1W70A

Sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
LIKHMRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w70A00
1QWFA 1K76A 1T3SA 1YCSB 1B3QA 3TSZA 2W10A 2B86A 4JJDA 4F17A 1K1ZA 1SRMA 1NG2A 2KGTA 5IH2A 1M27C 4JJBA 1RUWA 2HSPA 2HBWA 2DE0X 1M3AA 2F2XA 1SHGA 2FPDA 1SPKA 2D0NA 4E6RA 2VKNA 4GLMA 2YUNA 1KFZA 1Y0MA 2ESWA 2DL4A 2DVJA 1V1CA 1NLPC 2ABLA 1JXMA 1Z9ZA 2MIOA 2C0OA 2DLPA 4DEXA 3LH5A 3IQLA 2DNUA 3TSWA 4RTVA 1T3LA 4EIKA 5GJWB 1GBRA 1JU5C 3GBQA 1M8MA 2A08A 2CH4A 2KBTA 3H0IA 3VS6A 1T0HA 1UE9A 1AWJA 3JV3A 1M3BA 2H8HA 1OEBA 2BZ8A 1BU1A 1AZGB 1X2QA 1UFFA 2OAWA 3SHWA 2AKKA 3H41A 1JO8A 1M30A 2EGCA 1VYUA 3VS7A 4RTWA 2DL3A 1K0SA 4JZ3A 2EGEA 1E6HA 1TUDA 1FYNA 4ZNXA 1WXTA 3EG2A 4J9HA 1GFDA 1X2KA 2J6KA 2BTTA 3NGPA 2VVKA 3REAB 1AZEA 4LN2A 3EG0A 4JZ4A 2KEAA 2CDTA 3VRZA 4HVUA 2SEMA 2FEIA 1X43A 1HD3A 2DL7A 1UDLA 2O2OA 1WXUA 2CSIA 1ZUUA 1VYVA 4LNPA 2EPDA 2SRCA 3U23A 2EBPA 4RTYA 3VS2A 1LCKA 2BZYA 2DL8A 1CSKA 2RQRA 4ORZA 2EYYA 3UATA 3H0HA 2GNCA 1X27A 5EC7A 2L3QA 3EGUA 2D8HA 1QWEA 2KR3A 2DA9A 2RQVA 4LUDA 1GBQA 2V1RA 4FSSA 2I0NA 3RNJA 2FPEA 1WX6A 3SEMA 2FRWA 5ECAA 1I0CA 4Z8AA 1UECA 1W70A 4J9BA 2JS0A 1AEYA 2GBQA 1KSWA 1U3OA 4K11A 1X69A 1WDXA 2F2VA 2L3PA 1PHTA 1E7OA 2A28A 3A98A 3M0TA 1Y57A 1NLOC 2CSQA 2D8JA 1WYXA 2JMAA 4D8DA 4DEYA 3UF4A 2J6OA 2YUOA 1QKXA 4LE9A 3VS3A 2CREA 1KIKA 3M0PA 2LP5A 4J9GA 4D8KA 1RLPC 2PZ1A 2K2MA 2K6DA 1NYFA 2KE9A 5IHIA 5IXBA 2A36A 2X3WD 3NHNA 2AZSA 1GFCA 5FWCA 3PE0A 3VRYA 1Z9QA 1G83A 3EHQA 4CC2A 2LJ1A 1TG0A 1ZLMA 1CKAA 4RTTA 2CH4W 1NEGA 4HVVA 2DRKA 2ROLA 2AKLA 5IHNA 1H8KA 4IIMA 1AWWA 2EVRA 2G6FX 4Y92A 2KYBA 5FWBA 2C0TA 3M0UA 1UJYA 2ENMA 2LMJA 2VWFA 2A37A 1WFWA 2CUDA 2FG0A 1RLQC 1ZBJA 2LX7A 3I5SA 2MCNA 2KXDA 1X6BA 1BK2A 2F2WA 2DX1A 2L0AA 2RMOA 1AD5A 3ZL7C 3PVQA 2D1XA 2DYBA 1I07A 2V1QA 2AK5A 1T0JA 2JM9A 2NUZA 2DM1A 4WCIA 2JW4A 1U06A 4J9IA 5IXFA 2GQIA 2EYZA 2NWMA 4CC3A 4HVWA 3I35A 4M4ZA 2QDLA 4RUGA 1YNZA 1J3TA 1YP5A 2KRSA 2W0ZA 3EG3A 1IO6A 4R0KA 2DBKA 4F14A 1TUCA 2ECZA 2KXCA 2JS2A 2JT4A 2X3XD 1E6GA 2KT1A 3I5RA 2O88A 1ABOA 1PKTA 2M51A 2LCSA 2OJ2A 3VS4A 2RN8A 1HSQA 4A63B 2DRMA 1CKBA 4CC4B 3R6NA 1UG1A 1AWOA 1JEGA 2KNBB 3TVTA 4J9EA 1M3CA 1RI9A 4HXJA 4J9FA 1NYGA 1KJWA 1YWOA 2YT6A 1FMKA 1B07A 2DL5A 1NEBA 1WXBA 1QCFA 1JXOA 3VS0A 1GCQC 2J05A 1MUZA 4RTZA 2JMCA 1XOVA 5IHKA 1BB9A 2XMFA 4OMOA 1PRLC 3ULRB 4LUEA 2BZXA 2DILA 2M0YA 2K7AA 1AVZC 1AWXA 2E5KA 3NPFA 3FJ5A 1OPKA 1H92A 5FW9A 2YSQA 3THKA 2HEQA 2ROTA 4AG2C 1SHFA 1I1JA 3O5ZA 2YUPA 1MV3A 2EYXA 2KT8A 3H0FA 3VS1A 2KROA 1SRLA 4J9DA 2LQWA 3M0QA 1UUEA 2K79A 2CUBA 1ZSGA 3QWYA 2HDAA 2AZVA 3UA6A 5GJVB 2PTKA 1UJ0A 4F16A 4GBQA 2RNAA 4Z89A 2KRNA 2DMOA 2L3SA 2RQTA 3NMZC 2HCKA 3M0SA 4QT7A 1YWPA 1SSHA 1PKSA 2PNIA 4X1VA 2C0IA 1QKWA 3KFVA 1K4US 1OV3A 1A0NB 2LJ3A 2GTJA 4RTUA 1PNJA 2EQIA 4Z88A 1S1NA 4OMQA 2FO0A 1K0XA 3RBBB 2RQWA 3PVLA 1ABQA 1GCPA 3C0CA 1YN8A 1VA7A 1OOTA 1HJDA 1OPLA 4AG1C 2J7IA 3QWXX 2RQUA 1QLYA 1ZUKA 4OMPA 4ESRA 2EGAA 4IIOA 4AFSC 2LNHB 2FPFA 3UA7A 2YDLA 1EFNA 2DBMA 1WIEA 2RF0A 1UGVA 1W6XA 2KRMA 4JPBW 2CT3A 4HCKA 5HCKA 1UHFA 2DJQA 2EW3A 2P4RA 1AOJA 1X6GA 1U5SA 1ARKA 1PRMC 2OI3A 2GTOA 2LJ0A 2JM8A 2IIMA 2YUQA 1SEMA 2RPNA 4OMMA 3M0RA 1UHCA 2K9GA 2FRYA 2EKHA 3VS5A 4AFUC 4JJCA 5I22A 2JTEA 2J06A 4AFZC 1WLPB 2ED1A 1K9AA 1GCQA 2EYWA 2O31A 1MV0B 5L23A 4RTXA 2L2PA 3EHRA 2O9VA 4OMNA 5I11A 2MOXA 2DF6A 1W1FA 1UTIA 1GL5A 2GGRA 2LQNA 1VYTA 2CT4A 4AFQC 1WA7A 2K3BA 3I9QA 4KRTA 1JQQA 1WI7A 1H3HA 1PWTA 4J9CA 4CC7A 1G2BA 2KYMA 2J6FA 3EG1A 1GRIA 2JXBA 2LZ6B 2ED0A 2O9SA 3CQTA 1BBZA 4OMLA 1N5ZA 1ZX6A 1NM7A 1ZUYA 3REBB
chains in the Genus database with same CATH superfamily
1K76A 1YCSB 3JCMW 1B3QA 1N8RC 1WJQA 4BB7A 4Q5WA 1NG2A 1OYXA 1RI0A 2BIVA 2ZPFB 5IH2A 1M27C 1RUWA 2NUPA 4J6XA 2F2XA 1SHGA 3GIBA 1SPKA 1K9MU 4E6RA 1Y0MA 2ESWA 5GAOp 3CCUQ 3S3NA 1NLPC 2ABLA 1JXMA 2P4TA 2MIOA 8ATCB 3SWNA 5I21A 2DLPA 4N0AA 2RHXA 4RTVA 1T3LA 4XU3A 2MMPA 2QAZA 2V8KA 4BI8B 3MCAB 4L59A 1PG5B 4PJOB 3CCVA 1GBRA 2K5FA 2FZKB 5AYFA 1JU5C 4RKUE 5KCHA 1VQ8T 3OS2A 3KXTA 3V7SA 1M8MA 1ZA2B 2A08A 2CH4A 3PIOA 1UE9A 1OEBA 4JRKA 3OMGA 3CXCS 2OAWA 1FWZA 4QQGA 3H41A 2DJZA 3FRNA 1M30A 5KE3A 2DL3A 2EKOA 1E6HA 1TUDA 2HQEA 2K5IA 1BI3A 1O75A 2XKOC 2QK0A 3G7ZA 2QA4A 3NGPA 4O6JA 1TXQA 4LN2A 3JCMc 3EG0A 4DA4A 3EH1A 4HVUA 1VQLQ 9ATCB 2DL7A 1UDLA 4PJOA 3I55T 2CKKA 3QJ6A 3A1PA 1WXUA 2CSIA 1ZUUA 1G3WA 4M78C 2JVVA 2SRCA 3I56Q 4E7ZA 4KT0E 1VQPA 3PT9A 3JCMf 4CI0C 1LCKA 3RR6A 4MMKA 1PCXA 5KE2A 3M57A 4ORZA 3KBGA 1IRXA 4DOVA 3CC4T 3C4SA 5EC7A 1W2BS 3EGUA 2DK3A 3I55Q 3M58A 3OS1A 1OX9A 5IAYA 4PLLA 1UGPB 3QKJA 5GMKh 4ZTJA 1LJOA 3PFSA 2I0NA 2M16A 3CPWP 3MPUB 1WX6A 5ECAA 1I0CA 4Z8AA 4C0ZA 3C95A 4EDUA 2YRVA 1C1AA 1Y96A 2GBQA 5GAOn 4XU0A 2GQVA 1PHTA 4C92B 5GAOq 3CC4Q 3A98A 3M0TA 1Y57A 2OX7A 2QYZA 1KC8U 5CVIA 2K2VA 4C8QB 2H3JA 1B34B 3TU4K 2HQXA 1I5OB 5GMKi 4FT4A 3M0PA 2DXBA 2DTIA 3C12A 2PZ1A 3P8DA 3NTHA 1NYFA 1VQ7A 2A36A 2L3RA 1KC8R 2PVDB 3A8LB 3UT1A 3VRYA 1K9MC 1Z9QA 1M1GA 1YI2A 2LJ1A 5CQXA 1CKAA 3OY9A 2CH4W 1NEGA 2ROLA 5CIUA 5LJ3d 2JJ9A 2G6FX 1K8AC 3J81E 5FWBA 1UJYA 2VWFA 5FRNA 4M7DE 2LX7A 5FU6B 3I5SA 1BK2A 1KQSS 2L0AA 1ZSZC 3SWNC 5GMKm 3P8HA 3CCSQ 5CK9A 3L1AA 2JNGA 2R57A 1Q7YC 1YJ9Q 4WCIA 5KYUB 2E70A 4DBRA 2JZ2A 3G6EQ 4EMGA 3HRTA 1YNZA 1TTHB 4IUQA 3EG3A 3GLXA 3OYDA 4PJOE 1QVFA 4RMOA 5LJ5g 4Z02A 1TUCA 2DPPB 5GAMj 2X4XA 2JS2A 2X3XD 2EJ9A 2VC8A 4IUVA 1JJ2P 3BDUA 2LCSA 2LT1A 2OJ2A 3VS4A 2D9TA 2K5LA 2COZA 4PJOD 1CKBA 4CC4B 3R6NA 2YRCA 1AWOA 3G71T 3TVTA 1M3CA 2EQUA 2QEXT 1UGQB 4LXCA 2L8DA 1IXDA 2FVUA 1YWOA 4FYXB 1B07A 2JTFA 2E1HA 4F7UG 1VQKA 3JB9J 1Q82C 3OSVA 5A0DA 4JS5A 1MUZA 1D09B 1XOVA 5IHKA 3CCRA 1PRLC 4LUEA 4B9WA 1DJ7B 4M78B 3FJ5A 3L2VA 3M5AA 1H92A 1BKBA 2YSQA 3CD6Q 5KYWA 5FU6C 3O5ZA 2YUPA 1MV3A 3CCEQ 1YIJA 2LRQA 2ZPHB 3H0FA 4F7UB 3L2WA 1D1AA 3AT1B 4DBQA 2LQWA 3OYGA 1UUEA 2PUOB 2CUBA 2RJFA 2NUTA 1Q95G 2HKNA 3JB9I 2PTKA 2G3RA 1VQ5Q 4F16A 4Z89A 3OBWA 3PIPA 3NMZC 1VQKT 1M2OA 1YWPA 4M77A 2PNIA 2Y4YA 1KHCA 4OB1B 1YJNA 5L8RE 1VQ6T 4JJNK 3HSBA 3PMIA 3OYHA 3KFVA 1M1FA 2GTJA 1W4SA 4J6WA 4Z88A 3H6ZA 5M9OA 