5I22A

Amphiphysin sh3 in complex with chikungunya virus nsp3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Myc box-dependent-interacting protein 1
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i22A00
1WXUA 2LQWA 4X1VA 3EG3A 2D0NA 1UG1A 1QWEA 1Z9QA 1UE9A 1PKTA 2EW3A 2SRCA 3ZL7C 3QWXX 3VS7A 4JZ4A 2LJ3A 1KSWA 1UGVA 1OPLA 2CH4A 1CKBA 3REBB 4E6RA 2ENMA 4JPBW 2GGRA 3M0QA 2CSQA 2DNUA 1AWWA 1XOVA 3H41A 3VS0A 1N5ZA 5FWBA 1SHGA 2KBTA 4RTYA 1UJYA 1OV3A 1T0JA 2CUBA 2LMJA 2J6KA 2LQNA 3KFVA 2J05A 3SEMA 1MV0B 2DRMA 4RTTA 2KXCA 2C0TA 1PHTA 2D8JA 2AK5A 1GFCA 4OMPA 1UHFA 1KFZA 2O9VA 2RMOA 2JS0A 4JJDA 2F2WA 1CKAA 2AZVA 2C0OA 3VRYA 1K4US 1I0CA 2PNIA 5IXFA 1M8MA 2AKKA 1YNZA 4JJBA 3VRZA 5ECAA 1K0SA 1VYVA 3I5SA 4FSSA 1K76A 1AZGB 2O9SA 2JXBA 3EGUA 3UA6A 2JW4A 2NWMA 1JQQA 5L23A 1AD5A 2BZXA 1K9AA 5IHIA 1AWJA 1GBRA 2JS2A 1QKWA 1YWOA 2AZSA 2DM1A 2ROLA 4HVUA 2W10A 4CC2A 1GCQA 4Z8AA 2CT4A 2JM8A 3PVLA 3THKA 1ZUKA 1GL5A 1PRMC 2DILA 3H0FA 1AVZC 3C0CA 1VA7A 1WA7A 1HSQA 2O88A 1SSHA 3M0UA 4EIKA 1NYFA 5IHKA 2ROTA 4R0KA 1X6GA 1WDXA 4OMQA 1X43A 1ARKA 2GQIA 2NUZA 2KT8A 2DLPA 4KRTA 1NLPC 2L0AA 3VS2A 1YN8A 4OMMA 4HCKA 3REAB 1FYNA 2CUDA 1RUWA 2KRMA 2RQTA 2DL7A 1QCFA 3FJ5A 4OMLA 2L2PA 1HJDA 2LJ0A 2EBPA 1NG2A 2FRYA 2A08A 2O2OA 4AFUC 1OOTA 3GBQA 4Y92A 3U23A 1H92A 4ESRA 1W6XA 2A37A 2LP5A 1J3TA 1H3HA 4RTUA 2MCNA 1M30A 1ZBJA 3QWYA 3VS1A 5I22A 5EC7A 2KXDA 5GJWB 2EYWA 2DE0X 2YT6A 3VS4A 2LX7A 2CSIA 3ULRB 3A98A 1AOJA 2ECZA 3TSWA 2VWFA 1LCKA 1KJWA 1YP5A 2ED1A 1V1CA 2XMFA 2J6OA 2DBKA 4A63B 1WFWA 1QWFA 2FPFA 2YDLA 2KRSA 3NHNA 2HCKA 3UA7A 2SEMA 2CH4W 1SPKA 1M3CA 2DJQA 2RN8A 3VS6A 1B3QA 4Z89A 2GNCA 2JT4A 2KYMA 1GCPA 2I0NA 1MUZA 4LNPA 2FG0A 2D8HA 1K0XA 1SRLA 1ZUYA 1QKXA 5FW9A 1NEGA 1YCSB 2HSPA 1PKSA 4DEXA 4OMNA 1B07A 2KEAA 1FMKA 4J9FA 1M27C 1JO8A 1U06A 1ABQA 1K1ZA 1KIKA 1OEBA 1WIEA 3NGPA 2B86A 2M0YA 4HVVA 2KGTA 2EPDA 3I9QA 1M3AA 2EKHA 2KNBB 3RNJA 1QLYA 3EHRA 4J9HA 4AG1C 2J7IA 1T3SA 3JV3A 3UF4A 1Z9ZA 4RTWA 1JXOA 4J9BA 2BZYA 4J9GA 2O31A 4AFSC 3M0PA 1JU5C 5HCKA 1T0HA 2F2XA 4J9CA 1M3BA 1T3LA 2J06A 1RLQC 4HXJA 2DA9A 1EFNA 2J6FA 2RQWA 1GCQC 2A28A 2RQRA 2DL8A 2FPDA 2EYXA 2K6DA 3VS5A 1TUCA 2DVJA 1MV3A 2X3XD 1TUDA 3I5RA 1GFDA 4J9IA 1UJ0A 4F14A 2YUOA 2K3BA 2W0ZA 2K79A 2L3QA 2KR3A 1ZUUA 2H8HA 1G83A 2OJ2A 3PVQA 1I07A 1X6BA 1E7OA 1WI7A 2MOXA 2K2MA 2OI3A 2K9GA 2QDLA 2ESWA 1AWOA 2DYBA 2KYBA 1U5SA 2EGCA 1W1FA 2RPNA 1X69A 4GBQA 5IHNA 4LN2A 2CT3A 2RQUA 2V1QA 1UECA 2GBQA 4WCIA 2E5KA 2JMCA 3I35A 1Y57A 1WXBA 2EQIA 2FEIA 3M0RA 1I1JA 1X27A 1PWTA 2YUPA 1VYTA 1NLOC 2RNAA 4LUEA 1Y0MA 1IO6A 1UTIA 1TG0A 3UATA 2RF0A 4K11A 2EYYA 4RUGA 1AEYA 4Z88A 4AFZC 2DL3A 3CQTA 1JEGA 2HDAA 2HEQA 5IXBA 4LUDA 2JM9A 4IIOA 4LE9A 1JXMA 2EGAA 3EG1A 2LJ1A 4CC4B 2KT1A 4RTXA 5GJVB 1G2BA 1AZEA 1PRLC 2LZ6B 3PE0A 2FPEA 2VVKA 2K7AA 5IH2A 1NYGA 1UFFA 2JTEA 1X2QA 1UHCA 5I11A 2C0IA 2LNHB 2JMAA 3H0HA 3TSZA 1U3OA 3EG2A 1NM7A 2ABLA 1UDLA 1W70A 3NMZC 3M0SA 4ORZA 1BK2A 3NPFA 4IIMA 4CC3A 2DRKA 2DF6A 2ED0A 4F17A 1ABOA 2EYZA 2HBWA 4OMOA 2X3WD 1RLPC 2KE9A 2F2VA 2L3SA 1WXTA 3EG0A 1X2KA 1A0NB 2DBMA 1VYUA 2M51A 1S1NA 3O5ZA 4AG2C 2CDTA 2PTKA 2EGEA 2DL5A 3EHQA 2G6FX 2GTJA 2DMOA 3TVTA 1SHFA 3H0IA 4D8DA 1H8KA 4J9EA 1YWPA 4RTZA 1BB9A 3M0TA 2YUNA 2AKLA 2DX1A 2PZ1A 2GTOA 4F16A 2BZ8A 1OPKA 1NEBA 2FO0A 4M4ZA 4DEYA 2OAWA 3R6NA 4JZ3A 2V1RA 2RQVA 1BU1A 2VKNA 1WLPB 4AFQC 2KRNA 4ZNXA 1PNJA 1CSKA 1UUEA 4D8KA 1E6GA 1E6HA 1SEMA 1ZLMA 5FWCA 2LCSA 4CC7A 1SRMA 1BBZA 1ZX6A 2CREA 4J9DA 4QT7A 3VS3A 2EVRA 2MIOA 1WYXA 4HVWA 1ZSGA 2YSQA 1AWXA 2P4RA 2IIMA 2YUQA 1GBQA 2D1XA 4JJCA 4RTVA 2A36A 3SHWA 1HD3A 1WX6A 4GLMA 2DL4A 2L3PA 2KROA 1RI9A 3IQLA 2BTTA 3LH5A 1GRIA 2FRWA 3RBBB
chains in the Genus database with same CATH superfamily
4X1VA 3HHTB 1TTHB 4JDSA 2RHUA 2K2VA 3CC2Q 2E65A 1UGVA 4QVZA 4GY5A 3WVEB 2CH4A 5KE2A 3EFOA 4FM4B 5CQYA 3CCEA 2D9TA 4JPBW 2QDYB 2GQVA 3M0QA 1ZHIA 5GANd 4LD6A 3H41A 3WVDB 4XTZA 2COWA 5GAN7 2QGFB 1P92A 2CUBA 1U1SA 5FU7B 3EFRA 1XQHA 2PUOB 2LQNA 4RTTA 2KXCA 2EQMA 2LVMA 2Y90A 1WQ7A 2D8JA 4FYYB 1VQMQ 4EMKA 2XI9A 1CKAA 4ZN3A 3E19A 2OTJQ 4E7ZA 2PVDB 2CP0A 3CCSA 1M8MA 1YNZA 4JJBA 4LDWA 3JB9I 2E70A 3VRZA 2GFAA 1K0SA 4KGVB 1K76A 2O9SA 4OB1B 1C6VX 4C92A 1KD1R 2NUPA 5L23A 1MGQA 4NL3A 3JCMb 2K3YA 2NUTA 1YWOA 3QXEB 4DQ2A 1IGQA 3OQ5A 1GL5A 1PRMC 2CP5A 4M7DC 5D6YA 1AVZC 4MZTA 2MAMA 3C0CA 1WJSA 2RJCA 4XU3A 2VGMA 2O88A 3CD6T 1SSHA 1TOVA 2BUDA 1YJ9T 3OB9A 4KBMB 1WHLA 2Z0WA 3OYIA 1NYFA 2KQWA 4R0KA 5IHKA 3S3MA 3HRSA 1WPYA 2PQWA 1Q7YC 2NUZA 2KT8A 3VS2A 4KGZB 3OW2A 5C6SA 3MP6A 2K4YA 3RR6A 2CUDA 3CCRA 3OYFA 2KRMA 1VQ5T 2RI3A 1QCFA 1RAFB 4NOYA 1Q82U 1Y96A 2LJ0A 2QASA 2ZPHB 4EDUA 4Y92A 5I21A 1YHQQ 2QQBA 1Q86C 3QBYA 1ZSZC 2EQJA 2XHCA 1H92A 2H3JA 4C8QF 1H3HA 2MCNA 1OX8A 1ZBJA 1OULA 3E9GA 3QWYA 2BE9B 2LQ8A 2DO3A 4C0FA 2FHDA 3CCQQ 3CBMA 2R5AA 3VS4A 2LX7A 4M78C 3QPHA 3DKMA 4ELYC 5GMKi 1K73R 1YCYA 1W2BS 1VUBA 4B9XA 1VQOA 1LCKA 1KJWA 4FIBA 1V1CA 2NUPB 1W2BA 3JCMW 3EAEA 3CCLQ 2DBKA 4A63B 2KMTA 2YXYA 5IT9E 5GANe 4FT2A 3S3NA 3NHNA 2HCKA 3UA7A 2CH4W 3C4SA 1NJIR 2E12A 5KYXA 5HY6A 5GAMe 1NJIC 4J5YA 2QEXA 4J8OA 2FZCB 3GPLA 5GANj 1VQ9T 1TXQA 1C0MA 1M90C 1IHWA 2XK0A 1SRLA 1ZUYA 5FW9A 1NEGA 4IUQA 4ELZC 5KYXB 3DLMA 1PKSA 4DEXA 5HK3A 2V8IA 2MI6A 4OMNA 3A5ZB 1YI2Q 1FMKA 1M27C 2IG0A 3CC2T 1SG5A 3HSBA 3OYAA 1KIKA 2XDPA 3HKSA 3JB9J 2B86A 4HVVA 1KC8R 3S6WA 2RD1A 3V8JA 5CVIA 1M3AA 3G6EA 2KNBB 2DXUA 3LGLA 4J9HA 1QVFS 3JV3A 3UF4A 4NL2A 4HT9A 4J9GA 3EGXA 3CXCP 2F5KA 4FYXB 2WSFE 5DLQE 2F2XA 4Q5WA 3ZEHA 3I56T 1VQPT 2J06A 3G7ZA 2V8KA 4HXJA 5CIUA 2DA9A 4BI3A 1GCQC 3BW1A 2DZ9A 2EYXA 3QHSA 1Q7YR 1IB8A 3CPWA 5FU7C 1M8VA 1GFDA 2YUOA 4PFPA 2W0ZA 2RI2A 3TREA 2M0OA 2RI5A 1OQKA 1VQ5Q 2G3RA 4OB0B 5D7UA 2DZCA 2DXTA 5C0MA 1X6BA 5DM7R 2OI3A 2QDLA 1BCMA 2ESWA 3J80E 3RKXA 2EGCA 1QVFP 4YTLA 1W1FA 3SDZA 4DBHA 3RMQA 5GAMg 1X69A 3UT1A 4LN2A 2NUTB 3FLGA 1IRXA 2V1QA 2DYIA 2JMCA 2K5FA 2ZPBB 3ME9A 2FEIA 2JTFA 2MMPA 1K73C 3CPWP 1PD0A 3JSCA 1NLOC 4M7AB 4LUEA 4BACA 3PNWC 3CC2A 4F7UA 1NPRA 1I5LA 4M7AF 2EYYA 3CC7T 5DY9A 3A8LB 1AEYA 4Z88A 2DL3A 2HDAA 1X6OA 4HA8A 2YLBA 4C92G 