2NYSA

X-ray crystal structure of protein agr_c_3712 from agrobacterium tumefaciens. northeast structural genomics consortium target atr88.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QDHIRYDILAQDALRGVIRKVLGEVAATGRLPGDHHFFITFLTGAPGVRISQHLKSKYAEQMTIVIQHQFWDMKVTETGFEIGLSFSDTPEKLVIPYNAIRGFYDPSVNFELEFDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein AGR_C_3712 from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
molecule keywords AGR_C_3712p
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04386 SspB Stringent starvation protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2nysA00
2QAZA 1OULA 2QASA 1TWBA 1YFNA 1OU9A 1ZSZA 1ZSZC 1OX9A 1ZSZB 1OU8A 1OX8A 2NYSA
chains in the Genus database with same CATH superfamily
4XTYA 3TEEA 2RH2A 1YJNQ 3V8KA 5CCAA 5GAN7 1IHWA 3IQLA 4IKFA 1CKAA 1VUBA 1QKXA 4BB7A 3KBGA 1K9AA 1SSHA 4A63B 4AMCA 1VQKA 3QUIA 1AWJA 2AZVA 4JPBW 1IGQA 3FRNA 1OULA 2NUPA 1MHNA 2VB6A 4LDYA 4QVCA 3TU4K 1VQNQ 4Z88A 5GMKe 4E2FB 1JJ2A 4J9EA 4N4GA 3BDUA 1WQWA 1D0XA 1MGQA 3GBQA 4N4IA 4PFZA 1CKBA 3JCMh 4FYXB 4OMOA 3CC7T 2C0TA 1VQOA 1TH7A 2RQUA 1Q86R 2RHYA 1ZSZC 2O31A 5IT9E 5GAMj 1GFDA 3M58A 4PK4A 4LXCA 2OX7A 4PJOG 3H0HA 1GCPA 3G7ZA 2P4RA 1W2BA 4PFPA 1S1NA 1SSFA 1XJWB 2E65A 4M75A 4C8QG 5HKCA 4FT4A 5LJ5g 2QG9B 3T9NA 3J7AF 1UUEA 4PJMA 3NGPA 3QDRB 5LJ3g 2ENMA 2X51A 3CCLQ 2PTKA 3RIRA 2JNGA 3SHWA 1MMNA 3JCMV 3HP9A 4M75D 2AK5A 2RNAA 4DEYA 3CMET 2M0OA 1AWOA 3EG2A 3OSVA 5GANj 2MIOA 1MMGA 3G1JA 1YJNT 5FW9A 2JM8A 4EMHA 3PMIA 1WDXA 2ROTA 2AHJB 4QVZA 4PFOA 4XTWA 1D1CA 4M77C 3JCMP 4C8QE 1I5LA 1G3WA 2JS0A 5LJ5j 5KCOA 1RACB 1Q81R 1JB0E 2FG0A 1SRLA 4ZTFA 2DMOA 3CCVT 5GAMh 2LNVA 2DZCA 1YJWA 1VQ9Q 3REAB 1Q81U 4OB2B 2E3HA 3CC7Q 1HSQA 3QYHB 2LJ3A 3C12A 2DERA 4II1A 4XU3A 1I81A 3RERA 1HD3A 4NL2A 1X01A 3SD4A 4QQDA 4JJBA 3CC2Q 2JT4A 3BFMA 2FPEA 4M7AB 1T0HA 2HEQA 1XNIA 3LX7A 5M9OA 1Y0MA 2DA9A 4F16A 1QCNA 1BIAA 1WPYA 2EIFA 1V76A 1GCQA 4ZN3A 3QPHA 2P0PA 4KT0E 9ATCB 2EAYA 3CC4T 2D9TA 2BZ8A 1TU0B 4C8QC 1QMCA 1JEGA 3MHXA 3A8LB 1UECA 3G6EQ 3I9QA 4FW1A 1WGSA 2DXUA 2RI3A 5GAOp 4ZGEB 3LLRA 1JJ2P 2E6NA 2JJ9A 3GNGA 2RI2A 4FL6A 4XAXB 2HD0A 3OYEA 1K9MR 3RESA 2NLUA 2F2WA 5LJ5h 4ELYC 1UGVA 2ZCFB 5CR2A 4A4HA 4E7IA 1VQ8A 2PUOB 2JW4A 4VUBA 5KYUB 1PD0A 3M0UA 1SKUB 3CCUT 3M0TA 4R55A 1RAEB 4AG2C 4BI8B 1EX4A 3F70A 1YN8A 4DOVA 4PLIA 3L2VA 3GNFB 2VC8A 4C5IA 2RQRA 4IIMA 2RI5A 3EGUA 3UATA 2RJEA 1OYXA 1BI3A 2COZA 1SHFA 1UTIA 3SFMA 1AWWA 4XTZA 3REBB 4M7AA 3RKYA 3GF5A 3PGGA 2XDBA 3JCMg 3ZFJA 4XQ3A 1Y96A 4O6JA 1FXXA 2JTMA 2RM4A 3G6EA 3MKDA 2VVKA 3KXTA 1PM3A 3L2ZA 1ZHIA 4BDZA 2W0ZA 1WZOA 2EBPA 2DEQA 2CP0A 1Q95G 4HVVA 3J80E 5GAN4 2O4XA 1K8AC 3QYGB 2DYIA 1WXBA 1RAHB 4Y91A 2EQUA 2DD4A 3TCJA 2DJQA 1E7OA 3RDVA 3JCMb 5GAN8 2HKNA 2PUKB 4KGVB 2AT1B 2O9SA 5A0GA 5GANg 2BTTA 5GAMd 1YWOA 2K9GA 2HQHA 2SRCA 5GAMe 1K73U 1VIEA 3EFSA 4JLGA 3G4SQ 4FW2A 3JB9F 2KROA 1B34A 2P0KA 3ZEHA 3L2UA 4JJDA 3CMAA 5I2SA 4JS4A 1UGRB 4JRKA 1H92A 2A0FB 2E6ZA 4B9WA 1JRIA 4YTLA 1YJNA 5HY6A 2FL7A 3SEMA 2PU9B 2JTEA 5CQYA 1W70A 5FRMA 2X4JA 1VQPQ 4NOYA 3CCUQ 1M3BA 3WXMB 1C1AA 2GQIA 1YJ9T 1W4SA 1WYXA 1IGUA 3A8MB 5CKHA 3EH2A 4J8OA 3OS2A 2FRYA 4DOWA 2EJFA 3LH5A 4MDXA 4IUTA 3EHQA 2H3JA 4JRQA 4F17A 2LQWA 4PJOB 1S72Q 2RQTA 2EGAA 4NS5A 1VQOT 3CCJT 3OYFA 2BE7D 3JSCA 5CKFA 5D7UA 2DF6A 3OS5A 3JCMW 2LJ1A 5GANd 3JB9G 1X69A 3L2QA 2F5KA 2EYZA 4RTXA 3HTRA 3JB9I 3A98A 2DAQA 3OYJA 3LW5E 2YRVA 4EIKA 1QVGS 5HK0A 1IREB 1PNJA 3PVLA 4Q5WA 4IURA 2XG8D 1YHQA 2DLPA 1FMWA 1YP5A 2YRDA 2DX1A 3VU3C 2QGFB 2DRMA 4EMKB 1UEBA 4E7SA 4E7JA 2QEXA 1VQMQ 4MDWA 3JV3A 2V8KA 2J06A 1H641 2ED0A 2YUOA 1R0CB 3VS2A 2KR3A 3TVTA 3U23A 1AOJA 4D8DA 3X26B 3MCAB 4B9XA 5FRNA 3G4SA 1OPKA 2EGEA 3CCMT 4IUPA 4M77A 1U06A 2CKKA 2RHZA 1B7TA 1CSKA 1VOMA 2YUQA 3X28B 3S3MA 1YWPA 3VS5A 2HKQB 1MUZA 3CC2A 5GAOr 2L2PA 3I55T 1UDLA 1VQ5T 1UE9A 2DVEA 2AKKA 1EIFA 3CCVA 2MCNA 4CI0C 2L3SA 1K9MU 2ZPIB 5FROA 3THKA 2FPDA 1M1KR 2BKDN 2FVUA 4C92C 2L89A 1G83A 1NEGA 4JS5A 2C0OA 4M4ZA 4OMPA 1X43A 2KRSA 2CUDA 3A8OB 