3A8HB 2JTMA 3CCJA 1NJIU 3RBBB 2HL5C 1EIFA 2HMAA 3CCUT 1ABQA 2PQWA 1GCPA 4C8QC 3C0CA 3SDZA 4ZGEB 1OOTA 4KH1B 1U1TA 2PVOB 5FLXE 2P84A 3TCJA 1NJIR 2ZPBB 2RQUA 1VQ8A 1ZUKA 3N5BB 1RAFB 4LDWA 4AFSC 1TOVA 2FPFA 3CC7A 3LWIA 2RF0A 3CCLA 3PTAA 3OW2P 1UHFA 1X01A 4LDXA 2DZ9A 2WSFE 3QBYA 3FDRA 4M75B 5GAN8 1YJ9T 1KQSA 5HKCA 2YUQA 3QHSA 1EZZB 3M0RA 2A3LA 1Q7YU 2K9GA 1TUGB 3FJPA 2JTEA 2ED1A 1KHIA 4ZGJB 3X28B 2L2PA 4FU6A 2CP0A 2KK4A 1W1FA 1K8AR 3G4SQ 2IPOB 1M90R 2OTJQ 4R56A 1QVFS 1WQ7A 3ASKA 1YITQ 1RACB 2HBPA 1QVPA 1JQQA 1WI7A 1H3HA 4M78G 1BI0A 4OGCA 4J9CA 4CC7A 1G2BA 1LNXA 4LD6A 3F70A 1GRIA 2JXBA 2CP3A 4OMLA 4J5YA 3ZBDA 1BBZA 2JN0A 1ZX6A 1MNDA 1MHNA 3OYMA 1RAEB 1QWFA 5GAN7 5CR2A 1T3SA 5KCOA 1N27A 4DBFA 1I8FA 4JJDA 1R0CB 4QKUA 2MWPA 4JLGA 2FZCB 2DE0X 2HBWA 3CBPA 2D0NA 4M7AG 1PM3A 3QSUA 2QI2A 3CCSA 4E47A 3KUFA 4C5HA 3JCMX 3HL8A 3DKMA 3M59A 1VQPT 4OB2B 3E9FA 4ZGDB 3IQLA 3A8MB 3TSWA 2OTLQ 3MEAA 4EIKA 3OYBA 3BY7A 3MEWA 3EGXA 5GJWB 2HD0A 1YJWA 4PLIA 4JDSA 5FROA 2KAFA 2KDSA 5GANe 4BY6B 3VS6A 4M77D 1M1KR 1AWJA 1OZ3A 2H8HA 3EFOB 4MDXA 2BZ8A 4E2FB 4GY5A 2RB6A 4KGZB 1X2QA 1UFFA 3CCVT 3X24B 1YHQQ 3QDFA 2X9HA 3VS7A 3CCRT 3J7AF 1K0SA 4ZNXA 5GAOr 1FYNA 1YHQA 2RI2A 1VQ7Q 3I56T 3JCMJ 1GFDA 3GOXA 2XDDA 2D0QB 2Z0WA 3NTKA 5CKFA 3V7RA 1D0ZA 4FW1A 1WJSA 4AMCA 1KD1R 2CP7A 2KEAA 4C5IA 3QJYA 5DLQE 1OU9A 1HD3A 1N8RR 4M78F 1YJWQ 4PJLA 5FU7B 2B8AA 5GAN5 3G71Q 2EPDA 2OTLA 3BE3A 1S72T 3U23A 2HQHA 2K4YA 2BZYA 4QVCA 2RQRA 4KUIA 1NBEB 2FHDA 2GNCA 3H0HA 4M77F 2L3QA 2D8HA 2V8JA 4HKEA 2KR3A 2DA9A 4IUUA 4J8OA 4LUDA 4X9DA 3HRSA 3ZFJA 2V1RA 4FSSA 3JCMb 5CKBA 3JCMh 3RERA 2XDBA 2PUKB 2FRWA 2HL3A 1VUBA 1W70A 3EG9B 1X75C 3OSSC 1VQPQ 1VIEA 4XAXB 2XICA 3CBOA 4C5EA 1U3OA 2F2VA 2L3PA 2E41A 4C92G 1VOMA 2COYA 1YITA 2CSQA 2D8JA 1VQNT 2KI7A 3CMET 4D8DA 4E7IA 3HTRA 4DEYA 1WHGA 2J6OA 2YUOA 3G4SA 3CCMT 1K8AU 2QQAA 1VQ4Q 3QYGB 4M77G 3LW5E 2RHIA 1I5LA 1N6AA 1FMVA 4PJMA 2FB7A 2KE9A 2VYTA 5DY9A 5FWCA 1XJWB 5J39A 2XHCA 2CYZB 3EHQA 4M75F 4CC2A 3A8GB 1TG0A 1ZLMA 4M7DA 3MEUA 4DQ2A 2E6NA 2DRKA 2MAMA 2EQJA 3WXMB 1H8KA 2FL7A 4Y92A 2KYBA 2GCXA 4EMHA 4A54A 4V2SA 4FCYA 3CC7Q 1MMNA 3OYLA 4BDZA 4PJOC 1VQ8Q 3DLMA 3M56A 2MCNA 2KXDA 1X6BA 2DTHA 2F2WA 2RMOA 1PC0A 2EJGA 2BE7D 4PJOF 2BKDN 4QW2A 2D1XA 2CZ6B 2AK5A 1T0JA 1TH7A 2DM1A 4J9IA 5IXFA 4L5GA 4CC3A 4HVWA 1YI2T 1MMDA 3I35A 4X9CA 2QDLA 4C92E 1YP5A 4PJJA 5KYUA 2QEXQ 2LQ8A 4PK4A 2QTXA 3V8KA 4HCCA 5GANj 4BY6C 2DBKA 2M02A 4F14A 3LWHA 2KXCA 2C06A 3EH2A 2CZ1B 3HHTB 2O88A 2O4XB 1ABOA 3EGXB 3GF5A 3CCLT 2DEUA 2DRMA 1YHQT 3S3MA 1RABB 4R55A 3JB9H 2KNBB 3QG1A 1OQKA 3RDVA 1RI9A 1KD1U 4J9FA 2RI5A 3OYIA 1KJWA 2YT6A 1YIJQ 5LJ5f 1WXBA 4KULA 3CD6A 1JXOA 3VS0A 2HZYA 2K3XA 1IHWA 3UWNA 1FXXA 5GMKe 3JCMQ 1R8OB 4Y28E 2XMFA 4EPCA 2FZGB 2DILA 3M55A 2LX9A 2M0YA 2QDYB 2K7AA 4CRIA 5CCAA 1AVZC 2EQKA 1OPKA 1ZHIA 4M7DF 4OVAA 5FW9A 1VQKQ 2DERA 3HFNA 2ROTA 4AG2C 3E2UA 2VGNA 5LJ3f 1KD1C 4JRIA 1VQ4A 1F1BB 1IGQA 2KROA 4XTZA 1SRLA 3QPHA 2EYQA 4M78E 3AHUA 4ATOA 2K79A 2XD0A 1ZSGA 3DB3A 2L5QA 2LVMA 1UJ0A 1TU0B 1JJ2S 4GBQA 3JB9D 2RNAA 3JB9F 2RQTA 2HCKA 3M0SA 4QT7A 3MJXA 1SSHA 4XTWA 4J83A 2COWA 4C0DB 2Y4XA 4M7DC 4M75G 2LJ3A 2KMTA 1VQNA 4BE1A 1S1NA 4OMQA 3G6EA 4AT1B 2K3YA 2WSCE 1K0XA 2CZ7B 4M7DD 4KGXB 2NUTB 3PVLA 3OW2A 1YJNT 1VQ4T 3EG9A 1ZBXA 5KYNA 1OPLA 1KQSP 3QWXX 2HAXA 3CCJT 4ESRA 2AIRB 3FEOA 2YDLA 2QTVA 1EFNA 2YXYA 2ZPIB 5IN1A 3MP6A 4J6YA 1WIEA 3T9NA 1W6XA 2KRMA 5KYYB 1ZSZB 4TVRA 2EW3A 3CCST 3M4GA 2DD4A 4RCCA 4RCBA 3FC3A 1UGSB 4ZN1A 4JUVA 2LJ0A 4PKCC 2DAQA 3CC2A 2LCLA 2YLCA 5I2MA 1YI2Q 3PNWC 3QZ5B 4KUDK 3CC2Q 1QP2A 2J06A 4AFZC 1WLPB 1Q86R 2YWWA 5L23A 1B7TA 3PGGA 1G3YA 1N9SA 5I11A 3JCMe 1VQLT 3CXCA 4PJNA 2YHTA 3ZEHA 3I9QA 1WPYA 3G6ET 4N4HA 1BIAA 4KRTA 1TSFA 1RAHB 2YLBA 2KYMA 3GNFB 2J6FA 3EG1A 2LZ6B 2O9SA 5A0LA 4C8QD 5GAMg 2R5MA 4YTLA 2NUPB 3TSZA 2W10A 4MZTA 2DIQA 3OYEA 4JJBA 2HSPA 5FU7C 3FB9A 5LJ3h 2HNIA 1H641 2DXTA 4GLMA 2DL4A 1HXDA 5GANh 1D0XA 1V1CA 2DXCA 1RAGB 2ZAEA 1S72A 1VQMQ 2IG0A 3A5ZB 1WZOA 2C0OA 3LH5A 5AT1B 4C92C 5GMKj 2EFIA 1WQWA 4F7UF 1QVFP 3META 2OTJA 2QGFB 2VGMA 1JJ2A 3MO8A 4C92D 4D6WA 5LJ5h 5HK0A 3H0IA 3SB2A 4C8QF 2E64A 4LDYA 2O01E 3JCMd 4M7AD 1WHLA 1AZGB 3SHWA 1KQ1A 2AKKA 2X4YA 4JRPA 1JO8A 1EX4A 1PD1A 2MF2A 2EGCA 3URGA 2EJFA 3L2ZA 1P92A 2CP2A 4WF2A 1WXTA 3VUZA 3EG2A 1KG1A 3CXCP 2J6KA 5LJ3j 4BI3A 1Q86C 5KYXA 5A0GA 2VVKA 3REAB 3EGDA 2GFAA 3VV0A 2KVQG 3OW2S 4KH0B 3RUXA 1K73C 2V26A 1NPRA 1M90C 3VYHB 4M7DB 3CCVQ 2XIDA 6AT1B 2MWOA 4FYVB 2HKQB 1VYVA 5LJ3e 2QG9B 2DVEA 3VYGA 2EBPA 3VS2A 4HA8A 2DL8A 1D3BA 3L2RA 1LVKA 3CMAA 1JBMA 1G5VA 4BE0A 2QEXA 2EYYA 3DLLA 3UATA 1X27A 3CCJQ 3S6WA 1QWEA 2A0FB 4LD9K 3CPFA 1VQ5T 2RQVA 1HK9A 1Y71A 1GBQA 4JLIA 2K57A 1B34A 4BUGA 3RNJA 2FPEA 2HSEB 1UECA 4XK8E 1QMCA 2JS0A 4HT8A 5KYWB 2DIGA 1WDXA 2DZCA 2A28A 1OU8A 1NLOC 1D1CA 1GXIE 4IUTA 1UGRB 1WYXA 2JMAA 1QCOA 4ZTFA 2E65A 1VQOT 1RADB 1TS9A 5D6YA 3UF4A 4BD3A 3BFMA 3QDRB 4FW2A 1I4K1 4LE9A 3VS3A 2CREA 3CCQT 2VXEA 2CS7A 1IB8A 2V8IA 2LP5A 4C8QA 4FIBA 3V8LA 4J9GA 2CP6A 3HP9A 5IXBA 2X3WD 2AZSA 3RKYA 1OZ2A 3CCRQ 1G83A 3H9NA 3GP8A 4E7HA 2DEQA 4OP0A 2VXFA 1Q86U 4LDUA 1VQ7T 4HVVA 4ANJA 3CD6T 5IHNA 3E19A 4IIMA 1MGQA 1AWWA 4MDWA 1N9RA 1Q82R 2QQ9A 1QVGA 2ENMA 2LMJA 1M2VB 3JB9G 1K9MR 2A37A 2ATCB 4MZPA 3RMQA 3S3OA 1WFWA 1XNIA 1SSFA 2X35A 4QQDA 1RAAB 4A4GA 4C92A 3NFCA 3OA6A 4ELZC 3JAME 3ER0A 1KK7A 2DX1A 4IKFA 1AD5A 4VUBA 4ME7A 3CBMA 3JRZA 4M7AA 1I07A 2JM9A 4M7DG 4M75C 1U06A 2Y90A 2NWMA 3H8ZA 3LX7A 4A4KA 2QQRA 2X51A 2JUFA 3C94A 1J3TA 2DD5A 1MMAA 1WJRA 3OYKA 2W0ZA 1YJ9A 2ZGWA 3M9QA 1IO6A 2EQMA 4R0KA 5LJ5e 4M7AE 1M4ZA 2DYIA 2ECZA 2JT4A 2KT1A 3I5RA 2RHUA 5GANf 3G71A 4BI4A 2M51A 4A63B 1WGSA 5GAMd 4QVZA 4E7SA 1JEGA 1BI2A 2KSSA 4J9EA 3UPUA 4GLKA 4HXJA 2DTOA 5LJ5j 3BW1A 1NYGA 2RJCA 4QVDA 5C6SA 3CCET 4F7UA 1ACMB 5GAMe 4P5NA 3EAEA 2E4HA 5IT9E 1QCFA 1ZA1B 2OTLT 4OGEA 4RTZA 3SD4A 4M78A 2RK1A 2WSEE 1I81A 3MHXA 3WVEB 1VQ9T 2QQSA 2DETA 3ULRB 2BZXA 2VB6A 2LT4A 4FYYB 2ZCFB 3THKA 3UDCA 1SG5A 4FL6A 4N4GA 3LGFA 3GPLA 2KT8A 1VQMT 3G4ST 3CCMA 4J9DA 2D6FA 2DFUA 2HDAA 2X4WA 4PFPA 2AZVA 2XG8D 