4M78A

Crystal structure of lsm2-8 complex, space group p21
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
MSATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 67
sequence length 67
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78A00
3FIFA 2DEQA 4M7AD 5GANj 3QSUA 1M5Q1 4M7AF 4EMKB 3JCMX 4M7AE 3RERA 1I81A 4J6XA 4PJOG 3QHSA 5GAOm 4PJOB 4EMKA 3JCMf 1JRIA 4M78D 4M78F 4PJOA 4XU1A 3GIBA 3RIRA 2DXTA 4M78E 5GAMh 4A53A 4M77C 4HT9A 4M7DE 4M75G 2RB6A 4M75B 4X9CA 3JCMV 5GAMd 4DQ2A 5GAN5 5GAOr 1I4K1 3BDUA 5GANh 4JLIA 1LJOA 2E64A 3V8KA 5GAOq 3V8LA 4C8QD 5GANd 2VXFA 4C8QF 2VC8A 4C92D 4NOYA 4N0AC 4C92F 2JN0A 4C8QE 4QVDA 4C92E 1WNLA 2DZ9A 3RUXA 4HA8A 3PGGA 4XU3A 4HT8A 5GAOp 1Y96B 4N0AA 2DTOA 2RM4A 2VXEA 4A54A 4EMKC 4M77D 1MGQA 4M77F 1Y96A 4X9DA 3JCMW 1HK9A 5GAN3 5LJ5f 4PJOC 5LJ3e 4EMHA 5LJ5g 4WF2A 1LNXA 3RKYA 5GAOl 4XTVA 4NL3A 3BW1A 4F7UF 5CAIA 4PNOA 4OP0A 4M75C 3V7SA 3FJPA 1HXDA 3AHUA 4M78G 3JCMJ 1D3BB 3JCMh 1N9SA 4M75A 5LJ5e 2E1HA 5GMKe 4M7DG 4M7DB 1N9RA 1U1TA 5GMKm 1D3BA 3JCMd 5LJ3f 3EFSA 5LJ3g 4M7DA 1BIAA 2FB7A 2HNIA 5GMKl 4PJOF 4PJOD 3INZA 3BFMA 3JCMQ 3RESA 2YLBA 4XTWA 5GAMg 3M4GA 3HSBA 2DTIA 4C92G 3V7CA 4XQ3A 2RD1A 5GANg 2DTHA 4V2SA 2RA2A 2I2LA 1KQ1A 3FB9A 4J6WA 4M77E 2E65A 2K57A 3JB9D 4M7AC 4RCCA 4J5YA 3HFOA 4J6YA 4NL2A 5GAMe 3JB9F 3V8JA 4M7AG 4M7AB 2QTXA 1WQ7A 4F7UE 2E10A 3JB9J 4M7AA 4M78C 1WQWA 5LJ5h 3V7RA 2DKGA 2ZGWA 5GMKh 5GANe 4RCBA 2EWNA 3QO3A 5GAN8 4M78B 4M7DC 2EJFA 4EMGA 3JB9I 4XU0A 4JUVA 5I21A 4M78A 3JCMc 3JCMP 1WPYA 2EJGA 5GAN7 4XTUA 2E41A 1LOJA 4PJOE 5GAMf 4MMKA 4C8QC 4C92C 5LJ5j 4C8QG 2DJZA 4C8QB 5GMKj 1U1SA 4M75D 4XTXA 4XTYA 5LJ3h 4M75F 3SWNC 4C92B 3JCMg 5GANf 2YHTA 4C8QA 4M75E 4M7DD 3SWNB 5LJ3d 2DZCA 4C92A 3JCMb 1X01A 4M7DF 1M8VA 1YCYA 3JB9H 4JRKA 3SWNA 5GMKi 1TH7A 1I5LA 4JRIA 4M77G 4M77B 2CGHA 4Y91A 5GAN6 2DVEA 3QUIA 2Y90A 4XU2A 5GAN2 1KQ2A 4M77A 5DY9A 3L1AA 1H641 1B34B 3JCMe 3JB9G 5LJ3j 4XTZA 4QVCA 5GAN4 3VU3C 4F7UG 1B34A 4F7UB 2FYKA 5LJ5d 3SB2A 3L2ZA 2EAYA 1BIBA 1I8FA 2DXUA 3RKXA 5GAMj 2EJ9A 4F7UA 5GAOn 3RKWA 4MMLA 1JBMA 3EFRA 2YLCA 3HFNA 3BY7A
chains in the Genus database with same CATH superfamily
3A8GB 2ZPHB 1KSWA 1PSFA 3CMEA 3QYHB 4E7ZA 2QDLA 5FU7B 5D7UA 2GBQA 4KUIA 4Z8AA 4FT2A 3PVLA 4C5GA 2VGMA 1YWOA 2F2WA 2LCCA 1PM3A 1VYTA 2V8IA 2J6FA 1PHTA 4QVDA 2O4XA 3ZBDA 1U8RA 2BE9B 4PJOC 2PUKB 3OBYA 4IUVA 4CC7A 3CCUQ 2FG0A 1S72T 4PNOA 3D7SB 1GFDA 5KYXB 2VYTA 3PFSA 9ATCB 1WJSA 3G1JA 5L8RE 4DBQA 2VASA 1N9RA 4BE0A 3J80E 3RR6A 1NLPC 1E6GA 4O6JA 1VQ8A 2D8JA 5FWBA 1OU8A 2DTHA 4HVWA 2RO0A 3JB9D 4RCCA 2X9HA 2EQIA 1QVPA 1WQWA 2J6KA 3G71Q 3MPUB 3QO3A 4BDZA 3E2UA 4JJBA 3FC3A 2CP5A 2EQMA 4OB0B 1RI9A 3OYHA 2BUDA 4E7KA 4GLKA 2EQJA 1AD5A 1AZGB 2KRMA 4CI0C 3MEAA 1JB0E 2OTJA 2QQSA 2E4HA 3CCRA 4A4GA 5GANf 2D9TA 1QCFA 3VKIA 1WXUA 2HL3A 5GMKi 4JRIA 3TREA 3M59A 1A0NB 1SG5A 2DRKA 4J7FA 1ZX6A 3M4YA 1JO8A 2EYXA 2FPDA 2FVUA 2LC4A 5CKDA 2XDBA 3HFNA 3BY7A 5CQYA 2OTJQ 1M1GA 1HYOA 5GAOm 4KGXB 5FW9A 4PJOA 2L2PA 3NTIA 4M78E 1YN8A 2DL8A 3WVEB 2HMAA 1C0MA 1WHKA 1UGQB 2DF6A 3LWIA 2C0OA 1BYMA 2DAQA 2DMOA 2LT1A 2JN0A 1OOTA 3UDCA 2DYIA 3RUXA 1OULA 2HSEB 4J9HA 3OYJA 2KMTA 3CD6T 3EHRA 1M1KU 1VQLQ 2QQAA 1WDXA 2JMCA 4BI8B 4M7DG 2KBTA 2YUQA 2QASA 4LD9K 3T9NA 3JCMQ 3RESA 5GAMg 4JZ4A 3I55Q 1SF9A 3PNWC 2I2LA 3JAME 1WX6A 2OTLT 1YIJT 4F7UE 1QKWA 3CCMA 1VQ5Q 2QEXQ 1W6XA 3DLLA 3M53A 1Q81C 2CZ0B 1UUEA 4OGCA 2DIQA 1BI2A 4LNPA 4M75D 1RLQC 3OS5A 2DLPA 2CUBA 4BB7A 5FROA 1YJWQ 3JCMb 4M7DF 1IREB 1QKXA 2BKDN 1SRMA 4HVUA 1T3LA 2AHJB 3SWNA 2X4YA 4KT0E 3CC4A 2XICA 3QJ6A 3QUIA 4XU2A 2GTOA 3LWHA 3S3OA 1N6AA 4RTWA 5FRNA 2O31A 1C6VX 3EGUA 4C0DC 2ZZDA 1JBMA 2AKLA 1VQ9A 3M54A 3EG9B 1RABB 3CBPA 1GCQC 4J83A 5FRMA 4M7AE 3VYGA 4M78F 1QVFA 2P4TA 1ARKA 3NFCA 4X9CA 4DQ2A 1VQ4A 1OU9A 1W4SA 4OF1A 4OMMA 6AT1B 3FEOA 2DL7A 4L59A 1X2QA 4HVVA 4X1VA 4PLIA 4XU3A 4Q5WA 4N0AA 5CIUA 2HZYA 3TQ7P 4N4HA 3CC7Q 3TSZA 3QG1A 2QK0A 4EDUA 1ABQA 2RQRA 2YSQA 4E6RA 2ZPEB 1CKAA 1MNDA 2PZ1A 3EFSA 2HNIA 2E6ZA 5GJVB 3CCLA 2MIOA 3G7ZA 3CPFA 3I56T 1ZA1B 2K4YA 5IAYA 4J6WA 2EKHA 3QXEB 2JTEA 2ABLA 1MUZA 2A3LA 1JU5C 1RLPC 2C0IA 2M9UA 5EG2A 4M7AG 2V8KA 1EIFA 1KG1A 4DOWA 3LH5A 1G2BA 4IURA 5GANe 1GBRA 3JB9I 3OW2A 4BY6C 3CMET 1UGPB 4PFOA 2MPXC 3EG2A 4QKUA 1QVFS 1YFNA 4PFPA 4C92C 1VIEA 5KCOA 1TXQA 2K5FA 3CCST 3LGLA 5IHKA 4M77G 1FMWA 2KROA 4B9WA 2K79A 2IIMA 3M0SA 4Z89A 1G8XA 2PVOB 3PIOA 1DJ7B 1HD3A 2O2OA 2WSEE 1TTHB 5M9OA 3EFRA 1K76A 1AHJB 2YLCA 3M9QA 2CS7A 2DL3A 4BDYA 4M7AF 3G4SA 5ECAA 5KYYB 1BI3A 1WHGA 3RIRA 4JS4A 3PMTA 1Q82C 3HRUA 2COYA 1OX8A 1D1CA 3OYGA 5KYUB 3M0UA 2KNBB 2YRCA 4E2FB 1JEGA 2O88A 1KD1C 1Z9ZA 4OB3B 1S72Q 3L2QA 1Y96B 4DBRA 4M77F 2XIDA 4EMHA 3OYCA 2HQHA 1ZBJA 1N8RU 1M90R 1TS9A 2X4XA 3OW2S 1QVGP 3FJPA 2B8AA 5HCKA 3N5BB 2JM8A 2M02A 3AHUA 2XHCA 1K8AR 2E1HA 2RF0A 3CCRT 4M7DB 2YUPA 3VUBA 3A8LB 5A0LA 1AWXA 4DEYA 1M1FA 3OA6A 3VYHB 2RJDA 2F2XA 1MMGA 3H0HA 2L3SA 2E65A 1AVZC 4J5YA 2E3HA 4DBFA 1VQ6A 2EYQA 2JS0A 1YNZA 4M78B 1WA7A 1YJNA 2RK2A 1KK7A 2RN8A 1Q81R 2EJGA 1KC8R 4MMKA 4KGVB 4JZ3A 2MCNA 3JCMg 2YRDA 1YHQT 4Y92A 1KQSP 2RNAA 1YCYA 4KGZB 4FM4B 2LQWA 1B34B 2ATCB 4AG1C 5LJ5d 2KXCA 3BE3A 2V26A 1UHFA 3LGFA 1N5ZA 3QSUA 5LL6S 1NBEB 1YWPA 2H3EB 3A1PA 4PJOG 3REAB 2JTFA 4XU1A 1VA7A 3HL8A 5I11A 1G3TA 2ED1A 2EPDA 3BDUA 3EGDA 3RMQA 4Z88A 3V8KA 2AZVA 3F70A 3CD6Q 1JQQA 4C0ZA 1UGSB 3PGGA 3UPUA 1G3SA 3CPWA 3CCMT 1RUWA 2CYZB 4BI3A 2HKNA 3GBQA 1PNJA 2AIRB 2LJ0A 2K7AA 5KE2A 5J26A 1ACMB 2RHZA 3EGXA 1FX7A 2FB7A 4MZPA 4PJOF 3INZA 3M57A 3BFMA 2OTLQ 3CC4T 1YIJQ 1B7TA 2FZCB 2YDLA 2DE0X 3V7CA 4IUPA 4M7AB 2KK4A 1VQ9T 3KFVA 1BKBA 2D8HA 3DKMA 1D09B 2VKNA 3JSCA 4XU0A 1T0JA 2CT3A 3HP9A 3P8HA 4D6WA 4HXJA 3UATA 1BB9A 3O5ZA 3VS4A 1PRLC 3A8OB 2DJZA 1JXOA 4FYWB 1VQ4T 1U1SA 1VQMQ 3OBWA 4C8QA 4M7DD 2DZCA 2PNIA 2GNCA 3MEUA 1XOVA 3R6OA 4M77B 5IHIA 7AT1B 1X27A 4XTZA 1IXDA 5GAN4 3SB2A 1M2VA 2VV5A 1VUBA 5J3BA 2RMOA 2HSPA 1MMNA 2R58A 2LMJA 2NUZA 1SSFA 2MYSA 2XMFA 3ZFJA 4M78D 1LCKA 2MAMA 4J9BA 1UGVA 4LD6A 5FU7C 3CCLT 2ECZA 1O9SA 3GIBA 1H3ZA 4F14A 4E7HA 1E6HA 2RB6A 2CZ7B 3VS2A 2PVGB 2DVJA 3C94A 3QDRB 3CCVA 2KI7A 4LUDA 2NUTA 1KD1R 1I5OB 2O4XB 4GY5A 4R55A 2A37A 3I5RA 1BI0A 1FYNA 1PD0A 1ZBXA 1M27C 1HK9A 3LLRA 1RAHB 4DEXA 1WJRA 4M75C 1QCOA 3I56Q 1K4US 3NTKA 4AG2C 3CCQA 1ABOA 4BE2A 4RMOA 3M0QA 3VRYA 5GMKe 3X20B 4LDXA 4FIBA 3J81E 2C0TA 1IB8A 3CCSA 1F1BB 2GCXA 3M4GA 2IPOB 3HTRA 5DM7R 1AWOA 2CP3A 3QZ5B 3CMEQ 2FZKB 2K9GA 1BU1A 1TWBA 3VUZA 2HQEA 2QA4T 1BI1A 1RAIB 1VQPT 2DKGA 5GMKh 1AWJA 1I07A 3G4ST 3MEVA 1AT1B 3KBGA 1RL2A 5DLQE 4GBQA 2GTJA 2HQXA 2DL4A 1W2BP 5GAMf 2A0FB 2LJ1A 2ZAEA 4J9DA 4QVZA 3ME9A 3GOXA 2QXFA 4C0GA 3GNGA 4CC3A 1PKSA 5GAN6 4RUGA 3KUFA 