3RBBB

Hiv-1 nef protein in complex with engineered hck sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
publication title Conformation of the Dileucine-Based Sorting Motif in HIV-1 Nef Revealed by Intermolecular Domain Assembly.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Viral protein, protein binding
total genus 12
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rbbB00
2EGCA 1E6GA 3QWXX 4IIOA 1NG2A 2F2VA 1NM7A 4AG2C 2CSQA 2LX7A 2A28A 1SRLA 4D8KA 4J9IA 4AFQC 2MCNA 1NYGA 3SEMA 5I11A 5IH2A 2D0NA 1AOJA 2LQNA 1UE9A 2DNUA 3GBQA 1OEBA 4OMPA 1U06A 2CUBA 1K76A 2J6FA 4DEXA 5L23A 4R0KA 1JU5C 4OMQA 1TUCA 2EYWA 4RTYA 2O88A 3EHRA 2DX1A 4CC7A 1UUEA 1BB9A 2DBMA 1X6GA 1FMKA 2HCKA 1UHFA 1QWFA 5FWBA 4IIMA 1HD3A 2ROLA 2M51A 4HXJA 2RNAA 2EVRA 1RLPC 2RQVA 2O31A 2LJ1A 4J9DA 2DE0X 5GJVB 1NEBA 2FPEA 4E6RA 1U5SA 1IO6A 2RF0A 2XMFA 2CUDA 3H41A 1AVZC 2DA9A 2G6FX 2KNBB 1B07A 2LQWA 4Z88A 1SEMA 1CSKA 4GLMA 1X6BA 3EGUA 2OAWA 4ESRA 2J6OA 1GL5A 2KRMA 4F17A 2KXDA 1YP5A 4ZNXA 3O5ZA 2GGRA 1GBRA 1HSQA 2D1XA 1WI7A 1QWEA 2YT6A 2JTEA 2LP5A 1RUWA 2ED0A 3M0QA 4OMOA 1UFFA 4OMNA 2DMOA 2MIOA 2P4RA 1UG1A 2JM8A 2KR3A 1I07A 3RNJA 1QKXA 2DJQA 3EG1A 2YUQA 1BU1A 1X43A 2EYYA 4LN2A 2FRYA 1GCPA 2DL8A 2FPFA 1WX6A 3M0UA 1G2BA 2JM9A 2RN8A 4JPBW 1I1JA 3VS4A 3PVLA 2DL7A 2NWMA 1BBZA 5FWCA 2KXCA 1M3AA 4WCIA 4Z89A 2L3QA 1UECA 1T0HA 3EG0A 2FEIA 2KRNA 1RI9A 1JQQA 2KRSA 3UA6A 2LCSA 2YUPA 1M8MA 4A63B 2KROA 2FRWA 1AWOA 1SSHA 3NMZC 1ABQA 2BZXA 2KYMA 2DF6A 1VYUA 3NPFA 2ED1A 1ZBJA 2A37A 2O2OA 1E7OA 2ESWA 2F2WA 2KEAA 2GBQA 4RTUA 5I22A 3FJ5A 1GBQA 2KBTA 4HVWA 1UTIA 2CDTA 4RTZA 1AWWA 2VKNA 4K11A 1M3CA 1UJ0A 1K0XA 2LJ0A 1HJDA 2YSQA 2BZYA 2X3WD 4RTTA 3M0PA 2K7AA 2EYXA 2EGEA 1QKWA 1GCQA 1ZLMA 3THKA 4Z8AA 1AD5A 2CSIA 1XOVA 2SRCA 1AWXA 3VS5A 2IIMA 3LH5A 2MOXA 2VWFA 3TVTA 2RQUA 3PVQA 1PKSA 1WIEA 1YWPA 3VRYA 3A98A 2A08A 1YCSB 3VRZA 4LUDA 1JXMA 1MUZA 4RUGA 1UGVA 1ARKA 1NLPC 2L0AA 4M4ZA 2YDLA 2LZ6B 3VS3A 1PHTA 1H92A 1W6XA 3H0IA 1X69A 1A0NB 2E5KA 4DEYA 3IQLA 2PNIA 3I5SA 1JXOA 1OV3A 2RQRA 2AKKA 2D8JA 2BTTA 4GBQA 3RBBB 2HDAA 5FW9A 3H0HA 4JJDA 3TSZA 1ABOA 2D8HA 1G83A 2DRKA 4J9BA 2KGTA 1KIKA 2DYBA 2EPDA 1I0CA 2DVJA 2CH4W 2CH4A 1WLPB 3M0RA 1E6HA 1JEGA 3REBB 3SHWA 1S1NA 2K9GA 1K1ZA 2C0OA 2J05A 1JO8A 4J9CA 1QLYA 2V1QA 1TUDA 1UHCA 4HVUA 2C0IA 2K3BA 1NYFA 1RLQC 2A36A 4J9FA 2ECZA 2I0NA 2DL4A 1K9AA 1WA7A 2YUOA 1Y57A 2FG0A 1NEGA 3VS0A 4D8DA 1KSWA 4OMLA 1LCKA 2EQIA 4AFUC 2H8HA 1ZSGA 4AFSC 1WXTA 2LJ3A 2EYZA 1N5ZA 1VYTA 2JS0A 2AZVA 2FPDA 5HCKA 4ORZA 4JJCA 1GCQC 2KT8A 2RQTA 1SPKA 2DBKA 1H3HA 4CC4B 2LMJA 2RQWA 5IHNA 1YWOA 2QDLA 3H0FA 1WYXA 3NGPA 3ULRB 2J06A 3REAB 2O9SA 2W0ZA 1ZX6A 1NLOC 1B3QA 2AK5A 4RTWA 2HBWA 2J6KA 5EC7A 1AWJA 2GQIA 1YNZA 2LNHB 1PWTA 3C0CA 3VS7A 1V1CA 2EKHA 4LUEA 2C0TA 1MV0B 4LE9A 1GFDA 3PE0A 1W1FA 1X27A 1Z9ZA 2J7IA 1TG0A 4J9HA 1MV3A 2DL5A 1UDLA 2FO0A 2JT4A 2YUNA 5IXFA 1SHFA 3EG3A 1PKTA 4CC2A 1M3BA 3I5RA 2AZSA 1T0JA 4AFZC 4JZ4A 2EW3A 1K4US 2B86A 1U3OA 3VS6A 2JXBA 2KT1A 2CT3A 2DM1A 1QCFA 2EBPA 2JMAA 1VYVA 5IHKA 2BZ8A 4QT7A 1AEYA 2K2MA 2DL3A 3QWYA 3M0SA 3M0TA 5IXBA 4JZ3A 5ECAA 4AG1C 1KJWA 2DRMA 2NUZA 2ABLA 2ROTA 2OI3A 2PTKA 4CC3A 3ZL7C 2JW4A 3EHQA 2KYBA 1J3TA 2AKLA 1Y0MA 4OMMA 5IHIA 1ZUUA 1H8KA 2SEMA 2X3XD 1K0SA 1FYNA 1M30A 2M0YA 3TSWA 2V1RA 2L3SA 2HSPA 3R6NA 3I9QA 2GNCA 4EIKA 1ZUKA 1M27C 2PZ1A 2KE9A 2RMOA 1GRIA 4RTXA 1T3SA 3NHNA 4Y92A 3CQTA 2L3PA 4J9EA 4HCKA 2OJ2A 1BK2A 4J9GA 3JV3A 2VVKA 1PNJA 1SHGA 1SRMA 1VA7A 1OOTA 1EFNA 3VS2A 1T3LA 2L2PA 4X1VA 1AZEA 3UA7A 2RPNA 1X2QA 2CREA 2W10A 1YN8A 3EG2A 4F16A 1Z9QA 2HEQA 4RTVA 4F14A 2GTJA 1ZUYA 3KFVA 1OPKA 2F2XA 4FSSA 2DLPA 2ENMA 1X2KA 1WXBA 3I35A 2CT4A 1AZGB 1CKAA 3VS1A 3U23A 4JJBA 4KRTA 5GJWB 4LNPA 3UF4A 1WXUA 2JS2A 2DILA 1WDXA 2GTOA 2EGAA 1PRLC 1GFCA 3UATA 1WFWA 1UJYA 2JMCA 1W70A 1CKBA 2K6DA 2O9VA 1KFZA 1PRMC 2K79A 1OPLA 4HVVA
chains in the Genus database with same CATH superfamily
1YHQT 1GXIE 1P92A 3QWXX 4IIOA 1NG2A 2RD1A 1NM7A 2KVQG 2RHUA 5D7UA 3L2UA 2CZ7B 1KQSP 4M78D 1M2OA 1BYMA 4NS5A 3SEMA 2R58A 3CCJQ 5GMKe 1UE9A 1VQKQ 4BUGA 3PNWC 1YJNA 1V76A 1TUCA 3A1PA 1ZSZC 1K8AU 3EHRA 1KHIA 4E2FB 3CCMQ 4DBHA 4N4GA 2E41A 5FWBA 3X28B 2DZ9A 4R55A 2EVRA 1RLPC 3H9NA 2RQVA 1YJ9T 3EGDA 2O31A 3GLXA 1WJSA 2LJ1A 5J3BA 4J9DA 3PMIA 5LJ5j 4E6RA 1U5SA 2PUOB 3V7SA 2QDYB 1LPLA 2RJCA 1Q81U 2DVEA 4C92C 2RJEA 1JJ2S 3OB9A 5FROA 2LQWA 2WSFE 4Q5WA 1VQ8Q 1QQJA 5GAOn 3EGUA 4XQ3A 4XTVA 4FYYB 4IUUA 1YP5A 4JS5A 2DTHA 1NE8A 4ZNXA 3EGXA 3CCST 1WHMA 2QEXA 4HCCA 2GGRA 1GBRA 1HSQA 2D1XA 4HA8A 4C0GA 4A4FA 2M1HA 3BW1A 5KE3A 2XI9A 2LP5A 1RUWA 2O01E 3MEVA 4RCBA 3M0QA 4OMOA 2H3EB 2DMOA 4L59A 3UWNA 5GMKh 1MMDA 1V29B 3CMEA 4C8QD 2YUQA 1BU1A 1X43A 2MF2A 1YIJQ 2FPFA 3M0UA 2JM9A 1X01A 1I1JA 2JOYA 2R57A 3EH1A 3V8JA 1VQ4Q 3PVLA 3QPHA 2DL7A 4Y91A 3N5BB 1BBZA 3L42A 2DIQA 4E7LA 3ZFJA 4WCIA 1I5LA 3QBYA 4WF2A 4M77G 3TCJA 2DXUA 1QP3A 3PT9A 4PJOF 3LGFA 3MEWA 4C5IA 1JQQA 4M7DF 3JCMe 1M8MA 4A63B 1Q82U 1AWOA 4F04B 1SSHA 2QQBA 2QA4Q 3NMZC 4XU2A 3JB9H 2KYMA 1N9SA 4MMLA 2M9UA 5CKBA 1ZBJA 2A37A 2PQWA 2O2OA 1BIAA 2BE9B 2DD4A 4JLGA 1EX4A 5M9OA 1RAEB 1YBYA 4X9CA 1UGSB 4XTUA 1DJ7B 2P4TA 1GBQA 4ZTFA 3HKSA 4R56A 3CBOA 5GAOm 2KBTA 4WTOB 2COZA 1AWWA 2VKNA 3CD6Q 4K11A 1OPLA 2MWOA 4M75A 1VOMA 2P0KA 5CKHA 2K3XA 4GY5A 1ACMB 3QIIA 1RI0A 4PJOA 2WSCE 1D1AA 4M7DA 3HTRA 4Z8AA 4OMFB 2CSIA 1XOVA 1FX7A 2SRCA 2RI3A 2D9TA 1Q86U 3LX7A 3JCMd 5GAOr 3TVTA 1M1KU 1YITT 3MHXA 4QQGA 3BE3A 5GAMe 1WIEA 3C95A 5LL6S 2DERA 2KI7A 3BFMA 1G3SA 1VQOA 4LUDA 1MUZA 4RUGA 1ARKA 4M4ZA 5C0MA 3QUIA 2YRCA 3VS3A 1H92A 3JCMh 3OYLA 3H0IA 3ER0A 4PL6A 5GANj 1XNIA 3QKJA 4EMGA 1VQNQ 2OTJQ 2HBPA 3I5SA 2DTIA 2D8JA 4OVAA 3OS5A 1QCOA 5CK9A 4JRQA 3CCVA 4JLIA 4JJDA 3MP6A 1ABOA 2QK0A 4J9BA 5A0GA 3QYHB 1BI2A 3GP8A 1JRIA 1KIKA 2C06A 2EPDA 4LDWA 5DLQE 4ZGDB 4UC4A 2CH4W 2CH4A 1WLPB 3FEOA 2K9GA 5GAMd 1OZ3A 2C0OA 2CZ0B 2J05A 3PFSA 4BI8B 3V7CA 4M7AG 5A2QE 1XJWB 2V1QA 1TUDA 2C0IA 1NYFA 1RLQC 3SDZA 2EQMA 5FU6B 2DL4A 5LJ3j 4QVCA 2FG0A 1NEGA 2CP0A 1XQHA 3TQ7P 4OMLA 5GAMh 3LYIA 2EQIA 3OYGA 2XICA 3WVEB 3RDVA 4AFSC 1MNDA 5HKCA 3F70A 3HPWA 1R8OB 2JS0A 