1W70A

Sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'LIKHMRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
molecule tags Sh3 domain
source organism Homo sapiens
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w70A00
4AG1C 1SHFA 2GNCA 1GL5A 1VYVA 2LQNA 2AZSA 3PE0A 2GTJA 2ED1A 1RI9A 1VA7A 1AWJA 2A08A 1OPKA 1TUCA 2GGRA 4AFSC 2LX7A 1WXBA 4Z88A 1PKSA 1G83A 1UGVA 1WLPB 1YCSB 4HCKA 4JZ3A 1AWOA 3VS6A 2K79A 1RLPC 2KBTA 2EGEA 3VS0A 2RMOA 1TUDA 2QDLA 3I35A 2DL5A 4DEYA 4R0KA 1K4US 1BB9A 1Y57A 1SPKA 1X6BA 4OMOA 1GBQA 2L3PA 2NUZA 2LJ0A 4OMLA 2JTEA 1K0XA 4JJBA 1CKBA 1UECA 2EYWA 2JMAA 4RTXA 5I11A 2FPFA 2LJ1A 4ESRA 1YWOA 3VS3A 3VS2A 2K7AA 2MOXA 3PVQA 4J9CA 1ZUYA 4ORZA 3REAB 1OV3A 2KRNA 2J05A 1ZSGA 2C0IA 1ZUUA 1E6GA 3GBQA 3SEMA 2ABLA 2RQRA 1KJWA 3UA7A 1T3SA 2HSPA 2SRCA 3KFVA 1PRMC 3RNJA 5EC7A 1M8MA 3NHNA 2V1RA 2CH4W 1RLQC 1X27A 2A37A 1PRLC 4DEXA 5IH2A 1H3HA 3EG3A 1M3CA 1M30A 1X69A 1PNJA 2X3XD 2ROTA 2YUPA 1Y0MA 2CT3A 4GLMA 1A0NB 1I0CA 2FG0A 1K9AA 2DYBA 1KFZA 3M0RA 2JW4A 1AZEA 1H92A 2O2OA 3CQTA 2LMJA 1MV3A 1HD3A 4LNPA 4OMQA 3JV3A 4RTWA 1AWWA 4CC3A 2OI3A 1I1JA 2H8HA 1AZGB 1ABQA 1X2QA 1WYXA 2K6DA 3TVTA 2RQWA 2RF0A 1WDXA 2LNHB 2O31A 1Z9QA 1U3OA 1X6GA 3THKA 3REBB 3VS4A 1Z9ZA 1JU5C 2EW3A 2J6FA 2LCSA 1UJ0A 2KYMA 2I0NA 2MIOA 3M0SA 2AKLA 2G6FX 1E6HA 2DE0X 1NM7A 1E7OA 2OAWA 4JZ4A 4AFUC 2W0ZA 2O9VA 1T3LA 2VVKA 3H41A 4AG2C 3NGPA 2JM9A 4J9DA 2CSIA 4JJCA 2L0AA 4WCIA 1AWXA 3C0CA 4HVVA 2KEAA 1OPLA 1QKWA 2EVRA 1NG2A 1M3AA 2KR3A 2W10A 1GCPA 1WA7A 1WXUA 5GJVB 1ARKA 1W1FA 2FRYA 2JT4A 1UHFA 2CH4A 1ZLMA 4J9GA 2CUBA 3LH5A 2ROLA 2C0OA 4IIOA 1WIEA 2RN8A 2C0TA 1OEBA 1UJYA 2LZ6B 3R6NA 1QLYA 1ABOA 2KGTA 2DF6A 3NMZC 2YSQA 2FRWA 1UTIA 3ZL7C 3VS5A 1BK2A 1UE9A 2JXBA 3VRZA 2VWFA 2YUOA 2OJ2A 3H0FA 2CSQA 2JS2A 2KRSA 5IHKA 2CT4A 2KT8A 2EYXA 2YUQA 2BZ8A 5FWCA 4X1VA 1QKXA 1QWFA 5L23A 1I07A 2CDTA 2DLPA 4AFZC 2RNAA 2DA9A 1SHGA 1NLOC 2M51A 3O5ZA 1YNZA 2ESWA 4Y92A 2X3WD 1IO6A 3U23A 2HDAA 2F2XA 2KXDA 2DRKA 2M0YA 1RUWA 2JS0A 3VRYA 4J9EA 2E5KA 2RQUA 1YWPA 1J3TA 4LE9A 1GBRA 2L3QA 4Z8AA 2EBPA 1GRIA 1BU1A 1JXOA 2VKNA 1T0JA 4RTTA 1W6XA 4F14A 1MV0B 1WXTA 2YDLA 1AVZC 2ENMA 5FW9A 1NYFA 2AZVA 2J06A 4FSSA 4D8KA 2EPDA 3UF4A 1KSWA 1W70A 3M0UA 1JO8A 4OMMA 1HJDA 3TSZA 2J7IA 2A36A 1X2KA 2EYYA 5IHIA 2O9SA 2DL3A 2PZ1A 4RTYA 1WFWA 2EYZA 2LP5A 2HCKA 3M0TA 3EG0A 1K76A 2DM1A 4LUEA 3I9QA 4M4ZA 3SHWA 2DMOA 2AKKA 2KE9A 4OMNA 2BTTA 2D0NA 1SRLA 1UHCA 2XMFA 2NWMA 4RTZA 5IXFA 2DL7A 2P4RA 4CC4B 2GTOA 1U06A 4QT7A 1OOTA 1HSQA 2KRMA 2EKHA 3EG1A 1CKAA 2FPEA 5ECAA 2YUNA 3M0PA 2V1QA 2AK5A 1H8KA 4OMPA 1QCFA 3ULRB 1GCQC 2DJQA 2FO0A 3IQLA 1CSKA 2KT1A 1PWTA 1SEMA 1NEBA 2JM8A 1K0SA 1XOVA 4CC2A 5GJWB 4J9BA 2CUDA 4RTVA 1JXMA 2DNUA 2EGAA 1V1CA 2EQIA 2DBKA 1GFCA 3EHQA 1B07A 3RBBB 2B86A 3A98A 5FWBA 3I5SA 2O88A 1ZUKA 4JPBW 3TSWA 2YT6A 2FPDA 3EG2A 4F16A 2ECZA 2D8HA 2DL4A 2KXCA 1YP5A 2KNBB 4E6RA 2LQWA 2K3BA 5HCKA 4Z89A 1FMKA 2RQTA 4HXJA 3QWXX 1EFNA 5IXBA 1T0HA 4J9HA 3VS1A 1JQQA 2LJ3A 2HBWA 2IIMA 1M3BA 1GFDA 1K1ZA 1ZBJA 1BBZA 1SRMA 2A28A 2PNIA 4D8DA 4J9FA 1LCKA 1M27C 1NLPC 1SSHA 2BZYA 2DBMA 2EGCA 1S1NA 2DILA 3NPFA 3QWYA 2FEIA 3I5RA 5IHNA 4A63B 1WX6A 2GBQA 2PTKA 4CC7A 2GQIA 3H0HA 1WI7A 1PKTA 2K9GA 1GCQA 2J6OA 1NYGA 3EGUA 4HVWA 4EIKA 4IIMA 5I22A 2D8JA 4KRTA 1FYNA 3H0IA 1VYTA 2ED0A 1PHTA 1TG0A 4F17A 2HEQA 3VS7A 2DRMA 2F2VA 1MUZA 2SEMA 3FJ5A 1QWEA 4LUDA 2J6KA 2DVJA 3UA6A 4J9IA 4K11A 1AOJA 1G2BA 4ZNXA 4AFQC 1U5SA 4HVUA 1ZX6A 2DL8A 4RUGA 1UG1A 1AEYA 1JEGA 2L2PA 1NEGA 2KROA 2MCNA 3PVLA 1X43A 2JMCA 4GBQA 2K2MA 1UDLA 2RPNA 1B3QA 1UUEA 2CREA 4JJDA 2BZXA 1AD5A 4RTUA 2F2WA 2L3SA 2DX1A 3M0QA 1UFFA 1YN8A 3UATA 1KIKA 1VYUA 2KYBA 1N5ZA 2D1XA 2RQVA 3EHRA 4LN2A
chains in the Genus database with same CATH superfamily
4M7AC 3MPUB 2GNCA 5CR2A 4WF2A 3G4SA 2DEUA 2EQMA 4RCBA 1RI9A 1VA7A 3E1SA 1OPKA 1WJRA 4AFSC 1RADB 1PKSA 4JZ3A 5HK0A 1VQPT 1AWOA 1M1KU 3I55Q 1RLPC 3EAEA 4KUIA 1D3BA 2KBTA 3BFMA 3QZ5B 1TUDA 1VQ5Q 3RIRA 1M90R 5HK3A 5GMKm 1K4US 1BB9A 1Y57A 2XD0A 5CQXA 4HT8A 5CKBA 4PJOB 4OMLA 2JTEA 3OQ5A 1K0XA 4JJBA 2FHDA 4II1A 1UECA 2EYWA 4C92F 1KD1R 5I11A 5A0GA 1YITT 4J8OA 1KC8C 2L3RA 2LJ1A 3E9GA 2XIDA 1JRIA 3FEOA 1I5OB 3E19A 4ORZA 2VB6A 3NTHA 4M78G 1OV3A 5FRNA 3GOXA 2FB7A 2QTVA 1ZUUA 4M77F 3JB9F 4M7DE 4BD3A 1KJWA 5LJ5f 3QO3A 1PRMC 4ELYC 1PCXA 1M8MA 3JCMW 3JB9H 5A2QE 1RLQC 2A37A 1H3HA 1M3CA 2GFAA 3CCSA 2ROTA 4EPCA 1FXXA 2DO3A 3L2RA 4EDUA 3O8VA 4N0AC 2E5QA 3GLXA 2QQRA 1K9AA 4HKEA 3OYDA 3CC4Q 2JW4A 3MKDA 1AZEA 4M77A 2HAXA 1MV3A 4KUDK 4F04B 4M78B 4MMLA 4RTWA 1H641 5HY6A 1VQ9Q 1IREB 3JB9J 4C92C 2V8JA 3LGLA 4PJOA 1AZGB 1X2QA 1W2BP 4M7DC 1WDXA 1ACMB 1Z9QA 2OAUA 3VS4A 1Z9ZA 2EW3A 5KYYB 2I0NA 1YJWT 3FIFA 4LDUA 1E6HA 1F1BB 4R55A 1E7OA 2OAWA 3A8OB 3EG9B 4JZ4A 2W0ZA 2CP6A 3V7RA 1N27A 2VVKA 1IXDA 3CMEQ 4AG2C 1VQ6T 2DVEA 2DFUA 3FJPA 4O6JA 3I55A 3L42A 2ZGWA 2BKDN 1M3AA 2KR3A 2RJDA 4JRPA 3J7AF 4M7AF 2X35A 5IT9E 1IHWA 4L59A 2ZAEA 4D6WA 3I55T 3Q1JA 5D6WA 1WPYA 2DAQA 2CH4A 1C6VX 5GANg 3LH5A 2MK5A 2E6ZA 3GIBA 2RN8A 2DXUA 3QDRB 2OTJT 1M4ZA 4PFZA 4OMFB 2KGTA 4FYYB 2YSQA 1UGRB 3ZL7C 3ZEHA 3VS5A 4N4GA 1NE8A 4Y91A 2AT1B 5D6YA 2CZ7B 3H0FA 2CSQA 4BACA 2KRSA 2KT8A 2EYXA 2YUQA 3CMET 4E7KA 2R5MA 2RHYA 1QKXA 1QWFA 1OU9A 4BB7A 1I07A 2CYZB 3CEYA 1OX8A 2JTMA 4AFZC 1HYOA 1NPPA 1HXDA 2E64A 2PU9B 4CI0C 1YNZA 3HSBA 4Y92A 1KHIA 2ZPEB 1D0YA 2HZYA 4B9WA 2DZCA 2JS0A 4XTXA 2E65A 1YWPA 2LX9A 2HNIA 3QG1A 2O01E 4Z8AA 2M02A 2EBPA 1JXOA 1OQKA 4JRIA 4RTTA 1VQPQ 3DLLA 4F14A 1D1AA 1PSFA 1VQ8Q 1TXQA 3EGXA 1AVZC 1KC8R 4FW2A 1Q86U 3UF4A 4M7AD 3HPWA 4IUQA 3M59A 4N4HA 4OMMA 3I56A 4PJOG 3TSZA 3ZFJA 1M1KR 3DKMA 3VYHB 3OYBA 3OYGA 2EYYA 2O9SA 3DLMA 2OX7A 2YXYA 1YIJT 4M78A 4RTYA 3BY7A 3M0TA 3CCJA 4J5YA 5M9OA 1K76A 3RKYA 3P8HA 4M4ZA 3SHWA 2AKKA 4NL2A 4OMNA 1FX7A 2L8DA 2QGFB 3BDUA 4HA8A 2XMFA 2QA4T 4RTZA 4L5GA 4DBHA 1HK9A 4QT7A 4FYXB 2ZPBB 2KRMA 2I2LA 3EG1A 2M9UA 4M75A 2YUNA 3JCMV 4C8QE 1PSEA 2OTJA 4PJOF 1ZBXA 3ULRB 2DJQA 2DYIA 4M77G 3JB9G 1VQLA 3MHXA 1CSKA 2KT1A 3G4ST 2ZPIB 2JM8A 1K0SA 1VQMA 5HKCA 4XU1A 4J9BA 3CCQA 3WVDB 1MMGA 2K3XA 2XHCA 1W4SA 1B07A 