4ORZA

Hiv-1 nef protein in complex with single domain antibody sdab19 and an engineered hck sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
IIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/apoptosis/immune system
molecule keywords Tyrosine-protein kinase HCK
publication title Structural basis for the inhibition of HIV-1 Nef by a high-affinity binding single-domain antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4orzA00
1VYTA 3H0FA 4RTUA 2B86A 2EW3A 4J9EA 2KRSA 2CT3A 3RBBB 3O5ZA 1T3SA 3QWXX 4LNPA 4HCKA 2ABLA 2JW4A 1GL5A 5L23A 4J9FA 4Z89A 3ULRB 2RQUA 2K2MA 2NUZA 1U06A 4CC2A 1GBRA 1M3BA 2FRYA 2KBTA 3I5SA 2ECZA 2W0ZA 1T0HA 4D8KA 1PRMC 4GBQA 3EG1A 1YCSB 5I11A 1W1FA 2F2XA 2HSPA 1IO6A 1YWOA 3M0QA 2FRWA 2D1XA 3LH5A 4IIOA 2BTTA 4RTWA 3PE0A 1ZUKA 2YUPA 1HJDA 3REAB 1SEMA 1UE9A 1WA7A 2D8HA 1UJ0A 1JQQA 1PWTA 2HDAA 4JPBW 2RQVA 2EKHA 2HEQA 1H3HA 1WIEA 2GTJA 2H8HA 4CC4B 4ESRA 2JM9A 2VWFA 2A08A 3I9QA 2XMFA 1HD3A 1VYUA 2LJ0A 2OJ2A 2VVKA 2KGTA 1AOJA 4WCIA 2DL5A 2DVJA 1GCPA 2KE9A 1T0JA 2RNAA 1E6GA 2EYYA 3JV3A 1W6XA 2FO0A 5GJVB 2PZ1A 4JJCA 2YDLA 4JZ4A 3ZL7C 1KFZA 1S1NA 1AVZC 1TUDA 2DJQA 2EPDA 1Z9ZA 4KRTA 5FWBA 1X6GA 1UG1A 1UJYA 1UHFA 1N5ZA 2KNBB 1BK2A 4RTVA 3UF4A 1WXTA 1H92A 2RQTA 3VS2A 2GBQA 2AZSA 1SSHA 5IXFA 1AD5A 1KSWA 3FJ5A 1SRLA 2X3XD 1SHFA 3C0CA 1RUWA 4J9GA 2DYBA 2D0NA 1Y57A 2C0IA 1SPKA 1M27C 4QT7A 1UTIA 2NWMA 2DF6A 1M3AA 1U5SA 2O9VA 4AFUC 2CSIA 1AWWA 2CUDA 1WI7A 1K76A 1FMKA 1AWOA 3VS4A 1UUEA 1PRLC 5FW9A 3VS5A 3VS3A 2KT8A 1QKXA 3NMZC 2DA9A 2L3PA 4HVWA 1UGVA 1BBZA 1X2KA 2ROTA 3PVQA 2RQRA 3R6NA 2KXCA 4IIMA 1NEBA 1SHGA 2BZYA 2DILA 1CKBA 2K6DA 2FEIA 3I5RA 1GFCA 3M0TA 4D8DA 3TVTA 2ED0A 3EG3A 1KJWA 2PTKA 5FWCA 1ZUYA 2RMOA 2V1QA 1HSQA 2ROLA 3NPFA 2BZXA 2DL7A 2JMAA 3EGUA 3EHRA 1WYXA 2DM1A 2QDLA 1JO8A 1KIKA 3TSWA 1GFDA 2DL8A 1QWEA 4A63B 1PKSA 1UECA 2LJ3A 5HCKA 4CC3A 4AFSC 1Y0MA 1YP5A 5GJWB 3KFVA 1AWXA 2RPNA 1ABQA 1NG2A 2DRMA 3H41A 2CREA 2LX7A 2LCSA 1B3QA 1RLPC 4LN2A 1V1CA 1QKWA 1ARKA 1X43A 2L3SA 1VYVA 2EGEA 2J6OA 2F2VA 4OMLA 1A0NB 1MUZA 2MIOA 1X69A 1K9AA 2O88A 2J05A 1NM7A 1ZBJA 4RTTA 2ESWA 4ZNXA 4OMMA 2RF0A 1ZX6A 4F14A 3U23A 3A98A 2EGCA 4HXJA 4Z8AA 1PHTA 1NYFA 4J9CA 3REBB 2RQWA 2K3BA 1WXUA 1M30A 2O9SA 3EHQA 2EQIA 1RI9A 1EFNA 2CUBA 2GNCA 2DBKA 4LUEA 2SRCA 3M0UA 4JJDA 4AFQC 1ABOA 1U3OA 2EVRA 2LQNA 3M0SA 3VRYA 5IHIA 1NYGA 2CDTA 1YNZA 1E6HA 1NLPC 1OEBA 1QWFA 2MCNA 2AK5A 2J6FA 2JM8A 1ZSGA 2LZ6B 1Z9QA 2FPDA 2KRMA 1RLQC 2LNHB 3M0PA 1WXBA 4J9HA 1YN8A 2K7AA 3QWYA 5IH2A 1QCFA 1JXOA 3VS1A 3M0RA 2KXDA 2X3WD 1SRMA 2BZ8A 4OMPA 1X27A 2K9GA 2DL4A 1OPLA 5IHNA 1OPKA 2L2PA 1GRIA 4AFZC 4OMQA 1G2BA 4OMNA 4CC7A 1AEYA 2KEAA 2YUNA 4JZ3A 1UDLA 2SEMA 4RTXA 2DNUA 2FPEA 1X6BA 1GCQA 4J9BA 2DX1A 2KR3A 4HVUA 4J9DA 2JS0A 3EG2A 3VS7A 4AG2C 4LE9A 1M3CA 2GTOA 1JU5C 2ENMA 1CKAA 2V1RA 2JMCA 2ED1A 2DBMA 2HBWA 2A37A 1AZGB 2RN8A 3GBQA 1OOTA 2YSQA 2LMJA 1AZEA 2AKKA 3I35A 4HVVA 2LP5A 4F16A 2JT4A 3SHWA 2DE0X 1GCQC 2JS2A 2KT1A 1K4US 1JXMA 2CSQA 3SEMA 1FYNA 1YWPA 4Z88A 1J3TA 2W10A 2DRKA 2L3QA 2M51A 4E6RA 2KROA 2P4RA 2K79A 3NGPA 1UFFA 2M0YA 2C0TA 2DL3A 2EYWA 5ECAA 1ZUUA 1I07A 3EG0A 1PNJA 1WLPB 2MOXA 2L0AA 1W70A 1MV3A 3RNJA 3UA7A 2J7IA 2AKLA 4K11A 1B07A 1NLOC 1PKTA 2OAWA 4RUGA 4JJBA 1WDXA 2CT4A 2PNIA 2YUOA 2D8JA 1QLYA 3UATA 3UA6A 2DLPA 5IXBA 1K1ZA 5EC7A 3CQTA 3H0HA 2OI3A 3H0IA 1AWJA 2YUQA 1BB9A 1XOVA 1VA7A 2EYZA 1H8KA 1BU1A 2EGAA 4R0KA 3IQLA 4RTZA 2IIMA 4Y92A 1I1JA 2DMOA 2GQIA 3VS0A 2J6KA 3PVLA 2FPFA 2I0NA 4EIKA 1CSKA 2F2WA 2KRNA 4GLMA 2G6FX 1G83A 2O2OA 4FSSA 1X2QA 1K0SA 1TUCA 1LCKA 3VS6A 4DEXA 1TG0A 2CH4W 1T3LA 1K0XA 5IHKA 4OMOA 1UHCA 4J9IA 2J06A 2JXBA 2E5KA 4RTYA 1JEGA 2LQWA 2KYBA 2O31A 1I0CA 2VKNA 1MV0B 2AZVA 1OV3A 1M8MA 2LJ1A 2CH4A 2A36A 1E7OA 2C0OA 2EYXA 1GBQA 2A28A 4DEYA 4F17A 4AG1C 1WFWA 2JTEA 3VRZA 2GGRA 4X1VA 4LUDA 3TSZA 2EBPA 2FG0A 3THKA 1WX6A 2KYMA 4ORZA 5I22A 3NHNA 4M4ZA 1ZLMA 2YT6A 2HCKA 1NEGA
chains in the Genus database with same CATH superfamily
3SB2A 1VQ4Q 3LGFA 3FLGA 1QVFS 3VV0A 2CT3A 3OYIA 3V8LA 3JCMW 3O5ZA 2HAXA 4A4FA 1Y96B 3CCMQ 1WJRA 2ABLA 4QQ6A 5KE2A 3M54A 3QIIA 4PFZA 1P92A 1U06A 2OX7A 2KBTA 3CCJA 3CCQA 1X01A 2LRQA 2W0ZA 2DEUA 5GAN2 1PRMC 3GOXA 3CCUQ 1N8RU 1NZ9A 1W1FA 4O5VA 3INZA 1YWOA 3M0QA 2NLUA 4IIOA 1M2VB 4RTWA 1JJ2P 3RIRA 1Q81U 1VQKQ 1QVGA 4BUGA 1ZUKA 5CAIA 1RAFB 1WA7A 1UJ0A 3N5BB 1JQQA 1Y96A 4M78E 3FEOA 1NJIU 2EKHA 1YBYA 2DKGA 2HEQA 3C4SA 1H3HA 1WIEA 2QTVA 1S72Q 2QQRA 2JM9A 2VWFA 3PT9A 2LJ0A 1KHCA 2LCLA 2KMTA 3OS0A 1QVGS 4WCIA 5D7UA 1GCPA 3A8HB 1BIAA 3CCVQ 2CGHA 2QGFB 3JV3A 3OMGA 3FIFA 4NL2A 1M2VA 4M75D 3E2UA 2DERA 3OS2A 2FO0A 3MO8A 3GP8A 5CIUA 2DJQA 5KYNA 1Z9ZA 2XD0A 2LVMA 3HHTB 2M02A 5C0MA 3PNWC 1BK2A 3QHSA 3RKWA 1H92A 3G4ST 5GAMj 3H6ZA 1QP3A 1KC8C 2GBQA 2AZSA 4FL6A 3OY9A 1YITQ 3JCMf 1YI2A 3KUFA 1KSWA 3FJ5A 4KGVB 3G6EQ 2X3XD 5KYWB 2GQVA 1AT1B 2DYBA 2D0NA 1YJNQ 4QT7A 5GAOr 2AT1B 2P0PA 3CCEA 1M5Q1 2O9VA 4AFUC 2JTMA 1K76A 1AWOA 4M77B 2COWA 3QPHA 4PJLA 1PRLC 4M78G 2DYIA 2DTIA 4PJNA 5LJ3h 1KD1C 2L3PA 4HVWA 2A7YA 3EG9A 2VGMA 2HKNA 4IIMA 1SHGA 2E6ZA 2KI7A 2K6DA 4X9CA 2FEIA 4PJOD 1QCNA 5KYWA 1JBMA 1GFCA 3M0TA 4D8DA 2F69A 4EDUA 3EG3A 3OYLA 1KJWA 2PTKA 3TQ7P 1M8VA 2BE7D 3V7SA 3MHXA 2M16A 3QBYA 2JMAA 3MP6A 1R8OB 5GAMe 3PIOA 2KSSA 2RM4A 4ELZC 4A63B 1PKSA 3HRUA 3CMAQ 4AFSC 1Y0MA 1YP5A 2DD5A 5GJWB 1Q7YC 2RPNA 2V8JA 4C92G 1VQLQ 4M7DG 1G8XA 4M78F 3ZFJA 1OZ2A 1VQ6T 4HKEA 4C8QE 4LN2A 2CS7A 2D6FA 1FMVA 5CKHA 2QG9B 1EIFA 2F2VA 2MIOA 1X69A 1RAEB 3C95A 4NL3A 2J05A 2X4XA 1N6AA 1QW1A 1QQJA 3QSUA 4XU3A 2QASA 4JRQA 1ZA1B 1UB4A 2RHYA 5LJ5g 3JCMe 2JNGA 4M7AD 2H3EB 4HXJA 3SDZA 3HFNA 1C6VX 4IUVA 3REBB 2RQWA 5FRNA 2L8DA 1F1BB 1M30A 2CYZB 2KQWA 3EHQA 3CC2T 2DAQA 2DXCA 2GNCA 5FLXE 2DBKA 4FYVB 2BE9B 2MWPA 4RCCA 3VU3C 3SWNB 7AT1B 4AFQC 5KCOA 1ABOA 2IVWA 3VRYA 3BDUA 2P84A 3QUIA 1E6HA 2LX9A 5LJ5f 1OEBA 2MCNA 4Q5WA 4Y28E 2LZ6B 1PD1A 1Z9QA 2LNHB 4J9HA 3J81E 1JXOA 3OS1A 2HMAA 1BKBA 3G7ZA 4O6JA 1SRMA 1G3WA 2R58A 4QKUA 4OMPA 4E7ZA 1TS9A 4CRIA 1RL2A 3UPUA 2K3YA 4C8QG 3SWNA 1TOVA 3CPWP 2QQ9A 3OS5A 4OMNA 4QQDA 2EQUA 4J9BA 2OTJT 4EMKA 2RHIA 1YJWT 3JCMc 2JS0A 