5I22A

Amphiphysin sh3 in complex with chikungunya virus nsp3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Myc box-dependent-interacting protein 1
publication title Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i22A00
3EHRA 1GBQA 4J9CA 4RTUA 2BTTA 4CC7A 4JJBA 2PNIA 4R0KA 1OPKA 3UF4A 2KYBA 2RQUA 2EGCA 3I5RA 1AWOA 4Z8AA 3TSWA 2L0AA 2O9VA 3RBBB 1E7OA 1U3OA 3SHWA 1WI7A 1NYFA 5FW9A 2J7IA 4J9GA 2DL3A 3VS6A 2CH4A 2JXBA 4AG1C 1PKTA 2RQVA 1AEYA 1B07A 2YDLA 1GCQC 3UA6A 1X2KA 2EBPA 1VA7A 2EVRA 3I9QA 2MIOA 2ENMA 3SEMA 2KT8A 2CT4A 4X1VA 1M27C 4IIMA 4F17A 2J6KA 1WXBA 1CSKA 2KEAA 2EYZA 2KT1A 2KXDA 2RMOA 2I0NA 1I07A 2DL7A 1ZUKA 3M0TA 5L23A 2AZSA 2G6FX 2RF0A 2KRNA 2MCNA 2IIMA 2HDAA 1H92A 1K0XA 4F14A 2DL8A 1QWFA 2JT4A 1ZUUA 2CSIA 5IHIA 1W6XA 1M3AA 1JXMA 3EG1A 2B86A 1PWTA 2AKLA 1NEGA 2X3XD 2GNCA 1BB9A 1VYTA 4Z89A 1JQQA 4J9EA 1H8KA 2C0OA 3M0QA 2LJ3A 1OV3A 2EW3A 2O2OA 2LJ0A 1WA7A 4J9BA 3M0RA 4F16A 2YUQA 1ABQA 2FPEA 1GL5A 1W70A 2KROA 1TG0A 3QWYA 1UTIA 1QKXA 2LNHB 2K9GA 2JM9A 1Z9ZA 2D8JA 1UG1A 1GCPA 4JZ4A 2HCKA 2KRSA 1X6GA 1K0SA 2DYBA 2JS0A 4LN2A 2M51A 3FJ5A 2C0IA 2GBQA 3REAB 2DMOA 1K9AA 2DRMA 1SEMA 1M8MA 4E6RA 5FWBA 2XMFA 2LMJA 2KNBB 1X27A 2H8HA 1PRMC 1K1ZA 1QWEA 1BU1A 1T3LA 3I5SA 1T0HA 4HVVA 2LQNA 1AOJA 2L3SA 3VS2A 2OJ2A 4OMMA 2CUBA 4ORZA 2AZVA 1CKAA 3RNJA 5IXBA 2J6FA 1SPKA 2DRKA 1GFCA 1SRMA 1PNJA 1X2QA 4JJDA 3NGPA 3IQLA 1JXOA 2DL5A 5I11A 4JZ3A 3GBQA 1ZUYA 4M4ZA 2JW4A 2DL4A 1I0CA 1UE9A 4LE9A 2CUDA 3M0SA 4LUDA 4ZNXA 1GBRA 2DA9A 1MV0B 1NLOC 1PHTA 3LH5A 3M0UA 2O88A 3EG0A 2ECZA 1X6BA 1ZSGA 2DNUA 2LJ1A 1WXTA 1TUCA 3ULRB 2BZYA 2ROTA 2PZ1A 1PRLC 1E6GA 2RN8A 1UECA 1AZEA 1M3BA 2CDTA 1SRLA 1V1CA 1Y57A 3REBB 2GTOA 4DEYA 1HJDA 1AWJA 1IO6A 4J9HA 4HVUA 4J9FA 3VS1A 4K11A 3VRZA 4RTTA 2EKHA 3TVTA 1AD5A 4RTWA 2D0NA 4JJCA 2CT3A 2FRWA 3NPFA 1OPLA 1ZX6A 1KJWA 2EGEA 4AFUC 5I22A 2J06A 1UFFA 2SEMA 3M0PA 2RPNA 2DM1A 5ECAA 2LCSA 3EHQA 2V1RA 1K4US 4AFSC 2KGTA 2DF6A 2KBTA 4RTXA 3VS5A 3H0IA 2YT6A 4A63B 2L3PA 2P4RA 1ARKA 1UHFA 1TUDA 2KRMA 2F2XA 3THKA 5GJVB 2EPDA 2KXCA 5IH2A 3VS3A 2A28A 2OAWA 1SSHA 3EGUA 1OOTA 2GTJA 1W1FA 1CKBA 1NYGA 2JMCA 1B3QA 1XOVA 4Z88A 3VS4A 2D8HA 1VYVA 3O5ZA 3H0HA 1GCQA 5IHNA 2GQIA 2X3WD 3UATA 3H41A 5IHKA 1PKSA 2DX1A 1VYUA 2LQWA 2EYXA 1Y0MA 4J9DA 1NG2A 2DBKA 1A0NB 3PE0A 1G2BA 2NWMA 4RTZA 1WFWA 4OMPA 2PTKA 1UHCA 4EIKA 2MOXA 1FYNA 1GRIA 1QCFA 2ESWA 3VS0A 2VVKA 2FRYA 4JPBW 4CC4B 2K79A 2A37A 3C0CA 3I35A 1UJYA 1LCKA 1WXUA 1AWWA 3VS7A 1K76A 4ESRA 3CQTA 2ED1A 4RUGA 1YWOA 4KRTA 1YP5A 2V1QA 5EC7A 4CC3A 2FG0A 3A98A 2AKKA 4LNPA 2O9SA 2JTEA 2L3QA 2EYYA 1G83A 3ZL7C 1S1NA 2VWFA 4J9IA 2J05A 2W10A 3NMZC 1AZGB 1I1JA 2JM8A 3JV3A 1JO8A 4IIOA 4AFZC 2YSQA 2J6OA 1YCSB 2K2MA 3TSZA 2RQWA 3EG2A 1RLPC 1HD3A 4LUEA 1WIEA 1U5SA 2VKNA 2KR3A 2HSPA 1RI9A 1E6HA 1ABOA 2RNAA 5IXFA 2OI3A 4QT7A 1M3CA 5HCKA 2DVJA 1N5ZA 4AG2C 2FEIA 4OMOA 2SRCA 1BK2A 2DLPA 2RQTA 1UGVA 2KE9A 2K7AA 4D8KA 2F2WA 4HXJA 1GFDA 4RTVA 4OMQA 4DEXA 3PVLA 1M30A 4D8DA 2HEQA 3EG3A 1MV3A 1T3SA 3U23A 4FSSA 4Y92A 2GGRA 1H3HA 1YNZA 2BZXA 4CC2A 2LP5A 3PVQA 4HCKA 1SHFA 4WCIA 1YWPA 2K6DA 3H0FA 1FMKA 1WLPB 2EQIA 2L2PA 1NM7A 1JEGA 4OMLA 1UUEA 3NHNA 2FPDA 3UA7A 4OMNA 1AWXA 2KYMA 2CREA 4AFQC 1JU5C 2ED0A 1WX6A 2D1XA 4GBQA 1HSQA 1EFNA 1ZLMA 2YUOA 2K3BA 1X43A 2FO0A 2O31A 2ROLA 1UJ0A 2QDLA 1KIKA 2DBMA 1Z9QA 1RUWA 5GJWB 2A36A 1NEBA 1UDLA 2F2VA 1KFZA 2DILA 1J3TA 2DE0X 2LX7A 2YUNA 1ZBJA 1NLPC 2ABLA 1OEBA 2JMAA 2CSQA 2M0YA 2LZ6B 1QKWA 1SHGA 2BZ8A 2A08A 1WDXA 3VRYA 4HVWA 1KSWA 2FPFA 3R6NA 3QWXX 2C0TA 1MUZA 3KFVA 1RLQC 1T0JA 1QLYA 1WYXA 4GLMA 2W0ZA 2EGAA 1X69A 5FWCA 1AVZC 2E5KA 2NUZA 2YUPA 1YN8A 1BBZA 2RQRA 1U06A 4RTYA 2AK5A 2EYWA 2HBWA 2CH4W 2DJQA 2JS2A
chains in the Genus database with same CATH superfamily
2QQBA 4J9CA 2RB6A 4CC7A 2MK5A 2P0KA 3OY9A 4BI4A 1Q95G 1NZ9A 3UF4A 3L2ZA 2VV5A 2L0AA 3JCMf 5EG2A 4HCBA 2QA4T 3SHWA 1YHQA 2LDMA 3OSSC 5HY6A 4GY5A 2NUTA 4X34A 5J39A 4XU0A 4C92F 1I5LA 1NJIU 4M75A 2ZZDA 1X2KA 4XQ3A 2MIOA 2K5LA 2ENMA 3A1PA 4BDYA 3OQ5A 1ZHIA 2PVDB 2CT4A 1Q7YR 4QVCA 2J6KA 1WXBA 4OMFB 1WNLA 4M75G 3VUZA 8ATCB 1Q7YC 2RI3A 3M9QA 1YCYA 3EGXB 2RF0A 1ACMB 2FYKA 1K0XA 2LT1A 3QZ9B 2JT4A 3GLXA 2K3XA 2CSIA 2LQKA 2LX9A 3TREA 5GAOl 1M3AA 1JXMA 2F5TX 3VV0A 2ATCB 3MCAB 4M7AG 3PFSA 4FT4A 3OYIA 1NEGA 2DO3A 3CCRA 2GNCA 1VYTA 3RDVA 2HQHA 4J9EA 3I55A 4M7DF 1H8KA 2P0PA 1G3YA 4LDVA 2C0OA 1BI1A 1OV3A 1YIJT 2CP2A 3QHSA 1M4ZA 3D7SB 2FPEA 1GL5A 3CPWA 2BE9B 1N8RR 3JB9I 3QWYA 2I2LA 2K9GA 1GCPA 2M16A 2KRSA 3CEYA 5A0LA 3F70A 2OAUA 3GNGA 1UGRB 3M56A 1SKUB 4LN2A 2QTXA 1BCMA 1BKBA 2VGMA 2RK2A 3VKIA 2YWWA 2DMOA 3QZ5B 2DRMA 3UPUA 4E6RA 4LD9K 2DXBA 1X27A 2H8HA 4XU3A 3I5SA 1BU1A 4Z02A 4C8QF 2L3SA 1KK7A 5CO7A 5GAOm 1WHHA 3CCEQ 2CUBA 5GAN5 4ORZA 1IGUA 2JJ9A 3OS1A 1YI2A 2J6FA 4AT1B 3WVEB 2GCXA 2HL5C 4JJDA 3S6WA 3R6OA 3IQLA 1KD1U 1JXOA 5I11A 3CC4A 4E7LA 3FIFA 1UEBA 5I21A 4FCYA 3Q1JA 2XDBA 4BE1A 1IGQA 2DTHA 2JW4A 4EPCA 1I0CA 3PIOA 3M0SA 1N9RA 4LUDA 4PJOE 3FDRA 1GBRA 1V29B 3LH5A 3CCSQ 2IG0A 2MYSA 3QJYA 1X6BA 2DNUA 2CZ6B 2QAZA 3ULRB 4XU1A 4RCBA 4J6WA 1D0YA 3OYLA 2NUPB 2X4YA 2E6ZA 1UECA 2GQVA 3VU3C 3L2UA 1AZEA 2CDTA 3EGXA 1NJIR 1V1CA 3H9NA 4PKCC 4C92E 2XICA 4PJMA 4J9HA 2VYTA 2EKHA 3OW2A 3QDFA 4JRPA 1ZX6A 3X28B 1M5Q1 2SEMA 2RH2A 2DM1A 4FT2A 5CR2A 1EZZB 5ECAA 3EHQA 3OYHA 2KBTA 4PJOD 5LJ3h 4EMKB 1VQ9A 4OB2B 4KH0B 2XU8A 2X35A 3MEUA 2KRMA 3QKJA 3TEEA 1TWBA 2XDDA 1B7TA 1NYGA 2HSEB 1WHLA 2DFUA 3CCMA 1IRXA 1XOVA 3C95A 2JZ2A 2D8HA 2QEXA 3O5ZA 3H0HA 4C92D 2X3WD 5IHKA 2LQWA 1Y0MA 4JDSA 3PE0A 3CCET 2NWMA 1WFWA 2E4HA 3RMQA 5KYXA 1RAAB 2RK1A 2QK0A 3MHXA 5D6WA 3C0CA 2F5KA 5A2QE 1UGQB 3A5ZB 3CCQQ 3M4GA 2Y90A 1YWOA 2EWNA 1KHIA 3CCST 1RAHB 4M78F 3E2UA 3CMAA 5HKCA 4LD6A 1WQWA 3LW5E 4C8QE 3EH2A 3BY7A 3NMZC 1JO8A 2YSQA 2J6OA 2RJFA 3EG9B 1OU9A 1YCSB 5GAMh 4M7DD 1JJ2A 4BY6B 2COZA 1KD1R 1RLPC 3E9GA 1S72A 1QVFA 3UWNA 1U5SA 2ZPHB 2KR3A 3G4SA 1E6HA 1ABOA 5IXFA 1I81A 1VQ8A 2E70A 2OI3A 2RHZA 2QASA 1N5ZA 1VQ7Q 3ME9A 3V8LA 3UDCA 3JCMP 1M1FA 5GAOq 1GFDA 4ZGJB 4RTVA 1QVGS 2HEQA 2E5QA 3EG3A 5KE2A 2DPPB 2OTJQ 3LLRA 4LDXA 3A8HB 3CXCA 4EMKA 