4M78A

Crystal structure of lsm2-8 complex, space group p21
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
MSATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 67
sequence length 67
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78A00
4M75C 1WPYA 1Y96B 3EFRA 4JRIA 4XTYA 3V8LA 3EFSA 4PNOA 4XQ3A 4XU1A 3V7CA 1WQWA 1I81A 2DZ9A 5GAOn 5GAN2 3HFOA 5GAN8 5GMKe 4M78B 4C8QC 3VU3C 4EMHA 5I21A 3V8KA 5LJ5j 4DQ2A 3SB2A 5LJ3e 2EJGA 1H641 2HNIA 4MMKA 4EMKA 4F7UG 5GAMg 2EAYA 1LOJA 4M77A 4M7AA 4J6WA 3QHSA 3JB9H 2FYKA 3QUIA 3BY7A 3JB9D 2DJZA 4M77E 4M7AE 4J6XA 5CAIA 5GAN6 4F7UB 4HA8A 1TH7A 2RA2A 3JB9G 3JCMV 4C92C 3JCMd 4QVDA 4WF2A 3SWNA 1KQ1A 4M77D 3JCMQ 4M7AD 4F7UF 2E1HA 3JCMX 5LJ5d 4M7DA 4EMKB 1M5Q1 4JRKA 5GANj 4X9CA 4XTUA 4M77G 4MMLA 5GAMh 2I2LA 3JCMJ 4M7AG 4M7DE 4M7DF 4NL2A 4PJOC 1D3BA 5GAOp 2DKGA 3JCMg 5GMKl 5GAMf 5GMKj 3JCMb 5DY9A 2E65A 3L2ZA 3JB9F 2DEQA 1I4K1 2DZCA 4M7DD 5LJ3j 5LJ5g 4M77B 4M7AB 4N0AA 5GANe 4XTVA 4M75A 3RIRA 1X01A 3V7RA 2DTHA 4X9DA 1HXDA 4M7DG 4M78C 3L1AA 3RUXA 4M75E 3JB9J 4M77F 4XTZA 5GMKm 5GANd 4M7AF 2QTXA 4C92D 5GAN5 5GAOq 4C8QA 2VXFA 1I5LA 3SWNB 5GAN3 4XU0A 3JCMP 4XTWA 3HFNA 2DVEA 4C8QE 4M7DB 4M75D 2K57A 1N9RA 3AHUA 3HSBA 5GAMe 1N9SA 4V2SA 4RCCA 3JCMh 1B34A 5LJ3d 2RM4A 3RERA 4M75G 4A54A 5GANg 4PJOD 2YHTA 5LJ5h 3M4GA 2DTOA 4C8QD 1D3BB 3BDUA 3JCMf 1U1SA 2Y90A 3JB9I 4C92A 3V8JA 5GMKi 4HT8A 3V7SA 4EMKC 4C8QG 3BW1A 5LJ5f 4C92E 3RKXA 4RCBA 1JBMA 2EJFA 1LJOA 4M75B 4C92F 5LJ3g 1YCYA 2VXEA 4PJOB 2CGHA 4PJOA 3QO3A 1WNLA 3FB9A 3FIFA 4JUVA 4M75F 3JCMc 4C8QB 5GAN4 4M77C 4M7AC 2RB6A 2DTIA 3GIBA 4PJOE 1Y96A 1WQ7A 2DXUA 4PJOF 4C92G 3JCMe 5GANh 1JRIA 4JLIA 3FJPA 4NL3A 4HT9A 4C8QF 1U1TA 4XU3A 4EMGA 4XTXA 4A53A 2E64A 1B34B 4XU2A 5LJ5e 4M78A 5GAMj 5GANf 5GAOr 1BIAA 3QSUA 5GMKh 3SWNC 4OP0A 2JN0A 4M78E 2YLBA 3PGGA 4C92B 5GAOl 2ZGWA 1HK9A 4M78F 5LJ3h 4PJOG 5GAN7 4M7DC 2EWNA 3JCMW 1M8VA 4Y91A 3BFMA 4NOYA 1KQ2A 3INZA 2DXTA 5LJ3f 3RKYA 4J5YA 4M78D 4F7UA 2YLCA 1LNXA 3RKWA 1I8FA 5GAOm 4QVCA 2RD1A 4J6YA 2E10A 4M78G 2EJ9A 3RESA 2E41A 4F7UE 1BIBA 2VC8A 5GAMd 2FB7A 1MGQA 4N0AC
chains in the Genus database with same CATH superfamily
3EFRA 4JRIA 4XQ3A 4X1VA 1VQ7Q 3QYGB 4FT4A 2C0OA 2DK3A 2O01E 3SB2A 2HDAA 5GAMg 1LOJA 1K8AU 2KBTA 4BDYA 1QVFS 2KRMA 1LCKA 3EG0A 3JB9D 5FU7C 1VQKA 1XQHA 3EHRA 4C5IA 1W6XA 3SWNA 1AWXA 2CSIA 5A0DA 2E70A 1KHCA 3QZ9B 1MV3A 2DYIA 1TSFA 1AZGB 2DEQA 1I4K1 2AKLA 3EFOA 5LJ5g 2R57A 1ZA2B 3PVLA 1VQ6Q 1TXQA 3A98A 2RHIA 3GNFB 3DB4A 2DE0X 2LZ6B 3RUXA 2JUFA 2W10A 5KYWB 1U3OA 4Z88A 5FLXE 4AMCA 5CK9A 1PM3A 1N9RA 3HSBA 2DIGA 2AHJB 2CH4A 2I0NA 3CEYA 2CUBA 3LWIA 3PTAA 1UJYA 2C06A 2ZPGB 4J9FA 1TTHB 1VQ5A 4LE9A 4E7IA 1FMKA 2C0IA 1M1KR 2CP5A 5A0GA 2KAFA 2L89A 1M90C 2W0ZA 1ABQA 4XAXB 1S72A 2O9VA 3VV0A 4PL6A 1PKTA 2E64A 5IXFA 5A2QE 2COWA 2F2VA 4PJOG 1ARKA 2RJCA 1JQQA 3BFMA 1U8RA 4A4GA 2YRVA 3LW5E 4ELYC 1M3BA 4F7UE 3ZFJA 1IZ6A 4LDWA 5GANe 2F2XA 1ZSZB 1WDXA 4FT2A 1Q82C 2RJDA 4VUBA 4LD6A 2RPNA 3CCJQ 3RR6A 3CPWA 4OGEA 4J6WA 1AWOA 1UGSB 1Y71A 4C92C 3JCMd 4LUDA 4M7AD 2OAUA 2HSPA 3JCMX 3VYHB 1E6HA 4Q5WA 4XTUA 4M77G 2EPDA 4J9HA 2FZGB 2X3XD 4KGZB 4OB1B 2KROA 2RQWA 3UWNA 1M90U 2KT1A 2D8HA 2YT6A 4M75A 3CC7T 1X01A 2LCLA 1X6OA 2QTXA 5CR2A 3OY9A 3HKSA 2P0KA 1WGSA 4A4KA 1YFNA 2RO0A 3M0UA 1V76A 2PQWA 2V26A 1RL2A 1D0ZA 3MKDA 2YHTA 1SPKA 1GFCA 4IUPA 4QKUA 3E2UA 4C8QG 2M9UA 1JBMA 4C92F 2PTKA 1YJ9T 2D8JA 1Q82U 2MYSA 3QO3A 3JCMc 1RI0A 5D7UA 2OTLA 4M7AC 2RB6A 1PD1A 1PNJA 3NFCA 5KCHA 4JJCA 4A53A 3OYKA 1B34B 3LWHA 5GANf 5IHIA 2IIMA 3A8HB 1OULA 2GTOA 4Y91A 2JS0A 1WLPB 2DXTA 1KQSP 2M0YA 2ZAEA 4IUVA 1VQPT 1M1GA 3LH5A 1K73R 2FVUA 1Y96B 1VYUA 2JTEA 2FG0A 4IUQA 4MZMA 3MP8A 1BCMA 4R55A 3MO8A 2BUDA 2XIDA 5I2MA 1G3WA 4J8OA 1HYOA 1M9SA 4B9XA 2JM8A 2RN8A 3C95A 2LCCA 3CCVQ 2LNVA 4HA8A 3G4SA 2OTJA 2K2VA 1QKXA 1KIKA 3I55T 2DM1A 4X34A 3UDCA 4C0GA 4PJMA 3JCMJ 2E3HA 5EG2A 1PCXA 2KRNA 2RI3A 2ZPIB 3FRNA 5LJ3j 1M27C 4X9DA 2JM9A 2DVJA 1QVPA 4M75E 2XKOC 4XTZA 1RLQC 2XK0A 1EIFA 2KGTA 1WZOA 4PJJA 4Y28E 1QCFA 2QTVA 2FEIA 3L2WA 2LMJA 3DLMA 2RM4A 5GANg 2QDYB 1PSEA 1YITT 2L3PA 5KYUA 1F1BB 4DEYA 2XDBA 1M2OA 1KHIA 2DLPA 3QG1A 3HRSA 3HTRA 4CI0C 1X27A 5GAN4 4JRQA 5I2SA 5HK0A 3LGFA 4JJDA 2ROLA 1JXMA 2LQ8A 1AOJA 5EC7A 2KXCA 1T3LA 1BCOA 1G2BA 4F04B 4KUIA 5GAN7 1YJ9Q 2ATCB 1IO6A 1R77A 2RF0A 1VYTA 1Q86C 1LNXA 3TEEA 4DOWA 5GAOm 3QDRB 4J9BA 4BY6B 1BIBA 1MGQA 3E1SA 4EMKA 3T9NA 5GAOn 2GQIA 2MCNA 1OZ2A 1U5SA 4RTUA 2L5QA 2P4TA 1H641 1K9AA 2CP6A 3RMSA 4F17A 1XJWB 2FYKA 2FZCB 3M0PA 3CCUA 4J6XA 4C0FA 4F7UB 1B3QA 2RQRA 1TH7A 2DNUA 1GCPA 1KQ1A 4AFQC 2DMOA 3VKIA 1WJRA 1YJNT 2E1HA 3QWXX 2AIRB 4JRKA 3FLGA 5GAMh 4DEXA 3KUFA 4R56A 1K0XA 4J9CA 4NL2A 4GLKA 2CYZB 3OYNA 2DAQA 3M0SA 3X24B 4WTOB 1UUEA 1ZSZC 2GBQA 2K9GA 2E5QA 1W2BP 2VVKA 4M77F 1SEMA 1P92A 3BDLA 3SWNB 2DVEA 3GOXA 3AT1B 4WCIA 1NPPA 2DXCA 3FEOA 4JS5A 3M0TA 1Q86U 5LJ5h 2GGRA 1KG1A 3G71Q 1MHNA 3V7SA 2ROTA 3EFOB 3BW1A 3IQLA 3CMEQ 1XNIA 2EJFA 1Y7XA 3LH0A 3L42A 1YCYA 2VXEA 3HRTA 5M9OA 1BBZA 3PNWC 2DTIA 2DD4A 2Y4XA 3FJPA 3CC2T 4C8QF 1C1AA 4XTXA 1YJWA 1ZQ1A 2XDDA 1YITQ 3M53A 1WIEA 1TUDA 1N8RC 2YUQA 2JN0A 3CC4A 3CPFA 2NUTA 2P4RA 2EVRA 3DKMA 2MAMA 5GJVB 2AZVA 3CQTA 5HKCA 2A3LA 1NYFA 2JXBA 2MI6A 1Q81C 4MDXA 3I56T 1QVFA 2EQJA 1VQMT 1BI2A 3CCRA 4FSSA 5CKHA 4ELZC 4QQGA 1VQ7T 4F14A 2E4HA 3Q1JA 2HQEA 2D1XA 2EQMA 3NPFA 3HPWA 2OX7A 2CP3A 4PLLA 3LGLA 2RA2A 3JB9G 2AKKA 4FYWB 2DF6A 1VA7A 3QIIA 2XHCA 3PIPA 3J80E 4M7DA 3VS0A 4X9CA 4C0DB 1VQ9A 2V8KA 2YUOA 1D0YA 1QMCA 1RAAB 2NYSA 3A8OB 2JS2A 5GMKj 2BZYA 2BE9B 2EKOA 5FROA 2NLUA 4QQDA 3D7SB 2L8DA 4R0KA 4LD9K 1VQ6T 4IUTA 2QA4T 1N8RU 2IPOB 4OB0B 1NLPC 2KI7A 2RMOA 4UC4A 2DYBA 3OSSC 3AHUA 1E6GA 1YWOA 4RUGA 2CH4W 4A4HA 4DBFA 4AG2C 2BKDN 2H3JA 2JNGA 1Q81U 5D6YA 1VYVA 4M75B 5L8RE 2QYZA 1UEBA 2YWWA 5IHNA 1M8MA 4JZ3A 1T0HA 4LDUA 4C0ZA 3E19A 1N6AA 5FRMA 5KE3A 1Y0MA 4B9WA 1WHJA 2O4XA 4JLGA 4C92G 4NL3A 3OYIA 4C5GA 2M0OA 2KSSA 5DLQE 2YLBA 5CQYA 2O88A 3NTHA 2P0PA 2EKHA 3TSZA 1M3AA 4KRTA 3EAEA 1BK2A 5CKDA 1M1KC 2EJ9A 3EG3A 5GJWB 1VQ5Q 4N0AC 2PUOB 7AT1B 3GF5A 4XTYA 1QVGP 3EFSA 4ZN1A 2EBPA 5CKEA 1AVZC 3OMCA 4EMHA 4DQ2A 5LJ3e 1S72Q 2B86A 3EGUA 3QYHB 2DL5A 3CCLA 2EYZA 3REBB 1ZUKA 2FPEA 3RNJA 4CC7A 2HKNA 2HD0A 3G6EA 4IURA 3CD6A 4JJBA 3UATA 3OW2P 4M7AG 4M7DE 3MEWA 3OYLA 3RBBB 1VQOA 4BY6C 4RG8A 3JCMb 1YNZA 3PMTA 1OOTA 1MV0B 1OU9A 4IIOA 4KH0B 3P8DA 5I11A 5CCAA 2JW4A 4BD3A 1H3ZA 3EG2A 3FJ5A 2KY9A 3TU4K 4J9EA 3H8ZA 4KUDK 2V1RA 4J7IA 2R5MA 4OMLA 1EZZB 4FYVB 4MZTA 1JJ2P 1M1KU 3V8JA 4PKCC 3L2VA 1UGQB 2EW3A 2QA4Q 4L5GA 2KMTA 4AT1B 3OYHA 4PJOB 3OYEA 1XTDA 2J6KA 1C0MA 5GANh 1U1TA 1GXIE 4N4HA 4EMGA 1IGQA 4D8DA 3O8VA 3QZ5B 4M78A 1SHGA 2ABLA 4QVZA 