1W70A

Sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'LIKHMRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w70A00
1TG0A 5IHIA 1VYVA 5ECAA 1ZUYA 2JT4A 2PZ1A 4M4ZA 2MOXA 4HVWA 2IIMA 1GFCA 1JXOA 2CT3A 2GQIA 3O5ZA 2KXCA 1K9AA 3R6NA 2MIOA 5IHKA 2EYWA 3U23A 1HSQA 2K3BA 2MCNA 1U3OA 1LCKA 1VA7A 3EGUA 1U5SA 1M3AA 1X6GA 2DA9A 2RPNA 4LE9A 3EG2A 1V1CA 1M3CA 1ABOA 4JPBW 2M51A 1PHTA 1H8KA 3UA6A 2ED0A 1K1ZA 2CH4A 2O9SA 3EG3A 2KR3A 3JV3A 2CUBA 2P4RA 1UJYA 2AKKA 1X69A 1M8MA 1K4US 4JJCA 1OEBA 3UF4A 1GBRA 1AVZC 2KBTA 2JMCA 3VS1A 2FPEA 1M30A 3TVTA 3KFVA 3SEMA 1X2QA 2V1RA 1AD5A 2DL7A 2DILA 1AEYA 2RF0A 1WFWA 2X3XD 4ORZA 2DYBA 2YDLA 1E6GA 2J7IA 4LUDA 2RN8A 4FSSA 1QWEA 2EYYA 5IHNA 1ZSGA 2QDLA 2W10A 2FO0A 1MUZA 1YP5A 2BZXA 2FPFA 2V1QA 2KRSA 1BU1A 2FRWA 1UUEA 4F17A 1T3LA 2KXDA 2KRMA 4J9HA 2EPDA 1K0SA 1YN8A 4OMNA 3I5RA 2FEIA 2GGRA 1VYTA 4Y92A 1T3SA 4AFUC 1X43A 2EBPA 2JM9A 2L3SA 2O31A 1G2BA 2DMOA 3C0CA 4GLMA 1NYGA 1AOJA 3UATA 2A36A 2FRYA 1ARKA 1KFZA 2D1XA 1WX6A 1QWFA 2RQUA 1WXTA 5FWCA 1WYXA 2NUZA 4F16A 1UECA 3M0PA 2KNBB 1UGVA 2LMJA 1WIEA 3TSZA 2OJ2A 3VS3A 2DVJA 3REAB 1Y57A 5FWBA 2BZ8A 2J06A 2L3PA 2BTTA 2JS2A 1NLPC 4LNPA 3M0UA 1K76A 2J05A 1PKTA 1T0JA 2CH4W 3UA7A 4R0KA 5IXBA 2JS0A 1ABQA 3RBBB 1VYUA 1UJ0A 2PTKA 1OPLA 5I22A 2VWFA 2D0NA 4CC7A 1NM7A 2I0NA 1WXUA 4HXJA 2CSIA 2LQNA 1H92A 2A37A 2J6OA 4Z89A 1W70A 1YWOA 2F2XA 1XOVA 4CC2A 2A08A 2KEAA 2DX1A 2HBWA 1UDLA 2C0IA 2ED1A 1NLOC 1RUWA 2JM8A 2KRNA 1KIKA 3VS2A 3M0QA 2AKLA 1RI9A 1BBZA 1AWXA 2L2PA 1NEBA 1OV3A 2FG0A 2OI3A 2HEQA 1N5ZA 2KT1A 2YUQA 4AG2C 2GTJA 4EIKA 3NMZC 1HJDA 2EYZA 4Z8AA 1IO6A 2PNIA 1A0NB 3I35A 1AZGB 1G83A 2CUDA 2GNCA 1CKBA 1KSWA 2HSPA 2RNAA 5I11A 1NEGA 3H41A 2LJ3A 3A98A 3CQTA 3ULRB 2K6DA 1JU5C 2E5KA 2YUNA 4RTXA 1JEGA 1GL5A 2A28A 1WLPB 2KT8A 3I9QA 4WCIA 1WA7A 1M3BA 1YWPA 2ROTA 3VS0A 1JXMA 2KYBA 4JZ3A 1TUDA 4QT7A 1K0XA 2KYMA 3PVQA 4ESRA 2O9VA 2FPDA 3EG1A 2D8HA 4LUEA 2O88A 3EG0A 1E7OA 1ZUUA 2RQVA 4RTZA 2ESWA 1QKWA 1X6BA 2JTEA 3ZL7C 5FW9A 5IXFA 2CDTA 2VVKA 2K7AA 5EC7A 1X2KA 4LN2A 4OMLA 4X1VA 2RQWA 2DM1A 2EW3A 4J9EA 1YNZA 1AWJA 2LZ6B 2DJQA 2ABLA 1B07A 1Y0MA 2CSQA 2GBQA 1OOTA 2DF6A 2LNHB 2NWMA 2JMAA 4CC3A 1J3TA 1W1FA 2YT6A 1FYNA 1Z9ZA 1YCSB 1ZUKA 3THKA 1UFFA 3IQLA 2DL5A 2LQWA 1SHFA 4JJDA 4K11A 2F2WA 1MV3A 2RQTA 3H0FA 3EHQA 2K2MA 2SRCA 4IIOA 4F14A 2DBKA 5GJVB 2H8HA 2L0AA 2EVRA 2KGTA 3I5SA 3VRYA 2O2OA 4HCKA 1SEMA 1SRLA 1EFNA 1PRMC 2JW4A 3LH5A 2LX7A 1CKAA 2VKNA 1I1JA 4AFQC 2AZVA 3RNJA 3M0TA 2M0YA 4J9GA 1UG1A 4RTTA 2C0OA 1UE9A 2ROLA 4OMOA 1ZBJA 2KE9A 2LJ1A 1SRMA 2OAWA 1PNJA 3EHRA 1JO8A 1JQQA 3H0IA 4J9FA 1WXBA 2DL3A 2EGCA 2CREA 4RTYA 2EGEA 1GFDA 2DNUA 1W6XA 4RUGA 3QWYA 3VS4A 5L23A 4D8KA 1U06A 1NG2A 3REBB 2AZSA 4A63B 2SEMA 3SHWA 2L3QA 1GBQA 1B3QA 3VRZA 2J6FA 1Z9QA 2ENMA 2DLPA 4RTVA 1GCQA 1AZEA 3NGPA 4J9DA 2DL8A 2KROA 2W0ZA 1TUCA 2HDAA 1UTIA 3PE0A 2JXBA 3VS7A 3H0HA 1OPKA 3NHNA 2LJ0A 5IH2A 1T0HA 1I07A 2LP5A 1BK2A 1PWTA 4OMQA 2YUPA 4JJBA 2F2VA 1WI7A 2DE0X 3QWXX 4GBQA 1SPKA 2HCKA 4IIMA 3VS6A 4CC4B 2AK5A 2X3WD 1ZX6A 4RTUA 1RLPC 2DL4A 1S1NA 1MV0B 2EKHA 4HVVA 2YUOA 3M0RA 1H3HA 2EYXA 4E6RA 3VS5A 2D8JA 3PVLA 1GRIA 1FMKA 2C0TA 1HD3A 2GTOA 2YSQA 4AFSC 4ZNXA 4OMMA 1SHGA 2B86A 3GBQA 2XMFA 1QLYA 3TSWA 1QCFA 2BZYA 1X27A 1UHFA 1PRLC 2G6FX 5HCKA 2RQRA 2LCSA 2DBMA 4JZ4A 1M27C 2CT4A 2K9GA 4OMPA 5GJWB 2J6KA 1CSKA 3FJ5A 1I0CA 1SSHA 4Z88A 2EQIA 2DRKA 1E6HA 4J9BA 1AWWA 1GCPA 2ECZA 4DEXA 4KRTA 4HVUA 4J9IA 2K79A 4AFZC 2RMOA 1ZLMA 1QKXA 4J9CA 2EGAA 2DRMA 3M0SA 4D8DA 3NPFA 4AG1C 1GCQC 1RLQC 1AWOA 4RTWA 1KJWA 1UHCA 1PKSA 1NYFA 1BB9A 4DEYA 1WDXA
chains in the Genus database with same CATH superfamily
1YIJT 2F5KA 2R58A 4N4HA 1XTDA 5CAIA 3OYDA 2PZ1A 3N5BB 1YJWT 2MOXA 3CBPA 4PKCC 4HVWA 1MMAA 2GQIA 3G4ST 1K9AA 2MIOA 3GNFB 1OU8A 2EYWA 3U23A 1HSQA 1S72Q 3E19A 1VA7A 3HRTA 1M3AA 2K5FA 5IT9E 2RHXA 3V7CA 2DVEA 1VQNQ 1ZHIA 1V1CA 1PHTA 1YHQQ 3CCET 4C8QA 4E47A 4KT0E 3E9FA 4YTLA 2CH4A 2O9SA 3EG3A 1BI0A 2MPXC 2RJCA 4M77F 1VQNA 2DO3A 1X69A 3CPWS 1YITT 2X4WA 1GBRA 4V2SA 4F7UE 5GAMg 2KBTA 4PJOE 1M30A 3KFVA 2V1RA 4XTYA 3RMSA 1WFWA 3BDLA 2DYBA 2AHJB 5FRNA 5CQYA 3L2RA 4KGXB 4BI4A 2EYYA 2GQVA 3HFOA 1AHJB 5IHNA 5A0DA 4OB3B 2FO0A 1N6AA 2BZXA 1RAHB 2KRSA 1K8AU 1JJ2S 2BIVA 1T3LA 2RK1A 4J9HA 4NS5A 1WGSA 1VQ7T 4Q5WA 1YN8A 2HNIA 5LJ5g 3I5RA 1PSEA 5HK3A 1VQLT 4Y92A 3CCRQ 2Y4YA 2EBPA 1G3SA 3HSBA 4GLMA 2A7YA 1AOJA 3UATA 2FRYA 1BCOA 3CCRA 1WYXA 2NUZA 3CXCA 3QKJA 4KGZB 4DBFA 1N8RU 5HY6A 3QJYA 2KY9A 3M53A 3REAB 4EMHA 4FYXB 1MMGA 2BZ8A 2JS2A 5GANf 2J05A 2QEXQ 4KH1B 2DTIA 5GAN4 3UA7A 1QCOA 5IXBA 2E64A 2XI9A 1VYUA 4JJNK 5I22A 5A2QE 3F70A 2FYKA 4CC7A 5I21A 2COWA 2QEXA 2MAMA 5GAN8 2QYZA 1Y7XA 2JNGA 2CSIA 2LRQA 1H92A 2A37A 3HRSA 1Q95G 1HK9A 4MMKA 1QMCA 3P8BB 2HD0A 2KEAA 1NLOC 2OTLT 1WHLA 1NZ9A 4JLGA 5D6YA 1VQ6Q 1X75C 1WQ7A 2KAFA 5CR2A 2OI3A 1N5ZA 1D09B 4EIKA 4M78D 2EYZA 1LNXA 2X35A 1NE8A 1VQ6A 1KC8U 4VUBA 1G83A 2CUDA 2GNCA 3M54A 4P5NA 4LD9K 1D1BA 1VQ8T 3V8KA 2RNAA 1IGQA 1NEGA 4DBRA 2LJ3A 2ZPEB 3ULRB 4PL6A 1AT1B 4ELZC 4IUUA 2EJGA 3OMGA 3AT1B 1FMVA 4PJOC 1V76A 3RKXA 2RI3A 3S3MA 1TXQA 4J5YA 3CPFA 3RERA 4AMCA 1WJRA 4QT7A 1K0XA 3CBOA 3FIFA 2VASA 2O9VA 2D8HA 3PMTA 4LUEA 4A4FA 4F7UB 4PJOB 1OZ3A 3EG0A 1ZUUA 5D7UA 1UGQB 1D3BB 1Q81R 4C92D 4C8QG 1KHIA 2JOYA 4A53A 3I55A 4XTVA 3RKWA 3QDRB 1YNZA 1AWJA 2YRDA 3CCSA 3OYNA 2MF2A 4NL2A 3J80E 2XDDA 3CCLT 1OOTA 1V29B 2V26A 4DBHA 2HQEA 4BI8B 1X01A 5CKEA 2NWMA 1W2BP 1J3TA 1FYNA 1ZUKA 1UFFA 1SHFA 2L8DA 1OU9A 2DYIA 2QASA 1MV3A 5LJ3j 1QW1A 3EHQA 2SRCA 6AT1B 2P0KA 3BDUA 2H8HA 3SDZA 2CZ1B 1SEMA 3I56Q 2KDSA 1PRMC 2LX7A 1CKAA 1VUBA 4HKEA 2AZVA 4C0FA 1KQSA 3M0TA 2M0YA 1G3TA 1UG1A 4HCBA 2D9TA 5LJ3h 1UE9A 2ROLA 1QVGA 2WSFE 3OS0A 4LDUA 1PNJA 4MDWA 1TOVA 3CXCS 3RUXA 1JQQA 1D0XA 3A8OB 2OAUA 3ZEHA 2EGCA 3L2QA 4RTYA 4GLKA 1W6XA 5DY9A 4M78E 2XD0A 5L23A 3QYGB 2WACA 4ZN1A 2Y90A 2FL7A 3REBB 3P8HA 3E1SA 3M58A 4EMGA 2LX9A 3CC4Q 1RABB 2L3QA 4JRKA 2M02A 2VXEA 2NYSA 4E7JA 4M75D 2COYA 5GAN7 3BE3A 1TTHB 2LQKA 5CVIA 5GAMj 1W4SA 1C1AA 3CCQQ 1TUCA 1UTIA 3T9NA 2AIRB 2JXBA 2JVVA 1M90R 5IH2A 1I07A 