1W70A

Sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
LIKHMRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w70A00
2G6FX 2AZVA 1HJDA 1UTIA 1RUWA 1Y0MA 1ABQA 4ESRA 3NHNA 1UGVA 3UA6A 1VYVA 1Y57A 2O9SA 2W10A 2RQWA 2YDLA 1X2KA 4M4ZA 1PRMC 1YP5A 2FRYA 1KIKA 1VYUA 2DYBA 4LN2A 1K0SA 2LX7A 1AZEA 3NMZC 1ZUUA 1PRLC 2DF6A 2F2XA 1N5ZA 1AEYA 4Y92A 2HEQA 4AFUC 4EIKA 1ZLMA 1U06A 2KBTA 2EYXA 2K7AA 1CSKA 1G2BA 2V1QA 1WXBA 4LUDA 2GBQA 1K0XA 2W0ZA 5FW9A 3H0HA 2DL3A 2VWFA 1SRMA 2KYMA 2HSPA 3FJ5A 4RTYA 2GQIA 1QKXA 2AZSA 2HDAA 3RBBB 4J9CA 1KFZA 3EG1A 3UATA 2EGEA 1PKTA 1WA7A 2EYZA 2DRMA 2J06A 4J9BA 1W70A 2JS0A 3REAB 1UHFA 4HVWA 2FPEA 2JT4A 2KRSA 2J6KA 1IO6A 2OAWA 3EHQA 2L3SA 1VYTA 3VS0A 5L23A 1NEGA 2X3WD 1NYGA 1G83A 3M0RA 2A08A 3NGPA 1I0CA 1WLPB 1CKBA 4IIMA 3U23A 1NG2A 2GNCA 1X69A 1FYNA 1E6HA 2KYBA 1T3SA 3I9QA 1WI7A 4JJCA 2D1XA 2JXBA 2FRWA 4OMQA 5GJVB 2DL8A 3TSWA 4F16A 3I35A 2BZYA 1AWWA 2EBPA 2BZ8A 2YUNA 2FPDA 4A63B 3EHRA 2C0TA 2KRNA 2L0AA 2LMJA 3I5SA 1UDLA 3NPFA 1AZGB 2RQVA 4OMMA 1SHGA 1U3OA 4E6RA 2J7IA 1EFNA 2EGAA 2RMOA 4LNPA 1RI9A 1MV0B 1U5SA 3LH5A 1WXUA 1ABOA 2K2MA 1WXTA 2FPFA 2K9GA 1GFDA 4JJDA 1E6GA 2L3QA 5IXBA 2DNUA 2RQTA 1NLPC 2FG0A 3M0QA 4Z88A 1XOVA 2ED0A 4LE9A 4RTXA 1GBRA 2LNHB 2M0YA 5IXFA 2EW3A 2LP5A 2PTKA 2O9VA 1PNJA 2DM1A 1MV3A 2KNBB 2YT6A 2MOXA 4AFQC 3VS3A 3QWXX 4JZ4A 2PZ1A 1K9AA 1AOJA 1BB9A 1B3QA 4Z8AA 3M0SA 4RTUA 1WIEA 3SHWA 3PVLA 1JEGA 4F14A 1WYXA 2L2PA 2DMOA 2V1RA 1SHFA 3EGUA 2AK5A 2C0OA 3PVQA 1FMKA 1HD3A 5FWCA 2CH4W 4KRTA 4GBQA 1T3LA 2KXCA 1SSHA 2CDTA 4ORZA 2LCSA 4AFSC 1B07A 2DL4A 4RUGA 5IHKA 1MUZA 1X6BA 1M3CA 4RTVA 2KROA 2FEIA 1QCFA 1YNZA 2RN8A 1QWEA 4OMNA 2XMFA 2YSQA 2J6FA 3R6NA 2O88A 1AWJA 1W6XA 2LJ0A 4FSSA 3ZL7C 1GCQA 2DRKA 2I0NA 1UJ0A 1WX6A 2DL5A 4Z89A 1QKWA 2EKHA 1BK2A 3O5ZA 1GRIA 4OMOA 2YUOA 1ZBJA 1UG1A 2D8JA 2CUBA 2DA9A 2DL7A 1GBQA 1X43A 2JM8A 3JV3A 2DVJA 2LJ1A 5FWBA 1GCPA 2F2WA 1A0NB 3VS7A 3VS4A 1AD5A 2EYWA 1ZUKA 3EG2A 2DBMA 2KR3A 4K11A 2DBKA 1CKAA 2HBWA 1T0HA 1RLQC 2KGTA 3REBB 2EGCA 1ZX6A 2GGRA 4J9HA 5IHNA 3VS5A 2X3XD 3I5RA 2JTEA 4J9IA 3SEMA 5IHIA 2VKNA 4D8DA 1UECA 3M0PA 3TVTA 1VA7A 1S1NA 2AKKA 2JS2A 1YCSB 3H0IA 2VVKA 1KJWA 2J05A 2RF0A 4AG2C 4DEYA 4AFZC 2JW4A 2A37A 1HSQA 2O2OA 1JXOA 4HCKA 2EYYA 4LUEA 2CSIA 1JXMA 2KRMA 4JZ3A 1TG0A 2F2VA 1KSWA 1ZSGA 1K4US 1QLYA 2DILA 1M3BA 2CSQA 1NM7A 5EC7A 2MCNA 1W1FA 1WFWA 4JPBW 2CREA 2L3PA 2K6DA 2M51A 3VRZA 1YWOA 1UJYA 2OI3A 5I22A 1OPKA 2RQRA 3CQTA 4QT7A 2QDLA 3UA7A 2DE0X 2E5KA 1AWOA 2JMCA 1PWTA 2D0NA 3UF4A 1E7OA 1UHCA 4J9FA 1K76A 3QWYA 1UUEA 2CUDA 2J6OA 2ROTA 1J3TA 2ED1A 1GCQC 2RPNA 5ECAA 1PKSA 1H8KA 2NUZA 2P4RA 2HCKA 2EQIA 1RLPC 2DLPA 4CC2A 1YWPA 1NYFA 3EG0A 2IIMA 3VS2A 1QWFA 5I11A 3KFVA 1JU5C 3C0CA 4HVUA 1JQQA 2LZ6B 2EVRA 1OPLA 1UFFA 2K3BA 2KEAA 4RTTA 2OJ2A 3M0TA 4RTWA 1M27C 2LJ3A 2C0IA 1OV3A 2A36A 2ENMA 5HCKA 2BZXA 4HVVA 4IIOA 1I07A 3PE0A 1Z9ZA 2ESWA 1SEMA 2ABLA 4OMLA 1BU1A 5GJWB 4CC7A 4CC3A 3VS1A 4GLMA 4CC4B 2AKLA 2SRCA 1H3HA 2ROLA 4AG1C 2PNIA 2KT8A 3ULRB 2O31A 4R0KA 1I1JA 1OEBA 1Z9QA 2KE9A 4J9DA 1YN8A 2MIOA 2JM9A 1K1ZA 2DX1A 2FO0A 1OOTA 1M8MA 1NLOC 1M3AA 1T0JA 2CH4A 2BTTA 1WDXA 2GTOA 2EPDA 2KXDA 3VRYA 1BBZA 1SRLA 4JJBA 4OMPA 1GL5A 1AWXA 1AVZC 2LQWA 1UE9A 1ARKA 1TUCA 1SPKA 3THKA 2YUQA 2GTJA 2KT1A 2SEMA 5IH2A 2RNAA 1JO8A 2K79A 3TSZA 4DEXA 2B86A 2A28A 2RQUA 2DJQA 4ZNXA 2ECZA 2YUPA 4RTZA 1M30A 2NWMA 1TUDA 1GFCA 3H41A 2CT4A 3VS6A 1X27A 4J9GA 3H0FA 1X6GA 1V1CA 2D8HA 3M0UA 2CT3A 2LQNA 4HXJA 4WCIA 3EG3A 1H92A 3A98A 3GBQA 3RNJA 4F17A 1LCKA 1ZUYA 4D8KA 2JMAA 1X2QA 4X1VA 3IQLA 1NEBA 1PHTA 4J9EA 2H8HA
chains in the Genus database with same CATH superfamily
2G6FX 1HJDA 1UTIA 4FYVB 3NHNA 4A4KA 1LJOA 1VYVA 2RQWA 1M2VA 3JCMf 1X2KA 5LJ3f 3A8LB 4FYXB 2CZ6B 2HD0A 1PG5B 4OVAA 1AZEA 3RUXA 4MZMA 1PRLC 4L5GA 1VQLA 4QQ6A 3FRNA 3CCSQ 4AFUC 1U06A 1D0YA 4FM4B 4C5EA 2KBTA 1CSKA 1G2BA 3VKIA 2V1QA 4LUDA 4M7AG 2GBQA 1K0XA 3H0HA 1SF9A 3RMQA 3CCQQ 3EH1A 2KI7A 4D6WA 2KYMA 2HSPA 3FC3A 3CCRQ 5CCAA 4QQGA 4J9CA 1VQLQ 4M75G 3CCRT 1KFZA 4KBMB 1M1KU 4EMKA 2EGEA 4M77F 1PKTA 2B8AA 2J06A 5GAOl 1I8FA 5KE3A 2CP0A 4GY5A 5DLOA 4QQDA 2FPEA 2JT4A 2QG9B 2J6KA 2AT1B 3LGFA 1QVFS 2YRVA 2O4XA 1M1KR 2X3WD 2ZZDA 4X9DA 2WSCE 3M0RA 2MI6A 3G4ST 1QVGS 2GCXA 3BFMA 2P0KA 2CP5A 3OBYA 1YITA 1WLPB 4JS4A 3U23A 9ATCB 2XDPA 1N8RR 1FYNA 1T3SA 4C8QC 2M0OA 2D0QB 4KGVB 3OB9A 2E3HA 2JXBA 2FRWA 1K8AC 3I35A 2BZYA 3BW1A 3OSSC 2EBPA 2C0TA 3QDRB 2L0AA 1QVPA 2X4YA 1LNXA 2LMJA 1UDLA 3I5SA 1AZGB 3I55T 1ZA2B 4EMKC 4M7DC 3RR6A 3BE3A 4V2SA 5LJ3g 4A4EA 1WXUA 1YFNA 3M54A 3PTAA 2K9GA 1GFDA 4JJDA 3V8KA 3JB9J 1Y71A 3M0QA 2VUBA 2ED0A 3CC2Q 4RTXA 2LNHB 2YLBA 3G71T 2PTKA 3TQ7P 1M90R 5KCOA 4EDUA 4O5VA 1YIJT 2KMTA 2OAUA 5LJ3h 3QWXX 4X34A 2PUKB 1K9AA 2DIGA 4XU0A 1WIEA 3G71A 3PVLA 4F14A 2QQRA 1N8RC 3I56T 1G3SA 1YJ9Q 2AK5A 3WXMB 5CO7A 2C0OA 5GAN8 5FWCA 1YJNT 2RA2A 2LRQA 4M78A 5I2MA 2KXCA 3OW2A 3QJYA 2YLCA 1B07A 1X01A 1WHHA 4N4HA 1OZ3A 1RAIB 1X6BA 1M3CA 3MPUB 1UGRB 3QHSA 4N4IA 3GNGA 3QSUA 1I5LA 1YNZA 2KAFA 3TU4K 1QWEA 2R57A 3UPUA 2K57A 4OMNA 4M7DF 3R6NA 3LWIA 2O88A 2LJ0A 2RHUA 1VQ7A 1VQ9T 1UJ0A 1YHQQ 5AYFA 5C6SA 3OSVA 3JCMV 2DIQA 5HY6A 2EKHA 1WJQA 2EWNA 4QW2A 2QEXA 2L5QA 2DXUA 1NZ9A 4OMOA 3VU3C 1HYOA 3M9QA 4JRKA 3L42A 1X43A 5DY9A 3WVEB 5FWBA 2F2WA 3VS4A 1AD5A 4OB2B 3EG2A 1NJIU 2KR3A 1QVGP 3T9NA 2ZPEB 2DEQA 4K11A 1T0HA 3REBB 2EGCA 4FT4A 3QDFA 4KGZB 2GGRA 2L3RA 2M02A 1ZA1B 2JTEA 2YWWA 3SEMA 5KYXA 3CC7Q 3M0PA 4Y91A 2AKKA 2JS2A 3G4SQ 3H0IA 2VVKA 4A54A 2J05A 2OTLQ 3CCEQ 2E64A 4C5GA 2OTJQ 4A4HA 1YJ9T 2DFUA 2QEXT 1MMNA 1FMVA 1TG0A 1KSWA 5GAMe 1ZBXA 2DILA 5EC7A 3ZBDA 1IREB 3C12A 1C0MA 1W1FA 2F5KA 4JPBW 2F5TX 5HK3A 1OX8A 3QPHA 3QZ9B 2ZPIB 1Q86C 1LOJA 2DXCA 2RQRA 3CQTA 1D1CA 2QDLA 2DE0X 4C0GA 4E7LA 2D0NA 4ZTFA 3SD4A 3UF4A 3GP8A 1YHQT 1LVKA 1K76A 4XTVA 1KG1A 2ED1A 3SB2A 1Q86U 3CCLT 3CCMT 4OGEA 3RKYA 4F7UB 1GCQC 5GAN2 2DEUA 2NUZA 1VIEA 2NUTB 4HA8A 2FZKB 1YCYA 2HCKA 3V7RA 3JAME 3OW2P 3CCUT 1RLPC 4PJJA 4DBFA 1UGQB 2X9HA 2ZAEA 4A53A 1YIJQ 2Z0WA 1KHCA 1MMAA 2JJ9A 4PJOD 2IIMA 1KC8R 1Q81U 3E1SA 4M7AC 3KFVA 1JU5C 