1OQKA

Structure of mth11: a homologue of human rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
b'RHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved protein MTH11
publication title Structure of Mth11/Mth Rpp29, an essential protein subunit of archaeal and eukaryotic RNase P.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Hydrolase
total genus 6
structure length 78
sequence length 78
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1oqkA00
1OQKA 1TS9A 1TSFA 1PC0A 2ZAEA 1V76A 2KI7A
chains in the Genus database with same CATH superfamily
4O5VA 1FYNA 4EMKA 1KQ2A 2EYYA 3R6NA 2RQTA 4OMOA 1NLOC 4J6WA 1NPRA 2DNUA 2PNIA 3PVQA 3LH5A 1TOVA 5J26A 5LJ3d 2HQHA 2M9UA 1NYFA 2O31A 4YTLA 4LDXA 3M5AA 2I2LA 5EG2A 2L3RA 1ARKA 2EVRA 2DX1A 2ZZDA 1I8FA 2ZCFB 4J6YA 2COZA 3LWIA 3NTHA 4J8OA 2QA4A 3JB9F 2B86A 2DYIA 1D3BB 1RAAB 3QDFA 1E7OA 1PRLC 4BE1A 3NFCA 2NUTB 2YRVA 4JRIA 2QQSA 1YITQ 2FZKB 1K0XA 2C0OA 5LL6S 3LLRA 3CCRQ 3T9NA 5GAN8 3QYGB 2E65A 5LJ3h 2V26A 4J9HA 4A53A 3E1SA 2DJZA 5FROA 2EKHA 2DIQA 4OB3B 1UGQB 2X3WD 4PJLA 3REAB 2DXCA 4GBQA 2QGGA 4XTWA 3QIIA 1VQOA 3NPFA 1X27A 3G1JA 2D8HA 5KYWA 2QQAA 4K11A 3VS4A 3G71Q 1HK9A 1EIFA 4R0KA 3OW2A 2ENMA 2E3IA 2K9GA 4L6V5 2OJ2A 3RUXA 2GTOA 4RTVA 1PD0A 5IHKA 1C0MA 1FMKA 5LJ5j 5GJWB 1QVFS 2EQUA 5C6SA 4P5NA 3UT1A 1PD1A 1WI7A 1W1FA 2JXBA 1MNDA 5I11A 4PL6A 2BE9B 4LNPA 4KH0B 4QT7A 1M3AA 2OI3A 3EG2A 2DAQA 2D1XA 5KYUB 3VRZA 1K0SA 1KQSA 3CC4A 3G6EA 1CSKA 2LQKA 3MPUB 4DA4A 1UE9A 3OYGA 4IIOA 2KEAA 4B6MA 4C92G 2K57A 3CEYA 1KIKA 2FRWA 4M7AC 1TXQA 3ASKA 1VQ9T 3EGUA 1E6HA 2KRNA 2HSEB 1SKUB 1P92A 4CC4B 3I56T 1WQ7A 7AT1B 1YI2Q 1D3BA 2RHIA 2GGRA 2JW4A 1YJWQ 1KD1R 1NLPC 4PFZA 2JNGA 1I0CA 1YHQA 2NUTA 1K73C 3QZ9B 2NYSA 4J9IA 1HJDA 4OMPA 2JM9A 3GP8A 1GCQA 3HTRA 2AKKA 3JCMQ 2EGAA 1UFFA 4C5HA 1CKBA 1Q82U 2EKOA 4BI3A 4OMLA 1WJRA 2A37A 3NHNA 2X35A 2KAFA 4B9WA 2KT1A 3S3MA 3FDRA 3VJPA 4Y28E 2X9HA 4GLMA 2OTLA 1IXDA 4C92C 3OYYA 2R5AA 5CO7A 1ZSZC 3SHWA 1MHNA 1PCXA 2O2OA 4ESRA 2MOXA 2M0YA 3FJ5A 3H0FA 4M7AB 2RJFA 2RO0A 3VRYA 2QQBA 4E7LA 2DIGA 1PKSA 4BY6C 1WFWA 2CP7A 1YN8A 1QKWA 2VUBA 2K5FA 6AT1B 2OTLQ 4KULA 2XD0A 4E7KA 2DD4A 2KDSA 5LJ5e 3EH2A 5ECAA 4HT9A 4M78G 2G3RA 2L3SA 2ZPBB 1LOJA 1WNLA 1PSEA 1UEBA 3CCUQ 1VQ6T 3CPFA 4FT4A 3SD4A 2O88A 1D0XA 2RQRA 2E4HA 2JS2A 1RI9A 3RNJA 1VQ4Q 3CMAQ 4XTZA 2DPPB 4PFPA 3GF5A 5DLQE 4JS5A 4QQ6A 3I55T 1MMNA 2LMJA 4CRIA 2DVEA 3DB4A 4KGZB 3QYHB 3CCVT 1Z9QA 4C92B 1RAFB 1ZA1B 4AFSC 1Q86C 4M7AF 1ZSZB 3CC7A 1X69A 4L5GA 1K9AA 1WYXA 3BFMA 1K9MC 3C0CA 4AT1B 2MPXC 1TWBA 1N9SA 1FMVA 2KYBA 3CCMQ 3QO3A 2WSEE 4X9DA 1GRIA 1HSQA 3ULRB 4JJNK 4RUGA 3P8HA 4BY6B 1SRLA 3OYKA 1ZA2B 4J7IA 3CD6A 1JXMA 1R0CB 4RG8A 3CC7Q 2GFUA 3G7ZA 2DEUA 1KC8R 1MMAA 3FC3A 4KUIA 4PFOA 4J9CA 4J9BA 3MEWA 1D0YA 2LDMA 2RQVA 1RAEB 3INZA 3OS5A 4HCCA 2M0OA 2F5TX 5FRNA 2QTXA 1OI1A 2H3EB 3EHQA 1PKTA 3U23A 3BDUA 2GNCA 4KGXB 2EYXA 1VQKA 3QWXX 4DQ2A 2JVVA 1VQPA 1QVFP 4C92F 2X4YA 1JB0E 2XDDA 1VQ8T 2CZ0B 2B8AA 2XI9A 5A0GA 1NEGA 4IIMA 3M57A 2LNHB 2YXYA 1QCNA 2NWMA 1QMCA 2RI5A 2VXFA 4FYXB 3C4SA 5KYYB 5KYXB 4PJOC 2CH4A 3H41A 2P0KA 1GCPA 3M56A 3PT9A 1X01A 2HL5C 2P0QA 2XDPA 4FCYA 1UGVA 2LJ1A 5A0DA 4M75C 3CCJA 1WLPB 1QWEA 2JT4A 1M4ZA 2MWOA 4QW2A 1UB4A 2CYZB 5KE3A 3NMZC 2PQWA 4OMMA 1KQ1A 4M78B 1PRMC 2ESWA 3JB9G 3JCMX 1G3YA 1FX7A 1K8AC 1Y0MA 1K73U 3AHUA 4N0AC 1XJWB 1IGUA 3UPUA 1GFCA 3CCLA 3I55Q 4XTUA 3VS0A 1WQWA 3VS2A 1UGPB 1WXTA 1OYXA 1WIEA 3QKJA 4HXJA 3VYGA 2SRCA 1OOTA 1UDLA 3CCQA 1QWFA 3VS3A 5C0MA 2O01E 3HFOA 1Y71A 2VB6A 1U3OA 2RJDA 3EG1A 3RKXA 2VC8A 4PLLA 4JJCA 3JCMg 1VQ7Q 4C92A 1Q82R 5CK9A 1ZSZA 3RMQA 2E6NA 1YIJA 3OQ5A 2C0TA 3JCMc 3VYHB 3CCLQ 1YITT 2PUOB 1VIFA 4PJOB 2FG0A 1DJ7B 1M1KR 3JCMd 3VS6A 3A8OB 3CCQQ 3OS2A 1TU0B 4PJOD 5D6WA 4MMKA 1ABOA 3DKMA 2XG8D 3QDRB 2L3PA 3MP6A 3P8DA 3DLMA 4JS4A 2YHTA 4KRTA 2K4YA 5GAMf 2HL3A 5DM7R 4Z02A 2DL4A 4M75D 2EIFA 2DMOA 4OGEA 3G4SQ 1WJQA 4C5EA 2RNAA 2VASA 3OYBA 1J3TA 5DLOA 1JBMA 4F14A 1YBYA 1VQ5A 3ZL7C 2DF6A 