4M78A

Crystal structure of lsm2-8 complex, space group p21
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'MSATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 67
sequence length 67
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78A00
1U1SA 2JN0A 2ZGWA 4C92D 4PJOB 3JCMg 4M77D 5LJ5g 3V8LA 4MMKA 4M7DG 2E10A 2VXEA 5LJ3h 4EMGA 4PNOA 4WF2A 4C8QA 5GMKh 3RKWA 3V7SA 3RIRA 3SWNA 4M75G 5GAN8 4M7AA 1D3BA 1H641 1HK9A 3L1AA 3V8JA 3HFOA 3EFSA 5LJ3f 5LJ3e 5GAOm 1I81A 1WQ7A 4M7DF 4C92G 2RA2A 5GMKe 5GANg 4M77G 2YHTA 2CGHA 4XTYA 4M7DA 3JCMd 1B34A 2E41A 4A54A 4M75F 3V7CA 5CAIA 1KQ1A 4PJOD 4M7AB 5LJ3j 4RCCA 3QSUA 5GAOp 3BY7A 4C92F 5GMKj 2DXUA 5GAN7 4M77F 2DZCA 4M77E 2DTIA 4XTZA 4NOYA 2RD1A 2FB7A 2DEQA 1WQWA 1B34B 1JRIA 4C8QC 1BIAA 1LNXA 4A53A 3RKYA 4J6WA 4PJOG 4JUVA 2E1HA 4JLIA 4M78E 4F7UF 3PGGA 5GAMe 4F7UE 1N9SA 4QVDA 4M7DC 2E64A 3EFRA 2EJGA 4NL2A 1M8VA 3VU3C 2QTXA 4OP0A 1I5LA 4HT9A 4PJOF 1Y96A 4M75C 4M78D 5LJ3g 4PJOE 5GAMj 3JB9H 4HA8A 3L2ZA 3JB9D 1M5Q1 2VXFA 4C92C 4EMKA 4M77C 4C8QB 4MMLA 1KQ2A 4Y91A 3SWNB 1D3BB 3SB2A 3JCMb 5LJ5h 1WNLA 4M75A 2E65A 4X9DA 3AHUA 4XU1A 3FJPA 2YLBA 4M78G 4XU3A 5GMKm 5GAN5 4F7UG 4C92A 4JRIA 2EAYA 5LJ3d 2FYKA 4DQ2A 1I4K1 4M77A 1LOJA 5GMKi 5LJ5f 5LJ5e 5GAMh 3JB9G 4M7DB 3JCMc 3RUXA 4V2SA 3V7RA 3JCMJ 5GAOr 3HSBA 4M75B 4M78F 4JRKA 5GANh 1JBMA 5GAN2 3QUIA 5GAMf 3RESA 1HXDA 4EMHA 4XU0A 3JCMW 5LJ5j 3JB9F 4PJOC 4C92B 4EMKC 3JCMQ 2DZ9A 5GAN3 3HFNA 5GAN4 4F7UA 3JB9J 4M7AD 5GANf 2VC8A 4XQ3A 5GANe 1TH7A 3GIBA 2DTHA 2EJ9A 4XTVA 3FB9A 2RM4A 4PJOA 2EJFA 3BFMA 4J6YA 3RKXA 5GANj 2I2LA 3JCMX 5GAMd 3JCMV 2RB6A 4QVCA 5I21A 1YCYA 5GAOn 3JCMh 3JB9I 2DKGA 1U1TA 2YLCA 4XTUA 1Y96B 4XU2A 4M7AG 4N0AC 3INZA 2HNIA 2DTOA 4XTWA 1X01A 4M78C 3JCMf 3JCMe 4C8QF 4EMKB 4C8QE 2DVEA 3RERA 2DJZA 4X9CA 4M7AF 3QO3A 4M7AE 2Y90A 1N9RA 4NL3A 4N0AA 2DXTA 5GAMg 3V8KA 3BDUA 1WPYA 4M78A 4XTXA 4C8QD 2EWNA 4M77B 5GAOl 3BW1A 4M7DE 1I8FA 4RCBA 1MGQA 4J5YA 5LJ5d 1LJOA 1BIBA 3QHSA 3JCMP 4M75E 5GAN6 4J6XA 2K57A 5DY9A 4M7DD 4M78B 3FIFA 4C92E 4C8QG 4F7UB 5GMKl 3M4GA 4M75D 4HT8A 5GAOq 3SWNC 4M7AC 5GANd
chains in the Genus database with same CATH superfamily
3J7AF 1D09B 4FW1A 4BB7A 2LJ3A 2O2OA 3A5ZB 2HKQB 3EG0A 3C4SA 1UUEA 2IVWA 1WLPB 5GANg 4LDXA 2D1XA 3G4SQ 1WXTA 2D8HA 2E6NA 2RQWA 3P8DA 4J7FA 1N6AA 1VQMQ 2DEQA 1OI1A 2FZGB 1LNXA 4AFSC 2EPDA 2E70A 5CQYA 1C0MA 1ZQ1A 4M78D 3TSZA 4J9GA 2VXFA 3I5SA 1J3TA 1Q81C 2LT4A 2K2VA 4AFZC 1N8RU 2WSEE 4ZGDB 1Q7YC 3VUZA 4JRIA 1D0ZA 2EYXA 5LJ5f 2K5LA 4Z8AA 3HSBA 4ZTJA 3E9FA 5GAN2 1VQNT 4L6V5 2QK0A 3GF5A 2I0NA 2P0QA 3DB4A 3FB9A 3OYYA 1QW1A 1GFDA 1XTDA 2JW4A 3JAME 2ENMA 5GANj 2I2LA 3CCUA 5I21A 1SG5A 1VQPA 1SF9A 4JS4A 1VQLT 2D9TA 4PFPA 3X25B 2YUQA 3HKSA 2X4YA 4EDUA 2RNAA 2WSCE 2J6FA 2M51A 1VQLQ 2EWNA 4R56A 1YJWT 1LJOA 2D8JA 2DX1A 3HRSA 1NEGA 3CMEQ 4P5NA 4GLKA 3URGA 2PNIA 4RUGA 1MV3A 1YJWQ 3MEUA 3J81E 1K8AU 4N4IA 2XDDA 2EKOA 2CP3A 2BZ8A 3OA6A 1BU1A 1IGUA 1WX6A 3QIIA 1M2OA 2DO3A 2NUPA 3D7SB 3VS2A 4OGCA 2YT6A 3LX7A 1YHQT 2FG0A 2J6KA 2QI2A 3JCMd 3HRTA 2E41A 2EQUA 4M75F 5CAIA 3OYFA 3BY7A 1YHQQ 2JVVA 5GAN7 3M0QA 2DTIA 3OYEA 4NOYA 2PVOB 2QASA 1KD1R 1GXIE 2HQHA 4DA4A 1VUBA 5A0DA 4FT2A 2KVQG 2KBTA 1EIFA 2KSSA 3G7ZA 4FYXB 2DLPA 1M9SA 4C8QB 1Y71A 4MMLA 1MHNA 1PD0A 2KDSA 2E65A 2YLBA 4F04B 5GMKi 2QEXA 1MMNA 2D0NA 2KY9A 4V2SA 2XHCA 4PJOC 2XDPA 3GP8A 2AHJB 1ZUYA 1OX9A 4F14A 1VQOQ 1TH7A 1U3OA 1WHGA 1VQNA 1KG1A 4Q5WA 2LQNA 1JU5C 5KYXB 3BFMA 2DBMA 3JB9I 2ZPBB 1YCYA 1WXBA 2DM1A 3JV3A 4E7KA 4N0AC 2DD4A 4R55A 1TU0B 2C0TA 1Y07A 1KQSS 1M1KR 3EG9A 2DXTA 2WSFE 2ZPIB 1TUDA 1ZSZA 1RAGB 4BY6B 4J5YA 5CKHA 1WZOA 4J6XA 4HXJA 3LH5A 4PL6A 1GCPA 1QKXA 3CXCP 3LW5E 1M2VA 3EG1A 3SD4A 3VS3A 2JN0A 4C92D 1Q7YR 1Y7XA 1C1AA 1TXQA 3OYIA 1BCMA 2P84A 3A1PA 3LWHA 3M59A 2PZ1A 2LNVA 1VOMA 2YUPA 4LNPA 1M90U 1I81A 3QZ5B 5HCKA 3MEVA 2K3YA 1FX7A 1IHWA 2JTEA 2MIOA 3I56T 3M5AA 2RD1A 1WQWA 4PK4A 4IUPA 1G2BA 1PHTA 2XDBA 1YITT 4JUVA 1QCOA 1HSQA 4JJDA 4DOWA 1OX8A 3I56Q 2HQEA 3CCLT 1W2BP 4X1VA 1VQ7A 4OVAA 2O01E 1M27C 3CC7T 2KYMA 1AWJA 2RI5A 3RNJA 2L0AA 3M53A 1ZLMA 4Y91A 3CCLQ 2RQUA 5GMKm 4D8DA 2EYZA 5FU6B 4M77A 3JCMJ 3CPFA 2QTVA 4LD9K 1G83A 3HFNA 2HD0A 4C0ZA 3ER0A 4DEXA 2X4WA 2OAWA 2KI7A 4KUIA 2CUBA 4LDUA 3EHQA 1B3QA 3QJ6A 5CVIA 1YN8A 1XNIA 4EMKB 2LDMA 2OJ2A 1GBQA 2WACA 2EFIA 2DJZA 2X4JA 1VQ6Q 4O5VA 5HK3A 1YCSB 1U5SA 2LVMA 3PMTA 5I2MA 1AD5A 3M0RA 4ATOA 2JUFA 2RJDA 4OMMA 3A8OB 3IQLA 2V1QA 1OV3A 1RABB 1OQKA 2FO0A 2LRQA 1KC8C 1FMVA 2ED0A 1WHLA 2R5AA 3WXMB 5DLQE 5IHIA 1V29B 2GGRA 5GAN8 1KJWA 4HVUA 3EFSA 4ZN1A 1WQ7A 1K0XA 2K4YA 2RPNA 1N8RR 1Y57A 1M1FA 1WI7A 1UHCA 1PG5B 5FRMA 1BIAA 1BKBA 3G6ET 2RJEA 4PJOG 3UT1A 2OTLQ 4F7UF 2EYQA 4F7UE 4M7DC 2EQJA 1M90C 2KQWA 1PSEA 1YITA 2L89A 2KNBB 1Y96A 2LQKA 2JTMA 2O9VA 4IUTA 3O8VA 2V1RA 4A4HA 3VS0A 1FXXA 1MV0B 1WJQA 1D3BB 1E7OA 3QKJA 1WNLA 5LJ5h 3CC7A 1RLQC 3MP6A 1X2QA 1CSKA 1H8KA 1LCKA 3UWNA 1BBZA 2M16A 5J39A 2M0OA 2QQ9A 1UECA 3CC4Q 4M7AD 4LDVA 2J06A 1KQSA 3EGDB 2DE0X 3S6WA 4PLLA 3LGFA 4QQ6A 1JXOA 2K2MA 1TUGB 5KYYB 2XMFA 1IHVA 1X75C 2CT3A 4AT1B 1K8AR 1ZSZC 2A7YA 1WHJA 1NG2A 2DFUA 2KT8A 4PFOA 4XK8E 4FM4B 2RI3A 4OB0B 5I2SA 2IIMA 4M78A 5EG2A 3FEOA 4M7DE 3OS0A 3CCMQ 2O4XA 1UDLA 3ZL7C 3VRZA 1R0CB 3TU4K 1G3TA 1NYFA 3CMAQ 1RL2A 1M1GA 3PFSA 1KSWA 4IIMA 1T3LA 2DILA 5L23A 1SHFA 2H3JA 3V8LA 1Q82C 2E10A 2QAZA 5KYUA 3CD6Q 1SSFA 1V76A 2CZ6B 4EPCA 4L5GA 4FYYB 4WTOB 2C0OA 2DIGA 3L2RA 2RHUA 1X43A 3R6NA 3PE0A 5IHKA 3GOXA 2EYYA 4DBRA 1NPPA 4RTXA 3OMGA 3G6EA 2EJGA 4JRPA 4OP0A 1VQ5Q 3I5RA 3M0SA 3NPFA 1UTIA 1G3WA 4M77C 1QKWA 4Z89A 2QA4Q 5M9OA 4RTUA 4IUVA 8AT1B 1Q81U 2ABLA 2DMOA 4F7UG 4DQ2A 1I07A 3C0CA 4IUQA 1X6BA 1YNZA 4F17A 3M56A 3JCMQ 3QDRB 2LCSA 2HL5C 4PKCC 3SDZA 3OYKA 4XTVA 2H8HA 1GRIA 2ZPHB 1ARKA 5A0LA 2A3LA 3REBB 1ZBJA 2DXCA 4E47A 5GAOn 4R0KA 4A4KA 1VIFA 3MPUB 1QVFP 3X20B 1GCQA 4D6WA 1UGPB 2EQIA 3OYHA 4PFZA 1WDXA 1K73R 5LJ5d 3JCMP 2RHZA 1OU8A 4B6MA 1UGVA 2FEIA 4DBHA 2MWPA 1Z9ZA 2AKKA 2RI2A 2NUTB 5LJ5g 2IG0A 1X6GA 3NHNA 4ZN3A 4M7DG 2KE9A 4PJNA 1JQQA 2FZKB 3SWNA 4RTVA 5KCHA 2RQTA 2C06A 1B7TA 5GAOm 1ABQA 2P4TA 3EGUA 1WHKA 4A54A 4HVVA 1UFFA 5D6XA 1YJNA 4BDYA 3UA6A 4X34A 4LXCA 4XTZA 2RHIA 1G5VA 2ZZDA 4J9IA 3NFCA 3RMQA 1RUWA 3G4ST 2K3XA 1NE8A 1W4SA 3GLXA 3S3MA 2L3QA 2BZXA 1VQMT 2DD5A 2P4RA 1PKTA 1BI3A 3OYGA 2XU8A 3THKA 1JB0E 1VYUA 4E7IA 3FJPA 3CEYA 3KFVA 4C92A 4J9EA 2FYKA 4FCYA 1WJRA 2E12A 4J8OA 4ZTFA 3RUXA 4J7IA 2RN8A 2MCNA 4BE2A 3JCMW 1PC0A 5LJ5j 1QVGP 2DVJA 1YJ9Q 3EGXA 1BK2A 4XQ3A 2R5MA 1Y0MA 2FZCB 2OAUA 1R77A 2RM4A 2HBWA 3KUFA 3X24B 4DBFA 3EG2A 5KE3A 3RKXA 5J26A 4VUBA 1K1ZA 3CCJQ 2YUOA 2KGTA 3VRYA 4M78C 2M02A 1WGSA 3HRUA 5GJVB 5CCAA 3QO3A 3L2UA 4BI8B 3LYIA 2FHDA 2K79A 