4ORZA

Hiv-1 nef protein in complex with single domain antibody sdab19 and an engineered hck sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
IIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of HIV-1 Nef by a high-affinity binding single-domain antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/apoptosis/immune system
molecule keywords Tyrosine-protein kinase HCK
total genus 13
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4orzA00
2W10A 4KRTA 5IXFA 1BB9A 1PHTA 1K1ZA 1HJDA 4WCIA 4HVVA 2EPDA 2B86A 4AG1C 4AFQC 1MV3A 4LE9A 3REAB 2NWMA 1HD3A 1SPKA 3THKA 2RQRA 1UECA 2L0AA 1FMKA 2L3QA 2KR3A 4AG2C 2DL8A 2J6KA 1X2QA 4JJDA 3REBB 1X6BA 1OV3A 2KYMA 2RMOA 1KJWA 1AWJA 4Z8AA 4CC4B 2DILA 1CKAA 2DMOA 4OMMA 2JS2A 2E5KA 3NHNA 1YN8A 1K0SA 1ABOA 2JW4A 2CUBA 2YUNA 1GL5A 1RI9A 5EC7A 4F14A 3RNJA 2M51A 3I35A 2X3XD 1G83A 2LNHB 4GBQA 3EG0A 1B3QA 2LJ3A 1E7OA 2DM1A 3VS2A 3EG1A 2FPFA 1CSKA 2EGAA 4HVUA 1GCQC 1SHFA 2HCKA 1TG0A 1ZBJA 1OOTA 2ENMA 3VS3A 5GJVB 1U3OA 1H3HA 2H8HA 5IHIA 1PNJA 2EGEA 2A36A 2ABLA 3EG3A 1X69A 2O9SA 2RN8A 4JZ3A 4HXJA 2FEIA 2PTKA 2VWFA 1KIKA 4RTVA 2DL7A 2F2WA 1YP5A 2KYBA 2W0ZA 1VYUA 2LJ1A 1OPKA 2KRMA 2GQIA 3M0PA 4JPBW 2GNCA 1HSQA 5I11A 1ARKA 2PZ1A 1H8KA 2CUDA 4J9DA 1BBZA 2HBWA 1YWPA 2O88A 2DL3A 5FWBA 4J9FA 2KEAA 4JZ4A 1T3LA 1UUEA 2J06A 4RTWA 2KNBB 1NEGA 3IQLA 1IO6A 3GBQA 3TVTA 3H0HA 4CC2A 2KRSA 2GTOA 2YSQA 2DA9A 2AKKA 1NEBA 3VS0A 3EG2A 5IH2A 1K9AA 2EBPA 1UTIA 5FW9A 1UHFA 4LN2A 1RLPC 1JU5C 2L3PA 4QT7A 2X3WD 1SRLA 2EVRA 1M3CA 1H92A 1V1CA 1W70A 1SSHA 2DF6A 1MUZA 2J7IA 1Z9QA 2LZ6B 5FWCA 2JM9A 4R0KA 4ZNXA 1E6HA 3UATA 1A0NB 2ECZA 1WXTA 2KE9A 1PKSA 1KSWA 1X2KA 2V1RA 4IIMA 3VRYA 5IHNA 4J9IA 2XMFA 2CSIA 1AZEA 5HCKA 3KFVA 1WIEA 4RUGA 3SHWA 1WXUA 2A37A 2EYWA 4K11A 2LCSA 2LJ0A 3VS1A 1AWWA 1MV0B 3UA6A 2ROTA 4E6RA 2KT8A 2MIOA 1B07A 2DX1A 3U23A 1NLOC 1N5ZA 2O31A 1K76A 1Y0MA 2FG0A 4DEXA 4RTTA 1W1FA 1T3SA 2VKNA 4RTYA 2DLPA 2PNIA 1VYTA 1M3BA 3H0FA 1U5SA 1RUWA 1AVZC 2CT3A 1RLQC 2IIMA 4D8DA 2YUOA 3QWYA 1I0CA 2BZYA 1NYGA 3C0CA 1AD5A 3M0UA 2F2XA 2O9VA 1JXMA 1OPLA 2MOXA 3NPFA 2LP5A 2CREA 1M30A 2JMAA 4J9GA 1JQQA 3PVQA 4RTUA 1SRMA 2KXCA 3SEMA 4ESRA 4F17A 1T0JA 3TSWA 2V1QA 2ESWA 3M0TA 2MCNA 1TUDA 2YUQA 4LNPA 2AZSA 1GRIA 1WX6A 2DBMA 3VS7A 2EYYA 4Z89A 1QWEA 2KT1A 1M3AA 2EYZA 4D8KA 2F2VA 4F16A 1KFZA 2FO0A 2KRNA 3EGUA 3EHRA 5IXBA 2K7AA 4X1VA 1UJ0A 3FJ5A 1ZUUA 2CH4A 4AFZC 3VRZA 4OMOA 1S1NA 2JXBA 2RPNA 3PVLA 1GCQA 5L23A 4EIKA 3PE0A 4CC3A 1VYVA 2EYXA 2FRYA 2FPDA 1PRLC 2D1XA 2EW3A 3TSZA 2DYBA 2DL4A 2KROA 1UHCA 2BZ8A 1ZUYA 1QKWA 2J6OA 1WA7A 2RF0A 4JJBA 4OMQA 3ULRB 3ZL7C 1ABQA 2RQTA 1UDLA 4CC7A 2HDAA 1QLYA 3M0SA 2DVJA 1JO8A 1I1JA 2D8JA 1AWOA 2CSQA 4GLMA 1EFNA 1WYXA 4IIOA 2J6FA 1YCSB 2OJ2A 2OAWA 2HEQA 2RQWA 3VS6A 2I0NA 4Z88A 1K0XA 4DEYA 1WFWA 1SHGA 1WI7A 1X27A 2L2PA 2NUZA 3EHQA 1UE9A 1QKXA 1VA7A 1X43A 1Y57A 2JT4A 1GCPA 3UA7A 4RTZA 1OEBA 1NG2A 1UJYA 2RNAA 2JS0A 3LH5A 4J9BA 1TUCA 1LCKA 5ECAA 2K6DA 1W6XA 2CT4A 2AK5A 2RQVA 1ZX6A 4RTXA 4J9CA 2C0TA 2C0IA 2CDTA 2BTTA 1X6GA 1ZLMA 2GGRA 2A08A 4M4ZA 2QDLA 2LQNA 3I9QA 2SRCA 3R6NA 1WDXA 2CH4W 4HVWA 1BU1A 2DRMA 1GBQA 1AWXA 2ED0A 2EKHA 2DBKA 3M0RA 3M0QA 2DJQA 2DNUA 5IHKA 2LQWA 2SEMA 3H41A 1SEMA 2KBTA 3NMZC 1Z9ZA 2AZVA 4OMLA 3I5SA 1K4US 4J9HA 2KGTA 1BK2A 1NYFA 2RQUA 1U06A 2M0YA 1JXOA 1ZUKA 2JTEA 2ROLA 1AOJA 1UFFA 2K79A 1GBRA 1M27C 2D0NA 1FYNA 3O5ZA 2K3BA 1M8MA 1WLPB 2EQIA 3CQTA 2K9GA 2GTJA 2KXDA 1PRMC 3RBBB 2ED1A 1I07A 2DL5A 2GBQA 2OI3A 2JMCA 3QWXX 4OMNA 3H0IA 2HSPA 2JM8A 1YWOA 4LUEA 4J9EA 2LMJA 2EGCA 1PWTA 5GJWB 2BZXA 2YUPA 1UGVA 2YT6A 4A63B 4ORZA 2O2OA 4AFSC 1CKBA 4AFUC 1NM7A 2C0OA 1E6GA 2D8HA 1AEYA 3A98A 4OMPA 5I22A 4HCKA 1PKTA 2A28A 4JJCA 1QWFA 1AZGB 4LUDA 2LX7A 1XOVA 1UG1A 1YNZA 1G2BA 2YDLA 1T0HA 2P4RA 4Y92A 1ZSGA 2L3SA 2K2MA 1NLPC 2DRKA 2AKLA 3JV3A 1J3TA 3NGPA 2J05A 3VS4A 2DE0X 3VS5A 4FSSA 1WXBA 3I5RA 1GFCA 1QCFA 1GFDA 2VVKA 3UF4A 2G6FX 1JEGA 2FRWA 2FPEA
chains in the Genus database with same CATH superfamily
4M75F 1PHTA 3CMAT 1BCOA 1K1ZA 4WCIA 4M7AC 3A8HB 4M77E 4AG1C 2EQJA 4Y28E 2JVVA 3PMIA 2OTJQ 3QSUA 3BDLA 1VQ5T 4EDUA 5GMKh 3CPWS 3MP6A 2EWNA 5KYXB 1VQNT 2L3QA 3VYHB 4AG2C 4E2FB 2DL8A 3REBB 1XNIA 2QK0A 3V8LA 2QDYB 5DY9A 1OV3A 1NPPA 2QQAA 4JRQA 2E64A 5I2MA 1MMAA 4F7UG 1IHWA 2VXEA 4OMMA 5KYWA 1MMGA 4X34A 1SKUB 3NHNA 3QZ5B 1KD1C 1P92A 3QJYA 4DOWA 3JB9H 4RCCA 2LCCA 1QCOA 1LVKA 2R57A 2YUNA 2X4YA 3PNWC 5EC7A 4F14A 1YI2Q 4M7AD 3I35A 2X3XD 1G83A 1OYXA 4GBQA 1NBEB 3EAEA 4XU2A 2CZ1B 4RMOA 1E7OA 2DM1A 3EG1A 3J81E 2EGAA 3M53A 1ZBJA 3VS3A 1NJIR 5GJVB 1U3OA 1MNDA 1YI2T 3UT1A 1PNJA 3EG3A 2OAUA 3OYLA 4HXJA 1VQOA 1RADB 2RB6A 4PJOF 3TU4K 4CI0C 2VWFA 1M90R 1KIKA 5KYUA 1IZ6A 4FM4B 3GP8A 4E47A 4OB2B 2BKDN 3HRSA 3GNFB 4M78D 3TEEA 5GANd 4HT8A 1XQHA 1HSQA 4GY5A 4J9DA 1BBZA 2HBWA 2V26A 3BY7A 4PJMA 2GF7A 3CC2Q 1VQLQ 4JZ4A 3PIPA 4C92F 1WHGA 4XK8E 1N8RU 2KNBB 1NEGA 1VQ7Q 1WJSA 1D3BA 4LDYA 2A0FB 2RHYA 2E4HA 2GTOA 2YSQA 2OTLT 3QIIA 5LJ5j 4M7DC 4GLKA 3S3MA 4PKCC 1QW1A 5KYYB 5GMKm 1RLPC 2L3PA 3META 2ZPHB 1UGQB 1H92A 5CKHA 1SSHA 2DF6A 2WSCE 4C92A 2J7IA 5FU6C 2HKNA 1MGQA 4XAXB 2L8DA 3H9NA 3VRYA 2DYIA 5HCKA 4RUGA 2HQEA 3PGGA 1LOJA 1M1KR 3C95A 3JCMh 2ROTA 2MIOA 1Y7XA 1HYOA 1TU0B 3U23A 4Z02A 3OW2S 4PJOA 1W1FA 4LDVA 2LX9A 2XDPA 4RTYA 1VQ9T 5D6WA 5LJ3e 3D7SB 2QQBA 2FZCB 4XU3A 1AVZC 3JCMW 2LT1A 3H6ZA 1VQNQ 5GANe 1JXMA 3SDZA 2RHXA 2LP5A 2CREA 3PIOA 3BFMA 1JJ2A 4M77G 3HTRA 2CP2A 3SEMA 4ATOA 5GAMe 4F17A 2V1QA 3N5BB 2LTOA 4OB0B 3INZA 4OF1A 2JN0A 4EPCA 3LYIA 3MPUB 2EYYA 4Z89A 3FLGA 5D6YA 2F2VA 4MMLA 3EGUA 5HK0A 2K7AA 1UJ0A 4QQ6A 3RR6A 3OSSC 3QKJA 1OQKA 7AT1B 4RCBA 2DEUA 3RMSA 1S1NA 2EJFA 2LNVA 2RPNA 5CR2A 1VYVA 2P4TA 1BIAA 4PJLA 2D6FA 3QO3A 1S72A 2DYBA 1PCXA 2J6OA 1WA7A 4OMQA 3OW2A 2LDMA 4CC7A 3NTHA 2FL7A 3CCMQ 1WHJA 1I1JA 2D8JA 5D6XA 4GLMA 1WYXA 1Q81U 3VS6A 1VQOQ 2A7YA 3HP9A 1YJWT 2I0NA 2ZPGB 4Z88A 2KVQG 3TCJA 1FX7A 3VUZA 4M7AA 1SHGA 1WI7A 2HBPA 2LRQA 1N8RC 1EZZB 1QKXA 1QVPA 4QW2A 1K9MU 3M9QA 2DXBA 1QP2A 1GCPA 1OEBA 1UJYA 1M4ZA 1TUCA 1LCKA 4EMKB 4PFPA 1H641 4BE1A 1W6XA 1VUBA 4FT2A 1VQPA 1Q81R 3P8HA 2DKGA 4KBMB 5CQYA 4A4HA 