1W70A

Sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
LIKHMRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w70A00
1KSWA 1H3HA 1UHCA 2RPNA 2JXBA 1UJ0A 4K11A 1BU1A 1VYTA 2VVKA 1M27C 2AZVA 4Y92A 1RUWA 1AWJA 1SPKA 1X27A 2KBTA 2OI3A 1N5ZA 1LCKA 1YWPA 2L3PA 1ZX6A 2EGAA 3NHNA 3EG2A 2LCSA 2DL5A 3REBB 4JPBW 2YSQA 1SHFA 1NEBA 3EHQA 4QT7A 2EBPA 3NGPA 2EYZA 5GJVB 1NYGA 4FSSA 2HSPA 4J9EA 2D1XA 2C0TA 2KT8A 2RQWA 1NEGA 2CT4A 4KRTA 2QDLA 3FJ5A 5ECAA 4Z8AA 2JT4A 1PNJA 2DL4A 2ABLA 3VS0A 5I22A 1YN8A 2EYWA 2DX1A 2EYYA 1VYUA 2DBMA 4CC2A 1ZLMA 1AEYA 1SRLA 1GCPA 3I5SA 4ZNXA 2O9VA 4M4ZA 4HVVA 1ZSGA 2KRMA 1QCFA 1T3SA 2SEMA 4A63B 2KRNA 2LQWA 4J9FA 1H92A 1UDLA 4ESRA 1E6HA 4RTYA 1ABQA 4R0KA 3VS6A 1KJWA 2CH4W 3M0TA 1E6GA 2CUBA 3PE0A 2LZ6B 2KXDA 2JMAA 2DBKA 2LQNA 2DILA 1M3CA 2YDLA 1SSHA 2HEQA 1UGVA 3RBBB 2LJ1A 3EG0A 2DA9A 1ZUKA 1WX6A 1EFNA 5HCKA 1BBZA 2LJ3A 4JZ3A 1AOJA 4AG1C 1HJDA 1M8MA 2NWMA 1WI7A 2CSQA 2RQUA 1M3AA 2CDTA 2KEAA 2CH4A 2DJQA 1KFZA 1JU5C 1NM7A 4OMPA 3IQLA 1K76A 2LJ0A 1NYFA 5I11A 1JXOA 1U06A 1CKBA 2MIOA 5FW9A 1JO8A 1QKXA 3JV3A 2DNUA 1RI9A 3QWXX 2O9SA 2O2OA 1W1FA 2P4RA 1T0HA 4OMQA 1X43A 2OAWA 4DEYA 3H41A 1FMKA 1SEMA 1GCQA 1K4US 2LNHB 5IHIA 2PTKA 2DM1A 2ESWA 2ECZA 2AZSA 2J05A 1GBRA 1X2KA 1YP5A 2F2VA 1GBQA 4AFUC 1T0JA 2JMCA 4CC7A 4AG2C 2KNBB 1VYVA 1SRMA 4E6RA 1PRMC 2GGRA 2FPDA 1OV3A 4D8DA 3UA7A 1UHFA 1AWOA 2D8JA 1ZBJA 3EG1A 2CUDA 1PHTA 1TUDA 1FYNA 2D0NA 1JXMA 4HXJA 1WXBA 4OMNA 2KXCA 2PZ1A 2KYMA 2IIMA 2RMOA 1QLYA 1WYXA 3THKA 1WDXA 2EKHA 2JW4A 1X6BA 3UA6A 2RQVA 1WXUA 2DRMA 2X3XD 3VS1A 4RTWA 4CC3A 2KRSA 2BZ8A 1XOVA 1MUZA 1UJYA 4F16A 2YUQA 2C0IA 2E5KA 3M0UA 4HCKA 5IHKA 1HD3A 3SEMA 1HSQA 3NPFA 1WA7A 1B3QA 2K3BA 1K0SA 2DE0X 1BB9A 3ULRB 3PVLA 2JTEA 5IH2A 1WFWA 1X6GA 1AZGB 1TUCA 1Z9QA 2HCKA 4DEXA 1WIEA 5FWBA 1X2QA 1CKAA 2DL7A 3VS4A 2HDAA 2JM9A 1YCSB 4HVUA 4JJDA 3I5RA 1V1CA 2KT1A 5IHNA 1AVZC 4LUEA 2A37A 2KGTA 4LN2A 2F2XA 4J9HA 2RQTA 4JJBA 2ED0A 2FPEA 3VRYA 1M3BA 3SHWA 3TSZA 1ARKA 2AKLA 1MV0B 2A08A 2L0AA 1WLPB 2YUNA 1S1NA 2KYBA 3H0IA 2VKNA 4OMOA 4LUDA 1PRLC 3I35A 2FRYA 3EG3A 2W0ZA 3RNJA 2GBQA 1OPLA 1YWOA 1UE9A 3VRZA 3VS5A 1UTIA 3H0FA 4RTTA 4F17A 1AD5A 2K2MA 2EW3A 4J9BA 1AWXA 2M0YA 1JEGA 1TG0A 1GCQC 3GBQA 1QWFA 2RF0A 2CSIA 3C0CA 1UG1A 4RUGA 2PNIA 3I9QA 1X69A 2BZXA 4J9IA 2V1QA 2LP5A 1W6XA 4CC4B 2LMJA 2GQIA 3O5ZA 1GL5A 2I0NA 2YUOA 2L3QA 1PWTA 1NLOC 3PVQA 2J6KA 2O31A 4LE9A 2KROA 2C0OA 1T3LA 2EGEA 2W10A 2X3WD 4X1VA 3QWYA 4AFSC 1GRIA 3VS7A 1QWEA 4EIKA 2FG0A 1OPKA 1RLPC 1OOTA 2RQRA 2L2PA 2ENMA 4JJCA 5IXBA 1SHGA 2M51A 4WCIA 2RNAA 1ZUUA 3A98A 5GJWB 2DVJA 4RTUA 2K9GA 1U3OA 1Y57A 2MOXA 1I0CA 2A36A 3NMZC 2NUZA 5IXFA 2AKKA 1UFFA 1NLPC 1ABOA 1M30A 1UUEA 1K9AA 2CREA 2JM8A 2FEIA 2DL8A 2OJ2A 4RTZA 3M0RA 2DYBA 1AZEA 3CQTA 2BTTA 4D8KA 1G2BA 1G83A 1AWWA 2DLPA 1H8KA 2V1RA 1U5SA 4AFQC 3EHRA 2A28A 4IIMA 1UECA 1KIKA 2YT6A 2O88A 2G6FX 2YUPA 2KE9A 3R6NA 3REAB 1J3TA 4OMMA 2GTJA 2CT3A 5FWCA 4AFZC 4Z89A 1GFCA 2ROLA 2RN8A 4LNPA 2ROTA 4OMLA 4GLMA 1ZUYA 2GNCA 3TVTA 3VS3A 1A0NB 4J9GA 2K79A 2L3SA 3U23A 4HVWA 3TSWA 1K0XA 2MCNA 4GBQA 1NG2A 2DL3A 2D8HA 2DF6A 2EVRA 3UF4A 1W70A 2KR3A 1RLQC 2SRCA 2K7AA 2J06A 2EYXA 2FRWA 3M0QA 3LH5A 2DRKA 3M0PA 2J6OA 2J7IA 3M0SA 1Z9ZA 4J9DA 3KFVA 3ZL7C 1GFDA 4RTXA 2LX7A 2F2WA 1CSKA 1B07A 4Z88A 2EPDA 2HBWA 4IIOA 4F14A 1MV3A 1Y0MA 2J6FA 1VA7A 2JS0A 1PKTA 2EQIA 2ED1A 2FPFA 2B86A 1IO6A 5EC7A 2DMOA 2XMFA 1I07A 1K1ZA 3UATA 1PKSA 4J9CA 1QKWA 4JZ4A 1BK2A 2JS2A 4ORZA 1JQQA 1I1JA 2EGCA 2BZYA 2K6DA 3EGUA 1E7OA 2FO0A 1WXTA 2AK5A 3H0HA 4RTVA 2H8HA 3VS2A 1YNZA 5L23A 2VWFA 2GTOA 1OEBA
chains in the Genus database with same CATH superfamily
5LJ3j 1RABB 1UHCA 4E7SA 4C92E 3JCMb 3VJPA 3CCUT 1VYTA 3HKSA 1QVFP 1Y96B 1N6AA 2VVKA 1M27C 1VQ6T 2E41A 2KBTA 4N4HA 2QQ9A 4X9DA 3JB9F 1XNIA 5KCHA 3H8ZA 3EH2A 4HT8A 3EG2A 3FEOA 3R6OA 2DL5A 3CMEQ 1FX7A 2X4WA 2YSQA 1I81A 1SHFA 2ZPHB 3TCJA 4F7UF 3OYAA 3JRZA 3TREA 3CCLQ 2P0KA 1VQ7Q 2EBPA 3NGPA 5GJVB 2HSPA 2NUPA 1PD1A 2LTOA 3PIOA 5DM7R 2HQEA 4PKCC 4C5EA 4F7UG 3RKXA 3OYKA 1M1KU 4PJOD 1K73R 3PMTA 3GOXA 2DX1A 2EYYA 1VYUA 3META 1I8FA 4LDVA 2E6NA 2JTMA 5A0GA 1K9MU 3FC3A 4QVZA 1SRLA 3CMEA 1GCPA 2NLUA 1WHLA 3I5SA 4ZNXA 3CCLA 1ZSGA 1T3SA 4BUGA 4MZTA 4A63B 1H92A 3BE3A 2HSEB 4ESRA 3P8HA 3G6ET 3QYGB 1M90C 1ABQA 3VV0A 3EH1A 3CMET 1IHVA 4IURA 5CAIA 2KXDA 4XU0A 2LQKA 1F1BB 2DILA 4M77A 2YDLA 3MEUA 1VQ7T 3RBBB 5GAOm 3EG0A 1I5OB 5LL6S 2DA9A 1ZUKA 1WX6A 3JCMh 1BBZA 4JZ3A 5GAMh 2A7YA 2K57A 4M78A 1WI7A 2CSQA 3MPUB 3JCMW 1JU5C 3IQLA 1NYFA 5EG2A 4F04B 5CKDA 1CKBA 2CZ6B 4XU3A 3MP8A 4OGCA 1QKXA 4IUQA 1RI9A 2LNVA 2O9SA 2P4RA 3CMAQ 8ATCB 4OMQA 1X43A 1QVPA 2BE9B 4OB2B 4E7KA 4KUDK 4AMCA 4ELZC 5IHIA 2XG8D 1NE8A 2PTKA 3OQ5A 4OB3B 1B7TA 2ECZA 1TSFA 2VUBA 1Q82U 1X2KA 1YP5A 5CKEA 1UGSB 2LVMA 2MI6A 3E9FA 2RI5A 3OBYA 1VYVA 3LH0A 1PRMC 2FPDA 2O4XA 4M77F 3I56T 2HBPA 2RO0A 2D8JA 3CMAA 2MF2A 1BI3A 2LT1A 2CUDA 2EJGA 4C0DB 1YIJQ 2D0NA 4C5IA 4PJOC 4M78F 1WXBA 3VYGA 2OX7A 2RB6A 1QLYA 5HY6A 3OYMA 1WDXA 3DLMA 2CYZB 3TU4K 2DO3A 2RQVA 2M9UA 4C0ZA 4CC3A 1R77A 2FVUA 1M90R 4F16A 1D0YA 3F70A 3M0UA 4ZTJA 1Q86C 3NPFA 3CCEQ 1B3QA 4O5VA 2K3BA 2V26A 1BB9A 1NJIU 4MMLA 3JB9H 3G71Q 1Z9QA 3EFRA 1YIJA 1K8AU 2JOYA 1YJWQ 4XTZA 3M5AA 3CD6Q 1B34B 2JM9A 3LWIA 3G1JA 1WJRA 3CCVQ 3I5RA 2ZPEB 1YIJT 4PFOA 5IHNA 1AVZC 2YLCA 1GXIE 4LN2A 4L59A 2F2XA 4WTOB 1LJOA 2KI7A 1S72T 2E3HA 3DKMA 4M7AB 3VRYA 3G71A 3TSZA 5J26A 4QQ6A 3ASKA 1YJWA 1KHCA 3CD6A 2L0AA 5CO7A 3QHSA 2EQMA 3CCET 1PRLC 3I35A 2FRYA 2GBQA 2EWNA 4C92F 1YWOA 1ZBXA 3L42A 1UE9A 4PNOA 4JS5A 3VS5A 1I4K1 3H0FA 4RTTA 4HT9A 2EW3A 2D9TA 4J9BA 1TTHB 1U1TA 3CCVT 4C92G 3RKYA 2DYIA 2YHTA 1D09B 2HQHA 4J9IA 2V1QA 3OSVA 3O5ZA 3LLRA 3OW2A 2HL5C 1PWTA 2L3QA 1NLOC 3PVQA 2J6KA 4MDWA 1Q86R 5LJ5h 5GAMf 2EGEA 2W10A 4UC4A 1U1SA 2KAFA 4M7AD 3RESA 2F69A 3C12A 4BI4A 3V7RA 5KYWA 3CC4Q 2RJDA 4B9XA 1JBMA 4JJCA 3RR6A 4IUUA 3CC7Q 3RKWA 3E9GA 2KMTA 1UGPB 4C5GA 1D3BA 2AIRB 4PJNA 4JRIA 2PVOB 3VKIA 1ABOA 4Y28E 3M4GA 2CREA 4M75B 3HTRA 4FCYA 1Q7YR 4FT4A 4NOYA 2ZPIB 4RTZA 4AT1B 2RH2A 3CC4A 1AZEA 3ME9A 3M58A 4OB1B 4C0DC 