2NYSA

X-ray crystal structure of protein agr_c_3712 from agrobacterium tumefaciens. northeast structural genomics consortium target atr88.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQMTIVIQHQFWDMKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein AGR_C_3712 from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
molecule keywords AGR_C_3712p
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04386 SspB Stringent starvation protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2nysA00
1ZSZB 1OU9A 1OX9A 1OX8A 2QASA 2QAZA 1OU8A 1TWBA 1ZSZA 1OULA 1ZSZC 2NYSA 1YFNA
chains in the Genus database with same CATH superfamily
5CKDA 2CYZB 4HVVA 4MZPA 3OQ5A 3SWNC 1UJYA 2E12A 4P5NA 4Q5WA 4LXCA 3M59A 2CP6A 4C92D 3MP6A 1VA7A 1MV3A 4XTZA 1YJWQ 2LQKA 3RIRA 1B07A 1EX4A 1QP2A 2DZCA 2P4TA 2MAMA 1M8MA 2LJ3A 1D0ZA 1FYNA 1E6HA 3CCVQ 1BI2A 4AFQC 3VS6A 4KULA 5KYNA 2CP0A 2FO0A 4LN2A 4M78G 1K9AA 5L23A 2QQSA 3BDLA 1BIAA 3EFOA 1G8XA 2RQUA 1ZUKA 3HFOA 2NUPB 4BDYA 5C6SA 1G2BA 4HKEA 5GAOn 2DIQA 3SB2A 3EGXB 4M75A 4J9FA 2HEQA 1WJSA 4HA8A 2EWNA 1RAAB 1XJWB 3L2WA 1Q81C 3JV3A 2C0TA 3RBBB 3UT1A 2O01E 1YJWT 2NUZA 4M78E 1QMCA 3LLRA 3A8LB 2RA2A 2XDPA 1U06A 5GAMg 1HSQA 1HK9A 4J9EA 4C8QC 2DL8A 2HQHA 1B34B 1RLPC 1ACMB 1WGSA 4J6WA 4C0DB 1MNDA 2F2WA 1AD5A 4F17A 1UGRB 3EGXA 2P0QA 3OBWA 4N0AA 2DRMA 5D6WA 3M0SA 2LC4A 3F70A 2PVGB 3UATA 1PM3A 1RAGB 1OX9A 2A08A 4F04B 3OS0A 1PWTA 3H0FA 4KT0E 2EIFA 3C0CA 1VQNT 1N6AA 3CPWP 1Q7YR 2LT4A 1ZX6A 1NLOC 1YHQQ 2OAWA 4HT9A 4J7FA 3I56T 4DA4A 2XD0A 1B3QA 4ELZC 1TH7A 4JDSA 4EPCA 1GBQA 1KQSA 1TUCA 4F14A 3FRNA 4II1A 2DTHA 4M7DF 2OAUA 2L0AA 1G3YA 2GGRA 4FYYB 2DTIA 4LD9K 4HCKA 2XMFA 2KK4A 3WVDB 3NMZC 4ZTFA 1WDXA 1IHVA 4M77E 3NFCA 3PVLA 2J6OA 2VB6A 2RJDA 2MWOA 3PGGA 1VQOA 3VYGA 3OB9A 1M5Q1 1QW1A 3MJXA 1B7TA 1YN8A 3MCAB 3O8VA 3LYIA 1AT1B 1KQSP 1X75C 5DLQE 3LGLA 2DILA 3QWYA 3EG0A 4OF1A 2VUBA 1VQOT 3DLLA 2FZGB 1R0BG 5CCAA 2KYBA 1VQ9T 1VQLA 4M7DB 4FCYA 1XNIA 2QTXA 2X4XA 4C8QE 1QVGP 4RG8A 2QEXA 3FJPA 1I81A 2ROLA 4DOVA 4BE1A 4M77C 4OVAA 2HKQB 2K9GA 2HSEB 4FYXB 2YXYA 2J06A 2MF2A 4E7ZA 5AYFA 2HQEA 1YBYA 1RADB 5GANh 4B9WA 3OSSC 2YUPA 3MEWA 2M0OA 2L3QA 3QO3A 1PNJA 3U23A 4M7AF 5GAMe 4JZ3A 1Y07A 4J6XA 4E7KA 3OYLA 3GF5A 5FLXE 2A36A 1AZEA 2LJ0A 2HDAA 2KVQG 3CCJT 3JRZA 3CCEA 2EJGA 1S72A 4PFZA 5GAMf 5I21A 5DY9A 4GLMA 3CCET 2Y90A 4JUVA 1SRMA 3TQ7P 4FL6A 2QEXQ 5KE2A 1H8KA 3P8HA 1WZOA 1NE8A 4D6WA 4JRIA 2ZPBB 1Q86R 1MGQA 1XQHA 3UDCA 2FEIA 2WSCE 2H8HA 1WJQA 2M9UA 1IGQA 4C0ZA 2MWPA 2OTLA 1YWOA 3CMEQ 2DBMA 3L1AA 3CMAA 2QA4Q 2Z0WA 1VQ4A 4FSXA 2QDLA 4E7LA 4JJCA 5FU6C 3EFRA 1M2VA 1GFCA 3OS2A 4M78F 4EMHA 3FC3A 3CMAT 4A63B 3OS1A 3VS4A 3EG2A 4L59A 2OTLT 1KQ1A 5GAOr 2D6FA 2GBQA 3CCST 3E1SA 1GRIA 1HXDA 1M27C 4DEXA 1ZBXA 5GMKe 4M77D 3JB9J 3H6ZA 3I35A 2R57A 3CC2Q 4D8KA 4JJDA 3UF4A 4C5GA 1WI7A 3EGDA 5I2MA 4A4EA 3E2UA 1N9RA 2GF7A 3JCMb 2R58A 2VKNA 2ZCFB 3P8DA 4CC7A 1K9MC 2DBKA 3OYIA 5GAOm 1TSFA 3QPHA 4IIMA 1YJNQ 1KQSS 4M78B 2QQ9A 4JLIA 2VXFA 1JBMA 2JOYA 2YT6A 4BE0A 2P0PA 2E65A 4XTUA 2RJEA 1LNXA 3QJYA 4JRQA 1VQ4Q 3JAME 4K11A 1H3ZA 2XK0A 4ZGEB 1QVGS 2OTLQ 2ZGWA 2JS0A 1WXTA 5CKFA 3PNWC 1K73U 3E19A 4Y91A 2JZ2A 2BE7D 3BDUA 4M75B 4C0GA 5D6YA 2E4HA 4J9DA 2EBPA 1BYMA 4KGZB 4QT7A 3QHSA 2AZVA 2IIMA 4RTYA 2RK1A 3JB9F 1ZHIA 1M4ZA 3JB9D 2RQWA 3H41A 4FM4B 1VIFA 1TUGB 1N8RU 3X25B 4IUPA 1OQKA 3SHWA 1DJ7B 3M0PA 2WSFE 4O5VA 2BIVA 3EG9A 2XDDA 1ABOA 1W70A 2RK2A 1B34A 4BD3A 3I55Q 4M77G 3NHNA 4E7HA 3OYYA 3I56Q 1N5ZA 2RF0A 3BE3A 2VWFA 3DB4A 4PFOA 2KBTA 1Q82U 5CKEA 2NUTB 3M0UA 3OYEA 2LP5A 4CC3A 3KXTA 4IUTA 3CCJA 3S6WA 1WHHA 2FHDA 2CP2A 3JCMW 1RI9A 2DXUA 5CR2A 1JJ2S 4N4HA 1XOVA 2DAQA 1IXDA 2CREA 1RUWA 2MYSA 4KGVB 4OB0B 4C92B 2KROA 3QWXX 3URGA 4M7DE 2CUDA 2MOXA 1TUDA 1VQPQ 3ZEHA 4ATOA 2VVKA 1AWWA 1PD1A 5D7UA 3V7CA 2COWA 5GAN8 2RI3A 2JTEA 4Z88A 4FW2A 1YHQT 4JS4A 2HD0A 5IHIA 4J9HA 3C95A 2X4YA 2KT1A 1IRXA 3EH2A 1AWXA 4AT1B 1D1AA 3JCMP 1UJ0A 5FWBA 4IUVA 2J7IA 4AFZC 3JB9I 2W0ZA 4QVCA 1KK7A 2RM4A 3V8KA 2DIGA 