1IGQA 4C8QB 4M78E 5KCHA 4JJCA 3EFRA 2VXFA 3QZ5B 1FXXA 3CCUA 1IREB 5AYFA 4QQDA 1M90R 3CC7Q 1SKUB 5CKDA 2QDLA 4JRPA 1K8AR 2FB7A 1XTDA 1QVGS 1M90C 2ZPHB 1KQ1A 2E10A 2MAMA 1K8AC 4PJNA 2GQIA 1YNZA 2CGHA 1PM3A 1PWTA 2LNHB 3C0CA 3A8GB 3PE0A 1TXQA 1VQ5Q 1NZ9A 2J7IA 2D0QB 1Q81R 5I2MA 4BI4A 3C94A 2JT4A 4M7DB 3EG3A 1VQ9T 4XAXB 4CC2A 4MZMA 4AFZC 1T0JA 5GAN3 1PD0A 2KMTA 1Q81C 1D3BA 4PJMA 5J26A 4JRIA 3L2QA 2K5LA 2JXBA 2KT1A 3OYYA 4LXCA 5IHKA 3JCMV 2DL3A 3QWYA 4P5NA 3CCRA 4AG1C 1C6VX 2YRVA 2EYQA 2ROTA 1AHJB 1RAFB 5FRMA 4CC3A 3G4SA 1YHQQ 4PJJA 2XDPA 4OMMA 5IHIA 1YJWA 1K0SA 1NBEB 4QQ6A 1WNLA 2HKNA 4N0AC 2NYSA 3I9QA 4JS4A 4C8QE 1YI2T 3MKDA 3I55Q 3CXCP 1D1BA 2KE9A 1GRIA 1TTHB 3HHTB 3I56T 1PC0A 3HFNA 2L3PA 4J9EA 3HRSA 4J9GA 1IXDA 2VVKA 2WACA 3EG9B 4OB2B 4GLKA 3RMQA 2QG9B 3BDLA 3MO8A 1EFNA 1T3LA 2L2PA 4X1VA 4KULA 3SWNC 3EG2A 1YN8A 3X25B 2BKDN 4EMKC 1YJ9Q 3G6ET 3PMTA 2FYKA 4FSSA 3CXCA 4M75G 1WXBA 2ZAEA 2MPXC 4M77D 2E65A 3HRTA 4PJOG 2RI5A 3AT1B 4HT9A 3RKXA 2DILA 1KC8U 3H6ZA 4B9XA 4LDUA 1PRLC 3UATA 1UJYA 3CCSQ 1PRMC 3DB3A 4PLIA 4HVVA 3ASKA 2EGCA 3EFSA 1Y96A 3M56A 2F2VA 2KSSA 3JCMX 3PTAA 2KK4A 1Q86R 3VU3C 4X34A 2LX7A 4D8KA 4J9IA 2GCXA 1NYGA 4M78C 2JJ9A 5IH2A 5GMKm 1M2VA 2FZGB 1Q86C 2CYZB 3CC2A 1OEBA 4OMPA 2PVOB 3LGLA 4XU1A 4R0KA 1JU5C 2RM4A 3A8OB 4OMQA 1I4K1 2EYWA 3L2WA 4RTYA 4KT0E 2DX1A 1UHFA 1ZHIA 2P84A 1QWFA 1D3BB 4IIMA 1HD3A 2IVWA 1VQ7A 1VQ9A 4MDXA 4CRIA 2ROLA 2HMAA 4HXJA 2RNAA 4JJNK 5GJVB 3A8HB 1NEBA 3M54A 3JAME 4C0DC 2XMFA 5KYYA 2K2VA 1AVZC 2DA9A 2G6FX 1K9MR 1N8RR 2BIVA 1B07A 2QEXT 2OTLQ 3OQ5A 4Z88A 5CIUA 1SEMA 1VQ6A 1CSKA 4GLMA 3CC4A 1K9MC 2DK3A 1N8RC 3FRNA 3CMET 4J6YA 5GANg 1IGUA 2A3LA 2YT6A 2DD5A 4RKUE 5GAN7 2CZ6B 4M7AF 4OMNA 4ELYC 1UG1A 1ZQ1A 2KY9A 2JTMA 4JUVA 3TREA 4EMHA 1QKXA 3OYEA 3MJXA 4C8QC 1AT1B 1YITQ 2EYYA 1WX6A 4J6XA 2RN8A 2A7YA 1LJOA 3OS2A 1VQLQ 5FWCA 4JDSA 1QVPA 2VUBA 2HL5C 2Z0WA 4Z89A 4KUIA 2DIGA 1MMGA 1D0YA 2KRNA 4IUQA 2YUPA 2LT1A 2KROA 2FRWA 3MP8A 4PLLA 5LJ3g 2BZXA 4LD9K 3P8BB 1VYUA 3CCET 4M7AA 3MPUB 2NUTA 2CP7A 4BD3A 2HNIA 3CMAA 2GBQA 4RTUA 2CP5A 3FJ5A 2GQVA 2QAZA 3SWNA 3RKYA 4HVWA 1UTIA 2CDTA 2VGNA 4RTZA 5CQXA 2EWNA 4M77B 5FRNA 3CCQA 1YCYA 2E3IA 5FU7B 2EIFA 2LJ0A 1RABB 4F7UF 1HJDA 4E47A 3OW2P 3OS0A 2YXYA 5GAOl 2X3WD 4RTTA 1M90U 3GOXA 5KH6A 3JCMc 5DLOA 1ZLMA 1OYXA 4BDZA 3THKA 3OYDA 5GAMf 1VQOT 2OTJA 4N4HA 4X9DA 3OYFA 4FU6A 1AWXA 1U1SA 4IUTA 3VS5A 2LDMA 2BUDA 1UGRB 3LH5A 2MOXA 1G5VA 2VWFA 4XTXA 4OGCA 1KQSA 3PVQA 3NFCA 1QCNA 2KQWA 2QTVA 1YWPA 3DKMA 1VIFA 3KBGA 1YCSB 4BY6B 1JXMA 3FIFA 1UGVA 3JCMb 3CCVT 1BCOA 2LZ6B 5KYYB 3OW2A 2QI2A 1ZA1B 4E7SA 3G71A 4DEYA 4F7UA 3ZBDA 2PNIA 2RI2A 1JXOA 1OV3A 2YRDA 2AKKA 2QQAA 4GBQA 3RBBB 1W2BP 4FSXA 2QGFB 4OB0B 2L8DA 1QP2A 3HP9A 1RAIB 4AMCA 2OX7A 4XU3A 5AT1B 1LNXA 5KCOA 2RJFA 2X51A 3RUXA 3M0RA 1FMWA 1E6HA 6AT1B 3SHWA 2RO0A 2LTOA 4EPCA 1KC8R 4J9CA 4M77E 1UHCA 4HVUA 2A36A 5L8RE 3CC7A 2XKOC 5HK0A 4M75F 1K73R 1R0CB 2I0NA 1KC8C 1UB4A 1W2BA 3JB9F 2EJFA 2LC4A 3RMSA 3CCUT 4KGZB 1K73C 1MNEA 4M75D 5KYNA 2LJ3A 3GF5A 3J80E 5LJ5e 1VYTA 2AZVA 2FPDA 3CPWS 3S3NA 4PJOD 5D6WA 4ORZA 4M7DD 4FW1A 1GCQC 2FL7A 4M7AB 1YI2Q 1H3HA 2NUTB 1YWOA 2YLBA 3I56Q 3CCEA 3REAB 2O9SA 2E6ZA 2RB6A 5KYWA 1B3QA 2M02A 3RERA 4RTWA 2Y4XA 2J6KA 1U8RA 1AWJA 2YWWA 4KUDK 1V1CA 4LE9A 3FB9A 1R0BG 2DXCA 1W1FA 1X27A 1Z9ZA 3JRZA 2EQUA 3BY7A 1TG0A 1IRXA 2CP2A 3R6OA 3CCRT 2DL5A 4OF1A 3G6EQ 2YUNA 4A54A 5A0DA 1M3BA 4O5VA 1VQPQ 2F5TX 1K4US 3V7RA 3G4ST 1PG5B 2HAXA 2CT3A 4PFOA 2JMAA 4VUBA 3EGDB 3NTKA 1D1CA 1RAAB 4QT7A 2VB6A 4C92F 1YJWT 2LCCA 1M1GA 5IXBA 5ECAA 1KJWA 2NUZA 2K4YA 2ABLA 2DYIA 2X4YA 3KUFA 2VYTA 2KYBA 2AKLA 2E1HA 1ZSZA 2SEMA 1FYNA 1YJNQ 4PK4A 3EGXB 2RA2A 2X9HA 3CCLT 1VQMA 2GNCA 4EIKA 3T9NA 4ELZC 1QVFP 1M27C 2VXEA 2MYSA 1S72A 1K9MU 1N8RU 3OYKA 4E7KA 3NHNA 4Y92A 3CQTA 2ZPEB 2CS7A 2OJ2A 1PNJA 4C92A 5A0LA 2VASA 5CR2A 3GPLA 1VA7A 3E9GA 2RPNA 1X2QA 2DEUA 2XIDA 1VQKT 2FVUA 4RTVA 3MCAB 3OYBA 4F14A 1C1AA 4DBFA 1OZ2A 3LWIA 1ZUYA 2DFUA 1QVFA 1OPKA 3NTHA 3X26B 4LD6A 3I35A 1CKAA 3VS1A 3CCMT 4JJBA 2DZCA 3UF4A 2GTOA 4A4HA 2HQHA 5GANe 4ZGJB 1GFCA 1OX9A 3LLRA 4V2SA 4DOWA 3CMEQ 3TU4K 2PU9B 1RAHB 3CC2T 3E9FA 1E6GA 4DOVA 4AG2C 1WHJA 2CSQA 2A28A 1H3ZA 3L1AA 5KYWB 5CVIA 1SRLA 3MEAA 4M75B 2MCNA 2EFIA 2LQNA 3OY9A 3GBQA 1MHNA 4PJOB 3QJ6A 2CUBA 4F7UG 2HZYA 1K76A 2LNVA 2J6FA 1RL2A 1VQ7T 5L23A 3OA6A 4RG8A 3PIPA 1PCXA 3FLGA 5GMKl 1N27A 1OX8A 4CC7A 1UUEA 1X6GA 1WGSA 5CAIA 1MGQA 2M51A 3D7SB 2LQKA 4YTLA 3GNFB 1YIJT 3VUZA 1VQ6T 1B34A 1UGPB 3CC4T 3EFOA 1FWZA 1VQ4T 5CKEA 2QQSA 1Q7YU 2KNBB 1UEBA 1Y7XA 2MI6A 5KYXA 1WZOA 1ZSZB 2CZ1B 2FZCB 4N4IA 1X6BA 4ESRA 1LVKA 2J6OA 1GL5A 3OYNA 2KXDA 4BACA 2L89A 2ATCB 2P0PA 3O5ZA 1VQLA 3OYMA 2COWA 5KYUA 3JCMg 2JUFA 3TEEA 1QWEA 3CCLA 2JTEA 2ED0A 1UFFA 2MIOA 1VQOQ 2JM8A 2KR3A 4HKEA 2DXBA 1WHLA 2MWPA 2OAUA 1JJ2P 3EG1A 3HL8A 1NPRA 3CD6T 1ZA2B 2DXTA 1HYOA 2V26A 4LN2A 4XTYA 1NJIU 2FRYA 3JSCA 5KE2A 4PJLA 3FJPA 4OB3B 8ATCB 4PJOE 1KK7A 3P8DA 4M7DE 2KXCA 2JN0A 3CCJA 3JB9G 1UECA 3CCVQ 1VQKA 3G7ZA 3EG0A 1H641 4XU0A 4Z02A 1RI9A 4EDUA 2KRSA 3UA6A 3CMAT 2LCSA 1KG1A 1JB0E 1G3YA 4FYVB 1G3TA 5GAN5 1KQ2A 7AT1B 1K73U 1RACB 3KXTA 1O75A 3CCMA 3NPFA 4MZTA 4HCBA 2LT4A 3CCQT 1JJ2A 1E7OA 5GAMg 2R5MA 2KEAA 4KH1B 3M9QA 3M4YA 5HY6A 3CEYA 1VQNT 2OTJT 1WQWA 1M3CA 3OBWA 1UJ0A 2ZPIB 1K0XA 1PSEA 1RAGB 3CPFA 2LRQA 2EYXA 2EGEA 1VQ8A 2E5QA 3DLMA 3OMGA 3VYHB 4ME7A 3RIRA 3CPWP 3A5ZB 1I8FA 2IIMA 5DY9A 3CCUQ 1TU0B 2E3HA 2DETA 1PKSA 5DM7R 3G71T 2ZZDA 2A08A 4QVDA 5CKFA 3VRZA 4C92G 2I2LA 4J7FA 4B9WA 4KBMB 5GAN8 4NOYA 2YDLA 1PHTA 2LQ8A 1YIJA 1W6XA 2R5AA 1A0NB 2ZPGB 3OSVA 3RR6A 5KYXB 1VQ4A 3LH0A 2BTTA 2XD0A 5FU6C 2H3JA 3H0HA 2FHDA 3TSZA 2D8HA 4LDXA 3OSSC 1G83A 2DRKA 2KGTA 8AT1B 2QA4A 5GMKj 3CC7T 4KGXB 4RMOA 1I0CA 2DVJA 3CCRQ 1JEGA 4LDYA 5I2SA 3HRUA 3WVDB 4M7AD 1K1ZA 1BCMA 3G4SQ 2RHIA 1JBMA 4N0AA 4CI0C 2DAQA 3QXEB 2AT1B 2YHTA 2RH2A 1VQ5T 3CD6A 2M0OA 5LJ5f 3H8ZA 3Q1JA 1Y57A 3ME9A 4C5GA 4C5EA 3EAEA 5CQYA 4D8DA 3M5AA 4AFUC 2H8HA 2XK0A 2EYZA 1X6OA 1KHCA 3QYGB 3PIOA 1BKBA 4PJOC 1LOJA 2RQTA 1SPKA 4M7DC 2KAFA 3QDRB 4DBQA 1Y96B 4A53A 1D09B 1TUGB 4CC4B 3C12A 1VQPA 