1AWWA 2DLPA 4EMKB 1KG1A 5FROA 2V1RA 1OYXA 2QA4Q 3EHRA 5IT9E 2A28A 2FZCB 3CC7A 4FIBA 3ZBDA 3BFMA 3GPLA 3MCAB 2G6FX 2VASA 3CC4T 3A8LB 3L2RA 3R6NA 4KH1B 2R57A 4OMMA 4ZGEB 2GTJA 2IPOB 5GAOq 1VQ5Q 4LNPA 2ROTA 1KC8C 4GLMA 1W4SA 3P8DA 2XD0A 2QGFB 1LPLA 2OTJT 2H3EB 5I21A 4RG8A 4LDYA 2PQWA 2EJFA 4GBQA 2EQUA 2QA4A 4DBRA 2D8HA 1VQ9T 2E10A 1W70A 2KR3A 2ZAEA 2K7AA 2AT1B 1QP3A 2MWOA 2FRWA 3CC2Q 4LDXA 2MK5A 2DD5A 1AT1B 2J6OA 4BD3A 5LJ3e 4M75D 3KFVA 1VQ5A 2VB6A 4A4GA 1GFDA 4BY6B 3EG9B 2X4XA 1Q95G 2LX7A 3JCMV 4M7AC 1M2OA 1CSKA 4ZN1A 4N0AC 2HBWA 2ZPGB 4F14A 3SWNB 2J6FA 1VA7A 2JS0A 2HL3A 3S3OA 1YJ9T 2DKGA 1ACMB 2E4HA 1HK9A 2E70A 5KYUB 1VQ5T 3QDRB 4RG2A 1I07A 3CXCS 5C6SA 5GANg 1N8RU 5GMKj 4ORZA 1KD1C 1JQQA 3CC2A 3A5ZB 4J7FA 1E7OA 3H0HA 2QYZA 4BE2A 1KQ1A 1SKUB 2P0QA 5HKCA 5L23A 2LCCA 4YTLA 1YI2T 1H3HA 3TEEA 2E12A 2RPNA 2JXBA 1QVFA 1BU1A 3HFNA 5FU6B 2HQXA 2DXUA 4MMKA 3E1SA 1SPKA 1N9SA 2OI3A 5A2QE 2EQKA 3VU3C 1YWPA 2L3PA 1ZX6A 2EGAA 2HKQB 2JVVA 2QXFA 3J7AF 1QP2A 1RI0A 4LXCA 4PJOA 3REBB 2PVDB 4JPBW 4XAXB 4JRPA 2CP5A 3EHQA 3OS2A 8AT1B 1NYGA 5CQXA 4FSSA 4GY5A 2C0TA 2KT8A 3S3NA 1NEGA 2OTLT 4Z8AA 2JT4A 5J3BA 2DZCA 2K3YA 3QIIA 2HNIA 1HYOA 1K73U 4CC2A 3CCJQ 1Y96A 3CCQQ 1EZZB 3CCSQ 4EPCA 3OS1A 1KK7A 3OYGA 2O9VA 4M4ZA 4JUVA 2KRMA 3LGFA 1UGQB 2EIFA 4M75C 2K3XA 2HZYA 1E6HA 4QQDA 2BKDN 3FDRA 2PUOB 3VS6A 3RMQA 4EMKC 1E6GA 3PE0A 5KCOA 1XJWB 3UPUA 1W2BP 1FMVA 1SSHA 4JLIA 2E3IA 4PJOF 2LJ1A 2X51A 3L2ZA 1EFNA 3CCQA 2NUTB 4M7AE 1VQPT 2VXFA 1M8MA 2XKOC 4MZMA 1MGQA 2KEAA 2CH4A 3OYCA 5GAN7 4OMPA 1K76A 3MEAA 1WQ7A 3CCJT 5FU7B 2CKKA 2JTFA 3CCST 2YRVA 1ZA1B 3QWXX 3ER0A 1T0HA 2ZCFB 1RAAB 2MAMA 4Z02A 4X9CA 3CCMA 1SEMA 2E64A 1C6VX 3HFOA 1YJNQ 1M8VA 3RIRA 1D1CA 3I55T 2Y4YA 5AT1B 2ESWA 3A8HB 1GBRA 2F2VA 4AFUC 1M5Q1 4AG2C 4BY6C 1XQHA 1SRMA 5GANf 1JB0E 3OB9A 1WZOA 1OV3A 3SWNC 4D8DA 2L8DA 1AWOA 1YFNA 3EG1A 2DAQA 1VQ8T 1TUDA 1R0CB 1JXMA 3OYHA 4DOVA 4HXJA 2YWWA 2QASA 2KXCA 1BI0A 2PZ1A 1YJNA 3X28B 3PT9A 2RMOA 3OW2S 2JW4A 1QCOA 1WXUA 2KRSA 3QZ9B 2BZ8A 1D0XA 1R8OB 3V8JA 2E1HA 2C0IA 2OAUA 3QJ6A 3SEMA 2DE0X 3AHUA 3ULRB 4BACA 3MP6A 1Q81R 1OU9A 5KYXB 1X6GA 3QKJA 1AZGB 2HCKA 4WF2A 5FU6C 4OB0B 4PLLA 1CKAA 2DL7A 3V8LA 2HDAA 4M75E 1KQSP 2PVGB 5J39A 2ZPFB 3X25B 3DB4A 1TWBA 4JLGA 4R56A 1V1CA 1HXDA 2KGTA 1QVGP 2DXCA 3OYEA 2RQTA 5GANd 3NFCA 2ED0A 5C0MA 3CCLT 2P84A 3CXCA 1ARKA 1M1FA 2COZA 2A0FB 4FM4B 4OP0A 3QZ5B 2YUNA 4L6V5 5DLQE 1M1KC 1B34A 3L2VA 4B9WA 2CP3A 3WXMB 1K9MC 2RHZA 7AT1B 1TG0A 1YHQQ 1OI1A 3JCMg 1GCQC 3GBQA 3TQ7P 3OYIA 1BIAA 2VC8A 5GAMg 2CSIA 3C0CA 1UG1A 4RUGA 2R5AA 2PNIA 3I9QA 2QQSA 3EGXB 4CC4B 5CR2A 2I0NA 2LCLA 3S6WA 2E6ZA 2V8KA 2YUOA 2M1HA 2CP0A 2O31A 4LE9A 2KROA 1I5LA 1OQKA 2AHJB 1VQOQ 3E2UA 3OMGA 2X3WD 1RL2A 2P0PA 1FMWA 5FU7C 4AFSC 3VS7A 3BY7A 2CP7A 1QWEA 1YHQA 1OPKA 3CPWP 4BE0A 1RLPC 2D0QB 2RQRA 2L2PA 2MMPA 5IXBA 3D7SB 4WCIA 3P8BB 2RNAA 4NL3A 1WGSA 1ZUUA 3A98A 4II1A 5GJWB 4OMFB 1M4ZA 4FW1A 3CMAT 3ZEHA 2DVJA 2DFUA 4FYYB 5KE2A 1U3OA 1Y57A 3WVDB 3KUFA 2Y4XA 3HRSA 4ZTFA 2A36A 4C92A 3NMZC 2NUZA 1MNDA 4FSXA 2E5QA 1VQOA 5IXFA 1UFFA 1M30A 2M02A 2EFIA 5A0DA 2OJ2A 2IVWA 1Q82C 1Q7YU 4M7AF 3CQTA 2RHXA 1QVFS 1TH7A 5LJ3h 1AHJB 1H8KA 2NYSA 2QTVA 1M1KR 1KIKA 2YT6A 2XIDA 4M7AG 2KE9A 3GLXA 5CVIA 2X4YA 1LOJA 5GANj 4M7DC 5FWCA 2PU9B 3GP8A 4B6MA 2EKOA 2JNGA 4MZPA 2A3LA 1Y7XA 4J9GA 4XTXA 2L3SA 1QW1A 1VQLQ 1WJQA 4M75A 2MCNA 4J83A 2KVQG 5GMKe 2RJCA 2VGMA 4RKUE 4OVAA 4EDUA 5GAN8 3G71T 5IN1A 3UF4A 3EFOB 3PFSA 4EMKA 1NJIC 1O9SA 4N4GA 2J06A 1YJWT 1K8AC 2EYXA 2QEXQ 3CD6T 5D7UA 4FT2A 1IGUA 2EYQA 4A4FA 2J7IA 3MEWA 1Z9ZA 3AT1B 4J9DA 4FYXB 2V8JA 2FZKB 3O8VA 2XI9A 2F1LA 2O4XB 4CI0C 2HAXA 1MMAA 1H641 1QVGS 1OU8A 1MV3A 1VQLA 1NPPA 1PKTA 4BE1A 2X9HA 5EC7A 3V7SA 3CCRA 2XMFA 3LGLA 4IUVA 4PL6A 1PKSA 3M55A 4J9CA 3JCMf 1BI2A 2QEXA 4C8QB 2FZGB 2L5QA 2DZ9A 5A0LA 2EGCA 2BZYA 2KSSA 2K6DA 2AK5A 4RTVA 2H8HA 1VQKQ 4M75F 2GCXA 1YNZA 4LDUA 1SSFA 5FRNA 3JAME 4KGZB 2CZ1B 1VQMQ 4K11A 3PNWC 4R55A 2AZVA 2RK1A 4Y92A 5LJ5g 3INZA 1RUWA 1AWJA 3SWNA 1X27A 4M75G 2IG0A 1N5ZA 3M53A 1LCKA 4J8OA 1C1AA 5I2SA 2JN0A 5KYUA 3NHNA 2LCSA 2DXTA 3M4YA 4HCZA 1BYMA 4QVDA 1MMDA 2Y90A 4PJJA 1M1GA 1VQKA 2EYZA 1P92A 4J6WA 2VGNA 4HCBA 2RQWA 4E7LA 4KBMB 3LWHA 3MP1A 2KY9A 3FJ5A 1VQMA 5ECAA 1FXXA 1LNXA 1PNJA 3VS0A 2M16A 1ZQ1A 4M7DE 2BUDA 3BDUA 2YRDA 2JJ9A 2EYWA 2DBMA 1PSEA 1PCXA 1ZLMA 4PJLA 4C8QD 2RI2A 3JCMd 5GAN3 3CC7T 5GAMd 3OY9A 4HVVA 1NPRA 1QCFA 2SEMA 2LQWA 2X4JA 1UDLA 4LDWA 2COWA 5AYFA 5DY9A 2XICA 4R0KA 3M0TA 3URGA 1OX8A 2DBKA 2LT4A 1M3CA 3MKDA 2HEQA 3JCMQ 1RADB 5HCKA 4O6JA 4E7JA 1AOJA 2QA4T 1QQJA 1X75C 1HJDA 2RQUA 1M3AA 4KUIA 1OZ3A 3X26B 3H6ZA 1IXDA 1PD0A 5KYYB 2XK0A 5I11A 3OS5A 1U06A 2MIOA 5FW9A 3JV3A 2DNUA 1W1FA 4A4EA 2OAWA 4P5NA 1OX9A 1GCQA 1K4US 4E47A 4A4HA 2DM1A 3OA6A 2QQBA 1X01A 2FHDA 1GBQA 2JMCA 4CC7A 2KNBB 4E6RA 2BE7D 2GGRA 3CC2T 4E2FB 4J6XA 4ZGJB 1C0MA 1RAEB 4N4IA 1FYNA 5M9OA 1IREB 4IUTA 4OMNA 1KC8R 2KYMA 2XDPA 1WYXA 4C8QC 3THKA 2EKHA 1X6BA 3VS1A 1V29B 5LJ5f 1XOVA 1N8RC 1G3SA 3X24B 2XDBA 2E5KA 1HD3A 4FYVB 1HSQA 2QDYB 2BIVA 5CQYA 5IH2A 2QAZA 1YITQ 5GMKi 5DLOA 1Q81U 1X2QA 2RA2A 5GAMj 1JRIA 1YCSB 3QSUA 2GF7A 4HVUA 3FRNA 3JSCA 2KT1A 2XHCA 3QDFA 4DOWA 1QVGA 2A37A 3V8KA 3HHTB 3QUIA 4J9HA 2P4TA 4JJBA 4M78E 5GAOr 3CCMQ 1KD1R 1M3BA 1YITA 3OSSC 1WHJA 2AKLA 3RMSA 4XQ3A 3GF5A 5GMKl 1S1NA 4JJNK 2VKNA 4OMOA 4ANJA 4LUDA 3L2QA 3EG3A 2W0ZA 3RNJA 2M0OA 3EGDB 1JJ2P 4XTWA 3FB9A 1YITT 3GNGA 3VRZA 3CCQT 1K73C 4J5YA 4OF1A 1UTIA 4DBFA 2MYSA 3CCUQ 5LJ5d 2DIGA 1AD5A 2K2MA 2JUFA 2M0YA 5D6XA 1JEGA 2VV5A 1VQ6Q 1PSFA 2RK2A 2DERA 1ZHIA 1MHNA 1O75A 1X69A 1BCMA 1M2VB 1WHMA 4HA8A 2GQIA 1MMGA 4BI8B 5CCAA 3CCMT 2WSEE 2I2LA 3G4SQ 3CBMA 2C0OA 3UDCA 1T3LA 4M7DF 1H3ZA 1BI1A 3CCUA 1TS9A 2LX9A 3QWYA 1IHWA 5HK0A 3A1PA 1GRIA 1PM3A 1VQ6A 2FG0A 1EX4A 2QI2A 3NTIA 4C8QE 3EAEA 3C95A 2XU8A 3JB9I 4M7DG 1G3WA 1UGRB 5GANe 4RTUA 3NTHA 2DEUA 5GAN4 3Q1JA 3VUZA 3J80E 1MMNA 1I0CA 4M7DB 1TXQA 3EGXA 2QQRA 5GMKh 3G4SA 3G6EQ 1M90U 1YJNT 1UUEA 2LDMA 1K9AA 3GIBA 2FEIA 2DYBA 2CP2A 3JB9J 4BI3A 5CIUA 2COYA 3G4ST 3JB9G 1G2BA 3GNFB 3L2UA 3N5BB 2L89A 