3RBBB

Hiv-1 nef protein in complex with engineered hck sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
EDIIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformation of the Dileucine-Based Sorting Motif in HIV-1 Nef Revealed by Intermolecular Domain Assembly.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Viral protein, protein binding
molecule keywords Protein Nef
total genus 12
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rbbB00
2ROTA 4EIKA 2CSQA 1AVZC 2B86A 4A63B 2A08A 4JPBW 1K9AA 2MIOA 2D8HA 4ESRA 1I07A 1MV0B 2CUDA 2FEIA 1JXMA 2AK5A 4CC3A 2FPFA 3FJ5A 3UA6A 1UJ0A 1UHCA 2KT8A 1HSQA 2EBPA 4OMNA 2KYMA 3SEMA 1PRLC 2XMFA 1LCKA 3VS2A 2X3XD 1G83A 1T0JA 2DL5A 1AZGB 2EVRA 2I0NA 2RQUA 1UUEA 3VS6A 3PE0A 4CC7A 4AG1C 1KIKA 3EHRA 1K4US 1CSKA 3VS5A 2YSQA 2H8HA 1V1CA 1AWJA 4HVWA 1YWPA 2LJ0A 2JS0A 3M0TA 3TSZA 4D8DA 1GCQC 3VS1A 4WCIA 2YDLA 2ED1A 2SRCA 1NLPC 1WDXA 2MOXA 5L23A 4LUDA 1CKBA 4AFQC 2D0NA 1QCFA 1OPLA 3A98A 1JQQA 1EFNA 1PWTA 1WYXA 2LJ3A 4IIMA 1H8KA 1SRMA 1SHGA 2EGEA 5EC7A 2SEMA 1NM7A 2DE0X 3M0UA 2JW4A 2MCNA 2LQWA 1T3SA 1QKWA 2LZ6B 2OJ2A 3EHQA 1GL5A 1WI7A 4AFZC 2L3QA 2JS2A 1AOJA 1U3OA 2AZVA 4AFSC 1WLPB 2K7AA 2C0OA 2O88A 1UHFA 2LNHB 4HVUA 2O9VA 1BB9A 1WXTA 1ZBJA 1QLYA 1KFZA 1NYFA 1SPKA 2VWFA 2EKHA 1PNJA 2DF6A 2K3BA 1K0SA 1ABQA 3VS7A 1SRLA 1IO6A 2F2WA 3LH5A 4J9GA 3PVQA 2EW3A 3H0FA 3SHWA 1UECA 4QT7A 1SHFA 5IXBA 1E6HA 1K76A 4J9DA 3M0QA 2G6FX 1QWEA 1H92A 3C0CA 2L2PA 1X6GA 2KGTA 3QWYA 1M3BA 2VKNA 2FRYA 4AG2C 1AWWA 1U06A 4CC2A 2A37A 2RQTA 2KRNA 3EG2A 2C0TA 1W70A 3UF4A 2KBTA 1NG2A 1ARKA 2J6FA 2KE9A 1AWOA 2RMOA 1YCSB 2KT1A 2HEQA 2J7IA 1RLQC 2EYXA 1M3AA 4RUGA 1JO8A 1X2KA 2M51A 2NWMA 1ZUYA 1AZEA 4F16A 1X6BA 5FWCA 2DBKA 4ORZA 2ROLA 1WXBA 1T3LA 2O31A 2LQNA 4JZ4A 4AFUC 1H3HA 1X43A 3I35A 2J6OA 1TUCA 4M4ZA 2DX1A 2D1XA 2JMCA 3I9QA 4RTUA 1AD5A 1AEYA 2JXBA 2L3PA 2K79A 1VYTA 1M8MA 1Y57A 2J05A 2DMOA 2DNUA 3R6NA 1B07A 2M0YA 2KXDA 1G2BA 4CC4B 2EYYA 2RNAA 1N5ZA 1OEBA 2J06A 1GRIA 1WIEA 5FW9A 2VVKA 1WX6A 4DEYA 3NHNA 2KEAA 1W1FA 4Z89A 2DILA 1BK2A 1NEBA 1T0HA 3ULRB 1UDLA 2KNBB 1PRMC 1K1ZA 1UGVA 3JV3A 1NEGA 3I5SA 2RF0A 2F2XA 2EPDA 3THKA 2NUZA 2YT6A 1TG0A 2EQIA 1VYVA 2JTEA 1FMKA 3H0IA 4J9FA 1ABOA 3VS3A 4OMLA 4RTYA 1UJYA 2E5KA 1QKXA 1RLPC 3KFVA 1GBRA 4J9BA 2GTJA 2YUPA 1ZUUA 5GJVB 2W0ZA 4IIOA 2BZ8A 2JT4A 1X27A 2FPEA 2JM8A 4J9HA 2KXCA 4LNPA 2GNCA 1ZLMA 1M27C 2CREA 2C0IA 4JJBA 4LUEA 2BZXA 4R0KA 2EGAA 4E6RA 3U23A 3REAB 1BBZA 4LN2A 1YNZA 3PVLA 1FYNA 4F17A 3M0PA 2DA9A 3H0HA 1NYGA 2CSIA 1OPKA 4RTXA 2RQRA 2OAWA 2KR3A 2GTOA 2DJQA 2EYZA 3VRZA 2AKLA 2F2VA 5IHIA 1JU5C 2CT3A 4RTVA 2ESWA 1SSHA 2FG0A 2LJ1A 1KJWA 2CUBA 4FSSA 2KYBA 5HCKA 2YUQA 1UE9A 4HVVA 1X2QA 2OI3A 3RBBB 1GBQA 4KRTA 1KSWA 2JMAA 3EG1A 1WXUA 4HCKA 4OMPA 1TUDA 3VS0A 1BU1A 5I22A 1B3QA 2ABLA 2HDAA 4HXJA 1UG1A 1M3CA 2DBMA 2V1QA 1GFCA 1HD3A 1W6XA 3H41A 2FPDA 4RTZA 1E6GA 4LE9A 1Z9QA 3M0SA 2KRSA 4OMOA 1J3TA 2AKKA 1PKTA 1HJDA 2EGCA 2RQWA 3RNJA 5IXFA 2LP5A 2CT4A 2DM1A 2CDTA 2KRMA 3IQLA 2YUOA 1MV3A 1PHTA 4GBQA 4JJCA 1A0NB 1OV3A 2QDLA 1UTIA 1UFFA 3TVTA 2EYWA 1VYUA 2O9SA 1YP5A 4OMMA 2DVJA 4X1VA 4ZNXA 2PTKA 4JZ3A 1MUZA 1Y0MA 2LX7A 2A28A 1NLOC 1U5SA 2ECZA 1VA7A 5IHKA 3NMZC 2RPNA 3EG3A 2ENMA 2DYBA 1GCPA 2GGRA 2K2MA 1M30A 1YWOA 3VRYA 4RTWA 4RTTA 4Z8AA 2JM9A 1ZX6A 2ED0A 2HCKA 2IIMA 1RI9A 5ECAA 1ZSGA 1Z9ZA 2P4RA 2KROA 3I5RA 1S1NA 2YUNA 2FRWA 3EG0A 1X69A 1WFWA 2CH4A 1PKSA 2HBWA 2W10A 2HSPA 4GLMA 5IHNA 2K9GA 2BZYA 2PZ1A 3EGUA 1JEGA 2A36A 1JXOA 4F14A 2LMJA 2FO0A 2O2OA 2CH4W 2DL3A 2DRKA 2J6KA 2DL7A 2GBQA 2PNIA 2K6DA 1K0XA 2DRMA 1I1JA 4JJDA 3ZL7C 1I0CA 3NPFA 1CKAA 3TSWA 4Y92A 4J9CA 2BTTA 3QWXX 5GJWB 1AWXA 2AZSA 2DL4A 2L3SA 4J9IA 2RQVA 3CQTA 1XOVA 1GCQA 1SEMA 3M0RA 2GQIA 5FWBA 3VS4A 1GFDA 1QWFA 4K11A 3UATA 4D8KA 4J9EA 3UA7A 3GBQA 1YN8A 3NGPA 5I11A 2DLPA 3REBB 2DL8A 4OMQA 2LCSA 2V1RA 1RUWA 3O5ZA 4DEXA 5IH2A 2D8JA 2X3WD 1OOTA 1WA7A 1ZUKA 4Z88A 1E7OA 2L0AA 2RN8A
chains in the Genus database with same CATH superfamily
2ROTA 2LX9A 2CSQA 4OMFB 1Q7YR 4A63B 4JPBW 2HKNA 3M58A 2MIOA 2B8AA 1ZHIA 2DTOA 2FEIA 5LJ5f 2FPFA 1F1BB 2DERA 3UA6A 1O9SA 1UJ0A 2EBPA 1W2BP 4C8QE 2PVOB 3L2VA 3H9NA 2ZZDA 4C92F 3OS0A 1G83A 1T0JA 2DL5A 4OB1B 5CK9A 3M4GA 4MZPA 3FLGA 4JRIA 4L5GA 1UUEA 3VS6A 3PE0A 2E6ZA 4CC7A 4XU3A 4AG1C 5AYFA 1BIBA 5J3BA 1VQOA 1KIKA 1QVFA 2VXEA 1CSKA 3CC2A 2E41A 9ATCB 4XTZA 4Q5WA 1VQNA 1WGSA 4HVWA 1YWPA 2JS0A 4D8DA 2M1HA 4DBQA 4WCIA 2GCXA 1WDXA 3C95A 2Y4YA 3JCMd 2IPOB 3SFMA 3TREA 3OYNA 1JQQA 1EFNA 1WYXA 1C6VX 1SHGA 2SEMA 3PFSA 2DE0X 4FT2A 1M4ZA 1WQWA 1OU9A 2JW4A 2LQWA 3HRSA 4B9WA 4ZGDB 2G3RA 1U3OA 3PTAA 4OB2B 2KAFA 1K73R 1UHFA 2LNHB 3TCJA 2X4WA 3INZA 4HVUA 4LDUA 1WXTA 1VQ7T 1JJ2P 1BCMA 1NYFA 1SPKA 4LXCA 2KDSA 1PNJA 3CCEQ 4F7UE 5KYWA 2K3BA 2WSFE 1M90R 3QG1A 3SWNB 1UB4A 3R6OA 2XKOC 1IO6A 2F2WA 5FRNA 4FU6A 2RO0A 4OB0B 5KE3A 4PJOA 4M7AD 2YLBA 3OS2A 4AG2C 3JSCA 3EGXA 1U06A 4B9XA 4XAXB 1K9MR 2QEXT 4M7DF 2HQHA 1BIAA 3I55T 2C0TA 3JB9F 5D6WA 3S6WA 4BE2A 3UF4A 1C1AA 3OQ5A 4NL3A 1N8RU 2KY9A 4A4FA 4C0FA 3L2RA 2E12A 1ARKA 3E2UA 2KE9A 4DOVA 2EKOA 2LRQA 3CBPA 3M4YA 2PUOB 2V8IA 3CCJQ 1QVGP 2KT1A 1RLQC 2QEXQ 1Y96A 1BYMA 4E7IA 1M1GA 1X2KA 2NWMA 1B34A 5FWCA 2DBKA 5KYUB 1WXBA 1T3LA 3OSSC 3RERA 3BDLA 4OF1A 3SWNA 4A4EA 3FDRA 3CMET 4BI8B 5LL6S 1LNXA 2HL3A 2J6OA 3VU3C 1TUCA 2HZYA 2DX1A 2D1XA 2JMCA 3I9QA 2H3EB 4EMHA 2D9TA 3UPUA 1KD1C 4EMKB 1AHJB 3I56T 3FEOA 2EYYA 4PJNA 1FMWA 2J06A 1GRIA 2X4XA 3RIRA 2VVKA 4J6WA 4A4GA 4VUBA 2KEAA 1W1FA 2QQ9A 2DETA 1BK2A 1NEBA 1K1ZA 2RF0A 3O8VA 4QQ6A 3RESA 8AT1B 3THKA 2NUZA 4M75C 2EQIA 1W2BA 3QDRB 4RCCA 3GF5A 5CQYA 3HSBA 1FMVA 3H0IA 2RM4A 2LNVA 2CP6A 4OMLA 4RTYA 3CMAA 4PJOB 1YJNQ 3GNFB 2FZGB 4J9BA 1ACMB 3I56Q 1I5LA 4DQ2A 2JUFA 3OYCA 3E1SA 4IIOA 1X27A 2KXCA 3CD6A 1OX8A 4E7JA 3RMQA 1ZLMA 3A5ZB 1VQ4Q 1ZSZC 2C0IA 4JJBA 2XDPA 2EGAA 4E6RA 3U23A 5A0DA 5LJ3e 4LN2A 3PVLA 2ATCB 1Y07A 1D3BA 1QMCA 2LCLA 2VUBA 3X20B 1N27A 1I8FA 4PFPA 2NUPB 2P84A 2RQRA 4HKEA 2KR3A 2GTOA 1YITQ 1K8AC 1JU5C 2FHDA 1M90U 4N0AA 2ESWA 1G3WA 5KYYB 3CC7T 2KYBA 3QZ5B 4J7IA 3FIFA 5HCKA 1M1FA 4KRTA 2JMAA 2HBPA 1KQSA 1TUDA 2KSSA 2ABLA 