5I22A

Amphiphysin sh3 in complex with chikungunya virus nsp3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box-dependent-interacting protein 1
publication title Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i22A00
1BB9A 4Y92A 1UDLA 4GLMA 4JJDA 2GTOA 3VS1A 1RLQC 2O9VA 2KYBA 2KT1A 1QWFA 1HSQA 1QCFA 1JXOA 2ED0A 5FW9A 1UJYA 2FRYA 2EYWA 2M51A 1FYNA 2YUNA 1Z9QA 3U23A 2EPDA 3VS6A 2JS0A 4RTXA 2D8HA 3EGUA 1Y57A 2EGEA 1Y0MA 2RQTA 1SHGA 2EGCA 2JM9A 1JXMA 3ULRB 4E6RA 1T3LA 3ZL7C 2KXCA 2J6FA 2C0TA 3VRZA 2DVJA 2DA9A 2MOXA 2K7AA 1OPLA 4AG1C 3NPFA 2J06A 3PE0A 2RNAA 1M27C 1UECA 2CREA 1RLPC 1GFCA 4RTTA 3I35A 1JU5C 2ROTA 2A36A 1I07A 2JM8A 5IXBA 1VYUA 3H0FA 1X69A 2RQWA 2OJ2A 2FG0A 1H8KA 1VYVA 4F16A 4J9FA 1WI7A 1HJDA 5HCKA 2GBQA 2RF0A 2JW4A 1GBRA 1KIKA 2EYYA 1AVZC 1PRMC 4J9CA 2ENMA 2AKLA 2B86A 1S1NA 2CSQA 1U5SA 3REAB 4CC3A 3CQTA 2KNBB 2O2OA 1CKBA 2RPNA 1WDXA 1WX6A 2CUBA 2ESWA 2KRMA 4J9HA 4HVVA 5I11A 2KEAA 2K2MA 2YSQA 2DRKA 2DL4A 2GQIA 2X3XD 1GRIA 4ESRA 2LZ6B 1BBZA 1SHFA 3SEMA 2CH4W 2DM1A 1T3SA 3C0CA 2C0OA 1JQQA 5I22A 1JEGA 1UTIA 2L3PA 4LE9A 3IQLA 2K9GA 1UE9A 4OMPA 2JMCA 1AWOA 3NMZC 1YWPA 3SHWA 1ZLMA 4ZNXA 4RTVA 2DF6A 2GTJA 1NLOC 3PVQA 4K11A 5IXFA 4X1VA 1J3TA 1SSHA 1WXUA 1YN8A 2NUZA 1TUDA 4LUDA 1E7OA 1KFZA 2BZXA 1PNJA 1RI9A 2DE0X 3R6NA 1UG1A 2BZ8A 2KBTA 1WIEA 2DYBA 1UHCA 1PKSA 2D8JA 4Z89A 2GNCA 2LNHB 1UUEA 2ROLA 2MCNA 2YUPA 5L23A 1W6XA 1PHTA 1UGVA 1NEBA 1X6BA 2KRNA 2KROA 1UJ0A 1NYGA 1X27A 3EG1A 3H41A 3RNJA 4AFZC 1RUWA 1I0CA 3O5ZA 1ZBJA 1WYXA 2F2WA 3NGPA 1OEBA 4J9EA 3I5SA 1GCPA 2F2VA 4DEYA 3THKA 1ABQA 1PRLC 2KYMA 1NG2A 4IIOA 4JJBA 2EYZA 1NM7A 4D8KA 1YWOA 2RN8A 2IIMA 1E6GA 3PVLA 5FWBA 1QLYA 1W70A 4CC7A 2EW3A 3QWXX 4RTWA 4F14A 1BU1A 4OMNA 4A63B 2V1QA 2LCSA 1T0JA 2CUDA 1SRLA 5IHNA 1NYFA 4J9IA 1CKAA 2OI3A 1ZUYA 4DEXA 3JV3A 2W10A 3M0UA 4GBQA 4RTYA 5IH2A 1K1ZA 1OOTA 3EG2A 1GL5A 2EBPA 1I1JA 2YUOA 2D1XA 2L0AA 3VS4A 1NLPC 2LX7A 1BK2A 1M30A 4QT7A 3VRYA 1GCQA 2LMJA 2O9SA 4KRTA 2GGRA 1TUCA 4CC2A 1CSKA 2FPFA 2KR3A 2KE9A 4HVWA 2M0YA 1SRMA 5GJVB 1OPKA 2K79A 2HBWA 3LH5A 2CH4A 3M0PA 1GFDA 1X2QA 3M0RA 3NHNA 2RMOA 3REBB 2DBMA 1AOJA 2EGAA 1SPKA 2EKHA 1PKTA 3UA6A 4WCIA 2FO0A 3TVTA 1M3CA 2DL3A 2DBKA 1AWXA 1YNZA 2VWFA 1QKXA 1ZSGA 1UHFA 3VS7A 3M0QA 2ED1A 4J9DA 5FWCA 3M0SA 1YCSB 1M3BA 1K0SA 2I0NA 4D8DA 4OMMA 4HCKA 1TG0A 4ORZA 2KRSA 2HEQA 3EG3A 4FSSA 1AD5A 1W1FA 1N5ZA 4LN2A 2LP5A 2LQWA 5EC7A 1WLPB 3VS3A 1UFFA 1WXTA 2J7IA 1T0HA 1KJWA 3EG0A 3A98A 2V1RA 3H0IA 4F17A 1M3AA 1WFWA 2HSPA 4HXJA 2O31A 1X43A 2C0IA 1YP5A 1M8MA 1AWJA 2X3WD 2G6FX 2W0ZA 1U3OA 2BTTA 2FEIA 1ZUKA 4OMOA 4Z8AA 3UA7A 1WA7A 2AK5A 4R0KA 2H8HA 1KSWA 2BZYA 1WXBA 2VVKA 2F2XA 1G2BA 2CT3A 4EIKA 2YUQA 1ABOA 2HDAA 1EFNA 3FJ5A 3EHRA 1E6HA 3TSWA 2DNUA 2AZSA 2MIOA 1AZGB 4Z88A 3VS0A 4LUEA 1PWTA 1Z9ZA 2LQNA 2DMOA 2JT4A 3GBQA 3VS5A 2D0NA 2KGTA 2CDTA 3UF4A 2ABLA 1VA7A 2FPEA 2DJQA 3RBBB 2J05A 2K6DA 1FMKA 2DL5A 4JJCA 2LJ0A 2LJ3A 1OV3A 4AFQC 1MV3A 2CSIA 2VKNA 4AG2C 2A37A 2HCKA 2PZ1A 4OMQA 1NEGA 1U06A 1K4US 1HD3A 1QWEA 1AZEA 1V1CA 5GJWB 2L3SA 2OAWA 1X2KA 4CC4B 4IIMA 4AFUC 1B3QA 2DL7A 4JZ3A 2L2PA 1SEMA 2K3BA 1QKWA 3EHQA 1IO6A 1ZUUA 2RQRA 1K9AA 1H92A 3KFVA 4RTZA 1JO8A 3TSZA 2J6KA 1AWWA 3M0TA 4JZ4A 2KT8A 4RUGA 4M4ZA 1VYTA 1G83A 2EVRA 3UATA 2O88A 2QDLA 2P4RA 2AZVA 4J9GA 5IHIA 1K0XA 2PNIA 1LCKA 1XOVA 4OMLA 1AEYA 3I9QA 1ARKA 2L3QA 2SRCA 2E5KA 5IHKA 2AKKA 4LNPA 2A08A 2ECZA 4AFSC 2SEMA 2RQVA 3I5RA 5ECAA 2NWMA 1A0NB 1B07A 2JMAA 2DILA 4HVUA 1K76A 2A28A 4RTUA 2XMFA 3QWYA 2J6OA 2LJ1A 1GBQA 2EQIA 4JPBW 2FPDA 1ZX6A 1MUZA 1MV0B 3VS2A 2EYXA 1X6GA 2PTKA 2KXDA 2JTEA 2FRWA 2JS2A 2YT6A 3H0HA 2DLPA 2JXBA 4J9BA 2YDLA 2DL8A 2CT4A 1H3HA 1GCQC 2DRMA 2RQUA 2DX1A
chains in the Genus database with same CATH superfamily
3BFMA 4M77G 1QP3A 2RA2A 1RLQC 2KT1A 1QWFA 2MF2A 1HSQA 3EFOA 5KE3A 4BDZA 2ED0A 5KYWB 1UJYA 3G71A 4C5EA 2FRYA 2M51A 3X24B 3G4ST 3OS0A 3EGUA 2EGEA 2RQTA 3JB9G 4M7AA 3META 1SHGA 1JB0E 1TSFA 3QYGB 3ULRB 1XJWB 3CC7Q 4OGCA 1T3LA 4E6RA 3R6OA 4XU2A 5KYYA 1AT1B 2XIDA 2K7AA 3CMET 3CPWP 3CCEQ 3CCUT 1JJ2P 1WHKA 2RNAA 3NFCA 3GNGA 1N27A 5CKDA 1RLPC 1XNIA 4PJMA 3RKXA 1GFCA 4RTTA 2ROTA 1G5VA 1Q82C 1V76A 3CCMQ 2RQWA 2FG0A 2QA4T 3CC7A 4M78G 1HJDA 2RF0A 1VQ8Q 2JW4A 2JTMA 2FVUA 1KIKA 4M77B 5GAOm 1AVZC 2P84A 3J81E 3CCEA 1X01A 1U5SA 3REAB 3FC3A 3OYIA 3CQTA 2V8IA 1UB4A 1CKBA 3A8LB 4M77C 1YI2T 5GANg 2L5QA 1WX6A 2CUBA 4RG8A 2KEAA 1K9MR 2K2MA 3QG1A 2DL4A 3CCMA 2NYSA 2KMTA 2LZ6B 5GAOl 1SHFA 1BKBA 2R58A 3QHSA 1VQ8A 1I5LA 2DM1A 3JCMd 2DERA 1T3SA 5I22A 2L3PA 4LE9A 3IQLA 3VYHB 1SKUB 1UE9A 1U1TA 1VQ6Q 2K5IA 3J7AF 2M9UA 2VGNA 1PSFA 3CCJQ 1OU8A 2HSEB 3PVQA 2DIGA 4K11A 7AT1B 5IXFA 5LJ5h 3CD6T 1J3TA 1WXUA 1YN8A 4F7UB 1M9SA 4C0DB 1TOVA 4BE1A 2ZZDA 3M59A 4KGXB 1PNJA 2P0PA 2DE0X 1N9SA 5CVIA 3MHXA 2O4XB 1V29B 3JRZA 3HL8A 6AT1B 3GIBA 4B9XA 2CKKA 1VQ6A 4C0DC 3LW5E 2AIRB 3QJ6A 4M7DF 2MCNA 3CCJA 5L23A 4C8QG 1UGVA 1X6BA 2QQAA 2PUKB 3OYAA 2KROA 4ME7A 1UGSB 4J5YA 2RI2A 2LC4A 3FRNA 3VV0A 5GMKm 1I0CA 3O5ZA 1OEBA 4J9EA 1WPYA 1YIJQ 2F2VA 1M2VA 1B7TA 4DEYA 4BACA 1PRLC 1ZA1B 4JJBA 2EYZA 2PVDB 1VQOT 4JUVA 2RO0A 5GAN7 1M90C 4CC7A 2EW3A 3QWXX 4F14A 1BU1A 4OMNA 2QGGA 5GMKl 5GAOr 2VASA 3OYLA 2LCSA 1T0JA 4HCBA 2CUDA 5IHNA 1K9MC 2LX9A 2QAZA 3HP9A 4XTXA 1YIJA 2W10A 4PFPA 1Q86U 3A5ZB 3NTKA 4LD6A 3I56Q 2XI9A 3CCVQ 4DA4A 4RCCA 4F7UA 2X4XA 5DY9A 2EQJA 1G8XA 2L0AA 1KD1C 3VS4A 2LX7A 1M30A 4QT7A 1GCQA 2YRDA 2C06A 1CSKA 2XKOC 3QKJA 2EKOA 1X6OA 2K79A 2HAXA 3CC2T 1EX4A 3I56A 2E12A 4BDYA 1AOJA 3ZFJA 1ZA2B 2CYZB 3CCVA 1D0YA 4WCIA 3TVTA 4PJOC 2VV5A 1IRXA 2EWNA 1YNZA 1VQMQ 2VWFA 2Y4XA 1VQ7T 2LT4A 1NPPA 5LJ3j 2PQWA 1C6VX 1UHFA 3EFRA 2RK1A 1YJ9Q 1YCSB 1M3BA 2MYSA 3MKDA 2I0NA 4OMMA 4HCKA 5J3BA 1TS9A 4L59A 2KRSA 2HEQA 1K8AC 3WVDB 2LP5A 3HTRA 1WLPB 3QPHA 3VS3A 4E7JA 1VQMA 2RHXA 5FLXE 2J7IA 3QIIA 2Y4YA 4E2FB 1M3AA 3KXTA 1BI3A 2HSPA 4C5IA 1NJIR 1YJ9A 4ZGJB 2EIFA 3NTIA 2X3WD 2EAYA 4M7DG 5GAMg 2YXYA 1U3OA 4OMOA 1M2OA 3CBMA 2DXCA 3QSUA 4IUVA 1OI1A 1VQ8T 4ZN1A 4LD9K 1BI1A 1C0MA 4C92F 1KC8U 1G3WA 2D9TA 1TH7A 2G3RA 1Y71A 2OTLQ 4EIKA 5HK3A 1SF9A 2RD1A 2X9HA 4PJOA 