2NYSA

X-ray crystal structure of protein agr_c_3712 from agrobacterium tumefaciens. northeast structural genomics consortium target atr88.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQMTIVIQHQFWDMKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGR_C_3712p
publication title Crystal structure of the hypothetical protein AGR_C_3712 from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04386 SspB Stringent starvation protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2nysA00
2NYSA 1YFNA 1OU8A 1ZSZB 1ZSZA 2QAZA 1OX8A 1OU9A 1OULA 1ZSZC 1OX9A 1TWBA 2QASA
chains in the Genus database with same CATH superfamily
1UB4A 1BI1A 2OAUA 1NM7A 2CT4A 2KK4A 5CKDA 5I22A 1OI1A 1YIJT 5CK9A 1PSEA 4EIKA 4JJBA 3V7RA 4OB3B 2E6ZA 2JZ2A 1RABB 3C95A 4PJOD 3EG0A 3QIIA 2JXBA 3GPLA 4FT2A 1U3OA 3R6NA 4OMMA 4A4FA 4PNOA 4GLKA 3CMAT 2KSSA 1OX9A 5AYFA 4M77G 2O31A 2V8JA 1NYGA 2CZ0B 2KGTA 5GAN4 4C92F 2L2PA 2Y90A 4M75C 3S3MA 3CC4Q 1MV3A 5FU6B 4KULA 4XTZA 1TXQA 3WXMB 5HKCA 2BE9B 1BKBA 2JM8A 2O2OA 1RI0A 2KRNA 1D0XA 1VUBA 3HHTB 2M02A 2GF7A 1Q82R 1G8XA 3JB9D 3JCMX 2E65A 2X3XD 5GANg 2HMAA 3GIBA 5FROA 4C92B 4FL6A 3X24B 2NUTA 2E4HA 2RI2A 1W2BP 4M77C 1UJ0A 4FW1A 5FWCA 3ZEHA 1FMKA 3CCLA 4ZGEB 3L2QA 3OYCA 3ASKA 1WGSA 4FU6A 1Q82U 1CKAA 1AWOA 3CCSA 1WXTA 2ZPGB 5GAMg 1M90C 2G3RA 1M2OA 2BE7D 2I2LA 4DQ2A 2E64A 1YJNT 1JRIA 1PNJA 3L2ZA 5KYUB 4J83A 1QQJA 1UUEA 1SPKA 2L5QA 4LUEA 2LP5A 2CDTA 3H8ZA 4JLGA 2HQEA 3L42A 2LCSA 7AT1B 5D6WA 3KUFA 1H3HA 4LDYA 3I35A 2JT4A 2FG0A 4C0ZA 1QVFP 2MK5A 2DM1A 4XTXA 2ZCFB 4ZN1A 2Y4XA 4II1A 2VXFA 3HSBA 2CZ6B 2GQVA 2PVOB 4JJDA 1OU9A 1ABOA 4M75F 5HK0A 1H641 4WCIA 1Y0MA 2VUBA 3HKSA 1G3YA 2EYZA 1IGUA 1MMGA 2K2VA 2YWWA 1Q86R 9ATCB 1VQ9Q 4C8QE 4EMKA 2MPXC 3QXEB 3PFSA 4N0AC 4MDXA 4IKFA 1AOJA 4B6MA 2E12A 1WHKA 1HD3A 2MMPA 1BB9A 3FRNA 2RHIA 2K5IA 1MNEA 2DX1A 2PUOB 1AD5A 1ZSZC 3OYYA 3G4SA 1ZA2B 1OU8A 1VQKQ 1WQ7A 3PE0A 1WNLA 3JSCA 1Q86U 1U1TA 2NUPB 3DLMA 3NTHA 3TREA 2J6OA 3QZ5B 3M58A 3SEMA 3VYHB 3HRTA 4M77F 1FXXA 1SRLA 2JS0A 3OYMA 2AHJB 4M75B 4M78A 3THKA 3CXCP 2DEUA 3EFRA 5GAN5 3CC2Q 1Y96A 2NYSA 4QKUA 1Y7XA 2NUTB 2ZAEA 1PSFA 2M51A 3JRZA 5I21A 2QXFA 4KH1B 1DJ7B 2BKDN 4J9BA 2LJ1A 2RQVA 1RADB 4M78D 1ZBJA 4PJNA 2E1HA 1M1FA 4M7DA 2V8KA 5IT9E 2AK5A 3OS2A 2X35A 3J7AF 1H8KA 2VC8A 4Z89A 4F7UA 2GTOA 4MZTA 1JO8A 2P0PA 2K9GA 5GANd 3FB9A 3RKWA 4M7DD 2EVRA 2QYZA 4M77B 3CCQQ 2M0OA 2PZ1A 2RPNA 4AFSC 2HD0A 3PVQA 2QA4Q 1YITQ 2BZXA 2VVKA 3FLGA 2HQHA 1YWOA 3A8GB 1VQ6T 3CBOA 1MMDA 1R8OB 1WLPB 2DXTA 2RB6A 4KGVB 2K5FA 1WZOA 3M0SA 3PMIA 1FWZA 2FL7A 5GAMd 3I56A 4ESRA 4ME7A 2VYTA 1QP3A 3EH2A 5CAIA 4D6WA 2DKGA 1EZZB 2PVGB 1X6GA 2M0YA 1YHQQ 2AKLA 1UGRB 2R58A 3CMEA 3E9GA 1IRXA 3I5RA 2F1LA 2LNVA 2FZKB 2P0QA 1KSWA 2HSEB 2Z0WA 1K9AA 3CCMQ 2RJCA 2OTLT 4DEYA 2KR3A 1K73C 4HVWA 3OYNA 5GAOr 1TUDA 2KE9A 4JRQA 1N6AA 5DLOA 1VQNA 2JTEA 3C12A 2YLCA 1RUWA 3QG1A 1KHCA 3UA6A 4FT4A 1VYUA 4KT0E 2CUDA 1NPRA 2L3SA 2KROA 3MP1A 3OBYA 1G83A 2F2XA 3JB9I 4KH0B 3EH1A 2YDLA 4C0FA 5A0DA 3RUXA 5I2MA 3H6ZA 4OMQA 2MWOA 3WVEB 3SWNA 3X26B 3QHSA 5LJ5f 2QEXT 5EC7A 1U1SA 1VQPA 5KYWB 2IPOB 3LWIA 3OSSC 2D1XA 3TQ7P 1T3SA 1VYTA 3UT1A 1YJ9Q 1X75C 1IGQA 4M4ZA 3CD6Q 4LN2A 3H0FA 2FZGB 4EMGA 1XJWB 2EJFA 1WIEA 2L89A 4CC3A 3HPWA 2G6FX 2RJDA 4BDYA 2KRSA 2MIOA 1YCYA 3META 4BD3A 4OGEA 1N9RA 2A0FB 3PNWC 1ABQA 2JUFA 2KBTA 3CXCS 3OYDA 2HL5C 2P0KA 1QCNA 3QYHB 2RH2A 3MCAB 3EGDB 3JCMc 1TU0B 5GAOn 1LOJA 4JS4A 2P84A 3PIOA 2D6FA 3CC7Q 2EFIA 4IUVA 1UHCA 1M1KC 1PRLC 3PT9A 3OYEA 1TH7A 2YXYA 5CQYA 3TCJA 5KE2A 3MPUB 3I56T 2L3QA 3CCUQ 3A5ZB 3JCMd 3DLLA 1OZ2A 2LX9A 4C0DC 5GANj 2FPEA 5LJ3d 1D3BA 1QKXA 1VQ8Q 2M9UA 4IUTA 2KYMA 1IHVA 3CCJT 3EGUA 1PRMC 2DXCA 2EW3A 4LE9A 4HKEA 3BW1A 4KUIA 1ZQ1A 3LGFA 5GAMj 3A8MB 3JCMQ 2LTOA 3EHRA 4QQDA 5GANh 3CCRQ 4OB2B 1M3AA 3QYGB 1TSFA 1Y57A 4Z02A 1FMVA 2QQRA 4ZGDB 5FWBA 2L8DA 3OS1A 1K8AR 5KH6A 1WI7A 4RCBA 3JCMJ 2F2WA 1KD1C 5GAMh 2VGMA 1K9MC 1AVZC 3O5ZA 4CC4B 1SHFA 3VS4A 2GCXA 3M0TA 4C92G 1K73R 3PIPA 2ECZA 3G4SQ 1OPLA 5GANf 