4A4EA

Solution structure of smn tudor domain in complex with symmetrically dimethylated arginine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords SURVIVAL MOTOR NEURON PROTEIN
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4eA00
3LGFA 3OYCA 2HQXA 3PMTA 5IN1A 5D6WA 2MWPA 2RI5A 2DAQA 2O4XA 3C4SA 3MEAA 4GY5A 2RHIA 2RHXA 4E7HA 5KCHA 4IUVA 1G5VA 5IAYA 4E7KA 4X34A 5M9OA 4BE0A 2E6NA 2QQSA 2X35A 3GOXA 1OZ2A 3LLRA 3FC3A 3MEVA 5CIUA 2L89A 4C5GA 3META 3LGLA 5J26A 1MHNA 4IUQA 5KE3A 3OB9A 4BDYA 4C5HA 3OMGA 3FEOA 3DB3A 3SD4A 4E7IA 2BIVA 2QQRA 4Z02A 2EQJA 5J39A 4FU6A 3OYJA 4IKFA 3QKJA 4BE2A 4BACA 4EDUA 3MEWA 4IUTA 3L42A 3KUFA 3LX7A 2VYTA 3OYKA 2R5MA 3OYFA 4B9XA 3ZEHA 2LRQA 3OS2A 2K3YA 3LYIA 4PLIA 4QQDA 3PFSA 4PL6A 3H6ZA 4NS5A 3EAEA 3L2VA 2DIGA 3E9GA 3PMIA 4QW2A 4A4GA 1H3ZA 1OI1A 3OS1A 3QIIA 2RI2A 2GFUA 3F70A 4N4HA 1KHCA 3MP8A 2EFIA 2L8DA 2LDMA 2RHYA 4E7JA 3NTHA 5FRNA 2RJFA 4UC4A 4RG2A 3S3OA 1SSFA 3BDLA 4OVAA 2PQWA 3NTIA 4QQGA 4IUUA 1WJSA 3QJ6A 2R57A 1WGSA 4II1A 4IUPA 4N4IA 3CEYA 3OS0A 3DB4A 2FHDA 4LD6A 3L2WA 3QBYA 5C0MA 1WJQA 2RHUA 2RJDA 4BD3A 3PNWC 2BKDN 3ASKA 2E5QA 1XNIA 4IURA 3UT1A 3L2UA 3MP6A 3OMCA 4E7LA 2BUDA 4HCZA 4N4GA 2JZ2A 4ZTFA 4ZTJA 2LCCA 2F5KA 4C5IA 2D9TA 4C5EA 1RI0A 3MO8A 3OYAA 4BE1A 3OYIA 1N27A 5D6XA 3OYEA 5C6SA 2RJEA 4QQ6A 2XDPA 3OYBA 3FLGA 2EQKA 2RHZA 3E9FA 3P8HA 2EKOA 2EQMA 2GF7A 1OZ3A 2R5AA 2XK0A 3FDRA 3ME9A 3NTKA 3OQ5A 4L59A 4A4FA 2NLUA 2GFAA 2LVMA 3S3MA 2X4WA 2L3RA 2RI3A 3P8DA 3M9QA 2WACA 3OYMA 2X4XA 2RO0A 4Q5WA 3S6WA 2DIQA 3L2RA 1WJRA 5FRMA 2MWOA 3OYHA 1OYXA 3MEUA 2EQUA 2IG0A 5KE2A 2LTOA 4PLLA 4B9WA 4CRIA 3OY9A 3OA6A 4A4EA 3DLMA 2G3RA 2CKKA 2HQEA 4A4HA 3OYNA 3MP1A 3UWNA 3OYLA 2O4XB 2M1HA 2JTFA 5FROA 3Q1JA 4BDZA 2R58A 3H8ZA 4FL6A 2K3XA 2X4YA 2M0OA 3OYGA 3S3NA 4QVZA 2RJCA 2P0KA 5KH6A 3OYDA 3L2QA 2B8AA 5D6YA 3LH0A 2M16A 2YRVA 5KCOA 3O8VA
chains in the Genus database with same CATH superfamily
2PZ1A 3EFOA 3CC4T 3L2ZA 3CC2Q 2DTIA 4XTXA 2HMAA 5I22A 1RADB 5M9OA 4DOVA 4X9DA 2COZA 3LGLA 3V8JA 1MHNA 4M78E 2DRMA 2IPOB 1BBZA 1KSWA 2RNAA 3QXEB 3KUFA 5HK3A 3JV3A 4CC3A 4QVDA 1AZEA 1Q7YU 3VU3C 3V7CA 2ZGWA 2L3PA 2ZZDA 4ZN3A 1W4SA 1VIEA 1VQ9A 5J3BA 2DK3A 1R77A 2OAUA 1F1BB 3MCAB 1W6XA 3BDLA 4A63B 2J05A 1FMKA 4XTWA 2Y4YA 4M77G 3TSWA 4HCBA 2DA9A 3CEYA 4RTWA 1YI2A 4WCIA 1ZUKA 3I9QA 1XNIA 3I55T 1I5LA 1EFNA 1BI0A 5HCKA 3OBYA 3MO8A 1ACMB 4CI0C 1ZHIA 1Q81C 1ZSZC 2DTHA 3M0UA 4XU1A 4AFUC 2CP2A 1U5SA 4XU0A 1VQ4T 1NEBA 5GMKl 3CCSQ 2LCLA 1VOMA 1J3TA 1OZ3A 4A4FA 2DERA 1VA7A 2F2VA 2YLCA 2RD1A 5AYFA 2YT6A 3N5BB 3H0IA 3EGXB 3V8LA 1C0MA 3OYMA 4M77D 3OYHA 2QTVA 1RABB 4J9BA 2GBQA 4C0GA 3M54A 1D09B 3SDZA 1Q86U 3O5ZA 1TH7A 3CCVT 2XI9A 3NFCA 3EG0A 7AT1B 2GNCA 2M0YA 4EMGA 2PVGB 2HQXA 4M7DE 2DAQA 1D0XA 3U23A 1HK9A 1YJWQ 2DZCA 2K5IA 2VWFA 4C0DC 1T0HA 1Y57A 2VGNA 3EGUA 1VYUA 1YJ9Q 1X75C 3FC3A 1YWPA 4PK4A 4A4KA 3CQTA 1GBQA 3KXTA 4JS4A 3I35A 3ER0A 1K9MR 4HVWA 3CMAA 4FU6A 3EFSA 4HT8A 1ARKA 1WIEA 1Q7YC 1GFCA 1I1JA 1KHIA 4RUGA 1ZA2B 4M75A 4KRTA 3L2VA 4LXCA 2PUOB 3PMIA 5CQYA 4LE9A 4FT2A 2D0QB 1PSFA 4PFZA 3RR6A 4M78F 3CCSA 1TOVA 4ESRA 2DPPB 4BY6B 1RACB 4N4IA 4FW2A 4PJOG 2DILA 4PJOC 2IIMA 2JM9A 1TUDA 1VIFA 4BB7A 2F2XA 4DOWA 4M78B 3QHSA 4OMFB 2D9TA 2E3IA 1W70A 1H8KA 5D6XA 5KYNA 3FLGA 4J83A 4QVCA 1OEBA 5KYWB 4FYXB 5L23A 5KYUA 2ROLA 1M3BA 3CD6Q 1YJWA 1IRXA 1M1GA 2OTLQ 4QT7A 3P8DA 1AWJA 1T3LA 2DL7A 2XU8A 5CCAA 3CCLQ 4PJOD 4B9WA 1PC0A 4A4EA 2G3RA 1FX7A 4MZPA 4PFPA 2DMOA 1Q86C 4M77E 4LDWA 3ZFJA 2M0OA 4JJBA 3OYGA 3SB2A 3EG1A 3HPWA 5GAOq 1UGRB 5D6YA 1HYOA 2FRWA 2JM8A 4XK8E 3OYCA 1D0YA 2MI6A 4DEXA 8ATCB 4JZ4A 3JSCA 4KGVB 2CYZB 2EBPA 3M5AA 5CKHA 2E6NA 2X35A 5GANg 3CCET 2EJGA 3KBGA 2NYSA 3I5SA 4M7DF 1WPYA 4RCCA 1QWFA 5GANe 3CCRQ 1YNZA 2C0TA 1GCPA 3M4YA 5FU6B 2HZYA 1NBEB 4ZGDB 3RMQA 1KHCA 2FB7A 1X6BA 2RJFA 4ATOA 4M7DB 4OVAA 1SF9A 1Y7XA 4N0AC 2BTTA 3HRTA 2R57A 1WGSA 2FHDA 4MZTA 1TWBA 3TVTA 3PNWC 4V2SA 1QKXA 3J7AF 1SEMA 2Z0WA 2LNVA 2OTJT 2GQVA 4BE1A 1GCQA 3OYIA 1KQSA 2H8HA 4HT9A 4GLMA 1AEYA 1Q95G 5GANh 4RG8A 3PT9A 3VS7A 2ZPHB 2X4WA 2L3RA 2CH4W 3EGDB 3M9QA 4AFZC 2CGHA 1SHGA 3MEUA 2HNIA 3OA6A 1VQPQ 2KYBA 4JPBW 3Q1JA 4QKUA 1U8RA 3VS3A 4MDXA 3WVEB 3L2QA 3EGXA 2RQWA 2RQTA 5CVIA 3JCMV 1VQ4A 4D8KA 2W0ZA 1LCKA 4E47A 1VQMQ 1K73R 3M59A 1YITQ 4JRKA 2CZ7B 1K8AU 1EX4A 4R56A 5GANj 2PU9B 2E64A 4M77F 1NM7A 1VQKQ 1VQ8Q 1B07A 2O9SA 1N9SA 4RTYA 4E2FB 2YRCA 1PD1A 1JQQA 1VQ7T 2QQRA 2I2LA 2O31A 3CPFA 3LWHA 2JTEA 1KFZA 2KNBB 5CR2A 2BZXA 1P92A 1LOJA 4M77B 3PFSA 5KYYB 1M2VA 2C0OA 2MF2A 5GANd 1H3ZA 2FEIA 3QO3A 2DLPA 2RF0A 1KQSP 3GNFB 1LVKA 1KC8R 2JNGA 1VYVA 3G4SQ 1M2OA 1WLPB 1ZSZB 4M7AG 2DL3A 4M7AC 2ZPFB 1FYNA 2MOXA 1X6GA 2GCXA 3DKMA 3OS0A 4F17A 1AHJB 3UA7A 2JXBA 2QASA 4JRIA 2E41A 4RTXA 4HCKA 2YXYA 3EHRA 4P5NA 3LWIA 4J7FA 2ZPGB 2EKOA 1YITA 4ANJA 2EYZA 4M78A 4KGZB 2YHTA 3VRYA 2FZCB 3OQ5A 1LJOA 2DJQA 2CT4A 4M7AD 5LJ3g 2RO0A 4FIBA 1VQKA 5GAN7 3DLMA 1MUZA 1ZQ1A 4J9FA 2K3BA 1UGPB 4PJMA 1WHGA 2CUDA 2DYBA 4FL6A 4C0DB 3ZL7C 5LJ3e 1Q82R 3M0SA 3CC2T 3RUXA 2XDDA 3QUIA 2KROA 2YUQA 1K8AC 2XD0A 3ZBDA 4OMPA 2ROTA 2QQ9A 1BU1A 4JDSA 2RI5A 2RK2A 1G2BA 2QEXQ 2RHIA 2XMFA 1IO6A 4PJOF 2HL5C 3VYGA 3JCMg 4O5VA 5LL6S 5IHNA 4B6MA 1QCFA 2RQUA 1BIAA 1M3AA 2K79A 2HCKA 5FWBA 4PKCC 3JCMP 4BE2A 1Y07A 3OYYA 3JCMe 2WSEE 3EG3A 3CMEQ 2ZPBB 4PJOB 1ZUUA 1UHCA 5LJ3h 2RI2A 1TG0A 1UGSB 4L5GA 1PKSA 3MP8A 2LDMA 3INZA 4OB3B 3VS6A 2HSEB 1NE8A 1SSFA 3BFMA 2F2WA 1B34B 3CCEA 2ABLA 3EFRA 3OW2P 2P84A 3URGA 2H3EB 3JCMb 1QMCA 1U1SA 4WTOB 4E7LA 2NUTA 2EPDA 4Y28E 4FCYA 2JZ2A 4ZTFA 4M7DA 3PTAA 1ABOA 2SEMA 1BB9A 2CP0A 4Y91A 4XQ3A 3JAME 4HCCA 3NMZC 1B3QA 2E5KA 1BI1A 3E9FA 3P8HA 5LJ3j 2FZGB 2P0QA 2MAMA 5KYXB 2RMOA 2DVEA 3X25B 2GFAA 1XQHA 2QEXA 2KRNA 2O01E 2VC8A 3CC7T 1MMDA 4KUIA 5L8RE 5GAOn 2WSFE 4AFQC 2PTKA 3TSZA 2OI3A 1WI7A 4BUGA 3I5RA 3UWNA 1KG1A 3EGDA 3TU4K 4LNPA 3OSSC 4BI3A 5LJ3d 2KEAA 3CMEA 3SWNB 1K0XA 5EG2A 1NYFA 4J9HA 2EYXA 1AD5A 5D6WA 2ESWA 1YI2Q 3UATA 4IIOA 2QI2A 5CIUA 2WSCE 3META 1Y0MA 2XIDA 5J26A 5KE3A 1KK7A 2ECZA 5IHKA 2HDAA 3VS1A 3OYJA 1U1TA 