4ORZA

Hiv-1 nef protein in complex with single domain antibody sdab19 and an engineered hck sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
IIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of HIV-1 Nef by a high-affinity binding single-domain antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/apoptosis/immune system
molecule keywords Tyrosine-protein kinase HCK
total genus 13
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4orzA00
1N5ZA 5IHNA 4J9FA 4OMMA 1YWPA 1U3OA 5I11A 1XOVA 2KRSA 1NYGA 2JXBA 3EG3A 3NHNA 1M8MA 2VWFA 4RTUA 1Y57A 2K3BA 1W70A 3VS0A 2O9VA 1WLPB 2B86A 3REAB 2DM1A 2J6FA 2K7AA 2LJ0A 1Y0MA 2F2WA 1M27C 4ORZA 2YUOA 2IIMA 4OMLA 1ABQA 2KYMA 3H0IA 2ENMA 3R6NA 2V1RA 4E6RA 1X6GA 2KXCA 1CSKA 1BB9A 2DX1A 2DE0X 2KE9A 1OEBA 3EG2A 4ESRA 5IXFA 3SEMA 2ESWA 2OI3A 4F16A 4K11A 1UECA 3SHWA 5GJWB 1HD3A 3H0FA 1WI7A 2DBMA 3EG0A 2F2XA 3PE0A 2L2PA 2C0IA 1SRMA 1E6HA 1K0XA 1X2KA 1GFCA 2DMOA 2EW3A 2OAWA 2LQNA 2KXDA 1X2QA 1UE9A 2CUDA 3M0UA 2BZXA 2LNHB 1QWEA 1VYTA 2BZYA 1PWTA 1T3SA 2RQWA 1M3BA 4D8KA 2J05A 2A28A 1YWOA 1WDXA 3I5RA 4F14A 2EYXA 1ARKA 5ECAA 1M30A 1T3LA 5IXBA 1X69A 2W10A 2DJQA 4HVUA 1MV3A 2OJ2A 2EGAA 2YDLA 3UF4A 2RQRA 2X3XD 4CC2A 3VRZA 2PZ1A 2K6DA 4RTXA 2KYBA 2DL8A 1TUDA 2EYYA 4RTVA 4R0KA 4JJCA 2FRYA 3TVTA 4DEXA 2JS0A 4J9IA 3FJ5A 2KGTA 2VVKA 2YT6A 2JT4A 4J9CA 5IHKA 4D8DA 3VS4A 1K9AA 1OPKA 2YUQA 3H41A 3QWXX 5HCKA 2D1XA 2KNBB 1H92A 2CSIA 1AZEA 1AWWA 1MV0B 2E5KA 4EIKA 2DVJA 3NGPA 4AFSC 3PVLA 1H3HA 1B3QA 3CQTA 2EBPA 1PRLC 1YCSB 2EYWA 4KRTA 1ZLMA 2FG0A 1NLPC 1PNJA 1NG2A 2YSQA 1RLPC 4WCIA 2LJ3A 2DBKA 3NMZC 1WFWA 1ZUKA 3IQLA 2LX7A 1BU1A 1TG0A 1GFDA 2DRMA 2DILA 2J06A 5FW9A 2KEAA 2RN8A 4FSSA 4OMNA 3H0HA 4AG2C 1X43A 1LCKA 2JMCA 2HEQA 1NLOC 2EPDA 2W0ZA 1GCPA 2C0OA 2DF6A 4RTWA 3VS5A 3VS2A 2LJ1A 2MIOA 4J9EA 2AKLA 1A0NB 4JPBW 2L3SA 3UA6A 4Z88A 2KR3A 1QKXA 4HVVA 2CH4A 1GRIA 2FEIA 2A08A 2ECZA 3M0SA 4LUEA 1AVZC 1AWOA 3O5ZA 2NUZA 2JM9A 3QWYA 1QLYA 1J3TA 1AWJA 1T0HA 1V1CA 2V1QA 4GBQA 4GLMA 4AG1C 2EVRA 2KT1A 2K2MA 4CC4B 1WXTA 2PNIA 1OV3A 2M0YA 2DNUA 1SEMA 1KSWA 2D8JA 2O9SA 2CUBA 2K9GA 5EC7A 1H8KA 2F2VA 3REBB 3GBQA 3NPFA 3UATA 4HXJA 2K79A 2RQUA 1I0CA 2VKNA 2DL7A 4A63B 4X1VA 3VRYA 4OMPA 2LZ6B 2RF0A 3I5SA 2HSPA 1YN8A 2M51A 1AZGB 2RPNA 1UHFA 2D8HA 4RTZA 2AZVA 2G6FX 2J6OA 2X3WD 4Y92A 1QKWA 2EYZA 1E7OA 2P4RA 1ZSGA 4J9DA 1KFZA 4OMQA 1UDLA 2DYBA 1K1ZA 1E6GA 2EKHA 1U5SA 1S1NA 3JV3A 1UHCA 2JM8A 4HCKA 4M4ZA 1SHGA 2CDTA 1GL5A 3ULRB 4OMOA 2FPFA 2L0AA 5IHIA 3A98A 1K0SA 1OOTA 3I9QA 4JZ3A 1AEYA 2GQIA 2JTEA 1X27A 2AZSA 4IIMA 1SSHA 1T0JA 3M0PA 1SHFA 2FPEA 5GJVB 1K76A 1QWFA 4JJBA 5I22A 2RNAA 1GBRA 1BK2A 2L3QA 4J9GA 2GTJA 2DA9A 4AFZC 1Z9ZA 2HCKA 3U23A 1JXMA 2I0NA 2CREA 1W1FA 4CC3A 2BTTA 2MCNA 4JJDA 1AOJA 3RBBB 2H8HA 3M0RA 1HJDA 4RUGA 2O2OA 3VS7A 4J9HA 1JU5C 1NEBA 3TSZA 2PTKA 2AKKA 1WXUA 1M3CA 1ZX6A 2J6KA 2ROLA 3C0CA 1UUEA 3EGUA 1UTIA 2MOXA 2GTOA 2O31A 4JZ4A 1PKTA 2ROTA 2RQVA 1GCQA 2A37A 2LCSA 4IIOA 2SEMA 2KRMA 1GBQA 2NWMA 2BZ8A 1G83A 1RLQC 1YP5A 1KJWA 2EQIA 2EGCA 2GBQA 4DEYA 2LQWA 1OPLA 1FYNA 3RNJA 1RUWA 1W6XA 2FPDA 2A36A 2YUNA 1JXOA 1GCQC 2ABLA 1U06A 2DRKA 1WYXA 1K4US 1VA7A 1EFNA 2GGRA 2CT3A 2JW4A 2J7IA 1ZUUA 1WXBA 1I1JA 1Z9QA 1MUZA 1ZUYA 4ZNXA 1UG1A 2HBWA 1PKSA 1PRMC 1M3AA 2YUPA 2L3PA 3EHRA 3VS3A 4J9BA 1HSQA 3M0QA 2FRWA 1FMKA 1SPKA 2KBTA 2CSQA 2EGEA 4RTTA 4Z89A 2D0NA 2QDLA 5L23A 1VYVA 2KROA 2JS2A 5IH2A 2DL4A 2ED0A 1B07A 1NYFA 1SRLA 1CKBA 1JQQA 2KT8A 3UA7A 2AK5A 4QT7A 3VS6A 2GNCA 2RQTA 1WX6A 3M0TA 2LMJA 4AFUC 2DL5A 1YNZA 3ZL7C 1WA7A 3THKA 2FO0A 1TUCA 1KIKA 3LH5A 4F17A 1UFFA 4RTYA 4LUDA 1JO8A 1ABOA 1UJ0A 1CKAA 3I35A 4LE9A 4Z8AA 1JEGA 2SRCA 2HDAA 2ED1A 2RMOA 1I07A 1UJYA 5FWCA 2C0TA 1AD5A 3EG1A 4CC7A 1NM7A 1UGVA 1RI9A 1WIEA 2CT4A 2XMFA 3VS1A 1VYUA 1IO6A 1X6BA 2JMAA 3EHQA 2O88A 1BBZA 2LP5A 5FWBA 1QCFA 4AFQC 1AWXA 2CH4W 4LNPA 1PHTA 4HVWA 1ZBJA 1G2BA 2KRNA 4LN2A 1NEGA 3KFVA 3TSWA 2DL3A 3PVQA 2DLPA
chains in the Genus database with same CATH superfamily
3BW1A 4O6JA 5IHNA 2LCCA 2DFUA 1N6AA 2X4JA 2KRSA 1NYGA 1FXXA 2JXBA 5CVIA 3OW2S 2VV5A 3EG3A 2M9UA 1R0CB 2VWFA 2K3BA 1W70A 4EMGA 3C4SA 1Q82R 2ATCB 1Q86R 2E3IA 4E7ZA 2B86A 2DM1A 2PQWA 2AT1B 3HTRA 2H3EB 2VASA 4O5VA 2P4TA 4ORZA 4OP0A 3HSBA 3R6NA 2V1RA 3OYKA 2DXCA 2JUFA 4JJNK 4JRIA 4M77F 1BB9A 4BE2A 2H3JA 2Y4XA 3S3MA 4PJOF 3EG2A 4ESRA 5IAYA 4J7FA 4PJJA 1BI0A 3I55T 1WHHA 3SHWA 5GAN5 4BY6B 1OQKA 5LJ5d 3VYGA 2C0IA 1WHGA 4JRQA 2FZGB 4OB2B 5LJ3g 2LQNA 3CBPA 1X2QA 3JCMe 1JBMA 3GF5A 5GMKh 2QA4A 2A28A 1WDXA 3I5RA 1KQSA 1AHJB 1KD1U 1M30A 5GAN3 4A4KA 2RM4A 3OYFA 3HP9A 3I55Q 1X69A 4J6YA 4WF2A 1YI2T 1MV3A 2OJ2A 2YRVA 4OGEA 3RUXA 3J81E 3G71Q 2A7YA 4CC2A 3RR6A 2PZ1A 2K6DA 5CKBA 1QP3A 4Z02A 3OYBA 1K8AR 2EYYA 4M75F 1ZHIA 1BCOA 4C92A 2QAZA 2RJCA 4F7UF 2JS0A 2GQVA 2FYKA 5GANe 5HK3A 5IHKA 2YUQA 2D0QB 3JCMf 2MPXC 4DBQA 2E5KA 1ACMB 1TWBA 2MWPA 1H3HA 2Y90A 3JCMc 1Y07A 2EBPA 4C92C 4L5GA 1O9SA 1ZLMA 2C06A 5HKCA 1NLPC 2YSQA 4AT1B 2CP5A 4WCIA 1XNIA 3OYCA 4DBHA 3OYLA 1VQ8A 2COWA 4LDVA 3NMZC 4ME7A 3KBGA 1NPPA 2P0PA 4PLIA 3JB9I 2LX9A 1VOMA 1BU1A 3L2RA 1BKBA 1BYMA 2X4YA 4OMNA 3H0HA 4FYYB 1X43A 2JMCA 2W0ZA 4A4HA 3M57A 1Q7YR 1GCPA 1WHLA 2OTJT 4PJOA 3CMEQ 3E9FA 1LNXA 1M2VB 1SSFA 3EFRA 4JPBW 3UA6A 4QW2A 2MK5A 4HVVA 1Q81U 4KGZB 1VQOQ 2RA2A 1GRIA 4M7DE 4M75B 2A08A 2ECZA 4PFPA 1RAIB 3MP8A 5LJ5h 4MZMA 1W2BP 4J6WA 2QA4Q 2NUZA 2V8KA 3M55A 2JM9A 4L59A 2LTOA 3P8BB 1AWJA 3EFOB 3JCMP 1N27A 4GLMA 1Q7YC 1VQKQ 2EVRA 1B34B 1BIAA 2K2MA 2PNIA 3ASKA 3VKIA 5L8RE 5IT9E 2LQKA 1QVGP 2D8JA 2CUBA 1H8KA 2L8DA 5GAOq 4A4GA 3NFCA 2F2VA 3REBB 1VQ6T 3FC3A 3BE3A 3EH1A 1I0CA 4FU6A 3CCMT 2F1LA 3VRYA 2DXTA 5FU7B 4IKFA 4QKUA 3L2QA 4OMPA 3CC4Q 2Z0WA 2ZPGB 2EYQA 2RPNA 4EMKA 2NYSA 2KQWA 2D8HA 4M7DD 2G6FX 2J6OA 1QKWA 2EYZA 2P4RA 4J9DA 1KFZA 1IXDA 1X01A 1UDLA 2DYBA 1MHNA 1Q82U 1Q86U 2K4YA 2JM8A 2DXBA 4M4ZA 2PVOB 1GL5A 1RL2A 3OQ5A 3A98A 2KY9A 4C8QC 1X27A 1Q81R 3HRTA 1SSHA 5GAOm 4E2FB 1XJWB 3CXCP 2E6ZA 2E64A 2FPEA 4C92E 3RKWA 2O01E 3LLRA 3RKYA 3M53A 3A8GB 3MEUA 4J9GA 1UGRB 4A53A 5GAOr 3TEEA 3G71T 3CBMA 2P84A 4AFZC 3CCJT 1G3SA 1FWZA 1ZBXA 1VQLQ 3U23A 2DD4A 