5CKDA 3UA6A 5GJVB 3FLGA 1NE8A 2BUDA 2MPXC 2KRNA 3EFOA 1VQ6A 5LJ5d 2L3SA 1C0MA 2F1LA 3SWNB 4EMKC 5I2SA 3M53A 5CO7A 3CPWS 1M9SA 1QKWA 1K4US 4MMLA 1OV3A 1A0NB 4M7AF 5GAMh 1PNJA 2EQIA 1NJIC 3I55A 4A53A 3HRUA 1W2BP 2FO0A 3QXEB 1YBYA 1OULA 3MEVA 4M7AC 4HCBA 4MZMA 1VA7A 5CKEA 3FIFA 2NLUA 1Y7XA 2M9UA 2J7IA 4LDVA 1VQ6Q 3I56A 3OQ5A 4OMPA 2EGAA 2CZ0B 2DBMA 3L2QA 2RHYA 4A4EA 4HT9A 1UGVA 4C92F 3X26B 5EG2A 4JPBW 2CT3A 4HCKA 5GAMf 5HCKA 2F69A 2DJQA 3E9GA 2R5AA 2QA4Q 1ARKA 1PRMC 3OBYA 2E3IA 2RPNA 2OTJT 4HCZA 3CC7T 1UHCA 3MKDA 2FRYA 2EKHA 3VS5A 1QW1A 2VV5A 3CMEQ 2E3HA 1RL2A 1VQOQ 1K9AA 4J7IA 4EMKB 1GCQA 3OYAA 2EYWA 2O31A 4JRQA 1Y96B 4JS4A 1Q82U 2CP5A 4RTXA 4OMNA 3PMTA 1GL5A 2LDMA 3M54A 1WNLA 3CCLQ 4AFQC 1VYTA 4F7UE 1QVGS 2K3BA 2E6ZA 1WHJA 3X25B 2PU9B 4C5GA 1D3BB 2CGHA 5GAN6 5GANg 2A7YA 4M7AB 3CQTA 8AT1B 1NM7A 3REBB 2AT1B 3M4YA 4UC4A 2XI9A 3V8JA 2AHJB 2B86A 4M78D 4F17A 1K1ZA 1SRMA 1H3ZA 2KGTA 3OYYA 1M3AA 2FPDA 3VUBA 2VKNA 1KFZA 2YUNA 3LH0A 2E12A 5GAOm 1YJNQ 4C8QG 2E5QA 3EFRA 2DVJA 3X20B 2XU8A 5LL6S 2RO0A 1Z9ZA 1M1KC 4XU1A 3VJPA 4DEXA 2DNUA 1XQHA 1VQ5A 1SKUB 1M5Q1 1RAIB 2M1HA 3VKIA 3TEEA 1O9SA 2X4JA 4BDYA 2QQBA 3GBQA 4M75D 2KBTA 3JCMP 3CCQQ 3V7CA 1IGUA 1T0HA 2YRDA 4E7JA 2RI3A 4OB0B 3CCEA 3JV3A 1M3BA 4DOWA 1MNEA 2RA2A 1BU1A 2QA4T 2GFUA 1PD0A 2I2LA 1VYUA 1VQ9A 4RTWA 1BCMA 4JZ3A 2EGEA 4BACA 1IREB 1UEBA 2GF7A 4J9HA 2E10A 1X2KA 2NYSA 2BTTA 3O8VA 4A4HA 1WHHA 1G3SA 5C0MA 1AZEA 5J26A 3CCQA 4JZ4A 2CDTA 3VRZA 2SEMA 2LCCA 2FEIA 4DBHA 1X43A 1K73U 4OMFB 2H3EB 2O2OA 1BIBA 3E1SA 4PJOG 4A4FA 1LPLA 1QQJA 4LNPA 4B9XA 3QUIA 3WVDB 3D7SB 3DB4A 5GAN2 3OS5A 4FT2A 1BCOA 3G1JA 4RTYA 1M2VA 1M8VA 1YIJT 3QO3A 1K73R 1N8RU 3A8OB 2L89A 1CSKA 5D6XA 1YFNA 1V29B 1NPPA 3LGLA 3MP8A 2P0QA 4PFZA 3P8BB 2EAYA 2RH2A 1X6OA 2ZZDA 4FYWB 3ME9A 5FRMA 3CMAQ 2XK0A 5CAIA 3SEMA 5DM7R 4N4IA 5KYYA 4BE2A 1Q7YR 4J9BA 5GANd 1IZ6A 1AEYA 3CEYA 2P0PA 1KSWA 4K11A 1X69A 4C8QE 1E7OA 1C6VX 3RMSA 2LC4A 3CPWA 2MK5A 2M0OA 4Y91A 3HKSA 2R58A 1QVGP 3OS0A 1QKXA 3EGDB 3L42A 1WHMA 1ZQ1A 2F5TX 4L6V5 1KIKA 1TWBA 4J7FA 1Q81C 1BYMA 4D8KA 2BE9B 1RLPC 4QQ6A 2K2MA 2K6DA 4FSXA 5IHIA 1VQOA 3NHNA 3CMEA 1GFCA 4C0DC 3PE0A 3SFMA 4O5VA 1D0YA 2IVWA 4RTTA 4M77B 2AKLA 4N0AC 2EVRA 3TREA 1D1BA 1WHKA 4XTUA 2C0TA 3M0UA 2RM4A 1UB4A 4E7KA 3MP1A 4OF1A 2CUDA 1MMGA 3CC4A 2FG0A 1RLQC 1ZBJA 4XTYA 4M75A 2FYKA 1VQMA 1S72Q 2LNVA 3ZL7C 2RJDA 2ZPGB 3NTIA 3PVQA 2OAUA 2DYBA 2V1QA 2VASA 7AT1B 2NUZA 2JW4A 2QASA 2GQIA 2EYZA 4RG8A 4M4ZA 4RUGA 1AT1B 2KRSA 4X34A 5DLOA 4KBMB 2JOYA 1OX8A 1Y07A 4WTOB 2KY9A 4RG2A 1VIFA 5D7UA 1HYOA 4OB3B 1FX7A 1E6GA 3LLRA 1PKTA 5GAN4 2RK2A 2RHZA 2RN8A 1HSQA 1BI1A 3JSCA 1FMWA 1UG1A 1SF9A 2PVGB 1VQLA 2LQKA 3LYIA 3CCMQ 1M1KU 4II1A 4PFOA 3VU3C 2RD1A 4M77C 1FMKA 2DL5A 1NEBA 5KYXB 1QCNA 3JCMg 3QIIA 1GCQC 5CQYA 2J05A 2JMCA 1BB9A 4OMOA 1YJWT 2MI6A 2DXUA 1AWXA 2E5KA 3NPFA 3CMAT 4XTVA 3QZ9B 4NS5A 2EIFA 2HEQA 1SHFA 5J3BA 4PNOA 1I1JA 2WACA 3R6OA 2EYXA 1V76A 4FM4B 1ZSZA 3VS1A 3M0QA 2MYSA 3QWYA 5GAN3 3BDLA 1PSEA 1OI1A 3EFSA 4XTXA 2DMOA 5LJ3g 3RESA 3OYCA 1PKSA 4C0FA 4X1VA 3CCUA 2C0IA 4RTUA 2XDPA 5KH6A 1XTDA 1PSFA 2DO3A 4PL6A 1VQNQ 4ZN3A 4E7LA 2RQWA 4C0GA 4M77E 4XQ3A 5A2QE 3QYHB 2P0KA 3OYNA 1YN8A 5D6WA 3RIRA 1HJDA 4M75E 1M90U 1KQ2A 2KQWA 4AG1C 3JCMV 1QLYA 3L2UA 4NL2A 4IIOA 3J80E 1Q81U 2LNHB 1U8RA 1G8XA 1G3TA 3UA7A 4F04B 1NZ9A 3CC2T 2QXFA 4ELYC 1R0BG 3GNGA 4B6MA 3HFOA 3OMCA 3INZA 2P4RA 1AOJA 4KGVB 2F5KA 3OYJA 1X6GA 1Q81R 1U5SA 1JRIA 4NL3A 3OYFA 2OI3A 2GTOA 2JM8A 5GMKl 2IIMA 4IUPA 1SEMA 4OMMA 5CKHA 1KC8C 2ZPEB 1R77A 1YITT 1VQ9Q 4AFUC 4JJCA 5I22A 4IURA 4XU2A 2LTOA 1YCYA 3RKWA 1MV0B 3HPWA 5HY6A 1QP3A 2O4XA 3EHRA 4NOYA 2O9VA 3TQ7P 4EMKA 2MOXA 2VUBA 2DF6A 5HK3A 1UTIA 2GGRA 2LQNA 2CT4A 1W2BA 3OB9A 1WA7A 1LOJA 2QGGA 3RKXA 1JB0E 3Q1JA 2EWNA 2RJEA 5GAOl 1IHVA 1PWTA 1U1SA 2DKGA 2ED0A 1N5ZA 1AHJB 1ZUYA
chains in the Genus database with same CATH topology
1QWFA 1K76A 1T3SA 1YCSB 1B3QA 3TSZA 2W10A 2B86A 4JJDA 4F17A 1K1ZA 1SRMA 1NG2A 2KGTA 5IH2A 1M27C 4JJBA 1RUWA 2HSPA 2HBWA 2DE0X 1M3AA 2F2XA 1SHGA 2FPDA 1SPKA 2D0NA 4E6RA 2VKNA 4GLMA 2YUNA 1KFZA 1Y0MA 2ESWA 2DL4A 2DVJA 1V1CA 1NLPC 2ABLA 1JXMA 1Z9ZA 2MIOA 2C0OA 2DLPA 4DEXA 3LH5A 3IQLA 2DNUA 3TSWA 4RTVA 1T3LA 4EIKA 5GJWB 1GBRA 1JU5C 3GBQA 1M8MA 2A08A 2CH4A 2KBTA 3H0IA 3VS6A 1T0HA 1UE9A 1AWJA 3JV3A 1M3BA 2H8HA 1OEBA 2BZ8A 1BU1A 1AZGB 1X2QA 1UFFA 2OAWA 3SHWA 2AKKA 3H41A 1JO8A 1M30A 2EGCA 1VYUA 3VS7A 4RTWA 2DL3A 1K0SA 4JZ3A 2EGEA 1E6HA 1TUDA 1FYNA 4ZNXA 1WXTA 3EG2A 4J9HA 1GFDA 1X2KA 2J6KA 2BTTA 3NGPA 2VVKA 3REAB 1AZEA 4LN2A 3EG0A 4JZ4A 2KEAA 2CDTA 3VRZA 4HVUA 2SEMA 2FEIA 1X43A 1HD3A 2DL7A 1UDLA 2O2OA 1WXUA 2CSIA 1ZUUA 1VYVA 4LNPA 2EPDA 2SRCA 3U23A 2EBPA 4RTYA 3VS2A 1LCKA 2BZYA 2DL8A 1CSKA 2RQRA 4ORZA 2EYYA 3UATA 3H0HA 2GNCA 1X27A 5EC7A 2L3QA 3EGUA 2D8HA 1QWEA 2KR3A 2DA9A 2RQVA 4LUDA 1GBQA 2V1RA 4FSSA 2I0NA 3RNJA 2FPEA 1WX6A 3SEMA 2FRWA 5ECAA 1I0CA 4Z8AA 1UECA 1W70A 4J9BA 2JS0A 1AEYA 2GBQA 1KSWA 1U3OA 4K11A 1X69A 1WDXA 2F2VA 2L3PA 1PHTA 1E7OA 2A28A 3A98A 3M0TA 1Y57A 1NLOC 2CSQA 2D8JA 1WYXA 2JMAA 4D8DA 4DEYA 3UF4A 2J6OA 2YUOA 1QKXA 4LE9A 3VS3A 2CREA 1KIKA 3M0PA 2LP5A 4J9GA 4D8KA 1RLPC 2PZ1A 2K2MA 2K6DA 1NYFA 2KE9A 5IHIA 5IXBA 2A36A 2X3WD 3NHNA 2AZSA 1GFCA 5FWCA 3PE0A 3VRYA 1Z9QA 1G83A 3EHQA 4CC2A 2LJ1A 1TG0A 1ZLMA 1CKAA 4RTTA 2CH4W 1NEGA 4HVVA 2DRKA 2ROLA 2AKLA 5IHNA 1H8KA 4IIMA 1AWWA 2EVRA 2G6FX 4Y92A 2KYBA 5FWBA 2C0TA 3M0UA 1UJYA 2ENMA 2LMJA 2VWFA 2A37A 1WFWA 2CUDA 2FG0A 1RLQC 1ZBJA 2LX7A 3I5SA 2MCNA 2KXDA 1X6BA 1BK2A 2F2WA 2DX1A 2L0AA 2RMOA 1AD5A 3ZL7C 3PVQA 2D1XA 2DYBA 1I07A 2V1QA 2AK5A 1T0JA 2JM9A 2NUZA 2DM1A 4WCIA 2JW4A 1U06A 4J9IA 5IXFA 2GQIA 2EYZA 2NWMA 4CC3A 4HVWA 3I35A 4M4ZA 2QDLA 4RUGA 1YNZA 1J3TA 1YP5A 2KRSA 2W0ZA 3EG3A 1IO6A 4R0KA 2DBKA 4F14A 1TUCA 2ECZA 2KXCA 2JS2A 2JT4A 2X3XD 1E6GA 2KT1A 3I5RA 2O88A 1ABOA 1PKTA 2M51A 2LCSA 2OJ2A 3VS4A 2RN8A 1HSQA 4A63B 2DRMA 1CKBA 4CC4B 3R6NA 1UG1A 1AWOA 1JEGA 2KNBB 3TVTA 4J9EA 1M3CA 1RI9A 4HXJA 4J9FA 1NYGA 1KJWA 1YWOA 2YT6A 1FMKA 1B07A 2DL5A 1NEBA 1WXBA 1QCFA 1JXOA 3VS0A 1GCQC 2J05A 1MUZA 4RTZA 