5CIUA 4PLLA 5GAOp 1QP3A 3CPWP 2D9TA 3DB3A 4ELYC 5AT1B 1YWPA 3H0FA 2DTIA 3CCVT 1JEGA 5CK9A 4OMLA 2RI2A 5GMKh 1HXDA 1KQSA 2VXEA 5CVIA 3SWNC 1JU5C 3I56A 1HSQA 2EJFA 1ZLMA 3M54A 1GXIE 1VOMA 1Q82C 2DXCA 2EJ9A 3JAME 1X43A 2ROLA 1F1BB 5LJ3g 4F7UF 1KIKA 4M7AE 1RUWA 3CCQT 2DD5A 3GPLA 2XD0A 2KSSA 3SD4A 3MP1A 4XAXB 1MMNA 2XK0A 2M0YA 2QYZA 1QKWA 3MP8A 4DQ2A 3NFCA 4E2FB 4A54A 1U8RA 4PJOA 2OTLA 3QG1A 3KBGA 4RMOA 1FXXA 4FYXB 4C8QB 3VRYA 4IUUA 4HVWA 1WQ7A 2K4YA 3R6NA 4IUTA 2CP6A 3KFVA 3EAEA 3QXEB 1IXDA 2W0ZA 3ZEHA 3OSVA 1D1AA 4PJOG 4IKFA 3BE3A 4N4HA 4RTYA 4C92A 2EYWA 2CH4W 2ZPIB 1MNEA 5GANh 4Y28E 1VQ7T 5GMKm 4N4GA 3OYFA 2KYBA 2RQUA 1AWOA 3TSWA 3JCMQ 3C12A 1U3OA 2R57A 1W4SA 1WI7A 4KT0E 1NYFA 4M78E 4C92G 3CCRQ 2OTJT 2DL3A 2PQWA 4UC4A 3VS6A 1PD1A 1OZ2A 2JXBA 4AG1C 1PKTA 2P0QA 1B07A 2Y4XA 1GCQC 3OYEA 3LGLA 2NUTB 2EBPA 5DY9A 5GAMg 2MAMA 1EIFA 1WGSA 1X01A 3PTAA 3CCQA 3JCMh 1OYXA 2KT8A 3RMSA 3EH1A 2FHDA 3J80E 3ZFJA 2RO0A 4HCZA 1CSKA 2KEAA 2KXDA 2RMOA 3QJ6A 1I07A 2DL7A 2GFUA 3M0TA 3LYIA 2G6FX 1RAGB 3RIRA 4QQDA 1G3TA 2MCNA 3OS0A 5KYUB 2QQSA 4M7AB 1QWFA 5DLOA 2DERA 1MHNA 1ZUUA 4FIBA 2WSEE 2E41A 2EJGA 3OYCA 2DAQA 2FZGB 2B86A 1YI2Q 2AKLA 3V8JA 3J7AF 2X3XD 4M7DG 1JQQA 1OU8A 3CC4Q 1VQ7A 2DZ9A 2LJ3A 1IREB 4LDYA 1VQ6A 4KGVB 2BUDA 3PGGA 1ABQA 1W70A 4O5VA 3RUXA 1DJ7B 2FVUA 4C8QA 2E10A 1UTIA 3RKXA 3M57A 2LNHB 2VC8A 2E12A 2R58A 4B9XA 1X6GA 4WF2A 2DYBA 2JS0A 4F7UE 2M51A 3QYGB 2GBQA 3REAB 2EFIA 2EYQA 1SEMA 1Y96A 2PU9B 2XMFA 5FWBA 5IT9E 5GAOr 1JJ2P 2KNBB 4A4HA 1QWEA 1QVPA 1QVFP 4N0AA 4ZTJA 3CD6A 4D6WA 1AOJA 3OS5A 4M78B 4A4GA 4PL6A 3CCRT 2AZVA 1CKAA 3RNJA 3PIPA 5FRNA 2DRKA 1SRMA 3I55T 2FZKB 3NGPA 1XQHA 3ASKA 4JZ3A 2EIFA 1P92A 3GBQA 4XTWA 5L8RE 4KBMB 2WSCE 1HK9A 1UE9A 4HT9A 2DIGA 1VQ9Q 3LX7A 4ZNXA 3X20B 3CXCP 3OYMA 1WJQA 1I8FA 5GANg 3BDLA 1D1CA 1WJRA 2ECZA 1ZSGA 2RJCA 1MGQA 1VQ4A 2CYZB 4II1A 2BZYA 3CCMQ 4PFOA 2PZ1A 4L6V5 1Q86U 2QEXQ 1E6GA 1O75A 2HNIA 5CKBA 4QW2A 1M3BA 4E7ZA 1SRLA 1Y57A 5KYUA 1AWJA 4M7AA 1IO6A 1YI2T 4K11A 3JRZA 1AD5A 2D6FA 3NPFA 3CC4T 3QBYA 1KJWA 3JCMg 4J6XA 5I22A 2J06A 3M0PA 4J7IA 3MO8A 3S3NA 1D3BA 2YRDA 2DD4A 4XU2A 3HRUA 4E47A 3VS5A 3H0IA 3OB9A 2DXTA 2YT6A 3CCUA 4A63B 2P4RA 3MJXA 5FU6C 2RHYA 4XTYA 3CMAQ 4F7UB 1YJNA 1VIFA 3VS3A 3OBWA 5I2MA 1SSHA 1OOTA 2GTJA 3BFMA 1D1BA 4C5GA 4M77F 1B3QA 3VS4A 4DBQA 3UATA 3ER0A 3H41A 2DX1A 4FM4B 4M75C 2NYSA 4ATOA 4J9DA 1S72Q 2DBKA 2HQXA 1A0NB 1G2BA 4QVDA 3JCMc 4RTZA 3G4SQ 1N9SA 4OMPA 4DBFA 1VQ8Q 1UHCA 2RHXA 4BUGA 2DKGA 1U1SA 2DETA 4M78A 4MZPA 2KMTA 1FYNA 4KULA 2ESWA 3VS0A 2VVKA 2FRYA 2MWOA 4JPBW 5KYXB 4BI8B 2V26A 1PC0A 4XTZA 3FJPA 1WXUA 3M53A 1AWWA 1VQ9T 3OYBA 3VS7A 1K76A 4ESRA 3KXTA 1BI3A 4RUGA 4ZN3A 4KRTA 4M78G 1QCNA 2QDYB 2V1QA 4PNOA 4CC3A 2E3HA 9ATCB 4JJNK 4A4FA 3A98A 2AKKA 4MZTA 3ZL7C 1G83A 5IN1A 3CCMT 1K73U 2VWFA 4X9CA 3MEWA 2QEXT 2A7YA 3EFSA 2LC4A 1AZGB 4IIOA 1D0XA 4AFZC 3OYNA 3TSZA 2K2MA 4ME7A 1HD3A 3I56Q 4PJJA 3SFMA 3CBOA 2X4WA 5LJ5h 3VYGA 5CKDA 2RNAA 2LVMA 4FYYB 2DVJA 2FEIA 4OMOA 3X26B 2DLPA 1ZSZB 4C0GA 1YJWA 1NPRA 4E7SA 4DEXA 2E6NA 2BE7D 4LXCA 5KYNA 4QQ6A 1Q86R 1Q82U 3JB9F 5FROA 1T3SA 3U23A 1WHMA 3CMAT 4J8OA 2OTLQ 2YRVA 1H3HA 3AHUA 5AYFA 2BZXA 4MDXA 4EMHA 1Q86C 4J83A 4WCIA 4XK8E 4FL6A 4F7UA 2L89A 1BIBA 1AT1B 1OX8A 2RHUA 1D0ZA 2KVQG 3NHNA 1V76A 3UA7A 1S72T 2O4XB 3CBPA 1VQNA 2CREA 4AFQC 3G4ST 3PMIA 2PVOB 3FRNA 1KG1A 3FLGA 1VQ8T 2E3IA 3HHTB 3P8BB 2VUBA 1Y71A 4OB0B 4R55A 2YUOA 4F7UG 2K3BA 1QVGA 2E1HA 2QI2A 1WJSA 2QDLA 4XTVA 5GJWB 1WHKA 4QKUA 4M7DE 2DILA 1J3TA 1B34A 4ZGDB 4IUVA 2VB6A 2O01E 1TSFA 4M77E 2BZ8A 2C06A 3MEVA 4KH1B 2P84A 1EX4A 1WDXA 2DTOA 4PJOB 3V7SA 5A0DA 1RLQC 1QLYA 4DBRA 1QMCA 1WYXA 1Y7XA 4GLMA 1RL2A 5FU7B 4BI3A 1Q81U 1AVZC 3OYYA 1K8AU 3I56T 2E5KA 4C0ZA 5C0MA 1U06A 3V7RA 1VQKA 2HBWA 2QG9B 4RKUE 2JS2A 4J6YA 3EHRA 2ZCFB 2B8AA 4C92B 4JJBA 2PNIA 3G71Q 1OPKA 4HKEA 4JLGA 3I5RA 4Z8AA 2O9VA 2CZ0B 5CCAA 1E7OA 5FW9A 3C4SA 4J9GA 2HBPA 1K73R 1ZSZA 4M77D 4RG2A 1AEYA 1HYOA 2OTLT 2YDLA 2X4JA 3CC2A 1VA7A 2EVRA 1K73C 1VQ6Q 1G3SA 1TTHB 2JN0A 1NBEB 1PCXA 1YFNA 1TUGB 2KI7A 2VXFA 4DOWA 1M27C 4IIMA 4F17A 5LJ5g 1FMWA 1PD0A 1RADB 3G7ZA 5KH6A 3JCMW 2KT1A 1IB8A 3HFOA 2NLUA 4FYVB 1ZUKA 1SG5A 5LJ3f 2O4XA 1M2OA 5GMKi 2AZSA 1K9MU 2KRNA 3EGDB 4JUVA 2HDAA 4E7JA 1H92A 1C0MA 2DVEA 4F14A 3OMGA 2Z0WA 1NPPA 2JTMA 2VASA 3CD6Q 1XTDA 1Q82R 4M7DB 5IHIA 1W6XA 1G8XA 3EG1A 1R0CB 1PWTA 3TCJA 3E19A 1BB9A 4Z89A 5GMKl 4E7KA 4BE2A 2JOYA 2KK4A 3SDZA 1WZOA 4JS5A 5FLXE 3M0QA 2IVWA 2O2OA 1W2BS 2WACA 2LJ0A 4J9BA 3DLLA 3LH0A 8AT1B 2M02A 3N5BB 1IHWA 2RM4A 3GP8A 3HPWA 5KE3A 5D7UA 5CKEA 2JM9A 2D8JA 4F04B 2HCKA 1VQMA 4XTXA 1VQ4Q 1VQOA 1K0SA 3HL8A 4L59A 5HK3A 3FJ5A 2C0IA 1M1GA 3CMEA 1SSFA 5KCHA 1BI2A 3JB9D 1QVFS 1KC8C 1T3LA 1K1ZA 3J81E 4HVVA 2LQNA 1Y96B 1TXQA 3VS2A 1Y07A 4EMKC 1PG5B 4DA4A 2OJ2A 4OMMA 4M75D 4PJLA 1WPYA 5IXBA 1SPKA 2EQKA 2K5IA 5CKFA 1PNJA 5GAMf 2KDSA 2RJDA 1G5VA 1VQ6T 1Q81R 4A4EA 1K8AR 2DL4A 3OW2P 4LE9A 2CUDA 3CCUQ 4ANJA 2L3RA 3CXCS 1Q81C 5KYYB 4VUBA 1BYMA 2DA9A 1K8AC 4A4KA 1MV0B 1NLOC 1PHTA 1YJNQ 2O88A 3DB4A 3A8MB 1WXTA 1TUCA 1PRLC 3L1AA 3V7CA 2RN8A 3CD6T 4FSXA 3EGDA 2GTOA 4DEYA 2RD1A 1YBYA 6AT1B 1D09B 1HJDA 1YJ9A 5LJ3j 4HVUA 3CPFA 1RI0A 3VRZA 4M7DA 4RTWA 2CT3A 1U1TA 1OPLA 1OX9A 2CP0A 1SF9A 1X6OA 2EGEA 3QSUA 4AFUC 1JRIA 3G71A 2DEUA 4M77A 2LCSA 3HFNA 4JS4A 1K4US 4KUIA 2YRCA 2DF6A 4C92C 4RTXA 1LOJA 1D3BB 3M4YA 3S3MA 1I5OB 1RABB 2L3PA 1K9MR 4BY6C 2HL3A 1PSFA 1ARKA 1UHFA 2COWA 3GF5A 4B9WA 1VQ4T 5D6XA 5GJVB 1M1KC 2EPDA 2KXCA 2RJEA 4J7FA 4M77G 2OAWA 1K9MC 2H3JA 3ZBDA 1CKBA 2LQ8A 3G6EA 2JMCA 4Z88A 3L2RA 3TU4K 3INZA 3OYKA 5IHNA 2M9UA 2GQIA 1ZA1B 2X51A 4TVRA 1PKSA 1VQ5A 1VQPA 4OB3B 2GFAA 2PTKA 2HQEA 4NL2A 3WVDB 1GRIA 1M2VA 1QCFA 4QQGA 3RR6A 3EFRA 1YJWQ 4PJNA 3DLMA 1MMGA 3CCUT 1BCOA 1C6VX 4ELZC 2LCLA 5GAMj 2ED1A 3SB2A 4C5EA 1XJWB 4ZGEB 4R56A 1YJNT 5CQYA 2FG0A 2IPOB 4FW1A 1KHCA 5KYYA 1OZ3A 5C6SA 2YHTA 2J05A 2XIDA 1I1JA 2JM8A 4J5YA 3JV3A 1KQ2A 5J3BA 1VQNQ 2RQWA 2HKQB 4E7IA 1LNXA 3JCMV 4LUEA 5LL6S 2VKNA 5LJ3d 2HSPA 1RI9A 5GAN3 3G1JA 1VQLA 1ZBXA 3CCLA 3EFOA 1M3CA 4C0FA 5HCKA 2M0OA 2MWPA 1IHVA 4OP0A 4CRIA 