4AFQC 2FB7A 3OMCA 4LD6A 3HRUA 5GAOl 1UECA 1D1BA 1WHKA 4IKFA 3E19A 1R0BG 3G6EA 1RAIB 4QQGA 4F7UB 4XU1A 1GFCA 2RN8A 4V2SA 2PUKB 3RUXA 3VS3A 1A0NB 4A53A 1VQ7A 4HVWA 2B8AA 3TSWA 4Y91A 1K0XA 1ZSZB 2QGGA 1G3YA 3H9NA 3DB3A 2RJEA 1RLQC 2SRCA 4M7DD 1UB4A 5LJ5j 3M9QA 4JRKA 4DQ2A 3M0QA 3LH5A 2DRKA 3M0PA 3I56Q 4ATOA 3HRTA 2K5LA 5I2MA 3ZL7C 2R58A 4PFZA 1TU0B 4Z88A 1RACB 2EPDA 4IIOA 2DK3A 4M7AA 1Y0MA 4NS5A 2EQIA 4N0AA 1QCNA 1W2BS 2ED1A 1FWZA 2FPFA 3JB9D 3M59A 3UATA 3BW1A 4JZ4A 1Q86U 2K5IA 3CBPA 5CKFA 2YLBA 3EFOA 2KK4A 2NUPB 3I56A 1JJ2S 1WXTA 2WSFE 3S3MA 2Z0WA 2XDDA 4ME7A 2GTOA 1KSWA 2F5TX 1UJ0A 4A54A 4PFPA 2H3JA 2VYTA 1YHQT 3A8GB 3VUBA 1VUBA 4JDSA 4KH0B 1WNLA 4J6YA 5CKHA 1WQWA 3UWNA 2KQWA 3QO3A 4Q5WA 1BCOA 4KT0E 2ATCB 4M77G 1S72Q 1NEBA 4OGEA 4C0GA 4QT7A 4C5HA 4C8QA 1N9RA 3BDLA 3J81E 3NTKA 4J9EA 5CKBA 2D1XA 3QPHA 4M77B 4M78G 2RHUA 2CT4A 1VQOT 4KRTA 2QDLA 3QBYA 3RERA 2DL4A 2ABLA 2F5KA 5I22A 1YN8A 2CZ7B 4M78B 1K9MR 2HMAA 3SD4A 2YRCA 2X35A 1AEYA 2MPXC 2CP6A 3QG1A 5CK9A 4QW2A 1SF9A 5HK3A 3MJXA 1S72A 5LJ3g 2C06A 1MNEA 1LVKA 2DVEA 2KRNA 3A8MB 4J9FA 3L2WA 3OYFA 4EMGA 5L8RE 2O01E 4RTYA 3V7CA 1KJWA 2CH4W 2CZ0B 3CCRQ 2DETA 2CUBA 3CCEA 2LZ6B 2JMAA 4HCCA 4MDXA 2KDSA 2LQNA 4D6WA 1UGVA 3CXCP 3DLLA 1G3TA 1Q7YC 2EJ9A 2DD4A 1KQSS 5D6WA 4QVCA 4KGXB 9ATCB 2LJ3A 3M56A 3ZFJA 4AG1C 4C8QF 2NWMA 1N27A 2CDTA 2DJQA 1KFZA 5FLXE 3CCVA 1NM7A 2LJ0A 3VYHB 4ZGDB 1JXOA 4M77D 4XTYA 1IRXA 1QMCA 1JO8A 4C8QG 1D0ZA 1ZSZC 2O2OA 2GQVA 3HPWA 5KYNA 4DEYA 4M78D 3H41A 1FMKA 3CEYA 1U8RA 4CRIA 1VQLT 2LNHB 4FL6A 1Q82R 2LRQA 2AZSA 2J05A 4C92B 3CCRT 2DXBA 4FU6A 1T0JA 4XK8E 3JCMc 2RD1A 4GLKA 3OYBA 2QEXT 2V8IA 1M9SA 1RAGB 4ELYC 3CPFA 3EG9A 1IB8A 4E7HA 3JCMe 4PJOE 3UA7A 1BIBA 1UHFA 5GAMe 5KYYA 1ZBJA 2QK0A 3PIPA 1PHTA 2RHIA 2EQJA 6AT1B 3OYNA 1XTDA 4C0FA 1ZA2B 5GAN5 2IIMA 1KC8U 2LC4A 1VIEA 3UA6A 2RM4A 2DRMA 2X3XD 3X20B 3PMIA 5IAYA 3QJYA 4RTWA 5GAOp 2OTJQ 1UJYA 1MUZA 2YUQA 1IZ6A 4HCKA 5IHKA 3L1AA 2E65A 1WA7A 3CPWS 2CGHA 1NJIR 1K0SA 1TOVA 3PVLA 1K8AR 2JTEA 4XTVA 1VQ9Q 1WFWA 1VQKT 1TUCA 4BB7A 4DEXA 1WIEA 4KULA 4EMHA 5FWBA 2FL7A 1PC0A 3VS4A 1VQMT 4DBQA 2QTXA 4C92D 4JJDA 2OTJA 1EIFA 3T9NA 4LUEA 3QXEB 1W2BA 1YJ9Q 4M77C 3A8OB 2G3RA 2FPEA 1VQ9A 3SHWA 1X6OA 4F7UE 4PJMA 1KD1U 1MV0B 3LW5E 5LJ3f 4RMOA 4M78C 4TVRA 2A08A 3PGGA 1WLPB 2KYBA 3OYYA 3PTAA 3H0IA 1JJ2A 4RCBA 2ZPBB 1OPLA 1YI2Q 1DJ7B 2WSCE 1UEBA 5KYWB 3OYJA 4F17A 2HKNA 5GANh 1YJ9A 1AWXA 1Y07A 3LYIA 2YXYA 4JS4A 3MHXA 2RJFA 1QWFA 2RF0A 3JCMX 1IGQA 1VOMA 3OS0A 2BZXA 1D3BB 2GFAA 1VQ4Q 1W6XA 2LMJA 1GL5A 2K4YA 4DA4A 4L5GA 1KHIA 2NUTA 3OW2P 5KE3A 1YI2A 1G8XA 3CBOA 1PG5B 4PLIA 1TUGB 2ZGWA 3EGDA 2EAYA 2WACA 4X1VA 4BDYA 2OTLQ 3KBGA 4EIKA 1NZ9A 1WHHA 1OOTA 3QYHB 1RAHB 3C94A 2DEQA 3FLGA 2DIQA 2ENMA 3OYLA 1SHGA 2M51A 5LJ3d 1VQ4A 2RI3A 2QQAA 2K9GA 2MOXA 1YBYA 4C92C 3G7ZA 1M2VA 1V76A 1G5VA 1RAFB 2AKKA 1BKBA 1NLPC 4XTUA 2L3RA 3FIFA 3EFSA 2OTLA 1VQ4T 3C4SA 5GAN2 4ZN3A 2JM8A 1KQ2A 2DL8A 5GAOn 3M0RA 4A4KA 2BTTA 2R5MA 1Y71A 4D8KA 1G83A 1KQSA 4VUBA 2K2VA 3KXTA 1VQPQ 1U5SA 2MWPA 2K5FA 5LJ5e 4QKUA 3SFMA 4IIMA 1VQNQ 4E7ZA 2O88A 4M77E 2HD0A 1WPYA 3M57A 2YUPA 3MEVA 3SB2A 2ZZDA 3REAB 1J3TA 2CT3A 4AFZC 3M54A 4Z89A 1NBEB 1YCYA 2ROLA 4M7DA 3JCMJ 2DPPB 4OMLA 1VIFA 1ZUYA 2GNCA 3TVTA 2D6FA 4X34A 4JRQA 2K79A 1OULA 3U23A 4BDZA 1WJSA 5KYXA 1VQPA 1NG2A 3HP9A 3I55Q 3LX7A 2JZ2A 2DL3A 4XU2A 1VQNA 2DF6A 2EVRA 4PK4A 3UT1A 3OBWA 2CS7A 1Q81C 3CCJA 1D1AA 2LQ8A 3CCSA 3M0SA 4J7IA 1VQNT 4IUPA 4RTXA 1VQ8Q 2DJZA 4F7UA 2F2WA 3OYDA 5KH6A 1B07A 5GAN6 4PJOG 2GFUA 1SG5A 2DTHA 3HSBA 2B86A 1IO6A 5GMKm 2QG9B 3RDVA 3I55A 2DTIA 2DMOA 1N8RR 4LD9K 4NL2A 2VXEA 1K1ZA 4PJOB 2RHYA 1QKWA 1ZSZA 4KGVB 4E7IA 2FYKA 1OZ2A 1BK2A 2JS2A 4DBHA 2DTOA 4FW2A 3JCMP 4HKEA 3HL8A 1I1JA 4FYWB 5D6YA 3FJPA 3CPWA 3MO8A 4RCCA 3EGUA 2FO0A 3SDZA 3VS2A 1VQ8A 1WHGA 5FRMA 2VWFA 2LP5A 3WVEB 1OEBA
chains in the Genus database with same CATH topology
1KSWA 1H3HA 1UHCA 2RPNA 2JXBA 1UJ0A 4K11A 1BU1A 1VYTA 2VVKA 1M27C 2AZVA 4Y92A 1RUWA 1AWJA 1SPKA 1X27A 2KBTA 2OI3A 1N5ZA 1LCKA 1YWPA 2L3PA 1ZX6A 2EGAA 3NHNA 3EG2A 2LCSA 2DL5A 3REBB 4JPBW 2YSQA 1SHFA 1NEBA 3EHQA 4QT7A 2EBPA 3NGPA 2EYZA 5GJVB 1NYGA 4FSSA 2HSPA 4J9EA 2D1XA 2C0TA 2KT8A 2RQWA 1NEGA 2CT4A 4KRTA 2QDLA 3FJ5A 5ECAA 4Z8AA 2JT4A 1PNJA 2DL4A 2ABLA 3VS0A 5I22A 1YN8A 2EYWA 2DX1A 2EYYA 1VYUA 2DBMA 4CC2A 1ZLMA 1AEYA 1SRLA 1GCPA 3I5SA 4ZNXA 2O9VA 4M4ZA 4HVVA 1ZSGA 2KRMA 1QCFA 1T3SA 2SEMA 4A63B 2KRNA 2LQWA 4J9FA 1H92A 1UDLA 4ESRA 1E6HA 4RTYA 1ABQA 4R0KA 3VS6A 1KJWA 2CH4W 3M0TA 1E6GA 2CUBA 3PE0A 2LZ6B 2KXDA 2JMAA 2DBKA 2LQNA 2DILA 1M3CA 2YDLA 1SSHA 2HEQA 1UGVA 3RBBB 2LJ1A 3EG0A 2DA9A 1ZUKA 1WX6A 1EFNA 5HCKA 1BBZA 2LJ3A 4JZ3A 1AOJA 4AG1C 1HJDA 1M8MA 2NWMA 1WI7A 2CSQA 2RQUA 1M3AA 2CDTA 2KEAA 2CH4A 2DJQA 1KFZA 1JU5C 1NM7A 4OMPA 3IQLA 1K76A 2LJ0A 1NYFA 5I11A 1JXOA 1U06A 1CKBA 2MIOA 5FW9A 1JO8A 1QKXA 3JV3A 2DNUA 1RI9A 3QWXX 2O9SA 2O2OA 1W1FA 2P4RA 1T0HA 4OMQA 1X43A 2OAWA 4DEYA 3H41A 1FMKA 1SEMA 1GCQA 1K4US 2LNHB 5IHIA 2PTKA 2DM1A 2ESWA 2ECZA 2AZSA 2J05A 1GBRA 1X2KA 1YP5A 2F2VA 1GBQA 4AFUC 1T0JA 2JMCA 4CC7A 4AG2C 2KNBB 1VYVA 1SRMA 4E6RA 1PRMC 2GGRA 2FPDA 1OV3A 4D8DA 3UA7A 1UHFA 1AWOA 2D8JA 1ZBJA 3EG1A 2CUDA 1PHTA 1TUDA 1FYNA 2D0NA 1JXMA 4HXJA 1WXBA 4OMNA 2KXCA 2PZ1A 2KYMA 2IIMA 2RMOA 1QLYA 1WYXA 3THKA 1WDXA 2EKHA 2JW4A 1X6BA 3UA6A 2RQVA 1WXUA 2DRMA 2X3XD 3VS1A 4RTWA 4CC3A 2KRSA 2BZ8A 1XOVA 1MUZA 1UJYA 4F16A 2YUQA 2C0IA 2E5KA 3M0UA 4HCKA 5IHKA 1HD3A 3SEMA 1HSQA 3NPFA 1WA7A 1B3QA 2K3BA 1K0SA 2DE0X 1BB9A 3ULRB 3PVLA 2JTEA 5IH2A 1WFWA 1X6GA 1AZGB 1TUCA 1Z9QA 2HCKA 4DEXA 1WIEA 5FWBA 1X2QA 1CKAA 2DL7A 3VS4A 2HDAA 2JM9A 1YCSB 4HVUA 4JJDA 3I5RA 1V1CA 2KT1A 5IHNA 1AVZC 4LUEA 2A37A 2KGTA 4LN2A 2F2XA 4J9HA 2RQTA 4JJBA 2ED0A 2FPEA 3VRYA 1M3BA 3SHWA 3TSZA 1ARKA 2AKLA 1MV0B 2A08A 2L0AA 1WLPB 2YUNA 1S1NA 2KYBA 3H0IA 2VKNA 4OMOA 4LUDA 1PRLC 3I35A 2FRYA 3EG3A 2W0ZA 3RNJA 2GBQA 1OPLA 1YWOA 1UE9A 3VRZA 3VS5A 1UTIA 3H0FA 4RTTA 4F17A 1AD5A 2K2MA 2EW3A 4J9BA 1AWXA 2M0YA 1JEGA 1TG0A 1GCQC 3GBQA 1QWFA 2RF0A 2CSIA 3C0CA 1UG1A 4RUGA 2PNIA 3I9QA 1X69A 2BZXA 4J9IA 