1VQ9T 3RBBB 3A98A 1YI2Q 8ATCB 3I5SA 3OBYA 4M7AA 3INZA 1RAAB 1N9SA 4TVRA 4J83A 3PT9A 3L2QA 1ZHIA 2FPDA 4EMKA 2ZPGB 3QYHB 3D7SB 2D8HA 2MF2A 2RHUA 4QQ6A 3KXTA 1YP5A 1Q7YC 3AHUA 4JDSA 4ANJA 4Z89A 4DQ2A 1TS9A 1KC8U 1EFNA 1VQLT 4IUPA 1NZ9A 3L2UA 2IPOB 5J26A 2LJ3A 1M9SA 4ZGDB 4L6V5 1WHLA 4PFPA 1G3WA 4XU3A 3HHTB 3TREA 1ZBJA 2VASA 3M57A 4C8QB 1BBZA 2EIFA 2CP3A 2PNIA 4J9FA 1LCKA 4DBQA 1QVFA 1NLPC 2BZYA 2EGCA 2XDPA 3I5RA 1YJ9Q 4A63B 1WX6A 1D09B 4CC7A 2GQIA 3H0HA 2KY9A 1WI7A 2YLCA 2CP5A 2K9GA 2G3RA 3V8JA 1NYGA 3EGUA 1OYXA 4QW2A 1WQWA 1O75A 3H0IA 4QVZA 3CCMA 2EWNA 1PHTA 1MUZA 1AT1B 1K73U 5GAMe 2J6KA 1IRXA 4X34A 3S6WA 2GF7A 2EAYA 2XDBA 4E7IA 1U5SA 5GMKj 3CCJT 4FT2A 4RUGA 2CS7A 5DY9A 1UG1A 2VGMA 3J81E 1VQ4Q 3CCLT 2E3IA 5CIUA 2E4HA 1VQOT 1KK7A 5KE3A 5I2MA 5KYYA 2FL7A 2QEXT 1KG1A 2RPNA 1B3QA 2EQJA 3CCMT 2BZXA 2GFUA 3V7SA 1R8OB 1Q81U 4E7HA 1YN8A 2LCLA 1RAIB 3J80E 1BCOA 3OYFA 4C92A 1N5ZA 3DB3A 2RQVA 4FSXA 4ZN1A 4A4HA 4LN2A 3EFRA 4ZGJB 1VQMQ 4M7DA 1VYVA 5GANj 3PGGA 2AZSA 2OTLT 4M7DG 2A08A 3CPWS 2GGRA 2DTOA 5IAYA 4M77B 2WACA 1YCSB 1WLPB 1YI2A 3SWNA 1N8RR 3CCEQ 3QIIA 5LJ3f 3C12A 1IHVA 1C1AA 4J6WA 1QCOA 2QDLA 3I35A 2DL5A 3MJXA 3OS2A 4DEYA 2HL5C 4JJNK 4R0KA 3CPWP 1W2BA 5KCHA 3RESA 1SPKA 4J6YA 4OMOA 4ME7A 1G3TA 1TTHB 2L3PA 4NL3A 4PLIA 3QHSA 3QYGB 1UEBA 1NBEB 4JLGA 1CKBA 2KSSA 4A4FA 3JCMJ 2JMAA 2HQXA 4RTXA 2QQBA 1LVKA 2RJEA 5GANf 1MNEA 1OZ3A 4HCCA 4F7UF 2CP2A 2RK1A 4RG8A 3MP8A 3L2ZA 3KBGA 4PJJA 1AHJB 2DTHA 3ER0A 1ZSGA 4PJOE 1ZSZB 4BDYA 1E6GA 1TWBA 4FM4B 1C0MA 1XJWB 2RQRA 2DIGA 3UA7A 2HSPA 1I81A 3QBYA 1VQKA 2NUPA 4DOVA 2K3YA 2P0PA 1PRLC 5I2SA 2KDSA 2HKNA 1PNJA 2X3XD 1TSFA 4XTVA 5LJ5j 4IUVA 1K9MC 2FG0A 1VQ6A 1KFZA 3M0RA 3HFNA 3CQTA 3CPFA 1Q86C 1HD3A 2RHIA 2NUTA 4C8QC 2DD4A 4LNPA 4CC3A 4M75D 1WYXA 2JUFA 3TVTA 2HBPA 2RF0A 3URGA 3CC2T 3CXCA 2HL3A 3MCAB 2J6FA 3OW2A 2LCSA 2KYMA 3CC2A 3I56T 2FVUA 2DE0X 2YLBA 4QVCA 2K5LA 3SFMA 2COYA 2ZPFB 4QVDA 5KYUA 1BI1A 4M78D 4C92E 4J9DA 2OTLQ 1AWXA 3UDCA 3C0CA 5GAN4 1QKWA 1G8XA 2W10A 1UGPB 3CCVT 3A8GB 1GCPA 4QKUA 3ME9A 3CCET 2K57A 1OI1A 1K73R 1W1FA 2JT4A 1UHFA 3QJYA 3TQ7P 3M5AA 4CRIA 2ROLA 2JZ2A 4IIOA 4F7UB 3LLRA 1WIEA 4IUUA 5GAN7 2RHXA 3RMSA 3SDZA 1M1FA 1Q7YR 2DF6A 2CP0A 3QJ6A 5J3BA 3NFCA 1UTIA 5GAMf 4C0FA 2JXBA 1WHMA 2YUOA 1K9MR 1QCNA 2AHJB 1BYMA 2JS2A 5CKEA 1Q7YU 4C0GA 5IHKA 1YHQQ 2BZ8A 5FWCA 1Q82R 4XTZA 3M9QA 3CCLQ 5GAMj 2DLPA 2RNAA 1N8RC 3QSUA 1NLOC 3CXCP 2Y4YA 4M78F 4C0DB 1W2BS 1QVGS 3E2UA 3JCMX 4M7DB 2X3WD 1IO6A 2HD0A 2HDAA 2F2XA 5GAOn 2M16A 3OW2S 2QAZA 2RD1A 1VQ5A 2M0YA 3JCMh 2DJZA 4ZN3A 3MEWA 5C0MA 1YCYA 2Y4XA 4KGVB 4MZPA 3JCMP 3R6OA 1QVPA 1GRIA 4A53A 1U8RA 3G6EA 2DKGA 1PC0A 2HKQB 4Q5WA 4PK4A 2AZVA 5AT1B 4FSSA 4D8KA 4E47A 2DPPB 2F1LA 5CAIA 1NPRA 2QQSA 3L2WA 4M7AE 1HJDA 2J7IA 2VUBA 3LGFA 5FU7B 1WHHA 1X2KA 3OMCA 2D0QB 3E9FA 1NJIU 1VQ8A 2RH2A 2EYZA 2LP5A 4FIBA 2QEXA 5LJ5h 2HCKA 5DLOA 2DM1A 3I56Q 4M75C 2KE9A 2P4TA 1M8VA 2BTTA 2D0NA 2HQHA 1SRLA 3OYYA 3V8KA 1GXIE 2YRCA 3JCMe 3CC7Q 4JRKA 4M75E 4CC4B 1KD1U 2RJCA 2EKHA 3VUZA 3M4GA 4PFOA 5ECAA 3CCST 3L2VA 4HT9A 2MWOA 4XU0A 4MMKA 2AK5A 2COZA 2R58A 4E7ZA 2DIQA 4OMPA 2JJ9A 2BIVA 1FWZA 2CZ6B 3CCRQ 1ZA2B 3GP8A 4FYWB 5FROA 4C5IA 1D1CA 1U1TA 5CVIA 3G71A 3CMAT 4CC2A 1WJQA 2WSEE 4FU6A 2DNUA 2EGAA 4FYVB 2RK2A 3RKWA 2CGHA 2EQUA 3OA6A 2OTJQ 1KQ1A 1VQLQ 3OB9A 3NTIA 4JPBW 2R5AA 4C8QF 2QG9B 2ATCB 4M77C 1X6OA 2DXTA 1Y96B 3CMAA 3CPWA 2KNBB 4E6RA 3CD6Q 1OX9A 5HCKA 5GANh 1FMKA 4BDZA 4FCYA 1SSFA 4ELZC 2CKKA 2DD5A 3CCUT 2X4WA 4C5HA 5FU7C 1T0HA 3VS1A 3P8BB 3RMQA 4C92D 1LPLA 2NUPB 1BIBA 1K1ZA 3PNWC 3V7CA 1Y96A 2WSCE 1QQJA 3OYCA 4UC4A 4EMHA 4IURA 2BE9B 1SSHA 2DERA 2DILA 1NJIR 2O4XB 1MNDA 1B7TA 4F7UA 2GBQA 2X4XA 2FZCB 2QQ9A 2J6OA 4EIKA 3H6ZA 4IIMA 5I22A 1K9MU 2D8JA 2LRQA 4BE1A 2E1HA 5GAOl 3FB9A 5KYWA 2ED0A 1TG0A 1IB8A 2HEQA 2QEXQ 3VS7A 2LDMA 1KQSP 2SEMA 4C8QD 1QVGA 1RI0A 2DVJA 4IKFA 2MMPA 3CCUQ 4J9IA 1G2BA 1EX4A 1DJ7B 2F69A 1Q81R 5A0DA 4VUBA 1G3SA 1UGQB 2FZKB 1B34B 4M78C 2KROA 1X43A 1JB0E 3RUXA 4GBQA 2PVDB 3PTAA 2CREA 4JJDA 1I4K1 1AD5A 4ZGEB 1UFFA 2HQEA 3LH0A 4PJOC 4QQDA 3LWIA 2KYBA 5CO7A 4JLIA 2XK0A 2D1XA 8AT1B 5KE2A 3EHRA 3JAME 2X4YA 4AG1C 4JS4A 2LQNA 3CC4A 2CZ1B 5FLXE 1TUCA 2LX7A 3MEUA 1WXBA 4MDXA 1UGVA 2YRDA 4HCKA 3VS6A 5D7UA 2K79A 3VKIA 1VOMA 4XU2A 1VQ9A 4KGXB 1Y71A 4YTLA 1S72A 4AMCA 1EIFA 3CCJQ 4E2FB 2RI5A 1VQMT 4F7UE 4FW1A 2C06A 2NUZA 2LJ0A 3M55A 4O5VA 3QPHA 4M77E 4M7DF 5FRMA 1H3ZA 3MEAA 3RERA 3MO8A 4PJLA 2KMTA 4EMKC 3HL8A 3SB2A 2FPFA 4ESRA 3VS2A 2RHZA 2K7AA 3CMEA 2MOXA 2GQVA 3PVQA 3N5BB 1ZUYA 2V26A 1YBYA 5CKFA 3REAB 1YJNT 4PJNA 3OYEA 3NTKA 2J05A 2EJGA 2C0IA 3FLGA 4BY6C 3M56A 3CC4T 3JCMc 4C0DC 2IG0A 4WTOB 4GLKA 1T3SA 2A7YA 2SRCA 3CCQQ 3KFVA 4RCCA 4BI8B 5EC7A 4C5EA 4OF1A 3QUIA 2E41A 2K2VA 3EG3A 1M30A 1X69A 5GMKe 2CT3A 3H8ZA 1M1KC 3G4SQ 2XG8D 2XU8A 2QGGA 4OVAA 3HFOA 2K5FA 2DYBA 3OBWA 3EH2A 3TEEA 3X20B 2O2OA 3CCQT 2LMJA 1Q82C 1V29B 4OB0B 3BE3A 2IVWA 3JV3A 3X25B 4LDYA 1AWWA 2CP7A 5DM7R 1VQ7T 5KYXA 3G6ET 5GAN6 4M7AB 4KH1B 1V76A 2QI2A 2K6DA 1YJNQ 1VQ6Q 1M2VA 2LNHB 2E12A 1X6GA 3REBB 1JU5C 1MGQA 1UJ0A 2MIOA 3M0SA 1RL2A 1TH7A 3GPLA 3CCVQ 2RB6A 2G6FX 1VQKT 3M53A 2VXFA 4N0AA 4AFUC 2X9HA 2XKOC 1WJSA 3OS0A 1VUBA 3CBOA 3H41A 4BI3A 2QASA 3OYJA 4JJCA 1D1BA 1KQSS 4M75B 4WCIA 2RI3A 3CC2Q 4HVVA 1OPLA 2EVRA 1NG2A 1S72Q 1MMNA 1YJWQ 1WA7A 1WXUA 2PUOB 1ZLMA 5GAMd 1IGUA 4XTUA 3WXMB 3JSCA 2C0OA 3VV0A 1MMDA 4PJOD 1LNXA 2C0TA 2LZ6B 3R6NA 1ABOA 3NMZC 4LDWA 2FRWA 1VIFA 1BK2A 1VQNQ 1M5Q1 3C95A 2VWFA 4M78E 2OJ2A 5GAN8 2KI7A 2HSEB 2LQ8A 1ZA1B 2XI9A 1D3BB 1Y07A 4BE2A 1JJ2P 3CBMA 2EQKA 2DA9A 2LQKA 2L5QA 2M51A 3CCEA 3O5ZA 3OW2P 3U23A 3ZBDA 2KVQG 2P84A 1KQ2A 2KXDA 2DRKA 2E10A 3EH1A 3TU4K 2RQUA 3HRUA 1PD1A 1J3TA 4LE9A 2L3QA 4PL6A 2VYTA 1BU1A 4XK8E 1YFNA 1W6XA 3HRTA 4ZTJA 2XICA 3FDRA 1B34A 2YDLA 1M1GA 2ENMA 4A4EA 3SWNC 2A3LA 3V8LA 2J06A 2EPDA 1YJNA 4OGCA 3M0UA 3G7ZA 2QA4Q 2MAMA 2A36A 4LXCA 2QDYB 5KYXB 4M75F 5GANe 3PIOA 2DL3A 2MI6A 2EKOA 1M90U 2EFIA 4B9XA 3EG0A 2RJFA 1IZ6A 5LJ3j 4ZTFA 3HP9A 3OYHA 4DBFA 1BKBA 1BI0A 1TOVA 1UHCA 1PG5B 2NWMA 4N4IA 2DL7A 3AT1B 3GNGA 2GTOA 1U06A 