5LJ3e 1KQSP 1MMAA 4AG2C 2DXUA 4C8QC 3CC7A 2HAXA 1BK2A 2KY9A 2RQTA 1UGVA 2K7AA 4D8KA 2F2WA 4OMQA 1YITA 1M30A 4Q5WA 2K57A 5GMKj 3JB9G 2XKOC 3QUIA 5KYWA 3T9NA 3FC3A 4ZTFA 1MV3A 1TU0B 2LNVA 4FU6A 4OB1B 4Y92A 2GGRA 4N0AC 4HCKA 4JRIA 4QVZA 2CZ7B 1FMKA 2L8DA 4IURA 3RESA 1UUEA 4HT8A 4OMNA 1AWXA 4PK4A 1VQKQ 1WX6A 1EFNA 3NTHA 3E1SA 2FO0A 2O31A 1UJ0A 4NL3A 2ZPBB 1YJWT 3QDRB 3CCJQ 2MPXC 2A36A 4AMCA 2F2VA 1KFZA 2RHIA 2DE0X 5GAOn 1QW1A 2YUNA 2QA4A 4MMLA 2Y4YA 2ABLA 2ZPFB 2JMAA 2CSQA 3E9FA 5GAMd 3CC2Q 1B34B 2JUFA 3VUBA 2A08A 1N8RC 5GAMe 5GANj 3H6ZA 3PT9A 2FPFA 1FMVA 2ZGWA 4M7AC 3QWXX 2C0TA 1T0JA 3OBYA 1VQNT 2EGAA 4LDUA 3JSCA 3FEOA 1N27A 2NUZA 3HSBA 2YUPA 1YN8A 1BBZA 2RQRA 3X25B 3OYJA 3EG2A 2AHJB 2QTVA 1GBQA 4RTUA 2BTTA 2P4TA 2ZPGB 4R0KA 1XNIA 2EGCA 4BD3A 2FZCB 5J26A 3RBBB 2J7IA 1UGSB 4OVAA 3SWNB 2CH4A 3P8DA 3GNFB 3RKWA 2RQVA 5DLQE 3UA6A 5GMKe 1JB0E 1LPLA 2WSFE 3I9QA 1PSEA 1I4K1 2CP3A 3SEMA 1YIJA 2EKOA 3JB9J 4X1VA 2DZCA 4M78C 1VQMQ 2XDPA 2EYZA 1ZA2B 1PM3A 1VQOQ 1VQKT 2I0NA 3CPWS 2BKDN 4M75F 5L23A 3CMEQ 2OX7A 2A0FB 4C5IA 2IIMA 4JRKA 1NJIC 3VJPA 4P5NA 2A3LA 2DL8A 1G3WA 4IUPA 4JRQA 3CCJT 3PMTA 3VYHB 1OULA 5CKHA 2QGFB 3V8KA 2PVGB 2V8KA 1N6AA 4M7AF 3MP6A 3CC2T 2HZYA 3O8VA 2DJZA 1M9SA 1KC8U 2EW3A 1WA7A 5GANd 3M0RA 4F16A 2YUQA 4N4IA 3JCMJ 2KROA 1TG0A 1LJOA 3A8GB 1M90U 5GANe 2PUKB 3BDUA 1QKXA 3CCVQ 4FW2A 1Z9ZA 1UG1A 4JZ4A 1VUBA 4PFZA 4RCCA 3NTKA 1K9AA 1M8MA 3QO3A 1TOVA 5GAN6 5CAIA 4YTLA 2LMJA 2DIQA 1JBMA 1PRMC 3META 1T0HA 1YJ9Q 2D0QB 2GF7A 5I2SA 1RACB 1UGPB 2DK3A 5CQXA 3JCMd 1H641 5IAYA 2XG8D 1W2BA 1GFCA 3JCMe 2F1LA 1X2QA 3CBMA 4BACA 3QIIA 2KAFA 2EQMA 2DL5A 2QQAA 1TS9A 2XI9A 4E7HA 2LCCA 3SWNA 3CCJA 4BDZA 5LJ5f 1ZUYA 3GOXA 4GLKA 3OW2S 4M4ZA 2L5QA 1OI1A 3MEAA 4DBHA 2DYIA 2LTOA 2RA2A 1RAIB 3X24B 3QPHA 2YLCA 1VQMT 3M0UA 1VQOT 1C1AA 2MI6A 3EG0A 3CMET 1R8OB 2NUPA 2LJ1A 2VGNA 3MPUB 3LGFA 4JLIA 3M59A 2ROTA 3OYAA 3G6EQ 4Y91A 3OMCA 2PUOB 4A53A 4PLIA 5HK0A 1ZQ1A 1KD1C 1VQ5Q 3HP9A 4RG8A 2DEQA 1VQPQ 3REBB 1M1KU 4WTOB 4BE0A 3HKSA 2X9HA 4J9FA 3CCEA 3VS1A 4RTTA 1RAFB 3TVTA 2D0NA 4JJCA 2FRWA 1MNDA 1QCOA 1BIAA 1UFFA 2RPNA 3H8ZA 2V8JA 4NS5A 4C8QD 2HMAA 2V1RA 5D6YA 4AFSC 2KGTA 2QXFA 1KQ1A 4MMKA 4M75E 4M77B 5GAN2 4C0DB 5A0GA 1TUDA 3MKDA 3RERA 2F2XA 3THKA 3CCSA 5IH2A 5KCOA 5DM7R 2QGGA 2A28A 3URGA 2K2VA 2YLBA 3EGUA 3L2QA 3BW1A 1W1FA 4DOVA 2EAYA 1QQJA 2R5AA 1VYVA 3A8LB 1ZSZC 1GCQA 1WHGA 5GAN4 3UT1A 1VYUA 2EYXA 1YJ9T 3P8HA 1NG2A 2CZ1B 3WXMB 2HKNA 1IZ6A 2CP5A 1YHQQ 1KC8R 3GIBA 3TQ7P 1VQLQ 4OGEA 3CCLQ 2FB7A 1OQKA 4EIKA 4IUQA 2MOXA 4HCCA 3G71T 2QQ9A 1JJ2S 3CC7Q 1M90R 3AT1B 4CC4B 2F69A 2K79A 2A37A 3M5AA 3I35A 3L42A 4FYWB 1M2VB 1YITQ 1X75C 1UJYA 1LCKA 3OYGA 2E65A 1M90C 2AT1B 2XHCA 3CQTA 1H3ZA 3QYHB 3L2WA 2HD0A 2K3YA 1YP5A 2EQUA 5EC7A 2X4XA 2ZAEA 2MMPA 5LJ5j 4LNPA 2YXYA 1RAEB 2O9SA 2JTEA 2L3QA 2EYYA 2CP7A 3HTRA 1S1NA 2E64A 3G6ET 4J9IA 3EG9A 4EMGA 2W10A 2COYA 1VQ5T 2M1HA 4C5HA 4M7AD 4KGXB 1VQPT 4XTUA 3CCVA 1R77A 1LVKA 2BIVA 5FU6B 2RI5A 3NTIA 1WIEA 3JB9H 2KQWA 1Q7YU 4QT7A 1KQSS 3LWIA 3A8OB 3M55A 3I55Q 4KUDK 1VIEA 2SRCA 2AIRB 4EDUA 4PJOC 3EFOB 2KE9A 2K5FA 4HXJA 4M75B 3FB9A 3PVLA 2QA4Q 4D8DA 1QVGP 5FU7C 3C94A 3OS2A 4FSSA 3HRSA 4BB7A 5KYWB 1YNZA 4CC2A 2LP5A 3PVQA 3OYDA 1SHFA 3DKMA 1M1KR 1WHJA 4V2SA 1R0BG 2JVVA 2K6DA 1WLPB 2EQIA 2V8IA 2L2PA 5M9OA 2LT4A 1NM7A 4NOYA 1O9SA 2FPDA 2CGHA 4KGZB 2KYMA 1YHQT 3KUFA 4M78D 3S3OA 2ED0A 2EQJA 1N8RU 1VQLT 2D1XA 1FX7A 3CCLT 2ZPEB 4GBQA 4LDWA 1QP2A 7AT1B 3CC7T 1NE8A 4ZN1A 4PFPA 3OA6A 2DBMA 1Z9QA 4HA8A 3JCMb 1MMDA 1FWZA 1NEBA 1YITT 1UDLA 1W2BP 2JNGA 2LX7A 4L5GA 1ZBJA 4X9DA 1NLPC 3PNWC 5GAN7 1OEBA 2G3RA 2LZ6B 2H3EB 1UB4A 2LRQA 2OTJA 1SHGA 5FRMA 4B6MA 3L2VA 2JTFA 3M58A 2CKKA 2QQRA 4OF1A 5LJ5d 5GANf 1M8VA 4MZMA 4CI0C 1KSWA 1YIJQ 2FL7A 3JCMX 3LWHA 1MUZA 4OGCA 5LJ5e 4O6JA 4M7DC 1AHJB 1BI0A 4MDWA 2CS7A 4C8QG 2MF2A 1X69A 5FWCA 1TH7A 2R5MA 3HRTA 4M77C 2AK5A 4PJOF 4C0DC 5GAN8 2DJQA 3RKYA
chains in the Genus database with same CATH topology
3EHRA 1GBQA 4J9CA 4RTUA 2BTTA 4CC7A 4JJBA 2PNIA 4R0KA 1OPKA 3UF4A 2KYBA 2RQUA 2EGCA 3I5RA 1AWOA 4Z8AA 3TSWA 2L0AA 2O9VA 3RBBB 1E7OA 1U3OA 3SHWA 1WI7A 1NYFA 5FW9A 2J7IA 4J9GA 2DL3A 3VS6A 2CH4A 2JXBA 4AG1C 1PKTA 2RQVA 1AEYA 1B07A 2YDLA 1GCQC 3UA6A 1X2KA 2EBPA 1VA7A 2EVRA 3I9QA 2MIOA 2ENMA 3SEMA 2KT8A 2CT4A 4X1VA 1M27C 4IIMA 4F17A 2J6KA 1WXBA 1CSKA 2KEAA 2EYZA 2KT1A 2KXDA 2RMOA 2I0NA 1I07A 2DL7A 1ZUKA 3M0TA 5L23A 2AZSA 2G6FX 2RF0A 2KRNA 2MCNA 2IIMA 2HDAA 1H92A 1K0XA 4F14A 2DL8A 1QWFA 2JT4A 1ZUUA 2CSIA 5IHIA 1W6XA 1M3AA 1JXMA 3EG1A 2B86A 1PWTA 2AKLA 1NEGA 2X3XD 2GNCA 1BB9A 1VYTA 4Z89A 1JQQA 4J9EA 1H8KA 2C0OA 3M0QA 2LJ3A 1OV3A 2EW3A 2O2OA 2LJ0A 1WA7A 4J9BA 3M0RA 4F16A 2YUQA 1ABQA 2FPEA 1GL5A 1W70A 2KROA 1TG0A 3QWYA 1UTIA 1QKXA 2LNHB 2K9GA 2JM9A 1Z9ZA 2D8JA 1UG1A 1GCPA 4JZ4A 2HCKA 2KRSA 1X6GA 1K0SA 2DYBA 2JS0A 4LN2A 2M51A 3FJ5A 2C0IA 2GBQA 3REAB 2DMOA 1K9AA 2DRMA 1SEMA 1M8MA 4E6RA 5FWBA 2XMFA 2LMJA 2KNBB 1X27A 2H8HA 1PRMC 1K1ZA 1QWEA 1BU1A 1T3LA 3I5SA 1T0HA 4HVVA 2LQNA 1AOJA 2L3SA 3VS2A 2OJ2A 4OMMA 2CUBA 4ORZA 2AZVA 1CKAA 3RNJA 5IXBA 2J6FA 1SPKA 2DRKA 1GFCA 1SRMA 1PNJA 1X2QA 4JJDA 3NGPA 3IQLA 1JXOA 2DL5A 5I11A 4JZ3A 3GBQA 1ZUYA 4M4ZA 2JW4A 2DL4A 1I0CA 1UE9A 4LE9A 2CUDA 3M0SA 4LUDA 4ZNXA 1GBRA 2DA9A 1MV0B 1NLOC 1PHTA 3LH5A 3M0UA 2O88A 3EG0A 2ECZA 1X6BA 1ZSGA 2DNUA 2LJ1A 1WXTA 1TUCA 3ULRB 2BZYA 2ROTA 2PZ1A 1PRLC 1E6GA 2RN8A 1UECA 1AZEA 1M3BA 2CDTA 1SRLA 1V1CA 1Y57A 3REBB 2GTOA 4DEYA 1HJDA 1AWJA 1IO6A 4J9HA 4HVUA 4J9FA 3VS1A 4K11A 3VRZA 4RTTA 2EKHA 3TVTA 1AD5A 4RTWA 2D0NA 4JJCA 2CT3A 2FRWA 3NPFA 1OPLA 1ZX6A 1KJWA 2EGEA 4AFUC 5I22A 2J06A 1UFFA 2SEMA 3M0PA 2RPNA 2DM1A 5ECAA 2LCSA 3EHQA 2V1RA 1K4US 4AFSC 2KGTA 2DF6A 2KBTA 4RTXA 3VS5A 3H0IA 2YT6A 4A63B 2L3PA 2P4RA 1ARKA 1UHFA 1TUDA 2KRMA 2F2XA 3THKA 5GJVB 2EPDA 2KXCA 5IH2A 3VS3A 2A28A 2OAWA 1SSHA 3EGUA 1OOTA 2GTJA 1W1FA 1CKBA 1NYGA 2JMCA 1B3QA 1XOVA 4Z88A 3VS4A 2D8HA 1VYVA 3O5ZA 3H0HA 1GCQA 5IHNA 2GQIA 2X3WD 3UATA 3H41A 5IHKA 1PKSA 2DX1A 1VYUA 2LQWA 2EYXA 1Y0MA 4J9DA 1NG2A 2DBKA 1A0NB 3PE0A 1G2BA 2NWMA 4RTZA 1WFWA 4OMPA 2PTKA 1UHCA 