2KT1A 4AMCA 3L2ZA 1OPLA 2EAYA 3M0TA 3OYFA 3OYLA 1VQ8Q 4M7AD 2R5MA 2PTKA 4J6XA 2X3WD 2XD0A 2GFAA 4PJOB 1JRIA 4YTLA 4IKFA 1WHHA 4M7DE 3ZEHA 2OAWA 2YXYA 4IIMA 2ROTA 2KY9A 2IG0A 4NOYA 2DETA 3OYNA 1VQ6T 1H8KA 1M3CA 2F1LA 4M77D 3Q1JA 3A8HB 1B3QA 3CCRQ 1YJNT 1QVGS 2CP2A 2W0ZA 1LNXA 2DPPB 1KIKA 3QKJA 1NJIR 2CP7A 2RHUA 1MV0B 5CKHA 2HDAA 3H0IA 2KEAA 3P8DA 1YHQA 2M1HA 4J9CA 2YUNA 4LDYA 2P0KA 4F04B 3HSBA 1HSQA 1WIEA 1X75C 2PVDB 4OMOA 4C92G 3CCJA 3VS3A 1OZ2A 3UF4A 4CC2A 1QW1A 8AT1B 1M90C 3CBMA 1M90U 2A7YA 4PL6A 3V7RA 5IXBA 4MDWA 1K8AC 1MNEA 1WPYA 1MMAA 2NYSA 1K8AU 3EAEA 1LOJA 1X6GA 1RAEB 3VS7A 2DD4A 2ENMA 4OMPA 2I0NA 4KRTA 3SWNB 1M8VA 1ZA2B 4JRKA 1QCNA 4RTVA 2DEUA 2EQKA 2DNUA 2GF7A 3C0CA 3CBOA 1VQ7A 1M3BA 3VU3C 3QWYA 5HK3A 2MF2A 3SHWA 3MJXA 3CMAA 3CXCP 1KC8C 1Q81U 1Y57A 1IRXA 1UFFA 2QGGA 1KC8U 1I81A 3M0PA 5CK9A 1V29B 1D0ZA 2JMAA 2XK0A 3HRSA 3CCMQ 2Z0WA 2LQNA 2CREA 5GAOq 4FYXB 5GANd 5CR2A 1FWZA 2CZ1B 4C8QE 2DBMA 5L23A 4FW1A 2J7IA 2VXEA 2FZGB 4EMKC 3OQ5A 5GAN3 4HCCA 5CCAA 2K3XA 2H8HA 3TEEA 4A63B 3CC4Q 3EG0A 5GJWB 2JOYA 1Q86C 2MOXA 4C5IA 3H0FA 3UT1A 4EPCA 1R0BG 4JJCA 4PJOD 1NYFA 1WHLA 3L2VA 1VQ9Q 3CC2T 1UG1A 3ER0A 2A28A 1J3TA 2RA2A 4M77E 3C4SA 2QG9B 1AOJA 2D0NA 4QQ6A 5GAMe 3J7AF 2RQTA 2QGFB 1RACB 4JJDA 1VQ4Q 4JS5A 2BZ8A 1XTDA 4KULA 1BCMA 5I21A 2DIGA 5KYNA 4C0DB 1WZOA 4J9EA 3CEYA 3O8VA 2FRWA 5LJ5j 3UWNA 4C8QG 1JJ2P 1U06A 3CCVT 4C5EA 3AT1B 1FXXA 1Q7YR 3ULRB 2RI2A 4RKUE 1H641 3I5SA 3JB9G 4L6V5 5LJ3j 2K5IA 1PRMC 5J39A 1VQNA 2MMPA 3CCLQ 3RKWA 1G3WA 3U23A 1R8OB 3FIFA 2DEQA 3OMGA 4OGEA 4D8KA 3CCQT 3PVQA 2E6NA 3LYIA 3QHSA 4EMKA 3JCMf 3EG1A 2DILA 1GCQA 4PFZA 4MDXA 1WFWA 2P84A 4AFZC 2BE7D 3MP1A 5GANh 2E64A 2DJQA 3PMIA 4C8QF 3IQLA 1K73C 1WNLA 2KDSA 3R6NA 3OS1A 4E7IA 4HT8A 2G6FX 4L5GA 2WSCE 2DTOA 3RNJA 2QA4A 4A54A 1M4ZA 2QYZA 4A4EA 1VQPA 2MWOA 3RMSA 5LJ5f 4BUGA 1WYXA 5GAOl 1QMCA 3PE0A 4NL3A 5HY6A 1SRLA 1Q82U 1AZEA 5FU6B 2O9SA 1U1TA 4HCBA 5LJ3f 1WXTA 4K11A 2YLBA 4E47A 1VQKA 1KD1U 1VYUA 5I22A 4FT4A 1Q95G 4RG2A 1VQPQ 4DBHA 1OQKA 1OYXA 4IIOA 2RD1A 3G4SQ 2JW4A 2DERA 3MP8A 2WACA 2OJ2A 1YJ9A 4J6YA 1UECA 5CKBA 3QPHA 4MZTA 4M78C 1I1JA 1WJQA 3QDFA 1CKBA 1I0CA 1W2BS 1BCOA 2EYWA 1NM7A 1IO6A 5IXFA 5GAN7 1VOMA 4PJOE 1XQHA 4OVAA 1VQOA 4ELZC 4C92A 2RJCA 3JB9H 3KXTA 1IHWA 1UHCA 2VWFA 5KYWA 1WLPB 2LNHB 5A2QE 2ZPGB 3RKXA 2EJ9A 4ZGDB 2X35A 2QTVA 3VS6A 1S1NA 4J9IA 4FU6A 3C12A 2DL5A 1R77A 1K0SA 2V1QA 2G3RA 2DXTA 1VQ6Q 2LX7A 4M75G 3EGDB 4LE9A 1K1ZA 3CCJT 1QLYA 2EYZA 3CCEA 3LW5E 1YJNQ 1XNIA 2RH2A 3NPFA 2KYMA 3H9NA 1UDLA 2DZ9A 1WHMA 5GAOp 2GFUA 1QP2A 4E7SA 5LJ5g 4B9XA 5C0MA 2HBWA 4WF2A 1IGUA 4R0KA 4FL6A 2L5QA 4LDUA 1Q86R 1BK2A 3WVDB 5KE3A 5IH2A 1ZQ1A 1KHCA 3EGXB 4R56A 2AKKA 1D3BA 5LJ3g 1OPKA 5HK0A 4O5VA 2Y4XA 1BBZA 4MZMA 2KSSA 2AT1B 2E70A 4Y28E 3M58A 4GLMA 4N4GA 1FMKA 2P0QA 2K6DA 3REBB 1VQ7T 2KRNA 4M7AC 4PKCC 3CMAT 2FEIA 4BD3A 3M56A 1NJIC 2EJFA 5I2MA 2RK1A 4JUVA 1Y7XA 3JCMP 3UA7A 1LPLA 2JM9A 1WXBA 3DB4A 2WSFE 4C8QB 3CQTA 2LQ8A 1IZ6A 2YHTA 1X01A 1YITA 1EZZB 1B07A 1YCSB 1C1AA 2YRVA 1P92A 4OMFB 2K3YA 3JCMe 1M2VB 3CXCS 3EG3A 1K9MC 1I8FA 2HAXA 4RTXA 4F7UA 4MMLA 3HPWA 4ZTFA 3ZL7C 3RERA 4JRQA 1ZSGA 3HRTA 2M16A 4NS5A 1NG2A 2DXBA 2EIFA 2CH4W 3A5ZB 2KQWA 3EFOA 1SKUB 3CC2A 1LJOA 3MEWA 1ZSZC 2NUTB 3OYDA 2RI3A 1K73R 4JRPA 1ZUKA 1TU0B 4HA8A 3G6EA 1NEBA 2RM4A 1MGQA 2JNGA 1N27A 5D6XA 5LJ3e 1UGRB 1G83A 1YI2A 4CC4B 5FLXE 5CAIA 2HL5C 2E3IA 5CKFA 4IUTA 1TG0A 2VGNA 1WGSA 4OB2B 3OB9A 1EFNA 4HCKA 4II1A 2QAZA 4ZNXA 1QVFP 1VQNT 2KYBA 4KH0B 1K9AA 2QTXA 2DK3A 2LCSA 5GAN8 2K3BA 2EWNA 2JJ9A 2J05A 3CCVQ 2JTMA 2QQBA 1JJ2S 1NEGA 4XTUA 2Y4YA 2VUBA 1IHVA 1NLOC 2RI5A 1N8RR 4FSSA 4M4ZA 1RI0A 1D1AA 1NE8A 3X25B 2CH4A 2L0AA 1G5VA 3CCUA 3SEMA 3OYKA 4KBMB 4ZTJA 1TH7A 2JT4A 1RAFB 1U5SA 1QVGA 3CCQQ 1AEYA 2L3RA 3E9FA 2EYYA 1V1CA 2DXUA 1ZSZA 3CCSQ 2EBPA 4C0FA 3PIPA 1HJDA 1O75A 2LX9A 1RADB 5GANj 2YT6A 2A36A 2YUOA 4JLGA 4PLLA 4JDSA 2R57A 4IUUA 4WTOB 4HT9A 1VQKT 4M75B 1Q7YC 3MO8A 2XKOC 4QT7A 2P0PA 3OW2P 1Q7YU 3G71A 1SSHA 4C5HA 4WCIA 4C8QD 1Y0MA 4E7JA 4AFUC 1YJ9T 4C92E 2F5KA 4AFQC 3JCMW 5D6YA 1Y07A 4ORZA 1UB4A 4ELYC 3BW1A 1KQSA 3M55A 2RHIA 1HXDA 2ROLA 4ZN1A 3OSSC 1PC0A 5KYXA 2GQVA 4M75A 2E5QA 1VQOT 2DX1A 3VV0A 3I9QA 1EX4A 5IN1A 5I2SA 4DA4A 2ZPBB 4QQGA 1MMDA 3H6ZA 2PUOB 4XQ3A 2KR3A 2XU8A 4BACA 3FB9A 2K57A 2A08A 3OYIA 2NWMA 2E5KA 4BE1A 3V8JA 3META 3NGPA 2SEMA 3JB9J 5IT9E 4D8DA 2ZGWA 1PD1A 5AT1B 2BIVA 2JXBA 2XI9A 1UE9A 3CCET 3LH0A 3SWNC 4HKEA 2EW3A 2GQIA 2DA9A 2D1XA 1I5LA 4Y91A 2CGHA 1MHNA 3S3MA 1VQLA 1KQ2A 2BZYA 5DY9A 3L1AA 3QIIA 3OS0A 2QQRA 1K9MR 3OYBA 1YHQQ 1IGQA 2VB6A 1BIBA 3EHQA 1R0CB 4LDWA 4FCYA 2LCLA 3I55A 3CCJQ 2XDDA 1KQSS 3E1SA 2HCKA 5CQXA 4HCZA 1M1KC 1SEMA 3RBBB 5GAMd 1OEBA 3EH2A 4J8OA 1NZ9A 4UC4A 4TVRA 4AT1B 1MV3A 1VQ5A 2QEXA 2EKOA 5IHNA 4N0AC 4C92F 1KHIA 1Z9QA 2D0QB 2CKKA 1ZHIA 3OMCA 1GXIE 2CSIA 4X9DA 1QQJA 4Z02A 2RHXA 2OI3A 2HBPA 3OS2A 2AK5A 1UJYA 2M0OA 1YJWA 2C06A 3PT9A 4OMQA 2O01E 3GP8A 1GBQA 4M78G 5EC7A 1N9SA 2DO3A 4F17A 1VQ7Q 4VUBA 1YITT 2LNVA 2AZSA 2FHDA 3CMAQ 3THKA 4XTWA 2D6FA 3OSVA 2DTIA 2BTTA 4KH1B 4LUEA 4RTTA 5GANg 1UEBA 3P8BB 1KQ1A 4FW2A 2L89A 2FPFA 2EQUA 1M9SA 2L3PA 4QQDA 1SHGA 3WXMB 3RDVA 1QWEA 1SHFA 2XDPA 3OYYA 2RQUA 1VQMT 4RCBA 2H3JA 3PTAA 4EMGA 1VIFA 1Q86U 2KVQG 5A0DA 2KT8A 4RTUA 3JCMc 8ATCB 2BZXA 3CPWP 2YWWA 3FDRA 1X43A 2CT4A 3URGA 3I35A 1NPRA 1TUCA 1JXMA 3CC7A 2ZPIB 3A8MB 5KCHA 1GRIA 3G6ET 2L3QA 2DVEA 5GAN2 3LX7A 2NLUA 2NUPB 2LZ6B 1E7OA 4F7UG 2CDTA 2COZA 1T3SA 3TCJA 1YI2T 1H3HA 2M0YA 2XG8D 3DB3A 4EMKB 3OYEA 3EG9A 1XJWB 3NTHA 5GAMh 2FRYA 4ZGJB 4PJNA 2HD0A 2SRCA 3SD4A 5GAN5 2CUDA 3MHXA 4CRIA 5D6WA 5CO7A 2LRQA 2LTOA 2VXFA 3TSWA 2VC8A 2LVMA 3S6WA 2NUPA 1OZ3A 4DOVA 3OYAA 2EGAA 2J6OA 1YP5A 1W2BA 1OV3A 1U3OA 2W10A 5AYFA 1KFZA 5KH6A 3ASKA 4F7UF 2ZCFB 4RTZA 1D1BA 1X6OA 5FU6C 2O9VA 3JCMJ 1D0YA 5GMKm 1VQNQ 1BIAA 3CCUT 4ATOA 2R5AA 1K73U 4A4FA 4V2SA 4OB1B 3OYMA 2RJFA 1UJ0A 3JB9F 1X69A 4A4HA 3QWXX 4AFSC 1WQ7A 1H92A 5DLOA 2E10A 3JV3A 4F16A 3M5AA 4M7DC 2K2MA 2F2VA 4OMNA 1OI1A 3C95A 4BY6B 4PK4A 1S72A 4ZGEB 2QA4Q 3GNFB 4QW2A 5GMKj 3G71T 4XTYA 4C92B 3OY9A 4M75E 1PWTA 1RAAB 3TU4K 2RQVA 2KAFA 3QBYA 5KYWB 1VQ8T 2MI6A 1QWFA 2B86A 3VRZA 4ZN3A 1OX9A 4PJJA 1FMVA 2EGCA 1K0XA 3L2RA 2FO0A 5GAOn 1Y71A 1VQKQ 1AWWA 3FJ5A 3VS1A 2ZPFB 3HHTB 3UA6A 2L8DA 3JCMX 1M8MA 1N8RC 1GCPA 1M1KR 5KYYA 1YJ9Q 4A53A 1M2OA 2DXCA 2HKQB 5GAOr 2OTJT 1I4K1 3QJYA 2PQWA 5CVIA 1ZLMA 5KYUA 1WI7A 2K2VA 3NMZC 1TSFA 1WHJA 2F69A 1PKTA 1Y96A 2OAUA 1VQOQ 2DM1A 2ESWA 2LT4A 4XTVA 3X28B 3GF5A 4E7LA 5C6SA 1M3AA 3H41A 2DFUA 1D3BB 2RHYA 2X51A 1ZUUA 3JCMd 4J9GA 4M7DA 3VS5A 2E12A 3E19A 1W70A 3QZ9B 3VJPA 1VQLT 3CXCA 4RTYA 2CP0A 2V8JA 2PU9B 2QDYB 1ZUYA 4NL2A 4OMLA 