5I22A

Amphiphysin sh3 in complex with chikungunya virus nsp3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box-dependent-interacting protein 1
publication title Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i22A00
3EG1A 2KT8A 2K7AA 4HVVA 5IH2A 3THKA 3M0RA 2K6DA 1QWFA 2DBMA 2DL5A 2RF0A 1UECA 3PE0A 2J06A 1CKAA 1I07A 2RQUA 1NLOC 1UGVA 2OAWA 1AWWA 1CSKA 2EGEA 1AZEA 1M3CA 1OV3A 2DE0X 2C0TA 4LUDA 1SHFA 2ROTA 2LX7A 1BBZA 3M0UA 2D1XA 2HSPA 3VS6A 2CT3A 4J9IA 2GQIA 2AKLA 1K0XA 2VKNA 2AZSA 1M27C 2FRYA 2L0AA 2ED1A 4AG1C 1K76A 1ARKA 1N5ZA 3U23A 3LH5A 3JV3A 3EG0A 4JZ4A 1YWPA 1GCQC 2RNAA 2JT4A 2LNHB 4JPBW 3M0SA 2AK5A 2DLPA 4AFUC 1RI9A 2KR3A 4Z89A 1HSQA 2CSQA 1PKTA 2ECZA 2GTOA 2X3WD 1JU5C 3H41A 1VYUA 1Z9ZA 1I1JA 2EYZA 3UA7A 4ZNXA 4GBQA 2GNCA 2KRMA 2JM8A 1T3LA 2YUPA 2YT6A 1AWOA 4F14A 1FYNA 3H0HA 4J9HA 1YNZA 4CC3A 1OOTA 2MCNA 4M4ZA 2LQNA 2KNBB 4HCKA 3GBQA 3I35A 1IO6A 1I0CA 3RNJA 1U3OA 2CDTA 2FPFA 3M0PA 1M3AA 4RUGA 5FWCA 1GFDA 1QLYA 2K79A 3VS2A 1UG1A 1UTIA 2KYBA 2A08A 4DEYA 1H3HA 3EHRA 2ED0A 2SEMA 2KEAA 3NPFA 2KBTA 4K11A 2EYYA 1V1CA 5L23A 1GCQA 5IXFA 1CKBA 1ZBJA 2D8HA 4GLMA 3TSZA 1WIEA 1M30A 2YDLA 1WA7A 2JXBA 2E5KA 2EKHA 2LQWA 1W70A 1OPKA 3NGPA 1H92A 3SHWA 1SEMA 2C0IA 4OMOA 2CH4W 1AVZC 1FMKA 2JMCA 1OEBA 2J05A 2DRMA 2LP5A 3O5ZA 1B3QA 2H8HA 1ABOA 4JJBA 1KJWA 2LJ1A 4LNPA 2X3XD 2O88A 2LCSA 3EG3A 2F2WA 1UJYA 3EHQA 1G83A 2HDAA 1VYTA 4J9BA 2K9GA 1E6GA 4F16A 1VYVA 4J9DA 2KRNA 2HEQA 2DL3A 2KT1A 1WLPB 2CUDA 4OMLA 1RUWA 4J9GA 4WCIA 1NLPC 2O9SA 1PNJA 1BK2A 4IIMA 2DNUA 2KROA 1UDLA 2ABLA 2DBKA 1UE9A 4Y92A 1PHTA 2KE9A 4LE9A 4LN2A 3ULRB 2L3QA 1X6BA 1K0SA 1H8KA 3FJ5A 1KSWA 1AWXA 1PRLC 1T0JA 2YUQA 1YP5A 2DMOA 5IHIA 2A37A 1AEYA 2DL8A 1AZGB 1U06A 2EYXA 2PZ1A 5FWBA 3EGUA 2J6FA 3VS4A 4AFSC 5EC7A 2RN8A 1HJDA 1NEBA 2JM9A 1TUDA 1OPLA 3C0CA 2LJ0A 2RQVA 3UATA 4DEXA 4ORZA 2EYWA 2GTJA 1JXOA 2FPEA 4JJCA 2M0YA 4OMQA 1NYGA 1JQQA 2FEIA 3VRZA 2RPNA 2LJ3A 3H0IA 1QKXA 1T3SA 2P4RA 5GJWB 2M51A 4KRTA 4D8KA 2MOXA 2K3BA 1KFZA 2OJ2A 1RLQC 2JS0A 1T0HA 2NUZA 2K2MA 4FSSA 1HD3A 2RQTA 4AFQC 2JMAA 2V1RA 1RLPC 1UFFA 1YN8A 3VS5A 3M0QA 4Z8AA 4AG2C 1MV3A 2J6KA 1GRIA 1K9AA 2BZXA 3I9QA 1E6HA 2F2VA 2PTKA 3SEMA 1WXUA 3EG2A 3CQTA 1X69A 2CREA 2CSIA 1ZLMA 2PNIA 2HBWA 4D8DA 2ENMA 2EBPA 2JW4A 5HCKA 2O2OA 1J3TA 2O31A 3QWYA 4E6RA 1AD5A 2G6FX 2J6OA 3IQLA 3REBB 1SSHA 2VWFA 1A0NB 2B86A 5I22A 3TSWA 2JTEA 4RTZA 4RTXA 1LCKA 2BTTA 4EIKA 1UUEA 2VVKA 3KFVA 3TVTA 4CC2A 1Y0MA 1WI7A 1AOJA 4Z88A 4RTVA 2DYBA 3NMZC 1TUCA 1W1FA 4CC7A 4J9EA 1BU1A 1VA7A 2DVJA 3VS1A 1GL5A 2FO0A 3NHNA 1K1ZA 1SRLA 1JEGA 5I11A 1AWJA 1YWOA 2A28A 1X2KA 2KRSA 2F2XA 2KXDA 4RTWA 4HXJA 4OMNA 1BB9A 3I5RA 4A63B 4QT7A 2EQIA 1X6GA 2DL7A 4OMMA 2GBQA 2BZ8A 2YUOA 3I5SA 4LUEA 1WYXA 1NM7A 1NEGA 2L3PA 5IHNA 2EGAA 2RMOA 1MUZA 1WDXA 1JO8A 2JS2A 3QWXX 2XMFA 2AKKA 2DM1A 4HVWA 2HCKA 3PVLA 1X27A 1ABQA 1EFNA 5GJVB 1QWEA 2GGRA 2W10A 2CT4A 4RTTA 2NWMA 3A98A 2O9VA 2DRKA 2YSQA 3ZL7C 1ZUYA 2A36A 1M8MA 3VRYA 1GCPA 1YCSB 1NG2A 1SRMA 1ZUKA 2DX1A 1ZSGA 2I0NA 3UF4A 5IXBA 2KGTA 4JZ3A 2EGCA 1WXTA 1QCFA 4J9CA 3R6NA 2D0NA 4CC4B 4RTYA 1W6XA 2RQWA 1TG0A 2KXCA 2EPDA 2W0ZA 2EW3A 4RTUA 1M3BA 2DL4A 3RBBB 4AFZC 1GBQA 3M0TA 2J7IA 2MIOA 2CUBA 1SPKA 4F17A 2BZYA 5FW9A 1X43A 1PKSA 1GBRA 2DF6A 2FPDA 2RQRA 4OMPA 1ZUUA 2D8JA 4ESRA 2LMJA 1B07A 1ZX6A 5ECAA 5IHKA 2DJQA 1S1NA 2C0OA 1XOVA 1Z9QA 1WX6A 2DA9A 2EVRA 4JJDA 2IIMA 3VS0A 3H0FA 1PRMC 4R0KA 1Y57A 3REAB 1JXMA 1QKWA 4J9FA 1UHFA 1G2BA 4IIOA 2DILA 2LZ6B 3VS3A 1WFWA 1E7OA 2OI3A 2KYMA 2YUNA 1NYFA 1U5SA 2FRWA 4HVUA 2QDLA 4X1VA 2AZVA 1GFCA 1KIKA 3VS7A 2CH4A 1UJ0A 3UA6A 2V1QA 1WXBA 2L3SA 1PWTA 1SHGA 2L2PA 2ROLA 2ESWA 3PVQA 1UHCA 1X2QA 1K4US 2SRCA 2FG0A 1MV0B
chains in the Genus database with same CATH superfamily
2K7AA 1IREB 5A2QE 3QHSA 1QWFA 4C0DB 1YIJT 5GMKh 3PE0A 1R8OB 2J06A 3A8OB 1CKAA 2ZPIB 3CCQA 2RHYA 4PL6A 1R0BG 3OYGA 4M75E 2NYSA 2QTVA 4M78G 1AZEA 4C92G 1PSFA 3GP8A 4ANJA 1VQNQ 1YJWA 5GAN7 3GPLA 2LX7A 3VS6A 2HSPA 2CT3A 2K3YA 4DA4A 2P0QA 3O8VA 2GQIA 2P0PA 4P5NA 2FB7A 1EZZB 1M27C 1D3BA 3CCJQ 3FIFA 2LDMA 3JCMg 1MMAA 5FLXE 3LYIA 3CD6T 3LH5A 3JV3A 1YIJQ 4XTWA 4BACA 3G71T 2LTOA 4EMKB 1WHJA 4Q5WA 4Z89A 2RHUA 3JB9G 1QQJA 5GMKl 2QK0A 2ECZA 5FRNA 2M0OA 3H41A 3UA7A 5GANj 4QVDA 2KRMA 2JM8A 3EGXA 2O4XB 1G8XA 3L42A 2X9HA 3CCLT 3RMQA 3H0HA 2DXUA 2EAYA 2KNBB 3LW5E 1IO6A 1S72A 2CDTA 2QA4Q 4YTLA 3G71Q 1BI0A 1PM3A 4M7AD 4BDZA 1UTIA 4ZGEB 1I4K1 3FB9A 1PD1A 1QP2A 1M4ZA 3LGFA 2ED0A 2LQ8A 4BY6B 1ZHIA 2KBTA 2FVUA 1IHWA 2EYYA 2OAUA 1CKBA 2D8HA 3JB9J 2XICA 1WIEA 4KH0B 3OYDA 4M7AA 1K8AR 1WA7A 2LQWA 1QVPA 4OB2B 3NGPA 2E12A 3SHWA 2Y90A 2C0IA 1OZ3A 4OMOA 2MI6A 2CH4W 3J80E 2J05A 2LP5A 3CPWP 2L5QA 1ABOA 4ZN3A 3CCUA 4PJOG 2KAFA 5GMKm 4R55A 1W4SA 2LJ1A 3LLRA 1WQ7A 1UB4A 3L2ZA 2HAXA 3EHQA 2NUTA 3ZFJA 2KK4A 4ZGDB 4LDXA 4XU1A 4RKUE 2K9GA 1E6GA 2E6NA 4J9DA 5CAIA 4NL2A 1K73U 4C8QB 4OMLA 1RUWA 1UGPB 4WCIA 1NLPC 2LCCA 1Y96B 2DNUA 2DBKA 5LJ3d 4N0AC 1PHTA 4PJMA 1AT1B 4LN2A 3ULRB 1QVFS 3G6ET 5CQXA 1H8KA 3L2RA 1KSWA 1AWXA 2KQWA 3WVDB 1YJ9Q 1YP5A 5IHIA 1D1CA 2OTJQ 2PZ1A 5FWBA 4E7KA 1MMGA 2E3IA 2J6FA 5EC7A 5AT1B 3OYFA 1TUDA 4FW2A 5D6XA 1IZ6A 4A4FA 3EGDA 4DEXA 1IB8A 3PNWC 4ORZA 3CMAA 1KQSS 2DAQA 2FPEA 2M0YA 4M7AF 4KT0E 2PQWA 2ZPEB 5FU6C 2JOYA 4KRTA 4D8KA 2VASA 3SWNB 1NJIR 1G3YA 4FSSA 1HD3A 4UC4A 2CP2A 3G6EQ 2KMTA 4DBQA 3C95A 5LJ5h 5CVIA 4OF1A 2DTOA 1NJIC 3I9QA 3CCQQ 1E6HA 2F2VA 3SEMA 4LXCA 2E10A 4A4KA 2CSIA 2PNIA 3EFRA 4N0AA 1QMCA 2JW4A 1VQ6A 1J3TA 4C0DC 1HK9A 2O31A 3QWYA 3JCMW 2J6OA 3IQLA 4C5HA 1SSHA 4J8OA 5GANg 1Q7YR 3C4SA 2D9TA 1Q81R 5GAMg 1V76A 1VQ8A 2VC8A 2BTTA 1Q7YC 3KFVA 3TVTA 4XQ3A 4A53A 1C6VX 4RTVA 2DYBA 3NMZC 1YJNT 1C0MA 1W1FA 4J9EA 5LJ3j 1SRLA 2QQBA 4HKEA 5C6SA 1O9SA 1VQMA 3RDVA 3I5RA 4CRIA 4EMKC 1QVGA 3M9QA 4OMMA 2EQIA 2GBQA 3OMGA 4LUEA 3DB3A 1I5LA 1QVGS 1TTHB 2L3PA 2EGAA 3CBOA 1S72Q 3HL8A 3S6WA 5CKHA 4M7DG 1ACMB 3PIOA 4AMCA 4II1A 3MO8A 2CP3A 2RJDA 1YJNQ 2F1LA 1VOMA 1YBYA 1TUGB 4KH1B 2AT1B 3CCMA 1I81A 4QQDA 4LDWA 1NG2A 1ZUKA 5GAN4 1TH7A 3A8LB 2I0NA 2RJFA 3L1AA 1ZSZC 4JZ3A 2EGCA 1PD0A 5FRMA 3JCMd 2K57A 2D0NA 4BY6C 