1YJWA 3EFSA 2MYSA 3CXCS 4E7SA 2FPEA 5D6XA 1WHJA 2D9TA 5LL6S 1JJ2A 1QCFA 1GCQC 4KH0B 2E3HA 3CC7A 2VV5A 3A1PA 1NEBA 4A4KA 3M54A 3A5ZB 1XOVA 2CUDA 1ZQ1A 4RTVA 3SWNB 2V8IA 1V1CA 2EQIA 2DBKA 3EHQA 2M1HA 1JJ2S 1O9SA 3CCRA 5C6SA 1K73C 5LJ3d 2V8KA 1ZUKA 3TSWA 4ATOA 1VQPA 4M7AG 5FU6B 4F16A 5A0LA 4MDWA 2ECZA 2DL4A 3CBPA 3HKSA 2KXCA 2B8AA 3RKXA 2LQWA 2JOYA 1RACB 5DLQE 2RQTA 2OTLA 2HMAA 1PD0A 5CKHA 3QWXX 3BDLA 1QP2A 4PKCC 2JVVA 5KCOA 3CCRT 1VIEA 1M2OA 2IIMA 1M3BA 1RAFB 5GAOr 1GFDA 4PLLA 1VQ7A 3OSVA 5LJ3e 2ZCFB 3OY9A 1SRMA 1M27C 1XQHA 3HTRA 2JTFA 2FEIA 1R0BG 1QMCA 5IHNA 3M4YA 3JCMd 1RAEB 2BUDA 1BIAA 1YIJA 2PVOB 2JNGA 4XQ3A 1Y7XA 1OU8A 3UWNA 3EGDB 4RMOA 1YHQA 2ZZDA 3L1AA 2DRMA 3CCLA 3FJ5A 4LUDA 4XTWA 3G1JA 5I21A 9ATCB 1Q82U 3QDFA 3FRNA 2RA2A 1AOJA 2EJFA 4V2SA 3QKJA 4LD6A 1ZX6A 5FU6C 1AEYA 1JEGA 2L2PA 4KGZB 1NEGA 2MCNA 3PVLA 3X26B 3VUBA 1YHQT 1UDLA 4P5NA 1VQKQ 3ASKA 2L3SA 3LYIA 3UATA 1XTDA 1KIKA 4OGEA 1LJOA 3OSSC 5LJ3g 4C92G 7AT1B 5KYNA 3OS1A 1SHFA 1GL5A 3PE0A 2GTJA 2ED1A 3EFOA 1AWJA 1Q86R 3GNFB 4LDVA 3A8LB 1S72T 4Z88A 1G83A 2X51A 1FMVA 2EGEA 2RM4A 2RMOA 3VS0A 2NYSA 1QVFP 3FC3A 4IUTA 1X6BA 5GAN5 2LT1A 1GBQA 3EFOB 4Y28E 1WQ7A 1FMWA 3M58A 5CK9A 4NS5A 2EYQA 4F7UG 3CCMQ 3OS5A 1VQNT 2NLUA 5KYWB 1I5LA 1BI3A 4NOYA 2YRVA 4GY5A 1YWOA 3VS3A 2E70A 1VQ7Q 1K8AU 4J9CA 5GAOm 5GAOq 3OYKA 2H3JA 4FL6A 3VU3C 1BI2A 4C0ZA 4A4GA 3C4SA 1SG5A 2KRNA 2R57A 1IGQA 1Q81C 2JN0A 3CCSQ 3GBQA 3SEMA 2DETA 2ABLA 2PVGB 2DZ9A 2P0KA 5LJ5e 1K8AR 1I8FA 1R0CB 3RNJA 3X28B 3UPUA 3NHNA 5KYUB 2V1RA 3MEVA 4LDXA 2CH4W 1X27A 4J7IA 1KHCA 4DEXA 5IH2A 2QYZA 2XDDA 4DA4A 2PUKB 2VC8A 2YUPA 1Y0MA 5J39A 4GLMA 1A0NB 1I0CA 1LOJA 1RAGB 3PIPA 2BE7D 2DXBA 3CMAQ 2QK0A 1H92A 1U1SA 3CD6A 2LC4A 3QXEB 2COWA 2AIRB 4OMQA 3BW1A 4J6XA 1SF9A 4XAXB 2OI3A 3META 1I1JA 2H8HA 1ABQA 4PNOA 2RQWA 4HCBA 3OYNA 2O31A 1U3OA 1M90C 4EMGA 3JRZA 3THKA 3EG9A 2MWPA 1G3YA 5CCAA 4AT1B 2AKLA 1NM7A 1N8RU 2DK3A 5EG2A 1X01A 2O9VA 3S3OA 1T3LA 1VQOA 3KUFA 1WNLA 3NGPA 5GMKi 2JM9A 2CSIA 2L0AA 2QXFA 3P8DA 2KEAA 5IN1A 3OYLA 3CCVA 1ZSZA 3GF5A 3OMGA 5GAMh 1G5VA 5GJVB 3S3MA 3RR6A 2YWWA 1ARKA 2FRYA 1JBMA 3CCUA 4J9GA 3JCMg 2CUBA 2KK4A 3A8MB 3RDVA 2X4JA 2DEQA 2O4XA 5CKDA 2K5IA 1OEBA 2E6NA 1D0XA 1UJYA 1QLYA 2MPXC 3A8HB 1NJIC 1WHGA 1XNIA 1UE9A 4E7JA 3VRZA 2F5TX 5GANd 4M75G 4MZMA 2CT4A 3LX7A 3JCMf 3PMTA 1WZOA 4X1VA 1VQ4T 3JB9I 4OB1B 5L23A 4DOWA 4B6MA 2CDTA 3C94A 2FZGB 1VQNA 1KD1C 1M2VB 1SHGA 2LTOA 4DBRA 1VQ8T 2LCCA 2QTXA 5AYFA 1VQ4A 2ESWA 3DB4A 1Q95G 4BI4A 5GAN2 4OB2B 1RUWA 4C8QG 4C92B 3TCJA 3VRYA 2EJ9A 4J9EA 4C8QA 2E5KA 2RI2A 2QQAA 1P92A 1GBRA 4BE0A 2ZPHB 2VKNA 1T0JA 2L89A 4BY6B 2RO0A 5L8RE 3PFSA 1MV0B 1WXTA 5GAMg 5FW9A 4X9DA 1NYFA 1QW1A 1KSWA 1UGSB 4RKUE 1W70A 1JO8A 2H3EB 4KBMB 1UB4A 2GCXA 1QP3A 5CQYA 5IHIA 5GAOp 4EMKB 2F5KA 3X24B 2PZ1A 1WFWA 2NUTB 3F70A 1YI2T 4MZTA 4RG2A 1KQSA 4LUEA 3I9QA 5GMKh 1VQOQ 4FT4A 2DMOA 2QA4A 5LJ5d 5IXFA 3OYMA 2P4RA 4KT0E 2Z0WA 4JS5A 4E7LA 1OOTA 1HSQA 2P0QA 1CKAA 1RABB 3LWHA 3M0PA 2V1QA 1H8KA 2Y90A 3JCMQ 3LW5E 1YITA 3VJPA 2FO0A 3IQLA 2LVMA 1MMAA 1PWTA 1SEMA 4JUVA 3CC7T 2LNVA 1QVGP 3S3NA 5GJWB 5LJ3h 1JXMA 3CD6T 2A0FB 1GFCA 3MP1A 1D0ZA 2B86A 4KULA 2KAFA 4X9CA 4QQGA 5FWBA 2O88A 3G6EQ 2KQWA 2YT6A 5KH6A 3EG2A 4R56A 4OP0A 2K3BA 3VYGA 1WGSA 6AT1B 4HXJA 5GMKl 4M7DD 1K8AC 5LJ5g 4BUGA 2WSFE 5IXBA 1MHNA 4J9HA 1YJ9A 1JQQA 2HBWA 3T9NA 3WVEB 2A28A 4D8DA 3SD4A 3G71T 3PMIA 2FYKA 2DTIA 4Z02A 2D6FA 2DBMA 2PQWA 1S1NA 3NPFA 3QWYA 2YHTA 4LD9K 1N9RA 1TU0B 1OZ2A 4A54A 2DXCA 2PTKA 3OYIA 4OB3B 1PKTA 1GCQA 2K4YA 4HVWA 1WHKA 1BCMA 3HRSA 4KRTA 1FYNA 2VGNA 1X75C 1VYTA 4JRQA 3UT1A 4F17A 3G71Q 2F2VA 1QWEA 1N6AA 1OULA 3UA6A 4K11A 3QZ9B 4ZNXA 1YIJQ 4AFQC 1SKUB 1ZSZC 4HVUA 5GAN3 2DL8A 1QVFS 4M77D 3JB9D 3EGDA 4C5GA 3EGXB 1EZZB 4J7FA 4HCZA 2LT4A 1PM3A 2JMCA 2K2MA 2CZ0B 1R77A 1UUEA 3MP6A 3JCMb 4XTYA 4RTUA 2F2WA 2VXEA 3OYAA 3H9NA 2DX1A 3M0QA 1TUGB 4PJMA 1YITQ 1RAHB 1YJ9T 1VQ5T 1VYUA 2M0OA
chains in the Genus database with same CATH topology
4AG1C 1SHFA 2GNCA 1GL5A 1VYVA 2LQNA 2AZSA 3PE0A 2GTJA 2ED1A 1RI9A 1VA7A 1AWJA 2A08A 1OPKA 1TUCA 2GGRA 4AFSC 2LX7A 1WXBA 4Z88A 1PKSA 1G83A 1UGVA 1WLPB 1YCSB 4HCKA 4JZ3A 1AWOA 3VS6A 2K79A 1RLPC 2KBTA 2EGEA 3VS0A 2RMOA 1TUDA 2QDLA 3I35A 2DL5A 4DEYA 4R0KA 1K4US 1BB9A 1Y57A 1SPKA 1X6BA 4OMOA 1GBQA 2L3PA 2NUZA 2LJ0A 4OMLA 2JTEA 1K0XA 4JJBA 1CKBA 1UECA 2EYWA 2JMAA 4RTXA 5I11A 2FPFA 2LJ1A 4ESRA 1YWOA 3VS3A 3VS2A 2K7AA 2MOXA 3PVQA 4J9CA 1ZUYA 4ORZA 3REAB 1OV3A 2KRNA 2J05A 1ZSGA 2C0IA 1ZUUA 1E6GA 3GBQA 3SEMA 2ABLA 2RQRA 1KJWA 3UA7A 1T3SA 2HSPA 2SRCA 3KFVA 1PRMC 3RNJA 5EC7A 1M8MA 3NHNA 2V1RA 2CH4W 1RLQC 1X27A 2A37A 1PRLC 4DEXA 5IH2A 1H3HA 3EG3A 1M3CA 1M30A 1X69A 1PNJA 2X3XD 2ROTA 2YUPA 1Y0MA 2CT3A 4GLMA 1A0NB 1I0CA 2FG0A 1K9AA 2DYBA 1KFZA 3M0RA 2JW4A 1AZEA 1H92A 2O2OA 3CQTA 2LMJA 1MV3A 1HD3A 4LNPA 4OMQA 3JV3A 4RTWA 1AWWA 4CC3A 2OI3A 1I1JA 2H8HA 1AZGB 1ABQA 1X2QA 1WYXA 2K6DA 3TVTA 2RQWA 2RF0A 1WDXA 2LNHB 2O31A 1Z9QA 1U3OA 1X6GA 3THKA 3REBB 3VS4A 1Z9ZA 1JU5C 2EW3A 2J6FA 2LCSA 1UJ0A 2KYMA 2I0NA 2MIOA 3M0SA 2AKLA 2G6FX 1E6HA 2DE0X 1NM7A 1E7OA 2OAWA 4JZ4A 4AFUC 2W0ZA 2O9VA 1T3LA 2VVKA 3H41A 4AG2C 3NGPA 2JM9A 4J9DA 2CSIA 4JJCA 2L0AA 4WCIA 1AWXA 3C0CA 4HVVA 2KEAA 1OPLA 1QKWA 2EVRA 1NG2A 1M3AA 2KR3A 2W10A 1GCPA 1WA7A 1WXUA 5GJVB 1ARKA 1W1FA 2FRYA 2JT4A 1UHFA 2CH4A 1ZLMA 4J9GA 2CUBA 3LH5A 2ROLA 2C0OA 4IIOA 1WIEA 2RN8A 2C0TA 1OEBA 1UJYA 2LZ6B 3R6NA 1QLYA 1ABOA 2KGTA 2DF6A 3NMZC 2YSQA 2FRWA 1UTIA 3ZL7C 3VS5A 1BK2A 1UE9A 2JXBA 3VRZA 2VWFA 2YUOA 2OJ2A 3H0FA 2CSQA 2JS2A 2KRSA 5IHKA 2CT4A 2KT8A 2EYXA 2YUQA 2BZ8A 5FWCA 4X1VA 1QKXA 1QWFA 5L23A 1I07A 2CDTA 2DLPA 4AFZC 2RNAA 2DA9A 1SHGA 1NLOC 2M51A 3O5ZA 1YNZA 2ESWA 4Y92A 2X3WD 1IO6A 3U23A 2HDAA 2F2XA 2KXDA 2DRKA 2M0YA 1RUWA 2JS0A 3VRYA 4J9EA 2E5KA 2RQUA 1YWPA 1J3TA 4LE9A 1GBRA 2L3QA 4Z8AA 2EBPA 1GRIA 1BU1A 1JXOA 2VKNA 1T0JA 4RTTA 1W6XA 4F14A 1MV0B 1WXTA 2YDLA 1AVZC 2ENMA 5FW9A 1NYFA 2AZVA 2J06A 4FSSA 4D8KA 2EPDA 3UF4A 1KSWA 1W70A 3M0UA 1JO8A 4OMMA 1HJDA 3TSZA 2J7IA 2A36A 1X2KA 2EYYA 5IHIA 2O9SA 2DL3A 2PZ1A 4RTYA 1WFWA 2EYZA 2LP5A 2HCKA 3M0TA 3EG0A 