4M78A

Crystal structure of lsm2-8 complex, space group p21
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
MSATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 13
structure length 67
sequence length 67
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78A00
3V7CA 4F7UG 2ZGWA 3V8KA 4M7DG 5GMKe 1Y96A 1U1TA 2JN0A 2QTXA 3QHSA 4M77C 5GAN5 3GIBA 4RCBA 4M7AE 4QVCA 4M7AD 5GMKj 3L1AA 2YHTA 2FB7A 4J5YA 4N0AA 3JCMW 1LOJA 4J6WA 4C92F 3L2ZA 4M78G 5GAN2 1LNXA 4PJOG 1I4K1 1JBMA 2DTHA 3JCMP 3QSUA 4C92C 2I2LA 2E41A 3RUXA 3JCMV 1HK9A 4PJOE 4XQ3A 2CGHA 5LJ3h 4M7DD 4PJOC 5LJ3g 1JRIA 3RKYA 4PNOA 4C8QG 3QUIA 4PJOF 5GANj 4XTUA 4C92B 2DTOA 3RIRA 3FJPA 4M75C 4X9DA 5GAMh 3JB9G 2DTIA 2EJGA 5GMKh 3V7RA 4JRKA 4PJOA 4XTZA 4C8QF 3JCMb 4C92A 5GAN6 4M77A 3BDUA 3SWNA 1I81A 3JB9J 2DZ9A 5GAMj 3JB9F 4PJOB 5GMKl 4M78B 4M77B 3AHUA 5GAOp 4M77F 2DZCA 4M75A 1X01A 3JB9H 4M77E 5CAIA 4NL3A 5GAMd 5LJ5g 5GAOm 4Y91A 4A54A 1D3BA 4C92G 5LJ5e 4M77G 4C8QA 5LJ3f 5LJ3j 4M7DC 4EMKC 5GAN8 3JCMh 4HT8A 4M75E 4A53A 1B34A 4F7UF 3RERA 4M7DF 1KQ1A 2FYKA 1U1SA 4V2SA 2YLCA 5GMKi 4XTWA 4M7AG 3BY7A 5GAN3 5GAOr 4M75F 1WQ7A 3JCMc 1I5LA 4M78D 3JCMg 4DQ2A 4M78E 4MMLA 4M78C 1BIAA 4EMGA 4F7UA 2EJFA 4M7DA 5GAMf 4C8QC 4XU2A 4EMKB 1WQWA 3BFMA 4J6YA 4WF2A 2K57A 2VXFA 5GANf 4M7AF 1TH7A 1WPYA 2E10A 4J6XA 5I21A 2E65A 3BW1A 3V8LA 5GANh 5GAN4 1BIBA 2DJZA 3HFOA 3M4GA 4HA8A 3V8JA 4C92D 4JUVA 1H641 3RKWA 1WNLA 3EFRA 5LJ5f 2DXTA 3EFSA 2HNIA 5GANd 2DEQA 4XU0A 4EMHA 4M7AB 2EWNA 2RB6A 3JCMJ 4X9CA 3FIFA 4JLIA 3V7SA 4N0AC 1HXDA 4QVDA 2RM4A 3RKXA 4NOYA 2RD1A 3SWNB 3QO3A 2YLBA 3INZA 4M7AA 3SWNC 3JCMX 4XTVA 2VXEA 5GANe 2EAYA 3JCMf 4C8QE 3PGGA 4C8QD 5GAMe 1M5Q1 3JCMQ 3JB9I 2EJ9A 4M75B 4JRIA 5GAMg 5LJ5d 3HSBA 4M78F 5GANg 3FB9A 3HFNA 1MGQA 1YCYA 4M77D 4XTXA 2RA2A 2E64A 2DVEA 3JCMe 3JB9D 3VU3C 2Y90A 5DY9A 5LJ3e 5GAOl 4M7AC 1N9SA 2E1HA 5GAN7 1KQ2A 4M78A 1I8FA 4XU1A 4F7UE 5LJ5j 4M7DE 4OP0A 1N9RA 4PJOD 1B34B 3SB2A 4C92E 3JCMd 5GMKm 2DKGA 1M8VA 4RCCA 5LJ3d 5LJ5h 4M75G 2DXUA 1D3BB 1Y96B 4NL2A 4XU3A 3RESA 4MMKA 4F7UB 5GAOq 1LJOA 4C8QB 4HT9A 2VC8A 4M7DB 4EMKA 4M75D 5GAOn 4XTYA
chains in the Genus database with same CATH superfamily
3M4YA 3CCMQ 3CD6Q 2QTXA 2MWOA 2ZPHB 3QYHB 1DJ7B 4M7AE 3VRYA 1ZSZC 3JCMW 4J6WA 2XI9A 2L3QA 2F2WA 1UGVA 3UA7A 2DNUA 3UATA 2QA4T 1QLYA 2B86A 5FLXE 3FJPA 3VS7A 2HZYA 3JB9G 2M02A 1OZ2A 2XDDA 3MKDA 3BDUA 2EKOA 2BZ8A 2FVUA 2AKLA 1Y57A 1YIJQ 4M77B 4DBHA 4ZNXA 1V29B 2J7IA 1PSEA 2FZGB 4L5GA 1PNJA 2K4YA 1N27A 2HD0A 1QVFA 4D8DA 4M7AG 4ANJA 2M0YA 1VYVA 4DQ2A 3ME9A 1NPPA 2CP7A 4LNPA 5LL6S 2BIVA 4C0FA 3OYFA 1VQMQ 2GQVA 5GANh 1AT1B 2LQNA 3A8GB 3EGDB 1YJWA 2EYWA 3JCMJ 3S3NA 2RJDA 3X24B 4JLGA 3SWNC 1ZSZB 1I07A 3CC7T 3ZL7C 1I0CA 4C8QE 3CCLQ 4BACA 1RAIB 2QEXA 1VQLT 2EYYA 5KYWB 2RA2A 3VU3C 5FRNA 2IPOB 2JTMA 2CSQA 4B9WA 3O8VA 2AT1B 1VIEA 1Z9QA 4C92E 3EG2A 2C06A 2CP2A 2RJCA 1SHGA 2XD0A 2DXCA 4JJDA 1D3BB 1RAAB 3RESA 1LJOA 2GNCA 3G1JA 5ECAA 4QT7A 1U1TA 1VQ5A 3VUZA 2XG8D 2LRQA 3VJPA 1LOJA 1X75C 3MO8A 4KULA 2CGHA 2EW3A 3NPFA 1CSKA 2P0KA 3FLGA 2HEQA 1YIJT 1VQ6Q 1VQ5Q 3LLRA 2O9VA 3MEWA 4BD3A 2E6NA 1TG0A 2E6ZA 4PLLA 4HCZA 2L5QA 2V1RA 3VS2A 2J05A 1KHCA 2LVMA 2WSCE 1X27A 2LT1A 1PWTA 4RG2A 3EGXB 1UGQB 1VQMT 5D6YA 1VYUA 2J06A 1QCFA 1WQ7A 3FJ5A 3M54A 1U06A 1WQWA 3BFMA 1RLPC 4DOVA 1ZSGA 2LTOA 3CC4Q 1UJYA 2BZXA 1BIBA 3M4GA 3EGUA 3OW2P 1Y07A 1H641 2NLUA 1EIFA 1M1GA 3ZFJA 2RB6A 1BCMA 3MHXA 2YWWA 4A63B 4FYVB 3RKXA 3CMAQ 3INZA 1W1FA 3CCJA 2D0NA 3JCMf 3JCMQ 3UWNA 1JXMA 1HSQA 1YITQ 1T3LA 4WTOB 1S1NA 3X28B 3ZEHA 2CUDA 2JT4A 2J6OA 4AFUC 4M7DE 5LJ5j 4E7HA 1M3BA 2EGCA 5HK0A 3META 2DKGA 2BZYA 2KYMA 2DF6A 3CCEA 2F1LA 1VQ7A 3J7AF 3EAEA 3P8BB 3CCUA 2P0PA 2YRVA 8AT1B 4AFSC 2BE7D 1MMAA 3URGA 1RL2A 2X3XD 2V8JA 1RUWA 5GMKj 4FYYB 1RI9A 5GAN2 2DILA 1LPLA 1YJ9A 2DL8A 1OX8A 2XDBA 2KEAA 2W0ZA 1M27C 3UDCA 4AMCA 4GLKA 2DTIA 3M0QA 2Y4YA 3PVQA 2ZCFB 1PKTA 2OTLA 5CVIA 4BI8B 4KUIA 2RF0A 2D8HA 2H3JA 1U5SA 1S72A 3VUBA 3EG1A 4J9DA 4M75A 1QVFS 2ESWA 1QVPA 1OV3A 5CAIA 4NL3A 2DM1A 5LJ3f 4E7JA 3WVDB 1VQKQ 1TUCA 3P8DA 4AFQC 1I5LA 3QPHA 2KT1A 4XU2A 2E10A 3E9FA 3PE0A 2VUBA 2YSQA 2HSPA 2GTOA 2DJZA 3DB3A 4EMHA 4M7AB 1E6GA 4C5IA 4N0AC 2RM4A 2DBMA 2IG0A 3H41A 3HKSA 4XTVA 3JSCA 3NMZC 1GL5A 2KBTA 4P5NA 1M5Q1 1ZLMA 5CKEA 1YBYA 3M0PA 3EG0A 4HCBA 3VRZA 2O01E 3JCMe 3CC4T 3TU4K 2HCKA 1ZHIA 4M78A 2HQEA 3LGLA 1G83A 3QG1A 1TSFA 1FMKA 2RI3A 2LCCA 1WHGA 2MWPA 4O5VA 3EH1A 2YUNA 4FIBA 1BYMA 3L2VA 3RMSA 3TEEA 1VQKT 2DJQA 2LDMA 2CP6A 3L2ZA 1LNXA 1N5ZA 3CXCS 3CCMT 4J9HA 1M90C 2GQIA 2LCSA 5LJ3h 3RKYA 2GCXA 2C0IA 1WI7A 1T0JA 3G7ZA 3NHNA 1V1CA 1X2KA 1ZX6A 2F5TX 2EQJA 1JQQA 5FU7C 2COYA 4KGXB 2JS2A 4PJOB 4RG8A 4B9XA 1N8RU 5CKDA 3CPWA 2JW4A 1YI2T 1ZUUA 3CCQT 3OW2S 4DBFA 3GBQA 2K9GA 1OPKA 4ZN3A 2EKHA 3VS3A 3CCMA 2FYKA 4KT0E 2KRMA 1K9MC 4DEXA 2QAZA 4J9GA 4EMGA 4M78E 3H9NA 1XNIA 3A98A 2RQUA 2X4JA 1OX9A 2G6FX 3GOXA 2LJ0A 5KCHA 4AT1B 2EFIA 1UB4A 2DIQA 2DXTA 2LQWA 1XTDA 2EBPA 1KC8C 1YJNA 1WDXA 2QQBA 3CC4A 2RH2A 4LUEA 3IQLA 4JRIA 1RI0A 3OYEA 1PM3A 2QYZA 3OS0A 1VQ8A 3JB9D 2D0QB 1C6VX 1Q86C 4BDZA 2QI2A 1W2BP 4HCCA 2F69A 4FT4A 4J8OA 2OX7A 3UF4A 4OMMA 1Y96B 4F7UB 3REBB 2CYZB 3CCRA 4MZPA 2RHIA 3V7CA 2ZGWA 3V8KA 4E7SA 1B07A 4BE1A 1Y96A 2L2PA 1SHFA 1YFNA 2NYSA 3CBMA 1X6BA 2E5KA 2LNVA 2O4XA 2Z0WA 1F1BB 2I2LA 4IKFA 3C4SA 3PNWC 3HP9A 3OBWA 1P92A 2K6DA 4LXCA 2QEXQ 4M75C 1VQNT 2NWMA 2O88A 1D09B 5KYYB 3QZ9B 1NM7A 1X69A 1PHTA 5CCAA 4M78B 3QJYA 1YJWT 1ACMB 3EH2A 4Y91A 3NTHA 4CI0C 1YN8A 5LJ3j 4M7DC 1YJNT 4CRIA 2DD4A 4D8KA 1KSWA 2JJ9A 4XTWA 5CKBA 6AT1B 3BY7A 4M75F 2MI6A 4M7DA 1RACB 5A0GA 1G3YA 4EMKB 1ZUYA 1VQ5T 3OMGA 2CH4W 2VYTA 3CXCP 2LC4A 5GAN4 4QQ6A 4OB0B 5LJ5f 1VQ6A 3QXEB 4ELYC 2FRYA 1QVGA 3CCJQ 2RD1A 3EG9A 4OMPA 3ULRB 2L0AA 4BI4A 5GANe 1WHHA 2V1QA 1N8RC 2O31A 4XTXA 4N4GA 2JM8A 1WHMA 2CSIA 1TTHB 4UC4A 1AOJA 1YNZA 2QDLA 4PJOD 3MCAB 4FT2A 5GMKm 2L89A 4LDVA 1VQ6T 2CKKA 5GAOn 1UECA 4XTYA 4F7UG 2YUOA 3KXTA 3VYGA 3KBGA 3QBYA 2K2VA 2VASA 4RTWA 2FZCB 2HKNA 3C0CA 2A08A 1H3HA 3RUXA 1NYFA 1X2QA 1D1BA 4A4KA 1JRIA 2DA9A 2JMCA 2OAWA 5GANj 2X4WA 1VQ9A 1M2VB 2DL3A 4C8QF 3JCMb 2JZ2A 1M2VA 1J3TA 2LX9A 1ZSZA 4R0KA 1SSHA 2QQAA 2D8JA 1W2BS 1IGUA 3HRTA 5LJ5e 1VQ9Q 4C92G 2DPPB 2AKKA 2DX1A 3RNJA 4C5EA 1MNDA 4IUQA 2M9UA 2RHYA 3CCVQ 4V2SA 5GMKi 4ELZC 2AHJB 1EFNA 1G2BA 1KD1U 3GF5A 4DBRA 2KI7A 2VB6A 4PKCC 1K76A 2COWA 4DBQA 4HCKA 3SHWA 4WCIA 2A36A 1NEBA 1YITA 4PJMA 1TUGB 3FIFA 1NJIR 1WXBA 2KNBB 1YCSB 3OYYA 1GCPA 2KGTA 1A0NB 3L2UA 2FG0A 1D1AA 3E1SA 5GAMe 5IHIA 2GF7A 1Y0MA 1GCQC 2NUTA 3HFNA 2K3XA 3CC7A 1AZGB 2DK3A 2NUTB 4XU1A 1ARKA 2E3IA 4OP0A 1TUDA 3LH5A 3SB2A 5FU6C 2A37A 1W4SA 5A2QE 1QVGP 1WJSA 3Q1JA 4M7DB 2QA4Q 3JCMP 4GLMA 