2LMJA 5IHNA 3H0FA 4M78F 4EMKA 1WYXA 3NGPA 4IUPA 2JZ2A 2J06A 4E7HA 2DEQA 2X35A 2XHCA 1NLOC 3VV0A 5EG2A 3RESA 2AK5A 4IKFA 1M2VB 2HBWA 4KGVB 2NLUA 2E12A 3VS7A 2EKHA 4LUEA 1MV0B 1GFDA 1VQNA 2GFUA 4ZN3A 3I55T 5IT9E 1Q7YR 4KH0B 4J9HA 1QW1A 2CP3A 2FO0A 1PKTA 1BI0A 1N6AA 3RKWA 2AZSA 2JVVA 2WSEE 2LCLA 1Q7YC 2EW3A 2B86A 1U3OA 1OU8A 3PGGA 3CXCS 2DM1A 1QCFA 2EBPA 1QVGP 1VYVA 4BE2A 1YFNA 2BZ8A 1AEYA 4II1A 4M78A 3E19A 3M0TA 1KD1U 4JZ3A 1QMCA 2DRMA 3MP1A 4BE0A 4QKUA 4Y28E 1VQMT 4A4KA 3ZL7C 3M53A 1NPPA 1WPYA 4OGEA 2RJDA 3CC2Q 1S72T 1IHWA 1Y0MA 2HQXA 5GAN6 4PKCC 1ZUUA 2LVMA 2X3XD 1M30A 1RADB 1I5OB 2V1RA 2L3SA 1D0ZA 1NJIR 3WXMB 2PZ1A 1EIFA 3JCMQ 4BB7A 2VV5A 4XTWA 4RTXA 1QVGA 1NJIC 1VQ7Q 1VQ9Q 2PUKB 4C8QF 2ZPFB 1M1FA 4FM4B 4HCKA 5D6XA 1M8VA 1SHGA 2X4WA 1SRMA 1X75C 2NUPA 4J8OA 3JB9I 2W10A 3QHSA 3SB2A 5GAOp 1Z9QA 2HEQA 4LDVA 1VQ6Q 3CC4Q 5GAMj 4OB1B 2GTJA 3OYAA 2GFAA 2DLPA 2V8JA 2E70A 2QQRA 5GANf 1X2KA 2CT4A 3J81E 3JB9D 1VQ5A 3U23A 4O6JA 4NL3A 4LNPA 3SD4A 4FYXB 4ZGEB 1WDXA 4C0FA 3C4SA 4C8QA 3LW5E 1WFWA 4RG2A 2K6DA 2K79A 3S3MA 3NTIA 3SWNB 2DPPB 4EMKB 2EKOA 2KDSA 2OTLT 2B8AA 4J7IA 2XDBA 4NL2A 1OULA 4AFQC 3META 3QDFA 3V8KA 5I11A 1MMAA 2D0NA 1AOJA 2L3RA 4IURA 4ATOA 2DNUA 1YHQA 2VC8A 1U06A 3URGA 3DLLA 4BDYA 4DEXA 2QQ9A 5LJ3f 3X20B 2EQKA 4AT1B 5LJ5d 2O88A 1M9SA 3I55A 1BB9A 2DBMA 1FMKA 2HCKA 4B6MA 3CMAQ 3UT1A 4D6WA 3J7AF 3OBYA 3VJPA 2E64A 2ZGWA 4JRKA 4M78B 2L5QA 2DE0X 5LJ5h 2MK5A 2CP6A 2FPEA 1OQKA 1IO6A 2RF0A 3CCQQ 4C92D 2CUDA 1VQLT 3H41A 4F7UB 4MZPA 2D6FA 5HK3A 4QW2A 5C6SA 3S3OA 3L2ZA 1YJ9A 1MMNA 2OAWA 1TS9A 2JNGA 2KRMA 4F17A 2QXFA 3UDCA 3X24B 4MDWA 4XK8E 4M7AE 1IZ6A 3A8LB 1WI7A 4ZN1A 4J83A 4C0ZA 3E2UA 4BE1A 2P4RA 4C5HA 4C0DB 3EH2A 2PVGB 1I07A 3RNJA 3CCSA 2DJQA 3CCJT 4PNOA 3EG9A 4A4EA 2NUPB 1OI1A 2F5KA 3UPUA 1M4ZA 1GCPA 2K5FA 2DL8A 3G71Q 3INZA 1KQSS 1G2BA 4JPBW 3VKIA 3VS4A 2V8IA 2NWMA 3JCMJ 1Y71A 1M3AA 2QEXQ 2L3QA 1TH7A 3GIBA 4M77C 3VYGA 1T0HA 2FEIA 4FW2A 4DBRA 5FU7C 3OW2S 1IB8A 1WHGA 3QO3A 2G3RA 3OYCA 1ABQA 3HSBA 2PVDB 2DF6A 1BI1A 2ED1A 3MEUA 4DQ2A 1TWBA 2ESWA 2F2WA 1BI3A 5I22A 4PFPA 4M78G 4F7UE 1VQ8T 3P8HA 3ZEHA 4XTZA 3S6WA 2RK1A 3AHUA 4BY6C 4E7JA 1KD1R 2OTLA 4E7ZA 2O4XA 2YSQA 2BZYA 4OP0A 4HT8A 2ZPBB 3M0PA 2K7AA 1QKWA 1GCQA 4L6V5 3FC3A 5GMKi 1KD1C 1AD5A 5LJ3e 3FDRA 1M5Q1 1W2BS 4FT4A 5GANd 1WHHA 2RQUA 3HFOA 1HXDA 3VRYA 3CCEQ 2V8KA 1IHVA 3A98A 3M4GA 4FIBA 2K5IA 1NLPC 2L0AA 2M16A 3G1JA 4MMKA 3DB4A 4L5GA 1YITA 1UGQB 4J5YA 5GANh 2Y4YA 1X69A 2HKQB 2E5KA 5GAOq 3IQLA 1R77A 1ZBXA 2GF7A 2QA4T 2RQRA 2HSEB 1F1BB 2ZCFB 2HDAA 5FW9A 2FZKB 4IUVA 3E1SA 4FYWB 4BI3A 2RHYA 5LJ5g 4FT2A 2DYBA 2EAYA 4J6WA 1O9SA 4C92B 5LJ3d 5J39A 1PSFA 4C8QG 3REBB 4M75E 4ZTJA 1VUBA 2LX9A 1S1NA 1SG5A 3QSUA 1JO8A 5CO7A 4M7AC 1QLYA 1Q82R 2EJGA 2QASA 1SF9A 2K3BA 3M55A 4J9FA 2ECZA 3LWHA 5LJ3h 1K9AA 2AIRB 2COYA 1WA7A 2YUOA 4M77F 1Q82C 1N9RA 3VS0A 3M59A 2MMPA 4PFZA 1VQMQ 1WQ7A 1KSWA 2A0FB 1LCKA 2QGGA 4A4GA 1ZSGA 2XDDA 1VQPT 1WXTA 1S72Q 3BDUA 1N5ZA 2XU8A 2P0QA 9ATCB 3L2VA 5HCKA 3OS1A 2KT8A 4M7DG 4FL6A 3M57A 2DBKA 5CCAA 2RQWA 2RHZA 3M58A 3ULRB 2EJ9A 1Q95G 3V8LA 3JCMP 3L2RA 2W0ZA 1I81A 1ZX6A 4DA4A 5GAN2 2Y90A 1D0XA 3QZ9B 1Y07A 2RHXA 1YJNT 5EC7A 1M1KR 2EQJA 4M77A 4ANJA 1VIEA 2C0TA 1BIBA 2O4XB 1G8XA 3VUBA 3SFMA 1M1KC 1MV3A 1UDLA 2AHJB 5IXFA 1SHFA 1TSFA 3GNGA 3I5RA 4JZ4A 4C92E 3VS6A 5IAYA 1QVFS 1C0MA 2DO3A 1TOVA 5FLXE 3JCMW 1B34B 3EFOB 2K2MA 3M0SA 2QTXA 2BE7D 2OI3A 2PTKA 2K57A 2HQEA 2JW4A 3EHQA 1WJQA 1WJRA 1J3TA 3CPWA 5GAN4 1FMVA 1H8KA 1W4SA 2K3YA 1HK9A 4QVZA 3A8MB 2M0YA 3TSWA 3OMCA 2E6NA 2HSPA 5KYUB 3R6NA 2DKGA 5IN1A 5I21A 3CBMA 1ZUKA 2YLCA 2F69A 2X4JA 5D6YA 2RMOA 1B7TA 4HCZA 1T3SA 2CKKA 1U1TA 2E4HA 2XG8D 1EZZB 1BK2A 3CBPA 3JV3A 3JB9J 1YI2A 2F1LA 1OOTA 3VS2A 3I56A 1YJWQ 1AZEA 3UA7A 2CREA 4F16A 4E7IA 2X4XA 1G3WA 2IPOB 4RCCA 1SSFA 2DJZA 3KFVA 2F2XA 3JCMf 4M75C 2ENMA 1WHKA 2RK2A 2DTOA 1AZGB 3OYHA 2HL3A 2QYZA 3QG1A 4KRTA 5GJWB 3OYIA 3CCLQ 4FCYA 1OU9A 3QJYA 3G6EA 1WXUA 2JS2A 2HD0A 2JTFA 3OYJA 2EGAA 2IG0A 2JMCA 1W70A 3O8VA 1CKBA 2O9VA 1PD1A 1KFZA 4TVRA 2VGMA
chains in the Genus database with same CATH topology
2EGCA 1E6GA 3QWXX 4IIOA 1NG2A 2F2VA 1NM7A 4AG2C 2CSQA 2LX7A 2A28A 1SRLA 4D8KA 4J9IA 4AFQC 2MCNA 1NYGA 3SEMA 5I11A 5IH2A 2D0NA 1AOJA 2LQNA 1UE9A 2DNUA 3GBQA 1OEBA 4OMPA 1U06A 2CUBA 1K76A 2J6FA 4DEXA 5L23A 4R0KA 1JU5C 4OMQA 1TUCA 2EYWA 4RTYA 2O88A 3EHRA 2DX1A 4CC7A 1UUEA 1BB9A 2DBMA 1X6GA 1FMKA 2HCKA 1UHFA 1QWFA 5FWBA 4IIMA 1HD3A 2ROLA 2M51A 4HXJA 2RNAA 2EVRA 1RLPC 2RQVA 2O31A 2LJ1A 4J9DA 2DE0X 5GJVB 1NEBA 2FPEA 4E6RA 1U5SA 1IO6A 2RF0A 2XMFA 2CUDA 3H41A 1AVZC 2DA9A 2G6FX 2KNBB 1B07A 2LQWA 4Z88A 1SEMA 1CSKA 4GLMA 1X6BA 3EGUA 2OAWA 4ESRA 2J6OA 1GL5A 2KRMA 4F17A 2KXDA 1YP5A 4ZNXA 3O5ZA 2GGRA 1GBRA 1HSQA 2D1XA 1WI7A 1QWEA 2YT6A 2JTEA 2LP5A 1RUWA 2ED0A 3M0QA 4OMOA 1UFFA 4OMNA 2DMOA 2MIOA 2P4RA 1UG1A 2JM8A 2KR3A 1I07A 3RNJA 1QKXA 2DJQA 3EG1A 2YUQA 1BU1A 1X43A 2EYYA 4LN2A 2FRYA 1GCPA 2DL8A 2FPFA 1WX6A 3M0UA 1G2BA 2JM9A 2RN8A 4JPBW 1I1JA 3VS4A 3PVLA 2DL7A 2NWMA 1BBZA 5FWCA 2KXCA 1M3AA 4WCIA 4Z89A 2L3QA 1UECA 1T0HA 3EG0A 2FEIA 2KRNA 1RI9A 1JQQA 2KRSA 3UA6A 2LCSA 2YUPA 1M8MA 4A63B 2KROA 2FRWA 1AWOA 1SSHA 3NMZC 1ABQA 2BZXA 2KYMA 2DF6A 1VYUA 3NPFA 2ED1A 1ZBJA 2A37A 2O2OA 1E7OA 2ESWA 2F2WA 2KEAA 2GBQA 4RTUA 5I22A 3FJ5A 1GBQA 2KBTA 4HVWA 1UTIA 2CDTA 4RTZA 1AWWA 2VKNA 4K11A 1M3CA 1UJ0A 1K0XA 2LJ0A 1HJDA 2YSQA 2BZYA 2X3WD 4RTTA 3M0PA 2K7AA 2EYXA 2EGEA 1QKWA 1GCQA 1ZLMA 3THKA 4Z8AA 1AD5A 2CSIA 1XOVA 2SRCA 1AWXA 3VS5A 2IIMA 3LH5A 2MOXA 2VWFA 3TVTA 2RQUA 3PVQA 1PKSA 1WIEA 1YWPA 3VRYA 3A98A 2A08A 1YCSB 3VRZA 4LUDA 1JXMA 1MUZA 4RUGA 1UGVA 1ARKA 1NLPC 2L0AA 4M4ZA 2YDLA 2LZ6B 3VS3A 1PHTA 1H92A 1W6XA 3H0IA 1X69A 1A0NB 2E5KA 4DEYA 3IQLA 2PNIA 3I5SA 1JXOA 1OV3A 2RQRA 2AKKA 2D8JA 2BTTA 4GBQA 3RBBB 2HDAA 5FW9A 3H0HA 4JJDA 3TSZA 1ABOA 2D8HA 1G83A 2DRKA 4J9BA 2KGTA 1KIKA 2DYBA 2EPDA 1I0CA 2DVJA 2CH4W 2CH4A 1WLPB 3M0RA 1E6HA 1JEGA 3REBB 3SHWA 1S1NA 2K9GA 1K1ZA 2C0OA 2J05A 1JO8A 4J9CA 1QLYA 2V1QA 1TUDA 1UHCA 4HVUA 2C0IA 2K3BA 1NYFA 1RLQC 2A36A 4J9FA 2ECZA 2I0NA 2DL4A 1K9AA 1WA7A 2YUOA 1Y57A 2FG0A 1NEGA 