1QP3A 4PJOC 4C8QF 1OZ3A 3PTAA 3MO8A 4HVUA 1UEBA 1Q81U 1D1BA 2RI5A 4ZNXA 1NPPA 2MMPA 1SF9A 2X35A 4PLLA 4A4KA 4HCBA 2RHYA 5KYUB 1N8RR 1VQ7A 2IVWA 3NTKA 1VQ6T 5GANe 3LWHA 2GQVA 4C92A 2H3EB 3S3MA 4OMNA 1M90C 2DYBA 3I5RA 4XTYA 2LZ6B 1NEBA 3C94A 5CKBA 4F7UE 5LJ5e 5LJ3f 1WIEA 1QKWA 3NTHA 3QKJA 1M3BA 1PHTA 1TXQA 1VQNQ 4HT8A 2LQ8A 3QZ9B 1U1TA 5GMKl 1BIBA 1X2QA 3UPUA 3JCMh 1V1CA 2EGCA 2P0KA 4QVZA 1Q7YU 2GCXA 2OTJT 6AT1B 4MMKA 1G3SA 2DVJA 2CT3A 2AKLA 1W2BP 1OULA 1NYGA 2GTJA 2HNIA 2V8JA 2XICA 2BZ8A 1IB8A 2GQIA 2G6FX 1TG0A 4LDWA 2QXFA 4PJOD 1H92A 2EJFA 1WJRA 1AVZC 4DOWA 2BUDA 2EQUA 4ESRA 1GL5A 1YIJT 2IG0A 4E7JA 1LVKA 2DZ9A 2CGHA 4XU3A 5CAIA 5GAOl 4M75C 1JO8A 5FW9A 3CCSQ 2YSQA 4HVWA 2J6FA 3ZL7C 2HKNA 1HD3A 2FYKA 4C5EA 5GJWB 2DJQA 2K5FA 2KEAA 1UB4A 3EH1A 5GMKh 3CCVT 1YITT 1Q86U 1QWFA 3PVQA 1I0CA 4FW1A 2A37A 2O9VA 2VGMA 2R5MA 2QQAA 1I07A 1NJIC 1LCKA 4Y28E 1UUEA 4PKCC 1GBRA 4WTOB 4HCZA 5KH6A 3CXCS 1ZSZC 3UA6A 3CCUQ 1H641 1X2KA 2JM8A 1UDLA 4IIOA 2HMAA 3CCLA 2CT4A 5GMKm 3OYBA 1WFWA 1X6BA 1YJWA 2DEQA 1UGVA 2YWWA 2K4YA 3L2ZA 3GOXA 2K3XA 4PJMA 1MMNA 2PZ1A 3S3OA 4R55A 2E5KA 2QG9B 3EHQA 2GFUA 5GAN7 5D6XA 3UWNA 1Y71A 1VQPA 4OMLA 2ECZA 5HKCA 3M0TA 1WX6A 2RI2A 5IH2A 3DKMA 1VQLQ 5I2SA 1I8FA 2LNHB 2CSIA 3CCRA 1N9SA 3H8ZA 2JNGA 4J7IA 2C0OA 3GBQA 3QJ6A 2E70A 3EAEA 4PNOA 1BI0A 2A0FB 4BE2A 4JJNK 3OW2A 1VQOQ 3JCMe 3OW2S 4MMLA 1X01A 2ZPGB 2CP7A 1PRLC 1M1KR 5FRNA 1VQ6A 2BZYA 4KRTA 1OU8A 2DXTA 1VYTA 1VIEA 3PIPA 1M1KU 2LX7A 2V1QA 2EGEA 1PRMC 3GIBA 3L2UA 4WCIA 2CZ7B 5IT9E 2DLPA 1CKBA 4D8DA 3ME9A 4OMFB 1X69A 2XDBA 1VQMQ 4M77A 4E2FB 5LJ3d 1PG5B 3CC4A 5LJ5f 3SWNB 1TS9A 3QDRB 3THKA 4M75G 1J3TA 2CUBA 1QVFP 1ZQ1A 1QLYA 1YFNA 2M02A 2DJZA 5GANf 3V7RA 1M1FA 1VQ7Q 1D0XA 2FZCB 1VQ8Q 1VQ9A 1VQLT 1T0HA 2Y4YA 1C6VX 1YITA 1Q82R 4L5GA 4CC4B 3CCRQ 3CD6Q 2MK5A 5EC7A 3OYGA 1Q86C 2CH4W 4EMKC 4BI4A 2RHIA 2RJCA 2V1RA 3ULRB 3ZBDA 1CSKA 2FRWA 5IXBA 2A28A 4PJOF 2YUOA 5GAOp 1NBEB 4C5IA 4R56A 2LRQA 3LH0A 5LJ5h 4BY6C 2M51A 3JCMV 2KYMA 4RCBA 2F2VA 1RAIB 2F69A 2EQIA 1E6GA 2X3XD 5FU7B 1QVFS 1AEYA 2D8HA 2DKGA 5GAMh 4RTUA 3E9FA 2PNIA 3RKXA 4DBHA 3QIIA 4DBRA 1U1SA 1KC8R 2RNAA 3OMGA 1OEBA 3TSZA 3CQTA 3Q1JA 2PQWA 4KH1B 4OMOA 3CMEA 3M4YA 5IXFA 1M9SA 1QVGA 1SHGA 2K3BA 2FVUA 5CKHA 4F7UA 4OMPA 2ZPFB 5IHNA 5CVIA 3CCMQ 2DK3A 3LX7A 2K5LA 4M75D 3CBMA 4C92C 1YITQ 4R0KA 4JRKA 4X1VA 4Z89A 1IO6A 3HFNA 1VQ5Q 1TTHB 1ZSZB 1OX8A 1GCQC 2CZ6B 2DA9A 2CSQA 3HRUA 2KNBB 4ME7A 1R77A 5GAN5 3ZFJA 1M2VB 2DYIA 4M77F 2DETA 2ZPIB 2ROTA 3D7SB 1U5SA 4HXJA 1PC0A 3A5ZB 1NM7A 2JS2A 2LTOA 4E7IA 1UTIA 2LDMA 3CCLT 3RUXA 3V7SA 1OI1A 2D1XA 4M78D 3UA7A 1KD1R 2OX7A 2FRYA 2RMOA 2DL3A 2DVEA 1W1FA 4N4GA 2D8JA 3TSWA 2CH4A 2ZPEB 4MDXA 2JW4A 5CQXA 2SEMA 2OTJQ 4V2SA 3L42A 1D3BA 1SRLA 1V76A 3X20B 1M30A 4EMKB 2QDYB 3JCMf 2KE9A 2E64A 4PL6A 2DL7A 4KGXB 4FSSA 3CC4T 3QUIA 4XU1A 4JZ4A 2HQXA 3PIOA 1MUZA 1MNEA 2DPPB 2DNUA 4BUGA 3H9NA 5A2QE 4NL3A 3CXCP 3FDRA 2RHXA 3CC4Q 1WQ7A 2J6KA 3MPUB 3L2VA 3MEVA 3RMQA 4M7AD 2BTTA 2QEXT 3HTRA 3M9QA 2DERA 2XI9A 5I22A 1ZSZA 1M90U 3RMSA 2KT8A 4F7UF 1I5LA 2JJ9A 1Q7YC 4LUEA 2LQNA 1NYFA 2EJ9A 3PMIA 4LDUA 1TU0B 5A0LA 1Z9ZA 1EFNA 3LW5E 1ZLMA 2VC8A 3QYHB 1ZBJA 3GNGA 1K76A 2LCCA 1PCXA 2HL3A 3DLMA 3OSVA 4CC2A 2D9TA 3VS2A 4MDWA 3RNJA 1BKBA 3CXCA 2I2LA 2E6ZA 1YIJA 2EAYA 2G3RA 3M0QA 4X9CA 1OOTA 2B86A 5HY6A 2EYZA 2QK0A 4J9GA 2DMOA 3KUFA 1D1CA 2QGGA 3SDZA 2KI7A 1WXBA 1A0NB 3M58A 1R8OB 4M7AG 1SKUB 2LQWA 1KD1U 1GXIE 3VV0A 4Z02A 1KC8U 2ABLA 2DXCA 5GJVB 3OYHA 1NPRA 2ED1A 1EZZB 4LNPA 3I55A 3VRZA 3OW2P 3GP8A 2E6NA 4X9DA 2RQRA 2O88A 3CCMT 4IUUA 3T9NA 3VUZA 3QG1A 1KG1A 1G5VA 2ED0A 2YRDA 3HPWA 3HRSA 4RUGA 4YTLA 4TVRA 2JUFA 1VUBA 2HL5C 3BY7A 5DM7R 4OMMA 1YIJQ 4QW2A 2I0NA 2RHZA 1YNZA 1K9MR 2X51A 2KGTA 3EHRA 3CCMA 1AWJA 3P8BB 4A53A 1KFZA 1KSWA 4A54A 3RKYA 2XIDA 1VQ8A 3MEAA 5ECAA 5DLOA 2EGAA 3BFMA 5FWCA 3VU3C 5LJ3j 4E6RA 1NEGA 2DF6A 3EFSA 5GAN2 3X28B 3CPFA 1K4US 2LX9A 3G71A 2K2VA 2FZKB 3A98A 4GY5A 3M55A 4ZN3A 2A3LA 4DEYA 3G71T 4JLGA 4RKUE 2DEUA 3BW1A 1YCSB 3MHXA 