2P0KA 3V8LA 4CC3A 2MWOA 4HCZA 4RUGA 3VS7A 3L2VA 3JCMb 2PTKA 2AKKA 1WXUA 1ZX6A 4NS5A 2MOXA 1R77A 2DTHA 2YWWA 4OMFB 3S3NA 1PKTA 1Q7YU 3PMTA 5GAMf 5DM7R 3CCQA 2ROTA 1D09B 1M1KC 4UC4A 3QYHB 3E1SA 4DBRA 2KRMA 2RD1A 1KHIA 3CPWP 2BZ8A 1G83A 1KJWA 3OYMA 1EX4A 5GAN2 2LQWA 2VXEA 3H9NA 2RI3A 1FYNA 3OYJA 1TUGB 1RAHB 3RIRA 1D0ZA 1UB4A 4L6V5 3ZBDA 1WYXA 1VA7A 1ZUUA 1WJSA 1WXBA 1Y96A 3DKMA 1KD1C 2DEUA 4JS5A 4ZNXA 2E6NA 2HBWA 1PRMC 2YUPA 1NZ9A 2X4XA 2MAMA 4J9BA 3JB9J 2K3XA 1SPKA 1K73R 2VGMA 5L23A 2KROA 2OTJQ 3AHUA 4JLIA 2K3YA 2MF2A 4BY6C 1KQ2A 3CC2Q 2QQAA 5GANj 2ZPFB 3FJPA 3ZEHA 1M4ZA 1YNZA 5CAIA 3JCMJ 2LDMA 1UGPB 1KIKA 3OYYA 1WNLA 1UFFA 4M75A 4GLKA 1ABOA 1U1SA 3I35A 4LE9A 4Z8AA 2KSSA 4C0GA 2HDAA 1I07A 1KQ1A 4M78F 4A54A 7AT1B 4AMCA 3CC2T 1RABB 2M1HA 4C0DB 1PG5B 2QQSA 4CC7A 1H3ZA 2HKNA 1U1TA 1UGVA 3JB9F 3VS1A 1IO6A 2EWNA 3CCEQ 2QYZA 3MP6A 5LJ3f 1VQ6Q 3FEOA 3PIOA 3I55A 4ZTJA 1U8RA 2XDDA 1NEGA 3KFVA 3CCMQ 5GAN7 2E5QA 3MEVA 3UDCA 2LT4A 4XK8E 3TSWA 2DL3A 3OSSC 4E7IA 1D1AA 2XIDA 2GFUA 3WVEB 4N4IA 4QVZA 4BE1A 4KGVB 3RESA 4C5HA 1XOVA 4FYVB 4XU1A 1KD1R 2JOYA 3NHNA 3FIFA 2IVWA 5AYFA 4RTUA 1WHJA 1VQPT 3G4ST 2CP0A 2O9VA 1WLPB 4PJOG 4M7AE 3META 2QG9B 1YJ9A 3HFOA 2J6FA 5CIUA 2X9HA 2L3RA 1Y0MA 1X6OA 1G5VA 1YHQT 2DJZA 4OMLA 3E9GA 1ABQA 2ENMA 3A1PA 3OYAA 2XICA 2KXCA 2DX1A 3VYHB 3D7SB 1OEBA 1RADB 3MEWA 1VQ9Q 2ESWA 4JRKA 2DVEA 3G4SQ 3OB9A 3CMAA 5D6WA 5GJWB 1HD3A 3Q1JA 5J39A 2F2XA 2L2PA 1SRMA 1GFCA 1UE9A 4ZGDB 2EQUA 2LNHB 4A4EA 2BZYA 1PWTA 2CZ7B 2YHTA 2I2LA 5HY6A 2DTIA 1VQNQ 1OX9A 4C8QF 2DAQA 2EYXA 5GAMg 4BI8B 2EAYA 3LH0A 1T3LA 1M1FA 3L2UA 2W10A 3PT9A 3CPWS 4F7UB 5GAOl 4MZTA 3UF4A 2RQRA 3A8HB 1VQLT 4IUQA 1VQPQ 3CC7T 3UPUA 4E7HA 1KHCA 2PU9B 2DETA 3CMET 2FRYA 2GCXA 4DA4A 4BI4A 4M7DC 4DEXA 4LDWA 2QQBA 3FJ5A 4B9XA 5GANd 4J9CA 3V7CA 1K9AA 3H41A 3HRUA 3QWXX 4BD3A 3CCRA 2FZKB 5KCOA 1PD1A 4M77D 1H92A 1AWWA 1MV0B 3R6OA 4AFSC 5CO7A 1B3QA 1PM3A 1RAAB 3CQTA 3A8MB 3DLLA 1YCSB 4MMLA 2RHIA 2FG0A 5KE3A 1PNJA 3V8KA 4HA8A 2LJ3A 1MMDA 5KYWA 1IGUA 1XQHA 1WFWA 1ZUKA 3IQLA 1YJ9Q 3LWHA 2LX7A 3A8LB 5GAOn 5FU7C 1GFDA 3JCMd 4M75D 3OBWA 1YCYA 2L89A 4C8QB 5KYYB 4BACA 1LCKA 1YHQA 2XKOC 3TU4K 2EQJA 1NLOC 5KCHA 2C0OA 2CP3A 4Q5WA 4XU3A 3VS5A 1WJRA 1ZA2B 2MIOA 4J9EA 3CCMA 5GANh 1H641 4NOYA 3I56A 1QQJA 2CH4A 2QDYB 3CCET 1YIJA 2E10A 1AVZC 2COYA 3OYEA 3DB4A 1MNDA 2EQKA 5CQXA 2R57A 3QWYA 5I21A 4M75C 1T0HA 1VQOA 1IREB 1V1CA 1ZA1B 2CP6A 1BI2A 4P5NA 4N4GA 4PFZA 4BUGA 4KUIA 3EFSA 4CC4B 1WXTA 4F04B 1UEBA 2DPPB 2DNUA 4D6WA 1KG1A 4PL6A 3PMIA 1KSWA 5CK9A 1YFNA 4GY5A 1WQWA 5A0LA 3GBQA 3GIBA 3NPFA 4C92G 3GPLA 2K79A 2K5IA 3RMQA 2VKNA 1ZSZA 3JRZA 1K9MU 3LW5E 1VQMA 1KC8R 2LC4A 2HSPA 5LJ3d 3CCSA 2XG8D 1IB8A 1YN8A 2ZZDA 1K9MR 2M51A 1AZGB 2X51A 4LDYA 4PKCC 1M1GA 4RCBA 5KYXA 1B7TA 2QASA 3HPWA 3N5BB 2MI6A 4Y92A 2HMAA 4MMKA 4BE0A 5FRNA 2HQXA 4J83A 2K5FA 2BE9B 1K1ZA 3OSVA 4N0AC 1UHCA 1S72T 4HCKA 2WSCE 1PCXA 3LX7A 3MO8A 3CCLA 3L2ZA 2L0AA 1OOTA 3I9QA 4JZ3A 3CCST 2GQIA 3CD6Q 2YLBA 2RO0A 1K73U 5LJ5g 4M77G 4ZN1A 1T0JA 2M0OA 3M0PA 4XU2A 5DLQE 1D3BB 5GJVB 1QWFA 1N8RU 2RNAA 4N0AA 1GBRA 8ATCB 2DA9A 2ZPBB 1Z9ZA 1S72Q 1LPLA 1W1FA 2MCNA 2DD5A 3M0RA 5FRMA 2E12A 2O2OA 1JU5C 4C5GA 4BDYA 3CCSQ 2J6KA 4M7DF 2NUTB 3EGUA 3QSUA 3I56Q 2GTOA 3SD4A 2DYIA 3NTIA 4JZ4A 1QVFS 1OULA 4EDUA 2PUKB 1JJ2P 4R56A 4M75G 3JB9G 2XI9A 1QW1A 2NWMA 2VGNA 1VIEA 5LJ5e 1VQ7A 4DEYA 2RJEA 2RHUA 1YBYA 4KBMB 2QI2A 2RI5A 2E70A 1D1BA 3CC2A 2A36A 1JXOA 1U06A 1K4US 1UGSB 5LJ3j 2CT3A 2J7IA 5LJ3h 1O75A 1YJWA 5KYUB 1K8AU 2CZ6B 1M3AA 2DIGA 1G3WA 1QCNA 1Q82C 1Q86C 1HSQA 2LVMA 2FRWA 3L42A 2RHYA 2CSQA 2EGEA 4V2SA 2D0NA 3CCRT 1BIBA 3RERA 1TSFA 1SF9A 1MNEA 1B07A 3FLGA 2KT8A 2CYZB 3MPUB 3UA7A 3PTAA 5KYXB 3JCMg 4C5IA 3VS6A 5GAOp 3M0TA 3ER0A 3I56T 4FL6A 3CBOA 5DY9A 1YJ9T 1RAFB 4M78E 3ZL7C 5KH6A 4X34A 2NUPA 2ZPEB 1TUCA 2QA4T 3LH5A 2F5KA 2KAFA 3HHTB 4LUDA 1JO8A 4E7SA 3MCAB 4Y28E 3QDFA 1I81A 2ED1A 1YJNA 2EQMA 2QEXQ 2C0TA 1AD5A 3CMEA 2JVVA 3CXCA 1HXDA 4LXCA 1MMNA 1RI9A 2CT4A 1VYUA 1X6BA 2JMAA 2WSEE 1BBZA 2LP5A 5D7UA 5FWBA 1QCFA 4AFQC 4QVCA 4ELZC 2GF7A 3OS5A 1PHTA 1N8RC 1W2BA 1I5LA 1ZBJA 3EAEA 4RMOA 2KRNA 3CC4T 2JZ2A 5ECAA 3CCLQ 2DLPA 1KC8C 3F70A 1VQ7Q 1N5ZA 3QYGB 3VV0A 4J9FA 1PSEA 3PNWC 4OMMA 1YWPA 1U3OA 3UT1A 2RK1A 4KULA 3AT1B 4OF1A 3HL8A 1M8MA 1Y57A 3VS0A 2QGGA 2FZCB 5J26A 3QO3A 3REAB 2K7AA 1Y71A 5GAN6 3MKDA 2LJ0A 2F2WA 1M27C 3LYIA 3CD6T 2YUOA 2IIMA 3SWNB 2DK3A 1VQLA 2IG0A 2KYMA 3H0IA 5GANf 4BDZA 3JB9D 1QMCA 3LGLA 4E6RA 1X6GA 2DE0X 3VUBA 4FSXA 4MZPA 5IN1A 3SEMA 2CZ1B 3CCJQ 2A0FB 1QVGS 1UECA 3EGDA 5HK0A 2YLCA 3H0FA 3EG0A 3PE0A 1K8AC 1K0XA 2OAWA 2EW3A 2KXDA 4C92F 4F7UA 2KMTA 1VYTA 3GNFB 2HSEB 2NUPB 1TTHB 2RQWA 1M3BA 4QQ6A 2PUOB 1VQ5Q 4ANJA 3PFSA 4MDXA 3H8ZA 1HK9A 2V8JA 3G6EA 4RCCA 3CCLT 4PJMA 2EKOA 4Y91A 1UGQB 5I2MA 3H6ZA 1VQ9T 3EGXB 4EPCA 2F5TX 4HVUA 2P0QA 4OB1B 3J80E 2EGAA 3DB3A 4FYXB 2RH2A 2YDLA 2HZYA 3GP8A 4M7DG 3EGDB 2KYBA 4PK4A 1M8VA 2ZPHB 5GMKj 2DL8A 3RDVA 1TUDA 3CCQT 4R0KA 4JJCA 1VQ5T 4HT9A 1OYXA 4OB3B 5GMKi 4J9IA 4M7DB 4FW2A 5GMKl 2QQ9A 4FM4B 3OY9A 4HCCA 2OX7A 3FRNA 5HCKA 2D1XA 2KNBB 4DOVA 5GAMh 1AZEA 8AT1B 3CCRQ 2DVJA 2EJFA 3PVLA 3M54A 3OW2A 3TREA 3V8JA 2R58A 2EYWA 4KRTA 1MGQA 5EG2A 4PJOD 1D0YA 1RLPC 4QQGA 3CMAT 5LJ3e 1YIJQ 4PJOC 2O4XA 3ZFJA 2DIQA 3M9QA 1TG0A 5GAMe 1SG5A 2B8AA 3FB9A 3G7ZA 3SWNA 2DRMA 5FW9A 3M4YA 2KEAA 4FSSA 1NJIC 2HD0A 5LJ5j 4LD6A 1VQ9A 3NTKA 2EPDA 1P92A 2DKGA 4TVRA 3P8HA 3M5AA 2CKKA 4RTWA 4B9WA 3G4SA 3HKSA 3PIPA 1KQSS 1A0NB 2COZA 2L3SA 4Z88A 1FMVA 3SB2A 1QKXA 2OTLT 2RK2A 1YITT 2FEIA 4MDWA 3M0SA 3JCMV 3CC4A 3C94A 1AWOA 3O5ZA 1QLYA 1BI1A 3CCVT 1J3TA 1IGQA 3EG9B 2EIFA 4FCYA 2RJFA 2V1QA 1D1CA 4AG1C 5CKHA 4LDUA 2DO3A 2QEXT 3ME9A 4EMKB 2BUDA 3CCUQ 3QBYA 3M59A 5EC7A 2K9GA 3OA6A 4EMKC 2RHXA 3X20B 3UATA 3CCEA 1YHQQ 5GAMj 4M7AF 3BDUA 1PD0A 2FHDA 3CEYA 4IUPA 4X1VA 2RF0A 2XHCA 3I5SA 1KQSP 4CI0C 2QTXA 1VQPA 4QQDA 2KK4A 5D6XA 3CCUT 3L2WA 1UHFA 4RTZA 1M90U 3X24B 4NL2A 1VQKA 2X3WD 4A4FA 3DLMA 1E7OA 2LT1A 1R8OB 3GNGA 3C12A 1V76A 1I5OB 1ZSGA 4BI3A 4OMQA 2FVUA 1E6GA 2EKHA 3JV3A 1S1NA 2HBPA 1SHGA 3OYGA 4II1A 3ULRB 1VQNT 2VYTA 5A0GA 1K0SA 1TXQA 4XTXA 