1OQKA

Structure of mth11: a homologue of human rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
RHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved protein MTH11
publication title Structure of Mth11/Mth Rpp29, an essential protein subunit of archaeal and eukaryotic RNase P.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Hydrolase
total genus 6
structure length 78
sequence length 78
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1oqkA00
2ZAEA 1TS9A 1TSFA 1PC0A 1OQKA 2KI7A 1V76A
chains in the Genus database with same CATH superfamily
3FIFA 2BZ8A 1BB9A 1RADB 1UGSB 4EMGA 3QSUA 5ECAA 1ZBXA 5LJ3g 2EIFA 4M7DE 3JCMc 5LJ3f 1IXDA 4KT0E 5AT1B 3EFOB 2M02A 1YWPA 1JEGA 2ZGWA 3WXMB 4CC4B 3OS2A 3JCMJ 1FWZA 4Q5WA 4MDWA 5D6YA 3NMZC 4ZGJB 3E1SA 1H3ZA 1VIFA 1MGQA 3I56T 1U3OA 3JCMV 4EMHA 4PK4A 1QVFS 1WQWA 4F7UB 2PVGB 4EMKA 2DNUA 2R5MA 2WSFE 4ZTFA 3ME9A 5CVIA 5GMKl 2OTLA 3NPFA 1VQ5A 1UB4A 2PU9B 3LWHA 1D1BA 5GAOr 2DK3A 2M0YA 2NUTA 2QASA 2A28A 1YN8A 5J26A 4ATOA 3CCLA 4AFSC 1VQOQ 4C92F 8ATCB 4R56A 4J9EA 4C8QB 2J6OA 4C5HA 5GANf 5IT9E 5D6XA 4A53A 3R6OA 4PJOA 1XTDA 2HSPA 2K5IA 2XG8D 2E1HA 2XD0A 3P8HA 1SRMA 3VS3A 3PIPA 1U8RA 3CC2Q 2VB6A 2DJQA 2YXYA 1VQ5T 3TSZA 2JM8A 5FLXE 4WTOB 2YUPA 1AWWA 3G4SA 2L3QA 4CRIA 2LMJA 1N6AA 3RKYA 2DZ9A 2FEIA 2DTIA 4M7AB 1SF9A 1UHFA 1NM7A 2D1XA 3JCMd 3OYKA 2CSIA 2DL3A 4M77F 3G4ST 4PFOA 2ED1A 3QG1A 3EAEA 4C92G 1M2VA 1KD1U 5J3BA 4KH1B 4DEXA 3CCEA 2LX9A 3FJPA 4FT2A 2L3SA 4LDVA 1UTIA 2XU8A 2EWNA 3GBQA 3JB9I 4D8DA 1M1KC 2GCXA 2EQMA 2JN0A 2DEUA 3M55A 4BE1A 1M3CA 1N27A 1ZA1B 2D0NA 2D6FA 2NUPA 2EYWA 4QKUA 1SSHA 2V8KA 3OS5A 4X9DA 1KC8U 1PG5B 2RD1A 1VQNQ 1QCOA 1KD1R 2ESWA 1MMGA 2DIQA 1QWEA 4PKCC 4M77C 5C6SA 4HVUA 4M75F 2X35A 1GL5A 4M77G 3LLRA 1BCMA 3CCVQ 3OW2S 2RHYA 4RKUE 3L2RA 2CUDA 3EGDB 2CP7A 1D0XA 3OBWA 1YITQ 2GFUA 3CCMA 1KC8R 3SD4A 2QI2A 3P8BB 3WVEB 3S3NA 5KE3A 3VRZA 3GNGA 5FWCA 4M7DA 1U06A 4LD9K 5L23A 5KYWB 3MEAA 1JJ2P 3CMET 4QQGA 3CD6Q 5GAMd 1JRIA 5CQYA 3OYMA 5FU7C 3CCMT 4XTZA 4Z02A 5LJ3e 2JZ2A 4M75C 2GNCA 2HL5C 1QVGA 3LX7A 4PL6A 2D8JA 4LDXA 2KDSA 2DO3A 4ZGDB 4M75G 4NOYA 3DKMA 1Y7XA 2KMTA 3VYHB 1AZEA 3FEOA 3VS2A 1Q86U 1BI2A 2WSEE 1TOVA 3OYDA 3A8OB 4IURA 1W6XA 5GAN3 3EG1A 3H0IA 3JCMf 3CMAA 3UDCA 4XTXA 3I56Q 4GLMA 4C0FA 1ZUUA 2RK1A 2VWFA 3M0QA 2CP0A 1W4SA 3MP8A 1BYMA 3HP9A 3X26B 3CCJA 1OYXA 3QDFA 1Q86R 3CXCA 3UPUA 3M0PA 3JB9J 4LDUA 1SPKA 3CMAT 4PJLA 1FYNA 1TSFA 1Q95G 1OX8A 1X27A 2LJ3A 3CBOA 5CQXA 2ZAEA 4MMLA 3JB9G 2J06A 5CAIA 1YCYA 5GAN6 2V26A 4PLLA 2LJ1A 5GMKh 3E19A 3CCJT 2I0NA 2KI7A 2KRSA 2VYTA 1MMDA 3FJ5A 2YRDA 3M0UA 1UDLA 4LN2A 1X6OA 1OU9A 1PKSA 1M3BA 3A5ZB 4DEYA 4EIKA 1TS9A 5KH6A 3JAME 4HKEA 3SWNA 2P0KA 2BUDA 4OMOA 5DLOA 1VQKQ 2O4XA 1WIEA 3MO8A 2R57A 2PZ1A 3G6EA 4PFZA 4JDSA 3OYLA 2G3RA 2E3IA 2RQVA 1BBZA 1LOJA 1CKAA 3OYBA 3BY7A 3IQLA 2KRNA 1S72A 1GCQC 3JRZA 4PJOC 1YHQQ 4JRQA 2X3XD 3LYIA 5I21A 4RTXA 2K9GA 2KEAA 4L5GA 1ZSZC 3EG3A 3SEMA 1JO8A 2SEMA 1UGPB 1VQ8Q 3G71A 1QVFA 5GAMf 4AFUC 2HQHA 3G6ET 1WHLA 4Y92A 3CCSA 1K73R 3TREA 2L89A 1S72T 2ZPBB 2RI2A 3EGUA 1ZSGA 1RI0A 4JRPA 1E7OA 2QAZA 2LQWA 3J81E 1YNZA 2JTEA 2EYQA 2LVMA 2RHZA 4OP0A 1WPYA 2EW3A 2AKKA 1M1GA 4AFZC 4KRTA 2ENMA 3EGXA 3CCST 3BFMA 4J6YA 1TTHB 4RG8A 2QGGA 4OB3B 3OYHA 2LNHB 3OY9A 3AHUA 4A54A 3JCMX 5I11A 2V1QA 2RPNA 3CC7Q 1G5VA 1MNEA 4EPCA 2MIOA 2CH4A 4IUTA 1VQ9Q 4IKFA 1JBMA 3EG9B 3CBMA 1VQ6Q 1PRLC 3TQ7P 3CCRQ 1LPLA 2KROA 5GMKm 4JJNK 1OI1A 2K7AA 2DFUA 1OEBA 4DA4A 2JNGA 2EYXA 4OMPA 3VV0A 1B07A 2CKKA 1W2BP 3CC2A 2HQXA 3PVQA 4D8KA 3OMCA 1M90C 2EBPA 2DLPA 4XTUA 1ZBJA 2O88A 1SHGA 3M59A 1VQOT 4PJOD 2DXTA 1H641 1WDXA 1YP5A 3ZEHA 3MJXA 2J05A 1JB0E 2K79A 1IGQA 1WI7A 1X01A 5I2SA 3CC2T 1VYUA 1VQ7Q 2O31A 3OW2A 2FB7A 1IHVA 4ZGEB 2K4YA 1N8RR 1WZOA 2K57A 1JJ2S 2YLCA 3I5RA 3META 4F14A 2CZ0B 2VC8A 4N4IA 1G3WA 1MMAA 4PJOE 4FM4B 1E6HA 1B34A 2QQRA 3A98A 3X28B 3OYFA 3M0RA 1EX4A 1RLPC 2Y4YA 1UGQB 1I5OB 4M77A 2P4TA 4QW2A 4E2FB 4M7DB 2B8AA 3EH2A 4JJCA 3QZ5B 1WQ7A 