1JBMA 3C0CA 4LD6A 3HHTB 4JRQA 4WF2A 2FVUA 3CD6T 3ZEHA 4L6V5 3MO8A 1D0XA 3OYAA 1S72Q 2ZPFB 4RTWA 3CCQA 4XU3A 4M75B 1OV3A 2ENMA 2PVGB 5KE2A 1BI0A 4HVVA 1M8VA 1BKBA 3JCMb 1VQPA 1NJIC 3EGDB 3I56A 5GAOr 4DQ2A 4AMCA 2ESWA 2ABLA 4JJNK 1BU1A 4CC4B 4HCZA 2CZ7B 2AKLA 2V8IA 3QZ5B 2I2LA 4KUIA 5D6YA 1K9MU 3A8MB 4R0KA 2O31A 4XTZA 2DK3A 4BE1A 1VQLT 5GMKi 2RI3A 1K1ZA 2FO0A 1NPRA 1QVGA 3QUIA 3PIOA 1OOTA 2GTOA 1WDXA 4AT1B 2EPDA 4XK8E 3VRYA 4M78B 1BBZA 4JJBA 2DO3A 3S3NA 4ATOA 1H641 1C1AA 5CQYA 1UE9A 2MPXC 1ARKA 1SPKA 3THKA 1WZOA 2YUQA 5IH2A 3JCMe 1UGSB 2K79A 4DEXA 2B86A 3LWHA 1JJ2S 3CBPA 4ZNXA 2ECZA 4RTZA 1M30A 2NWMA 3QBYA 4M78D 1TUDA 3G6EQ 4C92F 3SDZA 3CCVT 4PL6A 1VQ5A 3QXEB 4C92B 4FSXA 5A0GA 4M75E 5LJ5e 2LQKA 1X2QA 3IQLA 1NEBA 2AZVA 3AHUA 2CP7A 2X35A 3CCST 1ABQA 5GAMg 1YJ9A 2NLUA 1W2BP 1Y57A 2O9SA 1X75C 1U1SA 2YDLA 2PVDB 1Q82U 1YP5A 1VQKQ 1Q7YR 3ASKA 3DLLA 2FRYA 4ZN1A 1VYUA 1KIKA 2YXYA 2LX7A 2O01E 3CBMA 5KYXB 4C92D 2HEQA 3GOXA 2K7AA 1WXBA 3HTRA 1UB4A 3CMEQ 1RABB 3ME9A 1WNLA 4PLLA 4ELYC 2DETA 6AT1B 1WGSA 5A2QE 3FJ5A 2GQIA 4Q5WA 1YJWT 2AZSA 3HP9A 3OQ5A 2IVWA 2HDAA 3EG1A 5CK9A 4QVCA 5D6XA 4MDWA 5GAN7 3G7ZA 4C92G 2EQMA 1WA7A 2EYZA 1VQ5Q 1VQMT 1FX7A 3REAB 4F7UE 2EYQA 1VQKA 3MCAB 1IO6A 2X4XA 5CKDA 3A1PA 4KT0E 3AT1B 2OTJT 4FU6A 5L23A 3OYCA 2KDSA 4EMKB 1MMGA 1NEGA 2DXBA 3J7AF 3FIFA 3NTKA 3NGPA 4F7UA 1I0CA 5LJ3j 2RM4A 1YBYA 4XQ3A 4O6JA 1FWZA 2KYBA 3DB4A 3Q1JA 2D1XA 2R5AA 1VQ8T 5GJVB 2DL8A 4M78C 3TSWA 4B9WA 5LJ5j 3HRTA 2FPDA 1SG5A 1PM3A 5KYWB 3GLXA 2JTMA 4N4GA 3NPFA 2RJDA 5GAOm 1OU8A 3CC4T 3R6OA 3FJPA 1QP2A 4PJOA 2RI5A 3CCVQ 1RI9A 2HZYA 1MV0B 8ATCB 4C8QE 1I5OB 2ZGWA 1M90U 2K2MA 1WXTA 2FPFA 4IURA 2LVMA 1RADB 3OYYA 3M58A 2FHDA 3QYHB 3JCMJ 5IXBA 2A7YA 1VQ4T 2FG0A 4Z88A 1KC8C 3V8JA 1S72A 4C8QB 4MMKA 3OS1A 1GBRA 2M0YA 5IXFA 4M77G 1MV3A 2KNBB 2YT6A 4J7IA 2MOXA 1RAAB 4KGXB 4C8QF 1N9SA 4JZ4A 2EQKA 5J26A 2PZ1A 1BB9A 4J7FA 2K2VA 3M0SA 4RTUA 3SHWA 2MAMA 2EJFA 3QJ6A 2BE7D 1WHGA 1FMWA 5GAMd 5J3BA 2LDMA 1SHFA 3CPWA 4N0AC 3PVQA 4R56A 3HFNA 1HD3A 2QQSA 4XTYA 1T3LA 3FB9A 2LCSA 4AFSC 3M4GA 4RUGA 1VQ7T 1RI0A 2DTIA 4FCYA 2FEIA 2CP2A 4EMHA 1QCFA 2HSEB 2RN8A 4RMOA 2ZPBB 3CMET 3KBGA 2RK2A 1VQ5T 5LJ3d 3I55A 2DRKA 2DL5A 1BK2A 3O5ZA 2XG8D 1ACMB 3CCJQ 1ZBJA 1UG1A 4E7JA 2LCLA 5GAN5 1FXXA 4M75A 3MEWA 5GMKj 2DBKA 4JUVA 1RLQC 3DLMA 4J9HA 1YIJA 2KVQG 3M5AA 3VS5A 3CCLQ 4J9IA 4BUGA 4D8DA 5CKEA 2M9UA 1S1NA 1NJIR 1D3BB 4WTOB 2Y4XA 2RF0A 4AG2C 2GFAA 2LX9A 4AFZC 2O2OA 4HCKA 2EYYA 2JN0A 3CXCA 4LUEA 3OY9A 2LC4A 4IUPA 4FW2A 2ZPHB 2CSIA 2K5FA 2KRMA 4JZ3A 3CCJA 3SWNC 1QLYA 4JRIA 1M3BA 2RHYA 2CSQA 1NM7A 4HKEA 2EAYA 3MEUA 1YI2T 3E9FA 3LGLA 2L3PA 2K6DA 2X4WA 2M51A 2LTOA 1YWOA 1MNEA 2M16A 5I22A 1M4ZA 4CI0C 3OYJA 4JS5A 3S3MA 5GAMj 4QT7A 1AWOA 2JMCA 2KY9A 1PWTA 4M77C 1G5VA 4NOYA 5GANj 1UHCA 3H8ZA 3QWYA 1J3TA 4F7UG 3LW5E 2RI2A 3VYGA 5FU7B 2VGNA 1OU9A 2JTFA 2MYSA 2OTLA 1H8KA 5IT9E 1QVFA 4XTWA 3CMAQ 2COWA 2HQEA 1IZ6A 2EQIA 3CEYA 3I55Q 2VC8A 1WJRA 5KYNA 2DLPA 4OGCA 2NUTA 1JJ2P 4OP0A 2PQWA 3C95A 1YJNQ 1VQKT 1OX9A 3EG0A 4XU2A 2L89A 3VS2A 1QWFA 2YRCA 5I11A 2O4XB 3JCMW 3EGDA 3PMIA 1JQQA 2LZ6B 2EVRA 4HT9A 1OPLA 5CR2A 2K3BA 2KEAA 1VQPT 2Y4YA 1N9RA 3CC2A 1TU0B 3M0TA 1M27C 4BI4A 1KHIA 1QCOA 1VQOA 2P0PA 2QGFB 1QCNA 4FT2A 1XTDA 5LJ5h 1VQ7Q 2L8DA 4M7DA 2FZGB 3HKSA 1VQ6Q 1SEMA 4OMLA 3VS1A 4GLMA 1RL2A 3NTHA 3QG1A 1AHJB 2G3RA 2DYIA 4XAXB 3CPWS 3INZA 1RAHB 3JCMh 2KE9A 4J9DA 4RKUE 1PCXA 2JM9A 2DX1A 4M78E 5GAOn 1YJWQ 4IKFA 1NLOC 3L2VA 1M3AA 1T0JA 2X4JA 2XDBA 3EFOA 1K9MR 3OYBA 5GANd 2DD5A 1WQWA 1AVZC 1M1KC 2FB7A 4BI3A 2DTHA 1GXIE 2CZ1B 2RO0A 1KQ1A 3RESA 3JCMg 1JO8A 3FEOA 1VQ6T 1JRIA 1WHMA 2YHTA 4J6WA 2FYKA 1G8XA 3V7SA 3CCLA 2XD0A 1GFCA 3H41A 3LYIA 5CKBA 1X27A 4PFOA 2IG0A 3OYFA 4J5YA 4J9GA 3OYMA 2VV5A 3PFSA 5CKHA 1VQNQ 2BIVA 3GBQA 4F17A 1LCKA 4F7UF 1Q82R 3CCVA 2K3XA 8AT1B 4TVRA 4ESRA 5KYUB 1D1AA 1UGVA 4DA4A 4OMFB 4DBRA 2W10A 4IUUA 5FU7C 1R8OB 4DOWA 2EJ9A 4LN2A 1K0SA 2P0QA 4KH1B 4M75D 1ZUUA 2DF6A 1AEYA 4Y92A 4EIKA 3J81E 1ZLMA 5CIUA 4ME7A 3RIRA 4B6MA 2DAQA 3CCRA 5FW9A 3VUZA 2RH2A 1Q7YU 1SKUB 1U8RA 2KQWA 2JZ2A 2NUPA 1U1TA 2EFIA 1QKXA 3E9GA 3OYNA 3A8HB 3M53A 1TOVA 1WPYA 3JRZA 3JB9D 2H3EB 2EIFA 4KH0B 3UATA 4M75C 2DRMA 2JS0A 4MZPA 3OS2A 5KYYB 4HVWA 1IHVA 1I4K1 2KRSA 3QO3A 2OAWA 3TCJA 3EHQA 2VXFA 2L3SA 3VS0A 3EGXB 5GAMh 1G3WA 1G83A 4HCCA 3CCJT 3OS0A 3BDUA 4M77E 1CKBA 1RAGB 1NBEB 1NG2A 4C8QD 4Z02A 1X69A 1E6HA 4HCBA 3EFSA 1BCMA 4DBQA 1BYMA 1IXDA 1ZHIA 3NFCA 4OMQA 5LJ3e 1BI3A 1RAFB 1AWWA 4XTXA 3QKJA 2BZ8A 2YUNA 1HXDA 4J6XA 3EHRA 3N5BB 1O75A 1QMCA 2KRNA 2BKDN 3O8VA 1O9SA 4JLIA 1U3OA 2J7IA 5DM7R 2RMOA 1N27A 2VYTA 4LNPA 4MDXA 3G6ET 1IGQA 1VQOT 4BB7A 1ABOA 4RCBA 3HPWA 1VQ8Q 1E6GA 2L3QA 2LQ8A 2VGMA 2E1HA 2A0FB 1YJWA 2DNUA 2RQTA 3EG9A 5LJ5d 1MNDA 1XOVA 4LE9A 1Q7YC 2EW3A 2LP5A 1KQSS 1XNIA 4YTLA 2FZCB 5KCHA 2DM1A 2JNGA 5CKFA 4AFQC 5GMKl 2D6FA 3VS3A 3CXCS 1QP3A 1KD1U 2XU8A 1YI2Q 3MP1A 3OYHA 1QQJA 4Z8AA 3JCMP 3OYIA 1JEGA 3CD6Q 1WYXA 2EQUA 3GNFB 2QTXA 1UGPB 1D0ZA 3EGUA 3CPFA 3M56A 1FMKA 3X28B 1KD1R 2CH4W 1KQSA 4KRTA 2VXEA 1Y96A 3E19A 5GMKe 4ORZA 2CDTA 3DKMA 2D9TA 1K9MC 1VQ9A 2DL4A 2VB6A 1WHKA 1VQNA 3CPWP 4BE2A 2QQAA 1YITT 5GANf 2XMFA 2YSQA 2J6FA 1SSFA 1OZ2A 1AWJA 2E70A 4FSSA 1GCQA 1M2OA 1VQPQ 3TREA 2QA4A 4C0FA 4NL3A 5D6WA 1NE8A 3L2ZA 4ANJA 2YUOA 3X20B 3CCET 1QVFP 3PNWC 2D8JA 2CUBA 2DA9A 2HBPA 1M1GA 2DTOA 1GBQA 5IN1A 1AT1B 2DVJA 2LJ1A 1Q81C 2EYWA 1ZUKA 2DBMA 3EAEA 5GANh 2KGTA 1PD1A 2QTVA 1ZX6A 3G6EA 5KYWA 3I5RA 3CCMQ 1D09B 4M78F 3OBWA 5GANe 4PNOA 1YCSB 2XHCA 2GQVA 4II1A 1M5Q1 2QYZA 2JVVA 2RHIA 4QVDA 4GLKA 5A0DA 4J6YA 1KK7A 2E12A 1JXMA 3MP6A 2F2VA 1ZSGA 5FU6B 5GAN4 1VQNT 1C6VX 3CC7A 1WFWA 1ZQ1A 4M7DB 1F1BB 4HT8A 3VRZA 1Q86R 1BCOA 1UJYA 2PUOB 4M7AB 3CCMA 1TWBA 2RK1A 2DPPB 3DB3A 2QQBA 1IGUA 4FYWB 2HKNA 1E7OA 5EG2A 3OMCA 4JDSA 5GMKh 1UUEA 1BIBA 2CUDA 3P8DA 2ROTA 4BDYA 3I56Q 4BI8B 5J39A 3JB9G 2QI2A 4A4GA 1Q81R 1N6AA 5ECAA 2HQXA 2LNVA 1TSFA 2P4RA 4LDYA 4OF1A 3VYHB 1HK9A 4CC2A 3P8BB 2DJZA 4C0DC 1YWPA 4PJLA 4M7AD 2RJFA 3CC7T 2DERA 2KSSA 4M77A 4M7AE 1MHNA 4C8QA 3TEEA 5GAOq 1EX4A 4PJOC 3LX7A 