2F2WA

Alpha-spectrin sh3 domain r21a mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'ELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2wA00
2FEIA 5IXFA 2L3PA 2FG0A 2OAWA 1AWXA 1QWFA 2SRCA 4GLMA 4CC7A 1J3TA 2DL3A 2V1QA 1AEYA 2H8HA 1WFWA 2F2WA 1M27C 3U23A 2C0IA 2DL8A 3PE0A 1YCSB 2EGCA 2RQUA 1WA7A 3NHNA 3C0CA 4M4ZA 4AG2C 4RTYA 4JPBW 2K2MA 3I5SA 3M0QA 4AG1C 2ESWA 2YUQA 1SSHA 4IIOA 1GCQA 1WIEA 3R6NA 4HVWA 2NUZA 2DRKA 2A08A 1PKSA 4J9HA 2G6FX 1U06A 2LJ3A 1G83A 1UHFA 1WLPB 2JXBA 5FW9A 3UA6A 1QWEA 1WYXA 2VWFA 2VVKA 3VRYA 2CT3A 3A98A 1KJWA 2B86A 1AWOA 1MV3A 1NG2A 1GCQC 1AWJA 2JW4A 3H0FA 1BB9A 1NM7A 1KFZA 2YDLA 2YUNA 1RLQC 2KRNA 2AZSA 5HCKA 2ROTA 1W70A 4J9DA 2DYBA 1B07A 3EHRA 1GFCA 1K0XA 1E6HA 2LNHB 2LJ1A 1I07A 3EG0A 1NEBA 1WI7A 1ZLMA 2A36A 2J7IA 3THKA 2FPDA 1N5ZA 5EC7A 1K9AA 1PRLC 2CH4A 3EG3A 2I0NA 5I11A 4Z8AA 1NYGA 2DL7A 1ZUYA 1W1FA 3RNJA 1RI9A 2E5KA 1I0CA 3M0RA 1H92A 2LCSA 1KSWA 2KXDA 3NMZC 2K3BA 2W0ZA 1VYVA 2DX1A 2GBQA 2KRSA 2O9VA 1W6XA 1M3CA 2V1RA 2P4RA 1GBQA 5FWCA 4DEYA 2CDTA 4J9BA 2O88A 2OI3A 4OMQA 3I5RA 2RQTA 1HD3A 4E6RA 4D8DA 3NPFA 3M0PA 1M30A 3SEMA 2YUOA 1WXUA 2DMOA 2XMFA 2CUDA 2EBPA 1UJ0A 1QKXA 2DBMA 1OPLA 2O2OA 4LNPA 2L3QA 2F2XA 3H0IA 1OEBA 1OPKA 1QLYA 1XOVA 1OV3A 2GQIA 2J05A 1HSQA 2K6DA 3I35A 2DVJA 4CC4B 1TG0A 2GTJA 2HCKA 4OMPA 1WX6A 2HBWA 1SRLA 2RPNA 4LN2A 1KIKA 2JMAA 2D0NA 4HVVA 1NLPC 2KXCA 1E6GA 3TSZA 3H41A 4R0KA 1V1CA 1OOTA 3VS6A 4JJCA 4ORZA 2EPDA 4JZ4A 5L23A 2JT4A 5IXBA 3QWYA 1RUWA 2J6KA 4ZNXA 2PNIA 4EIKA 4FSSA 3TVTA 2O9SA 2OJ2A 2DBKA 1X43A 2J6FA 1SHFA 2DRMA 2BTTA 2KRMA 1M3BA 3PVQA 3VS2A 1AZEA 2RQWA 4HVUA 3NGPA 4RUGA 4X1VA 1UHCA 1B3QA 4F14A 2DL5A 1X6BA 1JU5C 2HEQA 1GCPA 2ENMA 3SHWA 1T3SA 4J9IA 3UATA 3VS7A 2X3XD 1SHGA 2K9GA 4OMNA 2DA9A 1NYFA 1FMKA 1CKAA 1Y57A 3RBBB 1UGVA 3M0TA 1YN8A 4HCKA 4JJDA 1Z9QA 2AK5A 1RLPC 2ABLA 2GTOA 2LP5A 1WXBA 2HSPA 2EGEA 2JS0A 2IIMA 2DE0X 3IQLA 4Z88A 2CT4A 4K11A 1ABQA 2CUBA 3I9QA 3O5ZA 1UDLA 1JXOA 1BBZA 2FO0A 2MOXA 1JXMA 3QWXX 3H0HA 2EKHA 1SRMA 3VS4A 1CKBA 2L3SA 3PVLA 2CH4W 1PRMC 2ED1A 2J06A 2RQRA 2CSQA 5I22A 1NLOC 2EQIA 1ABOA 2JM8A 1SPKA 1E7OA 4AFZC 3ZL7C 1VA7A 4J9CA 1YP5A 2PTKA 1JEGA 3M0SA 2MCNA 2D8JA 1YNZA 2KR3A 1U5SA 1TUCA 5ECAA 1K0SA 1YWOA 1T3LA 4IIMA 3VS1A 1IO6A 2HDAA 2DLPA 2FPEA 2CSIA 2LJ0A 1QCFA 1UFFA 2DM1A 2KNBB 2GGRA 2LQNA 1T0HA 2X3WD 3REBB 2VKNA 1X69A 1WDXA 2LQWA 4AFQC 1PKTA 1MUZA 2KT8A 3EGUA 4CC3A 3REAB 2ECZA 2RMOA 2C0TA 2QDLA 1NEGA 3GBQA 2LX7A 2LZ6B 3VS0A 4LE9A 1H8KA 2ED0A 3JV3A 1M3AA 1X2QA 1X6GA 1QKWA 3LH5A 2A37A 1VYTA 2KE9A 1H3HA 2KT1A 1M8MA 2PZ1A 2DILA 4F16A 1Y0MA 2EYWA 5FWBA 2RNAA 3KFVA 1K4US 5IHIA 4GBQA 4RTUA 4RTVA 5IHNA 2K79A 1AOJA 2W10A 1T0JA 2KEAA 2AKLA 4RTXA 5GJVB 4WCIA 1S1NA 2FPFA 2F2VA 3EG2A 1PNJA 2JTEA 2KBTA 4RTWA 4Z89A 2DL4A 2NWMA 1AWWA 4JZ3A 2C0OA 5IHKA 1AVZC 4J9GA 4OMLA 4LUEA 2D8HA 1ZSGA 4ESRA 1SEMA 1I1JA 2YT6A 4CC2A 1G2BA 1JO8A 2MIOA 2M0YA 1BU1A 1UTIA 1GBRA 1ARKA 1TUDA 3ULRB 2KROA 1UE9A 1UJYA 2O31A 1U3OA 1Z9ZA 3CQTA 1FYNA 1VYUA 4AFSC 2M51A 1HJDA 1JQQA 1AZGB 4JJBA 1GRIA 2KGTA 1ZUKA 2DNUA 3VS3A 1CSKA 2RN8A 4J9FA 1X27A 1MV0B 4Y92A 1LCKA 4A63B 1AD5A 1PWTA 1UG1A 1K76A 1BK2A 2D1XA 2FRYA 2BZYA 2FRWA 4OMOA 4HXJA 3UA7A 2BZ8A 1WXTA 2RQVA 5IH2A 1UUEA 4J9EA 2EYXA 2JM9A 1X2KA 4KRTA 3M0UA 1K1ZA 2EYZA 5GJWB 1GL5A 1EFNA 2AZVA 3VRZA 2KYBA 2AKKA 1ZUUA 1ZBJA 2EW3A 2BZXA 4RTZA 3VS5A 4AFUC 4DEXA 3EG1A 2EYYA 2KYMA 3TSWA 2YSQA 2RF0A 4OMMA 3UF4A 4F17A 2DF6A 2A28A 1YWPA 3FJ5A 1ZX6A 2CREA 2ROLA 2JMCA 2YUPA 3EHQA 2J6OA 2LMJA 2L0AA 2K7AA 1PHTA 2DJQA 2EGAA 2SEMA 4QT7A 4D8KA 1GFDA 1UECA 2L2PA 4LUDA 1A0NB 4RTTA 2JS2A 2GNCA 2EVRA
chains in the Genus database with same CATH superfamily
2KAFA 1KK7A 1VQKA 3UDCA 4BUGA 4LXCA 2OAWA 2L3RA 4JLGA 1VQPQ 3EH1A 3V7RA 4LD9K 4EMKA 2H8HA 1YJWT 1G3TA 3CMAT 1Q82C 1EZZB 4M75G 1D3BA 2PUOB 2EGCA 1QVFP 4QW2A 1WA7A 3NHNA 3C0CA 4M4ZA 5GAOm 3OMGA 4OB0B 1N27A 4PJOB 4EMKC 2OTJQ 1WIEA 3MJXA 3R6NA 3MO8A 2OTLT 3GF5A 2G6FX 3SFMA 1G83A 5IT9E 1UHFA 3UA6A 2QI2A 5CR2A 5GAN2 1LOJA 1OI1A 4JRIA 2VWFA 5FLXE 2RM4A 1JJ2P 4J6YA 2CT3A 1RAEB 1PC0A 3A8OB 3A8GB 4C0GA 3RKYA 1BIAA 2EKOA 1NM7A 4C92B 1WPYA 2KRNA 1G3YA 2AZSA 2E10A 4IUQA 5HCKA 1NJIC 4C5HA 3EGDA 4BI8B 2LNHB 1BI3A 4M7AE 1M90R 2JZ2A 2EJ9A 2E3IA 5EC7A 2CH4A 1OX8A 2KSSA 3G6ET 4RCCA 3OSSC 1W1FA 4PJMA 1WHGA 2E5KA 1I0CA 4OB3B 3M0RA 4XU0A 1H92A 5CKEA 3QG1A 3VJPA 2DXUA 2KXDA 2W0ZA 5GANe 3CC4T 1V76A 2V1RA 4DEYA 4M7DE 4J9BA 2BE9B 2DIQA 4F7UE 3RMQA 4XK8E 3E9FA 3NPFA 1M1KR 3M0PA 3PTAA 2DD5A 2QQ9A 4XTZA 1M1GA 1YJ9Q 1UJ0A 2LX9A 2QEXA 3CCRA 2O2OA 2X4XA 1U8RA 3H0IA 1OPKA 1ZA1B 2GQIA 1Y96B 2ATCB 1IREB 2NUPB 3CCMA 2HCKA 1TH7A 5HKCA 2HBWA 3MEVA 3AHUA 4LN2A 2JMAA 2KXCA 4HCCA 5CQXA 1G3SA 5FRNA 1Q7YU 3CC7Q 1IHVA 1VQ8Q 4JJCA 4ORZA 1TS9A 3X28B 4FM4B 5IXBA 1KD1U 1RUWA 2V8KA 3NTHA 4EIKA 3M4YA 1K73U 3CCLA 3X24B 2OJ2A 3S3MA 2J6FA 4PFPA 1K9MR 3RDVA 1MMDA 1M3BA 2L89A 2CGHA 4HVUA 1B3QA 4FYVB 3MEAA 3OYHA 5KE2A 2BKDN 1RL2A 2M1HA 2KMTA 3HTRA 4J7IA 1W4SA 1G3WA 3UATA 2NYSA 3N5BB 3M55A 1VQ5Q 4GLKA 3VS7A 3HPWA 5D7UA 1VQ7Q 1YBYA 3HP9A 2K9GA 1QVFA 1FMKA 1PD1A 2JNGA 5CO7A 3LLRA 4JJDA 2AK5A 2HD0A 4ELZC 1KC8R 1KQ1A 2COWA 3IQLA 4DOVA 3O5ZA 2QGGA 1WHMA 3L2VA 2EKHA 1JJ2A 4M77D 1QP2A 3VS4A 1TTHB 3A1PA 3OYMA 1O75A 5LJ3e 1PRMC 4BI4A 3LWHA 1RI0A 2ED1A 1VQNA 3V8KA 5I22A 2YHTA 2JM8A 1SG5A 2A0FB 1JEGA 3EAEA 2EWNA 1Q86R 3M58A 1VQ4A 1VQMA 2NUPA 5LL6S 4C8QB 1K0SA 1YWOA 3JCMh 4C8QD 3OYGA 3VS1A 4O5VA 2OTJT 4M78F 1IO6A 3SD4A 3OYBA 4WF2A 1OQKA 1QCFA 4L59A 2X4YA 3I56T 1NPPA 1UFFA 2K5FA 2QGFB 2X3WD 1WDXA 4A4EA 3EGUA 1MUZA 4BDYA 4CC3A 2E12A 3CC7A 5KYXB 4B6MA 3QDRB 3P8DA 3CD6Q 2ECZA 3MP8A 3RIRA 1VQLQ 2QDLA 2RJFA 1Q95G 3VS0A 4HT8A 2CZ0B 1X2QA 1X6GA 3LH5A 2QTXA 2E6ZA 2HL3A 2MK5A 2KE9A 2LCCA 1N8RU 4E7IA 2GF7A 2YWWA 3C4SA 1Y0MA 2CYZB 2CZ7B 1MHNA 3GPLA 3CBOA 1K4US 4YTLA 5IHIA 5HK3A 1BYMA 3OSVA 5GJVB 2AKLA 2KEAA 2KY9A 4DOWA 3GOXA 5CVIA 1S1NA 2JTEA 1U1TA 3JCMc 2DL4A 1AWWA 1VQOA 1I5OB 3X20B 4N4HA 2XU8A 1AVZC 3C95A 3CEYA 4R55A 3HRSA 2CZ1B 1I1JA 1M5Q1 1QVPA 1PM3A 4CC2A 3FC3A 3PFSA 3WVDB 4OVAA 3OW2P 2FVUA 4M77C 1UE9A 1EIFA 2VGMA 