3SWNC 1AD5A 1TUGB 3MEVA 2ZGWA 1HK9A 3PE0A 3PVQA 2EWNA 4PLIA 5KYUB 3INZA 5LJ3f 1YHQT 2HMAA 2RHZA 2IG0A 2KE9A 1TS9A 2AZSA 1Z9ZA 2EQKA 3CCMA 4KULA 3HRUA 1HJDA 2DZ9A 4BI3A 1TOVA 3CCEA 1D1BA 5L23A 2OTLQ 2P84A 3QBYA 3CC2A 2KYBA 3VS2A 1VUBA 1YIJT 3C0CA 2DIQA 5AYFA 2DJZA 4ZGEB 4E2FB 2OI3A 2EFIA 4O5VA 3TREA 1GFDA 4C5HA 1VQ8A 3MEUA 1Q7YR 2QQ9A 4E6RA 3CCVT 1K73C 4EMKB 1OYXA 2KVQG 5GAOp 4RMOA 1I5OB 1AEYA 2XMFA 1BYMA 1D1AA 1WFWA 3JB9F 1RABB 4XTVA 1CKAA 3R6NA 3CXCP 3CMAA 2YUNA 4QQ6A 3MPUB 3CCQA 5KYNA 2QEXA 1LPLA 4XTWA 3NHNA 5IXBA 4M75D 1KFZA 3EHQA 5CVIA 3OYYA 3G4SQ 3MP6A 2CZ6B 2ED1A 1FYNA 2JTFA 1NJIR 1WHGA 2VKNA 1X43A 4C0DC 1AT1B 1OZ3A 1SKUB 3NTKA 4HVVA 5LJ3g 4DBHA 1OU8A 2CZ1B 5IHKA 1X2KA 3S3NA 4JUVA 1OEBA 2FL7A 2L2PA 2QDLA 2DXUA 1C6VX 1KK7A 1YI2A 2VUBA 2VGMA 3TSWA 2EGAA 1Y57A 3MP1A 2GFAA 4M78E 1E7OA 1KJWA 3H41A 1G8XA 2CT4A 1K73U 2VGNA 2BE7D 8AT1B 2HBPA 2E41A 1FMWA 1WA7A 4M75C 2EIFA 2D0NA 1D0XA 3HFOA 5GMKe 1GCQA 1WXUA 2WACA 1QW1A 1TWBA 1YHQQ 1JXOA 2X9HA 3JB9H 3QUIA 2NUTB 1VQ4T 5GAN6 1QCNA 2QI2A 4RKUE 1X6BA 4AFSC 1N27A 3G7ZA 2WSEE 4HVUA 1MMGA 2D6FA 1MUZA 5ECAA 1BI3A 1YIJQ 1LVKA 2HAXA 2E65A 1Z9QA 2F5TX 5HY6A 3L1AA 2LP5A 2PNIA 3VS5A 4M7AF 1KQSS 5GAOq 3FC3A 3ASKA 2ESWA 3OYBA 5GAN3 4ZNXA 1BI1A 4M7DB 3CCJA 3CCUQ 4OMNA 2CUDA 4DOVA 3GPLA 3RERA 4PJOD 1AHJB 2DL3A 3JB9I 4RTWA 4Z02A 2LQKA 2QXFA 1OV3A 1MNDA 3M58A 3G71T 4OMFB 2WSCE 3CMET 3DLLA 4PJOA 2PU9B 1UHCA 3LLRA 3CPWP 3JCMe 1IHVA 4HCCA 1PSFA 4JPBW 5C6SA 1WYXA 4E7SA 4II1A 3G1JA 5GAOl 3PGGA 2FZKB 4OGCA 2RQUA 3JCMW 4BE2A 1TUCA 1VQNT 1W1FA 5AT1B 5FWBA 1G3SA 2DRKA 5J39A 2DBKA 5GAMd 2A0FB 1JEGA 2LC4A 2LRQA 2YRCA 1M2VB 1FMVA 2O4XB 4PNOA 3QWYA 1VQLT 3M0QA 5I21A 3UA6A 2EAYA 1NE8A 4M77A 4A63B 2DRMA 1I0CA 1KD1R 2NWMA 4PFZA 2QG9B 3NTIA 2K3YA 2DX1A 1ZBJA 3CC4Q 1QCOA 2HSEB 3JCMQ 3CCST 5LJ5d 1SHFA 3BE3A 1RAGB 2EGEA 4MMLA 2I2LA 3OBWA 3I35A 4KGVB 1PC0A 1K9MR 3HP9A 2K6DA 1O9SA 1VQ4Q 1T0JA 4J9DA 1UFFA 1YP5A 3WVDB 1RI9A 1MMNA 1OX9A 3M5AA 4LDYA 1OQKA 4C8QA 1IREB 2LJ3A 5LL6S 3HFNA 1R0CB 2E12A 3E9GA 6AT1B 2HZYA 3X28B 5CKFA 3OA6A 4FYXB 1NPRA 4RTVA 5HK3A 1VQKT 3JCMf 1NZ9A 5IH2A 3JAME 4EMKC 3CBOA 3WVEB 5D6WA 1VQ9Q 2ZPEB 2CGHA 4ORZA 3O5ZA 4LDVA 2L3QA 5KE2A 4IUUA 2XG8D 2RQTA 4PJOE 4DBQA 1JRIA 4LN2A 3M9QA 2QASA 4E7HA 3DB3A 3OBYA 1ZHIA 2LDMA 4D6WA 2EYWA 3RKYA 4JZ4A 1W2BS 1I8FA 2RHXA 2X4YA 2E5KA 3CC7A 2MPXC 3P8HA 3V8LA 1VQ5T 3REAB 5GAN8 5KYYA 4M78B 3VU3C 4HKEA 1UTIA 2EJGA 4F7UG 2DFUA 1VQNQ 4EIKA 3J7AF 3OS2A 1RLPC 2CZ7B 2JTMA 4M77E 1S72T 1WHHA 2LTOA 1XOVA 2L0AA 1BU1A 1UJ0A 1J3TA 2CP7A 4XK8E 3L2UA 1VQLQ 2YDLA 1YJ9A 2NUPA 4GLMA 1D3BA 2JT4A 3H0FA 3JCMg 2OJ2A 4P5NA 5DY9A 3L2ZA 4M7DD 2K7AA 3M4YA 3JB9J 3I9QA 2LX9A 3CCSQ 2X51A 2BZ8A 1I5LA 2QGFB 2X4JA 3CCLQ 1M30A 3SFMA 4J9IA 4C8QE 2AK5A 2L3RA 2ZCFB 1UG1A 3R6OA 1VQPA 1ZSGA 1GBRA 1M4ZA 2PVGB 4RTTA 1MMAA 2Y90A 2V8IA 2DXBA 3CD6Q 1OI1A 3S3OA 2CKKA 1M1FA 4ANJA 4B6MA 1VQOQ 4A4FA 2XICA 1I07A 1HD3A 4HT9A 1VQKQ 1PHTA 3I55A 3EG9A 3TCJA 2DJQA 4LUEA 1WHMA 4F16A 2DERA 5LJ3h 4M7DC 1MNEA 2F2WA 2Y4YA 4Z89A 4JJNK 4J5YA 3LX7A 1ABOA 1UGPB 2VC8A 3CBPA 1FWZA 4E47A 1M2VA 1KC8R 3M57A 4Z8AA 5GAN2 5A0LA 1RAEB 2K3XA 2CP0A 3VRZA 2EYYA 1VIEA 2OTLT 4RG2A 4ATOA 3BY7A 2EYXA 2K4YA 2CS7A 4ZN3A 1YITA 3JCMV 2CZ0B 3TVTA 2R58A 3A5ZB 2MF2A 2VYTA 4KH1B 1JB0E 1AWWA 2ZPBB 3OS1A 1N8RR 4M7DF 1SSHA 4ME7A 3H0IA 3CCMQ 5DM7R 1EX4A 2F69A 2E6ZA 3CBMA 1HXDA 1WXBA 1IB8A 4N4IA 5GANd 5GMKm 1GRIA 1G3YA 3JCMP 5D6XA 1Q7YC 3VS3A 1B7TA 3VUBA 2AT1B 2SRCA 1QVGS 2PVOB 2RNAA 1M3CA 4M75G 4A54A 1VQ8Q 3BDUA 1TG0A 2RHUA 2FPDA 3G4ST 2OTJT 1QVFP 4C5EA 4RCBA 4E7ZA 1LJOA 3SDZA 2O9SA 1WNLA 2DD5A 3FB9A 4LDXA 1BI0A 4AG1C 4DA4A 3L2RA 3CMAQ 4JLIA 2J6OA 2K5IA 2RI5A 3H0HA 3OW2S 3CCQQ 4QT7A 2QEXQ 4QW2A 1YJNA 1ZBXA 2K5LA 1KSWA 2D9TA 1DJ7B 4BACA 1NJIC 2M16A 3KFVA 4FL6A 3C12A 4M78D 4FW1A 1RACB 1MMDA 1NM7A 4XU3A 2A08A 1I81A 2C0TA 2MWPA 2LNHB 2PZ1A 2ECZA 4FM4B 1SF9A 2XD0A 4MMKA 1AZEA 1JJ2S 1YI2Q 4MDWA 1Q7YU 3P8BB 2YRDA 1K8AR 3EGDB 3QDFA 4F7UF 3VUZA 2H8HA 4YTLA 4IIMA 3VJPA 1KQSA 1VIFA 4L6V5 2CSQA 1WHLA 1Y07A 2E3IA 1V1CA 4KT0E 4M77B 3ZBDA 2KXDA 2J7IA 4FIBA 3OYCA 4M78C 2A37A 1BKBA 4C92D 1ZX6A 2VXFA 2LQNA 4XU0A 1QWEA 2CP2A 4CC2A 2EQUA 1PKSA 2BIVA 2QQSA 1NJIU 2KQWA 1RAHB 3OS0A 3CCUT 4J7FA 4C92A 2B8AA 4OMPA 3I56A 4HT8A 1VQMA 3QXEB 3M54A 3RKXA 1Q95G 1NEGA 2DBMA 1GL5A 3ULRB 1VQ7A 1T3SA 3PFSA 1OPLA 3FIFA 4C8QB 4AFUC 2LT4A 2HEQA 1O75A 5KCOA 2BZXA 2HL5C 2JOYA 2GNCA 2X35A 1WI7A 5GAMj 4PK4A 2HQXA 2VWFA 1YBYA 2OTJQ 5GMKh 4OP0A 2OAWA 3C4SA 4M78F 2LJ1A 4RTYA 1G83A 3J81E 2COYA 3EH1A 2YLCA 3CXCS 3NMZC 2DO3A 2E10A 2PVDB 4IKFA 3UPUA 2QGGA 2A36A 2FB7A 1WPYA 2DPPB 1FX7A 2O31A 3V7CA 1UE9A 1VQ6A 2QA4A 3VRYA 5FRNA 4O6JA 2P0QA 5LJ5j 2ENMA 4BB7A 2YXYA 2MMPA 4M7AA 2K2MA 1QLYA 2EYQA 3EGXA 3H9NA 1HSQA 1RUWA 2LJ0A 1YJWT 3X26B 5CQXA 5IAYA 1RAFB 4M4ZA 3E9FA 3CC4T 4JRPA 4N4GA 4OMQA 5KYYB 1NEBA 2DKGA 3PMIA 2JVVA 2ZZDA 2EQIA 1K4US 1OPKA 2CREA 3RIRA 4LXCA 1KD1C 5GAN5 3CCRT 1M90R 1AWJA 2J05A 2K57A 2QK0A 2QQAA 1N9SA 3JCMh 3OSVA 4LNPA 2NUPB 1PWTA 2XI9A 3M4GA 1K1ZA 1D3BB 1U1SA 2QQBA 2V1QA 2SEMA 3NGPA 1K9MC 4C92E 1SRLA 3OB9A 1IHWA 1GCQC 2M51A 4BI8B 4M75F 3ZL7C 2PUKB 1VQ9T 2V8JA 3GLXA 5CKBA 4PFPA 1ZLMA 4J83A 2XU8A 3URGA 1Q82R 3GP8A 1WXTA 2JMAA 5CIUA 4XU2A 1W2BA 4RTXA 1TU0B 1SRMA 2LCSA 5KYXB 3MCAB 1X2QA 2A7YA 3MJXA 2R5AA 1H8KA 1PRMC 4NOYA 1H3HA 3PIOA 2COZA 3UF4A 1YN8A 2HL3A 1FXXA 2X3WD 4QVCA 3A1PA 5FWCA 3ME9A 3SHWA 1WQWA 2LT1A 2XDPA 1KD1U 3EG9B 1QP2A 3VS7A 1UECA 5J26A 1S1NA 4L59A 4M7AE 1H92A 2E6NA 5KYWA 3I5RA 2RHYA 1B07A 4WF2A 2J06A 3EGDA 4M77D 4E7LA 2GTJA 4J9GA 2YSQA 3CPWS 1K9MU 2HBWA 2ZPHB 1WJQA 3M0RA 4PJOC 3S3MA 5FU6B 3CC7Q 1UDLA 1IXDA 1SSFA 1WHKA 9ATCB 3VYGA 3QPHA 2H3EB 3KXTA 3VS1A 4HXJA 1IGUA 1YJWQ 4M7DG 3U23A 4JDSA 2DILA 3OYAA 2K79A 1PG5B 2L3SA 4RTZA 3EH2A 1YHQA 4KGXB 3N5BB 2WSFE 3CCLT 2FHDA 4EPCA 4C8QD 3OMGA 5GMKi 3FDRA 4ZGDB 1UGVA 3G6ET 1NLOC 2VASA 3CCRQ 3QJYA 3CD6T 1R0BG 1G3TA 1YIJA 2KK4A 4BDZA 1VQOT 4M77C 2FPFA 4ZGJB 2MIOA 1WJSA 4PJOF 2FO0A 3OYFA 4HCKA 1ZSZA 4D8KA 3M55A 4BE1A 5FU7B 1K76A 3QSUA 2J6FA 3CCVA 2HQHA 2M1HA 1YCSB 1NG2A 2RK2A 3PT9A 1VQPQ 2GCXA 5DLOA 1IRXA 2YUPA 3RKWA 2NUZA 2K5FA 2RQVA 1NBEB 1NYGA 3I5SA 2RD1A 2FRYA 3QKJA 4J6YA 3RESA 2F1LA 4PJNA 5I22A 3M56A 4OMMA 1JO8A 4BI4A 1CKBA 1UB4A 4C8QC 5C0MA 3QHSA 1I1JA 2ED0A 4FYYB 3I55Q 2QAZA 2D0QB 3A8MB 1UGRB 5CAIA 2GQVA 1K0SA 4QVDA 3JV3A 4ZTJA 4FW2A 4AFZC 1X6GA 2LQWA 5GANj 1A0NB 1KC8C 2A28A 4GY5A 1D1CA 1X75C 3META 4A4EA 3SEMA 3CCMT 2DTHA 1VOMA 1QVGA 2LX7A 2KDSA 1N5ZA 3WXMB 2KEAA 3X20B 1QWFA 3CCET 4BUGA 2KYMA 4ESRA 3L2QA 5GAMe 4V2SA 2HCKA 2K3BA 1B34A 5LJ3d 1SG5A 4BE0A 5FW9A 2KRSA 3OS5A 4HCBA 3ER0A 1VQ8T 4CRIA 2RJFA 4DBRA 4E7KA 3RMQA 2CDTA 4CC4B 