1S72T 2ZAEA 4AMCA 4M77A 4M4ZA 2QDLA 4R56A 4IUTA 2VC8A 1NE8A 3WVEB 1M5Q1 2HQXA 4M78E 5GAMf 4BE2A 2SRCA 3EFOB 3OYMA 1QVFS 3R6NA 4DA4A 1UEBA 2CH4W 3MKDA 4KGZB 4HVWA 4C8QF 2RJEA 1M1FA 4MDWA 3CCJA 3HRUA 2ED0A 1B7TA 5GANf 3M0QA 5LJ5d 4BDZA 1VOMA 2LQWA 2SEMA 1SEMA 3G71T 3S3OA 2DTHA 2AZVA 4C8QE 1VQ4A 1W2BA 2KGTA 1BK2A 2DETA 4QVCA 2OTLQ 2RQUA 4B9WA 2DD5A 1B34A 1ZUKA 1X01A 2MK5A 2ROLA 2K79A 1UFFA 2QA4A 1GBRA 2D0NA 2KK4A 2K3BA 2VYTA 5CAIA 1U8RA 2DXUA 1WLPB 3Q1JA 4AT1B 3CQTA 2BE7D 3CBPA 2L5QA 2A3LA 4C8QC 4M78A 5GAOn 4M7AF 3CCQQ 2DL5A 4C8QG 2BIVA 2RA2A 2JMCA 5KYWB 2JNGA 1YWOA 4LUEA 1W2BS 4ZTJA 2LMJA 2EGCA 2YUPA 4J6YA 2L89A 2O2OA 2RHIA 3OS5A 2RK2A 2MMPA 4FSXA 3MP8A 3EH1A 2EQUA 2VB6A 3LGLA 2M02A 1AZGB 1T0HA 4Y92A 3JCMg 1ZSGA 2L3SA 4C8QD 4FW2A 1NLPC 3OYHA 4IUUA 2DRKA 1BI0A 3CC7A 4FYXB 2X4WA 2AKLA 5J26A 4FIBA 2E1HA 1EX4A 2YLCA 3FB9A 5LJ5h 3L2WA 4E7LA 2LVMA 2HL3A 3VS4A 2DE0X 3VS5A 3CD6T 4M75C 4F04B 2BUDA 4ZTFA 4XTWA 2DXCA 3I55T 2RJCA 4L59A 3GPLA 3J80E 1M2OA 4KRTA 1HJDA 2DFUA 1R0CB 1YJ9A 5CKDA 5I21A 2DJZA 3REAB 1N8RR 4HCBA 4BI4A 4M75G 4CRIA 3CCUT 4C92D 1VQ5Q 4E7SA 3HL8A 2F1LA 2E12A 2RO0A 3CCLT 5CKEA 1I4K1 4A4GA 2IPOB 2DILA 2ZPEB 4DBFA 2KY9A 2E5KA 2QA4T 1TSFA 3M4GA 4IURA 4C92B 2CUBA 1GL5A 1WQ7A 1RI9A 5LJ5f 2NLUA 5J3BA 5M9OA 2FHDA 2HD0A 1TTHB 4E7JA 2LJ3A 2FZGB 2HZYA 5LJ3d 3LX7A 4C5EA 2RJFA 1GCQC 3EH2A 3GLXA 1OOTA 4BD3A 3M4YA 5GAN5 2H8HA 2EQKA 5CK9A 2A36A 3CMEA 5HY6A 1M2VB 5LL6S 5FU7B 3L1AA 1D1CA 4D6WA 2FEIA 2PTKA 3CCRQ 2E3HA 3ER0A 2E3IA 4B9XA 3CPFA 2KYBA 3QPHA 2W0ZA 2NYSA 1VYUA 1OPKA 1Q82R 1TUGB 3QBYA 3NFCA 2KQWA 3V8KA 4R55A 1Q7YC 4NOYA 4XU0A 2CUDA 1G3SA 5LJ3g 1YWPA 4FYWB 2O88A 2DL3A 4J9FA 1T3LA 1M1GA 2J06A 4KGVB 5A2QE 3H0HA 4CC2A 4IUQA 2KRSA 3CCQA 2E10A 3EG2A 4PLIA 1MNEA 2EBPA 1VQ6Q 1QQJA 3SB2A 4LN2A 4QT7A 1KK7A 1M3CA 2E6ZA 4X9DA 3CC2A 2JZ2A 2F5KA 1C6VX 5FWCA 2GFUA 4ZNXA 3EGXB 1A0NB 2I2LA 4IIMA 4RG8A 3EG9B 5IHNA 4J9IA 1Q7YR 2RK1A 1YJNT 5KE2A 4C8QB 3X20B 5KCHA 1KG1A 2LCSA 1U1TA 3QYGB 3VS1A 1MV0B 3UA6A 4E6RA 1BYMA 2R58A 4XTVA 1NLOC 3CC7Q 1Y0MA 3OYIA 2FG0A 1YBYA 3M54A 5IAYA 1BI2A 2DLPA 1K73R 1VYTA 2CT3A 3CCJT 1RLQC 3C4SA 2YRCA 1KQSA 2YUOA 3QWYA 2BZYA 1N9SA 2HL5C 3CC4A 1FXXA 2OX7A 3LWIA 4C0DB 5I2SA 1K8AC 1MHNA 2JMAA 3RMQA 1KHIA 5GAOl 4RTUA 2QEXQ 1EIFA 1YJ9Q 1G3WA 2KXCA 1KQSP 1T0JA 1QVGP 2ESWA 2R5AA 3CXCS 1TUDA 3MP1A 4LNPA 1VQKQ 4BI3A 1WX6A 2V8KA 2DBMA 1WJRA 1QWEA 2KRNA 3V7CA 5IXBA 2CS7A 4A54A 1YJ9T 1FMWA 4A4FA 4KUIA 2E41A 2JXBA 3E1SA 3G7ZA 5L23A 5KYNA 2EYXA 3MEUA 4P5NA 4KH1B 4ZGJB 4J83A 3VV0A 4DOVA 2KROA 1UHCA 2XG8D 4MZPA 3TREA 4II1A 3JB9J 1ZUYA 4XTYA 3UWNA 3ULRB 5IT9E 1QLYA 3CC2T 3QXEB 2XICA 1AWOA 2CSQA 3OYGA 3V7RA 1N9RA 4X9CA 2OJ2A 3I56A 1Q86R 1YITA 3RESA 1IXDA 3A8GB 4DEYA 4M78B 1S72Q 4M78F 1IRXA 1UE9A 4HCZA 3RUXA 5FRMA 3JCMd 1YIJA 1F1BB 2JS0A 3LH5A 3SWNA 4IKFA 3G71A 2MYSA 2K6DA 2CT4A 3CEYA 2MF2A 2HQHA 5A0GA 3QUIA 4KUDK 2CDTA 1RAHB 1X6GA 2BTTA 1BI3A 3UDCA 3OYCA 3A8MB 5KYUB 5LJ3j 2XDDA 1SF9A 3EFRA 3CPWA 3I9QA 2K2VA 4RG2A 2QQSA 1JBMA 4IUVA 1GBQA 3X25B 3OYNA 3ME9A 1KC8U 2EKHA 1UGSB 2X35A 1I8FA 2CP5A 3G4ST 4BDYA 4PJOC 2KBTA 4XTUA 1BKBA 5GANh 3JCMJ 4LDWA 2CP7A 2M1HA 1KQ1A 1RAGB 2PU9B 2KMTA 2P84A 3QDRB 2JTEA 3MEVA 4TVRA 4L6V5 4QVDA 1M27C 5FU7C 5KYYA 1M1KC 4M7DE 5FROA 4ANJA 1H3ZA 1VQ8A 2K9GA 2DAQA 3RBBB 1I07A 2GBQA 3MHXA 1IREB 1ZSZA 1VQPT 3CCUA 1OU8A 4NL3A 4J9EA 4PJOD 2QG9B 5DM7R 2HSEB 1UGVA 2K3XA 3CCST 4N0AC 5GANg 4N4HA 5A0DA 3PFSA 2D8HA 2JTFA 3A98A 2RI5A 4OMPA 2V8JA 1C1AA 5I22A 4PJOB 2QEXA 1PKTA 2A28A 1QWFA 5CIUA 4BB7A 1BI1A 3R6OA 1WZOA 4BACA 1UG1A 1OULA 2YDLA 2P4RA 2EKOA 2OTJT 1QVFP 3OS0A 1I5OB 3G4SQ 2RM4A 2DXTA 3HKSA 3CC7T 9ATCB 3CXCP 2MWOA 1QVGS 3NGPA 2MI6A 3CCVQ 1WXBA 2XD0A 1GFCA 3ZFJA 3A8LB 3JSCA 2VVKA 3E2UA 2MPXC 4WTOB 2M16A 1MMNA 3WXMB 4PL6A 1UB4A 1DJ7B 2FPEA 2CP0A 2VGNA 2RJDA 5C0MA 4AFQC 3I55Q 3FC3A 2CGHA 4OB3B 4MZTA 3RDVA 5CO7A 1WJQA 3I56Q 1SPKA 2QTVA 3THKA 1UECA 3JRZA 4IUPA 4NL2A 2VGMA 4JS5A 4OVAA 4BUGA 2J6KA 1Q86C 2XKOC 2FZKB 1LNXA 1X6BA 3OBWA 1WHMA 1YIJQ 3JCMc 2KYMA 2NUPA 4M7AE 4Y91A 3EGDB 4CC4B 2DMOA 1Q95G 2JS2A 5GAN8 1YN8A 2H3EB 3FJPA 2QQ9A 3OMGA 1MMDA 5L8RE 3OYBA 3VUBA 1D1BA 2K57A 4C92E 3EGXA 4LDUA 2M51A 4FYVB 1RAFB 3L2QA 3EG9A 4JLIA 3X26B 3EG0A 1QP3A 4QKUA 3VS2A 4C92G 2FPFA 2EAYA 3CBMA 1TG0A 1IGQA 2ENMA 2HCKA 4VUBA 4EMKC 1H3HA 5GAOp 4M7AB 3E19A 4UC4A 2IG0A 2QQRA 4JRIA 3CCQT 4JRKA 3OA6A 4O5VA 1WQWA 1ZA1B 1X69A 2O9SA 2RN8A 4JZ3A 3CCMT 5GAN2 1R0BG 4RTVA 2F2WA 3S3NA 1VQ9Q 4HCCA 1YP5A 4LD9K 1WHLA 1R8OB 2EJ9A 1OU9A 1G3TA 2LJ1A 4EMHA 2KRMA 2GQIA 2COWA 3M0PA 1VIFA 4ZGDB 5I11A 1ARKA 1H8KA 1ZQ1A 2P0QA 2RHZA 1V76A 3CMEQ 1VQ7A 3O8VA 2KEAA 2YXYA 2DTIA 3IQLA 3FEOA 1IO6A 2DZ9A 3EFOA 2COYA 5CQXA 2XDBA 4F7UB 3CMET 2PUKB 2RH2A 2AKKA 3VS0A 3HFOA 5IH2A 3JCMP 1UTIA 5FW9A 3P8BB 1UHFA 2LQKA 1JU5C 2QGFB 4XTXA 3V7SA 1SRLA 5KH6A 1KC8R 2EVRA 3C94A 1HK9A 2MWPA 1V1CA 1W70A 3HFNA 3HRTA 1MUZA 2E70A 1Z9QA 4N4IA 1RI0A 2KI7A 2KE9A 2V1RA 1PKSA 3RIRA 1PG5B 4J6WA 3CCET 4MDXA 2V8IA 2CSIA 2XMFA 1YHQA 1AZEA 4M77D 1RAEB 3LLRA 4ME7A 3M58A 3BW1A 2EYWA 5GAMd 3RKWA 3OY9A 5AT1B 2FYKA 2DX1A 5KE3A 2O31A 1N5ZA 1K76A 4FCYA 1VQNA 4RTTA 1Y07A 2PNIA 1M3BA 3DLLA 1U5SA 2IIMA 1WHHA 5LJ3h 3CD6Q 2KSSA 3C0CA 1NYGA 3M0UA 3PMTA 2F2XA 5AYFA 8ATCB 1JQQA 3PVQA 5KCOA 4A4KA 5GAMh 2C06A 1SRMA 2BE9B 4M77C 2O4XA 4ESRA 3OQ5A 1Q86U 4C92C 4ZN1A 4N0AA 4M75A 3M0TA 1BCMA 1KC8C 3JB9D 1Q81C 1Y96A 1GRIA 3CCEQ 3CC4Q 1M3AA 2EYZA 1WHKA 2QXFA 3LWHA 1KFZA 3GOXA 1JB0E 2GFAA 2DD4A 4X1VA 3FJ5A 1LJOA 3AT1B 4M7DA 4E7ZA 4AFZC 3LH0A 1FMVA 1K8AU 1GCQA 5CVIA 5GMKl 3PE0A 4ZN3A 4CC3A 1LPLA 1PRLC 2D1XA 5HKCA 1VQKA 3TSZA 2CP6A 2DL4A 3MEWA 2D0QB 4XTZA 3CCMA 4J8OA 1KD1R 2RF0A 3ZL7C 1QVFA 4DBHA 4FT4A 4M75D 4FYYB 2DVJA 1KQ2A 4PFOA 2GCXA 1EFNA 1X75C 5EG2A 2CKKA 1YCSB 2DPPB 3I56T 4M78C 2KAFA 4PJJA 2NUTA 4KGXB 2X9HA 5LJ3f 1K0XA 3M56A 1X27A 2NUZA 3EHQA 2E6NA 2DIGA 2CP3A 4J6XA 1VA7A 3DB4A 1Y57A 1ZSZB 1VQ4T 3X24B 3PTAA 2JT4A 4OGCA 1K9MC 3UA7A 1VQPQ 2COZA 2K5FA 5J39A 2XIDA 5ECAA 3JB9F 2WSEE 4M78G 1K73U 1VQ9A 2M9UA 4XU1A 2AK5A 2YRDA 1QMCA 4HA8A 2RQVA 3L42A 1ZX6A 1WGSA 2DZCA 1X6OA 2C0TA 1QVGA 2WACA 3RKYA 1ZLMA 2GGRA 