2V1QA 2LP5A 1W6XA 4CC4B 2LMJA 2GQIA 3O5ZA 1GL5A 2I0NA 2YUOA 2L3QA 1PWTA 1NLOC 3PVQA 2J6KA 2O31A 4LE9A 2KROA 2C0OA 1T3LA 2EGEA 2W10A 2X3WD 4X1VA 3QWYA 4AFSC 1GRIA 3VS7A 1QWEA 4EIKA 2FG0A 1OPKA 1RLPC 1OOTA 2RQRA 2L2PA 2ENMA 4JJCA 5IXBA 1SHGA 2M51A 4WCIA 2RNAA 1ZUUA 3A98A 5GJWB 2DVJA 4RTUA 2K9GA 1U3OA 1Y57A 2MOXA 1I0CA 2A36A 3NMZC 2NUZA 5IXFA 2AKKA 1UFFA 1NLPC 1ABOA 1M30A 1UUEA 1K9AA 2CREA 2JM8A 2FEIA 2DL8A 2OJ2A 4RTZA 3M0RA 2DYBA 1AZEA 3CQTA 2BTTA 4D8KA 1G2BA 1G83A 1AWWA 2DLPA 1H8KA 2V1RA 1U5SA 4AFQC 3EHRA 2A28A 4IIMA 1UECA 1KIKA 2YT6A 2O88A 2G6FX 2YUPA 2KE9A 3R6NA 3REAB 1J3TA 4OMMA 2GTJA 2CT3A 5FWCA 4AFZC 4Z89A 1GFCA 2ROLA 2RN8A 4LNPA 2ROTA 4OMLA 4GLMA 1ZUYA 2GNCA 3TVTA 3VS3A 1A0NB 4J9GA 2K79A 2L3SA 3U23A 4HVWA 3TSWA 1K0XA 2MCNA 4GBQA 1NG2A 2DL3A 2D8HA 2DF6A 2EVRA 3UF4A 1W70A 2KR3A 1RLQC 2SRCA 2K7AA 2J06A 2EYXA 2FRWA 3M0QA 3LH5A 2DRKA 3M0PA 2J6OA 2J7IA 3M0SA 1Z9ZA 4J9DA 3KFVA 3ZL7C 1GFDA 4RTXA 2LX7A 2F2WA 1CSKA 1B07A 4Z88A 2EPDA 2HBWA 4IIOA 4F14A 1MV3A 1Y0MA 2J6FA 1VA7A 2JS0A 1PKTA 2EQIA 2ED1A 2FPFA 2B86A 1IO6A 5EC7A 2DMOA 2XMFA 1I07A 1K1ZA 3UATA 1PKSA 4J9CA 1QKWA 4JZ4A 1BK2A 2JS2A 4ORZA 1JQQA 1I1JA 2EGCA 2BZYA 2K6DA 3EGUA 1E7OA 2FO0A 1WXTA 2AK5A 3H0HA 4RTVA 2H8HA 3VS2A 1YNZA 5L23A 2VWFA 2GTOA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  1H3H A;  1UHC A;  2RPN A;  2JXB A;  1UJ0 A;  4K11 A;  1BU1 A;  1VYT A;  2VVK A;  1M27 C;  2AZV A;  4Y92 A;  1RUW A;  1AWJ A;  1SPK A;  1X27 A;  2KBT A;  2OI3 A;  1N5Z A;  1LCK A;  1YWP A;  2L3P A;  1ZX6 A;  2EGA A;  3NHN A;  3EG2 A;  2LCS A;  2DL5 A;  3REB B;  4JPB W;  2YSQ A;  1SHF A;  1NEB A;  3EHQ A;  4QT7 A;  2EBP A;  3NGP A;  2EYZ A;  5GJV B;  1NYG A;  4FSS A;  2HSP A;  4J9E A;  2D1X A;  2C0T A;  2KT8 A;  2RQW A;  1NEG A;  2CT4 A;  4KRT A;  2QDL A;  3FJ5 A;  5ECA A;  4Z8A A;  2JT4 A;  1PNJ A;  2DL4 A;  2ABL A;  3VS0 A;  5I22 A;  1YN8 A;  2EYW A;  2DX1 A;  2EYY A;  1VYU A;  2DBM A;  4CC2 A;  1ZLM A;  1AEY A;  1SRL A;  1GCP A;  3I5S A;  4ZNX A;  2O9V A;  4M4Z A;  4HVV A;  1ZSG A;  2KRM A;  1QCF A;  1T3S A;  2SEM A;  4A63 B;  2KRN A;  2LQW A;  4J9F A;  1H92 A;  1UDL A;  4ESR A;  1E6H A;  4RTY A;  1ABQ A;  4R0K A;  3VS6 A;  1KJW A;  2CH4 W;  3M0T A;  1E6G A;  2CUB A;  3PE0 A;  2LZ6 B;  2KXD A;  2JMA A;  2DBK A;  2LQN A;  2DIL A;  1M3C A;  2YDL A;  1SSH A;  2HEQ A;  1UGV A;  3RBB B;  2LJ1 A;  3EG0 A;  2DA9 A;  1ZUK A;  1WX6 A;  1EFN A;  5HCK A;  1BBZ A;  2LJ3 A;  4JZ3 A;  1AOJ A;  4AG1 C;  1HJD A;  1M8M A;  2NWM A;  1WI7 A;  2CSQ A;  2RQU A;  1M3A A;  2CDT A;  2KEA A;  2CH4 A;  2DJQ A;  1KFZ A;  1JU5 C;  1NM7 A;  4OMP A;  3IQL A;  1K76 A;  2LJ0 A;  1NYF A;  5I11 A;  1JXO A;  1U06 A;  1CKB A;  2MIO A;  5FW9 A;  1JO8 A;  1QKX A;  3JV3 A;  2DNU A;  1RI9 A;  3QWX X;  2O9S A;  2O2O A;  1W1F A;  2P4R A;  1T0H A;  4OMQ A;  1X43 A;  2OAW A;  4DEY A;  3H41 A;  1FMK A;  1SEM A;  1GCQ A;  1K4U S;  2LNH B;  5IHI A;  2PTK A;  2DM1 A;  2ESW A;  2ECZ A;  2AZS A;  2J05 A;  1GBR A;  1X2K A;  1YP5 A;  2F2V A;  1GBQ A;  4AFU C;  1T0J A;  2JMC A;  4CC7 A;  4AG2 C;  2KNB B;  1VYV A;  1SRM A;  4E6R A;  1PRM C;  2GGR A;  2FPD A;  1OV3 A;  4D8D A;  3UA7 A;  1UHF A;  1AWO A;  2D8J A;  1ZBJ A;  3EG1 A;  2CUD A;  1PHT A;  1TUD A;  1FYN A;  2D0N A;  1JXM A;  4HXJ A;  1WXB A;  4OMN A;  2KXC A;  2PZ1 A;  2KYM A;  2IIM A;  2RMO A;  1QLY A;  1WYX A;  3THK A;  1WDX A;  2EKH A;  2JW4 A;  1X6B A;  3UA6 A;  2RQV A;  1WXU A;  2DRM A;  2X3X D;  3VS1 A;  4RTW A;  4CC3 A;  2KRS A;  2BZ8 A;  1XOV A;  1MUZ A;  1UJY A;  4F16 A;  2YUQ A;  2C0I A;  2E5K A;  3M0U A;  4HCK A;  5IHK A;  1HD3 A;  3SEM A;  1HSQ A;  3NPF A;  1WA7 A;  1B3Q A;  2K3B A;  1K0S A;  2DE0 X;  1BB9 A;  3ULR B;  3PVL A;  2JTE A;  5IH2 A;  1WFW A;  1X6G A;  1AZG B;  1TUC A;  1Z9Q A;  2HCK A;  4DEX A;  1WIE A;  5FWB A;  1X2Q A;  1CKA A;  2DL7 A;  3VS4 A;  2HDA A;  2JM9 A;  1YCS B;  4HVU A;  4JJD A;  3I5R A;  1V1C A;  2KT1 A;  5IHN A;  1AVZ C;  4LUE A;  2A37 A;  2KGT A;  4LN2 A;  2F2X A;  4J9H A;  2RQT A;  4JJB A;  2ED0 A;  2FPE A;  3VRY A;  1M3B A;  3SHW A;  3TSZ A;  1ARK A;  2AKL A;  1MV0 B;  2A08 A;  2L0A A;  1WLP B;  2YUN A;  1S1N A;  2KYB A;  3H0I A;  2VKN A;  4OMO A;  4LUD A;  1PRL C;  3I35 A;  2FRY A;  3EG3 A;  2W0Z A;  3RNJ A;  2GBQ A;  1OPL A;  1YWO A;  1UE9 A;  3VRZ A;  3VS5 A;  1UTI A;  3H0F A;  4RTT A;  4F17 A;  1AD5 A;  2K2M A;  2EW3 A;  4J9B A;  1AWX A;  2M0Y A;  1JEG A;  1TG0 A;  1GCQ C;  3GBQ A;  1QWF A;  2RF0 A;  2CSI A;  3C0C A;  1UG1 A;  4RUG A;  2PNI A;  3I9Q A;  1X69 A;  2BZX A;  4J9I A;  2V1Q A;  2LP5 A;  1W6X A;  4CC4 B;  2LMJ A;  2GQI A;  3O5Z A;  1GL5 A;  2I0N A;  2YUO A;  2L3Q A;  1PWT A;  1NLO C;  3PVQ A;  2J6K A;  2O31 A;  4LE9 A;  2KRO A;  2C0O A;  1T3L A;  2EGE A;  2W10 A;  2X3W D;  4X1V A;  3QWY A;  4AFS C;  1GRI A;  3VS7 A;  1QWE A;  4EIK A;  2FG0 A;  1OPK A;  1RLP C;  1OOT A;  2RQR A;  2L2P A;  2ENM A;  4JJC A;  5IXB A;  1SHG A;  2M51 A;  4WCI A;  2RNA A;  1ZUU A;  3A98 A;  5GJW B;  2DVJ A;  4RTU A;  2K9G A;  1U3O A;  1Y57 A;  2MOX A;  1I0C A;  2A36 A;  3NMZ C;  2NUZ A;  5IXF A;  2AKK A;  1UFF A;  1NLP C;  1ABO A;  1M30 A;  1UUE A;  1K9A A;  2CRE A;  2JM8 A;  2FEI A;  2DL8 A;  2OJ2 A;  4RTZ A;  3M0R A;  2DYB A;  1AZE A;  3CQT A;  2BTT A;  4D8K A;  1G2B A;  1G83 A;  1AWW A;  2DLP A;  1H8K A;  2V1R A;  1U5S A;  4AFQ C;  3EHR A;  2A28 A;  4IIM A;  1UEC A;  1KIK A;  2YT6 A;  2O88 A;  2G6F X;  2YUP A;  2KE9 A;  3R6N A;  3REA B;  1J3T A;  4OMM A;  2GTJ A;  2CT3 A;  5FWC A;  4AFZ C;  4Z89 A;  1GFC A;  2ROL A;  2RN8 A;  4LNP A;  2ROT A;  4OML A;  4GLM A;  1ZUY A;  2GNC A;  3TVT A;  3VS3 A;  1A0N B;  4J9G A;  2K79 A;  2L3S A;  3U23 A;  4HVW A;  3TSW A;  1K0X A;  2MCN A;  4GBQ A;  1NG2 A;  2DL3 A;  2D8H A;  2DF6 A;  2EVR A;  3UF4 A;  1W70 A;  2KR3 A;  1RLQ C;  2SRC A;  2K7A A;  2J06 A;  2EYX A;  2FRW A;  3M0Q A;  3LH5 A;  2DRK A;  3M0P A;  2J6O A;  2J7I A;  3M0S A;  1Z9Z A;  4J9D A;  3KFV A;  3ZL7 C;  1GFD A;  4RTX A;  2LX7 A;  2F2W A;  1CSK A;  1B07 A;  4Z88 A;  2EPD A;  2HBW A;  4IIO A;  4F14 A;  1MV3 A;  1Y0M A;  2J6F A;  1VA7 A;  2JS0 A;  1PKT A;  2EQI A;  2ED1 A;  2FPF A;  2B86 A;  1IO6 A;  5EC7 A;  2DMO A;  2XMF A;  1I07 A;  1K1Z A;  3UAT A;  1PKS A;  4J9C A;  1QKW A;  4JZ4 A;  1BK2 A;  2JS2 A;  4ORZ A;  1JQQ A;  1I1J A;  2EGC A;  2BZY A;  2K6D A;  3EGU A;  1E7O A;  2FO0 A;  1WXT A;  2AK5 A;  3H0H A;  4RTV A;  2H8H A;  3VS2 A;  1YNZ A;  5L23 A;  2VWF A;  2GTO A;  1OEB A; 