5IT9E 1Q86R 3HL8A 1G5VA 3OW2A 4JS4A 5HCKA 4FSXA 3LYIA 3VS4A 1Y96A 2MOXA 2DA9A 1VQ4A 2MK5A 1BB9A 5KH6A 1RADB 1EFNA 5J3BA 5LJ5e 3CMAT 2G3RA 2JJ9A 3G6EQ 5KYXA 4C92B 3CCQT 1M8VA 3ZEHA 2QEXT 2JZ2A 3GBQA 3M59A 1KQ2A 4NS5A 1KC8U 3UA7A 1U06A 1PRLC 1PD0A 4HVWA 2RJEA 2KNBB 3GNGA 2M02A 2KT8A 4M78G 3SD4A 4E7JA 3A8LB 1JJ2A 1ZUYA 2G6FX 1YWPA 4XU1A 3C94A 2X4XA 2CT3A 2DL7A 3TQ7P 1ZUUA 2IVWA 3KBGA 3V8KA 4Y92A 4OMOA 2HNIA 2HKQB 2ZPFB 5CO7A 3OYGA 2DL8A 2DL4A 2QQRA 1YJNQ 1YI2T 4PFOA 2DEUA 3X25B 2DETA 1QP3A 3G71A 4OVAA 4EDUA 1M5Q1 3CMEA 3OYJA 1D09B 2MWOA 3EG1A 1WX6A 5GMKl 1X69A 5GAMf 1ACMB 3THKA 2DZCA 4FU6A 4M7AB 4N0AA 4FCYA 3V7RA 3EGXB 1W4SA 3HHTB 3S6WA 4OF1A 3H6ZA 4KBMB 2GF7A 1K8AC 1VQNA 5IN1A 4RCCA 3VS6A 8ATCB 4ZTFA 3F70A 4GBQA 2RI2A 2DTOA 4HCZA 2RK1A 1JU5C 1CSKA 5LJ5f 1OX8A 4OB2B 3OQ5A 1VQLA 3JSCA 1RAIB 3CCEQ 3OYMA 4OB3B 5FU6C 2KR3A 2EGCA 2JMCA 3CC2Q 1ZA1B 2VB6A 1Q81R 1GBQA 2X4WA 4MZPA 3GIBA 3A8GB 1WQ7A 3UT1A 2LVMA 1QQJA 4CC3A 2VV5A 1UHFA 5GAOr 2GFUA 3CXCA 1BIAA 3QJ6A 2RH2A 2F5KA 3JRZA 3CCSA 1W70A 1R8OB 2Z0WA 3MHXA 1V29B 2FRWA 3CCJT 4F7UA 4K11A 4TVRA 3RDVA 3I56Q 1VQMQ 3OYDA 3MEAA 1QKWA 2O2OA 4PJLA 2BTTA
chains in the Genus database with same CATH topology
4MDXA 1WPYA 2DPPB 3EFRA 4JRIA 1FX7A 2O4XB 4PNOA 3I56T 2EQJA 4XQ3A 3V7CA 1VQMT 3QYGB 1QVFA 1BI2A 3CCRA 4FT4A 2DK3A 1VQ6A 2QA4A 1VQLT 5CKHA 5FRNA 2O01E 4ELZC 4O6JA 5I21A 2P0QA 4QQGA 5LJ5j 3SB2A 5GAMg 1VQ7T 3Q1JA 2EAYA 2HQEA 4BB7A 1LOJA 1NE8A 4M77A 2MMPA 1K8AU 4M7AA 4BDYA 1QVFS 2EYQA 3JB9D 2EQMA 5FU7C 3NTIA 1VQKA 2K3YA 3HPWA 1XQHA 4PLLA 4C5IA 3LGLA 2RA2A 3JB9G 1YJWT 3X26B 5CQXA 3SWNA 5IAYA 3QIIA 3JCMQ 2XHCA 3PIPA 3CCST 3J80E 4M7DA 5LJ5d 3E9FA 5A0DA 4X9CA 3CC4T 4MMLA 4C0DB 2I2LA 4N4GA 4JRPA 1VQ9A 2E70A 2V8KA 3OBWA 1KHCA 3A8OB 3QZ9B 2DKGA 5GMKj 3HP9A 2DEQA 3PMIA 1I4K1 2JVVA 1O9SA 2ZZDA 5LJ5g 2EKOA 2R57A 3RIRA 5FROA 2NLUA 3WVDB 2RHIA 3GNFB 3DB4A 4QQDA 1KD1C 3RUXA 2L8DA 2JUFA 3M5AA 4LDYA 5GAN5 3CCRT 4LD9K 4C8QA 1VQ6T 4IUTA 2QA4T 1IREB 1N8RU 4OB0B 5LL6S 5FLXE 3HFNA 2E12A 3E9GA 5CK9A 4UC4A 2K57A 1N9RA 3OSSC 3AHUA 3HSBA 2QQAA 1N9SA 3JCMh 3OSVA 5CKFA 3X28B 3OA6A 2DIGA 1NPRA 2AHJB 2XI9A 5HK3A 3CEYA 3M4GA 4A4HA 1D3BB 3JCMf 3LWIA 3PTAA 1U1SA 2QQBA 1VQKT 1NZ9A 2C06A 3JAME 2BKDN 2H3JA 2JNGA 2ZPGB 4EMKC 1Q81U 5D6YA 1K9MC 3CBOA 4C92E 3WVEB 4E7IA 1VQ5A 4M75B 5D6WA 3OB9A 5L8RE 1UEBA 2ZPEB 4BI8B 2CGHA 5A0GA 2KAFA 2L89A 4LDUA 4M75F 4LDVA 2PUKB 4C0ZA 1VQ9T 3E19A 5KE2A 4IUUA 2XG8D 2V8JA 1N6AA 3GLXA 5CKBA 1M90C 5FRMA 5KE3A 4PJOE 4XAXB 4J83A 1S72A 4B9WA 2XU8A 2O4XA 4JLGA 3VV0A 3URGA 1JRIA 4C92G 4C5GA 4NL3A 3OYIA 3GP8A 4PL6A 3M9QA 5CIUA 2E64A 4XU2A 2M0OA 4E7HA 1W2BA 5A2QE 2KSSA 3DB3A 5DLQE 2YLBA 3MCAB 5CQYA 2A7YA 3OBYA 1ZHIA 3NTHA 4PJOG 2P0PA 2LDMA 2R5AA 2RJCA 3BFMA 4D6WA 1U8RA 4NOYA 3EAEA 3RKYA 4A4GA 3PIOA 2YRVA 3LW5E 4ELYC 1W2BS 1FXXA 1I8FA 5CKDA 1M1KC 4QVCA 2RHXA 2X4YA 4F7UE 2EJ9A 1IZ6A 3ZFJA 4LDWA 3CC7A 5GANe 3ME9A 4N0AC 2PUOB 3P8HA 3V8LA 3GF5A 4XTYA 3EFSA 4ZN1A 1WQWA 2LT1A 4FT2A 2XDPA 2RJDA 5CKEA 4VUBA 5GAN8 1Q82C 4LD6A 4M78B 1KD1U 3OMCA 3VU3C 4HKEA 4EMHA 1QP2A 4DQ2A 5LJ3e 2EJGA 4F7UG 5J26A 3J7AF 3QYHB 3CPWA 3OS2A 3CCLA 4OGEA 4J6WA 2CZ7B 2JTMA 4L59A 4M77E 1S72T 4M7AE 2E6NA 1UGSB 2LTOA 1XOVA 1Y71A 2RHYA 4C92C 3JCMd 4WF2A 2HD0A 3G6EA 4M77D 4M7AD 2OAUA 3JCMX 4E7LA 4IURA 4XK8E 3L2UA 3CPWS 3CD6A 1K9MU 1YJ9A 2ZPHB 3VYHB 4Q5WA 4XTUA 4M77G 1WJQA 4M7AG 4M7DE 3MEWA 3OYLA 2FB7A 4PJOC 3S3MA 1VQOA 1D3BA 4OB1B 5FU6B 3JCMg 4BY6C 1SSFA 4RG8A 4P5NA 3JCMb 3UWNA 5DY9A 3L2ZA 3VYGA 3QPHA 3KXTA 1M90U 4M7DD 4M75A 3CC7T 1X01A 3PMTA 4M7DG 2LCLA 3M4YA 3P8DA 1X6OA 3JB9J 4JDSA 5CCAA 3OYAA 2LX9A 2QTXA 5CR2A 4BD3A 3OY9A 1H3ZA 1I5LA 2X4JA 3HKSA 3SFMA 2P0KA 4C8QE 2KY9A 1YHQA 1WGSA 2L3RA 4A4KA 2ZCFB 3TU4K 2RO0A 3H8ZA 3N5BB 2WSFE 4J7IA 2PQWA 1VQ5T 3R6OA 2R5MA 1VQPA 4KUDK 1RL2A 3CCLT 2FHDA 4EPCA 1M4ZA 2PVGB 2YHTA 4C8QD 4MZTA 2Y90A 3OMGA 4IUPA 2V8IA 1M1KU 2DXBA 3V8JA 5GMKi 1OI1A 4PKCC 4C8QG 3FDRA 4ZGDB 3L2VA 2M9UA 3G6ET 3S3OA 2CKKA 1JBMA 1M1FA 1UGQB 3QJYA 4C92F 3CD6T 1YJ9T 4A4FA 4L5GA 1Q82U 2KMTA 4PJOB 3OYHA 1G3TA 3QO3A 3JCMc 2XICA 1RI0A 1YIJA 2KK4A 4BDZA 3OYEA 1VQOT 4M77C 2OTLA 2RB6A 1XTDA 4ZGJB 4M7AC 1WJSA 4PJOF 5GANh 3OYFA 4HT9A 3NFCA 1U1TA 1GXIE 4N4HA 4EMGA 5KCHA 3M55A 4A53A 3O8VA 3OYKA 1B34B 3LWHA 3QZ5B 5FU7B 4M78A 3I55A 5GANf 4BE1A 3TCJA 3QSUA 4QVZA 3SWNC 3CCVA 3MEVA 2ZGWA 1HK9A 2M1HA 5LJ3h 4M7DC 2EWNA 3A8HB 4PLIA 2RK2A 3PT9A 4Y91A 2Y4YA 3INZA 2DXTA 5LJ3f 2GCXA 1YHQT 4JJNK 4J5YA 5DLOA 3RKWA 3LX7A 4IUVA 2K5FA 1VQPT 2RHZA 1M1GA 2IG0A 2RD1A 4J6YA 3QKJA 3RESA 1UGPB 2VC8A 2EQKA 3CCMA 3CBPA 2FVUA 1FWZA 4KULA 1Y96B 3HRUA 4E47A 3M56A 4IUQA 2DZ9A 4MZMA 4BI4A 3M57A 5GAN2 4BI3A 3MP8A 4R55A 3CCEA 1UB4A 4C8QC 5A0LA 3MO8A 3QBYA 3CC2A 2K3XA 2BUDA 5C0MA 1VUBA 2XIDA 5I2MA 1G3WA 4J8OA 1YIJT 1VIEA 2OTLT 3QHSA 4RG2A 1M9SA 2DIQA 5AYFA 3BY7A 4B9XA 2DJZA 2D0QB 2K4YA 4ZGEB 3C95A 3A8MB 1UGRB 2CS7A 4ZN3A 2LCCA 5CAIA 2GQVA 2EFIA 2LNVA 4HA8A 4O5VA 3TREA 3G4SA 2K2VA 3JCMV 4C5HA 1YITA 3I55T 4QVDA 4ZTJA 1VQ8A 2OTJA 2CZ0B 4X34A 3MEUA 2QQ9A 3UDCA 4C0GA 2R58A 3CCVT 3A5ZB 1K73C 2MF2A 4EMKB 2VYTA 5GANj 1OYXA 1JB0E 1KC8C 3JCMJ 2ZPBB 3OS1A 4GY5A 4M7DF 1X75C 2KVQG 5EG2A 4ME7A 5GAOp 4RMOA 3META 1BYMA 4A4EA 5DM7R 3JB9F 2F69A 2RI3A 2ZPIB 3FRNA 5LJ3j 4XTVA 2E6ZA 2DTHA 4X9DA 3CCMT 3CBMA 3CMAA 1HXDA 1QVGA 1QVPA 4M75E 2KDSA 2XKOC 4N4IA 4XTZA 5GMKm 5GANd 4QQ6A 3WXMB 2XK0A 3X20B 1EIFA 3CCQA 3CCET 2QEXA 4BUGA 4Y28E 1G3YA 3JCMP 4XTWA 5D6XA 3L2QA 1Q7YC 4M75D 3L2WA 5GAMe 3VUBA 4V2SA 5CVIA 3DLMA 1B34A 3OYYA 2PVOB 5LJ3d 1QVGS 2RM4A 4ATOA 4M75G 4A54A 5GANg 3MP6A 2CZ6B 4BE0A 3BDUA 2QDYB 2RHUA 1PSEA 1YITT 3G4ST 2JTFA 3OS5A 4HCBA 2OTJT 3ER0A 1VQ8T 4C5EA 4CRIA 2RJFA 4E7KA 4RCBA 3RMQA 4C0DC 1LJOA 1OZ3A 5IT9E 2XDBA 3NTKA 5LJ3g 3HL8A 1G5VA 1KHIA 3QG1A 3SDZA 3OW2A 2CZ1B 3S3NA 4JS4A 3HRSA 4CI0C 1WNLA 2DD5A 3FB9A 4JUVA 1BI0A 5GAN4 4LDXA 2FL7A 4FSXA 4JRQA 5I2SA 3LYIA 3LGFA 5HK0A 1Y96A 4DA4A 2DXUA 3L2RA 2LQ8A 4JLIA 1VQ4A 1YI2A 5KH6A 2K5IA 2VUBA 2RI5A 2VGMA 5J3BA 5LJ5e 3OW2S 3MP1A 3CMAT 4QW2A 2G3RA 1YJNA 2GFAA 1ZBXA 2K5LA 4M78E 4C92B 4KUIA 5GAN7 4BACA 2D9TA 1DJ7B 3ZEHA 3CCQT 1M8VA 2QEXT 2JZ2A 2M16A 1NJIC 1K73U 3M59A 4FL6A 2VGNA 1KQ2A 4NS5A 3C12A 1KC8U 4M78D 1Q86C 1LNXA 3TEEA 4DOWA 5GAOm 2RJEA 3QDRB 3GNGA 4M78G 2HBPA 3SD4A 2E41A 4BY6B 1BIBA 4E7JA 4XU3A 1MGQA 3A8LB 1JJ2A 3E1SA 4M75C 4EMKA 2EIFA 4XU1A 3T9NA 1I81A 2X4XA 3C94A 5GAOn 2MWPA 3HFOA 1OZ2A 5GMKe 2IVWA 3KBGA 2L5QA 3V8KA 4FM4B 2WACA 2P4TA 2XD0A 1H641 1QW1A 2HNIA 4MMKA 2ZPFB 3RMSA 1JJ2S 4MDWA 5CO7A 3OYGA 3JB9H 1Q7YU 2FYKA 3QUIA 3P8BB 3CCUA 2QQRA 4J6XA 1VQ4T 5GAN6 4C0FA 4F7UB 1YI2T 1TH7A 2QI2A 3X25B 1KQ1A 1QP3A 1WJRA 3VKIA 3G71A 1YJNT 4F7UF 2E1HA 