3VS0A 4D8DA 1KSWA 4OMLA 1LCKA 2EQIA 4AFUC 2H8HA 1ZSGA 4AFSC 1WXTA 2LJ3A 2EYZA 1N5ZA 1VYTA 2JS0A 2AZVA 2FPDA 5HCKA 4ORZA 4JJCA 1GCQC 2KT8A 2RQTA 1SPKA 2DBKA 1H3HA 4CC4B 2LMJA 2RQWA 5IHNA 1YWOA 2QDLA 3H0FA 1WYXA 3NGPA 3ULRB 2J06A 3REAB 2O9SA 2W0ZA 1ZX6A 1NLOC 1B3QA 2AK5A 4RTWA 2HBWA 2J6KA 5EC7A 1AWJA 2GQIA 1YNZA 2LNHB 1PWTA 3C0CA 3VS7A 1V1CA 2EKHA 4LUEA 2C0TA 1MV0B 4LE9A 1GFDA 3PE0A 1W1FA 1X27A 1Z9ZA 2J7IA 1TG0A 4J9HA 1MV3A 2DL5A 1UDLA 2FO0A 2JT4A 2YUNA 5IXFA 1SHFA 3EG3A 1PKTA 4CC2A 1M3BA 3I5RA 2AZSA 1T0JA 4AFZC 4JZ4A 2EW3A 1K4US 2B86A 1U3OA 3VS6A 2JXBA 2KT1A 2CT3A 2DM1A 1QCFA 2EBPA 2JMAA 1VYVA 5IHKA 2BZ8A 4QT7A 1AEYA 2K2MA 2DL3A 3QWYA 3M0SA 3M0TA 5IXBA 4JZ3A 5ECAA 4AG1C 1KJWA 2DRMA 2NUZA 2ABLA 2ROTA 2OI3A 2PTKA 4CC3A 3ZL7C 2JW4A 3EHQA 2KYBA 1J3TA 2AKLA 1Y0MA 4OMMA 5IHIA 1ZUUA 1H8KA 2SEMA 2X3XD 1K0SA 1FYNA 1M30A 2M0YA 3TSWA 2V1RA 2L3SA 2HSPA 3R6NA 3I9QA 2GNCA 4EIKA 1ZUKA 1M27C 2PZ1A 2KE9A 2RMOA 1GRIA 4RTXA 1T3SA 3NHNA 4Y92A 3CQTA 2L3PA 4J9EA 4HCKA 2OJ2A 1BK2A 4J9GA 3JV3A 2VVKA 1PNJA 1SHGA 1SRMA 1VA7A 1OOTA 1EFNA 3VS2A 1T3LA 2L2PA 4X1VA 1AZEA 3UA7A 2RPNA 1X2QA 2CREA 2W10A 1YN8A 3EG2A 4F16A 1Z9QA 2HEQA 4RTVA 4F14A 2GTJA 1ZUYA 3KFVA 1OPKA 2F2XA 4FSSA 2DLPA 2ENMA 1X2KA 1WXBA 3I35A 2CT4A 1AZGB 1CKAA 3VS1A 3U23A 4JJBA 4KRTA 5GJWB 4LNPA 3UF4A 1WXUA 2JS2A 2DILA 1WDXA 2GTOA 2EGAA 1PRLC 1GFCA 3UATA 1WFWA 1UJYA 2JMCA 1W70A 1CKBA 2K6DA 2O9VA 1KFZA 1PRMC 2K79A 1OPLA 4HVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGC A;  1E6G A;  3QWX X;  4IIO A;  1NG2 A;  2F2V A;  1NM7 A;  4AG2 C;  2CSQ A;  2LX7 A;  2A28 A;  1SRL A;  4D8K A;  4J9I A;  4AFQ C;  2MCN A;  1NYG A;  3SEM A;  5I11 A;  5IH2 A;  2D0N A;  1AOJ A;  2LQN A;  1UE9 A;  2DNU A;  3GBQ A;  1OEB A;  4OMP A;  1U06 A;  2CUB A;  1K76 A;  2J6F A;  4DEX A;  5L23 A;  4R0K A;  1JU5 C;  4OMQ A;  1TUC A;  2EYW A;  4RTY A;  2O88 A;  3EHR A;  2DX1 A;  4CC7 A;  1UUE A;  1BB9 A;  2DBM A;  1X6G A;  1FMK A;  2HCK A;  1UHF A;  1QWF A;  5FWB A;  4IIM A;  1HD3 A;  2ROL A;  2M51 A;  4HXJ A;  2RNA A;  2EVR A;  1RLP C;  2RQV A;  2O31 A;  2LJ1 A;  4J9D A;  2DE0 X;  5GJV B;  1NEB A;  2FPE A;  4E6R A;  1U5S A;  1IO6 A;  2RF0 A;  2XMF A;  2CUD A;  3H41 A;  1AVZ C;  2DA9 A;  2G6F X;  2KNB B;  1B07 A;  2LQW A;  4Z88 A;  1SEM A;  1CSK A;  4GLM A;  1X6B A;  3EGU A;  2OAW A;  4ESR A;  2J6O A;  1GL5 A;  2KRM A;  4F17 A;  2KXD A;  1YP5 A;  4ZNX A;  3O5Z A;  2GGR A;  1GBR A;  1HSQ A;  2D1X A;  1WI7 A;  1QWE A;  2YT6 A;  2JTE A;  2LP5 A;  1RUW A;  2ED0 A;  3M0Q A;  4OMO A;  1UFF A;  4OMN A;  2DMO A;  2MIO A;  2P4R A;  1UG1 A;  2JM8 A;  2KR3 A;  1I07 A;  3RNJ A;  1QKX A;  2DJQ A;  3EG1 A;  2YUQ A;  1BU1 A;  1X43 A;  2EYY A;  4LN2 A;  2FRY A;  1GCP A;  2DL8 A;  2FPF A;  1WX6 A;  3M0U A;  1G2B A;  2JM9 A;  2RN8 A;  4JPB W;  1I1J A;  3VS4 A;  3PVL A;  2DL7 A;  2NWM A;  1BBZ A;  5FWC A;  2KXC A;  1M3A A;  4WCI A;  4Z89 A;  2L3Q A;  1UEC A;  1T0H A;  3EG0 A;  2FEI A;  2KRN A;  1RI9 A;  1JQQ A;  2KRS A;  3UA6 A;  2LCS A;  2YUP A;  1M8M A;  4A63 B;  2KRO A;  2FRW A;  1AWO A;  1SSH A;  3NMZ C;  1ABQ A;  2BZX A;  2KYM A;  2DF6 A;  1VYU A;  3NPF A;  2ED1 A;  1ZBJ A;  2A37 A;  2O2O A;  1E7O A;  2ESW A;  2F2W A;  2KEA A;  2GBQ A;  4RTU A;  5I22 A;  3FJ5 A;  1GBQ A;  2KBT A;  4HVW A;  1UTI A;  2CDT A;  4RTZ A;  1AWW A;  2VKN A;  4K11 A;  1M3C A;  1UJ0 A;  1K0X A;  2LJ0 A;  1HJD A;  2YSQ A;  2BZY A;  2X3W D;  4RTT A;  3M0P A;  2K7A A;  2EYX A;  2EGE A;  1QKW A;  1GCQ A;  1ZLM A;  3THK A;  4Z8A A;  1AD5 A;  2CSI A;  1XOV A;  2SRC A;  1AWX A;  3VS5 A;  2IIM A;  3LH5 A;  2MOX A;  2VWF A;  3TVT A;  2RQU A;  3PVQ A;  1PKS A;  1WIE A;  1YWP A;  3VRY A;  3A98 A;  2A08 A;  1YCS B;  3VRZ A;  4LUD A;  1JXM A;  1MUZ A;  4RUG A;  1UGV A;  1ARK A;  1NLP C;  2L0A A;  4M4Z A;  2YDL A;  2LZ6 B;  3VS3 A;  1PHT A;  1H92 A;  1W6X A;  3H0I A;  1X69 A;  1A0N B;  2E5K A;  4DEY A;  3IQL A;  2PNI A;  3I5S A;  1JXO A;  1OV3 A;  2RQR A;  2AKK A;  2D8J A;  2BTT A;  4GBQ A;  3RBB B;  2HDA A;  5FW9 A;  3H0H A;  4JJD A;  3TSZ A;  1ABO A;  2D8H A;  1G83 A;  2DRK A;  4J9B A;  2KGT A;  1KIK A;  2DYB A;  2EPD A;  1I0C A;  2DVJ A;  2CH4 W;  2CH4 A;  1WLP B;  3M0R A;  1E6H A;  1JEG A;  3REB B;  3SHW A;  1S1N A;  2K9G A;  1K1Z A;  2C0O A;  2J05 A;  1JO8 A;  4J9C A;  1QLY A;  2V1Q A;  1TUD A;  1UHC A;  4HVU A;  2C0I A;  2K3B A;  1NYF A;  1RLQ C;  2A36 A;  4J9F A;  2ECZ A;  2I0N A;  2DL4 A;  1K9A A;  1WA7 A;  2YUO A;  1Y57 A;  2FG0 A;  1NEG A;  3VS0 A;  4D8D A;  1KSW A;  4OML A;  1LCK A;  2EQI A;  4AFU C;  2H8H A;  1ZSG A;  4AFS C;  1WXT A;  2LJ3 A;  2EYZ A;  1N5Z A;  1VYT A;  2JS0 A;  2AZV A;  2FPD A;  5HCK A;  4ORZ A;  4JJC A;  1GCQ C;  2KT8 A;  2RQT A;  1SPK A;  2DBK A;  1H3H A;  4CC4 B;  2LMJ A;  2RQW A;  5IHN A;  1YWO A;  2QDL A;  3H0F A;  1WYX A;  3NGP A;  3ULR B;  2J06 A;  3REA B;  2O9S A;  2W0Z A;  1ZX6 A;  1NLO C;  1B3Q A;  2AK5 A;  4RTW A;  2HBW A;  2J6K A;  5EC7 A;  1AWJ A;  2GQI A;  1YNZ A;  2LNH B;  1PWT A;  3C0C A;  3VS7 A;  1V1C A;  2EKH A;  4LUE A;  2C0T A;  1MV0 B;  4LE9 A;  1GFD A;  3PE0 A;  1W1F A;  1X27 A;  1Z9Z A;  2J7I A;  1TG0 A;  4J9H A;  1MV3 A;  2DL5 A;  1UDL A;  2FO0 A;  2JT4 A;  2YUN A;  5IXF A;  1SHF A;  3EG3 A;  1PKT A;  4CC2 A;  1M3B A;  3I5R A;  2AZS A;  1T0J A;  4AFZ C;  4JZ4 A;  2EW3 A;  1K4U S;  2B86 A;  1U3O A;  3VS6 A;  2JXB A;  2KT1 A;  2CT3 A;  2DM1 A;  1QCF A;  2EBP A;  2JMA A;  1VYV A;  5IHK A;  2BZ8 A;  4QT7 A;  1AEY A;  2K2M A;  2DL3 A;  3QWY A;  3M0S A;  3M0T A;  5IXB A;  4JZ3 A;  5ECA A;  4AG1 C;  1KJW A;  2DRM A;  2NUZ A;  2ABL A;  2ROT A;  2OI3 A;  2PTK A;  4CC3 A;  3ZL7 C;  2JW4 A;  3EHQ A;  2KYB A;  1J3T A;  2AKL A;  1Y0M A;  4OMM A;  5IHI A;  1ZUU A;  1H8K A;  2SEM A;  2X3X D;  1K0S A;  1FYN A;  1M30 A;  2M0Y A;  3TSW A;  2V1R A;  2L3S A;  2HSP A;  3R6N A;  3I9Q A;  2GNC A;  4EIK A;  1ZUK A;  1M27 C;  2PZ1 A;  2KE9 A;  2RMO A;  1GRI A;  4RTX A;  1T3S A;  3NHN A;  4Y92 A;  3CQT A;  2L3P A;  4J9E A;  4HCK A;  2OJ2 A;  1BK2 A;  4J9G A;  3JV3 A;  2VVK A;  1PNJ A;  1SHG A;  1SRM A;  1VA7 A;  1OOT A;  1EFN A;  3VS2 A;  1T3L A;  2L2P A;  4X1V A;  1AZE A;  3UA7 A;  2RPN A;  1X2Q A;  2CRE A;  2W10 A;  1YN8 A;  3EG2 A;  4F16 A;  1Z9Q A;  2HEQ A;  4RTV A;  4F14 A;  2GTJ A;  1ZUY A;  3KFV A;  1OPK A;  2F2X A;  4FSS A;  2DLP A;  2ENM A;  1X2K A;  1WXB A;  3I35 A;  2CT4 A;  1AZG B;  1CKA A;  3VS1 A;  3U23 A;  4JJB A;  4KRT A;  5GJW B;  4LNP A;  3UF4 A;  1WXU A;  2JS2 A;  2DIL A;  1WDX A;  2GTO A;  2EGA A;  1PRL C;  1GFC A;  3UAT A;  1WFW A;  1UJY A;  2JMC A;  1W70 A;  1CKB A;  2K6D A;  2O9V A;  1KFZ A;  1PRM C;  2K79 A;  1OPL A;  4HVV A; 