1MMGA 2XK0A 1VQ8Q 1PCXA 2DLPA 3M56A 2FRWA 3H6ZA 1GBQA 2ZPIB 5I2MA 1YWOA 1E7OA 2FB7A 2QQSA 4C92F 1Q81U 5DLQE 3I55T 1HK9A 5D7UA 2RMOA 4LDWA 4PJOF 4A4FA 2ZPBB 2QK0A 4FYWB 1JEGA 2K3BA 3RDVA 1SPKA 1JJ2A 1QP3A 4E2FB 1GXIE 1K0XA 1M1KC 4Z8AA 4M77A 2J6FA 3M0TA 2KQWA 2DZ9A 2QGGA 2RQVA 4D6WA 4CC2A 3OMCA 3SDZA 2PVOB 2BKDN 5I2SA 2M1HA 2RK1A 2EYZA 1KQ1A 1G8XA 2ZZDA 1R0CB 2LQKA 3G71Q 4MMLA 5GAMf 5GANf 4BDYA 2ENMA 2E65A 4EIKA 4HA8A 4PLIA 4C92D 3DB4A 2JTEA 4XU0A 4JJBA 1WXTA 2ZPGB 9ATCB 1BI2A 2MYSA 2YUQA 1VQPQ 3OYJA 2OAUA 3QO3A 1JJ2S 5GJWB 4ZGJB 2KMTA 3GPLA 2JTFA 4HXJA 3I5SA 2GTJA 2HL5C 1K9AA 2YT6A 1MGQA 5IN1A 4M77D 4N4HA 1G3SA 1OULA 5CO7A 1YI2A 3OSSC 1BK2A 2H3EB 2K2MA 1N9RA 3QKJA 2QASA 4Y28E 3CCRQ 4OMNA 5LJ3d 4ESRA 3A5ZB 2KYBA 3X26B 1FYNA 3CCLT 1BI0A 4M7DG 1MV0B 1YI2Q 2GFAA 2FZKB 3TCJA 1SKUB 2FPFA 1IZ6A 3CC2Q 1OEBA 1VQMA 3VKIA 1K73C 1M8MA 3ER0A 2P0QA 2HBWA 3G6EA 1OI1A 2DBKA 2EYQA 2XKOC 2EGEA 4F04B 2K5LA 4E6RA 2PVGB 3MEVA 2LQ8A 5GAOp 2CH4A 2LJ3A 4AG2C 3A8OB 3PMIA 1YIJA 2D1XA 5GAOm 5J3BA 4QQGA 4M77G 4C8QA 5GAN8 4OF1A 3OQ5A 3JCMh 4HT8A 4F7UF 3A8LB 2K7AA 2KY9A 3EHRA 3OY9A 3F70A 5KYUB 5GAN3 4A4GA 1MMNA 2CP5A 2Y4XA 2WACA 2X35A 2JVVA 2X9HA 1TH7A 4J83A 1AHJB 1QWEA 3T9NA 2MIOA 4QQDA 1TU0B 1LCKA 1MMDA 1ZUKA 3CCVT 3D7SB 1HXDA 1ZA1B 4FU6A 4NOYA 4RTUA 3NTIA 1SF9A 4JS4A 1KJWA 4KH0B 3PGGA 5C0MA 1WJQA 4BY6B 3OW2A 3E9GA 3FRNA 3CCRT 2E64A 3MP1A 2PU9B 2Y90A 3OSVA 5KE2A 4PJLA 2KROA 4Q5WA 4F7UE 5FWCA 1Q86U 2RK2A 1S72T 2ATCB 4OGEA 5A0DA 3CEYA 3CPFA 4C0DB 4M4ZA 2P84A 4IURA 4RCCA 2VVKA 3R6NA 2DXUA 2NUPB 2DL4A 4HT9A 3DKMA 2KT8A 3OYIA 2QDYB 1KD1C 3GNGA 4C5HA 3FDRA 2YHTA 1Q86R 2RN8A 1BCOA 2KR3A 3M57A 3QSUA 1YHQQ 4CC7A 1QVFP 4PJOE 3BE3A 4PNOA 1VQLQ 4PL6A 1Q7YR 3VS6A 1PRLC 4MDWA 4C92B 2V8IA 1QP2A 1TWBA 3OYNA 2ROTA 1IO6A 4YTLA 1M1FA 4C92A 3QDFA 5GAN6 1WHLA 2VGNA 3AHUA 2WSEE 3J80E 2G3RA 4HKEA 2WSFE 2YRDA 1Q7YU 3ASKA 1UTIA 1UHFA 1R8OB 4OB2B 4F17A 1ZBXA 1RLQC 1AZEA 1K9MU 1ABQA 1D0YA 5FWBA 1BU1A 2R58A 1W70A 4M78C 1AD5A 3MJXA 4C8QC 2LX7A 1VQ4T 4J9IA 2DRMA 1K4US 2DL7A 4E7IA 4Z89A 1T0HA 2CUBA 3GLXA 1K1ZA 1N8RR 3U23A 2XHCA 4BB7A 3JCMX 2MPXC 2FO0A 1KQSS 2ECZA 2HDAA 3VYHB 3JB9I 4KBMB 1OPLA 2JS0A 4O6JA 3FB9A 3ZBDA 5FRMA 4N4IA 2DVEA 3THKA 5GAOl 3PTAA 1FMWA 3PT9A 3I55Q 2ZPEB 2ED1A 8ATCB 2DERA 4FSXA 4C0DC 2K5FA 5GAOq 4NL2A 1WYXA 1TXQA 2DYBA 4E47A 2DIGA 1H3ZA 3OYLA 3CMAT 3CMEQ 4M7AD 4L59A 3M9QA 2PTKA 1FXXA 1JBMA 1HYOA 4L6V5 3JCMV 1K8AR 4OMFB 1YITT 4Z88A 1WA7A 4ME7A 3I9QA 5KE3A 3CPWP 1VQ7T 1MV3A 3CCET 2V26A 4ORZA 2EJGA 5GMKh 1UE9A 2QQRA 3P8HA 3L2WA 2EPDA 2SEMA 3OYGA 3CC2A 3JB9F 4JS5A 1O9SA 3REAB 2DZCA 3EFOB 2DETA 1VQ8T 3TREA 1GFCA 3QZ5B 1PKSA 2QA4A 1YHQT 2L3RA 1M2OA 2CZ6B 1Z9ZA 1D0XA 3A8HB 3RERA 1U1SA 3LWIA 2FHDA 4JRQA 1QWFA 5GAOr 3PIPA 4QVZA 2OTLT 1BB9A 1AEYA 3PFSA 4B6MA 2YXYA 5I21A 2CS7A 1JB0E 2AZSA 2MF2A 2A28A 2CP0A 2EGAA 4KH1B 2KE9A 3OYKA 3CC7Q 1NZ9A 1KK7A 1VQPA 4FCYA 1G5VA 4FM4B 3DLLA 1EZZB 1IXDA 1KG1A 5M9OA 1RABB 2FEIA 2IVWA 3CMET 2E70A 1I5OB 1W6XA 1FWZA 3WXMB 5IHKA 3A1PA 2KRSA 3I56Q 4C8QD 2F5KA 3AT1B 4M75B 4RUGA 2L8DA 1ABOA 2KSSA 3OB9A 4OMLA 1XJWB 4M7AC 1OQKA 5C6SA 1SRLA 4BUGA 1B3QA 2O2OA 3JCMd 1NJIC 1IHWA 1GRIA 1IB8A 2HQHA 4M75G 4F16A 4MMKA 1KHIA 4XAXB 2O4XB 2XIDA 3SD4A 4RTTA 3L2QA 3QHSA 3QWYA 2DEUA 1Y71A 2RI2A 2DTHA 3DLMA 4FSSA 3X20B 3RBBB 4XQ3A 5D6WA 1WIEA 1UEBA 2H8HA 3OA6A 5GAMh 2LZ6B 3OBYA 2SRCA 4JRKA 1YJNQ 4II1A 1I81A 2QGFB 2YRCA 1ZQ1A 3RR6A 3H0IA 2GFUA 4RMOA 1VQLA 3OYDA 1X01A 2HBPA 3S3MA 1WLPB 3S6WA 1SSFA 2ED0A 3FEOA 2F2VA 1AWOA 1X43A 2AIRB 2EVRA 3WVEB 1WHJA 3PIOA 4OMQA 2L3PA 2E3HA 4M78D 3JCMg 2EJFA 1M3CA 4QKUA 2K57A 4M7AF 2FPEA 3BW1A 2DXBA 4RTXA 5L8RE 2QTVA 1WNLA 2DRKA 4A4EA 3NFCA 1M3AA 3EFSA 5GANd 2DEQA 3EHQA 4X9CA 4QVDA 1OZ3A 2YLBA 1KQSP 3G6ET 5KYWA 2VXEA 4GBQA 2MCNA 4RKUE 1V76A 2JM9A 4JZ3A 2OTJQ 4OB3B 3RMQA 1PSFA 3EFOA 4ATOA 2CZ7B 1VQ4A 1N9SA 3LH0A 3OYHA 1I8FA 4PFOA 2MOXA 1OOTA 3TSZA 2YUPA 2HL3A 5FROA 2KDSA 4QW2A 3CCLA 4CC3A 4JRPA 1PD0A 2I0NA 3O5ZA 4ZGEB 7AT1B 3G6EQ 1NE8A 3J81E 1U8RA 3KFVA 3G4ST 1YJ9T 4J9EA 4LUDA 4LE9A 4BE0A 1K0SA 4M78G 4JJCA 2CDTA 1JO8A 4GY5A 4C92C 2COZA 2HMAA 5KYXA 1I1JA 4ZTFA 5LJ3g 1K73U 3QUIA 1VQ9T 1VUBA 2LJ1A 1D1CA 2DTOA 4X9DA 4DA4A 3CMEA 3V7RA 1BI1A 1KD1R 5IXFA 1NEGA 5IAYA 2C0TA 3M55A 2CT3A 3G4SQ 3JAME 1Q82R 3UA6A 1K9MR 2L3SA 2DO3A 1K73R 2HSEB 4A54A 2RQTA 3L42A 4PK4A 1VIFA 3CCJT 2YLCA 1CKBA 2RJFA 3G4SA 4FW2A 2BTTA 4E7KA 1Y7XA 1KC8R 1YHQA 5J26A 1FMVA 2F2XA 4JUVA 4EDUA 3E2UA 2HNIA 2KRNA 1UHCA 3VS5A 1WXUA 3CCSA 3MP8A 2OTLQ 5KYYA 4IIMA 3E19A 1TS9A 3H8ZA 4RTVA 2JOYA 4KGVB 3HSBA 4M78F 1Q95G 3I55A 3OYCA 5IT9E 2E1HA 3N5BB 1JXOA 1KQ2A 1KIKA 2RO0A 1WZOA 2K5IA 3A8MB 2EQIA 1XQHA 4LDUA 4XU3A 2XMFA 4E7LA 2XICA 4EMKA 3EGXA 2RHZA 1SRMA 5HY6A 3JV3A 3H0HA 1H92A 5GAN5 4QVCA 2X51A 2O9SA 5HCKA 4PJOG 1BKBA 3NGPA 4J9CA 2CZ1B 3TQ7P 1E6HA 2AK5A 1NLPC 1YWPA 4M7DD 2ZPFB 1N6AA 2B8AA 4J9BA 1PG5B 1NYGA 1W2BA 3CXCA 2JNGA 5GAMj 3S3OA 3G71A 1H8KA 1YJ9Q 5HKCA 4IUPA 3HRSA 1EX4A 2PVDB 1D3BA 4MZTA 1Q81R 2EQKA 1VOMA 4A53A 2E5QA 4DEYA 1S72Q 1UJ0A 2RHXA 4RTYA 2JMAA 3SFMA 4WF2A 5J39A 2VXFA 1WPYA 1G3TA 1WFWA 3QYGB 4CC4B 1O75A 2VV5A 2FPDA 1WGSA 1M90U 1IGQA 2PNIA 5AT1B 1VQKA 3EGDA 2RNAA 4ZN1A 3I56A 4M7AA 2HQXA 3LGFA 3VS0A 2PUOB 4OVAA 2VKNA 1R77A 2OI3A 2M16A 2LP5A 1BI3A 4MDXA 1R0BG 2CZ0B 2R57A 1B7TA 1WJRA 1VQPT 3CCST 2RQRA 4F14A 1TOVA 3OS5A 2OTJT 4JZ4A 3CQTA 5LJ5h 1PRMC 1GFDA 2A0FB 2FL7A 4VUBA 2JN0A 3CCQA 1M9SA 1YP5A 1IHVA 4BY6C 2HKQB 4AG1C 5D6XA 3GIBA 4RCBA 1AWWA 3L1AA 1UGPB 3I5RA 1I4K1 4J7FA 2EIFA 4PJJA 1QVGS 3KUFA 4PJOC 2AZVA 3HTRA 4KGZB 1RAGB 5CIUA 2NUZA 3R6OA 1C1AA 1YJWQ 2BUDA 5I11A 2M0OA 5CQYA 1NBEB 5L23A 4PJOA 2YDLA 4Z02A 3QJ6A 3QIIA 1RAFB 4LDYA 4M77F 5CKFA 2VWFA 4M77E 3OYBA 5LJ5g 1X6GA 5FW9A 2NUPA 4RTZA 5FU6B 3TSWA 5KYUA 1B34A 4M7DF 2X3WD 2LCLA 3LYIA 4OMOA 3JCMc 4X1VA 5GJVB 4OB1B 4JDSA 3V8LA 1AWJA 5EC7A 4PFZA 1VQOT 3RKWA 2R5MA 3CPWS 2EQMA 2R5AA 4LN2A 3LX7A 4TVRA 2VGMA 4J7IA 4AFZC 1MHNA 3GP8A 1M4ZA 1QKXA 2LMJA 1ZBJA 2DFUA 5GAMg 4KUDK 4MZMA 1VQ4Q 4FW1A 5GANg 2ROLA 3L2RA 2KVQG 2EYXA 2IIMA 3CD6A 5GAN7 1XOVA 2DMOA 2D9TA 3G71T 4C0ZA 1NJIU 1OYXA 1UFFA 3C12A 1NPRA 4LDXA 3LW5E 3I35A 4HVVA 5HK3A 5CQXA 1WHKA 1OU9A 2JUFA 4HVUA 5GMKe 2DD5A 4X34A 4K11A 4M77C 1RAEB 4BE2A 2RPNA 2PQWA 4LD9K 2J6KA 4J5YA 2A7YA 4N0AA 4EPCA 1UG1A 2D6FA 3QWXX 5I22A 2E41A 2CREA 2EQUA 2RQWA 3CCUQ 2KAFA 2QG9B 2OTJA 3H0FA 3RIRA 3QDRB 1Q82U 1KC8U 1D0ZA 3M59A 3PMTA 1K8AU 3SWNA 5CK9A 1K8AC 3GNFB 3JB9J 1QCNA 1IREB 5KH6A 2W10A 1U3OA 5GAMd 3M0RA 2DYIA 3CCUT 1M1KR 2MMPA 4EMKC 3I56T 1JU5C 4XK8E 4M75E 1KQSA 4ZGDB 3M53A 4J9FA 1MNEA 2CT4A 2XU8A 4F7UA 3HPWA 1QKWA 2QQ9A 4BI3A 4J6YA 2MK5A 4J6XA 4C5GA 5IHNA 4DOWA 2LT4A 3HFOA 1GCQA 1PC0A 