2F2WA

Alpha-spectrin sh3 domain r21a mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2wA00
1IO6A 1GCQA 2F2VA 1E6HA 4OMQA 2GBQA 3CQTA 1AWWA 1YWPA 3TVTA 2DL8A 1ARKA 4RTUA 2CT4A 2EGCA 1AZGB 1SEMA 2ROLA 2DYBA 1X2KA 4IIMA 3EHRA 2AZVA 1U5SA 2DL4A 2BZYA 4HVUA 2C0TA 2M51A 2DNUA 2FEIA 4OMLA 4RUGA 2KYBA 1WX6A 2HBWA 1GBQA 2DILA 3R6NA 2K9GA 2O9VA 1X27A 1KFZA 1WXTA 4QT7A 2DVJA 3RNJA 2RQTA 1UECA 2DJQA 1UJYA 4HVWA 1M3CA 1X43A 2JS0A 1XOVA 2NWMA 5L23A 1A0NB 2GGRA 1HJDA 1K0SA 1TG0A 1WXBA 5IXFA 2FG0A 2EGAA 1V1CA 2EBPA 1PKSA 2KRSA 2OJ2A 2KXDA 2W0ZA 3THKA 2RQVA 2D0NA 2DRMA 1QKXA 1BBZA 1QKWA 2JTEA 2KXCA 3NHNA 4Z88A 1UHFA 2EVRA 1NEGA 4JJCA 5I22A 1NEBA 4E6RA 1AOJA 5GJWB 1CKBA 1I07A 4RTZA 1SPKA 4OMPA 3M0TA 1U3OA 1YN8A 2JS2A 2CSQA 2D8JA 4J9BA 1GL5A 1WA7A 2M0YA 1H8KA 1HSQA 1VYVA 2K79A 1SRMA 4ESRA 2DL7A 3M0RA 2O31A 2VWFA 3VS6A 2RQRA 1GFCA 2DRKA 1E7OA 1MV3A 3A98A 1SRLA 1ZBJA 4LNPA 2ENMA 4EIKA 4OMMA 4AFZC 3QWXX 3M0QA 5I11A 1UFFA 4J9IA 1Y0MA 3H0HA 1K9AA 3VS1A 4LN2A 5IXBA 2V1RA 4JZ3A 1AVZC 3VRZA 1SSHA 3VS4A 2BZ8A 3EG2A 1YCSB 1OPKA 4AG2C 1J3TA 1W6XA 1AWXA 1PRLC 2MIOA 4OMNA 2LNHB 2DL3A 2FPDA 1KIKA 3FJ5A 5FW9A 2MCNA 1G83A 4LE9A 2AKKA 2RQWA 1ZUYA 1RI9A 2DA9A 4Y92A 1I1JA 2JW4A 4K11A 2O88A 2P4RA 2ECZA 4GBQA 2PNIA 2CSIA 1JEGA 3VS2A 1WXUA 1U06A 3I5SA 2YT6A 2HEQA 1UDLA 3I9QA 1YNZA 4OMOA 1SHGA 1NYGA 2L2PA 2I0NA 3M0UA 3SEMA 3TSZA 1EFNA 2YDLA 1WFWA 4AFUC 1UE9A 2KR3A 1X6GA 2HSPA 2PZ1A 1JXOA 4RTYA 5IHNA 5FWCA 2ED0A 5HCKA 1RUWA 2E5KA 2GQIA 4KRTA 2X3WD 2DBMA 3KFVA 1RLPC 2SRCA 1S1NA 1K0XA 4RTXA 2KNBB 2YSQA 2O9SA 3VS0A 3EG3A 1H3HA 1BU1A 2B86A 1AEYA 1CKAA 1QWFA 2KRMA 1B3QA 3RBBB 4DEXA 2F2XA 2CH4A 2KBTA 2X3XD 2J6FA 2DL5A 2LX7A 3PVLA 3EG1A 4J9EA 1B07A 2DX1A 1AWOA 4GLMA 1FMKA 2XMFA 4X1VA 2LMJA 2ESWA 2DMOA 4CC2A 2DE0X 4CC4B 2A08A 1ZSGA 2SEMA 1GFDA 1GBRA 2H8HA 1ZX6A 1M3AA 1QLYA 2LZ6B 1UGVA 2ROTA 1K1ZA 1ZUKA 1WDXA 2L3QA 1X2QA 4RTWA 2EKHA 1GCQC 2AKLA 2JM9A 3NMZC 1RLQC 4JPBW 1M27C 2BZXA 1K4US 2GTJA 1QWEA 2FRYA 1UTIA 1G2BA 3NGPA 1BK2A 2J06A 1VYTA 1JU5C 2BTTA 1UG1A 2ABLA 3ZL7C 2CUDA 1JQQA 2J7IA 3H0FA 1AZEA 1WIEA 2DBKA 3REAB 3U23A 1M3BA 1AWJA 2VVKA 4AG1C 2O2OA 1WI7A 2RN8A 4HXJA 4AFSC 4Z89A 4JJBA 1I0CA 4JJDA 1AD5A 2K7AA 2KE9A 1T0HA 2HCKA 2VKNA 2YUQA 2KEAA 2RMOA 2RQUA 4J9HA 2KRNA 4R0KA 3EGUA 2CT3A 3NPFA 2C0OA 3JV3A 1VYUA 2RF0A 1X6BA 1VA7A 1NLPC 3PVQA 3EHQA 2DM1A 2L3SA 1ZUUA 3M0SA 1PRMC 2EYZA 4HCKA 2JMAA 4RTVA 2FO0A 1M30A 1PWTA 2LQNA 3H0IA 2L3PA 4J9CA 3VRYA 3QWYA 1PNJA 2J6KA 1MV0B 3UATA 1NG2A 5EC7A 2GTOA 1CSKA 3VS5A 3UA7A 2C0IA 3VS3A 2FPEA 1YP5A 3TSWA 1T3SA 5IHKA 3O5ZA 4LUEA 2NUZA 4WCIA 4CC7A 5ECAA 2EYXA 1M8MA 2G6FX 3IQLA 3SHWA 2EQIA 2A36A 4J9GA 1K76A 2LP5A 1Z9ZA 2YUNA 1UJ0A 1W70A 1UHCA 2CDTA 2JM8A 2K6DA 2J6OA 1KSWA 2W10A 2EGEA 2LJ0A 3PE0A 2MOXA 1WYXA 1T3LA 1ABOA 1QCFA 1NLOC 3ULRB 4F14A 2LCSA 2QDLA 3H41A 2FRWA 1YWOA 4ZNXA 1Z9QA 4FSSA 2KROA 3VS7A 4IIOA 1SHFA 2KT1A 2EPDA 1H92A 3GBQA 1NYFA 1T0JA 3M0PA 4F17A 1UUEA 1W1FA 3EG0A 2YUPA 4LUDA 4D8KA 2CH4W 2JMCA 2DLPA 2EW3A 1X69A 3I5RA 3C0CA 2A28A 3LH5A 1WLPB 4JZ4A 2LJ1A 4F16A 4A63B 2OAWA 2AZSA 2FPFA 2CREA 1PKTA 3REBB 1NM7A 1TUCA 2YUOA 4ORZA 1OOTA 2CUBA 4CC3A 1E6GA 2V1QA 2JXBA 2KYMA 2OI3A 2J05A 2K2MA 5IH2A 3I35A 4RTTA 1FYNA 1OPLA 2EYWA 2F2WA 5GJVB 2GNCA 1BB9A 4AFQC 2K3BA 2EYYA 2DF6A 4Z8AA 2RPNA 1JO8A 2PTKA 1Y57A 2D8HA 1LCKA 1N5ZA 2KT8A 3UA6A 1GRIA 2RNAA 1ABQA 4M4ZA 2HDAA 1HD3A 2LQWA 1JXMA 1MUZA 1OEBA 4DEYA 1GCPA 1PHTA 2LJ3A 1KJWA 4J9DA 1TUDA 5FWBA 2A37A 3UF4A 2L0AA 2JT4A 4J9FA 2AK5A 2KGTA 2IIMA 5IHIA 1OV3A 1ZLMA 2D1XA 4D8DA 4HVVA 2ED1A
chains in the Genus database with same CATH superfamily
2QQ9A 2CYZB 2F2VA 5HK3A 4JLGA 1M2OA 1YJWA 4J7IA 2VXEA 1Q82U 1XNIA 4B9WA 5GMKe 3TVTA 1I81A 5LJ5f 2F69A 1M9SA 4RTUA 5A0DA 2EGCA 6AT1B 2LCCA 3MPUB 4F7UF 1KD1C 3MP8A 2K3XA 4PJOB 3META 3CCLT 2EIFA 3SDZA 4M7DB 2BIVA 3X24B 2RB6A 5KYXA 2O4XA 1Q95G 4RCBA 1GBQA 2RHZA 3R6NA 3X26B 4II1A 2O9VA 1KFZA 2CZ1B 1LJOA 3ZBDA 2WSEE 1OX9A 2DVJA 2M02A 1RI0A 4DBQA 1X43A 3RR6A 5L23A 1K0SA 5IXFA 1NE8A 2FG0A 5GAMe 2GFAA 4DOVA 1KD1U 1VQ5T 2K3YA 2OJ2A 4E2FB 1I5OB 2KQWA 1QMCA 4J6XA 1KQSS 2DTHA 3OS5A 1LPLA 1VQMT 3CBOA 1UHFA 5I22A 1NEBA 1G5VA 4E6RA 1AOJA 1WJRA 3A5ZB 3V7CA 1CKBA 3H6ZA 3L2QA 3QXEB 2EKOA 3EGXB 1S72Q 2X35A 1TH7A 2HQHA 3MJXA 4OMPA 1JBMA 2EYQA 3GLXA 3CCUQ 3CCRA 3L2UA 2CZ0B 1WA7A 1H8KA 3GIBA 4M78B 3M9QA 4ESRA 2O31A 1R77A 2VWFA 2EJGA 1E7OA 2QA4Q 1MV3A 3A98A 1KHCA 4EIKA 1WPYA 5GAOn 3M0QA 4ELYC 2OTLA 1XJWB 3L1AA 5C6SA 4M75B 3H0HA 1K9AA 5IXBA 3NTIA 1OPKA 4AG2C 2E6NA 4XK8E 4QVDA 3O8VA 3TREA 3M4YA 1N8RC 2DL3A 3R6OA 3FJ5A 5D7UA 4LDWA 1G83A 1BIBA 4NL3A 3KBGA 3MEWA 1D3BB 1MMAA 1PSEA 3EFRA 4BDZA 5FLXE 3V7SA 2PNIA 3MKDA 2WSCE 1WXUA 3M57A 4JS5A 2RK1A 3UT1A 3X20B 4M78E 2ZAEA 1UDLA 3I9QA 4FT4A 3TSZA 2X4JA 2YDLA 4N0AA 2FHDA 2K2VA 1NPPA 1QVPA 2FZKB 4A4EA 1QW1A 5GMKj 1MMGA 1EZZB 2L5QA 5FWCA 1N8RU 1W4SA 2E5KA 3GP8A 2L8DA 2E3IA 1D0ZA 2Y4YA 3QSUA 3P8HA 1Q86R 1VQLA 3CXCP 4C92E 1SKUB 3DB3A 4KGZB 1K0XA 3JCMX 5GAN5 2XHCA 2RHUA 2FB7A 2K5LA 2YXYA 2QK0A 1CKAA 4C0GA 1O9SA 3RBBB 4X9CA 2F2XA 1TWBA 3OBYA 5GAMd 2CH4A 2KBTA 2JN0A 2DL5A 5D6XA 1B7TA 4C0ZA 4C92C 1B07A 2DX1A 1UB4A 3CCET 1AWOA 1RAHB 4GLMA 1FMKA 2AHJB 5HY6A 3CXCS 4ZGDB 2DIQA 4CC2A 4M7AG 1M4ZA 4CC4B 4M77F 3CCVA 1GFDA 1GBRA 2H8HA 3L42A 2LZ6B 1PG5B 1WDXA 2MWOA 5J39A 1X2QA 1RACB 1RAFB 4KGXB 4M77D 3LWHA 4RTWA 4ZTFA 5D6YA 5CKBA 1M27C 3EFSA 1VYTA 1JU5C 4ZN1A 5KYYB 1MMDA 1VQMQ 3QPHA 1WIEA 2DBKA 4LXCA 2KVQG 4O6JA 2R58A 2PVOB 2WACA 4AG1C 4JRPA 1IGUA 4C5GA 5CKEA 4Z89A 1I0CA 2HL3A 1AD5A 5CAIA 2L3RA 2YUQA 3M58A 3M54A 2DZCA 2RQUA 2DFUA 4DBFA 4XTZA 2ZPFB 4M7AC 1VUBA 5DLQE 3I55A 2CKKA 5GAN3 1NLPC 4BE2A 3EHQA 2DM1A 3I56A 1YJWT 2MPXC 1KC8C 2EYZA 4LDXA 1KQSA 2FO0A 3CD6Q 2L89A 3SWNA 2EAYA 3QWYA 2ZPIB 4XTYA 3QBYA 1I5LA 1PNJA 2J6KA 5IN1A 3SFMA 1UGSB 3QUIA 4N4IA 1C1AA 3MHXA 2C0IA 2RHXA 1YP5A 4XU2A 4RG2A 2PVDB 4LUEA 5KCHA 4CC7A 1QP3A 3HPWA 2CS7A 3IQLA 2A36A 4J9GA 1G3YA 1K76A 2LP5A 1Z9ZA 3OW2P 2JM8A 3PIOA 2JVVA 1WJQA 1MNDA 1YITT 4CRIA 2K57A 3PE0A 2MOXA 1T3LA 1ABOA 2DYIA 3TU4K 3NTHA 2DD4A 1NLOC 3CCLA 