3VJPA 3M0TA 4C0DC 4MZPA 3H0HA 4KBMB 5FROA 2EBPA 2MK5A 3M9QA 4F7UB 3OYBA 2ZPGB 4M75D 2FRWA 4FU6A 3HPWA 2CP7A 2CP2A 2YXYA 5CR2A 1NJIU 3VS1A 3CXCS 2AZSA 5FWBA 1AWOA 3A8MB 4J9FA 3HTRA 4RTWA 2E3HA 2ZAEA 4GBQA 3CMET 3L1AA 3QZ9B 5LJ3e 1GFCA 1UB4A 3G71A 5GMKe 4M77G 2NUPB 2MI6A 2V26A 3H8ZA 1KFZA 1S72Q 5HY6A 4C5EA 4BI4A 2CP0A 3E9GA 2DXBA 1D0YA 4JLIA 4M78E 2C0IA 5GAMe 3PGGA 2PVGB 3N5BB 2W10A 5ECAA 3G4SA 1RAAB 5LJ3g 3JB9H 4HA8A 1M5Q1 4N4HA 2CS7A 2VASA 1W2BS 1KQ2A 1VQMA 2LP5A 2W0ZA 2HAXA 1TG0A 2CZ0B 4BE0A 1VYTA 3JB9G 4M7DB 4KGXB 1M8MA 3V7RA 1HXDA 1EZZB 4EMHA 1IRXA 3C95A 5GAN3 1PD1A 4IURA 1KK7A 1ZSGA 3CQTA 3PIOA 1IO6A 3UF4A 2GF7A 2P0KA 4PJJA 2CZ7B 1GCQC 2YLCA 4XU2A 2FVUA 3R6OA 2FPDA 5LL6S 2EVRA 1QWFA 1M4ZA 1VQOT 1JJ2P 5C0MA 1V1CA 1X6OA 5FLXE 1YFNA 1MMAA 4DEYA 2AKLA 5GAOl 1AOJA 3OMCA 2K7AA 4FL6A 1FWZA 4MDXA 1ZSZB 3CCSQ 2IPOB 4K11A 5C6SA 1HJDA 4NS5A 5D6YA 3SWNC 1KC8U 2DNUA 2M9UA 1RAHB 4OB3B 1TS9A 1RI9A 4MMKA 4DOVA 4EMGA 1QMCA 2KK4A 4PNOA 2QQRA 4C8QA 5IXBA 1VQLA 3QDFA 2AZVA 4M7AA 4LDWA 1XJWB 2AIRB 5FU7C 5LJ3f 4RMOA 2G3RA 4HCKA 1D1CA 3CMEA 2OTJQ 1KQ1A 3OY9A 1YJWA 2MMPA 1Q81R 3Q1JA 2X3WD 1VQ4Q 4E2FB 1NJIC 2NUZA 3FRNA 1F1BB 2RQRA 1VA7A 5KYXA 2E5QA 3BDLA 1VQ8T 4OGEA 3OSVA 4PJOF 8ATCB 4PJOE 3OQ5A 5D7UA 3L2ZA 4C92C 1YHQA 1VQ8Q 1W70A 1ZX6A 2PUOB 1YIJT 4QKUA 2XG8D 4JZ4A 4M78G 2X4XA 4BACA 1SHGA 4J9DA 3JCMc 4JLGA 1YIJQ 1C6VX 5GAOr 1X27A 4E7LA 2GFUA 3RESA 3FC3A 3CPWS 1K9MU 3MEAA 1JXMA 2VC8A 2YUNA 3A8LB 3QJYA 3QXEB 2LQ8A 3ASKA 2EJFA 1QP2A 2JZ2A 2EGAA 1E6HA 3C94A 3HL8A 1BI0A 2X3XD 1UGQB 3CC2Q 2RF0A 2F2WA 1MNDA 1U06A 4RKUE 1VQOA 1VQKQ 2E3IA 2P0PA 2XK0A 3QWYA 3CXCA 1UEBA 4RCBA 6AT1B 2F2XA 4KH1B 2CH4W 2A28A 2ECZA 2J7IA 4C92E 3CCVQ 1AWXA 2FRYA 1VQ6T 1H92A 2FL7A 2ROLA 2OI3A 3DLMA 1QP3A 2LJ0A 1RAEB 3FJ5A 3M0PA 1TWBA 2RHXA 3FLGA 4E7JA 2K5FA 1G3YA 1Q82U 2CYZB 3CCEQ 2E4HA 5CIUA 3QYGB 1B34A 2YSQA 4AFUC 1G3SA 4JDSA 1NLPC 3J80E 2MAMA 1W2BA 1YBYA 4F16A 2KRNA 2E64A 2QQSA 4BD3A 4NL2A 1AZGB 1Q95G 3EH1A 3PTAA 2XICA 2K5IA 4EMKA 2HEQA 1YI2T 2ROTA 2OTLT 4BI3A 2LX9A 1E6GA 2VVKA 1LOJA 5L8RE 5A0GA 3OYLA 3I35A 3I56A 1YI2Q 1VQ9Q 5HKCA 2CDTA 4CC3A 4IIOA 4KRTA 3S3NA 5GAN4 2DZ9A 2DEUA 2Z0WA 1X69A 3H6ZA 3SFMA 1QWEA 3CCLA 1AZEA 5CQXA 1Q86C 4JJCA 1U1TA 2KROA 2DF6A 1WHHA 3CPWP 4J9HA 3CC4T 2HMAA 4X9CA 3F70A 1NJIR 1K9MC 4NL3A 2JJ9A 4O6JA 4C8QD 1QQJA 4FIBA 3I55T 1UJ0A 4MDWA 1QVFS 2GTOA 4KT0E 4ELZC 3ZFJA 4M78B 1NEBA 2ZPFB 3I55Q 4FT4A 3OW2P 1H3ZA 2O4XB 4A4FA 3M4GA 4M7AC 2DRMA 2PU9B 1U1SA 2R57A 2PVDB 2AT1B 1VQ6A 3KBGA 3CCMT 4C0DB 1UG1A 3TEEA 2MPXC 4J9CA 2RHYA 4L59A 2EYWA 4C5GA 1D3BA 1LPLA 1NPRA 1RLPC 1JEGA 2VV5A 3CMAT 4M7DF 4C92G 2KR3A 3U23A 4JRQA 4RG8A 3V7CA 1K0SA 2QQAA 1PWTA 2FB7A 1PKSA 3OSSC 3CD6T 2DYBA 3EGDA 1XOVA 2YRCA 4LDYA 1AWWA 2LTOA 3WVEB 1MUZA 2F69A 4HCZA 3VKIA 4AFQC 3CPWA 1P92A 2RK1A 3CCQQ 4BY6C 2F1LA 4LN2A 3WVDB 4M75A 2L5QA 4UC4A 3CCRQ 2JMAA 2ATCB 3O5ZA 3OBWA 2YRVA 1I0CA 2YRDA 1VQ5T 1OZ2A 2QA4T 2HL3A 1WXUA 2GBQA 1ZA1B 2DL8A 1QVGS 2KRSA 3VYGA 1KC8R 4RTTA 2DTOA 1X01A 5A2QE 1UGSB 1N9RA 4OMQA 3CC4A 3V8KA 1W6XA 3P8HA 3MJXA 4HCCA 4CC2A 1BYMA 3QWXX 1PRLC 4QW2A 4II1A 2KXDA 1VYVA 4HVWA 2DJQA 4Z88A 3TCJA 4QQGA 2ZGWA 1X2KA 5FWCA 1RACB 3TREA 4PJOB 3EFOA 4ZGEB 4KULA 5FU6C 5LJ3h 4WF2A 5GMKh 3RIRA 1T0HA 1H641 2VYTA 1B07A 5FW9A 5IAYA 4JZ3A 1M90R 1QLYA 4QT7A 2LC4A 2L3PA 2PQWA 3CMAA 3MKDA 1SKUB 2ZCFB 2K9GA 4M77F 4M77E 4C5HA 4ZNXA 1JRIA 2GQIA 2RH2A 1N27A 3RKYA 2EGCA 3MO8A 4Y28E 2CSQA 3A8GB 1K9MR 2OX7A 2EW3A 3MP8A 4IUUA 1VQPT 1MMGA 3EG3A 4ME7A 1G8XA 1TSFA 1OPLA 1AHJB 1KD1C 3OYMA 4XU1A 3CCUQ 1VQPQ 5I22A 3OYAA 5GAN5 4RG2A 2JM9A 1I4K1 2XI9A 5KYWA 2MF2A 3E2UA 1ABOA 2CUDA 1JBMA 1PNJA 3UA7A 3JB9F 4C92B 2RJCA 4XAXB 1VQ5A 3JB9J 1OEBA 5GANe 3EAEA 2K3BA 2F2VA 2QA4A 2NUTA 1VIEA 4LE9A 1QVFA 3JCMX 2RB6A 4M7AG 2BIVA 2EGEA 2HNIA 2LCCA 1YJ9T 2DVEA 2BTTA 3RERA 1I1JA 2DK3A 5CK9A 4OMLA 4FSXA 2GNCA 3OBYA 3VS6A 1Q82R 3E19A 2GQVA 3HHTB 1JJ2S 2JT4A 3CCJT 2ESWA 1M3CA 1OZ3A 2B86A 2K57A 5DY9A 3VS4A 2Y4YA 4ZGJB 2LZ6B 1M1KC 2NWMA 4BUGA 5GJWB 2LNHB 3PIPA 2BE7D 1TTHB 4YTLA 3OYDA 3QG1A 2YHTA 2X51A 4FW2A 4BDZA 4XTYA 3OS1A 1I5OB 3QSUA 2SEMA 2QEXT 1QCFA 2A37A 1IB8A 4E7ZA 2GCXA 3TSWA 2QEXQ 1S1NA 2DL7A 1HYOA 2CP5A 1SRLA 4M75C 1S72T 4IKFA 2BE9B 4HCBA 3M55A 1VQNQ 3M54A 4J9BA 3ME9A 1TUCA 2JMCA 4WCIA 3LGLA 3AHUA 3VS7A 1QVGA 5LJ3d 4E7SA 4OB2B 1PM3A 3MEWA 1AT1B 2VGMA 4M78F 3QUIA 2A08A 3VS5A 9ATCB 2QDYB 2VB6A 1NZ9A 4F7UA 4N4GA 5GANf 2DPPB 3C12A 1PRMC 2COZA 1ZHIA 3FDRA 1UGRB 5GAMd 1IXDA 1K76A 4TVRA 1BB9A 3GNFB 5DLOA 1WA7A 3JCMe 2JM8A 5IHNA 3L2QA 2JS2A 3MHXA 1YJ9A 5GAMg 3QYHB 3BDUA 4OB1B 1RAIB 2A36A 2A0FB 5CO7A 2DL3A 4KH0B 1CKBA 3LLRA 5DM7R 4M75E 5GAN6 3TQ7P 2D0QB 3CCJA 2V8KA 2V8JA 4HT8A 4AMCA 2ZPEB 3JCMg 1VQ7T 2VXEA 4LUEA 3OYCA 4RTYA 1HK9A 3V8JA 3CCST 1Z9QA 4JJNK 1VQ7Q 2CGHA 3PT9A 4M7DA 2DRKA 3EG9B 4PJOD 4M7AB 5LJ3j 4LD6A 2CREA 4EIKA 5GMKj 2DBKA 2DZCA 1SSHA 2PUKB 2VWFA 3RR6A 1DJ7B 1GBRA 2SRCA 2BKDN 2E1HA 1ZBXA 3DKMA 3EFRA 2OTJT 1M2VB 2KT1A 1NBEB 4HT9A 2HQXA 5GAMj 2DYIA 2O9SA 2QDLA 1N8RC 5CKDA 1VQ4T 3CBOA 2VKNA 4ANJA 1S72A 3OS5A 1FMKA 3UPUA 4XU3A 3UDCA 2EAYA 2NYSA 1PCXA 4CI0C 2JXBA 5GAMf 4J83A 4C0GA 2XIDA 4QQDA 3OB9A 2JOYA 1MNEA 2DTHA 3GNGA 1AEYA 2XKOC 3ZBDA 1YWOA 4QVCA 1RADB 1NM7A 1JJ2A 4XTUA 4PJMA 4C0FA 1Q86U 4RTZA 1IGQA 3JCMf 1BI2A 4E7HA 7AT1B 4HKEA 2BUDA 2HSPA 4DBQA 1XQHA 3H41A 2KXCA 1K73U 4M77B 1I8FA 3VUBA 4D8KA 3CC2T 1WIEA 2G6FX 1T0JA 3SHWA 1K8AC 1YP5A 1RAFB 2HBPA 3ULRB 4E6RA 1VQKT 2DETA 2KMTA 1MMDA 3TVTA 2M0YA 3OW2S 2ED1A 3M4YA 4ESRA 5AYFA 3RKWA 3EH2A 4M75G 1GL5A 3REAB 2MOXA 3HFOA 1KIKA 1M3AA 3CCVT 1YITQ 2RQVA 1H3HA 1QCNA 2CH4A 2M1HA 3CCSA 4RCCA 3JSCA 4C92F 2LJ1A 3CC7Q 4CC4B 1B34B 5KCOA 1WHMA 3CCET 2XD0A 3P8BB 4J6WA 2DAQA 4OMPA 4B9XA 3DB3A 1N9SA 2JNGA 2HKNA 2QTXA 2MWOA 2F5TX 5IXFA 1I5LA 2X9HA 2JS0A 5EC7A 4JJBA 2OTJA 3UATA 4M4ZA 2GTJA 1OOTA 2BZYA 1K4US 1K9AA 3H0FA 1VQ4A 2R58A 2Y4XA 1O75A 3NTKA 5J3BA 2CT4A 3M58A 4XU0A 4LUDA 2JTFA 5D6WA 4ELYC 1SRMA 3GIBA 2EJ9A 1VQ8A 3S3OA 3M57A 5I11A 3JRZA 2DL5A 1VQ9T 1KQSP 1Y96B 1SEMA 2CSIA 1YIJA 4B9WA 2LX7A 5FRNA 1UJYA 2GFAA 1PSFA 2RK2A 2QYZA 2YDLA 3BW1A 4BE1A 2E5KA 2LCLA 2PTKA 2EIFA 2KRMA 4M7DD 1NYGA 4JPBW 2L8DA 2L2PA 3CC2A 2LT1A 2QGFB 5GAOq 2HCKA 4FYWB 3KXTA 3H0IA 2CKKA 1UE9A 1VQKA 3X28B 3G1JA 1K73C 1EX4A 2DL4A 1FMWA 2J6OA 4GY5A 3G6EQ 2RA2A 2FPEA 3L2WA 3NGPA 3CCVA 3AT1B 2V8IA 3CBPA 3PMIA 5GAOp 5AT1B 2DXUA 1A0NB 1JO8A 1ZUUA 4C8QC 1OULA 3META 2DIQA 4C5IA 2YWWA 3A8HB 1D1BA 1WJSA 2HDAA 2EQKA 3CCEA 1M8VA 3VU3C 2COYA 1W1FA 4OMNA 2COWA 1O9SA 3M0UA 5KYUB 1QVPA 3JCMb 3VV0A 2H3EB 2EQMA 3NTIA 1KHCA 5CKFA 1KD1U 1BI1A 2O31A 4CC7A 3OS2A 1EFNA 2RJFA 1M3BA 1OYXA 4M75B 2L3SA 4JRKA 4A63B 5GANh 3VYHB 5KE2A 3CCQT 