2F2WA

Alpha-spectrin sh3 domain r21a mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2wA00
2X3XD 4J9HA 3M0TA 1U06A 2J6FA 2FG0A 3TVTA 1YP5A 1CSKA 2KRSA 2FPFA 1A0NB 2J6KA 5IHNA 1UG1A 2YUOA 3I5SA 2O31A 2X3WD 4WCIA 2K9GA 1WI7A 2DRKA 4A63B 1MV3A 2EYYA 2KYBA 2HBWA 1ARKA 2P4RA 2MIOA 3VRYA 4F14A 2EW3A 2DVJA 3R6NA 1OPKA 2YUPA 2GBQA 2V1QA 2KT1A 2K7AA 3VS2A 2EGAA 1NYFA 4CC2A 2RQWA 2DMOA 4D8KA 1I1JA 1UJYA 1V1CA 2F2WA 2AK5A 2EYZA 1T0JA 1QLYA 4X1VA 2O9VA 1YNZA 3REBB 4Z8AA 2K3BA 2EBPA 2RQUA 5FW9A 2MCNA 1YN8A 2KT8A 2DBMA 1PKSA 3THKA 2RF0A 2CT4A 2A36A 1SHGA 1UECA 4D8DA 1QKXA 2CSIA 1NYGA 1SRMA 1X43A 4RTVA 1BU1A 1PRLC 1WA7A 1ZUYA 5HCKA 3VS7A 1U3OA 3RBBB 1CKAA 4Z88A 1T3LA 1ZUKA 1HD3A 3KFVA 1E7OA 1K9AA 3EG0A 3M0UA 2KE9A 3EHQA 2YT6A 1VYVA 4KRTA 2DX1A 1H3HA 5I22A 2HDAA 3GBQA 2JS0A 2CUBA 4CC3A 2JMCA 1WX6A 2AZSA 1SRLA 1PNJA 1BBZA 4Z89A 4DEYA 1SPKA 1X6BA 2PTKA 2HCKA 4JJDA 4CC4B 2G6FX 2FRWA 2LJ1A 4OMNA 3I35A 4IIOA 1WLPB 2DJQA 2NUZA 4RTUA 5IHKA 1GRIA 2AKKA 4AG1C 1TG0A 1GBQA 2FEIA 2EGCA 1TUDA 1RI9A 2B86A 1WIEA 3I9QA 1AWJA 2L3SA 2A28A 2FO0A 2O9SA 2OJ2A 3UA7A 1K0SA 1SHFA 1RLQC 2GQIA 4J9IA 1HJDA 1ZUUA 2RPNA 3VRZA 4LUDA 2BZ8A 3EG3A 3PVQA 1AEYA 4QT7A 1M3BA 4AFUC 3M0PA 1X69A 1AWWA 2CUDA 1NEGA 1G83A 1J3TA 3M0RA 1PWTA 1OV3A 2JXBA 1NEBA 4DEXA 2AZVA 2JM9A 1E6HA 2AKLA 4Y92A 1GFDA 5FWCA 1M27C 4OMLA 4OMQA 2DYBA 2M51A 4ESRA 2ECZA 1UFFA 1WXUA 2JM8A 1VA7A 1PRMC 2DL4A 1JEGA 2LJ0A 2W10A 3O5ZA 1UHCA 2RNAA 1KJWA 2DE0X 1NLPC 1VYTA 4R0KA 1M3CA 1Z9QA 1N5ZA 1Z9ZA 1X27A 2DLPA 4LUEA 1RUWA 1OOTA 2DL3A 1B3QA 1UUEA 1E6GA 2JTEA 2DBKA 3NHNA 1M3AA 1Y0MA 1OEBA 2J6OA 3QWXX 1WXBA 1RLPC 1ZSGA 1YWOA 1GL5A 2DL7A 2DNUA 2RQVA 4J9DA 5EC7A 4CC7A 3VS3A 1GFCA 2CH4A 3C0CA 3UATA 2KXDA 2SEMA 5I11A 2CDTA 2L0AA 3QWYA 5GJVB 3VS6A 2FPEA 5L23A 1ZX6A 3M0QA 3UA6A 2L3PA 2O2OA 1CKBA 1ABQA 1M30A 3A98A 2M0YA 1PHTA 1GCQA 2OI3A 5ECAA 2O88A 2EQIA 1U5SA 2EVRA 1SSHA 3UF4A 3RNJA 2VKNA 1JXMA 3H0IA 1HSQA 2KEAA 4HVWA 1K1ZA 4ZNXA 2EYXA 2JW4A 3JV3A 2L2PA 1JU5C 3LH5A 4LE9A 2KR3A 2K79A 1W70A 2DA9A 2PZ1A 3SEMA 1X6GA 2YUQA 3VS1A 1M8MA 1WXTA 2OAWA 1Y57A 2LQNA 2FPDA 2D0NA 4AFSC 2DILA 2F2XA 2ED1A 1JQQA 1KIKA 2CREA 1ZLMA 3ULRB 4JZ3A 2K2MA 1T0HA 2LNHB 2XMFA 1OPLA 2ABLA 2BZYA 3EGUA 1H8KA 3NGPA 2W0ZA 3NPFA 2EGEA 1MV0B 2A37A 5IXFA 2ESWA 1AWXA 1QWEA 1UHFA 4K11A 1UTIA 1BK2A 2HEQA 3EG1A 1YWPA 1TUCA 3FJ5A 4LNPA 1NLOC 2GTJA 4RTWA 2KXCA 1I07A 3NMZC 2JT4A 2LCSA 2SRCA 4JZ4A 2EPDA 1AVZC 4E6RA 2DF6A 4OMOA 2RN8A 3H0FA 1W1FA 1BB9A 4AG2C 2C0TA 2GTOA 2EKHA 2LZ6B 1AOJA 5FWBA 1UJ0A 2D8JA 4RTYA 3H41A 2YDLA 2NWMA 4EIKA 1GCQC 2RMOA 3EG2A 3IQLA 1X2QA 2E5KA 1MUZA 2V1RA 4RTTA 4J9CA 1WDXA 1T3SA 4JJCA 4GLMA 2YSQA 1WYXA 1UE9A 4J9FA 1UGVA 1VYUA 1ZBJA 2YUNA 1IO6A 2BZXA 2GGRA 2H8HA 4HCKA 5IHIA 1JXOA 4GBQA 1FYNA 5IH2A 4RUGA 2J06A 2I0NA 2J05A 1FMKA 2JMAA 4AFQC 1KSWA 4FSSA 2CH4W 1LCKA 1I0CA 2RQTA 1S1NA 3EHRA 2J7IA 3ZL7C 3TSZA 4ORZA 4HVUA 2DRMA 4RTXA 1ABOA 4J9BA 1SEMA 4LN2A 1QKWA 1XOVA 2LJ3A 2KRMA 1QCFA 2KGTA 3PVLA 1AD5A 3I5RA 2KYMA 2VVKA 2ROLA 2HSPA 3CQTA 4JPBW 1NG2A 1AWOA 2LX7A 4OMMA 1B07A 2CSQA 1EFNA 1JO8A 1K76A 2DL8A 2LMJA 2KNBB 2FRYA 4JJBA 2DM1A 3M0SA 2KBTA 4J9GA 2LQWA 3VS4A 3VS0A 2QDLA 2D8HA 4RTZA 2JS2A 2KROA 1AZGB 1GCPA 1YCSB 2ROTA 2DL5A 1GBRA 2K6DA 4OMPA 1WFWA 2EYWA 2F2VA 5GJWB 4F16A 2C0IA 2ENMA 4HVVA 3H0HA 1UDLA 4IIMA 2C0OA 3VS5A 3SHWA 2BTTA 1X2KA 4M4ZA 2GNCA 1W6XA 1H92A 1K4US 1KFZA 3PE0A 2MOXA 5IXBA 2ED0A 3U23A 2IIMA 1NM7A 3TSWA 4F17A 2PNIA 2L3QA 2RQRA 2LP5A 2CT3A 4HXJA 2VWFA 1G2BA 3REAB 1K0XA 1PKTA 2D1XA 2A08A 4AFZC 4J9EA 1AZEA 1QWFA 2KRNA
chains in the Genus database with same CATH superfamily
3MKDA 2J6FA 3TVTA 4LDUA 1XNIA 3G6EA 1TH7A 1UG1A 2DIQA 2O31A 4FIBA 2QA4T 4M7AC 3G71A 3L42A 4WCIA 2RI2A 2KYBA 4M7AF 1ARKA 3QSUA 2P4RA 1AHJB 3C4SA 1W2BA 3X24B 4F14A 4C8QA 3JSCA 4WF2A 1JRIA 5GANh 1VQMT 4IUPA 1OPKA 2V1QA 2KT1A 2K7AA 3OW2A 2EGAA 3G71Q 4CC2A 2RQWA 3CPWS 3HRTA 2HQHA 1BI3A 3BDLA 4M77C 3RKWA 2F2WA 2E12A 4JLIA 2CP2A 1T0JA 1QLYA 4PFZA 1S72Q 4M77F 3L2QA 3CCQA 4NOYA 2RJDA 4FSXA 5A0LA 2KT8A 4N4HA 4M75B 4FCYA 2RF0A 2CT4A 3QJYA 4QQGA 2CSIA 1BI1A 1NYGA 1X43A 5GAOm 5LJ5d 1BU1A 5GAN3 1U3OA 4Z88A 2VASA 2COWA 1D1AA 2LT4A 5I2SA 4BE1A 2OTLQ 3MP1A 3RMQA 1KD1R 3EHQA 3JCMc 3P8BB 1FWZA 2DTHA 1PG5B 4DBRA 1ZA1B 2HDAA 3A8GB 4IKFA 2JS0A 4CC3A 1YHQA 2AHJB 1WX6A 3EGXB 1SRLA 3FJPA 3JCMd 2E4HA 3JCMW 2ZPIB 3QHSA 2FL7A 1WHJA 1KQ1A 3CC7A 3OS1A 3NTKA 1U1TA 3QDRB 4C0ZA 3VUZA 1MMNA 3OS0A 3RUXA 2LJ1A 2K5LA 3EG9B 4C8QC 2NUZA 4RTUA 1GRIA 2AKKA 2KMTA 4BI3A 3JB9G 4C8QF 2QYZA 3CC7Q 2EGCA 3OA6A 1TUDA 2B86A 2VV5A 4DA4A 2NUTA 1K0SA 3OYJA 4JRKA 1RLQC 2GQIA 2RHYA 2R57A 1ZUUA 2K2VA 3EG3A 1VQ8T 4JS4A 5FLXE 5A0GA 1OV3A 2E10A 3GLXA 1K73R 3MO8A 5KYUA 1NEBA 4DEXA 1VQLA 2Y4XA 3FEOA 3MEVA 4NL3A 2AKLA 4Y92A 4ATOA 4OMQA 2O4XA 2M51A 4ESRA 2MWPA 1UB4A 2KSSA 1KD1C 1VUBA 1WXUA 2CP7A 4OB1B 2JM8A 5LJ3j 2XI9A 4XU3A 1VQNA 1ZBXA 2K4YA 2KI7A 1KJWA 2HAXA 4M78E 5KYNA 1SSFA 1N5ZA 1Z9QA 2QTVA 4R56A 2DLPA 4C5GA 2FB7A 1UUEA 4E47A 1UGSB 3CCMA 1M3AA 4A53A 2J6OA 2KQWA 1VQNQ 2K3XA 1GL5A 3S6WA 3VV0A 3PTAA 4YTLA 1OZ3A 5FU7B 1Y96B 2DNUA 1KQSP 2RQVA 4J9DA 5EC7A 4KT0E 1RAIB 4CC7A 2RHIA 2KXDA 2CDTA 4M7DB 2V8JA 1M4ZA 3MCAB 3VS6A 5GJVB 1G5VA 4X9DA 1WZOA 1P92A 4CI0C 4IUQA 3HFOA 1GCQA 5ECAA 2E65A 1RABB 4J6YA 1U5SA 2DXUA 1QP2A 2G3RA 2B8AA 2PVOB 5KE2A 1B34A 1O9SA 1QW1A 2KEAA 3CBPA 4ZNXA 1ZQ1A 2ZPBB 3LH5A 2KR3A 2KVQG 2K79A 4F04B 3M58A 2L5QA 1BIBA 2K57A 2ZZDA 5AT1B 2KAFA 2D0NA 1BI0A 2DILA 3V8LA 2ED1A 5KYWB 1JQQA 1RAEB 3META 4C0GA 1ZLMA 3M53A 3ULRB 3A8MB 1VQ9Q 1T0HA 4QVCA 2XMFA 5CAIA 3NGPA 3NPFA 3QYGB 3RKXA 2EGEA 2A37A 2JTMA 3CCSQ 5IXFA 2PUKB 1AWXA 4K11A 1BK2A 1Q95G 3RDVA 2HEQA 2VB6A 1Q7YR 4KGVB 3J81E 1MMAA 1WHGA 3INZA 1C6VX 4V2SA 4C92E 2HKQB 4PFPA 2X4XA 1H3ZA 1JJ2A 1NJIR 4OMOA 3OW2P 3G4SA 5KE3A 4L6V5 3CC2T 1QVFP 3S3MA 2HKNA 4ZGJB 3LH0A 3OYYA 1YJNQ 1GCQC 3MEAA 4X9CA 1V29B 3M56A 3LGFA 3SDZA 3OBWA 1VQ7A 3F70A 4E7HA 1PC0A 4LD9K 4M75D 3N5BB 2YSQA 3CMEA 1VQ6A 3G4SQ 2MAMA 3M4GA 4E7SA 5LJ3h 2C06A 1VYUA 1ZBJA 3V7RA 1D3BB 2L8DA 3VKIA 1IO6A 1QVGA 4ANJA 2KK4A 2BZXA 1YJ9T 2GGRA 