4C5HA 4JRQA 2LCSA 1NBEB 4ZNXA 4FSSA 1YI2A 4IIOA 3JCMJ 3CCMQ 2EPDA 1YJ9T 3GBQA 4C5IA 3HRSA 4JDSA 4E47A 5DLOA 2EQKA 3PFSA 3RUXA 4C8QB 2JMCA 2DEUA 4DBHA 2EW3A 2X4XA 3C0CA 2Z0WA 1OU9A 2A28A 2MK5A 3J7AF 2V8KA 3CCEQ 3GF5A 4C0FA 1VQ5A 3C4SA 1G3WA 4NL2A 1ZA1B 1AHJB 1N9RA 3RMQA 1TUCA 2OTLT 1VQ8T 1OOTA 3JB9H 1VQMA 2V1QA 3HKSA 1WNLA 2MYSA 4N0AC 2VV5A 4RTTA 5GJVB 4AFQC 2K3BA 1KG1A 4J7FA 2EYYA 2RPNA 4X34A 2JTFA 3BE3A 4E7JA 2PTKA 2KT8A 2QEXA 4BI8B 4C92F 1ABQA 5IT9E 1QVGP 2HDAA 2QI2A 2G3RA 4AT1B 4BE1A 2XKOC 5GAN7 2RH2A 1YIJA 2Y90A 4J9DA 3UF4A 2L0AA 4J5YA 3JCMW 3SWNB 2IIMA 5IHIA 5KYNA 3PTAA 3OYLA 2E5QA 1Q82R 3C94A 1GCQA 3MEVA 4OMQA 1YJWQ 1K73C 4J6YA 3CQTA 1AWWA 2D9TA 2DL8A 3JCMh 2HZYA 2DXBA 1VQLT 4PJOA 1HYOA 1H3ZA 4GY5A 3M55A 3EHRA 4QQDA 4M7DA 2DL4A 2C0TA 3G4SA 2DNUA 3Q1JA 1QCNA 2FEIA 3PGGA 4RUGA 1ZSZB 3JCMV 4M7AF 4BUGA 2LT4A 2FZGB 3CPFA 4FU6A 2DILA 4LDUA 1U1SA 4OMFB 2XD0A 3N5BB 1WXTA 3CMAA 4M7AD 3OMCA 4QT7A 2M9UA 1YITQ 4BI3A 3CCVT 2DJQA 5HK0A 2JS0A 1KD1R 2EWNA 5KE3A 2GGRA 3F70A 1TG0A 1M1KC 3S6WA 2HMAA 2KRSA 2KXDA 3SWNC 5KE2A 2D0NA 2YLBA 1QKWA 2KXCA 3EGXA 1VQ9T 2EVRA 1RAEB 2EJFA 4JJCA 1MMNA 5GJWB 3L2VA 4HT8A 3M0TA 1Y96B 2JS2A 5FU7B 2CSQA 3AHUA 3PNWC 1HK9A 4XTUA 1RAIB 1ZHIA 1VQOT 3M0RA 5J26A 2M16A 3VS6A 1YJNT 1GFCA 2EQUA 2JUFA 3L2ZA 4IUVA 4OP0A 4M75A 2ENMA 4OMMA 5CIUA 4B9XA 1UFFA 1WHKA 2OTLQ 1VQ8Q 1Y0MA 1M1KU 2V1RA 4JZ3A 1AVZC 3VRZA 1SSHA 3VS4A 3X25B 1YCSB 3CMET 1J3TA 2JNGA 2CP3A 1M1GA 1ACMB 2PUKB 2MIOA 2A7YA 1FX7A 2LC4A 1KIKA 2VXFA 1D3BA 2E70A 2AT1B 5GAOr 4LE9A 3TEEA 1ZUYA 1LNXA 1RI9A 2DA9A 1KK7A 4PJNA 3BFMA 3OS0A 2DAQA 2QDYB 2YT6A 2QQBA 2HEQA 4R56A 2DERA 1I4K1 2VGMA 2L2PA 2RD1A 2CP5A 1KQ1A 4IUPA 5LJ3f 1N8RR 3A8LB 2KR3A 1X6GA 2HSPA 3BY7A 5FRNA 4EDUA 1JXOA 5FU7C 2ED0A 2O01E 5HCKA 2GQIA 3E9GA 4PLLA 1VQPA 1YI2T 1X6OA 3VU3C 2DBMA 4TVRA 3HHTB 4ZGJB 1VQLQ 2SRCA 3S3NA 7AT1B 1KQSP 4RTXA 1YITA 4JJNK 3JCMe 1BU1A 2B86A 3V8JA 1U8RA 1D1CA 1QWFA 4FYYB 2KRMA 1B3QA 4KUIA 3OYDA 3LWIA 2J6FA 4GLKA 1D0YA 3EG1A 2QGGA 4F04B 4PFPA 1D0XA 5KH6A 4X1VA 2LMJA 2ESWA 2DMOA 1YJ9A 3VYHB 1ZBXA 3JB9I 1ZSGA 3CCVQ 5CKFA 1M3AA 1QLYA 4PJOE 4BDYA 5LJ5j 3GNFB 4M7DE 1GCQC 2AKLA 2QTXA 1YCYA 4A4KA 4EMGA 2JM9A 1RLQC 4JPBW 5I21A 2WSFE 2OTJT 3OS1A 2GTJA 4D6WA 2FRYA 5KYYA 4ANJA 2QEXT 1K8AC 1BK2A 2J06A 2CZ6B 2VUBA 2BTTA 1UG1A 2JZ2A 2P4TA 1IB8A 4JRKA 3ZL7C 2DIGA 4PJOC 1PD1A 4XTVA 2PU9B 1AZEA 3FLGA 3REAB 1D1AA 1M3BA 1VQ8A 4PJJA 4M7DC 2O2OA 2DXUA 4J8OA 4HXJA 4AFSC 1YIJT 4RMOA 4M78G 3RERA 3DB4A 4OVAA 2COZA 4Z02A 1D1BA 2KEAA 2FVUA 2KRNA 3G71A 4M75G 3OQ5A 2CT3A 2XG8D 3OSSC 2XDBA 2C0OA 4JLIA 3I55Q 3DLMA 2JOYA 3I56Q 1ZUUA 2R5AA 4HCKA 3H0IA 1PWTA 1I8FA 3CC7A 1D09B 4C92G 1K8AU 4RKUE 2X4WA 3HTRA 2QAZA 3V7RA 3E19A 3UATA 5CKHA 1NG2A 5EC7A 1WHMA 3VS5A 3JCMb 3CCJT 1KQ2A 3G4ST 3TSWA 1WZOA 3D7SB 3O5ZA 4E7KA 2NUTA 4WCIA 5FROA 1F1BB 1M1FA 5ECAA 4WTOB 4M75E 1M8MA 1U1TA 2EQIA 1V76A 3MEUA 2JTMA 2YRDA 1WHGA 1VOMA 4OGEA 1R0BG 2FZCB 1MNEA 4Y91A 1UJ0A 1N6AA 5GAMf 4M78C 3E2UA 2CDTA 2K6DA 1KC8R 3CMAT 1K9MC 1OULA 3JCMd 3DLLA 2VC8A 2J6OA 1KSWA 2W10A 4PFOA 2X9HA 4F7UA 3JCMg 1WQ7A 1WYXA 2IPOB 4M75C 2LDMA 3RKYA 1OU8A 4QQGA 1WHJA 3UDCA 3CCLQ 4F14A 3EG9A 3QJYA 1YI2Q 1SHFA 4RG8A 2XDDA 2DXCA 1RABB 3M0PA 2CZ7B 4C8QA 4F17A 1UUEA 1W1FA 4LD9K 1TU0B 2YUPA 4A54A 3E1SA 3OYCA 1PC0A 3I5RA 1K9MU 1OX8A 3LYIA 5HKCA 4F16A 2OAWA 1PKTA 1VQ5Q 3P8BB 1NM7A 3VV0A 2QYZA 3NFCA 1VQ9A 2CUBA 3M56A 2HKQB 4CC3A 3CC4A 3OS2A 3C95A 1DJ7B 2KYMA 4FW2A 4EMHA 5IH2A 2HSEB 3I35A 3LLRA 5CK9A 3S3OA 2EYWA 2F2WA 4FYVB 5CQXA 1BB9A 4OB1B 3OYFA 4DQ2A 3A1PA 1VQOA 4Z8AA 2R5MA 2KAFA 2R57A 2ZZDA 1YJNA 1LCKA 1N5ZA 2QEXQ 1QCOA 4O5VA 1GXIE 1G8XA 2H3EB 1MUZA 3SD4A 4JS4A 4DEYA 1GCPA 2MAMA 3H9NA 3CMEA 1YIJQ 1TUDA 5FWBA 3QYHB 2A37A 1VIFA 1IRXA 4PJMA 3OYAA 3FC3A 1ZLMA 2D1XA 2E1HA 3V8KA 4D8DA 2KI7A 1TOVA 1IO6A 5CCAA 2BE9B 1OZ2A 1BI0A 2F5KA 4OB2B 3OYGA 1VQPT 4PJOF 1H641 2GBQA 1PD0A 1YWPA 2NUTB 5KYUA 1TUGB 2CT4A 1AZGB 4M7DF 5IAYA 1Y7XA 1VQ4A 1X2KA 4PJOD 2XIDA 2LCLA 2BZYA 4HVUA 3CCJQ 4M7DD 1ZSZA 2GQVA 2DD5A 2M51A 3FDRA 3G4SQ 1KC8U 1NJIC 3FJPA 5LJ5h 3VJPA 2OAUA 4XU3A 3QHSA 4F7UB 4MZMA 5J3BA 1WX6A 2HBWA 4XU0A 8AT1B 5LJ3h 2D6FA 3DKMA 1JJ2A 4EMKB 1K73R 8ATCB 3EG9B 3CMAQ 4UC4A 5KYWB 3RNJA 2RJCA 2RQTA 4QQ6A 2DTIA 1NZ9A 1BYMA 3M4GA 3CBMA 1UJYA 1M3CA 4HCCA 4QVCA 4FYWB 1BI3A 1W2BS 4C0DB 4AMCA 1O75A 2RQVA 1RAAB 4HA8A 1QKXA 1BBZA 3PT9A 1NJIU 2JTEA 2LX9A 2RI2A 4Y28E 3NHNA 2QGFB 1BCOA 4MMKA 4Z88A 4M78F 1NEGA 3EGDB 2A3LA 1PCXA 1Y96A 2MWPA 4M77A 4RTZA 5GANf 4FM4B 1VQ7T 1TS9A 2B8AA 1U3OA 1YN8A 1IREB 1N9SA 3OYYA 4M78D 3UPUA 2D8JA 2XK0A 4J9BA 4F7UE 1GL5A 2M0YA 2CP2A 1HSQA 4M75F 2K79A 2DL7A 4DA4A 1NPRA 3QO3A 2QQRA 2OTJA 4L5GA 1M1KR 1SRLA 4XTXA 1ZBJA 3VUBA 3MO8A 3G71T 4M75D 3BDUA 1SSFA 2K5IA 4J9IA 1M2VA 4YTLA 3JSCA 1FWZA 3VS1A 5KCOA 4LN2A 1HXDA 4KT0E 2AIRB 3EG2A 3CC7T 4C92D 4C8QE 1C6VX 1IZ6A 1BIAA 2LNHB 1EIFA 4V2SA 1TXQA 4ME7A 5FW9A 2MCNA 5CO7A 1VQNA 1IGQA 2RQWA 1AT1B 1I1JA 2RJDA 4K11A 2E64A 1M8VA 2O88A 2P4RA 2ECZA 4C8QC 4GBQA 3KUFA 2DTOA 3OBWA 4N4GA 2ZGWA 4IURA 4C5EA 3I5SA 4FSXA 1YHQA 1IXDA 1YNZA 4N4HA 1NYGA 3OSVA 3M0UA 1Y07A 3CC2A 1IHWA 5KYUB 1WFWA 3ZEHA 3CCJA 3GOXA 2E10A 3JCMP 3AT1B 5IHNA 4RTYA 1Q7YR 2YRCA 2DK3A 1VQPQ 2X3WD 4A53A 2IG0A 3KFVA 2M1HA 1RLPC 4A4GA 2KSSA 1S1NA 1ZA2B 2YSQA 2KY9A 2O9SA 3EG3A 5GAMh 1K73U 1AEYA 1BKBA 4DEXA 2VASA 4OGCA 2LX7A 5CVIA 5I2SA 2QXFA 2P0KA 1LOJA 2RO0A 4J9EA 5LJ5e 5I2MA 3CCQT 3RKWA 2XMFA 1FMVA 2NUPB 1VQ6T 1RAGB 2DE0X 1YJ9Q 4QKUA 4EPCA 5LJ3e 2HD0A 1ZX6A 1S72T 2DJZA 3CC4T 4LD6A 3G6EA 2ROTA 1K1ZA 1ZUKA 3FIFA 4PNOA 4M77B 3HP9A 1XQHA 1QP2A 2QA4T 2C06A 3RIRA 2E12A 1UTIA 1G2BA 5FU6B 2F5TX 2X51A 2RI5A 1PM3A 2CUDA 2H3JA 4HCBA 3U23A 2VVKA 3M59A 2RN8A 1ZSZC 1M2VB 2FYKA 4JJBA 4IUTA 5GMKl 2K7AA 2KE9A 2HCKA 2VKNA 2RJEA 2RMOA 3CBPA 4RCCA 3JCMQ 3HFOA 4A4HA 3T9NA 4R0KA 1W2BA 3G71Q 3NPFA 1UGRB 1Q7YC 1VYUA 2RF0A 1VA7A 2XI9A 2QASA 1K8AR 2L3SA 4HKEA 3M0SA 1PRMC 2LQ8A 2LQNA 2L3PA 4J9CA 3CC7Q 3VRYA 2XICA 3P8DA 2LTOA 3QDFA 2JJ9A 3WXMB 1VQ4T 4M77E 2DZ9A 1MV0B 1OYXA 4X9DA 3A8OB 1RL2A 1CSKA 3UA7A 3J81E 2FPEA 3CPWS 2ZPBB 