3RBBB

Hiv-1 nef protein in complex with engineered hck sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
publication title Conformation of the Dileucine-Based Sorting Motif in HIV-1 Nef Revealed by Intermolecular Domain Assembly.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Viral protein, protein binding
total genus 12
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rbbB00
2EVRA 3EHQA 4GLMA 1PRMC 1M30A 4HVUA 3VS0A 1AEYA 2GGRA 2DNUA 2YUNA 5FWBA 1M27C 2FEIA 4AFUC 2GBQA 3I5SA 2JMAA 1UJ0A 1MV0B 2GQIA 3M0QA 3ZL7C 1YWOA 2DBKA 2D8HA 2F2WA 2L3SA 2NWMA 4IIMA 1Z9ZA 1T3SA 3H0FA 1NEBA 3UATA 1X6GA 2EGEA 4Z8AA 1B3QA 2VVKA 2DL8A 3EGUA 1ZBJA 2LZ6B 1PNJA 1YN8A 2CREA 2W0ZA 1ZX6A 2DF6A 1RLQC 1KIKA 2ED1A 2YUQA 2JM9A 2EBPA 2RQTA 2SEMA 2EGAA 1JQQA 1WXUA 2DL5A 2K79A 2K3BA 3TVTA 2ECZA 4JJDA 1M3BA 1NEGA 2D8JA 1JXOA 1T3LA 3NMZC 1AOJA 2A36A 1VYUA 1GCQA 4F17A 3VS2A 1HSQA 3NPFA 2FPEA 1CSKA 2FG0A 1MUZA 4J9BA 1QWEA 2AKKA 3ULRB 1WDXA 1WFWA 1QKWA 2DLPA 3VS4A 1AVZC 2A08A 2EYZA 3QWXX 2FRWA 1GRIA 1WYXA 3RBBB 2KNBB 1QCFA 1I0CA 1X69A 2J7IA 3A98A 1WA7A 3H0IA 5IH2A 4J9GA 2L3PA 2JXBA 1U3OA 3NGPA 1PKTA 1OOTA 1SRMA 1GCPA 2KT1A 2DM1A 3CQTA 1RI9A 4RTXA 1E7OA 4CC4B 1OEBA 2LJ1A 1ZLMA 2RQWA 2DX1A 4LN2A 5FWCA 1KSWA 4AG2C 1UG1A 2J6OA 4LNPA 3I5RA 4F14A 5GJVB 3FJ5A 2EKHA 2LJ3A 2FPFA 1YCSB 2OI3A 4K11A 4OMNA 2W10A 4RUGA 3LH5A 1NYFA 2RQRA 2KRMA 1AWWA 2RQVA 1K9AA 1SHFA 1QLYA 4DEXA 4Z89A 1VYTA 2DBMA 2HEQA 1X2KA 2KE9A 4RTYA 1UECA 2ED0A 3TSZA 3M0PA 4WCIA 1KFZA 4A63B 2LCSA 5IHNA 2VWFA 2GNCA 1JXMA 1G83A 4RTTA 1ZSGA 3R6NA 2DJQA 1CKAA 2RQUA 3EG0A 1PHTA 2CUDA 2BZ8A 1E6HA 3EHRA 1A0NB 1N5ZA 3M0RA 4OMPA 1ARKA 3SHWA 4EIKA 1I07A 2EYWA 4ORZA 1GBRA 1GBQA 4OMMA 1OPLA 2AKLA 4QT7A 2O2OA 2MOXA 2KRSA 4D8KA 1XOVA 2YUOA 4CC3A 2F2VA 1G2BA 1B07A 1WXTA 2CDTA 2JW4A 2LQNA 3VRZA 5I22A 1GFCA 2DL4A 4OMOA 1ABQA 2CT3A 3SEMA 3KFVA 4AG1C 3PVQA 1W1FA 1U06A 5IXFA 1UJYA 4J9EA 3EG1A 4AFZC 1H92A 2RNAA 4X1VA 2O88A 1RLPC 2LP5A 2DMOA 1MV3A 3O5ZA 5IHIA 1V1CA 2FO0A 1ZUKA 1X43A 1CKBA 2DRMA 2O9VA 2CT4A 2RF0A 4RTWA 2KYBA 1Y57A 1UHFA 4Z88A 1UDLA 2C0TA 4R0KA 3C0CA 2PNIA 1BK2A 2A28A 1GL5A 2YUPA 1K4US 4J9CA 2OJ2A 2LX7A 2KEAA 1E6GA 2KXCA 2EYXA 4GBQA 4AFSC 1RUWA 2MIOA 1NLOC 3M0UA 1X27A 2DVJA 5ECAA 2KR3A 2KYMA 3M0SA 2CSQA 1ABOA 3VS6A 1U5SA 2OAWA 2DRKA 2K9GA 2GTJA 1AZEA 2EQIA 2EGCA 1YWPA 2JMCA 3PE0A 5I11A 1AZGB 4JPBW 1UUEA 4JJBA 2M0YA 2RPNA 1FMKA 1TG0A 1X2QA 3UA6A 1NG2A 4M4ZA 3RNJA 4J9DA 4F16A 1ZUYA 2J6KA 1AWJA 2B86A 5L23A 4Y92A 2KGTA 4CC7A 2J06A 1Z9QA 5FW9A 2V1RA 4RTUA 1FYNA 1JU5C 2A37A 4JJCA 2ROTA 3QWYA 2DL3A 4HVWA 1SRLA 1AWXA 1GCQC 2C0OA 1K1ZA 2JM8A 4OMQA 3EG3A 2EYYA 4FSSA 3GBQA 2H8HA 3VS3A 2SRCA 1K76A 4CC2A 2VKNA 2X3XD 2LQWA 1X6BA 1NYGA 1H3HA 3I35A 1NLPC 2J05A 2LNHB 2G6FX 1SSHA 1S1NA 2HBWA 2O31A 1UHCA 1VA7A 1SHGA 3REAB 2DL7A 2HDAA 2D1XA 3REBB 1HD3A 4KRTA 5GJWB 4J9FA 4RTZA 1OV3A 2XMFA 3TSWA 2J6FA 4DEYA 2I0NA 1TUDA 3PVLA 1YP5A 3VS5A 4J9HA 5IXBA 2RMOA 2ESWA 1GFDA 5HCKA 1WLPB 1M3CA 1HJDA 1VYVA 1BBZA 1AWOA 2GTOA 2JT4A 1SEMA 2ENMA 1BU1A 2JS0A 3EG2A 4IIOA 3UF4A 2CSIA 1LCKA 4HVVA 1QKXA 1T0JA 2DYBA 2YSQA 2PTKA 1UFFA 2O9SA 2BTTA 4ESRA 2RN8A 1ZUUA 1UE9A 2YDLA 4JZ3A 3H0HA 3VS7A 3THKA 4ZNXA 2CUBA 2P4RA 1W70A 4LUDA 4AFQC 2L3QA 2X3WD 1EFNA 2FPDA 1JO8A 1WI7A 4HCKA 2EPDA 2K6DA 1K0SA 1M8MA 1AD5A 2KT8A 2KRNA 1WIEA 2FRYA 2L2PA 2CH4W 2LMJA 2DE0X 2HSPA 2KXDA 1H8KA 1NM7A 4J9IA 1Y0MA 2L0AA 4RTVA 3VRYA 2YT6A 3M0TA 4D8DA 1T0HA 2MCNA 2AZSA 3H41A 4E6RA 2C0IA 2NUZA 1K0XA 5EC7A 2D0NA 1PRLC 2JS2A 1M3AA 1W6XA 2E5KA 1QWFA 2K2MA 3I9QA 3IQLA 3VS1A 1WX6A 2KBTA 2CH4A 3NHNA 2EW3A 1PWTA 2AZVA 1JEGA 2BZXA 3UA7A 2ABLA 4HXJA 1J3TA 1BB9A 2PZ1A 2ROLA 4LUEA 1UGVA 2DILA 4LE9A 1OPKA 2AK5A 3JV3A 2JTEA 2KROA 2DA9A 2QDLA 1WXBA 2F2XA 2K7AA 2LJ0A 1SPKA 1KJWA 2BZYA 2V1QA 2HCKA 2M51A 4JZ4A 5IHKA 4OMLA 1IO6A 1PKSA 1UTIA 1TUCA 2IIMA 1YNZA 3U23A 1I1JA
chains in the Genus database with same CATH superfamily
3GF5A 2EVRA 3EGDA 4GLMA 4N4GA 3HPWA 3QDFA 3BDLA 2EJ9A 1N8RR 3J81E 1VQ4Q 2YUNA 5FWBA 4FYVB 3A1PA 1YJ9A 2FEIA 4OB2B 4XAXB 4AFUC 1JRIA 2GBQA 1UJ0A 1WQWA 1K9MR 2F2WA 2D8HA 4XU0A 5GAMj 2OTLT 1IXDA 1T3SA 1VQPT 3E9FA 2DFUA 1XNIA 3H0FA 4QVCA 2HD0A 3M54A 1W2BS 4ZN1A 2X4XA 5IN1A 3ZFJA 4Z8AA 1KQ1A 2HAXA 4F7UF 3M56A 3CCQQ 5GAN6 3G7ZA 2QGFB 2EJGA 1VQ4T 2P0PA 4Y28E 2LZ6B 4RG8A 1RLQC 5CKFA 4IUTA 2ED1A 1JBMA 4B6MA 1D0YA 2R5AA 2DL5A 2LDMA 2K79A 3CD6Q 1KK7A 2QQAA 2D8JA 4A53A 1AOJA 1QCNA 3OYEA 2VXFA 1YHQQ 4F17A 4MDXA 2O01E 1HSQA 4PJOB 2X51A 2A7YA 1YIJQ 2AT1B 1WFWA 3VS4A 2DLPA 4C5EA 3L2RA 2OAUA 3V8KA 1NJIU 2FRWA 4DOWA 3QZ5B 2MWPA 3CD6T 2CZ7B 2XHCA 3GPLA 1I0CA 3A98A 3H0IA 4HCZA 1K73R 5IH2A 3QUIA 4J9GA 1Q81R 2JXBA 2CKKA 1VQ5Q 3CCUQ 2V8JA 1C0MA 2RK2A 4MZMA 3GNGA 4C92A 1GCPA 4RTXA 4CC4B 1YITQ 1OI1A 1ZLMA 3I55Q 3VJPA 3Q1JA 1M1KU 2HKQB 3OS2A 2NUPA 4LNPA 4M7DD 4F14A 4DBHA 4QKUA 2FPFA 1Y96A 4K11A 4OMNA 4J6XA 1HXDA 3QXEB 1IZ6A 4M77A 2E3IA 1VYTA 2LNVA 5LJ5j 1VQ5T 3CCUT 3JB9H 3QO3A 3LWIA 1X2KA 2COZA 2V8IA 3VUBA 4WCIA 1YITT 3QKJA 2LCSA 1I5OB 3OYIA 3I55T 2VWFA 4C92B 1RL2A 2XDDA 1VQKQ 4RTTA 4C0ZA 2QA4Q 2DJQA 2A3LA 2C06A 5DY9A 3JCMX 4B9XA 1A0NB 2NUPB 1ARKA 3MP6A 1BYMA 4ZGDB 4OB1B 3G71T 1LJOA 2RJCA 3L2UA 1Y96B 4M7DG 4ORZA 4M77B 4NOYA 5LJ3j 3X26B 4OMMA 4EDUA 2YWWA 2M0OA 2KRSA 4D8KA 2F2VA 1WXTA 3DLMA 2CDTA 2XU8A 5I22A 2EQKA 1Q82R 5AT1B 4BI8B 2MI6A 1M2OA 4AG1C 2FHDA 2BIVA 1W1FA 3G6EQ 2EIFA 5IXFA 1UJYA 3R6OA 3EG1A 4AFZC 4JJNK 3CMAA 4M7AA 1RLPC 1O75A 2LX9A 1WHKA 2LP5A 1BI1A 2OTJQ 4FT4A 4FIBA 2LCLA 3MKDA 2FO0A 1ZUKA 4KT0E 2O9VA 4V2SA 1VQ9A 3CCMQ 1VQ7A 1M1FA 1TWBA 2XD0A 3JAME 3G6ET 2YRVA 1WJRA 4J9CA 2OJ2A 4JRPA 2LX7A 2COYA 1KHCA 2KXCA 4GBQA 4X34A 1NLOC 1UB4A 2JNGA 2OTJT 1AHJB 2RHIA 3AT1B 1QVGA 2VASA 4M7AB 3FC3A 5CR2A 2KR3A 2E64A 2KYMA 2CSQA 1YJWQ 3CCMT 1PM3A 2GTJA 1AZEA 2EQIA 2EGCA 2F69A 3PE0A 5I11A 3X28B 3EFSA 5IAYA 1WHLA 2RPNA 1EX4A 1Y07A 2R58A 1K8AU 2MF2A 1ZQ1A 1ZUYA 2J6KA 1AWJA 2B86A 4Y92A 3GNFB 4JRQA 4C5IA 4TVRA 2J06A 1Z9QA 2QAZA 1FYNA 1GXIE 2ROTA 4HVWA 1SRLA 1YJWT 1QVGS 1K1ZA 3EG3A 2EYYA 1OX9A 1XQHA 2DZCA 4PKCC 2E6NA 4A4HA 2VXEA 4CC2A 1KD1C 1BKBA 2EYQA 3V7CA 3VYHB 5EG2A 