4ORZA

Hiv-1 nef protein in complex with single domain antibody sdab19 and an engineered hck sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
IIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase HCK
publication title Structural basis for the inhibition of HIV-1 Nef by a high-affinity binding single-domain antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/apoptosis/immune system
total genus 13
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4orzA00
3TVTA 4DEXA 1YP5A 2ENMA 2JMAA 1ARKA 3ULRB 3UA7A 1VYUA 2KGTA 2KYMA 3NGPA 3R6NA 2YUOA 4QT7A 5I22A 1K1ZA 1VYTA 2VVKA 3M0UA 4J9GA 2YUQA 4K11A 4AFQC 3TSWA 2EW3A 4ZNXA 1PNJA 1GRIA 2GTOA 2RQRA 2LZ6B 2O9VA 1CKAA 1YN8A 2YSQA 3PE0A 2DRMA 2CSIA 3CQTA 3VS2A 4CC4B 3RNJA 2NUZA 2M0YA 2YUNA 3VS7A 1IO6A 1YCSB 2EYYA 3FJ5A 1UUEA 1RLQC 4LNPA 3SHWA 4DEYA 3VS3A 2K6DA 2GGRA 2KBTA 1AWOA 4LE9A 2F2VA 1WXUA 1ZUKA 4F16A 2EBPA 2KXCA 4OMLA 1ZUYA 1VA7A 1WXTA 1G2BA 2HCKA 2JM9A 2PNIA 3TSZA 1ZSGA 4IIOA 3I5RA 2EGCA 1K0XA 5FWBA 3PVQA 2X3XD 5IHIA 1E7OA 2AZVA 1KSWA 4RTWA 5FW9A 1K4US 2JT4A 2DYBA 4LUDA 2EYXA 1ABOA 2C0IA 2K7AA 2C0OA 1BU1A 4HCKA 1GBQA 2LJ3A 1S1NA 2F2XA 5GJWB 2EQIA 1UJYA 2K79A 2ESWA 1NEBA 1NG2A 1UG1A 2J6KA 3NHNA 3I5SA 2DJQA 2EVRA 4OMNA 3H0FA 4JJBA 2DL8A 1CKBA 4RTUA 4D8KA 2MOXA 2DE0X 3UA6A 2BZ8A 3THKA 1SPKA 2GTJA 2A08A 1WLPB 2JXBA 3VS0A 3SEMA 4OMMA 2JS2A 3M0SA 3PVLA 2J05A 2F2WA 1TUDA 1K9AA 1X2QA 4OMQA 2W10A 2RNAA 2A36A 2D8JA 2G6FX 2IIMA 2DM1A 2QDLA 2CT3A 1B3QA 1CSKA 1PKTA 1PKSA 1WI7A 1WFWA 2DL3A 2KT1A 1X69A 1UDLA 1RI9A 2LJ1A 2I0NA 4J9FA 1Z9ZA 2LJ0A 5L23A 3A98A 2DRKA 3QWXX 1GFCA 1JO8A 2YT6A 3EG1A 4Z88A 1ZLMA 2DBKA 4GLMA 2V1RA 2KR3A 2CH4A 2W0ZA 4FSSA 2J7IA 3VRZA 2EYWA 1NLOC 1JU5C 2A37A 2DF6A 2OI3A 4F17A 2ROLA 3M0TA 2GNCA 1X43A 1E6GA 4JJCA 2DL5A 4HVUA 1MV3A 1WA7A 2KRNA 1ZBJA 1QKWA 2K9GA 2O9SA 1UECA 2RMOA 3EGUA 1QKXA 2OAWA 2YDLA 2FG0A 2DLPA 1H92A 1AOJA 3VRYA 1X6GA 2E5KA 2EGAA 1PRLC 1PRMC 2RN8A 3KFVA 1GCQC 1I0CA 1T0JA 2RF0A 3LH5A 3EHQA 4GBQA 2DL7A 3C0CA 2ABLA 2OJ2A 3NMZC 4JZ4A 2FO0A 3ZL7C 2L0AA 3O5ZA 3QWYA 1VYVA 1AWWA 1OPKA 2A28A 1BK2A 2KYBA 5IHKA 2CSQA 1WIEA 4F14A 1GCPA 1NEGA 2DX1A 4Y92A 2D0NA 1WXBA 1JEGA 2FRWA 2CREA 2VWFA 2PZ1A 1AWXA 1UTIA 2L3QA 2KEAA 4RTXA 2DL4A 1KIKA 1YWPA 1FYNA 2ED0A 2MCNA 2X3WD 1OPLA 1QWFA 1X6BA 2KNBB 4AFUC 4IIMA 2KRMA 1UJ0A 4CC3A 1Y0MA 4LN2A 4CC2A 2DMOA 1HJDA 4E6RA 2LCSA 2DILA 5IXBA 1ZUUA 1QWEA 1M3CA 2FPDA 4M4ZA 2AKLA 5I11A 1M27C 1RUWA 2CDTA 2LMJA 1GCQA 4AFSC 2J06A 3GBQA 5ECAA 2KROA 1AWJA 4J9DA 4AG2C 3REBB 1Z9QA 2MIOA 2VKNA 4ORZA 4ESRA 4J9IA 1AD5A 1M3AA 2SEMA 2L2PA 1YNZA 1UHFA 1I07A 1GFDA 1M3BA 2O31A 2GQIA 3VS5A 4HVWA 5EC7A 1TUCA 4RTTA 5IXFA 5HCKA 4HVVA 1MUZA 1B07A 2CT4A 3VS1A 2V1QA 1A0NB 2AKKA 4AFZC 3U23A 2EYZA 1AZEA 4A63B 1GBRA 5GJVB 2RQUA 2BTTA 2L3SA 2FRYA 2BZYA 2JW4A 2RQWA 5IHNA 1OV3A 2KE9A 2J6FA 5IH2A 2O2OA 1K76A 1KJWA 1X2KA 3VS4A 4KRTA 1UHCA 3EG3A 3M0PA 1SEMA 2K3BA 1J3TA 1W6XA 1KFZA 2AZSA 2LX7A 2ED1A 1NYGA 4Z8AA 1SHGA 2L3PA 1NLPC 3I9QA 2DVJA 2DA9A 1PHTA 2AK5A 2RPNA 1V1CA 1H3HA 1QCFA 2FPEA 1X27A 4D8DA 1NM7A 2CUDA 2KRSA 4X1VA 1RLPC 1UGVA 4J9CA 1HD3A 1YWOA 2YUPA 2CUBA 5FWCA 1W70A 1SRLA 4JPBW 3JV3A 2HEQA 2EPDA 4WCIA 1W1FA 3UF4A 3H0IA 1U3OA 2NWMA 2JS0A 1QLYA 1LCKA 4AG1C 1T0HA 2PTKA 1T3LA 1MV0B 2O88A 2FPFA 1AVZC 1JXOA 1SRMA 1WX6A 2H8HA 1AZGB 4CC7A 1I1JA 1N5ZA 3REAB 1EFNA 2DNUA 2GBQA 2KXDA 1G83A 2RQTA 1GL5A 2D8HA 1NYFA 2B86A 3EHRA 1OEBA 3M0QA 1BBZA 3EG0A 2HDAA 3RBBB 1M30A 1K0SA 1SHFA 1WDXA 1BB9A 3M0RA 4HXJA 3NPFA 1WYXA 3H41A 1U06A 2C0TA 1TG0A 1ZX6A 2KT8A 2JM8A 4LUEA 2EKHA 1JXMA 2K2MA 4J9BA 1U5SA 1E6HA 2M51A 3IQLA 4J9EA 3I35A 1H8KA 2JTEA 1HSQA 2LNHB 2ECZA 2ROTA 3EG2A 4J9HA 4Z89A 4RTVA 1AEYA 2SRCA 4OMOA 3H0HA 2RQVA 2D1XA 2LQWA 1XOVA 1OOTA 2EGEA 1SSHA 4RTYA 2J6OA 2HSPA 2JMCA 1T3SA 4RTZA 2CH4W 2P4RA 1JQQA 2XMFA 4EIKA 4RUGA 2LQNA 3UATA 3VS6A 1M8MA 4OMPA 2BZXA 1PWTA 2FEIA 4JZ3A 1FMKA 1UE9A 4JJDA 1UFFA 2HBWA 1ABQA 4R0KA 1Y57A 2LP5A 2DBMA
chains in the Genus database with same CATH superfamily
2X4WA 2JMAA 2XDPA 1UGQB 1ZSZB 4C0DB 1VYUA 2BUDA 2CYZB 2EQKA 2KGTA 1N6AA 2YUOA 5I22A 3A8OB 1YHQA 2PVDB 4J9GA 3A8LB 1YHQQ 2CP3A 3TSWA 2EW3A 3BDUA 1GRIA 2RQRA 5GAMg 3CCUT 2LZ6B 3NTHA 2DRMA 4J83A 3VU3C 3OYLA 3VS2A 3OYEA 2YUNA 4C92C 1IO6A 3FJ5A 1UUEA 2P0PA 3HRUA 3SHWA 5AYFA 3L2VA 4DEYA 4LE9A 1VA7A 1WXTA 1M2VA 3TSZA 2ZPFB 2MMPA 3L1AA 4M77F 1Q82U 3CBOA 3FJPA 3PVQA 2DXCA 2HSEB 2X3XD 4ZGDB 1ZA1B 1S72Q 2JT4A 4JRPA 3C12A 3EAEA 3JCMW 1ABOA 1M2OA 1VUBA 1M1FA 1BU1A 4M78E 3JCMc 4HCKA 4QW2A 1GBQA 3JRZA 5D7UA 3HSBA 1S1NA 2F2XA 4OF1A 1Q82C 2FYKA 4E7HA 3JB9D 2E41A 4HA8A 4C92B 3J81E 2K79A 2EJGA 1D1BA 2JJ9A 3OS1A 2DJQA 4FIBA 1CKBA 4RTUA 2F5TX 1I5OB 2COZA 2CP7A 3QPHA 3HFNA 1K73U 2BZ8A 4WF2A 2GTJA 3L42A 4A4HA 2E10A 2XDBA 3VS0A 1D3BA 4OMMA 3M0SA 2J05A 1TOVA 1D0XA 1WHJA 1VQNT 1X2QA 1G8XA 3OYHA 2A36A 2G6FX 2QDYB 1QVGP 4XTVA 2CT3A 1K73C 1PKTA 4M7DF 1WFWA 4A4GA 3HFOA 2CZ0B 2QTXA 1RI9A 3M59A 4J9FA 3L2RA 2LJ0A 1M1KU 2VV5A 3CC7T 4DOVA 1VQ7A 2CP5A 3SD4A 5FROA 3QWXX 2Y4XA 1GFCA 1VQ7Q 4EPCA 2YT6A 3CD6A 3EG1A 2QQAA 1QVPA 1IREB 3L2ZA 4A4KA 4MZTA 4XU1A 1SKUB 3RIRA 3CD6Q 1VQ4T 4PLLA 1ZQ1A 1Q81U 2CH4A 2PQWA 3WVDB 2LQKA 2DF6A 2OI3A 4F17A 4F7UG 3LWIA 1C0MA 2ROLA 3M0TA 5GANh 1KC8R 2O01E 4JJNK 4HT9A 1WA7A 4M7DE 5GAOp 2RM4A 3SFMA 1Q81C 2L3RA 2OX7A 1IGUA 3M4GA 1OX8A 5CQXA 2DERA 2FG0A 2GFUA 5LJ3h 2RN8A 5GANf 1BIBA 3OS0A 1YITA 2DVEA 2RF0A 3EHQA 4J8OA 4E7IA 1YITQ 5CO7A 3NMZC 3QXEB 1VQMA 3O5ZA 3JAME 5LJ3f 3QHSA 2LX9A 5CVIA 2COYA 4MMKA 1VQMQ 2KYBA 2VXFA 4ZN1A 4HKEA 3UWNA 1PD1A 2DX1A 2LNVA 2D0NA 1WXBA 2RJEA 2IG0A 1TU0B 2PZ1A 1JJ2A 2FL7A 1R8OB 1JJ2S 1RAAB 1UTIA 3DLMA 1BYMA 2DL4A 1FMVA 4M78A 2ED0A 1QVFA 1QVFS 1OPLA 1QWFA 2YHTA 5GAMj 5GAMd 1IHVA 3RMQA 1TUGB 2KRMA 1UJ0A 3M55A 1Y0MA 4FM4B 3JCMV 1WJSA 1VQ6T 4OGEA 3JSCA 2LCSA 2DILA 2RA2A 1QWEA 3V8JA 3OBYA 1JBMA 3L2UA 2QA4T 1MHNA 5I11A 3CC7Q 1KHIA 1GCQA 4ZN3A 4PFOA 1KK7A 2RO0A 3CC2A 2LT4A 2M9UA 3ME9A 1Z9QA 2MIOA 2VKNA 1VQ4Q 4ESRA 2QK0A 3CC2Q 4J9IA 2V8JA 1AD5A 5GAN2 2XK0A 1NZ9A 3CMET 1NJIU 1YNZA 1UHFA 4C0GA 1I07A 5KE3A 2NUTA 1M3BA 3X28B 2HBPA 5IXFA 4BACA 3CCJA 1MUZA 3EFRA 