3RBBB

Hiv-1 nef protein in complex with engineered hck sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, protein binding
molecule keywords Protein Nef
publication title Conformation of the Dileucine-Based Sorting Motif in HIV-1 Nef Revealed by Intermolecular Domain Assembly.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
total genus 12
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rbbB00
2BZYA 1OPKA 1WLPB 2G6FX 2KYBA 1M3BA 1NEGA 3A98A 1UUEA 4M4ZA 1JQQA 1PRLC 3UA6A 2XMFA 2NWMA 4RTXA 2CH4W 3O5ZA 3TVTA 5IH2A 1AWOA 1NEBA 2KRMA 1WX6A 1H92A 2YUNA 2K7AA 1X6GA 1H8KA 3GBQA 2LX7A 2B86A 2JT4A 3NGPA 2DL5A 1CSKA 1S1NA 1MV3A 4OMMA 1W1FA 1E6GA 1UHCA 4IIOA 3CQTA 3R6NA 1ZBJA 2J06A 1HJDA 3EGUA 2DRMA 1W6XA 2MCNA 3NHNA 2ED0A 4FSSA 4RTVA 2ROTA 4RTUA 4LUEA 4OMQA 2RN8A 2DBMA 3PVQA 1MV0B 4ESRA 2C0OA 2LQWA 2JXBA 5IHNA 2L3PA 1OV3A 3TSWA 2QDLA 4JJCA 4J9FA 1KJWA 1AWXA 2CSQA 2DRKA 2DF6A 4LE9A 2A08A 4F14A 2DM1A 2DBKA 2F2WA 2CT3A 2O31A 3EG3A 1NYGA 2ESWA 3EG2A 1VA7A 1SSHA 2KXDA 4RTTA 2BZXA 1Z9QA 1GL5A 2KROA 2JW4A 1UDLA 2M0YA 1QWEA 5IHKA 1SPKA 1HD3A 1NLOC 1ABQA 3H41A 2HBWA 2W10A 3EHRA 2AKLA 2C0TA 2YDLA 1G2BA 4HCKA 1T0HA 4E6RA 2DILA 2DE0X 2LJ3A 2FEIA 2L3SA 2DNUA 1G83A 1WI7A 2I0NA 2KNBB 2X3XD 3JV3A 1TUDA 5FW9A 2ECZA 2CUBA 2JM8A 1UE9A 1VYVA 2YSQA 3I9QA 1ZX6A 4RUGA 4D8DA 1V1CA 2KRSA 2A37A 1PWTA 4J9BA 4EIKA 2EGCA 2ABLA 2RQTA 4R0KA 2LCSA 1UFFA 4Y92A 2FO0A 4CC4B 3VS5A 1OPLA 4HXJA 1SHFA 1TUCA 2E5KA 2CH4A 2RQWA 4OMNA 3PVLA 2LZ6B 2EGAA 1GFDA 1YP5A 4AFUC 2KT8A 2KYMA 1I1JA 5GJVB 3THKA 2YUPA 2CUDA 4RTWA 3VS0A 2J6OA 3QWYA 2J6FA 1FYNA 2JM9A 1UTIA 1QLYA 2AKKA 2LQNA 3I35A 1Z9ZA 1GRIA 1U5SA 1VYUA 2O9SA 2MIOA 3VRZA 2DL8A 1RUWA 1BK2A 1B3QA 2DLPA 1KIKA 4RTYA 1X2KA 3H0FA 2DJQA 1RI9A 3I5RA 1K0XA 5FWBA 1M8MA 1SHGA 2PNIA 4OMPA 1GCQA 5IXBA 2K3BA 4Z8AA 2A28A 3M0RA 2F2VA 2KE9A 2KRNA 4JZ3A 2GTOA 1CKBA 2HCKA 1RLPC 4LUDA 2AK5A 1WIEA 2KEAA 1WDXA 1PNJA 1ZSGA 1Y57A 1PKTA 2W0ZA 1SEMA 2FRWA 3EHQA 4CC7A 4OMOA 1K1ZA 2DVJA 3M0SA 2BTTA 1CKAA 3C0CA 3VS2A 1UG1A 3EG1A 1WFWA 2FPEA 5I22A 4AG2C 3UA7A 2ROLA 1SRLA 2LNHB 1XOVA 1ARKA 1OOTA 2D8HA 1ZUUA 1E7OA 2EBPA 2JMCA 4HVWA 4Z88A 4J9IA 4CC2A 2L2PA 1UECA 2LMJA 3ZL7C 1ZLMA 1TG0A 1QKWA 2FPDA 1GCQC 1FMKA 1NM7A 2GNCA 4OMLA 2VKNA 2KBTA 4JJBA 2EGEA 1BU1A 1OEBA 2EYZA 2KGTA 1WXTA 2KT1A 4X1VA 2EKHA 2GGRA 2OAWA 1X43A 4IIMA 5FWCA 2DL4A 1GBQA 4WCIA 4J9CA 1QKXA 2V1QA 2JMAA 4CC3A 4AFSC 2RQRA 3M0QA 1M3AA 2GTJA 2DL7A 3VRYA 3M0PA 2C0IA 5ECAA 1JXOA 2CT4A 4GBQA 2RF0A 1JU5C 2KR3A 1QCFA 2NUZA 5HCKA 3TSZA 3UF4A 1YNZA 1AOJA 2ED1A 2MOXA 2EQIA 4ZNXA 2RQVA 1UHFA 2JTEA 2BZ8A 1BB9A 1K9AA 1GFCA 1X69A 2YUOA 4LN2A 2GQIA 2HEQA 1AEYA 1A0NB 2RQUA 1WXUA 2K79A 4DEXA 5EC7A 4AFZC 1B07A 1UJYA 2ENMA 1K4US 1X2QA 1UGVA 1BBZA 1PHTA 1HSQA 1JXMA 2EPDA 3PE0A 2FPFA 5L23A 2SRCA 3IQLA 3UATA 2HDAA 2FG0A 1AZEA 1ABOA 2YUQA 3RBBB 3EG0A 2EYYA 2L3QA 2CDTA 3REAB 4AG1C 1ZUKA 4F17A 3H0HA 2EW3A 1U06A 2X3WD 4QT7A 1M3CA 4JZ4A 2DL3A 1SRMA 2O88A 2H8HA 3H0IA 2DA9A 1I07A 2O2OA 4DEYA 2J6KA 1EFNA 1JO8A 2LJ0A 2DYBA 4ORZA 1H3HA 1UJ0A 3M0TA 4HVUA 2PZ1A 2RNAA 4F16A 2CREA 2D0NA 2HSPA 1JEGA 2O9VA 1GCPA 2JS0A 1U3OA 1AD5A 1AZGB 5GJWB 3SHWA 1AWWA 1RLQC 1N5ZA 2V1RA 1YN8A 4RTZA 2D8JA 2AZSA 2LJ1A 3VS4A 1IO6A 5I11A 1NG2A 1X6BA 3I5SA 1WYXA 2FRYA 1W70A 1E6HA 2L0AA 2YT6A 2LP5A 1MUZA 1J3TA 5IXFA 3VS7A 2DX1A 1YWPA 2J7IA 2EYWA 1LCKA 3VS1A 1T3LA 2SEMA 1NLPC 2RMOA 2VWFA 3ULRB 2IIMA 1ZUYA 2JS2A 2J05A 1KSWA 4Z89A 3FJ5A 4D8KA 1QWFA 3RNJA 3M0UA 2K6DA 1KFZA 3NPFA 2P4RA 4AFQC 2PTKA 1I0CA 4LNPA 3U23A 1K0SA 4J9DA 2M51A 3VS6A 2AZVA 4GLMA 1M27C 1WA7A 1T0JA 1PKSA 2CSIA 1X27A 1Y0MA 4KRTA 2KXCA 4JPBW 1K76A 3KFVA 3REBB 5IHIA 1VYTA 1WXBA 4K11A 1YWOA 2EYXA 3QWXX 3VS3A 1PRMC 2DMOA 2OI3A 3SEMA 1GBRA 2K9GA 1NYFA 4J9HA 1AVZC 4JJDA 1AWJA 4A63B 4J9EA 1T3SA 2OJ2A 4HVVA 2D1XA 2EVRA 1M30A 4J9GA 2A36A 2GBQA 2K2MA 3LH5A 2RPNA 2VVKA 1YCSB 2F2XA 3NMZC
chains in the Genus database with same CATH superfamily
1OPKA 2RHUA 4DA4A 1VQLT 3OSSC 2KYBA 1UEBA 3OYNA 3A98A 1QP3A 3C12A 1JQQA 1PRLC 3UA6A 2DXCA 2FZKB 5KYWA 2MI6A 1QVFP 1AWOA 4C5GA 2EJGA 1QVGA 3GBQA 4BUGA 2HD0A 1S1NA 3CC7T 5GANh 4E7ZA 1W1FA 1UHCA 2DFUA 4UC4A 4M7AF 1XNIA 2DRMA 3Q1JA 3NHNA 1RABB 2BIVA 2M9UA 4OMQA 3OYDA 5GAMj 3M5AA 1Q81C 5L8RE 1VQ9T 1HYOA 4XU0A 2KI7A 2A3LA 2JXBA 3CCJT 1KJWA 3OYHA 2A08A 4F14A 2DBKA 4YTLA 3X20B 4ZN1A 3CEYA 2CT3A 5GMKl 3EG3A 1RAIB 4M7DE 1G3YA 3S6WA 1JBMA 1MMNA 2KXDA 4ELZC 4PJJA 5LJ3h 2O01E 1OQKA 1GL5A 2KROA 2JW4A 2QGGA 5IT9E 2M0YA 2E3HA 4C0DB 1HD3A 1NLOC 5C0MA 3OS0A 3H41A 1I5OB 4RKUE 3CXCP 3EHRA 2YDLA 3OW2A 3OYGA 3BDUA 1T0HA 4E6RA 4PFPA 4J7FA 1K8AC 2WACA 5FW9A 3OYJA 4OB1B 2PUKB 1D0ZA 2JM8A 1VYVA 4FM4B 2RHYA 3E9GA 1X6OA 2A37A 5AT1B 1PWTA 2HQXA 2LCSA 1OU8A 4JLIA 4Y92A 3PGGA 2MYSA 2FO0A 5GANg 3VYGA 2EWNA 3L2RA 2E5KA 2CH4A 2DEUA 5FU7B 2RQWA 1KC8R 1D1BA 1YI2A 2LZ6B 4OMFB 2VASA 4M78B 5GJVB 3VS0A 5LJ5j 2YUPA 3OS2A 2J6OA 2QQAA 4R55A 1QVFS 2JJ9A 2J6FA 2MWPA 3SD4A 3J7AF 1Q86C 4M7DF 3EFOA 3HRUA 1UTIA 1QLYA 2AKKA 2LQNA 2OAUA 1O75A 1Z9ZA 3X26B 1Q82C 1WHHA 3E9FA 5D7UA 1VQMQ 1GRIA 1U5SA 1VYUA 2E64A 4OF1A 3T9NA 2DLPA 3EGDB 1X2KA 1YITT 1Q7YC 4EMKA 3G4SQ 2FZGB 1RL2A 1RI9A 2FL7A 2L8DA 5LJ3g 3TU4K 2MPXC 1K0XA 5FWBA 1M8MA 2LDMA 3LX7A 2G3RA 2PNIA 2A28A 5GAMe 1VQNQ 2DXUA 5CAIA 2F2VA 5KH6A 1N8RR 2NUTB 2HCKA 1YJWQ 4LUDA 4N4IA 1K73C 2CZ7B 5GAN2 3PTAA 1YIJQ 4QVZA 3CMEA 1Y57A 4M77B 1TXQA 2ZZDA 3G6ET 3CD6Q 2W0ZA 3EHQA 3RMSA 2JOYA 1TOVA 3VKIA 2PVOB 1KHCA 1VQ5T 3VV0A 2YRCA 3GP8A 3V8LA 1I8FA 1YHQA 1M2OA 1UG1A 1WQWA 1Y96B 5KYXA 1WFWA 4XTWA 1M90C 1SRLA 4FYWB 2RB6A 3CXCS 3EH2A 3M4YA 4ATOA 1BI1A 3A5ZB 2QQ9A 2JMCA 1VQ6A 4Z88A 4E7HA 1V29B 3S3NA 4CC2A 4X9CA 3CCST 1UECA 3ZL7C 2LT1A 2OTLA 1Y07A 1ZLMA 3A1PA 1G3TA 3V8JA 3PNWC 2COWA 3OYYA 3JRZA 3JCMe 4OMLA 2VKNA 5HK0A 4JJBA 3GOXA 2QA4A 1OEBA 1WXTA 4ZTFA 2P0PA 4N4GA 4X1VA 3CBOA 2EKHA 3P8BB 2DAQA 3H6ZA 1GBQA 4CC3A 4AFSC 3OYBA 4C8QA 2DL7A 3M53A 3LWIA 3G71A 1VQLQ 4Z02A 2X4XA 1Q81U 3OSVA 3RUXA 1JXOA 4RG8A 4A4KA 1QCFA 3DKMA 4F7UG 4LDYA 2X4YA 1AOJA 4ZNXA 2RQVA 4DBHA 1UHFA 2BZ8A 1BB9A 2YUOA 1GFCA 1N9SA 2GQIA 3OMGA 1YCYA 1WXUA 3CC7Q 1K4US 2DKGA 