2DVJA 2GGRA 1FX7A 1ZA2B 1NG2A 1HD3A 1IRXA 1HJDA 5CR2A 2EWNA 2CP3A 1UGRB 3V7SA 4E7ZA 2MAMA 1AVZC 1M30A 1MUZA 2KXDA 4LD6A 1QW1A 3UPUA 4C0GA 2EAYA 2C0OA 5EG2A 4JJNK 3OYAA 3EG9B 2RJEA 1SEMA 3VS4A 1YCYA 2X4YA 3CC2T 5DY9A 3FC3A 4OGCA 1RADB 4PJNA 1QMCA 3NTKA 5DM7R 3CCVA 1B34B 1M90R 4ZTJA 3OS1A 3HL8A 2DL5A 1M8VA 2BE9B 2DAQA 2VC8A 3JRZA 5A0LA 5KCOA 1VQ7Q 3CCEQ 3CBPA 2K3YA 3CBOA 2PUKB 3CCSQ 1AWXA 5FU7B 3VS1A 2XDPA 1LVKA 1QQJA 3MEUA 1VQNA 3M5AA 3M0UA 2RI5A 5AYFA 4R56A 1GBRA 2A3LA 3C95A 4FYXB 4C8QG 4XTUA 1VYTA 1Q82C 3EG3A 3TVTA 3OYMA 4IUVA 2KK4A 4XTZA 2ZAEA 1CKAA 3SEMA 2X4XA 2OJ2A 2ABLA 5GMKl 3VV0A 2QXFA 2E4HA 4Y92A 2KXCA 1VQNQ 3CD6T 3JB9H 3C94A 4R55A 1UGSB 4IUUA 3X25B 5IH2A 1Q7YC 1T3SA 1BBZA 1G3WA 4IIOA 3MP6A 3LWHA 1KFZA 3HHTB 1BIAA 1X6OA 1JJ2P 3CMAA 2GBQA 2P4RA 1VQOA 1C0MA 3HRUA 2QEXT 5DLOA 2HAXA 3MPUB 3V8JA 3EFRA 3MEAA 4KRTA 1Q81C 4JLIA 2K79A 3PVLA 4HVWA 5IXBA 5KYXB 3SWNB 2M51A 4A4HA 4NS5A 1OU8A 1VQOQ 2EJ9A 2E12A 1M1KU 2DE0X 2LNHB 5KYNA 5LJ5d 1UDLA 4JPBW 1QCOA 3UT1A 2V8KA 3BDLA 5LJ3e 1NLOC 3M0SA 1WX6A 2JXBA 2RHUA 2P4TA 2PZ1A 1RAHB 3M58A 1VA7A 1SG5A 5CKHA 3OS2A 4IUTA 4C8QB 3CCQQ 1PD1A 4M75D 4PFPA 4FL6A 1UUEA
chains in the Genus database with same CATH topology
2RHIA 5HY6A 2ZGWA 3V7CA 3V8KA 4BE1A 1Y96A 3M4YA 1KD1C 3GNGA 2QTXA 2MWOA 4C5HA 2ZPHB 3QYHB 1DJ7B 5GAN5 4M7AE 3CBMA 3FDRA 4QVCA 2LNVA 2O4XA 2YHTA 3JCMW 4J6WA 4PJOG 2XI9A 1BKBA 3M57A 3QSUA 2I2LA 2CZ1B 4IKFA 4PJOE 4M7DD 3C4SA 3PNWC 2ZPFB 3HP9A 1N6AA 2B8AA 3OBWA 4PNOA 4PL6A 2QA4T 5FLXE 4MDWA 4C92B 1P92A 2V8IA 3FJPA 1QP2A 4M75C 3OYNA 3JB9G 1VQNT 1OZ2A 4YTLA 2XDDA 3CXCA 1W2BA 3QZ9B 1M1FA 4C92A 2JNGA 5GAN6 2VGNA 3BDUA 5CCAA 2EKOA 5GAMj 2FVUA 3G71A 3S3OA 4M78B 3QJYA 1YJWT 4M77B 3AHUA 2WSEE 3J80E 1V29B 5HKCA 1PSEA 4IUPA 3HRSA 2G3RA 4L5GA 4HKEA 4Y91A 2WSFE 2PVDB 1D3BA 1Q7YU 3NTHA 3ASKA 4CI0C 4MZTA 5LJ3j 4M7DC 2K4YA 1N27A 1R8OB 4OB2B 2HD0A 2EQKA 1ZBXA 1YJNT 4A53A 4CRIA 2DD4A 1K9MU 2E5QA 1QVFA 4XTWA 5CKBA 4M7AG 2R58A 3BY7A 4M75F 2MI6A 4DQ2A 4M7DA 4M78C 2RHXA 3ME9A 5A0GA 1G3YA 1NPPA 3SFMA 4C8QC 5LL6S 4EMKB 4WF2A 1VQ4T 5J39A 2BIVA 2VXFA 4C0FA 3OYFA 1VQ5T 1WPYA 2GQVA 3OMGA 1G3TA 2VYTA 2LC4A 3QYGB 5GANh 5GAN4 3A8GB 4E7IA 1O75A 2VV5A 4QQ6A 1YJWA 4OB0B 5LJ5f 1WGSA 1VQ6A 3GLXA 1M90U 3QXEB 4ELYC 3JCMJ 3S3NA 1VQKA 1QVGA 2XHCA 2RJDA 4ZN1A 2RD1A 4BB7A 3I56A 4M7AA 3X24B 4JLGA 2HQXA 3SWNC 4BI4A 3JCMX 3LGFA 1KQSS 5GANe 3CC7T 3VYHB 2PUOB 4C8QE 4BACA 3JB9I 4KBMB 2QEXA 4OVAA 1N8RC 1VQLT 4O6JA 3FB9A 3ZBDA 5FRMA 4XTXA 2RA2A 4N4IA 2DVEA 2M16A 4N4GA 3VU3C 5FRNA 5GAOl 2JTMA 3PTAA 1BI3A 4UC4A 4MDXA 2CZ0B 2R57A 4B9WA 3PT9A 3O8VA 2ZPEB 4PJOD 1WJRA 3MCAB 1VIEA 4FT2A 4C92E 2C06A 1VQPT 5GMKm 2RJCA 3CCST 2L89A 4LDVA 1VQ6T 4FSXA 2XD0A 3OS5A 2OTJT 2DXCA 5LJ5h 4C0DC 2K5FA 1D3BB 5GAOq 4NL2A 3RESA 2CKKA 1LJOA 5GAOn 4XTYA 2FL7A 4VUBA 4F7UG 4E47A 2DIGA 1U1TA 1VQ5A 2JN0A 3CCQA 3KXTA 3VYGA 1M9SA 3VUZA 3OYLA 1H3ZA 3CMAT 2XG8D 4BY6C 3KBGA 3QBYA 5D6XA 3GIBA 2K2VA 2LRQA 4RCBA 4M7AD 3L1AA 4L59A 3VJPA 1LOJA 1UGPB 3M9QA 1FXXA 1JBMA 1I4K1 4J7FA 1X75C 2EIFA 3MO8A 4L6V5 3RUXA 4OMFB 3KUFA 4KULA 3JCMV 1YITT 1QVGS 4PJOC 2CGHA 4A4KA 1JRIA 4ME7A 2P0KA 5GANj 3FLGA 5CIUA 2X4WA 5KE3A 1VQ9A 3R6OA 1VQ7T 3CCET 1YIJT 2BUDA 2M0OA 5CQYA 3LLRA 3MEWA 2EJGA 5GMKh 4BD3A 2E6NA 4PJOA 4C8QF 3JCMb 4Z02A 3QJ6A 2JZ2A 2QQRA 2LX9A 3P8HA 3L2WA 3QIIA 3OYGA 3JB9F 3CC2A 2E6ZA 4PLLA 4HCZA 4JS5A 2L5QA 2QQAA 1O9SA 4LDYA 4M77F 2DZCA 5CKFA 1W2BS 1KHCA 2LVMA 2WSCE 3HRTA 4M77E 1VQ8T 3TREA 3OYBA 3QZ5B 5LJ5g 2QA4A 1YHQT 2L3RA 5LJ5e 4C92G 2LT1A 2DPPB 2CZ6B 5FU6B 4RG2A 3A8HB 1UGQB 1VQMT 4C5EA 4IUQA 1B34A 5D6YA 3RERA 4M7DF 2M9UA 2LCLA 1U1SA 2RHYA 3LYIA 4V2SA 5GMKi 3LWIA 4ELZC 2FHDA 4JRQA 2AHJB 5GAOr 1KD1U 3JCMc 1WQ7A 3PIPA 4QVZA 2OTLT 3M54A 3GF5A 3PFSA 1WQWA 3BFMA 4OB1B 4DOVA 4PKCC 4JDSA 2LTOA 5I21A 2CS7A 1JB0E 3V8LA 2MF2A 1BIBA 3M4GA 1VQOT 1Y07A 1H641 3RKWA 1YITA 2NLUA 3OYKA 1EIFA 2R5MA 3CPWS 1NZ9A 2EQMA 2R5AA 1M1GA 1VQPA 3ZFJA 1G5VA 3LX7A 2RB6A 4FM4B 4TVRA 3FIFA 3MHXA 3DLLA 1KG1A 2VGMA 3RKXA 5M9OA 2IVWA 4J7IA 2E70A 3INZA 3CMET 1FWZA 3WXMB 1MHNA 3OYYA 3GP8A 1M4ZA 3L2UA 3CCJA 3JCMf 3E1SA 2F5KA 4C8QD 5GAMe 3JCMQ 5GAMg 2GF7A 4M75B 4KUDK 3UWNA 4MZMA 2L8DA 2KSSA 5GANg 3HFNA 2K3XA 3OB9A 3CC7A 3X28B 3ZEHA 3L2RA 2KVQG 2DK3A 3CD6A 4M7AC 5C6SA 5GAN7 4M7DE 1XOVA 4XU1A 4BUGA 5LJ5j 4E7HA 4OP0A 2D9TA 3G71T 4C0ZA 5HK0A 3META 3SB2A 1OYXA 1NJIU 5FU6C 3JCMd 1NJIC 2DKGA 3C12A 1NPRA 1W4SA 5A2QE 3CCEA 1VQ7A 3LW5E 1WJSA 4LDXA 4M75G 3Q1JA 4M7DB 4MMKA 3J7AF 5HK3A 3EAEA 3P8BB 5CQXA 3CCUA 3JCMP 2P0PA 2JUFA 2YRVA 2XK0A 1KHIA 4XAXB 3M56A 5GMKe 2DD5A 3H6ZA 2O4XB 2XIDA 3SD4A 3URGA 1RL2A 3L2QA 3QHSA 4X34A 4M77C 2ZPIB 4BE2A 5I2MA 2V8JA 2PQWA 5GMKj 4LD9K 4J5YA 2FB7A 2A7YA 2QQSA 4N0AA 4EPCA 5GAN2 4C92F 2D6FA 1Y71A 2RI2A 2DTHA 3DLMA 1YJ9A 1Q81U 5DLQE 3I55T 2E41A 3X20B 1HK9A 4LDWA 4XQ3A 2EQUA 5D6WA 2KAFA 2XDBA 1UEBA 4PJOF 4A4FA 3UDCA 2ZPBB 2OTJA 3OA6A 4GLKA 3RIRA 3QDRB 1Q82U 5GAMh 1KC8U 2DTIA 3OBYA 3M59A 2Y4YA 3PMTA 1JJ2A 4JRKA 1QP3A 2ZCFB 1K8AU 5CVIA 4BI8B 2OTLA 1M1KC 1GXIE 4KUIA 4M77A 3SWNA 5CK9A 4II1A 2H3JA 2KQWA 1I81A 3GNFB 2DZ9A 3JB9J 1K8AC 1ZQ1A 4D6WA 1S72A 1IREB 5KH6A 3VUBA 2GFUA 4M75A 1QVFS 4RMOA 1VQLA 3OYDA 1QVPA 1X01A 2HBPA 5CAIA 4NL3A 5GAMd 3S3MA 3OMCA 3SDZA 2PVOB 3CCUT 5LJ3f 2MMPA 3S6WA 1SSFA 3FEOA 4EMKC 3I56T 2BKDN 4E7JA 4XK8E 4M75E 5I2SA 2M1HA 2RK1A 1KQSA 3WVEB 1KQ1A 4ZGDB 3M53A 3WVDB 3PIOA 2ZZDA 2LQKA 2XU8A 3P8DA 1I5LA 4M78D 3JCMg 3QPHA 4F7UA 4MMLA 3HPWA 2EJFA 5GAMf 2QQ9A 4XU2A 4BI3A 4J6YA 2K57A 5GANf 4M7AF 2E10A 3E9FA 4J6XA 2VUBA 4BDYA 4C5GA 2E65A 2DXBA 3BW1A 5L8RE 4DOWA 2DJZA 2LT4A 3HFOA 4HA8A 3DB3A 4PLIA 4C92D 3DB4A 1FX7A 1WNLA 4A4EA 3NFCA 3EFSA 5GANd 2DEQA 4XU0A 4EMHA 4M7AB 2EWNA 5CR2A 4X9CA 1UGRB 2ZPGB 3V7SA 4C5IA 4N0AC 1BI2A 4QVDA 2RM4A 2MAMA 1OZ3A 2IG0A 3OYJA 2OAUA 2YLBA 3QO3A 4LD6A 1K73U 3HKSA 1JJ2S 4ZGJB 1QW1A 2KMTA 3GPLA 4XTVA 4C0GA 3G6ET 2VXEA 2JTFA 3JSCA 2EAYA 3UPUA 5EG2A 4JJNK 4RKUE 4P5NA 1M5Q1 4OB3B 3RMQA 1PSFA 1YBYA 5CKEA 3OYAA 4ATOA 4HCBA 2RJEA 2CZ7B 1MGQA 1YCYA 2O01E 4M77D 2X4YA 4N4HA 1G3SA 5IN1A 3JCMe 3CC4T 3TU4K 3CC2T 5DY9A 3FC3A 1VQ4A 5CO7A 1N9SA 4OGCA 3OSSC 1YI2A 1ZHIA 3LH0A 4M78A 1I8FA 3OYHA 2HQEA 3NTKA 1N9RA 5DM7R 3CCVA 1B34B 3QKJA 4ZTJA 4Y28E 3OS1A 5FROA 2KDSA 3HL8A 3LGLA 3QG1A 1M8VA 5LJ3d 2DAQA 3A5ZB 4QW2A 3X26B 3CCLA 2RI3A 2LCCA 2VC8A 2MWPA 3JRZA 5A0LA 1BI0A 3CCLT 5KCOA 4O5VA 4M7DG 4JRPA 3CBPA 2K3YA 4ZGEB 4FIBA 1NE8A 3CBOA 3J81E 1BYMA 1U8RA 3L2VA 3RMSA 2PUKB 3G4ST 1YJ9T 2GFAA 3TEEA 1VQKT 2LDMA 4BE0A 3TCJA 3L2ZA 4M78G 5FU7B 1LNXA 1IZ6A 3CXCS 4GY5A 2XDPA 4C92C 3CCMT 3VKIA 1VQMA 1M90C 3MEUA 1K73C 1VQNA 5LJ3h 3ER0A 3M5AA 2P0QA 2RI5A 5AYFA 3RKYA 5LJ3g 4R56A 2A3LA 4ZTFA 