3GOXA 3KUFA 3L2UA 5D6WA 3MEUA 1K0SA 4HCZA 5GAOp 1OPKA 2L0AA 4MZPA 4F17A 3CCVA 1T0JA 3HRUA 4M78G 1K9AA 2HSEB 5DM7R 3S3OA 1YITA 1VQNT 2IG0A 2CZ1B 3VS0A 1KQSP 2KT1A 1YJWA 2YHTA 2LQ8A 2FHDA 4M75A 1N9RA 2YWWA 3M56A 1WHJA 1NLOC 2KNBB 1UEBA 2QK0A 4M78B 3CCVT 3CD6A 4F7UF 3G1JA 6AT1B 1YITT 1AZGB 2H3EB 1PD0A 1NYGA 1X75C 3Q1JA 1I0CA 5I22A 2FPEA 1UJYA 2M0OA 4XTWA 1I8FA 1G83A 2QQSA 1VOMA 3G7ZA 1QMCA 3OMGA 4J9BA 1UFFA 3QWXX 2JJ9A 1X43A 1PSEA 1Q82R 5KYUB 2P84A 2ZZDA 4C8QF 3QDRB 3CD6T 3PE0A 4N0AC 3RUXA 2ROLA 1UE9A 3J80E 3CCQQ 2JUFA 5GAN5 2EQIA 3RMSA 1QCFA 2IVWA 2RJDA 2F2XA 3JCMQ 3I9QA 3FC3A 5GMKe 3I56A 1KIKA 4X34A 1FMKA 4KULA 4XU0A 3REBB 1QQJA 1E6GA 2RN8A 1RI9A 4F7UG 1Y96A 1ZUYA 1MMNA 4M7AF 4ZN3A 2GFAA 1V76A 1Q7YU 2YT6A 2DBMA 3H0HA 3VUBA 1BI1A 4NL3A 4BDZA 3CPWP 4J8OA 5CKBA 2KAFA 4C8QG 2JOYA 1N9SA 2HBWA 4FL6A 2AIRB 4C5IA 2AZVA 4JRKA 3MEWA 3OYIA 1WXUA 1KQ2A 1NJIU 5A0DA 1YJNQ 2E3HA 4PFPA 2EJFA 4BUGA 2JTMA 1Q7YR 4HT9A 2YUOA 1BKBA 5IHKA 2LCSA 2ZPEB 5GANg 2A36A 4QT7A 5FU6B 1GCQA 4ZTJA 1VQKA 1QCNA 2I2LA 1NEBA 1ZSZA 4OB2B 4M7AG 4KBMB 3PNWC 4IUQA 4Z8AA 4JLIA 3QPHA 4Z89A 2QXFA 2VGMA 4A4FA 2ZPIB 3TCJA 1ABQA 1NJIR 4C0GA 4GBQA 1MV3A 2BKDN 1YHQA 4BI4A 2A3LA 1KSWA 3QBYA 3OS0A 5GAOq 1VQKT 1VQ8A 4ORZA 1D0ZA 3GP8A 1D1CA 3F70A 2DRMA 4HXJA 3A8MB 1I4K1 1QLYA 2MPXC 2DPPB 2MK5A 4LNPA 4C92C 1W2BS 2F69A 4DQ2A 1IZ6A 2CUBA 4HA8A 5CIUA 1YHQT 3HFNA 4RTTA 3JCMh 1GXIE 2H3JA 2FZCB 3EG0A 5IXFA 1M1KR 1VQ8T 4XTVA 2O9SA 3SHWA 2E4HA 2DF6A 2RHIA 2J7IA 5A0GA 1QKWA 4ANJA 2CDTA 2KSSA 2SRCA 3VKIA 4KGXB 4J7FA 1H3HA 1VYVA 2M1HA 3UT1A 5GJVB 1IGUA 3FDRA 1WJRA 1NBEB 2CGHA 2V1RA 3CC7A 1XNIA 1D09B 2MCNA 4E7JA 2HKQB 2QA4Q 4C0ZA 1SEMA 1WLPB 2VXEA 1VQ9A 4OMFB 3RKXA 3OBYA 2LT1A 1ZQ1A 1RL2A 4J9FA 3CMEA 3CCRA 1JJ2A 1K0XA 4F04B 4FSXA 2C06A 3CQTA 2L3PA 3EG2A 1X6BA 5LJ3j 1LJOA 2FVUA 3CC7T 2RJEA 4XQ3A 2DL8A 1QKXA 4FYVB 3BDLA 2OJ2A 5CKEA 1KD1C 3QZ9B 4QVDA 2OX7A 1VQ9T 1RABB 1EIFA 2EVRA 1QW1A 1VQ6T 4JS4A 3I5SA 3CCRT 2KVQG 4FIBA 4TVRA 5M9OA 4P5NA 2R58A 1KG1A 2CT4A 4C0DB 1QVPA 4YTLA 2PTKA 1NZ9A 5GAMh 3BW1A 3RNJA 2GTOA 1KC8C 2FPDA 2F5TX 4DBHA 1KQSS 3OYJA 1GBQA 4FYWB 2ZCFB 2FZKB 3JB9F 1OU8A 2A08A 4GY5A 3CCUQ 1VQ7A 2AT1B 2JT4A 5GANj 2BE9B 2P4RA 3LH5A 1OOTA 1V1CA 5CK9A 5KYYB 3A8HB 1SRLA 2DKGA 2F1LA 4C92D 1IREB 3JCMg 4OMQA 1YJ9T 5LL6S 3C4SA 3OB9A 5DY9A 2E65A 1VQ7T 1F1BB 2YRCA 1NG2A 1FXXA 1Y57A 1I81A 1OZ3A 1QP3A 2HL3A 3LH0A 3ZBDA 5GANe 3TSWA 2MWOA 5LJ5d 4WF2A 1R0CB 4J9IA 3KXTA 4C92E 4X1VA 2JW4A 2YUNA 5CO7A 4AFQC 4AG1C 3EFRA 1K9MR 1U5SA 5LJ5h 2EGCA 2LP5A 4E7SA 2LDMA 1W70A 4XU1A 4M77D 4AT1B 2HMAA 5KCHA 1JXOA 1JXMA 4BDYA 3RESA 1PM3A 2KT8A 1Q86C 3O8VA 3E9FA 2A37A 1G3YA 4ZN1A 4BE0A 1X6GA 4QVZA 1K8AU 4IIOA 4J9GA 2CS7A 1WJSA 2OTLQ 4AG2C 3CPWS 2DXUA 2HEQA 1K73U 4JJBA 3A1PA 1WHMA 3NTHA 4M77E 2RMOA 1PD1A 2FPFA 2CH4W 5DLQE 3PFSA 1RAEB 3CCLQ 2H8HA 4N0AA 4DOVA 4WCIA 2RO0A 4E7IA 1JQQA 5FW9A 5GAMg 4M75D 3HL8A 2BZXA 2DMOA 1K8AR 4E7KA 3M57A 4RG2A 1VQLQ 3RDVA 4F7UA 1UUEA 2CT3A 1YBYA 4JZ4A 3KFVA 4EMKB 1Q81U 2DA9A 2RQUA 2EJ9A 1M9SA 3UATA 4J6WA 5FWBA 2ABLA 2NUTB 4M75E 1CKBA 2EJGA 1UECA 1VUBA 1HJDA 3VS1A 2PUKB 2HCKA 1NEGA 4PJOB 1K73C 5KYXA 3CCQT 3CCEQ 4QQDA 4OMMA 2DX1A 4QQ6A 2K6DA 2A7YA 1Q81R 2V8JA 4LUEA 3QO3A 3JCMP 2CZ6B 1ABOA 2IIMA 2YSQA 5LJ5f 2PVDB 4JUVA 1W2BA 5FRNA 2CREA 1M4ZA 2WACA 1YJNA 1WX6A 2HDAA 2CSQA 3H41A 2NUZA 4PJMA 1NE8A 3LGLA 1VQOA 4PLIA 3MEVA 4M7DF 4IUUA 4EDUA 1GRIA 3FRNA 2JMAA 2JTFA 4E7LA 2AZSA 2JS0A 4JPBW 4OVAA 1IO6A 1M2VB 3THKA 2MWPA 4Y91A 4BY6B 3VUZA 4LE9A 3HPWA 3JCMe 1N8RU 3C94A 3J7AF 2RQRA 2XMFA 1YJNT 4CC7A 1PNJA 1X2QA 4PJNA 3NTIA 3M53A 4HCCA 1ARKA 2VV5A 2YRVA 4C92A 2NUPB 2XK0A 3MHXA 1KFZA 2QTXA 1YJ9Q 2GF7A 3RR6A 2EFIA 4NL2A 1TXQA 1TUGB 1YWOA 1YIJQ 1TH7A 2KQWA 3HSBA 3O5ZA 2DL7A 3ER0A 4XK8E 5CKFA 1MHNA 1WFWA 1WHKA 4A4KA 1UG1A 2Z0WA 4M78F 1ZUKA 4M7DG 5HKCA 3EGDA 1R77A 1WJQA 2EKOA 3V8JA 5GAOl 4B9WA 3GF5A 4LDYA 1TG0A 1GCPA 1IB8A 2K5FA 2MYSA 5FRMA 2LRQA 2L3RA 5LJ3d 3UA7A 3BDUA 2DILA 1X2KA 5KYWA 2FYKA 4DBFA 