2M02A 2AZSA 4JUVA 1M9SA 4FT2A 4LD9K 1MMGA 4M78B 3CD6A 4PFOA 2VB6A 1K76A 2QTVA 5I22A 1BK2A 2L3QA 3M58A 2GTJA 3CCJA 4CRIA 3L1AA 2HCKA 3CC7Q 1IZ6A 2I0NA 2CREA 2BTTA 2KDSA 4C8QA 4JJDA 5KYYA 4M7AG 4PJOE 2OAUA 1AOJA 2H8HA 3TSZA 2ROLA 1M3CA 1TU0B 1NJIU 1XTDA 1UUEA 1Y7XA 5CKEA 2O31A 1EIFA 2O4XB 1JJ2S 1QVFA 2DTOA 2RQVA 1GCQA 2LNVA 4E47A 1AT1B 2L5QA 1GBQA 1YITA 1VQ4Q 1YP5A 2YXYA 3QXEB 3WXMB 1QVPA 2EQIA 3VUZA 2EGCA 5A2QE 2GBQA 1EZZB 3RNJA 1W6XA 2FPDA 3OS1A 2CGHA 3CMAQ 2YUNA 4XTWA 1GCQC 3QHSA 4C92D 2IPOB 5LL6S 2HNIA 2JTMA 4OB0B 3T9NA 3LWIA 2GGRA 4PJLA 1JB0E 1I1JA 1Z9QA 1MUZA 3J7AF 1ZUYA 1UG1A 1PKSA 2RHZA 1VQ4T 1N9RA 3EHRA 3QIIA 3VS3A 3VJPA 3M0QA 4YTLA 1N8RR 2Y4YA 4EMHA 2DEQA 2QDLA 1VYVA 1LOJA 2JS2A 2QQRA 5IH2A 2DL4A 1VQ7T 4XU0A 2XDPA 1CKBA 1JQQA 3EGXA 1B34A 3OMCA 4JS4A 3MJXA 1NE8A 4QT7A 1M1KR 4VUBA 2GNCA 2RQTA 2GFAA 1WX6A 4XTYA 3CPFA 4C0FA 1YITQ 5CKDA 2QGFB 1WHKA 2CS7A 5CQYA 5KE2A 4F17A 4OGCA 1VQMT 2XU8A 4RTYA 2K2VA 3SWNC 2V8IA 2HKQB 1M5Q1 4HCBA 3CCVQ 1JEGA 4IUTA 2XK0A 1BCMA 1UJYA 2EJ9A 3EG1A 1JJ2A 3CC7A 4WTOB 1WIEA 1M2OA 2FL7A 2KVQG 2O88A 1JRIA 3URGA 2RI2A 1QCOA 3QJ6A 4LNPA 4XTUA 5C0MA 1VQOT 4HVWA 4PJNA 2VXFA 4N4HA 5FLXE 3G1JA 4E7KA 1QVGA 3G6ET 2R5AA 4F7UE 4M7AC 4C8QG 2RB6A 1HYOA 3LGFA 5I11A 1VQKT 1X75C 1WHMA 5GMKe 4M7AD 5FROA 4IURA 5CR2A 4FIBA 3G6EQ 1S72A 1G8XA 4ATOA 2XDBA 4C92B 1CSKA 2KE9A 4J6XA 1R0BG 3C95A 2ZGWA 5IXFA 3V7RA 2OI3A 3WVDB 4K11A 4F16A 4FW1A 1YI2Q 5GANg 1WI7A 2DBMA 4NL3A 2WACA 2HAXA 1E6HA 1X2KA 2DMOA 4M77B 2CUDA 3M0UA 2BZXA 1QWEA 3OYNA 2PVDB 3HRSA 3X26B 1T3SA 4JDSA 2AHJB 4D8KA 2J05A 1YWOA 3TQ7P 2PVGB 1LJOA 1YIJT 4F14A 1VQNA 1ARKA 4B6MA 4X9DA 1RAEB 2E4HA 5IXBA 3BY7A 1VQ8Q 1WGSA 2DJQA 3BFMA 3V7SA 2XD0A 5FU6C 2D6FA 3UWNA 2X3XD 3VRZA 3OYDA 1RI0A 4RTXA 1OZ2A 3SFMA 1RACB 2LRQA 2VC8A 3VU3C 2KI7A 5GMKm 1MMAA 3M56A 4RTVA 3JCMQ 3TVTA 2X4WA 1KC8U 2KGTA 1C1AA 1K9MC 1IHWA 2VVKA 2YT6A 2JT4A 4D8DA 2JN0A 1OPKA 3VS4A 4XQ3A 2CP7A 2CSIA 6AT1B 2WSFE 4EIKA 3NGPA 9ATCB 1IRXA 4C5EA 2K57A 1G3TA 5CCAA 1PRLC 1D3BA 4LDXA 1Q95G 2R5MA 3KUFA 1NG2A 4JRPA 1VQ5A 2DZ9A 1WQ7A 1WZOA 4IUUA 3OW2P 2DBKA 3JCMW 2MYSA 3MEAA 2X35A 3QDRB 4C0ZA 1M90C 1NBEB 1ZQ1A 2DILA 2J06A 2CZ0B 1W4SA 2RN8A 3GLXA 1D0XA 4AG2C 2E65A 4C8QD 2HEQA 3P8DA 5J3BA 2DF6A 5AT1B 2VUBA 3QUIA 4BB7A 3VS2A 1OI1A 2LJ1A 2AKLA 4M77E 2BE7D 2KR3A 3MP1A 1M90R 1VQ6A 1LVKA 3KXTA 1M1KU 3FDRA 4LUEA 1VQMQ 1C6VX 4C0DC 3A8OB 3JCMh 1WPYA 2EJGA 2HQHA 4GBQA 4M7AB 1BI3A 1PC0A 2KT1A 3EFOA 3QJYA 3E19A 1OV3A 2M0YA 5DLOA 1SEMA 1RAGB 2O9SA 4M75E 4FYWB 4XTZA 1YJNT 2HL3A 4M78G 4HXJA 2RQUA 5GAMd 3GOXA 4FT4A 1G3YA 2E3HA 2DL7A 4A63B 3OS2A 4J5YA 5KYUA 1DJ7B 2LZ6B 2RJDA 3JSCA 1M2VA 3X28B 1I4K1 2ZPIB 3QG1A 5M9OA 3QZ9B 4PJOB 3PGGA 2AZVA 2V26A 4M7AA 4XAXB 3QKJA 3HFNA 3SDZA 1YJNQ 2YRDA 5D6YA 1ZSZC 1YI2A 2BKDN 1NPRA 1FX7A 1U5SA 2JTFA 2CDTA 4KGXB 2DZCA 1TH7A 4OMOA 2FPFA 5LJ5f 5IHIA 5KYWB 4E7JA 2G3RA 4DOWA 1AEYA 2JTEA 4RG8A 4ZN3A 4IIMA 2ZAEA 2CP2A 1Y96B 1I8FA 2NUTA 1SHFA 3TCJA 5KYNA 1QP2A 4KUDK 4JJBA 3CCUA 4R55A 2YRCA 2ZCFB 1OU8A 5GAN8 3OYIA 2LCLA 3S3OA 2AIRB 1JXMA 1W2BS 2OTLA 2EFIA 2D9TA 3CCQQ 5GAN4 1FMWA 3RBBB 1HJDA 3QPHA 4J9HA 1NEBA 4RG2A 3C0CA 5FU6B 4ELYC 1UTIA 1Q81C 2A3LA 3NTHA 4DBFA 1QVFP 3X25B 2E41A 4ZGJB 2A37A 2LCSA 4IIOA 4RKUE 4IUVA 4J8OA 3INZA 1VQ8T 2SEMA 2LQ8A 3E2UA 4F7UG 1KK7A 1VIFA 4E7LA 4C8QE 1RLQC 2F69A 4M77C 1K73C 4HKEA 1OPLA 1TOVA 4KT0E 1RUWA 1PSFA 2ABLA 3A5ZB 1OX8A 2DRKA 4HT8A 4QVDA 1EFNA 2JW4A 2NLUA 4M78A 1YJWT 4M7DA 3QZ5B 1WJQA 3EH2A 1ZSZB 4M77A 2HQEA 2L3PA 2MMPA 1FMKA 3CCVA 2KBTA 4RTTA 4Z89A 3JB9H 1V29B 2ED0A 4M78C 1NYFA 3S6WA 5I2SA 1SRLA 4X9CA 5C6SA 2AK5A 3O8VA 5A0DA 2DXUA 2LMJA 2OTLQ 4ZGEB 3BDLA 4AFUC 4M78D 2DL5A 2E1HA 3CXCS 1OZ3A 1GXIE 1IHVA 1WA7A 3THKA 3M4GA 2FO0A 2M16A 2FB7A 1TS9A 1VQ4A 1NJIR 1C0MA 1N9SA 3JAME 1SKUB 3OYHA 3OS0A 2JJ9A 1UJ0A 1CKAA 3CPWA 2JNGA 2SRCA 2QXFA 2HL5C 2RMOA 3MHXA 3RMSA 2OTJA 3G71A 5FWCA 1F1BB 4OVAA 1NM7A 2QEXA 2XMFA 2K5LA 2QK0A 3EHQA 4PNOA 1YJWQ 1VUBA 3JCMX 3EG9A 4XTVA 2BIVA 1AWXA 3RKXA 2CH4W 4JLGA 1OU9A 5CKFA 3OBYA 1G2BA 4LN2A 4ZTFA 4DQ2A 3OMGA 4KH0B 4J7IA 4KH1B 2DERA 4PLLA 3PVQA
chains in the Genus database with same CATH topology
1N5ZA 5IHNA 4J9FA 4OMMA 1YWPA 1U3OA 5I11A 1XOVA 2KRSA 1NYGA 2JXBA 3EG3A 3NHNA 1M8MA 2VWFA 4RTUA 1Y57A 2K3BA 1W70A 3VS0A 2O9VA 1WLPB 2B86A 3REAB 2DM1A 2J6FA 2K7AA 2LJ0A 1Y0MA 2F2WA 1M27C 4ORZA 2YUOA 2IIMA 4OMLA 1ABQA 2KYMA 3H0IA 2ENMA 3R6NA 2V1RA 4E6RA 1X6GA 2KXCA 1CSKA 1BB9A 2DX1A 2DE0X 2KE9A 1OEBA 3EG2A 4ESRA 5IXFA 3SEMA 2ESWA 2OI3A 4F16A 4K11A 1UECA 3SHWA 5GJWB 1HD3A 3H0FA 1WI7A 2DBMA 3EG0A 2F2XA 3PE0A 2L2PA 2C0IA 1SRMA 1E6HA 1K0XA 1X2KA 1GFCA 2DMOA 2EW3A 2OAWA 2LQNA 2KXDA 1X2QA 1UE9A 2CUDA 3M0UA 2BZXA 2LNHB 1QWEA 1VYTA 2BZYA 1PWTA 1T3SA 2RQWA 1M3BA 4D8KA 2J05A 2A28A 1YWOA 1WDXA 3I5RA 4F14A 2EYXA 1ARKA 5ECAA 1M30A 1T3LA 5IXBA 1X69A 2W10A 2DJQA 4HVUA 1MV3A 2OJ2A 2EGAA 2YDLA 3UF4A 2RQRA 2X3XD 4CC2A 3VRZA 2PZ1A 2K6DA 4RTXA 2KYBA 2DL8A 1TUDA 2EYYA 4RTVA 4R0KA 4JJCA 2FRYA 3TVTA 4DEXA 2JS0A 4J9IA 3FJ5A 2KGTA 2VVKA 2YT6A 2JT4A 4J9CA 5IHKA 4D8DA 3VS4A 1K9AA 1OPKA 2YUQA 3H41A 3QWXX 5HCKA 2D1XA 2KNBB 1H92A 2CSIA 1AZEA 1AWWA 1MV0B 2E5KA 4EIKA 2DVJA 3NGPA 4AFSC 3PVLA 1H3HA 1B3QA 3CQTA 2EBPA 1PRLC 1YCSB 2EYWA 4KRTA 1ZLMA 2FG0A 1NLPC 1PNJA 1NG2A 2YSQA 1RLPC 4WCIA 2LJ3A 2DBKA 3NMZC 1WFWA 1ZUKA 3IQLA 2LX7A 1BU1A 1TG0A 1GFDA 2DRMA 2DILA 2J06A 5FW9A 2KEAA 2RN8A 4FSSA 4OMNA 3H0HA 4AG2C 1X43A 1LCKA 2JMCA 2HEQA 1NLOC 2EPDA 2W0ZA 1GCPA 2C0OA 2DF6A 4RTWA 3VS5A 3VS2A 2LJ1A 2MIOA 4J9EA 2AKLA 1A0NB 4JPBW 2L3SA 3UA6A 4Z88A 2KR3A 1QKXA 4HVVA 2CH4A 1GRIA 2FEIA 2A08A 2ECZA 3M0SA 4LUEA 1AVZC 1AWOA 3O5ZA 2NUZA 2JM9A 3QWYA 1QLYA 1J3TA 1AWJA 1T0HA 1V1CA 2V1QA 4GBQA 4GLMA 4AG1C 2EVRA 2KT1A 2K2MA 4CC4B 1WXTA 2PNIA 1OV3A 2M0YA 2DNUA 1SEMA 1KSWA 2D8JA 2O9SA 2CUBA 2K9GA 5EC7A 1H8KA 2F2VA 3REBB 3GBQA 3NPFA 3UATA 4HXJA 2K79A 2RQUA 1I0CA 2VKNA 2DL7A 4A63B 4X1VA 3VRYA 4OMPA 2LZ6B 2RF0A 3I5SA 2HSPA 1YN8A 2M51A 1AZGB 2RPNA 1UHFA 2D8HA 4RTZA 2AZVA 2G6FX 2J6OA 2X3WD 4Y92A 1QKWA 2EYZA 1E7OA 2P4RA 1ZSGA 4J9DA 1KFZA 4OMQA 1UDLA 2DYBA 1K1ZA 1E6GA 2EKHA 1U5SA 1S1NA 3JV3A 1UHCA 