1I4K1 3OW2P 2K2VA 1BK2A 4A54A 1BI3A 4OMQA 3PTAA 2F2VA 1M1GA 4IIMA 1YBYA 4C92E 4E7KA 2DD5A 1VQMA 3M9QA 2PQWA 2CGHA 5A0LA 1YJ9Q 1VQ5Q 1H3HA 4E6RA 1IGUA 1GRIA 4C8QF 4BDYA 2RI5A 5LJ5j 2XK0A 1VQOT 1HD3A 4A4HA 4OB1B 3QXEB 1PSFA 1SHGA 3UPUA 2B86A 1EZZB 4A4GA 4M77D 4E7HA 2DXUA 2XMFA 5KYUA 3VYGA 1YJ9A 1VQ5A 5KYYB 3ER0A 3G6ET 2E4HA 2BZYA 1PRLC 2YLCA 5HCKA 2RQRA 2PUKB 2FZGB 3UT1A 4FSXA 2COZA 4OMPA 1I0CA 3OYBA 1UB4A 2E70A 3SB2A 4QVCA 1GCPA 4DEXA 4HVUA 2DETA 3JCMf 1M9SA 1GCQC 3CCMT 2ZPGB 3DKMA 1PKSA 3DLLA 1NYFA 2E3HA 1FMWA 1UGRB 3WXMB 1VYVA 1Q81U 5ECAA 1OYXA 4KUIA 1RACB 4M7AG 5KCHA 3OYLA 2CZ0B 4IUTA 1RAAB 4XQ3A 3CCJQ 3O5ZA 1IXDA 3R6NA 3MP6A 3QPHA 1VQ4Q 2YRCA 2C06A 2RHUA 2EQUA 1U3OA 3G7ZA 1U5SA 1X6GA 2DA9A 3CC2T 3CCJA 4FIBA 3MP8A 4LE9A 2F5TX 4GY5A 2WSEE 1YJNT 1M3CA 1ABOA 2M51A 3J81E 2EQMA 2M1HA 3NTHA 4M78C 1VQ4A 4PFZA 1FXXA 3UA6A 2ED0A 1M90C 1W2BS 3QZ5B 1Q86U 2CUBA 4ATOA 1KQSS 3INZA 2P4RA 2YHTA 1UJYA 4JJCA 1OEBA 3OS1A 1QVGS 3UF4A 4M78B 2HQHA 1RAFB 1SG5A 4QVZA 1C0MA 3HRUA 4QKUA 5GAMf 2DL7A 2DILA 4ORZA 2E41A 1OQKA 1K9MR 1G8XA 2QI2A 2NUTA 2J7IA 2DIGA 2EAYA 1QWEA 4C0DC 5GAOr 2OTJQ 3DB3A 1F1BB 4M77E 2W10A 4MMLA 3JRZA 1O9SA 2YLBA 1MUZA 2GCXA 2FPFA 4HT9A 1BU1A 2FRWA 3V8LA 4F17A 3OYIA 2RI2A 2X9HA 4C5HA 2EPDA 2I2LA 4C0DB 3QDFA 3GPLA 5GAOp 2OTJA 5CKFA 4XAXB 5LJ5f 3LWHA 4RMOA 3UWNA 2O31A 1Y96A 5KYWB 1OI1A 2QTXA 4C92B 4QW2A 2RQUA 2CYZB 1WXTA 1UECA 1PD1A 2LMJA 2FZKB 3TSZA 3VS3A 2DVJA 3LWIA 2QA4Q 2DXBA 1Y57A 2E6ZA 5FWBA 1M1KC 1VQNT 2J06A 3JB9G 2RJFA 2E65A 2K4YA 3CC7Q 2XICA 2BTTA 4Z02A 4WF2A 4UC4A 2HZYA 4BE2A 3H9NA 1PKTA 4A4KA 1T0JA 1ZSZB 2B8AA 2CP5A 2QA4A 4R0KA 2VXFA 5GANh 3ZFJA 3R6OA 3CC7A 4MZMA 4M7AF 1WPYA 2P4TA 3JSCA 5IN1A 1KD1R 4HXJA 2ZPIB 1M2OA 3EGXB 3ME9A 2J6OA 2AT1B 2A3LA 3J7AF 4CC2A 2L89A 2CZ6B 2H3EB 2C0IA 1NJIC 1Q82U 3M0QA 3PMIA 3EAEA 3JCMJ 5FROA 2IPOB 1TWBA 1BBZA 3A8HB 3X24B 2MWOA 1S72A 1OV3A 2HKNA 4ZTJA 3TQ7P 2HEQA 3V7RA 4LDXA 4M75C 1WJSA 3CCRT 3M59A 1K9MC 1HJDA 2VUBA 2PNIA 4LXCA 1YHQA 1A0NB 1AZGB 1CKBA 1PM3A 2F1LA 3PNWC 1KSWA 2JTMA 5L8RE 5I11A 1M4ZA 1TH7A 2M0OA 3RKYA 4M75B 3A98A 3CQTA 2K6DA 3A8LB 3SWNA 4N4IA 3TU4K 1JU5C 2E5KA 2YUNA 1YIJQ 2VYTA 5CQXA 1JEGA 1R8OB 2KT8A 3I9QA 2X4XA 1WA7A 3VUZA 2RA2A 1YJWQ 1M2VB 3VS0A 2KYBA 5GANe 3OB9A 5GMKm 1TUDA 2QEXT 2CP2A 2KYMA 3PVQA 5CKBA 2CP7A 4OGEA 4JRQA 3H8ZA 3OQ5A 4M77C 1UEBA 5IXFA 2YWWA 2RD1A 2K7AA 4LN2A 3CCEQ 4OMLA 1P92A 2RQWA 5C6SA 4PJMA 3LGFA 2JUFA 3MPUB 1K73R 4J9EA 4M77B 4FYVB 5FU6C 2QGGA 2DF6A 4X9CA 2V8IA 3QYHB 4CC3A 3JB9F 1W1FA 5FLXE 2LNVA 1Z9ZA 3IQLA 1VQ6T 1EIFA 3VKIA 2LC4A 4JJDA 3M4YA 4F04B 1FX7A 3TEEA 5KH6A 2EIFA 2F2WA 2M16A 2RQTA 2QQSA 4KH0B 3SFMA 4OMFB 4IIOA 1KD1C 2DBKA 5GJVB 4C8QD 2L0AA 4Y28E 2EVRA 3X26B 2KGTA 2JJ9A 2O2OA 4PFOA 2XHCA 4N0AC 1EFNA 4PJLA 3OYFA 3OS2A 1WJQA 4IUPA 2VKNA 1EX4A 4AFQC 3VUBA 1JB0E 4J9GA 3SD4A 3FRNA 5KYWA 1G5VA 1FWZA 4C92A 2LVMA 1HXDA 2LJ1A 1SRMA 3EHRA 2P0QA 1R77A 2KI7A 3H0IA 4J9FA 1I81A 1MNEA 1WXBA 4XTUA 4OB0B 2R5MA 2CREA 2EGEA 3VS4A 4ME7A 2E10A 4D8KA 1U06A 3A5ZB 2QQ9A 4FT2A 7AT1B 3I55T 5AYFA 2L3RA 3L42A 3SHWA 1WHJA 3CCST 1B3QA 4M7DG 1ZSZA 2J6FA 1Z9QA 2E12A 2ENMA 2D0QB 4OVAA 1QP2A 3WVEB 4OGCA 4PLLA 2DXCA 2DL8A 2W0ZA 3CMEQ 4KGVB 2HDAA 5GMKj 2DPPB 1OPKA 3MEWA 1T0HA 3A8GB 3OMCA 1M5Q1 5HK0A 3CMEA 2DE0X 3OS5A 1QP3A 4RTUA 4HVVA 2KMTA 1K73C 2O4XB 3PVLA 1KG1A 3PFSA 1ZQ1A 3HKSA 4ZNXA 4RCCA 4OMMA 2D6FA 3M5AA 2RHIA 3GBQA 1Q7YR 3PT9A 1I5OB 1X27A 1UHFA 3MP1A 3O8VA 2DBMA 4JZ4A 2CT4A 3QO3A 4C8QE 3VU3C 2FB7A 4XTXA 3FJ5A 1SSHA 4Z88A 1M2VA 4E7LA 2DRKA 2EWNA 4J9BA 1BI1A 4KRTA 4J9IA 4AFZC 2RMOA 1ZLMA 4J9CA 3QG1A 2DRMA 5GAOl 5CK9A 4J6XA 2DFUA 1Y71A 1RLQC 1YFNA 1SF9A 1W2BA 4FL6A 3V7SA 1KJWA 1UHCA 1BB9A 2BE7D 4A4EA 3JCMh 4DEYA 1WDXA 2EKOA 4EMKC 5IHIA 3I56A 4E7ZA 1VQMT 2XDPA 1TU0B 3JB9I 2IIMA 3EG9B 3CEYA 2CT3A 1N9RA 2RO0A 3E9GA 5IHKA 2GFUA 5CCAA 2K3BA 3META 1YJ9T 1VQ5T 1C6VX 4M7DF 4BE1A 4BE0A 2QQAA 4JPBW 5KE3A 2X4JA 3MJXA 1K1ZA 3CC4A 2KR3A 3TCJA 3JV3A 4M7AD 1K4US 1U1SA 3OYHA 2CP6A 3EGDB 1QVFP 4R56A 2JMCA 2DIQA 3TVTA 1X2QA 2QK0A 2QG9B 3CCQA 3GNGA 1E6GA 1SSFA 3RR6A 4LUDA 1B7TA 5GAMh 4FSSA 1BCMA 1NPRA 4ZGDB 1Q7YC 3FDRA 2QDLA 3FJPA 3JCMe 4ZGJB 5EG2A 5LJ3e 3OYMA 2V1QA 1YP5A 1R0BG 4M7DC 3BW1A 2GFAA 4J6YA 2E6NA 1UUEA 2KRMA 3KUFA 5KYXB 3OW2A 4QQ6A 5AT1B 1KHCA 3URGA 4L59A 2MK5A 1VYTA 1T3SA 1WNLA 2E3IA 3CCUQ 1H3ZA 1D1AA 4NL3A 2Z0WA 2JM9A 2L3SA 3C0CA 5LJ5h 4XK8E 3CCJT 1KFZA 3P8DA 2ZZDA 5FWCA 1VQ4T 2LDMA 2XIDA 3CCUA 3JCMX 3H6ZA 1UGVA 2LCCA 2EQJA 2R57A 1WIEA 5GAN6 3V8JA 4BDZA 4J6WA 3PGGA 5GAN2 4F7UA 4C8QC 4PJOA 4LNPA 4B9XA 3CPWP 2DTHA 1D3BA 2DERA 2CP3A 1M1KR 2ZAEA 1BIBA 1ABQA 4KBMB 4J7IA 3RBBB 5FU7C 1UJ0A 4C8QB 2PTKA 1OPLA 4DOVA 4IKFA 5GAOn 2VWFA 2BUDA 5GAMe 5KYNA 2KQWA 2BE9B 2I0NA 2DTOA 1WXUA 2ZCFB 3OYKA 3OBWA 3JCMP 1JJ2P 1W70A 3JCMd 2F2XA 1OZ2A 1XOVA 4M75E 5LJ3d 5KCOA 3JB9D 2OTJT 2DX1A 2HBWA 3L2WA 2ED1A 1RUWA 2KRNA 2LTOA 3VS2A 4M7AE 3MEAA 1AWXA 2L2PA 2PVGB 3FLGA 4LDVA 2FZCB 1K8AR 1WZOA 3RIRA 3C94A 3G71Q 5LJ5e 1NJIR 2KT1A 3GP8A 2MI6A 3EH2A 1VQKQ 5FRMA 3NMZC 3QSUA 1IO6A 3C12A 2DXTA 2ZPHB 1O75A 3RMQA 1RADB 3G71A 1OX9A 2HSPA 3X28B 5J26A 3DLMA 3MO8A 4CI0C 1VQKA 5HKCA 3EG9A 3MHXA 3JB9J 4RTXA 1GL5A 2A28A 3FB9A 2RM4A 2QA4T 1M3BA 1YI2Q 1MGQA 5DLQE 4X34A 1NBEB 1TSFA 3CC7T 2HL5C 4QQGA 2V8KA 2VGNA 3M57A 3HL8A 4ESRA 3OY9A 3EG1A 1YI2A 3OYGA 1E7OA 2RQVA 2NUPB 1QKWA 1ZBXA 3ZL7C 5FW9A 3QHSA 2CDTA 4O5VA 3A8MB 3JCMV 5I2SA 3EGDA 4X1VA 2DM1A 2K57A 4RCBA 1S72T 5LL6S 2HMAA 1IB8A 2LZ6B 1M90U 2BKDN 3L2UA 2ABLA 1XJWB 1Y0MA 1QCNA 2JMAA 1BKBA 2RH2A 1M1FA 1YCSB 1RL2A 3THKA 2DL5A 1VIFA 1YHQT 2LQWA 5LJ5d 2DZCA 2KK4A 3WVDB 3L1AA 1RAEB 3H0FA 3OW2S 2K2MA 2XG8D 2IVWA 4LDWA 4F14A 5KYXA 3VRYA 3QUIA 4E7IA 4HCKA 5LJ3g 1SRLA 3ASKA 4X9DA 3L2ZA 2JW4A 3LYIA 5KYYA 1VIEA 1I1JA 1LVKA 3CCVQ 3OYCA 4LD6A 4RTTA 2C0OA 5C0MA 2RJEA 3VJPA 4OMOA 1ZBJA 2KE9A 3CD6Q 1BYMA 3EFOB 1WHMA 2XKOC 2OAWA 1K8AC 1JO8A 3L2VA 3CCVA 1Y07A 3CMAQ 2IG0A 1GFDA 2DNUA 3QWYA 3HFNA 2EYQA 3CD6A 1NG2A 4A63B 4XU2A 5A0GA 1VQPQ 3ZBDA 2SEMA 3CMAA 3RDVA 1VQ9Q 1GBQA 4F7UG 4PJOG 4D6WA 3VRZA 4M7AC 1LOJA 1WHHA 4RTVA 1GCQA 1M1KU 