#chains in the Genus database with same CATH topology
 5LJ3 j;  1RAB B;  1UHC A;  4E7S A;  4C92 E;  3JCM b;  3VJP A;  3CCU T;  1VYT A;  3HKS A;  1QVF P;  1Y96 B;  1N6A A;  2VVK A;  1M27 C;  1VQ6 T;  2E41 A;  2KBT A;  4N4H A;  2QQ9 A;  4X9D A;  3JB9 F;  1XNI A;  5KCH A;  3H8Z A;  3EH2 A;  4HT8 A;  3EG2 A;  3FEO A;  3R6O A;  2DL5 A;  3CME Q;  1FX7 A;  2X4W A;  2YSQ A;  1I81 A;  1SHF A;  2ZPH B;  3TCJ A;  4F7U F;  3OYA A;  3JRZ A;  3TRE A;  3CCL Q;  2P0K A;  1VQ7 Q;  2EBP A;  3NGP A;  5GJV B;  2HSP A;  2NUP A;  1PD1 A;  2LTO A;  3PIO A;  5DM7 R;  2HQE A;  4PKC C;  4C5E A;  4F7U G;  3RKX A;  3OYK A;  1M1K U;  4PJO D;  1K73 R;  3PMT A;  3GOX A;  2DX1 A;  2EYY A;  1VYU A;  3MET A;  1I8F A;  4LDV A;  2E6N A;  2JTM A;  5A0G A;  1K9M U;  3FC3 A;  4QVZ A;  1SRL A;  3CME A;  1GCP A;  2NLU A;  1WHL A;  3I5S A;  4ZNX A;  3CCL A;  1ZSG A;  1T3S A;  4BUG A;  4MZT A;  4A63 B;  1H92 A;  3BE3 A;  2HSE B;  4ESR A;  3P8H A;  3G6E T;  3QYG B;  1M90 C;  1ABQ A;  3VV0 A;  3EH1 A;  3CME T;  1IHV A;  4IUR A;  5CAI A;  2KXD A;  4XU0 A;  2LQK A;  1F1B B;  2DIL A;  4M77 A;  2YDL A;  3MEU A;  1VQ7 T;  3RBB B;  5GAO m;  3EG0 A;  1I5O B;  5LL6 S;  2DA9 A;  1ZUK A;  1WX6 A;  3JCM h;  1BBZ A;  4JZ3 A;  5GAM h;  2A7Y A;  2K57 A;  4M78 A;  1WI7 A;  2CSQ A;  3MPU B;  3JCM W;  1JU5 C;  3IQL A;  1NYF A;  5EG2 A;  4F04 B;  5CKD A;  1CKB A;  2CZ6 B;  4XU3 A;  3MP8 A;  4OGC A;  1QKX A;  4IUQ A;  1RI9 A;  2LNV A;  2O9S A;  2P4R A;  3CMA Q;  8ATC B;  4OMQ A;  1X43 A;  1QVP A;  2BE9 B;  4OB2 B;  4E7K A;  4KUD K;  4AMC A;  4ELZ C;  5IHI A;  2XG8 D;  1NE8 A;  2PTK A;  3OQ5 A;  4OB3 B;  1B7T A;  2ECZ A;  1TSF A;  2VUB A;  1Q82 U;  1X2K A;  1YP5 A;  5CKE A;  1UGS B;  2LVM A;  2MI6 A;  3E9F A;  2RI5 A;  3OBY A;  1VYV A;  3LH0 A;  1PRM C;  2FPD A;  2O4X A;  4M77 F;  3I56 T;  2HBP A;  2RO0 A;  2D8J A;  3CMA A;  2MF2 A;  1BI3 A;  2LT1 A;  2CUD A;  2EJG A;  4C0D B;  1YIJ Q;  2D0N A;  4C5I A;  4PJO C;  4M78 F;  1WXB A;  3VYG A;  2OX7 A;  2RB6 A;  1QLY A;  5HY6 A;  3OYM A;  1WDX A;  3DLM A;  2CYZ B;  3TU4 K;  2DO3 A;  2RQV A;  2M9U A;  4C0Z A;  4CC3 A;  1R77 A;  2FVU A;  1M90 R;  4F16 A;  1D0Y A;  3F70 A;  3M0U A;  4ZTJ A;  1Q86 C;  3NPF A;  3CCE Q;  1B3Q A;  4O5V A;  2K3B A;  2V26 A;  1BB9 A;  1NJI U;  4MML A;  3JB9 H;  3G71 Q;  1Z9Q A;  3EFR A;  1YIJ A;  1K8A U;  2JOY A;  1YJW Q;  4XTZ A;  3M5A A;  3CD6 Q;  1B34 B;  2JM9 A;  3LWI A;  3G1J A;  1WJR A;  3CCV Q;  3I5R A;  2ZPE B;  1YIJ T;  4PFO A;  5IHN A;  1AVZ C;  2YLC A;  1GXI E;  4LN2 A;  4L59 A;  2F2X A;  4WTO B;  1LJO A;  2KI7 A;  1S72 T;  2E3H A;  3DKM A;  4M7A B;  3VRY A;  3G71 A;  3TSZ A;  5J26 A;  4QQ6 A;  3ASK A;  1YJW A;  1KHC A;  3CD6 A;  2L0A A;  5CO7 A;  3QHS A;  2EQM A;  3CCE T;  1PRL C;  3I35 A;  2FRY A;  2GBQ A;  2EWN A;  4C92 F;  1YWO A;  1ZBX A;  3L42 A;  1UE9 A;  4PNO A;  4JS5 A;  3VS5 A;  1I4K 1;  3H0F A;  4RTT A;  4HT9 A;  2EW3 A;  2D9T A;  4J9B A;  1TTH B;  1U1T A;  3CCV T;  4C92 G;  3RKY A;  2DYI A;  2YHT A;  1D09 B;  2HQH A;  4J9I A;  2V1Q A;  3OSV A;  3O5Z A;  3LLR A;  3OW2 A;  2HL5 C;  1PWT A;  2L3Q A;  1NLO C;  3PVQ A;  2J6K A;  4MDW A;  1Q86 R;  5LJ5 h;  5GAM f;  2EGE A;  2W10 A;  4UC4 A;  1U1S A;  2KAF A;  4M7A D;  3RES A;  2F69 A;  3C12 A;  4BI4 A;  3V7R A;  5KYW A;  3CC4 Q;  2RJD A;  4B9X A;  1JBM A;  4JJC A;  3RR6 A;  4IUU A;  3CC7 Q;  3RKW A;  3E9G A;  2KMT A;  1UGP B;  4C5G A;  1D3B A;  2AIR B;  4PJN A;  4JRI A;  2PVO B;  3VKI A;  1ABO A;  4Y28 E;  3M4G A;  2CRE A;  4M75 B;  3HTR A;  4FCY A;  1Q7Y R;  4FT4 A;  4NOY A;  2ZPI B;  4RTZ A;  4AT1 B;  2RH2 A;  3CC4 A;  1AZE A;  3ME9 A;  3M58 A;  4OB1 B;  4C0D C;  1AWW A;  2DLP A;  4EMK B;  1KG1 A;  5FRO A;  2V1R A;  1OYX A;  2QA4 Q;  3EHR A;  5IT9 E;  2A28 A;  2FZC B;  3CC7 A;  4FIB A;  3ZBD A;  3BFM A;  3GPL A;  3MCA B;  2G6F X;  2VAS A;  3CC4 T;  3A8L B;  3L2R A;  3R6N A;  4KH1 B;  2R57 A;  4OMM A;  4ZGE B;  2GTJ A;  2IPO B;  5GAO q;  1VQ5 Q;  4LNP A;  2ROT A;  1KC8 C;  4GLM A;  1W4S A;  3P8D A;  2XD0 A;  2QGF B;  1LPL A;  2OTJ T;  2H3E B;  5I21 A;  4RG8 A;  4LDY A;  2PQW A;  2EJF A;  4GBQ A;  2EQU A;  2QA4 A;  4DBR A;  2D8H A;  1VQ9 T;  2E10 A;  1W70 A;  2KR3 A;  2ZAE A;  2K7A A;  2AT1 B;  1QP3 A;  2MWO A;  2FRW A;  3CC2 Q;  4LDX A;  2MK5 A;  2DD5 A;  1AT1 B;  2J6O A;  4BD3 A;  5LJ3 e;  4M75 D;  3KFV A;  1VQ5 A;  2VB6 A;  4A4G A;  1GFD A;  4BY6 B;  3EG9 B;  2X4X A;  1Q95 G;  2LX7 A;  3JCM V;  4M7A C;  1M2O A;  1CSK A;  4ZN1 A;  4N0A C;  2HBW A;  2ZPG B;  4F14 A;  3SWN B;  2J6F A;  1VA7 A;  2JS0 A;  2HL3 A;  3S3O A;  1YJ9 T;  2DKG A;  1ACM B;  2E4H A;  1HK9 A;  2E70 A;  5KYU B;  1VQ5 T;  3QDR B;  4RG2 A;  1I07 A;  3CXC S;  5C6S A;  5GAN g;  1N8R U;  5GMK j;  4ORZ A;  1KD1 C;  1JQQ A;  3CC2 A;  3A5Z B;  4J7F A;  1E7O A;  3H0H A;  2QYZ A;  4BE2 A;  1KQ1 A;  1SKU B;  2P0Q A;  5HKC A;  5L23 A;  2LCC A;  4YTL A;  1YI2 T;  1H3H A;  3TEE A;  2E12 A;  2RPN A;  2JXB A;  1QVF A;  1BU1 A;  3HFN A;  5FU6 B;  2HQX A;  2DXU A;  4MMK A;  3E1S A;  1SPK A;  1N9S A;  2OI3 A;  5A2Q E;  2EQK A;  3VU3 C;  1YWP A;  2L3P A;  1ZX6 A;  2EGA A;  2HKQ B;  2JVV A;  2QXF A;  3J7A F;  1QP2 A;  1RI0 A;  4LXC A;  4PJO A;  3REB B;  2PVD B;  4JPB W;  4XAX B;  4JRP A;  2CP5 A;  3EHQ A;  3OS2 A;  8AT1 B;  1NYG A;  5CQX A;  4FSS A;  4GY5 A;  2C0T A;  2KT8 A;  3S3N A;  1NEG A;  2OTL T;  4Z8A A;  2JT4 A;  5J3B A;  2DZC A;  2K3Y A;  3QII A;  2HNI A;  1HYO A;  1K73 U;  4CC2 A;  3CCJ Q;  1Y96 A;  3CCQ Q;  1EZZ B;  3CCS Q;  4EPC A;  3OS1 A;  1KK7 A;  3OYG A;  2O9V A;  4M4Z A;  4JUV A;  2KRM A;  3LGF A;  1UGQ B;  2EIF