1K76A 2DM1A 4LUEA 3I9QA 4M4ZA 3SHWA 2DMOA 2AKKA 2KE9A 4OMNA 2BTTA 2D0NA 1SRLA 1UHCA 2XMFA 2NWMA 4RTZA 5IXFA 2DL7A 2P4RA 4CC4B 2GTOA 1U06A 4QT7A 1OOTA 1HSQA 2KRMA 2EKHA 3EG1A 1CKAA 2FPEA 5ECAA 2YUNA 3M0PA 2V1QA 2AK5A 1H8KA 4OMPA 1QCFA 3ULRB 1GCQC 2DJQA 2FO0A 3IQLA 1CSKA 2KT1A 1PWTA 1SEMA 1NEBA 2JM8A 1K0SA 1XOVA 4CC2A 5GJWB 4J9BA 2CUDA 4RTVA 1JXMA 2DNUA 2EGAA 1V1CA 2EQIA 2DBKA 1GFCA 3EHQA 1B07A 3RBBB 2B86A 3A98A 5FWBA 3I5SA 2O88A 1ZUKA 4JPBW 3TSWA 2YT6A 2FPDA 3EG2A 4F16A 2ECZA 2D8HA 2DL4A 2KXCA 1YP5A 2KNBB 4E6RA 2LQWA 2K3BA 5HCKA 4Z89A 1FMKA 2RQTA 4HXJA 3QWXX 1EFNA 5IXBA 1T0HA 4J9HA 3VS1A 1JQQA 2LJ3A 2HBWA 2IIMA 1M3BA 1GFDA 1K1ZA 1ZBJA 1BBZA 1SRMA 2A28A 2PNIA 4D8DA 4J9FA 1LCKA 1M27C 1NLPC 1SSHA 2BZYA 2DBMA 2EGCA 1S1NA 2DILA 3NPFA 3QWYA 2FEIA 3I5RA 5IHNA 4A63B 1WX6A 2GBQA 2PTKA 4CC7A 2GQIA 3H0HA 1WI7A 1PKTA 2K9GA 1GCQA 2J6OA 1NYGA 3EGUA 4HVWA 4EIKA 4IIMA 5I22A 2D8JA 4KRTA 1FYNA 3H0IA 1VYTA 2ED0A 1PHTA 1TG0A 4F17A 2HEQA 3VS7A 2DRMA 2F2VA 1MUZA 2SEMA 3FJ5A 1QWEA 4LUDA 2J6KA 2DVJA 3UA6A 4J9IA 4K11A 1AOJA 1G2BA 4ZNXA 4AFQC 1U5SA 4HVUA 1ZX6A 2DL8A 4RUGA 1UG1A 1AEYA 1JEGA 2L2PA 1NEGA 2KROA 2MCNA 3PVLA 1X43A 2JMCA 4GBQA 2K2MA 1UDLA 2RPNA 1B3QA 1UUEA 2CREA 4JJDA 2BZXA 1AD5A 4RTUA 2F2WA 2L3SA 2DX1A 3M0QA 1UFFA 1YN8A 3UATA 1KIKA 1VYUA 2KYBA 1N5ZA 2D1XA 2RQVA 3EHRA 4LN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG1 C;  1SHF A;  2GNC A;  1GL5 A;  1VYV A;  2LQN A;  2AZS A;  3PE0 A;  2GTJ A;  2ED1 A;  1RI9 A;  1VA7 A;  1AWJ A;  2A08 A;  1OPK A;  1TUC A;  2GGR A;  4AFS C;  2LX7 A;  1WXB A;  4Z88 A;  1PKS A;  1G83 A;  1UGV A;  1WLP B;  1YCS B;  4HCK A;  4JZ3 A;  1AWO A;  3VS6 A;  2K79 A;  1RLP C;  2KBT A;  2EGE A;  3VS0 A;  2RMO A;  1TUD A;  2QDL A;  3I35 A;  2DL5 A;  4DEY A;  4R0K A;  1K4U S;  1BB9 A;  1Y57 A;  1SPK A;  1X6B A;  4OMO A;  1GBQ A;  2L3P A;  2NUZ A;  2LJ0 A;  4OML A;  2JTE A;  1K0X A;  4JJB A;  1CKB A;  1UEC A;  2EYW A;  2JMA A;  4RTX A;  5I11 A;  2FPF A;  2LJ1 A;  4ESR A;  1YWO A;  3VS3 A;  3VS2 A;  2K7A A;  2MOX A;  3PVQ A;  4J9C A;  1ZUY A;  4ORZ A;  3REA B;  1OV3 A;  2KRN A;  2J05 A;  1ZSG A;  2C0I A;  1ZUU A;  1E6G A;  3GBQ A;  3SEM A;  2ABL A;  2RQR A;  1KJW A;  3UA7 A;  1T3S A;  2HSP A;  2SRC A;  3KFV A;  1PRM C;  3RNJ A;  5EC7 A;  1M8M A;  3NHN A;  2V1R A;  2CH4 W;  1RLQ C;  1X27 A;  2A37 A;  1PRL C;  4DEX A;  5IH2 A;  1H3H A;  3EG3 A;  1M3C A;  1M30 A;  1X69 A;  1PNJ A;  2X3X D;  2ROT A;  2YUP A;  1Y0M A;  2CT3 A;  4GLM A;  1A0N B;  1I0C A;  2FG0 A;  1K9A A;  2DYB A;  1KFZ A;  3M0R A;  2JW4 A;  1AZE A;  1H92 A;  2O2O A;  3CQT A;  2LMJ A;  1MV3 A;  1HD3 A;  4LNP A;  4OMQ A;  3JV3 A;  4RTW A;  1AWW A;  4CC3 A;  2OI3 A;  1I1J A;  2H8H A;  1AZG B;  1ABQ A;  1X2Q A;  1WYX A;  2K6D A;  3TVT A;  2RQW A;  2RF0 A;  1WDX A;  2LNH B;  2O31 A;  1Z9Q A;  1U3O A;  1X6G A;  3THK A;  3REB B;  3VS4 A;  1Z9Z A;  1JU5 C;  2EW3 A;  2J6F A;  2LCS A;  1UJ0 A;  2KYM A;  2I0N A;  2MIO A;  3M0S A;  2AKL A;  2G6F X;  1E6H A;  2DE0 X;  1NM7 A;  1E7O A;  2OAW A;  4JZ4 A;  4AFU C;  2W0Z A;  2O9V A;  1T3L A;  2VVK A;  3H41 A;  4AG2 C;  3NGP A;  2JM9 A;  4J9D A;  2CSI A;  4JJC A;  2L0A A;  4WCI A;  1AWX A;  3C0C A;  4HVV A;  2KEA A;  1OPL A;  1QKW A;  2EVR A;  1NG2 A;  1M3A A;  2KR3 A;  2W10 A;  1GCP A;  1WA7 A;  1WXU A;  5GJV B;  1ARK A;  1W1F A;  2FRY A;  2JT4 A;  1UHF A;  2CH4 A;  1ZLM A;  4J9G A;  2CUB A;  3LH5 A;  2ROL A;  2C0O A;  4IIO A;  1WIE A;  2RN8 A;  2C0T A;  1OEB A;  1UJY A;  2LZ6 B;  3R6N A;  1QLY A;  1ABO A;  2KGT A;  2DF6 A;  3NMZ C;  2YSQ A;  2FRW A;  1UTI A;  3ZL7 C;  3VS5 A;  1BK2 A;  1UE9 A;  2JXB A;  3VRZ A;  2VWF A;  2YUO A;  2OJ2 A;  3H0F A;  2CSQ A;  2JS2 A;  2KRS A;  5IHK A;  2CT4 A;  2KT8 A;  2EYX A;  2YUQ A;  2BZ8 A;  5FWC A;  4X1V A;  1QKX A;  1QWF A;  5L23 A;  1I07 A;  2CDT A;  2DLP A;  4AFZ C;  2RNA A;  2DA9 A;  1SHG A;  1NLO C;  2M51 A;  3O5Z A;  1YNZ A;  2ESW A;  4Y92 A;  2X3W D;  1IO6 A;  3U23 A;  2HDA A;  2F2X A;  2KXD A;  2DRK A;  2M0Y A;  1RUW A;  2JS0 A;  3VRY A;  4J9E A;  2E5K A;  2RQU A;  1YWP A;  1J3T A;  4LE9 A;  1GBR A;  2L3Q A;  4Z8A A;  2EBP A;  1GRI A;  1BU1 A;  1JXO A;  2VKN A;  1T0J A;  4RTT A;  1W6X A;  4F14 A;  1MV0 B;  1WXT A;  2YDL A;  1AVZ C;  2ENM A;  5FW9 A;  1NYF A;  2AZV A;  2J06 A;  4FSS A;  4D8K A;  2EPD A;  3UF4 A;  1KSW A;  1W70 A;  3M0U A;  1JO8 A;  4OMM A;  1HJD A;  3TSZ A;  2J7I A;  2A36 A;  1X2K A;  2EYY A;  5IHI A;  2O9S A;  2DL3 A;  2PZ1 A;  4RTY A;  1WFW A;  2EYZ A;  2LP5 A;  2HCK A;  3M0T A;  3EG0 A;  1K76 A;  2DM1 A;  4LUE A;  3I9Q A;  4M4Z A;  3SHW A;  2DMO A;  2AKK A;  2KE9 A;  4OMN A;  2BTT A;  2D0N A;  1SRL A;  1UHC A;  2XMF A;  2NWM A;  4RTZ A;  5IXF A;  2DL7 A;  2P4R A;  4CC4 B;  2GTO A;  1U06 A;  4QT7 A;  1OOT A;  1HSQ A;  2KRM A;  2EKH A;  3EG1 A;  1CKA A;  2FPE A;  5ECA A;  2YUN A;  3M0P A;  2V1Q A;  2AK5 A;  1H8K A;  4OMP A;  1QCF A;  3ULR B;  1GCQ C;  2DJQ A;  2FO0 A;  3IQL A;  1CSK A;  2KT1 A;  1PWT A;  1SEM A;  1NEB A;  2JM8 A;  1K0S A;  1XOV A;  4CC2 A;  5GJW B;  4J9B A;  2CUD A;  4RTV A;  1JXM A;  2DNU A;  2EGA A;  1V1C A;  2EQI A;  2DBK A;  1GFC A;  3EHQ A;  1B07 A;  3RBB B;  2B86 A;  3A98 A;  5FWB A;  3I5S A;  2O88 A;  1ZUK A;  4JPB W;  3TSW A;  2YT6 A;  2FPD A;  3EG2 A;  4F16 A;  2ECZ A;  2D8H A;  2DL4 A;  2KXC A;  1YP5 A;  2KNB B;  4E6R A;  2LQW A;  2K3B A;  5HCK A;  4Z89 A;  1FMK A;  2RQT A;  4HXJ A;  3QWX X;  1EFN A;  5IXB A;  1T0H A;  4J9H A;  3VS1 A;  1JQQ A;  2LJ3 A;  2HBW A;  2IIM A;  1M3B A;  1GFD A;  1K1Z A;  1ZBJ A;  1BBZ A;  1SRM A;  2A28 A;  2PNI A;  4D8D A;  4J9F A;  1LCK A;  1M27 C;  1NLP C;  1SSH A;  2BZY A;  2DBM A;  2EGC A;  1S1N A;  2DIL A;  3NPF A;  3QWY A;  2FEI A;  3I5R A;  5IHN A;  4A63 B;  1WX6 A;  2GBQ A;  2PTK A;  4CC7 A;  2GQI A;  3H0H A;  1WI7 A;  1PKT A;  2K9G A;  1GCQ A;  2J6O A;  1NYG A;  3EGU A;  4HVW A;  4EIK A;  4IIM A;  5I22 A;  2D8J A;  4KRT A;  1FYN A;  3H0I A;  1VYT A;  2ED0 A;  1PHT A;  1TG0 A;  4F17 A;  2HEQ A;  3VS7 A;  2DRM A;  2F2V A;  1MUZ A;  2SEM A;  3FJ5 A;  1QWE A;  4LUD A;  2J6K A;  2DVJ A;  3UA6 A;  4J9I A;  4K11 A;  1AOJ A;  1G2B A;  4ZNX A;  4AFQ C;  1U5S A;  4HVU A;  1ZX6 A;  2DL8 A;  4RUG A;  1UG1 A;  1AEY A;  1JEG A;  2L2P A;  1NEG A;  2KRO A;  2MCN A;  3PVL A;  1X43 A;  2JMC A;  4GBQ A;  2K2M A;  1UDL A;  2RPN A;  1B3Q A;  1UUE A;  2CRE A;  4JJD A;  2BZX A;  1AD5 A;  4RTU A;  2F2W A;  2L3S A;  2DX1 A;  3M0Q A;  1UFF A;  1YN8 A;  3UAT A;  1KIK A;  1VYU A;  2KYB A;  1N5Z A;  2D1X A;  2RQV A;  3EHR A;  4LN2 A; 