4BACA 5M9OA 3G4SQ 3EG2A 2RJFA 3VS7A 4LE9A 2GTOA 2ENMA 3EFOA 2L89A 5CKDA 4M75G 2A37A 3M59A 2LMJA 1AZEA 4OB2B 4F16A 3CCRA 4ZTJA 2JS2A 5D6WA 5D6XA 4EMKC 2CSQA 1YIJQ 2WSFE 3URGA 3AHUA 3LLRA 1FYNA 3D7SB 4BD3A 3BFMA 2JZ2A 4Z88A 1M1KC 1J3TA 4FYYB 1U1TA 2X51A 2HKQB 2FZGB 4OB3B 2M51A 2Z0WA 1NE8A 4C8QF 3CXCA 4XTZA 2P4RA 3NGPA 4RCBA 2LT1A 4FSXA 1KG1A 2ZPBB 1I07A 2E41A 3CD6A 5GANd 2MOXA 1ZA2B 3E19A 2PVOB 2BIVA 1OI1A 2J7IA 3O8VA 4C92B 3EAEA 4JJBA 4M7DB 2LT4A 1OULA 1Q82C 2PU9B 2I2LA 4JS5A 3UATA 2R5MA 3CXCS 1D1AA 4JUVA 5IT9E 1K1ZA 1YHQA 1K73C 3H0HA 4L59A 5D6YA 1BB9A 4HA8A 2YRDA 5AT1B 3GIBA 4R0KA 4RTZA 1UEBA 2IIMA 5CKBA 2QEXA 5FRMA 2DMOA 2J6KA 3R6OA 3DB3A 4EIKA 4EPCA 2F2WA 2KRNA 4XTXA 3UDCA 2O2OA 1W2BA 1X2QA 2X35A 3PFSA 1VQ6Q 4PLIA 1VQ9A 4BY6C 3MP8A 2RI2A 3QYGB 4OMOA 4J9IA 3LH0A 2FZCB 3CC7Q 2O31A 2VKNA 1MV0B 3OW2A 1VQMA 5CR2A 2M9UA 5GMKm 3I56A 4MDXA 2RK2A 4AG1C 1W2BS 2DIGA 4R55A 3JSCA 4UC4A 4X1VA 2X9HA 3HTRA 1TTHB 3THKA 2EQJA 3NHNA 3PTAA 3LX7A 2YT6A 2NUTA 3OW2S 2EW3A 1Q81R 2WSCE 1WHMA 2NUPA 1Y7XA 2KRSA 5J26A 2ZGWA 3RBBB 1T3SA 5I2SA 3MJXA 5HKCA 1VQ7Q 4HCBA 2JW4A 4Z89A 2K2MA 4B9XA 4OB0B 4CC2A 2LQ8A 1GBRA 4M7AG 3CCJT 2O01E 4C0GA 3CCQT 3RMQA 1VQ8A 3GF5A 5IN1A 1IHVA 2FL7A 4D8KA 1VQOA 1OZ3A 1D09B 2YHTA 1YCSB 2RB6A 5I11A 3JCMP 1IO6A 4M78D 2D1XA 3LH5A 1K8AC 3BW1A 1KK7A 4DBFA 4WTOB 3SFMA 3CC4A 3CCSA 4FM4B 1SEMA 1UE9A 2D8HA 4M75B 2HDAA 2RQVA 4IUUA 4ME7A 2DEQA 3RERA 1OX8A 2EAYA 3VJPA 2H8HA 2MI6A 3A8MB 4ESRA 1KQSA 1VQNA 2OTJQ 1VYUA 5DLQE 1YJWQ 4OGEA 2YXYA 2E70A 2X4JA 4EMGA 4F7UA 1X75C 2RNAA 1E6GA 2EYYA 4J8OA 3S3OA 2MYSA 4M7AF 1Y07A 3QDFA 5GJVB 2PZ1A 4QVDA 2QGGA 5C6SA 1YJ9A 2LNVA 2E65A 2VXEA 1RABB 2FZKB 3MCAB 5FWBA 1MHNA 1RAIB 1UHFA 2K2VA 2KNBB 3NTHA 1M90C 4FIBA 2E4HA 1YI2T 1ZSZA 1SSHA 1WHGA 5IXFA 1KQ1A 3G71A 5J3BA 3CCMA 1RUWA 2C0IA 4PJOB 3JCMh 4KH0B 1G3YA 4R56A 3CCET 4N4HA 4NOYA 2CSIA 1WI7A 3OSSC 5FROA 3VS4A 1UUEA 3NTKA 4J6YA 1ZSZC 5FW9A 3VS3A 2GFAA 1B34B 3EGDA 2KT8A 3NMZC 2DA9A 2HQXA 4ZN1A 1KC8U 1UGVA 1VQKA 1X2KA 3PVQA 3EFRA 3R6NA 2KXCA 4MZMA 1NEBA 3PMTA 2BZYA 4KGZB 2PUKB 3HKSA 1RADB 1D0ZA 1SF9A 3C94A 4E7JA 1FWZA 3A5ZB 4PJOA 2F5KA 4BI3A 3A8LB 5FU6C 2ROLA 2RI3A 5FU7B 5GAN5 2PUOB 3DLLA 2DTHA 2YWWA 5GAMg 3OYDA 1JJ2A 3META 1Q86C 3EGUA 1WYXA 3CCVA 3I55A 1B34A 3WVEB 1QWEA 4FU6A 1MNEA 4PFOA 4C8QD 3RKYA 4PFPA 1JJ2S 3V8JA 2E3HA 5GAMf 1XNIA 1X43A 2QA4A 1WQWA 1YITA 2J6OA 2LC4A 4OMLA 2GCXA 2K5IA 1A0NB 2ZAEA 1WGSA 3CCLA 3G6EA 1NM7A 1XTDA 3JCMg 4RTTA 4E7LA 1UGPB 2ESWA 3MEUA 4HT9A 2RI5A 1MNDA 3JB9J 1YJNA 2YRCA 2DXBA 4J7IA 3M4GA 1ZX6A 3A98A 1NYFA 4J9CA 1RACB 2C06A 1OU8A 2DD4A 2K3BA 3QG1A 1VQPA 4E47A 3X26B 3MEWA 1LVKA 2HL3A 1RI9A 1K9MC 1SKUB 2CUBA 2XDBA 4LUEA 1MMAA 2XK0A 3CBOA 4DBHA 2R5AA 4XTUA 5IHIA 3X24B 2CDTA 3M5AA 2E3IA 1NLPC 2P0QA 2DXTA 1M4ZA 4FW1A 2AK5A 4PKCC 2KRMA 4PLLA 1YN8A 2K7AA 5IH2A 4IUTA 1I8FA 2L5QA 3VS1A 5LJ5h 2RJEA 2X3WD 3LYIA 4BB7A 1XJWB 3FJPA 1U8RA 2K9GA 2DTOA 3L42A 4LDWA 4J83A 1NBEB 1OPLA 3HP9A 2CP0A 2OAUA 3NTIA 4HCCA 2RA2A 4N0AA 1GRIA 1IREB 1G2BA 1AEYA 2KEAA 2ZCFB 2RO0A 1N8RC 1GCQA 1SG5A 3QJ6A 1KQ2A 1OX9A 1M3CA 4M77A 2LQKA 3CMEQ 5GAOl 4DBRA 1KHIA 2QYZA 2FVUA 2JMCA 4VUBA 2OTLA 1NJIC 2EQMA 2BUDA 2RN8A 4N0AC 1BCOA 1IZ6A 3OBYA 3T9NA 3CCRT 2LP5A 3SHWA 3L2VA 2LCCA 2DO3A 1GCQC 3A8OB 2KDSA 2GFUA 3F70A 3CCEQ 1WHJA 4C0DB 1YWPA 4M77C 4DOWA 2W10A 2K5LA 5LJ3d 4XK8E 4OB1B 2EYWA 3CD6T 3OYFA 4WF2A 2XG8D 1BI3A 3RNJA 3UA7A 1XQHA 4C5IA 1NLOC 2EYQA 1C1AA 1QLYA 2HD0A 1V76A 1YHQT 4A54A 5EC7A 3CQTA 4RG2A 3LW5E 2EYZA 4F7UE 4II1A 3OBWA 4LDVA 2QEXT 2IG0A 1I1JA 2XU8A 2GQIA 1UGQB 1HK9A 2DVEA 4DOVA 3J80E 2MMPA 4PL6A 1BI0A 1BI1A 2G6FX 2CP7A 3MEAA 1VQ9T 4C0DC 3GPLA 1Q82U 2KK4A 1LCKA 3VS6A 4DEXA 2CH4W 1G3SA 1T3LA 2HL5C 5IHKA 1UHCA 1MGQA 2E5KA 1K73U 4RTYA 3CPWA 1I0CA 2RHZA 1Q95G 1OV3A 1M8MA 4OP0A 1VQMT 2LJ1A 5J39A 1RAAB 2JJ9A 1WHKA 4AT1B 3I56T 3OYMA 2M0OA 1GBQA 4DEYA 5LJ3f 2MWOA 3JCMJ 2GGRA 3S6WA 1YIJA 2E6NA 2CP5A 4BE2A 3OB9A 3CPWS 4A53A 2HCKA 1NEGA 3OA6A 1TXQA 1VYTA 3H0FA 4RTUA 4DQ2A 2B86A 4M78B 5GMKi 1RAGB 2IPOB 3SWNC 4LNPA 1LJOA 5L8RE 3JB9H 1VQ8T 2QQBA 3ER0A 2HQEA 2M1HA 3MP1A 3I5SA 2ECZA 5LJ3j 4KUIA 1VQOT 1I81A 2F2XA 2HSPA 4ZN3A 2FRWA 2QQSA 1TU0B 4ZTFA 4L6V5 3CC4T 2NYSA 3CCST 1IXDA 4M78A 3RR6A 8AT1B 3RUXA 1HJDA 3REAB 3TEEA 5GAN4 1PC0A 3E9GA 5CKFA 5I21A 4B6MA 1VQNT 2RHXA 4BE1A 3I9QA 3MEVA 4HT8A 1IB8A 2OJ2A 2XDDA 2ZPHB 4C5HA 3E1SA 2DL5A 3CC7A 5HY6A 1T0JA 4E7IA 1DJ7B 2QXFA 1K8AU 4BDYA 4RMOA 2JUFA 1ACMB 4F7UF 3CCRQ 1YJ9T 3ZL7C 4ELYC 1KFZA 1AVZC 3KXTA 1TUDA 2EPDA 1NPPA 3QZ9B 1X6GA 4F04B 4E7HA 4RTVA 2DXUA 4C92A 3OYCA 4M7DA 3OYNA 5LJ3e 2LTOA 2RQTA 1OQKA 1KC8R 2FYKA 3VS2A 3EFSA 1D3BB 3J7AF 3G71T 4LXCA 4JLGA 1AD5A 5DM7R 3M58A 2JTFA 3CCMT 1VQ7A 3L1AA 1D0XA 1R0BG 5KH6A 3C0CA 3CD6Q 3V7CA 4J9GA 1OU9A 1Y57A 1SPKA 1M27C 4PJJA 3LGLA 3M55A 2DF6A 3OYYA 1U5SA 2VGNA 3PIPA 2AHJB 1AWWA 1PSFA 4C92C 5GANf 4M7DC 4JLIA 2GF7A 1YHQQ 2O4XB 3QYHB 4KUDK 1G5VA 1KD1R 2Y4XA 1QKXA 5KYUB 1VQKT 3CC2Q 1EX4A 4MMKA 1BBZA 2ROTA 2HSEB 4BI8B 1D3BA 3X25B 4XQ3A 2QEXQ 2DILA 3BE3A 1CKBA 1WHHA 4N4IA 3I5RA 4LD9K 3OYKA 4AMCA 4C8QB 1Y71A 4XU2A 4C0FA 4ZGDB 6AT1B 1ZUYA 2V1QA 4MZTA 1VQ9Q 2CP2A 3NPFA 2BZXA 2CZ7B 5A0DA 2DL7A 3CCVT 3CBMA 5GANj 3I55T 2ZPEB 3EHRA 1O9SA 2O4XA 2DM1A 2QDLA 1JO8A 1KIKA 4M77E 5KYUA 1GFDA 2DL8A 1LPLA 4XAXB 4KBMB 3I56Q 1UECA 2LJ3A 1Q7YR 3FRNA 4C5GA 4A4KA 2K4YA 3KFVA 4JRKA 3HPWA 5CVIA 1ABQA 1NG2A 3H41A 1R0CB 4C8QA 3VKIA 1VQ5A 2E12A 1M1GA 3UT1A 3MKDA 5CK9A 1U1SA 1V1CA 1QKWA 2QA4T 1YITT 1PSEA 2L3SA 1VYVA 3HRTA 1UGRB 3CCLT 3G6ET 1RAHB 1K9AA 2O88A 4QVZA 3P8DA 1VIEA 1ZBJA 5GAMh 1YJNT 2JVVA 3PGGA 2DETA 3X20B 3M4YA 3U23A 3H8ZA 4M75A 1TWBA 1KQSS 4X34A 1VQPT 3DB4A 1WXUA 2EWNA 2EQIA 1IGQA 1VQ4A 2K57A 3E9FA 2SRCA 3CC4Q 3CCSQ 4JJDA 5GANe 5KYYB 3M0SA 3ZBDA 4E2FB 3L2ZA 1NYGA 2JOYA 4KT0E 4M75C 4J7FA 4XU0A 1B7TA 2X4YA 1QVPA 1VQNQ 2J6FA 2JM8A 2XICA 2YLBA 3BY7A 1RLQC 3M0PA 1WXBA 3QWYA 5KCHA 3CCUA 2MPXC 2HZYA 5CKEA 2KXDA 4FT4A 4DA4A 1K9MU 4ZGJB 2DIQA 3CMAT 2P4TA 4ANJA 3WXMB 1OPKA 4E7KA 1YJ9Q 4A4HA 3S3NA 4OMFB 1GXIE 4OMQA 4IUPA 1HYOA 4JZ3A 1QVFP 4RTXA 3M9QA 1S72A 1PCXA 2DX1A 2KR3A 5I2MA 4HVUA 3TU4K 2QK0A 