1OQKA

Structure of mth11: a homologue of human rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
RHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved protein MTH11
publication title Structure of Mth11/Mth Rpp29, an essential protein subunit of archaeal and eukaryotic RNase P.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Hydrolase
total genus 6
structure length 78
sequence length 78
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1oqkA00
2KI7A 1OQKA 1V76A 1PC0A 1TSFA 2ZAEA 1TS9A
chains in the Genus database with same CATH superfamily
2EYWA 5FRNA 1ZBXA 1WQ7A 2DE0X 3I56Q 4YTLA 1D3BB 3DB3A 3N5BB 1M3CA 2DF6A 2Y4YA 1VQ6T 3LH0A 2GFAA 3VS5A 3OSVA 1VIEA 4GLKA 2E3HA 1KHCA 3FB9A 2Y4XA 3UT1A 6AT1B 1M1KU 3NFCA 1MNEA 2EIFA 1VQLQ 1RABB 2O01E 1KD1C 3I55T 4C8QF 4UC4A 2KR3A 2QK0A 2CS7A 2ESWA 2EJFA 3S3MA 2RJFA 2XMFA 3GLXA 3GIBA 1YWOA 2V8IA 3MP1A 2EYYA 1NE8A 1YJNT 4N0AC 2YRDA 5HCKA 3SB2A 1UGSB 5GAN4 4MZPA 1PCXA 3FJPA 3G4ST 2J05A 2DD4A 4RCCA 3O8VA 1Z9ZA 3EG0A 4NOYA 1KD1R 4Y91A 2YRVA 3MEUA 2IPOB 4J9HA 3CCRQ 1IXDA 2QA4T 3EG9B 4AT1B 1U1TA 1ACMB 3PMIA 4A4EA 4ELZC 2AZSA 2X4JA 4M7DD 4FM4B 5FU6C 4OMPA 2GGRA 2GCXA 1X43A 2LCSA 3CCSA 1K8AR 4OP0A 2RA2A 5LJ5f 4HT9A 2VKNA 2YHTA 3T9NA 5GAOm 3MJXA 1M8VA 3NHNA 5DLQE 3VS2A 2ED0A 2HEQA 2PZ1A 2DAQA 4V2SA 3ZBDA 1VQNQ 5KYNA 4F04B 5GMKe 1EZZB 1FMVA 2AIRB 3FJ5A 1X6OA 1UGVA 1JXOA 4LDUA 5IAYA 1I5LA 2L3QA 2ZCFB 2F2VA 3CCUA 1TUDA 1X01A 3I9QA 4M7AG 1WHLA 1M1KC 3CMAQ 5GAN3 3PFSA 3EGXA 1G2BA 2NUZA 5HK3A 1G3YA 1NJIC 2QEXT 2JTMA 3NTKA 1WDXA 3H6ZA 3V8KA 5FROA 3WVEB 3V7RA 2NUTB 3CCEA 3GP8A 1C1AA 2RHXA 3PNWC 5KYXB 2VC8A 5A2QE 2E64A 1YJWQ 2JOYA 2H3JA 2AKLA 2O2OA 2CP0A 1K1ZA 2DPPB 4M7AB 2E4HA 2VGMA 3NMZC 2JTEA 3A5ZB 3SDZA 4MDWA 2JJ9A 2LT1A 3E9FA 1VQ7Q 1I0CA 3KBGA 3CXCP 3CCRA 1TTHB 1ARKA 2B86A 1N8RU 4J9IA 2DTHA 1I1JA 1NJIR 4IUQA 2J6KA 1S72T 4M75E 3M4YA 2MWOA 3CCST 3A8HB 1KC8U 1QKXA 3CCVQ 2RHUA 4C0DC 1D1BA 3CBPA 2DRMA 4IUTA 2BIVA 5FRMA 1B3QA 4L59A 3I56T 2XI9A 3KUFA 3VS6A 2KRNA 2GF7A 1UUEA 2K2VA 4M7DC 4KUIA 1VQ8Q 1G5VA 4B6MA 3GNGA 2RM4A 4M75A 1QCFA 4OMMA 1X2QA 1JQQA 4PLIA 4HVUA 5GAOr 3HPWA 1PM3A 2EW3A 2X4WA 3CC2Q 3G7ZA 4J7FA 1YIJA 1VQLT 1Y96A 3OYKA 2RQVA 1OQKA 5GMKj 2RHZA 3VKIA 3OQ5A 3OS0A 1ZUKA 3CMAA 4BY6B 2K79A 2ABLA 3OYGA 3EGUA 3CCQA 3JSCA 3S3OA 3M53A 3J7AF 2ENMA 2OI3A 3JB9D 4LN2A 1W2BA 3RMQA 4IUPA 5CKBA 1FMWA 9ATCB 1DJ7B 1UHCA 2FPDA 4HCZA 3M55A 3EG3A 3CPFA 4RTWA 1CSKA 3QYGB 2E1HA 1UGPB 1T0JA 5KYYA 1QVFP 3OYFA 1X27A 4B9XA 2EFIA 1BK2A 4OGEA 1QWFA 1PRMC 5IT9E 3GPLA 1N9RA 3H41A 2CKKA 1YJWA 1VQ4Q 2AZVA 1TSFA 1VIFA 3G71A 2HBPA 4OVAA 2QAZA 5A0DA 1W2BS 2EQMA 2LQNA 5I2MA 3CCRT 3RBBB 2F1LA 2HL3A 1VQ5Q 1WNLA 3JV3A 1OOTA 4DBFA 4J6XA 2K5IA 2YWWA 2OTLQ 4C5GA 4FSXA 2QDLA 1UE9A 3E2UA 4C8QD 1N8RC 2LNHB 3PIPA 4IKFA 2CH4A 2G3RA 1XTDA 1OV3A 4A63B 4XU1A 2E70A 1VQ9Q 1KC8C 3QPHA 2KNBB 4ZNXA 1WHHA 1KQSA 2DYIA 4XTXA 5ECAA 5D6XA 2CP3A 1VQNT 2WACA 3JRZA 2JM8A 2JTFA 1UFFA 5FLXE 2M0YA 2XK0A 1Q82U 2A37A 1U06A 2MAMA 1IGQA 2MMPA 1GXIE 3HFNA 1JB0E 3CC7Q 1KQ1A 1ZQ1A 4OB1B 3SHWA 5KCHA 2K3XA 2CREA 1MMGA 3HRUA 3OMCA 1AOJA 4M75F 4X9CA 1YCYA 1KQSS 3A8LB 1PC0A 3QDRB 4M77E 1MMDA 2QYZA 3VS0A 3JAME 1KK7A 1HSQA 2E5QA 1KC8R 4N4GA 2RJDA 1VYTA 2BE7D 2DVEA 1AWOA 3TREA 1Q81R 4DQ2A 4FSSA 5M9OA 2EAYA 4M77A 2DD5A 4CC4B 4D8KA 1QW1A 1R8OB 2GTOA 2CUBA 2O88A 4RTYA 1G3TA 3CCMA 5CK9A 2ZPBB 4A53A 4F14A 1WI7A 1Y07A 3ZFJA 2BZYA 2NUPA 1ZA2B 2RO0A 3QJ6A 5I22A 1VQ4A 4BI4A 2EJ9A 1VQMT 1VQ7T 1PWTA 2KI7A 2OAUA 1XJWB 1VQPA 2KAFA 1K4US 2D0QB 1NPPA 4LD6A 4TVRA 1VQ5A 4F16A 1KFZA 1KSWA 3CCVT 4M7AC 3MKDA 5FU6B 1RAFB 1LOJA 2HKQB 3U23A 1YBYA 3QG1A 4JUVA 4FU6A 2L8DA 1SEMA 3BFMA 1H8KA 2LT4A 1VQ8T 3EGXB 3SWNA 2HNIA 1BBZA 1KJWA 2QQSA 4OMNA 3KFVA 3QDFA 2VVKA 1BU1A 2RK2A 4RTUA 3FC3A 3OYMA 1G8XA 4XTYA 3CC2T 3FDRA 3LYIA 4J7IA 1Q82C 2VXFA 3MP6A 3C12A 3CMEA 2PVGB 4J9EA 4HCKA 1UTIA 1PSEA 2R57A 2VV5A 4DEXA 2XG8D 3MEWA 1WPYA 3M57A 1H3HA 1BI1A 4IUVA 2J6OA 4QVZA 1M2VA 2HCKA 2VXEA 4RG2A 