1EFNA 1YJWQ 4A4KA 5CKEA 5KCOA 1D09B 3RIRA 5GANh 3PTAA 4V2SA 1OZ3A 2MIOA 4M75E 1Y7XA 4Z88A 5LJ3f 3VS0A 4LUEA 4J7IA 2LQNA 1OYXA 3L2VA 4B6MA 3G6EQ 2GFUA 2KGTA 3TCJA 3VKIA 3UF4A 2PVGB 2E3HA 2MWPA 4PLLA 2KY9A 3MO8A 2OTLA 1WHMA 1QMCA 3BW1A 4JRPA 1YJWA 2CP6A 1MV3A 3RDVA 2CP7A 4NL3A 4TVRA 1NEGA 1U06A 1K4US 4BE0A 3NTHA 1V1CA 2CP0A 3G6EA 4IIMA 3RKWA 1B3QA 4JZ3A 2K3BA 1QKWA 1VIEA 1UGPB 2DTOA 3URGA 4PNOA 1LVKA 1JO8A 2HKQB 2EQKA 4PLIA 4JZ4A 3JCMb 1NBEB 2XDPA 4FL6A 2PUOB 1JJ2A 1G83A 4FIBA 3JCMX 2O88A 2P4RA 1NJIC 2E70A 1MGQA 4J9GA 3G4SQ 2PNIA 1LCKA 5A0DA 1IHVA 3C12A 3M56A 1WJQA 4XTZA 3CPFA 1ARKA 2P4TA 2VGMA 2MWOA 5GAN2 2AKKA 3QYHB 5LJ3e 1QVFP 2ECZA 5HY6A 2WSEE 3BY7A 2RQVA 2XD0A 1RI0A 3CMEQ 3AT1B 5ECAA 3CCUQ 5A0GA 3G4SA 1IREB 5GANd 1RABB 4HVUA 4ELZC 3OSVA 3I55T 2DZCA 4A54A 3L1AA 4FM4B 1VQPT 5GMKh 1G3SA 3QWYA 2YLCA 2K5FA 1ACMB 2Y90A 4EMGA 4ZGEB 3PT9A 3CMEA 3CCUA 4OF1A 3VS2A 1PD1A 4Y28E 4XTWA 2KXDA 2YT6A 3H0HA 1D0XA 4J9BA 1WJSA 2RQUA 4C92G 1Q7YC 4M77E 2P0KA 5DLOA 3JB9I 1M5Q1 5I21A 1JXOA 2WACA 5FW9A 1FYNA 2YUNA 5CK9A 3DLLA 2EPDA 1WZOA 3T9NA 1Y0MA 2COZA 1Y96B 3JSCA 5LJ5g 3CD6Q 2JM9A 1JXMA 2EFIA 2CZ0B 2HBPA 3ZL7C 5J39A 1BIBA 2DVJA 3M53A 2DA9A 1H641 3FJPA 2DJZA 2J06A 1KQSP 3A8MB 4EMKA 3PIPA 3X20B 3MEUA 2QGFB 4F7UE 1VYUA 4JRIA 1X69A 3CD6A 1H8KA 3GLXA 4F16A 2L3RA 4C92B 3EGXB 3L42A 1OULA 3S3MA 2LRQA 5GAMh 1LPLA 2AKLA 2B86A 3HFNA 1R77A 4C92C 1X75C 3UWNA 4CC3A 2BKDN 1Q86R 4A4EA 2RPNA 1VQOQ 3M55A 4KUIA 5I11A 2E4HA 5I2SA 4A4GA 4QVCA 1H3ZA 2X3XD 2A7YA 2ZPEB 2K3XA 5KYXB 1K73U 3C0CA 2C0OA 1JEGA 1Q81U 5D6YA 2GCXA 3OYBA 2K9GA 4OMPA 4N4GA 4PJLA 2JMCA 3CXCA 1VQLT 4OMFB 3CCLT 2DF6A 1PG5B 1VQOA 1Y96A 2RB6A 3E1SA 4X9CA 2DFUA 1SSHA 4QVZA 2NUZA 3FB9A 4M75D 2BZXA 4FSXA 3GF5A 2CP2A 2KK4A 2BZ8A 2KBTA 2QI2A 1WIEA 1FXXA 4IURA 3MP1A 2JTFA 3CC2Q 1WQWA 2GNCA 2QG9B 8AT1B 3OSSC 4LXCA 2MI6A 1W6XA 1PHTA 3JCMV 1NEBA 4N0AA 4VUBA 3MEAA 2BUDA 4IKFA 1VQ7Q 4E7SA 2LQ8A 2DTIA 1X27A 3EG1A 4XK8E 4M75A 4AFZC 1ZBJA 4KUDK 4PJOE 2EJ9A 1WYXA 5D7UA 3CC2A 1YITT 1ABQA 2KYMA 1NG2A 4IIOA 1NM7A 1U1SA 5GAMd 1YWOA 4MZTA 3M54A 5FWBA 2RHZA 1Q86C 1VQ7A 1KC8R 5KYXA 4NOYA 5A0LA 1SRLA 4FYWB 4J9IA 1ZUYA 4DEXA 2R57A 4GBQA 2X4JA 5CKBA 4RTYA 2HD0A 5IH2A 3E9FA 3QDFA 1RAHB 1OOTA 2CZ7B 1GL5A 2EBPA 1I1JA 2JN0A 4OB3B 2YUOA 2D1XA 1RAGB 1KG1A 4NS5A 4KULA 3VRYA 3G1JA 4BI8B 1IXDA 4KRTA 2GGRA 1EZZB 5GAOp 4FW2A 2KE9A 1YFNA 3TREA 3OYKA 3GP8A 1QVPA 4GY5A 4QQ6A 1GFDA 3QO3A 3M0RA 2EGAA 3L2ZA 1PKTA 3JCMW 1M3CA 2DD4A 2DL3A 3CBPA 2DBKA 1AWXA 4E7LA 1QKXA 4J6WA 3PMIA 1MMNA 2F69A 5KYWA 3JCMJ 3QUIA 5LJ3h 3M58A 1OX8A 5KYNA 2ED1A 1W2BA 5FWCA 3HPWA 1RAAB 2QQSA 1K0SA 4D8DA 2WSCE 2RJFA 4MMKA 1TG0A 2RH2A 2KVQG 4M77D 1LOJA 1W1FA 2E1HA 3L2QA 1WHJA 4KT0E 1M1KU 2DAQA 4M78B 5EG2A 3A8OB 3OYEA 1T0HA 4EDUA 3EG0A 5CCAA 3H0IA 4F17A 3LGLA 3QDRB 1WFWA 1AHJB 3EAEA 1KQ1A 4M78C 1QVFA 4AMCA 2C0IA 1AWJA 4IUTA 3EH1A 2M1HA 4N4HA 2BTTA 1ZUKA 4Z8AA 3S3NA 2AK5A 4R0KA 4M77A 2H8HA 4KGZB 1KSWA 1WXBA 2OTJT 2VVKA 3OMCA 4OB2B 2F2XA 3OYYA 4PJJA 2CT3A 5CAIA 3M57A 4J7FA 3FJ5A 3EHRA 2E65A 3OYCA 3RR6A 3X25B 3D7SB 2QQ9A 2LVMA 3HKSA 2D0NA 4OB0B 2CDTA 2ABLA 1IGQA 2DPPB 3JCMQ 1VA7A 1M1FA 2DJQA 2FPEA 3RBBB 3I55Q 4OVAA 3OYNA 1FMKA 1VQPQ 1VUBA 2A0FB 4AFQC 3SB2A 2CSIA 2A37A 2V26A 4B9WA 4C8QB 2EQUA 2L3SA 3P8HA 2OAUA 4M78A 2CP3A 2O4XA 3QJYA 4AFUC 4LDXA 4RCBA 2IPOB 3H9NA 1WQ7A 4C8QC 5KH6A 3I55A 5LJ5d 5FROA 3EHQA 1IO6A 1PCXA 1VQPA 2WSFE 3DB4A 4R55A 1EIFA 1H92A 4RTZA 1QW1A 4F04B 2PU9B 1QP2A 4EPCA 3JCMf 4RUGA 4XAXB 2VXFA 2HQHA 2PVOB 4BD3A 1Q82U 3OW2P 4HT8A 3RKYA 5CQXA 5IHIA 4BY6B 2RJCA 1XOVA 4IUQA 2I2LA 2MK5A 4FU6A 4QQDA 5GAN6 2L3QA 2X4YA 2E5KA 4BY6C 2HKNA 1F1BB 1WGSA 1PC0A 5GAN8 3UPUA 1A0NB 1QCOA 1O9SA 1IZ6A 2L8DA 3OYFA 1I81A 3HRUA 4PJOD 3KUFA 5IT9E 2QEXT 1NZ9A 3FIFA 2XMFA 2J6OA 1TTHB 1KHIA 2HZYA 1QVGA 1GBQA 1K73R 2DXTA 2F1LA 1Q81R 4JPBW 2FPDA 4C8QA 3EG9B 3OW2S 2EYXA 3LLRA 2JS2A 2ZCFB 3CXCS 2QXFA 4C92E 5KE2A 4O5VA 2RI5A 3P8DA 2DX1A 3OB9A 1MNDA 3JCMe 2XDBA 3HRSA 2FZGB 4GLMA 3VS1A 4C0FA 4HCCA 3RESA 5GAN3 3Q1JA 1VQ9T 1QCFA 1RAEB 3VUBA 2HL5C 2EYWA 2EQMA 1VQLQ 1Z9QA 1RAFB 3VS6A 5M9OA 1MMAA 3CCLQ 2JS0A 4RTXA 4JDSA 1UGRB 3S6WA 2VXEA 2M02A 3LYIA 4II1A 3V7CA 2KXCA 3DB3A 4M7AF 4XU1A 2MOXA 1OPLA 1RAIB 4M7DB 2KQWA 4RG2A 3V8JA 3CCRT 1VQLA 1UECA 1VQ4T 4R56A 1D1AA 2XU8A 2ZPGB 1M90U 3CCLA 4HT9A 4M7DC 1MNEA 2JJ9A 4Z02A 2V8JA 2OJ2A 4ZN3A 4JRKA 2FZCB 1BYMA 5HCKA 5CR2A 1GBRA 3EG9A 3CPWA 2ENMA 3DKMA 2BE7D 2K2VA 4JLGA 2AT1B 1YITQ 2QYZA 1DJ7B 2O2OA 4JS5A 2K57A 2ESWA 2KRMA 4HVVA 4MDWA 1KD1U 2YSQA 3M4GA 2DRKA 3H6ZA 1D1BA 4CRIA 5GAOq 2JUFA 4ESRA 2LCLA 3CBOA 2CH4W 3VU3C 1JQQA 3JAME 2LTOA 1UTIA 4DOWA 3QZ5B 4C5GA 1YHQT 1YITA 1BCMA 4ZNXA 3AHUA 4RTVA 4UC4A 3MEVA 1OZ2A 1OU9A 4BB7A 2QASA 3X26B 1TUDA 3DLMA 2KSSA 4LUDA 1E7OA 1KFZA 2P0QA 1RI9A 3V8LA 3OYMA 2QQBA 4M7DA 4ZTFA 3S3OA 2GF7A 3OS2A 1UHCA 1VQNT 1W2BS 2D8JA 4Z89A 3RERA 3V8KA 1K8AU 1UUEA 2YUPA 1OX9A 4E7ZA 1M1KR 2HNIA 4FYVB 1UJ0A 4L6V5 1O75A 2LDMA 3H41A 3RNJA 1UGQB 5LJ3g 3N5BB 1N8RU 5CO7A 2EYQA 2L89A 4C5HA 2VYTA 2JOYA 1FMVA 3E19A 4QQGA 5GANj 2HQXA 4ELYC 5KYUB 4M75G 3L2UA 2DXBA 2RN8A 4RMOA 4JS4A 2IIMA 3PVLA 1QLYA 4MZMA 4RTWA 4OB1B 5FRMA 2X51A 2V1QA 3BE3A 2CS7A 4M7AG 1CKAA 3JV3A 3M0UA 4X9DA 2CGHA 1K1ZA 4XTVA 2VC8A 4M78E 2QK0A 1PM3A 2DVEA 3OMGA 1BK2A 3CEYA 4OP0A 2OTJQ 1S72T 2LMJA 3ZEHA 3OS1A 4F7UF 1I5OB 2FPFA 2KR3A 4WF2A 5CIUA 2M0YA 3EH2A 1OPKA 3LH5A 2CH4A 3M0PA 3PNWC 1X2QA 1BIAA 2RMOA 4PKCC 2NLUA 4A4HA 1SPKA 2DTHA 2EKHA 2CP5A 5CQYA 2HQEA 4JJNK 2OTJA 5FU6B 5GANf 1MHNA 1ZSGA 4NL2A 3OBWA 3M0QA 1TWBA 4IUUA 4J9DA 3EGDB 2K4YA 5FU6C 4M7AB 2XK0A 5KYUA 2E10A 4C92D 1Q82R 2COWA 1WJRA 4FSSA 1AD5A 4M7AC 5KYYB 1N5ZA 2LQWA 5FU7B 1WXTA 1YBYA 4GLKA 2JZ2A 1KJWA 1U8RA 3A98A 1KK7A 5FU7C 4E7IA 1X43A 1YP5A 4C8QE 3OQ5A 2QQRA 1M8MA 2RHYA 2G6FX 3CMAQ 4C92A 2W0ZA 2LCCA 2KAFA 2FEIA 2GQVA 1WA7A 3EGXA 4KH0B 2MMPA 2E6ZA 2QTVA 2RK2A 2E5QA 4DBRA 1VIFA 2FB7A 2YUQA 1ABOA 2HDAA 1WNLA 2YWWA 5DLQE 5HKCA 3LWIA 2DNUA 2AZSA 1QVGS 5L8RE 1YJNT 2X35A 4PJOF 3CMAA 1Z9ZA 3GBQA 5GANe 3ASKA 2O01E 4MMLA 1Q7YU 2DXUA 4HKEA 4O6JA 2YRCA 2RM4A 2QEXQ 2J05A 