1OQKA

Structure of mth11: a homologue of human rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
RHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords conserved protein MTH11
publication title Structure of Mth11/Mth Rpp29, an essential protein subunit of archaeal and eukaryotic RNase P.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 6
structure length 78
sequence length 78
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1oqkA00
2KI7A 1TS9A 1V76A 1TSFA 1PC0A 1OQKA 2ZAEA
chains in the Genus database with same CATH superfamily
3BFMA 1QWFA 1XOVA 3HRTA 2FEIA 5KE3A 2DPPB 2X51A 2COWA 2QQSA 4X9CA 2L3RA 2QEXQ 4CC4B 2DFUA 4RUGA 3JCMg 4OB2B 1W4SA 4M77G 1M9SA 4Y91A 1OQKA 1U1TA 3J81E 3WVDB 2DM1A 4KRTA 3VU3C 2LP5A 4JLIA 3SWNB 1UGRB 2EYZA 3UWNA 1ZUKA 2YUPA 4C8QA 1HK9A 4CI0C 1WLPB 4RTUA 4XK8E 5A0GA 5IAYA 3JCMX 4BY6C 4PJOG 1K8AU 4LXCA 2D0NA 2KNBB 1VQKT 4ZN3A 2C0OA 4HVUA 2DAQA 1D0XA 2HQEA 2ED0A 3H0IA 2YUOA 2ZGWA 1F1BB 1PRLC 1KHCA 1KD1R 4YTLA 3GF5A 2DEQA 4PKCC 1K9MC 4RG8A 5GAMh 2XI9A 1N8RU 2GGRA 2JUFA 3EGXA 2KXDA 1UEBA 2D0QB 1OEBA 3J7AF 2RQTA 2VXFA 1X2KA 4DA4A 3MKDA 2MK5A 1VOMA 1RAFB 2VVKA 4BB7A 2DIQA 1AVZC 1RAEB 4WF2A 3JCMQ 1N9RA 4M7AA 3QYGB 2DBKA 4ZNXA 4LDYA 2EKOA 3M53A 2K6DA 1K0SA 2EYWA 2RPNA 2F5KA 2XMFA 1WHGA 3A8OB 2X9HA 5FWCA 2CT3A 2EVRA 2K2MA 1SG5A 5KYUA 2ZPFB 3TREA 2PVOB 3QSUA 3HL8A 3OB9A 2HQHA 1XQHA 3VS7A 2E4HA 3M4GA 1NBEB 3CC4Q 9ATCB 4EMKC 1WJSA 1CSKA 4E6RA 1UDLA 3AHUA 2VYTA 5GMKm 1I07A 3CCJA 2K4YA 1SRMA 4BI4A 2RJCA 5CKDA 1D3BA 2CP3A 5KYNA 2DNUA 3EHQA 4F04B 4D6WA 3M9QA 4PFZA 4M7AG 4JLGA 2V8IA 1YN8A 1H92A 1X75C 5LJ5h 5GAMe 2JTFA 4F7UA 1IGUA 5GAMd 2FO0A 4FIBA 2ROTA 3CCUT 5CVIA 1FXXA 1OZ2A 1LVKA 1RAIB 1D3BB 2VC8A 5I21A 5LJ3e 1WQWA 1M1KU 4O5VA 2OX7A 2O31A 4J7FA 3VRYA 1UHCA 5IXBA 2ZPBB 2PUKB 3QDRB 1Q7YU 1TU0B 2CZ7B 4QQ6A 2X4XA 3BDLA 4J6XA 4Z02A 4LDWA 4ZGEB 3CBPA 2CH4W 1YI2A 2GNCA 2DJQA 1Q86R 1OYXA 1OU8A 3PTAA 2L3SA 3MPUB 3A1PA 4J9GA 2DL3A 2O2OA 4IIOA 4KT0E 1G2BA 2COZA 3MHXA 2LX7A 4AFUC 4J83A 1G3SA 4F17A 3G6EQ 1UE9A 3NFCA 2YSQA 4WTOB 2XDBA 2A28A 2F2VA 2DLPA 3CCJQ 1CKAA 2RJFA 2RK1A 4M77F 3WVEB 4C0DB 4QVDA 2VB6A 3OSSC 3SB2A 2MPXC 1IREB 2NUPA 4LDUA 4KBMB 1SF9A 1UB4A 1UFFA 5LJ5e 3JCMW 4PFPA 5LJ5d 3ZL7C 1BU1A 4C92B 1K73R 4NOYA 1JJ2S 3G7ZA 3GLXA 2WSEE 2HSEB 3NTIA 4PJOF 3QJYA 1VQNA 3EFOB 3R6NA 3J80E 5AYFA 3TEEA 4OGCA 5D6XA 3RKWA 3OYDA 2XHCA 4QVZA 2HL3A 2DETA 2MWOA 5GAN3 5KYYB 1M2VA 2QDYB 3NHNA 5GMKl 3RUXA 4M75A 2X4YA 3G71A 2EJFA 1VQ9Q 1OI1A 1JXMA 2CT4A 1V29B 4OVAA 1EFNA 1YI2Q 1GCPA 2DA9A 2HCKA 3CPFA 4N4GA 1M5Q1 4C8QF 3CD6Q 2YHTA 1XJWB 2OTLA 1NLPC 4A4KA 2E10A 1MHNA 4M77E 4M75B 1WZOA 3QG1A 2L5QA 4RTZA 3OMCA 4Z8AA 1WIEA 4M78C 2O88A 2QXFA 2DK3A 4X1VA 3EGDA 2JMAA 1JJ2P 4M75G 4PJOE 2LQNA 3A98A 1Q81R 1PSFA 1KK7A 2RI2A 4QT7A 3M57A 5EG2A 1PG5B 3MP6A 2DKGA 3OW2A 1N6AA 1VQLA 1VQNQ 3EG3A 1QP3A 3M59A 4HVVA 4C92D 1YIJQ 2RQUA 1QQJA 2KYBA 4BY6B 3CCET 2RNAA 4E7IA 5HK3A 2OTLT 4DEYA 4M7AF 1VQMA 4A54A 2DL7A 3JB9J 1OU9A 1VA7A 2KRMA 3CMEA 6AT1B 2O4XA 3G71Q 2YLCA 5IXFA 2EIFA 4C8QE 3DB3A 3OYIA 2DRMA 1PCXA 4L59A 2F2XA 1VYUA 2AZVA 3LX7A 1GBQA 3I9QA 5GAOp 3E1SA 1CKBA 1PC0A 1SKUB 2BZ8A 3H0FA 2E41A 1Z9QA 2QK0A 1KHIA 4FL6A 1RABB 4JZ4A 2G6FX 5D7UA 2HL5C 4XQ3A 5C6SA 3PE0A 4FCYA 1VQMT 2KAFA 3EHRA 1GFDA 3CXCS 3LW5E 4B9XA 1M1FA 3JAME 3CMET 2DZ9A 1VQ6A 2VGMA 1Q86U 1M3BA 2K5FA 1H8KA 2E5KA 1NYGA 2YLBA 1K9MR 1VQ7A 2QGFB 1IRXA 1OV3A 1NJIU 1VQLQ 5FWBA 3CC7T 4LD6A 4M7AE 2KDSA 3TVTA 2DF6A 4EMKB 1PSEA 3EG9A 4PNOA 2V8KA 4B6MA 1ZSZC 3KUFA 1VQOT 4LNPA 4MMKA 1IHWA 5KH6A 1VQMQ 3I55A 1QVFS 2E12A 5CKHA 5CKEA 5FROA 2X4WA 3O5ZA 2HAXA 3CCMT 3S6WA 1BKBA 1Y0MA 1QCFA 2RJDA 1U1SA 2H8HA 3VS3A 2K5LA 2CZ6B 3H9NA 3PT9A 4ANJA 1R77A 3EG9B 1GCQC 2KI7A 2RHXA 1HSQA 2YUNA 4DOWA 2YWWA 2J6FA 1WFWA 4ELZC 1YHQT 2RM4A 1VQ7T 2CP6A 3VKIA 1RI0A 1ZQ1A 3KFVA 4OGEA 5A2QE 2LTOA 1OZ3A 2YT6A 1YJ9A 1FYNA 3CXCP 1Q82U 4XU2A 3QDFA 1BI0A 2KSSA 3REAB 2YRDA 1T0JA 2LNVA 3I55T 1M4ZA 2DEUA 3QO3A 3META 