1VQNA 1BK2A 4KUDK 1OV3A 1I1JA 2CZ7B 3REAB 1KQSA 1W1FA 2ROTA 3QYGB 2W10A 4M78C 1OX9A 3T9NA 8AT1B 3L1AA 2LCCA 1HK9A 3CC4Q 1M5Q1 5GAMe 4BACA 2P0PA 3DLMA 3L2VA 3OYNA 5EG2A 5HCKA 5CR2A 5KE2A 3PVLA 2DD4A 1ZA2B 1WGSA 2FRWA 4J5YA 2QA4T 2GGRA 1R0BG 1VQPQ 1Q82U 1P92A 2RQTA 2X3WD 1M8VA 2RI3A 2JS2A 1VQMQ 1H92A 2EGAA 2E64A 2GBQA 4JZ3A 2QQ9A 1SG5A 2HD0A 4OMLA 1J3TA 4MZMA 2KY9A 2RJFA 2P0QA 1WXBA 5GMKj 4M4ZA 2XICA 1NLPC 2F2WA 1RAGB 2K5LA 2COYA 1CSKA 1TUDA 3CCUA 3QYHB 3ZFJA 2M51A 3TU4K 4JS5A 1D3BA 3HRTA 2E6NA 3L42A 3G71Q 2LCLA 2K3BA 2CP3A 2DE0X 2PUOB 2HNIA 3EHRA 2E5QA 4BI8B 2MOXA 2LQNA 3R6NA 2ZPGB 5D7UA 5L8RE 3CPWA 1WHGA 2HZYA 3SWNB 3JV3A 4FT4A 5GAN8 3CCUT 1ZX6A 2BE7D 2O4XB 1Q82C 4J9DA 2O2OA 3RKWA 3NTKA 1AVZC 1XJWB 2R5AA 2RA2A 4HCBA 2RJCA 5FU6C 2EYYA 5J39A 4C8QC 4RUGA 2MMPA 2NWMA 2Y4XA 2LX7A 4F16A 3VS7A 1OQKA 1K1ZA 2DJZA 3PIOA 3HFOA 1LCKA 4J9CA 3VU3C 4KUIA 2V8IA 4M78D 3I35A 1JU5C 2LQKA 2E5KA 2G6FX 2C0IA 4B6MA 4CI0C 2BIVA 2MAMA 1U1SA 2COWA 4OB0B 4M7AC 2KE9A 5HK0A 4A4GA 2X4JA 3VS6A 1MUZA 3VRYA 2DIGA 2DXBA 2KXCA 2LNVA 2L8DA 2CP6A 4RTZA 2XI9A 3QUIA 2DYIA 3MPUB 1XOVA 4XTYA 3NFCA 2DERA 3EGXB 2OAUA 4M78E 1M1KU 9ATCB 3QIIA 1BIBA 4MZTA 1BI0A 1Q7YC 1IHWA 1S1NA 2VUBA 3OSVA 1KHIA 5KYXB 3I55Q 3DB4A 4OB1B 2OTLT 4LD6A 3GIBA 1PC0A 2DZCA 2W0ZA 3TEEA 2Y90A 1D0YA 1VQLA 2M9UA 1HXDA 2X4WA 2FRYA 1FX7A 2VKNA 3CCLT 2KXDA 1H8KA 3EG9A 5AYFA 2ED0A 4LDWA 3M54A 1NJIC 2QQBA 2AKLA 3P8DA 3FB9A 2D0QB 2E10A 5KYNA 2HBPA 4KGZB 1M30A 1I5LA 4X9CA 1AD5A 2A0FB 3SB2A 3URGA 2D8HA 3RMQA 1VQLT 1AWJA 2JXBA 1LVKA 1NPRA 4ZNXA 3VS4A 2F2VA 1PHTA 2QYZA 2DYBA 1VQ4Q 3FLGA 4BB7A 3C0CA 3JCMb 3PGGA 1K76A 4E7ZA 1BIAA 4OF1A 2K2VA 1HD3A 2DRKA 1PCXA 2K3YA 2ZPHB 1AHJB 1HYOA 1RAAB 3PT9A 4C8QD 1G3TA 3INZA 3DB3A 3BE3A 2RF0A 4IUVA 1RAIB 2HAXA 4C92B 2O01E 4C5GA 4F7UE 5CKDA 1VQ6A 1PWTA 3JSCA 3CCET 1AEYA 3MP6A 3C95A 3ULRB 4C0DC 2QEXQ 2BZYA 1EZZB 1PKTA 1SHFA 4LUDA 4AMCA 5FROA 2QGFB 2OTJQ 1B3QA 4N4HA 1YI2Q 2KGTA 2LT4A 2YUQA 1RACB 3ZL7C 1RAFB 5GAN7 5GAN2 3S6WA 2E41A 1V29B 5GAOn 4FSSA 4M7AD 3OYAA 4C8QE 4J6XA 2DL4A 1WXTA 4Z88A 4O5VA 1B34B 2EQKA 2EQJA 2LJ0A 1YJWQ 2BTTA 4R0KA 2ATCB 4M77B 4RTUA 1YJ9A 3NGPA 4RCBA 1MV0B 2GTJA 2RI5A 4A4EA 7AT1B 4M7AE 3VYGA 3LGFA 1YIJA 3C12A 3QJYA 1BCOA 2O9VA 3OSSC 1N5ZA 5IXBA 1KK7A 3M58A 3OS1A 2K2MA 2X4YA 1K9MU 4ESRA 2YLBA 2E6ZA 3X20B 3QWYA 1AWOA 3OYGA 3UA6A 1RUWA 2PQWA 2QTVA 1VIEA 3L2ZA 1YIJT 1R8OB 1BU1A 5GAOm 4QVCA 2COZA 2EAYA 2C0OA 4DBRA 5FU7B 1OPLA 1QVGP 2VXFA 2VGNA 4M75B 2QDYB 4NS5A 4J7IA 4E7HA 3UWNA 4M78A 1K4US 4JLGA 1A0NB 1C1AA 4BD3A 4XU2A 4CC3A 3S3MA 2KBTA 1UHCA 3L2WA 2RB6A 1M1FA 5IH2A 3H0FA 3AT1B 3JCMW 2X9HA 5KYUA 3CC4A 3SDZA 1G2BA 1RAHB 4PJOF 3GPLA 1YCSB 2X4XA 3VJPA 2RH2A 1D3BB 2PVOB 1WA7A 4J83A 4R55A 3CXCP 1K9MC 4D6WA 1VQPA 1VQ5Q 2K3XA 2X51A 2DVEA 3V7CA 1AOJA 2RHXA 3TVTA 3UF4A 3M0TA 5IN1A 1VQMA 3H9NA 3CC4T 1EFNA 1LNXA 1UGVA 3EFOA 1O9SA 4CC2A 4EMKC 1T0HA 4Y28E 4E47A 4HT8A 2MF2A 1Y96B 4OGCA 4DBQA 4BE2A 3EHQA 4HVVA 1GFCA 3MCAB 2QQAA 5IHNA 2ZPFB 3KBGA 1VQPT 5I2MA 4OGEA 2D9TA 5HY6A 1I07A 3MKDA 2F5KA 4FCYA 1VQMT 2DEQA 4PJJA 3G4SQ 2KRMA 2DBKA 2J6KA 1KJWA 3CCQA 1PRMC 1VYTA 4PJOG 4XU3A 2GQIA 2XDBA 2OI3A 2J6FA 1GFDA 2DD5A 1OULA 3H8ZA 4N4GA 4ELYC 5KCOA 2AK5A 3CBPA 3MP1A 4J9HA 2JM9A 3RIRA 3HRSA 2HQEA 2LC4A 1UGRB 2KYMA 1K8AC 4C8QA 3WVDB 3A8GB 1QWFA 2KK4A 2XHCA 1ZSZB 3G71T 1QVFP 2ECZA 1Y71A 4RCCA 2RHUA 3HKSA 1NYFA 3N5BB 3JB9D 2IPOB 4IIMA 5LJ5g 1M90U 4L6V5 4BY6C 3LWIA 2KYBA 4M7AA 2XIDA 2VASA 1D1AA 1G8XA 1KHCA 4VUBA 3LW5E 4ME7A 4KGVB 1Z9QA 2DTOA 4RTVA 5IAYA 1TUCA 4A4HA 1Q81C 1UJ0A 1WYXA 4FU6A 2DTHA 2L2PA 4RTWA 4JJDA 4HCKA 4RMOA 4E6RA 5GMKi 4IUPA 3CMEQ 3NHNA 1M90R 2FZGB 2DL5A 1TU0B 3M4YA 4L59A 3OYCA 2DETA 1DJ7B 2E70A 3CCMQ 4JRIA 4V2SA 1M2OA 1IRXA 2JVVA 4RTYA 2L5QA 5C0MA 3M0SA 3RBBB 4K11A 1B7TA 1M8MA 2C0TA 3I55A 1Y0MA 1WNLA 3OYYA 4DOWA 2EGEA 4XAXB 5GAN4 4A63B 3L2QA 2XDPA 3D7SB 5A2QE 3V7RA 2PNIA 2QG9B 3CPFA 3SFMA 1ZHIA 4M7DC 1AWXA 4GLKA 3PMIA 2NLUA 3QKJA 4PNOA 4OMNA 1C0MA 3GLXA 