1AZEA 1BIAA 1VQPA 1N8RC 3FC3A 5DM7R 5D6WA 4J9DA 4KUDK 2KROA 1VQ9A 1UGSB 2PVOB 3OBYA 4FW2A 4M7AB 4BUGA 3PE0A 1XNIA 3H0HA 5GAN5 1IHVA 2EFIA 2LP5A 4OF1A 4JJBA 2E1HA 3G4SQ 1YIJA 4FU6A 1SPKA 2HCKA 3FEOA 3VS6A 4CC4B 3S3NA 2AK5A 5J3BA 1ZX6A 1WHGA 1VOMA 4M7DD 2DL4A 2FVUA 1S1NA 1YJWA 2VC8A 2JTFA 2EKHA 3LX7A 3TREA 3EFRA 2EYXA 4XU1A 3VS5A 8AT1B 2D8JA 2C0TA 3G4SA 5IAYA 2WSCE 1OULA 3MKDA 1NJIU 4AFSC 3CXCP 1OX8A 4M78A 3OYAA 4TVRA 4JRPA 2NLUA 2LQ8A 1LPLA 4FYYB 4FCYA 4PFPA 3MEVA 1QLYA 3TSWA 1QCFA 4HT8A 1YITQ 1WHKA 3C95A 3CCEA 1K9MU 2DEQA 1M27C 2DKGA 2K9GA 4FYWB 1CSKA 5M9OA 5FU6B 3GLXA 1RAGB 2EQIA 2RK2A 3MCAB 4JLIA 1YITA 4FT4A 2ECZA 4ELYC 1KC8C 3PIOA 3JCMW 1RAIB 2K79A 4RG2A 1QKXA 1MHNA 3DB4A 4D8DA 2XU8A 3NPFA 4AG1C 1AWOA 3HP9A 2NUPA 1G3YA 3NFCA 4PJNA 5DLOA 4B6MA 1VQ7Q 4C0ZA 3BY7A 3CBMA 3CMET 1VQLQ 1TG0A 4QVDA 1ZUYA 2JT4A 5I2MA 2EQKA 2DJZA 5GANd 4M4ZA 3C4SA 2RJDA 1VQ7A 1GFCA 1JXOA 1H641 2KXCA 3E2UA 1VQLA 3KXTA 1UGPB 1SKUB 2PU9B 2MCNA 1LCKA 1ACMB 3EGUA 4F7UF 4PJOF 2RPNA 2VGMA 3EG2A 2X4YA 5GAN3 4DOWA 1QVPA 1H8KA 1NPPA 4RG8A 4IUVA 3MEUA 2M9UA 4PNOA 4ZTFA 4J8OA 2AKKA 1M8MA 1HYOA 3EGXA 1AVZC 1KD1U 3VS1A 4M7DE 1MNDA 2FPEA 3EFOA 3LW5E 2EJ9A 5KYUB 3SEMA 1BI2A 1AD5A 1AEYA 3OYYA 2RF0A 2X3XD 1PG5B 2CKKA 4PLIA 1LJOA 2X51A 2YDLA 2RN8A 5CKHA 5GMKh 3JCMb 3JB9H 1ZSGA 3I56T 2OTLQ 1B34B 2HKQB 2KVQG 2K3XA 2KXDA 4QQDA 2LT4A 4XU3A 1K0SA 2P84A 4OMNA 1D1CA 4PJJA 2OX7A 1IHWA 3I55Q 2FEIA 2GGRA 2RHYA 4AFUC 2OTLA 1X43A 4M75A 3CCSQ 1G2BA 2DMOA 1NYGA 4M7AA 2A36A 1U1TA 1VQ8Q 4XTWA 1ARKA 2D1XA 1WX6A 2K5LA 2QGFB 1QWFA 4F16A 4C5GA 3M0PA 2KNBB 2VV5A 3CC4T 5GMKi 2OJ2A 1ZA2B 2DZ9A 1VQ8A 1KQSP 2Y4XA 3RESA 2L3PA 5GANg 1IRXA 1NLPC 3KBGA 3M0UA 4IUQA 2QAZA 1K76A 3QBYA 1QVGP 2YRVA 1IZ6A 3NTIA 2CH4W 3GF5A 4CRIA 3CCQT 2JS0A 1Q86R 4EPCA 1N27A 4M77A 2D0NA 4BB7A 2ATCB 4M78G 5GMKe 5CIUA 1NM7A 1K73U 4EMKB 4II1A 1YCYA 4JUVA 2LQNA 1DJ7B 3OSVA 2RB6A 4C0GA 4L6V5 3M4GA 4Z89A 1YWOA 2K3YA 3QIIA 3PIPA 2A08A 3CCLQ 4DA4A 1UDLA 2JM8A 1KIKA 2JN0A 2YXYA 2NUTB 4J7FA 2AKLA 1RI9A 1X6OA 1WQWA 1PC0A 1NEBA 2FG0A 1ZA1B 2CP0A 3UDCA 3JAME 3CCLA 3X25B 2YUQA 4HA8A 4AG2C 4B9WA 2GTJA 2QTVA 4C5IA 3CCUT 4Z8AA 4MDXA 8ATCB 3I35A 2LCLA 3EFSA 2JZ2A 3VV0A 3OSSC 4N0AA 4DQ2A 5CKDA 3G1JA 3BFMA 3H41A 4C92G 2RHZA 1Y96B 1MMDA 3EH1A 3NTKA 5GAOq 2CZ7B 2EJFA 2ZPBB 1WLPB 4WCIA 1VQMQ 4L5GA 1YWPA 2ROTA 3QZ9B 1GXIE 1JXMA 2HQXA 4NOYA 1QVFA 4JZ3A 4OP0A 1KQ2A 3OYJA 2DD4A 1Q81C 3S6WA 2FPDA 2F69A 2QQRA 2A0FB 4OB2B 3GIBA 1PD0A 2O88A 4M7DB 2R5AA 4RTZA 3A1PA 2ESWA 1X6BA 1TUGB 2MYSA 2GF7A 2JTEA 3VYHB 1IREB 2VVKA 5EC7A 1X2KA 2QXFA 4HCZA 2EW3A 2PUOB 2DJQA 1B07A 4BACA 2CSQA 2GBQA 3QJ6A 4C5EA 2LNHB 4LDYA 2FHDA 3M56A 2YT6A 2MWPA 1N9SA 3X20B 1Q86C 2LT1A 1D0YA 1Q82R 2K5IA 4K11A 1RI0A 2O4XA 1B34A 3G71T 4IURA 4O6JA 1VQKT 3I5SA 4JS5A 2HSEB 2P0PA 5LJ3f 2VB6A 4M78F 1KQ1A 3LH5A 1VQOQ 1Q7YU 4JRIA 2L5QA 4FW1A 3RNJA 1QQJA 3SWNC 5FU7B 4HCCA 3CPWA 1I8FA 4M75G 9ATCB 2CS7A 3G6EQ 4ZN3A 1VQOA 1MMNA 1YI2T 5GMKl 2DL3A 3JCMQ 3HHTB 3SWNB 4RUGA 4BI3A 4Y91A 3G6EA 2PVDB 4WTOB 5CO7A 2AZSA 2QQBA 3LGLA 1JJ2A 1JRIA 3CCMQ 2DLPA 1R0CB 4DBQA 2ZPFB 4R55A 4C92F 3D7SB 5GAOm 2DEUA 4BY6C 3NGPA 2O01E 3JCMc 1I5LA 2E5QA 4EMKA 4BD3A 5J39A 4M77G 3VS7A 3CCMA 4JS4A 3NHNA 4FM4B 1N8RR 2LJ0A 1PCXA 4E7SA 1TS9A 3AHUA 1PWTA 4J83A 2QDYB 1D0ZA 2YUPA 4BY6B 1WI7A 3HPWA 3QWXX 4GBQA 3M55A 2X3WD 4PJOD 4ANJA 1RLPC 5D6XA 1MV0B 3S3OA 5GAMd 2YUOA 3M0RA 4PK4A 3CC2Q 1FMKA 1YJNQ 4E2FB 5KE2A 2GTOA 3OYEA 2YSQA 3CCVT 4EDUA 4ZGEB 4MZPA 4C92C 3GOXA 3CC2A 4XTZA 3CD6T 1Q82C 1G3WA 2ZGWA 1YJNA 2G6FX 3LLRA 2LCSA 2V8JA 4XU0A 3CMAT 1KK7A 2DK3A 5GJWB 3OA6A 2G3RA 2J6KA 2HAXA 2KSSA 2H3JA 3HTRA 3Q1JA 1QVFS 1E6HA 4N4GA 2MMPA 1VQPT 1AWWA 1JBMA 5GANj 4AT1B 1ZSZC 1VQ9T 3JCMg 1U8RA 2XDBA 2EGAA 1M8VA 3M0SA 4KULA 2DAQA 2HL3A 4M7DA 2HBPA 3LH0A 4RTWA 1KC8R 4RKUE 4MZTA 1XQHA 4JDSA 4M75F
chains in the Genus database with same CATH topology
1TG0A 5IHIA 1VYVA 5ECAA 1ZUYA 2JT4A 2PZ1A 4M4ZA 2MOXA 4HVWA 2IIMA 1GFCA 1JXOA 2CT3A 2GQIA 3O5ZA 2KXCA 1K9AA 3R6NA 2MIOA 5IHKA 2EYWA 3U23A 1HSQA 2K3BA 2MCNA 1U3OA 1LCKA 1VA7A 3EGUA 1U5SA 1M3AA 1X6GA 2DA9A 2RPNA 4LE9A 3EG2A 1V1CA 1M3CA 1ABOA 4JPBW 2M51A 1PHTA 1H8KA 3UA6A 2ED0A 1K1ZA 2CH4A 2O9SA 3EG3A 2KR3A 3JV3A 2CUBA 2P4RA 1UJYA 2AKKA 1X69A 1M8MA 1K4US 4JJCA 1OEBA 3UF4A 1GBRA 1AVZC 2KBTA 2JMCA 3VS1A 2FPEA 1M30A 3TVTA 3KFVA 3SEMA 1X2QA 2V1RA 1AD5A 2DL7A 2DILA 1AEYA 2RF0A 1WFWA 2X3XD 4ORZA 2DYBA 2YDLA 1E6GA 2J7IA 4LUDA 2RN8A 4FSSA 1QWEA 2EYYA 5IHNA 1ZSGA 2QDLA 2W10A 2FO0A 1MUZA 1YP5A 2BZXA 2FPFA 2V1QA 2KRSA 1BU1A 2FRWA 1UUEA 4F17A 1T3LA 2KXDA 2KRMA 4J9HA 2EPDA 1K0SA 1YN8A 4OMNA 3I5RA 2FEIA 2GGRA 1VYTA 4Y92A 1T3SA 4AFUC 1X43A 2EBPA 2JM9A 2L3SA 2O31A 1G2BA 2DMOA 3C0CA 4GLMA 1NYGA 1AOJA 3UATA 2A36A 2FRYA 1ARKA 1KFZA 2D1XA 1WX6A 1QWFA 2RQUA 1WXTA 5FWCA 1WYXA 2NUZA 4F16A 1UECA 3M0PA 2KNBB 1UGVA 2LMJA 1WIEA 3TSZA 2OJ2A 3VS3A 2DVJA 3REAB 1Y57A 5FWBA 2BZ8A 2J06A 2L3PA 2BTTA 2JS2A 1NLPC 4LNPA 3M0UA 1K76A 2J05A 1PKTA 1T0JA 2CH4W 3UA7A 4R0KA 5IXBA 2JS0A 1ABQA 3RBBB 1VYUA 1UJ0A 2PTKA 1OPLA 5I22A 2VWFA 2D0NA 4CC7A 1NM7A 2I0NA 1WXUA 4HXJA 2CSIA 2LQNA 1H92A 2A37A 2J6OA 4Z89A 1W70A 1YWOA 2F2XA 1XOVA 4CC2A 2A08A 2KEAA 2DX1A 2HBWA 1UDLA 2C0IA 2ED1A 1NLOC 1RUWA 2JM8A 2KRNA 1KIKA 3VS2A 3M0QA 2AKLA 1RI9A 1BBZA 1AWXA 2L2PA 1NEBA 1OV3A 2FG0A 2OI3A 2HEQA 1N5ZA 2KT1A 2YUQA 4AG2C 2GTJA 4EIKA 3NMZC 1HJDA 2EYZA 4Z8AA 1IO6A 2PNIA 1A0NB 3I35A 1AZGB 1G83A 2CUDA 2GNCA 1CKBA 1KSWA 2HSPA 2RNAA 5I11A 1NEGA 3H41A 2LJ3A 3A98A 3CQTA 3ULRB 2K6DA 1JU5C 2E5KA 2YUNA 4RTXA 1JEGA 1GL5A 2A28A 1WLPB 2KT8A 3I9QA 4WCIA 1WA7A 1M3BA 1YWPA 2ROTA 3VS0A 1JXMA 2KYBA 4JZ3A 1TUDA 4QT7A 1K0XA 2KYMA 3PVQA 4ESRA 2O9VA 2FPDA 3EG1A 2D8HA 4LUEA 2O88A 3EG0A 1E7OA 1ZUUA 2RQVA 4RTZA 2ESWA 1QKWA 1X6BA 2JTEA 3ZL7C 5FW9A 5IXFA 2CDTA 2VVKA 2K7AA 5EC7A 1X2KA 4LN2A 4OMLA 4X1VA 2RQWA 2DM1A 2EW3A 4J9EA 1YNZA 1AWJA 2LZ6B 2DJQA 2ABLA 1B07A 1Y0MA 2CSQA 2GBQA 1OOTA 2DF6A 2LNHB 2NWMA 2JMAA 4CC3A 1J3TA 1W1FA 2YT6A 1FYNA 1Z9ZA 1YCSB 1ZUKA 3THKA 1UFFA 3IQLA 2DL5A 2LQWA 1SHFA 4JJDA 4K11A 2F2WA 1MV3A 2RQTA 3H0FA 3EHQA 