1UFFA 3MJXA 1R0CB 4RTTA 2ZPGB 3SFMA 3MP8A 1X6OA 3UWNA 5HCKA 2BZXA 1KC8U 2QEXQ 4IIOA 4PLIA 1LPLA 3LLRA 3M59A 2MK5A 3PE0A 5GANg 4PKCC 1Z9ZA 2F69A 3CBOA 2EKOA 4PJOF 3ZFJA 1PD0A 4CC3A 4BY6C 2OX7A 3CCUA 1H3HA 2ROLA 4AG1C 2PNIA 2KT8A 2DZCA 2EQJA 4C5IA 1MMDA 3GF5A 1OEBA 1TS9A 4B9XA 4JRPA 1YN8A 2MIOA 2MF2A 2E65A 2WSFE 2Y90A 3A8OB 3OYLA 2K4YA 2XKOC 4RG2A 1ZSZA 2BTTA 4A4FA 2QQ9A 2KXDA 2CZ0B 4LDVA 2R5MA 1VOMA 4QVZA 3MEAA 2JOYA 3G71Q 1VUBA 4OMPA 3OYEA 5AT1B 2E5QA 4MZTA 1IHWA 3OS5A 1TUCA 2JUFA 2SEMA 2RNAA 3PGGA 2A28A 2RQUA 2IPOB 2DJQA 4J8OA 3UT1A 2YUPA 2XI9A 1NPPA 3VJPA 5CVIA 2CT4A 2WSEE 2BE9B 1X6GA 1S72T 1V1CA 4M7AA 2D8HA 3M0UA 2CT3A 3M4YA 4WCIA 1KD1C 2E10A 4XU1A 5GAOp 3S6WA 5L8RE 3RKXA 1WHJA 2MWOA 2JMAA 1Y7XA 3EFOB 7AT1B 4X1VA 1VQMQ 3H9NA 2H8HA 1TXQA 4N0AA 1RUWA 1Y0MA 4BACA 1TH7A 4DOVA 2BUDA 3UA6A 1ZSZC 2HQHA 5IAYA 4E7HA 1K8AU 4NS5A 3CD6A 3NTIA 2HNIA 4J83A 4M4ZA 2QK0A 1PRMC 3KXTA 2DYBA 2PVOB 2HL5C 3NMZC 1VQ6A 2F2XA 1N5ZA 4R55A 4X9CA 4E7SA 3HRUA 1Q82C 2EYXA 3JCMQ 4C92C 1W4SA 4KUDK 2W0ZA 2ZCFB 2DL3A 3JCMd 1OULA 3A5ZB 2XDDA 2VWFA 1SRMA 1VQMA 3UDCA 3CMEA 1Q95G 4PJOB 1UEBA 4RTYA 5KYYA 3M55A 1B34A 5KH6A 4P5NA 1H3ZA 3V8LA 3OMGA 3RBBB 4F04B 1M90C 1M1FA 2K5LA 4PJMA 1R0BG 2HMAA 1YJNA 2MWPA 4J9BA 1W70A 4C92A 2ATCB 2E6ZA 1B34B 3JCMc 1UHFA 5I21A 2RJCA 4E7IA 1VYTA 1K73U 3F70A 4OB3B 1NYGA 1PC0A 2EJGA 1W2BA 5LJ5f 2A08A 4C92E 2LT4A 2K5IA 3EH2A 4IIMA 5I2SA 3CC2T 2NUPB 3URGA 2GNCA 1K73R 4M7DG 3I9QA 2HL3A 1WI7A 4JJCA 5LJ5g 4RCCA 4C8QG 3WVDB 3X24B 2PU9B 3L2UA 1K73C 3OYKA 1BI1A 4A63B 4E47A 3OA6A 1N8RU 4EPCA 4CRIA 4PJOG 1WHLA 2RQVA 4OMMA 3CCUQ 1SHGA 2E4HA 4E6RA 1EFNA 2EGAA 4M77D 1V76A 2YRDA 3M57A 3X25B 1U5SA 3LH5A 4LD9K 3JB9F 1KQ2A 4M7DD 2CP6A 2GFUA 5GAN3 4FIBA 1QW1A 5CQXA 3L2RA 2E41A 1NLPC 3S3OA 5HKCA 4BD3A 2DZ9A 2RB6A 4ZGDB 3A8GB 2O9VA 1PNJA 3OYDA 3VV0A 1R77A 1VQ4A 2HAXA 4OB0B 1AOJA 2XK0A 4RG8A 1B3QA 3L2WA 4LDXA 2X51A 5FRNA 1EIFA 1JJ2A 2L2PA 2DMOA 2V1RA 1Y07A 4PJNA 2F1LA 3CCEA 3RMSA 1PSEA 4QKUA 1VQOQ 2QA4Q 2V8JA 4GBQA 3BY7A 1SSHA 4XTUA 4C5HA 2RHZA 2QASA 5IHKA 1MUZA 1V29B 4RTVA 2KROA 3X26B 3CCSA 4L59A 2QDYB 2E3IA 4FYYB 4NL2A 5D7UA 1XQHA 3JCMX 2DXTA 1M2VB 4KULA 1W6XA 3ZL7C 1RACB 2I0NA 1B7TA 1WX6A 2LT1A 4Z89A 1QKWA 3RKWA 2HKQB 3MKDA 1GRIA 2AHJB 4EMGA 3CMAA 4ZGJB 1XJWB 3J80E 2CS7A 2DL7A 3P8HA 2P84A 4PJOE 2JM8A 3JV3A 1GCPA 3PIPA 2CKKA 1A0NB 3VS7A 3OYGA 5GMKm 1P92A 4Y28E 3CMAT 2HBWA 1CKAA 3GPLA 3MEVA 1OI1A 5HK0A 3FDRA 3JB9I 5IHNA 2MMPA 2X3XD 2GF7A 1G3YA 2VKNA 5IHIA 3RERA 4E2FB 1OYXA 1UECA 4LDWA 3BDLA 3TVTA 3L1AA 4M77B 1VA7A 3EG9B 4PFPA 3CC4Q 4E7KA 1BI2A 1BIAA 1KJWA 3D7SB 4DEYA 3E2UA 2QA4T 1DJ7B 2JW4A 2A37A 1HSQA 1JXOA 4M7DE 3META 4IUQA 5M9OA 1WJSA 3QYGB 2E6NA 3VUBA 1K4US 4OB1B 3G4SA 2CP3A 3QIIA 2MCNA 4IUTA 1TTHB 3ER0A 2CREA 2COYA 1D1BA 1IRXA 1W2BS 5DLQE 2CYZB 2OI3A 1OPKA 1RAEB 3UA7A 2E5KA 4M75F 5LL6S 2DD4A 4DBHA 2C06A 2RJEA 4J9FA 3SWNA 3JSCA 2DKGA 2J6OA 5A0LA 4IUVA 1D3BA 4PFZA 3KUFA 4FW1A 4BDZA 2RPNA 2CGHA 1PKSA 2COZA 2QGGA 3SWNB 5GAMf 2QAZA 1TUGB 2WACA 4ELZC 4JLGA 2RHXA 4BY6B 1JB0E 1NYFA 4LDUA 1MGQA 1YI2A 3C94A 2RD1A 1M9SA 4HVUA 2QXFA 4FL6A 3EGXA 1VQ9Q 2OJ2A 4ZN3A 1YITQ 3HRSA 4BE0A 2C0IA 2A36A 2LJ3A 4PK4A 4VUBA 1I07A 2VASA 3L2QA 5FLXE 1VQ8A 3EFRA 5GAN6 2OTLT 2NYSA 2OTJA 2K3YA 5GJWB 1VQ4Q 4CC7A 4C0DB 4ZGEB 2V8KA 2FL7A 1EZZB 2SRCA 3FLGA 2DVEA 3ULRB 3V7CA 1I1JA 3HSBA 3MHXA 1Z9QA 2M1HA 1OQKA 5CAIA 2R58A 2H3JA 2P4TA 3HFOA 1VIFA 1M8MA 2CH4A 5FRMA 4C0ZA 1WQ7A 2KK4A 4LXCA 2XIDA 3LH0A 3CCQT 4UC4A 1SRLA 1Y96B 4ZTJA 1G3TA 4M7AF 1I81A 1IB8A 1GL5A 3G1JA 1AWXA 2LQWA 5KYUA 3GIBA 2LCCA 2XICA 2GTJA 2KT1A 1ZSZB 4M78G 2AIRB 4MMLA 3CC4A 3TSZA 3CXCP 3JB9H 1PSFA 3HL8A 1YHQA 3OW2S 1KQSP 3PT9A 3VS6A 5FU6C 2A3LA 4E7ZA 3C4SA 3H0FA 5FROA 5C0MA 3RDVA 2LQNA 1K8AR 4HXJA 3EG3A 1H92A 3A98A 3RNJA 1ZUYA 4D8KA 2V26A 3H6ZA 4F16A 1PHTA 4J9EA 3PMTA
chains in the Genus database with same CATH topology
2G6FX 2AZVA 1HJDA 1UTIA 1RUWA 1Y0MA 1ABQA 4ESRA 3NHNA 1UGVA 3UA6A 1VYVA 1Y57A 2O9SA 2W10A 2RQWA 2YDLA 1X2KA 4M4ZA 1PRMC 1YP5A 2FRYA 1KIKA 1VYUA 2DYBA 4LN2A 1K0SA 2LX7A 1AZEA 3NMZC 1ZUUA 1PRLC 2DF6A 2F2XA 1N5ZA 1AEYA 4Y92A 2HEQA 4AFUC 4EIKA 1ZLMA 1U06A 2KBTA 2EYXA 2K7AA 1CSKA 1G2BA 2V1QA 1WXBA 4LUDA 2GBQA 1K0XA 2W0ZA 5FW9A 3H0HA 2DL3A 2VWFA 1SRMA 2KYMA 2HSPA 3FJ5A 4RTYA 2GQIA 1QKXA 2AZSA 2HDAA 3RBBB 4J9CA 1KFZA 3EG1A 3UATA 2EGEA 1PKTA 1WA7A 2EYZA 2DRMA 2J06A 4J9BA 1W70A 2JS0A 3REAB 1UHFA 4HVWA 2FPEA 2JT4A 2KRSA 2J6KA 1IO6A 2OAWA 3EHQA 2L3SA 1VYTA 3VS0A 5L23A 1NEGA 2X3WD 1NYGA 1G83A 3M0RA 2A08A 3NGPA 1I0CA 1WLPB 1CKBA 4IIMA 3U23A 1NG2A 2GNCA 1X69A 1FYNA 1E6HA 2KYBA 1T3SA 3I9QA 1WI7A 4JJCA 2D1XA 2JXBA 2FRWA 4OMQA 5GJVB 2DL8A 3TSWA 4F16A 3I35A 2BZYA 1AWWA 2EBPA 2BZ8A 2YUNA 2FPDA 4A63B 3EHRA 2C0TA 2KRNA 2L0AA 2LMJA 3I5SA 1UDLA 3NPFA 1AZGB 2RQVA 4OMMA 1SHGA 1U3OA 4E6RA 2J7IA 1EFNA 2EGAA 2RMOA 4LNPA 1RI9A 1MV0B 1U5SA 3LH5A 1WXUA 1ABOA 2K2MA 1WXTA 2FPFA 2K9GA 1GFDA 4JJDA 1E6GA 2L3QA 5IXBA 2DNUA 2RQTA 1NLPC 2FG0A 3M0QA 4Z88A 1XOVA 2ED0A 4LE9A 4RTXA 1GBRA 2LNHB 2M0YA 5IXFA 2EW3A 2LP5A 2PTKA 2O9VA 1PNJA 2DM1A 1MV3A 2KNBB 2YT6A 2MOXA 4AFQC 3VS3A 3QWXX 4JZ4A 2PZ1A 1K9AA 1AOJA 1BB9A 1B3QA 4Z8AA 3M0SA 4RTUA 1WIEA 3SHWA 3PVLA 1JEGA 4F14A 1WYXA 2L2PA 2DMOA 2V1RA 1SHFA 3EGUA 2AK5A 2C0OA 3PVQA 1FMKA 1HD3A 5FWCA 2CH4W 4KRTA 4GBQA 1T3LA 2KXCA 1SSHA 2CDTA 4ORZA 2LCSA 4AFSC 1B07A 2DL4A 4RUGA 5IHKA 1MUZA 1X6BA 1M3CA 4RTVA 2KROA 2FEIA 1QCFA 1YNZA 2RN8A 1QWEA 4OMNA 2XMFA 2YSQA 2J6FA 3R6NA 2O88A 1AWJA 1W6XA 2LJ0A 4FSSA 3ZL7C 1GCQA 2DRKA 2I0NA 1UJ0A 1WX6A 2DL5A 4Z89A 1QKWA 2EKHA 1BK2A 3O5ZA 1GRIA 4OMOA 2YUOA 1ZBJA 1UG1A 2D8JA 2CUBA 2DA9A 2DL7A 1GBQA 1X43A 2JM8A 3JV3A 2DVJA 2LJ1A 5FWBA 1GCPA 2F2WA 1A0NB 3VS7A 3VS4A 1AD5A 2EYWA 1ZUKA 3EG2A 2DBMA 2KR3A 4K11A 2DBKA 1CKAA 2HBWA 1T0HA 1RLQC 2KGTA 3REBB 2EGCA 1ZX6A 2GGRA 4J9HA 5IHNA 3VS5A 2X3XD 3I5RA 2JTEA 4J9IA 3SEMA 5IHIA 2VKNA 4D8DA 1UECA 3M0PA 3TVTA 1VA7A 1S1NA 2AKKA 2JS2A 1YCSB 3H0IA 2VVKA 1KJWA 2J05A 2RF0A 4AG2C 4DEYA 4AFZC 2JW4A 2A37A 1HSQA 2O2OA 1JXOA 4HCKA 2EYYA 4LUEA 2CSIA 1JXMA 2KRMA 4JZ3A 1TG0A 2F2VA 1KSWA 