1H3HA

Structural basis for specific recognition of an rxxk-containing slp-76 peptide by the gads c-terminal sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
GRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GRB2-RELATED ADAPTOR PROTEIN 2
publication title Structural Basis for Specific Binding of the Gads SH3 Domain to an Rxxk Motif-Containing Slp-76 Peptide: A Novel Mode of Peptide Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h3hA00
2A36A 1I1JA 1WLPB 1X27A 3I5SA 1TG0A 2O88A 3IQLA 2ECZA 1V1CA 4AFSC 4RTYA 3EG3A 1AZGB 4CC4B 2RQRA 2FEIA 4GLMA 3UF4A 2SEMA 2HSPA 2GBQA 3VRYA 2DNUA 2VKNA 2EQIA 1GL5A 1UG1A 5FWCA 2A37A 2F2WA 2CREA 3R6NA 1AZEA 2CUBA 1GFDA 2GQIA 4JJBA 2JS0A 4LE9A 2O9VA 3VS5A 4J9GA 1I0CA 1M3CA 3H0FA 2OJ2A 3PE0A 3EG1A 3TSZA 1KFZA 2FG0A 3EGUA 2O31A 1WXTA 2CH4A 2D1XA 1YWOA 1XOVA 2GGRA 1AEYA 2NWMA 2LCSA 4GBQA 2LJ0A 4AFUC 2C0IA 2A28A 2LQNA 1GBRA 1QLYA 2RN8A 2RMOA 4J9BA 1SSHA 1GCQC 1HSQA 3EG0A 2YUPA 4DEXA 4OMNA 1ZLMA 5IHIA 3VS0A 2K6DA 2KR3A 1J3TA 2J6FA 1UTIA 2BTTA 2DBMA 1PKSA 2DILA 1ZUKA 3H0IA 1AOJA 1UE9A 2HDAA 3QWYA 1SHGA 2YUOA 1X6BA 2K2MA 1UHCA 1QKXA 2K9GA 2KYMA 1SEMA 2E5KA 2GTJA 1M27C 2DL8A 3ULRB 2JS2A 1B07A 4DEYA 1UHFA 1K76A 1AD5A 1ABQA 2EGCA 4QT7A 3VS4A 1VYTA 1WIEA 4RTXA 2J06A 3VS3A 2CH4W 4HCKA 4AG1C 1X6GA 2FO0A 2C0TA 2ROTA 2YDLA 4J9EA 1OEBA 1H3HA 1SPKA 4Z89A 1YCSB 2PTKA 2KGTA 2CSQA 2FRYA 1UUEA 2A08A 4ESRA 2DX1A 2DBKA 4LNPA 1K9AA 3H41A 2PNIA 2L3SA 1QCFA 2EPDA 2XMFA 1T0JA 1IO6A 2FPDA 1JU5C 1ZUYA 1HJDA 1NYFA 2H8HA 4F17A 2BZYA 4J9FA 5HCKA 2DL3A 2EBPA 4Y92A 1NEBA 2DA9A 2JM8A 1TUCA 1YWPA 3VS1A 1RI9A 2KRNA 2I0NA 5IH2A 1PNJA 1OV3A 3TVTA 1GFCA 1KSWA 1N5ZA 1GCPA 1YN8A 2QDLA 3PVQA 2KYBA 2EYYA 2P4RA 1NM7A 2EW3A 2JW4A 1ARKA 1Y57A 1K0XA 3CQTA 1QWFA 2EVRA 3REBB 1EFNA 4J9DA 2D8HA 1Z9QA 3C0CA 1S1NA 4HVVA 2RF0A 2AKKA 2F2VA 4JZ4A 2DM1A 2J05A 2K79A 2ED0A 2KT8A 4OMOA 4CC3A 4K11A 1JXMA 1T3LA 1ABOA 1YP5A 1E7OA 5FWBA 4IIMA 5GJVB 1H8KA 2JM9A 1X2KA 2HEQA 4OMQA 2DRMA 2G6FX 1WA7A 1JEGA 3U23A 1HD3A 2JXBA 2FRWA 4IIOA 2L3PA 5IXFA 1WX6A 1W6XA 2RQVA 2DRKA 2CDTA 3UA6A 4F16A 1ZX6A 4CC2A 2KRSA 5EC7A 3VS7A 1M3BA 2KXDA 3REAB 2O2OA 1Y0MA 3LH5A 4X1VA 2LP5A 1SRMA 4KRTA 1SRLA 1CKAA 2BZ8A 2AKLA 4JZ3A 3M0RA 3M0TA 2DE0X 1PRLC 2JMAA 4Z88A 2EKHA 1SHFA 1K4US 2PZ1A 2ED1A 2ENMA 2MCNA 1UGVA 1FMKA 4JPBW 2FPFA 2NUZA 1JQQA 1X69A 2DYBA 4HVUA 3NGPA 1YNZA 2IIMA 1UFFA 4D8KA 2DVJA 1WDXA 4HVWA 3H0HA 1H92A 1U3OA 1KJWA 3GBQA 3THKA 3O5ZA 1AVZC 2CT3A 2ESWA 4RUGA 2YUQA 1TUDA 1RLQC 2J6KA 5IHNA 3FJ5A 1B3QA 2B86A 1WYXA 2DL7A 2KRMA 5IXBA 1RLPC 1X2QA 1OOTA 4J9CA 2K7AA 3EHRA 4WCIA 1E6GA 3EG2A 1VA7A 5FW9A 2X3XD 4RTTA 5I22A 2L0AA 1WXBA 4A63B 1X43A 1ZUUA 3KFVA 3I9QA 1WI7A 3TSWA 1NLPC 3RNJA 2L2PA 2KNBB 3SEMA 4Z8AA 4J9IA 2J7IA 2JT4A 2KT1A 2ABLA 2HCKA 2YT6A 2M0YA 2L3QA 4LUEA 1AWXA 2EYXA 3NHNA 1VYVA 1LCKA 1PKTA 2DL5A 2OAWA 3JV3A 2EGAA 2GTOA 2DL4A 1JXOA 1NG2A 2VWFA 1CSKA 2RQWA 4AFZC 4JJDA 2LMJA 1BU1A 1OPKA 1GBQA 2RPNA 5I11A 2W10A 2J6OA 4LUDA 1NYGA 2EGEA 2BZXA 2DMOA 4RTUA 4OMPA 4RTZA 1NEGA 1M8MA 3I5RA 5ECAA 1MV3A 1E6HA 1UDLA 1BBZA 2X3WD 2YUNA 1UJYA 1JO8A 1GCQA 3SHWA 1T3SA 2V1RA 1M30A 5L23A 2D0NA 2FPEA 4ORZA 5GJWB 5IHKA 4AG2C 3M0UA 4LN2A 3RBBB 1GRIA 1VYUA 2F2XA 2LX7A 2DJQA 1QWEA 1PRMC 1T0HA 2RQUA 4CC7A 2AZSA 2CT4A 4RTWA 1U06A 1A0NB 2SRCA 3NMZC 2KBTA 3ZL7C 2EYWA 3I35A 1K1ZA 4HXJA 1OPLA 4AFQC 1WXUA 1KIKA 2MIOA 2AK5A 2DF6A 1Z9ZA 2LQWA 3M0SA 4RTVA 2YSQA 3QWXX 2HBWA 2LJ3A 2VVKA 2W0ZA 4OMMA 1U5SA 2DLPA 2C0OA 1PHTA 1NLOC 2CUDA 2RQTA 3VS2A 2OI3A 4F14A 2KXCA 4D8DA 2O9SA 1ZBJA 1G2BA 3EHQA 2GNCA 2K3BA 2AZVA 2MOXA 1UJ0A 1W70A 3A98A 3UATA 3VRZA 4EIKA 3PVLA 2JTEA 1MV0B 4JJCA 1RUWA 1BB9A 4OMLA 1M3AA 3VS6A 4R0KA 1FYNA 4E6RA 1I07A 1AWJA 3NPFA 2KEAA 2KE9A 4M4ZA 2LJ1A 1MUZA 1ZSGA 4ZNXA 1UECA 1W1FA 1QKWA 1K0SA 2EYZA 1CKBA 2M51A 2CSIA 3M0PA 2V1QA 1BK2A 1PWTA 2ROLA 4J9HA 1AWWA 4FSSA 2LNHB 1AWOA 3UA7A 2KROA 3M0QA 2D8JA 2LZ6B 2JMCA 1G83A 1WFWA 2RNAA
chains in the Genus database with same CATH superfamily
1WLPB 1QVPA 1BI2A 2DETA 4UC4A 2O88A 3IQLA 2ECZA 3OYYA 1V1CA 1BKBA 2JOYA 3V8JA 3L2RA 4XTYA 2BE9B 4GLMA 1R77A 2HSPA 4PJLA 2VKNA 2EQIA 1K8AC 1GL5A 1UG1A 5FWCA 3CCRA 4M7AF 3CCMA 4XTXA 2KVQG 4O5VA 2QEXQ 3TCJA 3E19A 2DIGA 3CXCA 4JS5A 2VXEA 2ZGWA 4XU3A 1I0CA 2MPXC 1VQ7T 4ANJA 5FRMA 2E3IA 1VIEA 2GFAA 1M2VB 4PJOE 2FZCB 1BCOA 1WXTA 2BE7D 4GBQA 4XTVA 2HD0A 1H641 2A28A 1KQ1A 2LQNA 1QLYA 3V7CA 4E7JA 4M7AD 4RMOA 4J9BA 4J6XA 1GCQC 1W2BA 1HSQA 1Y71A 3ER0A 2FYKA 1WHJA 2HL3A 1J3TA 4M75F 3HKSA 3OYCA 3QSUA 2Z0WA 3H0IA 1UE9A 1WHLA 3OYJA 1N8RU 1C1AA 2CKKA 1B34A 2COWA 1IREB 4BUGA 1QKXA 2DJZA 4HA8A 3CXCS 2GTJA 1AHJB 3JSCA 1VQPQ 1UHFA 2M9UA 1AD5A 1G5VA 1ABQA 3CEYA 2OTJA 1PG5B 2C06A 1VYTA 1VQKA 2VC8A 4RTXA 4HCKA 3MCAB 3LWHA 4AG1C 4ZTJA 4IUPA 3VJPA 3CCSQ 2YDLA 1VQ4T 1OEBA 2GCXA 4C92E 1YCSB 2PTKA 5D6YA 1VQMT 2FRYA 5LJ3d 3CCVA 2DTOA 4M75D 3JCMc 5HK0A 4NOYA 2HKNA 3FEOA 3EG9B 3OY9A 3BFMA 2PNIA 1R8OB 4OB3B 2L3SA 2EPDA 1RAFB 5KYWA 1IO6A 1I5LA 2M1HA 4N4HA 1QCNA 2BZYA 4J9FA 5HCKA 3QXEB 2DA9A 1BIBA 3GLXA 3VS1A 3JCMb 1YI2Q 3CCRT 2QTVA 3CCMT 3PT9A 2VGMA 5GAMj 2HQHA 1PNJA 1OV3A 3OYDA 3L2QA 4E7KA 3TVTA 4QVZA 5FRNA 2BIVA 3CCEA 3HRSA 1N5ZA 3UPUA 3EGXA 3M56A 3CMEA 1B34B 2EQUA 1ZHIA 2JN0A 2QA4A 2MI6A 1VQ4Q 2JW4A 3SDZA 1K0XA 3MO8A 1DJ7B 4J9DA 4MMKA 2D8HA 1ACMB 3MKDA 1D09B 4AT1B 4FW1A 2F2VA 4JZ4A 4A4KA 5GAN8 1M90U 2K2VA 3AHUA 1ZQ1A 1YP5A 2M0OA 2V8KA 1H8KA 1X2KA 1AT1B 4OMQA 1WJRA 4E47A 4FYXB 2RHYA 3U23A 4C8QG 4ZGDB 4IIOA 4IUUA 4PK4A 1W6XA 2RQVA 4F16A 2E10A 4CC2A 2XICA 3HRTA 3CCRQ 2CZ1B 5DM7R 3WVDB 1M3BA 1KK7A 3REAB 2O4XB 1IHWA 1HYOA 3UDCA 1VOMA 3KBGA 3LH5A 2JNGA 1YITT 2FZKB 4E7IA 5FLXE 2Y90A 1SRLA 1N8RC 2AKLA 4F7UE 2RJEA 4OF1A 3X24B 2F69A 1IZ6A 4E7ZA 2JMAA 2EQMA 1K4US 2ED1A 5KH6A 5LJ5e 2HSEB 3OSSC 1KC8R 1VQKT 1SSFA 4FT4A 2HKQB 2RM4A 4BD3A 5C0MA 4HVUA 3MJXA 3CCJA 3EGDA 2IIMA 3CCVT 3G4SA 3UWNA 4M7DD 3H0HA 4KUDK 2QQSA 5CQXA 1OZ2A 3O5ZA 4M77C 1WHGA 2JUFA 2M02A 1RAAB 5IHNA 2MWOA 1B3QA 3CCLA 5KE3A 2DD4A 2KRMA 2F5TX 5LJ5h 4RG8A 1X2QA 3FRNA 1E6GA 3GNFB 4E7LA 4RTTA 3QHSA 1QVFA 5I22A 5LJ3j 2XI9A 2L0AA 4FM4B 3VU3C 3ASKA 1WI7A 1NLPC 