3HFOA 4AG2C 3CEYA 1JU5C 5CO7A 1CKAA 3G71Q 3V8KA 2CZ6B 2ED1A 2OTLT 2HQHA 1KD1U 1AZGB 4IKFA 4M77F 3FDRA 3I35A 4HVVA 4JRIA 2JT4A 2DE0X 5GAOp 4PJOC 1K4US 1QCOA 2G3RA 4X9DA 3JCMd 2XIDA 4M7AB 1BCMA 1M1KR 4BE0A 4P5NA 4CI0C 2DRKA 2Y90A 4Y91A 2L3QA 4JRPA 4E6RA 4KGXB 3JRZA 3JB9G 2EJFA 3C12A 2M0YA 4FW2A 3EG0A 1WLPB 5CQXA 1QVGP 2L0AA 4XTVA 1W70A 1MV3A 2V8KA 3L2UA 1Q7YU 1B07A 1PKTA 3HSBA 4D6WA 2OAWA 4RUGA 3CCJQ 3CCQQ 1Q82R 2CT4A 2D8JA 4OGCA 5FU7C 2QTXA 4BI4A 3OYEA 2DLPA 4J6XA 5IXBA 4M7AA 1K73R 1BYMA 2OI3A 3I55Q 2RH2A 1XOVA 2RJDA 1BU1A 2DPPB 4KULA 2EGAA 2YLCA 4E7SA 4MZPA 2VB6A 2Y4YA 5GAOn 1R77A 2F1LA 1WNLA 2QDYB 5GAN8 3VS0A 3PVLA 2FPFA 1CSKA 2EKOA 4GLMA 4M7AC 4FSSA 4TVRA 2MK5A 1K0SA 2XKOC 3EG9B 1TG0A 1ZBXA 2QA4Q 3JB9F 2QAZA 4C92E 4M7DE 2KY9A 2JXBA 3CMEA 1JEGA 2KYBA 3CCLQ 4PK4A 1RI0A 3P8BB 1UGSB 1JRIA 2CH4A 1E7OA 5GAN7 4ATOA 2DZCA 3SD4A 4L5GA 2C0OA 3CMAA 3L2RA 5HK0A 5DLOA 1YIJT 1VQLA 1VQPQ 1M1FA 4LUDA 3TCJA 3TSZA 2EBPA 2FG0A 2RK1A 2KYMA 1M2OA 5I22A 1I5OB 1ZLMA 4XTWA 2D9TA 1NPRA 2L3RA 3GLXA 5AYFA 1Q81C 4PJMA 4J9EA 1C0MA 1YI2Q 5GMKj 5A2QE 3Q1JA 2ZPFB 3MPUB 4IUQA 4LDYA 3QWXX 4HCKA 1GL5A 5L23A 4J9FA 4KH1B 3ULRB 2RQUA 2CKKA 2NUZA 2VXFA 1M3BA 4J5YA 2FRYA 2AIRB 2P0KA 3M53A 4RKUE 1T0HA 4LD6A 1WJQA 3RMSA 4GBQA 3UWNA 3EG1A 5DY9A 4DBQA 2X4WA 2BTTA 3OSVA 1K8AR 1M9SA 5LJ5d 2XI9A 1WHLA 5GAOq 3PE0A 2YUPA 1FX7A 4B9WA 1MMNA 1PWTA 4JPBW 2E64A 3VYHB 2GTJA 5IAYA 1BI2A 4CC4B 1WPYA 2VUBA 2A08A 2XMFA 1HD3A 2EIFA 2VVKA 3EH1A 2KGTA 3A1PA 1AOJA 3CC7T 3AT1B 2DVJA 4MMLA 2KE9A 2ZZDA 5CQYA 1VOMA 1M1KU 3OYJA 2OTLQ 1W6XA 1IRXA 3LWHA 4JJCA 2YDLA 5GMKe 4JZ4A 3QZ5B 1S1NA 1N9SA 4NS5A 5GAN6 1VIFA 1WQ7A 4KRTA 5LJ3g 4FCYA 4M75E 1UG1A 1UJYA 4MDWA 1M90R 1N5ZA 3UF4A 1WXTA 4OF1A 1N9RA 3VUBA 1JB0E 9ATCB 3G4SA 4GLKA 3QO3A 3QKJA 4JDSA 1EZZB 1BIBA 1VUBA 1VQ7T 1SRLA 4C92F 1MMGA 2CP3A 4M7DF 1SHFA 1IGUA 1UTIA 4EMKB 3S3MA 2NWMA 3TREA 1M3AA 2KVQG 2CUDA 1FMKA 2KAFA 2DJZA 3EFOB 3VS5A 2PQWA 4XTYA 2EFIA 5GMKl 2XDPA 1LNXA 3BDLA 2RQRA 3OYGA 2H3JA 5GANh 5HK3A 4A4EA 5CCAA 5LL6S 1I5LA 2JN0A 2PVDB 1MMDA 5GAOm 3TVTA 2ED0A 5FWCA 2RMOA 5LJ5j 1HSQA 3RKXA 2WSEE 1V29B 4M77D 4F7UG 4PJOE 4QQGA 1QP2A 1Q86R 4QVCA 3JB9I 3TSWA 3QJYA 1TH7A 1FXXA 3GNGA 1IHWA 4Z02A 5HCKA 4CC3A 1AWXA 3DLMA 3KBGA 2DRMA 2CREA 2LX7A 4FYXB 2LCSA 1VQ5T 2QI2A 3OQ5A 1B3QA 1QMCA 2VV5A 4JS4A 1RLPC 4BY6B 1VQ6A 2YRVA 1ARKA 2RD1A 2K5FA 2HNIA 2EGEA 4GY5A 1MUZA 1TSFA 4M78C 1AHJB 3ZEHA 2ZPGB 3FB9A 3CXCP 5EG2A 1H3ZA 4ZNXA 4OMMA 2RF0A 2E1HA 4F14A 2MAMA 1PM3A 3HL8A 2EGCA 4Z8AA 2RHUA 1PHTA 2HBPA 1SSFA 2CZ0B 2O9SA 2FHDA 3A8GB 5LJ5e 2VC8A 3EGXB 4M75F 2F5TX 1WJSA 5GANg 1K9MR 1VQ4T 3CC2A 1EFNA 4M7AE 4C0ZA 2QQAA 2B8AA 2RJCA 3OMCA 3NFCA 1ZHIA 3M0UA 4QW2A 3JB9D 4PJOG 1U3OA 2LQNA 2EVRA 3V7RA 1N27A 3EH2A 1YNZA 3DKMA 1X6OA 2ZPIB 1QWFA 4LDUA 2WACA 3PMIA 3X28B 2FB7A 1ZSGA 2NUTB 2FPDA 3M56A 4PNOA 1QCFA 3CCUT 2NUPB 2DFUA 3M0RA 4XU1A 2CP6A 2DZ9A 1W2BP 3EGXA 1M90U 5A0GA 2BZ8A 1X27A 3P8HA 1G3TA 2DL4A 3ME9A 3GNFB 2VYTA 5IHNA 3ASKA 3OW2P 2L2PA 4AFZC 2MF2A 3VUZA 4FYWB 3G1JA 4CC7A 2V8IA 2CZ1B 2YUNA 1W4SA 1S72T 4RG8A 2A3LA 1N8RR 1UDLA 2SEMA 2DNUA 2FPEA 1X6BA 1YFNA 3L2WA 2A0FB 2V26A 1HXDA 2OTJA 4J9DA 1H641 1YJWA 3WVDB 5GAN3 3HRSA 4PJOF 1PD0A 3OYBA 2V1RA 5KYXB 1O75A 2DBMA 4A4GA 2HBWA 1NJIR 3QXEB 3GBQA 3VYGA 2D0QB 1OOTA 2YSQA 1VQMQ 4LDXA 4J6WA 2AKKA 2COYA 3H9NA 2KT1A 1JXMA 1TUGB 3SEMA 4F7UB 3JCMV 2ATCB 2KROA 4N4GA 2E10A 1Q86U 3JAME 2K79A 1UFFA 4JJNK 2C0TA 5KYXA 2DL3A 5ECAA 1ZUUA 1LOJA 2PVGB 1PNJA 3LWIA 1I4K1 4OVAA 2AKLA 2LDMA 4K11A 3RESA 4C8QC 1YCYA 2VASA 3JCMQ 1VQ8Q 1WDXA 3OYAA 3FC3A 2PNIA 2YUOA 1ZSZB 8ATCB 3UA6A 1VQOQ 1OYXA 4ZGEB 1D1CA 1KQSP 4C5EA 3RDVA 3QDRB 3H0IA 5KE3A 2K3XA 2R57A 1AWJA 2BKDN 2YUQA 3L2QA 1VA7A 1H8KA 4FT2A 1D0YA 4V2SA 1WZOA 2EJ9A 3JCMX 4YTLA 3IQLA 4Y92A 5A0LA 1PG5B 4C92D 4M7DD 5FU6B 1VQ5Q 2I0NA 4M77G 1G83A 3EGDB 4HCZA 3CBPA 1TUCA 2E5QA 1K0XA 3CMET 4IURA 2J06A 2LQWA 2AZVA 2EQKA 2XHCA 2A36A 1D1BA 1FMWA 2COZA 2EYXA 3OYHA 5GMKh 1QVFA 2A28A 4F17A 5GAMd 1WFWA 4EMHA 2JTEA 3VRZA 5KYYA 1VQLT 1ZQ1A 2DK3A 3JCMb 3M57A 4BDZA 1WX6A 4ORZA 4M4ZA 3CPFA 2EJGA
chains in the Genus database with same CATH topology
1VYTA 3H0FA 4RTUA 2B86A 2EW3A 4J9EA 2KRSA 2CT3A 3RBBB 3O5ZA 1T3SA 3QWXX 4LNPA 4HCKA 2ABLA 2JW4A 1GL5A 5L23A 4J9FA 4Z89A 3ULRB 2RQUA 2K2MA 2NUZA 1U06A 4CC2A 1GBRA 1M3BA 2FRYA 2KBTA 3I5SA 2ECZA 2W0ZA 1T0HA 4D8KA 1PRMC 4GBQA 3EG1A 1YCSB 5I11A 1W1FA 2F2XA 2HSPA 1IO6A 1YWOA 3M0QA 2FRWA 2D1XA 3LH5A 4IIOA 2BTTA 4RTWA 3PE0A 1ZUKA 2YUPA 1HJDA 3REAB 1SEMA 1UE9A 1WA7A 2D8HA 1UJ0A 1JQQA 1PWTA 2HDAA 4JPBW 2RQVA 2EKHA 2HEQA 1H3HA 1WIEA 2GTJA 2H8HA 4CC4B 4ESRA 2JM9A 2VWFA 2A08A 3I9QA 2XMFA 1HD3A 1VYUA 2LJ0A 2OJ2A 2VVKA 2KGTA 1AOJA 4WCIA 2DL5A 2DVJA 1GCPA 2KE9A 1T0JA 2RNAA 1E6GA 2EYYA 3JV3A 1W6XA 2FO0A 5GJVB 2PZ1A 4JJCA 2YDLA 4JZ4A 3ZL7C 1KFZA 1S1NA 1AVZC 1TUDA 2DJQA 2EPDA 1Z9ZA 4KRTA 5FWBA 1X6GA 1UG1A 1UJYA 1UHFA 1N5ZA 2KNBB 1BK2A 4RTVA 3UF4A 1WXTA 1H92A 2RQTA 3VS2A 2GBQA 2AZSA 1SSHA 5IXFA 1AD5A 1KSWA 3FJ5A 1SRLA 2X3XD 1SHFA 3C0CA 1RUWA 4J9GA 2DYBA 2D0NA 1Y57A 2C0IA 1SPKA 1M27C 4QT7A 1UTIA 2NWMA 2DF6A 1M3AA 1U5SA 2O9VA 4AFUC 2CSIA 1AWWA 2CUDA 1WI7A 1K76A 1FMKA 1AWOA 3VS4A 1UUEA 1PRLC 5FW9A 3VS5A 3VS3A 2KT8A 1QKXA 3NMZC 2DA9A 2L3PA 4HVWA 1UGVA 1BBZA 1X2KA 2ROTA 3PVQA 2RQRA 3R6NA 2KXCA 4IIMA 1NEBA 1SHGA 2BZYA 2DILA 1CKBA 2K6DA 2FEIA 3I5RA 1GFCA 3M0TA 4D8DA 3TVTA 2ED0A 3EG3A 1KJWA 2PTKA 5FWCA 1ZUYA 2RMOA 2V1QA 1HSQA 2ROLA 3NPFA 2BZXA 2DL7A 2JMAA 3EGUA 3EHRA 1WYXA 2DM1A 2QDLA 1JO8A 1KIKA 3TSWA 1GFDA 2DL8A 1QWEA 4A63B 1PKSA 1UECA 2LJ3A 5HCKA 4CC3A 4AFSC 1Y0MA 1YP5A 5GJWB 3KFVA 1AWXA 2RPNA 1ABQA 1NG2A 2DRMA 3H41A 2CREA 2LX7A 2LCSA 1B3QA 1RLPC 4LN2A 1V1CA 1QKWA 1ARKA 1X43A 2L3SA 1VYVA 2EGEA 2J6OA 2F2VA 4OMLA 1A0NB 1MUZA 2MIOA 1X69A 1K9AA 2O88A 2J05A 1NM7A 1ZBJA 4RTTA 2ESWA 4ZNXA 4OMMA 2RF0A 1ZX6A 4F14A 3U23A 3A98A 2EGCA 4HXJA 4Z8AA 1PHTA 1NYFA 4J9CA 3REBB 2RQWA 2K3BA 1WXUA 1M30A 2O9SA 3EHQA 2EQIA 1RI9A 1EFNA 2CUBA 2GNCA 2DBKA 4LUEA 2SRCA 3M0UA 4JJDA 4AFQC 1ABOA 1U3OA 2EVRA 2LQNA 3M0SA 3VRYA 5IHIA 1NYGA 2CDTA 1YNZA 1E6HA 1NLPC 1OEBA 1QWFA 2MCNA 2AK5A 2J6FA 