2K5FA 1PHTA 1HK9A 5L23A 2O4XA 3CCQT 2HDAA 2FG0A 2RH2A 2EQMA 3MP8A 1VQ9Q 4B6MA 1BCMA 5A0LA 1ZUKA 2QK0A 3HPWA 3OQ5A 2EW3A 4QT7A 3CCJQ 1SRMA 1K8AU 2O88A 2H8HA 1FXXA 1I07A 2CP6A 1LNXA 4DEYA 3CCVT 1VQ7Q 4C92A 3CPFA 3HFOA 2J6KA 4BI4A 1NE8A 3H9NA 4F16A 2CS7A 4A54A 2OTJA 4M78G 1AZGB 5GJWB 4XU1A 3SHWA 3L2WA 4QQ6A 1VQ8Q 2CP2A 1YN8A 3VS4A 3GNGA 3G6EA 4B9XA 2KAFA 2YRDA 4J6YA 3I5SA 3QO3A 1G8XA 2VUBA 3JCMP 3JCMV 1B34A 1Q86U 3HKSA 3C94A 2VGNA 2J7IA 1Q82U 2IG0A 1H3ZA 4PJOA 1T3LA 3ULRB 3CCLA 3HSBA 3FLGA 2QEXT 2J05A 1KSWA 2F5TX 3FJ5A 1Q7YU 2HL3A 2E10A 4J83A 1NJIR 4DBFA 3NPFA 3LGFA 4M77G 4NOYA 3NTHA 4J9DA 4Q5WA 3VS6A 1M27C 1WA7A 4OB2B 1QVFA 2KK4A 1R8OB 2HKQB 3MJXA 3ASKA 1QW1A 1K73U 3QSUA 3G1JA 4EPCA 4N0AC 4D6WA 3DB3A 3V7RA 1M1GA 3DB4A 3OYFA 4E7LA 5IHIA 2LVMA 3I55T 3VS3A 3QWXX 3M56A 3MP6A 1H641 2DMOA 1VUBA 1W4SA 4II1A 1YITQ 4PKCC 5GAN5 4M78E 5KE2A 4J9EA 1M90U 2D1XA 3M54A 1YFNA 3URGA 3MCAB 4M7AA 2QTXA 1MGQA 3OBYA 4ANJA 3SWNA 3QIIA 3NMZC 3CMAA 3CCUQ 2XG8D 1WLPB 1M4ZA 1M3BA 1RADB 2HBPA 4M4ZA 1HXDA 3BY7A 4PFOA 2XIDA 2I2LA 2CH4W 3O5ZA 3TVTA 1BI3A 2LQKA 2JUFA 1VQ5Q 1WHMA 4ME7A 2LX7A 3CC4A 2GCXA 5CQYA 3CXCA 2RJFA 1MV3A 2D0QB 3CBPA 2EQKA 1YJ9A 4OMMA 1KQSP 1E6GA 1IB8A 4NL2A 2C06A 5FROA 1ZBJA 4M77E 1OZ2A 2XU8A 4ZGJB 3PMIA 3CCVA 4M78D 2GQVA 2DBMA 2ZPHB 1TWBA 3A8GB 4ESRA 3CCSQ 3VUZA 2LQWA 5IHNA 4FSXA 3G7ZA 4JJCA 4J9FA 6AT1B 2QG9B 2JTMA 4XU3A 2DM1A 1QVPA 4M78F 1K9MR 1VA7A 5HKCA 2JZ2A 1KC8C 1UDLA 1QWEA 5IHKA 2HL5C 4M75D 5FU7C 8ATCB 1AHJB 1MMAA 2L89A 2HQEA 4M78C 1LPLA 3HP9A 2HZYA 1I5LA 3EG9A 2RK1A 2L3SA 3FIFA 1G83A 2LT4A 1OYXA 2E6ZA 1WI7A 4M7DA 1RAFB 3JV3A 1TUDA 1IGUA 3I56Q 1AT1B 1UE9A 2RI3A 2YSQA 3I9QA 1YI2T 3H8ZA 5GMKj 2KRSA 4EIKA 4M77F 2ABLA 5IN1A 2VXEA 2JTFA 1MNEA 1ZA1B 1N8RC 1UGPB 4M75C 1SHFA 5LJ5h 3CCQQ 1TSFA 3L2QA 2E6NA 3OYKA 2E3IA 2WSFE 3L2VA 1GFDA 3THKA 2MF2A 2CUDA 3QWYA 5KYUB 2JM9A 1BYMA 2NLUA 3VRZA 2MIOA 1KQSS 1N9RA 2RK2A 3OYEA 2DJQA 5A2QE 3CMET 1KQ1A 3QZ5B 1KK7A 4GLKA 5FRMA 1X01A 1M2VB 1PD1A 1PSFA 2E4HA 4OMPA 3M0RA 4J6XA 4QW2A 2NYSA 4JZ3A 2XDBA 1RLPC 1YHQT 2AK5A 1WIEA 5IAYA 4MMLA 4FU6A 3OS5A 1QP2A 5M9OA 1ZSGA 3PMTA 2X4WA 2XDPA 2FRWA 2CP7A 4IUUA 2P0KA 4OMOA 2DVJA 4BD3A 3MPUB 2QEXQ 1VQ6T 1TU0B 5LL6S 5GANd 2PU9B 1TTHB 2DVEA 3CCET 2RD1A 2OTLT 4QVDA 1KD1U 4AG2C 3A8LB 5GANf 2CP5A 4F7UB 1OI1A 2LNHB 4RMOA 2VXFA 3PIOA 1ARKA 5LJ5g 4WF2A 2D8HA 3JB9J 2QA4T 4OGEA 1ZUUA 3RR6A 4PNOA 1WJRA 3OYCA 4HVWA 3FEOA 4JRKA 5CKEA 2L2PA 2LMJA 3JSCA 4E47A 3GNFB 1QKWA 2FPDA 3I55Q 4FW2A 1B7TA 5GMKe 1ZSZC 2KBTA 3G71T 2QYZA 3DLMA 4KGVB 5LJ3d 2EAYA 2E41A 2KGTA 4XK8E 2GGRA 4FT2A 1IXDA 2V8IA 4LDWA 3C95A 4L59A 2JVVA 1TS9A 2V1QA 4VUBA 5J39A 2VB6A 4RG2A 1G5VA 1G3SA 1VQ4T 3NTKA 3QYHB 2NUPA 5GAOn 3JCMc 4GBQA 4E7JA 1BCOA 4QQDA 4LD9K 2DIGA 2KR3A 2NUZA 5CR2A 2LCLA 3TSZA 1JB0E 1ZBXA 3UF4A 3J81E 2MOXA 3QBYA 4LDUA 3BDLA 2JTEA 2HEQA 4PJNA 2K3YA 1RACB 3M4GA 4IKFA 2MMPA 5EC7A 4FYXB 4AFZC 1D1CA 2ZPBB 1B07A 3HTRA 4A4FA 2FVUA 1KC8U 4C92B 5KYYA 2ZGWA 3A8MB 2B8AA 3KBGA 2V26A 2EPDA 3KUFA 3TQ7P 2FPFA 3HRSA 4E7SA 2KY9A 1WHGA 2VC8A 1AZEA 3EGXB 3PIPA 1ZHIA 1ABOA 4IUQA 4OB0B 1JRIA 2CZ0B 2OTJT 4CI0C 4M75B 1YJNT 2CDTA 4AG1C 3H0HA 3M57A 2K57A 1LJOA 2PQWA 1U06A 1VQPT 5DLOA 1M3CA 1P92A 1WPYA 2COZA 2O2OA 1BI0A 1D1AA 1NJIC 1JO8A 1VQOA 2DYBA 1KQ2A 1UJ0A 3D7SB 2CREA 2D0NA 2D6FA 4HKEA 2JS0A 1U3OA 1N8RU 1AWWA 2E70A 3OBWA 4N0AA 3QPHA 4KH1B 4BE2A 3E19A 4C5EA 4LD6A 3CCLT 1NG2A 4PLLA 4ZGDB 2QGFB 1X6BA 1WYXA 4JRIA 2FRYA 1OZ3A 5DLQE 3CCMA 1U1SA 1VIEA 1LOJA 2LP5A 1MUZA 3CCEA 5EG2A 1YWPA 1RI0A 2KDSA 5DM7R 1F1BB 1NLPC 2RMOA 1I4K1 1YI2Q 2IIMA 2JS2A 1SG5A 5KE3A 4BI8B 5HY6A 4D8KA 2RHZA 1OX9A 3E1SA 3LGLA 3RNJA 2P4RA 1S72A 4WTOB 2X4JA 4LNPA 1QVGP 5CKHA 2QAZA 3S3OA 4FIBA 3HHTB 1X27A 1Y0MA 3CPWP 3MEWA 1PC0A 1K76A 4EMHA 3KFVA 2ZPGB 2VGMA 1KQSA 2E65A 3SWNB 1VYTA 3ZFJA 4K11A 1YWOA 2EYXA 3FC3A 2K2VA 1PRMC 2LNVA 2GFUA 2OI3A 4PL6A 3CMAT 1N27A 2P0QA 1NZ9A 4J9HA 3CMEQ 1AWJA 4A63B 1VQ4A 3EAEA 1ZSZB 1T3SA 4J9GA 1M30A 3ZBDA 1ACMB 4HCBA 2K2MA 4BDZA 3LH5A 4C8QG 4HT8A 2JNGA 2LCCA 3CC2T 1M8VA 2F2XA 2BZYA 1YHQQ 1UGRB 4ZGEB 3CC4T 2G6FX 1NEGA 1YJ9T 1K9MC 5KYNA 2XMFA 2VV5A 2PVGB 1NPRA 4MDWA 4QQGA 2E5QA 5IH2A 2A7YA 2OX7A 1VQ6Q 2KRMA 1WX6A 1H92A 1X6GA 4M78A 1H8KA 2AT1B 1WHJA 2JT4A 5GAOm 2K3XA 2OTLQ 3NGPA 2DL5A 5GANe 3TREA 3JB9H 2P84A 3OS1A 1YJNA 3CQTA 1JJ2P 1HJDA 1VQPA 1W6XA 2MCNA 2RA2A 2ED0A 3BW1A 2PUOB 4FSSA 4RTVA 2QA4Q 1BIAA 2DYIA 2ROTA 4RTUA 3BFMA 3OY9A 1MHNA 1PCXA 2DTOA 4JS5A 2XD0A 3EGDA 4C0GA 1MV0B 3META 2Y4XA 3TSWA 2R57A 2QDLA 5GAN6 4C92G 2CSQA 2DRKA 4LE9A 2DF6A 3OB9A 2D9TA 4F7UE 3G71Q 4OP0A 3RKYA 2O31A 2NUTA 3EG2A 1SSHA 1QVGS 2K5LA 2BZXA 1Z9QA 4M75G 3HRTA 4M77A 2RJDA 4XTXA 2RJEA 2HAXA 3CPWS 4EMKC 4ZTJA 1W2BP 2HBWA 2DIQA 2W10A 1Y96A 3OYIA 2XI9A 3MO8A 4XTZA 4HCKA 5CK9A 3EFRA 3CCRA 2DE0X 2LJ3A 2FEIA 1QMCA 3PFSA 3VJPA 4HT9A 2I0NA 1NJIU 2ECZA 4RCBA 2DO3A 4D8DA 1V1CA 4IUTA 1Y71A 4J9BA 4R0KA 4XTVA 2FB7A 2P4TA 3RKWA 3VS5A 2X9HA 3ZEHA 1OPLA 1Y7XA 1TUCA 5KYWB 3V8KA 2HSEB 4XQ3A 1OULA 3A8OB 2EQJA 4Y28E 3PVLA 2OTJQ 4PJLA 5D6YA 2EGAA 1VQKA 1RAHB 2KYMA 4FL6A 3RESA 4JJNK 3OW2S 4F7UF 3QUIA 4C8QD 4A53A 3HL8A 4C92E 1FYNA 3G6EQ 3AHUA 5GAOp 2O9SA 2DL8A 2YXYA 1RUWA 1B3QA 1XJWB 1KIKA 4RTYA 1JJ2S 3CC2A 3H0FA 2YWWA 4M75E 3I5RA 1IRXA 2MWOA 1UB4A 4M7AG 2RHXA 1SHGA 1WZOA 5GAN3 3JCMJ 1IHWA 5C6SA 5IXBA 3CCLQ 2K3BA 2L3RA 3TEEA 5GAMh 1WNLA 2KE9A 2KRNA 2GTOA 1CKBA 5DY9A 3X24B 3LWHA 2KQWA 1WDXA 3SB2A 4C8QC 1PKTA 3JCMW 3QDRB 1SEMA 1VQMT 1BKBA 3EH1A 1O9SA 4C5IA 1YBYA 2MK5A 3MHXA 1Q95G 3C0CA 5CQXA 2DPPB 4C0ZA 4ZN3A 3G4ST 2RJCA 3VS2A 4C92D 3L2UA 4A4GA 1TUGB 5I22A 2DTIA 4JRPA 2PVDB 4RCCA 1W2BS 1MMDA 4MDXA 2CKKA 2K4YA 2XDDA 1YJWT 3RKXA 1E7OA 4J9IA 4L5GA 4BB7A 3JB9D 2GFAA 4EMGA 1K9MU 2EFIA 2EQUA 1BIBA 1GCQC 3JCMh 3VU3C 1NM7A 2X35A 2GNCA 5FU6C 5KCOA 4M75F 3CMAQ 1D3BA 4FW1A 2DXTA 2EYZA 2QXFA 2DXBA 4C92C 2OAWA 1X43A 4PJOD 1VOMA 2QASA 4IIMA 1PD0A 5FWCA 2DL4A 1IZ6A 3S3MA 2EYQA 4J9CA 1QKXA 3EFOB 2JMAA 2RQRA 4JDSA 3WXMB 1M3AA 1X75C 3CC2Q 3OYLA 3OMCA 4DOVA 5CKBA 3VRYA 2CP3A 1NBEB 3M0PA 2RI5A 2C0IA 5GAMg 3CC4Q 3NTIA 5ECAA 4P5NA 1NPPA 2CT4A 5CO7A 1YJ9Q 1M1KR 4EMKB 