5GAN8 3FEOA 3CQTA 4C8QA 1FYNA 3I55Q 1VYUA 2M51A 1JQQA 2ZAEA 1ZUKA 2QA4A 1H3ZA 4J9FA 2E65A 3PIPA 4Y92A 3SB2A 4XTUA 4BY6B 4WTOB 1GXIE 2HKNA 4C8QC 3CCUQ 4XQ3A 2E6NA 2D1XA 1LNXA 2BZYA 3UA7A 1Q81C 5KYXA 3VYGA 2DEUA 1WHLA 2E4HA 2RO0A 1TU0B 1YITA 4KRTA 2EYZA 5CIUA 1PD0A 4Z02A 5L8RE 1LVKA 4OGCA 2MMPA 4Y91A 4N4IA 5GMKh 1EFNA 2AZVA 4OF1A 2KYBA 3HHTB 2CS7A 2G3RA 1ZBJA 2KVQG 4NS5A 3VS5A 4AFUC 2L5QA 3EG1A 4FCYA 2EYYA 4PNOA 1TSFA 1I5LA 2WSEE 5LJ5j 5GAMd 3UF4A 2DXCA 5GANj 2DF6A 1FXXA 1YWPA 2DXTA 2VGNA 3VV0A 4MMLA 1ZX6A 3EFRA 3G71T 1YIJT 1K8AU 1YI2Q 3T9NA 2YUPA 2L0AA 2ZZDA 4M7AB 1MNDA 3M59A 2RH2A 2CP6A 3OS1A 3JB9D 4OMFB 1A0NB 2JS2A 4CC7A 2EVRA 2FEIA 3H6ZA 3GLXA 1M2VB 1TUGB 5IN1A 2FG0A 1Y07A 2Y4XA 1AWXA 1NJIR 1D0ZA 2SRCA 1OX9A 4GLMA 1QCOA 1N9SA 2DAQA 1NZ9A 1J3TA 2DL3A 3L42A 2XICA 5GAN5 2F2WA 1M27C 1G8XA 1MMAA 2C0IA 1VQKQ 2O4XB 4M7DF 1RABB 4F7UF 4MZPA 4F7UB 2XD0A 3JCMX 4AG1C 2F1LA 3CCET 1SSHA 3QZ9B 3DLMA 1S72A 4LDVA 1KQ2A 2P84A 2Z0WA 2NUZA 2A08A 1IGQA 3LGLA 2IPOB 8AT1B 4M78E 3OYJA 1WLPB 4KUDK 3VRYA 2K3XA 3G4ST 2HQHA 2BE7D 1NG2A 1V29B 4M77G 2JW4A 2MWPA 1OZ2A 2R5AA 5J26A 1YJNT 3CCUA 1PSEA 2GCXA 1RLQC 4BB7A 4EPCA 4EMHA 1B07A 2FZCB 1VQ9T 2MWOA 1I07A 1D1CA 1WJRA 1NEBA 1ZLMA 2J7IA 1YJWA 4EDUA 3QJYA 1HK9A 3UPUA 1M90U 1N5ZA 3OW2A 4E47A 4XU2A 1K9AA 1PRLC 4C8QG 5I11A 3E19A 4X34A 3P8BB 1NYGA 2DZ9A 1RI9A 4J6XA 1R0CB 3HFOA 1KSWA 3WXMB 4A54A 4M7AA 3NMZC 3V7CA 2R5MA 2KRSA 2O9VA 3CCJT 2A3LA 5LJ3j 1VQ6A 1M3CA 1XQHA 2X4JA 1M2VA 1FMVA 2O88A 4JS4A 3M4GA 1W2BS 1JBMA 4BE0A 2EQJA 4E6RA 2E3HA 5HY6A 3JCMJ 1M4ZA 5GAMf 1M1KU 2XDBA 4R56A 2XMFA 2CUDA 4M75E 1WQWA 2DBMA 1OPLA 4LNPA 2F2XA 3SWNA 2K4YA 3JCMe 2K6DA 1UEBA 1TG0A 2M16A 4OMPA 1SRLA 2RPNA 3LWIA 2QQSA 4KH1B 2QEXQ 2OAUA 4HVVA 2EYQA 3CCRQ 3G6EA 3CXCP 4NL3A 3M54A 1QMCA 3SWNC 3JSCA 3CCMQ 3JB9H 2JT4A 3UT1A 3CC4A 2CP2A 1YHQT 4PJOD 5A0LA 1K9MU 2NLUA 1ZA2B 4PKCC 1IRXA 1UHCA 2VB6A 1JU5C 1RAIB 2E64A 4CI0C 1Y7XA 4QKUA 4XTXA 1GCPA 2ENMA 3CCLQ 4QVCA 4F04B 2X51A 5I21A 2RI2A 4PLIA 4QQDA 3ASKA 4DA4A 2PVDB 2DA9A 1NYFA 3RBBB 1U1SA 4B9XA 4C92D 1RLPC 2ABLA 2LP5A 3JB9I 1WXBA 1KC8U 2DE0X 4K11A 1ZSZB 1UDLA 1BBZA 2MOXA 1JXMA 4KGXB 2LT4A 3H0HA 1KQSP 2M9UA 4XTYA 4II1A 1CKBA 2L3SA 4KH0B 2CH4W 2CP5A 2AHJB 1WHKA 2JOYA 2EQIA 1ABOA 5LJ5e 1SPKA 2QQBA 4FW2A 3ZL7C 4LDWA 2BIVA 4C0DB 3M0SA 2MCNA 5GAOp 1Q86U 3QKJA 3JB9J 2KR3A 1U5SA 4AT1B 1TUCA 6AT1B 4J8OA 5GAMg 1VQNQ 3RMSA 2HDAA 2DLPA 3OYFA 2FPEA 4JDSA 3BW1A 4FT2A 2RHUA 3H8ZA 3CCQT 1VQMQ 1VQ4Q 2HMAA 1OU9A 2GGRA 2GFAA 3JB9G 2LQNA 2DIGA 1TOVA 3LH0A 3LYIA 2VKNA 3KUFA 2RHXA 2LQWA 3P8HA 2KT8A 4PJOA 3D7SB 2DD4A 5GMKe 1M9SA 4E7LA 2LX7A 2XG8D 3CCVQ 5KYNA 3FB9A 3OA6A 3JV3A 2D9TA 4BI3A 2ZPBB 1PG5B 5C0MA 4PJOC 1RACB 1H3HA 1M8MA 3MCAB 3VKIA 4OP0A 2EQUA 2P0KA 4C92A 2GQVA 2RNAA 2Y4YA 4GBQA 1IZ6A 1ZSZA 1AOJA 4RTXA 2W10A 3NFCA 4WCIA 2FPFA 1Q81R 2F2VA 3EG2A 5CK9A 2KBTA 1TWBA 3CXCA 5GAN7 3I56A 4FW1A 4XTVA 4C92C 4DBRA 3S3NA 4OMLA 1VOMA 4LUEA 2LT1A 4O6JA 1SEMA 2RHIA 1ZSZC 2YT6A 4IUTA 3OYNA 1G2BA 2ZCFB 3BE3A 1JO8A 1VQOQ 4JS5A 5GAN6 1SF9A 3EFOB 1TUDA 2K3YA 2QXFA 2CP7A 5FU7B 3QSUA 3VYHB 1AZGB 1WNLA 2KGTA 1AT1B 2RN8A 1VQPT 2DXBA 2QEXT 2E5QA 1X27A 4C0DC 1MV0B 4BACA 2QTVA 4HA8A 3MPUB 2F5KA 1QW1A 3CC2Q 5FU6B 2QQAA 3CXCS 3JCMP 1BK2A 5DLOA 4PFZA 2PQWA 1X01A 4DBHA 4OMOA 1Y96A 4M77F 4P5NA 2QA4Q 3CCSQ 4KT0E 1WXTA 2RQVA 4MDWA 2ZPIB 4FYWB 4J9EA 3WVEB 3M0UA 4N4GA 5J39A 3G7ZA 5I2MA 5GJWB 1Q82U 4M78B 1KQSA 2K57A 4M78D 5GAN4 3L2RA 1ZUUA 3L2UA 3BY7A 3NTKA 1YITQ 4DEXA 5KYYB 2ZGWA 3PT9A 3CCVA 1B34B 3ZBDA 4A53A 4J83A 1C6VX 4V2SA 3OBYA 2PUKB 3TQ7P 2PVOB 4J7FA 3FJ5A 3JCMd 4MDXA 2ROLA 2JMCA 2RJCA 2DTHA 1PHTA 2DJQA 2K7AA 2MYSA 3JCMQ 2I2LA 2VXFA 4JLIA 3CMEA 4QT7A 1GFDA 4Y28E 1UECA 4LUDA 3PMTA 4RTTA 2LNVA 3DB3A 2L3PA 2RI3A 4PJOG 4LDXA 3ME9A 4C5EA 1NJIU 1KQSS 1KG1A 2E1HA 3EFOA 1PSFA 1F1BB 1YCSB 4JRPA 3TU4K 2RQUA 1W2BP 5CKHA 2EJGA 3I5SA 2MI6A 2RK2A 2ESWA 3HSBA 2YUQA 2RK1A 4IIOA 1GCQA 4C92G 4HVWA 4A4KA 2DRKA 2HBPA 2XHCA 1PKSA 2O01E 1U06A 1VQMT 5FW9A 4M75F 4M75B 1WYXA 2XI9A 5D6XA 1YJ9T 4LDUA 2VVKA 3G71A 2ZPEB 1YIJA 1S72Q 1MV3A 1GCQC 3CC2A 4E7HA 4ZGEB 1KFZA 4M78A 3LX7A 3CCSA 2P0QA 5FU6C 2ROTA 1W70A 4J9DA 3EHRA 1GFCA 3CC7T 4C0FA 1E6HA 5KYYA 1VQ8T 2LJ1A 3EG0A 3E9GA 1B34A 4A4FA 4A4GA 3J80E 2KDSA 2XIDA 2COZA 4M78C 5LJ5d 3EG3A 2I0NA 2E70A 4X9CA 5GANd 4Z8AA 1BIBA 2DL7A 1ZUYA 1ZQ1A 4RKUE 1Q82R 3RNJA 4RG2A 4PJJA 3CCEA 1YJWQ 3CMAQ 5KYWB 2LCLA 2X9HA 1NPRA 4IKFA 4HKEA 2DX1A 2EAYA 3AT1B 1O9SA 5GAMh 5GAOq 2LRQA 1GBQA 5FWCA 2CDTA 1VQ5T 3ZEHA 1VQ7T 2OI3A 2DEQA 3I5RA 4QVDA 4DBQA 2RQTA 3G4SA 3OS0A 3JCMW 4D8DA 1D1AA 3G1JA 2F69A 1VQ6Q 1M30A 3SEMA 1YJNA 4ZTJA 3BDUA 2DMOA 4E7JA 3BFMA 1QKXA 4ZGJB 2AT1B 2L3QA 4M7AD 4C5GA 1UB4A 3FLGA 3RR6A 1VQ9A 1VIFA 2ZPGB 5A0DA 5HK0A 1HSQA 1UGQB 9ATCB 3I35A 2DVJA 3VU3C 1WX6A 2NUTB 1M8VA 4ELYC 1KIKA 2D0NA 3E2UA 1SKUB 4OB2B 3GIBA 3DKMA 1E6GA 3TSZA 4DBFA 3H41A 4R0KA 2HQEA 3BDLA 3VS6A 1OOTA 1B7TA 5GMKj 3L2WA 1WJSA 2EPDA 3QO3A 5L23A 3FDRA 3QWYA 3OYYA 2QA4T 4M7DB 4B9WA 4M7DD 2EQMA 4FSSA 1D0YA 3TVTA 2DBKA 2L8DA 2R58A 4M77E 3G6EQ 3CCJA 2DRMA 1BCOA 4FIBA 3VS2A 1C0MA 2RQWA 3URGA 4X1VA 3M5AA 5A2QE 2DL5A 1FMWA 1BI1A 3FIFA 2YRDA 2HEQA 3CC4Q 5CQYA 1YITT 4LD6A 3HKSA 1DJ7B 1QP3A 4MMKA 1SHGA 3PGGA 4OMNA 4C8QE 1CKAA 1W2BA 4AMCA 3CD6T 1UGVA 1ACMB 4C0ZA 4PJLA 4BY6C 1VQLT 2WSFE 2HSPA 2CP3A 2MF2A 4E7ZA 5GMKi 4BE1A 4Z88A 2CUBA 5GAOn 1OU8A 3I9QA 4PK4A 4KGZB 3CBPA 1Q7YC 5LJ3d 1I4K1 3CMAA 1Y71A 4EMGA 3J81E 1MNEA 2EQKA 1KD1C 1SRMA 2E41A 3NTIA 1K73C 2R57A 2FB7A 5LJ5f 2CSQA 5GANf 3OBWA 4FSXA 1YHQA 4OB1B 1E7OA 4AFZC 2OTLA 4J9CA 1YP5A 2PTKA 2D8JA 5KYUB 4A4HA 5KCHA 2JN0A 5FROA 2QYZA 5D6YA 2NUTA 4ATOA 4IIMA 2CSIA 2K2VA 2LJ0A 4QVZA 3JCMg 2V8IA 4M7AC 1QVGA 4PFOA 2KK4A 2LQKA 2RB6A 2DM1A 2KNBB 2O4XA 4M7DA 2IG0A 4AFQC 1PKTA 4F7UA 2LC4A 3JCMV 3I55T 1G5VA 3A5ZB 1VUBA 3CBMA 3REAB 2RMOA 2C0TA 5CKFA 2LZ6B 4LE9A 3X26B 1H8KA 1VIEA 2ED0A 3S3OA 4M7DC 1M3AA 3QZ5B 4HCZA 3GNFB 1QKWA 2A37A 3CCUT 3MEUA 2KT1A 2PZ1A 3FRNA 2DILA 4BDZA 1D09B 4F16A 2HAXA 3RKXA 1IB8A 1QVGS 3KFVA 2QAZA 2K79A 1T0JA 2DTOA 1PNJA 3M9QA 4FYXB 4C5IA 1Q81U 