5KYYA 3E1SA 3X26B 3RDVA 3CCRT 3QBYA 1CKAA 2CZ1B 3A98A 1IZ6A 4KGZB 3INZA 3H9NA 5CKBA 3DLLA 3BE3A 4XTWA 2AK5A 1YI2A 4C8QF 1VQ9A 2OTLA 4C8QE 1WYXA 3MP1A 4M7AF 4M7AE 2HSEB 1WPYA 1WFWA 4OMFB 1YJNT 3OW2A 4MZTA 1MGQA 1BIBA 1TOVA 2VGNA 2RO0A 4GLMA 1YJNQ 5GMKl 2D6FA 1FYNA 3GPLA 2QXFA 4M77D 1M1KU 4Z02A 3NMZC 4OMOA 3V7SA 3PVLA 5IN1A 1R8OB 3EFOB 3RMSA 3I9QA 5IT9E 2O88A 3LWIA 2QG9B 3I55A 5CKEA 3OYNA 1HD3A 5HK0A 4AG1C 4FYVB 3MCAB 3QPHA 1D0XA 3NTHA 1OU9A 3ZEHA 1ZUKA 4A53A 4AG2C 1Q7YU 1ACMB 2KEAA 4QVDA 3RBBB 1R0BG 3CCMA 2QQBA 4QVZA 2FPFA 2QGGA 1T3SA 4ORZA 3JB9D 4A4EA 1KHIA 3SWNB 4JS5A 3T9NA 3SB2A 4X9DA 1Q86R 4CRIA 1NLOC 1AVZC 5LJ5e 5GAMh 1U8RA 1ZA2B 5FU7B 2KYBA 5KH6A 4PJLA 3PNWC 1OPKA 3EHRA 1BCOA 4EMKC 2X35A 2NLUA 3CD6A 1IREB 5KYWB 3CCUT 2E6ZA 3CCQA 5IH2A 5KYNA 4PJOA 3HP9A 3PVQA 2MYSA 2LMJA 4J6YA 4KGVB 1N5ZA 1YWPA 3L42A 3JCMV 3CCRA 2LQWA 3JCMh 2DKGA 2CP6A 2VUBA 4OF1A 1D1AA 4MZMA 2J05A 2HZYA 4A4GA 2DERA 1SPKA 3OYJA 2Y90A 2KAFA 3G71T 4N0AA 4PLIA 2EKHA 4FSSA 2B8AA 3SEMA 4XTXA 1UHFA 2DA9A 2L3RA 1LVKA 2F5KA 2RMOA 1RI0A 3QHSA 3G71Q 3CBMA 4Y92A 1M30A 3GBQA 4KUDK 3FIFA 4C8QG 3LH0A 3EGXB 2K6DA 3L2VA 5GANd
chains in the Genus database with same CATH topology
3J7AF 3DLMA 2ZPEB 1QP3A 3JCMg 4BB7A 1VQ7T 3PFSA 3A5ZB 2H3JA 3V8LA 1Q82C 2E10A 2RHXA 2VXEA 3C4SA 3FLGA 4E7JA 3OYCA 2K5FA 2IVWA 1G3YA 1HK9A 1Q82U 3V8JA 2CYZB 3CCST 1SSFA 2CZ6B 4JJNK 5GANg 5CIUA 2CGHA 3PT9A 3QYGB 4LDXA 4M7DA 1B34A 2E6NA 4PJOD 4M7AB 5LJ3j 1G3SA 3P8DA 4J7FA 4EPCA 4JDSA 4LD6A 1N6AA 5GMKj 4L5GA 3J80E 2DZCA 2DIGA 3L2RA 2RHUA 2DEQA 2PUKB 2MAMA 1OI1A 1DJ7B 1LNXA 3GOXA 1W2BA 2BKDN 2E1HA 2E70A 1YBYA 1ZBXA 3DKMA 1NPPA 2E64A 2QQSA 3EFRA 3OMGA 5CQYA 4BD3A 2EJGA 4NL2A 3G6EA 4JRPA 4OP0A 4HT9A 1ZQ1A 4M78D 2HQXA 5GAMj 3PTAA 1N8RC 2XICA 5CKDA 2VXFA 1VQ4T 1G3WA 2K5IA 3CBOA 4M77C 4EMKA 1Q81C 2LT4A 2K2VA 5M9OA 1S72A 1YI2T 1N8RU 2OTLT 4BI3A 3OS5A 4IUVA 2WSEE 4ZGDB 1Q81U 3UPUA 4XU3A 1Q7YC 3UDCA 2LX9A 4F7UG 3VUZA 4JRIA 2EAYA 4DQ2A 5LJ5f 1LOJA 4IUQA 5L8RE 5A0GA 3OYLA 2K5LA 3I56A 3HSBA 4CI0C 4ZTJA 5HKCA 3E9FA 5GAN2 5GAMf 4J83A 1VQNT 4L6V5 3M56A 3S3NA 3JCMQ 2DZ9A 2XIDA 4C0GA 3GF5A 5GAN4 3QDRB 3H6ZA 4QQDA 3SFMA 3OB9A 4PKCC 2JOYA 3SDZA 2DTHA 3OYKA 4XTVA 2P0QA 3GNGA 3DB4A 3FB9A 3OYYA 2ZPHB 1QW1A 3CCLA 1XTDA 5CQXA 5A0LA 2XKOC 2A3LA 3JAME 5GANj 2I2LA 1Q86C 3ZBDA 2DXCA 5I21A 4QVCA 3CCUA 4E47A 1VQPA 5GAOn 1JJ2A 1U1TA 4XTUA 4C0FA 4JS4A 1Q86U 4A4KA 1VQLT 2D9TA 3JCMf 4E7HA 1BI2A 3CC4T 1VIFA 3X25B 4X9CA 4HKEA 3F70A 2BUDA 3X20B 1K9MC 3HKSA 2X4YA 4EDUA 4D6WA 1UGPB 4NL3A 1XQHA 2WSCE 4O6JA 4C8QD 4FIBA 3I55T 4MDWA 1K73U 2EWNA 4M77B 3OYHA 1QVFS 1I8FA 4R56A 3VUBA 4KT0E 1YJWT 4ELZC 5LJ5d 1LJOA 3JCMP 3HRSA 3ZFJA 3CC2T 2RHZA 4P5NA 4M78B 2ZPFB 1K8AC 4FT4A 2HBPA 1H3ZA 2O4XB 4GLKA 3URGA 4A4FA 3M4GA 3MEUA 3J81E 4M7AC 1VQKT 2PU9B 1U1SA 2MWPA 2KMTA 2PVDB 2R57A 4N4IA 1K8AU 2RI2A 3KBGA 1VQ6A 2OTJT 2XDDA 2EKOA 5LJ5g 2IG0A 3OA6A 3CCMT 4C0DB 3TEEA 4ZN3A 3OW2S 4M7DG 3QIIA 2DO3A 2RHYA 3M4YA 5AYFA 4OGCA 3RKWA 3LX7A 4L59A 4C5GA 3SWNA 4M75G 5KCHA 1D3BA 1YHQT 2C06A 1NPRA 3HFOA 5GAOm 2VV5A 3CCVT 3CMAT 4M7DF 4C92G 2P4TA 2QI2A 4JRQA 3JCMd 2M1HA 2E41A 3HRTA 4A54A 2EQUA 4M75F 4RG8A 3CCSA 3V7CA 5CAIA 5D6XA 1YJNA 3OYFA 4RCCA 4BDYA 2QQAA 3BY7A 2JVVA 3JSCA 4C92F 5GAN7 4X34A 2DTIA 4XTZA 2RHIA 3OYEA 4NOYA 2FB7A 2PVOB 1G5VA 1B34B 5KCOA 2ZZDA 3OSSC 3CCET 3CD6T 1GXIE 2XD0A 3P8BB 4J6WA 1XOVA 3NFCA 3RMQA 4DA4A 2DAQA 4LDYA 4B9XA 2K3XA 3DB3A 3G4ST 1NE8A 1N9SA 1VUBA 1W4SA 2JNGA 3GLXA 5A0DA 2KVQG 2LTOA 2MWOA 1EIFA 2F5TX 2QTXA 4FT2A 3WVEB 3S3MA 2KSSA 1I5LA 2F69A 3G7ZA 1VQMT 2DD5A 2OTJA 4HCZA 3VKIA 3CPWA 1BI3A 1M9SA 1P92A 1Y71A 4C8QB 2RK1A 3OYGA 2XU8A 4MMLA 4BY6C 1MHNA 1JB0E 2KDSA 3WVDB 4M75A 4E7IA 1VQ4A 2E65A 2L5QA 4UC4A 3FJPA 2YLBA 3CEYA 4C92A 2FYKA 5GMKi 2R58A 2QEXA 1WJRA 2E12A 2Y4XA 2KY9A 1O75A 3OBWA 2YRVA 4J8OA 4ZTFA 3RUXA 4V2SA 2XHCA 1VQ5T 4J7IA 3NTKA 4BE2A 3JCMW 5J3BA 4PJOC 3M58A 2XDPA 4XU0A 2AHJB 5LJ5j 2JTFA 3GP8A 5D6WA 1OZ2A 2QA4T 4ELYC 4XQ3A 2R5MA 1TH7A 3GIBA 1VQNA 2EJ9A 1VQ8A 1KG1A 3KUFA 2OAUA 2RM4A 3M57A 4Q5WA 3X24B 3S3OA 3BFMA 3JRZA 5KE3A 1QVGS 3RKXA 3JB9I 5J26A 2ZPBB 1YCYA 1VQ9T 4VUBA 1Y96B 4E7KA 4N0AC 3VYGA 2DD4A 1YIJA 2DTOA 1X01A 4M78C 4B9WA 4R55A 5A2QE 1Y07A 1WGSA 3HRUA 5FRNA 5CCAA 1KQSS 3QO3A 2GFAA 1UGSB 1N9RA 1PSFA 3L2UA 4BI8B 2DXTA 3LYIA 3CC4A 2FHDA 2WSFE 2ZPIB 3V8KA 2RK2A 3VJPA 3P8HA 4C0DC 4HCCA 3BW1A 4MZPA 4BY6B 4BE1A 4J5YA 2LCLA 5CKHA 1BYMA 4KBMB 5FROA 2EIFA 4J6XA 4M7DD 4QW2A 3M9QA 4PL6A 4F7UB 4II1A 2L8DA 3LW5E 3CC2A 2LT1A 2ZPGB 4M75D 3OYBA 4FU6A 3TCJA 5GAOq 3SD4A 4QQGA 2ZGWA 2JN0A 3HPWA 4C92D 3TREA 4PJOB 3KXTA 1Y7XA 4ZGEB 2CKKA 4KULA 5CR2A 1NJIU 3CXCS 5FU6C 3OYIA 5LJ3h 1VQKA 3LWHA 3A8MB 4WF2A 3X28B 1K73C 5GMKh 3RIRA 3CMET 1H641 2VYTA 3L1AA 3M59A 2LNVA 3QZ9B 4GY5A 5LJ3e 1M90U 1I81A 5IAYA 1UB4A 3QZ5B 3G71A 2RA2A 5GMKe 4M77G 3MEVA 3L2WA 2LC4A 2MI6A 2PQWA 3CCVA 3CMAA 2K3YA 1FX7A 2V8IA 3CBPA 3PMIA 5GAOp 3H8ZA 2DXUA 2ZCFB 4M77F 3I56T 4M77E 5HY6A 4C5EA 3M5AA 4C5HA 4C8QC 2RD1A 4BI4A 1WQWA 1JRIA 3META 4IUPA 3E9GA 2DIQA 2DXBA 2RH2A 1N27A 1YITT 3RKYA 2XDBA 4JUVA 4C5IA 3MO8A 3A8HB 4JLIA 4M78E 4Y28E 5GAMe 3PGGA 1WJSA 4DOWA 2HQEA 2EQKA 3CCEA 2PVGB 3A8GB 3N5BB 3CCLT 1M8VA 3VU3C 1VQ7A 3G4SA 5LJ3g 4OVAA 3MP8A 3JB9H 4IUUA 1VQPT 2O01E 4HA8A 1M5Q1 4N4HA 3CC7T 2CS7A 2RI5A 1O9SA 4ME7A 1W2BS 1KQ2A 3M53A 4Y91A 1AHJB 1VQMA 1QVPA 3JCMb 3VV0A 2HAXA 1KD1C 3OYMA 2CZ0B 2EQMA 4XU1A 5GMKm 4BE0A 3NTIA 3OYAA 5FU6B 5GAN5 1KHCA 4RG2A 3JB9G 4M7DB 1I4K1 4M77A 5CKFA 1KD1U 2XI9A 1BI1A 2MF2A 3OS2A 3V7RA 2RJFA 3JCMJ 1OYXA 3CPFA 4M75B 4JRKA 5GANh 1JBMA 3VYHB 1HXDA 4EMHA 5KE2A 3JB9F 4LD9K 4C92B 2RJCA 4XAXB 3C95A 5GAN3 3HFNA 3CCQT 2HD0A 1VQ5A 3JB9J 4C0ZA 3E1SA 4IURA 5GANe 3EAEA 3ER0A 3X26B 2X4WA 3PIOA 3CCRT 2QA4A 3QBYA 2GF7A 4KUIA 1VIEA 1QVFA 3JCMX 2CZ1B 2P0KA 2RB6A 2CZ7B 4LDUA 2YLCA 3QJ6A 2BIVA 4XU2A 4M7AG 1IZ6A 2FVUA 3INZA 3R6OA 2HNIA 5CKBA 2LCCA 3DLLA 5CVIA 4XTWA 1XNIA 1YI2A 5LL6S 4C8QF 4EMKB 2LDMA 1YJ9T 4C8QE 2DVEA 1VQOT 1M4ZA 2WACA 1VQ9A 2OTLA 2EFIA 2DJZA 3MP1A 2X4JA 3RERA 2DK3A 5C0MA 4M7AE 4O5VA 5CK9A 4M7AF 1X6OA 4FSXA 5HK3A 2LVMA 3OBYA 5FLXE 3PMTA 5I2MA 4ATOA 2JUFA 1WPYA 3E19A 2RJDA 4OMFB 2GQVA 1YJNT 5GAOl 3HHTB 3OMCA 3OW2A 4MZTA 3CCJT 1JJ2S 1MGQA 4FL6A 3A8OB 1BIBA 2VGNA 2RO0A 1FWZA 2LRQA 1OZ3A 2K57A 5DY9A 1KC8C 4MDXA 5GMKl 5C6SA 2R5AA 2Y4YA 4NS5A 4ZGJB 2D6FA 5D6YA 3SWNC 1KC8U 2M9UA 3WXMB 4BUGA 1M1KC 3GPLA 5DLQE 4OB3B 2QXFA 4M77D 1V29B 3PIPA 4MMKA 1M1KU 4Z02A 4DOVA 4EMGA 2KK4A 4PNOA 2QQRA 4C8QA 4YTLA 3OYDA 1VQLA 3V7SA 5GAN8 4M7AA 3QG1A 4LDWA 3EFSA 5FU7C 1R8OB 5IN1A 5LJ3f 3RMSA 1WQ7A 4ZN1A 2G3RA 4RMOA 5IT9E 2YHTA 3CMEA 3LWIA 4BDZA 4XTYA 3OS1A 3I55A 1KQ1A 5CKEA 3OYNA 2QEXT 