1KD1C 4J9CA 2JOYA 4F7UA 3X24B 3LX7A 1AVZC 1R0BG 4JLIA 1MNDA 4PL6A 3VUZA 3CCQT 2Y4XA 3JCMd 2YUOA 1K1ZA 2YWWA 1U06A 1SHFA 1KIKA 2DETA 2LT1A 2LQ8A 1KQ2A 4M77A 2HBWA 3NTIA 1ZUYA 1QWEA 3QWYA 5KYYA 1N9RA 3RIRA 4YTLA 5EC7A 2L3SA 2NUPB 2EGEA 4C8QG 2JT4A 4C8QC 4JLGA 3OMCA 4HCZA 2COYA 2VB6A 3RNJA 4C5EA 5I2MA 3CCMT 2I0NA 3CD6T 1WHHA 3D7SB 1O9SA 3RESA 9ATCB 2OTLT 1VQLQ 3CBOA 4C92G 4C92C 2RHZA 4FYWB 1YIJQ 2GF7A 5HK0A 1V76A 2CP3A 3S3MA 1M30A 3CMAQ 3RBBB 2DM1A 2MPXC 4HVVA 2A0FB 2F1LA 2MWOA 2LZ6B 2RK1A 1WA7A 2HL3A 1M5Q1 1JRIA 4C8QD 3OYNA 2CZ6B 3CCUT 2LT4A 1OV3A 2X4YA 2YLBA 1NLPC 2B8AA 3QDRB 1GFDA 4J8OA 3LH0A 1YHQA 3G6EA 2EVRA 1WHKA 3HRUA 3M0TA 3CPWA 4C92D 1YJNQ 1NJIR 1U3OA 2C06A 4ZN1A 1BCMA 1G5VA 4M7AF 1XTDA 2EAYA 1OZ2A 2KE9A 2DO3A 4MDWA 3CCRT 1V29B 4HA8A 2GGRA 4XAXB 1IB8A 4KULA 3QDFA 2DFUA 2ZAEA 4ZGJB 2DL8A 2A28A 3OYFA 4A54A 4LDYA 1SG5A 1OX8A 2DXUA 1VQLA 2EFIA 2RHYA 3VS2A 2VKNA 1YIJA 3TREA 1ZBJA 2OJ2A 4Z88A 2YUNA 3QPHA 3QSUA 1YP5A 2KI7A 3X26B 2FVUA 3QJ6A 5GAN3 1M8MA 1QW1A 2PNIA 3PE0A 3L2UA 5IH2A 1WXUA 4LDUA 1QQJA 2O88A 1B34A 3HP9A 1VQ5T 2ATCB 3OBWA 2L3QA 1MNEA 2P4TA 2XDPA 1IZ6A 5HY6A 5I11A 4PNOA 2HKNA 1M3CA 4NL3A 1YJNA 3HKSA 3SFMA 3CPWP 2QA4A 4M4ZA 2KRMA 2PVOB 1M1KR 3L1AA 2LQWA 1K9MC 1QVFP 2EQUA 3OY9A 1YBYA 3EH1A 1FMWA 5KYXA 2CKKA 1VQMT 1TS9A 2O4XB 3CC4Q 3CCJT 2R58A 3THKA 1ZX6A 4KUDK 4XTVA 4HKEA 3RERA 4E7SA 5DM7R 1WFWA 2J6FA 1D1CA 4RCBA 4Y92A 1WHLA 2DL4A 1VQ8T 4O6JA 1TU0B 1WYXA 2QGGA 2JTMA 4M75G 4M75C 2RHXA 3CC7A 5GANf 1M90U 3I56A 1YWOA 1CKBA 4JS5A 3SWNA 1O75A 1JBMA 1WX6A 1MV3A 1LPLA 1UFFA 1UGVA 4NL2A 1EIFA 1N8RU 2R5MA 3E2UA 2K4YA 3X28B 2P4RA 1KQSS 4EPCA 1LNXA 4TVRA 1NLOC 1K4US 3ULRB 4JJNK 2QDYB 2DXBA 4JJCA 1VQNA 3I55Q 4CC2A 1KQ1A 4M75D 2DD5A 2PQWA 3GLXA 2GTJA 2V1QA 4IUPA 1Y71A 4J9DA 2AKKA 1VQ4Q 4ZGEB 4E7ZA 1BI3A 4ZTJA 1XOVA 1QVGA 4AT1B 3CC4A 2K2MA 1X6OA 1ZA1B 3OYAA 1K73U 2BE9B 3M57A 5C6SA 1VQOT 4OMOA 3HL8A 2J7IA 2NUPA 3JB9I 1UG1A 4FSSA 2D1XA 1WQWA 2L5QA 1VQ6T 5GMKi 3X20B 2DRKA 1RAEB 4AMCA 3CCVQ 3L2RA 2QGFB 2IG0A 2E1HA 4EMKB 2A08A 3MP1A 4PFOA 2LQKA 1NPRA 2KBTA 3RDVA 5IXFA 4OGCA 1SRLA 2M02A 4LUEA 3G7ZA 2KDSA 4FSXA 5FU7C 3JCMQ 1KC8U 1S72T 6AT1B 3I55A 4JUVA 1M90C 1Z9ZA 5GAOr 3QYHB 2M9UA 3LLRA 2VV5A 2EWNA 1M1FA 4BI8B 3AT1B 4C8QF 1HSQA 4PJOE 1QCOA 3RKXA 3M4GA 4J6XA 4JRQA 3SEMA 1N8RC 4IUTA 5LJ5g 5GAMg 3V7RA 3A5ZB 2K3YA 2Y90A 1UHFA 1FXXA 3C95A 2BZYA 3E19A 3GF5A 4C92F 1BYMA 4QW2A 3CBMA 1QVGP 4J6YA 2MK5A 2GFUA 4HXJA 2DKGA 1GCQC 2J6OA 5LJ5e 5GAMe 3OW2S 2V8IA 2JJ9A 1WXTA 4OMLA 2QQBA 3LW5E 4Z89A 1V1CA 1E6GA 1N6AA 3DB4A 3CCVA 1WJQA 1FMVA 1ABQA 2DBMA 3ASKA 3FRNA 1D1AA 3VYHB 1G3TA 1W1FA 2LCCA 1K73C 1RI0A 4LDXA 3WVDB 4J7IA 3JB9G 1N27A 5GJWB 3NPFA 4DEYA 2RJEA 3QJYA 2BZ8A 3GNGA 5LJ3f 2KR3A 1I0CA 3ME9A 1SSHA 2PUKB 4CC4B 1QP3A 5GAMh 3VS5A 1VQ9T 4CRIA 2KXCA 2CREA 5FROA 1IXDA 2FPEA 2K3XA 1R8OB 3OYDA 3GPLA 2MMPA 3JB9D 3OW2A 2FRYA 2DTOA 5GAN4 1KC8C 3CCEQ 1TUGB 1H92A 1OU9A 2DX1A 2O4XA 1AWOA 2VGMA 1E7OA 3JCMf 2EYQA 4X34A 3TEEA 3G71T 1K8AR 5KYWA 4BE0A 1BI2A 2QQSA 3SHWA 1YCSB 5GAMj 2CP5A 2EGAA 3FEOA 2BIVA 2EQJA 1ZSGA 4IKFA 3H0HA 4X1VA 2QK0A 1VYTA 3A8OB 4QQDA 4NS5A 3EAEA 4A4GA 3OS1A 1K76A 4BY6C 1I5OB 4X9CA 1I8FA 2L0AA 5CQXA 5LJ5d 5GAMd 3JB9J 4J6WA 4M78C 3V8KA 2OX7A 1KD1U 2RHUA 2RJDA 4Z8AA 1Q82C 1UE9A 4J9IA 2BKDN 1PWTA 3VV0A 1UJ0A 1N5ZA 2K2VA 2F5KA 4J9GA 4C5IA 1UEBA 2EIFA 3QG1A 2O2OA 3CMAT 4K11A 1HD3A 3R6OA 4M75F 3M56A 2IVWA 4JJDA 2XDBA 1ZLMA 1X2KA 1WJRA 2DF6A 2QQAA 4PLLA 3CCST 5GMKe 2HD0A 4A4HA 1WDXA 3HHTB 3OYLA 4XTZA 3PIPA 1D3BB 1K0SA 3JCMh 1FWZA 3VUBA 2KQWA 5KCOA 3OS2A 4EMKA 3LGFA 2JUFA 3QYGB 2A7YA 2F5TX 2NWMA 1VQ7Q 4KT0E 4PJJA 3M58A 3JRZA 4E7KA 4BDZA 1D1BA 2L89A 2XICA 2OTJA 4M7AE 3A1PA 3A8GB 5CKEA 3M55A 4NOYA 1PD0A 1YJWT 3C0CA 5FU6C 2PVDB 4GBQA 2FPDA 5GAN6 1QCNA 1YJ9T 1GBRA 2V1RA 4B9XA 1VUBA 4LD9K 2O9VA 4J5YA 2RQVA 4M7DC 4XU3A 1OI1A 2ED0A 2YUPA 3F70A 4N4HA 1W2BP 2L8DA 3TQ7P 4RKUE 5IXBA 3OSVA 1UTIA 2F69A 3S3OA 4QQGA 1JU5C 3EG9B 4IUUA 2RA2A 4E6RA 3QZ5B 4FYYB 3G1JA 2XG8D 1TUCA 3L2WA 1WNLA 3T9NA 1YHQQ 3UT1A 1JO8A 3G6EQ 2BUDA 3MJXA 1H3HA 2YRDA 1YFNA 2JW4A 1SPKA 2K57A 4ELZC 5GMKj 3REAB 1IGQA 5HKCA 1NJIU 4L6V5 1JJ2P 3CPWS 2DXCA 3NTKA 4L59A 1MMNA 1VQ7A 1QVFS 4FM4B 4IIMA 3S6WA 2BE7D 5DLOA 5FU7B 1R0CB 1EZZB 1X69A 4DBHA 1ZSZA 3A8HB 2XKOC 1BCOA 2RJCA 3BY7A 4AG1C 2J6KA 4PJLA 4MMLA 3CCLT 2HBPA 3JCMc 3MKDA 2KAFA 4F7UG 5ECAA 1Q81R 3PMTA 5IN1A 2MWPA 4R55A 3MEAA 4C0FA 1K9MU 4C5GA 5CAIA 4C0ZA 2B86A 4CC7A 2CZ0B 3OMGA 2LJ0A 4M77C 3CXCA 3EH2A 1UB4A 3MEWA 3JB9F 1CSKA 2KYMA 3E1SA 4PLIA 1QVFA 2EKHA 4ORZA 3E9GA 2DIGA 2A36A 2MIOA 2QA4Q 1NPPA 1SRMA 2DZ9A 2JS0A 2JMAA 1JXOA 3G71A 2V8JA 2DEQA 2HEQA 1SKUB 1M1KU 3PGGA 1X01A 4FYVB 3CC2A 2C0IA 1G83A 1IREB 2MCNA 3M0PA 1M8VA 3OS5A 3MP6A 2CP6A 4M7AB 1XJWB 3VJPA 5I21A 2LCSA 1E6HA 1WHMA 2RM4A 1WQ7A 4F04B 3KFVA 2FL7A 3OYEA 2DXTA 4R0KA 3CC7Q 1UECA 1NJIC 4QQ6A 1Q7YR 2FZKB 3TCJA 1BKBA 2AIRB 5A2QE 3I56Q 1TSFA 1MV0B 2D0NA 1I81A 4OF1A 4PJOA 2XK0A 2RI3A 2WACA 2X9HA 3DLLA 5FLXE 4KBMB 2CDTA 3UDCA 2DE0X 1K9AA 1RAFB 3C12A 1T3SA 4GLKA 2K7AA 1M2VB 3FB9A 1M27C 3VS0A 1RAHB 2P0KA 1VQNQ 3CXCP 1VQPT 3LH5A 2YRVA 1Y96B 5A0GA 1RAGB 2VXFA 3H0FA 2CH4A 2X3XD 4GY5A 3IQLA 2D6FA 5GAN5 1PM3A 3M53A 1D3BA 5IAYA 3RKWA 3PVQA 1YITT 1HXDA 4IUQA 1JB0E 3CCQQ 4BDYA 4C5HA 3V7SA 3SD4A 4Z02A 1YCYA 4C8QE 3QKJA 4BACA 2LX7A 2E65A 1VQKT 3OYKA 1Q86R 2LX9A 1QVGS 3ZEHA 4RTTA 5CKBA 1GL5A 5DLQE 2YDLA 2JS2A 2CP7A 4C92E 1NEGA 1OU8A 4E7JA 2P0PA 4WF2A 3NTHA 2FPFA 5FRNA 1OPLA 1C1AA 3PVLA 4BI4A 2XHCA 2E3HA 1M1KC 4F7UE 3CBPA 2CSIA 3CCMQ 4OMNA 3QBYA 4D6WA 3R6NA 1OULA 1QLYA 4D8DA 1OOTA 1I07A 2G6FX 1YJ9A 3G4ST 2K6DA 3EG9A 3FJ5A 2NUZA 1RL2A 1G3YA 3JCMX 2EQKA 1TXQA 2QYZA 4N0AA 2EQMA 2KVQG 1PRMC 4MZMA 4HVUA 2LMJA 2QTXA 3CCUQ 1BK2A 3RMSA 2E12A 2X4XA 4Q5WA 2DIQA 5KE2A 1PNJA 3VRZA 3VS4A 1T0JA 2E6ZA 3CCQA 2M1HA 2JTFA 3SWNC 1AT1B 3H8ZA 4DA4A 2AT1B 4PJNA 5KH6A 2M51A 2COWA 1RLPC 2A3LA 3O8VA 1CKAA 1G3WA 3QWXX 1RAIB 5GAOm 2RH2A 2X4JA 2GTOA 5KCHA 1JXMA 3GIBA 2EJFA 4J9EA 3GOXA 2NUTB 2EJ9A 1TTHB 3CCMA 1OQKA 3CD6A 5LJ5f 2KXDA 2OTLA 5GAMf 