3C95A 3QUIA 2GCXA 4C8QG 4XTUA 1VUBA 1VQ9T 1Q82C 2DTOA 3G6EA 1OI1A 4X9DA 3G7ZA 3OYMA 2EYQA 3CMEA 4DA4A 4IUVA 3V7RA 2XKOC 2KK4A 4XTZA 1BI1A 2F5TX 2EQJA 5FU7C 5IAYA 2K5LA 2X4XA 3M55A 2PVGB 3MEVA 4PJOB 4RG8A 4B9XA 5GMKl 3VV0A 1N8RU 5CKDA 2LQ8A 3JAME 3CPWA 5GAOp 2QXFA 1YI2T 3CD6T 3CCQT 3OW2S 3JB9H 3A8OB 3C94A 3PMIA 2DO3A 1YIJA 4R55A 1UGSB 5GAOm 5J3BA 4A54A 4QQGA 4ZN3A 4IUUA 4M77G 3X25B 4C8QA 1Q7YC 5GAN8 4OF1A 3OQ5A 3JCMh 4HT8A 3L42A 1G3WA 1VIFA 3CCJT 3CCMA 4F7UF 2FYKA 3A8LB 2KY9A 2YLCA 4KT0E 3MP6A 3OY9A 3F70A 1K9MC 2RJFA 5GAN3 3LWHA 4A4GA 3G4SA 3HHTB 4M78E 4EMGA 1BIAA 1X6OA 1XNIA 2Y4XA 3CMAA 4E7KA 2WACA 2X35A 2JVVA 1Y7XA 1YHQA 2X4JA 1TH7A 5J26A 4J83A 1VQOA 3GOXA 1AHJB 3HRUA 5KCHA 5DLOA 2QEXT 2HAXA 3T9NA 2EFIA 4QQDA 3V8JA 4JUVA 3EFRA 3MEAA 4EDUA 1UB4A 2DIQA 2DXTA 2HNIA 1Q81C 3CCSA 3MP8A 3CCVT 4JLIA 1XTDA 1HXDA 1KC8C 1YJNA 4FU6A 4NOYA 3E19A 3SWNB 2QQBA 3H8ZA 3NTIA 4A4HA 3CC4A 4JS4A 2JOYA 2RH2A 4NS5A 3PGGA 5C0MA 1WJQA 4BY6B 2EJ9A 4EMKA 2E12A 4JRIA 1RI0A 5LJ5d 3OYEA 3E9GA 3OW2A 3FRNA 4M78F 3CCRT 1M1KU 3HSBA 3OS0A 1VQ8A 3JB9D 2E64A 3I55A 3UT1A 3MP1A 2PU9B 2V8KA 2Y90A 3BDLA 3OSVA 5KE2A 5LJ3e 3OYCA 5IT9E 2E1HA 2D0QB 3N5BB 1Q86C 4Q5WA 2RHUA 4F7UE 1KQ2A 4BDZA 2P4TA 2RO0A 2RK2A 1Q86U 2K5IA 1S72T 3A8MB 3M58A 4OGEA 2QI2A 5A0DA 1XQHA 3CEYA 4M75D 4HCCA 2F69A 4FT4A 4J8OA 4C0DB 4IURA 4LDUA 4RCCA 5CKHA 2DXUA 4XU3A 1Y96B 3OS2A 4F7UB 3DKMA 4HT9A 3CCRA 2CYZB 4IUTA 4C8QB 4E7LA 2XICA 4MZPA 3CPFA 3OYIA 4FL6A 2RHZA 2QDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  4F7U G;  2ZGW A;  3V8K A;  4M7D G;  5GMK e;  1Y96 A;  1U1T A;  2JN0 A;  2QTX A;  3QHS A;  4M77 C;  5GAN 5;  3GIB A;  4RCB A;  4M7A E;  4QVC A;  4M7A D;  5GMK j;  3L1A A;  2YHT A;  2FB7 A;  4J5Y A;  4N0A A;  3JCM W;  1LOJ A;  4J6W A;  4C92 F;  3L2Z A;  4M78 G;  5GAN 2;  1LNX A;  4PJO G;  1I4K 1;  1JBM A;  2DTH A;  3JCM P;  3QSU A;  4C92 C;  2I2L A;  2E41 A;  3RUX A;  3JCM V;  1HK9 A;  4PJO E;  4XQ3 A;  2CGH A;  5LJ3 h;  4M7D D;  4PJO C;  5LJ3 g;  1JRI A;  3RKY A;  4PNO A;  4C8Q G;  3QUI A;  4PJO F;  5GAN j;  4XTU A;  4C92 B;  2DTO A;  3RIR A;  3FJP A;  4M75 C;  4X9D A;  5GAM h;  3JB9 G;  2DTI A;  2EJG A;  5GMK h;  3V7R A;  4JRK A;  4PJO A;  4XTZ A;  4C8Q F;  3JCM b;  4C92 A;  5GAN 6;  4M77 A;  3BDU A;  3SWN A;  1I81 A;  3JB9 J;  2DZ9 A;  5GAM j;  3JB9 F;  4PJO B;  5GMK l;  4M78 B;  4M77 B;  3AHU A;  5GAO p;  4M77 F;  2DZC A;  4M75 A;  1X01 A;  3JB9 H;  4M77 E;  5CAI A;  4NL3 A;  5GAM d;  5LJ5 g;  5GAO m;  4Y91 A;  4A54 A;  1D3B A;  4C92 G;  5LJ5 e;  4M77 G;  4C8Q A;  5LJ3 f;  5LJ3 j;  4M7D C;  4EMK C;  5GAN 8;  3JCM h;  4HT8 A;  4M75 E;  4A53 A;  1B34 A;  4F7U F;  3RER A;  4M7D F;  1KQ1 A;  2FYK A;  1U1S A;  4V2S A;  2YLC A;  5GMK i;  4XTW A;  4M7A G;  3BY7 A;  5GAN 3;  5GAO r;  4M75 F;  1WQ7 A;  3JCM c;  1I5L A;  4M78 D;  3JCM g;  4DQ2 A;  4M78 E;  4MML A;  4M78 C;  1BIA A;  4EMG A;  4F7U A;  2EJF A;  4M7D A;  5GAM f;  4C8Q C;  4XU2 A;  4EMK B;  1WQW A;  3BFM A;  4J6Y A;  4WF2 A;  2K57 A;  2VXF A;  5GAN f;  4M7A F;  1TH7 A;  1WPY A;  2E10 A;  4J6X A;  5I21 A;  2E65 A;  3BW1 A;  3V8L A;  5GAN h;  5GAN 4;  1BIB A;  2DJZ A;  3HFO A;  3M4G A;  4HA8 A;  3V8J A;  4C92 D;  4JUV A;  1H64 1;  3RKW A;  1WNL A;  3EFR A;  5LJ5 f;  2DXT A;  3EFS A;  2HNI A;  5GAN d;  2DEQ A;  4XU0 A;  4EMH A;  4M7A B;  2EWN A;  2RB6 A;  3JCM J;  4X9C A;  3FIF A;  4JLI A;  3V7S A;  4N0A C;  1HXD A;  4QVD A;  2RM4 A;  3RKX A;  4NOY A;  2RD1 A;  3SWN B;  3QO3 A;  2YLB A;  3INZ A;  4M7A A;  3SWN C;  3JCM X;  4XTV A;  2VXE A;  5GAN e;  2EAY A;  3JCM f;  4C8Q E;  3PGG A;  4C8Q D;  5GAM e;  1M5Q 1;  3JCM Q;  3JB9 I;  2EJ9 A;  4M75 B;  4JRI A;  5GAM g;  5LJ5 d;  3HSB A;  4M78 F;  5GAN g;  3FB9 A;  3HFN A;  1MGQ A;  1YCY A;  4M77 D;  4XTX A;  2RA2 A;  2E64 A;  2DVE A;  3JCM e;  3JB9 D;  3VU3 C;  2Y90 A;  5DY9 A;  5LJ3 e;  5GAO l;  4M7A C;  1N9S A;  2E1H A;  5GAN 7;  1KQ2 A;  4M78 A;  1I8F A;  4XU1 A;  4F7U E;  5LJ5 j;  4M7D E;  4OP0 A;  1N9R A;  4PJO D;  1B34 B;  3SB2 A;  4C92 E;  3JCM d;  5GMK m;  2DKG A;  1M8V A;  4RCC A;  5LJ3 d;  5LJ5 h;  4M75 G;  2DXU A;  1D3B B;  1Y96 B;  4NL2 A;  4XU3 A;  3RES A;  4MMK A;  4F7U B;  5GAO q;  1LJO A;  4C8Q B;  4HT9 A;  2VC8 A;  4M7D B;  4EMK A;  4M75 D;  5GAO n;  4XTY A; 
#chains in the Genus database with same CATH topology
 3M4Y A;  3CCM Q;  3CD6 Q;  2QTX A;  2MWO A;  2ZPH B;  3QYH B;  1DJ7 B;  4M7A E;  3VRY A;  1ZSZ C;  3JCM W;  4J6W A;  2XI9 A;  2L3Q A;  2F2W A;  1UGV A;  3UA7 A;  2DNU A;  3UAT A;  2QA4 T;  1QLY A;  2B86 A;  5FLX E;  3FJP A;  3VS7 A;  2HZY A;  3JB9 G;  2M02 A;  1OZ2 A;  2XDD A;  3MKD A;  3BDU A;  2EKO A;  2BZ8 A;  2FVU A;  2AKL A;  1Y57 A;  1YIJ Q;  4M77 B;  4DBH A;  4ZNX A;  1V29 B;  2J7I A;  1PSE A;  2FZG B;  4L5G A;  1PNJ A;  2K4Y A;  1N27 A;  2HD0 A;  1QVF A;  4D8D A;  4M7A G;  4ANJ A;  2M0Y A;  1VYV A;  4DQ2 A;  3ME9 A;  1NPP A;  2CP7 A;  4LNP A;  5LL6 S;  2BIV A;  4C0F A;  3OYF A;  1VQM Q;  2GQV A;  5GAN h;  1AT1 B;  2LQN A;  3A8G B;  3EGD B;  1YJW A;  2EYW A;  3JCM J;  3S3N A;  2RJD A;  3X24 B;  4JLG A;  3SWN C;  1ZSZ B;  1I07 A;  3CC7 T;  3ZL7 C;  1I0C A;  4C8Q E;  3CCL Q;  4BAC A;  1RAI B;  2QEX A;  1VQL T;  2EYY A;  5KYW B;  2RA2 A;  3VU3 C;  5FRN A;  2IPO B;  2JTM A;  2CSQ A;  4B9W A;  3O8V A;  2AT1 B;  1VIE A;  1Z9Q A;  4C92 E;  3EG2 A;  2C06 A;  2CP2 A;  2RJC A;  1SHG A;  2XD0 A;  2DXC A;  4JJD A;  1D3B B;  1RAA B;  3RES A;  1LJO A;  2GNC A;  3G1J A;  5ECA A;  4QT7 A;  1U1T A;  1VQ5 A;  3VUZ A;  2XG8 D;  2LRQ A;  3VJP A;  1LOJ A;  1X75 C;  3MO8 A;  4KUL A;  2CGH A;  2EW3 A;  3NPF A;  1CSK A;  2P0K A;  3FLG A;  2HEQ A;  1YIJ T;  1VQ6 Q;  1VQ5 Q;  3LLR A;  2O9V A;  3MEW A;  4BD3 A;  2E6N A;  1TG0 A;  2E6Z A;  4PLL A;  4HCZ A;  2L5Q A;  2V1R A;  3VS2 A;  2J05 A;  1KHC A;  2LVM A;  2WSC E;  1X27 A;  2LT1 A;  1PWT A;  4RG2 A;  3EGX B;  1UGQ B;  1VQM T;  5D6Y A;  1VYU A;  2J06 A;  1QCF A;  1WQ7 A;  3FJ5 A;  3M54 A;  1U06 A;  1WQW A;  3BFM A;  1RLP C;  4DOV A;  1ZSG A;  2LTO A;  3CC4 Q;  1UJY A;  2BZX A;  1BIB A;  3M4G A;  3EGU A;  3OW2 P;  1Y07 A;  1H64 1;  2NLU A;  1EIF A;  1M1G A;  3ZFJ A;  2RB6 A;  1BCM A;  3MHX A;  2YWW A;  4A63 B;  4FYV B;  3RKX A;  3CMA Q;  3INZ A;  1W1F A;  3CCJ A;  2D0N A;  3JCM f;  3JCM Q;  3UWN A;  1JXM A;  1HSQ A;  1YIT Q;  1T3L A;  4WTO B;  1S1N A;  3X28 B;  3ZEH A;  2CUD A;  2JT4 A;  2J6O A;  4AFU C;  4M7D E;  5LJ5 j;  4E7H A;  1M3B A;  2EGC A;  5HK0 A;  3MET A;  2DKG A;  2BZY A;  2KYM A;  2DF6 A;  3CCE A;  2F1L A;  1VQ7 A;  3J7A F;  3EAE A;  3P8B B;  3CCU A;  2P0P A;  2YRV A;  8AT1 B;  4AFS C;  2BE7 D;  1MMA A;  3URG A;  