3OBWA 2KRSA 2EQKA 1X2QA 4N0AC 1VQ6Q 5CR2A 2CKKA 2O9VA 1RLPC 2A37A 1VQ7Q 1K9AA 3CPWP 4DEXA 1ABOA 4J6YA 1UECA 3OYHA 2I0NA 3OYBA 2DXUA 5IN1A 1S72Q 1AWOA 1JQQA 2JN0A 2EKHA 4E7SA 5CQYA 1C6VX 1QVGP 3UPUA 4OMOA 1RADB 3D7SB 4QKUA 1PHTA 4M75F 2X3XD 3LYIA 2XK0A 2RMOA 3JCMP 2RHYA 1PKTA 5FLXE 4C0GA 3MEUA 1WXTA 2FZKB 3R6OA 2AHJB 4IUVA 1VQPA 2FG0A 4NS5A 2IIMA 2ABLA 2LQWA 3P8DA 2HNIA 1HD3A 2LQKA 2J06A 2B86A 1X43A 3JB9G 2A36A 3CCVT 2LCSA 2WSFE 3RKXA 4C5GA 1MMDA 1VQ5T 2R58A 3VS1A 4R0KA 2HKQB 1Y07A 1B07A 2I2LA 4X34A 1NYFA 1NE8A 2GTJA 2DL5A 2YUQA 2O01E 3MEWA 4OMFB 2LX9A 1YJ9Q 2BZYA 1YITT 1TS9A 1VQKA 3SWNA 2KT1A 3P8BB 3C12A 3M0SA 4FYVB 2ROLA 4J6WA 2E3HA 2GFUA 4HKEA 2P4TA 5GAOn 1VQPT 1H3HA 5CCAA 1WHJA 3JCMf 1QVFA 3CC2Q 3L1AA 3V8JA 4J9CA 1QCNA 4M75E 1J3TA 5GAN2 1A0NB 5CKBA 2M02A 2K3YA 1NLOC 2GTOA 2D1XA 2CYZB 4KUIA 2MI6A 2Y90A 4M78B 1H641 2JM8A 3NMZC 4XU1A 1BIAA 5GMKj 2RH2A 2ZAEA 4GY5A 4R55A 1MGQA 2PUOB 1N9SA 4Z89A 3JB9D 4XTZA 4LDVA 3OYYA 4WCIA 2CZ1B 4M78G 1W1FA 5HY6A 5GJWB 3UA6A 1YCSB 4JZ3A 1WQ7A 2SEMA 4R56A 2MIOA 5D6YA 4IUQA 5GAOq 4HCBA 1VIEA 4RG2A 4BI8B 1SHGA 2CP2A 1K8AC 2CP7A 2RHUA 1ZSGA 2DTOA 1EZZB 2HZYA 2R5MA 3CBMA 4M7DC 3OS5A 4XTWA 1VQKQ 1TUGB 2YXYA 1KQSP 4PJMA 1YWOA 2ATCB 5FW9A 4AFSC 1TTHB 4L5GA 2RF0A 1O9SA 2MAMA 1I4K1 3CCUA 1N8RC 2BE7D 2HMAA 1VYVA 1E7OA 4OB1B 2RQWA 5GANj 8AT1B 2EGEA 1M3CA 2MOXA 3VV0A 3UT1A 1MMGA 1M3AA 3M4YA 1OULA 8ATCB 2EW3A 2IG0A 2FVUA 3ULRB 3PGGA 2PVGB 3JV3A 2NLUA 3CCRA 2V26A 4HCCA 1QMCA 5KYWA 1B7TA 3X28B 1AWJA 1I8FA 3VRZA 3OY9A 2RHZA 4M78D 2EJ9A 4C0FA 4JRPA 4KGVB 4BACA 2LT1A 2DVEA 4E7KA 4PFOA 3LH5A 1HYOA 2HD0A 1AT1B 2NUZA 1VQ8T 2BTTA 1M90U 3HP9A 1WPYA 1ZSZB 2J6KA 2ZCFB 1U06A 2JVVA 5LL6S 5GAOr 2JS2A 5KYWB 3JCMb 3LWHA 1PRMC 2VWFA 1QCOA 3THKA 4BE0A 1MNEA 3GP8A 2EQIA 2K9GA 5DY9A 3JB9F 2E65A 4ME7A 5C0MA 5GAN7 2JOYA 3CCRT 1I0CA 1ZX6A 1TUDA 4JJNK 2KVQG 4KUDK 2KMTA 2YRVA 3CCUQ 1YJNT 4N0AA 2MCNA 2KRNA 3KXTA 1FX7A 1QWEA 1WJRA 1AWWA 2OTJT 2HKNA 2A08A 1ZBJA 1BCMA 3DLMA 4E7JA 3BW1A 1M1KC 3V7SA 1KC8R 1E6GA 3I56A 4C92A 5GAN8 2E3IA 1Y71A 1Q7YC 2BE9B 2DX1A 3EFOA 2LJ0A 2XG8D 3RBBB 2QA4T 3BE3A 2HBPA 3GIBA 3VUZA 1D09B 1V76A 1EX4A 1WDXA 2R5AA 5GANg 5GANf 1UG1A 5KYYA 4ELYC 1AOJA 1B3QA 4CRIA 3CMAA 2RA2A 1WHKA 1WJQA 4K11A 5ECAA 4JPBW 5FU6C 2HBWA 2ZPEB 3VS5A 3FIFA 2L89A 4A4FA 5KCHA 3NPFA 1BI1A 1Y96A 1BCOA 1ZLMA 3JSCA 5GMKi 2F1LA 3CEYA 1G8XA 1OPLA 4C92G 2D9TA 2HDAA 2CP0A 1UGVA 3I56T 2L8DA 4HT8A 4M78F 4FSXA 3V7CA 3A5ZB 3JB9I 3INZA 2SRCA 2CS7A 3LH0A 3OS0A 3H6ZA 3GOXA 4RTVA 3FB9A 3JCMh 3SEMA 1KD1U 4X9DA 2NUTA 1Y96B 3L2ZA 1AZEA 1MMNA 3CCEA 3RIRA 4C0ZA 2RB6A 4FYWB 5CAIA 1XNIA 1ZHIA 2PU9B 3CMAT 2P0PA 3QKJA 4M77C 3TSWA 4IUUA 5FRNA 1PKSA 2HSPA 3FLGA 1ZA1B 3ME9A 4PJJA 2MYSA 1O75A 4Y92A 3C4SA 4QW2A 3X25B 2J6OA 3VYGA 4J9FA 1GRIA 3M0UA 2NUTB 2LCCA 2E6NA 1W2BP 4HCKA 2H3EB 1G3WA 4PJOC 2FRYA 3PMIA 2JZ2A 3OYAA 1M8VA 4FU6A 2RI3A 2CZ0B 1BBZA 3E9GA 3HPWA 2DYIA 3MP1A 1IZ6A 2H3JA 4OMPA 2PTKA 2VKNA 1PNJA 1SHFA 4OB3B 2DJZA 1D1BA 4M78E 2GQIA 1PM3A 1B34B 4C5EA 1BYMA 3RMQA 1R8OB 3ASKA 2EYXA 1X27A 2XKOC 3UATA 2BIVA 3RDVA 4C8QC 2A0FB 2EQUA 3JCMe 4RTWA 2OJ2A 1WI7A 3JCMd 3AT1B 2KROA 4QQGA 1WYXA 2EWNA 4DBQA 2M1HA 1ZBXA 3CC7A 3ZBDA 1JU5C 3CCEQ 2DXCA 2QTVA 2IPOB 2FPDA 1I81A 1VQOA 2OTLQ 4M7DB 4QQDA 4F14A 3CBOA 1NPPA 3S3MA 3ZEHA 1YJWA 1MUZA 1YFNA 3H41A 4PLIA 3VS0A 2DXBA 4L6V5 2F69A 4RTXA 3CCMA 2X4JA 1JJ2A 4RTYA 3OYMA 2DO3A 1UGQB 1WXUA 4E7HA 4EMKA 1X01A 5CKFA 4EPCA 1KIKA 3X20B 3TSZA 3M55A 1RAHB 2ZPIB 4M7DG 2CSIA 2LMJA 4J8OA 1LJOA 3X24B 4LUDA 3OSVA 4RMOA 2QQRA 1YHQA 1D1CA 2GFAA 3SHWA 5GMKh 5LJ3g 4M7AC 4A4HA 3QHSA 2XU8A 5HCKA 1KC8U 3GNFB 1U5SA 3SFMA 3F70A 3VUBA 3SDZA 4BDZA 2EJGA 3CPWS 2ESWA 4GLKA 4BDYA 1EIFA 2L0AA 1RUWA 2DILA 1YJWT 1QVGS 2GF7A 1LPLA 3CMEQ 1Q86C 2DIGA 2VGNA 3H8ZA 1N5ZA 1N8RR 2Y4YA 4DOVA 3CCQT 3FJ5A 1NJIC 1M2OA 5D6WA 2V8JA 3UDCA 1K73U 3OYJA 2FZCB 1ZUUA 2QG9B 4FW2A 3CC7Q 5CK9A 2JXBA 5I2MA 1JO8A 3JCMJ 3BY7A 1QW1A 1BK2A 1C0MA 3MP8A 4C92F 1WHLA 1RAAB 1VQOQ 1ABQA 