2RB6A 3PVLA 1YI2Q 4M75G 1RLQC 2JMCA 3MP8A 4LXCA 3M0SA 2K4YA 1I5OB 2R5MA 4EMKA 2A3LA 1AT1B 4LUDA 2P0PA 1V76A 4BY6C 1RAGB 3OYBA 1UGQB 4XK8E 1VQ4T 4Q5WA 2CGHA 2DL3A 4R55A 3HRSA 1LJOA 1M90R 1SKUB 2L3SA 1Q7YU 2L2PA 2DO3A 1VA7A 4ZGEB 3LGLA 3L2RA 2KYBA 2KRSA 1VQ5T 2MI6A 1PKTA 2O31A 2V8JA 3M56A 1OPLA 4M75B 3OYNA 2MWPA 1QLYA 1UDLA 2OTLT 4BB7A 2EYQA 2K6DA 1PD1A 1PHTA 1K0SA 1GCQA 1Y96B 5GAMf 5L8RE 1VQ9T 3QWYA 3GOXA 3M5AA 2X35A 3VYGA 4KH0B 2NYSA 4QQ6A 1YCSB 1HYOA 2QDYB 4DBQA 1NBEB 5CAIA 1YWPA 2L89A 3G6EA 4N4IA 5GAN2 4LE9A 1TXQA 2HDAA 3EH2A 5I2SA 5HKCA 3CC7T 2EPDA 4NL2A 4DBHA 4E7HA 2K7AA 5CVIA 3QHSA 5KYYB 3JCMW 4OMFB 2ZAEA 3M0RA 3ZEHA 8ATCB 3RESA 2J06A 4XTUA 3INZA 3LWIA 2O9SA 1U8RA 5DY9A 3JB9J 3CXCA 4AFUC 4PKCC 2FG0A 2K57A 4M7AF 4C92E 4CRIA 2ZPIB 1IGUA 1BI0A 3UDCA 3CCUQ 1YI2A 3VUBA 2E41A 1SF9A 4OF1A 5GAOq 1U3OA 2YUPA 5FU7C 2EYXA 4X34A 4C92A 5A0GA 2MOXA 1ZSZA 1K0XA 1IO6A 1SHFA 3OYDA 1WQWA 1GFCA 1NG2A 4E7JA 4HVVA 2JS0A 4A4FA 3OYAA 1MV0B 3CCEQ 2DXBA 3EAEA 4AFSC 1Q7YC 1GCPA 2DNUA 4Z88A 3VRZA 4L6V5 4HT8A 4M75D 1OEBA 2RQRA 4M77G 3FEOA 3M0TA 2QI2A 2YLBA 3L1AA 4HA8A 4CC7A 4ESRA 1GBRA 1D1AA 1Y7XA 1J3TA 3EH1A 3FIFA 4FT2A 3REBB 3VV0A 3ME9A 4PJOE 3MPUB 3UATA 4FCYA 5DLOA 5CKEA 2R58A 2EJGA 2JVVA 5LJ3g 3CD6Q 4BD3A 2CUDA 3R6OA 1SSFA 4PJMA 1WX6A 1O75A 2FRWA 4PLLA 1QVFA 1UECA 2YUNA 2RMOA 3EFRA 1JEGA 2CP5A 4J83A 4C5IA 1W1FA 3F70A 3M58A 2ZGWA 4F7UE 4PFZA 3JCMb 1KG1A 3OS1A 3TQ7P 1Q7YR 4PJOA 2RH2A 4M77B 3VJPA 3OS5A 3E1SA 2JM9A 4Z89A 1D1CA 4JRKA 5CQXA 2OTJQ 2M51A 2KGTA 4J5YA 3VUZA 1JO8A 4O5VA 5GAOl 3CPWP 5CQYA 2OAWA 2CP7A 2ZPGB 1YI2T 1QCNA 1YIJQ 4F7UA 1QVFS 4M78E 4RTXA 4JLIA 4R0KA 5AT1B 3A8OB 5LJ3h 3C95A 3HP9A 4J8OA 2XKOC 4XU2A 2VWFA 2FRYA 2RI2A 1XQHA 1M30A 2C0IA 3FRNA 1WFWA 3EFOA 2E65A 4RUGA 1GFDA 3L2QA 2E12A 3CCQQ 2LNVA 4J9FA 1WXBA 1RAEB 2CT4A 3P8DA 4M78A 5GJVB 4QQDA 3SWNB 1M3AA 1A0NB 1TOVA 1RACB 4C92F 1X69A 1O9SA 1YJ9Q 2HSEB 4OB3B 3REAB 4D8DA 3H0HA 4RCBA 4CI0C 3EG2A 3CC4A 2KXDA 2AHJB 3G71Q 2X51A 5GMKi 1WXTA 4KGZB 1M1KR 4KRTA 4IIMA 3X25B 2JT4A 4M75C 2EQUA 3CCJA 1YHQQ 2DMOA 2ZPEB 4XU0A 2CZ6B 2LQWA 4F17A 1M2VB 3CD6A 1QP2A 3M0QA 4FW2A 3SFMA 4PK4A 3LW5E 3HHTB 3KXTA 4EMKB 2QQRA 1ZA1B 3RNJA 1OYXA 4JJNK 2PU9B 1I81A 4HXJA 2LVMA 4BDYA 4PJNA 4KULA 4OMQA 1WXUA 2OTJA 1YITA 3QIIA 4C0GA 2RQWA 1SPKA 3RUXA 4PJOF 1JXMA 1VUBA 2G6FX 3D7SB 2WSEE 2LRQA 3DKMA 2AK5A 3CCUT 2KRMA 1NZ9A 2DL4A 4P5NA 4O6JA 1UEBA 2BUDA 2CYZB 4A54A 1QQJA 2KT8A 5CIUA 5IXBA 1FX7A 5GANg 1OX8A 4BE2A 2CP6A 3DLMA 1GRIA 2EVRA 2H3EB 3LGFA 5IN1A 4QVCA 4F7UF 2DTIA 5GANe 1T3LA 7AT1B 1I4K1 1ZUUA 3OMGA 4BI3A 5KE2A 2LJ3A 1OI1A 5CO7A 4KT0E 2QTVA 5IXFA 4JZ3A 4ANJA 2GBQA 4EPCA 3CCET 1OPKA 2P4TA 2KXCA 3CCMQ 2DXUA 5J26A 1C6VX 2ATCB 1UG1A 2VASA 1YJ9A 4M78F 3QSUA 2RI3A 5D6YA 2DEUA 5GANd 5I21A 3RDVA 3LH5A 2RQTA 1W6XA 1BIAA 4OB2B 4C92G 5GANh 2NLUA 4M7AD 4J6YA 4JJBA 2M16A 1RLPC 1NLOC 1VQPQ 1RL2A 2CP2A 2DM1A 4PFPA 2FO0A 3CD6T 1NYGA 2SEMA 1YHQA 3GF5A 2RNAA 3VU3C 2P4RA 2KMTA 4ZTJA 1HXDA 1N27A 4VUBA 3TSWA 3H9NA 2X4XA 2HZYA 4BACA 2DBKA 3V8JA 2K2MA 4IIOA 1RI0A 2OTJT 1M9SA 3QKJA 3VRYA 4C92B 2P84A 2DZCA 1ZSZB 3X26B 1NPRA 2F69A 1YIJT 2DTOA 5J39A 3EHRA 4K11A 2O9VA 3JB9H 1BB9A 2QQ9A 3CMEQ 4M77C 4DEYA 1VQOQ 1OZ2A 3L2VA 1OX9A 2BZXA 3PMTA 3CMAT 2CZ1B 2JNGA 4PJOG 4II1A 2E6ZA 2LC4A 3CQTA 5FU7B 1N8RR 2RJEA 3CCQT 2D1XA 2DLPA 2J6FA 1IB8A 2VYTA 2EYZA 3R6NA 4FYVB 2RHYA 4RG8A 3JCMh 1KQ2A 2PNIA 2L3RA 2VUBA 3DLLA 1W70A 2LCCA 2COWA 4F7UG 1M5Q1 1YJ9T 2E5KA 2M02A 1IZ6A 5GANj 2DL8A 1VQ6Q 1WHKA 2F2XA 1BIBA 4C5HA 4AG2C 4JRQA 1YJWT 2GQVA 2FHDA 1AZGB 2RD1A 5EC7A 3G71T 4PJOB 4BE1A 3V7CA 2FZGB 2DILA 4J6WA 3SWNC 3Q1JA 3H0IA 3OYCA 2D0NA 3P8BB 1JJ2P 1K9MU 2ZPHB 5FW9A 4M78G 3DB4A 1LPLA 1YHQT 4OB0B 4Z8AA 3TCJA 3E19A 1D09B 1ZX6A 3I35A 3L2ZA 1BI3A 4F7UB 2ED1A 1VQKA 2EQJA 3X24B 4NL3A 4ORZA 2MCNA 4RKUE 1B7TA 3A8GB 1OZ3A 4DBRA 3RKYA 5KYUA 4E7IA 3EFOB 4E2FB 2HKNA 1N5ZA 4MZTA 5D6WA 2XD0A 4PNOA 4DA4A 4ELYC 3G6EQ 4ATOA 4BI8B 3UA6A 3M54A 4C92D 2F5KA 3VS4A 3EGDA 