2L3RA 3T9NA 3ZBDA 5FLXE 1KD1U 1Q7YU 2LQNA 2DERA 2R5MA 2LT4A 3G71Q 1WDXA 4HKEA 1FWZA 1BU1A 3JB9I 2DRMA 1W2BP 1K8AR 2DBKA 3M0RA 2DNUA 5IHKA 1VQLT 4QVZA 3CC4T 3NTIA 3UPUA 3H41A 3NMZC 1Z9ZA 1ZSZC 3OYAA 2OTLA 1G5VA 5GAMj 1O75A 4OMLA 1K4US 2YLBA 4J9HA 4C0DC 4M7DG 4DQ2A 2WSFE 1U06A 1W4SA 1AOJA 4MMKA 1VQ4Q 3CXCA 5GANj 1YIJT 1FYNA 1M8MA 5GAN3 2ZPIB 5FU6B 2E65A 2KXDA 4C5GA 1ZHIA 4BY6C 1JRIA 3VKIA 2ED1A 4PLLA 3OYJA 2NUPB 1Q82U 2ZZDA 2VV5A 3EGDA 1JJ2S 3QWXX 3QZ9B 4OGEA 1ACMB 1OI1A 5DLOA 3OYDA 5GAN4 4PFZA 1PWTA 4OMFB 2DVEA 2BZXA 4M7DD 3S6WA 1YJNA 3RKXA 4E7IA 1N27A 1NM7A 2C0OA 2QASA 1U1SA 1PD0A 1VQ8T 4LDXA 3X28B 4MZMA 3CCEA 4LUDA 1XOVA 1YNZA 3G1JA 2IVWA 2D9TA 4KT0E 3E9FA 2ATCB 5GMKe 4OP0A 3CCSA 2CYZB 5LJ5e 4M7DF 3JV3A 4PJOG 4HT9A 2DTOA 2PVGB 2P0PA 3KUFA 2HNIA 3OBYA 3A8OB 4JJNK 4DBQA 1QCFA 1R77A 3UF4A 1PSEA 3JCMe 1JEGA 2FRWA 2J05A 2W10A 5IXFA 1BB9A 3FRNA 4HVVA 2EPDA 2B86A 3QDFA 1NJIC 1MV3A 2FB7A 2YRVA 3L2UA 4ZGEB 4B6MA 1VQ5A 4LE9A 2CZ0B 1HD3A 2NWMA 3OW2P 3L2VA 1AT1B 2RQRA 2L0AA 2Y90A 1YI2A 3CCVA 3G6EQ 3SWNC 1FMKA 4WF2A 2KR3A 3F70A 4F7UA 3CBOA 1WNLA 1X2QA 4JJDA 3URGA 3C12A 1JJ2P 2RMOA 1KJWA 3SFMA 2QEXT 1AWJA 1TXQA 3DKMA 3A5ZB 4Z8AA 3CMAA 3ASKA 1CKAA 2CZ6B 1OZ3A 2ZGWA 2DK3A 3E9GA 1K0SA 1ABOA 2JW4A 4M75E 1PC0A 1NZ9A 4JDSA 2JOYA 3RNJA 2LNHB 3VYGA 3V8JA 5GAN7 1VQ7T 1B3QA 4EMKA 1AHJB 3KXTA 1CSKA 4OB1B 2HMAA 1QCNA 2Y4XA 4HVUA 1SHFA 1WPYA 4JLGA 4J5YA 5IHIA 4A4EA 2EGEA 4M77F 2ABLA 3QHSA 3MCAB 4N4GA 3MEAA 1IGUA 1IB8A 2DL7A 3SWNB 2CZ7B 2K4YA 2JJ9A 4M7AG 1M9SA 4NS5A 3CCRA 1ZA2B 4C0GA 4JPBW 2GNCA 2Z0WA 3JCMV 2PZ1A 2O4XB 3BDUA 4JUVA 2PVDB 5FWBA 1D0YA 2AIRB 1UUEA 1TOVA 1PM3A 1Y96B 4RTWA 3GBQA 3LGFA 4RKUE 3TVTA 1V29B 2PUOB 5KYXA 1VQ6A 1O9SA 2K3YA 1B34B 4E7KA 2DA9A 1VQMQ 1NEBA 3HPWA 1K9AA 2VUBA 5FRNA 4J7FA 4M7DB 1VQMT 2X3WD 1TS9A 4YTLA 3OYEA 1D09B 1D0ZA 1RACB 2LZ6B 1VIEA 2JM9A 1NPRA 4R0KA 4BI8B 1E6HA 3UATA 2ECZA 1WXTA 1KSWA 1X2KA 4FW1A 2EIFA 2RI2A 2GQVA 2JTMA 3MO8A 3KFVA 1WIEA 3SHWA 1HXDA 2DEQA 2X4XA 1WXUA 2A37A 2P0KA 4K11A 1YJNQ 2LJ0A 1AWWA 3M57A 4XQ3A 2RD1A 1I81A 2KT8A 1B07A 1SG5A 3PT9A 2AHJB 2EQMA 3CCSQ 4DEXA 3JB9G 2LC4A 1T3SA 2NUTB 2VKNA 2VASA 4C0FA 4QQDA 3CPWP 1D1AA 3H0FA 1RUWA 4D8DA 1OZ2A 1I0CA 4DBRA 1AD5A 2O9VA 1YHQQ 1TH7A 1OPLA 2MOXA 5CCAA 5GAMg 3NPFA 1K9MR 2F5TX 1M30A 4J9GA 4JRPA 4LD6A 3CCLQ 3OS1A 1Y71A 5CKFA 3P8DA 4EMGA 3ZEHA 3TSWA 3TQ7P 1XTDA 5GAOr 2E5QA 2RI3A 1RL2A 2MCNA 1UGPB 5GAN6 2YUQA 3CD6A 2AZSA 4BY6B 1D3BB 8AT1B 3VS7A 2B8AA 2KT1A 2EFIA 1SSFA 4D8KA 4F16A 2XI9A 2FO0A 3HSBA 2YWWA 2JUFA 3EHRA 3CMAQ 1ZUUA 2CH4A 3QG1A 1GXIE 1KQSS 3G6EA 3VRZA 4OMOA 1YJWQ 3PVLA 5GMKj 3GIBA 4EIKA 1YHQT 4PJOE 1VQ6T 2FRYA 2FPDA 3WVDB 3L2RA 1RAAB 2EW3A 2QI2A 3AHUA 3LW5E 2KDSA 4BE0A 5CKBA 2MAMA 1YFNA 2BZ8A 1QKWA 4JJBA 2XK0A 1C0MA 4V2SA 1ABQA 2RQTA 3OS2A 1UDLA 2HDAA 3M0SA 3RERA 1JO8A 4Q5WA 1YITQ 5DLQE 2OTJA 4F7UE 4A53A 4IIOA 2J6FA 3HHTB 2VXFA 2OAWA 2HEQA 2RQWA 2XHCA 4C5IA 3KBGA 2M0OA 2QTXA 3FDRA 2QAZA 1WFWA 2L2PA 3EFSA 1PD1A 4JS4A 3M5AA 1X43A 4KULA 1M2VA 1N6AA 1RAIB 2PVOB 3SD4A 4RTZA 4FU6A 1NG2A 2RNAA 3QJ6A 3H8ZA 4J9BA 3OYYA 1RABB 3VU3C 2QGGA 3CCJQ 4PK4A 1OX9A 5HK3A 4PNOA 4RTXA 4J9CA 2C0IA 1M1KU 1D0XA 3CCRT 4PJNA 2A08A 2O01E 3OMCA 2EJGA 3JCMf 4ELZC 3OB9A 2X4JA 3A1PA 2ZPFB 2DO3A 2X51A 2QA4Q 3M55A 3JCMX 5IN1A 1AWXA 2Y4YA 3GF5A 1BIBA 2QYZA 1VQMA 4E7HA 3DB3A 4C5HA 2DJQA 3FIFA 1VQLA 1K73C 2G3RA 2HAXA 4J7IA 3L2ZA 3I5SA 4KH0B 1XJWB 1G8XA 1YCYA 1NYFA 2M0YA 2AT1B 1JXOA 4F7UF 2ZPBB 3O5ZA 4FL6A 4C8QA 2LQ8A 3JAME 5GAOm 3M59A 2EQIA 4QQGA 2DIQA 2GTJA 2PQWA 3CCUQ 1I5LA 1PRMC 2LCLA 4O6JA 2OI3A 1VQ8Q 3CCVT 2F69A 4OMNA 6AT1B 3H0IA 2HSPA 2JM8A 3MJXA 1M90U 2FVUA 1OX8A 5GJWB 3OYFA 2YT6A 3BE3A 4A63B 4ORZA 5D7UA 4AFSC 1TWBA 3JCMb 5C6SA 1CKBA 4AFUC 1UGRB 3OSVA 1E6GA 2EYQA 3GNGA 1AEYA 1VQOT 1G3YA 3G6ET 3OYKA 1NJIU 4HCKA 3CCLA 2XU8A 3DLMA 3G4SA 4JJCA 1PSFA 2LX7A 1YITT 5GAOq 5GMKi 1G2BA 4L5GA 2K5LA 4M77B 2K2MA 4C0ZA 1ZBXA 3J7AF 3VJPA 4ELYC 1M8VA 2HKQB 1J3TA 1YJWA 2ZCFB 2RHUA 3QYHB 2K5IA 1Q82C 5A0LA 1VQKT 4FSSA 1M90C 3I5RA 4LXCA 3JCMQ 5LJ5g 1IHVA 1GFDA 2G6FX 1KHCA 3I55A 2YHTA 3NTKA 2H3JA 4M75B
chains in the Genus database with same CATH topology
2W10A 4KRTA 5IXFA 1BB9A 1PHTA 1K1ZA 1HJDA 4WCIA 4HVVA 2EPDA 2B86A 4AG1C 4AFQC 1MV3A 4LE9A 3REAB 2NWMA 1HD3A 1SPKA 3THKA 2RQRA 1UECA 2L0AA 1FMKA 2L3QA 2KR3A 4AG2C 2DL8A 2J6KA 1X2QA 4JJDA 3REBB 1X6BA 1OV3A 2KYMA 2RMOA 1KJWA 1AWJA 4Z8AA 4CC4B 2DILA 1CKAA 2DMOA 4OMMA 2JS2A 2E5KA 3NHNA 1YN8A 1K0SA 1ABOA 2JW4A 2CUBA 2YUNA 1GL5A 1RI9A 5EC7A 4F14A 3RNJA 2M51A 3I35A 2X3XD 1G83A 2LNHB 4GBQA 3EG0A 1B3QA 2LJ3A 1E7OA 2DM1A 3VS2A 3EG1A 2FPFA 1CSKA 2EGAA 4HVUA 1GCQC 1SHFA 2HCKA 1TG0A 1ZBJA 1OOTA 2ENMA 3VS3A 5GJVB 1U3OA 1H3HA 2H8HA 5IHIA 1PNJA 2EGEA 2A36A 2ABLA 3EG3A 1X69A 2O9SA 2RN8A 4JZ3A 4HXJA 2FEIA 2PTKA 2VWFA 1KIKA 4RTVA 2DL7A 2F2WA 1YP5A 2KYBA 2W0ZA 1VYUA 2LJ1A 1OPKA 2KRMA 2GQIA 3M0PA 4JPBW 2GNCA 1HSQA 5I11A 1ARKA 2PZ1A 1H8KA 2CUDA 4J9DA 1BBZA 2HBWA 1YWPA 2O88A 2DL3A 5FWBA 4J9FA 2KEAA 4JZ4A 1T3LA 1UUEA 2J06A 4RTWA 2KNBB 1NEGA 3IQLA 1IO6A 3GBQA 3TVTA 3H0HA 4CC2A 2KRSA 2GTOA 2YSQA 2DA9A 2AKKA 1NEBA 3VS0A 3EG2A 5IH2A 1K9AA 2EBPA 1UTIA 5FW9A 1UHFA 4LN2A 1RLPC 1JU5C 2L3PA 4QT7A 2X3WD 1SRLA 2EVRA 1M3CA 1H92A 1V1CA 1W70A 1SSHA 2DF6A 1MUZA 2J7IA 1Z9QA 2LZ6B 5FWCA 2JM9A 4R0KA 4ZNXA 1E6HA 3UATA 1A0NB 2ECZA 1WXTA 2KE9A 1PKSA 1KSWA 1X2KA 2V1RA 4IIMA 3VRYA 5IHNA 4J9IA 2XMFA 2CSIA 1AZEA 5HCKA 3KFVA 1WIEA 4RUGA 3SHWA 1WXUA 2A37A 2EYWA 4K11A 2LCSA 2LJ0A 3VS1A 1AWWA 1MV0B 3UA6A 2ROTA 4E6RA 2KT8A 2MIOA 1B07A 2DX1A 3U23A 1NLOC 1N5ZA 2O31A 1K76A 1Y0MA 2FG0A 4DEXA 4RTTA 1W1FA 1T3SA 2VKNA 4RTYA 2DLPA 2PNIA 1VYTA 1M3BA 3H0FA 1U5SA 1RUWA 1AVZC 2CT3A 1RLQC 2IIMA 4D8DA 2YUOA 3QWYA 1I0CA 2BZYA 1NYGA 3C0CA 1AD5A 3M0UA 2F2XA 2O9VA 1JXMA 1OPLA 2MOXA 3NPFA 2LP5A 2CREA 1M30A 2JMAA 4J9GA 1JQQA 3PVQA 4RTUA 1SRMA 2KXCA 3SEMA 4ESRA 4F17A 1T0JA 3TSWA 2V1QA 2ESWA 3M0TA 2MCNA 1TUDA 2YUQA 4LNPA 2AZSA 1GRIA 1WX6A 2DBMA 3VS7A 2EYYA 4Z89A 1QWEA 2KT1A 1M3AA 2EYZA 4D8KA 2F2VA 4F16A 1KFZA 2FO0A 2KRNA 3EGUA 3EHRA 5IXBA 2K7AA 4X1VA 1UJ0A 3FJ5A 1ZUUA 2CH4A 4AFZC 3VRZA 4OMOA 1S1NA 2JXBA 