2QEXT 3NGPA 1M90R 3HFNA 3CCLA 1X43A 1M9SA 3L42A 1OPKA 3HFOA 3UPUA 2DL5A 2LNHB 1OX9A 2KSSA 4DQ2A 1PKTA 1N8RR 2AZVA 2V26A 8AT1B 1NZ9A 3CMET 1C6VX 3CCUA 1G3SA 1X27A 1UDLA 1WJSA 1PCXA 4LDVA 2YSQA 1VQ5Q 5CKDA 4LD6A 5C0MA 3MHXA 1QKWA 4BD3A 2KY9A 4EMHA 2LJ3A 4N4GA 1IHVA 2CT3A 2E4HA 2FYKA 4C8QB 5GAN2 2FG0A 4XTUA 3EHQA 4F7UF 4DBFA 3OYBA 2ZPEB 2KGTA 4F14A 4JRPA 1WHJA 4M7AA 2DYIA 3CCRA 3MPUB 1IHWA 3FDRA 2DD4A 3CCJQ 2EYYA 2VASA 2LVMA 5GAOl 4M75E 1GXIE 4C92B 4RTVA 3J81E 5FRMA 4OB1B 4DBRA 1Q82U 1QP2A 4F7UB 2LTOA 2AK5A 3HSBA 1GRIA 3EFOB 2A37A 3HTRA 3NHNA 4QVZA 2MYSA 3FJPA 2KT1A 5CKFA 4KH0B 2CS7A 2M16A 4ME7A 2RQRA 4A53A 4LUDA 3C4SA 2VXEA 5LJ5h 1HJDA 4E7HA 4KGXB 3EG2A 4IUVA 4OB0B 1RI9A 1DJ7B 3UF4A 2K9GA 1Y96A 1BIBA 1VQ5A 2X51A 1YN8A 4E7IA 1YI2T 5J39A 4OGEA 1PHTA 3H41A 5IT9E 4XTYA 4EDUA 2VUBA 1VQPA 2QAZA 1S1NA 4F16A 1W2BS 1PG5B 3A98A 3UA6A 1AZGB 4OMMA 3HRSA 1RLQC 5LJ5j 1YHQT 5CO7A 3G6ET 4UC4A 4OMQA 1VQMA 3CCJA 4FT4A 2LP5A 4II1A 1AOJA 3H9NA 1QVPA 2DNUA 5GAOp 1VQOQ 2ENMA 2RN8A 1MMAA 5AT1B 1NG2A 2JN0A 4RTZA 4IURA 2CUBA 3GBQA 2K5LA 1VQ8A 2DVJA 1VQ6Q 1D0ZA 4FW1A 2H3JA 4OP0A 1JJ2S 4AFSC 1A0NB 2CSQA 3M0RA 2VVKA 1UGQB 2OTJQ 2E10A 4M78G 2R5AA 2NLUA 2SRCA 1G8XA 3M0QA 5I2SA 1WZOA 1AWWA 2RB6A 2L2PA 1VQLT 1OYXA 1PRLC 1YIJT 3G4SA 1W2BA 2HQEA 1S72Q 3S3NA 4LN2A 1I4K1 2JVVA 2EQIA 3J80E 2CZ1B 2DBKA 2HAXA 2QG9B 3VKIA 2QXFA 2LJ1A 2J06A 3A8LB 4M78D 2LQNA 2GQIA 2K5FA 1MGQA 2QDLA 3GP8A 2HSPA 1KJWA 2EYWA 2ZPIB 4ELYC 3MEVA 2ED1A 5GAN8 4M75B 1M4ZA 3OB9A 4RTUA 1YJNT 1JJ2A 1VQOA 3DB3A 4KH1B 2QA4T 1UJYA 1IGUA 2KK4A 5FWCA 3REBB 2VYTA 2V8KA 1VQ6A 2LRQA 3LYIA 3BDUA 3H6ZA 1RUWA 4ZNXA 3RKYA 2X3WD 2D8HA 3JCMJ 4EIKA 1B7TA 3QIIA 1PSEA 2AHJB 2HQHA 3JB9H 1RAAB 2KMTA 3PIOA 5D7UA 4RG2A 4RMOA 5CK9A 3P8BB 3BW1A 5A0DA 2E70A 3JCMW 4XU2A 2RPNA 3A8MB 1WXBA 2AZSA 5FW9A 2FO0A 2EW3A 2EGCA 2E5QA 4VUBA 2HKQB 5GMKh 3C94A 2JMCA 4JZ3A 3AHUA 3I56T 5KYUB 2KT8A 1ZBXA 1S72A 4M7DG 3WXMB 1KD1R 4MMKA 2DJZA 2OAWA 1Q81U 2W10A 1UUEA 5A0LA 1VQ9Q 2ZCFB 3BE3A 3QZ9B 1Z9QA 2LC4A 4OB2B 2KRSA 5IHIA 4EMKC 4C8QA 4DBQA 2D8JA 3FIFA 1NYGA 5DY9A 1VQNT 1H641 5GJVB 2DEUA 1MMGA 1X2QA 3CXCS 4C92A 4AG2C 4M7DD 1AWXA 5GMKm 3G71Q 1JEGA 2AKLA
chains in the Genus database with same CATH topology
1Y96B 4FSXA 3ZBDA 5A0GA 5FU7C 2QQ9A 2VXFA 4JDSA 3JCMQ 1KC8U 2RI5A 3L2ZA 3CC4T 1S72T 2RK2A 2DTIA 4XTXA 4GY5A 2D6FA 5GAN5 2RHIA 3M53A 3I55A 1D3BA 5IAYA 4JUVA 1M90C 3RKWA 5M9OA 4DOVA 5GAOr 3QYHB 4X9DA 2M9UA 3LLRA 4PJOF 3VYGA 1YITT 3JCMg 3LGLA 2VV5A 2EWNA 1M1FA 3V8JA 1MHNA 1HXDA 4IUQA 4O5VA 1JB0E 4M78E 5LL6S 4BI8B 4C8QF 4BDYA 4PJOE 4C5HA 1BIAA 3V7SA 3RKXA 3SD4A 4Z02A 3M4GA 1YCYA 4PKCC 3QKJA 4J6XA 4C8QE 3JCMP 4JRQA 4BACA 4BE2A 1Y07A 3QXEB 2E65A 1N8RC 4IUTA 5LJ5g 3KUFA 3OYYA 5HK3A 3JCMe 5GAMg 2WSEE 3V7RA 3A5ZB 3OYKA 1VQKT 2LX9A 1QVGS 3ZEHA 4QVDA 2K3YA 2Y90A 1Q7YU 2ZPBB 1FXXA 3C95A 5CKBA 3E19A 3GF5A 4C92F 4PJOB 3VU3C 4QW2A 5DLQE 1BYMA 5LJ3h 3CBMA 3V7CA 2ZGWA 2ZZDA 4J6YA 2RI2A 4L5GA 1UGSB 2GFUA 2DKGA 4ZN3A 1W4SA 4C92E 1VIEA 5LJ5e 3MP8A 4E7JA 2LDMA 2P0PA 3INZA 4WF2A 1VQ9A 3NTHA 5GAMe 5J3BA 2DK3A 4OB3B 2V8IA 3OW2S 2OAUA 5FRNA 1M1KC 4BI4A 2XHCA 3MCAB 4F7UE 1NE8A 1SSFA 2QQBA 1B34B 3BFMA 3BDLA 3LW5E 3CBPA 4XTWA 2Y4YA 1N6AA 3EFRA 4M77G 4HCBA 3URGA 3CEYA 3DB4A 1YI2A 3QBYA 3JCMb 4D6WA 3CCVA 1WJQA 1U1SA 3ASKA 1XNIA 3FRNA 3I55T 4E7LA 3VYHB 1I5LA 1YJ9A 1G3TA 1BI0A 4Y28E 3G4ST 2JZ2A 3OBYA 4ZTFA 2LCCA 1K73C 4M7DA 3PTAA 1RI0A 4LDXA 3MO8A 3WVDB 4J7IA 1ZHIA 4CI0C 3JB9G 1Q81C 1N27A 1RL2A 2DTHA 1G3YA 4XU1A 4Y91A 4XQ3A 2RJEA 3JCMX 3JAME 4XU0A 4HCCA 3QJYA 1VQ4T 2EQKA 5GMKl 3E9FA 3P8HA 1BI1A 5LJ3j 4N0AA 2LCLA 2EQMA 2MAMA 2P0QA 2KVQG 3GNGA 4MZMA 3G7ZA 5LJ3f 1OZ3A 2DVEA 4A4FA 3ME9A 2YLCA 3X25B 2QTXA 2RD1A 2GFAA 1XQHA 5AYFA 3N5BB 2QEXA 3RMSA 2E12A 2O01E 2VC8A 3V8LA 3CC7T 3OYMA 2PUKB 2X4XA 4M77D 4Q5WA 2DIQA 1QP3A 5GAMh 4KUIA 3OYHA 5L8RE 5GAOn 2WSFE 5KE2A 1VQ9T 4CRIA 2E6ZA 3CCQA 4BUGA 3UWNA 2M1HA 2JTFA 5FROA 4C0GA 3M54A 3H8ZA 3SWNC 4DA4A 2K3XA 3SDZA 1Q86U 1R8OB 1KG1A 1TH7A 5KH6A 3OYDA 3GPLA 3TU4K 3CCVT 2MMPA 2XI9A 3NFCA 3JB9D 3OW2A 3OSSC 4BI3A 5LJ3d 2A3LA 3SWNB 2DTOA 3O8VA 5EG2A 4EMGA 1G3WA 5GAN4 2PVGB 3CMEA 1KC8C 2HQXA 5D6WA 4M7DE 2DAQA 2O4XA 5GAOm 2RH2A 1HK9A 2X4JA 2XD0A 2DZCA 2K5IA 2VGMA 4C0DC 3JCMf 5KCHA 2VGNA 3GIBA 2EYQA 2EJFA 4X34A 3TEEA 3G71T 4BE0A 1BI2A 1X75C 2QQSA 3GOXA 2QI2A 3FC3A 5CIUA 2EJ9A 2WSCE 3META 5J26A 2XIDA 4A4KA 3CCMA 5GAMj 5KE3A 3KXTA 4JS4A 3CD6A 5LJ5f 3FEOA 2OTLA 2BIVA 3ER0A 5GAMf 3OYJA 2EQJA 3CMAA 4FU6A 2QEXT 1U1TA 4IKFA 3EFSA 1KD1C 4HT8A 2JOYA 3HFNA 4F7UA 3CCLA 1M9SA 3L42A 3X24B 3LX7A 1Q7YC 3HFOA 3UPUA 1KHIA 4JLIA 4QQDA 3A8OB 4PL6A 4M75A 4NS5A 2KSSA 3VUZA 3EAEA 4DQ2A 3L2VA 4A4GA 3CCQT 2PUOB 3PMIA 2Y4XA 5CQYA 3JCMd 3OS1A 4FT2A 2D0QB 1PSFA 4BY6C 4M78F 4X9CA 3CCSA 1I8FA 2LT1A 2LQ8A 1KQ2A 5CQXA 1NZ9A 4M77A 3CMET 3NTIA 5LJ5d 3CCUA 1G3SA 2DPPB 1WJSA 5GAMd 3JB9J 4J6WA 4LDVA 4BY6B 4M78C 3V8KA 4N4IA 5CKDA 4PJOG 4LD6A 4PJOC 1N9RA 3RIRA 5C0MA 4YTLA 3MHXA 1KD1U 2RHUA 2RJDA 1VIFA 4BD3A 1Q82C 2KY9A 2BKDN 4C8QG 4EMHA 4C8QC 4JLGA 3OMCA 4BB7A 3VV0A 4DOWA 4HCZA 4N4GA 4M78B 3QHSA 4OMFB 2K2VA 2F5KA 4C5IA 2D9TA 4C5EA 2FYKA 1UEBA 2EIFA 5I2MA 3CCMT 4C8QB 5D6XA 5GAN2 4XTUA 3QG1A 4F7UF 3CD6T 1O9SA 3RESA 2OTLT 3OYBA 3FLGA 2ZPEB 4J83A 3CBOA 4JRPA 4C92G 4QVCA 4C92C 3CMAT 2RHZA 4M7AA 3R6OA 3CCRA 4M75F 3M56A 2GF7A 2IVWA 5HK0A 3FDRA 2DD4A 1YJWA 2LVMA 5GAOl 1M1GA 4M75E 3S3MA 4C92B 2XDBA 1GXIE 3P8DA 3J81E 2XU8A 5FRMA 4OB1B 1WJRA 5CCAA 1QP2A 2MWOA 1Q82U 2RK1A 4PJOD 4F7UB 2LTOA 2QQAA 4PLLA 4B9WA 3CCST 1M5Q1 4A4EA 5GMKe 2HD0A 2G3RA 3HSBA 1FX7A 3CCEA 1JRIA 4MZPA 4C8QD 4A4HA 3OYNA 3HHTB 3OYLA 2CZ6B 1Q86C 4M77E 4LDWA 3ZFJA 3CCUT 2LT4A 4XTZA 3PIPA 2X4YA 2M0OA 2YLBA 3OYGA 4QVZA 3FJPA 3SB2A 1D3BB 2B8AA 3HPWA 3QDRB 5GAOq 1UGRB 5D6YA 3JCMh 1FWZA 5CKFA 4J8OA 3LH0A 3VUBA 2CS7A 3G6EA 1YHQA 2M16A 3HRUA 4ME7A 2KQWA 5KCOA 3OS2A 4XK8E 3CPWA 4EMKA 3LGFA 4C92D 3OYCA 2MI6A 2JUFA 3QYGB 4A53A 2A7YA 2F5TX 2C06A 3C4SA 4ZN1A 3JSCA 2VXEA 5LJ5h 4E7HA 2CYZB 4KT0E 4IUVA 3M58A 1G5VA 4M7AF 3M5AA 3JRZA 4E7KA 1XTDA 