3HPWA 5IHIA 4A4KA 1JXOA 3WVDB 1IGUA 2EQMA 3JB9H 4XAXB 2XDBA 1VQ7Q 1VQ6Q 4E7JA 4XK8E 2F5KA 4F7UG 1M1GA 2E6ZA 2J7IA 2DD4A 3TSZA 4ORZA 2M1HA 2LJ3A 4PLLA 5FROA 3VYHB 3M9QA 5KYYA 3I5RA 1YITQ 1Q7YC 4HCZA 2VVKA 1RAGB 2HSPA 3CQTA 4M7AD 3OMCA 2BUDA 1VQPT 4QQ6A 4FT4A 2CSQA 3A1PA 5M9OA 1WQWA 1NJIC 2RJEA 3JB9I 3M0SA 2QDLA 4XU0A 4DBQA 5GAMf 2JS2A 5GAOp 3CCUA 4EDUA 1GBRA 5A2QE 2E70A 3SWNB 2HQEA 4BY6B 2K6DA 3CCLT 4M77D 1WJQA 2MF2A 1LNXA 2ENMA 2CZ0B 3HHTB 4M4ZA 1KFZA 1K4US 1KK7A 4IUTA 3PE0A 2MOXA 5FRNA 1IHVA 2ED0A 2QEXQ 3CMAT 3CCUQ 2X4YA 4J6WA 4PK4A 1K0XA 3M4YA 3QG1A 3EFSA 4AFZC 4IUUA 2KRNA 3G1JA 2X3XD 3L2ZA 1D09B 2ZGWA 5HKCA 2OTJA 1A0NB 2YUOA 4BDYA 1VQOT 4M75A 1WI7A 3CEYA 3OSSC 1MV3A 2EYYA 4OMFB 2VXFA 5GAMg 4C0FA 2WACA 1PCXA 3VRYA 4F7UF 5CQXA 4XQ3A 3PIPA 1G3YA 2OTJQ 2DVJA 3R6NA 1WHHA 2YUPA 4RG2A 4IUVA 1RI0A 3VS2A 1NYFA 2DK3A 4D8KA 1WPYA 4Y28E 3G6ET 4M7DD 3EGXA 2GCXA 4C8QE 1VQ4T 1YNZA 2DJZA 4Z8AA 2CGHA 3PFSA 3ZBDA 2RHZA 3JB9J 4JUVA 1PKSA 3THKA 2LCLA 4C0DB 1UECA 5GAOl 3OYBA 1QKXA 5LJ5f 3EG9A 4M7AA 2ZPFB 4RTVA 3CC4Q 1PM3A 1WA7A 3RBBB 1K9MR 2GFUA 2LC4A 1QQJA 4PNOA 1YJWA 3EG0A 3M0UA 3I55A 1OU9A 2KE9A 3A8HB 3C94A 3CCEQ 3FC3A 4DBHA 1MNDA 1G3SA 3GBQA 3CCQT 2CUBA 5CKEA 5GAMe 1N27A 2X9HA 1PNJA 4DEYA 3CD6A 2PTKA 4M75C 3TREA 2RK2A 1YJWQ 5KCHA 3I55Q 4M75F 3RESA 4JJDA 2G6FX 1VQKA 3OS5A 2BIVA 4OMNA 3I35A 4IIOA 2XIDA 4X34A 2DJQA 1TUGB 5IHKA 4AG1C 4HKEA 3LGLA 2Y90A 1TG0A 1GBQA 1JJ2P 3RR6A 2ZCFB 3O8VA 3WVEB 1WHMA 3GIBA 1OULA 2LT1A 1YHQT 3I9QA 2L3SA 4B6MA 3L1AA 3OQ5A 3QKJA 4BI8B 2V26A 4WTOB 1NJIU 1HJDA 4RG8A 2BZ8A 3OSVA 4QT7A 1RAAB 1M3BA 1M9SA 4OB3B 3JB9D 4PJNA 1NEGA 2PQWA 1KG1A 1G83A 1J3TA 1PWTA 4B9XA 4PJLA 5HY6A 4HCCA 1FXXA 3HL8A 4M7DG 3BE3A 3JCMg 4JJNK 1QVGP 1M27C 1K9MC 1Y96A 2ATCB 3ER0A 1S72A 3CCJA 2ECZA 2HBPA 1G8XA 3H9NA 2EJ9A 4M7DA 1JEGA 3RERA 2RNAA 4C92B 1NLPC 1IB8A 2A3LA 4Y91A 2A0FB 4R0KA 4A4GA 2QGFB 4FYVB 1Z9ZA 1X27A 4LUEA 3BFMA 1OOTA 1Q81C 3JRZA 3CCJQ 3UDCA 2OTLA 2DBKA 1VQLT 1Y0MA 2M16A 3QWXX 3OYCA 3KBGA 1WHKA 5LJ5e 5DLQE 2GF7A 4FT2A 1NPRA 3D7SB 2LTOA 3PNWC 2GFAA 4PJOG 5KYWA 5I11A 4DQ2A 2HL3A 2L0AA 4ELZC 3QWYA 5L23A 2FPEA 4J8OA 2BE7D 5GANf 3JCMe 3CCMT 3RMSA 1ABQA 1EX4A 2COZA 3A98A 3CCVA 2FZGB 2O88A 2DVEA 1HYOA 2VKNA 2CYZB 3H0IA 5D6XA 7AT1B 4PL6A 1K1ZA 3HRSA 2EYXA 2JW4A 1YIJT 5FU7C 4LE9A 1D1BA 2DA9A 2PZ1A 3SEMA 1X6GA 2RA2A 3DKMA 4NL2A 1UEBA 3VS1A 4IURA 2JN0A 2QK0A 3CPWP 2DXTA 2OAWA 3CCVQ 3JCMX 4M7DC 2LQNA 2FPDA 3MEWA 2RM4A 4AFSC 4JRQA 1ACMB 2F2XA 3JCMb 3TU4K 1KIKA 4M7DF 4JZ3A 2LQ8A 2M0OA 2K2MA 3EFOB 3EGUA 2ABLA 2BZYA 1R0CB 3QYHB 2CZ1B 3SB2A 2W0ZA 5CIUA 2QA4A 1M2VB 2DTOA 1MV0B 2MYSA 1QWEA 3EG1A 2L89A 3FJ5A 1D3BA 1NZ9A 2EIFA 4RTWA 4KGXB 1I07A 1PSFA 1KQSS 2R58A 2EPDA 1TS9A 1VQMA 1BKBA 4DBFA 2RN8A 1I4K1 5CCAA 2QA4Q 1LVKA 4ZTFA 3VJPA 1D0ZA 1YBYA 1Y7XA 2C0TA 4AG2C 1M1KR 2DAQA 2H3EB 2CP6A 2LZ6B 2YRCA 2DZCA 3CBMA 1BCMA 3H41A 4RTYA 3KXTA 3GNGA 4QVZA 4EIKA 4RCBA 3V8JA 1N9SA 2V1RA 1Q86U 4ZGEB 2WSEE 1QCOA 1VQMQ 3L2VA 3VYGA 4GLMA 2QQRA 1WYXA 1UE9A 4J9FA 1UGVA 3ZEHA 4A4HA 5J26A 2OX7A 4E7LA 4EMHA 1RADB 4HCKA 3MJXA 1FYNA 5GAMj 2J06A 3EH1A 4Q5WA 2JMAA 1K9MU 3QPHA 3OYGA 4FSSA 4LDVA 1LCKA 1I0CA 5A0DA 2RQTA 3EHRA 1TOVA 3SWNA 3JCMP 2KY9A 2VXEA 3NFCA 4RTXA 1ABOA 3CMET 4AMCA 4J9BA 1SEMA 3PGGA 3OS2A 5GANd 1XOVA 5DLOA 3JB9F 3X26B 2KRMA 2KGTA 1AD5A 1JBMA 5CVIA 2RI3A 4FM4B 5L8RE 1Q81U 1IXDA 4JPBW 2MK5A 1AWOA 1IGQA 4NS5A 1VQ9A 1O75A 1EFNA 2MWOA 3CCRT 8AT1B 2DL8A 2FRYA 4N4GA 3ASKA 2VC8A 2LQWA 3VS0A 3CCSA 2P84A 4RTZA 4KH0B 1C1AA 2P0KA 1M1KC 1QVFS 4EMGA 1ZSZB 5D6WA 1AZGB 1GCPA 1TU0B 3M55A 2DFUA 1YCSB 3I56A 5J3BA 5FRMA 4PJMA 2LQKA 4P5NA 2DL5A 4LDWA 3J7AF 1G3TA 2XICA 1HK9A 1VQ8A 3UT1A 2XU8A 4F16A 3GP8A 4JRIA 4OGEA 3HSBA 2QTXA 1OX9A 1PSEA 1WJSA 2M9UA 2DEUA 2VGMA 4PJOB 4KULA 1LJOA 3SHWA 2AT1B 1X2KA 2GNCA 1W6XA 2CS7A 2QQSA 1MMGA 3LLRA 1AT1B 2DKGA 3TSWA 3I56Q 3CBOA 5DM7R 2PNIA 2L3QA 2RQRA 2LP5A 1W2BP 4HXJA 3S3NA 1YJNA 1DJ7B 1VQ8Q 1PKTA 4J9EA 4MDWA 1QWFA 2NUPB 5GMKm 4QKUA 2LRQA 2FG0A 1YP5A 1CSKA 2KRSA 3SWNC 4BY6C 2FPFA 5EG2A 3I5SA 5LJ5j 3DLLA 2K9GA 3ME9A 2DRKA 4A63B 2LNVA 1Q82R 4BUGA 2MIOA 3H8ZA 5CQYA 1OYXA 2HNIA 4M75E 2GBQA 2ZPHB 5CKHA 3FB9A 2DMOA 2EJGA 1UJYA 1V1CA 2EQUA 2EYQA 3OYDA 1VQ5T 1YITA 2EKOA 2K3BA 4RMOA 2YRDA 1YN8A 2DBMA 2RK1A 5KYUB 5GAMh 4KUDK 3EH2A 1SHGA 3M54A 2ZPGB 4BE0A 1SRMA 4J5YA 4Z02A 2EFIA 5HCKA 3OBYA 1LPLA 4F7UA 1R8OB 2EAYA 1K9AA 5C6SA 4HT9A 1TXQA 2YT6A 2CP3A 4KRTA 3HFNA 4E7IA 2HSEB 4A4EA 2D6FA 5I22A 4GLKA 3OY9A 4M7AE 2X4JA 2X4WA 4XTXA 4EMKB 1VIEA 3X20B 1BI2A 3E2UA 4MDXA 2QEXA 2F69A 4C0DC 4JS5A 1QVPA 2DO3A 4CC4B 2FRWA 1Q82C 1YJWT 5CKBA 4C92G 2CP5A 4M77E 2DYIA 2CP0A 5KYXB 3EAEA 4PKCC 4ZN1A 5CKFA 1WIEA 1X6OA 2FO0A 1D0YA 2OJ2A 4JDSA 1SHFA 3CC2A 3LYIA 3CD6T 1SG5A 4CRIA 3HKSA 2RPNA 2E3HA 4LUDA 4AFUC 1M1KU 3M0PA 1X69A 2XHCA 1VQKT 1AWWA 2CUDA 1YI2T 2P0PA 4FW2A 2VYTA 4J7IA 1PD1A 3A8LB 3OYIA 2JM9A 1E6HA 1IRXA 4J83A 3CC2Q 2NLUA 3MP8A 5FWCA 4OMLA 2DYBA 4FW1A 1KQ2A 4BI4A 3OYHA 1WGSA 3AT1B 4PFOA 4JLGA 2DL4A 2AIRB 2LJ0A 1RAHB 2W10A 3OB9A 4XTUA 5IT9E 1Q86R 3CC4A 3MPUB 1YJ9Q 4HT8A 1UGRB 1B3QA 2E1HA 1E6GA 2JTEA 3G71T 3NHNA 2DERA 4M7DE 5CKDA 1M1FA 1RLPC 1ZSGA 1N6AA 3CCEA 2QI2A 2K5FA 3JCMh 1S72T 2RD1A 5GMKe 2CKKA 2X35A 4M78B 1VQPA 3QDFA 2DD5A 3TQ7P 2X51A 1BCOA 2XDDA 2E6NA 4OVAA 1IHWA 2RB6A 2CH4A 3C0CA 3UATA 2DXCA 2QDYB 1Y71A 3M0QA 3CXCS 4C92F 3EFOA 5LJ3d 5CK9A 2OTLT 5KH6A 2RH2A 1OZ2A 1PHTA 1VQPQ 2OI3A 2YRVA 6AT1B 2EVRA 4QVDA 5HK3A 3UF4A 3RNJA 1NBEB 2WSCE 1Q81R 1JXMA 4HVWA 4PJOD 3OYKA 1KQSA 2L2PA 1JU5C 1UGPB 1W70A 2QGGA 5D6YA 3QZ5B 1Y57A 3CCLQ 3MHXA 1IZ6A 2CREA 2FVUA 5HK0A 3CCVT 1M90C 1WQ7A 1Q86C 3V7CA 1K8AU 5LJ5g 3CC7T 1H8KA 3CMAQ 1VQOA 1QMCA 2YLCA 3JCMQ 1UHFA 1UTIA 1YWPA 4LDYA 1NLOC 3PMIA 5GAN5 1UGQB 3NTIA 2KXCA 3NMZC 3V7SA 5I2MA 2DXBA 2JT4A 2QXFA 2A7YA 4C5IA 1TWBA 4E6RA 4LDXA 1Q82U 1VQOQ 1XQHA 3H0FA 1W1FA 1BB9A 1BIAA 3M59A 2RJFA 2GTOA 1RACB 2EKHA 1TSFA 1AOJA 5FWBA 1UJ0A 2HQXA 4II1A 4C8QG 1XTDA 1VQ4A 2LX9A 2YDLA 4E7ZA 3EG2A 3IQLA 1MUZA 4RTTA 4J9CA 2EQJA 3GF5A 3OMGA 1T3SA 1YFNA 4BD3A 3G6EQ 2OAUA 2K5IA 2YUNA 3NTHA 