4EIKA 2MOXA 1FYNA 1GRIA 1QCFA 2ESWA 3VS0A 2VVKA 2FRYA 4JPBW 4CC4B 2K79A 2A37A 3C0CA 3I35A 1UJYA 1LCKA 1WXUA 1AWWA 3VS7A 1K76A 4ESRA 3CQTA 2ED1A 4RUGA 1YWOA 4KRTA 1YP5A 2V1QA 5EC7A 4CC3A 2FG0A 3A98A 2AKKA 4LNPA 2O9SA 2JTEA 2L3QA 2EYYA 1G83A 3ZL7C 1S1NA 2VWFA 4J9IA 2J05A 2W10A 3NMZC 1AZGB 1I1JA 2JM8A 3JV3A 1JO8A 4IIOA 4AFZC 2YSQA 2J6OA 1YCSB 2K2MA 3TSZA 2RQWA 3EG2A 1RLPC 1HD3A 4LUEA 1WIEA 1U5SA 2VKNA 2KR3A 2HSPA 1RI9A 1E6HA 1ABOA 2RNAA 5IXFA 2OI3A 4QT7A 1M3CA 5HCKA 2DVJA 1N5ZA 4AG2C 2FEIA 4OMOA 2SRCA 1BK2A 2DLPA 2RQTA 1UGVA 2KE9A 2K7AA 4D8KA 2F2WA 4HXJA 1GFDA 4RTVA 4OMQA 4DEXA 3PVLA 1M30A 4D8DA 2HEQA 3EG3A 1MV3A 1T3SA 3U23A 4FSSA 4Y92A 2GGRA 1H3HA 1YNZA 2BZXA 4CC2A 2LP5A 3PVQA 4HCKA 1SHFA 4WCIA 1YWPA 2K6DA 3H0FA 1FMKA 1WLPB 2EQIA 2L2PA 1NM7A 1JEGA 4OMLA 1UUEA 3NHNA 2FPDA 3UA7A 4OMNA 1AWXA 2KYMA 2CREA 4AFQC 1JU5C 2ED0A 1WX6A 2D1XA 4GBQA 1HSQA 1EFNA 1ZLMA 2YUOA 2K3BA 1X43A 2FO0A 2O31A 2ROLA 1UJ0A 2QDLA 1KIKA 2DBMA 1Z9QA 1RUWA 5GJWB 2A36A 1NEBA 1UDLA 2F2VA 1KFZA 2DILA 1J3TA 2DE0X 2LX7A 2YUNA 1ZBJA 1NLPC 2ABLA 1OEBA 2JMAA 2CSQA 2M0YA 2LZ6B 1QKWA 1SHGA 2BZ8A 2A08A 1WDXA 3VRYA 4HVWA 1KSWA 2FPFA 3R6NA 3QWXX 2C0TA 1MUZA 3KFVA 1RLQC 1T0JA 1QLYA 1WYXA 4GLMA 2W0ZA 2EGAA 1X69A 5FWCA 1AVZC 2E5KA 2NUZA 2YUPA 1YN8A 1BBZA 2RQRA 1U06A 4RTYA 2AK5A 2EYWA 2HBWA 2CH4W 2DJQA 2JS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  1GBQ A;  4J9C A;  4RTU A;  2BTT A;  4CC7 A;  4JJB A;  2PNI A;  4R0K A;  1OPK A;  3UF4 A;  2KYB A;  2RQU A;  2EGC A;  3I5R A;  1AWO A;  4Z8A A;  3TSW A;  2L0A A;  2O9V A;  3RBB B;  1E7O A;  1U3O A;  3SHW A;  1WI7 A;  1NYF A;  5FW9 A;  2J7I A;  4J9G A;  2DL3 A;  3VS6 A;  2CH4 A;  2JXB A;  4AG1 C;  1PKT A;  2RQV A;  1AEY A;  1B07 A;  2YDL A;  1GCQ C;  3UA6 A;  1X2K A;  2EBP A;  1VA7 A;  2EVR A;  3I9Q A;  2MIO A;  2ENM A;  3SEM A;  2KT8 A;  2CT4 A;  4X1V A;  1M27 C;  4IIM A;  4F17 A;  2J6K A;  1WXB A;  1CSK A;  2KEA A;  2EYZ A;  2KT1 A;  2KXD A;  2RMO A;  2I0N A;  1I07 A;  2DL7 A;  1ZUK A;  3M0T A;  5L23 A;  2AZS A;  2G6F X;  2RF0 A;  2KRN A;  2MCN A;  2IIM A;  2HDA A;  1H92 A;  1K0X A;  4F14 A;  2DL8 A;  1QWF A;  2JT4 A;  1ZUU A;  2CSI A;  5IHI A;  1W6X A;  1M3A A;  1JXM A;  3EG1 A;  2B86 A;  1PWT A;  2AKL A;  1NEG A;  2X3X D;  2GNC A;  1BB9 A;  1VYT A;  4Z89 A;  1JQQ A;  4J9E A;  1H8K A;  2C0O A;  3M0Q A;  2LJ3 A;  1OV3 A;  2EW3 A;  2O2O A;  2LJ0 A;  1WA7 A;  4J9B A;  3M0R A;  4F16 A;  2YUQ A;  1ABQ A;  2FPE A;  1GL5 A;  1W70 A;  2KRO A;  1TG0 A;  3QWY A;  1UTI A;  1QKX A;  2LNH B;  2K9G A;  2JM9 A;  1Z9Z A;  2D8J A;  1UG1 A;  1GCP A;  4JZ4 A;  2HCK A;  2KRS A;  1X6G A;  1K0S A;  2DYB A;  2JS0 A;  4LN2 A;  2M51 A;  3FJ5 A;  2C0I A;  2GBQ A;  3REA B;  2DMO A;  1K9A A;  2DRM A;  1SEM A;  1M8M A;  4E6R A;  5FWB A;  2XMF A;  2LMJ A;  2KNB B;  1X27 A;  2H8H A;  1PRM C;  1K1Z A;  1QWE A;  1BU1 A;  1T3L A;  3I5S A;  1T0H A;  4HVV A;  2LQN A;  1AOJ A;  2L3S A;  3VS2 A;  2OJ2 A;  4OMM A;  2CUB A;  4ORZ A;  2AZV A;  1CKA A;  3RNJ A;  5IXB A;  2J6F A;  1SPK A;  2DRK A;  1GFC A;  1SRM A;  1PNJ A;  1X2Q A;  4JJD A;  3NGP A;  3IQL A;  1JXO A;  2DL5 A;  5I11 A;  4JZ3 A;  3GBQ A;  1ZUY A;  4M4Z A;  2JW4 A;  2DL4 A;  1I0C A;  1UE9 A;  4LE9 A;  2CUD A;  3M0S A;  4LUD A;  4ZNX A;  1GBR A;  2DA9 A;  1MV0 B;  1NLO C;  1PHT A;  3LH5 A;  3M0U A;  2O88 A;  3EG0 A;  2ECZ A;  1X6B A;  1ZSG A;  2DNU A;  2LJ1 A;  1WXT A;  1TUC A;  3ULR B;  2BZY A;  2ROT A;  2PZ1 A;  1PRL C;  1E6G A;  2RN8 A;  1UEC A;  1AZE A;  1M3B A;  2CDT A;  1SRL A;  1V1C A;  1Y57 A;  3REB B;  2GTO A;  4DEY A;  1HJD A;  1AWJ A;  1IO6 A;  4J9H A;  4HVU A;  4J9F A;  3VS1 A;  4K11 A;  3VRZ A;  4RTT A;  2EKH A;  3TVT A;  1AD5 A;  4RTW A;  2D0N A;  4JJC A;  2CT3 A;  2FRW A;  3NPF A;  1OPL A;  1ZX6 A;  1KJW A;  2EGE A;  4AFU C;  5I22 A;  2J06 A;  1UFF A;  2SEM A;  3M0P A;  2RPN A;  2DM1 A;  5ECA A;  2LCS A;  3EHQ A;  2V1R A;  1K4U S;  4AFS C;  2KGT A;  2DF6 A;  2KBT A;  4RTX A;  3VS5 A;  3H0I A;  2YT6 A;  4A63 B;  2L3P A;  2P4R A;  1ARK A;  1UHF A;  1TUD A;  2KRM A;  2F2X A;  3THK A;  5GJV B;  2EPD A;  2KXC A;  5IH2 A;  3VS3 A;  2A28 A;  2OAW A;  1SSH A;  3EGU A;  1OOT A;  2GTJ A;  1W1F A;  1CKB A;  1NYG A;  2JMC A;  1B3Q A;  1XOV A;  4Z88 A;  3VS4 A;  2D8H A;  1VYV A;  3O5Z A;  3H0H A;  1GCQ A;  5IHN A;  2GQI A;  2X3W D;  3UAT A;  3H41 A;  5IHK A;  1PKS A;  2DX1 A;  1VYU A;  2LQW A;  2EYX A;  1Y0M A;  4J9D A;  1NG2 A;  2DBK A;  1A0N B;  3PE0 A;  1G2B A;  2NWM A;  4RTZ A;  1WFW A;  4OMP A;  2PTK A;  1UHC A;  4EIK A;  2MOX A;  1FYN A;  1GRI A;  1QCF A;  2ESW A;  3VS0 A;  2VVK A;  2FRY A;  4JPB W;  4CC4 B;  2K79 A;  2A37 A;  3C0C A;  3I35 A;  1UJY A;  1LCK A;  1WXU A;  1AWW A;  3VS7 A;  1K76 A;  4ESR A;  3CQT A;  2ED1 A;  4RUG A;  1YWO A;  4KRT A;  1YP5 A;  2V1Q A;  5EC7 A;  4CC3 A;  2FG0 A;  3A98 A;  2AKK A;  4LNP A;  2O9S A;  2JTE A;  2L3Q A;  2EYY A;  1G83 A;  3ZL7 C;  1S1N A;  2VWF A;  4J9I A;  2J05 A;  2W10 A;  3NMZ C;  1AZG B;  1I1J A;  2JM8 A;  3JV3 A;  1JO8 A;  4IIO A;  4AFZ C;  2YSQ A;  2J6O A;  1YCS B;  2K2M A;  3TSZ A;  2RQW A;  3EG2 A;  1RLP C;  1HD3 A;  4LUE A;  1WIE A;  1U5S A;  2VKN A;  2KR3 A;  2HSP A;  1RI9 A;  1E6H A;  1ABO A;  2RNA A;  5IXF A;  2OI3 A;  4QT7 A;  1M3C A;  5HCK A;  2DVJ A;  1N5Z A;  4AG2 C;  2FEI A;  4OMO A;  2SRC A;  1BK2 A;  2DLP A;  2RQT A;  1UGV A;  2KE9 A;  2K7A A;  4D8K A;  2F2W A;  4HXJ A;  1GFD A;  4RTV A;  4OMQ A;  4DEX A;  3PVL A;  1M30 A;  4D8D A;  2HEQ A;  3EG3 A;  1MV3 A;  1T3S A;  3U23 A;  4FSS A;  4Y92 A;  2GGR A;  1H3H A;  1YNZ A;  2BZX A;  4CC2 A;  2LP5 A;  3PVQ A;  4HCK A;  1SHF A;  4WCI A;  1YWP A;  2K6D A;  3H0F A;  1FMK A;  1WLP B;  2EQI A;  2L2P A;  1NM7 A;  1JEG A;  4OML A;  1UUE A;  3NHN A;  2FPD A;  3UA7 A;  4OMN A;  1AWX A;  2KYM A;  2CRE A;  4AFQ C;  1JU5 C;  2ED0 A;  1WX6 A;  2D1X A;  4GBQ A;  1HSQ A;  1EFN A;  1ZLM A;  2YUO A;  2K3B A;  1X43 A;  2FO0 A;  2O31 A;  2ROL A;  1UJ0 A;  2QDL A;  1KIK A;  2DBM A;  1Z9Q A;  1RUW A;  5GJW B;  2A36 A;  1NEB A;  1UDL A;  2F2V A;  1KFZ A;  2DIL A;  1J3T A;  2DE0 X;  2LX7 A;  2YUN A;  1ZBJ A;  1NLP C;  2ABL A;  1OEB A;  2JMA A;  2CSQ A;  2M0Y A;  2LZ6 B;  1QKW A;  1SHG A;  2BZ8 A;  2A08 A;  1WDX A;  3VRY A;  4HVW A;  1KSW A;  2FPF A;  3R6N A;  3QWX X;  2C0T A;  1MUZ A;  3KFV A;  1RLQ C;  1T0J A;  1QLY A;  1WYX A;  4GLM A;  2W0Z A;  2EGA A;  1X69 A;  5FWC A;  1AVZ C;  2E5K A;  2NUZ A;  2YUP A;  1YN8 A;  1BBZ A;  2RQR A;  1U06 A;  4RTY A;  2AK5 A;  2EYW A;  2HBW A;  2CH4 W;  2DJQ A;  2JS2 A; 