2JM8A 1ZSGA 2LZ6B 1Z9QA 2FPDA 2KRMA 1RLQC 2LNHB 3M0PA 1WXBA 4J9HA 1YN8A 2K7AA 3QWYA 5IH2A 1QCFA 1JXOA 3VS1A 3M0RA 2KXDA 2X3WD 1SRMA 2BZ8A 4OMPA 1X27A 2K9GA 2DL4A 1OPLA 5IHNA 1OPKA 2L2PA 1GRIA 4AFZC 4OMQA 1G2BA 4OMNA 4CC7A 1AEYA 2KEAA 2YUNA 4JZ3A 1UDLA 2SEMA 4RTXA 2DNUA 2FPEA 1X6BA 1GCQA 4J9BA 2DX1A 2KR3A 4HVUA 4J9DA 2JS0A 3EG2A 3VS7A 4AG2C 4LE9A 1M3CA 2GTOA 1JU5C 2ENMA 1CKAA 2V1RA 2JMCA 2ED1A 2DBMA 2HBWA 2A37A 1AZGB 2RN8A 3GBQA 1OOTA 2YSQA 2LMJA 1AZEA 2AKKA 3I35A 4HVVA 2LP5A 4F16A 2JT4A 3SHWA 2DE0X 1GCQC 2JS2A 2KT1A 1K4US 1JXMA 2CSQA 3SEMA 1FYNA 1YWPA 4Z88A 1J3TA 2W10A 2DRKA 2L3QA 2M51A 4E6RA 2KROA 2P4RA 2K79A 3NGPA 1UFFA 2M0YA 2C0TA 2DL3A 2EYWA 5ECAA 1ZUUA 1I07A 3EG0A 1PNJA 1WLPB 2MOXA 2L0AA 1W70A 1MV3A 3RNJA 3UA7A 2J7IA 2AKLA 4K11A 1B07A 1NLOC 1PKTA 2OAWA 4RUGA 4JJBA 1WDXA 2CT4A 2PNIA 2YUOA 2D8JA 1QLYA 3UATA 3UA6A 2DLPA 5IXBA 1K1ZA 5EC7A 3CQTA 3H0HA 2OI3A 3H0IA 1AWJA 2YUQA 1BB9A 1XOVA 1VA7A 2EYZA 1H8KA 1BU1A 2EGAA 4R0KA 3IQLA 4RTZA 2IIMA 4Y92A 1I1JA 2DMOA 2GQIA 3VS0A 2J6KA 3PVLA 2FPFA 2I0NA 4EIKA 1CSKA 2F2WA 2KRNA 4GLMA 2G6FX 1G83A 2O2OA 4FSSA 1X2QA 1K0SA 1TUCA 1LCKA 3VS6A 4DEXA 1TG0A 2CH4W 1T3LA 1K0XA 5IHKA 4OMOA 1UHCA 4J9IA 2J06A 2JXBA 2E5KA 4RTYA 1JEGA 2LQWA 2KYBA 2O31A 1I0CA 2VKNA 1MV0B 2AZVA 1OV3A 1M8MA 2LJ1A 2CH4A 2A36A 1E7OA 2C0OA 2EYXA 1GBQA 2A28A 4DEYA 4F17A 4AG1C 1WFWA 2JTEA 3VRZA 2GGRA 4X1VA 4LUDA 3TSZA 2EBPA 2FG0A 3THKA 1WX6A 2KYMA 4ORZA 5I22A 3NHNA 4M4ZA 1ZLMA 2YT6A 2HCKA 1NEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  3H0F A;  4RTU A;  2B86 A;  2EW3 A;  4J9E A;  2KRS A;  2CT3 A;  3RBB B;  3O5Z A;  1T3S A;  3QWX X;  4LNP A;  4HCK A;  2ABL A;  2JW4 A;  1GL5 A;  5L23 A;  4J9F A;  4Z89 A;  3ULR B;  2RQU A;  2K2M A;  2NUZ A;  1U06 A;  4CC2 A;  1GBR A;  1M3B A;  2FRY A;  2KBT A;  3I5S A;  2ECZ A;  2W0Z A;  1T0H A;  4D8K A;  1PRM C;  4GBQ A;  3EG1 A;  1YCS B;  5I11 A;  1W1F A;  2F2X A;  2HSP A;  1IO6 A;  1YWO A;  3M0Q A;  2FRW A;  2D1X A;  3LH5 A;  4IIO A;  2BTT A;  4RTW A;  3PE0 A;  1ZUK A;  2YUP A;  1HJD A;  3REA B;  1SEM A;  1UE9 A;  1WA7 A;  2D8H A;  1UJ0 A;  1JQQ A;  1PWT A;  2HDA A;  4JPB W;  2RQV A;  2EKH A;  2HEQ A;  1H3H A;  1WIE A;  2GTJ A;  2H8H A;  4CC4 B;  4ESR A;  2JM9 A;  2VWF A;  2A08 A;  3I9Q A;  2XMF A;  1HD3 A;  1VYU A;  2LJ0 A;  2OJ2 A;  2VVK A;  2KGT A;  1AOJ A;  4WCI A;  2DL5 A;  2DVJ A;  1GCP A;  2KE9 A;  1T0J A;  2RNA A;  1E6G A;  2EYY A;  3JV3 A;  1W6X A;  2FO0 A;  5GJV B;  2PZ1 A;  4JJC A;  2YDL A;  4JZ4 A;  3ZL7 C;  1KFZ A;  1S1N A;  1AVZ C;  1TUD A;  2DJQ A;  2EPD A;  1Z9Z A;  4KRT A;  5FWB A;  1X6G A;  1UG1 A;  1UJY A;  1UHF A;  1N5Z A;  2KNB B;  1BK2 A;  4RTV A;  3UF4 A;  1WXT A;  1H92 A;  2RQT A;  3VS2 A;  2GBQ A;  2AZS A;  1SSH A;  5IXF A;  1AD5 A;  1KSW A;  3FJ5 A;  1SRL A;  2X3X D;  1SHF A;  3C0C A;  1RUW A;  4J9G A;  2DYB A;  2D0N A;  1Y57 A;  2C0I A;  1SPK A;  1M27 C;  4QT7 A;  1UTI A;  2NWM A;  2DF6 A;  1M3A A;  1U5S A;  2O9V A;  4AFU C;  2CSI A;  1AWW A;  2CUD A;  1WI7 A;  1K76 A;  1FMK A;  1AWO A;  3VS4 A;  1UUE A;  1PRL C;  5FW9 A;  3VS5 A;  3VS3 A;  2KT8 A;  1QKX A;  3NMZ C;  2DA9 A;  2L3P A;  4HVW A;  1UGV A;  1BBZ A;  1X2K A;  2ROT A;  3PVQ A;  2RQR A;  3R6N A;  2KXC A;  4IIM A;  1NEB A;  1SHG A;  2BZY A;  2DIL A;  1CKB A;  2K6D A;  2FEI A;  3I5R A;  1GFC A;  3M0T A;  4D8D A;  3TVT A;  2ED0 A;  3EG3 A;  1KJW A;  2PTK A;  5FWC A;  1ZUY A;  2RMO A;  2V1Q A;  1HSQ A;  2ROL A;  3NPF A;  2BZX A;  2DL7 A;  2JMA A;  3EGU A;  3EHR A;  1WYX A;  2DM1 A;  2QDL A;  1JO8 A;  1KIK A;  3TSW A;  1GFD A;  2DL8 A;  1QWE A;  4A63 B;  1PKS A;  1UEC A;  2LJ3 A;  5HCK A;  4CC3 A;  4AFS C;  1Y0M A;  1YP5 A;  5GJW B;  3KFV A;  1AWX A;  2RPN A;  1ABQ A;  1NG2 A;  2DRM A;  3H41 A;  2CRE A;  2LX7 A;  2LCS A;  1B3Q A;  1RLP C;  4LN2 A;  1V1C A;  1QKW A;  1ARK A;  1X43 A;  2L3S A;  1VYV A;  2EGE A;  2J6O A;  2F2V A;  4OML A;  1A0N B;  1MUZ A;  2MIO A;  1X69 A;  1K9A A;  2O88 A;  2J05 A;  1NM7 A;  1ZBJ A;  4RTT A;  2ESW A;  4ZNX A;  4OMM A;  2RF0 A;  1ZX6 A;  4F14 A;  3U23 A;  3A98 A;  2EGC A;  4HXJ A;  4Z8A A;  1PHT A;  1NYF A;  4J9C A;  3REB B;  2RQW A;  2K3B A;  1WXU A;  1M30 A;  2O9S A;  3EHQ A;  2EQI A;  1RI9 A;  1EFN A;  2CUB A;  2GNC A;  2DBK A;  4LUE A;  2SRC A;  3M0U A;  4JJD A;  4AFQ C;  1ABO A;  1U3O A;  2EVR A;  2LQN A;  3M0S A;  3VRY A;  5IHI A;  1NYG A;  2CDT A;  1YNZ A;  1E6H A;  1NLP C;  1OEB A;  1QWF A;  2MCN A;  2AK5 A;  2J6F A;  2JM8 A;  1ZSG A;  2LZ6 B;  1Z9Q A;  2FPD A;  2KRM A;  1RLQ C;  2LNH B;  3M0P A;  1WXB A;  4J9H A;  1YN8 A;  2K7A A;  3QWY A;  5IH2 A;  1QCF A;  1JXO A;  3VS1 A;  3M0R A;  2KXD A;  2X3W D;  1SRM A;  2BZ8 A;  4OMP A;  1X27 A;  2K9G A;  2DL4 A;  1OPL A;  5IHN A;  1OPK A;  2L2P A;  1GRI A;  4AFZ C;  4OMQ A;  1G2B A;  4OMN A;  4CC7 A;  1AEY A;  2KEA A;  2YUN A;  4JZ3 A;  1UDL A;  2SEM A;  4RTX A;  2DNU A;  2FPE A;  1X6B A;  1GCQ A;  4J9B A;  2DX1 A;  2KR3 A;  4HVU A;  4J9D A;  2JS0 A;  3EG2 A;  3VS7 A;  4AG2 C;  4LE9 A;  1M3C A;  2GTO A;  1JU5 C;  2ENM A;  1CKA A;  2V1R A;  2JMC A;  2ED1 A;  2DBM A;  2HBW A;  2A37 A;  1AZG B;  2RN8 A;  3GBQ A;  1OOT A;  2YSQ A;  2LMJ A;  1AZE A;  2AKK A;  3I35 A;  4HVV A;  2LP5 A;  4F16 A;  2JT4 A;  3SHW A;  2DE0 X;  1GCQ C;  2JS2 A;  2KT1 A;  1K4U S;  1JXM A;  2CSQ A;  3SEM A;  1FYN A;  1YWP A;  4Z88 A;  1J3T A;  2W10 A;  2DRK A;  2L3Q A;  2M51 A;  4E6R A;  2KRO A;  2P4R A;  2K79 A;  3NGP A;  1UFF A;  2M0Y A;  2C0T A;  2DL3 A;  2EYW A;  5ECA A;  1ZUU A;  1I07 A;  3EG0 A;  1PNJ A;  1WLP B;  2MOX A;  2L0A A;  1W70 A;  1MV3 A;  3RNJ A;  3UA7 A;  2J7I A;  2AKL A;  4K11 A;  1B07 A;  1NLO C;  1PKT A;  2OAW A;  4RUG A;  4JJB A;  1WDX A;  2CT4 A;  2PNI A;  2YUO A;  2D8J A;  1QLY A;  3UAT A;  3UA6 A;  2DLP A;  5IXB A;  1K1Z A;  5EC7 A;  3CQT A;  3H0H A;  2OI3 A;  3H0I A;  1AWJ A;  2YUQ A;  1BB9 A;  1XOV A;  1VA7 A;  2EYZ A;  1H8K A;  1BU1 A;  2EGA A;  4R0K A;  3IQL A;  4RTZ A;  2IIM A;  4Y92 A;  1I1J A;  2DMO A;  2GQI A;  3VS0 A;  2J6K A;  3PVL A;  2FPF A;  2I0N A;  4EIK A;  1CSK A;  2F2W A;  2KRN A;  4GLM A;  2G6F X;  1G83 A;  2O2O A;  4FSS A;  1X2Q A;  1K0S A;  1TUC A;  1LCK A;  3VS6 A;  4DEX A;  1TG0 A;  2CH4 W;  1T3L A;  1K0X A;  5IHK A;  4OMO A;  1UHC A;  4J9I A;  2J06 A;  2JXB A;  2E5K A;  4RTY A;  1JEG A;  2LQW A;  2KYB A;  2O31 A;  1I0C A;  2VKN A;  1MV0 B;  2AZV A;  1OV3 A;  1M8M A;  2LJ1 A;  2CH4 A;  2A36 A;  1E7O A;  2C0O A;  2EYX A;  1GBQ A;  2A28 A;  4DEY A;  4F17 A;  4AG1 C;  1WFW A;  2JTE A;  3VRZ A;  2GGR A;  4X1V A;  4LUD A;  3TSZ A;  2EBP A;  2FG0 A;  3THK A;  1WX6 A;  2KYM A;  4ORZ A;  5I22 A;  3NHN A;  4M4Z A;  1ZLM A;  2YT6 A;  2HCK A;  1NEG A; 