2FZKB 2K6DA 3V7SA 3EGDA 2DL5A 4JJCA 2LJ0A 3F70A 1OV3A 4FW1A 1ZHIA 4ANJA 4AT1B 2F5TX 2HCKA 4OMQA 3JB9J 4Y91A 1HD3A 1AZEA 2DKGA 3JB9H 2F5KA 4FCYA 3RMSA 1X2KA 4YTLA 4CC4B 2LT1A 4RKUE 1WHLA 2L2PA 4IUPA 5LL6S 2QEXA 2XG8D 1ZUUA 3KBGA 4F7UG 3KFVA 2BE9B 3TSZA 4XU0A 4KGVB 1Y07A 3C95A 2HMAA 4ATOA 1RL2A 5FRNA 4M4ZA 5GAMj 3OA6A 1VQ9Q 1FWZA 3UATA 1M90R 1LJOA 3HHTB 1K0XA 2IVWA 1ZBXA 1M2VB 3BDUA 4OMLA 4QVDA 3I9QA 3LX7A 2SRCA 3M4YA 4HA8A 4LNPA 4MDXA 2A08A 4AFSC 3CPWS 4WTOB 1VQ9A 3CCRQ 1JJ2S 1BI2A 2DILA 1VQ4Q 2ZPIB 4PFZA 2LNVA 1KD1R 3RUXA 2RHUA 2B8AA 5CKFA 1K76A 1G3TA 3HRTA 4EMHA 2A28A 3MPUB 1RACB 2RHIA 3CCST 2E64A 1KC8C 3E2UA 1I4K1 2EQIA 4M7DE 3JB9D 3MP8A 5GMKi 2GFAA 5GMKe 1QCNA 1MUZA 3CCRA 1VQ5Q 2M16A 2D6FA 1X6GA 4XQ3A 4FT2A 1FMWA 2FRWA 1VQ4A 1RADB 3LWHA 2DLPA 2YDLA 2DL8A 1D1CA 4FYXB 3VJPA 1D3BB 1GCQC 2FYKA 3ME9A 5GAMf 4A4FA 2V8KA 1BB9A 4Y92A 1UDLA 2YLBA 4D6WA 2ZAEA 4JJDA 2GTOA 2O9VA 2KYBA 4DBQA 5GAN5 4M78D 1VQ5A 4PJOG 3E9GA 1M4ZA 3V7RA 1K8AR 2OX7A 1YHQQ 1M8VA 1G3YA 1R8OB 4P5NA 3U23A 2D8HA 3EFSA 1Y57A 5D6WA 2EGCA 4LDUA 1VQKQ 3WVEB 4ZTJA 1NE8A 1UEBA 2E3IA 2J6FA 4L5GA 1N8RR 2C0TA 3VRZA 3OYDA 5HK0A 5LJ3d 2DIQA 2E6NA 4AG1C 3NPFA 3PE0A 4C0GA 1VQNQ 3WXMB 4KH1B 1YHQA 4PFOA 1M27C 2CREA 1R0CB 3O8VA 3I35A 1JU5C 3CC4Q 2QTXA 2A36A 1I07A 2JM8A 5IXBA 3H0FA 2XHCA 1VYVA 5GAN4 4J9FA 1VQKA 1FX7A 1WI7A 2RJDA 2GBQA 3L2WA 1D0ZA 1YCYA 4DQ2A 3CMAT 2EYYA 4DOVA 1PRMC 4J9CA 1KQSA 1M1GA 2XICA 1S1NA 4FYYB 2CSQA 3FEOA 1VQNA 3G71T 4J6XA 2KNBB 5GAMe 3P8BB 4PJOB 1WDXA 1D3BA 3CC4A 3CXCP 4J9HA 1LNXA 4QW2A 1N9RA 3GNFB 4PJNA 3ER0A 2GQIA 2D0QB 1GRIA 1BBZA 4C8QD 5AT1B 2DO3A 3SEMA 2ZPBB 1ZSZB 1AWOA 1OQKA 3NMZC 1YWPA 4OGEA 3SHWA 1ZLMA 1MMDA 2GTJA 3OY9A 1NLOC 2DYIA 5LJ5j 4PK4A 4MZPA 1ZSZC 4X1VA 1PSEA 2YRVA 3CC7T 1KHCA 1S72Q 1VOMA 2H3JA 3R6NA 1UG1A 4DBHA 2ZGWA 3CCET 3QXEB 2DYBA 4ZGDB 3RMQA 1PKSA 2DEUA 2IG0A 4N4IA 2AHJB 2LNHB 2ROLA 3CCQQ 2DK3A 1N8RC 3VYGA 5IN1A 4BE2A 2VB6A 3CCMT 2KRNA 3OS5A 3SDZA 4JRQA 1BCOA 1ZQ1A 1NYGA 3INZA 1S72A 1RUWA 1WHGA 2F2WA 3NGPA 1WHHA 8ATCB 3I5SA 1GCPA 4KBMB 4M75F 3THKA 1JBMA 3CCQA 2NUTB 3UDCA 4D8KA 4J6YA 1E6GA 1W4SA 2EJGA 4E7KA 1W70A 4JLIA 3J80E 4A63B 1TU0B 3SD4A 4M7AE 5LJ5f 1NYFA 2FL7A 3SFMA 1ZSZA 2OI3A 2FHDA 1VQ6T 4QKUA 2QDYB 3A8HB 2XDDA 1PD0A 3M5AA 3CCJT 3VUZA 2COYA 3A8GB 3EG2A 1K9MU 4XTYA 1Q7YR 1NLPC 2K3YA 3JCMg 1JRIA 3TQ7P 2O9SA 2R5MA 2YHTA 1TUCA 4CC2A 1VQ5T 4HVWA 1SRMA 5GJVB 1K73C 2HBWA 2JVVA 3UT1A 1Q81C 3GOXA 1W2BP 3NHNA 1YJNQ 3REBB 2DBMA 2NUPB 4LDWA 3UA6A 4PL6A 2FO0A 2ZPHB 3MJXA 5J26A 4M7DD 1I8FA 5AYFA 3MEWA 2CZ1B 3VS7A 4BUGA 1YIJT 4J8OA 2Z0WA 3M0SA 2A3LA 2NUTA 4X34A 5A2QE 1IB8A 2MPXC 1YJNA 4ORZA 3EG3A 4LDVA 1BI0A 3PGGA 3PMTA 4C0ZA 4DBFA 1VQKT 3FDRA 4LN2A 3SWNB 5EC7A 1UFFA 2R5AA 5LJ5e 2ATCB 3OYGA 2MAMA 4EMKB 2V1RA 2ZPFB 3SWNC 4HXJA 2O31A 3CC4T 1GXIE 2QA4Q 2LQKA 4EMKC 3I56T 3TEEA 3MCAB 3CCVT 3UA7A 2DD5A 1C1AA 3ZBDA 2RJEA 4J83A 2BZYA 1HK9A 1YI2Q 4FT4A 1G2BA 1IGUA 3M9QA 4M77F 1HXDA 1TXQA 2H3EB 2CZ6B 5D6XA 1QVFS 1E6HA 3TSWA 2KI7A 2QA4A 1AZGB 4BI4A 2RI3A 3H8ZA 1MMGA 4CI0C 2NUPA 1PWTA 2DMOA 2JT4A 3VS5A 4XU3A 2KDSA 1VQMT 2DETA 9ATCB 3JB9F 4A53A 1YI2A 3LGFA 2E41A 1B34B 3JCMP 3CCSQ 2LJ3A 1YJ9T 5KCHA 2VKNA 2JNGA 4AG2C 4E47A 2VUBA 2PZ1A 1IHWA 1KQ2A 1XTDA 1QWEA 5GJWB 1Q95G 3SWNA 3A1PA 2OAWA 3BDLA 1XQHA 2DL7A 1SEMA 2HL3A 3QBYA 3CCSA 4M78F 2RQRA 1K9AA 3JCMc 2J6KA 1AWWA 3C94A 3M0TA 3C4SA 3CCQT 4E7HA 2KT8A 3LH0A 1VYTA 5CKHA 4M75B 3HFOA 2EVRA 3EFOB 4N0AC 2QDLA 1QQJA 2AZVA 1SSFA 5C6SA 1SG5A 1R0BG 3PIOA 4Q5WA 3FLGA 4M75C 2BIVA 2OTLT 1AEYA 1M1KC 4LDYA 1HYOA 5DM7R 5IHKA 4BI3A 3L2RA 3GPLA 3X28B 1YJWT 2DEQA 2M0OA 1NJIU 2SEMA 1QVGP 2DZ9A 3I5RA 5GAOn 3OW2A 1TUGB 2NWMA 1B07A 2JMAA 3QZ9B 3OYJA 1KQSS 3G6ET 3OYHA 3MP6A 1B34A 5IAYA 4RTUA 5GMKj 1NPRA 3TU4K 3OBYA 4HCZA 2LJ1A 3HSBA 5I2MA 1ZX6A 1MV0B 1N6AA 3G71Q 2K5LA 2PTKA 2JTEA 2EJFA 4C8QF 2JXBA 3JCMh 5C0MA 2CT4A 3PFSA 4M7AD 1H3HA 2DRMA 2X4WA 1P92A 3G7ZA 4XTUA
chains in the Genus database with same CATH topology
1BB9A 4Y92A 1UDLA 4GLMA 4JJDA 2GTOA 3VS1A 1RLQC 2O9VA 2KYBA 2KT1A 1QWFA 1HSQA 1QCFA 1JXOA 2ED0A 5FW9A 1UJYA 2FRYA 2EYWA 2M51A 1FYNA 2YUNA 1Z9QA 3U23A 2EPDA 3VS6A 2JS0A 4RTXA 2D8HA 3EGUA 1Y57A 2EGEA 1Y0MA 2RQTA 1SHGA 2EGCA 2JM9A 1JXMA 3ULRB 4E6RA 1T3LA 3ZL7C 2KXCA 2J6FA 2C0TA 3VRZA 2DVJA 2DA9A 2MOXA 2K7AA 1OPLA 4AG1C 3NPFA 2J06A 3PE0A 2RNAA 1M27C 1UECA 2CREA 1RLPC 1GFCA 4RTTA 3I35A 1JU5C 2ROTA 2A36A 1I07A 2JM8A 5IXBA 1VYUA 3H0FA 1X69A 2RQWA 2OJ2A 2FG0A 1H8KA 1VYVA 4F16A 4J9FA 1WI7A 1HJDA 5HCKA 2GBQA 2RF0A 2JW4A 1GBRA 1KIKA 2EYYA 1AVZC 1PRMC 4J9CA 2ENMA 2AKLA 2B86A 1S1NA 2CSQA 1U5SA 3REAB 4CC3A 3CQTA 2KNBB 2O2OA 1CKBA 2RPNA 1WDXA 1WX6A 2CUBA 2ESWA 2KRMA 4J9HA 4HVVA 5I11A 2KEAA 2K2MA 2YSQA 2DRKA 2DL4A 2GQIA 2X3XD 1GRIA 4ESRA 2LZ6B 1BBZA 1SHFA 3SEMA 2CH4W 2DM1A 1T3SA 3C0CA 2C0OA 1JQQA 5I22A 1JEGA 1UTIA 2L3PA 4LE9A 3IQLA 2K9GA 1UE9A 4OMPA 2JMCA 1AWOA 3NMZC 1YWPA 3SHWA 1ZLMA 4ZNXA 4RTVA 2DF6A 2GTJA 1NLOC 3PVQA 4K11A 5IXFA 4X1VA 1J3TA 1SSHA 1WXUA 1YN8A 2NUZA 1TUDA 4LUDA 1E7OA 1KFZA 2BZXA 1PNJA 1RI9A 2DE0X 3R6NA 1UG1A 2BZ8A 2KBTA 1WIEA 2DYBA 1UHCA 1PKSA 2D8JA 4Z89A 2GNCA 2LNHB 1UUEA 2ROLA 2MCNA 2YUPA 5L23A 1W6XA 1PHTA 1UGVA 1NEBA 1X6BA 2KRNA 2KROA 1UJ0A 1NYGA 1X27A 3EG1A 3H41A 3RNJA 4AFZC 1RUWA 1I0CA 3O5ZA 1ZBJA 1WYXA 2F2WA 3NGPA 1OEBA 4J9EA 3I5SA 1GCPA 2F2VA 4DEYA 3THKA 1ABQA 1PRLC 2KYMA 1NG2A 4IIOA 4JJBA 2EYZA 1NM7A 4D8KA 1YWOA 2RN8A 2IIMA 1E6GA 3PVLA 5FWBA 1QLYA 1W70A 4CC7A 2EW3A 3QWXX 4RTWA 4F14A 1BU1A 4OMNA 4A63B 2V1QA 2LCSA 1T0JA 2CUDA 1SRLA 5IHNA 1NYFA 4J9IA 1CKAA 2OI3A 1ZUYA 4DEXA 3JV3A 2W10A 3M0UA 4GBQA 4RTYA 5IH2A 1K1ZA 1OOTA 3EG2A 1GL5A 2EBPA 1I1JA 2YUOA 2D1XA 2L0AA 3VS4A 1NLPC 2LX7A 1BK2A 1M30A 4QT7A 3VRYA 1GCQA 2LMJA 2O9SA 4KRTA 2GGRA 1TUCA 4CC2A 1CSKA 2FPFA 2KR3A 2KE9A 4HVWA 2M0YA 1SRMA 5GJVB 1OPKA 2K79A 2HBWA 3LH5A 2CH4A 3M0PA 1GFDA 1X2QA 3M0RA 3NHNA 2RMOA 3REBB 2DBMA 1AOJA 2EGAA 1SPKA 2EKHA 1PKTA 3UA6A 4WCIA 2FO0A 3TVTA 1M3CA 2DL3A 2DBKA 1AWXA 1YNZA 2VWFA 1QKXA 1ZSGA 1UHFA 3VS7A 3M0QA 2ED1A 4J9DA 5FWCA 3M0SA 1YCSB 1M3BA 1K0SA 2I0NA 4D8DA 4OMMA 4HCKA 1TG0A 