1ZSGA 1K4US 1QLYA 2DILA 1M3BA 2CSQA 1NM7A 5EC7A 2MCNA 1W1FA 1WFWA 4JPBW 2CREA 2L3PA 2K6DA 2M51A 3VRZA 1YWOA 1UJYA 2OI3A 5I22A 1OPKA 2RQRA 3CQTA 4QT7A 2QDLA 3UA7A 2DE0X 2E5KA 1AWOA 2JMCA 1PWTA 2D0NA 3UF4A 1E7OA 1UHCA 4J9FA 1K76A 3QWYA 1UUEA 2CUDA 2J6OA 2ROTA 1J3TA 2ED1A 1GCQC 2RPNA 5ECAA 1PKSA 1H8KA 2NUZA 2P4RA 2HCKA 2EQIA 1RLPC 2DLPA 4CC2A 1YWPA 1NYFA 3EG0A 2IIMA 3VS2A 1QWFA 5I11A 3KFVA 1JU5C 3C0CA 4HVUA 1JQQA 2LZ6B 2EVRA 1OPLA 1UFFA 2K3BA 2KEAA 4RTTA 2OJ2A 3M0TA 4RTWA 1M27C 2LJ3A 2C0IA 1OV3A 2A36A 2ENMA 5HCKA 2BZXA 4HVVA 4IIOA 1I07A 3PE0A 1Z9ZA 2ESWA 1SEMA 2ABLA 4OMLA 1BU1A 5GJWB 4CC7A 4CC3A 3VS1A 4GLMA 4CC4B 2AKLA 2SRCA 1H3HA 2ROLA 4AG1C 2PNIA 2KT8A 3ULRB 2O31A 4R0KA 1I1JA 1OEBA 1Z9QA 2KE9A 4J9DA 1YN8A 2MIOA 2JM9A 1K1ZA 2DX1A 2FO0A 1OOTA 1M8MA 1NLOC 1M3AA 1T0JA 2CH4A 2BTTA 1WDXA 2GTOA 2EPDA 2KXDA 3VRYA 1BBZA 1SRLA 4JJBA 4OMPA 1GL5A 1AWXA 1AVZC 2LQWA 1UE9A 1ARKA 1TUCA 1SPKA 3THKA 2YUQA 2GTJA 2KT1A 2SEMA 5IH2A 2RNAA 1JO8A 2K79A 3TSZA 4DEXA 2B86A 2A28A 2RQUA 2DJQA 4ZNXA 2ECZA 2YUPA 4RTZA 1M30A 2NWMA 1TUDA 1GFCA 3H41A 2CT4A 3VS6A 1X27A 4J9GA 3H0FA 1X6GA 1V1CA 2D8HA 3M0UA 2CT3A 2LQNA 4HXJA 4WCIA 3EG3A 1H92A 3A98A 3GBQA 3RNJA 4F17A 1LCKA 1ZUYA 4D8KA 2JMAA 1X2QA 4X1VA 3IQLA 1NEBA 1PHTA 4J9EA 2H8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6F X;  2AZV A;  1HJD A;  1UTI A;  1RUW A;  1Y0M A;  1ABQ A;  4ESR A;  3NHN A;  1UGV A;  3UA6 A;  1VYV A;  1Y57 A;  2O9S A;  2W10 A;  2RQW A;  2YDL A;  1X2K A;  4M4Z A;  1PRM C;  1YP5 A;  2FRY A;  1KIK A;  1VYU A;  2DYB A;  4LN2 A;  1K0S A;  2LX7 A;  1AZE A;  3NMZ C;  1ZUU A;  1PRL C;  2DF6 A;  2F2X A;  1N5Z A;  1AEY A;  4Y92 A;  2HEQ A;  4AFU C;  4EIK A;  1ZLM A;  1U06 A;  2KBT A;  2EYX A;  2K7A A;  1CSK A;  1G2B A;  2V1Q A;  1WXB A;  4LUD A;  2GBQ A;  1K0X A;  2W0Z A;  5FW9 A;  3H0H A;  2DL3 A;  2VWF A;  1SRM A;  2KYM A;  2HSP A;  3FJ5 A;  4RTY A;  2GQI A;  1QKX A;  2AZS A;  2HDA A;  3RBB B;  4J9C A;  1KFZ A;  3EG1 A;  3UAT A;  2EGE A;  1PKT A;  1WA7 A;  2EYZ A;  2DRM A;  2J06 A;  4J9B A;  1W70 A;  2JS0 A;  3REA B;  1UHF A;  4HVW A;  2FPE A;  2JT4 A;  2KRS A;  2J6K A;  1IO6 A;  2OAW A;  3EHQ A;  2L3S A;  1VYT A;  3VS0 A;  5L23 A;  1NEG A;  2X3W D;  1NYG A;  1G83 A;  3M0R A;  2A08 A;  3NGP A;  1I0C A;  1WLP B;  1CKB A;  4IIM A;  3U23 A;  1NG2 A;  2GNC A;  1X69 A;  1FYN A;  1E6H A;  2KYB A;  1T3S A;  3I9Q A;  1WI7 A;  4JJC A;  2D1X A;  2JXB A;  2FRW A;  4OMQ A;  5GJV B;  2DL8 A;  3TSW A;  4F16 A;  3I35 A;  2BZY A;  1AWW A;  2EBP A;  2BZ8 A;  2YUN A;  2FPD A;  4A63 B;  3EHR A;  2C0T A;  2KRN A;  2L0A A;  2LMJ A;  3I5S A;  1UDL A;  3NPF A;  1AZG B;  2RQV A;  4OMM A;  1SHG A;  1U3O A;  4E6R A;  2J7I A;  1EFN A;  2EGA A;  2RMO A;  4LNP A;  1RI9 A;  1MV0 B;  1U5S A;  3LH5 A;  1WXU A;  1ABO A;  2K2M A;  1WXT A;  2FPF A;  2K9G A;  1GFD A;  4JJD A;  1E6G A;  2L3Q A;  5IXB A;  2DNU A;  2RQT A;  1NLP C;  2FG0 A;  3M0Q A;  4Z88 A;  1XOV A;  2ED0 A;  4LE9 A;  4RTX A;  1GBR A;  2LNH B;  2M0Y A;  5IXF A;  2EW3 A;  2LP5 A;  2PTK A;  2O9V A;  1PNJ A;  2DM1 A;  1MV3 A;  2KNB B;  2YT6 A;  2MOX A;  4AFQ C;  3VS3 A;  3QWX X;  4JZ4 A;  2PZ1 A;  1K9A A;  1AOJ A;  1BB9 A;  1B3Q A;  4Z8A A;  3M0S A;  4RTU A;  1WIE A;  3SHW A;  3PVL A;  1JEG A;  4F14 A;  1WYX A;  2L2P A;  2DMO A;  2V1R A;  1SHF A;  3EGU A;  2AK5 A;  2C0O A;  3PVQ A;  1FMK A;  1HD3 A;  5FWC A;  2CH4 W;  4KRT A;  4GBQ A;  1T3L A;  2KXC A;  1SSH A;  2CDT A;  4ORZ A;  2LCS A;  4AFS C;  1B07 A;  2DL4 A;  4RUG A;  5IHK A;  1MUZ A;  1X6B A;  1M3C A;  4RTV A;  2KRO A;  2FEI A;  1QCF A;  1YNZ A;  2RN8 A;  1QWE A;  4OMN A;  2XMF A;  2YSQ A;  2J6F A;  3R6N A;  2O88 A;  1AWJ A;  1W6X A;  2LJ0 A;  4FSS A;  3ZL7 C;  1GCQ A;  2DRK A;  2I0N A;  1UJ0 A;  1WX6 A;  2DL5 A;  4Z89 A;  1QKW A;  2EKH A;  1BK2 A;  3O5Z A;  1GRI A;  4OMO A;  2YUO A;  1ZBJ A;  1UG1 A;  2D8J A;  2CUB A;  2DA9 A;  2DL7 A;  1GBQ A;  1X43 A;  2JM8 A;  3JV3 A;  2DVJ A;  2LJ1 A;  5FWB A;  1GCP A;  2F2W A;  1A0N B;  3VS7 A;  3VS4 A;  1AD5 A;  2EYW A;  1ZUK A;  3EG2 A;  2DBM A;  2KR3 A;  4K11 A;  2DBK A;  1CKA A;  2HBW A;  1T0H A;  1RLQ C;  2KGT A;  3REB B;  2EGC A;  1ZX6 A;  2GGR A;  4J9H A;  5IHN A;  3VS5 A;  2X3X D;  3I5R A;  2JTE A;  4J9I A;  3SEM A;  5IHI A;  2VKN A;  4D8D A;  1UEC A;  3M0P A;  3TVT A;  1VA7 A;  1S1N A;  2AKK A;  2JS2 A;  1YCS B;  3H0I A;  2VVK A;  1KJW A;  2J05 A;  2RF0 A;  4AG2 C;  4DEY A;  4AFZ C;  2JW4 A;  2A37 A;  1HSQ A;  2O2O A;  1JXO A;  4HCK A;  2EYY A;  4LUE A;  2CSI A;  1JXM A;  2KRM A;  4JZ3 A;  1TG0 A;  2F2V A;  1KSW A;  1ZSG A;  1K4U S;  1QLY A;  2DIL A;  1M3B A;  2CSQ A;  1NM7 A;  5EC7 A;  2MCN A;  1W1F A;  1WFW A;  4JPB W;  2CRE A;  2L3P A;  2K6D A;  2M51 A;  3VRZ A;  1YWO A;  1UJY A;  2OI3 A;  5I22 A;  1OPK A;  2RQR A;  3CQT A;  4QT7 A;  2QDL A;  3UA7 A;  2DE0 X;  2E5K A;  1AWO A;  2JMC A;  1PWT A;  2D0N A;  3UF4 A;  1E7O A;  1UHC A;  4J9F A;  1K76 A;  3QWY A;  1UUE A;  2CUD A;  2J6O A;  2ROT A;  1J3T A;  2ED1 A;  1GCQ C;  2RPN A;  5ECA A;  1PKS A;  1H8K A;  2NUZ A;  2P4R A;  2HCK A;  2EQI A;  1RLP C;  2DLP A;  4CC2 A;  1YWP A;  1NYF A;  3EG0 A;  2IIM A;  3VS2 A;  1QWF A;  5I11 A;  3KFV A;  1JU5 C;  3C0C A;  4HVU A;  1JQQ A;  2LZ6 B;  2EVR A;  1OPL A;  1UFF A;  2K3B A;  2KEA A;  4RTT A;  2OJ2 A;  3M0T A;  4RTW A;  1M27 C;  2LJ3 A;  2C0I A;  1OV3 A;  2A36 A;  2ENM A;  5HCK A;  2BZX A;  4HVV A;  4IIO A;  1I07 A;  3PE0 A;  1Z9Z A;  2ESW A;  1SEM A;  2ABL A;  4OML A;  1BU1 A;  5GJW B;  4CC7 A;  4CC3 A;  3VS1 A;  4GLM A;  4CC4 B;  2AKL A;  2SRC A;  1H3H A;  2ROL A;  4AG1 C;  2PNI A;  2KT8 A;  3ULR B;  2O31 A;  4R0K A;  1I1J A;  1OEB A;  1Z9Q A;  2KE9 A;  4J9D A;  1YN8 A;  2MIO A;  2JM9 A;  1K1Z A;  2DX1 A;  2FO0 A;  1OOT A;  1M8M A;  1NLO C;  1M3A A;  1T0J A;  2CH4 A;  2BTT A;  1WDX A;  2GTO A;  2EPD A;  2KXD A;  3VRY A;  1BBZ A;  1SRL A;  4JJB A;  4OMP A;  1GL5 A;  1AWX A;  1AVZ C;  2LQW A;  1UE9 A;  1ARK A;  1TUC A;  1SPK A;  3THK A;  2YUQ A;  2GTJ A;  2KT1 A;  2SEM A;  5IH2 A;  2RNA A;  1JO8 A;  2K79 A;  3TSZ A;  4DEX A;  2B86 A;  2A28 A;  2RQU A;  2DJQ A;  4ZNX A;  2ECZ A;  2YUP A;  4RTZ A;  1M30 A;  2NWM A;  1TUD A;  1GFC A;  3H41 A;  2CT4 A;  3VS6 A;  1X27 A;  4J9G A;  3H0F A;  1X6G A;  1V1C A;  2D8H A;  3M0U A;  2CT3 A;  2LQN A;  4HXJ A;  4WCI A;  3EG3 A;  1H92 A;  3A98 A;  3GBQ A;  3RNJ A;  4F17 A;  1LCK A;  1ZUY A;  4D8K A;  2JMA A;  1X2Q A;  4X1V A;  3IQL A;  1NEB A;  1PHT A;  4J9E A;  2H8H A; 