4CC2A 1U06A 3VYGA 1K8AU 1W70A 2XDBA 3E19A 1VQ5Q 2JTMA 8AT1B 2JW4A 3RDVA 3EG9A 2R57A 1A0NB 1M9SA 1KK7A 3M0RA 4HCKA 2GBQA 2RHZA 1LCKA 1WHJA 4MDWA 3BDUA 4RTYA 1YIJA 2RJEA 3QPHA 1I4K1 3QJYA 2CH4W 4F17A 3INZA 3L2UA 1VQOA 2XU8A 3CMAA 1UG1A 3EAEA 3PMTA 3IQLA 3CC4T 5KYYA 4JLIA 4FCYA 3CEYA 4D8KA 3LH0A 4M7AA 1Q7YR 3RNJA 2K5LA 1XTDA 3RMQA 4PJOG 1SSFA 3VS3A 5FRMA 2QTVA 2DMOA 3QWYA 1D3BB 4JZ3A 5GMKe 4RTZA 2K3BA 3L2VA 4M7AD 1X2KA 4WF2A 2LRQA 3QSUA 4NL2A 2ZPFB 1Q7YU 3U23A 5GAN8 3LH5A 1JBMA 2MAMA 2HDAA 3HFNA 2DZ9A 2MOXA 2NLUA 1EFNA 3V8JA 4HCZA 2KMTA 4NL3A 1JU5C 5DLQE 4C8QA 4C0DB 3GNGA 1BU1A 2LJ0A 4ELYC 4L5GA 3MHXA 4P5NA 3QO3A 3M9QA 2BZ8A 3JB9G 4PJOC 5J39A 2V1QA 1W6XA 1GBRA 3NHNA 2CP3A 4C8QD 2J6FA 4Y28E 1UEBA 2LDMA 3JCMh 2JNGA 4LDXA 5LJ3h 2DL8A 1AT1B 5IN1A 3UDCA 4IURA 2QTXA 1WHLA 1YJNA 4NS5A 3OA6A 1ZUYA 2KT1A 2DETA 2BUDA 2QQBA 2XHCA 1GFDA 4J5YA 3FIFA 2ZZDA 2RO0A 2DVJA 2EQUA 3NMZC 2DE0X 1KJWA 2LQWA 1D1BA 4RTUA 4PJLA 4PJJA 5LJ5e 1GXIE 1VQPQ 2YHTA 2DYBA 3JCMf 4QQGA 1K1ZA 5LJ3f 1IHWA 1BI0A 1VQOT 1CSKA 1WA7A 3OS5A 1T3LA 5CCAA 3OYIA 2BTTA 3CBMA 5GAN2 2CH4A 3JAME 1VQ9T 2JVVA 4M7AB 4OB0B 3L2RA 3F70A 3S3NA 2E5KA 3MP6A 2DILA 3SFMA 4JPBW 2B8AA 1UGVA 2V1RA 1HXDA 1N8RC 2VWFA 1PG5B 2PTKA 5A2QE 1WFWA 1PM3A 5GMKi 4E7LA 2CKKA 1YN8A 4F14A 2M16A 4K11A 5IAYA 1NYFA 1KQ2A 5KE3A 2DIQA 2JMAA 1Y07A 1Q81C 4E7JA 1R77A 1YBYA 2DPPB 4JJCA 1MHNA 1N27A 2LJ3A 4PJOF 1O9SA 2EGEA 1FX7A 3UA7A 1WJRA 2DTHA 4DEXA 1K0XA 4V2SA 4QVZA 4RCCA 1WPYA 2CREA 1JJ2S 1U5SA 3ULRB 2COZA 4CRIA 3CCQT 4DBQA 4R56A 4MZMA 2L3RA 2QA4T 1HK9A 4M78G 4JJNK 1YITT 3V8KA 1S1NA 3PVLA 1VIEA 2H3JA 3RKYA 1YI2Q 2GFUA 3BFMA 3MO8A 1I5LA 3CCEQ 5CO7A 2HKQB 4E7ZA 3RERA 2XICA 2O9SA 1KIKA 4DBHA 1AWXA 4PJOB 2O4XB 4JRIA 5L8RE 4EMKC 1VQ6A 5L23A 4YTLA 4M7DG 3MEAA 2C06A 1Q95G 1B34A 3JB9F 4ELZC 2LT4A 2WACA 1VQ7T 3A98A 3VV0A 2CP2A 1JJ2A 4F7UG 2H8HA 2KAFA 4LDWA 5FRNA 3HL8A 4JRPA 3FEOA 1BCMA 3CCMT 2K57A 1M30A 2DO3A 1OYXA 4IUUA 4JDSA 4TVRA 1R0CB 3C4SA 1EX4A 2YUNA 4M78C 4C0GA 2DK3A 3CBPA 1YIJQ 2OTLA 3VRYA 4RTXA 4QVCA 4XTWA 1UJYA 3M4YA 5HY6A 2XDDA 3M0UA 5DM7R 4WTOB 4FM4B 4HT9A 3J81E 4C92E 1S72A 3SDZA 1KFZA 2JM9A 1VQMQ 2DL4A 2DNUA 4M7DC 2R5AA 3M5AA 1QW1A 3M0QA 4Q5WA 2D8JA 2P4RA 1MGQA 1GCPA 1YJ9T 1XQHA 2F69A 1VQLQ 2QEXA 5GJVB 4N4IA 1E7OA 2FPDA 1RAHB 1VQ4Q 4J9DA 3X25B 5IHIA 2XIDA 5HK3A 1ACMB 1X69A 4PFZA 2DBMA 1NJIC 4A63B 3EHQA 1E6GA 2KT8A 2GFAA 1UHFA 1KQ1A 1B7TA 1NE8A 1V76A 2E70A 2ROTA 1MMNA 4AG1C 4ZTJA 3CC7T 2DL5A 4AFUC 2XMFA 2EGAA 3LWHA 1I81A 1VIFA 2OTJT 2VXEA 1AWJA 5GAOp 3CCUT 2KEAA 1BCOA 2DIGA 4XU2A 3PTAA 1VQ8T 2JMCA 4J9FA 3OYBA 3CCVQ 5LL6S 4AT1B 2HBWA 1M90R 2FZCB 4OMOA 4PLLA 1M1GA 4Z88A 5D7UA 3CCJA 2DZCA 5IXBA 4BB7A 5A0GA 1QWEA 4M78F 3G6EQ 2DBKA 2DXUA 3REBB 3CCRT 4EMKB 2RF0A 4X9CA 2LMJA 1M90U 2D8HA 1RAFB 4HXJA 2DD4A 4N4HA 2RA2A 1NZ9A 3OW2S 1CKBA 2A7YA 4XK8E 3MKDA 3UF4A 2YRVA 2E6NA 3QBYA 3UPUA 4M75E 4J9IA 1S72T 4M7DF 1J3TA 4XTVA 4OMFB 2OX7A 1X2QA 4ZN3A 2DFUA 2COWA 2RQTA 2KY9A 1AZGB 3JCMb 4GBQA 1K0SA 4IIOA 4F7UF 2GQIA 5CKEA 2ENMA 1YCSB 2JTFA 3N5BB 3M59A 5DY9A 4XU1A 1YJWT 3TSZA 2M1HA 5GAOl 4LD6A 4M78B 4OB1B 2XKOC 1Y96B 2HL3A 1VQ5T 5GAN7 1M8MA 5I2SA 3MEUA 2FO0A 1B07A 2RK2A 5FU7B 3OW2A 2E3HA 3RESA 1KHIA 2K6DA 1I5OB 4QVDA 3UATA 1QLYA 3G71T 1TOVA 4M77E 5FLXE 1SEMA 4M7DB 1WHHA 5CKFA 4J7FA 4PK4A 1XNIA 1RI9A 3M56A 4F7UB 2P4TA 3JB9J 1MUZA 2FYKA 3HRSA 4ZNXA 2FHDA 3LW5E 2HEQA 1PD0A 2K2MA 3CCLQ 3MEWA 2BZYA 4C5IA 2VASA 1RAIB 5AT1B 3H41A 3CCSQ 2YUQA 3CC4A 3L1AA 1IO6A 1QVGS 3FC3A 1TUGB 2NWMA 1WHMA 4LD9K 1ZUKA 1FMWA 4PFPA 2Y4YA 2X4YA 1D0ZA 4AFZC 2COYA 2CSQA 1TUCA 4KGZB 1SKUB 2GNCA 5ECAA 3TVTA 5D6XA 2B86A 3OYAA 4A4HA 4CC7A 1BIBA 2EQKA 1WYXA 1X6BA 1UDLA 2EYYA 1KC8C 2E10A 1QVPA 3EG3A 1D09B 5CR2A 2J06A 1JQQA 2DEQA 4HCCA 2DAQA 2KQWA 4A54A 4OMNA 4M7AG 4RTWA 2ZPHB 2I0NA 1VYVA 2ROLA 4J9GA 2EQJA 5I11A 3MEVA 1GCQC 2FPFA 3O8VA 1UGSB 2VB6A 1QVGA 2X4WA 3OMCA 5A0LA 2F5TX 1SHGA 4OVAA 4DBFA 2L0AA 2XI9A 5KYXA 3GOXA 2RN8A 8ATCB 1QCOA 1LVKA 1OULA 3I55T 4HT8A 3E2UA 4FYVB 3OYFA 3SWNB 