3I35A 3SFMA 2RB6A 5DM7R 1S1NA 1UHCA 1VA7A 2DTOA 1SHGA 3REAB 3MEUA 3REBB 1HD3A 1G3YA 1Q86U 2FVUA 1OV3A 3N5BB 3VYGA 3FDRA 3JCMh 3CXCP 1EIFA 2I0NA 3PVLA 3VS5A 5IXBA 3CCRQ 3G4SQ 1BBZA 2QYZA 1AWOA 4XTVA 2CSIA 3M53A 4Q5WA 1QKXA 1T0JA 2RHUA 4FT2A 3CCLA 2RN8A 4N0AA 4F7UE 5GANe 1M2VA 2OX7A 3VS7A 3CCSA 2LRQA 1KQSP 2Y90A 1Q7YC 2YRDA 1WI7A 2EPDA 1NPPA 4M77C 2FRYA 1M90R 3JCMg 1VQMQ 3CCRT 3OMGA 3UPUA 2DPPB 3G4ST 1NM7A 5GAN4 1Y0MA 2CS7A 5KYNA 3CCVQ 2L0AA 4RTVA 1OU8A 4OB3B 3M59A 2YT6A 3EG9A 3M0TA 3OW2P 1T0HA 2MCNA 1D1CA 5CCAA 1TUGB 4B9WA 1PRLC 4FM4B 1I4K1 4PJNA 1QWFA 2K2MA 4J8OA 1M2VB 3M55A 2KBTA 4FYWB 2QI2A 2LC4A 1PWTA 1JEGA 5FU6C 2ABLA 3BY7A 1VQMT 5FU7C 3CPWP 1RADB 4M75F 3S3OA 3CCVT 3JB9J 1OPKA 5LL6S 4KGVB 2HL3A 4EMKA 4ANJA 4BDYA 2LTOA 1U8RA 2E1HA 1ZSZA 2E4HA 2BZYA 3EG9B 4JZ4A 2QG9B 1IO6A 2IIMA 2RI2A 1YNZA 1PD0A 3CMEA 4C0DB 4M78F 3EHQA 4OVAA 3X20B 4HT8A 4M7AC 1M30A 3CC2A 1AEYA 4L5GA 4LDWA 2GGRA 2DNUA 2VYTA 1M27C 3BFMA 2KI7A 2X4JA 4GLKA 2FZGB 3I5SA 2EQMA 2COWA 2GQIA 3M0QA 1YWOA 2HQEA 2L3SA 3TQ7P 2NWMA 2QQRA 1I81A 1Z9ZA 4EMKB 4FW2A 1X6GA 2EGEA 2P0QA 1IHWA 1KC8C 3MCAB 3MO8A 4KGXB 4BB7A 4ME7A 5A0DA 2DD5A 4II1A 3A8GB 4DBQA 1NZ9A 2RA2A 2HKNA 1YN8A 2W0ZA 1KIKA 2LQKA 2JM9A 2YHTA 1NJIR 1YJNQ 1VQOA 4LDYA 5GAMg 3L2WA 1D0XA 1NEGA 3NTKA 1T3LA 1ZA1B 1SSFA 4QVZA 5KYYA 3KXTA 3OBWA 1VYUA 3OA6A 3AHUA 2RJEA 1QVFS 1YI2A 1PD1A 1X75C 2FPEA 2E3HA 2QASA 1NE8A 2GF7A 4KH1B 2EQUA 4OB0B 3JB9F 1M1KR 1WDXA 3VV0A 1VQ8T 1KG1A 2EYZA 3CEYA 2YXYA 2EWNA 1QVPA 1WYXA 4EMHA 3RBBB 1YJNT 1RAAB 1S72T 4J7FA 4KULA 2KNBB 2FZCB 5GAOm 4QQGA 4QVDA 1MMNA 2JTMA 3LGLA 4BE0A 5CAIA 2L5QA 3PTAA 1SRMA 2OTLA 2NUTA 2KT1A 5KYYB 2DM1A 5C0MA 4AMCA 2ATCB 1NBEB 5AYFA 4E7ZA 1QCOA 1U1TA 2DX1A 3C12A 2DVEA 1VQ6Q 3CCEQ 1IB8A 3A8HB 2LJ3A 1R8OB 1TSFA 4PJOF 3JSCA 1YCSB 3OSSC 1NYFA 4PJLA 4M7DB 2RQRA 2PQWA 5LJ5h 3V7RA 3I56A 1VQNQ 1BI3A 1IRXA 4OF1A 3LWHA 4N0AC 1MNEA 4OMFB 2ED0A 4N4IA 5IHNA 2QEXQ 4PK4A 2NUTB 4RG2A 1JXMA 2L3RA 1VQ6T 3CCET 1G83A 3R6NA 2GCXA 4LDXA 1WPYA 1CKAA 2RQUA 3EG0A 2IG0A 4PJOA 2BZ8A 1N5ZA 5J26A 4EIKA 2CYZB 1QW1A 1QVFP 1VQNT 4E7HA 3INZA 5LJ5g 1YJ9Q 2O2OA 3CD6A 2I2LA 2WSEE 1XOVA 4C0DC 2YUOA 1H3ZA 3ZEHA 2D9TA 4JS4A 1B07A 2DXUA 3JCMf 5KH6A 5GMKe 2CT3A 2KSSA 3HFOA 4LDUA 3QYHB 2KQWA 3EFOA 2FZKB 3CCQT 4C92F 1MNDA 3RESA 4EMKC 2DMOA 2NYSA 2RHZA 3O5ZA 1ZSZC 2X9HA 5LJ3g 1YJ9T 5HK3A 4C8QF 1CKBA 3JCMd 4XTXA 2RF0A 3X24B 2RHYA 2KYBA 2MMPA 1UHFA 2ZZDA 1UDLA 2C0TA 3EGXA 4R0KA 2HBPA 5GAOr 4M77F 3M9QA 2PNIA 2AIRB 4M75C 1N9RA 1GL5A 2YUPA 3QJ6A 1YHQT 2RI3A 5GMKm 1RUWA 1K8AR 3M0UA 1F1BB 1M1GA 3EFOB 3V8JA 1OZ3A 3JCMQ 4LXCA 4C8QA 1YIJT 1TTHB 3RKWA 5ECAA 3G71A 3P8HA 4XU3A 3M0SA 2XI9A 3EH1A 4M78C 3O8VA 2K57A 5GANj 5GMKi 3F70A 5GAOn 1TXQA 1SKUB 1AZGB 4JPBW 4JJBA 3HP9A 3EGXB 4JLGA 2QTXA 2FL7A 4J6WA 1IHVA 5CQXA 3CC4A 1X2QA 2XK0A 3UA6A 2RO0A 4M75E 3GP8A 1Q86R 2K5LA 1OULA 4XK8E 2A37A 4JJCA 4E47A 4C8QB 2C0OA 4OMQA 4FSSA 2K5IA 3GBQA 5GAOl 5D6YA 2VKNA 2X3XD 2O4XA 5GAN2 4M7AF 2HNIA 4M78E 3CXCA 3HRSA 1JJ2P 5GAMf 2HL5C 2DL7A 2HDAA 2D1XA 5GJWB 4JDSA 2JZ2A 3TSWA 2DEQA 3L1AA 3CBOA 2NLUA 2R57A 1YP5A 3OYYA 4J9HA 5HY6A 1VQKT 3NTIA 2QA4T 1HJDA 1VYVA 1HK9A 3RIRA 2DEUA 2GTOA 2M1HA 2JT4A 1SEMA 2ENMA 1BU1A 2HZYA 1B7TA 2DYBA 3LW5E 1KQSA 1UFFA 2O9SA 2P0KA 4ESRA 1FXXA 2F5KA 2BKDN 3LH0A 2VB6A 4J7IA 4JZ3A 5GAMd 2M02A 2O4XB 3THKA 4ZNXA 1SG5A 3MJXA 1WHJA 3JCMV 2FYKA 2PUKB 3CXCS 3P8DA 4PFZA 4ZTFA 1WGSA 4HCKA 2K6DA 1M8MA 1AD5A 1N9SA 3OYHA 3OW2A 2HSPA 4E7KA 2G3RA 1KD1U 2VGNA 4J9IA 3QDRB 2P84A 3E19A 2DK3A 1PSEA 3H9NA 3RMQA 5GAN5 4D8DA 3CMAQ 1D3BA 3VKIA 2C0IA 2NUZA 5EC7A 1KQSS 2JS2A 4A4FA 3NFCA 3A8MB 3CPWA 2F5TX 4KH0B 3MEVA 4PJOC 2CH4A 2PVOB 2EW3A 2AZVA 2QK0A 4E7IA 3L2QA 2YLBA 3UA7A 1BB9A 2PZ1A 5GAOp 2GFUA 2AHJB 2ROLA 4LUEA 4F04B 1UGVA 1N8RC 2VV5A 4AT1B 3JV3A 1BI0A 2IPOB 3OW2S 4E7SA 2DXTA 3CMAT 1Q7YU 1WXBA 1LPLA 3CBPA 1KJWA 2V1QA 1K9MC 2M51A 1TOVA 2D6FA 3QG1A 1D3BB 4C5HA 2XDBA 1PCXA 4KUIA 5LJ5f 1BI2A 2XIDA 4WTOB 3CPWS 4VUBA 1FX7A 4QW2A 4PJOE 1TS9A 4PL6A 2EAYA 2XICA 5CKDA 1MV0B 4F7UG 4E2FB 5GMKl 3RERA 4IIMA 4ZN3A 4ZTJA 2LT1A 3MP1A 3OYFA 3UATA 1W4SA 1BIBA 3H6ZA 1B3QA 5LJ5d 2X4YA 1UGRB 5KCHA 2DL8A 4YTLA 5LJ3f 4C92C 3HKSA 3L2ZA 1ZBJA 1WJSA 2HSEB 2K3XA 3OS5A 3OB9A 3H8ZA 2CREA 5CIUA 1ZX6A 7AT1B 3JCMW 3SD4A 2QXFA 2YUQA 2EBPA 4C8QC 3CCJQ 5CKEA 1JQQA 4XTZA 1WXUA 5C6SA 2KAFA 2K3BA 4JJDA 3G1JA 2PUOB 1I5LA 3KBGA 4FW1A 5KYXA 1K73C 3NPFA 3OYDA 3TU4K 2R5MA 5LJ3d 1CSKA 4O6JA 1MUZA 3HRTA 2PU9B 4FU6A 4J9BA 1QWEA 1Y7XA 3CCLQ 2DKGA 1KQ2A 3ULRB 4LDVA 2E70A 3CCJT 2F1LA 4C92E 2CP3A 2A08A 1RAIB 3QWXX 3C4SA 3CC7A 1O9SA 1GRIA 1WJQA 3HFNA 1KC8U 1QCFA 2J7IA 3OY9A 1N27A 1WA7A 2L3PA 1C6VX 2WSFE 2XDPA 1EZZB 1H641 1BCMA 1OZ2A 3HRUA 2QTVA 5KYWA 1OOTA 4M7AD 4NL3A 4P5NA 5GMKj 2ZPFB 8ATCB 4MDWA 1E7OA 5KYXB 4M77E 1OEBA 2LJ1A 1OU9A 4C0GA 3CCLT 5FWCA 1KSWA 4AG2C 4KBMB 2RJDA 4ELZC 3QZ9B 1R0CB 3MEWA 3I5RA 4OGEA 3FJ5A 2EKHA 2DTIA 2M9UA 5KCOA 2W10A 3LH5A 1AWWA 2KRMA 4Z89A 3NTHA 1VQLA 2DBMA 2YLCA 2KE9A 4BE1A 3L2VA 4ATOA 3RDVA 3TSZA 1KFZA 4A63B 2X35A 5KYWB 1MGQA 4JUVA 4R55A 5GAMh 5A0GA 3J80E 3UWNA 2H3EB 1VIFA 4KUDK 4M7AG 3ME9A 2LQ8A 4HCBA 2IVWA 1QVFA 4MZPA 1E6HA 5I21A 1Q82C 1Q95G 3CMEQ 4XU1A 3S6WA 3SHWA 4E7LA 1VQ8A 2EYWA 3OYKA 1VIEA 2HMAA 2HQXA 4BACA 1G3WA 1GBRA 1HYOA 3CC2Q 1PG5B 4HT9A 1S72A 3LX7A 4CC3A 3ZBDA 2CZ1B 4M7AE 3OYJA 4WF2A 4M7DF 2LQNA 3VRZA 2DL4A 4OMOA 5D6XA 1IGUA 4C0FA 3RKYA 3SEMA 4DBRA 1RAEB 1P92A 3CMET 1H92A 1UEBA 3E2UA 4X1VA 5KYUB 2ZPHB 3CC2T 2QQSA 1V1CA 2QDYB 2DRMA 1X01A 1WHHA 1X43A 4DA4A 1RI0A 2MWOA 4A54A 4RTWA 4C5GA 4M7DA 2X4WA 3HTRA 5GAOq 1G5VA 3MP8A 1R77A 1VQOQ 4Z88A 4KGZB 3V8LA 2A28A 5D6WA 3OBYA 2RM4A 2DERA 1U1SA 2KEAA 1E6GA 1YI2Q 2EYXA 2KMTA 2P4TA 4IUUA 4BI3A 1VQPA 1TU0B 1V76A 3FIFA 3BE3A 4R56A 3MPUB 3OYGA 5DLOA 4BE2A 5FROA 4D6WA 1ABOA 2DZ9A 3QBYA 2DRKA 1VQ4A 4XQ3A 2LCCA 1YWPA 2JMCA 2B8AA 4L59A 3QSUA 5CK9A 4DOVA 1G8XA 3SWNA 3OYMA 4FL6A 2M0YA 3FLGA 4IUPA 1YI2T 4M4ZA 4F16A 4J9DA 1C1AA 3J7AF 5L23A 4Z02A 1LVKA 4CC7A 2MAMA 3OYLA 2V1RA 3QYGB 1UGQB 3QWYA 3CCQA 1AWXA 2JM8A 1JJ2A 2ZCFB 5HKCA 2H8HA 2ZPBB 2SRCA 5GAN3 5GANg 2LQWA 5KE3A 1NYGA 1NLPC 