4M78B 3CBMA 3E9GA 1NEBA 1SSHA 4N4HA 4EMKC 3RIRA 1HJDA 5HK0A 2ROTA 2QASA 5C6SA 1AHJB 2COYA 4E6RA 2SRCA 3LLRA 2BZ8A 1VQOA 1AZEA 4RTTA 5GMKm 3JCMJ 1ABOA 3CCLQ 1U1SA 1W2BP 4BE0A 3HTRA 5A0LA 3J81E 2F5TX 2YUOA 3OYYA 3WVDB 5GMKl 3PVQA 1M1FA 1G83A 1X6BA 1IHVA 5GAOp 3QUIA 4WF2A 5LJ5g 4CC3A 4JDSA 4PJLA 1QKWA 3A8MB 4JS5A 2P0QA 1B34A 5LJ5e 2GTJA 3CCMT 5KYWA 3OYHA 4FL6A 4J9DA 4C8QA 1GCQC 3VS7A 1VQ6A 1X75C 4OGCA 1N9SA 1W4SA 1KD1U 1Q82R 2HL5C 1I8FA 4IUUA 5CKDA 3OBYA 2GNCA 4M77F 3CPWA 2HQHA 2DBMA 4PJOD 1QVGP 2M9UA 1VQPT 1WYXA 3JCMP 1JU5C 3I55A 2BTTA 4QW2A 1VYVA 3UF4A 2NWMA 5LJ5d 1K9MC 1WZOA 3QJYA 1JRIA 2ROLA 1K8AU 1WHGA 3PT9A 3TSZA 5LJ5h 3NTIA 1SRMA 2RN8A 3L42A 4RTVA 3RMSA 1ZSGA 2KVQG 3PIOA 1T3SA 2O4XA 4XTZA 4AFZC 4PFOA 1P92A 2VGNA 2R5AA 1YJNA 3BDLA 1RAIB 3ASKA 3QWXX 5GJWB 5CKHA 4E7ZA 1WHMA 2FEIA 2LX7A 2FZKB 2IVWA 3G4SA 1M1GA 3SD4A 5GAN6 1ZLMA 3CMET 2QGFB 3VS1A 2E10A 3OSSC 2FZCB 4C92C 2EQIA 5D7UA 1ZSZC 3AHUA 1S72Q 3CCLA 1QP3A 2WSCE 3EG1A 1D0YA 4EMHA 2A28A 3UWNA 4ZN1A 3BE3A 1S1NA 2LX9A 1Q86U 5IHIA 2M0OA 2RK1A 2DA9A 2C0OA 5GAN7 3CXCS 4JLGA 1WJRA 1EFNA 2YXYA 3JCMc 3I5SA 2V8KA 2MF2A 4DOWA 2YLCA 5LJ5j 2DVJA 1NEGA 1NJIU 4LDYA 3NPFA 2IG0A 3JB9I 2HQEA 2XDBA 2V26A 3IQLA 4FT4A 2XU8A 1WJQA 3CC4Q 4PJOC 1U5SA 3M0UA 1LNXA 1FYNA 4LUEA 2I2LA 2QEXA 3ULRB 1K8AC 3HSBA 2B8AA 4GY5A 1SG5A 2DRKA 2L0AA 3CCJQ 1MV3A 1TG0A 2XHCA 4LDVA 1IRXA 1K73U 3VYHB 3G6ET 5HY6A 2EKHA 2KSSA 5CR2A 2EGAA 2CT3A 2PTKA 3VS3A 5LJ3e 4JZ4A 3TU4K 3OW2P 1UJYA 1V1CA 2KYMA 1AWWA 1PKSA 1QCOA 1R77A 4MMLA 3HKSA 1VYUA 3A1PA 2KBTA 2D6FA 4FIBA 3CCLT 1UGRB 1YITQ 5AYFA 4N0AA 2OX7A 3V7SA 2LZ6B 2NUPB 1S72A 1C0MA 4M78C 2QG9B 1MHNA 2W10A 5LJ3d 1XOVA 5CKFA 2JUFA 3A98A 3O5ZA 3JB9G 1GBQA 1SHGA 3I56A 1X2KA 1E7OA 2KEAA 5FWBA 2EBPA 1YN8A 8AT1B 4J9GA 2KDSA 1AD5A 2K5LA 3OYEA 1B07A 1K76A 2IIMA 5EG2A 1Q86C 4XTVA 4JRPA 2A7YA 3OBWA 1K9AA 1YFNA 1OULA 2K3BA 5KYUB 3QBYA 2HBWA 2CSQA 4LDXA 3LWHA 1IREB 1VQLA 4QVDA 2MK5A 3OYJA 1CKBA 1RAHB 1M27C 4QQGA 2X4YA 3NTHA 2LMJA 2RQUA 3EGDB 1QVPA 1QWEA 2C06A 3BDUA 3GBQA 1TU0B 4FW1A 3OS2A 5GMKh 2DXTA 4C8QG 1GL5A 2AKKA 3OYIA 4IURA 3V8LA 4J9BA 4WTOB 2JN0A 1D0XA 1PD0A 4X1VA 1RAAB 4HKEA 3CEYA 1Q86R 1WGSA 1G3WA 4GBQA 5IHKA 3C4SA 1K73C 1EX4A 3M4GA 1WHJA 2D8JA 5GAN8 3MO8A 2Z0WA 1VQMQ 4C0ZA 2LJ1A 2PQWA 1PRLC 1B34B 1I07A 2DL5A 3H8ZA 5KYWB 2EGEA 4RMOA 1AWJA 2KT1A 2WSFE 4ME7A 4M77D 1UHFA 4C8QB 3JCMQ 1JJ2A 4D6WA 4ZTFA 4QKUA 1RI9A 5LJ3j 4Y92A 1E6HA 2MPXC 2RPNA 4A4GA 1OU8A 2YRCA 2EGCA 2L5QA 3M0PA 1NLPC 3FLGA 3PE0A 2W0ZA 1LCKA 5KCOA 4FYWB 4NS5A 3QZ5B 1Q81U 1HK9A 5IHNA 2QQAA 1BCMA 1Y57A 1TS9A 3OA6A 4FYYB 3S6WA 2K9GA 2XDPA 1XNIA 2V1RA 2EWNA 2GFUA 1VQNA 1K73R 4M7DE 5DM7R 1JJ2S 2DK3A 1TUCA 3SEMA 3I5RA 2YDLA 4LD9K 1H3ZA 4JRIA 1RUWA 4XU3A 4XQ3A 3RERA 2O4XB 1RADB 3PGGA 2FB7A 1WJSA 3ER0A 5IH2A 1MMNA 4EMGA 3L2WA 4C5EA 2RI5A 3X20B 1T0HA 4LNPA 4M7DA 4MDXA 1TWBA 3CC4T 2HSPA 1NYFA 2KK4A 5FWCA 2DIGA 3C94A 5I11A 2JW4A 4PL6A 1M4ZA 5LJ3f 3CCJT 4ZN3A 1BYMA 1D3BA 3OB9A 2JXBA 1BI2A 1WIEA 1VQKQ 5C0MA 2VB6A 2LP5A 3X28B 2A36A 1FMKA 2AT1B 2K5FA 3MHXA 1H641 4J9CA 1VQMA 1VQ7A 2OJ2A 4R56A 3JCMg 1AEYA 1LVKA 3ZL7C 3RKXA 1VOMA 1YITT 1IHWA 2LJ0A 4JJCA 4KGXB 4EIKA 1QVGA 4EDUA 4M4ZA 3JCMe 4JPBW 4FYXB 3RKWA 5L23A 2QXFA 1AVZC 3QYHB 1H92A 1M3BA 3CCVA 3QO3A 4KGVB 2DXCA 1G3SA 2MYSA 2GQIA 4PJJA 4XTWA 3TVTA 1E6GA 5GAMg 2DX1A 2YSQA 1SRLA 1EIFA 2RHIA 3AT1B 1TUGB 4HVWA 5GAMe 1VQ8A 1Q81C 4Z02A 4E7KA 1Y71A 1OU9A 2C0TA 4LDWA 3L2UA 1QVGS 3JCMd 1M90U 1D0ZA 4OMOA 3HL8A 5LL6S 2FPFA 3H0FA 1ZUYA 3J80E 5J3BA 3CC2A 5GAN5 3BW1A 2Y90A 2LCLA 3PTAA 2X3WD 2H8HA 3EG9A 2PUKB 2DETA 2X9HA 5GAMd 4JJDA 2CSIA 2DJZA 5KH6A 1WLPB 1PG5B 1MGQA 5GAMh 2D8HA 4BDZA 1PSFA 2CZ0B 1UJ0A 2DYBA 3G1JA 2DL7A 4L5GA 3URGA 4M7DF 2M1HA 2ZZDA 3I55Q 2DJQA 3OY9A 2LTOA 3MEVA 1ZBJA 1AWXA 4OMLA 2EQKA 4HCCA 5GAOn 4JS4A 1MUZA 2RF0A 3THKA 1X6GA 3CBOA 3M9QA 4ZGDB 2JS2A 1WA7A 3EFSA 1UB4A 4A4KA 1JBMA 2FPEA 2YUQA 3HFOA 2V1QA 2KQWA 2DFUA 1YJNQ 2JZ2A 2DEQA 3P8HA 2HMAA 1KHIA 2OTLA 2FVUA 1MNDA 