#chains in the Genus database with same CATH topology
 1YHQ T;  1GXI E;  1P92 A;  3QWX X;  4IIO A;  1NG2 A;  2RD1 A;  1NM7 A;  2KVQ G;  2RHU A;  5D7U A;  3L2U A;  2CZ7 B;  1KQS P;  4M78 D;  1M2O A;  1BYM A;  4NS5 A;  3SEM A;  2R58 A;  3CCJ Q;  5GMK e;  1UE9 A;  1VQK Q;  4BUG A;  3PNW C;  1YJN A;  1V76 A;  1TUC A;  3A1P A;  1ZSZ C;  1K8A U;  3EHR A;  1KHI A;  4E2F B;  3CCM Q;  4DBH A;  4N4G A;  2E41 A;  5FWB A;  3X28 B;  2DZ9 A;  4R55 A;  2EVR A;  1RLP C;  3H9N A;  2RQV A;  1YJ9 T;  3EGD A;  2O31 A;  3GLX A;  1WJS A;  2LJ1 A;  5J3B A;  4J9D A;  3PMI A;  5LJ5 j;  4E6R A;  1U5S A;  2PUO B;  3V7S A;  2QDY B;  1LPL A;  2RJC A;  1Q81 U;  2DVE A;  4C92 C;  2RJE A;  1JJ2 S;  3OB9 A;  5FRO A;  2LQW A;  2WSF E;  4Q5W A;  1VQ8 Q;  1QQJ A;  5GAO n;  3EGU A;  4XQ3 A;  4XTV A;  4FYY B;  4IUU A;  1YP5 A;  4JS5 A;  2DTH A;  1NE8 A;  4ZNX A;  3EGX A;  3CCS T;  1WHM A;  2QEX A;  4HCC A;  2GGR A;  1GBR A;  1HSQ A;  2D1X A;  4HA8 A;  4C0G A;  4A4F A;  2M1H A;  3BW1 A;  5KE3 A;  2XI9 A;  2LP5 A;  1RUW A;  2O01 E;  3MEV A;  4RCB A;  3M0Q A;  4OMO A;  2H3E B;  2DMO A;  4L59 A;  3UWN A;  5GMK h;  1MMD A;  1V29 B;  3CME A;  4C8Q D;  2YUQ A;  1BU1 A;  1X43 A;  2MF2 A;  1YIJ Q;  2FPF A;  3M0U A;  2JM9 A;  1X01 A;  1I1J A;  2JOY A;  2R57 A;  3EH1 A;  3V8J A;  1VQ4 Q;  3PVL A;  3QPH A;  2DL7 A;  4Y91 A;  3N5B B;  1BBZ A;  3L42 A;  2DIQ A;  4E7L A;  3ZFJ A;  4WCI A;  1I5L A;  3QBY A;  4WF2 A;  4M77 G;  3TCJ A;  2DXU A;  1QP3 A;  3PT9 A;  4PJO F;  3LGF A;  3MEW A;  4C5I A;  1JQQ A;  4M7D F;  3JCM e;  1M8M A;  4A63 B;  1Q82 U;  1AWO A;  4F04 B;  1SSH A;  2QQB A;  2QA4 Q;  3NMZ C;  4XU2 A;  3JB9 H;  2KYM A;  1N9S A;  4MML A;  2M9U A;  5CKB A;  1ZBJ A;  2A37 A;  2PQW A;  2O2O A;  1BIA A;  2BE9 B;  2DD4 A;  4JLG A;  1EX4 A;  5M9O A;  1RAE B;  1YBY A;  4X9C A;  1UGS B;  4XTU A;  1DJ7 B;  2P4T A;  1GBQ A;  4ZTF A;  3HKS A;  4R56 A;  3CBO A;  5GAO m;  2KBT A;  4WTO B;  2COZ A;  1AWW A;  2VKN A;  3CD6 Q;  4K11 A;  1OPL A;  2MWO A;  4M75 A;  1VOM A;  2P0K A;  5CKH A;  2K3X A;  4GY5 A;  1ACM B;  3QII A;  1RI0 A;  4PJO A;  2WSC E;  1D1A A;  4M7D A;  3HTR A;  4Z8A A;  4OMF B;  2CSI A;  1XOV A;  1FX7 A;  2SRC A;  2RI3 A;  2D9T A;  1Q86 U;  3LX7 A;  3JCM d;  5GAO r;  3TVT A;  1M1K U;  1YIT T;  3MHX A;  4QQG A;  3BE3 A;  5GAM e;  1WIE A;  3C95 A;  5LL6 S;  2DER A;  2KI7 A;  3BFM A;  1G3S A;  1VQO A;  4LUD A;  1MUZ A;  4RUG A;  1ARK A;  4M4Z A;  5C0M A;  3QUI A;  2YRC A;  3VS3 A;  1H92 A;  3JCM h;  3OYL A;  3H0I A;  3ER0 A;  4PL6 A;  5GAN j;  1XNI A;  3QKJ A;  4EMG A;  1VQN Q;  2OTJ Q;  2HBP A;  3I5S A;  2DTI A;  2D8J A;  4OVA A;  3OS5 A;  1QCO A;  5CK9 A;  4JRQ A;  3CCV A;  4JLI A;  4JJD A;  3MP6 A;  1ABO A;  2QK0 A;  4J9B A;  5A0G A;  3QYH B;  1BI2 A;  3GP8 A;  1JRI A;  1KIK A;  2C06 A;  2EPD A;  4LDW A;  5DLQ E;  4ZGD B;  4UC4 A;  2CH4 W;  2CH4 A;  1WLP B;  3FEO A;  2K9G A;  5GAM d;  1OZ3 A;  2C0O A;  2CZ0 B;  2J05 A;  3PFS A;  4BI8 B;  3V7C A;  4M7A G;  5A2Q E;  1XJW B;  2V1Q A;  1TUD A;  2C0I A;  1NYF A;  1RLQ C;  3SDZ A;  2EQM A;  5FU6 B;  2DL4 A;  5LJ3 j;  4QVC A;  2FG0 A;  1NEG A;  2CP0 A;  1XQH A;  3TQ7 P;  4OML A;  5GAM h;  3LYI A;  2EQI A;  3OYG A;  2XIC A;  3WVE B;  3RDV A;  4AFS C;  1MND A;  5HKC A;  3F70 A;  3HPW A;  1R8O B;  2JS0 A;  1IGQ A;  4C8Q B;  4M78 E;  5KCH A;  4JJC A;  3EFR A;  2VXF A;  3QZ5 B;  1FXX A;  3CCU A;  1IRE B;  5AYF A;  4QQD A;  1M90 R;  3CC7 Q;  1SKU B;  5CKD A;  2QDL A;  4JRP A;  1K8A R;  2FB7 A;  1XTD A;  1QVG S;  1M90 C;  2ZPH B;  1KQ1 A;  2E10 A;  2MAM A;  1K8A C;  4PJN A;  2GQI A;  1YNZ A;  2CGH A;  1PM3 A;  1PWT A;  2LNH B;  3C0C A;  3A8G B;  3PE0 A;  1TXQ A;  1VQ5 Q;  1NZ9 A;  2J7I A;  2D0Q B;  1Q81 R;  5I2M A;  4BI4 A;  3C94 A;  2JT4 A;  4M7D B;  3EG3 A;  1VQ9 T;  4XAX B;  4CC2 A;  4MZM A;  4AFZ C;  1T0J A;  5GAN 3;  1PD0 A;  2KMT A;  1Q81 C;  1D3B A;  4PJM A;  5J26 A;  4JRI A;  3L2Q A;  2K5L A;  2JXB A;  2KT1 A;  3OYY A;  4LXC A;  5IHK A;  3JCM V;  2DL3 A;  3QWY A;  4P5N A;  3CCR A;  4AG1 C;  1C6V X;  2YRV A;  2EYQ A;  2ROT A;  1AHJ B;  1RAF B;  5FRM A;  4CC3 A;  3G4S A;  1YHQ Q;  4PJJ A;  2XDP A;  4OMM A;  5IHI A;  1YJW A;  1K0S A;  1NBE B;  4QQ6 A;  1WNL A;  2HKN A;  4N0A C;  2NYS A;  3I9Q A;  4JS4 A;  4C8Q E;  1YI2 T;  3MKD A;  3I55 Q;  3CXC P;  1D1B A;  2KE9 A;  1GRI A;  1TTH B;  3HHT B;  3I56 T;  1PC0 A;  3HFN A;  2L3P A;  4J9E A;  3HRS A;  4J9G A;  1IXD A;  2VVK A;  2WAC A;  3EG9 B;  4OB2 B;  4GLK A;  3RMQ A;  2QG9 B;  3BDL A;  3MO8 A;  1EFN A;  1T3L A;  2L2P A;  4X1V A;  4KUL A;  3SWN C;  3EG2 A;  1YN8 A;  3X25 B;  2BKD N;  4EMK C;  1YJ9 Q;  3G6E T;  3PMT A;  2FYK A;  4FSS A;  3CXC A;  4M75 G;  1WXB A;  2ZAE A;  2MPX C;  4M77 D;  2E65 A;  3HRT A;  4PJO G;  2RI5 A;  3AT1 B;  4HT9 A;  3RKX A;  2DIL A;  1KC8 U;  3H6Z A;  4B9X A;  4LDU A;  1PRL C;  3UAT A;  1UJY A;  3CCS Q;  1PRM C;  3DB3 A;  4PLI A;  4HVV A;  3ASK A;  2EGC A;  3EFS A;  1Y96 A;  3M56 A;  2F2V A;  2KSS A;  3JCM X;  3PTA A;  2KK4 A;  1Q86 R;  3VU3 C;  4X34 A;  2LX7 A;  4D8K A;  4J9I A;  2GCX A;  1NYG A;  4M78 C;  2JJ9 A;  5IH2 A;  5GMK m;  1M2V A;  2FZG B;  1Q86 C;  2CYZ B;  3CC2 A;  1OEB A;  4OMP A;  2PVO B;  3LGL A;  4XU1 A;  4R0K A;  1JU5 C;  2RM4 A;  3A8O B;  4OMQ A;  1I4K 1;  2EYW A;  3L2W A;  4RTY A;  4KT0 E;  2DX1 A;  1UHF A;  1ZHI A;  2P84 A;  1QWF A;  1D3B B;  4IIM A;  1HD3 A;  2IVW A;  1VQ7 A;  1VQ9 A;  4MDX A;  4CRI A;  2ROL A;  2HMA A;  4HXJ A;  2RNA A;  4JJN K;  5GJV B;  3A8H