4ORZA 2KRSA 2HEQA 3EG3A 4FSSA 1AD5A 1W1FA 1N5ZA 4LN2A 2LP5A 2LQWA 5EC7A 1WLPB 3VS3A 1UFFA 1WXTA 2J7IA 1T0HA 1KJWA 3EG0A 3A98A 2V1RA 3H0IA 4F17A 1M3AA 1WFWA 2HSPA 4HXJA 2O31A 1X43A 2C0IA 1YP5A 1M8MA 1AWJA 2X3WD 2G6FX 2W0ZA 1U3OA 2BTTA 2FEIA 1ZUKA 4OMOA 4Z8AA 3UA7A 1WA7A 2AK5A 4R0KA 2H8HA 1KSWA 2BZYA 1WXBA 2VVKA 2F2XA 1G2BA 2CT3A 4EIKA 2YUQA 1ABOA 2HDAA 1EFNA 3FJ5A 3EHRA 1E6HA 3TSWA 2DNUA 2AZSA 2MIOA 1AZGB 4Z88A 3VS0A 4LUEA 1PWTA 1Z9ZA 2LQNA 2DMOA 2JT4A 3GBQA 3VS5A 2D0NA 2KGTA 2CDTA 3UF4A 2ABLA 1VA7A 2FPEA 2DJQA 3RBBB 2J05A 2K6DA 1FMKA 2DL5A 4JJCA 2LJ0A 2LJ3A 1OV3A 4AFQC 1MV3A 2CSIA 2VKNA 4AG2C 2A37A 2HCKA 2PZ1A 4OMQA 1NEGA 1U06A 1K4US 1HD3A 1QWEA 1AZEA 1V1CA 5GJWB 2L3SA 2OAWA 1X2KA 4CC4B 4IIMA 4AFUC 1B3QA 2DL7A 4JZ3A 2L2PA 1SEMA 2K3BA 1QKWA 3EHQA 1IO6A 1ZUUA 2RQRA 1K9AA 1H92A 3KFVA 4RTZA 1JO8A 3TSZA 2J6KA 1AWWA 3M0TA 4JZ4A 2KT8A 4RUGA 4M4ZA 1VYTA 1G83A 2EVRA 3UATA 2O88A 2QDLA 2P4RA 2AZVA 4J9GA 5IHIA 1K0XA 2PNIA 1LCKA 1XOVA 4OMLA 1AEYA 3I9QA 1ARKA 2L3QA 2SRCA 2E5KA 5IHKA 2AKKA 4LNPA 2A08A 2ECZA 4AFSC 2SEMA 2RQVA 3I5RA 5ECAA 2NWMA 1A0NB 1B07A 2JMAA 2DILA 4HVUA 1K76A 2A28A 4RTUA 2XMFA 3QWYA 2J6OA 2LJ1A 1GBQA 2EQIA 4JPBW 2FPDA 1ZX6A 1MUZA 1MV0B 3VS2A 2EYXA 1X6GA 2PTKA 2KXDA 2JTEA 2FRWA 2JS2A 2YT6A 3H0HA 2DLPA 2JXBA 4J9BA 2YDLA 2DL8A 2CT4A 1H3HA 1GCQC 2DRMA 2RQUA 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BB9 A;  4Y92 A;  1UDL A;  4GLM A;  4JJD A;  2GTO A;  3VS1 A;  1RLQ C;  2O9V A;  2KYB A;  2KT1 A;  1QWF A;  1HSQ A;  1QCF A;  1JXO A;  2ED0 A;  5FW9 A;  1UJY A;  2FRY A;  2EYW A;  2M51 A;  1FYN A;  2YUN A;  1Z9Q A;  3U23 A;  2EPD A;  3VS6 A;  2JS0 A;  4RTX A;  2D8H A;  3EGU A;  1Y57 A;  2EGE A;  1Y0M A;  2RQT A;  1SHG A;  2EGC A;  2JM9 A;  1JXM A;  3ULR B;  4E6R A;  1T3L A;  3ZL7 C;  2KXC A;  2J6F A;  2C0T A;  3VRZ A;  2DVJ A;  2DA9 A;  2MOX A;  2K7A A;  1OPL A;  4AG1 C;  3NPF A;  2J06 A;  3PE0 A;  2RNA A;  1M27 C;  1UEC A;  2CRE A;  1RLP C;  1GFC A;  4RTT A;  3I35 A;  1JU5 C;  2ROT A;  2A36 A;  1I07 A;  2JM8 A;  5IXB A;  1VYU A;  3H0F A;  1X69 A;  2RQW A;  2OJ2 A;  2FG0 A;  1H8K A;  1VYV A;  4F16 A;  4J9F A;  1WI7 A;  1HJD A;  5HCK A;  2GBQ A;  2RF0 A;  2JW4 A;  1GBR A;  1KIK A;  2EYY A;  1AVZ C;  1PRM C;  4J9C A;  2ENM A;  2AKL A;  2B86 A;  1S1N A;  2CSQ A;  1U5S A;  3REA B;  4CC3 A;  3CQT A;  2KNB B;  2O2O A;  1CKB A;  2RPN A;  1WDX A;  1WX6 A;  2CUB A;  2ESW A;  2KRM A;  4J9H A;  4HVV A;  5I11 A;  2KEA A;  2K2M A;  2YSQ A;  2DRK A;  2DL4 A;  2GQI A;  2X3X D;  1GRI A;  4ESR A;  2LZ6 B;  1BBZ A;  1SHF A;  3SEM A;  2CH4 W;  2DM1 A;  1T3S A;  3C0C A;  2C0O A;  1JQQ A;  5I22 A;  1JEG A;  1UTI A;  2L3P A;  4LE9 A;  3IQL A;  2K9G A;  1UE9 A;  4OMP A;  2JMC A;  1AWO A;  3NMZ C;  1YWP A;  3SHW A;  1ZLM A;  4ZNX A;  4RTV A;  2DF6 A;  2GTJ A;  1NLO C;  3PVQ A;  4K11 A;  5IXF A;  4X1V A;  1J3T A;  1SSH A;  1WXU A;  1YN8 A;  2NUZ A;  1TUD A;  4LUD A;  1E7O A;  1KFZ A;  2BZX A;  1PNJ A;  1RI9 A;  2DE0 X;  3R6N A;  1UG1 A;  2BZ8 A;  2KBT A;  1WIE A;  2DYB A;  1UHC A;  1PKS A;  2D8J A;  4Z89 A;  2GNC A;  2LNH B;  1UUE A;  2ROL A;  2MCN A;  2YUP A;  5L23 A;  1W6X A;  1PHT A;  1UGV A;  1NEB A;  1X6B A;  2KRN A;  2KRO A;  1UJ0 A;  1NYG A;  1X27 A;  3EG1 A;  3H41 A;  3RNJ A;  4AFZ C;  1RUW A;  1I0C A;  3O5Z A;  1ZBJ A;  1WYX A;  2F2W A;  3NGP A;  1OEB A;  4J9E A;  3I5S A;  1GCP A;  2F2V A;  4DEY A;  3THK A;  1ABQ A;  1PRL C;  2KYM A;  1NG2 A;  4IIO A;  4JJB A;  2EYZ A;  1NM7 A;  4D8K A;  1YWO A;  2RN8 A;  2IIM A;  1E6G A;  3PVL A;  5FWB A;  1QLY A;  1W70 A;  4CC7 A;  2EW3 A;  3QWX X;  4RTW A;  4F14 A;  1BU1 A;  4OMN A;  4A63 B;  2V1Q A;  2LCS A;  1T0J A;  2CUD A;  1SRL A;  5IHN A;  1NYF A;  4J9I A;  1CKA A;  2OI3 A;  1ZUY A;  4DEX A;  3JV3 A;  2W10 A;  3M0U A;  4GBQ A;  4RTY A;  5IH2 A;  1K1Z A;  1OOT A;  3EG2 A;  1GL5 A;  2EBP A;  1I1J A;  2YUO A;  2D1X A;  2L0A A;  3VS4 A;  1NLP C;  2LX7 A;  1BK2 A;  1M30 A;  4QT7 A;  3VRY A;  1GCQ A;  2LMJ A;  2O9S A;  4KRT A;  2GGR A;  1TUC A;  4CC2 A;  1CSK A;  2FPF A;  2KR3 A;  2KE9 A;  4HVW A;  2M0Y A;  1SRM A;  5GJV B;  1OPK A;  2K79 A;  2HBW A;  3LH5 A;  2CH4 A;  3M0P A;  1GFD A;  1X2Q A;  3M0R A;  3NHN A;  2RMO A;  3REB B;  2DBM A;  1AOJ A;  2EGA A;  1SPK A;  2EKH A;  1PKT A;  3UA6 A;  4WCI A;  2FO0 A;  3TVT A;  1M3C A;  2DL3 A;  2DBK A;  1AWX A;  1YNZ A;  2VWF A;  1QKX A;  1ZSG A;  1UHF A;  3VS7 A;  3M0Q A;  2ED1 A;  4J9D A;  5FWC A;  3M0S A;  1YCS B;  1M3B A;  1K0S A;  2I0N A;  4D8D A;  4OMM A;  4HCK A;  1TG0 A;  4ORZ A;  2KRS A;  2HEQ A;  3EG3 A;  4FSS A;  1AD5 A;  1W1F A;  1N5Z A;  4LN2 A;  2LP5 A;  2LQW A;  5EC7 A;  1WLP B;  3VS3 A;  1UFF A;  1WXT A;  2J7I A;  1T0H A;  1KJW A;  3EG0 A;  3A98 A;  2V1R A;  3H0I A;  4F17 A;  1M3A A;  1WFW A;  2HSP A;  4HXJ A;  2O31 A;  1X43 A;  2C0I A;  1YP5 A;  1M8M A;  1AWJ A;  2X3W D;  2G6F X;  2W0Z A;  1U3O A;  2BTT A;  2FEI A;  1ZUK A;  4OMO A;  4Z8A A;  3UA7 A;  1WA7 A;  2AK5 A;  4R0K A;  2H8H A;  1KSW A;  2BZY A;  1WXB A;  2VVK A;  2F2X A;  1G2B A;  2CT3 A;  4EIK A;  2YUQ A;  1ABO A;  2HDA A;  1EFN A;  3FJ5 A;  3EHR A;  1E6H A;  3TSW A;  2DNU A;  2AZS A;  2MIO A;  1AZG B;  4Z88 A;  3VS0 A;  4LUE A;  1PWT A;  1Z9Z A;  2LQN A;  2DMO A;  2JT4 A;  3GBQ A;  3VS5 A;  2D0N A;  2KGT A;  2CDT A;  3UF4 A;  2ABL A;  1VA7 A;  2FPE A;  2DJQ A;  3RBB B;  2J05 A;  2K6D A;  1FMK A;  2DL5 A;  4JJC A;  2LJ0 A;  2LJ3 A;  1OV3 A;  4AFQ C;  1MV3 A;  2CSI A;  2VKN A;  4AG2 C;  2A37 A;  2HCK A;  2PZ1 A;  4OMQ A;  1NEG A;  1U06 A;  1K4U S;  1HD3 A;  1QWE A;  1AZE A;  1V1C A;  5GJW B;  2L3S A;  2OAW A;  1X2K A;  4CC4 B;  4IIM A;  4AFU C;  1B3Q A;  2DL7 A;  4JZ3 A;  2L2P A;  1SEM A;  2K3B A;  1QKW A;  3EHQ A;  1IO6 A;  1ZUU A;  2RQR A;  1K9A A;  1H92 A;  3KFV A;  4RTZ A;  1JO8 A;  3TSZ A;  2J6K A;  1AWW A;  3M0T A;  4JZ4 A;  2KT8 A;  4RUG A;  4M4Z A;  1VYT A;  1G83 A;  2EVR A;  3UAT A;  2O88 A;  2QDL A;  2P4R A;  2AZV A;  4J9G A;  5IHI A;  1K0X A;  2PNI A;  1LCK A;  1XOV A;  4OML A;  1AEY A;  3I9Q A;  1ARK A;  2L3Q A;  