4PJOD 3BW1A 3PNWC 2EYZA 3CMAA 4A63B 5D6YA 1JB0E 2ZPIB 3QBYA 1NJIC 3CMAQ 3RKYA 2RQUA 2FRYA 2BZYA 3SWNB 2MAMA 1M90U 1G3WA 3JCMX 2O2OA 1KJWA 2DTHA 3EG3A 3A1PA 2AZSA 3F70A 2ED1A 2HL5C 1YFNA 1WGSA 4XTUA 2L3PA 1NLPC 2DA9A 4QQDA 3MO8A 2AK5A 2RPNA 1M90C 4M7DA 1NM7A 3EFOA 5FU7C 3EGXA 1VQLA 4ZGJB 1UGVA 3RDVA 1YWOA 1TS9A 3X24B 4C8QC 2CUBA 1JRIA 1SRLA 1VQLQ 3OYBA 2FHDA 4C92F 4RKUE 4JLGA 2EPDA 1IGQA 1D1AA 1W1FA 5GAN8 2D6FA 2RI5A 4XTWA 4DA4A 1Q82R 4AG1C 1T0HA 1MV0B 4M75D 2O88A 2FPFA 3CCET 2H8HA 5CIUA 4R56A 2DNUA 1QCOA 2EWNA 1RADB 2E6ZA 2XKOC 4LD6A 3EG0A 3QJ6A 3RMSA 4IUUA 3G71A 4A4EA 1WHLA 1BB9A 4HXJA 2DYIA 3G71Q 1RAFB 1VQPT 5LJ5f 3QO3A 3QJYA 1WYXA 4DBQA 2C0TA 2QQ9A 2CZ6B 1OULA 1ZA2B 4OB1B 4C92E 3CMEQ 4LUEA 4M7AG 4C8QB 1R0CB 1O75A 2K2MA 1U5SA 4KT0E 4J9EA 3I35A 3QG1A 1HSQA 3LYIA 1YI2A 4XTYA 1BIAA 1YI2Q 2QI2A 3EG2A 4J9HA 2FZKB 2RQVA 3H6ZA 1B34B 5KCOA 3A8GB 1ZHIA 2EGEA 2RHUA 4RG2A 3OMGA 2C06A 4X34A 2MYSA 4RTZA 1HXDA 3CCSA 4X9CA 3CPWA 5DM7R 2CS7A 2ATCB 1IRXA 3JCMJ 3CCSQ 1X6OA 2BZXA 4FYVB 1PWTA 1H641 3OS5A 1JJ2P 4MZMA 2HBWA 1ABQA 5FRMA 2ENMA 3EH1A 1MMGA 4Z02A 3J7AF 1QCNA 5I2SA 5KYWB 3ZBDA 4E7LA 2NUPB 4M77G 1K1ZA 3N5BB 2VGMA 1I5LA 3Q1JA 2VVKA 1ZSZA 2FZCB 3E9FA 4AFQC 4ZNXA 4AT1B 1N8RC 3PIOA 2IPOB 2O4XB 4VUBA 3A8HB 3TCJA 2F1LA 4CC4B 3RNJA 2M0YA 1TWBA 3TU4K 3VS7A 1YCSB 2EYYA 1OX9A 1VQOT 3VS3A 2K6DA 2KBTA 3I56A 1AWOA 4F16A 4A4FA 2ZGWA 1ZUYA 2AT1B 3QKJA 2HCKA 1K8AU 2PNIA 1I4K1 2RJCA 4NOYA 3I55T 5KH6A 4EMGA 5FWBA 4BB7A 5IHIA 1FMWA 2JN0A 1E7OA 1G3TA 4EDUA 3M57A 1K4US 2DYBA 2QGGA 1FXXA 4BY6C 1WHHA 4M7AD 2K7AA 4FT4A 3G1JA 2LJ3A 3RKWA 1Q7YR 4KGZB 2EQIA 4J6WA 3RKXA 4AMCA 1NEBA 1NG2A 3CCRA 3NHNA 4C0DC 4N4IA 4OMNA 3CCRQ 1LOJA 2DL8A 3G6EA 1UGRB 1QMCA 1KQSS 4C92A 2MOXA 3G6EQ 4CI0C 3D7SB 2E12A 5GANd 5GANj 1BCOA 1KD1U 1VQKT 5GMKh 1WJRA 3PVLA 3VYGA 1LNXA 3RR6A 4BY6B 2ZCFB 1VQ8T 1BKBA 1V76A 2DM1A 5FRNA 1IB8A 2KY9A 4HCBA 1UEBA 2DL3A 2KI7A 4MZPA 1X69A 5I2MA 1KD1C 4M77D 1PM3A 1Q86U 3FLGA 1HYOA 2E6NA 1ZLMA 2DBKA 4GLMA 3FDRA 1OQKA 2RK1A 1RABB 1WJQA 1XNIA 2HQXA 2KR3A 4UC4A 1Q86C 3MJXA 1O9SA 2K2VA 3OYMA 3KBGA 3CXCP 4HCZA 1JU5C 1EZZB 5GAN3 4M78F 3X25B 4JJCA 2XIDA 5DY9A 4KH0B 1SG5A 2JTMA 2LCLA 3V7SA 3DLLA 1ZBJA 2O9SA 3CCLT 1UECA 1QKXA 4Q5WA 3AT1B 3AHUA 2Y90A 1X6GA 4PJLA 2DPPB 3OSVA 1PRLC 3FB9A 2H3EB 1KQ2A 2QASA 3CCMA 2GF7A 1YBYA 3CPWP 3OYCA 3C0CA 1S72A 3CCMQ 2OJ2A 2QAZA 2D0QB 4JZ4A 2FO0A 3ZL7C 3LH0A 3QWYA 5DLQE 3CCQT 2X51A 4FYYB 3OSSC 5KYUB 4M7DD 1D0ZA 2MWPA 2MF2A 1VOMA 3M9QA 3GOXA 4Y92A 2XICA 2FRWA 3JB9H 2JNGA 2P4TA 2KEAA 1X6BA 2DD5A 1YJWA 1VQ8Q 3CC4T 4CC3A 1MNDA 1YJWQ 4CC2A 2DMOA 1Y96B 2HKNA 5IXBA 4BD3A 5M9OA 2DXTA 3JB9J 3JCMh 2QEXT 4C8QE 3S6WA 1M27C 2EFIA 2R57A 1RUWA 3E19A 2GCXA 3TEEA 1LPLA 2DTIA 4PJOB 3JCMQ 2E4HA 2J06A 1NBEB 3GBQA 5ECAA 2KROA 4F7UB 5FU6C 3JCMf 3REBB 3OMCA 2R5AA 1WNLA 3CCUA 1G3SA 5GAOm 4MDXA 3OYGA 3CCUQ 3E2UA 5GAOn 2X4JA 2KDSA 4HVWA 4II1A 5EC7A 1TUCA 4RTTA 5HCKA 4HVVA 2CT4A 2V1QA 3EH2A 3OYYA 4AFZC 1N8RR 2QXFA 2EJ9A 3NFCA 4EMKB 1AZEA 3FIFA 3M54A 3GNGA 1GBRA 5LJ5j 5LJ5d 3P8HA 5GJVB 3HHTB 1M1KC 2L3SA 4PJOG 2RQWA 5HK3A 2Y4YA 5HK0A 2KSSA 4DBHA 2EIFA 5IH2A 1N9RA 5GAN7 1H3ZA 3VS4A 1UHCA 4F04B 4QVCA 5FU6B 1SEMA 2K3BA 1KFZA 5GMKm 3SWNA 4A53A 3CCQQ 3VUBA 1NYGA 4Z8AA 5IT9E 5A0GA 1LJOA 4M75B 5HKCA 3I9QA 2DVJA 4B9WA 4KBMB 2VUBA 3OW2S 4HCCA 2OTLT 2DAQA 4L5GA 1X27A 4D8DA 3PFSA 1RLPC 4J9CA 1FWZA 1HD3A 3VKIA 5J26A 5FWCA 1K9MU 2G3RA 4KUDK 1RAGB 3CC4Q 4WCIA 1U3OA 2ZZDA 3CCVT 2LTOA 3HL8A 1T3LA 1JXOA 1SRMA 1AZGB 1I1JA 1K9MC 3REAB 1EFNA 4IURA 2XD0A 2KXDA 1G83A 2RQTA 1VQNA 2DO3A 3BFMA 8ATCB 4M75G 3M0QA 1BBZA 2L5QA 4ME7A 1VQNQ 3RBBB 1SHFA 1WDXA 3M0RA 3H9NA 3INZA 3NPFA 2FB7A 1BI1A 3VJPA 2RHIA 5J39A 3CC7A 1TG0A 4ANJA 1XTDA 3OYFA 2EKHA 2JTFA 4BE2A 3SWNC 3M58A 5CKDA 3BDLA 2XDDA 1E6HA 3C94A 1WHMA 8AT1B 1YJ9T 1H8KA 2JTEA 2A0FB 1VQ4A 2LNHB 1GXIE 2E70A 4C8QA 4Z89A 4RTVA 1AEYA 2D1XA 4RCBA 1XOVA 3OYKA 4OB0B 2RJDA 2J6OA 3GLXA 2JMCA 3G4ST 1JQQA 2XHCA 4RUGA 4EIKA 2LQNA 2YLBA 3TQ7P 2CZ7B 1F1BB 5GAOq 4M7AC 3META 1M8VA 2DIGA 2FEIA 4C5HA 1UE9A 4X9DA 4JJDA 4C5EA 5A0LA 2E5QA 3DB4A 2COWA 2X35A 2LP5A 5GANe 1YP5A 3CBPA 3ULRB 3UA7A 2DJZA 3GF5A 4D6WA 3HRSA 3NGPA 4PLIA 3R6NA 4B6MA 2PUOB 4LDXA 5LJ3e 2K3YA 3M0UA 1M5Q1 4K11A 1C6VX 4JRIA 3CCVQ 1R0BG 1PNJA 3JCMP 2NUPA 1D09B 2GTOA 4OP0A 2O9VA 2K3XA 3EFSA 1YIJT 3PE0A 3MCAB 3ER0A 3HKSA 4NS5A 2D9TA 2NUZA 3HP9A 2RB6A 2O4XA 4M7AB 2HMAA 5GANg 4LDVA 1VQ6A 2GGRA 5KYNA 1ZUKA 5GAOl 1TH7A 2EBPA 4WTOB 3V7RA 1VQ6Q 1QQJA 1P92A 5GMKj 2QA4A 2JM9A 1RAIB 1RI0A 1TTHB 4M77C 5LJ3g 4PJJA 1ZSGA 2QA4Q 1WZOA 2EQUA 4OB3B 2EGCA 1K0XA 3WXMB 1KSWA 1YJ9Q 4RTWA 5FW9A 2QQBA 2M02A 3EGDA 4OB2B 3OYJA 5D6WA 3CMEA 1I8FA 4LD9K 1UG1A 2J6KA 2DK3A 2NYSA 3EG9B 4E47A 5GMKl 1K73R 2YWWA 3H0FA 4JJBA 4DBRA 4ELZC 2VGNA 3OS2A 4M77B 4EMHA 2OTJT 1SPKA 2DXUA 5CCAA 5GAN4 5EG2A 2A08A 1WLPB 1WPYA 5FLXE 3M56A 4XTZA 1VQ5T 3SEMA 2F5KA 2JS2A 1VQ9T 2YRVA 4DBFA 1TUDA 1K9AA 4F7UE 2DEUA 4J7FA 2CGHA 4OMQA 4M78G 2RNAA 2D8JA 1RL2A 1QW1A 2CP0A 2MI6A 1M1KR 2QDLA 4NL2A 1B3QA 1RAHB 2LT1A 5KYXA 2DKGA 4JRQA 1SF9A 2EYQA 1YIJQ 2LJ1A 2I0NA 1Z9ZA 3OY9A 1BI2A 1QVFP 1Q81R 3P8DA 4BE1A 2I2LA 4JS4A 2DZCA 3URGA 4BI4A 2WSCE 4N0AC 3FRNA 4PKCC 1KQ1A 5GAMh 2RD1A 3CCEA 2W0ZA 4FSSA 3VRZA 3CCEQ 2EYWA 1NLOC 4Y28E 3OYDA 4FT2A 2VXEA 2GNCA 5GAMf 2WSEE 2ZPBB 2DL5A 1MV3A 4M7DB 4B9XA 4BE0A 3A5ZB 2EKOA 1RAEB 3EGXB 1VQPA 2K9GA 4KUIA 4QKUA 3EGUA 1YJNT 2OAWA 2YDLA 1KC8U 1VQPQ 1M1GA 2LQ8A 1AOJA 5LJ5e 2E5KA 4DQ2A 2VYTA 2EGAA 1PRMC 1I0CA 1T0JA 4PNOA 3LH5A 4GBQA 3E1SA 2A7YA 3CPFA 2ABLA 1W2BA 1W2BS 2LVMA 5GAN6 5J3BA 3GP8A 1D0YA 2L0AA 2QQRA 5CQYA 3MEVA 5IHKA 1YHQT 4FCYA 2CSQA 4E7ZA 3S3MA 3O8VA 2XG8D 4F14A 1K8AC 3CBMA 1B7TA 2EQJA 2MWOA 2CREA 1AWXA 5KYUA 1Y71A 1N9SA 3RERA 4M7DG 2L3QA 2V8IA 3MPUB 1VQ5Q 1VQ9Q 1KIKA 1YWPA 2M0OA 5LJ5g 2QYZA 4AFUC 2RJFA 4IIMA 4FU6A 2DEQA 1PCXA 1TXQA 2H3JA 1KQSA 2DD4A 2KVQG 1OU9A 3V7CA 2FPDA 3S3OA 4M78D 5GAOr 2CDTA 1Y96A 1XQHA 4LXCA 2RHXA 3OQ5A 5LJ3d 5LJ3j 1NJIR 4PJOA 3ASKA 1M3AA 3T9NA 2SEMA 4F7UA 2L2PA 2VB6A 1GFDA 3S3NA 2O31A 2GQIA 3FEOA 3VS5A 1U8RA 1W4SA 5A0DA 1VQOA 4OMFB 4XAXB 1YJNA 2JVVA 1VQOQ 3QZ5B 2QG9B 