5IXBA 3OY9A 4XTVA 5AYFA 1K8AU 1PRLC 1YJWA 1BCOA 3EG9A 3HFOA 2P84A 2FPEA 1U1TA 1X2QA 3FIFA 2C0IA 3TSZA 2ABLA 3L1AA 1UDLA 3NMZC 1RL2A 3EFOB 2NYSA 2QEXT 4LXCA 3L2WA 1IREB 2A0FB 4IUUA 4E47A 3OS0A 3V7RA 4KUIA 4OMOA 4ANJA 2X3WD 4ZN1A 3G4SQ 3F70A 1X2KA 1LPLA 3CCJA 1VIEA 4BY6C 5GAOq 3PIPA 3O5ZA 2YLCA 4J7IA 4J6WA 2DL5A 2H3EB 4RCBA 1QW1A 2G6FX 4BUGA 2OTJT 1H8KA 4HT8A 4RTZA 5LJ5g 2DXBA 1N27A 5FLXE 2GTOA 2HD0A 4ZTFA 1VQMT 1S72T 3LW5E 1HYOA 1W2BP 2FO0A 2JOYA 4DEYA 2OAWA 3ASKA 3OYBA 1C1AA 2DTHA 1G5VA 1SSFA 5GAMd 1UUEA 2PU9B 2L89A 4D8KA 3CCVQ 2LCSA 3UDCA 4JRPA 3HP9A 2MIOA 5LJ3f 2I2LA 1FXXA 4LDXA 4CRIA 1JB0E 2XICA 1MMNA 4BDZA 3TU4K 2QQSA 2HZYA 1GBQA 2D1XA 2LTOA 1Q82C 2CP2A 4GLMA 4OP0A 1EIFA 2BTTA 1Q86U 4HCZA 5LJ3j 3RBBB 1IGUA 1VQLQ 1K9MR 3BY7A 4NS5A 3LH0A 2K5LA 3EG3A 2D0NA 4JLIA 1UG1A 1QWEA 3QZ5B 3QZ9B 1PKTA 2M02A 3VS7A 4JZ4A 5LJ5h 1OPLA 5A0GA 1RAHB 3G1JA 2ZZDA 4IKFA 1MNDA 2VXEA 5CKHA 1YFNA 3CCUQ 2GGRA 2RO0A 1I5OB 5FRMA 2L8DA 1AWWA 5FWBA 1FMVA 1PCXA 3LYIA 3I55Q 1UJYA 1OV3A 2RJEA 2BKDN 1Y07A 3PT9A 4EMGA 3LWIA 4KT0E 4ZGJB 2DRMA 4RCCA 1QP3A 3J81E 2C0TA 3KXTA 1GFCA 3R6OA 1QCNA 2EQUA 4PJLA 2JS0A 3I55T 1RAEB 2CZ7B 1I0CA 1G3WA 5IXFA 5LJ5e 5ECAA 1FMWA 3P8DA 1YITQ 1AZGB 4C5HA 4XAXB 2JW4A 3MP1A 3HRTA 1VQ4Q 2BZXA 1K9AA 1AWJA 1ACMB 4HKEA 1B34B 4DBFA 2ROLA 4ATOA 1VQNT 2RHZA 2W10A 2JZ2A 1SKUB 3OMCA 2EJ9A 5GAOn 1M1GA 4FW1A 1Q81U 1ZUKA 3H0FA 3MEVA 1WA7A 1D3BB 1VQ4T 7AT1B 2EJFA 4KUDK 3OA6A 2ROTA 1X6GA 1WDXA 1X43A 1ARKA 4DOVA 4RMOA 4PJOB 2MF2A 4KRTA 2DLPA 1N8RR 1NLPC 2L0AA 1YN8A 2YRCA 1FYNA 4JJNK 2YRDA 1WHMA 4PJOC 2DK3A 2RQTA 4QW2A 2QA4T 2L2PA 1HJDA 1YJWT 4XTWA 4AFUC 1OYXA 3GBQA 3EGDB 2KI7A 1M9SA 3U23A 1OU9A 1YBYA 1J3TA 4RTUA 1D09B 1QVGP 2JN0A 1YJNT 3LGFA 3VS1A 1OZ3A 3RUXA 2KXDA 5GJWB 2YT6A 1OZ2A 2P0KA 3OYYA 4PJNA 2GF7A 2ZPGB 5KYUB 2CP7A 4II1A 3QDFA 3OBWA 1WHGA 1XTDA 3CMAA 4WTOB 1VQ7Q 3JRZA 5GAN6 2ECZA 3TSWA 2F69A 2VWFA 2ED1A 5D6XA 3NFCA 2E4HA 4Y28E 1BI2A 4LDUA 1WFWA 4C8QC 2YDLA 3G71Q 1MNEA 1K73U 2O4XA 3A1PA 4ME7A 1N6AA 1M3CA 1BIAA 3X26B 2RJDA 2HNIA 4KGXB 3CCSQ 2JT4A 3OMGA 4MMKA 2WSCE 1MMGA 1VQ6T 3J7AF 2D8HA 3QJYA 1YCSB 2VV5A 3DB3A 4M7AC 5GMKl 1KC8U 1VQ6Q 1JRIA 5HKCA 3JCMd 1RADB 1KQSA 2B8AA 2KEAA 4XTUA 4QQ6A 1U06A 1K1ZA 4PJOD 3AT1B 2AT1B 3V7CA 2X9HA 2EPDA 3CC4T 4MZMA 4O6JA 3RESA 1VQPA 1Q86R 3RNJA 2D0QB 2J7IA 1KHCA 4J6YA 4C5EA 4RTWA 4J7FA 4J9BA 3QKJA 4CI0C 2O31A 3BDUA 2QQ9A 3M0PA 2V26A 1JU5C 4HCCA 1ZQ1A 3CXCS 2CZ6B 4RG2A 4QQDA 1T3LA 1LVKA 1RLQC 2FZGB 2RQWA 2KAFA 3KUFA 1M1KR 1G3SA 2DL8A 2K6DA 4EPCA 1D0YA 3A8MB 3CPFA 3EG9B 2DETA 2X3XD 2ZGWA 4M77B 3I5RA 4ZGEB 4M7DG 4J9IA 4MMLA 3I55A 2K3BA 4FYVB 1M1KU 3CBOA 2L3QA 3Q1JA 4C0DB 4TVRA 5CAIA 4BD3A 2AIRB 4ZGDB 1PM3A 4M77D 2OJ2A 3OYGA 1E7OA 4DBQA 4C8QD 2DKGA 3M59A 1M2VB 2DYBA 5CQXA 1I81A 3PMTA 5LJ3e 2RPNA 1UGPB 2P0PA 1F1BB 2X35A 1WHJA 4M7AD 3SWNA 4EMKC 3RERA 4M75E 4E7HA 4JRQA 1I1JA 1PWTA 3FB9A 4M7DD 4Z02A 2Y4XA 5KYWB 3G6ET 4PJOG 1IO6A 1TG0A 3UATA 1G3TA 4F7UE 4K11A 2OTLA 2E3IA 1R8OB 1VQKQ 4AFZC 1D0ZA 1NE8A 1QMCA 5IN1A 2JM9A 2FYKA 4OGCA 2EGAA 2QK0A 2LJ1A 1M4ZA 4RTXA 2JVVA 4BE0A 2LZ6B 1I4K1 2K7AA 1XNIA 1NYGA 1UHCA 5FRNA 3JCMe 2RA2A 3QUIA 1U3OA 1R0BG 3VJPA 3N5BB 5LL6S 4XTXA 4ORZA 4PJOF 3NPFA 5J39A 4M78F 2DF6A 2HBWA 1GXIE 4LDVA 3JCMV 5FROA 2C06A 2F2VA 1QVGS 3CC4A 5I2MA 1BYMA 1M1FA 4FU6A 1OX9A 3S3OA 1AT1B 3DLLA 3GLXA 2CDTA 5M9OA 4Y91A 1ZSZA 1OU8A 3M55A 3OYHA 4BDYA 4M7DA 1SHFA 3H0IA 3CMAQ 3MPUB 4C8QB 3M9QA 3OSVA 2HKQB 2YUNA 2AKLA 2PZ1A 3D7SB 4F16A 1Q81C 1Q95G 4C92E 4QQGA 2QA4A 1NEBA 3V8KA 1BU1A 2VKNA 2L3RA 1WLPB 1ZBXA 4AFQC 4E7LA 2CKKA 5A0LA 4ZNXA 4N0AC 3X24B 4KULA 2KSSA 1WHKA 1E6GA 1TWBA 4CC7A 1SRMA 1ZX6A 3BE3A 1NBEB 2EVRA 3M58A 3M54A 3GNFB 5D6WA 4FYWB 3CC7Q 4C0GA 2E41A 2P4RA 3QG1A 3LWHA 4PL6A 2IIMA 2YUQA 2E6NA 2LT4A 4JJCA 2A36A 5CKDA 2EIFA 3E1SA 5GMKj 1GRIA 2FRWA 4JS4A 4PJJA 1WXUA 2LQWA 1LOJA 4E7SA 3LLRA 1UE9A 3OYJA 5KYYB 1UGQB 5LJ5f 2LJ3A 1ZA1B 3JCMg 1VIFA 1G3YA 3QJ6A 1YI2T 4E2FB 5LJ3d 5CCAA 4BE2A 3REBB 2E64A 5GAMh 3CCVT 2RHYA 1XOVA 4M75G 4N0AA 1N5ZA 4M78B 2QI2A 5A2QE 2KBTA 4RTYA 3CD6A 2CYZB 1D1BA 2J6KA 2O01E 5J26A 3V8LA 2HKNA 5GANh 3KFVA 3EH2A 1MV0B 1N8RU 2DVEA 3META 1PHTA 3GOXA 2AK5A 1BKBA 1KFZA 2O9VA 2F2WA 1YI2A 2GCXA 3O8VA 2PNIA 1TH7A 2AKKA 1PG5B 5GANg 2AHJB 3I5SA 1VQPQ 4FSSA 1TSFA 3PMIA 2ZPEB 3UA6A 4DBRA 1KQ1A 3CCQT 5LJ5d 1AD5A 2QAZA 2CP3A 4A4FA 5IHIA 2GFUA 1GBRA 2JS2A 1QKWA 1V76A 2DM1A 3VKIA 3ZFJA 4HVUA 3M4YA 4GLKA 1GCQA 4Z8AA 4KH0B 2CT4A 1VOMA 4C92B 2K5IA 3BFMA 2DPPB 1QQJA 2DILA 3OS1A 2X4WA 4LD9K 3CCMQ 3H9NA 2QGGA 3T9NA 3HL8A 3M0UA 2E10A 4EIKA 2MYSA 4OMQA 3G4SA 5FU6C 4RG8A 2OTLQ 4OMMA 4XTYA 4WF2A 3CPWS 2LX9A 4HCKA 2DXCA 1RAIB 4L5GA 1BI0A 1RUWA 2XKOC 3A8GB 3MEUA 1RAAB 4JS5A 1KQSP 2VYTA 3FJ5A 3FRNA 3QYHB 2EBPA 3CEYA 1NG2A 5CKEA 3OYDA 2O2OA 2QXFA 1OOTA 1R0CB 1S72Q 4FT4A 2DD5A 1D1AA 3URGA 5KCHA 1RI0A 1W6XA 2MWPA 3FDRA 2RHXA 2QYZA 1M30A 2DTIA 6AT1B 5I22A 4F7UB 2EYWA 4N4GA 4E7KA 2DE0X 4M7AA 3GF5A 4M77C 3E2UA 2DEUA 2CSIA 1KD1U 4IUPA 1K8AC 2DAQA 1AOJA 2JJ9A 1YP5A 1R77A 4OB3B 2V8JA 3VV0A 2OAUA 3GIBA 3OS5A 1QWFA 3MJXA 1M5Q1 4MDWA 2KRSA 1YHQT 4X34A 4M75F 4M7DF 1JJ2P 1KHIA 1KG1A 5GAOl 1VQLA 2GNCA 1MUZA 3SB2A 4F7UG 2LCCA 1YITA 3INZA 2D6FA 5GAOr 1K0XA 3G71A 2QQAA 1H641 2HMAA 2XU8A 4ZTJA 1YIJQ 3JB9D 2OTLT 4L59A 3A8OB 2RK1A 3X28B 1B07A 3QSUA 4A4GA 2DERA 1YJNA 3SD4A 4J9FA 5CK9A 1UEBA 2E1HA 1OEBA 3CCMT 1NZ9A 3CD6Q 3NGPA 2M0YA 3I9QA 3SWNC 5IAYA 2EKHA 4XU1A 3CCLT 1QLYA 5GAN5 1T3SA 5GAN8 3DB4A 3JCMc 2BZYA 2P4TA 2CZ0B 4A4KA 1UB4A 4AFSC 1JJ2S 3RMSA 3MO8A 4M7DE 1M3BA 4M77E 1EFNA 3CCQA 2RH2A 5GAMj 2RQRA 3OYCA 1VQ4A 4M77F 3VS5A 1TUCA 2CZ1B 1IHVA 4PFZA 4C92C 1RACB 1WJQA 1TS9A 4F14A 4VUBA 2WSEE 2MWOA 3CCVA 2PVGB 1ZUUA 3CC7A 2VXFA 5EG2A 3CCMA 1V29B 4PJOE 3UWNA 3MKDA 3PVQA 2LQKA 3L2QA 2MOXA 1WI7A 9ATCB 2K9GA 2EAYA 2LNVA 3I56Q 2KYBA 1U5SA 1HK9A 4X9CA 4GBQA 5IHNA 2CT3A 4FSXA 1ZSZB 1DJ7B 2RQUA 4JRIA 1UECA 2GBQA 3I56A 3I35A 4PFOA 1VYTA 3FEOA 4EMHA 4IURA 1Y0MA 3M5AA 3L2UA 2COYA 4OGEA 5FU6B 4OVAA 3CBPA 1TUGB 1VQOT 2A7YA 1UGRB 2M9UA 2HEQA 3JCMX 1KQ2A 1WGSA 4LUDA 1WQWA 5KH6A 4LE9A 1JXMA 3LX7A 2EQKA 