3TQ7P 3MEAA 5GAN5 1GL5A 2JM9A 4BUGA 2VASA 2M51A 3OMGA 1WHMA 1QKXA 4M7DD 4XU3A 3CCMQ 2CSQA 3G1JA 5CIUA 2L2PA 4JJCA 2LT4A 1H3ZA 2AKLA 2C06A 1OX8A 2MMPA 5GANh 2A7YA 3CCVA 1Y7XA 1ZUYA 1SSFA 2PZ1A 5GMKe 1YHQQ 1VQ5A 2VV5A 4Y28E 1RAGB 1VQ4A 5AT1B 3CCST 1I5LA 1T3SA 1TSFA 1K4US 4MZPA 3QPHA 1Q82C 2LJ1A 1MV3A 1YITA 2K57A 4C0DC 1OPKA 4D8KA 5J39A 3IQLA 4HVWA 3I55Q 4IUTA 2DXTA 3PVQA 4GBQA 4KGZB 4BD3A 2WSCE 4C92E 2E6ZA 1FMVA 3OYCA 1Q81U 4XTUA 3M54A 4AT1B 5M9OA 3MJXA 1M1KR 1UJ0A 3C0CA 3E2UA 3CXCA 4C5IA 2JTEA 1VQ4T 1QP2A 3JB9H 1UJYA 1Q7YR 1LCKA 2CH4A 5DLOA 1YP5A 2J7IA 3PIOA 2WACA 4FM4B 2QEXT 1X6GA 5GANe 1WGSA 4A63B 2RK2A 4XU0A 1JRIA 5IT9E 5GANd 2QQAA 4O6JA 4M78A 2EQJA 1YWPA 3CCVQ 1UTIA 2QDLA 1KQSS 1VQ5Q 1QVGA 2JW4A 4J9EA 3DLLA 2D8JA 4M77B 4HCZA 4IKFA 1Y57A 4AFZC 3RERA 5J3BA 4M75C 2RQVA 1LOJA 2KR3A 3E19A 3VJPA 3VYHB 4LE9A 1FMWA 4ZN1A 2FB7A 1YITQ 2DL4A 1S1NA 2ECZA 1IHVA 4M7DF 2PQWA 2FHDA 3OBYA 3RNJA 4PJOB 4RCBA 2K3XA 2DD5A 2K79A 4EIKA 1VQPQ 3RESA 4EMGA 4OMNA 2RI5A 4ZGDB 4N4IA 1K9MU 1QKWA 4E7LA 4OMMA 1NM7A 1SSHA 3CC4A 4XAXB 3EH2A 4ZGJB 1RI9A 2KBTA 4A53A 2RN8A 4JUVA 4JRIA 2C0IA 4KGXB 1HJDA 4RCCA 2OAUA 3JCMc 4PL6A 3LWIA 2D8HA 3MEVA 3OQ5A 1UGSB 4C8QB 4CC7A 1WHHA 1QLYA 5FU7C 2QYZA 3M58A 3C94A 1KQ2A 7AT1B 3EG0A 4UC4A 2KY9A 1VQ8A 2LZ6B 2JT4A 2X35A 2XICA 3CQTA 4V2SA 3V8LA 3UF4A 3E9FA 2XDPA 1K1ZA 1WXBA 4C8QG 4JJBA 2CUBA 5LJ3h 2P4RA 4EDUA 2MF2A 4M7DE 1YCYA 3FEOA 3HRUA 5EC7A 3A8MB 5I11A 3CC4T 5CO7A 2NYSA 4M77D 2DD4A 3QXEB 3PIPA 2Y4XA 3OYKA 4M4ZA 4IUPA 4XTVA 4KH1B 2PNIA 2EBPA 3EGXB 4ORZA 1VIFA 1ZSZA 3H0HA 2AT1B 1I5OB 2KXCA 1YJNA 5DLQE 2COYA 3L2QA 4PJOD 1JEGA 2VXEA 4JS5A 2EFIA 5KCOA 2E70A 4M7AB 3M0TA 2JS0A 3OYLA 2OTJA 2DTIA 2LVMA 1IXDA 3G6EA 1ACMB 1BI2A 1KSWA 1VUBA 1GCQA 3M0PA 1KQ1A 2DE0X 5KYUB 4C5HA 4JJDA 1D0ZA 2K2VA 1KQSA 1GFCA 1NZ9A 2YDLA 3LGFA 1R0BG 4RKUE 2QA4A 4PJNA 3HKSA 3QJ6A 3I5RA 3CCLA 2DZCA 3RR6A 1TG0A 2XIDA 3I35A 1TUCA 3RKYA 1M27C 4C8QD 4OF1A 5IH2A 1G5VA 3PFSA 4E47A 1VQ8Q 1M90C 2KK4A 3RMSA 1AD5A 3A8LB 5A0DA 4DBHA 3DB4A 2QAZA 2JNGA 5LJ3d 2L3PA 1YBYA 1BI3A 1OX9A 1QVPA 1KG1A 2LC4A 3NGPA 3G6ET 1UGPB 1WNLA 4F7UB 4HXJA 1WA7A 3OW2S 1NEGA 2KYMA 2EAYA 3CCJT 2Z0WA 3TCJA 1VQ9A 1X69A 4E7ZA 4FYYB 3CCRQ 3FRNA 2AZSA 3O8VA 2ZZDA 4EMHA 3CD6A 2ZPGB 3CCLT 1NJIR 1YJNQ 1U8RA 4F7UG 2BKDN 1UUEA 2C0TA 2LQ8A 4MDWA 2XDDA 3HTRA 3PNWC 2OTJQ 1UHFA 1W2BS 3EFRA 4ZTFA 1FMKA 4LUEA 3NTKA 5FRMA 2YRCA 5GAOm 1X6BA 4IIMA 3HSBA 1G83A 4M7AD 3WXMB 3OYFA 3FDRA 3QIIA 3OYGA 2AIRB 2V1QA 2MWPA 4CC3A 4P5NA 2QA4Q 1ZA2B 3ER0A 5L23A 3CCLQ 2DMOA 3M0QA 3C95A 4JDSA 5GAN6 3G4SA 1VQ9T 1TWBA 4J9DA 2RD1A 3BDUA 2KGTA 2FL7A 2EGAA 1YI2T 2CP5A 3PMTA 2JTMA 2QGGA 4F16A 1YIJA 5IHNA 4LDXA 1VYTA 2KT8A 2HEQA 5I2SA 3CD6T 2W0ZA 5HKCA 2NUPB 3OW2P 4MDXA 3GBQA 2M0OA 4GLMA 4LD9K 1V1CA 1Q82R 3M5AA 5GAMj 2AK5A 2RHIA 2DL8A 1W70A 1GXIE 3QZ5B 2QQBA 1AZGB 3I56Q 1R0CB 2EQMA 3GPLA 2EGCA 4TVRA 5LJ3j 4XTXA 1K76A 3PVLA 5L8RE 2F2WA 4A4GA 1MNDA 4BI3A 1KD1C 4AMCA 1M2VB 1KJWA 1W6XA 1B34A 5GAN4 2P0KA 3G4ST 3QBYA 4ZTJA 4PJLA 3EAEA 1VQNT 4ESRA 2GBQA 3CMAQ 1M8MA 1OOTA 4PK4A 1YIJT 3SWNC 2M0YA 2KE9A 1MV0B 2DBMA 1D0YA 4VUBA 1IO6A 4MZMA 2CREA 3M56A 2BUDA 4NL2A 2E1HA 4FYXB 2QI2A 3OYEA 3G71T 2EYQA 2CDTA 4NL3A 3G4SQ 4M7DA 2W10A 3HHTB 1G3YA 3NTHA 2CUDA 3N5BB 5GJVB 2PVDB 3OYNA 3A8GB 4BE2A 2HQXA 2VUBA 5DM7R 2O9SA 4KULA 4B9WA 4MZTA 2FPEA 1Z9ZA 4Q5WA 2G3RA 4ATOA 5LJ5j 3EGDB 2XD0A 5GAOl 3S3OA 4MMLA 1NEBA 3URGA 2DERA 2F5TX 5FU7B 1C1AA 1W2BA 2NWMA 4OMLA 5KE2A 2K5IA 3TU4K 5HK0A 2FYKA 2K7AA 3ZFJA 4CC2A 1SRLA 1DJ7B 3L2UA 3QWYA 3CCQA 2AKKA 2IVWA 1BB9A 1X6OA 2QQ9A 2GQVA 2RQRA 3L2VA 5GAMf 5GAMg 3HFNA 3EFSA 1VQLT 2O4XB 4OP0A 1PD0A 2BZXA 3P8HA 4D8DA 3V8KA 4JS4A 5KYXA 3DKMA 5LJ3f 1AHJB 4M75D 1XTDA 1K8AR 2EYYA 2ENMA 1TH7A 1KFZA 4JRKA 2OI3A 4F7UF 1NPRA 2DYBA 3OS2A 4II1A 4KH0B 2D6FA 1ARKA 4J7IA 1FWZA 3LLRA 4OMQA 3JRZA 3EH1A 4DQ2A 2DRKA 3FJPA 1PWTA 2FPFA 4DBRA 5KYXB 1E6HA 2LNHB 1S72A 4OB0B 2DTHA 3VS4A 1IB8A 3QZ9B 3CCSA 2LDMA 3U23A 3VS2A 2QTXA 3QYHB 