2EAYA 5CKHA 2E6NA 2X35A 4OB0B 4BDZA 1OZ2A 1DJ7B 2L89A 2XICA 2OTJA 2DO3A 5GANg 4M7AE 4MDWA 1Y96A 3CCRT 3CCET 3A8GB 5CKEA 1BIBA 1V29B 1VQ5A 3M55A 4HA8A 2EJGA 4NOYA 4XAXB 4KULA 3KBGA 4E7IA 1YI2T 1YJWT 5FU6C 4OGEA 5J39A 2PVDB 5IT9E 4M7DF 1WPYA 4RCCA 4XTYA 4EDUA 5GAN6 2VUBA 5GANe 4ZGJB 1VQPA 1YJ9T 3OYFA 4A54A 1VUBA 4B9XA 4LD9K 3M4YA 5FU6B 4J5YA 1W2BS 4LDYA 4M7DC 4XU3A 1OI1A 3HRSA 4ZGDB 3RMQA 2DXUA 1VQLA 3F70A 4N4HA 1KHCA 2FB7A 2EFIA 2L8DA 2RHYA 1YIJA 3TREA 2RJFA 4RKUE 3OSVA 5LJ5j 1YHQT 5CO7A 3G6ET 4UC4A 1VQMA 2F69A 4ATOA 3QPHA 3QSUA 3S3OA 4M7DB 4OVAA 4QQGA 3CCJA 1Y7XA 4FT4A 2FVUA 4IUUA 3HRTA 2RA2A 2R57A 3QJ6A 1WGSA 3QZ5B 4II1A 5GAN3 2XG8D 1QW1A 3L2WA 2FHDA 1QVPA 4MZTA 1WNLA 5GAOp 3T9NA 2JN0A 3PNWC 3UT1A 4IURA 3L2UA 2BUDA 4V2SA 4LDUA 3J7AF 2K5LA 1VQ8A 2LNVA 2OTJT 2GQVA 1B34A 4BE1A 1KQSA 2K57A 3OYIA 4ELZC 5GMKj 3HP9A 2H3JA 4OP0A 1JJ2S 1VQ5T 4HT9A 3OBWA 2P4TA 2XDPA 5HKCA 1IZ6A 5HY6A 1NJIU 5GANh 1UGQB 4L6V5 4RG8A 3CPWS 4PNOA 2DXCA 2E10A 3NTKA 2R5AA 3PT9A 4L59A 4M78G 4NL3A 3HKSA 1YJNA 2NLUA 2ZPHB 1VQ7A 1QVFS 2X4WA 2L3RA 3SFMA 2QA4A 3M9QA 5I2SA 4FM4B 2PVOB 2CGHA 3S6WA 2RB6A 3L1AA 1VQLT 1OYXA 3MEUA 2EQUA 5DLOA 1K9MC 2HNIA 3OY9A 4N0AC 5FU7B 3OA6A 1YIJT 1YBYA 3G4SA 2CKKA 1VQMT 1W2BA 2HQEA 3A8HB 2XKOC 2O4XB 3Q1JA 1U8RA 3CCJT 2R58A 4MDXA 3WVEB 4KUDK 4XTVA 4HKEA 3S3NA 2RJCA 3L2QA 3RERA 3BY7A 5CVIA 1I4K1 3JCMV 1VQ4A 3CCLT 4MMLA 3X26B 2JVVA 2HBPA 5DM7R 3JCMc 4E47A 3J80E 2KAFA 3M59A 4F7UG 4JRKA 2CZ1B 4RCBA 2HAXA 3VKIA 2CZ7B 1K8AU 3PMTA 5IN1A 2MWPA 1VQ8T 4O6JA 4R56A 5GANj 4R55A 2QXFA 2JTMA 3MEAA 4M75G 3A8LB 4M75C 2RHXA 4M78D 3CC7A 2K5FA 5GANf 1MGQA 3GP8A 4C0FA 2PU9B 2E64A 4M77F 1K9MU 2ZPIB 4ELYC 1M90U 3I56A 3MEVA 4C5GA 5CAIA 4C0ZA 3SWNA 5GAN8 1O75A 4JS5A 1JBMA 4M75B 1N9SA 1M4ZA 3OB9A 2CZ0B 3OMGA 1YJNT 1JJ2A 1VQOA 3DB3A 4M77C 1VQ7T 2QQRA 2I2LA 3CXCA 2QA4T 3CPFA 3LWHA 1UB4A 2KK4A 3MEWA 4NL2A 3JB9F 5CR2A 1EIFA 2VYTA 1P92A 1LOJA 2R5MA 2V8KA 1N8RU 2LRQA 4M77B 1VQ6A 2K4YA 3E1SA 3LYIA 3BDUA 4PLIA 3PFSA 3X28B 3H6ZA 1QVFA 1KQSS 3RKYA 2DIGA 3E9GA 2MF2A 3JCMJ 5GANd 4EPCA 1H3ZA 1NPPA 1LNXA 4TVRA 2DZ9A 3QIIA 4JJNK 1PSEA 2QDYB 2AHJB 3QO3A 2DXBA 1VQNA 3JB9H 3GNFB 1KQ1A 3G71A 2KMTA 4M75D 3PIOA 2DD5A 2V8JA 2JNGA 2DEQA 4RG2A 4RMOA 1M1KU 2PQWA 5CK9A 3GLXA 3PGGA 3P8BB 2ZPFB 3BW1A 1X01A 2E70A 5A0DA 4M7AG 4M7AC 2GCXA 3DKMA 4IUPA 3OS0A 4XU2A 3JCMW 3CC2A 1Y71A 1AHJB 3A8MB 4JRIA 1IREB 2E41A 4ZGEB 2E5QA 4VUBA 5GMKh 1M8VA 3OS5A 3MP6A 4M7AB 3C94A 3VJPA 5I21A 3AHUA 1BI3A 3I56T 4ZTJA 1XOVA 1QVGA 1ZBXA 3CC4A 1S72A 2RM4A 4M7DG 1X6OA 3OYAA 1WQ7A 1K73U 3WXMB 2FL7A 4MMKA 3OYEA 2DXTA 2DJZA 1Q81U 3M57A 4P5NA 5C6SA 1VQOT 3HL8A 4QQ6A 3LWIA 1NJIC 3TCJA 3JB9I 1BKBA 5A0LA 4J7FA 5A2QE 2ZPGB 2EKOA 1YITA 2ZCFB 1I81A 4OF1A 4M78A 1WQWA 2YHTA 3QZ9B 2L5QA 2LC4A 4PJOA 3OQ5A 2XK0A 1VQ6T 5GMKi 3X20B 4OB2B 1LJOA 4EMKC 2RI3A 4C8QA 4M7AD 2WACA 3DLLA 5LJ3g 2RO0A 3L2RA 3FIFA 4FIBA 5DY9A 1VQKA 2IG0A 2E1HA 5FLXE 5GAN7 1VQNT 4KBMB 3UDCA 3DLMA 4EMKB 1ZQ1A 1H641 3MP1A 1UGPB 3C12A 4GLKA 4FL6A 4C0DB 5LJ3e 2LQKA 1NPRA 3FB9A 4C92A 3CXCS 2P0KA 3CC2T 4M7DD 5GMKm 3RUXA 2XDDA 3QUIA 4OGCA 1VQPT 1K8AC 2YRVA 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGF A;  3OYC A;  2HQX A;  3PMT A;  5IN1 A;  5D6W A;  2MWP A;  2RI5 A;  2DAQ A;  2O4X A;  3C4S A;  3MEA A;  4GY5 A;  2RHI A;  2RHX A;  4E7H A;  5KCH A;  4IUV A;  1G5V A;  5IAY A;  4E7K A;  4X34 A;  5M9O A;  4BE0 A;  2E6N A;  2QQS A;  2X35 A;  3GOX A;  1OZ2 A;  3LLR A;  3FC3 A;  3MEV A;  5CIU A;  2L89 A;  4C5G A;  3MET A;  3LGL A;  5J26 A;  1MHN A;  4IUQ A;  5KE3 A;  3OB9 A;  4BDY A;  4C5H A;  3OMG A;  3FEO A;  3DB3 A;  3SD4 A;  4E7I A;  2BIV A;  2QQR A;  4Z02 A;  2EQJ A;  5J39 A;  4FU6 A;  3OYJ A;  4IKF A;  3QKJ A;  4BE2 A;  4BAC A;  4EDU A;  3MEW A;  4IUT A;  3L42 A;  3KUF A;  3LX7 A;  2VYT A;  3OYK A;  2R5M A;  3OYF A;  4B9X A;  3ZEH A;  2LRQ A;  3OS2 A;  2K3Y A;  3LYI A;  4PLI A;  4QQD A;  3PFS A;  4PL6 A;  3H6Z A;  4NS5 A;  3EAE A;  3L2V A;  2DIG A;  3E9G A;  3PMI A;  4QW2 A;  4A4G A;  1H3Z A;  1OI1 A;  3OS1 A;  3QII A;  2RI2 A;  2GFU A;  3F70 A;  4N4H A;  1KHC A;  3MP8 A;  2EFI A;  2L8D A;  2LDM A;  2RHY A;  4E7J A;  3NTH A;  5FRN A;  2RJF A;  4UC4 A;  4RG2 A;  3S3O A;  1SSF A;  3BDL A;  4OVA A;  2PQW A;  3NTI A;  4QQG A;  4IUU A;  1WJS A;  3QJ6 A;  2R57 A;  1WGS A;  4II1 A;  4IUP A;  4N4I A;  3CEY A;  3OS0 A;  3DB4 A;  2FHD A;  4LD6 A;  3L2W A;  3QBY A;  5C0M A;  1WJQ A;  2RHU A;  2RJD A;  4BD3 A;  3PNW C;  2BKD N;  3ASK A;  2E5Q A;  1XNI A;  4IUR A;  3UT1 A;  3L2U A;  3MP6 A;  3OMC A;  4E7L A;  2BUD A;  4HCZ A;  4N4G A;  2JZ2 A;  4ZTF A;  4ZTJ A;  2LCC A;  2F5K A;  4C5I A;  2D9T A;  4C5E A;  1RI0 A;  3MO8 A;  3OYA A;  4BE1 A;  3OYI A;  1N27 A;  5D6X A;  3OYE A;  5C6S A;  2RJE A;  4QQ6 A;  2XDP A;  3OYB A;  3FLG A;  2EQK A;  2RHZ A;  3E9F A;  3P8H A;  2EKO A;  2EQM A;  2GF7 A;  1OZ3 A;  2R5A A;  2XK0 A;  3FDR A;  3ME9 A;  3NTK A;  3OQ5 A;  4L59 A;  4A4F A;  2NLU A;  2GFA A;  2LVM A;  3S3M A;  2X4W A;  2L3R A;  2RI3 A;  3P8D A;  3M9Q A;  2WAC A;  3OYM A;  2X4X A;  2RO0 A;  4Q5W A;  3S6W A;  2DIQ A;  3L2R A;  1WJR A;  5FRM A;  2MWO A;  3OYH A;  1OYX A;  3MEU A;  2EQU A;  2IG0 A;  5KE2 A;  2LTO A;  4PLL A;  4B9W A;  4CRI A;  3OY9 A;  3OA6 A;  4A4E A;  3DLM A;  2G3R A;  2CKK A;  2HQE A;  4A4H A;  3OYN A;  3MP1 A;  3UWN A;  3OYL A;  2O4X B;  2M1H A;  2JTF A;  5FRO A;  3Q1J A;  4BDZ A;  2R58 A;  3H8Z A;  4FL6 A;  2K3X A;  2X4Y A;  2M0O A;  3OYG A;  3S3N A;  4QVZ A;  2RJC A;  2P0K A;  5KH6 A;  3OYD A;  3L2Q A;  2B8A A;  5D6Y A;  3LH0 A;  2M16 A;  2YRV A;  5KCO A;  3O8V A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  3EFO A;  3CC4 T;  3L2Z A;  3CC2 Q;  2DTI A;  4XTX A;  2HMA A;  5I22 A;  1RAD B;  5M9O A;  4DOV A;  4X9D A;  2COZ A;  3LGL A;  3V8J A;  1MHN A;  4M78 E;  2DRM A;  2IPO B;  1BBZ A;  1KSW A;  2RNA A;  3QXE B;  3KUF A;  5HK3 A;  3JV3 A;  4CC3 A;  4QVD A;  1AZE A;  1Q7Y U;  3VU3 C;  3V7C A;  2ZGW A;  2L3P A;  2ZZD A;  4ZN3 A;  1W4S A;  1VIE A;  1VQ9 A;  