1Y96B 4CC4B 1VQ8Q 3HTRA 1G2BA 1AZEA 3X25B 2ZPIB 3QDRB 2VVKA 2DIQA 4QVCA 2COZA 5IH2A 1VQKT 3JB9F 4M78A 5GMKm 1YHQA 5I11A 2LNHB 4KH1B 2JMAA 3H0HA 3EG2A 1BI1A 1NM7A 1O9SA 1IZ6A 1W70A 2KK4A 3M0SA 1BK2A 2P0QA 1QCOA 5KYYA 2ED0A 4F17A 2EYZA 4C92D 1IXDA 1RLPC 2L3SA 5KYWA 1WXTA 1MMDA 3EG0A 1N9SA 1A0NB 3TEEA 3RKYA 1VYUA 2M51A 3V7SA 4AG2C 1VQ6A 2VC8A 1K9MU 3SWNB 4HCBA 3EHQA 2DMOA 4BI4A 3TVTA 4BB7A 5GMKh 1YWPA 4DA4A 2KDSA 1BB9A 3M0TA 2X4JA 3CMEQ 3CC4Q 1UGSB 5GAOm 4FCYA 2BZ8A 1WHHA 4D6WA 2XG8D 5LJ3g 2XDDA 3CCRT 4JZ3A 1D0XA 2M16A 2V1RA 3L2RA 2RQVA 3CMEA 1EX4A 2LT1A 4B6MA 2QA4Q 4EMKB 3MP8A 2KRNA 5KYNA 4C8QG 1S72A 2X4XA 1E6HA 1SEMA 1ZLMA 4DOWA 1BBZA 2VASA 2CREA 4J9DA 3NTHA 4QT7A 1WYXA 3E9FA 4HVWA 1ZSGA 2DD4A 1OI1A 3VU3C 2R57A 4C8QA 3C95A 5GAN2 4MDXA 3VUBA 4M7DB 3NTIA 2EJGA 4M75D 5LJ5j 1SF9A 1HD3A 1WX6A 2YHTA 3G6EQ 3CCJT 2DL4A 2L3PA 2HL3A 1U8RA 2L5QA 1RI9A 3IQLA 3JCMP 2FL7A 3OYNA 4M7AG 2R58A 2RJFA 3PFSA 1VQKA 3FC3A 3OS2A 1I8FA 4OMFB 4QKUA 1XJWB 5CKFA 1VQ7T 1Z9QA 2SRCA 2EW3A 2HSEB 3ZL7C 5GMKe 1BIBA 3CCEQ 3QWXX 1MMAA 1KSWA 4N4IA 1CKBA 4E6RA 2ENMA 1KD1C 1RABB 2FVUA 2CSQA 2DNUA 2VUBA 3VS0A 3OYEA 8AT1B 1G8XA 3QIIA 1H3ZA 1SHGA 2EFIA 1WNLA 1T0JA 2LMJA 1X75C 4A53A 4JRKA 3H6ZA 2J05A 3SEMA 2KY9A 2DTOA 3QO3A 4C0DC 4C8QE 3G71T 4OMPA 1UHFA 2RMOA 4JJDA 1PC0A 3MHXA 2AZVA 2C0OA 3HPWA 3VRYA 1K4US 1VQ9A 3JCMJ 3ER0A 2O4XB 2PVOB 1QVGA 5L8RE 4M78D 5DLOA 1M2OA 1VYVA 1N9RA 1Q81R 2JXBA 3EGUA 2Y4YA 2NWMA 2VGNA 1JQQA 4J6XA 2MPXC 1Y71A 1QVPA 3RDVA 3ZBDA 4PLLA 2AZSA 5KYUA 4CC2A 2FZKB 2PUKB 3H8ZA 5I2SA 2JM8A 3PVLA 3THKA 1M2VA 4QVDA 1VA7A 1HSQA 3OW2P 2JNGA 4JUVA 2HQXA 2GQIA 2ZCFB 2KVQG 1X01A 3CXCA 4BI8B 2BE7D 3REAB 3OYMA 4M77A 1AHJB 5GAN4 4V2SA 5KCOA 1PD1A 8ATCB 2DL7A 2YRVA 2XD0A 4OMLA 3OSSC 4F04B 2FRYA 3HRUA 4M77G 2A08A 2LDMA 2EWNA 4M78E 4PJOA 2E6ZA 5J3BA 4E7JA 4PJMA 3HFNA 4ESRA 2A37A 3CMAT 2LP5A 1FWZA 1VQMA 1ZA2B 4L6V5 3UPUA 5EC7A 2QQRA 3CCLA 3CCUT 2OTJA 1LJOA 4PNOA 2NLUA 3X20B 2QTVA 1FX7A 3ULRB 3M56A 3A98A 1RAGB 2DJZA 4OB2B 3GP8A 2VB6A 3JAME 3SFMA 1YJNQ 2DEQA 2RM4A 2XMFA 1MHNA 2J6OA 5GAN3 1WZOA 2FPFA 1D1CA 4M75B 1B7TA 2K3XA 4BE1A 4C92F 3JB9H 2SEMA 1SPKA 3JCMQ 2DJQA 2RN8A 4AMCA 3VS6A 1B3QA 4Z89A 2KYMA 2HL5C 1GCPA 2I0NA 4LNPA 1LNXA 2FG0A 3BDLA 1QKXA 4B9WA 2HSPA 1K8AR 4M78G 3WXMB 3TCJA 4RKUE 5CKBA 3CCST 1VQOQ 2RB6A 4FL6A 1JO8A 1ABQA 3CCRQ 1O75A 5GANf 4X9DA 1VQNA 2HQEA 4PLIA 1WIEA 2CGHA 2KGTA 4XU0A 3JB9G 1QP2A 3EHRA 4N4HA 4AG1C 5GAMf 1Z9ZA 1JXOA 4MZPA 2A3LA 3VYHB 3AHUA 2M1HA 1M90R 1Q7YU 5HCKA 1T0HA 3OYLA 2RHIA 2CP6A 5HK0A 4J9CA 3G4ST 1KQSS 4C5IA 3EGDA 2LRQA 2J6FA 4A4HA 2A28A 1K9MC 5AT1B 4O5VA 2FPDA 5LJ3h 2DVJA 1MV3A 2WACA 3OYKA 1TUDA 3TQ7P 3L42A 3PTAA 1TU0B 1UJ0A 3RKWA 4BY6B 2K79A 3NTKA 2KR3A 1YIJA 4A4EA 1JBMA 3M53A 1QVFA 2H8HA 5CR2A 1G83A 5GAOp 1HXDA 1I07A 2QTXA 2K2MA 3MEAA 1D3BA 2ATCB 1AWOA 2FB7A 4M75A 1PSFA 3CCET 5CO7A 4PK4A 1VQ8A 1B34A 4JLGA 2OX7A 4WCIA 2E5KA 1Y57A 2RK2A 1WXBA 2EQIA 3M0RA 1X27A 2YWWA 2YUPA 2XDBA 3P8HA 1VQ7A 1PSEA 2RNAA 1N8RC 4LDYA 1BI3A 4E7IA 3CCJQ 1NJIU 3A8HB 3PGGA 1UTIA 3C94A 2RF0A 1Y7XA 1YJWQ 3M57A 2E5QA 1WJRA 4RUGA 4XQ3A 1M90U 3CQTA 1JEGA 3OW2S 2LC4A 4M7AE 2ZAEA 4IIOA 3EG1A 4A54A 4XK8E 4FW2A 2KT1A 2IVWA 4M75C 5GJVB 4PKCC 3VYGA 3PIOA 3PE0A 1VQ9Q 2HQHA 3VUZA 1UFFA 2JTEA 2X4YA 2X51A 4R56A 2EYQA 3RIRA 2LCLA 2JTMA 3CMET 4IIMA 4CC3A 4IUTA 2DRKA 1ABOA 3M4GA 3JCMh 1JJ2A 2DFUA 2KE9A 2R5MA 1KC8C 2DBMA 4C5GA 3MEWA 1KK7A 1S1NA 3L2ZA 1W4SA 4UC4A 1YITT 2JUFA 2PTKA 2EGEA 3OBYA 3L2VA 2GTJA 2F5TX 1VQLT 4D8DA 4J9EA 2DX1A 2QEXQ 2EKOA 2XIDA 4OF1A 1OPKA 3C12A 4F7UF 2BIVA 4M4ZA 2ZPFB 2HAXA 3R6NA 1NPPA 3QYGB 1VQ8T 1PNJA 4R55A 2DIGA 1CSKA 4XU2A 1YIJT 5A0DA 1VQ5A 5FWCA 1YJ9A 3KBGA 4P5NA 1EZZB 2CS7A 3VS3A 5KE3A 2MK5A 2F1LA 2YSQA 1AWXA 3FJPA 1Q82R 3MCAB 3EH1A 4C0ZA 1YJ9Q 4RTVA 3SHWA 2QG9B 3JCMf 2KROA 2IPOB 3P8BB 4AT1B 2HBPA 1M1KC 3LH5A 2K57A 3EFSA 3CCUA 2E3HA 3GNGA 4IUVA 1VQNQ 4J83A 3EGXB
chains in the Genus database with same CATH topology
1WXUA 2LQWA 4X1VA 3EG3A 2D0NA 1UG1A 1QWEA 1Z9QA 1UE9A 1PKTA 2EW3A 2SRCA 3ZL7C 3QWXX 3VS7A 4JZ4A 2LJ3A 1KSWA 1UGVA 1OPLA 2CH4A 1CKBA 3REBB 4E6RA 2ENMA 4JPBW 2GGRA 3M0QA 2CSQA 2DNUA 1AWWA 1XOVA 3H41A 3VS0A 1N5ZA 5FWBA 1SHGA 2KBTA 4RTYA 1UJYA 1OV3A 1T0JA 2CUBA 2LMJA 2J6KA 2LQNA 3KFVA 2J05A 3SEMA 1MV0B 2DRMA 4RTTA 2KXCA 2C0TA 1PHTA 2D8JA 2AK5A 1GFCA 4OMPA 1UHFA 1KFZA 2O9VA 2RMOA 2JS0A 4JJDA 2F2WA 1CKAA 2AZVA 2C0OA 3VRYA 1K4US 1I0CA 2PNIA 5IXFA 1M8MA 2AKKA 1YNZA 4JJBA 3VRZA 5ECAA 1K0SA 1VYVA 3I5SA 4FSSA 1K76A 1AZGB 2O9SA 2JXBA 3EGUA 3UA6A 2JW4A 2NWMA 1JQQA 5L23A 1AD5A 2BZXA 1K9AA 5IHIA 1AWJA 1GBRA 2JS2A 1QKWA 1YWOA 2AZSA 2DM1A 2ROLA 4HVUA 2W10A 4CC2A 1GCQA 4Z8AA 2CT4A 2JM8A 3PVLA 3THKA 1ZUKA 1GL5A 1PRMC 2DILA 3H0FA 1AVZC 3C0CA 1VA7A 1WA7A 1HSQA 2O88A 1SSHA 3M0UA 4EIKA 1NYFA 5IHKA 2ROTA 4R0KA 1X6GA 1WDXA 4OMQA 1X43A 1ARKA 2GQIA 2NUZA 2KT8A 2DLPA 4KRTA 1NLPC 2L0AA 3VS2A 1YN8A 4OMMA 4HCKA 3REAB 1FYNA 2CUDA 1RUWA 2KRMA 2RQTA 2DL7A 1QCFA 3FJ5A 4OMLA 2L2PA 1HJDA 2LJ0A 2EBPA 1NG2A 2FRYA 2A08A 2O2OA 4AFUC 1OOTA 3GBQA 4Y92A 3U23A 1H92A 4ESRA 1W6XA 2A37A 2LP5A 1J3TA 1H3HA 4RTUA 2MCNA 1M30A 1ZBJA 3QWYA 3VS1A 5I22A 5EC7A 2KXDA 5GJWB 2EYWA 2DE0X 2YT6A 3VS4A 2LX7A 2CSIA 3ULRB 3A98A 1AOJA 2ECZA 3TSWA 2VWFA 1LCKA 1KJWA 1YP5A 2ED1A 1V1CA 2XMFA 2J6OA 2DBKA 4A63B 1WFWA 1QWFA 2FPFA 2YDLA 2KRSA 3NHNA 2HCKA 3UA7A 2SEMA 2CH4W 1SPKA 1M3CA 2DJQA 2RN8A 3VS6A 1B3QA 4Z89A 2GNCA 2JT4A 2KYMA 1GCPA 2I0NA 1MUZA 4LNPA 2FG0A 2D8HA 1K0XA 1SRLA 1ZUYA 1QKXA 5FW9A 1NEGA 1YCSB 2HSPA 1PKSA 4DEXA 4OMNA 1B07A 2KEAA 1FMKA 4J9FA 1M27C 1JO8A 1U06A 1ABQA 1K1ZA 1KIKA 1OEBA 1WIEA 3NGPA 2B86A 2M0YA 4HVVA 2KGTA 2EPDA 3I9QA 1M3AA 2EKHA 2KNBB 3RNJA 1QLYA 3EHRA 4J9HA 4AG1C 2J7IA 1T3SA 3JV3A 3UF4A 1Z9ZA 4RTWA 1JXOA 4J9BA 2BZYA 4J9GA 2O31A 4AFSC 3M0PA 1JU5C 5HCKA 1T0HA 2F2XA 4J9CA 1M3BA 1T3LA 2J06A 1RLQC 4HXJA 2DA9A 1EFNA 2J6FA 2RQWA 1GCQC 2A28A 2RQRA 2DL8A 2FPDA 2EYXA 2K6DA 3VS5A 1TUCA 2DVJA 1MV3A 2X3XD 1TUDA 3I5RA 1GFDA 4J9IA 1UJ0A 4F14A 2YUOA 2K3BA 2W0ZA 2K79A 2L3QA 2KR3A 1ZUUA 2H8HA 1G83A 2OJ2A 3PVQA 1I07A 1X6BA 1E7OA 1WI7A 2MOXA 2K2MA 