3L2WA 1RACB 1KC8C 1WX6A 2KEAA 1N27A 3L2RA 5IHKA 4E2FB 2R57A 1YNZA 3I5SA 1K0XA 2LCLA 3LGLA 3X26B 4HT9A 2M9UA 2ZPHB 4AFQC 2OAWA 4BE1A 1TXQA 4XTYA 1IGQA 3SD4A 1YJWQ 2P84A 4AG1C 1RLQC 1T3LA 3Q1JA 1G3TA 1VQ4Q 5J26A 2L3QA 3HFOA 4FSSA 5LJ5g 5LJ5f 4J9HA 2KQWA 2DVJA 3CCQQ 4JRQA 2ED1A 1VQ6T 3EG1A 2V1RA 1K73C 5IHIA 4A4EA 4N4HA 1MMAA 4Z88A 1S72T 2P0QA 4DBFA 4QVCA 1LNXA 4J9BA 3QWXX 2JMCA 2X3WD 3M0RA 1TOVA 4F7UE 1JXOA 4FT4A 1Q95G 1AEYA 1BIBA 2FZGB 5I22A 2FRWA 2QEXA 1U3OA 2CGHA 2JJ9A 1AWXA 3S3NA 3QUIA 3CC2A 3OS1A 3VS6A 3V7RA 1JB0E 3GNGA 1M90R 2E64A 1M1GA 3T9NA 3MO8A 3JCMV 4C92C 1RL2A 5A0LA 4HA8A 2RO0A 3FC3A 3MCAB 1QVFP 5FU6B 2E5QA 4RTTA 4J5YA 3CCSQ 1D1AA 3L42A 2J05A 1SEMA 4LN2A 3A8HB 1YJ9T 1I1JA 4PLLA 2B8AA 5CQXA 2EPDA 3REBB 1JBMA 2M16A 4IURA 2RJEA 4M77A 1GBRA 3EG2A 1P92A 1SPKA 3HRSA 3KBGA 2LJ3A 2A3LA 4AG2C 1HXDA 1Q81C 2GCXA 4J9IA 1NG2A 3CPWA 3CC2T 1PD1A 3UA7A 4FW1A 2LRQA 2K3BA 1M30A 3OA6A 1T0HA 4PJOA 4FT2A 2QASA 3EGUA
chains in the Genus database with same CATH topology
2KI7A 1TS9A 1V76A 1TSFA 1PC0A 1OQKA 2ZAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 A;  1TS9 A;  1V76 A;  1TSF A;  1PC0 A;  1OQK A;  2ZAE A; 
#chains in the Genus database with same CATH topology
 3BFM A;  1QWF A;  1XOV A;  3HRT A;  2FEI A;  5KE3 A;  2DPP B;  2X51 A;  2COW A;  2QQS A;  4X9C A;  2L3R A;  2QEX Q;  4CC4 B;  2DFU A;  4RUG A;  3JCM g;  4OB2 B;  1W4S A;  4M77 G;  1M9S A;  4Y91 A;  1OQK A;  1U1T A;  3J81 E;  3WVD B;  2DM1 A;  4KRT A;  3VU3 C;  2LP5 A;  4JLI A;  3SWN B;  1UGR B;  2EYZ A;  3UWN A;  1ZUK A;  2YUP A;  4C8Q A;  1HK9 A;  4CI0 C;  1WLP B;  4RTU A;  4XK8 E;  5A0G A;  5IAY A;  3JCM X;  4BY6 C;  4PJO G;  1K8A U;  4LXC A;  2D0N A;  2KNB B;  1VQK T;  4ZN3 A;  2C0O A;  4HVU A;  2DAQ A;  1D0X A;  2HQE A;  2ED0 A;  3H0I A;  2YUO A;  2ZGW A;  1F1B B;  1PRL C;  1KHC A;  1KD1 R;  4YTL A;  3GF5 A;  2DEQ A;  4PKC C;  1K9M C;  4RG8 A;  5GAM h;  2XI9 A;  1N8R U;  2GGR A;  2JUF A;  3EGX A;  2KXD A;  1UEB A;  2D0Q B;  1OEB A;  3J7A F;  2RQT A;  2VXF A;  1X2K A;  4DA4 A;  3MKD A;  2MK5 A;  1VOM A;  1RAF B;  2VVK A;  4BB7 A;  2DIQ A;  1AVZ C;  1RAE B;  4WF2 A;  3JCM Q;  1N9R A;  4M7A A;  3QYG B;  2DBK A;  4ZNX A;  4LDY A;  2EKO A;  3M53 A;  2K6D A;  1K0S A;  2EYW A;  2RPN A;  2F5K A;  2XMF A;  1WHG A;  3A8O B;  2X9H A;  5FWC A;  2CT3 A;  2EVR A;  2K2M A;  1SG5 A;  5KYU A;  2ZPF B;  3TRE A;  2PVO B;  3QSU A;  3HL8 A;  3OB9 A;  2HQH A;  1XQH A;  3VS7 A;  2E4H A;  3M4G A;  1NBE B;  3CC4 Q;  9ATC B;  4EMK C;  1WJS A;  1CSK A;  4E6R A;  1UDL A;  3AHU A;  2VYT A;  5GMK m;  1I07 A;  3CCJ A;  2K4Y A;  1SRM A;  4BI4 A;  2RJC A;  5CKD A;  1D3B A;  2CP3 A;  5KYN A;  2DNU A;  3EHQ A;  4F04 B;  4D6W A;  3M9Q A;  4PFZ A;  4M7A G;  4JLG A;  2V8I A;  1YN8 A;  1H92 A;  1X75 C;  5LJ5 h;  5GAM e;  2JTF A;  4F7U A;  1IGU A;  5GAM d;  2FO0 A;  4FIB A;  2ROT A;  3CCU T;  5CVI A;  1FXX A;  1OZ2 A;  1LVK A;  1RAI B;  1D3B B;  2VC8 A;  5I21 A;  5LJ3 e;  1WQW A;  1M1K U;  4O5V A;  2OX7 A;  2O31 A;  4J7F A;  3VRY A;  1UHC A;  5IXB A;  2ZPB B;  2PUK B;  3QDR B;  1Q7Y U;  1TU0 B;  2CZ7 B;  4QQ6 A;  2X4X A;  3BDL A;  4J6X A;  4Z02 A;  4LDW A;  4ZGE B;  3CBP A;  2CH4 W;  1YI2 A;  2GNC A;  2DJQ A;  1Q86 R;  1OYX A;  1OU8 A;  3PTA A;  2L3S A;  3MPU B;  3A1P A;  4J9G A;  2DL3 A;  2O2O A;  4IIO A;  4KT0 E;  1G2B A;  2COZ A;  3MHX A;  2LX7 A;  4AFU C;  4J83 A;  1G3S A;  4F17 A;  3G6E Q;  1UE9 A;  3NFC A;  2YSQ A;  4WTO B;  2XDB A;  2A28 A;  2F2V A;  2DLP A;  3CCJ Q;  1CKA A;  2RJF A;  2RK1 A;  4M77 F;  3WVE B;  4C0D B;  4QVD A;  2VB6 A;  3OSS C;  3SB2 A;  2MPX C;  1IRE B;  2NUP A;  4LDU A;  4KBM B;  1SF9 A;  1UB4 A;  1UFF A;  5LJ5 e;  3JCM W;  4PFP A;  5LJ5 d;  3ZL7 C;  1BU1 A;  4C92 B;  1K73 R;  4NOY A;  1JJ2 S;  3G7Z A;  3GLX A;  2WSE E;  2HSE B;  3NTI A;  4PJO F;  3QJY A;  1VQN A;  3EFO B;  3R6N A;  3J80 E;  5AYF A;  3TEE A;  4OGC A;  5D6X A;  3RKW A;  3OYD A;  2XHC A;  4QVZ A;  2HL3 