5J3B A;  2DK3 A;  1R77 A;  2OAU A;  1F1B B;  3MCA B;  1W6X A;  3BDL A;  4A63 B;  2J05 A;  1FMK A;  4XTW A;  2Y4Y A;  4M77 G;  3TSW A;  4HCB A;  2DA9 A;  3CEY A;  4RTW A;  1YI2 A;  4WCI A;  1ZUK A;  3I9Q A;  1XNI A;  3I55 T;  1I5L A;  1EFN A;  1BI0 A;  5HCK A;  3OBY A;  3MO8 A;  1ACM B;  4CI0 C;  1ZHI A;  1Q81 C;  1ZSZ C;  2DTH A;  3M0U A;  4XU1 A;  4AFU C;  2CP2 A;  1U5S A;  4XU0 A;  1VQ4 T;  1NEB A;  5GMK l;  3CCS Q;  2LCL A;  1VOM A;  1J3T A;  1OZ3 A;  4A4F A;  2DER A;  1VA7 A;  2F2V A;  2YLC A;  2RD1 A;  5AYF A;  2YT6 A;  3N5B B;  3H0I A;  3EGX B;  3V8L A;  1C0M A;  3OYM A;  4M77 D;  3OYH A;  2QTV A;  1RAB B;  4J9B A;  2GBQ A;  4C0G A;  3M54 A;  1D09 B;  3SDZ A;  1Q86 U;  3O5Z A;  1TH7 A;  3CCV T;  2XI9 A;  3NFC A;  3EG0 A;  7AT1 B;  2GNC A;  2M0Y A;  4EMG A;  2PVG B;  2HQX A;  4M7D E;  2DAQ A;  1D0X A;  3U23 A;  1HK9 A;  1YJW Q;  2DZC A;  2K5I A;  2VWF A;  4C0D C;  1T0H A;  1Y57 A;  2VGN A;  3EGU A;  1VYU A;  1YJ9 Q;  1X75 C;  3FC3 A;  1YWP A;  4PK4 A;  4A4K A;  3CQT A;  1GBQ A;  3KXT A;  4JS4 A;  3I35 A;  3ER0 A;  1K9M R;  4HVW A;  3CMA A;  4FU6 A;  3EFS A;  4HT8 A;  1ARK A;  1WIE A;  1Q7Y C;  1GFC A;  1I1J A;  1KHI A;  4RUG A;  1ZA2 B;  4M75 A;  4KRT A;  3L2V A;  4LXC A;  2PUO B;  3PMI A;  5CQY A;  4LE9 A;  4FT2 A;  2D0Q B;  1PSF A;  4PFZ A;  3RR6 A;  4M78 F;  3CCS A;  1TOV A;  4ESR A;  2DPP B;  4BY6 B;  1RAC B;  4N4I A;  4FW2 A;  4PJO G;  2DIL A;  4PJO C;  2IIM A;  2JM9 A;  1TUD A;  1VIF A;  4BB7 A;  2F2X A;  4DOW A;  4M78 B;  3QHS A;  4OMF B;  2D9T A;  2E3I A;  1W70 A;  1H8K A;  5D6X A;  5KYN A;  3FLG A;  4J83 A;  4QVC A;  1OEB A;  5KYW B;  4FYX B;  5L23 A;  5KYU A;  2ROL A;  1M3B A;  3CD6 Q;  1YJW A;  1IRX A;  1M1G A;  2OTL Q;  4QT7 A;  3P8D A;  1AWJ A;  1T3L A;  2DL7 A;  2XU8 A;  5CCA A;  3CCL Q;  4PJO D;  4B9W A;  1PC0 A;  4A4E A;  2G3R A;  1FX7 A;  4MZP A;  4PFP A;  2DMO A;  1Q86 C;  4M77 E;  4LDW A;  3ZFJ A;  2M0O A;  4JJB A;  3OYG A;  3SB2 A;  3EG1 A;  3HPW A;  5GAO q;  1UGR B;  5D6Y A;  1HYO A;  2FRW A;  2JM8 A;  4XK8 E;  3OYC A;  1D0Y A;  2MI6 A;  4DEX A;  8ATC B;  4JZ4 A;  3JSC A;  4KGV B;  2CYZ B;  2EBP A;  3M5A A;  5CKH A;  2E6N A;  2X35 A;  5GAN g;  3CCE T;  2EJG A;  3KBG A;  2NYS A;  3I5S A;  4M7D F;  1WPY A;  4RCC A;  1QWF A;  5GAN e;  3CCR Q;  1YNZ A;  2C0T A;  1GCP A;  3M4Y A;  5FU6 B;  2HZY A;  1NBE B;  4ZGD B;  3RMQ A;  1KHC A;  2FB7 A;  1X6B A;  2RJF A;  4ATO A;  4M7D B;  4OVA A;  1SF9 A;  1Y7X A;  4N0A C;  2BTT A;  3HRT A;  2R57 A;  1WGS A;  2FHD A;  4MZT A;  1TWB A;  3TVT A;  3PNW C;  4V2S A;  1QKX A;  3J7A F;  1SEM A;  2Z0W A;  2LNV A;  2OTJ T;  2GQV A;  4BE1 A;  1GCQ A;  3OYI A;  1KQS A;  2H8H A;  4HT9 A;  4GLM A;  1AEY A;  1Q95 G;  5GAN h;  4RG8 A;  3PT9 A;  3VS7 A;  2ZPH B;  2X4W A;  2L3R A;  2CH4 W;  3EGD B;  3M9Q A;  4AFZ C;  2CGH A;  1SHG A;  3MEU A;  2HNI A;  3OA6 A;  1VQP Q;  2KYB A;  4JPB W;  3Q1J A;  4QKU A;  1U8R A;  3VS3 A;  4MDX A;  3WVE B;  3L2Q A;  3EGX A;  2RQW A;  2RQT A;  5CVI A;  3JCM V;  1VQ4 A;  4D8K A;  2W0Z A;  1LCK A;  4E47 A;  1VQM Q;  1K73 R;  3M59 A;  1YIT Q;  4JRK A;  2CZ7 B;  1K8A U;  1EX4 A;  4R56 A;  5GAN j;  2PU9 B;  2E64 A;  4M77 F;  1NM7 A;  1VQK Q;  1VQ8 Q;  1B07 A;  2O9S A;  1N9S A;  4RTY A;  4E2F B;  2YRC A;  1PD1 A;  1JQQ A;  1VQ7 T;  2QQR A;  2I2L A;  2O31 A;  3CPF A;  3LWH A;  2JTE A;  1KFZ A;  2KNB B;  5CR2 A;  2BZX A;  1P92 A;  1LOJ A;  4M77 B;  3PFS A;  5KYY B;  1M2V A;  2C0O A;  2MF2 A;  5GAN d;  1H3Z A;  2FEI A;  3QO3 A;  2DLP A;  2RF0 A;  1KQS P;  3GNF B;  1LVK A;  1KC8 R;  2JNG A;  1VYV A;  3G4S Q;  1M2O A;  1WLP B;  1ZSZ B;  4M7A G;  2DL3 A;  4M7A C;  2ZPF B;  1FYN A;  2MOX A;  1X6G A;  2GCX A;  3DKM A;  3OS0 A;  4F17 A;  1AHJ B;  3UA7 A;  2JXB A;  2QAS A;  4JRI A;  2E41 A;  4RTX A;  4HCK A;  2YXY A;  3EHR A;  4P5N A;  3LWI A;  4J7F A;  2ZPG B;  2EKO A;  1YIT A;  4ANJ A;  2EYZ A;  4M78 A;  4KGZ B;  2YHT A;  3VRY A;  2FZC B;  3OQ5 A;  1LJO A;  2DJQ A;  2CT4 A;  4M7A D;  5LJ3 g;  2RO0 A;  4FIB A;  1VQK A;  5GAN 7;  3DLM A;  1MUZ A;  1ZQ1 A;  4J9F A;  2K3B A;  1UGP B;  4PJM A;  1WHG A;  2CUD A;  2DYB A;  4FL6 A;  4C0D B;  3ZL7 C;  5LJ3 e;  1Q82 R;  3M0S A;  3CC2 T;  3RUX A;  2XDD A;  3QUI A;  2KRO A;  2YUQ A;  1K8A C;  2XD0 A;  3ZBD A;  4OMP A;  2ROT A;  2QQ9 A;  1BU1 A;  4JDS A;  2RI5 A;  2RK2 A;  1G2B A;  2QEX Q;  2RHI A;  2XMF A;  1IO6 A;  4PJO F;  2HL5 C;  3VYG A;  3JCM g;  4O5V A;  5LL6 S;  5IHN A;  4B6M A;  1QCF A;  2RQU A;  1BIA A;  1M3A A;  2K79 A;  2HCK A;  5FWB A;  4PKC C;  3JCM P;  4BE2 A;  1Y07 A;  3OYY A;  3JCM e;  2WSE E;  3EG3 A;  3CME Q;  2ZPB B;  4PJO B;  1ZUU A;  1UHC A;  5LJ3 h;  2RI2 A;  1TG0 A;  1UGS B;  4L5G A;  1PKS A;  3MP8 A;  2LDM A;  3INZ A;  4OB3 B;  3VS6 A;  2HSE B;  1NE8 A;  1SSF A;  3BFM A;  2F2W A;  1B34 B;  3CCE A;  2ABL A;  3EFR A;  3OW2 P;  2P84 A;  3URG A;  2H3E B;  3JCM b;  1QMC A;  1U1S A;  4WTO B;  4E7L A;  2NUT A;  2EPD A;  4Y28 E;  4FCY A;  2JZ2 A;  4ZTF A;  4M7D A;  3PTA A;  1ABO A;  2SEM A;  1BB9 A;  2CP0 A;  4Y91 A;  4XQ3 A;  3JAM E;  4HCC A;  3NMZ C;  1B3Q A;  2E5K A;  1BI1 A;  3E9F A;  3P8H A;  5LJ3 j;  2FZG B;  2P0Q A;  2MAM A;  5KYX B;  2RMO A;  2DVE A;  3X25 B;  2GFA A;  1XQH A;  2QEX A;  2KRN A;  2O01 E;  2VC8 A;  3CC7 T;  1MMD A;  4KUI A;  5L8R E;  5GAO n;  2WSF E;  4AFQ C;  2PTK A;  3TSZ A;  2OI3 A;  1WI7 A;  4BUG A;  3I5R A;  3UWN A;  1KG1 A;  3EGD A;  3TU4 K;  4LNP A;  3OSS C;  4BI3 A;  5LJ3 d;  2KEA A;  3CME A;  3SWN B;  1K0X A;  5EG2 A;  1NYF A;  4J9H A;  2EYX A;  1AD5 A;  5D6W A;  2ESW A;  1YI2 Q;  3UAT A;  4IIO A;  2QI2 A;  5CIU A;  2WSC E;  3MET A;  1Y0M A;  2XID A;  5J26 A;  5KE3 A;  1KK7 A;  2ECZ A;  5IHK A;  2HDA A;  3VS1 A;  3OYJ A;  1U1T A;  1KD1 C;  4J9C A;  2JOY A;  4F7U A;  3X24 B;  3LX7 A;  1AVZ C;  1R0B G;  4JLI A;  1MND A;  4PL6 A;  3VUZ A;  3CCQ T;  2Y4X A;  3JCM d;  2YUO A;  1K1Z A;  2YWW A;  1U06 A;  1SHF A;  1KIK A;  2DET A;  2LT1 A;  2LQ8 A;  1KQ2 A;  4M77 A;  2HBW A;  3NTI A;  1ZUY