5KCOA 3M56A 1QP3A 2KXCA 2EPDA 3S3MA 5A0LA 2HMAA 5GANf 2QQ9A 4KGZB 4EMKA 4M77D 4AFZC 2MIOA 2D6FA 1SPKA 5CQYA 4F7UA 2DIGA 2LNVA 3LX7A 3RR6A 2DTHA 4FYXB 1TS9A 1VIFA 1GBRA 1IXDA 5CKFA 5KE3A 2MAMA 4M77A 1XJWB 2EKOA 1MMDA 3QYGB 1SKUB 5ECAA 4M7AB 1PCXA 4JJDA 2EVRA 2KY9A 4ME7A 2PUOB 2EIFA 4C8QC 3GIBA 1PRMC 4R0KA 2DEQA 1QKWA 2XIDA 2OTLT 5CO7A 2DILA 1YIJA 5HK0A 2E70A 2OI3A 1ZSZA 2MK5A 4HVUA 5DY9A 2QDLA 4X1VA 5IN1A 3VS7A 2VV5A 3X24B 1UJ0A 3H9NA 1QVFP 3EFSA 2NUTB 3A1PA 2COYA 3OMCA 1QW1A 3QJ6A 2ROLA 1IHVA 1X2QA 4FYWB 4A4EA 1W2BA 2L3RA 3T9NA 2FG0A 1MV0B 2EQMA 2KT8A 3EG1A 3FJPA 3JB9I 5IH2A 2CZ0B 2DBMA 5I2MA 2RF0A 4DQ2A 1W2BS 3CC4A 1N8RC 1I07A 3CD6A 4IKFA 4F7UF 1UGVA 3V8LA 1AWWA 4DBFA 1CSKA 1VQPT 4M75G 1M3CA 2LT1A 2GFUA 3LWIA 2IPOB 1B34A 2C0TA 3BDUA 5IT9E 4C8QA 1N9RA 2PUKB 3M0UA 4M77F 1M1KR 2FHDA 4J9IA 1VQ5A 1Y96A 3CC2T 1K0XA 2VKNA 2O01E 3C94A 2V8JA 2L0AA 2XG8D 5CKEA 1M1KC 2DIQA 1VQ8Q 1ARKA 5AYFA 3CCLA 3U23A 1OX9A 4JZ4A 1D1AA 3E9GA 2WSEE 2LNHB 4LDYA 2COZA 3JCMP 4KUDK 4J6YA 1Q86R 2DLPA 5LJ3e 2E6ZA 2RHIA 1VQPQ 3CCRT 2CSQA 2PVDB 3TREA 1U1TA 1JU5C 1BI3A 1Q86C 1VYUA 1VQMQ 1I1JA 4ZNXA 4GBQA 1WHGA 4PFZA 4NL3A 2VGMA 3CC2Q 1T3LA 2YUPA 2YT6A 1X01A 3QDRB 1KQ1A 1FYNA 4M78D 4DBHA 2DKGA 2FYKA 4C92D 1OOTA 2MCNA 4M4ZA 2LQNA 4MMKA 4PJNA 4HCKA 4BI4A 3I35A 4BE0A 1VQ4T 1ZBXA 9ATCB 4A4GA 1U3OA 2FPFA 2PVOB 3M58A 3M0PA 2CP7A 4JRPA 3VS2A 3LH0A 1UG1A 3CCRQ 2KYBA 8AT1B 2XDDA 4JLGA 2A08A 4M78A 3OQ5A 3ASKA 1QVGP 5CIUA 3CCMQ 3HRTA 2RI2A 2X51A 4C8QF 3NPFA 4E7ZA 3OYEA 1V1CA 2CYZB 2QAZA 5IXFA 3TSZA 4GLMA 3TU4K 1Y7XA 3MCAB 4JLIA 1M30A 1RAEB 2YDLA 2JXBA 2YRCA 3TQ7P 3JB9D 2EKHA 4MZPA 1OPKA 3CXCA 5LJ3f 1SEMA 2LRQA 2QGGA 1FMKA 1YHQT 1NPRA 1OEBA 2ZPGB 1U8RA 1VQ4Q 3O5ZA 3OYLA 2H8HA 2PU9B 2K5IA 3CXCS 4MDXA 1PSEA 4JJBA 1KJWA 4D6WA 2X3XD 3G6EA 1ZA1B 3EG3A 1UJYA 2MWOA 1G83A 2HDAA 3UT1A 1VQ9T 3M59A 4J9BA 5GAN8 2DJZA 4F16A 1VYVA 2DK3A 4PJOC 2B8AA 2KRNA 3EH1A 2DL3A 2R5MA 2IG0A 2BE9B 2QXFA 3S3NA 3JCMc 4J9GA 1PNJA 1ZQ1A 3SD4A 5LJ5d 4A54A 2ABLA 2XD0A 4ATOA 3OB9A 1EIFA 1RACB 3FJ5A 1PRLC 1T0JA 3VYHB 3CC4T 1AEYA 2EYXA 2EWNA 4M78F 4ZTJA 4AFSC 4M7AC 2JM9A 1VQ9Q 1RL2A 1OPLA 2M02A 2A3LA 3C0CA 2LJ0A 5HK3A 3UATA 1KQ2A 4CI0C 2D0QB 2GTJA 4C0FA 4F7UB 4PJOD 1NYGA 2RK1A 4VUBA 3VRZA 5HY6A 2LJ3A 3H0IA 4J7FA 1VQ5T 2M51A 2JTMA 3MEUA 4DBRA 1RLQC 4JS4A 1LOJA 3M57A 2JMAA 1OULA 4M77B 1VQLT 3GLXA 3M0QA 4PJOA 2DTIA 3DLMA 4IUUA 3CC4Q 1MV3A 3CD6Q 3A5ZB 3JB9F 3QO3A 1VIEA 4EMGA 3JCMe 2R5AA 1M1GA 2RA2A 4RCBA 3D7SB 4C8QE 1MGQA 2H3EB 1MHNA 2HQHA 1D0ZA 4QVZA 4X9DA 1YJNA 2O2OA 1ZSZB 5CKBA 3CMET 2CZ7B 4WTOB 1VQ5Q 1AD5A 2EQJA 1W2BP 4OB0B 2JUFA 1QCOA 2HKNA 2B86A 4FT4A 4E7HA 4PK4A 4Z02A 3CCLQ 3LWHA 4RTXA 1X75C 1F1BB 1K9MR 2V26A 4CC2A 3HTRA 4MDWA 1K8AC 1WI7A 3QSUA 2QI2A 1K9MC 2JVVA 2RJCA 2Y4YA 5LJ5j 2RI3A 1FX7A 1GL5A 2FO0A 1K1ZA 3A8GB 3HHTB 1AWJA 3OYIA 1YWOA 4RTWA 2JN0A 4HXJA 2CP6A 4A63B 4PNOA 1B34B 1X6GA 3L2VA 1OZ2A 3RIRA 1M9SA 5IHNA 2E3HA 4PKCC 3QZ9B 1MUZA 4PJOF 3JCMV 2XDBA 4X9CA 1BI1A 4IUVA 2XMFA 2AKKA 3J7AF 5GANh 4XTUA 4HVWA 1WPYA 1VQKT 3PVLA 1X27A 5GAMh 5KYYB 3MP8A 2F5TX 1QWEA 2W10A 4BI8B 2CT4A 3A98A 3QXEB 2DRKA 1OYXA 1K73R 1NE8A 1ZUYA 5GAOr 2K5FA 3VRYA 1YCSB 1SRMA 4FU6A 2DX1A 1ZA2B 4HCCA 2GF7A 1NJIU 2I2LA 2KGTA 1BIAA 4CC4B 4RTYA 2RQWA 3M4YA 1OU9A 2W0ZA 2EW3A 1VQKQ 2CP5A 3MJXA 1KC8R 3RBBB 3WXMB 1UGSB 2JJ9A 2MYSA 2RH2A 2CUBA 5FU7B 1FXXA 4TVRA 2OTLA 5FW9A 1KC8C 4M7DD 1M5Q1 4M78B 4E2FB 3CXCP 2VYTA 2DF6A 4C92B 4JRIA 5D7UA 1Q7YU 2YXYA 1X6OA 1ZX6A 1R77A 3A8HB 3OYJA 1Z9QA 3F70A 4F04B 2FL7A 1JBMA 3FDRA 1JXMA 1UHFA 2X35A 4IIOA 5GAN5 3VS3A 3X25B 1E7OA 2P84A 1Q81C 2YUNA 2CP0A 4JDSA 1U5SA 3P8HA 1GFCA 2IVWA 4O5VA 4B9WA 2VUBA 1VQPA 2Z0WA 1WXBA 5GMKi 3PVQA 4J5YA 2Y4XA 1YITT 4PFPA 1VUBA 1K4US 3S3OA 2DXTA 3CC2A 2SRCA 3Q1JA 3THKA 3M0RA 1RAGB 2KI7A 2DL5A 2EJFA 1WZOA 1VQ7A 2RQUA 2DETA 1NLOC 1WGSA 3NTIA 2OAWA 3I56T 4M77C 2EGEA 3PMTA 5CK9A 2MWPA 8ATCB 1OV3A 3CCRA 1BYMA 2DZ9A 5KYXA 4LUDA 1SHFA 2ROTA 3CCVT 4M7AE 2D1XA 5GAOl 4QQGA 2E1HA 1PG5B 2AKLA 5KYWA 2QEXT 3NFCA 4LDVA 3CBPA 3EG9B 5CCAA 5GAOp 1HYOA 2ED1A 3V7SA 1D0XA 4AG1C 3JCMb 2PVGB 5C0MA 1N5ZA 3BDLA 1YWPA 2MPXC 1GCQC 4MZMA 2DVEA 2P0KA 2RNAA 2JT4A 2JNGA 5LJ5e 1VQ4A 4PJOB 5HKCA 3CCET 1RI9A 2KR3A 1HSQA 3I56Q 2QYZA 4HCZA 2ZPHB 3DKMA 2JZ2A 3QBYA 1Z9ZA 2EYZA 3PT9A 3G4SA 5GAN6 1TWBA 2WSFE 2EJ9A 3WVEB 1JB0E 1JJ2A 1V29B 1AWOA 3RMSA 4F14A 3V8JA 4BB7A 4RMOA 4J9HA 4M75D 3L2QA 3RKXA 5KYUA 5LJ3h 1JJ2S 5D6WA 4HT8A 3BY7A 3GBQA 4C0ZA 1YI2T 1I0CA 3RNJA 3OY9A 1M3AA 1YHQA 1IGUA 4E7LA 3X26B 1GFDA 1KD1U 2RJEA 1QLYA 3CCEQ 3RKWA 2HQEA 4BD3A 4EDUA 4M75A 3EHRA 3V7RA 2MF2A 3V8KA 2SEMA 1XNIA 4GLKA 4K11A 1RAHB 1AHJB 1VQ9A 1GCQA 3PGGA 1ZBJA 1WJQA 2E5KA 2BE7D 5LJ5f 4XU3A 2HD0A 1N8RU 2JMCA 1C1AA 3CC7T 1B3QA 3MHXA 2M1HA 4XTVA 1SF9A 3J81E 3M54A 4LNPA 4F7UG 2ZGWA 2OTLQ 1VYTA 4ZGJB 4RCCA 4XU2A 3VUBA 2HEQA 1M1KU 1WLPB 2CUDA 2O9SA 2BIVA 5LJ3g 5FU7C 1BK2A 2E65A 4V2SA 2KROA 2EYQA 1UE9A 4Y92A 2NUPA 3QYHB 4HT9A 2KE9A 3GNGA 4M78C 3BE3A 4FL6A 3QUIA 4C92C 1NPPA 1OQKA 1K0SA 2YWWA 2DMOA 1N9SA 2A37A 1VQLA 1M1FA 2DL8A 1VQ7T 1U06A 1P92A 5KYYA 1RAFB 4M75F 2HL5C 2RN8A 1NEBA 2GQVA 2WSCE 3M4GA 1WHLA 3G1JA 1BCMA 1JXOA 4JJCA 5GMKj 1JQQA 2FEIA 2RPNA 1T3SA 2YHTA 4ELZC 3CMEA 2K3BA 1KFZA 3OBWA 4FM4B 2K2MA 3OW2A 2V1RA 1YN8A 3VS5A 5DLOA 3TEEA 4Z8AA 2J6KA 1K9AA 2BZXA 1VQ7Q 4M7DB 2VGNA 2G3RA 3JSCA 2QTXA 1WXUA 2V8IA 3CQTA 1NZ9A 2CREA 3JCMX 3JAME 1ZLMA 3OYNA 2ZPFB 2ENMA 5CKDA 3ER0A 2EBPA 4C8QG 3FC3A 3G4ST 4C92A 5J3BA 2G6FX 4XTYA 4LDUA 2VWFA 1M90R 3E19A 3BW1A 2C06A 1TSFA 1LNXA 5I22A 5DM7R 2JTEA 4KGVB 4QW2A 3OSSC 4RTZA 5GANd 3OYAA 1H3ZA 1LCKA 4BI3A 1M90C 2XKOC 4EIKA 3X28B 5GAMd 1UUEA 2VVKA 4XAXB 4DOVA 4AT1B 4FSXA 1AOJA 2AIRB 4Z88A 1I8FA 4F7UE 3M53A 3OYYA 1VQKA 1VA7A 2DVJA 5GAOq 2DPPB 2RO0A 3NHNA 1VQNT 1Y71A 1JEGA 5I11A 2RK2A 3G4SQ 2A28A 1X2KA 2F2XA 2KXDA 3VV0A 1WJSA 4OMNA 1BB9A 1Q82R 1UGRB 2VB6A 4FCYA 1MNDA 1N27A 2DL7A 4M77E 3I55T 2YUOA 5KYXB 3I5SA 3CCJT 2K4YA 1WYXA 4X34A 1SSFA 1NEGA 2HZYA 1Q82C 2QASA 2RMOA 1JO8A 5KYWB 1WJRA 4C5EA 1YHQQ 4B9XA 3PTAA 5IAYA 3HP9A 4C5GA 3PIPA 1M2VA 1QCNA 1IGQA 1ABQA 1EFNA 