4OVAA 4RKUE 3VUZA 4EDUA 1M5Q1 4JRKA 1N27A 3G7ZA 2WSEE 3FLGA 4YTLA 5GAMh 3OYJA 3KUFA 4R56A 3VJPA 3CMEA 2D6FA 4NL2A 2MWOA 2CYZB 4GLKA 3OYNA 1KQSA 1VIFA 1BI3A 2DAQA 4L6V5 5GMKl 5GAMf 3X24B 2HAXA 1Y07A 2E65A 2DZCA 4KT0E 4FU6A 4M77B 4M7AB 4N0AA 3ZBDA 2F5TX 4FIBA 3V7RA 3HHTB 1W4SA 2E5QA 5HY6A 3OYCA 4M78C 3L1AA 4OF1A 3H6ZA 3S6WA 4M77F 4KBMB 1KQSS 1BKBA 4M7AF 5GAOq 4C92D 3FC3A 3ASKA 2VXFA 1P92A 2GF7A 3BDLA 3SWNB 3OYBA 1K8AC 5GAN3 4XU0A 2EQUA 2BIVA 2DVEA 1BI1A 1VQNA 3GOXA 4M7DB 5IN1A 2QQSA 3CCJA 1NJIU 4RCCA 4DOVA 2KQWA 3GPLA 1NPPA 4ZTFA 3F70A 2DXCA 3FEOA 3RERA 1AHJB 4JS5A 4PJOD 3OS0A 1Q86U 5LJ5h 2RI2A 2DTOA 4HCZA 3CCUT 4J7FA 3JB9I 2RK1A 1KG1A 4C92A 2B8AA 3I56A 4HT8A 1MHNA 2LQKA 3QXEB 4Z02A 3V7SA 2QXFA 1VQMA 5LJ5f 3BW1A 3M54A 1XNIA 3M58A 4OB2B 3RKXA 3OQ5A 1VQLA 2EJFA 3JSCA 3G71T 4OMFB 2WSCE 1Y7XA 3OYMA 3LH0A 1VQ7A 3L42A 1YCYA 2VXEA 3HRTA 3PFSA 4OB3B 5FU6C 5M9OA 3CMET 3DLLA 4PJOA 3FIFA 4C8QB 2PU9B 2X4WA 2LT4A 3LLRA 3PNWC 2DTIA 4MZPA 3GIBA 3A8GB 1O75A 2DD4A 1WQ7A 5KCOA 2Y4XA 3JCMe 4HCCA 3FJPA 3CC2T 3UT1A 4C8QF 2LVMA 2JOYA 4XTXA 1YJWA 1ZQ1A 2VV5A 2X35A 5GAMj 2XDDA 1PSFA 3M53A 2GFUA 3CXCA 5GAOr 2HQXA 1BIAA 1YBYA 3QJ6A 5C6SA 2RH2A 2F5KA 5GMKh 1N8RC 3JRZA 3CCSA 4OP0A 4II1A 2JN0A 3C4SA 5GAOl 3PGGA 1R8OB 4M78F 4OGCA 3CC4A 3JCMW 3MHXA 4BE2A 1V29B 3CPFA 3J81E 1VQNT 3CCJT 3DKMA 4F7UA 1G3SA 2YLCA 4TVRA 2MAMA 3CXCS 5J39A 5HKCA 3OYDA 2A3LA 2DO3A 2E10A 2PVDB 3MEAA 5GAMd 2MI6A 3UPUA 1Q81C 4IKFA 2LC4A 2LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  1WPY A;  1Y96 B;  3EFR A;  4JRI A;  4XTY A;  3V8L A;  3EFS A;  4PNO A;  4XQ3 A;  4XU1 A;  3V7C A;  1WQW A;  1I81 A;  2DZ9 A;  5GAO n;  5GAN 2;  3HFO A;  5GAN 8;  5GMK e;  4M78 B;  4C8Q C;  3VU3 C;  4EMH A;  5I21 A;  3V8K A;  5LJ5 j;  4DQ2 A;  3SB2 A;  5LJ3 e;  2EJG A;  1H64 1;  2HNI A;  4MMK A;  4EMK A;  4F7U G;  5GAM g;  2EAY A;  1LOJ A;  4M77 A;  4M7A A;  4J6W A;  3QHS A;  3JB9 H;  2FYK A;  3QUI A;  3BY7 A;  3JB9 D;  2DJZ A;  4M77 E;  4M7A E;  4J6X A;  5CAI A;  5GAN 6;  4F7U B;  4HA8 A;  1TH7 A;  2RA2 A;  3JB9 G;  3JCM V;  4C92 C;  3JCM d;  4QVD A;  4WF2 A;  3SWN A;  1KQ1 A;  4M77 D;  3JCM Q;  4M7A D;  4F7U F;  2E1H A;  3JCM X;  5LJ5 d;  4M7D A;  4EMK B;  1M5Q 1;  4JRK A;  5GAN j;  4X9C A;  4XTU A;  4M77 G;  4MML A;  5GAM h;  2I2L A;  3JCM J;  4M7A G;  4M7D E;  4M7D F;  4NL2 A;  4PJO C;  1D3B A;  5GAO p;  2DKG A;  3JCM g;  5GMK l;  5GAM f;  5GMK j;  3JCM b;  5DY9 A;  2E65 A;  3L2Z A;  3JB9 F;  2DEQ A;  1I4K 1;  2DZC A;  4M7D D;  5LJ3 j;  5LJ5 g;  4M77 B;  4M7A B;  4N0A A;  5GAN e;  4XTV A;  4M75 A;  3RIR A;  1X01 A;  3V7R A;  2DTH A;  4X9D A;  1HXD A;  4M7D G;  4M78 C;  3L1A A;  3RUX A;  4M75 E;  3JB9 J;  4M77 F;  4XTZ A;  5GMK m;  5GAN d;  4M7A F;  2QTX A;  4C92 D;  5GAN 5;  5GAO q;  4C8Q A;  2VXF A;  1I5L A;  3SWN B;  5GAN 3;  4XU0 A;  3JCM P;  4XTW A;  3HFN A;  2DVE A;  4C8Q E;  4M7D B;  4M75 D;  2K57 A;  1N9R A;  3AHU A;  3HSB A;  5GAM e;  1N9S A;  4V2S A;  4RCC A;  3JCM h;  1B34 A;  5LJ3 d;  2RM4 A;  3RER A;  4M75 G;  4A54 A;  5GAN g;  4PJO D;  2YHT A;  5LJ5 h;  3M4G A;  2DTO A;  4C8Q D;  1D3B B;  3BDU A;  3JCM f;  1U1S A;  2Y90 A;  3JB9 I;  4C92 A;  3V8J A;  5GMK i;  4HT8 A;  3V7S A;  4EMK C;  4C8Q G;  3BW1 A;  5LJ5 f;  4C92 E;  3RKX A;  4RCB A;  1JBM A;  2EJF A;  1LJO A;  4M75 B;  4C92 F;  5LJ3 g;  1YCY A;  2VXE A;  4PJO B;  2CGH A;  4PJO A;  3QO3 A;  1WNL A;  3FB9 A;  3FIF A;  4JUV A;  4M75 F;  3JCM c;  4C8Q B;  5GAN 4;  4M77 C;  4M7A C;  2RB6 A;  2DTI A;  3GIB A;  4PJO E;  1Y96 A;  1WQ7 A;  2DXU A;  4PJO F;  4C92 G;  3JCM e;  5GAN h;  1JRI A;  4JLI A;  3FJP A;  4NL3 A;  4HT9 A;  4C8Q F;  1U1T A;  4XU3 A;  4EMG A;  4XTX A;  4A53 A;  2E64 A;  1B34 B;  4XU2 A;  5LJ5 e;  4M78 A;  5GAM j;  5GAN f;  5GAO r;  1BIA A;  3QSU A;  5GMK h;  3SWN C;  4OP0 A;  2JN0 A;  4M78 E;  2YLB A;  3PGG A;  4C92 B;  5GAO l;  2ZGW A;  1HK9 A;  4M78 F;  5LJ3 h;  4PJO G;  5GAN 7;  4M7D C;  2EWN A;  3JCM W;  1M8V A;  4Y91 A;  3BFM A;  4NOY A;  1KQ2 A;  3INZ A;  2DXT A;  5LJ3 f;  3RKY A;  4J5Y A;  4M78 D;  4F7U A;  2YLC A;  1LNX A;  3RKW A;  1I8F A;  5GAO m;  4QVC A;  2RD1 A;  4J6Y A;  2E10 A;  4M78 G;  2EJ9 A;  3RES A;  2E41 A;  4F7U E;  1BIB A;  2VC8 A;  5GAM d;  2FB7 A;  1MGQ A;  4N0A C; 
#chains in the Genus database with same CATH topology
 3EFR A;  4JRI A;  4XQ3 A;  4X1V A;  1VQ7 Q;  3QYG B;  4FT4 A;  2C0O A;  2DK3 A;  2O01 E;  3SB2 A;  2HDA A;  5GAM g;  1LOJ A;  1K8A U;  2KBT A;  4BDY A;  1QVF S;  2KRM A;  1LCK A;  3EG0 A;  3JB9 D;  5FU7 C;  1VQK A;  1XQH A;  3EHR A;  4C5I A;  1W6X A;  3SWN A;  1AWX A;  2CSI A;  5A0D A;  2E70 A;  1KHC A;  3QZ9 B;  1MV3 A;  2DYI A;  1TSF A;  1AZG B;  2DEQ A;  1I4K 1;  2AKL A;  3EFO A;  5LJ5 g;  2R57 A;  1ZA2 B;  3PVL A;  1VQ6 Q;  1TXQ A;  3A98 A;  2RHI A;  3GNF B;  3DB4 A;  2DE0 X;  2LZ6 B;  3RUX A;  2JUF A;  2W10 A;  5KYW B;  1U3O A;  4Z88 A;  5FLX E;  4AMC A;  5CK9 A;  1PM3 A;  1N9R A;  3HSB A;  2DIG A;  2AHJ B;  2CH4 A;  2I0N A;  3CEY A;  2CUB A;  3LWI A;  3PTA A;  1UJY A;  2C06 A;  2ZPG B;  4J9F A;  1TTH B;  1VQ5 A;  4LE9 A;  4E7I A;  1FMK A;  2C0I A;  1M1K R;  2CP5 A;  5A0G A;  2KAF A;  2L89 A;  1M90 C;  2W0Z A;  1ABQ A;  4XAX B;  1S72 A;  2O9V A;  3VV0 A;  4PL6 A;  1PKT A;  2E64 A;  5IXF A;  5A2Q E;  2COW A;  2F2V A;  4PJO G;  1ARK A;  2RJC A;  1JQQ A;  3BFM A;  1U8R A;  4A4G A;  2YRV A;  3LW5 E;  4ELY C;  1M3B A;  4F7U E;  3ZFJ A;  1IZ6 A;  4LDW A;  5GAN e;  2F2X A;  1ZSZ B;  1WDX A;  4FT2 A;  1Q82 C;  2RJD A;  4VUB A;  4LD6 A;  2RPN A;  3CCJ Q;  3RR6 A;  3CPW A;  4OGE A;  4J6W A;  1AWO A;  1UGS B;  1Y71 A;  4C92 C;  3JCM d;  4LUD A;  4M7A D;  2OAU A;  2HSP A;  3JCM X;  3VYH B;  1E6H A;  4Q5W A;  4XTU A;  4M77 G;  2EPD A;  4J9H A;  2FZG B;  2X3X D;  4KGZ B;  4OB1 B;  2KRO A;  2RQW A;  3UWN A;  1M90 U;  2KT1 A;  2D8H A;  2YT6 A;  4M75 A;  3CC7 T;  1X01 A;  2LCL A;  1X6O A;  2QTX A;  5CR2 A;  3OY9 A;  3HKS A;  2P0K A;  1WGS A;  4A4K A;  1YFN A;  2RO0 A;  3M0U A;  1V76 A;  2PQW A;  2V26 A;  1RL2 A;  1D0Z A;  3MKD A;  2YHT A;  1SPK A;  1GFC A;  4IUP A;  4QKU A;  3E2U A;  4C8Q G;  2M9U A;  1JBM A;  4C92 F;  2PTK A;  1YJ9 T;  2D8J A;  1Q82 U;  2MYS A;  3QO3 A;  3JCM c;  1RI0 A;  5D7U A;  2OTL A;  4M7A C;  2RB6 A;  1PD1 A;  1PNJ A;  3NFC A;  5KCH A;  4JJC A;  4A53 A;  3OYK A;  1B34 B;  3LWH A;  5GAN f;  5IHI A;  2IIM A;  3A8H B;  1OUL A;  2GTO A;  4Y91 A;  2JS0 A;  1WLP B;  2DXT A;  1KQS P;  2M0Y A;  2ZAE A;  4IUV A;  1VQP T;  1M1G A;  3LH5 A;  1K73 R;  2FVU A;  1Y96 B;  1VYU A;  2JTE A;  2FG0 A;  4IUQ A;  4MZM A;  3MP8 A;  1BCM A;  4R55 A;  3MO8 A;  2BUD A;  2XID A;  