4Z89A 3CCQA 3CPWA 3QYGB 5IHKA 3GNGA 4PJOF 4J9GA 3QUIA 1TXQA 2D8HA 1KHIA 2WACA 2YXYA 2DYIA 1X75C 1NE8A 1VQ6T 3I56Q 2MIOA 4ZN1A 1YI2T 1BU1A 1GBRA 1ARKA 5KYUA 3ULRB 2KROA 2GFUA 2H3JA 1UJYA 2CZ6B 4FYYB 1D0XA 3V8JA 1SSFA 5LJ5g 1N8RC 4C92F 5LJ3f 4J5YA 5GANg 1GRIA 2DNUA 1WGSA 5IAYA 2D6FA 1FWZA 3LW5E 2X4WA 2FZKB 1VQKT 1K76A 3CPWS 2FRWA 4HXJA 5AT1B 2BZ8A 5IH2A 1UUEA 1I81A 1R0BG 2JTMA 5GAOl 2JM9A 1ZBXA 1K1ZA 5D6WA 4DQ2A 1GL5A 1IGUA 3TEEA 3VRZA 2HNIA 3RUXA 2AKKA 2EW3A 4RMOA 4JRKA 4M7AG 4N0AA 5DY9A 4MZMA 2KYMA 8ATCB 2DKGA 2YSQA 4F17A 4ZTFA 1R8OB 4N0AC 4GY5A 2J6OA 2C06A 1UGRB 5GAMe 2EGAA 3MP6A 2XK0A 3FJPA 1VQPA 2DETA 2L2PA 4M7DG 4MZTA 1H641 4F7UG 1RADB 3QJ6A 5IXFA 3QXEB 1JRIA 1QWFA 3L2ZA 1C1AA 2IVWA 3CMEQ 2V1QA 1AEYA 1OZ3A 1WFWA 2JVVA 3E1SA 2B8AA 2OTJA 3U23A 2DL8A 2HQXA 3PE0A 5EG2A 3S6WA 1PCXA 3J7AF 4AG2C 2WSCE 2EJFA 4RTYA 4JPBW 2K2MA 1LPLA 3M0QA 1LJOA 4L5GA 4ANJA 2X35A 4J9HA 2LJ3A 2JXBA 2RJEA 2DJZA 1K8AC 1QWEA 2RHZA 1BI2A 5LJ3g 2DZCA 2XKOC 2F5TX 1KJWA 3A98A 2B86A 3QHSA 1AWOA 3F70A 2DPPB 1AWJA 4IURA 1KHCA 3H0FA 1BB9A 1BI0A 2JJ9A 2RA2A 2P0PA 4IUUA 2YDLA 2YUNA 2RHYA 1P92A 5A0GA 3G71Q 1YIJQ 2DYBA 2HSEB 3CCRT 2BUDA 3Q1JA 2LQ8A 1K0XA 3CCMT 1WI7A 2A36A 1WZOA 2V8JA 2H3EB 3THKA 3OMCA 3PIOA 3RKWA 2FPDA 3OY9A 4JRQA 2QDYB 4M77B 3VUBA 3JCMb 1WJQA 3C12A 1YCYA 2A7YA 2RJDA 2LCSA 2FHDA 2EIFA 2RD1A 3TREA 2K3BA 3CPFA 1VYVA 3CCLT 2GBQA 4PJNA 1W6XA 3HFNA 2P4RA 3A8HB 4C8QF 2CP0A 1QVFS 1QCNA 1UGPB 3JRZA 1XNIA 2M0OA 4OMQA 3QYHB 2MPXC 1YJ9A 3CCEQ 5DLQE 1AHJB 3INZA 2QG9B 1WHJA 4PJOE 5CKBA 1HD3A 4NL2A 2VUBA 1MMGA 3O8VA 4KUIA 2YUOA 1WXUA 1JB0E 2EBPA 3OQ5A 2M02A 3G4SQ 3QDFA 1OEBA 1QLYA 2YLCA 1XOVA 1OV3A 3OYKA 3MEWA 1JJ2S 2J05A 2LTOA 2DVEA 1VQ8A 1XTDA 4CC4B 1YJNQ 1M90C 2GTJA 2VV5A 5GMKm 4KGVB 3PNWC 4C92E 2AIRB 1NLPC 1Q7YR 1VQ9Q 4XAXB 1V1CA 2DO3A 1KD1R 4JZ4A 3QIIA 4JJNK 2J6KA 1K73R 4ZNXA 2PNIA 1FX7A 2O9SA 2HL5C 1HXDA 1X43A 1SHFA 4HCBA 1VQNT 2BTTA 2KRMA 4NOYA 3PVQA 1VQ5A 2QQRA 3M53A 3OYCA 3NGPA 4RUGA 1AZEA 1VQ7A 4VUBA 2KQWA 4UC4A 4F14A 1MMNA 1X6BA 1VQ4T 2LVMA 4IUPA 1M1KC 5CKDA 5M9OA 3SHWA 1T3SA 4J9IA 4M75D 3CCJQ 3TCJA 5FU7C 3MHXA 4M77A 5KE3A 2X3XD 1YFNA 5GAN3 1Y57A 4TVRA 3M0TA 1YN8A 4HCKA 2D0QB 1Z9QA 5GMKl 2GTOA 2EGEA 3CCVT 4E7KA 2JS0A 1MGQA 2IIMA 1I8FA 2CT4A 4E7SA 4E2FB 1ABQA 3PMIA 2QASA 3V7SA 1OULA 1JXOA 5LJ5h 1X6OA 2FO0A 3DLLA 5GANh 2K5IA 2DFUA 2HZYA 3QWXX 1BCMA 5CCAA 1EX4A 1QVGP 2YRVA 3PVLA 4XTWA 4QQGA 4FL6A 5AYFA 3CMET 3L1AA 5J3BA 4BE2A 2J06A 2RQRA 1NLOC 1K9MC 4IUVA 2DERA 1RAHB 3M57A 3OYDA 3H9NA 3UWNA 1VA7A 4RCBA 4FT4A 3EFSA 3L2QA 1YNZA 2VYTA 1R77A 3M56A 5ECAA 7AT1B 1T3LA 3RERA 4XU3A 1YHQQ 2V26A 1ZHIA 5KH6A 2OTLQ 1HYOA 3SDZA 1VQOT 3CD6A 4D6WA 1VQLA 1T0HA 1KC8C 3EGXB 3REBB 3JCMf 1X69A 4ME7A 4XU1A 2FL7A 2HKQB 3R6OA 3QBYA 1NEGA 3GBQA 3A8MB 1NBEB 3MKDA 3EH2A 4M75A 4M7AF 3CPWP 3JB9F 3CC2T 3OYAA 1VYTA 1N8RR 3CCST 3A8LB 3EG9B 3VUZA 2YLBA 5GAMj 1Q86C 4ZGDB 4JUVA 2CKKA 2EYWA 5FWBA 4M75C 1RAFB 4RTUA 2K5LA 4RTVA 4ZN3A 2KI7A 2FYKA 5IHNA 3HL8A 5I2SA 4RTWA 1OYXA 2NWMA 4JZ3A 2C0OA 3SWNB 2ZPHB 1ZSGA 4ESRA 3OYLA 3DB4A 2JTFA 3I55A 5KYWA 3CCQQ 5GAOr 2M0YA 5LJ3h 4EMKB 1QQJA 3JAME 3HRUA 5CAIA 2JUFA 3OB9A 1UTIA 4KULA 4L6V5 2O31A 1D3BB 1U3OA 3KXTA 1D1BA 1Z9ZA 4AFSC 1HJDA 3V8LA 1XJWB 4OGEA 2MAMA 5C6SA 2ZPFB 4JJBA 2COYA 3VS3A 3OYEA 1N9RA 1CSKA 2PVGB 2DTIA 4M78G 2VC8A 1N6AA 2FZGB 1LCKA 4FU6A 4A63B 1AD5A 4J6WA 3EGXA 4PLLA 1PWTA 2DK3A 1UG1A 2XDPA 3ER0A 2FRYA 3KBGA 2Y90A 4LDYA 3RESA 1RAGB 4HT9A 3GP8A 1M2OA 4PL6A 2EYXA 1X2KA 3OS2A 4RG8A 1M1FA 1WHHA 3ZFJA 3MP1A 5KCOA 4CRIA 3C94A 3OYIA 1RAAB 2P4TA 3X25B 1IXDA 4KBMB 3LGFA 2BZXA 4RTZA 3EGDB 2XDDA 1YI2A 1S72T 3EG9A 3OS5A 3TSWA 3HRTA 3META 2RF0A 4OMMA 2RI5A 2EFIA 2A28A 3QPHA 1IHWA 4BD3A 2PU9B 1K8AR 2QK0A 4Q5WA 2CREA 1WQ7A 2VASA 3EHQA 1BKBA 2LMJA 4X9DA 2LDMA 2VXEA 1UGSB 2YRCA 5FRMA 2SEMA 4D8KA 2OX7A 4QQ6A 3OW2S 5DM7R 2GNCA
chains in the Genus database with same CATH topology
2FEIA 5IXFA 2L3PA 2FG0A 2OAWA 1AWXA 1QWFA 2SRCA 4GLMA 4CC7A 1J3TA 2DL3A 2V1QA 1AEYA 2H8HA 1WFWA 2F2WA 1M27C 3U23A 2C0IA 2DL8A 3PE0A 1YCSB 2EGCA 2RQUA 1WA7A 3NHNA 3C0CA 4M4ZA 4AG2C 4RTYA 4JPBW 2K2MA 3I5SA 3M0QA 4AG1C 2ESWA 2YUQA 1SSHA 4IIOA 1GCQA 1WIEA 3R6NA 4HVWA 2NUZA 2DRKA 2A08A 1PKSA 4J9HA 2G6FX 1U06A 2LJ3A 1G83A 1UHFA 1WLPB 2JXBA 5FW9A 3UA6A 1QWEA 1WYXA 2VWFA 2VVKA 3VRYA 2CT3A 3A98A 1KJWA 2B86A 1AWOA 1MV3A 1NG2A 1GCQC 1AWJA 2JW4A 3H0FA 1BB9A 1NM7A 1KFZA 2YDLA 2YUNA 1RLQC 2KRNA 2AZSA 5HCKA 2ROTA 1W70A 4J9DA 2DYBA 1B07A 3EHRA 1GFCA 1K0XA 1E6HA 2LNHB 2LJ1A 1I07A 3EG0A 1NEBA 1WI7A 1ZLMA 2A36A 2J7IA 3THKA 2FPDA 1N5ZA 5EC7A 1K9AA 1PRLC 2CH4A 3EG3A 2I0NA 5I11A 4Z8AA 1NYGA 2DL7A 1ZUYA 1W1FA 3RNJA 1RI9A 2E5KA 1I0CA 3M0RA 1H92A 2LCSA 1KSWA 2KXDA 3NMZC 2K3BA 2W0ZA 1VYVA 2DX1A 2GBQA 2KRSA 2O9VA 1W6XA 1M3CA 2V1RA 2P4RA 1GBQA 5FWCA 4DEYA 2CDTA 4J9BA 2O88A 2OI3A 4OMQA 3I5RA 2RQTA 1HD3A 4E6RA 4D8DA 3NPFA 3M0PA 1M30A 3SEMA 2YUOA 1WXUA 2DMOA 2XMFA 2CUDA 2EBPA 1UJ0A 1QKXA 2DBMA 1OPLA 2O2OA 4LNPA 2L3QA 2F2XA 3H0IA 1OEBA 1OPKA 1QLYA 1XOVA 1OV3A 2GQIA 2J05A 1HSQA 2K6DA 3I35A 2DVJA 4CC4B 1TG0A 2GTJA 2HCKA 4OMPA 1WX6A 2HBWA 1SRLA 2RPNA 4LN2A 1KIKA 2JMAA 2D0NA 4HVVA 1NLPC 2KXCA 1E6GA 3TSZA 3H41A 4R0KA 1V1CA 1OOTA 3VS6A 4JJCA 4ORZA 2EPDA 4JZ4A 5L23A 2JT4A 5IXBA 3QWYA 1RUWA 2J6KA 4ZNXA 2PNIA 4EIKA 4FSSA 3TVTA 2O9SA 2OJ2A 2DBKA 1X43A 2J6FA 1SHFA 2DRMA 2BTTA 2KRMA 1M3BA 3PVQA 3VS2A 1AZEA 2RQWA 4HVUA 3NGPA 4RUGA 4X1VA 1UHCA 1B3QA 4F14A 2DL5A 1X6BA 1JU5C 2HEQA 1GCPA 2ENMA 3SHWA 1T3SA 4J9IA 3UATA 3VS7A 2X3XD 1SHGA 2K9GA 4OMNA 2DA9A 1NYFA 1FMKA 1CKAA 1Y57A 3RBBB 1UGVA 3M0TA 1YN8A 4HCKA 4JJDA 1Z9QA 2AK5A 1RLPC 2ABLA 2GTOA 2LP5A 1WXBA 2HSPA 2EGEA 2JS0A 2IIMA 2DE0X 3IQLA 4Z88A 2CT4A 4K11A 1ABQA 2CUBA 3I9QA 3O5ZA 1UDLA 1JXOA 1BBZA 2FO0A 2MOXA 1JXMA 3QWXX 3H0HA 2EKHA 1SRMA 3VS4A 1CKBA 2L3SA 3PVLA 2CH4W 1PRMC 2ED1A 2J06A 2RQRA 2CSQA 5I22A 1NLOC 2EQIA 1ABOA 2JM8A 1SPKA 1E7OA 4AFZC 3ZL7C 1VA7A 4J9CA 1YP5A 2PTKA 1JEGA 3M0SA 2MCNA 2D8JA 1YNZA 2KR3A 1U5SA 1TUCA 5ECAA 1K0SA 1YWOA 1T3LA 4IIMA 3VS1A 1IO6A 2HDAA 2DLPA 2FPEA 2CSIA 2LJ0A 1QCFA 1UFFA 2DM1A 2KNBB 