3I56Q 5LJ3h 2G6FX 2HBWA 3X25B 2DIGA 3SWNB 2KDSA 2XMFA 2J6FA 2QEXT 3BDUA 4DEYA 2DO3A 1M9SA 1YHQA 2RMOA 2ESWA 1B34A 1X6OA 5HCKA 4GY5A 1YBYA 5CQYA 1M90C 1KD1R 2EFIA 3UF4A 3EG2A 3ASKA 1OX8A 4HVVA 3E1SA 2YSQA 3EGDB 2CGHA 4M75D 1VUBA 5J39A 1YIJA 4BY6B 4XTYA 2BTTA 2EQJA 1JJ2S 4PLLA 3I56T 3SDZA 2YDLA 3MEAA 2EKOA 2QQ9A 3H0HA 4E7JA 3S3NA 2A0FB 2CUBA 4LUDA 1W70A 2P4RA 3GOXA 2L3QA 2X3WD 1EFNA 4X9CA 1K0SA 2E5QA 1VQ5A 3CCUA 4J83A 4ZGEB 4M78D 4A4GA 3LGFA 3OMCA 3T9NA 2KXDA 4F7UA 1H8KA 2CZ0B 5FRMA 1FMVA 3PIOA 1JB0E 1YITA 1B34B 3VRYA 3I55A 2KY9A 5CKBA 2E10A 3D7SB 1YCYA 3H41A 1Q7YR 3TREA 2D0NA 3RUXA 4O5VA 5I2MA 3OS0A 4M75G 2E5KA 1V29B 3IQLA 5CVIA 1BCOA 1WX6A 1N6AA 3LLRA 4EPCA 2RK1A 1LNXA 2LT4A 2V8KA 1J3TA 2H3JA 4PJJA 4FYYB 3URGA 1WNLA 1D0ZA 3JCMe 2DIQA 2AK5A 2K3YA 2KK4A 4F7UB 2K4YA 2XKOC 2JTEA 1MMGA 2KROA 4M78G 4MZTA 2ZAEA 1VQKA 2QA4A 3VU3C 4CI0C 2RJFA 3HHTB 1PKSA 1UTIA 2JN0A 1G3TA 1W2BP 1I1JA 3G71Q 2JOYA 3FJPA 1PRMC 4HVUA 3VS0A 2DXBA 2YRCA 3BW1A 4L6V5 1M4ZA 2JMAA 3OYNA 3ZL7C 2DBKA 3JB9D 3CC4Q 2V26A 4M7DC 1NJIC 1NEBA 3G6EA 3GLXA 4DQ2A 2Y4XA 3DB4A 5CO7A 5IT9E 2VVKA 4IURA 1RAGB 1N8RU 2OTJA 4MMLA 3EGUA 1PNJA 2DF6A 3QJYA 2PVGB 1BIAA 4FSXA 2RQTA 1K9MU 2SEMA 3CCMA 3KUFA 2EGAA 2WSCE 1M1KC 1VOMA 3VUZA 3CC4T 3TVTA 4EMGA 4PJMA 2ECZA 3OYAA 1KC8R 1M3BA 1JXOA 3NMZC 2A36A 3RR6A 4PJOD 1WHMA 3JB9G 1GCQA 4M7DE 3VS2A 3SWNC 2RI5A 3DLLA 4OP0A 3TEEA 2FG0A 5FU6B 4FYXB 2Y4YA 4PLIA 1OYXA 5FU7B 2AKKA 1ZHIA 2GQVA 3WVDB 1QKWA 1AVZC 1YJWA 3JCMP 1PC0A 4BY6C 5GAN7 1X69A 3OYCA 1VQ9Q 4OGCA 5GAMe 1U3OA 3NGPA 2DAQA 5GMKh 1PKTA 1VQ7Q 2Z0WA 2LVMA 3CQTA 1RI9A 2E12A 4PJOG 2CP5A 2RQWA 4IUQA 4LN2A 5FLXE 1ZA2B 1D09B 1RACB 3A8LB 4NS5A 1UG1A 3JCMc 8AT1B 2J6OA 1TH7A 2MPXC 3META 5GJVB 2XG8D 2MK5A 1MMDA 5GANf 2OI3A 1OQKA 4A4KA 4RUGA 5J3BA 1LOJA 2CZ6B 1K73U 1D1AA 2RQVA 1K9AA 1SHFA 1QLYA 1Q81U 4DEXA 4N4HA 3FEOA 1VQ9T 2HEQA 4QQDA 3PGGA 4RTYA 4C92D 1VQ7T 1UECA 1KHIA 3M0PA 4ELYC 1FMWA 3CPFA 3FRNA 2K2VA 4C8QD 2GNCA 3JRZA 1ZSGA 2L8DA 3CCRA 3G4SA 1D1BA 2DETA 5GANd 1PHTA 4LD6A 1MMAA 1YFNA 2CUDA 3EHRA 2WACA 3M0RA 4OMPA 4M77D 3V7SA 1I07A 3CCJA 3UDCA 1GBQA 2FB7A 3OS1A 1OPLA 2EJFA 2AKLA 3QIIA 4QT7A 2VUBA 2MOXA 3DB3A 3HL8A 2K5FA 1G2BA 1IGQA 1QP3A 1I8FA 2JW4A 1PSFA 4C92G 3P8BB 1GFCA 2DXCA 1VQMA 1ABQA 2PVDB 2JJ9A 3FB9A 3CCVA 3KFVA 1QQJA 3PVQA 4LD9K 4ZGJB 4C8QG 1U06A 3C95A 4J9EA 2RNAA 2O88A 2ZPIB 1Q81C 1MV3A 5I2SA 4PFOA 1WHGA 2BUDA 3L42A 5IHIA 3M5AA 3E9GA 1K8AC 4M77G 1ACMB 4MMKA 1DJ7B 2CT4A 5LJ5e 1Y71A 2D0QB 4RCBA 2BE7D 5CKHA 3CCSQ 2L89A 1Y57A 1Q82U 2RD1A 1ZBXA 4C8QE 3C0CA 3PMTA 1BK2A 3PNWC 3JB9I 2HQHA 1K4US 3M57A 2QQBA 1QP2A 4AFSC 6AT1B 4A4EA 4JS5A 2MIOA 4BD3A 5GAN8 1UGPB 1X27A 5A0LA 2DVJA 1Q86C 3PFSA 3CBMA 5KE2A 5LJ3e 3VS6A 3CC7Q 1NPRA 1U5SA 2OAWA 3EH2A 3CCST 1QVGP 1AT1B 3QPHA 2JVVA 2K9GA 2DYIA 5L8RE 3PIPA 3PMIA 4BDZA 4RCCA 4UC4A 1UUEA 4BUGA 4RMOA 2CP2A 3MHXA 3RMSA 4DBFA 1FMKA 1TG0A 3GIBA 1NG2A 3RNJA 1G3SA 1XTDA 3ER0A 3OSVA 4IKFA 4JRKA 2KGTA 5FW9A 4RTUA 1JU5C 2VGMA 5FRNA 4JLIA 3A5ZB 2DL3A 3SB2A 1GCQC 3CC7T 1IREB 3VS3A 5KYUA 1K76A 3EAEA 4M75A 5D7UA 1X6BA 1H3HA 4BI4A 2J05A 2RH2A 1VQLQ 4Y91A 3S3MA 2LNHB 1SSHA 2VC8A 3UT1A 2O31A 2CP7A 1YJNA 4XTWA 4KRTA 4J9FA 4RTZA 1RABB 2GFAA 5A2QE 1ZSZB 1TUDA 4XU2A 1GFDA 1WLPB 4M78A 1M3CA 4RKUE 2ZPEB 2MYSA 4HCCA 2CP6A 2JS0A 4IIOA 1LCKA 3LYIA 2JUFA 2PTKA 1WZOA 4FCYA 1ZUUA 1UE9A 4PNOA 1VQLT 1VQ8Q 3DKMA 3OQ5A 4M75B 4AFQC 1FWZA 1MHNA 2QGGA 4QQ6A 2FPDA 1S72Q 2ZGWA 3HSBA 4JRIA 3OYBA 1JO8A 2ZPGB 2E41A 2KT8A 2KRNA 1WIEA 4CRIA 2L2PA 2CH4W 2CP0A 2LMJA 1XJWB 5DLQE 2BE9B 3JCMJ 1RAHB 2DE0X 3M58A 3M4GA 3JCMb 1R0BG 4IUVA 2DTHA 1UGSB 4M78B 2DJZA 5HK0A 1VQ6A 1SF9A 3CCEA 4J6YA 4J5YA 4HA8A 3QHSA 2AZSA 1QMCA 4E6RA 1K0XA 4HKEA 1M3AA 1RAFB 1W6XA 3A8OB 3I9QA 4XTUA 1M8VA 3VS1A 3WVEB 4X9DA 3NHNA 1M90U 9ATCB 2BZXA 1VQNA 3WXMB 5GANh 2KVQG 3EFRA 2E65A 3PT9A 4HXJA 1M5Q1 2E6ZA 3TCJA 2DD4A 1VQOT 4PFPA 2M16A 4LE9A 2DILA 2QEXA 2RHXA 2JTFA 3M4YA 2DA9A 2QDLA 1W2BA 2OTLQ 2F2XA 3C94A 2K7AA 2LJ0A 1SPKA 1VQPQ 2HCKA 3RKXA 5IHKA 4OMLA 1WQ7A 5M9OA 4NL2A 1TUCA 3U23A
chains in the Genus database with same CATH topology
2EVRA 3EHQA 4GLMA 1PRMC 1M30A 4HVUA 3VS0A 1AEYA 2GGRA 2DNUA 2YUNA 5FWBA 1M27C 2FEIA 4AFUC 2GBQA 3I5SA 2JMAA 1UJ0A 1MV0B 2GQIA 3M0QA 3ZL7C 1YWOA 2DBKA 2D8HA 2F2WA 2L3SA 2NWMA 4IIMA 1Z9ZA 1T3SA 3H0FA 1NEBA 3UATA 1X6GA 2EGEA 4Z8AA 1B3QA 2VVKA 2DL8A 3EGUA 1ZBJA 2LZ6B 1PNJA 1YN8A 2CREA 2W0ZA 1ZX6A 2DF6A 1RLQC 1KIKA 2ED1A 2YUQA 2JM9A 2EBPA 2RQTA 2SEMA 2EGAA 1JQQA 1WXUA 2DL5A 2K79A 2K3BA 3TVTA 2ECZA 4JJDA 1M3BA 1NEGA 2D8JA 1JXOA 1T3LA 3NMZC 1AOJA 2A36A 1VYUA 1GCQA 4F17A 3VS2A 1HSQA 3NPFA 2FPEA 1CSKA 2FG0A 1MUZA 4J9BA 1QWEA 2AKKA 3ULRB 1WDXA 1WFWA 1QKWA 2DLPA 3VS4A 1AVZC 2A08A 2EYZA 3QWXX 2FRWA 1GRIA 1WYXA 3RBBB 2KNBB 1QCFA 1I0CA 1X69A 2J7IA 3A98A 1WA7A 3H0IA 5IH2A 4J9GA 2L3PA 2JXBA 1U3OA 3NGPA 1PKTA 1OOTA 1SRMA 1GCPA 2KT1A 2DM1A 3CQTA 1RI9A 4RTXA 1E7OA 4CC4B 1OEBA 2LJ1A 1ZLMA 2RQWA 2DX1A 4LN2A 5FWCA 1KSWA 4AG2C 1UG1A 2J6OA 4LNPA 3I5RA 4F14A 5GJVB 3FJ5A 2EKHA 2LJ3A 2FPFA 1YCSB 2OI3A 4K11A 4OMNA 2W10A 4RUGA 3LH5A 1NYFA 2RQRA 2KRMA 1AWWA 2RQVA 1K9AA 1SHFA 1QLYA 4DEXA 4Z89A 1VYTA 2DBMA 2HEQA 1X2KA 2KE9A 4RTYA 1UECA 2ED0A 3TSZA 3M0PA 4WCIA 1KFZA 4A63B 2LCSA 5IHNA 2VWFA 2GNCA 1JXMA 1G83A 4RTTA 1ZSGA 3R6NA 2DJQA 1CKAA 2RQUA 3EG0A 1PHTA 2CUDA 2BZ8A 1E6HA 3EHRA 1A0NB 1N5ZA 3M0RA 4OMPA 1ARKA 3SHWA 4EIKA 1I07A 2EYWA 4ORZA 1GBRA 1GBQA 4OMMA 1OPLA 2AKLA 4QT7A 2O2OA 2MOXA 2KRSA 4D8KA 1XOVA 2YUOA 4CC3A 2F2VA 1G2BA 1B07A 1WXTA 2CDTA 2JW4A 2LQNA 3VRZA 5I22A 1GFCA 2DL4A 4OMOA 1ABQA 2CT3A 3SEMA 3KFVA 4AG1C 3PVQA 1W1FA 1U06A 5IXFA 1UJYA 4J9EA 3EG1A 4AFZC 1H92A 2RNAA 4X1VA 2O88A 1RLPC 2LP5A 2DMOA 1MV3A 3O5ZA 5IHIA 1V1CA 2FO0A 1ZUKA 1X43A 1CKBA 2DRMA 2O9VA 2CT4A 2RF0A 4RTWA 2KYBA 1Y57A 1UHFA 4Z88A 1UDLA 2C0TA 4R0KA 3C0CA 2PNIA 1BK2A 2A28A 1GL5A 2YUPA 1K4US 4J9CA 2OJ2A 2LX7A 2KEAA 1E6GA 2KXCA 2EYXA 4GBQA 4AFSC 1RUWA 2MIOA 1NLOC 3M0UA 1X27A 2DVJA 5ECAA 2KR3A 2KYMA 3M0SA 2CSQA 1ABOA 3VS6A 1U5SA 2OAWA 2DRKA 2K9GA 2GTJA 1AZEA 2EQIA 2EGCA 1YWPA 2JMCA 3PE0A 5I11A 1AZGB 4JPBW 1UUEA 4JJBA 2M0YA 2RPNA 1FMKA 