2JM8A 4HCKA 4M4ZA 1SHGA 2CDTA 1GL5A 3ULRB 4OMOA 2FPFA 2L0AA 5IHIA 3A98A 1K0SA 1OOTA 3I9QA 4JZ3A 1AEYA 2GQIA 2JTEA 1X27A 2AZSA 4IIMA 1SSHA 1T0JA 3M0PA 1SHFA 2FPEA 5GJVB 1K76A 1QWFA 4JJBA 5I22A 2RNAA 1GBRA 1BK2A 2L3QA 4J9GA 2GTJA 2DA9A 4AFZC 1Z9ZA 2HCKA 3U23A 1JXMA 2I0NA 2CREA 1W1FA 4CC3A 2BTTA 2MCNA 4JJDA 1AOJA 3RBBB 2H8HA 3M0RA 1HJDA 4RUGA 2O2OA 3VS7A 4J9HA 1JU5C 1NEBA 3TSZA 2PTKA 2AKKA 1WXUA 1M3CA 1ZX6A 2J6KA 2ROLA 3C0CA 1UUEA 3EGUA 1UTIA 2MOXA 2GTOA 2O31A 4JZ4A 1PKTA 2ROTA 2RQVA 1GCQA 2A37A 2LCSA 4IIOA 2SEMA 2KRMA 1GBQA 2NWMA 2BZ8A 1G83A 1RLQC 1YP5A 1KJWA 2EQIA 2EGCA 2GBQA 4DEYA 2LQWA 1OPLA 1FYNA 3RNJA 1RUWA 1W6XA 2FPDA 2A36A 2YUNA 1JXOA 1GCQC 2ABLA 1U06A 2DRKA 1WYXA 1K4US 1VA7A 1EFNA 2GGRA 2CT3A 2JW4A 2J7IA 1ZUUA 1WXBA 1I1JA 1Z9QA 1MUZA 1ZUYA 4ZNXA 1UG1A 2HBWA 1PKSA 1PRMC 1M3AA 2YUPA 2L3PA 3EHRA 3VS3A 4J9BA 1HSQA 3M0QA 2FRWA 1FMKA 1SPKA 2KBTA 2CSQA 2EGEA 4RTTA 4Z89A 2D0NA 2QDLA 5L23A 1VYVA 2KROA 2JS2A 5IH2A 2DL4A 2ED0A 1B07A 1NYFA 1SRLA 1CKBA 1JQQA 2KT8A 3UA7A 2AK5A 4QT7A 3VS6A 2GNCA 2RQTA 1WX6A 3M0TA 2LMJA 4AFUC 2DL5A 1YNZA 3ZL7C 1WA7A 3THKA 2FO0A 1TUCA 1KIKA 3LH5A 4F17A 1UFFA 4RTYA 4LUDA 1JO8A 1ABOA 1UJ0A 1CKAA 3I35A 4LE9A 4Z8AA 1JEGA 2SRCA 2HDAA 2ED1A 2RMOA 1I07A 1UJYA 5FWCA 2C0TA 1AD5A 3EG1A 4CC7A 1NM7A 1UGVA 1RI9A 1WIEA 2CT4A 2XMFA 3VS1A 1VYUA 1IO6A 1X6BA 2JMAA 3EHQA 2O88A 1BBZA 2LP5A 5FWBA 1QCFA 4AFQC 1AWXA 2CH4W 4LNPA 1PHTA 4HVWA 1ZBJA 1G2BA 2KRNA 4LN2A 1NEGA 3KFVA 3TSWA 2DL3A 3PVQA 2DLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5Z A;  5IHN A;  4J9F A;  4OMM A;  1YWP A;  1U3O A;  5I11 A;  1XOV A;  2KRS A;  1NYG A;  2JXB A;  3EG3 A;  3NHN A;  1M8M A;  2VWF A;  4RTU A;  1Y57 A;  2K3B A;  1W70 A;  3VS0 A;  2O9V A;  1WLP B;  2B86 A;  3REA B;  2DM1 A;  2J6F A;  2K7A A;  2LJ0 A;  1Y0M A;  2F2W A;  1M27 C;  4ORZ A;  2YUO A;  2IIM A;  4OML A;  1ABQ A;  2KYM A;  3H0I A;  2ENM A;  3R6N A;  2V1R A;  4E6R A;  1X6G A;  2KXC A;  1CSK A;  1BB9 A;  2DX1 A;  2DE0 X;  2KE9 A;  1OEB A;  3EG2 A;  4ESR A;  5IXF A;  3SEM A;  2ESW A;  2OI3 A;  4F16 A;  4K11 A;  1UEC A;  3SHW A;  5GJW B;  1HD3 A;  3H0F A;  1WI7 A;  2DBM A;  3EG0 A;  2F2X A;  3PE0 A;  2L2P A;  2C0I A;  1SRM A;  1E6H A;  1K0X A;  1X2K A;  1GFC A;  2DMO A;  2EW3 A;  2OAW A;  2LQN A;  2KXD A;  1X2Q A;  1UE9 A;  2CUD A;  3M0U A;  2BZX A;  2LNH B;  1QWE A;  1VYT A;  2BZY A;  1PWT A;  1T3S A;  2RQW A;  1M3B A;  4D8K A;  2J05 A;  2A28 A;  1YWO A;  1WDX A;  3I5R A;  4F14 A;  2EYX A;  1ARK A;  5ECA A;  1M30 A;  1T3L A;  5IXB A;  1X69 A;  2W10 A;  2DJQ A;  4HVU A;  1MV3 A;  2OJ2 A;  2EGA A;  2YDL A;  3UF4 A;  2RQR A;  2X3X D;  4CC2 A;  3VRZ A;  2PZ1 A;  2K6D A;  4RTX A;  2KYB A;  2DL8 A;  1TUD A;  2EYY A;  4RTV A;  4R0K A;  4JJC A;  2FRY A;  3TVT A;  4DEX A;  2JS0 A;  4J9I A;  3FJ5 A;  2KGT A;  2VVK A;  2YT6 A;  2JT4 A;  4J9C A;  5IHK A;  4D8D A;  3VS4 A;  1K9A A;  1OPK A;  2YUQ A;  3H41 A;  3QWX X;  5HCK A;  2D1X A;  2KNB B;  1H92 A;  2CSI A;  1AZE A;  1AWW A;  1MV0 B;  2E5K A;  4EIK A;  2DVJ A;  3NGP A;  4AFS C;  3PVL A;  1H3H A;  1B3Q A;  3CQT A;  2EBP A;  1PRL C;  1YCS B;  2EYW A;  4KRT A;  1ZLM A;  2FG0 A;  1NLP C;  1PNJ A;  1NG2 A;  2YSQ A;  1RLP C;  4WCI A;  2LJ3 A;  2DBK A;  3NMZ C;  1WFW A;  1ZUK A;  3IQL A;  2LX7 A;  1BU1 A;  1TG0 A;  1GFD A;  2DRM A;  2DIL A;  2J06 A;  5FW9 A;  2KEA A;  2RN8 A;  4FSS A;  4OMN A;  3H0H A;  4AG2 C;  1X43 A;  1LCK A;  2JMC A;  2HEQ A;  1NLO C;  2EPD A;  2W0Z A;  1GCP A;  2C0O A;  2DF6 A;  4RTW A;  3VS5 A;  3VS2 A;  2LJ1 A;  2MIO A;  4J9E A;  2AKL A;  1A0N B;  4JPB W;  2L3S A;  3UA6 A;  4Z88 A;  2KR3 A;  1QKX A;  4HVV A;  2CH4 A;  1GRI A;  2FEI A;  2A08 A;  2ECZ A;  3M0S A;  4LUE A;  1AVZ C;  1AWO A;  3O5Z A;  2NUZ A;  2JM9 A;  3QWY A;  1QLY A;  1J3T A;  1AWJ A;  1T0H A;  1V1C A;  2V1Q A;  4GBQ A;  4GLM A;  4AG1 C;  2EVR A;  2KT1 A;  2K2M A;  4CC4 B;  1WXT A;  2PNI A;  1OV3 A;  2M0Y A;  2DNU A;  1SEM A;  1KSW A;  2D8J A;  2O9S A;  2CUB A;  2K9G A;  5EC7 A;  1H8K A;  2F2V A;  3REB B;  3GBQ A;  3NPF A;  3UAT A;  4HXJ A;  2K79 A;  2RQU A;  1I0C A;  2VKN A;  2DL7 A;  4A63 B;  4X1V A;  3VRY A;  4OMP A;  2LZ6 B;  2RF0 A;  3I5S A;  2HSP A;  1YN8 A;  2M51 A;  1AZG B;  2RPN A;  1UHF A;  2D8H A;  4RTZ A;  2AZV A;  2G6F X;  2J6O A;  2X3W D;  4Y92 A;  1QKW A;  2EYZ A;  1E7O A;  2P4R A;  1ZSG A;  4J9D A;  1KFZ A;  4OMQ A;  1UDL A;  2DYB A;  1K1Z A;  1E6G A;  2EKH A;  1U5S A;  1S1N A;  3JV3 A;  1UHC A;  2JM8 A;  4HCK A;  4M4Z A;  1SHG A;  2CDT A;  1GL5 A;  3ULR B;  4OMO A;  2FPF A;  2L0A A;  5IHI A;  3A98 A;  1K0S A;  1OOT A;  3I9Q A;  4JZ3 A;  1AEY A;  2GQI A;  2JTE A;  1X27 A;  2AZS A;  4IIM A;  1SSH A;  1T0J A;  3M0P A;  1SHF A;  2FPE A;  5GJV B;  1K76 A;  1QWF A;  4JJB A;  5I22 A;  2RNA A;  1GBR A;  1BK2 A;  2L3Q A;  4J9G A;  2GTJ A;  2DA9 A;  4AFZ C;  1Z9Z A;  2HCK A;  3U23 A;  1JXM A;  2I0N A;  2CRE A;  1W1F A;  4CC3 A;  2BTT A;  2MCN A;  4JJD A;  1AOJ A;  3RBB B;  2H8H A;  3M0R A;  1HJD A;  4RUG A;  2O2O A;  3VS7 A;  4J9H A;  1JU5 C;  1NEB A;  3TSZ A;  2PTK A;  2AKK A;  1WXU A;  1M3C A;  1ZX6 A;  2J6K A;  2ROL A;  3C0C A;  1UUE A;  3EGU A;  1UTI A;  2MOX A;  2GTO A;  2O31 A;  4JZ4 A;  1PKT A;  2ROT A;  2RQV A;  1GCQ A;  2A37 A;  2LCS A;  4IIO A;  2SEM A;  2KRM A;  1GBQ A;  2NWM A;  2BZ8 A;  1G83 A;  1RLQ C;  1YP5 A;  1KJW A;  2EQI A;  2EGC A;  2GBQ A;  4DEY A;  2LQW A;  1OPL A;  1FYN A;  3RNJ A;  1RUW A;  1W6X A;  2FPD A;  2A36 A;  2YUN A;  1JXO A;  1GCQ C;  2ABL A;  1U06 A;  2DRK A;  1WYX A;  1K4U S;  1VA7 A;  1EFN A;  2GGR A;  2CT3 A;  2JW4 A;  2J7I A;  1ZUU A;  1WXB A;  1I1J A;  1Z9Q A;  1MUZ A;  1ZUY A;  4ZNX A;  1UG1 A;  2HBW A;  1PKS A;  1PRM C;  1M3A A;  2YUP A;  2L3P A;  3EHR A;  3VS3 A;  4J9B A;  1HSQ A;  3M0Q A;  2FRW A;  1FMK A;  1SPK A;  2KBT A;  2CSQ A;  2EGE A;  4RTT A;  4Z89 A;  2D0N A;  2QDL A;  5L23 A;  1VYV A;  2KRO A;  2JS2 A;  5IH2 A;  2DL4 A;  2ED0 A;  1B07 A;  1NYF A;  1SRL A;  1CKB A;  1JQQ A;  2KT8 A;  3UA7 A;  2AK5 A;  4QT7 A;  3VS6 A;  2GNC A;  2RQT A;  1WX6 A;  3M0T A;  2LMJ A;  4AFU C;  2DL5 A;  1YNZ A;  3ZL7 C;  1WA7 A;  3THK A;  2FO0 A;  1TUC A;  1KIK A;  3LH5 A;  4F17 A;  1UFF A;  4RTY A;  4LUD A;  1JO8 A;  1ABO A;  1UJ0 A;  1CKA A;  3I35 A;  4LE9 A;  4Z8A A;  1JEG A;  2SRC A;  2HDA A;  2ED1 A;  2RMO A;  1I07 A;  1UJY A;  5FWC A;  2C0T A;  1AD5 A;  3EG1 A;  4CC7 A;  1NM7 A;  1UGV A;  1RI9 A;  1WIE A;  2CT4 A;  2XMF A;  3VS1 A;  1VYU A;  1IO6 A;  1X6B A;  2JMA A;  3EHQ A;  2O88 A;  1BBZ A;  2LP5 A;  5FWB A;  1QCF A;  4AFQ C;  1AWX A;  2CH4 W;  4LNP A;  1PHT A;  4HVW A;  1ZBJ A;  1G2B A;  2KRN A;  4LN2 A;  1NEG A;  3KFV A;  3TSW A;  2DL3 A;  3PVQ A;  2DLP A; 