5I2M A;  1G3W A;  4J8O A;  1HYO A;  1M9S A;  4B9X A;  2JM8 A;  2RN8 A;  3C95 A;  2LCC A;  3CCV Q;  2LNV A;  4HA8 A;  3G4S A;  2OTJ A;  2K2V A;  1QKX A;  1KIK A;  3I55 T;  2DM1 A;  4X34 A;  3UDC A;  4C0G A;  4PJM A;  3JCM J;  2E3H A;  5EG2 A;  1PCX A;  2KRN A;  2RI3 A;  2ZPI B;  3FRN A;  5LJ3 j;  1M27 C;  4X9D A;  2JM9 A;  2DVJ A;  1QVP A;  4M75 E;  2XKO C;  4XTZ A;  1RLQ C;  2XK0 A;  1EIF A;  2KGT A;  1WZO A;  4PJJ A;  4Y28 E;  1QCF A;  2QTV A;  2FEI A;  3L2W A;  2LMJ A;  3DLM A;  2RM4 A;  5GAN g;  2QDY B;  1PSE A;  1YIT T;  2L3P A;  5KYU A;  1F1B B;  4DEY A;  2XDB A;  1M2O A;  1KHI A;  2DLP A;  3QG1 A;  3HRS A;  3HTR A;  4CI0 C;  1X27 A;  5GAN 4;  4JRQ A;  5I2S A;  5HK0 A;  3LGF A;  4JJD A;  2ROL A;  1JXM A;  2LQ8 A;  1AOJ A;  5EC7 A;  2KXC A;  1T3L A;  1BCO A;  1G2B A;  4F04 B;  4KUI A;  5GAN 7;  1YJ9 Q;  2ATC B;  1IO6 A;  1R77 A;  2RF0 A;  1VYT A;  1Q86 C;  1LNX A;  3TEE A;  4DOW A;  5GAO m;  3QDR B;  4J9B A;  4BY6 B;  1BIB A;  1MGQ A;  3E1S A;  4EMK A;  3T9N A;  5GAO n;  2GQI A;  2MCN A;  1OZ2 A;  1U5S A;  4RTU A;  2L5Q A;  2P4T A;  1H64 1;  1K9A A;  2CP6 A;  3RMS A;  4F17 A;  1XJW B;  2FYK A;  2FZC B;  3M0P A;  3CCU A;  4J6X A;  4C0F A;  4F7U B;  1B3Q A;  2RQR A;  1TH7 A;  2DNU A;  1GCP A;  1KQ1 A;  4AFQ C;  2DMO A;  3VKI A;  1WJR A;  1YJN T;  2E1H A;  3QWX X;  2AIR B;  4JRK A;  3FLG A;  5GAM h;  4DEX A;  3KUF A;  4R56 A;  1K0X A;  4J9C A;  4NL2 A;  4GLK A;  2CYZ B;  3OYN A;  2DAQ A;  3M0S A;  3X24 B;  4WTO B;  1UUE A;  1ZSZ C;  2GBQ A;  2K9G A;  2E5Q A;  1W2B P;  2VVK A;  4M77 F;  1SEM A;  1P92 A;  3BDL A;  3SWN B;  2DVE A;  3GOX A;  3AT1 B;  4WCI A;  1NPP A;  2DXC A;  3FEO A;  4JS5 A;  3M0T A;  1Q86 U;  5LJ5 h;  2GGR A;  1KG1 A;  3G71 Q;  1MHN A;  3V7S A;  2ROT A;  3EFO B;  3BW1 A;  3IQL A;  3CME Q;  1XNI A;  2EJF A;  1Y7X A;  3LH0 A;  3L42 A;  1YCY A;  2VXE A;  3HRT A;  5M9O A;  1BBZ A;  3PNW C;  2DTI A;  2DD4 A;  2Y4X A;  3FJP A;  3CC2 T;  4C8Q F;  1C1A A;  4XTX A;  1YJW A;  1ZQ1 A;  2XDD A;  1YIT Q;  3M53 A;  1WIE A;  1TUD A;  1N8R C;  2YUQ A;  2JN0 A;  3CC4 A;  3CPF A;  2NUT A;  2P4R A;  2EVR A;  3DKM A;  2MAM A;  5GJV B;  2AZV A;  3CQT A;  5HKC A;  2A3L A;  1NYF A;  2JXB A;  2MI6 A;  1Q81 C;  4MDX A;  3I56 T;  1QVF A;  2EQJ A;  1VQM T;  1BI2 A;  3CCR A;  4FSS A;  5CKH A;  4ELZ C;  4QQG A;  1VQ7 T;  4F14 A;  2E4H A;  3Q1J A;  2HQE A;  2D1X A;  2EQM A;  3NPF A;  3HPW A;  2OX7 A;  2CP3 A;  4PLL A;  3LGL A;  2RA2 A;  3JB9 G;  2AKK A;  4FYW B;  2DF6 A;  1VA7 A;  3QII A;  2XHC A;  3PIP A;  3J80 E;  4M7D A;  3VS0 A;  4X9C A;  4C0D B;  1VQ9 A;  2V8K A;  2YUO A;  1D0Y A;  1QMC A;  1RAA B;  2NYS A;  3A8O B;  2JS2 A;  5GMK j;  2BZY A;  2BE9 B;  2EKO A;  5FRO A;  2NLU A;  4QQD A;  3D7S B;  2L8D A;  4R0K A;  4LD9 K;  1VQ6 T;  4IUT A;  2QA4 T;  1N8R U;  2IPO B;  4OB0 B;  1NLP C;  2KI7 A;  2RMO A;  4UC4 A;  2DYB A;  3OSS C;  3AHU A;  1E6G A;  1YWO A;  4RUG A;  2CH4 W;  4A4H A;  4DBF A;  4AG2 C;  2BKD N;  2H3J A;  2JNG A;  1Q81 U;  5D6Y A;  1VYV A;  4M75 B;  5L8R E;  2QYZ A;  1UEB A;  2YWW A;  5IHN A;  1M8M A;  4JZ3 A;  1T0H A;  4LDU A;  4C0Z A;  3E19 A;  1N6A A;  5FRM A;  5KE3 A;  1Y0M A;  4B9W A;  1WHJ A;  2O4X A;  4JLG A;  4C92 G;  4NL3 A;  3OYI A;  4C5G A;  2M0O A;  2KSS A;  5DLQ E;  2YLB A;  5CQY A;  2O88 A;  3NTH A;  2P0P A;  2EKH A;  3TSZ A;  1M3A A;  4KRT A;  3EAE A;  1BK2 A;  5CKD A;  1M1K C;  2EJ9 A;  3EG3 A;  5GJW B;  1VQ5 Q;  4N0A C;  2PUO B;  7AT1 B;  3GF5 A;  4XTY A;  1QVG P;  3EFS A;  4ZN1 A;  2EBP A;  5CKE A;  1AVZ C;  3OMC A;  4EMH A;  4DQ2 A;  5LJ3 e;  1S72 Q;  2B86 A;  3EGU A;  3QYH B;  2DL5 A;  3CCL A;  2EYZ A;  3REB B;  1ZUK A;  2FPE A;  3RNJ A;  4CC7 A;  2HKN A;  2HD0 A;  3G6E A;  4IUR A;  3CD6 A;  4JJB A;  3UAT A;  3OW2 P;  4M7A G;  4M7D E;  3MEW A;  3OYL A;  3RBB B;  1VQO A;  4BY6 C;  4RG8 A;  3JCM b;  1YNZ A;  3PMT A;  1OOT A;  1MV0 B;  1OU9 A;  4IIO A;  4KH0 B;  3P8D A;  5I11 A;  5CCA A;  2JW4 A;  4BD3 A;  1H3Z A;  3EG2 A;  3FJ5 A;  2KY9 A;  3TU4 K;  4J9E A;  3H8Z A;  4KUD K;  2V1R A;  4J7I A;  2R5M A;  4OML A;  1EZZ B;  4FYV B;  4MZT A;  1JJ2 P;  1M1K U;  3V8J A;  4PKC C;  3L2V A;  1UGQ B;  2EW3 A;  2QA4 Q;  4L5G A;  2KMT A;  4AT1 B;  3OYH A;  4PJO B;  3OYE A;  1XTD A;  2J6K A;  1C0M A;  5GAN h;  1U1T A;  1GXI E;  4N4H A;  4EMG A;  1IGQ A;  4D8D A;  3O8V A;  3QZ5 B;  4M78 A;  1SHG A;  2ABL A;  4QVZ A;  3SWN C;  1AD5 A;  1TUG B;  3MEV A;  2ZGW A;  1HK9 A;  3PE0 A;  3PVQ A;  2EWN A;  4PLI A;  5KYU B;  3INZ A;  5LJ3 f;  1YHQ T;  2HMA A;  2RHZ A;  2IG0 A;  2KE9 A;  1TS9 A;  2AZS A;  1Z9Z A;  2EQK A;  3CCM A;  4KUL A;  3HRU A;  1HJD A;  2DZ9 A;  4BI3 A;  1TOV A;  3CCE A;  1D1B A;  5L23 A;  2OTL Q;  2P84 A;  3QBY A;  3CC2 A;  2KYB A;  3VS2 A;  1VUB A;  1YIJ T;  3C0C A;  2DIQ A;  5AYF A;  2DJZ A;  4ZGE B;  4E2F B;  2OI3 A;  2EFI A;  4O5V A;  3TRE A;  1GFD A;  4C5H A;  1VQ8 A;  3MEU A;  1Q7Y R;  2QQ9 A;  4E6R A;  3CCV T;  1K73 C;  4EMK B;  1OYX A;  2KVQ G;  5GAO p;  4RMO A;  1I5O B;  1AEY A;  2XMF A;  1BYM A;  1D1A A;  1WFW A;  3JB9 F;  1RAB B;  4XTV A;  1CKA A;  3R6N A;  3CXC P;  3CMA A;  2YUN A;  4QQ6 A;  3MPU B;  3CCQ A;  5KYN A;  2QEX A;  1LPL A;  4XTW A;  3NHN A;  5IXB A;  4M75 D;  1KFZ A;  3EHQ A;  5CVI A;  3OYY A;  3G4S Q;  3MP6 A;  2CZ6 B;  2ED1 A;  1FYN A;  2JTF A;  1NJI R;  1WHG A;  2VKN A;  1X43 A;  4C0D C;  1AT1 B;  1OZ3 A;  1SKU B;  3NTK A;  4HVV A;  5LJ3 g;  4DBH A;  1OU8 A;  2CZ1 B;  5IHK A;  1X2K A;  3S3N A;  4JUV A;  1OEB A;  2FL7 A;  2L2P A;  2QDL A;  2DXU A;  1C6V X;  1KK7 A;  1YI2 A;  2VUB A;  2VGM A;  3TSW A;  2EGA A;  1Y57 A;  3MP1 A;  2GFA A;  4M78 E;  1E7O A;  1KJW A;  3H41 A;  1G8X A;  2CT4 A;  1K73 U;  2VGN A;  2BE7 D;  8AT1 B;  2HBP A;  2E41 A;  1FMW A;  1WA7 A;  4M75 C;  2EIF A;  2D0N A;  1D0X A;  3HFO A;  5GMK e;  1GCQ A;  1WXU A;  2WAC A;  1QW1 A;  1TWB A;  1YHQ Q;  1JXO A;  2X9H A;  3JB9 H;  3QUI A;  2NUT B;  1VQ4 T;  5GAN 6;  1QCN A;  2QI2 A;  4RKU E;  1X6B A;  4AFS C;  1N27 A;  3G7Z A;  2WSE E;  4HVU A;  1MMG A;  2D6F A;  1MUZ A;  5ECA A;  1BI3 A;  1YIJ Q;  1LVK A;  2HAX A;  2E65 A;  1Z9Q A;  2F5T X;  5HY6 A;  3L1A A;  2LP5 A;  2PNI A;  3VS5 A;  4M7A F;  1KQS S;  5GAO q;  3FC3 A;  3ASK A;  2ESW A;  3OYB A;  5GAN 3;  4ZNX A;  1BI1 A;  4M7D B;  3CCJ A;  3CCU Q;  4OMN A;  2CUD A;  4DOV A;  3GPL A;  3RER A;  4PJO D;  1AHJ B;  2DL3 A;  3JB9 I;  4RTW A;  4Z02 A;  2LQK A;  2QXF A;  1OV3 A;  1MND A;  3M58 A;  3G71 T;  4OMF B;  2WSC E;  3CME T;  3DLL A;  4PJO A;  2PU9 B;  1UHC A;  3LLR A;  3CPW P;  3JCM e;  1IHV A;  4HCC A;  1PSF A;  4JPB W;  5C6S A;  1WYX A;  4E7S A;  4II1 A;  