2CZ1B 1WPYA 1JXOA 2FG0A 4M78A 4NL2A 3OYCA 3CD6T 2HZYA 1YHQA 2OTJA 4LUDA 4XTWA 1BI1A 2FPFA 4QVDA 1MMGA 2NWMA 1NG2A 1T0JA 3TCJA 3CPWS 4DBFA 3I9QA 4BACA 4RCCA 4C92E 3J81E 2OI3A 1VOMA 1NJIU 1BU1A 5HK3A 3REBB 5I11A 1OZ2A 1BB9A 2CS7A 2KMTA 1VQ5T 1SG5A 1T3SA 3M4GA 3CC7Q 2EKOA 4M7DA 4FIBA 2D0QB 1LPLA 4EMKA 2L2PA 4OMQA 1M1KC 4MZTA 1VQ4T 2YLCA 3HL8A 1Q95G 1I1JA 3OMCA 4C8QA 2HCKA 3HHTB 1U8RA 2W10A 1VQKT 2VV5A 4XK8E 2QGFB 1VQ8T 3MKDA 9ATCB 5IAYA 3CCQT 1PKTA 2JN0A 2YUNA 5AT1B 3CCRT 3OBYA 4F16A 1S1NA 2NYSA 4N4IA 1C0MA 2RQTA 1VYUA 2DE0X 3MP1A 2EYQA 5GAMj 2DD5A 3SFMA 2XHCA 2DD4A 2GFAA 2NUTA 1QVFA 3INZA 1RL2A 1QCNA 2EVRA 2L3RA 3L2RA 2QI2A 1Q82C 3G4SQ 4A4HA 4J9IA 8ATCB 2E10A 2K79A 2MI6A 1FWZA 4L6V5 2L5QA 1FX7A 2DM1A 1KQ2A 5FU6B 2L3SA 2RHUA 2ENMA 3CCJQ 1JJ2P 1RACB 2E41A 1QQJA 1RAFB 3CCSA 2QAZA 4M7AE 2C06A 1WNLA 4XU0A 3S3NA 3X26B 2YUQA 3PT9A 7AT1B 2C0IA 4JRPA 1RABB 4O6JA 4M7DG 2CP5A 1YCYA 1X6GA 3CBPA 3EGDB 4C8QD 4ELYC 1WHGA 2L8DA 1WLPB 1UHFA 1VQ9Q 1VQMT 2PVDB 1D0YA 3MP8A 4LDXA 3G7ZA 2HAXA 1O75A 3OYDA 3CD6A 2E3IA 3JCMg 1JJ2A 5C0MA 1W2BA 2D0NA 1WXUA 2E1HA 2X4JA 5HCKA 4KH0B 2QA4T 4PFPA 1E7OA 1VQMA 3AHUA 5LJ3h 2LNVA 3J80E 5KCOA 3QBYA 1JRIA 2JTFA 3DB3A 4HCCA 1YJNT 5CK9A 3CC2A 3OS5A 5CQYA 4XU2A 3VS7A 3VJPA 4QQ6A 4XTXA 1K0XA 3EG1A 3QSUA 3ER0A 4M7AC 4OGEA 3VS3A 1UGQB 1I4K1 1Q81R 2LCLA 5FROA 4B6MA 1UG1A 4PJNA 4Z8AA 3EFOB 1RAEB 2O9SA 2RJFA 4RTZA 1PKSA 3JCMc 1EIFA 3C12A 3V8JA 2AIRB 3JCMJ 3CCUA 2FPDA 1ZA1B 4QQDA 3GPLA 4J9BA 1K8AU 1XTDA 2RD1A 1S72T 4GBQA 1QCOA 5GMKj 2EQJA 4UC4A 1ARKA 2LJ1A 1VQ7T 1IZ6A 1G3TA 1M3CA 2O4XB 2JT4A 1QWEA 3CMET 4OGCA 2QQBA 3A8HB 2KR3A 5KCHA 1GFDA 4M77B 2CP3A 1RAHB 3R6NA 4F7UG 1K73R 3SWNA 1O9SA 2EW3A 4RTVA 1BCMA 3M56A 4IKFA 1LOJA 4RG2A 1UE9A 5KYUA 2NLUA 2E5QA 1K73C 2F5KA 4Y92A 3VS1A 3NTIA 4XAXB 3JB9H 2VGNA 4C0FA 1SSFA 2HBPA 1M3AA 2OJ2A 4J8OA 3OY9A 3CPWA 1UGPB 4EMGA 1GCQA 3PE0A 1YI2Q 3JSCA 4EDUA 3VS0A 2KQWA 4AG1C 1G3WA 3SD4A 4C8QB 1WHJA 1ZUUA 4OP0A 4NS5A 4E7SA 4PJOB 1ZA2B 2K57A 3LH5A 5A0GA 1VQPT 1TOVA 4GLKA 4OB2B 2J05A 2WACA 3CCUT 1QVPA 2H3JA 5KYWA 5J3BA 1BK2A 2RO0A 2IPOB 4M78C 2EKHA 1AZGB 2EFIA 2MIOA 1RLQC 1Y7XA 4PJJA 1K8AR 4LE9A 1KC8C 2XU8A 4ZTJA 3CCQA 4DQ2A 2QQRA 1NZ9A 3GNFB 1KD1C 2V8IA 1UHCA 3QYGB 2DL5A 3ASKA 2M1HA 5LJ5g 5LJ3e 2BKDN 5LJ5j 3M0RA 1WHMA 2PTKA 3RERA 3NPFA 1Z9QA 4LD6A 5GANd 3OYMA 2AT1B 1JXMA 2EPDA 3L2QA 2AHJB 1JEGA 1X27A 2DFUA 3PMTA 1Y96B 5KYYA 2ZPHB 2ZZDA 1VQ6Q 2EQKA 4RTXA 4ZGDB 1HJDA 4XTVA 3HRTA 4M7AB 3JB9G 4QQGA 2COZA 2RB6A 4ANJA 1Y0MA 1Y57A 2KXDA 4RTWA 4C92G 4WF2A 1AHJB 3RR6A 3E9GA 2M16A 3RDVA 4C0DC 3NGPA 1YWPA 1UGSB 1PD0A 2LCSA 1MMDA 4KBMB 2M0YA 3AT1B 3HKSA 2X3WD 4A4FA 1CKAA 3VYHB 4JS5A 3EG9B 5GAN3 2KSSA 2YRVA 2AK5A 3A1PA 2VXEA 2R5AA 4AFSC 1SPKA 1BI3A 2JMCA 3J7AF 4IURA 4E47A 3I55T 5IHKA 1F1BB 2YHTA 2K5IA 4CI0C 3CEYA 5A0DA 1OU9A 2FL7A 2F5TX 2EQMA 3FEOA 2KRSA 3X24B 5M9OA 3A8GB 2YDLA 5GMKi 4J6YA 5GANj 2KDSA 1JU5C 4JJBA 5KE3A 4KUDK 1V29B 1D09B 2FB7A 2CKKA 1JQQA 2SRCA 3CBOA 2JM9A 2BZXA 4DBQA 4C8QG 4M75E 2B8AA 3QZ5B 5KYXA 5LL6S 3EGUA 1M1GA 4BDZA 1YI2T 2X4WA 4BB7A 4BI3A 3HP9A 3OYFA 2QYZA 3A8MB 3O5ZA 2PUOB 3G6EA 4QKUA 3CCLQ 3WXMB 2MPXC 1YI2A 5CIUA 4PJOG 2KRMA 1UFFA 1HYOA 1MHNA 1C1AA 4AG2C 4PLIA 3JCMQ 1BCOA 2EYWA 3TU4K 1YJ9A 3G6EQ 5GAN4 1GCPA 2V26A 3IQLA 3RESA 3KFVA 1KHCA 4BI8B 4J5YA 3CC7A 3CCEQ 2O4XA 5FRMA 1S72Q 4IUQA 1T3LA 1VQNA 2AZSA 2COYA 4ORZA 2HBWA 3R6OA 3RKWA 3H0HA 1PSEA 1U3OA 4NOYA 5CO7A 3HSBA 4M4ZA 3CC7T 4LDYA 1YP5A 2YLBA 4FT4A 3TVTA 1UECA 1OPKA 2XG8D 4FYVB 4ZGJB 5EG2A 3C4SA 4JPBW 2VASA 3G4ST 2K6DA 3JCMd 1AOJA 1WA7A 2CZ0B 1G83A 5LJ3g 2F2XA 4FYWB 1W2BS 3I56A 3FB9A 1W6XA 3QXEB 4XQ3A 4PJOE 1VQKA 1FXXA 1SEMA 3G1JA 5J39A 3G6ET 1KIKA 2ZAEA 1PSFA 1YJ9Q 4M7DC 2LVMA 1QKXA 3REAB 3KBGA 1VYVA 2DX1A 2CDTA 4RTTA 1VQKQ 4OB1B 2DO3A 1MV0B 3CMAQ 2F1LA 3V8LA 4B9XA 8AT1B 3N5BB 1VQ5A 3OYJA 2DRKA 1ZSGA 1IHWA 4KUIA 3WVEB 2PVOB 1SHFA 4ZN1A 2RQVA 5FU7C 5HK0A 2EYXA 1IREB 3H0IA 4MZMA 1N27A 3EG3A 4PJLA 3VUBA 2RH2A 1NJIR 3A8OB 3CCVA 3OYKA 1YJ9T 4J9CA 2DTOA 