2E10A 2AK5A 4FSSA 1SEMA 4J7FA 2K6DA 3MO8A 1YWPA 1QVGS 2D6FA 1D1AA 3M0PA 5EC7A 3JCMh 3CCRT 4C8QD 3OYJA 1AWJA 1M30A 2KE9A 3CC2Q 1F1BB 5KYYA 5KYXA 5LJ3f 2DEQA 4PJOF 1X75C 5AT1B 5GMKl 1I1JA 2GBQA 4X9CA 1Q86U 1VQ5Q 2KROA 4PKCC 2FL7A 3OA6A 1EZZB 4FM4B 4DBFA 3CXCS 2PVOB 3QZ5B 2VGNA 3VS7A 4FYYB 1TSFA 5GAMg 1OZ3A 4M75F 1GBQA 4M7DD 3URGA 3MEVA 5GAOn 2YRCA 5IHIA 4O6JA 1BI3A 3H8ZA 2VVKA 4M78A 4HCKA 3EG3A 2CZ7B 2DBKA 4KGVB 3M59A 3G71T 4MZMA 2K5IA 5GAMd 4PJOE 4AFZC 1BI0A 3A8LB 2FB7A 4TVRA 3TCJA 2LX9A 3N5BB 3OYIA 1U1SA 3JCMb 1V29B 2JJ9A 1M2VB 4M75E 4M77C 5M9OA 2NLUA 3WXMB 3L42A 2CP0A 3I35A 3M53A 4NL3A 3M0QA 4JDSA 1W2BA 2LP5A 1AVZC 4OMFB 2O4XB 4EIKA 1VQNA 1YFNA 3REBB 2K5LA 4E7JA 4M7DF 2D9TA 4R55A 2K3XA 2JTEA 2BIVA 4C8QE 2E5KA 4IURA 3QWYA 4II1A 2K2VA 4IKFA 1IHWA 2XMFA 5GAMh 2BTTA 2KXCA 1NJIC 5GAOm 4OMNA 3BW1A 5J3BA 2QEXQ 2IG0A 2HKQB 1BCOA 3PMTA 1TH7A 3DLLA 4EMHA 1RAHB 2RI2A 4XU0A 4HVWA 1VQLA 4KT0E 2KSSA 2PTKA 4M7DE 2QI2A 1JO8A 4OGCA 2PU9B 4F7UE 1YI2T 3BE3A 1R77A 3OYHA 4FW2A 4N0AA 3S3OA 1Q81R 1YJWT 2MMPA 1BK2A 2HAXA 3CCEA 3H6ZA 2ZPIB 1WJSA 2VKNA 4PJJA 1KG1A 4KBMB 2KRMA 1RLPC 2CUDA 3OY9A 2DYBA 2QA4Q 1VQLQ 3OSVA 1Y57A 3JB9I 3GPLA 1W70A 3OYLA 2AT1B 4M77D 1KSWA 4N4GA 2PUKB 4OB1B 3EFSA 3C12A 3CCEQ 2EJFA 2DZCA 2LX7A 1G2BA 4MDWA 4DOVA 3HRSA 2QYZA 3UF4A 3OYFA 1X6OA 2YRDA 1ABQA 4M7AG 2EYQA 2ZPGB 2MCNA 4F04B 1RUWA 3EG0A 3GNFB 3A98A 2LT1A 3OW2S 2ZGWA 3SB2A 5FWBA 4A63B 2FO0A 2DL3A 2HDAA 1QCOA 4XTVA 4A4EA 5CCAA 3EGDB 4E7IA 3RKWA 2CSQA 4FSXA 2Y4XA 1VQOQ 2OAUA 2P4TA 2QDYB 1KHCA 3IQLA 3QUIA 2H3JA 2OTLT 4HT8A 1M2VA 4C5IA 2W10A 2KK4A 2RHYA 3MP8A 2AZSA 4M77F 3M55A 4XTYA 1XQHA 4RKUE 3VUBA 4QVCA 3I9QA 1SF9A 3A5ZB 1N8RR 3PMIA 3QJ6A 2DL7A 3CCUT 2J7IA 1QP2A 2F2WA 3OBWA 1NG2A 5I22A 2HBWA 2RHZA 2DXTA 2L3QA 2EWNA 4HKEA 5GMKi 1VQ4T 3CMAT 1WHLA 1B34B 1QVPA 1G3SA 3E2UA 4D8KA 2X4WA 1PSFA 4M77E 3CMEA 2YT6A 3H0IA 3NTIA 4JRQA 1PNJA 3PVLA 4BI4A 1QVGP 2CGHA 2XK0A 2LCSA 2Z0WA 1TUDA 2VXEA 1IREB 1QW1A 1G8XA 3CBPA 2KNBB 5GAN4 2HNIA 1ZUKA 1YP5A 4RCCA 3G6EQ 3CC4Q 3CCMT 1Q86R 3RERA 1AHJB 1TS9A 3LH0A 2EQMA 3R6OA 3GBQA 3CXCP 4C0DC 3CMEQ 1D1CA 9ATCB 4FL6A 1N6AA 4C0GA 5LJ5f 2KR3A 1D1BA 3MEAA 1IHVA 1TG0A 1W4SA 4ZTJA 2FVUA 3HP9A 3CC7T 3KFVA 1RLQC 4XU2A 1N9RA 2EW3A 3H9NA 5KYNA 8AT1B 4R56A 4OB0B 1YHQQ 1OU9A 2DL5A 1JJ2S 1UECA 1XNIA 2E1HA 1X2QA 1M8VA 1K1ZA 2PZ1A 4HCZA 2O9VA 4N4IA 3CPWS 1YCYA 1C1AA 3EFOB 1AZGB 3L2QA 2IIMA 4LD9K 2E6ZA 5KE2A 4RTUA 4ELYC 1T0HA 1X6BA 4Y92A 3OSSC 3L2WA 2NUPB 4E47A 2KBTA 2EGCA 1QKXA 2ABLA 3EGDA 1EFNA 5LJ5g 1YJ9A 1BBZA 1PM3A 2FPDA 5FW9A 1WHMA 2I0NA 4DEYA 2DKGA 5GANj 4Y91A 2J6KA 4OP0A 4FYWB 5LJ5d 3TSWA 4B9XA 3KXTA 3L2ZA 2E5QA 1OV3A 2XU8A 1Z9ZA 3UWNA 3UATA 5GAOl 2BUDA 4QVZA 4J9EA 2VGMA 5KYUA 2ZPEB 1YJ9Q 1VQ9A 2HBPA 1MUZA 3OMGA 3I56A 4ATOA 3NGPA 1B34A 1ZBXA 1IO6A 3M54A 3S6WA 3X20B 5GAN2 3SDZA 3OYEA 2MYSA 4LDWA 3UDCA 1EX4A 3JCMJ 5DY9A 2L2PA 5GMKe 1B7TA 3LYIA 1VA7A 1E6GA 1NEBA 2YLCA 1VQ7T 1SPKA 2PVGB 4PJOG 2V8IA 3LGFA 5FU6C 1M1GA 1VOMA 4CC2A 1NYGA 4LE9A 3J81E 3HSBA 1KD1C 5LJ5h 3CCLT 1WXUA 1AEYA 2AHJB 4RTTA 4M75G 4E7SA 2FEIA 3VKIA 4XU3A 1H92A 1V76A 1BYMA 1GL5A 4C0ZA 4QVDA 3CCQT 4UC4A 5I2MA 3A8GB 2YUNA 3FIFA 5GAOq 3OW2P 1I5OB 3JCMW 3MP1A 5L23A 4BD3A 2QQRA 1M27C 4JUVA 1ZLMA 3J80E 3G4ST 3RIRA 3UA7A 5HY6A 3CD6Q 1AWOA 5GJVB 2RI3A 4J83A 2RHUA 5CIUA 4M7AA 5CR2A 2NUZA 4M7DG 3EFOA 2QGFB 3JCMf 2OTJA 2RD1A 3PIPA 3CC2T 4EMKC 4NS5A 3FEOA 1VQ6A 3ZEHA 2NUPA 4PJMA 1KQSP 5FU6B 5GAOr 1VQKQ 2RQWA 3VV0A 1VQPQ 2K79A 1VQ5T 5FRMA 4CC7A 2KY9A 2EBPA 1RI0A 2EYWA 2VWFA 2DTIA 1X43A 5GANe 4LDVA 2R5MA 3M0SA 2XKOC 2X3XD 5IT9E 1M90C 4XK8E 5CVIA 3JCMP 4E2FB 1UGSB 1G5VA 2M51A 1AOJA 3QSUA 1ZSGA 2P84A 2L5QA 2OTJQ 4WCIA 3CCVA 1BIBA 4XQ3A 4C8QC 1UHFA 3GNGA 1SHFA 3CCJQ 1LNXA 1C6VX 3EFRA 3JV3A 3LW5E 4LD6A 4EDUA 5KH6A 2L0AA 1QLYA 1FMWA 2G6FX 2EFIA 2RN8A 2EAYA 1YJNA 4X1VA 5GAOp 4FIBA 4NL2A 1KJWA 3QHSA 4JZ4A 2KMTA 4M7DC 4JLIA 5HCKA 4JRPA 2YUPA 1UGRB 2ED0A 1UHCA 5J39A 1W6XA 4ZGDB 3OB9A 1WXBA 2DERA 1VUBA 