2SRC A;  2E5K A;  5IHK A;  2AKK A;  4LNP A;  2A08 A;  2ECZ A;  4AFS C;  2SEM A;  2RQV A;  3I5R A;  5ECA A;  2NWM A;  1A0N B;  1B07 A;  2JMA A;  2DIL A;  4HVU A;  1K76 A;  2A28 A;  4RTU A;  2XMF A;  3QWY A;  2J6O A;  2LJ1 A;  1GBQ A;  2EQI A;  4JPB W;  2FPD A;  1ZX6 A;  1MUZ A;  1MV0 B;  3VS2 A;  2EYX A;  1X6G A;  2PTK A;  2KXD A;  2JTE A;  2FRW A;  2JS2 A;  2YT6 A;  3H0H A;  2DLP A;  2JXB A;  4J9B A;  2YDL A;  2DL8 A;  2CT4 A;  1H3H A;  1GCQ C;  2DRM A;  2RQU A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 3BFM A;  4M77 G;  1QP3 A;  2RA2 A;  1RLQ C;  2KT1 A;  1QWF A;  2MF2 A;  1HSQ A;  3EFO A;  5KE3 A;  4BDZ A;  2ED0 A;  5KYW B;  1UJY A;  3G71 A;  4C5E A;  2FRY A;  2M51 A;  3X24 B;  3G4S T;  3OS0 A;  3EGU A;  2EGE A;  2RQT A;  3JB9 G;  4M7A A;  3MET A;  1SHG A;  1JB0 E;  1TSF A;  3QYG B;  3ULR B;  1XJW B;  3CC7 Q;  4OGC A;  1T3L A;  4E6R A;  3R6O A;  4XU2 A;  5KYY A;  1AT1 B;  2XID A;  2K7A A;  3CME T;  3CPW P;  3CCE Q;  3CCU T;  1JJ2 P;  1WHK A;  2RNA A;  3NFC A;  3GNG A;  1N27 A;  5CKD A;  1RLP C;  1XNI A;  4PJM A;  3RKX A;  1GFC A;  4RTT A;  2ROT A;  1G5V A;  1Q82 C;  1V76 A;  3CCM Q;  2RQW A;  2FG0 A;  2QA4 T;  3CC7 A;  4M78 G;  1HJD A;  2RF0 A;  1VQ8 Q;  2JW4 A;  2JTM A;  2FVU A;  1KIK A;  4M77 B;  5GAO m;  1AVZ C;  2P84 A;  3J81 E;  3CCE A;  1X01 A;  1U5S A;  3REA B;  3FC3 A;  3OYI A;  3CQT A;  2V8I A;  1UB4 A;  1CKB A;  3A8L B;  4M77 C;  1YI2 T;  5GAN g;  2L5Q A;  1WX6 A;  2CUB A;  4RG8 A;  2KEA A;  1K9M R;  2K2M A;  3QG1 A;  2DL4 A;  3CCM A;  2NYS A;  2KMT A;  2LZ6 B;  5GAO l;  1SHF A;  1BKB A;  2R58 A;  3QHS A;  1VQ8 A;  1I5L A;  2DM1 A;  3JCM d;  2DER A;  1T3S A;  5I22 A;  2L3P A;  4LE9 A;  3IQL A;  3VYH B;  1SKU B;  1UE9 A;  1U1T A;  1VQ6 Q;  2K5I A;  3J7A F;  2M9U A;  2VGN A;  1PSF A;  3CCJ Q;  1OU8 A;  2HSE B;  3PVQ A;  2DIG A;  4K11 A;  7AT1 B;  5IXF A;  5LJ5 h;  3CD6 T;  1J3T A;  1WXU A;  1YN8 A;  4F7U B;  1M9S A;  4C0D B;  1TOV A;  4BE1 A;  2ZZD A;  3M59 A;  4KGX B;  1PNJ A;  2P0P A;  2DE0 X;  1N9S A;  5CVI A;  3MHX A;  2O4X B;  1V29 B;  3JRZ A;  3HL8 A;  6AT1 B;  3GIB A;  4B9X A;  2CKK A;  1VQ6 A;  4C0D C;  3LW5 E;  2AIR B;  3QJ6 A;  4M7D F;  2MCN A;  3CCJ A;  5L23 A;  4C8Q G;  1UGV A;  1X6B A;  2QQA A;  2PUK B;  3OYA A;  2KRO A;  4ME7 A;  1UGS B;  4J5Y A;  2RI2 A;  2LC4 A;  3FRN A;  3VV0 A;  5GMK m;  1I0C A;  3O5Z A;  1OEB A;  4J9E A;  1WPY A;  1YIJ Q;  2F2V A;  1M2V A;  1B7T A;  4DEY A;  4BAC A;  1PRL C;  1ZA1 B;  4JJB A;  2EYZ A;  2PVD B;  1VQO T;  4JUV A;  2RO0 A;  5GAN 7;  1M90 C;  4CC7 A;  2EW3 A;  3QWX X;  4F14 A;  1BU1 A;  4OMN A;  2QGG A;  5GMK l;  5GAO r;  2VAS A;  3OYL A;  2LCS A;  1T0J A;  4HCB A;  2CUD A;  5IHN A;  1K9M C;  2LX9 A;  2QAZ A;  3HP9 A;  4XTX A;  1YIJ A;  2W10 A;  4PFP A;  1Q86 U;  3A5Z B;  3NTK A;  4LD6 A;  3I56 Q;  2XI9 A;  3CCV Q;  4DA4 A;  4RCC A;  4F7U A;  2X4X A;  5DY9 A;  2EQJ A;  1G8X A;  2L0A A;  1KD1 C;  3VS4 A;  2LX7 A;  1M30 A;  4QT7 A;  1GCQ A;  2YRD A;  2C06 A;  1CSK A;  2XKO C;  3QKJ A;  2EKO A;  1X6O A;  2K79 A;  2HAX A;  3CC2 T;  1EX4 A;  3I56 A;  2E12 A;  4BDY A;  1AOJ A;  3ZFJ A;  1ZA2 B;  2CYZ B;  3CCV A;  1D0Y A;  4WCI A;  3TVT A;  4PJO C;  2VV5 A;  1IRX A;  2EWN A;  1YNZ A;  1VQM Q;  2VWF A;  2Y4X A;  1VQ7 T;  2LT4 A;  1NPP A;  5LJ3 j;  2PQW A;  1C6V X;  1UHF A;  3EFR A;  2RK1 A;  1YJ9 Q;  1YCS B;  1M3B A;  2MYS A;  3MKD A;  2I0N A;  4OMM A;  4HCK A;  5J3B A;  1TS9 A;  4L59 A;  2KRS A;  2HEQ A;  1K8A C;  3WVD B;  2LP5 A;  3HTR A;  1WLP B;  3QPH A;  3VS3 A;  4E7J A;  1VQM A;  2RHX A;  5FLX E;  2J7I A;  3QII A;  2Y4Y A;  4E2F B;  1M3A A;  3KXT A;  1BI3 A;  2HSP A;  4C5I A;  1NJI R;  1YJ9 A;  4ZGJ B;  2EIF A;  3NTI A;  2X3W D;  2EAY A;  4M7D G;  5GAM g;  2YXY A;  1U3O A;  4OMO A;  1M2O A;  3CBM A;  2DXC A;  3QSU A;  4IUV A;  1OI1 A;  1VQ8 T;  4ZN1 A;  4LD9 K;  1BI1 A;  1C0M A;  4C92 F;  1KC8 U;  1G3W A;  2D9T A;  1TH7 A;  2G3R A;  1Y71 A;  2OTL Q;  4EIK A;  5HK3 A;  1SF9 A;  2RD1 A;  2X9H A;  4PJO A;  1EFN A;  1YJW Q;  4A4K A;  5CKE A;  5KCO A;  1D09 B;  3RIR A;  5GAN h;  3PTA A;  4V2S A;  1OZ3 A;  2MIO A;  4M75 E;  1Y7X A;  4Z88 A;  5LJ3 f;  3VS0 A;  4LUE A;  4J7I A;  2LQN A;  1OYX A;  3L2V A;  4B6M A;  3G6E Q;  2GFU A;  2KGT A;  3TCJ A;  3VKI A;  3UF4 A;  2PVG B;  2E3H A;  2MWP A;  4PLL A;  2KY9 A;  3MO8 A;  2OTL A;  1WHM A;  1QMC A;  3BW1 A;  4JRP A;  1YJW A;  2CP6 A;  1MV3 A;  3RDV A;  2CP7 A;  4NL3 A;  4TVR A;  1NEG A;  1U06 A;  1K4U S;  4BE0 A;  3NTH A;  1V1C A;  2CP0 A;  3G6E A;  4IIM A;  3RKW A;  1B3Q A;  4JZ3 A;  2K3B A;  1QKW A;  1VIE A;  1UGP B;  2DTO A;  3URG A;  4PNO A;  1LVK A;  1JO8 A;  2HKQ B;  2EQK A;  4PLI A;  4JZ4 A;  3JCM b;  1NBE B;  2XDP A;  4FL6 A;  2PUO B;  1JJ2 A;  1G83 A;  4FIB A;  3JCM X;  2O88 A;  2P4R A;  1NJI C;  2E70 A;  1MGQ A;  4J9G A;  3G4S Q;  2PNI A;  1LCK A;  5A0D A;  1IHV A;  3C12 A;  3M56 A;  1WJQ A;  4XTZ A;  3CPF A;  1ARK A;  2P4T A;  2VGM A;  2MWO A;  5GAN 2;  2AKK A;  3QYH B;  5LJ3 e;  1QVF P;  2ECZ A;  5HY6 A;  2WSE E;  3BY7 A;  2RQV A;  2XD0 A;  1RI0 A;  3CME Q;  3AT1 B;  5ECA A;  3CCU Q;  5A0G A;  3G4S A;  1IRE B;  5GAN d;  1RAB B;  4HVU A;  4ELZ C;  3OSV A;  3I55 T;  2DZC A;  4A54 A;  3L1A A;  4FM4 B;  1VQP T;  5GMK h;  1G3S A;  3QWY A;  2YLC A;  2K5F A;  1ACM B;  2Y90 A;  4EMG A;  4ZGE B;  3PT9 A;  3CME A;  3CCU A;  4OF1 A;  3VS2 A;  1PD1 A;  4Y28 E;  4XTW A;  2KXD A;  2YT6 A;  3H0H A;  1D0X A;  4J9B A;  1WJS A;  2RQU A;  4C92 G;  1Q7Y C;  4M77 E;  2P0K A;  5DLO A;  3JB9 I;  1M5Q 1;  5I21 A;  1JXO A;  2WAC A;  5FW9 A;  1FYN A;  2YUN A;  5CK9 A;  3DLL A;  2EPD A;  1WZO A;  3T9N A;  1Y0M A;  2COZ A;  1Y96 B;  3JSC A;  5LJ5 g;  3CD6 Q;  2JM9 A;  1JXM A;  2EFI A;  2CZ0 B;  2HBP A;  3ZL7 C;  5J39 A;  1BIB A;  2DVJ A;  3M53 A;  2DA9 A;  1H64 1;  3FJP A;  2DJZ A;  2J06 A;  1KQS P;  3A8M B;  4EMK A;  3PIP A;  3X20 B;  3MEU A;  2QGF B;  4F7U E;  1VYU A;  4JRI A;  1X69 A;  3CD6 A;  1H8K A;  3GLX A;  4F16 A;  2L3R A;  4C92 B;  3EGX B;  3L42 A;  1OUL A;  3S3M A;  2LRQ A;  5GAM h;  1LPL A;  2AKL A;  2B86 A;  3HFN A;  1R77 A;  4C92 C;  1X75 C;  3UWN A;  4CC3 A;  2BKD N;  1Q86 R;  4A4E A;  2RPN A;  1VQO Q;  3M55 A;  4KUI A;  5I11 A;  2E4H A;  5I2S A;  4A4G A;  4QVC A;  1H3Z A;  2X3X D;  2A7Y A;  2ZPE B;  2K3X A;  5KYX B;  1K73 U;  3C0C A;  2C0O A;  1JEG A;  1Q81 U;  5D6Y A;  2GCX A;  3OYB A;  2K9G A;  4OMP A;  4N4G A;  4PJL A;  2JMC A;  3CXC A;  1VQL T;  4OMF B;  3CCL T;  2DF6 A;  1PG5 B;  1VQO A;  1Y96 A;  2RB6 A;  3E1S A;  4X9C A;  2DFU A;  1SSH A;  4QVZ A;  2NUZ A;  3FB9 A;  4M75 D;  2BZX A;  4FSX A;  3GF5 A;  2CP2 A;  2KK4 A;  2BZ8 A;  2KBT A;  2QI2 A;  1WIE A;  1FXX A;  4IUR A;  3MP1 A;  2JTF A;  3CC2 Q;  1WQW A;  2GNC A;  2QG9 B;  8AT1 B;  3OSS C;  4LXC A;  2MI6 A;  1W6X A;  1PHT A;  3JCM V;  1NEB A;  4N0A A;  4VUB A;  3MEA A;  2BUD A;  4IKF A;  1VQ7 Q;  4E7S A;  2LQ8 A;  2DTI A;  1X27 A;  3EG1 A;  4XK8 E;  4M75 A;  4AFZ C;  1ZBJ A;  4KUD K;  4PJO E;  2EJ9 A;  1WYX A;  5D7U A;  3CC2 A;  1YIT T;  1ABQ A;  2KYM A;  1NG2 A;  4IIO A;  1NM7 A;  1U1S A;  5GAM d;  1YWO A;  4MZT A;  3M54 A;  5FWB A;  2RHZ A;  1Q86 C;  1VQ7 A;  1KC8 R;  5KYX A;  4NOY A;  5A0L A;  1SRL A;  4FYW B;  4J9I A;  1ZUY A;  4DEX A;  2R57 A;  4GBQ A;  2X4J A;  5CKB A;  4RTY A;  2HD0 A;  5IH2 A;  3E9F A;  3QDF A;  1RAH B;  1OOT A;  2CZ7 B;  1GL5 A;  2EBP A;  1I1J A;  2JN0 A;  4OB3 B;  2YUO A;  2D1X A;  1RAG B;  1KG1 A;  4NS5 A;  4KUL A;  3VRY A;  3G1J A;  4BI8 B;  1IXD A;  4KRT A;  2GGR A;  1EZZ B;  5GAO p;  4FW2 A;  2KE9 A;  1YFN A;  3TRE A;  3OYK A;  3GP8 A;  1QVP A;  4GY5 A;  4QQ6 A;  1GFD A;  3QO3 A;  3M0R A;  2EGA A;  3L2Z A;  1PKT A;  3JCM W;  1M3C A;  2DD4 A;  2DL3 A;  3CBP A;  2DBK A;  1AWX A;  4E7L A;  1QKX A;  4J6W A;  3PMI A;  1MMN A;  2F69 A;  5KYW A;  3JCM J;  3QUI A;  5LJ3 h;  3M58 A;  1OX8 A;  5KYN A;  2ED1 A;  1W2B A;  5FWC A;  3HPW A;  1RAA B;  2QQS A;  1K0S A;  4D8D A;  2WSC E;  2RJF A;  4MMK A;  1TG0 A;  2RH2 A;  2KVQ G;  4M77 D;  1LOJ A;  1W1F A;  2E1H A;  3L2Q A;  1WHJ A;  4KT0 E;  1M1K U;  2DAQ A;  4M78 B;  5EG2 A;  3A8O B;  3OYE A;  1T0H A;  4EDU A;  3EG0 A;  5CCA A;  3H0I A;  4F17 A;  3LGL A;  3QDR B;  1WFW A;  1AHJ B;  3EAE A;  1KQ1 A;  4M78 C;  1QVF A;  4AMC A;  2C0I A;  1AWJ A;  4IUT A;  3EH1 A;  2M1H A;  4N4H A;  2BTT A;  1ZUK A;  4Z8A A;  3S3N A;  2AK5 A;  4R0K A;  4M77 A;  2H8H A;  4KGZ B;  1KSW A;  1WXB A;  2OTJ T;  2VVK A;  3OMC A;  4OB2 B;  2F2X A;  3OYY A;  4PJJ A;  2CT3 A;  5CAI A;  3M57 A;  4J7F A;  3FJ5 A;  3EHR A;  2E65 A;  3OYC A;  3RR6 A;  3X25 B;  3D7S B;  2QQ9 A;  2LVM A;  3HKS A;  2D0N A;  4OB0 B;  2CDT A;  2ABL A;  1IGQ A;  2DPP B;  3JCM Q;  1VA7 A;  1M1F A;  2DJQ A;  2FPE A;  3RBB B;  3I55 Q;  4OVA A;  3OYN A;  1FMK A;  1VQP Q;  1VUB A;  2A0F B;  4AFQ C;  3SB2 A;  2CSI A;  2A37 A;  2V26 A;  4B9W A;  4C8Q B;  2EQU A;  2L3S A;  3P8H A;  2OAU A;  4M78 A;  2CP3 A;  2O4X A;  3QJY A;  4AFU C;  4LDX A;  4RCB A;  2IPO B;  3H9N A;  1WQ7 A;  4C8Q C;  5KH6 A;  3I55 A;  5LJ5 d;  5FRO A;  3EHQ A;  1IO6 A;  1PCX A;  1VQP A;  2WSF E;  3DB4 A;  4R55 A;  1EIF A;  1H92 A;  4RTZ A;  1QW1 A;  4F04 B;  2PU9 B;  1QP2 A;  4EPC A;  3JCM f;  4RUG A;  4XAX B;  2VXF A;  2HQH A;  2PVO B;  4BD3 A;  1Q82 U;  3OW2 P;  4HT8 A;  3RKY A;  5CQX A;  5IHI A;  4BY6 B;  2RJC A;  1XOV A;  4IUQ A;  2I2L A;  2MK5 A;  4FU6 A;  4QQD A;  5GAN 6;  2L3Q A;  2X4Y A;  2E5K A;  4BY6 C;  2HKN A;  1F1B B;  1WGS A;  1PC0 A;  5GAN 8;  3UPU A;  1A0N B;  1QCO A;  1O9S A;  1IZ6 A;  2L8D A;  3OYF A;  1I81 A;  3HRU A;  4PJO D;  3KUF A;  5IT9 E;  2QEX T;  1NZ9 A;  3FIF A;  2XMF A;  2J6O A;  1TTH B;  1KHI A;  2HZY A;  1QVG A;  1GBQ A;  1K73 R;  2DXT A;  2F1L A;  1Q81 R;  4JPB W;  2FPD A;  4C8Q A;  3EG9 B;  3OW2 S;  2EYX A;  3LLR A;  2JS2 A;  2ZCF B;  3CXC S;  2QXF A;  4C92 E;  5KE2 A;  4O5V A;  2RI5 A;  3P8D A;  2DX1 A;  3OB9 A;  1MND A;  3JCM e;  2XDB A;  3HRS A;  2FZG B;  4GLM A;  3VS1 A;  4C0F A;  4HCC A;  3RES A;  5GAN 3;  3Q1J A;  1VQ9 T;  1QCF A;  1RAE B;  3VUB A;  2HL5 C;  2EYW A;  2EQM A;  1VQL Q;  1Z9Q A;  1RAF B;  3VS6 A;  5M9O A;  1MMA A;  3CCL Q;  2JS0 A;  4RTX A;  4JDS A;  1UGR B;  3S6W A;  2VXE A;  2M02 A;  3LYI A;  4II1 A;  3V7C A;  2KXC A;  3DB3 A;  4M7A F;  4XU1 A;  2MOX A;  1OPL A;  1RAI B;  4M7D B;  2KQW A;  4RG2 A;  3V8J A;  3CCR T;  1VQL A;  1UEC A;  1VQ4 T;  4R56 A;  1D1A A;  2XU8 A;  2ZPG B;  1M90 U;  3CCL A;  4HT9 A;  4M7D C;  1MNE A;  2JJ9 A;  4Z02 A;  2V8J A;  2OJ2 A;  4ZN3 A;  4JRK A;  2FZC B;  1BYM A;  5HCK A;  5CR2 A;  1GBR A;  3EG9 A;  3CPW A;  2ENM A;  3DKM A;  2BE7 D;  2K2V A;  4JLG A;  2AT1 B;  1YIT Q;  2QYZ A;  1DJ7 B;  2O2O A;  4JS5 A;  2K57 A;  2ESW A;  2KRM A;  4HVV A;  4MDW A;  1KD1 U;  2YSQ A;  3M4G A;  2DRK A;  3H6Z A;  1D1B A;  4CRI A;  5GAO q;  2JUF A;  4ESR A;  2LCL A;  3CBO A;  2CH4 W;  3VU3 C;  1JQQ A;  3JAM E;  2LTO A;  1UTI A;  4DOW A;  3QZ5 B;  4C5G A;  1YHQ T;  1YIT A;  1BCM A;  4ZNX A;  3AHU A;  4RTV A;  4UC4 A;  3MEV A;  1OZ2 A;  1OU9 A;  4BB7 A;  2QAS A;  3X26 B;  1TUD A;  3DLM A;  2KSS A;  4LUD A;  1E7O A;  1KFZ A;  2P0Q A;  1RI9 A;  3V8L A;  3OYM A;  2QQB A;  4M7D A;  4ZTF A;  3S3O A;  2GF7 A;  3OS2 A;  1UHC A;  1VQN T;  1W2B S;  2D8J A;  4Z89 A;  3RER A;  3V8K A;  1K8A U;  1UUE A;  2YUP A;  1OX9 A;  4E7Z A;  1M1K R;  2HNI A;  4FYV B;  1UJ0 A;  4L6V 5;  1O75 A;  2LDM A;  3H41 A;  3RNJ A;  1UGQ B;  5LJ3 g;  3N5B B;  1N8R U;  5CO7 A;  2EYQ A;  2L89 A;  4C5H A;  2VYT A;  2JOY A;  1FMV A;  3E19 A;  4QQG A;  5GAN j;  2HQX A;  4ELY C;  5KYU B;  4M75 G;  3L2U A;  2DXB A;  2RN8 A;  4RMO A;  4JS4 A;  2IIM A;  3PVL A;  1QLY A;  4MZM A;  4RTW A;  4OB1 B;  5FRM A;  2X51 A;  2V1Q A;  3BE3 A;  2CS7 A;  4M7A G;  1CKA A;  3JV3 A;  3M0U A;  4X9D A;  2CGH A;  1K1Z A;  4XTV A;  2VC8 A;  4M78 E;  2QK0 A;  1PM3 A;  2DVE A;  3OMG A;  1BK2 A;  3CEY A;  4OP0 A;  2OTJ Q;  1S72 T;  2LMJ A;  3ZEH A;  3OS1 A;  4F7U F;  1I5O B;  2FPF A;  2KR3 A;  4WF2 A;  5CIU A;  2M0Y A;  3EH2 A;  1OPK A;  3LH5 A;  2CH4 A;  3M0P A;  3PNW C;  1X2Q A;  1BIA A;  2RMO A;  4PKC