2RPNA 3PVLA 1GCQA 5L23A 4EIKA 3PE0A 4CC3A 1VYVA 2EYXA 2FRYA 2FPDA 1PRLC 2D1XA 2EW3A 3TSZA 2DYBA 2DL4A 2KROA 1UHCA 2BZ8A 1ZUYA 1QKWA 2J6OA 1WA7A 2RF0A 4JJBA 4OMQA 3ULRB 3ZL7C 1ABQA 2RQTA 1UDLA 4CC7A 2HDAA 1QLYA 3M0SA 2DVJA 1JO8A 1I1JA 2D8JA 1AWOA 2CSQA 4GLMA 1EFNA 1WYXA 4IIOA 2J6FA 1YCSB 2OJ2A 2OAWA 2HEQA 2RQWA 3VS6A 2I0NA 4Z88A 1K0XA 4DEYA 1WFWA 1SHGA 1WI7A 1X27A 2L2PA 2NUZA 3EHQA 1UE9A 1QKXA 1VA7A 1X43A 1Y57A 2JT4A 1GCPA 3UA7A 4RTZA 1OEBA 1NG2A 1UJYA 2RNAA 2JS0A 3LH5A 4J9BA 1TUCA 1LCKA 5ECAA 2K6DA 1W6XA 2CT4A 2AK5A 2RQVA 1ZX6A 4RTXA 4J9CA 2C0TA 2C0IA 2CDTA 2BTTA 1X6GA 1ZLMA 2GGRA 2A08A 4M4ZA 2QDLA 2LQNA 3I9QA 2SRCA 3R6NA 1WDXA 2CH4W 4HVWA 1BU1A 2DRMA 1GBQA 1AWXA 2ED0A 2EKHA 2DBKA 3M0RA 3M0QA 2DJQA 2DNUA 5IHKA 2LQWA 2SEMA 3H41A 1SEMA 2KBTA 3NMZC 1Z9ZA 2AZVA 4OMLA 3I5SA 1K4US 4J9HA 2KGTA 1BK2A 1NYFA 2RQUA 1U06A 2M0YA 1JXOA 1ZUKA 2JTEA 2ROLA 1AOJA 1UFFA 2K79A 1GBRA 1M27C 2D0NA 1FYNA 3O5ZA 2K3BA 1M8MA 1WLPB 2EQIA 3CQTA 2K9GA 2GTJA 2KXDA 1PRMC 3RBBB 2ED1A 1I07A 2DL5A 2GBQA 2OI3A 2JMCA 3QWXX 4OMNA 3H0IA 2HSPA 2JM8A 1YWOA 4LUEA 4J9EA 2LMJA 2EGCA 1PWTA 5GJWB 2BZXA 2YUPA 1UGVA 2YT6A 4A63B 4ORZA 2O2OA 4AFSC 1CKBA 4AFUC 1NM7A 2C0OA 1E6GA 2D8HA 1AEYA 3A98A 4OMPA 5I22A 4HCKA 1PKTA 2A28A 4JJCA 1QWFA 1AZGB 4LUDA 2LX7A 1XOVA 1UG1A 1YNZA 1G2BA 2YDLA 1T0HA 2P4RA 4Y92A 1ZSGA 2L3SA 2K2MA 1NLPC 2DRKA 2AKLA 3JV3A 1J3TA 3NGPA 2J05A 3VS4A 2DE0X 3VS5A 4FSSA 1WXBA 3I5RA 1GFCA 1QCFA 1GFDA 2VVKA 3UF4A 2G6FX 1JEGA 2FRWA 2FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W10 A;  4KRT A;  5IXF A;  1BB9 A;  1PHT A;  1K1Z A;  1HJD A;  4WCI A;  4HVV A;  2EPD A;  2B86 A;  4AG1 C;  4AFQ C;  1MV3 A;  4LE9 A;  3REA B;  2NWM A;  1HD3 A;  1SPK A;  3THK A;  2RQR A;  1UEC A;  2L0A A;  1FMK A;  2L3Q A;  2KR3 A;  4AG2 C;  2DL8 A;  2J6K A;  1X2Q A;  4JJD A;  3REB B;  1X6B A;  1OV3 A;  2KYM A;  2RMO A;  1KJW A;  1AWJ A;  4Z8A A;  4CC4 B;  2DIL A;  1CKA A;  2DMO A;  4OMM A;  2JS2 A;  2E5K A;  3NHN A;  1YN8 A;  1K0S A;  1ABO A;  2JW4 A;  2CUB A;  2YUN A;  1GL5 A;  1RI9 A;  5EC7 A;  4F14 A;  3RNJ A;  2M51 A;  3I35 A;  2X3X D;  1G83 A;  2LNH B;  4GBQ A;  3EG0 A;  1B3Q A;  2LJ3 A;  1E7O A;  2DM1 A;  3VS2 A;  3EG1 A;  2FPF A;  1CSK A;  2EGA A;  4HVU A;  1GCQ C;  1SHF A;  2HCK A;  1TG0 A;  1ZBJ A;  1OOT A;  2ENM A;  3VS3 A;  5GJV B;  1U3O A;  1H3H A;  2H8H A;  5IHI A;  1PNJ A;  2EGE A;  2A36 A;  2ABL A;  3EG3 A;  1X69 A;  2O9S A;  2RN8 A;  4JZ3 A;  4HXJ A;  2FEI A;  2PTK A;  2VWF A;  1KIK A;  4RTV A;  2DL7 A;  2F2W A;  1YP5 A;  2KYB A;  2W0Z A;  1VYU A;  2LJ1 A;  1OPK A;  2KRM A;  2GQI A;  3M0P A;  4JPB W;  2GNC A;  1HSQ A;  5I11 A;  1ARK A;  2PZ1 A;  1H8K A;  2CUD A;  4J9D A;  1BBZ A;  2HBW A;  1YWP A;  2O88 A;  2DL3 A;  5FWB A;  4J9F A;  2KEA A;  4JZ4 A;  1T3L A;  1UUE A;  2J06 A;  4RTW A;  2KNB B;  1NEG A;  3IQL A;  1IO6 A;  3GBQ A;  3TVT A;  3H0H A;  4CC2 A;  2KRS A;  2GTO A;  2YSQ A;  2DA9 A;  2AKK A;  1NEB A;  3VS0 A;  3EG2 A;  5IH2 A;  1K9A A;  2EBP A;  1UTI A;  5FW9 A;  1UHF A;  4LN2 A;  1RLP C;  1JU5 C;  2L3P A;  4QT7 A;  2X3W D;  1SRL A;  2EVR A;  1M3C A;  1H92 A;  1V1C A;  1W70 A;  1SSH A;  2DF6 A;  1MUZ A;  2J7I A;  1Z9Q A;  2LZ6 B;  5FWC A;  2JM9 A;  4R0K A;  4ZNX A;  1E6H A;  3UAT A;  1A0N B;  2ECZ A;  1WXT A;  2KE9 A;  1PKS A;  1KSW A;  1X2K A;  2V1R A;  4IIM A;  3VRY A;  5IHN A;  4J9I A;  2XMF A;  2CSI A;  1AZE A;  5HCK A;  3KFV A;  1WIE A;  4RUG A;  3SHW A;  1WXU A;  2A37 A;  2EYW A;  4K11 A;  2LCS A;  2LJ0 A;  3VS1 A;  1AWW A;  1MV0 B;  3UA6 A;  2ROT A;  4E6R A;  2KT8 A;  2MIO A;  1B07 A;  2DX1 A;  3U23 A;  1NLO C;  1N5Z A;  2O31 A;  1K76 A;  1Y0M A;  2FG0 A;  4DEX A;  4RTT A;  1W1F A;  1T3S A;  2VKN A;  4RTY A;  2DLP A;  2PNI A;  1VYT A;  1M3B A;  3H0F A;  1U5S A;  1RUW A;  1AVZ C;  2CT3 A;  1RLQ C;  2IIM A;  4D8D A;  2YUO A;  3QWY A;  1I0C A;  2BZY A;  1NYG A;  3C0C A;  1AD5 A;  3M0U A;  2F2X A;  2O9V A;  1JXM A;  1OPL A;  2MOX A;  3NPF A;  2LP5 A;  2CRE A;  1M30 A;  2JMA A;  4J9G A;  1JQQ A;  3PVQ A;  4RTU A;  1SRM A;  2KXC A;  3SEM A;  4ESR A;  4F17 A;  1T0J A;  3TSW A;  2V1Q A;  2ESW A;  3M0T A;  2MCN A;  1TUD A;  2YUQ A;  4LNP A;  2AZS A;  1GRI A;  1WX6 A;  2DBM A;  3VS7 A;  2EYY A;  4Z89 A;  1QWE A;  2KT1 A;  1M3A A;  2EYZ A;  4D8K A;  2F2V A;  4F16 A;  1KFZ A;  2FO0 A;  2KRN A;  3EGU A;  3EHR A;  5IXB A;  2K7A A;  4X1V A;  1UJ0 A;  3FJ5 A;  1ZUU A;  2CH4 A;  4AFZ C;  3VRZ A;  4OMO A;  1S1N A;  2JXB A;  2RPN A;  3PVL A;  1GCQ A;  5L23 A;  4EIK A;  3PE0 A;  4CC3 A;  1VYV A;  2EYX A;  2FRY A;  2FPD A;  1PRL C;  2D1X A;  2EW3 A;  3TSZ A;  2DYB A;  2DL4 A;  2KRO A;  1UHC A;  2BZ8 A;  1ZUY A;  1QKW A;  2J6O A;  1WA7 A;  2RF0 A;  4JJB A;  4OMQ A;  3ULR B;  3ZL7 C;  1ABQ A;  2RQT A;  1UDL A;  4CC7 A;  2HDA A;  1QLY A;  3M0S A;  2DVJ A;  1JO8 A;  1I1J A;  2D8J A;  1AWO A;  2CSQ A;  4GLM A;  1EFN A;  1WYX A;  4IIO A;  2J6F A;  1YCS B;  2OJ2 A;  2OAW A;  2HEQ A;  2RQW A;  3VS6 A;  2I0N A;  4Z88 A;  1K0X A;  4DEY A;  1WFW A;  1SHG A;  1WI7 A;  1X27 A;  2L2P A;  2NUZ A;  3EHQ A;  1UE9 A;  1QKX A;  1VA7 A;  1X43 A;  1Y57 A;  2JT4 A;  1GCP A;  3UA7 A;  4RTZ A;  1OEB A;  1NG2 A;  1UJY A;  2RNA A;  2JS0 A;  3LH5 A;  4J9B A;  1TUC A;  1LCK A;  5ECA A;  2K6D A;  1W6X A;  2CT4 A;  2AK5 A;  2RQV A;  1ZX6 A;  4RTX A;  4J9C A;  2C0T A;  2C0I A;  2CDT A;  2BTT A;  1X6G A;  1ZLM A;  2GGR A;  2A08 A;  4M4Z A;  2QDL A;  2LQN A;  3I9Q A;  2SRC A;  3R6N A;  1WDX A;  2CH4 W;  4HVW A;  1BU1 A;  2DRM A;  1GBQ A;  1AWX A;  2ED0 A;  2EKH A;  2DBK A;  3M0R A;  3M0Q A;  2DJQ A;  2DNU A;  5IHK A;  2LQW A;  2SEM A;  3H41 A;  1SEM A;  2KBT A;  3NMZ C;  1Z9Z A;  2AZV A;  4OML A;  3I5S A;  1K4U S;  4J9H A;  2KGT A;  1BK2 A;  1NYF A;  2RQU A;  1U06 A;  2M0Y A;  1JXO A;  1ZUK A;  2JTE A;  2ROL A;  1AOJ A;  1UFF A;  2K79 A;  1GBR A;  1M27 C;  2D0N A;  1FYN A;  3O5Z A;  2K3B A;  1M8M A;  1WLP B;  2EQI A;  3CQT A;  2K9G A;  2GTJ A;  2KXD A;  1PRM C;  3RBB B;  2ED1 A;  1I07 A;  2DL5 A;  2GBQ A;  2OI3 A;  2JMC A;  3QWX X;  4OMN A;  3H0I A;  2HSP A;  2JM8 A;  1YWO A;  4LUE A;  4J9E A;  2LMJ A;  2EGC A;  1PWT A;  5GJW B;  2BZX A;  2YUP A;  1UGV A;  2YT6 A;  4A63 B;  4ORZ A;  2O2O A;  4AFS C;  1CKB A;  4AFU C;  1NM7 A;  2C0O A;  1E6G A;  2D8H A;  1AEY A;  3A98 A;  4OMP A;  5I22 A;  4HCK A;  1PKT A;  2A28 A;  4JJC A;  1QWF A;  1AZG B;  4LUD A;  2LX7 A;  1XOV A;  1UG1 A;  1YNZ A;  1G2B A;  2YDL A;  1T0H A;  2P4R A;  4Y92 A;  1ZSG A;  2L3S A;  2K2M A;  1NLP C;  2DRK A;  2AKL A;  3JV3 A;  1J3T A;  3NGP A;  2J05 A;  3VS4 A;  2DE0 X;  3VS5 A;  4FSS A;  1WXB A;  3I5R A;  1GFC A;  1QCF A;  1GFD A;  2VVK A;  3UF4 A;  2G6F X;  1JEG A;  2FRW A;  2FPE A; 