4PJLA 3I55T 1YBYA 2QQ9A 4J7IA 4PJMA 1T0HA 2M51A 3CCEQ 2LJ3A 4LXCA 1PSEA 4M78A 3CD6A 3FRNA 1W1FA 1RAGB 2CZ6B 2E41A 1QP3A 4C8QC 2KRSA 2JZ2A 4XTXA 1VQ5T 4M75F 2QI2A 2QEXT 2JS2A 3MKDA 5LJ3d 1D0XA 2X4WA 3JRZA 3SDZA 3FLGA 3SFMA 1X6BA 2RJEA 4ANJA 3QYGB 4QVCA 3S3NA 1NJIU 1B34A 2KGTA 4F7UB 4JPBW 1YJWT 2X3XD 2MWPA 2OTLA 4FSXA 1YIJA 2CP6A 1M5Q1 2VVKA 1UTIA 3EFOB 4M77C 3JCMV 2K5LA 3L42A 4B6MA 3BDLA 3M0RA 4JLIA 2LQKA 3V8LA 2V1RA 2IVWA 4C92D 1NPPA 2LP5A 3L2UA 1TOVA 4P5NA 1K9MU 1CSKA 4RG8A 3X24B 2RQWA 1VQMA 3HKSA 1VYVA 1JJ2A 3RKYA 3MCAB 1GL5A 3MP6A 1YITQ 2HEQA 2P4RA 4ME7A 2MK5A 2FL7A 4OP0A 3V7SA 4EIKA 4LDVA 3JCMh 5LJ5e 4KUDK 4FYVB 3E9GA 4BI4A 2F5TX 4N4IA 3CC7T 3X26B 5GMKl 5HKCA 2COWA 1GFCA 1LVKA 3H8ZA 2KE9A 2DYBA 2DD5A 5A0GA 2X4JA 4J9FA 2DRMA 3HFOA 2JUFA 3DLMA 3CC2Q 4M7AA 5LJ5h 3A98A 3L2WA 1TUDA 3TVTA 2J06A 3CPWS 5CKEA 4JJNK 4XAXB 1NYGA 2DBKA 1X2KA 3G6EQ 3VS0A 2EVRA 1M30A 4X34A 2OX7A 1PCXA 3GLXA 5LJ3h 4LN2A 2RPNA 5FWCA 2LDMA 4XK8E 2JVVA 2KXDA 4IUQA 1YI2Q 1Q82R 2EFIA 1SPKA 4A4KA 3NHNA 2FPEA 3I56A 2Y90A 4M77A 1TUGB 2GGRA 4FYYB 1ZSZB 2FYKA 5GAMj 3EH1A 3GPLA 1G3YA 2ED0A 1KJWA 2EGEA 1PG5B 2CSQA 1V76A 4ESRA
chains in the Genus database with same CATH topology
3FIFA 2DEQA 3LGFA 3I55A 3A8GB 3OMGA 4OGEA 2XDDA 5LL6S 2ZPHB 3CCQT 1KQSS 3QSUA 3E1SA 2E6NA 3LYIA 4PJOG 3QHSA 4EMKA 3JCMf 5CQXA 1PSFA 3CMEA 4HCZA 2JTFA 3QYHB 1M1KC 4XU1A 3HL8A 4MDXA 5FU7B 1G3TA 5GAMd 4KUIA 4FT2A 4J8OA 1NZ9A 3BDUA 2VGMA 4UC4A 3MP1A 3RMQA 4TVRA 4C5GA 5GANh 1VQ5A 2E64A 3V8KA 2QEXA 2EKOA 2LCCA 3PMIA 4C8QF 2V8IA 3F70A 4N0AC 4C92F 1K73C 4QVDA 1KHIA 2D0QB 1WNLA 2KDSA 2CKKA 1ZHIA 3OMCA 4C0ZA 3OS1A 4E7IA 1UGSB 1GXIE 2O4XA 3PGGA 4HT8A 3ZBDA 1U8RA 4L5GA 2WSCE 2DTOA 3UPUA 2QA4A 4A54A 1M4ZA 1G3SA 4A4EA 4X9DA 4Z02A 3CPWA 3CCMT 1VQPA 2MWOA 4PJOC 3RMSA 5LJ5f 2RHXA 2PUKB 3OBYA 4IUVA 2CYZB 4BI3A 2HBPA 4BUGA 3OS2A 2M0OA 1YJWA 5GAOl 2C06A 3PT9A 4NL3A 1S72T 5HY6A 4PNOA 2O01E 3GP8A 2VYTA 3PFSA 1WJSA 5L8RE 1Q82U 4M78G 5KE2A 5J26A 1N9SA 2DO3A 5FU6B 1N9RA 1U1TA 2RHZA 4BE0A 3J80E 4HCBA 1FX7A 5LJ3f 2FB7A 4MZPA 4VUBA 4PJOF 1YITT 2LNVA 3INZA 2FHDA 3BFMA 3M57A 3CC4T 2YLBA 4XTWA 4O6JA 2D6FA 3OSVA 4E47A 1VQKA 1KD1U 1VQ8A 4FT4A 4RG2A 2DTIA 3V7CA 1OYXA 2RD1A 5GANg 2DTHA 1UEBA 3P8BB 1KQ1A 3MP8A 2RO0A 2WACA 2L89A 3JB9D 4RCCA 4IUPA 1YJ9A 4J6YA 2EQUA 4M7AB 1M9SA 4QQDA 5CKBA 1QVPA 2KK4A 3QPHA 1VQ9T 3WXMB 4MZTA 4M78C 1WQWA 2XDPA 3OYYA 1WJQA 1BKBA 1VQMT 4RCBA 3QO3A 3DKMA 4BDZA 2H3JA 3PTAA 4EMGA 3JSCA 1VIFA 4XU0A 3FC3A 2KVQG 5A0DA 1W2BS 3HP9A 1Q86U 3JCMc 2EQMA 4OB0B 3P8HA 4D6WA 5GAN7 3OYHA 2BUDA 4E7KA 4GLKA 4PJOE 2EQJA 4CI0C 1XQHA 3FDRA 4OVAA 3A8OB 2DJZA 3MEAA 1JB0E 1VQ4T 1U1SA 2OTJA 2QQSA 3OBWA 3URGA 3CCRA 4A4GA 5GANf 1VQOA 2D9TA 1NPRA 4C8QA 3VKIA 4ELZC 4C92A 3CC7A 2DZCA 2RJCA 2ZPIB 4M7DD 3A8MB 3JB9H 5KCHA 5GMKi 3MEUA 1XOVA 3R6OA 4JRIA 4M77B 3TREA 3KXTA 3G6ET 2DVEA 3M59A 5GAN2 4J7FA 3LX7A 2NLUA 5A2QE 4XTZA 2ZPGB 3M4YA 4F7UG 5GAN4 3SB2A 2VV5A 3TCJA 1VUBA 2FVUA 2LC4A 5J3BA 3RKXA 5CKDA 2EJ9A 1YI2T 4ZGDB 2X35A 2XDBA 2R58A 3HFNA 3BY7A 1SSFA 5CQYA 2XG8D 3DB3A 1M1GA 4EMKB 3OYEA 4FU6A 3C12A 5GAOm 3ZFJA 4M78D 4PJOA 2MAMA 3NTIA 5FU7C 4LD6A 3NTHA 3CCLT 2G3RA 1O9SA 2DXTA 4M78E 3WVEB 4ZGJB 5GAMh 1H3ZA 4E7HA 4M75G 2RB6A 2HD0A 2CZ7B 1UGQB 2PVGB 3SD4A 5GAN5 3LWIA 3MHXA 4CRIA 3CCJT 5D6WA 3CCEA 1BYMA 3C94A 2DAQA 3LW5E 5CO7A 3QDRB 2LRQA 2LTOA 3CCVA 2VXFA 1XNIA 2LT1A 2LVMA 2RH2A 2VC8A 3S6WA 2JN0A 2O4XB 4GY5A 4R55A 3UDCA 1OZ3A 4DOVA 3OYAA 2DZ9A 3RUXA 1BI0A 5GAOp 1ZBXA 1W2BA 2GFUA 3OYJA 1QP2A 1HK9A 5LJ5g 4B9XA 5C0MA 4WF2A 3LLRA 2KMTA 3CD6T 5AYFA 5KH6A 3ASKA 4FL6A 2L5QA 4F7UF 2ZCFB 1WJRA 4M75C 4LDUA 1M1KU 1X6OA 3WVDB 5KE3A 2QQAA 5FU6C 3NTKA 1ZQ1A 3JCMJ 3CCQA 1KHCA 4BI8B 4RMOA 4BE2A 4M7DG 5GMKe 4R56A 3X20B 5GMKm 1D3BA 4LDXA 4FIBA 5LJ3g 1BIAA 3CCUT 3J81E 4LD9K 5HK0A 4O5VA 3T9NA 2Y4XA 3JCMQ 3RESA 3CCSA 4ATOA 5GAMg 2R5AA 1K73U 2GCXA 4MZMA 4A4FA 2KSSA 3M4GA 5DM7R 2E70A 4Y28E 3M58A 4N4GA 2P0QA 3QZ5B 1VQ7T 4V2SA 3PNWC 2I2LA 3JAME 4OB1B 3OYMA 2RJFA 4M7AC 3JB9F 2OTLT 4PKCC 4A4HA 3CMAT 3VUZA 2HQEA 2QA4T 4BD3A 1WQ7A 1YIJT 1BI1A 4F7UE 5DLOA 2E10A 3M56A 1VQPT 1NJIC 2DKGA 5GMKh 3M5AA 3CCMA 4M7DC 3G4ST 2EJFA 5I2MA 3MEVA 2RK1A 3KBGA 1OI1A 1RL2A 4JUVA 5DLQE 3M53A 3C95A 3DLLA 1Y7XA 4BY6B 3JCMP 1Q81C 2CZ0B 1S72A 2HQXA 4ZGEB 5GAMf 4OGCA 3DB4A 3GNFB 2DIQA 1BI2A 2WSFE 4QW2A 4C8QB 5GMKj 3G71T 4M75D 4XTYA 2LQ8A 4C92B 3OS5A 3OY9A 1IZ6A 4QVZA 2YHTA 4M75E 3ME9A 4BB7A 3GOXA 5FROA 3TU4K 3JCMb 1X01A 2QXFA 1IREB 1YITA 4M7DF 2BKDN 2AHJB 3SWNA 2X4YA 2KAFA 3GNGA 2XICA 3QBYA 4KT0E 4C0GA 5GAN6 3CC4A 1VQ8T 3QJ6A 2MI6A 3QUIA 4XU2A 3LWHA 3S3OA 2YRVA 4ZN3A 1N6AA 1P92A 4OMFB 2K3YA 3KUFA 3JCMe 3CXCS 5FRNA 1K9MC 3L2ZA 2EAYA 1I8FA 3L2RA 2HAXA 4C0DC 4F7UA 5GAOn 2ZZDA 1Y71A 4MMLA 1JBMA 3HPWA 4ZTFA 1VQ9A 3OYFA 3M54A 3OYLA 4M7AD 3CBPA 2R5MA 2ZPFB 3HHTB 4J83A 2L8DA 3JCMX 5FRMA 1N8RC 4J6XA 3RERA 4JRQA 2XD0A 3HRTA 2GFAA 2M16A 4M7AE 4PJOB 1JRIA 4YTLA 4NS5A 3VYGA 4IKFA 4M78F 3GIBA 2DXBA 1QVFA 2P4TA 3NFCA 4A53A 2EIFA 4M7DE 3A5ZB 4X9CA 2KQWA 3ZEHA 4DQ2A 2DXCA 5GAOr 3CC2A 2OTJT 1I4K1 3QJYA 1VQ4A 2PQWA 5CVIA 1LJOA 3MEWA 1W4SA 3OYDA 2RI3A 4OF1A 2KY9A 2IG0A 4NOYA 2K2VA 4JRPA 3FEOA 3OYNA 4L59A 1VQ6T 4HA8A 2F69A 4PLIA 4Q5WA 4XU3A 3G6EA 4N0AA 2RM4A 4M77D 5CIUA 3Q1JA 3A8HB 1MGQA 2JNGA 1Y96A 1N27A 2OAUA 5D6XA 5LJ3e 4N4HA 1YJNT 1QVGS 1LNXA 1UGRB 2LT4A 2DPPB 1YI2A 4XTVA 5FLXE 3X28B 3QKJA 3GF5A 5CAIA 3QG1A 5C6SA 4E7LA 4EDUA 2RHUA 5CKFA 4IUTA 1D3BB 2RHYA 2VGNA 1WGSA 5CKHA 2ZPEB 3JCMd 3EFSA 4OB2B 3P8DA 1YHQA 2HNIA 4M7DA 2E6ZA 2M1HA 3CCLA 3OB9A 2E12A 3E19A 3G7ZA 4II1A 3CPFA 2P0KA 3QZ9B 4LDYA 3VJPA 3I56T 3CXCA 1VQLT 3HSBA 1X75C 3CCJA 2PVDB 4C92G 2K4YA 5IAYA 1OZ2A 4J6WA 2V8JA 1VQNT 3QXEB 2PU9B 2A3LA 2QDYB 2M9UA 4NL2A 1QW1A 5EG2A 4M7AG 2V8KA 1EIFA 1M90C 1KG1A 2QTXA 2DK3A 3CBMA 3I55T 1YBYA 2QQ9A 4J7IA 1M90U 2A7YA 4PL6A 3V7RA 4DOWA 4IURA 5GANe 2EWNA 5GAN8 4MDWA 3JB9I 3OW2A 4BY6C 3CMET 1PSEA 1K8AC 1UGPB 4M78A 3CD6A 3FRNA 1WPYA 2JTMA 2QQBA 1K8AU 3EAEA 1JJ2S 2CZ6B 4XTUA 2E41A 1LOJA 2Y4YA 2VUBA 1QP3A 2RI5A 4C8QC 1QVFS 4C92C 2JZ2A 4XTXA 1VQ5T 2DD4A 4M75F 1RI0A 1NE8A 1VIEA 2QI2A 3X25B 2QEXT 1G5VA 3SWNB 5LJ3d 5KCOA 1M8VA 2K5FA 3CCST 3CCUA 2X4WA 3JRZA 3LGLA 3FLGA 3SDZA 4JRKA 3OYKA 4KBMB 4ZTJA 1TH7A 4M77G 3SFMA 2EQKA 2RJEA 1QVGA 2GF7A 4B9WA 3QYGB 2PVOB 3CBOA 3PIOA 2L3RA 3E9FA 4QVCA 3S3NA 1VQ7A 3VU3C 1NJIU 1B34A 4F7UB 5HK3A 1YJWT 1DJ7B 2DXUA 2MF2A 2WSEE 2MWPA 2OTLA 3CMAA 4C0FA 5M9OA 4FSXA 3PIPA 1O75A 2YLCA 1AHJB 3EFRA 1YIJA 1Q81U 3M9QA 2CS7A 2LX9A 4BDYA 1KC8C 5GANj 1M5Q1 4M7AF 1KC8U 1I81A 5CK9A 3G4SA 4JLGA 1BI3A 4PLLA 1V29B 4JDSA 2R57A 4IUUA 3RIRA 3PMTA 4JS4A 1Q82C 4M77C 4HT9A 3HRUA 2XK0A 1VQKT 3HRSA 4M75B 3JCMV 