2A0FB 3G4SQ 1Z9QA 2X3XD 3JCMX 4KH1B 4HCBA 1M8MA 4M7AE 4RTZA 1M2OA 4E7SA 1VQ9A 2XDDA 2L3PA 3QZ9B 5GANf 2CDTA 2QA4Q 2DZ9A 4C8QC 2KY9A 2JMAA 2I0NA 2FYKA 2NUTA 4C0FA 2F2WA 4A4HA 3HRTA 4C8QE 2HD0A 5KYXA 4E7LA 3EHQA 2CZ7B 2YT6A 2LDMA 2HQXA 3GNFB 1CKAA 1PNJA 4M7AA 4Y28E 2XIDA 1R0BG 2LQKA 3CC7A 1M90C 3WXMB 2PVOB 3OW2A 5GAMj 4KBMB 1TH7A 2EKOA 2K3YA 2QQBA 2ZPFB 2D9TA 3LX7A 2KROA 4AMCA 4AFQC 3MCAB 1N6AA 1R0CB 3RR6A 3QXEB 4B9WA 4DOVA 1ZHIA 1NM7A 1YP5A 3UA7A 2KE9A 2PUOB 3M59A 2COZA 4E47A 3OW2S 3JCMV 3MEAA 4MMKA 1HD3A 2BE9B 5CCAA 1VQKT 2ECZA 2J7IA 1KQSP 3S3NA 4KUDK 4M7DG 2QEXQ 1FWZA 2XICA 2QTXA 3META 3JCMf 3NGPA 2BKDN 2DKGA 4GLMA 3UPUA 1QMCA 1MMAA 3CPWS 1ABQA 1BKBA 4WCIA 2LQ8A 4X9DA 2E6NA 4CC2A 2E3IA 3C0CA 2DERA 1YNZA 4C0DB 4QT7A 4M78D 1V29B 2A08A 4ZGJB 2PVDB 2RJCA 1VQOT 5KE3A 3BY7A 2P0KA 4M7DB 2QA4A 1K9MR 1KIKA 3JB9F 1Q95G 1Y0MA 2HAXA 4BUGA 3TEEA 2QGGA 2CH4W 1FXXA 2DIQA 4MZMA 3CCSQ 2FL7A 2MIOA 1F1BB 3OYLA 4AG1C 1BCOA 4XAXB
chains in the Genus database with same CATH topology
2KI7A 1OQKA 1V76A 1PC0A 1TSFA 2ZAEA 1TS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 A;  1OQK A;  1V76 A;  1PC0 A;  1TSF A;  2ZAE A;  1TS9 A; 
#chains in the Genus database with same CATH topology
 2EYW A;  5FRN A;  1ZBX A;  1WQ7 A;  2DE0 X;  3I56 Q;  4YTL A;  1D3B B;  3DB3 A;  3N5B B;  1M3C A;  2DF6 A;  2Y4Y A;  1VQ6 T;  3LH0 A;  2GFA A;  3VS5 A;  3OSV A;  1VIE A;  4GLK A;  2E3H A;  1KHC A;  3FB9 A;  2Y4X A;  3UT1 A;  6AT1 B;  1M1K U;  3NFC A;  1MNE A;  2EIF A;  1VQL Q;  1RAB B;  2O01 E;  1KD1 C;  3I55 T;  4C8Q F;  4UC4 A;  2KR3 A;  2QK0 A;  2CS7 A;  2ESW A;  2EJF A;  3S3M A;  2RJF A;  2XMF A;  3GLX A;  3GIB A;  1YWO A;  2V8I A;  3MP1 A;  2EYY A;  1NE8 A;  1YJN T;  4N0A C;  2YRD A;  5HCK A;  3SB2 A;  1UGS B;  5GAN 4;  4MZP A;  1PCX A;  3FJP A;  3G4S T;  2J05 A;  2DD4 A;  4RCC A;  3O8V A;  1Z9Z A;  3EG0 A;  4NOY A;  1KD1 R;  4Y91 A;  2YRV A;  3MEU A;  2IPO B;  4J9H A;  3CCR Q;  1IXD A;  2QA4 T;  3EG9 B;  4AT1 B;  1U1T A;  1ACM B;  3PMI A;  4A4E A;  4ELZ C;  2AZS A;  2X4J A;  4M7D D;  4FM4 B;  5FU6 C;  4OMP A;  2GGR A;  2GCX A;  1X43 A;  2LCS A;  3CCS A;  1K8A R;  4OP0 A;  2RA2 A;  5LJ5 f;  4HT9 A;  2VKN A;  2YHT A;  3T9N A;  5GAO m;  3MJX A;  1M8V A;  3NHN A;  5DLQ E;  3VS2 A;  2ED0 A;  2HEQ A;  2PZ1 A;  2DAQ A;  4V2S A;  3ZBD A;  1VQN Q;  5KYN A;  4F04 B;  5GMK e;  1EZZ B;  1FMV A;  2AIR B;  3FJ5 A;  1X6O A;  1UGV A;  1JXO A;  4LDU A;  5IAY A;  1I5L A;  2L3Q A;  2ZCF B;  2F2V A;  3CCU A;  1TUD A;  1X01 A;  3I9Q A;  4M7A G;  1WHL A;  1M1K C;  3CMA Q;  5GAN 3;  3PFS A;  3EGX A;  1G2B A;  2NUZ A;  5HK3 A;  1G3Y A;  1NJI C;  2QEX T;  2JTM A;  3NTK A;  1WDX A;  3H6Z A;  3V8K A;  5FRO A;  3WVE B;  3V7R A;  2NUT B;  3CCE A;  3GP8 A;  1C1A A;  2RHX A;  3PNW C;  5KYX B;  2VC8 A;  5A2Q E;  2E64 A;  1YJW Q;  2JOY A;  2H3J A;  2AKL A;  2O2O A;  2CP0 A;  1K1Z A;  2DPP B;  4M7A B;  2E4H A;  2VGM A;  3NMZ C;  2JTE A;  3A5Z B;  3SDZ A;  4MDW A;  2JJ9 A;  2LT1 A;  3E9F A;  1VQ7 Q;  1I0C A;  3KBG A;  3CXC P;  3CCR A;  1TTH B;  1ARK A;  2B86 A;  1N8R U;  4J9I A;  2DTH A;  1I1J A;  1NJI R;  4IUQ A;  2J6K A;  1S72 T;  4M75 E;  3M4Y A;  2MWO A;  3CCS T;  3A8H B;  1KC8 U;  1QKX A;  3CCV Q;  2RHU A;  4C0D C;  1D1B A;  3CBP A;  2DRM A;  4IUT A;  2BIV A;  5FRM A;  1B3Q A;  4L59 A;  3I56 T;  2XI9 A;  3KUF A;  3VS6 A;  2KRN A;  2GF7 A;  1UUE A;  2K2V A;  4M7D C;  4KUI A;  1VQ8 Q;  1G5V A;  4B6M A;  3GNG A;  2RM4 A;  4M75 A;  1QCF A;  4OMM A;  1X2Q A;  1JQQ A;  4PLI A;  4HVU A;  5GAO r;  3HPW A;  1PM3 A;  2EW3 A;  2X4W A;  3CC2 Q;  3G7Z A;  4J7F A;  1YIJ A;  1VQL T;  1Y96 A;  3OYK A;  2RQV A;  1OQK A;  5GMK j;  2RHZ A;  3VKI A;  3OQ5 A;  3OS0 A;  1ZUK A;  3CMA A;  4BY6 B;  2K79 A;  2ABL A;  3OYG A;  3EGU A;  3CCQ A;  3JSC A;  3S3O A;  3M53 A;  3J7A F;  2ENM A;  2OI3 A;  3JB9 D;  4LN2 A;  1W2B A;  3RMQ A;  4IUP A;  5CKB A;  1FMW A;  9ATC B;  1DJ7 B;  1UHC A;  2FPD A;  4HCZ A;  