A;  1QWE A;  3QWY A;  5KYY A;  1N9R A;  3RIR A;  4YTL A;  5EC7 A;  2L3S A;  2NUP B;  2EGE A;  4C8Q G;  2JT4 A;  4C8Q C;  4JLG A;  3OMC A;  4HCZ A;  2COY A;  2VB6 A;  3RNJ A;  4C5E A;  5I2M A;  3CCM T;  2I0N A;  3CD6 T;  1WHH A;  3D7S B;  1O9S A;  3RES A;  9ATC B;  2OTL T;  1VQL Q;  3CBO A;  4C92 G;  4C92 C;  2RHZ A;  4FYW B;  1YIJ Q;  2GF7 A;  5HK0 A;  1V76 A;  2CP3 A;  3S3M A;  1M30 A;  3CMA Q;  3RBB B;  2DM1 A;  2MPX C;  4HVV A;  2A0F B;  2F1L A;  2MWO A;  2LZ6 B;  2RK1 A;  1WA7 A;  2HL3 A;  1M5Q 1;  1JRI A;  4C8Q D;  3OYN A;  2CZ6 B;  3CCU T;  2LT4 A;  1OV3 A;  2X4Y A;  2YLB A;  1NLP C;  2B8A A;  3QDR B;  1GFD A;  4J8O A;  3LH0 A;  1YHQ A;  3G6E A;  2EVR A;  1WHK A;  3HRU A;  3M0T A;  3CPW A;  4C92 D;  1YJN Q;  1NJI R;  1U3O A;  2C06 A;  4ZN1 A;  1BCM A;  1G5V A;  4M7A F;  1XTD A;  2EAY A;  1OZ2 A;  2KE9 A;  2DO3 A;  4MDW A;  3CCR T;  1V29 B;  4HA8 A;  2GGR A;  4XAX B;  1IB8 A;  4KUL A;  3QDF A;  2DFU A;  2ZAE A;  4ZGJ B;  2DL8 A;  2A28 A;  3OYF A;  4A54 A;  4LDY A;  1SG5 A;  1OX8 A;  2DXU A;  1VQL A;  2EFI A;  2RHY A;  3VS2 A;  2VKN A;  1YIJ A;  3TRE A;  1ZBJ A;  2OJ2 A;  4Z88 A;  2YUN A;  3QPH A;  3QSU A;  1YP5 A;  2KI7 A;  3X26 B;  2FVU A;  3QJ6 A;  5GAN 3;  1M8M A;  1QW1 A;  2PNI A;  3PE0 A;  3L2U A;  5IH2 A;  1WXU A;  4LDU A;  1QQJ A;  2O88 A;  1B34 A;  3HP9 A;  1VQ5 T;  2ATC B;  3OBW A;  2L3Q A;  1MNE A;  2P4T A;  2XDP A;  1IZ6 A;  5HY6 A;  5I11 A;  4PNO A;  2HKN A;  1M3C A;  4NL3 A;  1YJN A;  3HKS A;  3SFM A;  3CPW P;  2QA4 A;  4M4Z A;  2KRM A;  2PVO B;  1M1K R;  3L1A A;  2LQW A;  1K9M C;  1QVF P;  2EQU A;  3OY9 A;  1YBY A;  3EH1 A;  1FMW A;  5KYX A;  2CKK A;  1VQM T;  1TS9 A;  2O4X B;  3CC4 Q;  3CCJ T;  2R58 A;  3THK A;  1ZX6 A;  4KUD K;  4XTV A;  4HKE A;  3RER A;  4E7S A;  5DM7 R;  1WFW A;  2J6F A;  1D1C A;  4RCB A;  4Y92 A;  1WHL A;  2DL4 A;  1VQ8 T;  4O6J A;  1TU0 B;  1WYX A;  2QGG A;  2JTM A;  4M75 G;  4M75 C;  2RHX A;  3CC7 A;  5GAN f;  1M90 U;  3I56 A;  1YWO A;  1CKB A;  4JS5 A;  3SWN A;  1O75 A;  1JBM A;  1WX6 A;  1MV3 A;  1LPL A;  1UFF A;  1UGV A;  4NL2 A;  1EIF A;  1N8R U;  2R5M A;  3E2U A;  2K4Y A;  3X28 B;  2P4R A;  1KQS S;  4EPC A;  1LNX A;  4TVR A;  1NLO C;  1K4U S;  3ULR B;  4JJN K;  2QDY B;  2DXB A;  4JJC A;  1VQN A;  3I55 Q;  4CC2 A;  1KQ1 A;  4M75 D;  2DD5 A;  2PQW A;  3GLX A;  2GTJ A;  2V1Q A;  4IUP A;  1Y71 A;  4J9D A;  2AKK A;  1VQ4 Q;  4ZGE B;  4E7Z A;  1BI3 A;  4ZTJ A;  1XOV A;  1QVG A;  4AT1 B;  3CC4 A;  2K2M A;  1X6O A;  1ZA1 B;  3OYA A;  1K73 U;  2BE9 B;  3M57 A;  5C6S A;  1VQO T;  4OMO A;  3HL8 A;  2J7I A;  2NUP A;  3JB9 I;  1UG1 A;  4FSS A;  2D1X A;  1WQW A;  2L5Q A;  1VQ6 T;  5GMK i;  3X20 B;  2DRK A;  1RAE B;  4AMC A;  3CCV Q;  3L2R A;  2QGF B;  2IG0 A;  2E1H A;  4EMK B;  2A08 A;  3MP1 A;  4PFO A;  2LQK A;  1NPR A;  2KBT A;  3RDV A;  5IXF A;  4OGC A;  1SRL A;  2M02 A;  4LUE A;  3G7Z A;  2KDS A;  4FSX A;  5FU7 C;  3JCM Q;  1KC8 U;  1S72 T;  6AT1 B;  3I55 A;  4JUV A;  1M90 C;  1Z9Z A;  5GAO r;  3QYH B;  2M9U A;  3LLR A;  2VV5 A;  2EWN A;  1M1F A;  4BI8 B;  3AT1 B;  4C8Q F;  1HSQ A;  4PJO E;  1QCO A;  3RKX A;  3M4G A;  4J6X A;  4JRQ A;  3SEM A;  1N8R C;  4IUT A;  5LJ5 g;  5GAM g;  3V7R A;  3A5Z B;  2K3Y A;  2Y90 A;  1UHF A;  1FXX A;  3C95 A;  2BZY A;  3E19 A;  3GF5 A;  4C92 F;  1BYM A;  4QW2 A;  3CBM A;  1QVG P;  4J6Y A;  2MK5 A;  2GFU A;  4HXJ A;  2DKG A;  1GCQ C;  2J6O A;  5LJ5 e;  5GAM e;  3OW2 S;  2V8I A;  2JJ9 A;  1WXT A;  4OML A;  2QQB A;  3LW5 E;  4Z89 A;  1V1C A;  1E6G A;  1N6A A;  3DB4 A;  3CCV A;  1WJQ A;  1FMV A;  1ABQ A;  2DBM A;  3ASK A;  3FRN A;  1D1A A;  3VYH B;  1G3T A;  1W1F A;  2LCC A;  1K73 C;  1RI0 A;  4LDX A;  3WVD B;  4J7I A;  3JB9 G;  1N27 A;  5GJW B;  3NPF A;  4DEY A;  2RJE A;  3QJY A;  2BZ8 A;  3GNG A;  5LJ3 f;  2KR3 A;  1I0C A;  3ME9 A;  1SSH A;  2PUK B;  4CC4 B;  1QP3 A;  5GAM h;  3VS5 A;  1VQ9 T;  4CRI A;  2KXC A;  2CRE A;  5FRO A;  1IXD A;  2FPE A;  2K3X A;  1R8O B;  3OYD A;  3GPL A;  2MMP A;  3JB9 D;  3OW2 A;  2FRY A;  2DTO A;  5GAN 4;  1KC8 C;  3CCE Q;  1TUG B;  1H92 A;  1OU9 A;  2DX1 A;  2O4X A;  1AWO A;  2VGM A;  1E7O A;  3JCM f;  2EYQ A;  4X34 A;  3TEE A;  3G71 T;  1K8A R;  5KYW A;  4BE0 A;  1BI2 A;  2QQS A;  3SHW A;  1YCS B;  5GAM j;  2CP5 A;  2EGA A;  3FEO A;  2BIV A;  2EQJ A;  1ZSG A;  4IKF A;  3H0H A;  4X1V A;  2QK0 A;  1VYT A;  3A8O B;  4QQD A;  4NS5 A;  3EAE A;  4A4G A;  3OS1 A;  1K76 A;  4BY6 C;  1I5O B;  4X9C A;  1I8F A;  2L0A A;  5CQX A;  5LJ5 d;  5GAM d;  3JB9 J;  4J6W A;  4M78 C;  3V8K A;  2OX7 A;  1KD1 U;  2RHU A;  2RJD A;  4Z8A A;  1Q82 C;  1UE9 A;  4J9I A;  2BKD N;  1PWT A;  3VV0 A;  1UJ0 A;  1N5Z A;  2K2V A;  2F5K A;  4J9G A;  4C5I A;  1UEB A;  2EIF A;  3QG1 A;  2O2O A;  3CMA T;  4K11 A;  1HD3 A;  3R6O A;  4M75 F;  3M56 A;  2IVW A;  4JJD A;  2XDB A;  1ZLM A;  1X2K A;  1WJR A;  2DF6 A;  2QQA A;  4PLL A;  3CCS T;  5GMK e;  2HD0 A;  4A4H A;  1WDX A;  3HHT B;  3OYL A;  4XTZ A;  3PIP A;  1D3B B;  1K0S A;  3JCM h;  1FWZ A;  3VUB A;  2KQW A;  5KCO A;  3OS2 A;  4EMK A;  3LGF A;  2JUF A;  3QYG B;  2A7Y A;  2F5T X;  2NWM A;  1VQ7 Q;  4KT0 E;  4PJJ A;  3M58 A;  3JRZ A;  4E7K A;  4BDZ A;  1D1B A;  2L89 A;  2XIC A;  2OTJ A;  4M7A E;  3A1P A;  3A8G B;  5CKE A;  3M55 A;  4NOY A;  1PD0 A;  1YJW T;  3C0C A;  5FU6 C;  2PVD B;  4GBQ A;  2FPD A;  5GAN 6;  1QCN A;  1YJ9 T;  1GBR A;  2V1R A;  4B9X A;  1VUB A;  4LD9 K;  2O9V A;  4J5Y A;  2RQV A;  4M7D C;  4XU3 A;  1OI1 A;  2ED0 A;  2YUP A;  3F70 A;  4N4H A;  1W2B P;  2L8D A;  3TQ7 P;  4RKU E;  5IXB A;  3OSV A;  1UTI A;  2F69 A;  3S3O A;  4QQG A;  1JU5 C;  3EG9 B;  4IUU A;  2RA2 A;  4E6R A;  3QZ5 B;  4FYY B;  3G1J A;  2XG8 D;  1TUC A;  3L2W A;  1WNL A;  3T9N A;  1YHQ Q;  3UT1 A;  1JO8 A;  3G6E Q;  2BUD A;  3MJX A;  1H3H A;  2YRD A;  1YFN A;  2JW4 A;  1SPK A;  2K57 A;  4ELZ C;  5GMK j;  3REA B;  1IGQ A;  5HKC A;  1NJI U;  4L6V 5;  1JJ2 P;  3CPW S;  2DXC A;  3NTK A;  4L59 A;  1MMN A;  1VQ7 A;  1QVF S;  4FM4 B;  4IIM A;  