A;  2DET A;  2MWO A;  5GAN 3;  5KYY B;  1M2V A;  2QDY B;  3NHN A;  5GMK l;  3RUX A;  4M75 A;  2X4Y A;  3G71 A;  2EJF A;  1VQ9 Q;  1OI1 A;  1JXM A;  2CT4 A;  1V29 B;  4OVA A;  1EFN A;  1YI2 Q;  1GCP A;  2DA9 A;  2HCK A;  3CPF A;  4N4G A;  1M5Q 1;  4C8Q F;  3CD6 Q;  2YHT A;  1XJW B;  2OTL A;  1NLP C;  4A4K A;  2E10 A;  1MHN A;  4M77 E;  4M75 B;  1WZO A;  3QG1 A;  2L5Q A;  4RTZ A;  3OMC A;  4Z8A A;  1WIE A;  4M78 C;  2O88 A;  2QXF A;  2DK3 A;  4X1V A;  3EGD A;  2JMA A;  1JJ2 P;  4M75 G;  4PJO E;  2LQN A;  3A98 A;  1Q81 R;  1PSF A;  1KK7 A;  2RI2 A;  4QT7 A;  3M57 A;  5EG2 A;  1PG5 B;  3MP6 A;  2DKG A;  3OW2 A;  1N6A A;  1VQL A;  1VQN Q;  3EG3 A;  1QP3 A;  3M59 A;  4HVV A;  4C92 D;  1YIJ Q;  2RQU A;  1QQJ A;  2KYB A;  4BY6 B;  3CCE T;  2RNA A;  4E7I A;  5HK3 A;  2OTL T;  4DEY A;  4M7A F;  1VQM A;  4A54 A;  2DL7 A;  3JB9 J;  1OU9 A;  1VA7 A;  2KRM A;  3CME A;  6AT1 B;  2O4X A;  3G71 Q;  2YLC A;  5IXF A;  2EIF A;  4C8Q E;  3DB3 A;  3OYI A;  2DRM A;  1PCX A;  4L59 A;  2F2X A;  1VYU A;  2AZV A;  3LX7 A;  1GBQ A;  3I9Q A;  5GAO p;  3E1S A;  1CKB A;  1PC0 A;  1SKU B;  2BZ8 A;  3H0F A;  2E41 A;  1Z9Q A;  2QK0 A;  1KHI A;  4FL6 A;  1RAB B;  4JZ4 A;  2G6F X;  5D7U A;  2HL5 C;  4XQ3 A;  5C6S A;  3PE0 A;  4FCY A;  1VQM T;  2KAF A;  3EHR A;  1GFD A;  3CXC S;  3LW5 E;  4B9X A;  1M1F A;  3JAM E;  3CME T;  2DZ9 A;  1VQ6 A;  2VGM A;  1Q86 U;  1M3B A;  2K5F A;  1H8K A;  2E5K A;  1NYG A;  2YLB A;  1K9M R;  1VQ7 A;  2QGF B;  1IRX A;  1OV3 A;  1NJI U;  1VQL Q;  5FWB A;  3CC7 T;  4LD6 A;  4M7A E;  2KDS A;  3TVT A;  2DF6 A;  4EMK B;  1PSE A;  3EG9 A;  4PNO A;  2V8K A;  4B6M A;  1ZSZ C;  3KUF A;  1VQO T;  4LNP A;  4MMK A;  1IHW A;  5KH6 A;  1VQM Q;  3I55 A;  1QVF S;  2E12 A;  5CKH A;  5CKE A;  5FRO A;  2X4W A;  3O5Z A;  2HAX A;  3CCM T;  3S6W A;  1BKB A;  1Y0M A;  1QCF A;  2RJD A;  1U1S A;  2H8H A;  3VS3 A;  2K5L A;  2CZ6 B;  3H9N A;  3PT9 A;  4ANJ A;  1R77 A;  3EG9 B;  1GCQ C;  2KI7 A;  2RHX A;  1HSQ A;  2YUN A;  4DOW A;  2YWW A;  2J6F A;  1WFW A;  4ELZ C;  1YHQ T;  2RM4 A;  1VQ7 T;  2CP6 A;  3VKI A;  1RI0 A;  1ZQ1 A;  3KFV A;  4OGE A;  5A2Q E;  2LTO A;  1OZ3 A;  2YT6 A;  1YJ9 A;  1FYN A;  3CXC P;  1Q82 U;  4XU2 A;  3QDF A;  1BI0 A;  2KSS A;  3REA B;  2YRD A;  1T0J A;  2LNV A;  3I55 T;  1M4Z A;  2DEU A;  3QO3 A;  3MET A;  3OBW A;  2KRS A;  2EQK A;  1X2Q A;  4N0A C;  1VQ6 Q;  5CR2 A;  2CKK A;  2O9V A;  1RLP C;  2A37 A;  1VQ7 Q;  1K9A A;  3CPW P;  4DEX A;  1ABO A;  4J6Y A;  1UEC A;  3OYH A;  2I0N A;  3OYB A;  2DXU A;  5IN1 A;  1S72 Q;  1AWO A;  1JQQ A;  2JN0 A;  2EKH A;  4E7S A;  5CQY A;  1C6V X;  1QVG P;  3UPU A;  4OMO A;  1RAD B;  3D7S B;  4QKU A;  1PHT A;  4M75 F;  2X3X D;  3LYI A;  2XK0 A;  2RMO A;  3JCM P;  2RHY A;  1PKT A;  5FLX E;  4C0G A;  3MEU A;  1WXT A;  2FZK B;  3R6O A;  2AHJ B;  4IUV A;  1VQP A;  2FG0 A;  4NS5 A;  2IIM A;  2ABL A;  2LQW A;  3P8D A;  2HNI A;  1HD3 A;  2LQK A;  2J06 A;  2B86 A;  1X43 A;  3JB9 G;  2A36 A;  3CCV T;  2LCS A;  2WSF E;  3RKX A;  4C5G A;  1MMD A;  1VQ5 T;  2R58 A;  3VS1 A;  4R0K A;  2HKQ B;  1Y07 A;  1B07 A;  2I2L A;  4X34 A;  1NYF A;  1NE8 A;  2GTJ A;  2DL5 A;  2YUQ A;  2O01 E;  3MEW A;  4OMF B;  2LX9 A;  1YJ9 Q;  2BZY A;  1YIT T;  1TS9 A;  1VQK A;  3SWN A;  2KT1 A;  3P8B B;  3C12 A;  3M0S A;  4FYV B;  2ROL A;  4J6W A;  2E3H A;  2GFU A;  4HKE A;  2P4T A;  5GAO n;  1VQP T;  1H3H A;  5CCA A;  1WHJ A;  3JCM f;  1QVF A;  3CC2 Q;  3L1A A;  3V8J A;  4J9C A;  1QCN A;  4M75 E;  1J3T A;  5GAN 2;  1A0N B;  5CKB A;  2M02 A;  2K3Y A;  1NLO C;  2GTO A;  2D1X A;  2CYZ B;  4KUI A;  2MI6 A;  2Y90 A;  4M78 B;  1H64 1;  2JM8 A;  3NMZ C;  4XU1 A;  1BIA A;  5GMK j;  2RH2 A;  2ZAE A;  4GY5 A;  4R55 A;  1MGQ A;  2PUO B;  1N9S A;  4Z89 A;  3JB9 D;  4XTZ A;  4LDV A;  3OYY A;  4WCI A;  2CZ1 B;  4M78 G;  1W1F A;  5HY6 A;  5GJW B;  3UA6 A;  1YCS B;  4JZ3 A;  1WQ7 A;  2SEM A;  4R56 A;  2MIO A;  5D6Y A;  4IUQ A;  5GAO q;  4HCB A;  