2K2MA 2SRCA 4IIOA 4F14A 2DBKA 5GJVB 2H8HA 2L0AA 2EVRA 2KGTA 3I5SA 3VRYA 2O2OA 4HCKA 1SEMA 1SRLA 1EFNA 1PRMC 2JW4A 3LH5A 2LX7A 1CKAA 2VKNA 1I1JA 4AFQC 2AZVA 3RNJA 3M0TA 2M0YA 4J9GA 1UG1A 4RTTA 2C0OA 1UE9A 2ROLA 4OMOA 1ZBJA 2KE9A 2LJ1A 1SRMA 2OAWA 1PNJA 3EHRA 1JO8A 1JQQA 3H0IA 4J9FA 1WXBA 2DL3A 2EGCA 2CREA 4RTYA 2EGEA 1GFDA 2DNUA 1W6XA 4RUGA 3QWYA 3VS4A 5L23A 4D8KA 1U06A 1NG2A 3REBB 2AZSA 4A63B 2SEMA 3SHWA 2L3QA 1GBQA 1B3QA 3VRZA 2J6FA 1Z9QA 2ENMA 2DLPA 4RTVA 1GCQA 1AZEA 3NGPA 4J9DA 2DL8A 2KROA 2W0ZA 1TUCA 2HDAA 1UTIA 3PE0A 2JXBA 3VS7A 3H0HA 1OPKA 3NHNA 2LJ0A 5IH2A 1T0HA 1I07A 2LP5A 1BK2A 1PWTA 4OMQA 2YUPA 4JJBA 2F2VA 1WI7A 2DE0X 3QWXX 4GBQA 1SPKA 2HCKA 4IIMA 3VS6A 4CC4B 2AK5A 2X3WD 1ZX6A 4RTUA 1RLPC 2DL4A 1S1NA 1MV0B 2EKHA 4HVVA 2YUOA 3M0RA 1H3HA 2EYXA 4E6RA 3VS5A 2D8JA 3PVLA 1GRIA 1FMKA 2C0TA 1HD3A 2GTOA 2YSQA 4AFSC 4ZNXA 4OMMA 1SHGA 2B86A 3GBQA 2XMFA 1QLYA 3TSWA 1QCFA 2BZYA 1X27A 1UHFA 1PRLC 2G6FX 5HCKA 2RQRA 2LCSA 2DBMA 4JZ4A 1M27C 2CT4A 2K9GA 4OMPA 5GJWB 2J6KA 1CSKA 3FJ5A 1I0CA 1SSHA 4Z88A 2EQIA 2DRKA 1E6HA 4J9BA 1AWWA 1GCPA 2ECZA 4DEXA 4KRTA 4HVUA 4J9IA 2K79A 4AFZC 2RMOA 1ZLMA 1QKXA 4J9CA 2EGAA 2DRMA 3M0SA 4D8DA 3NPFA 4AG1C 1GCQC 1RLQC 1AWOA 4RTWA 1KJWA 1UHCA 1PKSA 1NYFA 1BB9A 4DEYA 1WDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG0 A;  5IHI A;  1VYV A;  5ECA A;  1ZUY A;  2JT4 A;  2PZ1 A;  4M4Z A;  2MOX A;  4HVW A;  2IIM A;  1GFC A;  1JXO A;  2CT3 A;  2GQI A;  3O5Z A;  2KXC A;  1K9A A;  3R6N A;  2MIO A;  5IHK A;  2EYW A;  3U23 A;  1HSQ A;  2K3B A;  2MCN A;  1U3O A;  1LCK A;  1VA7 A;  3EGU A;  1U5S A;  1M3A A;  1X6G A;  2DA9 A;  2RPN A;  4LE9 A;  3EG2 A;  1V1C A;  1M3C A;  1ABO A;  4JPB W;  2M51 A;  1PHT A;  1H8K A;  3UA6 A;  2ED0 A;  1K1Z A;  2CH4 A;  2O9S A;  3EG3 A;  2KR3 A;  3JV3 A;  2CUB A;  2P4R A;  1UJY A;  2AKK A;  1X69 A;  1M8M A;  1K4U S;  4JJC A;  1OEB A;  3UF4 A;  1GBR A;  1AVZ C;  2KBT A;  2JMC A;  3VS1 A;  2FPE A;  1M30 A;  3TVT A;  3KFV A;  3SEM A;  1X2Q A;  2V1R A;  1AD5 A;  2DL7 A;  2DIL A;  1AEY A;  2RF0 A;  1WFW A;  2X3X D;  4ORZ A;  2DYB A;  2YDL A;  1E6G A;  2J7I A;  4LUD A;  2RN8 A;  4FSS A;  1QWE A;  2EYY A;  5IHN A;  1ZSG A;  2QDL A;  2W10 A;  2FO0 A;  1MUZ A;  1YP5 A;  2BZX A;  2FPF A;  2V1Q A;  2KRS A;  1BU1 A;  2FRW A;  1UUE A;  4F17 A;  1T3L A;  2KXD A;  2KRM A;  4J9H A;  2EPD A;  1K0S A;  1YN8 A;  4OMN A;  3I5R A;  2FEI A;  2GGR A;  1VYT A;  4Y92 A;  1T3S A;  4AFU C;  1X43 A;  2EBP A;  2JM9 A;  2L3S A;  2O31 A;  1G2B A;  2DMO A;  3C0C A;  4GLM A;  1NYG A;  1AOJ A;  3UAT A;  2A36 A;  2FRY A;  1ARK A;  1KFZ A;  2D1X A;  1WX6 A;  1QWF A;  2RQU A;  1WXT A;  5FWC A;  1WYX A;  2NUZ A;  4F16 A;  1UEC A;  3M0P A;  2KNB B;  1UGV A;  2LMJ A;  1WIE A;  3TSZ A;  2OJ2 A;  3VS3 A;  2DVJ A;  3REA B;  1Y57 A;  5FWB A;  2BZ8 A;  2J06 A;  2L3P A;  2BTT A;  2JS2 A;  1NLP C;  4LNP A;  3M0U A;  1K76 A;  2J05 A;  1PKT A;  1T0J A;  2CH4 W;  3UA7 A;  4R0K A;  5IXB A;  2JS0 A;  1ABQ A;  3RBB B;  1VYU A;  1UJ0 A;  2PTK A;  1OPL A;  5I22 A;  2VWF A;  2D0N A;  4CC7 A;  1NM7 A;  2I0N A;  1WXU A;  4HXJ A;  2CSI A;  2LQN A;  1H92 A;  2A37 A;  2J6O A;  4Z89 A;  1W70 A;  1YWO A;  2F2X A;  1XOV A;  4CC2 A;  2A08 A;  2KEA A;  2DX1 A;  2HBW A;  1UDL A;  2C0I A;  2ED1 A;  1NLO C;  1RUW A;  2JM8 A;  2KRN A;  1KIK A;  3VS2 A;  3M0Q A;  2AKL A;  1RI9 A;  1BBZ A;  1AWX A;  2L2P A;  1NEB A;  1OV3 A;  2FG0 A;  2OI3 A;  2HEQ A;  1N5Z A;  2KT1 A;  2YUQ A;  4AG2 C;  2GTJ A;  4EIK A;  3NMZ C;  1HJD A;  2EYZ A;  4Z8A A;  1IO6 A;  2PNI A;  1A0N B;  3I35 A;  1AZG B;  1G83 A;  2CUD A;  2GNC A;  1CKB A;  1KSW A;  2HSP A;  2RNA A;  5I11 A;  1NEG A;  3H41 A;  2LJ3 A;  3A98 A;  3CQT A;  3ULR B;  2K6D A;  1JU5 C;  2E5K A;  2YUN A;  4RTX A;  1JEG A;  1GL5 A;  2A28 A;  1WLP B;  2KT8 A;  3I9Q A;  4WCI A;  1WA7 A;  1M3B A;  1YWP A;  2ROT A;  3VS0 A;  1JXM A;  2KYB A;  4JZ3 A;  1TUD A;  4QT7 A;  1K0X A;  2KYM A;  3PVQ A;  4ESR A;  2O9V A;  2FPD A;  3EG1 A;  2D8H A;  4LUE A;  2O88 A;  3EG0 A;  1E7O A;  1ZUU A;  2RQV A;  4RTZ A;  2ESW A;  1QKW A;  1X6B A;  2JTE A;  3ZL7 C;  5FW9 A;  5IXF A;  2CDT A;  2VVK A;  2K7A A;  5EC7 A;  1X2K A;  4LN2 A;  4OML A;  4X1V A;  2RQW A;  2DM1 A;  2EW3 A;  4J9E A;  1YNZ A;  1AWJ A;  2LZ6 B;  2DJQ A;  2ABL A;  1B07 A;  1Y0M A;  2CSQ A;  2GBQ A;  1OOT A;  2DF6 A;  2LNH B;  2NWM A;  2JMA A;  4CC3 A;  1J3T A;  1W1F A;  2YT6 A;  1FYN A;  1Z9Z A;  1YCS B;  1ZUK A;  3THK A;  1UFF A;  3IQL A;  2DL5 A;  2LQW A;  1SHF A;  4JJD A;  4K11 A;  2F2W A;  1MV3 A;  2RQT A;  3H0F A;  3EHQ A;  2K2M A;  2SRC A;  4IIO A;  4F14 A;  2DBK A;  5GJV B;  2H8H A;  2L0A A;  2EVR A;  2KGT A;  3I5S A;  3VRY A;  2O2O A;  4HCK A;  1SEM A;  1SRL A;  1EFN A;  1PRM C;  2JW4 A;  3LH5 A;  2LX7 A;  1CKA A;  2VKN A;  1I1J A;  4AFQ C;  2AZV A;  3RNJ A;  3M0T A;  2M0Y A;  4J9G A;  1UG1 A;  4RTT A;  2C0O A;  1UE9 A;  2ROL A;  4OMO A;  1ZBJ A;  2KE9 A;  2LJ1 A;  1SRM A;  2OAW A;  1PNJ A;  3EHR A;  1JO8 A;  1JQQ A;  3H0I A;  4J9F A;  1WXB A;  2DL3 A;  2EGC A;  2CRE A;  4RTY A;  2EGE A;  1GFD A;  2DNU A;  1W6X A;  4RUG A;  3QWY A;  3VS4 A;  5L23 A;  4D8K A;  1U06 A;  1NG2 A;  3REB B;  2AZS A;  4A63 B;  2SEM A;  3SHW A;  2L3Q A;  1GBQ A;  1B3Q A;  3VRZ A;  2J6F A;  1Z9Q A;  2ENM A;  2DLP A;  4RTV A;  1GCQ A;  1AZE A;  3NGP A;  4J9D A;  2DL8 A;  2KRO A;  2W0Z A;  1TUC A;  2HDA A;  1UTI A;  3PE0 A;  2JXB A;  3VS7 A;  3H0H A;  1OPK A;  3NHN A;  2LJ0 A;  5IH2 A;  1T0H A;  1I07 A;  2LP5 A;  1BK2 A;  1PWT A;  4OMQ A;  2YUP A;  4JJB A;  2F2V A;  1WI7 A;  2DE0 X;  3QWX X;  4GBQ A;  1SPK A;  2HCK A;  4IIM A;  3VS6 A;  4CC4 B;  2AK5 A;  2X3W D;  1ZX6 A;  4RTU A;  1RLP C;  2DL4 A;  1S1N A;  1MV0 B;  2EKH A;  4HVV A;  2YUO A;  3M0R A;  1H3H A;  2EYX A;  4E6R A;  3VS5 A;  2D8J A;  3PVL A;  1GRI A;  1FMK A;  2C0T A;  1HD3 A;  2GTO A;  2YSQ A;  4AFS C;  4ZNX A;  4OMM A;  1SHG A;  2B86 A;  3GBQ A;  2XMF A;  1QLY A;  3TSW A;  1QCF A;  2BZY A;  1X27 A;  1UHF A;  1PRL C;  2G6F X;  5HCK A;  2RQR A;  2LCS A;  2DBM A;  4JZ4 A;  1M27 C;  2CT4 A;  2K9G A;  4OMP A;  5GJW B;  2J6K A;  1CSK A;  3FJ5 A;  1I0C A;  1SSH A;  4Z88 A;  2EQI A;  2DRK A;  1E6H A;  4J9B A;  1AWW A;  1GCP A;  2ECZ A;  4DEX A;  4KRT A;  4HVU A;  4J9I A;  2K79 A;  4AFZ C;  2RMO A;  1ZLM A;  1QKX A;  4J9C A;  2EGA A;  2DRM A;  3M0S A;  4D8D A;  3NPF A;  4AG1 C;  1GCQ C;  1RLQ C;  1AWO A;  4RTW A;  1KJW A;  1UHC A;  1PKS A;  1NYF A;  1BB9 A;  4DEY A;  1WDX A; 