2GGRA 2LQNA 1T0HA 2X3WD 3REBB 2VKNA 1X69A 1WDXA 2LQWA 4AFQC 1PKTA 1MUZA 2KT8A 3EGUA 4CC3A 3REAB 2ECZA 2RMOA 2C0TA 2QDLA 1NEGA 3GBQA 2LX7A 2LZ6B 3VS0A 4LE9A 1H8KA 2ED0A 3JV3A 1M3AA 1X2QA 1X6GA 1QKWA 3LH5A 2A37A 1VYTA 2KE9A 1H3HA 2KT1A 1M8MA 2PZ1A 2DILA 4F16A 1Y0MA 2EYWA 5FWBA 2RNAA 3KFVA 1K4US 5IHIA 4GBQA 4RTUA 4RTVA 5IHNA 2K79A 1AOJA 2W10A 1T0JA 2KEAA 2AKLA 4RTXA 5GJVB 4WCIA 1S1NA 2FPFA 2F2VA 3EG2A 1PNJA 2JTEA 2KBTA 4RTWA 4Z89A 2DL4A 2NWMA 1AWWA 4JZ3A 2C0OA 5IHKA 1AVZC 4J9GA 4OMLA 4LUEA 2D8HA 1ZSGA 4ESRA 1SEMA 1I1JA 2YT6A 4CC2A 1G2BA 1JO8A 2MIOA 2M0YA 1BU1A 1UTIA 1GBRA 1ARKA 1TUDA 3ULRB 2KROA 1UE9A 1UJYA 2O31A 1U3OA 1Z9ZA 3CQTA 1FYNA 1VYUA 4AFSC 2M51A 1HJDA 1JQQA 1AZGB 4JJBA 1GRIA 2KGTA 1ZUKA 2DNUA 3VS3A 1CSKA 2RN8A 4J9FA 1X27A 1MV0B 4Y92A 1LCKA 4A63B 1AD5A 1PWTA 1UG1A 1K76A 1BK2A 2D1XA 2FRYA 2BZYA 2FRWA 4OMOA 4HXJA 3UA7A 2BZ8A 1WXTA 2RQVA 5IH2A 1UUEA 4J9EA 2EYXA 2JM9A 1X2KA 4KRTA 3M0UA 1K1ZA 2EYZA 5GJWB 1GL5A 1EFNA 2AZVA 3VRZA 2KYBA 2AKKA 1ZUUA 1ZBJA 2EW3A 2BZXA 4RTZA 3VS5A 4AFUC 4DEXA 3EG1A 2EYYA 2KYMA 3TSWA 2YSQA 2RF0A 4OMMA 3UF4A 4F17A 2DF6A 2A28A 1YWPA 3FJ5A 1ZX6A 2CREA 2ROLA 2JMCA 2YUPA 3EHQA 2J6OA 2LMJA 2L0AA 2K7AA 1PHTA 2DJQA 2EGAA 2SEMA 4QT7A 4D8KA 1GFDA 1UECA 2L2PA 4LUDA 1A0NB 4RTTA 2JS2A 2GNCA 2EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEI A;  5IXF A;  2L3P A;  2FG0 A;  2OAW A;  1AWX A;  1QWF A;  2SRC A;  4GLM A;  4CC7 A;  1J3T A;  2DL3 A;  2V1Q A;  1AEY A;  2H8H A;  1WFW A;  2F2W A;  1M27 C;  3U23 A;  2C0I A;  2DL8 A;  3PE0 A;  1YCS B;  2EGC A;  2RQU A;  1WA7 A;  3NHN A;  3C0C A;  4M4Z A;  4AG2 C;  4RTY A;  4JPB W;  2K2M A;  3I5S A;  3M0Q A;  4AG1 C;  2ESW A;  2YUQ A;  1SSH A;  4IIO A;  1GCQ A;  1WIE A;  3R6N A;  4HVW A;  2NUZ A;  2DRK A;  2A08 A;  1PKS A;  4J9H A;  2G6F X;  1U06 A;  2LJ3 A;  1G83 A;  1UHF A;  1WLP B;  2JXB A;  5FW9 A;  3UA6 A;  1QWE A;  1WYX A;  2VWF A;  2VVK A;  3VRY A;  2CT3 A;  3A98 A;  1KJW A;  2B86 A;  1AWO A;  1MV3 A;  1NG2 A;  1GCQ C;  1AWJ A;  2JW4 A;  3H0F A;  1BB9 A;  1NM7 A;  1KFZ A;  2YDL A;  2YUN A;  1RLQ C;  2KRN A;  2AZS A;  5HCK A;  2ROT A;  1W70 A;  4J9D A;  2DYB A;  1B07 A;  3EHR A;  1GFC A;  1K0X A;  1E6H A;  2LNH B;  2LJ1 A;  1I07 A;  3EG0 A;  1NEB A;  1WI7 A;  1ZLM A;  2A36 A;  2J7I A;  3THK A;  2FPD A;  1N5Z A;  5EC7 A;  1K9A A;  1PRL C;  2CH4 A;  3EG3 A;  2I0N A;  5I11 A;  4Z8A A;  1NYG A;  2DL7 A;  1ZUY A;  1W1F A;  3RNJ A;  1RI9 A;  2E5K A;  1I0C A;  3M0R A;  1H92 A;  2LCS A;  1KSW A;  2KXD A;  3NMZ C;  2K3B A;  2W0Z A;  1VYV A;  2DX1 A;  2GBQ A;  2KRS A;  2O9V A;  1W6X A;  1M3C A;  2V1R A;  2P4R A;  1GBQ A;  5FWC A;  4DEY A;  2CDT A;  4J9B A;  2O88 A;  2OI3 A;  4OMQ A;  3I5R A;  2RQT A;  1HD3 A;  4E6R A;  4D8D A;  3NPF A;  3M0P A;  1M30 A;  3SEM A;  2YUO A;  1WXU A;  2DMO A;  2XMF A;  2CUD A;  2EBP A;  1UJ0 A;  1QKX A;  2DBM A;  1OPL A;  2O2O A;  4LNP A;  2L3Q A;  2F2X A;  3H0I A;  1OEB A;  1OPK A;  1QLY A;  1XOV A;  1OV3 A;  2GQI A;  2J05 A;  1HSQ A;  2K6D A;  3I35 A;  2DVJ A;  4CC4 B;  1TG0 A;  2GTJ A;  2HCK A;  4OMP A;  1WX6 A;  2HBW A;  1SRL A;  2RPN A;  4LN2 A;  1KIK A;  2JMA A;  2D0N A;  4HVV A;  1NLP C;  2KXC A;  1E6G A;  3TSZ A;  3H41 A;  4R0K A;  1V1C A;  1OOT A;  3VS6 A;  4JJC A;  4ORZ A;  2EPD A;  4JZ4 A;  5L23 A;  2JT4 A;  5IXB A;  3QWY A;  1RUW A;  2J6K A;  4ZNX A;  2PNI A;  4EIK A;  4FSS A;  3TVT A;  2O9S A;  2OJ2 A;  2DBK A;  1X43 A;  2J6F A;  1SHF A;  2DRM A;  2BTT A;  2KRM A;  1M3B A;  3PVQ A;  3VS2 A;  1AZE A;  2RQW A;  4HVU A;  3NGP A;  4RUG A;  4X1V A;  1UHC A;  1B3Q A;  4F14 A;  2DL5 A;  1X6B A;  1JU5 C;  2HEQ A;  1GCP A;  2ENM A;  3SHW A;  1T3S A;  4J9I A;  3UAT A;  3VS7 A;  2X3X D;  1SHG A;  2K9G A;  4OMN A;  2DA9 A;  1NYF A;  1FMK A;  1CKA A;  1Y57 A;  3RBB B;  1UGV A;  3M0T A;  1YN8 A;  4HCK A;  4JJD A;  1Z9Q A;  2AK5 A;  1RLP C;  2ABL A;  2GTO A;  2LP5 A;  1WXB A;  2HSP A;  2EGE A;  2JS0 A;  2IIM A;  2DE0 X;  3IQL A;  4Z88 A;  2CT4 A;  4K11 A;  1ABQ A;  2CUB A;  3I9Q A;  3O5Z A;  1UDL A;  1JXO A;  1BBZ A;  2FO0 A;  2MOX A;  1JXM A;  3QWX X;  3H0H A;  2EKH A;  1SRM A;  3VS4 A;  1CKB A;  2L3S A;  3PVL A;  2CH4 W;  1PRM C;  2ED1 A;  2J06 A;  2RQR A;  2CSQ A;  5I22 A;  1NLO C;  2EQI A;  1ABO A;  2JM8 A;  1SPK A;  1E7O A;  4AFZ C;  3ZL7 C;  1VA7 A;  4J9C A;  1YP5 A;  2PTK A;  1JEG A;  3M0S A;  2MCN A;  2D8J A;  1YNZ A;  2KR3 A;  1U5S A;  1TUC A;  5ECA A;  1K0S A;  1YWO A;  1T3L A;  4IIM A;  3VS1 A;  1IO6 A;  2HDA A;  2DLP A;  2FPE A;  2CSI A;  2LJ0 A;  1QCF A;  1UFF A;  2DM1 A;  2KNB B;  2GGR A;  2LQN A;  1T0H A;  2X3W D;  3REB B;  2VKN A;  1X69 A;  1WDX A;  2LQW A;  4AFQ C;  1PKT A;  1MUZ A;  2KT8 A;  3EGU A;  4CC3 A;  3REA B;  2ECZ A;  2RMO A;  2C0T A;  2QDL A;  1NEG A;  3GBQ A;  2LX7 A;  2LZ6 B;  3VS0 A;  4LE9 A;  1H8K A;  2ED0 A;  3JV3 A;  1M3A A;  1X2Q A;  1X6G A;  1QKW A;  3LH5 A;  2A37 A;  1VYT A;  2KE9 A;  1H3H A;  2KT1 A;  1M8M A;  2PZ1 A;  2DIL A;  4F16 A;  1Y0M A;  2EYW A;  5FWB A;  2RNA A;  3KFV A;  1K4U S;  5IHI A;  4GBQ A;  4RTU A;  4RTV A;  5IHN A;  2K79 A;  1AOJ A;  2W10 A;  1T0J A;  2KEA A;  2AKL A;  4RTX A;  5GJV B;  4WCI A;  1S1N A;  2FPF A;  2F2V A;  3EG2 A;  1PNJ A;  2JTE A;  2KBT A;  4RTW A;  4Z89 A;  2DL4 A;  2NWM A;  1AWW A;  4JZ3 A;  2C0O A;  5IHK A;  1AVZ C;  4J9G A;  4OML A;  4LUE A;  2D8H A;  1ZSG A;  4ESR A;  1SEM A;  1I1J A;  2YT6 A;  4CC2 A;  1G2B A;  1JO8 A;  2MIO A;  2M0Y A;  1BU1 A;  1UTI A;  1GBR A;  1ARK A;  1TUD A;  3ULR B;  2KRO A;  1UE9 A;  1UJY A;  2O31 A;  1U3O A;  1Z9Z A;  3CQT A;  1FYN A;  1VYU A;  4AFS C;  2M51 A;  1HJD A;  1JQQ A;  1AZG B;  4JJB A;  1GRI A;  2KGT A;  1ZUK A;  2DNU A;  3VS3 A;  1CSK A;  2RN8 A;  4J9F A;  1X27 A;  1MV0 B;  4Y92 A;  1LCK A;  4A63 B;  1AD5 A;  1PWT A;  1UG1 A;  1K76 A;  1BK2 A;  2D1X A;  2FRY A;  2BZY A;  2FRW A;  4OMO A;  4HXJ A;  3UA7 A;  2BZ8 A;  1WXT A;  2RQV A;  5IH2 A;  1UUE A;  4J9E A;  2EYX A;  2JM9 A;  1X2K A;  4KRT A;  3M0U A;  1K1Z A;  2EYZ A;  5GJW B;  1GL5 A;  1EFN A;  2AZV A;  3VRZ A;  2KYB A;  2AKK A;  1ZUU A;  1ZBJ A;  2EW3 A;  2BZX A;  4RTZ A;  3VS5 A;  4AFU C;  4DEX A;  3EG1 A;  2EYY A;  2KYM A;  3TSW A;  2YSQ A;  2RF0 A;  4OMM A;  3UF4 A;  4F17 A;  2DF6 A;  2A28 A;  1YWP A;  3FJ5 A;  1ZX6 A;  2CRE A;  2ROL A;  2JMC A;  2YUP A;  3EHQ A;  2J6O A;  2LMJ A;  2L0A A;  2K7A A;  1PHT A;  2DJQ A;  2EGA A;  2SEM A;  4QT7 A;  4D8K A;  1GFD A;  1UEC A;  2L2P A;  4LUD A;  1A0N B;  4RTT A;  2JS2 A;  2GNC A;  2EVR A; 
#chains in the Genus database with same CATH topology
 2KAF A;  1KK7 A;  1VQK A;  3UDC A;  4BUG A;  4LXC A;  2OAW A;  2L3R A;  4JLG A;  1VQP Q;  3EH1 A;  3V7R A;  4LD9 K;  4EMK A;  2H8H A;  1YJW T;  1G3T A;  3CMA T;  1Q82 C;  1EZZ B;  4M75 G;  1D3B A;  2PUO B;  2EGC A;  1QVF P;  4QW2 A;  1WA7 A;  3NHN A;  3C0C A;  4M4Z A;  5GAO m;  3OMG A;  4OB0 B;  1N27 A;  4PJO B;  4EMK C;  2OTJ Q;  1WIE A;  3MJX A;  3R6N A;  3MO8 A;  2OTL T;  3GF5 A;  2G6F X;  3SFM A;  1G83 A;  5IT9 E;  1UHF A;  3UA6 A;  2QI2 A;  5CR2 A;  5GAN 2;  1LOJ A;  1OI1 A;  4JRI A;  2VWF A;  5FLX E;  2RM4 A;  1JJ2 P;  4J6Y A;  2CT3 A;  1RAE B;  1PC0 A;  3A8O B;  3A8G B;  4C0G A;  3RKY A;  1BIA A;  2EKO A;  1NM7 A;  4C92 B;  1WPY A;  2KRN A;  1G3Y A;  2AZS A;  2E10 A;  4IUQ A;  5HCK A;  1NJI C;  4C5H A;  3EGD A;  4BI8 B;  2LNH B;  1BI3 A;  4M7A E;  1M90 R;  2JZ2 A;  2EJ9 A;  2E3I A;  5EC7 A;  2CH4 A;  1OX8 A;  2KSS A;  3G6E T;  4RCC A;  3OSS C;  1W1F A;  4PJM A;  1WHG A;  2E5K A;  1I0C A;  4OB3 B;  3M0R A;  4XU0 A;  1H92 A;  5CKE A;  3QG1 A;  3VJP A;  2DXU A;  2KXD A;  2W0Z A;  5GAN e;  3CC4 T;  1V76 A;  2V1R A;  4DEY A;  4M7D E;  4J9B A;  2BE9 B;  2DIQ A;  4F7U E;  3RMQ A;  4XK8 E;  3E9F A;  3NPF A;  1M1K R;  3M0P A;  3PTA A;  2DD5 A;  2QQ9 A;  4XTZ A;  1M1G A;  1YJ9 Q;  1UJ0 A;  2LX9 A;  2QEX A;  3CCR A;  2O2O A;  2X4X A;  1U8R A;  3H0I A;  1OPK A;  1ZA1 B;  2GQI A;  1Y96 B;  2ATC B;  1IRE B;  2NUP B;  3CCM A;  2HCK A;  1TH7 A;  5HKC A;  2HBW A;  3MEV A;  3AHU A;  4LN2 A;  2JMA A;  2KXC A;  4HCC A;  5CQX A;  1G3S A;  5FRN A;  1Q7Y U;  3CC7 Q;  1IHV A;  1VQ8 Q;  4JJC A;  4ORZ A;  1TS9 A;  3X28 B;  4FM4 B;  5IXB A;  1KD1 U;  1RUW A;  2V8K A;  3NTH A;  4EIK A;  3M4Y A;  1K73 U;  3CCL A;  3X24 B;  2OJ2 A;  3S3M A;  2J6F A;  4PFP A;  1K9M R;  3RDV A;  1MMD A;  1M3B A;  2L89 A;  2CGH A;  4HVU A;  1B3Q A;  4FYV B;  3MEA A;  3OYH A;  5KE2 A;  2BKD N;  1RL2 A;  2M1H A;  2KMT A;  3HTR A;  4J7I A;  1W4S A;  1G3W A;  3UAT A;  2NYS A;  3N5B B;  3M55 A;  1VQ5 Q;  4GLK A;  3VS7 A;  3HPW A;  5D7U A;  1VQ7 Q;  1YBY A;  3HP9 A;  2K9G A;  1QVF A;  1FMK A;  1PD1 A;  2JNG A;  5CO7 A;  3LLR A;  4JJD A;  2AK5 A;  2HD0 A;  4ELZ C;  1KC8 R;  1KQ1 A;  2COW A;  3IQL A;  4DOV A;  3O5Z A;  2QGG A;  1WHM A;  3L2V A;  2EKH A;  1JJ2 A;  4M77 D;  1QP2 A;  3VS4 A;  1TTH B;  3A1P A;  3OYM A;  1O75 A;  5LJ3 e;  1PRM C;  4BI4 A;  3LWH A;  1RI0 A;  2ED1 A;  1VQN A;  3V8K A;  5I22 A;  2YHT A;  2JM8 A;  1SG5 A;  2A0F B;  1JEG A;  3EAE A;  2EWN A;  1Q86 R;  3M58 A;  1VQ4 A;  1VQM A;  2NUP A;  5LL6 S;  4C8Q B;  1K0S A;  1YWO A;  3JCM h;  4C8Q D;  3OYG A;  3VS1 A;  4O5V A;  2OTJ T;  4M78 F;  1IO6 A;  3SD4 A;  3OYB A;  4WF2 A;  1OQK A;  1QCF A;  4L59 A;  2X4Y A;  3I56 T;  1NPP A;  1UFF A;  2K5F A;  2QGF B;  2X3W D;  1WDX A;  4A4E A;  3EGU A;  1MUZ A;  4BDY A;  4CC3 A;  2E12 A;  3CC7 A;  5KYX B;  4B6M A;  3QDR B;  3P8D A;  3CD6 Q;  2ECZ A;  3MP8 A;  3RIR A;  1VQL Q;  2QDL A;  2RJF A;  1Q95 G;  3VS0 A;  4HT8 A;  2CZ0 B;  1X2Q A;  1X6G A;  3LH5 A;  2QTX A;  2E6Z A;  2HL3 A;  2MK5 A;  2KE9 A;  2LCC A;  1N8R U;  4E7I A;  2GF7 A;  2YWW A;  3C4S A;  1Y0M A;  2CYZ B;  2CZ7 B;  1MHN A;  3GPL A;  3CBO A;  1K4U S;  4YTL A;  5IHI A;  5HK3 A;  1BYM A;  3OSV A;  5GJV B;  2AKL A;  2KEA A;  2KY9 A;  4DOW A;  3GOX A;  5CVI A;  1S1N A;  2JTE A;  1U1T A;  3JCM c;  2DL4 A;  1AWW A;  1VQO A;  1I5O B;  3X20 B;  4N4H A;  2XU8 A;  1AVZ C;  3C95 A;  3CEY A;  4R55 A;  3HRS A;  2CZ1 B;  1I1J A;  1M5Q 1;  1QVP A;  1PM3 A;  4CC2 A;  3FC3 A;  3PFS A;  3WVD B;  4OVA A;  3OW2 P;  2FVU A;  4M77 C;  1UE9 A;  1EIF A;  2VGM A;  5GAN 8;  3FEO A;  3CQT A;  4C8Q A;  1FYN A;  3I55 Q;  1VYU A;  2M51 A;  1JQQ A;  2ZAE A;  1ZUK A;  2QA4 A;  1H3Z A;  4J9F A;  2E65 A;  3PIP A;  4Y92 A;  3SB2 A;  4XTU A;  4BY6 B;  4WTO B;  1GXI E;  2HKN A;  4C8Q C;  3CCU Q;  4XQ3 A;  2E6N A;  2D1X A;  1LNX A;  2BZY A;  3UA7 A;  1Q81 C;  5KYX A;  3VYG A;  2DEU A;  1WHL A;  2E4H A;  2RO0 A;  1TU0 B;  1YIT A;  4KRT A;  2EYZ A;  5CIU A;  1PD0 A;  4Z02 A;  5L8R E;  1LVK A;  4OGC A;  2MMP A;  4Y91 A;  4N4I A;  5GMK h;  1EFN A;  2AZV A;  4OF1 A;  2KYB A;  3HHT B;  2CS7 A;  2G3R A;  1ZBJ A;  2KVQ G;  4NS5 A;  3VS5 A;  4AFU C;  2L5Q A;  3EG1 A;  4FCY A;  2EYY A;  4PNO A;  1TSF A;  1I5L A;  2WSE E;  5LJ5 j;  5GAM d;  3UF4 A;  2DXC A;  5GAN j;  2DF6 A;  1FXX A;  1YWP A;  2DXT A;  2VGN A;  3VV0 A;  4MML A;  1ZX6 A;  3EFR A;  3G71 T;  1YIJ T;  1K8A U;  1YI2 Q;  3T9N A;  2YUP A;  2L0A A;  2ZZD A;  4M7A B;  1MND A;  3M59 A;  2RH2 A;  2CP6 A;  3OS1 A;  3JB9 D;  4OMF B;  1A0N B;  2JS2 A;  4CC7 A;  2EVR A;  2FEI A;  3H6Z A;  3GLX A;  1M2V B;  1TUG B;  5IN1 A;  2FG0 A;  1Y07 A;  2Y4X A;  1AWX A;  1NJI R;  1D0Z A;  2SRC A;  1OX9 A;  4GLM A;  1QCO A;  1N9S A;  2DAQ A;  1NZ9 A;  1J3T A;  2DL3 A;  3L42 A;  2XIC A;  5GAN 5;  2F2W A;  1M27 C;  1G8X A;  1MMA A;  2C0I A;  1VQK Q;  2O4X B;  4M7D F;  1RAB B;  4F7U F;  4MZP A;  4F7U B;  2XD0 A;  3JCM X;  4AG1 C;  2F1L A;  3CCE T;  1SSH A;  3QZ9 B;  3DLM A;  1S72 A;  4LDV A;  1KQ2 A;  2P84 A;  2Z0W A;  2NUZ A;  2A08 A;  1IGQ A;  3LGL A;  2IPO B;  8AT1 B;  4M78 E;  3OYJ A;  1WLP B;  4KUD K;  3VRY A;  2K3X A;  3G4S T;  2HQH A;  2BE7 D;  1NG2 A;  1V29 B;  4M77 G;  2JW4 A;  2MWP A;  1OZ2 A;  2R5A A;  5J26 A;  1YJN T;  3CCU A;  1PSE A;  2GCX A;  1RLQ C;  4BB7 A;  4EPC A;  4EMH A;  1B07 A;  2FZC B;  1VQ9 T;  2MWO A;  1I07 A;  1D1C A;  1WJR A;  1NEB A;  1ZLM A;  2J7I A;  1YJW A;  4EDU A;  3QJY A;  1HK9 A;  3UPU A;  1M90 U;  1N5Z A;  3OW2 A;  4E47 A;  4XU2 A;  1K9A A;  