1VIE A;  4RG2 A;  4BI8 B;  1SHG A;  2CP2 A;  1K8A C;  2CP7 A;  2RHU A;  1ZSG A;  2DTO A;  1EZZ B;  2HZY A;  2R5M A;  3CBM A;  4M7D C;  3OS5 A;  4XTW A;  1VQK Q;  1TUG B;  2YXY A;  1KQS P;  4PJM A;  1YWO A;  2ATC B;  5FW9 A;  4AFS C;  1TTH B;  4L5G A;  2RF0 A;  1O9S A;  2MAM A;  1I4K 1;  3CCU A;  1N8R C;  2BE7 D;  2HMA A;  1VYV A;  1E7O A;  4OB1 B;  2RQW A;  5GAN j;  8AT1 B;  2EGE A;  1M3C A;  2MOX A;  3VV0 A;  3UT1 A;  1MMG A;  1M3A A;  3M4Y A;  1OUL A;  8ATC B;  2EW3 A;  2IG0 A;  2FVU A;  3ULR B;  3PGG A;  2PVG B;  3JV3 A;  2NLU A;  3CCR A;  2V26 A;  4HCC A;  1QMC A;  5KYW A;  1B7T A;  3X28 B;  1AWJ A;  1I8F A;  3VRZ A;  3OY9 A;  2RHZ A;  4M78 D;  2EJ9 A;  4C0F A;  4JRP A;  4KGV B;  4BAC A;  2LT1 A;  2DVE A;  4E7K A;  4PFO A;  3LH5 A;  1HYO A;  2HD0 A;  1AT1 B;  2NUZ A;  1VQ8 T;  2BTT A;  1M90 U;  3HP9 A;  1WPY A;  1ZSZ B;  2J6K A;  2ZCF B;  1U06 A;  2JVV A;  5LL6 S;  5GAO r;  2JS2 A;  5KYW B;  3JCM b;  3LWH A;  1PRM C;  2VWF A;  1QCO A;  3THK A;  4BE0 A;  1MNE A;  3GP8 A;  2EQI A;  2K9G A;  5DY9 A;  3JB9 F;  2E65 A;  4ME7 A;  5C0M A;  5GAN 7;  2JOY A;  3CCR T;  1I0C A;  1ZX6 A;  1TUD A;  4JJN K;  2KVQ G;  4KUD K;  2KMT A;  2YRV A;  3CCU Q;  1YJN T;  4N0A A;  2MCN A;  2KRN A;  3KXT A;  1FX7 A;  1QWE A;  1WJR A;  1AWW A;  2OTJ T;  2HKN A;  2A08 A;  1ZBJ A;  1BCM A;  3DLM A;  4E7J A;  3BW1 A;  1M1K C;  3V7S A;  1KC8 R;  1E6G A;  3I56 A;  4C92 A;  5GAN 8;  2E3I A;  1Y71 A;  1Q7Y C;  2BE9 B;  2DX1 A;  3EFO A;  2LJ0 A;  2XG8 D;  3RBB B;  2QA4 T;  3BE3 A;  2HBP A;  3GIB A;  3VUZ A;  1D09 B;  1V76 A;  1EX4 A;  1WDX A;  2R5A A;  5GAN g;  5GAN f;  1UG1 A;  5KYY A;  4ELY C;  1AOJ A;  1B3Q A;  4CRI A;  3CMA A;  2RA2 A;  1WHK A;  1WJQ A;  4K11 A;  5ECA A;  4JPB W;  5FU6 C;  2HBW A;  2ZPE B;  3VS5 A;  3FIF A;  2L89 A;  4A4F A;  5KCH A;  3NPF A;  1BI1 A;  1Y96 A;  1BCO A;  1ZLM A;  3JSC A;  5GMK i;  2F1L A;  3CEY A;  1G8X A;  1OPL A;  4C92 G;  2D9T A;  2HDA A;  2CP0 A;  1UGV A;  3I56 T;  2L8D A;  4HT8 A;  4M78 F;  4FSX A;  3V7C A;  3A5Z B;  3JB9 I;  3INZ A;  2SRC A;  2CS7 A;  3LH0 A;  3OS0 A;  3H6Z A;  3GOX A;  4RTV A;  3FB9 A;  3JCM h;  3SEM A;  1KD1 U;  4X9D A;  2NUT A;  1Y96 B;  3L2Z A;  1AZE A;  1MMN A;  3CCE A;  3RIR A;  4C0Z A;  2RB6 A;  4FYW B;  5CAI A;  1XNI A;  1ZHI A;  2PU9 B;  3CMA T;  2P0P A;  3QKJ A;  4M77 C;  3TSW A;  4IUU A;  5FRN A;  1PKS A;  2HSP A;  3FLG A;  1ZA1 B;  3ME9 A;  4PJJ A;  2MYS A;  1O75 A;  4Y92 A;  3C4S A;  4QW2 A;  3X25 B;  2J6O A;  3VYG A;  4J9F A;  1GRI A;  3M0U A;  2NUT B;  2LCC A;  2E6N A;  1W2B P;  4HCK A;  2H3E B;  1G3W A;  4PJO C;  2FRY A;  3PMI A;  2JZ2 A;  3OYA A;  1M8V A;  4FU6 A;  2RI3 A;  2CZ0 B;  1BBZ A;  3E9G A;  3HPW A;  2DYI A;  3MP1 A;  1IZ6 A;  2H3J A;  4OMP A;  2PTK A;  2VKN A;  1PNJ A;  1SHF A;  4OB3 B;  2DJZ A;  1D1B A;  4M78 E;  2GQI A;  1PM3 A;  1B34 B;  4C5E A;  1BYM A;  3RMQ A;  1R8O B;  3ASK A;  2EYX A;  1X27 A;  2XKO C;  3UAT A;  2BIV A;  3RDV A;  4C8Q C;  2A0F B;  2EQU A;  3JCM e;  4RTW A;  2OJ2 A;  1WI7 A;  3JCM d;  3AT1 B;  2KRO A;  4QQG A;  1WYX A;  2EWN A;  4DBQ A;  2M1H A;  1ZBX A;  3CC7 A;  3ZBD A;  1JU5 C;  3CCE Q;  2DXC A;  2QTV A;  2IPO B;  2FPD A;  1I81 A;  1VQO A;  2OTL Q;  4M7D B;  4QQD A;  4F14 A;  3CBO A;  1NPP A;  3S3M A;  3ZEH A;  1YJW A;  1MUZ A;  1YFN A;  3H41 A;  4PLI A;  3VS0 A;  2DXB A;  4L6V 5;  2F69 A;  4RTX A;  3CCM A;  2X4J A;  1JJ2 A;  4RTY A;  3OYM A;  2DO3 A;  1UGQ B;  1WXU A;  4E7H A;  4EMK A;  1X01 A;  5CKF A;  4EPC A;  1KIK A;  3X20 B;  3TSZ A;  3M55 A;  1RAH B;  2ZPI B;  4M7D G;  2CSI A;  2LMJ A;  4J8O A;  1LJO A;  3X24 B;  4LUD A;  3OSV A;  4RMO A;  2QQR A;  1YHQ A;  1D1C A;  2GFA A;  3SHW A;  5GMK h;  5LJ3 g;  4M7A C;  4A4H A;  3QHS A;  2XU8 A;  5HCK A;  1KC8 U;  3GNF B;  1U5S A;  3SFM A;  3F70 A;  3VUB A;  3SDZ A;  4BDZ A;  2EJG A;  3CPW S;  2ESW A;  4GLK A;  4BDY A;  1EIF A;  2L0A A;  1RUW A;  2DIL A;  1YJW T;  1QVG S;  2GF7 A;  1LPL A;  3CME Q;  1Q86 C;  2DIG A;  2VGN A;  3H8Z A;  1N5Z A;  1N8R R;  2Y4Y A;  4DOV A;  3CCQ T;  3FJ5 A;  1NJI C;  1M2O A;  5D6W A;  2V8J A;  3UDC A;  1K73 U;  3OYJ A;  2FZC B;  1ZUU A;  2QG9 B;  4FW2 A;  3CC7 Q;  5CK9 A;  2JXB A;  5I2M A;  1JO8 A;  3JCM J;  3BY7 A;  1QW1 A;  1BK2 A;  1C0M A;  3MP8 A;  4C92 F;  1WHL A;  1RAA B;  1VQO Q;  1ABQ A;  3TQ7 P;  3MEA A;  5GAN 5;  1GL5 A;  2JM9 A;  4BUG A;  2VAS A;  2M51 A;  3OMG A;  1WHM A;  1QKX A;  4M7D D;  4XU3 A;  3CCM Q;  2CSQ A;  3G1J A;  5CIU A;  2L2P A;  4JJC A;  2LT4 A;  1H3Z A;  2AKL A;  2C06 A;  1OX8 A;  2MMP A;  5GAN h;  2A7Y A;  3CCV A;  1Y7X A;  1ZUY A;  1SSF A;  2PZ1 A;  5GMK e;  1YHQ Q;  1VQ5 A;  2VV5 A;  4Y28 E;  1RAG B;  1VQ4 A;  5AT1 B;  3CCS T;  1I5L A;  1T3S A;  1TSF A;  1K4U S;  4MZP A;  3QPH A;  1Q82 C;  2LJ1 A;  1MV3 A;  1YIT A;  2K57 A;  4C0D C;  1OPK A;  4D8K A;  5J39 A;  3IQL A;  4HVW A;  3I55 Q;  4IUT A;  2DXT A;  3PVQ A;  4GBQ A;  4KGZ B;  4BD3 A;  2WSC E;  4C92 E;  2E6Z A;  1FMV A;  3OYC A;  1Q81 U;  4XTU A;  3M54 A;  4AT1 B;  5M9O A;  3MJX A;  1M1K R;  1UJ0 A;  3C0C A;  3E2U A;  3CXC A;  4C5I A;  2JTE A;  1VQ4 T;  1QP2 A;  3JB9 H;  1UJY A;  1Q7Y R;  1LCK A;  2CH4 A;  5DLO A;  1YP5 A;  2J7I A;  3PIO A;  2WAC A;  4FM4 B;  2QEX T;  1X6G A;  5GAN e;  1WGS A;  4A63 B;  2RK2 A;  4XU0 A;  1JRI A;  5IT9 E;  5GAN d;  2QQA A;  4O6J A;  4M78 A;  2EQJ A;  1YWP A;  3CCV Q;  1UTI A;  2QDL A;  1KQS S;  1VQ5 Q;  1QVG A;  2JW4 A;  4J9E A;  3DLL A;  2D8J A;  4M77 B;  4HCZ A;  4IKF A;  1Y57 A;  4AFZ C;  3RER A;  5J3B A;  4M75 C;  2RQV A;  1LOJ A;  2KR3 A;  3E19 A;  3VJP A;  3VYH B;  4LE9 A;  1FMW A;  4ZN1 A;  2FB7 A;  1YIT Q;  2DL4 A;  1S1N A;  2ECZ A;  1IHV A;  4M7D F;  2PQW A;  2FHD A;  3OBY A;  3RNJ A;  4PJO B;  4RCB A;  2K3X A;  2DD5 A;  2K79 A;  4EIK A;  1VQP Q;  3RES A;  4EMG A;  4OMN A;  2RI5 A;  4ZGD B;  4N4I A;  1K9M U;  1QKW A;  4E7L A;  4OMM A;  1NM7 A;  1SSH A;  3CC4 A;  4XAX B;  3EH2 A;  4ZGJ B;  1RI9 A;  2KBT A;  4A53 A;  2RN8 A;  4JUV A;  4JRI A;  2C0I A;  4KGX B;  1HJD A;  4RCC A;  2OAU A;  3JCM c;  4PL6 A;  3LWI A;  2D8H A;  3MEV A;  3OQ5 A;  1UGS B;  4C8Q B;  4CC7 A;  1WHH A;  1QLY A;  5FU7 C;  2QYZ A;  3M58 A;  3C94 A;  1KQ2 A;  7AT1 B;  3EG0 A;  4UC4 A;  2KY9 A;  1VQ8 A;  2LZ6 B;  2JT4 A;  2X35 A;  2XIC A;  3CQT A;  4V2S A;  3V8L A;  3UF4 A;  3E9F A;  2XDP A;  1K1Z A;  1WXB A;  4C8Q G;  4JJB A;  2CUB A;  5LJ3 h;  2P4R A;  4EDU A;  2MF2 A;  4M7D E;  1YCY A;  3FEO A;  3HRU A;  5EC7 A;  3A8M B;  5I11 A;  3CC4 T;  5CO7 A;  2NYS A;  4M77 D;  2DD4 A;  3QXE B;  3PIP A;  2Y4X A;  3OYK A;  4M4Z A;  4IUP A;  4XTV A;  4KH1 B;  2PNI A;  2EBP A;  3EGX B;  4ORZ A;  1VIF A;  1ZSZ A;  3H0H A;  2AT1 B;  1I5O B;  2KXC A;  1YJN A;  5DLQ E;  2COY A;  3L2Q A;  4PJO D;  1JEG A;  2VXE A;  4JS5 A;  2EFI A;  5KCO A;  2E70 A;  4M7A B;  3M0T A;  2JS0 A;  3OYL A;  2OTJ A;  2DTI A;  2LVM A;  1IXD A;  3G6E A;  1ACM B;  1BI2 A;  1KSW A;  1VUB A;  1GCQ A;  3M0P A;  1KQ1 A;  2DE0 X;  5KYU B;  4C5H A;  4JJD A;  1D0Z A;  2K2V A;  1KQS A;  1GFC A;  1NZ9 A;  2YDL A;  3LGF A;  1R0B G;  4RKU E;  2QA4 A;  4PJN A;  3HKS A;  3QJ6 A;  3I5R A;  3CCL A;  2DZC A;  3RR6 A;  1TG0 A;  2XID A;  3I35 A;  1TUC A;  3RKY A;  1M27 C;  4C8Q D;  4OF1 A;  5IH2 A;  1G5V A;  3PFS A;  4E47 A;  1VQ8 Q;  1M90 C;  2KK4 A;  3RMS A;  1AD5 A;  3A8L B;  5A0D A;  4DBH A;  3DB4 A;  2QAZ A;  2JNG A;  5LJ3 d;  2L3P A;  1YBY A;  1BI3 A;  1OX9 A;  1QVP A;  1KG1 A;  2LC4 A;  3NGP A;  3G6E T;  1UGP B;  1WNL A;  4F7U B;  4HXJ A;  1WA7 A;  3OW2 S;  1NEG A;  2KYM A;  2EAY A;  3CCJ T;  2Z0W A;  3TCJ A;  1VQ9 A;  1X69 A;  4E7Z A;  4FYY B;  3CCR Q;  3FRN A;  2AZS A;  3O8V A;  2ZZD A;  4EMH A;  3CD6 A;  2ZPG B;  3CCL T;  1NJI R;  1YJN Q;  1U8R A;  4F7U G;  2BKD N;  1UUE A;  2C0T A;  2LQ8 A;  4MDW A;  2XDD A;  3HTR A;  3PNW C;  2OTJ Q;  1UHF A;  1W2B S;  3EFR A;  4ZTF A;  1FMK A;  4LUE A;  3NTK A;  5FRM A;  2YRC A;  5GAO