3JRZA 1U1SA 5I2SA 2GGRA 4RTTA 2HKQB 1JJ2P 2YRDA 2O9VA 4C92F 5KYNA 2YSQA 3ZL7C 1M8VA 4OB1B 1UGQB 3OBYA 3I55Q 1BIBA 1ZSGA 3RERA 3UF4A 2XHCA 3EG9A 2FZKB 7AT1B 1KG1A 4JRQA 1QCFA 3R6NA 3AHUA 2E4HA 1TG0A 2YLCA 2QA4T 5KH6A 4RTUA 1M3BA 3GOXA 3UDCA 5KYUB 3L2UA 2P4TA 3GF5A 1GBQA 3M0TA 4E7IA 2J7IA 3NTHA 3OS0A 3JB9H 3HFNA 2XU8A 3EFOB 3G7ZA 5EG2A 3ZEHA 5GAMj 4M75B 1PKSA 2FPDA 3KUFA 4OMPA 3OYHA 1ZUUA 1RAAB 3OYBA 1K8AU 2COWA 2C0OA 4PJLA 1XOVA 2RM4A 2DA9A 2IIMA 1YITA 1K9MU 3VS0A 3QKJA 4XTXA 1VQLQ 3L2WA 2RI5A 2E64A 1MNEA 5KE2A 1G2BA 2XI9A 1VQOT 1N6AA 1WFWA 1FMWA 2VXEA 1BCOA 2KYMA 2F69A 1NYFA 4BDYA 3HRUA 4FYYB 2DD5A 4QKUA 5GMKe 3KXTA 2AZVA 2QQSA 1KIKA 2CH4A 3UA6A 2R58A 3UWNA 3I56A 2LC4A 3HRSA 4PFOA 2V1QA 1PWTA 2L2PA 1OU8A 3CMEQ 3HSBA 4C0GA 3CCVA 3OA6A 1H641 4PJJA 2QEXA 4E47A 4MZTA 1YJ9T 4HVVA 3H6ZA 3JCMf 2YRVA 3QZ5B 2K6DA 2OTJT 2NUPB 3E9FA 5CR2A 1KK7A 2AHJB 1UECA 4J7IA 1KHIA 1VQOQ 2ZPBB 4EPCA 4M78E 2HNIA 2DD4A 1PC0A 2RB6A 4C92E 1MMNA 3CCEA 4EMHA 2DE0X 2DXBA 4M7DC 1LVKA 2ZCFB 1BBZA 1QVFA 3QIIA 3OW2P 1YFNA 2DEUA 4M7AG 2AZSA 2FRYA 2K5LA 4B6MA 3OS2A 3R6OA 4OGCA 1K73C 1IRXA 1K76A 3SFMA 4R56A 3EG0A 3CCQT 4FW1A 4JRKA 1KQSA 1KC8U 4JPBW 2WACA 3M0SA 2LQKA 1YI2A 1RADB 2AK5A 5J26A 4AFUC 3P8BB 1PKTA 1YJWT 3VYGA 2GTOA 2X3WD 4BE2A 1GXIE 4BUGA 2DXCA 3CPFA 2GNCA 4J83A 4XTZA 4QQ6A 1DJ7B 1B7TA 2ZAEA 3H8ZA 1G3WA 1YNZA 4CC3A 3VKIA 3X20B 1Q81U 2VXFA 1R0CB 5M9OA 4M7DA 4RUGA 4XU0A 5FWCA 3CC7A 3RKYA 2DO3A 2M16A 2K79A 2EJGA 4RG8A 2CGHA 1YJWQ 4DEYA 1H3HA 4O6JA 2KEAA 3ZBDA 4L6V5 5L23A 2YLBA 3QPHA 2GFAA 2MMPA 3NTKA 3CCSA 2RHZA 3OSVA 1W70A 2DERA 1H92A 1WNLA 1S72T 2K2VA 1AVZC 4FT2A 2DRMA 3MEVA 4PJOE 1RAIB 2QQAA 1RABB 1OX8A 2KSSA 4HA8A 4IUQA 2O88A 2LCSA 2ZZDA 2F2WA 5GANe 2QQRA 3SDZA 3VJPA 3OS5A 5GAMe 1M2VB 2A7YA 4LD9K 4KBMB 2KT1A 4JUVA 2X4WA 5LJ5g 4C5IA 4IIMA 4PLIA 5I21A 1UDLA 1YITQ 3CCUT 1D3BB 3EAEA 4LE9A 4M75C 4M7DF 2L3QA 1X6BA 2F5KA 2YUQA 2KDSA 3KBGA 3QDFA 3OYKA 4XK8E 2K3XA 1AZGB 2R57A 1M2OA 3EGUA 3M55A 3VS4A 1TU0B 3URGA 3QJYA 1HJDA 2ATCB 2RQVA 1G3SA 1BI2A 2EYWA 1D1BA 2LX9A 1I5OB 4ELYC 4OMQA 1WHMA 1YCYA 1QKXA 3EH2A 3CCVQ 2P4RA 5GJWB 4OGEA 2LVMA 3EGXB 2MOXA 3JCMJ 2EFIA 2OJ2A 1Q95G 3INZA 2JS0A 1T0HA 2NUZA 4PLLA 3CCUQ 2QGFB 2QEXQ 2RQTA 4AFQC 4OP0A 1RLPC 1UFFA 3MEWA 1NBEB 4AG2C 5GAMf 3A8MB 2KVQG 2L8DA 1GRIA 2RHXA 2X4JA 2PTKA 4KULA 2M9UA 3EG2A 3CMAT 1X69A 2A0FB 2FZGB 1SG5A 2HBWA 4D8DA 5FROA 3EFOA 5L8RE 5HCKA 2O4XA 4HCBA 3DLLA 1VQNA 1TOVA 3MP1A 4E6RA 5GAOm 3SB2A 1LJOA 4N4GA 3REBB 5LL6S 3BFMA 1A0NB 2NLUA 2FZCB 2DFUA 4FYVB 3TSWA 1XTDA 3I55A 3CCJA 2X4XA 3OYCA 1OI1A 3MEAA 3VUZA 1KD1R 1YI2Q 1Y0MA 2BKDN 1TXQA 2HBPA 2V8KA 3CMAQ 1TUCA 1VQ6T 1KD1C 4CC7A 3UPUA 1BU1A 3VS1A 5KCHA 3GNFB 3FLGA 4OMFB 2DYIA 2KRSA 1G3TA 4A4HA 3E1SA 4QT7A 3MP6A 3DB4A 3CCST 5DLQE 3FEOA 2BZ8A 2CS7A 4IUPA 4M77G 1N8RR 4QVCA 1VQ8T 1NM7A 4MMLA 1KQSP 4M7DE 2EQKA 4ZTFA 4C8QD 4N4HA 2OX7A 1WDXA 2JS2A 5GAN3 2HSEB 3QWXX 1XQHA 3MKDA 3CC7Q 3SWNC 3V7CA 3OYMA 2DM1A 2QA4A 1HXDA 3META 2CZ6B 1WQWA 2HCKA 3HKSA 3JCMQ 3G71A 3HPWA 3CPWA 4NOYA 1VQ6Q 3C12A 1UEBA 1Q86U 5GJVB 2XK0A 4L59A 4OB3B 1VQMT 3VU3C 3E2UA 3CEYA 2NWMA 3CPWS 4Y28E 3P8DA 3ME9A 3EGDB 2H3JA 2HQXA 1BKBA 4L5GA 1FWZA 2A36A 4NS5A 1M8MA 3CCSQ 2BUDA 1GCPA 1FMVA 4N4IA 5IXBA 1D0YA 1KHCA 3M5AA 3RESA 4FIBA 4ZN1A 1WHKA 1WXTA 1Y07A 4WF2A 4J9CA 4JJNK 4BE1A 3AT1B 1W6XA 2CZ1B 2RD1A 3QG1A 5A0DA 1G5VA 3TCJA 2DL4A 2EQUA 4DOWA 4OVAA 3FRNA 2E5QA 3HFOA 3PMIA 4E7JA 3OW2S 3CCMT 3LGLA 4F17A 2BZYA 1VQOA 4LD6A 1X43A 1O75A 4KGXB 4KUIA 2RQRA 2L89A 3SWNA 4J6WA 3MPUB 2D8JA 1M90U 1EX4A 4ESRA 5GAN2 2LMJA 1B07A 2XDPA 5IHKA 2X4YA 2DJQA 1S1NA 3RUXA 2LCLA 1LPLA 1WX6A 5A0GA 1RI0A 1WHHA 4JS5A 4E7SA 3H0FA 2E41A 3JCMh 1Y57A 2QDYB 3PFSA 3N5BB 4RG2A 3REAB 4Y91A 4J9FA 3OS1A 1YJ9A 5GAOn 1D09B 2LZ6B 5FU6B 2QG9B 6AT1B 2OTJA 3CBMA 2CKKA 2FRWA 4GY5A 2HL3A 5D6YA 1Q82U 4IURA 2DZCA 2L3SA 5J39A 1SHGA 2GCXA 2ESWA 1JRIA 1UHCA 4J6XA 4IUTA 2LT4A 2JTFA
chains in the Genus database with same CATH topology
3EG1A 2KT8A 2K7AA 4HVVA 5IH2A 3THKA 3M0RA 2K6DA 1QWFA 2DBMA 2DL5A 2RF0A 1UECA 3PE0A 2J06A 1CKAA 1I07A 2RQUA 1NLOC 1UGVA 2OAWA 1AWWA 1CSKA 2EGEA 1AZEA 1M3CA 1OV3A 2DE0X 2C0TA 4LUDA 1SHFA 2ROTA 2LX7A 1BBZA 3M0UA 2D1XA 2HSPA 3VS6A 2CT3A 4J9IA 2GQIA 2AKLA 1K0XA 2VKNA 2AZSA 1M27C 2FRYA 2L0AA 2ED1A 4AG1C 1K76A 1ARKA 1N5ZA 3U23A 3LH5A 3JV3A 3EG0A 4JZ4A 1YWPA 1GCQC 2RNAA 2JT4A 2LNHB 4JPBW 3M0SA 2AK5A 2DLPA 4AFUC 1RI9A 2KR3A 4Z89A 1HSQA 2CSQA 1PKTA 2ECZA 2GTOA 2X3WD 1JU5C 3H41A 1VYUA 1Z9ZA 1I1JA 2EYZA 3UA7A 4ZNXA 4GBQA 2GNCA 2KRMA 2JM8A 1T3LA 2YUPA 2YT6A 1AWOA 4F14A 1FYNA 3H0HA 4J9HA 1YNZA 4CC3A 1OOTA 2MCNA 4M4ZA 2LQNA 2KNBB 4HCKA 3GBQA 3I35A 1IO6A 1I0CA 3RNJA 1U3OA 2CDTA 2FPFA 3M0PA 1M3AA 4RUGA 5FWCA 1GFDA 1QLYA 2K79A 3VS2A 1UG1A 1UTIA 2KYBA 2A08A 4DEYA 1H3HA 3EHRA 2ED0A 2SEMA 2KEAA 3NPFA 2KBTA 4K11A 2EYYA 1V1CA 5L23A 1GCQA 5IXFA 1CKBA 1ZBJA 2D8HA 4GLMA 3TSZA 1WIEA 1M30A 2YDLA 1WA7A 2JXBA 2E5KA 2EKHA 2LQWA 1W70A 1OPKA 3NGPA 1H92A 3SHWA 1SEMA 2C0IA 4OMOA 2CH4W 1AVZC 1FMKA 2JMCA 1OEBA 2J05A 2DRMA 2LP5A 3O5ZA 1B3QA 2H8HA 1ABOA 4JJBA 1KJWA 2LJ1A 4LNPA 2X3XD 2O88A 2LCSA 3EG3A 2F2WA 1UJYA 3EHQA 1G83A 2HDAA 1VYTA 4J9BA 2K9GA 1E6GA 4F16A 1VYVA 4J9DA 2KRNA 2HEQA 2DL3A 2KT1A 1WLPB 2CUDA 4OMLA 1RUWA 4J9GA 4WCIA 1NLPC 2O9SA 1PNJA 1BK2A 4IIMA 2DNUA 2KROA 1UDLA 2ABLA 2DBKA 1UE9A 4Y92A 1PHTA 2KE9A 4LE9A 4LN2A 3ULRB 2L3QA 1X6BA 1K0SA 1H8KA 3FJ5A 1KSWA 1AWXA 1PRLC 1T0JA 2YUQA 1YP5A 2DMOA 5IHIA 2A37A 1AEYA 2DL8A 1AZGB 1U06A 2EYXA 2PZ1A 5FWBA 3EGUA 2J6FA 3VS4A 4AFSC 5EC7A 2RN8A 1HJDA 1NEBA 2JM9A 1TUDA 1OPLA 3C0CA 2LJ0A 2RQVA 3UATA 4DEXA 4ORZA 2EYWA 2GTJA 1JXOA 2FPEA 4JJCA 2M0YA 4OMQA 1NYGA 1JQQA 2FEIA 3VRZA 2RPNA 2LJ3A 3H0IA 1QKXA 1T3SA 2P4RA 5GJWB 2M51A 4KRTA 4D8KA 2MOXA 2K3BA 1KFZA 2OJ2A 1RLQC 2JS0A 1T0HA 2NUZA 2K2MA 4FSSA 1HD3A 2RQTA 4AFQC 2JMAA 2V1RA 1RLPC 1UFFA 1YN8A 3VS5A 3M0QA 4Z8AA 4AG2C 1MV3A 2J6KA 1GRIA 1K9AA 2BZXA 3I9QA 1E6HA 2F2VA 2PTKA 3SEMA 1WXUA 3EG2A 3CQTA 1X69A 2CREA 2CSIA 1ZLMA 2PNIA 2HBWA 4D8DA 2ENMA 2EBPA 2JW4A 5HCKA 2O2OA 1J3TA 2O31A 3QWYA 4E6RA 1AD5A 2G6FX 2J6OA 3IQLA 3REBB 1SSHA 