#chains in the Genus database with same CATH topology
 4M75 F;  1PHT A;  3CMA T;  1BCO A;  1K1Z A;  4WCI A;  4M7A C;  3A8H B;  4M77 E;  4AG1 C;  2EQJ A;  4Y28 E;  2JVV A;  3PMI A;  2OTJ Q;  3QSU A;  3BDL A;  1VQ5 T;  4EDU A;  5GMK h;  3CPW S;  3MP6 A;  2EWN A;  5KYX B;  1VQN T;  2L3Q A;  3VYH B;  4AG2 C;  4E2F B;  2DL8 A;  3REB B;  1XNI A;  2QK0 A;  3V8L A;  2QDY B;  5DY9 A;  1OV3 A;  1NPP A;  2QQA A;  4JRQ A;  2E64 A;  5I2M A;  1MMA A;  4F7U G;  1IHW A;  2VXE A;  4OMM A;  5KYW A;  1MMG A;  4X34 A;  1SKU B;  3NHN A;  3QZ5 B;  1KD1 C;  1P92 A;  3QJY A;  4DOW A;  3JB9 H;  4RCC A;  2LCC A;  1QCO A;  1LVK A;  2R57 A;  2YUN A;  2X4Y A;  3PNW C;  5EC7 A;  4F14 A;  1YI2 Q;  4M7A D;  3I35 A;  2X3X D;  1G83 A;  1OYX A;  4GBQ A;  1NBE B;  3EAE A;  4XU2 A;  2CZ1 B;  4RMO A;  1E7O A;  2DM1 A;  3EG1 A;  3J81 E;  2EGA A;  3M53 A;  1ZBJ A;  3VS3 A;  1NJI R;  5GJV B;  1U3O A;  1MND A;  1YI2 T;  3UT1 A;  1PNJ A;  3EG3 A;  2OAU A;  3OYL A;  4HXJ A;  1VQO A;  1RAD B;  2RB6 A;  4PJO F;  3TU4 K;  4CI0 C;  2VWF A;  1M90 R;  1KIK A;  5KYU A;  1IZ6 A;  4FM4 B;  3GP8 A;  4E47 A;  4OB2 B;  2BKD N;  3HRS A;  3GNF B;  4M78 D;  3TEE A;  5GAN d;  4HT8 A;  1XQH A;  1HSQ A;  4GY5 A;  4J9D A;  1BBZ A;  2HBW A;  2V26 A;  3BY7 A;  4PJM A;  2GF7 A;  3CC2 Q;  1VQL Q;  4JZ4 A;  3PIP A;  4C92 F;  1WHG A;  4XK8 E;  1N8R U;  2KNB B;  1NEG A;  1VQ7 Q;  1WJS A;  1D3B A;  4LDY A;  2A0F B;  2RHY A;  2E4H A;  2GTO A;  2YSQ A;  2OTL T;  3QII A;  5LJ5 j;  4M7D C;  4GLK A;  3S3M A;  4PKC C;  1QW1 A;  5KYY B;  5GMK m;  1RLP C;  2L3P A;  3MET A;  2ZPH B;  1UGQ B;  1H92 A;  5CKH A;  1SSH A;  2DF6 A;  2WSC E;  4C92 A;  2J7I A;  5FU6 C;  2HKN A;  1MGQ A;  4XAX B;  2L8D A;  3H9N A;  3VRY A;  2DYI A;  5HCK A;  4RUG A;  2HQE A;  3PGG A;  1LOJ A;  1M1K R;  3C95 A;  3JCM h;  2ROT A;  2MIO A;  1Y7X A;  1HYO A;  1TU0 B;  3U23 A;  4Z02 A;  3OW2 S;  4PJO A;  1W1F A;  4LDV A;  2LX9 A;  2XDP A;  4RTY A;  1VQ9 T;  5D6W A;  5LJ3 e;  3D7S B;  2QQB A;  2FZC B;  4XU3 A;  1AVZ C;  3JCM W;  2LT1 A;  3H6Z A;  1VQN Q;  5GAN e;  1JXM A;  3SDZ A;  2RHX A;  2LP5 A;  2CRE A;  3PIO A;  3BFM A;  1JJ2 A;  4M77 G;  3HTR A;  2CP2 A;  3SEM A;  4ATO A;  5GAM e;  4F17 A;  2V1Q A;  3N5B B;  2LTO A;  4OB0 B;  3INZ A;  4OF1 A;  2JN0 A;  4EPC A;  3LYI A;  3MPU B;  2EYY A;  4Z89 A;  3FLG A;  5D6Y A;  2F2V A;  4MML A;  3EGU A;  5HK0 A;  2K7A A;  1UJ0 A;  4QQ6 A;  3RR6 A;  3OSS C;  3QKJ A;  1OQK A;  7AT1 B;  4RCB A;  2DEU A;  3RMS A;  1S1N A;  2EJF A;  2LNV A;  2RPN A;  5CR2 A;  1VYV A;  2P4T A;  1BIA A;  4PJL A;  2D6F A;  3QO3 A;  1S72 A;  2DYB A;  1PCX A;  2J6O A;  1WA7 A;  4OMQ A;  3OW2 A;  2LDM A;  4CC7 A;  3NTH A;  2FL7 A;  3CCM Q;  1WHJ A;  1I1J A;  2D8J A;  5D6X A;  4GLM A;  1WYX A;  1Q81 U;  3VS6 A;  1VQO Q;  2A7Y A;  3HP9 A;  1YJW T;  2I0N A;  2ZPG B;  4Z88 A;  2KVQ G;  3TCJ A;  1FX7 A;  3VUZ A;  4M7A A;  1SHG A;  1WI7 A;  2HBP A;  2LRQ A;  1N8R C;  1EZZ B;  1QKX A;  1QVP A;  4QW2 A;  1K9M U;  3M9Q A;  2DXB A;  1QP2 A;  1GCP A;  1OEB A;  1UJY A;  1M4Z A;  1TUC A;  1LCK A;  4EMK B;  4PFP A;  1H64 1;  4BE1 A;  1W6X A;  1VUB A;  4FT2 A;  1VQP A;  1Q81 R;  3P8H A;  2DKG A;  4KBM B;  5CQY A;  4A4H A;  1S72 T;  2ZAE A;  4AMC A;  4M77 A;  4M4Z A;  2QDL A;  4R56 A;  4IUT A;  2VC8 A;  1NE8 A;  3WVE B;  1M5Q 1;  2HQX A;  4M78 E;  5GAM f;  4BE2 A;  2SRC A;  3EFO B;  3OYM A;  1QVF S;  3R6N A;  4DA4 A;  1UEB A;  2CH4 W;  3MKD A;  4KGZ B;  4HVW A;  4C8Q F;  2RJE A;  1M1F A;  4MDW A;  3CCJ A;  3HRU A;  2ED0 A;  1B7T A;  5GAN f;  3M0Q A;  5LJ5 d;  4BDZ A;  1VOM A;  2LQW A;  2SEM A;  1SEM A;  3G71 T;  3S3O A;  2DTH A;  2AZV A;  4C8Q E;  1VQ4 A;  1W2B A;  2KGT A;  1BK2 A;  2DET A;  4QVC A;  2OTL Q;  2RQU A;  4B9W A;  2DD5 A;  1B34 A;  1ZUK A;  1X01 A;  2MK5 A;  2ROL A;  2K79 A;  1UFF A;  2QA4 A;  1GBR A;  2D0N A;  2KK4 A;  2K3B A;  2VYT A;  5CAI A;  1U8R A;  2DXU A;  1WLP B;  3Q1J A;  4AT1 B;  3CQT A;  2BE7 D;  3CBP A;  2L5Q A;  2A3L A;  4C8Q C;  4M78 A;  5GAO n;  4M7A F;  3CCQ Q;  2DL5 A;  4C8Q G;  2BIV A;  2RA2 A;  2JMC A;  5KYW B;  2JNG A;  1YWO A;  4LUE A;  1W2B S;  4ZTJ A;  2LMJ A;  2EGC A;  2YUP A;  4J6Y A;  2L89 A;  2O2O A;  2RHI A;  3OS5 A;  2RK2 A;  2MMP A;  4FSX A;  3MP8 A;  3EH1 A;  2EQU A;  2VB6 A;  3LGL A;  2M02 A;  1AZG B;  1T0H A;  4Y92 A;  3JCM g;  1ZSG A;  2L3S A;  4C8Q D;  4FW2 A;  1NLP C;  3OYH A;  4IUU A;  2DRK A;  1BI0 A;  3CC7 A;  4FYX B;  2X4W A;  2AKL A;  5J26 A;  4FIB A;  2E1H A;  1EX4 A;  2YLC A;  3FB9 A;  5LJ5 h;  3L2W A;  4E7L A;  2LVM A;  2HL3 A;  3VS4 A;  2DE0 X;  3VS5 A;  3CD6 T;  4M75 C;  4F04 B;  2BUD A;  4ZTF A;  4XTW A;  2DXC A;  3I55 T;  2RJC A;  4L59 A;  3GPL A;  3J80 E;  1M2O A;  4KRT A;  1HJD A;  2DFU A;  1R0C B;  1YJ9 A;  5CKD A;  5I21 A;  2DJZ A;  3REA B;  1N8R R;  4HCB A;  4BI4 A;  4M75 G;  4CRI A;  3CCU T;  4C92 D;  1VQ5 Q;  4E7S A;  3HL8 A;  2F1L A;  2E12 A;  2RO0 A;  3CCL T;  5CKE A;  1I4K 1;  4A4G A;  2IPO B;  2DIL A;  2ZPE B;  4DBF A;  2KY9 A;  2E5K A;  2QA4 T;  1TSF A;  3M4G A;  4IUR A;  4C92 B;  2CUB A;  1GL5 A;  1WQ7 A;  1RI9 A;  5LJ5 f;  2NLU A;  5J3B A;  5M9O A;  2FHD A;  2HD0 A;  1TTH B;  4E7J A;  2LJ3 A;  2FZG B;  2HZY A;  5LJ3 d;  3LX7 A;  4C5E A;  2RJF A;  1GCQ C;  3EH2 A;  3GLX A;  1OOT A;  4BD3 A;  3M4Y A;  5GAN 5;  2H8H A;  2EQK A;  5CK9 A;  2A36 A;  3CME A;  5HY6 A;  1M2V B;  5LL6 S;  5FU7 B;  3L1A A;  1D1C A;  4D6W A;  2FEI A;  2PTK A;  3CCR Q;  2E3H A;  3ER0 A;  2E3I