3QKJA 1C6VX 4A4HA 4M7DG 2HMAA 2FYKA 4JUVA 2EKOA 4IUPA 3CCVQ 1X69A 2XICA 1LVKA 1A0NB 5GAOr 3L1AA 4IUVA 2XK0A 1UJYA 2ZAEA 5LJ5d 1X2QA 1WGSA 1BBZA 4LDVA 1HSQA 4KBMB 3PE0A 1MNDA 5LJ5f 1VQOT 3UATA 5D6XA 2YUQA 5GAOq 3EG0A 3OYMA 4TVRA 2L3QA 3UPUA 1SSFA 5KYXB 3X28B 4M7AD 4JZ4A 3F70A 2DL3A 1FX7A 4KUIA 3M59A 4OVAA 1RAEB 3JCMg 2LJ0A 4ORZA 2K5IA 3O8VA 3RERA 1PM3A 3AT1B 5KCHA 3V7CA 2XKOC 1GCPA 3CCMT 1AD5A 2BE9B 1D0YA 3CPWA 1EX4A 3PT9A 2XHCA 4KUDK 2V1RA 1KD1R 4E2FB 2LJ1A 3QYGB 3DLLA 4BY6B 1VQMA 5I21A 1R0CB 3RMQA 4M7AC 2L0AA 1VQ7T 2QQSA 1S72T 3G4SA 3MEUA 4JS4A 4JRQA 3SWNC 2YRVA 3UDCA 5IXFA 1C0MA 1XTDA 3QHSA 3VS7A 2EYWA 1FMWA 1LCKA 5I2SA 3VS1A 2LTOA 2SEMA 3SDZA 3QDFA 2DTHA 4C8QB 1ZUYA 4IURA 1VQNA 4V2SA 4Z89A 3N5BB 1VQ8T 4E7KA 1ZA2B 1YJWA 3M0UA 2ZCFB 1YIJA 2K6DA 1KFZA 3R6OA 4PLIA 3SFMA 1WJQA 2PTKA 2BE7D 3CD6A 1OX8A 5LJ3f 5GMKi 2AZVA 2FZCB 3RIRA 4GLMA 1T0JA 1PKSA 1UGQB 2VYTA 3MEVA 4BACA 2CSIA 4KRTA 4FCYA 3C4SA 4JLGA 4JPBW 3MKDA 4E7IA 3FDRA 4MZTA 3WVDB 1R77A 3UWNA 1JJ2A 2O4XB 5J26A 5A0DA 2ZPIB 2DEQA 2K9GA 2CP0A 5GMKm 3JCMb 2V8JA 1SF9A 1AVZC 5FU6B 5HK3A 4M7DD 1G3WA 5GAN7 2OJ2A 4HVVA 3GF5A 2GBQA 2F1LA 3JCMX 2RPNA 5D6WA 3INZA 3V7SA 3NFCA 3FB9A 2LC4A 2F5KA 1KG1A 1UUEA 1D0XA 2R5MA 1OU9A 3FRNA 1D09B 2NWMA 4RTXA 4O6JA 1NEBA 2YUNA 2K7AA 1QQJA 1VQLA 2B86A 1MMGA 1W2BA 5KYUA 3HFNA 1CSKA 5AYFA 4M7DC 2QI2A 2F69A 5CIUA 7AT1B 3E2UA 1B34B 4IIOA 2EJ9A 3R6NA 2J06A 3EGUA 4PJOB 3CCUT 2HKNA 5GANj 4LUEA 4BDYA 2RN8A 9ATCB 3PVQA 1QCNA 3GPLA 4QKUA 2C0OA 2L3PA 1OV3A 3CC7A 3VYHB 1AWXA 2CZ1B 4XTYA 1M2VA 2X51A 2F2WA 1BI2A 1GXIE 1NYGA 2ESWA 4RTTA 2AIRB 1VQ9A 3QXEB 2QQBA 4LXCA 3CCRT 3CCJA 4J6WA 1SPKA 2L5QA 2RO0A 4KULA 1VQ7A 5LJ3j 4A4EA 1ABQA 2LX9A 3GLXA 1PG5B 2BUDA 1WHLA 1TH7A 2AKLA 2C0TA 2LRQA 3VUBA 1G2BA 3L42A 3JCMQ 2E1HA 2DILA 1VQ8A 4F7UA 4NL3A 2DNUA 1QCOA 1Q81R 2KNBB 2COYA 2X3XD 4M7AB 3M58A 2CUBA 4MZPA 5GAOl 1ZX6A 4RUGA 1VQKT 4PK4A 4BE0A 2EGCA 2RQTA 1EIFA 1UFFA 2DK3A 2EJFA 4CC4B 2KSSA 4HXJA 5LJ5e 2DD5A 3LW5E 1VQOQ 4MZMA 4DOWA 4QVCA 2CYZB 4OMNA 4FYVB 4Y91A 1WQ7A 4MMKA 1YP5A 4AFUC 2KT8A 1I1JA 4RTWA 3L2ZA 2ZPEB 2EIFA 4KT0E 3JB9I 3LH0A 2BKDN 3I56T 2RI2A 3I35A 2DZCA 1IREB 3ME9A 4HCZA 1BK2A 1U1TA 2M02A 1K8AR 3OW2P 2Y90A 2FHDA 3CCMQ 2YLCA 3GIBA 3OYAA 4C5HA 3CCEQ 1M9SA 4OB3B 3QZ9B 3M55A 2YLBA 1PSEA 1GCQA 5FLXE 4Z8AA 2WSCE 5FRNA 3WVEB 3TCJA 4BE1A 3MEAA 2KEAA 2QDYB 2CZ6B 3QG1A 1YITA 2V8KA 1PNJA 1S72Q 1DJ7B 2DD4A 4J7IA 4NS5A 4CC7A 1K1ZA 3M0SA 2BTTA 1CKAA 3EGXA 3OA6A 4X9DA 2RHIA 4M75A 1Q86R 3CCUA 1Q82R 1RAAB 2M0OA 3EG1A 4R56A 2FPEA 1M1FA 3UA7A 3EG9B 2ROLA 5LJ3e 2Y4YA 2KVQG 4B9WA 2R5AA 1D3BB 1XOVA 8AT1B 1Q7YR 3LLRA 1M1KC 1OOTA 4M7DB 2DJZA 4OGCA 5GAN8 3JB9G 2HNIA 2EBPA 4DBQA 1VQ5A 2DETA 4J5YA 4XTUA 4C8QE 1VQ4Q 2Z0WA 1TG0A 3P8HA 3A8HB 5CKDA 1FMKA 1K73R 4CRIA 5GMKh 2EGEA 4DBRA 4PJOG 1BU1A 2KT1A 3LYIA 1UGSB 3BE3A 4BI3A 3CCSA 1WHKA 1M5Q1 2HQHA 4N4HA 2IVWA 4WCIA 1VIFA 3M0QA 2GTJA 2IPOB 2M16A 3P8DA 2R58A 1M90R 5CKFA 3X25B 1IGQA 2RF0A 5I2MA 1JU5C 1YJNQ 5HCKA 1IHVA 4XAXB 1VQPQ 1YNZA 2ED1A 2EQIA 1U8RA 5GAN4 1K9AA 4LN2A 2MAMA 4L6V5 2E12A 2H3EB 1KD1C 1AEYA 2RQUA 2K79A 1WJSA 4DEXA 2M1HA 2ENMA 1ZQ1A 1UGVA 4HA8A 4O5VA 1JXMA 4XU2A 2A0FB 2ATCB 4C8QF 4BY6C 2SRCA 3IQLA 4AT1B 3RBBB 4ELYC 3I56A 4X34A 4C0FA 1RAGB 2EYYA 3CBMA 3EFSA 3REAB 4F17A 2X3WD 2CGHA 1XQHA 1ZSZA 2DERA 4KGXB 3H0IA 1N6AA 2DA9A 1FWZA 2GF7A 5CVIA 5CCAA 3CCQA 1EFNA 4KH0B 2KMTA 4FT4A 1H3HA 3M0TA 4HVUA 2PZ1A 1EZZB 2RNAA 4PJOE 2HSPA 1JEGA 2AHJB 2O9VA 4C0DC 2QQRA 3RDVA 3CCRQ 4HCCA 1RLQC 1N5ZA 3QJ6A 4RTZA 2D8JA 2AZSA 2YHTA 5GAMd 4DQ2A 1IO6A 5I11A 2WSEE 1VQNT 5GAMf 4F04B 1FMVA 1W70A 1YIJT 1E6HA 2LQ8A 1KHIA 2YT6A 4C92F 1J3TA 4PJMA 3CD6T 2DX1A 2RM4A 3J80E 4J8OA 5A0GA 2VWFA 3KXTA 1VQKQ 2H3JA 4KGZB 2NUPB 1QWFA 3UT1A 3QJYA 3MP1A 4AFQC 3JB9F 1I0CA 2QTVA 3U23A 3FJPA 1K0SA 2M51A 1V76A 4M77D 4M7AE 2QEXA 1I81A 2KXCA 4GY5A 1R0BG 3JCMd 4LDXA 5KYYB 1SKUB 3REBB 4AMCA 4PJOF 1WXBA 2JN0A 3M9QA 3JCMf 5J3BA 2DZ9A 1GBRA 3JAME 3SEMA 4PFZA 4EDUA 2ZPFB 1C1AA 1NYFA 4JJDA 2EVRA 2A36A 4PJOC 3ER0A 4FYYB 1M1KU 3I55A 2VVKA 1YCSB 4M77C
chains in the Genus database with same CATH topology
2BZYA 1OPKA 1WLPB 2G6FX 2KYBA 1M3BA 1NEGA 3A98A 1UUEA 4M4ZA 1JQQA 1PRLC 3UA6A 2XMFA 2NWMA 4RTXA 2CH4W 3O5ZA 3TVTA 5IH2A 1AWOA 1NEBA 2KRMA 1WX6A 1H92A 2YUNA 2K7AA 1X6GA 1H8KA 3GBQA 2LX7A 2B86A 2JT4A 3NGPA 2DL5A 1CSKA 1S1NA 1MV3A 4OMMA 1W1FA 1E6GA 1UHCA 4IIOA 3CQTA 3R6NA 1ZBJA 2J06A 1HJDA 3EGUA 2DRMA 1W6XA 2MCNA 3NHNA 2ED0A 4FSSA 4RTVA 2ROTA 4RTUA 4LUEA 4OMQA 2RN8A 2DBMA 3PVQA 1MV0B 4ESRA 2C0OA 2LQWA 2JXBA 5IHNA 2L3PA 1OV3A 3TSWA 2QDLA 4JJCA 4J9FA 1KJWA 1AWXA 2CSQA 2DRKA 2DF6A 4LE9A 2A08A 4F14A 2DM1A 2DBKA 2F2WA 2CT3A 2O31A 3EG3A 1NYGA 2ESWA 3EG2A 1VA7A 1SSHA 2KXDA 4RTTA 2BZXA 1Z9QA 1GL5A 2KROA 2JW4A 1UDLA 2M0YA 1QWEA 5IHKA 1SPKA 1HD3A 1NLOC 1ABQA 3H41A 2HBWA 2W10A 3EHRA 2AKLA 2C0TA 2YDLA 1G2BA 4HCKA 1T0HA 4E6RA 2DILA 2DE0X 2LJ3A 2FEIA 2L3SA 2DNUA 1G83A 1WI7A 2I0NA 2KNBB 2X3XD 3JV3A 1TUDA 5FW9A 2ECZA 2CUBA 2JM8A 1UE9A 1VYVA 2YSQA 3I9QA 1ZX6A 4RUGA 4D8DA 1V1CA 2KRSA 2A37A 1PWTA 4J9BA 4EIKA 2EGCA 2ABLA 2RQTA 4R0KA 2LCSA 1UFFA 4Y92A 2FO0A 4CC4B 3VS5A 1OPLA 4HXJA 1SHFA 1TUCA 2E5KA 2CH4A 2RQWA 4OMNA 3PVLA 2LZ6B 2EGAA 1GFDA 1YP5A 4AFUC 2KT8A 2KYMA 1I1JA 5GJVB 3THKA 2YUPA 2CUDA 4RTWA 3VS0A 2J6OA 3QWYA 2J6FA 1FYNA 2JM9A 1UTIA 1QLYA 2AKKA 2LQNA 3I35A 1Z9ZA 1GRIA 1U5SA 1VYUA 2O9SA 2MIOA 3VRZA 2DL8A 1RUWA 1BK2A 1B3QA 2DLPA 1KIKA 4RTYA 1X2KA 3H0FA 2DJQA 1RI9A 3I5RA 1K0XA 5FWBA 1M8MA 1SHGA 2PNIA 4OMPA 1GCQA 5IXBA 2K3BA 4Z8AA 2A28A 3M0RA 2F2VA 2KE9A 2KRNA 4JZ3A 2GTOA 1CKBA 2HCKA 1RLPC 4LUDA 2AK5A 1WIEA 2KEAA 1WDXA 1PNJA 1ZSGA 1Y57A 1PKTA 2W0ZA 1SEMA 2FRWA 3EHQA 4CC7A 4OMOA 1K1ZA 2DVJA 3M0SA 2BTTA 1CKAA 3C0CA 3VS2A 1UG1A 3EG1A 1WFWA 2FPEA 5I22A 4AG2C 3UA7A 2ROLA 1SRLA 2LNHB 1XOVA 1ARKA 1OOTA 2D8HA 1ZUUA 1E7OA 2EBPA 2JMCA 4HVWA 4Z88A 4J9IA 4CC2A 2L2PA 1UECA 2LMJA 3ZL7C 1ZLMA 1TG0A 1QKWA 2FPDA 1GCQC 1FMKA 1NM7A 2GNCA 4OMLA 2VKNA 2KBTA 4JJBA 2EGEA 1BU1A 1OEBA 2EYZA 2KGTA 1WXTA 2KT1A 4X1VA 2EKHA 2GGRA 2OAWA 1X43A 4IIMA 5FWCA 2DL4A 1GBQA 4WCIA 4J9CA 1QKXA 2V1QA 2JMAA 4CC3A 4AFSC 