3QSUA 5HK0A 2K4YA 3OY9A 1YJWA 3MCAB 1M1FA 2MMPA 3QPHA 3NTHA 3Q1JA 3ZEHA 5FRMA 2GCXA 1NJIC 1BIAA 1BKBA 4A53A 3FRNA 1Q7YU 3G6ET 2RJEA 4PJOG 3UT1A 2E5QA 4F7UF 2EYQA 4F7UE 3BDLA 1VQ8T 4QVDA 2EQJA 1M90C 2KQWA 4M7DC 1PSEA 1YITA 2L89A 4OGEA 3OSVA 3CCMA 2QQBA 4PJOF 1Y96A 2LQKA 2JTMA 3OQ5A 4M75C 4QVZA 4PJOE 1S72T 4IUTA 4IKFA 3O8VA 3L2ZA 3JB9D 4C92C 4HCBA 3M55A 4A4HA 4A4EA 1KHIA 1YHQA 2PUOB 3M54A 1YIJT 1FXXA 1WJQA 3ME9A 3SWNB 3T9NA 1D3BB 3SB2A 4JS5A 5LJ5h 3QKJA 1WNLA 3CC7A 2XG8D 4X9DA 3AHUA 3LGLA 3MP6A 2X4XA 4M78G 4BACA 4CRIA 1QVGA 5LJ3d 5LJ5e 5GAMh 1U8RA 3JCMc 4JLGA 5GAOr 4OB2B 3MEWA 2VGMA 4M78F 5FU7B 4E7LA 3UWNA 5KH6A 3QUIA 2GFUA 3RESA 3PNWC 3FC3A 3CPWS 2M16A 2QDYB 5J39A 4EMKC 2X35A 1K9MU 2NLUA 3CD6A 3MEAA 1NZ9A 1IREB 2M0OA 2QQ9A 2VC8A 2DPPB 4LDVA 4N4GA 3C12A 4F7UA 5GANf 3A8LB 1KQSA 3QJYA 3QXEB 3CCUT 4M7AD 2E6ZA 2LQ8A 3S6WA 3CCQA 3ASKA 4PJOA 2EJFA 3HP9A 1QP2A 4PLLA 2JZ2A 3LGFA 4J6YA 4QQ6A 1ZHIA 3FDRA 3L42A 1UGRB 3JCMV 5GAMd 3CCRA 3JCMh 3C94A 2DKGA 1X75C 3HL8A 1BI0A 4TVRA 2VUBA 3GNFB 4OF1A 5DLOA 1UGQB 4MZMA 2A7YA 3JCMe 4A4GA 3L2QA 3OYJA 4XK8E 2Y90A 2KAFA 3G71T 3MHXA 2RI3A 4FM4B 4N0AA 4OB0B 4PLIA 4RKUE 5GAMg 5I2SA 1YJ9A 1VQOA 2B8AA 2P0PA 2XK0A 3QYHB 3BDUA 4OB1B 4M78A 4XTXA 5EG2A 3FEOA 4M7DE 3OS0A 5CO7A 2L3RA 3CXCA 2O4XA 1UEBA 4RCBA 2F5KA 1RI0A 3LLRA 3QHSA 5DM7R 4M75E 3CBMA 5GAN6 3TU4K 1G3TA 2D0QB 4KUDK 3CCJA 3FIFA 2V8KA 4C92E 4C8QG 3LH0A 1VQ6T 1RL2A 1M1GA 2V8JA 3L2VA 4HT8A 2FL7A 5GANd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U1S A;  2JN0 A;  2ZGW A;  4C92 D;  4PJO B;  3JCM g;  4M77 D;  5LJ5 g;  3V8L A;  4MMK A;  4M7D G;  2E10 A;  2VXE A;  5LJ3 h;  4EMG A;  4PNO A;  4WF2 A;  4C8Q A;  5GMK h;  3RKW A;  3V7S A;  3RIR A;  3SWN A;  4M75 G;  5GAN 8;  4M7A A;  1D3B A;  1H64 1;  1HK9 A;  3L1A A;  3V8J A;  3HFO A;  3EFS A;  5LJ3 f;  5LJ3 e;  5GAO m;  1I81 A;  1WQ7 A;  4M7D F;  4C92 G;  2RA2 A;  5GMK e;  5GAN g;  4M77 G;  2YHT A;  2CGH A;  4XTY A;  4M7D A;  3JCM d;  1B34 A;  2E41 A;  4A54 A;  4M75 F;  3V7C A;  5CAI A;  1KQ1 A;  4PJO D;  4M7A B;  5LJ3 j;  4RCC A;  3QSU A;  5GAO p;  3BY7 A;  4C92 F;  5GMK j;  2DXU A;  5GAN 7;  4M77 F;  2DZC A;  4M77 E;  2DTI A;  4XTZ A;  4NOY A;  2RD1 A;  2FB7 A;  2DEQ A;  1WQW A;  1B34 B;  1JRI A;  4C8Q C;  1BIA A;  1LNX A;  4A53 A;  3RKY A;  4J6W A;  4PJO G;  4JUV A;  2E1H A;  4JLI A;  4M78 E;  4F7U F;  3PGG A;  5GAM e;  4F7U E;  1N9S A;  4QVD A;  4M7D C;  2E64 A;  3EFR A;  2EJG A;  4NL2 A;  1M8V A;  3VU3 C;  2QTX A;  4OP0 A;  1I5L A;  4HT9 A;  4PJO F;  1Y96 A;  4M75 C;  4M78 D;  5LJ3 g;  4PJO E;  5GAM j;  3JB9 H;  4HA8 A;  3L2Z A;  3JB9 D;  1M5Q 1;  2VXF A;  4C92 C;  4EMK A;  4M77 C;  4C8Q B;  4MML A;  1KQ2 A;  4Y91 A;  3SWN B;  1D3B B;  3SB2 A;  3JCM b;  5LJ5 h;  1WNL A;  4M75 A;  2E65 A;  4X9D A;  3AHU A;  4XU1 A;  3FJP A;  2YLB A;  4M78 G;  4XU3 A;  5GMK m;  5GAN 5;  4F7U G;  4C92 A;  4JRI A;  2EAY A;  5LJ3 d;  2FYK A;  4DQ2 A;  1I4K 1;  4M77 A;  1LOJ A;  5GMK i;  5LJ5 f;  5LJ5 e;  5GAM h;  3JB9 G;  4M7D B;  3JCM c;  3RUX A;  4V2S A;  3V7R A;  3JCM J;  5GAO r;  3HSB A;  4M75 B;  4M78 F;  4JRK A;  5GAN h;  1JBM A;  5GAN 2;  3QUI A;  5GAM f;  3RES A;  1HXD A;  4EMH A;  4XU0 A;  3JCM W;  5LJ5 j;  3JB9 F;  4PJO C;  4C92 B;  4EMK C;  3JCM Q;  2DZ9 A;  5GAN 3;  3HFN A;  5GAN 4;  4F7U A;  3JB9 J;  4M7A D;  5GAN f;  2VC8 A;  4XQ3 A;  5GAN e;  1TH7 A;  3GIB A;  2DTH A;  2EJ9 A;  4XTV A;  3FB9 A;  2RM4 A;  4PJO A;  2EJF A;  3BFM A;  4J6Y A;  3RKX A;  5GAN j;  2I2L A;  3JCM X;  5GAM d;  3JCM V;  2RB6 A;  4QVC A;  5I21 A;  1YCY A;  5GAO n;  3JCM h;  3JB9 I;  2DKG A;  1U1T A;  2YLC A;  4XTU A;  1Y96 B;  4XU2 A;  4M7A G;  4N0A C;  3INZ A;  2HNI A;  2DTO A;  4XTW A;  1X01 A;  4M78 C;  3JCM f;  3JCM e;  4C8Q F;  4EMK B;  4C8Q E;  2DVE A;  3RER A;  2DJZ A;  4X9C A;  4M7A F;  3QO3 A;  4M7A E;  2Y90 A;  1N9R A;  4NL3 A;  4N0A A;  2DXT A;  5GAM g;  3V8K A;  3BDU A;  1WPY A;  4M78 A;  4XTX A;  4C8Q D;  2EWN A;  4M77 B;  5GAO l;  3BW1 A;  4M7D E;  1I8F A;  4RCB A;  1MGQ A;  4J5Y A;  5LJ5 d;  1LJO A;  1BIB A;  3QHS A;  3JCM P;  4M75 E;  5GAN 6;  4J6X A;  2K57 A;  5DY9 A;  4M7D D;  4M78 B;  3FIF A;  4C92 E;  4C8Q G;  4F7U B;  5GMK l;  3M4G A;  4M75 D;  4HT8 A;  5GAO q;  3SWN C;  4M7A C;  5GAN d; 
#chains in the Genus database with same CATH topology
 3J7A F;  1D09 B;  4FW1 A;  4BB7 A;  2LJ3 A;  2O2O A;  3A5Z B;  2HKQ B;  3EG0 A;  3C4S A;  1UUE A;  2IVW A;  1WLP B;  5GAN g;  4LDX A;  2D1X A;  3G4S Q;  1WXT A;  2D8H A;  2E6N A;  2RQW A;  3P8D A;  4J7F A;  1N6A A;  1VQM Q;  2DEQ A;  1OI1 A;  2FZG B;  1LNX A;  4AFS C;  2EPD A;  2E70 A;  5CQY A;  1C0M A;  1ZQ1 A;  4M78 D;  3TSZ A;  4J9G A;  2VXF A;  3I5S A;  1J3T A;  1Q81 C;  2LT4 A;  2K2V A;  4AFZ C;  1N8R U;  2WSE E;  4ZGD B;  1Q7Y C;  3VUZ A;  4JRI A;  1D0Z A;  2EYX A;  5LJ5 f;  2K5L A;  4Z8A A;  3HSB A;  4ZTJ A;  3E9F A;  5GAN 2;  1VQN T;  4L6V 5;  2QK0 A;  3GF5 A;  2I0N A;  2P0Q A;  3DB4 A;  3FB9 A;  3OYY A;  1QW1 A;  1GFD A;  1XTD A;  2JW4 A;  3JAM E;  2ENM A;  5GAN j;  2I2L A;  3CCU A;  5I21 A;  1SG5 A;  1VQP A;  1SF9 A;  4JS4 A;  1VQL T;  2D9T A;  4PFP A;  3X25 B;  2YUQ A;  3HKS A;  2X4Y A;  4EDU A;  2RNA A;  2WSC E;  2J6F A;  2M51 A;  1VQL Q;  2EWN A;  4R56 A;  1YJW T;  1LJO A;  2D8J A;  2DX1 A;  3HRS A;  1NEG A;  3CME Q;  4P5N A;  4GLK A;  3URG A;  2PNI A;  4RUG A;  1MV3 A;  1YJW Q;  3MEU A;  3J81 E;  1K8A U;  4N4I A;  2XDD A;  2EKO A;  2CP3 A;  2BZ8 A;  3OA6 A;  1BU1 A;  1IGU A;  1WX6 A;  3QII A;  1M2O A;  2DO3 A;  2NUP A;  3D7S B;  3VS2 A;  4OGC A;  2YT6 A;  3LX7 A;  1YHQ T;  2FG0 A;  2J6K A;  2QI2 A;  3JCM d;  3HRT A;  2E41 A;  2EQU A;  4M75 F;  5CAI A;  3OYF A;  3BY7 A;  1YHQ Q;  2JVV A;  5GAN 7;  3M0Q A;  2DTI A;  3OYE A;  4NOY A;  2PVO B;  2QAS A;  1KD1 R;  1GXI E;  2HQH A;  4DA4 A;  1VUB A;  5A0D A;  4FT2 A;  2KVQ G;  2KBT A;  1EIF A;  2KSS A;  3G7Z A;  4FYX B;  2DLP A;  1M9S A;  4C8Q B;  1Y71 A;  4MML A;  1MHN A;  1PD0 A;  2KDS A;  2E65 A;  2YLB A;  4F04 B;  5GMK i;  2QEX A;  1MMN A;  2D0N A;  2KY9 A;  4V2S A;  2XHC A;  4PJO C;  2XDP A;  3GP8 A;  2AHJ B;  1ZUY A;  1OX9 A;  4F14 A;  1VQO Q;  1TH7 A;  1U3O A;  1WHG A;  1VQN A;  1KG1 A;  4Q5W A;  2LQN A;  1JU5 C;  5KYX B;  3BFM A;  2DBM A;  3JB9 I;  2ZPB B;  1YCY A;  1WXB A;  2DM1 A;  3JV3 A;  4E7K A;  4N0A C;  2DD4 A;  4R55 A;  1TU0 B;  2C0T A;  1Y07 A;  1KQS S;  1M1K R;  3EG9 A;  2DXT A;  2WSF E;  2ZPI B;  1TUD A;  1ZSZ A;  1RAG B;  4BY6 B;  4J5Y A;  5CKH A;  1WZO A;  4J6X A;  4HXJ A;  3LH5 A;  4PL6 A;  1GCP A;  1QKX A;  3CXC P;  3LW5 E;  1M2V A;  3EG1 A;  3SD4 A;  3VS3 A;  2JN0 A;  4C92 D;  1Q7Y R;  