2JZ2A 3LWHA 1I81A 3ZFJA 1VQ4Q 3RIRA 1N8RU 1BYMA 2I0NA 2J05A 2LDMA 1QVFA 1VQNT 2YLBA 1U1SA 4AFQC 4DOWA 1M2OA 5FU6B 1ZSZA 2Y4YA 2CH4W 4J7FA 1M5Q1 2VUBA 2DRMA 1I8FA 2MI6A 4LN2A 1QKWA 1SF9A 3Q1JA 4PJOA 2YWWA 2KYMA 5CO7A 2ROLA 3CCQQ 1KC8U 3EGDB 2LX7A 1OU8A 4AT1B 1B07A 3FLGA 4N4IA 1K76A 5GAN7 3OYLA 1RL2A 2LMJA 4JJBA 2KNBB 1KHCA 2DM1A 3VUBA 2E64A 2KBTA 3VS4A 2NUPA 1GXIE 3OYMA 5GAN4 5GAOr 3FDRA 2LCCA 2ZAEA 1OQKA 2F1LA 3MEUA 1I5LA 4OMPA 4PLIA 5GJWB 2F5TX 4M7AB 3H0HA 1YHQQ 3VS5A 2MPXC 1VQ9T 1H92A 2HZYA 2IPOB 4KBMB 3C12A 5C0MA 5IXBA 3V8KA 2IIMA 4F17A 4ZGDB 2RI5A 2CT3A 2VWFA 3CCST 1FX7A 1G2BA 3REAB 4ZN3A 5GANg 2D1XA 2A08A 4MMLA 5GMKl 4L5GA 3I56T 2V8IA 1ZSZC 4J9HA 2QQBA 3M0TA 1U06A 1X01A 4M77B 2QASA 1QCNA 2J6KA 5IHNA 2M02A 4XTWA 2K3YA 2JJ9A 2X3WD 2HMAA 5GMKj 4PJOC 1M90U 1FMVA 2ZPEB 2HBWA 1VIFA 4PJOF 1EZZB 3JAME 1YJNT 2EW3A 1HXDA 2PVDB 5CR2A 4M78D 1WJRA 1V76A 3G4ST 1VQLQ 9ATCB 1I1JA 4KGZB 4EMKA 2AK5A 5I21A 2EYZA 4X1VA 2VGNA 4N0AA 1LOJA 2O9VA 1B7TA 3RKYA 3REBB 2KDSA 3GNFB 2EBPA 2RQUA 4HA8A 5FW9A 2MCNA 1N9RA 4BB7A 1VQ7T 3OYFA 5GANe 3DLMA 4LD6A 2L3RA 2A36A 4D8DA 1VQ6T 4OB2B 2LVMA 8ATCB 2DIGA 2HL5C 3HTRA 2DPPB 1PRLC 4ME7A 2PU9B 2I2LA 1ZUYA 3VS7A 1YIJA 1CKAA 1T3LA 1ZUKA 3PMTA 5KYXA 1HD3A 3QBYA 3KFVA 4C8QB 1E7OA 1W2BS 3CCMQ 2QAZA 4D6WA 1VYVA 2DX1A 1H3HA 3QZ9B 1YITT 2QG9B 1MMDA 4L59A 3OW2S 5GAN8 2JMCA 2AZSA 4F7UE 1YIJQ 1BBZA 4Z89A 1SPKA 1X6BA 2HCKA 3MP6A 1VOMA 1X75C 1K73C 3L2WA 3C95A 5LL6S 4A54A 5GAN2 2E41A 4QQDA 1D0XA 1WLPB 1OX8A 1QP3A 2FEIA 4RCCA 3QXEB 1RI9A 1AWJA 3M57A 2A28A 4EMKC 2O9SA 5IAYA 3UA7A 4N0AC 4B9WA 2R5AA 1K8AR 4J9IA 2QEXT 3CCUT 3VRZA 4TVRA 4QW2A 3PVQA 4E2FB 4C92D 1AEYA 3LWIA 3X28B 2BKDN 1YCYA 1C0MA 4M78G 3UPUA 1EIFA 4OB0B 3M0RA 5AYFA 4DOVA 1Y07A 2XG8D 3S3OA 2JNGA 2JXBA 2AZVA 3JCMV 3QIIA 4C5EA 3GPLA 4M78A 1GFDA 5GMKi 1OI1A 3BY7A 4BDZA 2XKOC 4J6XA 1UFFA 2RO0A 1VA7A 2QQAA 2R5MA 1PRMC 3CXCA 4BE2A 3R6OA 5GMKh 3O5ZA 2NUTB 1UHCA 2DE0X 1VYTA 2RJCA 2H3JA 3JCMJ 1M3CA 1ZA2B 2HD0A 2OTJT 5GAOn 2E5QA 1RUWA 2BE9B 2DL3A 1D1CA 1WHLA 2CZ7B 1NE8A 2PVGB 1OEBA 1WXBA 4OGCA 4XTZA 4LXCA 4FYWB 3CPFA 1XJWB 3L2UA 1YWOA 3M5AA 2JVVA 1N8RR 3J80E 2PUOB 5GAN6 2DL7A 2O4XB 4XU2A 2D0QB 3CCRA 2CZ6B 3CMEQ 3VS3A 4A4FA 1GFCA 1KD1U 2V8KA 4KUIA 2SEMA 4R55A 3CC4T 3TEEA 2EJFA 1ZX6A 5LJ3f 3UA6A 1K8AC 3URGA 2L3PA 2O2OA 1CKBA 3PT9A 1M30A 5IN1A 2M0YA 2MMPA 2GQVA 2QQ9A 3E9GA 2EQIA 3CCET 3CCRQ 3X25B 1SSHA 2DEQA 4MZTA 2P0QA 3OYNA 1HSQA 1KC8R 3JV3A 3DB3A 4M78C 2XDPA 3P8DA 3A8OB 2YUQA 3QJ6A 4M78F 3I55T 1M8MA 1MHNA 1WXTA 5DY9A 2JOYA 2E3IA 2P4TA 3L2RA 4O6JA 1FMWA 4XTVA 2O01E 3FIFA 4C92A 2LNHB 1OPLA 3QUIA 4UC4A 3E1SA 2FZKB 3HRUA 3E9FA 2ESWA 2EQKA 1WNLA 1TUCA 2YHTA 4LNPA 2GTJA 1B34B 3HP9A 3PIOA 3CPWA 2Z0WA 1K73U 5LJ3g 4HCBA 3LX7A 3DB4A 1N8RC 3FRNA 5KCOA 2LCSA 2SRCA 4GY5A 4JZ4A 1W4SA 1AVZC 1NPPA 1MNEA 1YJ9A 4M75G 2DF6A 3GOXA 3VU3C 2FHDA 3OYAA 5GANj 5LJ5h 1VQ5A 2D8JA 1SKUB 2IG0A 2NWMA 1TTHB 3SFMA 2RMOA 1M90R 1X2QA 2E5KA 2YXYA 1WDXA 3P8HA 4JJCA 3BDUA 1R77A 4MZPA 4XTYA 2DETA 3KUFA 3T9NA 1U8RA 1KC8C 5J39A 3EGDA 3E19A 3BW1A 1PD0A 3UWNA 1VQ5Q 2H8HA 3EFRA 2RHXA 4C8QD 4GBQA 5IH2A 3CCJT 4RUGA 1JJ2S 4FYYB 2JTFA 1FMKA 2WSFE 3SD4A 2FZCB 1KSWA 4M7AG 4EPCA 4C92C 5GAOq 1S1NA 4MZMA 5LJ3e 4RKUE 1RAFB 4XU1A 4BACA 2DZ9A 3ZL7C 4HVUA 4KH1B 4MMKA 2COYA 4O5VA 4ELYC 1M2VA 1QCFA 3PVLA 3CCLA 2XD0A 3H6ZA 1IREB 2NYSA 2RHUA 1KHIA 4FL6A 2IVWA 1NG2A 4M77G 4OMMA 3OYEA 1M8VA 1QVGS 1JO8A 1R0BG 3LW5E 4C5HA 3AHUA 3CMAA 4PJOE 3G7ZA 5FU6C 4E7KA 2JUFA 3JCMf 4J9GA 1MGQA 2D8HA 5GAMd 1F1BB 4M77A 2KROA 4PJJA 2ROTA 3QO3A 1G3WA 3WXMB 4FU6A 5D7UA 1WFWA 2EYWA 4OP0A 2F2VA 1YI2A 4FYXB 4HVVA 1JB0E 1I5OB 2C0IA 3A5ZB 1UDLA 3TCJA 4IIMA 2C0OA 5KYYB 4OF1A 2BTTA 2FYKA 4F7UB 2XK0A 1Q7YU 1ZHIA 3CD6Q 4VUBA 1H641 3U23A 1NM7A 2DTIA 4JRPA 2D9TA 2EWNA 1VQKQ 1AZEA 1YI2Q 4ZTJA 3CXCP
chains in the Genus database with same CATH topology
2X3XD 4J9HA 3M0TA 1U06A 2J6FA 2FG0A 3TVTA 1YP5A 1CSKA 2KRSA 2FPFA 1A0NB 2J6KA 5IHNA 1UG1A 2YUOA 3I5SA 2O31A 2X3WD 4WCIA 2K9GA 1WI7A 2DRKA 4A63B 1MV3A 2EYYA 2KYBA 2HBWA 1ARKA 2P4RA 2MIOA 3VRYA 4F14A 2EW3A 2DVJA 3R6NA 1OPKA 2YUPA 2GBQA 2V1QA 2KT1A 2K7AA 3VS2A 2EGAA 1NYFA 4CC2A 2RQWA 2DMOA 4D8KA 1I1JA 1UJYA 1V1CA 2F2WA 2AK5A 2EYZA 1T0JA 1QLYA 4X1VA 2O9VA 1YNZA 3REBB 4Z8AA 2K3BA 2EBPA 2RQUA 5FW9A 2MCNA 1YN8A 2KT8A 2DBMA 1PKSA 3THKA 2RF0A 2CT4A 2A36A 1SHGA 1UECA 4D8DA 1QKXA 2CSIA 1NYGA 1SRMA 1X43A 4RTVA 1BU1A 1PRLC 1WA7A 1ZUYA 5HCKA 3VS7A 1U3OA 3RBBB 1CKAA 4Z88A 1T3LA 1ZUKA 1HD3A 3KFVA 1E7OA 1K9AA 3EG0A 3M0UA 2KE9A 3EHQA 2YT6A 1VYVA 4KRTA 2DX1A 1H3HA 5I22A 2HDAA 3GBQA 2JS0A 2CUBA 4CC3A 2JMCA 1WX6A 2AZSA 1SRLA 1PNJA 1BBZA 4Z89A 4DEYA 1SPKA 1X6BA 2PTKA 2HCKA 4JJDA 4CC4B 2G6FX 2FRWA 2LJ1A 4OMNA 3I35A 4IIOA 1WLPB 2DJQA 2NUZA 4RTUA 5IHKA 1GRIA 2AKKA 4AG1C 1TG0A 1GBQA 2FEIA 2EGCA 1TUDA 1RI9A 2B86A 1WIEA 3I9QA 1AWJA 2L3SA 2A28A 2FO0A 2O9SA 2OJ2A 3UA7A 1K0SA 1SHFA 1RLQC 2GQIA 4J9IA 1HJDA 1ZUUA 2RPNA 3VRZA 4LUDA 2BZ8A 3EG3A 3PVQA 1AEYA 4QT7A 1M3BA 4AFUC 3M0PA 1X69A 1AWWA 2CUDA 1NEGA 1G83A 1J3TA 3M0RA 1PWTA 1OV3A 2JXBA 1NEBA 4DEXA 2AZVA 2JM9A 1E6HA 2AKLA 4Y92A 1GFDA 5FWCA 1M27C 4OMLA 4OMQA 2DYBA 2M51A 4ESRA 2ECZA 1UFFA 1WXUA 2JM8A 1VA7A 1PRMC 2DL4A 1JEGA 2LJ0A 2W10A 3O5ZA 1UHCA 2RNAA 1KJWA 2DE0X 1NLPC 1VYTA 4R0KA 1M3CA 1Z9QA 1N5ZA 1Z9ZA 1X27A 2DLPA 4LUEA 1RUWA 1OOTA 2DL3A 1B3QA 1UUEA 1E6GA 2JTEA 2DBKA 3NHNA 1M3AA 1Y0MA 1OEBA 2J6OA 3QWXX 1WXBA 1RLPC 1ZSGA 1YWOA 1GL5A 2DL7A 2DNUA 2RQVA 4J9DA 5EC7A 4CC7A 3VS3A 1GFCA 2CH4A 3C0CA 3UATA 2KXDA 2SEMA 5I11A 2CDTA 2L0AA 3QWYA 5GJVB 3VS6A 2FPEA 5L23A 1ZX6A 3M0QA 3UA6A 2L3PA 2O2OA 1CKBA 1ABQA 1M30A 3A98A 2M0YA 1PHTA 1GCQA 2OI3A 5ECAA 2O88A 2EQIA 1U5SA 2EVRA 1SSHA 3UF4A 3RNJA 2VKNA 1JXMA 3H0IA 1HSQA 2KEAA 4HVWA 1K1ZA 4ZNXA 2EYXA 2JW4A 3JV3A 2L2PA 1JU5C 3LH5A 4LE9A 2KR3A 2K79A 1W70A 2DA9A 2PZ1A 3SEMA 1X6GA 2YUQA 3VS1A 1M8MA 1WXTA 2OAWA 1Y57A 2LQNA 2FPDA 2D0NA 4AFSC 2DILA 2F2XA 2ED1A 1JQQA 1KIKA 2CREA 1ZLMA 3ULRB 4JZ3A 2K2MA 1T0HA 2LNHB 2XMFA 1OPLA 2ABLA 2BZYA 3EGUA 1H8KA 3NGPA 2W0ZA 3NPFA 2EGEA 1MV0B 2A37A 5IXFA 2ESWA 1AWXA 1QWEA 