1RL2 A;  2X3X D;  2V8J A;  1RUW A;  5GMK j;  4FYY B;  1RI9 A;  5GAN 2;  2DIL A;  1LPL A;  1YJ9 A;  2DL8 A;  1OX8 A;  2XDB A;  2KEA A;  2W0Z A;  1M27 C;  3UDC A;  4AMC A;  4GLK A;  2DTI A;  3M0Q A;  2Y4Y A;  3PVQ A;  2ZCF B;  1PKT A;  2OTL A;  5CVI A;  4BI8 B;  4KUI A;  2RF0 A;  2D8H A;  2H3J A;  1U5S A;  1S72 A;  3VUB A;  3EG1 A;  4J9D A;  4M75 A;  1QVF S;  2ESW A;  1QVP A;  1OV3 A;  5CAI A;  4NL3 A;  2DM1 A;  5LJ3 f;  4E7J A;  3WVD B;  1VQK Q;  1TUC A;  3P8D A;  4AFQ C;  1I5L A;  3QPH A;  2KT1 A;  4XU2 A;  2E10 A;  3E9F A;  3PE0 A;  2VUB A;  2YSQ A;  2HSP A;  2GTO A;  2DJZ A;  3DB3 A;  4EMH A;  4M7A B;  1E6G A;  4C5I A;  4N0A C;  2RM4 A;  2DBM A;  2IG0 A;  3H41 A;  3HKS A;  4XTV A;  3JSC A;  3NMZ C;  1GL5 A;  2KBT A;  4P5N A;  1M5Q 1;  1ZLM A;  5CKE A;  1YBY A;  3M0P A;  3EG0 A;  4HCB A;  3VRZ A;  2O01 E;  3JCM e;  3CC4 T;  3TU4 K;  2HCK A;  1ZHI A;  4M78 A;  2HQE A;  3LGL A;  1G83 A;  3QG1 A;  1TSF A;  1FMK A;  2RI3 A;  2LCC A;  1WHG A;  2MWP A;  4O5V A;  3EH1 A;  2YUN A;  4FIB A;  1BYM A;  3L2V A;  3RMS A;  3TEE A;  1VQK T;  2DJQ A;  2LDM A;  2CP6 A;  3L2Z A;  1LNX A;  1N5Z A;  3CXC S;  3CCM T;  4J9H A;  1M90 C;  2GQI A;  2LCS A;  5LJ3 h;  3RKY A;  2GCX A;  2C0I A;  1WI7 A;  1T0J A;  3G7Z A;  3NHN A;  1V1C A;  1X2K A;  1ZX6 A;  2F5T X;  2EQJ A;  1JQQ A;  5FU7 C;  2COY A;  4KGX B;  2JS2 A;  4PJO B;  4RG8 A;  4B9X A;  1N8R U;  5CKD A;  3CPW A;  2JW4 A;  1YI2 T;  1ZUU A;  3CCQ T;  3OW2 S;  4DBF A;  3GBQ A;  2K9G A;  1OPK A;  4ZN3 A;  2EKH A;  3VS3 A;  3CCM A;  2FYK A;  4KT0 E;  2KRM A;  1K9M C;  4DEX A;  2QAZ A;  4J9G A;  4EMG A;  4M78 E;  3H9N A;  1XNI A;  3A98 A;  2RQU A;  2X4J A;  1OX9 A;  2G6F X;  3GOX A;  2LJ0 A;  5KCH A;  4AT1 B;  2EFI A;  1UB4 A;  2DIQ A;  2DXT A;  2LQW A;  1XTD A;  2EBP A;  1KC8 C;  1YJN A;  1WDX A;  2QQB A;  3CC4 A;  2RH2 A;  4LUE A;  3IQL A;  4JRI A;  1RI0 A;  3OYE A;  1PM3 A;  2QYZ A;  3OS0 A;  1VQ8 A;  3JB9 D;  2D0Q B;  1C6V X;  1Q86 C;  4BDZ A;  2QI2 A;  1W2B P;  4HCC A;  2F69 A;  4FT4 A;  4J8O A;  2OX7 A;  3UF4 A;  4OMM A;  1Y96 B;  4F7U B;  3REB B;  2CYZ B;  3CCR A;  4MZP A;  2RHI A;  3V7C A;  2ZGW A;  3V8K A;  4E7S A;  1B07 A;  4BE1 A;  1Y96 A;  2L2P A;  1SHF A;  1YFN A;  2NYS A;  3CBM A;  1X6B A;  2E5K A;  2LNV A;  2O4X A;  2Z0W A;  1F1B B;  2I2L A;  4IKF A;  3C4S A;  3PNW C;  3HP9 A;  3OBW A;  1P92 A;  2K6D A;  4LXC A;  2QEX Q;  4M75 C;  1VQN T;  2NWM A;  2O88 A;  1D09 B;  5KYY B;  3QZ9 B;  1NM7 A;  1X69 A;  1PHT A;  5CCA A;  4M78 B;  3QJY A;  1YJW T;  1ACM B;  3EH2 A;  4Y91 A;  3NTH A;  4CI0 C;  1YN8 A;  5LJ3 j;  4M7D C;  1YJN T;  4CRI A;  2DD4 A;  4D8K A;  1KSW A;  2JJ9 A;  4XTW A;  5CKB A;  6AT1 B;  3BY7 A;  4M75 F;  2MI6 A;  4M7D A;  1RAC B;  5A0G A;  1G3Y A;  4EMK B;  1ZUY A;  1VQ5 T;  3OMG A;  2CH4 W;  2VYT A;  3CXC P;  2LC4 A;  5GAN 4;  4QQ6 A;  4OB0 B;  5LJ5 f;  1VQ6 A;  3QXE B;  4ELY C;  2FRY A;  1QVG A;  3CCJ Q;  2RD1 A;  3EG9 A;  4OMP A;  3ULR B;  2L0A A;  4BI4 A;  5GAN e;  1WHH A;  2V1Q A;  1N8R C;  2O31 A;  4XTX A;  4N4G A;  2JM8 A;  1WHM A;  2CSI A;  1TTH B;  4UC4 A;  1AOJ A;  1YNZ A;  2QDL A;  4PJO D;  3MCA B;  4FT2 A;  5GMK m;  2L89 A;  4LDV A;  1VQ6 T;  2CKK A;  5GAO n;  1UEC A;  4XTY A;  4F7U G;  2YUO A;  3KXT A;  3VYG A;  3KBG A;  3QBY A;  2K2V A;  2VAS A;  4RTW A;  2FZC B;  2HKN A;  3C0C A;  2A08 A;  1H3H A;  3RUX A;  1NYF A;  1X2Q A;  1D1B A;  4A4K A;  1JRI A;  2DA9 A;  2JMC A;  2OAW A;  5GAN j;  2X4W A;  1VQ9 A;  1M2V B;  2DL3 A;  4C8Q F;  3JCM b;  2JZ2 A;  1M2V A;  1J3T A;  2LX9 A;  1ZSZ A;  4R0K A;  1SSH A;  2QQA A;  2D8J A;  1W2B S;  1IGU A;  3HRT A;  5LJ5 e;  1VQ9 Q;  4C92 G;  2DPP B;  2AKK A;  2DX1 A;  3RNJ A;  4C5E A;  1MND A;  4IUQ A;  2M9U A;  2RHY A;  3CCV Q;  4V2S A;  5GMK i;  4ELZ C;  2AHJ B;  1EFN A;  1G2B A;  1KD1 U;  3GF5 A;  4DBR A;  2KI7 A;  2VB6 A;  4PKC C;  1K76 A;  2COW A;  4DBQ A;  4HCK A;  3SHW A;  4WCI A;  2A36 A;  1NEB A;  1YIT A;  4PJM A;  1TUG B;  3FIF A;  1NJI R;  1WXB A;  2KNB B;  1YCS B;  3OYY A;  1GCP A;  2KGT A;  1A0N B;  3L2U A;  2FG0 A;  1D1A A;  3E1S A;  5GAM e;  5IHI A;  2GF7 A;  1Y0M A;  1GCQ C;  2NUT A;  3HFN A;  2K3X A;  3CC7 A;  1AZG B;  2DK3 A;  2NUT B;  4XU1 A;  1ARK A;  2E3I A;  4OP0 A;  1TUD A;  3LH5 A;  3SB2 A;  5FU6 C;  2A37 A;  1W4S A;  5A2Q E;  1QVG P;  1WJS A;  3Q1J A;  4M7D B;  2QA4 Q;  3JCM P;  4GLM A;  1MMG A;  2XK0 A;  1VQ8 Q;  1PCX A;  2DLP A;  3M56 A;  2FRW A;  3H6Z A;  1GBQ A;  2ZPI B;  5I2M A;  1YWO A;  1E7O A;  2FB7 A;  2QQS A;  4C92 F;  1Q81 U;  5DLQ E;  3I55 T;  1HK9 A;  5D7U A;  2RMO A;  4LDW A;  4PJO F;  4A4F A;  2ZPB B;  2QK0 A;  4FYW B;  1JEG A;  2K3B A;  3RDV A;  1SPK A;  1JJ2 A;  1QP3 A;  4E2F B;  1GXI E;  1K0X A;  1M1K C;  4Z8A A;  4M77 A;  2J6F A;  3M0T A;  2KQW A;  2DZ9 A;  2QGG A;  2RQV A;  4D6W A;  4CC2 A;  3OMC A;  3SDZ A;  2PVO B;  2BKD N;  5I2S A;  2M1H A;  2RK1 A;  2EYZ A;  1KQ1 A;  1G8X A;  2ZZD A;  1R0C B;  2LQK A;  3G71 Q;  4MML A;  5GAM f;  5GAN f;  4BDY A;  2ENM A;  2E65 A;  4EIK A;  4HA8 A;  4PLI A;  4C92 D;  3DB4 A;  2JTE A;  4XU0 A;  4JJB A;  1WXT A;  2ZPG B;  9ATC B;  1BI2 A;  2MYS A;  2YUQ A;  1VQP Q;  3OYJ A;  2OAU A;  3QO3 A;  1JJ2 S;  5GJW B;  4ZGJ B;  2KMT A;  3GPL A;  2JTF A;  4HXJ A;  3I5S A;  2GTJ A;  2HL5 C;  1K9A A;  2YT6 A;  1MGQ A;  5IN1 A;  4M77 D;  4N4H A;  1G3S A;  1OUL A;  5CO7 A;  1YI2 A;  3OSS C;  1BK2 A;  2H3E B;  2K2M A;  1N9R A;  3QKJ A;  2QAS A;  4Y28 E;  3CCR Q;  4OMN A;  5LJ3 d;  4ESR A;  3A5Z B;  2KYB A;  3X26 B;  1FYN A;  3CCL T;  1BI0 A;  4M7D G;  1MV0 B;  1YI2 Q;  2GFA A;  2FZK B;  3TCJ A;  1SKU B;  2FPF A;  1IZ6 A;  3CC2 Q;  1OEB A;  1VQM A;  3VKI A;  1K73 C;  1M8M A;  3ER0 A;  2P0Q A;  2HBW A;  3G6E A;  1OI1 A;  2DBK A;  2EYQ A;  2XKO C;  2EGE A;  4F04 B;  2K5L A;  4E6R A;  2PVG B;  3MEV A;  2LQ8 A;  5GAO p;  2CH4 A;  2LJ3 A;  4AG2 C;  3A8O B;  3PMI A;  1YIJ A;  2D1X A;  5GAO m;  5J3B A;  4QQG A;  4M77 G;  4C8Q A;  5GAN 8;  4OF1 A;  3OQ5 A;  3JCM h;  4HT8 A;  4F7U F;  3A8L B;  2K7A A;  2KY9 A;  3EHR A;  3OY9 A;  3F70 A;  5KYU B;  5GAN 3;  4A4G A;  1MMN A;  2CP5 A;  2Y4X A;  2WAC A;  2X35 A;  2JVV A;  2X9H A;  1TH7 A;  4J83 A;  1AHJ B;  1QWE A;  3T9N A;  2MIO A;  4QQD A;  1TU0 B;  1LCK A;  1MMD A;  1ZUK A;  3CCV T;  3D7S B;  1HXD A;  1ZA1 B;  4FU6 A;  4NOY A;  4RTU A;  3NTI A;  1SF9 A;  4JS4 A;  1KJW A;  4KH0 B;  3PGG A;  5C0M A;  1WJQ A;  4BY6 B;  3OW2 A;  3E9G A;  3FRN A;  3CCR T;  2E64 A;  3MP1 A;  2PU9 B;  2Y90 A;  3OSV A;  5KE2 A;  4PJL A;  2KRO A;  4Q5W A;  4F7U E;  5FWC A;  1Q86 U;  2RK2 A;  1S72 T;  2ATC B;  4OGE A;  5A0D A;  3CEY A;  3CPF A;  