2CP5A 2GTJA 4RKUE 1K76A 2CGHA 3AHUA 2EWNA 4ANJA 4PLIA 3M55A 2CP0A 3KFVA 1PWTA 2CZ7B 2W0ZA 2ZGWA 2YRDA 4J7IA 1T0JA 5CKBA 1OPKA 2QQ9A 3EFOA 1RAAB 2DL7A 2W10A 2HQXA 4M7AC 2A37A 2O01E 3OS0A 4E7KA 2VV5A 2EKHA 1O75A 5IH2A 3MJXA 4N4GA 1K73U 1AEYA 2IG0A 2KDSA 2RJFA 2O9VA 2D0NA 5GAMf 4BY6C 2OAWA 1G2BA 1KQSS 5GAN6 1RL2A 5GAOm 3C0CA 1HJDA 2LZ6B 3NTIA 4FYWB 1VQ9A 1HYOA 3NGPA 1RAEB 5HCKA 2QDLA 3CPFA 1RLPC 3JB9H 2EQIA 1Z9QA 2D9TA 4ORZA 4E2FB 1RAGB 1I8FA 4DBRA 1VQKA 3FJPA 2YSQA 3ZBDA 3GNFB 1Q82C 3VS1A 3I9QA 2LX7A 4VUBA 4LDUA 1X43A 2QQSA 4LNPA 1KQSA 3M54A 2NUZA 4BI4A 3QJ6A 2MCNA 1M1KR 1JJ2P 3CC2A 1H92A 2DXBA 3JV3A 2K79A 3VUBA 3I56Q 5KCOA 3M4GA 2X51A 3TEEA 1X6OA 1GFCA 1BI2A 5LJ5g 1YFNA 1UGQB 4ATOA 2KYBA 1M27C 3CMEQ 1M1KU 1BI3A 2HAXA 2YRCA 4C92A 1W1FA 2PU9B 4FYXB 4KGXB 1ZSGA 1ARKA 2PUKB 4JUVA 4FIBA 4ZTFA 2K3YA 1YI2T 2HSPA 3A8HB 3VU3C 3HRUA 3CCQA 3CCET 1VQNQ 2EBPA 1D1AA 2QA4A 1YITA 4C92D 3OY9A 1PCXA 3JCMV 4M7AF 4FW2A 1PKTA 1U8RA 1KG1A 4E7HA 1IB8A 1GL5A 5GJWB 1NLPC 2BIVA 3EG9B 3OSVA 5KYUA 4J6XA 2VGNA 4PFOA 4JS5A 1WDXA 5CQXA 1KD1R 2VKNA 1VQ7A 4BE0A 1WXBA 1BYMA 1K9MR 1Q86C 1YHQA 3OQ5A 5EG2A 4KBMB 1OQKA 4LUDA 4R55A 3OMGA 2LQKA 4IIMA 3CCMA 1WHGA 3P8HA 5KYYB 4C8QF 1QKWA 2EJ9A 3D7SB 1KD1U 2X4JA 1K9MU 1M8VA 4A4KA 2RHYA 1MNDA 2DYIA 3L2WA 1VQKT 1JB0E 1RACB 2H3EB 4BY6B 1VQMT 4LXCA 1TWBA 3P8DA 2ABLA 2DTIA 2EQMA 2LQ8A 4EMHA 2DJQA 3QDFA 1VQLT 1NEGA 5J3BA 3CC2T 2EAYA 2CP6A 2EPDA 5D6YA 1VQ4T 2DL3A 1YJ9A 2XDPA 3QUIA 3CD6A 4C8QB 4OP0A 2NUPA 1IREB 2PNIA 3ZL7C 4XQ3A 1M4ZA 3EG2A 2SEMA 2DA9A 2YUOA 4M75A 2DJZA 2CSIA 4AMCA 3X20B 3CPWS 2SRCA 4BUGA 2ZPIB 2LCLA 2EKOA 4ZGJB 3OYKA 4O6JA 1HSQA 2EYWA 2HNIA 3DB4A 4M75D 4RG8A 3CC7A 2DRKA 4BI8B 2GGRA 2AIRB 1P92A 3LX7A 2OTJA 2YUPA 5LJ5d 3KXTA 3CCVT 1OX8A 3OYGA 2ED1A 3CCUA 1G3TA 3EG1A 1AZEA 1VQ8A 3MP8A 4M77A 2F2VA 3OW2P 3V8LA 3CPWA 1YHQT 5J26A 1WJSA 4M7AE 5GANe 3G6ET 1PC0A 4A4EA 3A8LB 4M77D 2E5QA 5M9OA 1UGPB 4MMKA 2XK0A 4Y92A 2JOYA 3HFOA 2A28A 1ZUUA 3RR6A 1BK2A 2JJ9A 5GMKl 3CCRA 4Z8AA 2MWPA 4OF1A 2JS2A 2FVUA 5GAMe 1I1JA 3EGXA 4QT7A 1VQOQ 5FU7C 1UFFA 3CMAQ 1ZX6A 1VA7A 3BE3A 1YNZA 3I5SA 4R0KA 2RHXA 1SSHA 2QASA 5GMKj 2C0TA 3DKMA 3UWNA 3HTRA 3CD6T 4J9EA 1YJWA 3TSWA 4EPCA 1VQ5A 1GBQA 1MV0B 2FRWA 3H0HA 2MYSA 4E7SA 1N8RR 2CS7A 3SD4A 3WVDB 2K3XA 3LYIA 1BBZA 4N0AA 1WQWA 4J9CA 2J6KA 2ZPBB 5KYWA 5GMKh 3P8BB 3G71A 1PHTA 1SRMA 1QVGP 1IZ6A 4QQ6A 3OYJA 4XAXB 2DLPA 2LQNA 4PJOE 2IIMA 1ZSZA 5KYNA 4XU0A 2MI6A 3CCLT 1C0MA 1ZLMA 1BIAA 1Q81R 1RLQC 1I07A 1LPLA 3LGLA 4IUQA 3CCST 3E9FA 1N8RU 3GF5A 1X01A 3JCMg 4BACA 3BDLA 5LJ3g 4LDVA 3VRZA 3E1SA 2XG8D 4XU3A 4JZ4A 3G1JA 1W2BS 2DD5A 3EGDA 1B34B 1Q81U 1YJNQ 1NEBA 1X27A 2FRYA 2EYQA 3ZFJA 2HCKA 2A36A 1W4SA 5LJ5j 2QGGA 5CKHA 4HVUA 1OZ3A 1D0YA 1TS9A 4MMLA 4DA4A 1GRIA 2QGFB 1TTHB 2RI3A 3SWNC 3ER0A 4E47A 2LT1A 3JCMe 1VQ7Q 2KRMA 5LJ3e 4C5EA 5GAN3 3H0IA 1K8AC 3EGXB 4RMOA 2RD1A 1W2BA 5LJ5h 4DOVA 5C0MA 2DF6A 5CIUA 1ZA1B 2FB7A 4E7IA 4FSSA 1H3ZA 2YLBA 2K7AA 4J9HA 3VS0A 1QVFS 3I55A 3SB2A 2X9HA 2QDYB 2OJ2A 2C0OA 2J05A 4BE2A 3QWXX 3G4ST 3J80E 4RG2A 5GMKm 1JXOA 1KQSP 2CZ1B 4A4GA 5IHKA 1Y71A 3RMSA 1G5VA 4HA8A 3GP8A 2KXCA 4L59A 2X3WD 5C6SA 2KNBB 2RHUA 1UTIA 2E3IA 4GLMA 3H9NA 3HP9A 5IHNA 5CVIA 1QVFA 4O5VA 2DTOA 3Q1JA 2J7IA 1ZSZB 2QI2A 1Q7YC 1OV3A 2WSCE 4RTVA 3OBWA 2RI5A 1V29B 1G3WA 2AZVA 1AWWA 2V26A 4UC4A 3QZ9B 1UECA 1F1BB 5KCHA 1JEGA 1NJIR 3VS2A 1SF9A 2CT3A 4AFQC 4BDZA 1R0BG 2HKNA 4Y91A 3VS7A 3RKXA 3FDRA 2PQWA 2OTJQ 2RK1A 3OYLA 2K4YA 2HBPA 2C0IA 1NJIU 2KXDA 2QG9B 2LNHB 1N9SA 4PKCC 1VQ6Q 4J6YA 6AT1B 2CP7A 4D8DA 3AT1B 4HVVA 4RTTA 1QWFA 1ZHIA 2QAZA 4BI3A 3CXCA 4AG2C 4CI0C 3CMET 2YT6A 1XOVA 2AT1B 4QW2A 2ZPEB 4M78E 3S6WA 3M57A 1E6HA 3DB3A 2HZYA 2RQUA 3URGA 4BE1A 1C1AA 1YP5A 1G3SA 2E41A 1VQNT 2CUBA 2AZSA 1QCFA 3NPFA 2RMOA 1D1CA 2R5MA 2OTLQ 3QKJA 1WX6A 1C6VX 4FYYB 1Z9ZA 3A8OB 1AHJB 1YI2A 5FW9A 4M7DE 4X9DA 1M3BA 3CCEA 4X34A 4C8QG 3PGGA 1WJQA 3G7ZA 1NLOC 1S72Q 1QMCA 4IUPA 3GBQA 3VS6A 4F7UE 4MZPA 1K4US 1NBEB 2XD0A 4F16A 1I0CA 3V7SA 1VQPT 2DVEA 2RQRA 