1UHFA 4K11A 1UTIA 1BK2A 2HEQA 3EG1A 1YWPA 1TUCA 3FJ5A 4LNPA 1NLOC 2GTJA 4RTWA 2KXCA 1I07A 3NMZC 2JT4A 2LCSA 2SRCA 4JZ4A 2EPDA 1AVZC 4E6RA 2DF6A 4OMOA 2RN8A 3H0FA 1W1FA 1BB9A 4AG2C 2C0TA 2GTOA 2EKHA 2LZ6B 1AOJA 5FWBA 1UJ0A 2D8JA 4RTYA 3H41A 2YDLA 2NWMA 4EIKA 1GCQC 2RMOA 3EG2A 3IQLA 1X2QA 2E5KA 1MUZA 2V1RA 4RTTA 4J9CA 1WDXA 1T3SA 4JJCA 4GLMA 2YSQA 1WYXA 1UE9A 4J9FA 1UGVA 1VYUA 1ZBJA 2YUNA 1IO6A 2BZXA 2GGRA 2H8HA 4HCKA 5IHIA 1JXOA 4GBQA 1FYNA 5IH2A 4RUGA 2J06A 2I0NA 2J05A 1FMKA 2JMAA 4AFQC 1KSWA 4FSSA 2CH4W 1LCKA 1I0CA 2RQTA 1S1NA 3EHRA 2J7IA 3ZL7C 3TSZA 4ORZA 4HVUA 2DRMA 4RTXA 1ABOA 4J9BA 1SEMA 4LN2A 1QKWA 1XOVA 2LJ3A 2KRMA 1QCFA 2KGTA 3PVLA 1AD5A 3I5RA 2KYMA 2VVKA 2ROLA 2HSPA 3CQTA 4JPBW 1NG2A 1AWOA 2LX7A 4OMMA 1B07A 2CSQA 1EFNA 1JO8A 1K76A 2DL8A 2LMJA 2KNBB 2FRYA 4JJBA 2DM1A 3M0SA 2KBTA 4J9GA 2LQWA 3VS4A 3VS0A 2QDLA 2D8HA 4RTZA 2JS2A 2KROA 1AZGB 1GCPA 1YCSB 2ROTA 2DL5A 1GBRA 2K6DA 4OMPA 1WFWA 2EYWA 2F2VA 5GJWB 4F16A 2C0IA 2ENMA 4HVVA 3H0HA 1UDLA 4IIMA 2C0OA 3VS5A 3SHWA 2BTTA 1X2KA 4M4ZA 2GNCA 1W6XA 1H92A 1K4US 1KFZA 3PE0A 2MOXA 5IXBA 2ED0A 3U23A 2IIMA 1NM7A 3TSWA 4F17A 2PNIA 2L3QA 2RQRA 2LP5A 2CT3A 4HXJA 2VWFA 1G2BA 3REAB 1K0XA 1PKTA 2D1XA 2A08A 4AFZC 4J9EA 1AZEA 1QWFA 2KRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X D;  4J9H A;  3M0T A;  1U06 A;  2J6F A;  2FG0 A;  3TVT A;  1YP5 A;  1CSK A;  2KRS A;  2FPF A;  1A0N B;  2J6K A;  5IHN A;  1UG1 A;  2YUO A;  3I5S A;  2O31 A;  2X3W D;  4WCI A;  2K9G A;  1WI7 A;  2DRK A;  4A63 B;  1MV3 A;  2EYY A;  2KYB A;  2HBW A;  1ARK A;  2P4R A;  2MIO A;  3VRY A;  4F14 A;  2EW3 A;  2DVJ A;  3R6N A;  1OPK A;  2YUP A;  2GBQ A;  2V1Q A;  2KT1 A;  2K7A A;  3VS2 A;  2EGA A;  1NYF A;  4CC2 A;  2RQW A;  2DMO A;  4D8K A;  1I1J A;  1UJY A;  1V1C A;  2F2W A;  2AK5 A;  2EYZ A;  1T0J A;  1QLY A;  4X1V A;  2O9V A;  1YNZ A;  3REB B;  4Z8A A;  2K3B A;  2EBP A;  2RQU A;  5FW9 A;  2MCN A;  1YN8 A;  2KT8 A;  2DBM A;  1PKS A;  3THK A;  2RF0 A;  2CT4 A;  2A36 A;  1SHG A;  1UEC A;  4D8D A;  1QKX A;  2CSI A;  1NYG A;  1SRM A;  1X43 A;  4RTV A;  1BU1 A;  1PRL C;  1WA7 A;  1ZUY A;  5HCK A;  3VS7 A;  1U3O A;  3RBB B;  1CKA A;  4Z88 A;  1T3L A;  1ZUK A;  1HD3 A;  3KFV A;  1E7O A;  1K9A A;  3EG0 A;  3M0U A;  2KE9 A;  3EHQ A;  2YT6 A;  1VYV A;  4KRT A;  2DX1 A;  1H3H A;  5I22 A;  2HDA A;  3GBQ A;  2JS0 A;  2CUB A;  4CC3 A;  2JMC A;  1WX6 A;  2AZS A;  1SRL A;  1PNJ A;  1BBZ A;  4Z89 A;  4DEY A;  1SPK A;  1X6B A;  2PTK A;  2HCK A;  4JJD A;  4CC4 B;  2G6F X;  2FRW A;  2LJ1 A;  4OMN A;  3I35 A;  4IIO A;  1WLP B;  2DJQ A;  2NUZ A;  4RTU A;  5IHK A;  1GRI A;  2AKK A;  4AG1 C;  1TG0 A;  1GBQ A;  2FEI A;  2EGC A;  1TUD A;  1RI9 A;  2B86 A;  1WIE A;  3I9Q A;  1AWJ A;  2L3S A;  2A28 A;  2FO0 A;  2O9S A;  2OJ2 A;  3UA7 A;  1K0S A;  1SHF A;  1RLQ C;  2GQI A;  4J9I A;  1HJD A;  1ZUU A;  2RPN A;  3VRZ A;  4LUD A;  2BZ8 A;  3EG3 A;  3PVQ A;  1AEY A;  4QT7 A;  1M3B A;  4AFU C;  3M0P A;  1X69 A;  1AWW A;  2CUD A;  1NEG A;  1G83 A;  1J3T A;  3M0R A;  1PWT A;  1OV3 A;  2JXB A;  1NEB A;  4DEX A;  2AZV A;  2JM9 A;  1E6H A;  2AKL A;  4Y92 A;  1GFD A;  5FWC A;  1M27 C;  4OML A;  4OMQ A;  2DYB A;  2M51 A;  4ESR A;  2ECZ A;  1UFF A;  1WXU A;  2JM8 A;  1VA7 A;  1PRM C;  2DL4 A;  1JEG A;  2LJ0 A;  2W10 A;  3O5Z A;  1UHC A;  2RNA A;  1KJW A;  2DE0 X;  1NLP C;  1VYT A;  4R0K A;  1M3C A;  1Z9Q A;  1N5Z A;  1Z9Z A;  1X27 A;  2DLP A;  4LUE A;  1RUW A;  1OOT A;  2DL3 A;  1B3Q A;  1UUE A;  1E6G A;  2JTE A;  2DBK A;  3NHN A;  1M3A A;  1Y0M A;  1OEB A;  2J6O A;  3QWX X;  1WXB A;  1RLP C;  1ZSG A;  1YWO A;  1GL5 A;  2DL7 A;  2DNU A;  2RQV A;  4J9D A;  5EC7 A;  4CC7 A;  3VS3 A;  1GFC A;  2CH4 A;  3C0C A;  3UAT A;  2KXD A;  2SEM A;  5I11 A;  2CDT A;  2L0A A;  3QWY A;  5GJV B;  3VS6 A;  2FPE A;  5L23 A;  1ZX6 A;  3M0Q A;  3UA6 A;  2L3P A;  2O2O A;  1CKB A;  1ABQ A;  1M30 A;  3A98 A;  2M0Y A;  1PHT A;  1GCQ A;  2OI3 A;  5ECA A;  2O88 A;  2EQI A;  1U5S A;  2EVR A;  1SSH A;  3UF4 A;  3RNJ A;  2VKN A;  1JXM A;  3H0I A;  1HSQ A;  2KEA A;  4HVW A;  1K1Z A;  4ZNX A;  2EYX A;  2JW4 A;  3JV3 A;  2L2P A;  1JU5 C;  3LH5 A;  4LE9 A;  2KR3 A;  2K79 A;  1W70 A;  2DA9 A;  2PZ1 A;  3SEM A;  1X6G A;  2YUQ A;  3VS1 A;  1M8M A;  1WXT A;  2OAW A;  1Y57 A;  2LQN A;  2FPD A;  2D0N A;  4AFS C;  2DIL A;  2F2X A;  2ED1 A;  1JQQ A;  1KIK A;  2CRE A;  1ZLM A;  3ULR B;  4JZ3 A;  2K2M A;  1T0H A;  2LNH B;  2XMF A;  1OPL A;  2ABL A;  2BZY A;  3EGU A;  1H8K A;  3NGP A;  2W0Z A;  3NPF A;  2EGE A;  1MV0 B;  2A37 A;  5IXF A;  2ESW A;  1AWX A;  1QWE A;  1UHF A;  4K11 A;  1UTI A;  1BK2 A;  2HEQ A;  3EG1 A;  1YWP A;  1TUC A;  3FJ5 A;  4LNP A;  1NLO C;  2GTJ A;  4RTW A;  2KXC A;  1I07 A;  3NMZ C;  2JT4 A;  2LCS A;  2SRC A;  4JZ4 A;  2EPD A;  1AVZ C;  4E6R A;  2DF6 A;  4OMO A;  2RN8 A;  3H0F A;  1W1F A;  1BB9 A;  4AG2 C;  2C0T A;  2GTO A;  2EKH A;  2LZ6 B;  1AOJ A;  5FWB A;  1UJ0 A;  2D8J A;  4RTY A;  3H41 A;  2YDL A;  2NWM A;  4EIK A;  1GCQ C;  2RMO A;  3EG2 A;  3IQL A;  1X2Q A;  2E5K A;  1MUZ A;  2V1R A;  4RTT A;  4J9C A;  1WDX A;  1T3S A;  4JJC A;  4GLM A;  2YSQ A;  1WYX A;  1UE9 A;  4J9F A;  1UGV A;  1VYU A;  1ZBJ A;  2YUN A;  1IO6 A;  2BZX A;  2GGR A;  2H8H A;  4HCK A;  5IHI A;  1JXO A;  4GBQ A;  1FYN A;  5IH2 A;  4RUG A;  2J06 A;  2I0N A;  2J05 A;  1FMK A;  2JMA A;  4AFQ C;  1KSW A;  4FSS A;  2CH4 W;  1LCK A;  1I0C A;  2RQT A;  1S1N A;  3EHR A;  2J7I A;  3ZL7 C;  3TSZ A;  4ORZ A;  4HVU A;  2DRM A;  4RTX A;  1ABO A;  4J9B A;  1SEM A;  4LN2 A;  1QKW A;  1XOV A;  2LJ3 A;  2KRM A;  1QCF A;  2KGT A;  3PVL A;  1AD5 A;  3I5R A;  2KYM A;  2VVK A;  2ROL A;  2HSP A;  3CQT A;  4JPB W;  1NG2 A;  1AWO A;  2LX7 A;  4OMM A;  1B07 A;  2CSQ A;  1EFN A;  1JO8 A;  1K76 A;  2DL8 A;  2LMJ A;  2KNB B;  2FRY A;  4JJB A;  2DM1 A;  3M0S A;  2KBT A;  4J9G A;  2LQW A;  3VS4 A;  3VS0 A;  2QDL A;  2D8H A;  4RTZ A;  2JS2 A;  2KRO A;  1AZG B;  1GCP A;  1YCS B;  2ROT A;  2DL5 A;  1GBR A;  2K6D A;  4OMP A;  1WFW A;  2EYW A;  2F2V A;  5GJW B;  4F16 A;  2C0I A;  2ENM A;  4HVV A;  3H0H A;  1UDL A;  4IIM A;  2C0O A;  3VS5 A;  3SHW A;  2BTT A;  1X2K A;  4M4Z A;  2GNC A;  1W6X A;  1H92 A;  1K4U S;  1KFZ A;  3PE0 A;  2MOX A;  5IXB A;  2ED0 A;  3U23 A;  2IIM A;  1NM7 A;  3TSW A;  4F17 A;  2PNI A;  2L3Q A;  2RQR A;  2LP5 A;  2CT3 A;  4HXJ A;  2VWF A;  1G2B A;  3REA B;  1K0X A;  1PKT A;  2D1X A;  2A08 A;  4AFZ C;  4J9E A;  1AZE A;  1QWF A;  2KRN A; 