2JMCA 1XOVA 5IHKA 1BB9A 2XMFA 4OMOA 1PRLC 3ULRB 4LUEA 2BZXA 2DILA 2M0YA 2K7AA 1AVZC 1AWXA 2E5KA 3NPFA 3FJ5A 1OPKA 1H92A 5FW9A 2YSQA 3THKA 2HEQA 2ROTA 4AG2C 1SHFA 1I1JA 3O5ZA 2YUPA 1MV3A 2EYXA 2KT8A 3H0FA 3VS1A 2KROA 1SRLA 4J9DA 2LQWA 3M0QA 1UUEA 2K79A 2CUBA 1ZSGA 3QWYA 2HDAA 2AZVA 3UA6A 5GJVB 2PTKA 1UJ0A 4F16A 4GBQA 2RNAA 4Z89A 2KRNA 2DMOA 2L3SA 2RQTA 3NMZC 2HCKA 3M0SA 4QT7A 1YWPA 1SSHA 1PKSA 2PNIA 4X1VA 2C0IA 1QKWA 3KFVA 1K4US 1OV3A 1A0NB 2LJ3A 2GTJA 4RTUA 1PNJA 2EQIA 4Z88A 1S1NA 4OMQA 2FO0A 1K0XA 3RBBB 2RQWA 3PVLA 1ABQA 1GCPA 3C0CA 1YN8A 1VA7A 1OOTA 1HJDA 1OPLA 4AG1C 2J7IA 3QWXX 2RQUA 1QLYA 1ZUKA 4OMPA 4ESRA 2EGAA 4IIOA 4AFSC 2LNHB 2FPFA 3UA7A 2YDLA 1EFNA 2DBMA 1WIEA 2RF0A 1UGVA 1W6XA 2KRMA 4JPBW 2CT3A 4HCKA 5HCKA 1UHFA 2DJQA 2EW3A 2P4RA 1AOJA 1X6GA 1U5SA 1ARKA 1PRMC 2OI3A 2GTOA 2LJ0A 2JM8A 2IIMA 2YUQA 1SEMA 2RPNA 4OMMA 3M0RA 1UHCA 2K9GA 2FRYA 2EKHA 3VS5A 4AFUC 4JJCA 5I22A 2JTEA 2J06A 4AFZC 1WLPB 2ED1A 1K9AA 1GCQA 2EYWA 2O31A 1MV0B 5L23A 4RTXA 2L2PA 3EHRA 2O9VA 4OMNA 5I11A 2MOXA 2DF6A 1W1FA 1UTIA 1GL5A 2GGRA 2LQNA 1VYTA 2CT4A 4AFQC 1WA7A 2K3BA 3I9QA 4KRTA 1JQQA 1WI7A 1H3HA 1PWTA 4J9CA 4CC7A 1G2BA 2KYMA 2J6FA 3EG1A 1GRIA 2JXBA 2LZ6B 2ED0A 2O9SA 3CQTA 1BBZA 4OMLA 1N5ZA 1ZX6A 1NM7A 1ZUYA 3REBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWF A;  1K76 A;  1T3S A;  1YCS B;  1B3Q A;  3TSZ A;  2W10 A;  2B86 A;  4JJD A;  4F17 A;  1K1Z A;  1SRM A;  1NG2 A;  2KGT A;  5IH2 A;  1M27 C;  4JJB A;  1RUW A;  2HSP A;  2HBW A;  2DE0 X;  1M3A A;  2F2X A;  1SHG A;  2FPD A;  1SPK A;  2D0N A;  4E6R A;  2VKN A;  4GLM A;  2YUN A;  1KFZ A;  1Y0M A;  2ESW A;  2DL4 A;  2DVJ A;  1V1C A;  1NLP C;  2ABL A;  1JXM A;  1Z9Z A;  2MIO A;  2C0O A;  2DLP A;  4DEX A;  3LH5 A;  3IQL A;  2DNU A;  3TSW A;  4RTV A;  1T3L A;  4EIK A;  5GJW B;  1GBR A;  1JU5 C;  3GBQ A;  1M8M A;  2A08 A;  2CH4 A;  2KBT A;  3H0I A;  3VS6 A;  1T0H A;  1UE9 A;  1AWJ A;  3JV3 A;  1M3B A;  2H8H A;  1OEB A;  2BZ8 A;  1BU1 A;  1AZG B;  1X2Q A;  1UFF A;  2OAW A;  3SHW A;  2AKK A;  3H41 A;  1JO8 A;  1M30 A;  2EGC A;  1VYU A;  3VS7 A;  4RTW A;  2DL3 A;  1K0S A;  4JZ3 A;  2EGE A;  1E6H A;  1TUD A;  1FYN A;  4ZNX A;  1WXT A;  3EG2 A;  4J9H A;  1GFD A;  1X2K A;  2J6K A;  2BTT A;  3NGP A;  2VVK A;  3REA B;  1AZE A;  4LN2 A;  3EG0 A;  4JZ4 A;  2KEA A;  2CDT A;  3VRZ A;  4HVU A;  2SEM A;  2FEI A;  1X43 A;  1HD3 A;  2DL7 A;  1UDL A;  2O2O A;  1WXU A;  2CSI A;  1ZUU A;  1VYV A;  4LNP A;  2EPD A;  2SRC A;  3U23 A;  2EBP A;  4RTY A;  3VS2 A;  1LCK A;  2BZY A;  2DL8 A;  1CSK A;  2RQR A;  4ORZ A;  2EYY A;  3UAT A;  3H0H A;  2GNC A;  1X27 A;  5EC7 A;  2L3Q A;  3EGU A;  2D8H A;  1QWE A;  2KR3 A;  2DA9 A;  2RQV A;  4LUD A;  1GBQ A;  2V1R A;  4FSS A;  2I0N A;  3RNJ A;  2FPE A;  1WX6 A;  3SEM A;  2FRW A;  5ECA A;  1I0C A;  4Z8A A;  1UEC A;  1W70 A;  4J9B A;  2JS0 A;  1AEY A;  2GBQ A;  1KSW A;  1U3O A;  4K11 A;  1X69 A;  1WDX A;  2F2V A;  2L3P A;  1PHT A;  1E7O A;  2A28 A;  3A98 A;  3M0T A;  1Y57 A;  1NLO C;  2CSQ A;  2D8J A;  1WYX A;  2JMA A;  4D8D A;  4DEY A;  3UF4 A;  2J6O A;  2YUO A;  1QKX A;  4LE9 A;  3VS3 A;  2CRE A;  1KIK A;  3M0P A;  2LP5 A;  4J9G A;  4D8K A;  1RLP C;  2PZ1 A;  2K2M A;  2K6D A;  1NYF A;  2KE9 A;  5IHI A;  5IXB A;  2A36 A;  2X3W D;  3NHN A;  2AZS A;  1GFC A;  5FWC A;  3PE0 A;  3VRY A;  1Z9Q A;  1G83 A;  3EHQ A;  4CC2 A;  2LJ1 A;  1TG0 A;  1ZLM A;  1CKA A;  4RTT A;  2CH4 W;  1NEG A;  4HVV A;  2DRK A;  2ROL A;  2AKL A;  5IHN A;  1H8K A;  4IIM A;  1AWW A;  2EVR A;  2G6F X;  4Y92 A;  2KYB A;  5FWB A;  2C0T A;  3M0U A;  1UJY A;  2ENM A;  2LMJ A;  2VWF A;  2A37 A;  1WFW A;  2CUD A;  2FG0 A;  1RLQ C;  1ZBJ A;  2LX7 A;  3I5S A;  2MCN A;  2KXD A;  1X6B A;  1BK2 A;  2F2W A;  2DX1 A;  2L0A A;  2RMO A;  1AD5 A;  3ZL7 C;  3PVQ A;  2D1X A;  2DYB A;  1I07 A;  2V1Q A;  2AK5 A;  1T0J A;  2JM9 A;  2NUZ A;  2DM1 A;  4WCI A;  2JW4 A;  1U06 A;  4J9I A;  5IXF A;  2GQI A;  2EYZ A;  2NWM A;  4CC3 A;  4HVW A;  3I35 A;  4M4Z A;  2QDL A;  4RUG A;  1YNZ A;  1J3T A;  1YP5 A;  2KRS A;  2W0Z A;  3EG3 A;  1IO6 A;  4R0K A;  2DBK A;  4F14 A;  1TUC A;  2ECZ A;  2KXC A;  2JS2 A;  2JT4 A;  2X3X D;  1E6G A;  2KT1 A;  3I5R A;  2O88 A;  1ABO A;  1PKT A;  2M51 A;  2LCS A;  2OJ2 A;  3VS4 A;  2RN8 A;  1HSQ A;  4A63 B;  2DRM A;  1CKB A;  4CC4 B;  3R6N A;  1UG1 A;  1AWO A;  1JEG A;  2KNB B;  3TVT A;  4J9E A;  1M3C A;  1RI9 A;  4HXJ A;  4J9F A;  1NYG A;  1KJW A;  1YWO A;  2YT6 A;  1FMK A;  1B07 A;  2DL5 A;  1NEB A;  1WXB A;  1QCF A;  1JXO A;  3VS0 A;  1GCQ C;  2J05 A;  1MUZ A;  4RTZ A;  2JMC A;  1XOV A;  5IHK A;  1BB9 A;  2XMF A;  4OMO A;  1PRL C;  3ULR B;  4LUE A;  2BZX A;  2DIL A;  2M0Y A;  2K7A A;  1AVZ C;  1AWX A;  2E5K A;  3NPF A;  3FJ5 A;  1OPK A;  1H92 A;  5FW9 A;  2YSQ A;  3THK A;  2HEQ A;  2ROT A;  4AG2 C;  1SHF A;  1I1J A;  3O5Z A;  2YUP A;  1MV3 A;  2EYX A;  2KT8 A;  3H0F A;  3VS1 A;  2KRO A;  1SRL A;  4J9D A;  2LQW A;  3M0Q A;  1UUE A;  2K79 A;  2CUB A;  1ZSG A;  3QWY A;  2HDA A;  2AZV A;  3UA6 A;  5GJV B;  2PTK A;  1UJ0 A;  4F16 A;  4GBQ A;  2RNA A;  4Z89 A;  2KRN A;  2DMO A;  2L3S A;  2RQT A;  3NMZ C;  2HCK A;  3M0S A;  4QT7 A;  1YWP A;  1SSH A;  1PKS A;  2PNI A;  4X1V A;  2C0I A;  1QKW A;  3KFV A;  1K4U S;  1OV3 A;  1A0N B;  2LJ3 A;  2GTJ A;  4RTU A;  1PNJ A;  2EQI A;  4Z88 A;  1S1N A;  4OMQ A;  2FO0 A;  1K0X A;  3RBB B;  2RQW A;  3PVL A;  1ABQ A;  1GCP A;  3C0C A;  1YN8 A;  1VA7 A;  1OOT A;  1HJD A;  1OPL A;  4AG1 C;  2J7I A;  3QWX X;  2RQU A;  1QLY A;  1ZUK A;  4OMP A;  4ESR A;  2EGA A;  4IIO A;  4AFS C;  2LNH B;  2FPF A;  3UA7 A;  2YDL A;  1EFN A;  2DBM A;  1WIE A;  2RF0 A;  1UGV A;  1W6X A;  2KRM A;  4JPB W;  2CT3 A;  4HCK A;  5HCK A;  1UHF A;  2DJQ A;  2EW3 A;  2P4R A;  1AOJ A;  1X6G A;  1U5S A;  1ARK A;  1PRM C;  2OI3 A;  2GTO A;  2LJ0 A;  2JM8 A;  2IIM A;  2YUQ A;  1SEM A;  2RPN A;  4OMM A;  3M0R A;  1UHC A;  2K9G A;  2FRY A;  2EKH A;  3VS5 A;  4AFU C;  4JJC A;  5I22 A;  2JTE A;  2J06 A;  4AFZ C;  1WLP B;  2ED1 A;  1K9A A;  1GCQ A;  2EYW A;  2O31 A;  1MV0 B;  5L23 A;  4RTX A;  2L2P A;  3EHR A;  2O9V A;  4OMN A;  5I11 A;  2MOX A;  2DF6 A;  1W1F A;  1UTI A;  1GL5 A;  2GGR A;  2LQN A;  1VYT A;  2CT4 A;  4AFQ C;  1WA7 A;  2K3B A;  3I9Q A;  4KRT A;  1JQQ A;  1WI7 A;  1H3H A;  1PWT A;  4J9C A;  4CC7 A;  1G2B A;  2KYM A;  2J6F A;  3EG1 A;  1GRI A;  2JXB A;  2LZ6 B;  2ED0 A;  2O9S A;  3CQT A;  1BBZ A;  4OML A;  1N5Z A;  1ZX6 A;  1NM7 A;  1ZUY A;  3REB B; 