2NUTA 2V1QA 2PQWA 1HD3A 3OYIA 4HA8A 5I2MA 1I4K1 2ZPIB 1E6GA 4OMOA 4E7LA 3QZ9B 2DEUA 1M5Q1 1MGQA 4HCZA 1HJDA 1VQPA 2FVUA 2DM1A 4MMKA 1S72A 1Q86R 3V8KA 4JJCA 4RKUE 1OV3A 4MDXA 1UTIA 3TVTA 1Q81U 2O9SA 4OGCA 4PK4A 2EJFA 4M78C 5KE2A 1NLOC 1BCOA 2QTVA 1U5SA 5GAN8 3QJ6A 3CMEQ 2DXBA 3A8OB 3PMIA 1VQMQ 1VQ5T 2RPNA 3CCQT 2K2MA 3OY9A 3PMTA 2Z0WA 2P0QA 1YCYA 1VQKT 3ZFJA 1MMDA 1OULA 4RG8A 4M7DC 2HCKA 1ZSGA 1Z9ZA 2P4RA 3QJYA 2KROA 3I5RA 2DJZA 1M9SA 2E1HA 1X69A 2DIQA 3OA6A 4LDYA 1WFWA 2CH4A 2YHTA 4QVDA 1W2BS 3X25B 2HBWA 1K73C 2K9GA 2BZYA 3EGUA 4XTVA 3URGA 5GAN2 4EPCA 4F14A 2V26A 4M77D 2JN0A 5IN1A 3ASKA 1VUBA 1M90C 1YJ9A 2DL3A 2DRKA 2J6KA 2PNIA 2K6DA 3RMSA 1I1JA 3RR6A 3ZL7C 2EWNA 1RAIB 1H3ZA 5A0GA 3TSWA 4C5EA 3LWIA 2L5QA 2QQBA 2DXCA 2CKKA 3PIPA 1X01A 1AWXA 4KGZB 4JLIA 3SDZA 2LTOA 4J9IA 3CQTA 4FYYB 1VIFA 5FWBA 1KQSP 1QWFA 1TU0B 2XDBA 3G4SA 1RACB 1B7TA 3OYKA 5FU7C 3NGPA 3EAEA 2XIDA 3REBB 2K3YA 1YJWQ 4LDVA 1YHQA 4R56A 2LCSA 4PFZA 1UGQB 2QQRA 4BB7A 1RI0A 2CP5A 1U1TA 4M77B 1V29B 1OOTA 2GFAA 3OS5A 4XTYA 1UEBA 2MMPA 1KC8C 2RI3A 2LQ8A 2DFUA 3CMAQ 3F70A 1V76A 4ZN1A 3VV0A 4HT8A 4IUQA 4XK8E 1LOJA 4PJOC 3Q1JA 1JXMA 2AK5A 3G4ST 2HMAA 2EAYA 1MMNA 3CMAT 4PJMA 4E7ZA 2K57A 4C92C 1UHCA 4OMNA 3S3MA 3SEMA 4M7DG 3CPFA 1PRLC 5LJ5g 2XMFA 1LCKA 3VS2A 2X3XD 4ZN3A 4M7AB 5GAOr 2AT1B 3GNGA 4F7UF 2ZPBB 2RQUA 1U8RA 2DK3A 1Q81R 2P4TA 1K4US 5GMKh 3VS5A 3CCQQ 1PD0A 1VQMT 2KI7A 1VQ5Q 3MKDA 1OX9A 1NJIU 1AWJA 3CC4T 2LJ0A 3M0TA 2DO3A 5HY6A 1VQNT 1WJQA 2V8JA 2XG8D 1D1BA 1H641 2MOXA 5LJ3h 5GMKl 4LUDA 1CKBA 3CCQA 2D0NA 1QCFA 1VQLT 5LJ3g 5FROA 3NTIA 4C8QC 2P0PA 5KYUA 1OPLA 1WZOA 3SWNC 1IHVA 2LJ3A 4IIMA 2AHJB 1SRMA 2BE7D 3EG9A 4DBHA 1NM7A 2AIRB 3N5BB 4M7AA 3M0UA 4GY5A 2CP7A 3OS1A 2MCNA 2RHZA 1T3SA 3CCUT 4QQDA 2OJ2A 1EZZB 1WI7A 2NUPA 5GAMf 2L3QA 2JS2A 1VQ9Q 4J7FA 1WLPB 2K7AA 2EQMA 2C0OA 2O88A 3L42A 2O9VA 2X35A 4PJLA 4Y28E 1QLYA 3CCVT 3OYBA 3DKMA 4A54A 5GAN4 2XICA 5EG2A 2DTHA 1SRLA 2O4XB 4E47A 3M55A 4PFOA 2EW3A 3JB9D 2DIGA 4QT7A 5GAOm 5IXBA 4J9DA 1K76A 3M0QA 2ZPHB 2G6FX 4M78G 1H92A 3OW2A 2VKNA 2FRYA 1SG5A 1AWWA 2CYZB 2A37A 3EG2A 1YHQQ 3D7SB 4E7HA 1W70A 3JAME 4N4GA 3V7CA 2D6FA 1P92A 1WHKA 3I55A 3LWHA 1RABB 4OVAA 1AWOA 5KYXB 3A8GB 1YCSB 3SD4A 4JUVA 1VQ4T 2J7IA 2EYXA 4QKUA 3HRUA 1BI1A 1ZA2B 2LT4A 1KG1A 3JB9G 3G4SQ 2ROLA 1NJIC 3ER0A 2LQNA 4JZ4A 2ZPEB 2OTLA 5CKFA 4AFUC 2EJ9A 1H3HA 2FZKB 1KK7A 4TVRA 4NL2A 1YFNA 4M78B 4C0GA 4IUVA 1AD5A 2JXBA 1VQNQ 5FLXE 4RMOA 3G6EA 3MO8A 1C0MA 3R6NA 2QI2A 3EFSA 4A4HA 2KXDA 1I81A 3GLXA 2K5IA 2LC4A 5D6XA 4JDSA 1VOMA 1WX6A 4EDUA 2MAMA 3PGGA 4F7UB 1NE8A 4Z89A 2DILA 2YRVA 1LVKA 2E5QA 3ULRB 2EFIA 1UDLA 1PRMC 3JV3A 2E65A 4QVZA 3I5SA 3RKXA 2EPDA 1IB8A 2YT6A 4A53A 5KCOA 1VQMA 3EGDA 3MJXA 3RKWA 3J80E 1D1CA 5CKHA 2JTEA 4BDZA 2K5FA 1YIJQ 1FMKA 1R0CB 2LQKA 2E70A 1UJYA 3KFVA 5IAYA 3QIIA 1ZUUA 3BFMA 3LGFA 2JT4A 4DA4A 3LGLA 5CVIA 4C8QG 4FW2A 5GAOn 2L3RA 4LNPA 3OMGA 5HKCA 1S72Q 5GAMd 3C12A 2NUTB 3MEWA 3REAB 1BBZA 4E7SA 1VQPQ 2QA4T 1YITT 1PSFA 4KGVB 2DA9A 2ZCFB 3H0HA 2CSIA 5DY9A 4RTXA 1NPRA 4FW1A 1IGUA 5GMKe 4BE0A 2F2VA 2PUKB 3JCMX 4BI4A 5C6SA 3CC7A 2CT3A 4RTVA 4C8QD 2K3XA 3CCMT 4C5GA 1SSHA 2FG0A 5J39A 2CUBA 2COWA 3HKSA 4J6YA 1N9SA 4ZGJB 4PJOF 1VQLQ 2OTLQ 1UE9A 1ZQ1A 2A7YA 2FYKA 1WPYA 3RBBB 1GBQA 4IUPA 3CCMQ 4HCKA 3VS0A 1YBYA 1Y7XA 1BU1A 5I22A 2DD5A 5GANd 1B3QA 1UG1A 1W6XA 3H41A 4EMKA 1K8AR 4EMKC 4LE9A 3M0SA 1M1KU 2KRSA 1PKTA 2RQWA 3OYMA 3JCMW 5IXFA 2LP5A 2CT4A 2KMTA 3HRTA 2CDTA 2YUOA 1MV3A 4GBQA 3VUBA 2EJGA 4PNOA 2RI5A 2QDLA 3QHSA 1S72T 2JNGA 5FRMA 2EYWA 4O6JA 1BI2A 3CBMA 1YI2T 3I55Q 3CCSA 3QYHB 4ZNXA 2L89A 4JZ3A 4WF2A 1Y0MA 2LX7A 2LVMA 3M59A 5KYXA 5GAMh 1EX4A 5LJ5e 2LCCA 2E6NA 5GAOl 3EG3A 2ENMA 3P8BB 3UWNA 2GGRA 1YWOA 3JB9J 3VRYA 3OSVA 1VQ9A 2F1LA 3JB9I 4BY6B 2IIMA 5ECAA 4BUGA 2YXYA 2HSEB 3EH2A 4B6MA 4E7KA 4F7UG 4JRKA 4GLMA 2DAQA 3CXCA 3MCAB 3PNWC 2PZ1A 1JEGA 1JXOA 3CEYA 5CKBA 3JCMP 2FO0A 2VASA 3J81E 2HD0A 4BD3A 3MP8A 3EGXB 2HAXA 2DL7A 3TEEA 5GAN5 4PLLA 3CCLT 4FM4B 4AMCA 2CZ0B 3CCVQ 2RK1A 5GJWB 4PL6A 1KC8R 5GMKj 2DL4A 1M2OA 5GAN7 2VC8A 2DVEA 3M53A 5KYWB 3PT9A 1NPPA 3UA7A 1VIEA 2HQXA 5FU7B 3CCLA 1D3BB 4FCYA 4R55A 4CI0C 4M77E 4DEXA 1R0BG 1M2VA 1D0ZA 1E7OA 4C0DB 1G8XA 4EIKA 4LD6A 1AVZC 2CP0A 2A08A 4FYWB 3OW2P 2D0QB 2D8HA 3A8MB 1I07A 2CUDA 1SSFA 4GLKA 3FJ5A 2HNIA 4M75B 4Y91A 1Y96B 2KT8A 3BY7A 7AT1B 1QP3A 3DLMA 4KH0B 2COYA 3X26B 4N4HA 2RA2A 3CCSQ 1N8RC 3JCMV 3CCEA 3QBYA 4QVCA 5LJ3f 1WHMA 1WHHA 1QVGS 3EHRA 4KH1B 3PIOA 1YI2A 2YSQA 2H8HA 1V1CA 3TSZA 1GCQC 3VS1A 1VQKQ 2E10A 3JCMh 2ED1A 2SRCA 1NLPC 4KT0E 1QCOA 3CPWP 5L23A 2QQSA 2JTMA 3GIBA 4AFQC 3CCMA 1KD1U 3A98A 2RD1A 1VQLA 3CC4Q 3MP6A 6AT1B 2EYQA 1H8KA 4M75F 2EGEA 3P8DA 5EC7A 2QQAA 4QW2A 3MP1A 2M16A 1TTHB 1QQJA 1QKWA 2LZ6B 1WJRA 1GL5A 4M75E 4DOWA 2QYZA 3OYYA 5CR2A 2DKGA 5LJ5j 1VQOQ 1Q82C 2PVDB 3MEAA 2E3HA 1KQ2A 4M7AF 3CXCS 1ZBJA 1TS9A 4LDWA 2EKHA 2QK0A 2DF6A 1K0SA 4RCBA 2QTXA 2RHYA 3VS7A 2MPXC 2IVWA 2RHUA 4OB3B 3H0FA 2HQEA 3SHWA 1SHFA 5KH6A 4FL6A 1VQ6A 4L6V5 1XJWB 1QWEA 1LJOA 2F69A 3C0CA 1B34B 2L2PA 1X6GA 1M3BA 1LPLA 1VQ6Q 3CMEA 3CPWS 1YJNT 4ATOA 2OX7A 4M77G 4CC2A 4M78A 2M9UA 1NG2A 3QO3A 1YIJA 1PSEA 1HYOA 5CCAA 2J6FA 2Y4XA 1YJWT 2RMOA 4F7UA 1EIFA 2YRDA 1I5OB 1M3AA 1RADB 1JO8A 2M51A 5CO7A 1ZUYA 1FWZA 2LT1A 2ZPGB 3JCMJ 2O31A 4HT9A 2EQUA 3I35A 2X51A 4FT4A 3H6ZA 2K79A 1NZ9A 1VYTA 1M8MA 4PJOG 2OTJA 1PC0A 1Y57A 2VYTA 3JCMc 2DMOA 1WHGA 2M0YA 2RJDA 1G2BA 4CC4B 3QKJA 3OW2S 2RNAA 1VQKA 1N5ZA 3CCRA 1WIEA 2GQVA 1NJIR 3CCET 3LX7A 1VQ7Q 4C8QB 1T0HA 1DJ7B 2KNBB 1R77A 1MNDA 3ZBDA 1G5VA 1Q82U 1UGVA 4JS5A 1NEGA 5GANh 1VQOT 2C06A 2F2XA 3FRNA 1KHCA 1IZ6A 1TG0A 1Q81C 3CC2T 1VYVA 2Y90A 3OYEA 3I56A 4J9FA 1ABOA 3VS3A 4ANJA 2E5KA 1RLPC 2GTJA 2YUPA 2RK2A 2O4XA 3OB9A 4MZTA 1MNEA 2NLUA 1BKBA 2VGNA 3A1PA 4J9HA 3T9NA 4C0DC 3L2UA 2GNCA 4C5IA 3G71A 5LJ3d 1GXIE 2CREA 1N9RA 1JBMA 1PD1A 5CKEA 1D0XA 2BZXA 4M77A 5DLQE 4PJOD 1YNZA 2COZA 2EQJA 5HK3A 4ZTFA 1FYNA 2RJFA 3M0PA 1KQ1A 1M8VA 1NYGA 1WHJA 3CC4A 4M78D 5A0LA 2DJQA 1JB0E 1IREB 2QA4Q 4OGEA 2CP3A 3CD6T 2DYIA 3G71T 2RJEA 2HKQB 4IURA 4AT1B 2LJ1A 2JJ9A 1D0YA 1RL2A 1MMGA 2E4HA 3M5AA 4HVVA 1X2QA 