4KH0B 1T3SA 5IHKA 3OY9A 3EH1A 3LGFA 3LGLA 2CGHA 1VIEA 2G6FX 3SHWA 2HAXA 1C0MA 4M77C 1Q81R 1M5Q1 4ZGEB 1UHCA 1ZQ1A 1Q7YU 5DY9A 5FU6C 3JB9G 4IUUA 4PJOG 2LJ0A 2P0PA 3OYIA 1QCFA 4M7DG 2GCXA 2RJFA 3QDRB 4BY6B 3ULRB 2HQEA 2QTVA 3JRZA 3S3MA 5LJ5d 3VS7A 2XU8A 2KROA 3J80E 5LJ5g 4M7AA 2KT1A 4C8QF 5LJ3d 1H92A 3QZ5B 1NYFA 3OYKA 1T0JA 2CP6A 5LJ3g 3RDVA 1K9MR 3EG0A 4C8QD 4XU1A 2E65A 3JCMc 5GAOq 2ZPEB 1X69A 1PSFA 2V26A 5GAN8 3OA6A 2IVWA 3CCST 1QVGA 3FRNA 4HCZA 4XAXB 2D0QB 4A63B 2GFUA 2FPFA 2CREA 2RI3A 2ZPHB 3CCQQ 5LJ3j 3C12A 1VQ6Q 2K5FA 2YUOA 4KULA 4ORZA 4FCYA 1VQ9Q 4MZPA 1JJ2P 3CC4Q 3JAME 2JXBA 4XQ3A 2OI3A 3EFOB 2J05A 1QQJA 1VQKT 1WHHA 1VQ7A 1FYNA 2COYA 2VB6A 3VYGA 1EX4A 2DVEA 3JB9J 1QVFA 5GMKm 4Q5WA 2MF2A 1VQOQ 1TSFA 5GANh 1Y57A 2EQMA 1YJNQ 1VQNT 3ME9A 2RNAA 4FIBA 1Q81C 1HD3A 4BY6C 2LQWA 1JXMA 1JJ2S 1OEBA 3CD6T 1B34A 9ATCB 2LJ3A 1KJWA 3CMEQ 4C92B 1MHNA 1YHQT 4IKFA 3OYHA 2AK5A 2KGTA 2E3HA 2EQJA 4MZTA 3WVEB 3CC2T 4PFZA 2KMTA 3JCMf 3OB9A 4HVVA 4DBRA 3EAEA 3MEAA 1E6HA 3OYJA 3HL8A 2QQSA 1ARKA 4ATOA 1SEMA 2ROLA 5AYFA 1VQ4Q 2DYBA 4IIMA 3RMSA 2AZVA 1Q81U 1U5SA 1G3SA 3E9FA 4MDWA 3PMTA 2QQAA 1OQKA 4OMLA 2YRVA 2KYBA 5GMKi 4EMKA 2BKDN 3HSBA 5KYXB 3CCMT 2O4XB 2DEQA 5KYWA 2K9GA 2MMPA 2VYTA 5CKDA 3QIIA 1X27A 3ASKA 1G3TA 1IHVA 4M7AB 1UECA 4JUVA 3ZFJA 4HVWA 2COWA 4KGVB 3BDLA 1XOVA 3G6ET 3G7ZA 2M0OA 4LDVA 4E7SA 3SB2A 2DETA 2EFIA 2NWMA 1A0NB 1XTDA 1HJDA 3WVDB 3UWNA 5A2QE 3OYMA 3CPWA 1NJIR 2E4HA 1WXBA 5GAMg 3NTKA 2EGAA 2YLCA 1V1CA 2EBPA 1PKSA 5GAN6 2W0ZA 3THKA 2DRMA 3EGDA 3CCQA 2LNVA 5LL6S 1VQ6A 1WGSA 4OF1A 4LDYA 3L2RA 4E7ZA 1I07A 2RM4A 1RADB 1S72A 5GAMj 1SPKA 3H8ZA 3L2WA 3CCUA 5C0MA 2HNIA 1V29B 1VYVA 1SRMA 3HRUA 3CCSQ 1R0CB 2RQRA 3A8HB 2DRKA 2QA4A 2OX7A 2OTJQ 4BI4A 4LNPA 4PKCC 5EG2A 4AFZC 3QWXX 5I11A 3QYGB 4M7AE 2PUOB 2BZ8A 1W6XA 3OYEA 5FRMA 1VQKQ 3GPLA 1FMWA 1AWXA 1N27A 1PRLC 4ELZC 2GF7A 1B34B 3OMGA 4OMNA 2FPDA 2EJ9A 2RHYA 2P84A 1MGQA 2AKKA 1VQNQ 5GAN4 1OI1A 2DXTA 4Y92A 5GANe 2JW4A 3PIPA 1Q86C 3A8GB 3RESA 2CSIA 3JB9F 1JEGA 2XDPA 3VS2A 1U06A 1JRIA 2MI6A 1YHQQ 2LVMA 4FYXB 4OMOA 3FEOA 1SHGA 4E7LA 4KH1B 3JB9D 1JB0E 4OB0B 2I0NA 3SEMA 3CC2Q 5GAOl 1EFNA 4J6WA 1OZ3A 4WF2A 1WHLA 4AFUC 1UE9A 2X4YA 4E7IA 2PZ1A 2HQXA 1W2BP 2V8JA 1KHIA 1RUWA 2KDSA 4KRTA 3INZA 3LW5E 3KXTA 4FL6A 3LX7A 3URGA 2KNBB 5CQYA 4IUQA 1Q86U 3VS0A 2CP7A 1H3HA 5CR2A 4F7UG 1YBYA 1P92A 2X3XD 3PVLA 3PMIA 3OW2S 3ER0A 2NUPA 1FXXA 1SF9A 1X01A 4E7HA 1BI1A 4VUBA 1UEBA 2A08A 2SEMA 4ZTJA 3RKXA 1UGVA 3G6EQ 1TTHB 2LRQA 4C8QG 1M90R 2L3QA 3CCRT 2EKHA 4PLIA 4NS5A 1X75C 2DPPB 5L8RE 3NMZC 3CCSA 4MDXA 2BZXA 1K4US 4KUDK 1QWEA 4QVZA 3NGPA 5M9OA 2RA2A 2FL7A 3G1JA 4KBMB 3QG1A 2ABLA 4J83A 1JQQA 2J7IA 2K4YA 3H0FA 4JRIA 2P0QA 2PQWA 1AWJA 2ZCFB 1WI7A 5GAN2 4JJDA 4BB7A 1VQKA 1T0HA 4EMKC 2ATCB 4J9HA 4FW1A 4DOWA 5GANd 3EGUA 3MP6A 3JV3A 1X6BA 5GMKh 3PVQA 5GANg 3CXCA 2QG9B 1WQWA 2JMAA 4RTVA 1M30A 4BACA 3CD6A 3QJ6A 2NYSA 2CP0A 4C0DC 4MMLA 4ZN3A 2DO3A 2E6ZA 4PL6A 2HBPA 2GTOA 3VS3A 5GANj 2ZPGB 3HFNA 3VKIA 3CEYA 5GAOm 4R55A 3X28B 1QVGS 1QVFP 2NUZA 2PVGB 3VUZA 2EYXA 2Y4XA 2HKNA 3V8LA 4NOYA 4XTWA 2BUDA 3TQ7P 1Y71A 2YUNA 1W70A 5A0GA 1R8OB 3BW1A 5AT1B 1M90C 2EGEA 2YHTA 3HRTA 1QVFS 4P5NA 4L6V5 3QKJA 2QDLA 3H41A 2FRWA 1YWOA 1Z9QA 5D6WA 2VGNA 3CCMA 3LH0A 5GAOp 1WJSA 1SG5A 3M53A 3MCAB 2I2LA 4LUDA 2V8IA 4PJLA 4FT2A 3A8MB 4D8KA 2CH4W 4L59A 3CCUT 2DLPA 1LVKA 3LH5A 1WLPB 1BI2A 2A0FB 2LJ1A 4JZ4A 2DKGA 4PK4A 3CCEA 2AZSA 1M90U 2KK4A 3REBB 1UGQB 3EFOA 1E6GA 2NLUA 2HL5C 2BE7D 2F1LA 4M78A 1UGPB 5DM7R 2K2MA 3OYNA 3CCRQ 1OPLA 1VQ7Q 4M77G 4BE0A 2GNCA 2YWWA 2E41A 2DF6A 4BD3A 1Q82C 2RK2A 4B6MA 1JO8A 2D8HA 1YFNA 3UA6A 3I55T 3CPWP 3OW2A 1GRIA 4CI0C 4M4ZA 3I56T 3OYBA 1BCMA 4OB3B 4C92A 1PHTA 3M5AA 3MP1A 2JT4A 2LQKA 4HT9A 4A4FA 4J9FA 2RHIA 5A0LA 3GNGA 3TCJA 3QZ9B 3EH2A 4QW2A 1OV3A 3FB9A 2ED1A 2LT1A
chains in the Genus database with same CATH topology
1IO6A 1GCQA 2F2VA 1E6HA 4OMQA 2GBQA 3CQTA 1AWWA 1YWPA 3TVTA 2DL8A 1ARKA 4RTUA 2CT4A 2EGCA 1AZGB 1SEMA 2ROLA 2DYBA 1X2KA 4IIMA 3EHRA 2AZVA 1U5SA 2DL4A 2BZYA 4HVUA 2C0TA 2M51A 2DNUA 2FEIA 4OMLA 4RUGA 2KYBA 1WX6A 2HBWA 1GBQA 2DILA 3R6NA 2K9GA 2O9VA 1X27A 1KFZA 1WXTA 4QT7A 2DVJA 3RNJA 2RQTA 1UECA 2DJQA 1UJYA 4HVWA 1M3CA 1X43A 2JS0A 1XOVA 2NWMA 5L23A 1A0NB 2GGRA 1HJDA 1K0SA 1TG0A 1WXBA 5IXFA 2FG0A 2EGAA 1V1CA 2EBPA 1PKSA 2KRSA 2OJ2A 2KXDA 2W0ZA 3THKA 2RQVA 2D0NA 2DRMA 1QKXA 1BBZA 1QKWA 2JTEA 2KXCA 3NHNA 4Z88A 1UHFA 2EVRA 1NEGA 4JJCA 5I22A 1NEBA 4E6RA 1AOJA 5GJWB 1CKBA 1I07A 4RTZA 1SPKA 4OMPA 3M0TA 1U3OA 1YN8A 2JS2A 2CSQA 2D8JA 4J9BA 1GL5A 1WA7A 2M0YA 1H8KA 1HSQA 1VYVA 2K79A 1SRMA 4ESRA 2DL7A 3M0RA 2O31A 2VWFA 3VS6A 2RQRA 1GFCA 2DRKA 1E7OA 1MV3A 3A98A 1SRLA 1ZBJA 4LNPA 2ENMA 4EIKA 4OMMA 4AFZC 3QWXX 3M0QA 5I11A 1UFFA 4J9IA 1Y0MA 3H0HA 1K9AA 3VS1A 4LN2A 5IXBA 2V1RA 4JZ3A 1AVZC 3VRZA 1SSHA 3VS4A 2BZ8A 3EG2A 1YCSB 1OPKA 4AG2C 1J3TA 1W6XA 1AWXA 1PRLC 2MIOA 4OMNA 2LNHB 2DL3A 2FPDA 1KIKA 3FJ5A 5FW9A 2MCNA 1G83A 4LE9A 2AKKA 2RQWA 1ZUYA 1RI9A 2DA9A 4Y92A 1I1JA 2JW4A 4K11A 2O88A 2P4RA 2ECZA 4GBQA 2PNIA 2CSIA 1JEGA 3VS2A 1WXUA 1U06A 3I5SA 2YT6A 2HEQA 1UDLA 3I9QA 1YNZA 4OMOA 1SHGA 1NYGA 2L2PA 2I0NA 3M0UA 3SEMA 3TSZA 1EFNA 2YDLA 1WFWA 4AFUC 1UE9A 2KR3A 1X6GA 2HSPA 2PZ1A 1JXOA 4RTYA 5IHNA 5FWCA 2ED0A 5HCKA 1RUWA 2E5KA 2GQIA 4KRTA 2X3WD 2DBMA 3KFVA 1RLPC 2SRCA 1S1NA 1K0XA 4RTXA 2KNBB 2YSQA 2O9SA 3VS0A 3EG3A 1H3HA 1BU1A 2B86A 1AEYA 1CKAA 1QWFA 2KRMA 1B3QA 3RBBB 4DEXA 2F2XA 2CH4A 2KBTA 2X3XD 2J6FA 2DL5A 2LX7A 3PVLA 3EG1A 4J9EA 1B07A 2DX1A 1AWOA 4GLMA 1FMKA 2XMFA 4X1VA 2LMJA 2ESWA 2DMOA 4CC2A 2DE0X 4CC4B 2A08A 1ZSGA 2SEMA 1GFDA 1GBRA 2H8HA 1ZX6A 1M3AA 1QLYA 2LZ6B 1UGVA 2ROTA 1K1ZA 1ZUKA 1WDXA 2L3QA 1X2QA 4RTWA 2EKHA 1GCQC 2AKLA 2JM9A 3NMZC 1RLQC 4JPBW 1M27C 2BZXA 1K4US 2GTJA 1QWEA 2FRYA 1UTIA 1G2BA 3NGPA 1BK2A 2J06A 1VYTA 1JU5C 2BTTA 1UG1A 2ABLA 3ZL7C 2CUDA 1JQQA 2J7IA 3H0FA 1AZEA 1WIEA 2DBKA 3REAB 3U23A 1M3BA 1AWJA 2VVKA 4AG1C 2O2OA 1WI7A 2RN8A 4HXJA 4AFSC 4Z89A 4JJBA 1I0CA 4JJDA 1AD5A 2K7AA 2KE9A 1T0HA 2HCKA 2VKNA 2YUQA 2KEAA 2RMOA 2RQUA 4J9HA 2KRNA 4R0KA 3EGUA 