3VS5A 1CKAA 5CAIA 4CC3A 3MHXA 2F2XA 1JJ2P 5I2SA 4QKUA 4M75B 1YJNQ 4PNOA 1WZOA 1H641 1T3SA 3NTKA 2GF7A 1YIJQ 3CPWP 4ZGJB 1ZUUA 2QEXT 1KC8C 1R8OB 2IVWA 2FZCB 4DOWA 4A4HA 1MV3A 1RABB 3EG9B 2D0QB 2LNVA 5A0LA 3M0TA 2DK3A 1M9SA 2AZVA 1H3ZA 2HZYA 2F69A 5A2QE 1G3TA 2LQNA 2D8JA 4EPCA 4C8QB 2VV5A 4M77G 3GLXA 1UG1A 2MI6A 3CCSA 1V1CA 2XIDA 4XTXA 2Y90A 1X2KA 3E19A 4J9FA 1PWTA 1TUCA 1IGQA 2BZ8A 2ROTA 1OULA 2H8HA 2QA4T 4BUGA 2E70A 2SEMA 3PIOA 1D0ZA 1VQLT 2A08A 1HYOA 4M7DB 1QVGA 1PG5B 1NPPA 4F7UB 4BE0A 5IXBA 1K9MU 3DB3A 2RQUA 2LQWA 1Q7YC 5D6YA 2YSQA 4L59A 3CCET 2A28A 3CCSQ 3BY7A 2KVQG 2GTJA 2R57A 3A1PA 3LGLA 1AWXA 3EHRA 1OPKA 2HKNA 2F2VA 1BI2A 5CQXA 1MMGA 4PLIA 4C8QF 3TU4K 3FLGA 4EMGA 3VU3C 4JPBW 2XICA 1VQOT 2LCCA 2RK2A 3QG1A 2CT3A 1BKBA 1NE8A 3E9GA 1GXIE 2CP6A 1GCQC 4FU6A 5HK3A 1W2BS 2QG9B 2RMOA 3JB9D 4C0FA 1X6GA 4BDZA 3ME9A 5FU7C 3X24B 1Y7XA 1BU1A 4AFQC 4AG2C 1BIAA 3QBYA 4RTZA 2YUOA 3JAME 2XDBA 1OQKA 2LQ8A 4F7UF 4E7ZA 1MNEA 4PJOA 2DL8A 3HFNA 1M1KC 2EJ9A 2AKLA 2EQKA 2KT8A 3V7CA 2RJEA 4XAXB 5LJ3e 3LX7A 2IPOB 1QCFA 3JRZA 4VUBA 3ZBDA 2BZXA 4M75A 4LDUA 2LVMA 2DBMA 2K2MA 4IUVA 3ZFJA 2KXDA 1T3LA 1Q95G 2MIOA 4JRKA 1VQNQ 2A7YA 4RG2A 4E7HA 2YUQA 4JJBA 1GBRA 2KYMA 3D7SB 2DFUA 4AMCA 3VS1A 3CCRA 2RM4A 1M5Q1 3EG9A 1VQMA 3MJXA 2ZAEA 3P8BB 3WVEB 1M90U 2EGEA 3M4GA 2CP3A 1K8AU 3CC4T 3G6ET 2K3BA 3CQTA 4ZN1A 1PC0A 1NM7A 2ED1A 4C8QA 1XOVA 1AWWA 2CSIA 3WVDB 1I4K1 1S1NA 1S72A 4M77B 4Z89A 3CMET 5D6XA 2PVDB 3O5ZA 1K73R 3HRUA 2CT4A 1M1FA 1RAIB 5IXFA 2DETA 3UA6A 5GAN5 3X25B 3LWHA 3EH1A 5CKBA 4J9GA 1VQMQ 5FU7B 1XTDA 4LUDA 4M7DA 4ZTFA 2CREA 2F5KA 3H0HA 3RR6A 5GAN7 3G71A 1YHQT 1ACMB 1WHGA 1VIEA 4F7UA 2JMAA 5L8RE 1S72Q 2EYZA 4RCBA 2DXBA 2O9SA 1M2OA 4KH1B 3F70A 1I07A 2M16A 3QJYA 4KUDK 2VYTA 1WX6A 1M3BA 2DM1A 2LJ3A 2JZ2A 2J06A 3GOXA 1KC8U 3L2VA 3M0RA 2D0NA 1Y96B 2A36A 3SWNC 5CKHA 3RKYA 4X34A 4Z88A 3M0UA 1QVFA 4IUTA 2QTVA 2O4XA 4ZGEB 1M8MA 4LUEA 1KQSS 1I81A 1HD3A 2ECZA 1YJ9T 5IHNA 4LN2A 1WA7A 2WSCE 3TQ7P 2ZPFB 2LC4A 1YI2A 2MF2A 5GMKj 4ME7A 1YJWA 2JMCA 2J05A 2J6OA 1Q7YU 4JJDA 1VYVA 3PNWC 2LT4A 3V7RA 1BI1A 1PHTA 1Q81C 2JN0A 1K9MR 2EPDA 3X26B 4DBRA 1M3CA 1N5ZA 4M77A 1MGQA 3A8MB 3SWNB 1GFDA 2L8DA 3MCAB 4BACA 4CI0C 2X4XA 2RA2A 3O8VA 4BDYA 3SFMA 5IAYA 3TVTA 4QQGA 2Y4YA 2DA9A 4OF1A 1H8KA 2AIRB 2E41A 3CD6T 1SHGA 5CKFA 1O9SA 2M02A 4BE2A 4AFUC 1M1KU 1JJ2A 1W2BP 3THKA 5IN1A 1NJIU 2DTHA 2DILA 3JB9J 2LJ0A 2WSFE 2KQWA 3RBBB 4MDXA 1A0NB 2DO3A 4HCBA 2RJCA 3CPWA 3PTAA 4RMOA 3L2RA 2ROLA 3CCUA 5HKCA 2DTOA 3KUFA 1VQKT 3Q1JA 4A4GA 1VQPT 2DVJA 1Y96A 4C0DB 1JQQA 2RPNA 4M7AD 3C95A 1Y07A 3CMAA 1VQ4A 2HMAA 2YLBA 2RK1A 2KGTA 4A4KA 1WGSA 1YCSB 4DBHA 4C5GA 2CP5A 2V8JA 1OX9A 1N8RC 4ORZA 1JEGA 4OVAA 1WHKA 4DBQA 4OMQA 3OS1A 3PE0A 1LCKA 2QASA 1NBEB 5GMKm 2OTJT 5CQYA 1M90R 1K8AR 2CP2A 1BCMA 1QP3A 2W0ZA 1RACB 3CCJT 3EGXB 4WF2A 3OS0A 2EQJA 2BKDN 4J6XA 4N4HA 3CCMA 4ANJA 2LCLA 1BB9A 2DRMA 3VUZA 3A8HB 2E3HA 1T0JA 4HVVA 3FJPA 3OYDA 3V8LA 5FLXE 1VQ9Q 4J5YA 3I56Q 1UUEA 1K4US 4E6RA 2FRYA 2CS7A 2FYKA 3OYNA 3HKSA 4XU1A 3J7AF 4C92D 3GIBA 1AD5A 4PJNA 1YJNT 2QXFA 5GANf 3META 1ZQ1A 2GQIA 1YIJT 3I5RA 4M78C 3L2UA 3SWNA 1ZBJA 2EJGA 4BB7A 2HEQA 4C8QG 1U8RA 5GAN6 2C06A 1YNZA 3HHTB 4M7AE 1JXOA 1AZEA 3V7SA 4LXCA 1R0BG 4A4FA 1RAGB 2L89A 5GMKh 2K7AA 3ER0A 2P0PA 3L1AA 1JRIA 4ZN3A 3HL8A 1OX8A 4Z8AA 2E12A 2ATCB 2P4RA 1N27A 4F7UG 2X4JA 1LVKA 2BE7D 4NOYA 1WPYA 1JU5C 1VYUA 5KCHA 3M58A 5GANg 4D8DA 2V1RA 4MZPA 1SSHA 2OAWA 3QPHA 4A54A 1D09B 3V8JA 2JUFA 2YWWA 2E64A 2XHCA 3I55A 3CCST 3MKDA 4FT2A 2GFAA 1Q81U 2CUBA 4GLKA 3EAEA 1Q7YR 5GANd 4C92E 1U06A 2JS0A 1VQ6Q 5GAMj 4RTYA 2CKKA 2YDLA 4MZTA 1VQ7A 4F17A 4FW1A 3JCMV 2JOYA 3HRTA 3EGXA 5CKEA 4M4ZA 4M78D 2BZYA 1UJYA 1RL2A 1KFZA 4IUPA 1IB8A 1B3QA 2R58A 3OMCA 3PGGA 1LJOA 1RADB 2DE0X 2RH2A 8ATCB 3CCVQ 2QQ9A 3JSCA 3X28B 4JLGA 1YWOA 4MMLA 1WHJA 1SSFA 2QAZA 3I5SA 3BDLA 1ZX6A 2HQXA 1LPLA 2FPEA 2J6FA 4EMKB 5LJ3j 5GANh 2MK5A 3JCMe 2GCXA 1MV0B 2X51A 3M4YA 3RESA 2M1HA 1HXDA 2A0FB 2DRKA 3FRNA 2GQVA 