3PVQA 3GOXA 3CC2T 1BK2A 1RADB 2ABLA 2ECZA 2O4XB 3S3OA 1K8AR 1NPRA 4EMGA 5KYWB 3VS7A 5CAIA 3VS6A 1N9SA 2CZ6B 2QQ9A 3JCMc 5GAN6 1X2QA 5GAMf 3CCQA 4LE9A 1X2KA 3M0QA 3E19A 2QXFA 4FSXA 2K3YA 4UC4A 2LMJA 4A53A 4BACA 2LX9A 4FIBA 2W10A 3M0PA 2DL4A 1WX6A 3H0IA 1RLQC 3Q1JA 4RUGA 2K57A 2YDLA 2LX7A 2XDPA 1Q82R 1FMVA 4LUDA 2NUPB 1AD5A 3PMTA 1JO8A 4MZTA 3CCLT 1YITQ 5CK9A 4LDWA 3X20B 3CEYA 2CZ7B 1M2VB 4TVRA 4ORZA 4O5VA 4OMFB 1KC8R 2FB7A 3CQTA 1KSWA 1M30A 3CMEQ 1VA7A 3CCRT 3VV0A 2OTJA 3EGXB 2CP3A 5C0MA 3ER0A 4HA8A 3PTAA 1OU8A 1HYOA 2KT1A 1VQ5Q 5FU6B 1KD1C 4E7ZA 4A4EA 2M02A 3NMZC 3JCMe 2QDYB 2ZPBB 1K0XA 4AG1C 2Y4XA 1G3TA 3RBBB 4E6RA 2CSIA 2EQIA 3UF4A 4M7DE 3AHUA 1SRMA 2RK1A 2HBWA 4X9DA 4HCBA 5HK3A 3OMGA 4J9DA 4J9HA 1VQLA 1XTDA 1W1FA 4CC4B 4M75C 2LT4A 3OMCA 4J9GA 4M7DG 3M57A 1M8MA 1JQQA 1YJWQ 2LTOA 2MWPA 3CMEA 3G71Q 1NJIC 1OOTA 1BBZA 4M77B 2MK5A 1M1FA 1KQ2A 1Q82C 3JRZA 1AWXA 3M54A 4C0DC 1VQKQ 1B3QA 1LJOA 2L0AA 4D8KA 1JXMA 3L2WA 1OV3A 1D0ZA 5GMKi 2JMCA 1BU1A 5GJWB 4BDYA 1PRLC 4M78E 1ZBXA 2PVOB 2KRMA 1VQPA 1D09B 3MEUA 1MMDA 1VQ4Q 3VS3A 5GAN5 3OYAA 3CC4Q 2BZXA 2RF0A 4RTYA 3MP1A 3J81E 5DLOA 3CCMA 1QVGP 5LL6S 1Z9ZA 4C5EA 3G6ET 2JM9A 3META 3OB9A 2J6KA 3EG9A 2H3EB 2A08A 2PNIA 4QQGA 1IB8A 3QSUA 1WI7A 2ZGWA 2Z0WA 3EG9B 3PE0A 1YIJT 3A8GB 4XK8E 4RG2A 2EVRA 4MMLA 4J5YA 1AVZC 1TXQA 1YITA 2DEUA 3E1SA 3KFVA 2KY9A 2QAZA 1M1KC 1T0JA 3GIBA 2QTVA 2KE9A 1YJ9Q 2JXBA 4MZMA 2CYZB 4ZGJB 2YRCA 2PVGB 2R57A 4FYVB 2ZPFB 1IXDA 3ULRB 3A1PA 4LDXA 2CP5A 1UGQB 1QVFS 1LOJA 3UWNA 3UDCA 1JU5C 2L5QA 2CH4W 2HL5C 2HNIA 1OPLA 1S72T 2E12A 4E7LA 1VQOQ 3CXCP 1I07A 6AT1B 2LQNA 3NTIA 2FZCB 4J6XA 1VQ6Q 2NYSA 1M1GA 1KHCA 2VYTA 4LNPA 3VRYA 2E3IA 1UB4A 1Q81C 4E47A 2C06A 4HT8A 2DIQA 3M5AA 4OMLA 2QA4Q 4IUUA 4C5GA 2RQVA 2KDSA 3FC3A 1QVPA 3EFRA 4FYWB 3RMSA 5LJ3h 4ZTJA 2JZ2A 3VKIA 1FWZA 4OMQA 3OYMA 2AIRB 1B34B 1YHQT 5GAOl 1AHJB 1K73R 3L2RA 5CO7A 1K76A 4M7AF 2QDLA 3V7CA 3JAME 3CCLA 3HRTA 1O75A 1PCXA 3FLGA 2E4HA 1NM7A 2CT4A 1EFNA 5LJ5e 1BCMA 4Z8AA 3UA7A 3VUZA 2COWA 2L8DA 2O9VA 3JB9J 3G4ST 2H8HA 1V1CA 3P8HA 3VJPA 3CMAQ 1QP2A 4KULA 3BY7A 3EG1A 3O5ZA 3I56A 1VQ7Q 4RTWA 4L59A 1ZBJA 3TSZA 2RN8A 5D6YA 3MEAA 3INZA 2ED1A 5CVIA 4DBQA 4FT2A 2ZZDA 3TQ7P 3OYCA 3ME9A 4C0ZA 3VS1A 5A0LA 4R0KA 2RMOA 2DKGA 2KVQG 3I55A 4BI3A 1KHIA 3TREA 4AFQC 2FRWA 3SWNB 4M7DC 2DTIA 4KGXB 3CCST 4L5GA 4BI4A 4N0AA 1Q7YU 3JCMJ 2KQWA 1WHMA 4LD9K 2NUTA 1LNXA 1M3CA 4AFUC 2EYWA 3MO8A 2EQKA 3H41A 2G3RA 1ABQA 2QK0A 2CZ0B 1NYFA 3UPUA 1MV0B 1E6GA 2DYBA 3GLXA 4M77E 2F5TX 1LPLA 4QKUA 4DBRA 2QQBA 4A54A 1WJQA 2COYA 4XU2A 1WJSA 1QW1A 4XU1A 4M7AE 4LDUA 3HFNA 4OF1A 3V7RA 1BYMA 2RD1A 3BDLA 4QT7A 2MI6A 1ZSZB 1QWEA 3QXEB 4DBHA 4ESRA 4J6WA 3OYKA 3R6OA 2XMFA 3OBWA 1MNEA 2KAFA 4QVDA 2SEMA 1BI2A 2A28A 4AT1B 2X3WD 2X4WA 3DB3A 1WFWA 2OAWA 4C8QA 4BE1A 1VYTA 3SWNC 1PG5B 2VASA 3P8DA 4PKCC 2HQEA 1KG1A 5EG2A 4M75E 3OQ5A 2QYZA 1NLOC 1WHGA 1ZLMA 4N0AC 1S72A 4BD3A 3JB9D 2DIGA 4J6YA 4JJCA 3L42A 4WTOB 2QEXT 3PIOA 5GANh 2RHIA 1VQLT 1N8RU 2KSSA 4KUIA 1B07A 5IHKA 2DD5A 3ASKA 1W6XA 4RTTA 2V1QA 4J83A 1BB9A 1Y57A 1OQKA 2HZYA 4M77F 4X34A 2JMAA 3UA6A 2QI2A 5CKDA 2EGCA 2E5KA 2DBMA 3EGDA 3MPUB 4XTXA 4J7IA 2LVMA 2MPXC 2LZ6B 2DETA 2LC4A 3MEVA 3EFOA 1Q82U 3CCVQ 2RJCA 4Z02A 5GANf 1VQ9A 2L3RA 2QGGA 3OS0A 1HXDA 2RJFA 1Y71A 4J9FA 4GY5A 1U8RA 2X4XA 3TSWA 4C92D 2PQWA 2FZKB 2WSCE 3O8VA 4RTZA 1Y7XA 4C8QD 1NYGA 3CCET 1W2BP 2PZ1A 1I5OB 2MF2A 4M77D 4BY6B 1JBMA 1VYUA 2CDTA 4XTVA 2C0IA 3QHSA 3QWYA 1WLPB 1OU9A 2D0QB 4KRTA 2EKOA 2XDDA 1M90C 1G8XA 1PWTA 4OVAA 5KYWA 5J3BA 1TSFA 4M78B 4M78G 2RB6A 2X9HA 2QA4A 1XOVA 2HDAA 2DTHA 5GMKl 1M1KU 4F04B 2KXDA 3CCEA 1ZA2B 2GGRA 1I1JA 3PIPA 2QASA 4PL6A 1VQ7T 1VQ8Q 2V1RA 3RR6A 2IIMA 4M78A 4E7KA 1ZUYA 3E9FA 2NWMA 1M2OA 4F14A 1IZ6A 1H8KA 1YI2T 3OYYA 1TTHB 1VYVA 2QA4T 2L3PA 1PC0A 2YUPA 3NPFA 4HXJA 2EQJA 4OMNA 5FWBA 4M7DB 1C0MA 5KCHA 1OX8A 3QJ6A 1YJWT 2B8AA 2FO0A 3CCRA 2OTJT 1SG5A 3I56Q 1VQ7A 3NFCA 4FSSA 1LCKA 2DXTA 2MYSA 4OB3B 1GFCA 2WSEE 3NTKA 2LT1A 5KYXB 4HCZA 1K4US 2DRKA 3X25B 1WXTA 3NHNA 3FEOA 