3RNJA 2OTJQ 2L2PA 1BI3A 1VQKQ 3CPFA 4M7AA 1VQ6A 3NTHA 3CCET 2LRQA 4Z8AA 2JT4A 3JCMQ 2YT6A 2M0YA 2EYXA 3NHNA 3QO3A 1VYVA 3CCVQ 1VQ5A 4J5YA 3CBOA 4JRKA 4A54A 4M7AC 2PVGB 1JXOA 1UGQB 1GBQA 2W10A 2J6OA 4MDWA 4BE2A 4FL6A 3JCMf 4M77B 1TOVA 1M90C 1LNXA 4IUVA 2BZXA 3CCQA 2RJCA 3MEWA 5A0DA 3F70A 2MYSA 1MV3A 4C8QF 2CS7A 4JRPA 2YUNA 5KYYA 2VUBA 4X9DA 2DTIA 5DY9A 1NZ9A 5GAMf 4RKUE 5DLOA 2X35A 5GJWB 2CP6A 4XAXB 5IHKA 3CCEQ 3HTRA 2CP7A 4M75A 3CMEQ 2DXCA 2QA4Q 1GRIA 1VYUA 2F2XA 1QWEA 1T0HA 1YIJA 1M2OA 1OQKA 4LDUA 2LQ8A 1I5OB 3HP9A 3RERA 3CC7T 4JLGA 2BUDA 5CKEA 4M7AB 2QTXA 2LX9A 3CBMA 1OPLA 4FCYA 3QWXX 2HBWA 3CCJT 2VVKA 3G4ST 4OMMA 2DLPA 4PJOF 2C0OA 5GANe 2CUDA 3VS2A 1W4SA 3ZEHA 2LCCA 3EFRA 5KYXA 2ZPGB 2O9SA 1MMGA 1Q86R 1ZBJA 2X4XA 3META 4BI8B 3OYBA 4EDUA 4IUQA 3FJPA 3JCMJ 3A8HB 3UATA 4EIKA 1X01A 1M1KU 3EFSA 4OMLA 3RMSA 1G3YA 1G3TA 4R0KA 1VQNA 4N4GA 2HQEA 4M4ZA 3CBPA 4ATOA 4ZNXA 1ZSGA 2LT1A 4KGXB 4XTZA 2M51A 2E1HA 2A7YA 2V1QA 4JJNK 2OX7A 4M77G 3OS0A 4AMCA 2ROLA 1WGSA 1AWWA 1AWOA 5GANh 1BIAA 2KROA 2R5AA 3M0QA 2JMCA 1G83A 4DQ2A 5IN1A 4PJOD 2RNAA 3QUIA 1OX9A 1I81A 2A36A 1I1JA 1PC0A 3MP1A 1TG0A 1S72A 1NPRA 4AFSC 2ZPIB 1AZGB 5CR2A 4MZPA 3CCJQ 2DZ9A 2FEIA 5CQYA 2DXTA 2SEMA 3G4SQ 2XU8A 2DNUA 2ZZDA 2QK0A 2F2WA 2CREA 3R6NA 1AZEA 2CUBA 1QVGA 6AT1B 3GOXA 2EIFA 2EQJA 1TU0B 1PSFA 4C92F 2EYQA 3CCLQ 3JCMW 1M3CA 3EG1A 2QQAA 1VUBA 2FG0A 1TH7A 1UB4A 4XQ3A 5LJ3f 1OU9A 2D1XA 2GGRA 2HNIA 3G6ET 2ZPFB 4LXCA 1GBRA 1BI1A 1NPPA 2E5QA 3MEVA 1VQ6Q 2RMOA 1IGQA 1SSHA 1Q7YR 3GF5A 1WHKA 1ZA2B 2MK5A 3EG0A 2KAFA 5A0GA 3RESA 4DEXA 1VQ5Q 5IHIA 3LW5E 4C92D 2K6DA 2OTLT 1WHHA 2E12A 4F04B 5CCAA 2JZ2A 2P0PA 2YHTA 1ZUKA 1AOJA 4Y91A 4M7DC 3QWYA 1QVGS 2CP0A 2X9HA 1X6BA 4RCCA 1KHIA 1SEMA 3CCQQ 1HXDA 4HCZA 4PJNA 3ULRB 2JS2A 2K57A 2H3EB 2CP2A 3JCMd 2XHCA 3VS4A 1TTHB 4BE1A 4E7SA 5GAOm 1VQLA 2QEXT 5AT1B 2CH4W 5CKDA 2FO0A 2C0TA 3J80E 4J9EA 3CPWA 2QQRA 4OGCA 2WSEE 1VQNT 1Q82R 2KGTA 4B9XA 1M1KC 1UUEA 1Y96B 2DX1A 2YRVA 5GAMd 1K9AA 2DYIA 3EFOB 2EFIA 4C8QE 3BE3A 4TVRA 1YIJQ 2QDYB 3C4SA 2LDMA 5LJ3h 2LVMA 3A8GB 2RHIA 2HL5C 1ZUYA 3OBYA 3OQ5A 1S72T 4M7DB 2ZPEB 3M57A 1TXQA 2NUPB 4F7UF 5J3BA 1NEBA 3FIFA 3INZA 1RI9A 4IUTA 2KRNA 4ELYC 2KSSA 4KUIA 5IH2A 1K9MU 4WF2A 1N6AA 1XNIA 1U8RA 5GAOr 2K4YA 3KXTA 2QI2A 3PVQA 2KI7A 1TS9A 5HY6A 1VQNQ 4XK8E 1ARKA 3P8DA 3CQTA 1QWFA 1VQPT 3OW2S 3CCUA 1Z9QA 2YLCA 2K3XA 2AKKA 2K79A 4C8QA 3CXCP 1RI0A 5GMKe 3CCST 1E7OA 1YHQA 2HEQA 3P8HA 3CMAA 1WA7A 1YJWA 1JEGA 1S72Q 1HD3A 2JXBA 2FRWA 2EJFA 3BDUA 2DRKA 2AIRB 2RD1A 1M1GA 1IB8A 3H9NA 2KXDA 2E41A 1QQJA 2A3LA 2FVUA 2K5LA 3AT1B 5KE2A 1SRMA 3VUZA 4CRIA 3S3NA 5EG2A 3VUBA 4JZ3A 4M78G 3M0RA 2PVOB 1D0XA 5GMKh 1YI2T 1OU8A 1PRLC 3SWNA 2EKHA 1LJOA 1SHFA 2XDPA 2ENMA 4PJOA 2HAXA 1UGVA 4PLLA 4OVAA 3OYLA 2NUZA 2DEQA 1JQQA 1V29B 2A0FB 2DVJA 4BY6C 2DD5A 1KJWA 1AVZC 1W2BS 3PMIA 1TUDA 4QKUA 3JCMP 4DOWA 2DL7A 5IXBA 4J9CA 3EHRA 4WCIA 1UGPB 1VIFA 3RKXA 1FX7A 4L59A 1UGSB 5GAN3 3N5BB 1X43A 3G1JA 1ZUUA 3KFVA 3ZFJA 3RKWA 2VYTA 4YTLA 1ZSZA 4IKFA 1VQLQ 3MEUA 4XU2A 3TREA 2J7IA 1K9MC 2KT1A 4OB0B 2ABLA 4ZN1A 1K73U 3CC2A 2QG9B 4PJMA 4JLIA 1OI1A 2E6NA 5FU7C 1LCKA 3FLGA 1IRXA 4C92A 4II1A 2X4WA 2EGAA 4Y28E 4AFZC 4BY6B 2XD0A 1OPKA 5I11A 1OYXA 2IG0A 5GAN5 2WACA 1NYGA 1YFNA 1G3WA 4L5GA 4C92C 2DMOA 4VUBA 1YHQT 4OMPA 1NEGA 3G71A 1M8MA 3OMGA 5CVIA 1YJWT 5I21A 2CZ0B 2ZPHB 3JB9G 4ELZC 3SHWA 5L23A 5KYWB 5KYUA 4JS4A 2FPEA 1KD1U 3OYFA 3M4YA 4EPCA 2IVWA 4LN2A 3RBBB 2VB6A 4M78F 3OMCA 3OBWA 2DZCA 1M8VA 2CT4A 1N9RA 3CCUQ 5FU7B 4A4GA 2SRCA 3NMZC 4JDSA 4LDYA 2OTJT 2EYWA 2QYZA 3EGXB 2DF6A 1Z9ZA 2LQWA 3C12A 3M0SA 2VV5A 4P5NA 1YHQQ 2LJ3A 2E6ZA 1WJQA 2R5MA 2EKOA 3CMAQ 4C92B 1YJWQ 2RQTA 2CP5A 2OI3A 2KXCA 4D8DA 4FYYB 3OA6A 5GAOq 4ZN3A 1R0CB 1G2BA 2GNCA 2HZYA 2K3BA 3SFMA 3FC3A 2MOXA 1UJ0A 1W70A 3A98A 2JTEA 1JJ2A 2HBPA 4OGEA 1RUWA 3X20B 2JTMA 4E6RA 1FYNA 2XK0A 1I07A 1AWJA 3NPFA 4DBQA 2ZPBB 3PTAA 3RMQA 4EMHA 1BI0A 5C6SA 2X4YA 4OMFB 1Q81R 4J9HA 4F7UA 2LNHB 5KYUB 3UA7A 1QW1A 1Y07A 3LLRA 1NJIR 5FROA 2LQKA 3MPUB 3CMET 1VQ9A 3CC2T 3EG3A 2QA4T 1NE8A 2RQRA 3MP8A 2DPPB 1N8RR 1O9SA 1K73C 1FMWA 2GBQA 4DBHA 3DLLA 2F5KA 3QZ5B 1M9SA 2GQIA 4QQ6A 3JB9J 2Y4YA 2KQWA 3UT1A 3HRUA 2GF7A 4LE9A 3S3MA 3LH0A 2O01E 2O9VA 3VS5A 3GPLA 3EAEA 3EGDB 4XU0A 3H0FA 4OP0A 2OJ2A 1VQ8A 2MF2A 1PD1A 1KFZA 4EMKA 3JB9I 4J7IA 3FDRA 2O31A 1PM3A 1AEYA 3M53A 2NWMA 1JBMA 1QVFS 2LJ0A 2C0IA 2DXUA 2L89A 5HKCA 4PL6A 2RK1A 4LDXA 2COYA 2CZ6B 1KD1C 3CC2Q 2NYSA 2ZAEA 1B7TA 2YUPA 4OMNA 3M4GA 3ME9A 4F7UB 2KR3A 5GMKl 3PIOA 3JCMe 2X4JA 4QW2A 1UTIA 1PKSA 4M75C 2HDAA 2AT1B 5D6XA 1YCYA 4C8QD 1SHGA 2YUOA 2K2MA 1Y7XA 2H3JA 4JUVA 2PQWA 2KYMA 3G71Q 1M27C 2DL8A 3E1SA 5GAMe 4FYWB 3OYMA 3GIBA 1ZBXA 1C6VX 1RABB 2LTOA 2B8AA 3S3OA 1WQWA 2ROTA 5J39A 1H3HA 3CCLT 3HFNA 3JCMh 1SPKA 2RJFA 4A4FA 1M90R 2RI5A 3M54A 2VGNA 5CAIA 4HKEA 3QKJA 4ESRA 1H3ZA 4O6JA 2DBKA 4LNPA 1PD0A 3C95A 4PKCC 2EJGA 3H41A 7AT1B 5LJ5g 3OYKA 1X6OA 2DIQA 4L6V5 3HFOA 5KYYB 4PNOA 1LVKA 2P0KA 2JJ9A 2FB7A 2XMFA 5GAMh 1T0JA 1JU5C 2RA2A 3OYNA 1VQ6T 4A4HA 4F17A 3I55A 4M75B 4CI0C 2DXBA 2EBPA 4Y92A 2JM8A 2XKOC 4IURA 4M78E 2DO3A 1VQ5T 2LNVA 1D1AA 2D0QB 4QQDA 2I0NA 1IXDA 3A1PA 1GFCA 4PFOA 2QGGA 1KSWA 3WXMB 1QP2A 3Q1JA 3QYHB 3P8BB 4C5IA 1WJSA 3OS1A 1KQSA 2EYYA 4Q5WA 3CCQT 1NM7A 2EW3A 2P0QA 1VQ8T 1Y57A 2EWNA 3OSVA 2EVRA 3REBB 2VASA 3C0CA 4M7AG 3QJYA 5DLQE 5KYXB 1QVGP 1S1NA 2RF0A 2DM1A 1D3BA 4CC3A 2GFUA 3VKIA 5GAN7 3QG1A 1JXMA 3L2UA 1ABOA 3LGFA 2F1LA 3QDFA 5FWBA 4BI4A 4IIMA 5GJVB 4KH0B 3L2VA 2DRMA 1VQ7A 3V8LA 2EJ9A 1RAIB 3HSBA 1VQ9Q 4X9CA 3LYIA 4QVDA 4C0GA 5J26A 2L3PA 3NTKA 1WX6A 1PSEA 2CDTA 1YIJT 1RACB 4HCBA 4M78A 2NLUA 3VS7A 2G3RA 4JRQA 2O2OA 2ATCB 1Y0MA 4X1VA 1YBYA 4X34A 2RH2A 1CKAA 2BZ8A 3M0TA 4A4EA 2PU9B 1VQ8Q 2DE0X 5LJ3e 1KQSS 4DOVA 2PUKB 3QPHA 1BYMA 2PZ1A 4M75G 1YJ9A 2RHXA 2L8DA 1FMKA 4JPBW 2GQVA 4MZTA 2FPFA 1D0YA 1X69A 2COZA 2FL7A 1D0ZA 3NGPA 1N27A 1RADB 3QIIA 1UFFA 4D8KA 1XJWB 3JCMg 1M2VA 4HVWA 2P84A 1U3OA 3GBQA 4M77F 3CC4A 2ESWA 4J7FA 2YUQA 2HMAA 1RLQC 2J6KA 3FJ5A 3CPWP 2B86A 2YLBA 3OW2P 4DA4A 4LDVA 1KG1A 5GANg 1VQMA 4LD9K 1RLPC 4C5GA 1OOTA 1WHMA 2K7AA 3EG2A 1VA7A 5FW9A 