3S6W A;  2BE7 D;  5DLO A;  5FU7 B;  1R0C B;  1EZZ B;  1X69 A;  4DBH A;  1ZSZ A;  3A8H B;  2XKO C;  1BCO A;  2RJC A;  3BY7 A;  4AG1 C;  2J6K A;  4PJL A;  4MML A;  3CCL T;  2HBP A;  3JCM c;  3MKD A;  2KAF A;  4F7U G;  5ECA A;  1Q81 R;  3PMT A;  5IN1 A;  2MWP A;  4R55 A;  3MEA A;  4C0F A;  1K9M U;  4C5G A;  5CAI A;  4C0Z A;  2B86 A;  4CC7 A;  2CZ0 B;  3OMG A;  2LJ0 A;  4M77 C;  3CXC A;  3EH2 A;  1UB4 A;  3MEW A;  3JB9 F;  1CSK A;  2KYM A;  3E1S A;  4PLI A;  1QVF A;  2EKH A;  4ORZ A;  3E9G A;  2DIG A;  2A36 A;  2MIO A;  2QA4 Q;  1NPP A;  1SRM A;  2DZ9 A;  2JS0 A;  2JMA A;  1JXO A;  3G71 A;  2V8J A;  2DEQ A;  2HEQ A;  1SKU B;  1M1K U;  3PGG A;  1X01 A;  4FYV B;  3CC2 A;  2C0I A;  1G83 A;  1IRE B;  2MCN A;  3M0P A;  1M8V A;  3OS5 A;  3MP6 A;  2CP6 A;  4M7A B;  1XJW B;  3VJP A;  5I21 A;  2LCS A;  1E6H A;  1WHM A;  2RM4 A;  1WQ7 A;  4F04 B;  3KFV A;  2FL7 A;  3OYE A;  2DXT A;  4R0K A;  3CC7 Q;  1UEC A;  1NJI C;  4QQ6 A;  1Q7Y R;  2FZK B;  3TCJ A;  1BKB A;  2AIR B;  5A2Q E;  3I56 Q;  1TSF A;  1MV0 B;  2D0N A;  1I81 A;  4OF1 A;  4PJO A;  2XK0 A;  2RI3 A;  2WAC A;  2X9H A;  3DLL A;  5FLX E;  4KBM B;  2CDT A;  3UDC A;  2DE0 X;  1K9A A;  1RAF B;  3C12 A;  1T3S A;  4GLK A;  2K7A A;  1M2V B;  3FB9 A;  1M27 C;  3VS0 A;  1RAH B;  2P0K A;  1VQN Q;  3CXC P;  1VQP T;  3LH5 A;  2YRV A;  1Y96 B;  5A0G A;  1RAG B;  2VXF A;  3H0F A;  2CH4 A;  2X3X D;  4GY5 A;  3IQL A;  2D6F A;  5GAN 5;  1PM3 A;  3M53 A;  1D3B A;  5IAY A;  3RKW A;  3PVQ A;  1YIT T;  1HXD A;  4IUQ A;  1JB0 E;  3CCQ Q;  4BDY A;  4C5H A;  3V7S A;  3SD4 A;  4Z02 A;  1YCY A;  4C8Q E;  3QKJ A;  4BAC A;  2LX7 A;  2E65 A;  1VQK T;  3OYK A;  1Q86 R;  2LX9 A;  1QVG S;  3ZEH A;  4RTT A;  5CKB A;  1GL5 A;  5DLQ E;  2YDL A;  2JS2 A;  2CP7 A;  4C92 E;  1NEG A;  1OU8 A;  4E7J A;  2P0P A;  4WF2 A;  3NTH A;  2FPF A;  5FRN A;  1OPL A;  1C1A A;  3PVL A;  4BI4 A;  2XHC A;  2E3H A;  1M1K C;  4F7U E;  3CBP A;  2CSI A;  3CCM Q;  4OMN A;  3QBY A;  4D6W A;  3R6N A;  1OUL A;  1QLY A;  4D8D A;  1OOT A;  1I07 A;  2G6F X;  1YJ9 A;  3G4S T;  2K6D A;  3EG9 A;  3FJ5 A;  2NUZ A;  1RL2 A;  1G3Y A;  3JCM X;  2EQK A;  1TXQ A;  2QYZ A;  4N0A A;  2EQM A;  2KVQ G;  1PRM C;  4MZM A;  4HVU A;  2LMJ A;  2QTX A;  3CCU Q;  1BK2 A;  3RMS A;  2E12 A;  2X4X A;  4Q5W A;  2DIQ A;  5KE2 A;  1PNJ A;  3VRZ A;  3VS4 A;  1T0J A;  2E6Z A;  3CCQ A;  2M1H A;  2JTF A;  3SWN C;  1AT1 B;  3H8Z A;  4DA4 A;  2AT1 B;  4PJN A;  5KH6 A;  2M51 A;  2COW A;  1RLP C;  2A3L A;  3O8V A;  1CKA A;  1G3W A;  3QWX X;  1RAI B;  5GAO m;  2RH2 A;  2X4J A;  2GTO A;  5KCH A;  1JXM A;  3GIB A;  2EJF A;  4J9E A;  3GOX A;  2NUT B;  2EJ9 A;  1TTH B;  3CCM A;  1OQK A;  3CD6 A;  5LJ5 f;  2KXD A;  2OTL A;  5GAM f;  2QEX T;  3NGP A;  1M90 R;  3HFN A;  3CCL A;  1X43 A;  1M9S A;  3L42 A;  1OPK A;  3HFO A;  3UPU A;  2DL5 A;  2LNH B;  1OX9 A;  2KSS A;  4DQ2 A;  1PKT A;  1N8R R;  2AZV A;  2V26 A;  8AT1 B;  1NZ9 A;  3CME T;  1C6V X;  3CCU A;  1G3S A;  1X27 A;  1UDL A;  1WJS A;  1PCX A;  4LDV A;  2YSQ A;  1VQ5 Q;  5CKD A;  4LD6 A;  5C0M A;  3MHX A;  1QKW A;  4BD3 A;  2KY9 A;  4EMH A;  2LJ3 A;  4N4G A;  1IHV A;  2CT3 A;  2E4H A;  2FYK A;  4C8Q B;  5GAN 2;  2FG0 A;  4XTU A;  3EHQ A;  4F7U F;  4DBF A;  3OYB A;  2ZPE B;  2KGT A;  4F14 A;  4JRP A;  1WHJ A;  4M7A A;  2DYI A;  3CCR A;  3MPU B;  1IHW A;  3FDR A;  2DD4 A;  3CCJ Q;  2EYY A;  2VAS A;  2LVM A;  5GAO l;  4M75 E;  1GXI E;  4C92 B;  4RTV A;  3J81 E;  5FRM A;  4OB1 B;  4DBR A;  1Q82 U;  1QP2 A;  4F7U B;  2LTO A;  2AK5 A;  3HSB A;  1GRI A;  3EFO B;  2A37 A;  3HTR A;  3NHN A;  4QVZ A;  2MYS A;  3FJP A;  2KT1 A;  5CKF A;  4KH0 B;  2CS7 A;  2M16 A;  4ME7 A;  2RQR A;  4A53 A;  4LUD A;  3C4S A;  2VXE A;  5LJ5 h;  1HJD A;  4E7H A;  4KGX B;  3EG2 A;  4IUV A;  4OB0 B;  1RI9 A;  1DJ7 B;  3UF4 A;  2K9G A;  1Y96 A;  1BIB A;  1VQ5 A;  2X51 A;  1YN8 A;  4E7I A;  1YI2 T;  5J39 A;  4OGE A;  1PHT A;  3H41 A;  5IT9 E;  4XTY A;  4EDU A;  2VUB A;  1VQP A;  2QAZ A;  1S1N A;  4F16 A;  1W2B S;  1PG5 B;  3A98 A;  3UA6 A;  1AZG B;  4OMM A;  3HRS A;  1RLQ C;  5LJ5 j;  1YHQ T;  5CO7 A;  3G6E T;  4UC4 A;  4OMQ A;  1VQM A;  3CCJ A;  4FT4 A;  2LP5 A;  4II1 A;  1AOJ A;  3H9N A;  1QVP A;  2DNU A;  5GAO p;  1VQO Q;  2ENM A;  2RN8 A;  1MMA A;  5AT1 B;  1NG2 A;  2JN0 A;  4RTZ A;  4IUR A;  2CUB A;  3GBQ A;  2K5L A;  1VQ8 A;  2DVJ A;  1VQ6 Q;  1D0Z A;  4FW1 A;  2H3J A;  4OP0 A;  1JJ2 S;  4AFS C;  1A0N B;  2CSQ A;  3M0R A;  2VVK A;  1UGQ B;  2OTJ Q;  2E10 A;  4M78 G;  2R5A A;  2NLU A;  2SRC A;  1G8X A;  3M0Q A;  5I2S A;  1WZO A;  1AWW A;  2RB6 A;  2L2P A;  1VQL T;  1OYX A;  1PRL C;  1YIJ T;  3G4S A;  1W2B A;  2HQE A;  1S72 Q;  3S3N A;  4LN2 A;  1I4K 1;  2JVV A;  2EQI A;  3J80 E;  2CZ1 B;  2DBK A;  2HAX A;  2QG9 B;  3VKI A;  2QXF A;  2LJ1 A;  2J06 A;  3A8L B;  4M78 D;  2LQN A;  2GQI A;  2K5F A;  1MGQ A;  2QDL A;  3GP8 A;  2HSP A;  1KJW A;  2EYW A;  2ZPI B;  4ELY C;  3MEV A;  2ED1 A;  5GAN 8;  4M75 B;  1M4Z A;  3OB9 A;  4RTU A;  1YJN T;  1JJ2 A;  1VQO A;  3DB3 A;  4KH1 B;  2QA4 T;  1UJY A;  1IGU A;  2KK4 A;  5FWC A;  3REB B;  2VYT A;  2V8K A;  1VQ6 A;  2LRQ A;  3LYI A;  3BDU A;  3H6Z A;  1RUW A;  4ZNX A;  3RKY A;  2X3W D;  2D8H A;  3JCM J;  4EIK A;  1B7T A;  3QII A;  1PSE A;  2AHJ B;  2HQH A;  3JB9 H;  1RAA B;  2KMT A;  3PIO A;  5D7U A;  4RG2 A;  4RMO A;  5CK9 A;  3P8B B;  3BW1 A;  5A0D A;  2E70 A;  3JCM W;  4XU2 A;  2RPN A;  3A8M B;  1WXB A;  2AZS A;  5FW9 A;  2FO0 A;  2EW3 A;  2EGC A;  2E5Q A;  4VUB A;  2HKQ B;  5GMK h;  3C94 A;  2JMC A;  4JZ3 A;  3AHU A;  3I56 T;  5KYU B;  2KT8 A;  1ZBX A;  1S72 A;  4M7D G;  3WXM B;  1KD1 R;  4MMK A;  2DJZ A;  2OAW A;  1Q81 U;  2W10 A;  1UUE A;  5A0L A;  1VQ9 Q;  2ZCF B;  3BE3 A;  3QZ9 B;  1Z9Q A;  2LC4 A;  4OB2 B;  2KRS A;  5IHI A;  4EMK C;  4C8Q A;  4DBQ A;  2D8J A;  3FIF A;  1NYG A;  5DY9 A;  1VQN T;  1H64 1;  5GJV B;  2DEU A;  1MMG A;  1X2Q A;  3CXC S;  4C92 A;  4AG2 C;  4M7D D;  1AWX A;  5GMK m;  3G71 Q;  1JEG A;  2AKL