#chains in the Genus database with same CATH topology
 3MKD A;  2J6F A;  3TVT A;  4LDU A;  1XNI A;  3G6E A;  1TH7 A;  1UG1 A;  2DIQ A;  2O31 A;  4FIB A;  2QA4 T;  4M7A C;  3G71 A;  3L42 A;  4WCI A;  2RI2 A;  2KYB A;  4M7A F;  1ARK A;  3QSU A;  2P4R A;  1AHJ B;  3C4S A;  1W2B A;  3X24 B;  4F14 A;  4C8Q A;  3JSC A;  4WF2 A;  1JRI A;  5GAN h;  1VQM T;  4IUP A;  1OPK A;  2V1Q A;  2KT1 A;  2K7A A;  3OW2 A;  2EGA A;  3G71 Q;  4CC2 A;  2RQW A;  3CPW S;  3HRT A;  2HQH A;  1BI3 A;  3BDL A;  4M77 C;  3RKW A;  2F2W A;  2E12 A;  4JLI A;  2CP2 A;  1T0J A;  1QLY A;  4PFZ A;  1S72 Q;  4M77 F;  3L2Q A;  3CCQ A;  4NOY A;  2RJD A;  4FSX A;  5A0L A;  2KT8 A;  4N4H A;  4M75 B;  4FCY A;  2RF0 A;  2CT4 A;  3QJY A;  4QQG A;  2CSI A;  1BI1 A;  1NYG A;  1X43 A;  5GAO m;  5LJ5 d;  1BU1 A;  5GAN 3;  1U3O A;  4Z88 A;  2VAS A;  2COW A;  1D1A A;  2LT4 A;  5I2S A;  4BE1 A;  2OTL Q;  3MP1 A;  3RMQ A;  1KD1 R;  3EHQ A;  3JCM c;  3P8B B;  1FWZ A;  2DTH A;  1PG5 B;  4DBR A;  1ZA1 B;  2HDA A;  3A8G B;  4IKF A;  2JS0 A;  4CC3 A;  1YHQ A;  2AHJ B;  1WX6 A;  3EGX B;  1SRL A;  3FJP A;  3JCM d;  2E4H A;  3JCM W;  2ZPI B;  3QHS A;  2FL7 A;  1WHJ A;  1KQ1 A;  3CC7 A;  3OS1 A;  3NTK A;  1U1T A;  3QDR B;  4C0Z A;  3VUZ A;  1MMN A;  3OS0 A;  3RUX A;  2LJ1 A;  2K5L A;  3EG9 B;  4C8Q C;  2NUZ A;  4RTU A;  1GRI A;  2AKK A;  2KMT A;  4BI3 A;  3JB9 G;  4C8Q F;  2QYZ A;  3CC7 Q;  2EGC A;  3OA6 A;  1TUD A;  2B86 A;  2VV5 A;  4DA4 A;  2NUT A;  1K0S A;  3OYJ A;  4JRK A;  1RLQ C;  2GQI A;  2RHY A;  2R57 A;  1ZUU A;  2K2V A;  3EG3 A;  1VQ8 T;  4JS4 A;  5FLX E;  5A0G A;  1OV3 A;  2E10 A;  3GLX A;  1K73 R;  3MO8 A;  5KYU A;  1NEB A;  4DEX A;  1VQL A;  2Y4X A;  3FEO A;  3MEV A;  4NL3 A;  2AKL A;  4Y92 A;  4ATO A;  4OMQ A;  2O4X A;  2M51 A;  4ESR A;  2MWP A;  1UB4 A;  2KSS A;  1KD1 C;  1VUB A;  1WXU A;  2CP7 A;  4OB1 B;  2JM8 A;  5LJ3 j;  2XI9 A;  4XU3 A;  1VQN A;  1ZBX A;  2K4Y A;  2KI7 A;  1KJW A;  2HAX A;  4M78 E;  5KYN A;  1SSF A;  1N5Z A;  1Z9Q A;  2QTV A;  4R56 A;  2DLP A;  4C5G A;  2FB7 A;  1UUE A;  4E47 A;  1UGS B;  3CCM A;  1M3A A;  4A53 A;  2J6O A;  2KQW A;  1VQN Q;  2K3X A;  1GL5 A;  3S6W A;  3VV0 A;  3PTA A;  4YTL A;  1OZ3 A;  5FU7 B;  1Y96 B;  2DNU A;  1KQS P;  2RQV A;  4J9D A;  5EC7 A;  4KT0 E;  1RAI B;  4CC7 A;  2RHI A;  2KXD A;  2CDT A;  4M7D B;  2V8J A;  1M4Z A;  3MCA B;  3VS6 A;  5GJV B;  1G5V A;  4X9D A;  1WZO A;  1P92 A;  4CI0 C;  4IUQ A;  3HFO A;  1GCQ A;  5ECA A;  2E65 A;  1RAB B;  4J6Y A;  1U5S A;  2DXU A;  1QP2 A;  2G3R A;  2B8A A;  2PVO B;  5KE2 A;  1B34 A;  1O9S A;  1QW1 A;  2KEA A;  3CBP A;  4ZNX A;  1ZQ1 A;  2ZPB B;  3LH5 A;  2KR3 A;  2KVQ G;  2K79 A;  4F04 B;  3M58 A;  2L5Q A;  1BIB A;  2K57 A;  2ZZD A;  5AT1 B;  2KAF A;  2D0N A;  1BI0 A;  2DIL A;  3V8L A;  2ED1 A;  5KYW B;  1JQQ A;  1RAE B;  3MET A;  4C0G A;  1ZLM A;  3M53 A;  3ULR B;  3A8M B;  1VQ9 Q;  1T0H A;  4QVC A;  2XMF A;  5CAI A;  3NGP A;  3NPF A;  3QYG B;  3RKX A;  2EGE A;  2A37 A;  2JTM A;  3CCS Q;  5IXF A;  2PUK B;  1AWX A;  4K11 A;  1BK2 A;  1Q95 G;  3RDV A;  2HEQ A;  2VB6 A;  1Q7Y R;  4KGV B;  3J81 E;  1MMA A;  1WHG A;  3INZ A;  1C6V X;  4V2S A;  4C92 E;  2HKQ B;  4PFP A;  2X4X A;  1H3Z A;  1JJ2 A;  1NJI R;  4OMO A;  3OW2 P;  3G4S A;  5KE3 A;  4L6V 5;  3CC2 T;  1QVF P;  3S3M A;  2HKN A;  4ZGJ B;  3LH0 A;  3OYY A;  1YJN Q;  1GCQ C;  3MEA A;  4X9C A;  1V29 B;  3M56 A;  3LGF A;  3SDZ A;  3OBW A;  1VQ7 A;  3F70 A;  4E7H A;  1PC0 A;  4LD9 K;  4M75 D;  3N5B B;  2YSQ A;  3CME A;  1VQ6 A;  3G4S Q;  2MAM A;  3M4G A;  4E7S A;  5LJ3 h;  2C06 A;  1VYU A;  1ZBJ A;  3V7R A;  1D3B B;  2L8D A;  3VKI A;  1IO6 A;  1QVG A;  4ANJ A;  2KK4 A;  2BZX A;  1YJ9 T;  2GGR A;  3HPW A;  5IHI A;  4A4K A;  1JXO A;  3WVD B;  1IGU A;  2EQM A;  3JB9 H;  4XAX B;  2XDB A;  1VQ7 Q;  1VQ6 Q;  4E7J A;  4XK8 E;  2F5K A;  4F7U G;  1M1G A;  2E6Z A;  2J7I A;  2DD4 A;  3TSZ A;  4ORZ A;  2M1H A;  2LJ3 A;  4PLL A;  5FRO A;  3VYH B;  3M9Q A;  5KYY A;  3I5R A;  1YIT Q;  1Q7Y C;  4HCZ A;  2VVK A;  1RAG B;  2HSP A;  3CQT A;  4M7A D;  3OMC A;  2BUD A;  1VQP T;  4QQ6 A;  4FT4 A;  2CSQ A;  3A1P A;  5M9O A;  1WQW A;  1NJI C;  2RJE A;  3JB9 I;  3M0S A;  2QDL A;  4XU0 A;  4DBQ A;  5GAM f;  2JS2 A;  5GAO p;  3CCU A;  4EDU A;  1GBR A;  5A2Q E;  2E70 A;  3SWN B;  2HQE A;  4BY6 B;  2K6D A;  3CCL T;  4M77 D;  1WJQ A;  2MF2 A;  1LNX A;  2ENM A;  2CZ0 B;  3HHT B;  4M4Z A;  1KFZ A;  1K4U S;  1KK7 A;  4IUT A;  3PE0 A;  2MOX A;  5FRN A;  1IHV A;  2ED0 A;  2QEX Q;  3CMA T;  3CCU Q;  2X4Y A;  4J6W A;  4PK4 A;  1K0X A;  3M4Y A;  3QG1 A;  3EFS A;  4AFZ C;  4IUU A;  2KRN A;  3G1J A;  2X3X D;  3L2Z A;  1D09 B;  2ZGW A;  5HKC A;  2OTJ A;  1A0N B;  2YUO A;  4BDY A;  1VQO T;  4M75 A;  1WI7 A;  3CEY A;  3OSS C;  1MV3 A;  2EYY A;  4OMF B;  2VXF A;  5GAM g;  4C0F A;  2WAC A;  1PCX A;  3VRY A;  4F7U F;  5CQX A;  4XQ3 A;  3PIP A;  1G3Y A;  2OTJ Q;  2DVJ A;  3R6N A;  1WHH A;  2YUP A;  4RG2 A;  4IUV A;  1RI0 A;  3VS2 A;  1NYF A;  2DK3 A;  4D8K A;  1WPY A;  4Y28 E;  3G6E T;  4M7D D;  3EGX A;  2GCX A;  4C8Q E;  1VQ4 T;  1YNZ A;  2DJZ A;  4Z8A A;  2CGH A;  3PFS A;  3ZBD A;  2RHZ A;  3JB9 J;  4JUV A;  1PKS A;  3THK A;  2LCL A;  4C0D B;  1UEC A;  5GAO l;  3OYB A;  1QKX A;  5LJ5 f;  3EG9 A;  4M7A A;  2ZPF B;  4RTV A;  3CC4 Q;  1PM3 A;  1WA7 A;  3RBB B;  1K9M R;  2GFU A;  2LC4 A;  1QQJ A;  4PNO A;  1YJW A;  3EG0 A;  3M0U A;  3I55 A;  1OU9 A;  2KE9 A;  3A8H B;  3C94 A;  3CCE Q;  3FC3 A;  4DBH A;  1MND A;  1G3S A;  3GBQ A;  3CCQ T;  2CUB A;  5CKE A;  5GAM e;  1N27 A;  2X9H A;  1PNJ A;  4DEY A;  3CD6 A;  2PTK A;  4M75 