#chains in the Genus database with same CATH topology
 2G6F X;  1HJD A;  1UTI A;  4FYV B;  3NHN A;  4A4K A;  1LJO A;  1VYV A;  2RQW A;  1M2V A;  3JCM f;  1X2K A;  5LJ3 f;  3A8L B;  4FYX B;  2CZ6 B;  2HD0 A;  1PG5 B;  4OVA A;  1AZE A;  3RUX A;  4MZM A;  1PRL C;  4L5G A;  1VQL A;  4QQ6 A;  3FRN A;  3CCS Q;  4AFU C;  1U06 A;  1D0Y A;  4FM4 B;  4C5E A;  2KBT A;  1CSK A;  1G2B A;  3VKI A;  2V1Q A;  4LUD A;  4M7A G;  2GBQ A;  1K0X A;  3H0H A;  1SF9 A;  3RMQ A;  3CCQ Q;  3EH1 A;  2KI7 A;  4D6W A;  2KYM A;  2HSP A;  3FC3 A;  3CCR Q;  5CCA A;  4QQG A;  4J9C A;  1VQL Q;  4M75 G;  3CCR T;  1KFZ A;  4KBM B;  1M1K U;  4EMK A;  2EGE A;  4M77 F;  1PKT A;  2B8A A;  2J06 A;  5GAO l;  1I8F A;  5KE3 A;  2CP0 A;  4GY5 A;  5DLO A;  4QQD A;  2FPE A;  2JT4 A;  2QG9 B;  2J6K A;  2AT1 B;  3LGF A;  1QVF S;  2YRV A;  2O4X A;  1M1K R;  2X3W D;  2ZZD A;  4X9D A;  2WSC E;  3M0R A;  2MI6 A;  3G4S T;  1QVG S;  2GCX A;  3BFM A;  2P0K A;  2CP5 A;  3OBY A;  1YIT A;  1WLP B;  4JS4 A;  3U23 A;  9ATC B;  2XDP A;  1N8R R;  1FYN A;  1T3S A;  4C8Q C;  2M0O A;  2D0Q B;  4KGV B;  3OB9 A;  2E3H A;  2JXB A;  2FRW A;  1K8A C;  3I35 A;  2BZY A;  3BW1 A;  3OSS C;  2EBP A;  2C0T A;  3QDR B;  2L0A A;  1QVP A;  2X4Y A;  1LNX A;  2LMJ A;  1UDL A;  3I5S A;  1AZG B;  3I55 T;  1ZA2 B;  4EMK C;  4M7D C;  3RR6 A;  3BE3 A;  4V2S A;  5LJ3 g;  4A4E A;  1WXU A;  1YFN A;  3M54 A;  3PTA A;  2K9G A;  1GFD A;  4JJD A;  3V8K A;  3JB9 J;  1Y71 A;  3M0Q A;  2VUB A;  2ED0 A;  3CC2 Q;  4RTX A;  2LNH B;  2YLB A;  3G71 T;  2PTK A;  3TQ7 P;  1M90 R;  5KCO A;  4EDU A;  4O5V A;  1YIJ T;  2KMT A;  2OAU A;  5LJ3 h;  3QWX X;  4X34 A;  2PUK B;  1K9A A;  2DIG A;  4XU0 A;  1WIE A;  3G71 A;  3PVL A;  4F14 A;  2QQR A;  1N8R C;  3I56 T;  1G3S A;  1YJ9 Q;  2AK5 A;  3WXM B;  5CO7 A;  2C0O A;  5GAN 8;  5FWC A;  1YJN T;  2RA2 A;  2LRQ A;  4M78 A;  5I2M A;  2KXC A;  3OW2 A;  3QJY A;  2YLC A;  1B07 A;  1X01 A;  1WHH A;  4N4H A;  1OZ3 A;  1RAI B;  1X6B A;  1M3C A;  3MPU B;  1UGR B;  3QHS A;  4N4I A;  3GNG A;  3QSU A;  1I5L A;  1YNZ A;  2KAF A;  3TU4 K;  1QWE A;  2R57 A;  3UPU A;  2K57 A;  4OMN A;  4M7D F;  3R6N A;  3LWI A;  2O88 A;  2LJ0 A;  2RHU A;  1VQ7 A;  1VQ9 T;  1UJ0 A;  1YHQ Q;  5AYF A;  5C6S A;  3OSV A;  3JCM V;  2DIQ A;  5HY6 A;  2EKH A;  1WJQ A;  2EWN A;  4QW2 A;  2QEX A;  2L5Q A;  2DXU A;  1NZ9 A;  4OMO A;  3VU3 C;  1HYO A;  3M9Q A;  4JRK A;  3L42 A;  1X43 A;  5DY9 A;  3WVE B;  5FWB A;  2F2W A;  3VS4 A;  1AD5 A;  4OB2 B;  3EG2 A;  1NJI U;  2KR3 A;  1QVG P;  3T9N A;  2ZPE B;  2DEQ A;  4K11 A;  1T0H A;  3REB B;  2EGC A;  4FT4 A;  3QDF A;  4KGZ B;  2GGR A;  2L3R A;  2M02 A;  1ZA1 B;  2JTE A;  2YWW A;  3SEM A;  5KYX A;  3CC7 Q;  3M0P A;  4Y91 A;  2AKK A;  2JS2 A;  3G4S Q;  3H0I A;  2VVK A;  4A54 A;  2J05 A;  2OTL Q;  3CCE Q;  2E64 A;  4C5G A;  2OTJ Q;  4A4H A;  1YJ9 T;  2DFU A;  2QEX T;  1MMN A;  1FMV A;  1TG0 A;  1KSW A;  5GAM e;  1ZBX A;  2DIL A;  5EC7 A;  3ZBD A;  1IRE B;  3C12 A;  1C0M A;  1W1F A;  2F5K A;  4JPB W;  2F5T X;  5HK3 A;  1OX8 A;  3QPH A;  3QZ9 B;  2ZPI B;  1Q86 C;  1LOJ A;  2DXC A;  2RQR A;  3CQT A;  1D1C A;  2QDL A;  2DE0 X;  4C0G A;  4E7L A;  2D0N A;  4ZTF A;  3SD4 A;  3UF4 A;  3GP8 A;  1YHQ T;  1LVK A;  1K76 A;  4XTV A;  1KG1 A;  2ED1 A;  3SB2 A;  1Q86 U;  3CCL T;  3CCM T;  4OGE A;  3RKY A;  4F7U B;  1GCQ C;  5GAN 2;  2DEU A;  2NUZ A;  1VIE A;  2NUT B;  4HA8 A;  2FZK B;  1YCY A;  2HCK A;  3V7R A;  3JAM E;  3OW2 P;  3CCU T;  1RLP C;  4PJJ A;  4DBF A;  1UGQ B;  2X9H A;  2ZAE A;  4A53 A;  1YIJ Q;  2Z0W A;  1KHC A;  1MMA A;  2JJ9 A;  4PJO D;  2IIM A;  1KC8 R;  1Q81 U;  3E1S A;  4M7A C;  3KFV A;  1JU5 C;  1JBM A;  3C0C A;  4LD6 A;  3HHT B;  4JRQ A;  4WF2 A;  2FVU A;  3CD6 T;  3ZEH A;  4L6V 5;  3MO8 A;  1D0X A;  3OYA A;  1S72 Q;  2ZPF B;  4RTW A;  3CCQ A;  4XU3 A;  4M75 B;  1OV3 A;  2ENM A;  2PVG B;  5KE2 A;  1BI0 A;  4HVV A;  1M8V A;  1BKB A;  3JCM b;  1VQP A;  1NJI C;  3EGD B;  3I56 A;  5GAO r;  4DQ2 A;  4AMC A;  2ESW A;  2ABL A;  4JJN K;  1BU1 A;  4CC4 B;  4HCZ A;  2CZ7 B;  2AKL A;  2V8I A;  3QZ5 B;  2I2L A;  4KUI A;  5D6Y A;  1K9M U;  3A8M B;  4R0K A;  2O31 A;  4XTZ A;  2DK3 A;  4BE1 A;  1VQL T;  5GMK i;  2RI3 A;  1K1Z A;  2FO0 A;  1NPR A;  1QVG A;  3QUI A;  3PIO A;  1OOT A;  2GTO A;  1WDX A;  4AT1 B;  2EPD A;  4XK8 E;  3VRY A;  4M78 B;  1BBZ A;  4JJB A;  2DO3 A;  3S3N A;  4ATO A;  1H64 1;  1C1A A;  5CQY A;  1UE9 A;  2MPX C;  1ARK A;  1SPK A;  3THK A;  1WZO A;  2YUQ A;  5IH2 A;  3JCM e;  1UGS B;  2K79 A;  4DEX A;  2B86 A;  3LWH A;  1JJ2 S;  3CBP A;  4ZNX A;  2ECZ A;  4RTZ A;  1M30 A;  2NWM A;  3QBY A;  4M78 D;  1TUD A;  3G6E Q;  4C92 F;  3SDZ A;  3CCV T;  4PL6 A;  1VQ5 A;  3QXE B;  4C92 B;  4FSX A;  5A0G A;  4M75 E;  5LJ5 e;  2LQK A;  1X2Q A;  3IQL A;  1NEB A;  2AZV A;  3AHU A;  2CP7 A;  2X35 A;  3CCS T;  1ABQ A;  5GAM g;  1YJ9 A;  2NLU A;  1W2B P;  1Y57 A;  2O9S A;  1X75 C;  1U1S A;  2YDL A;  2PVD B;  1Q82 U;  1YP5 A;  1VQK Q;  1Q7Y R;  3ASK A;  3DLL A;  2FRY A;  4ZN1 A;  1VYU A;  1KIK A;  2YXY A;  2LX7 A;  2O01 E;  3CBM A;  5KYX B;  4C92 D;  2HEQ A;  3GOX A;  2K7A A;  1WXB A;  3HTR A;  1UB4 A;  3CME Q;  1RAB B;  3ME9 A;  1WNL A;  4PLL A;  4ELY C;  2DET A;  6AT1 B;  1WGS A;  5A2Q E;  3FJ5 A;  2GQI A;  4Q5W A;  1YJW T;  2AZS A;  3HP9 A;  3OQ5 A;  2IVW A;  2HDA A;  3EG1 A;  5CK9 A;  4QVC A;  5D6X A;  4MDW A;  5GAN 7;  3G7Z A;  4C92 G;  2EQM A;  1WA7 A;  2EYZ A;  1VQ5 Q;  1VQM T;  1FX7 A;  3REA B;  4F7U E;  2EYQ A;  1VQK A;  3MCA B;  1IO6 A;  2X4X A;  5CKD A;  3A1P A;  4KT0 E;  3AT1 B;  2OTJ T;  4FU6 A;  5L23 A;  3OYC