2CT3A 3NPFA 2C0OA 3JV3A 1VYUA 2RF0A 1X6BA 1VA7A 1NLPC 3PVQA 3EHQA 2DM1A 2L3SA 1ZUUA 3M0SA 1PRMC 2EYZA 4HCKA 2JMAA 4RTVA 2FO0A 1M30A 1PWTA 2LQNA 3H0IA 2L3PA 4J9CA 3VRYA 3QWYA 1PNJA 2J6KA 1MV0B 3UATA 1NG2A 5EC7A 2GTOA 1CSKA 3VS5A 3UA7A 2C0IA 3VS3A 2FPEA 1YP5A 3TSWA 1T3SA 5IHKA 3O5ZA 4LUEA 2NUZA 4WCIA 4CC7A 5ECAA 2EYXA 1M8MA 2G6FX 3IQLA 3SHWA 2EQIA 2A36A 4J9GA 1K76A 2LP5A 1Z9ZA 2YUNA 1UJ0A 1W70A 1UHCA 2CDTA 2JM8A 2K6DA 2J6OA 1KSWA 2W10A 2EGEA 2LJ0A 3PE0A 2MOXA 1WYXA 1T3LA 1ABOA 1QCFA 1NLOC 3ULRB 4F14A 2LCSA 2QDLA 3H41A 2FRWA 1YWOA 4ZNXA 1Z9QA 4FSSA 2KROA 3VS7A 4IIOA 1SHFA 2KT1A 2EPDA 1H92A 3GBQA 1NYFA 1T0JA 3M0PA 4F17A 1UUEA 1W1FA 3EG0A 2YUPA 4LUDA 4D8KA 2CH4W 2JMCA 2DLPA 2EW3A 1X69A 3I5RA 3C0CA 2A28A 3LH5A 1WLPB 4JZ4A 2LJ1A 4F16A 4A63B 2OAWA 2AZSA 2FPFA 2CREA 1PKTA 3REBB 1NM7A 1TUCA 2YUOA 4ORZA 1OOTA 2CUBA 4CC3A 1E6GA 2V1QA 2JXBA 2KYMA 2OI3A 2J05A 2K2MA 5IH2A 3I35A 4RTTA 1FYNA 1OPLA 2EYWA 2F2WA 5GJVB 2GNCA 1BB9A 4AFQC 2K3BA 2EYYA 2DF6A 4Z8AA 2RPNA 1JO8A 2PTKA 1Y57A 2D8HA 1LCKA 1N5ZA 2KT8A 3UA6A 1GRIA 2RNAA 1ABQA 4M4ZA 2HDAA 1HD3A 2LQWA 1JXMA 1MUZA 1OEBA 4DEYA 1GCPA 1PHTA 2LJ3A 1KJWA 4J9DA 1TUDA 5FWBA 2A37A 3UF4A 2L0AA 2JT4A 4J9FA 2AK5A 2KGTA 2IIMA 5IHIA 1OV3A 1ZLMA 2D1XA 4D8DA 4HVVA 2ED1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  1GCQ A;  2F2V A;  1E6H A;  4OMQ A;  2GBQ A;  3CQT A;  1AWW A;  1YWP A;  3TVT A;  2DL8 A;  1ARK A;  4RTU A;  2CT4 A;  2EGC A;  1AZG B;  1SEM A;  2ROL A;  2DYB A;  1X2K A;  4IIM A;  3EHR A;  2AZV A;  1U5S A;  2DL4 A;  2BZY A;  4HVU A;  2C0T A;  2M51 A;  2DNU A;  2FEI A;  4OML A;  4RUG A;  2KYB A;  1WX6 A;  2HBW A;  1GBQ A;  2DIL A;  3R6N A;  2K9G A;  2O9V A;  1X27 A;  1KFZ A;  1WXT A;  4QT7 A;  2DVJ A;  3RNJ A;  2RQT A;  1UEC A;  2DJQ A;  1UJY A;  4HVW A;  1M3C A;  1X43 A;  2JS0 A;  1XOV A;  2NWM A;  5L23 A;  1A0N B;  2GGR A;  1HJD A;  1K0S A;  1TG0 A;  1WXB A;  5IXF A;  2FG0 A;  2EGA A;  1V1C A;  2EBP A;  1PKS A;  2KRS A;  2OJ2 A;  2KXD A;  2W0Z A;  3THK A;  2RQV A;  2D0N A;  2DRM A;  1QKX A;  1BBZ A;  1QKW A;  2JTE A;  2KXC A;  3NHN A;  4Z88 A;  1UHF A;  2EVR A;  1NEG A;  4JJC A;  5I22 A;  1NEB A;  4E6R A;  1AOJ A;  5GJW B;  1CKB A;  1I07 A;  4RTZ A;  1SPK A;  4OMP A;  3M0T A;  1U3O A;  1YN8 A;  2JS2 A;  2CSQ A;  2D8J A;  4J9B A;  1GL5 A;  1WA7 A;  2M0Y A;  1H8K A;  1HSQ A;  1VYV A;  2K79 A;  1SRM A;  4ESR A;  2DL7 A;  3M0R A;  2O31 A;  2VWF A;  3VS6 A;  2RQR A;  1GFC A;  2DRK A;  1E7O A;  1MV3 A;  3A98 A;  1SRL A;  1ZBJ A;  4LNP A;  2ENM A;  4EIK A;  4OMM A;  4AFZ C;  3QWX X;  3M0Q A;  5I11 A;  1UFF A;  4J9I A;  1Y0M A;  3H0H A;  1K9A A;  3VS1 A;  4LN2 A;  5IXB A;  2V1R A;  4JZ3 A;  1AVZ C;  3VRZ A;  1SSH A;  3VS4 A;  2BZ8 A;  3EG2 A;  1YCS B;  1OPK A;  4AG2 C;  1J3T A;  1W6X A;  1AWX A;  1PRL C;  2MIO A;  4OMN A;  2LNH B;  2DL3 A;  2FPD A;  1KIK A;  3FJ5 A;  5FW9 A;  2MCN A;  1G83 A;  4LE9 A;  2AKK A;  2RQW A;  1ZUY A;  1RI9 A;  2DA9 A;  4Y92 A;  1I1J A;  2JW4 A;  4K11 A;  2O88 A;  2P4R A;  2ECZ A;  4GBQ A;  2PNI A;  2CSI A;  1JEG A;  3VS2 A;  1WXU A;  1U06 A;  3I5S A;  2YT6 A;  2HEQ A;  1UDL A;  3I9Q A;  1YNZ A;  4OMO A;  1SHG A;  1NYG A;  2L2P A;  2I0N A;  3M0U A;  3SEM A;  3TSZ A;  1EFN A;  2YDL A;  1WFW A;  4AFU C;  1UE9 A;  2KR3 A;  1X6G A;  2HSP A;  2PZ1 A;  1JXO A;  4RTY A;  5IHN A;  5FWC A;  2ED0 A;  5HCK A;  1RUW A;  2E5K A;  2GQI A;  4KRT A;  2X3W D;  2DBM A;  3KFV A;  1RLP C;  2SRC A;  1S1N A;  1K0X A;  4RTX A;  2KNB B;  2YSQ A;  2O9S A;  3VS0 A;  3EG3 A;  1H3H A;  1BU1 A;  2B86 A;  1AEY A;  1CKA A;  1QWF A;  2KRM A;  1B3Q A;  3RBB B;  4DEX A;  2F2X A;  2CH4 A;  2KBT A;  2X3X D;  2J6F A;  2DL5 A;  2LX7 A;  3PVL A;  3EG1 A;  4J9E A;  1B07 A;  2DX1 A;  1AWO A;  4GLM A;  1FMK A;  2XMF A;  4X1V A;  2LMJ A;  2ESW A;  2DMO A;  4CC2 A;  2DE0 X;  4CC4 B;  2A08 A;  1ZSG A;  2SEM A;  1GFD A;  1GBR A;  2H8H A;  1ZX6 A;  1M3A A;  1QLY A;  2LZ6 B;  1UGV A;  2ROT A;  1K1Z A;  1ZUK A;  1WDX A;  2L3Q A;  1X2Q A;  4RTW A;  2EKH A;  1GCQ C;  2AKL A;  2JM9 A;  3NMZ C;  1RLQ C;  4JPB W;  1M27 C;  2BZX A;  1K4U S;  2GTJ A;  1QWE A;  2FRY A;  1UTI A;  1G2B A;  3NGP A;  1BK2 A;  2J06 A;  1VYT A;  1JU5 C;  2BTT A;  1UG1 A;  2ABL A;  3ZL7 C;  2CUD A;  1JQQ A;  2J7I A;  3H0F A;  1AZE A;  1WIE A;  2DBK A;  3REA B;  3U23 A;  1M3B A;  1AWJ A;  2VVK A;  4AG1 C;  2O2O A;  1WI7 A;  2RN8 A;  4HXJ A;  4AFS C;  4Z89 A;  4JJB A;  1I0C A;  4JJD A;  1AD5 A;  2K7A A;  2KE9 A;  1T0H A;  2HCK A;  2VKN A;  2YUQ A;  2KEA A;  2RMO A;  2RQU A;  4J9H A;  2KRN A;  4R0K A;  3EGU A;  2CT3 A;  3NPF A;  2C0O A;  3JV3 A;  1VYU A;  2RF0 A;  1X6B A;  1VA7 A;  1NLP C;  3PVQ A;  3EHQ A;  2DM1 A;  2L3S A;  1ZUU A;  3M0S A;  1PRM C;  2EYZ A;  4HCK A;  2JMA A;  4RTV A;  2FO0 A;  1M30 A;  1PWT A;  2LQN A;  3H0I A;  2L3P A;  4J9C A;  3VRY A;  3QWY A;  1PNJ A;  2J6K A;  1MV0 B;  3UAT A;  1NG2 A;  5EC7 A;  2GTO A;  1CSK A;  3VS5 A;  3UA7 A;  2C0I A;  3VS3 A;  2FPE A;  1YP5 A;  3TSW A;  1T3S A;  5IHK A;  3O5Z A;  4LUE A;  2NUZ A;  4WCI A;  4CC7 A;  5ECA A;  2EYX A;  1M8M A;  2G6F X;  3IQL A;  3SHW A;  2EQI A;  2A36 A;  4J9G A;  1K76 A;  2LP5 A;  1Z9Z A;  2YUN A;  1UJ0 A;  1W70 A;  1UHC A;  2CDT A;  2JM8 A;  2K6D A;  2J6O A;  1KSW A;  2W10 A;  2EGE A;  2LJ0 A;  3PE0 A;  2MOX A;  1WYX A;  1T3L A;  1ABO A;  1QCF A;  1NLO C;  3ULR B;  4F14 A;  2LCS A;  2QDL A;  3H41 A;  2FRW A;  1YWO A;  4ZNX A;  1Z9Q A;  4FSS A;  2KRO A;  3VS7 A;  4IIO A;  1SHF A;  2KT1 A;  2EPD A;  1H92 A;  3GBQ A;  1NYF A;  1T0J A;  3M0P A;  4F17 A;  1UUE A;  1W1F A;  3EG0 A;  2YUP A;  4LUD A;  4D8K A;  2CH4 W;  2JMC A;  2DLP A;  2EW3 A;  1X69 A;  3I5R A;  3C0C A;  2A28 A;  3LH5 A;  1WLP B;  4JZ4 A;  2LJ1 A;  4F16 A;  4A63 B;  2OAW A;  2AZS A;  2FPF A;  2CRE A;  1PKT A;  3REB B;  1NM7 A;  1TUC A;  2YUO A;  4ORZ A;  1OOT A;  2CUB A;  4CC3 A;  1E6G A;  2V1Q A;  2JXB A;  2KYM A;  2OI3 A;  2J05 A;  2K2M A;  5IH2 A;  3I35 A;  4RTT A;  1FYN A;  1OPL A;  2EYW A;  2F2W A;  5GJV B;  2GNC A;  1BB9 A;  4AFQ C;  2K3B