3VKIA 3VS5A 1M90R 2AKKA 2LMJA 1WHKA 1FMWA 2LT1A 5KYYB 1LJOA 2K2MA 4AMCA 1AWOA 4F7UB 3FJ5A 4VUBA 2L3PA 3CC2T 4C92F 3VRYA 2RN8A 2V8KA 1ABQA 3LGFA 3JCMX 4BY6B 2DL4A 4J83A 5KYXB 2KRNA 3OA6A 1OV3A 1KJWA 2RPNA 5IN1A 3G4SA 3FIFA 2QA4A 3TEEA 1K8AC 4FU6A 2HSPA 3QDFA 3PFSA 4FT2A 4N0AC 2A7YA 1MMAA 2K3YA 2QTVA 4CRIA 3M54A 1NLPC 1R0CB 1WYXA 2X9HA 4C5HA 5L8RE 4M7DD 3FLGA 2O31A 3I5SA 2PUKB 1WHLA 1M2OA 2QASA 2GNCA 1SSHA 1K9MU 1K1ZA 2JXBA 1Y96A 2YRCA 1X43A 3M53A 2KY9A 2NUPA 2Y4XA 1X6OA 2E3HA 4M75F 2EYYA 4RMOA 1OYXA 1H3HA 2JVVA 3GLXA 3MEUA 3OYNA 2PU9B 1KHIA 2MCNA 4PK4A 1BBZA 1JB0E 2VYTA 5GAMd 2ATCB 2XKOC 1OPLA 2ESWA 5GANg 1RI0A 5KYWB 3TREA 2BE9B 5J26A 2KAFA 2GTOA 5LJ5d 5GAOq 3SEMA 1IGUA 4M7AA 3CCQQ 1P92A 1W4SA 2WSEE 2KXCA 3META 1D3BB 1N8RC 2K7AA 4AFUC 3M5AA 2JMAA 2P4RA 4PJOA 3M57A 4LDVA 2O2OA 2JTMA 1FMVA 2P84A 4A4GA 3LWIA 2FPEA 1WQWA 3G71Q 5GAN6 4OB3B 4EIKA 3OYAA 1QCFA 1M8VA 1TWBA 1ZUYA 1FMKA 4X34A 2L89A 1K0SA 1YJNA 1I5OB 2DXBA
chains in the Genus database with same CATH topology
1ZSZB 1OU9A 1OX9A 1OX8A 2QASA 2QAZA 1OU8A 1TWBA 1ZSZA 1OULA 1ZSZC 2NYSA 1YFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ B;  1OU9 A;  1OX9 A;  1OX8 A;  2QAS A;  2QAZ A;  1OU8 A;  1TWB A;  1ZSZ A;  1OUL A;  1ZSZ C;  2NYS A;  1YFN A; 
#chains in the Genus database with same CATH topology
 5CKD A;  2CYZ B;  4HVV A;  4MZP A;  3OQ5 A;  3SWN C;  1UJY A;  2E12 A;  4P5N A;  4Q5W A;  4LXC A;  3M59 A;  2CP6 A;  4C92 D;  3MP6 A;  1VA7 A;  1MV3 A;  4XTZ A;  1YJW Q;  2LQK A;  3RIR A;  1B07 A;  1EX4 A;  1QP2 A;  2DZC A;  2P4T A;  2MAM A;  1M8M A;  2LJ3 A;  1D0Z A;  1FYN A;  1E6H A;  3CCV Q;  1BI2 A;  4AFQ C;  3VS6 A;  4KUL A;  5KYN A;  2CP0 A;  2FO0 A;  4LN2 A;  4M78 G;  1K9A A;  5L23 A;  2QQS A;  3BDL A;  1BIA A;  3EFO A;  1G8X A;  2RQU A;  1ZUK A;  3HFO A;  2NUP B;  4BDY A;  5C6S A;  1G2B A;  4HKE A;  5GAO n;  2DIQ A;  3SB2 A;  3EGX B;  4M75 A;  4J9F A;  2HEQ A;  1WJS A;  4HA8 A;  2EWN A;  1RAA B;  1XJW B;  3L2W A;  1Q81 C;  3JV3 A;  2C0T A;  3RBB B;  3UT1 A;  2O01 E;  1YJW T;  2NUZ A;  4M78 E;  1QMC A;  3LLR A;  3A8L B;  2RA2 A;  2XDP A;  1U06 A;  5GAM g;  1HSQ A;  1HK9 A;  4J9E A;  4C8Q C;  2DL8 A;  2HQH A;  1B34 B;  1RLP C;  1ACM B;  1WGS A;  4J6W A;  4C0D B;  1MND A;  2F2W A;  1AD5 A;  4F17 A;  1UGR B;  3EGX A;  2P0Q A;  3OBW A;  4N0A A;  2DRM A;  5D6W A;  3M0S A;  2LC4 A;  3F70 A;  2PVG B;  3UAT A;  1PM3 A;  1RAG B;  1OX9 A;  2A08 A;  4F04 B;  3OS0 A;  1PWT A;  3H0F A;  4KT0 E;  2EIF A;  3C0C A;  1VQN T;  1N6A A;  3CPW P;  1Q7Y R;  2LT4 A;  1ZX6 A;  1NLO C;  1YHQ Q;  2OAW A;  4HT9 A;  4J7F A;  3I56 T;  4DA4 A;  2XD0 A;  1B3Q A;  4ELZ C;  1TH7 A;  4JDS A;  4EPC A;  1GBQ A;  1KQS A;  1TUC A;  4F14 A;  3FRN A;  4II1 A;  2DTH A;  4M7D F;  2OAU A;  2L0A A;  1G3Y A;  2GGR A;  4FYY B;  2DTI A;  4LD9 K;  4HCK A;  2XMF A;  2KK4 A;  3WVD B;  3NMZ C;  4ZTF A;  1WDX A;  1IHV A;  4M77 E;  3NFC A;  3PVL A;  2J6O A;  2VB6 A;  2RJD A;  2MWO A;  3PGG A;  1VQO A;  3VYG A;  3OB9 A;  1M5Q 1;  1QW1 A;  3MJX A;  1B7T A;  1YN8 A;  3MCA B;  3O8V A;  3LYI A;  1AT1 B;  1KQS P;  1X75 C;  5DLQ E;  3LGL A;  2DIL A;  3QWY A;  3EG0 A;  4OF1 A;  2VUB A;  1VQO T;  3DLL A;  2FZG B;  1R0B G;  5CCA A;  2KYB A;  1VQ9 T;  1VQL A;  4M7D B;  4FCY A;  1XNI A;  2QTX A;  2X4X A;  4C8Q E;  1QVG P;  4RG8 A;  2QEX A;  3FJP A;  1I81 A;  2ROL A;  4DOV A;  4BE1 A;  4M77 C;  4OVA A;  2HKQ B;  2K9G A;  2HSE B;  4FYX B;  2YXY A;  2J06 A;  2MF2 A;  4E7Z A;  5AYF A;  2HQE A;  1YBY A;  1RAD B;  5GAN h;  4B9W A;  3OSS C;  2YUP A;  3MEW A;  2M0O A;  2L3Q A;  3QO3 A;  1PNJ A;  3U23 A;  4M7A F;  5GAM e;  4JZ3 A;  1Y07 A;  4J6X A;  4E7K A;  3OYL A;  3GF5 A;  5FLX E;  2A36 A;  1AZE A;  2LJ0 A;  2HDA A;  2KVQ G;  3CCJ T;  3JRZ A;  3CCE A;  2EJG A;  1S72 A;  4PFZ A;  5GAM f;  5I21 A;  5DY9 A;  4GLM A;  3CCE T;  2Y90 A;  4JUV A;  1SRM A;  3TQ7 P;  4FL6 A;  2QEX Q;  5KE2 A;  1H8K A;  3P8H A;  1WZO A;  1NE8 A;  4D6W A;  4JRI A;  2ZPB B;  1Q86 R;  1MGQ A;  1XQH A;  3UDC A;  2FEI A;  2WSC E;  2H8H A;  1WJQ A;  2M9U A;  1IGQ A;  4C0Z A;  2MWP A;  2OTL A;  1YWO A;  3CME Q;  2DBM A;  3L1A A;  3CMA A;  2QA4 Q;  2Z0W A;  1VQ4 A;  4FSX A;  2QDL A;  4E7L A;  4JJC A;  5FU6 C;  3EFR A;  1M2V A;  1GFC A;  3OS2 A;  4M78 F;  4EMH A;  3FC3 A;  3CMA T;  4A63 B;  3OS1 A;  3VS4 A;  3EG2 A;  4L59 A;  2OTL T;  1KQ1 A;  5GAO r;  2D6F A;  2GBQ A;  3CCS T;  3E1S A;  1GRI A;  1HXD A;  1M27 C;  4DEX A;  1ZBX A;  5GMK e;  4M77 D;  3JB9 J;  3H6Z A;  3I35 A;  2R57 A;  3CC2 Q;  4D8K A;  4JJD A;  3UF4 A;  4C5G A;  1WI7 A;  3EGD A;  5I2M A;  4A4E A;  3E2U A;  1N9R A;  2GF7 A;  3JCM b;  2R58 A;  2VKN A;  2ZCF B;  3P8D A;  4CC7 A;  1K9M C;  2DBK A;  3OYI A;  5GAO m;  1TSF A;  3QPH A;  4IIM A;  1YJN Q;  1KQS S;  4M78 B;  2QQ9 A;  4JLI A;  2VXF A;  1JBM A;  2JOY A;  2YT6 A;  4BE0 A;  2P0P A;  2E65 A;  4XTU A;  2RJE A;  1LNX A;  3QJY A;  4JRQ A;  1VQ4 Q;  3JAM E;  4K11 A;  1H3Z A;  2XK0 A;  4ZGE B;  1QVG S;  2OTL Q;  2ZGW A;  2JS0 A;  1WXT A;  5CKF A;  3PNW C;  1K73 U;  3E19 A;  4Y91 A;  2JZ2 A;  2BE7 D;  3BDU A;  4M75 B;  4C0G A;  5D6Y A;  2E4H A;  4J9D A;  2EBP A;  1BYM A;  4KGZ B;  4QT7 A;  3QHS A;  2AZV A;  2IIM A;  4RTY A;  2RK1 A;  3JB9 F;  1ZHI A;  1M4Z A;  3JB9 D;  2RQW A;  3H41 A;  4FM4 B;  1VIF A;  1TUG B;  1N8R U;  3X25 B;  4IUP A;  1OQK A;  3SHW A;  1DJ7 B;  3M0P A;  2WSF E;  4O5V A;  2BIV A;  3EG9 A;  2XDD A;  1ABO A;  1W70 A;  2RK2 A;  1B34 A;  4BD3 A;  3I55 Q;  4M77 G;  3NHN A;  4E7H A;  3OYY A;  3I56 Q;  1N5Z A;  2RF0 A;  3BE3 A;  2VWF A;  3DB4 A;  4PFO A;  2KBT A;  1Q82 U;  5CKE A;  2NUT B;  3M0U A;  3OYE A;  2LP5 A;  4CC3 A;  3KXT A;  4IUT A;  3CCJ A;  3S6W A;  1WHH A;  2FHD A;  2CP2 A;  3JCM W;  1RI9 A;  2DXU A;  5CR2 A;  1JJ2 S;  4N4H A;  1XOV A;  2DAQ A;  1IXD A;  2CRE A;  1RUW A;  2MYS A;  4KGV B;  4OB0 B;  4C92 B;  2KRO A;  3QWX X;  3URG A;  4M7D E;  2CUD A;  2MOX A;  1TUD A;  1VQP Q;  3ZEH A;  4ATO A;  2VVK A;  1AWW A;  1PD1 A;  5D7U A;  3V7C A;  2COW A;  5GAN 8;  2RI3 A;  2JTE A;  4Z88 A;  4FW2 A;  1YHQ T;  4JS4 A;  2HD0 A;  5IHI A;  4J9H A;  3C95 A;  2X4Y A;  2KT1 A;  1IRX A;  3EH2 A;  1AWX A;  4AT1 B;  1D1A A;  3JCM P;  1UJ0 A;  5FWB A;  4IUV A;  2J7I A;  4AFZ C;  3JB9 I;  2W0Z A;  4QVC A;  1KK7 A;  2RM4 A;  3V8K A;  2DIG A;  1QP3 A;  4PJO C;  4C8Q F;  1OZ3 A;  3PTA A;  3MO8 A;  4HVU A;  1UEB A;  1Q81 U;  1D1B A;  2RI5 A;  4ZNX A;  1NPP A;  2MMP A;  1SF9 A;  2X35 A;  4PLL A;  4A4K A;  4HCB A;  2RHY A;  5KYU B;  1N8R R;  1VQ7 A;  2IVW A;  3NTK A;  1VQ6 T;  5GAN e;  3LWH A;  2GQV A;  4C92 A;  2H3E B;  3S3M A;  4OMN A;  1M90 C;  2DYB A;  3I5R A;  4XTY A;  2LZ6 B;  1NEB A;  3C94 A;  5CKB A;  4F7U E;  5LJ5 e;  5LJ3 f;  1WIE A;  1QKW A;  3NTH A;  3QKJ A;  1M3B A;  1PHT A;  1TXQ A;  1VQN Q;  4HT8 A;  2LQ8 A;  3QZ9 B;  1U1T A;  5GMK l;  1BIB A;  1X2Q A;  3UPU A;  3JCM h;  1V1C A;  2EGC A;  2P0K A;  4QVZ A;  1Q7Y U;  2GCX A;  2OTJ T;  6AT1 B;  4MMK A;  1G3S A;  2DVJ A;  2CT3 A;  2AKL A;  1W2B P;  1OUL A;  1NYG A;  2GTJ A;  2HNI A;  2V8J A;  2XIC A;  2BZ8 A;  1IB8 A;  2GQI A;  2G6F X;  1TG0 A;  4LDW A;  2QXF A;  4PJO D;  1H92 A;  2EJF A;  1WJR A;  1AVZ C;  4DOW A;  2BUD A;  2EQU A;  4ESR A;  1GL5 A;  1YIJ T;  2IG0 A;  4E7J A;  1LVK A;  2DZ9 A;  2CGH A;  4XU3 A;  5CAI A;  5GAO l;  4M75 C;  1JO8 A;  5FW9 A;  3CCS Q;  2YSQ A;  4HVW A;  2J6F A;  3ZL7 C;  2HKN A;  1HD3 A;  2FYK A;  4C5E A;  5GJW B;  2DJQ A;  2K5F A;  2KEA A;  1UB4 A;  3EH1 A;  5GMK h;  3CCV T;  1YIT T;  1Q86 U;  1QWF A;  3PVQ A;  1I0C A;  4FW1 A;  2A37 A;  2O9V A;  2VGM A;  2R5M A;  2QQA A;  1I07 A;  1NJI C;  1LCK A;  4Y28 E;  1UUE A;  4PKC C;  1GBR A;  4WTO B;  4HCZ A;  5KH6 A;  3CXC S;  1ZSZ C;  3UA6 A;  3CCU Q;  1H64 1;  1X2K A;  2JM8 A;  1UDL A;  4IIO A;  2HMA A;  3CCL A;  2CT4 A;  5GMK m;  3OYB A;  1WFW A;  1X6B A;  1YJW A;  2DEQ A;  1UGV A;  2YWW A;  2K4Y A;  3L2Z A;  3GOX A;  2K3X A;  4PJM A;  1MMN A;  2PZ1 A;  3S3O A;  4R55 A;  2E5K A;  