#chains in the Genus database with same CATH topology
 2QQB A;  4J9C A;  2RB6 A;  4CC7 A;  2MK5 A;  2P0K A;  3OY9 A;  4BI4 A;  1Q95 G;  1NZ9 A;  3UF4 A;  3L2Z A;  2VV5 A;  2L0A A;  3JCM f;  5EG2 A;  4HCB A;  2QA4 T;  3SHW A;  1YHQ A;  2LDM A;  3OSS C;  5HY6 A;  4GY5 A;  2NUT A;  4X34 A;  5J39 A;  4XU0 A;  4C92 F;  1I5L A;  1NJI U;  4M75 A;  2ZZD A;  1X2K A;  4XQ3 A;  2MIO A;  2K5L A;  2ENM A;  3A1P A;  4BDY A;  3OQ5 A;  1ZHI A;  2PVD B;  2CT4 A;  1Q7Y R;  4QVC A;  2J6K A;  1WXB A;  4OMF B;  1WNL A;  4M75 G;  3VUZ A;  8ATC B;  1Q7Y C;  2RI3 A;  3M9Q A;  1YCY A;  3EGX B;  2RF0 A;  1ACM B;  2FYK A;  1K0X A;  2LT1 A;  3QZ9 B;  2JT4 A;  3GLX A;  2K3X A;  2CSI A;  2LQK A;  2LX9 A;  3TRE A;  5GAO l;  1M3A A;  1JXM A;  2F5T X;  3VV0 A;  2ATC B;  3MCA B;  4M7A G;  3PFS A;  4FT4 A;  3OYI A;  1NEG A;  2DO3 A;  3CCR A;  2GNC A;  1VYT A;  3RDV A;  2HQH A;  4J9E A;  3I55 A;  4M7D F;  1H8K A;  2P0P A;  1G3Y A;  4LDV A;  2C0O A;  1BI1 A;  1OV3 A;  1YIJ T;  2CP2 A;  3QHS A;  1M4Z A;  3D7S B;  2FPE A;  1GL5 A;  3CPW A;  2BE9 B;  1N8R R;  3JB9 I;  3QWY A;  2I2L A;  2K9G A;  1GCP A;  2M16 A;  2KRS A;  3CEY A;  5A0L A;  3F70 A;  2OAU A;  3GNG A;  1UGR B;  3M56 A;  1SKU B;  4LN2 A;  2QTX A;  1BCM A;  1BKB A;  2VGM A;  2RK2 A;  3VKI A;  2YWW A;  2DMO A;  3QZ5 B;  2DRM A;  3UPU A;  4E6R A;  4LD9 K;  2DXB A;  1X27 A;  2H8H A;  4XU3 A;  3I5S A;  1BU1 A;  4Z02 A;  4C8Q F;  2L3S A;  1KK7 A;  5CO7 A;  5GAO m;  1WHH A;  3CCE Q;  2CUB A;  5GAN 5;  4ORZ A;  1IGU A;  2JJ9 A;  3OS1 A;  1YI2 A;  2J6F A;  4AT1 B;  3WVE B;  2GCX A;  2HL5 C;  4JJD A;  3S6W A;  3R6O A;  3IQL A;  1KD1 U;  1JXO A;  5I11 A;  3CC4 A;  4E7L A;  3FIF A;  1UEB A;  5I21 A;  4FCY A;  3Q1J A;  2XDB A;  4BE1 A;  1IGQ A;  2DTH A;  2JW4 A;  4EPC A;  1I0C A;  3PIO A;  3M0S A;  1N9R A;  4LUD A;  4PJO E;  3FDR A;  1GBR A;  1V29 B;  3LH5 A;  3CCS Q;  2IG0 A;  2MYS A;  3QJY A;  1X6B A;  2DNU A;  2CZ6 B;  2QAZ A;  3ULR B;  4XU1 A;  4RCB A;  4J6W A;  1D0Y A;  3OYL A;  2NUP B;  2X4Y A;  2E6Z A;  1UEC A;  2GQV A;  3VU3 C;  3L2U A;  1AZE A;  2CDT A;  3EGX A;  1NJI R;  1V1C A;  3H9N A;  4PKC C;  4C92 E;  2XIC A;  4PJM A;  4J9H A;  2VYT A;  2EKH A;  3OW2 A;  3QDF A;  4JRP A;  1ZX6 A;  3X28 B;  1M5Q 1;  2SEM A;  2RH2 A;  2DM1 A;  4FT2 A;  5CR2 A;  1EZZ B;  5ECA A;  3EHQ A;  3OYH A;  2KBT A;  4PJO D;  5LJ3 h;  4EMK B;  1VQ9 A;  4OB2 B;  4KH0 B;  2XU8 A;  2X35 A;  3MEU A;  2KRM A;  3QKJ A;  3TEE A;  1TWB A;  2XDD A;  1B7T A;  1NYG A;  2HSE B;  1WHL A;  2DFU A;  3CCM A;  1IRX A;  1XOV A;  3C95 A;  2JZ2 A;  2D8H A;  2QEX A;  3O5Z A;  3H0H A;  4C92 D;  2X3W D;  5IHK A;  2LQW A;  1Y0M A;  4JDS A;  3PE0 A;  3CCE T;  2NWM A;  1WFW A;  2E4H A;  3RMQ A;  5KYX A;  1RAA B;  2RK1 A;  2QK0 A;  3MHX A;  5D6W A;  3C0C A;  2F5K A;  5A2Q E;  1UGQ B;  3A5Z B;  3CCQ Q;  3M4G A;  2Y90 A;  1YWO A;  2EWN A;  1KHI A;  3CCS T;  1RAH B;  4M78 F;  3E2U A;  3CMA A;  5HKC A;  4LD6 A;  1WQW A;  3LW5 E;  4C8Q E;  3EH2 A;  3BY7 A;  3NMZ C;  1JO8 A;  2YSQ A;  2J6O A;  2RJF A;  3EG9 B;  1OU9 A;  1YCS B;  5GAM h;  4M7D D;  1JJ2 A;  4BY6 B;  2COZ A;  1KD1 R;  1RLP C;  3E9G A;  1S72 A;  1QVF A;  3UWN A;  1U5S A;  2ZPH B;  2KR3 A;  3G4S A;  1E6H A;  1ABO A;  5IXF A;  1I81 A;  1VQ8 A;  2E70 A;  2OI3 A;  2RHZ A;  2QAS A;  1N5Z A;  1VQ7 Q;  3ME9 A;  3V8L A;  3UDC A;  3JCM P;  1M1F A;  5GAO q;  1GFD A;  4ZGJ B;  4RTV A;  1QVG S;  2HEQ A;  2E5Q A;  3EG3 A;  5KE2 A;  2DPP B;  2OTJ Q;  3LLR A;  4LDX A;  3A8H B;  3CXC A;  4EMK A;  5CIU A;  4PLL A;  5GAO p;  1QP3 A;  3CPW P;  2D9T A;  3DB3 A;  4ELY C;  5AT1 B;  1YWP A;  3H0F A;  2DTI A;  3CCV T;  1JEG A;  5CK9 A;  4OML A;  2RI2 A;  5GMK h;  1HXD A;  1KQS A;  2VXE A;  5CVI A;  3SWN C;  1JU5 C;  3I56 A;  1HSQ A;  2EJF A;  1ZLM A;  3M54 A;  1GXI E;  1VOM A;  1Q82 C;  2DXC A;  2EJ9 A;  3JAM E;  1X43 A;  2ROL A;  1F1B B;  5LJ3 g;  4F7U F;  1KIK A;  4M7A E;  1RUW A;  3CCQ T;  2DD5 A;  3GPL A;  2XD0 A;  2KSS A;  3SD4 A;  3MP1 A;  4XAX B;  1MMN A;  2XK0 A;  2M0Y A;  2QYZ A;  1QKW A;  3MP8 A;  4DQ2 A;  3NFC A;  4E2F B;  4A54 A;  1U8R A;  4PJO A;  2OTL A;  3QG1 A;  3KBG A;  4RMO A;  1FXX A;  4FYX B;  4C8Q B;  3VRY A;  4IUU A;  4HVW A;  1WQ7 A;  2K4Y A;  3R6N A;  4IUT A;  2CP6 A;  3KFV A;  3EAE A;  3QXE B;  1IXD A;  2W0Z A;  3ZEH A;  3OSV A;  1D1A A;  4PJO G;  4IKF A;  3BE3 A;  4N4H A;  4RTY A;  4C92 A;  2EYW A;  2CH4 W;  2ZPI B;  1MNE A;  5GAN h;  4Y28 E;  1VQ7 T;  5GMK m;  4N4G A;  3OYF A;  2KYB A;  2RQU A;  1AWO A;  3TSW A;  3JCM Q;  3C12 A;  1U3O A;  2R57 A;  1W4S A;  1WI7 A;  4KT0 E;  1NYF A;  4M78 E;  4C92 G;  3CCR Q;  2OTJ T;  2DL3 A;  2PQW A;  4UC4 A;  3VS6 A;  1PD1 A;  1OZ2 A;  2JXB A;  4AG1 C;  1PKT A;  2P0Q A;  1B07 A;  2Y4X A;  1GCQ C;  3OYE A;  3LGL A;  2NUT B;  2EBP A;  5DY9 A;  5GAM g;  2MAM A;  1EIF A;  1WGS A;  1X01 A;  3PTA A;  3CCQ A;  3JCM h;  1OYX A;  2KT8 A;  3RMS A;  3EH1 A;  2FHD A;  3J80 E;  3ZFJ A;  2RO0 A;  4HCZ A;  1CSK A;  2KEA A;  2KXD A;  2RMO A;  3QJ6 A;  1I07 A;  2DL7 A;  2GFU A;  3M0T A;  3LYI A;  2G6F X;  1RAG B;  3RIR A;  4QQD A;  1G3T A;  2MCN A;  3OS0 A;  5KYU B;  2QQS A;  4M7A B;  1QWF A;  5DLO A;  2DER A;  1MHN A;  1ZUU A;  4FIB A;  2WSE E;  2E41 A;  2EJG A;  3OYC A;  2DAQ A;  2FZG B;  2B86 A;  1YI2 Q;  2AKL A;  3V8J A;  3J7A F;  2X3X D;  4M7D G;  1JQQ A;  1OU8 A;  3CC4 Q;  1VQ7 A;  2DZ9 A;  2LJ3 A;  1IRE B;  4LDY A;  1VQ6 A;  4KGV B;  2BUD A;  3PGG A;  1ABQ A;  1W70 A;  4O5V A;  3RUX A;  1DJ7 B;  2FVU A;  4C8Q A;  2E10 A;  1UTI A;  3RKX A;  3M57 A;  2LNH B;  2VC8 