2VWFA 1A0NB 2B86A 5I22A 3TSWA 2JTEA 4RTZA 4RTXA 1LCKA 2BTTA 4EIKA 1UUEA 2VVKA 3KFVA 3TVTA 4CC2A 1Y0MA 1WI7A 1AOJA 4Z88A 4RTVA 2DYBA 3NMZC 1TUCA 1W1FA 4CC7A 4J9EA 1BU1A 1VA7A 2DVJA 3VS1A 1GL5A 2FO0A 3NHNA 1K1ZA 1SRLA 1JEGA 5I11A 1AWJA 1YWOA 2A28A 1X2KA 2KRSA 2F2XA 2KXDA 4RTWA 4HXJA 4OMNA 1BB9A 3I5RA 4A63B 4QT7A 2EQIA 1X6GA 2DL7A 4OMMA 2GBQA 2BZ8A 2YUOA 3I5SA 4LUEA 1WYXA 1NM7A 1NEGA 2L3PA 5IHNA 2EGAA 2RMOA 1MUZA 1WDXA 1JO8A 2JS2A 3QWXX 2XMFA 2AKKA 2DM1A 4HVWA 2HCKA 3PVLA 1X27A 1ABQA 1EFNA 5GJVB 1QWEA 2GGRA 2W10A 2CT4A 4RTTA 2NWMA 3A98A 2O9VA 2DRKA 2YSQA 3ZL7C 1ZUYA 2A36A 1M8MA 3VRYA 1GCPA 1YCSB 1NG2A 1SRMA 1ZUKA 2DX1A 1ZSGA 2I0NA 3UF4A 5IXBA 2KGTA 4JZ3A 2EGCA 1WXTA 1QCFA 4J9CA 3R6NA 2D0NA 4CC4B 4RTYA 1W6XA 2RQWA 1TG0A 2KXCA 2EPDA 2W0ZA 2EW3A 4RTUA 1M3BA 2DL4A 3RBBB 4AFZC 1GBQA 3M0TA 2J7IA 2MIOA 2CUBA 1SPKA 4F17A 2BZYA 5FW9A 1X43A 1PKSA 1GBRA 2DF6A 2FPDA 2RQRA 4OMPA 1ZUUA 2D8JA 4ESRA 2LMJA 1B07A 1ZX6A 5ECAA 5IHKA 2DJQA 1S1NA 2C0OA 1XOVA 1Z9QA 1WX6A 2DA9A 2EVRA 4JJDA 2IIMA 3VS0A 3H0FA 1PRMC 4R0KA 1Y57A 3REAB 1JXMA 1QKWA 4J9FA 1UHFA 1G2BA 4IIOA 2DILA 2LZ6B 3VS3A 1WFWA 1E7OA 2OI3A 2KYMA 2YUNA 1NYFA 1U5SA 2FRWA 4HVUA 2QDLA 4X1VA 2AZVA 1GFCA 1KIKA 3VS7A 2CH4A 1UJ0A 3UA6A 2V1QA 1WXBA 2L3SA 1PWTA 1SHGA 2L2PA 2ROLA 2ESWA 3PVQA 1UHCA 1X2QA 1K4US 2SRCA 2FG0A 1MV0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG1 A;  2KT8 A;  2K7A A;  4HVV A;  5IH2 A;  3THK A;  3M0R A;  2K6D A;  1QWF A;  2DBM A;  2DL5 A;  2RF0 A;  1UEC A;  3PE0 A;  2J06 A;  1CKA A;  1I07 A;  2RQU A;  1NLO C;  1UGV A;  2OAW A;  1AWW A;  1CSK A;  2EGE A;  1AZE A;  1M3C A;  1OV3 A;  2DE0 X;  2C0T A;  4LUD A;  1SHF A;  2ROT A;  2LX7 A;  1BBZ A;  3M0U A;  2D1X A;  2HSP A;  3VS6 A;  2CT3 A;  4J9I A;  2GQI A;  2AKL A;  1K0X A;  2VKN A;  2AZS A;  1M27 C;  2FRY A;  2L0A A;  2ED1 A;  4AG1 C;  1K76 A;  1ARK A;  1N5Z A;  3U23 A;  3LH5 A;  3JV3 A;  3EG0 A;  4JZ4 A;  1YWP A;  1GCQ C;  2RNA A;  2JT4 A;  2LNH B;  4JPB W;  3M0S A;  2AK5 A;  2DLP A;  4AFU C;  1RI9 A;  2KR3 A;  4Z89 A;  1HSQ A;  2CSQ A;  1PKT A;  2ECZ A;  2GTO A;  2X3W D;  1JU5 C;  3H41 A;  1VYU A;  1Z9Z A;  1I1J A;  2EYZ A;  3UA7 A;  4ZNX A;  4GBQ A;  2GNC A;  2KRM A;  2JM8 A;  1T3L A;  2YUP A;  2YT6 A;  1AWO A;  4F14 A;  1FYN A;  3H0H A;  4J9H A;  1YNZ A;  4CC3 A;  1OOT A;  2MCN A;  4M4Z A;  2LQN A;  2KNB B;  4HCK A;  3GBQ A;  3I35 A;  1IO6 A;  1I0C A;  3RNJ A;  1U3O A;  2CDT A;  2FPF A;  3M0P A;  1M3A A;  4RUG A;  5FWC A;  1GFD A;  1QLY A;  2K79 A;  3VS2 A;  1UG1 A;  1UTI A;  2KYB A;  2A08 A;  4DEY A;  1H3H A;  3EHR A;  2ED0 A;  2SEM A;  2KEA A;  3NPF A;  2KBT A;  4K11 A;  2EYY A;  1V1C A;  5L23 A;  1GCQ A;  5IXF A;  1CKB A;  1ZBJ A;  2D8H A;  4GLM A;  3TSZ A;  1WIE A;  1M30 A;  2YDL A;  1WA7 A;  2JXB A;  2E5K A;  2EKH A;  2LQW A;  1W70 A;  1OPK A;  3NGP A;  1H92 A;  3SHW A;  1SEM A;  2C0I A;  4OMO A;  2CH4 W;  1AVZ C;  1FMK A;  2JMC A;  1OEB A;  2J05 A;  2DRM A;  2LP5 A;  3O5Z A;  1B3Q A;  2H8H A;  1ABO A;  4JJB A;  1KJW A;  2LJ1 A;  4LNP A;  2X3X D;  2O88 A;  2LCS A;  3EG3 A;  2F2W A;  1UJY A;  3EHQ A;  1G83 A;  2HDA A;  1VYT A;  4J9B A;  2K9G A;  1E6G A;  4F16 A;  1VYV A;  4J9D A;  2KRN A;  2HEQ A;  2DL3 A;  2KT1 A;  1WLP B;  2CUD A;  4OML A;  1RUW A;  4J9G A;  4WCI A;  1NLP C;  2O9S A;  1PNJ A;  1BK2 A;  4IIM A;  2DNU A;  2KRO A;  1UDL A;  2ABL A;  2DBK A;  1UE9 A;  4Y92 A;  1PHT A;  2KE9 A;  4LE9 A;  4LN2 A;  3ULR B;  2L3Q A;  1X6B A;  1K0S A;  1H8K A;  3FJ5 A;  1KSW A;  1AWX A;  1PRL C;  1T0J A;  2YUQ A;  1YP5 A;  2DMO A;  5IHI A;  2A37 A;  1AEY A;  2DL8 A;  1AZG B;  1U06 A;  2EYX A;  2PZ1 A;  5FWB A;  3EGU A;  2J6F A;  3VS4 A;  4AFS C;  5EC7 A;  2RN8 A;  1HJD A;  1NEB A;  2JM9 A;  1TUD A;  1OPL A;  3C0C A;  2LJ0 A;  2RQV A;  3UAT A;  4DEX A;  4ORZ A;  2EYW A;  2GTJ A;  1JXO A;  2FPE A;  4JJC A;  2M0Y A;  4OMQ A;  1NYG A;  1JQQ A;  2FEI A;  3VRZ A;  2RPN A;  2LJ3 A;  3H0I A;  1QKX A;  1T3S A;  2P4R A;  5GJW B;  2M51 A;  4KRT A;  4D8K A;  2MOX A;  2K3B A;  1KFZ A;  2OJ2 A;  1RLQ C;  2JS0 A;  1T0H A;  2NUZ A;  2K2M A;  4FSS A;  1HD3 A;  2RQT A;  4AFQ C;  2JMA A;  2V1R A;  1RLP C;  1UFF A;  1YN8 A;  3VS5 A;  3M0Q A;  4Z8A A;  4AG2 C;  1MV3 A;  2J6K A;  1GRI A;  1K9A A;  2BZX A;  3I9Q A;  1E6H A;  2F2V A;  2PTK A;  3SEM A;  1WXU A;  3EG2 A;  3CQT A;  1X69 A;  2CRE A;  2CSI A;  1ZLM A;  2PNI A;  2HBW A;  4D8D A;  2ENM A;  2EBP A;  2JW4 A;  5HCK A;  2O2O A;  1J3T A;  2O31 A;  3QWY A;  4E6R A;  1AD5 A;  2G6F X;  2J6O A;  3IQL A;  3REB B;  1SSH A;  2VWF A;  1A0N B;  2B86 A;  5I22 A;  3TSW A;  2JTE A;  4RTZ A;  4RTX A;  1LCK A;  2BTT A;  4EIK A;  1UUE A;  2VVK A;  3KFV A;  3TVT A;  4CC2 A;  1Y0M A;  1WI7 A;  1AOJ A;  4Z88 A;  4RTV A;  2DYB A;  3NMZ C;  1TUC A;  1W1F A;  4CC7 A;  4J9E A;  1BU1 A;  1VA7 A;  2DVJ A;  3VS1 A;  1GL5 A;  2FO0 A;  3NHN A;  1K1Z A;  1SRL A;  1JEG A;  5I11 A;  1AWJ A;  1YWO A;  2A28 A;  1X2K A;  2KRS A;  2F2X A;  2KXD A;  4RTW A;  4HXJ A;  4OMN A;  1BB9 A;  3I5R A;  4A63 B;  4QT7 A;  2EQI A;  1X6G A;  2DL7 A;  4OMM A;  2GBQ A;  2BZ8 A;  2YUO A;  3I5S A;  4LUE A;  1WYX A;  1NM7 A;  1NEG A;  2L3P A;  5IHN A;  2EGA A;  2RMO A;  1MUZ A;  1WDX A;  1JO8 A;  2JS2 A;  3QWX X;  2XMF A;  2AKK A;  2DM1 A;  4HVW A;  2HCK A;  3PVL A;  1X27 A;  1ABQ A;  1EFN A;  5GJV B;  1QWE A;  2GGR A;  2W10 A;  2CT4 A;  4RTT A;  2NWM A;  3A98 A;  2O9V A;  2DRK A;  2YSQ A;  3ZL7 C;  1ZUY A;  2A36 A;  1M8M A;  3VRY A;  1GCP A;  1YCS B;  1NG2 A;  1SRM A;  1ZUK A;  2DX1 A;  1ZSG A;  2I0N A;  3UF4 A;  5IXB A;  2KGT A;  4JZ3 A;  2EGC A;  1WXT A;  1QCF A;  4J9C A;  3R6N A;  2D0N A;  4CC4 B;  4RTY A;  1W6X A;  2RQW A;  1TG0 A;  2KXC A;  2EPD A;  2W0Z A;  2EW3 A;  4RTU A;  1M3B A;  2DL4 A;  3RBB B;  4AFZ C;  1GBQ A;  3M0T A;  2J7I A;  2MIO A;  2CUB A;  1SPK A;  4F17 A;  2BZY A;  5FW9 A;  1X43 A;  1PKS A;  1GBR A;  2DF6 A;  2FPD A;  2RQR A;  4OMP A;  1ZUU A;  2D8J A;  4ESR A;  2LMJ A;  1B07 A;  1ZX6 A;  5ECA A;  5IHK A;  2DJQ A;  1S1N A;  2C0O A;  1XOV A;  1Z9Q A;  1WX6 A;  2DA9 A;  2EVR A;  4JJD A;  2IIM A;  3VS0 A;  3H0F A;  1PRM C;  4R0K A;  1Y57 A;  3REA B;  1JXM A;  1QKW A;  4J9F A;  1UHF A;  1G2B A;  4IIO A;  2DIL A;  2LZ6 B;  3VS3 A;  1WFW A;  1E7O A;  2OI3 A;  2KYM A;  2YUN A;  1NYF A;  1U5S A;  2FRW A;  4HVU A;  2QDL A;  4X1V A;  2AZV A;  1GFC A;  1KIK A;  3VS7 A;  2CH4 A;  1UJ0 A;  3UA6 A;  2V1Q A;  1WXB A;  2L3S A;  1PWT A;  1SHG A;  2L2P A;  2ROL A;  2ESW A;  3PVQ A;  1UHC A;  1X2Q A;  1K4U S;  2SRC A;  2FG0 A;  1MV0 B; 