2RQRA 3M0QA 1M3AA 2GTJA 2DL7A 3VRYA 3M0PA 2C0IA 5ECAA 1JXOA 2CT4A 4GBQA 2RF0A 1JU5C 2KR3A 1QCFA 2NUZA 5HCKA 3TSZA 3UF4A 1YNZA 1AOJA 2ED1A 2MOXA 2EQIA 4ZNXA 2RQVA 1UHFA 2JTEA 2BZ8A 1BB9A 1K9AA 1GFCA 1X69A 2YUOA 4LN2A 2GQIA 2HEQA 1AEYA 1A0NB 2RQUA 1WXUA 2K79A 4DEXA 5EC7A 4AFZC 1B07A 1UJYA 2ENMA 1K4US 1X2QA 1UGVA 1BBZA 1PHTA 1HSQA 1JXMA 2EPDA 3PE0A 2FPFA 5L23A 2SRCA 3IQLA 3UATA 2HDAA 2FG0A 1AZEA 1ABOA 2YUQA 3RBBB 3EG0A 2EYYA 2L3QA 2CDTA 3REAB 4AG1C 1ZUKA 4F17A 3H0HA 2EW3A 1U06A 2X3WD 4QT7A 1M3CA 4JZ4A 2DL3A 1SRMA 2O88A 2H8HA 3H0IA 2DA9A 1I07A 2O2OA 4DEYA 2J6KA 1EFNA 1JO8A 2LJ0A 2DYBA 4ORZA 1H3HA 1UJ0A 3M0TA 4HVUA 2PZ1A 2RNAA 4F16A 2CREA 2D0NA 2HSPA 1JEGA 2O9VA 1GCPA 2JS0A 1U3OA 1AD5A 1AZGB 5GJWB 3SHWA 1AWWA 1RLQC 1N5ZA 2V1RA 1YN8A 4RTZA 2D8JA 2AZSA 2LJ1A 3VS4A 1IO6A 5I11A 1NG2A 1X6BA 3I5SA 1WYXA 2FRYA 1W70A 1E6HA 2L0AA 2YT6A 2LP5A 1MUZA 1J3TA 5IXFA 3VS7A 2DX1A 1YWPA 2J7IA 2EYWA 1LCKA 3VS1A 1T3LA 2SEMA 1NLPC 2RMOA 2VWFA 3ULRB 2IIMA 1ZUYA 2JS2A 2J05A 1KSWA 4Z89A 3FJ5A 4D8KA 1QWFA 3RNJA 3M0UA 2K6DA 1KFZA 3NPFA 2P4RA 4AFQC 2PTKA 1I0CA 4LNPA 3U23A 1K0SA 4J9DA 2M51A 3VS6A 2AZVA 4GLMA 1M27C 1WA7A 1T0JA 1PKSA 2CSIA 1X27A 1Y0MA 4KRTA 2KXCA 4JPBW 1K76A 3KFVA 3REBB 5IHIA 1VYTA 1WXBA 4K11A 1YWOA 2EYXA 3QWXX 3VS3A 1PRMC 2DMOA 2OI3A 3SEMA 1GBRA 2K9GA 1NYFA 4J9HA 1AVZC 4JJDA 1AWJA 4A63B 4J9EA 1T3SA 2OJ2A 4HVVA 2D1XA 2EVRA 1M30A 4J9GA 2A36A 2GBQA 2K2MA 3LH5A 2RPNA 2VVKA 1YCSB 2F2XA 3NMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZY A;  1OPK A;  1WLP B;  2G6F X;  2KYB A;  1M3B A;  1NEG A;  3A98 A;  1UUE A;  4M4Z A;  1JQQ A;  1PRL C;  3UA6 A;  2XMF A;  2NWM A;  4RTX A;  2CH4 W;  3O5Z A;  3TVT A;  5IH2 A;  1AWO A;  1NEB A;  2KRM A;  1WX6 A;  1H92 A;  2YUN A;  2K7A A;  1X6G A;  1H8K A;  3GBQ A;  2LX7 A;  2B86 A;  2JT4 A;  3NGP A;  2DL5 A;  1CSK A;  1S1N A;  1MV3 A;  4OMM A;  1W1F A;  1E6G A;  1UHC A;  4IIO A;  3CQT A;  3R6N A;  1ZBJ A;  2J06 A;  1HJD A;  3EGU A;  2DRM A;  1W6X A;  2MCN A;  3NHN A;  2ED0 A;  4FSS A;  4RTV A;  2ROT A;  4RTU A;  4LUE A;  4OMQ A;  2RN8 A;  2DBM A;  3PVQ A;  1MV0 B;  4ESR A;  2C0O A;  2LQW A;  2JXB A;  5IHN A;  2L3P A;  1OV3 A;  3TSW A;  2QDL A;  4JJC A;  4J9F A;  1KJW A;  1AWX A;  2CSQ A;  2DRK A;  2DF6 A;  4LE9 A;  2A08 A;  4F14 A;  2DM1 A;  2DBK A;  2F2W A;  2CT3 A;  2O31 A;  3EG3 A;  1NYG A;  2ESW A;  3EG2 A;  1VA7 A;  1SSH A;  2KXD A;  4RTT A;  2BZX A;  1Z9Q A;  1GL5 A;  2KRO A;  2JW4 A;  1UDL A;  2M0Y A;  1QWE A;  5IHK A;  1SPK A;  1HD3 A;  1NLO C;  1ABQ A;  3H41 A;  2HBW A;  2W10 A;  3EHR A;  2AKL A;  2C0T A;  2YDL A;  1G2B A;  4HCK A;  1T0H A;  4E6R A;  2DIL A;  2DE0 X;  2LJ3 A;  2FEI A;  2L3S A;  2DNU A;  1G83 A;  1WI7 A;  2I0N A;  2KNB B;  2X3X D;  3JV3 A;  1TUD A;  5FW9 A;  2ECZ A;  2CUB A;  2JM8 A;  1UE9 A;  1VYV A;  2YSQ A;  3I9Q A;  1ZX6 A;  4RUG A;  4D8D A;  1V1C A;  2KRS A;  2A37 A;  1PWT A;  4J9B A;  4EIK A;  2EGC A;  2ABL A;  2RQT A;  4R0K A;  2LCS A;  1UFF A;  4Y92 A;  2FO0 A;  4CC4 B;  3VS5 A;  1OPL A;  4HXJ A;  1SHF A;  1TUC A;  2E5K A;  2CH4 A;  2RQW A;  4OMN A;  3PVL A;  2LZ6 B;  2EGA A;  1GFD A;  1YP5 A;  4AFU C;  2KT8 A;  2KYM A;  1I1J A;  5GJV B;  3THK A;  2YUP A;  2CUD A;  4RTW A;  3VS0 A;  2J6O A;  3QWY A;  2J6F A;  1FYN A;  2JM9 A;  1UTI A;  1QLY A;  2AKK A;  2LQN A;  3I35 A;  1Z9Z A;  1GRI A;  1U5S A;  1VYU A;  2O9S A;  2MIO A;  3VRZ A;  2DL8 A;  1RUW A;  1BK2 A;  1B3Q A;  2DLP A;  1KIK A;  4RTY A;  1X2K A;  3H0F A;  2DJQ A;  1RI9 A;  3I5R A;  1K0X A;  5FWB A;  1M8M A;  1SHG A;  2PNI A;  4OMP A;  1GCQ A;  5IXB A;  2K3B A;  4Z8A A;  2A28 A;  3M0R A;  2F2V A;  2KE9 A;  2KRN A;  4JZ3 A;  2GTO A;  1CKB A;  2HCK A;  1RLP C;  4LUD A;  2AK5 A;  1WIE A;  2KEA A;  1WDX A;  1PNJ A;  1ZSG A;  1Y57 A;  1PKT A;  2W0Z A;  1SEM A;  2FRW A;  3EHQ A;  4CC7 A;  4OMO A;  1K1Z A;  2DVJ A;  3M0S A;  2BTT A;  1CKA A;  3C0C A;  3VS2 A;  1UG1 A;  3EG1 A;  1WFW A;  2FPE A;  5I22 A;  4AG2 C;  3UA7 A;  2ROL A;  1SRL A;  2LNH B;  1XOV A;  1ARK A;  1OOT A;  2D8H A;  1ZUU A;  1E7O A;  2EBP A;  2JMC A;  4HVW A;  4Z88 A;  4J9I A;  4CC2 A;  2L2P A;  1UEC A;  2LMJ A;  3ZL7 C;  1ZLM A;  1TG0 A;  1QKW A;  2FPD A;  1GCQ C;  1FMK A;  1NM7 A;  2GNC A;  4OML A;  2VKN A;  2KBT A;  4JJB A;  2EGE A;  1BU1 A;  1OEB A;  2EYZ A;  2KGT A;  1WXT A;  2KT1 A;  4X1V A;  2EKH A;  2GGR A;  2OAW A;  1X43 A;  4IIM A;  5FWC A;  2DL4 A;  1GBQ A;  4WCI A;  4J9C A;  1QKX A;  2V1Q A;  2JMA A;  4CC3 A;  4AFS C;  2RQR A;  3M0Q A;  1M3A A;  2GTJ A;  2DL7 A;  3VRY A;  3M0P A;  2C0I A;  5ECA A;  1JXO A;  2CT4 A;  4GBQ A;  2RF0 A;  1JU5 C;  2KR3 A;  1QCF A;  2NUZ A;  5HCK A;  3TSZ A;  3UF4 A;  1YNZ A;  1AOJ A;  2ED1 A;  2MOX A;  2EQI A;  4ZNX A;  2RQV A;  1UHF A;  2JTE A;  2BZ8 A;  1BB9 A;  1K9A A;  1GFC A;  1X69 A;  2YUO A;  4LN2 A;  2GQI A;  2HEQ A;  1AEY A;  1A0N B;  2RQU A;  1WXU A;  2K79 A;  4DEX A;  5EC7 A;  4AFZ C;  1B07 A;  1UJY A;  2ENM A;  1K4U S;  1X2Q A;  1UGV A;  1BBZ A;  1PHT A;  1HSQ A;  1JXM A;  2EPD A;  3PE0 A;  2FPF A;  5L23 A;  2SRC A;  3IQL A;  3UAT A;  2HDA A;  2FG0 A;  1AZE A;  1ABO A;  2YUQ A;  3RBB B;  3EG0 A;  2EYY A;  2L3Q A;  2CDT A;  3REA B;  4AG1 C;  1ZUK A;  4F17 A;  3H0H A;  2EW3 A;  1U06 A;  2X3W D;  4QT7 A;  1M3C A;  4JZ4 A;  2DL3 A;  1SRM A;  2O88 A;  2H8H A;  3H0I A;  2DA9 A;  1I07 A;  2O2O A;  4DEY A;  2J6K A;  1EFN A;  1JO8 A;  2LJ0 A;  2DYB A;  4ORZ A;  1H3H A;  1UJ0 A;  3M0T A;  4HVU A;  2PZ1 A;  2RNA A;  4F16 A;  2CRE A;  2D0N A;  2HSP A;  1JEG A;  2O9V A;  1GCP A;  2JS0 A;  1U3O A;  1AD5 A;  1AZG B;  5GJW B;  3SHW A;  1AWW A;  1RLQ C;  1N5Z A;  2V1R A;  1YN8 A;  4RTZ A;  2D8J A;  2AZS A;  2LJ1 A;  3VS4 A;  1IO6 A;  5I11 A;  1NG2 A;  1X6B A;  3I5S A;  1WYX A;  2FRY A;  1W70 A;  1E6H A;  2L0A A;  2YT6 A;  2LP5 A;  1MUZ A;  1J3T A;  5IXF A;  3VS7 A;  2DX1 A;  1YWP A;  2J7I A;  2EYW A;  1LCK A;  3VS1 A;  1T3L A;  2SEM A;  1NLP C;  2RMO A;  2VWF A;  3ULR B;  2IIM A;  1ZUY A;  2JS2 A;  2J05 A;  1KSW A;  4Z89 A;  3FJ5 A;  4D8K A;  1QWF A;  3RNJ A;  3M0U A;  2K6D A;  1KFZ A;  3NPF A;  2P4R A;  4AFQ C;  2PTK A;  1I0C A;  4LNP A;  3U23 A;  1K0S A;  4J9D A;  2M51 A;  3VS6 A;  2AZV A;  4GLM A;  1M27 C;  1WA7 A;  1T0J A;  1PKS A;  2CSI A;  1X27 A;  1Y0M A;  4KRT A;  2KXC A;  4JPB W;  1K76 A;  3KFV A;  3REB B;  5IHI A;  1VYT A;  1WXB A;  4K11 A;  1YWO A;  2EYX A;  3QWX X;  3VS3 A;  1PRM C;  2DMO A;  2OI3 A;  3SEM A;  1GBR A;  2K9G A;  1NYF A;  4J9H A;  1AVZ C;  4JJD A;  1AWJ A;  4A63 B;  4J9E A;  1T3S A;  2OJ2 A;  4HVV A;  2D1X A;  2EVR A;  1M30 A;  4J9G A;  2A36 A;  2GBQ A;  2K2M A;  3LH5 A;  2RPN A;  2VVK A;  1YCS B;  2F2X A;  3NMZ C; 