A;  2KDS A;  4EMK B;  1MMG A;  1NEG A;  2DXB A;  3J7A F;  3FIF A;  3NTK A;  3NGP A;  4F7U A;  1I0C A;  5LJ3 j;  2RM4 A;  1YBY A;  4XQ3 A;  4O6J A;  1FWZ A;  2KYB A;  3DB4 A;  3Q1J A;  2D1X A;  2R5A A;  1VQ8 T;  5GJV B;  2DL8 A;  4M78 C;  3TSW A;  4B9W A;  5LJ5 j;  3HRT A;  2FPD A;  1SG5 A;  1PM3 A;  5KYW B;  3GLX A;  2JTM A;  4N4G A;  3NPF A;  2RJD A;  5GAO m;  1OU8 A;  3CC4 T;  3R6O A;  3FJP A;  1QP2 A;  4PJO A;  2RI5 A;  3CCV Q;  1RI9 A;  2HZY A;  1MV0 B;  8ATC B;  4C8Q E;  1I5O B;  2ZGW A;  1M90 U;  2K2M A;  1WXT A;  2FPF A;  4IUR A;  2LVM A;  1RAD B;  3OYY A;  3M58 A;  2FHD A;  3QYH B;  3JCM J;  5IXB A;  2A7Y A;  1VQ4 T;  2FG0 A;  4Z88 A;  1KC8 C;  3V8J A;  1S72 A;  4C8Q B;  4MMK A;  3OS1 A;  1GBR A;  2M0Y A;  5IXF A;  4M77 G;  1MV3 A;  2KNB B;  2YT6 A;  4J7I A;  2MOX A;  1RAA B;  4KGX B;  4C8Q F;  1N9S A;  4JZ4 A;  2EQK A;  5J26 A;  2PZ1 A;  1BB9 A;  4J7F A;  2K2V A;  3M0S A;  4RTU A;  3SHW A;  2MAM A;  2EJF A;  3QJ6 A;  2BE7 D;  1WHG A;  1FMW A;  5GAM d;  5J3B A;  2LDM A;  1SHF A;  3CPW A;  4N0A C;  3PVQ A;  4R56 A;  3HFN A;  1HD3 A;  2QQS A;  4XTY A;  1T3L A;  3FB9 A;  2LCS A;  4AFS C;  3M4G A;  4RUG A;  1VQ7 T;  1RI0 A;  2DTI A;  4FCY A;  2FEI A;  2CP2 A;  4EMH A;  1QCF A;  2HSE B;  2RN8 A;  4RMO A;  2ZPB B;  3CME T;  3KBG A;  2RK2 A;  1VQ5 T;  5LJ3 d;  3I55 A;  2DRK A;  2DL5 A;  1BK2 A;  3O5Z A;  2XG8 D;  1ACM B;  3CCJ Q;  1ZBJ A;  1UG1 A;  4E7J A;  2LCL A;  5GAN 5;  1FXX A;  4M75 A;  3MEW A;  5GMK j;  2DBK A;  4JUV A;  1RLQ C;  3DLM A;  4J9H A;  1YIJ A;  2KVQ G;  3M5A A;  3VS5 A;  3CCL Q;  4J9I A;  4BUG A;  4D8D A;  5CKE A;  2M9U A;  1S1N A;  1NJI R;  1D3B B;  4WTO B;  2Y4X A;  2RF0 A;  4AG2 C;  2GFA A;  2LX9 A;  4AFZ C;  2O2O A;  4HCK A;  2EYY A;  2JN0 A;  3CXC A;  4LUE A;  3OY9 A;  2LC4 A;  4IUP A;  4FW2 A;  2ZPH B;  2CSI A;  2K5F A;  2KRM A;  4JZ3 A;  3CCJ A;  3SWN C;  1QLY A;  4JRI A;  1M3B A;  2RHY A;  2CSQ A;  1NM7 A;  4HKE A;  2EAY A;  3MEU A;  1YI2 T;  3E9F A;  3LGL A;  2L3P A;  2K6D A;  2X4W A;  2M51 A;  2LTO A;  1YWO A;  1MNE A;  2M16 A;  5I22 A;  1M4Z A;  4CI0 C;  3OYJ A;  4JS5 A;  3S3M A;  5GAM j;  4QT7 A;  1AWO A;  2JMC A;  2KY9 A;  1PWT A;  4M77 C;  1G5V A;  4NOY A;  5GAN j;  1UHC A;  3H8Z A;  3QWY A;  1J3T A;  4F7U G;  3LW5 E;  2RI2 A;  3VYG A;  5FU7 B;  2VGN A;  1OU9 A;  2JTF A;  2MYS A;  2OTL A;  1H8K A;  5IT9 E;  1QVF A;  4XTW A;  3CMA Q;  2COW A;  2HQE A;  1IZ6 A;  2EQI A;  3CEY A;  3I55 Q;  2VC8 A;  1WJR A;  5KYN A;  2DLP A;  4OGC A;  2NUT A;  1JJ2 P;  4OP0 A;  2PQW A;  3C95 A;  1YJN Q;  1VQK T;  1OX9 A;  3EG0 A;  4XU2 A;  2L89 A;  3VS2 A;  1QWF A;  2YRC A;  5I11 A;  2O4X B;  3JCM W;  3EGD A;  3PMI A;  1JQQ A;  2LZ6 B;  2EVR A;  4HT9 A;  1OPL A;  5CR2 A;  2K3B A;  2KEA A;  1VQP T;  2Y4Y A;  1N9R A;  3CC2 A;  1TU0 B;  3M0T A;  1M27 C;  4BI4 A;  1KHI A;  1QCO A;  1VQO A;  2P0P A;  2QGF B;  1QCN A;  4FT2 A;  1XTD A;  5LJ5 h;  1VQ7 Q;  2L8D A;  4M7D A;  2FZG B;  3HKS A;  1VQ6 Q;  1SEM A;  4OML A;  3VS1 A;  4GLM A;  1RL2 A;  3NTH A;  3QG1 A;  1AHJ B;  2G3R A;  2DYI A;  4XAX B;  3CPW S;  3INZ A;  1RAH B;  3JCM h;  2KE9 A;  4J9D A;  4RKU E;  1PCX A;  2JM9 A;  2DX1 A;  4M78 E;  5GAO n;  1YJW Q;  4IKF A;  1NLO C;  3L2V A;  1M3A A;  1T0J A;  2X4J A;  2XDB A;  3EFO A;  1K9M R;  3OYB A;  5GAN d;  2DD5 A;  1WQW A;  1AVZ C;  1M1K C;  2FB7 A;  4BI3 A;  2DTH A;  1GXI E;  2CZ1 B;  2RO0 A;  1KQ1 A;  3RES A;  3JCM g;  1JO8 A;  3FEO A;  1VQ6 T;  1JRI A;  1WHM A;  2YHT A;  4J6W A;  2FYK A;  1G8X A;  3V7S A;  3CCL A;  2XD0 A;  1GFC A;  3H41 A;  3LYI A;  5CKB A;  1X27 A;  4PFO A;  2IG0 A;  3OYF A;  4J5Y A;  4J9G A;  3OYM A;  2VV5 A;  3PFS A;  5CKH A;  1VQN Q;  2BIV A;  3GBQ A;  4F17 A;  1LCK A;  4F7U F;  1Q82 R;  3CCV A;  2K3X A;  8AT1 B;  4TVR A;  4ESR A;  5KYU B;  1D1A A;  1UGV A;  4DA4 A;  4OMF B;  4DBR A;  2W10 A;  4IUU A;  5FU7 C;  1R8O B;  4DOW A;  2EJ9 A;  4LN2 A;  1K0S A;  2P0Q A;  4KH1 B;  4M75 D;  1ZUU A;  2DF6 A;  1AEY A;  4Y92 A;  4EIK A;  3J81 E;  1ZLM A;  5CIU A;  4ME7 A;  3RIR A;  4B6M A;  2DAQ A;  3CCR A;  5FW9 A;  3VUZ A;  2RH2 A;  1Q7Y U;  1SKU B;  1U8R A;  2KQW A;  2JZ2 A;  2NUP A;  1U1T A;  2EFI A;  1QKX A;  3E9G A;  3OYN A;  3A8H B;  3M53 A;  1TOV A;  1WPY A;  3JRZ A;  3JB9 D;  2H3E B;  2EIF A;  4KH0 B;  3UAT A;  4M75 C;  2DRM A;  2JS0 A;  4MZP A;  3OS2 A;  5KYY B;  4HVW A;  1IHV A;  1I4K 1;  2KRS A;  3QO3 A;  2OAW A;  3TCJ A;  3EHQ A;  2VXF A;  2L3S A;  3VS0 A;  3EGX B;  5GAM h;  1G3W A;  1G83 A;  4HCC A;  3CCJ T;  3OS0 A;  3BDU A;  4M77 E;  1CKB A;  1RAG B;  1NBE B;  1NG2 A;  4C8Q D;  4Z02 A;  1X69 A;  1E6H A;  4HCB A;  3EFS A;  1BCM A;  4DBQ A;  1BYM A;  1IXD A;  1ZHI A;  3NFC A;  4OMQ A;  5LJ3 e;  1BI3 A;  1RAF B;  1AWW A;  4XTX A;  3QKJ A;  2BZ8 A;  2YUN A;  1HXD A;  4J6X A;  3EHR A;  3N5B B;  1O75 A;  1QMC A;  2KRN A;  2BKD N;  3O8V A;  1O9S A;  4JLI A;  1U3O A;  2J7I A;  5DM7 R;  2RMO A;  1N27 A;  2VYT A;  4LNP A;  4MDX A;  3G6E T;  1IGQ A;  1VQO T;  4BB7 A;  1ABO A;  4RCB A;  3HPW A;  1VQ8 Q;  1E6G A;  2L3Q A;  2LQ8 A;  2VGM A;  2E1H A;  2A0F B;  1YJW A;  2DNU A;  2RQT A;  3EG9 A;  5LJ5 d;  1MND A;  1XOV A;  4LE9 A;  1Q7Y C;  2EW3 A;  2LP5 A;  1KQS S;  1XNI A;  4YTL A;  2FZC B;  5KCH A;  2DM1 A;  2JNG A;  5CKF A;  4AFQ C;  5GMK l;  2D6F A;  3VS3 A;  3CXC S;  1QP3 A;  1KD1 U;  2XU8 A;  1YI2 Q;  3MP1 A;  3OYH A;  1QQJ A;  4Z8A A;  3JCM P;  3OYI A;  1JEG A;  3CD6 Q;  1WYX A;  2EQU A;  3GNF B;  2QTX A;  1UGP B;  1D0Z A;  3EGU A;  3CPF A;  3M56 A;  1FMK A;  3X28 B;  1KD1 R;  2CH4 W;  1KQS A;  4KRT A;  2VXE A;  1Y96 A;  3E19 A;  5GMK e;  4ORZ A;  2CDT A;  3DKM A;  2D9T A;  1K9M C;  1VQ9 A;  2DL4 A;  2VB6 A;  1WHK A;  1VQN A;  3CPW P;  4BE2 A;  2QQA A;  1YIT T;  5GAN f;  2XMF A;  2YSQ A;  2J6F A;  1SSF A;  1OZ2 A;  1AWJ A;  2E70 A;  4FSS A;  1GCQ A;  1M2O A;  1VQP Q;  3TRE A;  2QA4 A;  4C0F A;  4NL3 A;  5D6W A;  1NE8 A;  3L2Z A;  4ANJ A;  2YUO A;  3X20 B;  3CCE T;  1QVF P;  3PNW C;  2D8J A;  2CUB A;  2DA9 A;  2HBP A;  1M1G A;  