B;  1NEB A;  3M54 A;  3JAM E;  4C0D C;  2XMF A;  5KYY A;  2K2V A;  1AVZ C;  2DA9 A;  2G6F X;  1K9M R;  1N8R R;  2BIV A;  1B07 A;  2QEX T;  2OTL Q;  3OQ5 A;  4Z88 A;  5CIU A;  1SEM A;  1VQ6 A;  1CSK A;  4GLM A;  3CC4 A;  1K9M C;  2DK3 A;  1N8R C;  3FRN A;  3CME T;  4J6Y A;  5GAN g;  1IGU A;  2A3L A;  2YT6 A;  2DD5 A;  4RKU E;  5GAN 7;  2CZ6 B;  4M7A F;  4OMN A;  4ELY C;  1UG1 A;  1ZQ1 A;  2KY9 A;  2JTM A;  4JUV A;  3TRE A;  4EMH A;  1QKX A;  3OYE A;  3MJX A;  4C8Q C;  1AT1 B;  1YIT Q;  2EYY A;  1WX6 A;  4J6X A;  2RN8 A;  2A7Y A;  1LJO A;  3OS2 A;  1VQL Q;  5FWC A;  4JDS A;  1QVP A;  2VUB A;  2HL5 C;  2Z0W A;  4Z89 A;  4KUI A;  2DIG A;  1MMG A;  1D0Y A;  2KRN A;  4IUQ A;  2YUP A;  2LT1 A;  2KRO A;  2FRW A;  3MP8 A;  4PLL A;  5LJ3 g;  2BZX A;  4LD9 K;  3P8B B;  1VYU A;  3CCE T;  4M7A A;  3MPU B;  2NUT A;  2CP7 A;  4BD3 A;  2HNI A;  3CMA A;  2GBQ A;  4RTU A;  2CP5 A;  3FJ5 A;  2GQV A;  2QAZ A;  3SWN A;  3RKY A;  4HVW A;  1UTI A;  2CDT A;  2VGN A;  4RTZ A;  5CQX A;  2EWN A;  4M77 B;  5FRN A;  3CCQ A;  1YCY A;  2E3I A;  5FU7 B;  2EIF A;  2LJ0 A;  1RAB B;  4F7U F;  1HJD A;  4E47 A;  3OW2 P;  3OS0 A;  2YXY A;  5GAO l;  2X3W D;  4RTT A;  1M90 U;  3GOX A;  5KH6 A;  3JCM c;  5DLO A;  1ZLM A;  1OYX A;  4BDZ A;  3THK A;  3OYD A;  5GAM f;  1VQO T;  2OTJ A;  4N4H A;  4X9D A;  3OYF A;  4FU6 A;  1AWX A;  1U1S A;  4IUT A;  3VS5 A;  2LDM A;  2BUD A;  1UGR B;  3LH5 A;  2MOX A;  1G5V A;  2VWF A;  4XTX A;  4OGC A;  1KQS A;  3PVQ A;  3NFC A;  1QCN A;  2KQW A;  2QTV A;  1YWP A;  3DKM A;  1VIF A;  3KBG A;  1YCS B;  4BY6 B;  1JXM A;  3FIF A;  1UGV A;  3JCM b;  3CCV T;  1BCO A;  2LZ6 B;  5KYY B;  3OW2 A;  2QI2 A;  1ZA1 B;  4E7S A;  3G71 A;  4DEY A;  4F7U A;  3ZBD A;  2PNI A;  2RI2 A;  1JXO A;  1OV3 A;  2YRD A;  2AKK A;  2QQA A;  4GBQ A;  3RBB B;  1W2B P;  4FSX A;  2QGF B;  4OB0 B;  2L8D A;  1QP2 A;  3HP9 A;  1RAI B;  4AMC A;  2OX7 A;  4XU3 A;  5AT1 B;  1LNX A;  5KCO A;  2RJF A;  2X51 A;  3RUX A;  3M0R A;  1FMW A;  1E6H A;  6AT1 B;  3SHW A;  2RO0 A;  2LTO A;  4EPC A;  1KC8 R;  4J9C A;  4M77 E;  1UHC A;  4HVU A;  2A36 A;  5L8R E;  3CC7 A;  2XKO C;  5HK0 A;  4M75 F;  1K73 R;  1R0C B;  2I0N A;  1KC8 C;  1UB4 A;  1W2B A;  3JB9 F;  2EJF A;  2LC4 A;  3RMS A;  3CCU T;  4KGZ B;  1K73 C;  1MNE A;  4M75 D;  5KYN A;  2LJ3 A;  3GF5 A;  3J80 E;  5LJ5 e;  1VYT A;  2AZV A;  2FPD A;  3CPW S;  3S3N A;  4PJO D;  5D6W A;  4ORZ A;  4M7D D;  4FW1 A;  1GCQ C;  2FL7 A;  4M7A B;  1YI2 Q;  1H3H A;  2NUT B;  1YWO A;  2YLB A;  3I56 Q;  3CCE A;  3REA B;  2O9S A;  2E6Z A;  2RB6 A;  5KYW A;  1B3Q A;  2M02 A;  3RER A;  4RTW A;  2Y4X A;  2J6K A;  1U8R A;  1AWJ A;  2YWW A;  4KUD K;  1V1C A;  4LE9 A;  3FB9 A;  1R0B G;  2DXC A;  1W1F A;  1X27 A;  1Z9Z A;  3JRZ A;  2EQU A;  3BY7 A;  1TG0 A;  1IRX A;  2CP2 A;  3R6O A;  3CCR T;  2DL5 A;  4OF1 A;  3G6E Q;  2YUN A;  4A54 A;  5A0D A;  1M3B A;  4O5V A;  1VQP Q;  2F5T X;  1K4U S;  3V7R A;  3G4S T;  1PG5 B;  2HAX A;  2CT3 A;  4PFO A;  2JMA A;  4VUB A;  3EGD B;  3NTK A;  1D1C A;  1RAA B;  4QT7 A;  2VB6 A;  4C92 F;  1YJW T;  2LCC A;  1M1G A;  5IXB A;  5ECA A;  1KJW A;  2NUZ A;  2K4Y A;  2ABL A;  2DYI A;  2X4Y A;  3KUF A;  2VYT A;  2KYB A;  2AKL A;  2E1H A;  1ZSZ A;  2SEM A;  1FYN A;  1YJN Q;  4PK4 A;  3EGX B;  2RA2 A;  2X9H A;  3CCL T;  1VQM A;  2GNC A;  4EIK A;  3T9N A;  4ELZ C;  1QVF P;  1M27 C;  2VXE A;  2MYS A;  1S72 A;  1K9M U;  1N8R U;  3OYK A;  4E7K A;  3NHN A;  4Y92 A;  3CQT A;  2ZPE B;  2CS7 A;  2OJ2 A;  1PNJ A;  4C92 A;  5A0L A;  2VAS A;  5CR2 A;  3GPL A;  1VA7 A;  3E9G A;  2RPN A;  1X2Q A;  2DEU A;  2XID A;  1VQK T;  2FVU A;  4RTV A;  3MCA B;  3OYB A;  4F14 A;  1C1A A;  4DBF A;  1OZ2 A;  3LWI A;  1ZUY A;  2DFU A;  1QVF A;  1OPK A;  3NTH A;  3X26 B;  4LD6 A;  3I35 A;  1CKA A;  3VS1 A;  3CCM T;  4JJB A;  2DZC A;  3UF4 A;  2GTO A;  4A4H A;  2HQH A;  5GAN e;  4ZGJ B;  1GFC A;  1OX9 A;  3LLR A;  4V2S A;  4DOW A;  3CME Q;  3TU4 K;  2PU9 B;  1RAH B;  3CC2 T;  3E9F A;  1E6G A;  4DOV A;  4AG2 C;  1WHJ A;  2CSQ A;  2A28 A;  1H3Z A;  3L1A A;  5KYW B;  5CVI A;  1SRL A;  3MEA A;  4M75 B;  2MCN A;  2EFI A;  2LQN A;  3OY9 A;  3GBQ A;  1MHN A;  4PJO B;  3QJ6 A;  2CUB A;  4F7U G;  2HZY A;  1K76 A;  2LNV A;  2J6F A;  1RL2 A;  1VQ7 T;  5L23 A;  3OA6 A;  4RG8 A;  3PIP A;  1PCX A;  3FLG A;  5GMK l;  1N27 A;  1OX8 A;  4CC7 A;  1UUE A;  1X6G A;  1WGS A;  5CAI A;  1MGQ A;  2M51 A;  3D7S B;  2LQK A;  4YTL A;  3GNF B;  1YIJ T;  3VUZ A;  1VQ6 T;  1B34 A;  1UGP B;  3CC4 T;  3EFO A;  1FWZ A;  1VQ4 T;  5CKE A;  2QQS A;  1Q7Y U;  2KNB B;  1UEB A;  1Y7X A;  2MI6 A;  5KYX A;  1WZO A;  1ZSZ B;  2CZ1 B;  2FZC B;  4N4I A;  1X6B A;  4ESR A;  1LVK A;  2J6O A;  1GL5 A;  3OYN A;  2KXD A;  4BAC A;  2L89 A;  2ATC B;  2P0P A;  3O5Z A;  1VQL A;  3OYM A;  2COW A;  5KYU A;  3JCM g;  2JUF A;  3TEE A;  1QWE A;  3CCL A;  2JTE A;  2ED0 A;  1UFF A;  2MIO A;  1VQO Q;  2JM8 A;  2KR3 A;  4HKE A;  2DXB A;  1WHL A;  2MWP A;  2OAU A;  1JJ2 P;  3EG1 A;  3HL8 A;  1NPR A;  3CD6 T;  1ZA2 B;  2DXT A;  1HYO A;  2V26 A;  4LN2 A;  4XTY A;  1NJI U;  2FRY A;  3JSC A;  5KE2 A;  4PJL A;  3FJP A;  4OB3 B;  8ATC B;  4PJO E;  1KK7 A;  3P8D A;  4M7D E;  2KXC A;  2JN0 A;  3CCJ A;  3JB9 G;  1UEC A;  3CCV Q;  1VQK A;  3G7Z A;  3EG0 A;  1H64 1;  4XU0 A;  4Z02 A;  1RI9 A;  4EDU A;  2KRS A;  3UA6 A;  3CMA T;  2LCS A;  1KG1 A;  1JB0 E;  1G3Y A;  4FYV B;  1G3T A;  5GAN 5;  1KQ2 A;  7AT1 B;  1K73 U;  1RAC B;  3KXT A;  1O75 A;  3CCM A;  3NPF A;  4MZT A;  4HCB A;  2LT4 A;  3CCQ T;  1JJ2 A;  1E7O A;  5GAM g;  2R5M A;  2KEA A;  4KH1 B;  3M9Q A;  3M4Y A;  5HY6 A;  3CEY A;  1VQN T;  2OTJ T;  1WQW A;  1M3C A;  3OBW A;  1UJ0 A;  2ZPI B;  1K0X A;  1PSE A;  1RAG B;  3CPF A;  2LRQ A;  2EYX A;  2EGE A;  1VQ8 A;  2E5Q A;  3DLM A;  3OMG A;  3VYH B;  4ME7 A;  3RIR A;  3CPW P;  3A5Z B;  1I8F A;  2IIM A;  5DY9 A;  3CCU Q;  1TU0 B;  2E3H A;  2DET A;  1PKS A;  5DM7 R;  3G71 T;  2ZZD A;  2A08 A;  4QVD A;  5CKF A;  3VRZ A;  4C92 G;  2I2L A;  4J7F A;  4B9W A;  4KBM B;  5GAN 8;  4NOY A;  2YDL A;  1PHT