#chains in the Genus database with same CATH topology
 3SB2 A;  1VQ4 Q;  3LGF A;  3FLG A;  1QVF S;  3VV0 A;  2CT3 A;  3OYI A;  3V8L A;  3JCM W;  3O5Z A;  2HAX A;  4A4F A;  1Y96 B;  3CCM Q;  1WJR A;  2ABL A;  4QQ6 A;  5KE2 A;  3M54 A;  3QII A;  4PFZ A;  1P92 A;  1U06 A;  2OX7 A;  2KBT A;  3CCJ A;  3CCQ A;  1X01 A;  2LRQ A;  2W0Z A;  2DEU A;  5GAN 2;  1PRM C;  3GOX A;  3CCU Q;  1N8R U;  1NZ9 A;  1W1F A;  4O5V A;  3INZ A;  1YWO A;  3M0Q A;  2NLU A;  4IIO A;  1M2V B;  4RTW A;  1JJ2 P;  3RIR A;  1Q81 U;  1VQK Q;  1QVG A;  4BUG A;  1ZUK A;  5CAI A;  1RAF B;  1WA7 A;  1UJ0 A;  3N5B B;  1JQQ A;  1Y96 A;  4M78 E;  3FEO A;  1NJI U;  2EKH A;  1YBY A;  2DKG A;  2HEQ A;  3C4S A;  1H3H A;  1WIE A;  2QTV A;  1S72 Q;  2QQR A;  2JM9 A;  2VWF A;  3PT9 A;  2LJ0 A;  1KHC A;  2LCL A;  2KMT A;  3OS0 A;  1QVG S;  4WCI A;  5D7U A;  1GCP A;  3A8H B;  1BIA A;  3CCV Q;  2CGH A;  2QGF B;  3JV3 A;  3OMG A;  3FIF A;  4NL2 A;  1M2V A;  4M75 D;  3E2U A;  2DER A;  3OS2 A;  2FO0 A;  3MO8 A;  3GP8 A;  5CIU A;  2DJQ A;  5KYN A;  1Z9Z A;  2XD0 A;  2LVM A;  3HHT B;  2M02 A;  5C0M A;  3PNW C;  1BK2 A;  3QHS A;  3RKW A;  1H92 A;  3G4S T;  5GAM j;  3H6Z A;  1QP3 A;  1KC8 C;  2GBQ A;  2AZS A;  4FL6 A;  3OY9 A;  1YIT Q;  3JCM f;  1YI2 A;  3KUF A;  1KSW A;  3FJ5 A;  4KGV B;  3G6E Q;  2X3X D;  5KYW B;  2GQV A;  1AT1 B;  2DYB A;  2D0N A;  1YJN Q;  4QT7 A;  5GAO r;  2AT1 B;  2P0P A;  3CCE A;  1M5Q 1;  2O9V A;  4AFU C;  2JTM A;  1K76 A;  1AWO A;  4M77 B;  2COW A;  3QPH A;  4PJL A;  1PRL C;  4M78 G;  2DYI A;  2DTI A;  4PJN A;  5LJ3 h;  1KD1 C;  2L3P A;  4HVW A;  2A7Y A;  3EG9 A;  2VGM A;  2HKN A;  4IIM A;  1SHG A;  2E6Z A;  2KI7 A;  2K6D A;  4X9C A;  2FEI A;  4PJO D;  1QCN A;  5KYW A;  1JBM A;  1GFC A;  3M0T A;  4D8D A;  2F69 A;  4EDU A;  3EG3 A;  3OYL A;  1KJW A;  2PTK A;  3TQ7 P;  1M8V A;  2BE7 D;  3V7S A;  3MHX A;  2M16 A;  3QBY A;  2JMA A;  3MP6 A;  1R8O B;  5GAM e;  3PIO A;  2KSS A;  2RM4 A;  4ELZ C;  4A63 B;  1PKS A;  3HRU A;  3CMA Q;  4AFS C;  1Y0M A;  1YP5 A;  2DD5 A;  5GJW B;  1Q7Y C;  2RPN A;  2V8J A;  4C92 G;  1VQL Q;  4M7D G;  1G8X A;  4M78 F;  3ZFJ A;  1OZ2 A;  1VQ6 T;  4HKE A;  4C8Q E;  4LN2 A;  2CS7 A;  2D6F A;  1FMV A;  5CKH A;  2QG9 B;  1EIF A;  2F2V A;  2MIO A;  1X69 A;  1RAE B;  3C95 A;  4NL3 A;  2J05 A;  2X4X A;  1N6A A;  1QW1 A;  1QQJ A;  3QSU A;  4XU3 A;  2QAS A;  4JRQ A;  1ZA1 B;  1UB4 A;  2RHY A;  5LJ5 g;  3JCM e;  2JNG A;  4M7A D;  2H3E B;  4HXJ A;  3SDZ A;  3HFN A;  1C6V X;  4IUV A;  3REB B;  2RQW A;  5FRN A;  2L8D A;  1F1B B;  1M30 A;  2CYZ B;  2KQW A;  3EHQ A;  3CC2 T;  2DAQ A;  2DXC A;  2GNC A;  5FLX E;  2DBK A;  4FYV B;  2BE9 B;  2MWP A;  4RCC A;  3VU3 C;  3SWN B;  7AT1 B;  4AFQ C;  5KCO A;  1ABO A;  2IVW A;  3VRY A;  3BDU A;  2P84 A;  3QUI A;  1E6H A;  2LX9 A;  5LJ5 f;  1OEB A;  2MCN A;  4Q5W A;  4Y28 E;  2LZ6 B;  1PD1 A;  1Z9Q A;  2LNH B;  4J9H A;  3J81 E;  1JXO A;  3OS1 A;  2HMA A;  1BKB A;  3G7Z A;  4O6J A;  1SRM A;  1G3W A;  2R58 A;  4QKU A;  4OMP A;  4E7Z A;  1TS9 A;  4CRI A;  1RL2 A;  3UPU A;  2K3Y A;  4C8Q G;  3SWN A;  1TOV A;  3CPW P;  2QQ9 A;  3OS5 A;  4OMN A;  4QQD A;  2EQU A;  4J9B A;  2OTJ T;  4EMK A;  2RHI A;  1YJW T;  3JCM c;  2JS0 A;  4BAC A;  5M9O A;  3G4S Q;  3EG2 A;  2RJF A;  3VS7 A;  4LE9 A;  2GTO A;  2ENM A;  3EFO A;  2L89 A;  5CKD A;  4M75 G;  2A37 A;  3M59 A;  2LMJ A;  1AZE A;  4OB2 B;  4F16 A;  3CCR A;  4ZTJ A;  2JS2 A;  5D6W A;  5D6X A;  4EMK C;  2CSQ A;  1YIJ Q;  2WSF E;  3URG A;  3AHU A;  3LLR A;  1FYN A;  3D7S B;  4BD3 A;  3BFM A;  2JZ2 A;  4Z88 A;  1M1K C;  1J3T A;  4FYY B;  1U1T A;  2X51 A;  2HKQ B;  2FZG B;  4OB3 B;  2M51 A;  2Z0W A;  1NE8 A;  4C8Q F;  3CXC A;  4XTZ A;  2P4R A;  3NGP A;  4RCB A;  2LT1 A;  4FSX A;  1KG1 A;  2ZPB B;  1I07 A;  2E41 A;  3CD6 A;  5GAN d;  2MOX A;  1ZA2 B;  3E19 A;  2PVO B;  2BIV A;  1OI1 A;  2J7I A;  3O8V A;  4C92 B;  3EAE A;  4JJB A;  4M7D B;  2LT4 A;  1OUL A;  1Q82 C;  2PU9 B;  2I2L A;  4JS5 A;  3UAT A;  2R5M A;  3CXC S;  1D1A A;  4JUV A;  5IT9 E;  1K1Z A;  1YHQ A;  1K73 C;  3H0H A;  4L59 A;  5D6Y A;  1BB9 A;  4HA8 A;  2YRD A;  5AT1 B;  3GIB A;  4R0K A;  4RTZ A;  1UEB A;  2IIM A;  5CKB A;  2QEX A;  5FRM A;  2DMO A;  2J6K A;  3R6O A;  3DB3 A;  4EIK A;  4EPC A;  2F2W A;  2KRN A;  4XTX A;  3UDC A;  2O2O A;  1W2B A;  1X2Q A;  2X35 A;  3PFS A;  1VQ6 Q;  4PLI A;  1VQ9 A;  4BY6 C;  3MP8 A;  2RI2 A;  3QYG B;  4OMO A;  4J9I A;  3LH0 A;  2FZC B;  3CC7 Q;  2O31 A;  2VKN A;  1MV0 B;  3OW2 A;  1VQM A;  5CR2 A;  2M9U A;  5GMK m;  3I56 A;  4MDX A;  2RK2 A;  4AG1 C;  1W2B S;  2DIG A;  4R55 A;  3JSC A;  4UC4 A;  4X1V A;  2X9H A;  3HTR A;  1TTH B;  3THK A;  2EQJ A;  3NHN A;  3PTA A;  3LX7 A;  2YT6 A;  2NUT A;  3OW2 S;  2EW3 A;  1Q81 R;  2WSC E;  1WHM A;  2NUP A;  1Y7X A;  2KRS A;  5J26 A;  2ZGW A;  3RBB B;  1T3S A;  5I2S A;  3MJX A;  5HKC A;  1VQ7 Q;  4HCB A;  2JW4 A;  4Z89 A;  2K2M A;  4B9X A;  4OB0 B;  4CC2 A;  2LQ8 A;  1GBR A;  4M7A G;  3CCJ T;  2O01 E;  4C0G A;  3CCQ T;  3RMQ A;  1VQ8 A;  3GF5 A;  5IN1 A;  1IHV A;  2FL7 A;  4D8K A;  1VQO A;  1OZ3 A;  1D09 B;  2YHT A;  1YCS B;  2RB6 A;  5I11 A;  3JCM P;  1IO6 A;  4M78 D;  2D1X A;  3LH5 A;  1K8A C;  3BW1 A;  1KK7 A;  4DBF A;  4WTO B;  3SFM A;  3CC4 A;  3CCS A;  4FM4 B;  1SEM A;  1UE9 A;  2D8H A;  4M75 B;  2HDA A;  2RQV A;  4IUU A;  4ME7 A;  2DEQ A;  3RER A;  1OX8 A;  2EAY A;  3VJP A;  2H8H A;  2MI6 A;  3A8M B;  4ESR A;  1KQS A;  1VQN A;  2OTJ Q;  1VYU A;  5DLQ E;  1YJW Q;  4OGE A;  2YXY A;  2E70 A;  2X4J A;  4EMG A;  4F7U A;  1X75 C;  2RNA A;  1E6G A;  2EYY A;  4J8O A;  3S3O A;  2MYS A;  4M7A F;  1Y07 A;  3QDF A;  5GJV B;  2PZ1 A;  4QVD A;  2QGG A;  5C6S A;  1YJ9 A;  2LNV A;  2E65 A;  2VXE A;  1RAB B;  2FZK B;  3MCA B;  5FWB A;  1MHN A;  1RAI B;  1UHF A;  2K2V A;  2KNB B;  3NTH A;  1M90 C;  4FIB A;  2E4H A;  1YI2 T;  1ZSZ A;  1SSH A;  1WHG A;  5IXF A;  1KQ1 A;  3G71 A;  5J3B A;  3CCM A;  1RUW A;  2C0I A;  4PJO B;  3JCM h;  4KH0 B;  1G3Y A;  4R56 A;  3CCE T;  4N4H A;  4NOY A;  2CSI A;  1WI7 A;  3OSS C;  5FRO A;  3VS4 A;  1UUE A;  3NTK A;  4J6Y A;  1ZSZ C;  5FW9 A;  3VS3 A;  2GFA A;  1B34 B;  3EGD A;  2KT8 A;  3NMZ C;  2DA9 A;  2HQX A;  4ZN1 A;  1KC8 U;  1UGV A;  1VQK A;  1X2K A;  3PVQ A;  3EFR A;  3R6N A;  2KXC A;  4MZM A;  1NEB A;  3PMT A;  2BZY A;  4KGZ B;  2PUK B;  3HKS A;  1RAD B;  1D0Z A;  1SF9 A;  3C94 A;  4E7J A;  1FWZ A;  3A5Z B;  4PJO A;  2F5K A;  4BI3 A;  3A8L B;  5FU6 C;  2ROL A;  2RI3 A;  5FU7 B;  5GAN 5;  2PUO B;  3DLL A;  2DTH A;  2YWW A;  5GAM g;  3OYD A;  1JJ2 A;  3MET A;  1Q86 C;  3EGU A;  1WYX A;  3CCV A;  3I55 A;  1B34 A;  3WVE B;  1QWE A;  4FU6 A;  1MNE A;  4PFO A;  4C8Q D;  3RKY A;  4PFP A;  1JJ2 S;  3V8J A;  2E3H A;  5GAM f;  1XNI A;  1X43 A;  2QA4 A;  1WQW A;  1YIT A;  2J6O A;  2LC4 A;  4OML A;  2GCX A;  2K5I A;  1A0N B;  2ZAE A;  1WGS A;  3CCL A;  3G6E A;  1NM7 A;  1XTD A;  3JCM g;  4RTT A;  4E7L A;  1UGP B;  2ESW A;  3MEU A;  4HT9 A;  2RI5 A;  1MND A;  3JB9 J;  1YJN A;  2YRC A;  2DXB A;  4J7I A;  3M4G A;  1ZX6 A;  3A98 A;  1NYF A;  4J9C A;  1RAC B;  2C06 A;  1OU8 A;  2DD4 A;  2K3B A;  3QG1 A;  1VQP A;  4E47 A;  3X26 B;  3MEW A;  1LVK A;  2HL3 A;  1RI9 A;  1K9M C;  1SKU B;  2CUB A;  2XDB A;  4LUE A;  1MMA A;  2XK0 A;  3CBO A;  4DBH A;  2R5A A;  4XTU A;  5IHI A;  3X24 B;  2CDT A;  3M5A A;  2E3I A;  1NLP C;  2P0Q A;  2DXT A;  1M4Z A;  4FW1 A;  2AK5 A;  4PKC C;  2KRM A;  4PLL A;  1YN8 A;  2K7A A;  5IH2 A;  4IUT A;  1I8F A;  2L5Q A;  3VS1 A;  5LJ5 h;  2RJE A;  2X3W D;  3LYI A;  4BB7 A;  1XJW B;  3FJP A;  1U8R A;  2K9G A;  2DTO A;  3L42 A;  4LDW A;  4J83 A;  1NBE B;  1OPL A;  3HP9 A;  2CP0 A;  2OAU A;  3NTI A;  4HCC A;  2RA2 A;  4N0A A;  1GRI A;  1IRE B;  1G2B A;  1AEY A;  2KEA A;  2ZCF B;  2RO0 A;  1N8R C;  1GCQ A;  1SG5 A;  3QJ6 A;  1KQ2 A;  1OX9 A;  1M3C A;  4M77 A;  2LQK A;  3CME Q;  5GAO l;  4DBR A;  1KHI A;  2QYZ A;  2FVU A;  2JMC A;  4VUB A;  2OTL A;  1NJI C;  2EQM A;  2BUD A;  2RN8 A;  4N0A C;  1BCO A;  1IZ6 A;  3OBY A;  3T9N A;  3CCR T;  2LP5 A;  3SHW A;  3L2V A;  2LCC A;  2DO3 A;  1GCQ C;  3A8O B;  2KDS A;  2GFU A;  3F70 A;  3CCE Q;  1WHJ A;  4C0D B;  1YWP A;  4M77 C;  4DOW A;  2W10 A;  2K5L A;  5LJ3 d;  4XK8 E;  4OB1 B;  2EYW A;  3CD6 T;  3OYF A;  4WF2 A;  2XG8 D;  1BI3 A;  3RNJ A;  3UA7 A;  1XQH A;  4C5I A;  1NLO C;  2EYQ A;  1C1A A;  1QLY A;  2HD0 A;  1V76 A;  1YHQ T;  4A54 A;  5EC7 A;  3CQT A;  4RG2 A;  3LW5 E;  2EYZ A;  4F7U E;  4II1 A;  3OBW A;  4LDV A;  2QEX T;  2IG0 A;  1I1J A;  2XU8 A;  2GQI A;  1UGQ B;  1HK9 A;  2DVE A;  4DOV A;  3J80 E;  2MMP A;  4PL6 A;  1BI0 A;  1BI1 A;  2G6F X;  2CP7 A;  3MEA A;  1VQ9 T;  4C0D C;  3GPL A;  1Q82 U;  2KK4 A;  1LCK A;  3VS6 A;  4DEX A;  2CH4 W;  1G3S A;  1T3L A;  2HL5 C;  5IHK A;  1UHC A;  1MGQ A;  2E5K A;  1K73 U;  4RTY A;  3CPW A;  1I0C A;  2RHZ A;  1Q95 G;  1OV3 A;  1M8M A;  4OP0 A;  1VQM T;  2LJ1 A;  5J39 A;  1RAA B;  2JJ9 A;  1WHK A;  4AT1 B;  3I56 T;  3OYM A;  2M0O A;  1GBQ A;  4DEY A;  5LJ3 f;  2MWO A;  3JCM J;  2GGR A;  3S6W A;  1YIJ A;  2E6N A;  2CP5 A;  4BE2 A;  3OB9 A;  3CPW S;  4A53 A;  2HCK A;  1NEG A;  3OA6 A;  1TXQ A;  1VYT A;  3H0F A;  4RTU A;  4DQ2 A;  2B86 A;  4M78 B;  5GMK i;  1RAG B;  2IPO B;  3SWN C;  4LNP A;  1LJO A;  5L8R E;  3JB9 H;  1VQ8 T;  2QQB A;  3ER0 A;  2HQE A;  2M1H A;  3MP1 A;  3I5S A;  2ECZ A;  5LJ3 j;  4KUI A;  1VQO T;  1I81 A;  2F2X A;  2HSP A;  4ZN3 A;  2FRW A;  2QQS A;  1TU0 B;  4ZTF A;  4L6V 5;  3CC4 T;  2NYS A;  3CCS T;  1IXD A;  4M78 A;  3RR6 A;  8AT1 B;  3RUX A;  1HJD A;  3REA B;  3TEE A;  5GAN 4;  1PC0 A;  3E9G A;  5CKF A;  5I21 A;  4B6M A;  1VQN T;  2RHX A;  4BE1 A;  3I9Q A;  3MEV A;  4HT8 A;  1IB8 A;  2OJ2 A;  2XDD A;  2ZPH B;  4C5H A;  3E1S A;  2DL5 A;  3CC7 A;  5HY6 A;  1T0J A;  4E7I A;  1DJ7 B;  2QXF A;  1K8A U;  4BDY A;  4RMO A;  2JUF A;  1ACM B;  4F7U F;  3CCR Q;  1YJ9 T;  3ZL7 C;  4ELY C;  1KFZ A;  1AVZ C;  3KXT A;  1TUD A;  2EPD A;  1NPP A;  3QZ9 B;  1X6G A;  4F04 B;  4E7H A;  4RTV A;  2DXU A;  4C92 A;  3OYC A;  4M7D A;  3OYN A;  5LJ3 e;  2LTO A;  2RQT A;  1OQK A;  1KC8 R;  2FYK A;  3VS2 A;  3EFS A;  1D3B B;  3J7A F;  3G71 T;  4LXC A;  4JLG A;  1AD5 A;  5DM7 R;  3M58 A;  2JTF A;  3CCM T;  1VQ7 A;  3L1A A;  1D0X A;  1R0B G;  5KH6 A;  3C0C A;  3CD6 Q;  3V7C A;  4J9G A;  1OU9 A;  1Y57 A;  1SPK A;  1M27 C;  4PJJ A;  3LGL A;  3M55 A;  2DF6 A;  3OYY A;  1U5S A;  2VGN A;  3PIP A;  2AHJ B;  1AWW A;  1PSF A;  4C92 C;  5GAN f;  4M7D C;  4JLI A;  2GF7 A;  1YHQ Q;  2O4X B;  3QYH B;  4KUD K;  1G5V A;  1KD1 R;  2Y4X A;  1QKX A;  5KYU B;  1VQK T;  3CC2 Q;  1EX4 A;  4MMK A;  1BBZ A;  2ROT A;  2HSE B;  4BI8 B;  1D3B A;  3X25 B;  4XQ3 A;  2QEX Q;  2DIL A;  3BE3 A;  1CKB A;  1WHH A;  4N4I A;  3I5R A;  4LD9 K;  3OYK A;  4AMC A;  4C8Q B;  1Y71 A;  4XU2 A;  4C0F A;  4ZGD B;  6AT1 B;  1ZUY A;  2V1Q A;  4MZT A;  1VQ9 Q;  2CP2 A;  3NPF A;  2BZX A;  2CZ7 B;  5A0D A;  2DL7 A;  3CCV T;  3CBM A;  5GAN j;  3I55 T;  2ZPE B;  3EHR A;  1O9S A;  2O4X A;  2DM1 A;  2QDL A;  1JO8 A;  1KIK A;  4M77 E;  5KYU A;  1GFD A;  2DL8 A;  1LPL A;  4XAX B;  4KBM B;  3I56 Q;  1UEC A;  2LJ3 A;  1Q7Y R;  3FRN A;  4C5G A;  4A4K A;  2K4Y A;  3KFV A;  4JRK A;  3HPW A;  5CVI A;  1ABQ A;  1NG2 A;  3H41 A;  1R0C B;  4C8Q A;  3VKI A;  1VQ5 A;  2E12 A;  1M1G A;  3UT1 A;  3MKD A;  5CK9 A;  1U1S A;  1V1C A;  1QKW A;  2QA4 T;  1YIT T;  1PSE A;  2L3S A;  1VYV A;  3HRT A;  1UGR B;  3CCL T;  3G6E T;  1RAH B;  1K9A A;  2O88 A;  4QVZ A;  3P8D A;  1VIE A;  1ZBJ A;  5GAM h;  1YJN T;  2JVV A;  3PGG A;  2DET A;  3X20 B;  3M4Y A;  3U23 A;  3H8Z A;  4M75 A;  1TWB A;  1KQS S;  4X34 A;  1VQP T;  3DB4 A;  1WXU A;  2EWN A;  2EQI A;  1IGQ A;  1VQ4 A;  2K57 A;  3E9F A;  2SRC A;  3CC4 Q;  3CCS Q;  4JJD A;  5GAN e;  5KYY B;  3M0S A;  3ZBD A;  4E2F B;  3L2Z A;  1NYG A;  2JOY A;  4KT0 E;  4M75 C;  4J7F A;  4XU0 A;  1B7T A;  2X4Y A;  1QVP A;  1VQN Q;  2J6F A;  2JM8 A;  2XIC A;  2YLB A;  3BY7 A;  1RLQ C;  3M0P A;  1WXB A;  3QWY A;  5KCH A;  3CCU A;  2MPX C;  2HZY A;  5CKE A;  2KXD A;  4FT4 A;  4DA4 A;  1K9M U;  4ZGJ B;  2DIQ A;  3CMA T;  2P4T A;  4ANJ A;  3WXM B;  1OPK A;  4E7K A;  1YJ9 Q;  4A4H A;  3S3N A;  4OMF B;  1GXI E;  4OMQ A;  4IUP A;  1HYO A;  4JZ3 A;  1QVF P;  4RTX A;  3M9Q A;  1S72 A;  1PCX A;  2DX1 A;  2KR3 A;  5I2M A;  4HVU A;  3TU4 K;  2QK0 A;  3HFO A;  4AG2 C;  3CEY A;  1JU5 C;  5CO7 A;  1CKA A;  3G71 Q;  3V8K A;  2CZ6 B;  2ED1 A;  2OTL T;  2HQH A;  1KD1 U;  1AZG B;  4IKF A;  4M77 F;  3FDR A;  3I35 A;  4HVV A;  4JRI A;  2JT4 A;  2DE0 X;  5GAO p;  4PJO C;  1K4U S;  1QCO A;  2G3R A;  4X9D A;  3JCM d;  2XID A;  4M7A B;  1BCM A;  1M1K R;  4BE0 A;  4P5N A;  4CI0 C;  2DRK A;  2Y90 A;  4Y91 A;  2L3Q A;  4JRP A;  4E6R A;  4KGX B;  3JRZ A;  3JB9 G;  2EJF A;  3C12 A;  2M0Y A;  4FW2 A;  3EG0 A;  1WLP B;  5CQX A;  1QVG P;  2L0A A;  4XTV A;  1W70 A;  1MV3 A;  2V8K A;  3L2U A;  1Q7Y U;  1B07 A;  1PKT A;  3HSB A;  4D6W A;  2OAW A;  4RUG A;  3CCJ Q;  3CCQ Q;  1Q82 R;  2CT4 A;  2D8J A;  4OGC A;  5FU7 C;  2QTX A;  4BI4 A;  3OYE A;  2DLP A;  4J6X A;  5IXB A;  4M7A A;  1K73 R;  1BYM A;  2OI3 A;  3I55 Q;  2RH2 A;  1XOV A;  2RJD A;  1BU1 A;  2DPP B;  4KUL A;  2EGA A;  2YLC A;  4E7S A;  4MZP A;  2VB6 A;  2Y4Y A;  5GAO n;  1R77 A;  2F1L A;  1WNL A;  2QDY B;  5GAN 8;  3VS0 A;  3PVL A;  2FPF A;  1CSK A;  2EKO A;  4GLM A;  4M7A C;  4FSS A;  4TVR A;  2MK5 A;  1K0S A;  2XKO C;  3EG9 B;  1TG0 A;  1ZBX A;  2QA4 Q;  3JB9 F;  2QAZ A;  4C92 E;  4M7D E;  2KY9 A;  2JXB A;  3CME A;  1JEG A;  2KYB A;  3CCL Q;  4PK4 A;  1RI0 A;  3P8B B;  1UGS B;  1JRI A;  2CH4 A;  1E7O A;  5GAN 7;  4ATO A;  2DZC A;  3SD4 A;  4L5G A;  2C0O A;  3CMA A;  3L2R A;  5HK0 A;  5DLO A;  1YIJ T;  1VQL A;  1VQP Q;  1M1F A;  4LUD A;  3TCJ A;  3TSZ A;  2EBP A;  2FG0 A;  2RK1 A;  2KYM A;  1M2O A;  5I22 A;  1I5O B;  1ZLM A;  4XTW A;  2D9T A;  1NPR A;  2L3R A;  3GLX A;  5AYF A;  1Q81 C;  4PJM A;  4J9E A;  1C0M A;  1YI2 Q;  5GMK j;  5A2Q E;  3Q1J A;  2ZPF B;  3MPU B;  4IUQ A;  4LDY A;  3QWX X;  4HCK A;  1GL5 A;  5L23 A;  4J9F A;  4KH1 B;  3ULR B;  2RQU A;  2CKK A;  2NUZ A;  2VXF A;  1M3B A;  4J5Y A;  2FRY A;  2AIR B;  2P0K A;  3M53 A;  4RKU E;  1T0H A;  4LD6 A;  1WJQ A;  3RMS A;  4GBQ A;  3UWN A;  3EG1 A;  5DY9 A;  4DBQ A;  2X4W A;  2BTT A;  3OSV A;  1K8A R;  1M9S A;  5LJ5 d;  2XI9 A;  1WHL A;  5GAO q;  3PE0 A;  2YUP A;  1FX7 A;  4B9W A;  1MMN A;  1PWT A;  4JPB W;  2E64 A;  3VYH B;  2GTJ A;  5IAY A;  1BI2 A;  4CC4 B;  1WPY A;  2VUB A;  2A08 A;  2XMF A;  1HD3 A;  2EIF A;  2VVK A;  3EH1 A;  2KGT A;  3A1P A;  1AOJ A;  3CC7 T;  3AT1 B;  2DVJ A;  4MML A;  2KE9 A;  2ZZD A;  5CQY A;  1VOM A;  1M1K U;  3OYJ A;  2OTL Q;  1W6X A;  1IRX A;  3LWH A;  4JJC A;  2YDL A;  5GMK e;  4JZ4 A;  3QZ5 B;  1S1N A;  1N9S A;  4NS5 A;  5GAN 6;  1VIF A;  1WQ7 A;  4KRT A;  5LJ3 g;  4FCY A;  4M75 E;  1UG1 A;  1UJY A;  4MDW A;  1M90 R;  1N5Z A;  3UF4 A;  1WXT A;  4OF1 A;  1N9R A;  3VUB A;  1JB0 E;  9ATC B;  3G4S A;  4GLK A;  3QO3 A;  3QKJ A;  4JDS A;  1EZZ B;  1BIB A;  1VUB A;  1VQ7 T;  1SRL A;  4C92 F;  1MMG A;  2CP3 A;  4M7D F;  1SHF A;  1IGU A;  1UTI A;  4EMK B;  3S3M A;  2NWM A;  3TRE A;  1M3A A;  2KVQ G;  2CUD A;  1FMK A;  2KAF A;  2DJZ A;  3EFO B;  3VS5 A;  2PQW A;  4XTY A;  2EFI A;  5GMK l;  2XDP A;  1LNX A;  3BDL A;  2RQR A;  3OYG A;  2H3J A;  5GAN h;  5HK3 A;  4A4E A;  5CCA A;  5LL6 S;  1I5L A;  2JN0 A;  2PVD B;  1MMD A;  5GAO m;  3TVT A;  2ED0 A;  5FWC A;  2RMO A;  5LJ5 j;  1HSQ A;  3RKX A;  2WSE E;  1V29 B;  4M77 D;  4F7U G;  4PJO E;  4QQG A;  1QP2 A;  1Q86 R;  4QVC A;  3JB9 I;  3TSW A;  3QJY A;  1TH7 A;  1FXX A;  3GNG A;  1IHW A;  4Z02 A;  5HCK A;  4CC3 A;  1AWX A;  3DLM A;  3KBG A;  2DRM A;  2CRE A;  2LX7 A;  4FYX B;  2LCS A;  1VQ5 T;  2QI2 A;  3OQ5 A;  1B3Q A;  1QMC A;  2VV5 A;  4JS4 A;  1RLP C;  4BY6 B;  1VQ6 A;  2YRV A;  1ARK A;  2RD1 A;  2K5F A;  2HNI A;  2EGE A;  4GY5 A;  1MUZ A;  1TSF A;  4M78 C;  1AHJ B;  3ZEH A;  2ZPG B;  3FB9 A;  3CXC P;  5EG2 A;  1H3Z A;  4ZNX A;  4OMM A;  2RF0 A;  2E1H A;  4F14 A;  2MAM A;  1PM3 A;  3HL8 A;  2EGC A;  4Z8A A;  2RHU A;  1PHT A;  2HBP A;  1SSF A;  2CZ0 B;  2O9S A;  2FHD A;  3A8G B;  5LJ5 e;  2VC8 A;  3EGX B;  4M75 F;  2F5T X;  1WJS A;  5GAN g;  1K9M R;  1VQ4 T;  3CC2 A;  1EFN A;  4M7A E;  4C0Z A;  2QQA A;  2B8A A;  2RJC A;  3OMC A;  3NFC A;  1ZHI A;  3M0U A;  4QW2 A;  3JB9 D;  4PJO G;  1U3O A;  2LQN A;  2EVR A;  3V7R A;  1N27 A;  3EH2 A;  1YNZ A;  3DKM A;  1X6O A;  2ZPI B;  1QWF A;  4LDU A;  2WAC A;  3PMI A;  3X28 B;  2FB7 A;  1ZSG A;  2NUT B;  2FPD A;  3M56 A;  4PNO A;  1QCF A;  3CCU T;  2NUP B;  2DFU A;  3M0R A;  4XU1 A;  2CP6 A;  2DZ9 A;  1W2B P;  3EGX A;  1M90 U;  5A0G A;  2BZ8 A;  1X27 A;  3P8H A;  1G3T A;  2DL4 A;  3ME9 A;  3GNF B;  2VYT A;  5IHN A;  3ASK A;  3OW2 P;  2L2P A;  4AFZ C;  2MF2 A;  3VUZ A;  4FYW B;  3G1J A;  4CC7 A;  2V8I A;  2CZ1 B;  2YUN A;  1W4S A;  1S72 T;  4RG8 A;  2A3L A;  1N8R R;  1UDL A;  2SEM A;  2DNU A;  2FPE A;  1X6B A;  1YFN A;  3L2W A;  2A0F B;  2V26 A;  1HXD A;  2OTJ A;  4J9D A;  1H64 1;  1YJW A;  3WVD B;  5GAN 3;  3HRS A;  4PJO F;  1PD0 A;  3OYB A;  2V1R A;  5KYX B;  1O75 A;  2DBM A;  4A4G A;  2HBW A;  1NJI R;  3QXE B;  3GBQ A;  3VYG A;  2D0Q B;  1OOT A;  2YSQ A;  1VQM Q;  4LDX A;  4J6W A;  2AKK A;  2COY A;  3H9N A;  2KT1 A;  1JXM A;  1TUG B;  3SEM A;  4F7U B;  3JCM V;  2ATC B;  2KRO A;  4N4G A;  2E10 A;  1Q86 U;  3JAM E;  2K79 A;  1UFF A;  4JJN K;  2C0T A;  5KYX A;  2DL3 A;  5ECA A;  1ZUU A;  1LOJ A;  2PVG B;  1PNJ A;  3LWI A;  1I4K 1;  4OVA A;  2AKL A;  2LDM A;  4K11 A;  3RES A;  4C8Q C;  1YCY A;  2VAS A;  3JCM Q;  1VQ8 Q;  1WDX A;  3OYA A;  3FC3 A;  2PNI A;  2YUO A;  1ZSZ B;  8ATC B;  3UA6 A;  1VQO Q;  1OYX A;  4ZGE B;  1D1C A;  1KQS P;  4C5E A;  3RDV A;  3QDR B;  3H0I A;  5KE3 A;  2K3X A;  2R57 A;  1AWJ A;  2BKD N;  2YUQ A;  3L2Q A;  1VA7 A;  1H8K A;  4FT2 A;  1D0Y A;  4V2S A;  1WZO A;  2EJ9 A;  3JCM X;  4YTL A;  3IQL A;  4Y92 A;  5A0L A;  1PG5 B;  4C92 D;  4M7D D;  5FU6 B;  1VQ5 Q;  2I0N A;  4M77 G;  1G83 A;  3EGD B;  4HCZ A;  3CBP A;  1TUC A;  2E5Q A;  1K0X A;  3CME T;  4IUR A;  2J06 A;  2LQW A;  2AZV A;  2EQK A;  2XHC A;  2A36 A;  1D1B A;  1FMW A;  2COZ A;  2EYX A;  3OYH A;  5GMK h;  1QVF A;  2A28 A;  4F17 A;  5GAM d;  1WFW A;  4EMH A;  2JTE A;  3VRZ A;  5KYY A;  1VQL T;  1ZQ1 A;  2DK3 A;  3JCM b;  3M57 A;  4BDZ A;  1WX6 A;  4ORZ A;  4M4Z A;  3CPF A;  2EJG A; 