4BI8B 2WACA 4QQDA 3G4SA 1OZ2A 3V8KA 5AYFA 2HSPA 3FB9A 2DZ9A 2OX7A 3TREA 4ELZC 2DJQA 2LTOA 2RHXA 4JZ3A 4IUQA 1NJIR 2LRQA 2QK0A 4J9DA 1VQ8A 1FXXA 1VQNT 2ZPHB 4M78F 2DXUA 1H3HA 4V2SA 2DD5A 3JB9H 3TEEA 1FWZA 2CZ1B 4IUUA 1IRXA 4HVUA 2MWPA 2HD0A 1N8RU 3OBYA 3CC2A 1MMDA 1OU8A 4GY5A 2F1LA 1I5LA 2CDTA 2JTFA 5IH2A 4HA8A 4D6WA 3RDVA 1IZ6A 2JTMA 2DLPA 5FWCA 2QDLA 2HQEA 3OYMA 1VQ8Q 1G3WA 2COYA 4M78E 1O75A 3S3NA 3PFSA 1OEBA 1SG5A 3M9QA 2MAMA 1VQMT 3QXEB 2LZ6B 4Q5WA 5I21A 1UJ0A 1NZ9A 2JM8A 1KD1U 2EQIA 2RF0A 4DEXA 1S72T 2CZ6B 1ZUYA 3CBOA 5CKDA 1VYTA 1OPLA 2FZGB 1U1TA 3CXCA 2HCKA 3SEMA 2FHDA 4RTWA 4F16A 3RMSA 5KYWB 2RB6A 2KRSA 5KCOA 1TTHB 2CH4W 5GAMe 1WDXA 4OB2B 1U5SA 4PK4A 2FPFA 5GAN3 3CBMA 1KHIA 1K76A 1YITA 2V1QA 5HK0A 4FYVB 5D7UA 2KI7A 1KK7A 3E9FA 1Q82C 1QQJA 3KBGA 4AG1C 2COWA 2K3YA 4WTOB 1TUGB 4RTXA 3OYCA 3OYAA 1G83A 2A3LA 4LDYA 3TSZA 3AT1B 2C0IA 3MEUA 1SRMA 1UTIA 2V8KA 4ZNXA 3HPWA 5LJ3g 2QEXA 1ZHIA 3C94A 1B07A 1AT1B 1WHHA
chains in the Genus database with same CATH topology
1OQKA 1TS9A 1TSFA 1PC0A 2ZAEA 1V76A 2KI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQK A;  1TS9 A;  1TSF A;  1PC0 A;  2ZAE A;  1V76 A;  2KI7 A; 
#chains in the Genus database with same CATH topology
 4O5V A;  1FYN A;  4EMK A;  1KQ2 A;  2EYY A;  3R6N A;  2RQT A;  4OMO A;  1NLO C;  4J6W A;  1NPR A;  2DNU A;  2PNI A;  3PVQ A;  3LH5 A;  1TOV A;  5J26 A;  5LJ3 d;  2HQH A;  2M9U A;  1NYF A;  2O31 A;  4YTL A;  4LDX A;  3M5A A;  2I2L A;  5EG2 A;  2L3R A;  1ARK A;  2EVR A;  2DX1 A;  2ZZD A;  1I8F A;  2ZCF B;  4J6Y A;  2COZ A;  3LWI A;  3NTH A;  4J8O A;  2QA4 A;  3JB9 F;  2B86 A;  2DYI A;  1D3B B;  1RAA B;  3QDF A;  1E7O A;  1PRL C;  4BE1 A;  3NFC A;  2NUT B;  2YRV A;  4JRI A;  2QQS A;  1YIT Q;  2FZK B;  1K0X A;  2C0O A;  5LL6 S;  3LLR A;  3CCR Q;  3T9N A;  5GAN 8;  3QYG B;  2E65 A;  5LJ3 h;  2V26 A;  4J9H A;  4A53 A;  3E1S A;  2DJZ A;  5FRO A;  2EKH A;  2DIQ A;  4OB3 B;  1UGQ B;  2X3W D;  4PJL A;  3REA B;  2DXC A;  4GBQ A;  2QGG A;  4XTW A;  3QII A;  1VQO A;  3NPF A;  1X27 A;  3G1J A;  2D8H A;  5KYW A;  2QQA A;  4K11 A;  3VS4 A;  3G71 Q;  1HK9 A;  1EIF A;  4R0K A;  3OW2 A;  2ENM A;  2E3I A;  2K9G A;  4L6V 5;  2OJ2 A;  3RUX A;  2GTO A;  4RTV A;  1PD0 A;  5IHK A;  1C0M A;  1FMK A;  5LJ5 j;  5GJW B;  1QVF S;  2EQU A;  5C6S A;  4P5N A;  3UT1 A;  1PD1 A;  1WI7 A;  1W1F A;  2JXB A;  1MND A;  5I11 A;  4PL6 A;  2BE9 B;  4LNP A;  4KH0 B;  4QT7 A;  1M3A A;  2OI3 A;  3EG2 A;  2DAQ A;  2D1X A;  5KYU B;  3VRZ A;  1K0S A;  1KQS A;  3CC4 A;  3G6E A;  1CSK A;  2LQK A;  3MPU B;  4DA4 A;  1UE9 A;  3OYG A;  4IIO A;  2KEA A;  4B6M A;  4C92 G;  2K57 A;  3CEY A;  1KIK A;  2FRW A;  4M7A C;  1TXQ A;  3ASK A;  1VQ9 T;  3EGU A;  1E6H A;  2KRN A;  2HSE B;  1SKU B;  1P92 A;  4CC4 B;  3I56 T;  1WQ7 A;  7AT1 B;  1YI2 Q;  1D3B A;  2RHI A;  2GGR A;  2JW4 A;  1YJW Q;  1KD1 R;  1NLP C;  4PFZ A;  2JNG A;  1I0C A;  1YHQ A;  2NUT A;  1K73 C;  3QZ9 B;  2NYS A;  4J9I A;  1HJD A;  4OMP A;  2JM9 A;  3GP8 A;  1GCQ A;  3HTR A;  2AKK A;  3JCM Q;  2EGA A;  1UFF A;  4C5H A;  1CKB A;  1Q82 U;  2EKO A;  4BI3 A;  4OML A;  1WJR A;  2A37 A;  3NHN A;  2X35 A;  2KAF A;  4B9W A;  2KT1 A;  3S3M A;  3FDR A;  3VJP A;  4Y28 E;  2X9H A;  4GLM A;  2OTL A;  1IXD A;  4C92 C;  3OYY A;  2R5A A;  5CO7 A;  1ZSZ C;  3SHW A;  1MHN A;  1PCX A;  2O2O A;  4ESR A;  2MOX A;  2M0Y A;  3FJ5 A;  3H0F A;  4M7A B;  2RJF A;  2RO0 A;  3VRY A;  2QQB A;  4E7L A;  2DIG A;  1PKS A;  4BY6 C;  1WFW A;  2CP7 A;  1YN8 A;  1QKW A;  2VUB A;  2K5F A;  6AT1 B;  2OTL Q;  4KUL A;  2XD0 A;  4E7K A;  2DD4 A;  2KDS A;  5LJ5 e;  3EH2 A;  5ECA A;  4HT9 A;  4M78 G;  2G3R A;  2L3S A;  2ZPB B;  1LOJ A;  1WNL A;  1PSE A;  1UEB A;  3CCU Q;  1VQ6 T;  3CPF A;  4FT4 A;  3SD4 A;  2O88 A;  1D0X A;  2RQR A;  2E4H A;  2JS2 A;  1RI9 A;  3RNJ A;  1VQ4 Q;  3CMA Q;  4XTZ A;  2DPP B;  4PFP A;  3GF5 A;  5DLQ E;  4JS5 A;  4QQ6 A;  3I55 T;  1MMN A;  2LMJ A;  4CRI A;  2DVE