1Q7YC 2K5LA 3MO8A 2XKOC 2P0PA 3L42A 3OYGA 1Q7YU 3BDLA 4JLIA 3G71A 2LQKA 4C5HA 3V8LA 5GAOq 4C8QD 4E7JA 5GANd 2IVWA 4C92D 1NPPA 1FWZA 5CR2A 3L2UA 2CZ1B 4C8QE 1KD1C 1YJ9T 4C92E 4OB3B 2F5KA 4P5NA 1K9MU 3L2QA 1Y96B 2VXEA 4EMKC 4RG8A 4M77F 3OQ5A 3X24B 3JCMW 2XIDA 5D6YA 1Y07A 5GAN3 1UB4A 1VQMA 4EMHA 4HCCA 3HKSA 1JJ2A 3OYCA 5CCAA 3RKYA 3MCAB 2K3XA 3MP6A 4ELYC 1N8RU 3TEEA 2X4XA 3BW1A 4ME7A 3M55A 2RHIA 1KQSA 3OW2S 4OP0A 2FL7A 3V7SA 3FJPA 1HXDA 4LDVA 2B8AA 3AHUA 2JOYA 3N5BB 3OSSC 4ZN1A 4C5IA 1Q86C 2XHCA 2GQVA 3UT1A 3JCMh 5LJ5e 4M75A 2E5QA 2E1HA 3CCRT 4KUDK 3E9GA 4BI4A 2F5TX 4EPCA 1VQOT 4M7DB 4N4IA 3VV0A 3X26B 3CC7T 5IN1A 4PJOD 5GMKl 5I2SA 5HKCA 4DA4A 2ZPBB 3VUBA 3A8LB 5A0LA 4QQGA 3L2VA 3CC2T 3H8ZA 3H6ZA 3ER0A 2PUOB 1M1FA 4XQ3A 3OA6A 3VYHB 2XU8A 2RJDA 2DD5A 4BACA 2RA2A 4M77E 3FB9A 5A0GA 2X4JA 2E65A 2K57A 3C4SA 3OYIA 4J5YA 3HFOA 4QQ6A 5GAMe 4BE1A 3J7AF 3V8JA 2JUFA 1VQ6A 3META 2EYQA 3DLMA 3JB9J 4M7AA 5LJ5h 5IT9E 2ZGWA 3L2WA 4M78B 4JS5A 1XTDA 1YJNA 4KULA 2RK2A 3CPWS 5CKEA 5I21A 4JJNK 4XAXB 2DIGA 2EJGA 2BIVA 4C0DB 2XI9A 3CEYA 3O8VA 4MMKA 4X34A 5LJ5j 3UWNA 4C8QG 3GLXA 3LH0A 3CCET 5LJ3h 3SWNC 3JCMg 3CCVT 4HKEA 4C5EA 1YHQT 1FXXA 2LDMA 4XK8E 2JVVA 4IUQA 1YCYA 2EFIA 4FM4B 2RI2A 1I5LA 4Y91A 4A4KA 2CGHA 1MHNA 3S3MA 3I56A 2Y90A 1VQLA 1KQ2A 4RKUE 4M77A 5DY9A 3L1AA 1H641 1B34B 3QIIA 3JB9G 4L6V5 5LJ3j 2K5IA 2QQRA 3OS0A 5J39A 5LJ5d 1VQNA 2FYKA 3OYBA 2MMPA 1BIBA 5GAMj 3GPLA 1G3YA 3RKWA 1G3WA 4LDWA 1R8OB 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIF A;  2DEQ A;  4M7A D;  5GAN j;  3QSU A;  1M5Q 1;  4M7A F;  4EMK B;  3JCM X;  4M7A E;  3RER A;  1I81 A;  4J6X A;  4PJO G;  3QHS A;  5GAO m;  4PJO B;  4EMK A;  3JCM f;  1JRI A;  4M78 D;  4M78 F;  4PJO A;  4XU1 A;  3GIB A;  3RIR A;  2DXT A;  4M78 E;  5GAM h;  4A53 A;  4M77 C;  4HT9 A;  4M7D E;  4M75 G;  2RB6 A;  4M75 B;  4X9C A;  3JCM V;  5GAM d;  4DQ2 A;  5GAN 5;  5GAO r;  1I4K 1;  3BDU A;  5GAN h;  4JLI A;  1LJO A;  2E64 A;  3V8K A;  5GAO q;  3V8L A;  4C8Q D;  5GAN d;  2VXF A;  4C8Q F;  2VC8 A;  4C92 D;  4NOY A;  4N0A C;  4C92 F;  2JN0 A;  4C8Q E;  4QVD A;  4C92 E;  1WNL A;  2DZ9 A;  3RUX A;  4HA8 A;  3PGG A;  4XU3 A;  4HT8 A;  5GAO p;  1Y96 B;  4N0A A;  2DTO A;  2RM4 A;  2VXE A;  4A54 A;  4EMK C;  4M77 D;  1MGQ A;  4M77 F;  1Y96 A;  4X9D A;  3JCM W;  1HK9 A;  5GAN 3;  5LJ5 f;  4PJO C;  5LJ3 e;  4EMH A;  5LJ5 g;  4WF2 A;  1LNX A;  3RKY A;  5GAO l;  4XTV A;  4NL3 A;  3BW1 A;  4F7U F;  5CAI A;  4PNO A;  4OP0 A;  4M75 C;  3V7S A;  3FJP A;  1HXD A;  3AHU A;  4M78 G;  3JCM J;  1D3B B;  3JCM h;  1N9S A;  4M75 A;  5LJ5 e;  2E1H A;  5GMK e;  4M7D G;  4M7D B;  1N9R A;  1U1T A;  5GMK m;  1D3B A;  3JCM d;  5LJ3 f;  3EFS A;  5LJ3 g;  4M7D A;  1BIA A;  2FB7 A;  2HNI A;  5GMK l;  4PJO F;  4PJO D;  3INZ A;  3BFM A;  3JCM Q;  3RES A;  2YLB A;  4XTW A;  5GAM g;  3M4G A;  3HSB A;  2DTI A;  4C92 G;  3V7C A;  4XQ3 A;  2RD1 A;  5GAN g;  2DTH A;  4V2S A;  2RA2 A;  2I2L A;  1KQ1 A;  3FB9 A;  4J6W A;  4M77 E;  2E65 A;  2K57 A;  3JB9 D;  4M7A C;  4RCC A;  4J5Y A;  3HFO A;  4J6Y A;  4NL2 A;  5GAM e;  3JB9 F;  3V8J A;  4M7A G;  4M7A B;  2QTX A;  1WQ7 A;  4F7U E;  2E10 A;  3JB9 J;  4M7A A;  4M78 C;  1WQW A;  5LJ5 h;  3V7R A;  2DKG A;  2ZGW A;  5GMK h;  5GAN e;  4RCB A;  2EWN A;  3QO3 A;  5GAN 8;  4M78 B;  4M7D C;  2EJF A;  4EMG A;  3JB9 I;  4XU0 A;  4JUV A;  5I21 A;  4M78 A;  3JCM c;  3JCM P;  1WPY A;  2EJG A;  5GAN 7;  4XTU A;  2E41 A;  1LOJ A;  4PJO E;  5GAM f;  4MMK A;  4C8Q C;  4C92 C;  5LJ5 j;  4C8Q G;  2DJZ A;  4C8Q B;  5GMK j;  1U1S A;  4M75 D;  4XTX A;  4XTY A;  5LJ3 h;  4M75 F;  3SWN C;  4C92 B;  3JCM g;  5GAN f;  2YHT A;  4C8Q A;  4M75 E;  4M7D D;  3SWN B;  5LJ3 d;  2DZC A;  4C92 A;  3JCM b;  1X01 A;  4M7D F;  1M8V A;  1YCY A;  3JB9 H;  4JRK A;  3SWN A;  5GMK i;  1TH7 A;  1I5L A;  4JRI A;  4M77 G;  4M77 B;  2CGH A;  4Y91 A;  5GAN 6;  2DVE A;  3QUI A;  2Y90 A;  4XU2 A;  5GAN 2;  1KQ2 A;  4M77 A;  5DY9 A;  3L1A A;  1H64 1;  1B34 B;  3JCM e;  3JB9 G;  5LJ3 j;  4XTZ A;  4QVC A;  5GAN 4;  3VU3 C;  4F7U G;  1B34 A;  4F7U B;  2FYK A;  5LJ5 d;  3SB2 A;  3L2Z A;  2EAY A;  1BIB A;  1I8F A;  2DXU A;  3RKX A;  5GAM j;  2EJ9 A;  4F7U A;  5GAO n;  3RKW A;  4MML A;  1JBM A;  3EFR A;  2YLC A;  3HFN A;  3BY7 A; 
#chains in the Genus database with same CATH topology
 3A8G B;  2ZPH B;  1KSW A;  1PSF A;  3CME A;  3QYH B;  4E7Z A;  2QDL A;  5FU7 B;  5D7U A;  2GBQ A;  4KUI A;  4Z8A A;  4FT2 A;  3PVL A;  4C5G A;  2VGM A;  1YWO A;  2F2W A;  2LCC A;  1PM3 A;  1VYT A;  2V8I A;  2J6F A;  1PHT A;  4QVD A;  2O4X A;  3ZBD A;  1U8R A;  2BE9 B;  4PJO C;  2PUK B;  3OBY A;  4IUV A;  4CC7 A;  3CCU Q;  2FG0 A;  1S72 T;  4PNO A;  3D7S B;  1GFD A;  5KYX B;  2VYT A;  3PFS A;  9ATC B;  1WJS A;  3G1J A;  5L8R E;  4DBQ A;  2VAS A;  1N9R A;  4BE0 A;  3J80 E;  3RR6 A;  1NLP C;  1E6G A;  4O6J A;  1VQ8 A;  2D8J A;  5FWB A;  1OU8 A;  2DTH A;  4HVW A;  2RO0 A;  3JB9 D;  4RCC A;  2X9H A;  2EQI A;  1QVP A;  1WQW A;  2J6K A;  3G71 Q;  3MPU B;  3QO3 A;  4BDZ A;  3E2U A;  4JJB A;  3FC3 A;  2CP5 A;  2EQM A;  4OB0 B;  1RI9 A;  3OYH A;  2BUD A;  4E7K A;  4GLK A;  2EQJ A;  1AD5 A;  1AZG B;  2KRM A;  4CI0 C;  3MEA A;  1JB0 E;  2OTJ A;  2QQS A;  2E4H A;  3CCR A;  4A4G A;  5GAN f;  2D9T A;  1QCF A;  3VKI A;  1WXU A;  2HL3 A;  5GMK i;  4JRI A;  3TRE A;  3M59 A;  1A0N B;  1SG5 A;  2DRK A;  4J7F A;  1ZX6 A;  3M4Y A;  1JO8 A;  2EYX A;  2FPD A;  2FVU A;  2LC4 A;  5CKD A;  2XDB A;  3HFN A;  3BY7 A;  5CQY A;  2OTJ Q;  1M1G A;  1HYO A;  5GAO m;  4KGX B;  5FW9 A;  4PJO A;  2L2P A;  3NTI A;  4M78 E;  1YN8 A;  2DL8 A;  3WVE B;  2HMA A;  1C0M A;  1WHK A;  1UGQ B;  2DF6 A;  3LWI A;  2C0O A;  1BYM A;  2DAQ A;  2DMO A;  2LT1 A;  2JN0 A;  1OOT A;  3UDC A;  2DYI A;  3RUX A;  1OUL A;  2HSE B;  4J9H A;  3OYJ A;  2KMT A;  3CD6 T;  3EHR A;  1M1K U;  1VQL Q;  2QQA A;  1WDX A;  2JMC A;  4BI8 B;  4M7D G;  2KBT A;  2YUQ A;  2QAS A;  4LD9 K;  3T9N A;  3JCM Q;  3RES A;  5GAM g;  4JZ4 A;  3I55 Q;  1SF9 A;  3PNW C;  2I2L A;  3JAM E;  1WX6 A;  2OTL T;  1YIJ T;  4F7U E;  1QKW A;  3CCM A;  1VQ5 Q;  2QEX Q;  1W6X A;  3DLL A;  3M53 A;  1Q81 C;  2CZ0 B;  1UUE A;  4OGC A;  2DIQ A;  1BI2 A;  4LNP A;  4M75 D;  1RLQ C;  3OS5 A;  2DLP A;  2CUB A;  4BB7 A;  5FRO A;  1YJW Q;  3JCM b;  4M7D F;  1IRE B;  1QKX A;  2BKD N;  1SRM A;  4HVU A;  1T3L A;  2AHJ B;  3SWN A;  2X4Y A;  4KT0 E;  3CC4 A;  2XIC A;  3QJ6 A;  3QUI A;  4XU2 A;  2GTO A;  3LWH A;  3S3O A;  1N6A A;  4RTW A;  5FRN A;  2O31 A;  1C6V X;  3EGU A;  4C0D C;  2ZZD A;  1JBM A;  2AKL A;  1VQ9 A;  3M54 A;  3EG9 B;  1RAB B;  3CBP A;  1GCQ C;  4J83 A;  5FRM