#chains in the Genus database with same CATH topology
 1K76 A;  1YCS B;  3JCM W;  1B3Q A;  1N8R C;  1WJQ A;  4BB7 A;  4Q5W A;  1NG2 A;  1OYX A;  1RI0 A;  2BIV A;  2ZPF B;  5IH2 A;  1M27 C;  1RUW A;  2NUP A;  4J6X A;  2F2X A;  1SHG A;  3GIB A;  1SPK A;  1K9M U;  4E6R A;  1Y0M A;  2ESW A;  5GAO p;  3CCU Q;  3S3N A;  1NLP C;  2ABL A;  1JXM A;  2P4T A;  2MIO A;  8ATC B;  3SWN A;  5I21 A;  2DLP A;  4N0A A;  2RHX A;  4RTV A;  1T3L A;  4XU3 A;  2MMP A;  2QAZ A;  2V8K A;  4BI8 B;  3MCA B;  4L59 A;  1PG5 B;  4PJO B;  3CCV A;  1GBR A;  2K5F A;  2FZK B;  5AYF A;  1JU5 C;  4RKU E;  5KCH A;  1VQ8 T;  3OS2 A;  3KXT A;  3V7S A;  1M8M A;  1ZA2 B;  2A08 A;  2CH4 A;  3PIO A;  1UE9 A;  1OEB A;  4JRK A;  3OMG A;  3CXC S;  2OAW A;  1FWZ A;  4QQG A;  3H41 A;  2DJZ A;  3FRN A;  1M30 A;  5KE3 A;  2DL3 A;  2EKO A;  1E6H A;  1TUD A;  2HQE A;  2K5I A;  1BI3 A;  1O75 A;  2XKO C;  2QK0 A;  3G7Z A;  2QA4 A;  3NGP A;  4O6J A;  1TXQ A;  4LN2 A;  3JCM c;  3EG0 A;  4DA4 A;  3EH1 A;  4HVU A;  1VQL Q;  9ATC B;  2DL7 A;  1UDL A;  4PJO A;  3I55 T;  2CKK A;  3QJ6 A;  3A1P A;  1WXU A;  2CSI A;  1ZUU A;  1G3W A;  4M78 C;  2JVV A;  2SRC A;  3I56 Q;  4E7Z A;  4KT0 E;  1VQP A;  3PT9 A;  3JCM f;  4CI0 C;  1LCK A;  3RR6 A;  4MMK A;  1PCX A;  5KE2 A;  3M57 A;  4ORZ A;  3KBG A;  1IRX A;  4DOV A;  3CC4 T;  3C4S A;  5EC7 A;  1W2B S;  3EGU A;  2DK3 A;  3I55 Q;  3M58 A;  3OS1 A;  1OX9 A;  5IAY A;  4PLL A;  1UGP B;  3QKJ A;  5GMK h;  4ZTJ A;  1LJO A;  3PFS A;  2I0N A;  2M16 A;  3CPW P;  3MPU B;  1WX6 A;  5ECA A;  1I0C A;  4Z8A A;  4C0Z A;  3C95 A;  4EDU A;  2YRV A;  1C1A A;  1Y96 A;  2GBQ A;  5GAO n;  4XU0 A;  2GQV A;  1PHT A;  4C92 B;  5GAO q;  3CC4 Q;  3A98 A;  3M0T A;  1Y57 A;  2OX7 A;  2QYZ A;  1KC8 U;  5CVI A;  2K2V A;  4C8Q B;  2H3J A;  1B34 B;  3TU4 K;  2HQX A;  1I5O B;  5GMK i;  4FT4 A;  3M0P A;  2DXB A;  2DTI A;  3C12 A;  2PZ1 A;  3P8D A;  3NTH A;  1NYF A;  1VQ7 A;  2A36 A;  2L3R A;  1KC8 R;  2PVD B;  3A8L B;  3UT1 A;  3VRY A;  1K9M C;  1Z9Q A;  1M1G A;  1YI2 A;  2LJ1 A;  5CQX A;  1CKA A;  3OY9 A;  2CH4 W;  1NEG A;  2ROL A;  5CIU A;  5LJ3 d;  2JJ9 A;  2G6F X;  1K8A C;  3J81 E;  5FWB A;  1UJY A;  2VWF A;  5FRN A;  4M7D E;  2LX7 A;  5FU6 B;  3I5S A;  1BK2 A;  1KQS S;  2L0A A;  1ZSZ C;  3SWN C;  5GMK m;  3P8H A;  3CCS Q;  5CK9 A;  3L1A A;  2JNG A;  2R57 A;  1Q7Y C;  1YJ9 Q;  4WCI A;  5KYU B;  2E70 A;  4DBR A;  2JZ2 A;  3G6E Q;  4EMG A;  3HRT A;  1YNZ A;  1TTH B;  4IUQ A;  3EG3 A;  3GLX A;  3OYD A;  4PJO E;  1QVF A;  4RMO A;  5LJ5 g;  4Z02 A;  1TUC A;  2DPP B;  5GAM j;  2X4X A;  2JS2 A;  2X3X D;  2EJ9 A;  2VC8 A;  4IUV A;  1JJ2 P;  3BDU A;  2LCS A;  2LT1 A;  2OJ2 A;  3VS4 A;  2D9T A;  2K5L A;  2COZ A;  4PJO D;  1CKB A;  4CC4 B;  3R6N A;  2YRC A;  1AWO A;  3G71 T;  3TVT A;  1M3C A;  2EQU A;  2QEX T;  1UGQ B;  4LXC A;  2L8D A;  1IXD A;  2FVU A;  1YWO A;  4FYX B;  1B07 A;  2JTF A;  2E1H A;  4F7U G;  1VQK A;  3JB9 J;  1Q82 C;  3OSV A;  5A0D A;  4JS5 A;  1MUZ A;  1D09 B;  1XOV A;  5IHK A;  3CCR A;  1PRL C;  4LUE A;  4B9W A;  1DJ7 B;  4M78 B;  3FJ5 A;  3L2V A;  3M5A A;  1H92 A;  1BKB A;  2YSQ A;  3CD6 Q;  5KYW A;  5FU6 C;  3O5Z A;  2YUP A;  1MV3 A;  3CCE Q;  1YIJ A;  2LRQ A;  2ZPH B;  3H0F A;  4F7U B;  3L2W A;  1D1A A;  3AT1 B;  4DBQ A;  2LQW A;  3OYG A;  1UUE A;  2PUO B;  2CUB A;  2RJF A;  2NUT A;  1Q95 G;  2HKN A;  3JB9 I;  2PTK A;  2G3R A;  1VQ5 Q;  4F16 A;  4Z89 A;  3OBW A;  3PIP A;  3NMZ C;  1VQK T;  1M2O A;  1YWP A;  4M77 A;  2PNI A;  2Y4Y A;  1KHC A;  4OB1 B;  1YJN A;  5L8R E;  1VQ6 T;  4JJN K;  3HSB A;  3PMI A;  3OYH A;  3KFV A;  1M1F A;  2GTJ A;  1W4S A;  4J6W A;  4Z88 A;  3H6Z A;  5M9O A;  3A8H B;  2JTM A;  3CCJ A;  1NJI U;  3RBB B;  2HL5 C;  1EIF A;  2HMA A;  3CCU T;  1ABQ A;  2PQW A;  1GCP A;  4C8Q C;  3C0C A;  3SDZ A;  4ZGE B;  1OOT A;  4KH1 B;  1U1T A;  2PVO B;  5FLX E;  2P84 A;  3TCJ A;  1NJI R;  2ZPB B;  2RQU A;  1VQ8 A;  1ZUK A;  3N5B B;  1RAF B;  4LDW A;  4AFS C;  1TOV A;  2FPF A;  3CC7 A;  3LWI A;  2RF0 A;  3CCL A;  3PTA A;  3OW2 P;  1UHF A;  1X01 A;  4LDX A;  2DZ9 A;  2WSF E;  3QBY A;  3FDR A;  4M75 B;  5GAN 8;  1YJ9 T;  1KQS A;  5HKC A;  2YUQ A;  3QHS A;  1EZZ B;  3M0R A;  2A3L A;  1Q7Y U;  2K9G A;  1TUG B;  3FJP A;  2JTE A;  2ED1 A;  1KHI A;  4ZGJ B;  3X28 B;  2L2P A;  4FU6 A;  2CP0 A;  2KK4 A;  1W1F A;  1K8A R;  3G4S Q;  2IPO B;  1M90 R;  2OTJ Q;  4R56 A;  1QVF S;  1WQ7 A;  3ASK A;  1YIT Q;  1RAC B;  2HBP A;  1QVP A;  1JQQ A;  1WI7 A;  1H3H A;  4M78 G;  1BI0 A;  4OGC A;  4J9C A;  4CC7 A;  1G2B A;  1LNX A;  4LD6 A;  3F70 A;  1GRI A;  2JXB A;  2CP3 A;  4OML A;  4J5Y A;  3ZBD A;  1BBZ A;  2JN0 A;  1ZX6 A;  1MND A;  1MHN A;  3OYM A;  1RAE B;  1QWF A;  5GAN 7;  5CR2 A;  1T3S A;  5KCO A;  1N27 A;  4DBF A;  1I8F A;  4JJD A;  1R0C B;  4QKU A;  2MWP A;  4JLG A;  2FZC B;  2DE0 X;  2HBW A;  3CBP A;  2D0N A;  4M7A G;  1PM3 A;  3QSU A;  2QI2 A;  3CCS A;  4E47 A;  3KUF A;  4C5H A;  3JCM X;  3HL8 A;  3DKM A;  3M59 A;  1VQP T;  4OB2 B;  3E9F A;  4ZGD B;  3IQL A;  3A8M B;  3TSW A;  2OTL Q;  3MEA A;  4EIK A;  3OYB A;  3BY7 A;  3MEW A;  3EGX A;  5GJW B;  2HD0 A;  1YJW A;  4PLI A;  4JDS A;  5FRO A;  2KAF A;  2KDS A;  5GAN e;  4BY6 B;  3VS6 A;  4M77 D;  1M1K R;  1AWJ A;  1OZ3 A;  2H8H A;  3EFO B;  4MDX A;  2BZ8 A;  4E2F B;  4GY5 A;  2RB6 A;  4KGZ B;  1X2Q A;  1UFF A;  3CCV T;  3X24 B;  1YHQ Q;  3QDF A;  2X9H A;  3VS7 A;  3CCR T;  3J7A F;  1K0S A;  4ZNX A;  5GAO r;  1FYN A;  1YHQ A;  2RI2 A;  1VQ7 Q;  3I56 T;  3JCM J;  1GFD A;  3GOX A;  2XDD A;  2D0Q B;  2Z0W A;  3NTK A;  5CKF A;  3V7R A;  1D0Z A;  4FW1 