C;  3TRE A;  2RK2 A;  1YJW Q;  5KCH A;  3I55 Q;  4M75 F;  3RES A;  4JJD A;  2G6F X;  1VQK A;  3OS5 A;  2BIV A;  4OMN A;  3I35 A;  4IIO A;  2XID A;  4X34 A;  2DJQ A;  1TUG B;  5IHK A;  4AG1 C;  4HKE A;  3LGL A;  2Y90 A;  1TG0 A;  1GBQ A;  1JJ2 P;  3RR6 A;  2ZCF B;  3O8V A;  3WVE B;  1WHM A;  3GIB A;  1OUL A;  2LT1 A;  1YHQ T;  3I9Q A;  2L3S A;  4B6M A;  3L1A A;  3OQ5 A;  3QKJ A;  4BI8 B;  2V26 A;  4WTO B;  1NJI U;  1HJD A;  4RG8 A;  2BZ8 A;  3OSV A;  4QT7 A;  1RAA B;  1M3B A;  1M9S A;  4OB3 B;  3JB9 D;  4PJN A;  1NEG A;  2PQW A;  1KG1 A;  1G83 A;  1J3T A;  1PWT A;  4B9X A;  4PJL A;  5HY6 A;  4HCC A;  1FXX A;  3HL8 A;  4M7D G;  3BE3 A;  3JCM g;  4JJN K;  1QVG P;  1M27 C;  1K9M C;  1Y96 A;  2ATC B;  3ER0 A;  1S72 A;  3CCJ A;  2ECZ A;  2HBP A;  1G8X A;  3H9N A;  2EJ9 A;  4M7D A;  1JEG A;  3RER A;  2RNA A;  4C92 B;  1NLP C;  1IB8 A;  2A3L A;  4Y91 A;  2A0F B;  4R0K A;  4A4G A;  2QGF B;  4FYV B;  1Z9Z A;  1X27 A;  4LUE A;  3BFM A;  1OOT A;  1Q81 C;  3JRZ A;  3CCJ Q;  3UDC A;  2OTL A;  2DBK A;  1VQL T;  1Y0M A;  2M16 A;  3QWX X;  3OYC A;  3KBG A;  1WHK A;  5LJ5 e;  5DLQ E;  2GF7 A;  4FT2 A;  1NPR A;  3D7S B;  2LTO A;  3PNW C;  2GFA A;  4PJO G;  5KYW A;  5I11 A;  4DQ2 A;  2HL3 A;  2L0A A;  4ELZ C;  3QWY A;  5L23 A;  2FPE A;  4J8O A;  2BE7 D;  5GAN f;  3JCM e;  3CCM T;  3RMS A;  1ABQ A;  1EX4 A;  2COZ A;  3A98 A;  3CCV A;  2FZG B;  2O88 A;  2DVE A;  1HYO A;  2VKN A;  2CYZ B;  3H0I A;  5D6X A;  7AT1 B;  4PL6 A;  1K1Z A;  3HRS A;  2EYX A;  2JW4 A;  1YIJ T;  5FU7 C;  4LE9 A;  1D1B A;  2DA9 A;  2PZ1 A;  3SEM A;  1X6G A;  2RA2 A;  3DKM A;  4NL2 A;  1UEB A;  3VS1 A;  4IUR A;  2JN0 A;  2QK0 A;  3CPW P;  2DXT A;  2OAW A;  3CCV Q;  3JCM X;  4M7D C;  2LQN A;  2FPD A;  3MEW A;  2RM4 A;  4AFS C;  4JRQ A;  1ACM B;  2F2X A;  3JCM b;  3TU4 K;  1KIK A;  4M7D F;  4JZ3 A;  2LQ8 A;  2M0O A;  2K2M A;  3EFO B;  3EGU A;  2ABL A;  2BZY A;  1R0C B;  3QYH B;  2CZ1 B;  3SB2 A;  2W0Z A;  5CIU A;  2QA4 A;  1M2V B;  2DTO A;  1MV0 B;  2MYS A;  1QWE A;  3EG1 A;  2L89 A;  3FJ5 A;  1D3B A;  1NZ9 A;  2EIF A;  4RTW A;  4KGX B;  1I07 A;  1PSF A;  1KQS S;  2R58 A;  2EPD A;  1TS9 A;  1VQM A;  1BKB A;  4DBF A;  2RN8 A;  1I4K 1;  5CCA A;  2QA4 Q;  1LVK A;  4ZTF A;  3VJP A;  1D0Z A;  1YBY A;  1Y7X A;  2C0T A;  4AG2 C;  1M1K R;  2DAQ A;  2H3E B;  2CP6 A;  2LZ6 B;  2YRC A;  2DZC A;  3CBM A;  1BCM A;  3H41 A;  4RTY A;  3KXT A;  3GNG A;  4QVZ A;  4EIK A;  4RCB A;  3V8J A;  1N9S A;  2V1R A;  1Q86 U;  4ZGE B;  2WSE E;  1QCO A;  1VQM Q;  3L2V A;  3VYG A;  4GLM A;  2QQR A;  1WYX A;  1UE9 A;  4J9F A;  1UGV A;  3ZEH A;  4A4H A;  5J26 A;  2OX7 A;  4E7L A;  4EMH A;  1RAD B;  4HCK A;  3MJX A;  1FYN A;  5GAM j;  2J06 A;  3EH1 A;  4Q5W A;  2JMA A;  1K9M U;  3QPH A;  3OYG A;  4FSS A;  4LDV A;  1LCK A;  1I0C A;  5A0D A;  2RQT A;  3EHR A;  1TOV A;  3SWN A;  3JCM P;  2KY9 A;  2VXE A;  3NFC A;  4RTX A;  1ABO A;  3CME T;  4AMC A;  4J9B A;  1SEM A;  3PGG A;  3OS2 A;  5GAN d;  1XOV A;  5DLO A;  3JB9 F;  3X26 B;  2KRM A;  2KGT A;  1AD5 A;  1JBM A;  5CVI A;  2RI3 A;  4FM4 B;  5L8R E;  1Q81 U;  1IXD A;  4JPB W;  2MK5 A;  1AWO A;  1IGQ A;  4NS5 A;  1VQ9 A;  1O75 A;  1EFN A;  2MWO A;  3CCR T;  8AT1 B;  2DL8 A;  2FRY A;  4N4G A;  3ASK A;  2VC8 A;  2LQW A;  3VS0 A;  3CCS A;  2P84 A;  4RTZ A;  4KH0 B;  1C1A A;  2P0K A;  1M1K C;  1QVF S;  4EMG A;  1ZSZ B;  5D6W A;  1AZG B;  1GCP A;  1TU0 B;  3M55 A;  2DFU A;  1YCS B;  3I56 A;  5J3B A;  5FRM A;  4PJM A;  2LQK A;  4P5N A;  2DL5 A;  4LDW A;  3J7A F;  1G3T A;  2XIC A;  1HK9 A;  1VQ8 A;  3UT1 A;  2XU8 A;  4F16 A;  3GP8 A;  4JRI A;  4OGE A;  3HSB A;  2QTX A;  1OX9 A;  1PSE A;  1WJS A;  2M9U A;  2DEU A;  2VGM A;  4PJO B;  4KUL A;  1LJO A;  3SHW A;  2AT1 B;  1X2K A;  2GNC A;  1W6X A;  2CS7 A;  2QQS A;  1MMG A;  3LLR A;  1AT1 B;  2DKG A;  3TSW A;  3I56 Q;  3CBO A;  5DM7 R;  2PNI A;  2L3Q A;  2RQR A;  2LP5 A;  1W2B P;  4HXJ A;  3S3N A;  1YJN A;  1DJ7 B;  1VQ8 Q;  1PKT A;  4J9E A;  4MDW A;  1QWF A;  2NUP B;  5GMK m;  4QKU A;  2LRQ A;  2FG0 A;  1YP5 A;  1CSK A;  2KRS A;  3SWN C;  4BY6 C;  2FPF A;  5EG2 A;  3I5S A;  5LJ5 j;  3DLL A;  2K9G A;  3ME9 A;  2DRK A;  4A63 B;  2LNV A;  1Q82 R;  4BUG A;  2MIO A;  3H8Z A;  5CQY A;  1OYX A;  2HNI A;  4M75 E;  2GBQ A;  2ZPH B;  5CKH A;  3FB9 A;  2DMO A;  2EJG A;  1UJY A;  1V1C A;  2EQU A;  2EYQ A;  3OYD A;  1VQ5 T;  1YIT A;  2EKO A;  2K3B A;  4RMO A;  2YRD A;  1YN8 A;  2DBM A;  2RK1 A;  5KYU B;  5GAM h;  4KUD K;  3EH2 A;  1SHG A;  3M54 A;  2ZPG B;  4BE0 A;  1SRM A;  4J5Y A;  4Z02 A;  2EFI A;  5HCK A;  3OBY A;  1LPL A;  4F7U A;  1R8O B;  2EAY A;  1K9A A;  5C6S A;  4HT9 A;  1TXQ A;  2YT6 A;  2CP3 A;  4KRT A;  3HFN A;  4E7I A;  2HSE B;  4A4E A;  2D6F A;  5I22 A;  4GLK A;  3OY9 A;  4M7A E;  2X4J A;  2X4W A;  4XTX A;  4EMK B;  1VIE A;  3X20 B;  1BI2 A;  3E2U A;  4MDX A;  2QEX A;  2F69 A;  4C0D C;  4JS5 A;  1QVP A;  2DO3 A;  4CC4 B;  2FRW A;  1Q82 C;  1YJW T;  5CKB A;  4C92 G;  2CP5 A;  4M77 E;  2DYI A;  2CP0 A;  5KYX B;  3EAE A;  4PKC C;  4ZN1 A;  5CKF A;  1WIE A;  1X6O A;  2FO0 A;  1D0Y A;  2OJ2 A;  4JDS A;  1SHF A;  3CC2 A;  3LYI A;  3CD6 T;  1SG5 A;  4CRI A;  3HKS A;  2RPN A;  2E3H A;  4LUD A;  4AFU C;  1M1K U;  3M0P A;  1X69 A;  2XHC A;  1VQK T;  1AWW A;  2CUD A;  1YI2 T;  2P0P A;  4FW2 A;  2VYT A;  4J7I A;  1PD1 A;  3A8L B;  3OYI A;  2JM9 A;  1E6H A;  1IRX A;  4J83 A;  3CC2 Q;  2NLU A;  3MP8 A;  5FWC A;  4OML A;  2DYB A;  4FW1 A;  1KQ2 A;  4BI4 A;  3OYH A;  1WGS A;  3AT1 B;  4PFO A;  4JLG A;  2DL4 A;  2AIR B;  2LJ0 A;  1RAH B;  2W10 A;  3OB9 A;  4XTU A;  5IT9 E;  1Q86 R;  3CC4 A;  3MPU B;  1YJ9 Q;  4HT8 A;  1UGR B;  1B3Q A;  2E1H A;  1E6G A;  2JTE A;  3G71 T;  3NHN A;  2DER A;  4M7D E;  5CKD A;  1M1F A;  1RLP C;  1ZSG A;  1N6A A;  3CCE A;  2QI2 A;  2K5F A;  3JCM h;  1S72 T;  2RD1 A;  5GMK e;  2CKK A;  2X35 A;  4M78 B;  1VQP A;  3QDF A;  2DD5 A;  3TQ7 P;  2X51 A;  1BCO A;  2XDD A;  2E6N A;  4OVA A;  1IHW A;  2RB6 A;  2CH4 A;  3C0C A;  3UAT A;  2DXC A;  2QDY B;  