2OI3A 2K9GA 2QDLA 2ESWA 1AWOA 2DYBA 2KYBA 1U5SA 2EGCA 1W1FA 2RPNA 1X69A 4GBQA 5IHNA 4LN2A 2CT3A 2RQUA 2V1QA 1UECA 2GBQA 4WCIA 2E5KA 2JMCA 3I35A 1Y57A 1WXBA 2EQIA 2FEIA 3M0RA 1I1JA 1X27A 1PWTA 2YUPA 1VYTA 1NLOC 2RNAA 4LUEA 1Y0MA 1IO6A 1UTIA 1TG0A 3UATA 2RF0A 4K11A 2EYYA 4RUGA 1AEYA 4Z88A 4AFZC 2DL3A 3CQTA 1JEGA 2HDAA 2HEQA 5IXBA 4LUDA 2JM9A 4IIOA 4LE9A 1JXMA 2EGAA 3EG1A 2LJ1A 4CC4B 2KT1A 4RTXA 5GJVB 1G2BA 1AZEA 1PRLC 2LZ6B 3PE0A 2FPEA 2VVKA 2K7AA 5IH2A 1NYGA 1UFFA 2JTEA 1X2QA 1UHCA 5I11A 2C0IA 2LNHB 2JMAA 3H0HA 3TSZA 1U3OA 3EG2A 1NM7A 2ABLA 1UDLA 1W70A 3NMZC 3M0SA 4ORZA 1BK2A 3NPFA 4IIMA 4CC3A 2DRKA 2DF6A 2ED0A 4F17A 1ABOA 2EYZA 2HBWA 4OMOA 2X3WD 1RLPC 2KE9A 2F2VA 2L3SA 1WXTA 3EG0A 1X2KA 1A0NB 2DBMA 1VYUA 2M51A 1S1NA 3O5ZA 4AG2C 2CDTA 2PTKA 2EGEA 2DL5A 3EHQA 2G6FX 2GTJA 2DMOA 3TVTA 1SHFA 3H0IA 4D8DA 1H8KA 4J9EA 1YWPA 4RTZA 1BB9A 3M0TA 2YUNA 2AKLA 2DX1A 2PZ1A 2GTOA 4F16A 2BZ8A 1OPKA 1NEBA 2FO0A 4M4ZA 4DEYA 2OAWA 3R6NA 4JZ3A 2V1RA 2RQVA 1BU1A 2VKNA 1WLPB 4AFQC 2KRNA 4ZNXA 1PNJA 1CSKA 1UUEA 4D8KA 1E6GA 1E6HA 1SEMA 1ZLMA 5FWCA 2LCSA 4CC7A 1SRMA 1BBZA 1ZX6A 2CREA 4J9DA 4QT7A 3VS3A 2EVRA 2MIOA 1WYXA 4HVWA 1ZSGA 2YSQA 1AWXA 2P4RA 2IIMA 2YUQA 1GBQA 2D1XA 4JJCA 4RTVA 2A36A 3SHWA 1HD3A 1WX6A 4GLMA 2DL4A 2L3PA 2KROA 1RI9A 3IQLA 2BTTA 3LH5A 1GRIA 2FRWA 3RBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXU A;  2LQW A;  4X1V A;  3EG3 A;  2D0N A;  1UG1 A;  1QWE A;  1Z9Q A;  1UE9 A;  1PKT A;  2EW3 A;  2SRC A;  3ZL7 C;  3QWX X;  3VS7 A;  4JZ4 A;  2LJ3 A;  1KSW A;  1UGV A;  1OPL A;  2CH4 A;  1CKB A;  3REB B;  4E6R A;  2ENM A;  4JPB W;  2GGR A;  3M0Q A;  2CSQ A;  2DNU A;  1AWW A;  1XOV A;  3H41 A;  3VS0 A;  1N5Z A;  5FWB A;  1SHG A;  2KBT A;  4RTY A;  1UJY A;  1OV3 A;  1T0J A;  2CUB A;  2LMJ A;  2J6K A;  2LQN A;  3KFV A;  2J05 A;  3SEM A;  1MV0 B;  2DRM A;  4RTT A;  2KXC A;  2C0T A;  1PHT A;  2D8J A;  2AK5 A;  1GFC A;  4OMP A;  1UHF A;  1KFZ A;  2O9V A;  2RMO A;  2JS0 A;  4JJD A;  2F2W A;  1CKA A;  2AZV A;  2C0O A;  3VRY A;  1K4U S;  1I0C A;  2PNI A;  5IXF A;  1M8M A;  2AKK A;  1YNZ A;  4JJB A;  3VRZ A;  5ECA A;  1K0S A;  1VYV A;  3I5S A;  4FSS A;  1K76 A;  1AZG B;  2O9S A;  2JXB A;  3EGU A;  3UA6 A;  2JW4 A;  2NWM A;  1JQQ A;  5L23 A;  1AD5 A;  2BZX A;  1K9A A;  5IHI A;  1AWJ A;  1GBR A;  2JS2 A;  1QKW A;  1YWO A;  2AZS A;  2DM1 A;  2ROL A;  4HVU A;  2W10 A;  4CC2 A;  1GCQ A;  4Z8A A;  2CT4 A;  2JM8 A;  3PVL A;  3THK A;  1ZUK A;  1GL5 A;  1PRM C;  2DIL A;  3H0F A;  1AVZ C;  3C0C A;  1VA7 A;  1WA7 A;  1HSQ A;  2O88 A;  1SSH A;  3M0U A;  4EIK A;  1NYF A;  5IHK A;  2ROT A;  4R0K A;  1X6G A;  1WDX A;  4OMQ A;  1X43 A;  1ARK A;  2GQI A;  2NUZ A;  2KT8 A;  2DLP A;  4KRT A;  1NLP C;  2L0A A;  3VS2 A;  1YN8 A;  4OMM A;  4HCK A;  3REA B;  1FYN A;  2CUD A;  1RUW A;  2KRM A;  2RQT A;  2DL7 A;  1QCF A;  3FJ5 A;  4OML A;  2L2P A;  1HJD A;  2LJ0 A;  2EBP A;  1NG2 A;  2FRY A;  2A08 A;  2O2O A;  4AFU C;  1OOT A;  3GBQ A;  4Y92 A;  3U23 A;  1H92 A;  4ESR A;  1W6X A;  2A37 A;  2LP5 A;  1J3T A;  1H3H A;  4RTU A;  2MCN A;  1M30 A;  1ZBJ A;  3QWY A;  3VS1 A;  5I22 A;  5EC7 A;  2KXD A;  5GJW B;  2EYW A;  2DE0 X;  2YT6 A;  3VS4 A;  2LX7 A;  2CSI A;  3ULR B;  3A98 A;  1AOJ A;  2ECZ A;  3TSW A;  2VWF A;  1LCK A;  1KJW A;  1YP5 A;  2ED1 A;  1V1C A;  2XMF A;  2J6O A;  2DBK A;  4A63 B;  1WFW A;  1QWF A;  2FPF A;  2YDL A;  2KRS A;  3NHN A;  2HCK A;  3UA7 A;  2SEM A;  2CH4 W;  1SPK A;  1M3C A;  2DJQ A;  2RN8 A;  3VS6 A;  1B3Q A;  4Z89 A;  2GNC A;  2JT4 A;  2KYM A;  1GCP A;  2I0N A;  1MUZ A;  4LNP A;  2FG0 A;  2D8H A;  1K0X A;  1SRL A;  1ZUY A;  1QKX A;  5FW9 A;  1NEG A;  1YCS B;  2HSP A;  1PKS A;  4DEX A;  4OMN A;  1B07 A;  2KEA A;  1FMK A;  4J9F A;  1M27 C;  1JO8 A;  1U06 A;  1ABQ A;  1K1Z A;  1KIK A;  1OEB A;  1WIE A;  3NGP A;  2B86 A;  2M0Y A;  4HVV A;  2KGT A;  2EPD A;  3I9Q A;  1M3A A;  2EKH A;  2KNB B;  3RNJ A;  1QLY A;  3EHR A;  4J9H A;  4AG1 C;  2J7I A;  1T3S A;  3JV3 A;  3UF4 A;  1Z9Z A;  4RTW A;  1JXO A;  4J9B A;  2BZY A;  4J9G A;  2O31 A;  4AFS C;  3M0P A;  1JU5 C;  5HCK A;  1T0H A;  2F2X A;  4J9C A;  1M3B A;  1T3L A;  2J06 A;  1RLQ C;  4HXJ A;  2DA9 A;  1EFN A;  2J6F A;  2RQW A;  1GCQ C;  2A28 A;  2RQR A;  2DL8 A;  2FPD A;  2EYX A;  2K6D A;  3VS5 A;  1TUC A;  2DVJ A;  1MV3 A;  2X3X D;  1TUD A;  3I5R A;  1GFD A;  4J9I A;  1UJ0 A;  4F14 A;  2YUO A;  2K3B A;  2W0Z A;  2K79 A;  2L3Q A;  2KR3 A;  1ZUU A;  2H8H A;  1G83 A;  2OJ2 A;  3PVQ A;  1I07 A;  1X6B A;  1E7O A;  1WI7 A;  2MOX A;  2K2M A;  2OI3 A;  2K9G A;  2QDL A;  2ESW A;  1AWO A;  2DYB A;  2KYB A;  1U5S A;  2EGC A;  1W1F A;  2RPN A;  1X69 A;  4GBQ A;  5IHN A;  4LN2 A;  2CT3 A;  2RQU A;  2V1Q A;  1UEC A;  2GBQ A;  4WCI A;  2E5K A;  2JMC A;  3I35 A;  1Y57 A;  1WXB A;  2EQI A;  2FEI A;  3M0R A;  1I1J A;  1X27 A;  1PWT A;  2YUP A;  1VYT A;  1NLO C;  2RNA A;  4LUE A;  1Y0M A;  1IO6 A;  1UTI A;  1TG0 A;  3UAT A;  2RF0 A;  4K11 A;  2EYY A;  4RUG A;  1AEY A;  4Z88 A;  4AFZ C;  2DL3 A;  3CQT A;  1JEG A;  2HDA A;  2HEQ A;  5IXB A;  4LUD A;  2JM9 A;  4IIO A;  4LE9 A;  1JXM A;  2EGA A;  3EG1 A;  2LJ1 A;  4CC4 B;  2KT1 A;  4RTX A;  5GJV B;  1G2B A;  1AZE A;  1PRL C;  2LZ6 B;  3PE0 A;  2FPE A;  2VVK A;  2K7A A;  5IH2 A;  1NYG A;  1UFF A;  2JTE A;  1X2Q A;  1UHC A;  5I11 A;  2C0I A;  2LNH B;  2JMA A;  3H0H A;  3TSZ A;  1U3O A;  3EG2 A;  1NM7 A;  2ABL A;  1UDL A;  1W70 A;  3NMZ C;  3M0S A;  4ORZ A;  1BK2 A;  3NPF A;  4IIM A;  4CC3 A;  2DRK A;  2DF6 A;  2ED0 A;  4F17 A;  1ABO A;  2EYZ A;  2HBW A;  4OMO A;  2X3W D;  1RLP C;  2KE9 A;  2F2V A;  2L3S A;  1WXT A;  3EG0 A;  1X2K A;  1A0N B;  2DBM A;  1VYU A;  2M51 A;  1S1N A;  3O5Z A;  4AG2 C;  2CDT A;  2PTK A;  2EGE A;  2DL5 A;  3EHQ A;  2G6F X;  2GTJ A;  2DMO A;  3TVT A;  1SHF A;  3H0I A;  4D8D A;  1H8K A;  4J9E A;  1YWP A;  4RTZ A;  1BB9 A;  3M0T A;  2YUN A;  2AKL A;  2DX1 A;  2PZ1 A;  2GTO A;  4F16 A;  2BZ8 A;  1OPK A;  1NEB A;  2FO0 A;  4M4Z A;  4DEY A;  2OAW A;  3R6N A;  4JZ3 A;  2V1R A;  2RQV A;  1BU1 A;  2VKN A;  1WLP B;  4AFQ C;  2KRN A;  4ZNX A;  1PNJ A;  1CSK A;  1UUE A;  4D8K A;  1E6G A;  1E6H A;  1SEM A;  1ZLM A;  5FWC A;  2LCS A;  4CC7 A;  1SRM A;  1BBZ A;  1ZX6 A;  2CRE A;  4J9D A;  4QT7 A;  3VS3 A;  2EVR A;  2MIO A;  1WYX A;  4HVW A;  1ZSG A;  2YSQ A;  1AWX A;  2P4R A;  2IIM A;  2YUQ A;  1GBQ A;  2D1X A;  4JJC A;  4RTV A;  2A36 A;  3SHW A;  1HD3 A;  1WX6 A;  4GLM A;  2DL4 A;  2L3P A;  2KRO A;  1RI9 A;  3IQL A;  2BTT A;  3LH5 A;  1GRI A;  2FRW A;  3RBB B; 