1TG0A 1X2QA 3UA6A 1NG2A 4M4ZA 3RNJA 4J9DA 4F16A 1ZUYA 2J6KA 1AWJA 2B86A 5L23A 4Y92A 2KGTA 4CC7A 2J06A 1Z9QA 5FW9A 2V1RA 4RTUA 1FYNA 1JU5C 2A37A 4JJCA 2ROTA 3QWYA 2DL3A 4HVWA 1SRLA 1AWXA 1GCQC 2C0OA 1K1ZA 2JM8A 4OMQA 3EG3A 2EYYA 4FSSA 3GBQA 2H8HA 3VS3A 2SRCA 1K76A 4CC2A 2VKNA 2X3XD 2LQWA 1X6BA 1NYGA 1H3HA 3I35A 1NLPC 2J05A 2LNHB 2G6FX 1SSHA 1S1NA 2HBWA 2O31A 1UHCA 1VA7A 1SHGA 3REAB 2DL7A 2HDAA 2D1XA 3REBB 1HD3A 4KRTA 5GJWB 4J9FA 4RTZA 1OV3A 2XMFA 3TSWA 2J6FA 4DEYA 2I0NA 1TUDA 3PVLA 1YP5A 3VS5A 4J9HA 5IXBA 2RMOA 2ESWA 1GFDA 5HCKA 1WLPB 1M3CA 1HJDA 1VYVA 1BBZA 1AWOA 2GTOA 2JT4A 1SEMA 2ENMA 1BU1A 2JS0A 3EG2A 4IIOA 3UF4A 2CSIA 1LCKA 4HVVA 1QKXA 1T0JA 2DYBA 2YSQA 2PTKA 1UFFA 2O9SA 2BTTA 4ESRA 2RN8A 1ZUUA 1UE9A 2YDLA 4JZ3A 3H0HA 3VS7A 3THKA 4ZNXA 2CUBA 2P4RA 1W70A 4LUDA 4AFQC 2L3QA 2X3WD 1EFNA 2FPDA 1JO8A 1WI7A 4HCKA 2EPDA 2K6DA 1K0SA 1M8MA 1AD5A 2KT8A 2KRNA 1WIEA 2FRYA 2L2PA 2CH4W 2LMJA 2DE0X 2HSPA 2KXDA 1H8KA 1NM7A 4J9IA 1Y0MA 2L0AA 4RTVA 3VRYA 2YT6A 3M0TA 4D8DA 1T0HA 2MCNA 2AZSA 3H41A 4E6RA 2C0IA 2NUZA 1K0XA 5EC7A 2D0NA 1PRLC 2JS2A 1M3AA 1W6XA 2E5KA 1QWFA 2K2MA 3I9QA 3IQLA 3VS1A 1WX6A 2KBTA 2CH4A 3NHNA 2EW3A 1PWTA 2AZVA 1JEGA 2BZXA 3UA7A 2ABLA 4HXJA 1J3TA 1BB9A 2PZ1A 2ROLA 4LUEA 1UGVA 2DILA 4LE9A 1OPKA 2AK5A 3JV3A 2JTEA 2KROA 2DA9A 2QDLA 1WXBA 2F2XA 2K7AA 2LJ0A 1SPKA 1KJWA 2BZYA 2V1QA 2HCKA 2M51A 4JZ4A 5IHKA 4OMLA 1IO6A 1PKSA 1UTIA 1TUCA 2IIMA 1YNZA 3U23A 1I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVR A;  3EHQ A;  4GLM A;  1PRM C;  1M30 A;  4HVU A;  3VS0 A;  1AEY A;  2GGR A;  2DNU A;  2YUN A;  5FWB A;  1M27 C;  2FEI A;  4AFU C;  2GBQ A;  3I5S A;  2JMA A;  1UJ0 A;  1MV0 B;  2GQI A;  3M0Q A;  3ZL7 C;  1YWO A;  2DBK A;  2D8H A;  2F2W A;  2L3S A;  2NWM A;  4IIM A;  1Z9Z A;  1T3S A;  3H0F A;  1NEB A;  3UAT A;  1X6G A;  2EGE A;  4Z8A A;  1B3Q A;  2VVK A;  2DL8 A;  3EGU A;  1ZBJ A;  2LZ6 B;  1PNJ A;  1YN8 A;  2CRE A;  2W0Z A;  1ZX6 A;  2DF6 A;  1RLQ C;  1KIK A;  2ED1 A;  2YUQ A;  2JM9 A;  2EBP A;  2RQT A;  2SEM A;  2EGA A;  1JQQ A;  1WXU A;  2DL5 A;  2K79 A;  2K3B A;  3TVT A;  2ECZ A;  4JJD A;  1M3B A;  1NEG A;  2D8J A;  1JXO A;  1T3L A;  3NMZ C;  1AOJ A;  2A36 A;  1VYU A;  1GCQ A;  4F17 A;  3VS2 A;  1HSQ A;  3NPF A;  2FPE A;  1CSK A;  2FG0 A;  1MUZ A;  4J9B A;  1QWE A;  2AKK A;  3ULR B;  1WDX A;  1WFW A;  1QKW A;  2DLP A;  3VS4 A;  1AVZ C;  2A08 A;  2EYZ A;  3QWX X;  2FRW A;  1GRI A;  1WYX A;  3RBB B;  2KNB B;  1QCF A;  1I0C A;  1X69 A;  2J7I A;  3A98 A;  1WA7 A;  3H0I A;  5IH2 A;  4J9G A;  2L3P A;  2JXB A;  1U3O A;  3NGP A;  1PKT A;  1OOT A;  1SRM A;  1GCP A;  2KT1 A;  2DM1 A;  3CQT A;  1RI9 A;  4RTX A;  1E7O A;  4CC4 B;  1OEB A;  2LJ1 A;  1ZLM A;  2RQW A;  2DX1 A;  4LN2 A;  5FWC A;  1KSW A;  4AG2 C;  1UG1 A;  2J6O A;  4LNP A;  3I5R A;  4F14 A;  5GJV B;  3FJ5 A;  2EKH A;  2LJ3 A;  2FPF A;  1YCS B;  2OI3 A;  4K11 A;  4OMN A;  2W10 A;  4RUG A;  3LH5 A;  1NYF A;  2RQR A;  2KRM A;  1AWW A;  2RQV A;  1K9A A;  1SHF A;  1QLY A;  4DEX A;  4Z89 A;  1VYT A;  2DBM A;  2HEQ A;  1X2K A;  2KE9 A;  4RTY A;  1UEC A;  2ED0 A;  3TSZ A;  3M0P A;  4WCI A;  1KFZ A;  4A63 B;  2LCS A;  5IHN A;  2VWF A;  2GNC A;  1JXM A;  1G83 A;  4RTT A;  1ZSG A;  3R6N A;  2DJQ A;  1CKA A;  2RQU A;  3EG0 A;  1PHT A;  2CUD A;  2BZ8 A;  1E6H A;  3EHR A;  1A0N B;  1N5Z A;  3M0R A;  4OMP A;  1ARK A;  3SHW A;  4EIK A;  1I07 A;  2EYW A;  4ORZ A;  1GBR A;  1GBQ A;  4OMM A;  1OPL A;  2AKL A;  4QT7 A;  2O2O A;  2MOX A;  2KRS A;  4D8K A;  1XOV A;  2YUO A;  4CC3 A;  2F2V A;  1G2B A;  1B07 A;  1WXT A;  2CDT A;  2JW4 A;  2LQN A;  3VRZ A;  5I22 A;  1GFC A;  2DL4 A;  4OMO A;  1ABQ A;  2CT3 A;  3SEM A;  3KFV A;  4AG1 C;  3PVQ A;  1W1F A;  1U06 A;  5IXF A;  1UJY A;  4J9E A;  3EG1 A;  4AFZ C;  1H92 A;  2RNA A;  4X1V A;  2O88 A;  1RLP C;  2LP5 A;  2DMO A;  1MV3 A;  3O5Z A;  5IHI A;  1V1C A;  2FO0 A;  1ZUK A;  1X43 A;  1CKB A;  2DRM A;  2O9V A;  2CT4 A;  2RF0 A;  4RTW A;  2KYB A;  1Y57 A;  1UHF A;  4Z88 A;  1UDL A;  2C0T A;  4R0K A;  3C0C A;  2PNI A;  1BK2 A;  2A28 A;  1GL5 A;  2YUP A;  1K4U S;  4J9C A;  2OJ2 A;  2LX7 A;  2KEA A;  1E6G A;  2KXC A;  2EYX A;  4GBQ A;  4AFS C;  1RUW A;  2MIO A;  1NLO C;  3M0U A;  1X27 A;  2DVJ A;  5ECA A;  2KR3 A;  2KYM A;  3M0S A;  2CSQ A;  1ABO A;  3VS6 A;  1U5S A;  2OAW A;  2DRK A;  2K9G A;  2GTJ A;  1AZE A;  2EQI A;  2EGC A;  1YWP A;  2JMC A;  3PE0 A;  5I11 A;  1AZG B;  4JPB W;  1UUE A;  4JJB A;  2M0Y A;  2RPN A;  1FMK A;  1TG0 A;  1X2Q A;  3UA6 A;  1NG2 A;  4M4Z A;  3RNJ A;  4J9D A;  4F16 A;  1ZUY A;  2J6K A;  1AWJ A;  2B86 A;  5L23 A;  4Y92 A;  2KGT A;  4CC7 A;  2J06 A;  1Z9Q A;  5FW9 A;  2V1R A;  4RTU A;  1FYN A;  1JU5 C;  2A37 A;  4JJC A;  2ROT A;  3QWY A;  2DL3 A;  4HVW A;  1SRL A;  1AWX A;  1GCQ C;  2C0O A;  1K1Z A;  2JM8 A;  4OMQ A;  3EG3 A;  2EYY A;  4FSS A;  3GBQ A;  2H8H A;  3VS3 A;  2SRC A;  1K76 A;  4CC2 A;  2VKN A;  2X3X D;  2LQW A;  1X6B A;  1NYG A;  1H3H A;  3I35 A;  1NLP C;  2J05 A;  2LNH B;  2G6F X;  1SSH A;  1S1N A;  2HBW A;  2O31 A;  1UHC A;  1VA7 A;  1SHG A;  3REA B;  2DL7 A;  2HDA A;  2D1X A;  3REB B;  1HD3 A;  4KRT A;  5GJW B;  4J9F A;  4RTZ A;  1OV3 A;  2XMF A;  3TSW A;  2J6F A;  4DEY A;  2I0N A;  1TUD A;  3PVL A;  1YP5 A;  3VS5 A;  4J9H A;  5IXB A;  2RMO A;  2ESW A;  1GFD A;  5HCK A;  1WLP B;  1M3C A;  1HJD A;  1VYV A;  1BBZ A;  1AWO A;  2GTO A;  2JT4 A;  1SEM A;  2ENM A;  1BU1 A;  2JS0 A;  3EG2 A;  4IIO A;  3UF4 A;  2CSI A;  1LCK A;  4HVV A;  1QKX A;  1T0J A;  2DYB A;  2YSQ A;  2PTK A;  1UFF A;  2O9S A;  2BTT A;  4ESR A;  2RN8 A;  1ZUU A;  1UE9 A;  2YDL A;  4JZ3 A;  3H0H A;  3VS7 A;  3THK A;  4ZNX A;  2CUB A;  2P4R A;  1W70 A;  4LUD A;  4AFQ C;  2L3Q A;  2X3W D;  1EFN A;  2FPD A;  1JO8 A;  1WI7 A;  4HCK A;  2EPD A;  2K6D A;  1K0S A;  1M8M A;  1AD5 A;  2KT8 A;  2KRN A;  1WIE A;  2FRY A;  2L2P A;  2CH4 W;  2LMJ A;  2DE0 X;  2HSP A;  2KXD A;  1H8K A;  1NM7 A;  4J9I A;  1Y0M A;  2L0A A;  4RTV A;  3VRY A;  2YT6 A;  3M0T A;  4D8D A;  1T0H A;  2MCN A;  2AZS A;  3H41 A;  4E6R A;  2C0I A;  2NUZ A;  1K0X A;  5EC7 A;  2D0N A;  1PRL C;  2JS2 A;  1M3A A;  1W6X A;  2E5K A;  1QWF A;  2K2M A;  3I9Q A;  3IQL A;  3VS1 A;  1WX6 A;  2KBT A;  2CH4 A;  3NHN A;  2EW3 A;  1PWT A;  2AZV A;  1JEG A;  2BZX A;  3UA7 A;  2ABL A;  4HXJ A;  1J3T A;  1BB9 A;  2PZ1 A;  2ROL A;  4LUE A;  1UGV A;  2DIL A;  4LE9 A;  1OPK A;  2AK5 A;  3JV3 A;  2JTE A;  2KRO A;  2DA9 A;  2QDL A;  1WXB A;  2F2X A;  2K7A A;  2LJ0 A;  1SPK A;  1KJW A;  2BZY A;  2V1Q A;  2HCK A;  2M51 A;  4JZ4 A;  5IHK A;  4OML A;  1IO6 A;  1PKS A;  1UTI A;  1TUC A;  2IIM A;  1YNZ A;  3U23 A;  1I1J A; 