4OVAA 1M90R 1WQ7A 2ZPEB 1YJNQ 4XQ3A 3X26B 1U1TA 2JW4A 3BE3A 3I55A 1OV3A 3MP1A 4EMKA 2J6FA 3M4YA 4N4HA 1PG5B 3LLRA 1EX4A 1X2KA 3J80E 3I55Q 4IUQA 2PVGB 4ELYC 3CEYA 3JB9I 3M0PA 2KMTA 2LX7A 1SHGA 4C0ZA 5CAIA 2JOYA 2VASA 1PHTA 2HAXA 1V1CA 1H3HA 3PT9A 2RHYA 2FPEA 2CUDA 2KRSA 1NPPA 4M75A 3QYHB 1Y7XA 4C5GA 1W70A 1VQ7T 4M7AE 2CZ1B 4PJOC 1KHCA 2HQHA 4C8QF 3CD6T 2E3HA 3MEWA 1SSFA 2NWMA 2DETA 1BCMA 1LCKA 5CKEA 4JLIA 4C0FA 2PTKA 2QQSA 3UPUA 1XJWB 1PSFA 4NL3A 4CC7A 1WX6A 3OYIA 4JS5A 1VQKA 2AIRB 5C0MA 2YRDA 1VIFA 2LCCA 2GBQA 1VQKQ 1GL5A 1AT1B 1NYFA 5HY6A 1NE8A 2B86A 1VQ8A 3PTAA 1OEBA 1M30A 1K0SA 4ZGEB 5KCHA 4RCCA 5LL6S 2BE9B 4KH1B 4EMKC 2ZPHB 5L8RE 3H41A 5KYYB 5GMKe 4BI3A 2KT8A 5GAN5 3RESA 1JXMA 1YITT 4J9BA 4LDWA 5CKFA 2M51A 2EQMA 2M16A 2WSFE 5D6XA 3SDZA 4J5YA 2L8DA 1VQMT 4L6V5 3MEAA 2ECZA 2ROTA 3NTIA 3H0HA 4M77E 5CKBA 4FYWB 1OOTA 4M75C 3QYGB 1SSHA 4PL6A 1W2BP 2MK5A 2CP2A 1T3SA 2CH4W 2P4RA 2XMFA 4QQ6A 3CCLA 5I21A 1N27A 1M8MA 1QP2A 1FMKA 3CCLQ 4C92G 1UFFA 1UB4A 4JUVA 1Y57A 4FW1A 1AHJB 3TVTA 4DEXA 2OAUA 4QQGA 1ARKA 1I81A 2ZPGB 1HK9A 2V8KA 4BUGA 4PFPA 3JCMb 3JB9F 3CCQA 2KYMA 4FYXB 4QT7A 1KQSP 4XU3A 2X4YA 2QTVA 1DJ7B 4J6XA 2QGFB 4L59A 1VYTA 2YUQA 3CC2T 4GLKA 3LGFA 1EIFA 3QZ9B 3OW2A 1CKAA 1YN8A 2YSQA 1UGSB 3GIBA 2CSIA 3CQTA 2PU9B 1G5VA 3CC4A 2DFUA 2RI3A 1M2VB 1RLQC 4LNPA 1K8AR 4C5IA 3CCJT 3GPLA 2F2VA 1WXUA 2KXCA 4OMLA 3CMAT 2QEXA 3HRTA 1G2BA 2HNIA 4M7AA 2L89A 2QEXQ 1WHGA 2XI9A 4IIOA 3I5RA 1LVKA 1ZBXA 5CKHA 4HT8A 1VIEA 2GQVA 2AZVA 1PC0A 4LUDA 2EYXA 4IUTA 4O5VA 2C0IA 2LRQA 1KG1A 2C0OA 3JCMe 3HPWA 2B8AA 5GJWB 1IHWA 2RHZA 4Y91A 1UJYA 2ESWA 3MP6A 2KAFA 1VQLT 3I5SA 2EVRA 4FW2A 1Q7YU 2FZGB 3LGLA 4GY5A 4OGCA 3QUIA 4D8KA 1IXDA 1KD1R 3LWHA 1D3BB 1BI0A 4LDUA 2DE0X 3EG9A 3UA6A 5IN1A 3THKA 1R77A 2EJFA 3M53A 2JXBA 4TVRA 4XU2A 3JCMg 1D1CA 2IVWA 4C92D 1ACMB 1Q7YC 4M77A 3H8ZA 1B34A 2F2WA 2PUKB 4JDSA 2X4XA 3C95A 2P84A 2W10A 2K5LA 4JRKA 2E1HA 2FVUA 2IIMA 1Q86R 3G71T 3X20B 1CSKA 3QDFA 1PKSA 2OTLA 1WI7A 4RMOA 2KT1A 2LC4A 2DTOA 1UDLA 2OTLQ 3KXTA 3G7ZA 2CKKA 5L23A 4XK8E 3A98A 2DRKA 1NPRA 1JO8A 4E7JA 4Z88A 3CCJQ 9ATCB 1YI2T 3CCVA 2KQWA 4FL6A 2V1RA 2RH2A 1PSEA 2E3IA 2AHJB 5KYWA 2J7IA 3HTRA 4M78C 4DOWA 2K57A 2A37A 2E64A 5KE2A 7AT1B 4RG8A 2DIQA 2PVOB 2YXYA 3MHXA 4PK4A 1Y07A 4IUVA 1X43A 1E6GA 1QP3A 1YCYA 4KGVB 4HVUA 2KRNA 3CCST 1MMDA 2NLUA 1QKWA 2RMOA 4QVDA 3MEUA 2DLPA 1H92A 2BKDN 3VRYA 3KUFA 3KFVA 1GCQC 1PD0A 1V29B 4ATOA 2DL7A 3VUZA 1YJ9A 5C6SA 5DLOA 1VYVA 1AWWA 1OPKA 2HD0A 2A28A 4MMLA 1BK2A 5IAYA 2EAYA 4PJOF 2JUFA 3V8LA 4ZTJA 1WIEA 4R55A 1GCPA 4XTXA 1NEGA 4M78B 1WHKA 1JEGA 4F7UF 4N0AA 3L2QA 3M5AA 1X75C 2VWFA 2P0QA 3G4SA 5LJ5h 2CP6A 1OI1A 3BY7A 4BDYA 3LW5E 4RTXA 3G4SQ 1FYNA 2MCNA 2X3WD 2KNBB 2LDMA 2ZAEA 5AT1B 4LN2A 4E7SA 3RUXA 2F69A 3OW2P 4BI8B 4V2SA 1HJDA 4BDZA 4E6RA 3I56T 4KGXB 1ZUUA 5FU7B 3LX7A 1M3CA 2P0KA 4M4ZA 2AKLA 2KK4A 2Z0WA 1FX7A 6AT1B 3CXCA 1IZ6A 3CXCS 3UDCA 3P8BB 4PJOE 2RI2A 2LMJA 4AFSC 2R58A 3DB3A 3A8MB 3R6OA 1MNEA 3QDRB 3QIIA 1AWJA 4J9DA 2RK2A 4AG2C 2GFAA 2NUTB 4M7DC 2HZYA 4ORZA 3WVEB 3OYAA 2JZ2A 1YIJA 4J7IA 4A54A 4M75F 3V8KA 1TSFA 4IUPA 3PGGA 3SB2A 3CPWS 3CCRT 1B07A 3VS1A 1A0NB 4MDWA 2AKKA 1MGQA 1C1AA 3U23A 1OU8A 3OB9A 3G6ET 4E2FB 4C8QG 2K4YA 3C4SA 3E9GA 4IKFA 2BTTA 4PJMA 1N8RU 5IHNA 2KE9A 3VV0A 1OYXA 1K76A 3PMTA 4KRTA 4P5NA 2M1HA 4E7KA 1J3TA 1W6XA 2WACA 5GMKi 3EFOB 1MMNA 2BE7D 4M75E 2R5MA 3JCMd 1K9MR 2E65A 5A2QE 1RACB 1M9SA 3VYHB 1QCFA 4X1VA 4YTLA 2VC8A 2YUPA 2HQEA 4JPBW 3JV3A 2YLCA 1Q95G 3FC3A 2XU8A 2HEQA 1KC8C 3OYNA 3UF4A 3H0IA 4J6YA 1OZ2A 2JS0A 1QLYA 1UGPB 2MPXC 3I56Q 1QVGA 2OTJA 3GNFB 1QVGS 3UT1A 5CR2A 3L2WA 1AVZC 1VQ5A 1N5ZA 2OTJQ 1VQ9A 3PMIA 4KULA 3EGDB 4QVZA 2D8HA 3EHRA 1M4ZA 1U1SA 2HDAA 3MKDA 4PFZA 5CK9A 3PIPA 2DZ9A 4LDYA 4CRIA 1U06A 1ZX6A 1OZ3A 2YRCA 2JM8A 3TREA 1BI3A 3CCMT 1ZSZC 3MP8A 3IQLA 5KYYA 1S72T 3ZEHA 3OA6A 3JB9G 4O6JA 2V26A 2SRCA 4OMOA 2LQWA 1G3YA 4RTYA 4XU0A 2A3LA 2HSPA 2K5FA 4FSXA 3OBWA 4PJNA 5KYXB 4C8QD 2HKQB 2K5IA 4ZTFA 5GAMe 2BIVA 1X01A 3UATA 3VS6A 4N4GA 1YJWT 3DKMA 4OMPA 4JZ3A 2X9HA 1MMAA 2HL3A 3QSUA 4M7AF 1WQWA 3ZFJA 2DXBA 4R0KA 3NTKA 2DBMA
chains in the Genus database with same CATH topology
3TVTA 4DEXA 1YP5A 2ENMA 2JMAA 1ARKA 3ULRB 3UA7A 1VYUA 2KGTA 2KYMA 3NGPA 3R6NA 2YUOA 4QT7A 5I22A 1K1ZA 1VYTA 2VVKA 3M0UA 4J9GA 2YUQA 4K11A 4AFQC 3TSWA 2EW3A 4ZNXA 1PNJA 1GRIA 2GTOA 2RQRA 2LZ6B 2O9VA 1CKAA 1YN8A 2YSQA 3PE0A 2DRMA 2CSIA 3CQTA 3VS2A 4CC4B 3RNJA 2NUZA 2M0YA 2YUNA 3VS7A 1IO6A 1YCSB 2EYYA 3FJ5A 1UUEA 1RLQC 4LNPA 3SHWA 4DEYA 3VS3A 2K6DA 2GGRA 2KBTA 1AWOA 4LE9A 2F2VA 1WXUA 1ZUKA 4F16A 2EBPA 2KXCA 4OMLA 1ZUYA 1VA7A 1WXTA 1G2BA 2HCKA 2JM9A 2PNIA 3TSZA 1ZSGA 4IIOA 3I5RA 2EGCA 1K0XA 5FWBA 3PVQA 2X3XD 5IHIA 1E7OA 2AZVA 1KSWA 4RTWA 5FW9A 1K4US 2JT4A 2DYBA 4LUDA 2EYXA 1ABOA 2C0IA 2K7AA 2C0OA 1BU1A 4HCKA 1GBQA 2LJ3A 1S1NA 2F2XA 5GJWB 2EQIA 1UJYA 2K79A 2ESWA 1NEBA 1NG2A 1UG1A 2J6KA 3NHNA 3I5SA 2DJQA 2EVRA 4OMNA 3H0FA 4JJBA 2DL8A 1CKBA 4RTUA 4D8KA 2MOXA 2DE0X 3UA6A 2BZ8A 3THKA 1SPKA 2GTJA 2A08A 1WLPB 2JXBA 3VS0A 3SEMA 4OMMA 2JS2A 3M0SA 3PVLA 2J05A 2F2WA 1TUDA 1K9AA 1X2QA 4OMQA 2W10A 2RNAA 2A36A 2D8JA 2G6FX 2IIMA 2DM1A 2QDLA 2CT3A 1B3QA 1CSKA 1PKTA 1PKSA 1WI7A 1WFWA 2DL3A 2KT1A 1X69A 1UDLA 1RI9A 2LJ1A 2I0NA 4J9FA 1Z9ZA 2LJ0A 5L23A 3A98A 2DRKA 3QWXX 1GFCA 1JO8A 2YT6A 3EG1A 4Z88A 1ZLMA 2DBKA 4GLMA 2V1RA 2KR3A 2CH4A 2W0ZA 4FSSA 2J7IA 3VRZA 2EYWA 1NLOC 1JU5C 2A37A 2DF6A 2OI3A 4F17A 2ROLA 3M0TA 2GNCA 1X43A 1E6GA 4JJCA 2DL5A 4HVUA 1MV3A 1WA7A 2KRNA 1ZBJA 1QKWA 2K9GA 2O9SA 1UECA 2RMOA 3EGUA 1QKXA 2OAWA 2YDLA 2FG0A 2DLPA 1H92A 1AOJA 3VRYA 1X6GA 2E5KA 2EGAA 1PRLC 1PRMC 2RN8A 3KFVA 1GCQC 1I0CA 1T0JA 2RF0A 3LH5A 3EHQA 4GBQA 2DL7A 3C0CA 2ABLA 2OJ2A 3NMZC 4JZ4A 2FO0A 3ZL7C 2L0AA 3O5ZA 3QWYA 1VYVA 1AWWA 1OPKA 2A28A 1BK2A 2KYBA 5IHKA 2CSQA 1WIEA 4F14A 1GCPA 1NEGA 2DX1A 4Y92A 2D0NA 1WXBA 1JEGA 2FRWA 2CREA 2VWFA 2PZ1A 1AWXA 1UTIA 2L3QA 2KEAA 4RTXA 2DL4A 1KIKA 1YWPA 1FYNA 2ED0A 2MCNA 2X3WD 1OPLA 1QWFA 1X6BA 2KNBB 4AFUC 4IIMA 2KRMA 1UJ0A 4CC3A 1Y0MA 4LN2A 4CC2A 2DMOA 1HJDA 4E6RA 2LCSA 2DILA 5IXBA 1ZUUA 1QWEA 1M3CA 2FPDA 4M4ZA 2AKLA 5I11A 1M27C 