#chains in the Genus database with same CATH topology
 2K7A A;  1IRE B;  5A2Q E;  3QHS A;  1QWF A;  4C0D B;  1YIJ T;  5GMK h;  3PE0 A;  1R8O B;  2J06 A;  3A8O B;  1CKA A;  2ZPI B;  3CCQ A;  2RHY A;  4PL6 A;  1R0B G;  3OYG A;  4M75 E;  2NYS A;  2QTV A;  4M78 G;  1AZE A;  4C92 G;  1PSF A;  3GP8 A;  4ANJ A;  1VQN Q;  1YJW A;  5GAN 7;  3GPL A;  2LX7 A;  3VS6 A;  2HSP A;  2CT3 A;  2K3Y A;  4DA4 A;  2P0Q A;  3O8V A;  2GQI A;  2P0P A;  4P5N A;  2FB7 A;  1EZZ B;  1M27 C;  1D3B A;  3CCJ Q;  3FIF A;  2LDM A;  3JCM g;  1MMA A;  5FLX E;  3LYI A;  3CD6 T;  3LH5 A;  3JV3 A;  1YIJ Q;  4XTW A;  4BAC A;  3G71 T;  2LTO A;  4EMK B;  1WHJ A;  4Q5W A;  4Z89 A;  2RHU A;  3JB9 G;  1QQJ A;  5GMK l;  2QK0 A;  2ECZ A;  5FRN A;  2M0O A;  3H41 A;  3UA7 A;  5GAN j;  4QVD A;  2KRM A;  2JM8 A;  3EGX A;  2O4X B;  1G8X A;  3L42 A;  2X9H A;  3CCL T;  3RMQ A;  3H0H A;  2DXU A;  2EAY A;  2KNB B;  3LW5 E;  1IO6 A;  1S72 A;  2CDT A;  2QA4 Q;  4YTL A;  3G71 Q;  1BI0 A;  1PM3 A;  4M7A D;  4BDZ A;  1UTI A;  4ZGE B;  1I4K 1;  3FB9 A;  1PD1 A;  1QP2 A;  1M4Z A;  3LGF A;  2ED0 A;  2LQ8 A;  4BY6 B;  1ZHI A;  2KBT A;  2FVU A;  1IHW A;  2EYY A;  2OAU A;  1CKB A;  2D8H A;  3JB9 J;  2XIC A;  1WIE A;  4KH0 B;  3OYD A;  4M7A A;  1K8A R;  1WA7 A;  2LQW A;  1QVP A;  4OB2 B;  3NGP A;  2E12 A;  3SHW A;  2Y90 A;  2C0I A;  1OZ3 A;  4OMO A;  2MI6 A;  2CH4 W;  3J80 E;  2J05 A;  2LP5 A;  3CPW P;  2L5Q A;  1ABO A;  4ZN3 A;  3CCU A;  4PJO G;  2KAF A;  5GMK m;  4R55 A;  1W4S A;  2LJ1 A;  3LLR A;  1WQ7 A;  1UB4 A;  3L2Z A;  2HAX A;  3EHQ A;  2NUT A;  3ZFJ A;  2KK4 A;  4ZGD B;  4LDX A;  4XU1 A;  4RKU E;  2K9G A;  1E6G A;  2E6N A;  4J9D A;  5CAI A;  4NL2 A;  1K73 U;  4C8Q B;  4OML A;  1RUW A;  1UGP B;  4WCI A;  1NLP C;  2LCC A;  1Y96 B;  2DNU A;  2DBK A;  5LJ3 d;  4N0A C;  1PHT A;  4PJM A;  1AT1 B;  4LN2 A;  3ULR B;  1QVF S;  3G6E T;  5CQX A;  1H8K A;  3L2R A;  1KSW A;  1AWX A;  2KQW A;  3WVD B;  1YJ9 Q;  1YP5 A;  5IHI A;  1D1C A;  2OTJ Q;  2PZ1 A;  5FWB A;  4E7K A;  1MMG A;  2E3I A;  2J6F A;  5EC7 A;  5AT1 B;  3OYF A;  1TUD A;  4FW2 A;  5D6X A;  1IZ6 A;  4A4F A;  3EGD A;  4DEX A;  1IB8 A;  3PNW C;  4ORZ A;  3CMA A;  1KQS S;  2DAQ A;  2FPE A;  2M0Y A;  4M7A F;  4KT0 E;  2PQW A;  2ZPE B;  5FU6 C;  2JOY A;  4KRT A;  4D8K A;  2VAS A;  3SWN B;  1NJI R;  1G3Y A;  4FSS A;  1HD3 A;  4UC4 A;  2CP2 A;  3G6E Q;  2KMT A;  4DBQ A;  3C95 A;  5LJ5 h;  5CVI A;  4OF1 A;  2DTO A;  1NJI C;  3I9Q A;  3CCQ Q;  1E6H A;  2F2V A;  3SEM A;  4LXC A;  2E10 A;  4A4K A;  2CSI A;  2PNI A;  3EFR A;  4N0A A;  1QMC A;  2JW4 A;  1VQ6 A;  1J3T A;  4C0D C;  1HK9 A;  2O31 A;  3QWY A;  3JCM W;  2J6O A;  3IQL A;  4C5H A;  1SSH A;  4J8O A;  5GAN g;  1Q7Y R;  3C4S A;  2D9T A;  1Q81 R;  5GAM g;  1V76 A;  1VQ8 A;  2VC8 A;  2BTT A;  1Q7Y C;  3KFV A;  3TVT A;  4XQ3 A;  4A53 A;  1C6V X;  4RTV A;  2DYB A;  3NMZ C;  1YJN T;  1C0M A;  1W1F A;  4J9E A;  5LJ3 j;  1SRL A;  2QQB A;  4HKE A;  5C6S A;  1O9S A;  1VQM A;  3RDV A;  3I5R A;  4CRI A;  4EMK C;  1QVG A;  3M9Q A;  4OMM A;  2EQI A;  2GBQ A;  3OMG A;  4LUE A;  3DB3 A;  1I5L A;  1QVG S;  1TTH B;  2L3P A;  2EGA A;  3CBO A;  1S72 Q;  3HL8 A;  3S6W A;  5CKH A;  4M7D G;  1ACM B;  3PIO A;  4AMC A;  4II1 A;  3MO8 A;  2CP3 A;  2RJD A;  1YJN Q;  2F1L A;  1VOM A;  1YBY A;  1TUG B;  4KH1 B;  2AT1 B;  3CCM A;  1I81 A;  4QQD A;  4LDW A;  1NG2 A;  1ZUK A;  5GAN 4;  1TH7 A;  3A8L B;  2I0N A;  2RJF A;  3L1A A;  1ZSZ C;  4JZ3 A;  2EGC A;  1PD0 A;  5FRM A;  3JCM d;  2K57 A;  2D0N A;  4BY6 C;  5KCO A;  3M56 A;  1QP3 A;  2KXC A;  2EPD A;  3S3M A;  5A0L A;  2HMA A;  5GAN f;  2QQ9 A;  4KGZ B;  4EMK A;  4M77 D;  4AFZ C;  2MIO A;  2D6F A;  1SPK A;  5CQY A;  4F7U A;  2DIG A;  2LNV A;  3LX7 A;  3RR6 A;  2DTH A;  4FYX B;  1TS9 A;  1VIF A;  1GBR A;  1IXD A;  5CKF A;  5KE3 A;  2MAM A;  4M77 A;  1XJW B;  2EKO A;  1MMD A;  3QYG B;  1SKU B;  5ECA A;  4M7A B;  1PCX A;  4JJD A;  2EVR A;  2KY9 A;  4ME7 A;  2PUO B;  2EIF A;  4C8Q C;  3GIB A;  1PRM C;  4R0K A;  2DEQ A;  1QKW A;  2XID A;  2OTL T;  5CO7 A;  2DIL A;  1YIJ A;  5HK0 A;  2E70 A;  2OI3 A;  1ZSZ A;  2MK5 A;  4HVU A;  5DY9 A;  2QDL A;  4X1V A;  5IN1 A;  3VS7 A;  2VV5 A;  3X24 B;  1UJ0 A;  3H9N A;  1QVF P;  3EFS A;  2NUT B;  3A1P A;  2COY A;  3OMC A;  1QW1 A;  3QJ6 A;  2ROL A;  1IHV A;  1X2Q A;  4FYW B;  4A4E A;  1W2B A;  2L3R A;  3T9N A;  2FG0 A;  1MV0 B;  2EQM A;  2KT8 A;  3EG1 A;  3FJP A;  3JB9 I;  5IH2 A;  2CZ0 B;  2DBM A;  5I2M A;  2RF0 A;  4DQ2 A;  1W2B S;  3CC4 A;  1N8R C;  1I07 A;  3CD6 A;  4IKF A;  4F7U F;  1UGV A;  3V8L A;  1AWW A;  4DBF A;  1CSK A;  1VQP T;  4M75 G;  1M3C A;  2LT1 A;  2GFU A;  3LWI A;  2IPO B;  1B34 A;  2C0T A;  3BDU A;  5IT9 E;  4C8Q A;  1N9R A;  2PUK B;  3M0U A;  4M77 F;  1M1K R;  2FHD A;  4J9I A;  1VQ5 A;  1Y96 A;  3CC2 T;  1K0X A;  2VKN A;  2O01 E;  3C94 A;  2V8J A;  2L0A A;  2XG8 D;  5CKE A;  1M1K C;  2DIQ A;  1VQ8 Q;  1ARK A;  5AYF A;  3CCL A;  3U23 A;  1OX9 A;  4JZ4 A;  1D1A A;  3E9G A;  2WSE E;  2LNH B;  4LDY A;  2COZ A;  3JCM P;  4KUD K;  4J6Y A;  1Q86 R;  2DLP A;  5LJ3 e;  2E6Z A;  2RHI A;  1VQP Q;  3CCR T;  2CSQ A;  2PVD B;  3TRE A;  1U1T A;  1JU5 C;  1BI3 A;  1Q86 C;  1VYU A;  1VQM Q;  1I1J A;  4ZNX A;  4GBQ A;  1WHG A;  4PFZ A;  4NL3 A;  2VGM A;  3CC2 Q;  1T3L A;  2YUP A;  2YT6 A;  1X01 A;  3QDR B;  1KQ1 A;  1FYN A;  4M78 D;  4DBH A;  2DKG A;  2FYK A;  4C92 D;  1OOT A;  2MCN A;  4M4Z A;  2LQN A;  4MMK A;  4PJN A;  4HCK A;  4BI4 A;  3I35 A;  4BE0 A;  1VQ4 T;  1ZBX A;  9ATC B;  4A4G A;  1U3O A;  2FPF A;  2PVO B;  