A;  3DB4 A;  4KGZ B;  3QYH B;  3CCV T;  1Z9Q A;  4C92 B;  1RAF B;  1ZA1 B;  4AFS C;  1Q86 C;  4M7A F;  1ZSZ B;  3CC7 A;  1X69 A;  4L5G A;  1K9A A;  1WYX A;  3BFM A;  1K9M C;  3C0C A;  4AT1 B;  2MPX C;  1TWB A;  1N9S A;  1FMV A;  2KYB A;  3CCM Q;  3QO3 A;  2WSE E;  4X9D A;  1GRI A;  1HSQ A;  3ULR B;  4JJN K;  4RUG A;  3P8H A;  4BY6 B;  1SRL A;  3OYK A;  1ZA2 B;  4J7I A;  3CD6 A;  1JXM A;  1R0C B;  4RG8 A;  3CC7 Q;  2GFU A;  3G7Z A;  2DEU A;  1KC8 R;  1MMA A;  3FC3 A;  4KUI A;  4PFO A;  4J9C A;  4J9B A;  3MEW A;  1D0Y A;  2LDM A;  2RQV A;  1RAE B;  3INZ A;  3OS5 A;  4HCC A;  2M0O A;  2F5T X;  5FRN A;  2QTX A;  1OI1 A;  2H3E B;  3EHQ A;  1PKT A;  3U23 A;  3BDU A;  2GNC A;  4KGX B;  2EYX A;  1VQK A;  3QWX X;  4DQ2 A;  2JVV A;  1VQP A;  1QVF P;  4C92 F;  2X4Y A;  1JB0 E;  2XDD A;  1VQ8 T;  2CZ0 B;  2B8A A;  2XI9 A;  5A0G A;  1NEG A;  4IIM A;  3M57 A;  2LNH B;  2YXY A;  1QCN A;  2NWM A;  1QMC A;  2RI5 A;  2VXF A;  4FYX B;  3C4S A;  5KYY B;  5KYX B;  4PJO C;  2CH4 A;  3H41 A;  2P0K A;  1GCP A;  3M56 A;  3PT9 A;  1X01 A;  2HL5 C;  2P0Q A;  2XDP A;  4FCY A;  1UGV A;  2LJ1 A;  5A0D A;  4M75 C;  3CCJ A;  1WLP B;  1QWE A;  2JT4 A;  1M4Z A;  2MWO A;  4QW2 A;  1UB4 A;  2CYZ B;  5KE3 A;  3NMZ C;  2PQW A;  4OMM A;  1KQ1 A;  4M78 B;  1PRM C;  2ESW A;  3JB9 G;  3JCM X;  1G3Y A;  1FX7 A;  1K8A C;  1Y0M A;  1K73 U;  3AHU A;  4N0A C;  1XJW B;  1IGU A;  3UPU A;  1GFC A;  3CCL A;  3I55 Q;  4XTU A;  3VS0 A;  1WQW A;  3VS2 A;  1UGP B;  1WXT A;  1OYX A;  1WIE A;  3QKJ A;  4HXJ A;  3VYG A;  2SRC A;  1OOT A;  1UDL A;  3CCQ A;  1QWF A;  3VS3 A;  5C0M A;  2O01 E;  3HFO A;  1Y71 A;  2VB6 A;  1U3O A;  2RJD A;  3EG1 A;  3RKX A;  2VC8 A;  4PLL A;  4JJC A;  3JCM g;  1VQ7 Q;  4C92 A;  1Q82 R;  5CK9 A;  1ZSZ A;  3RMQ A;  2E6N A;  1YIJ A;  3OQ5 A;  2C0T A;  3JCM c;  3VYH B;  3CCL Q;  1YIT T;  2PUO B;  1VIF A;  4PJO B;  2FG0 A;  1DJ7 B;  1M1K R;  3JCM d;  3VS6 A;  3A8O B;  3CCQ Q;  3OS2 A;  1TU0 B;  4PJO D;  5D6W A;  4MMK A;  1ABO A;  3DKM A;  2XG8 D;  3QDR B;  2L3P A;  3MP6 A;  3P8D A;  3DLM A;  4JS4 A;  2YHT A;  4KRT A;  2K4Y A;  5GAM f;  2HL3 A;  5DM7 R;  4Z02 A;  2DL4 A;  4M75 D;  2EIF A;  2DMO A;  4OGE A;  3G4S Q;  1WJQ A;  4C5E A;  2RNA A;  2VAS A;  3OYB A;  1J3T A;  5DLO A;  1JBM A;  4F14 A;  1YBY A;  1VQ5 A;  3ZL7 C;  2DF6 A;  2E10 A;  2AK5 A;  4FSS A;  1SEM A;  4J7F A;  2K6D A;  3MO8 A;  1YWP A;  1QVG S;  2D6F A;  1D1A A;  3M0P A;  5EC7 A;  3JCM h;  3CCR T;  4C8Q D;  3OYJ A;  1AWJ A;  1M30 A;  2KE9 A;  3CC2 Q;  1F1B B;  5KYY A;  5KYX A;  5LJ3 f;  2DEQ A;  4PJO F;  1X75 C;  5AT1 B;  5GMK l;  1I1J A;  2GBQ A;  4X9C A;  1Q86 U;  1VQ5 Q;  2KRO A;  4PKC C;  2FL7 A;  3OA6 A;  1EZZ B;  4FM4 B;  4DBF A;  3CXC S;  2PVO B;  3QZ5 B;  2VGN A;  3VS7 A;  4FYY B;  1TSF A;  5GAM g;  1OZ3 A;  4M75 F;  1GBQ A;  4M7D D;  3URG A;  3MEV A;  5GAO n;  2YRC A;  5IHI A;  4O6J A;  1BI3 A;  3H8Z A;  2VVK A;  4M78 A;  4HCK A;  3EG3 A;  2CZ7 B;  2DBK A;  4KGV B;  3M59 A;  3G71 T;  4MZM A;  2K5I A;  5GAM d;  4PJO E;  4AFZ C;  1BI0 A;  3A8L B;  2FB7 A;  4TVR A;  3TCJ A;  2LX9 A;  3N5B B;  3OYI A;  1U1S A;  3JCM b;  1V29 B;  2JJ9 A;  1M2V B;  4M75 E;  4M77 C;  5M9O A;  2NLU A;  3WXM B;  3L42 A;  2CP0 A;  3I35 A;  3M53 A;  4NL3 A;  3M0Q A;  4JDS A;  1W2B A;  2LP5 A;  1AVZ C;  4OMF B;  2O4X B;  4EIK A;  1VQN A;  1YFN A;  3REB B;  2K5L A;  4E7J A;  4M7D F;  2D9T A;  4R55 A;  2K3X A;  2JTE A;  2BIV A;  4C8Q E;  2E5K A;  4IUR A;  3QWY A;  4II1 A;  2K2V A;  4IKF A;  1IHW A;  2XMF A;  5GAM h;  2BTT A;  2KXC A;  1NJI C;  5GAO m;  4OMN A;  3BW1 A;  5J3B A;  2QEX Q;  2IG0 A;  2HKQ B;  1BCO A;  3PMT A;  1TH7 A;  3DLL A;  4EMH A;  1RAH B;  2RI2 A;  4XU0 A;  4HVW A;  1VQL A;  4KT0 E;  2KSS A;  2PTK A;  4M7D E;  2QI2 A;  1JO8 A;  4OGC A;  2PU9 B;  4F7U E;  1YI2 T;  3BE3 A;  1R77 A;  3OYH A;  4FW2 A;  4N0A A;  3S3O A;  1Q81 R;  1YJW T;  2MMP A;  1BK2 A;  2HAX A;  3CCE A;  3H6Z A;  2ZPI B;  