#chains in the Genus database with same CATH topology
 4X1V A;  3HHT B;  1TTH B;  4JDS A;  2RHU A;  2K2V A;  3CC2 Q;  2E65 A;  1UGV A;  4QVZ A;  4GY5 A;  3WVE B;  2CH4 A;  5KE2 A;  3EFO A;  4FM4 B;  5CQY A;  3CCE A;  2D9T A;  4JPB W;  2QDY B;  2GQV A;  3M0Q A;  1ZHI A;  5GAN d;  4LD6 A;  3H41 A;  3WVD B;  4XTZ A;  2COW A;  5GAN 7;  2QGF B;  1P92 A;  2CUB A;  1U1S A;  5FU7 B;  3EFR A;  1XQH A;  2PUO B;  2LQN A;  4RTT A;  2KXC A;  2EQM A;  2LVM A;  2Y90 A;  1WQ7 A;  2D8J A;  4FYY B;  1VQM Q;  4EMK A;  2XI9 A;  1CKA A;  4ZN3 A;  3E19 A;  2OTJ Q;  4E7Z A;  2PVD B;  2CP0 A;  3CCS A;  1M8M A;  1YNZ A;  4JJB A;  4LDW A;  3JB9 I;  2E70 A;  3VRZ A;  2GFA A;  1K0S A;  4KGV B;  1K76 A;  2O9S A;  4OB1 B;  1C6V X;  4C92 A;  1KD1 R;  2NUP A;  5L23 A;  1MGQ A;  4NL3 A;  3JCM b;  2K3Y A;  2NUT A;  1YWO A;  3QXE B;  4DQ2 A;  1IGQ A;  3OQ5 A;  1GL5 A;  1PRM C;  2CP5 A;  4M7D C;  5D6Y A;  1AVZ C;  4MZT A;  2MAM A;  3C0C A;  1WJS A;  2RJC A;  4XU3 A;  2VGM A;  2O88 A;  3CD6 T;  1SSH A;  1TOV A;  2BUD A;  1YJ9 T;  3OB9 A;  4KBM B;  1WHL A;  2Z0W A;  3OYI A;  1NYF A;  2KQW A;  4R0K A;  5IHK A;  3S3M A;  3HRS A;  1WPY A;  2PQW A;  1Q7Y C;  2NUZ A;  2KT8 A;  3VS2 A;  4KGZ B;  3OW2 A;  5C6S A;  3MP6 A;  2K4Y A;  3RR6 A;  2CUD A;  3CCR A;  3OYF A;  2KRM A;  1VQ5 T;  2RI3 A;  1QCF A;  1RAF B;  4NOY A;  1Q82 U;  1Y96 A;  2LJ0 A;  2QAS A;  2ZPH B;  4EDU A;  4Y92 A;  5I21 A;  1YHQ Q;  2QQB A;  1Q86 C;  3QBY A;  1ZSZ C;  2EQJ A;  2XHC A;  1H92 A;  2H3J A;  4C8Q F;  1H3H A;  2MCN A;  1OX8 A;  1ZBJ A;  1OUL A;  3E9G A;  3QWY A;  2BE9 B;  2LQ8 A;  2DO3 A;  4C0F A;  2FHD A;  3CCQ Q;  3CBM A;  2R5A A;  3VS4 A;  2LX7 A;  4M78 C;  3QPH A;  3DKM A;  4ELY C;  5GMK i;  1K73 R;  1YCY A;  1W2B S;  1VUB A;  4B9X A;  1VQO A;  1LCK A;  1KJW A;  4FIB A;  1V1C A;  2NUP B;  1W2B A;  3JCM W;  3EAE A;  3CCL Q;  2DBK A;  4A63 B;  2KMT A;  2YXY A;  5IT9 E;  5GAN e;  4FT2 A;  3S3N A;  3NHN A;  2HCK A;  3UA7 A;  2CH4 W;  3C4S A;  1NJI R;  2E12 A;  5KYX A;  5HY6 A;  5GAM e;  1NJI C;  4J5Y A;  2QEX A;  4J8O A;  2FZC B;  3GPL A;  5GAN j;  1VQ9 T;  1TXQ A;  1C0M A;  1M90 C;  1IHW A;  2XK0 A;  1SRL A;  1ZUY A;  5FW9 A;  1NEG A;  4IUQ A;  4ELZ C;  5KYX B;  3DLM A;  1PKS A;  4DEX A;  5HK3 A;  2V8I A;  2MI6 A;  4OMN A;  3A5Z B;  1YI2 Q;  1FMK A;  1M27 C;  2IG0 A;  3CC2 T;  1SG5 A;  3HSB A;  3OYA A;  1KIK A;  2XDP A;  3HKS A;  3JB9 J;  2B86 A;  4HVV A;  1KC8 R;  3S6W A;  2RD1 A;  3V8J A;  5CVI A;  1M3A A;  3G6E A;  2KNB B;  2DXU A;  3LGL A;  4J9H A;  1QVF S;  3JV3 A;  3UF4 A;  4NL2 A;  4HT9 A;  4J9G A;  3EGX A;  3CXC P;  2F5K A;  4FYX B;  2WSF E;  5DLQ E;  2F2X A;  4Q5W A;  3ZEH A;  3I56 T;  1VQP T;  2J06 A;  3G7Z A;  2V8K A;  4HXJ A;  5CIU A;  2DA9 A;  4BI3 A;  1GCQ C;  3BW1 A;  2DZ9 A;  2EYX A;  3QHS A;  1Q7Y R;  1IB8 A;  3CPW A;  5FU7 C;  1M8V A;  1GFD A;  2YUO A;  4PFP A;  2W0Z A;  2RI2 A;  3TRE A;  2M0O A;  2RI5 A;  1OQK A;  1VQ5 Q;  2G3R A;  4OB0 B;  5D7U A;  2DZC A;  2DXT A;  5C0M A;  1X6B A;  5DM7 R;  2OI3 A;  2QDL A;  1BCM A;  2ESW A;  3J80 E;  3RKX A;  2EGC A;  1QVF P;  4YTL A;  1W1F A;  3SDZ A;  4DBH A;  3RMQ A;  5GAM g;  1X69 A;  3UT1 A;  4LN2 A;  2NUT B;  3FLG A;  1IRX A;  2V1Q A;  2DYI A;  2JMC A;  2K5F A;  2ZPB B;  3ME9 A;  2FEI A;  2JTF A;  2MMP A;  1K73 C;  3CPW P;  1PD0 A;  3JSC A;  1NLO C;  4M7A B;  4LUE A;  4BAC A;  3PNW C;  3CC2 A;  4F7U A;  1NPR A;  1I5L A;  4M7A F;  2EYY A;  3CC7 T;  5DY9 A;  3A8L B;  1AEY A;  4Z88 A;  2DL3 A;  2HDA A;  1X6O A;  4HA8 A;  2YLB A;  4C92 G;  5IXB A;  3OY9 A;  4XTV A;  5AYF A;  1K8A U;  1PRL C;  1YJW A;  1BCO A;  3EG9 A;  3HFO A;  2P84 A;  2FPE A;  1U1T A;  1X2Q A;  3FIF A;  2C0I A;  3TSZ A;  2ABL A;  3L1A A;  1UDL A;  3NMZ C;  1RL2 A;  3EFO B;  2NYS A;  2QEX T;  4LXC A;  3L2W A;  1IRE B;  2A0F B;  4IUU A;  4E47 A;  3OS0 A;  3V7R A;  4KUI A;  4OMO A;  4ANJ A;  2X3W D;  4ZN1 A;  3G4S Q;  3F70 A;  1X2K A;  1LPL A;  3CCJ A;  1VIE A;  4BY6 C;  5GAO q;  3PIP A;  3O5Z A;  2YLC A;  4J7I A;  4J6W A;  2DL5 A;  2H3E B;  4RCB A;  1QW1 A;  2G6F X;  4BUG A;  2OTJ T;  1H8K A;  4HT8 A;  4RTZ A;  5LJ5 g;  2DXB A;  1N27 A;  5FLX E;  2GTO A;  2HD0 A;  4ZTF A;  1VQM T;  1S72 T;  3LW5 E;  1HYO A;  1W2B P;  2FO0 A;  2JOY A;  4DEY A;  2OAW A;  3ASK A;  3OYB A;  1C1A A;  2DTH A;  1G5V A;  1SSF A;  5GAM d;  1UUE A;  2PU9 B;  2L89 A;  4D8K A;  3CCV Q;  2LCS A;  3UDC A;  4JRP A;  3HP9 A;  2MIO A;  5LJ3 f;  2I2L A;  1FXX A;  4LDX A;  4CRI A;  1JB0 E;  2XIC A;  1MMN A;  4BDZ A;  3TU4 K;  2QQS A;  2HZY A;  1GBQ A;  2D1X A;  2LTO A;  1Q82 C;  2CP2 A;  4GLM A;  4OP0 A;  1EIF A;  2BTT A;  1Q86 U;  4HCZ A;  5LJ3 j;  3RBB B;  1IGU A;  1VQL Q;  1K9M R;  3BY7 A;  4NS5 A;  3LH0 A;  2K5L A;  3EG3 A;  2D0N A;  4JLI A;  1UG1 A;  1QWE A;  3QZ5 B;  3QZ9 B;  1PKT A;  2M02 A;  3VS7 A;  4JZ4 A;  5LJ5 h;  1OPL A;  5A0G A;  1RAH B;  3G1J A;  2ZZD A;  4IKF A;  1MND A;  2VXE A;  5CKH A;  1YFN A;  3CCU Q;  2GGR A;  2RO0 A;  1I5O B;  5FRM A;  2L8D A;  1AWW A;  5FWB A;  1FMV A;  1PCX A;  3LYI A;  3I55 Q;  1UJY A;  1OV3 A;  2RJE A;  2BKD N;  1Y07 A;  3PT9 A;  4EMG A;  3LWI A;  4KT0 E;  4ZGJ B;  2DRM A;  4RCC A;  1QP3 A;  3J81 E;  2C0T A;  3KXT A;  1GFC A;  3R6O A;  1QCN A;  2EQU A;  4PJL A;  2JS0 A;  3I55 T;  1RAE B;  2CZ7 B;  1I0C A;  1G3W A;  5IXF A;  5LJ5 e;  5ECA A;  1FMW A;  3P8D A;  1YIT Q;  1AZG B;  4C5H A;  4XAX B;  2JW4 A;  3MP1 A;  3HRT A;  1VQ4 Q;  2BZX A;  1K9A A;  1AWJ A;  1ACM B;  4HKE A;  1B34 B;  4DBF A;  2ROL A;  4ATO A;  1VQN T;  2RHZ A;  2W10 A;  2JZ2 A;  1SKU B;  