#chains in the Genus database with same CATH topology
 1OPK A;  2RHU A;  4DA4 A;  1VQL T;  3OSS C;  2KYB A;  1UEB A;  3OYN A;  3A98 A;  1QP3 A;  3C12 A;  1JQQ A;  1PRL C;  3UA6 A;  2DXC A;  2FZK B;  5KYW A;  2MI6 A;  1QVF P;  1AWO A;  4C5G A;  2EJG A;  1QVG A;  3GBQ A;  4BUG A;  2HD0 A;  1S1N A;  3CC7 T;  5GAN h;  4E7Z A;  1W1F A;  1UHC A;  2DFU A;  4UC4 A;  4M7A F;  1XNI A;  2DRM A;  3Q1J A;  3NHN A;  1RAB B;  2BIV A;  2M9U A;  4OMQ A;  3OYD A;  5GAM j;  3M5A A;  1Q81 C;  5L8R E;  1VQ9 T;  1HYO A;  4XU0 A;  2KI7 A;  2A3L A;  2JXB A;  3CCJ T;  1KJW A;  3OYH A;  2A08 A;  4F14 A;  2DBK A;  4YTL A;  3X20 B;  4ZN1 A;  3CEY A;  2CT3 A;  5GMK l;  3EG3 A;  1RAI B;  4M7D E;  1G3Y A;  3S6W A;  1JBM A;  1MMN A;  2KXD A;  4ELZ C;  4PJJ A;  5LJ3 h;  2O01 E;  1OQK A;  1GL5 A;  2KRO A;  2JW4 A;  2QGG A;  5IT9 E;  2M0Y A;  2E3H A;  4C0D B;  1HD3 A;  1NLO C;  5C0M A;  3OS0 A;  3H41 A;  1I5O B;  4RKU E;  3CXC P;  3EHR A;  2YDL A;  3OW2 A;  3OYG A;  3BDU A;  1T0H A;  4E6R A;  4PFP A;  4J7F A;  1K8A C;  2WAC A;  5FW9 A;  3OYJ A;  4OB1 B;  2PUK B;  1D0Z A;  2JM8 A;  1VYV A;  4FM4 B;  2RHY A;  3E9G A;  1X6O A;  2A37 A;  5AT1 B;  1PWT A;  2HQX A;  2LCS A;  1OU8 A;  4JLI A;  4Y92 A;  3PGG A;  2MYS A;  2FO0 A;  5GAN g;  3VYG A;  2EWN A;  3L2R A;  2E5K A;  2CH4 A;  2DEU A;  5FU7 B;  2RQW A;  1KC8 R;  1D1B A;  1YI2 A;  2LZ6 B;  4OMF B;  2VAS A;  4M78 B;  5GJV B;  3VS0 A;  5LJ5 j;  2YUP A;  3OS2 A;  2J6O A;  2QQA A;  4R55 A;  1QVF S;  2JJ9 A;  2J6F A;  2MWP A;  3SD4 A;  3J7A F;  1Q86 C;  4M7D F;  3EFO A;  3HRU A;  1UTI A;  1QLY A;  2AKK A;  2LQN A;  2OAU A;  1O75 A;  1Z9Z A;  3X26 B;  1Q82 C;  1WHH A;  3E9F A;  5D7U A;  1VQM Q;  1GRI A;  1U5S A;  1VYU A;  2E64 A;  4OF1 A;  3T9N A;  2DLP A;  3EGD B;  1X2K A;  1YIT T;  1Q7Y C;  4EMK A;  3G4S Q;  2FZG B;  1RL2 A;  1RI9 A;  2FL7 A;  2L8D A;  5LJ3 g;  3TU4 K;  2MPX C;  1K0X A;  5FWB A;  1M8M A;  2LDM A;  3LX7 A;  2G3R A;  2PNI A;  2A28 A;  5GAM e;  1VQN Q;  2DXU A;  5CAI A;  2F2V A;  5KH6 A;  1N8R R;  2NUT B;  2HCK A;  1YJW Q;  4LUD A;  4N4I A;  1K73 C;  2CZ7 B;  5GAN 2;  3PTA A;  1YIJ Q;  4QVZ A;  3CME A;  1Y57 A;  4M77 B;  1TXQ A;  2ZZD A;  3G6E T;  3CD6 Q;  2W0Z A;  3EHQ A;  3RMS A;  2JOY A;  1TOV A;  3VKI A;  2PVO B;  1KHC A;  1VQ5 T;  3VV0 A;  2YRC A;  3GP8 A;  3V8L A;  1I8F A;  1YHQ A;  1M2O A;  1UG1 A;  1WQW A;  1Y96 B;  5KYX A;  1WFW A;  4XTW A;  1M90 C;  1SRL A;  4FYW B;  2RB6 A;  3CXC S;  3EH2 A;  3M4Y A;  4ATO A;  1BI1 A;  3A5Z B;  2QQ9 A;  2JMC A;  1VQ6 A;  4Z88 A;  4E7H A;  1V29 B;  3S3N A;  4CC2 A;  4X9C A;  3CCS T;  1UEC A;  3ZL7 C;  2LT1 A;  2OTL A;  1Y07 A;  1ZLM A;  3A1P A;  1G3T A;  3V8J A;  3PNW C;  2COW A;  3OYY A;  3JRZ A;  3JCM e;  4OML A;  2VKN A;  5HK0 A;  4JJB A;  3GOX A;  2QA4 A;  1OEB A;  1WXT A;  4ZTF A;  2P0P A;  4N4G A;  4X1V A;  3CBO A;  2EKH A;  3P8B B;  2DAQ A;  3H6Z A;  1GBQ A;  4CC3 A;  4AFS C;  3OYB A;  4C8Q A;  2DL7 A;  3M53 A;  3LWI A;  3G71 A;  1VQL Q;  4Z02 A;  2X4X A;  1Q81 U;  3OSV A;  3RUX A;  1JXO A;  4RG8 A;  4A4K A;  1QCF A;  3DKM A;  4F7U G;  4LDY A;  2X4Y A;  1AOJ A;  4ZNX A;  2RQV A;  4DBH A;  1UHF A;  2BZ8 A;  1BB9 A;  2YUO A;  1GFC A;  1N9S A;  2GQI A;  3OMG A;  1YCY A;  1WXU A;  3CC7 Q;  1K4U S;  2DKG A;  2K5F A;  1PHT A;  1HK9 A;  5L23 A;  2O4X A;  3CCQ T;  2HDA A;  2FG0 A;  2RH2 A;  2EQM A;  3MP8 A;  1VQ9 Q;  4B6M A;  1BCM A;  5A0L A;  1ZUK A;  2QK0 A;  3HPW A;  3OQ5 A;  2EW3 A;  4QT7 A;  3CCJ Q;  1SRM A;  1K8A U;  2O88 A;  2H8H A;  1FXX A;  1I07 A;  2CP6 A;  1LNX A;  4DEY A;  3CCV T;  1VQ7 Q;  4C92 A;  3CPF A;  3HFO A;  2J6K A;  4BI4 A;  1NE8 A;  3H9N A;  4F16 A;  2CS7 A;  4A54 A;  2OTJ A;  4M78 G;  1AZG B;  5GJW B;  4XU1 A;  3SHW A;  3L2W A;  4QQ6 A;  1VQ8 Q;  2CP2 A;  1YN8 A;  3VS4 A;  3GNG A;  3G6E A;  4B9X A;  2KAF A;  2YRD A;  4J6Y A;  3I5S A;  3QO3 A;  1G8X A;  2VUB A;  3JCM P;  3JCM V;  1B34 A;  1Q86 U;  3HKS A;  3C94 A;  2VGN A;  2J7I A;  1Q82 U;  2IG0 A;  1H3Z A;  4PJO A;  1T3L A;  3ULR B;  3CCL A;  3HSB A;  3FLG A;  2QEX T;  2J05 A;  1KSW A;  2F5T X;  3FJ5 A;  1Q7Y U;  2HL3 A;  2E10 A;  4J83 A;  1NJI R;  4DBF A;  3NPF A;  3LGF A;  4M77 G;  4NOY A;  3NTH A;  4J9D A;  4Q5W A;  3VS6 A;  1M27 C;  1WA7 A;  4OB2 B;  1QVF A;  2KK4 A;  1R8O B;  2HKQ B;  3MJX A;  3ASK A;  1QW1 A;  1K73 U;  3QSU A;  3G1J A;  4EPC A;  4N0A C;  4D6W A;  3DB3 A;  3V7R A;  1M1G A;  3DB4 A;  3OYF A;  4E7L A;  5IHI A;  2LVM A;  3I55 T;  3VS3 A;  3QWX X;  3M56 A;  3MP6 A;  1H64 1;  2DMO A;  1VUB A;  1W4S A;  4II1 A;  1YIT Q;  4PKC C;  5GAN 5;  4M78 E;  5KE2 A;  4J9E A;  1M90 U;  2D1X A;  3M54 A;  1YFN A;  3URG A;  3MCA B;  4M7A A;  2QTX A;  1MGQ A;  3OBY A;  4ANJ A;  3SWN A;  3QII A;  3NMZ C;  3CMA A;  3CCU Q;  2XG8 D;  1WLP B;  1M4Z A;  1M3B A;  1RAD B;  2HBP A;  4M4Z A;  1HXD A;  3BY7 A;  4PFO A;  2XID A;  2I2L A;  2CH4 W;  3O5Z A;  3TVT A;  1BI3 A;  2LQK A;  2JUF A;  1VQ5 Q;  1WHM A;  4ME7 A;  2LX7 A;  3CC4 A;  2GCX A;  5CQY A;  3CXC A;  2RJF A;  1MV3 A;  2D0Q B;  3CBP A;  2EQK A;  1YJ9 A;  4OMM A;  1KQS P;  1E6G A;  1IB8 A;  4NL2 A;  2C06 A;  5FRO A;  1ZBJ A;  4M77 E;  1OZ2 A;  2XU8 A;  4ZGJ B;  3PMI A;  3CCV A;  4M78 D;  2GQV A;  2DBM A;  2ZPH B;  1TWB A;  3A8G B;  4ESR A;  3CCS Q;  3VUZ A;  2LQW A;  5IHN A;  4FSX A;  3G7Z A;  4JJC A;  4J9F A;  6AT1 B;  2QG9 B;  2JTM A;  4XU3 A;  2DM1 A;  1QVP A;  4M78 F;  1K9M R;  1VA7 A;  5HKC A;  2JZ2 A;  1KC8 C;  1UDL A;  1QWE A;  5IHK A;  2HL5 C;  4M75 