1RUWA 2CDTA 2LMJA 1GCQA 4AFSC 2J06A 3GBQA 5ECAA 2KROA 1AWJA 4J9DA 4AG2C 3REBB 1Z9QA 2MIOA 2VKNA 4ORZA 4ESRA 4J9IA 1AD5A 1M3AA 2SEMA 2L2PA 1YNZA 1UHFA 1I07A 1GFDA 1M3BA 2O31A 2GQIA 3VS5A 4HVWA 5EC7A 1TUCA 4RTTA 5IXFA 5HCKA 4HVVA 1MUZA 1B07A 2CT4A 3VS1A 2V1QA 1A0NB 2AKKA 4AFZC 3U23A 2EYZA 1AZEA 4A63B 1GBRA 5GJVB 2RQUA 2BTTA 2L3SA 2FRYA 2BZYA 2JW4A 2RQWA 5IHNA 1OV3A 2KE9A 2J6FA 5IH2A 2O2OA 1K76A 1KJWA 1X2KA 3VS4A 4KRTA 1UHCA 3EG3A 3M0PA 1SEMA 2K3BA 1J3TA 1W6XA 1KFZA 2AZSA 2LX7A 2ED1A 1NYGA 4Z8AA 1SHGA 2L3PA 1NLPC 3I9QA 2DVJA 2DA9A 1PHTA 2AK5A 2RPNA 1V1CA 1H3HA 1QCFA 2FPEA 1X27A 4D8DA 1NM7A 2CUDA 2KRSA 4X1VA 1RLPC 1UGVA 4J9CA 1HD3A 1YWOA 2YUPA 2CUBA 5FWCA 1W70A 1SRLA 4JPBW 3JV3A 2HEQA 2EPDA 4WCIA 1W1FA 3UF4A 3H0IA 1U3OA 2NWMA 2JS0A 1QLYA 1LCKA 4AG1C 1T0HA 2PTKA 1T3LA 1MV0B 2O88A 2FPFA 1AVZC 1JXOA 1SRMA 1WX6A 2H8HA 1AZGB 4CC7A 1I1JA 1N5ZA 3REAB 1EFNA 2DNUA 2GBQA 2KXDA 1G83A 2RQTA 1GL5A 2D8HA 1NYFA 2B86A 3EHRA 1OEBA 3M0QA 1BBZA 3EG0A 2HDAA 3RBBB 1M30A 1K0SA 1SHFA 1WDXA 1BB9A 3M0RA 4HXJA 3NPFA 1WYXA 3H41A 1U06A 2C0TA 1TG0A 1ZX6A 2KT8A 2JM8A 4LUEA 2EKHA 1JXMA 2K2MA 4J9BA 1U5SA 1E6HA 2M51A 3IQLA 4J9EA 3I35A 1H8KA 2JTEA 1HSQA 2LNHB 2ECZA 2ROTA 3EG2A 4J9HA 4Z89A 4RTVA 1AEYA 2SRCA 4OMOA 3H0HA 2RQVA 2D1XA 2LQWA 1XOVA 1OOTA 2EGEA 1SSHA 4RTYA 2J6OA 2HSPA 2JMCA 1T3SA 4RTZA 2CH4W 2P4RA 1JQQA 2XMFA 4EIKA 4RUGA 2LQNA 3UATA 3VS6A 1M8MA 4OMPA 2BZXA 1PWTA 2FEIA 4JZ3A 1FMKA 1UE9A 4JJDA 1UFFA 2HBWA 1ABQA 4R0KA 1Y57A 2LP5A 2DBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVT A;  4DEX A;  1YP5 A;  2ENM A;  2JMA A;  1ARK A;  3ULR B;  3UA7 A;  1VYU A;  2KGT A;  2KYM A;  3NGP A;  3R6N A;  2YUO A;  4QT7 A;  5I22 A;  1K1Z A;  1VYT A;  2VVK A;  3M0U A;  4J9G A;  2YUQ A;  4K11 A;  4AFQ C;  3TSW A;  2EW3 A;  4ZNX A;  1PNJ A;  1GRI A;  2GTO A;  2RQR A;  2LZ6 B;  2O9V A;  1CKA A;  1YN8 A;  2YSQ A;  3PE0 A;  2DRM A;  2CSI A;  3CQT A;  3VS2 A;  4CC4 B;  3RNJ A;  2NUZ A;  2M0Y A;  2YUN A;  3VS7 A;  1IO6 A;  1YCS B;  2EYY A;  3FJ5 A;  1UUE A;  1RLQ C;  4LNP A;  3SHW A;  4DEY A;  3VS3 A;  2K6D A;  2GGR A;  2KBT A;  1AWO A;  4LE9 A;  2F2V A;  1WXU A;  1ZUK A;  4F16 A;  2EBP A;  2KXC A;  4OML A;  1ZUY A;  1VA7 A;  1WXT A;  1G2B A;  2HCK A;  2JM9 A;  2PNI A;  3TSZ A;  1ZSG A;  4IIO A;  3I5R A;  2EGC A;  1K0X A;  5FWB A;  3PVQ A;  2X3X D;  5IHI A;  1E7O A;  2AZV A;  1KSW A;  4RTW A;  5FW9 A;  1K4U S;  2JT4 A;  2DYB A;  4LUD A;  2EYX A;  1ABO A;  2C0I A;  2K7A A;  2C0O A;  1BU1 A;  4HCK A;  1GBQ A;  2LJ3 A;  1S1N A;  2F2X A;  5GJW B;  2EQI A;  1UJY A;  2K79 A;  2ESW A;  1NEB A;  1NG2 A;  1UG1 A;  2J6K A;  3NHN A;  3I5S A;  2DJQ A;  2EVR A;  4OMN A;  3H0F A;  4JJB A;  2DL8 A;  1CKB A;  4RTU A;  4D8K A;  2MOX A;  2DE0 X;  3UA6 A;  2BZ8 A;  3THK A;  1SPK A;  2GTJ A;  2A08 A;  1WLP B;  2JXB A;  3VS0 A;  3SEM A;  4OMM A;  2JS2 A;  3M0S A;  3PVL A;  2J05 A;  2F2W A;  1TUD A;  1K9A A;  1X2Q A;  4OMQ A;  2W10 A;  2RNA A;  2A36 A;  2D8J A;  2G6F X;  2IIM A;  2DM1 A;  2QDL A;  2CT3 A;  1B3Q A;  1CSK A;  1PKT A;  1PKS A;  1WI7 A;  1WFW A;  2DL3 A;  2KT1 A;  1X69 A;  1UDL A;  1RI9 A;  2LJ1 A;  2I0N A;  4J9F A;  1Z9Z A;  2LJ0 A;  5L23 A;  3A98 A;  2DRK A;  3QWX X;  1GFC A;  1JO8 A;  2YT6 A;  3EG1 A;  4Z88 A;  1ZLM A;  2DBK A;  4GLM A;  2V1R A;  2KR3 A;  2CH4 A;  2W0Z A;  4FSS A;  2J7I A;  3VRZ A;  2EYW A;  1NLO C;  1JU5 C;  2A37 A;  2DF6 A;  2OI3 A;  4F17 A;  2ROL A;  3M0T A;  2GNC A;  1X43 A;  1E6G A;  4JJC A;  2DL5 A;  4HVU A;  1MV3 A;  1WA7 A;  2KRN A;  1ZBJ A;  1QKW A;  2K9G A;  2O9S A;  1UEC A;  2RMO A;  3EGU A;  1QKX A;  2OAW A;  2YDL A;  2FG0 A;  2DLP A;  1H92 A;  1AOJ A;  3VRY A;  1X6G A;  2E5K A;  2EGA A;  1PRL C;  1PRM C;  2RN8 A;  3KFV A;  1GCQ C;  1I0C A;  1T0J A;  2RF0 A;  3LH5 A;  3EHQ A;  4GBQ A;  2DL7 A;  3C0C A;  2ABL A;  2OJ2 A;  3NMZ C;  4JZ4 A;  2FO0 A;  3ZL7 C;  2L0A A;  3O5Z A;  3QWY A;  1VYV A;  1AWW A;  1OPK A;  2A28 A;  1BK2 A;  2KYB A;  5IHK A;  2CSQ A;  1WIE A;  4F14 A;  1GCP A;  1NEG A;  2DX1 A;  4Y92 A;  2D0N A;  1WXB A;  1JEG A;  2FRW A;  2CRE A;  2VWF A;  2PZ1 A;  1AWX A;  1UTI A;  2L3Q A;  2KEA A;  4RTX A;  2DL4 A;  1KIK A;  1YWP A;  1FYN A;  2ED0 A;  2MCN A;  2X3W D;  1OPL A;  1QWF A;  1X6B A;  2KNB B;  4AFU C;  4IIM A;  2KRM A;  1UJ0 A;  4CC3 A;  1Y0M A;  4LN2 A;  4CC2 A;  2DMO A;  1HJD A;  4E6R A;  2LCS A;  2DIL A;  5IXB A;  1ZUU A;  1QWE A;  1M3C A;  2FPD A;  4M4Z A;  2AKL A;  5I11 A;  1M27 C;  1RUW A;  2CDT A;  2LMJ A;  1GCQ A;  4AFS C;  2J06 A;  3GBQ A;  5ECA A;  2KRO A;  1AWJ A;  4J9D A;  4AG2 C;  3REB B;  1Z9Q A;  2MIO A;  2VKN A;  4ORZ A;  4ESR A;  4J9I A;  1AD5 A;  1M3A A;  2SEM A;  2L2P A;  1YNZ A;  1UHF A;  1I07 A;  1GFD A;  1M3B A;  2O31 A;  2GQI A;  3VS5 A;  4HVW A;  5EC7 A;  1TUC A;  4RTT A;  5IXF A;  5HCK A;  4HVV A;  1MUZ A;  1B07 A;  2CT4 A;  3VS1 A;  2V1Q A;  1A0N B;  2AKK A;  4AFZ C;  3U23 A;  2EYZ A;  1AZE A;  4A63 B;  1GBR A;  5GJV B;  2RQU A;  2BTT A;  2L3S A;  2FRY A;  2BZY A;  2JW4 A;  2RQW A;  5IHN A;  1OV3 A;  2KE9 A;  2J6F A;  5IH2 A;  2O2O A;  1K76 A;  1KJW A;  1X2K A;  3VS4 A;  4KRT A;  1UHC A;  3EG3 A;  3M0P A;  1SEM A;  2K3B A;  1J3T A;  1W6X A;  1KFZ A;  2AZS A;  2LX7 A;  2ED1 A;  1NYG A;  4Z8A A;  1SHG A;  2L3P A;  1NLP C;  3I9Q A;  2DVJ A;  2DA9 A;  1PHT A;  2AK5 A;  2RPN A;  1V1C A;  1H3H A;  1QCF A;  2FPE A;  1X27 A;  4D8D A;  1NM7 A;  2CUD A;  2KRS A;  4X1V A;  1RLP C;  1UGV A;  4J9C A;  1HD3 A;  1YWO A;  2YUP A;  2CUB A;  5FWC A;  1W70 A;  1SRL A;  4JPB W;  3JV3 A;  2HEQ A;  2EPD A;  4WCI A;  1W1F A;  3UF4 A;  3H0I A;  1U3O A;  2NWM A;  2JS0 A;  1QLY A;  1LCK A;  4AG1 C;  1T0H A;  2PTK A;  1T3L A;  1MV0 B;  2O88 A;  2FPF A;  1AVZ C;  1JXO A;  1SRM A;  1WX6 A;  2H8H A;  1AZG B;  4CC7 A;  1I1J A;  1N5Z A;  3REA B;  1EFN A;  2DNU A;  2GBQ A;  2KXD A;  1G83 A;  2RQT A;  1GL5 A;  2D8H A;  1NYF A;  2B86 A;  3EHR A;  1OEB A;  3M0Q A;  1BBZ A;  3EG0 A;  2HDA A;  3RBB B;  1M30 A;  1K0S A;  1SHF A;  1WDX A;  1BB9 A;  3M0R A;  4HXJ A;  3NPF A;  1WYX A;  3H41 A;  1U06 A;  2C0T A;  1TG0 A;  1ZX6 A;  2KT8 A;  2JM8 A;  4LUE A;  2EKH A;  1JXM A;  2K2M A;  4J9B A;  1U5S A;  1E6H A;  2M51 A;  3IQL A;  4J9E A;  3I35 A;  1H8K A;  2JTE A;  1HSQ A;  2LNH B;  2ECZ A;  2ROT A;  3EG2 A;  4J9H A;  4Z89 A;  4RTV A;  1AEY A;  2SRC A;  4OMO A;  3H0H A;  2RQV A;  2D1X A;  2LQW A;  1XOV A;  1OOT A;  2EGE A;  1SSH A;  4RTY A;  2J6O A;  2HSP A;  2JMC A;  1T3S A;  4RTZ A;  2CH4 W;  2P4R A;  1JQQ A;  2XMF A;  4EIK A;  4RUG A;  2LQN A;  3UAT A;  3VS6 A;  1M8M A;  4OMP A;  2BZX A;  1PWT A;  2FEI A;  4JZ3 A;  1FMK A;  1UE9 A;  4JJD A;  1UFF A;  2HBW A;  1ABQ A;  4R0K A;  1Y57 A;  2LP5 A;  2DBM A; 
#chains in the Genus database with same CATH topology
 2X4W A;  2JMA A;  2XDP A;  1UGQ B;  1ZSZ B;  4C0D B;  1VYU A;  2BUD A;  2CYZ B;  2EQK A;  2KGT A;  1N6A A;  2YUO A;  5I22 A;  3A8O B;  1YHQ A;  2PVD B;  4J9G A;  3A8L B;  1YHQ Q;  2CP3 A;  3TSW A;  2EW3 A;  3BDU A;  1GRI A;  2RQR A;  5GAM g;  3CCU T;  2LZ6 B;  3NTH A;  2DRM A;  4J83 A;  3VU3 C;  3OYL A;  3VS2 A;  3OYE A;  2YUN A;  4C92 C;  1IO6 A;  3FJ5 A;  1UUE A;  2P0P A;  3HRU A;  3SHW A;  5AYF A;  3L2V A;  4DEY A;  4LE9 A;  1VA7 A;  1WXT A;  1M2V A;  3TSZ A;  2ZPF B;  2MMP A;  3L1A A;  4M77 F;  1Q82 U;  3CBO A;  3FJP A;  3PVQ A;  2DXC A;  2HSE B;  2X3X D;  4ZGD B;  1ZA1 B;  1S72 Q;  2JT4 A;  4JRP A;  3C12 A;  3EAE A;  3JCM W;  1ABO A;  1M2O A;  1VUB A;  1M1F A;  1BU1 A;  4M78 E;  3JCM c;  4HCK A;  4QW2 A;  1GBQ A;  3JRZ A;  5D7U A;  3HSB A;  1S1N A;  2F2X A;  4OF1 A;  1Q82 C;  2FYK A;  4E7H A;  3JB9 D;  2E41 A;  4HA8 A;  4C92 B;  3J81 E;  2K79 A;  2EJG A;  1D1B A;  2JJ9 A;  3OS1 A;  2DJQ A;  4FIB A;  1CKB A;  4RTU A;  2F5T X;  1I5O B;  2COZ A;  2CP7 A;  3QPH A;  3HFN A;  1K73 U;  2BZ8 A;  4WF2 A;  2GTJ A;  3L42 A;  4A4H A;  2E10 A;  2XDB A;  3VS0 A;  1D3B A;  4OMM A;  3M0S A;  2J05 A;  1TOV A;  1D0X A;  1WHJ A;  1VQN T;  1X2Q A;  1G8X A;  3OYH A;  2A36 A;  2G6F X;  2QDY B;  1QVG P;  4XTV A;  2CT3 A;  1K73 C;  1PKT A;  4M7D F;  1WFW A;  4A4G A;  3HFO A;  2CZ0 B;  2QTX A;  1RI9 A;  3M59 A;  4J9F A;  3L2R A;  2LJ0 A;  1M1K U;  2VV5 A;  3CC7 T;  4DOV A;  1VQ7 A;  2CP5 A;  3SD4 A;  5FRO A;  3QWX X;  2Y4X A;  1GFC A;  1VQ7 Q;  4EPC A;  2YT6 A;  3CD6 A;  3EG1 A;  2QQA A;  1QVP A;  1IRE B;  3L2Z A;  4A4K A;  4MZT A;  4XU1 A;  1SKU B;  3RIR A;  3CD6 Q;  1VQ4 T;  4PLL A;  1ZQ1 A;  1Q81 U;  2CH4 A;  2PQW A;  3WVD B;  2LQK A;  2DF6 A;  2OI3 A;  4F17 A;  4F7U G;  3LWI A;  1C0M A;  2ROL A;  3M0T A;  5GAN h;  1KC8 R;  2O01 E;  4JJN K;  4HT9 A;  1WA7 A;  4M7D E;  5GAO p;  2RM4 A;  3SFM A;  1Q81 C;  2L3R A;  2OX7 A;  1IGU A;  3M4G A;  1OX8 A;  5CQX A;  2DER A;  2FG0 A;  2GFU A;  5LJ3 h;  2RN8 A;  5GAN f;  1BIB A;  3OS0 A;  1YIT A;  2DVE A;  2RF0 A;  3EHQ A;  4J8O A;  4E7I A;  1YIT Q;  5CO7 A;  3NMZ C;  3QXE B;  1VQM A;  3O5Z A;  3JAM E;  5LJ3 f;  3QHS A;  2LX9 A;  5CVI A;  2COY A;  4MMK A;  1VQM Q;  2KYB A;  2VXF A;  4ZN1 A;  4HKE A;  3UWN A;  1PD1 A;  2DX1 A;  2LNV A;  2D0N A;  1WXB A;  2RJE A;  2IG0 A;  1TU0 B;  2PZ1 A;  1JJ2 A;  2FL7 A;  1R8O B;  1JJ2 S;  1RAA B;  1UTI A;  3DLM A;  1BYM A;  2DL4 A;  1FMV A;  4M78 A;  2ED0 A;  1QVF A;  1QVF S;  1OPL A;  1QWF A;  2YHT A;  5GAM j;  5GAM d;  1IHV A;  3RMQ A;  1TUG B;  2KRM A;  1UJ0 A;  3M55 A;  1Y0M A;  4FM4 B;  3JCM V;  1WJS A;  1VQ6 T;  4OGE A;  3JSC A;  2LCS A;  2DIL A;  2RA2 A;  1QWE A;  3V8J A;  3OBY A;  1JBM A;  3L2U A;  2QA4 T;  1MHN A;  5I11 A;  3CC7 Q;  1KHI A;  1GCQ A;  4ZN3 A;  4PFO A;  1KK7 A;  2RO0 A;  3CC2 A;  2LT4 A;  2M9U A;  3ME9 A;  1Z9Q A;  2MIO A;  2VKN A;  1VQ4 Q;  4ESR A;  2QK0 A;  3CC2 Q;  4J9I A;  2V8J A;  1AD5 A;  5GAN 2;  2XK0 A;  1NZ9 A;  3CME T;  1NJI U;  1YNZ A;  1UHF A;  4C0G A;  1I07 A;  5KE3 A;  2NUT A;  1M3B A;  3X28 B;  2HBP A;  5IXF A;  4BAC A;  3CCJ A;  1MUZ A;  3EFR A;  4PJO D;  3BW1 A;  3PNW C;  2EYZ A;  3CMA A;  4A63 B;  5D6Y A;  1JB0 E;  2ZPI B;  3QBY A;  1NJI C;  3CMA Q;  3RKY A;  2RQU A;  2FRY A;  2BZY A;  3SWN B;  2MAM A;  1M90 U;  1G3W A;  3JCM X;  2O2O A;  1KJW A;  2DTH A;  3EG3 A;  3A1P A;  2AZS A;  3F70 A;  2ED1 A;  2HL5 C;  1YFN A;  1WGS A;  4XTU A;  2L3P A;  1NLP C;  2DA9 A;  4QQD A;  3MO8 A;  2AK5 A;  2RPN A;  1M90 C;  4M7D A;  1NM7 A;  3EFO A;  5FU7 C;  3EGX A;  1VQL A;  4ZGJ B;  1UGV A;  3RDV A;  1YWO A;  1TS9 A;  3X24 B;  4C8Q C;  2CUB A;  1JRI A;  1SRL A;  1VQL Q;  3OYB A;  2FHD A;  4C92 F;  4RKU E;  4JLG A;  2EPD A;  1IGQ A;  1D1A A;  1W1F A;  5GAN 8;  2D6F A;  2RI5 A;  4XTW A;  4DA4 A;  1Q82 R;  4AG1 C;  1T0H A;  1MV0 B;  4M75 D;  2O88 A;  2FPF A;  3CCE T;  2H8H A;  5CIU A;  4R56 A;  2DNU A;  1QCO A;  2EWN A;  1RAD B;  2E6Z A;  2XKO C;  4LD6 A;  3EG0 A;  3QJ6 A;  3RMS A;  4IUU A;  3G71 A;  4A4E A;  1WHL A;  1BB9 A;  4HXJ A;  2DYI A;  3G71 Q;  1RAF B;  1VQP T;  5LJ5 f;  3QO3 A;  3QJY A;  1WYX A;  4DBQ A;  2C0T A;  2QQ9 A;  2CZ6 B;  1OUL A;  1ZA2 B;  4OB1 B;  4C92 E;  3CME Q;  4LUE A;  4M7A G;  4C8Q B;  1R0C B;  1O75 A;  2K2M A;  1U5S A;  4KT0 E;  4J9E A;  3I35 A;  3QG1 A;  1HSQ A;  3LYI A;  1YI2 A;  4XTY A;  1BIA A;  1YI2 Q;  2QI2 A;  3EG2 A;  4J9H A;  2FZK B;  2RQV A;  3H6Z A;  1B34 B;  5KCO A;  3A8G B;  1ZHI A;  2EGE A;  2RHU A;  4RG2 A;  3OMG A;  2C06 A;  4X34 A;  2MYS A;  4RTZ A;  1HXD A;  3CCS A;  4X9C A;  3CPW A;  5DM7 R;  2CS7 A;  2ATC B;  1IRX A;  3JCM J;  3CCS Q;  1X6O A;  2BZX A;  4FYV B;  1PWT A;  1H64 1;  3OS5 A;  1JJ2 P;  4MZM A;  2HBW A;  1ABQ A;  5FRM A;  2ENM A;  3EH1 A;  1MMG A;  4Z02 A;  3J7A F;  1QCN A;  5I2S A;  5KYW B;  3ZBD A;  4E7L A;  2NUP B;  4M77 G;  1K1Z A;  3N5B B;  2VGM A;  1I5L A;  3Q1J A;  2VVK A;  1ZSZ A;  2FZC B;  3E9F A;  4AFQ C;  4ZNX A;  4AT1 B;  1N8R C;  3PIO A;  2IPO B;  2O4X B;  4VUB A;  3A8H B;  3TCJ A;  2F1L A;  4CC4 B;  3RNJ A;  2M0Y A;  1TWB A;  3TU4 K;  3VS7 A;  1YCS B;  2EYY A;  1OX9 A;  1VQO T;  3VS3 A;  2K6D A;  2KBT A;  3I56 A;  1AWO A;  4F16 A;  4A4F A;  2ZGW A;  1ZUY A;  2AT1 B;  3QKJ A;  2HCK A;  1K8A U;  2PNI A;  1I4K 1;  2RJC A;  4NOY A;  3I55 T;  5KH6 A;  4EMG A;  5FWB A;  4BB7 A;  5IHI A;  1FMW A;  2JN0 A;  1E7O A;  1G3T A;  