1PRL C;  4C8Q G;  5I11 A;  3E19 A;  4X34 A;  3P8B B;  1NYG A;  2DZ9 A;  1RI9 A;  4J6X A;  1R0C B;  3HFO A;  1KSW A;  3WXM B;  4A54 A;  4M7A A;  3NMZ C;  3V7C A;  2R5M A;  2KRS A;  2O9V A;  3CCJ T;  2A3L A;  5LJ3 j;  1VQ6 A;  1M3C A;  1XQH A;  2X4J A;  1M2V A;  1FMV A;  2O88 A;  4JS4 A;  3M4G A;  1W2B S;  1JBM A;  4BE0 A;  2EQJ A;  4E6R A;  2E3H A;  5HY6 A;  3JCM J;  1M4Z A;  5GAM f;  1M1K U;  2XDB A;  4R56 A;  2XMF A;  2CUD A;  4M75 E;  1WQW A;  2DBM A;  1OPL A;  4LNP A;  2F2X A;  3SWN A;  2K4Y A;  3JCM e;  2K6D A;  1UEB A;  1TG0 A;  2M16 A;  4OMP A;  1SRL A;  2RPN A;  3LWI A;  2QQS A;  4KH1 B;  2QEX Q;  2OAU A;  4HVV A;  2EYQ A;  3CCR Q;  3G6E A;  3CXC P;  4NL3 A;  3M54 A;  1QMC A;  3SWN C;  3JSC A;  3CCM Q;  3JB9 H;  2JT4 A;  3UT1 A;  3CC4 A;  2CP2 A;  1YHQ T;  4PJO D;  5A0L A;  1K9M U;  2NLU A;  1ZA2 B;  4PKC C;  1IRX A;  1UHC A;  2VB6 A;  1JU5 C;  1RAI B;  2E64 A;  4CI0 C;  1Y7X A;  4QKU A;  4XTX A;  1GCP A;  2ENM A;  3CCL Q;  4QVC A;  4F04 B;  2X51 A;  5I21 A;  2RI2 A;  4PLI A;  4QQD A;  3ASK A;  4DA4 A;  2PVD B;  2DA9 A;  1NYF A;  3RBB B;  1U1S A;  4B9X A;  4C92 D;  1RLP C;  2ABL A;  2LP5 A;  3JB9 I;  1WXB A;  1KC8 U;  2DE0 X;  4K11 A;  1ZSZ B;  1UDL A;  1BBZ A;  2MOX A;  1JXM A;  4KGX B;  2LT4 A;  3H0H A;  1KQS P;  2M9U A;  4XTY A;  4II1 A;  1CKB A;  2L3S A;  4KH0 B;  2CH4 W;  2CP5 A;  2AHJ B;  1WHK A;  2JOY A;  2EQI A;  1ABO A;  5LJ5 e;  1SPK A;  2QQB A;  4FW2 A;  3ZL7 C;  4LDW A;  2BIV A;  4C0D B;  3M0S A;  2MCN A;  5GAO p;  1Q86 U;  3QKJ A;  3JB9 J;  2KR3 A;  1U5S A;  4AT1 B;  1TUC A;  6AT1 B;  4J8O A;  5GAM g;  1VQN Q;  3RMS A;  2HDA A;  2DLP A;  3OYF A;  2FPE A;  4JDS A;  3BW1 A;  4FT2 A;  2RHU A;  3H8Z A;  3CCQ T;  1VQM Q;  1VQ4 Q;  2HMA A;  1OU9 A;  2GGR A;  2GFA A;  3JB9 G;  2LQN A;  2DIG A;  1TOV A;  3LH0 A;  3LYI A;  2VKN A;  3KUF A;  2RHX A;  2LQW A;  3P8H A;  2KT8 A;  4PJO A;  3D7S B;  2DD4 A;  5GMK e;  1M9S A;  4E7L A;  2LX7 A;  2XG8 D;  3CCV Q;  5KYN A;  3FB9 A;  3OA6 A;  3JV3 A;  2D9T A;  4BI3 A;  2ZPB B;  1PG5 B;  5C0M A;  4PJO C;  1RAC B;  1H3H A;  1M8M A;  3MCA B;  3VKI A;  4OP0 A;  2EQU A;  2P0K A;  4C92 A;  2GQV A;  2RNA A;  2Y4Y A;  4GBQ A;  1IZ6 A;  1ZSZ A;  1AOJ A;  4RTX A;  2W10 A;  3NFC A;  4WCI A;  2FPF A;  1Q81 R;  2F2V A;  3EG2 A;  5CK9 A;  2KBT A;  1TWB A;  3CXC A;  5GAN 7;  3I56 A;  4FW1 A;  4XTV A;  4C92 C;  4DBR A;  3S3N A;  4OML A;  1VOM A;  4LUE A;  2LT1 A;  4O6J A;  1SEM A;  2RHI A;  1ZSZ C;  2YT6 A;  4IUT A;  3OYN A;  1G2B A;  2ZCF B;  3BE3 A;  1JO8 A;  1VQO Q;  4JS5 A;  5GAN 6;  1SF9 A;  3EFO B;  1TUD A;  2K3Y A;  2QXF A;  2CP7 A;  5FU7 B;  3QSU A;  3VYH B;  1AZG B;  1WNL A;  2KGT A;  1AT1 B;  2RN8 A;  1VQP T;  2DXB A;  2QEX T;  2E5Q A;  1X27 A;  4C0D C;  1MV0 B;  4BAC A;  2QTV A;  4HA8 A;  3MPU B;  2F5K A;  1QW1 A;  3CC2 Q;  5FU6 B;  2QQA A;  3CXC S;  3JCM P;  1BK2 A;  5DLO A;  4PFZ A;  2PQW A;  1X01 A;  4DBH A;  4OMO A;  1Y96 A;  4M77 F;  4P5N A;  2QA4 Q;  3CCS Q;  4KT0 E;  1WXT A;  2RQV A;  4MDW A;  2ZPI B;  4FYW B;  4J9E A;  3WVE B;  3M0U A;  4N4G A;  5J39 A;  3G7Z A;  5I2M A;  5GJW B;  1Q82 U;  4M78 B;  1KQS A;  2K57 A;  4M78 D;  5GAN 4;  3L2R A;  1ZUU A;  3L2U A;  3BY7 A;  3NTK A;  1YIT Q;  4DEX A;  5KYY B;  2ZGW A;  3PT9 A;  3CCV A;  1B34 B;  3ZBD A;  4A53 A;  4J83 A;  1C6V X;  4V2S A;  3OBY A;  2PUK B;  3TQ7 P;  2PVO B;  4J7F A;  3FJ5 A;  3JCM d;  4MDX A;  2ROL A;  2JMC A;  2RJC A;  2DTH A;  1PHT A;  2DJQ A;  2K7A A;  2MYS A;  3JCM Q;  2I2L A;  2VXF A;  4JLI A;  3CME A;  4QT7 A;  1GFD A;  4Y28 E;  1UEC A;  4LUD A;  3PMT A;  4RTT A;  2LNV A;  3DB3 A;  2L3P A;  2RI3 A;  4PJO G;  4LDX A;  3ME9 A;  4C5E A;  1NJI U;  1KQS S;  1KG1 A;  2E1H A;  3EFO A;  1PSF A;  1F1B B;  1YCS B;  4JRP A;  3TU4 K;  2RQU A;  1W2B P;  5CKH A;  2EJG A;  3I5S A;  2MI6 A;  2RK2 A;  2ESW A;  3HSB A;  2YUQ A;  2RK1 A;  4IIO A;  1GCQ A;  4C92 G;  4HVW A;  4A4K A;  2DRK A;  2HBP A;  2XHC A;  1PKS A;  2O01 E;  1U06 A;  1VQM T;  5FW9 A;  4M75 F;  4M75 B;  1WYX A;  2XI9 A;  5D6X A;  1YJ9 T;  4LDU A;  2VVK A;  3G71 A;  2ZPE B;  1YIJ A;  1S72 Q;  1MV3 A;  1GCQ C;  3CC2 A;  4E7H A;  4ZGE B;  1KFZ A;  4M78 A;  3LX7 A;  3CCS A;  2P0Q A;  5FU6 C;  2ROT A;  1W70 A;  4J9D A;  3EHR A;  1GFC A;  3CC7 T;  4C0F A;  1E6H A;  5KYY A;  1VQ8 T;  2LJ1 A;  3EG0 A;  3E9G A;  1B34 A;  4A4F A;  4A4G A;  3J80 E;  2KDS A;  2XID A;  2COZ A;  4M78 C;  5LJ5 d;  3EG3 A;  2I0N A;  2E70 A;  4X9C A;  5GAN d;  4Z8A A;  1BIB A;  2DL7 A;  1ZUY A;  1ZQ1 A;  4RKU E;  1Q82 R;  3RNJ A;  4RG2 A;  4PJJ A;  3CCE A;  1YJW Q;  3CMA Q;  5KYW B;  2LCL A;  2X9H A;  1NPR A;  4IKF A;  4HKE A;  2DX1 A;  2EAY A;  3AT1 B;  1O9S A;  5GAM h;  5GAO q;  2LRQ A;  1GBQ A;  5FWC A;  2CDT A;  1VQ5 T;  3ZEH A;  1VQ7 T;  2OI3 A;  2DEQ A;  3I5R A;  4QVD A;  4DBQ A;  2RQT A;  3G4S A;  3OS0 A;  3JCM W;  4D8D A;  1D1A A;  3G1J A;  2F69 A;  1VQ6 Q;  1M30 A;  3SEM A;  1YJN A;  4ZTJ A;  3BDU A;  2DMO A;  4E7J A;  3BFM A;  1QKX A;  4ZGJ B;  2AT1 B;  2L3Q A;  4M7A D;  4C5G A;  1UB4 A;  3FLG A;  3RR6 A;  1VQ9 A;  1VIF A;  2ZPG B;  5A0D A;  5HK0 A;  1HSQ A;  1UGQ B;  9ATC B;  3I35 A;  2DVJ A;  3VU3 C;  1WX6 A;  2NUT B;  1M8V A;  4ELY C;  1KIK A;  2D0N A;  3E2U A;  1SKU B;  4OB2 B;  3GIB A;  3DKM A;  1E6G A;  3TSZ A;  4DBF A;  3H41 A;  4R0K A;  2HQE A;  3BDL A;  3VS6 A;  1OOT A;  1B7T A;  5GMK j;  3L2W A;  1WJS A;  2EPD A;  3QO3 A;  5L23 A;  3FDR A;  3QWY A;  3OYY A;  2QA4 T;  4M7D B;  4B9W A;  4M7D D;  2EQM A;  4FSS A;  1D0Y A;  3TVT A;  2DBK A;  2L8D A;  2R58 A;  4M77 E;  3G6E Q;  3CCJ A;  2DRM A;  1BCO A;  4FIB A;  3VS2 A;  1C0M A;  2RQW A;  3URG A;  4X1V A;  3M5A A;  5A2Q E;  2DL5 A;  1FMW A;  1BI1 A;  3FIF A;  2YRD A;  2HEQ A;  3CC4 Q;  5CQY A;  1YIT T;  4LD6 A;  3HKS A;  1DJ7 B;  1QP3 A;  4MMK A;  1SHG A;  3PGG A;  4OMN A;  4C8Q E;  1CKA A;  1W2B A;  4AMC A;  3CD6 T;  1UGV A;  1ACM B;  4C0Z A;  4PJL A;  4BY6 C;  1VQL T;  2WSF E;  2HSP A;  2CP3 A;  2MF2 A;  4E7Z A;  5GMK i;  4BE1 A;  4Z88 A;  2CUB A;  5GAO n;  1OU8 