3M58 A;  3M0P A;  2CP7 A;  4JRP A;  3VS2 A;  3LH0 A;  1UG1 A;  3CCR Q;  2KYB A;  8AT1 B;  2XDD A;  4JLG A;  2A08 A;  4M78 A;  3OQ5 A;  3ASK A;  1QVG P;  5CIU A;  3CCM Q;  3HRT A;  2RI2 A;  2X51 A;  4C8Q F;  3NPF A;  4E7Z A;  3OYE A;  1V1C A;  2CYZ B;  2QAZ A;  5IXF A;  3TSZ A;  4GLM A;  3TU4 K;  1Y7X A;  3MCA B;  4JLI A;  1M30 A;  1RAE B;  2YDL A;  2JXB A;  2YRC A;  3TQ7 P;  3JB9 D;  2EKH A;  4MZP A;  1OPK A;  3CXC A;  5LJ3 f;  1SEM A;  2LRQ A;  2QGG A;  1FMK A;  1YHQ T;  1NPR A;  1OEB A;  2ZPG B;  1U8R A;  1VQ4 Q;  3O5Z A;  3OYL A;  2H8H A;  2PU9 B;  2K5I A;  3CXC S;  4MDX A;  1PSE A;  4JJB A;  1KJW A;  4D6W A;  2X3X D;  3G6E A;  1ZA1 B;  3EG3 A;  1UJY A;  2MWO A;  1G83 A;  2HDA A;  3UT1 A;  1VQ9 T;  3M59 A;  4J9B A;  5GAN 8;  2DJZ A;  4F16 A;  1VYV A;  2DK3 A;  4PJO C;  2B8A A;  2KRN A;  3EH1 A;  2DL3 A;  2R5M A;  2IG0 A;  2BE9 B;  2QXF A;  3S3N A;  3JCM c;  4J9G A;  1PNJ A;  1ZQ1 A;  3SD4 A;  5LJ5 d;  4A54 A;  2ABL A;  2XD0 A;  4ATO A;  3OB9 A;  1EIF A;  1RAC B;  3FJ5 A;  1PRL C;  1T0J A;  3VYH B;  3CC4 T;  1AEY A;  2EYX A;  2EWN A;  4M78 F;  4ZTJ A;  4AFS C;  4M7A C;  2JM9 A;  1VQ9 Q;  1RL2 A;  1OPL A;  2M02 A;  2A3L A;  3C0C A;  2LJ0 A;  5HK3 A;  3UAT A;  1KQ2 A;  4CI0 C;  2D0Q B;  2GTJ A;  4C0F A;  4F7U B;  4PJO D;  1NYG A;  2RK1 A;  4VUB A;  3VRZ A;  5HY6 A;  2LJ3 A;  3H0I A;  4J7F A;  1VQ5 T;  2M51 A;  2JTM A;  3MEU A;  4DBR A;  1RLQ C;  4JS4 A;  1LOJ A;  3M57 A;  2JMA A;  1OUL A;  4M77 B;  1VQL T;  3GLX A;  3M0Q A;  4PJO A;  2DTI A;  3DLM A;  4IUU A;  3CC4 Q;  1MV3 A;  3CD6 Q;  3A5Z B;  3JB9 F;  3QO3 A;  1VIE A;  4EMG A;  3JCM e;  2R5A A;  1M1G A;  2RA2 A;  4RCB A;  3D7S B;  4C8Q E;  1MGQ A;  2H3E B;  1MHN A;  2HQH A;  1D0Z A;  4QVZ A;  4X9D A;  1YJN A;  2O2O A;  1ZSZ B;  5CKB A;  3CME T;  2CZ7 B;  4WTO B;  1VQ5 Q;  1AD5 A;  2EQJ A;  1W2B P;  4OB0 B;  2JUF A;  1QCO A;  2HKN A;  2B86 A;  4FT4 A;  4E7H A;  4PK4 A;  4Z02 A;  3CCL Q;  3LWH A;  4RTX A;  1X75 C;  1F1B B;  1K9M R;  2V26 A;  4CC2 A;  3HTR A;  4MDW A;  1K8A C;  1WI7 A;  3QSU A;  2QI2 A;  1K9M C;  2JVV A;  2RJC A;  2Y4Y A;  5LJ5 j;  2RI3 A;  1FX7 A;  1GL5 A;  2FO0 A;  1K1Z A;  3A8G B;  3HHT B;  1AWJ A;  3OYI A;  1YWO A;  4RTW A;  2JN0 A;  4HXJ A;  2CP6 A;  4A63 B;  4PNO A;  1B34 B;  1X6G A;  3L2V A;  1OZ2 A;  3RIR A;  1M9S A;  5IHN A;  2E3H A;  4PKC C;  3QZ9 B;  1MUZ A;  4PJO F;  3JCM V;  2XDB A;  4X9C A;  1BI1 A;  4IUV A;  2XMF A;  2AKK A;  3J7A F;  5GAN h;  4XTU A;  4HVW A;  1WPY A;  1VQK T;  3PVL A;  1X27 A;  5GAM h;  5KYY B;  3MP8 A;  2F5T X;  1QWE A;  2W10 A;  4BI8 B;  2CT4 A;  3A98 A;  3QXE B;  2DRK A;  1OYX A;  1K73 R;  1NE8 A;  1ZUY A;  5GAO r;  2K5F A;  3VRY A;  1YCS B;  1SRM A;  4FU6 A;  2DX1 A;  1ZA2 B;  4HCC A;  2GF7 A;  1NJI U;  2I2L A;  2KGT A;  1BIA A;  4CC4 B;  4RTY A;  2RQW A;  3M4Y A;  1OU9 A;  2W0Z A;  2EW3 A;  1VQK Q;  2CP5 A;  3MJX A;  1KC8 R;  3RBB B;  3WXM B;  1UGS B;  2JJ9 A;  2MYS A;  2RH2 A;  2CUB A;  5FU7 B;  1FXX A;  4TVR A;  2OTL A;  5FW9 A;  1KC8 C;  4M7D D;  1M5Q 1;  4M78 B;  4E2F B;  3CXC P;  2VYT A;  2DF6 A;  4C92 B;  4JRI A;  5D7U A;  1Q7Y U;  2YXY A;  1X6O A;  1ZX6 A;  1R77 A;  3A8H B;  3OYJ A;  1Z9Q A;  3F70 A;  4F04 B;  2FL7 A;  1JBM A;  3FDR A;  1JXM A;  1UHF A;  2X35 A;  4IIO A;  5GAN 5;  3VS3 A;  3X25 B;  1E7O A;  2P84 A;  1Q81 C;  2YUN A;  2CP0 A;  4JDS A;  1U5S A;  3P8H A;  1GFC A;  2IVW A;  4O5V A;  4B9W A;  2VUB A;  1VQP A;  2Z0W A;  1WXB A;  5GMK i;  3PVQ A;  4J5Y A;  2Y4X A;  1YIT T;  4PFP A;  1VUB A;  1K4U S;  3S3O A;  2DXT A;  3CC2 A;  2SRC A;  3Q1J A;  3THK A;  3M0R A;  1RAG B;  2KI7 A;  2DL5 A;  2EJF A;  1WZO A;  1VQ7 A;  2RQU A;  2DET A;  1NLO C;  1WGS A;  3NTI A;  2OAW A;  3I56 T;  4M77 C;  2EGE A;  3PMT A;  5CK9 A;  2MWP A;  8ATC B;  1OV3 A;  3CCR A;  1BYM A;  2DZ9 A;  5KYX A;  4LUD A;  1SHF A;  2ROT A;  3CCV T;  4M7A E;  2D1X A;  5GAO l;  4QQG A;  2E1H A;  1PG5 B;  2AKL A;  5KYW A;  2QEX T;  3NFC A;  4LDV A;  3CBP A;  3EG9 B;  5CCA A;  5GAO p;  1HYO A;  2ED1 A;  3V7S A;  1D0X A;  4AG1 C;  3JCM b;  2PVG B;  5C0M A;  1N5Z A;  3BDL A;  1YWP A;  2MPX C;  1GCQ C;  4MZM A;  2DVE A;  2P0K A;  2RNA A;  2JT4 A;  2JNG A;  5LJ5 e;  1VQ4 A;  4PJO B;  5HKC A;  3CCE T;  1RI9 A;  2KR3 A;  1HSQ A;  3I56 Q;  2QYZ A;  4HCZ A;  2ZPH B;  3DKM A;  2JZ2 A;  3QBY A;  1Z9Z A;  2EYZ A;  3PT9 A;  3G4S A;  5GAN 6;  1TWB A;  2WSF E;  2EJ9 A;  3WVE B;  1JB0 E;  1JJ2 A;  1V29 B;  1AWO A;  3RMS A;  4F14 A;  3V8J A;  4BB7 A;  4RMO A;  4J9H A;  4M75 D;  3L2Q A;  3RKX A;  5KYU A;  5LJ3 h;  1JJ2 S;  5D6W A;  4HT8 A;  3BY7 A;  3GBQ A;  4C0Z A;  1YI2 T;  1I0C A;  3RNJ A;  3OY9 A;  1M3A A;  1YHQ A;  1IGU A;  4E7L A;  3X26 B;  1GFD A;  1KD1 U;  2RJE A;  1QLY A;  3CCE Q;  3RKW A;  2HQE A;  4BD3 A;  4EDU A;  4M75 A;  3EHR A;  3V7R A;  2MF2 A;  3V8K A;  2SEM A;  1XNI A;  4GLK A;  4K11 A;  1RAH B;  1AHJ B;  1VQ9 A;  1GCQ A;  3PGG A;  1ZBJ A;  1WJQ A;  2E5K A;  2BE7 D;  5LJ5 f;  4XU3 A;  2HD0 A;  1N8R U;  2JMC A;  1C1A A;  3CC7 T;  1B3Q A;  3MHX A;  2M1H A;  4XTV A;  1SF9 A;  3J81 E;  3M54 A;  4LNP A;  4F7U G;  2ZGW A;  2OTL Q;  1VYT A;  4ZGJ B;  4RCC A;  4XU2 A;  3VUB A;  2HEQ A;  1M1K U;  1WLP B;  2CUD A;  2O9S A;  2BIV A;  5LJ3 g;  5FU7 C;  1BK2 A;  2E65 A;  4V2S A;  2KRO A;  2EYQ A;  1UE9 A;  4Y92 A;  2NUP A;  3QYH B;  4HT9 A;  2KE9 A;  3GNG A;  4M78 C;  3BE3 A;  4FL6 A;  3QUI A;  4C92 C;  1NPP A;  1OQK A;  1K0S A;  2YWW A;  2DMO A;  1N9S A;  2A37 A;  1VQL A;  1M1F A;  2DL8 A;  1VQ7 T;  1U06 A;  1P92 A;  5KYY A;  1RAF B;  4M75 F;  2HL5 C;  2RN8 A;  1NEB A;  2GQV A;  2WSC E;  3M4G A;  1WHL A;  3G1J A;  1BCM A;  1JXO A;  4JJC A;  5GMK j;  1JQQ A;  2FEI A;  2RPN A;  1T3S A;  2YHT A;  4ELZ C;  3CME A;  2K3B A;  1KFZ A;  3OBW A;  4FM4 B;  2K2M A;  3OW2 A;  2V1R A;  1YN8 A;  3VS5 A;  5DLO A;  3TEE A;  4Z8A A;  2J6K A;  1K9A A;  2BZX A;  1VQ7 Q;  4M7D B;  2VGN A;  2G3R A;  3JSC A;  2QTX A;  1WXU A;  2V8I A;  3CQT A;  1NZ9 A;  2CRE A;  3JCM X;  3JAM E;  1ZLM A;  3OYN A;  2ZPF B;  2ENM A;  5CKD A;  3ER0 