#chains in the Genus database with same CATH topology
 3BW1 A;  4O6J A;  5IHN A;  2LCC A;  2DFU A;  1N6A A;  2X4J A;  2KRS A;  1NYG A;  1FXX A;  2JXB A;  5CVI A;  3OW2 S;  2VV5 A;  3EG3 A;  2M9U A;  1R0C B;  2VWF A;  2K3B A;  1W70 A;  4EMG A;  3C4S A;  1Q82 R;  2ATC B;  1Q86 R;  2E3I A;  4E7Z A;  2B86 A;  2DM1 A;  2PQW A;  2AT1 B;  3HTR A;  2H3E B;  2VAS A;  4O5V A;  2P4T A;  4ORZ A;  4OP0 A;  3HSB A;  3R6N A;  2V1R A;  3OYK A;  2DXC A;  2JUF A;  4JJN K;  4JRI A;  4M77 F;  1BB9 A;  4BE2 A;  2H3J A;  2Y4X A;  3S3M A;  4PJO F;  3EG2 A;  4ESR A;  5IAY A;  4J7F A;  4PJJ A;  1BI0 A;  3I55 T;  1WHH A;  3SHW A;  5GAN 5;  4BY6 B;  1OQK A;  5LJ5 d;  3VYG A;  2C0I A;  1WHG A;  4JRQ A;  2FZG B;  4OB2 B;  5LJ3 g;  2LQN A;  3CBP A;  1X2Q A;  3JCM e;  1JBM A;  3GF5 A;  5GMK h;  2QA4 A;  2A28 A;  1WDX A;  3I5R A;  1KQS A;  1AHJ B;  1KD1 U;  1M30 A;  5GAN 3;  4A4K A;  2RM4 A;  3OYF A;  3HP9 A;  3I55 Q;  1X69 A;  4J6Y A;  4WF2 A;  1YI2 T;  1MV3 A;  2OJ2 A;  2YRV A;  4OGE A;  3RUX A;  3J81 E;  3G71 Q;  2A7Y A;  4CC2 A;  3RR6 A;  2PZ1 A;  2K6D A;  5CKB A;  1QP3 A;  4Z02 A;  3OYB A;  1K8A R;  2EYY A;  4M75 F;  1ZHI A;  1BCO A;  4C92 A;  2QAZ A;  2RJC A;  4F7U F;  2JS0 A;  2GQV A;  2FYK A;  5GAN e;  5HK3 A;  5IHK A;  2YUQ A;  2D0Q B;  3JCM f;  2MPX C;  4DBQ A;  2E5K A;  1ACM B;  1TWB A;  2MWP A;  1H3H A;  2Y90 A;  3JCM c;  1Y07 A;  2EBP A;  4C92 C;  4L5G A;  1O9S A;  1ZLM A;  2C06 A;  5HKC A;  1NLP C;  2YSQ A;  4AT1 B;  2CP5 A;  4WCI A;  1XNI A;  3OYC A;  4DBH A;  3OYL A;  1VQ8 A;  2COW A;  4LDV A;  3NMZ C;  4ME7 A;  3KBG A;  1NPP A;  2P0P A;  4PLI A;  3JB9 I;  2LX9 A;  1VOM A;  1BU1 A;  3L2R A;  1BKB A;  1BYM A;  2X4Y A;  4OMN A;  3H0H A;  4FYY B;  1X43 A;  2JMC A;  2W0Z A;  4A4H A;  3M57 A;  1Q7Y R;  1GCP A;  1WHL A;  2OTJ T;  4PJO A;  3CME Q;  3E9F A;  1LNX A;  1M2V B;  1SSF A;  3EFR A;  4JPB W;  3UA6 A;  4QW2 A;  2MK5 A;  4HVV A;  1Q81 U;  4KGZ B;  1VQO Q;  2RA2 A;  1GRI A;  4M7D E;  4M75 B;  2A08 A;  2ECZ A;  4PFP A;  1RAI B;  3MP8 A;  5LJ5 h;  4MZM A;  1W2B P;  4J6W A;  2QA4 Q;  2NUZ A;  2V8K A;  3M55 A;  2JM9 A;  4L59 A;  2LTO A;  3P8B B;  1AWJ A;  3EFO B;  3JCM P;  1N27 A;  4GLM A;  1Q7Y C;  1VQK Q;  2EVR A;  1B34 B;  1BIA A;  2K2M A;  2PNI A;  3ASK A;  3VKI A;  5L8R E;  5IT9 E;  2LQK A;  1QVG P;  2D8J A;  2CUB A;  1H8K A;  2L8D A;  5GAO q;  4A4G A;  3NFC A;  2F2V A;  3REB B;  1VQ6 T;  3FC3 A;  3BE3 A;  3EH1 A;  1I0C A;  4FU6 A;  3CCM T;  2F1L A;  3VRY A;  2DXT A;  5FU7 B;  4IKF A;  4QKU A;  3L2Q A;  4OMP A;  3CC4 Q;  2Z0W A;  2ZPG B;  2EYQ A;  2RPN A;  4EMK A;  2NYS A;  2KQW A;  2D8H A;  4M7D D;  2G6F X;  2J6O A;  1QKW A;  2EYZ A;  2P4R A;  4J9D A;  1KFZ A;  1IXD A;  1X01 A;  1UDL A;  2DYB A;  1MHN A;  1Q82 U;  1Q86 U;  2K4Y A;  2JM8 A;  2DXB A;  4M4Z A;  2PVO B;  1GL5 A;  1RL2 A;  3OQ5 A;  3A98 A;  2KY9 A;  4C8Q C;  1X27 A;  1Q81 R;  3HRT A;  1SSH A;  5GAO m;  4E2F B;  1XJW B;  3CXC P;  2E6Z A;  2E64 A;  2FPE A;  4C92 E;  3RKW A;  2O01 E;  3LLR A;  3RKY A;  3M53 A;  3A8G B;  3MEU A;  4J9G A;  1UGR B;  4A53 A;  5GAO r;  3TEE A;  3G71 T;  3CBM A;  2P84 A;  4AFZ C;  3CCJ T;  1G3S A;  1FWZ A;  1ZBX A;  1VQL Q;  3U23 A;  2DD4 A;  2P0K A;  3V8L A;  4CC3 A;  2MWO A;  4HCZ A;  4RUG A;  3VS7 A;  3L2V A;  3JCM b;  2PTK A;  2AKK A;  1WXU A;  1ZX6 A;  4NS5 A;  2MOX A;  1R77 A;  2DTH A;  2YWW A;  4OMF B;  3S3N A;  1PKT A;  1Q7Y U;  3PMT A;  5GAM f;  5DM7 R;  3CCQ A;  2ROT A;  1D09 B;  1M1K C;  4UC4 A;  3QYH B;  3E1S A;  4DBR A;  2KRM A;  2RD1 A;  1KHI A;  3CPW P;  2BZ8 A;  1G83 A;  1KJW A;  3OYM A;  1EX4 A;  5GAN 2;  2LQW A;  2VXE A;  3H9N A;  2RI3 A;  1FYN A;  3OYJ A;  1TUG B;  1RAH B;  3RIR A;  1D0Z A;  1UB4 A;  4L6V 5;  3ZBD A;  1WYX A;  1VA7 A;  1ZUU A;  1WJS A;  1WXB A;  1Y96 A;  3DKM A;  1KD1 C;  2DEU A;  4JS5 A;  4ZNX A;  2E6N A;  2HBW A;  1PRM C;  2YUP A;  1NZ9 A;  2X4X A;  2MAM A;  4J9B A;  3JB9 J;  2K3X A;  1SPK A;  1K73 R;  2VGM A;  5L23 A;  2KRO A;  2OTJ Q;  3AHU A;  4JLI A;  2K3Y A;  2MF2 A;  4BY6 C;  1KQ2 A;  3CC2 Q;  2QQA A;  5GAN j;  2ZPF B;  3FJP A;  3ZEH A;  1M4Z A;  1YNZ A;  5CAI A;  3JCM J;  2LDM A;  1UGP B;  1KIK A;  3OYY A;  1WNL A;  1UFF A;  4M75 A;  4GLK A;  1ABO A;  1U1S A;  3I35 A;  4LE9 A;  4Z8A A;  2KSS A;  4C0G A;  2HDA A;  1I07 A;  1KQ1 A;  4M78 F;  4A54 A;  7AT1 B;  4AMC A;  3CC2 T;  1RAB B;  2M1H A;  4C0D B;  1PG5 B;  2QQS A;  4CC7 A;  1H3Z A;  2HKN A;  1U1T A;  1UGV A;  3JB9 F;  3VS1 A;  1IO6 A;  2EWN A;  3CCE Q;  2QYZ A;  3MP6 A;  5LJ3 f;  1VQ6 Q;  3FEO A;  3PIO A;  3I55 A;  4ZTJ A;  1U8R A;  2XDD A;  1NEG A;  3KFV A;  3CCM Q;  5GAN 7;  2E5Q A;  3MEV A;  3UDC A;  2LT4 A;  4XK8 E;  3TSW A;  2DL3 A;  3OSS C;  4E7I A;  1D1A A;  2XID A;  2GFU A;  3WVE B;  4N4I A;  4QVZ A;  4BE1 A;  4KGV B;  3RES A;  4C5H A;  1XOV A;  4FYV B;  4XU1 A;  1KD1 R;  2JOY A;  3NHN A;  3FIF A;  2IVW A;  5AYF A;  4RTU A;  1WHJ A;  1VQP T;  3G4S T;  2CP0 A;  2O9V A;  1WLP B;  4PJO G;  4M7A E;  3MET A;  2QG9 B;  1YJ9 A;  3HFO A;  2J6F A;  5CIU A;  2X9H A;  2L3R A;  1Y0M A;  1X6O A;  1G5V A;  1YHQ T;  2DJZ A;  4OML A;  3E9G A;  1ABQ A;  2ENM A;  3A1P A;  3OYA A;  2XIC A;  2KXC A;  2DX1 A;  3VYH B;  3D7S B;  1OEB A;  1RAD B;  3MEW A;  1VQ9 Q;  2ESW A;  4JRK A;  2DVE A;  3G4S Q;  3OB9 A;  3CMA A;  5D6W A;  5GJW B;  1HD3 A;  3Q1J A;  5J39 A;  2F2X A;  2L2P A;  1SRM A;  1GFC A;  1UE9 A;  4ZGD B;  2EQU A;  2LNH B;  4A4E A;  2BZY A;  1PWT A;  2CZ7 B;  2YHT