4XTUA 1VQ8A 2OI3A 5GANj 5GANf 3EG1A 4M7DD 3A8HB 3CCUA 2FZCB 4DBFA 1M3CA 3M57A 2QEXA 2F5TX 4JS4A 3CCJA 1GFCA 3C94A 3L2QA 4RTZA 1Z9QA 2MWOA 2QGFB 1J3TA 1YIJT 1IRXA 3JCMf 1VQ5A 3RNJA 2RB6A 4JJNK 3WXMB 4C8QA 1RAGB 1PHTA 3OYAA 4CRIA 2RHIA 4PLIA 1UFFA 4LDXA 3CCST 5A2QE 4M7AC 1YP5A 3HTRA 2DVJA 2QXFA 1JJ2A 1W4SA 3MPUB 5D6YA 4C92B 4X1VA 2YLCA 3E9GA 3MHXA 3SB2A 1QVFS 5FU6C 2X4JA 3EG9B 2WSEE 4E2FB 1QVGA 2JTFA 3JCMg 4BACA 3M56A 1O75A 5LJ3j 3NFCA 3NMZC 2R58A 1X75C 3MEVA 2DYBA 2KQWA 2NYSA 1BI3A 2V8KA 4RTTA 4Z8AA 1OU8A 2JM9A 2MYSA 3OYFA 1WHLA 4DBRA 1RI9A 5GAN3 4KUIA 2QAZA 2WSCE 1S1NA 2YUNA 2FRWA 5CAIA 2A3LA 2H3JA 1UGPB 1Q82R 1PKSA 3JCMQ 1RAAB 2W10A 3TQ7P 5IHNA 3QYGB 5GAMe 1X6OA 2LMJA 2O2OA 4L59A 1K8AU 2CH4W 5I21A 4P5NA 1RAEB 3QPHA 2QASA 2PU9B 4EMGA 4JJDA 3QDFA 4HCBA 1YHQT 3HP9A 1I0CA 3NPFA 5KCHA 4XTWA 4Y92A 4XQ3A 3OYLA 2BTTA 4XU2A 1XNIA 3G1JA 2AZSA 3FC3A 3AT1B 3V8LA 2K5LA 2L3SA 5GAOq 1XOVA 1GCQA 2ZAEA 1GFDA 1FX7A 3VS4A 4K11A 5L8RE 3UATA 4M75D 5AT1B 1TXQA 5GAMg 2DZ9A 2FL7A 2L8DA 4QQGA 2XK0A 2XU8A 2M02A 2DL8A 4OMQA 1K9MU 3O5ZA 5CKDA 1UGRB 2GFUA 2QDYB 1WA7A 4M7AG 1ZUKA 4Z88A 3OMCA 4BY6C 2RN8A 4X9CA 2R57A 1ZSZA 3C4SA 1QW1A 1G3YA 2B86A 3VUZA 2P0KA 1M1KR 2XDDA 1IGQA 1K9AA 4ESRA 3WVEB 1MV0B 4M78E 4CC3A 3G6ET 3OYJA 3S3NA 4ME7A 4Z02A 4F04B 2BE9B 1KQSS 5GANg 1HSQA 2DXUA 3L2WA 2HL5C 2KYMA 1IXDA 5M9OA 3BDUA 4JRPA 1AZGB 3DLLA 4ELZC 2EVRA 1Y71A 1TWBA 1WQ7A 2I0NA 3CCRQ 2K2VA 1K73U 1OI1A 3JCMb 5IT9E 1JJ2S 5DLOA 4HCCA 4WTOB 4V2SA 4M7DA 1BI0A 5GAOp 2YDLA 2OAUA 3ZEHA 5GMKm 1N8RR 1TOVA 5GANe 3CC7Q 3V7RA 2KK4A 4FSXA 3EH1A 1PWTA 2I2LA 4KBMB 3KUFA 2IG0A 2E64A 1G3TA 1WNLA 1MMAA 1TUGB 2M0OA 4NOYA 2YWWA 3EFOA 1QVPA 3BW1A 3EHQA 4C8QF 5GMKi 3LW5E 4AFZC 1YITA 5CQXA 1AOJA 2DPPB 2AZVA 3CCJT 4AFSC 3VJPA 3DB4A 1SKUB 4J8OA 5CIUA 1TSFA 1K9MC 1BB9A 3OBYA 4M75G 5HK0A 4IKFA 1KFZA 3V7SA 3JRZA 2VWFA 1KC8U 2JOYA 1ABQA 4A4KA 3LH5A 1VQ6T 4J9GA 1VQ4A 3PVQA 2CS7A 1QP2A 1JRIA 1UECA 2XHCA 3CD6Q 1E6HA 3OBWA 2CGHA 2YRCA 3HFNA 3QWYA 2KGTA 2DZCA 3L1AA 2OTLT 2RJCA 2RQTA 2KRNA 3FJPA 4C92G 1YJNA 4NS5A 4PJOE 2KBTA 4JLGA 3KBGA 2EIFA 4M77C 2X9HA 3J7AF 4IUUA 4PKCC 2CZ7B 3CPWA 2HEQA 3QSUA 4M77F 2JZ2A 3ME9A 2PVGB 2RHXA 4RUGA 3X28B 4C92A 1XQHA 1AZEA 4XTXA 4F16A 1X6BA 3RDVA 4ORZA 4OP0A 3G6EQ 3A8LB 5DM7R 2R5AA 2DXTA 3META 1RAHB 2RI2A 1X43A 2XI9A 4M4ZA 1Q7YC 4BE1A 4RTUA 2OTJT 3HHTB 1AEYA 3V8JA 2L3PA 2DD4A 5GAMj 3BE3A 1YI2Q 2J05A 3S3OA 3GP8A 2DNUA 1B07A 3M54A 3E9FA 2JVVA 2A0FB 1OEBA 5FW9A 4DEYA 3NHNA 3LYIA 3CCRT 1ZBXA 2MI6A 2VGMA 1SF9A 4LD9K 4M7DE 4M7AE 4X34A 1PG5B 4J83A 3OYHA 3JCMe 1KD1R 4PJJA 4J5YA 3OYGA 4UC4A 1D1AA 3G7ZA 1N6AA 3RKYA 3OYDA 1QKXA 4C92D 3QUIA 1HXDA 1OQKA 3LH0A 1GBRA 4KULA 3NTKA 5GJVB 2EQKA 3GOXA 2W0ZA 3JB9H 3KXTA 2BZ8A 2FPEA 2JM8A 3TU4K 3VKIA 8ATCB 1NBEB 1PCXA 3EFRA 2E3IA 1XTDA 1Q86U 1M27C 1ZSZB 3CCLQ 2MK5A 4LUEA 4R0KA 2GF7A 4YTLA 4FIBA 4ELYC 1M2VB 3UT1A 1RAFB 1MHNA 4XU1A 1IHWA 4F17A 2WACA 4C5HA 5KYNA 2ZPFB 1HK9A 1OZ3A 1OPKA 2OAWA 3CCUQ 3VRZA 2EYZA 2AKLA 3CCVA 4M78F 5IHIA 4KUDK 1OYXA 2F5KA 1KJWA 1U1SA 4FSSA 1VQ8T 1Q7YU 1PM3A 2YUQA 2VB6A 2QA4A 5FU6B 3HL8A 1KSWA 4OMPA 4MZMA 1WXUA 1VQ8Q 4HXJA 2HDAA 3WVDB 4D6WA 2DBMA 2QG9B 2O01E 5LJ5d 3H8ZA 4N4IA 1ZA1B 2FPDA 4II1A 3UDCA 1QVFP 4RG2A 2AKKA 2LDMA 1YJ9Q 2EGCA 4ZGEB 3CC2Q 3VYGA 1D09B 5I2SA 1WJSA 4KGXB 1VQPT 3IQLA 2KRMA 1A0NB 2MWPA 3HFOA 1VQ9T 2ZGWA 3QXEB 1Q95G 1VYUA 4M75A 4OMMA 1QCNA 3EFOB 3CBOA 1TH7A 3FB9A 4MDWA 3CXCP 2PTKA 1MUZA 2A28A 3G71Q 2ECZA 3DB3A 2VXFA 1VA7A 5IHKA 2R5MA 4X9DA 2K4YA 3HPWA 4C0ZA 4BDYA 3P8HA 1GCPA 2VV5A 1M30A 1Q86C 3AHUA 4RTWA 1YJWA 1FXXA 4XU0A 2QGGA 1G3SA 1OZ2A 1ZX6A 2BIVA 2ED0A 3X24B 4ZTJA 2DTIA 3EG0A 1R8OB 2CZ1B 5KYYA 3GPLA 2BKDN 1UGSB 1KHIA 4MMLA 2RH2A 3L2ZA 2HSPA 5LJ5h 2CZ6B 5D7UA 5C0MA 2A36A 1YJ9T 5GAN6 4O5VA 1VQ7A 4JRQA 2GBQA 2X4YA 1K0XA 4N0AC 2DRMA 1AT1B 4FYXB 4J6XA 2XD0A 1CKAA 4J9CA 4BI3A 3QWXX 3EGDB 3LLRA 2OTJQ 2MF2A 4M7DB 2BUDA 3RUXA 5J26A 2RQVA 1SEMA 3M0RA 2GQIA 1M1KC 4D8KA 3E19A 4C92E 3M9QA 4J9EA 3NTHA 3GBQA 1YN8A 3VYHB 2DEQA 5I11A 2DLPA 2V1RA 1RUWA 2KVQG 3MEUA 2FB7A 5IH2A 2D8JA 4FYVB 2X3WD 2CP2A 2L0AA 4IUTA
chains in the Genus database with same CATH topology
2ROTA 4EIKA 2CSQA 1AVZC 2B86A 4A63B 2A08A 4JPBW 1K9AA 2MIOA 2D8HA 4ESRA 1I07A 1MV0B 2CUDA 2FEIA 1JXMA 2AK5A 4CC3A 2FPFA 3FJ5A 3UA6A 1UJ0A 1UHCA 2KT8A 1HSQA 2EBPA 4OMNA 2KYMA 3SEMA 1PRLC 2XMFA 1LCKA 3VS2A 2X3XD 1G83A 1T0JA 2DL5A 1AZGB 2EVRA 2I0NA 2RQUA 1UUEA 3VS6A 3PE0A 4CC7A 4AG1C 1KIKA 3EHRA 1K4US 1CSKA 3VS5A 2YSQA 2H8HA 1V1CA 1AWJA 4HVWA 1YWPA 2LJ0A 2JS0A 3M0TA 3TSZA 4D8DA 1GCQC 3VS1A 4WCIA 2YDLA 2ED1A 2SRCA 1NLPC 1WDXA 2MOXA 5L23A 4LUDA 1CKBA 4AFQC 2D0NA 1QCFA 1OPLA 3A98A 1JQQA 1EFNA 1PWTA 1WYXA 2LJ3A 4IIMA 1H8KA 1SRMA 1SHGA 2EGEA 5EC7A 2SEMA 1NM7A 2DE0X 3M0UA 2JW4A 2MCNA 2LQWA 1T3SA 1QKWA 2LZ6B 2OJ2A 3EHQA 1GL5A 1WI7A 4AFZC 2L3QA 2JS2A 1AOJA 1U3OA 2AZVA 4AFSC 1WLPB 2K7AA 2C0OA 2O88A 1UHFA 2LNHB 4HVUA 2O9VA 1BB9A 1WXTA 1ZBJA 1QLYA 1KFZA 1NYFA 1SPKA 2VWFA 2EKHA 1PNJA 2DF6A 2K3BA 1K0SA 1ABQA 3VS7A 1SRLA 1IO6A 2F2WA 3LH5A 4J9GA 3PVQA 2EW3A 3H0FA 3SHWA 1UECA 4QT7A 1SHFA 5IXBA 1E6HA 1K76A 4J9DA 3M0QA 2G6FX 1QWEA 1H92A 3C0CA 2L2PA 1X6GA 2KGTA 3QWYA 1M3BA 2VKNA 2FRYA 4AG2C 1AWWA 1U06A 4CC2A 2A37A 2RQTA 2KRNA 3EG2A 2C0TA 1W70A 3UF4A 2KBTA 1NG2A 1ARKA 2J6FA 2KE9A 1AWOA 2RMOA 1YCSB 2KT1A 2HEQA 2J7IA 1RLQC 2EYXA 1M3AA 4RUGA 1JO8A 1X2KA 2M51A 2NWMA 1ZUYA 1AZEA 4F16A 1X6BA 5FWCA 2DBKA 4ORZA 2ROLA 1WXBA 1T3LA 2O31A 2LQNA 4JZ4A 4AFUC 1H3HA 1X43A 3I35A 2J6OA 1TUCA 4M4ZA 2DX1A 2D1XA 2JMCA 3I9QA 4RTUA 1AD5A 1AEYA 2JXBA 2L3PA 2K79A 1VYTA 1M8MA 1Y57A 2J05A 2DMOA 2DNUA 3R6NA 1B07A 2M0YA 2KXDA 1G2BA 4CC4B 2EYYA 2RNAA 1N5ZA 1OEBA 2J06A 1GRIA 1WIEA 5FW9A 2VVKA 1WX6A 4DEYA 3NHNA 2KEAA 1W1FA 4Z89A 2DILA 1BK2A 1NEBA 1T0HA 3ULRB 1UDLA 2KNBB 1PRMC 1K1ZA 1UGVA 3JV3A 1NEGA 3I5SA 2RF0A 2F2XA 2EPDA 3THKA 2NUZA 2YT6A 1TG0A 2EQIA 1VYVA 2JTEA 1FMKA 3H0IA 4J9FA 1ABOA 3VS3A 4OMLA 4RTYA 1UJYA 2E5KA 1QKXA 1RLPC 3KFVA 1GBRA 4J9BA 2GTJA 2YUPA 1ZUUA 5GJVB 2W0ZA 4IIOA 2BZ8A 2JT4A 1X27A 2FPEA 2JM8A 4J9HA 2KXCA 4LNPA 2GNCA 1ZLMA 1M27C 2CREA 2C0IA 4JJBA 4LUEA 2BZXA 4R0KA 