A;  4M75 C;  2K3X A;  2HZY A;  1E6H A;  4QQD A;  2BKD N;  3FDR A;  2PUO B;  3VS6 A;  3RMQ A;  4EMK C;  1E6G A;  3PE0 A;  5KCO A;  1XJW B;  3UPU A;  1W2B P;  1FMV A;  1SSH A;  4JLI A;  2E3I A;  4PJO F;  2LJ1 A;  2X51 A;  3L2Z A;  1EFN A;  3CCQ A;  2NUT B;  4M7A E;  1VQP T;  2VXF A;  1M8M A;  2XKO C;  4MZM A;  1MGQ A;  2KEA A;  2CH4 A;  3OYC A;  5GAN 7;  4OMP A;  1K76 A;  3MEA A;  1WQ7 A;  3CCJ T;  5FU7 B;  2CKK A;  2JTF A;  3CCS T;  2YRV A;  1ZA1 B;  3QWX X;  3ER0 A;  1T0H A;  2ZCF B;  1RAA B;  2MAM A;  4Z02 A;  4X9C A;  3CCM A;  1SEM A;  2E64 A;  1C6V X;  3HFO A;  1YJN Q;  1M8V A;  3RIR A;  1D1C A;  3I55 T;  2Y4Y A;  5AT1 B;  2ESW A;  3A8H B;  1GBR A;  2F2V A;  4AFU C;  1M5Q 1;  4AG2 C;  4BY6 C;  1XQH A;  1SRM A;  5GAN f;  1JB0 E;  3OB9 A;  1WZO A;  1OV3 A;  3SWN C;  4D8D A;  2L8D A;  1AWO A;  1YFN A;  3EG1 A;  2DAQ A;  1VQ8 T;  1TUD A;  1R0C B;  1JXM A;  3OYH A;  4DOV A;  4HXJ A;  2YWW A;  2QAS A;  2KXC A;  1BI0 A;  2PZ1 A;  1YJN A;  3X28 B;  3PT9 A;  2RMO A;  3OW2 S;  2JW4 A;  1QCO A;  1WXU A;  2KRS A;  3QZ9 B;  2BZ8 A;  1D0X A;  1R8O B;  3V8J A;  2E1H A;  2C0I A;  2OAU A;  3QJ6 A;  3SEM A;  2DE0 X;  3AHU A;  3ULR B;  4BAC A;  3MP6 A;  1Q81 R;  1OU9 A;  5KYX B;  1X6G A;  3QKJ A;  1AZG B;  2HCK A;  4WF2 A;  5FU6 C;  4OB0 B;  4PLL A;  1CKA A;  2DL7 A;  3V8L A;  2HDA A;  4M75 E;  1KQS P;  2PVG B;  5J39 A;  2ZPF B;  3X25 B;  3DB4 A;  1TWB A;  4JLG A;  4R56 A;  1V1C A;  1HXD A;  2KGT A;  1QVG P;  2DXC A;  3OYE A;  2RQT A;  5GAN d;  3NFC A;  2ED0 A;  5C0M A;  3CCL T;  2P84 A;  3CXC A;  1ARK A;  1M1F A;  2COZ A;  2A0F B;  4FM4 B;  4OP0 A;  3QZ5 B;  2YUN A;  4L6V 5;  5DLQ E;  1M1K C;  1B34 A;  3L2V A;  4B9W A;  2CP3 A;  3WXM B;  1K9M C;  2RHZ A;  7AT1 B;  1TG0 A;  1YHQ Q;  1OI1 A;  3JCM g;  1GCQ C;  3GBQ A;  3TQ7 P;  3OYI A;  1BIA A;  2VC8 A;  5GAM g;  2CSI A;  3C0C A;  1UG1 A;  4RUG A;  2R5A A;  2PNI A;  3I9Q A;  2QQS A;  3EGX B;  4CC4 B;  5CR2 A;  2I0N A;  2LCL A;  3S6W A;  2E6Z A;  2V8K A;  2YUO A;  2M1H A;  2CP0 A;  2O31 A;  4LE9 A;  2KRO A;  1I5L A;  1OQK A;  2AHJ B;  1VQO Q;  3E2U A;  3OMG A;  2X3W D;  1RL2 A;  2P0P A;  1FMW A;  5FU7 C;  4AFS C;  3VS7 A;  3BY7 A;  2CP7 A;  1QWE A;  1YHQ A;  1OPK A;  3CPW P;  4BE0 A;  1RLP C;  2D0Q B;  2RQR A;  2L2P A;  2MMP A;  5IXB A;  3D7S B;  4WCI A;  3P8B B;  2RNA A;  4NL3 A;  1WGS A;  1ZUU A;  3A98 A;  4II1 A;  5GJW B;  4OMF B;  1M4Z A;  4FW1 A;  3CMA T;  3ZEH A;  2DVJ A;  2DFU A;  4FYY B;  5KE2 A;  1U3O A;  1Y57 A;  3WVD B;  3KUF A;  2Y4X A;  3HRS A;  4ZTF A;  2A36 A;  4C92 A;  3NMZ C;  2NUZ A;  1MND A;  4FSX A;  2E5Q A;  1VQO A;  5IXF A;  1UFF A;  1M30 A;  2M02 A;  2EFI A;  5A0D A;  2OJ2 A;  2IVW A;  1Q82 C;  1Q7Y U;  4M7A F;  3CQT A;  2RHX A;  1QVF S;  1TH7 A;  5LJ3 h;  1AHJ B;  1H8K A;  2NYS A;  2QTV A;  1M1K R;  1KIK A;  2YT6 A;  2XID A;  4M7A G;  2KE9 A;  3GLX A;  5CVI A;  2X4Y A;  1LOJ A;  5GAN j;  4M7D C;  5FWC A;  2PU9 B;  3GP8 A;  4B6M A;  2EKO A;  2JNG A;  4MZP A;  2A3L A;  1Y7X A;  4J9G A;  4XTX A;  2L3S A;  1QW1 A;  1VQL Q;  1WJQ A;  4M75 A;  2MCN A;  4J83 A;  2KVQ G;  5GMK e;  2RJC A;  2VGM A;  4RKU E;  4OVA A;  4EDU A;  5GAN 8;  3G71 T;  5IN1 A;  3UF4 A;  3EFO B;  3PFS A;  4EMK A;  1NJI C;  1O9S A;  4N4G A;  2J06 A;  1YJW T;  1K8A C;  2EYX A;  2QEX Q;  3CD6 T;  5D7U A;  4FT2 A;  1IGU A;  2EYQ A;  4A4F A;  2J7I A;  3MEW A;  1Z9Z A;  3AT1 B;  4J9D A;  4FYX B;  2V8J A;  2FZK B;  3O8V A;  2XI9 A;  2F1L A;  2O4X B;  4CI0 C;  2HAX A;  1MMA A;  1H64 1;  1QVG S;  1OU8 A;  1MV3 A;  1VQL A;  1NPP A;  1PKT A;  4BE1 A;  2X9H A;  5EC7 A;  3V7S A;  3CCR A;  2XMF A;  3LGL A;  4IUV A;  4PL6 A;  1PKS A;  3M55 A;  4J9C A;  3JCM f;  1BI2 A;  2QEX A;  4C8Q B;  2FZG B;  2L5Q A;  2DZ9 A;  5A0L A;  2EGC A;  2BZY A;  2KSS A;  2K6D A;  2AK5 A;  4RTV A;  2H8H A;  1VQK Q;  4M75 F;  2GCX A;  1YNZ A;  4LDU A;  1SSF A;  5FRN A;  3JAM E;  4KGZ B;  2CZ1 B;  1VQM Q;  4K11 A;  3PNW C;  4R55 A;  2AZV A;  2RK1 A;  4Y92 A;  5LJ5 g;  3INZ A;  1RUW A;  1AWJ A;  3SWN A;  1X27 A;  4M75 G;  2IG0 A;  1N5Z A;  3M53 A;  1LCK A;  4J8O A;  1C1A A;  5I2S A;  2JN0 A;  5KYU A;  3NHN A;  2LCS A;  2DXT A;  3M4Y A;  4HCZ A;  1BYM A;  4QVD A;  1MMD A;  2Y90 A;  4PJJ A;  1M1G A;  1VQK A;  2EYZ A;  1P92 A;  4J6W A;  2VGN A;  4HCB A;  2RQW A;  4E7L A;  4KBM B;  3LWH A;  3MP1 A;  2KY9 A;  3FJ5 A;  1VQM A;  5ECA A;  1FXX A;  1LNX A;  1PNJ A;  3VS0 A;  2M16 A;  1ZQ1 A;  4M7D E;  2BUD A;  3BDU A;  2YRD A;  2JJ9 A;  2EYW A;  2DBM A;  1PSE A;  1PCX A;  1ZLM A;  4PJL A;  4C8Q D;  2RI2 A;  3JCM d;  5GAN 3;  3CC7 T;  5GAM d;  3OY9 A;  4HVV A;  1NPR A;  1QCF A;  2SEM A;  2LQW A;  2X4J A;  1UDL A;  4LDW A;  2COW A;  5AYF A;  5DY9 A;  2XIC A;  4R0K A;  3M0T A;  3URG A;  1OX8 A;  2DBK A;  2LT4 A;  1M3C A;  3MKD A;  2HEQ A;  3JCM Q;  1RAD B;  5HCK A;  4O6J A;  4E7J A;  1AOJ A;  2QA4 T;  1QQJ A;  1X75 C;  1HJD A;  2RQU A;  1M3A A;  4KUI A;  1OZ3 A;  3X26 B;  3H6Z A;  1IXD A;  1PD0 A;  5KYY B;  2XK0 A;  5I11 A;  3OS5 A;  1U06 A;  2MIO A;  5FW9 A;  3JV3 A;  2DNU A;  1W1F A;  4A4E A;  2OAW A;  4P5N A;  1OX9 A;  1GCQ A;  1K4U S;  4E47 A;  4A4H A;  2DM1 A;  3OA6 A;  2QQB A;  1X01 A;  2FHD A;  1GBQ A;  2JMC A;  4CC7 A;  2KNB B;  4E6R A;  2BE7 D;  2GGR A;  3CC2 T;  4E2F B;  4J6X A;  4ZGJ B;  1C0M A;  1RAE B;  4N4I A;  1FYN A;  5M9O A;  1IRE B;  4IUT A;  4OMN A;  1KC8 R;  2KYM A;  2XDP A;  1WYX A;  4C8Q C;  3THK A;  2EKH A;  1X6B A;  3VS1 A;  1V29 B;  5LJ5 f;  1XOV A;  1N8R C;  1G3S A;  3X24 B;  2XDB A;  2E5K A;  1HD3 A;  4FYV B;  1HSQ A;  2QDY B;  2BIV A;  5CQY A;  5IH2 A;  2QAZ A;  1YIT Q;  5GMK i;  5DLO A;  1Q81 U;  1X2Q A;  2RA2 A;  5GAM j;  1JRI A;  1YCS B;  3QSU A;  2GF7 A;  4HVU A;  3FRN A;  3JSC A;  2KT1 A;  2XHC A;  3QDF A;  4DOW A;  1QVG A;  2A37 A;  3V8K A;  3HHT B;  3QUI A;  4J9H A;  2P4T A;  4JJB A;  4M78 E;  5GAO r;  3CCM Q;  1KD1 R;  1M3B A;  1YIT A;  3OSS C;  1WHJ A;  2AKL A;  3RMS A;  4XQ3 A;  3GF5 A;  5GMK l;  1S1N A;  4JJN K;  2VKN A;  4OMO A;  4ANJ A;  4LUD A;  