#chains in the Genus database with same CATH topology
 3GF5 A;  2EVR A;  3EGD A;  4GLM A;  4N4G A;  3HPW A;  3QDF A;  3BDL A;  2EJ9 A;  1N8R R;  3J81 E;  1VQ4 Q;  2YUN A;  5FWB A;  4FYV B;  3A1P A;  1YJ9 A;  2FEI A;  4OB2 B;  4XAX B;  4AFU C;  1JRI A;  2GBQ A;  1UJ0 A;  1WQW A;  1K9M R;  2F2W A;  2D8H A;  4XU0 A;  5GAM j;  2OTL T;  1IXD A;  1T3S A;  1VQP T;  3E9F A;  2DFU A;  1XNI A;  3H0F A;  4QVC A;  2HD0 A;  3M54 A;  1W2B S;  4ZN1 A;  2X4X A;  5IN1 A;  3ZFJ A;  4Z8A A;  1KQ1 A;  2HAX A;  4F7U F;  3M56 A;  3CCQ Q;  5GAN 6;  3G7Z A;  2QGF B;  2EJG A;  1VQ4 T;  2P0P A;  4Y28 E;  2LZ6 B;  4RG8 A;  1RLQ C;  5CKF A;  4IUT A;  2ED1 A;  1JBM A;  4B6M A;  1D0Y A;  2R5A A;  2DL5 A;  2LDM A;  2K79 A;  3CD6 Q;  1KK7 A;  2QQA A;  2D8J A;  4A53 A;  1AOJ A;  1QCN A;  3OYE A;  2VXF A;  1YHQ Q;  4F17 A;  4MDX A;  2O01 E;  1HSQ A;  4PJO B;  2X51 A;  2A7Y A;  1YIJ Q;  2AT1 B;  1WFW A;  3VS4 A;  2DLP A;  4C5E A;  3L2R A;  2OAU A;  3V8K A;  1NJI U;  2FRW A;  4DOW A;  3QZ5 B;  2MWP A;  3CD6 T;  2CZ7 B;  2XHC A;  3GPL A;  1I0C A;  3A98 A;  3H0I A;  4HCZ A;  1K73 R;  5IH2 A;  3QUI A;  4J9G A;  1Q81 R;  2JXB A;  2CKK A;  1VQ5 Q;  3CCU Q;  2V8J A;  1C0M A;  2RK2 A;  4MZM A;  3GNG A;  4C92 A;  1GCP A;  4RTX A;  4CC4 B;  1YIT Q;  1OI1 A;  1ZLM A;  3I55 Q;  3VJP A;  3Q1J A;  1M1K U;  2HKQ B;  3OS2 A;  2NUP A;  4LNP A;  4M7D D;  4F14 A;  4DBH A;  4QKU A;  2FPF A;  1Y96 A;  4K11 A;  4OMN A;  4J6X A;  1HXD A;  3QXE B;  1IZ6 A;  4M77 A;  2E3I A;  1VYT A;  2LNV A;  5LJ5 j;  1VQ5 T;  3CCU T;  3JB9 H;  3QO3 A;  3LWI A;  1X2K A;  2COZ A;  2V8I A;  3VUB A;  4WCI A;  1YIT T;  3QKJ A;  2LCS A;  1I5O B;  3OYI A;  3I55 T;  2VWF A;  4C92 B;  1RL2 A;  2XDD A;  1VQK Q;  4RTT A;  4C0Z A;  2QA4 Q;  2DJQ A;  2A3L A;  2C06 A;  5DY9 A;  3JCM X;  4B9X A;  1A0N B;  2NUP B;  1ARK A;  3MP6 A;  1BYM A;  4ZGD B;  4OB1 B;  3G71 T;  1LJO A;  2RJC A;  3L2U A;  1Y96 B;  4M7D G;  4ORZ A;  4M77 B;  4NOY A;  5LJ3 j;  3X26 B;  4OMM A;  4EDU A;  2YWW A;  2M0O A;  2KRS A;  4D8K A;  2F2V A;  1WXT A;  3DLM A;  2CDT A;  2XU8 A;  5I22 A;  2EQK A;  1Q82 R;  5AT1 B;  4BI8 B;  2MI6 A;  1M2O A;  4AG1 C;  2FHD A;  2BIV A;  1W1F A;  3G6E Q;  2EIF A;  5IXF A;  1UJY A;  3R6O A;  3EG1 A;  4AFZ C;  4JJN K;  3CMA A;  4M7A A;  1RLP C;  1O75 A;  2LX9 A;  1WHK A;  2LP5 A;  1BI1 A;  2OTJ Q;  4FT4 A;  4FIB A;  2LCL A;  3MKD A;  2FO0 A;  1ZUK A;  4KT0 E;  2O9V A;  4V2S A;  1VQ9 A;  3CCM Q;  1VQ7 A;  1M1F A;  1TWB A;  2XD0 A;  3JAM E;  3G6E T;  2YRV A;  1WJR A;  4J9C A;  2OJ2 A;  4JRP A;  2LX7 A;  2COY A;  1KHC A;  2KXC A;  4GBQ A;  4X34 A;  1NLO C;  1UB4 A;  2JNG A;  2OTJ T;  1AHJ B;  2RHI A;  3AT1 B;  1QVG A;  2VAS A;  4M7A B;  3FC3 A;  5CR2 A;  2KR3 A;  2E64 A;  2KYM A;  2CSQ A;  1YJW Q;  3CCM T;  1PM3 A;  2GTJ A;  1AZE A;  2EQI A;  2EGC A;  2F69 A;  3PE0 A;  5I11 A;  3X28 B;  3EFS A;  5IAY A;  1WHL A;  2RPN A;  1EX4 A;  1Y07 A;  2R58 A;  1K8A U;  2MF2 A;  1ZQ1 A;  1ZUY A;  2J6K A;  1AWJ A;  2B86 A;  4Y92 A;  3GNF B;  4JRQ A;  4C5I A;  4TVR A;  2J06 A;  1Z9Q A;  2QAZ A;  1FYN A;  1GXI E;  2ROT A;  4HVW A;  1SRL A;  1YJW T;  1QVG S;  1K1Z A;  3EG3 A;  2EYY A;  1OX9 A;  1XQH A;  2DZC A;  4PKC C;  2E6N A;  4A4H A;  2VXE A;  4CC2 A;  1KD1 C;  1BKB A;  2EYQ A;  3V7C A;  3VYH B;  5EG2 A;  3I35 A;  3SFM A;  2RB6 A;  5DM7 R;  1S1N A;  1UHC A;  1VA7 A;  2DTO A;  1SHG A;  3REA B;  3MEU A;  3REB B;  1HD3 A;  1G3Y A;  1Q86 U;  2FVU A;  1OV3 A;  3N5B B;  3VYG A;  3FDR A;  3JCM h;  3CXC P;  1EIF A;  2I0N A;  3PVL A;  3VS5 A;  5IXB A;  3CCR Q;  3G4S Q;  1BBZ A;  2QYZ A;  1AWO A;  4XTV A;  2CSI A;  3M53 A;  4Q5W A;  1QKX A;  1T0J A;  2RHU A;  4FT2 A;  3CCL A;  2RN8 A;  4N0A A;  4F7U E;  5GAN e;  1M2V A;  2OX7 A;  3VS7 A;  3CCS A;  2LRQ A;  1KQS P;  2Y90 A;  1Q7Y C;  2YRD A;  1WI7 A;  2EPD A;  1NPP A;  4M77 C;  2FRY A;  1M90 R;  3JCM g;  1VQM Q;  3CCR T;  3OMG A;  3UPU A;  2DPP B;  3G4S T;  1NM7 A;  5GAN 4;  1Y0M A;  2CS7 A;  5KYN A;  3CCV Q;  2L0A A;  4RTV A;  1OU8 A;  4OB3 B;  3M59 A;  2YT6 A;  3EG9 A;  3M0T A;  3OW2 P;  1T0H A;  2MCN A;  1D1C A;  5CCA A;  1TUG B;  4B9W A;  1PRL C;  4FM4 B;  1I4K 1;  4PJN A;  1QWF A;  2K2M A;  4J8O A;  1M2V B;  3M55 A;  2KBT A;  4FYW B;  2QI2 A;  2LC4 A;  1PWT A;  1JEG A;  5FU6 C;  2ABL A;  3BY7 A;  1VQM T;  5FU7 C;  3CPW P;  1RAD B;  4M75 F;  3S3O A;  3CCV T;  3JB9 J;  1OPK A;  5LL6 S;  4KGV B;  2HL3 A;  4EMK A;  4ANJ A;  4BDY A;  2LTO A;  1U8R A;  2E1H A;  1ZSZ A;  2E4H A;  2BZY A;  3EG9 B;  4JZ4 A;  2QG9 B;  1IO6 A;  2IIM A;  2RI2 A;  1YNZ A;  1PD0 A;  3CME A;  4C0D B;  4M78 F;  3EHQ A;  4OVA A;  3X20 B;  4HT8 A;  4M7A C;  1M30 A;  3CC2 A;  1AEY A;  4L5G A;  4LDW A;  2GGR A;  2DNU A;  2VYT A;  1M27 C;  3BFM A;  2KI7 A;  2X4J A;  4GLK A;  2FZG B;  3I5S A;  2EQM A;  2COW A;  2GQI A;  3M0Q A;  1YWO A;  2HQE A;  2L3S A;  3TQ7 P;  2NWM A;  2QQR A;  1I81 A;  1Z9Z A;  4EMK B;  4FW2 A;  1X6G A;  2EGE A;  2P0Q A;  1IHW A;  1KC8 C;  3MCA B;  3MO8 A;  4KGX B;  4BB7 A;  4ME7 A;  5A0D A;  2DD5 A;  4II1 A;  3A8G B;  4DBQ A;  1NZ9 A;  2RA2 A;  2HKN A;  1YN8 A;  2W0Z A;  1KIK A;  2LQK A;  2JM9 A;  2YHT A;  1NJI R;  1YJN Q;  1VQO A;  4LDY A;  5GAM g;  3L2W A;  1D0X A;  1NEG A;  3NTK A;  1T3L A;  1ZA1 B;  1SSF A;  4QVZ A;  5KYY A;  3KXT A;  3OBW A;  1VYU A;  3OA6 A;  3AHU A;  2RJE A;  1QVF S;  1YI2 A;  1PD1 A;  1X75 C;  2FPE A;  2E3H A;  2QAS A;  1NE8 A;  2GF7 A;  4KH1 B;  2EQU A;  4OB0 B;  3JB9 F;  1M1K R;  1WDX A;  3VV0 A;  