D;  5FU7 C;  8ATC B;  1AHJ B;  1MMA A;  2L89 A;  2HQE A;  4M78 C;  1LPL A;  3HP9 A;  2HZY A;  1I5L A;  3EG9 A;  2RK1 A;  2L3S A;  3FIF A;  1G83 A;  2LT4 A;  1OYX A;  2E6Z A;  1WI7 A;  4M7D A;  1RAF B;  3JV3 A;  1TUD A;  1IGU A;  3I56 Q;  1AT1 B;  1UE9 A;  2RI3 A;  2YSQ A;  3I9Q A;  1YI2 T;  3H8Z A;  5GMK j;  2KRS A;  4EIK A;  4M77 F;  2ABL A;  5IN1 A;  2VXE A;  2JTF A;  1MNE A;  1ZA1 B;  1N8R C;  1UGP B;  4M75 C;  1SHF A;  5LJ5 h;  3CCQ Q;  1TSF A;  3L2Q A;  2E6N A;  3OYK A;  2E3I A;  2WSF E;  3L2V A;  1GFD A;  3THK A;  2MF2 A;  2CUD A;  3QWY A;  5KYU B;  2JM9 A;  1BYM A;  2NLU A;  3VRZ A;  2MIO A;  1KQS S;  1N9R A;  2RK2 A;  3OYE A;  2DJQ A;  5A2Q E;  3CME T;  1KQ1 A;  3QZ5 B;  1KK7 A;  4GLK A;  5FRM A;  1X01 A;  1M2V B;  1PD1 A;  1PSF A;  2E4H A;  4OMP A;  3M0R A;  4J6X A;  4QW2 A;  2NYS A;  4JZ3 A;  2XDB A;  1RLP C;  1YHQ T;  2AK5 A;  1WIE A;  5IAY A;  4MML A;  4FU6 A;  3OS5 A;  1QP2 A;  5M9O A;  1ZSG A;  3PMT A;  2X4W A;  2XDP A;  2FRW A;  2CP7 A;  4IUU A;  2P0K A;  4OMO A;  2DVJ A;  4BD3 A;  3MPU B;  2QEX Q;  1VQ6 T;  1TU0 B;  5LL6 S;  5GAN d;  2PU9 B;  1TTH B;  2DVE A;  3CCE T;  2RD1 A;  2OTL T;  4QVD A;  1KD1 U;  4AG2 C;  3A8L B;  5GAN f;  2CP5 A;  4F7U B;  1OI1 A;  2LNH B;  4RMO A;  2VXF A;  3PIO A;  1ARK A;  5LJ5 g;  4WF2 A;  2D8H A;  3JB9 J;  2QA4 T;  4OGE A;  1ZUU A;  3RR6 A;  4PNO A;  1WJR A;  3OYC A;  4HVW A;  3FEO A;  4JRK A;  5CKE A;  2L2P A;  2LMJ A;  3JSC A;  4E47 A;  3GNF B;  1QKW A;  2FPD A;  3I55 Q;  4FW2 A;  1B7T A;  5GMK e;  1ZSZ C;  2KBT A;  3G71 T;  2QYZ A;  3DLM A;  4KGV B;  5LJ3 d;  2EAY A;  2E41 A;  2KGT A;  4XK8 E;  2GGR A;  4FT2 A;  1IXD A;  2V8I A;  4LDW A;  3C95 A;  4L59 A;  2JVV A;  1TS9 A;  2V1Q A;  4VUB A;  5J39 A;  2VB6 A;  4RG2 A;  1G5V A;  1G3S A;  1VQ4 T;  3NTK A;  3QYH B;  2NUP A;  5GAO n;  3JCM c;  4GBQ A;  4E7J A;  1BCO A;  4QQD A;  4LD9 K;  2DIG A;  2KR3 A;  2NUZ A;  5CR2 A;  2LCL A;  3TSZ A;  1JB0 E;  1ZBX A;  3UF4 A;  3J81 E;  2MOX A;  3QBY A;  4LDU A;  3BDL A;  2JTE A;  2HEQ A;  4PJN A;  2K3Y A;  1RAC B;  3M4G A;  4IKF A;  2MMP A;  5EC7 A;  4FYX B;  4AFZ C;  1D1C A;  2ZPB B;  1B07 A;  3HTR A;  4A4F A;  2FVU A;  1KC8 U;  4C92 B;  5KYY A;  2ZGW A;  3A8M B;  2B8A A;  3KBG A;  2V26 A;  2EPD A;  3KUF A;  3TQ7 P;  2FPF A;  3HRS A;  4E7S A;  2KY9 A;  1WHG A;  2VC8 A;  1AZE A;  3EGX B;  3PIP A;  1ZHI A;  1ABO A;  4IUQ A;  4OB0 B;  1JRI A;  2CZ0 B;  2OTJ T;  4CI0 C;  4M75 B;  1YJN T;  2CDT A;  4AG1 C;  3H0H A;  3M57 A;  2K57 A;  1LJO A;  2PQW A;  1U06 A;  1VQP T;  5DLO A;  1M3C A;  1P92 A;  1WPY A;  2COZ A;  2O2O A;  1BI0 A;  1D1A A;  1NJI C;  1JO8 A;  1VQO A;  2DYB A;  1KQ2 A;  1UJ0 A;  3D7S B;  2CRE A;  2D0N A;  2D6F A;  4HKE A;  2JS0 A;  1U3O A;  1N8R U;  1AWW A;  2E70 A;  3OBW A;  4N0A A;  3QPH A;  4KH1 B;  4BE2 A;  3E19 A;  4C5E A;  4LD6 A;  3CCL T;  1NG2 A;  4PLL A;  4ZGD B;  2QGF B;  1X6B A;  1WYX A;  4JRI A;  2FRY A;  1OZ3 A;  5DLQ E;  3CCM A;  1U1S A;  1VIE A;  1LOJ A;  2LP5 A;  1MUZ A;  3CCE A;  5EG2 A;  1YWP A;  1RI0 A;  2KDS A;  5DM7 R;  1F1B B;  1NLP C;  2RMO A;  1I4K 1;  1YI2 Q;  2IIM A;  2JS2 A;  1SG5 A;  5KE3 A;  4BI8 B;  5HY6 A;  4D8K A;  2RHZ A;  1OX9 A;  3E1S A;  3LGL A;  3RNJ A;  2P4R A;  1S72 A;  4WTO B;  2X4J A;  4LNP A;  1QVG P;  5CKH A;  2QAZ A;  3S3O A;  4FIB A;  3HHT B;  1X27 A;  1Y0M A;  3CPW P;  3MEW A;  1PC0 A;  1K76 A;  4EMH A;  3KFV A;  2ZPG B;  2VGM A;  1KQS A;  2E65 A;  3SWN B;  1VYT A;  3ZFJ A;  4K11 A;  1YWO A;  2EYX A;  3FC3 A;  2K2V A;  1PRM C;  2LNV A;  2GFU A;  2OI3 A;  4PL6 A;  3CMA T;  1N27 A;  2P0Q A;  1NZ9 A;  4J9H A;  3CME Q;  1AWJ A;  4A63 B;  1VQ4 A;  3EAE A;  1ZSZ B;  1T3S A;  4J9G A;  1M30 A;  3ZBD A;  1ACM B;  4HCB A;  2K2M A;  4BDZ A;  3LH5 A;  4C8Q G;  4HT8 A;  2JNG A;  2LCC A;  3CC2 T;  1M8V A;  2F2X A;  2BZY A;  1YHQ Q;  1UGR B;  4ZGE B;  3CC4 T;  2G6F X;  1NEG A;  1YJ9 T;  1K9M C;  5KYN A;  2XMF A;  2VV5 A;  2PVG B;  1NPR A;  4MDW A;  4QQG A;  2E5Q A;  5IH2 A;  2A7Y A;  2OX7 A;  1VQ6 Q;  2KRM A;  1WX6 A;  1H92 A;  1X6G A;  4M78 A;  1H8K A;  2AT1 B;  1WHJ A;  2JT4 A;  5GAO m;  2K3X A;  2OTL Q;  3NGP A;  2DL5 A;  5GAN e;  3TRE A;  3JB9 H;  2P84 A;  3OS1 A;  1YJN A;  3CQT A;  1JJ2 P;  1HJD A;  1VQP A;  1W6X A;  2MCN A;  2RA2 A;  2ED0 A;  3BW1 A;  2PUO B;  4FSS A;  4RTV A;  2QA4 Q;  1BIA A;  2DYI A;  2ROT A;  4RTU A;  3BFM A;  3OY9 A;  1MHN A;  1PCX A;  2DTO A;  4JS5 A;  2XD0 A;  3EGD A;  4C0G A;  1MV0 B;  3MET A;  2Y4X A;  3TSW A;  2R57 A;  2QDL A;  5GAN 6;  4C92 G;  2CSQ A;  2DRK A;  4LE9 A;  2DF6 A;  3OB9 A;  2D9T A;  4F7U E;  3G71 Q;  4OP0 A;  3RKY A;  2O31 A;  2NUT A;  3EG2 A;  1SSH A;  1QVG S;  2K5L A;  2BZX A;  1Z9Q A;  4M75 G;  3HRT A;  4M77 A;  2RJD A;  4XTX A;  2RJE A;  2HAX A;  3CPW S;  4EMK C;  4ZTJ A;  1W2B P;  2HBW A;  2DIQ A;  2W10 A;  1Y96 A;  3OYI A;  2XI9 A;  3MO8 A;  4XTZ A;  4HCK A;  5CK9 A;  3EFR A;  3CCR A;  2DE0 X;  2LJ3 A;  2FEI A;  1QMC A;  3PFS A;  3VJP A;  4HT9 A;  2I0N A;  1NJI U;  2ECZ A;  4RCB A;  2DO3 A;  4D8D A;  1V1C A;  4IUT A;  1Y71 A;  4J9B A;  4R0K A;  4XTV A;  2FB7 A;  2P4T A;  3RKW A;  3VS5 A;  2X9H A;  3ZEH A;  1OPL A;  1Y7X A;  1TUC A;  5KYW B;  3V8K A;  2HSE B;  4XQ3 A;  1OUL A;  3A8O B;  2EQJ A;  4Y28 E;  3PVL A;  2OTJ Q;  4PJL A;  5D6Y A;  2EGA A;  1VQK A;  1RAH B;  2KYM A;  4FL6 A;  3RES A;  4JJN K;  3OW2 S;  4F7U F;  3QUI A;  4C8Q D;  4A53 A;  3HL8 A;  4C92 E;  1FYN A;  3G6E Q;  3AHU A;  5GAO p;  2O9S A;  2DL8 A;  2YXY A;  1RUW A;  1B3Q A;  1XJW B;  1KIK A;  4RTY A;  1JJ2 S;  3CC2 A;  3H0F A;  2YWW A;  4M75 E;  3I5R A;  1IRX A;  2MWO A;  1UB4 A;  4M7A G;  2RHX A;  1SHG A;  1WZO A;  5GAN 3;  3JCM J;  1IHW A;  5C6S A;  5IXB A;  3CCL Q;  2K3B A;  2L3R A;  3TEE A;  5GAM h;  1WNL A;  2KE9 A;  2KRN A;  2GTO A;  1CKB A;  5DY9 A;  3X24 B;  3LWH A;  2KQW A;  1WDX A;  3SB2 A;  4C8Q C;  1PKT A;  3JCM W;  3QDR B;  1SEM A;  1VQM T;  1BKB A;  3EH1 A;  1O9S A;  4C5I A;  1YBY A;  2MK5 A;  3MHX A;  1Q95 G;  3C0C A;  5CQX A;  2DPP B;  4C0Z A;  4ZN3 A;  3G4S T;  2RJC A;  3VS2 A;  