A;  3I9Q A;  4PK4 A;  4KGZ B;  3CBP A;  1Q7Y C;  5LJ3 d;  1I4K 1;  3CMA A;  1Y71 A;  4EMG A;  3J81 E;  1MNE A;  2EQK A;  1KD1 C;  1SRM A;  2E41 A;  3NTI A;  1K73 C;  2R57 A;  2FB7 A;  5LJ5 f;  2CSQ A;  5GAN f;  3OBW A;  4FSX A;  1YHQ A;  4OB1 B;  1E7O A;  4AFZ C;  2OTL A;  4J9C A;  1YP5 A;  2PTK A;  2D8J A;  5KYU B;  4A4H A;  5KCH A;  2JN0 A;  5FRO A;  2QYZ A;  5D6Y A;  2NUT A;  4ATO A;  4IIM A;  2CSI A;  2K2V A;  2LJ0 A;  4QVZ A;  3JCM g;  2V8I A;  4M7A C;  1QVG A;  4PFO A;  2KK4 A;  2LQK A;  2RB6 A;  2DM1 A;  2KNB B;  2O4X A;  4M7D A;  2IG0 A;  4AFQ C;  1PKT A;  4F7U A;  2LC4 A;  3JCM V;  3I55 T;  1G5V A;  3A5Z B;  1VUB A;  3CBM A;  3REA B;  2RMO A;  2C0T A;  5CKF A;  2LZ6 B;  4LE9 A;  3X26 B;  1H8K A;  1VIE A;  2ED0 A;  3S3O A;  4M7D C;  1M3A A;  3QZ5 B;  4HCZ A;  3GNF B;  1QKW A;  2A37 A;  3CCU T;  3MEU A;  2KT1 A;  2PZ1 A;  3FRN A;  2DIL A;  4BDZ A;  1D09 B;  4F16 A;  2HAX A;  3RKX A;  1IB8 A;  1QVG S;  3KFV A;  2QAZ A;  2K79 A;  1T0J A;  2DTO A;  1PNJ A;  3M9Q A;  4FYX B;  4C5I A;  1Q81 U;  4Z89 A;  3CCQ A;  3CPW A;  3QYG B;  5IHK A;  3GNG A;  4PJO F;  4J9G A;  3QUI A;  1TXQ A;  2D8H A;  1KHI A;  2WAC A;  2YXY A;  2DYI A;  1X75 C;  1NE8 A;  1VQ6 T;  3I56 Q;  2MIO A;  4ZN1 A;  1YI2 T;  1BU1 A;  1GBR A;  1ARK A;  5KYU A;  3ULR B;  2KRO A;  2GFU A;  2H3J A;  1UJY A;  2CZ6 B;  4FYY B;  1D0X A;  3V8J A;  1SSF A;  5LJ5 g;  1N8R C;  4C92 F;  5LJ3 f;  4J5Y A;  5GAN g;  1GRI A;  2DNU A;  1WGS A;  5IAY A;  2D6F A;  1FWZ A;  3LW5 E;  2X4W A;  2FZK B;  1VQK T;  1K76 A;  3CPW S;  2FRW A;  4HXJ A;  5AT1 B;  2BZ8 A;  5IH2 A;  1UUE A;  1I81 A;  1R0B G;  2JTM A;  5GAO l;  2JM9 A;  1ZBX A;  1K1Z A;  5D6W A;  4DQ2 A;  1GL5 A;  1IGU A;  3TEE A;  3VRZ A;  2HNI A;  3RUX A;  2AKK A;  2EW3 A;  4RMO A;  4JRK A;  4M7A G;  4N0A A;  5DY9 A;  4MZM A;  2KYM A;  8ATC B;  2DKG A;  2YSQ A;  4F17 A;  4ZTF A;  1R8O B;  4N0A C;  4GY5 A;  2J6O A;  2C06 A;  1UGR B;  5GAM e;  2EGA A;  3MP6 A;  2XK0 A;  3FJP A;  1VQP A;  2DET A;  2L2P A;  4M7D G;  4MZT A;  1H64 1;  4F7U G;  1RAD B;  3QJ6 A;  5IXF A;  3QXE B;  1JRI A;  1QWF A;  3L2Z A;  1C1A A;  2IVW A;  3CME Q;  2V1Q A;  1AEY A;  1OZ3 A;  1WFW A;  2JVV A;  3E1S A;  2B8A A;  2OTJ A;  3U23 A;  2DL8 A;  2HQX A;  3PE0 A;  5EG2 A;  3S6W A;  1PCX A;  3J7A F;  4AG2 C;  2WSC E;  2EJF A;  4RTY A;  4JPB W;  2K2M A;  1LPL A;  3M0Q A;  1LJO A;  4L5G A;  4ANJ A;  2X35 A;  4J9H A;  2LJ3 A;  2JXB A;  2RJE A;  2DJZ A;  1K8A C;  1QWE A;  2RHZ A;  1BI2 A;  5LJ3 g;  2DZC A;  2XKO C;  2F5T X;  1KJW A;  3A98 A;  2B86 A;  3QHS A;  1AWO A;  3F70 A;  2DPP B;  1AWJ A;  4IUR A;  1KHC A;  3H0F A;  1BB9 A;  1BI0 A;  2JJ9 A;  2RA2 A;  2P0P A;  4IUU A;  2YDL A;  2YUN A;  2RHY A;  1P92 A;  5A0G A;  3G71 Q;  1YIJ Q;  2DYB A;  2HSE B;  3CCR T;  2BUD A;  3Q1J A;  2LQ8 A;  1K0X A;  3CCM T;  1WI7 A;  2A36 A;  1WZO A;  2V8J A;  2H3E B;  3THK A;  3OMC A;  3PIO A;  3RKW A;  2FPD A;  3OY9 A;  4JRQ A;  2QDY B;  4M77 B;  3VUB A;  3JCM b;  1WJQ A;  3C12 A;  1YCY A;  2A7Y A;  2RJD A;  2LCS A;  2FHD A;  2EIF A;  2RD1 A;  3TRE A;  2K3B A;  3CPF A;  1VYV A;  3CCL T;  2GBQ A;  4PJN A;  1W6X A;  3HFN A;  2P4R A;  3A8H B;  4C8Q F;  2CP0 A;  1QVF S;  1QCN A;  1UGP B;  3JRZ A;  1XNI A;  2M0O A;  4OMQ A;  3QYH B;  2MPX C;  1YJ9 A;  3CCE Q;  5DLQ E;  1AHJ B;  3INZ A;  2QG9 B;  1WHJ A;  4PJO E;  5CKB A;  1HD3 A;  4NL2 A;  2VUB A;  1MMG A;  3O8V A;  4KUI A;  2YUO A;  1WXU A;  1JB0 E;  2EBP A;  3OQ5 A;  2M02 A;  3G4S Q;  3QDF A;  1OEB A;  1QLY A;  2YLC A;  1XOV A;  1OV3 A;  3OYK A;  3MEW A;  1JJ2 S;  2J05 A;  2LTO A;  2DVE A;  1VQ8 A;  1XTD A;  4CC4 B;  1YJN Q;  1M90 C;  2GTJ A;  2VV5 A;  5GMK m;  4KGV B;  3PNW C;  4C92 E;  2AIR B;  1NLP C;  1Q7Y R;  1VQ9 Q;  4XAX B;  1V1C A;  2DO3 A;  1KD1 R;  4JZ4 A;  3QII A;  4JJN K;  2J6K A;  1K73 R;  4ZNX A;  2PNI A;  1FX7 A;  2O9S A;  2HL5 C;  1HXD A;  1X43 A;  1SHF A;  4HCB A;  1VQN T;  2BTT A;  2KRM A;  4NOY A;  3PVQ A;  1VQ5 A;  2QQR A;  3M53 A;  3OYC A;  3NGP A;  4RUG A;  1AZE A;  1VQ7 A;  4VUB A;  2KQW A;  4UC4 A;  4F14 A;  1MMN A;  1X6B A;  1VQ4 T;  2LVM A;  4IUP A;  1M1K C;  5CKD A;  5M9O A;  3SHW A;  1T3S A;  4J9I A;  4M75 D;  3CCJ Q;  3TCJ A;  5FU7 C;  3MHX A;  4M77 A;  5KE3 A;  2X3X D;  1YFN A;  5GAN 3;  1Y57 A;  4TVR A;  3M0T A;  1YN8 A;  4HCK A;  2D0Q B;  1Z9Q A;  5GMK l;  2GTO A;  2EGE A;  3CCV T;  4E7K A;  2JS0 A;  1MGQ A;  2IIM A;  1I8F A;  2CT4 A;  4E7S A;  4E2F B;  1ABQ A;  3PMI A;  2QAS A;  3V7S A;  1OUL A;  1JXO A;  5LJ5 h;  1X6O A;  2FO0 A;  3DLL A;  5GAN h;  2K5I A;  2DFU A;  2HZY A;  3QWX X;  1BCM A;  5CCA A;  1EX4 A;  1QVG P;  2YRV A;  3PVL A;  4XTW A;  4QQG A;  4FL6 A;  5AYF A;  3CME T;  3L1A A;  5J3B A;  4BE2 A;  2J06 A;  2RQR A;  1NLO C;  1K9M C;  4IUV A;  2DER A;  1RAH B;  3M57 A;  3OYD A;  3H9N A;  3UWN A;  1VA7 A;  4RCB A;  4FT4 A;  3EFS A;  3L2Q A;  1YNZ A;  2VYT A;  1R77 A;  3M56 A;  5ECA A;  7AT1 B;  1T3L A;  3RER A;  4XU3 A;  1YHQ Q;  2V26 A;  1ZHI A;  5KH6 A;  2OTL Q;  1HYO A;  3SDZ A;  1VQO T;  3CD6 A;  4D6W A;  1VQL A;  1T0H A;  1KC8 C;  3EGX B;  3REB B;  3JCM f;  1X69 A;  4ME7 A;  4XU1 A;  2FL7 A;  2HKQ B;  3R6O A;  3QBY A;  1NEG A;  3GBQ A;  3A8M B;  1NBE B;  3MKD A;  3EH2 A;  4M75 A;  4M7A F;  3CPW P;  3JB9 F;  3CC2 T;  3OYA A;  1VYT A;  1N8R R;  3CCS T;  3A8L B;  3EG9 B;  3VUZ A;  2YLB A;  5GAM j;  1Q86 C;  4ZGD B;  4JUV A;  2CKK A;  2EYW A;  5FWB A;  4M75 C;  1RAF B;  4RTU A;  2K5L A;  4RTV A;  4ZN3 A;  2KI7 A;  2FYK A;  5IHN A;  3HL8 A;  5I2S A;  4RTW A;  1OYX A;  2NWM A;  4JZ3 A;  2C0O A;  3SWN B;  2ZPH B;  1ZSG A;  4ESR A;  3OYL A;  3DB4 A;  2JTF A;  3I55 A;  5KYW A;  3CCQ Q;  5GAO r;  2M0Y A;  5LJ3 h;  4EMK B;  1QQJ A;  3JAM E;  3HRU A;  5CAI A;  2JUF A;  3OB9 A;  1UTI A;  4KUL A;  4L6V 5;  2O31 A;  1D3B B;  1U3O A;  3KXT A;  1D1B A;  1Z9Z A;  4AFS C;  1HJD A;  3V8L A;  1XJW B;  4OGE A;  2MAM A;  5C6S A;  2ZPF B;  4JJB A;  2COY A;  3VS3 A;  3OYE A;  1N9R A;  1CSK A;  2PVG B;  2DTI A;  4M78 G;  2VC8 A;  1N6A A;  2FZG B;  1LCK A;  4FU6 A;  4A63 B;  1AD5 A;  4J6W A;  3EGX A;  4PLL A;  1PWT A;  2DK3 A;  1UG1 A;  2XDP A;  3ER0 A;  2FRY A;  3KBG A;  2Y90 A;  4LDY A;  3RES A;  1RAG B;  4HT9 A;  3GP8 A;  1M2O A;  4PL6 A;  2EYX A;  1X2K A;  3OS2 A;  4RG8 A;  1M1F A;  1WHH A;  3ZFJ A;  3MP1 A;  5KCO A;  4CRI A;  3C94 A;  3OYI A;  1RAA B;  2P4T A;  3X25 B;  1IXD A;  4KBM B;  3LGF A;  2BZX A;  4RTZ A;  3EGD B;  2XDD A;  1YI2 A;  1S72 T;  3EG9 A;  3OS5 A;  3TSW A;  3HRT A;  3MET A;  2RF0 A;  4OMM A;  2RI5 A;  2EFI A;  2A28 A;  3QPH A;  1IHW A;  4BD3 A;  2PU9 B;  1K8A R;  2QK0 A;  4Q5W A;  2CRE A;  1WQ7 A;  2VAS A;  3EHQ A;  1BKB A;  2LMJ A;  4X9D A;  2LDM A;  2VXE A;  1UGS B;  2YRC A;  5FRM A;  2SEM A;  4D8K A;  2OX7 A;  4QQ6 A;  3OW2 S;  5DM7 R;  2GNC A; 