1XQHA 3HTRA 3I55T 2MI6A 3EFSA 5A0LA 1Z9ZA 4FYYB 4LXCA 1ACMB 3M9QA 2KR3A 3E9GA 1HSQA 2EPDA 3M5AA 2RQWA 5GAMj 3CEYA 3HHTB 5HK3A 2EYZA 3CMAQ 2CP2A 1T3LA 1N8RC 2EKHA 1VQ4A 5LJ3h 4KH0B 1VA7A 1TWBA 2WSCE 3OW2P 3CCJQ 2QA4A 1OZ2A 2FG0A 3U23A 1KQ1A 1O75A 4MDXA 1ZLMA 1WHHA 3A8LB 4ELZC 2LTOA 3JB9H 3M4GA 1PSFA 1T3SA 3V8LA 1FMVA 1NPPA 2YDLA 1RLQC 1VQ4T 5CKHA 3QJ6A 5CCAA 2QEXA 1QVGS 2JMCA 2OTJA 2LZ6B 1GBRA 5KYYA 1M27C 1YI2A 2E12A 2FL7A 1G3SA 1C6VX 4C5EA 5GANd 3ASKA 4HVWA 3OA6A 4FYXB 3PMTA 3V8KA 3RERA 2AHJB 1SKUB 5EC7A 3X25B 3OYEA 2RM4A 3EH1A 5GANh 2QEXT 2CP5A 2RK2A 4FW2A 2EQUA 4BI3A 5LJ5j 2OTJT 4MMKA 3V7SA 3G6EQ 1YI2T 2CYZB 2GQVA 3DLLA 1BI3A 1AT1B 2RNAA 3E2UA 1MNDA 1SSFA 3SWNC 4O6JA 1S72Q 2DM1A 2VVKA 3VS5A 3OQ5A 2NYSA 3CXCS 1X69A 5IHIA 4UC4A 2XKOC 1YJWT 5GJWB 3X24B 1U1TA 3PTAA 3QHSA 3QXEB 1YFNA 5LJ5e 4M7DD 2XDDA 4FW1A 1QP2A 2OAWA 2DXCA 4II1A 3H6ZA 2QDLA 4B9XA 1FMWA 2DVJA 3CCSQ 2FO0A 1Y07A 2M16A 2B86A 2DAQA 2HKNA 3GNFB 1M3AA
chains in the Genus database with same CATH topology
2ZAEA 1TS9A 1TSFA 1PC0A 1OQKA 2KI7A 1V76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAE A;  1TS9 A;  1TSF A;  1PC0 A;  1OQK A;  2KI7 A;  1V76 A; 
#chains in the Genus database with same CATH topology
 3FIF A;  2BZ8 A;  1BB9 A;  1RAD B;  1UGS B;  4EMG A;  3QSU A;  5ECA A;  1ZBX A;  5LJ3 g;  2EIF A;  4M7D E;  3JCM c;  5LJ3 f;  1IXD A;  4KT0 E;  5AT1 B;  3EFO B;  2M02 A;  1YWP A;  1JEG A;  2ZGW A;  3WXM B;  4CC4 B;  3OS2 A;  3JCM J;  1FWZ A;  4Q5W A;  4MDW A;  5D6Y A;  3NMZ C;  4ZGJ B;  3E1S A;  1H3Z A;  1VIF A;  1MGQ A;  3I56 T;  1U3O A;  3JCM V;  4EMH A;  4PK4 A;  1QVF S;  1WQW A;  4F7U B;  2PVG B;  4EMK A;  2DNU A;  2R5M A;  2WSF E;  4ZTF A;  3ME9 A;  5CVI A;  5GMK l;  2OTL A;  3NPF A;  1VQ5 A;  1UB4 A;  2PU9 B;  3LWH A;  1D1B A;  5GAO r;  2DK3 A;  2M0Y A;  2NUT A;  2QAS A;  2A28 A;  1YN8 A;  5J26 A;  4ATO A;  3CCL A;  4AFS C;  1VQO Q;  4C92 F;  8ATC B;  4R56 A;  4J9E A;  4C8Q B;  2J6O A;  4C5H A;  5GAN f;  5IT9 E;  5D6X A;  4A53 A;  3R6O A;  4PJO A;  1XTD A;  2HSP A;  2K5I A;  2XG8 D;  2E1H A;  2XD0 A;  3P8H A;  1SRM A;  3VS3 A;  3PIP A;  1U8R A;  3CC2 Q;  2VB6 A;  2DJQ A;  2YXY A;  1VQ5 T;  3TSZ A;  2JM8 A;  5FLX E;  4WTO B;  2YUP A;  1AWW A;  3G4S A;  2L3Q A;  4CRI A;  2LMJ A;  1N6A A;  3RKY A;  2DZ9 A;  2FEI A;  2DTI A;  4M7A B;  1SF9 A;  1UHF A;  1NM7 A;  2D1X A;  3JCM d;  3OYK A;  2CSI A;  2DL3 A;  4M77 F;  3G4S T;  4PFO A;  2ED1 A;  3QG1 A;  3EAE A;  4C92 G;  1M2V A;  1KD1 U;  5J3B A;  4KH1 B;  4DEX A;  3CCE A;  2LX9 A;  3FJP A;  4FT2 A;  2L3S A;  4LDV A;  1UTI A;  2XU8 A;  2EWN A;  3GBQ A;  3JB9 I;  4D8D A;  1M1K C;  2GCX A;  2EQM A;  2JN0 A;  2DEU A;  3M55 A;  4BE1 A;  1M3C A;  1N27 A;  1ZA1 B;  2D0N A;  2D6F A;  2NUP A;  2EYW A;  4QKU A;  1SSH A;  2V8K A;  3OS5 A;  4X9D A;  1KC8 U;  1PG5 B;  2RD1 A;  1VQN Q;  1QCO A;  1KD1 R;  2ESW A;  1MMG A;  2DIQ A;  1QWE A;  4PKC C;  4M77 C;  5C6S A;  4HVU A;  4M75 F;  2X35 A;  1GL5 A;  4M77 G;  3LLR A;  1BCM A;  3CCV Q;  3OW2 S;  2RHY A;  4RKU E;  3L2R A;  2CUD A;  3EGD B;  2CP7 A;  1D0X A;  3OBW A;  1YIT Q;  2GFU A;  3CCM A;  1KC8 R;  3SD4 A;  2QI2 A;  3P8B B;  3WVE B;  3S3N A;  5KE3 A;  3VRZ A;  3GNG A;  5FWC A;  4M7D A;  1U06 A;  4LD9 K;  5L23 A;  5KYW B;  3MEA A;  1JJ2 P;  3CME T;  4QQG A;  3CD6 Q;  5GAM d;  1JRI A;  5CQY A;  3OYM A;  5FU7 C;  3CCM T;  4XTZ A;  4Z02 A;  5LJ3 e;  2JZ2 A;  4M75 C;  2GNC A;  2HL5 C;  1QVG A;  3LX7 A;  4PL6 A;  2D8J A;  4LDX A;  2KDS A;  2DO3 A;  4ZGD B;  4M75 G;  4NOY A;  3DKM A;  1Y7X A;  2KMT A;  3VYH B;  1AZE A;  3FEO A;  3VS2 A;  1Q86 U;  1BI2 A;  2WSE E;  1TOV A;  3OYD A;  3A8O B;  4IUR A;  1W6X A;  5GAN 3;  3EG1 A;  3H0I A;  3JCM f;  3CMA A;  3UDC A;  4XTX A;  3I56 Q;  4GLM A;  4C0F A;  1ZUU A;  2RK1 A;  2VWF A;  3M0Q A;  2CP0 A;  1W4S A;  3MP8 A;  1BYM A;  3HP9 A;  3X26 B;  3CCJ A;  1OYX A;  3QDF A;  1Q86 R;  3CXC A;  3UPU A;  3M0P A;  3JB9 J;  4LDU A;  1SPK A;  