3M55 A;  3EG3 A;  3CPF A;  4RTW A;  1CSK A;  3QYG B;  2E1H A;  1UGP B;  1T0J A;  5KYY A;  1QVF P;  3OYF A;  1X27 A;  4B9X A;  2EFI A;  1BK2 A;  4OGE A;  1QWF A;  1PRM C;  5IT9 E;  3GPL A;  1N9R A;  3H41 A;  2CKK A;  1YJW A;  1VQ4 Q;  2AZV A;  1TSF A;  1VIF A;  3G71 A;  2HBP A;  4OVA A;  2QAZ A;  5A0D A;  1W2B S;  2EQM A;  2LQN A;  5I2M A;  3CCR T;  3RBB B;  2F1L A;  2HL3 A;  1VQ5 Q;  1WNL A;  3JV3 A;  1OOT A;  4DBF A;  4J6X A;  2K5I A;  2YWW A;  2OTL Q;  4C5G A;  4FSX A;  2QDL A;  1UE9 A;  3E2U A;  4C8Q D;  1N8R C;  2LNH B;  3PIP A;  4IKF A;  2CH4 A;  2G3R A;  1XTD A;  1OV3 A;  4A63 B;  4XU1 A;  2E70 A;  1VQ9 Q;  1KC8 C;  3QPH A;  2KNB B;  4ZNX A;  1WHH A;  1KQS A;  2DYI A;  4XTX A;  5ECA A;  5D6X A;  2CP3 A;  1VQN T;  2WAC A;  3JRZ A;  2JM8 A;  2JTF A;  1UFF A;  5FLX E;  2M0Y A;  2XK0 A;  1Q82 U;  2A37 A;  1U06 A;  2MAM A;  1IGQ A;  2MMP A;  1GXI E;  3HFN A;  1JB0 E;  3CC7 Q;  1KQ1 A;  1ZQ1 A;  4OB1 B;  3SHW A;  5KCH A;  2K3X A;  2CRE A;  1MMG A;  3HRU A;  3OMC A;  1AOJ A;  4M75 F;  4X9C A;  1YCY A;  1KQS S;  3A8L B;  1PC0 A;  3QDR B;  4M77 E;  1MMD A;  2QYZ A;  3VS0 A;  3JAM E;  1KK7 A;  1HSQ A;  2E5Q A;  1KC8 R;  4N4G A;  2RJD A;  1VYT A;  2BE7 D;  2DVE A;  1AWO A;  3TRE A;  1Q81 R;  4DQ2 A;  4FSS A;  5M9O A;  2EAY A;  4M77 A;  2DD5 A;  4CC4 B;  4D8K A;  1QW1 A;  1R8O B;  2GTO A;  2CUB A;  2O88 A;  4RTY A;  1G3T A;  3CCM A;  5CK9 A;  2ZPB B;  4A53 A;  4F14 A;  1WI7 A;  1Y07 A;  3ZFJ A;  2BZY A;  2NUP A;  1ZA2 B;  2RO0 A;  3QJ6 A;  5I22 A;  1VQ4 A;  4BI4 A;  2EJ9 A;  1VQM T;  1VQ7 T;  1PWT A;  2KI7 A;  2OAU A;  1XJW B;  1VQP A;  2KAF A;  1K4U S;  2D0Q B;  1NPP A;  4LD6 A;  4TVR A;  1VQ5 A;  4F16 A;  1KFZ A;  1KSW A;  3CCV T;  4M7A C;  3MKD A;  5FU6 B;  1RAF B;  1LOJ A;  2HKQ B;  3U23 A;  1YBY A;  3QG1 A;  4JUV A;  4FU6 A;  2L8D A;  1SEM A;  3BFM A;  1H8K A;  2LT4 A;  1VQ8 T;  3EGX B;  3SWN A;  2HNI A;  1BBZ A;  1KJW A;  2QQS A;  4OMN A;  3KFV A;  3QDF A;  2VVK A;  1BU1 A;  2RK2 A;  4RTU A;  3FC3 A;  3OYM A;  1G8X A;  4XTY A;  3CC2 T;  3FDR A;  3LYI A;  4J7I A;  1Q82 C;  2VXF A;  3MP6 A;  3C12 A;  3CME A;  2PVG B;  4J9E A;  4HCK A;  1UTI A;  1PSE A;  2R57 A;  2VV5 A;  4DEX A;  2XG8 D;  3MEW A;  1WPY A;  3M57 A;  1H3H A;  1BI1 A;  4IUV A;  2J6O A;  4QVZ A;  1M2V A;  2HCK A;  2VXE A;  4RG2 A;  2RB6 A;  3PVL A;  1YI2 Q;  4M75 G;  1RLQ C;  2JMC A;  3MP8 A;  4LXC A;  3M0S A;  2K4Y A;  1I5O B;  2R5M A;  4EMK A;  2A3L A;  1AT1 B;  4LUD A;  2P0P A;  1V76 A;  4BY6 C;  1RAG B;  3OYB A;  1UGQ B;  4XK8 E;  1VQ4 T;  4Q5W A;  2CGH A;  2DL3 A;  4R55 A;  3HRS A;  1LJO A;  1M90 R;  1SKU B;  2L3S A;  1Q7Y U;  2L2P A;  2DO3 A;  1VA7 A;  4ZGE B;  3LGL A;  3L2R A;  2KYB A;  2KRS A;  1VQ5 T;  2MI6 A;  1PKT A;  2O31 A;  2V8J A;  3M56 A;  1OPL A;  4M75 B;  3OYN A;  2MWP A;  1QLY A;  1UDL A;  2OTL T;  4BB7 A;  2EYQ A;  2K6D A;  1PD1 A;  1PHT A;  1K0S A;  1GCQ A;  1Y96 B;  5GAM f;  5L8R E;  1VQ9 T;  3QWY A;  3GOX A;  3M5A A;  2X35 A;  3VYG A;  4KH0 B;  2NYS A;  4QQ6 A;  1YCS B;  1HYO A;  2QDY B;  4DBQ A;  1NBE B;  5CAI A;  1YWP A;  2L89 A;  3G6E A;  4N4I A;  5GAN 2;  4LE9 A;  1TXQ A;  2HDA A;  3EH2 A;  5I2S A;  5HKC A;  3CC7 T;  2EPD A;  4NL2 A;  4DBH A;  4E7H A;  2K7A A;  5CVI A;  3QHS A;  5KYY B;  3JCM W;  4OMF B;  2ZAE A;  3M0R A;  3ZEH A;  8ATC B;  3RES A;  2J06 A;  4XTU A;  3INZ A;  3LWI A;  2O9S A;  1U8R A;  5DY9 A;  3JB9 J;  3CXC A;  4AFU C;  4PKC C;  2FG0 A;  2K57 A;  4M7A F;  4C92 E;  4CRI A;  2ZPI B;  1IGU A;  1BI0 A;  3UDC A;  3CCU Q;  1YI2 A;  3VUB A;  2E41 A;  1SF9 A;  4OF1 A;  5GAO q;  1U3O A;  2YUP A;  5FU7 C;  2EYX A;  4X34 A;  4C92 A;  5A0G A;  2MOX A;  1ZSZ A;  1K0X A;  1IO6 A;  1SHF A;  3OYD A;  1WQW A;  1GFC A;  1NG2 A;  4E7J A;  4HVV A;  2JS0 A;  4A4F A;  3OYA A;  1MV0 B;  3CCE Q;  2DXB A;  3EAE A;  4AFS C;  1Q7Y C;  1GCP A;  2DNU A;  4Z88 A;  3VRZ A;  4L6V 5;  4HT8 A;  4M75 D;  1OEB A;  2RQR A;  4M77 G;  3FEO A;  3M0T