2EGAA 4E6RA 3U23A 3REAB 1BBZA 4LN2A 1YNZA 3PVLA 1FYNA 4F17A 3M0PA 2DA9A 3H0HA 1NYGA 2CSIA 1OPKA 4RTXA 2RQRA 2OAWA 2KR3A 2GTOA 2DJQA 2EYZA 3VRZA 2AKLA 2F2VA 5IHIA 1JU5C 2CT3A 4RTVA 2ESWA 1SSHA 2FG0A 2LJ1A 1KJWA 2CUBA 4FSSA 2KYBA 5HCKA 2YUQA 1UE9A 4HVVA 1X2QA 2OI3A 3RBBB 1GBQA 4KRTA 1KSWA 2JMAA 3EG1A 1WXUA 4HCKA 4OMPA 1TUDA 3VS0A 1BU1A 5I22A 1B3QA 2ABLA 2HDAA 4HXJA 1UG1A 1M3CA 2DBMA 2V1QA 1GFCA 1HD3A 1W6XA 3H41A 2FPDA 4RTZA 1E6GA 4LE9A 1Z9QA 3M0SA 2KRSA 4OMOA 1J3TA 2AKKA 1PKTA 1HJDA 2EGCA 2RQWA 3RNJA 5IXFA 2LP5A 2CT4A 2DM1A 2CDTA 2KRMA 3IQLA 2YUOA 1MV3A 1PHTA 4GBQA 4JJCA 1A0NB 1OV3A 2QDLA 1UTIA 1UFFA 3TVTA 2EYWA 1VYUA 2O9SA 1YP5A 4OMMA 2DVJA 4X1VA 4ZNXA 2PTKA 4JZ3A 1MUZA 1Y0MA 2LX7A 2A28A 1NLOC 1U5SA 2ECZA 1VA7A 5IHKA 3NMZC 2RPNA 3EG3A 2ENMA 2DYBA 1GCPA 2GGRA 2K2MA 1M30A 1YWOA 3VRYA 4RTWA 4RTTA 4Z8AA 2JM9A 1ZX6A 2ED0A 2HCKA 2IIMA 1RI9A 5ECAA 1ZSGA 1Z9ZA 2P4RA 2KROA 3I5RA 1S1NA 2YUNA 2FRWA 3EG0A 1X69A 1WFWA 2CH4A 1PKSA 2HBWA 2W10A 2HSPA 4GLMA 5IHNA 2K9GA 2BZYA 2PZ1A 3EGUA 1JEGA 2A36A 1JXOA 4F14A 2LMJA 2FO0A 2O2OA 2CH4W 2DL3A 2DRKA 2J6KA 2DL7A 2GBQA 2PNIA 2K6DA 1K0XA 2DRMA 1I1JA 4JJDA 3ZL7C 1I0CA 3NPFA 1CKAA 3TSWA 4Y92A 4J9CA 2BTTA 3QWXX 5GJWB 1AWXA 2AZSA 2DL4A 2L3SA 4J9IA 2RQVA 3CQTA 1XOVA 1GCQA 1SEMA 3M0RA 2GQIA 5FWBA 3VS4A 1GFDA 1QWFA 4K11A 3UATA 4D8KA 4J9EA 3UA7A 3GBQA 1YN8A 3NGPA 5I11A 2DLPA 3REBB 2DL8A 4OMQA 2LCSA 2V1RA 1RUWA 3O5ZA 4DEXA 5IH2A 2D8JA 2X3WD 1OOTA 1WA7A 1ZUKA 4Z88A 1E7OA 2L0AA 2RN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROT A;  4EIK A;  2CSQ A;  1AVZ C;  2B86 A;  4A63 B;  2A08 A;  4JPB W;  1K9A A;  2MIO A;  2D8H A;  4ESR A;  1I07 A;  1MV0 B;  2CUD A;  2FEI A;  1JXM A;  2AK5 A;  4CC3 A;  2FPF A;  3FJ5 A;  3UA6 A;  1UJ0 A;  1UHC A;  2KT8 A;  1HSQ A;  2EBP A;  4OMN A;  2KYM A;  3SEM A;  1PRL C;  2XMF A;  1LCK A;  3VS2 A;  2X3X D;  1G83 A;  1T0J A;  2DL5 A;  1AZG B;  2EVR A;  2I0N A;  2RQU A;  1UUE A;  3VS6 A;  3PE0 A;  4CC7 A;  4AG1 C;  1KIK A;  3EHR A;  1K4U S;  1CSK A;  3VS5 A;  2YSQ A;  2H8H A;  1V1C A;  1AWJ A;  4HVW A;  1YWP A;  2LJ0 A;  2JS0 A;  3M0T A;  3TSZ A;  4D8D A;  1GCQ C;  3VS1 A;  4WCI A;  2YDL A;  2ED1 A;  2SRC A;  1NLP C;  1WDX A;  2MOX A;  5L23 A;  4LUD A;  1CKB A;  4AFQ C;  2D0N A;  1QCF A;  1OPL A;  3A98 A;  1JQQ A;  1EFN A;  1PWT A;  1WYX A;  2LJ3 A;  4IIM A;  1H8K A;  1SRM A;  1SHG A;  2EGE A;  5EC7 A;  2SEM A;  1NM7 A;  2DE0 X;  3M0U A;  2JW4 A;  2MCN A;  2LQW A;  1T3S A;  1QKW A;  2LZ6 B;  2OJ2 A;  3EHQ A;  1GL5 A;  1WI7 A;  4AFZ C;  2L3Q A;  2JS2 A;  1AOJ A;  1U3O A;  2AZV A;  4AFS C;  1WLP B;  2K7A A;  2C0O A;  2O88 A;  1UHF A;  2LNH B;  4HVU A;  2O9V A;  1BB9 A;  1WXT A;  1ZBJ A;  1QLY A;  1KFZ A;  1NYF A;  1SPK A;  2VWF A;  2EKH A;  1PNJ A;  2DF6 A;  2K3B A;  1K0S A;  1ABQ A;  3VS7 A;  1SRL A;  1IO6 A;  2F2W A;  3LH5 A;  4J9G A;  3PVQ A;  2EW3 A;  3H0F A;  3SHW A;  1UEC A;  4QT7 A;  1SHF A;  5IXB A;  1E6H A;  1K76 A;  4J9D A;  3M0Q A;  2G6F X;  1QWE A;  1H92 A;  3C0C A;  2L2P A;  1X6G A;  2KGT A;  3QWY A;  1M3B A;  2VKN A;  2FRY A;  4AG2 C;  1AWW A;  1U06 A;  4CC2 A;  2A37 A;  2RQT A;  2KRN A;  3EG2 A;  2C0T A;  1W70 A;  3UF4 A;  2KBT A;  1NG2 A;  1ARK A;  2J6F A;  2KE9 A;  1AWO A;  2RMO A;  1YCS B;  2KT1 A;  2HEQ A;  2J7I A;  1RLQ C;  2EYX A;  1M3A A;  4RUG A;  1JO8 A;  1X2K A;  2M51 A;  2NWM A;  1ZUY A;  1AZE A;  4F16 A;  1X6B A;  5FWC A;  2DBK A;  4ORZ A;  2ROL A;  1WXB A;  1T3L A;  2O31 A;  2LQN A;  4JZ4 A;  4AFU C;  1H3H A;  1X43 A;  3I35 A;  2J6O A;  1TUC A;  4M4Z A;  2DX1 A;  2D1X A;  2JMC A;  3I9Q A;  4RTU A;  1AD5 A;  1AEY A;  2JXB A;  2L3P A;  2K79 A;  1VYT A;  1M8M A;  1Y57 A;  2J05 A;  2DMO A;  2DNU A;  3R6N A;  1B07 A;  2M0Y A;  2KXD A;  1G2B A;  4CC4 B;  2EYY A;  2RNA A;  1N5Z A;  1OEB A;  2J06 A;  1GRI A;  1WIE A;  5FW9 A;  2VVK A;  1WX6 A;  4DEY A;  3NHN A;  2KEA A;  1W1F A;  4Z89 A;  2DIL A;  1BK2 A;  1NEB A;  1T0H A;  3ULR B;  1UDL A;  2KNB B;  1PRM C;  1K1Z A;  1UGV A;  3JV3 A;  1NEG A;  3I5S A;  2RF0 A;  2F2X A;  2EPD A;  3THK A;  2NUZ A;  2YT6 A;  1TG0 A;  2EQI A;  1VYV A;  2JTE A;  1FMK A;  3H0I A;  4J9F A;  1ABO A;  3VS3 A;  4OML A;  4RTY A;  1UJY A;  2E5K A;  1QKX A;  1RLP C;  3KFV A;  1GBR A;  4J9B A;  2GTJ A;  2YUP A;  1ZUU A;  5GJV B;  2W0Z A;  4IIO A;  2BZ8 A;  2JT4 A;  1X27 A;  2FPE A;  2JM8 A;  4J9H A;  2KXC A;  4LNP A;  2GNC A;  1ZLM A;  1M27 C;  2CRE A;  2C0I A;  4JJB A;  4LUE A;  2BZX A;  4R0K A;  2EGA A;  4E6R A;  3U23 A;  3REA B;  1BBZ A;  4LN2 A;  1YNZ A;  3PVL A;  1FYN A;  4F17 A;  3M0P A;  2DA9 A;  3H0H A;  1NYG A;  2CSI A;  1OPK A;  4RTX A;  2RQR A;  2OAW A;  2KR3 A;  2GTO A;  2DJQ A;  2EYZ A;  3VRZ A;  2AKL A;  2F2V A;  5IHI A;  1JU5 C;  2CT3 A;  4RTV A;  2ESW A;  1SSH A;  2FG0 A;  2LJ1 A;  1KJW A;  2CUB A;  4FSS A;  2KYB A;  5HCK A;  2YUQ A;  1UE9 A;  4HVV A;  1X2Q A;  2OI3 A;  3RBB B;  1GBQ A;  4KRT A;  1KSW A;  2JMA A;  3EG1 A;  1WXU A;  4HCK A;  4OMP A;  1TUD A;  3VS0 A;  1BU1 A;  5I22 A;  1B3Q A;  2ABL A;  2HDA A;  4HXJ A;  1UG1 A;  1M3C A;  2DBM A;  2V1Q A;  1GFC A;  1HD3 A;  1W6X A;  3H41 A;  2FPD A;  4RTZ A;  1E6G A;  4LE9 A;  1Z9Q A;  3M0S A;  2KRS A;  4OMO A;  1J3T A;  2AKK A;  1PKT A;  1HJD A;  2EGC A;  2RQW A;  3RNJ A;  5IXF A;  2LP5 A;  2CT4 A;  2DM1 A;  2CDT A;  2KRM A;  3IQL A;  2YUO A;  1MV3 A;  1PHT A;  4GBQ A;  4JJC A;  1A0N B;  1OV3 A;  2QDL A;  1UTI A;  1UFF A;  3TVT A;  2EYW A;  1VYU A;  2O9S A;  1YP5 A;  4OMM A;  2DVJ A;  4X1V A;  4ZNX A;  2PTK A;  4JZ3 A;  1MUZ A;  1Y0M A;  2LX7 A;  2A28 A;  1NLO C;  1U5S A;  2ECZ A;  1VA7 A;  5IHK A;  3NMZ C;  2RPN A;  3EG3 A;  2ENM A;  2DYB A;  1GCP A;  2GGR A;  2K2M A;  1M30 A;  1YWO A;  3VRY A;  4RTW A;  4RTT A;  4Z8A A;  2JM9 A;  1ZX6 A;  2ED0 A;  2HCK A;  2IIM A;  1RI9 A;  5ECA A;  1ZSG A;  1Z9Z A;  2P4R A;  2KRO A;  3I5R A;  1S1N A;  2YUN A;  2FRW A;  3EG0 A;  1X69 A;  1WFW A;  2CH4 A;  1PKS A;  2HBW A;  2W10 A;  2HSP A;  4GLM A;  5IHN A;  2K9G A;  2BZY A;  2PZ1 A;  3EGU A;  1JEG A;  2A36 A;  1JXO A;  4F14 A;  2LMJ A;  2FO0 A;  2O2O A;  2CH4 W;  2DL3 A;  2DRK A;  2J6K A;  2DL7 A;  2GBQ A;  2PNI A;  2K6D A;  1K0X A;  2DRM A;  1I1J A;  4JJD A;  3ZL7 C;  1I0C A;  3NPF A;  1CKA A;  3TSW A;  4Y92 A;  4J9C A;  2BTT A;  3QWX X;  5GJW B;  1AWX A;  2AZS A;  2DL4 A;  2L3S A;  4J9I A;  2RQV A;  3CQT A;  1XOV A;  1GCQ A;  1SEM A;  3M0R A;  2GQI A;  5FWB A;  3VS4 A;  1GFD A;  1QWF A;  4K11 A;  3UAT A;  4D8K A;  4J9E A;  3UA7 A;  3GBQ A;  1YN8 A;  3NGP A;  5I11 A;  2DLP A;  3REB B;  2DL8 A;  4OMQ A;  2LCS A;  2V1R A;  1RUW A;  3O5Z A;  4DEX A;  5IH2 A;  2D8J A;  2X3W D;  1OOT A;  1WA7 A;  1ZUK A;  4Z88 A;  1E7O A;  2L0A A;  2RN8 A; 