A;  1WJS A;  4AMC A;  1KD1 R;  2CP7 A;  2KEA A;  4C5I A;  3QJY A;  5DLQ E;  1OU9 A;  1HD3 A;  1N8R R;  4M78 F;  1YJW Q;  4PJL A;  5FU7 B;  2B8A A;  5GAN 5;  3G71 Q;  2EPD A;  2OTL A;  3BE3 A;  1S72 T;  3U23 A;  2HQH A;  2K4Y A;  2BZY A;  4QVC A;  2RQR A;  4KUI A;  1NBE B;  2FHD A;  2GNC A;  3H0H A;  4M77 F;  2L3Q A;  2D8H A;  2V8J A;  4HKE A;  2KR3 A;  2DA9 A;  4IUU A;  4J8O A;  4LUD A;  4X9D A;  3HRS A;  3ZFJ A;  2V1R A;  4FSS A;  3JCM b;  5CKB A;  3JCM h;  3RER A;  2XDB A;  2PUK B;  2FRW A;  2HL3 A;  1VUB A;  1W70 A;  3EG9 B;  1X75 C;  3OSS C;  1VQP Q;  1VIE A;  4XAX B;  2XIC A;  3CBO A;  4C5E A;  1U3O A;  2F2V A;  2L3P A;  2E41 A;  4C92 G;  1VOM A;  2COY A;  1YIT A;  2CSQ A;  2D8J A;  1VQN T;  2KI7 A;  3CME T;  4D8D A;  4E7I A;  3HTR A;  4DEY A;  1WHG A;  2J6O A;  2YUO A;  3G4S A;  3CCM T;  1K8A U;  2QQA A;  1VQ4 Q;  3QYG B;  4M77 G;  3LW5 E;  2RHI A;  1I5L A;  1N6A A;  1FMV A;  4PJM A;  2FB7 A;  2KE9 A;  2VYT A;  5DY9 A;  5FWC A;  1XJW B;  5J39 A;  2XHC A;  2CYZ B;  3EHQ A;  4M75 F;  4CC2 A;  3A8G B;  1TG0 A;  1ZLM A;  4M7D A;  3MEU A;  4DQ2 A;  2E6N A;  2DRK A;  2MAM A;  2EQJ A;  3WXM B;  1H8K A;  2FL7 A;  4Y92 A;  2KYB A;  2GCX A;  4EMH A;  4A54 A;  4V2S A;  4FCY A;  3CC7 Q;  1MMN A;  3OYL A;  4BDZ A;  4PJO C;  1VQ8 Q;  3DLM A;  3M56 A;  2MCN A;  2KXD A;  1X6B A;  2DTH A;  2F2W A;  2RMO A;  1PC0 A;  2EJG A;  2BE7 D;  4PJO F;  2BKD N;  4QW2 A;  2D1X A;  2CZ6 B;  2AK5 A;  1T0J A;  1TH7 A;  2DM1 A;  4J9I A;  5IXF A;  4L5G A;  4CC3 A;  4HVW A;  1YI2 T;  1MMD A;  3I35 A;  4X9C A;  2QDL A;  4C92 E;  1YP5 A;  4PJJ A;  5KYU A;  2QEX Q;  2LQ8 A;  4PK4 A;  2QTX A;  3V8K A;  4HCC A;  5GAN j;  4BY6 C;  2DBK A;  2M02 A;  4F14 A;  3LWH A;  2KXC A;  2C06 A;  3EH2 A;  2CZ1 B;  3HHT B;  2O88 A;  2O4X B;  1ABO A;  3EGX B;  3GF5 A;  3CCL T;  2DEU A;  2DRM A;  1YHQ T;  3S3M A;  1RAB B;  4R55 A;  3JB9 H;  2KNB B;  3QG1 A;  1OQK A;  3RDV A;  1RI9 A;  1KD1 U;  4J9F A;  2RI5 A;  3OYI A;  1KJW A;  2YT6 A;  1YIJ Q;  5LJ5 f;  1WXB A;  4KUL A;  3CD6 A;  1JXO A;  3VS0 A;  2HZY A;  2K3X A;  1IHW A;  3UWN A;  1FXX A;  5GMK e;  3JCM Q;  1R8O B;  4Y28 E;  2XMF A;  4EPC A;  2FZG B;  2DIL A;  3M55 A;  2LX9 A;  2M0Y A;  2QDY B;  2K7A A;  4CRI A;  5CCA A;  1AVZ C;  2EQK A;  1OPK A;  1ZHI A;  4M7D F;  4OVA A;  5FW9 A;  1VQK Q;  2DER A;  3HFN A;  2ROT A;  4AG2 C;  3E2U A;  2VGN A;  5LJ3 f;  1KD1 C;  4JRI A;  1VQ4 A;  1F1B B;  1IGQ A;  2KRO A;  4XTZ A;  1SRL A;  3QPH A;  2EYQ A;  4M78 E;  3AHU A;  4ATO A;  2K79 A;  2XD0 A;  1ZSG A;  3DB3 A;  2L5Q A;  2LVM A;  1UJ0 A;  1TU0 B;  1JJ2 S;  4GBQ A;  3JB9 D;  2RNA A;  3JB9 F;  2RQT A;  2HCK A;  3M0S A;  4QT7 A;  3MJX A;  1SSH A;  4XTW A;  4J83 A;  2COW A;  4C0D B;  2Y4X A;  4M7D C;  4M75 G;  2LJ3 A;  2KMT A;  1VQN A;  4BE1 A;  1S1N A;  4OMQ A;  3G6E A;  4AT1 B;  2K3Y A;  2WSC E;  1K0X A;  2CZ7 B;  4M7D D;  4KGX B;  2NUT B;  3PVL A;  3OW2 A;  1YJN T;  1VQ4 T;  3EG9 A;  1ZBX A;  5KYN A;  1OPL A;  1KQS P;  3QWX X;  2HAX A;  3CCJ T;  4ESR A;  2AIR B;  3FEO A;  2YDL A;  2QTV A;  1EFN A;  2YXY A;  2ZPI B;  5IN1 A;  3MP6 A;  4J6Y A;  1WIE A;  3T9N A;  1W6X A;  2KRM A;  5KYY B;  1ZSZ B;  4TVR A;  2EW3 A;  3CCS T;  3M4G A;  2DD4 A;  4RCC A;  4RCB A;  3FC3 A;  1UGS B;  4ZN1 A;  4JUV A;  2LJ0 A;  4PKC C;  2DAQ A;  3CC2 A;  2LCL A;  2YLC A;  5I2M A;  1YI2 Q;  3PNW C;  3QZ5 B;  4KUD K;  3CC2 Q;  1QP2 A;  2J06 A;  4AFZ C;  1WLP B;  1Q86 R;  2YWW A;  5L23 A;  1B7T A;  3PGG A;  1G3Y A;  1N9S A;  5I11 A;  3JCM e;  1VQL T;  3CXC A;  4PJN A;  2YHT A;  3ZEH A;  3I9Q A;  1WPY A;  3G6E T;  4N4H A;  1BIA A;  4KRT A;  1TSF A;  1RAH B;  2YLB A;  2KYM A;  3GNF B;  2J6F A;  3EG1 A;  2LZ6 B;  2O9S A;  5A0L A;  4C8Q D;  5GAM g;  2R5M A;  4YTL A;  2NUP B;  3TSZ A;  2W10 A;  4MZT A;  2DIQ A;  3OYE A;  4JJB A;  2HSP A;  5FU7 C;  3FB9 A;  5LJ3 h;  2HNI A;  1H64 1;  2DXT A;  4GLM A;  2DL4 A;  1HXD A;  5GAN h;  1D0X A;  1V1C A;  2DXC A;  1RAG B;  2ZAE A;  1S72 A;  1VQM Q;  2IG0 A;  3A5Z B;  1WZO A;  2C0O A;  3LH5 A;  5AT1 B;  4C92 C;  5GMK j;  2EFI A;  1WQW A;  4F7U F;  1QVF P;  3MET A;  2OTJ A;  2QGF B;  2VGM A;  1JJ2 A;  3MO8 A;  4C92 D;  4D6W A;  5LJ5 h;  5HK0 A;  3H0I A;  3SB2 A;  4C8Q F;  2E64 A;  4LDY A;  2O01 E;  3JCM d;  4M7A D;  1WHL A;  1AZG B;  3SHW A;  1KQ1 A;  2AKK A;  2X4Y A;  4JRP A;  1JO8 A;  1EX4 A;  1PD1 A;  2MF2 A;  2EGC A;  3URG A;  2EJF A;  3L2Z A;  1P92 A;  2CP2 A;  4WF2 A;  1WXT A;  3VUZ A;  3EG2 A;  1KG1 A;  3CXC P;  2J6K A;  5LJ3 j;  4BI3 A;  1Q86 C;  5KYX A;  5A0G A;  2VVK A;  3REA B;  3EGD A;  2GFA A;  3VV0 A;  2KVQ G;  3OW2 S;  4KH0 B;  3RUX A;  1K73 C;  2V26 A;  1NPR A;  1M90 C;  3VYH B;  4M7D B;  3CCV Q;  2XID A;  6AT1 B;  2MWO A;  4FYV B;  2HKQ B;  1VYV A;  5LJ3 e;  2QG9 B;  2DVE A;  3VYG A;  2EBP A;  3VS2 A;  4HA8 A;  2DL8 A;  1D3B A;  3L2R A;  1LVK A;  3CMA A;  1JBM A;  1G5V A;  4BE0 A;  2QEX A;  2EYY A;  3DLL A;  3UAT A;  1X27 A;  3CCJ Q;  3S6W A;  1QWE A;  2A0F B;  4LD9 K;  3CPF A;  1VQ5 T;  2RQV A;  1HK9 A;  1Y71 A;  1GBQ A;  4JLI A;  2K57 A;  1B34 A;  4BUG A;  3RNJ A;  2FPE A;  2HSE B;  1UEC A;  4XK8 E;  1QMC A;  2JS0 A;  4HT8 A;  5KYW B;  2DIG A;  1WDX A;  2DZC A;  2A28 A;  1OU8 A;  1NLO C;  1D1C A;  1GXI E;  4IUT A;  1UGR B;  1WYX A;  2JMA A;  1QCO A;  4ZTF A;  2E65 A;  1VQO T;  1RAD B;  1TS9 A;  5D6Y A;  3UF4 A;  4BD3 A;  3BFM A;  3QDR B;  4FW2 A;  1I4K 1;  4LE9 A;  3VS3 A;  2CRE A;  3CCQ T;  2VXE A;  2CS7 A;  1IB8 A;  2V8I A;  2LP5 A;  4C8Q A;  4FIB A;  3V8L A;  4J9G A;  2CP6 A;  3HP9 A;  5IXB A;  2X3W D;  2AZS A;  3RKY A;  1OZ2 A;  3CCR Q;  1G83 A;  3H9N A;  3GP8 A;  4E7H A;  2DEQ A;  4OP0 A;  2VXF A;  1Q86 U;  4LDU A;  1VQ7 T;  4HVV A;  4ANJ A;  3CD6 T;  5IHN A;  3E19 A;  4IIM A;  1MGQ A;  1AWW A;  4MDW A;  1N9R A;  1Q82 R;  2QQ9 A;  1QVG A;  2ENM A;  2LMJ A;  1M2V B;  3JB9 G;  1K9M R;  2A37 A;  2ATC B;  4MZP A;  3RMQ A;  3S3O A;  1WFW A;  1XNI A;  1SSF A;  2X35 A;  4QQD A;  1RAA B;  4A4G A;  4C92 A;  3NFC A;  3OA6 A;  4ELZ C;  3JAM E;  