A;  2QI2 A;  2YLB A;  3L1A A;  4HA8 A;  4CC7 A;  4ESR A;  1GBR A;  1D1A A;  1Y7X A;  1J3T A;  3EH1 A;  3FIF A;  4FT2 A;  3REB B;  3VV0 A;  3ME9 A;  4PJO E;  3MPU B;  3UAT A;  4FCY A;  5DLO A;  5CKE A;  2R58 A;  2EJG A;  2JVV A;  5LJ3 g;  3CD6 Q;  4BD3 A;  2CUD A;  3R6O A;  1SSF A;  4PJM A;  1WX6 A;  1O75 A;  2FRW A;  4PLL A;  1QVF A;  1UEC A;  2YUN A;  2RMO A;  3EFR A;  1JEG A;  2CP5 A;  4J83 A;  4C5I A;  1W1F A;  3F70 A;  3M58 A;  2ZGW A;  4F7U E;  4PFZ A;  3JCM b;  1KG1 A;  3OS1 A;  3TQ7 P;  1Q7Y R;  4PJO A;  2RH2 A;  4M77 B;  3VJP A;  3OS5 A;  3E1S A;  2JM9 A;  4Z89 A;  1D1C A;  4JRK A;  5CQX A;  2OTJ Q;  2M51 A;  2KGT A;  4J5Y A;  3VUZ A;  1JO8 A;  4O5V A;  5GAO l;  3CPW P;  5CQY A;  2OAW A;  2CP7 A;  2ZPG B;  1YI2 T;  1QCN A;  1YIJ Q;  4F7U A;  1QVF S;  4M78 E;  4RTX A;  4JLI A;  4R0K A;  5AT1 B;  3A8O B;  5LJ3 h;  3C95 A;  3HP9 A;  4J8O A;  2XKO C;  4XU2 A;  2VWF A;  2FRY A;  2RI2 A;  1XQH A;  1M30 A;  2C0I A;  3FRN A;  1WFW A;  3EFO A;  2E65 A;  4RUG A;  1GFD A;  3L2Q A;  2E12 A;  3CCQ Q;  2LNV A;  4J9F A;  1WXB A;  1RAE B;  2CT4 A;  3P8D A;  4M78 A;  5GJV B;  4QQD A;  3SWN B;  1M3A A;  1A0N B;  1TOV A;  1RAC B;  4C92 F;  1X69 A;  1O9S A;  1YJ9 Q;  2HSE B;  4OB3 B;  3REA B;  4D8D A;  3H0H A;  4RCB A;  4CI0 C;  3EG2 A;  3CC4 A;  2KXD A;  2AHJ B;  3G71 Q;  2X51 A;  5GMK i;  1WXT A;  4KGZ B;  1M1K R;  4KRT A;  4IIM A;  3X25 B;  2JT4 A;  4M75 C;  2EQU A;  3CCJ A;  1YHQ Q;  2DMO A;  2ZPE B;  4XU0 A;  2CZ6 B;  2LQW A;  4F17 A;  1M2V B;  3CD6 A;  1QP2 A;  3M0Q A;  4FW2 A;  3SFM A;  4PK4 A;  3LW5 E;  3HHT B;  3KXT A;  4EMK B;  2QQR A;  1ZA1 B;  3RNJ A;  1OYX A;  4JJN K;  2PU9 B;  1I81 A;  4HXJ A;  2LVM A;  4BDY A;  4PJN A;  4KUL A;  4OMQ A;  1WXU A;  2OTJ A;  1YIT A;  3QII A;  4C0G A;  2RQW A;  1SPK A;  3RUX A;  4PJO F;  1JXM A;  1VUB A;  2G6F X;  3D7S B;  2WSE E;  2LRQ A;  3DKM A;  2AK5 A;  3CCU T;  2KRM A;  1NZ9 A;  2DL4 A;  4P5N A;  4O6J A;  1UEB A;  2BUD A;  2CYZ B;  4A54 A;  1QQJ A;  2KT8 A;  5CIU A;  5IXB A;  1FX7 A;  5GAN g;  1OX8 A;  4BE2 A;  2CP6 A;  3DLM A;  1GRI A;  2EVR A;  2H3E B;  3LGF A;  5IN1 A;  4QVC A;  4F7U F;  2DTI A;  5GAN e;  1T3L A;  7AT1 B;  1I4K 1;  1ZUU A;  3OMG A;  4BI3 A;  5KE2 A;  2LJ3 A;  1OI1 A;  5CO7 A;  4KT0 E;  2QTV A;  5IXF A;  4JZ3 A;  4ANJ A;  2GBQ A;  4EPC A;  3CCE T;  1OPK A;  2P4T A;  2KXC A;  3CCM Q;  2DXU A;  5J26 A;  1C6V X;  2ATC B;  1UG1 A;  2VAS A;  1YJ9 A;  4M78 F;  3QSU A;  2RI3 A;  5D6Y A;  2DEU A;  5GAN d;  5I21 A;  3RDV A;  3LH5 A;  2RQT A;  1W6X A;  1BIA A;  4OB2 B;  4C92 G;  5GAN h;  2NLU A;  4M7A D;  4J6Y A;  4JJB A;  2M16 A;  1RLP C;  1NLO C;  1VQP Q;  1RL2 A;  2CP2 A;  2DM1 A;  4PFP A;  2FO0 A;  3CD6 T;  1NYG A;  2SEM A;  1YHQ A;  3GF5 A;  2RNA A;  3VU3 C;  2P4R A;  2KMT A;  4ZTJ A;  1HXD A;  1N27 A;  4VUB A;  3TSW A;  3H9N A;  2X4X A;  2HZY A;  4BAC A;  2DBK A;  3V8J A;  2K2M A;  4IIO A;  1RI0 A;  2OTJ T;  1M9S A;  3QKJ A;  3VRY A;  4C92 B;  2P84 A;  2DZC A;  1ZSZ B;  3X26 B;  1NPR A;  2F69 A;  1YIJ T;  2DTO A;  5J39 A;  3EHR A;  4K11 A;  2O9V A;  3JB9 H;  1BB9 A;  2QQ9 A;  3CME Q;  4M77 C;  4DEY A;  1VQO Q;  1OZ2 A;  3L2V A;  1OX9 A;  2BZX A;  3PMT A;  3CMA T;  2CZ1 B;  2JNG A;  4PJO G;  4II1 A;  2E6Z A;  2LC4 A;  3CQT A;  5FU7 B;  1N8R R;  2RJE A;  3CCQ T;  2D1X A;  2DLP A;  2J6F A;  1IB8 A;  2VYT A;  2EYZ A;  3R6N A;  4FYV B;  2RHY A;  4RG8 A;  3JCM h;  1KQ2 A;  2PNI A;  2L3R A;  2VUB A;  3DLL A;  1W70 A;  2LCC A;  2COW A;  4F7U G;  1M5Q 1;  1YJ9 T;  2E5K A;  2M02 A;  1IZ6 A;  5GAN j;  2DL8 A;  1VQ6 Q;  1WHK A;  2F2X A;  1BIB A;  4C5H A;  4AG2 C;  4JRQ A;  1YJW T;  2GQV A;  2FHD A;  1AZG B;  2RD1 A;  5EC7 A;  3G71 T;  4PJO B;  4BE1 A;  3V7C A;  2FZG B;  2DIL A;  4J6W A;  3SWN C;  3Q1J A;  3H0I A;  3OYC A;  2D0N A;  3P8B B;  1JJ2 P;  1K9M U;  2ZPH B;  5FW9 A;  4M78 G;  3DB4 A;  1LPL A;  1YHQ T;  4OB0 B;  4Z8A A;  3TCJ A;  3E19 A;  1D09 B;  1ZX6 A;  3I35 A;  