3L2Q A;  3EG3 A;  2W0Z A;  3RNJ A;  2M0O A;  3EGD B;  1JJ2 P;  4XTW A;  3FB9 A;  1YIT T;  3GNG A;  3VRZ A;  3CCQ T;  1K73 C;  4J5Y A;  4OF1 A;  1UTI A;  4DBF A;  2MYS A;  3CCU Q;  5LJ5 d;  2DIG A;  1AD5 A;  2K2M A;  2JUF A;  2M0Y A;  5D6X A;  1JEG A;  2VV5 A;  1VQ6 Q;  1PSF A;  2RK2 A;  2DER A;  1ZHI A;  1MHN A;  1O75 A;  1X69 A;  1BCM A;  1M2V B;  1WHM A;  4HA8 A;  2GQI A;  1MMG A;  4BI8 B;  5CCA A;  3CCM T;  2WSE E;  2I2L A;  3G4S Q;  3CBM A;  2C0O A;  3UDC A;  1T3L A;  4M7D F;  1H3Z A;  1BI1 A;  3CCU A;  1TS9 A;  2LX9 A;  3QWY A;  1IHW A;  5HK0 A;  3A1P A;  1GRI A;  1PM3 A;  1VQ6 A;  2FG0 A;  1EX4 A;  2QI2 A;  3NTI A;  4C8Q E;  3EAE A;  3C95 A;  2XU8 A;  3JB9 I;  4M7D G;  1G3W A;  1UGR B;  5GAN e;  4RTU A;  3NTH A;  2DEU A;  5GAN 4;  3Q1J A;  3VUZ A;  3J80 E;  1MMN A;  1I0C A;  4M7D B;  1TXQ A;  3EGX A;  2QQR A;  5GMK h;  3G4S A;  3G6E Q;  1M90 U;  1YJN T;  1UUE A;  2LDM A;  1K9A A;  3GIB A;  2FEI A;  2DYB A;  2CP2 A;  3JB9 J;  4BI3 A;  5CIU A;  2COY A;  3G4S T;  3JB9 G;  1G2B A;  3GNF B;  3L2U A;  3N5B B;  2L89 A;  4AFQ C;  2FB7 A;  3OMC A;  4LD6 A;  3HRU A;  5GAO l;  1UEC A;  1D1B A;  1WHK A;  4IKF A;  3E19 A;  1R0B G;  3G6E A;  1RAI B;  4QQG A;  4F7U B;  4XU1 A;  1GFC A;  2RN8 A;  4V2S A;  2PUK B;  3RUX A;  3VS3 A;  1A0N B;  4A53 A;  1VQ7 A;  4HVW A;  2B8A A;  3TSW A;  4Y91 A;  1K0X A;  1ZSZ B;  2QGG A;  1G3Y A;  3H9N A;  3DB3 A;  2RJE A;  1RLQ C;  2SRC A;  4M7D D;  1UB4 A;  5LJ5 j;  3M9Q A;  4JRK A;  4DQ2 A;  3M0Q A;  3LH5 A;  2DRK A;  3M0P A;  3I56 Q;  4ATO A;  3HRT A;  2K5L A;  5I2M A;  3ZL7 C;  2R58 A;  4PFZ A;  1TU0 B;  4Z88 A;  1RAC B;  2EPD A;  4IIO A;  2DK3 A;  4M7A A;  1Y0M A;  4NS5 A;  2EQI A;  4N0A A;  1QCN A;  1W2B S;  2ED1 A;  1FWZ A;  2FPF A;  3JB9 D;  3M59 A;  3UAT A;  3BW1 A;  4JZ4 A;  1Q86 U;  2K5I A;  3CBP A;  5CKF A;  2YLB A;  3EFO A;  2KK4 A;  2NUP B;  3I56 A;  1JJ2 S;  1WXT A;  2WSF E;  3S3M A;  2Z0W A;  2XDD A;  4ME7 A;  2GTO A;  1KSW A;  2F5T X;  1UJ0 A;  4A54 A;  4PFP A;  2H3J A;  2VYT A;  1YHQ T;  3A8G B;  3VUB A;  1VUB A;  4JDS A;  4KH0 B;  1WNL A;  4J6Y A;  5CKH A;  1WQW A;  3UWN A;  2KQW A;  3QO3 A;  4Q5W A;  1BCO A;  4KT0 E;  2ATC B;  4M77 G;  1S72 Q;  1NEB A;  4OGE A;  4C0G A;  4QT7 A;  4C5H A;  4C8Q A;  1N9R A;  3BDL A;  3J81 E;  3NTK A;  4J9E A;  5CKB A;  2D1X A;  3QPH A;  4M77 B;  4M78 G;  2RHU A;  2CT4 A;  1VQO T;  4KRT A;  2QDL A;  3QBY A;  3RER A;  2DL4 A;  2ABL A;  2F5K A;  5I22 A;  1YN8 A;  2CZ7 B;  4M78 B;  1K9M R;  2HMA A;  3SD4 A;  2YRC A;  2X35 A;  1AEY A;  2MPX C;  2CP6 A;  3QG1 A;  5CK9 A;  4QW2 A;  1SF9 A;  5HK3 A;  3MJX A;  1S72 A;  5LJ3 g;  2C06 A;  1MNE A;  1LVK A;  2DVE A;  2KRN A;  3A8M B;  4J9F A;  3L2W A;  3OYF A;  4EMG A;  5L8R E;  2O01 E;  4RTY A;  3V7C A;  1KJW A;  2CH4 W;  2CZ0 B;  3CCR Q;  2DET A;  2CUB A;  3CCE A;  2LZ6 B;  2JMA A;  4HCC A;  4MDX A;  2KDS A;  2LQN A;  4D6W A;  1UGV A;  3CXC P;  3DLL A;  1G3T A;  1Q7Y C;  2EJ9 A;  2DD4 A;  1KQS S;  5D6W A;  4QVC A;  4KGX B;  9ATC B;  2LJ3 A;  3M56 A;  3ZFJ A;  4AG1 C;  4C8Q F;  2NWM A;  1N27 A;  2CDT A;  2DJQ A;  1KFZ A;  5FLX E;  3CCV A;  1NM7 A;  2LJ0 A;  3VYH B;  4ZGD B;  1JXO A;  4M77 D;  4XTY A;  1IRX A;  1QMC A;  1JO8 A;  4C8Q G;  1D0Z A;  1ZSZ C;  2O2O A;  2GQV A;  3HPW A;  5KYN A;  4DEY A;  4M78 D;  3H41 A;  1FMK A;  3CEY A;  1U8R A;  4CRI A;  1VQL T;  2LNH B;  4FL6 A;  1Q82 R;  2LRQ A;  2AZS A;  2J05 A;  4C92 B;  3CCR T;  2DXB A;  4FU6 A;  1T0J A;  4XK8 E;  3JCM c;  2RD1 A;  4GLK A;  3OYB A;  2QEX T;  2V8I A;  1M9S A;  1RAG B;  4ELY C;  3CPF A;  3EG9 A;  1IB8 A;  4E7H A;  3JCM e;  4PJO E;  3UA7 A;  1BIB A;  1UHF A;  5GAM e;  5KYY A;  1ZBJ A;  2QK0 A;  3PIP A;  1PHT A;  2RHI A;  2EQJ A;  6AT1 B;  3OYN A;  1XTD A;  4C0F A;  1ZA2 B;  5GAN 5;  2IIM A;  1KC8 U;  2LC4 A;  1VIE A;  3UA6 A;  2RM4 A;  2DRM A;  2X3X D;  3X20 B;  3PMI A;  5IAY A;  3QJY A;  4RTW A;  5GAO p;  2OTJ Q;  1UJY A;  1MUZ A;  2YUQ A;  1IZ6 A;  4HCK A;  5IHK A;  3L1A A;  2E65 A;  1WA7 A;  3CPW S;  2CGH A;  1NJI R;  1K0S A;  1TOV A;  3PVL A;  1K8A R;  2JTE A;  4XTV A;  1VQ9 Q;  1WFW A;  1VQK T;  1TUC A;  4BB7 A;  4DEX A;  1WIE A;  4KUL A;  4EMH A;  5FWB A;  2FL7 A;  1PC0 A;  3VS4 A;  1VQM T;  4DBQ A;  2QTX A;  4C92 D;  4JJD A;  2OTJ A;  1EIF A;  3T9N A;  4LUE A;  3QXE B;  1W2B A;  1YJ9 Q;  4M77 C;  3A8O B;  2G3R A;  2FPE A;  1VQ9 A;  3SHW A;  1X6O A;  4F7U E;  4PJM A;  1KD1 U;  1MV0 B;  3LW5 E;  5LJ3 f;  4RMO A;  4M78 C;  4TVR A;  2A08 A;  3PGG A;  1WLP B;  2KYB A;  3OYY A;  3PTA A;  3H0I A;  1JJ2 A;  4RCB A;  2ZPB B;  1OPL A;  1YI2 Q;  1DJ7 B;  2WSC E;  1UEB A;  5KYW B;  3OYJ A;  4F17 A;  2HKN A;  5GAN h;  1YJ9 A;  1AWX A;  1Y07 A;  3LYI A;  2YXY A;  4JS4 A;  3MHX A;  2RJF A;  1QWF A;  2RF0 A;  3JCM X;  1IGQ A;  1VOM A;  3OS0 A;  2BZX A;  1D3B B;  2GFA A;  1VQ4 Q;  1W6X A;  2LMJ A;  1GL5 A;  2K4Y A;  4DA4 A;  4L5G A;  1KHI A;  2NUT A;  3OW2 P;  5KE3 A;  1YI2 A;  1G8X A;  3CBO A;  1PG5 B;  4PLI A;  1TUG B;  2ZGW A;  3EGD A;  2EAY A;  2WAC A;  4X1V A;  4BDY A;  2OTL Q;  3KBG A;  4EIK A;  1NZ9 A;  1WHH A;  1OOT A;  3QYH B;  1RAH B;  3C94 A;  2DEQ A;  3FLG A;  2DIQ A;  2ENM A;  3OYL A;  1SHG A;  2M51 A;  5LJ3 d;  1VQ4 A;  2RI3 A;  2QQA A;  2K9G A;  2MOX A;  1YBY A;  4C92 C;  3G7Z A;  1M2V A;  1V76 A;  1G5V A;  1RAF B;  2AKK A;  1BKB A;  1NLP C;  4XTU A;  2L3R A;  3FIF A;  3EFS A;  2OTL A;  1VQ4 T;  3C4S A;  5GAN 2;  4ZN3 A;  2JM8 A;  1KQ2 A;  2DL8 A;  5GAO n;  3M0R A;  4A4K A;  2BTT A;  2R5M A;  1Y71 A;  4D8K A;  1G83 A;  1KQS A;  4VUB A;  2K2V A;  3KXT A;  1VQP Q;  1U5S A;  2MWP A;  2K5F A;  5LJ5 e;  4QKU A;  3SFM A;  4IIM A;  1VQN Q;  4E7Z A;  2O88 A;  4M77 E;  2HD0 A;  1WPY A;  3M57 A;  2YUP A;  3MEV A;  3SB2 A;  2ZZD A;  3REA B;  1J3T A;  2CT3 A;  4AFZ C;  3M54 A;  4Z89 A;  1NBE B;  1YCY A;  2ROL A;  4M7D A;  3JCM J;  2DPP B;  4OML A;  1VIF A;  1ZUY A;  2GNC A;  3TVT A;  2D6F A;  4X34 A;  4JRQ A;  2K79 A;  1OUL A;  3U23 A;  4BDZ A;  1WJS A;  5KYX A;  1VQP A;  1NG2 A;  3HP9 A;  3I55 Q;  3LX7 A;  2JZ2 A;  2DL3 A;  4XU2 A;  1VQN A;  2DF6 A;  2EVR A;  4PK4 A;  3UT1 A;  3OBW A;  2CS7 A;  1Q81 C;  3CCJ A;  1D1A A;  2LQ8 A;  3CCS A;  3M0S A;  4J7I A;  1VQN T;  4IUP A;  4RTX A;  1VQ8 Q;  2DJZ A;  4F7U A;  2F2W A;  3OYD A;  5KH6 A;  1B07 A;  5GAN 6;  4PJO G;  2GFU A;  1SG5 A;  2DTH A;  3HSB A;  2B86 A;  1IO6 A;  5GMK m;  2QG9 B;  3RDV A;  3I55 A;  2DTI A;  2DMO A;  1N8R R;  4LD9 K;  4NL2 A;  2VXE A;  1K1Z A;  4PJO B;  2RHY A;  1QKW A;  1ZSZ A;  4KGV B;  4E7I A;  2FYK A;  1OZ2 A;  1BK2 A;  2JS2 A;  4DBH A;  2DTO A;  4FW2 A;  3JCM P;  4HKE A;  3HL8 A;  1I1J A;  4FYW B;  5D6Y A;  3FJP A;  3CPW A;  3MO8 A;  4RCC A;  3EGU A;  2FO0 A;  3SDZ A;  3VS2 A;  1VQ8 A;  1WHG A;  5FRM A;  2VWF A;  2LP5 A;  3WVE B;  1OEB A; 