1Y7X A;  1C1A A;  1TXQ A;  3OYI A;  1BCM A;  2P84 A;  3A1P A;  3LWH A;  3M59 A;  2PZ1 A;  2LNV A;  1VOM A;  2YUP A;  4LNP A;  1M90 U;  1I81 A;  3QZ5 B;  5HCK A;  3MEV A;  2K3Y A;  1FX7 A;  1IHW A;  2JTE A;  2MIO A;  3I56 T;  3M5A A;  2RD1 A;  1WQW A;  4PK4 A;  4IUP A;  1G2B A;  1PHT A;  2XDB A;  1YIT T;  4JUV A;  1QCO A;  1HSQ A;  4JJD A;  4DOW A;  1OX8 A;  3I56 Q;  2HQE A;  3CCL T;  1W2B P;  4X1V A;  1VQ7 A;  4OVA A;  2O01 E;  1M27 C;  3CC7 T;  2KYM A;  1AWJ A;  2RI5 A;  3RNJ A;  2L0A A;  3M53 A;  1ZLM A;  4Y91 A;  3CCL Q;  2RQU A;  5GMK m;  4D8D A;  2EYZ A;  5FU6 B;  4M77 A;  3JCM J;  3CPF A;  2QTV A;  4LD9 K;  1G83 A;  3HFN A;  2HD0 A;  4C0Z A;  3ER0 A;  4DEX A;  2X4W A;  2OAW A;  2KI7 A;  4KUI A;  2CUB A;  4LDU A;  3EHQ A;  1B3Q A;  3QJ6 A;  5CVI A;  1YN8 A;  1XNI A;  4EMK B;  2LDM A;  2OJ2 A;  1GBQ A;  2WAC A;  2EFI A;  2DJZ A;  2X4J A;  1VQ6 Q;  4O5V A;  5HK3 A;  1YCS B;  1U5S A;  2LVM A;  3PMT A;  5I2M A;  1AD5 A;  3M0R A;  4ATO A;  2JUF A;  2RJD A;  4OMM A;  3A8O B;  3IQL A;  2V1Q A;  1OV3 A;  1RAB B;  1OQK A;  2FO0 A;  2LRQ A;  1KC8 C;  1FMV A;  2ED0 A;  1WHL A;  2R5A A;  3WXM B;  5DLQ E;  5IHI A;  1V29 B;  2GGR A;  5GAN 8;  1KJW A;  4HVU A;  3EFS A;  4ZN1 A;  1WQ7 A;  1K0X A;  2K4Y A;  2RPN A;  1N8R R;  1Y57 A;  1M1F A;  1WI7 A;  1UHC A;  1PG5 B;  5FRM A;  1BIA A;  1BKB A;  3G6E T;  2RJE A;  4PJO G;  3UT1 A;  2OTL Q;  4F7U F;  2EYQ A;  4F7U E;  4M7D C;  2EQJ A;  1M90 C;  2KQW A;  1PSE A;  1YIT A;  2L89 A;  2KNB B;  1Y96 A;  2LQK A;  2JTM A;  2O9V A;  4IUT A;  3O8V A;  2V1R A;  4A4H A;  3VS0 A;  1FXX A;  1MV0 B;  1WJQ A;  1D3B B;  1E7O A;  3QKJ A;  1WNL A;  5LJ5 h;  3CC7 A;  1RLQ C;  3MP6 A;  1X2Q A;  1CSK A;  1H8K A;  1LCK A;  3UWN A;  1BBZ A;  2M16 A;  5J39 A;  2M0O A;  2QQ9 A;  1UEC A;  3CC4 Q;  4M7A D;  4LDV A;  2J06 A;  1KQS A;  3EGD B;  2DE0 X;  3S6W A;  4PLL A;  3LGF A;  4QQ6 A;  1JXO A;  2K2M A;  1TUG B;  5KYY B;  2XMF A;  1IHV A;  1X75 C;  2CT3 A;  4AT1 B;  1K8A R;  1ZSZ C;  2A7Y A;  1WHJ A;  1NG2 A;  2DFU A;  2KT8 A;  4PFO A;  4XK8 E;  4FM4 B;  2RI3 A;  4OB0 B;  5I2S A;  2IIM A;  4M78 A;  5EG2 A;  3FEO A;  4M7D E;  3OS0 A;  3CCM Q;  2O4X A;  1UDL A;  3ZL7 C;  3VRZ A;  1R0C B;  3TU4 K;  1G3T A;  1NYF A;  3CMA Q;  1RL2 A;  1M1G A;  3PFS A;  1KSW A;  4IIM A;  1T3L A;  2DIL A;  5L23 A;  1SHF A;  2H3J A;  3V8L A;  1Q82 C;  2E10 A;  2QAZ A;  5KYU A;  3CD6 Q;  1SSF A;  1V76 A;  2CZ6 B;  4EPC A;  4L5G A;  4FYY B;  4WTO B;  2C0O A;  2DIG A;  3L2R A;  2RHU A;  1X43 A;  3R6N A;  3PE0 A;  5IHK A;  3GOX A;  2EYY A;  4DBR A;  1NPP A;  4RTX A;  3OMG A;  3G6E A;  2EJG A;  4JRP A;  4OP0 A;  1VQ5 Q;  3I5R A;  3M0S A;  3NPF A;  1UTI A;  1G3W A;  4M77 C;  1QKW A;  4Z89 A;  2QA4 Q;  5M9O A;  4RTU A;  4IUV A;  8AT1 B;  1Q81 U;  2ABL A;  2DMO A;  4F7U G;  4DQ2 A;  1I07 A;  3C0C A;  4IUQ A;  1X6B A;  1YNZ A;  4F17 A;  3M56 A;  3JCM Q;  3QDR B;  2LCS A;  2HL5 C;  4PKC C;  3SDZ A;  3OYK A;  4XTV A;  2H8H A;  1GRI A;  2ZPH B;  1ARK A;  5A0L A;  2A3L A;  3REB B;  1ZBJ A;  2DXC A;  4E47 A;  5GAO n;  4R0K A;  4A4K A;  1VIF A;  3MPU B;  1QVF P;  3X20 B;  1GCQ A;  4D6W A;  1UGP B;  2EQI A;  3OYH A;  4PFZ A;  1WDX A;  1K73 R;  5LJ5 d;  3JCM P;  2RHZ A;  1OU8 A;  4B6M A;  1UGV A;  2FEI A;  4DBH A;  2MWP A;  1Z9Z A;  2AKK A;  2RI2 A;  2NUT B;  5LJ5 g;  2IG0 A;  1X6G A;  3NHN A;  4ZN3 A;  4M7D G;  2KE9 A;  4PJN A;  1JQQ A;  2FZK B;  3SWN A;  4RTV A;  5KCH A;  2RQT A;  2C06 A;  1B7T A;  5GAO m;  1ABQ A;  2P4T A;  3EGU A;  1WHK A;  4A54 A;  4HVV A;  1UFF A;  5D6X A;  1YJN A;  4BDY A;  3UA6 A;  4X34 A;  4LXC A;  4XTZ A;  2RHI A;  1G5V A;  2ZZD A;  4J9I A;  3NFC A;  3RMQ A;  1RUW A;  3G4S T;  2K3X A;  1NE8 A;  1W4S A;  3GLX A;  3S3M A;  2L3Q A;  2BZX A;  1VQM T;  2DD5 A;  2P4R A;  1PKT A;  1BI3 A;  3OYG A;  2XU8 A;  3THK A;  1JB0 E;  1VYU A;  4E7I A;  3FJP A;  3CEY A;  3KFV A;  4C92 A;  4J9E A;  2FYK A;  4FCY A;  1WJR A;  2E12 A;  4J8O A;  4ZTF A;  3RUX A;  4J7I A;  2RN8 A;  2MCN A;  4BE2 A;  3JCM W;  1PC0 A;  5LJ5 j;  1QVG P;  2DVJ A;  1YJ9 Q;  3EGX A;  1BK2 A;  4XQ3 A;  2R5M A;  1Y0M A;  2FZC B;  2OAU A;  1R77 A;  2RM4 A;  2HBW A;  3KUF A;  3X24 B;  4DBF A;  3EG2 A;  5KE3 A;  3RKX A;  5J26 A;  4VUB A;  1K1Z A;  3CCJ Q;  2YUO A;  2KGT A;  3VRY A;  4M78 C;  2M02 A;  1WGS A;  3HRU A;  5GJV B;  5CCA A;  3QO3 A;  3L2U A;  4BI8 B;  3LYI A;  2FHD A;  2K79 A;  3VJP A;  3M0T A;  4C0D C;  4MZP A;  3H0H A;  4KBM B;  5FRO A;  2EBP A;  2MK5 A;  3M9Q A;  4F7U B;  3OYB A;  2ZPG B;  4M75 D;  2FRW A;  4FU6 A;  3HPW A;  2CP7 A;  2CP2 A;  2YXY A;  5CR2 A;  1NJI U;  3VS1 A;  3CXC S;  2AZS A;  5FWB A;  1AWO A;  3A8M B;  4J9F A;  3HTR A;  4RTW A;  2E3H A;  2ZAE A;  4GBQ A;  3CME T;  3L1A A;  3QZ9 B;  5LJ3 e;  1GFC A;  1UB4 A;  3G71 A;  5GMK e;  4M77 G;  2NUP B;  2MI6 A;  2V26 A;  3H8Z A;  1KFZ A;  1S72 Q;  5HY6 A;  4C5E A;  4BI4 A;  2CP0 A;  3E9G A;  2DXB A;  1D0Y A;  4JLI A;  4M78 E;  2C0I A;  5GAM e;  3PGG A;  2PVG B;  3N5B B;  2W10 A;  5ECA A;  3G4S A;  1RAA B;  5LJ3 g;  3JB9 H;  4HA8 A;  1M5Q 1;  4N4H A;  2CS7 A;  2VAS A;  1W2B S;  1KQ2 A;  1VQM A;  2LP5 A;  2W0Z A;  2HAX A;  1TG0 A;  2CZ0 B;  4BE0 A;  1VYT A;  3JB9 G;  4M7D B;  4KGX B;  1M8M A;  3V7R A;  1HXD A;  1EZZ B;  4EMH A;  1IRX A;  3C95 A;  5GAN 3;  1PD1 A;  4IUR A;  1KK7 A;  1ZSG A;  3CQT A;  3PIO A;  1IO6 A;  3UF4 A;  2GF7 A;  2P0K A;  4PJJ A;  2CZ7 B;  1GCQ C;  2YLC A;  4XU2 A;  2FVU A;  3R6O A;  2FPD A;  5LL6 S;  2EVR A;  1QWF A;  1M4Z A;  1VQO T;  1JJ2 P;  5C0M A;  1V1C A;  1X6O A;  5FLX E;  1YFN A;  1MMA A;  4DEY A;  2AKL A;  5GAO l;  1AOJ A;  3OMC A;  2K7A A;  4FL6 A;  1FWZ A;  4MDX A;  1ZSZ B;  3CCS Q;  2IPO B;  4K11 A;  5C6S A;  1HJD A;  4NS5 A;  5D6Y A;  3SWN C;  1KC8 U;  2DNU A;  2M9U A;  1RAH B;  4OB3 B;  1TS9 A;  1RI9 A;  4MMK A;  4DOV A;  4EMG A;  1QMC A;  2KK4 A;  4PNO A;  2QQR A;  4C8Q A;  5IXB A;  1VQL A;  3QDF A;  2AZV A;  4M7A A;  4LDW A;  1XJW B;  2AIR B;  5FU7 C;  5LJ3 f;  4RMO A;  2G3R A;  4HCK A;  1D1C A;  3CME A;  2OTJ Q;  1KQ1 A;  3OY9 A;  1YJW A;  2MMP A;  1Q81 R;  3Q1J A;  2X3W D;  1VQ4 Q;  4E2F B;  1NJI C;  2NUZ A;  3FRN A;  1F1B B;  2RQR A;  1VA7 A;  5KYX A;  2E5Q A;  3BDL A;  1VQ8 T;  4OGE A;  3OSV A;  4PJO F;  8ATC B;  4PJO E;  3OQ5 A;  5D7U A;  3L2Z A;  4C92 C;  1YHQ A;  1VQ8 Q;  1W70 A;  1ZX6 A;  2PUO B;  1YIJ T;  4QKU A;  2XG8 D;  4JZ4 A;  4M78 G;  2X4X A;  4BAC A;  1SHG A;  4J9D A;  3JCM c;  4JLG A;  1YIJ Q;  1C6V X;  5GAO r;  1X27 A;  4E7L A;  2GFU A;  3RES A;  3FC3 A;  3CPW S;  1K9M U;  3MEA A;  1JXM A;  2VC8 A;  2YUN A;  3A8L B;  3QJY A;  3QXE B;  2LQ8 A;  