4EDU A;  3M57 A;  1K4U S;  2DYB A;  2QGG A;  1FXX A;  4BY6 C;  1WHH A;  4M7A D;  2K7A A;  4FT4 A;  3G1J A;  2LJ3 A;  3RKW A;  1Q7Y R;  4KGZ B;  2EQI A;  4J6W A;  3RKX A;  4AMC A;  1NEB A;  1NG2 A;  3CCR A;  3NHN A;  4C0D C;  4N4I A;  4OMN A;  3CCR Q;  1LOJ A;  2DL8 A;  3G6E A;  1UGR B;  1QMC A;  1KQS S;  4C92 A;  2MOX A;  3G6E Q;  4CI0 C;  3D7S B;  2E12 A;  5GAN d;  5GAN j;  1BCO A;  1KD1 U;  1VQK T;  5GMK h;  1WJR A;  3PVL A;  3VYG A;  1LNX A;  3RR6 A;  4BY6 B;  2ZCF B;  1VQ8 T;  1BKB A;  1V76 A;  2DM1 A;  5FRN A;  1IB8 A;  2KY9 A;  4HCB A;  1UEB A;  2DL3 A;  2KI7 A;  4MZP A;  1X69 A;  5I2M A;  1KD1 C;  4M77 D;  1PM3 A;  1Q86 U;  3FLG A;  1HYO A;  2E6N A;  1ZLM A;  2DBK A;  4GLM A;  3FDR A;  1OQK A;  2RK1 A;  1RAB B;  1WJQ A;  1XNI A;  2HQX A;  2KR3 A;  4UC4 A;  1Q86 C;  3MJX A;  1O9S A;  2K2V A;  3OYM A;  3KBG A;  3CXC P;  4HCZ A;  1JU5 C;  1EZZ B;  5GAN 3;  4M78 F;  3X25 B;  4JJC A;  2XID A;  5DY9 A;  4KH0 B;  1SG5 A;  2JTM A;  2LCL A;  3V7S A;  3DLL A;  1ZBJ A;  2O9S A;  3CCL T;  1UEC A;  1QKX A;  4Q5W A;  3AT1 B;  3AHU A;  2Y90 A;  1X6G A;  4PJL A;  2DPP B;  3OSV A;  1PRL C;  3FB9 A;  2H3E B;  1KQ2 A;  2QAS A;  3CCM A;  2GF7 A;  1YBY A;  3CPW P;  3OYC A;  3C0C A;  1S72 A;  3CCM Q;  2OJ2 A;  2QAZ A;  2D0Q B;  4JZ4 A;  2FO0 A;  3ZL7 C;  3LH0 A;  3QWY A;  5DLQ E;  3CCQ T;  2X51 A;  4FYY B;  3OSS C;  5KYU B;  4M7D D;  1D0Z A;  2MWP A;  2MF2 A;  1VOM A;  3M9Q A;  3GOX A;  4Y92 A;  2XIC A;  2FRW A;  3JB9 H;  2JNG A;  2P4T A;  2KEA A;  1X6B A;  2DD5 A;  1YJW A;  1VQ8 Q;  3CC4 T;  4CC3 A;  1MND A;  1YJW Q;  4CC2 A;  2DMO A;  1Y96 B;  2HKN A;  5IXB A;  4BD3 A;  5M9O A;  2DXT A;  3JB9 J;  3JCM h;  2QEX T;  4C8Q E;  3S6W A;  1M27 C;  2EFI A;  2R57 A;  1RUW A;  3E19 A;  2GCX A;  3TEE A;  1LPL A;  2DTI A;  4PJO B;  3JCM Q;  2E4H A;  2J06 A;  1NBE B;  3GBQ A;  5ECA A;  2KRO A;  4F7U B;  5FU6 C;  3JCM f;  3REB B;  3OMC A;  2R5A A;  1WNL A;  3CCU A;  1G3S A;  5GAO m;  4MDX A;  3OYG A;  3CCU Q;  3E2U A;  5GAO n;  2X4J A;  2KDS A;  4HVW A;  4II1 A;  5EC7 A;  1TUC A;  4RTT A;  5HCK A;  4HVV A;  2CT4 A;  2V1Q A;  3EH2 A;  3OYY A;  4AFZ C;  1N8R R;  2QXF A;  2EJ9 A;  3NFC A;  4EMK B;  1AZE A;  3FIF A;  3M54 A;  3GNG A;  1GBR A;  5LJ5 j;  5LJ5 d;  3P8H A;  5GJV B;  3HHT B;  1M1K C;  2L3S A;  4PJO G;  2RQW A;  5HK3 A;  2Y4Y A;  5HK0 A;  2KSS A;  4DBH A;  2EIF A;  5IH2 A;  1N9R A;  5GAN 7;  1H3Z A;  3VS4 A;  1UHC A;  4F04 B;  4QVC A;  5FU6 B;  1SEM A;  2K3B A;  1KFZ A;  5GMK m;  3SWN A;  4A53 A;  3CCQ Q;  3VUB A;  1NYG A;  4Z8A A;  5IT9 E;  5A0G A;  1LJO A;  4M75 B;  5HKC A;  3I9Q A;  2DVJ A;  4B9W A;  4KBM B;  2VUB A;  3OW2 S;  4HCC A;  2OTL T;  2DAQ A;  4L5G A;  1X27 A;  4D8D A;  3PFS A;  1RLP C;  4J9C A;  1FWZ A;  1HD3 A;  3VKI A;  5J26 A;  5FWC A;  1K9M U;  2G3R A;  4KUD K;  1RAG B;  3CC4 Q;  4WCI A;  1U3O A;  2ZZD A;  3CCV T;  2LTO A;  3HL8 A;  1T3L A;  1JXO A;  1SRM A;  1AZG B;  1I1J A;  1K9M C;  3REA B;  1EFN A;  4IUR A;  2XD0 A;  2KXD A;  1G83 A;  2RQT A;  1VQN A;  2DO3 A;  3BFM A;  8ATC B;  4M75 G;  3M0Q A;  1BBZ A;  2L5Q A;  4ME7 A;  1VQN Q;  3RBB B;  1SHF A;  1WDX A;  3M0R A;  3H9N A;  3INZ A;  3NPF A;  2FB7 A;  1BI1 A;  3VJP A;  2RHI A;  5J39 A;  3CC7 A;  1TG0 A;  4ANJ A;  1XTD A;  3OYF A;  2EKH A;  2JTF A;  4BE2 A;  3SWN C;  3M58 A;  5CKD A;  3BDL A;  2XDD A;  1E6H A;  3C94 A;  1WHM A;  8AT1 B;  1YJ9 T;  1H8K A;  2JTE A;  2A0F B;  1VQ4 A;  2LNH B;  1GXI E;  2E70 A;  4C8Q A;  4Z89 A;  4RTV A;  1AEY A;  2D1X A;  4RCB A;  1XOV A;  3OYK A;  4OB0 B;  2RJD A;  2J6O A;  3GLX A;  2JMC A;  3G4S T;  1JQQ A;  2XHC A;  4RUG A;  4EIK A;  2LQN A;  2YLB A;  3TQ7 P;  2CZ7 B;  1F1B B;  5GAO q;  4M7A C;  3MET A;  1M8V A;  2DIG A;  2FEI A;  4C5H A;  1UE9 A;  4X9D A;  4JJD A;  4C5E A;  5A0L A;  2E5Q A;  3DB4 A;  2COW A;  2X35 A;  2LP5 A;  5GAN e;  1YP5 A;  3CBP A;  3ULR B;  3UA7 A;  2DJZ A;  3GF5 A;  4D6W A;  3HRS A;  3NGP A;  4PLI A;  3R6N A;  4B6M A;  2PUO B;  4LDX A;  5LJ3 e;  2K3Y A;  3M0U A;  1M5Q 1;  4K11 A;  1C6V X;  4JRI A;  3CCV Q;  1R0B G;  1PNJ A;  3JCM P;  2NUP A;  1D09 B;  2GTO A;  4OP0 A;  2O9V A;  2K3X A;  3EFS A;  1YIJ T;  3PE0 A;  3MCA B;  3ER0 A;  3HKS A;  4NS5 A;  2D9T A;  2NUZ A;  3HP9 A;  2RB6 A;  2O4X A;  4M7A B;  2HMA A;  5GAN g;  4LDV A;  1VQ6 A;  2GGR A;  5KYN A;  1ZUK A;  5GAO l;  1TH7 A;  2EBP A;  4WTO B;  3V7R A;  1VQ6 Q;  1QQJ A;  1P92 A;  5GMK j;  2QA4 A;  2JM9 A;  1RAI B;  1RI0 A;  1TTH B;  4M77 C;  5LJ3 g;  4PJJ A;  1ZSG A;  2QA4 Q;  1WZO A;  2EQU A;  4OB3 B;  2EGC A;  1K0X A;  3WXM B;  1KSW A;  1YJ9 Q;  4RTW A;  5FW9 A;  2QQB A;  2M02 A;  3EGD A;  4OB2 B;  3OYJ A;  5D6W A;  3CME A;  1I8F A;  4LD9 K;  1UG1 A;  2J6K A;  2DK3 A;  2NYS A;  3EG9 B;  4E47 A;  5GMK l;  1K73 R;  2YWW A;  3H0F A;  4JJB A;  4DBR A;  4ELZ C;  2VGN A;  3OS2 A;  4M77 B;  4EMH A;  2OTJ T;  1SPK A;  2DXU A;  5CCA A;  5GAN 4;  5EG2 A;  2A08 A;  1WLP B;  1WPY A;  5FLX E;  3M56 A;  4XTZ A;  1VQ5 T;  3SEM A;  2F5K A;  2JS2 A;  1VQ9 T;  2YRV A;  4DBF A;  1TUD A;  1K9A A;  4F7U E;  2DEU A;  4J7F A;  2CGH A;  4OMQ A;  4M78 G;  2RNA A;  2D8J A;  1RL2 A;  1QW1 A;  2CP0 A;  2MI6 A;  1M1K R;  2QDL A;  4NL2 A;  1B3Q A;  1RAH B;  2LT1 A;  5KYX A;  2DKG A;  4JRQ A;  1SF9 A;  2EYQ A;  1YIJ Q;  2LJ1 A;  2I0N A;  1Z9Z A;  3OY9 A;  1BI2 A;  1QVF P;  1Q81 R;  3P8D A;  4BE1 A;  2I2L A;  4JS4 A;  2DZC A;  3URG A;  4BI4 A;  2WSC E;  4N0A C;  3FRN A;  4PKC C;  1KQ1 A;  5GAM h;  2RD1 A;  3CCE A;  2W0Z A;  4FSS A;  3VRZ A;  3CCE Q;  2EYW A;  1NLO C;  4Y28 E;  3OYD A;  4FT2 A;  2VXE A;  2GNC A;  5GAM f;  2WSE E;  2ZPB B;  2DL5 A;  1MV3 A;  4M7D B;  4B9X A;  4BE0 A;  3A5Z B;  2EKO A;  1RAE B;  3EGX B;  1VQP A;  2K9G A;  4KUI A;  4QKU A;  3EGU A;  1YJN T;  2OAW A;  2YDL A;  1KC8 U;  1VQP Q;  1M1G A;  2LQ8 A;  1AOJ A;  5LJ5 e;  2E5K A;  4DQ2 A;  2VYT A;  2EGA A;  1PRM C;  1I0C A;  1T0J A;  4PNO A;  3LH5 A;  4GBQ A;  3E1S A;  2A7Y A;  3CPF A;  2ABL A;  1W2B A;  1W2B S;  2LVM A;  5GAN 6;  5J3B A;  3GP8 A;  1D0Y A;  2L0A A;  2QQR A;  5CQY A;  3MEV A;  5IHK