3JB9H 3OS5A 1EZZB 5I2MA 3X26B 1EIFA 1SF9A 1HK9A 1TWBA 4A63B 1WXBA 2EQKA 1RL2A 3RIRA 3I9QA 4EMGA 3TSWA 5LJ5j 2IPOB 1N9SA 3NTIA 5GAN4 3HPWA 2HQXA 4M77D 2HCKA 4RCBA 1IHVA 2LCLA 1FWZA 1TSFA 4LUEA 1KC8U 4JRIA 3CPWS 1PKTA 4OB1B 3A8LB 2WSCE 3JV3A 4C0ZA 1YJNA 1NG2A 2VWFA 1XTDA 1C0MA 1CSKA 1WQ7A 2FZGB 1BU1A 2DVEA 3R6OA 2MWPA 2EGEA 4FIBA 5GAOp 4DBRA 4RTUA 2E64A 1UGRB 3BW1A 3I55Q 4ZTFA 5ECAA 3H6ZA 1M1KR 1E6HA 4GLKA 4C8QC 3M55A 4FT2A 4FSXA 4FYVB 2L5QA 2X3WD 2NUTA 3EG9A 1JO8A 1GCQA 2DTHA 4N0AA 1P92A 2D0NA 5GMKm 3OYAA 4ORZA 4KGVB 3DLMA 4AG2C 3SB2A 1Q81U 3RR6A 1W2BP 4RG2A 2LX7A 4N0AC 1NJIU 1PRMC 1LPLA 5CKHA 1VQOA 1OZ3A 4CC7A 3DB4A 1M1FA 2AZSA 3LX7A 3M5AA 1K8AR 2KBTA 1YJ9T 4M7DG 1VQLT 3ZL7C 1RAHB 3I35A 1YITA 4HXJA 1WXUA 2AK5A 1JRIA 2CYZB 2YSQA 2WSFE 3MP6A 2W0ZA 3DB3A 2E70A 2RI2A 3SWNC 1VQ7Q 1U5SA 2QASA 1NLOC 4PJOC 4F14A 1QMCA 5KYNA 3LWIA 2XG8D 3CC4T 4XTWA 5FU6C 4C8QB 4XTUA 2AZVA 3FB9A 2QXFA 3PVLA 1MV0B 3E9FA 2QAZA 3VS6A 5LJ3g 2KY9A 3PGGA 3HL8A 5D7UA 2KEAA 2KDSA 3PFSA 4KBMB 2KE9A 2RI3A 2LJ1A 3RKYA 3X28B 1K0SA 1QKWA 5GAN2 1CKBA 3M0PA 2NUTB 1MMNA 4ME7A 1PWTA 4FSSA 3V8KA 2LZ6B 1WFWA 3GNGA 1U1SA 4N4IA 2O4XA 1YJ9Q 3QYGB 2YWWA 1X27A 3I5SA 1LOJA 2PVDB 4RTYA 4CC4B 2RHZA 4HT8A 3UF4A 3T9NA 2K5IA 3VRYA 3M59A 3M9QA 1ZSZC 3CCUT 5CIUA 5IT9E 5GANj 2A37A 1YJNT 3MEAA 3SWNB 1KC8C 4NL2A 1XQHA 1GFDA 4PJOB 4JJBA 3CC4Q 3V7RA 2JS0A 3JAME 2XDDA 2R58A 2YRDA 5FU6B 5KCOA 3JRZA 5KCHA 4BE0A 4J9GA 1VQMQ 3PE0A 2OAUA 1Q86U 3CMAT 3TSZA 5I2SA 3J7AF 3EGUA 5M9OA 3EH1A 2CH4A 1YWOA 1XOVA 4M77E 2LCSA 1FMVA 2RHUA 1M5Q1 4AFUC 3GP8A 5LJ5f 2RN8A 1IGUA 3OS2A 2X51A 2V8JA 1Q81C 1VQOT 1ZLMA 1KQ2A 3VS0A 1YJNQ 1NJIC 3CCMQ 2R57A 3QDRB 3PMTA 2J6FA 1ZSZB 2DILA 2BTTA 2DBMA 4M7DF 3G7ZA 3X25B 4MMLA 4MDXA 1UHCA 2K9GA 1K9MR 4PFZA 2EAYA 1O75A 1MHNA 2E5KA 3TU4K 1GXIE 1KHCA 1B07A 3DKMA 4DEYA 4R56A 1QP3A 5AYFA 1SG5A 3SD4A 1K76A 2EGCA 4M7AE 3CC7A 4QT7A 1MNDA 2QGFB 1WIEA 3E2UA 3OYHA 2J06A 2XIDA 3LGLA 4ZGEB 3VS3A 4M78D 1X6GA 4M77A 4Z89A 4KT0E 4BACA 2CSQA 2A08A 4PJOG 4V2SA 4WTOB 3OYEA 1MGQA 5GAOl 3L2ZA 1VQOQ 2M16A 3TQ7P 1QCFA 4C0DC 4BI3A 1JJ2P 4BDZA 1Q7YU 2FPDA 1HJDA 3URGA 1NYFA 2H8HA 1YITQ 3L1AA 4FW2A 3QJ6A 2DL3A 4B9WA 3I56A 1QVFP 1TUCA 1YWPA 2DK3A 1TUGB 3V7SA 2L3RA 4M75E 1JB0E 1NBEB 5D6WA 1GCPA 1YN8A 2QDLA 3TEEA 2KYBA 2P4RA 1JJ2S 3G71T 3QZ9B 3C94A 1EFNA 1Q86C 1D1CA 3JB9F 4HVVA 4PFPA 1MNEA 2J05A 2ED0A 2KT8A 3D7SB 4LDWA 4OMOA 1Q82U 3CD6A 3RDVA 1FXXA 4K11A 2FHDA 2YRCA 1T3LA 4C92G 2QQBA 2JM9A 4C0DB 3WVEB 2G6FX 2MMPA 4EMKC 2XDBA 1G8XA 2LC4A 5CKFA 4BB7A 5IXFA 2DKGA 3UA6A 1ZX6A 2DEUA 2KRSA 5EC7A 5GANf 2CGHA 5CKBA 3G6EA 1WNLA 3H8ZA 5CO7A 4E7HA 2LP5A 4KRTA 3ZBDA 4J83A 3MHXA 3QBYA 3JB9D 3VYGA 5GAOn 5A2QE 1K73R 2OTLA 4Z88A 2KK4A 3L42A 4KH1B 2MCNA 4Z02A 2KMTA 1WZOA 2CZ7B 2DYBA 2V26A 3A8MB 5GMKj 2V8IA 1YNZA 4C0FA 2MAMA 4D6WA 9ATCB 1WDXA 2JTFA 4EMKB 1H92A 5LJ5d 1Q95G 2ZCFB 2BKDN 3THKA 4PLIA 1I8FA 1QCOA 2CT3A 2K5FA 3HHTB 4RUGA 2QEXA 4R55A 4J8OA 4KULA 1RAEB 3PNWC 1WYXA 5IAYA 2JVVA 8AT1B 2QQ9A 1Q7YC 3NFCA 1VQ9T 2RB6A 3I56T 2E4HA 4OB2B 1KD1R 2X3XD 2D6FA 1G3SA 3CC7Q 1U1TA 2VXFA 2KNBB 1BCMA 3SEMA 4M7DE 1MMDA 4J9IA 3PIPA 5L8RE 2L3QA 3EH2A 1AWXA 2DFUA 4C5HA 4F7UG 3JCMX 4NL3A 1K8AU 4DBFA 2DL5A 2OAWA 1I4K1 2GTOA 2DL4A 2RQWA 4JJDA 2LMJA 2RJDA 3RUXA 3CD6T 5CK9A 2RPNA 2D9TA 4LUDA 1WPYA 4PJJA 1Q82C 1KQSP 1OX8A 1SKUB 4RTZA 3JCMV 1Y96A 3I5RA 1VQPA 1UDLA 3EFOA 3I56Q 1D1BA 1BBZA 3OYGA 4QVCA 1UJYA 4GY5A 5A0LA 1T3SA 2V1RA 1M30A 1MMAA 3CCSA 8ATCB 3A5ZB 3VYHB 1OULA 3KUFA 1R0BG 3VV0A 3M0UA 2P4TA 1F1BB 4M7DA 2DJQA 2NUPA 1UEBA 2DERA 2I2LA 1V76A 4M78C 1PCXA 2RK2A 4KGZB 4LD6A 2E65A 2RQUA 5GMKi 4RTWA 4A53A 3OB9A 2YXYA 1U06A 1A0NB 1RAGB 5HK3A 3CD6Q 1K1ZA 4NS5A 4AFQC 1KIKA 2MIOA 1EX4A 3M58A 2PUOB 2E3HA 4RTVA 3E9GA 4HT9A 3S6WA 4J6YA 2Y4XA 2K3YA 4QQGA 1PHTA 3J81E 1YI2A 4J6WA 2DAQA 4XU1A 4FU6A 4HCCA 1ZA1B 3EHQA 1D3BB 4E2FB 3VRZA 3G6EQ 4JJCA 4BDYA 2AHJB 1VQ4A 1BB9A 1M3AA 3OW2A 1X75C 4MZMA 3L2WA 2LT4A 5GAMg 5GANd 3I55T 4ZGJB 3OYIA 1MUZA 4B6MA 1UECA 5GAN6 1W1FA 2EYZA 2CSIA 1BK2A 2RO0A 5LL6S 3O8VA 3A8OB 2OTLQ 4M78B 3BY7A 1M4ZA 3BDLA 2D8JA 2CP3A 4C5EA
chains in the Genus database with same CATH topology
2A36A 1I1JA 1WLPB 1X27A 3I5SA 1TG0A 2O88A 3IQLA 2ECZA 1V1CA 4AFSC 4RTYA 3EG3A 1AZGB 4CC4B 2RQRA 2FEIA 4GLMA 3UF4A 2SEMA 2HSPA 2GBQA 3VRYA 2DNUA 2VKNA 2EQIA 1GL5A 1UG1A 5FWCA 2A37A 2F2WA 2CREA 3R6NA 1AZEA 2CUBA 1GFDA 2GQIA 4JJBA 2JS0A 4LE9A 2O9VA 3VS5A 4J9GA 1I0CA 1M3CA 3H0FA 2OJ2A 3PE0A 3EG1A 3TSZA 1KFZA 2FG0A 3EGUA 2O31A 1WXTA 2CH4A 2D1XA 1YWOA 1XOVA 2GGRA 1AEYA 2NWMA 2LCSA 4GBQA 2LJ0A 4AFUC 2C0IA 2A28A 2LQNA 1GBRA 1QLYA 2RN8A 2RMOA 4J9BA 1SSHA 1GCQC 1HSQA 3EG0A 2YUPA 4DEXA 4OMNA 1ZLMA 5IHIA 3VS0A 2K6DA 2KR3A 1J3TA 2J6FA 1UTIA 2BTTA 2DBMA 1PKSA 2DILA 1ZUKA 3H0IA 1AOJA 1UE9A 2HDAA 3QWYA 1SHGA 2YUOA 1X6BA 2K2MA 1UHCA 1QKXA 2K9GA 2KYMA 1SEMA 2E5KA 2GTJA 1M27C 2DL8A 3ULRB 2JS2A 1B07A 4DEYA 1UHFA 1K76A 1AD5A 1ABQA 2EGCA 4QT7A 3VS4A 1VYTA 1WIEA 4RTXA 2J06A 3VS3A 2CH4W 4HCKA 4AG1C 1X6GA 2FO0A 2C0TA 2ROTA 2YDLA 4J9EA 1OEBA 1H3HA 1SPKA 4Z89A 1YCSB 2PTKA 2KGTA 2CSQA 2FRYA 1UUEA 2A08A 4ESRA 2DX1A 2DBKA 4LNPA 1K9AA 3H41A 2PNIA 2L3SA 1QCFA 2EPDA 2XMFA 1T0JA 1IO6A 2FPDA 1JU5C 1ZUYA 1HJDA 1NYFA 2H8HA 4F17A 2BZYA 4J9FA 5HCKA 2DL3A 2EBPA 4Y92A 1NEBA 2DA9A 2JM8A 1TUCA 1YWPA 3VS1A 1RI9A 2KRNA 2I0NA 5IH2A 1PNJA 1OV3A 3TVTA 1GFCA 1KSWA 1N5ZA 1GCPA 1YN8A 2QDLA 3PVQA 2KYBA 2EYYA 2P4RA 1NM7A 2EW3A 2JW4A 1ARKA 1Y57A 1K0XA 3CQTA 1QWFA 2EVRA 3REBB 1EFNA 4J9DA 2D8HA 1Z9QA 3C0CA 1S1NA 4HVVA 2RF0A 2AKKA 2F2VA 4JZ4A 2DM1A 2J05A 2K79A 2ED0A 2KT8A 4OMOA 4CC3A 4K11A 1JXMA 1T3LA 1ABOA 1YP5A 1E7OA 5FWBA 4IIMA 5GJVB 1H8KA 2JM9A 1X2KA 2HEQA 4OMQA 2DRMA 2G6FX 1WA7A 1JEGA 3U23A 1HD3A 2JXBA 2FRWA 4IIOA 2L3PA 5IXFA 1WX6A 1W6XA 2RQVA 2DRKA 2CDTA 3UA6A 4F16A 1ZX6A 4CC2A 2KRSA 5EC7A 3VS7A 1M3BA 2KXDA 3REAB 2O2OA 1Y0MA 3LH5A 4X1VA 2LP5A 1SRMA 4KRTA 1SRLA 1CKAA 2BZ8A 2AKLA 4JZ3A 3M0RA 3M0TA 2DE0X 1PRLC 2JMAA 4Z88A 2EKHA 1SHFA 1K4US 2PZ1A 2ED1A 2ENMA 2MCNA 1UGVA 1FMKA 4JPBW 2FPFA 2NUZA 1JQQA 1X69A 2DYBA 4HVUA 3NGPA 1YNZA 2IIMA 1UFFA 4D8KA 2DVJA 1WDXA 4HVWA 3H0HA 1H92A 1U3OA 