2QG9 B;  3EHQ A;  2GFU A;  5GAN 7;  5D6X A;  3UWN A;  1Y71 A;  1VQP A;  4OML A;  2ECZ A;  5HKC A;  3M0T A;  1WX6 A;  2RI2 A;  5IH2 A;  3DKM A;  1VQL Q;  5I2S A;  1I8F A;  2LNH B;  2CSI A;  3CCR A;  1N9S A;  3H8Z A;  2JNG A;  4J7I A;  2C0O A;  3GBQ A;  3QJ6 A;  2E70 A;  3EAE A;  4PNO A;  1BI0 A;  2A0F B;  4BE2 A;  4JJN K;  3OW2 A;  1VQO Q;  3JCM e;  3OW2 S;  4MML A;  1X01 A;  2ZPG B;  2CP7 A;  1PRL C;  1M1K R;  5FRN A;  1VQ6 A;  2BZY A;  4KRT A;  1OU8 A;  2DXT A;  1VYT A;  1VIE A;  3PIP A;  1M1K U;  2LX7 A;  2V1Q A;  2EGE A;  1PRM C;  3GIB A;  3L2U A;  4WCI A;  2CZ7 B;  5IT9 E;  2DLP A;  1CKB A;  4D8D A;  3ME9 A;  4OMF B;  1X69 A;  2XDB A;  1VQM Q;  4M77 A;  4E2F B;  5LJ3 d;  1PG5 B;  3CC4 A;  5LJ5 f;  3SWN B;  1TS9 A;  3QDR B;  3THK A;  4M75 G;  1J3T A;  2CUB A;  1QVF P;  1ZQ1 A;  1QLY A;  1YFN A;  2M02 A;  2DJZ A;  5GAN f;  3V7R A;  1M1F A;  1VQ7 Q;  1D0X A;  2FZC B;  1VQ8 Q;  1VQ9 A;  1VQL T;  1T0H A;  2Y4Y A;  1C6V X;  1YIT A;  1Q82 R;  4L5G A;  4CC4 B;  3CCR Q;  3CD6 Q;  2MK5 A;  5EC7 A;  3OYG A;  1Q86 C;  2CH4 W;  4EMK C;  4BI4 A;  2RHI A;  2RJC A;  2V1R A;  3ULR B;  3ZBD A;  1CSK A;  2FRW A;  5IXB A;  2A28 A;  4PJO F;  2YUO A;  5GAO p;  1NBE B;  4C5I A;  4R56 A;  2LRQ A;  3LH0 A;  5LJ5 h;  4BY6 C;  2M51 A;  3JCM V;  2KYM A;  4RCB A;  2F2V A;  1RAI B;  2F69 A;  2EQI A;  1E6G A;  2X3X D;  5FU7 B;  1QVF S;  1AEY A;  2D8H A;  2DKG A;  5GAM h;  4RTU A;  3E9F A;  2PNI A;  3RKX A;  4DBH A;  3QII A;  4DBR A;  1U1S A;  1KC8 R;  2RNA A;  3OMG A;  1OEB A;  3TSZ A;  3CQT A;  3Q1J A;  2PQW A;  4KH1 B;  4OMO A;  3CME A;  3M4Y A;  5IXF A;  1M9S A;  1QVG A;  1SHG A;  2K3B A;  2FVU A;  5CKH A;  4F7U A;  4OMP A;  2ZPF B;  5IHN A;  5CVI A;  3CCM Q;  2DK3 A;  3LX7 A;  2K5L A;  4M75 D;  3CBM A;  4C92 C;  1YIT Q;  4R0K A;  4JRK A;  4X1V A;  4Z89 A;  1IO6 A;  3HFN A;  1VQ5 Q;  1TTH B;  1ZSZ B;  1OX8 A;  1GCQ C;  2CZ6 B;  2DA9 A;  2CSQ A;  3HRU A;  2KNB B;  4ME7 A;  1R77 A;  5GAN 5;  3ZFJ A;  1M2V B;  2DYI A;  4M77 F;  2DET A;  2ZPI B;  2ROT A;  3D7S B;  1U5S A;  4HXJ A;  1PC0 A;  3A5Z B;  1NM7 A;  2JS2 A;  2LTO A;  4E7I A;  1UTI A;  2LDM A;  3CCL T;  3RUX A;  3V7S A;  1OI1 A;  2D1X A;  4M78 D;  3UA7 A;  1KD1 R;  2OX7 A;  2FRY A;  2RMO A;  2DL3 A;  2DVE A;  1W1F A;  4N4G A;  2D8J A;  3TSW A;  2CH4 A;  2ZPE B;  4MDX A;  2JW4 A;  5CQX A;  2SEM A;  2OTJ Q;  4V2S A;  3L42 A;  1D3B A;  1SRL A;  1V76 A;  3X20 B;  1M30 A;  4EMK B;  2QDY B;  3JCM f;  2KE9 A;  2E64 A;  4PL6 A;  2DL7 A;  4KGX B;  4FSS A;  3CC4 T;  3QUI A;  4XU1 A;  4JZ4 A;  2HQX A;  3PIO A;  1MUZ A;  1MNE A;  2DPP B;  2DNU A;  4BUG A;  3H9N A;  5A2Q E;  4NL3 A;  3CXC P;  3FDR A;  2RHX A;  3CC4 Q;  1WQ7 A;  2J6K A;  3MPU B;  3L2V A;  3MEV A;  3RMQ A;  4M7A D;  2BTT A;  2QEX T;  3HTR A;  3M9Q A;  2DER A;  2XI9 A;  5I22 A;  1ZSZ A;  1M90 U;  3RMS A;  2KT8 A;  4F7U F;  1I5L A;  2JJ9 A;  1Q7Y C;  4LUE A;  2LQN A;  1NYF A;  2EJ9 A;  3PMI A;  4LDU A;  1TU0 B;  5A0L A;  1Z9Z A;  1EFN A;  3LW5 E;  1ZLM A;  2VC8 A;  3QYH B;  1ZBJ A;  3GNG A;  1K76 A;  2LCC A;  1PCX A;  2HL3 A;  3DLM A;  3OSV A;  4CC2 A;  2D9T A;  3VS2 A;  4MDW A;  3RNJ A;  1BKB A;  3CXC A;  2I2L A;  2E6Z A;  1YIJ A;  2EAY A;  2G3R A;  3M0Q A;  4X9C A;  1OOT A;  2B86 A;  5HY6 A;  2EYZ A;  2QK0 A;  4J9G A;  2DMO A;  3KUF A;  1D1C A;  2QGG A;  3SDZ A;  2KI7 A;  1WXB A;  1A0N B;  3M58 A;  1R8O B;  4M7A G;  1SKU B;  2LQW A;  1KD1 U;  1GXI E;  3VV0 A;  4Z02 A;  1KC8 U;  2ABL A;  2DXC A;  5GJV B;  3OYH A;  1NPR A;  2ED1 A;  1EZZ B;  4LNP A;  3I55 A;  3VRZ A;  3OW2 P;  3GP8 A;  2E6N A;  4X9D A;  2RQR A;  2O88 A;  3CCM T;  4IUU A;  3T9N A;  3VUZ A;  3QG1 A;  1KG1 A;  1G5V A;  2ED0 A;  2YRD A;  3HPW A;  3HRS A;  4RUG A;  4YTL A;  4TVR A;  2JUF A;  1VUB A;  2HL5 C;  3BY7 A;  5DM7 R;  4OMM A;  1YIJ Q;  4QW2 A;  2I0N A;  2RHZ A;  1YNZ A;  1K9M R;  2X51 A;  2KGT A;  3EHR A;  3CCM A;  1AWJ A;  3P8B B;  4A53 A;  1KFZ A;  1KSW A;  4A54 A;  3RKY A;  2XID A;  1VQ8 