3G1J A;  5GAO l;  3PGG A;  2FZK B;  4OGC A;  2RQU A;  3JCM W;  4BE2 A;  1TUC A;  1VQN T;  1W1F A;  5AT1 B;  5FWB A;  1G3S A;  2DRK A;  5J39 A;  2DBK A;  5GAM d;  2A0F B;  1JEG A;  2LC4 A;  2LRQ A;  2YRC A;  1M2V B;  1FMV A;  2O4X B;  4PNO A;  3QWY A;  1VQL T;  3M0Q A;  5I21 A;  3UA6 A;  2EAY A;  1NE8 A;  4M77 A;  4A63 B;  2DRM A;  1I0C A;  1KD1 R;  2NWM A;  4PFZ A;  2QG9 B;  3NTI A;  2K3Y A;  2DX1 A;  1ZBJ A;  3CC4 Q;  1QCO A;  2HSE B;  3JCM Q;  3CCS T;  5LJ5 d;  1SHF A;  3BE3 A;  1RAG B;  2EGE A;  4MML A;  2I2L A;  3OBW A;  3I35 A;  4KGV B;  1PC0 A;  1K9M R;  3HP9 A;  2K6D A;  1O9S A;  1VQ4 Q;  1T0J A;  4J9D A;  1UFF A;  1YP5 A;  3WVD B;  1RI9 A;  1MMN A;  1OX9 A;  3M5A A;  4LDY A;  1OQK A;  4C8Q A;  1IRE B;  2LJ3 A;  5LL6 S;  3HFN A;  1R0C B;  2E12 A;  3E9G A;  6AT1 B;  2HZY A;  3X28 B;  5CKF A;  3OA6 A;  4FYX B;  1NPR A;  4RTV A;  5HK3 A;  1VQK T;  3JCM f;  1NZ9 A;  5IH2 A;  3JAM E;  4EMK C;  3CBO A;  3WVE B;  5D6W A;  1VQ9 Q;  2ZPE B;  2CGH A;  4ORZ A;  3O5Z A;  4LDV A;  2L3Q A;  5KE2 A;  4IUU A;  2XG8 D;  2RQT A;  4PJO E;  4DBQ A;  1JRI A;  4LN2 A;  3M9Q A;  2QAS A;  4E7H A;  3DB3 A;  3OBY A;  1ZHI A;  2LDM A;  4D6W A;  2EYW A;  3RKY A;  4JZ4 A;  1W2B S;  1I8F A;  2RHX A;  2X4Y A;  2E5K A;  3CC7 A;  2MPX C;  3P8H A;  3V8L A;  1VQ5 T;  3REA B;  5GAN 8;  5KYY A;  4M78 B;  3VU3 C;  4HKE A;  1UTI A;  2EJG A;  4F7U G;  2DFU A;  1VQN Q;  4EIK A;  3J7A F;  3OS2 A;  1RLP C;  2CZ7 B;  2JTM A;  4M77 E;  1S72 T;  1WHH A;  2LTO A;  1XOV A;  2L0A A;  1BU1 A;  1UJ0 A;  1J3T A;  2CP7 A;  4XK8 E;  3L2U A;  1VQL Q;  2YDL A;  1YJ9 A;  2NUP A;  4GLM A;  1D3B A;  2JT4 A;  3H0F A;  3JCM g;  2OJ2 A;  4P5N A;  5DY9 A;  3L2Z A;  4M7D D;  2K7A A;  3M4Y A;  3JB9 J;  3I9Q A;  2LX9 A;  3CCS Q;  2X51 A;  2BZ8 A;  1I5L A;  2QGF B;  2X4J A;  3CCL Q;  1M30 A;  3SFM A;  4J9I A;  4C8Q E;  2AK5 A;  2L3R A;  2ZCF B;  1UG1 A;  3R6O A;  1VQP A;  1ZSG A;  1GBR A;  1M4Z A;  2PVG B;  4RTT A;  1MMA A;  2Y90 A;  2V8I A;  2DXB A;  3CD6 Q;  1OI1 A;  3S3O A;  2CKK A;  1M1F A;  4ANJ A;  4B6M A;  1VQO Q;  4A4F A;  2XIC A;  1I07 A;  1HD3 A;  4HT9 A;  1VQK Q;  1PHT A;  3I55 A;  3EG9 A;  3TCJ A;  2DJQ A;  4LUE A;  1WHM A;  4F16 A;  2DER A;  5LJ3 h;  4M7D C;  1MNE A;  2F2W A;  2Y4Y A;  4Z89 A;  4JJN K;  4J5Y A;  3LX7 A;  1ABO A;  1UGP B;  2VC8 A;  3CBP A;  1FWZ A;  4E47 A;  1M2V A;  1KC8 R;  3M57 A;  4Z8A A;  5GAN 2;  5A0L A;  1RAE B;  2K3X A;  2CP0 A;  3VRZ A;  2EYY A;  1VIE A;  2OTL T;  4RG2 A;  4ATO A;  3BY7 A;  2EYX A;  2K4Y A;  2CS7 A;  4ZN3 A;  1YIT A;  3JCM V;  2CZ0 B;  3TVT A;  2R58 A;  3A5Z B;  2MF2 A;  2VYT A;  4KH1 B;  1JB0 E;  1AWW A;  2ZPB B;  3OS1 A;  1N8R R;  4M7D F;  1SSH A;  4ME7 A;  3H0I A;  3CCM Q;  5DM7 R;  1EX4 A;  2F69 A;  2E6Z A;  3CBM A;  1HXD A;  1WXB A;  1IB8 A;  4N4I A;  5GAN d;  5GMK m;  1GRI A;  1G3Y A;  3JCM P;  5D6X A;  1Q7Y C;  3VS3 A;  1B7T A;  3VUB A;  2AT1 B;  2SRC A;  1QVG S;  2PVO B;  2RNA A;  1M3C A;  4M75 G;  4A54 A;  1VQ8 Q;  3BDU A;  1TG0 A;  2RHU A;  2FPD A;  3G4S T;  2OTJ T;  1QVF P;  4C5E A;  4RCB A;  4E7Z A;  1LJO A;  3SDZ A;  2O9S A;  1WNL A;  2DD5 A;  3FB9 A;  4LDX A;  1BI0 A;  4AG1 C;  4DA4 A;  3L2R A;  3CMA Q;  4JLI A;  2J6O A;  2K5I A;  2RI5 A;  3H0H A;  3OW2 S;  3CCQ Q;  4QT7 A;  2QEX Q;  4QW2 A;  1YJN A;  1ZBX A;  2K5L A;  1KSW A;  2D9T A;  1DJ7 B;  4BAC A;  1NJI C;  2M16 A;  3KFV A;  4FL6 A;  3C12 A;  4M78 D;  4FW1 A;  1RAC B;  1MMD A;  1NM7 A;  4XU3 A;  2A08 A;  1I81 A;  2C0T A;  2MWP A;  2LNH B;  2PZ1 A;  2ECZ A;  4FM4 B;  1SF9 A;  2XD0 A;  4MMK A;  1AZE A;  1JJ2 S;  1YI2 Q;  4MDW A;  1Q7Y U;  3P8B B;  2YRD A;  1K8A R;  3EGD B;  3QDF A;  4F7U F;  3VUZ A;  2H8H A;  4YTL A;  4IIM A;  3VJP A;  1KQS A;  1VIF A;  4L6V 5;  2CSQ A;  1WHL A;  1Y07 A;  2E3I A;  1V1C A;  4KT0 E;  4M77 B;  3ZBD A;  2KXD A;  2J7I A;  4FIB A;  3OYC A;  4M78 C;  2A37 A;  1BKB A;  4C92 D;  1ZX6 A;  2VXF A;  2LQN A;  4XU0 A;  1QWE A;  2CP2 A;  4CC2 A;  2EQU A;  1PKS A;  2BIV A;  2QQS A;  1NJI U;  2KQW A;  1RAH B;  3OS0 A;  3CCU T;  4J7F A;  4C92 A;  2B8A A;  4OMP A;  3I56 A;  4HT8 A;  1VQM A;  3QXE B;  3M54 A;  3RKX A;  1Q95 G;  1NEG A;  2DBM A;  1GL5 A;  3ULR B;  1VQ7 A;  1T3S A;  3PFS A;  1OPL A;  3FIF A;  4C8Q B;  4AFU C;  2LT4 A;  2HEQ A;  1O75 A;  5KCO A;  2BZX A;  2HL5 C;  2JOY A;  2GNC A;  2X35 A;  1WI7 A;  5GAM j;  4PK4 A;  2HQX A;  2VWF A;  1YBY A;  2OTJ Q;  5GMK h;  4OP0 A;  2OAW A;  3C4S A;  4M78 F;  2LJ1 A;  4RTY A;  1G83 A;  3J81 E;  2COY A;  3EH1 A;  2YLC A;  3CXC S;  3NMZ C;  2DO3 A;  2E10 A;  2PVD B;  4IKF A;  3UPU A;  2QGG A;  2A36 A;  2FB7 A;  1WPY A;  2DPP B;  1FX7 A;  2O31 A;  3V7C A;  1UE9 A;  1VQ6 A;  2QA4 A;  3VRY A;  5FRN A;  4O6J A;  2P0Q A;  5LJ5 j;  2ENM A;  4BB7 A;  2YXY A;  2MMP A;  4M7A A;  2K2M A;  1QLY A;  2EYQ A;  3EGX A;  3H9N A;  1HSQ A;  1RUW A;  2LJ0 A;  1YJW T;  3X26 B;  5CQX A;  5IAY A;  1RAF B;  4M4Z A;  3E9F A;  3CC4 T;  4JRP A;  4N4G A;  4OMQ A;  5KYY B;  1NEB A;  2DKG A;  3PMI A;  2JVV A;  2ZZD A;  2EQI A;  1K4U S;  1OPK A;  2CRE A;  3RIR A;  4LXC A;  1KD1 C;  5GAN 5;  3CCR T;  1M90 R;  1AWJ A;  2J05 A;  2K57 A;  2QK0 A;  2QQA A;  1N9S A;  3JCM h;  3OSV A;  4LNP A;  2NUP B;  1PWT A;  2XI9 A;  3M4G A;  1K1Z A;  1D3B B;  1U1S A;  2QQB A;  2V1Q A;  2SEM A;  3NGP A;  1K9M C;  4C92 E;  1SRL A;  3OB9 A;  1IHW A;  1GCQ C;  2M51 A;  4BI8 B;  4M75 F;  3ZL7 C;  2PUK B;  1VQ9 T;  2V8J A;  3GLX A;  5CKB A;  4PFP A;  1ZLM A;  4J83 A;  2XU8 A;  3URG A;  1Q82 R;  3GP8 A;  1WXT A;  2JMA A;  5CIU A;  4XU2 A;  1W2B A;  4RTX A;  1TU0 B;  1SRM A;  2LCS A;  5KYX B;  3MCA B;  1X2Q A;  2A7Y A;  3MJX A;  2R5A A;  1H8K A;  1PRM C;  4NOY A;  1H3H A;  3PIO A;  2COZ A;  3UF4 A;  1YN8 A;  2HL3 A;  1FXX A;  2X3W D;  4QVC A;  3A1P A;  5FWC A;  3ME9 A;  3SHW A;  1WQW A;  2LT1 A;  2XDP A;  1KD1 U;  3EG9 B;  1QP2 A;  3VS7 A;  1UEC A;  5J26 A;  1S1N A;  4L59 A;  4M7A E;  1H92 A;  2E6N A;  5KYW A;  3I5R A;  2RHY A;  1B07 A;  4WF2 A;  2J06 A;  3EGD A;  4M77 D;  4E7L A;  2GTJ A;  4J9G A;  2YSQ A;  3CPW S;  1K9M U;  2HBW A;  2ZPH B;  1WJQ A;  3M0R A;  4PJO C;  3S3M A;  5FU6 B;  3CC7 Q;  1UDL A;  1IXD A;  1SSF A;  1WHK A;  9ATC B;  3VYG A;  3QPH A;  2H3E B;  3KXT A;  3VS1 A;  4HXJ A;  1IGU A;  1YJW Q;  4M7D G;  3U23 A;  4JDS A;  2DIL A;  3OYA A;  2K79 A;  1PG5 B;  2L3S A;  4RTZ A;  3EH2 A;  1YHQ A;  4KGX B;  3N5B B;  2WSF E;  3CCL T;  2FHD A;  4EPC A;  4C8Q D;  3OMG A;  5GMK i;  3FDR A;  4ZGD B;  1UGV A;  3G6E T;  1NLO C;  2VAS A;  3CCR Q;  3QJY A;  3CD6 T;  1R0B G;  1G3T A;  1YIJ A;  2KK4 A;  4BDZ A;  1VQO T;  4M77 C;  2FPF A;  4ZGJ B;  