3CMA T;  4PJL A;  1FYN A;  1TSF A;  1Q95 G;  1OX8 A;  1X27 A;  2LJ3 A;  3CBO A;  5CQX A;  2ZAE A;  4MML A;  3JB9 G;  2J06 A;  5CAI A;  1YCY A;  5GAN 6;  2V26 A;  4PLL A;  2LJ1 A;  5GMK h;  3E19 A;  3CCJ T;  2I0N A;  2KI7 A;  2KRS A;  2VYT A;  1MMD A;  3FJ5 A;  2YRD A;  3M0U A;  1UDL A;  4LN2 A;  1X6O A;  1OU9 A;  1PKS A;  1M3B A;  3A5Z B;  4DEY A;  4EIK A;  1TS9 A;  5KH6 A;  3JAM E;  4HKE A;  3SWN A;  2P0K A;  2BUD A;  4OMO A;  5DLO A;  1VQK Q;  2O4X A;  1WIE A;  3MO8 A;  2R57 A;  2PZ1 A;  3G6E A;  4PFZ A;  4JDS A;  3OYL A;  2G3R A;  2E3I A;  2RQV A;  1BBZ A;  1LOJ A;  1CKA A;  3OYB A;  3BY7 A;  3IQL A;  2KRN A;  1S72 A;  1GCQ C;  3JRZ A;  4PJO C;  1YHQ Q;  4JRQ A;  2X3X D;  3LYI A;  5I21 A;  4RTX A;  2K9G A;  2KEA A;  4L5G A;  1ZSZ C;  3EG3 A;  3SEM A;  1JO8 A;  2SEM A;  1UGP B;  1VQ8 Q;  3G71 A;  1QVF A;  5GAM f;  4AFU C;  2HQH A;  3G6E T;  1WHL A;  4Y92 A;  3CCS A;  1K73 R;  3TRE A;  2L89 A;  1S72 T;  2ZPB B;  2RI2 A;  3EGU A;  1ZSG A;  1RI0 A;  4JRP A;  1E7O A;  2QAZ A;  2LQW A;  3J81 E;  1YNZ A;  2JTE A;  2EYQ A;  2LVM A;  2RHZ A;  4OP0 A;  1WPY A;  2EW3 A;  2AKK A;  1M1G A;  4AFZ C;  4KRT A;  2ENM A;  3EGX A;  3CCS T;  3BFM A;  4J6Y A;  1TTH B;  4RG8 A;  2QGG A;  4OB3 B;  3OYH A;  2LNH B;  3OY9 A;  3AHU A;  4A54 A;  3JCM X;  5I11 A;  2V1Q A;  2RPN A;  3CC7 Q;  1G5V A;  1MNE A;  4EPC A;  2MIO A;  2CH4 A;  4IUT A;  1VQ9 Q;  4IKF A;  1JBM A;  3EG9 B;  3CBM A;  1VQ6 Q;  1PRL C;  3TQ7 P;  3CCR Q;  1LPL A;  2KRO A;  5GMK m;  4JJN K;  1OI1 A;  2K7A A;  2DFU A;  1OEB A;  4DA4 A;  2JNG A;  2EYX A;  4OMP A;  3VV0 A;  1B07 A;  2CKK A;  1W2B P;  3CC2 A;  2HQX A;  3PVQ A;  4D8K A;  3OMC A;  1M90 C;  2EBP A;  2DLP A;  4XTU A;  1ZBJ A;  2O88 A;  1SHG A;  3M59 A;  1VQO T;  4PJO D;  2DXT A;  1H64 1;  1WDX A;  1YP5 A;  3ZEH A;  3MJX A;  2J05 A;  1JB0 E;  2K79 A;  1IGQ A;  1WI7 A;  1X01 A;  5I2S A;  3CC2 T;  1VYU A;  1VQ7 Q;  2O31 A;  3OW2 A;  2FB7 A;  1IHV A;  4ZGE B;  2K4Y A;  1N8R R;  1WZO A;  2K57 A;  1JJ2 S;  2YLC A;  3I5R A;  3MET A;  4F14 A;  2CZ0 B;  2VC8 A;  4N4I A;  1G3W A;  1MMA A;  4PJO E;  4FM4 B;  1E6H A;  1B34 A;  2QQR A;  3A98 A;  3X28 B;  3OYF A;  3M0R A;  1EX4 A;  1RLP C;  2Y4Y A;  1UGQ B;  1I5O B;  4M77 A;  2P4T A;  4QW2 A;  4E2F B;  4M7D B;  2B8A A;  3EH2 A;  4JJC A;  3QZ5 B;  1WQ7 A;  3GOX A;  3KUF A;  3L2U A;  5D6W A;  3MEU A;  1K0S A;  4HCZ A;  5GAO p;  1OPK A;  2L0A A;  4MZP A;  4F17 A;  3CCV A;  1T0J A;  3HRU A;  4M78 G;  1K9A A;  2HSE B;  5DM7 R;  3S3O A;  1YIT A;  1VQN T;  2IG0 A;  2CZ1 B;  3VS0 A;  1KQS P;  2KT1 A;  1YJW A;  2YHT A;  2LQ8 A;  2FHD A;  4M75 A;  1N9R A;  2YWW A;  3M56 A;  1WHJ A;  1NLO C;  2KNB B;  1UEB A;  2QK0 A;  4M78 B;  3CCV T;  3CD6 A;  4F7U F;  3G1J A;  6AT1 B;  1YIT T;  1AZG B;  2H3E B;  1PD0 A;  1NYG A;  1X75 C;  3Q1J A;  1I0C A;  5I22 A;  2FPE A;  1UJY A;  2M0O A;  4XTW A;  1I8F A;  1G83 A;  2QQS A;  1VOM A;  3G7Z A;  1QMC A;  3OMG A;  4J9B A;  1UFF A;  3QWX X;  2JJ9 A;  1X43 A;  1PSE A;  1Q82 R;  5KYU B;  2P84 A;  2ZZD A;  4C8Q F;  3QDR B;  3CD6 T;  3PE0 A;  4N0A C;  3RUX A;  2ROL A;  1UE9 A;  3J80 E;  3CCQ Q;  2JUF A;  5GAN 5;  2EQI A;  3RMS A;  1QCF A;  2IVW A;  2RJD A;  2F2X A;  3JCM Q;  3I9Q A;  3FC3 A;  5GMK e;  3I56 A;  1KIK A;  4X34 A;  1FMK A;  4KUL A;  4XU0 A;  3REB B;  1QQJ A;  1E6G A;  2RN8 A;  1RI9 A;  4F7U G;  1Y96 A;  1ZUY A;  1MMN A;  4M7A F;  4ZN3 A;  2GFA A;  1V76 A;  1Q7Y U;  2YT6 A;  2DBM A;  3H0H A;  3VUB A;  1BI1 A;  4NL3 A;  4BDZ A;  3CPW P;  4J8O A;  5CKB A;  2KAF A;  4C8Q G;  2JOY A;  1N9S A;  2HBW A;  4FL6 A;  2AIR B;  4C5I A;  2AZV A;  4JRK A;  3MEW A;  3OYI A;  1WXU A;  1KQ2 A;  1NJI U;  5A0D A;  1YJN Q;  2E3H A;  4PFP A;  2EJF A;  4BUG A;  2JTM A;  1Q7Y R;  4HT9 A;  2YUO A;  1BKB A;  5IHK A;  2LCS A;  2ZPE B;  5GAN g;  2A36 A;  4QT7 A;  5FU6 B;  1GCQ A;  4ZTJ A;  1VQK A;  1QCN A;  2I2L A;  1NEB A;  1ZSZ A;  4OB2 B;  4M7A G;  4KBM B;  3PNW C;  4IUQ A;  4Z8A A;  4JLI A;  3QPH A;  4Z89 A;  2QXF A;  2VGM A;  4A4F A;  2ZPI B;  3TCJ A;  1ABQ A;  1NJI R;  4C0G A;  4GBQ A;  1MV3 A;  2BKD N;  1YHQ A;  4BI4 A;  2A3L A;  1KSW A;  3QBY A;  3OS0 A;  5GAO q;  1VQK T;  1VQ8 A;  4ORZ A;  1D0Z A;  3GP8 A;  1D1C A;  3F70 A;  2DRM A;  4HXJ A;  3A8M B;  1I4K 1;  1QLY A;  2MPX C;  2DPP B;  2MK5 A;  4LNP A;  4C92 C;  1W2B S;  2F69 A;  4DQ2 A;  1IZ6 A;  2CUB A;  4HA8 A;  5CIU A;  1YHQ T;  3HFN A;  4RTT A;  3JCM h;  1GXI E;  2H3J A;  2FZC B;  3EG0 A;  5IXF A;  1M1K R;  1VQ8 T;  4XTV A;  2O9S A;  3SHW A;  2E4H A;  2DF6 A;  2RHI A;  2J7I A;  5A0G A;  1QKW A;  4ANJ A;  2CDT A;  2KSS A;  2SRC A;  3VKI A;  4KGX B;  4J7F A;  1H3H A;  1VYV A;  2M1H A;  3UT1 A;  5GJV B;  1IGU A;  3FDR A;  1WJR A;  1NBE B;  2CGH A;  2V1R A;  3CC7 A;  1XNI A;  1D09 B;  2MCN A;  4E7J A;  2HKQ B;  2QA4 Q;  4C0Z A;  1SEM A;  1WLP B;  2VXE A;  1VQ9 A;  4OMF B;  3RKX A;  3OBY A;  2LT1 A;  1ZQ1 A;  1RL2 A;  4J9F A;  3CME A;  3CCR A;  1JJ2 A;  1K0X A;  4F04 B;  4FSX A;  2C06 A;  3CQT A;  2L3P A;  3EG2 A;  1X6B A;  5LJ3 j;  1LJO A;  2FVU A;  3CC7 T;  2RJE A;  4XQ3 A;  2DL8 A;  1QKX A;  4FYV B;  3BDL A;  2OJ2 A;  5CKE A;  1KD1 C;  3QZ9 B;  4QVD A;  2OX7 A;  1VQ9 T;  1RAB B;  1EIF A;  2EVR A;  1QW1 A;  1VQ6 T;  4JS4 A;  3I5S A;  3CCR T;  2KVQ G;  4FIB A;  4TVR A;  5M9O A;  4P5N A;  2R58 A;  1KG1 A;  2CT4 A;  4C0D B;  1QVP A;  4YTL A;  2PTK A;  1NZ9 A;  5GAM h;  3BW1 A;  3RNJ A;  2GTO A;  1KC8 C;  2FPD A;  2F5T X;  4DBH A;  1KQS S;  3OYJ A;  1GBQ A;  4FYW B;  2ZCF B;  2FZK B;  3JB9 F;  1OU8 A;  2A08 A;  4GY5 A;  3CCU Q;  1VQ7 A;  2AT1 B;  2JT4 A;  5GAN j;  2BE9 B;  2P4R A;  3LH5 A;  1OOT A;  1V1C A;  5CK9 A;  5KYY B;  3A8H B;  1SRL A;  2DKG A;  2F1L A;  4C92 D;  1IRE B;  3JCM g;  4OMQ A;  1YJ9 T;  5LL6 S;  3C4S A;  3OB9 A;  5DY9 A;  2E65 A;  1VQ7 T;  1F1B B;  2YRC A;  1NG2 A;  1FXX A;  1Y57 A;  1I81 A;  1OZ3 A;  1QP3 A;  2HL3 A;  3LH0 A;  3ZBD A;  5GAN e;  3TSW A;  2MWO A;  5LJ5 d;  4WF2 A;  1R0C B;  4J9I A;  3KXT A;  4C92 E;  4X1V A;  2JW4 A;  2YUN A;  5CO7 A;  4AFQ C;  4AG1 C;  3EFR A;  1K9M R;  1U5S A;  5LJ5 h;  2EGC A;  2LP5 A;  4E7S A;  2LDM A;  1W70 A;  4XU1 A;  4M77 D;  4AT1 B;  2HMA A;  5KCH A;  1JXO A;  1JXM A;  4BDY A;  3RES A;  1PM3 A;  2KT8 A;  1Q86 C;  3O8V A;  3E9F A;  2A37 A;  1G3Y A;  4ZN1 A;  4BE0 A;  1X6G A;  4QVZ A;  1K8A U;  4IIO A;  4J9G A;  2CS7 A;  1WJS A;  2OTL Q;  4AG2 C;  3CPW S;  2DXU A;  2HEQ A;  1K73 U;  4JJB A;  3A1P A;  1WHM A;  3NTH A;  4M77 E;  2RMO A;  1PD1 A;  2FPF A;  2CH4 W;  5DLQ E;  3PFS A;  1RAE B;  3CCL Q;  2H8H A;  4N0A A;  4DOV A;  4WCI A;  2RO0 A;  4E7I A;  1JQQ A;  5FW9 A;  5GAM g;  4M75 D;  3HL8 A;  2BZX A;  2DMO A;  1K8A R;  4E7K A;  3M57 A;  4RG2 A;  1VQL Q;  3RDV A;  4F7U A;  1UUE A;  2CT3 A;  1YBY A;  4JZ4 A;  3KFV A;  4EMK B;  1Q81 U;  2DA9 A;  2RQU A;  2EJ9 A;  1M9S A;  3UAT A;  4J6W A;  5FWB A;  2ABL A;  2NUT B;  4M75 E;  1CKB A;  2EJG A;  1UEC A;  1VUB A;  1HJD A;  3VS1 A;  2PUK B;  2HCK A;  1NEG A;  4PJO B;  1K73 C;  5KYX A;  3CCQ T;  3CCE Q;  4QQD A;  4OMM A;  2DX1 A;  4QQ6 A;  2K6D A;  2A7Y A;  1Q81 R;  2V8J A;  4LUE A;  3QO3 A;  3JCM P;  2CZ6 B;  1ABO A;  2IIM A;  2YSQ A;  5LJ5 f;  2PVD B;  4JUV A;  1W2B A;  5FRN A;  2CRE A;  1M4Z A;  2WAC A;  1YJN A;  1WX6 A;  2HDA A;  2CSQ A;  3H41 A;  2NUZ A;  4PJM A;  1NE8 A;  3LGL A;  1VQO A;  4PLI A;  3MEV A;  4M7D F;  4IUU A;  4EDU A;  1GRI A;  3FRN A;  2JMA A;  2JTF A;  4E7L A;  2AZS A;  2JS0 A;  4JPB W;  4OVA A;  1IO6 A;  1M2V B;  3THK A;  2MWP A;  4Y91 A;  4BY6 B;  3VUZ A;  4LE9 A;  3HPW A;  3JCM e;  1N8R U;  3C94 A;  3J7A F;  2RQR A;  2XMF A;  1YJN T;  4CC7 A;  1PNJ A;  1X2Q A;  4PJN A;  3NTI A;  3M53 A;  4HCC A;  1ARK A;  2VV5 A;  2YRV A;  4C92 A;  2NUP B;  2XK0 A;  3MHX A;  1KFZ A;  2QTX A;  1YJ9 Q;  2GF7 A;  3RR6 A;  2EFI A;  4NL2 A;  1TXQ A;  1TUG B;  1YWO A;  1YIJ Q;  1TH7 A;  2KQW A;  3HSB A;  3O5Z A;  2DL7 A;  