A;  1YHQ T;  4FCY A;  2CSQ A;  4E7Z A;  3S3M A;  3O8V A;  2XG8 D;  4F14 A;  1K8A C;  3CBM A;  1B7T A;  2EQJ A;  2MWO A;  2CRE A;  1AWX A;  5KYU A;  1Y71 A;  1N9S A;  3RER A;  4M7D G;  2L3Q A;  2V8I A;  3MPU B;  1VQ5 Q;  1VQ9 Q;  1KIK A;  1YWP A;  2M0O A;  5LJ5 g;  2QYZ A;  4AFU C;  2RJF A;  4IIM A;  4FU6 A;  2DEQ A;  1PCX A;  1TXQ A;  2H3J A;  1KQS A;  2DD4 A;  2KVQ G;  1OU9 A;  3V7C A;  2FPD A;  3S3O A;  4M78 D;  5GAO r;  2CDT A;  1Y96 A;  1XQH A;  4LXC A;  2RHX A;  3OQ5 A;  5LJ3 d;  5LJ3 j;  1NJI R;  4PJO A;  3ASK A;  1M3A A;  3T9N A;  2SEM A;  4F7U A;  2L2P A;  2VB6 A;  1GFD A;  3S3N A;  2O31 A;  2GQI A;  3FEO A;  3VS5 A;  1U8R A;  1W4S A;  5A0D A;  1VQO A;  4OMF B;  4XAX B;  1YJN A;  2JVV A;  1VQO Q;  3QZ5 B;  2QG9 B;  4OVA A;  1M90 R;  1WQ7 A;  2ZPE B;  1YJN Q;  4XQ3 A;  3X26 B;  1U1T A;  2JW4 A;  3BE3 A;  3I55 A;  1OV3 A;  3MP1 A;  4EMK A;  2J6F A;  3M4Y A;  4N4H A;  1PG5 B;  3LLR A;  1EX4 A;  1X2K A;  3J80 E;  3I55 Q;  4IUQ A;  2PVG B;  4ELY C;  3CEY A;  3JB9 I;  3M0P A;  2KMT A;  2LX7 A;  1SHG A;  4C0Z A;  5CAI A;  2JOY A;  2VAS A;  1PHT A;  2HAX A;  1V1C A;  1H3H A;  3PT9 A;  2RHY A;  2FPE A;  2CUD A;  2KRS A;  1NPP A;  4M75 A;  3QYH B;  1Y7X A;  4C5G A;  1W70 A;  1VQ7 T;  4M7A E;  2CZ1 B;  4PJO C;  1KHC A;  2HQH A;  4C8Q F;  3CD6 T;  2E3H A;  3MEW A;  1SSF A;  2NWM A;  2DET A;  1BCM A;  1LCK A;  5CKE A;  4JLI A;  4C0F A;  2PTK A;  2QQS A;  3UPU A;  1XJW B;  1PSF A;  4NL3 A;  4CC7 A;  1WX6 A;  3OYI A;  4JS5 A;  1VQK A;  2AIR B;  5C0M A;  2YRD A;  1VIF A;  2LCC A;  2GBQ A;  1VQK Q;  1GL5 A;  1AT1 B;  1NYF A;  5HY6 A;  1NE8 A;  2B86 A;  1VQ8 A;  3PTA A;  1OEB A;  1M30 A;  1K0S A;  4ZGE B;  5KCH A;  4RCC A;  5LL6 S;  2BE9 B;  4KH1 B;  4EMK C;  2ZPH B;  5L8R E;  3H41 A;  5KYY B;  5GMK e;  4BI3 A;  2KT8 A;  5GAN 5;  3RES A;  1JXM A;  1YIT T;  4J9B A;  4LDW A;  5CKF A;  2M51 A;  2EQM A;  2M16 A;  2WSF E;  5D6X A;  3SDZ A;  4J5Y A;  2L8D A;  1VQM T;  4L6V 5;  3MEA A;  2ECZ A;  2ROT A;  3NTI A;  3H0H A;  4M77 E;  5CKB A;  4FYW B;  1OOT A;  4M75 C;  3QYG B;  1SSH A;  4PL6 A;  1W2B P;  2MK5 A;  2CP2 A;  1T3S A;  2CH4 W;  2P4R A;  2XMF A;  4QQ6 A;  3CCL A;  5I21 A;  1N27 A;  1M8M A;  1QP2 A;  1FMK A;  3CCL Q;  4C92 G;  1UFF A;  1UB4 A;  4JUV A;  1Y57 A;  4FW1 A;  1AHJ B;  3TVT A;  4DEX A;  2OAU A;  4QQG A;  1ARK A;  1I81 A;  2ZPG B;  1HK9 A;  2V8K A;  4BUG A;  4PFP A;  3JCM b;  3JB9 F;  3CCQ A;  2KYM A;  4FYX B;  4QT7 A;  1KQS P;  4XU3 A;  2X4Y A;  2QTV A;  1DJ7 B;  4J6X A;  2QGF B;  4L59 A;  1VYT A;  2YUQ A;  3CC2 T;  4GLK A;  3LGF A;  1EIF A;  3QZ9 B;  3OW2 A;  1CKA A;  1YN8 A;  2YSQ A;  1UGS B;  3GIB A;  2CSI A;  3CQT A;  2PU9 B;  1G5V A;  3CC4 A;  2DFU A;  2RI3 A;  1M2V B;  1RLQ C;  4LNP A;  1K8A R;  4C5I A;  3CCJ T;  3GPL A;  2F2V A;  1WXU A;  2KXC A;  4OML A;  3CMA T;  2QEX A;  3HRT A;  1G2B A;  2HNI A;  4M7A A;  2L89 A;  2QEX Q;  1WHG A;  2XI9 A;  4IIO A;  3I5R A;  1LVK A;  1ZBX A;  5CKH A;  4HT8 A;  1VIE A;  2GQV A;  2AZV A;  1PC0 A;  4LUD A;  2EYX A;  4IUT A;  4O5V A;  2C0I A;  2LRQ A;  1KG1 A;  2C0O A;  3JCM e;  3HPW A;  2B8A A;  5GJW B;  1IHW A;  2RHZ A;  4Y91 A;  1UJY A;  2ESW A;  3MP6 A;  2KAF A;  1VQL T;  3I5S A;  2EVR A;  4FW2 A;  1Q7Y U;  2FZG B;  3LGL A;  4GY5 A;  4OGC A;  3QUI A;  4D8K A;  1IXD A;  1KD1 R;  3LWH A;  1D3B B;  1BI0 A;  4LDU A;  2DE0 X;  3EG9 A;  3UA6 A;  5IN1 A;  3THK A;  1R77 A;  2EJF A;  3M53 A;  2JXB A;  4TVR A;  4XU2 A;  3JCM g;  1D1C A;  2IVW A;  4C92 D;  1ACM B;  1Q7Y C;  4M77 A;  3H8Z A;  1B34 A;  2F2W A;  2PUK B;  4JDS A;  2X4X A;  3C95 A;  2P84 A;  2W10 A;  2K5L A;  4JRK A;  2E1H A;  2FVU A;  2IIM A;  1Q86 R;  3G71 T;  3X20 B;  1CSK A;  3QDF A;  1PKS A;  2OTL A;  1WI7 A;  4RMO A;  2KT1 A;  2LC4 A;  2DTO A;  1UDL A;  2OTL Q;  3KXT A;  3G7Z A;  2CKK A;  5L23 A;  4XK8 E;  3A98 A;  2DRK A;  1NPR A;  1JO8 A;  4E7J A;  4Z88 A;  3CCJ Q;  9ATC B;  1YI2 T;  3CCV A;  2KQW A;  4FL6 A;  2V1R A;  2RH2 A;  1PSE A;  2E3I A;  2AHJ B;  5KYW A;  2J7I A;  3HTR A;  4M78 C;  4DOW A;  2K57 A;  2A37 A;  2E64 A;  5KE2 A;  7AT1 B;  4RG8 A;  2DIQ A;  2PVO B;  2YXY A;  3MHX A;  4PK4 A;  1Y07 A;  4IUV A;  1X43 A;  1E6G A;  1QP3 A;  1YCY A;  4KGV B;  4HVU A;  2KRN A;  3CCS T;  1MMD A;  2NLU A;  1QKW A;  2RMO A;  4QVD A;  3MEU A;  2DLP A;  1H92 A;  2BKD N;  3VRY A;  3KUF A;  3KFV A;  1GCQ C;  1PD0 A;  1V29 B;  4ATO A;  2DL7 A;  3VUZ A;  1YJ9 A;  5C6S A;  5DLO A;  1VYV A;  1AWW A;  1OPK A;  2HD0 A;  2A28 A;  4MML A;  1BK2 A;  5IAY A;  2EAY A;  4PJO F;  2JUF A;  3V8L A;  4ZTJ A;  1WIE A;  4R55 A;  1GCP A;  4XTX A;  1NEG A;  4M78 B;  1WHK A;  1JEG A;  4F7U F;  4N0A A;  3L2Q A;  3M5A A;  1X75 C;  2VWF A;  2P0Q A;  3G4S A;  5LJ5 h;  2CP6 A;  1OI1 A;  3BY7 A;  4BDY A;  3LW5 E;  4RTX A;  3G4S Q;  1FYN A;  2MCN A;  2X3W D;  2KNB B;  2LDM A;  2ZAE A;  5AT1 B;  4LN2 A;  4E7S A;  3RUX A;  2F69 A;  3OW2 P;  4BI8 B;  4V2S A;  1HJD A;  4BDZ A;  4E6R A;  3I56 T;  4KGX B;  1ZUU A;  5FU7 B;  3LX7 A;  1M3C A;  2P0K A;  4M4Z A;  2AKL A;  2KK4 A;  2Z0W A;  1FX7 A;  6AT1 B;  3CXC A;  1IZ6 A;  3CXC S;  3UDC A;  3P8B B;  4PJO E;  2RI2 A;  2LMJ A;  4AFS C;  2R58 A;  3DB3 A;  3A8M B;  3R6O A;  1MNE A;  3QDR B;  3QII A;  1AWJ A;  4J9D A;  2RK2 A;  4AG2 C;  2GFA A;  2NUT B;  4M7D C;  2HZY A;  4ORZ A;  3WVE B;  3OYA A;  2JZ2 A;  1YIJ A;  4J7I A;  4A54 A;  4M75 F;  3V8K A;  1TSF A;  4IUP A;  3PGG A;  3SB2 A;  3CPW S;  3CCR T;  1B07 A;  3VS1 A;  1A0N B;  4MDW A;  2AKK A;  1MGQ A;  1C1A A;  3U23 A;  1OU8 A;  3OB9 A;  3G6E T;  4E2F B;  4C8Q G;  2K4Y A;  3C4S A;  3E9G A;  4IKF A;  2BTT A;  4PJM A;  1N8R U;  5IHN A;  2KE9 A;  3VV0 A;  1OYX A;  1K76 A;  3PMT A;  4KRT A;  4P5N A;  2M1H A;  4E7K A;  1J3T A;  1W6X A;  2WAC A;  5GMK i;  3EFO B;  1MMN A;  2BE7 D;  4M75 E;  2R5M A;  3JCM d;  1K9M R;  2E65 A;  5A2Q E;  1RAC B;  1M9S A;  3VYH B;  1QCF A;  4X1V A;  4YTL A;  2VC8 A;  2YUP A;  2HQE A;  4JPB W;  3JV3 A;  2YLC A;  1Q95 G;  3FC3 A;  2XU8 A;  2HEQ A;  1KC8 C;  3OYN A;  3UF4 A;  3H0I A;  4J6Y A;  1OZ2 A;  2JS0 A;  1QLY A;  1UGP B;  2MPX C;  3I56 Q;  1QVG A;  2OTJ A;  3GNF B;  1QVG S;  3UT1 A;  5CR2 A;  3L2W A;  1AVZ C;  1VQ5 A;  1N5Z A;  2OTJ Q;  1VQ9 A;  3PMI A;  4KUL A;  3EGD B;  4QVZ A;  2D8H A;  3EHR A;  1M4Z A;  1U1S A;  2HDA A;  3MKD A;  4PFZ A;  5CK9 A;  3PIP A;  2DZ9 A;  4LDY A;  4CRI A;  1U06 A;  1ZX6 A;  1OZ3 A;  2YRC A;  2JM8 A;  3TRE A;  1BI3 A;  3CCM T;  1ZSZ C;  3MP8 A;  3IQL A;  5KYY A;  1S72 T;  3ZEH A;  3OA6 A;  3JB9 G;  4O6J A;  2V26 A;  2SRC A;  4OMO A;  2LQW A;  1G3Y A;  4RTY A;  4XU0 A;  2A3L A;  2HSP A;  2K5F A;  4FSX A;  3OBW A;  4PJN A;  5KYX B;  4C8Q D;  2HKQ B;  2K5I A;  4ZTF A;  5GAM e;  2BIV A;  1X01 A;  3UAT A;  3VS6 A;  4N4G A;  1YJW T;  3DKM A;  4OMP A;  4JZ3 A;  2X9H A;  1MMA A;  2HL3 A;  3QSU A;  4M7A F;  1WQW A;  3ZFJ A;  2DXB A;  4R0K A;  3NTK A;  2DBM A; 