A;  4M7A E;  3VYG A;  4M78 F;  1QVF A;  2P4T A;  1ARK A;  3NFC A;  4X9C A;  4DQ2 A;  1VQ4 A;  1OU9 A;  1W4S A;  4OF1 A;  4OMM A;  6AT1 B;  3FEO A;  2DL7 A;  4L59 A;  1X2Q A;  4HVV A;  4X1V A;  4PLI A;  4XU3 A;  4Q5W A;  4N0A A;  5CIU A;  2HZY A;  3TQ7 P;  4N4H A;  3CC7 Q;  3TSZ A;  3QG1 A;  2QK0 A;  4EDU A;  1ABQ A;  2RQR A;  2YSQ A;  4E6R A;  2ZPE B;  1CKA A;  1MND A;  2PZ1 A;  3EFS A;  2HNI A;  2E6Z A;  5GJV B;  3CCL A;  2MIO A;  3G7Z A;  3CPF A;  3I56 T;  1ZA1 B;  2K4Y A;  5IAY A;  4J6W A;  2EKH A;  3QXE B;  2JTE A;  2ABL A;  1MUZ A;  2A3L A;  1JU5 C;  1RLP C;  2C0I A;  2M9U A;  5EG2 A;  4M7A G;  2V8K A;  1EIF A;  1KG1 A;  4DOW A;  3LH5 A;  1G2B A;  4IUR A;  5GAN e;  1GBR A;  3JB9 I;  3OW2 A;  4BY6 C;  3CME T;  1UGP B;  4PFO A;  2MPX C;  3EG2 A;  4QKU A;  1QVF S;  1YFN A;  4PFP A;  4C92 C;  1VIE A;  5KCO A;  1TXQ A;  2K5F A;  3CCS T;  3LGL A;  5IHK A;  4M77 G;  1FMW A;  2KRO A;  4B9W A;  2K79 A;  2IIM A;  3M0S A;  4Z89 A;  1G8X A;  2PVO B;  3PIO A;  1DJ7 B;  1HD3 A;  2O2O A;  2WSE E;  1TTH B;  5M9O A;  3EFR A;  1K76 A;  1AHJ B;  2YLC A;  3M9Q A;  2CS7 A;  2DL3 A;  4BDY A;  4M7A F;  3G4S A;  5ECA A;  5KYY B;  1BI3 A;  1WHG A;  3RIR A;  4JS4 A;  3PMT A;  1Q82 C;  3HRU A;  2COY A;  1OX8 A;  1D1C A;  3OYG A;  5KYU B;  3M0U A;  2KNB B;  2YRC A;  4E2F B;  1JEG A;  2O88 A;  1KD1 C;  1Z9Z A;  4OB3 B;  1S72 Q;  3L2Q A;  1Y96 B;  4DBR A;  4M77 F;  2XID A;  4EMH A;  3OYC A;  2HQH A;  1ZBJ A;  1N8R U;  1M90 R;  1TS9 A;  2X4X A;  3OW2 S;  1QVG P;  3FJP A;  2B8A A;  5HCK A;  3N5B B;  2JM8 A;  2M02 A;  3AHU A;  2XHC A;  1K8A R;  2E1H A;  2RF0 A;  3CCR T;  4M7D B;  2YUP A;  3VUB A;  3A8L B;  5A0L A;  1AWX A;  4DEY A;  1M1F A;  3OA6 A;  3VYH B;  2RJD A;  2F2X A;  1MMG A;  3H0H A;  2L3S A;  2E65 A;  1AVZ C;  4J5Y A;  2E3H A;  4DBF A;  1VQ6 A;  2EYQ A;  2JS0 A;  1YNZ A;  4M78 B;  1WA7 A;  1YJN A;  2RK2 A;  1KK7 A;  2RN8 A;  1Q81 R;  2EJG A;  1KC8 R;  4MMK A;  4KGV B;  4JZ3 A;  2MCN A;  3JCM g;  2YRD A;  1YHQ T;  4Y92 A;  1KQS P;  2RNA A;  1YCY A;  4KGZ B;  4FM4 B;  2LQW A;  1B34 B;  2ATC B;  4AG1 C;  5LJ5 d;  2KXC A;  3BE3 A;  2V26 A;  1UHF A;  3LGF A;  1N5Z A;  3QSU A;  5LL6 S;  1NBE B;  1YWP A;  2H3E B;  3A1P A;  4PJO G;  3REA B;  2JTF A;  4XU1 A;  1VA7 A;  3HL8 A;  5I11 A;  1G3T A;  2ED1 A;  2EPD A;  3BDU A;  3EGD A;  3RMQ A;  4Z88 A;  3V8K A;  2AZV A;  3F70 A;  3CD6 Q;  1JQQ A;  4C0Z A;  1UGS B;  3PGG A;  3UPU A;  1G3S A;  3CPW A;  3CCM T;  1RUW A;  2CYZ B;  4BI3 A;  2HKN A;  3GBQ A;  1PNJ A;  2AIR B;  2LJ0 A;  2K7A A;  5KE2 A;  5J26 A;  1ACM B;  2RHZ A;  3EGX A;  1FX7 A;  2FB7 A;  4MZP A;  4PJO F;  3INZ A;  3M57 A;  3BFM A;  2OTL Q;  3CC4 T;  1YIJ Q;  1B7T A;  2FZC B;  2YDL A;  2DE0 X;  3V7C A;  4IUP A;  4M7A B;  2KK4 A;  1VQ9 T;  3KFV A;  1BKB A;  2D8H A;  3DKM A;  1D09 B;  2VKN A;  3JSC A;  4XU0 A;  1T0J A;  2CT3 A;  3HP9 A;  3P8H A;  4D6W A;  4HXJ A;  3UAT A;  1BB9 A;  3O5Z A;  3VS4 A;  1PRL C;  3A8O B;  2DJZ A;  1JXO A;  4FYW B;  1VQ4 T;  1U1S A;  1VQM Q;  3OBW A;  4C8Q A;  4M7D D;  2DZC A;  2PNI A;  2GNC A;  3MEU A;  1XOV A;  3R6O A;  4M77 B;  5IHI A;  7AT1 B;  1X27 A;  4XTZ A;  1IXD A;  5GAN 4;  3SB2 A;  1M2V A;  2VV5 A;  1VUB A;  5J3B A;  2RMO A;  2HSP A;  1MMN A;  2R58 A;  2LMJ A;  2NUZ A;  1SSF A;  2MYS A;  2XMF A;  3ZFJ A;  4M78 D;  1LCK A;  2MAM A;  4J9B A;  1UGV A;  4LD6 A;  5FU7 C;  3CCL T;  2ECZ A;  1O9S A;  3GIB A;  1H3Z A;  4F14 A;  4E7H A;  1E6H A;  2RB6 A;  2CZ7 B;  3VS2 A;  2PVG B;  2DVJ A;  3C94 A;  3QDR B;  3CCV A;  2KI7 A;  4LUD A;  2NUT A;  1KD1 R;  1I5O B;  2O4X B;  4GY5 A;  4R55 A;  2A37 A;  3I5R A;  1BI0 A;  1FYN A;  1PD0 A;  1ZBX A;  1M27 C;  1HK9 A;  3LLR A;  1RAH B;  4DEX A;  1WJR A;  4M75 C;  1QCO A;  3I56 Q;  1K4U S;  3NTK A;  4AG2 C;  3CCQ A;  1ABO A;  4BE2 A;  4RMO A;  3M0Q A;  3VRY A;  5GMK e;  3X20 B;  4LDX A;  4FIB A;  3J81 E;  2C0T A;  1IB8 A;  3CCS A;  1F1B B;  2GCX A;  3M4G A;  2IPO B;  3HTR A;  5DM7 R;  1AWO A;  2CP3 A;  3QZ5 B;  3CME Q;  2FZK B;  2K9G A;  1BU1 A;  1TWB A;  3VUZ A;  2HQE A;  2QA4 T;  1BI1 A;  1RAI B;  1VQP T;  2DKG A;  5GMK h;  1AWJ A;  1I07 A;  3G4S T;  3MEV A;  1AT1 B;  3KBG A;  1RL2 A;  5DLQ E;  4GBQ A;  2GTJ A;  2HQX A;  2DL4 A;  1W2B P;  5GAM f;  2A0F B;  2LJ1 A;  2ZAE A;  4J9D A;  4QVZ A;  3ME9 A;  3GOX A;  2QXF A;  4C0G A;  3GNG A;  4CC3 A;  1PKS A;  5GAN 6;  4RUG A;  3KUF A;  2KT1 A;  4AMC A;  3L2Z A;  1OPL A;  2EAY A;  3M0T A;  3OYF A;  3OYL A;  1VQ8 Q;  4M7A D;  2R5M A;  2PTK A;  4J6X A;  2X3W D;  2XD0 A;  2GFA A;  4PJO B;  1JRI A;  4YTL A;  4IKF A;  1WHH A;  4M7D E;  3ZEH A;  2OAW A;  2YXY A;  4IIM A;  2ROT A;  2KY9 A;  2IG0 A;  4NOY A;  2DET A;  3OYN A;  1VQ6 T;  1H8K A;  1M3C A;  2F1L A;  4M77 D;  3Q1J A;  3A8H B;  1B3Q A;  3CCR Q;  1YJN T;  1QVG S;  2CP2 A;  2W0Z A;  1LNX A;  2DPP B;  1KIK A;  3QKJ A;  1NJI R;  2CP7 A;  2RHU A;  1MV0 B;  5CKH A;  2HDA A;  3H0I A;  2KEA A;  3P8D A;  1YHQ A;  2M1H A;  4J9C A;  2YUN A;  4LDY A;  2P0K A;  4F04 B;  3HSB A;  1HSQ A;  1WIE A;  1X75 C;  2PVD B;  4OMO A;  4C92 G;  3CCJ A;  3VS3 A;  1OZ2 A;  3UF4 A;  4CC2 A;  1QW1 A;  8AT1 B;  1M90 C;  3CBM A;  1M90 U;  2A7Y A;  4PL6 A;  3V7R A;  5IXB A;  4MDW A;  1K8A C;  1MNE A;  1WPY A;  1MMA A;  2NYS A;  1K8A U;  3EAE A;  1LOJ A;  1X6G A;  1RAE B;  3VS7 A;  2DD4 A;  2ENM A;  4OMP A;  2I0N A;  4KRT A;  3SWN B;  1M8V A;  1ZA2 B;  4JRK A;  1QCN A;  4RTV A;  2DEU A;  2EQK A;  2DNU A;  2GF7 A;  3C0C A;  3CBO A;  1VQ7 A;  1M3B A;  3VU3 C;  3QWY A;  5HK3 A;  2MF2 A;  3SHW A;  3MJX A;  3CMA A;  3CXC P;  1KC8 C;  1Q81 U;  1Y57 A;  1IRX A;  1UFF A;  2QGG A;  1KC8 U;  1I81 A;  3M0P A;  5CK9 A;  1V29 B;  1D0Z A;  2JMA A;  2XK0 A;  3HRS A;  3CCM Q;  2Z0W A;  2LQN A;  2CRE A;  5GAO q;  4FYX B;  5GAN d;  5CR2 A;  1FWZ A;  2CZ1 B;  4C8Q E;  2DBM A;  5L23 A;  4FW1 A;  2J7I A;  2VXE A;  2FZG B;  4EMK C;  3OQ5 A;  5GAN 3;  4HCC A;  5CCA A;  2K3X A;  2H8H A;  3TEE A;  4A63 B;  3CC4 Q;  3EG0 A;  5GJW B;  2JOY A;  1Q86 C;  2MOX A;  4C5I A;  3H0F A;  3UT1 A;  4EPC A;  1R0B G;  4JJC A;  4PJO D;  1NYF A;  1WHL A;  3L2V A;  1VQ9 Q;  3CC2 T;  1UG1 A;  3ER0 A;  2A28 A;  1J3T A;  2RA2 A;  4M77 E;  3C4S A;  2QG9 B;  1AOJ A;  2D0N A;  4QQ6 A;  5GAM e;  3J7A F;  2RQT A;  2QGF B;  1RAC B;  4JJD A;  1VQ4 Q;  4JS5 A;  2BZ8 A;  1XTD A;  4KUL A;  1BCM A;  5I21 A;  2DIG A;  5KYN A;  4C0D B;  1WZO A;  4J9E A;  3CEY A;  3O8V A;  2FRW A;  5LJ5 j;  3UWN A;  4C8Q G;  1JJ2 P;  1U06 A;  3CCV T;  4C5E A;  3AT1 B;  1FXX A;  1Q7Y R;  3ULR B;  2RI2 A;  4RKU E;  1H64 1;  3I5S A;  3JB9 G;  4L6V 5;  5LJ3 j;  2K5I A;  1PRM C;  5J39 