#chains in the Genus database with same CATH topology
 1YIJ T;  2F5K A;  2R58 A;  4N4H A;  1XTD A;  5CAI A;  3OYD A;  2PZ1 A;  3N5B B;  1YJW T;  2MOX A;  3CBP A;  4PKC C;  4HVW A;  1MMA A;  2GQI A;  3G4S T;  1K9A A;  2MIO A;  3GNF B;  1OU8 A;  2EYW A;  3U23 A;  1HSQ A;  1S72 Q;  3E19 A;  1VA7 A;  3HRT A;  1M3A A;  2K5F A;  5IT9 E;  2RHX A;  3V7C A;  2DVE A;  1VQN Q;  1ZHI A;  1V1C A;  1PHT A;  1YHQ Q;  3CCE T;  4C8Q A;  4E47 A;  4KT0 E;  3E9F A;  4YTL A;  2CH4 A;  2O9S A;  3EG3 A;  1BI0 A;  2MPX C;  2RJC A;  4M77 F;  1VQN A;  2DO3 A;  1X69 A;  3CPW S;  1YIT T;  2X4W A;  1GBR A;  4V2S A;  4F7U E;  5GAM g;  2KBT A;  4PJO E;  1M30 A;  3KFV A;  2V1R A;  4XTY A;  3RMS A;  1WFW A;  3BDL A;  2DYB A;  2AHJ B;  5FRN A;  5CQY A;  3L2R A;  4KGX B;  4BI4 A;  2EYY A;  2GQV A;  3HFO A;  1AHJ B;  5IHN A;  5A0D A;  4OB3 B;  2FO0 A;  1N6A A;  2BZX A;  1RAH B;  2KRS A;  1K8A U;  1JJ2 S;  2BIV A;  1T3L A;  2RK1 A;  4J9H A;  4NS5 A;  1WGS A;  1VQ7 T;  4Q5W A;  1YN8 A;  2HNI A;  5LJ5 g;  3I5R A;  1PSE A;  5HK3 A;  1VQL T;  4Y92 A;  3CCR Q;  2Y4Y A;  2EBP A;  1G3S A;  3HSB A;  4GLM A;  2A7Y A;  1AOJ A;  3UAT A;  2FRY A;  1BCO A;  3CCR A;  1WYX A;  2NUZ A;  3CXC A;  3QKJ A;  4KGZ B;  4DBF A;  1N8R U;  5HY6 A;  3QJY A;  2KY9 A;  3M53 A;  3REA B;  4EMH A;  4FYX B;  1MMG A;  2BZ8 A;  2JS2 A;  5GAN f;  2J05 A;  2QEX Q;  4KH1 B;  2DTI A;  5GAN 4;  3UA7 A;  1QCO A;  5IXB A;  2E64 A;  2XI9 A;  1VYU A;  4JJN K;  5I22 A;  5A2Q E;  3F70 A;  2FYK A;  4CC7 A;  5I21 A;  2COW A;  2QEX A;  2MAM A;  5GAN 8;  2QYZ A;  1Y7X A;  2JNG A;  2CSI A;  2LRQ A;  1H92 A;  2A37 A;  3HRS A;  1Q95 G;  1HK9 A;  4MMK A;  1QMC A;  3P8B B;  2HD0 A;  2KEA A;  1NLO C;  2OTL T;  1WHL A;  1NZ9 A;  4JLG A;  5D6Y A;  1VQ6 Q;  1X75 C;  1WQ7 A;  2KAF A;  5CR2 A;  2OI3 A;  1N5Z A;  1D09 B;  4EIK A;  4M78 D;  2EYZ A;  1LNX A;  2X35 A;  1NE8 A;  1VQ6 A;  1KC8 U;  4VUB A;  1G83 A;  2CUD A;  2GNC A;  3M54 A;  4P5N A;  4LD9 K;  1D1B A;  1VQ8 T;  3V8K A;  2RNA A;  1IGQ A;  1NEG A;  4DBR A;  2LJ3 A;  2ZPE B;  3ULR B;  4PL6 A;  1AT1 B;  4ELZ C;  4IUU A;  2EJG A;  3OMG A;  3AT1 B;  1FMV A;  4PJO C;  1V76 A;  3RKX A;  2RI3 A;  3S3M A;  1TXQ A;  4J5Y A;  3CPF A;  3RER A;  4AMC A;  1WJR A;  4QT7 A;  1K0X A;  3CBO A;  3FIF A;  2VAS A;  2O9V A;  2D8H A;  3PMT A;  4LUE A;  4A4F A;  4F7U B;  4PJO B;  1OZ3 A;  3EG0 A;  1ZUU A;  5D7U A;  1UGQ B;  1D3B B;  1Q81 R;  4C92 D;  4C8Q G;  1KHI A;  2JOY A;  4A53 A;  3I55 A;  4XTV A;  3RKW A;  3QDR B;  1YNZ A;  1AWJ A;  2YRD A;  3CCS A;  3OYN A;  2MF2 A;  4NL2 A;  3J80 E;  2XDD A;  3CCL T;  1OOT A;  1V29 B;  2V26 A;  4DBH A;  2HQE A;  4BI8 B;  1X01 A;  5CKE A;  2NWM A;  1W2B P;  1J3T A;  1FYN A;  1ZUK A;  1UFF A;  1SHF A;  2L8D A;  1OU9 A;  2DYI A;  2QAS A;  1MV3 A;  5LJ3 j;  1QW1 A;  3EHQ A;  2SRC A;  6AT1 B;  2P0K A;  3BDU A;  2H8H A;  3SDZ A;  2CZ1 B;  1SEM A;  3I56 Q;  2KDS A;  1PRM C;  2LX7 A;  1CKA A;  1VUB A;  4HKE A;  2AZV A;  4C0F A;  1KQS A;  3M0T A;  2M0Y A;  1G3T A;  1UG1 A;  4HCB A;  2D9T A;  5LJ3 h;  1UE9 A;  2ROL A;  1QVG A;  2WSF E;  3OS0 A;  4LDU A;  1PNJ A;  4MDW A;  1TOV A;  3CXC S;  3RUX A;  1JQQ A;  1D0X A;  3A8O B;  2OAU A;  3ZEH A;  2EGC A;  3L2Q A;  4RTY A;  4GLK A;  1W6X A;  5DY9 A;  4M78 E;  2XD0 A;  5L23 A;  3QYG B;  2WAC A;  4ZN1 A;  2Y90 A;  2FL7 A;  3REB B;  3P8H A;  3E1S A;  3M58 A;  4EMG A;  2LX9 A;  3CC4 Q;  1RAB B;  2L3Q A;  4JRK A;  2M02 A;  2VXE A;  2NYS A;  4E7J A;  4M75 D;  2COY A;  5GAN 7;  3BE3 A;  1TTH B;  2LQK A;  5CVI A;  5GAM j;  1W4S A;  1C1A A;  3CCQ Q;  1TUC A;  1UTI A;  3T9N A;  2AIR B;  2JXB A;  2JVV A;  1M90 R;  5IH2 A;  1I07 A;  1I4K 1;  3OW2 P;  2K2V A;  1BK2 A;  4A54 A;  1BI3 A;  4OMQ A;  3PTA A;  2F2V A;  1M1G A;  4IIM A;  1YBY A;  4C92 E;  4E7K A;  2DD5 A;  1VQM A;  3M9Q A;  2PQW A;  2CGH A;  5A0L A;  1YJ9 Q;  1VQ5 Q;  1H3H A;  4E6R A;  1IGU A;  1GRI A;  4C8Q F;  4BDY A;  2RI5 A;  5LJ5 j;  2XK0 A;  1VQO T;  1HD3 A;  4A4H A;  4OB1 B;  3QXE B;  1PSF A;  1SHG A;  3UPU A;  2B86 A;  1EZZ B;  4A4G A;  4M77 D;  4E7H A;  2DXU A;  2XMF A;  5KYU A;  3VYG A;  1YJ9 A;  1VQ5 A;  5KYY B;  3ER0 A;  3G6E T;  2E4H A;  2BZY A;  1PRL C;  2YLC A;  5HCK A;  2RQR A;  2PUK B;  2FZG B;  3UT1 A;  4FSX A;  2COZ A;  4OMP A;  1I0C A;  3OYB A;  1UB4 A;  2E70 A;  3SB2 A;  4QVC A;  1GCP A;  4DEX A;  4HVU A;  2DET A;  3JCM f;  1M9S A;  1GCQ C;  3CCM T;  2ZPG B;  3DKM A;  1PKS A;  3DLL A;  1NYF A;  2E3H A;  1FMW A;  1UGR B;  3WXM B;  1VYV A;  1Q81 U;  5ECA A;  1OYX A;  4KUI A;  1RAC B;  4M7A G;  5KCH A;  3OYL A;  2CZ0 B;  4IUT A;  1RAA B;  4XQ3 A;  3CCJ Q;  3O5Z A;  1IXD A;  3R6N A;  3MP6 A;  3QPH A;  1VQ4 Q;  2YRC A;  2C06 A;  2RHU A;  2EQU A;  1U3O A;  3G7Z A;  1U5S A;  1X6G A;  2DA9 A;  3CC2 T;  3CCJ A;  4FIB A;  3MP8 A;  4LE9 A;  2F5T X;  4GY5 A;  2WSE E;  1YJN T;  1M3C A;  1ABO A;  2M51 A;  3J81 E;  2EQM A;  2M1H A;  3NTH A;  4M78 C;  1VQ4 A;  4PFZ A;  1FXX A;  3UA6 A;  2ED0 A;  1M90 C;  1W2B S;  3QZ5 B;  1Q86 U;  2CUB A;  4ATO A;  1KQS S;  3INZ A;  2P4R A;  2YHT A;  1UJY A;  4JJC A;  1OEB A;  3OS1 A;  1QVG S;  3UF4 A;  4M78 B;  2HQH A;  1RAF B;  1SG5 A;  4QVZ A;  1C0M A;  3HRU A;  4QKU A;  5GAM f;  2DL7 A;  2DIL A;  4ORZ A;  2E41 A;  1OQK A;  1K9M R;  1G8X A;  2QI2 A;  2NUT A;  2J7I A;  2DIG A;  2EAY A;  1QWE A;  4C0D C;  5GAO r;  2OTJ Q;  3DB3 A;  1F1B B;  4M77 E;  2W10 A;  4MML A;  3JRZ A;  1O9S A;  2YLB A;  1MUZ A;  2GCX A;  2FPF A;  4HT9 A;  1BU1 A;  2FRW A;  3V8L A;  4F17 A;  3OYI A;  2RI2 A;  2X9H A;  4C5H A;  2EPD A;  2I2L A;  4C0D B;  3QDF A;  3GPL A;  5GAO