2MIO A;  1WJS A;  4PJO F;  2FO0 A;  3OYF A;  4HCK A;  1ZSZ A;  4D8K A;  3M55 A;  4BE1 A;  5FU7 B;  1K76 A;  3QSU A;  2J6F A;  3CCV A;  2HQH A;  2M1H A;  1YCS B;  1NG2 A;  2RK2 A;  3PT9 A;  1VQP Q;  2GCX A;  5DLO A;  1IRX A;  2YUP A;  3RKW A;  2NUZ A;  2K5F A;  2RQV A;  1NBE B;  1NYG A;  3I5S A;  2RD1 A;  2FRY A;  3QKJ A;  4J6Y A;  3RES A;  2F1L A;  4PJN A;  5I22 A;  3M56 A;  4OMM A;  1JO8 A;  4BI4 A;  1CKB A;  1UB4 A;  4C8Q C;  5C0M A;  3QHS A;  1I1J A;  2ED0 A;  4FYY B;  3I55 Q;  2QAZ A;  2D0Q B;  3A8M B;  1UGR B;  5CAI A;  2GQV A;  1K0S A;  4QVD A;  3JV3 A;  4ZTJ A;  4FW2 A;  4AFZ C;  1X6G A;  2LQW A;  5GAN j;  1A0N B;  1KC8 C;  2A28 A;  4GY5 A;  1D1C A;  1X75 C;  3MET A;  4A4E A;  3SEM A;  3CCM T;  2DTH A;  1VOM A;  1QVG A;  2LX7 A;  2KDS A;  1N5Z A;  3WXM B;  2KEA A;  3X20 B;  1QWF A;  3CCE T;  4BUG A;  2KYM A;  4ESR A;  3L2Q A;  5GAM e;  4V2S A;  2HCK A;  2K3B A;  1B34 A;  5LJ3 d;  1SG5 A;  4BE0 A;  5FW9 A;  2KRS A;  3OS5 A;  4HCB A;  3ER0 A;  1VQ8 T;  4CRI A;  2RJF A;  4DBR A;  4E7K A;  3RMQ A;  2CDT A;  4CC4 B;  5IT9 E;  1Q86 R;  3HL8 A;  1G5V A;  3OW2 A;  4JS4 A;  5HCK A;  4FSX A;  3LYI A;  3VS4 A;  1Y96 A;  2MOX A;  2DA9 A;  1VQ4 A;  2MK5 A;  1BB9 A;  5KH6 A;  1RAD B;  1EFN A;  5J3B A;  5LJ5 e;  3CMA T;  2G3R A;  2JJ9 A;  3G6E Q;  5KYX A;  4C92 B;  3CCQ T;  1M8V A;  3ZEH A;  2QEX T;  2JZ2 A;  3GBQ A;  3M59 A;  1KQ2 A;  4NS5 A;  1KC8 U;  3UA7 A;  1U06 A;  1PRL C;  1PD0 A;  4HVW A;  2RJE A;  2KNB B;  3GNG A;  2M02 A;  2KT8 A;  4M78 G;  3SD4 A;  4E7J A;  3A8L B;  1JJ2 A;  1ZUY A;  2G6F X;  1YWP A;  4XU1 A;  3C94 A;  2X4X A;  2CT3 A;  2DL7 A;  3TQ7 P;  1ZUU A;  2IVW A;  3KBG A;  3V8K A;  4Y92 A;  4OMO A;  2HNI A;  2HKQ B;  2ZPF B;  5CO7 A;  3OYG A;  2DL8 A;  2DL4 A;  2QQR A;  1YJN Q;  1YI2 T;  4PFO A;  2DEU A;  3X25 B;  2DET A;  1QP3 A;  3G71 A;  4OVA A;  4EDU A;  1M5Q 1;  3CME A;  3OYJ A;  1D09 B;  2MWO A;  3EG1 A;  1WX6 A;  5GMK l;  1X69 A;  5GAM f;  1ACM B;  3THK A;  2DZC A;  4FU6 A;  4M7A B;  4N0A A;  4FCY A;  3V7R A;  3EGX B;  1W4S A;  3HHT B;  3S6W A;  4OF1 A;  3H6Z A;  4KBM B;  2GF7 A;  1K8A C;  1VQN A;  5IN1 A;  4RCC A;  3VS6 A;  8ATC B;  4ZTF A;  3F70 A;  4GBQ A;  2RI2 A;  2DTO A;  4HCZ A;  2RK1 A;  1JU5 C;  1CSK A;  5LJ5 f;  1OX8 A;  4OB2 B;  3OQ5 A;  1VQL A;  3JSC A;  1RAI B;  3CCE Q;  3OYM A;  4OB3 B;  5FU6 C;  2KR3 A;  2EGC A;  2JMC A;  3CC2 Q;  1ZA1 B;  2VB6 A;  1Q81 R;  1GBQ A;  2X4W A;  4MZP A;  3GIB A;  3A8G B;  1WQ7 A;  3UT1 A;  2LVM A;  1QQJ A;  4CC3 A;  2VV5 A;  1UHF A;  5GAO r;  2GFU A;  3CXC A;  1BIA A;  3QJ6 A;  2RH2 A;  2F5K A;  3JRZ A;  3CCS A;  1W70 A;  1R8O B;  2Z0W A;  3MHX A;  1V29 B;  2FRW A;  3CCJ T;  4F7U A;  4K11 A;  4TVR A;  3RDV A;  3I56 Q;  1VQM Q;  3OYD A;  3MEA A;  1QKW A;  2O2O A;  4PJL A;  2BTT A; 
#chains in the Genus database with same CATH homology
 4MDX A;  1WPY A;  2DPP B;  3EFR A;  4JRI A;  1FX7 A;  2O4X B;  4PNO A;  3I56 T;  2EQJ A;  4XQ3 A;  3V7C A;  1VQM T;  3QYG B;  1QVF A;  1BI2 A;  3CCR A;  4FT4 A;  2DK3 A;  1VQ6 A;  2QA4 A;  1VQL T;  5CKH A;  5FRN A;  2O01 E;  4ELZ C;  4O6J A;  5I21 A;  2P0Q A;  4QQG A;  5LJ5 j;  3SB2 A;  5GAM g;  1VQ7 T;  3Q1J A;  2EAY A;  2HQE A;  4BB7 A;  1LOJ A;  1NE8 A;  4M77 A;  2MMP A;  1K8A U;  4M7A A;  4BDY A;  1QVF S;  2EYQ A;  3JB9 D;  2EQM A;  5FU7 C;  3NTI A;  1VQK A;  2K3Y A;  3HPW A;  1XQH A;  4PLL A;  4C5I A;  3LGL A;  2RA2 A;  3JB9 G;  1YJW T;  3X26 B;  5CQX A;  3SWN A;  5IAY A;  3QII A;  3JCM Q;  2XHC A;  3PIP A;  3CCS T;  3J80 E;  4M7D A;  5LJ5 d;  3E9F A;  5A0D A;  4X9C A;  3CC4 T;  4MML A;  4C0D B;  2I2L A;  4N4G A;  4JRP A;  1VQ9 A;  2E70 A;  2V8K A;  3OBW A;  1KHC A;  3A8O B;  3QZ9 B;  2DKG A;  5GMK j;  3HP9 A;  2DEQ A;  3PMI A;  1I4K 1;  2JVV A;  1O9S A;  2ZZD A;  5LJ5 g;  2EKO A;  2R57 A;  3RIR A;  5FRO A;  2NLU A;  3WVD B;  2RHI A;  3GNF B;  3DB4 A;  4QQD A;  1KD1 C;  3RUX A;  2L8D A;  2JUF A;  3M5A A;  4LDY A;  5GAN 5;  3CCR T;  4LD9 K;  4C8Q A;  1VQ6 T;  4IUT A;  2QA4 T;  1IRE B;  1N8R U;  4OB0 B;  5LL6 S;  5FLX E;  3HFN A;  2E12 A;  3E9G A;  5CK9 A;  4UC4 A;  2K57 A;  1N9R A;  3OSS C;  3AHU A;  3HSB A;  2QQA A;  1N9S A;  3JCM h;  3OSV A;  5CKF A;  3X28 B;  3OA6 A;  2DIG A;  1NPR A;  2AHJ B;  2XI9 A;  5HK3 A;  3CEY A;  3M4G A;  4A4H A;  1D3B B;  3JCM f;  3LWI A;  3PTA A;  1U1S A;  2QQB A;  1VQK T;  1NZ9 A;  2C06 A;  3JAM E;  2BKD N;  2H3J A;  2JNG A;  2ZPG B;  4EMK C;  1Q81 U;  5D6Y A;  1K9M C;  3CBO A;  4C92 E;  3WVE B;  4E7I A;  1VQ5 A;  4M75 B;  5D6W A;  3OB9 A;  5L8R E;  1UEB A;  2ZPE B;  4BI8 B;  2CGH A;  5A0G A;  2KAF A;  2L89 A;  4LDU A;  4M75 F;  4LDV A;  2PUK B;  4C0Z A;  1VQ9 T;  3E19 A;  5KE2 A;  4IUU A;  2XG8 D;  2V8J A;  1N6A A;  3GLX A;  5CKB A;  1M90 C;  5FRM A;  5KE3 A;  4PJO E;  4XAX B;  4J83 A;  1S72 A;  4B9W A;  2XU8 A;  2O4X A;  4JLG A;  3VV0 A;  3URG A;  1JRI A;  4C92 G;  4C5G A;  4NL3 A;  3OYI A;  3GP8 A;  4PL6 A;  3M9Q A;  5CIU A;  2E64 A;  4XU2 A;  2M0O A;  4E7H A;  1W2B A;  5A2Q E;  2KSS A;  3DB3 A;  5DLQ E;  2YLB A;  3MCA B;  5CQY A;  2A7Y A;  3OBY A;  1ZHI A;  3NTH A;  4PJO G;  2P0P A;  2LDM A;  2R5A A;  2RJC A;  3BFM A;  4D6W A;  1U8R A;  4NOY A;  3EAE A;  3RKY A;  4A4G A;  3PIO A;  2YRV A;  3LW5 E;  4ELY C;  1W2B S;  1FXX A;  1I8F A;  5CKD A;  1M1K C;  4QVC A;  2RHX A;  2X4Y A;  4F7U E;  2EJ9 A;  1IZ6 A;  3ZFJ A;  4LDW A;  3CC7 A;  5GAN e;  3ME9 A;  4N0A C;  2PUO B;  3P8H A;  3V8L A;  3GF5 A;  4XTY A;  3EFS A;  4ZN1 A;  1WQW A;  2LT1 A;  4FT2 A;  2XDP A;  2RJD A;  5CKE A;  4VUB A;  5GAN 8;  1Q82 C;  4LD6 A;  4M78 B;  1KD1 U;  3OMC A;  3VU3 C;  4HKE A;  4EMH A;  1QP2 A;  4DQ2 A;  5LJ3 e;  2EJG A;  4F7U G;  5J26 A;  3J7A F;  3QYH B;  3CPW A;  3OS2 A;  3CCL A;  4OGE A;  4J6W A;  2CZ7 B;  2JTM A;  4L59 A;  4M77 E;  1S72 T;  4M7A E;  2E6N A;  1UGS B;  2LTO A;  1XOV A;  1Y71 A;  2RHY A;  4C92 C;  3JCM d;  4WF2 A;  2HD0 A;  3G6E A;  4M77 D;  4M7A D;  2OAU A;  3JCM X;  4E7L A;  4IUR A;  4XK8 E;  3L2U A;  3CPW S;  3CD6 A;  1K9M U;  1YJ9 A;  2ZPH B;  3VYH B;  4Q5W A;  4XTU A;  4M77 G;  1WJQ A;  4M7A G;  4M7D E;  3MEW A;  3OYL A;  2FB7 A;  4PJO C;  3S3M A;  1VQO A;  1D3B A;  4OB1 B;  5FU6 B;  3JCM g;  4BY6 C;  1SSF A;  4RG8 A;  4P5N A;  3JCM b;  3UWN A;  5DY9 A;  3L2Z A;  3VYG A;  3QPH A;  3KXT A;  1M90 U;  4M7D D;  4M75 A;  3CC7 T;  1X01 A;  3PMT A;  4M7D G;  2LCL A;  3M4Y A;  3P8D A;  1X6O A;  3JB9 J;  4JDS A;  5CCA A;  3OYA A;  2LX9 A;  2QTX A;  5CR2 A;  4BD3 A;  3OY9 A;  1H3Z A;  1I5L A;  2X4J A;  3HKS A;  3SFM A;  2P0K A;  4C8Q E;  2KY9 A;  1YHQ A;  1WGS A;  2L3R A;  4A4K A;  2ZCF B;  3TU4 