A;  2EBP A;  4C8Q G;  3FC3 A;  3G4S T;  4C92 A;  5J3B A;  2G6F X;  4XTY A;  4LDU A;  2VWF A;  1M90 R;  3E19 A;  3BW1 A;  2C06 A;  1TSF A;  1LNX A;  5I22 A;  5DM7 R;  2JTE A;  4KGV B;  4QW2 A;  3OSS C;  4RTZ A;  5GAN d;  3OYA A;  1H3Z A;  1LCK A;  4BI3 A;  1M90 C;  2XKO C;  4EIK A;  3X28 B;  5GAM d;  1UUE A;  2VVK A;  4XAX B;  4DOV A;  4AT1 B;  4FSX A;  1AOJ A;  2AIR B;  4Z88 A;  1I8F A;  4F7U E;  3M53 A;  3OYY A;  1VQK A;  1VA7 A;  2DVJ A;  5GAO q;  2DPP B;  2RO0 A;  3NHN A;  1VQN T;  1Y71 A;  1JEG A;  5I11 A;  2RK2 A;  3G4S Q;  2A28 A;  1X2K A;  2F2X A;  2KXD A;  3VV0 A;  1WJS A;  4OMN A;  1BB9 A;  1Q82 R;  1UGR B;  2VB6 A;  4FCY A;  1MND A;  1N27 A;  2DL7 A;  4M77 E;  3I55 T;  2YUO A;  5KYX B;  3I5S A;  3CCJ T;  2K4Y A;  1WYX A;  4X34 A;  1SSF A;  1NEG A;  2HZY A;  1Q82 C;  2QAS A;  2RMO A;  1JO8 A;  5KYW B;  1WJR A;  4C5E A;  1YHQ Q;  4B9X A;  3PTA A;  5IAY A;  3HP9 A;  4C5G A;  3PIP A;  1M2V A;  1QCN A;  1IGQ A;  1ABQ A;  1EFN A;  3JRZ A;  1U1S A;  5I2S A;  2GGR A;  4RTT A;  2HKQ B;  1JJ2 P;  2YRD A;  2O9V A;  4C92 F;  5KYN A;  2YSQ A;  3ZL7 C;  1M8V A;  4OB1 B;  1UGQ B;  3OBY A;  3I55 Q;  1BIB A;  1ZSG A;  3RER A;  3UF4 A;  2XHC A;  3EG9 A;  2FZK B;  7AT1 B;  1KG1 A;  4JRQ A;  1QCF A;  3R6N A;  3AHU A;  2E4H A;  1TG0 A;  2YLC A;  2QA4 T;  5KH6 A;  4RTU A;  1M3B A;  3GOX A;  3UDC A;  5KYU B;  3L2U A;  2P4T A;  3GF5 A;  1GBQ A;  3M0T A;  4E7I A;  2J7I A;  3NTH A;  3OS0 A;  3JB9 H;  3HFN A;  2XU8 A;  3EFO B;  3G7Z A;  5EG2 A;  3ZEH A;  5GAM j;  4M75 B;  1PKS A;  2FPD A;  3KUF A;  4OMP A;  3OYH A;  1ZUU A;  1RAA B;  3OYB A;  1K8A U;  2COW A;  2C0O A;  4PJL A;  1XOV A;  2RM4 A;  2DA9 A;  2IIM A;  1YIT A;  1K9M U;  3VS0 A;  3QKJ A;  4XTX A;  1VQL Q;  3L2W A;  2RI5 A;  2E64 A;  1MNE A;  5KE2 A;  1G2B A;  2XI9 A;  1VQO T;  1N6A A;  1WFW A;  1FMW A;  2VXE A;  1BCO A;  2KYM A;  2F69 A;  1NYF A;  4BDY A;  3HRU A;  4FYY B;  2DD5 A;  4QKU A;  5GMK e;  3KXT A;  2AZV A;  2QQS A;  1KIK A;  2CH4 A;  3UA6 A;  2R58 A;  3UWN A;  3I56 A;  2LC4 A;  3HRS A;  4PFO A;  2V1Q A;  1PWT A;  2L2P A;  1OU8 A;  3CME Q;  3HSB A;  4C0G A;  3CCV A;  3OA6 A;  1H64 1;  4PJJ A;  2QEX A;  4E47 A;  4MZT A;  1YJ9 T;  4HVV A;  3H6Z A;  3JCM f;  2YRV A;  3QZ5 B;  2K6D A;  2OTJ T;  2NUP B;  3E9F A;  5CR2 A;  1KK7 A;  2AHJ B;  1UEC A;  4J7I A;  1KHI A;  1VQO Q;  2ZPB B;  4EPC A;  4M78 E;  2HNI A;  2DD4 A;  1PC0 A;  2RB6 A;  4C92 E;  1MMN A;  3CCE A;  4EMH A;  2DE0 X;  2DXB A;  4M7D C;  1LVK A;  2ZCF B;  1BBZ A;  1QVF A;  3QII A;  3OW2 P;  1YFN A;  2DEU A;  4M7A G;  2AZS A;  2FRY A;  2K5L A;  4B6M A;  3OS2 A;  3R6O A;  4OGC A;  1K73 C;  1IRX A;  1K76 A;  3SFM A;  4R56 A;  3EG0 A;  3CCQ T;  4FW1 A;  4JRK A;  1KQS A;  1KC8 U;  4JPB W;  2WAC A;  3M0S A;  2LQK A;  1YI2 A;  1RAD B;  2AK5 A;  5J26 A;  4AFU C;  3P8B B;  1PKT A;  1YJW T;  3VYG A;  2GTO A;  2X3W D;  4BE2 A;  1GXI E;  4BUG A;  2DXC A;  3CPF A;  2GNC A;  4J83 A;  4XTZ A;  4QQ6 A;  1DJ7 B;  1B7T A;  2ZAE A;  3H8Z A;  1G3W A;  1YNZ A;  4CC3 A;  3VKI A;  3X20 B;  1Q81 U;  2VXF A;  1R0C B;  5M9O A;  4M7D A;  4RUG A;  4XU0 A;  5FWC A;  3CC7 A;  3RKY A;  2DO3 A;  2M16 A;  2K79 A;  2EJG A;  4RG8 A;  2CGH A;  1YJW Q;  4DEY A;  1H3H A;  4O6J A;  2KEA A;  3ZBD A;  4L6V 5;  5L23 A;  2YLB A;  3QPH A;  2GFA A;  2MMP A;  3NTK A;  3CCS A;  2RHZ A;  3OSV A;  1W70 A;  2DER A;  1H92 A;  1WNL A;  1S72 T;  2K2V A;  1AVZ C;  4FT2 A;  2DRM A;  3MEV A;  4PJO E;  1RAI B;  2QQA A;  1RAB B;  1OX8 A;  2KSS A;  4HA8 A;  4IUQ A;  2O88 A;  2LCS A;  2ZZD A;  2F2W A;  5GAN e;  2QQR A;  3SDZ A;  3VJP A;  3OS5 A;  5GAM e;  1M2V B;  2A7Y A;  4LD9 K;  4KBM B;  2KT1 A;  4JUV A;  2X4W A;  5LJ5 g;  4C5I A;  4IIM A;  4PLI A;  5I21 A;  1UDL A;  1YIT Q;  3CCU T;  1D3B B;  3EAE A;  4LE9 A;  4M75 C;  4M7D F;  2L3Q A;  1X6B A;  2F5K A;  2YUQ A;  2KDS A;  3KBG A;  3QDF A;  3OYK A;  4XK8 E;  2K3X A;  1AZG B;  2R57 A;  1M2O A;  3EGU A;  3M55 A;  3VS4 A;  1TU0 B;  3URG A;  3QJY A;  1HJD A;  2ATC B;  2RQV A;  1G3S A;  1BI2 A;  2EYW A;  1D1B A;  2LX9 A;  1I5O B;  4ELY C;  4OMQ A;  1WHM A;  1YCY A;  1QKX A;  3EH2 A;  3CCV Q;  2P4R A;  5GJW B;  4OGE A;  2LVM A;  3EGX B;  2MOX A;  3JCM J;  2EFI A;  2OJ2 A;  1Q95 G;  3INZ A;  2JS0 A;  1T0H A;  2NUZ A;  4PLL A;  3CCU Q;  2QGF B;  2QEX Q;  2RQT A;  4AFQ C;  4OP0 A;  1RLP C;  1UFF A;  3MEW A;  1NBE B;  4AG2 C;  5GAM f;  3A8M B;  2KVQ G;  2L8D A;  1GRI A;  2RHX A;  2X4J A;  2PTK A;  4KUL A;  2M9U A;  3EG2 A;  3CMA T;  1X69 A;  2A0F B;  2FZG B;  1SG5 A;  2HBW A;  4D8D A;  5FRO A;  3EFO A;  5L8R E;  5HCK A;  2O4X A;  4HCB A;  3DLL A;  1VQN A;  1TOV A;  3MP1 A;  4E6R A;  5GAO m;  3SB2 A;  1LJO A;  4N4G A;  3REB B;  5LL6 S;  3BFM A;  1A0N B;  2NLU A;  2FZC B;  2DFU A;  4FYV B;  3TSW A;  1XTD A;  3I55 A;  3CCJ A;  2X4X A;  3OYC A;  1OI1 A;  3MEA A;  3VUZ A;  1KD1 R;  1YI2 Q;  1Y0M A;  2BKD N;  1TXQ A;  2HBP A;  2V8K A;  3CMA Q;  1TUC A;  1VQ6 T;  1KD1 C;  4CC7 A;  3UPU A;  1BU1 A;  3VS1 A;  5KCH A;  3GNF B;  3FLG A;  4OMF B;  2DYI A;  2KRS A;  1G3T A;  4A4H A;  3E1S A;  4QT7 A;  3MP6 A;  3DB4 A;  3CCS T;  5DLQ E;  3FEO A;  2BZ8 A;  2CS7 A;  4IUP A;  4M77 G;  1N8R R;  4QVC A;  1VQ8 T;  1NM7 A;  4MML A;  1KQS P;  4M7D E;  2EQK A;  4ZTF A;  4C8Q D;  4N4H A;  2OX7 A;  1WDX A;  2JS2 A;  5GAN 3;  2HSE B;  3QWX X;  1XQH A;  3MKD A;  3CC7 Q;  3SWN C;  3V7C A;  3OYM A;  2DM1 A;  2QA4 A;  1HXD A;  3MET A;  2CZ6 B;  1WQW A;  2HCK A;  3HKS A;  3JCM Q;  3G71 A;  3HPW A;  3CPW A;  4NOY A;  1VQ6 Q;  3C12 A;  1UEB A;  1Q86 U;  5GJV B;  2XK0 A;  4L59 A;  4OB3 B;  1VQM T;  3VU3 C;  3E2U A;  3CEY A;  2NWM A;  3CPW S;  4Y28 E;  3P8D A;  3ME9 A;  3EGD B;  2H3J A;  2HQX A;  1BKB A;  4L5G A;  1FWZ A;  2A36 A;  4NS5 A;  1M8M A;  3CCS Q;  2BUD A;  1GCP A;  1FMV A;  4N4I A;  5IXB A;  1D0Y A;  1KHC A;  3M5A A;  3RES A;  4FIB A;  4ZN1 A;  1WHK A;  1WXT A;  1Y07 A;  4WF2 A;  4J9C A;  4JJN K;  4BE1 A;  3AT1 B;  1W6X A;  2CZ1 B;  2RD1 A;  3QG1 A;  5A0D A;  1G5V A;  3TCJ A;  2DL4 A;  2EQU A;  4DOW A;  4OVA A;  3FRN A;  2E5Q A;  3HFO A;  3PMI A;  4E7J A;  3OW2 S;  3CCM T;  3LGL A;  4F17 A;  2BZY A;  1VQO A;  4LD6 A;  1X43 A;  1O75 A;  4KGX B;  4KUI A;  2RQR A;  2L89 A;  3SWN A;  4J6W A;  3MPU B;  2D8J A;  1M90 U;  1EX4 A;  4ESR A;  5GAN 2;  2LMJ A;  1B07 A;  2XDP A;  5IHK A;  2X4Y A;  2DJQ A;  1S1N A;  3RUX A;  2LCL A;  1LPL A;  1WX6 A;  5A0G A;  1RI0 A;  1WHH A;  4JS5 A;  4E7S A;  3H0F A;  2E41 A;  3JCM h;  1Y57 A;  2QDY B;  3PFS A;  3N5B B;  4RG2 A;  3REA B;  4Y91 A;  4J9F A;  3OS1 A;  1YJ9 A;  5GAO n;  1D09 B;  2LZ6 B;  5FU6 B;  2QG9 B;  6AT1 B;  2OTJ A;  3CBM A;  2CKK A;  2FRW A;  4GY5 A;  2HL3 A;  5D6Y A;  1Q82 U;  4IUR A;  2DZC A;  2L3S A;  5J39 A;  1SHG A;  2GCX A;  2ESW A;  1JRI A;  1UHC A;  4J6X A;  4IUT A;  2LT4 A;  2JTF A; 