p;  2OTJ A;  5CKF A;  4XAX B;  5LJ5 f;  3LWH A;  4RMO A;  3UWN A;  2O31 A;  1Y96 A;  5KYW B;  1OI1 A;  2QTX A;  4C92 B;  4QW2 A;  2RQU A;  2CYZ B;  1WXT A;  1UEC A;  1PD1 A;  2LMJ A;  2FZK B;  3TSZ A;  3VS3 A;  2DVJ A;  3LWI A;  2QA4 Q;  2DXB A;  1Y57 A;  2E6Z A;  5FWB A;  1M1K C;  1VQN T;  2J06 A;  3JB9 G;  2RJF A;  2E65 A;  2K4Y A;  3CC7 Q;  2XIC A;  2BTT A;  4Z02 A;  4WF2 A;  4UC4 A;  2HZY A;  4BE2 A;  3H9N A;  1PKT A;  4A4K A;  1T0J A;  1ZSZ B;  2B8A A;  2CP5 A;  2QA4 A;  4R0K A;  2VXF A;  5GAN h;  3ZFJ A;  3R6O A;  3CC7 A;  4MZM A;  4M7A F;  1WPY A;  2P4T A;  3JSC A;  5IN1 A;  1KD1 R;  4HXJ A;  2ZPI B;  1M2O A;  3EGX B;  3ME9 A;  2J6O A;  2AT1 B;  2A3L A;  3J7A F;  4CC2 A;  2L89 A;  2CZ6 B;  2H3E B;  2C0I A;  1NJI C;  1Q82 U;  3M0Q A;  3PMI A;  3EAE A;  3JCM J;  5FRO A;  2IPO B;  1TWB A;  1BBZ A;  3A8H B;  3X24 B;  2MWO A;  1S72 A;  1OV3 A;  2HKN A;  4ZTJ A;  3TQ7 P;  2HEQ A;  3V7R A;  4LDX A;  4M75 C;  1WJS A;  3CCR T;  3M59 A;  1K9M C;  1HJD A;  2VUB A;  2PNI A;  4LXC A;  1YHQ A;  1A0N B;  1AZG B;  1CKB A;  1PM3 A;  2F1L A;  3PNW C;  1KSW A;  2JTM A;  5L8R E;  5I11 A;  1M4Z A;  1TH7 A;  2M0O A;  3RKY A;  4M75 B;  3A98 A;  3CQT A;  2K6D A;  3A8L B;  3SWN A;  4N4I A;  3TU4 K;  1JU5 C;  2E5K A;  2YUN A;  1YIJ Q;  2VYT A;  5CQX A;  1JEG A;  1R8O B;  2KT8 A;  3I9Q A;  2X4X A;  1WA7 A;  3VUZ A;  2RA2 A;  1YJW Q;  1M2V B;  3VS0 A;  2KYB A;  5GAN e;  3OB9 A;  5GMK m;  1TUD A;  2QEX T;  2CP2 A;  2KYM A;  3PVQ A;  5CKB A;  2CP7 A;  4OGE A;  4JRQ A;  3H8Z A;  3OQ5 A;  4M77 C;  1UEB A;  5IXF A;  2YWW A;  2RD1 A;  2K7A A;  4LN2 A;  3CCE Q;  4OML A;  1P92 A;  2RQW A;  5C6S A;  4PJM A;  3LGF A;  2JUF A;  3MPU B;  1K73 R;  4J9E A;  4M77 B;  4FYV B;  5FU6 C;  2QGG A;  2DF6 A;  4X9C A;  2V8I A;  3QYH B;  4CC3 A;  3JB9 F;  1W1F A;  5FLX E;  2LNV A;  1Z9Z A;  3IQL A;  1VQ6 T;  1EIF A;  3VKI A;  2LC4 A;  4JJD A;  3M4Y A;  4F04 B;  1FX7 A;  3TEE A;  5KH6 A;  2EIF A;  2F2W A;  2M16 A;  2RQT A;  2QQS A;  4KH0 B;  3SFM A;  4OMF B;  4IIO A;  1KD1 C;  2DBK A;  5GJV B;  4C8Q D;  2L0A A;  4Y28 E;  2EVR A;  3X26 B;  2KGT A;  2JJ9 A;  2O2O A;  4PFO A;  2XHC A;  4N0A C;  1EFN A;  4PJL A;  3OYF A;  3OS2 A;  1WJQ A;  4IUP A;  2VKN A;  1EX4 A;  4AFQ C;  3VUB A;  1JB0 E;  4J9G A;  3SD4 A;  3FRN A;  5KYW A;  1G5V A;  1FWZ A;  4C92 A;  2LVM A;  1HXD A;  2LJ1 A;  1SRM A;  3EHR A;  2P0Q A;  1R77 A;  2KI7 A;  3H0I A;  4J9F A;  1I81 A;  1MNE A;  1WXB A;  4XTU A;  4OB0 B;  2R5M A;  2CRE A;  2EGE A;  3VS4 A;  4ME7 A;  2E10 A;  4D8K A;  1U06 A;  3A5Z B;  2QQ9 A;  4FT2 A;  7AT1 B;  3I55 T;  5AYF A;  2L3R A;  3L42 A;  3SHW A;  1WHJ A;  3CCS T;  1B3Q A;  4M7D G;  1ZSZ A;  2J6F A;  1Z9Q A;  2E12 A;  2ENM A;  2D0Q B;  4OVA A;  1QP2 A;  3WVE B;  4OGC A;  4PLL A;  2DXC A;  2DL8 A;  2W0Z A;  3CME Q;  4KGV B;  2HDA A;  5GMK j;  2DPP B;  1OPK A;  3MEW A;  1T0H A;  3A8G B;  3OMC A;  1M5Q 1;  5HK0 A;  3CME A;  2DE0 X;  3OS5 A;  1QP3 A;  4RTU A;  4HVV A;  2KMT A;  1K73 C;  2O4X B;  3PVL A;  1KG1 A;  3PFS A;  1ZQ1 A;  3HKS A;  4ZNX A;  4RCC A;  4OMM A;  2D6F A;  3M5A A;  2RHI A;  3GBQ A;  1Q7Y R;  3PT9 A;  1I5O B;  1X27 A;  1UHF A;  3MP1 A;  3O8V A;  2DBM A;  4JZ4 A;  2CT4 A;  3QO3 A;  4C8Q E;  3VU3 C;  2FB7 A;  4XTX A;  3FJ5 A;  1SSH A;  4Z88 A;  1M2V A;  4E7L A;  2DRK A;  2EWN A;  4J9B A;  1BI1 A;  4KRT A;  4J9I A;  4AFZ C;  2RMO A;  1ZLM A;  4J9C A;  3QG1 A;  2DRM A;  5GAO l;  5CK9 A;  4J6X A;  2DFU A;  1Y71 A;  1RLQ C;  1YFN A;  1SF9 A;  1W2B A;  4FL6 A;  3V7S A;  1KJW A;  1UHC A;  1BB9 A;  2BE7 D;  4A4E A;  3JCM h;  4DEY A;  1WDX A;  2EKO A;  4EMK C;  5IHI A;  3I56 A;  4E7Z A;  1VQM T;  2XDP A;  1TU0 B;  3JB9 I;  2IIM A;  3EG9 B;  3CEY A;  2CT3 A;  1N9R A;  2RO0 A;  3E9G A;  5IHK A;  2GFU A;  5CCA A;  2K3B A;  3MET A;  1YJ9 T;  1VQ5 T;  1C6V X;  4M7D F;  4BE1 A;  4BE0 A;  2QQA A;  4JPB W;  5KE3 A;  2X4J A;  3MJX A;  1K1Z A;  3CC4 A;  2KR3 A;  3TCJ A;  3JV3 A;  4M7A D;  1K4U S;  1U1S A;  3OYH A;  2CP6 A;  3EGD B;  1QVF P;  4R56 A;  2JMC A;  2DIQ A;  3TVT A;  1X2Q A;  2QK0 A;  2QG9 B;  3CCQ A;  3GNG A;  1E6G A;  1SSF A;  3RR6 A;  4LUD A;  1B7T A;  5GAM h;  4FSS A;  1BCM A;  1NPR A;  4ZGD B;  1Q7Y C;  3FDR A;  2QDL A;  3FJP A;  3JCM e;  4ZGJ B;  5EG2 A;  5LJ3 e;  3OYM A;  2V1Q A;  1YP5 A;  1R0B G;  4M7D C;  3BW1 A;  2GFA A;  4J6Y A;  2E6N A;  1UUE A;  2KRM A;  3KUF A;  5KYX B;  3OW2 A;  4QQ6 A;  5AT1 B;  1KHC A;  3URG A;  4L59 A;  2MK5 A;  1VYT A;  1T3S A;  1WNL A;  2E3I A;  3CCU Q;  1H3Z A;  1D1A A;  4NL3 A;  2Z0W A;  2JM9 A;  2L3S A;  3C0C A;  5LJ5 h;  4XK8 E;  3CCJ T;  1KFZ A;  3P8D A;  2ZZD A;  5FWC A;  1VQ4 T;  2LDM A;  2XID A;  3CCU A;  3JCM X;  3H6Z A;  1UGV A;  2LCC A;  2EQJ A;  2R57 A;  1WIE A;  5GAN 6;  3V8J A;  4BDZ A;  4J6W A;  3PGG A;  5GAN 2;  4F7U A;  4C8Q C;  4PJO A;  4LNP A;  4B9X A;  3CPW P;  2DTH A;  1D3B A;  2DER A;  2CP3 A;  1M1K R;  2ZAE A;  1BIB A;  1ABQ A;  4KBM B;  4J7I A;  3RBB B;  5FU7 C;  1UJ0 A;  4C8Q B;  2PTK A;  1OPL A;  4DOV A;  4IKF A;  5GAO n;  2VWF A;  2BUD A;  5GAM e;  5KYN A;  2KQW A;  2BE9 B;  2I0N A;  2DTO A;  1WXU A;  2ZCF B;  3OYK A;  3OBW A;  3JCM P;  1JJ2 P;  1W70 A;  3JCM d;  2F2X A;  1OZ2 A;  1XOV A;  4M75 E;  5LJ3 d;  5KCO A;  3JB9 D;  2OTJ T;  2DX1 A;  2HBW A;  3L2W A;  2ED1 A;  1RUW A;  2KRN A;  2LTO A;  3VS2 A;  4M7A E;  3MEA A;  1AWX A;  2L2P A;  2PVG B;  3FLG A;  4LDV A;  2FZC B;  1K8A R;  1WZO A;  3RIR A;  3C94 A;  3G71 Q;  5LJ5 e;  1NJI R;  2KT1 A;  3GP8 A;  2MI6 A;  3EH2 A;  1VQK Q;  5FRM A;  3NMZ C;  3QSU A;  1IO6 A;  3C12 A;  2DXT A;  2ZPH B;  1O75 A;  3RMQ A;  1RAD B;  3G71 A;  1OX9 A;  2HSP A;  3X28 B;  5J26 A;  3DLM A;  3MO8 A;  4CI0 C;  1VQK A;  5HKC A;  3EG9 A;  3MHX A;  3JB9 J;  4RTX A;  1GL5 A;  2A28 A;  3FB9 A;  2RM4 A;  2QA4 T;  1M3B A;  1YI2 Q;  1MGQ A;  5DLQ E;  4X34 A;  1NBE B;  1TSF A;  3CC7 T;  2HL5 C;  4QQG A;  2V8K A;  2VGN A;  3M57 A;  3HL8 A;  4ESR A;  3OY9 A;  3EG1 A;  1YI2 A;  3OYG A;  1E7O A;  2RQV A;  2NUP B;  1QKW A;  1ZBX A;  