4C92 D;  3L2U A;  4A4G A;  1TUG B;  5I22 A;  2DTI A;  4JRP A;  2PVD B;  4RCC A;  1W2B S;  1MMD A;  4MDX A;  2CKK A;  2K4Y A;  2XDD A;  1YJW T;  3RKX A;  1E7O A;  4J9I A;  4L5G A;  4BB7 A;  3JB9 D;  2GFA A;  4EMG A;  1K9M U;  2EFI A;  2EQU A;  1BIB A;  1GCQ C;  3JCM h;  3VU3 C;  1NM7 A;  2X35 A;  2GNC A;  5FU6 C;  5KCO A;  4M75 F;  3CMA Q;  1D3B A;  4FW1 A;  2DXT A;  2EYZ A;  2QXF A;  2DXB A;  4C92 C;  2OAW A;  1X43 A;  4PJO D;  1VOM A;  2QAS A;  4IIM A;  1PD0 A;  5FWC A;  2DL4 A;  1IZ6 A;  3S3M A;  2EYQ A;  4J9C A;  1QKX A;  3EFO B;  2JMA A;  2RQR A;  4JDS A;  3WXM B;  1M3A A;  1X75 C;  3CC2 Q;  3OYL A;  3OMC A;  4DOV A;  5CKB A;  3VRY A;  2CP3 A;  1NBE B;  3M0P A;  2RI5 A;  2C0I A;  5GAM g;  3CC4 Q;  3NTI A;  5ECA A;  4P5N A;  1NPP A;  2CT4 A;  5CO7 A;  1YJ9 Q;  1M1K R;  4EMK B;  3QKJ A;  1C6V X;  4A4H A;  4M7D G;  2HMA A;  2FYK A;  4JUV A;  2EKO A;  4IUP A;  3CCV Q;  1X69 A;  2XIC A;  1LVK A;  1A0N B;  5GAO r;  3L1A A;  4IUV A;  2XK0 A;  1UJY A;  2ZAE A;  5LJ5 d;  1X2Q A;  1WGS A;  1BBZ A;  4LDV A;  1HSQ A;  4KBM B;  3PE0 A;  1MND A;  5LJ5 f;  1VQO T;  3UAT A;  5D6X A;  2YUQ A;  5GAO q;  3EG0 A;  3OYM A;  4TVR A;  2L3Q A;  3UPU A;  1SSF A;  5KYX B;  3X28 B;  4M7A D;  4JZ4 A;  3F70 A;  2DL3 A;  1FX7 A;  4KUI A;  3M59 A;  4OVA A;  1RAE B;  3JCM g;  2LJ0 A;  4ORZ A;  2K5I A;  3O8V A;  3RER A;  1PM3 A;  3AT1 B;  5KCH A;  3V7C A;  2XKO C;  1GCP A;  3CCM T;  1AD5 A;  2BE9 B;  1D0Y A;  3CPW A;  1EX4 A;  3PT9 A;  2XHC A;  4KUD K;  2V1R A;  1KD1 R;  4E2F B;  2LJ1 A;  3QYG B;  3DLL A;  4BY6 B;  1VQM A;  5I21 A;  1R0C B;  3RMQ A;  4M7A C;  2L0A A;  1VQ7 T;  2QQS A;  1S72 T;  3G4S A;  3MEU A;  4JS4 A;  4JRQ A;  3SWN C;  2YRV A;  3UDC A;  5IXF A;  1C0M A;  1XTD A;  3QHS A;  3VS7 A;  2EYW A;  1FMW A;  1LCK A;  5I2S A;  3VS1 A;  2LTO A;  2SEM A;  3SDZ A;  3QDF A;  2DTH A;  4C8Q B;  1ZUY A;  4IUR A;  1VQN A;  4V2S A;  4Z89 A;  3N5B B;  1VQ8 T;  4E7K A;  1ZA2 B;  1YJW A;  3M0U A;  2ZCF B;  1YIJ A;  2K6D A;  1KFZ A;  3R6O A;  4PLI A;  3SFM A;  1WJQ A;  2PTK A;  2BE7 D;  3CD6 A;  1OX8 A;  5LJ3 f;  5GMK i;  2AZV A;  2FZC B;  3RIR A;  4GLM A;  1T0J A;  1PKS A;  1UGQ B;  2VYT A;  3MEV A;  4BAC A;  2CSI A;  4KRT A;  4FCY A;  3C4S A;  4JLG A;  4JPB W;  3MKD A;  4E7I A;  3FDR A;  4MZT A;  3WVD B;  1R77 A;  3UWN A;  1JJ2 A;  2O4X B;  5J26 A;  5A0D A;  2ZPI B;  2DEQ A;  2K9G A;  2CP0 A;  5GMK m;  3JCM b;  2V8J A;  1SF9 A;  1AVZ C;  5FU6 B;  5HK3 A;  4M7D D;  1G3W A;  5GAN 7;  2OJ2 A;  4HVV A;  3GF5 A;  2GBQ A;  2F1L A;  3JCM X;  2RPN A;  5D6W A;  3INZ A;  3V7S A;  3NFC A;  3FB9 A;  2LC4 A;  2F5K A;  1KG1 A;  1UUE A;  1D0X A;  2R5M A;  1OU9 A;  3FRN A;  1D09 B;  2NWM A;  4RTX A;  4O6J A;  1NEB A;  2YUN A;  2K7A A;  1QQJ A;  1VQL A;  2B86 A;  1MMG A;  1W2B A;  5KYU A;  3HFN A;  1CSK A;  5AYF A;  4M7D C;  2QI2 A;  2F69 A;  5CIU A;  7AT1 B;  3E2U A;  1B34 B;  4IIO A;  2EJ9 A;  3R6N A;  2J06 A;  3EGU A;  4PJO B;  3CCU T;  2HKN A;  5GAN j;  4LUE A;  4BDY A;  2RN8 A;  9ATC B;  3PVQ A;  1QCN A;  3GPL A;  4QKU A;  2C0O A;  2L3P A;  1OV3 A;  3CC7 A;  3VYH B;  1AWX A;  2CZ1 B;  4XTY A;  1M2V A;  2X51 A;  2F2W A;  1BI2 A;  1GXI E;  1NYG A;  2ESW A;  4RTT A;  2AIR B;  1VQ9 A;  3QXE B;  2QQB A;  4LXC A;  3CCR T;  3CCJ A;  4J6W A;  1SPK A;  2L5Q A;  2RO0 A;  4KUL A;  1VQ7 A;  5LJ3 j;  4A4E A;  1ABQ A;  2LX9 A;  3GLX A;  1PG5 B;  2BUD A;  1WHL A;  1TH7 A;  2AKL A;  2C0T A;  2LRQ A;  3VUB A;  1G2B A;  3L42 A;  3JCM Q;  2E1H A;  2DIL A;  1VQ8 A;  4F7U A;  4NL3 A;  2DNU A;  1QCO A;  1Q81 R;  2KNB B;  2COY A;  2X3X D;  4M7A B;  3M58 A;  2CUB A;  4MZP A;  5GAO l;  1ZX6 A;  4RUG A;  1VQK T;  4PK4 A;  4BE0 A;  2EGC A;  2RQT A;  1EIF A;  1UFF A;  2DK3 A;  2EJF A;  4CC4 B;  2KSS A;  4HXJ A;  5LJ5 e;  2DD5 A;  3LW5 E;  1VQO Q;  4MZM A;  4DOW A;  4QVC A;  2CYZ B;  4OMN A;  4FYV B;  4Y91 A;  1WQ7 A;  4MMK A;  1YP5 A;  4AFU C;  2KT8 A;  1I1J A;  4RTW A;  3L2Z A;  2ZPE B;  2EIF A;  4KT0 E;  3JB9 I;  3LH0 A;  2BKD N;  3I56 T;  2RI2 A;  3I35 A;  2DZC A;  1IRE B;  3ME9 A;  4HCZ A;  1BK2 A;  1U1T A;  2M02 A;  1K8A R;  3OW2 P;  2Y90 A;  2FHD A;  3CCM Q;  2YLC A;  3GIB A;  3OYA A;  4C5H A;  3CCE Q;  1M9S A;  4OB3 B;  3QZ9 B;  3M55 A;  2YLB A;  1PSE A;  1GCQ A;  5FLX E;  4Z8A A;  2WSC E;  5FRN A;  3WVE B;  3TCJ A;  4BE1 A;  3MEA A;  2KEA A;  2QDY B;  2CZ6 B;  3QG1 A;  1YIT A;  2V8K A;  1PNJ A;  1S72 Q;  1DJ7 B;  2DD4 A;  4J7I A;  4NS5 A;  4CC7 A;  1K1Z A;  3M0S A;  2BTT A;  1CKA A;  3EGX A;  3OA6 A;  4X9D A;  2RHI A;  4M75 A;  1Q86 R;  3CCU A;  1Q82 R;  1RAA B;  2M0O A;  3EG1 A;  4R56 A;  2FPE A;  1M1F A;  3UA7 A;  3EG9 B;  2ROL A;  5LJ3 e;  2Y4Y A;  2KVQ G;  4B9W A;  2R5A A;  1D3B B;  1XOV A;  8AT1 B;  1Q7Y R;  3LLR A;  1M1K C;  1OOT A;  4M7D B;  2DJZ A;  4OGC A;  5GAN 8;  3JB9 G;  2HNI A;  2EBP A;  4DBQ A;  1VQ5 A;  2DET A;  4J5Y A;  4XTU A;  4C8Q E;  1VQ4 Q;  2Z0W A;  1TG0 A;  3P8H A;  3A8H B;  5CKD A;  1FMK A;  1K73 R;  4CRI A;  5GMK h;  2EGE A;  4DBR A;  4PJO G;  1BU1 A;  2KT1 A;  3LYI A;  1UGS B;  3BE3 A;  4BI3 A;  3CCS A;  1WHK A;  1M5Q 1;  2HQH A;  4N4H A;  2IVW A;  4WCI A;  1VIF A;  3M0Q A;  2GTJ A;  2IPO B;  2M16 A;  3P8D A;  2R58 A;  1M90 R;  5CKF A;  3X25 B;  1IGQ A;  2RF0 A;  5I2M A;  1JU5 C;  1YJN Q;  5HCK A;  1IHV A;  4XAX B;  1VQP Q;  1YNZ A;  2ED1 A;  2EQI A;  1U8R A;  5GAN 4;  1K9A A;  4LN2 A;  2MAM A;  4L6V 5;  2E12 A;  2H3E B;  1KD1 C;  1AEY A;  2RQU A;  2K79 A;  1WJS A;  4DEX A;  2M1H A;  2ENM A;  1ZQ1 A;  1UGV A;  4HA8 A;  4O5V A;  1JXM A;  4XU2 A;  2A0F B;  2ATC B;  4C8Q F;  4BY6 C;  2SRC A;  3IQL A;  4AT1 B;  3RBB B;  4ELY C;  3I56 A;  4X34 A;  4C0F A;  1RAG B;  2EYY A;  3CBM A;  3EFS A;  3REA B;  4F17 A;  2X3W D;  2CGH A;  1XQH A;  1ZSZ A;  2DER A;  4KGX B;  3H0I A;  1N6A A;  2DA9 A;  1FWZ A;  2GF7 A;  5CVI A;  5CCA A;  3CCQ A;  1EFN A;  4KH0 B;  2KMT A;  4FT4 A;  1H3H A;  3M0T A;  4HVU A;  2PZ1 A;  1EZZ B;  2RNA A;  4PJO E;  2HSP A;  1JEG A;  2AHJ B;  2O9V A;  4C0D C;  2QQR A;  3RDV A;  3CCR Q;  4HCC A;  1RLQ C;  1N5Z A;  3QJ6 A;  4RTZ A;  2D8J A;  2AZS A;  2YHT A;  5GAM d;  4DQ2 A;  1IO6 A;  5I11 A;  2WSE E;  1VQN T;  5GAM f;  4F04 B;  1FMV A;  1W70 A;  1YIJ T;  1E6H A;  2LQ8 A;  1KHI A;  2YT6 A;  4C92 F;  1J3T A;  4PJM A;  3CD6 T;  2DX1 A;  2RM4 A;  3J80 E;  4J8O A;  5A0G A;  2VWF A;  3KXT A;  1VQK Q;  2H3J A;  4KGZ B;  2NUP B;  1QWF A;  3UT1 A;  3QJY A;  3MP1 A;  4AFQ C;  3JB9 F;  1I0C A;  2QTV A;  3U23 A;  3FJP A;  1K0S A;  2M51 A;  1V76 A;  4M77 D;  4M7A E;  2QEX A;  1I81 A;  2KXC A;  4GY5 A;  1R0B G;  3JCM d;  4LDX A;  5KYY B;  1SKU B;  3REB B;  4AMC A;  4PJO F;  1WXB A;  2JN0 A;  3M9Q A;  3JCM f;  5J3B A;  2DZ9 A;  1GBR A;  3JAM E;  3SEM A;  4PFZ A;  4EDU A;  2ZPF B;  1C1A A;  1NYF A;  4JJD A;  2EVR A;  2A36 A;  4PJO C;  3ER0 A;  4FYY B;  1M1K U;  3I55 A;  2VVK A;  1YCS B;  4M77 C; 