1KJWA 3GBQA 3THKA 3O5ZA 1AVZC 2CT3A 2ESWA 4RUGA 2YUQA 1TUDA 1RLQC 2J6KA 5IHNA 3FJ5A 1B3QA 2B86A 1WYXA 2DL7A 2KRMA 5IXBA 1RLPC 1X2QA 1OOTA 4J9CA 2K7AA 3EHRA 4WCIA 1E6GA 3EG2A 1VA7A 5FW9A 2X3XD 4RTTA 5I22A 2L0AA 1WXBA 4A63B 1X43A 1ZUUA 3KFVA 3I9QA 1WI7A 3TSWA 1NLPC 3RNJA 2L2PA 2KNBB 3SEMA 4Z8AA 4J9IA 2J7IA 2JT4A 2KT1A 2ABLA 2HCKA 2YT6A 2M0YA 2L3QA 4LUEA 1AWXA 2EYXA 3NHNA 1VYVA 1LCKA 1PKTA 2DL5A 2OAWA 3JV3A 2EGAA 2GTOA 2DL4A 1JXOA 1NG2A 2VWFA 1CSKA 2RQWA 4AFZC 4JJDA 2LMJA 1BU1A 1OPKA 1GBQA 2RPNA 5I11A 2W10A 2J6OA 4LUDA 1NYGA 2EGEA 2BZXA 2DMOA 4RTUA 4OMPA 4RTZA 1NEGA 1M8MA 3I5RA 5ECAA 1MV3A 1E6HA 1UDLA 1BBZA 2X3WD 2YUNA 1UJYA 1JO8A 1GCQA 3SHWA 1T3SA 2V1RA 1M30A 5L23A 2D0NA 2FPEA 4ORZA 5GJWB 5IHKA 4AG2C 3M0UA 4LN2A 3RBBB 1GRIA 1VYUA 2F2XA 2LX7A 2DJQA 1QWEA 1PRMC 1T0HA 2RQUA 4CC7A 2AZSA 2CT4A 4RTWA 1U06A 1A0NB 2SRCA 3NMZC 2KBTA 3ZL7C 2EYWA 3I35A 1K1ZA 4HXJA 1OPLA 4AFQC 1WXUA 1KIKA 2MIOA 2AK5A 2DF6A 1Z9ZA 2LQWA 3M0SA 4RTVA 2YSQA 3QWXX 2HBWA 2LJ3A 2VVKA 2W0ZA 4OMMA 1U5SA 2DLPA 2C0OA 1PHTA 1NLOC 2CUDA 2RQTA 3VS2A 2OI3A 4F14A 2KXCA 4D8DA 2O9SA 1ZBJA 1G2BA 3EHQA 2GNCA 2K3BA 2AZVA 2MOXA 1UJ0A 1W70A 3A98A 3UATA 3VRZA 4EIKA 3PVLA 2JTEA 1MV0B 4JJCA 1RUWA 1BB9A 4OMLA 1M3AA 3VS6A 4R0KA 1FYNA 4E6RA 1I07A 1AWJA 3NPFA 2KEAA 2KE9A 4M4ZA 2LJ1A 1MUZA 1ZSGA 4ZNXA 1UECA 1W1FA 1QKWA 1K0SA 2EYZA 1CKBA 2M51A 2CSIA 3M0PA 2V1QA 1BK2A 1PWTA 2ROLA 4J9HA 1AWWA 4FSSA 2LNHB 1AWOA 3UA7A 2KROA 3M0QA 2D8JA 2LZ6B 2JMCA 1G83A 1WFWA 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A36 A;  1I1J A;  1WLP B;  1X27 A;  3I5S A;  1TG0 A;  2O88 A;  3IQL A;  2ECZ A;  1V1C A;  4AFS C;  4RTY A;  3EG3 A;  1AZG B;  4CC4 B;  2RQR A;  2FEI A;  4GLM A;  3UF4 A;  2SEM A;  2HSP A;  2GBQ A;  3VRY A;  2DNU A;  2VKN A;  2EQI A;  1GL5 A;  1UG1 A;  5FWC A;  2A37 A;  2F2W A;  2CRE A;  3R6N A;  1AZE A;  2CUB A;  1GFD A;  2GQI A;  4JJB A;  2JS0 A;  4LE9 A;  2O9V A;  3VS5 A;  4J9G A;  1I0C A;  1M3C A;  3H0F A;  2OJ2 A;  3PE0 A;  3EG1 A;  3TSZ A;  1KFZ A;  2FG0 A;  3EGU A;  2O31 A;  1WXT A;  2CH4 A;  2D1X A;  1YWO A;  1XOV A;  2GGR A;  1AEY A;  2NWM A;  2LCS A;  4GBQ A;  2LJ0 A;  4AFU C;  2C0I A;  2A28 A;  2LQN A;  1GBR A;  1QLY A;  2RN8 A;  2RMO A;  4J9B A;  1SSH A;  1GCQ C;  1HSQ A;  3EG0 A;  2YUP A;  4DEX A;  4OMN A;  1ZLM A;  5IHI A;  3VS0 A;  2K6D A;  2KR3 A;  1J3T A;  2J6F A;  1UTI A;  2BTT A;  2DBM A;  1PKS A;  2DIL A;  1ZUK A;  3H0I A;  1AOJ A;  1UE9 A;  2HDA A;  3QWY A;  1SHG A;  2YUO A;  1X6B A;  2K2M A;  1UHC A;  1QKX A;  2K9G A;  2KYM A;  1SEM A;  2E5K A;  2GTJ A;  1M27 C;  2DL8 A;  3ULR B;  2JS2 A;  1B07 A;  4DEY A;  1UHF A;  1K76 A;  1AD5 A;  1ABQ A;  2EGC A;  4QT7 A;  3VS4 A;  1VYT A;  1WIE A;  4RTX A;  2J06 A;  3VS3 A;  2CH4 W;  4HCK A;  4AG1 C;  1X6G A;  2FO0 A;  2C0T A;  2ROT A;  2YDL A;  4J9E A;  1OEB A;  1H3H A;  1SPK A;  4Z89 A;  1YCS B;  2PTK A;  2KGT A;  2CSQ A;  2FRY A;  1UUE A;  2A08 A;  4ESR A;  2DX1 A;  2DBK A;  4LNP A;  1K9A A;  3H41 A;  2PNI A;  2L3S A;  1QCF A;  2EPD A;  2XMF A;  1T0J A;  1IO6 A;  2FPD A;  1JU5 C;  1ZUY A;  1HJD A;  1NYF A;  2H8H A;  4F17 A;  2BZY A;  4J9F A;  5HCK A;  2DL3 A;  2EBP A;  4Y92 A;  1NEB A;  2DA9 A;  2JM8 A;  1TUC A;  1YWP A;  3VS1 A;  1RI9 A;  2KRN A;  2I0N A;  5IH2 A;  1PNJ A;  1OV3 A;  3TVT A;  1GFC A;  1KSW A;  1N5Z A;  1GCP A;  1YN8 A;  2QDL A;  3PVQ A;  2KYB A;  2EYY A;  2P4R A;  1NM7 A;  2EW3 A;  2JW4 A;  1ARK A;  1Y57 A;  1K0X A;  3CQT A;  1QWF A;  2EVR A;  3REB B;  1EFN A;  4J9D A;  2D8H A;  1Z9Q A;  3C0C A;  1S1N A;  4HVV A;  2RF0 A;  2AKK A;  2F2V A;  4JZ4 A;  2DM1 A;  2J05 A;  2K79 A;  2ED0 A;  2KT8 A;  4OMO A;  4CC3 A;  4K11 A;  1JXM A;  1T3L A;  1ABO A;  1YP5 A;  1E7O A;  5FWB A;  4IIM A;  5GJV B;  1H8K A;  2JM9 A;  1X2K A;  2HEQ A;  4OMQ A;  2DRM A;  2G6F X;  1WA7 A;  1JEG A;  3U23 A;  1HD3 A;  2JXB A;  2FRW A;  4IIO A;  2L3P A;  5IXF A;  1WX6 A;  1W6X A;  2RQV A;  2DRK A;  2CDT A;  3UA6 A;  4F16 A;  1ZX6 A;  4CC2 A;  2KRS A;  5EC7 A;  3VS7 A;  1M3B A;  2KXD A;  3REA B;  2O2O A;  1Y0M A;  3LH5 A;  4X1V A;  2LP5 A;  1SRM A;  4KRT A;  1SRL A;  1CKA A;  2BZ8 A;  2AKL A;  4JZ3 A;  3M0R A;  3M0T A;  2DE0 X;  1PRL C;  2JMA A;  4Z88 A;  2EKH A;  1SHF A;  1K4U S;  2PZ1 A;  2ED1 A;  2ENM A;  2MCN A;  1UGV A;  1FMK A;  4JPB W;  2FPF A;  2NUZ A;  1JQQ A;  1X69 A;  2DYB A;  4HVU A;  3NGP A;  1YNZ A;  2IIM A;  1UFF A;  4D8K A;  2DVJ A;  1WDX A;  4HVW A;  3H0H A;  1H92 A;  1U3O A;  1KJW A;  3GBQ A;  3THK A;  3O5Z A;  1AVZ C;  2CT3 A;  2ESW A;  4RUG A;  2YUQ A;  1TUD A;  1RLQ C;  2J6K A;  5IHN A;  3FJ5 A;  1B3Q A;  2B86 A;  1WYX A;  2DL7 A;  2KRM A;  5IXB A;  1RLP C;  1X2Q A;  1OOT A;  4J9C A;  2K7A A;  3EHR A;  4WCI A;  1E6G A;  3EG2 A;  1VA7 A;  5FW9 A;  2X3X D;  4RTT A;  5I22 A;  2L0A A;  1WXB A;  4A63 B;  1X43 A;  1ZUU A;  3KFV A;  3I9Q A;  1WI7 A;  3TSW A;  1NLP C;  3RNJ A;  2L2P A;  2KNB B;  3SEM A;  4Z8A A;  4J9I A;  2J7I A;  2JT4 A;  2KT1 A;  2ABL A;  2HCK A;  2YT6 A;  2M0Y A;  2L3Q A;  4LUE A;  1AWX A;  2EYX A;  3NHN A;  1VYV A;  1LCK A;  1PKT A;  2DL5 A;  2OAW A;  3JV3 A;  2EGA A;  2GTO A;  2DL4 A;  1JXO A;  1NG2 A;  2VWF A;  1CSK A;  2RQW A;  4AFZ C;  4JJD A;  2LMJ A;  1BU1 A;  1OPK A;  1GBQ A;  2RPN A;  5I11 A;  2W10 A;  2J6O A;  4LUD A;  1NYG A;  2EGE A;  2BZX A;  2DMO A;  4RTU A;  4OMP A;  4RTZ A;  1NEG A;  1M8M A;  3I5R A;  5ECA A;  1MV3 A;  1E6H A;  1UDL A;  1BBZ A;  2X3W D;  2YUN A;  1UJY A;  1JO8 A;  1GCQ A;  3SHW A;  1T3S A;  2V1R A;  1M30 A;  5L23 A;  2D0N A;  2FPE A;  4ORZ A;  5GJW B;  5IHK A;  4AG2 C;  3M0U A;  4LN2 A;  3RBB B;  1GRI A;  1VYU A;  2F2X A;  2LX7 A;  2DJQ A;  1QWE A;  1PRM C;  1T0H A;  2RQU A;  4CC7 A;  2AZS A;  2CT4 A;  4RTW A;  1U06 A;  1A0N B;  2SRC A;  3NMZ C;  2KBT A;  3ZL7 C;  2EYW A;  3I35 A;  1K1Z A;  4HXJ A;  1OPL A;  4AFQ C;  1WXU A;  1KIK A;  2MIO A;  2AK5 A;  2DF6 A;  1Z9Z A;  2LQW A;  3M0S A;  4RTV A;  2YSQ A;  3QWX X;  2HBW A;  2LJ3 A;  2VVK A;  2W0Z A;  4OMM A;  1U5S A;  2DLP A;  2C0O A;  1PHT A;  1NLO C;  2CUD A;  2RQT A;  3VS2 A;  2OI3 A;  4F14 A;  2KXC A;  4D8D A;  2O9S A;  1ZBJ A;  1G2B A;  3EHQ A;  2GNC A;  2K3B A;  2AZV A;  2MOX A;  1UJ0 A;  1W70 A;  3A98 A;  3UAT A;  3VRZ A;  4EIK A;  3PVL A;  2JTE A;  1MV0 B;  4JJC A;  1RUW A;  1BB9 A;  4OML A;  1M3A A;  3VS6 A;  4R0K A;  1FYN A;  4E6R A;  1I07 A;  1AWJ A;  3NPF A;  2KEA A;  2KE9 A;  4M4Z A;  2LJ1 A;  1MUZ A;  1ZSG A;  4ZNX A;  1UEC A;  1W1F A;  1QKW A;  1K0S A;  2EYZ A;  1CKB A;  2M51 A;  2CSI A;  3M0P A;  2V1Q A;  1BK2 A;  1PWT A;  2ROL A;  4J9H A;  1AWW A;  4FSS A;  2LNH B;  1AWO A;  3UA7 A;  2KRO A;  3M0Q A;  2D8J A;  2LZ6 B;  2JMC A;  1G83 A;  1WFW A;  2RNA A; 