4IIOA 5IXBA 1RLPC 4J9BA 2AKLA 4RTUA 4LN2A 3VYGA 2OTLQ 1VQ4T 1NPPA 3C94A 5J39A 3OYDA 4A4FA 8ATCB 2VUBA 1Q86U 4HKEA 1M5Q1 2KGTA 4FCYA 2O01E 1NE8A 4FYYB 4WF2A 1BIBA 2K3XA 1Q86C 4IUQA 2DILA 2LQKA 3CPFA 3CC4A 2VV5A 2K3BA 3CCEQ 1M8VA 2Y4YA 2RQWA 2MWOA 1KD1R 5A0DA 2LJ0A 2A7YA 4RCCA 4BE0A 4PLLA 3DB4A 3V8LA 3QIIA 4J9IA 2E5QA 2EPDA 5GMKh 1X6GA 2J6FA 3CC7A 2AZSA 1SF9A 2KT8A 1Y07A 4KGZB 4JJNK 2CP2A 2EJ9A 4KBMB 1D3BA 1VQ8T 3G71A 4HVUA 1O9SA 2R58A 5DY9A 1N6AA 1QKWA 5GAOm 3DLMA 3QDFA 1NZ9A 1X6OA 2GFAA 3RNJA 3QWXX 2DVJA 2XHCA 3VYHB 1YI2Q 1UGPB 3DLLA 3OYGA 2EQMA 2YLBA 8AT1B 4LUEA 1ARKA 4Y28E 4J9CA 2OJ2A 4DEXA 4XU0A 3WVEB 5CIUA 1U1TA 2PVDB 3V7SA 2QQRA 2M0YA 3RUXA 5LJ5d 2EYQA 1JXOA 1VQ9T 4C5HA 4JLIA 3R6NA 3DKMA 3CBMA 1M9SA 1AZEA 1TS9A 1ZSGA 4Z89A 1OEBA 2VXEA 3M55A 3OYLA 2V8JA 5GAOq 2CT3A 2DO3A 1VQ6A 1PSEA 2OTLA 2QTXA 2DL3A 3GP8A 1YNZA 1ZUKA 2RJDA 4ANJA 4QW2A 1WA7A 3PFSA 2DL7A 4GBQA 2D1XA 1U1SA 1GXIE 1W2BS 2NUTB 4LD6A 1UJYA 2EFIA 2LDMA 2CP6A 4ZN1A 5LJ3j 4DA4A 2E64A 2XICA 4E7HA 4FU6A 1TUGB 2FEIA 2QEXQ 1VQMA 4A4GA 3HHTB 1GBRA 3CCSQ 1OX9A 1YI2A 1RAIB 1OI1A 1Y96B 3CD6T 2DNUA 2FYKA 1R8OB 4OGEA 1UHCA 4GLMA 2CH4A 5CKBA 1EZZB 3OW2S 5AYFA 1N8RC 1YJ9A 2YWWA 4M7DA 5IH2A 2OAUA 5FU7C 3M9QA 3JB9H 5CQXA 5GANe 4PJOE 1VIFA 4KH1B 4WCIA 3JCMX 2BIVA 1VQ4A 4A4KA 3QBYA 4N4HA 2BUDA 2YT6A 2K4YA 2BE9B 3CCSA 5IHIA 5IHNA 2DZ9A 4OB1B 2VGMA 3EGXA 3BE3A 3NTHA 2D6FA 2RPNA 2CS7A 3M0SA 1M90R 3BW1A 2XD0A 2Y90A 1PKTA 1FYNA 3EH1A 4LDVA 1Q7YR 2DL5A 4AFZC 3PT9A 2F69A 1R77A 3CCUA 1KQ1A 3S3NA 2HCKA 3M0RA 3LWHA 3EG3A 2E70A 4CC3A 1T3LA 2VXFA 1KFZA 1KQSS 4AFSC 2K7AA 5J26A 2DTOA 2M16A 2F2XA 4JDSA 3HL8A 1GCQC 1ZX6A 4PJOA 3JCMd 2E1HA 1KJWA 2A37A 5DM7R 2LRQA 2RO0A 3H0FA 3JCMQ 2XI9A 1UGSB 1ZUUA 5D6WA 2CUBA 2IVWA 5KE3A 3QZ5B 2EW3A 2KNBB 3I35A 1H3HA 2ESWA 2ZAEA 1QWFA 1Q7YC 2B86A 4HVWA 4ATOA 1D1AA 4C8QB 5I2MA 4C8QF 3HRSA 1G5VA 3LH0A 1RUWA 2KK4A 1QVGA 2X3XD 1G3YA 5KH6A 3S6WA 1E6HA 2V26A 2GFUA 5ECAA 2OTJQ 2CP7A 4PJOF 1PKSA 4ZNXA 4OP0A 2JUFA 3D7SB 5KYUA 1K9MC 1SEMA 3AT1B 2GF7A 1DJ7B 3RMQA 1VQNA 4M75B 5FU7B 3EG0A 2IPOB 4C0DB 5GJVB 4HCKA 2LCSA 1X27A 2J7IA 2KYBA 1FX7A 1M3AA 4M75F 3EAEA 2JN0A 3M59A 4M75G 1PHTA 4EMKC 1ZQ1A 2F2VA 3SWNA 2K2VA 3FIFA 2P4TA 3CCQT 4M77G 3HSBA 2GCXA 3OYHA 1I0CA 2ROLA 3P8BB 2KEAA 1BI1A 1N27A 4C0GA 2LP5A 4HCCA 2ZPHB 1FMKA 4K11A 2D8JA 4JRIA 1LVKA 2KYMA 5KE2A 5GAN3 2I0NA 2BZYA 2YHTA 1WHKA 2HL3A 1VQMT 3CBOA 5A2QE 1GL5A 3M56A 3H8ZA 3N5BB 2R5AA 1PD1A 1IHVA 2F1LA 1ACMB 2JTFA 3JCMf 2LQ8A 1K0SA 1K1ZA 2M1HA 2A3LA 2LNHB 3QO3A 4HT9A 2DFUA 1UJ0A 3M4GA 1T3SA 4QQ6A 1YCSB 1I4K1 2XK0A 1R0BG 4C92E 4DBFA 4RCBA 4C0FA 1KD1U 1WNLA 3C4SA 5KYYB 2KI7A 3I55Q 1X75C 3C95A 2WSFE 2MMPA 1KK7A 3OW2P 4V2SA 1GBQA 2K5LA 4JRPA 4C92B 2MAMA 3I56T 1G2BA 3L1AA 3CPWS 5AT1B 4X1VA 4PJOC 2LCLA 3FJPA 1YCYA 5CKEA 3OS1A 2KRNA 4PJLA 2FPFA 2QQAA 1QCFA 4M78F 1HJDA 3RKWA 4RG8A 5C6SA 3QJYA 2K5IA 1N5ZA 1NJIU 2EWNA 2HAXA 5IAYA 1VQ6T 4P5NA 2OTLT 4RMOA 1D3BB 5I22A 2RHXA 1YHQQ 1UHFA 1RAGB 3LYIA 3CBPA 3EFOB 4JUVA 1UG1A 2DPPB 4MMKA 5IXFA 1TG0A 3FB9A 4M78D 1NJIR 1K8AU 3E2UA 5FWCA 1OZ3A 3OYIA 2R5MA 1XQHA 1QVFA 4OMMA 1D0YA 2EYXA 3ZL7C 4OGCA 1ABOA 4J7FA 2YXYA 4FM4B 1U5SA 2KBTA 4ZGDB 1IO6A 2X35A 4BUGA 2M9UA 1AT1B 2VKNA 1YIJA 2XKOC 1TOVA 1RL2A 4KH0B 1KQSP 2DBKA 1M90U 3OA6A 1K73C 1YITT 1AZGB 1G3SA 5FU6C 5L8RE 4M7DD 1KQSA 2GTJA 3LGLA 1V29B 2FHDA 1NBEB 2GNCA 5DLQE 2K79A 5GMKm 4PJNA 2VWFA 3CCRQ 5FLXE 4F7UE 2D8HA 4JZ3A 5LJ3d 2RA2A 3PNWC 3H9NA 1VQNT 3ZBDA 2YUNA 3M4YA 4D6WA 2KXCA 2X4YA 1J3TA 5GMKj 4ME7A 2EYYA 2GTOA 1MMAA 4M7AD 5I11A 3FJ5A 2CREA 4X9CA 2NUZA 1BI0A 3A5ZB 2G6FX 1X6BA 4GLKA 3QG1A 4BE2A 5KYNA 3MJXA 4IUVA 1OZ2A 5KYXA 2ATCB 2HBPA 4PNOA 5LJ5f 2GQVA 2HQXA 4B6MA 3G71T 1ZSZA 2O88A 3H6ZA 4CC2A 4OB0B 4PJJA 3OSSC 2K6DA 1VQKT 1BCOA 1UFFA 1QQJA 3GPLA 3OW2A 3CMAT 2LCCA 2OI3A 4KUDK 1H3ZA 4MZPA 1AEYA 3EHRA 1RABB 3I5SA 2J6OA 5D6XA 3SDZA 2A36A 4RTVA 2DL8A 1U3OA 4PJOD 2EKHA 2JVVA 3I5RA 7AT1B 5LJ3e 2DE0X 2MOXA 2CZ1B 5HCKA 3OYBA 4BY6C 2YLCA 2DXBA 3HFOA 1P92A 3CCQQ 1WHJA 3OY9A 1KIKA 2L3QA 1WQ7A 