3ZL7 C;  5FW9 A;  3QHS A;  2CDT A;  4O5V A;  3A8M B;  3JCM V;  5I2S A;  3EGD A;  4X1V A;  2DM1 A;  2K57 A;  4RCB A;  1S72 T;  5LL6 S;  2HMA A;  1IB8 A;  2LZ6 B;  1M90 U;  2BKD N;  3L2U A;  2ABL A;  1XJW B;  1Y0M A;  1QCN A;  2JMA A;  1BKB A;  2RH2 A;  1M1F A;  1YCS B;  1RL2 A;  3THK A;  2DL5 A;  1VIF A;  1YHQ T;  2LQW A;  5LJ5 d;  2DZC A;  2KK4 A;  3WVD B;  3L1A A;  1RAE B;  3H0F A;  3OW2 S;  2K2M A;  2XG8 D;  2IVW A;  4LDW A;  4F14 A;  5KYX A;  3VRY A;  3QUI A;  4E7I A;  4HCK A;  5LJ3 g;  1SRL A;  3ASK A;  4X9D A;  3L2Z A;  2JW4 A;  3LYI A;  5KYY A;  1VIE A;  1I1J A;  1LVK A;  3CCV Q;  3OYC A;  4LD6 A;  4RTT A;  2C0O A;  5C0M A;  2RJE A;  3VJP A;  4OMO A;  1ZBJ A;  2KE9 A;  3CD6 Q;  1BYM A;  3EFO B;  1WHM A;  2XKO C;  2OAW A;  1K8A C;  1JO8 A;  3L2V A;  3CCV A;  1Y07 A;  3CMA Q;  2IG0 A;  1GFD A;  2DNU A;  3QWY A;  3HFN A;  2EYQ A;  3CD6 A;  1NG2 A;  4A63 B;  4XU2 A;  5A0G A;  1VQP Q;  3ZBD A;  2SEM A;  3CMA A;  3RDV A;  1VQ9 Q;  1GBQ A;  4F7U G;  4PJO G;  4D6W A;  3VRZ A;  4M7A C;  1LOJ A;  1WHH A;  4RTV A;  1GCQ A;  1M1K U;  1AZE A;  1BIA A;  1VQP A;  1N8R C;  3FC3 A;  5DM7 R;  5D6W A;  4J9D A;  4KUD K;  2KRO A;  1VQ9 A;  1UGS B;  2PVO B;  3OBY A;  4FW2 A;  4M7A B;  4BUG A;  3PE0 A;  1XNI A;  3H0H A;  5GAN 5;  1IHV A;  2EFI A;  2LP5 A;  4OF1 A;  4JJB A;  2E1H A;  3G4S Q;  1YIJ A;  4FU6 A;  1SPK A;  2HCK A;  3FEO A;  3VS6 A;  4CC4 B;  3S3N A;  2AK5 A;  5J3B A;  1ZX6 A;  1WHG A;  1VOM A;  4M7D D;  2DL4 A;  2FVU A;  1S1N A;  1YJW A;  2VC8 A;  2JTF A;  2EKH A;  3LX7 A;  3TRE A;  3EFR A;  2EYX A;  4XU1 A;  3VS5 A;  8AT1 B;  2D8J A;  2C0T A;  3G4S A;  5IAY A;  2WSC E;  1OUL A;  3MKD A;  1NJI U;  4AFS C;  3CXC P;  1OX8 A;  4M78 A;  3OYA A;  4TVR A;  4JRP A;  2NLU A;  2LQ8 A;  1LPL A;  4FYY B;  4FCY A;  4PFP A;  3MEV A;  1QLY A;  3TSW A;  1QCF A;  4HT8 A;  1YIT Q;  1WHK A;  3C95 A;  3CCE A;  1K9M U;  2DEQ A;  1M27 C;  2DKG A;  2K9G A;  4FYW B;  1CSK A;  5M9O A;  5FU6 B;  3GLX A;  1RAG B;  2EQI A;  2RK2 A;  3MCA B;  4JLI A;  1YIT A;  4FT4 A;  2ECZ A;  4ELY C;  1KC8 C;  3PIO A;  3JCM W;  1RAI B;  2K79 A;  4RG2 A;  1QKX A;  1MHN A;  3DB4 A;  4D8D A;  2XU8 A;  3NPF A;  4AG1 C;  1AWO A;  3HP9 A;  2NUP A;  1G3Y A;  3NFC A;  4PJN A;  5DLO A;  4B6M A;  1VQ7 Q;  4C0Z A;  3BY7 A;  3CBM A;  3CME T;  1VQL Q;  1TG0 A;  4QVD A;  1ZUY A;  2JT4 A;  5I2M A;  2EQK A;  2DJZ A;  5GAN d;  4M4Z A;  3C4S A;  2RJD A;  1VQ7 A;  1GFC A;  1JXO A;  1H64 1;  2KXC A;  3E2U A;  1VQL A;  3KXT A;  1UGP B;  1SKU B;  2PU9 B;  2MCN A;  1LCK A;  1ACM B;  3EGU A;  4F7U F;  4PJO F;  2RPN A;  2VGM A;  3EG2 A;  2X4Y A;  5GAN 3;  4DOW A;  1QVP A;  1H8K A;  1NPP A;  4RG8 A;  4IUV A;  3MEU A;  2M9U A;  4PNO A;  4ZTF A;  4J8O A;  2AKK A;  1M8M A;  1HYO A;  3EGX A;  1AVZ C;  1KD1 U;  3VS1 A;  4M7D E;  1MND A;  2FPE A;  3EFO A;  3LW5 E;  2EJ9 A;  5KYU B;  3SEM A;  1BI2 A;  1AD5 A;  1AEY A;  3OYY A;  2RF0 A;  2X3X D;  1PG5 B;  2CKK A;  4PLI A;  1LJO A;  2X51 A;  2YDL A;  2RN8 A;  5CKH A;  5GMK h;  3JCM b;  3JB9 H;  1ZSG A;  3I56 T;  2OTL Q;  1B34 B;  2HKQ B;  2KVQ G;  2K3X A;  2KXD A;  4QQD A;  2LT4 A;  4XU3 A;  1K0S A;  2P84 A;  4OMN A;  1D1C A;  4PJJ A;  2OX7 A;  1IHW A;  3I55 Q;  2FEI A;  2GGR A;  2RHY A;  4AFU C;  2OTL A;  1X43 A;  4M75 A;  3CCS Q;  1G2B A;  2DMO A;  1NYG A;  4M7A A;  2A36 A;  1U1T A;  1VQ8 Q;  4XTW A;  1ARK A;  2D1X A;  1WX6 A;  2K5L A;  2QGF B;  1QWF A;  4F16 A;  4C5G A;  3M0P A;  2KNB B;  2VV5 A;  3CC4 T;  5GMK i;  2OJ2 A;  1ZA2 B;  2DZ9 A;  1VQ8 A;  1KQS P;  2Y4X A;  3RES A;  2L3P A;  5GAN g;  1IRX A;  1NLP C;  3KBG A;  3M0U A;  4IUQ A;  2QAZ A;  1K76 A;  3QBY A;  1QVG P;  2YRV A;  1IZ6 A;  3NTI A;  2CH4 W;  3GF5 A;  4CRI A;  3CCQ T;  2JS0 A;  1Q86 R;  4EPC A;  1N27 A;  4M77 A;  2D0N A;  4BB7 A;  2ATC B;  4M78 G;  5GMK e;  5CIU A;  1NM7 A;  1K73 U;  4EMK B;  4II1 A;  1YCY A;  4JUV A;  2LQN A;  1DJ7 B;  3OSV A;  2RB6 A;  4C0G A;  4L6V 5;  3M4G A;  4Z89 A;  1YWO A;  2K3Y A;  3QII A;  3PIP A;  2A08 A;  3CCL Q;  4DA4 A;  1UDL A;  2JM8 A;  1KIK A;  2JN0 A;  2YXY A;  2NUT B;  4J7F A;  2AKL A;  1RI9 A;  1X6O A;  1WQW A;  1PC0 A;  1NEB A;  2FG0 A;  1ZA1 B;  2CP0 A;  3UDC A;  3JAM E;  3CCL A;  3X25 B;  2YUQ A;  4HA8 A;  4AG2 C;  4B9W A;  2GTJ A;  2QTV A;  4C5I A;  3CCU T;  4Z8A A;  4MDX A;  8ATC B;  3I35 A;  2LCL A;  3EFS A;  2JZ2 A;  3VV0 A;  3OSS C;  4N0A A;  4DQ2 A;  5CKD A;  3G1J A;  3BFM A;  3H41 A;  4C92 G;  2RHZ A;  1Y96 B;  1MMD A;  3EH1 A;  3NTK A;  5GAO q;  2CZ7 B;  2EJF A;  2ZPB B;  1WLP B;  4WCI A;  1VQM Q;  4L5G A;  1YWP A;  2ROT A;  3QZ9 B;  1GXI E;  1JXM A;  2HQX A;  4NOY A;  1QVF A;  4JZ3 A;  4OP0 A;  1KQ2 A;  3OYJ A;  2DD4 A;  1Q81 C;  3S6W A;  2FPD A;  2F69 A;  2QQR A;  2A0F B;  4OB2 B;  3GIB A;  1PD0 A;  2O88 A;  4M7D B;  2R5A A;  4RTZ A;  3A1P A;  2ESW A;  1X6B A;  1TUG B;  2MYS A;  2GF7 A;  2JTE A;  3VYH B;  1IRE B;  2VVK A;  5EC7 A;  1X2K A;  2QXF A;  4HCZ A;  2EW3 A;  2PUO B;  2DJQ A;  1B07 A;  4BAC A;  2CSQ A;  2GBQ A;  3QJ6 A;  4C5E A;  2LNH B;  4LDY A;  2FHD A;  3M56 A;  2YT6 A;  2MWP A;  1N9S A;  3X20 B;  1Q86 C;  2LT1 A;  1D0Y A;  1Q82 R;  2K5I A;  4K11 A;  1RI0 A;  2O4X A;  1B34 A;  3G71 T;  4IUR A;  4O6J A;  1VQK T;  3I5S A;  4JS5 A;  2HSE B;  2P0P A;  5LJ3 f;  2VB6 A;  4M78 F;  1KQ1 A;  3LH5 A;  1VQO Q;  1Q7Y U;  4JRI A;  2L5Q A;  4FW1 A;  3RNJ A;  1QQJ A;  3SWN C;  5FU7 B;  4HCC A;  3CPW A;  1I8F A;  4M75 G;  9ATC B;  2CS7 A;  3G6E Q;  4ZN3 A;  1VQO A;  1MMN A;  1YI2 T;  5GMK l;  2DL3 A;  3JCM Q;  3HHT B;  3SWN B;  4RUG A;  4BI3 A;  4Y91 A;  3G6E A;  2PVD B;  4WTO B;  5CO7 A;  2AZS A;  2QQB A;  3LGL A;  1JJ2 A;  1JRI A;  3CCM Q;  2DLP A;  1R0C B;  4DBQ A;  2ZPF B;  4R55 A;  4C92 F;  3D7S B;  5GAO m;  2DEU A;  4BY6 C;  3NGP A;  2O01 E;  3JCM c;  1I5L A;  2E5Q A;  4EMK A;  4BD3 A;  5J39 A;  4M77 G;  3VS7 A;  3CCM A;  4JS4 A;  3NHN A;  4FM4 B;  1N8R R;  2LJ0 A;  1PCX A;  4E7S A;  1TS9 A;  3AHU A;  1PWT A;  4J83 A;  2QDY B;  1D0Z A;  2YUP A;  4BY6 B;  1WI7 A;  3HPW A;  3QWX X;  4GBQ A;  3M55 A;  2X3W D;  4PJO D;  4ANJ A;  1RLP C;  5D6X A;  1MV0 B;  3S3O A;  5GAM d;  2YUO A;  3M0R A;  4PK4 A;  3CC2 Q;  1FMK A;  1YJN Q;  4E2F B;  5KE2 A;  2GTO A;  3OYE A;  2YSQ A;  3CCV T;  4EDU A;  4ZGE B;  4MZP A;  4C92 C;  3GOX A;  3CC2 A;  4XTZ A;  3CD6 T;  1Q82 C;  1G3W A;  2ZGW A;  1YJN A;  2G6F X;  3LLR A;  2LCS A;  2V8J A;  4XU0 A;  3CMA T;  1KK7 A;  2DK3 A;  5GJW B;  3OA6 A;  2G3R A;  2J6K A;  2HAX A;  2KSS A;  2H3J A;  3HTR A;  3Q1J A;  1QVF S;  1E6H A;  4N4G A;  2MMP A;  1VQP T;  1AWW A;  1JBM A;  5GAN j;  4AT1 B;  1ZSZ C;  1VQ9 T;  3JCM g;  1U8R A;  2XDB A;  2EGA A;  1M8V A;  3M0S A;  4KUL A;  2DAQ A;  2HL3 A;  4M7D A;  2HBP A;  3LH0 A;  4RTW A;  1KC8 R;  4RKU E;  4MZT A;  1XQH A;  4JDS A;  4M75 F; 