3ER0 A;  4XK8 E;  5CKF A;  1MHN A;  1WFW A;  1WHK A;  4A4K A;  1UG1 A;  2Z0W A;  4M78 F;  1ZUK A;  4M7D G;  5HKC A;  3EGD A;  1R77 A;  1WJQ A;  2EKO A;  3V8J A;  5GAO l;  4B9W A;  3GF5 A;  4LDY A;  1TG0 A;  1GCP A;  1IB8 A;  2K5F A;  2MYS A;  5FRM A;  2LRQ A;  2L3R A;  5LJ3 d;  3UA7 A;  3BDU A;  2DIL A;  1X2K A;  5KYW A;  2FYK A;  4DBF A;  1VQN A;  1BK2 A;  4KUD K;  1OV3 A;  1I1J A;  2CZ7 B;  3REA B;  1KQS A;  1W1F A;  2ROT A;  3QYG B;  2W10 A;  4M78 C;  1OX9 A;  3T9N A;  8AT1 B;  3L1A A;  2LCC A;  1HK9 A;  3CC4 Q;  1M5Q 1;  5GAM e;  4BAC A;  2P0P A;  3DLM A;  3L2V A;  3OYN A;  5EG2 A;  5HCK A;  5CR2 A;  5KE2 A;  3PVL A;  2DD4 A;  1ZA2 B;  1WGS A;  2FRW A;  4J5Y A;  2QA4 T;  2GGR A;  1R0B G;  1VQP Q;  1Q82 U;  1P92 A;  2RQT A;  2X3W D;  1M8V A;  2RI3 A;  2JS2 A;  1VQM Q;  1H92 A;  2EGA A;  2E64 A;  2GBQ A;  4JZ3 A;  2QQ9 A;  1SG5 A;  2HD0 A;  4OML A;  1J3T A;  4MZM A;  2KY9 A;  2RJF A;  2P0Q A;  1WXB A;  5GMK j;  4M4Z A;  2XIC A;  1NLP C;  2F2W A;  1RAG B;  2K5L A;  2COY A;  1CSK A;  1TUD A;  3CCU A;  3QYH B;  3ZFJ A;  2M51 A;  3TU4 K;  4JS5 A;  1D3B A;  3HRT A;  2E6N A;  3L42 A;  3G71 Q;  2LCL A;  2K3B A;  2CP3 A;  2DE0 X;  2PUO B;  2HNI A;  3EHR A;  2E5Q A;  4BI8 B;  2MOX A;  2LQN A;  3R6N A;  2ZPG B;  5D7U A;  5L8R E;  3CPW A;  1WHG A;  2HZY A;  3SWN B;  3JV3 A;  4FT4 A;  5GAN 8;  3CCU T;  1ZX6 A;  2BE7 D;  2O4X B;  1Q82 C;  4J9D A;  2O2O A;  3RKW A;  3NTK A;  1AVZ C;  1XJW B;  2R5A A;  2RA2 A;  4HCB A;  2RJC A;  5FU6 C;  2EYY A;  5J39 A;  4C8Q C;  4RUG A;  2MMP A;  2NWM A;  2Y4X A;  2LX7 A;  4F16 A;  3VS7 A;  1OQK A;  1K1Z A;  2DJZ A;  3PIO A;  3HFO A;  1LCK A;  4J9C A;  3VU3 C;  4KUI A;  2V8I A;  4M78 D;  3I35 A;  1JU5 C;  2LQK A;  2E5K A;  2G6F X;  2C0I A;  4B6M A;  4CI0 C;  2BIV A;  2MAM A;  1U1S A;  2COW A;  4OB0 B;  4M7A C;  2KE9 A;  5HK0 A;  4A4G A;  2X4J A;  3VS6 A;  1MUZ A;  3VRY A;  2DIG A;  2DXB A;  2KXC A;  2LNV A;  2L8D A;  2CP6 A;  4RTZ A;  2XI9 A;  3QUI A;  2DYI A;  3MPU B;  1XOV A;  4XTY A;  3NFC A;  2DER A;  3EGX B;  2OAU A;  4M78 E;  1M1K U;  9ATC B;  3QII A;  1BIB A;  4MZT A;  1BI0 A;  1Q7Y C;  1IHW A;  1S1N A;  2VUB A;  3OSV A;  1KHI A;  5KYX B;  3I55 Q;  3DB4 A;  4OB1 B;  2OTL T;  4LD6 A;  3GIB A;  1PC0 A;  2DZC A;  2W0Z A;  3TEE A;  2Y90 A;  1D0Y A;  1VQL A;  2M9U A;  1HXD A;  2X4W A;  2FRY A;  1FX7 A;  2VKN A;  3CCL T;  2KXD A;  1H8K A;  3EG9 A;  5AYF A;  2ED0 A;  4LDW A;  3M54 A;  1NJI C;  2QQB A;  2AKL A;  3P8D A;  3FB9 A;  2D0Q B;  2E10 A;  5KYN A;  2HBP A;  4KGZ B;  1M30 A;  1I5L A;  4X9C A;  1AD5 A;  2A0F B;  3SB2 A;  3URG A;  2D8H A;  3RMQ A;  1VQL T;  1AWJ A;  2JXB A;  1LVK A;  1NPR A;  4ZNX A;  3VS4 A;  2F2V A;  1PHT A;  2QYZ A;  2DYB A;  1VQ4 Q;  3FLG A;  4BB7 A;  3C0C A;  3JCM b;  3PGG A;  1K76 A;  4E7Z A;  1BIA A;  4OF1 A;  2K2V A;  1HD3 A;  2DRK A;  1PCX A;  2K3Y A;  2ZPH B;  1AHJ B;  1HYO A;  1RAA B;  3PT9 A;  4C8Q D;  1G3T A;  3INZ A;  3DB3 A;  3BE3 A;  2RF0 A;  4IUV A;  1RAI B;  2HAX A;  4C92 B;  2O01 E;  4C5G A;  4F7U E;  5CKD A;  1VQ6 A;  1PWT A;  3JSC A;  3CCE T;  1AEY A;  3MP6 A;  3C95 A;  3ULR B;  4C0D C;  2QEX Q;  2BZY A;  1EZZ B;  1PKT A;  1SHF A;  4LUD A;  4AMC A;  5FRO A;  2QGF B;  2OTJ Q;  1B3Q A;  4N4H A;  1YI2 Q;  2KGT A;  2LT4 A;  2YUQ A;  1RAC B;  3ZL7 C;  1RAF B;  5GAN 7;  5GAN 2;  3S6W A;  2E41 A;  1V29 B;  5GAO n;  4FSS A;  4M7A D;  3OYA A;  4C8Q E;  4J6X A;  2DL4 A;  1WXT A;  4Z88 A;  4O5V A;  1B34 B;  2EQK A;  2EQJ A;  2LJ0 A;  1YJW Q;  2BTT A;  4R0K A;  2ATC B;  4M77 B;  4RTU A;  1YJ9 A;  3NGP A;  4RCB A;  1MV0 B;  2GTJ A;  2RI5 A;  4A4E A;  7AT1 B;  4M7A E;  3VYG A;  3LGF A;  1YIJ A;  3C12 A;  3QJY A;  1BCO A;  2O9V A;  3OSS C;  1N5Z A;  5IXB A;  1KK7 A;  3M58 A;  3OS1 A;  2K2M A;  2X4Y A;  1K9M U;  4ESR A;  2YLB A;  2E6Z A;  3X20 B;  3QWY A;  1AWO A;  3OYG A;  3UA6 A;  1RUW A;  2PQW A;  2QTV A;  1VIE A;  3L2Z A;  1YIJ T;  1R8O B;  1BU1 A;  5GAO m;  4QVC