#chains in the Genus database with same CATH topology
 1WLP B;  1QVP A;  1BI2 A;  2DET A;  4UC4 A;  2O88 A;  3IQL A;  2ECZ A;  3OYY A;  1V1C A;  1BKB A;  2JOY A;  3V8J A;  3L2R A;  4XTY A;  2BE9 B;  4GLM A;  1R77 A;  2HSP A;  4PJL A;  2VKN A;  2EQI A;  1K8A C;  1GL5 A;  1UG1 A;  5FWC A;  3CCR A;  4M7A F;  3CCM A;  4XTX A;  2KVQ G;  4O5V A;  2QEX Q;  3TCJ A;  3E19 A;  2DIG A;  3CXC A;  4JS5 A;  2VXE A;  2ZGW A;  4XU3 A;  1I0C A;  2MPX C;  1VQ7 T;  4ANJ A;  5FRM A;  2E3I A;  1VIE A;  2GFA A;  1M2V B;  4PJO E;  2FZC B;  1BCO A;  1WXT A;  2BE7 D;  4GBQ A;  4XTV A;  2HD0 A;  1H64 1;  2A28 A;  1KQ1 A;  2LQN A;  1QLY A;  3V7C A;  4E7J A;  4M7A D;  4RMO A;  4J9B A;  4J6X A;  1GCQ C;  1W2B A;  1HSQ A;  1Y71 A;  3ER0 A;  2FYK A;  1WHJ A;  2HL3 A;  1J3T A;  4M75 F;  3HKS A;  3OYC A;  3QSU A;  2Z0W A;  3H0I A;  1UE9 A;  1WHL A;  3OYJ A;  1N8R U;  1C1A A;  2CKK A;  1B34 A;  2COW A;  1IRE B;  4BUG A;  1QKX A;  2DJZ A;  4HA8 A;  3CXC S;  2GTJ A;  1AHJ B;  3JSC A;  1VQP Q;  1UHF A;  2M9U A;  1AD5 A;  1G5V A;  1ABQ A;  3CEY A;  2OTJ A;  1PG5 B;  2C06 A;  1VYT A;  1VQK A;  2VC8 A;  4RTX A;  4HCK A;  3MCA B;  3LWH A;  4AG1 C;  4ZTJ A;  4IUP A;  3VJP A;  3CCS Q;  2YDL A;  1VQ4 T;  1OEB A;  2GCX A;  4C92 E;  1YCS B;  2PTK A;  5D6Y A;  1VQM T;  2FRY A;  5LJ3 d;  3CCV A;  2DTO A;  4M75 D;  3JCM c;  5HK0 A;  4NOY A;  2HKN A;  3FEO A;  3EG9 B;  3OY9 A;  3BFM A;  2PNI A;  1R8O B;  4OB3 B;  2L3S A;  2EPD A;  1RAF B;  5KYW A;  1IO6 A;  1I5L A;  2M1H A;  4N4H A;  1QCN A;  2BZY A;  4J9F A;  5HCK A;  3QXE B;  2DA9 A;  1BIB A;  3GLX A;  3VS1 A;  3JCM b;  1YI2 Q;  3CCR T;  2QTV A;  3CCM T;  3PT9 A;  2VGM A;  5GAM j;  2HQH A;  1PNJ A;  1OV3 A;  3OYD A;  3L2Q A;  4E7K A;  3TVT A;  4QVZ A;  5FRN A;  2BIV A;  3CCE A;  3HRS A;  1N5Z A;  3UPU A;  3EGX A;  3M56 A;  3CME A;  1B34 B;  2EQU A;  1ZHI A;  2JN0 A;  2QA4 A;  2MI6 A;  1VQ4 Q;  2JW4 A;  3SDZ A;  1K0X A;  3MO8 A;  1DJ7 B;  4J9D A;  4MMK A;  2D8H A;  1ACM B;  3MKD A;  1D09 B;  4AT1 B;  4FW1 A;  2F2V A;  4JZ4 A;  4A4K A;  5GAN 8;  1M90 U;  2K2V A;  3AHU A;  1ZQ1 A;  1YP5 A;  2M0O A;  2V8K A;  1H8K A;  1X2K A;  1AT1 B;  4OMQ A;  1WJR A;  4E47 A;  4FYX B;  2RHY A;  3U23 A;  4C8Q G;  4ZGD B;  4IIO A;  4IUU A;  4PK4 A;  1W6X A;  2RQV A;  4F16 A;  2E10 A;  4CC2 A;  2XIC A;  3HRT A;  3CCR Q;  2CZ1 B;  5DM7 R;  3WVD B;  1M3B A;  1KK7 A;  3REA B;  2O4X B;  1IHW A;  1HYO A;  3UDC A;  1VOM A;  3KBG A;  3LH5 A;  2JNG A;  1YIT T;  2FZK B;  4E7I A;  5FLX E;  2Y90 A;  1SRL A;  1N8R C;  2AKL A;  4F7U E;  2RJE A;  4OF1 A;  3X24 B;  2F69 A;  1IZ6 A;  4E7Z A;  2JMA A;  2EQM A;  1K4U S;  2ED1 A;  5KH6 A;  5LJ5 e;  2HSE B;  3OSS C;  1KC8 R;  1VQK T;  1SSF A;  4FT4 A;  2HKQ B;  2RM4 A;  4BD3 A;  5C0M A;  4HVU A;  3MJX A;  3CCJ A;  3EGD A;  2IIM A;  3CCV T;  3G4S A;  3UWN A;  4M7D D;  3H0H A;  4KUD K;  2QQS A;  5CQX A;  1OZ2 A;  3O5Z A;  4M77 C;  1WHG A;  2JUF A;  2M02 A;  1RAA B;  5IHN A;  2MWO A;  1B3Q A;  3CCL A;  5KE3 A;  2DD4 A;  2KRM A;  2F5T X;  5LJ5 h;  4RG8 A;  1X2Q A;  3FRN A;  1E6G A;  3GNF B;  4E7L A;  4RTT A;  3QHS A;  1QVF A;  5I22 A;  5LJ3 j;  2XI9 A;  2L0A A;  4FM4 B;  3VU3 C;  3ASK A;  1WI7 A;  1NLP C;  3RNJ A;  2OTJ Q;  2L2P A;  1BI3 A;  1VQK Q;  3CPF A;  4M7A A;  1VQ6 A;  3NTH A;  3CCE T;  2LRQ A;  4Z8A A;  2JT4 A;  3JCM Q;  2YT6 A;  2M0Y A;  2EYX A;  3NHN A;  3QO3 A;  1VYV A;  3CCV Q;  1VQ5 A;  4J5Y A;  3CBO A;  4JRK A;  4A54 A;  4M7A C;  2PVG B;  1JXO A;  1UGQ B;  1GBQ A;  2W10 A;  2J6O A;  4MDW A;  4BE2 A;  4FL6 A;  3JCM f;  4M77 B;  1TOV A;  1M90 C;  1LNX A;  4IUV A;  2BZX A;  3CCQ A;  2RJC A;  3MEW A;  5A0D A;  3F70 A;  2MYS A;  1MV3 A;  4C8Q F;  2CS7 A;  4JRP A;  2YUN A;  5KYY A;  2VUB A;  4X9D A;  2DTI A;  5DY9 A;  1NZ9 A;  5GAM f;  4RKU E;  5DLO A;  2X35 A;  5GJW B;  2CP6 A;  4XAX B;  5IHK A;  3CCE Q;  3HTR A;  2CP7 A;  4M75 A;  3CME Q;  2DXC A;  2QA4 Q;  1GRI A;  1VYU A;  2F2X A;  1QWE A;  1T0H A;  1YIJ A;  1M2O A;  1OQK A;  4LDU A;  2LQ8 A;  1I5O B;  3HP9 A;  3RER A;  3CC7 T;  4JLG A;  2BUD A;  5CKE A;  4M7A B;  2QTX A;  2LX9 A;  3CBM A;  1OPL A;  4FCY A;  3QWX X;  2HBW A;  3CCJ T;  2VVK A;  3G4S T;  4OMM A;  2DLP A;  4PJO F;  2C0O A;  5GAN e;  2CUD A;  3VS2 A;  1W4S A;  3ZEH A;  2LCC A;  3EFR A;  5KYX A;  2ZPG B;  2O9S A;  1MMG A;  1Q86 R;  1ZBJ A;  2X4X A;  3MET A;  4BI8 B;  3OYB A;  4EDU A;  4IUQ A;  3FJP A;  3JCM J;  3A8H B;  3UAT A;  4EIK A;  1X01 A;  1M1K U;  3EFS A;  4OML A;  3RMS A;  1G3Y A;  1G3T A;  4R0K A;  1VQN A;  4N4G A;  2HQE A;  4M4Z A;  3CBP A;  4ATO A;  4ZNX A;  1ZSG A;  2LT1 A;  4KGX B;  4XTZ A;  2M51 A;  2E1H A;  2A7Y A;  2V1Q A;  4JJN K;  2OX7 A;  4M77 G;  3OS0 A;  4AMC A;  2ROL A;  1WGS A;  1AWW A;  1AWO A;  5GAN h;  1BIA A;  2KRO A;  2R5A A;  3M0Q A;  2JMC A;  1G83 A;  4DQ2 A;  5IN1 A;  4PJO D;  2RNA A;  3QUI A;  1OX9 A;  1I81 A;  2A36 A;  1I1J A;  1PC0 A;  3MP1 A;  1TG0 A;  1S72 A;  1NPR A;  4AFS C;  2ZPI B;  1AZG B;  5CR2 A;  4MZP A;  3CCJ Q;  2DZ9 A;  2FEI A;  5CQY A;  2DXT A;  2SEM A;  3G4S Q;  2XU8 A;  2DNU A;  2ZZD A;  2QK0 A;  2F2W A;  2CRE A;  3R6N A;  1AZE A;  2CUB A;  1QVG A;  6AT1 B;  3GOX A;  2EIF A;  2EQJ A;  1TU0 B;  1PSF A;  4C92 F;  2EYQ A;  3CCL Q;  3JCM W;  1M3C A;  3EG1 A;  2QQA A;  1VUB A;  2FG0 A;  1TH7 A;  1UB4 A;  4XQ3 A;  5LJ3 f;  1OU9 A;  2D1X A;  2GGR A;  2HNI A;  3G6E T;  2ZPF B;  4LXC A;  1GBR A;  1BI1 A;  1NPP A;  2E5Q A;  3MEV A;  1VQ6 Q;  2RMO A;  1IGQ A;  1SSH A;  1Q7Y R;  3GF5 A;  1WHK A;  1ZA2 B;  2MK5 A;  3EG0 A;  2KAF A;  5A0G A;  3RES A;  4DEX A;  1VQ5 Q;  5IHI A;  3LW5 E;  4C92 D;  2K6D A;  2OTL T;  1WHH A;  2E12 A;  4F04 B;  5CCA A;  2JZ2 A;  2P0P A;  2YHT A;  1ZUK A;  1AOJ A;  4Y91 A;  4M7D C;  3QWY A;  1QVG S;  2CP0 A;  2X9H A;  1X6B A;  4RCC A;  1KHI A;  1SEM A;  3CCQ Q;  1HXD A;  4HCZ A;  4PJN A;  3ULR B;  2JS2 A;  2K57 A;  2H3E B;  2CP2 A;  3JCM d;  2XHC A;  3VS4 A;  1TTH B;  4BE1 A;  4E7S A;  5GAO m;  1VQL A;  2QEX T;  5AT1 B;  2CH4 W;  5CKD A;  2FO0 A;  2C0T A;  3J80 E;  4J9E A;  3CPW A;  2QQR A;  4OGC A;  2WSE E;  1VQN T;  1Q82 R;  2KGT A;  4B9X A;  1M1K C;  1UUE A;  1Y96 B;  2DX1 A;  2YRV A;  5GAM d;  1K9A A;  2DYI A;  3EFO B;  2EFI A;  4C8Q E;  3BE3 A;  4TVR A;  1YIJ Q;  2QDY B;  3C4S A;  2LDM A;  5LJ3 h;  2LVM A;  3A8G B;  2RHI A;  2HL5 C;  1ZUY A;  3OBY A;  3OQ5 A;  1S72 T;  4M7D B;  2ZPE B;  3M57 A;  1TXQ A;  2NUP B;  4F7U F;  5J3B A;  1NEB A;  3FIF A;  3INZ A;  1RI9 A;  4IUT A;  2KRN A;  4ELY C;  2KSS A;  4KUI A;  5IH2 A;  1K9M U;  4WF2 A;  1N6A A;  1XNI A;  1U8R A;  5GAO r;  2K4Y A;  3KXT A;  2QI2 A;  3PVQ A;  2KI7 A;  1TS9 A;  5HY6 A;  1VQN Q;  4XK8 E;  1ARK A;  3P8D A;  3CQT A;  1QWF A;  1VQP T;  3OW2 S;  3CCU A;  1Z9Q A;  2YLC A;  2K3X A;  2AKK A;  2K79 A;  4C8Q A;  3CXC P;  1RI0 A;  5GMK e;  3CCS T;  1E7O A;  1YHQ A;  2HEQ A;  3P8H A;  3CMA A;  1WA7 A;  1YJW A;  1JEG A;  1S72 Q;  1HD3 A;  2JXB A;  2FRW A;  2EJF A;  3BDU A;  2DRK A;  2AIR B;  2RD1 A;  1M1G A;  1IB8 A;  3H9N A;  2KXD A;  2E41 A;  1QQJ A;  2A3L A;  2FVU A;  2K5L A;  3AT1 B;  5KE2 A;  1SRM A;  3VUZ A;  4CRI A;  3S3N A;  5EG2 A;  3VUB A;  4JZ3 A;  4M78 G;  3M0R A;  2PVO B;  1D0X A;  5GMK h;  1YI2 T;  1OU8 A;  1PRL C;  3SWN A;  2EKH A;  1LJO A;  1SHF A;  2XDP A;  2ENM A;  4PJO A;  2HAX A;  1UGV A;  4PLL A;  4OVA A;  3OYL A;  2NUZ A;  2DEQ A;  1JQQ A;  1V29 B;  2A0F B;  2DVJ A;  4BY6 C;  2DD5 A;  1KJW A;  1AVZ C;  1W2B S;  3PMI A;  1TUD A;  4QKU A;  3JCM P;  4DOW A;  2DL7 A;  5IXB A;  4J9C A;  3EHR A;  4WCI A;  1UGP B;  1VIF A;  3RKX A;  1FX7 A;  4L59 A;  1UGS B;  5GAN 3;  3N5B B;  1X43 A;  3G1J A;  1ZUU A;  3KFV A;  3ZFJ A;  3RKW A;  2VYT A;  4YTL A;  1ZSZ A;  4IKF A;  1VQL Q;  3MEU A;  4XU2 A;  3TRE A;  2J7I A;  1K9M C;  2KT1 A;  4OB0 B;  2ABL A;  4ZN1 A;  1K73 U;  3CC2 A;  2QG9 B;  4PJM A;  4JLI A;  1OI1 A;  2E6N A;  5FU7 C;  1LCK A;  3FLG A;  1IRX A;  4C92 A;  4II1 A;  2X4W A;  2EGA A;  4Y28 E;  4AFZ C;  4BY6 B;  2XD0 A;  1OPK A;  5I11 A;  1OYX A;  2IG0 A;  5GAN 5;  2WAC A;  1NYG A;  1YFN A;  1G3W A;  4L5G A;  4C92 C;  2DMO A;  4VUB A;  1YHQ T;  4OMP A;  1NEG A;  3G71 A;  1M8M A;  3OMG A;  5CVI A;  1YJW T;  5I21 A;  2CZ0 B;  2ZPH B;  3JB9 G;  4ELZ C;  3SHW A;  5L23 A;  5KYW B;  5KYU A;  4JS4 A;  2FPE A;  1KD1 U;  3OYF A;  3M4Y A;  4EPC A;  2IVW A;  4LN2 A;  3RBB B;  2VB6 A;  4M78 F;  3OMC A;  3OBW A;  2DZC A;  1M8V A;  2CT4 A;  1N9R A;  3CCU Q;  5FU7 B;  4A4G A;  2SRC A;  3NMZ C;  4JDS A;  4LDY A;  2OTJ T;  2EYW A;  2QYZ A;  3EGX B;  2DF6 A;  1Z9Z A;  2LQW A;  3C12 A;  3M0S A;  2VV5 A;  4P5N A;  1YHQ Q;  2LJ3 A;  2E6Z A;  1WJQ A;  2R5M A;  2EKO A;  3CMA Q;  4C92 B;  1YJW Q;  2RQT A;  2CP5 A;  2OI3 A;  2KXC A;  4D8D A;  4FYY B;  3OA6 A;  5GAO q;  4ZN3 A;  1R0C B;  1G2B A;  2GNC A;  2HZY A;  2K3B A;  3SFM A;  3FC3 A;  2MOX A;  1UJ0 A;  1W70 A;  3A98 A;  2JTE A;  1JJ2 A;  2HBP A;  4OGE A;  1RUW A;  3X20 B;  2JTM A;  4E6R A;  1FYN A;  2XK0 A;  1I07 A;  1AWJ A;  3NPF A;  4DBQ A;  2ZPB B;  3PTA A;  3RMQ A;  4EMH A;  1BI0 A;  5C6S A;  2X4Y A;  4OMF B;  1Q81 R;  4J9H A;  4F7U A;  2LNH B;  5KYU B;  3UA7 A;  1QW1 A;  1Y07 A;  3LLR A;  1NJI R;  5FRO A;  2LQK A;  3MPU B;  3CME T;  1VQ9 A;  3CC2 T;  3EG3 A;  2QA4 T;  1NE8 A;  2RQR A;  3MP8 A;  2DPP B;  1N8R R;  1O9S A;  1K73 C;  1FMW A;  2GBQ A;  4DBH A;  3DLL A;  2F5K A;  3QZ5 B;  1M9S A;  2GQI A;  4QQ6 A;  3JB9 J;  2Y4Y A;  2KQW A;  3UT1 A;  3HRU A;  2GF7 A;  4LE9 A;  3S3M A;  3LH0 A;  2O01 E;  2O9V A;  3VS5 A;  3GPL A;  3EAE A;  3EGD B;  4XU0 A;  3H0F A;  4OP0 A;  2OJ2 A;  1VQ8 A;  2MF2 A;  1PD1 A;  1KFZ A;  4EMK A;  3JB9 I;  4J7I A;  3FDR A;  2O31 A;  1PM3 A;  1AEY A;  3M53 A;  2NWM A;  1JBM A;  1QVF S;  2LJ0 A;  2C0I A;  2DXU A;  2L89 A;  5HKC A;  4PL6 A;  2RK1 A;  4LDX A;  2COY A;  2CZ6 B;  1KD1 C;  3CC2 Q;  2NYS A;  2ZAE A;  1B7T A;  2YUP A;  4OMN A;  3M4G A;  3ME9 A;  4F7U B;  2KR3 A;  5GMK l;  3PIO A;  3JCM e;  2X4J A;  4QW2 A;  1UTI A;  1PKS A;  4M75 C;  2HDA A;  2AT1 B;  5D6X A;  1YCY A;  4C8Q D;  1SHG A;  2YUO A;  2K2M A;  1Y7X A;  2H3J A;  4JUV A;  2PQW A;  2KYM A;  3G71 Q;  1M27 C;  2DL8 A;  3E1S A;  5GAM e;  4FYW B;  3OYM A;  3GIB A;  1ZBX A;  1C6V X;  1RAB B;  2LTO A;  2B8A A;  3S3O A;  1WQW A;  2ROT A;  5J39 A;  1H3H A;  3CCL T;  3HFN A;  3JCM h;  1SPK A;  2RJF A;  4A4F A;  1M90 R;  2RI5 A;  3M54 A;  2VGN A;  5CAI A;  4HKE A;  3QKJ A;  4ESR A;  1H3Z A;  4O6J A;  2DBK A;  4LNP A;  1PD0 A;  3C95 A;  4PKC C;  2EJG A;  3H41 A;  7AT1 B;  5LJ5 g;  3OYK A;  1X6O A;  2DIQ A;  4L6V 5;  3HFO A;  5KYY B;  4PNO A;  1LVK A;  2P0K A;  2JJ9 A;  2FB7 A;  2XMF A;  5GAM h;  1T0J A;  1JU5 C;  2RA2 A;  3OYN A;  1VQ6 T;  4A4H A;  4F17 A;  3I55 A;  4M75 B;  4CI0 C;  2DXB A;  2EBP A;  4Y92 A;  2JM8 A;  2XKO C;  4IUR A;  4M78 E;  2DO3 A;  1VQ5 T;  2LNV A;  1D1A A;  2D0Q B;  4QQD A;  2I0N A;  1IXD A;  3A1P A;  1GFC A;  4PFO A;  2QGG A;  1KSW A;  3WXM B;  1QP2 A;  3Q1J A;  3QYH B;  3P8B B;  4C5I A;  1WJS A;  3OS1 A;  1KQS A;  2EYY A;  4Q5W A;  3CCQ T;  1NM7 A;  2EW3 A;  2P0Q A;  1VQ8 T;  1Y57 A;  2EWN A;  3OSV A;  2EVR A;  3REB B;  2VAS A;  3C0C A;  4M7A G;  3QJY A;  5DLQ E;  5KYX B;  1QVG P;  1S1N A;  2RF0 A;  2DM1 A;  1D3B A;  4CC3 A;  2GFU A;  3VKI A;  5GAN 7;  3QG1 A;  1JXM A;  3L2U A;  1ABO A;  3LGF A;  2F1L A;  3QDF A;  5FWB A;  4BI4 A;  4IIM A;  5GJV B;  4KH0 B;  3L2V A;  2DRM A;  1VQ7 A;  3V8L A;  2EJ9 A;  1RAI B;  3HSB A;  1VQ9 Q;  4X9C A;  3LYI A;  4QVD A;  4C0G A;  5J26 A;  2L3P A;  3NTK A;  1WX6 A;  1PSE A;  2CDT