1YIJQ 3OBYA 3KUFA 5GAN2 4M78C 3MEWA 3LGFA 1SPKA 2O2OA 3URGA 3X24B 3CD6Q 4M7AC 1TUCA 2JOYA 1N8RR 3RKXA 3CCJA 4M7AG 3WVDB 2QQSA 3QKJA 3VS0A 4CC7A 5GAOn 1C6VX 2YSQA 1NLPC 3M53A 1PRMC 1VQPT 3V8JA 1HK9A 2FZGB 1QLYA 2P0QA 1RAAB 5I21A 1BKBA 3UT1A 5L23A 3E9GA 2DJZA 5LJ3f 1SHGA 5KYYA 1M27C 1WHLA 1RI9A 3VUBA 1GRIA 3CPWP 1NEBA 3CD6A 1F1BB 1RAFB 3OYNA 3HPWA 4Y92A 1KC8U 3C0CA 1QVFP 3CCJQ 2IG0A 3EGDB 4EMKA 3CPWA 1TUDA 1WXUA 1KC8C 1WHHA 1WJRA 2ZPEB 3VRZA 4M7DF 2RK2A 2CGHA 3CXCS 1N9RA 1M2VA 4F7UF 2V8IA 4NL3A 3CXCA 2J05A 2KMTA 4EPCA 1YFNA 2HMAA 4RKUE 4CRIA 4JZ4A 1A0NB 1PSFA 1RI0A 4C92G 2XU8A 2GBQA 2WACA 3LWIA 3QZ9B 1MNDA 3HRUA 1IRXA 3VS4A 1ZA1B 2K2MA 5EC7A 4XTUA 1JJ2S 4C92F 3HKSA 1VQ5A 4L6V5 2VGNA 2E41A 3FDRA 1YBYA 2RHUA 1QP3A 2EJGA 1Z9QA 2DM1A 2HSEB 4F7UA 1VQLQ 2JS2A 5IN1A 1QCOA 2I2LA 4F7UG 3SB2A 4F7UB 4R56A 4EDUA 5GAMg 2D0NA 1TWBA 2M51A 2E10A 1M4ZA 2XIDA 1I8FA 3CCMQ 1D1BA 1NG2A 2DK3A 2HSPA 1MV3A 3MP8A 2ZPGB 3MP6A 1WIEA 2K5FA 2DXCA 4C92A 4DQ2A 2CSQA 2P84A 4ELZC 3A8HB
chains in the Genus database with same CATH topology
2QAZA 1OULA 2QASA 1TWBA 1YFNA 1OU9A 1ZSZA 1ZSZC 1OX9A 1ZSZB 1OU8A 1OX8A 2NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAZ A;  1OUL A;  2QAS A;  1TWB A;  1YFN A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1OX9 A;  1ZSZ B;  1OU8 A;  1OX8 A;  2NYS A; 
#chains in the Genus database with same CATH topology
 4XTY A;  3TEE A;  2RH2 A;  1YJN Q;  3V8K A;  5CCA A;  5GAN 7;  1IHW A;  3IQL A;  4IKF A;  1CKA A;  1VUB A;  1QKX A;  4BB7 A;  3KBG A;  1K9A A;  1SSH A;  4A63 B;  4AMC A;  1VQK A;  3QUI A;  1AWJ A;  2AZV A;  4JPB W;  1IGQ A;  3FRN A;  1OUL A;  2NUP A;  1MHN A;  2VB6 A;  4LDY A;  4QVC A;  3TU4 K;  1VQN Q;  4Z88 A;  5GMK e;  4E2F B;  1JJ2 A;  4J9E A;  4N4G A;  3BDU A;  1WQW A;  1D0X A;  1MGQ A;  3GBQ A;  4N4I A;  4PFZ A;  1CKB A;  3JCM h;  4FYX B;  4OMO A;  3CC7 T;  2C0T A;  1VQO A;  1TH7 A;  2RQU A;  1Q86 R;  2RHY A;  1ZSZ C;  2O31 A;  5IT9 E;  5GAM j;  1GFD A;  3M58 A;  4PK4 A;  4LXC A;  2OX7 A;  4PJO G;  3H0H A;  1GCP A;  3G7Z A;  2P4R A;  1W2B A;  4PFP A;  1S1N A;  1SSF A;  1XJW B;  2E65 A;  4M75 A;  4C8Q G;  5HKC A;  4FT4 A;  5LJ5 g;  2QG9 B;  3T9N A;  3J7A F;  1UUE A;  4PJM A;  3NGP A;  3QDR B;  5LJ3 g;  2ENM A;  2X51 A;  3CCL Q;  2PTK A;  3RIR A;  2JNG A;  3SHW A;  1MMN A;  3JCM V;  3HP9 A;  4M75 D;  2AK5 A;  2RNA A;  4DEY A;  3CME T;  2M0O A;  1AWO A;  3EG2 A;  3OSV A;  5GAN j;  2MIO A;  1MMG A;  3G1J A;  1YJN T;  5FW9 A;  2JM8 A;  4EMH A;  3PMI A;  1WDX A;  2ROT A;  2AHJ B;  4QVZ A;  4PFO A;  4XTW A;  1D1C A;  4M77 C;  3JCM P;  4C8Q E;  1I5L A;  1G3W A;  2JS0 A;  5LJ5 j;  5KCO A;  1RAC B;  1Q81 R;  1JB0 E;  2FG0 A;  1SRL A;  4ZTF A;  2DMO A;  3CCV T;  5GAM h;  2LNV A;  2DZC A;  1YJW A;  1VQ9 Q;  3REA B;  1Q81 U;  4OB2 B;  2E3H A;  3CC7 Q;  1HSQ A;  3QYH B;  2LJ3 A;  3C12 A;  2DER A;  4II1 A;  4XU3 A;  1I81 A;  3RER A;  1HD3 A;  4NL2 A;  1X01 A;  3SD4 A;  4QQD A;  4JJB A;  3CC2 Q;  2JT4 A;  3BFM A;  2FPE A;  4M7A B;  1T0H A;  2HEQ A;  1XNI A;  3LX7 A;  5M9O A;  1Y0M A;  2DA9 A;  4F16 A;  1QCN A;  1BIA A;  1WPY A;  2EIF A;  1V76 A;  1GCQ A;  4ZN3 A;  3QPH A;  2P0P A;  4KT0 E;  9ATC B;  2EAY A;  3CC4 T;  2D9T A;  2BZ8 A;  1TU0 B;  4C8Q C;  1QMC A;  1JEG A;  3MHX A;  3A8L B;  1UEC A;  3G6E Q;  3I9Q A;  4FW1 A;  1WGS A;  2DXU A;  2RI3 A;  5GAO p;  4ZGE B;  3LLR A;  1JJ2 P;  2E6N A;  2JJ9 A;  3GNG A;  2RI2 A;  4FL6 A;  4XAX B;  2HD0 A;  3OYE A;  1K9M R;  3RES A;  2NLU A;  2F2W A;  5LJ5 h;  4ELY C;  1UGV A;  2ZCF B;  5CR2 A;  4A4H A;  4E7I A;  1VQ8 A;  2PUO B;  2JW4 A;  4VUB A;  5KYU B;  1PD0 A;  3M0U A;  1SKU B;  3CCU T;  3M0T A;  4R55 A;  1RAE B;  4AG2 C;  4BI8 B;  1EX4 A;  3F70 A;  1YN8 A;  4DOV A;  4PLI A;  3L2V A;  3GNF B;  2VC8 A;  4C5I A;  2RQR A;  4IIM A;  2RI5 A;  3EGU A;  3UAT A;  2RJE A;  1OYX A;  1BI3 A;  2COZ A;  1SHF A;  1UTI A;  3SFM A;  1AWW A;  4XTZ A;  3REB B;  4M7A A;  3RKY A;  3GF5 A;  3PGG A;  2XDB A;  3JCM g;  3ZFJ A;  4XQ3 