#chains in the Genus database with same CATH topology
 4M7A C;  3MPU B;  2GNC A;  5CR2 A;  4WF2 A;  3G4S A;  2DEU A;  2EQM A;  4RCB A;  1RI9 A;  1VA7 A;  3E1S A;  1OPK A;  1WJR A;  4AFS C;  1RAD B;  1PKS A;  4JZ3 A;  5HK0 A;  1VQP T;  1AWO A;  1M1K U;  3I55 Q;  1RLP C;  3EAE A;  4KUI A;  1D3B A;  2KBT A;  3BFM A;  3QZ5 B;  1TUD A;  1VQ5 Q;  3RIR A;  1M90 R;  5HK3 A;  5GMK m;  1K4U S;  1BB9 A;  1Y57 A;  2XD0 A;  5CQX A;  4HT8 A;  5CKB A;  4PJO B;  4OML A;  2JTE A;  3OQ5 A;  1K0X A;  4JJB A;  2FHD A;  4II1 A;  1UEC A;  2EYW A;  4C92 F;  1KD1 R;  5I11 A;  5A0G A;  1YIT T;  4J8O A;  1KC8 C;  2L3R A;  2LJ1 A;  3E9G A;  2XID A;  1JRI A;  3FEO A;  1I5O B;  3E19 A;  4ORZ A;  2VB6 A;  3NTH A;  4M78 G;  1OV3 A;  5FRN A;  3GOX A;  2FB7 A;  2QTV A;  1ZUU A;  4M77 F;  3JB9 F;  4M7D E;  4BD3 A;  1KJW A;  5LJ5 f;  3QO3 A;  1PRM C;  4ELY C;  1PCX A;  1M8M A;  3JCM W;  3JB9 H;  5A2Q E;  1RLQ C;  2A37 A;  1H3H A;  1M3C A;  2GFA A;  3CCS A;  2ROT A;  4EPC A;  1FXX A;  2DO3 A;  3L2R A;  4EDU A;  3O8V A;  4N0A C;  2E5Q A;  3GLX A;  2QQR A;  1K9A A;  4HKE A;  3OYD A;  3CC4 Q;  2JW4 A;  3MKD A;  1AZE A;  4M77 A;  2HAX A;  1MV3 A;  4KUD K;  4F04 B;  4M78 B;  4MML A;  4RTW A;  1H64 1;  5HY6 A;  1VQ9 Q;  1IRE B;  3JB9 J;  4C92 C;  2V8J A;  3LGL A;  4PJO A;  1AZG B;  1X2Q A;  1W2B P;  4M7D C;  1WDX A;  1ACM B;  1Z9Q A;  2OAU A;  3VS4 A;  1Z9Z A;  2EW3 A;  5KYY B;  2I0N A;  1YJW T;  3FIF A;  4LDU A;  1E6H A;  1F1B B;  4R55 A;  1E7O A;  2OAW A;  3A8O B;  3EG9 B;  4JZ4 A;  2W0Z A;  2CP6 A;  3V7R A;  1N27 A;  2VVK A;  1IXD A;  3CME Q;  4AG2 C;  1VQ6 T;  2DVE A;  2DFU A;  3FJP A;  4O6J A;  3I55 A;  3L42 A;  2ZGW A;  2BKD N;  1M3A A;  2KR3 A;  2RJD A;  4JRP A;  3J7A F;  4M7A F;  2X35 A;  5IT9 E;  1IHW A;  4L59 A;  2ZAE A;  4D6W A;  3I55 T;  3Q1J A;  5D6W A;  1WPY A;  2DAQ A;  2CH4 A;  1C6V X;  5GAN g;  3LH5 A;  2MK5 A;  2E6Z A;  3GIB A;  2RN8 A;  2DXU A;  3QDR B;  2OTJ T;  1M4Z A;  4PFZ A;  4OMF B;  2KGT A;  4FYY B;  2YSQ A;  1UGR B;  3ZL7 C;  3ZEH A;  3VS5 A;  4N4G A;  1NE8 A;  4Y91 A;  2AT1 B;  5D6Y A;  2CZ7 B;  3H0F A;  2CSQ A;  4BAC A;  2KRS A;  2KT8 A;  2EYX A;  2YUQ A;  3CME T;  4E7K A;  2R5M A;  2RHY A;  1QKX A;  1QWF A;  1OU9 A;  4BB7 A;  1I07 A;  2CYZ B;  3CEY A;  1OX8 A;  2JTM A;  4AFZ C;  1HYO A;  1NPP A;  1HXD A;  2E64 A;  2PU9 B;  4CI0 C;  1YNZ A;  3HSB A;  4Y92 A;  1KHI A;  2ZPE B;  1D0Y A;  2HZY A;  4B9W A;  2DZC A;  2JS0 A;  4XTX A;  2E65 A;  1YWP A;  2LX9 A;  2HNI A;  3QG1 A;  2O01 E;  4Z8A A;  2M02 A;  2EBP A;  1JXO A;  1OQK A;  4JRI A;  4RTT A;  1VQP Q;  3DLL A;  4F14 A;  1D1A A;  1PSF A;  1VQ8 Q;  1TXQ A;  3EGX A;  1AVZ C;  1KC8 R;  4FW2 A;  1Q86 U;  3UF4 A;  4M7A D;  3HPW A;  4IUQ A;  3M59 A;  4N4H A;  4OMM A;  3I56 A;  4PJO G;  3TSZ A;  3ZFJ A;  1M1K R;  3DKM A;  3VYH B;  3OYB A;  3OYG A;  2EYY A;  2O9S A;  3DLM A;  2OX7 A;  2YXY A;  1YIJ T;  4M78 A;  4RTY A;  3BY7 A;  3M0T A;  3CCJ A;  4J5Y A;  5M9O A;  1K76 A;  3RKY A;  3P8H A;  4M4Z A;  3SHW A;  2AKK A;  4NL2 A;  4OMN A;  1FX7 A;  2L8D A;  2QGF B;  3BDU A;  4HA8 A;  2XMF A;  2QA4 T;  4RTZ A;  4L5G A;  4DBH A;  1HK9 A;  4QT7 A;  4FYX B;  2ZPB B;  2KRM A;  2I2L A;  3EG1 A;  2M9U A;  4M75 A;  2YUN A;  3JCM V;  4C8Q E;  1PSE A;  2OTJ A;  4PJO F;  1ZBX A;  3ULR B;  2DJQ A;  2DYI A;  4M77 G;  3JB9 G;  1VQL A;  3MHX A;  1CSK A;  2KT1 A;  3G4S T;  2ZPI B;  2JM8 A;  1K0S A;  1VQM A;  5HKC A;  4XU1 A;  4J9B A;  3CCQ A;  3WVD B;  1MMG A;  2K3X A;  2XHC A;  1W4S A;  1B07 A;  1VQ9 T;  3RBB B;  3A98 A;  1YI2 Q;  8ATC B;  3I5S A;  3OBY A;  4M7A A;  3INZ A;  1RAA B;  1N9S A;  4TVR A;  4J83 A;  3PT9 A;  3L2Q A;  1ZHI A;  2FPD A;  4EMK A;  2ZPG B;  3QYH B;  3D7S B;  2D8H A;  2MF2 A;  2RHU A;  4QQ6 A;  3KXT A;  1YP5 A;  1Q7Y C;  3AHU A;  4JDS A;  4ANJ A;  4Z89 A;  4DQ2 A;  1TS9 A;  1KC8 U;  1EFN A;  1VQL T;  4IUP A;  1NZ9 A;  3L2U A;  2IPO B;  5J26 A;  2LJ3 A;  1M9S A;  4ZGD B;  4L6V 5;  1WHL A;  4PFP A;  1G3W A;  4XU3 A;  3HHT B;  3TRE A;  1ZBJ A;  2VAS A;  3M57 A;  4C8Q B;  1BBZ A;  2EIF A;  2CP3 A;  2PNI A;  4J9F A;  1LCK A;  4DBQ A;  1QVF A;  1NLP C;  2BZY A;  2EGC A;  2XDP A;  3I5R A;  1YJ9 Q;  4A63 B;  1WX6 A;  1D09 B;  4CC7 A;  2GQI A;  3H0H A;  2KY9 A;  1WI7 A;  2YLC A;  2CP5 A;  2K9G A;  2G3R A;  3V8J A;  1NYG A;  3EGU A;  1OYX A;  4QW2 A;  1WQW A;  1O75 A;  3H0I A;  4QVZ A;  3CCM A;  2EWN A;  1PHT A;  1MUZ A;  1AT1 B;  1K73 U;  5GAM e;  2J6K A;  1IRX A;  4X34 A;  3S6W A;  2GF7 A;  2EAY A;  2XDB A;  4E7I A;  1U5S A;  5GMK j;  3CCJ T;  4FT2 A;  4RUG A;  2CS7 A;  5DY9 A;  1UG1 A;  2VGM A;  3J81 E;  1VQ4 Q;  3CCL T;  2E3I A;  5CIU A;  2E4H A;  1VQO T;  1KK7 A;  5KE3 A;  5I2M A;  5KYY A;  2FL7 A;  2QEX T;  1KG1 A;  2RPN A;  1B3Q A;  2EQJ A;  3CCM T;  2BZX A;  2GFU A;  3V7S A;  1R8O B;  1Q81 U;  4E7H A;  1YN8 A;  2LCL A;  1RAI B;  3J80 E;  1BCO A;  3OYF A;  4C92 A;  1N5Z A;  3DB3 A;  2RQV A;  4FSX A;  4ZN1 A;  4A4H A;  4LN2 A;  3EFR A;  4ZGJ B;  1VQM Q;  4M7D A;  1VYV A;  5GAN j;  3PGG A;  2AZS A;  2OTL T;  4M7D G;  2A08 A;  3CPW S;  2GGR A;  2DTO A;  5IAY A;  4M77 B;  2WAC A;  1YCS B;  1WLP B;  1YI2 A;  3SWN A;  1N8R R;  3CCE Q;  3QII A;  5LJ3 f;  3C12 A;  1IHV A;  1C1A A;  4J6W A;  1QCO A;  2QDL A;  3I35 A;  2DL5 A;  3MJX A;  3OS2 A;  4DEY A;  2HL5 C;  4JJN K;  4R0K A;  3CPW P;  1W2B A;  5KCH A;  3RES A;  1SPK A;  4J6Y A;  4OMO A;  4ME7 A;  1G3T A;  1TTH B;  2L3P A;  4NL3 A;  4PLI A;  3QHS A;  3QYG B;  1UEB A;  1NBE B;  4JLG A;  1CKB A;  2KSS A;  4A4F A;  3JCM J;  2JMA A;  2HQX A;  4RTX A;  2QQB A;  1LVK A;  2RJE A;  5GAN f;  1MNE A;  1OZ3 A;  4HCC A;  4F7U F;  2CP2 A;  2RK1 A;  4RG8 A;  3MP8 A;  3L2Z A;  3KBG A;  4PJJ A;  1AHJ B;  2DTH A;  3ER0 A;  1ZSG A;  4PJO E;  1ZSZ B;  4BDY A;  1E6G A;  1TWB A;  4FM4 B;  1C0M A;  1XJW B;  2RQR A;  2DIG A;  3UA7 A;  2HSP A;  1I81 A;  3QBY A;  1VQK A;  2NUP A;  4DOV A;  2K3Y A;  2P0P A;  1PRL C;  5I2S A;  2KDS A;  2HKN A;  1PNJ A;  2X3X D;  1TSF A;  4XTV A;  5LJ5 j;  4IUV A;  1K9M C;  2FG0 A;  1VQ6 A;  1KFZ A;  3M0R A;  3HFN A;  3CQT A;  3CPF A;  1Q86 C;  1HD3 A;  2RHI A;  2NUT A;  4C8Q C;  2DD4 A;  4LNP A;  4CC3 A;  4M75 D;  1WYX A;  2JUF A;  3TVT A;  2HBP A;  2RF0 A;  3URG A;  3CC2 T;  3CXC A;  2HL3 A;  3MCA B;  2J6F A;  3OW2 A;  2LCS A;  2KYM A;  3CC2 A;  3I56 T;  2FVU A;  2DE0 X;  2YLB A;  4QVC A;  2K5L A;  3SFM A;  2COY A;  2ZPF B;  4QVD A;  5KYU A;  1BI1 A;  4M78 D;  4C92 E;  4J9D A;  2OTL Q;  1AWX A;  3UDC A;  3C0C A;  5GAN 4;  1QKW A;  1G8X A;  2W10 A;  1UGP B;  3CCV T;  3A8G B;  1GCP A;  4QKU A;  3ME9 A;  3CCE T;  2K57 A;  1OI1 A;  1K73 R;  1W1F A;  2JT4 A;  1UHF A;  3QJY A;  3TQ7 P;  3M5A A;  4CRI A;  2ROL A;  2JZ2 A;  4IIO A;  4F7U B;  3LLR A;  1WIE A;  4IUU A;  5GAN 7;  2RHX A;  3RMS A;  3SDZ A;  1M1F A;  1Q7Y R;  2DF6 A;  2CP0 A;  3QJ6 A;  5J3B A;  3NFC A;  1UTI A;  5GAM f;  4C0F A;  2JXB A;  1WHM A;  2YUO A;  1K9M R;  1QCN A;  2AHJ B;  1BYM A;  2JS2 A;  5CKE A;  1Q7Y U;  4C0G A;  5IHK A;  1YHQ Q;  2BZ8 A;  5FWC A;  1Q82 R;  4XTZ A;  3M9Q A;  3CCL Q;  5GAM j;  2DLP A;  2RNA A;  1N8R C;  3QSU A;  1NLO C;  3CXC P;  2Y4Y A;  4M78 F;  4C0D B;  1W2B S;  1QVG S;  3E2U A;  3JCM X;  4M7D B;  2X3W D;  1IO6 A;  2HD0 A;  2HDA A;  2F2X A;  5GAO n;  2M16 A;  3OW2 S;  2QAZ A;  2RD1 A;  1VQ5 A;  2M0Y A;  3JCM h;  2DJZ A;  4ZN3 A;  3MEW A;  5C0M A;  1YCY A;  2Y4X A;  4KGV B;  4MZP A;  3JCM P;  3R6O A;  1QVP A;  1GRI A;  4A53 A;  1U8R A;  3G6E A;  2DKG A;  1PC0 A;  2HKQ B;  4Q5W A;  4PK4 A;  2AZV A;  5AT1 B;  4FSS A;  4D8K A;  4E47 A;  2DPP B;  2F1L A;  5CAI A;  1NPR A;  2QQS A;  3L2W A;  4M7A E;  1HJD A;  2J7I A;  2VUB A;  3LGF A;  5FU7 B;  1WHH A;  1X2K A;  3OMC A;  2D0Q B;  3E9F A;  1NJI U;  1VQ8 A;  2RH2 A;  2EYZ A;  2LP5 A;  4FIB A;  2QEX A;  5LJ5 h;  2HCK A;  5DLO A;  2DM1 A;  3I56 Q;  4M75 C;  2KE9 A;  2P4T A;  1M8V A;  2BTT A;  2D0N A;  2HQH A;  1SRL A;  3OYY A;  3V8K A;  1GXI E;  2YRC A;  3JCM e;  3CC7 Q;  4JRK A;  4M75 E;  4CC4 B;  1KD1 U;  2RJC A;  2EKH A;  3VUZ A;  3M4G A;  4PFO A;  5ECA A;  3CCS T;  3L2V A;  4HT9 A;  2MWO A;  4XU0 A;  4MMK A;  2AK5 A;  2COZ A;  2R58 A;  4E7Z A;  2DIQ A;  4OMP A;  2JJ9 A;  2BIV A;  1FWZ A;  2CZ6 B;  3CCR Q;  1ZA2 B;  3GP8 A;  4FYW B;  5FRO A;  4C5I A;  1D1C A;  1U1T A;  5CVI A;  3G71 A;  3CMA T;  4CC2 A;  1WJQ A;  2WSE E;  4FU6 A;  2DNU A;  2EGA A;  4FYV B;  2RK2 A;  3RKW A;  2CGH A;  2EQU A;  3OA6 A;  2OTJ Q;  1KQ1 A;  1VQL Q;  3OB9 A;  3NTI A;  4JPB W;  2R5A A;  4C8Q F;  2QG9 B;  2ATC B;  4M77 C;  1X6O A;  2DXT A;  1Y96 B;  3CMA A;  3CPW A;  2KNB B;  4E6R A;  3CD6 Q;  1OX9 A;  5HCK A;  5GAN h;  1FMK A;  4BDZ A;  4FCY A;  1SSF A;  4ELZ C;  2CKK A;  2DD5 A;  3CCU T;  2X4W A;  4C5H A;  5FU7 C;  1T0H A;  3VS1 A;  3P8B B;  3RMQ A;  4C92 D;  1LPL A;  2NUP B;  1BIB A;  1K1Z A;  3PNW C;  3V7C A;  1Y96 A;  2WSC E;  1QQJ A;  3OYC A;  4UC4 A;  4EMH A;  4IUR A;  2BE9 B;  1SSH A;  2DER A;  2DIL A;  1NJI R;  2O4X B;  1MND A;  1B7T A;  4F7U A;  2GBQ A;  2X4X A;  2FZC B;  2QQ9 A;  2J6O A;  4EIK A;  3H6Z A;  4IIM A;  5I22 A;  1K9M U;  2D8J A;  2LRQ A;  4BE1 A;  2E1H A;  5GAO l;  3FB9 A;  5KYW A;  2ED0 A;  1TG0 A;  1IB8 A;  2HEQ A;  2QEX Q;  3VS7 A;  2LDM A;  1KQS P;  2SEM A;  4C8Q D;  1QVG A;  1RI0 A;  2DVJ A;  4IKF A;  2MMP A;  3CCU Q;  4J9I A;  1G2B A;  1EX4 A;  1DJ7 B;  2F69 A;  1Q81 R;  5A0D A;  4VUB A;  1G3S A;  1UGQ B;  2FZK B;  1B34 B;  4M78 C;  2KRO A;  1X43 A;  1JB0 E;  3RUX A;  4GBQ A;  2PVD B;  3PTA A;  2CRE A;  4JJD A;  1I4K 1;  1AD5 A;  4ZGE B;  1UFF A;  2HQE A;  3LH0 A;  4PJO C;  4QQD A;  3LWI A;  2KYB A;  5CO7 A;  4JLI A;  2XK0 A;  2D1X A;  8AT1 B;  5KE2 A;  3EHR A;  3JAM E;  2X4Y A;  4AG1 C;  4JS4 A;  2LQN A;  3CC4 A;  2CZ1 B;  5FLX E;  1TUC A;  2LX7 A;  3MEU A;  1WXB A;  4MDX A;  1UGV A;  2YRD A;  4HCK A;  3VS6 A;  5D7U A;  2K79 A;  3VKI A;  1VOM A;  4XU2 A;  1VQ9 A;  4KGX B;  1Y71 A;  4YTL A;  1S72 A;  4AMC A;  1EIF A;  3CCJ Q;  4E2F B;  2RI5 A;  1VQM T;  4F7U E;  4FW1 A;  2C06 A;  2NUZ A;  2LJ0 A;  3M55 A;  4O5V A;  3QPH A;  4M77 E;  4M7D F;  5FRM A;  1H3Z A;  3MEA A;  3RER A;  3MO8 A;  4PJL A;  2KMT A;  4EMK C;  3HL8 A;  3SB2 A;  2FPF A;  4ESR A;  3VS2 A;  2RHZ A;  2K7A A;  3CME A;  2MOX A;  2GQV A;  3PVQ A;  3N5B B;  1ZUY A;  2V26 A;  1YBY A;  5CKF A;  3REA B;  1YJN T;  4PJN A;  3OYE A;  3NTK A;  2J05 A;  2EJG A;  2C0I A;  3FLG A;  4BY6 C;  3M56 A;  3CC4 T;  3JCM c;  4C0D C;  2IG0 A;  4WTO B;  4GLK A;  1T3S A;  2A7Y A;  2SRC A;  3CCQ Q;  3KFV A;  4RCC A;  4BI8 B;  5EC7 A;  4C5E A;  4OF1 A;  3QUI A;  2E41 A;  2K2V A;  3EG3 A;  1M30 A;  1X69 A;  5GMK e;  2CT3 A;  3H8Z A;  1M1K C;  3G4S Q;  2XG8 D;  2XU8 A;  2QGG A;  4OVA A;  3HFO A;  2K5F A;  2DYB A;  3OBW A;  3EH2 A;  3TEE A;  3X20 B;  2O2O A;  3CCQ T;  2LMJ A;  1Q82 C;  1V29 B;  4OB0 B;  3BE3 A;  2IVW A;  3JV3 A;  3X25 B;  4LDY A;  1AWW A;  2CP7 A;  5DM7 R;  1VQ7 T;  5KYX A;  3G6E T;  5GAN 6;  4M7A B;  4KH1 B;  1V76 A;  2QI2 A;  2K6D A;  1YJN Q;  1VQ6 Q;  1M2V A;  2LNH B;  2E12 A;  1X6G A;  3REB B;  1JU5 C;  1MGQ A;  1UJ0 A;  2MIO A;  3M0S A;  1RL2 A;  1TH7 A;  3GPL A;  3CCV Q;  2RB6 A;  2G6F X;  1VQK T;  3M53 A;  2VXF A;  4N0A A;  4AFU C;  2X9H A;  2XKO C;  1WJS A;  3OS0 A;  1VUB A;  3CBO A;  3H41 A;  4BI3 A;  2QAS A;  3OYJ A;  4JJC A;  1D1B A;  1KQS S;  4M75 B;  4WCI A;  2RI3 A;  3CC2 Q;  4HVV A;  1OPL A;  2EVR A;  1NG2 A;  1S72 Q;  1MMN A;  1YJW Q;  1WA7 A;  1WXU A;  2PUO B;  1ZLM A;  5GAM d;  1IGU A;  4XTU A;  3WXM B;  3JSC A;  2C0O A;  3VV0 A;  1MMD A;  4PJO D;  1LNX A;  2C0T A;  2LZ6 B;  3R6N A;  1ABO A;  