1PD1A 2ATCB 2WSFE 1GCQA 3X28B 2RM4A 4E6RA 2QEXQ 2LCCA 4RUGA 3NTKA 1YJWQ 2QK0A 3EFSA 4C5HA 2EIFA 2LC4A 4NOYA 1M2VA 2PVDB 2EYXA 4XTUA 2RQWA 3VKIA 2RNAA 3GLXA 3LLRA 4EDUA 3BY7A 5FU6C 3G71Q 4L6V5 3R6OA 2FEIA 1NG2A 5GAOq 2ESWA 4C8QC 3VJPA 2DRMA 4HCBA 4J8OA 3RBBB 1VQMA 1PKSA 2A08A 1EIFA 1SG5A 4C92C 3M53A 3SHWA 3CPWP 2A3LA 1VQLA 3RIRA 4X1VA 1YWPA 2IVWA 1NPPA 4B9XA 3NFCA 4OMLA 4KUDK 1WXUA 4F04B 3KBGA 2D0QB 3CQTA 1VOMA 3V7CA 1VQ4A 3REAB 3S3OA 3A1PA 3JCMP 3CCJQ 2CYZB 4A53A 2EGCA 2V8IA 3VS5A 2X4XA 1M3CA 5LJ3j 4XTYA 5KYXB 2O88A 1ZBXA 1KC8R 1IXDA 4J6WA 2LVMA 4OMPA 2OI3A 1M5Q1 2WSEE 4C5GA 4PJMA 3ME9A 2AKKA 1B3QA 2ED0A 3VUZA 1KC8U 1TG0A 3EFOB 1FYNA 2JN0A 3M0PA 4OGCA 4B9WA 3CCVA 3I55Q 3OB9A 3T9NA 3FJ5A 1QP2A 4M75G 1JXMA 4FSXA 1LNXA 4GY5A 1LJOA 2MF2A 1OOTA 4KRTA 1UE9A 2KVQG 2QQAA 3OYHA 5IXFA 4JRKA 2DERA 1T0HA 2KI7A 1V1CA 1N5ZA 4PL6A 4DOWA 2EJGA 1OEBA 2F5KA 3TU4K 1M2VB 2L3PA 3JCMW 3C94A 2O4XA 3G6EA 4PJOA 3QDRB 1MMAA
chains in the Genus database with same CATH topology
2NYSA 1YFNA 1OU8A 1ZSZB 1ZSZA 2QAZA 1OX8A 1OU9A 1OULA 1ZSZC 1OX9A 1TWBA 2QASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYS A;  1YFN A;  1OU8 A;  1ZSZ B;  1ZSZ A;  2QAZ A;  1OX8 A;  1OU9 A;  1OUL A;  1ZSZ C;  1OX9 A;  1TWB A;  2QAS A; 
#chains in the Genus database with same CATH topology
 1UB4 A;  1BI1 A;  2OAU A;  1NM7 A;  2CT4 A;  2KK4 A;  5CKD A;  5I22 A;  1OI1 A;  1YIJ T;  5CK9 A;  1PSE A;  4EIK A;  4JJB A;  3V7R A;  4OB3 B;  2E6Z A;  2JZ2 A;  1RAB B;  3C95 A;  4PJO D;  3EG0 A;  3QII A;  2JXB A;  3GPL A;  4FT2 A;  1U3O A;  3R6N A;  4OMM A;  4A4F A;  4PNO A;  4GLK A;  3CMA T;  2KSS A;  1OX9 A;  5AYF A;  4M77 G;  2O31 A;  2V8J A;  1NYG A;  2CZ0 B;  2KGT A;  5GAN 4;  4C92 F;  2L2P A;  2Y90 A;  4M75 C;  3S3M A;  3CC4 Q;  1MV3 A;  5FU6 B;  4KUL A;  4XTZ A;  1TXQ A;  3WXM B;  5HKC A;  2BE9 B;  1BKB A;  2JM8 A;  2O2O A;  1RI0 A;  2KRN A;  1D0X A;  1VUB A;  3HHT B;  2M02 A;  2GF7 A;  1Q82 R;  1G8X A;  3JB9 D;  3JCM X;  2E65 A;  2X3X D;  5GAN g;  2HMA A;  3GIB A;  5FRO A;  4C92 B;  4FL6 A;  3X24 B;  2NUT A;  2E4H A;  2RI2 A;  1W2B P;  4M77 C;  1UJ0 A;  4FW1 A;  5FWC A;  3ZEH A;  1FMK A;  3CCL A;  4ZGE B;  3L2Q A;  3OYC A;  3ASK A;  1WGS A;  4FU6 A;  1Q82 U;  1CKA A;  1AWO A;  3CCS A;  1WXT A;  2ZPG B;  5GAM g;  1M90 C;  2G3R A;  1M2O A;  2BE7 D;  2I2L A;  4DQ2 A;  2E64 A;  1YJN T;  1JRI A;  1PNJ A;  3L2Z A;  5KYU B;  4J83 A;  1QQJ A;  1UUE A;  1SPK A;  2L5Q A;  4LUE A;  2LP5 A;  2CDT A;  3H8Z A;  4JLG A;  2HQE A;  3L42 A;  2LCS A;  7AT1 B;  5D6W A;  3KUF A;  1H3H A;  4LDY A;  3I35 A;  2JT4 A;  2FG0 A;  4C0Z A;  1QVF P;  2MK5 A;  2DM1 A;  4XTX A;  2ZCF B;  4ZN1 A;  2Y4X A;  4II1 A;  2VXF A;  3HSB A;  2CZ6 B;  2GQV A;  2PVO B;  4JJD A;  1OU9 A;  1ABO A;  4M75 F;  5HK0 A;  1H64 1;  4WCI A;  1Y0M A;  2VUB A;  3HKS A;  1G3Y A;  2EYZ A;  1IGU A;  1MMG A;  2K2V A;  2YWW A;  1Q86 R;  9ATC B;  1VQ9 Q;  4C8Q E;  4EMK A;  2MPX C;  3QXE B;  3PFS A;  4N0A C;  4MDX A;  4IKF A;  1AOJ A;  4B6M A;  2E12 A;  1WHK A;  1HD3 A;  2MMP A;  1BB9 A;  3FRN A;  2RHI A;  2K5I A;  1MNE A;  2DX1 A;  2PUO B;  1AD5 A;  1ZSZ C;  3OYY A;  3G4S A;  1ZA2 B;  1OU8 A;  1VQK Q;  1WQ7 A;  3PE0 A;  1WNL A;  3JSC A;  1Q86 U;  1U1T A;  2NUP B;  3DLM A;  3NTH A;  3TRE A;  2J6O A;  3QZ5 B;  3M58 A;  3SEM A;  3VYH B;  3HRT A;  4M77 F;  1FXX A;  1SRL A;  2JS0 A;  3OYM A;  2AHJ B;  4M75 B;  4M78 A;  3THK A;  3CXC P;  2DEU A;  3EFR A;  5GAN 5;  3CC2 Q;  1Y96 A;  2NYS A;  4QKU A;  1Y7X A;  2NUT B;  2ZAE A;  1PSF A;  2M51 A;  3JRZ A;  5I21 A;  2QXF A;  4KH1 B;  1DJ7 B;  2BKD N;  4J9B A;  2LJ1 A;  2RQV A;  1RAD B;  4M78 D;  1ZBJ A;  4PJN A;  2E1H A;  1M1F A;  4M7D A;  2V8K A;  5IT9 E;  2AK5 A;  3OS2 A;  2X35 A;  3J7A F;  1H8K A;  2VC8 A;  4Z89 A;  4F7U A;  2GTO A;  4MZT A;  1JO8 A;  2P0P A;  2K9G A;  5GAN d;  3FB9 A;  3RKW A;  4M7D D;  2EVR A;  2QYZ A;  4M77 B;  3CCQ Q;  2M0O A;  2PZ1 A;  2RPN A;  4AFS C;  2HD0 A;  3PVQ A;  2QA4 Q;  1YIT Q;  