#chains in the Genus database with same CATH homology
 1TG0 A;  5IHI A;  1VYV A;  5ECA A;  1ZUY A;  2JT4 A;  2PZ1 A;  4M4Z A;  2MOX A;  4HVW A;  2IIM A;  1GFC A;  1JXO A;  2CT3 A;  2GQI A;  3O5Z A;  2KXC A;  1K9A A;  3R6N A;  2MIO A;  5IHK A;  2EYW A;  3U23 A;  1HSQ A;  2K3B A;  2MCN A;  1U3O A;  1LCK A;  1VA7 A;  3EGU A;  1U5S A;  1M3A A;  1X6G A;  2DA9 A;  2RPN A;  4LE9 A;  3EG2 A;  1V1C A;  1M3C A;  1ABO A;  4JPB W;  2M51 A;  1PHT A;  1H8K A;  3UA6 A;  2ED0 A;  1K1Z A;  2CH4 A;  2O9S A;  3EG3 A;  2KR3 A;  3JV3 A;  2CUB A;  2P4R A;  1UJY A;  2AKK A;  1X69 A;  1M8M A;  1K4U S;  4JJC A;  1OEB A;  3UF4 A;  1GBR A;  1AVZ C;  2KBT A;  2JMC A;  3VS1 A;  2FPE A;  1M30 A;  3TVT A;  3KFV A;  3SEM A;  1X2Q A;  2V1R A;  1AD5 A;  2DL7 A;  2DIL A;  1AEY A;  2RF0 A;  1WFW A;  2X3X D;  4ORZ A;  2DYB A;  2YDL A;  1E6G A;  2J7I A;  4LUD A;  2RN8 A;  4FSS A;  1QWE A;  2EYY A;  5IHN A;  1ZSG A;  2QDL A;  2W10 A;  2FO0 A;  1MUZ A;  1YP5 A;  2BZX A;  2FPF A;  2V1Q A;  2KRS A;  1BU1 A;  2FRW A;  1UUE A;  4F17 A;  1T3L A;  2KXD A;  2KRM A;  4J9H A;  2EPD A;  1K0S A;  1YN8 A;  4OMN A;  3I5R A;  2FEI A;  2GGR A;  1VYT A;  4Y92 A;  1T3S A;  4AFU C;  1X43 A;  2EBP A;  2JM9 A;  2L3S A;  2O31 A;  1G2B A;  2DMO A;  3C0C A;  4GLM A;  1NYG A;  1AOJ A;  3UAT A;  2A36 A;  2FRY A;  1ARK A;  1KFZ A;  2D1X A;  1WX6 A;  1QWF A;  2RQU A;  1WXT A;  5FWC A;  1WYX A;  2NUZ A;  4F16 A;  1UEC A;  3M0P A;  2KNB B;  1UGV A;  2LMJ A;  1WIE A;  3TSZ A;  2OJ2 A;  3VS3 A;  2DVJ A;  3REA B;  1Y57 A;  5FWB A;  2BZ8 A;  2J06 A;  2L3P A;  2BTT A;  2JS2 A;  1NLP C;  4LNP A;  3M0U A;  1K76 A;  2J05 A;  1PKT A;  1T0J A;  2CH4 W;  3UA7 A;  4R0K A;  5IXB A;  2JS0 A;  1ABQ A;  3RBB B;  1VYU A;  1UJ0 A;  2PTK A;  1OPL A;  5I22 A;  2VWF A;  2D0N A;  4CC7 A;  1NM7 A;  2I0N A;  1WXU A;  4HXJ A;  2CSI A;  2LQN A;  1H92 A;  2A37 A;  2J6O A;  4Z89 A;  1W70 A;  1YWO A;  2F2X A;  1XOV A;  4CC2 A;  2A08 A;  2KEA A;  2DX1 A;  2HBW A;  1UDL A;  2C0I A;  2ED1 A;  1NLO C;  1RUW A;  2JM8 A;  2KRN A;  1KIK A;  3VS2 A;  3M0Q A;  2AKL A;  1RI9 A;  1BBZ A;  1AWX A;  2L2P A;  1NEB A;  1OV3 A;  2FG0 A;  2OI3 A;  2HEQ A;  1N5Z A;  2KT1 A;  2YUQ A;  4AG2 C;  2GTJ A;  4EIK A;  3NMZ C;  1HJD A;  2EYZ A;  4Z8A A;  1IO6 A;  2PNI A;  1A0N B;  3I35 A;  1AZG B;  1G83 A;  2CUD A;  2GNC A;  1CKB A;  1KSW A;  2HSP A;  2RNA A;  5I11 A;  1NEG A;  3H41 A;  2LJ3 A;  3A98 A;  3CQT A;  3ULR B;  2K6D A;  1JU5 C;  2E5K A;  2YUN A;  4RTX A;  1JEG A;  1GL5 A;  2A28 A;  1WLP B;  2KT8 A;  3I9Q A;  4WCI A;  1WA7 A;  1M3B A;  1YWP A;  2ROT A;  3VS0 A;  1JXM A;  2KYB A;  4JZ3 A;  1TUD A;  4QT7 A;  1K0X A;  2KYM A;  3PVQ A;  4ESR A;  2O9V A;  2FPD A;  3EG1 A;  2D8H A;  4LUE A;  2O88 A;  3EG0 A;  1E7O A;  1ZUU A;  2RQV A;  4RTZ A;  2ESW A;  1QKW A;  1X6B A;  2JTE A;  3ZL7 C;  5FW9 A;  5IXF A;  2CDT A;  2VVK A;  2K7A A;  5EC7 A;  1X2K A;  4LN2 A;  4OML A;  4X1V A;  2RQW A;  2DM1 A;  2EW3 A;  4J9E A;  1YNZ A;  1AWJ A;  2LZ6 B;  2DJQ A;  2ABL A;  1B07 A;  1Y0M A;  2CSQ A;  2GBQ A;  1OOT A;  2DF6 A;  2LNH B;  2NWM A;  2JMA A;  4CC3 A;  1J3T A;  1W1F A;  2YT6 A;  1FYN A;  1Z9Z A;  1YCS B;  1ZUK A;  3THK A;  1UFF A;  3IQL A;  2DL5 A;  2LQW A;  1SHF A;  4JJD A;  4K11 A;  2F2W A;  1MV3 A;  2RQT A;  3H0F A;  3EHQ A;  2K2M A;  2SRC A;  4IIO A;  4F14 A;  2DBK A;  5GJV B;  2H8H A;  2L0A A;  2EVR A;  2KGT A;  3I5S A;  3VRY A;  2O2O A;  4HCK A;  1SEM A;  1SRL A;  1EFN A;  1PRM C;  2JW4 A;  3LH5 A;  2LX7 A;  1CKA A;  2VKN A;  1I1J A;  4AFQ C;  2AZV A;  3RNJ A;  3M0T A;  2M0Y A;  4J9G A;  1UG1 A;  4RTT A;  2C0O A;  1UE9 A;  2ROL A;  4OMO A;  1ZBJ A;  2KE9 A;  2LJ1 A;  1SRM A;  2OAW A;  1PNJ A;  3EHR A;  1JO8 A;  1JQQ A;  3H0I A;  4J9F A;  1WXB A;  2DL3 A;  2EGC A;  2CRE A;  4RTY A;  2EGE A;  1GFD A;  2DNU A;  1W6X A;  4RUG A;  3QWY A;  3VS4 A;  5L23 A;  4D8K A;  1U06 A;  1NG2 A;  3REB B;  2AZS A;  4A63 B;  2SEM A;  3SHW A;  2L3Q A;  1GBQ A;  1B3Q A;  3VRZ A;  2J6F A;  1Z9Q A;  2ENM A;  2DLP A;  4RTV A;  1GCQ A;  1AZE A;  3NGP A;  4J9D A;  2DL8 A;  2KRO A;  2W0Z A;  1TUC A;  2HDA A;  1UTI A;  3PE0 A;  2JXB A;  3VS7 A;  3H0H A;  1OPK A;  3NHN A;  2LJ0 A;  5IH2 A;  1T0H A;  1I07 A;  2LP5 A;  1BK2 A;  1PWT A;  4OMQ A;  2YUP A;  4JJB A;  2F2V A;  1WI7 A;  2DE0 X;  3QWX X;  4GBQ A;  1SPK A;  2HCK A;  4IIM A;  3VS6 A;  4CC4 B;  2AK5 A;  2X3W D;  1ZX6 A;  4RTU A;  1RLP C;  2DL4 A;  1S1N A;  1MV0 B;  2EKH A;  4HVV A;  2YUO A;  3M0R A;  1H3H A;  2EYX A;  4E6R A;  3VS5 A;  2D8J A;  3PVL A;  1GRI A;  1FMK A;  2C0T A;  1HD3 A;  2GTO A;  2YSQ A;  4AFS C;  4ZNX A;  4OMM A;  1SHG A;  2B86 A;  3GBQ A;  2XMF A;  1QLY A;  3TSW A;  1QCF A;  2BZY A;  1X27 A;  1UHF A;  1PRL C;  2G6F X;  5HCK A;  2RQR A;  2LCS A;  2DBM A;  4JZ4 A;  1M27 C;  2CT4 A;  2K9G A;  4OMP A;  5GJW B;  2J6K A;  1CSK A;  3FJ5 A;  1I0C A;  1SSH A;  4Z88 A;  2EQI A;  2DRK A;  1E6H A;  4J9B A;  1AWW A;  1GCP A;  2ECZ A;  4DEX A;  4KRT A;  4HVU A;  4J9I A;  2K79 A;  4AFZ C;  2RMO A;  1ZLM A;  1QKX A;  4J9C A;  2EGA A;  2DRM A;  3M0S A;  4D8D A;  3NPF A;  4AG1 C;  1GCQ C;  1RLQ C;  1AWO A;  4RTW A;  1KJW A;  1UHC A;  1PKS A;  1NYF A;  1BB9 A;  4DEY A;  1WDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...