3L2Z A;  1BI3 A;  4F7U B;  2ED1 A;  1VQK A;  2EQJ A;  3X24 B;  4NL3 A;  4ORZ A;  2MCN A;  4RKU E;  1B7T A;  3A8G B;  1OZ3 A;  4DBR A;  3RKY A;  5KYU A;  4E7I A;  3EFO B;  4E2F B;  2HKN A;  1N5Z A;  4MZT A;  5D6W A;  2XD0 A;  4PNO A;  4DA4 A;  4ELY C;  3G6E Q;  4ATO A;  4BI8 B;  3UA6 A;  3M54 A;  4C92 D;  2F5K A;  3VS4 A;  3EGD A;  4M78 B;  3CBM A;  3E9G A;  1NEB A;  1SSH A;  4N4H A;  4EMK C;  3RIR A;  1HJD A;  5HK0 A;  2ROT A;  2QAS A;  5C6S A;  1AHJ B;  2COY A;  4E6R A;  2SRC A;  3LLR A;  2BZ8 A;  1VQO A;  1AZE A;  4RTT A;  5GMK m;  3JCM J;  1ABO A;  3CCL Q;  1U1S A;  1W2B P;  4BE0 A;  3HTR A;  5A0L A;  3J81 E;  2F5T X;  2YUO A;  3OYY A;  3WVD B;  5GMK l;  3PVQ A;  1M1F A;  1G83 A;  1X6B A;  1IHV A;  5GAO p;  3QUI A;  4WF2 A;  5LJ5 g;  4CC3 A;  4JDS A;  4PJL A;  1QKW A;  3A8M B;  4JS5 A;  2P0Q A;  1B34 A;  5LJ5 e;  2GTJ A;  3CCM T;  5KYW A;  3OYH A;  4FL6 A;  4J9D A;  4C8Q A;  1GCQ C;  3VS7 A;  1VQ6 A;  1X75 C;  4OGC A;  1N9S A;  1W4S A;  1KD1 U;  1Q82 R;  2HL5 C;  1I8F A;  4IUU A;  5CKD A;  3OBY A;  2GNC A;  4M77 F;  3CPW A;  2HQH A;  2DBM A;  4PJO D;  1QVG P;  2M9U A;  1VQP T;  1WYX A;  3JCM P;  1JU5 C;  3I55 A;  2BTT A;  4QW2 A;  1VYV A;  3UF4 A;  2NWM A;  5LJ5 d;  1K9M C;  1WZO A;  3QJY A;  1JRI A;  2ROL A;  1K8A U;  1WHG A;  3PT9 A;  3TSZ A;  5LJ5 h;  3NTI A;  1SRM A;  2RN8 A;  3L42 A;  4RTV A;  3RMS A;  1ZSG A;  2KVQ G;  3PIO A;  1T3S A;  2O4X A;  4XTZ A;  4AFZ C;  4PFO A;  1P92 A;  2VGN A;  2R5A A;  1YJN A;  3BDL A;  1RAI B;  3ASK A;  3QWX X;  5GJW B;  5CKH A;  4E7Z A;  1WHM A;  2FEI A;  2LX7 A;  2FZK B;  2IVW A;  3G4S A;  1M1G A;  3SD4 A;  5GAN 6;  1ZLM A;  3CME T;  2QGF B;  3VS1 A;  2E10 A;  3OSS C;  2FZC B;  4C92 C;  2EQI A;  5D7U A;  1ZSZ C;  3AHU A;  1S72 Q;  3CCL A;  1QP3 A;  2WSC E;  3EG1 A;  1D0Y A;  4EMH A;  2A28 A;  3UWN A;  4ZN1 A;  3BE3 A;  1S1N A;  2LX9 A;  1Q86 U;  5IHI A;  2M0O A;  2RK1 A;  2DA9 A;  2C0O A;  5GAN 7;  3CXC S;  4JLG A;  1WJR A;  1EFN A;  2YXY A;  3JCM c;  3I5S A;  2V8K A;  2MF2 A;  4DOW A;  2YLC A;  5LJ5 j;  2DVJ A;  1NEG A;  1NJI U;  4LDY A;  3NPF A;  2IG0 A;  3JB9 I;  2HQE A;  2XDB A;  2V26 A;  3IQL A;  4FT4 A;  2XU8 A;  1WJQ A;  3CC4 Q;  4PJO C;  1U5S A;  3M0U A;  1LNX A;  1FYN A;  4LUE A;  2I2L A;  2QEX A;  3ULR B;  1K8A C;  3HSB A;  2B8A A;  4GY5 A;  1SG5 A;  2DRK A;  2L0A A;  3CCJ Q;  1MV3 A;  1TG0 A;  2XHC A;  4LDV A;  1IRX A;  1K73 U;  3VYH B;  3G6E T;  5HY6 A;  2EKH A;  2KSS A;  5CR2 A;  2EGA A;  2CT3 A;  2PTK A;  3VS3 A;  5LJ3 e;  4JZ4 A;  3TU4 K;  3OW2 P;  1UJY A;  1V1C A;  2KYM A;  1AWW A;  1PKS A;  1QCO A;  1R77 A;  4MML A;  3HKS A;  1VYU A;  3A1P A;  2KBT A;  2D6F A;  4FIB A;  3CCL T;  1UGR B;  1YIT Q;  5AYF A;  4N0A A;  2OX7 A;  3V7S A;  2LZ6 B;  2NUP B;  1S72 A;  1C0M A;  4M78 C;  2QG9 B;  1MHN A;  2W10 A;  5LJ3 d;  1XOV A;  5CKF A;  2JUF A;  3A98 A;  3O5Z A;  3JB9 G;  1GBQ A;  1SHG A;  3I56 A;  1X2K A;  1E7O A;  2KEA A;  5FWB A;  2EBP A;  1YN8 A;  8AT1 B;  4J9G A;  2KDS A;  1AD5 A;  2K5L A;  3OYE A;  1B07 A;  1K76 A;  2IIM A;  5EG2 A;  1Q86 C;  4XTV A;  4JRP A;  2A7Y A;  3OBW A;  1K9A A;  1YFN A;  1OUL A;  2K3B A;  5KYU B;  3QBY A;  2HBW A;  2CSQ A;  4LDX A;  3LWH A;  1IRE B;  1VQL A;  4QVD A;  2MK5 A;  3OYJ A;  1CKB A;  1RAH B;  1M27 C;  4QQG A;  2X4Y A;  3NTH A;  2LMJ A;  2RQU A;  3EGD B;  1QVP A;  1QWE A;  2C06 A;  3BDU A;  3GBQ A;  1TU0 B;  4FW1 A;  3OS2 A;  5GMK h;  2DXT A;  4C8Q G;  1GL5 A;  2AKK A;  3OYI A;  4IUR A;  3V8L A;  4J9B A;  4WTO B;  2JN0 A;  1D0X A;  1PD0 A;  4X1V A;  1RAA B;  4HKE A;  3CEY A;  1Q86 R;  1WGS A;  1G3W A;  4GBQ A;  5IHK A;  3C4S A;  1K73 C;  1EX4 A;  3M4G A;  1WHJ A;  2D8J A;  5GAN 8;  3MO8 A;  2Z0W A;  1VQM Q;  4C0Z A;  2LJ1 A;  2PQW A;  1PRL C;  1B34 B;  1I07 A;  2DL5 A;  3H8Z A;  5KYW B;  2EGE A;  4RMO A;  1AWJ A;  2KT1 A;  2WSF E;  4ME7 A;  4M77 D;  1UHF A;  4C8Q B;  3JCM Q;  1JJ2 A;  4D6W A;  4ZTF A;  4QKU A;  1RI9 A;  