#chains in the Genus database with same CATH homology
 1KSW A;  1H3H A;  1UHC A;  2RPN A;  2JXB A;  1UJ0 A;  4K11 A;  1BU1 A;  1VYT A;  2VVK A;  1M27 C;  2AZV A;  4Y92 A;  1RUW A;  1AWJ A;  1SPK A;  1X27 A;  2KBT A;  2OI3 A;  1N5Z A;  1LCK A;  1YWP A;  2L3P A;  1ZX6 A;  2EGA A;  3NHN A;  3EG2 A;  2LCS A;  2DL5 A;  3REB B;  4JPB W;  2YSQ A;  1SHF A;  1NEB A;  3EHQ A;  4QT7 A;  2EBP A;  3NGP A;  2EYZ A;  5GJV B;  1NYG A;  4FSS A;  2HSP A;  4J9E A;  2D1X A;  2C0T A;  2KT8 A;  2RQW A;  1NEG A;  2CT4 A;  4KRT A;  2QDL A;  3FJ5 A;  5ECA A;  4Z8A A;  2JT4 A;  1PNJ A;  2DL4 A;  2ABL A;  3VS0 A;  5I22 A;  1YN8 A;  2EYW A;  2DX1 A;  2EYY A;  1VYU A;  2DBM A;  4CC2 A;  1ZLM A;  1AEY A;  1SRL A;  1GCP A;  3I5S A;  4ZNX A;  2O9V A;  4M4Z A;  4HVV A;  1ZSG A;  2KRM A;  1QCF A;  1T3S A;  2SEM A;  4A63 B;  2KRN A;  2LQW A;  4J9F A;  1H92 A;  1UDL A;  4ESR A;  1E6H A;  4RTY A;  1ABQ A;  4R0K A;  3VS6 A;  1KJW A;  2CH4 W;  3M0T A;  1E6G A;  2CUB A;  3PE0 A;  2LZ6 B;  2KXD A;  2JMA A;  2DBK A;  2LQN A;  2DIL A;  1M3C A;  2YDL A;  1SSH A;  2HEQ A;  1UGV A;  3RBB B;  2LJ1 A;  3EG0 A;  2DA9 A;  1ZUK A;  1WX6 A;  1EFN A;  5HCK A;  1BBZ A;  2LJ3 A;  4JZ3 A;  1AOJ A;  4AG1 C;  1HJD A;  1M8M A;  2NWM A;  1WI7 A;  2CSQ A;  2RQU A;  1M3A A;  2CDT A;  2KEA A;  2CH4 A;  2DJQ A;  1KFZ A;  1JU5 C;  1NM7 A;  4OMP A;  3IQL A;  1K76 A;  2LJ0 A;  1NYF A;  5I11 A;  1JXO A;  1U06 A;  1CKB A;  2MIO A;  5FW9 A;  1JO8 A;  1QKX A;  3JV3 A;  2DNU A;  1RI9 A;  3QWX X;  2O9S A;  2O2O A;  1W1F A;  2P4R A;  1T0H A;  4OMQ A;  1X43 A;  2OAW A;  4DEY A;  3H41 A;  1FMK A;  1SEM A;  1GCQ A;  1K4U S;  2LNH B;  5IHI A;  2PTK A;  2DM1 A;  2ESW A;  2ECZ A;  2AZS A;  2J05 A;  1GBR A;  1X2K A;  1YP5 A;  2F2V A;  1GBQ A;  4AFU C;  1T0J A;  2JMC A;  4CC7 A;  4AG2 C;  2KNB B;  1VYV A;  1SRM A;  4E6R A;  1PRM C;  2GGR A;  2FPD A;  1OV3 A;  4D8D A;  3UA7 A;  1UHF A;  1AWO A;  2D8J A;  1ZBJ A;  3EG1 A;  2CUD A;  1PHT A;  1TUD A;  1FYN A;  2D0N A;  1JXM A;  4HXJ A;  1WXB A;  4OMN A;  2KXC A;  2PZ1 A;  2KYM A;  2IIM A;  2RMO A;  1QLY A;  1WYX A;  3THK A;  1WDX A;  2EKH A;  2JW4 A;  1X6B A;  3UA6 A;  2RQV A;  1WXU A;  2DRM A;  2X3X D;  3VS1 A;  4RTW A;  4CC3 A;  2KRS A;  2BZ8 A;  1XOV A;  1MUZ A;  1UJY A;  4F16 A;  2YUQ A;  2C0I A;  2E5K A;  3M0U A;  4HCK A;  5IHK A;  1HD3 A;  3SEM A;  1HSQ A;  3NPF A;  1WA7 A;  1B3Q A;  2K3B A;  1K0S A;  2DE0 X;  1BB9 A;  3ULR B;  3PVL A;  2JTE A;  5IH2 A;  1WFW A;  1X6G A;  1AZG B;  1TUC A;  1Z9Q A;  2HCK A;  4DEX A;  1WIE A;  5FWB A;  1X2Q A;  1CKA A;  2DL7 A;  3VS4 A;  2HDA A;  2JM9 A;  1YCS B;  4HVU A;  4JJD A;  3I5R A;  1V1C A;  2KT1 A;  5IHN A;  1AVZ C;  4LUE A;  2A37 A;  2KGT A;  4LN2 A;  2F2X A;  4J9H A;  2RQT A;  4JJB A;  2ED0 A;  2FPE A;  3VRY A;  1M3B A;  3SHW A;  3TSZ A;  1ARK A;  2AKL A;  1MV0 B;  2A08 A;  2L0A A;  1WLP B;  2YUN A;  1S1N A;  2KYB A;  3H0I A;  2VKN A;  4OMO A;  4LUD A;  1PRL C;  3I35 A;  2FRY A;  3EG3 A;  2W0Z A;  3RNJ A;  2GBQ A;  1OPL A;  1YWO A;  1UE9 A;  3VRZ A;  3VS5 A;  1UTI A;  3H0F A;  4RTT A;  4F17 A;  1AD5 A;  2K2M A;  2EW3 A;  4J9B A;  1AWX A;  2M0Y A;  1JEG A;  1TG0 A;  1GCQ C;  3GBQ A;  1QWF A;  2RF0 A;  2CSI A;  3C0C A;  1UG1 A;  4RUG A;  2PNI A;  3I9Q A;  1X69 A;  2BZX A;  4J9I A;  2V1Q A;  2LP5 A;  1W6X A;  4CC4 B;  2LMJ A;  2GQI A;  3O5Z A;  1GL5 A;  2I0N A;  2YUO A;  2L3Q A;  1PWT A;  1NLO C;  3PVQ A;  2J6K A;  2O31 A;  4LE9 A;  2KRO A;  2C0O A;  1T3L A;  2EGE A;  2W10 A;  2X3W D;  4X1V A;  3QWY A;  4AFS C;  1GRI A;  3VS7 A;  1QWE A;  4EIK A;  2FG0 A;  1OPK A;  1RLP C;  1OOT A;  2RQR A;  2L2P A;  2ENM A;  4JJC A;  5IXB A;  1SHG A;  2M51 A;  4WCI A;  2RNA A;  1ZUU A;  3A98 A;  5GJW B;  2DVJ A;  4RTU A;  2K9G A;  1U3O A;  1Y57 A;  2MOX A;  1I0C A;  2A36 A;  3NMZ C;  2NUZ A;  5IXF A;  2AKK A;  1UFF A;  1NLP C;  1ABO A;  1M30 A;  1UUE A;  1K9A A;  2CRE A;  2JM8 A;  2FEI A;  2DL8 A;  2OJ2 A;  4RTZ A;  3M0R A;  2DYB A;  1AZE A;  3CQT A;  2BTT A;  4D8K A;  1G2B A;  1G83 A;  1AWW A;  2DLP A;  1H8K A;  2V1R A;  1U5S A;  4AFQ C;  3EHR A;  2A28 A;  4IIM A;  1UEC A;  1KIK A;  2YT6 A;  2O88 A;  2G6F X;  2YUP A;  2KE9 A;  3R6N A;  3REA B;  1J3T A;  4OMM A;  2GTJ A;  2CT3 A;  5FWC A;  4AFZ C;  4Z89 A;  1GFC A;  2ROL A;  2RN8 A;  4LNP A;  2ROT A;  4OML A;  4GLM A;  1ZUY A;  2GNC A;  3TVT A;  3VS3 A;  1A0N B;  4J9G A;  2K79 A;  2L3S A;  3U23 A;  4HVW A;  3TSW A;  1K0X A;  2MCN A;  4GBQ A;  1NG2 A;  2DL3 A;  2D8H A;  2DF6 A;  2EVR A;  3UF4 A;  1W70 A;  2KR3 A;  1RLQ C;  2SRC A;  2K7A A;  2J06 A;  2EYX A;  2FRW A;  3M0Q A;  3LH5 A;  2DRK A;  3M0P A;  2J6O A;  2J7I A;  3M0S A;  1Z9Z A;  4J9D A;  3KFV A;  3ZL7 C;  1GFD A;  4RTX A;  2LX7 A;  2F2W A;  1CSK A;  1B07 A;  4Z88 A;  2EPD A;  2HBW A;  4IIO A;  4F14 A;  1MV3 A;  1Y0M A;  2J6F A;  1VA7 A;  2JS0 A;  1PKT A;  2EQI A;  2ED1 A;  2FPF A;  2B86 A;  1IO6 A;  5EC7 A;  2DMO A;  2XMF A;  1I07 A;  1K1Z A;  3UAT A;  1PKS A;  4J9C A;  1QKW A;  4JZ4 A;  1BK2 A;  2JS2 A;  4ORZ A;  1JQQ A;  1I1J A;  2EGC A;  2BZY A;  2K6D A;  3EGU A;  1E7O A;  2FO0 A;  1WXT A;  2AK5 A;  3H0H A;  4RTV A;  2H8H A;  3VS2 A;  1YNZ A;  5L23 A;  2VWF A;  2GTO A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...