1VQ8 T;  1KG1 A;  2EYZ A;  3CEY A;  2YXY A;  2EWN A;  1QVP A;  1WYX A;  4EMH A;  3RBB B;  1YJN T;  1RAA B;  1S72 T;  4J7F A;  4KUL A;  2KNB B;  2FZC B;  5GAO m;  4QQG A;  4QVD A;  1MMN A;  2JTM A;  3LGL A;  4BE0 A;  5CAI A;  2L5Q A;  3PTA A;  1SRM A;  2OTL A;  2NUT A;  2KT1 A;  5KYY B;  2DM1 A;  5C0M A;  4AMC A;  2ATC B;  1NBE B;  5AYF A;  4E7Z A;  1QCO A;  1U1T A;  2DX1 A;  3C12 A;  2DVE A;  1VQ6 Q;  3CCE Q;  1IB8 A;  3A8H B;  2LJ3 A;  1R8O B;  1TSF A;  4PJO F;  3JSC A;  1YCS B;  3OSS C;  1NYF A;  4PJL A;  4M7D B;  2RQR A;  2PQW A;  5LJ5 h;  3V7R A;  3I56 A;  1VQN Q;  1BI3 A;  1IRX A;  4OF1 A;  3LWH A;  4N0A C;  1MNE A;  4OMF B;  2ED0 A;  4N4I A;  5IHN A;  2QEX Q;  4PK4 A;  2NUT B;  4RG2 A;  1JXM A;  2L3R A;  1VQ6 T;  3CCE T;  1G83 A;  3R6N A;  2GCX A;  4LDX A;  1WPY A;  1CKA A;  2RQU A;  3EG0 A;  2IG0 A;  4PJO A;  2BZ8 A;  1N5Z A;  5J26 A;  4EIK A;  2CYZ B;  1QW1 A;  1QVF P;  1VQN T;  4E7H A;  3INZ A;  5LJ5 g;  1YJ9 Q;  2O2O A;  3CD6 A;  2I2L A;  2WSE E;  1XOV A;  4C0D C;  2YUO A;  1H3Z A;  3ZEH A;  2D9T A;  4JS4 A;  1B07 A;  2DXU A;  3JCM f;  5KH6 A;  5GMK e;  2CT3 A;  2KSS A;  3HFO A;  4LDU A;  3QYH B;  2KQW A;  3EFO A;  2FZK B;  3CCQ T;  4C92 F;  1MND A;  3RES A;  4EMK C;  2DMO A;  2NYS A;  2RHZ A;  3O5Z A;  1ZSZ C;  2X9H A;  5LJ3 g;  1YJ9 T;  5HK3 A;  4C8Q F;  1CKB A;  3JCM d;  4XTX A;  2RF0 A;  3X24 B;  2RHY A;  2KYB A;  2MMP A;  1UHF A;  2ZZD A;  1UDL A;  2C0T A;  3EGX A;  4R0K A;  2HBP A;  5GAO r;  4M77 F;  3M9Q A;  2PNI A;  2AIR B;  4M75 C;  1N9R A;  1GL5 A;  2YUP A;  3QJ6 A;  1YHQ T;  2RI3 A;  5GMK m;  1RUW A;  1K8A R;  3M0U A;  1F1B B;  1M1G A;  3EFO B;  3V8J A;  1OZ3 A;  3JCM Q;  4LXC A;  4C8Q A;  1YIJ T;  1TTH B;  3RKW A;  5ECA A;  3G71 A;  3P8H A;  4XU3 A;  3M0S A;  2XI9 A;  3EH1 A;  4M78 C;  3O8V A;  2K57 A;  5GAN j;  5GMK i;  3F70 A;  5GAO n;  1TXQ A;  1SKU B;  1AZG B;  4JPB W;  4JJB A;  3HP9 A;  3EGX B;  4JLG A;  2QTX A;  2FL7 A;  4J6W A;  1IHV A;  5CQX A;  3CC4 A;  1X2Q A;  2XK0 A;  3UA6 A;  2RO0 A;  4M75 E;  3GP8 A;  1Q86 R;  2K5L A;  1OUL A;  4XK8 E;  2A37 A;  4JJC A;  4E47 A;  4C8Q B;  2C0O A;  4OMQ A;  4FSS A;  2K5I A;  3GBQ A;  5GAO l;  5D6Y A;  2VKN A;  2X3X D;  2O4X A;  5GAN 2;  4M7A F;  2HNI A;  4M78 E;  3CXC A;  3HRS A;  1JJ2 P;  5GAM f;  2HL5 C;  2DL7 A;  2HDA A;  2D1X A;  5GJW B;  4JDS A;  2JZ2 A;  3TSW A;  2DEQ A;  3L1A A;  3CBO A;  2NLU A;  2R57 A;  1YP5 A;  3OYY A;  4J9H A;  5HY6 A;  1VQK T;  3NTI A;  2QA4 T;  1HJD A;  1VYV A;  1HK9 A;  3RIR A;  2DEU A;  2GTO A;  2M1H A;  2JT4 A;  1SEM A;  2ENM A;  1BU1 A;  2HZY A;  1B7T A;  2DYB A;  3LW5 E;  1KQS A;  1UFF A;  2O9S A;  2P0K A;  4ESR A;  1FXX A;  2F5K A;  2BKD N;  3LH0 A;  2VB6 A;  4J7I A;  4JZ3 A;  5GAM d;  2M02 A;  2O4X B;  3THK A;  4ZNX A;  1SG5 A;  3MJX A;  1WHJ A;  3JCM V;  2FYK A;  2PUK B;  3CXC S;  3P8D A;  4PFZ A;  4ZTF A;  1WGS A;  4HCK A;  2K6D A;  1M8M A;  1AD5 A;  1N9S A;  3OYH A;  3OW2 A;  2HSP A;  4E7K A;  2G3R A;  1KD1 U;  2VGN A;  4J9I A;  3QDR B;  2P84 A;  3E19 A;  2DK3 A;  1PSE A;  3H9N A;  3RMQ A;  5GAN 5;  4D8D A;  3CMA Q;  1D3B A;  3VKI A;  2C0I A;  2NUZ A;  5EC7 A;  1KQS S;  2JS2 A;  4A4F A;  3NFC A;  3A8M B;  3CPW A;  2F5T X;  4KH0 B;  3MEV A;  4PJO C;  2CH4 A;  2PVO B;  2EW3 A;  2AZV A;  2QK0 A;  4E7I A;  3L2Q A;  2YLB A;  3UA7 A;  1BB9 A;  2PZ1 A;  5GAO p;  2GFU A;  2AHJ B;  2ROL A;  4LUE A;  4F04 B;  1UGV A;  1N8R C;  2VV5 A;  4AT1 B;  3JV3 A;  1BI0 A;  2IPO B;  3OW2 S;  4E7S A;  2DXT A;  3CMA T;  1Q7Y U;  1WXB A;  1LPL A;  3CBP A;  1KJW A;  2V1Q A;  1K9M C;  2M51 A;  1TOV A;  2D6F A;  3QG1 A;  1D3B B;  4C5H A;  2XDB A;  1PCX A;  4KUI A;  5LJ5 f;  1BI2 A;  2XID A;  4WTO B;  3CPW S;  4VUB A;  1FX7 A;  4QW2 A;  4PJO E;  1TS9 A;  4PL6 A;  2EAY A;  2XIC A;  5CKD A;  1MV0 B;  4F7U G;  4E2F B;  5GMK l;  3RER A;  4IIM A;  4ZN3 A;  4ZTJ A;  2LT1 A;  3MP1 A;  3OYF A;  3UAT A;  1W4S A;  1BIB A;  3H6Z A;  1B3Q A;  5LJ5 d;  2X4Y A;  1UGR B;  5KCH A;  2DL8 A;  4YTL A;  5LJ3 f;  4C92 C;  3HKS A;  3L2Z A;  1ZBJ A;  1WJS A;  2HSE B;  2K3X A;  3OS5 A;  3OB9 A;  3H8Z A;  2CRE A;  5CIU A;  1ZX6 A;  7AT1 B;  3JCM W;  3SD4 A;  2QXF A;  2YUQ A;  2EBP A;  4C8Q C;  3CCJ Q;  5CKE A;  1JQQ A;  4XTZ A;  1WXU A;  5C6S A;  2KAF A;  2K3B A;  4JJD A;  3G1J A;  2PUO B;  1I5L A;  3KBG A;  4FW1 A;  5KYX A;  1K73 C;  3NPF A;  3OYD A;  3TU4 K;  2R5M A;  5LJ3 d;  1CSK A;  4O6J A;  1MUZ A;  3HRT A;  2PU9 B;  4FU6 A;  4J9B A;  1QWE A;  1Y7X A;  3CCL Q;  2DKG A;  1KQ2 A;  3ULR B;  4LDV A;  2E70 A;  3CCJ T;  2F1L A;  4C92 E;  2CP3 A;  2A08 A;  1RAI B;  3QWX X;  3C4S A;  3CC7 A;  1O9S A;  1GRI A;  1WJQ A;  3HFN A;  1KC8 U;  1QCF A;  2J7I A;  3OY9 A;  1N27 A;  1WA7 A;  2L3P A;  1C6V X;  2WSF E;  2XDP A;  1EZZ B;  1H64 1;  1BCM A;  1OZ2 A;  3HRU A;  2QTV A;  5KYW A;  1OOT A;  4M7A D;  4NL3 A;  4P5N A;  5GMK j;  2ZPF B;  8ATC B;  4MDW A;  1E7O A;  5KYX B;  4M77 E;  1OEB A;  2LJ1 A;  1OU9 A;  4C0G A;  3CCL T;  5FWC A;  1KSW A;  4AG2 C;  4KBM B;  2RJD A;  4ELZ C;  3QZ9 B;  1R0C B;  3MEW A;  3I5R A;  4OGE A;  3FJ5 A;  2EKH A;  2DTI A;  2M9U A;  5KCO A;  2W10 A;  3LH5 A;  1AWW A;  2KRM A;  4Z89 A;  3NTH A;  1VQL A;  2DBM A;  2YLC A;  2KE9 A;  4BE1 A;  3L2V A;  4ATO A;  3RDV A;  3TSZ A;  1KFZ A;  4A63 B;  2X35 A;  5KYW B;  1MGQ A;  4JUV A;  4R55 A;  5GAM h;  5A0G A;  3J80 E;  3UWN A;  2H3E B;  1VIF A;  4KUD K;  4M7A G;  3ME9 A;  2LQ8 A;  4HCB A;  2IVW A;  1QVF A;  4MZP A;  1E6H A;  5I21 A;  1Q82 C;  1Q95 G;  3CME Q;  4XU1 A;  3S6W A;  3SHW A;  4E7L A;  1VQ8 A;  2EYW A;  3OYK A;  1VIE A;  2HMA A;  2HQX A;  4BAC A;  1G3W A;  1GBR A;  1HYO A;  3CC2 Q;  1PG5 B;  4HT9 A;  1S72 A;  3LX7 A;  4CC3 A;  3ZBD A;  2CZ1 B;  4M7A E;  3OYJ A;  4WF2 A;  4M7D F;  2LQN A;  3VRZ A;  2DL4 A;  4OMO A;  5D6X A;  1IGU A;  4C0F A;  3RKY A;  3SEM A;  4DBR A;  1RAE B;  1P92 A;  3CME T;  1H92 A;  1UEB A;  3E2U A;  4X1V A;  5KYU B;  2ZPH B;  3CC2 T;  2QQS A;  1V1C A;  2QDY B;  2DRM A;  1X01 A;  1WHH A;  1X43 A;  4DA4 A;  1RI0 A;  2MWO A;  4A54 A;  4RTW A;  4C5G