#chains in the Genus database with same CATH topology
 2ROT A;  2LX9 A;  2CSQ A;  4OMF B;  1Q7Y R;  4A63 B;  4JPB W;  2HKN A;  3M58 A;  2MIO A;  2B8A A;  1ZHI A;  2DTO A;  2FEI A;  5LJ5 f;  2FPF A;  1F1B B;  2DER A;  3UA6 A;  1O9S A;  1UJ0 A;  2EBP A;  1W2B P;  4C8Q E;  2PVO B;  3L2V A;  3H9N A;  2ZZD A;  4C92 F;  3OS0 A;  1G83 A;  1T0J A;  2DL5 A;  4OB1 B;  5CK9 A;  3M4G A;  4MZP A;  3FLG A;  4JRI A;  4L5G A;  1UUE A;  3VS6 A;  3PE0 A;  2E6Z A;  4CC7 A;  4XU3 A;  4AG1 C;  5AYF A;  1BIB A;  5J3B A;  1VQO A;  1KIK A;  1QVF A;  2VXE A;  1CSK A;  3CC2 A;  2E41 A;  9ATC B;  4XTZ A;  4Q5W A;  1VQN A;  1WGS A;  4HVW A;  1YWP A;  2JS0 A;  4D8D A;  2M1H A;  4DBQ A;  4WCI A;  2GCX A;  1WDX A;  3C95 A;  2Y4Y A;  3JCM d;  2IPO B;  3SFM A;  3TRE A;  3OYN A;  1JQQ A;  1EFN A;  1WYX A;  1C6V X;  1SHG A;  2SEM A;  3PFS A;  2DE0 X;  4FT2 A;  1M4Z A;  1WQW A;  1OU9 A;  2JW4 A;  2LQW A;  3HRS A;  4B9W A;  4ZGD B;  2G3R A;  1U3O A;  3PTA A;  4OB2 B;  2KAF A;  1K73 R;  1UHF A;  2LNH B;  3TCJ A;  2X4W A;  3INZ A;  4HVU A;  4LDU A;  1WXT A;  1VQ7 T;  1JJ2 P;  1BCM A;  1NYF A;  1SPK A;  4LXC A;  2KDS A;  1PNJ A;  3CCE Q;  4F7U E;  5KYW A;  2K3B A;  2WSF E;  1M90 R;  3QG1 A;  3SWN B;  1UB4 A;  3R6O A;  2XKO C;  1IO6 A;  2F2W A;  5FRN A;  4FU6 A;  2RO0 A;  4OB0 B;  5KE3 A;  4PJO A;  4M7A D;  2YLB A;  3OS2 A;  4AG2 C;  3JSC A;  3EGX A;  1U06 A;  4B9X A;  4XAX B;  1K9M R;  2QEX T;  4M7D F;  2HQH A;  1BIA A;  3I55 T;  2C0T A;  3JB9 F;  5D6W A;  3S6W A;  4BE2 A;  3UF4 A;  1C1A A;  3OQ5 A;  4NL3 A;  1N8R U;  2KY9 A;  4A4F A;  4C0F A;  3L2R A;  2E12 A;  1ARK A;  3E2U A;  2KE9 A;  4DOV A;  2EKO A;  2LRQ A;  3CBP A;  3M4Y A;  2PUO B;  2V8I A;  3CCJ Q;  1QVG P;  2KT1 A;  1RLQ C;  2QEX Q;  1Y96 A;  1BYM A;  4E7I A;  1M1G A;  1X2K A;  2NWM A;  1B34 A;  5FWC A;  2DBK A;  5KYU B;  1WXB A;  1T3L A;  3OSS C;  3RER A;  3BDL A;  4OF1 A;  3SWN A;  4A4E A;  3FDR A;  3CME T;  4BI8 B;  5LL6 S;  1LNX A;  2HL3 A;  2J6O A;  3VU3 C;  1TUC A;  2HZY A;  2DX1 A;  2D1X A;  2JMC A;  3I9Q A;  2H3E B;  4EMH A;  2D9T A;  3UPU A;  1KD1 C;  4EMK B;  1AHJ B;  3I56 T;  3FEO A;  2EYY A;  4PJN A;  1FMW A;  2J06 A;  1GRI A;  2X4X A;  3RIR A;  2VVK A;  4J6W A;  4A4G A;  4VUB A;  2KEA A;  1W1F A;  2QQ9 A;  2DET A;  1BK2 A;  1NEB A;  1K1Z A;  2RF0 A;  3O8V A;  4QQ6 A;  3RES A;  8AT1 B;  3THK A;  2NUZ A;  4M75 C;  2EQI A;  1W2B A;  3QDR B;  4RCC A;  3GF5 A;  5CQY A;  3HSB A;  1FMV A;  3H0I A;  2RM4 A;  2LNV A;  2CP6 A;  4OML A;  4RTY A;  3CMA A;  4PJO B;  1YJN Q;  3GNF B;  2FZG B;  4J9B A;  1ACM B;  3I56 Q;  1I5L A;  4DQ2 A;  2JUF A;  3OYC A;  3E1S A;  4IIO A;  1X27 A;  2KXC A;  3CD6 A;  1OX8 A;  4E7J A;  3RMQ A;  1ZLM A;  3A5Z B;  1VQ4 Q;  1ZSZ C;  2C0I A;  4JJB A;  2XDP A;  2EGA A;  4E6R A;  3U23 A;  5A0D A;  5LJ3 e;  4LN2 A;  3PVL A;  2ATC B;  1Y07 A;  1D3B A;  1QMC A;  2LCL A;  2VUB A;  3X20 B;  1N27 A;  1I8F A;  4PFP A;  2NUP B;  2P84 A;  2RQR A;  4HKE A;  2KR3 A;  2GTO A;  1YIT Q;  1K8A C;  1JU5 C;  2FHD A;  1M90 U;  4N0A A;  2ESW A;  1G3W A;  5KYY B;  3CC7 T;  2KYB A;  3QZ5 B;  4J7I A;  3FIF A;  5HCK A;  1M1F A;  4KRT A;  2JMA A;  2HBP A;  1KQS A;  1TUD A;  2KSS A;  2ABL A;  2NUT A;  2V1Q A;  2PQW A;  1HD3 A;  3OYI A;  4HA8 A;  5I2M A;  1I4K 1;  2ZPI B;  1E6G A;  4OMO A;  4E7L A;  3QZ9 B;  2DEU A;  1M5Q 1;  1MGQ A;  4HCZ A;  1HJD A;  1VQP A;  2FVU A;  2DM1 A;  4MMK A;  1S72 A;  1Q86 R;  3V8K A;  4JJC A;  4RKU E;  1OV3 A;  4MDX A;  1UTI A;  3TVT A;  1Q81 U;  2O9S A;  4OGC A;  4PK4 A;  2EJF A;  4M78 C;  5KE2 A;  1NLO C;  1BCO A;  2QTV A;  1U5S A;  5GAN 8;  3QJ6 A;  3CME Q;  2DXB A;  3A8O B;  3PMI A;  1VQM Q;  1VQ5 T;  2RPN A;  3CCQ T;  2K2M A;  3OY9 A;  3PMT A;  2Z0W A;  2P0Q A;  1YCY A;  1VQK T;  3ZFJ A;  1MMD A;  1OUL A;  4RG8 A;  4M7D C;  2HCK A;  1ZSG A;  1Z9Z A;  2P4R A;  3QJY A;  2KRO A;  3I5R A;  2DJZ A;  1M9S A;  2E1H A;  1X69 A;  2DIQ A;  3OA6 A;  4LDY A;  1WFW A;  2CH4 A;  2YHT A;  4QVD A;  1W2B S;  3X25 B;  2HBW A;  1K73 C;  2K9G A;  2BZY A;  3EGU A;  4XTV A;  3URG A;  5GAN 2;  4EPC A;  4F14 A;  2V26 A;  4M77 D;  2JN0 A;  5IN1 A;  3ASK A;  1VUB A;  1M90 C;  1YJ9 A;  2DL3 A;  2DRK A;  2J6K A;  2PNI A;  2K6D A;  3RMS A;  1I1J A;  3RR6 A;  3ZL7 C;  2EWN A;  1RAI B;  1H3Z A;  5A0G A;  3TSW A;  4C5E A;  3LWI A;  2L5Q A;  2QQB A;  2DXC A;  2CKK A;  3PIP A;  1X01 A;  1AWX A;  4KGZ B;  4JLI A;  3SDZ A;  2LTO A;  4J9I A;  3CQT A;  4FYY B;  1VIF A;  5FWB A;  1KQS P;  1QWF A;  1TU0 B;  2XDB A;  3G4S A;  1RAC B;  1B7T A;  3OYK A;  5FU7 C;  3NGP A;  3EAE A;  2XID A;  3REB B;  2K3Y A;  1YJW Q;  4LDV A;  1YHQ A;  4R56 A;  2LCS A;  4PFZ A;  1UGQ B;  2QQR A;  4BB7 A;  1RI0 A;  2CP5 A;  1U1T A;  4M77 B;  1V29 B;  1OOT A;  2GFA A;  3OS5 A;  4XTY A;  1UEB A;  2MMP A;  1KC8 C;  2RI3 A;  2LQ8 A;  2DFU A;  3CMA Q;  3F70 A;  1V76 A;  4ZN1 A;  3VV0 A;  4HT8 A;  4IUQ A;  4XK8 E;  1LOJ A;  4PJO C;  3Q1J A;  1JXM A;  2AK5 A;  3G4S T;  2HMA A;  2EAY A;  1MMN A;  3CMA T;  4PJM A;  4E7Z A;  2K57 A;  4C92 C;  1UHC A;  4OMN A;  3S3M A;  3SEM A;  4M7D G;  3CPF A;  1PRL C;  5LJ5 g;  2XMF A;  1LCK A;  3VS2 A;  2X3X D;  4ZN3 A;  4M7A B;  5GAO r;  2AT1 B;  3GNG A;  4F7U F;  2ZPB B;  2RQU A;  1U8R A;  2DK3 A;  1Q81 R;  2P4T A;  1K4U S;  5GMK h;  3VS5 A;  3CCQ Q;  1PD0 A;  1VQM T;  2KI7 A;  1VQ5 Q;  3MKD A;  1OX9 A;  1NJI U;  1AWJ A;  3CC4 T;  2LJ0 A;  3M0T A;  2DO3 A;  5HY6 A;  1VQN T;  1WJQ A;  2V8J A;  2XG8 D;  1D1B