A;  2EYY A;  2DF6 A;  4Z8A A;  2RPN A;  1JO8 A;  2PTK A;  1Y57 A;  2D8H A;  1LCK A;  1N5Z A;  2KT8 A;  3UA6 A;  1GRI A;  2RNA A;  1ABQ A;  4M4Z A;  2HDA A;  1HD3 A;  2LQW A;  1JXM A;  1MUZ A;  1OEB A;  4DEY A;  1GCP A;  1PHT A;  2LJ3 A;  1KJW A;  4J9D A;  1TUD A;  5FWB A;  2A37 A;  3UF4 A;  2L0A A;  2JT4 A;  4J9F A;  2AK5 A;  2KGT A;  2IIM A;  5IHI A;  1OV3 A;  1ZLM A;  2D1X A;  4D8D A;  4HVV A;  2ED1 A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  2CYZ B;  2F2V A;  5HK3 A;  4JLG A;  1M2O A;  1YJW A;  4J7I A;  2VXE A;  1Q82 U;  1XNI A;  4B9W A;  5GMK e;  3TVT A;  1I81 A;  5LJ5 f;  2F69 A;  1M9S A;  4RTU A;  5A0D A;  2EGC A;  6AT1 B;  2LCC A;  3MPU B;  4F7U F;  1KD1 C;  3MP8 A;  2K3X A;  4PJO B;  3MET A;  3CCL T;  2EIF A;  3SDZ A;  4M7D B;  2BIV A;  3X24 B;  2RB6 A;  5KYX A;  2O4X A;  1Q95 G;  4RCB A;  1GBQ A;  2RHZ A;  3R6N A;  3X26 B;  4II1 A;  2O9V A;  1KFZ A;  2CZ1 B;  1LJO A;  3ZBD A;  2WSE E;  1OX9 A;  2DVJ A;  2M02 A;  1RI0 A;  4DBQ A;  1X43 A;  3RR6 A;  5L23 A;  1K0S A;  5IXF A;  1NE8 A;  2FG0 A;  5GAM e;  2GFA A;  4DOV A;  1KD1 U;  1VQ5 T;  2K3Y A;  2OJ2 A;  4E2F B;  1I5O B;  2KQW A;  1QMC A;  4J6X A;  1KQS S;  2DTH A;  3OS5 A;  1LPL A;  1VQM T;  3CBO A;  1UHF A;  5I22 A;  1NEB A;  1G5V A;  4E6R A;  1AOJ A;  1WJR A;  3A5Z B;  3V7C A;  1CKB A;  3H6Z A;  3L2Q A;  3QXE B;  2EKO A;  3EGX B;  1S72 Q;  2X35 A;  1TH7 A;  2HQH A;  3MJX A;  4OMP A;  1JBM A;  2EYQ A;  3GLX A;  3CCU Q;  3CCR A;  3L2U A;  2CZ0 B;  1WA7 A;  1H8K A;  3GIB A;  4M78 B;  3M9Q A;  4ESR A;  2O31 A;  1R77 A;  2VWF A;  2EJG A;  1E7O A;  2QA4 Q;  1MV3 A;  3A98 A;  1KHC A;  4EIK A;  1WPY A;  5GAO n;  3M0Q A;  4ELY C;  2OTL A;  1XJW B;  3L1A A;  5C6S A;  4M75 B;  3H0H A;  1K9A A;  5IXB A;  3NTI A;  1OPK A;  4AG2 C;  2E6N A;  4XK8 E;  4QVD A;  3O8V A;  3TRE A;  3M4Y A;  1N8R C;  2DL3 A;  3R6O A;  3FJ5 A;  5D7U A;  4LDW A;  1G83 A;  1BIB A;  4NL3 A;  3KBG A;  3MEW A;  1D3B B;  1MMA A;  1PSE A;  3EFR A;  4BDZ A;  5FLX E;  3V7S A;  2PNI A;  3MKD A;  2WSC E;  1WXU A;  3M57 A;  4JS5 A;  2RK1 A;  3UT1 A;  3X20 B;  4M78 E;  2ZAE A;  1UDL A;  3I9Q A;  4FT4 A;  3TSZ A;  2X4J A;  2YDL A;  4N0A A;  2FHD A;  2K2V A;  1NPP A;  1QVP A;  2FZK B;  4A4E A;  1QW1 A;  5GMK j;  1MMG A;  1EZZ B;  2L5Q A;  5FWC A;  1N8R U;  1W4S A;  2E5K A;  3GP8 A;  2L8D A;  2E3I A;  1D0Z A;  2Y4Y A;  3QSU A;  3P8H A;  1Q86 R;  1VQL A;  3CXC P;  4C92 E;  1SKU B;  3DB3 A;  4KGZ B;  1K0X A;  3JCM X;  5GAN 5;  2XHC A;  2RHU A;  2FB7 A;  2K5L A;  2YXY A;  2QK0 A;  1CKA A;  4C0G A;  1O9S A;  3RBB B;  4X9C A;  2F2X A;  1TWB A;  3OBY A;  5GAM d;  2CH4 A;  2KBT A;  2JN0 A;  2DL5 A;  5D6X A;  1B7T A;  4C0Z A;  4C92 C;  1B07 A;  2DX1 A;  1UB4 A;  3CCE T;  1AWO A;  1RAH B;  4GLM A;  1FMK A;  2AHJ B;  5HY6 A;  3CXC S;  4ZGD B;  2DIQ A;  4CC2 A;  4M7A G;  1M4Z A;  4CC4 B;  4M77 F;  3CCV A;  1GFD A;  1GBR A;  2H8H A;  3L42 A;  2LZ6 B;  1PG5 B;  1WDX A;  2MWO A;  5J39 A;  1X2Q A;  1RAC B;  1RAF B;  4KGX B;  4M77 D;  3LWH A;  4RTW A;  4ZTF A;  5D6Y A;  5CKB A;  1M27 C;  3EFS A;  1VYT A;  1JU5 C;  4ZN1 A;  5KYY B;  1MMD A;  1VQM Q;  3QPH A;  1WIE A;  2DBK A;  4LXC A;  2KVQ G;  4O6J A;  2R58 A;  2PVO B;  2WAC A;  4AG1 C;  4JRP A;  1IGU A;  4C5G A;  5CKE A;  4Z89 A;  1I0C A;  2HL3 A;  1AD5 A;  5CAI A;  2L3R A;  2YUQ A;  3M58 A;  3M54 A;  2DZC A;  2RQU A;  2DFU A;  4DBF A;  4XTZ A;  2ZPF B;  4M7A C;  1VUB A;  5DLQ E;  3I55 A;  2CKK A;  5GAN 3;  1NLP C;  4BE2 A;  3EHQ A;  2DM1 A;  3I56 A;  1YJW T;  2MPX C;  1KC8 C;  2EYZ A;  4LDX A;  1KQS A;  2FO0 A;  3CD6 Q;  2L89 A;  3SWN A;  2EAY A;  3QWY A;  2ZPI B;  4XTY A;  3QBY A;  1I5L A;  1PNJ A;  2J6K A;  5IN1 A;  3SFM A;  1UGS B;  3QUI A;  4N4I A;  1C1A A;  3MHX A;  2C0I A;  2RHX A;  1YP5 A;  4XU2 A;  4RG2 A;  2PVD B;  4LUE A;  5KCH A;  4CC7 A;  1QP3 A;  3HPW A;  2CS7 A;  3IQL A;  2A36 A;  4J9G A;  1G3Y A;  1K76 A;  2LP5 A;  1Z9Z A;  3OW2 P;  2JM8 A;  3PIO A;  2JVV A;  1WJQ A;  1MND A;  1YIT T;  4CRI A;  2K57 A;  3PE0 A;  2MOX A;  1T3L A;  1ABO A;  2DYI A;  3TU4 K;  3NTH A;  2DD4 A;  1NLO C;  3CCL A;  4C5H A;  4JRQ A;  2LCS A;  1NBE B;  4ZNX A;  4FSS A;  1YI2 A;  4IIO A;  3JCM J;  3CCM Q;  2EPD A;  1YJ9 T;  3GBQ A;  4C5I A;  3HRS A;  4JDS A;  4E47 A;  5DLO A;  2EQK A;  3PFS A;  3RUX A;  4C8Q B;  2JMC A;  2DEU A;  4DBH A;  2EW3 A;  2X4X A;  3C0C A;  2Z0W A;  1OU9 A;  2A28 A;  2MK5 A;  3J7A F;  2V8K A;  3CCE Q;  3GF5 A;  4C0F A;  1VQ5 A;  3C4S A;  1G3W A;  4NL2 A;  1ZA1 B;  1AHJ B;  1N9R A;  3RMQ A;  1TUC A;  2OTL T;  1VQ8 T;  1OOT A;  3JB9 H;  1VQM A;  2V1Q A;  3HKS A;  1WNL A;  2MYS A;  4N0A C;  2VV5 A;  4RTT A;  5GJV B;  4AFQ C;  2K3B A;  1KG1 A;  4J7F A;  2EYY A;  2RPN A;  4X34 A;  2JTF A;  3BE3 A;  4E7J A;  2PTK A;  2KT8 A;  2QEX A;  4BI8 B;  4C92 F;  1ABQ A;  5IT9 E;  1QVG P;  2HDA A;  2QI2 A;  2G3R A;  4AT1 B;  4BE1 A;  2XKO C;  5GAN 7;  2RH2 A;  1YIJ A;  2Y90 A;  4J9D A;  3UF4 A;  2L0A A;  4J5Y A;  3JCM W;  3SWN B;  2IIM A;  5IHI A;  5KYN A;  3PTA A;  3OYL A;  2E5Q A;  1Q82 R;  3C94 A;  1GCQ A;  3MEV A;  4OMQ A;  1YJW Q;  1K73 C;  4J6Y A;  3CQT A;  1AWW A;  2D9T A;  2DL8 A;  3JCM h;  2HZY A;  2DXB A;  1VQL T;  4PJO A;  1HYO A;  1H3Z A;  4GY5 A;  3M55 A;  3EHR A;  4QQD A;  4M7D A;  2DL4 A;  2C0T A;  3G4S A;  2DNU A;  3Q1J A;  1QCN A;  2FEI A;  3PGG A;  4RUG A;  1ZSZ B;  3JCM V;  4M7A F;  4BUG A;  2LT4 A;  2FZG B;  3CPF A;  4FU6 A;  2DIL A;  4LDU A;  1U1S A;  4OMF B;  2XD0 A;  3N5B B;  1WXT A;  3CMA A;  4M7A D;  3OMC A;  4QT7 A;  2M9U A;  1YIT Q;  4BI3 A;  3CCV T;  2DJQ A;  5HK0 A;  2JS0 A;  1KD1 R;  2EWN A;  5KE3 A;  2GGR A;  3F70 A;  1TG0 A;  1M1K C;  3S6W A;  2HMA A;  2KRS A;  2KXD A;  3SWN C;  5KE2 A;  2D0N A;  2YLB A;  1QKW A;  2KXC A;  3EGX A;  1VQ9 T;  2EVR A;  1RAE B;  2EJF A;  4JJC A;  1MMN A;  5GJW B;  3L2V A;  4HT8 A;  3M0T A;  1Y96 B;  2JS2 A;  5FU7 B;  2CSQ A;  3AHU A;  3PNW C;  1HK9 A;  4XTU A;  1RAI B;  1ZHI A;  1VQO T;  3M0R A;  5J26 A;  2M16 A;  3VS6 A;  1YJN T;  1GFC