C;  2NLU A;  4A4H A;  1SPK A;  2DTH A;  2EKH A;  2CP5 A;  5CQY A;  2HQE A;  4JJN K;  2OTJ A;  5FU6 B;  5GAN f;  1MHN A;  1ZSG A;  4NL2 A;  3OBW A;  3M0Q A;  1TWB A;  4IUU A;  4J9D A;  3EGD B;  2K4Y A;  5FU6 C;  4M7A B;  2XK0 A;  5KYU A;  2E10 A;  4C92 D;  1Q82 R;  2COW A;  1WJR A;  4FSS A;  1AD5 A;  4M7A C;  5KYY B;  1N5Z A;  2LQW A;  5FU7 B;  1WXT A;  1YBY A;  4GLK A;  2JZ2 A;  1KJW A;  1U8R A;  3A98 A;  1KK7 A;  5FU7 C;  4E7I A;  1X43 A;  1YP5 A;  4C8Q E;  3OQ5 A;  2QQR A;  1M8M A;  2RHY A;  2G6F X;  3CMA Q;  4C92 A;  2W0Z A;  2LCC A;  2KAF A;  2FEI A;  2GQV A;  1WA7 A;  3EGX A;  4KH0 B;  2MMP A;  2E6Z A;  2QTV A;  2RK2 A;  2E5Q A;  4DBR A;  1VIF A;  2FB7 A;  2YUQ A;  1ABO A;  2HDA A;  1WNL A;  2YWW A;  5DLQ E;  5HKC A;  3LWI A;  2DNU A;  2AZS A;  1QVG S;  5L8R E;  1YJN T;  2X35 A;  4PJO F;  3CMA A;  1Z9Z A;  3GBQ A;  5GAN e;  3ASK A;  2O01 E;  4MML A;  1Q7Y U;  2DXU A;  4HKE A;  4O6J A;  2YRC A;  2RM4 A;  2QEX Q;  2J05 A;  2FZK B;  2K6D A;  3V7S A;  3EGD A;  2DL5 A;  4JJC A;  2LJ0 A;  3F70 A;  1OV3 A;  4FW1 A;  1ZHI A;  4ANJ A;  4AT1 B;  2F5T X;  2HCK A;  4OMQ A;  3JB9 J;  4Y91 A;  1HD3 A;  1AZE A;  2DKG A;  3JB9 H;  2F5K A;  4FCY A;  3RMS A;  1X2K A;  4YTL A;  4CC4 B;  2LT1 A;  4RKU E;  1WHL A;  2L2P A;  4IUP A;  5LL6 S;  2QEX A;  2XG8 D;  1ZUU A;  3KBG A;  4F7U G;  3KFV A;  2BE9 B;  3TSZ A;  4XU0 A;  4KGV B;  1Y07 A;  3C95 A;  2HMA A;  4ATO A;  1RL2 A;  5FRN A;  4M4Z A;  5GAM j;  3OA6 A;  1VQ9 Q;  1FWZ A;  3UAT A;  1M90 R;  1LJO A;  3HHT B;  1K0X A;  2IVW A;  1ZBX A;  1M2V B;  3BDU A;  4OML A;  4QVD A;  3I9Q A;  3LX7 A;  2SRC A;  3M4Y A;  4HA8 A;  4LNP A;  4MDX A;  2A08 A;  4AFS C;  3CPW S;  4WTO B;  1VQ9 A;  3CCR Q;  1JJ2 S;  1BI2 A;  2DIL A;  1VQ4 Q;  2ZPI B;  4PFZ A;  2LNV A;  1KD1 R;  3RUX A;  2RHU A;  2B8A A;  5CKF A;  1K76 A;  1G3T A;  3HRT A;  4EMH A;  2A28 A;  3MPU B;  1RAC B;  2RHI A;  3CCS T;  2E64 A;  1KC8 C;  3E2U A;  1I4K 1;  2EQI A;  4M7D E;  3JB9 D;  3MP8 A;  5GMK i;  2GFA A;  5GMK e;  1QCN A;  1MUZ A;  3CCR A;  1VQ5 Q;  2M16 A;  2D6F A;  1X6G A;  4XQ3 A;  4FT2 A;  1FMW A;  2FRW A;  1VQ4 A;  1RAD B;  3LWH A;  2DLP A;  2YDL A;  2DL8 A;  1D1C A;  4FYX B;  3VJP A;  1D3B B;  1GCQ C;  2FYK A;  3ME9 A;  5GAM f;  4A4F A;  2V8K A;  1BB9 A;  4Y92 A;  1UDL A;  2YLB A;  4D6W A;  2ZAE A;  4JJD A;  2GTO A;  2O9V A;  2KYB A;  4DBQ A;  5GAN 5;  4M78 D;  1VQ5 A;  4PJO G;  3E9G A;  1M4Z A;  3V7R A;  1K8A R;  2OX7 A;  1YHQ Q;  1M8V A;  1G3Y A;  1R8O B;  4P5N A;  3U23 A;  2D8H A;  3EFS A;  1Y57 A;  5D6W A;  2EGC A;  4LDU A;  1VQK Q;  3WVE B;  4ZTJ A;  1NE8 A;  1UEB A;  2E3I A;  2J6F A;  4L5G A;  1N8R R;  2C0T A;  3VRZ A;  3OYD A;  5HK0 A;  5LJ3 d;  2DIQ A;  2E6N A;  4AG1 C;  3NPF A;  3PE0 A;  4C0G A;  1VQN Q;  3WXM B;  4KH1 B;  1YHQ A;  4PFO A;  1M27 C;  2CRE A;  1R0C B;  3O8V A;  3I35 A;  1JU5 C;  3CC4 Q;  2QTX A;  2A36 A;  1I07 A;  2JM8 A;  5IXB A;  3H0F A;  2XHC A;  1VYV A;  5GAN 4;  4J9F A;  1VQK A;  1FX7 A;  1WI7 A;  2RJD A;  2GBQ A;  3L2W A;  1D0Z A;  1YCY A;  4DQ2 A;  3CMA T;  2EYY A;  4DOV A;  1PRM C;  4J9C A;  1KQS A;  1M1G A;  2XIC A;  1S1N A;  4FYY B;  2CSQ A;  3FEO A;  1VQN A;  3G71 T;  4J6X A;  2KNB B;  5GAM e;  3P8B B;  4PJO B;  1WDX A;  1D3B A;  3CC4 A;  3CXC P;  4J9H A;  1LNX A;  4QW2 A;  1N9R A;  3GNF B;  4PJN A;  3ER0 A;  2GQI A;  2D0Q B;  1GRI A;  1BBZ A;  4C8Q D;  5AT1 B;  2DO3 A;  3SEM A;  2ZPB B;  1ZSZ B;  1AWO A;  1OQK A;  3NMZ C;  1YWP A;  4OGE A;  3SHW A;  1ZLM A;  1MMD A;  2GTJ A;  3OY9 A;  1NLO C;  2DYI A;  5LJ5 j;  4PK4 A;  4MZP A;  1ZSZ C;  4X1V A;  1PSE A;  2YRV A;  3CC7 T;  1KHC A;  1S72 Q;  1VOM A;  2H3J A;  3R6N A;  1UG1 A;  4DBH A;  2ZGW A;  3CCE T;  3QXE B;  2DYB A;  4ZGD B;  3RMQ A;  1PKS A;  2DEU A;  2IG0 A;  4N4I A;  2AHJ B;  2LNH B;  2ROL A;  3CCQ Q;  2DK3 A;  1N8R C;  3VYG A;  5IN1 A;  4BE2 A;  2VB6 A;  3CCM T;  2KRN A;  3OS5 A;  3SDZ A;  4JRQ A;  1BCO A;  1ZQ1 A;  1NYG A;  3INZ A;  1S72 A;  1RUW A;  1WHG A;  2F2W A;  3NGP A;  1WHH A;  8ATC B;  3I5S A;  1GCP A;  4KBM B;  4M75 F;  3THK A;  1JBM A;  3CCQ A;  2NUT B;  3UDC A;  4D8K A;  4J6Y A;  1E6G A;  1W4S A;  2EJG A;  4E7K A;  1W70 A;  4JLI A;  3J80 E;  4A63 B;  1TU0 B;  3SD4 A;  4M7A E;  5LJ5 f;  1NYF A;  2FL7 A;  3SFM A;  1ZSZ A;  2OI3 A;  2FHD A;  1VQ6 T;  4QKU A;  2QDY B;  3A8H B;  2XDD A;  1PD0 A;  3M5A A;  3CCJ T;  3VUZ A;  2COY A;  3A8G B;  3EG2 A;  1K9M U;  4XTY A;  1Q7Y R;  1NLP C;  2K3Y A;  3JCM g;  1JRI A;  3TQ7 P;  2O9S A;  2R5M A;  2YHT A;  1TUC A;  4CC2 A;  1VQ5 T;  4HVW A;  1SRM A;  5GJV B;  1K73 C;  2HBW A;  2JVV A;  3UT1 A;  1Q81 C;  3GOX A;  1W2B P;  3NHN A;  1YJN Q;  3REB B;  2DBM A;  2NUP B;  4LDW A;  3UA6 A;  4PL6 A;  2FO0 A;  2ZPH B;  3MJX A;  5J26 A;  4M7D D;  1I8F A;  5AYF A;  3MEW A;  2CZ1 B;  3VS7 A;  4BUG A;  1YIJ T;  4J8O A;  2Z0W A;  3M0S A;  2A3L A;  2NUT A;  4X34 A;  5A2Q E;  1IB8 A;  2MPX C;  1YJN A;  4ORZ A;  3EG3 A;  4LDV A;  1BI0 A;  3PGG A;  3PMT A;  4C0Z A;  4DBF A;  1VQK T;  3FDR A;  4LN2 A;  3SWN B;  5EC7 A;  1UFF A;  2R5A A;  5LJ5 e;  2ATC B;  3OYG A;  2MAM A;  4EMK B;  2V1R A;  2ZPF B;  3SWN C;  4HXJ A;  2O31 A;  3CC4 T;  1GXI E;  2QA4 Q;  2LQK A;  4EMK C;  3I56 T;  3TEE A;  3MCA B;  3CCV T;  3UA7 A;  2DD5 A;  1C1A A;  3ZBD A;  2RJE A;  4J83 A;  2BZY A;  1HK9 A;  1YI2 Q;  4FT4 A;  1G2B A;  1IGU A;  3M9Q A;  4M77 F;  1HXD A;  1TXQ A;  2H3E B;  2CZ6 B;  5D6X A;  1QVF S;  1E6H A;  3TSW A;  2KI7 A;  2QA4 A;  1AZG B;  4BI4 A;  2RI3 A;  3H8Z A;  1MMG A;  4CI0 C;  2NUP A;  1PWT A;  2DMO A;  2JT4 A;  3VS5 A;  4XU3 A;  2KDS A;  1VQM T;  2DET A;  9ATC B;  3JB9 F;  4A53 A;  1YI2 A;  3LGF A;  2E41 A;  1B34 B;  3JCM P;  3CCS Q;  2LJ3 A;  1YJ9 T;  5KCH A;  2VKN A;  2JNG A;  4AG2 C;  4E47 A;  2VUB A;  2PZ1 A;  1IHW A;  1KQ2 A;  1XTD A;  1QWE A;  5GJW B;  1Q95 G;  3SWN A;  3A1P A;  2OAW A;  3BDL A;  1XQH A;  2DL7 A;  1SEM A;  2HL3 A;  3QBY A;  3CCS A;  4M78 F;  2RQR A;  1K9A A;  3JCM c;  2J6K A;  1AWW A;  3C94 A;  3M0T A;  3C4S A;  3CCQ T;  4E7H A;  2KT8 A;  3LH0 A;  1VYT A;  5CKH A;  4M75 B;  3HFO A;  2EVR A;  3EFO B;  4N0A C;  2QDL A;  1QQJ A;  2AZV A;  1SSF A;  5C6S A;  1SG5 A;  1R0B G;  3PIO A;  4Q5W A;  3FLG A;  4M75 C;  2BIV A;  2OTL T;  1AEY A;  1M1K C;  4LDY A;  1HYO A;  5DM7 R;  5IHK A;  4BI3 A;  3L2R A;  3GPL A;  3X28 B;  1YJW T;  2DEQ A;  2M0O A;  1NJI U;  2SEM A;  1QVG P;  2DZ9 A;  3I5R A;  5GAO n;  3OW2 A;  1TUG B;  2NWM A;  1B07 A;  2JMA A;  3QZ9 B;  3OYJ A;  1KQS S;  3G6E T;  3OYH A;  3MP6 A;  1B34 A;  5IAY A;  4RTU A;  5GMK j;  1NPR A;  3TU4 K;  3OBY A;  4HCZ A;  2LJ1 A;  3HSB A;  5I2M A;  1ZX6 A;  1MV0 B;  1N6A A;  3G71 Q;  2K5L A;  2PTK A;  2JTE A;  2EJF A;  4C8Q F;  2JXB A;  3JCM h;  5C0M A;  2CT4 A;  3PFS A;  4M7A D;  1H3H A;  2DRM A;  2X4W A;  1P92 A;  3G7Z A;  4XTU A; 