3OMC A;  2EJ9 A;  5GAO n;  1M1G A;  4FW1 A;  1Q81 U;  1ZUK A;  3H0F A;  3MEV A;  1WA7 A;  1D3B B;  1VQ4 T;  7AT1 B;  2EJF A;  4KUD K;  3OA6 A;  2ROT A;  1X6G A;  1WDX A;  1X43 A;  1ARK A;  4DOV A;  4RMO A;  4PJO B;  2MF2 A;  4KRT A;  2DLP A;  1N8R R;  1NLP C;  2L0A A;  1YN8 A;  2YRC A;  1FYN A;  4JJN K;  2YRD A;  1WHM A;  4PJO C;  2DK3 A;  2RQT A;  4QW2 A;  2QA4 T;  2L2P A;  1HJD A;  1YJW T;  4XTW A;  4AFU C;  1OYX A;  3GBQ A;  3EGD B;  2KI7 A;  1M9S A;  3U23 A;  1OU9 A;  1YBY A;  1J3T A;  4RTU A;  1D09 B;  1QVG P;  2JN0 A;  1YJN T;  3LGF A;  3VS1 A;  1OZ3 A;  3RUX A;  2KXD A;  5GJW B;  2YT6 A;  1OZ2 A;  2P0K A;  3OYY A;  4PJN A;  2GF7 A;  2ZPG B;  5KYU B;  2CP7 A;  4II1 A;  3QDF A;  3OBW A;  1WHG A;  1XTD A;  3CMA A;  4WTO B;  1VQ7 Q;  3JRZ A;  5GAN 6;  2ECZ A;  3TSW A;  2F69 A;  2VWF A;  2ED1 A;  5D6X A;  3NFC A;  2E4H A;  4Y28 E;  1BI2 A;  4LDU A;  1WFW A;  4C8Q C;  2YDL A;  3G71 Q;  1MNE A;  1K73 U;  2O4X A;  3A1P A;  4ME7 A;  1N6A A;  1M3C A;  1BIA A;  3X26 B;  2RJD A;  2HNI A;  4KGX B;  3CCS Q;  2JT4 A;  3OMG A;  4MMK A;  2WSC E;  1MMG A;  1VQ6 T;  3J7A F;  2D8H A;  3QJY A;  1YCS B;  2VV5 A;  3DB3 A;  4M7A C;  5GMK l;  1KC8 U;  1VQ6 Q;  1JRI A;  5HKC A;  3JCM d;  1RAD B;  1KQS A;  2B8A A;  2KEA A;  4XTU A;  4QQ6 A;  1U06 A;  1K1Z A;  4PJO D;  3AT1 B;  2AT1 B;  3V7C A;  2X9H A;  2EPD A;  3CC4 T;  4MZM A;  4O6J A;  3RES A;  1VQP A;  1Q86 R;  3RNJ A;  2D0Q B;  2J7I A;  1KHC A;  4J6Y A;  4C5E A;  4RTW A;  4J7F A;  4J9B A;  3QKJ A;  4CI0 C;  2O31 A;  3BDU A;  2QQ9 A;  3M0P A;  2V26 A;  1JU5 C;  4HCC A;  1ZQ1 A;  3CXC S;  2CZ6 B;  4RG2 A;  4QQD A;  1T3L A;  1LVK A;  1RLQ C;  2FZG B;  2RQW A;  2KAF A;  3KUF A;  1M1K R;  1G3S A;  2DL8 A;  2K6D A;  4EPC A;  1D0Y A;  3A8M B;  3CPF A;  3EG9 B;  2DET A;  2X3X D;  2ZGW A;  4M77 B;  3I5R A;  4ZGE B;  4M7D G;  4J9I A;  4MML A;  3I55 A;  2K3B A;  4FYV B;  1M1K U;  3CBO A;  2L3Q A;  3Q1J A;  4C0D B;  4TVR A;  5CAI A;  4BD3 A;  2AIR B;  4ZGD B;  1PM3 A;  4M77 D;  2OJ2 A;  3OYG A;  1E7O A;  4DBQ A;  4C8Q D;  2DKG A;  3M59 A;  1M2V B;  2DYB A;  5CQX A;  1I81 A;  3PMT A;  5LJ3 e;  2RPN A;  1UGP B;  2P0P A;  1F1B B;  2X35 A;  1WHJ A;  4M7A D;  3SWN A;  4EMK C;  3RER A;  4M75 E;  4E7H A;  4JRQ A;  1I1J A;  1PWT A;  3FB9 A;  4M7D D;  4Z02 A;  2Y4X A;  5KYW B;  3G6E T;  4PJO G;  1IO6 A;  1TG0 A;  3UAT A;  1G3T A;  4F7U E;  4K11 A;  2OTL A;  2E3I A;  1R8O B;  1VQK Q;  4AFZ C;  1D0Z A;  1NE8 A;  1QMC A;  5IN1 A;  2JM9 A;  2FYK A;  4OGC A;  2EGA A;  2QK0 A;  2LJ1 A;  1M4Z A;  4RTX A;  2JVV A;  4BE0 A;  2LZ6 B;  1I4K 1;  2K7A A;  1XNI A;  1NYG A;  1UHC A;  5FRN A;  3JCM e;  2RA2 A;  3QUI A;  1U3O A;  1R0B G;  3VJP A;  3N5B B;  5LL6 S;  4XTX A;  4ORZ A;  4PJO F;  3NPF A;  5J39 A;  4M78 F;  2DF6 A;  2HBW A;  1GXI E;  4LDV A;  3JCM V;  5FRO A;  2C06 A;  2F2V A;  1QVG S;  3CC4 A;  5I2M A;  1BYM A;  1M1F A;  4FU6 A;  1OX9 A;  3S3O A;  1AT1 B;  3DLL A;  3GLX A;  2CDT A;  5M9O A;  4Y91 A;  1ZSZ A;  1OU8 A;  3M55 A;  3OYH A;  4BDY A;  4M7D A;  1SHF A;  3H0I A;  3CMA Q;  3MPU B;  4C8Q B;  3M9Q A;  3OSV A;  2HKQ B;  2YUN A;  2AKL A;  2PZ1 A;  3D7S B;  4F16 A;  1Q81 C;  1Q95 G;  4C92 E;  4QQG A;  2QA4 A;  1NEB A;  3V8K A;  1BU1 A;  2VKN A;  2L3R A;  1WLP B;  1ZBX A;  4AFQ C;  4E7L A;  2CKK A;  5A0L A;  4ZNX A;  4N0A C;  3X24 B;  4KUL A;  2KSS A;  1WHK A;  1E6G A;  1TWB A;  4CC7 A;  1SRM A;  1ZX6 A;  3BE3 A;  1NBE B;  2EVR A;  3M58 A;  3M54 A;  3GNF B;  5D6W A;  4FYW B;  3CC7 Q;  4C0G A;  2E41 A;  2P4R A;  3QG1 A;  3LWH A;  4PL6 A;  2IIM A;  2YUQ A;  2E6N A;  2LT4 A;  4JJC A;  2A36 A;  5CKD A;  2EIF A;  3E1S A;  5GMK j;  1GRI A;  2FRW A;  4JS4 A;  4PJJ A;  1WXU A;  2LQW A;  1LOJ A;  4E7S A;  3LLR A;  1UE9 A;  3OYJ A;  5KYY B;  1UGQ B;  5LJ5 f;  2LJ3 A;  1ZA1 B;  3JCM g;  1VIF A;  1G3Y A;  3QJ6 A;  1YI2 T;  4E2F B;  5LJ3 d;  5CCA A;  4BE2 A;  3REB B;  2E64 A;  5GAM h;  3CCV T;  2RHY A;  1XOV A;  4M75 G;  4N0A A;  1N5Z A;  4M78 B;  2QI2 A;  5A2Q E;  2KBT A;  4RTY A;  3CD6 A;  2CYZ B;  1D1B A;  2J6K A;  2O01 E;  5J26 A;  3V8L A;  2HKN A;  5GAN h;  3KFV A;  3EH2 A;  1MV0 B;  1N8R U;  2DVE A;  3MET A;  1PHT A;  3GOX A;  2AK5 A;  1BKB A;  1KFZ A;  2O9V A;  2F2W A;  1YI2 A;  2GCX A;  3O8V A;  2PNI A;  1TH7 A;  2AKK A;  1PG5 B;  5GAN g;  2AHJ B;  3I5S A;  1VQP Q;  4FSS A;  1TSF A;  3PMI A;  2ZPE B;  3UA6 A;  4DBR A;  1KQ1 A;  3CCQ T;  5LJ5 d;  1AD5 A;  2QAZ A;  2CP3 A;  4A4F A;  5IHI A;  2GFU A;  1GBR A;  2JS2 A;  1QKW A;  1V76 A;  2DM1 A;  3VKI A;  3ZFJ A;  4HVU A;  3M4Y A;  4GLK A;  1GCQ A;  4Z8A A;  4KH0 B;  2CT4 A;  1VOM A;  4C92 B;  2K5I A;  3BFM A;  2DPP B;  1QQJ A;  2DIL A;  3OS1 A;  2X4W A;  4LD9 K;  3CCM Q;  3H9N A;  2QGG A;  3T9N A;  3HL8 A;  3M0U A;  2E10 A;  4EIK A;  2MYS A;  4OMQ A;  3G4S A;  5FU6 C;  4RG8 A;  2OTL Q;  4OMM A;  4XTY A;  4WF2 A;  3CPW S;  2LX9 A;  4HCK A;  2DXC A;  1RAI B;  4L5G A;  1BI0 A;  1RUW A;  2XKO C;  3A8G B;  3MEU A;  1RAA B;  4JS5 A;  1KQS P;  2VYT A;  3FJ5 A;  3FRN A;  3QYH B;  2EBP A;  3CEY A;  1NG2 A;  5CKE A;  3OYD A;  2O2O A;  2QXF A;  1OOT A;  1R0C B;  1S72 Q;  4FT4 A;  2DD5 A;  1D1A A;  3URG A;  5KCH A;  1RI0 A;  1W6X A;  2MWP A;  3FDR A;  2RHX A;  2QYZ A;  1M30 A;  2DTI A;  6AT1 B;  5I22 A;  4F7U B;  2EYW A;  4N4G A;  4E7K A;  2DE0 X;  4M7A A;  3GF5 A;  4M77 C;  3E2U A;  2DEU A;  2CSI A;  1KD1 U;  4IUP A;  1K8A C;  2DAQ A;  1AOJ A;  2JJ9 A;  1YP5 A;  1R77 A;  4OB3 B;  2V8J A;  3VV0 A;  2OAU A;  3GIB A;  3OS5 A;  1QWF A;  3MJX A;  1M5Q 1;  4MDW A;  2KRS A;  1YHQ T;  4X34 A;  4M75 F;  4M7D F;  1JJ2 P;  1KHI A;  1KG1 A;  5GAO l;  1VQL A;  2GNC A;  1MUZ A;  3SB2 A;  4F7U G;  2LCC A;  1YIT A;  3INZ A;  2D6F A;  5GAO r;  1K0X A;  3G71 A;  2QQA A;  1H64 1;  2HMA A;  2XU8 A;  4ZTJ A;  1YIJ Q;  3JB9 D;  2OTL T;  4L59 A;  3A8O B;  2RK1 A;  3X28 B;  1B07 A;  3QSU A;  4A4G A;  2DER A;  1YJN A;  3SD4 A;  4J9F A;  5CK9 A;  1UEB A;  2E1H A;  1OEB A;  3CCM T;  1NZ9 A;  3CD6 Q;  3NGP A;  2M0Y A;  3I9Q A;  3SWN C;  5IAY A;  2EKH