A;  4M7D A;  2X4W A;  3HTR A;  5GAO q;  1G5V A;  3MP8 A;  1R77 A;  1VQO Q;  4Z88 A;  4KGZ B;  3V8L A;  2A28 A;  5D6W A;  3OBY A;  2RM4 A;  2DER A;  1U1S A;  2KEA A;  1E6G A;  1YI2 Q;  2EYX A;  2KMT A;  2P4T A;  4IUU A;  4BI3 A;  1VQP A;  1TU0 B;  1V76 A;  3FIF A;  3BE3 A;  4R56 A;  3MPU B;  3OYG A;  5DLO A;  4BE2 A;  5FRO A;  4D6W A;  1ABO A;  2DZ9 A;  3QBY A;  2DRK A;  1VQ4 A;  4XQ3 A;  2LCC A;  1YWP A;  2JMC A;  2B8A A;  4L59 A;  3QSU A;  5CK9 A;  4DOV A;  1G8X A;  3SWN A;  3OYM A;  4FL6 A;  2M0Y A;  3FLG A;  4IUP A;  1YI2 T;  4M4Z A;  4F16 A;  4J9D A;  1C1A A;  3J7A F;  5L23 A;  4Z02 A;  1LVK A;  4CC7 A;  2MAM A;  3OYL A;  2V1R A;  3QYG B;  1UGQ B;  3QWY A;  3CCQ A;  1AWX A;  2JM8 A;  1JJ2 A;  2ZCF B;  5HKC A;  2H8H A;  2ZPB B;  2SRC A;  5GAN 3;  5GAN g;  2LQW A;  5KE3 A;  1NYG A;  1NLP C;  3I56 Q;  5LJ3 h;  2G6F X;  2HBW A;  3X25 B;  2DIG A;  3SWN B;  2KDS A;  2XMF A;  2J6F A;  2QEX T;  3BDU A;  4DEY A;  2DO3 A;  1M9S A;  1YHQ A;  2RMO A;  2ESW A;  1B34 A;  1X6O A;  5HCK A;  4GY5 A;  1YBY A;  5CQY A;  1M90 C;  1KD1 R;  2EFI A;  3UF4 A;  3EG2 A;  3ASK A;  1OX8 A;  4HVV A;  3E1S A;  2YSQ A;  3EGD B;  2CGH A;  4M75 D;  1VUB A;  5J39 A;  1YIJ A;  4BY6 B;  4XTY A;  2BTT A;  2EQJ A;  1JJ2 S;  4PLL A;  3I56 T;  3SDZ A;  2YDL A;  3MEA A;  2EKO A;  2QQ9 A;  3H0H A;  4E7J A;  3S3N A;  2A0F B;  2CUB A;  4LUD A;  1W70 A;  2P4R A;  3GOX A;  2L3Q A;  2X3W D;  1EFN A;  4X9C A;  1K0S A;  2E5Q A;  1VQ5 A;  3CCU A;  4J83 A;  4ZGE B;  4M78 D;  4A4G A;  3LGF A;  3OMC A;  3T9N A;  2KXD A;  4F7U A;  1H8K A;  2CZ0 B;  5FRM A;  1FMV A;  3PIO A;  1JB0 E;  1YIT A;  1B34 B;  3VRY A;  3I55 A;  2KY9 A;  5CKB A;  2E10 A;  3D7S B;  1YCY A;  3H41 A;  1Q7Y R;  3TRE A;  2D0N A;  3RUX A;  4O5V A;  5I2M A;  3OS0 A;  4M75 G;  2E5K A;  1V29 B;  3IQL A;  5CVI A;  1BCO A;  1WX6 A;  1N6A A;  3LLR A;  4EPC A;  2RK1 A;  1LNX A;  2LT4 A;  2V8K A;  1J3T A;  2H3J A;  4PJJ A;  4FYY B;  3URG A;  1WNL A;  1D0Z A;  3JCM e;  2DIQ A;  2AK5 A;  2K3Y A;  2KK4 A;  4F7U B;  2K4Y A;  2XKO C;  2JTE A;  1MMG A;  2KRO A;  4M78 G;  4MZT A;  2ZAE A;  1VQK A;  2QA4 A;  3VU3 C;  4CI0 C;  2RJF A;  3HHT B;  1PKS A;  1UTI A;  2JN0 A;  1G3T A;  1W2B P;  1I1J A;  3G71 Q;  2JOY A;  3FJP A;  1PRM C;  4HVU A;  3VS0 A;  2DXB A;  2YRC A;  3BW1 A;  4L6V 5;  1M4Z A;  2JMA A;  3OYN A;  3ZL7 C;  2DBK A;  3JB9 D;  3CC4 Q;  2V26 A;  4M7D C;  1NJI C;  1NEB A;  3G6E A;  3GLX A;  4DQ2 A;  2Y4X A;  3DB4 A;  5CO7 A;  5IT9 E;  2VVK A;  4IUR A;  1RAG B;  1N8R U;  2OTJ A;  4MML A;  3EGU A;  1PNJ A;  2DF6 A;  3QJY A;  2PVG B;  1BIA A;  4FSX A;  2RQT A;  1K9M U;  2SEM A;  3CCM A;  3KUF A;  2EGA A;  2WSC E;  1M1K C;  1VOM A;  3VUZ A;  3CC4 T;  3TVT A;  4EMG A;  4PJM A;  2ECZ A;  3OYA A;  1KC8 R;  1M3B A;  1JXO A;  3NMZ C;  2A36 A;  3RR6 A;  4PJO D;  1WHM A;  3JB9 G;  1GCQ A;  4M7D E;  3VS2 A;  3SWN C;  2RI5 A;  3DLL A;  4OP0 A;  3TEE A;  2FG0 A;  5FU6 B;  4FYX B;  2Y4Y A;  4PLI A;  1OYX A;  5FU7 B;  2AKK A;  1ZHI A;  2GQV A;  3WVD B;  1QKW A;  1AVZ C;  1YJW A;  3JCM P;  1PC0 A;  4BY6 C;  5GAN 7;  1X69 A;  3OYC A;  1VQ9 Q;  4OGC A;  5GAM e;  1U3O A;  3NGP A;  2DAQ A;  5GMK h;  1PKT A;  1VQ7 Q;  2Z0W A;  2LVM A;  3CQT A;  1RI9 A;  2E12 A;  4PJO G;  2CP5 A;  2RQW A;  4IUQ A;  4LN2 A;  5FLX E;  1ZA2 B;  1D09 B;  1RAC B;  3A8L B;  4NS5 A;  1UG1 A;  3JCM c;  8AT1 B;  2J6O A;  1TH7 A;  2MPX C;  3MET A;  5GJV B;  2XG8 D;  2MK5 A;  1MMD A;  5GAN f;  2OI3 A;  1OQK A;  4A4K A;  4RUG A;  5J3B A;  1LOJ A;  2CZ6 B;  1K73 U;  1D1A A;  2RQV A;  1K9A A;  1SHF A;  1QLY A;  1Q81 U;  4DEX A;  4N4H A;  3FEO A;  1VQ9 T;  2HEQ A;  4QQD A;  3PGG A;  4RTY A;  4C92 D;  1VQ7 T;  1UEC A;  1KHI A;  3M0P A;  4ELY C;  1FMW A;  3CPF A;  3FRN A;  2K2V A;  4C8Q D;  2GNC A;  3JRZ A;  1ZSG A;  2L8D A;  3CCR A;  3G4S A;  1D1B A;  2DET A;  5GAN d;  1PHT A;  4LD6 A;  1MMA A;  1YFN A;  2CUD A;  3EHR A;  2WAC A;  3M0R A;  4OMP A;  4M77 D;  3V7S A;  1I07 A;  3CCJ A;  3UDC A;  1GBQ A;  2FB7 A;  3OS1 A;  1OPL A;  2EJF A;  2AKL A;  3QII A;  4QT7 A;  2VUB A;  2MOX A;  3DB3 A;  3HL8 A;  2K5F A;  1G2B A;  1IGQ A;  1QP3 A;  1I8F A;  2JW4 A;  1PSF A;  4C92 G;  3P8B B;  1GFC A;  2DXC A;  1VQM A;  1ABQ A;  2PVD B;  2JJ9 A;  3FB9 A;  3CCV A;  3KFV A;  1QQJ A;  3PVQ A;  4LD9 K;  4ZGJ B;  4C8Q G;  1U06 A;  3C95 A;  4J9E A;  2RNA A;  2O88 A;  2ZPI B;  1Q81 C;  1MV3 A;  5I2S A;  4PFO A;  1WHG A;  2BUD A;  3L42 A;  5IHI A;  3M5A A;  3E9G A;  1K8A C;  4M77 G;  1ACM B;  4MMK A;  1DJ7 B;  2CT4 A;  5LJ5 e;  1Y71 A;  2D0Q B;  4RCB A;  2BE7 D;  5CKH A;  3CCS Q;  2L89 A;  1Y57 A;  1Q82 U;  2RD1 A;  1ZBX A;  4C8Q E;  3C0C A;  3PMT A;  1BK2 A;  3PNW C;  3JB9 I;  2HQH A;  1K4U S;  3M57 A;  2QQB A;  1QP2 A;  4AFS C;  6AT1 B;  4A4E A;  4JS5 A;  2MIO A;  4BD3 A;  5GAN 8;  1UGP B;  1X27 A;  5A0L A;  2DVJ A;  1Q86 C;  3PFS A;  3CBM A;  5KE2 A;  5LJ3 e;  3VS6 A;  3CC7 Q;  1NPR A;  1U5S A;  2OAW A;  3EH2 A;  3CCS T;  1QVG P;  1AT1 B;  3QPH A;  2JVV A;  2K9G A;  2DYI A;  5L8R E;  3PIP A;  3PMI A;  4BDZ A;  4RCC A;  4UC4 A;  1UUE A;  4BUG A;  4RMO A;  2CP2 A;  3MHX A;  3RMS A;  4DBF A;  1FMK A;  1TG0 A;  3GIB A;  1NG2 A;  3RNJ A;  1G3S A;  1XTD A;  3ER0 A;  3OSV A;  4IKF A;  4JRK A;  2KGT A;  5FW9 A;  4RTU A;  1JU5 C;  2VGM A;  5FRN A;  4JLI A;  3A5Z B;  2DL3 A;  3SB2 A;  1GCQ C;  3CC7 T;  1IRE B;  3VS3 A;  5KYU A;  1K76 A;  3EAE A;  4M75 A;  5D7U A;  1X6B A;  1H3H A;  4BI4 A;  2J05 A;  2RH2 A;  1VQL Q;  4Y91 A;  3S3M A;  2LNH B;  1SSH A;  2VC8 A;  3UT1 A;  2O31 A;  2CP7 A;  1YJN A;  4XTW A;  4KRT A;  4J9F A;  4RTZ A;  1RAB B;  2GFA A;  5A2Q E;  1ZSZ B;  1TUD A;  4XU2 A;  1GFD A;  1WLP B;  4M78 A;  1M3C A;  4RKU E;  2ZPE B;  2MYS A;  4HCC A;  2CP6 A;  2JS0 A;  4IIO A;  1LCK A;  3LYI A;  2JUF A;  2PTK A;  1WZO A;  4FCY A;  1ZUU A;  1UE9 A;  4PNO A;  1VQL T;  1VQ8 Q;  3DKM A;  3OQ5 A;  4M75 B;  4AFQ C;  1FWZ A;  1MHN A;  2QGG A;  4QQ6 A;  2FPD A;  1S72 Q;  2ZGW A;  3HSB A;  4JRI A;  3OYB A;  1JO8 A;  2ZPG B;  2E41 A;  2KT8 A;  2KRN A;  1WIE A;  4CRI A;  2L2P A;  2CH4 W;  2CP0 A;  2LMJ A;  1XJW B;  5DLQ E;  2BE9 B;  3JCM J;  1RAH B;  2DE0 X;  3M58 A;  3M4G A;  3JCM b;  1R0B G;  4IUV A;  2DTH A;  1UGS B;  4M78 B;  2DJZ A;  5HK0 A;  1VQ6 A;  1SF9 A;  3CCE A;  4J6Y A;  4J5Y A;  4HA8 A;  3QHS A;  2AZS A;  1QMC A;  4E6R A;  1K0X A;  4HKE A;  1M3A A;  1RAF B;  1W6X A;  3A8O B;  3I9Q A;  4XTU A;  1M8V A;  3VS1 A;  3WVE B;  4X9D A;  3NHN A;  1M90 U;  9ATC B;  2BZX A;  1VQN A;  3WXM B;  5GAN h;  2KVQ G;  3EFR A;  2E65 A;  3PT9 A;  4HXJ A;  1M5Q 1;  2E6Z A;  3TCJ A;  2DD4 A;  1VQO T;  4PFP A;  2M16 A;  4LE9 A;  2DIL A;  2QEX A;  2RHX A;  2JTF A;  3M4Y A;  2DA9 A;  2QDL A;  1W2B A;  2OTL Q;  2F2X A;  3C94 A;  2K7A A;  2LJ0 A;  1SPK A;  1VQP Q;  2HCK A;  3RKX A;  5IHK A;  4OML A;  1WQ7 A;  5M9O A;  4NL2 A;  1TUC A;  3U23 A; 