2BZX A;  2VVK A;  3FLG A;  2HQH A;  1YWO A;  3A8G B;  1VQ6 T;  3CBO A;  1MMD A;  1R8O B;  1WLP B;  2DXT A;  2RB6 A;  4KGV B;  2K5F A;  1WZO A;  3M0S A;  3PMI A;  1FWZ A;  2FL7 A;  5GAM d;  3I56 A;  4ESR A;  4ME7 A;  2VYT A;  1QP3 A;  3EH2 A;  5CAI A;  4D6W A;  2DKG A;  1EZZ B;  2PVG B;  1X6G A;  2M0Y A;  1YHQ Q;  2AKL A;  1UGR B;  2R58 A;  3CME A;  3E9G A;  1IRX A;  3I5R A;  2F1L A;  2LNV A;  2FZK B;  2P0Q A;  1KSW A;  2HSE B;  2Z0W A;  1K9A A;  3CCM Q;  2RJC A;  2OTL T;  4DEY A;  2KR3 A;  1K73 C;  4HVW A;  3OYN A;  5GAO r;  1TUD A;  2KE9 A;  4JRQ A;  1N6A A;  5DLO A;  1VQN A;  2JTE A;  3C12 A;  2YLC A;  1RUW A;  3QG1 A;  1KHC A;  3UA6 A;  4FT4 A;  1VYU A;  4KT0 E;  2CUD A;  1NPR A;  2L3S A;  2KRO A;  3MP1 A;  3OBY A;  1G83 A;  2F2X A;  3JB9 I;  4KH0 B;  3EH1 A;  2YDL A;  4C0F A;  5A0D A;  3RUX A;  5I2M A;  3H6Z A;  4OMQ A;  2MWO A;  3WVE B;  3SWN A;  3X26 B;  3QHS A;  5LJ5 f;  2QEX T;  5EC7 A;  1U1S A;  1VQP A;  5KYW B;  2IPO B;  3LWI A;  3OSS C;  2D1X A;  3TQ7 P;  1T3S A;  1VYT A;  3UT1 A;  1YJ9 Q;  1X75 C;  1IGQ A;  4M4Z A;  3CD6 Q;  4LN2 A;  3H0F A;  2FZG B;  4EMG A;  1XJW B;  2EJF A;  1WIE A;  2L89 A;  4CC3 A;  3HPW A;  2G6F X;  2RJD A;  4BDY A;  2KRS A;  2MIO A;  1YCY A;  3MET A;  4BD3 A;  4OGE A;  1N9R A;  2A0F B;  3PNW C;  1ABQ A;  2JUF A;  2KBT A;  3CXC S;  3OYD A;  2HL5 C;  2P0K A;  1QCN A;  3QYH B;  2RH2 A;  3MCA B;  3EGD B;  3JCM c;  1TU0 B;  5GAO n;  1LOJ A;  4JS4 A;  2P84 A;  3PIO A;  2D6F A;  3CC7 Q;  2EFI A;  4IUV A;  1UHC A;  1M1K C;  1PRL C;  3PT9 A;  3OYE A;  1TH7 A;  2YXY A;  5CQY A;  3TCJ A;  5KE2 A;  3MPU B;  3I56 T;  2L3Q A;  3CCU Q;  3A5Z B;  3JCM d;  3DLL A;  1OZ2 A;  2LX9 A;  4C0D C;  5GAN j;  2FPE A;  5LJ3 d;  1D3B A;  1QKX A;  1VQ8 Q;  2M9U A;  4IUT A;  2KYM A;  1IHV A;  3CCJ T;  3EGU A;  1PRM C;  2DXC A;  2EW3 A;  4LE9 A;  4HKE A;  3BW1 A;  4KUI A;  1ZQ1 A;  3LGF A;  5GAM j;  3A8M B;  3JCM Q;  2LTO A;  3EHR A;  4QQD A;  5GAN h;  3CCR Q;  4OB2 B;  1M3A A;  3QYG B;  1TSF A;  1Y57 A;  4Z02 A;  1FMV A;  2QQR A;  4ZGD B;  5FWB A;  2L8D A;  3OS1 A;  1K8A R;  5KH6 A;  1WI7 A;  4RCB A;  3JCM J;  2F2W A;  1KD1 C;  5GAM h;  2VGM A;  1K9M C;  1AVZ C;  3O5Z A;  4CC4 B;  1SHF A;  3VS4 A;  2GCX A;  3M0T A;  4C92 G;  1K73 R;  3PIP A;  2ECZ A;  3G4S Q;  1OPL A;  5GAN f;  4CC2 A;  1U06 A;  3VYG A;  1K8A U;  1W70 A;  2XDB A;  3E19 A;  1VQ5 Q;  2JTM A;  8AT1 B;  2JW4 A;  3RDV A;  3EG9 A;  2R57 A;  1A0N B;  1M9S A;  1KK7 A;  3M0R A;  4HCK A;  2GBQ A;  2RHZ A;  1LCK A;  1WHJ A;  4MDW A;  3BDU A;  4RTY A;  1YIJ A;  2RJE A;  3QPH A;  1I4K 1;  3QJY A;  2CH4 W;  4F17 A;  3INZ A;  3L2U A;  1VQO A;  2XU8 A;  3CMA A;  1UG1 A;  3EAE A;  3PMT A;  3IQL A;  3CC4 T;  5KYY A;  4JLI A;  4FCY A;  3CEY A;  4D8K A;  3LH0 A;  4M7A A;  1Q7Y R;  3RNJ A;  2K5L A;  1XTD A;  3RMQ A;  4PJO G;  1SSF A;  3VS3 A;  5FRM A;  2QTV A;  2DMO A;  3QWY A;  1D3B B;  4JZ3 A;  5GMK e;  4RTZ A;  2K3B A;  3L2V A;  4M7A D;  1X2K A;  4WF2 A;  2LRQ A;  3QSU A;  4NL2 A;  2ZPF B;  1Q7Y U;  3U23 A;  5GAN 8;  3LH5 A;  1JBM A;  2MAM A;  2HDA A;  3HFN A;  2DZ9 A;  2MOX A;  2NLU A;  1EFN A;  3V8J A;  4HCZ A;  2KMT A;  4NL3 A;  1JU5 C;  5DLQ E;  4C8Q A;  4C0D B;  3GNG A;  1BU1 A;  2LJ0 A;  4ELY C;  4L5G A;  3MHX A;  4P5N A;  3QO3 A;  3M9Q A;  2BZ8 A;  3JB9 G;  4PJO C;  5J39 A;  2V1Q A;  1W6X A;  1GBR A;  3NHN A;  2CP3 A;  4C8Q D;  2J6F A;  4Y28 E;  1UEB A;  2LDM A;  3JCM h;  2JNG A;  4LDX A;  5LJ3 h;  2DL8 A;  1AT1 B;  5IN1 A;  3UDC A;  4IUR A;  2QTX A;  1WHL A;  1YJN A;  4NS5 A;  3OA6 A;  1ZUY A;  2KT1 A;  2DET A;  2BUD A;  2QQB A;  2XHC A;  1GFD A;  4J5Y A;  3FIF A;  2ZZD A;  2RO0 A;  2DVJ A;  2EQU A;  3NMZ C;  2DE0 X;  1KJW A;  2LQW A;  1D1B A;  4RTU A;  4PJL A;  4PJJ A;  5LJ5 e;  1GXI E;  1VQP Q;  2YHT A;  2DYB A;  3JCM f;  4QQG A;  1K1Z A;  5LJ3 f;  1IHW A;  1BI0 A;  1VQO T;  1CSK A;  1WA7 A;  3OS5 A;  1T3L A;  5CCA A;  3OYI A;  2BTT A;  3CBM A;  5GAN 2;  2CH4 A;  3JAM E;  1VQ9 