A;  2E12 A;  2R58 A;  4B9X A;  1X6G A;  4WF2 A;  2DYB A;  2JS0 A;  4F7U E;  2M51 A;  3QYG B;  2GBQ A;  3REA B;  2EFI A;  2EYQ A;  1SEM A;  1Y96 A;  2PU9 B;  2XMF A;  5FWB A;  5IT9 E;  5GAO r;  1JJ2 P;  2KNB B;  4A4H A;  1QWE A;  1QVP A;  1QVF P;  4N0A A;  4ZTJ A;  3CD6 A;  4D6W A;  1AOJ A;  3OS5 A;  4M78 B;  4A4G A;  4PL6 A;  3CCR T;  2AZV A;  1CKA A;  3RNJ A;  3PIP A;  5FRN A;  2DRK A;  1SRM A;  3I55 T;  2FZK B;  3NGP A;  1XQH A;  3ASK A;  4JZ3 A;  2EIF A;  1P92 A;  3GBQ A;  4XTW A;  5L8R E;  4KBM B;  2WSC E;  1HK9 A;  1UE9 A;  4HT9 A;  2DIG A;  1VQ9 Q;  3LX7 A;  4ZNX A;  3X20 B;  3CXC P;  3OYM A;  1WJQ A;  1I8F A;  5GAN g;  3BDL A;  1D1C A;  1WJR A;  2ECZ A;  1ZSG A;  2RJC A;  1MGQ A;  1VQ4 A;  2CYZ B;  4II1 A;  2BZY A;  3CCM Q;  4PFO A;  2PZ1 A;  4L6V 5;  1Q86 U;  2QEX Q;  1E6G A;  1O75 A;  2HNI A;  5CKB A;  4QW2 A;  1M3B A;  4E7Z A;  1SRL A;  1Y57 A;  5KYU A;  1AWJ A;  4M7A A;  1IO6 A;  1YI2 T;  4K11 A;  3JRZ A;  1AD5 A;  2D6F A;  3NPF A;  3CC4 T;  3QBY A;  1KJW A;  3JCM g;  4J6X A;  5I22 A;  2J06 A;  3M0P A;  4J7I A;  3MO8 A;  3S3N A;  1D3B A;  2YRD A;  2DD4 A;  4XU2 A;  3HRU A;  4E47 A;  3VS5 A;  3H0I A;  3OB9 A;  2DXT A;  2YT6 A;  3CCU A;  4A63 B;  2P4R A;  3MJX A;  5FU6 C;  2RHY A;  4XTY A;  3CMA Q;  4F7U B;  1YJN A;  1VIF A;  3VS3 A;  3OBW A;  5I2M A;  1SSH A;  1OOT A;  2GTJ A;  3BFM A;  1D1B A;  4C5G A;  4M77 F;  1B3Q A;  3VS4 A;  4DBQ A;  3UAT A;  3ER0 A;  3H41 A;  2DX1 A;  4FM4 B;  4M75 C;  2NYS A;  4ATO A;  4J9D A;  1S72 Q;  2DBK A;  2HQX A;  1A0N B;  1G2B A;  4QVD A;  3JCM c;  4RTZ A;  3G4S Q;  1N9S A;  4OMP A;  4DBF A;  1VQ8 Q;  1UHC A;  2RHX A;  4BUG A;  2DKG A;  1U1S A;  2DET A;  4M78 A;  4MZP A;  2KMT A;  1FYN A;  4KUL A;  2ESW A;  3VS0 A;  2VVK A;  2FRY A;  2MWO A;  4JPB W;  5KYX B;  4BI8 B;  2V26 A;  1PC0 A;  4XTZ A;  3FJP A;  1WXU A;  3M53 A;  1AWW A;  1VQ9 T;  3OYB A;  3VS7 A;  1K76 A;  4ESR A;  3KXT A;  1BI3 A;  4RUG A;  4ZN3 A;  4KRT A;  4M78 G;  1QCN A;  2QDY B;  2V1Q A;  4PNO A;  4CC3 A;  2E3H A;  9ATC B;  4JJN K;  4A4F A;  3A98 A;  2AKK A;  4MZT A;  3ZL7 C;  1G83 A;  5IN1 A;  3CCM T;  1K73 U;  2VWF A;  4X9C A;  3MEW A;  2QEX T;  2A7Y A;  3EFS A;  2LC4 A;  1AZG B;  4IIO A;  1D0X A;  4AFZ C;  3OYN A;  3TSZ A;  2K2M A;  4ME7 A;  1HD3 A;  3I56 Q;  4PJJ A;  3SFM A;  3CBO A;  2X4W A;  5LJ5 h;  3VYG A;  5CKD A;  2RNA A;  2LVM A;  4FYY B;  2DVJ A;  2FEI A;  4OMO A;  3X26 B;  2DLP A;  1ZSZ B;  4C0G A;  1YJW A;  1NPR A;  4E7S A;  4DEX A;  2E6N A;  2BE7 D;  4LXC A;  5KYN A;  4QQ6 A;  1Q86 R;  1Q82 U;  3JB9 F;  5FRO A;  1T3S A;  3U23 A;  1WHM A;  3CMA T;  4J8O A;  2OTL Q;  2YRV A;  1H3H A;  3AHU A;  5AYF A;  2BZX A;  4MDX A;  4EMH A;  1Q86 C;  4J83 A;  4WCI A;  4XK8 E;  4FL6 A;  4F7U A;  2L89 A;  1BIB A;  1AT1 B;  1OX8 A;  2RHU A;  1D0Z A;  2KVQ G;  3NHN A;  1V76 A;  3UA7 A;  1S72 T;  2O4X B;  3CBP A;  1VQN A;  2CRE A;  4AFQ C;  3G4S T;  3PMI A;  2PVO B;  3FRN A;  1KG1 A;  3FLG A;  1VQ8 T;  2E3I A;  3HHT B;  3P8B B;  2VUB A;  1Y71 A;  4OB0 B;  4R55 A;  2YUO A;  4F7U G;  2K3B A;  1QVG A;  2E1H A;  2QI2 A;  1WJS A;  2QDL A;  4XTV A;  5GJW B;  1WHK A;  4QKU A;  4M7D E;  2DIL A;  1J3T A;  1B34 A;  4ZGD B;  4IUV A;  2VB6 A;  2O01 E;  1TSF A;  4M77 E;  2BZ8 A;  2C06 A;  3MEV A;  4KH1 B;  2P84 A;  1EX4 A;  1WDX A;  2DTO A;  4PJO B;  3V7S A;  5A0D A;  1RLQ C;  1QLY A;  4DBR A;  1QMC A;  1WYX A;  1Y7X A;  4GLM A;  1RL2 A;  5FU7 B;  4BI3 A;  1Q81 U;  1AVZ C;  3OYY A;  1K8A U;  3I56 T;  2E5K A;  4C0Z A;  5C0M A;  1U06 A;  3V7R A;  1VQK A;  2HBW A;  2QG9 B;  4RKU E;  2JS2 A;  4J6Y A;  3EHR A;  2ZCF B;  2B8A A;  4C92 B;  4JJB A;  2PNI A;  3G71 Q;  1OPK A;  4HKE A;  4JLG A;  3I5R A;  4Z8A A;  2O9V A;  2CZ0 B;  5CCA A;  1E7O A;  5FW9 A;  3C4S A;  4J9G A;  2HBP A;  1K73 R;  1ZSZ A;  4M77 D;  4RG2 A;  1AEY A;  1HYO A;  2OTL T;  2YDL A;  2X4J A;  3CC2 A;  1VA7 A;  2EVR A;  1K73 C;  1VQ6 Q;  1G3S A;  1TTH B;  2JN0 A;  1NBE B;  1PCX A;  1YFN A;  1TUG B;  2KI7 A;  2VXF A;  4DOW A;  1M27 C;  4IIM A;  4F17 A;  5LJ5 g;  1FMW A;  1PD0 A;  1RAD B;  3G7Z A;  5KH6 A;  3JCM W;  2KT1 A;  1IB8 A;  3HFO A;  2NLU A;  4FYV B;  1ZUK A;  1SG5 A;  5LJ3 f;  2O4X A;  1M2O A;  5GMK i;  2AZS A;  1K9M U;  2KRN A;  3EGD B;  4JUV A;  2HDA A;  4E7J A;  1H92 A;  1C0M A;  2DVE A;  4F14 A;  3OMG A;  2Z0W A;  1NPP A;  2JTM A;  2VAS A;  3CD6 Q;  1XTD A;  1Q82 R;  4M7D B;  5IHI A;  1W6X A;  1G8X A;  3EG1 A;  1R0C B;  1PWT A;  3TCJ A;  3E19 A;  1BB9 A;  4Z89 A;  5GMK l;  4E7K A;  4BE2 A;  2JOY A;  2KK4 A;  3SDZ A;  1WZO A;  4JS5 A;  5FLX E;  3M0Q A;  2IVW A;  2O2O A;  1W2B S;  2WAC A;  2LJ0 A;  4J9B A;  3DLL A;  3LH0 A;  8AT1 B;  2M02 A;  3N5B B;  1IHW A;  2RM4 A;  3GP8 A;  3HPW A;  5KE3 A;  5D7U A;  5CKE A;  2JM9 A;  2D8J A;  4F04 B;  2HCK A;  1VQM A;  4XTX A;  1VQ4 Q;  1VQO A;  1K0S A;  3HL8 A;  4L59 A;  5HK3 A;  3FJ5 A;  2C0I A;  1M1G A;  3CME A;  1SSF A;  5KCH A;  1BI2 A;  3JB9 D;  1QVF S;  1KC8 C;  1T3L A;  1K1Z A;  3J81 E;  4HVV A;  2LQN A;  1Y96 B;  1TXQ A;  3VS2 A;  1Y07 A;  4EMK C;  1PG5 B;  4DA4 A;  2OJ2 A;  4OMM A;  4M75 D;  4PJL A;  1WPY A;  5IXB A;  1SPK A;  2EQK A;  2K5I A;  5CKF A;  1PNJ A;  5GAM f;  2KDS A;  2RJD A;  1G5V A;  1VQ6 T;  1Q81 R;  4A4E A;  1K8A R;  2DL4 A;  3OW2 P;  4LE9 A;  2CUD A;  3CCU Q;  4ANJ A;  2L3R A;  3CXC S;  1Q81 C;  5KYY B;  4VUB A;  1BYM A;  2DA9 A;  1K8A C;  4A4K A;  1MV0 B;  1NLO C;  1PHT A;  1YJN Q;  2O88 A;  3DB4 A;  3A8M B;  1WXT A;  1TUC A;  1PRL C;  3L1A A;  3V7C A;  2RN8 A;  3CD6 T;  4FSX A;  3EGD A;  2GTO A;  4DEY A;  2RD1 A;  1YBY A;  6AT1 B;  1D09 B;  1HJD A;  1YJ9 A;  5LJ3 j;  4HVU A;  3CPF A;  1RI0 A;  3VRZ A;  4M7D A;  4RTW A;  2CT3 A;  1U1T A;  1OPL A;  1OX9 A;  2CP0 A;  1SF9 A;  1X6O A;  2EGE A;  3QSU A;  4AFU C;  1JRI A;  3G71 A;  2DEU A;  4M77 A;  2LCS A;  3HFN A;  4JS4 A;  1K4U S;  4KUI A;  2YRC A;  2DF6 A;  4C92 C;  4RTX A;  1LOJ A;  1D3B B;  3M4Y A;  3S3M A;  1I5O B;  1RAB B;  2L3P A;  1K9M R;  4BY6 C;  2HL3 A;  1PSF A;  1ARK A;  1UHF A;  2COW