A;  2EQU A;  2JUF A;  3L2Z A;  4IUV A;  4OP0 A;  4M75 A;  2ENM A;  4OMM A;  5CIU A;  4B9X A;  1UFF A;  1WHK A;  2OTL Q;  1VQ8 Q;  1Y0M A;  1M1K U;  2V1R A;  4JZ3 A;  1AVZ C;  3VRZ A;  1SSH A;  3VS4 A;  3X25 B;  1YCS B;  3CME T;  1J3T A;  2JNG A;  2CP3 A;  1M1G A;  1ACM B;  2PUK B;  2MIO A;  2A7Y A;  1FX7 A;  2LC4 A;  1KIK A;  2VXF A;  1D3B A;  2E70 A;  2AT1 B;  5GAO r;  4LE9 A;  3TEE A;  1ZUY A;  1LNX A;  1RI9 A;  2DA9 A;  1KK7 A;  4PJN A;  3BFM A;  3OS0 A;  2DAQ A;  2QDY B;  2YT6 A;  2QQB A;  2HEQ A;  4R56 A;  2DER A;  1I4K 1;  2VGM A;  2L2P A;  2RD1 A;  2CP5 A;  1KQ1 A;  4IUP A;  5LJ3 f;  1N8R R;  3A8L B;  2KR3 A;  1X6G A;  2HSP A;  3BY7 A;  5FRN A;  4EDU A;  1JXO A;  5FU7 C;  2ED0 A;  2O01 E;  5HCK A;  2GQI A;  3E9G A;  4PLL A;  1VQP A;  1YI2 T;  1X6O A;  3VU3 C;  2DBM A;  4TVR A;  3HHT B;  4ZGJ B;  1VQL Q;  2SRC A;  3S3N A;  7AT1 B;  1KQS P;  4RTX A;  1YIT A;  4JJN K;  3JCM e;  1BU1 A;  2B86 A;  3V8J A;  1U8R A;  1D1C A;  1QWF A;  4FYY B;  2KRM A;  1B3Q A;  4KUI A;  3OYD A;  3LWI A;  2J6F A;  4GLK A;  1D0Y A;  3EG1 A;  2QGG A;  4F04 B;  4PFP A;  1D0X A;  5KH6 A;  4X1V A;  2LMJ A;  2ESW A;  2DMO A;  1YJ9 A;  3VYH B;  1ZBX A;  3JB9 I;  1ZSG A;  3CCV Q;  5CKF A;  1M3A A;  1QLY A;  4PJO E;  4BDY A;  5LJ5 j;  3GNF B;  4M7D E;  1GCQ C;  2AKL A;  2QTX A;  1YCY A;  4A4K A;  4EMG A;  2JM9 A;  1RLQ C;  4JPB W;  5I21 A;  2WSF E;  2OTJ T;  3OS1 A;  2GTJ A;  4D6W A;  2FRY A;  5KYY A;  4ANJ A;  2QEX T;  1K8A C;  1BK2 A;  2J06 A;  2CZ6 B;  2VUB A;  2BTT A;  1UG1 A;  2JZ2 A;  2P4T A;  1IB8 A;  4JRK A;  3ZL7 C;  2DIG A;  4PJO C;  1PD1 A;  4XTV A;  2PU9 B;  1AZE A;  3FLG A;  3REA B;  1D1A A;  1M3B A;  1VQ8 A;  4PJJ A;  4M7D C;  2O2O A;  2DXU A;  4J8O A;  4HXJ A;  4AFS C;  1YIJ T;  4RMO A;  4M78 G;  3RER A;  3DB4 A;  4OVA A;  2COZ A;  4Z02 A;  1D1B A;  2KEA A;  2FVU A;  2KRN A;  3G71 A;  4M75 G;  3OQ5 A;  2CT3 A;  2XG8 D;  3OSS C;  2XDB A;  2C0O A;  4JLI A;  3I55 Q;  3DLM A;  2JOY A;  3I56 Q;  1ZUU A;  2R5A A;  4HCK A;  3H0I A;  1PWT A;  1I8F A;  3CC7 A;  1D09 B;  4C92 G;  1K8A U;  4RKU E;  2X4W A;  3HTR A;  2QAZ A;  3V7R A;  3E19 A;  3UAT A;  5CKH A;  1NG2 A;  5EC7 A;  1WHM A;  3VS5 A;  3JCM b;  3CCJ T;  1KQ2 A;  3G4S T;  3TSW A;  1WZO A;  3D7S B;  3O5Z A;  4E7K A;  2NUT A;  4WCI A;  5FRO A;  1F1B B;  1M1F A;  5ECA A;  4WTO B;  4M75 E;  1M8M A;  1U1T A;  2EQI A;  1V76 A;  3MEU A;  2JTM A;  2YRD A;  1WHG A;  1VOM A;  4OGE A;  1R0B G;  2FZC B;  1MNE A;  4Y91 A;  1UJ0 A;  1N6A A;  5GAM f;  4M78 C;  3E2U A;  2CDT A;  2K6D A;  1KC8 R;  3CMA T;  1K9M C;  1OUL A;  3JCM d;  3DLL A;  2VC8 A;  2J6O A;  1KSW A;  2W10 A;  4PFO A;  2X9H A;  4F7U A;  3JCM g;  1WQ7 A;  1WYX A;  2IPO B;  4M75 C;  2LDM A;  3RKY A;  1OU8 A;  4QQG A;  1WHJ A;  3UDC A;  3CCL Q;  4F14 A;  3EG9 A;  3QJY A;  1YI2 Q;  1SHF A;  4RG8 A;  2XDD A;  2DXC A;  1RAB B;  3M0P A;  2CZ7 B;  4C8Q A;  4F17 A;  1UUE A;  1W1F A;  4LD9 K;  1TU0 B;  2YUP A;  4A54 A;  3E1S A;  3OYC A;  1PC0 A;  3I5R A;  1K9M U;  1OX8 A;  3LYI A;  5HKC A;  4F16 A;  2OAW A;  1PKT A;  1VQ5 Q;  3P8B B;  1NM7 A;  3VV0 A;  2QYZ A;  3NFC A;  1VQ9 A;  2CUB A;  3M56 A;  2HKQ B;  4CC3 A;  3CC4 A;  3OS2 A;  3C95 A;  1DJ7 B;  2KYM A;  4FW2 A;  4EMH A;  5IH2 A;  2HSE B;  3I35 A;  3LLR A;  5CK9 A;  3S3O A;  2EYW A;  2F2W A;  4FYV B;  5CQX A;  1BB9 A;  4OB1 B;  3OYF A;  4DQ2 A;  3A1P A;  1VQO A;  4Z8A A;  2R5M A;  2KAF A;  2R57 A;  2ZZD A;  1YJN A;  1LCK A;  1N5Z A;  2QEX Q;  1QCO A;  4O5V A;  1GXI E;  1G8X A;  2H3E B;  1MUZ A;  3SD4 A;  4JS4 A;  4DEY A;  1GCP A;  2MAM A;  3H9N A;  3CME A;  1YIJ Q;  1TUD A;  5FWB A;  3QYH B;  2A37 A;  1VIF A;  1IRX A;  4PJM A;  3OYA A;  3FC3 A;  1ZLM A;  2D1X A;  2E1H A;  3V8K A;  4D8D A;  2KI7 A;  1TOV A;  1IO6 A;  5CCA A;  2BE9 B;  1OZ2 A;  1BI0 A;  2F5K A;  4OB2 B;  3OYG A;  1VQP T;  4PJO F;  1H64 1;  2GBQ A;  1PD0 A;  1YWP A;  2NUT B;  5KYU A;  1TUG B;  2CT4 A;  1AZG B;  4M7D F;  5IAY A;  1Y7X A;  1VQ4 A;  1X2K A;  4PJO D;  2XID A;  2LCL A;  2BZY A;  4HVU A;  3CCJ Q;  4M7D D;  1ZSZ A;  2GQV A;  2DD5 A;  2M51 A;  3FDR A;  3G4S Q;  1KC8 U;  1NJI C;  3FJP A;  5LJ5 h;  3VJP A;  2OAU A;  4XU3 A;  3QHS A;  4F7U B;  4MZM A;  5J3B A;  1WX6 A;  2HBW A;  4XU0 A;  8AT1 B;  5LJ3 h;  2D6F A;  3DKM A;  1JJ2 A;  4EMK B;  1K73 R;  8ATC B;  3EG9 B;  3CMA Q;  4UC4 A;  5KYW B;  3RNJ A;  2RJC A;  2RQT A;  4QQ6 A;  2DTI A;  1NZ9 A;  1BYM A;  3M4G A;  3CBM A;  1UJY A;  1M3C A;  4HCC A;  4QVC A;  4FYW B;  1BI3 A;  1W2B S;  4C0D B;  4AMC A;  1O75 A;  2RQV A;  1RAA B;  4HA8 A;  1QKX A;  1BBZ A;  3PT9 A;  1NJI U;  2JTE A;  2LX9 A;  2RI2 A;  4Y28 E;  3NHN A;  2QGF B;  1BCO A;  4MMK A;  4Z88 A;  4M78 F;  1NEG A;  3EGD B;  2A3L A;  1PCX A;  1Y96 A;  2MWP A;  4M77 A;  4RTZ A;  5GAN f;  4FM4 B;  1VQ7 T;  1TS9 A;  2B8A A;  1U3O A;  1YN8 A;  1IRE B;  1N9S A;  3OYY A;  4M78 D;  3UPU A;  2D8J A;  2XK0 A;  4J9B A;  4F7U E;  1GL5 A;  2M0Y A;  2CP2 A;  1HSQ A;  4M75 F;  2K79 A;  2DL7 A;  4DA4 A;  1NPR A;  3QO3 A;  2QQR A;  2OTJ A;  4L5G A;  1M1K R;  1SRL A;  4XTX A;  1ZBJ A;  3VUB A;  3MO8 A;  3G71 T;  4M75 D;  3BDU A;  1SSF A;  2K5I A;  4J9I A;  1M2V A;  4YTL A;  3JSC A;  1FWZ A;  3VS1 A;  5KCO A;  4LN2 A;  1HXD A;  4KT0 E;  2AIR B;  3EG2 A;  3CC7 T;  4C92 D;  4C8Q E;  1C6V X;  1IZ6 A;  1BIA A;  2LNH B;  1EIF A;  4V2S A;  1TXQ A;  4ME7 A;  5FW9 A;  2MCN A;  5CO7 A;  1VQN A;  1IGQ A;  2RQW A;  1AT1 B;  1I1J A;  2RJD A;  4K11 A;  2E64 A;  1M8V A;  2O88 A;  2P4R A;  2ECZ A;  4C8Q C;  4GBQ A;  3KUF A;  2DTO A;  3OBW A;  4N4G A;  2ZGW A;  4IUR A;  4C5E A;  3I5S A;  4FSX A;  1YHQ A;  1IXD A;  1YNZ A;  4N4H A;  1NYG A;  3OSV A;  3M0U A;  1Y07 A;  3CC2 A;  1IHW A;  5KYU B;  1WFW A;  3ZEH A;  3CCJ A;  3GOX A;  2E10 A;  3JCM P;  3AT1 B;  5IHN A;  4RTY A;  1Q7Y R;  2YRC A;  2DK3 A;  1VQP Q;  2X3W D;  4A53 A;  2IG0 A;  3KFV A;  2M1H A;  1RLP C;  4A4G A;  2KSS A;  1S1N A;  1ZA2 B;  2YSQ A;  2KY9 A;  2O9S A;  3EG3 A;  5GAM h;  1K73 U;  1AEY A;  1BKB A;  4DEX A;  2VAS