A;  2I2L A;  5HY6 A;  2DTI A;  1VQN Q;  1OX9 A;  4C8Q F;  2DAQ A;  2EYX A;  5GAM g;  4BI8 B;  2EAY A;  3LH0 A;  1T3L A;  1M1F A;  3L2U A;  2W10 A;  3PT9 A;  3CPW S;  4F7U B;  5GAO l;  4MZT A;  3UF4 A;  2RQR A;  3A8H B;  1VQL T;  4IUQ A;  1VQP Q;  3CC7 T;  3UPU A;  4E7H A;  1KHC A;  2PU9 B;  2DET A;  3CME T;  2FRY A;  2GCX A;  4DA4 A;  4BI4 A;  4M7D C;  4DEX A;  4LDW A;  2QQB A;  3FJ5 A;  4B9X A;  5GAN d;  4J9C A;  3V7C A;  1K9A A;  3H41 A;  3HRU A;  3QWX X;  4BD3 A;  3CCR A;  2FZK B;  5KCO A;  1PD1 A;  4M77 D;  1H92 A;  1AWW A;  1MV0 B;  3R6O A;  4AFS C;  5CO7 A;  1B3Q A;  1PM3 A;  1RAA B;  3CQT A;  3A8M B;  3DLL A;  1YCS B;  4MML A;  2RHI A;  2FG0 A;  5KE3 A;  1PNJ A;  3V8K A;  4HA8 A;  2LJ3 A;  1MMD A;  5KYW A;  1IGU A;  1XQH A;  1WFW A;  1ZUK A;  3IQL A;  1YJ9 Q;  3LWH A;  2LX7 A;  3A8L B;  5GAO n;  5FU7 C;  1GFD A;  3JCM d;  4M75 D;  3OBW A;  1YCY A;  2L89 A;  4C8Q B;  5KYY B;  4BAC A;  1LCK A;  1YHQ A;  2XKO C;  3TU4 K;  2EQJ A;  1NLO C;  5KCH A;  2C0O A;  2CP3 A;  4Q5W A;  4XU3 A;  3VS5 A;  1WJR A;  1ZA2 B;  2MIO A;  4J9E A;  3CCM A;  5GAN h;  1H64 1;  4NOY A;  3I56 A;  1QQJ A;  2CH4 A;  2QDY B;  3CCE T;  1YIJ A;  2E10 A;  1AVZ C;  2COY A;  3OYE A;  3DB4 A;  1MND A;  2EQK A;  5CQX A;  2R57 A;  3QWY A;  5I21 A;  4M75 C;  1T0H A;  1VQO A;  1IRE B;  1V1C A;  1ZA1 B;  2CP6 A;  1BI2 A;  4P5N A;  4N4G A;  4PFZ A;  4BUG A;  4KUI A;  3EFS A;  4CC4 B;  1WXT A;  4F04 B;  1UEB A;  2DPP B;  2DNU A;  4D6W A;  1KG1 A;  4PL6 A;  3PMI A;  1KSW A;  5CK9 A;  1YFN A;  4GY5 A;  1WQW A;  5A0L A;  3GBQ A;  3GIB A;  3NPF A;  4C92 G;  3GPL A;  2K79 A;  2K5I A;  3RMQ A;  2VKN A;  1ZSZ A;  3JRZ A;  1K9M U;  3LW5 E;  1VQM A;  1KC8 R;  2LC4 A;  2HSP A;  5LJ3 d;  3CCS A;  2XG8 D;  1IB8 A;  1YN8 A;  2ZZD A;  1K9M R;  2M51 A;  1AZG B;  2X51 A;  4LDY A;  4PKC C;  1M1G A;  4RCB A;  5KYX A;  1B7T A;  2QAS A;  3HPW A;  3N5B B;  2MI6 A;  4Y92 A;  2HMA A;  4MMK A;  4BE0 A;  5FRN A;  2HQX A;  4J83 A;  2K5F A;  2BE9 B;  1K1Z A;  3OSV A;  4N0A C;  1UHC A;  1S72 T;  4HCK A;  2WSC E;  1PCX A;  3LX7 A;  3MO8 A;  3CCL A;  3L2Z A;  2L0A A;  1OOT A;  3I9Q A;  4JZ3 A;  3CCS T;  2GQI A;  3CD6 Q;  2YLB A;  2RO0 A;  1K73 U;  5LJ5 g;  4M77 G;  4ZN1 A;  1T0J A;  2M0O A;  3M0P A;  4XU2 A;  5DLQ E;  1D3B B;  5GJV B;  1QWF A;  1N8R U;  2RNA A;  4N0A A;  1GBR A;  8ATC B;  2DA9 A;  2ZPB B;  1Z9Z A;  1S72 Q;  1LPL A;  1W1F A;  2MCN A;  2DD5 A;  3M0R A;  5FRM A;  2E12 A;  2O2O A;  1JU5 C;  4C5G A;  4BDY A;  3CCS Q;  2J6K A;  4M7D F;  2NUT B;  3EGU A;  3QSU A;  3I56 Q;  2GTO A;  3SD4 A;  2DYI A;  3NTI A;  4JZ4 A;  1QVF S;  1OUL A;  4EDU A;  2PUK B;  1JJ2 P;  4R56 A;  4M75 G;  3JB9 G;  2XI9 A;  1QW1 A;  2NWM A;  2VGN A;  1VIE A;  5LJ5 e;  1VQ7 A;  4DEY A;  2RJE A;  2RHU A;  1YBY A;  4KBM B;  2QI2 A;  2RI5 A;  2E70 A;  1D1B A;  3CC2 A;  2A36 A;  1JXO A;  1U06 A;  1K4U S;  1UGS B;  5LJ3 j;  2CT3 A;  2J7I A;  5LJ3 h;  1O75 A;  1YJW A;  5KYU B;  1K8A U;  2CZ6 B;  1M3A A;  2DIG A;  1G3W A;  1QCN A;  1Q82 C;  1Q86 C;  1HSQ A;  2LVM A;  2FRW A;  3L42 A;  2RHY A;  2CSQ A;  2EGE A;  4V2S A;  2D0N A;  3CCR T;  1BIB A;  3RER A;  1TSF A;  1SF9 A;  1MNE A;  1B07 A;  3FLG A;  2KT8 A;  2CYZ B;  3MPU B;  3UA7 A;  3PTA A;  5KYX B;  3JCM g;  4C5I A;  3VS6 A;  5GAO p;  3M0T A;  3ER0 A;  3I56 T;  4FL6 A;  3CBO A;  5DY9 A;  1YJ9 T;  1RAF B;  4M78 E;  3ZL7 C;  5KH6 A;  4X34 A;  2NUP A;  2ZPE B;  1TUC A;  2QA4 T;  3LH5 A;  2F5K A;  2KAF A;  3HHT B;  4LUD A;  1JO8 A;  4E7S A;  3MCA B;  4Y28 E;  3QDF A;  1I81 A;  2ED1 A;  1YJN A;  2EQM A;  2QEX Q;  2C0T A;  1AD5 A;  3CME A;  2JVV A;  3CXC A;  1HXD A;  4LXC A;  1MMN A;  1RI9 A;  2CT4 A;  1VYU A;  1X6B A;  2JMA A;  2WSE E;  1BBZ A;  2LP5 A;  5D7U A;  5FWB A;  1QCF A;  4AFQ C;  4QVC A;  4ELZ C;  2GF7 A;  3OS5 A;  1PHT A;  1N8R C;  1W2B A;  1I5L A;  1ZBJ A;  3EAE A;  4RMO A;  2KRN A;  3CC4 T;  2JZ2 A;  5ECA A;  3CCL Q;  2DLP A;  1KC8 C;  3F70 A;  1VQ7 Q;  1N5Z A;  3QYG B;  3VV0 A;  4J9F A;  1PSE A;  3PNW C;  4OMM A;  1YWP A;  1U3O A;  3UT1 A;  2RK1 A;  4KUL A;  3AT1 B;  4OF1 A;  3HL8 A;  1M8M A;  1Y57 A;  3VS0 A;  2QGG A;  2FZC B;  5J26 A;  3QO3 A;  3REA B;  2K7A A;  1Y71 A;  5GAN 6;  3MKD A;  2LJ0 A;  2F2W A;  1M27 C;  3LYI A;  3CD6 T;  2YUO A;  2IIM A;  3SWN B;  2DK3 A;  1VQL A;  2IG0 A;  2KYM A;  3H0I A;  5GAN f;  4BDZ A;  3JB9 D;  1QMC A;  3LGL A;  4E6R A;  1X6G A;  2DE0 X;  3VUB A;  4FSX A;  4MZP A;  5IN1 A;  3SEM A;  2CZ1 B;  3CCJ Q;  2A0F B;  1QVG S;  1UEC A;  3EGD A;  5HK0 A;  2YLC A;  3H0F A;  3EG0 A;  3PE0 A;  1K8A C;  1K0X A;  2OAW A;  2EW3 A;  2KXD A;  4C92 F;  4F7U A;  2KMT A;  1VYT A;  3GNF B;  2HSE B;  2NUP B;  1TTH B;  2RQW A;  1M3B A;  4QQ6 A;  2PUO B;  1VQ5 Q;  4ANJ A;  3PFS A;  4MDX A;  3H8Z A;  1HK9 A;  2V8J A;  3G6E A;  4RCC A;  3CCL T;  4PJM A;  2EKO A;  4Y91 A;  1UGQ B;  5I2M A;  3H6Z A;  1VQ9 T;  3EGX B;  4EPC A;  2F5T X;  4HVU A;  2P0Q A;  4OB1 B;  3J80 E;  2EGA A;  3DB3 A;  4FYX B;  2RH2 A;  2YDL A;  2HZY A;  3GP8 A;  4M7D G;  3EGD B;  2KYB A;  4PK4 A;  1M8V A;  2ZPH B;  5GMK j;  2DL8 A;  3RDV A;  1TUD A;  3CCQ T;  4R0K A;  4JJC A;  1VQ5 T;  4HT9 A;  1OYX A;  4OB3 B;  5GMK i;  4J9I A;  4M7D B;  4FW2 A;  5GMK l;  2QQ9 A;  4FM4 B;  3OY9 A;  4HCC A;  2OX7 A;  3FRN A;  5HCK A;  2D1X A;  2KNB B;  4DOV A;  5GAM h;  1AZE A;  8AT1 B;  3CCR Q;  2DVJ A;  2EJF A;  3PVL A;  3M54 A;  3OW2 A;  3TRE A;  3V8J A;  2R58 A;  2EYW A;  4KRT A;  1MGQ A;  5EG2 A;  4PJO D;  1D0Y A;  1RLP C;  4QQG A;  3CMA T;  5LJ3 e;  1YIJ Q;  4PJO C;  2O4X A;  3ZFJ A;  2DIQ A;  3M9Q A;  1TG0 A;  5GAM e;  1SG5 A;  2B8A A;  3FB9 A;  3G7Z A;  3SWN A;  2DRM A;  5FW9 A;  3M4Y A;  2KEA A;  4FSS A;  1NJI C;  2HD0 A;  5LJ5 j;  4LD6 A;  1VQ9 A;  3NTK A;  2EPD A;  1P92 A;  2DKG A;  4TVR A;  3P8H A;  3M5A A;  2CKK A;  4RTW A;  4B9W A;  3G4S A;  3HKS A;  3PIP A;  1KQS S;  1A0N B;  2COZ A;  2L3S A;  4Z88 A;  1FMV A;  3SB2 A;  1QKX A;  2OTL T;  2RK2 A;  1YIT T;  2FEI A;  4MDW A;  3M0S A;  3JCM V;  3CC4 A;  3C94 A;  1AWO A;  3O5Z A;  1QLY A;  1BI1 A;  3CCV T;  