A;  3GF5 A;  4B9W A;  1VQ4 T;  5D6X A;  5GJV B;  1M1K C;  2EPD A;  2KXC A;  2RJE A;  4J7F A;  4M77 G;  2OAW A;  1K9M C;  2H3J A;  3ZBD A;  1CKB A;  2LQ8 A;  3G6E A;  2JMC A;  4Z88 A;  3L2R A;  3TU4 K;  3INZ A;  3OYK A;  5IHN A;  2M9U A;  2GQI A;  1ZA1 B;  2X51 A;  4TVR A;  1PKS A;  1VQ5 A;  1VQP A;  4OB3 B;  2GFA A;  2PTK A;  2HQE A;  4NL2 A;  3WVD B;  1GRI A;  1M2V A;  1QCF A;  4QQG A;  3RR6 A;  3EFR A;  1YJW Q;  4PJN A;  3DLM A;  1MMG A;  3CCU T;  1BCO A;  1C6V X;  4ELZ C;  2LCL A;  5GAM j;  2ED1 A;  3SB2 A;  4C5E A;  1XJW B;  4ZGE B;  4R56 A;  1YJN T;  5CQY A;  2FG0 A;  2IPO B;  4FW1 A;  1KHC A;  5KYY A;  1OZ3 A;  5C6S A;  2YHT A;  2J05 A;  2XID A;  1I1J A;  2JM8 A;  4J5Y A;  3JV3 A;  1KQ2 A;  5J3B A;  1VQN Q;  2RQW A;  2HKQ B;  4E7I A;  1LNX A;  3JCM V;  4LUE A;  5LL6 S;  2VKN A;  5LJ3 d;  2HSP A;  1RI9 A;  5GAN 3;  3G1J A;  1VQL A;  1ZBX A;  3CCL A;  3EFO A;  1M3C A;  4C0F A;  5HCK A;  2M0O A;  2MWP A;  1IHV A;  4OP0 A;  4CRI A;  5LJ3 e;  1KQS P;  1MMA A;  4AG2 C;  2DXU A;  4C8Q C;  3CC7 A;  2HAX A;  1BK2 A;  2KY9 A;  2RQT A;  1UGV A;  2K7A A;  4D8K A;  2F2W A;  4OMQ A;  1YIT A;  1M30 A;  4Q5W A;  2K57 A;  5GMK j;  3JB9 G;  2XKO C;  3QUI A;  5KYW A;  3T9N A;  3FC3 A;  4ZTF A;  1MV3 A;  1TU0 B;  2LNV A;  4FU6 A;  4OB1 B;  4Y92 A;  2GGR A;  4N0A C;  4HCK A;  4JRI A;  4QVZ A;  2CZ7 B;  1FMK A;  2L8D A;  4IUR A;  3RES A;  1UUE A;  4HT8 A;  4OMN A;  1AWX A;  4PK4 A;  1VQK Q;  1WX6 A;  1EFN A;  3NTH A;  3E1S A;  2FO0 A;  2O31 A;  1UJ0 A;  4NL3 A;  2ZPB B;  1YJW T;  3QDR B;  3CCJ Q;  2MPX C;  2A36 A;  4AMC A;  2F2V A;  1KFZ A;  2RHI A;  2DE0 X;  5GAO n;  1QW1 A;  2YUN A;  2QA4 A;  4MML A;  2Y4Y A;  2ABL A;  2ZPF B;  2JMA A;  2CSQ A;  3E9F A;  5GAM d;  3CC2 Q;  1B34 B;  2JUF A;  3VUB A;  2A08 A;  1N8R C;  5GAM e;  5GAN j;  3H6Z A;  3PT9 A;  2FPF A;  1FMV A;  2ZGW A;  4M7A C;  3QWX X;  2C0T A;  1T0J A;  3OBY A;  1VQN T;  2EGA A;  4LDU A;  3JSC A;  3FEO A;  1N27 A;  2NUZ A;  3HSB A;  2YUP A;  1YN8 A;  1BBZ A;  2RQR A;  3X25 B;  3OYJ A;  3EG2 A;  2AHJ B;  2QTV A;  1GBQ A;  4RTU A;  2BTT A;  2P4T A;  2ZPG B;  4R0K A;  1XNI A;  2EGC A;  4BD3 A;  2FZC B;  5J26 A;  3RBB B;  2J7I A;  1UGS B;  4OVA A;  3SWN B;  2CH4 A;  3P8D A;  3GNF B;  3RKW A;  2RQV A;  5DLQ E;  3UA6 A;  5GMK e;  1JB0 E;  1LPL A;  2WSF E;  3I9Q A;  1PSE A;  1I4K 1;  2CP3 A;  3SEM A;  1YIJ A;  2EKO A;  3JB9 J;  4X1V A;  2DZC A;  4M78 C;  1VQM Q;  2XDP A;  2EYZ A;  1ZA2 B;  1PM3 A;  1VQO Q;  1VQK T;  2I0N A;  3CPW S;  2BKD N;  4M75 F;  5L23 A;  3CME Q;  2OX7 A;  2A0F B;  4C5I A;  2IIM A;  4JRK A;  1NJI C;  3VJP A;  4P5N A;  2A3L A;  2DL8 A;  1G3W A;  4IUP A;  4JRQ A;  3CCJ T;  3PMT A;  3VYH B;  1OUL A;  5CKH A;  2QGF B;  3V8K A;  2PVG B;  2V8K A;  1N6A A;  4M7A F;  3MP6 A;  3CC2 T;  2HZY A;  3O8V A;  2DJZ A;  1M9S A;  1KC8 U;  2EW3 A;  1WA7 A;  5GAN d;  3M0R A;  4F16 A;  2YUQ A;  4N4I A;  3JCM J;  2KRO A;  1TG0 A;  1LJO A;  3A8G B;  1M90 U;  5GAN e;  2PUK B;  3BDU A;  1QKX A;  3CCV Q;  4FW2 A;  1Z9Z A;  1UG1 A;  4JZ4 A;  1VUB A;  4PFZ A;  4RCC A;  3NTK A;  1K9A A;  1M8M A;  3QO3 A;  1TOV A;  5GAN 6;  5CAI A;  4YTL A;  2LMJ A;  2DIQ A;  1JBM A;  1PRM C;  3MET A;  1T0H A;  1YJ9 Q;  2D0Q B;  2GF7 A;  5I2S A;  1RAC B;  1UGP B;  2DK3 A;  5CQX A;  3JCM d;  1H64 1;  5IAY A;  2XG8 D;  1W2B A;  1GFC A;  3JCM e;  2F1L A;  1X2Q A;  3CBM A;  4BAC A;  3QII A;  2KAF A;  2EQM A;  2DL5 A;  2QQA A;  1TS9 A;  2XI9 A;  4E7H A;  2LCC A;  3SWN A;  3CCJ A;  4BDZ A;  5LJ5 f;  1ZUY A;  3GOX A;  4GLK A;  3OW2 S;  4M4Z A;  2L5Q A;  1OI1 A;  3MEA A;  4DBH A;  2DYI A;  2LTO A;  2RA2 A;  1RAI B;  3X24 B;  3QPH A;  2YLC A;  1VQM T;  3M0U A;  1VQO T;  1C1A A;  2MI6 A;  3EG0 A;  3CME T;  1R8O B;  2NUP A;  2LJ1 A;  2VGN A;  3MPU B;  3LGF A;  4JLI A;  3M59 A;  2ROT A;  3OYA A;  3G6E Q;  4Y91 A;  3OMC A;  2PUO B;  4A53 A;  4PLI A;  5HK0 A;  1ZQ1 A;  1KD1 C;  1VQ5 Q;  3HP9 A;  4RG8 A;  2DEQ A;  1VQP Q;  3REB B;  1M1K U;  4WTO B;  4BE0 A;  3HKS A;  2X9H A;  4J9F A;  3CCE A;  3VS1 A;  4RTT A;  1RAF B;  3TVT A;  2D0N A;  4JJC A;  2FRW A;  1MND A;  1QCO A;  1BIA A;  1UFF A;  2RPN A;  3H8Z A;  2V8J A;  4NS5 A;  4C8Q D;  2HMA A;  2V1R A;  5D6Y A;  4AFS C;  2KGT A;  2QXF A;  1KQ1 A;  4MMK A;  4M75 E;  4M77 B;  5GAN 2;  4C0D B;  5A0G A;  1TUD A;  3MKD A;  3RER A;  2F2X A;  3THK A;  3CCS A;  5IH2 A;  5KCO A;  5DM7 R;  2QGG A;  2A28 A;  3URG A;  2K2V A;  2YLB A;  3EGU A;  3L2Q A;  3BW1 A;  1W1F A;  4DOV A;  2EAY A;  1QQJ A;  2R5A A;  1VYV A;  3A8L B;  1ZSZ C;  1GCQ A;  1WHG A;  5GAN 4;  3UT1 A;  1VYU A;  2EYX A;  1YJ9 T;  3P8H A;  1NG2 A;  2CZ1 B;  3WXM B;  2HKN A;  1IZ6 A;  2CP5 A;  1YHQ Q;  1KC8 R;  3GIB A;  3TQ7 P;  1VQL Q;  4OGE A;  3CCL Q;  2FB7 A;  1OQK A;  4EIK A;  4IUQ A;  2MOX A;  4HCC A;  3G71 T;  2QQ9 A;  1JJ2 S;  3CC7 Q;  1M90 R;  3AT1 B;  4CC4 B;  2F69 A;  2K79 A;  2A37 A;  3M5A A;  3I35 A;  3L42 A;  4FYW B;  1M2V B;  1YIT Q;  1X75 C;  1UJY A;  1LCK A;  3OYG A;  2E65 A;  1M90 C;  2AT1 B;  2XHC A;  3CQT A;  1H3Z A;  3QYH B;  3L2W A;  2HD0 A;  2K3Y A;  1YP5 A;  2EQU A;  5EC7 A;  2X4X A;  2ZAE A;  2MMP A;  5LJ5 j;  4LNP A;  2YXY A;  1RAE B;  2O9S A;  2JTE A;  2L3Q A;  2EYY A;  2CP7 A;  3HTR A;  1S1N A;  2E64 A;  3G6E T;  4J9I A;  3EG9 A;  4EMG A;  2W10 A;  2COY A;  1VQ5 T;  2M1H A;  4C5H A;  4M7A D;  4KGX B;  1VQP T;  4XTU A;  3CCV A;  1R77 A;  1LVK A;  2BIV A;  5FU6 B;  2RI5 A;  3NTI A;  1WIE A;  3JB9 H;  2KQW A;  1Q7Y U;  4QT7 A;  1KQS S;  3LWI A;  3A8O B;  3M55 A;  3I55 Q;  4KUD K;  1VIE A;  2SRC A;  2AIR B;  4EDU A;  4PJO C;  3EFO B;  2KE9 A;  2K5F A;  4HXJ A;  4M75 B;  3FB9 A;  3PVL A;  2QA4 Q;  4D8D A;  1QVG P;  5FU7 C;  3C94 A;  3OS2 A;  4FSS A;  3HRS A;  4BB7 A;  5KYW B;  1YNZ A;  4CC2 A;  2LP5 A;  3PVQ A;  3OYD A;  1SHF A;  3DKM A;  1M1K R;  1WHJ A;  4V2S A;  1R0B G;  2JVV A;  2K6D A;  1WLP B;  2EQI A;  2V8I A;  2L2P A;  5M9O A;  2LT4 A;  1NM7 A;  4NOY A;  1O9S A;  2FPD A;  2CGH A;  4KGZ B;  2KYM A;  1YHQ T;  3KUF A;  4M78 D;  3S3O A;  2ED0 A;  2EQJ A;  1N8R U;  1VQL T;  2D1X A;  1FX7 A;  3CCL T;  2ZPE B;  4GBQ A;  4LDW A;  1QP2 A;  7AT1 B;  3CC7 T;  1NE8 A;  4ZN1 A;  4PFP A;  3OA6 A;  2DBM A;  1Z9Q A;  4HA8 A;  3JCM b;  1MMD A;  1FWZ A;  1NEB A;  1YIT T;  1UDL A;  1W2B P;  2JNG A;  2LX7 A;  4L5G A;  1ZBJ A;  4X9D A;  1NLP C;  3PNW C;  5GAN 7;  1OEB A;  2G3R A;  2LZ6 B;  2H3E B;  1UB4 A;  2LRQ A;  2OTJ A;  1SHG A;  5FRM A;  4B6M A;  3L2V A;  2JTF A;  3M58 A;  2CKK A;  2QQR A;  4OF1 A;  5LJ5 d;  5GAN f;  1M8V A;  4MZM A;  4CI0 C;  1KSW A;  1YIJ Q;  2FL7 A;  3JCM X;  3LWH A;  1MUZ A;  4OGC A;  5LJ5 e;  4O6J A;  4M7D C;  1AHJ B;  1BI0 A;  4MDW A;  2CS7 A;  4C8Q G;  2MF2 A;  1X69 A;  5FWC A;  1TH7 A;  2R5M A;  3HRT A;  4M77 C;  2AK5 A;  4PJO F;  4C0D C;  5GAN 8;  2DJQ A;  3RKY A; 