#chains in the Genus database with same CATH homology
 2EVR A;  3EHQ A;  4GLM A;  1PRM C;  1M30 A;  4HVU A;  3VS0 A;  1AEY A;  2GGR A;  2DNU A;  2YUN A;  5FWB A;  1M27 C;  2FEI A;  4AFU C;  2GBQ A;  3I5S A;  2JMA A;  1UJ0 A;  1MV0 B;  2GQI A;  3M0Q A;  3ZL7 C;  1YWO A;  2DBK A;  2D8H A;  2F2W A;  2L3S A;  2NWM A;  4IIM A;  1Z9Z A;  1T3S A;  3H0F A;  1NEB A;  3UAT A;  1X6G A;  2EGE A;  4Z8A A;  1B3Q A;  2VVK A;  2DL8 A;  3EGU A;  1ZBJ A;  2LZ6 B;  1PNJ A;  1YN8 A;  2CRE A;  2W0Z A;  1ZX6 A;  2DF6 A;  1RLQ C;  1KIK A;  2ED1 A;  2YUQ A;  2JM9 A;  2EBP A;  2RQT A;  2SEM A;  2EGA A;  1JQQ A;  1WXU A;  2DL5 A;  2K79 A;  2K3B A;  3TVT A;  2ECZ A;  4JJD A;  1M3B A;  1NEG A;  2D8J A;  1JXO A;  1T3L A;  3NMZ C;  1AOJ A;  2A36 A;  1VYU A;  1GCQ A;  4F17 A;  3VS2 A;  1HSQ A;  3NPF A;  2FPE A;  1CSK A;  2FG0 A;  1MUZ A;  4J9B A;  1QWE A;  2AKK A;  3ULR B;  1WDX A;  1WFW A;  1QKW A;  2DLP A;  3VS4 A;  1AVZ C;  2A08 A;  2EYZ A;  3QWX X;  2FRW A;  1GRI A;  1WYX A;  3RBB B;  2KNB B;  1QCF A;  1I0C A;  1X69 A;  2J7I A;  3A98 A;  1WA7 A;  3H0I A;  5IH2 A;  4J9G A;  2L3P A;  2JXB A;  1U3O A;  3NGP A;  1PKT A;  1OOT A;  1SRM A;  1GCP A;  2KT1 A;  2DM1 A;  3CQT A;  1RI9 A;  4RTX A;  1E7O A;  4CC4 B;  1OEB A;  2LJ1 A;  1ZLM A;  2RQW A;  2DX1 A;  4LN2 A;  5FWC A;  1KSW A;  4AG2 C;  1UG1 A;  2J6O A;  4LNP A;  3I5R A;  4F14 A;  5GJV B;  3FJ5 A;  2EKH A;  2LJ3 A;  2FPF A;  1YCS B;  2OI3 A;  4K11 A;  4OMN A;  2W10 A;  4RUG A;  3LH5 A;  1NYF A;  2RQR A;  2KRM A;  1AWW A;  2RQV A;  1K9A A;  1SHF A;  1QLY A;  4DEX A;  4Z89 A;  1VYT A;  2DBM A;  2HEQ A;  1X2K A;  2KE9 A;  4RTY A;  1UEC A;  2ED0 A;  3TSZ A;  3M0P A;  4WCI A;  1KFZ A;  4A63 B;  2LCS A;  5IHN A;  2VWF A;  2GNC A;  1JXM A;  1G83 A;  4RTT A;  1ZSG A;  3R6N A;  2DJQ A;  1CKA A;  2RQU A;  3EG0 A;  1PHT A;  2CUD A;  2BZ8 A;  1E6H A;  3EHR A;  1A0N B;  1N5Z A;  3M0R A;  4OMP A;  1ARK A;  3SHW A;  4EIK A;  1I07 A;  2EYW A;  4ORZ A;  1GBR A;  1GBQ A;  4OMM A;  1OPL A;  2AKL A;  4QT7 A;  2O2O A;  2MOX A;  2KRS A;  4D8K A;  1XOV A;  2YUO A;  4CC3 A;  2F2V A;  1G2B A;  1B07 A;  1WXT A;  2CDT A;  2JW4 A;  2LQN A;  3VRZ A;  5I22 A;  1GFC A;  2DL4 A;  4OMO A;  1ABQ A;  2CT3 A;  3SEM A;  3KFV A;  4AG1 C;  3PVQ A;  1W1F A;  1U06 A;  5IXF A;  1UJY A;  4J9E A;  3EG1 A;  4AFZ C;  1H92 A;  2RNA A;  4X1V A;  2O88 A;  1RLP C;  2LP5 A;  2DMO A;  1MV3 A;  3O5Z A;  5IHI A;  1V1C A;  2FO0 A;  1ZUK A;  1X43 A;  1CKB A;  2DRM A;  2O9V A;  2CT4 A;  2RF0 A;  4RTW A;  2KYB A;  1Y57 A;  1UHF A;  4Z88 A;  1UDL A;  2C0T A;  4R0K A;  3C0C A;  2PNI A;  1BK2 A;  2A28 A;  1GL5 A;  2YUP A;  1K4U S;  4J9C A;  2OJ2 A;  2LX7 A;  2KEA A;  1E6G A;  2KXC A;  2EYX A;  4GBQ A;  4AFS C;  1RUW A;  2MIO A;  1NLO C;  3M0U A;  1X27 A;  2DVJ A;  5ECA A;  2KR3 A;  2KYM A;  3M0S A;  2CSQ A;  1ABO A;  3VS6 A;  1U5S A;  2OAW A;  2DRK A;  2K9G A;  2GTJ A;  1AZE A;  2EQI A;  2EGC A;  1YWP A;  2JMC A;  3PE0 A;  5I11 A;  1AZG B;  4JPB W;  1UUE A;  4JJB A;  2M0Y A;  2RPN A;  1FMK A;  1TG0 A;  1X2Q A;  3UA6 A;  1NG2 A;  4M4Z A;  3RNJ A;  4J9D A;  4F16 A;  1ZUY A;  2J6K A;  1AWJ A;  2B86 A;  5L23 A;  4Y92 A;  2KGT A;  4CC7 A;  2J06 A;  1Z9Q A;  5FW9 A;  2V1R A;  4RTU A;  1FYN A;  1JU5 C;  2A37 A;  4JJC A;  2ROT A;  3QWY A;  2DL3 A;  4HVW A;  1SRL A;  1AWX A;  1GCQ C;  2C0O A;  1K1Z A;  2JM8 A;  4OMQ A;  3EG3 A;  2EYY A;  4FSS A;  3GBQ A;  2H8H A;  3VS3 A;  2SRC A;  1K76 A;  4CC2 A;  2VKN A;  2X3X D;  2LQW A;  1X6B A;  1NYG A;  1H3H A;  3I35 A;  1NLP C;  2J05 A;  2LNH B;  2G6F X;  1SSH A;  1S1N A;  2HBW A;  2O31 A;  1UHC A;  1VA7 A;  1SHG A;  3REA B;  2DL7 A;  2HDA A;  2D1X A;  3REB B;  1HD3 A;  4KRT A;  5GJW B;  4J9F A;  4RTZ A;  1OV3 A;  2XMF A;  3TSW A;  2J6F A;  4DEY A;  2I0N A;  1TUD A;  3PVL A;  1YP5 A;  3VS5 A;  4J9H A;  5IXB A;  2RMO A;  2ESW A;  1GFD A;  5HCK A;  1WLP B;  1M3C A;  1HJD A;  1VYV A;  1BBZ A;  1AWO A;  2GTO A;  2JT4 A;  1SEM A;  2ENM A;  1BU1 A;  2JS0 A;  3EG2 A;  4IIO A;  3UF4 A;  2CSI A;  1LCK A;  4HVV A;  1QKX A;  1T0J A;  2DYB A;  2YSQ A;  2PTK A;  1UFF A;  2O9S A;  2BTT A;  4ESR A;  2RN8 A;  1ZUU A;  1UE9 A;  2YDL A;  4JZ3 A;  3H0H A;  3VS7 A;  3THK A;  4ZNX A;  2CUB A;  2P4R A;  1W70 A;  4LUD A;  4AFQ C;  2L3Q A;  2X3W D;  1EFN A;  2FPD A;  1JO8 A;  1WI7 A;  4HCK A;  2EPD A;  2K6D A;  1K0S A;  1M8M A;  1AD5 A;  2KT8 A;  2KRN A;  1WIE A;  2FRY A;  2L2P A;  2CH4 W;  2LMJ A;  2DE0 X;  2HSP A;  2KXD A;  1H8K A;  1NM7 A;  4J9I A;  1Y0M A;  2L0A A;  4RTV A;  3VRY A;  2YT6 A;  3M0T A;  4D8D A;  1T0H A;  2MCN A;  2AZS A;  3H41 A;  4E6R A;  2C0I A;  2NUZ A;  1K0X A;  5EC7 A;  2D0N A;  1PRL C;  2JS2 A;  1M3A A;  1W6X A;  2E5K A;  1QWF A;  2K2M A;  3I9Q A;  3IQL A;  3VS1 A;  1WX6 A;  2KBT A;  2CH4 A;  3NHN A;  2EW3 A;  1PWT A;  2AZV A;  1JEG A;  2BZX A;  3UA7 A;  2ABL A;  4HXJ A;  1J3T A;  1BB9 A;  2PZ1 A;  2ROL A;  4LUE A;  1UGV A;  2DIL A;  4LE9 A;  1OPK A;  2AK5 A;  3JV3 A;  2JTE A;  2KRO A;  2DA9 A;  2QDL A;  1WXB A;  2F2X A;  2K7A A;  2LJ0 A;  1SPK A;  1KJW A;  2BZY A;  2V1Q A;  2HCK A;  2M51 A;  4JZ4 A;  5IHK A;  4OML A;  1IO6 A;  1PKS A;  1UTI A;  1TUC A;  2IIM A;  1YNZ A;  3U23 A;  1I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...