A;  4B9X A;  3CPF A;  2KYB A;  3QPH A;  2W0Z A;  2NYS A;  1VYU A;  1OPK A;  1Q82 R;  1TUG B;  3QBY A;  3NFC A;  2KQW A;  3V8K A;  4R55 A;  1Q7Y C;  4NOY A;  4XU0 A;  2CUD A;  1G3S A;  5LJ3 g;  1YWP A;  4FYW B;  2O88 A;  2DL3 A;  4J9F A;  1T3L A;  1M1G A;  2J06 A;  4KGV B;  5A2Q E;  3H0H A;  4CC2 A;  4IUQ A;  2KRS A;  3CCQ A;  2E10 A;  3EG2 A;  4PLI A;  1MNE A;  2EBP A;  1VQ6 Q;  1QQJ A;  3SB2 A;  4LN2 A;  4QT7 A;  1KK7 A;  1M3C A;  2E6Z A;  4X9D A;  3CC2 A;  2JZ2 A;  2F5K A;  1C6V X;  5FWC A;  2GFU A;  4ZNX A;  3EGX B;  1A0N B;  2I2L A;  4IIM A;  4RG8 A;  3EG9 B;  5IHN A;  4J9I A;  1Q7Y R;  2RK1 A;  1YJN T;  5KE2 A;  4C8Q B;  3X20 B;  5KCH A;  1KG1 A;  2LCS A;  1U1T A;  3QYG B;  3VS1 A;  1MV0 B;  3UA6 A;  4E6R A;  1BYM A;  2R58 A;  4XTV A;  1NLO C;  3CC7 Q;  1Y0M A;  3OYI A;  2FG0 A;  1YBY A;  3M54 A;  5IAY A;  1BI2 A;  2DLP A;  1K73 R;  1VYT A;  2CT3 A;  3CCJ T;  1RLQ C;  3C4S A;  2YRC A;  1KQS A;  2YUO A;  3QWY A;  2BZY A;  1N9S A;  2HL5 C;  3CC4 A;  1FXX A;  2OX7 A;  3LWI A;  4C0D B;  5I2S A;  1K8A C;  1MHN A;  2JMA A;  3RMQ A;  1KHI A;  5GAO l;  4RTU A;  2QEX Q;  1EIF A;  1YJ9 Q;  1G3W A;  2KXC A;  1KQS P;  1T0J A;  1QVG P;  2ESW A;  2R5A A;  3CXC S;  1TUD A;  3MP1 A;  4LNP A;  1VQK Q;  4BI3 A;  1WX6 A;  2V8K A;  2DBM A;  1WJR A;  1QWE A;  2KRN A;  3V7C A;  5IXB A;  2CS7 A;  4A54 A;  1YJ9 T;  1FMW A;  4A4F A;  4KUI A;  2E41 A;  2JXB A;  3E1S A;  3G7Z A;  5L23 A;  5KYN A;  2EYX A;  3MEU A;  4P5N A;  4KH1 B;  4ZGJ B;  4J83 A;  3VV0 A;  4DOV A;  2KRO A;  1UHC A;  2XG8 D;  4MZP A;  3TRE A;  4II1 A;  3JB9 J;  1ZUY A;  4XTY A;  3UWN A;  3ULR B;  5IT9 E;  1QLY A;  3CC2 T;  3QXE B;  2XIC A;  1AWO A;  2CSQ A;  3OYG A;  3V7R A;  1N9R A;  4X9C A;  2OJ2 A;  3I56 A;  1Q86 R;  1YIT A;  3RES A;  1IXD A;  3A8G B;  4DEY A;  4M78 B;  1S72 Q;  4M78 F;  1IRX A;  1UE9 A;  4HCZ A;  3RUX A;  5FRM A;  3JCM d;  1YIJ A;  1F1B B;  2JS0 A;  3LH5 A;  3SWN A;  4IKF A;  3G71 A;  2MYS A;  2K6D A;  2CT4 A;  3CEY A;  2MF2 A;  2HQH A;  5A0G A;  3QUI A;  4KUD K;  2CDT A;  1RAH B;  1X6G A;  2BTT A;  1BI3 A;  3UDC A;  3OYC A;  3A8M B;  5KYU B;  5LJ3 j;  2XDD A;  1SF9 A;  3EFR A;  3CPW A;  3I9Q A;  2K2V A;  4RG2 A;  2QQS A;  1JBM A;  4IUV A;  1GBQ A;  3X25 B;  3OYN A;  3ME9 A;  1KC8 U;  2EKH A;  1UGS B;  2X35 A;  1I8F A;  2CP5 A;  3G4S T;  4BDY A;  4PJO C;  2KBT A;  4XTU A;  1BKB A;  5GAN h;  3JCM J;  4LDW A;  2CP7 A;  2M1H A;  1KQ1 A;  1RAG B;  2PU9 B;  2KMT A;  2P84 A;  3QDR B;  2JTE A;  3MEV A;  4TVR A;  4L6V 5;  4QVD A;  1M27 C;  5FU7 C;  5KYY A;  1M1K C;  4M7D E;  5FRO A;  4ANJ A;  1H3Z A;  1VQ8 A;  2K9G A;  2DAQ A;  3RBB B;  1I07 A;  2GBQ A;  3MHX A;  1IRE B;  1ZSZ A;  1VQP T;  3CCU A;  1OU8 A;  4NL3 A;  4J9E A;  4PJO D;  2QG9 B;  5DM7 R;  2HSE B;  1UGV A;  2K3X A;  3CCS T;  4N0A C;  5GAN g;  4N4H A;  5A0D A;  3PFS A;  2D8H A;  2JTF A;  3A98 A;  2RI5 A;  4OMP A;  2V8J A;  1C1A A;  5I22 A;  4PJO B;  2QEX A;  1PKT A;  2A28 A;  1QWF A;  5CIU A;  4BB7 A;  1BI1 A;  3R6O A;  1WZO A;  4BAC A;  1UG1 A;  1OUL A;  2YDL A;  2P4R A;  2EKO A;  2OTJ T;  1QVF P;  3OS0 A;  1I5O B;  3G4S Q;  2RM4 A;  2DXT A;  3HKS A;  3CC7 T;  9ATC B;  3CXC P;  2MWO A;  1QVG S;  3NGP A;  2MI6 A;  3CCV Q;  1WXB A;  2XD0 A;  1GFC A;  3ZFJ A;  3A8L B;  3JSC A;  2VVK A;  3E2U A;  2MPX C;  4WTO B;  2M16 A;  1MMN A;  3WXM B;  4PL6 A;  1UB4 A;  1DJ7 B;  2FPE A;  2CP0 A;  2VGN A;  2RJD A;  5C0M A;  4AFQ C;  3I55 Q;  3FC3 A;  2CGH A;  4OB3 B;  4MZT A;  3RDV A;  5CO7 A;  1WJQ A;  3I56 Q;  1SPK A;  2QTV A;  3THK A;  1UEC A;  3JRZ A;  4IUP A;  4NL2 A;  2VGM A;  4JS5 A;  4OVA A;  4BUG A;  2J6K A;  1Q86 C;  2XKO C;  2FZK B;  1LNX A;  1X6B A;  3OBW A;  1WHM A;  1YIJ Q;  3JCM c;  2KYM A;  2NUP A;  4M7A E;  4Y91 A;  3EGD B;  4CC4 B;  2DMO A;  1Q95 G;  2JS2 A;  5GAN 8;  1YN8 A;  2H3E B;  3FJP A;  2QQ9 A;  3OMG A;  1MMD A;  5L8R E;  3OYB A;  3VUB A;  1D1B A;  2K57 A;  4C92 E;  3EGX A;  4LDU A;  2M51 A;  4FYV B;  1RAF B;  3L2Q A;  3EG9 A;  4JLI A;  3X26 B;  3EG0 A;  1QP3 A;  4QKU A;  3VS2 A;  4C92 G;  2FPF A;  2EAY A;  3CBM A;  1TG0 A;  1IGQ A;  2ENM A;  2HCK A;  4VUB A;  4EMK C;  1H3H A;  5GAO p;  4M7A B;  3E19 A;  4UC4 A;  2IG0 A;  2QQR A;  4JRI A;  3CCQ T;  4JRK A;  3OA6 A;  4O5V A;  1WQW A;  1ZA1 B;  1X69 A;  2O9S A;  2RN8 A;  4JZ3 A;  3CCM T;  5GAN 2;  1R0B G;  4RTV A;  2F2W A;  3S3N A;  1VQ9 Q;  4HCC A;  1YP5 A;  4LD9 K;  1WHL A;  1R8O B;  2EJ9 A;  1OU9 A;  1G3T A;  2LJ1 A;  4EMH A;  2KRM A;  2GQI A;  2COW A;  3M0P A;  1VIF A;  4ZGD B;  5I11 A;  1ARK A;  1H8K A;  1ZQ1 A;  2P0Q A;  2RHZ A;  1V76 A;  3CME Q;  1VQ7 A;  3O8V A;  2KEA A;  2YXY A;  2DTI A;  3IQL A;  3FEO A;  1IO6 A;  2DZ9 A;  3EFO A;  2COY A;  5CQX A;  2XDB A;  4F7U B;  3CME T;  2PUK B;  2RH2 A;  2AKK A;  3VS0 A;  3HFO A;  5IH2 A;  3JCM P;  1UTI A;  5FW9 A;  3P8B B;  1UHF A;  2LQK A;  1JU5 C;  2QGF B;  4XTX A;  3V7S A;  1SRL A;  5KH6 A;  1KC8 R;  2EVR A;  3C94 A;  1HK9 A;  2MWP A;  1V1C A;  1W70 A;  3HFN A;  3HRT A;  1MUZ A;  2E70 A;  1Z9Q A;  4N4I A;  1RI0 A;  2KI7 A;  2KE9 A;  2V1R A;  1PKS A;  3RIR A;  1PG5 B;  4J6W A;  3CCE T;  4MDX A;  2V8I A;  2CSI A;  2XMF A;  1YHQ A;  1AZE A;  4M77 D;  1RAE B;  3LLR A;  4ME7 A;  3M58 A;  3BW1 A;  2EYW A;  5GAM d;  3RKW A;  3OY9 A;  5AT1 B;  2FYK A;  2DX1 A;  5KE3 A;  2O31 A;  1N5Z A;  1K76 A;  4FCY A;  1VQN A;  4RTT A;  1Y07 A;  2PNI A;  1M3B A;  3DLL A;  1U5S A;  2IIM A;  1WHH A;  5LJ3 h;  3CD6 Q;  2KSS A;  3C0C A;  1NYG A;  3M0U A;  3PMT A;  2F2X A;  5AYF A;  8ATC B;  1JQQ A;  3PVQ A;  5KCO A;  4A4K A;  5GAM h;  2C06 A;  1SRM A;  2BE9 B;  4M77 C;  2O4X A;  4ESR A;  3OQ5 A;  1Q86 U;  4C92 C;  4ZN1 A;  4N0A A;  4M75 A;  3M0T A;  1BCM A;  1KC8 C;  3JB9 D;  1Q81 C;  1Y96 A;  1GRI A;  3CCE Q;  3CC4 Q;  1M3A A;  2EYZ A;  1WHK A;  2QXF A;  3LWH A;  1KFZ A;  3GOX A;  1JB0 E;  2GFA A;  2DD4 A;  4X1V A;  3FJ5 A;  1LJO A;  3AT1 B;  4M7D A;  4E7Z A;  4AFZ C;  3LH0 A;  1FMV A;  1K8A U;  1GCQ A;  5CVI A;  5GMK l;  3PE0 A;  4ZN3 A;  4CC3 A;  1LPL A;  1PRL C;  2D1X A;  5HKC A;  1VQK A;  