m;  1X6B A;  4IIM A;  3HSB A;  1G83 A;  4M7A D;  3WXM B;  3OYF A;  3FDR A;  3QII A;  3OYG A;  2AIR B;  2V1Q A;  2MWP A;  4CC3 A;  4P5N A;  2QA4 Q;  1ZA2 B;  3ER0 A;  5L23 A;  3CCL Q;  2DMO A;  3M0Q A;  3C95 A;  4JDS A;  5GAN 6;  3G4S A;  1VQ9 T;  1TWB A;  4J9D A;  2RD1 A;  3BDU A;  2KGT A;  2FL7 A;  2EGA A;  1YI2 T;  2CP5 A;  3PMT A;  2JTM A;  2QGG A;  4F16 A;  1YIJ A;  5IHN A;  4LDX A;  1VYT A;  2KT8 A;  2HEQ A;  5I2S A;  3CD6 T;  2W0Z A;  5HKC A;  2NUP B;  3OW2 P;  4MDX A;  3GBQ A;  2M0O A;  4GLM A;  4LD9 K;  1V1C A;  1Q82 R;  3M5A A;  5GAM j;  2AK5 A;  2RHI A;  2DL8 A;  1W70 A;  1GXI E;  3QZ5 B;  2QQB A;  1AZG B;  3I56 Q;  1R0C B;  2EQM A;  3GPL A;  2EGC A;  4TVR A;  5LJ3 j;  4XTX A;  1K76 A;  3PVL A;  5L8R E;  2F2W A;  4A4G A;  1MND A;  4BI3 A;  1KD1 C;  4AMC A;  1M2V B;  1KJW A;  1W6X A;  1B34 A;  5GAN 4;  2P0K A;  3G4S T;  3QBY A;  4ZTJ A;  4PJL A;  3EAE A;  1VQN T;  4ESR A;  2GBQ A;  3CMA Q;  1M8M A;  1OOT A;  4PK4 A;  1YIJ T;  3SWN C;  2M0Y A;  2KE9 A;  1MV0 B;  2DBM A;  1D0Y A;  4VUB A;  1IO6 A;  4MZM A;  2CRE A;  3M56 A;  2BUD A;  4NL2 A;  2E1H A;  4FYX B;  2QI2 A;  3OYE A;  3G71 T;  2EYQ A;  2CDT A;  4NL3 A;  3G4S Q;  4M7D A;  2W10 A;  3HHT B;  1G3Y A;  3NTH A;  2CUD A;  3N5B B;  5GJV B;  2PVD B;  3OYN A;  3A8G B;  4BE2 A;  2HQX A;  2VUB A;  5DM7 R;  2O9S A;  4KUL A;  4B9W A;  4MZT A;  2FPE A;  1Z9Z A;  4Q5W A;  2G3R A;  4ATO A;  5LJ5 j;  3EGD B;  2XD0 A;  5GAO l;  3S3O A;  4MML A;  1NEB A;  3URG A;  2DER A;  2F5T X;  5FU7 B;  1C1A A;  1W2B A;  2NWM A;  4OML A;  5KE2 A;  2K5I A;  3TU4 K;  5HK0 A;  2FYK A;  2K7A A;  3ZFJ A;  4CC2 A;  1SRL A;  1DJ7 B;  3L2U A;  3QWY A;  3CCQ A;  2AKK A;  2IVW A;  1BB9 A;  1X6O A;  2QQ9 A;  2GQV A;  2RQR A;  3L2V A;  5GAM f;  5GAM g;  3HFN A;  3EFS A;  1VQL T;  2O4X B;  4OP0 A;  1PD0 A;  2BZX A;  3P8H A;  4D8D A;  3V8K A;  4JS4 A;  5KYX A;  3DKM A;  5LJ3 f;  1AHJ B;  4M75 D;  1XTD A;  1K8A R;  2EYY A;  2ENM A;  1TH7 A;  1KFZ A;  4JRK A;  2OI3 A;  4F7U F;  1NPR A;  2DYB A;  3OS2 A;  4II1 A;  4KH0 B;  2D6F A;  1ARK A;  4J7I A;  1FWZ A;  3LLR A;  4OMQ A;  3JRZ A;  3EH1 A;  4DQ2 A;  2DRK A;  3FJP A;  1PWT A;  2FPF A;  4DBR A;  5KYX B;  1E6H A;  2LNH B;  1S72 A;  4OB0 B;  2DTH A;  3VS4 A;  1IB8 A;  3QZ9 B;  3CCS A;  2LDM A;  3U23 A;  3VS2 A;  2QTX A;  3QYH B;  3L2W A;  1RAC B;  1KC8 C;  1WX6 A;  2KEA A;  1N27 A;  3L2R A;  5IHK A;  4E2F B;  2R57 A;  1YNZ A;  3I5S A;  1K0X A;  2LCL A;  3LGL A;  3X26 B;  4HT9 A;  2M9U A;  2ZPH B;  4AFQ C;  2OAW A;  4BE1 A;  1TXQ A;  4XTY A;  1IGQ A;  3SD4 A;  1YJW Q;  2P84 A;  4AG1 C;  1RLQ C;  1T3L A;  3Q1J A;  1G3T A;  1VQ4 Q;  5J26 A;  2L3Q A;  3HFO A;  4FSS A;  5LJ5 g;  5LJ5 f;  4J9H A;  2KQW A;  2DVJ A;  3CCQ Q;  4JRQ A;  2ED1 A;  1VQ6 T;  3EG1 A;  2V1R A;  1K73 C;  5IHI A;  4A4E A;  4N4H A;  1MMA A;  4Z88 A;  1S72 T;  2P0Q A;  4DBF A;  4QVC A;  1LNX A;  4J9B A;  3QWX X;  2JMC A;  2X3W D;  3M0R A;  1TOV A;  4F7U E;  1JXO A;  4FT4 A;  1Q95 G;  1AEY A;  1BIB A;  2FZG B;  5I22 A;  2FRW A;  2QEX A;  1U3O A;  2CGH A;  2JJ9 A;  1AWX A;  3S3N A;  3QUI A;  3CC2 A;  3OS1 A;  3VS6 A;  3V7R A;  1JB0 E;  3GNG A;  1M90 R;  2E64 A;  1M1G A;  3T9N A;  3MO8 A;  3JCM V;  4C92 C;  1RL2 A;  5A0L A;  4HA8 A;  2RO0 A;  3FC3 A;  3MCA B;  1QVF P;  5FU6 B;  2E5Q A;  4RTT A;  4J5Y A;  3CCS Q;  1D1A A;  3L42 A;  2J05 A;  1SEM A;  4LN2 A;  3A8H B;  1YJ9 T;  1I1J A;  4PLL A;  2B8A A;  5CQX A;  2EPD A;  3REB B;  1JBM A;  2M16 A;  4IUR A;  2RJE A;  4M77 A;  1GBR A;  3EG2 A;  1P92 A;  1SPK A;  3HRS A;  3KBG A;  2LJ3 A;  2A3L A;  4AG2 C;  1HXD A;  1Q81 C;  2GCX A;  4J9I A;  1NG2 A;  3CPW A;  3CC2 T;  1PD1 A;  3UA7 A;  4FW1 A;  2LRQ A;  2K3B A;  1M30 A;  3OA6 A;  1T0H A;  4PJO A;  4FT2 A;  2QAS A;  3EGU A; 
#chains in the Genus database with same CATH homology
 2KI7 A;  1TS9 A;  1V76 A;  1TSF A;  1PC0 A;  1OQK A;  2ZAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...