1J3T A;  1IGQ A;  3EG9 B;  2EIF A;  4FCY A;  2RJF A;  2V1Q A;  1D1C A;  4AG1 C;  5CKH A;  4LDU A;  2DO3 A;  2QEX T;  3ME9 A;  4EMK B;  2BUD A;  3CCU Q;  3QBY A;  3M59 A;  5EC7 A;  2K9G A;  3OA6 A;  4EMK C;  2RHX A;  3X20 B;  3UAT A;  3CCE A;  1YHQ Q;  5GAM j;  4M7A F;  3BDU A;  1PD0 A;  2FHD A;  3CEY A;  4IUP A;  4X1V A;  2RF0 A;  2XHC A;  3I5S A;  1KQS P;  4CI0 C;  2QTX A;  1VQP A;  4QQD A;  2KK4 A;  5D6X A;  3CCU T;  3L2W A;  1UHF A;  4RTZ A;  1M90 U;  3X24 B;  4NL2 A;  1VQK A;  2X3W D;  4A4F A;  3DLM A;  1E7O A;  2LT1 A;  1R8O B;  3GNG A;  3C12 A;  1V76 A;  1I5O B;  1ZSG A;  4BI3 A;  4OMQ A;  2FVU A;  1E6G A;  2EKH A;  3JV3 A;  1S1N A;  2HBP A;  1SHG A;  3OYG A;  4II1 A;  3ULR B;  1VQN T;  2VYT A;  5A0G A;  1K0S A;  1TXQ A;  4XTX A;  2M02 A;  2AZS A;  4JUV A;  1M9S A;  4FT2 A;  4LD9 K;  1MMG A;  4M78 B;  3CD6 A;  4PFO A;  2VB6 A;  1K76 A;  2QTV A;  5I22 A;  1BK2 A;  2L3Q A;  3M58 A;  2GTJ A;  3CCJ A;  4CRI A;  3L1A A;  2HCK A;  3CC7 Q;  1IZ6 A;  2I0N A;  2CRE A;  2BTT A;  2KDS A;  4C8Q A;  4JJD A;  5KYY A;  4M7A G;  4PJO E;  2OAU A;  1AOJ A;  2H8H A;  3TSZ A;  2ROL A;  1M3C A;  1TU0 B;  1NJI U;  1XTD A;  1UUE A;  1Y7X A;  5CKE A;  2O31 A;  1EIF A;  2O4X B;  1JJ2 S;  1QVF A;  2DTO A;  2RQV A;  1GCQ A;  2LNV A;  4E47 A;  1AT1 B;  2L5Q A;  1GBQ A;  1YIT A;  1VQ4 Q;  1YP5 A;  2YXY A;  3QXE B;  3WXM B;  1QVP A;  2EQI A;  3VUZ A;  2EGC A;  5A2Q E;  2GBQ A;  1EZZ B;  3RNJ A;  1W6X A;  2FPD A;  3OS1 A;  2CGH A;  3CMA Q;  2YUN A;  4XTW A;  1GCQ C;  3QHS A;  4C92 D;  2IPO B;  5LL6 S;  2HNI A;  2JTM A;  4OB0 B;  3T9N A;  3LWI A;  2GGR A;  4PJL A;  1JB0 E;  1I1J A;  1Z9Q A;  1MUZ A;  3J7A F;  1ZUY A;  1UG1 A;  1PKS A;  2RHZ A;  1VQ4 T;  1N9R A;  3EHR A;  3QII A;  3VS3 A;  3VJP A;  3M0Q A;  4YTL A;  1N8R R;  2Y4Y A;  4EMH A;  2DEQ A;  2QDL A;  1VYV A;  1LOJ A;  2JS2 A;  2QQR A;  5IH2 A;  2DL4 A;  1VQ7 T;  4XU0 A;  2XDP A;  1CKB A;  1JQQ A;  3EGX A;  1B34 A;  3OMC A;  4JS4 A;  3MJX A;  1NE8 A;  4QT7 A;  1M1K R;  4VUB A;  2GNC A;  2RQT A;  2GFA A;  1WX6 A;  4XTY A;  3CPF A;  4C0F A;  1YIT Q;  5CKD A;  2QGF B;  1WHK A;  2CS7 A;  5CQY A;  5KE2 A;  4F17 A;  4OGC A;  1VQM T;  2XU8 A;  4RTY A;  2K2V A;  3SWN C;  2V8I A;  2HKQ B;  1M5Q 1;  4HCB A;  3CCV Q;  1JEG A;  4IUT A;  2XK0 A;  1BCM A;  1UJY A;  2EJ9 A;  3EG1 A;  1JJ2 A;  3CC7 A;  4WTO B;  1WIE A;  1M2O A;  2FL7 A;  2KVQ G;  2O88 A;  1JRI A;  3URG A;  2RI2 A;  1QCO A;  3QJ6 A;  4LNP A;  4XTU A;  5C0M A;  1VQO T;  4HVW A;  4PJN A;  2VXF A;  4N4H A;  5FLX E;  3G1J A;  4E7K A;  1QVG A;  3G6E T;  2R5A A;  4F7U E;  4M7A C;  4C8Q G;  2RB6 A;  1HYO A;  3LGF A;  5I11 A;  1VQK T;  1X75 C;  1WHM A;  5GMK e;  4M7A D;  5FRO A;  4IUR A;  5CR2 A;  4FIB A;  3G6E Q;  1S72 A;  1G8X A;  4ATO A;  2XDB A;  4C92 B;  1CSK A;  2KE9 A;  4J6X A;  1R0B G;  3C95 A;  2ZGW A;  5IXF A;  3V7R A;  2OI3 A;  3WVD B;  4K11 A;  4F16 A;  4FW1 A;  1YI2 Q;  5GAN g;  1WI7 A;  2DBM A;  4NL3 A;  2WAC A;  2HAX A;  1E6H A;  1X2K A;  2DMO A;  4M77 B;  2CUD A;  3M0U A;  2BZX A;  1QWE A;  3OYN A;  2PVD B;  3HRS A;  3X26 B;  1T3S A;  4JDS A;  2AHJ B;  4D8K A;  2J05 A;  1YWO A;  3TQ7 P;  2PVG B;  1LJO A;  1YIJ T;  4F14 A;  1VQN A;  1ARK A;  4B6M A;  4X9D A;  1RAE B;  2E4H A;  5IXB A;  3BY7 A;  1VQ8 Q;  1WGS A;  2DJQ A;  3BFM A;  3V7S A;  2XD0 A;  5FU6 C;  2D6F A;  3UWN A;  2X3X D;  3VRZ A;  3OYD A;  1RI0 A;  4RTX A;  1OZ2 A;  3SFM A;  1RAC B;  2LRQ A;  2VC8 A;  3VU3 C;  2KI7 A;  5GMK m;  1MMA A;  3M56 A;  4RTV A;  3JCM Q;  3TVT A;  2X4W A;  1KC8 U;  2KGT A;  1C1A A;  1K9M C;  1IHW A;  2VVK A;  2YT6 A;  2JT4 A;  4D8D A;  2JN0 A;  1OPK A;  3VS4 A;  4XQ3 A;  2CP7 A;  2CSI A;  6AT1 B;  2WSF E;  4EIK A;  3NGP A;  9ATC B;  1IRX A;  4C5E A;  2K57 A;  1G3T A;  5CCA A;  1PRL C;  1D3B A;  4LDX A;  1Q95 G;  2R5M A;  3KUF A;  1NG2 A;  4JRP A;  1VQ5 A;  2DZ9 A;  1WQ7 A;  1WZO A;  4IUU A;  3OW2 P;  2DBK A;  3JCM W;  2MYS A;  3MEA A;  2X35 A;  3QDR B;  4C0Z A;  1M90 C;  1NBE B;  1ZQ1 A;  2DIL A;  2J06 A;  2CZ0 B;  1W4S A;  2RN8 A;  3GLX A;  1D0X A;  4AG2 C;  2E65 A;  4C8Q D;  2HEQ A;  3P8D A;  5J3B A;  2DF6 A;  5AT1 B;  2VUB A;  3QUI A;  4BB7 A;  3VS2 A;  1OI1 A;  2LJ1 A;  2AKL A;  4M77 E;  2BE7 D;  2KR3 A;  3MP1 A;  1M90 R;  1VQ6 A;  1LVK A;  3KXT A;  1M1K U;  3FDR A;  4LUE A;  1VQM Q;  1C6V X;  4C0D C;  3A8O B;  3JCM h;  1WPY A;  2EJG A;  2HQH A;  4GBQ A;  4M7A B;  1BI3 A;  1PC0 A;  2KT1 A;  3EFO A;  3QJY A;  3E19 A;  1OV3 A;  2M0Y A;  5DLO A;  1SEM A;  1RAG B;  2O9S A;  4M75 E;  4FYW B;  4XTZ A;  1YJN T;  2HL3 A;  4M78 G;  4HXJ A;  2RQU A;  5GAM d;  3GOX A;  4FT4 A;  1G3Y A;  2E3H A;  2DL7 A;  4A63 B;  3OS2 A;  4J5Y A;  5KYU A;  1DJ7 B;  2LZ6 B;  2RJD A;  3JSC A;  1M2V A;  3X28 B;  1I4K 1;  2ZPI B;  3QG1 A;  5M9O A;  3QZ9 B;  4PJO B;  3PGG A;  2AZV A;  2V26 A;  4M7A A;  4XAX B;  3QKJ A;  3HFN A;  3SDZ A;  1YJN Q;  2YRD A;  5D6Y A;  1ZSZ C;  1YI2 A;  2BKD N;  1NPR A;  1FX7 A;  1U5S A;  2JTF A;  2CDT A;  4KGX B;  2DZC A;  1TH7 A;  4OMO A;  2FPF A;  5LJ5 f;  5IHI A;  5KYW B;  4E7J A;  2G3R A;  4DOW A;  1AEY A;  2JTE A;  4RG8 A;  4ZN3 A;  4IIM A;  2ZAE A;  2CP2 A;  1Y96 B;  1I8F A;  2NUT A;  1SHF A;  3TCJ A;  5KYN A;  1QP2 A;  4KUD K;  4JJB A;  3CCU A;  4R55 A;  2YRC A;  2ZCF B;  1OU8 A;  5GAN 8;  3OYI A;  2LCL A;  3S3O A;  2AIR B;  1JXM A;  1W2B S;  2OTL A;  2EFI A;  2D9T A;  3CCQ Q;  5GAN 4;  1FMW A;  3RBB B;  1HJD A;  3QPH A;  4J9H A;  1NEB A;  4RG2 A;  3C0C A;  5FU6 B;  4ELY C;  1UTI A;  1Q81 C;  2A3L A;  3NTH A;  4DBF A;  1QVF P;  3X25 B;  2E41 A;  4ZGJ B;  2A37 A;  2LCS A;  4IIO A;  4RKU E;  4IUV A;  4J8O A;  3INZ A;  1VQ8 T;  2SEM A;  2LQ8 A;  3E2U A;  4F7U G;  1KK7 A;  1VIF A;  4E7L A;  4C8Q E;  1RLQ C;  2F69 A;  4M77 C;  1K73 C;  4HKE A;  1OPL A;  1TOV A;  4KT0 E;  1RUW A;  1PSF A;  2ABL A;  3A5Z B;  1OX8 A;  2DRK A;  4HT8 A;  4QVD A;  1EFN A;  2JW4 A;  2NLU A;  4M78 A;  1YJW T;  4M7D A;  3QZ5 B;  1WJQ A;  3EH2 A;  1ZSZ B;  4M77 A;  2HQE A;  2L3P A;  2MMP A;  1FMK A;  3CCV A;  2KBT A;  4RTT A;  4Z89 A;  3JB9 H;  1V29 B;  2ED0 A;  4M78 C;  1NYF A;  3S6W A;  5I2S A;  1SRL A;  4X9C A;  5C6S A;  2AK5 A;  3O8V A;  5A0D A;  2DXU A;  2LMJ A;  2OTL Q;  4ZGE B;  3BDL A;  4AFU C;  4M78 D;  2DL5 A;  2E1H A;  3CXC S;  1OZ3 A;  1GXI E;  1IHV A;  1WA7 A;  3THK A;  3M4G A;  2FO0 A;  2M16 A;  2FB7 A;  1TS9 A;  1VQ4 A;  1NJI R;  1C0M A;  1N9S A;  3JAM E;  1SKU B;  3OYH A;  3OS0 A;  2JJ9 A;  1UJ0 A;  1CKA A;  3CPW A;  2JNG A;  2SRC A;  2QXF A;  2HL5 C;  2RMO A;  3MHX A;  3RMS A;  2OTJ A;  3G71 A;  5FWC A;  1F1B B;  4OVA A;  1NM7 A;  2QEX A;  2XMF A;  2K5L A;  2QK0 A;  3EHQ A;  4PNO A;  1YJW Q;  1VUB A;  3JCM X;  3EG9 A;  4XTV A;  2BIV A;  1AWX A;  3RKX A;  2CH4 W;  4JLG A;  1OU9 A;  5CKF A;  3OBY A;  1G2B A;  4LN2 A;  4ZTF A;  4DQ2 A;  3OMG A;  4KH0 B;  4J7I A;  4KH1 B;  2DER A;  4PLL A;  3PVQ A; 