3TSZ A;  2CP6 A;  2DL4 A;  3MEW A;  2D0Q B;  4XTZ A;  3CCM A;  4J8O A;  1KD1 R;  2RF0 A;  3ZL7 C;  1QVF A;  4DBH A;  4FT4 A;  4M75 D;  4FYY B;  2DVJ A;  1KQ2 A;  4PFO A;  2GCX A;  1EFN A;  1X75 C;  5EG2 A;  2CKK A;  1YCS B;  2DPP B;  3I56 T;  4M78 C;  2KAF A;  4PJJ A;  2NUT A;  4KGX B;  2X9H A;  5LJ3 f;  1K0X A;  3M56 A;  1X27 A;  2NUZ A;  3EHQ A;  2E6N A;  2DIG A;  2CP3 A;  4J6X A;  1VA7 A;  3DB4 A;  1Y57 A;  1ZSZ B;  1VQ4 T;  3X24 B;  3PTA A;  2JT4 A;  4OGC A;  1K9M C;  3UA7 A;  1VQP Q;  2COZ A;  2K5F A;  5J39 A;  2XID A;  5ECA A;  3JB9 F;  2WSE E;  4M78 G;  1K73 U;  1VQ9 A;  2M9U A;  4XU1 A;  2AK5 A;  2YRD A;  1QMC A;  4HA8 A;  2RQV A;  3L42 A;  1ZX6 A;  1WGS A;  2DZC A;  1X6O A;  2C0T A;  1QVG A;  2WAC A;  3RKY A;  1ZLM A;  2GGR A;  2L3R A;  3T9N A;  3ZBD A;  5FLX E;  1KD1 U;  1Q7Y U;  2LQN A;  2DER A;  2R5M A;  2LT4 A;  3G71 Q;  1WDX A;  4HKE A;  1FWZ A;  1BU1 A;  3JB9 I;  2DRM A;  1W2B P;  1K8A R;  2DBK A;  3M0R A;  2DNU A;  5IHK A;  1VQL T;  4QVZ A;  3CC4 T;  3NTI A;  3UPU A;  3H41 A;  3NMZ C;  1Z9Z A;  1ZSZ C;  3OYA A;  2OTL A;  1G5V A;  5GAM j;  1O75 A;  4OML A;  1K4U S;  2YLB A;  4J9H A;  4C0D C;  4M7D G;  4DQ2 A;  2WSF E;  1U06 A;  1W4S A;  1AOJ A;  4MMK A;  1VQ4 Q;  3CXC A;  5GAN j;  1YIJ T;  1FYN A;  1M8M A;  5GAN 3;  2ZPI B;  5FU6 B;  2E65 A;  2KXD A;  4C5G A;  1ZHI A;  4BY6 C;  1JRI A;  3VKI A;  2ED1 A;  4PLL A;  3OYJ A;  2NUP B;  1Q82 U;  2ZZD A;  2VV5 A;  3EGD A;  1JJ2 S;  3QWX X;  3QZ9 B;  4OGE A;  1ACM B;  1OI1 A;  5DLO A;  3OYD A;  5GAN 4;  4PFZ A;  1PWT A;  4OMF B;  2DVE A;  2BZX A;  4M7D D;  3S6W A;  1YJN A;  3RKX A;  4E7I A;  1N27 A;  1NM7 A;  2C0O A;  2QAS A;  1U1S A;  1PD0 A;  1VQ8 T;  4LDX A;  3X28 B;  4MZM A;  3CCE A;  4LUD A;  1XOV A;  1YNZ A;  3G1J A;  2IVW A;  2D9T A;  4KT0 E;  3E9F A;  2ATC B;  5GMK e;  4OP0 A;  3CCS A;  2CYZ B;  5LJ5 e;  4M7D F;  3JV3 A;  4PJO G;  4HT9 A;  2DTO A;  2PVG B;  2P0P A;  3KUF A;  2HNI A;  3OBY A;  3A8O B;  4JJN K;  4DBQ A;  1QCF A;  1R77 A;  3UF4 A;  1PSE A;  3JCM e;  1JEG A;  2FRW A;  2J05 A;  2W10 A;  5IXF A;  1BB9 A;  3FRN A;  4HVV A;  2EPD A;  2B86 A;  3QDF A;  1NJI C;  1MV3 A;  2FB7 A;  2YRV A;  3L2U A;  4ZGE B;  4B6M A;  1VQ5 A;  4LE9 A;  2CZ0 B;  1HD3 A;  2NWM A;  3OW2 P;  3L2V A;  1AT1 B;  2RQR A;  2L0A A;  2Y90 A;  1YI2 A;  3CCV A;  3G6E Q;  3SWN C;  1FMK A;  4WF2 A;  2KR3 A;  3F70 A;  4F7U A;  3CBO A;  1WNL A;  1X2Q A;  4JJD A;  3URG A;  3C12 A;  1JJ2 P;  2RMO A;  1KJW A;  3SFM A;  2QEX T;  1AWJ A;  1TXQ A;  3DKM A;  3A5Z B;  4Z8A A;  3CMA A;  3ASK A;  1CKA A;  2CZ6 B;  1OZ3 A;  2ZGW A;  2DK3 A;  3E9G A;  1K0S A;  1ABO A;  2JW4 A;  4M75 E;  1PC0 A;  1NZ9 A;  4JDS A;  2JOY A;  3RNJ A;  2LNH B;  3VYG A;  3V8J A;  5GAN 7;  1VQ7 T;  1B3Q A;  4EMK A;  1AHJ B;  3KXT A;  1CSK A;  4OB1 B;  2HMA A;  1QCN A;  2Y4X A;  4HVU A;  1SHF A;  1WPY A;  4JLG A;  4J5Y A;  5IHI A;  4A4E A;  2EGE A;  4M77 F;  2ABL A;  3QHS A;  3MCA B;  4N4G A;  3MEA A;  1IGU A;  1IB8 A;  2DL7 A;  3SWN B;  2CZ7 B;  2K4Y A;  2JJ9 A;  4M7A G;  1M9S A;  4NS5 A;  3CCR A;  1ZA2 B;  4C0G A;  4JPB W;  2GNC A;  2Z0W A;  3JCM V;  2PZ1 A;  2O4X B;  3BDU A;  4JUV A;  2PVD B;  5FWB A;  1D0Y A;  2AIR B;  1UUE A;  1TOV A;  1PM3 A;  1Y96 B;  4RTW A;  3GBQ A;  3LGF A;  4RKU E;  3TVT A;  1V29 B;  2PUO B;  5KYX A;  1VQ6 A;  1O9S A;  2K3Y A;  1B34 B;  4E7K A;  2DA9 A;  1VQM Q;  1NEB A;  3HPW A;  1K9A A;  2VUB A;  5FRN A;  4J7F A;  4M7D B;  1VQM T;  2X3W D;  1TS9 A;  4YTL A;  3OYE A;  1D09 B;  1D0Z A;  1RAC B;  2LZ6 B;  1VIE A;  2JM9 A;  1NPR A;  4R0K A;  4BI8 B;  1E6H A;  3UAT A;  2ECZ A;  1WXT A;  1KSW A;  1X2K A;  4FW1 A;  2EIF A;  2RI2 A;  2GQV A;  2JTM A;  3MO8 A;  3KFV A;  1WIE A;  3SHW A;  1HXD A;  2DEQ A;  2X4X A;  1WXU A;  2A37 A;  2P0K A;  4K11 A;  1YJN Q;  2LJ0 A;  1AWW A;  3M57 A;  4XQ3 A;  2RD1 A;  1I81 A;  2KT8 A;  1B07 A;  1SG5 A;  3PT9 A;  2AHJ B;  2EQM A;  3CCS Q;  4DEX A;  3JB9 G;  2LC4 A;  1T3S A;  2NUT B;  2VKN A;  2VAS A;  4C0F A;  4QQD A;  3CPW P;  1D1A A;  3H0F A;  1RUW A;  4D8D A;  1OZ2 A;  1I0C A;  4DBR A;  1AD5 A;  2O9V A;  1YHQ Q;  1TH7 A;  1OPL A;  2MOX A;  5CCA A;  5GAM g;  3NPF A;  1K9M R;  2F5T X;  1M30 A;  4J9G A;  4JRP A;  4LD6 A;  3CCL Q;  3OS1 A;  1Y71 A;  5CKF A;  3P8D A;  4EMG A;  3ZEH A;  3TSW A;  3TQ7 P;  1XTD A;  5GAO r;  2E5Q A;  2RI3 A;  1RL2 A;  2MCN A;  1UGP B;  5GAN 6;  2YUQ A;  3CD6 A;  2AZS A;  4BY6 B;  1D3B B;  8AT1 B;  3VS7 A;  2B8A A;  2KT1 A;  2EFI A;  1SSF A;  4D8K A;  4F16 A;  2XI9 A;  2FO0 A;  3HSB A;  2YWW A;  2JUF A;  3EHR A;  3CMA Q;  1ZUU A;  2CH4 A;  3QG1 A;  1GXI E;  1KQS S;  3G6E A;  3VRZ A;  4OMO A;  1YJW Q;  3PVL A;  5GMK j;  3GIB A;  4EIK A;  1YHQ T;  4PJO E;  1VQ6 T;  2FRY A;  2FPD A;  3WVD B;  3L2R A;  1RAA B;  2EW3 A;  2QI2 A;  3AHU A;  3LW5 E;  2KDS A;  4BE0 A;  5CKB A;  2MAM A;  1YFN A;  2BZ8 A;  1QKW A;  4JJB A;  2XK0 A;  1C0M A;  4V2S A;  1ABQ A;  2RQT A;  3OS2 A;  1UDL A;  2HDA A;  3M0S A;  3RER A;  1JO8 A;  4Q5W A;  1YIT Q;  5DLQ E;  2OTJ A;  4F7U E;  4A53 A;  4IIO A;  2J6F A;  3HHT B;  2VXF A;  2OAW A;  2HEQ A;  2RQW A;  2XHC A;  4C5I A;  3KBG A;  2M0O A;  2QTX A;  3FDR A;  2QAZ A;  1WFW A;  2L2P A;  3EFS A;  1PD1 A;  4JS4 A;  3M5A A;  1X43 A;  4KUL A;  1M2V A;  1N6A A;  1RAI B;  2PVO B;  3SD4 A;  4RTZ A;  4FU6 A;  1NG2 A;  2RNA A;  3QJ6 A;  3H8Z A;  4J9B A;  3OYY A;  1RAB B;  3VU3 C;  2QGG A;  3CCJ Q;  4PK4 A;  1OX9 A;  5HK3 A;  4PNO A;  4RTX A;  4J9C A;  2C0I A;  1M1K U;  1D0X A;  3CCR T;  4PJN A;  2A08 A;  2O01 E;  3OMC A;  2EJG A;  3JCM f;  4ELZ C;  3OB9 A;  2X4J A;  3A1P A;  2ZPF B;  2DO3 A;  2X51 A;  2QA4 Q;  3M55 A;  3JCM X;  5IN1 A;  1AWX A;  2Y4Y A;  3GF5 A;  1BIB A;  2QYZ A;  1VQM A;  4E7H A;  3DB3 A;  4C5H A;  2DJQ A;  3FIF A;  1VQL A;  1K73 C;  2G3R A;  2HAX A;  4J7I A;  3L2Z A;  3I5S A;  4KH0 B;  1XJW B;  1G8X A;  1YCY A;  1NYF A;  2M0Y A;  2AT1 B;  1JXO A;  4F7U F;  2ZPB B;  3O5Z A;  4FL6 A;  4C8Q A;  2LQ8 A;  3JAM E;  5GAO m;  3M59 A;  2EQI A;  4QQG A;  2DIQ A;  2GTJ A;  2PQW A;  3CCU Q;  1I5L A;  1PRM C;  2LCL A;  4O6J A;  2OI3 A;  1VQ8 Q;  3CCV T;  2F69 A;  4OMN A;  6AT1 B;  3H0I A;  2HSP A;  2JM8 A;  3MJX A;  1M90 U;  2FVU A;  1OX8 A;  5GJW B;  3OYF A;  2YT6 A;  3BE3 A;  4A63 B;  4ORZ A;  5D7U A;  4AFS C;  1TWB A;  3JCM b;  5C6S A;  1CKB A;  4AFU C;  1UGR B;  3OSV A;  1E6G A;  2EYQ A;  3GNG A;  1AEY A;  1VQO T;  1G3Y A;  3G6E T;  3OYK A;  1NJI U;  4HCK A;  3CCL A;  2XU8 A;  3DLM A;  3G4S A;  4JJC A;  1PSF A;  2LX7 A;  1YIT T;  5GAO q;  5GMK i;  1G2B A;  4L5G A;  2K5L A;  4M77 B;  2K2M A;  4C0Z A;  1ZBX A;  3J7A F;  3VJP A;  4ELY C;  1M8V A;  2HKQ B;  1J3T A;  1YJW A;  2ZCF B;  2RHU A;  3QYH B;  2K5I A;  1Q82 C;  5A0L A;  1VQK T;  4FSS A;  1M90 C;  3I5R A;  4LXC A;  3JCM Q;  5LJ5 g;  1IHV A;  1GFD A;  2G6F X;  1KHC A;  3I55 A;  2YHT A;  3NTK A;  2H3J A;  4M75 B; 