3ASK A;  2EJF A;  1QP2 A;  2JZ2 A;  2EGA A;  1E6H A;  3C94 A;  3HL8 A;  1BI0 A;  2X3X D;  1UGQ B;  3CC2 Q;  2RF0 A;  2F2W A;  1MND A;  1U06 A;  4RKU E;  1VQO A;  1VQK Q;  2E3I A;  2P0P A;  2XK0 A;  3QWY A;  3CXC A;  1UEB A;  4RCB A;  6AT1 B;  2F2X A;  4KH1 B;  2CH4 W;  2A28 A;  2ECZ A;  2J7I A;  4C92 E;  3CCV Q;  1AWX A;  2FRY A;  1VQ6 T;  1H92 A;  2FL7 A;  2ROL A;  2OI3 A;  3DLM A;  1QP3 A;  2LJ0 A;  1RAE B;  3FJ5 A;  3M0P A;  1TWB A;  2RHX A;  3FLG A;  4E7J A;  2K5F A;  1G3Y A;  1Q82 U;  2CYZ B;  3CCE Q;  2E4H A;  5CIU A;  3QYG B;  1B34 A;  2YSQ A;  4AFU C;  1G3S A;  4JDS A;  1NLP C;  3J80 E;  2MAM A;  1W2B A;  1YBY A;  4F16 A;  2KRN A;  2E64 A;  2QQS A;  4BD3 A;  4NL2 A;  1AZG B;  1Q95 G;  3EH1 A;  3PTA A;  2XIC A;  2K5I A;  4EMK A;  2HEQ A;  1YI2 T;  2ROT A;  2OTL T;  4BI3 A;  2LX9 A;  1E6G A;  2VVK A;  1LOJ A;  5L8R E;  5A0G A;  3OYL A;  3I35 A;  3I56 A;  1YI2 Q;  1VQ9 Q;  5HKC A;  2CDT A;  4CC3 A;  4IIO A;  4KRT A;  3S3N A;  5GAN 4;  2DZ9 A;  2DEU A;  2Z0W A;  1X69 A;  3H6Z A;  3SFM A;  1QWE A;  3CCL A;  1AZE A;  5CQX A;  1Q86 C;  4JJC A;  1U1T A;  2KRO A;  2DF6 A;  1WHH A;  3CPW P;  4J9H A;  3CC4 T;  2HMA A;  4X9C A;  3F70 A;  1NJI R;  1K9M C;  4NL3 A;  2JJ9 A;  4O6J A;  4C8Q D;  1QQJ A;  4FIB A;  3I55 T;  1UJ0 A;  4MDW A;  1QVF S;  2GTO A;  4KT0 E;  4ELZ C;  3ZFJ A;  4M78 B;  1NEB A;  2ZPF B;  3I55 Q;  4FT4 A;  3OW2 P;  1H3Z A;  2O4X B;  4A4F A;  3M4G A;  4M7A C;  2DRM A;  2PU9 B;  1U1S A;  2R57 A;  2PVD B;  2AT1 B;  1VQ6 A;  3KBG A;  3CCM T;  4C0D B;  1UG1 A;  3TEE A;  2MPX C;  4J9C A;  2RHY A;  4L59 A;  2EYW A;  4C5G A;  1D3B A;  1LPL A;  1NPR A;  1RLP C;  1JEG A;  2VV5 A;  3CMA T;  4M7D F;  4C92 G;  2KR3 A;  3U23 A;  4JRQ A;  4RG8 A;  3V7C A;  1K0S A;  2QQA A;  1PWT A;  2FB7 A;  1PKS A;  3OSS C;  3CD6 T;  2DYB A;  3EGD A;  1XOV A;  2YRC A;  4LDY A;  1AWW A;  2LTO A;  3WVE B;  1MUZ A;  2F69 A;  4HCZ A;  3VKI A;  4AFQ C;  3CPW A;  1P92 A;  2RK1 A;  3CCQ Q;  4BY6 C;  2F1L A;  4LN2 A;  3WVD B;  4M75 A;  2L5Q A;  4UC4 A;  3CCR Q;  2JMA A;  2ATC B;  3O5Z A;  3OBW A;  2YRV A;  1I0C A;  2YRD A;  1VQ5 T;  1OZ2 A;  2QA4 T;  2HL3 A;  1WXU A;  2GBQ A;  1ZA1 B;  2DL8 A;  1QVG S;  2KRS A;  3VYG A;  1KC8 R;  4RTT A;  2DTO A;  1X01 A;  5A2Q E;  1UGS B;  1N9R A;  4OMQ A;  3CC4 A;  3V8K A;  1W6X A;  3P8H A;  3MJX A;  4HCC A;  4CC2 A;  1BYM A;  3QWX X;  1PRL C;  4QW2 A;  4II1 A;  2KXD A;  1VYV A;  4HVW A;  2DJQ A;  4Z88 A;  3TCJ A;  4QQG A;  2ZGW A;  1X2K A;  5FWC A;  1RAC B;  3TRE A;  4PJO B;  3EFO A;  4ZGE B;  4KUL A;  5FU6 C;  5LJ3 h;  4WF2 A;  5GMK h;  3RIR A;  1T0H A;  1H64 1;  2VYT A;  1B07 A;  5FW9 A;  5IAY A;  4JZ3 A;  1M90 R;  1QLY A;  4QT7 A;  2LC4 A;  2L3P A;  2PQW A;  3CMA A;  3MKD A;  1SKU B;  2ZCF B;  2K9G A;  4M77 F;  4M77 E;  4C5H A;  4ZNX A;  1JRI A;  2GQI A;  2RH2 A;  1N27 A;  3RKY A;  2EGC A;  3MO8 A;  4Y28 E;  2CSQ A;  3A8G B;  1K9M R;  2OX7 A;  2EW3 A;  3MP8 A;  4IUU A;  1VQP T;  1MMG A;  3EG3 A;  4ME7 A;  1G8X A;  1TSF A;  1OPL A;  1AHJ B;  1KD1 C;  3OYM A;  4XU1 A;  3CCU Q;  1VQP Q;  5I22 A;  3OYA A;  5GAN 5;  4RG2 A;  2JM9 A;  1I4K 1;  2XI9 A;  5KYW A;  2MF2 A;  3E2U A;  1ABO A;  2CUD A;  1JBM A;  1PNJ A;  3UA7 A;  3JB9 F;  4C92 B;  2RJC A;  4XAX B;  1VQ5 A;  3JB9 J;  1OEB A;  5GAN e;  3EAE A;  2K3B A;  2F2V A;  2QA4 A;  2NUT A;  1VIE A;  4LE9 A;  1QVF A;  3JCM X;  2RB6 A;  4M7A G;  2BIV A;  2EGE A;  2HNI A;  2LCC A;  1YJ9 T;  2DVE A;  2BTT A;  3RER A;  1I1J A;  2DK3 A;  5CK9 A;  4OML A;  4FSX A;  2GNC A;  3OBY A;  3VS6 A;  1Q82 R;  3E19 A;  2GQV A;  3HHT B;  1JJ2 S;  2JT4 A;  3CCJ T;  2ESW A;  1M3C A;  1OZ3 A;  2B86 A;  2K57 A;  5DY9 A;  3VS4 A;  2Y4Y A;  4ZGJ B;  2LZ6 B;  1M1K C;  2NWM A;  4BUG A;  5GJW B;  2LNH B;  3PIP A;  2BE7 D;  1TTH B;  4YTL A;  3OYD A;  3QG1 A;  2YHT A;  2X51 A;  4FW2 A;  4BDZ A;  4XTY A;  3OS1 A;  1I5O B;  3QSU A;  2SEM A;  2QEX T;  1QCF A;  2A37 A;  1IB8 A;  4E7Z A;  2GCX A;  3TSW A;  2QEX Q;  1S1N A;  2DL7 A;  1HYO A;  2CP5 A;  1SRL A;  4M75 C;  1S72 T;  4IKF A;  2BE9 B;  4HCB A;  3M55 A;  1VQN Q;  3M54 A;  4J9B A;  3ME9 A;  1TUC A;  2JMC A;  4WCI A;  3LGL A;  3AHU A;  3VS7 A;  1QVG A;  5LJ3 d;  4E7S A;  4OB2 B;  1PM3 A;  3MEW A;  1AT1 B;  2VGM A;  4M78 F;  3QUI A;  2A08 A;  3VS5 A;  9ATC B;  2QDY B;  2VB6 A;  1NZ9 A;  4F7U A;  4N4G A;  5GAN f;  2DPP B;  3C12 A;  1PRM C;  2COZ A;  1ZHI A;  3FDR A;  1UGR B;  5GAM d;  1IXD A;  1K76 A;  4TVR A;  1BB9 A;  3GNF B;  5DLO A;  1WA7 A;  3JCM e;  2JM8 A;  5IHN A;  3L2Q A;  2JS2 A;  3MHX A;  1YJ9 A;  5GAM g;  3QYH B;  3BDU A;  4OB1 B;  1RAI B;  2A36 A;  2A0F B;  5CO7 A;  2DL3 A;  4KH0 B;  1CKB A;  3LLR A;  5DM7 R;  4M75 E;  5GAN 6;  3TQ7 P;  2D0Q B;  3CCJ A;  2V8K A;  2V8J A;  4HT8 A;  4AMC A;  2ZPE B;  3JCM g;  1VQ7 T;  2VXE A;  4LUE A;  3OYC A;  4RTY A;  1HK9 A;  3V8J A;  3CCS T;  1Z9Q A;  4JJN K;  1VQ7 Q;  2CGH A;  3PT9 A;  4M7D A;  2DRK A;  3EG9 B;  4PJO D;  4M7A B;  5LJ3 j;  4LD6 A;  2CRE A;  4EIK A;  5GMK j;  2DBK A;  2DZC A;  1SSH A;  2PUK B;  2VWF A;  3RR6 A;  1DJ7 B;  1GBR A;  2SRC A;  2BKD N;  2E1H A;  1ZBX A;  3DKM A;  3EFR A;  2OTJ T;  1M2V B;  2KT1 A;  1NBE B;  4HT9 A;  2HQX A;  5GAM j;  2DYI A;  2O9S A;  2QDL A;  1N8R C;  5CKD A;  1VQ4 T;  3CBO A;  2VKN A;  4ANJ A;  1S72 A;  3OS5 A;  1FMK A;  3UPU A;  4XU3 A;  3UDC A;  2EAY A;  2NYS A;  1PCX A;  4CI0 C;  2JXB A;  5GAM f;  4J83 A;  4C0G A;  2XID A;  4QQD A;  3OB9 A;  2JOY A;  1MNE A;  2DTH A;  3GNG A;  1AEY A;  2XKO C;  3ZBD A;  1YWO A;  4QVC A;  1RAD B;  1NM7 A;  1JJ2 A;  4XTU A;  4PJM A;  4C0F A;  1Q86 U;  4RTZ A;  1IGQ A;  3JCM f;  1BI2 A;  4E7H A;  7AT1 B;  4HKE A;  2BUD A;  2HSP A;  4DBQ A;  1XQH A;  3H41 A;  2KXC A;  1K73 U;  4M77 B;  1I8F A;  3VUB A;  4D8K A;  3CC2 T;  1WIE A;  2G6F X;  1T0J A;  3SHW A;  1K8A C;  1YP5 A;  1RAF B;  2HBP A;  3ULR B;  4E6R A;  1VQK T;  2DET A;  2KMT A;  1MMD A;  3TVT A;  2M0Y A;  3OW2 S;  2ED1 A;  3M4Y A;  4ESR A;  5AYF A;  3RKW A;  3EH2 A;  4M75 G;  1GL5 A;  3REA B;  2MOX A;  3HFO A;  1KIK A;  1M3A A;  3CCV T;  1YIT Q;  2RQV A;  1H3H A;  1QCN A;  2CH4 A;  2M1H A;  3CCS A;  4RCC A;  3JSC A;  4C92 F;  2LJ1 A;  3CC7 Q;  4CC4 B;  1B34 B;  5KCO A;  1WHM A;  3CCE T;  2XD0 A;  3P8B B;  4J6W A;  2DAQ A;  4OMP A;  4B9X A;  3DB3 A;  1N9S A;  2JNG A;  2HKN A;  2QTX A;  2MWO A;  2F5T X;  5IXF A;  1I5L A;  2X9H A;  2JS0 A;  5EC7 A;  4JJB A;  2OTJ A;  3UAT A;  4M4Z A;  2GTJ A;  1OOT A;  2BZY A;  1K4U S;  1K9A A;  3H0F A;  1VQ4 A;  2R58 A;  2Y4X A;  1O75 A;  3NTK A;  5J3B A;  2CT4 A;  3M58 A;  4XU0 A;  4LUD A;  2JTF A;  5D6W A;  4ELY C;  1SRM A;  