4C0D B;  4M4Z A;  2P84 A;  4IUR A;  4RCC A;  2VVK A;  3R6N A;  2DXU A;  2NUP B;  2DL4 A;  4HT9 A;  3DKM A;  2KT8 A;  3OYI A;  2QDY B;  1KD1 C;  3GNG A;  4C5H A;  3FDR A;  2YHT A;  1Q86 R;  2RN8 A;  1BCO A;  2KR3 A;  3M57 A;  3QSU A;  1YHQ Q;  4CC7 A;  1QVF P;  4PJO E;  3BE3 A;  4PNO A;  1VQL Q;  4PL6 A;  1Q7Y R;  3VS6 A;  1PRL C;  4MDW A;  4C92 B;  2V8I A;  1QP2 A;  1TWB A;  3OYN A;  2ROT A;  1IO6 A;  4YTL A;  1M1F A;  4C92 A;  3QDF A;  5GAN 6;  1WHL A;  2VGN A;  3AHU A;  2WSE E;  3J80 E;  2G3R A;  4HKE A;  2WSF E;  2YRD A;  1Q7Y U;  3ASK A;  1UTI A;  1UHF A;  1R8O B;  4OB2 B;  4F17 A;  1ZBX A;  1RLQ C;  1AZE A;  1K9M U;  1ABQ A;  1D0Y A;  5FWB A;  1BU1 A;  2R58 A;  1W70 A;  4M78 C;  1AD5 A;  3MJX A;  4C8Q C;  2LX7 A;  1VQ4 T;  4J9I A;  2DRM A;  1K4U S;  2DL7 A;  4E7I A;  4Z89 A;  1T0H A;  2CUB A;  3GLX A;  1K1Z A;  1N8R R;  3U23 A;  2XHC A;  4BB7 A;  3JCM X;  2MPX C;  2FO0 A;  1KQS S;  2ECZ A;  2HDA A;  3VYH B;  3JB9 I;  4KBM B;  1OPL A;  2JS0 A;  4O6J A;  3FB9 A;  3ZBD A;  5FRM A;  4N4I A;  2DVE A;  3THK A;  5GAO l;  3PTA A;  1FMW A;  3PT9 A;  3I55 Q;  2ZPE B;  2ED1 A;  8ATC B;  2DER A;  4FSX A;  4C0D C;  2K5F A;  5GAO q;  4NL2 A;  1WYX A;  1TXQ A;  2DYB A;  4E47 A;  2DIG A;  1H3Z A;  3OYL A;  3CMA T;  3CME Q;  4M7A D;  4L59 A;  3M9Q A;  2PTK A;  1FXX A;  1JBM A;  1HYO A;  4L6V 5;  3JCM V;  1K8A R;  4OMF B;  1YIT T;  4Z88 A;  1WA7 A;  4ME7 A;  3I9Q A;  5KE3 A;  3CPW P;  1VQ7 T;  1MV3 A;  3CCE T;  2V26 A;  4ORZ A;  2EJG A;  5GMK h;  1UE9 A;  2QQR A;  3P8H A;  3L2W A;  2EPD A;  2SEM A;  3OYG A;  3CC2 A;  3JB9 F;  4JS5 A;  1O9S A;  3REA B;  2DZC A;  3EFO B;  2DET A;  1VQ8 T;  3TRE A;  1GFC A;  3QZ5 B;  1PKS A;  2QA4 A;  1YHQ T;  2L3R A;  1M2O A;  2CZ6 B;  1Z9Z A;  1D0X A;  3A8H B;  3RER A;  1U1S A;  3LWI A;  2FHD A;  4JRQ A;  1QWF A;  5GAO r;  3PIP A;  4QVZ A;  2OTL T;  1BB9 A;  1AEY A;  3PFS A;  4B6M A;  2YXY A;  5I21 A;  2CS7 A;  1JB0 E;  2AZS A;  2MF2 A;  2A28 A;  2CP0 A;  2EGA A;  4KH1 B;  2KE9 A;  3OYK A;  3CC7 Q;  1NZ9 A;  1KK7 A;  1VQP A;  4FCY A;  1G5V A;  4FM4 B;  3DLL A;  1EZZ B;  1IXD A;  1KG1 A;  5M9O A;  1RAB B;  2FEI A;  2IVW A;  3CME T;  2E70 A;  1I5O B;  1W6X A;  1FWZ A;  3WXM B;  5IHK A;  3A1P A;  2KRS A;  3I56 Q;  4C8Q D;  2F5K A;  3AT1 B;  4M75 B;  4RUG A;  2L8D A;  1ABO A;  2KSS A;  3OB9 A;  4OML A;  1XJW B;  4M7A C;  1OQK A;  5C6S A;  1SRL A;  4BUG A;  1B3Q A;  2O2O A;  3JCM d;  1NJI C;  1IHW A;  1GRI A;  1IB8 A;  2HQH A;  4M75 G;  4F16 A;  4MMK A;  1KHI A;  4XAX B;  2O4X B;  2XID A;  3SD4 A;  4RTT A;  3L2Q A;  3QHS A;  3QWY A;  2DEU A;  1Y71 A;  2RI2 A;  2DTH A;  3DLM A;  4FSS A;  3X20 B;  3RBB B;  4XQ3 A;  5D6W A;  1WIE A;  1UEB A;  2H8H A;  3OA6 A;  5GAM h;  2LZ6 B;  3OBY A;  2SRC A;  4JRK A;  1YJN Q;  4II1 A;  1I81 A;  2QGF B;  2YRC A;  1ZQ1 A;  3RR6 A;  3H0I A;  2GFU A;  4RMO A;  1VQL A;  3OYD A;  1X01 A;  2HBP A;  3S3M A;  1WLP B;  3S6W A;  1SSF A;  2ED0 A;  3FEO A;  2F2V A;  1AWO A;  1X43 A;  2AIR B;  2EVR A;  3WVE B;  1WHJ A;  3PIO A;  4OMQ A;  2L3P A;  2E3H A;  4M78 D;  3JCM g;  2EJF A;  1M3C A;  4QKU A;  2K57 A;  4M7A F;  2FPE A;  3BW1 A;  2DXB A;  4RTX A;  5L8R E;  2QTV A;  1WNL A;  2DRK A;  4A4E A;  3NFC A;  1M3A A;  3EFS A;  5GAN d;  2DEQ A;  3EHQ A;  4X9C A;  4QVD A;  1OZ3 A;  2YLB A;  1KQS P;  3G6E T;  5KYW A;  2VXE A;  4GBQ A;  2MCN A;  4RKU E;  1V76 A;  2JM9 A;  4JZ3 A;  2OTJ Q;  4OB3 B;  3RMQ A;  1PSF A;  3EFO A;  4ATO A;  2CZ7 B;  1VQ4 A;  1N9S A;  3LH0 A;  3OYH A;  1I8F A;  4PFO A;  2MOX A;  1OOT A;  3TSZ A;  2YUP A;  2HL3 A;  5FRO A;  2KDS A;  4QW2 A;  3CCL A;  4CC3 A;  4JRP A;  1PD0 A;  2I0N A;  3O5Z A;  4ZGE B;  7AT1 B;  3G6E Q;  1NE8 A;  3J81 E;  1U8R A;  3KFV A;  3G4S T;  1YJ9 T;  4J9E A;  4LUD A;  4LE9 A;  4BE0 A;  1K0S A;  4M78 G;  4JJC A;  2CDT A;  1JO8 A;  4GY5 A;  4C92 C;  2COZ A;  2HMA A;  5KYX A;  1I1J A;  4ZTF A;  5LJ3 g;  1K73 U;  3QUI A;  1VQ9 T;  1VUB A;  2LJ1 A;  1D1C A;  2DTO A;  4X9D A;  4DA4 A;  3CME A;  3V7R A;  1BI1 A;  1KD1 R;  5IXF A;  1NEG A;  5IAY A;  2C0T A;  3M55 A;  2CT3 A;  3G4S Q;  3JAM E;  1Q82 R;  3UA6 A;  1K9M R;  2L3S A;  2DO3 A;  1K73 R;  2HSE B;  4A54 A;  2RQT A;  3L42 A;  4PK4 A;  1VIF A;  3CCJ T;  2YLC A;  1CKB A;  2RJF A;  3G4S A;  4FW2 A;  2BTT A;  4E7K A;  1Y7X A;  1KC8 R;  1YHQ A;  5J26 A;  1FMV A;  2F2X A;  4JUV A;  4EDU A;  3E2U A;  2HNI A;  2KRN A;  1UHC A;  3VS5 A;  1WXU A;  3CCS A;  3MP8 A;  2OTL Q;  5KYY A;  4IIM A;  3E19 A;  1TS9 A;  3H8Z A;  4RTV A;  2JOY A;  4KGV B;  3HSB A;  4M78 F;  1Q95 G;  3I55 A;  3OYC A;  5IT9 E;  2E1H A;  3N5B B;  1JXO A;  1KQ2 A;  1KIK A;  2RO0 A;  1WZO A;  2K5I A;  3A8M B;  2EQI A;  1XQH A;  4LDU A;  4XU3 A;  2XMF A;  4E7L A;  2XIC A;  4EMK A;  3EGX A;  2RHZ A;  1SRM A;  5HY6 A;  3JV3 A;  3H0H A;  1H92 A;  5GAN 5;  4QVC A;  2X51 A;  2O9S A;  5HCK A;  4PJO G;  1BKB A;  3NGP A;  4J9C A;  2CZ1 B;  3TQ7 P;  1E6H A;  2AK5 A;  1NLP C;  1YWP A;  4M7D D;  2ZPF B;  1N6A A;  2B8A A;  4J9B A;  1PG5 B;  1NYG A;  1W2B A;  3CXC A;  2JNG A;  5GAM j;  3S3O A;  3G71 A;  1H8K A;  1YJ9 Q;  5HKC A;  4IUP A;  3HRS A;  1EX4 A;  2PVD B;  1D3B A;  4MZT A;  1Q81 R;  2EQK A;  1VOM A;  4A53 A;  2E5Q A;  4DEY A;  1S72 Q;  1UJ0 A;  2RHX A;  4RTY A;  2JMA A;  3SFM A;  4WF2 A;  5J39 A;  2VXF A;  1WPY A;  1G3T A;  1WFW A;  3QYG B;  4CC4 B;  1O75 A;  2VV5 A;  2FPD A;  1WGS A;  1M90 U;  1IGQ A;  2PNI A;  5AT1 B;  1VQK A;  3EGD A;  2RNA A;  4ZN1 A;  3I56 A;  4M7A A;  2HQX A;  3LGF A;  3VS0 A;  2PUO B;  4OVA A;  2VKN A;  1R77 A;  2OI3 A;  2M16 A;  2LP5 A;  1BI3 A;  4MDX A;  1R0B G;  2CZ0 B;  2R57 A;  1B7T A;  1WJR A;  1VQP T;  3CCS T;  2RQR A;  4F14 A;  1TOV A;  3OS5 A;  2OTJ T;  4JZ4 A;  3CQT A;  5LJ5 h;  1PRM C;  1GFD A;  2A0F B;  2FL7 A;  4VUB A;  2JN0 A;  3CCQ A;  1M9S A;  1YP5 A;  1IHV A;  4BY6 C;  2HKQ B;  4AG1 C;  5D6X A;  3GIB A;  4RCB A;  1AWW A;  3L1A A;  1UGP B;  3I5R A;  1I4K 1;  4J7F A;  2EIF A;  4PJJ A;  1QVG S;  3KUF A;  4PJO C;  2AZV A;  3HTR A;  4KGZ B;  1RAG B;  5CIU A;  2NUZ A;  3R6O A;  1C1A A;  1YJW Q;  2BUD A;  5I11 A;  2M0O A;  5CQY A;  1NBE B;  5L23 A;  4PJO A;  2YDL A;  4Z02 A;  3QJ6 A;  3QII A;  1RAF B;  4LDY A;  4M77 F;  5CKF A;  2VWF A;  4M77 E;  3OYB A;  5LJ5 g;  1X6G A;  5FW9 A;  2NUP A;  4RTZ A;  5FU6 B;  3TSW A;  5KYU A;  1B34 A;  4M7D F;  2X3W D;  2LCL A;  3LYI A;  4OMO A;  3JCM c;  4X1V A;  5GJV B;  4OB1 B;  4JDS A;  3V8L A;  1AWJ A;  5EC7 A;  4PFZ A;  1VQO T;  3RKW A;  2R5M A;  3CPW S;  2EQM A;  2R5A A;  4LN2 A;  3LX7 A;  4TVR A;  2VGM A;  4J7I A;  4AFZ C;  1MHN A;  3GP8 A;  1M4Z A;  1QKX A;  2LMJ A;  1ZBJ A;  2DFU A;  5GAM g;  4KUD K;  4MZM A;  1VQ4 Q;  4FW1 A;  5GAN g;  2ROL A;  3L2R A;  2KVQ G;  2EYX A;  2IIM A;  3CD6 A;  5GAN 7;  1XOV A;  2DMO A;  2D9T A;  3G71 T;  4C0Z A;  1NJI U;  1OYX A;  1UFF A;  3C12 A;  1NPR A;  4LDX A;  3LW5 E;  3I35 A;  4HVV A;  5HK3 A;  5CQX A;  1WHK A;  1OU9 A;  2JUF A;  4HVU A;  5GMK e;  2DD5 A;  4X34 A;  4K11 A;  4M77 C;  1RAE B;  4BE2 A;  2RPN A;  2PQW A;  4LD9 K;  2J6K A;  4J5Y A;  2A7Y A;  4N0A A;  4EPC A;  1UG1 A;  2D6F A;  3QWX X;  5I22 A;  2E41 A;  2CRE A;  2EQU A;  2RQW A;  3CCU Q;  2KAF A;  2QG9 B;  2OTJ A;  3H0F A;  3RIR A;  3QDR B;  1Q82 U;  1KC8 U;  1D0Z A;  3M59 A;  3PMT A;  1K8A U;  3SWN A;  5CK9 A;  1K8A C;  3GNF B;  3JB9 J;  1QCN A;  1IRE B;  5KH6 A;  2W10 A;  1U3O A;  5GAM d;  3M0R A;  2DYI A;  3CCU T;  1M1K R;  2MMP A;  4EMK C;  3I56 T;  1JU5 C;  4XK8 E;  4M75 E;  1KQS A;  4ZGD B;  3M53 A;  4J9F A;  1MNE A;  2CT4 A;  2XU8 A;  4F7U A;  3HPW A;  1QKW A;  2QQ9 A;  4BI3 A;  4J6Y A;  2MK5 A;  4J6X A;  4C5G A;  5IHN A;  4DOW A;  2LT4 A;  3HFO A;  1GCQ A;  1PC0 A;  2DVJ A;  2GGR A;  1FX7 A;  1ZA2 B;  1NG2 A;  1HD3 A;  1IRX A;  1HJD A;  5CR2 A;  2EWN A;  2CP3 A;  1UGR B;  3V7S A;  4E7Z A;  2MAM A;  1AVZ C;  1M30 A;  1MUZ A;  2KXD A;  4LD6 A;  1QW1 A;  3UPU A;  4C0G A;  2EAY A;  2C0O A;  5EG2 A;  4JJN K;  3OYA A;  3EG9 B;  2RJE A;  1SEM A;  3VS4 A;  1YCY A;  2X4Y A;  3CC2 T;  5DY9 A;  3FC3 A;  4OGC A;  1RAD B;  4PJN A;  1QMC A;  3NTK A;  5DM7 R;  3CCV A;  1B34 B;  1M90 R;  4ZTJ A;  3OS1 A;  3HL8 A;  2DL5 A;  1M8V A;  2BE9 B;  2DAQ A;  2VC8 A;  3JRZ A;  5A0L A;  5KCO A;  1VQ7 Q;  3CCE Q;  3CBP A;  2K3Y A;  3CBO A;  2PUK B;  3CCS Q;  1AWX A;  5FU7 B;  3VS1 A;  2XDP A;  1LVK A;  1QQJ A;  3MEU A;  1VQN A;  3M5A A;  3M0U A;  2RI5 A;  5AYF A;  4R56 A;  1GBR A;  2A3L A;  3C95 A;  4FYX B;  4C8Q G;  4XTU A;  1VYT A;  1Q82 C;  3EG3 A;  3TVT A;  3OYM A;  4IUV A;  2KK4 A;  4XTZ A;  2ZAE A;  1CKA A;  3SEM A;  2X4X A;  2OJ2 A;  2ABL A;  5GMK l;  3VV0 A;  2QXF A;  2E4H A;  4Y92 A;  2KXC A;  1VQN Q;  3CD6 T;  3JB9 H;  3C94 A;  4R55 A;  1UGS B;  4IUU A;  3X25 B;  5IH2 A;  1Q7Y C;  1T3S A;  1BBZ A;  1G3W A;  4IIO A;  3MP6 A;  3LWH A;  1KFZ A;  3HHT B;  1BIA A;  1X6O A;  1JJ2 P;  3CMA A;  2GBQ A;  2P4R A;  1VQO A;  1C0M A;  3HRU A;  2QEX T;  5DLO A;  2HAX A;  3MPU B;  3V8J A;  3EFR A;  3MEA A;  4KRT A;  1Q81 C;  4JLI A;  2K79 A;  3PVL A;  4HVW A;  5IXB A;  5KYX B;  3SWN B;  2M51 A;  4A4H A;  4NS5 A;  1OU8 A;  1VQO Q;  2EJ9 A;  2E12 A;  1M1K U;  2DE0 X;  2LNH B;  5KYN A;  5LJ5 d;  1UDL A;  4JPB W;  1QCO A;  3UT1 A;  2V8K A;  3BDL A;  5LJ3 e;  1NLO C;  3M0S A;  1WX6 A;  2JXB A;  2RHU A;  2P4T A;  2PZ1 A;  1RAH B;  3M58 A;  1VA7 A;  1SG5 A;  5CKH A;  3OS2 A;  4IUT A;  4C8Q B;  3CCQ Q;  1PD1 A;  4M75 D;  4PFP A;  4FL6 A;  1UUE A; 
#chains in the Genus database with same CATH homology
 2RHI A;  5HY6 A;  2ZGW A;  3V7C A;  3V8K A;  4BE1 A;  1Y96 A;  3M4Y A;  1KD1 C;  3GNG A;  2QTX A;  2MWO A;  4C5H A;  2ZPH B;  3QYH B;  1DJ7 B;  5GAN 5;  4M7A E;  3CBM A;  3FDR A;  4QVC A;  2LNV A;  2O4X A;  2YHT A;  3JCM W;  4J6W A;  4PJO G;  2XI9 A;  1BKB A;  3M57 A;  3QSU A;  2I2L A;  2CZ1 B;  4IKF A;  4PJO E;  4M7D D;  3C4S A;  3PNW C;  2ZPF B;  3HP9 A;  1N6A A;  2B8A A;  3OBW A;  4PNO A;  4PL6 A;  2QA4 T;  5FLX E;  4MDW A;  4C92 B;  1P92 A;  2V8I A;  3FJP A;  1QP2 A;  4M75 C;  3OYN A;  3JB9 G;  1VQN T;  1OZ2 A;  4YTL A;  2XDD A;  3CXC A;  1W2B A;  3QZ9 B;  1M1F A;  4C92 A;  2JNG A;  5GAN 6;  2VGN A;  3BDU A;  5CCA A;  2EKO A;  5GAM j;  2FVU A;  3G71 A;  3S3O A;  4M78 B;  3QJY A;  1YJW T;  4M77 B;  3AHU A;  2WSE E;  3J80 E;  1V29 B;  5HKC A;  1PSE A;  4IUP A;  3HRS A;  2G3R A;  4L5G A;  4HKE A;  4Y91 A;  2WSF E;  2PVD B;  1D3B A;  1Q7Y U;  3NTH A;  3ASK A;  4CI0 C;  4MZT A;  5LJ3 j;  4M7D C;  2K4Y A;  1N27 A;  1R8O B;  4OB2 B;  2HD0 A;  2EQK A;  1ZBX A;  1YJN T;  4A53 A;  4CRI A;  2DD4 A;  1K9M U;  2E5Q A;  1QVF A;  4XTW A;  5CKB A;  4M7A G;  2R58 A;  3BY7 A;  4M75 F;  2MI6 A;  4DQ2 A;  4M7D A;  4M78 C;  2RHX A;  3ME9 A;  5A0G A;  1G3Y A;  1NPP A;  3SFM A;  4C8Q C;  5LL6 S;  4EMK B;  4WF2 A;  1VQ4 T;  5J39 A;  2BIV A;  2VXF A;  4C0F A;  3OYF A;  1VQ5 T;  1WPY A;  2GQV A;  3OMG A;  1G3T A;  2VYT A;  2LC4 A;  3QYG B;  5GAN h;  5GAN 4;  3A8G B;  4E7I A;  1O75 A;  2VV5 A;  4QQ6 A;  1YJW A;  4OB0 B;  5LJ5 f;  1WGS A;  1VQ6 A;  3GLX A;  1M90 U;  3QXE B;  4ELY C;  3JCM J;  3S3N A;  1VQK A;  1QVG A;  2XHC A;  2RJD A;  4ZN1 A;  2RD1 A;  4BB7 A;  3I56 A;  4M7A A;  3X24 B;  4JLG A;  2HQX A;  3SWN C;  4BI4 A;  3JCM X;  3LGF A;  1KQS S;  5GAN e;  3CC7 T;  3VYH B;  2PUO B;  4C8Q E;  4BAC A;  3JB9 I;  4KBM B;  2QEX A;  4OVA A;  1N8R C;  1VQL T;  4O6J A;  3FB9 A;  3ZBD A;  5FRM A;  4XTX A;  2RA2 A;  4N4I A;  2DVE A;  2M16 A;  4N4G A;  3VU3 C;  5FRN A;  5GAO l;  2JTM A;  3PTA A;  1BI3 A;  4UC4 A;  4MDX A;  2CZ0 B;  2R57 A;  4B9W A;  3PT9 A;  3O8V A;  2ZPE B;  4PJO D;  1WJR A;  3MCA B;  1VIE A;  4FT2 A;  4C92 E;  2C06 A;  1VQP T;  5GMK m;  2RJC A;  3CCS T;  2L89 A;  4LDV A;  1VQ6 T;  4FSX A;  2XD0 A;  3OS5 A;  2OTJ T;  2DXC A;  5LJ5 h;  4C0D C;  2K5F A;  1D3B B;  5GAO q;  4NL2 A;  3RES A;  2CKK A;  1LJO A;  5GAO n;  4XTY A;  2FL7 A;  4VUB A;  4F7U G;  4E47 A;  2DIG A;  1U1T A;  1VQ5 A;  2JN0 A;  3CCQ A;  3KXT A;  3VYG A;  1M9S A;  3VUZ A;  3OYL A;  1H3Z A;  3CMA T;  2XG8 D;  4BY6 C;  3KBG A;  3QBY A;  5D6X A;  3GIB A;  2K2V A;  2LRQ A;  4RCB A;  4M7A D;  3L1A A;  4L59 A;  3VJP A;  1LOJ A;  1UGP B;  3M9Q A;  1FXX A;  1JBM A;  1I4K 1;  4J7F A;  1X75 C;  2EIF A;  3MO8 A;  4L6V 5;  3RUX A;  4OMF B;  3KUF A;  4KUL A;  3JCM V;  1YIT T;  1QVG S;  4PJO C;  2CGH A;  4A4K A;  1JRI A;  4ME7 A;  2P0K A;  5GAN j;  3FLG A;  5CIU A;  2X4W A;  5KE3 A;  1VQ9 A;  3R6O A;  1VQ7 T;  3CCE T;  1YIJ T;  2BUD A;  2M0O A;  5CQY A;  3LLR A;  3MEW A;  2EJG A;  5GMK h;  4BD3 A;  2E6N A;  4PJO A;  4C8Q F;  3JCM b;  4Z02 A;  3QJ6 A;  2JZ2 A;  2QQR A;  2LX9 A;  3P8H A;  3L2W A;  3QII A;  3OYG A;  3JB9 F;  3CC2 A;  2E6Z A;  4PLL A;  4HCZ A;  4JS5 A;  2L5Q A;  2QQA A;  1O9S A;  4LDY A;  4M77 F;  2DZC A;  5CKF A;  1W2B S;  1KHC A;  2LVM A;  2WSC E;  3HRT A;  4M77 E;  1VQ8 T;  3TRE A;  3OYB A;  3QZ5 B;  5LJ5 g;  2QA4 A;  1YHQ T;  2L3R A;  5LJ5 e;  4C92 G;  2LT1 A;  2DPP B;  2CZ6 B;  5FU6 B;  4RG2 A;  3A8H B;  1UGQ B;  1VQM T;  4C5E A;  4IUQ A;  1B34 A;  5D6Y A;  3RER A;  4M7D F;  2M9U A;  2LCL A;  1U1S A;  2RHY A;  3LYI A;  4V2S A;  5GMK i;  3LWI A;  4ELZ C;  2FHD A;  4JRQ A;  2AHJ B;  5GAO r;  1KD1 U;  3JCM c;  1WQ7 A;  3PIP A;  4QVZ A;  2OTL T;  3M54 A;  3GF5 A;  3PFS