2DTO A;  1GBQ A;  5IN1 A;  1AT1 B;  2DVJ A;  2LJ1 A;  1Q81 C;  2EYW A;  1ZUK A;  2DBM A;  3EAE A;  5GAN h;  2KGT A;  1PD1 A;  2QTV A;  1ZX6 A;  3G6E A;  5KYW A;  3I5R A;  3CCM Q;  1D09 B;  4M78 F;  3OBW A;  5GAN e;  4PNO A;  1YCS B;  2XHC A;  2GQV A;  4II1 A;  1M5Q 1;  2QYZ A;  2JVV A;  2RHI A;  4QVD A;  4GLK A;  5A0D A;  4J6Y A;  1KK7 A;  2E12 A;  1JXM A;  3MP6 A;  2F2V A;  1ZSG A;  5FU6 B;  5GAN 4;  1VQN T;  1C6V X;  3CC7 A;  1WFW A;  1ZQ1 A;  4M7D B;  1F1B B;  4HT8 A;  3VRZ A;  1Q86 R;  1BCO A;  1UJY A;  2PUO B;  4M7A B;  3CCM A;  1TWB A;  2RK1 A;  2DPP B;  3DB3 A;  2QQB A;  1IGU A;  4FYW B;  2HKN A;  1E7O A;  5EG2 A;  3OMC A;  4JDS A;  5GMK h;  1UUE A;  1BIB A;  2CUD A;  3P8D A;  2ROT A;  4BDY A;  3I56 Q;  4BI8 B;  5J39 A;  3JB9 G;  2QI2 A;  4A4G A;  1Q81 R;  1N6A A;  5ECA A;  2HQX A;  2LNV A;  1TSF A;  2P4R A;  4LDY A;  4OF1 A;  3VYH B;  1HK9 A;  4CC2 A;  3P8B B;  2DJZ A;  4C0D C;  1YWP A;  4PJL A;  4M7A D;  2RJF A;  3CC7 T;  2DER A;  2KSS A;  4M77 A;  4M7A E;  1MHN A;  4C8Q A;  3TEE A;  5GAO q;  1EX4 A;  4PJO C;  3LX7 A;  1UFF A;  3MJX A;  1R0C B;  4RTT A;  2ZPG B;  3SFM A;  3MP8 A;  1X6O A;  3UWN A;  5HCK A;  2BZX A;  1KC8 U;  2QEX Q;  4IIO A;  4PLI A;  1LPL A;  3LLR A;  3M59 A;  2MK5 A;  3PE0 A;  5GAN g;  4PKC C;  1Z9Z A;  2F69 A;  3CBO A;  2EKO A;  4PJO F;  3ZFJ A;  1PD0 A;  4CC3 A;  4BY6 C;  2OX7 A;  3CCU A;  1H3H A;  2ROL A;  4AG1 C;  2PNI A;  2KT8 A;  2DZC A;  2EQJ A;  4C5I A;  1MMD A;  3GF5 A;  1OEB A;  1TS9 A;  4B9X A;  4JRP A;  1YN8 A;  2MIO A;  2MF2 A;  2E65 A;  2WSF E;  2Y90 A;  3A8O B;  3OYL A;  2K4Y A;  2XKO C;  4RG2 A;  1ZSZ A;  2BTT A;  4A4F A;  2QQ9 A;  2KXD A;  2CZ0 B;  4LDV A;  2R5M A;  1VOM A;  4QVZ A;  3MEA A;  2JOY A;  3G71 Q;  1VUB A;  4OMP A;  3OYE A;  5AT1 B;  2E5Q A;  4MZT A;  1IHW A;  3OS5 A;  1TUC A;  2JUF A;  2SEM A;  2RNA A;  3PGG A;  2A28 A;  2RQU A;  2IPO B;  2DJQ A;  4J8O A;  3UT1 A;  2YUP A;  2XI9 A;  1NPP A;  3VJP A;  5CVI A;  2CT4 A;  2WSE E;  2BE9 B;  1X6G A;  1S72 T;  1V1C A;  4M7A A;  2D8H A;  3M0U A;  2CT3 A;  3M4Y A;  4WCI A;  1KD1 C;  2E10 A;  4XU1 A;  5GAO p;  3S6W A;  5L8R E;  3RKX A;  1WHJ A;  2MWO A;  2JMA A;  1Y7X A;  3EFO B;  7AT1 B;  4X1V A;  1VQM Q;  3H9N A;  2H8H A;  1TXQ A;  4N0A A;  1RUW A;  1Y0M A;  4BAC A;  1TH7 A;  4DOV A;  2BUD A;  3UA6 A;  1ZSZ C;  2HQH A;  5IAY A;  4E7H A;  1K8A U;  4NS5 A;  3CD6 A;  3NTI A;  2HNI A;  4J83 A;  4M4Z A;  2QK0 A;  1PRM C;  3KXT A;  2DYB A;  2PVO B;  2HL5 C;  3NMZ C;  1VQ6 A;  2F2X A;  1N5Z A;  4R55 A;  4X9C A;  4E7S A;  3HRU A;  1Q82 C;  2EYX A;  3JCM Q;  4C92 C;  1W4S A;  4KUD K;  2W0Z A;  2ZCF B;  2DL3 A;  3JCM d;  1OUL A;  3A5Z B;  2XDD A;  2VWF A;  1SRM A;  1VQM A;  3UDC A;  3CME A;  1Q95 G;  4PJO B;  1UEB A;  4RTY A;  5KYY A;  3M55 A;  1B34 A;  5KH6 A;  4P5N A;  1H3Z A;  3V8L A;  3OMG A;  3RBB B;  4F04 B;  1M90 C;  1M1F A;  2K5L A;  4PJM A;  1R0B G;  2HMA A;  1YJN A;  2MWP A;  4J9B A;  1W70 A;  4C92 A;  2ATC B;  2E6Z A;  1B34 B;  3JCM c;  1UHF A;  5I21 A;  2RJC A;  4E7I A;  1VYT A;  1K73 U;  3F70 A;  4OB3 B;  1NYG A;  1PC0 A;  2EJG A;  1W2B A;  5LJ5 f;  2A08 A;  4C92 E;  2LT4 A;  2K5I A;  3EH2 A;  4IIM A;  5I2S A;  3CC2 T;  2NUP B;  3URG A;  2GNC A;  1K73 R;  4M7D G;  3I9Q A;  2HL3 A;  1WI7 A;  4JJC A;  5LJ5 g;  4RCC A;  4C8Q G;  3WVD B;  3X24 B;  2PU9 B;  3L2U A;  1K73 C;  3OYK A;  1BI1 A;  4A63 B;  4E47 A;  3OA6 A;  1N8R U;  4EPC A;  4CRI A;  4PJO G;  1WHL A;  2RQV A;  4OMM A;  3CCU Q;  1SHG A;  2E4H A;  4E6R A;  1EFN A;  2EGA A;  4M77 D;  1V76 A;  2YRD A;  3M57 A;  3X25 B;  1U5S A;  3LH5 A;  4LD9 K;  3JB9 F;  1KQ2 A;  4M7D D;  2CP6 A;  2GFU A;  5GAN 3;  4FIB A;  1QW1 A;  5CQX A;  3L2R A;  2E41 A;  1NLP C;  3S3O A;  5HKC A;  4BD3 A;  2DZ9 A;  2RB6 A;  4ZGD B;  3A8G B;  2O9V A;  1PNJ A;  3OYD A;  3VV0 A;  1R77 A;  1VQ4 A;  2HAX A;  4OB0 B;  1AOJ A;  2XK0 A;  4RG8 A;  1B3Q A;  3L2W A;  4LDX A;  2X51 A;  5FRN A;  1EIF A;  1JJ2 A;  2L2P A;  2DMO A;  2V1R A;  1Y07 A;  4PJN A;  2F1L A;  3CCE A;  3RMS A;  1PSE A;  4QKU A;  1VQO Q;  2QA4 Q;  2V8J A;  4GBQ A;  3BY7 A;  1SSH A;  4XTU A;  4C5H A;  2RHZ A;  2QAS A;  5IHK A;  1MUZ A;  1V29 B;  4RTV A;  2KRO A;  3X26 B;  3CCS A;  4L59 A;  2QDY B;  2E3I A;  4FYY B;  4NL2 A;  5D7U A;  1XQH A;  3JCM X;  2DXT A;  1M2V B;  4KUL A;  1W6X A;  3ZL7 C;  1RAC B;  2I0N A;  1B7T A;  1WX6 A;  2LT1 A;  4Z89 A;  1QKW A;  3RKW A;  2HKQ B;  3MKD A;  1GRI A;  2AHJ B;  4EMG A;  3CMA A;  4ZGJ B;  1XJW B;  3J80 E;  2CS7 A;  2DL7 A;  3P8H A;  2P84 A;  4PJO E;  2JM8 A;  3JV3 A;  1GCP A;  3PIP A;  2CKK A;  1A0N B;  3VS7 A;  3OYG A;  5GMK m;  1P92 A;  4Y28 E;  3CMA T;  2HBW A;  1CKA A;  3GPL A;  3MEV A;  1OI1 A;  5HK0 A;  3FDR A;  3JB9 I;  5IHN A;  2MMP A;  2X3X D;  2GF7 A;  1G3Y A;  2VKN A;  5IHI A;  3RER A;  4E2F B;  1OYX A;  1UEC A;  4LDW A;  3BDL A;  3TVT A;  3L1A A;  4M77 B;  1VA7 A;  3EG9 B;  4PFP A;  3CC4 Q;  4E7K A;  1BI2 A;  1BIA A;  1KJW A;  3D7S B;  4DEY A;  3E2U A;  2QA4 T;  1DJ7 B;  2JW4 A;  2A37 A;  1HSQ A;  1JXO A;  4M7D E;  3MET A;  4IUQ A;  5M9O A;  1WJS A;  3QYG B;  2E6N A;  3VUB A;  1K4U S;  4OB1 B;  3G4S A;  2CP3 A;  3QII A;  2MCN A;  4IUT A;  1TTH B;  3ER0 A;  2CRE A;  2COY A;  1D1B A;  1IRX A;  1W2B S;  5DLQ E;  2CYZ B;  2OI3 A;  1OPK A;  1RAE B;  3UA7 A;  2E5K A;  4M75 F;  5LL6 S;  2DD4 A;  4DBH A;  2C06 A;  2RJE A;  4J9F A;  3SWN A;  3JSC A;  2DKG A;  2J6O A;  5A0L A;  4IUV A;  1D3B A;  4PFZ A;  3KUF A;  4FW1 A;  4BDZ A;  2RPN A;  2CGH A;  1PKS A;  2COZ A;  2QGG A;  3SWN B;  5GAM f;  2QAZ A;  1TUG B;  2WAC A;  4ELZ C;  4JLG A;  2RHX A;  4BY6 B;  1JB0 E;  1NYF A;  4LDU A;  1MGQ A;  1YI2 A;  3C94 A;  2RD1 A;  1M9S A;  4HVU A;  2QXF A;  4FL6 A;  3EGX A;  1VQ9 Q;  2OJ2 A;  4ZN3 A;  1YIT Q;  3HRS A;  4BE0 A;  2C0I A;  2A36 A;  2LJ3 A;  4PK4 A;  4VUB A;  1I07 A;  2VAS A;  3L2Q A;  5FLX E;  1VQ8 A;  3EFR A;  5GAN 6;  2OTL T;  2NYS A;  2OTJ A;  2K3Y A;  5GJW B;  1VQ4 Q;  4CC7 A;  4C0D B;  4ZGE B;  2V8K A;  2FL7 A;  1EZZ B;  2SRC A;  3FLG A;  2DVE A;  3ULR B;  3V7C A;  1I1J A;  3HSB A;  3MHX A;  1Z9Q A;  2M1H A;  1OQK A;  5CAI A;  2R58 A;  2H3J A;  2P4T A;  3HFO A;  1VIF A;  1M8M A;  2CH4 A;  5FRM A;  4C0Z A;  1WQ7 A;  2KK4 A;  4LXC A;  2XID A;  3LH0 A;  3CCQ T;  4UC4 A;  1SRL A;  1Y96 B;  4ZTJ A;  1G3T A;  4M7A F;  1I81 A;  1IB8 A;  1GL5 A;  3G1J A;  1AWX A;  2LQW A;  5KYU A;  3GIB A;  2LCC A;  2XIC A;  2GTJ A;  2KT1 A;  1ZSZ B;  4M78 G;  2AIR B;  4MML A;  3CC4 A;  3TSZ A;  3CXC P;  3JB9 H;  1PSF A;  3HL8 A;  1YHQ A;  3OW2 S;  1KQS P;  3PT9 A;  3VS6 A;  5FU6 C;  2A3L A;  4E7Z A;  3C4S A;  3H0F A;  5FRO A;  5C0M A;  3RDV A;  2LQN A;  1K8A R;  4HXJ A;  3EG3 A;  1H92 A;  3A98 A;  3RNJ A;  1ZUY A;  4D8K A;  2V26 A;  3H6Z A;  4F16 A;  1PHT A;  4J9E A;  3PMT A; 