#chains in the Genus database with same CATH homology
 2BZY A;  1OPK A;  1WLP B;  2G6F X;  2KYB A;  1M3B A;  1NEG A;  3A98 A;  1UUE A;  4M4Z A;  1JQQ A;  1PRL C;  3UA6 A;  2XMF A;  2NWM A;  4RTX A;  2CH4 W;  3O5Z A;  3TVT A;  5IH2 A;  1AWO A;  1NEB A;  2KRM A;  1WX6 A;  1H92 A;  2YUN A;  2K7A A;  1X6G A;  1H8K A;  3GBQ A;  2LX7 A;  2B86 A;  2JT4 A;  3NGP A;  2DL5 A;  1CSK A;  1S1N A;  1MV3 A;  4OMM A;  1W1F A;  1E6G A;  1UHC A;  4IIO A;  3CQT A;  3R6N A;  1ZBJ A;  2J06 A;  1HJD A;  3EGU A;  2DRM A;  1W6X A;  2MCN A;  3NHN A;  2ED0 A;  4FSS A;  4RTV A;  2ROT A;  4RTU A;  4LUE A;  4OMQ A;  2RN8 A;  2DBM A;  3PVQ A;  1MV0 B;  4ESR A;  2C0O A;  2LQW A;  2JXB A;  5IHN A;  2L3P A;  1OV3 A;  3TSW A;  2QDL A;  4JJC A;  4J9F A;  1KJW A;  1AWX A;  2CSQ A;  2DRK A;  2DF6 A;  4LE9 A;  2A08 A;  4F14 A;  2DM1 A;  2DBK A;  2F2W A;  2CT3 A;  2O31 A;  3EG3 A;  1NYG A;  2ESW A;  3EG2 A;  1VA7 A;  1SSH A;  2KXD A;  4RTT A;  2BZX A;  1Z9Q A;  1GL5 A;  2KRO A;  2JW4 A;  1UDL A;  2M0Y A;  1QWE A;  5IHK A;  1SPK A;  1HD3 A;  1NLO C;  1ABQ A;  3H41 A;  2HBW A;  2W10 A;  3EHR A;  2AKL A;  2C0T A;  2YDL A;  1G2B A;  4HCK A;  1T0H A;  4E6R A;  2DIL A;  2DE0 X;  2LJ3 A;  2FEI A;  2L3S A;  2DNU A;  1G83 A;  1WI7 A;  2I0N A;  2KNB B;  2X3X D;  3JV3 A;  1TUD A;  5FW9 A;  2ECZ A;  2CUB A;  2JM8 A;  1UE9 A;  1VYV A;  2YSQ A;  3I9Q A;  1ZX6 A;  4RUG A;  4D8D A;  1V1C A;  2KRS A;  2A37 A;  1PWT A;  4J9B A;  4EIK A;  2EGC A;  2ABL A;  2RQT A;  4R0K A;  2LCS A;  1UFF A;  4Y92 A;  2FO0 A;  4CC4 B;  3VS5 A;  1OPL A;  4HXJ A;  1SHF A;  1TUC A;  2E5K A;  2CH4 A;  2RQW A;  4OMN A;  3PVL A;  2LZ6 B;  2EGA A;  1GFD A;  1YP5 A;  4AFU C;  2KT8 A;  2KYM A;  1I1J A;  5GJV B;  3THK A;  2YUP A;  2CUD A;  4RTW A;  3VS0 A;  2J6O A;  3QWY A;  2J6F A;  1FYN A;  2JM9 A;  1UTI A;  1QLY A;  2AKK A;  2LQN A;  3I35 A;  1Z9Z A;  1GRI A;  1U5S A;  1VYU A;  2O9S A;  2MIO A;  3VRZ A;  2DL8 A;  1RUW A;  1BK2 A;  1B3Q A;  2DLP A;  1KIK A;  4RTY A;  1X2K A;  3H0F A;  2DJQ A;  1RI9 A;  3I5R A;  1K0X A;  5FWB A;  1M8M A;  1SHG A;  2PNI A;  4OMP A;  1GCQ A;  5IXB A;  2K3B A;  4Z8A A;  2A28 A;  3M0R A;  2F2V A;  2KE9 A;  2KRN A;  4JZ3 A;  2GTO A;  1CKB A;  2HCK A;  1RLP C;  4LUD A;  2AK5 A;  1WIE A;  2KEA A;  1WDX A;  1PNJ A;  1ZSG A;  1Y57 A;  1PKT A;  2W0Z A;  1SEM A;  2FRW A;  3EHQ A;  4CC7 A;  4OMO A;  1K1Z A;  2DVJ A;  3M0S A;  2BTT A;  1CKA A;  3C0C A;  3VS2 A;  1UG1 A;  3EG1 A;  1WFW A;  2FPE A;  5I22 A;  4AG2 C;  3UA7 A;  2ROL A;  1SRL A;  2LNH B;  1XOV A;  1ARK A;  1OOT A;  2D8H A;  1ZUU A;  1E7O A;  2EBP A;  2JMC A;  4HVW A;  4Z88 A;  4J9I A;  4CC2 A;  2L2P A;  1UEC A;  2LMJ A;  3ZL7 C;  1ZLM A;  1TG0 A;  1QKW A;  2FPD A;  1GCQ C;  1FMK A;  1NM7 A;  2GNC A;  4OML A;  2VKN A;  2KBT A;  4JJB A;  2EGE A;  1BU1 A;  1OEB A;  2EYZ A;  2KGT A;  1WXT A;  2KT1 A;  4X1V A;  2EKH A;  2GGR A;  2OAW A;  1X43 A;  4IIM A;  5FWC A;  2DL4 A;  1GBQ A;  4WCI A;  4J9C A;  1QKX A;  2V1Q A;  2JMA A;  4CC3 A;  4AFS C;  2RQR A;  3M0Q A;  1M3A A;  2GTJ A;  2DL7 A;  3VRY A;  3M0P A;  2C0I A;  5ECA A;  1JXO A;  2CT4 A;  4GBQ A;  2RF0 A;  1JU5 C;  2KR3 A;  1QCF A;  2NUZ A;  5HCK A;  3TSZ A;  3UF4 A;  1YNZ A;  1AOJ A;  2ED1 A;  2MOX A;  2EQI A;  4ZNX A;  2RQV A;  1UHF A;  2JTE A;  2BZ8 A;  1BB9 A;  1K9A A;  1GFC A;  1X69 A;  2YUO A;  4LN2 A;  2GQI A;  2HEQ A;  1AEY A;  1A0N B;  2RQU A;  1WXU A;  2K79 A;  4DEX A;  5EC7 A;  4AFZ C;  1B07 A;  1UJY A;  2ENM A;  1K4U S;  1X2Q A;  1UGV A;  1BBZ A;  1PHT A;  1HSQ A;  1JXM A;  2EPD A;  3PE0 A;  2FPF A;  5L23 A;  2SRC A;  3IQL A;  3UAT A;  2HDA A;  2FG0 A;  1AZE A;  1ABO A;  2YUQ A;  3RBB B;  3EG0 A;  2EYY A;  2L3Q A;  2CDT A;  3REA B;  4AG1 C;  1ZUK A;  4F17 A;  3H0H A;  2EW3 A;  1U06 A;  2X3W D;  4QT7 A;  1M3C A;  4JZ4 A;  2DL3 A;  1SRM A;  2O88 A;  2H8H A;  3H0I A;  2DA9 A;  1I07 A;  2O2O A;  4DEY A;  2J6K A;  1EFN A;  1JO8 A;  2LJ0 A;  2DYB A;  4ORZ A;  1H3H A;  1UJ0 A;  3M0T A;  4HVU A;  2PZ1 A;  2RNA A;  4F16 A;  2CRE A;  2D0N A;  2HSP A;  1JEG A;  2O9V A;  1GCP A;  2JS0 A;  1U3O A;  1AD5 A;  1AZG B;  5GJW B;  3SHW A;  1AWW A;  1RLQ C;  1N5Z A;  2V1R A;  1YN8 A;  4RTZ A;  2D8J A;  2AZS A;  2LJ1 A;  3VS4 A;  1IO6 A;  5I11 A;  1NG2 A;  1X6B A;  3I5S A;  1WYX A;  2FRY A;  1W70 A;  1E6H A;  2L0A A;  2YT6 A;  2LP5 A;  1MUZ A;  1J3T A;  5IXF A;  3VS7 A;  2DX1 A;  1YWP A;  2J7I A;  2EYW A;  1LCK A;  3VS1 A;  1T3L A;  2SEM A;  1NLP C;  2RMO A;  2VWF A;  3ULR B;  2IIM A;  1ZUY A;  2JS2 A;  2J05 A;  1KSW A;  4Z89 A;  3FJ5 A;  4D8K A;  1QWF A;  3RNJ A;  3M0U A;  2K6D A;  1KFZ A;  3NPF A;  2P4R A;  4AFQ C;  2PTK A;  1I0C A;  4LNP A;  3U23 A;  1K0S A;  4J9D A;  2M51 A;  3VS6 A;  2AZV A;  4GLM A;  1M27 C;  1WA7 A;  1T0J A;  1PKS A;  2CSI A;  1X27 A;  1Y0M A;  4KRT A;  2KXC A;  4JPB W;  1K76 A;  3KFV A;  3REB B;  5IHI A;  1VYT A;  1WXB A;  4K11 A;  1YWO A;  2EYX A;  3QWX X;  3VS3 A;  1PRM C;  2DMO A;  2OI3 A;  3SEM A;  1GBR A;  2K9G A;  1NYF A;  4J9H A;  1AVZ C;  4JJD A;  1AWJ A;  4A63 B;  4J9E A;  1T3S A;  2OJ2 A;  4HVV A;  2D1X A;  2EVR A;  1M30 A;  4J9G A;  2A36 A;  2GBQ A;  2K2M A;  3LH5 A;  2RPN A;  2VVK A;  1YCS B;  2F2X A;  3NMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...