A;  1WQW A;  3BFM A;  4OB1 B;  4DOV A;  4PKC C;  4JDS A;  2LTO A;  5I21 A;  2CS7 A;  1JB0 E;  3V8L A;  2MF2 A;  1BIB A;  3M4G A;  1VQO T;  1Y07 A;  1H64 1;  3RKW A;  1YIT A;  2NLU A;  3OYK A;  1EIF A;  2R5M A;  3CPW S;  1NZ9 A;  2EQM A;  2R5A A;  1M1G A;  1VQP A;  3ZFJ A;  1G5V A;  3LX7 A;  2RB6 A;  4FM4 B;  4TVR A;  3FIF A;  3MHX A;  3DLL A;  1KG1 A;  2VGM A;  3RKX A;  5M9O A;  2IVW A;  4J7I A;  2E70 A;  3INZ A;  3CME T;  1FWZ A;  3WXM B;  1MHN A;  3OYY A;  3GP8 A;  1M4Z A;  3L2U A;  3CCJ A;  3JCM f;  3E1S A;  2F5K A;  4C8Q D;  5GAM e;  3JCM Q;  5GAM g;  2GF7 A;  4M75 B;  4KUD K;  3UWN A;  4MZM A;  2L8D A;  2KSS A;  5GAN g;  3HFN A;  2K3X A;  3OB9 A;  3CC7 A;  3X28 B;  3ZEH A;  3L2R A;  2KVQ G;  2DK3 A;  3CD6 A;  4M7A C;  5C6S A;  5GAN 7;  4M7D E;  1XOV A;  4XU1 A;  4BUG A;  5LJ5 j;  4E7H A;  4OP0 A;  2D9T A;  3G71 T;  4C0Z A;  5HK0 A;  3MET A;  3SB2 A;  1OYX A;  1NJI U;  5FU6 C;  3JCM d;  1NJI C;  2DKG A;  3C12 A;  1NPR A;  1W4S A;  5A2Q E;  3CCE A;  1VQ7 A;  3LW5 E;  1WJS A;  4LDX A;  4M75 G;  3Q1J A;  4M7D B;  4MMK A;  3J7A F;  5HK3 A;  3EAE A;  3P8B B;  5CQX A;  3CCU A;  3JCM P;  2P0P A;  2JUF A;  2YRV A;  2XK0 A;  1KHI A;  4XAX B;  3M56 A;  5GMK e;  2DD5 A;  3H6Z A;  2O4X B;  2XID A;  3SD4 A;  3URG A;  1RL2 A;  3L2Q A;  3QHS A;  4X34 A;  4M77 C;  2ZPI B;  4BE2 A;  5I2M A;  2V8J A;  2PQW A;  5GMK j;  4LD9 K;  4J5Y A;  2FB7 A;  2A7Y A;  2QQS A;  4N0A A;  4EPC A;  5GAN 2;  4C92 F;  2D6F A;  1Y71 A;  2RI2 A;  2DTH A;  3DLM A;  1YJ9 A;  1Q81 U;  5DLQ E;  3I55 T;  2E41 A;  3X20 B;  1HK9 A;  4LDW A;  4XQ3 A;  2EQU A;  5D6W A;  2KAF A;  2XDB A;  1UEB A;  4PJO F;  4A4F A;  3UDC A;  2ZPB B;  2OTJ A;  3OA6 A;  4GLK A;  3RIR A;  3QDR B;  1Q82 U;  5GAM h;  1KC8 U;  2DTI A;  3OBY A;  3M59 A;  2Y4Y A;  3PMT A;  1JJ2 A;  4JRK A;  1QP3 A;  2ZCF B;  1K8A U;  5CVI A;  4BI8 B;  2OTL A;  1M1K C;  1GXI E;  4KUI A;  4M77 A;  3SWN A;  5CK9 A;  4II1 A;  2H3J A;  2KQW A;  1I81 A;  3GNF B;  2DZ9 A;  3JB9 J;  1K8A C;  1ZQ1 A;  4D6W A;  1S72 A;  1IRE B;  5KH6 A;  3VUB A;  2GFU A;  4M75 A;  1QVF S;  4RMO A;  1VQL A;  3OYD A;  1QVP A;  1X01 A;  2HBP A;  5CAI A;  4NL3 A;  5GAM d;  3S3M A;  3OMC A;  3SDZ A;  2PVO B;  3CCU T;  5LJ3 f;  2MMP A;  3S6W A;  1SSF A;  3FEO A;  4EMK C;  3I56 T;  2BKD N;  4E7J A;  4XK8 E;  4M75 E;  5I2S A;  2M1H A;  2RK1 A;  1KQS A;  3WVE B;  1KQ1 A;  4ZGD B;  3M53 A;  3WVD B;  3PIO A;  2ZZD A;  2LQK A;  2XU8 A;  3P8D A;  1I5L A;  4M78 D;  3JCM g;  3QPH A;  4F7U A;  4MML A;  3HPW A;  2EJF A;  5GAM f;  2QQ9 A;  4XU2 A;  4BI3 A;  4J6Y A;  2K57 A;  5GAN f;  4M7A F;  2E10 A;  3E9F A;  4J6X A;  2VUB A;  4BDY A;  4C5G A;  2E65 A;  2DXB A;  3BW1 A;  5L8R E;  4DOW A;  2DJZ A;  2LT4 A;  3HFO A;  4HA8 A;  3DB3 A;  4PLI A;  4C92 D;  3DB4 A;  1FX7 A;  1WNL A;  4A4E A;  3NFC A;  3EFS A;  5GAN d;  2DEQ A;  4XU0 A;  4EMH A;  4M7A B;  2EWN A;  5CR2 A;  4X9C A;  1UGR B;  2ZPG B;  3V7S A;  4C5I A;  4N0A C;  1BI2 A;  4QVD A;  2RM4 A;  2MAM A;  1OZ3 A;  2IG0 A;  3OYJ A;  2OAU A;  2YLB A;  3QO3 A;  4LD6 A;  1K73 U;  3HKS A;  1JJ2 S;  4ZGJ B;  1QW1 A;  2KMT A;  3GPL A;  4XTV A;  4C0G A;  3G6E T;  2VXE A;  2JTF A;  3JSC A;  2EAY A;  3UPU A;  5EG2 A;  4JJN K;  4RKU E;  4P5N A;  1M5Q 1;  4OB3 B;  3RMQ A;  1PSF A;  1YBY A;  5CKE A;  3OYA A;  4ATO A;  4HCB A;  2RJE A;  2CZ7 B;  1MGQ A;  1YCY A;  2O01 E;  4M77 D;  2X4Y A;  4N4H A;  1G3S A;  5IN1 A;  3JCM e;  3CC4 T;  3TU4 K;  3CC2 T;  5DY9 A;  3FC3 A;  1VQ4 A;  5CO7 A;  1N9S A;  4OGC A;  3OSS C;  1YI2 A;  1ZHI A;  3LH0 A;  4M78 A;  1I8F A;  3OYH A;  2HQE A;  3NTK A;  1N9R A;  5DM7 R;  3CCV A;  1B34 B;  3QKJ A;  4ZTJ A;  4Y28 E;  3OS1 A;  5FRO A;  2KDS A;  3HL8 A;  3LGL A;  3QG1 A;  1M8V A;  5LJ3 d;  2DAQ A;  3A5Z B;  4QW2 A;  3X26 B;  3CCL A;  2RI3 A;  2LCC A;  2VC8 A;  2MWP A;  3JRZ A;  5A0L A;  1BI0 A;  3CCL T;  5KCO A;  4O5V A;  4M7D G;  4JRP A;  3CBP A;  2K3Y A;  4ZGE B;  4FIB A;  1NE8 A;  3CBO A;  3J81 E;  1BYM A;  1U8R A;  3L2V A;  3RMS A;  2PUK B;  3G4S T;  1YJ9 T;  2GFA A;  3TEE A;  1VQK T;  2LDM A;  4BE0 A;  3TCJ A;  3L2Z A;  4M78 G;  5FU7 B;  1LNX A;  1IZ6 A;  3CXC S;  4GY5 A;  2XDP A;  4C92 C;  3CCM T;  3VKI A;  1VQM A;  1M90 C;  3MEU A;  1K73 C;  1VQN A;  5LJ3 h;  3ER0 A;  3M5A A;  2P0Q A;  2RI5 A;  5AYF A;  3RKY A;  5LJ3 g;  4R56 A;  2A3L A;  4ZTF A;  3C95 A;  3QUI A;  2GCX A;  4C8Q G;  4XTU A;  1VUB A;  1VQ9 T;  1Q82 C;  2DTO A;  3G6E A;  1OI1 A;  4X9D A;  3G7Z A;  3OYM A;  2EYQ A;  3CME A;  4DA4 A;  4IUV A;  3V7R A;  2XKO C;  2KK4 A;  4XTZ A;  1BI1 A;  2F5T X;  2EQJ A;  5FU7 C;  5IAY A;  2K5L A;  2X4X A;  3M55 A;  2PVG B;  3MEV A;  4PJO B;  4RG8 A;  4B9X A;  5GMK l;  3VV0 A;  1N8R U;  5CKD A;  2LQ8 A;  3JAM E;  3CPW A;  5GAO p;  2QXF A;  1YI2 T;  3CD6 T;  3CCQ T;  3OW2 S;  3JB9 H;  3A8O B;  3C94 A;  3PMI A;  2DO3 A;  1YIJ A;  4R55 A;  1UGS B;  5GAO m;  5J3B A;  4A54 A;  4QQG A;  4ZN3 A;  4IUU A;  4M77 G;  3X25 B;  4C8Q A;  1Q7Y C;  5GAN 8;  4OF1 A;  3OQ5 A;  3JCM h;  4HT8 A;  3L42 A;  1G3W A;  1VIF A;  3CCJ T;  3CCM A;  4F7U F;  2FYK A;  3A8L B;  2KY9 A;  2YLC A;  4KT0 E;  3MP6 A;  3OY9 A;  3F70 A;  1K9M C;  2RJF A;  5GAN 3;  3LWH A;  4A4G A;  3G4S A;  3HHT B;  4M78 E;  4EMG A;  1BIA A;  1X6O A;  1XNI A;  2Y4X A;  3CMA A;  4E7K A;  2WAC A;  2X35 A;  2JVV A;  1Y7X A;  1YHQ A;  2X4J A;  1TH7 A;  5J26 A;  4J83 A;  1VQO A;  3GOX A;  1AHJ B;  3HRU A;  5KCH A;  5DLO A;  2QEX T;  2HAX A;  3T9N A;  2EFI A;  4QQD A;  3V8J A;  4JUV A;  3EFR A;  3MEA A;  4EDU A;  1UB4 A;  2DIQ A;  2DXT A;  2HNI A;  1Q81 C;  3CCS A;  3MP8 A;  3CCV T;  4JLI A;  1XTD A;  1HXD A;  1KC8 C;  1YJN A;  4FU6 A;  4NOY A;  3E19 A;  3SWN B;  2QQB A;  3H8Z A;  3NTI A;  4A4H A;  3CC4 A;  4JS4 A;  2JOY A;  2RH2 A;  4NS5 A;  3PGG A;  5C0M A;  1WJQ A;  4BY6 B;  2EJ9 A;  4EMK A;  2E12 A;  4JRI A;  1RI0 A;  5LJ5 d;  3OYE A;  3E9G A;  3OW2 A;  3FRN A;  4M78 F;  3CCR T;  1M1K U;  3HSB A;  3OS0 A;  1VQ8 A;  3JB9 D;  2E64 A;  3I55 A;  3UT1 A;  3MP1 A;  2PU9 B;  2V8K A;  2Y90 A;  3BDL A;  3OSV A;  5KE2 A;  5LJ3 e;  3OYC A;  5IT9 E;  2E1H A;  2D0Q B;  3N5B B;  1Q86 C;  4Q5W A;  2RHU A;  4F7U E;  1KQ2 A;  4BDZ A;  2P4T A;  2RO0 A;  2RK2 A;  1Q86 U;  2K5I A;  1S72 T;  3A8M B;  3M58 A;  4OGE A;  2QI2 A;  5A0D A;  1XQH A;  3CEY A;  4M75 D;  4HCC A;  2F69 A;  4FT4 A;  4J8O A;  4C0D B;  4IUR A;  4LDU A;  4RCC A;  5CKH A;  2DXU A;  4XU3 A;  1Y96 B;  3OS2 A;  4F7U B;  3DKM A;  4HT9 A;  3CCR A;  2CYZ B;  4IUT A;  4C8Q B;  4E7L A;  2XIC A;  4MZP A;  3CPF A;  3OYI A;  4FL6 A;  2RHZ A;  2QDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...