A;  4XU1 A;  3CCL T;  1QLY A;  5GAN 5;  1T3S A;  5GAN 8;  3DB4 A;  3JCM c;  2BZY A;  2P4T A;  2CZ0 B;  4A4K A;  1UB4 A;  4AFS C;  1JJ2 S;  3RMS A;  3MO8 A;  4M7D E;  1M3B A;  4M77 E;  1EFN A;  3CCQ A;  2RH2 A;  5GAM j;  2RQR A;  3OYC A;  1VQ4 A;  4M77 F;  3VS5 A;  1TUC A;  2CZ1 B;  1IHV A;  4PFZ A;  4C92 C;  1RAC B;  1WJQ A;  1TS9 A;  4F14 A;  4VUB A;  2WSE E;  2MWO A;  3CCV A;  2PVG B;  1ZUU A;  3CC7 A;  2VXF A;  5EG2 A;  3CCM A;  1V29 B;  4PJO E;  3UWN A;  3MKD A;  3PVQ A;  2LQK A;  3L2Q A;  2MOX A;  1WI7 A;  9ATC B;  2K9G A;  2EAY A;  2LNV A;  3I56 Q;  2KYB A;  1U5S A;  1HK9 A;  4X9C A;  4GBQ A;  5IHN A;  2CT3 A;  4FSX A;  1ZSZ B;  1DJ7 B;  2RQU A;  4JRI A;  1UEC A;  2GBQ A;  3I56 A;  3I35 A;  4PFO A;  1VYT A;  3FEO A;  4EMH A;  4IUR A;  1Y0M A;  3M5A A;  3L2U A;  2COY A;  4OGE A;  5FU6 B;  4OVA A;  3CBP A;  1TUG B;  1VQO T;  2A7Y A;  1UGR B;  2M9U A;  2HEQ A;  3JCM X;  1KQ2 A;  1WGS A;  4LUD A;  1WQW A;  5KH6 A;  4LE9 A;  1JXM A;  3LX7 A;  2EQK A;  1Y96 B;  4CC4 B;  1VQ8 Q;  3HTR A;  1G2B A;  1AZE A;  3X25 B;  2ZPI B;  3QDR B;  2VVK A;  2DIQ A;  4QVC A;  2COZ A;  5IH2 A;  1VQK T;  3JB9 F;  4M78 A;  5GMK m;  1YHQ A;  5I11 A;  2LNH B;  4KH1 B;  2JMA A;  3H0H A;  3EG2 A;  1BI1 A;  1NM7 A;  1O9S A;  1IZ6 A;  1W70 A;  2KK4 A;  3M0S A;  1BK2 A;  2P0Q A;  1QCO A;  5KYY A;  2ED0 A;  4F17 A;  2EYZ A;  4C92 D;  1IXD A;  1RLP C;  2L3S A;  5KYW A;  1WXT A;  1MMD A;  3EG0 A;  1N9S A;  1A0N B;  3TEE A;  3RKY A;  1VYU A;  2M51 A;  3V7S A;  4AG2 C;  1VQ6 A;  2VC8 A;  1K9M U;  3SWN B;  4HCB A;  3EHQ A;  2DMO A;  4BI4 A;  3TVT A;  4BB7 A;  5GMK h;  1YWP A;  4DA4 A;  2KDS A;  1BB9 A;  3M0T A;  2X4J A;  3CME Q;  3CC4 Q;  1UGS B;  5GAO m;  4FCY A;  2BZ8 A;  1WHH A;  4D6W A;  2XG8 D;  5LJ3 g;  2XDD A;  3CCR T;  4JZ3 A;  1D0X A;  2M16 A;  2V1R A;  3L2R A;  2RQV A;  3CME A;  1EX4 A;  2LT1 A;  4B6M A;  2QA4 Q;  4EMK B;  3MP8 A;  2KRN A;  5KYN A;  4C8Q G;  1S72 A;  2X4X A;  1E6H A;  1SEM A;  1ZLM A;  4DOW A;  1BBZ A;  2VAS A;  2CRE A;  4J9D A;  3NTH A;  4QT7 A;  1WYX A;  3E9F A;  4HVW A;  1ZSG A;  2DD4 A;  1OI1 A;  3VU3 C;  2R57 A;  4C8Q A;  3C95 A;  5GAN 2;  4MDX A;  3VUB A;  4M7D B;  3NTI A;  2EJG A;  4M75 D;  5LJ5 j;  1SF9 A;  1HD3 A;  1WX6 A;  2YHT A;  3G6E Q;  3CCJ T;  2DL4 A;  2L3P A;  2HL3 A;  1U8R A;  2L5Q A;  1RI9 A;  3IQL A;  3JCM P;  2FL7 A;  3OYN A;  4M7A G;  2R58 A;  2RJF A;  3PFS A;  1VQK A;  3FC3 A;  3OS2 A;  1I8F A;  4OMF B;  4QKU A;  1XJW B;  5CKF A;  1VQ7 T;  1Z9Q A;  2SRC A;  2EW3 A;  2HSE B;  3ZL7 C;  5GMK e;  1BIB A;  3CCE Q;  3QWX X;  1MMA A;  1KSW A;  4N4I A;  1CKB A;  4E6R A;  2ENM A;  1KD1 C;  1RAB B;  2FVU A;  2CSQ A;  2DNU A;  2VUB A;  3VS0 A;  3OYE A;  8AT1 B;  1G8X A;  3QII A;  1H3Z A;  1SHG A;  2EFI A;  1WNL A;  1T0J A;  2LMJ A;  1X75 C;  4A53 A;  4JRK A;  3H6Z A;  2J05 A;  3SEM A;  2KY9 A;  2DTO A;  3QO3 A;  4C0D C;  4C8Q E;  3G71 T;  4OMP A;  1UHF A;  2RMO A;  4JJD A;  1PC0 A;  3MHX A;  2AZV A;  2C0O A;  3HPW A;  3VRY A;  1K4U S;  1VQ9 A;  3JCM J;  3ER0 A;  2O4X B;  2PVO B;  1QVG A;  5L8R E;  4M78 D;  5DLO A;  1M2O A;  1VYV A;  1N9R A;  1Q81 R;  2JXB A;  3EGU A;  2Y4Y A;  2NWM A;  2VGN A;  1JQQ A;  4J6X A;  2MPX C;  1Y71 A;  1QVP A;  3RDV A;  3ZBD A;  4PLL A;  2AZS A;  5KYU A;  4CC2 A;  2FZK B;  2PUK B;  3H8Z A;  5I2S A;  2JM8 A;  3PVL A;  3THK A;  1M2V A;  4QVD A;  1VA7 A;  1HSQ A;  3OW2 P;  2JNG A;  4JUV A;  2HQX A;  2GQI A;  2ZCF B;  2KVQ G;  1X01 A;  3CXC A;  4BI8 B;  2BE7 D;  3REA B;  3OYM A;  4M77 A;  1AHJ B;  5GAN 4;  4V2S A;  5KCO A;  1PD1 A;  8ATC B;  2DL7 A;  2YRV A;  2XD0 A;  4OML A;  3OSS C;  4F04 B;  2FRY A;  3HRU A;  4M77 G;  2A08 A;  2LDM A;  2EWN A;  4M78 E;  4PJO A;  2E6Z A;  5J3B A;  4E7J A;  4PJM A;  3HFN A;  4ESR A;  2A37 A;  3CMA T;  2LP5 A;  1FWZ A;  1VQM A;  1ZA2 B;  4L6V 5;  3UPU A;  5EC7 A;  2QQR A;  3CCL A;  3CCU T;  2OTJ A;  1LJO A;  4PNO A;  2NLU A;  3X20 B;  2QTV A;  1FX7 A;  3ULR B;  3M56 A;  3A98 A;  1RAG B;  2DJZ A;  4OB2 B;  3GP8 A;  2VB6 A;  3JAM E;  3SFM A;  1YJN Q;  2DEQ A;  2RM4 A;  2XMF A;  1MHN A;  2J6O A;  5GAN 3;  1WZO A;  2FPF A;  1D1C A;  4M75 B;  1B7T A;  2K3X A;  4BE1 A;  4C92 F;  3JB9 H;  2SEM A;  1SPK A;  3JCM Q;  2DJQ A;  2RN8 A;  4AMC A;  3VS6 A;  1B3Q A;  4Z89 A;  2KYM A;  2HL5 C;  1GCP A;  2I0N A;  4LNP A;  1LNX A;  2FG0 A;  3BDL A;  1QKX A;  4B9W A;  2HSP A;  1K8A R;  4M78 G;  3WXM B;  3TCJ A;  4RKU E;  5CKB A;  3CCS T;  1VQO Q;  2RB6 A;  4FL6 A;  1JO8 A;  1ABQ A;  3CCR Q;  1O75 A;  5GAN f;  4X9D A;  1VQN A;  2HQE A;  4PLI A;  1WIE A;  2CGH A;  2KGT A;  4XU0 A;  3JB9 G;  1QP2 A;  3EHR A;  4N4H A;  4AG1 C;  5GAM f;  1Z9Z A;  1JXO A;  4MZP A;  2A3L A;  3VYH B;  3AHU A;  2M1H A;  1M90 R;  1Q7Y U;  5HCK A;  1T0H A;  3OYL A;  2RHI A;  2CP6 A;  5HK0 A;  4J9C A;  3G4S T;  1KQS S;  4C5I A;  3EGD A;  2LRQ A;  2J6F A;  4A4H A;  2A28 A;  1K9M C;  5AT1 B;  4O5V A;  2FPD A;  5LJ3 h;  2DVJ A;  1MV3 A;  2WAC A;  3OYK A;  1TUD A;  3TQ7 P;  3L42 A;  3PTA A;  1TU0 B;  1UJ0 A;  3RKW A;  4BY6 B;  2K79 A;  3NTK A;  2KR3 A;  1YIJ A;  4A4E A;  1JBM A;  3M53 A;  1QVF A;  2H8H A;  5CR2 A;  1G83 A;  5GAO p;  1HXD A;  1I07 A;  2QTX A;  2K2M A;  3MEA A;  1D3B A;  2ATC B;  1AWO A;  2FB7 A;  4M75 A;  1PSF A;  3CCE T;  5CO7 A;  4PK4 A;  1VQ8 A;  1B34 A;  4JLG A;  2OX7 A;  4WCI A;  2E5K A;  1Y57 A;  2RK2 A;  1WXB A;  2EQI A;  3M0R A;  1X27 A;  2YWW A;  2YUP A;  2XDB A;  3P8H A;  1VQ7 A;  1PSE A;  2RNA A;  1N8R C;  4LDY A;  1BI3 A;  4E7I A;  3CCJ Q;  1NJI U;  3A8H B;  3PGG A;  1UTI A;  3C94 A;  2RF0 A;  1Y7X A;  1YJW Q;  3M57 A;  2E5Q A;  1WJR A;  4RUG A;  4XQ3 A;  1M90 U;  3CQT A;  1JEG A;  3OW2 S;  2LC4 A;  4M7A E;  2ZAE A;  4IIO A;  3EG1 A;  4A54 A;  4XK8 E;  4FW2 A;  2KT1 A;  2IVW A;  4M75 C;  5GJV B;  4PKC C;  3VYG A;  3PIO A;  3PE0 A;  1VQ9 Q;  2HQH A;  3VUZ A;  1UFF A;  2JTE A;  2X4Y A;  2X51 A;  4R56 A;  2EYQ A;  3RIR A;  2LCL A;  2JTM A;  3CME T;  4IIM A;  4CC3 A;  4IUT A;  2DRK A;  1ABO A;  3M4G A;  3JCM h;  1JJ2 A;  2DFU A;  2KE9 A;  2R5M A;  1KC8 C;  2DBM A;  4C5G A;  3MEW A;  1KK7 A;  1S1N A;  3L2Z A;  1W4S A;  4UC4 A;  1YIT T;  2JUF A;  2PTK A;  2EGE A;  3OBY A;  3L2V A;  2GTJ A;  2F5T X;  1VQL T;  4D8D A;  4J9E A;  2DX1 A;  2QEX Q;  2EKO A;  2XID A;  4OF1 A;  1OPK A;  3C12 A;  4F7U F;  2BIV A;  4M4Z A;  2ZPF B;  2HAX A;  3R6N A;  1NPP A;  3QYG B;  1VQ8 T;  1PNJ A;  4R55 A;  2DIG A;  1CSK A;  4XU2 A;  1YIJ T;  5A0D A;  1VQ5 A;  5FWC A;  1YJ9 A;  3KBG A;  4P5N A;  1EZZ B;  2CS7 A;  3VS3 A;  5KE3 A;  2MK5 A;  2F1L A;  2YSQ A;  1AWX A;  3FJP A;  1Q82 R;  3MCA B;  3EH1 A;  4C0Z A;  1YJ9 Q;  4RTV A;  3SHW A;  2QG9 B;  3JCM f;  2KRO A;  2IPO B;  3P8B B;  4AT1 B;  2HBP A;  1M1K C;  3LH5 A;  2K57 A;  3EFS A;  3CCU A;  2E3H A;  3GNG A;  4IUV A;  1VQN Q;  4J83 A;  3EGX B; 