A;  1Y96 A;  4O6J A;  1FXX A;  2JTM A;  2RM4 A;  3G6E A;  3MKD A;  2VVK A;  3KXT A;  1PM3 A;  3L2Z A;  1ZHI A;  4BDZ A;  2W0Z A;  1WZO A;  2EBP A;  2DEQ A;  2CP0 A;  1Q95 G;  4HVV A;  3J80 E;  5GAN 4;  2O4X A;  1K8A C;  3QYG B;  2DYI A;  1WXB A;  1RAH B;  4Y91 A;  2EQU A;  2DD4 A;  3TCJ A;  2DJQ A;  1E7O A;  3RDV A;  3JCM b;  5GAN 8;  2HKN A;  2PUK B;  4KGV B;  2AT1 B;  2O9S A;  5A0G A;  5GAN g;  2BTT A;  5GAM d;  1YWO A;  2K9G A;  2HQH A;  2SRC A;  5GAM e;  1K73 U;  1VIE A;  3EFS A;  4JLG A;  3G4S Q;  4FW2 A;  3JB9 F;  2KRO A;  1B34 A;  2P0K A;  3ZEH A;  3L2U A;  4JJD A;  3CMA A;  5I2S A;  4JS4 A;  1UGR B;  4JRK A;  1H92 A;  2A0F B;  2E6Z A;  4B9W A;  1JRI A;  4YTL A;  1YJN A;  5HY6 A;  2FL7 A;  3SEM A;  2PU9 B;  2JTE A;  5CQY A;  1W70 A;  5FRM A;  2X4J A;  1VQP Q;  4NOY A;  3CCU Q;  1M3B A;  3WXM B;  1C1A A;  2GQI A;  1YJ9 T;  1W4S A;  1WYX A;  1IGU A;  3A8M B;  5CKH A;  3EH2 A;  4J8O A;  3OS2 A;  2FRY A;  4DOW A;  2EJF A;  3LH5 A;  4MDX A;  4IUT A;  3EHQ A;  2H3J A;  4JRQ A;  4F17 A;  2LQW A;  4PJO B;  1S72 Q;  2RQT A;  2EGA A;  4NS5 A;  1VQO T;  3CCJ T;  3OYF A;  2BE7 D;  3JSC A;  5CKF A;  5D7U A;  2DF6 A;  3OS5 A;  3JCM W;  2LJ1 A;  5GAN d;  3JB9 G;  1X69 A;  3L2Q A;  2F5K A;  2EYZ A;  4RTX A;  3HTR A;  3JB9 I;  3A98 A;  2DAQ A;  3OYJ A;  3LW5 E;  2YRV A;  4EIK A;  1QVG S;  5HK0 A;  1IRE B;  1PNJ A;  3PVL A;  4Q5W A;  4IUR A;  2XG8 D;  1YHQ A;  2DLP A;  1FMW A;  1YP5 A;  2YRD A;  2DX1 A;  3VU3 C;  2QGF B;  2DRM A;  4EMK B;  1UEB A;  4E7S A;  4E7J A;  2QEX A;  1VQM Q;  4MDW A;  3JV3 A;  2V8K A;  2J06 A;  1H64 1;  2ED0 A;  2YUO A;  1R0C B;  3VS2 A;  2KR3 A;  3TVT A;  3U23 A;  1AOJ A;  4D8D A;  3X26 B;  3MCA B;  4B9X A;  5FRN A;  3G4S A;  1OPK A;  2EGE A;  3CCM T;  4IUP A;  4M77 A;  1U06 A;  2CKK A;  2RHZ A;  1B7T A;  1CSK A;  1VOM A;  2YUQ A;  3X28 B;  3S3M A;  1YWP A;  3VS5 A;  2HKQ B;  1MUZ A;  3CC2 A;  5GAO r;  2L2P A;  3I55 T;  1UDL A;  1VQ5 T;  1UE9 A;  2DVE A;  2AKK A;  1EIF A;  3CCV A;  2MCN A;  4CI0 C;  2L3S A;  1K9M U;  2ZPI B;  5FRO A;  3THK A;  2FPD A;  1M1K R;  2BKD N;  2FVU A;  4C92 C;  2L89 A;  1G83 A;  1NEG A;  4JS5 A;  2C0O A;  4M4Z A;  4OMP A;  1X43 A;  2KRS A;  2CUD A;  3A8O B;  3PVQ A;  3GOX A;  3CC2 T;  1BK2 A;  1RAD B;  2ABL A;  2ECZ A;  2O4X B;  3S3O A;  1K8A R;  1NPR A;  4EMG A;  5KYW B;  3VS7 A;  5CAI A;  3VS6 A;  1N9S A;  2CZ6 B;  2QQ9 A;  3JCM c;  5GAN 6;  1X2Q A;  5GAM f;  3CCQ A;  4LE9 A;  1X2K A;  3M0Q A;  3E19 A;  2QXF A;  4FSX A;  2K3Y A;  4UC4 A;  2LMJ A;  4A53 A;  4BAC A;  2LX9 A;  4FIB A;  2W10 A;  3M0P A;  2DL4 A;  1WX6 A;  3H0I A;  1RLQ C;  3Q1J A;  4RUG A;  2K57 A;  2YDL A;  2LX7 A;  2XDP A;  1Q82 R;  1FMV A;  4LUD A;  2NUP B;  1AD5 A;  3PMT A;  1JO8 A;  4MZT A;  3CCL T;  1YIT Q;  5CK9 A;  4LDW A;  3X20 B;  3CEY A;  2CZ7 B;  1M2V B;  4TVR A;  4ORZ A;  4O5V A;  4OMF B;  1KC8 R;  2FB7 A;  3CQT A;  1KSW A;  1M30 A;  3CME Q;  1VA7 A;  3CCR T;  3VV0 A;  2OTJ A;  3EGX B;  2CP3 A;  5C0M A;  3ER0 A;  4HA8 A;  3PTA A;  1OU8 A;  1HYO A;  2KT1 A;  1VQ5 Q;  5FU6 B;  1KD1 C;  4E7Z A;  4A4E A;  2M02 A;  3NMZ C;  3JCM e;  2QDY B;  2ZPB B;  1K0X A;  4AG1 C;  2Y4X A;  1G3T A;  3RBB B;  4E6R A;  2CSI A;  2EQI A;  3UF4 A;  4M7D E;  3AHU A;  1SRM A;  2RK1 A;  2HBW A;  4X9D A;  4HCB A;  5HK3 A;  3OMG A;  4J9D A;  4J9H A;  1VQL A;  1XTD A;  1W1F A;  4CC4 B;  4M75 C;  2LT4 A;  3OMC A;  4J9G A;  4M7D G;  3M57 A;  1M8M A;  1JQQ A;  1YJW Q;  2LTO A;  2MWP A;  3CME A;  3G71 Q;  1NJI C;  1OOT A;  1BBZ A;  4M77 B;  2MK5 A;  1M1F A;  1KQ2 A;  1Q82 C;  3JRZ A;  1AWX A;  3M54 A;  4C0D C;  1VQK Q;  1B3Q A;  1LJO A;  2L0A A;  4D8K A;  1JXM A;  3L2W A;  1OV3 A;  1D0Z A;  5GMK i;  2JMC A;  1BU1 A;  5GJW B;  4BDY A;  1PRL C;  4M78 E;  1ZBX A;  2PVO B;  2KRM A;  1VQP A;  1D09 B;  3MEU A;  1MMD A;  1VQ4 Q;  3VS3 A;  5GAN 5;  3OYA A;  3CC4 Q;  2BZX A;  2RF0 A;  4RTY A;  3MP1 A;  3J81 E;  5DLO A;  3CCM A;  1QVG P;  5LL6 S;  1Z9Z A;  4C5E A;  3G6E T;  2JM9 A;  