T;  2JVV A;  4M7A B;  4OB0 B;  3L2R A;  3F70 A;  3S3N A;  2E5K A;  3MP6 A;  2DIL A;  3SFM A;  4JPB W;  2B8A A;  1UGV A;  2V1R A;  1HXD A;  1N8R C;  2VWF A;  1PG5 B;  2PTK A;  5A2Q E;  1WFW A;  1PM3 A;  5GMK i;  4E7L A;  2CKK A;  1YN8 A;  4F14 A;  2M16 A;  4K11 A;  5IAY A;  1NYF A;  1KQ2 A;  5KE3 A;  2DIQ A;  2JMA A;  1Y07 A;  1Q81 C;  4E7J A;  1R77 A;  1YBY A;  2DPP B;  4JJC A;  1MHN A;  1N27 A;  2LJ3 A;  4PJO F;  1O9S A;  2EGE A;  1FX7 A;  3UA7 A;  1WJR A;  2DTH A;  4DEX A;  1K0X A;  4V2S A;  4QVZ A;  4RCC A;  1WPY A;  2CRE A;  1JJ2 S;  1U5S A;  3ULR B;  2COZ A;  4CRI A;  3CCQ T;  4DBQ A;  4R56 A;  4MZM A;  2L3R A;  2QA4 T;  1HK9 A;  4M78 G;  4JJN K;  1YIT T;  3V8K A;  1S1N A;  3PVL A;  1VIE A;  2H3J A;  3RKY A;  1YI2 Q;  2GFU A;  3BFM A;  3MO8 A;  1I5L A;  3CCE Q;  5CO7 A;  2HKQ B;  4E7Z A;  3RER A;  2XIC A;  2O9S A;  1KIK A;  4DBH A;  1AWX A;  4PJO B;  2O4X B;  4JRI A;  5L8R E;  4EMK C;  1VQ6 A;  5L23 A;  4YTL A;  4M7D G;  3MEA A;  2C06 A;  1Q95 G;  1B34 A;  3JB9 F;  4ELZ C;  2LT4 A;  2WAC A;  1VQ7 T;  3A98 A;  3VV0 A;  2CP2 A;  1JJ2 A;  4F7U G;  2H8H A;  2KAF A;  4LDW A;  5FRN A;  3HL8 A;  4JRP A;  3FEO A;  1BCM A;  3CCM T;  2K57 A;  1M30 A;  2DO3 A;  1OYX A;  4IUU A;  4JDS A;  4TVR A;  1R0C B;  3C4S A;  1EX4 A;  2YUN A;  4M78 C;  4C0G A;  2DK3 A;  3CBP A;  1YIJ Q;  2OTL A;  3VRY A;  4RTX A;  4QVC A;  4XTW A;  1UJY A;  3M4Y A;  5HY6 A;  2XDD A;  3M0U A;  5DM7 R;  4WTO B;  4FM4 B;  4HT9 A;  3J81 E;  4C92 E;  1S72 A;  3SDZ A;  1KFZ A;  2JM9 A;  1VQM Q;  2DL4 A;  2DNU A;  4M7D C;  2R5A A;  3M5A A;  1QW1 A;  3M0Q A;  4Q5W A;  2D8J A;  2P4R A;  1MGQ A;  1GCP A;  1YJ9 T;  1XQH A;  2F69 A;  1VQL Q;  2QEX A;  5GJV B;  4N4I A;  1E7O A;  2FPD A;  1RAH B;  1VQ4 Q;  4J9D A;  3X25 B;  5IHI A;  2XID A;  5HK3 A;  1ACM B;  1X69 A;  4PFZ A;  2DBM A;  1NJI C;  4A63 B;  3EHQ A;  1E6G A;  2KT8 A;  2GFA A;  1UHF A;  1KQ1 A;  1B7T A;  1NE8 A;  1V76 A;  2E70 A;  2ROT A;  1MMN A;  4AG1 C;  4ZTJ A;  3CC7 T;  2DL5 A;  4AFU C;  2XMF A;  2EGA A;  3LWH A;  1I81 A;  1VIF A;  2OTJ T;  2VXE A;  1AWJ A;  5GAO p;  3CCU T;  2KEA A;  1BCO A;  2DIG A;  4XU2 A;  3PTA A;  1VQ8 T;  2JMC A;  4J9F A;  3OYB A;  3CCV Q;  5LL6 S;  4AT1 B;  2HBW A;  1M90 R;  2FZC B;  4OMO A;  4PLL A;  1M1G A;  4Z88 A;  5D7U A;  3CCJ A;  2DZC A;  5IXB A;  4BB7 A;  5A0G A;  1QWE A;  4M78 F;  3G6E Q;  2DBK A;  2DXU A;  3REB B;  3CCR T;  4EMK B;  2RF0 A;  4X9C A;  2LMJ A;  1M90 U;  2D8H A;  1RAF B;  4HXJ A;  2DD4 A;  4N4H A;  2RA2 A;  1NZ9 A;  3OW2 S;  1CKB A;  2A7Y A;  4XK8 E;  3MKD A;  3UF4 A;  2YRV A;  2E6N A;  3QBY A;  3UPU A;  4M75 E;  4J9I A;  1S72 T;  4M7D F;  1J3T A;  4XTV A;  4OMF B;  2OX7 A;  1X2Q A;  4ZN3 A;  2DFU A;  2COW A;  2RQT A;  2KY9 A;  1AZG B;  3JCM b;  4GBQ A;  1K0S A;  4IIO A;  4F7U F;  2GQI A;  5CKE A;  2ENM A;  1YCS B;  2JTF A;  3N5B B;  3M59 A;  5DY9 A;  4XU1 A;  1YJW T;  3TSZ A;  2M1H A;  5GAO l;  4LD6 A;  4M78 B;  4OB1 B;  2XKO C;  1Y96 B;  2HL3 A;  1VQ5 T;  5GAN 7;  1M8M A;  5I2S A;  3MEU A;  2FO0 A;  1B07 A;  2RK2 A;  5FU7 B;  3OW2 A;  2E3H A;  3RES A;  1KHI A;  2K6D A;  1I5O B;  4QVD A;  3UAT A;  1QLY A;  3G71 T;  1TOV A;  4M77 E;  5FLX E;  1SEM A;  4M7D B;  1WHH A;  5CKF A;  4J7F A;  4PK4 A;  1XNI A;  1RI9 A;  3M56 A;  4F7U B;  2P4T A;  3JB9 J;  1MUZ A;  2FYK A;  3HRS A;  4ZNX A;  2FHD A;  3LW5 E;  2HEQ A;  1PD0 A;  2K2M A;  3CCL Q;  3MEW A;  2BZY A;  4C5I A;  2VAS A;  1RAI B;  5AT1 B;  3H41 A;  3CCS Q;  2YUQ A;  3CC4 A;  3L1A A;  1IO6 A;  1QVG S;  3FC3 A;  1TUG B;  2NWM A;  1WHM A;  4LD9 K;  1ZUK A;  1FMW A;  4PFP A;  2Y4Y A;  2X4Y A;  1D0Z A;  4AFZ C;  2COY A;  2CSQ A;  1TUC A;  4KGZ B;  1SKU B;  2GNC A;  5ECA A;  3TVT A;  5D6X A;  2B86 A;  3OYA A;  4A4H A;  4CC7 A;  1BIB A;  2EQK A;  1WYX A;  1X6B A;  1UDL A;  2EYY A;  1KC8 C;  2E10 A;  1QVP A;  3EG3 A;  1D09 B;  5CR2 A;  2J06 A;  1JQQ A;  2DEQ A;  4HCC A;  2DAQ A;  2KQW A;  4A54 A;  4OMN A;  4M7A G;  4RTW A;  2ZPH B;  