5LJ3 j;  4Y92 A;  1E6H A;  2MPX C;  2RPN A;  4A4G A;  1OU8 A;  2YRC A;  2EGC A;  2L5Q A;  3M0P A;  1NLP C;  3FLG A;  3PE0 A;  2W0Z A;  1LCK A;  5KCO A;  4FYW B;  4NS5 A;  3QZ5 B;  1Q81 U;  1HK9 A;  5IHN A;  2QQA A;  1BCM A;  1Y57 A;  1TS9 A;  3OA6 A;  4FYY B;  3S6W A;  2K9G A;  2XDP A;  1XNI A;  2V1R A;  2EWN A;  2GFU A;  1VQN A;  1K73 R;  4M7D E;  5DM7 R;  1JJ2 S;  2DK3 A;  1TUC A;  3SEM A;  3I5R A;  2YDL A;  4LD9 K;  1H3Z A;  4JRI A;  1RUW A;  4XU3 A;  4XQ3 A;  3RER A;  2O4X B;  1RAD B;  3PGG A;  2FB7 A;  1WJS A;  3ER0 A;  5IH2 A;  1MMN A;  4EMG A;  3L2W A;  4C5E A;  2RI5 A;  3X20 B;  1T0H A;  4LNP A;  4M7D A;  4MDX A;  1TWB A;  3CC4 T;  2HSP A;  1NYF A;  2KK4 A;  5FWC A;  2DIG A;  3C94 A;  5I11 A;  2JW4 A;  4PL6 A;  1M4Z A;  5LJ3 f;  3CCJ T;  4ZN3 A;  1BYM A;  1D3B A;  3OB9 A;  2JXB A;  1BI2 A;  1WIE A;  1VQK Q;  5C0M A;  2VB6 A;  2LP5 A;  3X28 B;  2A36 A;  1FMK A;  2AT1 B;  2K5F A;  3MHX A;  1H64 1;  4J9C A;  1VQM A;  1VQ7 A;  2OJ2 A;  4R56 A;  3JCM g;  1AEY A;  1LVK A;  3ZL7 C;  3RKX A;  1VOM A;  1YIT T;  1IHW A;  2LJ0 A;  4JJC A;  4KGX B;  4EIK A;  1QVG A;  4EDU A;  4M4Z A;  3JCM e;  4JPB W;  4FYX B;  3RKW A;  5L23 A;  2QXF A;  1AVZ C;  3QYH B;  1H92 A;  1M3B A;  3CCV A;  3QO3 A;  4KGV B;  2DXC A;  1G3S A;  2MYS A;  2GQI A;  4PJJ A;  4XTW A;  3TVT A;  1E6G A;  5GAM g;  2DX1 A;  2YSQ A;  1SRL A;  1EIF A;  2RHI A;  3AT1 B;  1TUG B;  4HVW A;  5GAM e;  1VQ8 A;  1Q81 C;  4Z02 A;  4E7K A;  1Y71 A;  1OU9 A;  2C0T A;  4LDW A;  3L2U A;  1QVG S;  3JCM d;  1M90 U;  1D0Z A;  4OMO A;  3HL8 A;  5LL6 S;  2FPF A;  3H0F A;  1ZUY A;  3J80 E;  5J3B A;  3CC2 A;  5GAN 5;  3BW1 A;  2Y90 A;  2LCL A;  3PTA A;  2X3W D;  2H8H A;  3EG9 A;  2PUK B;  2DET A;  2X9H A;  5GAM d;  4JJD A;  2CSI A;  2DJZ A;  5KH6 A;  1WLP B;  1PG5 B;  1MGQ A;  5GAM h;  2D8H A;  4BDZ A;  1PSF A;  2CZ0 B;  1UJ0 A;  2DYB A;  3G1J A;  2DL7 A;  4L5G A;  3URG A;  4M7D F;  2M1H A;  2ZZD A;  3I55 Q;  2DJQ A;  3OY9 A;  2LTO A;  3MEV A;  1ZBJ A;  1AWX A;  4OML A;  2EQK A;  4HCC A;  5GAO n;  4JS4 A;  1MUZ A;  2RF0 A;  3THK A;  1X6G A;  3CBO A;  3M9Q A;  4ZGD B;  2JS2 A;  1WA7 A;  3EFS A;  1UB4 A;  4A4K A;  1JBM A;  2FPE A;  2YUQ A;  3HFO A;  2V1Q A;  2KQW A;  2DFU A;  1YJN Q;  2JZ2 A;  2DEQ A;  3P8H A;  2HMA A;  1KHI A;  2OTL A;  2FVU A;  1MND A;  2A0F B;  3G4S Q;  1Z9Q A;  2X3X D;  3JCM X;  4KH1 B;  4HCB A;  1M8M A;  4M7A E;  4RTZ A;  1M2O A;  4E7S A;  1VQ9 A;  2XDD A;  2L3P A;  3QZ9 B;  5GAN f;  2CDT A;  2QA4 Q;  2DZ9 A;  4C8Q C;  2KY9 A;  2JMA A;  2I0N A;  2FYK A;  2NUT A;  4C0F A;  2F2W A;  4A4H A;  3HRT A;  4C8Q E;  2HD0 A;  5KYX A;  4E7L A;  3EHQ A;  2CZ7 B;  2YT6 A;  2LDM A;  2HQX A;  3GNF B;  1CKA A;  1PNJ A;  4M7A A;  4Y28 E;  2XID A;  1R0B G;  2LQK A;  3CC7 A;  1M90 C;  3WXM B;  2PVO B;  3OW2 A;  5GAM j;  4KBM B;  1TH7 A;  2EKO A;  2K3Y A;  2QQB A;  2ZPF B;  2D9T A;  3LX7 A;  2KRO A;  4AMC A;  4AFQ C;  3MCA B;  1N6A A;  1R0C B;  3RR6 A;  3QXE B;  4B9W A;  4DOV A;  1ZHI A;  1NM7 A;  1YP5 A;  3UA7 A;  2KE9 A;  2PUO B;  3M59 A;  2COZ A;  4E47 A;  3OW2 S;  3JCM V;  3MEA A;  4MMK A;  1HD3 A;  2BE9 B;  5CCA A;  1VQK T;  2ECZ A;  2J7I A;  1KQS P;  3S3N A;  4KUD K;  4M7D G;  2QEX Q;  1FWZ A;  2XIC A;  2QTX A;  3MET A;  3JCM f;  3NGP A;  2BKD N;  2DKG A;  4GLM A;  3UPU A;  1QMC A;  1MMA A;  3CPW S;  1ABQ A;  1BKB A;  4WCI A;  2LQ8 A;  4X9D A;  2E6N A;  4CC2 A;  2E3I A;  3C0C A;  2DER A;  1YNZ A;  4C0D B;  4QT7 A;  4M78 D;  1V29 B;  2A08 A;  4ZGJ B;  2PVD B;  2RJC A;  1VQO T;  5KE3 A;  3BY7 A;  2P0K A;  4M7D B;  2QA4 A;  1K9M R;  1KIK A;  3JB9 F;  1Q95 G;  1Y0M A;  2HAX A;  4BUG A;  3TEE A;  2QGG A;  2CH4 W;  1FXX A;  2DIQ A;  4MZM A;  3CCS Q;  2FL7 A;  2MIO A;  1F1B B;  3OYL A;  4AG1 C;  1BCO A;  4XAX B; 
#chains in the Genus database with same CATH homology
 2KI7 A;  1OQK A;  1V76 A;  1PC0 A;  1TSF A;  2ZAE A;  1TS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...