#chains in the Genus database with same CATH homology
 3EG1 A;  2KT8 A;  2K7A A;  4HVV A;  5IH2 A;  3THK A;  3M0R A;  2K6D A;  1QWF A;  2DBM A;  2DL5 A;  2RF0 A;  1UEC A;  3PE0 A;  2J06 A;  1CKA A;  1I07 A;  2RQU A;  1NLO C;  1UGV A;  2OAW A;  1AWW A;  1CSK A;  2EGE A;  1AZE A;  1M3C A;  1OV3 A;  2DE0 X;  2C0T A;  4LUD A;  1SHF A;  2ROT A;  2LX7 A;  1BBZ A;  3M0U A;  2D1X A;  2HSP A;  3VS6 A;  2CT3 A;  4J9I A;  2GQI A;  2AKL A;  1K0X A;  2VKN A;  2AZS A;  1M27 C;  2FRY A;  2L0A A;  2ED1 A;  4AG1 C;  1K76 A;  1ARK A;  1N5Z A;  3U23 A;  3LH5 A;  3JV3 A;  3EG0 A;  4JZ4 A;  1YWP A;  1GCQ C;  2RNA A;  2JT4 A;  2LNH B;  4JPB W;  3M0S A;  2AK5 A;  2DLP A;  4AFU C;  1RI9 A;  2KR3 A;  4Z89 A;  1HSQ A;  2CSQ A;  1PKT A;  2ECZ A;  2GTO A;  2X3W D;  1JU5 C;  3H41 A;  1VYU A;  1Z9Z A;  1I1J A;  2EYZ A;  3UA7 A;  4ZNX A;  4GBQ A;  2GNC A;  2KRM A;  2JM8 A;  1T3L A;  2YUP A;  2YT6 A;  1AWO A;  4F14 A;  1FYN A;  3H0H A;  4J9H A;  1YNZ A;  4CC3 A;  1OOT A;  2MCN A;  4M4Z A;  2LQN A;  2KNB B;  4HCK A;  3GBQ A;  3I35 A;  1IO6 A;  1I0C A;  3RNJ A;  1U3O A;  2CDT A;  2FPF A;  3M0P A;  1M3A A;  4RUG A;  5FWC A;  1GFD A;  1QLY A;  2K79 A;  3VS2 A;  1UG1 A;  1UTI A;  2KYB A;  2A08 A;  4DEY A;  1H3H A;  3EHR A;  2ED0 A;  2SEM A;  2KEA A;  3NPF A;  2KBT A;  4K11 A;  2EYY A;  1V1C A;  5L23 A;  1GCQ A;  5IXF A;  1CKB A;  1ZBJ A;  2D8H A;  4GLM A;  3TSZ A;  1WIE A;  1M30 A;  2YDL A;  1WA7 A;  2JXB A;  2E5K A;  2EKH A;  2LQW A;  1W70 A;  1OPK A;  3NGP A;  1H92 A;  3SHW A;  1SEM A;  2C0I A;  4OMO A;  2CH4 W;  1AVZ C;  1FMK A;  2JMC A;  1OEB A;  2J05 A;  2DRM A;  2LP5 A;  3O5Z A;  1B3Q A;  2H8H A;  1ABO A;  4JJB A;  1KJW A;  2LJ1 A;  4LNP A;  2X3X D;  2O88 A;  2LCS A;  3EG3 A;  2F2W A;  1UJY A;  3EHQ A;  1G83 A;  2HDA A;  1VYT A;  4J9B A;  2K9G A;  1E6G A;  4F16 A;  1VYV A;  4J9D A;  2KRN A;  2HEQ A;  2DL3 A;  2KT1 A;  1WLP B;  2CUD A;  4OML A;  1RUW A;  4J9G A;  4WCI A;  1NLP C;  2O9S A;  1PNJ A;  1BK2 A;  4IIM A;  2DNU A;  2KRO A;  1UDL A;  2ABL A;  2DBK A;  1UE9 A;  4Y92 A;  1PHT A;  2KE9 A;  4LE9 A;  4LN2 A;  3ULR B;  2L3Q A;  1X6B A;  1K0S A;  1H8K A;  3FJ5 A;  1KSW A;  1AWX A;  1PRL C;  1T0J A;  2YUQ A;  1YP5 A;  2DMO A;  5IHI A;  2A37 A;  1AEY A;  2DL8 A;  1AZG B;  1U06 A;  2EYX A;  2PZ1 A;  5FWB A;  3EGU A;  2J6F A;  3VS4 A;  4AFS C;  5EC7 A;  2RN8 A;  1HJD A;  1NEB A;  2JM9 A;  1TUD A;  1OPL A;  3C0C A;  2LJ0 A;  2RQV A;  3UAT A;  4DEX A;  4ORZ A;  2EYW A;  2GTJ A;  1JXO A;  2FPE A;  4JJC A;  2M0Y A;  4OMQ A;  1NYG A;  1JQQ A;  2FEI A;  3VRZ A;  2RPN A;  2LJ3 A;  3H0I A;  1QKX A;  1T3S A;  2P4R A;  5GJW B;  2M51 A;  4KRT A;  4D8K A;  2MOX A;  2K3B A;  1KFZ A;  2OJ2 A;  1RLQ C;  2JS0 A;  1T0H A;  2NUZ A;  2K2M A;  4FSS A;  1HD3 A;  2RQT A;  4AFQ C;  2JMA A;  2V1R A;  1RLP C;  1UFF A;  1YN8 A;  3VS5 A;  3M0Q A;  4Z8A A;  4AG2 C;  1MV3 A;  2J6K A;  1GRI A;  1K9A A;  2BZX A;  3I9Q A;  1E6H A;  2F2V A;  2PTK A;  3SEM A;  1WXU A;  3EG2 A;  3CQT A;  1X69 A;  2CRE A;  2CSI A;  1ZLM A;  2PNI A;  2HBW A;  4D8D A;  2ENM A;  2EBP A;  2JW4 A;  5HCK A;  2O2O A;  1J3T A;  2O31 A;  3QWY A;  4E6R A;  1AD5 A;  2G6F X;  2J6O A;  3IQL A;  3REB B;  1SSH A;  2VWF A;  1A0N B;  2B86 A;  5I22 A;  3TSW A;  2JTE A;  4RTZ A;  4RTX A;  1LCK A;  2BTT A;  4EIK A;  1UUE A;  2VVK A;  3KFV A;  3TVT A;  4CC2 A;  1Y0M A;  1WI7 A;  1AOJ A;  4Z88 A;  4RTV A;  2DYB A;  3NMZ C;  1TUC A;  1W1F A;  4CC7 A;  4J9E A;  1BU1 A;  1VA7 A;  2DVJ A;  3VS1 A;  1GL5 A;  2FO0 A;  3NHN A;  1K1Z A;  1SRL A;  1JEG A;  5I11 A;  1AWJ A;  1YWO A;  2A28 A;  1X2K A;  2KRS A;  2F2X A;  2KXD A;  4RTW A;  4HXJ A;  4OMN A;  1BB9 A;  3I5R A;  4A63 B;  4QT7 A;  2EQI A;  1X6G A;  2DL7 A;  4OMM A;  2GBQ A;  2BZ8 A;  2YUO A;  3I5S A;  4LUE A;  1WYX A;  1NM7 A;  1NEG A;  2L3P A;  5IHN A;  2EGA A;  2RMO A;  1MUZ A;  1WDX A;  1JO8 A;  2JS2 A;  3QWX X;  2XMF A;  2AKK A;  2DM1 A;  4HVW A;  2HCK A;  3PVL A;  1X27 A;  1ABQ A;  1EFN A;  5GJV B;  1QWE A;  2GGR A;  2W10 A;  2CT4 A;  4RTT A;  2NWM A;  3A98 A;  2O9V A;  2DRK A;  2YSQ A;  3ZL7 C;  1ZUY A;  2A36 A;  1M8M A;  3VRY A;  1GCP A;  1YCS B;  1NG2 A;  1SRM A;  1ZUK A;  2DX1 A;  1ZSG A;  2I0N A;  3UF4 A;  5IXB A;  2KGT A;  4JZ3 A;  2EGC A;  1WXT A;  1QCF A;  4J9C A;  3R6N A;  2D0N A;  4CC4 B;  4RTY A;  1W6X A;  2RQW A;  1TG0 A;  2KXC A;  2EPD A;  2W0Z A;  2EW3 A;  4RTU A;  1M3B A;  2DL4 A;  3RBB B;  4AFZ C;  1GBQ A;  3M0T A;  2J7I A;  2MIO A;  2CUB A;  1SPK A;  4F17 A;  2BZY A;  5FW9 A;  1X43 A;  1PKS A;  1GBR A;  2DF6 A;  2FPD A;  2RQR A;  4OMP A;  1ZUU A;  2D8J A;  4ESR A;  2LMJ A;  1B07 A;  1ZX6 A;  5ECA A;  5IHK A;  2DJQ A;  1S1N A;  2C0O A;  1XOV A;  1Z9Q A;  1WX6 A;  2DA9 A;  2EVR A;  4JJD A;  2IIM A;  3VS0 A;  3H0F A;  1PRM C;  4R0K A;  1Y57 A;  3REA B;  1JXM A;  1QKW A;  4J9F A;  1UHF A;  1G2B A;  4IIO A;  2DIL A;  2LZ6 B;  3VS3 A;  1WFW A;  1E7O A;  2OI3 A;  2KYM A;  2YUN A;  1NYF A;  1U5S A;  2FRW A;  4HVU A;  2QDL A;  4X1V A;  2AZV A;  1GFC A;  1KIK A;  3VS7 A;  2CH4 A;  1UJ0 A;  3UA6 A;  2V1Q A;  1WXB A;  2L3S A;  1PWT A;  1SHG A;  2L2P A;  2ROL A;  2ESW A;  3PVQ A;  1UHC A;  1X2Q A;  1K4U S;  2SRC A;  2FG0 A;  1MV0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...