A;  1H64 1;  2MOX A;  5LJ3 h;  5GMK l;  4LUD A;  1CKB A;  3CCQ A;  2D0N A;  1QCF A;  1VQL T;  5LJ3 g;  5FRO A;  3NTI A;  4C8Q C;  2P0P A;  5KYU A;  1OPL A;  1WZO A;  3SWN C;  1IHV A;  2LJ3 A;  4IIM A;  2AHJ B;  1SRM A;  2BE7 D;  3EG9 A;  4DBH A;  1NM7 A;  2AIR B;  3N5B B;  4M7A A;  3M0U A;  4GY5 A;  2CP7 A;  3OS1 A;  2MCN A;  2RHZ A;  1T3S A;  3CCU T;  4QQD A;  2OJ2 A;  1EZZ B;  1WI7 A;  2NUP A;  5GAM f;  2L3Q A;  2JS2 A;  1VQ9 Q;  4J7F A;  1WLP B;  2K7A A;  2EQM A;  2C0O A;  2O88 A;  3L42 A;  2O9V A;  2X35 A;  4PJL A;  4Y28 E;  1QLY A;  3CCV T;  3OYB A;  3DKM A;  4A54 A;  5GAN 4;  2XIC A;  5EG2 A;  2DTH A;  1SRL A;  2O4X B;  4E47 A;  3M55 A;  4PFO A;  2EW3 A;  3JB9 D;  2DIG A;  4QT7 A;  5GAO m;  5IXB A;  4J9D A;  1K76 A;  3M0Q A;  2ZPH B;  2G6F X;  4M78 G;  1H92 A;  3OW2 A;  2VKN A;  2FRY A;  1SG5 A;  1AWW A;  2CYZ B;  2A37 A;  3EG2 A;  1YHQ Q;  3D7S B;  4E7H A;  1W70 A;  3JAM E;  4N4G A;  3V7C A;  2D6F A;  1P92 A;  1WHK A;  3I55 A;  3LWH A;  1RAB B;  4OVA A;  1AWO A;  5KYX B;  3A8G B;  1YCS B;  3SD4 A;  4JUV A;  1VQ4 T;  2J7I A;  2EYX A;  4QKU A;  3HRU A;  1BI1 A;  1ZA2 B;  2LT4 A;  1KG1 A;  3JB9 G;  3G4S Q;  2ROL A;  1NJI C;  3ER0 A;  2LQN A;  4JZ4 A;  2ZPE B;  2OTL A;  5CKF A;  4AFU C;  2EJ9 A;  1H3H A;  2FZK B;  1KK7 A;  4TVR A;  4NL2 A;  1YFN A;  4M78 B;  4C0G A;  4IUV A;  1AD5 A;  2JXB A;  1VQN Q;  5FLX E;  4RMO A;  3G6E A;  3MO8 A;  1C0M A;  3R6N A;  2QI2 A;  3EFS A;  4A4H A;  2KXD A;  1I81 A;  3GLX A;  2K5I A;  2LC4 A;  5D6X A;  4JDS A;  1VOM A;  1WX6 A;  4EDU A;  2MAM A;  3PGG A;  4F7U B;  1NE8 A;  4Z89 A;  2DIL A;  2YRV A;  1LVK A;  2E5Q A;  3ULR B;  2EFI A;  1UDL A;  1PRM C;  3JV3 A;  2E65 A;  4QVZ A;  3I5S A;  3RKX A;  2EPD A;  1IB8 A;  2YT6 A;  4A53 A;  5KCO A;  1VQM A;  3EGD A;  3MJX A;  3RKW A;  3J80 E;  1D1C A;  5CKH A;  2JTE A;  4BDZ A;  2K5F A;  1YIJ Q;  1FMK A;  1R0C B;  2LQK A;  2E70 A;  1UJY A;  3KFV A;  5IAY A;  3QII A;  1ZUU A;  3BFM A;  3LGF A;  2JT4 A;  4DA4 A;  3LGL A;  5CVI A;  4C8Q G;  4FW2 A;  5GAO n;  2L3R A;  4LNP A;  3OMG A;  5HKC A;  1S72 Q;  5GAM d;  3C12 A;  2NUT B;  3MEW A;  3REA B;  1BBZ A;  4E7S A;  1VQP Q;  2QA4 T;  1YIT T;  1PSF A;  4KGV B;  2DA9 A;  2ZCF B;  3H0H A;  2CSI A;  5DY9 A;  4RTX A;  1NPR A;  4FW1 A;  1IGU A;  5GMK e;  4BE0 A;  2F2V A;  2PUK B;  3JCM X;  4BI4 A;  5C6S A;  3CC7 A;  2CT3 A;  4RTV A;  4C8Q D;  2K3X A;  3CCM T;  4C5G A;  1SSH A;  2FG0 A;  5J39 A;  2CUB A;  2COW A;  3HKS A;  4J6Y A;  1N9S A;  4ZGJ B;  4PJO F;  1VQL Q;  2OTL Q;  1UE9 A;  1ZQ1 A;  2A7Y A;  2FYK A;  1WPY A;  3RBB B;  1GBQ A;  4IUP A;  3CCM Q;  4HCK A;  3VS0 A;  1YBY A;  1Y7X A;  1BU1 A;  5I22 A;  2DD5 A;  5GAN d;  1B3Q A;  1UG1 A;  1W6X A;  3H41 A;  4EMK A;  1K8A R;  4EMK C;  4LE9 A;  3M0S A;  1M1K U;  2KRS A;  1PKT A;  2RQW A;  3OYM A;  3JCM W;  5IXF A;  2LP5 A;  2CT4 A;  2KMT A;  3HRT A;  2CDT A;  2YUO A;  1MV3 A;  4GBQ A;  3VUB A;  2EJG A;  4PNO A;  2RI5 A;  2QDL A;  3QHS A;  1S72 T;  2JNG A;  5FRM A;  2EYW A;  4O6J A;  1BI2 A;  3CBM A;  1YI2 T;  3I55 Q;  3CCS A;  3QYH B;  4ZNX A;  2L89 A;  4JZ3 A;  4WF2 A;  1Y0M A;  2LX7 A;  2LVM A;  3M59 A;  5KYX A;  5GAM h;  1EX4 A;  5LJ5 e;  2LCC A;  2E6N A;  5GAO l;  3EG3 A;  2ENM A;  3P8B B;  3UWN A;  2GGR A;  1YWO A;  3JB9 J;  3VRY A;  3OSV A;  1VQ9 A;  2F1L A;  3JB9 I;  4BY6 B;  2IIM A;  5ECA A;  4BUG A;  2YXY A;  2HSE B;  3EH2 A;  4B6M A;  4E7K A;  4F7U G;  4JRK A;  4GLM A;  2DAQ A;  3CXC A;  3MCA B;  3PNW C;  2PZ1 A;  1JEG A;  1JXO A;  3CEY A;  5CKB A;  3JCM P;  2FO0 A;  2VAS A;  3J81 E;  2HD0 A;  4BD3 A;  3MP8 A;  3EGX B;  2HAX A;  2DL7 A;  3TEE A;  5GAN 5;  4PLL A;  3CCL T;  4FM4 B;  4AMC A;  2CZ0 B;  3CCV Q;  2RK1 A;  5GJW B;  4PL6 A;  1KC8 R;  5GMK j;  2DL4 A;  1M2O A;  5GAN 7;  2VC8 A;  2DVE A;  3M53 A;  5KYW B;  3PT9 A;  1NPP A;  3UA7 A;  1VIE A;  2HQX A;  5FU7 B;  3CCL A;  1D3B B;  4FCY A;  4R55 A;  4CI0 C;  4M77 E;  4DEX A;  1R0B G;  1M2V A;  1D0Z A;  1E7O A;  4C0D B;  1G8X A;  4EIK A;  4LD6 A;  1AVZ C;  2CP0 A;  2A08 A;  4FYW B;  3OW2 P;  2D0Q B;  2D8H A;  3A8M B;  1I07 A;  2CUD A;  1SSF A;  4GLK A;  3FJ5 A;  2HNI A;  4M75 B;  4Y91 A;  1Y96 B;  2KT8 A;  3BY7 A;  7AT1 B;  1QP3 A;  3DLM A;  4KH0 B;  2COY A;  3X26 B;  4N4H A;  2RA2 A;  3CCS Q;  1N8R C;  3JCM V;  3CCE A;  3QBY A;  4QVC A;  5LJ3 f;  1WHM A;  1WHH A;  1QVG S;  3EHR A;  4KH1 B;  3PIO A;  1YI2 A;  2YSQ A;  2H8H A;  1V1C A;  3TSZ A;  1GCQ C;  3VS1 A;  1VQK Q;  2E10 A;  3JCM h;  2ED1 A;  2SRC A;  1NLP C;  4KT0 E;  1QCO A;  3CPW P;  5L23 A;  2QQS A;  2JTM A;  3GIB A;  4AFQ C;  3CCM A;  1KD1 U;  3A98 A;  2RD1 A;  1VQL A;  3CC4 Q;  3MP6 A;  6AT1 B;  2EYQ A;  1H8K A;  4M75 F;  2EGE A;  3P8D A;  5EC7 A;  2QQA A;  4QW2 A;  3MP1 A;  2M16 A;  1TTH B;  1QQJ A;  1QKW A;  2LZ6 B;  1WJR A;  1GL5 A;  4M75 E;  4DOW A;  2QYZ A;  3OYY A;  5CR2 A;  2DKG A;  5LJ5 j;  1VQO Q;  1Q82 C;  2PVD B;  3MEA A;  2E3H A;  1KQ2 A;  4M7A F;  3CXC S;  1ZBJ A;  1TS9 A;  4LDW A;  2EKH A;  2QK0 A;  2DF6 A;  1K0S A;  4RCB A;  2QTX A;  2RHY A;  3VS7 A;  2MPX C;  2IVW A;  2RHU A;  4OB3 B;  3H0F A;  2HQE A;  3SHW A;  1SHF A;  5KH6 A;  4FL6 A;  1VQ6 A;  4L6V 5;  1XJW B;  1QWE A;  1LJO A;  2F69 A;  3C0C A;  1B34 B;  2L2P A;  1X6G A;  1M3B A;  1LPL A;  1VQ6 Q;  3CME A;  3CPW S;  1YJN T;  4ATO A;  2OX7 A;  4M77 G;  4CC2 A;  4M78 A;  2M9U A;  1NG2 A;  3QO3 A;  1YIJ A;  1PSE A;  1HYO A;  5CCA A;  2J6F A;  2Y4X A;  1YJW T;  2RMO A;  4F7U A;  1EIF A;  2YRD A;  1I5O B;  1M3A A;  1RAD B;  1JO8 A;  2M51 A;  5CO7 A;  1ZUY A;  1FWZ A;  2LT1 A;  2ZPG B;  3JCM J;  2O31 A;  4HT9 A;  2EQU A;  3I35 A;  2X51 A;  4FT4 A;  3H6Z A;  2K79 A;  1NZ9 A;  1VYT A;  1M8M A;  4PJO G;  2OTJ A;  1PC0 A;  1Y57 A;  2VYT A;  3JCM c;  2DMO A;  1WHG A;  2M0Y A;  2RJD A;  1G2B A;  4CC4 B;  3QKJ A;  3OW2 S;  2RNA A;  1VQK A;  1N5Z A;  3CCR A;  1WIE A;  2GQV A;  1NJI R;  3CCE T;  3LX7 A;  1VQ7 Q;  4C8Q B;  1T0H A;  1DJ7 B;  2KNB B;  1R77 A;  1MND A;  3ZBD A;  1G5V A;  1Q82 U;  1UGV A;  4JS5 A;  1NEG A;  5GAN h;  1VQO T;  2C06 A;  2F2X A;  