A;  1VQN A;  2MMP A;  3CCL Q;  3RKW A;  1G3W A;  3U23 A;  1R8O B;  3FIF A;  2DEQ A;  3OMG A;  4OGE A;  4D8K A;  3CCQ T;  3PVQ A;  2E6N A;  3LYI A;  3QHS A;  4EMK A;  3JCM f;  3EG1 A;  2DIL A;  1GCQ A;  4PFZ A;  4MDX A;  1WFW A;  2P84 A;  4AFZ C;  2BE7 D;  3MP1 A;  5GAN h;  2E64 A;  2DJQ A;  3PMI A;  4C8Q F;  3IQL A;  1K73 C;  1WNL A;  2KDS A;  3R6N A;  3OS1 A;  4E7I A;  4HT8 A;  2G6F X;  4L5G A;  2WSC E;  2DTO A;  3RNJ A;  2QA4 A;  4A54 A;  1M4Z A;  2QYZ A;  4A4E A;  1VQP A;  2MWO A;  3RMS A;  5LJ5 f;  4BUG A;  1WYX A;  5GAO l;  1QMC A;  3PE0 A;  4NL3 A;  5HY6 A;  1SRL A;  1Q82 U;  1AZE A;  5FU6 B;  2O9S A;  1U1T A;  4HCB A;  5LJ3 f;  1WXT A;  4K11 A;  2YLB A;  4E47 A;  1VQK A;  1KD1 U;  1VYU A;  5I22 A;  4FT4 A;  1Q95 G;  4RG2 A;  1VQP Q;  4DBH A;  1OQK A;  1OYX A;  4IIO A;  2RD1 A;  3G4S Q;  2JW4 A;  2DER A;  3MP8 A;  2WAC A;  2OJ2 A;  1YJ9 A;  4J6Y A;  1UEC A;  5CKB A;  3QPH A;  4MZT A;  4M78 C;  1I1J A;  1WJQ A;  3QDF A;  1CKB A;  1I0C A;  1W2B S;  1BCO A;  2EYW A;  1NM7 A;  1IO6 A;  5IXF A;  5GAN 7;  1VOM A;  4PJO E;  1XQH A;  4OVA A;  1VQO A;  4ELZ C;  4C92 A;  2RJC A;  3JB9 H;  3KXT A;  1IHW A;  1UHC A;  2VWF A;  5KYW A;  1WLP B;  2LNH B;  5A2Q E;  2ZPG B;  3RKX A;  2EJ9 A;  4ZGD B;  2X35 A;  2QTV A;  3VS6 A;  1S1N A;  4J9I A;  4FU6 A;  3C12 A;  2DL5 A;  1R77 A;  1K0S A;  2V1Q A;  2G3R A;  2DXT A;  1VQ6 Q;  2LX7 A;  4M75 G;  3EGD B;  4LE9 A;  1K1Z A;  3CCJ T;  1QLY A;  2EYZ A;  3CCE A;  3LW5 E;  1YJN Q;  1XNI A;  2RH2 A;  3NPF A;  2KYM A;  3H9N A;  1UDL A;  2DZ9 A;  1WHM A;  5GAO p;  2GFU A;  1QP2 A;  4E7S A;  5LJ5 g;  4B9X A;  5C0M A;  2HBW A;  4WF2 A;  1IGU A;  4R0K A;  4FL6 A;  2L5Q A;  4LDU A;  1Q86 R;  1BK2 A;  3WVD B;  5KE3 A;  5IH2 A;  1ZQ1 A;  1KHC A;  3EGX B;  4R56 A;  2AKK A;  1D3B A;  5LJ3 g;  1OPK A;  5HK0 A;  4O5V A;  2Y4X A;  1BBZ A;  4MZM A;  2KSS A;  2AT1 B;  2E70 A;  4Y28 E;  3M58 A;  4GLM A;  4N4G A;  1FMK A;  2P0Q A;  2K6D A;  3REB B;  1VQ7 T;  2KRN A;  4M7A C;  4PKC C;  3CMA T;  2FEI A;  4BD3 A;  3M56 A;  1NJI C;  2EJF A;  5I2M A;  2RK1 A;  4JUV A;  1Y7X A;  3JCM P;  3UA7 A;  1LPL A;  2JM9 A;  1WXB A;  3DB4 A;  2WSF E;  4C8Q B;  3CQT A;  2LQ8 A;  1IZ6 A;  2YHT A;  1X01 A;  1YIT A;  1EZZ B;  1B07 A;  1YCS B;  1C1A A;  2YRV A;  1P92 A;  4OMF B;  2K3Y A;  3JCM e;  1M2V B;  3CXC S;  3EG3 A;  1K9M C;  1I8F A;  2HAX A;  4RTX A;  4F7U A;  4MML A;  3HPW A;  4ZTF A;  3ZL7 C;  3RER A;  4JRQ A;  1ZSG A;  3HRT A;  2M16 A;  4NS5 A;  1NG2 A;  2DXB A;  2EIF A;  2CH4 W;  3A5Z B;  2KQW A;  3EFO A;  1SKU B;  3CC2 A;  1LJO A;  3MEW A;  1ZSZ C;  2NUT B;  3OYD A;  2RI3 A;  1K73 R;  4JRP A;  1ZUK A;  1TU0 B;  4HA8 A;  3G6E A;  1NEB A;  2RM4 A;  1MGQ A;  2JNG A;  1N27 A;  5D6X A;  5LJ3 e;  1UGR B;  1G83 A;  1YI2 A;  4CC4 B;  5FLX E;  5CAI A;  2HL5 C;  2E3I A;  5CKF A;  4IUT A;  1TG0 A;  2VGN A;  1WGS A;  4OB2 B;  3OB9 A;  1EFN A;  4HCK A;  4II1 A;  2QAZ A;  4ZNX A;  1QVF P;  1VQN T;  2KYB A;  4KH0 B;  1K9A A;  2QTX A;  2DK3 A;  2LCS A;  5GAN 8;  2K3B A;  2EWN A;  2JJ9 A;  2J05 A;  3CCV Q;  2JTM A;  2QQB A;  1JJ2 S;  1NEG A;  4XTU A;  2Y4Y A;  2VUB A;  1IHV A;  1NLO C;  2RI5 A;  1N8R R;  4FSS A;  4M4Z A;  1RI0 A;  1D1A A;  1NE8 A;  3X25 B;  2CH4 A;  2L0A A;  1G5V A;  3CCU A;  3SEM A;  3OYK A;  4KBM B;  4ZTJ A;  1TH7 A;  2JT4 A;  1RAF B;  1U5S A;  1QVG A;  3CCQ Q;  1AEY A;  2L3R A;  3E9F A;  2EYY A;  1V1C A;  2DXU A;  1ZSZ A;  3CCS Q;  2EBP A;  4C0F A;  3PIP A;  1HJD A;  1O75 A;  2LX9 A;  1RAD B;  5GAN j;  2YT6 A;  2A36 A;  2YUO A;  4JLG A;  4PLL A;  4JDS A;  2R57 A;  4IUU A;  4WTO B;  4HT9 A;  1VQK T;  4M75 B;  1Q7Y C;  3MO8 A;  2XKO C;  4QT7 A;  2P0P A;  3OW2 P;  1Q7Y U;  3G71 A;  1SSH A;  4C5H A;  4WCI A;  4C8Q D;  1Y0M A;  4E7J A;  4AFU C;  1YJ9 T;  4C92 E;  2F5K A;  4AFQ C;  3JCM W;  5D6Y A;  1Y07 A;  4ORZ A;  1UB4 A;  4ELY C;  3BW1 A;  1KQS A;  3M55 A;  2RHI A;  1HXD A;  2ROL A;  4ZN1 A;  3OSS C;  1PC0 A;  5KYX A;  2GQV A;  4M75 A;  2E5Q A;  1VQO T;  2DX1 A;  3VV0 A;  3I9Q A;  1EX4 A;  5IN1 A;  5I2S A;  4DA4 A;  2ZPB B;  4QQG A;  1MMD A;  3H6Z A;  2PUO B;  4XQ3 A;  2KR3 A;  2XU8 A;  4BAC A;  3FB9 A;  2K57 A;  2A08 A;  3OYI A;  2NWM A;  2E5K A;  4BE1 A;  3V8J A;  3MET A;  3NGP A;  2SEM A;  3JB9 J;  5IT9 E;  4D8D A;  2ZGW A;  1PD1 A;  5AT1 B;  2BIV A;  2JXB A;  2XI9 A;  1UE9 A;  3CCE T;  3LH0 A;  3SWN C;  4HKE A;  2EW3 A;  2GQI A;  2DA9 A;  2D1X A;  1I5L A;  4Y91 A;  2CGH A;  1MHN A;  3S3M A;  1VQL A;  1KQ2 A;  2BZY A;  5DY9 A;  3L1A A;  3QII A;  3OS0 A;  2QQR A;  1K9M R;  3OYB A;  1YHQ Q;  1IGQ A;  2VB6 A;  1BIB A;  3EHQ A;  1R0C B;  4LDW A;  4FCY A;  2LCL A;  3I55 A;  3CCJ Q;  2XDD A;  1KQS S;  3E1S A;  2HCK A;  5CQX A;  4HCZ A;  1M1K C;  1SEM A;  3RBB B;  5GAM d;  1OEB A;  3EH2 A;  4J8O A;  1NZ9 A;  4UC4 A;  4TVR A;  4AT1 B;  1MV3 A;  1VQ5 A;  2QEX A;  2EKO A;  5IHN A;  4N0A C;  4C92 F;  1KHI A;  1Z9Q A;  2D0Q B;  2CKK A;  1ZHI A;  3OMC A;  1GXI E;  2CSI A;  4X9D A;  1QQJ A;  4Z02 A;  2RHX A;  2OI3 A;  2HBP A;  3OS2 A;  2AK5 A;  1UJY A;  2M0O A;  1YJW A;  2C06 A;  3PT9 A;  4OMQ A;  2O01 E;  3GP8 A;  1GBQ A;  4M78 G;  5EC7 A;  1N9S A;  2DO3 A;  4F17 A;  1VQ7 Q;  4VUB A;  1YIT T;  2LNV A;  2AZS A;  2FHD A;  3CMA Q;  3THK A;  4XTW A;  2D6F A;  3OSV A;  2DTI A;  2BTT A;  4KH1 B;  4LUE A;  4RTT A;  5GAN g;  1UEB A;  3P8B B;  1KQ1 A;  4FW2 A;  2L89 A;  2FPF A;  2EQU A;  1M9S A;  2L3P A;  4QQD A;  1SHG A;  3WXM B;  3RDV A;  1QWE A;  1SHF A;  2XDP A;  3OYY A;  2RQU A;  1VQM T;  4RCB A;  2H3J A;  3PTA A;  4EMG A;  1VIF A;  1Q86 U;  2KVQ G;  5A0D A;  2KT8 A;  4RTU A;  3JCM c;  8ATC B;  2BZX A;  3CPW P;  2YWW A;  3FDR A;  1X43 A;  2CT4 A;  3URG A;  3I35 A;  1NPR A;  1TUC A;  1JXM A;  3CC7 A;  2ZPI B;  3A8M B;  5KCH A;  1GRI A;  3G6E T;  2L3Q A;  2DVE A;  5GAN 2;  3LX7 A;  2NLU A;  2NUP B;  2LZ6 B;  1E7O A;  4F7U G;  2CDT A;  2COZ A;  1T3S A;  3TCJ A;  1YI2 T;  1H3H A;  2M0Y A;  2XG8 D;  3DB3 A;  4EMK B;  3OYE A;  3EG9 A;  1XJW B;  3NTH A;  5GAM h;  2FRY A;  4ZGJ B;  4PJN A;  2HD0 A;  2SRC A;  3SD4 A;  5GAN 5;  2CUD A;  3MHX A;  4CRI A;  5D6W A;  5CO7 A;  2LRQ A;  2LTO A;  2VXF A;  3TSW A;  2VC8 A;  2LVM A;  3S6W A;  2NUP A;  1OZ3 A;  4DOV A;  3OYA A;  2EGA A;  2J6O A;  1YP5 A;  1W2B A;  1OV3 A;  1U3O A;  2W10 A;  5AYF A;  1KFZ A;  5KH6 A;  3ASK A;  4F7U F;  2ZCF B;  4RTZ A;  1D1B A;  1X6O A;  5FU6 C;  2O9V A;  3JCM J;  1D0Y A;  5GMK m;  1VQN Q;  1BIA A;  3CCU T;  4ATO A;  2R5A A;  1K73 U;  4A4F A;  4V2S A;  4OB1 B;  3OYM A;  2RJF A;  1UJ0 A;  3JB9 F;  1X69 A;  4A4H A;  3QWX X;  4AFS C;  1WQ7 A;  1H92 A;  5DLO A;  2E10 