3GIB A;  2EJ9 A;  1VQ8 A;  3S3O A;  3M57 A;  5I11 A;  3JRZ A;  2DL5 A;  1VQ9 T;  1KQS P;  1Y96 B;  1SEM A;  2CSI A;  1YIJ A;  4B9W A;  2LX7 A;  5FRN A;  1UJY A;  2GFA A;  1PSF A;  2RK2 A;  2QYZ A;  2YDL A;  3BW1 A;  4BE1 A;  2E5K A;  2LCL A;  2PTK A;  2EIF A;  2KRM A;  4M7D D;  1NYG A;  4JPB W;  2L8D A;  2L2P A;  3CC2 A;  2LT1 A;  2QGF B;  5GAO q;  2HCK A;  4FYW B;  3KXT A;  3H0I A;  2CKK A;  1UE9 A;  1VQK A;  3X28 B;  3G1J A;  1K73 C;  1EX4 A;  2DL4 A;  1FMW A;  2J6O A;  4GY5 A;  3G6E Q;  2RA2 A;  2FPE A;  3L2W A;  3NGP A;  3CCV A;  3AT1 B;  2V8I A;  3CBP A;  3PMI A;  5GAO p;  5AT1 B;  2DXU A;  1A0N B;  1JO8 A;  1ZUU A;  4C8Q C;  1OUL A;  3MET A;  2DIQ A;  4C5I A;  2YWW A;  3A8H B;  1D1B A;  1WJS A;  2HDA A;  2EQK A;  3CCE A;  1M8V A;  3VU3 C;  2COY A;  1W1F A;  4OMN A;  2COW A;  1O9S A;  3M0U A;  5KYU B;  1QVP A;  3JCM b;  3VV0 A;  2H3E B;  2EQM A;  3NTI A;  1KHC A;  5CKF A;  1KD1 U;  1BI1 A;  2O31 A;  4CC7 A;  3OS2 A;  1EFN A;  2RJF A;  1M3B A;  1OYX A;  4M75 B;  2L3S A;  4JRK A;  4A63 B;  5GAN h;  3VYH B;  5KE2 A;  3CCQ T;  5KYY A;  3E1S A;  3X26 B;  3RDV A;  3CCR T;  3QBY A;  1CKA A;  2CZ1 B;  3A98 A;  1IZ6 A;  4KGZ B;  3INZ A;  3H9N A;  5CKB A;  3DLL A;  3BE3 A;  4XTW A;  2AK5 A;  1YI2 A;  4C8Q F;  1VQ9 A;  2OTL A;  4C8Q E;  1WYX A;  3MP1 A;  4M7A F;  4M7A E;  2HSE B;  1WPY A;  1WFW A;  4OMF B;  1YJN T;  3OW2 A;  4MZT A;  1MGQ A;  1BIB A;  1TOV A;  2VGN A;  2RO0 A;  4GLM A;  1YJN Q;  5GMK l;  2D6F A;  1FYN A;  3GPL A;  2QXF A;  4M77 D;  1M1K U;  4Z02 A;  3NMZ C;  4OMO A;  3V7S A;  3PVL A;  5IN1 A;  1R8O B;  3EFO B;  3RMS A;  3I9Q A;  5IT9 E;  2O88 A;  3LWI A;  2QG9 B;  3I55 A;  5CKE A;  3OYN A;  1HD3 A;  5HK0 A;  4AG1 C;  4FYV B;  3MCA B;  3QPH A;  1D0X A;  3NTH A;  1OU9 A;  3ZEH A;  1ZUK A;  4A53 A;  4AG2 C;  1Q7Y U;  1ACM B;  2KEA A;  4QVD A;  3RBB B;  1R0B G;  3CCM A;  2QQB A;  4QVZ A;  2FPF A;  2QGG A;  1T3S A;  4ORZ A;  3JB9 D;  4A4E A;  1KHI A;  3SWN B;  4JS5 A;  3T9N A;  3SB2 A;  4X9D A;  1Q86 R;  4CRI A;  1NLO C;  1AVZ C;  5LJ5 e;  5GAM h;  1U8R A;  1ZA2 B;  5FU7 B;  2KYB A;  5KH6 A;  4PJL A;  3PNW C;  1OPK A;  3EHR A;  1BCO A;  4EMK C;  2X35 A;  2NLU A;  3CD6 A;  1IRE B;  5KYW B;  3CCU T;  2E6Z A;  3CCQ A;  5IH2 A;  5KYN A;  4PJO A;  3HP9 A;  3PVQ A;  2MYS A;  2LMJ A;  4J6Y A;  4KGV B;  1N5Z A;  1YWP A;  3L42 A;  3JCM V;  3CCR A;  2LQW A;  3JCM h;  2DKG A;  2CP6 A;  2VUB A;  4OF1 A;  1D1A A;  4MZM A;  2J05 A;  2HZY A;  4A4G A;  2DER A;  1SPK A;  3OYJ A;  2Y90 A;  2KAF A;  3G71 T;  4N0A A;  4PLI A;  2EKH A;  4FSS A;  2B8A A;  3SEM A;  4XTX A;  1UHF A;  2DA9 A;  2L3R A;  1LVK A;  2F5K A;  2RMO A;  1RI0 A;  3QHS A;  3G71 Q;  3CBM A;  4Y92 A;  1M30 A;  3GBQ A;  4KUD K;  3FIF A;  4C8Q G;  3LH0 A;  3EGX B;  2K6D A;  3L2V A;  5GAN d; 
#chains in the Genus database with same CATH homology
 3J7A F;  3DLM A;  2ZPE B;  1QP3 A;  3JCM g;  4BB7 A;  1VQ7 T;  3PFS A;  3A5Z B;  2H3J A;  3V8L A;  1Q82 C;  2E10 A;  2RHX A;  2VXE A;  3C4S A;  3FLG A;  4E7J A;  3OYC A;  2K5F A;  2IVW A;  1G3Y A;  1HK9 A;  1Q82 U;  3V8J A;  2CYZ B;  3CCS T;  1SSF A;  2CZ6 B;  4JJN K;  5GAN g;  5CIU A;  2CGH A;  3PT9 A;  3QYG B;  4LDX A;  4M7D A;  1B34 A;  2E6N A;  4PJO D;  4M7A B;  5LJ3 j;  1G3S A;  3P8D A;  4J7F A;  4EPC A;  4JDS A;  4LD6 A;  1N6A A;  5GMK j;  4L5G A;  3J80 E;  2DZC A;  2DIG A;  3L2R A;  2RHU A;  2DEQ A;  2PUK B;  2MAM A;  1OI1 A;  1DJ7 B;  1LNX A;  3GOX A;  1W2B A;  2BKD N;  2E1H A;  2E70 A;  1YBY A;  1ZBX A;  3DKM A;  1NPP A;  2E64 A;  2QQS A;  3EFR A;  3OMG A;  5CQY A;  4BD3 A;  2EJG A;  4NL2 A;  3G6E A;  4JRP A;  4OP0 A;  4HT9 A;  1ZQ1 A;  4M78 D;  2HQX A;  5GAM j;  3PTA A;  1N8R C;  2XIC A;  5CKD A;  2VXF A;  1VQ4 T;  1G3W A;  2K5I A;  3CBO A;  4M77 C;  4EMK A;  1Q81 C;  2LT4 A;  2K2V A;  5M9O A;  1S72 A;  1YI2 T;  1N8R U;  2OTL T;  4BI3 A;  3OS5 A;  4IUV A;  2WSE E;  4ZGD B;  1Q81 U;  3UPU A;  4XU3 A;  1Q7Y C;  3UDC A;  2LX9 A;  4F7U G;  3VUZ A;  4JRI A;  2EAY A;  4DQ2 A;  5LJ5 f;  1LOJ A;  4IUQ A;  5L8R E;  5A0G A;  3OYL A;  2K5L A;  3I56 A;  3HSB A;  4CI0 C;  4ZTJ A;  5HKC A;  3E9F A;  5GAN 2;  5GAM f;  4J83 A;  1VQN T;  4L6V 5;  3M56 A;  3S3N A;  3JCM Q;  2DZ9 A;  2XID A;  4C0G A;  3GF5 A;  5GAN 4;  3QDR B;  3H6Z A;  4QQD A;  3SFM A;  3OB9 A;  4PKC C;  2JOY A;  3SDZ A;  2DTH A;  3OYK A;  4XTV A;  2P0Q A;  3GNG A;  3DB4 A;  3FB9 A;  3OYY A;  2ZPH B;  1QW1 A;  3CCL A;  1XTD A;  5CQX A;  5A0L A;  2XKO C;  2A3L A;  3JAM E;  5GAN j;  2I2L A;  1Q86 C;  3ZBD A;  2DXC A;  5I21 A;  4QVC A;  3CCU A;  4E47 A;  1VQP A;  5GAO n;  1JJ2 A;  1U1T A;  4XTU A;  4C0F A;  4JS4 A;  1Q86 U;  4A4K A;  1VQL T;  2D9T A;  3JCM f;  4E7H A;  1BI2 A;  3CC4 T;  1VIF A;  3X25 B;  4X9C A;  4HKE A;  3F70 A;  2BUD A;  3X20 B;  1K9M C;  3HKS A;  2X4Y A;  4EDU A;  4D6W A;  1UGP B;  4NL3 A;  1XQH A;  2WSC E;  4O6J A;  4C8Q D;  4FIB A;  3I55 T;  4MDW A;  1K73 U;  2EWN A;  4M77 B;  3OYH A;  1QVF S;  1I8F A;  4R56 A;  3VUB A;  4KT0 E;  1YJW T;  4ELZ C;  5LJ5 d;  1LJO A;  3JCM P;  3HRS A;  3ZFJ A;  3CC2 T;  2RHZ A;  4P5N A;  4M78 B;  2ZPF B;  1K8A C;  4FT4 A;  2HBP A;  1H3Z A;  2O4X B;  4GLK A;  3URG A;  4A4F A;  3M4G A;  3MEU A;  3J81 E;  4M7A C;  1VQK T;  2PU9 B;  1U1S A;  2MWP A;  2KMT A;  2PVD B;  2R57 A;  4N4I A;  1K8A U;  2RI2 A;  3KBG A;  1VQ6 A;  2OTJ T;  2XDD A;  2EKO A;  5LJ5 g;  2IG0 A;  3OA6 A;  3CCM T;  4C0D B;  3TEE A;  4ZN3 A;  3OW2 S;  4M7D G;  3QII A;  2DO3 A;  2RHY A;  3M4Y A;  5AYF A;  4OGC A;  3RKW A;  3LX7 A;  4L59 A;  4C5G A;  3SWN A;  4M75 G;  5KCH A;  1D3B A;  1YHQ T;  2C06 A;  1NPR A;  3HFO A;  5GAO m;  2VV5 A;  3CCV T;  3CMA T;  4M7D F;  4C92 G;  2P4T A;  2QI2 A;  4JRQ A;  3JCM d;  2M1H A;  2E41 A;  3HRT A;  4A54 A;  2EQU A;  4M75 F;  4RG8 A;  3CCS A;  3V7C A;  5CAI A;  5D6X A;  1YJN A;  3OYF A;  4RCC A;  4BDY A;  2QQA A;  3BY7 A;  2JVV A;  3JSC A;  4C92 F;  5GAN 7;  4X34 A;  2DTI A;  4XTZ A;  2RHI A;  3OYE A;  4NOY A;  2FB7 A;  2PVO B;  1G5V A;  1B34 B;  5KCO A;  2ZZD A;  3OSS C;  3CCE T;  3CD6 T;  1GXI E;  2XD0 A;  3P8B B;  4J6W A;  1XOV A;  3NFC A;  3RMQ A;  4DA4 A;  2DAQ A;  4LDY A;  4B9X A;  2K3X A;  3DB3 A;  3G4S T;  1NE8 A;  1N9S A;  1VUB A;  1W4S A;  2JNG A;  3GLX A;  5A0D A;  2KVQ G;  2LTO A;  2MWO A;  1EIF A;  2F5T X;  2QTX A;  4FT2 A;  3WVE B;  3S3M A;  2KSS A;  1I5L A;  2F69 A;  3G7Z A;  1VQM T;  2DD5 A;  2OTJ A;  4HCZ A;  3VKI A;  3CPW A;  1BI3 A;  1M9S A;  1P92 A;  1Y71 A;  4C8Q B;  2RK1 A;  3OYG A;  2XU8 A;  4MML A;  4BY6 C;  1MHN A;  1JB0 E;  2KDS A;  3WVD B;  4M75 A;  4E7I A;  1VQ4 A;  2E65 A;  2L5Q A;  4UC4 A;  