2I0N A;  1VYV A;  2ROL A;  4J9G A;  2EQJ A;  5I11 A;  3MEV A;  1GCQ C;  2FPF A;  3O8V A;  1UGS B;  2VB6 A;  1QVG A;  2X4W A;  3OMC A;  5A0L A;  2F5T X;  1SHG A;  4OVA A;  4DBF A;  2L0A A;  2XI9 A;  5KYX A;  3GOX A;  2RN8 A;  8ATC B;  1QCO A;  1LVK A;  1OUL A;  3I55 T;  4HT8 A;  3E2U A;  4FYV B;  3OYF A;  3SWN B;  2CP5 A;  2GTJ A;  4RKU E;  1K76 A;  2CGH A;  3AHU A;  2EWN A;  4ANJ A;  4PLI A;  3M55 A;  2CP0 A;  3KFV A;  1PWT A;  2CZ7 B;  2W0Z A;  2ZGW A;  2YRD A;  4J7I A;  1T0J A;  5CKB A;  1OPK A;  2QQ9 A;  3EFO A;  1RAA B;  2DL7 A;  2W10 A;  2HQX A;  4M7A C;  2A37 A;  2O01 E;  3OS0 A;  4E7K A;  2VV5 A;  2EKH A;  1O75 A;  5IH2 A;  3MJX A;  4N4G A;  1K73 U;  1AEY A;  2IG0 A;  2KDS A;  2RJF A;  2O9V A;  2D0N A;  5GAM f;  4BY6 C;  2OAW A;  1G2B A;  1KQS S;  5GAN 6;  1RL2 A;  5GAO m;  3C0C A;  1HJD A;  2LZ6 B;  3NTI A;  4FYW B;  1VQ9 A;  1HYO A;  3NGP A;  1RAE B;  5HCK A;  2QDL A;  3CPF A;  1RLP C;  3JB9 H;  2EQI A;  1Z9Q A;  2D9T A;  4ORZ A;  4E2F B;  1RAG B;  1I8F A;  4DBR A;  1VQK A;  3FJP A;  2YSQ A;  3ZBD A;  3GNF B;  1Q82 C;  3VS1 A;  3I9Q A;  2LX7 A;  4VUB A;  4LDU A;  1X43 A;  2QQS A;  4LNP A;  1KQS A;  3M54 A;  2NUZ A;  4BI4 A;  3QJ6 A;  2MCN A;  1M1K R;  1JJ2 P;  3CC2 A;  1H92 A;  2DXB A;  3JV3 A;  2K79 A;  3VUB A;  3I56 Q;  5KCO A;  3M4G A;  2X51 A;  3TEE A;  1X6O A;  1GFC A;  1BI2 A;  5LJ5 g;  1YFN A;  1UGQ B;  4ATO A;  2KYB A;  1M27 C;  3CME Q;  1M1K U;  1BI3 A;  2HAX A;  2YRC A;  4C92 A;  1W1F A;  2PU9 B;  4FYX B;  4KGX B;  1ZSG A;  1ARK A;  2PUK B;  4JUV A;  4FIB A;  4ZTF A;  2K3Y A;  1YI2 T;  2HSP A;  3A8H B;  3VU3 C;  3HRU A;  3CCQ A;  3CCE T;  1VQN Q;  2EBP A;  1D1A A;  2QA4 A;  1YIT A;  4C92 D;  3OY9 A;  1PCX A;  3JCM V;  4M7A F;  4FW2 A;  1PKT A;  1U8R A;  1KG1 A;  4E7H A;  1IB8 A;  1GL5 A;  5GJW B;  1NLP C;  2BIV A;  3EG9 B;  3OSV A;  5KYU A;  4J6X A;  2VGN A;  4PFO A;  4JS5 A;  1WDX A;  5CQX A;  1KD1 R;  2VKN A;  1VQ7 A;  4BE0 A;  1WXB A;  1BYM A;  1K9M R;  1Q86 C;  1YHQ A;  3OQ5 A;  5EG2 A;  4KBM B;  1OQK A;  4LUD A;  4R55 A;  3OMG A;  2LQK A;  4IIM A;  3CCM A;  1WHG A;  3P8H A;  5KYY B;  4C8Q F;  1QKW A;  2EJ9 A;  3D7S B;  1KD1 U;  2X4J A;  1K9M U;  1M8V A;  4A4K A;  2RHY A;  1MND A;  2DYI A;  3L2W A;  1VQK T;  1JB0 E;  1RAC B;  2H3E B;  4BY6 B;  1VQM T;  4LXC A;  1TWB A;  3P8D A;  2ABL A;  2DTI A;  2EQM A;  2LQ8 A;  4EMH A;  2DJQ A;  3QDF A;  1VQL T;  1NEG A;  5J3B A;  3CC2 T;  2EAY A;  2CP6 A;  2EPD A;  5D6Y A;  1VQ4 T;  2DL3 A;  1YJ9 A;  2XDP A;  3QUI A;  3CD6 A;  4C8Q B;  4OP0 A;  2NUP A;  1IRE B;  2PNI A;  3ZL7 C;  4XQ3 A;  1M4Z A;  3EG2 A;  2SEM A;  2DA9 A;  2YUO A;  4M75 A;  2DJZ A;  2CSI A;  4AMC A;  3X20 B;  3CPW S;  2SRC A;  4BUG A;  2ZPI B;  2LCL A;  2EKO A;  4ZGJ B;  3OYK A;  4O6J A;  1HSQ A;  2EYW A;  2HNI A;  3DB4 A;  4M75 D;  4RG8 A;  3CC7 A;  2DRK A;  4BI8 B;  2GGR A;  2AIR B;  1P92 A;  3LX7 A;  2OTJ A;  2YUP A;  5LJ5 d;  3KXT A;  3CCV T;  1OX8 A;  3OYG A;  2ED1 A;  3CCU A;  1G3T A;  3EG1 A;  1AZE A;  1VQ8 A;  3MP8 A;  4M77 A;  2F2V A;  3OW2 P;  3V8L A;  3CPW A;  1YHQ T;  5J26 A;  1WJS A;  4M7A E;  5GAN e;  3G6E T;  1PC0 A;  4A4E A;  3A8L B;  4M77 D;  2E5Q A;  5M9O A;  1UGP B;  4MMK A;  2XK0 A;  4Y92 A;  2JOY A;  3HFO A;  2A28 A;  1ZUU A;  3RR6 A;  1BK2 A;  2JJ9 A;  5GMK l;  3CCR A;  4Z8A A;  2MWP A;  4OF1 A;  2JS2 A;  2FVU A;  5GAM e;  1I1J A;  3EGX A;  4QT7 A;  1VQO Q;  5FU7 C;  1UFF A;  3CMA Q;  1ZX6 A;  1VA7 A;  3BE3 A;  1YNZ A;  3I5S A;  4R0K A;  2RHX A;  1SSH A;  2QAS A;  5GMK j;  2C0T A;  3DKM A;  3UWN A;  3HTR A;  3CD6 T;  4J9E A;  1YJW A;  3TSW A;  4EPC A;  1VQ5 A;  1GBQ A;  1MV0 B;  2FRW A;  3H0H A;  2MYS A;  4E7S A;  1N8R R;  2CS7 A;  3SD4 A;  3WVD B;  2K3X A;  3LYI A;  1BBZ A;  4N0A A;  1WQW A;  4J9C A;  2J6K A;  2ZPB B;  5KYW A;  5GMK h;  3P8B B;  3G71 A;  1PHT A;  1SRM A;  1QVG P;  1IZ6 A;  4QQ6 A;  3OYJ A;  4XAX B;  2DLP A;  2LQN A;  4PJO E;  2IIM A;  1ZSZ A;  5KYN A;  4XU0 A;  2MI6 A;  