#chains in the Genus database with same CATH homology
 1N5Z A;  5IHN A;  4J9F A;  4OMM A;  1YWP A;  1U3O A;  5I11 A;  1XOV A;  2KRS A;  1NYG A;  2JXB A;  3EG3 A;  3NHN A;  1M8M A;  2VWF A;  4RTU A;  1Y57 A;  2K3B A;  1W70 A;  3VS0 A;  2O9V A;  1WLP B;  2B86 A;  3REA B;  2DM1 A;  2J6F A;  2K7A A;  2LJ0 A;  1Y0M A;  2F2W A;  1M27 C;  4ORZ A;  2YUO A;  2IIM A;  4OML A;  1ABQ A;  2KYM A;  3H0I A;  2ENM A;  3R6N A;  2V1R A;  4E6R A;  1X6G A;  2KXC A;  1CSK A;  1BB9 A;  2DX1 A;  2DE0 X;  2KE9 A;  1OEB A;  3EG2 A;  4ESR A;  5IXF A;  3SEM A;  2ESW A;  2OI3 A;  4F16 A;  4K11 A;  1UEC A;  3SHW A;  5GJW B;  1HD3 A;  3H0F A;  1WI7 A;  2DBM A;  3EG0 A;  2F2X A;  3PE0 A;  2L2P A;  2C0I A;  1SRM A;  1E6H A;  1K0X A;  1X2K A;  1GFC A;  2DMO A;  2EW3 A;  2OAW A;  2LQN A;  2KXD A;  1X2Q A;  1UE9 A;  2CUD A;  3M0U A;  2BZX A;  2LNH B;  1QWE A;  1VYT A;  2BZY A;  1PWT A;  1T3S A;  2RQW A;  1M3B A;  4D8K A;  2J05 A;  2A28 A;  1YWO A;  1WDX A;  3I5R A;  4F14 A;  2EYX A;  1ARK A;  5ECA A;  1M30 A;  1T3L A;  5IXB A;  1X69 A;  2W10 A;  2DJQ A;  4HVU A;  1MV3 A;  2OJ2 A;  2EGA A;  2YDL A;  3UF4 A;  2RQR A;  2X3X D;  4CC2 A;  3VRZ A;  2PZ1 A;  2K6D A;  4RTX A;  2KYB A;  2DL8 A;  1TUD A;  2EYY A;  4RTV A;  4R0K A;  4JJC A;  2FRY A;  3TVT A;  4DEX A;  2JS0 A;  4J9I A;  3FJ5 A;  2KGT A;  2VVK A;  2YT6 A;  2JT4 A;  4J9C A;  5IHK A;  4D8D A;  3VS4 A;  1K9A A;  1OPK A;  2YUQ A;  3H41 A;  3QWX X;  5HCK A;  2D1X A;  2KNB B;  1H92 A;  2CSI A;  1AZE A;  1AWW A;  1MV0 B;  2E5K A;  4EIK A;  2DVJ A;  3NGP A;  4AFS C;  3PVL A;  1H3H A;  1B3Q A;  3CQT A;  2EBP A;  1PRL C;  1YCS B;  2EYW A;  4KRT A;  1ZLM A;  2FG0 A;  1NLP C;  1PNJ A;  1NG2 A;  2YSQ A;  1RLP C;  4WCI A;  2LJ3 A;  2DBK A;  3NMZ C;  1WFW A;  1ZUK A;  3IQL A;  2LX7 A;  1BU1 A;  1TG0 A;  1GFD A;  2DRM A;  2DIL A;  2J06 A;  5FW9 A;  2KEA A;  2RN8 A;  4FSS A;  4OMN A;  3H0H A;  4AG2 C;  1X43 A;  1LCK A;  2JMC A;  2HEQ A;  1NLO C;  2EPD A;  2W0Z A;  1GCP A;  2C0O A;  2DF6 A;  4RTW A;  3VS5 A;  3VS2 A;  2LJ1 A;  2MIO A;  4J9E A;  2AKL A;  1A0N B;  4JPB W;  2L3S A;  3UA6 A;  4Z88 A;  2KR3 A;  1QKX A;  4HVV A;  2CH4 A;  1GRI A;  2FEI A;  2A08 A;  2ECZ A;  3M0S A;  4LUE A;  1AVZ C;  1AWO A;  3O5Z A;  2NUZ A;  2JM9 A;  3QWY A;  1QLY A;  1J3T A;  1AWJ A;  1T0H A;  1V1C A;  2V1Q A;  4GBQ A;  4GLM A;  4AG1 C;  2EVR A;  2KT1 A;  2K2M A;  4CC4 B;  1WXT A;  2PNI A;  1OV3 A;  2M0Y A;  2DNU A;  1SEM A;  1KSW A;  2D8J A;  2O9S A;  2CUB A;  2K9G A;  5EC7 A;  1H8K A;  2F2V A;  3REB B;  3GBQ A;  3NPF A;  3UAT A;  4HXJ A;  2K79 A;  2RQU A;  1I0C A;  2VKN A;  2DL7 A;  4A63 B;  4X1V A;  3VRY A;  4OMP A;  2LZ6 B;  2RF0 A;  3I5S A;  2HSP A;  1YN8 A;  2M51 A;  1AZG B;  2RPN A;  1UHF A;  2D8H A;  4RTZ A;  2AZV A;  2G6F X;  2J6O A;  2X3W D;  4Y92 A;  1QKW A;  2EYZ A;  1E7O A;  2P4R A;  1ZSG A;  4J9D A;  1KFZ A;  4OMQ A;  1UDL A;  2DYB A;  1K1Z A;  1E6G A;  2EKH A;  1U5S A;  1S1N A;  3JV3 A;  1UHC A;  2JM8 A;  4HCK A;  4M4Z A;  1SHG A;  2CDT A;  1GL5 A;  3ULR B;  4OMO A;  2FPF A;  2L0A A;  5IHI A;  3A98 A;  1K0S A;  1OOT A;  3I9Q A;  4JZ3 A;  1AEY A;  2GQI A;  2JTE A;  1X27 A;  2AZS A;  4IIM A;  1SSH A;  1T0J A;  3M0P A;  1SHF A;  2FPE A;  5GJV B;  1K76 A;  1QWF A;  4JJB A;  5I22 A;  2RNA A;  1GBR A;  1BK2 A;  2L3Q A;  4J9G A;  2GTJ A;  2DA9 A;  4AFZ C;  1Z9Z A;  2HCK A;  3U23 A;  1JXM A;  2I0N A;  2CRE A;  1W1F A;  4CC3 A;  2BTT A;  2MCN A;  4JJD A;  1AOJ A;  3RBB B;  2H8H A;  3M0R A;  1HJD A;  4RUG A;  2O2O A;  3VS7 A;  4J9H A;  1JU5 C;  1NEB A;  3TSZ A;  2PTK A;  2AKK A;  1WXU A;  1M3C A;  1ZX6 A;  2J6K A;  2ROL A;  3C0C A;  1UUE A;  3EGU A;  1UTI A;  2MOX A;  2GTO A;  2O31 A;  4JZ4 A;  1PKT A;  2ROT A;  2RQV A;  1GCQ A;  2A37 A;  2LCS A;  4IIO A;  2SEM A;  2KRM A;  1GBQ A;  2NWM A;  2BZ8 A;  1G83 A;  1RLQ C;  1YP5 A;  1KJW A;  2EQI A;  2EGC A;  2GBQ A;  4DEY A;  2LQW A;  1OPL A;  1FYN A;  3RNJ A;  1RUW A;  1W6X A;  2FPD A;  2A36 A;  2YUN A;  1JXO A;  1GCQ C;  2ABL A;  1U06 A;  2DRK A;  1WYX A;  1K4U S;  1VA7 A;  1EFN A;  2GGR A;  2CT3 A;  2JW4 A;  2J7I A;  1ZUU A;  1WXB A;  1I1J A;  1Z9Q A;  1MUZ A;  1ZUY A;  4ZNX A;  1UG1 A;  2HBW A;  1PKS A;  1PRM C;  1M3A A;  2YUP A;  2L3P A;  3EHR A;  3VS3 A;  4J9B A;  1HSQ A;  3M0Q A;  2FRW A;  1FMK A;  1SPK A;  2KBT A;  2CSQ A;  2EGE A;  4RTT A;  4Z89 A;  2D0N A;  2QDL A;  5L23 A;  1VYV A;  2KRO A;  2JS2 A;  5IH2 A;  2DL4 A;  2ED0 A;  1B07 A;  1NYF A;  1SRL A;  1CKB A;  1JQQ A;  2KT8 A;  3UA7 A;  2AK5 A;  4QT7 A;  3VS6 A;  2GNC A;  2RQT A;  1WX6 A;  3M0T A;  2LMJ A;  4AFU C;  2DL5 A;  1YNZ A;  3ZL7 C;  1WA7 A;  3THK A;  2FO0 A;  1TUC A;  1KIK A;  3LH5 A;  4F17 A;  1UFF A;  4RTY A;  4LUD A;  1JO8 A;  1ABO A;  1UJ0 A;  1CKA A;  3I35 A;  4LE9 A;  4Z8A A;  1JEG A;  2SRC A;  2HDA A;  2ED1 A;  2RMO A;  1I07 A;  1UJY A;  5FWC A;  2C0T A;  1AD5 A;  3EG1 A;  4CC7 A;  1NM7 A;  1UGV A;  1RI9 A;  1WIE A;  2CT4 A;  2XMF A;  3VS1 A;  1VYU A;  1IO6 A;  1X6B A;  2JMA A;  3EHQ A;  2O88 A;  1BBZ A;  2LP5 A;  5FWB A;  1QCF A;  4AFQ C;  1AWX A;  2CH4 W;  4LNP A;  1PHT A;  4HVW A;  1ZBJ A;  1G2B A;  2KRN A;  4LN2 A;  1NEG A;  3KFV A;  3TSW A;  2DL3 A;  3PVQ A;  2DLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...