A;  4OGC A;  2LX7 A;  5CVI A;  5I2S A;  2QXF A;  2P0K A;  1LOJ A;  2RO0 A;  4J9E A;  5LJ5 e;  5I2M A;  3CCQ T;  3RKW A;  2XMF A;  1FMV A;  2NUP B;  1VQ6 T;  1RAG B;  2DE0 X;  1YJ9 Q;  4QKU A;  4EPC A;  5LJ3 e;  2HD0 A;  1ZX6 A;  1S72 T;  2DJZ A;  3CC4 T;  4LD6 A;  3G6E A;  2ROT A;  1K1Z A;  1ZUK A;  3FIF A;  4PNO A;  4M77 B;  3HP9 A;  1XQH A;  1QP2 A;  2QA4 T;  2C06 A;  3RIR A;  2E12 A;  1UTI A;  1G2B A;  5FU6 B;  2F5T X;  2X51 A;  2RI5 A;  1PM3 A;  2CUD A;  2H3J A;  4HCB A;  3U23 A;  2VVK A;  3M59 A;  2RN8 A;  1ZSZ C;  1M2V B;  2FYK A;  4JJB A;  4IUT A;  5GMK l;  2K7A A;  2KE9 A;  2HCK A;  2VKN A;  2RJE A;  2RMO A;  3CBP A;  4RCC A;  3JCM Q;  3HFO A;  4A4H A;  3T9N A;  4R0K A;  1W2B A;  3G71 Q;  3NPF A;  1UGR B;  1Q7Y C;  1VYU A;  2RF0 A;  1VA7 A;  2XI9 A;  2QAS A;  1K8A R;  2L3S A;  4HKE A;  3M0S A;  1PRM C;  2LQ8 A;  2LQN A;  2L3P A;  4J9C A;  3CC7 Q;  3VRY A;  2XIC A;  3P8D A;  2LTO A;  3QDF A;  2JJ9 A;  3WXM B;  1VQ4 T;  4M77 E;  2DZ9 A;  1MV0 B;  1OYX A;  4X9D A;  3A8O B;  1RL2 A;  1CSK A;  3UA7 A;  3J81 E;  2FPE A;  3CPW S;  2ZPB B;  4KH0 B;  1T3S A;  5IHK A;  3OY9 A;  3EH1 A;  3LGF A;  3LGL A;  2CGH A;  1VIE A;  2G6F X;  3SHW A;  2HAX A;  1C0M A;  4M77 C;  1Q81 R;  1M5Q 1;  4ZGE B;  1UHC A;  1ZQ1 A;  1Q7Y U;  5DY9 A;  5FU6 C;  3JB9 G;  4IUU A;  4PJO G;  2LJ0 A;  2P0P A;  3OYI A;  1QCF A;  4M7D G;  2GCX A;  2RJF A;  3QDR B;  4BY6 B;  3ULR B;  2HQE A;  2QTV A;  3JRZ A;  3S3M A;  5LJ5 d;  3VS7 A;  2XU8 A;  2KRO A;  3J80 E;  5LJ5 g;  4M7A A;  2KT1 A;  4C8Q F;  5LJ3 d;  1H92 A;  3QZ5 B;  1NYF A;  3OYK A;  1T0J A;  2CP6 A;  5LJ3 g;  3RDV A;  1K9M R;  3EG0 A;  4C8Q D;  4XU1 A;  2E65 A;  3JCM c;  5GAO q;  2ZPE B;  1X69 A;  1PSF A;  2V26 A;  5GAN 8;  3OA6 A;  2IVW A;  3CCS T;  1QVG A;  3FRN A;  4HCZ A;  4XAX B;  2D0Q B;  4A63 B;  2GFU A;  2FPF A;  2CRE A;  2RI3 A;  2ZPH B;  3CCQ Q;  5LJ3 j;  3C12 A;  1VQ6 Q;  2K5F A;  2YUO A;  4KUL A;  4ORZ A;  4FCY A;  1VQ9 Q;  4MZP A;  1JJ2 P;  3CC4 Q;  3JAM E;  2JXB A;  4XQ3 A;  2OI3 A;  3EFO B;  2J05 A;  1QQJ A;  1VQK T;  1WHH A;  1VQ7 A;  1FYN A;  2COY A;  2VB6 A;  3VYG A;  1EX4 A;  2DVE A;  3JB9 J;  1QVF A;  5GMK m;  4Q5W A;  2MF2 A;  1VQO Q;  1TSF A;  5GAN h;  1Y57 A;  2EQM A;  1YJN Q;  1VQN T;  3ME9 A;  2RNA A;  4FIB A;  1Q81 C;  1HD3 A;  4BY6 C;  2LQW A;  1JXM A;  1JJ2 S;  1OEB A;  3CD6 T;  1B34 A;  9ATC B;  2LJ3 A;  1KJW A;  3CME Q;  4C92 B;  1MHN A;  1YHQ T;  4IKF A;  3OYH A;  2AK5 A;  2KGT A;  2E3H A;  2EQJ A;  4MZT A;  3WVE B;  3CC2 T;  4PFZ A;  2KMT A;  3JCM f;  3OB9 A;  4HVV A;  4DBR A;  3EAE A;  3MEA A;  1E6H A;  3OYJ A;  3HL8 A;  2QQS A;  1ARK A;  4ATO A;  1SEM A;  2ROL A;  5AYF A;  1VQ4 Q;  2DYB A;  4IIM A;  3RMS A;  2AZV A;  1Q81 U;  1U5S A;  1G3S A;  3E9F A;  4MDW A;  3PMT A;  2QQA A;  1OQK A;  4OML A;  2YRV A;  2KYB A;  5GMK i;  4EMK A;  2BKD N;  3HSB A;  5KYX B;  3CCM T;  2O4X B;  2DEQ A;  5KYW A;  2K9G A;  2MMP A;  2VYT A;  5CKD A;  3QII A;  1X27 A;  3ASK A;  1G3T A;  1IHV A;  4M7A B;  1UEC A;  4JUV A;  3ZFJ A;  4HVW A;  2COW A;  4KGV B;  3BDL A;  1XOV A;  3G6E T;  3G7Z A;  2M0O A;  4LDV A;  4E7S A;  3SB2 A;  2DET A;  2EFI A;  2NWM A;  1A0N B;  1XTD A;  1HJD A;  3WVD B;  3UWN A;  5A2Q E;  3OYM A;  3CPW A;  1NJI R;  2E4H A;  1WXB A;  5GAM g;  3NTK A;  2EGA A;  2YLC A;  1V1C A;  2EBP A;  1PKS A;  5GAN 6;  2W0Z A;  3THK A;  2DRM A;  3EGD A;  3CCQ A;  2LNV A;  5LL6 S;  1VQ6 A;  1WGS A;  4OF1 A;  4LDY A;  3L2R A;  4E7Z A;  1I07 A;  2RM4 A;  1RAD B;  1S72 A;  5GAM j;  1SPK A;  3H8Z A;  3L2W A;  3CCU A;  5C0M A;  2HNI A;  1V29 B;  1VYV A;  1SRM A;  3HRU A;  3CCS Q;  1R0C B;  2RQR A;  3A8H B;  2DRK A;  2QA4 A;  2OX7 A;  2OTJ Q;  4BI4 A;  4LNP A;  4PKC C;  5EG2 A;  4AFZ C;  3QWX X;  5I11 A;  3QYG B;  4M7A E;  2PUO B;  2BZ8 A;  1W6X A;  3OYE A;  5FRM A;  1VQK Q;  3GPL A;  1FMW A;  1AWX A;  1N27 A;  1PRL C;  4ELZ C;  2GF7 A;  1B34 B;  3OMG A;  4OMN A;  2FPD A;  2EJ9 A;  2RHY A;  2P84 A;  1MGQ A;  2AKK A;  1VQN Q;  5GAN 4;  1OI1 A;  2DXT A;  4Y92 A;  5GAN e;  2JW4 A;  3PIP A;  1Q86 C;  3A8G B;  3RES A;  2CSI A;  3JB9 F;  1JEG A;  2XDP A;  3VS2 A;  1U06 A;  1JRI A;  2MI6 A;  1YHQ Q;  2LVM A;  4FYX B;  4OMO A;  3FEO A;  1SHG A;  4E7L A;  4KH1 B;  3JB9 D;  1JB0 E;  4OB0 B;  2I0N A;  3SEM A;  3CC2 Q;  5GAO l;  1EFN A;  4J6W A;  1OZ3 A;  4WF2 A;  1WHL A;  4AFU C;  1UE9 A;  2X4Y A;  4E7I A;  2PZ1 A;  2HQX A;  1W2B P;  2V8J A;  1KHI A;  1RUW A;  2KDS A;  4KRT A;  3INZ A;  3LW5 E;  3KXT A;  4FL6 A;  3LX7 A;  3URG A;  2KNB B;  5CQY A;  4IUQ A;  1Q86 U;  3VS0 A;  2CP7 A;  1H3H A;  5CR2 A;  4F7U G;  1YBY A;  1P92 A;  2X3X D;  3PVL A;  3PMI A;  3OW2 S;  3ER0 A;  2NUP A;  1FXX A;  1SF9 A;  1X01 A;  4E7H A;  1BI1 A;  4VUB A;  1UEB A;  2A08 A;  2SEM A;  4ZTJ A;  3RKX A;  1UGV A;  3G6E Q;  1TTH B;  2LRQ A;  4C8Q G;  1M90 R;  2L3Q A;  3CCR T;  2EKH A;  4PLI A;  4NS5 A;  1X75 C;  2DPP B;  5L8R E;  3NMZ C;  3CCS A;  4MDX A;  2BZX A;  1K4U S;  4KUD K;  1QWE A;  4QVZ A;  3NGP A;  5M9O A;  2RA2 A;  2FL7 A;  3G1J A;  4KBM B;  3QG1 A;  2ABL A;  4J83 A;  1JQQ A;  2J7I A;  2K4Y A;  3H0F A;  4JRI A;  2P0Q A;  2PQW A;  1AWJ A;  2ZCF B;  1WI7 A;  5GAN 2;  4JJD A;  4BB7 A;  1VQK A;  1T0H A;  4EMK C;  2ATC B;  4J9H A;  4FW1 A;  4DOW A;  5GAN d;  3EGU A;  3MP6 A;  3JV3 A;  1X6B A;  5GMK h;  3PVQ A;  5GAN g;  3CXC A;  2QG9 B;  1WQW A;  2JMA A;  4RTV A;  1M30 A;  4BAC A;  3CD6 A;  3QJ6 A;  2NYS A;  2CP0 A;  4C0D C;  4MML A;  4ZN3 A;  2DO3 A;  2E6Z A;  4PL6 A;  2HBP A;  2GTO A;  3VS3 A;  5GAN j;  2ZPG B;  3HFN A;  3VKI A;  3CEY A;  5GAO m;  4R55 A;  3X28 B;  1QVG S;  1QVF P;  2NUZ A;  2PVG B;  3VUZ A;  2EYX A;  2Y4X A;  2HKN A;  3V8L A;  4NOY A;  4XTW A;  2BUD A;  3TQ7 P;  1Y71 A;  2YUN A;  1W70 A;  5A0G A;  1R8O B;  3BW1 A;  5AT1 B;  1M90 C;  2EGE A;  2YHT A;  3HRT A;  1QVF S;  4P5N A;  4L6V 5;  3QKJ A;  2QDL A;  3H41 A;  2FRW A;  1YWO A;  1Z9Q A;  5D6W A;  2VGN A;  3CCM A;  3LH0 A;  5GAO p;  1WJS A;  1SG5 A;  3M53 A;  3MCA B;  2I2L A;  4LUD