1Y71 A;  3M0Q A;  3CXC S;  4C92 F;  3EFO A;  5LJ3 d;  5CK9 A;  2OTL T;  5KH6 A;  2RH2 A;  1OZ2 A;  1PHT A;  1VQP Q;  2OI3 A;  2YRV A;  6AT1 B;  2EVR A;  4QVD A;  5HK3 A;  3UF4 A;  3RNJ A;  1NBE B;  2WSC E;  1Q81 R;  1JXM A;  4HVW A;  4PJO D;  3OYK A;  1KQS A;  2L2P A;  1JU5 C;  1UGP B;  1W70 A;  2QGG A;  5D6Y A;  3QZ5 B;  1Y57 A;  3CCL Q;  3MHX A;  1IZ6 A;  2CRE A;  2FVU A;  5HK0 A;  3CCV T;  1M90 C;  1WQ7 A;  1Q86 C;  3V7C A;  1K8A U;  5LJ5 g;  3CC7 T;  1H8K A;  3CMA Q;  1VQO A;  1QMC A;  2YLC A;  3JCM Q;  1UHF A;  1UTI A;  1YWP A;  4LDY A;  1NLO C;  3PMI A;  5GAN 5;  1UGQ B;  3NTI A;  2KXC A;  3NMZ C;  3V7S A;  5I2M A;  2DXB A;  2JT4 A;  2QXF A;  2A7Y A;  4C5I A;  1TWB A;  4E6R A;  4LDX A;  1Q82 U;  1VQO Q;  1XQH A;  3H0F A;  1W1F A;  1BB9 A;  1BIA A;  3M59 A;  2RJF A;  2GTO A;  1RAC B;  2EKH A;  1TSF A;  1AOJ A;  5FWB A;  1UJ0 A;  2HQX A;  4II1 A;  4C8Q G;  1XTD A;  1VQ4 A;  2LX9 A;  2YDL A;  4E7Z A;  3EG2 A;  3IQL A;  1MUZ A;  4RTT A;  4J9C A;  2EQJ A;  3GF5 A;  3OMG A;  1T3S A;  1YFN A;  4BD3 A;  3G6E Q;  2OAU A;  2K5I A;  2YUN A;  3NTH A;  2JZ2 A;  3LWH A;  1I81 A;  3ZFJ A;  1VQ4 Q;  3RIR A;  1N8R U;  1BYM A;  2I0N A;  2J05 A;  2LDM A;  1QVF A;  1VQN T;  2YLB A;  1U1S A;  4AFQ C;  4DOW A;  1M2O A;  5FU6 B;  1ZSZ A;  2Y4Y A;  2CH4 W;  4J7F A;  1M5Q 1;  2VUB A;  2DRM A;  1I8F A;  2MI6 A;  4LN2 A;  1QKW A;  1SF9 A;  3Q1J A;  4PJO A;  2YWW A;  2KYM A;  5CO7 A;  2ROL A;  3CCQ Q;  1KC8 U;  3EGD B;  2LX7 A;  1OU8 A;  4AT1 B;  1B07 A;  3FLG A;  4N4I A;  1K76 A;  5GAN 7;  3OYL A;  1RL2 A;  2LMJ A;  4JJB A;  2KNB B;  1KHC A;  2DM1 A;  3VUB A;  2E64 A;  2KBT A;  3VS4 A;  2NUP A;  1GXI E;  3OYM A;  5GAN 4;  5GAO r;  3FDR A;  2LCC A;  2ZAE A;  1OQK A;  2F1L A;  3MEU A;  1I5L A;  4OMP A;  4PLI A;  5GJW B;  2F5T X;  4M7A B;  3H0H A;  1YHQ Q;  3VS5 A;  2MPX C;  1VQ9 T;  1H92 A;  2HZY A;  2IPO B;  4KBM B;  3C12 A;  5C0M A;  5IXB A;  3V8K A;  2IIM A;  4F17 A;  4ZGD B;  2RI5 A;  2CT3 A;  2VWF A;  3CCS T;  1FX7 A;  1G2B A;  3REA B;  4ZN3 A;  5GAN g;  2D1X A;  2A08 A;  4MML A;  5GMK l;  4L5G A;  3I56 T;  2V8I A;  1ZSZ C;  4J9H A;  2QQB A;  3M0T A;  1U06 A;  1X01 A;  4M77 B;  2QAS A;  1QCN A;  2J6K A;  5IHN A;  2M02 A;  4XTW A;  2K3Y A;  2JJ9 A;  2X3W D;  2HMA A;  5GMK j;  4PJO C;  1M90 U;  1FMV A;  2ZPE B;  2HBW A;  1VIF A;  4PJO F;  1EZZ B;  3JAM E;  1YJN T;  2EW3 A;  1HXD A;  2PVD B;  5CR2 A;  4M78 D;  1WJR A;  1V76 A;  3G4S T;  1VQL Q;  9ATC B;  1I1J A;  4KGZ B;  4EMK A;  2AK5 A;  5I21 A;  2EYZ A;  4X1V A;  2VGN A;  4N0A A;  1LOJ A;  2O9V A;  1B7T A;  3RKY A;  3REB B;  2KDS A;  3GNF B;  2EBP A;  2RQU A;  4HA8 A;  5FW9 A;  2MCN A;  1N9R A;  4BB7 A;  1VQ7 T;  3OYF A;  5GAN e;  3DLM A;  4LD6 A;  2L3R A;  2A36 A;  4D8D A;  1VQ6 T;  4OB2 B;  2LVM A;  8ATC B;  2DIG A;  2HL5 C;  3HTR A;  2DPP B;  1PRL C;  4ME7 A;  2PU9 B;  2I2L A;  1ZUY A;  3VS7 A;  1YIJ A;  1CKA A;  1T3L A;  1ZUK A;  3PMT A;  5KYX A;  1HD3 A;  3QBY A;  3KFV A;  4C8Q B;  1E7O A;  1W2B S;  3CCM Q;  2QAZ A;  4D6W A;  1VYV A;  2DX1 A;  1H3H A;  3QZ9 B;  1YIT T;  2QG9 B;  1MMD A;  4L59 A;  3OW2 S;  5GAN 8;  2JMC A;  2AZS A;  4F7U E;  1YIJ Q;  1BBZ A;  4Z89 A;  1SPK A;  1X6B A;  2HCK A;  3MP6 A;  1VOM A;  1X75 C;  1K73 C;  3L2W A;  3C95 A;  5LL6 S;  4A54 A;  5GAN 2;  2E41 A;  4QQD A;  1D0X A;  1WLP B;  1OX8 A;  1QP3 A;  2FEI A;  4RCC A;  3QXE B;  1RI9 A;  1AWJ A;  3M57 A;  2A28 A;  4EMK C;  2O9S A;  5IAY A;  3UA7 A;  4N0A C;  4B9W A;  2R5A A;  1K8A R;  4J9I A;  2QEX T;  3CCU T;  3VRZ A;  4TVR A;  4QW2 A;  3PVQ A;  4E2F B;  4C92 D;  1AEY A;  3LWI A;  3X28 B;  2BKD N;  1YCY A;  1C0M A;  4M78 G;  3UPU A;  1EIF A;  4OB0 B;  3M0R A;  5AYF A;  4DOV A;  1Y07 A;  2XG8 D;  3S3O A;  2JNG A;  2JXB A;  2AZV A;  3JCM V;  3QII A;  4C5E A;  3GPL A;  4M78 A;  1GFD A;  5GMK i;  1OI1 A;  3BY7 A;  4BDZ A;  2XKO C;  4J6X A;  1UFF A;  2RO0 A;  1VA7 A;  2QQA A;  2R5M A;  1PRM C;  3CXC A;  4BE2 A;  3R6O A;  5GMK h;  3O5Z A;  2NUT B;  1UHC A;  2DE0 X;  1VYT A;  2RJC A;  2H3J A;  3JCM J;  1M3C A;  1ZA2 B;  2HD0 A;  2OTJ T;  5GAO n;  2E5Q A;  1RUW A;  2BE9 B;  2DL3 A;  1D1C A;  1WHL A;  2CZ7 B;  1NE8 A;  2PVG B;  1OEB A;  1WXB A;  4OGC A;  4XTZ A;  4LXC A;  4FYW B;  3CPF A;  1XJW B;  3L2U A;  1YWO A;  3M5A A;  2JVV A;  1N8R R;  3J80 E;  2PUO B;  5GAN 6;  2DL7 A;  2O4X B;  4XU2 A;  2D0Q B;  3CCR A;  2CZ6 B;  3CME Q;  3VS3 A;  4A4F A;  1GFC A;  1KD1 U;  2V8K A;  4KUI A;  2SEM A;  4R55 A;  3CC4 T;  3TEE A;  2EJF A;  1ZX6 A;  5LJ3 f;  3UA6 A;  1K8A C;  3URG A;  2L3P A;  2O2O A;  1CKB A;  3PT9 A;  1M30 A;  5IN1 A;  2M0Y A;  2MMP A;  2GQV A;  2QQ9 A;  3E9G A;  2EQI A;  3CCE T;  3CCR Q;  3X25 B;  1SSH A;  2DEQ A;  4MZT A;  2P0Q A;  3OYN A;  1HSQ A;  1KC8 R;  3JV3 A;  3DB3 A;  4M78 C;  2XDP A;  3P8D A;  3A8O B;  2YUQ A;  3QJ6 A;  4M78 F;  3I55 T;  1M8M A;  1MHN A;  1WXT A;  5DY9 A;  2JOY A;  2E3I A;  2P4T A;  3L2R A;  4O6J A;  1FMW A;  4XTV A;  2O01 E;  3FIF A;  4C92 A;  2LNH B;  1OPL A;  3QUI A;  4UC4 A;  3E1S A;  2FZK B;  3HRU A;  3E9F A;  2ESW A;  2EQK A;  1WNL A;  1TUC A;  2YHT A;  4LNP A;  2GTJ A;  1B34 B;  3HP9 A;  3PIO A;  3CPW A;  2Z0W A;  1K73 U;  5LJ3 g;  4HCB A;  3LX7 A;  3DB4 A;  1N8R C;  3FRN A;  5KCO A;  2LCS A;  2SRC A;  4GY5 A;  4JZ4 A;  1W4S A;  1AVZ C;  1NPP A;  1MNE A;  1YJ9 A;  4M75 G;  2DF6 A;  3GOX A;  3VU3 C;  2FHD A;  3OYA A;  5GAN j;  5LJ5 h;  1VQ5 A;  2D8J A;  1SKU B;  2IG0 A;  2NWM A;  1TTH B;  3SFM A;  2RMO A;  1M90 R;  1X2Q A;  2E5K A;  2YXY A;  1WDX A;  3P8H A;  4JJC A;  3BDU A;  1R77 A;  4MZP A;  4XTY A;  2DET A;  3KUF A;  3T9N A;  1U8R A;  1KC8 C;  5J39 A;  3EGD A;  3E19 A;  3BW1 A;  1PD0 A;  3UWN A;  1VQ5 Q;  2H8H A;  3EFR A;  2RHX A;  4C8Q D;  4GBQ A;  5IH2 A;  3CCJ T;  4RUG A;  1JJ2 S;  4FYY B;  2JTF A;  1FMK A;  2WSF E;  3SD4 A;  2FZC B;  1KSW A;  4M7A G;  4EPC A;  4C92 C;  5GAO q;  1S1N A;  4MZM A;  5LJ3 e;  4RKU E;  1RAF B;  4XU1 A;  4BAC A;  2DZ9 A;  3ZL7 C;  4HVU A;  4KH1 B;  4MMK A;  2COY A;  4O5V A;  4ELY C;  1M2V A;  1QCF A;  3PVL A;  3CCL A;  2XD0 A;  3H6Z A;  1IRE B;  2NYS A;  2RHU A;  1KHI A;  4FL6 A;  2IVW A;  1NG2 A;  4M77 G;  4OMM A;  3OYE A;  1M8V A;  1QVG S;  1JO8 A;  1R0B G;  3LW5 E;  4C5H A;  3AHU A;  3CMA A;  4PJO E;  3G7Z A;  5FU6 C;  4E7K A;  2JUF A;  3JCM f;  4J9G A;  1MGQ A;  2D8H A;  5GAM d;  1F1B B;  4M77 A;  2KRO A;  4PJJ A;  2ROT A;  3QO3 A;  1G3W A;  3WXM B;  4FU6 A;  5D7U A;  1WFW A;  2EYW A;  4OP0 A;  2F2V A;  1YI2 A;  4FYX B;  4HVV A;  1JB0 E;  1I5O B;  2C0I A;  3A5Z B;  1UDL A;  3TCJ A;  4IIM A;  2C0O A;  5KYY B;  4OF1 A;  2BTT A;  2FYK A;  4F7U B;  2XK0 A;  1Q7Y U;  1ZHI A;  3CD6 Q;  4VUB A;  1H64 1;  3U23 A;  1NM7 A;  2DTI A;  4JRP A;  2D9T A;  2EWN A;  1VQK Q;  1AZE A;  1YI2 Q;  4ZTJ A;  3CXC P; 