#chains in the Genus database with same CATH homology
 2FEI A;  5IXF A;  2L3P A;  2FG0 A;  2OAW A;  1AWX A;  1QWF A;  2SRC A;  4GLM A;  4CC7 A;  1J3T A;  2DL3 A;  2V1Q A;  1AEY A;  2H8H A;  1WFW A;  2F2W A;  1M27 C;  3U23 A;  2C0I A;  2DL8 A;  3PE0 A;  1YCS B;  2EGC A;  2RQU A;  1WA7 A;  3NHN A;  3C0C A;  4M4Z A;  4AG2 C;  4RTY A;  4JPB W;  2K2M A;  3I5S A;  3M0Q A;  4AG1 C;  2ESW A;  2YUQ A;  1SSH A;  4IIO A;  1GCQ A;  1WIE A;  3R6N A;  4HVW A;  2NUZ A;  2DRK A;  2A08 A;  1PKS A;  4J9H A;  2G6F X;  1U06 A;  2LJ3 A;  1G83 A;  1UHF A;  1WLP B;  2JXB A;  5FW9 A;  3UA6 A;  1QWE A;  1WYX A;  2VWF A;  2VVK A;  3VRY A;  2CT3 A;  3A98 A;  1KJW A;  2B86 A;  1AWO A;  1MV3 A;  1NG2 A;  1GCQ C;  1AWJ A;  2JW4 A;  3H0F A;  1BB9 A;  1NM7 A;  1KFZ A;  2YDL A;  2YUN A;  1RLQ C;  2KRN A;  2AZS A;  5HCK A;  2ROT A;  1W70 A;  4J9D A;  2DYB A;  1B07 A;  3EHR A;  1GFC A;  1K0X A;  1E6H A;  2LNH B;  2LJ1 A;  1I07 A;  3EG0 A;  1NEB A;  1WI7 A;  1ZLM A;  2A36 A;  2J7I A;  3THK A;  2FPD A;  1N5Z A;  5EC7 A;  1K9A A;  1PRL C;  2CH4 A;  3EG3 A;  2I0N A;  5I11 A;  4Z8A A;  1NYG A;  2DL7 A;  1ZUY A;  1W1F A;  3RNJ A;  1RI9 A;  2E5K A;  1I0C A;  3M0R A;  1H92 A;  2LCS A;  1KSW A;  2KXD A;  3NMZ C;  2K3B A;  2W0Z A;  1VYV A;  2DX1 A;  2GBQ A;  2KRS A;  2O9V A;  1W6X A;  1M3C A;  2V1R A;  2P4R A;  1GBQ A;  5FWC A;  4DEY A;  2CDT A;  4J9B A;  2O88 A;  2OI3 A;  4OMQ A;  3I5R A;  2RQT A;  1HD3 A;  4E6R A;  4D8D A;  3NPF A;  3M0P A;  1M30 A;  3SEM A;  2YUO A;  1WXU A;  2DMO A;  2XMF A;  2CUD A;  2EBP A;  1UJ0 A;  1QKX A;  2DBM A;  1OPL A;  2O2O A;  4LNP A;  2L3Q A;  2F2X A;  3H0I A;  1OEB A;  1OPK A;  1QLY A;  1XOV A;  1OV3 A;  2GQI A;  2J05 A;  1HSQ A;  2K6D A;  3I35 A;  2DVJ A;  4CC4 B;  1TG0 A;  2GTJ A;  2HCK A;  4OMP A;  1WX6 A;  2HBW A;  1SRL A;  2RPN A;  4LN2 A;  1KIK A;  2JMA A;  2D0N A;  4HVV A;  1NLP C;  2KXC A;  1E6G A;  3TSZ A;  3H41 A;  4R0K A;  1V1C A;  1OOT A;  3VS6 A;  4JJC A;  4ORZ A;  2EPD A;  4JZ4 A;  5L23 A;  2JT4 A;  5IXB A;  3QWY A;  1RUW A;  2J6K A;  4ZNX A;  2PNI A;  4EIK A;  4FSS A;  3TVT A;  2O9S A;  2OJ2 A;  2DBK A;  1X43 A;  2J6F A;  1SHF A;  2DRM A;  2BTT A;  2KRM A;  1M3B A;  3PVQ A;  3VS2 A;  1AZE A;  2RQW A;  4HVU A;  3NGP A;  4RUG A;  4X1V A;  1UHC A;  1B3Q A;  4F14 A;  2DL5 A;  1X6B A;  1JU5 C;  2HEQ A;  1GCP A;  2ENM A;  3SHW A;  1T3S A;  4J9I A;  3UAT A;  3VS7 A;  2X3X D;  1SHG A;  2K9G A;  4OMN A;  2DA9 A;  1NYF A;  1FMK A;  1CKA A;  1Y57 A;  3RBB B;  1UGV A;  3M0T A;  1YN8 A;  4HCK A;  4JJD A;  1Z9Q A;  2AK5 A;  1RLP C;  2ABL A;  2GTO A;  2LP5 A;  1WXB A;  2HSP A;  2EGE A;  2JS0 A;  2IIM A;  2DE0 X;  3IQL A;  4Z88 A;  2CT4 A;  4K11 A;  1ABQ A;  2CUB A;  3I9Q A;  3O5Z A;  1UDL A;  1JXO A;  1BBZ A;  2FO0 A;  2MOX A;  1JXM A;  3QWX X;  3H0H A;  2EKH A;  1SRM A;  3VS4 A;  1CKB A;  2L3S A;  3PVL A;  2CH4 W;  1PRM C;  2ED1 A;  2J06 A;  2RQR A;  2CSQ A;  5I22 A;  1NLO C;  2EQI A;  1ABO A;  2JM8 A;  1SPK A;  1E7O A;  4AFZ C;  3ZL7 C;  1VA7 A;  4J9C A;  1YP5 A;  2PTK A;  1JEG A;  3M0S A;  2MCN A;  2D8J A;  1YNZ A;  2KR3 A;  1U5S A;  1TUC A;  5ECA A;  1K0S A;  1YWO A;  1T3L A;  4IIM A;  3VS1 A;  1IO6 A;  2HDA A;  2DLP A;  2FPE A;  2CSI A;  2LJ0 A;  1QCF A;  1UFF A;  2DM1 A;  2KNB B;  2GGR A;  2LQN A;  1T0H A;  2X3W D;  3REB B;  2VKN A;  1X69 A;  1WDX A;  2LQW A;  4AFQ C;  1PKT A;  1MUZ A;  2KT8 A;  3EGU A;  4CC3 A;  3REA B;  2ECZ A;  2RMO A;  2C0T A;  2QDL A;  1NEG A;  3GBQ A;  2LX7 A;  2LZ6 B;  3VS0 A;  4LE9 A;  1H8K A;  2ED0 A;  3JV3 A;  1M3A A;  1X2Q A;  1X6G A;  1QKW A;  3LH5 A;  2A37 A;  1VYT A;  2KE9 A;  1H3H A;  2KT1 A;  1M8M A;  2PZ1 A;  2DIL A;  4F16 A;  1Y0M A;  2EYW A;  5FWB A;  2RNA A;  3KFV A;  1K4U S;  5IHI A;  4GBQ A;  4RTU A;  4RTV A;  5IHN A;  2K79 A;  1AOJ A;  2W10 A;  1T0J A;  2KEA A;  2AKL A;  4RTX A;  5GJV B;  4WCI A;  1S1N A;  2FPF A;  2F2V A;  3EG2 A;  1PNJ A;  2JTE A;  2KBT A;  4RTW A;  4Z89 A;  2DL4 A;  2NWM A;  1AWW A;  4JZ3 A;  2C0O A;  5IHK A;  1AVZ C;  4J9G A;  4OML A;  4LUE A;  2D8H A;  1ZSG A;  4ESR A;  1SEM A;  1I1J A;  2YT6 A;  4CC2 A;  1G2B A;  1JO8 A;  2MIO A;  2M0Y A;  1BU1 A;  1UTI A;  1GBR A;  1ARK A;  1TUD A;  3ULR B;  2KRO A;  1UE9 A;  1UJY A;  2O31 A;  1U3O A;  1Z9Z A;  3CQT A;  1FYN A;  1VYU A;  4AFS C;  2M51 A;  1HJD A;  1JQQ A;  1AZG B;  4JJB A;  1GRI A;  2KGT A;  1ZUK A;  2DNU A;  3VS3 A;  1CSK A;  2RN8 A;  4J9F A;  1X27 A;  1MV0 B;  4Y92 A;  1LCK A;  4A63 B;  1AD5 A;  1PWT A;  1UG1 A;  1K76 A;  1BK2 A;  2D1X A;  2FRY A;  2BZY A;  2FRW A;  4OMO A;  4HXJ A;  3UA7 A;  2BZ8 A;  1WXT A;  2RQV A;  5IH2 A;  1UUE A;  4J9E A;  2EYX A;  2JM9 A;  1X2K A;  4KRT A;  3M0U A;  1K1Z A;  2EYZ A;  5GJW B;  1GL5 A;  1EFN A;  2AZV A;  3VRZ A;  2KYB A;  2AKK A;  1ZUU A;  1ZBJ A;  2EW3 A;  2BZX A;  4RTZ A;  3VS5 A;  4AFU C;  4DEX A;  3EG1 A;  2EYY A;  2KYM A;  3TSW A;  2YSQ A;  2RF0 A;  4OMM A;  3UF4 A;  4F17 A;  2DF6 A;  2A28 A;  1YWP A;  3FJ5 A;  1ZX6 A;  2CRE A;  2ROL A;  2JMC A;  2YUP A;  3EHQ A;  2J6O A;  2LMJ A;  2L0A A;  2K7A A;  1PHT A;  2DJQ A;  2EGA A;  2SEM A;  4QT7 A;  4D8K A;  1GFD A;  1UEC A;  2L2P A;  4LUD A;  1A0N B;  4RTT A;  2JS2 A;  2GNC A;  2EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...