#chains in the Genus database with same CATH homology
 2W10 A;  4KRT A;  5IXF A;  1BB9 A;  1PHT A;  1K1Z A;  1HJD A;  4WCI A;  4HVV A;  2EPD A;  2B86 A;  4AG1 C;  4AFQ C;  1MV3 A;  4LE9 A;  3REA B;  2NWM A;  1HD3 A;  1SPK A;  3THK A;  2RQR A;  1UEC A;  2L0A A;  1FMK A;  2L3Q A;  2KR3 A;  4AG2 C;  2DL8 A;  2J6K A;  1X2Q A;  4JJD A;  3REB B;  1X6B A;  1OV3 A;  2KYM A;  2RMO A;  1KJW A;  1AWJ A;  4Z8A A;  4CC4 B;  2DIL A;  1CKA A;  2DMO A;  4OMM A;  2JS2 A;  2E5K A;  3NHN A;  1YN8 A;  1K0S A;  1ABO A;  2JW4 A;  2CUB A;  2YUN A;  1GL5 A;  1RI9 A;  5EC7 A;  4F14 A;  3RNJ A;  2M51 A;  3I35 A;  2X3X D;  1G83 A;  2LNH B;  4GBQ A;  3EG0 A;  1B3Q A;  2LJ3 A;  1E7O A;  2DM1 A;  3VS2 A;  3EG1 A;  2FPF A;  1CSK A;  2EGA A;  4HVU A;  1GCQ C;  1SHF A;  2HCK A;  1TG0 A;  1ZBJ A;  1OOT A;  2ENM A;  3VS3 A;  5GJV B;  1U3O A;  1H3H A;  2H8H A;  5IHI A;  1PNJ A;  2EGE A;  2A36 A;  2ABL A;  3EG3 A;  1X69 A;  2O9S A;  2RN8 A;  4JZ3 A;  4HXJ A;  2FEI A;  2PTK A;  2VWF A;  1KIK A;  4RTV A;  2DL7 A;  2F2W A;  1YP5 A;  2KYB A;  2W0Z A;  1VYU A;  2LJ1 A;  1OPK A;  2KRM A;  2GQI A;  3M0P A;  4JPB W;  2GNC A;  1HSQ A;  5I11 A;  1ARK A;  2PZ1 A;  1H8K A;  2CUD A;  4J9D A;  1BBZ A;  2HBW A;  1YWP A;  2O88 A;  2DL3 A;  5FWB A;  4J9F A;  2KEA A;  4JZ4 A;  1T3L A;  1UUE A;  2J06 A;  4RTW A;  2KNB B;  1NEG A;  3IQL A;  1IO6 A;  3GBQ A;  3TVT A;  3H0H A;  4CC2 A;  2KRS A;  2GTO A;  2YSQ A;  2DA9 A;  2AKK A;  1NEB A;  3VS0 A;  3EG2 A;  5IH2 A;  1K9A A;  2EBP A;  1UTI A;  5FW9 A;  1UHF A;  4LN2 A;  1RLP C;  1JU5 C;  2L3P A;  4QT7 A;  2X3W D;  1SRL A;  2EVR A;  1M3C A;  1H92 A;  1V1C A;  1W70 A;  1SSH A;  2DF6 A;  1MUZ A;  2J7I A;  1Z9Q A;  2LZ6 B;  5FWC A;  2JM9 A;  4R0K A;  4ZNX A;  1E6H A;  3UAT A;  1A0N B;  2ECZ A;  1WXT A;  2KE9 A;  1PKS A;  1KSW A;  1X2K A;  2V1R A;  4IIM A;  3VRY A;  5IHN A;  4J9I A;  2XMF A;  2CSI A;  1AZE A;  5HCK A;  3KFV A;  1WIE A;  4RUG A;  3SHW A;  1WXU A;  2A37 A;  2EYW A;  4K11 A;  2LCS A;  2LJ0 A;  3VS1 A;  1AWW A;  1MV0 B;  3UA6 A;  2ROT A;  4E6R A;  2KT8 A;  2MIO A;  1B07 A;  2DX1 A;  3U23 A;  1NLO C;  1N5Z A;  2O31 A;  1K76 A;  1Y0M A;  2FG0 A;  4DEX A;  4RTT A;  1W1F A;  1T3S A;  2VKN A;  4RTY A;  2DLP A;  2PNI A;  1VYT A;  1M3B A;  3H0F A;  1U5S A;  1RUW A;  1AVZ C;  2CT3 A;  1RLQ C;  2IIM A;  4D8D A;  2YUO A;  3QWY A;  1I0C A;  2BZY A;  1NYG A;  3C0C A;  1AD5 A;  3M0U A;  2F2X A;  2O9V A;  1JXM A;  1OPL A;  2MOX A;  3NPF A;  2LP5 A;  2CRE A;  1M30 A;  2JMA A;  4J9G A;  1JQQ A;  3PVQ A;  4RTU A;  1SRM A;  2KXC A;  3SEM A;  4ESR A;  4F17 A;  1T0J A;  3TSW A;  2V1Q A;  2ESW A;  3M0T A;  2MCN A;  1TUD A;  2YUQ A;  4LNP A;  2AZS A;  1GRI A;  1WX6 A;  2DBM A;  3VS7 A;  2EYY A;  4Z89 A;  1QWE A;  2KT1 A;  1M3A A;  2EYZ A;  4D8K A;  2F2V A;  4F16 A;  1KFZ A;  2FO0 A;  2KRN A;  3EGU A;  3EHR A;  5IXB A;  2K7A A;  4X1V A;  1UJ0 A;  3FJ5 A;  1ZUU A;  2CH4 A;  4AFZ C;  3VRZ A;  4OMO A;  1S1N A;  2JXB A;  2RPN A;  3PVL A;  1GCQ A;  5L23 A;  4EIK A;  3PE0 A;  4CC3 A;  1VYV A;  2EYX A;  2FRY A;  2FPD A;  1PRL C;  2D1X A;  2EW3 A;  3TSZ A;  2DYB A;  2DL4 A;  2KRO A;  1UHC A;  2BZ8 A;  1ZUY A;  1QKW A;  2J6O A;  1WA7 A;  2RF0 A;  4JJB A;  4OMQ A;  3ULR B;  3ZL7 C;  1ABQ A;  2RQT A;  1UDL A;  4CC7 A;  2HDA A;  1QLY A;  3M0S A;  2DVJ A;  1JO8 A;  1I1J A;  2D8J A;  1AWO A;  2CSQ A;  4GLM A;  1EFN A;  1WYX A;  4IIO A;  2J6F A;  1YCS B;  2OJ2 A;  2OAW A;  2HEQ A;  2RQW A;  3VS6 A;  2I0N A;  4Z88 A;  1K0X A;  4DEY A;  1WFW A;  1SHG A;  1WI7 A;  1X27 A;  2L2P A;  2NUZ A;  3EHQ A;  1UE9 A;  1QKX A;  1VA7 A;  1X43 A;  1Y57 A;  2JT4 A;  1GCP A;  3UA7 A;  4RTZ A;  1OEB A;  1NG2 A;  1UJY A;  2RNA A;  2JS0 A;  3LH5 A;  4J9B A;  1TUC A;  1LCK A;  5ECA A;  2K6D A;  1W6X A;  2CT4 A;  2AK5 A;  2RQV A;  1ZX6 A;  4RTX A;  4J9C A;  2C0T A;  2C0I A;  2CDT A;  2BTT A;  1X6G A;  1ZLM A;  2GGR A;  2A08 A;  4M4Z A;  2QDL A;  2LQN A;  3I9Q A;  2SRC A;  3R6N A;  1WDX A;  2CH4 W;  4HVW A;  1BU1 A;  2DRM A;  1GBQ A;  1AWX A;  2ED0 A;  2EKH A;  2DBK A;  3M0R A;  3M0Q A;  2DJQ A;  2DNU A;  5IHK A;  2LQW A;  2SEM A;  3H41 A;  1SEM A;  2KBT A;  3NMZ C;  1Z9Z A;  2AZV A;  4OML A;  3I5S A;  1K4U S;  4J9H A;  2KGT A;  1BK2 A;  1NYF A;  2RQU A;  1U06 A;  2M0Y A;  1JXO A;  1ZUK A;  2JTE A;  2ROL A;  1AOJ A;  1UFF A;  2K79 A;  1GBR A;  1M27 C;  2D0N A;  1FYN A;  3O5Z A;  2K3B A;  1M8M A;  1WLP B;  2EQI A;  3CQT A;  2K9G A;  2GTJ A;  2KXD A;  1PRM C;  3RBB B;  2ED1 A;  1I07 A;  2DL5 A;  2GBQ A;  2OI3 A;  2JMC A;  3QWX X;  4OMN A;  3H0I A;  2HSP A;  2JM8 A;  1YWO A;  4LUE A;  4J9E A;  2LMJ A;  2EGC A;  1PWT A;  5GJW B;  2BZX A;  2YUP A;  1UGV A;  2YT6 A;  4A63 B;  4ORZ A;  2O2O A;  4AFS C;  1CKB A;  4AFU C;  1NM7 A;  2C0O A;  1E6G A;  2D8H A;  1AEY A;  3A98 A;  4OMP A;  5I22 A;  4HCK A;  1PKT A;  2A28 A;  4JJC A;  1QWF A;  1AZG B;  4LUD A;  2LX7 A;  1XOV A;  1UG1 A;  1YNZ A;  1G2B A;  2YDL A;  1T0H A;  2P4R A;  4Y92 A;  1ZSG A;  2L3S A;  2K2M A;  1NLP C;  2DRK A;  2AKL A;  3JV3 A;  1J3T A;  3NGP A;  2J05 A;  3VS4 A;  2DE0 X;  3VS5 A;  4FSS A;  1WXB A;  3I5R A;  1GFC A;  1QCF A;  1GFD A;  2VVK A;  3UF4 A;  2G6F X;  1JEG A;  2FRW A;  2FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...