3FJP A;  2YLB A;  3CEY A;  4C92 A;  2FYK A;  5GMK i;  2R58 A;  2QEX A;  1WJR A;  2E12 A;  2Y4X A;  2KY9 A;  1O75 A;  3OBW A;  2YRV A;  4J8O A;  4ZTF A;  3RUX A;  4V2S A;  2XHC A;  1VQ5 T;  4J7I A;  3NTK A;  4BE2 A;  3JCM W;  5J3B A;  4PJO C;  3M58 A;  2XDP A;  4XU0 A;  2AHJ B;  5LJ5 j;  2JTF A;  3GP8 A;  5D6W A;  1OZ2 A;  2QA4 T;  4ELY C;  4XQ3 A;  2R5M A;  1TH7 A;  3GIB A;  1VQN A;  2EJ9 A;  1VQ8 A;  1KG1 A;  3KUF A;  2OAU A;  2RM4 A;  3M57 A;  4Q5W A;  3X24 B;  3S3O A;  3BFM A;  3JRZ A;  5KE3 A;  1QVG S;  3RKX A;  3JB9 I;  5J26 A;  2ZPB B;  1YCY A;  1VQ9 T;  4VUB A;  1Y96 B;  4E7K A;  4N0A C;  3VYG A;  2DD4 A;  1YIJ A;  2DTO A;  1X01 A;  4M78 C;  4B9W A;  4R55 A;  5A2Q E;  1Y07 A;  1WGS A;  3HRU A;  5FRN A;  5CCA A;  1KQS S;  3QO3 A;  2GFA A;  1UGS B;  1N9R A;  1PSF A;  3L2U A;  4BI8 B;  2DXT A;  3LYI A;  3CC4 A;  2FHD A;  2WSF E;  2ZPI B;  3V8K A;  2RK2 A;  3VJP A;  3P8H A;  4C0D C;  4HCC A;  3BW1 A;  4MZP A;  4BY6 B;  4BE1 A;  4J5Y A;  2LCL A;  5CKH A;  1BYM A;  4KBM B;  5FRO A;  2EIF A;  4J6X A;  4M7D D;  4QW2 A;  3M9Q A;  4PL6 A;  4F7U B;  4II1 A;  2L8D A;  3LW5 E;  3CC2 A;  2LT1 A;  2ZPG B;  4M75 D;  3OYB A;  4FU6 A;  3TCJ A;  5GAO q;  3SD4 A;  4QQG A;  2ZGW A;  2JN0 A;  3HPW A;  4C92 D;  3TRE A;  4PJO B;  3KXT A;  1Y7X A;  4ZGE B;  2CKK A;  4KUL A;  5CR2 A;  1NJI U;  3CXC S;  5FU6 C;  3OYI A;  5LJ3 h;  1VQK A;  3LWH A;  3A8M B;  4WF2 A;  3X28 B;  1K73 C;  5GMK h;  3RIR A;  3CME T;  1H64 1;  2VYT A;  3L1A A;  3M59 A;  2LNV A;  3QZ9 B;  4GY5 A;  5LJ3 e;  1M90 U;  1I81 A;  5IAY A;  1UB4 A;  3QZ5 B;  3G71 A;  2RA2 A;  5GMK e;  4M77 G;  3MEV A;  3L2W A;  2LC4 A;  2MI6 A;  2PQW A;  3CCV A;  3CMA A;  2K3Y A;  1FX7 A;  2V8I A;  3CBP A;  3PMI A;  5GAO p;  3H8Z A;  2DXU A;  2ZCF B;  4M77 F;  3I56 T;  4M77 E;  5HY6 A;  4C5E A;  3M5A A;  4C5H A;  4C8Q C;  2RD1 A;  4BI4 A;  1WQW A;  1JRI A;  3MET A;  4IUP A;  3E9G A;  2DIQ A;  2DXB A;  2RH2 A;  1N27 A;  1YIT T;  3RKY A;  2XDB A;  4JUV A;  4C5I A;  3MO8 A;  3A8H B;  4JLI A;  4M78 E;  4Y28 E;  5GAM e;  3PGG A;  1WJS A;  4DOW A;  2HQE A;  2EQK A;  3CCE A;  2PVG B;  3A8G B;  3N5B B;  3CCL T;  1M8V A;  3VU3 C;  1VQ7 A;  3G4S A;  5LJ3 g;  4OVA A;  3MP8 A;  3JB9 H;  4IUU A;  1VQP T;  2O01 E;  4HA8 A;  1M5Q 1;  4N4H A;  3CC7 T;  2CS7 A;  2RI5 A;  1O9S A;  4ME7 A;  1W2B S;  1KQ2 A;  3M53 A;  4Y91 A;  1AHJ B;  1VQM A;  1QVP A;  3JCM b;  3VV0 A;  2HAX A;  1KD1 C;  3OYM A;  2CZ0 B;  2EQM A;  4XU1 A;  5GMK m;  4BE0 A;  3NTI A;  3OYA A;  5FU6 B;  5GAN 5;  1KHC A;  4RG2 A;  3JB9 G;  4M7D B;  1I4K 1;  4M77 A;  5CKF A;  1KD1 U;  2XI9 A;  1BI1 A;  2MF2 A;  3OS2 A;  3V7R A;  2RJF A;  3JCM J;  1OYX A;  3CPF A;  4M75 B;  4JRK A;  5GAN h;  1JBM A;  3VYH B;  1HXD A;  4EMH A;  5KE2 A;  3JB9 F;  4LD9 K;  4C92 B;  2RJC A;  4XAX B;  3C95 A;  5GAN 3;  3HFN A;  3CCQ T;  2HD0 A;  1VQ5 A;  3JB9 J;  4C0Z A;  3E1S A;  4IUR A;  5GAN e;  3EAE A;  3ER0 A;  3X26 B;  2X4W A;  3PIO A;  3CCR T;  2QA4 A;  3QBY A;  2GF7 A;  4KUI A;  1VIE A;  1QVF A;  3JCM X;  2CZ1 B;  2P0K A;  2RB6 A;  2CZ7 B;  4LDU A;  2YLC A;  3QJ6 A;  2BIV A;  4XU2 A;  4M7A G;  1IZ6 A;  2FVU A;  3INZ A;  3R6O A;  2HNI A;  5CKB A;  2LCC A;  3DLL A;  5CVI A;  4XTW A;  1XNI A;  1YI2 A;  5LL6 S;  4C8Q F;  4EMK B;  2LDM A;  1YJ9 T;  4C8Q E;  2DVE A;  1VQO T;  1M4Z A;  2WAC A;  1VQ9 A;  2OTL A;  2EFI A;  2DJZ A;  3MP1 A;  2X4J A;  3RER A;  2DK3 A;  5C0M A;  4M7A E;  4O5V A;  5CK9 A;  4M7A F;  1X6O A;  4FSX A;  5HK3 A;  2LVM A;  3OBY A;  5FLX E;  3PMT A;  5I2M A;  4ATO A;  2JUF A;  1WPY A;  3E19 A;  2RJD A;  4OMF B;  2GQV A;  1YJN T;  5GAO l;  3HHT B;  3OMC A;  3OW2 A;  4MZT A;  3CCJ T;  1JJ2 S;  1MGQ A;  4FL6 A;  3A8O B;  1BIB A;  2VGN A;  2RO0 A;  1FWZ A;  2LRQ A;  1OZ3 A;  2K57 A;  5DY9 A;  1KC8 C;  4MDX A;  5GMK l;  5C6S A;  2R5A A;  2Y4Y A;  4NS5 A;  4ZGJ B;  2D6F A;  5D6Y A;  3SWN C;  1KC8 U;  2M9U A;  3WXM B;  4BUG A;  1M1K C;  3GPL A;  5DLQ E;  4OB3 B;  2QXF A;  4M77 D;  1V29 B;  3PIP A;  4MMK A;  1M1K U;  4Z02 A;  4DOV A;  4EMG A;  2KK4 A;  4PNO A;  2QQR A;  4C8Q A;  4YTL A;  3OYD A;  1VQL A;  3V7S A;  5GAN 8;  4M7A A;  3QG1 A;  4LDW A;  3EFS A;  5FU7 C;  1R8O B;  5IN1 A;  5LJ3 f;  3RMS A;  1WQ7 A;  4ZN1 A;  2G3R A;  4RMO A;  5IT9 E;  2YHT A;  3CME A;  3LWI A;  4BDZ A;  4XTY A;  3OS1 A;  3I55 A;  1KQ1 A;  5CKE A;  3OYN A;  2QEX T;  3QSU A;  5HK0 A;  2K4Y A;  3OY9 A;  1YJW A;  3MCA B;  1M1F A;  2MMP A;  3QPH A;  3NTH A;  3Q1J A;  3ZEH A;  5FRM A;  2GCX A;  1NJI C;  1BIA A;  1BKB A;  4A53 A;  3FRN A;  1Q7Y U;  3G6E T;  2RJE A;  4PJO G;  3UT1 A;  2E5Q A;  4F7U F;  2EYQ A;  4F7U E;  3BDL A;  1VQ8 T;  4QVD A;  2EQJ A;  1M90 C;  2KQW A;  4M7D C;  1PSE A;  1YIT A;  2L89 A;  4OGE A;  3OSV A;  3CCM A;  2QQB A;  4PJO F;  1Y96 A;  2LQK A;  2JTM A;  3OQ5 A;  4M75 C;  4QVZ A;  4PJO E;  1S72 T;  4IUT A;  4IKF A;  3O8V A;  3L2Z A;  3JB9 D;  4C92 C;  4HCB A;  3M55 A;  4A4H A;  4A4E A;  1KHI A;  1YHQ A;  2PUO B;  3M54 A;  1YIJ T;  1FXX A;  1WJQ A;  3ME9 A;  3SWN B;  3T9N A;  1D3B B;  3SB2 A;  4JS5 A;  5LJ5 h;  3QKJ A;  1WNL A;  3CC7 A;  2XG8 D;  4X9D A;  3AHU A;  3LGL A;  3MP6 A;  2X4X A;  4M78 G;  4BAC A;  4CRI A;  1QVG A;  5LJ3 d;  5LJ5 e;  5GAM h;  1U8R A;  3JCM c;  4JLG A;  5GAO r;  4OB2 B;  3MEW A;  2VGM A;  4M78 F;  5FU7 B;  4E7L A;  3UWN A;  5KH6 A;  3QUI A;  2GFU A;  3RES A;  3PNW C;  3FC3 A;  3CPW S;  2M16 A;  2QDY B;  5J39 A;  4EMK C;  2X35 A;  1K9M U;  2NLU A;  3CD6 A;  3MEA A;  1NZ9 A;  1IRE B;  2M0O A;  2QQ9 A;  2VC8 A;  2DPP B;  4LDV A;  4N4G A;  3C12 A;  4F7U A;  5GAN f;  3A8L B;  1KQS A;  3QJY A;  3QXE B;  3CCU T;  4M7A D;  2E6Z A;  2LQ8 A;  3S6W A;  3CCQ A;  3ASK A;  4PJO A;  2EJF A;  3HP9 A;  1QP2 A;  4PLL A;  2JZ2 A;  3LGF A;  4J6Y A;  4QQ6 A;  1ZHI A;  3FDR A;  3L42 A;  1UGR B;  3JCM V;  5GAM d;  3CCR A;  3JCM h;  3C94 A;  2DKG A;  1X75 C;  3HL8 A;  1BI0 A;  4TVR A;  2VUB A;  3GNF B;  4OF1 A;  5DLO A;  1UGQ B;  4MZM A;  2A7Y A;  3JCM e;  4A4G A;  3L2Q A;  3OYJ A;  4XK8 E;  2Y90 A;  2KAF A;  3G71 T;  3MHX A;  2RI3 A;  4FM4 B;  4N0A A;  4OB0 B;  4PLI A;  4RKU E;  5GAM g;  5I2S A;  1YJ9 A;  1VQO A;  2B8A A;  2P0P A;  2XK0 A;  3QYH B;  3BDU A;  4OB1 B;  4M78 A;  4XTX A;  5EG2 A;  3FEO A;  4M7D E;  3OS0 A;  5CO7 A;  2L3R A;  3CXC A;  2O4X A;  1UEB A;  4RCB A;  2F5K A;  1RI0 A;  3LLR A;  3QHS A;  5DM7 R;  4M75 E;  3CBM A;  5GAN 6;  3TU4 K;  1G3T A;  2D0Q B;  4KUD K;  3CCJ A;  3FIF A;  2V8K A;  4C92 E;  4C8Q G;  3LH0 A;  1VQ6 T;  1RL2 A;  1M1G A;  2V8J A;  3L2V A;  4HT8 A;  2FL7 A;  5GAN d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...