A;  3JV3 A;  4F16 A;  3M5A A;  4M7D C;  2K2M A;  2F2V A;  4OMN A;  1OI1 A;  3C95 A;  4BY6 B;  4PK4 A;  1S72 A;  4ZGE B;  2QA4 Q;  3GNF B;  4QW2 A;  5GMK j;  3G71 T;  4XTY A;  4C92 B;  3OY9 A;  4M75 E;  1PWT A;  1RAA B;  3TU4 K;  2RQV A;  2KAF A;  3QBY A;  5KYW B;  1VQ8 T;  2MI6 A;  1QWF A;  2B86 A;  3VRZ A;  4ZN3 A;  1OX9 A;  4PJJ A;  1FMV A;  2EGC A;  1K0X A;  3L2R A;  2FO0 A;  5GAO n;  1Y71 A;  1VQK Q;  1AWW A;  3FJ5 A;  3VS1 A;  2ZPF B;  3HHT B;  3UA6 A;  2L8D A;  3JCM X;  1M8M A;  1N8R C;  1GCP A;  1M1K R;  5KYY A;  1YJ9 Q;  4A53 A;  1M2O A;  2DXC A;  2HKQ B;  5GAO r;  2OTJ T;  1I4K 1;  3QJY A;  2PQW A;  5CVI A;  1ZLM A;  5KYU A;  1WI7 A;  2K2V A;  3NMZ C;  1TSF A;  1WHJ A;  2F69 A;  1PKT A;  1Y96 A;  2OAU A;  1VQO Q;  2DM1 A;  2ESW A;  2LT4 A;  4XTV A;  3X28 B;  3GF5 A;  4E7L A;  5C6S A;  1M3A A;  3H41 A;  2DFU A;  1D3B B;  2RHY A;  2X51 A;  1ZUU A;  3JCM d;  4J9G A;  4M7D A;  3VS5 A;  2E12 A;  3E19 A;  1W70 A;  3QZ9 B;  3VJP A;  1VQL T;  3CXC A;  4RTY A;  2CP0 A;  2V8J A;  2PU9 B;  2QDY B;  1ZUY A;  4NL2 A;  4OML A;  4PJL A;  3I55 T;  1YBY A;  2QQ9 A;  4J7I A;  4PJM A;  1T0H A;  2M51 A;  3CCE Q;  2LJ3 A;  4LXC A;  1PSE A;  4M78 A;  3CD6 A;  3FRN A;  1W1F A;  1RAG B;  2CZ6 B;  2E41 A;  1QP3 A;  4C8Q C;  2KRS A;  2JZ2 A;  4XTX A;  1VQ5 T;  4M75 F;  2QI2 A;  2QEX T;  2JS2 A;  3MKD A;  5LJ3 d;  1D0X A;  2X4W A;  3JRZ A;  3SDZ A;  3FLG A;  3SFM A;  1X6B A;  2RJE A;  4ANJ A;  3QYG B;  4QVC A;  3S3N A;  1NJI U;  1B34 A;  2KGT A;  4F7U B;  4JPB W;  1YJW T;  2X3X D;  2MWP A;  2OTL A;  4FSX A;  1YIJ A;  2CP6 A;  1M5Q 1;  2VVK A;  1UTI A;  3EFO B;  4M77 C;  3JCM V;  2K5L A;  3L42 A;  4B6M A;  3BDL A;  3M0R A;  4JLI A;  2LQK A;  3V8L A;  2V1R A;  2IVW A;  4C92 D;  1NPP A;  2LP5 A;  3L2U A;  1TOV A;  4P5N A;  1K9M U;  1CSK A;  4RG8 A;  3X24 B;  2RQW A;  1VQM A;  3HKS A;  1VYV A;  1JJ2 A;  3RKY A;  3MCA B;  1GL5 A;  3MP6 A;  1YIT Q;  2HEQ A;  2P4R A;  4ME7 A;  2MK5 A;  2FL7 A;  4OP0 A;  3V7S A;  4EIK A;  4LDV A;  3JCM h;  5LJ5 e;  4KUD K;  4FYV B;  3E9G A;  4BI4 A;  2F5T X;  4N4I A;  3CC7 T;  3X26 B;  5GMK l;  5HKC A;  2COW A;  1GFC A;  1LVK A;  3H8Z A;  2KE9 A;  2DYB A;  2DD5 A;  5A0G A;  2X4J A;  4J9F A;  2DRM A;  3HFO A;  2JUF A;  3DLM A;  3CC2 Q;  4M7A A;  5LJ5 h;  3A98 A;  3L2W A;  1TUD A;  3TVT A;  2J06 A;  3CPW S;  5CKE A;  4JJN K;  4XAX B;  1NYG A;  2DBK A;  1X2K A;  3G6E Q;  3VS0 A;  2EVR A;  1M30 A;  4X34 A;  2OX7 A;  1PCX A;  3GLX A;  5LJ3 h;  4LN2 A;  2RPN A;  5FWC A;  2LDM A;  4XK8 E;  2JVV A;  2KXD A;  4IUQ A;  1YI2 Q;  1Q82 R;  2EFI A;  1SPK A;  4A4K A;  3NHN A;  2FPE A;  3I56 A;  2Y90 A;  4M77 A;  1TUG B;  2GGR A;  4FYY B;  1ZSZ B;  2FYK A;  5GAM j;  3EH1 A;  3GPL A;  1G3Y A;  2ED0 A;  1KJW A;  2EGE A;  1PG5 B;  2CSQ A;  1V76 A;  4ESR A; 
#chains in the Genus database with same CATH homology
 3FIF A;  2DEQ A;  3LGF A;  3I55 A;  3A8G B;  3OMG A;  4OGE A;  2XDD A;  5LL6 S;  2ZPH B;  3CCQ T;  1KQS S;  3QSU A;  3E1S A;  2E6N A;  3LYI A;  4PJO G;  3QHS A;  4EMK A;  3JCM f;  5CQX A;  1PSF A;  3CME A;  4HCZ A;  2JTF A;  3QYH B;  1M1K C;  4XU1 A;  3HL8 A;  4MDX A;  5FU7 B;  1G3T A;  5GAM d;  4KUI A;  4FT2 A;  4J8O A;  1NZ9 A;  3BDU A;  2VGM A;  4UC4 A;  3MP1 A;  3RMQ A;  4TVR A;  4C5G A;  5GAN h;  1VQ5 A;  2E64 A;  3V8K A;  2QEX A;  2EKO A;  2LCC A;  3PMI A;  4C8Q F;  2V8I A;  3F70 A;  4N0A C;  4C92 F;  1K73 C;  4QVD A;  1KHI A;  2D0Q B;  1WNL A;  2KDS A;  2CKK A;  1ZHI A;  3OMC A;  4C0Z A;  3OS1 A;  4E7I A;  1UGS B;  1GXI E;  2O4X A;  3PGG A;  4HT8 A;  3ZBD A;  1U8R A;  4L5G A;  2WSC E;  2DTO A;  3UPU A;  2QA4 A;  4A54 A;  1M4Z A;  1G3S A;  4A4E A;  4X9D A;  4Z02 A;  3CPW A;  3CCM T;  1VQP A;  2MWO A;  4PJO C;  3RMS A;  5LJ5 f;  2RHX A;  2PUK B;  3OBY A;  4IUV A;  2CYZ B;  4BI3 A;  2HBP A;  4BUG A;  3OS2 A;  2M0O A;  1YJW A;  5GAO l;  2C06 A;  3PT9 A;  4NL3 A;  1S72 T;  5HY6 A;  4PNO A;  2O01 E;  3GP8 A;  2VYT A;  3PFS A;  1WJS A;  5L8R E;  1Q82 U;  4M78 G;  5KE2 A;  5J26 A;  1N9S A;  2DO3 A;  5FU6 B;  1N9R A;  1U1T A;  2RHZ A;  4BE0 A;  3J80 E;  4HCB A;  1FX7 A;  5LJ3 f;  2FB7 A;  4MZP A;  4VUB A;  4PJO F;  1YIT T;  2LNV A;  3INZ A;  2FHD A;  3BFM A;  3M57 A;  3CC4 T;  2YLB A;  4XTW A;  4O6J A;  2D6F A;  3OSV A;  4E47 A;  1VQK A;  1KD1 U;  1VQ8 A;  4FT4 A;  4RG2 A;  2DTI A;  3V7C A;  1OYX A;  2RD1 A;  5GAN g;  2DTH A;  1UEB A;  3P8B B;  1KQ1 A;  3MP8 A;  2RO0 A;  2WAC A;  2L89 A;  3JB9 D;  4RCC A;  4IUP A;  1YJ9 A;  4J6Y A;  2EQU A;  4M7A B;  1M9S A;  4QQD A;  5CKB A;  1QVP A;  2KK4 A;  3QPH A;  1VQ9 T;  3WXM B;  4MZT A;  4M78 C;  1WQW A;  2XDP A;  3OYY A;  1WJQ A;  1BKB A;  1VQM T;  4RCB A;  3QO3 A;  3DKM A;  4BDZ A;  2H3J A;  3PTA A;  4EMG A;  3JSC A;  1VIF A;  4XU0 A;  3FC3 A;  2KVQ G;  5A0D A;  1W2B S;  3HP9 A;  1Q86 U;  3JCM c;  2EQM A;  4OB0 B;  3P8H A;  4D6W A;  5GAN 7;  3OYH A;  2BUD A;  4E7K A;  4GLK A;  4PJO E;  2EQJ A;  4CI0 C;  1XQH A;  3FDR A;  4OVA A;  3A8O B;  2DJZ A;  3MEA A;  1JB0 E;  1VQ4 T;  1U1S A;  2OTJ A;  2QQS A;  3OBW A;  3URG A;  3CCR A;  4A4G A;  5GAN f;  1VQO A;  2D9T A;  1NPR A;  4C8Q A;  3VKI A;  4ELZ C;  4C92 A;  3CC7 A;  2DZC A;  2RJC A;  2ZPI B;  4M7D D;  3A8M B;  3JB9 H;  5KCH A;  5GMK i;  3MEU A;  1XOV A;  3R6O A;  4JRI A;  4M77 B;  3TRE A;  3KXT A;  3G6E T;  2DVE A;  3M59 A;  5GAN 2;  4J7F A;  3LX7 A;  2NLU A;  5A2Q E;  4XTZ A;  2ZPG B;  3M4Y A;  4F7U G;  5GAN 4;  3SB2 A;  2VV5 A;  3TCJ A;  1VUB A;  2FVU A;  2LC4 A;  5J3B A;  3RKX A;  5CKD A;  2EJ9 A;  1YI2 T;  4ZGD B;  2X35 A;  2XDB A;  2R58 A;  3HFN A;  3BY7 A;  1SSF A;  5CQY A;  2XG8 D;  3DB3 A;  1M1G A;  4EMK B;  3OYE A;  4FU6 A;  3C12 A;  5GAO m;  3ZFJ A;  4M78 D;  4PJO A;  2MAM A;  3NTI A;  5FU7 C;  4LD6 A;  3NTH A;  3CCL T;  2G3R A;  1O9S A;  2DXT A;  4M78 E;  3WVE B;  4ZGJ B;  5GAM h;  1H3Z A;  4E7H A;  4M75 G;  2RB6 A;  2HD0 A;  2CZ7 B;  1UGQ B;  2PVG B;  3SD4 A;  5GAN 5;  3LWI A;  3MHX A;  4CRI A;  3CCJ T;  5D6W A;  3CCE A;  1BYM A;  3C94 A;  2DAQ A;  3LW5 E;  5CO7 A;  3QDR B;  2LRQ A;  2LTO A;  3CCV A;  2VXF A;  1XNI A;  2LT1 A;  2LVM A;  2RH2 A;  2VC8 A;  3S6W A;  2JN0 A;  2O4X B;  4GY5 A;  4R55 A;  3UDC A;  1OZ3 A;  4DOV A;  3OYA A;  2DZ9 A;  3RUX A;  1BI0 A;  5GAO p;  1ZBX A;  1W2B A;  2GFU A;  3OYJ A;  1QP2 A;  1HK9 A;  5LJ5 g;  4B9X A;  5C0M A;  4WF2 A;  3LLR A;  2KMT A;  3CD6 T;  5AYF A;  5KH6 A;  3ASK A;  4FL6 A;  2L5Q A;  4F7U F;  2ZCF B;  1WJR A;  4M75 C;  4LDU A;  1M1K U;  1X6O A;  3WVD B;  5KE3 A;  2QQA A;  5FU6 C;  3NTK A;  1ZQ1 A;  3JCM J;  3CCQ A;  1KHC A;  4BI8 B;  4RMO A;  4BE2 A;  4M7D G;  5GMK e;  