#chains in the Genus database with same CATH homology
 2G6F X;  2AZV A;  1HJD A;  1UTI A;  1RUW A;  1Y0M A;  1ABQ A;  4ESR A;  3NHN A;  1UGV A;  3UA6 A;  1VYV A;  1Y57 A;  2O9S A;  2W10 A;  2RQW A;  2YDL A;  1X2K A;  4M4Z A;  1PRM C;  1YP5 A;  2FRY A;  1KIK A;  1VYU A;  2DYB A;  4LN2 A;  1K0S A;  2LX7 A;  1AZE A;  3NMZ C;  1ZUU A;  1PRL C;  2DF6 A;  2F2X A;  1N5Z A;  1AEY A;  4Y92 A;  2HEQ A;  4AFU C;  4EIK A;  1ZLM A;  1U06 A;  2KBT A;  2EYX A;  2K7A A;  1CSK A;  1G2B A;  2V1Q A;  1WXB A;  4LUD A;  2GBQ A;  1K0X A;  2W0Z A;  5FW9 A;  3H0H A;  2DL3 A;  2VWF A;  1SRM A;  2KYM A;  2HSP A;  3FJ5 A;  4RTY A;  2GQI A;  1QKX A;  2AZS A;  2HDA A;  3RBB B;  4J9C A;  1KFZ A;  3EG1 A;  3UAT A;  2EGE A;  1PKT A;  1WA7 A;  2EYZ A;  2DRM A;  2J06 A;  4J9B A;  1W70 A;  2JS0 A;  3REA B;  1UHF A;  4HVW A;  2FPE A;  2JT4 A;  2KRS A;  2J6K A;  1IO6 A;  2OAW A;  3EHQ A;  2L3S A;  1VYT A;  3VS0 A;  5L23 A;  1NEG A;  2X3W D;  1NYG A;  1G83 A;  3M0R A;  2A08 A;  3NGP A;  1I0C A;  1WLP B;  1CKB A;  4IIM A;  3U23 A;  1NG2 A;  2GNC A;  1X69 A;  1FYN A;  1E6H A;  2KYB A;  1T3S A;  3I9Q A;  1WI7 A;  4JJC A;  2D1X A;  2JXB A;  2FRW A;  4OMQ A;  5GJV B;  2DL8 A;  3TSW A;  4F16 A;  3I35 A;  2BZY A;  1AWW A;  2EBP A;  2BZ8 A;  2YUN A;  2FPD A;  4A63 B;  3EHR A;  2C0T A;  2KRN A;  2L0A A;  2LMJ A;  3I5S A;  1UDL A;  3NPF A;  1AZG B;  2RQV A;  4OMM A;  1SHG A;  1U3O A;  4E6R A;  2J7I A;  1EFN A;  2EGA A;  2RMO A;  4LNP A;  1RI9 A;  1MV0 B;  1U5S A;  3LH5 A;  1WXU A;  1ABO A;  2K2M A;  1WXT A;  2FPF A;  2K9G A;  1GFD A;  4JJD A;  1E6G A;  2L3Q A;  5IXB A;  2DNU A;  2RQT A;  1NLP C;  2FG0 A;  3M0Q A;  4Z88 A;  1XOV A;  2ED0 A;  4LE9 A;  4RTX A;  1GBR A;  2LNH B;  2M0Y A;  5IXF A;  2EW3 A;  2LP5 A;  2PTK A;  2O9V A;  1PNJ A;  2DM1 A;  1MV3 A;  2KNB B;  2YT6 A;  2MOX A;  4AFQ C;  3VS3 A;  3QWX X;  4JZ4 A;  2PZ1 A;  1K9A A;  1AOJ A;  1BB9 A;  1B3Q A;  4Z8A A;  3M0S A;  4RTU A;  1WIE A;  3SHW A;  3PVL A;  1JEG A;  4F14 A;  1WYX A;  2L2P A;  2DMO A;  2V1R A;  1SHF A;  3EGU A;  2AK5 A;  2C0O A;  3PVQ A;  1FMK A;  1HD3 A;  5FWC A;  2CH4 W;  4KRT A;  4GBQ A;  1T3L A;  2KXC A;  1SSH A;  2CDT A;  4ORZ A;  2LCS A;  4AFS C;  1B07 A;  2DL4 A;  4RUG A;  5IHK A;  1MUZ A;  1X6B A;  1M3C A;  4RTV A;  2KRO A;  2FEI A;  1QCF A;  1YNZ A;  2RN8 A;  1QWE A;  4OMN A;  2XMF A;  2YSQ A;  2J6F A;  3R6N A;  2O88 A;  1AWJ A;  1W6X A;  2LJ0 A;  4FSS A;  3ZL7 C;  1GCQ A;  2DRK A;  2I0N A;  1UJ0 A;  1WX6 A;  2DL5 A;  4Z89 A;  1QKW A;  2EKH A;  1BK2 A;  3O5Z A;  1GRI A;  4OMO A;  2YUO A;  1ZBJ A;  1UG1 A;  2D8J A;  2CUB A;  2DA9 A;  2DL7 A;  1GBQ A;  1X43 A;  2JM8 A;  3JV3 A;  2DVJ A;  2LJ1 A;  5FWB A;  1GCP A;  2F2W A;  1A0N B;  3VS7 A;  3VS4 A;  1AD5 A;  2EYW A;  1ZUK A;  3EG2 A;  2DBM A;  2KR3 A;  4K11 A;  2DBK A;  1CKA A;  2HBW A;  1T0H A;  1RLQ C;  2KGT A;  3REB B;  2EGC A;  1ZX6 A;  2GGR A;  4J9H A;  5IHN A;  3VS5 A;  2X3X D;  3I5R A;  2JTE A;  4J9I A;  3SEM A;  5IHI A;  2VKN A;  4D8D A;  1UEC A;  3M0P A;  3TVT A;  1VA7 A;  1S1N A;  2AKK A;  2JS2 A;  1YCS B;  3H0I A;  2VVK A;  1KJW A;  2J05 A;  2RF0 A;  4AG2 C;  4DEY A;  4AFZ C;  2JW4 A;  2A37 A;  1HSQ A;  2O2O A;  1JXO A;  4HCK A;  2EYY A;  4LUE A;  2CSI A;  1JXM A;  2KRM A;  4JZ3 A;  1TG0 A;  2F2V A;  1KSW A;  1ZSG A;  1K4U S;  1QLY A;  2DIL A;  1M3B A;  2CSQ A;  1NM7 A;  5EC7 A;  2MCN A;  1W1F A;  1WFW A;  4JPB W;  2CRE A;  2L3P A;  2K6D A;  2M51 A;  3VRZ A;  1YWO A;  1UJY A;  2OI3 A;  5I22 A;  1OPK A;  2RQR A;  3CQT A;  4QT7 A;  2QDL A;  3UA7 A;  2DE0 X;  2E5K A;  1AWO A;  2JMC A;  1PWT A;  2D0N A;  3UF4 A;  1E7O A;  1UHC A;  4J9F A;  1K76 A;  3QWY A;  1UUE A;  2CUD A;  2J6O A;  2ROT A;  1J3T A;  2ED1 A;  1GCQ C;  2RPN A;  5ECA A;  1PKS A;  1H8K A;  2NUZ A;  2P4R A;  2HCK A;  2EQI A;  1RLP C;  2DLP A;  4CC2 A;  1YWP A;  1NYF A;  3EG0 A;  2IIM A;  3VS2 A;  1QWF A;  5I11 A;  3KFV A;  1JU5 C;  3C0C A;  4HVU A;  1JQQ A;  2LZ6 B;  2EVR A;  1OPL A;  1UFF A;  2K3B A;  2KEA A;  4RTT A;  2OJ2 A;  3M0T A;  4RTW A;  1M27 C;  2LJ3 A;  2C0I A;  1OV3 A;  2A36 A;  2ENM A;  5HCK A;  2BZX A;  4HVV A;  4IIO A;  1I07 A;  3PE0 A;  1Z9Z A;  2ESW A;  1SEM A;  2ABL A;  4OML A;  1BU1 A;  5GJW B;  4CC7 A;  4CC3 A;  3VS1 A;  4GLM A;  4CC4 B;  2AKL A;  2SRC A;  1H3H A;  2ROL A;  4AG1 C;  2PNI A;  2KT8 A;  3ULR B;  2O31 A;  4R0K A;  1I1J A;  1OEB A;  1Z9Q A;  2KE9 A;  4J9D A;  1YN8 A;  2MIO A;  2JM9 A;  1K1Z A;  2DX1 A;  2FO0 A;  1OOT A;  1M8M A;  1NLO C;  1M3A A;  1T0J A;  2CH4 A;  2BTT A;  1WDX A;  2GTO A;  2EPD A;  2KXD A;  3VRY A;  1BBZ A;  1SRL A;  4JJB A;  4OMP A;  1GL5 A;  1AWX A;  1AVZ C;  2LQW A;  1UE9 A;  1ARK A;  1TUC A;  1SPK A;  3THK A;  2YUQ A;  2GTJ A;  2KT1 A;  2SEM A;  5IH2 A;  2RNA A;  1JO8 A;  2K79 A;  3TSZ A;  4DEX A;  2B86 A;  2A28 A;  2RQU A;  2DJQ A;  4ZNX A;  2ECZ A;  2YUP A;  4RTZ A;  1M30 A;  2NWM A;  1TUD A;  1GFC A;  3H41 A;  2CT4 A;  3VS6 A;  1X27 A;  4J9G A;  3H0F A;  1X6G A;  1V1C A;  2D8H A;  3M0U A;  2CT3 A;  2LQN A;  4HXJ A;  4WCI A;  3EG3 A;  1H92 A;  3A98 A;  3GBQ A;  3RNJ A;  4F17 A;  1LCK A;  1ZUY A;  4D8K A;  2JMA A;  1X2Q A;  4X1V A;  3IQL A;  1NEB A;  1PHT A;  4J9E A;  2H8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...