#chains in the Genus database with same CATH homology
 2X3X D;  4J9H A;  3M0T A;  1U06 A;  2J6F A;  2FG0 A;  3TVT A;  1YP5 A;  1CSK A;  2KRS A;  2FPF A;  1A0N B;  2J6K A;  5IHN A;  1UG1 A;  2YUO A;  3I5S A;  2O31 A;  2X3W D;  4WCI A;  2K9G A;  1WI7 A;  2DRK A;  4A63 B;  1MV3 A;  2EYY A;  2KYB A;  2HBW A;  1ARK A;  2P4R A;  2MIO A;  3VRY A;  4F14 A;  2EW3 A;  2DVJ A;  3R6N A;  1OPK A;  2YUP A;  2GBQ A;  2V1Q A;  2KT1 A;  2K7A A;  3VS2 A;  2EGA A;  1NYF A;  4CC2 A;  2RQW A;  2DMO A;  4D8K A;  1I1J A;  1UJY A;  1V1C A;  2F2W A;  2AK5 A;  2EYZ A;  1T0J A;  1QLY A;  4X1V A;  2O9V A;  1YNZ A;  3REB B;  4Z8A A;  2K3B A;  2EBP A;  2RQU A;  5FW9 A;  2MCN A;  1YN8 A;  2KT8 A;  2DBM A;  1PKS A;  3THK A;  2RF0 A;  2CT4 A;  2A36 A;  1SHG A;  1UEC A;  4D8D A;  1QKX A;  2CSI A;  1NYG A;  1SRM A;  1X43 A;  4RTV A;  1BU1 A;  1PRL C;  1WA7 A;  1ZUY A;  5HCK A;  3VS7 A;  1U3O A;  3RBB B;  1CKA A;  4Z88 A;  1T3L A;  1ZUK A;  1HD3 A;  3KFV A;  1E7O A;  1K9A A;  3EG0 A;  3M0U A;  2KE9 A;  3EHQ A;  2YT6 A;  1VYV A;  4KRT A;  2DX1 A;  1H3H A;  5I22 A;  2HDA A;  3GBQ A;  2JS0 A;  2CUB A;  4CC3 A;  2JMC A;  1WX6 A;  2AZS A;  1SRL A;  1PNJ A;  1BBZ A;  4Z89 A;  4DEY A;  1SPK A;  1X6B A;  2PTK A;  2HCK A;  4JJD A;  4CC4 B;  2G6F X;  2FRW A;  2LJ1 A;  4OMN A;  3I35 A;  4IIO A;  1WLP B;  2DJQ A;  2NUZ A;  4RTU A;  5IHK A;  1GRI A;  2AKK A;  4AG1 C;  1TG0 A;  1GBQ A;  2FEI A;  2EGC A;  1TUD A;  1RI9 A;  2B86 A;  1WIE A;  3I9Q A;  1AWJ A;  2L3S A;  2A28 A;  2FO0 A;  2O9S A;  2OJ2 A;  3UA7 A;  1K0S A;  1SHF A;  1RLQ C;  2GQI A;  4J9I A;  1HJD A;  1ZUU A;  2RPN A;  3VRZ A;  4LUD A;  2BZ8 A;  3EG3 A;  3PVQ A;  1AEY A;  4QT7 A;  1M3B A;  4AFU C;  3M0P A;  1X69 A;  1AWW A;  2CUD A;  1NEG A;  1G83 A;  1J3T A;  3M0R A;  1PWT A;  1OV3 A;  2JXB A;  1NEB A;  4DEX A;  2AZV A;  2JM9 A;  1E6H A;  2AKL A;  4Y92 A;  1GFD A;  5FWC A;  1M27 C;  4OML A;  4OMQ A;  2DYB A;  2M51 A;  4ESR A;  2ECZ A;  1UFF A;  1WXU A;  2JM8 A;  1VA7 A;  1PRM C;  2DL4 A;  1JEG A;  2LJ0 A;  2W10 A;  3O5Z A;  1UHC A;  2RNA A;  1KJW A;  2DE0 X;  1NLP C;  1VYT A;  4R0K A;  1M3C A;  1Z9Q A;  1N5Z A;  1Z9Z A;  1X27 A;  2DLP A;  4LUE A;  1RUW A;  1OOT A;  2DL3 A;  1B3Q A;  1UUE A;  1E6G A;  2JTE A;  2DBK A;  3NHN A;  1M3A A;  1Y0M A;  1OEB A;  2J6O A;  3QWX X;  1WXB A;  1RLP C;  1ZSG A;  1YWO A;  1GL5 A;  2DL7 A;  2DNU A;  2RQV A;  4J9D A;  5EC7 A;  4CC7 A;  3VS3 A;  1GFC A;  2CH4 A;  3C0C A;  3UAT A;  2KXD A;  2SEM A;  5I11 A;  2CDT A;  2L0A A;  3QWY A;  5GJV B;  3VS6 A;  2FPE A;  5L23 A;  1ZX6 A;  3M0Q A;  3UA6 A;  2L3P A;  2O2O A;  1CKB A;  1ABQ A;  1M30 A;  3A98 A;  2M0Y A;  1PHT A;  1GCQ A;  2OI3 A;  5ECA A;  2O88 A;  2EQI A;  1U5S A;  2EVR A;  1SSH A;  3UF4 A;  3RNJ A;  2VKN A;  1JXM A;  3H0I A;  1HSQ A;  2KEA A;  4HVW A;  1K1Z A;  4ZNX A;  2EYX A;  2JW4 A;  3JV3 A;  2L2P A;  1JU5 C;  3LH5 A;  4LE9 A;  2KR3 A;  2K79 A;  1W70 A;  2DA9 A;  2PZ1 A;  3SEM A;  1X6G A;  2YUQ A;  3VS1 A;  1M8M A;  1WXT A;  2OAW A;  1Y57 A;  2LQN A;  2FPD A;  2D0N A;  4AFS C;  2DIL A;  2F2X A;  2ED1 A;  1JQQ A;  1KIK A;  2CRE A;  1ZLM A;  3ULR B;  4JZ3 A;  2K2M A;  1T0H A;  2LNH B;  2XMF A;  1OPL A;  2ABL A;  2BZY A;  3EGU A;  1H8K A;  3NGP A;  2W0Z A;  3NPF A;  2EGE A;  1MV0 B;  2A37 A;  5IXF A;  2ESW A;  1AWX A;  1QWE A;  1UHF A;  4K11 A;  1UTI A;  1BK2 A;  2HEQ A;  3EG1 A;  1YWP A;  1TUC A;  3FJ5 A;  4LNP A;  1NLO C;  2GTJ A;  4RTW A;  2KXC A;  1I07 A;  3NMZ C;  2JT4 A;  2LCS A;  2SRC A;  4JZ4 A;  2EPD A;  1AVZ C;  4E6R A;  2DF6 A;  4OMO A;  2RN8 A;  3H0F A;  1W1F A;  1BB9 A;  4AG2 C;  2C0T A;  2GTO A;  2EKH A;  2LZ6 B;  1AOJ A;  5FWB A;  1UJ0 A;  2D8J A;  4RTY A;  3H41 A;  2YDL A;  2NWM A;  4EIK A;  1GCQ C;  2RMO A;  3EG2 A;  3IQL A;  1X2Q A;  2E5K A;  1MUZ A;  2V1R A;  4RTT A;  4J9C A;  1WDX A;  1T3S A;  4JJC A;  4GLM A;  2YSQ A;  1WYX A;  1UE9 A;  4J9F A;  1UGV A;  1VYU A;  1ZBJ A;  2YUN A;  1IO6 A;  2BZX A;  2GGR A;  2H8H A;  4HCK A;  5IHI A;  1JXO A;  4GBQ A;  1FYN A;  5IH2 A;  4RUG A;  2J06 A;  2I0N A;  2J05 A;  1FMK A;  2JMA A;  4AFQ C;  1KSW A;  4FSS A;  2CH4 W;  1LCK A;  1I0C A;  2RQT A;  1S1N A;  3EHR A;  2J7I A;  3ZL7 C;  3TSZ A;  4ORZ A;  4HVU A;  2DRM A;  4RTX A;  1ABO A;  4J9B A;  1SEM A;  4LN2 A;  1QKW A;  1XOV A;  2LJ3 A;  2KRM A;  1QCF A;  2KGT A;  3PVL A;  1AD5 A;  3I5R A;  2KYM A;  2VVK A;  2ROL A;  2HSP A;  3CQT A;  4JPB W;  1NG2 A;  1AWO A;  2LX7 A;  4OMM A;  1B07 A;  2CSQ A;  1EFN A;  1JO8 A;  1K76 A;  2DL8 A;  2LMJ A;  2KNB B;  2FRY A;  4JJB A;  2DM1 A;  3M0S A;  2KBT A;  4J9G A;  2LQW A;  3VS4 A;  3VS0 A;  2QDL A;  2D8H A;  4RTZ A;  2JS2 A;  2KRO A;  1AZG B;  1GCP A;  1YCS B;  2ROT A;  2DL5 A;  1GBR A;  2K6D A;  4OMP A;  1WFW A;  2EYW A;  2F2V A;  5GJW B;  4F16 A;  2C0I A;  2ENM A;  4HVV A;  3H0H A;  1UDL A;  4IIM A;  2C0O A;  3VS5 A;  3SHW A;  2BTT A;  1X2K A;  4M4Z A;  2GNC A;  1W6X A;  1H92 A;  1K4U S;  1KFZ A;  3PE0 A;  2MOX A;  5IXB A;  2ED0 A;  3U23 A;  2IIM A;  1NM7 A;  3TSW A;  4F17 A;  2PNI A;  2L3Q A;  2RQR A;  2LP5 A;  2CT3 A;  4HXJ A;  2VWF A;  1G2B A;  3REA B;  1K0X A;  1PKT A;  2D1X A;  2A08 A;  4AFZ C;  4J9E A;  1AZE A;  1QWF A;  2KRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...