K;  2RO0 A;  3H8Z A;  3N5B B;  2WSF E;  4J7I A;  2PQW A;  1VQ5 T;  3R6O A;  2R5M A;  1VQP A;  4KUD K;  1RL2 A;  3CCL T;  2FHD A;  4EPC A;  1M4Z A;  2PVG B;  2YHT A;  4C8Q D;  4MZT A;  2Y90 A;  3OMG A;  4IUP A;  2V8I A;  1M1K U;  2DXB A;  3V8J A;  5GMK i;  1OI1 A;  4PKC C;  4C8Q G;  3FDR A;  4ZGD B;  3L2V A;  2M9U A;  3G6E T;  3S3O A;  2CKK A;  1JBM A;  1M1F A;  1UGQ B;  3QJY A;  4C92 F;  3CD6 T;  1YJ9 T;  4A4F A;  4L5G A;  1Q82 U;  2KMT A;  4PJO B;  3OYH A;  1G3T A;  3QO3 A;  3JCM c;  2XIC A;  1RI0 A;  1YIJ A;  2KK4 A;  4BDZ A;  3OYE A;  1VQO T;  4M77 C;  2OTL A;  2RB6 A;  1XTD A;  4ZGJ B;  4M7A C;  1WJS A;  4PJO F;  5GAN h;  3OYF A;  4HT9 A;  3NFC A;  1U1T A;  1GXI E;  4N4H A;  4EMG A;  5KCH A;  3M55 A;  4A53 A;  3O8V A;  3OYK A;  1B34 B;  3LWH A;  3QZ5 B;  5FU7 B;  4M78 A;  3I55 A;  5GAN f;  4BE1 A;  3TCJ A;  3QSU A;  4QVZ A;  3SWN C;  3CCV A;  3MEV A;  2ZGW A;  1HK9 A;  2M1H A;  5LJ3 h;  4M7D C;  2EWN A;  3A8H B;  4PLI A;  2RK2 A;  3PT9 A;  4Y91 A;  2Y4Y A;  3INZ A;  2DXT A;  5LJ3 f;  2GCX A;  1YHQ T;  4JJN K;  4J5Y A;  5DLO A;  3RKW A;  3LX7 A;  4IUV A;  2K5F A;  1VQP T;  2RHZ A;  1M1G A;  2IG0 A;  2RD1 A;  4J6Y A;  3QKJ A;  3RES A;  1UGP B;  2VC8 A;  2EQK A;  3CCM A;  3CBP A;  2FVU A;  1FWZ A;  4KUL A;  1Y96 B;  3HRU A;  4E47 A;  3M56 A;  4IUQ A;  2DZ9 A;  4MZM A;  4BI4 A;  3M57 A;  5GAN 2;  4BI3 A;  3MP8 A;  4R55 A;  3CCE A;  1UB4 A;  4C8Q C;  5A0L A;  3MO8 A;  3QBY A;  3CC2 A;  2K3X A;  2BUD A;  5C0M A;  1VUB A;  2XID A;  5I2M A;  1G3W A;  4J8O A;  1YIJ T;  1VIE A;  2OTL T;  3QHS A;  4RG2 A;  1M9S A;  2DIQ A;  5AYF A;  3BY7 A;  4B9X A;  2DJZ A;  2D0Q B;  2K4Y A;  4ZGE B;  3C95 A;  3A8M B;  1UGR B;  2CS7 A;  4ZN3 A;  2LCC A;  5CAI A;  2GQV A;  2EFI A;  2LNV A;  4HA8 A;  4O5V A;  3TRE A;  3G4S A;  2K2V A;  3JCM V;  4C5H A;  1YIT A;  3I55 T;  4QVD A;  4ZTJ A;  1VQ8 A;  2OTJ A;  2CZ0 B;  4X34 A;  3MEU A;  2QQ9 A;  3UDC A;  4C0G A;  2R58 A;  3CCV T;  3A5Z B;  1K73 C;  2MF2 A;  4EMK B;  2VYT A;  5GAN j;  1OYX A;  1JB0 E;  1KC8 C;  3JCM J;  2ZPB B;  3OS1 A;  4GY5 A;  4M7D F;  1X75 C;  2KVQ G;  5EG2 A;  4ME7 A;  5GAO p;  4RMO A;  3MET A;  1BYM A;  4A4E A;  5DM7 R;  3JB9 F;  2F69 A;  2RI3 A;  2ZPI B;  3FRN A;  5LJ3 j;  4XTV A;  2E6Z A;  2DTH A;  4X9D A;  3CCM T;  3CBM A;  3CMA A;  1HXD A;  1QVG A;  1QVP A;  4M75 E;  2KDS A;  2XKO C;  4N4I A;  4XTZ A;  5GMK m;  5GAN d;  4QQ6 A;  3WXM B;  2XK0 A;  3X20 B;  1EIF A;  3CCQ A;  3CCE T;  2QEX A;  4BUG A;  4Y28 E;  1G3Y A;  3JCM P;  4XTW A;  5D6X A;  3L2Q A;  1Q7Y C;  4M75 D;  3L2W A;  5GAM e;  3VUB A;  4V2S A;  5CVI A;  3DLM A;  1B34 A;  3OYY A;  2PVO B;  5LJ3 d;  1QVG S;  2RM4 A;  4ATO A;  4M75 G;  4A54 A;  5GAN g;  3MP6 A;  2CZ6 B;  4BE0 A;  3BDU A;  2QDY B;  2RHU A;  1PSE A;  1YIT T;  3G4S T;  2JTF A;  3OS5 A;  4HCB A;  2OTJ T;  3ER0 A;  1VQ8 T;  4C5E A;  4CRI A;  2RJF A;  4E7K A;  4RCB A;  3RMQ A;  4C0D C;  1LJO A;  1OZ3 A;  5IT9 E;  2XDB A;  3NTK A;  5LJ3 g;  3HL8 A;  1G5V A;  1KHI A;  3QG1 A;  3SDZ A;  3OW2 A;  2CZ1 B;  3S3N A;  4JS4 A;  3HRS A;  4CI0 C;  1WNL A;  2DD5 A;  3FB9 A;  4JUV A;  1BI0 A;  5GAN 4;  4LDX A;  2FL7 A;  4FSX A;  4JRQ A;  5I2S A;  3LYI A;  3LGF A;  5HK0 A;  1Y96 A;  4DA4 A;  2DXU A;  3L2R A;  2LQ8 A;  4JLI A;  1VQ4 A;  1YI2 A;  5KH6 A;  2K5I A;  2VUB A;  2RI5 A;  2VGM A;  5J3B A;  5LJ5 e;  3OW2 S;  3MP1 A;  3CMA T;  4QW2 A;  2G3R A;  1YJN A;  2GFA A;  1ZBX A;  2K5L A;  4M78 E;  4C92 B;  4KUI A;  5GAN 7;  4BAC A;  2D9T A;  1DJ7 B;  3ZEH A;  3CCQ T;  1M8V A;  2QEX T;  2JZ2 A;  2M16 A;  1NJI C;  1K73 U;  3M59 A;  4FL6 A;  2VGN A;  1KQ2 A;  4NS5 A;  3C12 A;  1KC8 U;  4M78 D;  1Q86 C;  1LNX A;  3TEE A;  4DOW A;  5GAO m;  2RJE A;  3QDR B;  3GNG A;  4M78 G;  2HBP A;  3SD4 A;  2E41 A;  4BY6 B;  1BIB A;  4E7J A;  4XU3 A;  1MGQ A;  3A8L B;  1JJ2 A;  3E1S A;  4M75 C;  4EMK A;  2EIF A;  4XU1 A;  3T9N A;  1I81 A;  2X4X A;  3C94 A;  5GAO n;  2MWP A;  3HFO A;  1OZ2 A;  5GMK e;  2IVW A;  3KBG A;  2L5Q A;  3V8K A;  4FM4 B;  2WAC A;  2P4T A;  2XD0 A;  1H64 1;  1QW1 A;  2HNI A;  4MMK A;  2ZPF B;  3RMS A;  1JJ2 S;  4MDW A;  5CO7 A;  3OYG A;  3JB9 H;  1Q7Y U;  2FYK A;  3QUI A;  3P8B B;  3CCU A;  2QQR A;  4J6X A;  1VQ4 T;  5GAN 6;  4C0F A;  4F7U B;  1YI2 T;  1TH7 A;  2QI2 A;  3X25 B;  1KQ1 A;  1QP3 A;  1WJR A;  3VKI A;  3G71 A;  1YJN T;  4F7U F;  2E1H A;  4OVA A;  4RKU E;  3VUZ A;  4EDU A;  1M5Q 1;  4JRK A;  1N27 A;  3G7Z A;  2WSE E;  3FLG A;  4YTL A;  5GAM h;  3OYJ A;  3KUF A;  4R56 A;  3VJP A;  3CME A;  2D6F A;  4NL2 A;  2MWO A;  2CYZ B;  4GLK A;  3OYN A;  1KQS A;  1VIF A;  1BI3 A;  2DAQ A;  4L6V 5;  5GMK l;  5GAM f;  3X24 B;  2HAX A;  1Y07 A;  2E65 A;  2DZC A;  4KT0 E;  4FU6 A;  4M77 B;  4M7A B;  4N0A A;  3ZBD A;  2F5T X;  4FIB A;  3V7R A;  3HHT B;  1W4S A;  2E5Q A;  5HY6 A;  3OYC A;  4M78 C;  3L1A A;  4OF1 A;  3H6Z A;  3S6W A;  4M77 F;  4KBM B;  1KQS S;  1BKB A;  4M7A F;  5GAO q;  4C92 D;  3FC3 A;  3ASK A;  2VXF A;  1P92 A;  2GF7 A;  3BDL A;  3SWN B;  3OYB A;  1K8A C;  5GAN 3;  4XU0 A;  2EQU A;  2BIV A;  2DVE A;  1BI1 A;  1VQN A;  3GOX A;  4M7D B;  5IN1 A;  2QQS A;  3CCJ A;  1NJI U;  4RCC A;  4DOV A;  2KQW A;  3GPL A;  1NPP A;  4ZTF A;  3F70 A;  2DXC A;  3FEO A;  3RER A;  1AHJ B;  4JS5 A;  4PJO D;  3OS0 A;  1Q86 U;  5LJ5 h;  2RI2 A;  2DTO A;  4HCZ A;  3CCU T;  4J7F A;  3JB9 I;  2RK1 A;  1KG1 A;  4C92 A;  2B8A A;  3I56 A;  4HT8 A;  1MHN A;  2LQK A;  3QXE B;  4Z02 A;  3V7S A;  2QXF A;  1VQM A;  5LJ5 f;  3BW1 A;  3M54 A;  1XNI A;  3M58 A;  4OB2 B;  3RKX A;  3OQ5 A;  1VQL A;  2EJF A;  3JSC A;  3G71 T;  4OMF B;  2WSC E;  1Y7X A;  3OYM A;  3LH0 A;  1VQ7 A;  3L42 A;  1YCY A;  2VXE A;  3HRT A;  3PFS A;  4OB3 B;  5FU6 C;  5M9O A;  3CME T;  3DLL A;  4PJO A;  3FIF A;  4C8Q B;  2PU9 B;  2X4W A;  2LT4 A;  3LLR A;  3PNW C;  2DTI A;  4MZP A;  3GIB A;  3A8G B;  1O75 A;  2DD4 A;  1WQ7 A;  5KCO A;  2Y4X A;  3JCM e;  4HCC A;  3FJP A;  3CC2 T;  3UT1 A;  4C8Q F;  2LVM A;  2JOY A;  4XTX A;  1YJW A;  1ZQ1 A;  2VV5 A;  2X35 A;  5GAM j;  2XDD A;  1PSF A;  3M53 A;  2GFU A;  3CXC A;  5GAO r;  2HQX A;  1BIA A;  1YBY A;  3QJ6 A;  5C6S A;  2RH2 A;  2F5K A;  5GMK h;  1N8R C;  3JRZ A;  3CCS A;  4OP0 A;  4II1 A;  2JN0 A;  3C4S A;  5GAO l;  3PGG A;  1R8O B;  4M78 F;  4OGC A;  3CC4 A;  3JCM W;  3MHX A;  4BE2 A;  1V29 B;  3CPF A;  3J81 E;  1VQN T;  3CCJ T;  3DKM A;  4F7U A;  1G3S A;  2YLC A;  4TVR A;  2MAM A;  3CXC S;  5J39 A;  5HKC A;  3OYD A;  2A3L A;  2DO3 A;  2E10 A;  2PVD B;  3MEA A;  5GAM d;  2MI6 A;  3UPU A;  1Q81 C;  4IKF A;  2LC4 A;  2LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...