3MET A;  3OB9 A;  2J6K A;  3EG9 A;  2H3E B;  2A08 A;  2PNI A;  4QQG A;  1IB8 A;  3QSU A;  1WI7 A;  2ZGW A;  2Z0W A;  3EG9 B;  3PE0 A;  1YIJ T;  3A8G B;  4XK8 E;  4RG2 A;  2EVR A;  4MML A;  4J5Y A;  1AVZ C;  1TXQ A;  1YIT A;  2DEU A;  3E1S A;  3KFV A;  2KY9 A;  2QAZ A;  1M1K C;  1T0J A;  3GIB A;  2QTV A;  2KE9 A;  1YJ9 Q;  2JXB A;  4MZM A;  2CYZ B;  4ZGJ B;  2YRC A;  2PVG B;  2R57 A;  4FYV B;  2ZPF B;  1IXD A;  3ULR B;  3A1P A;  4LDX A;  2CP5 A;  1UGQ B;  1QVF S;  1LOJ A;  3UWN A;  3UDC A;  1JU5 C;  2L5Q A;  2CH4 W;  2HL5 C;  2HNI A;  1OPL A;  1S72 T;  2E12 A;  4E7L A;  1VQO Q;  3CXC P;  1I07 A;  6AT1 B;  2LQN A;  3NTI A;  2FZC B;  4J6X A;  1VQ6 Q;  2NYS A;  1M1G A;  1KHC A;  2VYT A;  4LNP A;  3VRY A;  2E3I A;  1UB4 A;  1Q81 C;  4E47 A;  2C06 A;  4HT8 A;  2DIQ A;  3M5A A;  4OML A;  2QA4 Q;  4IUU A;  4C5G A;  2RQV A;  2KDS A;  3FC3 A;  1QVP A;  3EFR A;  4FYW B;  3RMS A;  5LJ3 h;  4ZTJ A;  2JZ2 A;  3VKI A;  1FWZ A;  4OMQ A;  3OYM A;  2AIR B;  1B34 B;  1YHQ T;  5GAO l;  1AHJ B;  1K73 R;  3L2R A;  5CO7 A;  1K76 A;  4M7A F;  2QDL A;  3V7C A;  3JAM E;  3CCL A;  3HRT A;  1O75 A;  1PCX A;  3FLG A;  2E4H A;  1NM7 A;  2CT4 A;  1EFN A;  5LJ5 e;  1BCM A;  4Z8A A;  3UA7 A;  3VUZ A;  2COW A;  2L8D A;  2O9V A;  3JB9 J;  3G4S T;  2H8H A;  1V1C A;  3P8H A;  3VJP A;  3CMA Q;  1QP2 A;  4KUL A;  3BY7 A;  3EG1 A;  3O5Z A;  3I56 A;  1VQ7 Q;  4RTW A;  4L59 A;  1ZBJ A;  3TSZ A;  2RN8 A;  5D6Y A;  3MEA A;  3INZ A;  2ED1 A;  5CVI A;  4DBQ A;  4FT2 A;  2ZZD A;  3TQ7 P;  3OYC A;  3ME9 A;  4C0Z A;  3VS1 A;  5A0L A;  4R0K A;  2RMO A;  2DKG A;  2KVQ G;  3I55 A;  4BI3 A;  1KHI A;  3TRE A;  4AFQ C;  2FRW A;  3SWN B;  4M7D C;  2DTI A;  4KGX B;  3CCS T;  4L5G A;  4BI4 A;  4N0A A;  1Q7Y U;  3JCM J;  2KQW A;  1WHM A;  4LD9 K;  2NUT A;  1LNX A;  1M3C A;  4AFU C;  2EYW A;  3MO8 A;  2EQK A;  3H41 A;  2G3R A;  1ABQ A;  2QK0 A;  2CZ0 B;  1NYF A;  3UPU A;  1MV0 B;  1E6G A;  2DYB A;  3GLX A;  4M77 E;  2F5T X;  1LPL A;  4QKU A;  4DBR A;  2QQB A;  4A54 A;  1WJQ A;  2COY A;  4XU2 A;  1WJS A;  1QW1 A;  4XU1 A;  4M7A E;  4LDU A;  3HFN A;  4OF1 A;  3V7R A;  1BYM A;  2RD1 A;  3BDL A;  4QT7 A;  2MI6 A;  1ZSZ B;  1QWE A;  3QXE B;  4DBH A;  4ESR A;  4J6W A;  3OYK A;  3R6O A;  2XMF A;  3OBW A;  1MNE A;  2KAF A;  4QVD A;  2SEM A;  1BI2 A;  2A28 A;  4AT1 B;  2X3W D;  2X4W A;  3DB3 A;  1WFW A;  2OAW A;  4C8Q A;  4BE1 A;  1VYT A;  3SWN C;  1PG5 B;  2VAS A;  3P8D A;  4PKC C;  2HQE A;  1KG1 A;  5EG2 A;  4M75 E;  3OQ5 A;  2QYZ A;  1NLO C;  1WHG A;  1ZLM A;  4N0A C;  1S72 A;  4BD3 A;  3JB9 D;  2DIG A;  4J6Y A;  4JJC A;  3L42 A;  4WTO B;  2QEX T;  3PIO A;  5GAN h;  2RHI A;  1VQL T;  1N8R U;  2KSS A;  4KUI A;  1B07 A;  5IHK A;  2DD5 A;  3ASK A;  1W6X A;  4RTT A;  2V1Q A;  4J83 A;  1BB9 A;  1Y57 A;  1OQK A;  2HZY A;  4M77 F;  4X34 A;  2JMA A;  3UA6 A;  2QI2 A;  5CKD A;  2EGC A;  2E5K A;  2DBM A;  3EGD A;  3MPU B;  4XTX A;  4J7I A;  2LVM A;  2MPX C;  2LZ6 B;  2DET A;  2LC4 A;  3MEV A;  3EFO A;  1Q82 U;  3CCV Q;  2RJC A;  4Z02 A;  5GAN f;  1VQ9 A;  2L3R A;  2QGG A;  3OS0 A;  1HXD A;  2RJF A;  1Y71 A;  4J9F A;  4GY5 A;  1U8R A;  2X4X A;  3TSW A;  4C92 D;  2PQW A;  2FZK B;  2WSC E;  3O8V A;  4RTZ A;  1Y7X A;  4C8Q D;  1NYG A;  3CCE T;  1W2B P;  2PZ1 A;  1I5O B;  2MF2 A;  4M77 D;  4BY6 B;  1JBM A;  1VYU A;  2CDT A;  4XTV A;  2C0I A;  3QHS A;  3QWY A;  1WLP B;  1OU9 A;  2D0Q B;  4KRT A;  2EKO A;  2XDD A;  1M90 C;  1G8X A;  1PWT A;  4OVA A;  5KYW A;  5J3B A;  1TSF A;  4M78 B;  4M78 G;  2RB6 A;  2X9H A;  2QA4 A;  1XOV A;  2HDA A;  2DTH A;  5GMK l;  1M1K U;  4F04 B;  2KXD A;  3CCE A;  1ZA2 B;  2GGR A;  1I1J A;  3PIP A;  2QAS A;  4PL6 A;  1VQ7 T;  1VQ8 Q;  2V1R A;  3RR6 A;  2IIM A;  4M78 A;  4E7K A;  1ZUY A;  3E9F A;  2NWM A;  1M2O A;  4F14 A;  1IZ6 A;  1H8K A;  1YI2 T;  3OYY A;  1TTH B;  1VYV A;  2QA4 T;  2L3P A;  1PC0 A;  2YUP A;  3NPF A;  4HXJ A;  2EQJ A;  4OMN A;  5FWB A;  4M7D B;  1C0M A;  5KCH A;  1OX8 A;  3QJ6 A;  1YJW T;  2B8A A;  