3FRN A;  1KHC A;  1IZ6 A;  1TG0 A;  1Q81 C;  3CC2 T;  1VYV A;  2Y90 A;  3OYE A;  3I56 A;  4J9F A;  1ABO A;  3VS3 A;  4ANJ A;  2E5K A;  1RLP C;  2GTJ A;  2YUP A;  2RK2 A;  2O4X A;  3OB9 A;  4MZT A;  1MNE A;  2NLU A;  1BKB A;  2VGN A;  3A1P A;  4J9H A;  3T9N A;  4C0D C;  3L2U A;  2GNC A;  4C5I A;  3G71 A;  5LJ3 d;  1GXI E;  2CRE A;  1N9R A;  1JBM A;  1PD1 A;  5CKE A;  1D0X A;  2BZX A;  4M77 A;  5DLQ E;  4PJO D;  1YNZ A;  2COZ A;  2EQJ A;  5HK3 A;  4ZTF A;  1FYN A;  2RJF A;  3M0P A;  1KQ1 A;  1M8V A;  1NYG A;  1WHJ A;  3CC4 A;  4M78 D;  5A0L A;  2DJQ A;  1JB0 E;  1IRE B;  2QA4 Q;  4OGE A;  2CP3 A;  3CD6 T;  2DYI A;  3G71 T;  2RJE A;  2HKQ B;  4IUR A;  4AT1 B;  2LJ1 A;  2JJ9 A;  1D0Y A;  1RL2 A;  1MMG A;  2E4H A;  3M5A A;  4HVV A;  1X2Q A;  4XTU A;  1VQ8 A;  2OI3 A;  5GAN j;  5GAN f;  3EG1 A;  4M7D D;  3A8H B;  3CCU A;  2FZC B;  4DBF A;  1M3C A;  3M57 A;  2QEX A;  2F5T X;  4JS4 A;  3CCJ A;  1GFC A;  3C94 A;  3L2Q A;  4RTZ A;  1Z9Q A;  2MWO A;  2QGF B;  1J3T A;  1YIJ T;  1IRX A;  3JCM f;  1VQ5 A;  3RNJ A;  2RB6 A;  4JJN K;  3WXM B;  4C8Q A;  1RAG B;  1PHT A;  3OYA A;  4CRI A;  2RHI A;  4PLI A;  1UFF A;  4LDX A;  3CCS T;  5A2Q E;  4M7A C;  1YP5 A;  3HTR A;  2DVJ A;  2QXF A;  1JJ2 A;  1W4S A;  3MPU B;  5D6Y A;  4C92 B;  4X1V A;  2YLC A;  3E9G A;  3MHX A;  3SB2 A;  1QVF S;  5FU6 C;  2X4J A;  3EG9 B;  2WSE E;  4E2F B;  1QVG A;  2JTF A;  3JCM g;  4BAC A;  3M56 A;  1O75 A;  5LJ3 j;  3NFC A;  3NMZ C;  2R58 A;  1X75 C;  3MEV A;  2DYB A;  2KQW A;  2NYS A;  1BI3 A;  2V8K A;  4RTT A;  4Z8A A;  1OU8 A;  2JM9 A;  2MYS A;  3OYF A;  1WHL A;  4DBR A;  1RI9 A;  5GAN 3;  4KUI A;  2QAZ A;  2WSC E;  1S1N A;  2YUN A;  2FRW A;  5CAI A;  2A3L A;  2H3J A;  1UGP B;  1Q82 R;  1PKS A;  3JCM Q;  1RAA B;  2W10 A;  3TQ7 P;  5IHN A;  3QYG B;  5GAM e;  1X6O A;  2LMJ A;  2O2O A;  4L59 A;  1K8A U;  2CH4 W;  5I21 A;  4P5N A;  1RAE B;  3QPH A;  2QAS A;  2PU9 B;  4EMG A;  4JJD A;  3QDF A;  4HCB A;  1YHQ T;  3HP9 A;  1I0C A;  3NPF A;  5KCH A;  4XTW A;  4Y92 A;  4XQ3 A;  3OYL A;  2BTT A;  4XU2 A;  1XNI A;  3G1J A;  2AZS A;  3FC3 A;  3AT1 B;  3V8L A;  2K5L A;  2L3S A;  5GAO q;  1XOV A;  1GCQ A;  2ZAE A;  1GFD A;  1FX7 A;  3VS4 A;  4K11 A;  5L8R E;  3UAT A;  4M75 D;  5AT1 B;  1TXQ A;  5GAM g;  2DZ9 A;  2FL7 A;  2L8D A;  4QQG A;  2XK0 A;  2XU8 A;  2M02 A;  2DL8 A;  4OMQ A;  1K9M U;  3O5Z A;  5CKD A;  1UGR B;  2GFU A;  2QDY B;  1WA7 A;  4M7A G;  1ZUK A;  4Z88 A;  3OMC A;  4BY6 C;  2RN8 A;  4X9C A;  2R57 A;  1ZSZ A;  3C4S A;  1QW1 A;  1G3Y A;  2B86 A;  3VUZ A;  2P0K A;  1M1K R;  2XDD A;  1IGQ A;  1K9A A;  4ESR A;  3WVE B;  1MV0 B;  4M78 E;  4CC3 A;  3G6E T;  3OYJ A;  3S3N A;  4ME7 A;  4Z02 A;  4F04 B;  2BE9 B;  1KQS S;  5GAN g;  1HSQ A;  2DXU A;  3L2W A;  2HL5 C;  2KYM A;  1IXD A;  5M9O A;  3BDU A;  4JRP A;  1AZG B;  3DLL A;  4ELZ C;  2EVR A;  1Y71 A;  1TWB A;  1WQ7 A;  2I0N A;  3CCR Q;  2K2V A;  1K73 U;  1OI1 A;  3JCM b;  5IT9 E;  1JJ2 S;  5DLO A;  4HCC A;  4WTO B;  4V2S A;  4M7D A;  1BI0 A;  5GAO p;  2YDL A;  2OAU A;  3ZEH A;  5GMK m;  1N8R R;  1TOV A;  5GAN e;  3CC7 Q;  3V7R A;  2KK4 A;  4FSX A;  3EH1 A;  1PWT A;  2I2L A;  4KBM B;  3KUF A;  2IG0 A;  2E64 A;  1G3T A;  1WNL A;  1MMA A;  1TUG B;  2M0O A;  4NOY A;  2YWW A;  3EFO A;  1QVP A;  3BW1 A;  3EHQ A;  4C8Q F;  5GMK i;  3LW5 E;  4AFZ C;  1YIT A;  5CQX A;  1AOJ A;  2DPP B;  2AZV A;  3CCJ T;  4AFS C;  3VJP A;  3DB4 A;  1SKU B;  4J8O A;  5CIU A;  1TSF A;  1K9M C;  1BB9 A;  3OBY A;  4M75 G;  5HK0 A;  4IKF A;  1KFZ A;  3V7S A;  3JRZ A;  2VWF A;  1KC8 U;  2JOY A;  1ABQ A;  4A4K A;  3LH5 A;  1VQ6 T;  4J9G A;  1VQ4 A;  3PVQ A;  2CS7 A;  1QP2 A;  1JRI A;  1UEC A;  2XHC A;  3CD6 Q;  1E6H A;  3OBW A;  2CGH A;  2YRC A;  3HFN A;  3QWY A;  2KGT A;  2DZC A;  3L1A A;  2OTL T;  2RJC A;  2RQT A;  2KRN A;  3FJP A;  4C92 G;  1YJN A;  4NS5 A;  4PJO E;  2KBT A;  4JLG A;  3KBG A;  2EIF A;  4M77 C;  2X9H A;  3J7A F;  4IUU A;  4PKC C;  2CZ7 B;  3CPW A;  2HEQ A;  3QSU A;  4M77 F;  2JZ2 A;  3ME9 A;  2PVG B;  2RHX A;  4RUG A;  3X28 B;  4C92 A;  1XQH A;  1AZE A;  4XTX A;  4F16 A;  1X6B A;  3RDV A;  4ORZ A;  4OP0 A;  3G6E Q;  3A8L B;  5DM7 R;  2R5A A;  2DXT A;  3MET A;  1RAH B;  2RI2 A;  1X43 A;  2XI9 A;  4M4Z A;  1Q7Y C;  4BE1 A;  4RTU A;  2OTJ T;  3HHT B;  1AEY A;  3V8J A;  2L3P A;  2DD4 A;  5GAM j;  3BE3 A;  1YI2 Q;  2J05 A;  3S3O A;  3GP8 A;  2DNU A;  1B07 A;  3M54 A;  3E9F A;  2JVV A;  2A0F B;  1OEB A;  5FW9 A;  4DEY A;  3NHN A;  3LYI A;  3CCR T;  1ZBX A;  2MI6 A;  2VGM A;  1SF9 A;  4LD9 K;  4M7D E;  4M7A E;  4X34 A;  1PG5 B;  4J83 A;  3OYH A;  3JCM e;  1KD1 R;  4PJJ A;  4J5Y A;  3OYG A;  4UC4 A;  1D1A A;  3G7Z A;  1N6A A;  3RKY A;  3OYD A;  1QKX A;  4C92 D;  3QUI A;  1HXD A;  1OQK A;  3LH0 A;  1GBR A;  4KUL A;  3NTK A;  5GJV B;  2EQK A;  3GOX A;  2W0Z A;  3JB9 H;  3KXT A;  2BZ8 A;  2FPE A;  2JM8 A;  3TU4 K;  3VKI A;  8ATC B;  1NBE B;  1PCX A;  3EFR A;  2E3I A;  1XTD A;  1Q86 U;  1M27 C;  1ZSZ B;  3CCL Q;  2MK5 A;  4LUE A;  4R0K A;  2GF7 A;  4YTL A;  4FIB A;  4ELY C;  1M2V B;  3UT1 A;  1RAF B;  1MHN A;  4XU1 A;  1IHW A;  4F17 A;  2WAC A;  4C5H A;  5KYN A;  2ZPF B;  1HK9 A;  1OZ3 A;  1OPK A;  2OAW A;  3CCU Q;  3VRZ A;  2EYZ A;  2AKL A;  3CCV A;  4M78 F;  5IHI A;  4KUD K;  1OYX A;  2F5K A;  1KJW A;  1U1S A;  4FSS A;  1VQ8 T;  1Q7Y U;  1PM3 A;  2YUQ A;  2VB6 A;  2QA4 A;  5FU6 B;  3HL8 A;  1KSW A;  4OMP A;  4MZM A;  1WXU A;  1VQ8 Q;  4HXJ A;  2HDA A;  3WVD B;  4D6W A;  2DBM A;  2QG9 B;  2O01 E;  5LJ5 d;  3H8Z A;  4N4I A;  1ZA1 B;  2FPD A;  4II1 A;  3UDC A;  1QVF P;  4RG2 A;  2AKK A;  2LDM A;  1YJ9 Q;  2EGC A;  4ZGE B;  3CC2 Q;  3VYG A;  1D09 B;  5I2S A;  1WJS A;  4KGX B;  1VQP T;  3IQL A;  2KRM A;  1A0N B;  2MWP A;  3HFO A;  1VQ9 T;  2ZGW A;  3QXE B;  1Q95 G;  1VYU A;  4M75 A;  4OMM A;  1QCN A;  3EFO B;  3CBO A;  1TH7 A;  3FB9 A;  4MDW A;  3CXC P;  2PTK A;  1MUZ A;  2A28 A;  3G71 Q;  2ECZ A;  3DB3 A;  2VXF A;  1VA7 A;  5IHK A;  2R5M A;  4X9D A;  2K4Y A;  3HPW A;  4C0Z A;  4BDY A;  3P8H A;  1GCP A;  2VV5 A;  1M30 A;  1Q86 C;  3AHU A;  4RTW A;  1YJW A;  1FXX A;  4XU0 A;  2QGG A;  1G3S A;  1OZ2 A;  1ZX6 A;  2BIV A;  2ED0 A;  3X24 B;  4ZTJ A;  2DTI A;  3EG0 A;  1R8O B;  2CZ1 B;  5KYY A;  3GPL A;  2BKD N;  1UGS B;  1KHI A;  4MML A;  2RH2 A;  3L2Z A;  2HSP A;  5LJ5 h;  2CZ6 B;  5D7U A;  5C0M A;  2A36 A;  1YJ9 T;  5GAN 6;  4O5V A;  1VQ7 A;  4JRQ A;  2GBQ A;  2X4Y A;  1K0X A;  4N0A C;  2DRM A;  1AT1 B;  4FYX B;  4J6X A;  2XD0 A;  1CKA A;  4J9C A;  4BI3 A;  3QWX X;  3EGD B;  3LLR A;  2OTJ Q;  2MF2 A;  4M7D B;  2BUD A;  3RUX A;  5J26 A;  2RQV A;  1SEM A;  3M0R A;  2GQI A;  1M1K C;  4D8K A;  3E19 A;  4C92 E;  3M9Q A;  4J9E A;  3NTH A;  3GBQ A;  1YN8 A;  3VYH B;  2DEQ A;  5I11 A;  2DLP A;  2V1R A;  1RUW A;  2KVQ G;  3MEU A;  2FB7 A;  5IH2 A;  2D8J A;  4FYV B;  2X3W D;  2CP2 A;  2L0A A;  4IUT A; 