A;  2COZ A;  2EAY A;  2C0O A;  4DBR A;  5FU7 B;  1OPL A;  1QVG P;  2VXF A;  2VGN A;  4M75 B;  2QDY B;  4NS5 A;  4J7I A;  4E7H A;  3UWN A;  4M78 A;  1K4U S;  4JLG A;  1A0N B;  1C1A A;  4BD3 A;  4XU2 A;  4CC3 A;  3S3M A;  2KBT A;  1UHC A;  3L2W A;  2RB6 A;  1M1F A;  5IH2 A;  3H0F A;  3AT1 B;  3JCM W;  2X9H A;  5KYU A;  3CC4 A;  3SDZ A;  1G2B A;  1RAH B;  4PJO F;  3GPL A;  1YCS B;  2X4X A;  3VJP A;  2RH2 A;  1D3B B;  2PVO B;  1WA7 A;  4J83 A;  4R55 A;  3CXC P;  1K9M C;  4D6W A;  1VQP A;  1VQ5 Q;  2K3X A;  2X51 A;  2DVE A;  3V7C A;  1AOJ A;  2RHX A;  3TVT A;  3UF4 A;  3M0T A;  5IN1 A;  1VQM A;  3H9N A;  3CC4 T;  1EFN A;  1LNX A;  1UGV A;  3EFO A;  1O9S A;  4CC2 A;  4EMK C;  1T0H A;  4Y28 E;  4E47 A;  4HT8 A;  2MF2 A;  1Y96 B;  4OGC A;  4DBQ A;  4BE2 A;  3EHQ A;  4HVV A;  1GFC A;  3MCA B;  2QQA A;  5IHN A;  2ZPF B;  3KBG A;  1VQP T;  5I2M A;  4OGE A;  2D9T A;  5HY6 A;  1I07 A;  3MKD A;  2F5K A;  4FCY A;  1VQM T;  2DEQ A;  4PJJ A;  3G4S Q;  2KRM A;  2DBK A;  2J6K A;  1KJW A;  3CCQ A;  1PRM C;  1VYT A;  4PJO G;  4XU3 A;  2GQI A;  2XDB A;  2OI3 A;  2J6F A;  1GFD A;  2DD5 A;  1OUL A;  3H8Z A;  4N4G A;  4ELY C;  5KCO A;  2AK5 A;  3CBP A;  3MP1 A;  4J9H A;  2JM9 A;  3RIR A;  3HRS A;  2HQE A;  2LC4 A;  1UGR B;  2KYM A;  1K8A C;  4C8Q A;  3WVD B;  3A8G B;  1QWF A;  2KK4 A;  2XHC A;  1ZSZ B;  3G71 T;  1QVF P;  2ECZ A;  1Y71 A;  4RCC A;  2RHU A;  3HKS A;  1NYF A;  3N5B B;  3JB9 D;  2IPO B;  4IIM A;  5LJ5 g;  1M90 U;  4L6V 5;  4BY6 C;  3LWI A;  2KYB A;  4M7A A;  2XID A;  2VAS A;  1D1A A;  1G8X A;  1KHC A;  4VUB A;  3LW5 E;  4ME7 A;  4KGV B;  1Z9Q A;  2DTO A;  4RTV A;  5IAY A;  1TUC A;  4A4H A;  1Q81 C;  1UJ0 A;  1WYX A;  4FU6 A;  2DTH A;  2L2P A;  4RTW A;  4JJD A;  4HCK A;  4RMO A;  4E6R A;  5GMK i;  4IUP A;  3CME Q;  3NHN A;  1M90 R;  2FZG B;  2DL5 A;  1TU0 B;  3M4Y A;  4L59 A;  3OYC A;  2DET A;  1DJ7 B;  2E70 A;  3CCM Q;  4JRI A;  4V2S A;  1M2O A;  1IRX A;  2JVV A;  4RTY A;  2L5Q A;  5C0M A;  3M0S A;  3RBB B;  4K11 A;  1B7T A;  1M8M A;  2C0T A;  3I55 A;  1Y0M A;  1WNL A;  3OYY A;  4DOW A;  2EGE A;  4XAX B;  5GAN 4;  4A63 B;  3L2Q A;  2XDP A;  3D7S B;  5A2Q E;  3V7R A;  2PNI A;  2QG9 B;  3CPF A;  3SFM A;  1ZHI A;  4M7D C;  1AWX A;  4GLK A;  3PMI A;  2NLU A;  3QKJ A;  4PNO A;  4OMN A;  1C0M A;  3GLX A;  1XQH A;  3HTR A;  3I55 T;  2MI6 A;  3EFS A;  5A0L A;  1Z9Z A;  4FYY B;  4LXC A;  1ACM B;  3M9Q A;  2KR3 A;  3E9G A;  1HSQ A;  2EPD A;  3M5A A;  2RQW A;  5GAM j;  3CEY A;  3HHT B;  5HK3 A;  2EYZ A;  3CMA Q;  2CP2 A;  1T3L A;  1N8R C;  2EKH A;  1VQ4 A;  5LJ3 h;  4KH0 B;  1VA7 A;  1TWB A;  2WSC E;  3OW2 P;  3CCJ Q;  2QA4 A;  1OZ2 A;  2FG0 A;  3U23 A;  1KQ1 A;  1O75 A;  4MDX A;  1ZLM A;  1WHH A;  3A8L B;  4ELZ C;  2LTO A;  3JB9 H;  3M4G A;  1PSF A;  1T3S A;  3V8L A;  1FMV A;  1NPP A;  2YDL A;  1RLQ C;  1VQ4 T;  5CKH A;  3QJ6 A;  5CCA A;  2QEX A;  1QVG S;  2JMC A;  2OTJ A;  2LZ6 B;  1GBR A;  5KYY A;  1M27 C;  1YI2 A;  2E12 A;  2FL7 A;  1G3S A;  1C6V X;  4C5E A;  5GAN d;  3ASK A;  4HVW A;  3OA6 A;  4FYX B;  3PMT A;  3V8K A;  3RER A;  2AHJ B;  1SKU B;  5EC7 A;  3X25 B;  3OYE A;  2RM4 A;  3EH1 A;  5GAN h;  2QEX T;  2CP5 A;  2RK2 A;  4FW2 A;  2EQU A;  4BI3 A;  5LJ5 j;  2OTJ T;  4MMK A;  3V7S A;  3G6E Q;  1YI2 T;  2CYZ B;  2GQV A;  3DLL A;  1BI3 A;  1AT1 B;  2RNA A;  3E2U A;  1MND A;  1SSF A;  3SWN C;  4O6J A;  1S72 Q;  2DM1 A;  2VVK A;  3VS5 A;  3OQ5 A;  2NYS A;  3CXC S;  1X69 A;  5IHI A;  4UC4 A;  2XKO C;  1YJW T;  5GJW B;  3X24 B;  1U1T A;  3PTA A;  3QHS A;  3QXE B;  1YFN A;  5LJ5 e;  4M7D D;  2XDD A;  4FW1 A;  1QP2 A;  2OAW A;  2DXC A;  4II1 A;  3H6Z A;  2QDL A;  4B9X A;  1FMW A;  2DVJ A;  3CCS Q;  2FO0 A;  1Y07 A;  2M16 A;  2B86 A;  2DAQ A;  2HKN A;  3GNF B;  1M3A A; 
#chains in the Genus database with same CATH homology
 2ZAE A;  1TS9 A;  1TSF A;  1PC0 A;  1OQK A;  2KI7 A;  1V76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...