3ER0 A;  1KK7 A;  2DX1 A;  4IKF A;  1AD5 A;  4VUB A;  4ME7 A;  3CBM A;  3JRZ A;  4M7A A;  1I07 A;  2JM9 A;  4M7D G;  4M75 C;  1U06 A;  2Y90 A;  2NWM A;  3H8Z A;  3LX7 A;  4A4K A;  2QQR A;  2X51 A;  2JUF A;  3C94 A;  1J3T A;  2DD5 A;  1MMA A;  1WJR A;  3OYK A;  2W0Z A;  1YJ9 A;  2ZGW A;  3M9Q A;  1IO6 A;  2EQM A;  4R0K A;  5LJ5 e;  4M7A E;  1M4Z A;  2DYI A;  2ECZ A;  2JT4 A;  2KT1 A;  3I5R A;  2RHU A;  5GAN f;  3G71 A;  4BI4 A;  2M51 A;  4A63 B;  1WGS A;  5GAM d;  4QVZ A;  4E7S A;  1JEG A;  1BI2 A;  2KSS A;  4J9E A;  3UPU A;  4GLK A;  4HXJ A;  2DTO A;  5LJ5 j;  3BW1 A;  1NYG A;  2RJC A;  4QVD A;  5C6S A;  3CCE T;  4F7U A;  1ACM B;  5GAM e;  4P5N A;  3EAE A;  2E4H A;  5IT9 E;  1QCF A;  1ZA1 B;  2OTL T;  4OGE A;  4RTZ A;  3SD4 A;  4M78 A;  2RK1 A;  2WSE E;  1I81 A;  3MHX A;  3WVE B;  1VQ9 T;  2QQS A;  2DET A;  3ULR B;  2BZX A;  2VB6 A;  2LT4 A;  4FYY B;  2ZCF B;  3THK A;  3UDC A;  1SG5 A;  4FL6 A;  4N4G A;  3LGF A;  3GPL A;  2KT8 A;  1VQM T;  3G4S T;  3CCM A;  4J9D A;  2D6F A;  2DFU A;  2HDA A;  2X4W A;  4PFP A;  2AZV A;  2XG8 D;  5CKD A;  3UA6 A;  5GJV B;  3FLG A;  1NE8 A;  2BUD A;  2MPX C;  2KRN A;  3EFO A;  1VQ6 A;  5LJ5 d;  2L3S A;  1C0M A;  2F1L A;  3SWN B;  4EMK C;  5I2S A;  3M53 A;  5CO7 A;  3CPW S;  1M9S A;  1QKW A;  1K4U S;  4MML A;  1OV3 A;  1A0N B;  4M7A F;  5GAM h;  1PNJ A;  2EQI A;  1NJI C;  3I55 A;  4A53 A;  3HRU A;  1W2B P;  2FO0 A;  3QXE B;  1YBY A;  1OUL A;  3MEV A;  4M7A C;  4HCB A;  4MZM A;  1VA7 A;  5CKE A;  3FIF A;  2NLU A;  1Y7X A;  2M9U A;  2J7I A;  4LDV A;  1VQ6 Q;  3I56 A;  3OQ5 A;  4OMP A;  2EGA A;  2CZ0 B;  2DBM A;  3L2Q A;  2RHY A;  4A4E A;  4HT9 A;  1UGV A;  4C92 F;  3X26 B;  5EG2 A;  4JPB W;  2CT3 A;  4HCK A;  5GAM f;  5HCK A;  2F69 A;  2DJQ A;  3E9G A;  2R5A A;  2QA4 Q;  1ARK A;  1PRM C;  3OBY A;  2E3I A;  2RPN A;  2OTJ T;  4HCZ A;  3CC7 T;  1UHC A;  3MKD A;  2FRY A;  2EKH A;  3VS5 A;  1QW1 A;  2VV5 A;  3CME Q;  2E3H A;  1RL2 A;  1VQO Q;  1K9A A;  4J7I A;  4EMK B;  1GCQ A;  3OYA A;  2EYW A;  2O31 A;  4JRQ A;  1Y96 B;  4JS4 A;  1Q82 U;  2CP5 A;  4RTX A;  4OMN A;  3PMT A;  1GL5 A;  2LDM A;  3M54 A;  1WNL A;  3CCL Q;  4AFQ C;  1VYT A;  4F7U E;  1QVG S;  2K3B A;  2E6Z A;  1WHJ A;  3X25 B;  2PU9 B;  4C5G A;  1D3B B;  2CGH A;  5GAN 6;  5GAN g;  2A7Y A;  4M7A B;  3CQT A;  8AT1 B;  1NM7 A;  3REB B;  2AT1 B;  3M4Y A;  4UC4 A;  2XI9 A;  3V8J A;  2AHJ B;  2B86 A;  4M78 D;  4F17 A;  1K1Z A;  1SRM A;  1H3Z A;  2KGT A;  3OYY A;  1M3A A;  2FPD A;  3VUB A;  2VKN A;  1KFZ A;  2YUN A;  3LH0 A;  2E12 A;  5GAO m;  1YJN Q;  4C8Q G;  2E5Q A;  3EFR A;  2DVJ A;  3X20 B;  2XU8 A;  5LL6 S;  2RO0 A;  1Z9Z A;  1M1K C;  4XU1 A;  3VJP A;  4DEX A;  2DNU A;  1XQH A;  1VQ5 A;  1SKU B;  1M5Q 1;  1RAI B;  2M1H A;  3VKI A;  3TEE A;  1O9S A;  2X4J A;  4BDY A;  2QQB A;  3GBQ A;  4M75 D;  2KBT A;  3JCM P;  3CCQ Q;  3V7C A;  1IGU A;  1T0H A;  2YRD A;  4E7J A;  2RI3 A;  4OB0 B;  3CCE A;  3JV3 A;  1M3B A;  4DOW A;  1MNE A;  2RA2 A;  1BU1 A;  2QA4 T;  2GFU A;  1PD0 A;  2I2L A;  1VYU A;  1VQ9 A;  4RTW A;  1BCM A;  4JZ3 A;  2EGE A;  4BAC A;  1IRE B;  1UEB A;  2GF7 A;  4J9H A;  2E10 A;  1X2K A;  2NYS A;  2BTT A;  3O8V A;  4A4H A;  1WHH A;  1G3S A;  5C0M A;  1AZE A;  5J26 A;  3CCQ A;  4JZ4 A;  2CDT A;  3VRZ A;  2SEM A;  2LCC A;  2FEI A;  4DBH A;  1X43 A;  1K73 U;  4OMF B;  2H3E B;  2O2O A;  1BIB A;  3E1S A;  4PJO G;  4A4F A;  1LPL A;  1QQJ A;  4LNP A;  4B9X A;  3QUI A;  3WVD B;  3D7S B;  3DB4 A;  5GAN 2;  3OS5 A;  4FT2 A;  1BCO A;  3G1J A;  4RTY A;  1M2V A;  1M8V A;  1YIJ T;  3QO3 A;  1K73 R;  1N8R U;  3A8O B;  2L89 A;  1CSK A;  5D6X A;  1YFN A;  1V29 B;  1NPP A;  3LGL A;  3MP8 A;  2P0Q A;  4PFZ A;  3P8B B;  2EAY A;  2RH2 A;  1X6O A;  2ZZD A;  4FYW B;  3ME9 A;  5FRM A;  3CMA Q;  2XK0 A;  5CAI A;  3SEM A;  5DM7 R;  4N4I A;  5KYY A;  4BE2 A;  1Q7Y R;  4J9B A;  5GAN d;  1IZ6 A;  1AEY A;  3CEY A;  2P0P A;  1KSW A;  4K11 A;  1X69 A;  4C8Q E;  1E7O A;  1C6V X;  3RMS A;  2LC4 A;  3CPW A;  2MK5 A;  2M0O A;  4Y91 A;  3HKS A;  2R58 A;  1QVG P;  3OS0 A;  1QKX A;  3EGD B;  3L42 A;  1WHM A;  1ZQ1 A;  2F5T X;  4L6V 5;  1KIK A;  1TWB A;  4J7F A;  1Q81 C;  1BYM A;  4D8K A;  2BE9 B;  1RLP C;  4QQ6 A;  2K2M A;  2K6D A;  4FSX A;  5IHI A;  1VQO A;  3NHN A;  3CME A;  1GFC A;  4C0D C;  3PE0 A;  3SFM A;  4O5V A;  1D0Y A;  2IVW A;  4RTT A;  4M77 B;  2AKL A;  4N0A C;  2EVR A;  3TRE A;  1D1B A;  1WHK A;  4XTU A;  2C0T A;  3M0U A;  2RM4 A;  1UB4 A;  4E7K A;  3MP1 A;  4OF1 A;  2CUD A;  1MMG A;  3CC4 A;  2FG0 A;  1RLQ C;  1ZBJ A;  4XTY A;  4M75 A;  2FYK A;  1VQM A;  1S72 Q;  2LNV A;  3ZL7 C;  2RJD A;  2ZPG B;  3NTI A;  3PVQ A;  2OAU A;  2DYB A;  2V1Q A;  2VAS A;  7AT1 B;  2NUZ A;  2JW4 A;  2QAS A;  2GQI A;  2EYZ A;  4RG8 A;  4M4Z A;  4RUG A;  1AT1 B;  2KRS A;  4X34 A;  5DLO A;  4KBM B;  2JOY A;  1OX8 A;  1Y07 A;  4WTO B;  2KY9 A;  4RG2 A;  1VIF A;  5D7U A;  1HYO A;  4OB3 B;  1FX7 A;  1E6G A;  3LLR A;  1PKT A;  5GAN 4;  2RK2 A;  2RHZ A;  2RN8 A;  1HSQ A;  1BI1 A;  3JSC A;  1FMW A;  1UG1 A;  1SF9 A;  2PVG B;  1VQL A;  2LQK A;  3LYI A;  3CCM Q;  1M1K U;  4II1 A;  4PFO A;  3VU3 C;  2RD1 A;  4M77 C;  1FMK A;  2DL5 A;  1NEB A;  5KYX B;  1QCN A;  3JCM g;  3QII A;  1GCQ C;  5CQY A;  2J05 A;  2JMC A;  1BB9 A;  4OMO A;  1YJW T;  2MI6 A;  2DXU A;  1AWX A;  2E5K A;  3NPF A;  3CMA T;  4XTV A;  3QZ9 B;  4NS5 A;  2EIF A;  2HEQ A;  1SHF A;  5J3B A;  4PNO A;  1I1J A;  2WAC A;  3R6O A;  2EYX A;  1V76 A;  4FM4 B;  1ZSZ A;  3VS1 A;  3M0Q A;  2MYS A;  3QWY A;  5GAN 3;  3BDL A;  1PSE A;  1OI1 A;  3EFS A;  4XTX A;  2DMO A;  5LJ3 g;  3RES A;  3OYC A;  1PKS A;  4C0F A;  4X1V A;  3CCU A;  2C0I A;  4RTU A;  2XDP A;  5KH6 A;  1XTD A;  1PSF A;  2DO3 A;  4PL6 A;  1VQN Q;  4ZN3 A;  4E7L A;  2RQW A;  4C0G A;  4M77 E;  4XQ3 A;  5A2Q E;  3QYH B;  2P0K A;  3OYN A;  1YN8 A;  5D6W A;  3RIR A;  1HJD A;  4M75 E;  1M90 U;  1KQ2 A;  2KQW A;  4AG1 C;  3JCM V;  1QLY A;  3L2U A;  4NL2 A;  4IIO A;  3J80 E;  1Q81 U;  2LNH B;  1U8R A;  1G8X A;  1G3T A;  3UA7 A;  4F04 B;  1NZ9 A;  3CC2 T;  2QXF A;  4ELY C;  1R0B G;  3GNG A;  4B6M A;  3HFO A;  3OMC A;  3INZ A;  2P4R A;  1AOJ A;  4KGV B;  2F5K A;  3OYJ A;  1X6G A;  1Q81 R;  1U5S A;  1JRI A;  4NL3 A;  3OYF A;  2OI3 A;  2GTO A;  2JM8 A;  5GMK l;  2IIM A;  4IUP A;  1SEM A;  4OMM A;  5CKH A;  1KC8 C;  2ZPE B;  1R77 A;  1YIT T;  1VQ9 Q;  4AFU C;  4JJC A;  5I22 A;  4IUR A;  4XU2 A;  2LTO A;  1YCY A;  3RKW A;  1MV0 B;  3HPW A;  5HY6 A;  1QP3 A;  2O4X A;  3EHR A;  4NOY A;  2O9V A;  3TQ7 P;  4EMK A;  2MOX A;  2VUB A;  2DF6 A;  5HK3 A;  1UTI A;  2GGR A;  2LQN A;  2CT4 A;  1W2B A;  3OB9 A;  1WA7 A;  1LOJ A;  2QGG A;  3RKX A;  1JB0 E;  3Q1J A;  2EWN A;  2RJE A;  5GAO l;  1IHV A;  1PWT A;  1U1S A;  2DKG A;  2ED0 A;  1N5Z A;  1AHJ B;  1ZUY A; 