2FO0 A;  3CCR A;  2OTJ T;  1SG5 A;  3I56 Q;  1VQ7 A;  3NFC A;  4FSS A;  1LCK A;  2DXT A;  2MYS A;  4OB3 B;  1GFC A;  2WSE E;  3NTK A;  2LT1 A;  5KYX B;  4HCZ A;  1K4U S;  2DRK A;  3X25 B;  1WXT A;  3NHN A;  3FEO A;  4IIO A;  5IXB A;  1RLP C;  4J9B A;  2AKL A;  4RTU A;  4LN2 A;  3VYG A;  2OTL Q;  1VQ4 T;  1NPP A;  3C94 A;  5J39 A;  3OYD A;  4A4F A;  8ATC B;  2VUB A;  1Q86 U;  4HKE A;  1M5Q 1;  2KGT A;  4FCY A;  2O01 E;  1NE8 A;  4FYY B;  4WF2 A;  1BIB A;  2K3X A;  1Q86 C;  4IUQ A;  2DIL A;  2LQK A;  3CPF A;  3CC4 A;  2VV5 A;  2K3B A;  3CCE Q;  1M8V A;  2Y4Y A;  2RQW A;  2MWO A;  1KD1 R;  5A0D A;  2LJ0 A;  2A7Y A;  4RCC A;  4BE0 A;  4PLL A;  3DB4 A;  3V8L A;  3QII A;  4J9I A;  2E5Q A;  2EPD A;  5GMK h;  1X6G A;  2J6F A;  3CC7 A;  2AZS A;  1SF9 A;  2KT8 A;  1Y07 A;  4KGZ B;  4JJN K;  2CP2 A;  2EJ9 A;  4KBM B;  1D3B A;  1VQ8 T;  3G71 A;  4HVU A;  1O9S A;  2R58 A;  5DY9 A;  1N6A A;  1QKW A;  5GAO m;  3DLM A;  3QDF A;  1NZ9 A;  1X6O A;  2GFA A;  3RNJ A;  3QWX X;  2DVJ A;  2XHC A;  3VYH B;  1YI2 Q;  1UGP B;  3DLL A;  3OYG A;  2EQM A;  2YLB A;  8AT1 B;  4LUE A;  1ARK A;  4Y28 E;  4J9C A;  2OJ2 A;  4DEX A;  4XU0 A;  3WVE B;  5CIU A;  1U1T A;  2PVD B;  3V7S A;  2QQR A;  2M0Y A;  3RUX A;  5LJ5 d;  2EYQ A;  1JXO A;  1VQ9 T;  4C5H A;  4JLI A;  3R6N A;  3DKM A;  3CBM A;  1M9S A;  1AZE A;  1TS9 A;  1ZSG A;  4Z89 A;  1OEB A;  2VXE A;  3M55 A;  3OYL A;  2V8J A;  5GAO q;  2CT3 A;  2DO3 A;  1VQ6 A;  1PSE A;  2OTL A;  2QTX A;  2DL3 A;  3GP8 A;  1YNZ A;  1ZUK A;  2RJD A;  4ANJ A;  4QW2 A;  1WA7 A;  3PFS A;  2DL7 A;  4GBQ A;  2D1X A;  1U1S A;  1GXI E;  1W2B S;  2NUT B;  4LD6 A;  1UJY A;  2EFI A;  2LDM A;  2CP6 A;  4ZN1 A;  5LJ3 j;  4DA4 A;  2E64 A;  2XIC A;  4E7H A;  4FU6 A;  1TUG B;  2FEI A;  2QEX Q;  1VQM A;  4A4G A;  3HHT B;  1GBR A;  3CCS Q;  1OX9 A;  1YI2 A;  1RAI B;  1OI1 A;  1Y96 B;  3CD6 T;  2DNU A;  2FYK A;  1R8O B;  4OGE A;  1UHC A;  4GLM A;  2CH4 A;  5CKB A;  1EZZ B;  3OW2 S;  5AYF A;  1N8R C;  1YJ9 A;  2YWW A;  4M7D A;  5IH2 A;  2OAU A;  5FU7 C;  3M9Q A;  3JB9 H;  5CQX A;  5GAN e;  4PJO E;  1VIF A;  4KH1 B;  4WCI A;  3JCM X;  2BIV A;  1VQ4 A;  4A4K A;  3QBY A;  4N4H A;  2BUD A;  2YT6 A;  2K4Y A;  2BE9 B;  3CCS A;  5IHI A;  5IHN A;  2DZ9 A;  4OB1 B;  2VGM A;  3EGX A;  3BE3 A;  3NTH A;  2D6F A;  2RPN A;  2CS7 A;  3M0S A;  1M90 R;  3BW1 A;  2XD0 A;  2Y90 A;  1PKT A;  1FYN A;  3EH1 A;  4LDV A;  1Q7Y R;  2DL5 A;  4AFZ C;  3PT9 A;  2F69 A;  1R77 A;  3CCU A;  1KQ1 A;  3S3N A;  2HCK A;  3M0R A;  3LWH A;  3EG3 A;  2E70 A;  4CC3 A;  1T3L A;  2VXF A;  1KFZ A;  1KQS S;  4AFS C;  2K7A A;  5J26 A;  2DTO A;  2M16 A;  2F2X A;  4JDS A;  3HL8 A;  1GCQ C;  1ZX6 A;  4PJO A;  3JCM d;  2E1H A;  1KJW A;  2A37 A;  5DM7 R;  2LRQ A;  2RO0 A;  3H0F A;  3JCM Q;  2XI9 A;  1UGS B;  1ZUU A;  5D6W A;  2CUB A;  2IVW A;  5KE3 A;  3QZ5 B;  2EW3 A;  2KNB B;  3I35 A;  1H3H A;  2ESW A;  2ZAE A;  1QWF A;  1Q7Y C;  2B86 A;  4HVW A;  4ATO A;  1D1A A;  4C8Q B;  5I2M A;  4C8Q F;  3HRS A;  1G5V A;  3LH0 A;  1RUW A;  2KK4 A;  1QVG A;  2X3X D;  1G3Y A;  5KH6 A;  3S6W A;  1E6H A;  2V26 A;  2GFU A;  5ECA A;  2OTJ Q;  2CP7 A;  4PJO F;  1PKS A;  4ZNX A;  4OP0 A;  2JUF A;  3D7S B;  5KYU A;  1K9M C;  1SEM A;  3AT1 B;  2GF7 A;  1DJ7 B;  3RMQ A;  1VQN A;  4M75 B;  5FU7 B;  3EG0 A;  2IPO B;  4C0D B;  5GJV B;  4HCK A;  2LCS A;  1X27 A;  2J7I A;  2KYB A;  1FX7 A;  1M3A A;  4M75 F;  3EAE A;  2JN0 A;  3M59 A;  4M75 G;  1PHT A;  4EMK C;  1ZQ1 A;  2F2V A;  3SWN A;  2K2V A;  3FIF A;  2P4T A;  3CCQ T;  4M77 G;  3HSB A;  2GCX A;  3OYH A;  1I0C A;  2ROL A;  3P8B B;  2KEA A;  1BI1 A;  1N27 A;  4C0G A;  2LP5 A;  4HCC A;  2ZPH B;  1FMK A;  4K11 A;  2D8J A;  4JRI A;  1LVK A;  2KYM A;  5KE2 A;  5GAN 3;  2I0N A;  2BZY A;  2YHT A;  1WHK A;  2HL3 A;  1VQM T;  3CBO A;  5A2Q E;  1GL5 A;  3M56 A;  3H8Z A;  3N5B B;  2R5A A;  1PD1 A;  1IHV A;  2F1L A;  1ACM B;  2JTF A;  3JCM f;  2LQ8 A;  1K0S A;  1K1Z A;  2M1H A;  2A3L A;  2LNH B;  3QO3 A;  4HT9 