#chains in the Genus database with same CATH homology
 1VYT A;  3H0F A;  4RTU A;  2B86 A;  2EW3 A;  4J9E A;  2KRS A;  2CT3 A;  3RBB B;  3O5Z A;  1T3S A;  3QWX X;  4LNP A;  4HCK A;  2ABL A;  2JW4 A;  1GL5 A;  5L23 A;  4J9F A;  4Z89 A;  3ULR B;  2RQU A;  2K2M A;  2NUZ A;  1U06 A;  4CC2 A;  1GBR A;  1M3B A;  2FRY A;  2KBT A;  3I5S A;  2ECZ A;  2W0Z A;  1T0H A;  4D8K A;  1PRM C;  4GBQ A;  3EG1 A;  1YCS B;  5I11 A;  1W1F A;  2F2X A;  2HSP A;  1IO6 A;  1YWO A;  3M0Q A;  2FRW A;  2D1X A;  3LH5 A;  4IIO A;  2BTT A;  4RTW A;  3PE0 A;  1ZUK A;  2YUP A;  1HJD A;  3REA B;  1SEM A;  1UE9 A;  1WA7 A;  2D8H A;  1UJ0 A;  1JQQ A;  1PWT A;  2HDA A;  4JPB W;  2RQV A;  2EKH A;  2HEQ A;  1H3H A;  1WIE A;  2GTJ A;  2H8H A;  4CC4 B;  4ESR A;  2JM9 A;  2VWF A;  2A08 A;  3I9Q A;  2XMF A;  1HD3 A;  1VYU A;  2LJ0 A;  2OJ2 A;  2VVK A;  2KGT A;  1AOJ A;  4WCI A;  2DL5 A;  2DVJ A;  1GCP A;  2KE9 A;  1T0J A;  2RNA A;  1E6G A;  2EYY A;  3JV3 A;  1W6X A;  2FO0 A;  5GJV B;  2PZ1 A;  4JJC A;  2YDL A;  4JZ4 A;  3ZL7 C;  1KFZ A;  1S1N A;  1AVZ C;  1TUD A;  2DJQ A;  2EPD A;  1Z9Z A;  4KRT A;  5FWB A;  1X6G A;  1UG1 A;  1UJY A;  1UHF A;  1N5Z A;  2KNB B;  1BK2 A;  4RTV A;  3UF4 A;  1WXT A;  1H92 A;  2RQT A;  3VS2 A;  2GBQ A;  2AZS A;  1SSH A;  5IXF A;  1AD5 A;  1KSW A;  3FJ5 A;  1SRL A;  2X3X D;  1SHF A;  3C0C A;  1RUW A;  4J9G A;  2DYB A;  2D0N A;  1Y57 A;  2C0I A;  1SPK A;  1M27 C;  4QT7 A;  1UTI A;  2NWM A;  2DF6 A;  1M3A A;  1U5S A;  2O9V A;  4AFU C;  2CSI A;  1AWW A;  2CUD A;  1WI7 A;  1K76 A;  1FMK A;  1AWO A;  3VS4 A;  1UUE A;  1PRL C;  5FW9 A;  3VS5 A;  3VS3 A;  2KT8 A;  1QKX A;  3NMZ C;  2DA9 A;  2L3P A;  4HVW A;  1UGV A;  1BBZ A;  1X2K A;  2ROT A;  3PVQ A;  2RQR A;  3R6N A;  2KXC A;  4IIM A;  1NEB A;  1SHG A;  2BZY A;  2DIL A;  1CKB A;  2K6D A;  2FEI A;  3I5R A;  1GFC A;  3M0T A;  4D8D A;  3TVT A;  2ED0 A;  3EG3 A;  1KJW A;  2PTK A;  5FWC A;  1ZUY A;  2RMO A;  2V1Q A;  1HSQ A;  2ROL A;  3NPF A;  2BZX A;  2DL7 A;  2JMA A;  3EGU A;  3EHR A;  1WYX A;  2DM1 A;  2QDL A;  1JO8 A;  1KIK A;  3TSW A;  1GFD A;  2DL8 A;  1QWE A;  4A63 B;  1PKS A;  1UEC A;  2LJ3 A;  5HCK A;  4CC3 A;  4AFS C;  1Y0M A;  1YP5 A;  5GJW B;  3KFV A;  1AWX A;  2RPN A;  1ABQ A;  1NG2 A;  2DRM A;  3H41 A;  2CRE A;  2LX7 A;  2LCS A;  1B3Q A;  1RLP C;  4LN2 A;  1V1C A;  1QKW A;  1ARK A;  1X43 A;  2L3S A;  1VYV A;  2EGE A;  2J6O A;  2F2V A;  4OML A;  1A0N B;  1MUZ A;  2MIO A;  1X69 A;  1K9A A;  2O88 A;  2J05 A;  1NM7 A;  1ZBJ A;  4RTT A;  2ESW A;  4ZNX A;  4OMM A;  2RF0 A;  1ZX6 A;  4F14 A;  3U23 A;  3A98 A;  2EGC A;  4HXJ A;  4Z8A A;  1PHT A;  1NYF A;  4J9C A;  3REB B;  2RQW A;  2K3B A;  1WXU A;  1M30 A;  2O9S A;  3EHQ A;  2EQI A;  1RI9 A;  1EFN A;  2CUB A;  2GNC A;  2DBK A;  4LUE A;  2SRC A;  3M0U A;  4JJD A;  4AFQ C;  1ABO A;  1U3O A;  2EVR A;  2LQN A;  3M0S A;  3VRY A;  5IHI A;  1NYG A;  2CDT A;  1YNZ A;  1E6H A;  1NLP C;  1OEB A;  1QWF A;  2MCN A;  2AK5 A;  2J6F A;  2JM8 A;  1ZSG A;  2LZ6 B;  1Z9Q A;  2FPD A;  2KRM A;  1RLQ C;  2LNH B;  3M0P A;  1WXB A;  4J9H A;  1YN8 A;  2K7A A;  3QWY A;  5IH2 A;  1QCF A;  1JXO A;  3VS1 A;  3M0R A;  2KXD A;  2X3W D;  1SRM A;  2BZ8 A;  4OMP A;  1X27 A;  2K9G A;  2DL4 A;  1OPL A;  5IHN A;  1OPK A;  2L2P A;  1GRI A;  4AFZ C;  4OMQ A;  1G2B A;  4OMN A;  4CC7 A;  1AEY A;  2KEA A;  2YUN A;  4JZ3 A;  1UDL A;  2SEM A;  4RTX A;  2DNU A;  2FPE A;  1X6B A;  1GCQ A;  4J9B A;  2DX1 A;  2KR3 A;  4HVU A;  4J9D A;  2JS0 A;  3EG2 A;  3VS7 A;  4AG2 C;  4LE9 A;  1M3C A;  2GTO A;  1JU5 C;  2ENM A;  1CKA A;  2V1R A;  2JMC A;  2ED1 A;  2DBM A;  2HBW A;  2A37 A;  1AZG B;  2RN8 A;  3GBQ A;  1OOT A;  2YSQ A;  2LMJ A;  1AZE A;  2AKK A;  3I35 A;  4HVV A;  2LP5 A;  4F16 A;  2JT4 A;  3SHW A;  2DE0 X;  1GCQ C;  2JS2 A;  2KT1 A;  1K4U S;  1JXM A;  2CSQ A;  3SEM A;  1FYN A;  1YWP A;  4Z88 A;  1J3T A;  2W10 A;  2DRK A;  2L3Q A;  2M51 A;  4E6R A;  2KRO A;  2P4R A;  2K79 A;  3NGP A;  1UFF A;  2M0Y A;  2C0T A;  2DL3 A;  2EYW A;  5ECA A;  1ZUU A;  1I07 A;  3EG0 A;  1PNJ A;  1WLP B;  2MOX A;  2L0A A;  1W70 A;  1MV3 A;  3RNJ A;  3UA7 A;  2J7I A;  2AKL A;  4K11 A;  1B07 A;  1NLO C;  1PKT A;  2OAW A;  4RUG A;  4JJB A;  1WDX A;  2CT4 A;  2PNI A;  2YUO A;  2D8J A;  1QLY A;  3UAT A;  3UA6 A;  2DLP A;  5IXB A;  1K1Z A;  5EC7 A;  3CQT A;  3H0H A;  2OI3 A;  3H0I A;  1AWJ A;  2YUQ A;  1BB9 A;  1XOV A;  1VA7 A;  2EYZ A;  1H8K A;  1BU1 A;  2EGA A;  4R0K A;  3IQL A;  4RTZ A;  2IIM A;  4Y92 A;  1I1J A;  2DMO A;  2GQI A;  3VS0 A;  2J6K A;  3PVL A;  2FPF A;  2I0N A;  4EIK A;  1CSK A;  2F2W A;  2KRN A;  4GLM A;  2G6F X;  1G83 A;  2O2O A;  4FSS A;  1X2Q A;  1K0S A;  1TUC A;  1LCK A;  3VS6 A;  4DEX A;  1TG0 A;  2CH4 W;  1T3L A;  1K0X A;  5IHK A;  4OMO A;  1UHC A;  4J9I A;  2J06 A;  2JXB A;  2E5K A;  4RTY A;  1JEG A;  2LQW A;  2KYB A;  2O31 A;  1I0C A;  2VKN A;  1MV0 B;  2AZV A;  1OV3 A;  1M8M A;  2LJ1 A;  2CH4 A;  2A36 A;  1E7O A;  2C0O A;  2EYX A;  1GBQ A;  2A28 A;  4DEY A;  4F17 A;  4AG1 C;  1WFW A;  2JTE A;  3VRZ A;  2GGR A;  4X1V A;  4LUD A;  3TSZ A;  2EBP A;  2FG0 A;  3THK A;  1WX6 A;  2KYM A;  4ORZ A;  5I22 A;  3NHN A;  4M4Z A;  1ZLM A;  2YT6 A;  2HCK A;  1NEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...