4R56 A;  3X20 B;  5GMK m;  1D3B A;  4LDX A;  4FIB A;  5LJ3 g;  1BIA A;  3CCU T;  3J81 E;  4LD9 K;  5HK0 A;  4O5V A;  3T9N A;  2Y4X A;  3JCM Q;  3RES A;  3CCS A;  4ATO A;  5GAM g;  2R5A A;  1K73 U;  2GCX A;  4MZM A;  4A4F A;  2KSS A;  3M4G A;  5DM7 R;  2E70 A;  4Y28 E;  3M58 A;  4N4G A;  2P0Q A;  3QZ5 B;  1VQ7 T;  4V2S A;  3PNW C;  2I2L A;  3JAM E;  4OB1 B;  3OYM A;  2RJF A;  4M7A C;  3JB9 F;  2OTL T;  4PKC C;  4A4H A;  3CMA T;  3VUZ A;  2HQE A;  2QA4 T;  4BD3 A;  1WQ7 A;  1YIJ T;  1BI1 A;  4F7U E;  5DLO A;  2E10 A;  3M56 A;  1VQP T;  1NJI C;  2DKG A;  5GMK h;  3M5A A;  3CCM A;  4M7D C;  3G4S T;  2EJF A;  5I2M A;  3MEV A;  2RK1 A;  3KBG A;  1OI1 A;  1RL2 A;  4JUV A;  5DLQ E;  3M53 A;  3C95 A;  3DLL A;  1Y7X A;  4BY6 B;  3JCM P;  1Q81 C;  2CZ0 B;  1S72 A;  2HQX A;  4ZGE B;  5GAM f;  4OGC A;  3DB4 A;  3GNF B;  2DIQ A;  1BI2 A;  2WSF E;  4QW2 A;  4C8Q B;  5GMK j;  3G71 T;  4M75 D;  4XTY A;  2LQ8 A;  4C92 B;  3OS5 A;  3OY9 A;  1IZ6 A;  4QVZ A;  2YHT A;  4M75 E;  3ME9 A;  4BB7 A;  3GOX A;  5FRO A;  3TU4 K;  3JCM b;  1X01 A;  2QXF A;  1IRE B;  1YIT A;  4M7D F;  2BKD N;  2AHJ B;  3SWN A;  2X4Y A;  2KAF A;  3GNG A;  2XIC A;  3QBY A;  4KT0 E;  4C0G A;  5GAN 6;  3CC4 A;  1VQ8 T;  3QJ6 A;  2MI6 A;  3QUI A;  4XU2 A;  3LWH A;  3S3O A;  2YRV A;  4ZN3 A;  1N6A A;  1P92 A;  4OMF B;  2K3Y A;  3KUF A;  3JCM e;  3CXC S;  5FRN A;  1K9M C;  3L2Z A;  2EAY A;  1I8F A;  3L2R A;  2HAX A;  4C0D C;  4F7U A;  5GAO n;  2ZZD A;  1Y71 A;  4MML A;  1JBM A;  3HPW A;  4ZTF A;  1VQ9 A;  3OYF A;  3M54 A;  3OYL A;  4M7A D;  3CBP A;  2R5M A;  2ZPF B;  3HHT B;  4J83 A;  2L8D A;  3JCM X;  5FRM A;  1N8R C;  4J6X A;  3RER A;  4JRQ A;  2XD0 A;  3HRT A;  2GFA A;  2M16 A;  4M7A E;  4PJO B;  1JRI A;  4YTL A;  4NS5 A;  3VYG A;  4IKF A;  4M78 F;  3GIB A;  2DXB A;  1QVF A;  2P4T A;  3NFC A;  4A53 A;  2EIF A;  4M7D E;  3A5Z B;  4X9C A;  2KQW A;  3ZEH A;  4DQ2 A;  2DXC A;  5GAO r;  3CC2 A;  2OTJ T;  1I4K 1;  3QJY A;  1VQ4 A;  2PQW A;  5CVI A;  1LJO A;  3MEW A;  1W4S A;  3OYD A;  2RI3 A;  4OF1 A;  2KY9 A;  2IG0 A;  4NOY A;  2K2V A;  4JRP A;  3FEO A;  3OYN A;  4L59 A;  1VQ6 T;  4HA8 A;  2F69 A;  4PLI A;  4Q5W A;  4XU3 A;  3G6E A;  4N0A A;  2RM4 A;  4M77 D;  5CIU A;  3Q1J A;  3A8H B;  1MGQ A;  2JNG A;  1Y96 A;  1N27 A;  2OAU A;  5D6X A;  5LJ3 e;  4N4H A;  1YJN T;  1QVG S;  1LNX A;  1UGR B;  2LT4 A;  2DPP B;  1YI2 A;  4XTV A;  5FLX E;  3X28 B;  3QKJ A;  3GF5 A;  5CAI A;  3QG1 A;  5C6S A;  4E7L A;  4EDU A;  2RHU A;  5CKF A;  4IUT A;  1D3B B;  2RHY A;  2VGN A;  1WGS A;  5CKH A;  2ZPE B;  3JCM d;  3EFS A;  4OB2 B;  3P8D A;  1YHQ A;  2HNI A;  4M7D A;  2E6Z A;  2M1H A;  3CCL A;  3OB9 A;  2E12 A;  3E19 A;  3G7Z A;  4II1 A;  3CPF A;  2P0K A;  3QZ9 B;  4LDY A;  3VJP A;  3I56 T;  3CXC A;  1VQL T;  3HSB A;  1X75 C;  3CCJ A;  2PVD B;  4C92 G;  2K4Y A;  5IAY A;  1OZ2 A;  4J6W A;  2V8J A;  1VQN T;  3QXE B;  2PU9 B;  2A3L A;  2QDY B;  2M9U A;  4NL2 A;  1QW1 A;  5EG2 A;  4M7A G;  2V8K A;  1EIF A;  1M90 C;  1KG1 A;  2QTX A;  2DK3 A;  3CBM A;  3I55 T;  1YBY A;  2QQ9 A;  4J7I A;  1M90 U;  2A7Y A;  4PL6 A;  3V7R A;  4DOW A;  4IUR A;  5GAN e;  2EWN A;  5GAN 8;  4MDW A;  3JB9 I;  3OW2 A;  4BY6 C;  3CME T;  1PSE A;  1K8A C;  1UGP B;  4M78 A;  3CD6 A;  3FRN A;  1WPY A;  2JTM A;  2QQB A;  1K8A U;  3EAE A;  1JJ2 S;  2CZ6 B;  4XTU A;  2E41 A;  1LOJ A;  2Y4Y A;  2VUB A;  1QP3 A;  2RI5 A;  4C8Q C;  1QVF S;  4C92 C;  2JZ2 A;  4XTX A;  1VQ5 T;  2DD4 A;  4M75 F;  1RI0 A;  1NE8 A;  1VIE A;  2QI2 A;  3X25 B;  2QEX T;  1G5V A;  3SWN B;  5LJ3 d;  5KCO A;  1M8V A;  2K5F A;  3CCS T;  3CCU A;  2X4W A;  3JRZ A;  3LGL A;  3FLG A;  3SDZ A;  4JRK A;  3OYK A;  4KBM B;  4ZTJ A;  1TH7 A;  4M77 G;  3SFM A;  2EQK A;  2RJE A;  1QVG A;  2GF7 A;  4B9W A;  3QYG B;  2PVO B;  3CBO A;  3PIO A;  2L3R A;  3E9F A;  4QVC A;  3S3N A;  1VQ7 A;  3VU3 C;  1NJI U;  1B34 A;  4F7U B;  5HK3 A;  1YJW T;  1DJ7 B;  2DXU A;  2MF2 A;  2WSE E;  2MWP A;  2OTL A;  3CMA A;  4C0F A;  5M9O A;  4FSX A;  3PIP A;  1O75 A;  2YLC A;  1AHJ B;  3EFR A;  1YIJ A;  1Q81 U;  3M9Q A;  2CS7 A;  2LX9 A;  4BDY A;  1KC8 C;  5GAN j;  1M5Q 1;  4M7A F;  1KC8 U;  1I81 A;  5CK9 A;  3G4S A;  4JLG A;  1BI3 A;  4PLL A;  1V29 B;  4JDS A;  2R57 A;  4IUU A;  3RIR A;  3PMT A;  4JS4 A;  1Q82 C;  4M77 C;  4HT9 A;  3HRU A;  2XK0 A;  1VQK T;  3HRS A;  4M75 B;  3JCM V;  1Q7Y C;  2K5L A;  3MO8 A;  2XKO C;  2P0P A;  3L42 A;  3OYG A;  1Q7Y U;  3BDL A;  4JLI A;  3G71 A;  2LQK A;  4C5H A;  3V8L A;  5GAO q;  4C8Q D;  4E7J A;  5GAN d;  2IVW A;  4C92 D;  1NPP A;  1FWZ A;  5CR2 A;  3L2U A;  2CZ1 B;  4C8Q E;  1KD1 C;  1YJ9 T;  4C92 E;  4OB3 B;  2F5K A;  4P5N A;  1K9M U;  3L2Q A;  1Y96 B;  2VXE A;  4EMK C;  4RG8 A;  4M77 F;  3OQ5 A;  3X24 B;  3JCM W;  2XID A;  5D6Y A;  1Y07 A;  5GAN 3;  1UB4 A;  1VQM A;  4EMH A;  4HCC A;  3HKS A;  1JJ2 A;  3OYC A;  5CCA A;  3RKY A;  3MCA B;  2K3X A;  3MP6 A;  4ELY C;  1N8R U;  3TEE A;  2X4X A;  3BW1 A;  4ME7 A;  3M55 A;  2RHI A;  1KQS A;  3OW2 S;  4OP0 A;  2FL7 A;  3V7S A;  3FJP A;  1HXD A;  4LDV A;  2B8A A;  3AHU A;  2JOY A;  3N5B B;  3OSS C;  4ZN1 A;  4C5I A;  1Q86 C;  2XHC A;  2GQV A;  3UT1 A;  3JCM h;  5LJ5 e;  4M75 A;  2E5Q A;  2E1H A;  3CCR T;  4KUD K;  3E9G A;  4BI4 A;  2F5T X;  4EPC A;  1VQO T;  4M7D B;  4N4I A;  3VV0 A;  3X26 B;  3CC7 T;  5IN1 A;  4PJO D;  5GMK l;  5I2S A;  5HKC A;  4DA4 A;  2ZPB B;  3VUB A;  3A8L B;  5A0L A;  4QQG A;  3L2V A;  3CC2 T;  3H8Z A;  3H6Z A;  3ER0 A;  2PUO B;  1M1F A;  4XQ3 A;  3OA6 A;  3VYH B;  2XU8 A;  2RJD A;  2DD5 A;  4BAC A;  2RA2 A;  4M77 E;  3FB9 A;  5A0G A;  2X4J A;  2E65 A;  2K57 A;  3C4S A;  3OYI A;  4J5Y A;  3HFO A;  4QQ6 A;  5GAM e;  4BE1 A;  3J7A F;  3V8J A;  2JUF A;  1VQ6 A;  3MET A;  2EYQ A;  3DLM A;  3JB9 J;  4M7A A;  5LJ5 h;  5IT9 E;  2ZGW A;  3L2W A;  4M78 B;  4JS5 A;  1XTD A;  1YJN A;  4KUL A;  2RK2 A;  3CPW S;  5CKE A;  5I21 A;  4JJN K;  4XAX B;  2DIG A;  2EJG A;  2BIV A;  4C0D B;  2XI9 A;  3CEY A;  3O8V A;  4MMK A;  4X34 A;  5LJ5 j;  3UWN A;  4C8Q G;  3GLX A;  3LH0 A;  3CCE T;  5LJ3 h;  3SWN C;  3JCM g;  3CCV T;  4HKE A;  4C5E A;  1YHQ T;  1FXX A;  2LDM A;  4XK8 E;  2JVV A;  4IUQ A;  1YCY A;  2EFI A;  4FM4 B;  2RI2 A;  1I5L A;  4Y91 A;  4A4K A;  2CGH A;  1MHN A;  3S3M A;  3I56 A;  2Y90 A;  1VQL A;  1KQ2 A;  4RKU E;  4M77 A;  5DY9 A;  3L1A A;  1H64 1;  1B34 B;  3QII A;  3JB9 G;  4L6V 5;  5LJ3 j;  2K5I A;  2QQR A;  3OS0 A;  5J39 A;  5LJ5 d;  1VQN A;  2FYK A;  3OYB A;  2MMP A;  1BIB A;  5GAM j;  3GPL A;  1G3Y A;  3RKW A;  1G3W A;  4LDW A;  1R8O B;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...