A;  2DFU A;  1UJ0 A;  3M4G A;  1T3S A;  4QQ6 A;  1YCS B;  1I4K 1;  2XK0 A;  1R0B G;  4C92 E;  4DBF A;  4RCB A;  4C0F A;  1KD1 U;  1WNL A;  3C4S A;  5KYY B;  2KI7 A;  3I55 Q;  1X75 C;  3C95 A;  2WSF E;  2MMP A;  1KK7 A;  3OW2 P;  4V2S A;  1GBQ A;  2K5L A;  4JRP A;  4C92 B;  2MAM A;  3I56 T;  1G2B A;  3L1A A;  3CPW S;  5AT1 B;  4X1V A;  4PJO C;  2LCL A;  3FJP A;  1YCY A;  5CKE A;  3OS1 A;  2KRN A;  4PJL A;  2FPF A;  2QQA A;  1QCF A;  4M78 F;  1HJD A;  3RKW A;  4RG8 A;  5C6S A;  3QJY A;  2K5I A;  1N5Z A;  1NJI U;  2EWN A;  2HAX A;  5IAY A;  1VQ6 T;  4P5N A;  2OTL T;  4RMO A;  1D3B B;  5I22 A;  2RHX A;  1YHQ Q;  1UHF A;  1RAG B;  3LYI A;  3CBP A;  3EFO B;  4JUV A;  1UG1 A;  2DPP B;  4MMK A;  5IXF A;  1TG0 A;  3FB9 A;  4M78 D;  1NJI R;  1K8A U;  3E2U A;  5FWC A;  1OZ3 A;  3OYI A;  2R5M A;  1XQH A;  1QVF A;  4OMM A;  1D0Y A;  2EYX A;  3ZL7 C;  4OGC A;  1ABO A;  4J7F A;  2YXY A;  4FM4 B;  1U5S A;  2KBT A;  4ZGD B;  1IO6 A;  2X35 A;  4BUG A;  2M9U A;  1AT1 B;  2VKN A;  1YIJ A;  2XKO C;  1TOV A;  1RL2 A;  4KH0 B;  1KQS P;  2DBK A;  1M90 U;  3OA6 A;  1K73 C;  1YIT T;  1AZG B;  1G3S A;  5FU6 C;  5L8R E;  4M7D D;  1KQS A;  2GTJ A;  3LGL A;  1V29 B;  2FHD A;  1NBE B;  2GNC A;  5DLQ E;  2K79 A;  5GMK m;  4PJN A;  2VWF A;  3CCR Q;  5FLX E;  4F7U E;  2D8H A;  4JZ3 A;  5LJ3 d;  2RA2 A;  3PNW C;  3H9N A;  1VQN T;  3ZBD A;  2YUN A;  3M4Y A;  4D6W A;  2KXC A;  2X4Y A;  1J3T A;  5GMK j;  4ME7 A;  2EYY A;  2GTO A;  1MMA A;  4M7A D;  5I11 A;  3FJ5 A;  2CRE A;  4X9C A;  2NUZ A;  1BI0 A;  3A5Z B;  2G6F X;  1X6B A;  4GLK A;  3QG1 A;  4BE2 A;  5KYN A;  3MJX A;  4IUV A;  1OZ2 A;  5KYX A;  2ATC B;  2HBP A;  4PNO A;  5LJ5 f;  2GQV A;  2HQX A;  4B6M A;  3G71 T;  1ZSZ A;  2O88 A;  3H6Z A;  4CC2 A;  4OB0 B;  4PJJ A;  3OSS C;  2K6D A;  1VQK T;  1BCO A;  1UFF A;  1QQJ A;  3GPL A;  3OW2 A;  3CMA T;  2LCC A;  2OI3 A;  4KUD K;  1H3Z A;  4MZP A;  1AEY A;  3EHR A;  1RAB B;  3I5S A;  2J6O A;  5D6X A;  3SDZ A;  2A36 A;  4RTV A;  2DL8 A;  1U3O A;  4PJO D;  2EKH A;  2JVV A;  3I5R A;  7AT1 B;  5LJ3 e;  2DE0 X;  2MOX A;  2CZ1 B;  5HCK A;  3OYB A;  4BY6 C;  2YLC A;  2DXB A;  3HFO A;  1P92 A;  3CCQ Q;  1WHJ A;  3OY9 A;  1KIK A;  2L3Q A;  1WQ7 A;  1YIJ Q;  3OBY A;  3KUF A;  5GAN 2;  4M78 C;  3MEW A;  3LGF A;  1SPK A;  2O2O A;  3URG A;  3X24 B;  3CD6 Q;  4M7A C;  1TUC A;  2JOY A;  1N8R R;  3RKX A;  3CCJ A;  4M7A G;  3WVD B;  2QQS A;  3QKJ A;  3VS0 A;  4CC7 A;  5GAO n;  1C6V X;  2YSQ A;  1NLP C;  3M53 A;  1PRM C;  1VQP T;  3V8J A;  1HK9 A;  2FZG B;  1QLY A;  2P0Q A;  1RAA B;  5I21 A;  1BKB A;  3UT1 A;  5L23 A;  3E9G A;  2DJZ A;  5LJ3 f;  1SHG A;  5KYY A;  1M27 C;  1WHL A;  1RI9 A;  3VUB A;  1GRI A;  3CPW P;  1NEB A;  3CD6 A;  1F1B B;  1RAF B;  3OYN A;  3HPW A;  4Y92 A;  1KC8 U;  3C0C A;  1QVF P;  3CCJ Q;  2IG0 A;  3EGD B;  4EMK A;  3CPW A;  1TUD A;  1WXU A;  1KC8 C;  1WHH A;  1WJR A;  2ZPE B;  3VRZ A;  4M7D F;  2RK2 A;  2CGH A;  3CXC S;  1N9R A;  1M2V A;  4F7U F;  2V8I A;  4NL3 A;  3CXC A;  2J05 A;  2KMT A;  4EPC A;  1YFN A;  2HMA A;  4RKU E;  4CRI A;  4JZ4 A;  1A0N B;  1PSF A;  1RI0 A;  4C92 G;  2XU8 A;  2GBQ A;  2WAC A;  3LWI A;  3QZ9 B;  1MND A;  3HRU A;  1IRX A;  3VS4 A;  1ZA1 B;  2K2M A;  5EC7 A;  4XTU A;  1JJ2 S;  4C92 F;  3HKS A;  1VQ5 A;  4L6V 5;  2VGN A;  2E41 A;  3FDR A;  1YBY A;  2RHU A;  1QP3 A;  2EJG A;  1Z9Q A;  2DM1 A;  2HSE B;  4F7U A;  1VQL Q;  2JS2 A;  5IN1 A;  1QCO A;  2I2L A;  4F7U G;  3SB2 A;  4F7U B;  4R56 A;  4EDU A;  5GAM g;  2D0N A;  1TWB A;  2M51 A;  2E10 A;  1M4Z A;  2XID A;  1I8F A;  3CCM Q;  1D1B A;  1NG2 A;  2DK3 A;  2HSP A;  1MV3 A;  3MP8 A;  2ZPG B;  3MP6 A;  1WIE A;  2K5F A;  2DXC A;  4C92 A;  4DQ2 A;  2CSQ A;  2P84 A;  4ELZ C;  3A8H B; 
#chains in the Genus database with same CATH homology
 2QAZ A;  1OUL A;  2QAS A;  1TWB A;  1YFN A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1OX9 A;  1ZSZ B;  1OU8 A;  1OX8 A;  2NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...