A;  3MEA A;  5ECA A;  5DLO A;  2EGA A;  3BFM A;  5FWC A;  3VU3 C;  5LJ3 j;  4E6R A;  1NEG A;  2DF6 A;  3EFS A;  5GAN 2;  3X28 B;  3CPF A;  1K4U S;  2LX9 A;  3G71 A;  2K2V A;  2FZK B;  3A98 A;  4GY5 A;  3M55 A;  4ZN3 A;  2A3L A;  4DEY A;  3G71 T;  4JLG A;  4RKU E;  2DEU A;  3BW1 A;  1YCS B;  3MHX A;  2CZ1 B;  1WPY A;  1JXO A;  2FG0 A;  4M78 A;  4NL2 A;  3OYC A;  3CD6 T;  2HZY A;  1YHQ A;  2OTJ A;  4LUD A;  4XTW A;  1BI1 A;  2FPF A;  4QVD A;  1MMG A;  2NWM A;  1NG2 A;  1T0J A;  3TCJ A;  3CPW S;  4DBF A;  3I9Q A;  4BAC A;  4RCC A;  4C92 E;  3J81 E;  2OI3 A;  1VOM A;  1NJI U;  1BU1 A;  5HK3 A;  3REB B;  5I11 A;  1OZ2 A;  1BB9 A;  2CS7 A;  2KMT A;  1VQ5 T;  1SG5 A;  1T3S A;  3M4G A;  3CC7 Q;  2EKO A;  4M7D A;  4FIB A;  2D0Q B;  1LPL A;  4EMK A;  2L2P A;  4OMQ A;  1M1K C;  4MZT A;  1VQ4 T;  2YLC A;  3HL8 A;  1Q95 G;  1I1J A;  3OMC A;  4C8Q A;  2HCK A;  3HHT B;  1U8R A;  2W10 A;  1VQK T;  2VV5 A;  4XK8 E;  2QGF B;  1VQ8 T;  3MKD A;  9ATC B;  5IAY A;  3CCQ T;  1PKT A;  2JN0 A;  2YUN A;  5AT1 B;  3CCR T;  3OBY A;  4F16 A;  1S1N A;  2NYS A;  4N4I A;  1C0M A;  2RQT A;  1VYU A;  2DE0 X;  3MP1 A;  2EYQ A;  5GAM j;  2DD5 A;  3SFM A;  2XHC A;  2DD4 A;  2GFA A;  2NUT A;  1QVF A;  3INZ A;  1RL2 A;  1QCN A;  2EVR A;  2L3R A;  3L2R A;  2QI2 A;  1Q82 C;  3G4S Q;  4A4H A;  4J9I A;  8ATC B;  2E10 A;  2K79 A;  2MI6 A;  1FWZ A;  4L6V 5;  2L5Q A;  1FX7 A;  2DM1 A;  1KQ2 A;  5FU6 B;  2L3S A;  2RHU A;  2ENM A;  3CCJ Q;  1JJ2 P;  1RAC B;  2E41 A;  1QQJ A;  1RAF B;  3CCS A;  2QAZ A;  4M7A E;  2C06 A;  1WNL A;  4XU0 A;  3S3N A;  3X26 B;  2YUQ A;  3PT9 A;  7AT1 B;  2C0I A;  4JRP A;  1RAB B;  4O6J A;  4M7D G;  2CP5 A;  1YCY A;  1X6G A;  3CBP A;  3EGD B;  4C8Q D;  4ELY C;  1WHG A;  2L8D A;  1WLP B;  1UHF A;  1VQ9 Q;  1VQM T;  2PVD B;  1D0Y A;  3MP8 A;  4LDX A;  3G7Z A;  2HAX A;  1O75 A;  3OYD A;  3CD6 A;  2E3I A;  3JCM g;  1JJ2 A;  5C0M A;  1W2B A;  2D0N A;  1WXU A;  2E1H A;  2X4J A;  5HCK A;  4KH0 B;  2QA4 T;  4PFP A;  1E7O A;  1VQM A;  3AHU A;  5LJ3 h;  2LNV A;  3J80 E;  5KCO A;  3QBY A;  1JRI A;  2JTF A;  3DB3 A;  4HCC A;  1YJN T;  5CK9 A;  3CC2 A;  3OS5 A;  5CQY A;  4XU2 A;  3VS7 A;  3VJP A;  4QQ6 A;  4XTX A;  1K0X A;  3EG1 A;  3QSU A;  3ER0 A;  4M7A C;  4OGE A;  3VS3 A;  1UGQ B;  1I4K 1;  1Q81 R;  2LCL A;  5FRO A;  4B6M A;  1UG1 A;  4PJN A;  4Z8A A;  3EFO B;  1RAE B;  2O9S A;  2RJF A;  4RTZ A;  1PKS A;  3JCM c;  1EIF A;  3C12 A;  3V8J A;  2AIR B;  3JCM J;  3CCU A;  2FPD A;  1ZA1 B;  4QQD A;  3GPL A;  4J9B A;  1K8A U;  1XTD A;  2RD1 A;  1S72 T;  4GBQ A;  1QCO A;  5GMK j;  2EQJ A;  4UC4 A;  1ARK A;  2LJ1 A;  1VQ7 T;  1IZ6 A;  1G3T A;  1M3C A;  2O4X B;  2JT4 A;  1QWE A;  3CME T;  4OGC A;  2QQB A;  3A8H B;  2KR3 A;  5KCH A;  1GFD A;  4M77 B;  2CP3 A;  1RAH B;  3R6N A;  4F7U G;  1K73 R;  3SWN A;  1O9S A;  2EW3 A;  4RTV A;  1BCM A;  3M56 A;  4IKF A;  1LOJ A;  4RG2 A;  1UE9 A;  5KYU A;  2NLU A;  2E5Q A;  1K73 C;  2F5K A;  4Y92 A;  3VS1 A;  3NTI A;  4XAX B;  3JB9 H;  2VGN A;  4C0F A;  1SSF A;  2HBP A;  1M3A A;  2OJ2 A;  4J8O A;  3OY9 A;  3CPW A;  1UGP B;  4EMG A;  1GCQ A;  3PE0 A;  1YI2 Q;  3JSC A;  4EDU A;  3VS0 A;  2KQW A;  4AG1 C;  1G3W A;  3SD4 A;  4C8Q B;  1WHJ A;  1ZUU A;  4OP0 A;  4NS5 A;  4E7S A;  4PJO B;  1ZA2 B;  2K57 A;  3LH5 A;  5A0G A;  1VQP T;  1TOV A;  4GLK A;  4OB2 B;  2J05 A;  2WAC A;  3CCU T;  1QVP A;  2H3J A;  5KYW A;  5J3B A;  1BK2 A;  2RO0 A;  2IPO B;  4M78 C;  2EKH A;  1AZG B;  2EFI A;  2MIO A;  1RLQ C;  1Y7X A;  4PJJ A;  1K8A R;  4LE9 A;  1KC8 C;  2XU8 A;  4ZTJ A;  3CCQ A;  4DQ2 A;  2QQR A;  1NZ9 A;  3GNF B;  1KD1 C;  2V8I A;  1UHC A;  3QYG B;  2DL5 A;  3ASK A;  2M1H A;  5LJ5 g;  5LJ3 e;  2BKD N;  5LJ5 j;  3M0R A;  1WHM A;  2PTK A;  3RER A;  3NPF A;  1Z9Q A;  4LD6 A;  5GAN d;  3OYM A;  2AT1 B;  1JXM A;  2EPD A;  3L2Q A;  2AHJ B;  1JEG A;  1X27 A;  2DFU A;  3PMT A;  1Y96 B;  5KYY A;  2ZPH B;  2ZZD A;  1VQ6 Q;  2EQK A;  4RTX A;  4ZGD B;  1HJD A;  4XTV A;  