A;  1YIJ T;  1RAC B;  4HCB A;  4M78 A;  2NLU A;  3VS7 A;  2G3R A;  4JRQ A;  2O2O A;  2ATC B;  1Y0M A;  4X1V A;  1YBY A;  4X34 A;  2RH2 A;  1CKA A;  2BZ8 A;  3M0T A;  4A4E A;  2PU9 B;  1VQ8 Q;  2DE0 X;  5LJ3 e;  1KQS S;  4DOV A;  2PUK B;  3QPH A;  1BYM A;  2PZ1 A;  4M75 G;  1YJ9 A;  2RHX A;  2L8D A;  1FMK A;  4JPB W;  2GQV A;  4MZT A;  2FPF A;  1D0Y A;  1X69 A;  2COZ A;  2FL7 A;  1D0Z A;  3NGP A;  1N27 A;  1RAD B;  3QII A;  1UFF A;  4D8K A;  1XJW B;  3JCM g;  1M2V A;  4HVW A;  2P84 A;  1U3O A;  3GBQ A;  4M77 F;  3CC4 A;  2ESW A;  4J7F A;  2YUQ A;  2HMA A;  1RLQ C;  2J6K A;  3FJ5 A;  3CPW P;  2B86 A;  2YLB A;  3OW2 P;  4DA4 A;  4LDV A;  1KG1 A;  5GAN g;  1VQM A;  4LD9 K;  1RLP C;  4C5G A;  1OOT A;  1WHM A;  2K7A A;  3EG2 A;  1VA7 A;  5FW9 A;  3JB9 H;  3OS5 A;  1EZZ B;  5I2M A;  3X26 B;  1EIF A;  1SF9 A;  1HK9 A;  1TWB A;  4A63 B;  1WXB A;  2EQK A;  1RL2 A;  3RIR A;  3I9Q A;  4EMG A;  3TSW A;  5LJ5 j;  2IPO B;  1N9S A;  3NTI A;  5GAN 4;  3HPW A;  2HQX A;  4M77 D;  2HCK A;  4RCB A;  1IHV A;  2LCL A;  1FWZ A;  1TSF A;  4LUE A;  1KC8 U;  4JRI A;  3CPW S;  1PKT A;  4OB1 B;  3A8L B;  2WSC E;  3JV3 A;  4C0Z A;  1YJN A;  1NG2 A;  2VWF A;  1XTD A;  1C0M A;  1CSK A;  1WQ7 A;  2FZG B;  1BU1 A;  2DVE A;  3R6O A;  2MWP A;  2EGE A;  4FIB A;  5GAO p;  4DBR A;  4RTU A;  2E64 A;  1UGR B;  3BW1 A;  3I55 Q;  4ZTF A;  5ECA A;  3H6Z A;  1M1K R;  1E6H A;  4GLK A;  4C8Q C;  3M55 A;  4FT2 A;  4FSX A;  4FYV B;  2L5Q A;  2X3W D;  2NUT A;  3EG9 A;  1JO8 A;  1GCQ A;  2DTH A;  4N0A A;  1P92 A;  2D0N A;  5GMK m;  3OYA A;  4ORZ A;  4KGV B;  3DLM A;  4AG2 C;  3SB2 A;  1Q81 U;  3RR6 A;  1W2B P;  4RG2 A;  2LX7 A;  4N0A C;  1NJI U;  1PRM C;  1LPL A;  5CKH A;  1VQO A;  1OZ3 A;  4CC7 A;  3DB4 A;  1M1F A;  2AZS A;  3LX7 A;  3M5A A;  1K8A R;  2KBT A;  1YJ9 T;  4M7D G;  1VQL T;  3ZL7 C;  1RAH B;  3I35 A;  1YIT A;  4HXJ A;  1WXU A;  2AK5 A;  1JRI A;  2CYZ B;  2YSQ A;  2WSF E;  3MP6 A;  2W0Z A;  3DB3 A;  2E70 A;  2RI2 A;  3SWN C;  1VQ7 Q;  1U5S A;  2QAS A;  1NLO C;  4PJO C;  4F14 A;  1QMC A;  5KYN A;  3LWI A;  2XG8 D;  3CC4 T;  4XTW A;  5FU6 C;  4C8Q B;  4XTU A;  2AZV A;  3FB9 A;  2QXF A;  3PVL A;  1MV0 B;  3E9F A;  2QAZ A;  3VS6 A;  5LJ3 g;  2KY9 A;  3PGG A;  3HL8 A;  5D7U A;  2KEA A;  2KDS A;  3PFS A;  4KBM B;  2KE9 A;  2RI3 A;  2LJ1 A;  3RKY A;  3X28 B;  1K0S A;  1QKW A;  5GAN 2;  1CKB A;  3M0P A;  2NUT B;  1MMN A;  4ME7 A;  1PWT A;  4FSS A;  3V8K A;  2LZ6 B;  1WFW A;  3GNG A;  1U1S A;  4N4I A;  2O4X A;  1YJ9 Q;  3QYG B;  2YWW A;  1X27 A;  3I5S A;  1LOJ A;  2PVD B;  4RTY A;  4CC4 B;  2RHZ A;  4HT8 A;  3UF4 A;  3T9N A;  2K5I A;  3VRY A;  3M59 A;  3M9Q A;  1ZSZ C;  3CCU T;  5CIU A;  5IT9 E;  5GAN j;  2A37 A;  1YJN T;  3MEA A;  3SWN B;  1KC8 C;  4NL2 A;  1XQH A;  1GFD A;  4PJO B;  4JJB A;  3CC4 Q;  3V7R A;  2JS0 A;  3JAM E;  2XDD A;  2R58 A;  2YRD A;  5FU6 B;  5KCO A;  3JRZ A;  5KCH A;  4BE0 A;  4J9G A;  1VQM Q;  3PE0 A;  2OAU A;  1Q86 U;  3CMA T;  3TSZ A;  5I2S A;  3J7A F;  3EGU A;  5M9O A;  3EH1 A;  2CH4 A;  1YWO A;  1XOV A;  4M77 E;  2LCS A;  1FMV A;  2RHU A;  1M5Q 1;  4AFU C;  3GP8 A;  5LJ5 f;  2RN8 A;  1IGU A;  3OS2 A;  2X51 A;  2V8J A;  1Q81 C;  1VQO T;  1ZLM A;  1KQ2 A;  3VS0 A;  1YJN Q;  1NJI C;  3CCM Q;  2R57 A;  3QDR B;  3PMT A;  2J6F A;  1ZSZ B;  2DIL A;  2BTT A;  2DBM A;  4M7D F;  3G7Z A;  3X25 B;  4MML A;  4MDX A;  1UHC A;  2K9G A;  1K9M R;  4PFZ A;  2EAY A;  1O75 A;  1MHN A;  2E5K A;  3TU4 K;  1GXI E;  1KHC A;  1B07 A;  3DKM A;  4DEY A;  4R56 A;  1QP3 A;  5AYF A;  1SG5 A;  3SD4 A;  1K76 A;  2EGC A;  4M7A E;  3CC7 A;  4QT7 A;  1MND A;  2QGF B;  1WIE A;  3E2U A;  3OYH A;  2J06 A;  2XID A;  3LGL A;  4ZGE B;  3VS3 A;  4M78 D;  1X6G A;  4M77 A;  4Z89 A;  4KT0 E;  4BAC A;  2CSQ A;  2A08 A;  4PJO G;  4V2S A;  4WTO B;  3OYE A;  1MGQ A;  5GAO l;  3L2Z A;  1VQO Q;  2M16 A;  3TQ7 P;  1QCF A;  4C0D C;  4BI3 A;  1JJ2 P;  4BDZ A;  1Q7Y U;  2FPD A;  1HJD A;  3URG A;  1NYF A;  2H8H A;  1YIT Q;  3L1A A;  4FW2 A;  3QJ6 A;  2DL3 A;  4B9W A;  3I56 A;  1QVF P;  1TUC A;  1YWP A;  2DK3 A;  1TUG B;  3V7S A;  2L3R A;  4M75 E;  1JB0 E;  1NBE B;  5D6W A;  1GCP A;  1YN8 A;  2QDL A;  3TEE A;  2KYB A;  2P4R A;  1JJ2 S;  3G71 T;  3QZ9 B;  3C94 A;  1EFN A;  1Q86 C;  1D1C A;  3JB9 F;  4HVV A;  4PFP A;  1MNE A;  2J05 A;  2ED0 A;  2KT8 A;  3D7S B;  4LDW A;  4OMO A;  1Q82 U;  3CD6 A;  3RDV A;  1FXX A;  4K11 A;  2FHD A;  2YRC A;  1T3L A;  4C92 G;  2QQB A;  2JM9 A;  4C0D B;  3WVE B;  2G6F X;  2MMP A;  4EMK C;  2XDB A;  1G8X A;  2LC4 A;  5CKF A;  4BB7 A;  5IXF A;  2DKG A;  3UA6 A;  1ZX6 A;  2DEU A;  2KRS A;  5EC7 A;  5GAN f;  2CGH A;  5CKB A;  3G6E A;  1WNL A;  3H8Z A;  5CO7 A;  4E7H A;  2LP5 A;  4KRT A;  3ZBD A;  4J83 A;  3MHX A;  3QBY A;  3JB9 D;  3VYG A;  5GAO n;  5A2Q E;  1K73 R;  2OTL A;  4Z88 A;  2KK4 A;  3L42 A;  4KH1 B;  2MCN A;  4Z02 A;  2KMT A;  1WZO A;  2CZ7 B;  2DYB A;  2V26 A;  3A8M B;  5GMK j;  2V8I A;  1YNZ A;  4C0F A;  2MAM A;  4D6W A;  9ATC B;  1WDX A;  2JTF A;  4EMK B;  1H92 A;  5LJ5 d;  1Q95 G;  2ZCF B;  2BKD N;  3THK A;  4PLI A;  1I8F A;  1QCO A;  2CT3 A;  2K5F A;  3HHT B;  4RUG A;  2QEX A;  4R55 A;  4J8O A;  4KUL A;  1RAE B;  3PNW C;  1WYX A;  5IAY A;  2JVV A;  8AT1 B;  2QQ9 A;  1Q7Y C;  3NFC A;  1VQ9 T;  2RB6 A;  3I56 T;  2E4H A;  4OB2 B;  1KD1 R;  2X3X D;  2D6F A;  1G3S A;  3CC7 Q;  1U1T A;  2VXF A;  2KNB B;  1BCM A;  3SEM A;  4M7D E;  1MMD A;  4J9I A;  3PIP A;  5L8R E;  2L3Q A;  3EH2 A;  1AWX A;  2DFU A;  4C5H A;  4F7U G;  3JCM X;  4NL3 A;  1K8A U;  4DBF A;  2DL5 A;  2OAW A;  1I4K 1;  2GTO A;  2DL4 A;  2RQW A;  4JJD A;  2LMJ A;  2RJD A;  3RUX A;  3CD6 T;  5CK9 A;  2RPN A;  2D9T A;  4LUD A;  1WPY A;  4PJJ A;  1Q82 C;  1KQS P;  1OX8 A;  1SKU B;  4RTZ A;  3JCM V;  1Y96 A;  3I5R A;  1VQP A;  1UDL A;  3EFO A;  3I56 Q;  1D1B A;  1BBZ A;  3OYG A;  4QVC A;  1UJY A;  4GY5 A;  5A0L A;  1T3S A;  2V1R A;  1M30 A;  1MMA A;  3CCS A;  8ATC B;  3A5Z B;  3VYH B;  1OUL A;  3KUF A;  1R0B G;  3VV0 A;  3M0U A;  2P4T A;  1F1B B;  4M7D A;  2DJQ A;  2NUP A;  1UEB A;  2DER A;  2I2L A;  1V76 A;  4M78 C;  1PCX A;  2RK2 A;  4KGZ B;  4LD6 A;  2E65 A;  2RQU A;  5GMK i;  4RTW A;  4A53 A;  3OB9 A;  2YXY A;  1U06 A;  1A0N B;  1RAG B;  5HK3 A;  3CD6 Q;  1K1Z A;  4NS5 A;  4AFQ C;  1KIK A;  2MIO A;  1EX4 A;  3M58 A;  2PUO B;  2E3H A;  4RTV A;  3E9G A;  4HT9 A;  3S6W A;  4J6Y A;  2Y4X A;  2K3Y A;  4QQG A;  1PHT A;  3J81 E;  1YI2 A;  4J6W A;  2DAQ A;  4XU1 A;  4FU6 A;  4HCC A;  1ZA1 B;  3EHQ A;  1D3B B;  4E2F B;  3VRZ A;  3G6E Q;  4JJC A;  4BDY A;  2AHJ B;  1VQ4 A;  1BB9 A;  1M3A A;  3OW2 A;  1X75 C;  4MZM A;  3L2W A;  2LT4 A;  5GAM g;  5GAN d;  3I55 T;  4ZGJ B;  3OYI A;  1MUZ A;  4B6M A;  1UEC A;  5GAN 6;  1W1F A;  2EYZ A;  2CSI A;  1BK2 A;  2RO0 A;  5LL6 S;  3O8V A;  3A8O B;  2OTL Q;  4M78 B;  3BY7 A;  1M4Z A;  3BDL A;  2D8J A;  2CP3 A;  4C5E A; 