A;  2V8I A;  4PJL A;  4FT2 A;  3A8M B;  4D8K A;  2CH4 W;  4L59 A;  3CCU T;  2DLP A;  1LVK A;  3LH5 A;  1WLP B;  1BI2 A;  2A0F B;  2LJ1 A;  4JZ4 A;  2DKG A;  4PK4 A;  3CCE A;  2AZS A;  1M90 U;  2KK4 A;  3REB B;  1UGQ B;  3EFO A;  1E6G A;  2NLU A;  2HL5 C;  2BE7 D;  2F1L A;  4M78 A;  1UGP B;  5DM7 R;  2K2M A;  3OYN A;  3CCR Q;  1OPL A;  1VQ7 Q;  4M77 G;  4BE0 A;  2GNC A;  2YWW A;  2E41 A;  2DF6 A;  4BD3 A;  1Q82 C;  2RK2 A;  4B6M A;  1JO8 A;  2D8H A;  1YFN A;  3UA6 A;  3I55 T;  3CPW P;  3OW2 A;  1GRI A;  4CI0 C;  4M4Z A;  3I56 T;  3OYB A;  1BCM A;  4OB3 B;  4C92 A;  1PHT A;  3M5A A;  3MP1 A;  2JT4 A;  2LQK A;  4HT9 A;  4A4F A;  4J9F A;  2RHI A;  5A0L A;  3GNG A;  3TCJ A;  3QZ9 B;  3EH2 A;  4QW2 A;  1OV3 A;  3FB9 A;  2ED1 A;  2LT1 A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  1GCQ A;  2F2V A;  1E6H A;  4OMQ A;  2GBQ A;  3CQT A;  1AWW A;  1YWP A;  3TVT A;  2DL8 A;  1ARK A;  4RTU A;  2CT4 A;  2EGC A;  1AZG B;  1SEM A;  2ROL A;  2DYB A;  1X2K A;  4IIM A;  3EHR A;  2AZV A;  1U5S A;  2DL4 A;  2BZY A;  4HVU A;  2C0T A;  2M51 A;  2DNU A;  2FEI A;  4OML A;  4RUG A;  2KYB A;  1WX6 A;  2HBW A;  1GBQ A;  2DIL A;  3R6N A;  2K9G A;  2O9V A;  1X27 A;  1KFZ A;  1WXT A;  4QT7 A;  2DVJ A;  3RNJ A;  2RQT A;  1UEC A;  2DJQ A;  1UJY A;  4HVW A;  1M3C A;  1X43 A;  2JS0 A;  1XOV A;  2NWM A;  5L23 A;  1A0N B;  2GGR A;  1HJD A;  1K0S A;  1TG0 A;  1WXB A;  5IXF A;  2FG0 A;  2EGA A;  1V1C A;  2EBP A;  1PKS A;  2KRS A;  2OJ2 A;  2KXD A;  2W0Z A;  3THK A;  2RQV A;  2D0N A;  2DRM A;  1QKX A;  1BBZ A;  1QKW A;  2JTE A;  2KXC A;  3NHN A;  4Z88 A;  1UHF A;  2EVR A;  1NEG A;  4JJC A;  5I22 A;  1NEB A;  4E6R A;  1AOJ A;  5GJW B;  1CKB A;  1I07 A;  4RTZ A;  1SPK A;  4OMP A;  3M0T A;  1U3O A;  1YN8 A;  2JS2 A;  2CSQ A;  2D8J A;  4J9B A;  1GL5 A;  1WA7 A;  2M0Y A;  1H8K A;  1HSQ A;  1VYV A;  2K79 A;  1SRM A;  4ESR A;  2DL7 A;  3M0R A;  2O31 A;  2VWF A;  3VS6 A;  2RQR A;  1GFC A;  2DRK A;  1E7O A;  1MV3 A;  3A98 A;  1SRL A;  1ZBJ A;  4LNP A;  2ENM A;  4EIK A;  4OMM A;  4AFZ C;  3QWX X;  3M0Q A;  5I11 A;  1UFF A;  4J9I A;  1Y0M A;  3H0H A;  1K9A A;  3VS1 A;  4LN2 A;  5IXB A;  2V1R A;  4JZ3 A;  1AVZ C;  3VRZ A;  1SSH A;  3VS4 A;  2BZ8 A;  3EG2 A;  1YCS B;  1OPK A;  4AG2 C;  1J3T A;  1W6X A;  1AWX A;  1PRL C;  2MIO A;  4OMN A;  2LNH B;  2DL3 A;  2FPD A;  1KIK A;  3FJ5 A;  5FW9 A;  2MCN A;  1G83 A;  4LE9 A;  2AKK A;  2RQW A;  1ZUY A;  1RI9 A;  2DA9 A;  4Y92 A;  1I1J A;  2JW4 A;  4K11 A;  2O88 A;  2P4R A;  2ECZ A;  4GBQ A;  2PNI A;  2CSI A;  1JEG A;  3VS2 A;  1WXU A;  1U06 A;  3I5S A;  2YT6 A;  2HEQ A;  1UDL A;  3I9Q A;  1YNZ A;  4OMO A;  1SHG A;  1NYG A;  2L2P A;  2I0N A;  3M0U A;  3SEM A;  3TSZ A;  1EFN A;  2YDL A;  1WFW A;  4AFU C;  1UE9 A;  2KR3 A;  1X6G A;  2HSP A;  2PZ1 A;  1JXO A;  4RTY A;  5IHN A;  5FWC A;  2ED0 A;  5HCK A;  1RUW A;  2E5K A;  2GQI A;  4KRT A;  2X3W D;  2DBM A;  3KFV A;  1RLP C;  2SRC A;  1S1N A;  1K0X A;  4RTX A;  2KNB B;  2YSQ A;  2O9S A;  3VS0 A;  3EG3 A;  1H3H A;  1BU1 A;  2B86 A;  1AEY A;  1CKA A;  1QWF A;  2KRM A;  1B3Q A;  3RBB B;  4DEX A;  2F2X A;  2CH4 A;  2KBT A;  2X3X D;  2J6F A;  2DL5 A;  2LX7 A;  3PVL A;  3EG1 A;  4J9E A;  1B07 A;  2DX1 A;  1AWO A;  4GLM A;  1FMK A;  2XMF A;  4X1V A;  2LMJ A;  2ESW A;  2DMO A;  4CC2 A;  2DE0 X;  4CC4 B;  2A08 A;  1ZSG A;  2SEM A;  1GFD A;  1GBR A;  2H8H A;  1ZX6 A;  1M3A A;  1QLY A;  2LZ6 B;  1UGV A;  2ROT A;  1K1Z A;  1ZUK A;  1WDX A;  2L3Q A;  1X2Q A;  4RTW A;  2EKH A;  1GCQ C;  2AKL A;  2JM9 A;  3NMZ C;  1RLQ C;  4JPB W;  1M27 C;  2BZX A;  1K4U S;  2GTJ A;  1QWE A;  2FRY A;  1UTI A;  1G2B A;  3NGP A;  1BK2 A;  2J06 A;  1VYT A;  1JU5 C;  2BTT A;  1UG1 A;  2ABL A;  3ZL7 C;  2CUD A;  1JQQ A;  2J7I A;  3H0F A;  1AZE A;  1WIE A;  2DBK A;  3REA B;  3U23 A;  1M3B A;  1AWJ A;  2VVK A;  4AG1 C;  2O2O A;  1WI7 A;  2RN8 A;  4HXJ A;  4AFS C;  4Z89 A;  4JJB A;  1I0C A;  4JJD A;  1AD5 A;  2K7A A;  2KE9 A;  1T0H A;  2HCK A;  2VKN A;  2YUQ A;  2KEA A;  2RMO A;  2RQU A;  4J9H A;  2KRN A;  4R0K A;  3EGU A;  2CT3 A;  3NPF A;  2C0O A;  3JV3 A;  1VYU A;  2RF0 A;  1X6B A;  1VA7 A;  1NLP C;  3PVQ A;  3EHQ A;  2DM1 A;  2L3S A;  1ZUU A;  3M0S A;  1PRM C;  2EYZ A;  4HCK A;  2JMA A;  4RTV A;  2FO0 A;  1M30 A;  1PWT A;  2LQN A;  3H0I A;  2L3P A;  4J9C A;  3VRY A;  3QWY A;  1PNJ A;  2J6K A;  1MV0 B;  3UAT A;  1NG2 A;  5EC7 A;  2GTO A;  1CSK A;  3VS5 A;  3UA7 A;  2C0I A;  3VS3 A;  2FPE A;  1YP5 A;  3TSW A;  1T3S A;  5IHK A;  3O5Z A;  4LUE A;  2NUZ A;  4WCI A;  4CC7 A;  5ECA A;  2EYX A;  1M8M A;  2G6F X;  3IQL A;  3SHW A;  2EQI A;  2A36 A;  4J9G A;  1K76 A;  2LP5 A;  1Z9Z A;  2YUN A;  1UJ0 A;  1W70 A;  1UHC A;  2CDT A;  2JM8 A;  2K6D A;  2J6O A;  1KSW A;  2W10 A;  2EGE A;  2LJ0 A;  3PE0 A;  2MOX A;  1WYX A;  1T3L A;  1ABO A;  1QCF A;  1NLO C;  3ULR B;  4F14 A;  2LCS A;  2QDL A;  3H41 A;  2FRW A;  1YWO A;  4ZNX A;  1Z9Q A;  4FSS A;  2KRO A;  3VS7 A;  4IIO A;  1SHF A;  2KT1 A;  2EPD A;  1H92 A;  3GBQ A;  1NYF A;  1T0J A;  3M0P A;  4F17 A;  1UUE A;  1W1F A;  3EG0 A;  2YUP A;  4LUD A;  4D8K A;  2CH4 W;  2JMC A;  2DLP A;  2EW3 A;  1X69 A;  3I5R A;  3C0C A;  2A28 A;  3LH5 A;  1WLP B;  4JZ4 A;  2LJ1 A;  4F16 A;  4A63 B;  2OAW A;  2AZS A;  2FPF A;  2CRE A;  1PKT A;  3REB B;  1NM7 A;  1TUC A;  2YUO A;  4ORZ A;  1OOT A;  2CUB A;  4CC3 A;  1E6G A;  2V1Q A;  2JXB A;  2KYM A;  2OI3 A;  2J05 A;  2K2M A;  5IH2 A;  3I35 A;  4RTT A;  1FYN A;  1OPL A;  2EYW A;  2F2W A;  5GJV B;  2GNC A;  1BB9 A;  4AFQ C;  2K3B A;  2EYY A;  2DF6 A;  4Z8A A;  2RPN A;  1JO8 A;  2PTK A;  1Y57 A;  2D8H A;  1LCK A;  1N5Z A;  2KT8 A;  3UA6 A;  1GRI A;  2RNA A;  1ABQ A;  4M4Z A;  2HDA A;  1HD3 A;  2LQW A;  1JXM A;  1MUZ A;  1OEB A;  4DEY A;  1GCP A;  1PHT A;  2LJ3 A;  1KJW A;  4J9D A;  1TUD A;  5FWB A;  2A37 A;  3UF4 A;  2L0A A;  2JT4 A;  4J9F A;  2AK5 A;  2KGT A;  2IIM A;  5IHI A;  1OV3 A;  1ZLM A;  2D1X A;  4D8D A;  4HVV A;  2ED1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...