1WJS A;  2VKN A;  4PJJ A;  1KG1 A;  4KBM B;  2KRM A;  1RLP C;  2CUD A;  3OY9 A;  2DYB A;  2QA4 Q;  1VQL Q;  3OSV A;  1Y57 A;  3JB9 I;  3GPL A;  1W70 A;  3OYL A;  2AT1 B;  4M77 D;  1KSW A;  4N4G A;  2PUK B;  4OB1 B;  3EFS A;  3C12 A;  3CCE Q;  2EJF A;  2DZC A;  2LX7 A;  1G2B A;  4MDW A;  4DOV A;  3HRS A;  2QYZ A;  3UF4 A;  3OYF A;  1X6O A;  2YRD A;  1ABQ A;  4M7A G;  2EYQ A;  2ZPG B;  2MCN A;  4F04 B;  1RUW A;  3EG0 A;  3GNF B;  3A98 A;  2LT1 A;  3OW2 S;  2ZGW A;  3SB2 A;  5FWB A;  4A63 B;  2FO0 A;  2DL3 A;  2HDA A;  1QCO A;  4XTV A;  4A4E A;  5CCA A;  3EGD B;  4E7I A;  3RKW A;  2CSQ A;  4FSX A;  2Y4X A;  1VQO Q;  2OAU A;  2P4T A;  2QDY B;  1KHC A;  3IQL A;  3QUI A;  2H3J A;  2OTL T;  4HT8 A;  1M2V A;  4C5I A;  2W10 A;  2KK4 A;  2RHY A;  3MP8 A;  2AZS A;  4M77 F;  3M55 A;  4XTY A;  1XQH A;  4RKU E;  3VUB A;  4QVC A;  3I9Q A;  1SF9 A;  3A5Z B;  1N8R R;  3PMI A;  3QJ6 A;  2DL7 A;  3CCU T;  2J7I A;  1QP2 A;  2F2W A;  3OBW A;  1NG2 A;  5I22 A;  2HBW A;  2RHZ A;  2DXT A;  2L3Q A;  2EWN A;  4HKE A;  5GMK i;  1VQ4 T;  3CMA T;  1WHL A;  1B34 B;  1QVP A;  1G3S A;  3E2U A;  4D8K A;  2X4W A;  1PSF A;  4M77 E;  3CME A;  2YT6 A;  3H0I A;  3NTI A;  4JRQ A;  1PNJ A;  3PVL A;  4BI4 A;  1QVG P;  2CGH A;  2XK0 A;  2LCS A;  2Z0W A;  1TUD A;  2VXE A;  1IRE B;  1QW1 A;  1G8X A;  3CBP A;  2KNB B;  5GAN 4;  2HNI A;  1ZUK A;  1YP5 A;  4RCC A;  3G6E Q;  3CC4 Q;  3CCM T;  1Q86 R;  3RER A;  1AHJ B;  1TS9 A;  3LH0 A;  2EQM A;  3R6O A;  3GBQ A;  3CXC P;  4C0D C;  3CME Q;  1D1C A;  9ATC B;  4FL6 A;  1N6A A;  4C0G A;  5LJ5 f;  2KR3 A;  1D1B A;  3MEA A;  1IHV A;  1TG0 A;  1W4S A;  4ZTJ A;  2FVU A;  3HP9 A;  3CC7 T;  3KFV A;  1RLQ C;  4XU2 A;  1N9R A;  2EW3 A;  3H9N A;  5KYN A;  8AT1 B;  4R56 A;  4OB0 B;  1YHQ Q;  1OU9 A;  2DL5 A;  1JJ2 S;  1UEC A;  1XNI A;  2E1H A;  1X2Q A;  1M8V A;  1K1Z A;  2PZ1 A;  4HCZ A;  2O9V A;  4N4I A;  3CPW S;  1YCY A;  1C1A A;  3EFO B;  1AZG B;  3L2Q A;  2IIM A;  4LD9 K;  2E6Z A;  5KE2 A;  4RTU A;  4ELY C;  1T0H A;  1X6B A;  4Y92 A;  3OSS C;  3L2W A;  2NUP B;  4E47 A;  2KBT A;  2EGC A;  1QKX A;  2ABL A;  3EGD A;  1EFN A;  5LJ5 g;  1YJ9 A;  1BBZ A;  1PM3 A;  2FPD A;  5FW9 A;  1WHM A;  2I0N A;  4DEY A;  2DKG A;  5GAN j;  4Y91 A;  2J6K A;  4OP0 A;  4FYW B;  5LJ5 d;  3TSW A;  4B9X A;  3KXT A;  3L2Z A;  2E5Q A;  1OV3 A;  2XU8 A;  1Z9Z A;  3UWN A;  3UAT A;  5GAO l;  2BUD A;  4QVZ A;  4J9E A;  2VGM A;  5KYU A;  2ZPE B;  1YJ9 Q;  1VQ9 A;  2HBP A;  1MUZ A;  3OMG A;  3I56 A;  4ATO A;  3NGP A;  1B34 A;  1ZBX A;  1IO6 A;  3M54 A;  3S6W A;  3X20 B;  5GAN 2;  3SDZ A;  3OYE A;  2MYS A;  4LDW A;  3UDC A;  1EX4 A;  3JCM J;  5DY9 A;  2L2P A;  5GMK e;  1B7T A;  3LYI A;  1VA7 A;  1E6G A;  1NEB A;  2YLC A;  1VQ7 T;  1SPK A;  2PVG B;  4PJO G;  2V8I A;  3LGF A;  5FU6 C;  1M1G A;  1VOM A;  4CC2 A;  1NYG A;  4LE9 A;  3J81 E;  3HSB A;  1KD1 C;  5LJ5 h;  3CCL T;  1WXU A;  1AEY A;  2AHJ B;  4RTT A;  4M75 G;  4E7S A;  2FEI A;  3VKI A;  4XU3 A;  1H92 A;  1V76 A;  1BYM A;  1GL5 A;  4C0Z A;  4QVD A;  3CCQ T;  4UC4 A;  5I2M A;  3A8G B;  2YUN A;  3FIF A;  5GAO q;  3OW2 P;  1I5O B;  3JCM W;  3MP1 A;  5L23 A;  4BD3 A;  2QQR A;  1M27 C;  4JUV A;  1ZLM A;  3J80 E;  3G4S T;  3RIR A;  3UA7 A;  5HY6 A;  3CD6 Q;  1AWO A;  5GJV B;  2RI3 A;  4J83 A;  2RHU A;  5CIU A;  4M7A A;  5CR2 A;  2NUZ A;  4M7D G;  3EFO A;  2QGF B;  3JCM f;  2OTJ A;  2RD1 A;  3PIP A;  3CC2 T;  4EMK C;  4NS5 A;  3FEO A;  1VQ6 A;  3ZEH A;  2NUP A;  4PJM A;  1KQS P;  5FU6 B;  5GAO r;  1VQK Q;  2RQW A;  3VV0 A;  1VQP Q;  2K79 A;  1VQ5 T;  5FRM A;  4CC7 A;  2KY9 A;  2EBP A;  1RI0 A;  2EYW A;  2VWF A;  2DTI A;  1X43 A;  5GAN e;  4LDV A;  2R5M A;  3M0S A;  2XKO C;  2X3X D;  5IT9 E;  1M90 C;  4XK8 E;  5CVI A;  3JCM P;  4E2F B;  1UGS B;  1G5V A;  2M51 A;  1AOJ A;  3QSU A;  1ZSG A;  2P84 A;  2L5Q A;  2OTJ Q;  4WCI A;  3CCV A;  1BIB A;  4XQ3 A;  4C8Q C;  1UHF A;  3GNG A;  1SHF A;  3CCJ Q;  1LNX A;  1C6V