#chains in the Genus database with same CATH homology
 3EHR A;  1GBQ A;  4J9C A;  4RTU A;  2BTT A;  4CC7 A;  4JJB A;  2PNI A;  4R0K A;  1OPK A;  3UF4 A;  2KYB A;  2RQU A;  2EGC A;  3I5R A;  1AWO A;  4Z8A A;  3TSW A;  2L0A A;  2O9V A;  3RBB B;  1E7O A;  1U3O A;  3SHW A;  1WI7 A;  1NYF A;  5FW9 A;  2J7I A;  4J9G A;  2DL3 A;  3VS6 A;  2CH4 A;  2JXB A;  4AG1 C;  1PKT A;  2RQV A;  1AEY A;  1B07 A;  2YDL A;  1GCQ C;  3UA6 A;  1X2K A;  2EBP A;  1VA7 A;  2EVR A;  3I9Q A;  2MIO A;  2ENM A;  3SEM A;  2KT8 A;  2CT4 A;  4X1V A;  1M27 C;  4IIM A;  4F17 A;  2J6K A;  1WXB A;  1CSK A;  2KEA A;  2EYZ A;  2KT1 A;  2KXD A;  2RMO A;  2I0N A;  1I07 A;  2DL7 A;  1ZUK A;  3M0T A;  5L23 A;  2AZS A;  2G6F X;  2RF0 A;  2KRN A;  2MCN A;  2IIM A;  2HDA A;  1H92 A;  1K0X A;  4F14 A;  2DL8 A;  1QWF A;  2JT4 A;  1ZUU A;  2CSI A;  5IHI A;  1W6X A;  1M3A A;  1JXM A;  3EG1 A;  2B86 A;  1PWT A;  2AKL A;  1NEG A;  2X3X D;  2GNC A;  1BB9 A;  1VYT A;  4Z89 A;  1JQQ A;  4J9E A;  1H8K A;  2C0O A;  3M0Q A;  2LJ3 A;  1OV3 A;  2EW3 A;  2O2O A;  2LJ0 A;  1WA7 A;  4J9B A;  3M0R A;  4F16 A;  2YUQ A;  1ABQ A;  2FPE A;  1GL5 A;  1W70 A;  2KRO A;  1TG0 A;  3QWY A;  1UTI A;  1QKX A;  2LNH B;  2K9G A;  2JM9 A;  1Z9Z A;  2D8J A;  1UG1 A;  1GCP A;  4JZ4 A;  2HCK A;  2KRS A;  1X6G A;  1K0S A;  2DYB A;  2JS0 A;  4LN2 A;  2M51 A;  3FJ5 A;  2C0I A;  2GBQ A;  3REA B;  2DMO A;  1K9A A;  2DRM A;  1SEM A;  1M8M A;  4E6R A;  5FWB A;  2XMF A;  2LMJ A;  2KNB B;  1X27 A;  2H8H A;  1PRM C;  1K1Z A;  1QWE A;  1BU1 A;  1T3L A;  3I5S A;  1T0H A;  4HVV A;  2LQN A;  1AOJ A;  2L3S A;  3VS2 A;  2OJ2 A;  4OMM A;  2CUB A;  4ORZ A;  2AZV A;  1CKA A;  3RNJ A;  5IXB A;  2J6F A;  1SPK A;  2DRK A;  1GFC A;  1SRM A;  1PNJ A;  1X2Q A;  4JJD A;  3NGP A;  3IQL A;  1JXO A;  2DL5 A;  5I11 A;  4JZ3 A;  3GBQ A;  1ZUY A;  4M4Z A;  2JW4 A;  2DL4 A;  1I0C A;  1UE9 A;  4LE9 A;  2CUD A;  3M0S A;  4LUD A;  4ZNX A;  1GBR A;  2DA9 A;  1MV0 B;  1NLO C;  1PHT A;  3LH5 A;  3M0U A;  2O88 A;  3EG0 A;  2ECZ A;  1X6B A;  1ZSG A;  2DNU A;  2LJ1 A;  1WXT A;  1TUC A;  3ULR B;  2BZY A;  2ROT A;  2PZ1 A;  1PRL C;  1E6G A;  2RN8 A;  1UEC A;  1AZE A;  1M3B A;  2CDT A;  1SRL A;  1V1C A;  1Y57 A;  3REB B;  2GTO A;  4DEY A;  1HJD A;  1AWJ A;  1IO6 A;  4J9H A;  4HVU A;  4J9F A;  3VS1 A;  4K11 A;  3VRZ A;  4RTT A;  2EKH A;  3TVT A;  1AD5 A;  4RTW A;  2D0N A;  4JJC A;  2CT3 A;  2FRW A;  3NPF A;  1OPL A;  1ZX6 A;  1KJW A;  2EGE A;  4AFU C;  5I22 A;  2J06 A;  1UFF A;  2SEM A;  3M0P A;  2RPN A;  2DM1 A;  5ECA A;  2LCS A;  3EHQ A;  2V1R A;  1K4U S;  4AFS C;  2KGT A;  2DF6 A;  2KBT A;  4RTX A;  3VS5 A;  3H0I A;  2YT6 A;  4A63 B;  2L3P A;  2P4R A;  1ARK A;  1UHF A;  1TUD A;  2KRM A;  2F2X A;  3THK A;  5GJV B;  2EPD A;  2KXC A;  5IH2 A;  3VS3 A;  2A28 A;  2OAW A;  1SSH A;  3EGU A;  1OOT A;  2GTJ A;  1W1F A;  1CKB A;  1NYG A;  2JMC A;  1B3Q A;  1XOV A;  4Z88 A;  3VS4 A;  2D8H A;  1VYV A;  3O5Z A;  3H0H A;  1GCQ A;  5IHN A;  2GQI A;  2X3W D;  3UAT A;  3H41 A;  5IHK A;  1PKS A;  2DX1 A;  1VYU A;  2LQW A;  2EYX A;  1Y0M A;  4J9D A;  1NG2 A;  2DBK A;  1A0N B;  3PE0 A;  1G2B A;  2NWM A;  4RTZ A;  1WFW A;  4OMP A;  2PTK A;  1UHC A;  4EIK A;  2MOX A;  1FYN A;  1GRI A;  1QCF A;  2ESW A;  3VS0 A;  2VVK A;  2FRY A;  4JPB W;  4CC4 B;  2K79 A;  2A37 A;  3C0C A;  3I35 A;  1UJY A;  1LCK A;  1WXU A;  1AWW A;  3VS7 A;  1K76 A;  4ESR A;  3CQT A;  2ED1 A;  4RUG A;  1YWO A;  4KRT A;  1YP5 A;  2V1Q A;  5EC7 A;  4CC3 A;  2FG0 A;  3A98 A;  2AKK A;  4LNP A;  2O9S A;  2JTE A;  2L3Q A;  2EYY A;  1G83 A;  3ZL7 C;  1S1N A;  2VWF A;  4J9I A;  2J05 A;  2W10 A;  3NMZ C;  1AZG B;  1I1J A;  2JM8 A;  3JV3 A;  1JO8 A;  4IIO A;  4AFZ C;  2YSQ A;  2J6O A;  1YCS B;  2K2M A;  3TSZ A;  2RQW A;  3EG2 A;  1RLP C;  1HD3 A;  4LUE A;  1WIE A;  1U5S A;  2VKN A;  2KR3 A;  2HSP A;  1RI9 A;  1E6H A;  1ABO A;  2RNA A;  5IXF A;  2OI3 A;  4QT7 A;  1M3C A;  5HCK A;  2DVJ A;  1N5Z A;  4AG2 C;  2FEI A;  4OMO A;  2SRC A;  1BK2 A;  2DLP A;  2RQT A;  1UGV A;  2KE9 A;  2K7A A;  4D8K A;  2F2W A;  4HXJ A;  1GFD A;  4RTV A;  4OMQ A;  4DEX A;  3PVL A;  1M30 A;  4D8D A;  2HEQ A;  3EG3 A;  1MV3 A;  1T3S A;  3U23 A;  4FSS A;  4Y92 A;  2GGR A;  1H3H A;  1YNZ A;  2BZX A;  4CC2 A;  2LP5 A;  3PVQ A;  4HCK A;  1SHF A;  4WCI A;  1YWP A;  2K6D A;  3H0F A;  1FMK A;  1WLP B;  2EQI A;  2L2P A;  1NM7 A;  1JEG A;  4OML A;  1UUE A;  3NHN A;  2FPD A;  3UA7 A;  4OMN A;  1AWX A;  2KYM A;  2CRE A;  4AFQ C;  1JU5 C;  2ED0 A;  1WX6 A;  2D1X A;  4GBQ A;  1HSQ A;  1EFN A;  1ZLM A;  2YUO A;  2K3B A;  1X43 A;  2FO0 A;  2O31 A;  2ROL A;  1UJ0 A;  2QDL A;  1KIK A;  2DBM A;  1Z9Q A;  1RUW A;  5GJW B;  2A36 A;  1NEB A;  1UDL A;  2F2V A;  1KFZ A;  2DIL A;  1J3T A;  2DE0 X;  2LX7 A;  2YUN A;  1ZBJ A;  1NLP C;  2ABL A;  1OEB A;  2JMA A;  2CSQ A;  2M0Y A;  2LZ6 B;  1QKW A;  1SHG A;  2BZ8 A;  2A08 A;  1WDX A;  3VRY A;  4HVW A;  1KSW A;  2FPF A;  3R6N A;  3QWX X;  2C0T A;  1MUZ A;  3KFV A;  1RLQ C;  1T0J A;  1QLY A;  1WYX A;  4GLM A;  2W0Z A;  2EGA A;  1X69 A;  5FWC A;  1AVZ C;  2E5K A;  2NUZ A;  2YUP A;  1YN8 A;  1BBZ A;  2RQR A;  1U06 A;  4RTY A;  2AK5 A;  2EYW A;  2HBW A;  2CH4 W;  2DJQ A;  2JS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...