#chains in the Genus database with same CATH homology
 2A36 A;  1I1J A;  1WLP B;  1X27 A;  3I5S A;  1TG0 A;  2O88 A;  3IQL A;  2ECZ A;  1V1C A;  4AFS C;  4RTY A;  3EG3 A;  1AZG B;  4CC4 B;  2RQR A;  2FEI A;  4GLM A;  3UF4 A;  2SEM A;  2HSP A;  2GBQ A;  3VRY A;  2DNU A;  2VKN A;  2EQI A;  1GL5 A;  1UG1 A;  5FWC A;  2A37 A;  2F2W A;  2CRE A;  3R6N A;  1AZE A;  2CUB A;  1GFD A;  2GQI A;  4JJB A;  2JS0 A;  4LE9 A;  2O9V A;  3VS5 A;  4J9G A;  1I0C A;  1M3C A;  3H0F A;  2OJ2 A;  3PE0 A;  3EG1 A;  3TSZ A;  1KFZ A;  2FG0 A;  3EGU A;  2O31 A;  1WXT A;  2CH4 A;  2D1X A;  1YWO A;  1XOV A;  2GGR A;  1AEY A;  2NWM A;  2LCS A;  4GBQ A;  2LJ0 A;  4AFU C;  2C0I A;  2A28 A;  2LQN A;  1GBR A;  1QLY A;  2RN8 A;  2RMO A;  4J9B A;  1SSH A;  1GCQ C;  1HSQ A;  3EG0 A;  2YUP A;  4DEX A;  4OMN A;  1ZLM A;  5IHI A;  3VS0 A;  2K6D A;  2KR3 A;  1J3T A;  2J6F A;  1UTI A;  2BTT A;  2DBM A;  1PKS A;  2DIL A;  1ZUK A;  3H0I A;  1AOJ A;  1UE9 A;  2HDA A;  3QWY A;  1SHG A;  2YUO A;  1X6B A;  2K2M A;  1UHC A;  1QKX A;  2K9G A;  2KYM A;  1SEM A;  2E5K A;  2GTJ A;  1M27 C;  2DL8 A;  3ULR B;  2JS2 A;  1B07 A;  4DEY A;  1UHF A;  1K76 A;  1AD5 A;  1ABQ A;  2EGC A;  4QT7 A;  3VS4 A;  1VYT A;  1WIE A;  4RTX A;  2J06 A;  3VS3 A;  2CH4 W;  4HCK A;  4AG1 C;  1X6G A;  2FO0 A;  2C0T A;  2ROT A;  2YDL A;  4J9E A;  1OEB A;  1H3H A;  1SPK A;  4Z89 A;  1YCS B;  2PTK A;  2KGT A;  2CSQ A;  2FRY A;  1UUE A;  2A08 A;  4ESR A;  2DX1 A;  2DBK A;  4LNP A;  1K9A A;  3H41 A;  2PNI A;  2L3S A;  1QCF A;  2EPD A;  2XMF A;  1T0J A;  1IO6 A;  2FPD A;  1JU5 C;  1ZUY A;  1HJD A;  1NYF A;  2H8H A;  4F17 A;  2BZY A;  4J9F A;  5HCK A;  2DL3 A;  2EBP A;  4Y92 A;  1NEB A;  2DA9 A;  2JM8 A;  1TUC A;  1YWP A;  3VS1 A;  1RI9 A;  2KRN A;  2I0N A;  5IH2 A;  1PNJ A;  1OV3 A;  3TVT A;  1GFC A;  1KSW A;  1N5Z A;  1GCP A;  1YN8 A;  2QDL A;  3PVQ A;  2KYB A;  2EYY A;  2P4R A;  1NM7 A;  2EW3 A;  2JW4 A;  1ARK A;  1Y57 A;  1K0X A;  3CQT A;  1QWF A;  2EVR A;  3REB B;  1EFN A;  4J9D A;  2D8H A;  1Z9Q A;  3C0C A;  1S1N A;  4HVV A;  2RF0 A;  2AKK A;  2F2V A;  4JZ4 A;  2DM1 A;  2J05 A;  2K79 A;  2ED0 A;  2KT8 A;  4OMO A;  4CC3 A;  4K11 A;  1JXM A;  1T3L A;  1ABO A;  1YP5 A;  1E7O A;  5FWB A;  4IIM A;  5GJV B;  1H8K A;  2JM9 A;  1X2K A;  2HEQ A;  4OMQ A;  2DRM A;  2G6F X;  1WA7 A;  1JEG A;  3U23 A;  1HD3 A;  2JXB A;  2FRW A;  4IIO A;  2L3P A;  5IXF A;  1WX6 A;  1W6X A;  2RQV A;  2DRK A;  2CDT A;  3UA6 A;  4F16 A;  1ZX6 A;  4CC2 A;  2KRS A;  5EC7 A;  3VS7 A;  1M3B A;  2KXD A;  3REA B;  2O2O A;  1Y0M A;  3LH5 A;  4X1V A;  2LP5 A;  1SRM A;  4KRT A;  1SRL A;  1CKA A;  2BZ8 A;  2AKL A;  4JZ3 A;  3M0R A;  3M0T A;  2DE0 X;  1PRL C;  2JMA A;  4Z88 A;  2EKH A;  1SHF A;  1K4U S;  2PZ1 A;  2ED1 A;  2ENM A;  2MCN A;  1UGV A;  1FMK A;  4JPB W;  2FPF A;  2NUZ A;  1JQQ A;  1X69 A;  2DYB A;  4HVU A;  3NGP A;  1YNZ A;  2IIM A;  1UFF A;  4D8K A;  2DVJ A;  1WDX A;  4HVW A;  3H0H A;  1H92 A;  1U3O A;  1KJW A;  3GBQ A;  3THK A;  3O5Z A;  1AVZ C;  2CT3 A;  2ESW A;  4RUG A;  2YUQ A;  1TUD A;  1RLQ C;  2J6K A;  5IHN A;  3FJ5 A;  1B3Q A;  2B86 A;  1WYX A;  2DL7 A;  2KRM A;  5IXB A;  1RLP C;  1X2Q A;  1OOT A;  4J9C A;  2K7A A;  3EHR A;  4WCI A;  1E6G A;  3EG2 A;  1VA7 A;  5FW9 A;  2X3X D;  4RTT A;  5I22 A;  2L0A A;  1WXB A;  4A63 B;  1X43 A;  1ZUU A;  3KFV A;  3I9Q A;  1WI7 A;  3TSW A;  1NLP C;  3RNJ A;  2L2P A;  2KNB B;  3SEM A;  4Z8A A;  4J9I A;  2J7I A;  2JT4 A;  2KT1 A;  2ABL A;  2HCK A;  2YT6 A;  2M0Y A;  2L3Q A;  4LUE A;  1AWX A;  2EYX A;  3NHN A;  1VYV A;  1LCK A;  1PKT A;  2DL5 A;  2OAW A;  3JV3 A;  2EGA A;  2GTO A;  2DL4 A;  1JXO A;  1NG2 A;  2VWF A;  1CSK A;  2RQW A;  4AFZ C;  4JJD A;  2LMJ A;  1BU1 A;  1OPK A;  1GBQ A;  2RPN A;  5I11 A;  2W10 A;  2J6O A;  4LUD A;  1NYG A;  2EGE A;  2BZX A;  2DMO A;  4RTU A;  4OMP A;  4RTZ A;  1NEG A;  1M8M A;  3I5R A;  5ECA A;  1MV3 A;  1E6H A;  1UDL A;  1BBZ A;  2X3W D;  2YUN A;  1UJY A;  1JO8 A;  1GCQ A;  3SHW A;  1T3S A;  2V1R A;  1M30 A;  5L23 A;  2D0N A;  2FPE A;  4ORZ A;  5GJW B;  5IHK A;  4AG2 C;  3M0U A;  4LN2 A;  3RBB B;  1GRI A;  1VYU A;  2F2X A;  2LX7 A;  2DJQ A;  1QWE A;  1PRM C;  1T0H A;  2RQU A;  4CC7 A;  2AZS A;  2CT4 A;  4RTW A;  1U06 A;  1A0N B;  2SRC A;  3NMZ C;  2KBT A;  3ZL7 C;  2EYW A;  3I35 A;  1K1Z A;  4HXJ A;  1OPL A;  4AFQ C;  1WXU A;  1KIK A;  2MIO A;  2AK5 A;  2DF6 A;  1Z9Z A;  2LQW A;  3M0S A;  4RTV A;  2YSQ A;  3QWX X;  2HBW A;  2LJ3 A;  2VVK A;  2W0Z A;  4OMM A;  1U5S A;  2DLP A;  2C0O A;  1PHT A;  1NLO C;  2CUD A;  2RQT A;  3VS2 A;  2OI3 A;  4F14 A;  2KXC A;  4D8D A;  2O9S A;  1ZBJ A;  1G2B A;  3EHQ A;  2GNC A;  2K3B A;  2AZV A;  2MOX A;  1UJ0 A;  1W70 A;  3A98 A;  3UAT A;  3VRZ A;  4EIK A;  3PVL A;  2JTE A;  1MV0 B;  4JJC A;  1RUW A;  1BB9 A;  4OML A;  1M3A A;  3VS6 A;  4R0K A;  1FYN A;  4E6R A;  1I07 A;  1AWJ A;  3NPF A;  2KEA A;  2KE9 A;  4M4Z A;  2LJ1 A;  1MUZ A;  1ZSG A;  4ZNX A;  1UEC A;  1W1F A;  1QKW A;  1K0S A;  2EYZ A;  1CKB A;  2M51 A;  2CSI A;  3M0P A;  2V1Q A;  1BK2 A;  1PWT A;  2ROL A;  4J9H A;  1AWW A;  4FSS A;  2LNH B;  1AWO A;  3UA7 A;  2KRO A;  3M0Q A;  2D8J A;  2LZ6 B;  2JMC A;  1G83 A;  1WFW A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...