X;  3EFR A;  3JV3 A;  3LW5 E;  4LD6 A;  4EDU A;  5KH6 A;  2L0A A;  1QLY A;  1FMW A;  2G6F X;  2EFI A;  2RN8 A;  2EAY A;  1YJN A;  4X1V A;  5GAO p;  4FIB A;  4NL2 A;  1KJW A;  3QHS A;  4JZ4 A;  2KMT A;  4M7D C;  4JLI A;  5HCK A;  4JRP A;  2YUP A;  1UGR B;  2ED0 A;  1UHC A;  5J39 A;  1W6X A;  4ZGD B;  3OB9 A;  1WXB A;  2DER A;  1VUB A;  3VS5 A;  1CKA A;  5CAI A;  4CC3 A;  3MHX A;  2F2X A;  1JJ2 P;  5I2S A;  4QKU A;  4M75 B;  1YJN Q;  4PNO A;  1WZO A;  1H64 1;  1T3S A;  3NTK A;  2GF7 A;  1YIJ Q;  3CPW P;  4ZGJ B;  1ZUU A;  2QEX T;  1KC8 C;  1R8O B;  2IVW A;  2FZC B;  4DOW A;  4A4H A;  1MV3 A;  1RAB B;  3EG9 B;  2D0Q B;  2LNV A;  5A0L A;  3M0T A;  2DK3 A;  1M9S A;  2AZV A;  1H3Z A;  2HZY A;  2F69 A;  5A2Q E;  1G3T A;  2LQN A;  2D8J A;  4EPC A;  4C8Q B;  2VV5 A;  4M77 G;  3GLX A;  1UG1 A;  2MI6 A;  3CCS A;  1V1C A;  2XID A;  4XTX A;  2Y90 A;  1X2K A;  3E19 A;  4J9F A;  1PWT A;  1TUC A;  1IGQ A;  2BZ8 A;  2ROT A;  1OUL A;  2H8H A;  2QA4 T;  4BUG A;  2E70 A;  2SEM A;  3PIO A;  1D0Z A;  1VQL T;  2A08 A;  1HYO A;  4M7D B;  1QVG A;  1PG5 B;  1NPP A;  4F7U B;  4BE0 A;  5IXB A;  1K9M U;  3DB3 A;  2RQU A;  2LQW A;  1Q7Y C;  5D6Y A;  2YSQ A;  4L59 A;  3CCE T;  2A28 A;  3CCS Q;  3BY7 A;  2KVQ G;  2GTJ A;  2R57 A;  3A1P A;  3LGL A;  1AWX A;  3EHR A;  1OPK A;  2HKN A;  2F2V A;  1BI2 A;  5CQX A;  1MMG A;  4PLI A;  4C8Q F;  3TU4 K;  3FLG A;  4EMG A;  3VU3 C;  4JPB W;  2XIC A;  1VQO T;  2LCC A;  2RK2 A;  3QG1 A;  2CT3 A;  1BKB A;  1NE8 A;  3E9G A;  1GXI E;  2CP6 A;  1GCQ C;  4FU6 A;  5HK3 A;  1W2B S;  2QG9 B;  2RMO A;  3JB9 D;  4C0F A;  1X6G A;  4BDZ A;  3ME9 A;  5FU7 C;  3X24 B;  1Y7X A;  1BU1 A;  4AFQ C;  4AG2 C;  1BIA A;  3QBY A;  4RTZ A;  2YUO A;  3JAM E;  2XDB A;  1OQK A;  2LQ8 A;  4F7U F;  4E7Z A;  1MNE A;  4PJO A;  2DL8 A;  3HFN A;  1M1K C;  2EJ9 A;  2AKL A;  2EQK A;  2KT8 A;  3V7C A;  2RJE A;  4XAX B;  5LJ3 e;  3LX7 A;  2IPO B;  1QCF A;  3JRZ A;  4VUB A;  3ZBD A;  2BZX A;  4M75 A;  4LDU A;  2LVM A;  2DBM A;  2K2M A;  4IUV A;  3ZFJ A;  2KXD A;  1T3L A;  1Q95 G;  2MIO A;  4JRK A;  1VQN Q;  2A7Y A;  4RG2 A;  4E7H A;  2YUQ A;  4JJB A;  1GBR A;  2KYM A;  3D7S B;  2DFU A;  4AMC A;  3VS1 A;  3CCR A;  2RM4 A;  1M5Q 1;  3EG9 A;  1VQM A;  3MJX A;  2ZAE A;  3P8B B;  3WVE B;  1M90 U;  2EGE A;  3M4G A;  2CP3 A;  1K8A U;  3CC4 T;  3G6E T;  2K3B A;  3CQT A;  4ZN1 A;  1PC0 A;  1NM7 A;  2ED1 A;  4C8Q A;  1XOV A;  1AWW A;  2CSI A;  3WVD B;  1I4K 1;  1S1N A;  1S72 A;  4M77 B;  4Z89 A;  3CME T;  5D6X A;  2PVD B;  3O5Z A;  1K73 R;  3HRU A;  2CT4 A;  1M1F A;  1RAI B;  5IXF A;  2DET A;  3UA6 A;  5GAN 5;  3X25 B;  3LWH A;  3EH1 A;  5CKB A;  4J9G A;  1VQM Q;  5FU7 B;  1XTD A;  4LUD A;  4M7D A;  4ZTF A;  2CRE A;  2F5K A;  3H0H A;  3RR6 A;  5GAN 7;  3G71 A;  1YHQ T;  1ACM B;  1WHG A;  1VIE A;  4F7U A;  2JMA A;  5L8R E;  1S72 Q;  2EYZ A;  4RCB A;  2DXB A;  2O9S A;  1M2O A;  4KH1 B;  3F70 A;  1I07 A;  2M16 A;  3QJY A;  4KUD K;  2VYT A;  1WX6 A;  1M3B A;  2DM1 A;  2LJ3 A;  2JZ2 A;  2J06 A;  3GOX A;  1KC8 U;  3L2V A;  3M0R A;  2D0N A;  1Y96 B;  2A36 A;  3SWN C;  5CKH A;  3RKY A;  4X34 A;  4Z88 A;  3M0U A;  1QVF A;  4IUT A;  2QTV A;  2O4X A;  4ZGE B;  1M8M A;  4LUE A;  1KQS S;  1I81 A;  1HD3 A;  2ECZ A;  1YJ9 T;  5IHN A;  4LN2 A;  1WA7 A;  2WSC E;  3TQ7 P;  2ZPF B;  2LC4 A;  1YI2 A;  2MF2 A;  5GMK j;  4ME7 A;  1YJW A;  2JMC A;  2J05 A;  2J6O A;  1Q7Y U;  4JJD A;  1VYV A;  3PNW C;  2LT4 A;  3V7R A;  1BI1 A;  1PHT A;  1Q81 C;  2JN0 A;  1K9M R;  2EPD A;  3X26 B;  4DBR A;  1M3C A;  1N5Z A;  4M77 A;  1MGQ A;  3A8M B;  3SWN B;  1GFD A;  2L8D A;  3MCA B;  4BAC A;  4CI0 C;  2X4X A;  2RA2 A;  3O8V A;  4BDY A;  3SFM A;  5IAY A;  3TVT A;  4QQG A;  2Y4Y A;  2DA9 A;  4OF1 A;  1H8K A;  2AIR B;  2E41 A;  3CD6 T;  1SHG A;  5CKF A;  1O9S A;  2M02 A;  4BE2 A;  4AFU C;  1M1K U;  1JJ2 A;  1W2B P;  3THK A;  5IN1 A;  1NJI U;  2DTH A;  2DIL A;  3JB9 J;  2LJ0 A;  2WSF E;  2KQW A;  