3CCL T;  1C0M A;  1ZLM A;  1BIA A;  1Q81 R;  1RLQ C;  1I07 A;  1LPL A;  3LGL A;  4IUQ A;  3CCS T;  3E9F A;  1N8R U;  3GF5 A;  1X01 A;  3JCM g;  4BAC A;  3BDL A;  5LJ3 g;  4LDV A;  3VRZ A;  3E1S A;  2XG8 D;  4XU3 A;  4JZ4 A;  3G1J A;  1W2B S;  2DD5 A;  3EGD A;  1B34 B;  1Q81 U;  1YJN Q;  1NEB A;  1X27 A;  2FRY A;  2EYQ A;  3ZFJ A;  2HCK A;  2A36 A;  1W4S A;  5LJ5 j;  2QGG A;  5CKH A;  4HVU A;  1OZ3 A;  1D0Y A;  1TS9 A;  4MML A;  4DA4 A;  1GRI A;  2QGF B;  1TTH B;  2RI3 A;  3SWN C;  3ER0 A;  4E47 A;  2LT1 A;  3JCM e;  1VQ7 Q;  2KRM A;  5LJ3 e;  4C5E A;  5GAN 3;  3H0I A;  1K8A C;  3EGX B;  4RMO A;  2RD1 A;  1W2B A;  5LJ5 h;  4DOV A;  5C0M A;  2DF6 A;  5CIU A;  1ZA1 B;  2FB7 A;  4E7I A;  4FSS A;  1H3Z A;  2YLB A;  2K7A A;  4J9H A;  3VS0 A;  1QVF S;  3I55 A;  3SB2 A;  2X9H A;  2QDY B;  2OJ2 A;  2C0O A;  2J05 A;  4BE2 A;  3QWX X;  3G4S T;  3J80 E;  4RG2 A;  5GMK m;  1JXO A;  1KQS P;  2CZ1 B;  4A4G A;  5IHK A;  1Y71 A;  3RMS A;  1G5V A;  4HA8 A;  3GP8 A;  2KXC A;  4L59 A;  2X3W D;  5C6S A;  2KNB B;  2RHU A;  1UTI A;  2E3I A;  4GLM A;  3H9N A;  3HP9 A;  5IHN A;  5CVI A;  1QVF A;  4O5V A;  2DTO A;  3Q1J A;  2J7I A;  1ZSZ B;  2QI2 A;  1Q7Y C;  1OV3 A;  2WSC E;  4RTV A;  3OBW A;  2RI5 A;  1V29 B;  1G3W A;  2AZV A;  1AWW A;  2V26 A;  4UC4 A;  3QZ9 B;  1UEC A;  1F1B B;  5KCH A;  1JEG A;  1NJI R;  3VS2 A;  1SF9 A;  2CT3 A;  4AFQ C;  4BDZ A;  1R0B G;  2HKN A;  4Y91 A;  3VS7 A;  3RKX A;  3FDR A;  2PQW A;  2OTJ Q;  2RK1 A;  3OYL A;  2K4Y A;  2HBP A;  2C0I A;  1NJI U;  2KXD A;  2QG9 B;  2LNH B;  1N9S A;  4PKC C;  1VQ6 Q;  4J6Y A;  6AT1 B;  2CP7 A;  4D8D A;  3AT1 B;  4HVV A;  4RTT A;  1QWF A;  1ZHI A;  2QAZ A;  4BI3 A;  3CXC A;  4AG2 C;  4CI0 C;  3CME T;  2YT6 A;  1XOV A;  2AT1 B;  4QW2 A;  2ZPE B;  4M78 E;  3S6W A;  3M57 A;  1E6H A;  3DB3 A;  2HZY A;  2RQU A;  3URG A;  4BE1 A;  1C1A A;  1YP5 A;  1G3S A;  2E41 A;  1VQN T;  2CUB A;  2AZS A;  1QCF A;  3NPF A;  2RMO A;  1D1C A;  2R5M A;  2OTL Q;  3QKJ A;  1WX6 A;  1C6V X;  4FYY B;  1Z9Z A;  3A8O B;  1AHJ B;  1YI2 A;  5FW9 A;  4M7D E;  4X9D A;  1M3B A;  3CCE A;  4X34 A;  4C8Q G;  3PGG A;  1WJQ A;  3G7Z A;  1NLO C;  1S72 Q;  1QMC A;  4IUP A;  3GBQ A;  3VS6 A;  4F7U E;  4MZP A;  1K4U S;  1NBE B;  2XD0 A;  4F16 A;  1I0C A;  3V7S A;  1VQP T;  2DVE A;  2RQR A;  1PD1 A;  2ATC B;  2WSF E;  1GCQ A;  3X28 B;  2RM4 A;  4E6R A;  2QEX Q;  2LCC A;  4RUG A;  3NTK A;  1YJW Q;  2QK0 A;  3EFS A;  4C5H A;  2EIF A;  2LC4 A;  4NOY A;  1M2V A;  2PVD B;  2EYX A;  4XTU A;  2RQW A;  3VKI A;  2RNA A;  3GLX A;  3LLR A;  4EDU A;  3BY7 A;  5FU6 C;  3G71 Q;  4L6V 5;  3R6O A;  2FEI A;  1NG2 A;  5GAO q;  2ESW A;  4C8Q C;  3VJP A;  2DRM A;  4HCB A;  4J8O A;  3RBB B;  1VQM A;  1PKS A;  2A08 A;  1EIF A;  1SG5 A;  4C92 C;  3M53 A;  3SHW A;  3CPW P;  2A3L A;  1VQL A;  3RIR A;  4X1V A;  1YWP A;  2IVW A;  1NPP A;  4B9X A;  3NFC A;  4OML A;  4KUD K;  1WXU A;  4F04 B;  3KBG A;  2D0Q B;  3CQT A;  1VOM A;  3V7C A;  1VQ4 A;  3REA B;  3S3O A;  3A1P A;  3JCM P;  3CCJ Q;  2CYZ B;  4A53 A;  2EGC A;  2V8I A;  3VS5 A;  2X4X A;  1M3C A;  5LJ3 j;  4XTY A;  5KYX B;  2O88 A;  1ZBX A;  1KC8 R;  1IXD A;  4J6W A;  2LVM A;  4OMP A;  2OI3 A;  1M5Q 1;  2WSE E;  4C5G A;  4PJM A;  3ME9 A;  2AKK A;  1B3Q A;  2ED0 A;  3VUZ A;  1KC8 U;  1TG0 A;  3EFO B;  1FYN A;  2JN0 A;  3M0P A;  4OGC A;  4B9W A;  3CCV A;  3I55 Q;  3OB9 A;  3T9N A;  3FJ5 A;  1QP2 A;  4M75 G;  1JXM A;  4FSX A;  1LNX A;  4GY5 A;  1LJO A;  2MF2 A;  1OOT A;  4KRT A;  1UE9 A;  2KVQ G;  2QQA A;  3OYH A;  5IXF A;  4JRK A;  2DER A;  1T0H A;  2KI7 A;  1V1C A;  1N5Z A;  4PL6 A;  4DOW A;  2EJG A;  1OEB A;  2F5K A;  3TU4 K;  1M2V B;  2L3P A;  3JCM W;  3C94 A;  2O4X A;  3G6E A;  4PJO A;  3QDR B;  1MMA A; 
#chains in the Genus database with same CATH homology
 2NYS A;  1YFN A;  1OU8 A;  1ZSZ B;  1ZSZ A;  2QAZ A;  1OX8 A;  1OU9 A;  1OUL A;  1ZSZ C;  1OX9 A;  1TWB A;  2QAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...