#chains in the Genus database with same CATH homology
 1WXU A;  2LQW A;  4X1V A;  3EG3 A;  2D0N A;  1UG1 A;  1QWE A;  1Z9Q A;  1UE9 A;  1PKT A;  2EW3 A;  2SRC A;  3ZL7 C;  3QWX X;  3VS7 A;  4JZ4 A;  2LJ3 A;  1KSW A;  1UGV A;  1OPL A;  2CH4 A;  1CKB A;  3REB B;  4E6R A;  2ENM A;  4JPB W;  2GGR A;  3M0Q A;  2CSQ A;  2DNU A;  1AWW A;  1XOV A;  3H41 A;  3VS0 A;  1N5Z A;  5FWB A;  1SHG A;  2KBT A;  4RTY A;  1UJY A;  1OV3 A;  1T0J A;  2CUB A;  2LMJ A;  2J6K A;  2LQN A;  3KFV A;  2J05 A;  3SEM A;  1MV0 B;  2DRM A;  4RTT A;  2KXC A;  2C0T A;  1PHT A;  2D8J A;  2AK5 A;  1GFC A;  4OMP A;  1UHF A;  1KFZ A;  2O9V A;  2RMO A;  2JS0 A;  4JJD A;  2F2W A;  1CKA A;  2AZV A;  2C0O A;  3VRY A;  1K4U S;  1I0C A;  2PNI A;  5IXF A;  1M8M A;  2AKK A;  1YNZ A;  4JJB A;  3VRZ A;  5ECA A;  1K0S A;  1VYV A;  3I5S A;  4FSS A;  1K76 A;  1AZG B;  2O9S A;  2JXB A;  3EGU A;  3UA6 A;  2JW4 A;  2NWM A;  1JQQ A;  5L23 A;  1AD5 A;  2BZX A;  1K9A A;  5IHI A;  1AWJ A;  1GBR A;  2JS2 A;  1QKW A;  1YWO A;  2AZS A;  2DM1 A;  2ROL A;  4HVU A;  2W10 A;  4CC2 A;  1GCQ A;  4Z8A A;  2CT4 A;  2JM8 A;  3PVL A;  3THK A;  1ZUK A;  1GL5 A;  1PRM C;  2DIL A;  3H0F A;  1AVZ C;  3C0C A;  1VA7 A;  1WA7 A;  1HSQ A;  2O88 A;  1SSH A;  3M0U A;  4EIK A;  1NYF A;  5IHK A;  2ROT A;  4R0K A;  1X6G A;  1WDX A;  4OMQ A;  1X43 A;  1ARK A;  2GQI A;  2NUZ A;  2KT8 A;  2DLP A;  4KRT A;  1NLP C;  2L0A A;  3VS2 A;  1YN8 A;  4OMM A;  4HCK A;  3REA B;  1FYN A;  2CUD A;  1RUW A;  2KRM A;  2RQT A;  2DL7 A;  1QCF A;  3FJ5 A;  4OML A;  2L2P A;  1HJD A;  2LJ0 A;  2EBP A;  1NG2 A;  2FRY A;  2A08 A;  2O2O A;  4AFU C;  1OOT A;  3GBQ A;  4Y92 A;  3U23 A;  1H92 A;  4ESR A;  1W6X A;  2A37 A;  2LP5 A;  1J3T A;  1H3H A;  4RTU A;  2MCN A;  1M30 A;  1ZBJ A;  3QWY A;  3VS1 A;  5I22 A;  5EC7 A;  2KXD A;  5GJW B;  2EYW A;  2DE0 X;  2YT6 A;  3VS4 A;  2LX7 A;  2CSI A;  3ULR B;  3A98 A;  1AOJ A;  2ECZ A;  3TSW A;  2VWF A;  1LCK A;  1KJW A;  1YP5 A;  2ED1 A;  1V1C A;  2XMF A;  2J6O A;  2DBK A;  4A63 B;  1WFW A;  1QWF A;  2FPF A;  2YDL A;  2KRS A;  3NHN A;  2HCK A;  3UA7 A;  2SEM A;  2CH4 W;  1SPK A;  1M3C A;  2DJQ A;  2RN8 A;  3VS6 A;  1B3Q A;  4Z89 A;  2GNC A;  2JT4 A;  2KYM A;  1GCP A;  2I0N A;  1MUZ A;  4LNP A;  2FG0 A;  2D8H A;  1K0X A;  1SRL A;  1ZUY A;  1QKX A;  5FW9 A;  1NEG A;  1YCS B;  2HSP A;  1PKS A;  4DEX A;  4OMN A;  1B07 A;  2KEA A;  1FMK A;  4J9F A;  1M27 C;  1JO8 A;  1U06 A;  1ABQ A;  1K1Z A;  1KIK A;  1OEB A;  1WIE A;  3NGP A;  2B86 A;  2M0Y A;  4HVV A;  2KGT A;  2EPD A;  3I9Q A;  1M3A A;  2EKH A;  2KNB B;  3RNJ A;  1QLY A;  3EHR A;  4J9H A;  4AG1 C;  2J7I A;  1T3S A;  3JV3 A;  3UF4 A;  1Z9Z A;  4RTW A;  1JXO A;  4J9B A;  2BZY A;  4J9G A;  2O31 A;  4AFS C;  3M0P A;  1JU5 C;  5HCK A;  1T0H A;  2F2X A;  4J9C A;  1M3B A;  1T3L A;  2J06 A;  1RLQ C;  4HXJ A;  2DA9 A;  1EFN A;  2J6F A;  2RQW A;  1GCQ C;  2A28 A;  2RQR A;  2DL8 A;  2FPD A;  2EYX A;  2K6D A;  3VS5 A;  1TUC A;  2DVJ A;  1MV3 A;  2X3X D;  1TUD A;  3I5R A;  1GFD A;  4J9I A;  1UJ0 A;  4F14 A;  2YUO A;  2K3B A;  2W0Z A;  2K79 A;  2L3Q A;  2KR3 A;  1ZUU A;  2H8H A;  1G83 A;  2OJ2 A;  3PVQ A;  1I07 A;  1X6B A;  1E7O A;  1WI7 A;  2MOX A;  2K2M A;  2OI3 A;  2K9G A;  2QDL A;  2ESW A;  1AWO A;  2DYB A;  2KYB A;  1U5S A;  2EGC A;  1W1F A;  2RPN A;  1X69 A;  4GBQ A;  5IHN A;  4LN2 A;  2CT3 A;  2RQU A;  2V1Q A;  1UEC A;  2GBQ A;  4WCI A;  2E5K A;  2JMC A;  3I35 A;  1Y57 A;  1WXB A;  2EQI A;  2FEI A;  3M0R A;  1I1J A;  1X27 A;  1PWT A;  2YUP A;  1VYT A;  1NLO C;  2RNA A;  4LUE A;  1Y0M A;  1IO6 A;  1UTI A;  1TG0 A;  3UAT A;  2RF0 A;  4K11 A;  2EYY A;  4RUG A;  1AEY A;  4Z88 A;  4AFZ C;  2DL3 A;  3CQT A;  1JEG A;  2HDA A;  2HEQ A;  5IXB A;  4LUD A;  2JM9 A;  4IIO A;  4LE9 A;  1JXM A;  2EGA A;  3EG1 A;  2LJ1 A;  4CC4 B;  2KT1 A;  4RTX A;  5GJV B;  1G2B A;  1AZE A;  1PRL C;  2LZ6 B;  3PE0 A;  2FPE A;  2VVK A;  2K7A A;  5IH2 A;  1NYG A;  1UFF A;  2JTE A;  1X2Q A;  1UHC A;  5I11 A;  2C0I A;  2LNH B;  2JMA A;  3H0H A;  3TSZ A;  1U3O A;  3EG2 A;  1NM7 A;  2ABL A;  1UDL A;  1W70 A;  3NMZ C;  3M0S A;  4ORZ A;  1BK2 A;  3NPF A;  4IIM A;  4CC3 A;  2DRK A;  2DF6 A;  2ED0 A;  4F17 A;  1ABO A;  2EYZ A;  2HBW A;  4OMO A;  2X3W D;  1RLP C;  2KE9 A;  2F2V A;  2L3S A;  1WXT A;  3EG0 A;  1X2K A;  1A0N B;  2DBM A;  1VYU A;  2M51 A;  1S1N A;  3O5Z A;  4AG2 C;  2CDT A;  2PTK A;  2EGE A;  2DL5 A;  3EHQ A;  2G6F X;  2GTJ A;  2DMO A;  3TVT A;  1SHF A;  3H0I A;  4D8D A;  1H8K A;  4J9E A;  1YWP A;  4RTZ A;  1BB9 A;  3M0T A;  2YUN A;  2AKL A;  2DX1 A;  2PZ1 A;  2GTO A;  4F16 A;  2BZ8 A;  1OPK A;  1NEB A;  2FO0 A;  4M4Z A;  4DEY A;  2OAW A;  3R6N A;  4JZ3 A;  2V1R A;  2RQV A;  1BU1 A;  2VKN A;  1WLP B;  4AFQ C;  2KRN A;  4ZNX A;  1PNJ A;  1CSK A;  1UUE A;  4D8K A;  1E6G A;  1E6H A;  1SEM A;  1ZLM A;  5FWC A;  2LCS A;  4CC7 A;  1SRM A;  1BBZ A;  1ZX6 A;  2CRE A;  4J9D A;  4QT7 A;  3VS3 A;  2EVR A;  2MIO A;  1WYX A;  4HVW A;  1ZSG A;  2YSQ A;  1AWX A;  2P4R A;  2IIM A;  2YUQ A;  1GBQ A;  2D1X A;  4JJC A;  4RTV A;  2A36 A;  3SHW A;  1HD3 A;  1WX6 A;  4GLM A;  2DL4 A;  2L3P A;  2KRO A;  1RI9 A;  3IQL A;  2BTT A;  3LH5 A;  1GRI A;  2FRW A;  3RBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...