#chains in the Genus database with same CATH homology
 1BB9 A;  4Y92 A;  1UDL A;  4GLM A;  4JJD A;  2GTO A;  3VS1 A;  1RLQ C;  2O9V A;  2KYB A;  2KT1 A;  1QWF A;  1HSQ A;  1QCF A;  1JXO A;  2ED0 A;  5FW9 A;  1UJY A;  2FRY A;  2EYW A;  2M51 A;  1FYN A;  2YUN A;  1Z9Q A;  3U23 A;  2EPD A;  3VS6 A;  2JS0 A;  4RTX A;  2D8H A;  3EGU A;  1Y57 A;  2EGE A;  1Y0M A;  2RQT A;  1SHG A;  2EGC A;  2JM9 A;  1JXM A;  3ULR B;  4E6R A;  1T3L A;  3ZL7 C;  2KXC A;  2J6F A;  2C0T A;  3VRZ A;  2DVJ A;  2DA9 A;  2MOX A;  2K7A A;  1OPL A;  4AG1 C;  3NPF A;  2J06 A;  3PE0 A;  2RNA A;  1M27 C;  1UEC A;  2CRE A;  1RLP C;  1GFC A;  4RTT A;  3I35 A;  1JU5 C;  2ROT A;  2A36 A;  1I07 A;  2JM8 A;  5IXB A;  1VYU A;  3H0F A;  1X69 A;  2RQW A;  2OJ2 A;  2FG0 A;  1H8K A;  1VYV A;  4F16 A;  4J9F A;  1WI7 A;  1HJD A;  5HCK A;  2GBQ A;  2RF0 A;  2JW4 A;  1GBR A;  1KIK A;  2EYY A;  1AVZ C;  1PRM C;  4J9C A;  2ENM A;  2AKL A;  2B86 A;  1S1N A;  2CSQ A;  1U5S A;  3REA B;  4CC3 A;  3CQT A;  2KNB B;  2O2O A;  1CKB A;  2RPN A;  1WDX A;  1WX6 A;  2CUB A;  2ESW A;  2KRM A;  4J9H A;  4HVV A;  5I11 A;  2KEA A;  2K2M A;  2YSQ A;  2DRK A;  2DL4 A;  2GQI A;  2X3X D;  1GRI A;  4ESR A;  2LZ6 B;  1BBZ A;  1SHF A;  3SEM A;  2CH4 W;  2DM1 A;  1T3S A;  3C0C A;  2C0O A;  1JQQ A;  5I22 A;  1JEG A;  1UTI A;  2L3P A;  4LE9 A;  3IQL A;  2K9G A;  1UE9 A;  4OMP A;  2JMC A;  1AWO A;  3NMZ C;  1YWP A;  3SHW A;  1ZLM A;  4ZNX A;  4RTV A;  2DF6 A;  2GTJ A;  1NLO C;  3PVQ A;  4K11 A;  5IXF A;  4X1V A;  1J3T A;  1SSH A;  1WXU A;  1YN8 A;  2NUZ A;  1TUD A;  4LUD A;  1E7O A;  1KFZ A;  2BZX A;  1PNJ A;  1RI9 A;  2DE0 X;  3R6N A;  1UG1 A;  2BZ8 A;  2KBT A;  1WIE A;  2DYB A;  1UHC A;  1PKS A;  2D8J A;  4Z89 A;  2GNC A;  2LNH B;  1UUE A;  2ROL A;  2MCN A;  2YUP A;  5L23 A;  1W6X A;  1PHT A;  1UGV A;  1NEB A;  1X6B A;  2KRN A;  2KRO A;  1UJ0 A;  1NYG A;  1X27 A;  3EG1 A;  3H41 A;  3RNJ A;  4AFZ C;  1RUW A;  1I0C A;  3O5Z A;  1ZBJ A;  1WYX A;  2F2W A;  3NGP A;  1OEB A;  4J9E A;  3I5S A;  1GCP A;  2F2V A;  4DEY A;  3THK A;  1ABQ A;  1PRL C;  2KYM A;  1NG2 A;  4IIO A;  4JJB A;  2EYZ A;  1NM7 A;  4D8K A;  1YWO A;  2RN8 A;  2IIM A;  1E6G A;  3PVL A;  5FWB A;  1QLY A;  1W70 A;  4CC7 A;  2EW3 A;  3QWX X;  4RTW A;  4F14 A;  1BU1 A;  4OMN A;  4A63 B;  2V1Q A;  2LCS A;  1T0J A;  2CUD A;  1SRL A;  5IHN A;  1NYF A;  4J9I A;  1CKA A;  2OI3 A;  1ZUY A;  4DEX A;  3JV3 A;  2W10 A;  3M0U A;  4GBQ A;  4RTY A;  5IH2 A;  1K1Z A;  1OOT A;  3EG2 A;  1GL5 A;  2EBP A;  1I1J A;  2YUO A;  2D1X A;  2L0A A;  3VS4 A;  1NLP C;  2LX7 A;  1BK2 A;  1M30 A;  4QT7 A;  3VRY A;  1GCQ A;  2LMJ A;  2O9S A;  4KRT A;  2GGR A;  1TUC A;  4CC2 A;  1CSK A;  2FPF A;  2KR3 A;  2KE9 A;  4HVW A;  2M0Y A;  1SRM A;  5GJV B;  1OPK A;  2K79 A;  2HBW A;  3LH5 A;  2CH4 A;  3M0P A;  1GFD A;  1X2Q A;  3M0R A;  3NHN A;  2RMO A;  3REB B;  2DBM A;  1AOJ A;  2EGA A;  1SPK A;  2EKH A;  1PKT A;  3UA6 A;  4WCI A;  2FO0 A;  3TVT A;  1M3C A;  2DL3 A;  2DBK A;  1AWX A;  1YNZ A;  2VWF A;  1QKX A;  1ZSG A;  1UHF A;  3VS7 A;  3M0Q A;  2ED1 A;  4J9D A;  5FWC A;  3M0S A;  1YCS B;  1M3B A;  1K0S A;  2I0N A;  4D8D A;  4OMM A;  4HCK A;  1TG0 A;  4ORZ A;  2KRS A;  2HEQ A;  3EG3 A;  4FSS A;  1AD5 A;  1W1F A;  1N5Z A;  4LN2 A;  2LP5 A;  2LQW A;  5EC7 A;  1WLP B;  3VS3 A;  1UFF A;  1WXT A;  2J7I A;  1T0H A;  1KJW A;  3EG0 A;  3A98 A;  2V1R A;  3H0I A;  4F17 A;  1M3A A;  1WFW A;  2HSP A;  4HXJ A;  2O31 A;  1X43 A;  2C0I A;  1YP5 A;  1M8M A;  1AWJ A;  2X3W D;  2G6F X;  2W0Z A;  1U3O A;  2BTT A;  2FEI A;  1ZUK A;  4OMO A;  4Z8A A;  3UA7 A;  1WA7 A;  2AK5 A;  4R0K A;  2H8H A;  1KSW A;  2BZY A;  1WXB A;  2VVK A;  2F2X A;  1G2B A;  2CT3 A;  4EIK A;  2YUQ A;  1ABO A;  2HDA A;  1EFN A;  3FJ5 A;  3EHR A;  1E6H A;  3TSW A;  2DNU A;  2AZS A;  2MIO A;  1AZG B;  4Z88 A;  3VS0 A;  4LUE A;  1PWT A;  1Z9Z A;  2LQN A;  2DMO A;  2JT4 A;  3GBQ A;  3VS5 A;  2D0N A;  2KGT A;  2CDT A;  3UF4 A;  2ABL A;  1VA7 A;  2FPE A;  2DJQ A;  3RBB B;  2J05 A;  2K6D A;  1FMK A;  2DL5 A;  4JJC A;  2LJ0 A;  2LJ3 A;  1OV3 A;  4AFQ C;  1MV3 A;  2CSI A;  2VKN A;  4AG2 C;  2A37 A;  2HCK A;  2PZ1 A;  4OMQ A;  1NEG A;  1U06 A;  1K4U S;  1HD3 A;  1QWE A;  1AZE A;  1V1C A;  5GJW B;  2L3S A;  2OAW A;  1X2K A;  4CC4 B;  4IIM A;  4AFU C;  1B3Q A;  2DL7 A;  4JZ3 A;  2L2P A;  1SEM A;  2K3B A;  1QKW A;  3EHQ A;  1IO6 A;  1ZUU A;  2RQR A;  1K9A A;  1H92 A;  3KFV A;  4RTZ A;  1JO8 A;  3TSZ A;  2J6K A;  1AWW A;  3M0T A;  4JZ4 A;  2KT8 A;  4RUG A;  4M4Z A;  1VYT A;  1G83 A;  2EVR A;  3UAT A;  2O88 A;  2QDL A;  2P4R A;  2AZV A;  4J9G A;  5IHI A;  1K0X A;  2PNI A;  1LCK A;  1XOV A;  4OML A;  1AEY A;  3I9Q A;  1ARK A;  2L3Q A;  2SRC A;  2E5K A;  5IHK A;  2AKK A;  4LNP A;  2A08 A;  2ECZ A;  4AFS C;  2SEM A;  2RQV A;  3I5R A;  5ECA A;  2NWM A;  1A0N B;  1B07 A;  2JMA A;  2DIL A;  4HVU A;  1K76 A;  2A28 A;  4RTU A;  2XMF A;  3QWY A;  2J6O A;  2LJ1 A;  1GBQ A;  2EQI A;  4JPB W;  2FPD A;  1ZX6 A;  1MUZ A;  1MV0 B;  3VS2 A;  2EYX A;  1X6G A;  2PTK A;  2KXD A;  2JTE A;  2FRW A;  2JS2 A;  2YT6 A;  3H0H A;  2DLP A;  2JXB A;  4J9B A;  2YDL A;  2DL8 A;  2CT4 A;  1H3H A;  1GCQ C;  2DRM A;  2RQU A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...