#chains in the Genus database with same CATH homology
 2ROT A;  4EIK A;  2CSQ A;  1AVZ C;  2B86 A;  4A63 B;  2A08 A;  4JPB W;  1K9A A;  2MIO A;  2D8H A;  4ESR A;  1I07 A;  1MV0 B;  2CUD A;  2FEI A;  1JXM A;  2AK5 A;  4CC3 A;  2FPF A;  3FJ5 A;  3UA6 A;  1UJ0 A;  1UHC A;  2KT8 A;  1HSQ A;  2EBP A;  4OMN A;  2KYM A;  3SEM A;  1PRL C;  2XMF A;  1LCK A;  3VS2 A;  2X3X D;  1G83 A;  1T0J A;  2DL5 A;  1AZG B;  2EVR A;  2I0N A;  2RQU A;  1UUE A;  3VS6 A;  3PE0 A;  4CC7 A;  4AG1 C;  1KIK A;  3EHR A;  1K4U S;  1CSK A;  3VS5 A;  2YSQ A;  2H8H A;  1V1C A;  1AWJ A;  4HVW A;  1YWP A;  2LJ0 A;  2JS0 A;  3M0T A;  3TSZ A;  4D8D A;  1GCQ C;  3VS1 A;  4WCI A;  2YDL A;  2ED1 A;  2SRC A;  1NLP C;  1WDX A;  2MOX A;  5L23 A;  4LUD A;  1CKB A;  4AFQ C;  2D0N A;  1QCF A;  1OPL A;  3A98 A;  1JQQ A;  1EFN A;  1PWT A;  1WYX A;  2LJ3 A;  4IIM A;  1H8K A;  1SRM A;  1SHG A;  2EGE A;  5EC7 A;  2SEM A;  1NM7 A;  2DE0 X;  3M0U A;  2JW4 A;  2MCN A;  2LQW A;  1T3S A;  1QKW A;  2LZ6 B;  2OJ2 A;  3EHQ A;  1GL5 A;  1WI7 A;  4AFZ C;  2L3Q A;  2JS2 A;  1AOJ A;  1U3O A;  2AZV A;  4AFS C;  1WLP B;  2K7A A;  2C0O A;  2O88 A;  1UHF A;  2LNH B;  4HVU A;  2O9V A;  1BB9 A;  1WXT A;  1ZBJ A;  1QLY A;  1KFZ A;  1NYF A;  1SPK A;  2VWF A;  2EKH A;  1PNJ A;  2DF6 A;  2K3B A;  1K0S A;  1ABQ A;  3VS7 A;  1SRL A;  1IO6 A;  2F2W A;  3LH5 A;  4J9G A;  3PVQ A;  2EW3 A;  3H0F A;  3SHW A;  1UEC A;  4QT7 A;  1SHF A;  5IXB A;  1E6H A;  1K76 A;  4J9D A;  3M0Q A;  2G6F X;  1QWE A;  1H92 A;  3C0C A;  2L2P A;  1X6G A;  2KGT A;  3QWY A;  1M3B A;  2VKN A;  2FRY A;  4AG2 C;  1AWW A;  1U06 A;  4CC2 A;  2A37 A;  2RQT A;  2KRN A;  3EG2 A;  2C0T A;  1W70 A;  3UF4 A;  2KBT A;  1NG2 A;  1ARK A;  2J6F A;  2KE9 A;  1AWO A;  2RMO A;  1YCS B;  2KT1 A;  2HEQ A;  2J7I A;  1RLQ C;  2EYX A;  1M3A A;  4RUG A;  1JO8 A;  1X2K A;  2M51 A;  2NWM A;  1ZUY A;  1AZE A;  4F16 A;  1X6B A;  5FWC A;  2DBK A;  4ORZ A;  2ROL A;  1WXB A;  1T3L A;  2O31 A;  2LQN A;  4JZ4 A;  4AFU C;  1H3H A;  1X43 A;  3I35 A;  2J6O A;  1TUC A;  4M4Z A;  2DX1 A;  2D1X A;  2JMC A;  3I9Q A;  4RTU A;  1AD5 A;  1AEY A;  2JXB A;  2L3P A;  2K79 A;  1VYT A;  1M8M A;  1Y57 A;  2J05 A;  2DMO A;  2DNU A;  3R6N A;  1B07 A;  2M0Y A;  2KXD A;  1G2B A;  4CC4 B;  2EYY A;  2RNA A;  1N5Z A;  1OEB A;  2J06 A;  1GRI A;  1WIE A;  5FW9 A;  2VVK A;  1WX6 A;  4DEY A;  3NHN A;  2KEA A;  1W1F A;  4Z89 A;  2DIL A;  1BK2 A;  1NEB A;  1T0H A;  3ULR B;  1UDL A;  2KNB B;  1PRM C;  1K1Z A;  1UGV A;  3JV3 A;  1NEG A;  3I5S A;  2RF0 A;  2F2X A;  2EPD A;  3THK A;  2NUZ A;  2YT6 A;  1TG0 A;  2EQI A;  1VYV A;  2JTE A;  1FMK A;  3H0I A;  4J9F A;  1ABO A;  3VS3 A;  4OML A;  4RTY A;  1UJY A;  2E5K A;  1QKX A;  1RLP C;  3KFV A;  1GBR A;  4J9B A;  2GTJ A;  2YUP A;  1ZUU A;  5GJV B;  2W0Z A;  4IIO A;  2BZ8 A;  2JT4 A;  1X27 A;  2FPE A;  2JM8 A;  4J9H A;  2KXC A;  4LNP A;  2GNC A;  1ZLM A;  1M27 C;  2CRE A;  2C0I A;  4JJB A;  4LUE A;  2BZX A;  4R0K A;  2EGA A;  4E6R A;  3U23 A;  3REA B;  1BBZ A;  4LN2 A;  1YNZ A;  3PVL A;  1FYN A;  4F17 A;  3M0P A;  2DA9 A;  3H0H A;  1NYG A;  2CSI A;  1OPK A;  4RTX A;  2RQR A;  2OAW A;  2KR3 A;  2GTO A;  2DJQ A;  2EYZ A;  3VRZ A;  2AKL A;  2F2V A;  5IHI A;  1JU5 C;  2CT3 A;  4RTV A;  2ESW A;  1SSH A;  2FG0 A;  2LJ1 A;  1KJW A;  2CUB A;  4FSS A;  2KYB A;  5HCK A;  2YUQ A;  1UE9 A;  4HVV A;  1X2Q A;  2OI3 A;  3RBB B;  1GBQ A;  4KRT A;  1KSW A;  2JMA A;  3EG1 A;  1WXU A;  4HCK A;  4OMP A;  1TUD A;  3VS0 A;  1BU1 A;  5I22 A;  1B3Q A;  2ABL A;  2HDA A;  4HXJ A;  1UG1 A;  1M3C A;  2DBM A;  2V1Q A;  1GFC A;  1HD3 A;  1W6X A;  3H41 A;  2FPD A;  4RTZ A;  1E6G A;  4LE9 A;  1Z9Q A;  3M0S A;  2KRS A;  4OMO A;  1J3T A;  2AKK A;  1PKT A;  1HJD A;  2EGC A;  2RQW A;  3RNJ A;  5IXF A;  2LP5 A;  2CT4 A;  2DM1 A;  2CDT A;  2KRM A;  3IQL A;  2YUO A;  1MV3 A;  1PHT A;  4GBQ A;  4JJC A;  1A0N B;  1OV3 A;  2QDL A;  1UTI A;  1UFF A;  3TVT A;  2EYW A;  1VYU A;  2O9S A;  1YP5 A;  4OMM A;  2DVJ A;  4X1V A;  4ZNX A;  2PTK A;  4JZ3 A;  1MUZ A;  1Y0M A;  2LX7 A;  2A28 A;  1NLO C;  1U5S A;  2ECZ A;  1VA7 A;  5IHK A;  3NMZ C;  2RPN A;  3EG3 A;  2ENM A;  2DYB A;  1GCP A;  2GGR A;  2K2M A;  1M30 A;  1YWO A;  3VRY A;  4RTW A;  4RTT A;  4Z8A A;  2JM9 A;  1ZX6 A;  2ED0 A;  2HCK A;  2IIM A;  1RI9 A;  5ECA A;  1ZSG A;  1Z9Z A;  2P4R A;  2KRO A;  3I5R A;  1S1N A;  2YUN A;  2FRW A;  3EG0 A;  1X69 A;  1WFW A;  2CH4 A;  1PKS A;  2HBW A;  2W10 A;  2HSP A;  4GLM A;  5IHN A;  2K9G A;  2BZY A;  2PZ1 A;  3EGU A;  1JEG A;  2A36 A;  1JXO A;  4F14 A;  2LMJ A;  2FO0 A;  2O2O A;  2CH4 W;  2DL3 A;  2DRK A;  2J6K A;  2DL7 A;  2GBQ A;  2PNI A;  2K6D A;  1K0X A;  2DRM A;  1I1J A;  4JJD A;  3ZL7 C;  1I0C A;  3NPF A;  1CKA A;  3TSW A;  4Y92 A;  4J9C A;  2BTT A;  3QWX X;  5GJW B;  1AWX A;  2AZS A;  2DL4 A;  2L3S A;  4J9I A;  2RQV A;  3CQT A;  1XOV A;  1GCQ A;  1SEM A;  3M0R A;  2GQI A;  5FWB A;  3VS4 A;  1GFD A;  1QWF A;  4K11 A;  3UAT A;  4D8K A;  4J9E A;  3UA7 A;  3GBQ A;  1YN8 A;  3NGP A;  5I11 A;  2DLP A;  3REB B;  2DL8 A;  4OMQ A;  2LCS A;  2V1R A;  1RUW A;  3O5Z A;  4DEX A;  5IH2 A;  2D8J A;  2X3W D;  1OOT A;  1WA7 A;  1ZUK A;  4Z88 A;  1E7O A;  2L0A A;  2RN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...