3NMZ C;  4LDW A;  2FRW A;  1VIF A;  1BK2 A;  1VQN Q;  1M5Q 1;  3C95 A;  2VWF A;  4M78 E;  2OJ2 A;  5GAN 8;  2KI7 A;  2HSE B;  2LQ8 A;  1ZA1 B;  2XI9 A;  1D3B B;  1Y07 A;  4BE2 A;  1JJ2 P;  3CBM A;  2EQK A;  2DA9 A;  2LQK A;  2L5Q A;  2M51 A;  3CCE A;  3O5Z A;  3OW2 P;  3U23 A;  3ZBD A;  2KVQ G;  2P84 A;  1KQ2 A;  2KXD A;  2DRK A;  2E10 A;  3EH1 A;  3TU4 K;  2RQU A;  3HRU A;  1PD1 A;  1J3T A;  4LE9 A;  2L3Q A;  4PL6 A;  2VYT A;  1BU1 A;  4XK8 E;  1YFN A;  1W6X A;  3HRT A;  4ZTJ A;  2XIC A;  3FDR A;  1B34 A;  2YDL A;  1M1G A;  2ENM A;  4A4E A;  3SWN C;  2A3L A;  3V8L A;  2J06 A;  2EPD A;  1YJN A;  4OGC A;  3M0U A;  3G7Z A;  2QA4 Q;  2MAM A;  2A36 A;  4LXC A;  2QDY B;  5KYX B;  4M75 F;  5GAN e;  3PIO A;  2DL3 A;  2MI6 A;  2EKO A;  1M90 U;  2EFI A;  4B9X A;  3EG0 A;  2RJF A;  1IZ6 A;  5LJ3 j;  4ZTF A;  3HP9 A;  3OYH A;  4DBF A;  1BKB A;  1BI0 A;  1TOV A;  1UHC A;  1PG5 B;  2NWM A;  4N4I A;  2DL7 A;  3AT1 B;  3GNG A;  2GTO A;  1U06 A;  1YJW A;  3EFS A;  2MYS A;  3CXC S;  4E7S A;  2FPE A;  5D6X A;  1WHJ A;  2D9T A;  5LL6 S;  1JJ2 A;  1QCF A;  1GCQ C;  4KH0 B;  2E3H A;  3CC7 A;  2VV5 A;  3A1P A;  1NEB A;  4A4K A;  3M54 A;  3A5Z B;  1XOV A;  2CUD A;  1ZQ1 A;  4RTV A;  3SWN B;  2V8I A;  1V1C A;  2EQI A;  2DBK A;  3EHQ A;  2M1H A;  1JJ2 S;  1O9S A;  3CCR A;  5C6S A;  1K73 C;  5LJ3 d;  2V8K A;  1ZUK A;  3TSW A;  4ATO A;  1VQP A;  4M7A G;  5FU6 B;  4F16 A;  5A0L A;  4MDW A;  2ECZ A;  2DL4 A;  3CBP A;  3HKS A;  2KXC A;  2B8A A;  3RKX A;  2LQW A;  2JOY A;  1RAC B;  5DLQ E;  2RQT A;  2OTL A;  2HMA A;  1PD0 A;  5CKH A;  3QWX X;  3BDL A;  1QP2 A;  4PKC C;  2JVV A;  5KCO A;  3CCR T;  1VIE A;  1M2O A;  2IIM A;  1M3B A;  1RAF B;  5GAO r;  1GFD A;  4PLL A;  1VQ7 A;  3OSV A;  5LJ3 e;  2ZCF B;  3OY9 A;  1SRM A;  1M27 C;  1XQH A;  3HTR A;  2JTF A;  2FEI A;  1R0B G;  1QMC A;  5IHN A;  3M4Y A;  3JCM d;  1RAE B;  2BUD A;  1BIA A;  1YIJ A;  2PVO B;  2JNG A;  4XQ3 A;  1Y7X A;  1OU8 A;  3UWN A;  3EGD B;  4RMO A;  1YHQ A;  2ZZD A;  3L1A A;  2DRM A;  3CCL A;  3FJ5 A;  4LUD A;  4XTW A;  3G1J A;  5I21 A;  9ATC B;  1Q82 U;  3QDF A;  3FRN A;  2RA2 A;  1AOJ A;  2EJF A;  4V2S A;  3QKJ A;  4LD6 A;  1ZX6 A;  5FU6 C;  1AEY A;  1JEG A;  2L2P A;  4KGZ B;  1NEG A;  2MCN A;  3PVL A;  3X26 B;  3VUB A;  1YHQ T;  1UDL A;  4P5N A;  1VQK Q;  3ASK A;  2L3S A;  3LYI A;  3UAT A;  1XTD A;  1KIK A;  4OGE A;  1LJO A;  3OSS C;  5LJ3 g;  4C92 G;  7AT1 B;  5KYN A;  3OS1 A;  1SHF A;  1GL5 A;  3PE0 A;  2GTJ A;  2ED1 A;  3EFO A;  1AWJ A;  1Q86 R;  3GNF B;  4LDV A;  3A8L B;  1S72 T;  4Z88 A;  1G83 A;  2X51 A;  1FMV A;  2EGE A;  2RM4 A;  2RMO A;  3VS0 A;  2NYS A;  1QVF P;  3FC3 A;  4IUT A;  1X6B A;  5GAN 5;  2LT1 A;  1GBQ A;  3EFO B;  4Y28 E;  1WQ7 A;  1FMW A;  3M58 A;  5CK9 A;  4NS5 A;  2EYQ A;  4F7U G;  3CCM Q;  3OS5 A;  1VQN T;  2NLU A;  5KYW B;  1I5L A;  1BI3 A;  4NOY A;  2YRV A;  4GY5 A;  1YWO A;  3VS3 A;  2E70 A;  1VQ7 Q;  1K8A U;  4J9C A;  5GAO m;  5GAO q;  3OYK A;  2H3J A;  4FL6 A;  3VU3 C;  1BI2 A;  4C0Z A;  4A4G A;  3C4S A;  1SG5 A;  2KRN A;  2R57 A;  1IGQ A;  1Q81 C;  2JN0 A;  3CCS Q;  3GBQ A;  3SEM A;  2DET A;  2ABL A;  2PVG B;  2DZ9 A;  2P0K A;  5LJ5 e;  1K8A R;  1I8F A;  1R0C B;  3RNJ A;  3X28 B;  3UPU A;  3NHN A;  5KYU B;  2V1R A;  3MEV A;  4LDX A;  2CH4 W;  1X27 A;  4J7I A;  1KHC A;  4DEX A;  5IH2 A;  2QYZ A;  2XDD A;  4DA4 A;  2PUK B;  2VC8 A;  2YUP A;  1Y0M A;  5J39 A;  4GLM A;  1A0N B;  1I0C A;  1LOJ A;  1RAG B;  3PIP A;  2BE7 D;  2DXB A;  3CMA Q;  2QK0 A;  1H92 A;  1U1S A;  3CD6 A;  2LC4 A;  3QXE B;  2COW A;  2AIR B;  4OMQ A;  3BW1 A;  4J6X A;  1SF9 A;  4XAX B;  2OI3 A;  3MET A;  1I1J A;  2H8H A;  1ABQ A;  4PNO A;  2RQW A;  4HCB A;  3OYN A;  2O31 A;  1U3O A;  1M90 C;  4EMG A;  3JRZ A;  3THK A;  3EG9 A;  2MWP A;  1G3Y A;  5CCA A;  4AT1 B;  2AKL A;  1NM7 A;  1N8R U;  2DK3 A;  5EG2 A;  1X01 A;  2O9V A;  3S3O A;  1T3L A;  1VQO A;  3KUF A;  1WNL A;  3NGP A;  5GMK i;  2JM9 A;  2CSI A;  2L0A A;  2QXF A;  3P8D A;  2KEA A;  5IN1 A;  3OYL A;  3CCV A;  1ZSZ A;  3GF5 A;  3OMG A;  5GAM h;  1G5V A;  5GJV B;  3S3M A;  3RR6 A;  2YWW A;  1ARK A;  2FRY A;  1JBM A;  3CCU A;  4J9G A;  3JCM g;  2CUB A;  2KK4 A;  3A8M B;  3RDV A;  2X4J A;  2DEQ A;  2O4X A;  5CKD A;  2K5I A;  1OEB A;  2E6N A;  1D0X A;  1UJY A;  1QLY A;  2MPX C;  3A8H B;  1NJI C;  1WHG A;  1XNI A;  1UE9 A;  4E7J A;  3VRZ A;  2F5T X;  5GAN d;  4M75 G;  4MZM A;  2CT4 A;  3LX7 A;  3JCM f;  3PMT A;  1WZO A;  4X1V A;  1VQ4 T;  3JB9 I;  4OB1 B;  5L23 A;  4DOW A;  4B6M A;  2CDT A;  3C94 A;  2FZG B;  1VQN A;  1KD1 C;  1M2V B;  1SHG A;  2LTO A;  4DBR A;  1VQ8 T;  2LCC A;  2QTX A;  5AYF A;  1VQ4 A;  2ESW A;  3DB4 A;  1Q95 G;  4BI4 A;  5GAN 2;  4OB2 B;  1RUW A;  4C8Q G;  4C92 B;  3TCJ A;  3VRY A;  2EJ9 A;  4J9E A;  4C8Q A;  2E5K A;  2RI2 A;  2QQA A;  1P92 A;  1GBR A;  4BE0 A;  2ZPH B;  2VKN A;  1T0J A;  2L89 A;  4BY6 B;  2RO0 A;  5L8R E;  3PFS A;  1MV0 B;  1WXT A;  5GAM g;  5FW9 A;  4X9D A;  1NYF A;  1QW1 A;  1KSW A;  1UGS B;  4RKU E;  1W70 A;  1JO8 A;  2H3E B;  4KBM B;  1UB4 A;  2GCX A;  1QP3 A;  5CQY A;  5IHI A;  5GAO p;  4EMK B;  2F5K A;  3X24 B;  2PZ1 A;  1WFW A;  2NUT B;  3F70 A;  1YI2 T;  4MZT A;  4RG2 A;  1KQS A;  4LUE A;  3I9Q A;  5GMK h;  1VQO Q;  4FT4 A;  2DMO A;  2QA4 A;  5LJ5 d;  5IXF A;  3OYM A;  2P4R A;  4KT0 E;  2Z0W A;  4JS5 A;  4E7L A;  1OOT A;  1HSQ A;  2P0Q A;  1CKA A;  1RAB B;  3LWH A;  3M0P A;  2V1Q A;  1H8K A;  2Y90 A;  3JCM Q;  3LW5 E;  1YIT A;  3VJP A;  2FO0 A;  3IQL A;  2LVM A;  1MMA A;  1PWT A;  1SEM A;  4JUV A;  3CC7 T;  2LNV A;  1QVG P;  3S3N A;  5GJW B;  5LJ3 h;  1JXM A;  3CD6 T;  2A0F B;  1GFC A;  3MP1 A;  1D0Z A;  2B86 A;  4KUL A;  2KAF A;  4X9C A;  4QQG A;  5FWB A;  2O88 A;  3G6E Q;  2KQW A;  2YT6 A;  5KH6 A;  3EG2 A;  4R56 A;  4OP0 A;  2K3B A;  3VYG A;  1WGS A;  6AT1 B;  4HXJ A;  5GMK l;  4M7D D;  1K8A C;  5LJ5 g;  4BUG A;  2WSF E;  5IXB A;  1MHN A;  4J9H A;  1YJ9 A;  1JQQ A;  2HBW A;  3T9N A;  3WVE B;  2A28 A;  4D8D A;  3SD4 A;  3G71 T;  3PMI A;  2FYK A;  2DTI A;  4Z02 A;  2D6F A;  2DBM A;  2PQW A;  1S1N A;  3NPF A;  3QWY A;  2YHT A;  4LD9 K;  1N9R A;  1TU0 B;  1OZ2 A;  4A54 A;  2DXC A;  2PTK A;  3OYI A;  4OB3 B;  1PKT A;  1GCQ A;  2K4Y A;  4HVW A;  1WHK A;  1BCM A;  3HRS A;  4KRT A;  1FYN A;  2VGN A;  1X75 C;  1VYT A;  4JRQ A;  3UT1 A;  4F17 A;  3G71 Q;  2F2V A;  1QWE A;  1N6A A;  1OUL A;  3UA6 A;  4K11 A;  3QZ9 B;  4ZNX A;  1YIJ Q;  4AFQ C;  1SKU B;  1ZSZ C;  4HVU A;  5GAN 3;  2DL8 A;  1QVF S;  4M77 D;  3JB9 D;  3EGD A;  4C5G A;  3EGX B;  1EZZ B;  4J7F A;  4HCZ A;  2LT4 A;  1PM3 A;  2JMC A;  2K2M A;  2CZ0 B;  1R77 A;  1UUE A;  3MP6 A;  3JCM b;  4XTY A;  4RTU A;  2F2W A;  2VXE A;  3OYA A;  3H9N A;  2DX1 A;  3M0Q A;  1TUG B;  4PJM A;  1YIT Q;  1RAH B;  1YJ9 T;  1VQ5 T;  1VYU A;  2M0O A; 