#chains in the Genus database with same CATH homology
 3TVT A;  4DEX A;  1YP5 A;  2ENM A;  2JMA A;  1ARK A;  3ULR B;  3UA7 A;  1VYU A;  2KGT A;  2KYM A;  3NGP A;  3R6N A;  2YUO A;  4QT7 A;  5I22 A;  1K1Z A;  1VYT A;  2VVK A;  3M0U A;  4J9G A;  2YUQ A;  4K11 A;  4AFQ C;  3TSW A;  2EW3 A;  4ZNX A;  1PNJ A;  1GRI A;  2GTO A;  2RQR A;  2LZ6 B;  2O9V A;  1CKA A;  1YN8 A;  2YSQ A;  3PE0 A;  2DRM A;  2CSI A;  3CQT A;  3VS2 A;  4CC4 B;  3RNJ A;  2NUZ A;  2M0Y A;  2YUN A;  3VS7 A;  1IO6 A;  1YCS B;  2EYY A;  3FJ5 A;  1UUE A;  1RLQ C;  4LNP A;  3SHW A;  4DEY A;  3VS3 A;  2K6D A;  2GGR A;  2KBT A;  1AWO A;  4LE9 A;  2F2V A;  1WXU A;  1ZUK A;  4F16 A;  2EBP A;  2KXC A;  4OML A;  1ZUY A;  1VA7 A;  1WXT A;  1G2B A;  2HCK A;  2JM9 A;  2PNI A;  3TSZ A;  1ZSG A;  4IIO A;  3I5R A;  2EGC A;  1K0X A;  5FWB A;  3PVQ A;  2X3X D;  5IHI A;  1E7O A;  2AZV A;  1KSW A;  4RTW A;  5FW9 A;  1K4U S;  2JT4 A;  2DYB A;  4LUD A;  2EYX A;  1ABO A;  2C0I A;  2K7A A;  2C0O A;  1BU1 A;  4HCK A;  1GBQ A;  2LJ3 A;  1S1N A;  2F2X A;  5GJW B;  2EQI A;  1UJY A;  2K79 A;  2ESW A;  1NEB A;  1NG2 A;  1UG1 A;  2J6K A;  3NHN A;  3I5S A;  2DJQ A;  2EVR A;  4OMN A;  3H0F A;  4JJB A;  2DL8 A;  1CKB A;  4RTU A;  4D8K A;  2MOX A;  2DE0 X;  3UA6 A;  2BZ8 A;  3THK A;  1SPK A;  2GTJ A;  2A08 A;  1WLP B;  2JXB A;  3VS0 A;  3SEM A;  4OMM A;  2JS2 A;  3M0S A;  3PVL A;  2J05 A;  2F2W A;  1TUD A;  1K9A A;  1X2Q A;  4OMQ A;  2W10 A;  2RNA A;  2A36 A;  2D8J A;  2G6F X;  2IIM A;  2DM1 A;  2QDL A;  2CT3 A;  1B3Q A;  1CSK A;  1PKT A;  1PKS A;  1WI7 A;  1WFW A;  2DL3 A;  2KT1 A;  1X69 A;  1UDL A;  1RI9 A;  2LJ1 A;  2I0N A;  4J9F A;  1Z9Z A;  2LJ0 A;  5L23 A;  3A98 A;  2DRK A;  3QWX X;  1GFC A;  1JO8 A;  2YT6 A;  3EG1 A;  4Z88 A;  1ZLM A;  2DBK A;  4GLM A;  2V1R A;  2KR3 A;  2CH4 A;  2W0Z A;  4FSS A;  2J7I A;  3VRZ A;  2EYW A;  1NLO C;  1JU5 C;  2A37 A;  2DF6 A;  2OI3 A;  4F17 A;  2ROL A;  3M0T A;  2GNC A;  1X43 A;  1E6G A;  4JJC A;  2DL5 A;  4HVU A;  1MV3 A;  1WA7 A;  2KRN A;  1ZBJ A;  1QKW A;  2K9G A;  2O9S A;  1UEC A;  2RMO A;  3EGU A;  1QKX A;  2OAW A;  2YDL A;  2FG0 A;  2DLP A;  1H92 A;  1AOJ A;  3VRY A;  1X6G A;  2E5K A;  2EGA A;  1PRL C;  1PRM C;  2RN8 A;  3KFV A;  1GCQ C;  1I0C A;  1T0J A;  2RF0 A;  3LH5 A;  3EHQ A;  4GBQ A;  2DL7 A;  3C0C A;  2ABL A;  2OJ2 A;  3NMZ C;  4JZ4 A;  2FO0 A;  3ZL7 C;  2L0A A;  3O5Z A;  3QWY A;  1VYV A;  1AWW A;  1OPK A;  2A28 A;  1BK2 A;  2KYB A;  5IHK A;  2CSQ A;  1WIE A;  4F14 A;  1GCP A;  1NEG A;  2DX1 A;  4Y92 A;  2D0N A;  1WXB A;  1JEG A;  2FRW A;  2CRE A;  2VWF A;  2PZ1 A;  1AWX A;  1UTI A;  2L3Q A;  2KEA A;  4RTX A;  2DL4 A;  1KIK A;  1YWP A;  1FYN A;  2ED0 A;  2MCN A;  2X3W D;  1OPL A;  1QWF A;  1X6B A;  2KNB B;  4AFU C;  4IIM A;  2KRM A;  1UJ0 A;  4CC3 A;  1Y0M A;  4LN2 A;  4CC2 A;  2DMO A;  1HJD A;  4E6R A;  2LCS A;  2DIL A;  5IXB A;  1ZUU A;  1QWE A;  1M3C A;  2FPD A;  4M4Z A;  2AKL A;  5I11 A;  1M27 C;  1RUW A;  2CDT A;  2LMJ A;  1GCQ A;  4AFS C;  2J06 A;  3GBQ A;  5ECA A;  2KRO A;  1AWJ A;  4J9D A;  4AG2 C;  3REB B;  1Z9Q A;  2MIO A;  2VKN A;  4ORZ A;  4ESR A;  4J9I A;  1AD5 A;  1M3A A;  2SEM A;  2L2P A;  1YNZ A;  1UHF A;  1I07 A;  1GFD A;  1M3B A;  2O31 A;  2GQI A;  3VS5 A;  4HVW A;  5EC7 A;  1TUC A;  4RTT A;  5IXF A;  5HCK A;  4HVV A;  1MUZ A;  1B07 A;  2CT4 A;  3VS1 A;  2V1Q A;  1A0N B;  2AKK A;  4AFZ C;  3U23 A;  2EYZ A;  1AZE A;  4A63 B;  1GBR A;  5GJV B;  2RQU A;  2BTT A;  2L3S A;  2FRY A;  2BZY A;  2JW4 A;  2RQW A;  5IHN A;  1OV3 A;  2KE9 A;  2J6F A;  5IH2 A;  2O2O A;  1K76 A;  1KJW A;  1X2K A;  3VS4 A;  4KRT A;  1UHC A;  3EG3 A;  3M0P A;  1SEM A;  2K3B A;  1J3T A;  1W6X A;  1KFZ A;  2AZS A;  2LX7 A;  2ED1 A;  1NYG A;  4Z8A A;  1SHG A;  2L3P A;  1NLP C;  3I9Q A;  2DVJ A;  2DA9 A;  1PHT A;  2AK5 A;  2RPN A;  1V1C A;  1H3H A;  1QCF A;  2FPE A;  1X27 A;  4D8D A;  1NM7 A;  2CUD A;  2KRS A;  4X1V A;  1RLP C;  1UGV A;  4J9C A;  1HD3 A;  1YWO A;  2YUP A;  2CUB A;  5FWC A;  1W70 A;  1SRL A;  4JPB W;  3JV3 A;  2HEQ A;  2EPD A;  4WCI A;  1W1F A;  3UF4 A;  3H0I A;  1U3O A;  2NWM A;  2JS0 A;  1QLY A;  1LCK A;  4AG1 C;  1T0H A;  2PTK A;  1T3L A;  1MV0 B;  2O88 A;  2FPF A;  1AVZ C;  1JXO A;  1SRM A;  1WX6 A;  2H8H A;  1AZG B;  4CC7 A;  1I1J A;  1N5Z A;  3REA B;  1EFN A;  2DNU A;  2GBQ A;  2KXD A;  1G83 A;  2RQT A;  1GL5 A;  2D8H A;  1NYF A;  2B86 A;  3EHR A;  1OEB A;  3M0Q A;  1BBZ A;  3EG0 A;  2HDA A;  3RBB B;  1M30 A;  1K0S A;  1SHF A;  1WDX A;  1BB9 A;  3M0R A;  4HXJ A;  3NPF A;  1WYX A;  3H41 A;  1U06 A;  2C0T A;  1TG0 A;  1ZX6 A;  2KT8 A;  2JM8 A;  4LUE A;  2EKH A;  1JXM A;  2K2M A;  4J9B A;  1U5S A;  1E6H A;  2M51 A;  3IQL A;  4J9E A;  3I35 A;  1H8K A;  2JTE A;  1HSQ A;  2LNH B;  2ECZ A;  2ROT A;  3EG2 A;  4J9H A;  4Z89 A;  4RTV A;  1AEY A;  2SRC A;  4OMO A;  3H0H A;  2RQV A;  2D1X A;  2LQW A;  1XOV A;  1OOT A;  2EGE A;  1SSH A;  4RTY A;  2J6O A;  2HSP A;  2JMC A;  1T3S A;  4RTZ A;  2CH4 W;  2P4R A;  1JQQ A;  2XMF A;  4EIK A;  4RUG A;  2LQN A;  3UAT A;  3VS6 A;  1M8M A;  4OMP A;  2BZX A;  1PWT A;  2FEI A;  4JZ3 A;  1FMK A;  1UE9 A;  4JJD A;  1UFF A;  2HBW A;  1ABQ A;  4R0K A;  1Y57 A;  2LP5 A;  2DBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...