A;  2LQ8 A;  1YIJ A;  1W6X A;  2R5A A;  1A0N B;  2ZPG B;  3OSV A;  3RR6 A;  5KYX B;  1VQ4 A;  3LH0 A;  2BTT A;  2XD0 A;  5FU6 C;  2H3J A;  3H0H A;  2FHD A;  3TSZ A;  2D8H A;  4LDX A;  3OSS C;  1G83 A;  2DRK A;  2KGT A;  8AT1 B;  2QA4 A;  5GMK j;  3CC7 T;  4KGX B;  4RMO A;  1I0C A;  2DVJ A;  3CCR Q;  1JEG A;  4LDY A;  5I2S A;  3HRU A;  3WVD B;  4M7A D;  1K1Z A;  1BCM A;  3G4S Q;  2RHI A;  1JBM A;  4N0A A;  4CI0 C;  2DAQ A;  3QXE B;  2AT1 B;  2YHT A;  2RH2 A;  1VQ5 T;  3CD6 A;  2M0O A;  5LJ5 f;  3H8Z A;  3Q1J A;  1Y57 A;  3ME9 A;  4C5G A;  4C5E A;  3EAE A;  5CQY A;  4D8D A;  3M5A A;  4AFU C;  2H8H A;  2XK0 A;  2EYZ A;  1X6O A;  1KHC A;  3QYG B;  3PIO A;  1BKB A;  4PJO C;  1LOJ A;  2RQT A;  1SPK A;  4M7D C;  2KAF A;  3QDR B;  4DBQ A;  1Y96 B;  4A53 A;  1D09 B;  1TUG B;  4CC4 B;  3C12 A;  1VQP A;  2LMJ A;  5IHN A;  3H0F A;  4M78 F;  4EMK A;  1WYX A;  3NGP A;  4IUP A;  2JZ2 A;  2J06 A;  4E7H A;  2DEQ A;  2X35 A;  2XHC A;  1NLO C;  3VV0 A;  5EG2 A;  3RES A;  2AK5 A;  4IKF A;  1M2V B;  2HBW A;  4KGV B;  2NLU A;  2E12 A;  3VS7 A;  2EKH A;  4LUE A;  1MV0 B;  1GFD A;  1VQN A;  2GFU A;  4ZN3 A;  3I55 T;  5IT9 E;  1Q7Y R;  4KH0 B;  4J9H A;  1QW1 A;  2CP3 A;  2FO0 A;  1PKT A;  1BI0 A;  1N6A A;  3RKW A;  2AZS A;  2JVV A;  2WSE E;  2LCL A;  1Q7Y C;  2EW3 A;  2B86 A;  1U3O A;  1OU8 A;  3PGG A;  3CXC S;  2DM1 A;  1QCF A;  2EBP A;  1QVG P;  1VYV A;  4BE2 A;  1YFN A;  2BZ8 A;  1AEY A;  4II1 A;  4M78 A;  3E19 A;  3M0T A;  1KD1 U;  4JZ3 A;  1QMC A;  2DRM A;  3MP1 A;  4BE0 A;  4QKU A;  4Y28 E;  1VQM T;  4A4K A;  3ZL7 C;  3M53 A;  1NPP A;  1WPY A;  4OGE A;  2RJD A;  3CC2 Q;  1S72 T;  1IHW A;  1Y0M A;  2HQX A;  5GAN 6;  4PKC C;  1ZUU A;  2LVM A;  2X3X D;  1M30 A;  1RAD B;  1I5O B;  2V1R A;  2L3S A;  1D0Z A;  1NJI R;  3WXM B;  2PZ1 A;  1EIF A;  3JCM Q;  4BB7 A;  2VV5 A;  4XTW A;  4RTX A;  1QVG A;  1NJI C;  1VQ7 Q;  1VQ9 Q;  2PUK B;  4C8Q F;  2ZPF B;  1M1F A;  4FM4 B;  4HCK A;  5D6X A;  1M8V A;  1SHG A;  2X4W A;  1SRM A;  1X75 C;  2NUP A;  4J8O A;  3JB9 I;  2W10 A;  3QHS A;  3SB2 A;  5GAO p;  1Z9Q A;  2HEQ A;  4LDV A;  1VQ6 Q;  3CC4 Q;  5GAM j;  4OB1 B;  2GTJ A;  3OYA A;  2GFA A;  2DLP A;  2V8J A;  2E70 A;  2QQR A;  5GAN f;  1X2K A;  2CT4 A;  3J81 E;  3JB9 D;  1VQ5 A;  3U23 A;  4O6J A;  4NL3 A;  4LNP A;  3SD4 A;  4FYX B;  4ZGE B;  1WDX A;  4C0F A;  3C4S A;  4C8Q A;  3LW5 E;  1WFW A;  4RG2 A;  2K6D A;  2K79 A;  3S3M A;  3NTI A;  3SWN B;  2DPP B;  4EMK B;  2EKO A;  2KDS A;  2OTL T;  2B8A A;  4J7I A;  2XDB A;  4NL2 A;  1OUL A;  4AFQ C;  3MET A;  3QDF A;  3V8K A;  5I11 A;  1MMA A;  2D0N A;  1AOJ A;  2L3R A;  4IUR A;  4ATO A;  2DNU A;  1YHQ A;  2VC8 A;  1U06 A;  3URG A;  3DLL A;  4BDY A;  4DEX A;  2QQ9 A;  5LJ3 f;  3X20 B;  2EQK A;  4AT1 B;  5LJ5 d;  2O88 A;  1M9S A;  3I55 A;  1BB9 A;  2DBM A;  1FMK A;  2HCK A;  4B6M A;  3CMA Q;  3UT1 A;  4D6W A;  3J7A F;  3OBY A;  3VJP A;  2E64 A;  2ZGW A;  4JRK A;  4M78 B;  2L5Q A;  2DE0 X;  5LJ5 h;  2MK5 A;  2CP6 A;  2FPE A;  1OQK A;  1IO6 A;  2RF0 A;  3CCQ Q;  4C92 D;  2CUD A;  1VQL T;  3H41 A;  4F7U B;  4MZP A;  2D6F A;  5HK3 A;  4QW2 A;  5C6S A;  3S3O A;  3L2Z A;  1YJ9 A;  1MMN A;  2OAW A;  1TS9 A;  2JNG A;  2KRM A;  4F17 A;  2QXF A;  3UDC A;  3X24 B;  4MDW A;  4XK8 E;  4M7A E;  1IZ6 A;  3A8L B;  1WI7 A;  4ZN1 A;  4J83 A;  4C0Z A;  3E2U A;  4BE1 A;  2P4R A;  4C5H A;  4C0D B;  3EH2 A;  2PVG B;  1I07 A;  3RNJ A;  3CCS A;  2DJQ A;  3CCJ T;  4PNO A;  3EG9 A;  4A4E A;  2NUP B;  1OI1 A;  2F5K A;  3UPU A;  1M4Z A;  1GCP A;  2K5F A;  2DL8 A;  3G71 Q;  3INZ A;  1KQS S;  1G2B A;  4JPB W;  3VKI A;  3VS4 A;  2V8I A;  2NWM A;  3JCM J;  1Y71 A;  1M3A A;  2QEX Q;  2L3Q A;  1TH7 A;  3GIB A;  4M77 C;  3VYG A;  1T0H A;  2FEI A;  4FW2 A;  4DBR A;  5FU7 C;  3OW2 S;  1IB8 A;  1WHG A;  3QO3 A;  2G3R A;  3OYC A;  1ABQ A;  3HSB A;  2PVD B;  2DF6 A;  1BI1 A;  2ED1 A;  3MEU A;  4DQ2 A;  1TWB A;  2ESW A;  2F2W A;  1BI3 A;  5I22 A;  4PFP A;  4M78 G;  4F7U E;  1VQ8 T;  3P8H A;  3ZEH A;  4XTZ A;  3S6W A;  2RK1 A;  3AHU A;  4BY6 C;  4E7J A;  1KD1 R;  2OTL A;  4E7Z A;  2O4X A;  2YSQ A;  2BZY A;  4OP0 A;  4HT8 A;  2ZPB B;  3M0P A;  2K7A A;  1QKW A;  1GCQ A;  4L6V 5;  3FC3 A;  5GMK i;  1KD1 C;  1AD5 A;  5LJ3 e;  3FDR A;  1M5Q 1;  1W2B S;  4FT4 A;  5GAN d;  1WHH A;  2RQU A;  3HFO A;  1HXD A;  3VRY A;  3CCE Q;  2V8K A;  1IHV A;  3A98 A;  3M4G A;  4FIB A;  2K5I A;  1NLP C;  2L0A A;  2M16 A;  3G1J A;  4MMK A;  3DB4 A;  4L5G A;  1YIT A;  1UGQ B;  4J5Y A;  5GAN h;  2Y4Y A;  1X69 A;  2HKQ B;  2E5K A;  5GAO q;  3IQL A;  1R77 A;  1ZBX A;  2GF7 A;  2QA4 T;  2RQR A;  2HSE B;  1F1B B;  2ZCF B;  2HDA A;  5FW9 A;  2FZK B;  4IUV A;  3E1S A;  4FYW B;  4BI3 A;  2RHY A;  5LJ5 g;  4FT2 A;  2DYB A;  2EAY A;  4J6W A;  1O9S A;  4C92 B;  5LJ3 d;  5J39 A;  1PSF A;  4C8Q G;  3REB B;  4M75 E;  4ZTJ A;  1VUB A;  2LX9 A;  1S1N A;  1SG5 A;  3QSU A;  1JO8 A;  5CO7 A;  4M7A C;  1QLY A;  1Q82 R;  2EJG A;  2QAS A;  1SF9 A;  2K3B A;  3M55 A;  4J9F A;  2ECZ A;  3LWH A;  5LJ3 h;  1K9A A;  2AIR B;  2COY A;  1WA7 A;  2YUO A;  4M77 F;  1Q82 C;  1N9R A;  3VS0 A;  3M59 A;  2MMP A;  4PFZ A;  1VQM Q;  1WQ7 A;  1KSW A;  2A0F B;  1LCK A;  2QGG A;  4A4G A;  1ZSG A;  2XDD A;  1VQP T;  1WXT A;  1S72 Q;  3BDU A;  1N5Z A;  2XU8 A;  2P0Q A;  9ATC B;  3L2V A;  5HCK A;  3OS1 A;  2KT8 A;  4M7D G;  4FL6 A;  3M57 A;  2DBK A;  5CCA A;  2RQW A;  2RHZ A;  3M58 A;  3ULR B;  2EJ9 A;  1Q95 G;  3V8L A;  3JCM P;  3L2R A;  2W0Z A;  1I81 A;  1ZX6 A;  4DA4 A;  5GAN 2;  2Y90 A;  1D0X A;  3QZ9 B;  1Y07 A;  2RHX A;  1YJN T;  5EC7 A;  1M1K R;  2EQJ A;  4M77 A;  4ANJ A;  1VIE A;  2C0T A;  1BIB A;  2O4X B;  1G8X A;  3VUB A;  3SFM A;  1M1K C;  1MV3 A;  1UDL A;  2AHJ B;  5IXF A;  1SHF A;  1TSF A;  3GNG A;  3I5R A;  4JZ4 A;  4C92 E;  3VS6 A;  5IAY A;  1QVF S;  1C0M A;  2DO3 A;  1TOV A;  5FLX E;  3JCM W;  1B34 B;  3EFO B;  2K2M A;  3M0S A;  2QTX A;  2BE7 D;  2OI3 A;  2PTK A;  2K57 A;  2HQE A;  2JW4 A;  3EHQ A;  1WJQ A;  1WJR A;  1J3T A;  3CPW A;  5GAN 4;  1FMV A;  1H8K A;  1W4S A;  2K3Y A;  1HK9 A;  4QVZ A;  3A8M B;  2M0Y A;  3TSW A;  3OMC A;  2E6N A;  2HSP A;  5KYU B;  3R6N A;  2DKG A;  5IN1 A;  5I21 A;  3CBM A;  1ZUK A;  2YLC A;  2F69 A;  2X4J A;  5D6Y A;  2RMO A;  1B7T A;  4HCZ A;  1T3S A;  2CKK A;  1U1T A;  2E4H A;  2XG8 D;  1EZZ B;  1BK2 A;  3CBP A;  3JV3 A;  3JB9 J;  1YI2 A;  2F1L A;  1OOT A;  3VS2 A;  3I56 A;  1YJW Q;  1AZE A;  3UA7 A;  2CRE A;  4F16 A;  4E7I A;  2X4X A;  1G3W A;  2IPO B;  4RCC A;  1SSF A;  2DJZ A;  3KFV A;  2F2X A;  3JCM f;  4M75 C;  2ENM A;  1WHK A;  2RK2 A;  2DTO A;  1AZG B;  3OYH A;  2HL3 A;  2QYZ A;  3QG1 A;  4KRT A;  5GJW B;  3OYI A;  3CCL Q;  4FCY A;  1OU9 A;  3QJY A;  3G6E A;  1WXU A;  2JS2 A;  2HD0 A;  2JTF A;  3OYJ A;  2EGA A;  2IG0 A;  2JMC A;  1W70 A;  3O8V A;  1CKB A;  2O9V A;  1PD1 A;  1KFZ A;  4TVR A;  2VGM A; 