#chains in the Genus database with same CATH homology
 4AG1 C;  1SHF A;  2GNC A;  1GL5 A;  1VYV A;  2LQN A;  2AZS A;  3PE0 A;  2GTJ A;  2ED1 A;  1RI9 A;  1VA7 A;  1AWJ A;  2A08 A;  1OPK A;  1TUC A;  2GGR A;  4AFS C;  2LX7 A;  1WXB A;  4Z88 A;  1PKS A;  1G83 A;  1UGV A;  1WLP B;  1YCS B;  4HCK A;  4JZ3 A;  1AWO A;  3VS6 A;  2K79 A;  1RLP C;  2KBT A;  2EGE A;  3VS0 A;  2RMO A;  1TUD A;  2QDL A;  3I35 A;  2DL5 A;  4DEY A;  4R0K A;  1K4U S;  1BB9 A;  1Y57 A;  1SPK A;  1X6B A;  4OMO A;  1GBQ A;  2L3P A;  2NUZ A;  2LJ0 A;  4OML A;  2JTE A;  1K0X A;  4JJB A;  1CKB A;  1UEC A;  2EYW A;  2JMA A;  4RTX A;  5I11 A;  2FPF A;  2LJ1 A;  4ESR A;  1YWO A;  3VS3 A;  3VS2 A;  2K7A A;  2MOX A;  3PVQ A;  4J9C A;  1ZUY A;  4ORZ A;  3REA B;  1OV3 A;  2KRN A;  2J05 A;  1ZSG A;  2C0I A;  1ZUU A;  1E6G A;  3GBQ A;  3SEM A;  2ABL A;  2RQR A;  1KJW A;  3UA7 A;  1T3S A;  2HSP A;  2SRC A;  3KFV A;  1PRM C;  3RNJ A;  5EC7 A;  1M8M A;  3NHN A;  2V1R A;  2CH4 W;  1RLQ C;  1X27 A;  2A37 A;  1PRL C;  4DEX A;  5IH2 A;  1H3H A;  3EG3 A;  1M3C A;  1M30 A;  1X69 A;  1PNJ A;  2X3X D;  2ROT A;  2YUP A;  1Y0M A;  2CT3 A;  4GLM A;  1A0N B;  1I0C A;  2FG0 A;  1K9A A;  2DYB A;  1KFZ A;  3M0R A;  2JW4 A;  1AZE A;  1H92 A;  2O2O A;  3CQT A;  2LMJ A;  1MV3 A;  1HD3 A;  4LNP A;  4OMQ A;  3JV3 A;  4RTW A;  1AWW A;  4CC3 A;  2OI3 A;  1I1J A;  2H8H A;  1AZG B;  1ABQ A;  1X2Q A;  1WYX A;  2K6D A;  3TVT A;  2RQW A;  2RF0 A;  1WDX A;  2LNH B;  2O31 A;  1Z9Q A;  1U3O A;  1X6G A;  3THK A;  3REB B;  3VS4 A;  1Z9Z A;  1JU5 C;  2EW3 A;  2J6F A;  2LCS A;  1UJ0 A;  2KYM A;  2I0N A;  2MIO A;  3M0S A;  2AKL A;  2G6F X;  1E6H A;  2DE0 X;  1NM7 A;  1E7O A;  2OAW A;  4JZ4 A;  4AFU C;  2W0Z A;  2O9V A;  1T3L A;  2VVK A;  3H41 A;  4AG2 C;  3NGP A;  2JM9 A;  4J9D A;  2CSI A;  4JJC A;  2L0A A;  4WCI A;  1AWX A;  3C0C A;  4HVV A;  2KEA A;  1OPL A;  1QKW A;  2EVR A;  1NG2 A;  1M3A A;  2KR3 A;  2W10 A;  1GCP A;  1WA7 A;  1WXU A;  5GJV B;  1ARK A;  1W1F A;  2FRY A;  2JT4 A;  1UHF A;  2CH4 A;  1ZLM A;  4J9G A;  2CUB A;  3LH5 A;  2ROL A;  2C0O A;  4IIO A;  1WIE A;  2RN8 A;  2C0T A;  1OEB A;  1UJY A;  2LZ6 B;  3R6N A;  1QLY A;  1ABO A;  2KGT A;  2DF6 A;  3NMZ C;  2YSQ A;  2FRW A;  1UTI A;  3ZL7 C;  3VS5 A;  1BK2 A;  1UE9 A;  2JXB A;  3VRZ A;  2VWF A;  2YUO A;  2OJ2 A;  3H0F A;  2CSQ A;  2JS2 A;  2KRS A;  5IHK A;  2CT4 A;  2KT8 A;  2EYX A;  2YUQ A;  2BZ8 A;  5FWC A;  4X1V A;  1QKX A;  1QWF A;  5L23 A;  1I07 A;  2CDT A;  2DLP A;  4AFZ C;  2RNA A;  2DA9 A;  1SHG A;  1NLO C;  2M51 A;  3O5Z A;  1YNZ A;  2ESW A;  4Y92 A;  2X3W D;  1IO6 A;  3U23 A;  2HDA A;  2F2X A;  2KXD A;  2DRK A;  2M0Y A;  1RUW A;  2JS0 A;  3VRY A;  4J9E A;  2E5K A;  2RQU A;  1YWP A;  1J3T A;  4LE9 A;  1GBR A;  2L3Q A;  4Z8A A;  2EBP A;  1GRI A;  1BU1 A;  1JXO A;  2VKN A;  1T0J A;  4RTT A;  1W6X A;  4F14 A;  1MV0 B;  1WXT A;  2YDL A;  1AVZ C;  2ENM A;  5FW9 A;  1NYF A;  2AZV A;  2J06 A;  4FSS A;  4D8K A;  2EPD A;  3UF4 A;  1KSW A;  1W70 A;  3M0U A;  1JO8 A;  4OMM A;  1HJD A;  3TSZ A;  2J7I A;  2A36 A;  1X2K A;  2EYY A;  5IHI A;  2O9S A;  2DL3 A;  2PZ1 A;  4RTY A;  1WFW A;  2EYZ A;  2LP5 A;  2HCK A;  3M0T A;  3EG0 A;  1K76 A;  2DM1 A;  4LUE A;  3I9Q A;  4M4Z A;  3SHW A;  2DMO A;  2AKK A;  2KE9 A;  4OMN A;  2BTT A;  2D0N A;  1SRL A;  1UHC A;  2XMF A;  2NWM A;  4RTZ A;  5IXF A;  2DL7 A;  2P4R A;  4CC4 B;  2GTO A;  1U06 A;  4QT7 A;  1OOT A;  1HSQ A;  2KRM A;  2EKH A;  3EG1 A;  1CKA A;  2FPE A;  5ECA A;  2YUN A;  3M0P A;  2V1Q A;  2AK5 A;  1H8K A;  4OMP A;  1QCF A;  3ULR B;  1GCQ C;  2DJQ A;  2FO0 A;  3IQL A;  1CSK A;  2KT1 A;  1PWT A;  1SEM A;  1NEB A;  2JM8 A;  1K0S A;  1XOV A;  4CC2 A;  5GJW B;  4J9B A;  2CUD A;  4RTV A;  1JXM A;  2DNU A;  2EGA A;  1V1C A;  2EQI A;  2DBK A;  1GFC A;  3EHQ A;  1B07 A;  3RBB B;  2B86 A;  3A98 A;  5FWB A;  3I5S A;  2O88 A;  1ZUK A;  4JPB W;  3TSW A;  2YT6 A;  2FPD A;  3EG2 A;  4F16 A;  2ECZ A;  2D8H A;  2DL4 A;  2KXC A;  1YP5 A;  2KNB B;  4E6R A;  2LQW A;  2K3B A;  5HCK A;  4Z89 A;  1FMK A;  2RQT A;  4HXJ A;  3QWX X;  1EFN A;  5IXB A;  1T0H A;  4J9H A;  3VS1 A;  1JQQ A;  2LJ3 A;  2HBW A;  2IIM A;  1M3B A;  1GFD A;  1K1Z A;  1ZBJ A;  1BBZ A;  1SRM A;  2A28 A;  2PNI A;  4D8D A;  4J9F A;  1LCK A;  1M27 C;  1NLP C;  1SSH A;  2BZY A;  2DBM A;  2EGC A;  1S1N A;  2DIL A;  3NPF A;  3QWY A;  2FEI A;  3I5R A;  5IHN A;  4A63 B;  1WX6 A;  2GBQ A;  2PTK A;  4CC7 A;  2GQI A;  3H0H A;  1WI7 A;  1PKT A;  2K9G A;  1GCQ A;  2J6O A;  1NYG A;  3EGU A;  4HVW A;  4EIK A;  4IIM A;  5I22 A;  2D8J A;  4KRT A;  1FYN A;  3H0I A;  1VYT A;  2ED0 A;  1PHT A;  1TG0 A;  4F17 A;  2HEQ A;  3VS7 A;  2DRM A;  2F2V A;  1MUZ A;  2SEM A;  3FJ5 A;  1QWE A;  4LUD A;  2J6K A;  2DVJ A;  3UA6 A;  4J9I A;  4K11 A;  1AOJ A;  1G2B A;  4ZNX A;  4AFQ C;  1U5S A;  4HVU A;  1ZX6 A;  2DL8 A;  4RUG A;  1UG1 A;  1AEY A;  1JEG A;  2L2P A;  1NEG A;  2KRO A;  2MCN A;  3PVL A;  1X43 A;  2JMC A;  4GBQ A;  2K2M A;  1UDL A;  2RPN A;  1B3Q A;  1UUE A;  2CRE A;  4JJD A;  2BZX A;  1AD5 A;  4RTU A;  2F2W A;  2L3S A;  2DX1 A;  3M0Q A;  1UFF A;  1YN8 A;  3UAT A;  1KIK A;  1VYU A;  2KYB A;  1N5Z A;  2D1X A;  2RQV A;  3EHR A;  4LN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...