3HRT A;  4M7A B;  3JB9 G;  4QQG A;  2COZ A;  2RB6 A;  4ANJ A;  1Y0M A;  1Y57 A;  2KXD A;  4RTW A;  4C92 G;  4WF2 A;  1AHJ B;  3RR6 A;  3E9G A;  2M16 A;  3RDV A;  4C0D C;  3NGP A;  1YWP A;  1UGS B;  1PD0 A;  2LCS A;  1MMD A;  4KBM B;  2M0Y A;  3AT1 B;  3HKS A;  2X3W D;  4A4F A;  1CKA A;  3VYH B;  4JS5 A;  3EG9 B;  5GAN 3;  2KSS A;  2YRV A;  2AK5 A;  3A1P A;  2VXE A;  2R5A A;  4AFS C;  1SPK A;  1BI3 A;  2JMC A;  3J7A F;  4IUR A;  4E47 A;  3I55 T;  5IHK A;  1F1B B;  2YHT A;  2K5I A;  4CI0 C;  3CEY A;  5A0D A;  1OU9 A;  2FL7 A;  2F5T X;  2EQM A;  3FEO A;  2KRS A;  3X24 B;  5M9O A;  3A8G B;  2YDL A;  5GMK i;  4J6Y A;  5GAN j;  2KDS A;  1JU5 C;  4JJB A;  5KE3 A;  4KUD K;  1V29 B;  1D09 B;  2FB7 A;  2CKK A;  1JQQ A;  2SRC A;  3CBO A;  2JM9 A;  2BZX A;  4DBQ A;  4C8Q G;  4M75 E;  2B8A A;  3QZ5 B;  5KYX A;  5LL6 S;  3EGU A;  1M1G A;  4BDZ A;  1YI2 T;  2X4W A;  4BB7 A;  4BI3 A;  3HP9 A;  3OYF A;  2QYZ A;  3A8M B;  3O5Z A;  2PUO B;  3G6E A;  4QKU A;  3CCL Q;  3WXM B;  2MPX C;  1YI2 A;  5CIU A;  4PJO G;  2KRM A;  1UFF A;  1HYO A;  1MHN A;  1C1A A;  4AG2 C;  4PLI A;  3JCM Q;  1BCO A;  2EYW A;  3TU4 K;  1YJ9 A;  3G6E Q;  5GAN 4;  1GCP A;  2V26 A;  3IQL A;  3RES A;  3KFV A;  1KHC A;  4BI8 B;  4J5Y A;  3CC7 A;  3CCE Q;  2O4X A;  5FRM A;  1S72 Q;  4IUQ A;  1T3L A;  1VQN A;  2AZS A;  2COY A;  4ORZ A;  2HBW A;  3R6O A;  3RKW A;  3H0H A;  1PSE A;  1U3O A;  4NOY A;  5CO7 A;  3HSB A;  4M4Z A;  3CC7 T;  4LDY A;  1YP5 A;  2YLB A;  4FT4 A;  3TVT A;  1UEC A;  1OPK A;  2XG8 D;  4FYV B;  4ZGJ B;  5EG2 A;  3C4S A;  4JPB W;  2VAS A;  3G4S T;  2K6D A;  3JCM d;  1AOJ A;  1WA7 A;  2CZ0 B;  1G83 A;  5LJ3 g;  2F2X A;  4FYW B;  1W2B S;  3I56 A;  3FB9 A;  1W6X A;  3QXE B;  4XQ3 A;  4PJO E;  1VQK A;  1FXX A;  1SEM A;  3G1J A;  5J39 A;  3G6E T;  1KIK A;  2ZAE A;  1PSF A;  1YJ9 Q;  4M7D C;  2LVM A;  1QKX A;  3REA B;  3KBG A;  1VYV A;  2DX1 A;  2CDT A;  4RTT A;  1VQK Q;  4OB1 B;  2DO3 A;  1MV0 B;  3CMA Q;  2F1L A;  3V8L A;  4B9X A;  8AT1 B;  3N5B B;  1VQ5 A;  3OYJ A;  2DRK A;  1ZSG A;  1IHW A;  4KUI A;  3WVE B;  2PVO B;  1SHF A;  4ZN1 A;  2RQV A;  5FU7 C;  5HK0 A;  2EYX A;  1IRE B;  3H0I A;  4MZM A;  1N27 A;  3EG3 A;  4PJL A;  3VUB A;  2RH2 A;  1NJI R;  3A8O B;  3CCV A;  3OYK A;  1YJ9 T;  4J9C A;  2DTO A;  3VKI A;  3VS5 A;  1M90 R;  2AKK A;  2LMJ A;  1WHK A;  1FMW A;  2LT1 A;  5KYY B;  1LJO A;  2K2M A;  4AMC A;  1AWO A;  4F7U B;  3FJ5 A;  4VUB A;  2L3P A;  3CC2 T;  4C92 F;  3VRY A;  2RN8 A;  2V8K A;  1ABQ A;  3LGF A;  3JCM X;  4BY6 B;  2DL4 A;  4J83 A;  5KYX B;  2KRN A;  3OA6 A;  1OV3 A;  1KJW A;  2RPN A;  5IN1 A;  3G4S A;  3FIF A;  2QA4 A;  3TEE A;  1K8A C;  4FU6 A;  2HSP A;  3QDF A;  3PFS A;  4FT2 A;  4N0A C;  2A7Y A;  1MMA A;  2K3Y A;  2QTV A;  4CRI A;  3M54 A;  1NLP C;  1R0C B;  1WYX A;  2X9H A;  4C5H A;  5L8R E;  4M7D D;  3FLG A;  2O31 A;  3I5S A;  2PUK B;  1WHL A;  1M2O A;  2QAS A;  2GNC A;  1SSH A;  1K9M U;  1K1Z A;  2JXB A;  1Y96 A;  2YRC A;  1X43 A;  3M53 A;  2KY9 A;  2NUP A;  2Y4X A;  1X6O A;  2E3H A;  4M75 F;  2EYY A;  4RMO A;  1OYX A;  1H3H A;  2JVV A;  3GLX A;  3MEU A;  3OYN A;  2PU9 B;  1KHI A;  2MCN A;  4PK4 A;  1BBZ A;  1JB0 E;  2VYT A;  5GAM d;  2ATC B;  2XKO C;  1OPL A;  2ESW A;  5GAN g;  1RI0 A;  5KYW B;  3TRE A;  2BE9 B;  5J26 A;  2KAF A;  2GTO A;  5LJ5 d;  5GAO q;  3SEM A;  1IGU A;  4M7A A;  3CCQ Q;  1P92 A;  1W4S A;  2WSE E;  2KXC A;  3MET A;  1D3B B;  1N8R C;  2K7A A;  4AFU C;  3M5A A;  2JMA A;  2P4R A;  4PJO A;  3M57 A;  4LDV A;  2O2O A;  2JTM A;  1FMV A;  2P84 A;  4A4G A;  3LWI A;  2FPE A;  1WQW A;  3G71 Q;  5GAN 6;  4OB3 B;  4EIK A;  3OYA A;  1QCF A;  1M8V A;  1TWB A;  1ZUY A;  1FMK A;  4X34 A;  2L89 A;  1K0S A;  1YJN A;  1I5O B;  2DXB A; 
#chains in the Genus database with same CATH homology
 1ZSZ B;  1OU9 A;  1OX9 A;  1OX8 A;  2QAS A;  2QAZ A;  1OU8 A;  1TWB A;  1ZSZ A;  1OUL A;  1ZSZ C;  2NYS A;  1YFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...