#chains in the Genus database with same CATH homology
 2EGC A;  1E6G A;  3QWX X;  4IIO A;  1NG2 A;  2F2V A;  1NM7 A;  4AG2 C;  2CSQ A;  2LX7 A;  2A28 A;  1SRL A;  4D8K A;  4J9I A;  4AFQ C;  2MCN A;  1NYG A;  3SEM A;  5I11 A;  5IH2 A;  2D0N A;  1AOJ A;  2LQN A;  1UE9 A;  2DNU A;  3GBQ A;  1OEB A;  4OMP A;  1U06 A;  2CUB A;  1K76 A;  2J6F A;  4DEX A;  5L23 A;  4R0K A;  1JU5 C;  4OMQ A;  1TUC A;  2EYW A;  4RTY A;  2O88 A;  3EHR A;  2DX1 A;  4CC7 A;  1UUE A;  1BB9 A;  2DBM A;  1X6G A;  1FMK A;  2HCK A;  1UHF A;  1QWF A;  5FWB A;  4IIM A;  1HD3 A;  2ROL A;  2M51 A;  4HXJ A;  2RNA A;  2EVR A;  1RLP C;  2RQV A;  2O31 A;  2LJ1 A;  4J9D A;  2DE0 X;  5GJV B;  1NEB A;  2FPE A;  4E6R A;  1U5S A;  1IO6 A;  2RF0 A;  2XMF A;  2CUD A;  3H41 A;  1AVZ C;  2DA9 A;  2G6F X;  2KNB B;  1B07 A;  2LQW A;  4Z88 A;  1SEM A;  1CSK A;  4GLM A;  1X6B A;  3EGU A;  2OAW A;  4ESR A;  2J6O A;  1GL5 A;  2KRM A;  4F17 A;  2KXD A;  1YP5 A;  4ZNX A;  3O5Z A;  2GGR A;  1GBR A;  1HSQ A;  2D1X A;  1WI7 A;  1QWE A;  2YT6 A;  2JTE A;  2LP5 A;  1RUW A;  2ED0 A;  3M0Q A;  4OMO A;  1UFF A;  4OMN A;  2DMO A;  2MIO A;  2P4R A;  1UG1 A;  2JM8 A;  2KR3 A;  1I07 A;  3RNJ A;  1QKX A;  2DJQ A;  3EG1 A;  2YUQ A;  1BU1 A;  1X43 A;  2EYY A;  4LN2 A;  2FRY A;  1GCP A;  2DL8 A;  2FPF A;  1WX6 A;  3M0U A;  1G2B A;  2JM9 A;  2RN8 A;  4JPB W;  1I1J A;  3VS4 A;  3PVL A;  2DL7 A;  2NWM A;  1BBZ A;  5FWC A;  2KXC A;  1M3A A;  4WCI A;  4Z89 A;  2L3Q A;  1UEC A;  1T0H A;  3EG0 A;  2FEI A;  2KRN A;  1RI9 A;  1JQQ A;  2KRS A;  3UA6 A;  2LCS A;  2YUP A;  1M8M A;  4A63 B;  2KRO A;  2FRW A;  1AWO A;  1SSH A;  3NMZ C;  1ABQ A;  2BZX A;  2KYM A;  2DF6 A;  1VYU A;  3NPF A;  2ED1 A;  1ZBJ A;  2A37 A;  2O2O A;  1E7O A;  2ESW A;  2F2W A;  2KEA A;  2GBQ A;  4RTU A;  5I22 A;  3FJ5 A;  1GBQ A;  2KBT A;  4HVW A;  1UTI A;  2CDT A;  4RTZ A;  1AWW A;  2VKN A;  4K11 A;  1M3C A;  1UJ0 A;  1K0X A;  2LJ0 A;  1HJD A;  2YSQ A;  2BZY A;  2X3W D;  4RTT A;  3M0P A;  2K7A A;  2EYX A;  2EGE A;  1QKW A;  1GCQ A;  1ZLM A;  3THK A;  4Z8A A;  1AD5 A;  2CSI A;  1XOV A;  2SRC A;  1AWX A;  3VS5 A;  2IIM A;  3LH5 A;  2MOX A;  2VWF A;  3TVT A;  2RQU A;  3PVQ A;  1PKS A;  1WIE A;  1YWP A;  3VRY A;  3A98 A;  2A08 A;  1YCS B;  3VRZ A;  4LUD A;  1JXM A;  1MUZ A;  4RUG A;  1UGV A;  1ARK A;  1NLP C;  2L0A A;  4M4Z A;  2YDL A;  2LZ6 B;  3VS3 A;  1PHT A;  1H92 A;  1W6X A;  3H0I A;  1X69 A;  1A0N B;  2E5K A;  4DEY A;  3IQL A;  2PNI A;  3I5S A;  1JXO A;  1OV3 A;  2RQR A;  2AKK A;  2D8J A;  2BTT A;  4GBQ A;  3RBB B;  2HDA A;  5FW9 A;  3H0H A;  4JJD A;  3TSZ A;  1ABO A;  2D8H A;  1G83 A;  2DRK A;  4J9B A;  2KGT A;  1KIK A;  2DYB A;  2EPD A;  1I0C A;  2DVJ A;  2CH4 W;  2CH4 A;  1WLP B;  3M0R A;  1E6H A;  1JEG A;  3REB B;  3SHW A;  1S1N A;  2K9G A;  1K1Z A;  2C0O A;  2J05 A;  1JO8 A;  4J9C A;  1QLY A;  2V1Q A;  1TUD A;  1UHC A;  4HVU A;  2C0I A;  2K3B A;  1NYF A;  1RLQ C;  2A36 A;  4J9F A;  2ECZ A;  2I0N A;  2DL4 A;  1K9A A;  1WA7 A;  2YUO A;  1Y57 A;  2FG0 A;  1NEG A;  3VS0 A;  4D8D A;  1KSW A;  4OML A;  1LCK A;  2EQI A;  4AFU C;  2H8H A;  1ZSG A;  4AFS C;  1WXT A;  2LJ3 A;  2EYZ A;  1N5Z A;  1VYT A;  2JS0 A;  2AZV A;  2FPD A;  5HCK A;  4ORZ A;  4JJC A;  1GCQ C;  2KT8 A;  2RQT A;  1SPK A;  2DBK A;  1H3H A;  4CC4 B;  2LMJ A;  2RQW A;  5IHN A;  1YWO A;  2QDL A;  3H0F A;  1WYX A;  3NGP A;  3ULR B;  2J06 A;  3REA B;  2O9S A;  2W0Z A;  1ZX6 A;  1NLO C;  1B3Q A;  2AK5 A;  4RTW A;  2HBW A;  2J6K A;  5EC7 A;  1AWJ A;  2GQI A;  1YNZ A;  2LNH B;  1PWT A;  3C0C A;  3VS7 A;  1V1C A;  2EKH A;  4LUE A;  2C0T A;  1MV0 B;  4LE9 A;  1GFD A;  3PE0 A;  1W1F A;  1X27 A;  1Z9Z A;  2J7I A;  1TG0 A;  4J9H A;  1MV3 A;  2DL5 A;  1UDL A;  2FO0 A;  2JT4 A;  2YUN A;  5IXF A;  1SHF A;  3EG3 A;  1PKT A;  4CC2 A;  1M3B A;  3I5R A;  2AZS A;  1T0J A;  4AFZ C;  4JZ4 A;  2EW3 A;  1K4U S;  2B86 A;  1U3O A;  3VS6 A;  2JXB A;  2KT1 A;  2CT3 A;  2DM1 A;  1QCF A;  2EBP A;  2JMA A;  1VYV A;  5IHK A;  2BZ8 A;  4QT7 A;  1AEY A;  2K2M A;  2DL3 A;  3QWY A;  3M0S A;  3M0T A;  5IXB A;  4JZ3 A;  5ECA A;  4AG1 C;  1KJW A;  2DRM A;  2NUZ A;  2ABL A;  2ROT A;  2OI3 A;  2PTK A;  4CC3 A;  3ZL7 C;  2JW4 A;  3EHQ A;  2KYB A;  1J3T A;  2AKL A;  1Y0M A;  4OMM A;  5IHI A;  1ZUU A;  1H8K A;  2SEM A;  2X3X D;  1K0S A;  1FYN A;  1M30 A;  2M0Y A;  3TSW A;  2V1R A;  2L3S A;  2HSP A;  3R6N A;  3I9Q A;  2GNC A;  4EIK A;  1ZUK A;  1M27 C;  2PZ1 A;  2KE9 A;  2RMO A;  1GRI A;  4RTX A;  1T3S A;  3NHN A;  4Y92 A;  3CQT A;  2L3P A;  4J9E A;  4HCK A;  2OJ2 A;  1BK2 A;  4J9G A;  3JV3 A;  2VVK A;  1PNJ A;  1SHG A;  1SRM A;  1VA7 A;  1OOT A;  1EFN A;  3VS2 A;  1T3L A;  2L2P A;  4X1V A;  1AZE A;  3UA7 A;  2RPN A;  1X2Q A;  2CRE A;  2W10 A;  1YN8 A;  3EG2 A;  4F16 A;  1Z9Q A;  2HEQ A;  4RTV A;  4F14 A;  2GTJ A;  1ZUY A;  3KFV A;  1OPK A;  2F2X A;  4FSS A;  2DLP A;  2ENM A;  1X2K A;  1WXB A;  3I35 A;  2CT4 A;  1AZG B;  1CKA A;  3VS1 A;  3U23 A;  4JJB A;  4KRT A;  5GJW B;  4LNP A;  3UF4 A;  1WXU A;  2JS2 A;  2DIL A;  1WDX A;  2GTO A;  2EGA A;  1PRL C;  1GFC A;  3UAT A;  1WFW A;  1UJY A;  2JMC A;  1W70 A;  1CKB A;  2K6D A;  2O9V A;  1KFZ A;  1PRM C;  2K79 A;  1OPL A;  4HVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...