3RBB B;  4MDX A;  1A0N B;  2DO3 A;  4HCB A;  2RJC A;  3CPW A;  3PTA A;  4RMO A;  3L2R A;  2ROL A;  3CCU A;  5HKC A;  2DTO A;  3KUF A;  1VQK T;  3Q1J A;  4A4G A;  1VQP T;  2DVJ A;  1Y96 A;  4C0D B;  1JQQ A;  2RPN A;  4M7A D;  3C95 A;  1Y07 A;  3CMA A;  1VQ4 A;  2HMA A;  2YLB A;  2RK1 A;  2KGT A;  4A4K A;  1WGS A;  1YCS B;  4DBH A;  4C5G A;  2CP5 A;  2V8J A;  1OX9 A;  1N8R C;  4ORZ A;  1JEG A;  4OVA A;  1WHK A;  4DBQ A;  4OMQ A;  3OS1 A;  3PE0 A;  1LCK A;  2QAS A;  1NBE B;  5GMK m;  2OTJ T;  5CQY A;  1M90 R;  1K8A R;  2CP2 A;  1BCM A;  1QP3 A;  2W0Z A;  1RAC B;  3CCJ T;  3EGX B;  4WF2 A;  3OS0 A;  2EQJ A;  2BKD N;  4J6X A;  4N4H A;  3CCM A;  4ANJ A;  2LCL A;  1BB9 A;  2DRM A;  3VUZ A;  3A8H B;  2E3H A;  1T0J A;  4HVV A;  3FJP A;  3OYD A;  3V8L A;  5FLX E;  1VQ9 Q;  4J5Y A;  3I56 Q;  1UUE A;  1K4U S;  4E6R A;  2FRY A;  2CS7 A;  2FYK A;  3OYN A;  3HKS A;  4XU1 A;  3J7A F;  4C92 D;  3GIB A;  1AD5 A;  4PJN A;  1YJN T;  2QXF A;  5GAN f;  3MET A;  1ZQ1 A;  2GQI A;  1YIJ T;  3I5R A;  4M78 C;  3L2U A;  3SWN A;  1ZBJ A;  2EJG A;  4BB7 A;  2HEQ A;  4C8Q G;  1U8R A;  5GAN 6;  2C06 A;  1YNZ A;  3HHT B;  4M7A E;  1JXO A;  1AZE A;  3V7S A;  4LXC A;  1R0B G;  4A4F A;  1RAG B;  2L89 A;  5GMK h;  2K7A A;  3ER0 A;  2P0P A;  3L1A A;  1JRI A;  4ZN3 A;  3HL8 A;  1OX8 A;  4Z8A A;  2E12 A;  2ATC B;  2P4R A;  1N27 A;  4F7U G;  2X4J A;  1LVK A;  2BE7 D;  4NOY A;  1WPY A;  1JU5 C;  1VYU A;  5KCH A;  3M58 A;  5GAN g;  4D8D A;  2V1R A;  4MZP A;  1SSH A;  2OAW A;  3QPH A;  4A54 A;  1D09 B;  3V8J A;  2JUF A;  2YWW A;  2E64 A;  2XHC A;  3I55 A;  3CCS T;  3MKD A;  4FT2 A;  2GFA A;  1Q81 U;  2CUB A;  4GLK A;  3EAE A;  1Q7Y R;  5GAN d;  4C92 E;  1U06 A;  2JS0 A;  1VQ6 Q;  5GAM j;  4RTY A;  2CKK A;  2YDL A;  4MZT A;  1VQ7 A;  4F17 A;  4FW1 A;  3JCM V;  2JOY A;  3HRT A;  3EGX A;  5CKE A;  4M4Z A;  4M78 D;  2BZY A;  1UJY A;  1RL2 A;  1KFZ A;  4IUP A;  1IB8 A;  1B3Q A;  2R58 A;  3OMC A;  3PGG A;  1LJO A;  1RAD B;  2DE0 X;  2RH2 A;  8ATC B;  3CCV Q;  2QQ9 A;  3JSC A;  3X28 B;  4JLG A;  1YWO A;  4MML A;  1WHJ A;  1SSF A;  2QAZ A;  3I5S A;  3BDL A;  1ZX6 A;  2HQX A;  1LPL A;  2FPE A;  2J6F A;  4EMK B;  5LJ3 j;  5GAN h;  2MK5 A;  3JCM e;  2GCX A;  1MV0 B;  2X51 A;  3M4Y A;  3RES A;  2M1H A;  1HXD A;  2A0F B;  2DRK A;  3FRN A;  2GQV A;  4BI8 B;  2WAC A;  4QQD A;  3G4S A;  1OZ2 A;  3V8K A;  5AYF A;  2HSP A;  3FB9 A;  2DZ9 A;  2OX7 A;  3TRE A;  4ELZ C;  2DJQ A;  2LTO A;  2RHX A;  4JZ3 A;  4IUQ A;  1NJI R;  2LRQ A;  2QK0 A;  4J9D A;  1VQ8 A;  1FXX A;  1VQN T;  2ZPH B;  4M78 F;  2DXU A;  1H3H A;  4V2S A;  2DD5 A;  3JB9 H;  3TEE A;  1FWZ A;  2CZ1 B;  4IUU A;  1IRX A;  4HVU A;  2MWP A;  2HD0 A;  1N8R U;  3OBY A;  3CC2 A;  1MMD A;  1OU8 A;  4GY5 A;  2F1L A;  1I5L A;  2CDT A;  2JTF A;  5IH2 A;  4HA8 A;  4D6W A;  3RDV A;  1IZ6 A;  2JTM A;  2DLP A;  5FWC A;  2QDL A;  2HQE A;  3OYM A;  1VQ8 Q;  1G3W A;  2COY A;  4M78 E;  1O75 A;  3S3N A;  3PFS A;  1OEB A;  1SG5 A;  3M9Q A;  2MAM A;  1VQM T;  3QXE B;  2LZ6 B;  4Q5W A;  5I21 A;  1UJ0 A;  1NZ9 A;  2JM8 A;  1KD1 U;  2EQI A;  2RF0 A;  4DEX A;  1S72 T;  2CZ6 B;  1ZUY A;  3CBO A;  5CKD A;  1VYT A;  1OPL A;  2FZG B;  1U1T A;  3CXC A;  2HCK A;  3SEM A;  2FHD A;  4RTW A;  4F16 A;  3RMS A;  5KYW B;  2RB6 A;  2KRS A;  5KCO A;  1TTH B;  2CH4 W;  5GAM e;  1WDX A;  4OB2 B;  1U5S A;  4PK4 A;  2FPF A;  5GAN 3;  3CBM A;  1KHI A;  1K76 A;  1YIT A;  2V1Q A;  5HK0 A;  4FYV B;  5D7U A;  2KI7 A;  1KK7 A;  3E9F A;  1Q82 C;  1QQJ A;  3KBG A;  4AG1 C;  2COW A;  2K3Y A;  4WTO B;  1TUG B;  4RTX A;  3OYC A;  3OYA A;  1G83 A;  2A3L A;  4LDY A;  3TSZ A;  3AT1 B;  2C0I A;  3MEU A;  1SRM A;  1UTI A;  2V8K A;  4ZNX A;  3HPW A;  5LJ3 g;  2QEX A;  1ZHI A;  3C94 A;  1B07 A;  1AT1 B;  1WHH A; 
#chains in the Genus database with same CATH homology
 1OQK A;  1TS9 A;  1TSF A;  1PC0 A;  2ZAE A;  1V76 A;  2KI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...