#chains in the Genus database with same CATH homology
 1QWF A;  1K76 A;  1T3S A;  1YCS B;  1B3Q A;  3TSZ A;  2W10 A;  2B86 A;  4JJD A;  4F17 A;  1K1Z A;  1SRM A;  1NG2 A;  2KGT A;  5IH2 A;  1M27 C;  4JJB A;  1RUW A;  2HSP A;  2HBW A;  2DE0 X;  1M3A A;  2F2X A;  1SHG A;  2FPD A;  1SPK A;  2D0N A;  4E6R A;  2VKN A;  4GLM A;  2YUN A;  1KFZ A;  1Y0M A;  2ESW A;  2DL4 A;  2DVJ A;  1V1C A;  1NLP C;  2ABL A;  1JXM A;  1Z9Z A;  2MIO A;  2C0O A;  2DLP A;  4DEX A;  3LH5 A;  3IQL A;  2DNU A;  3TSW A;  4RTV A;  1T3L A;  4EIK A;  5GJW B;  1GBR A;  1JU5 C;  3GBQ A;  1M8M A;  2A08 A;  2CH4 A;  2KBT A;  3H0I A;  3VS6 A;  1T0H A;  1UE9 A;  1AWJ A;  3JV3 A;  1M3B A;  2H8H A;  1OEB A;  2BZ8 A;  1BU1 A;  1AZG B;  1X2Q A;  1UFF A;  2OAW A;  3SHW A;  2AKK A;  3H41 A;  1JO8 A;  1M30 A;  2EGC A;  1VYU A;  3VS7 A;  4RTW A;  2DL3 A;  1K0S A;  4JZ3 A;  2EGE A;  1E6H A;  1TUD A;  1FYN A;  4ZNX A;  1WXT A;  3EG2 A;  4J9H A;  1GFD A;  1X2K A;  2J6K A;  2BTT A;  3NGP A;  2VVK A;  3REA B;  1AZE A;  4LN2 A;  3EG0 A;  4JZ4 A;  2KEA A;  2CDT A;  3VRZ A;  4HVU A;  2SEM A;  2FEI A;  1X43 A;  1HD3 A;  2DL7 A;  1UDL A;  2O2O A;  1WXU A;  2CSI A;  1ZUU A;  1VYV A;  4LNP A;  2EPD A;  2SRC A;  3U23 A;  2EBP A;  4RTY A;  3VS2 A;  1LCK A;  2BZY A;  2DL8 A;  1CSK A;  2RQR A;  4ORZ A;  2EYY A;  3UAT A;  3H0H A;  2GNC A;  1X27 A;  5EC7 A;  2L3Q A;  3EGU A;  2D8H A;  1QWE A;  2KR3 A;  2DA9 A;  2RQV A;  4LUD A;  1GBQ A;  2V1R A;  4FSS A;  2I0N A;  3RNJ A;  2FPE A;  1WX6 A;  3SEM A;  2FRW A;  5ECA A;  1I0C A;  4Z8A A;  1UEC A;  1W70 A;  4J9B A;  2JS0 A;  1AEY A;  2GBQ A;  1KSW A;  1U3O A;  4K11 A;  1X69 A;  1WDX A;  2F2V A;  2L3P A;  1PHT A;  1E7O A;  2A28 A;  3A98 A;  3M0T A;  1Y57 A;  1NLO C;  2CSQ A;  2D8J A;  1WYX A;  2JMA A;  4D8D A;  4DEY A;  3UF4 A;  2J6O A;  2YUO A;  1QKX A;  4LE9 A;  3VS3 A;  2CRE A;  1KIK A;  3M0P A;  2LP5 A;  4J9G A;  4D8K A;  1RLP C;  2PZ1 A;  2K2M A;  2K6D A;  1NYF A;  2KE9 A;  5IHI A;  5IXB A;  2A36 A;  2X3W D;  3NHN A;  2AZS A;  1GFC A;  5FWC A;  3PE0 A;  3VRY A;  1Z9Q A;  1G83 A;  3EHQ A;  4CC2 A;  2LJ1 A;  1TG0 A;  1ZLM A;  1CKA A;  4RTT A;  2CH4 W;  1NEG A;  4HVV A;  2DRK A;  2ROL A;  2AKL A;  5IHN A;  1H8K A;  4IIM A;  1AWW A;  2EVR A;  2G6F X;  4Y92 A;  2KYB A;  5FWB A;  2C0T A;  3M0U A;  1UJY A;  2ENM A;  2LMJ A;  2VWF A;  2A37 A;  1WFW A;  2CUD A;  2FG0 A;  1RLQ C;  1ZBJ A;  2LX7 A;  3I5S A;  2MCN A;  2KXD A;  1X6B A;  1BK2 A;  2F2W A;  2DX1 A;  2L0A A;  2RMO A;  1AD5 A;  3ZL7 C;  3PVQ A;  2D1X A;  2DYB A;  1I07 A;  2V1Q A;  2AK5 A;  1T0J A;  2JM9 A;  2NUZ A;  2DM1 A;  4WCI A;  2JW4 A;  1U06 A;  4J9I A;  5IXF A;  2GQI A;  2EYZ A;  2NWM A;  4CC3 A;  4HVW A;  3I35 A;  4M4Z A;  2QDL A;  4RUG A;  1YNZ A;  1J3T A;  1YP5 A;  2KRS A;  2W0Z A;  3EG3 A;  1IO6 A;  4R0K A;  2DBK A;  4F14 A;  1TUC A;  2ECZ A;  2KXC A;  2JS2 A;  2JT4 A;  2X3X D;  1E6G A;  2KT1 A;  3I5R A;  2O88 A;  1ABO A;  1PKT A;  2M51 A;  2LCS A;  2OJ2 A;  3VS4 A;  2RN8 A;  1HSQ A;  4A63 B;  2DRM A;  1CKB A;  4CC4 B;  3R6N A;  1UG1 A;  1AWO A;  1JEG A;  2KNB B;  3TVT A;  4J9E A;  1M3C A;  1RI9 A;  4HXJ A;  4J9F A;  1NYG A;  1KJW A;  1YWO A;  2YT6 A;  1FMK A;  1B07 A;  2DL5 A;  1NEB A;  1WXB A;  1QCF A;  1JXO A;  3VS0 A;  1GCQ C;  2J05 A;  1MUZ A;  4RTZ A;  2JMC A;  1XOV A;  5IHK A;  1BB9 A;  2XMF A;  4OMO A;  1PRL C;  3ULR B;  4LUE A;  2BZX A;  2DIL A;  2M0Y A;  2K7A A;  1AVZ C;  1AWX A;  2E5K A;  3NPF A;  3FJ5 A;  1OPK A;  1H92 A;  5FW9 A;  2YSQ A;  3THK A;  2HEQ A;  2ROT A;  4AG2 C;  1SHF A;  1I1J A;  3O5Z A;  2YUP A;  1MV3 A;  2EYX A;  2KT8 A;  3H0F A;  3VS1 A;  2KRO A;  1SRL A;  4J9D A;  2LQW A;  3M0Q A;  1UUE A;  2K79 A;  2CUB A;  1ZSG A;  3QWY A;  2HDA A;  2AZV A;  3UA6 A;  5GJV B;  2PTK A;  1UJ0 A;  4F16 A;  4GBQ A;  2RNA A;  4Z89 A;  2KRN A;  2DMO A;  2L3S A;  2RQT A;  3NMZ C;  2HCK A;  3M0S A;  4QT7 A;  1YWP A;  1SSH A;  1PKS A;  2PNI A;  4X1V A;  2C0I A;  1QKW A;  3KFV A;  1K4U S;  1OV3 A;  1A0N B;  2LJ3 A;  2GTJ A;  4RTU A;  1PNJ A;  2EQI A;  4Z88 A;  1S1N A;  4OMQ A;  2FO0 A;  1K0X A;  3RBB B;  2RQW A;  3PVL A;  1ABQ A;  1GCP A;  3C0C A;  1YN8 A;  1VA7 A;  1OOT A;  1HJD A;  1OPL A;  4AG1 C;  2J7I A;  3QWX X;  2RQU A;  1QLY A;  1ZUK A;  4OMP A;  4ESR A;  2EGA A;  4IIO A;  4AFS C;  2LNH B;  2FPF A;  3UA7 A;  2YDL A;  1EFN A;  2DBM A;  1WIE A;  2RF0 A;  1UGV A;  1W6X A;  2KRM A;  4JPB W;  2CT3 A;  4HCK A;  5HCK A;  1UHF A;  2DJQ A;  2EW3 A;  2P4R A;  1AOJ A;  1X6G A;  1U5S A;  1ARK A;  1PRM C;  2OI3 A;  2GTO A;  2LJ0 A;  2JM8 A;  2IIM A;  2YUQ A;  1SEM A;  2RPN A;  4OMM A;  3M0R A;  1UHC A;  2K9G A;  2FRY A;  2EKH A;  3VS5 A;  4AFU C;  4JJC A;  5I22 A;  2JTE A;  2J06 A;  4AFZ C;  1WLP B;  2ED1 A;  1K9A A;  1GCQ A;  2EYW A;  2O31 A;  1MV0 B;  5L23 A;  4RTX A;  2L2P A;  3EHR A;  2O9V A;  4OMN A;  5I11 A;  2MOX A;  2DF6 A;  1W1F A;  1UTI A;  1GL5 A;  2GGR A;  2LQN A;  1VYT A;  2CT4 A;  4AFQ C;  1WA7 A;  2K3B A;  3I9Q A;  4KRT A;  1JQQ A;  1WI7 A;  1H3H A;  1PWT A;  4J9C A;  4CC7 A;  1G2B A;  2KYM A;  2J6F A;  3EG1 A;  1GRI A;  2JXB A;  2LZ6 B;  2ED0 A;  2O9S A;  3CQT A;  1BBZ A;  4OML A;  1N5Z A;  1ZX6 A;  1NM7 A;  1ZUY A;  3REB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...