A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  4FSX A;  3ZBD A;  5A0G A;  5FU7 C;  2QQ9 A;  2VXF A;  4JDS A;  3JCM Q;  1KC8 U;  2RI5 A;  3L2Z A;  3CC4 T;  1S72 T;  2RK2 A;  2DTI A;  4XTX A;  4GY5 A;  2D6F A;  5GAN 5;  2RHI A;  3M53 A;  3I55 A;  1D3B A;  5IAY A;  4JUV A;  1M90 C;  3RKW A;  5M9O A;  4DOV A;  5GAO r;  3QYH B;  4X9D A;  2M9U A;  3LLR A;  4PJO F;  3VYG A;  1YIT T;  3JCM g;  3LGL A;  2VV5 A;  2EWN A;  1M1F A;  3V8J A;  1MHN A;  1HXD A;  4IUQ A;  4O5V A;  1JB0 E;  4M78 E;  5LL6 S;  4BI8 B;  4C8Q F;  4BDY A;  4PJO E;  4C5H A;  1BIA A;  3V7S A;  3RKX A;  3SD4 A;  4Z02 A;  3M4G A;  1YCY A;  4PKC C;  3QKJ A;  4J6X A;  4C8Q E;  3JCM P;  4JRQ A;  4BAC A;  4BE2 A;  1Y07 A;  3QXE B;  2E65 A;  1N8R C;  4IUT A;  5LJ5 g;  3KUF A;  3OYY A;  5HK3 A;  3JCM e;  5GAM g;  2WSE E;  3V7R A;  3A5Z B;  3OYK A;  1VQK T;  2LX9 A;  1QVG S;  3ZEH A;  4QVD A;  2K3Y A;  2Y90 A;  1Q7Y U;  2ZPB B;  1FXX A;  3C95 A;  5CKB A;  3E19 A;  3GF5 A;  4C92 F;  4PJO B;  3VU3 C;  4QW2 A;  5DLQ E;  1BYM A;  5LJ3 h;  3CBM A;  3V7C A;  2ZGW A;  2ZZD A;  4J6Y A;  2RI2 A;  4L5G A;  1UGS B;  2GFU A;  2DKG A;  4ZN3 A;  1W4S A;  4C92 E;  1VIE A;  5LJ5 e;  3MP8 A;  4E7J A;  2LDM A;  2P0P A;  3INZ A;  4WF2 A;  1VQ9 A;  3NTH A;  5GAM e;  5J3B A;  2DK3 A;  4OB3 B;  2V8I A;  3OW2 S;  2OAU A;  5FRN A;  1M1K C;  4BI4 A;  2XHC A;  3MCA B;  4F7U E;  1NE8 A;  1SSF A;  2QQB A;  1B34 B;  3BFM A;  3BDL A;  3LW5 E;  3CBP A;  4XTW A;  2Y4Y A;  1N6A A;  3EFR A;  4M77 G;  4HCB A;  3URG A;  3CEY A;  3DB4 A;  1YI2 A;  3QBY A;  3JCM b;  4D6W A;  3CCV A;  1WJQ A;  1U1S A;  3ASK A;  1XNI A;  3FRN A;  3I55 T;  4E7L A;  3VYH B;  1I5L A;  1YJ9 A;  1G3T A;  1BI0 A;  4Y28 E;  3G4S T;  2JZ2 A;  3OBY A;  4ZTF A;  2LCC A;  1K73 C;  4M7D A;  3PTA A;  1RI0 A;  4LDX A;  3MO8 A;  3WVD B;  4J7I A;  1ZHI A;  4CI0 C;  3JB9 G;  1Q81 C;  1N27 A;  1RL2 A;  2DTH A;  1G3Y A;  4XU1 A;  4Y91 A;  4XQ3 A;  2RJE A;  3JCM X;  3JAM E;  4XU0 A;  4HCC A;  3QJY A;  1VQ4 T;  2EQK A;  5GMK l;  3E9F A;  3P8H A;  1BI1 A;  5LJ3 j;  4N0A A;  2LCL A;  2EQM A;  2MAM A;  2P0Q A;  2KVQ G;  3GNG A;  4MZM A;  3G7Z A;  5LJ3 f;  1OZ3 A;  2DVE A;  4A4F A;  3ME9 A;  2YLC A;  3X25 B;  2QTX A;  2RD1 A;  2GFA A;  1XQH A;  5AYF A;  3N5B B;  2QEX A;  3RMS A;  2E12 A;  2O01 E;  2VC8 A;  3V8L A;  3CC7 T;  3OYM A;  2PUK B;  2X4X A;  4M77 D;  4Q5W A;  2DIQ A;  1QP3 A;  5GAM h;  4KUI A;  3OYH A;  5L8R E;  5GAO n;  2WSF E;  5KE2 A;  1VQ9 T;  4CRI A;  2E6Z A;  3CCQ A;  4BUG A;  3UWN A;  2M1H A;  2JTF A;  5FRO A;  4C0G A;  3M54 A;  3H8Z A;  3SWN C;  4DA4 A;  2K3X A;  3SDZ A;  1Q86 U;  1R8O B;  1KG1 A;  1TH7 A;  5KH6 A;  3OYD A;  3GPL A;  3TU4 K;  3CCV T;  2MMP A;  2XI9 A;  3NFC A;  3JB9 D;  3OW2 A;  3OSS C;  4BI3 A;  5LJ3 d;  2A3L A;  3SWN B;  2DTO A;  3O8V A;  5EG2 A;  4EMG A;  1G3W A;  5GAN 4;  2PVG B;  3CME A;  1KC8 C;  2HQX A;  5D6W A;  4M7D E;  2DAQ A;  2O4X A;  5GAO m;  2RH2 A;  1HK9 A;  2X4J A;  2XD0 A;  2DZC A;  2K5I A;  2VGM A;  4C0D C;  3JCM f;  5KCH A;  2VGN A;  3GIB A;  2EYQ A;  2EJF A;  4X34 A;  3TEE A;  3G71 T;  4BE0 A;  1BI2 A;  1X75 C;  2QQS A;  3GOX A;  2QI2 A;  3FC3 A;  5CIU A;  2EJ9 A;  2WSC E;  3MET A;  5J26 A;  2XID A;  4A4K A;  3CCM A;  5GAM j;  5KE3 A;  3KXT A;  4JS4 A;  3CD6 A;  5LJ5 f;  3FEO A;  2OTL A;  2BIV A;  3ER0 A;  5GAM f;  3OYJ A;  2EQJ A;  3CMA A;  4FU6 A;  2QEX T;  1U1T A;  4IKF A;  3EFS A;  1KD1 C;  4HT8 A;  2JOY A;  3HFN A;  4F7U A;  3CCL A;  1M9S A;  3L42 A;  3X24 B;  3LX7 A;  1Q7Y C;  3HFO A;  3UPU A;  1KHI A;  4JLI A;  4QQD A;  3A8O B;  4PL6 A;  4M75 A;  4NS5 A;  2KSS A;  3VUZ A;  3EAE A;  4DQ2 A;  3L2V A;  4A4G A;  3CCQ T;  2PUO B;  3PMI A;  2Y4X A;  5CQY A;  3JCM d;  3OS1 A;  4FT2 A;  2D0Q B;  1PSF A;  4BY6 C;  4M78 F;  4X9C A;  3CCS A;  1I8F A;  2LT1 A;  2LQ8 A;  1KQ2 A;  5CQX A;  1NZ9 A;  4M77 A;  3CME T;  3NTI A;  5LJ5 d;  3CCU A;  1G3S A;  2DPP B;  1WJS A;  5GAM d;  3JB9 J;  4J6W A;  4LDV A;  4BY6 B;  4M78 C;  3V8K A;  4N4I A;  5CKD A;  4PJO G;  4LD6 A;  4PJO C;  1N9R A;  3RIR A;  5C0M A;  4YTL A;  3MHX A;  1KD1 U;  2RHU A;  2RJD A;  1VIF A;  4BD3 A;  1Q82 C;  2KY9 A;  2BKD N;  4C8Q G;  4EMH A;  4C8Q C;  4JLG A;  3OMC A;  4BB7 A;  3VV0 A;  4DOW A;  4HCZ A;  4N4G A;  4M78 B;  3QHS A;  4OMF B;  2K2V A;  2F5K A;  4C5I A;  2D9T A;  4C5E A;  2FYK A;  1UEB A;  2EIF A;  5I2M A;  3CCM T;  4C8Q B;  5D6X A;  5GAN 2;  4XTU A;  3QG1 A;  4F7U F;  3CD6 T;  1O9S A;  3RES A;  2OTL T;  3OYB A;  3FLG A;  2ZPE B;  4J83 A;  3CBO A;  4JRP A;  4C92 G;  4QVC A;  4C92 C;  3CMA T;  2RHZ A;  4M7A A;  3R6O A;  3CCR A;  4M75 F;  3M56 A;  2GF7 A;  2IVW A;  5HK0 A;  3FDR A;  2DD4 A;  1YJW A;  2LVM A;  5GAO l;  1M1G A;  4M75 E;  3S3M A;  4C92 B;  2XDB A;  1GXI E;  3P8D A;  3J81 E;  2XU8 A;  5FRM A;  4OB1 B;  1WJR A;  5CCA A;  1QP2 A;  2MWO A;  1Q82 U;  2RK1 A;  4PJO D;  4F7U B;  2LTO A;  2QQA A;  4PLL A;  4B9W A;  3CCS T;  1M5Q 1;  4A4E A;  5GMK e;  2HD0 A;  2G3R A;  3HSB A;  1FX7 A;  3CCE A;  1JRI A;  4MZP A;  4C8Q D;  4A4H A;  3OYN A;  3HHT B;  3OYL A;  2CZ6 B;  1Q86 C;  4M77 E;  4LDW A;  3ZFJ A;  3CCU T;  2LT4 A;  4XTZ A;  3PIP A;  2X4Y A;  2M0O A;  2YLB A;  3OYG A;  4QVZ A;  3FJP A;  3SB2 A;  1D3B B;  2B8A A;  3HPW A;  3QDR B;  5GAO q;  1UGR B;  5D6Y A;  3JCM h;  1FWZ A;  5CKF A;  4J8O A;  3LH0 A;  3VUB A;  2CS7 A;  3G6E A;  1YHQ A;  2M16 A;  3HRU A;  4ME7 A;  2KQW A;  5KCO A;  3OS2 A;  4XK8 E;  3CPW A;  4EMK A;  3LGF A;  4C92 D;  3OYC A;  2MI6 A;  2JUF A;  3QYG B;  4A53 A;  2A7Y A;  2F5T X;  2C06 A;  3C4S A;  4ZN1 A;  3JSC A;  2VXE A;  5LJ5 h;  4E7H A;  2CYZ B;  4KT0 E;  4IUV A;  3M58 A;  1G5V A;  4M7A F;  3M5A A;  3JRZ A;  4E7K A;  1XTD A;  2EAY A;  5CKH A;  2E6N A;  2X35 A;  4OB0 B;  4BDZ A;  1OZ2 A;  1DJ7 B;  2L89 A;  2XIC A;  2OTJ A;  2DO3 A;  5GAN g;  4M7A E;  4MDW A;  1Y96 A;  3CCR T;  3CCE T;  3A8G B;  5CKE A;  1BIB A;  1V29 B;  1VQ5 A;  3M55 A;  4HA8 A;  2EJG A;  4NOY A;  4XAX B;  4KUL A;  3KBG A;  4E7I A;  1YI2 T;  1YJW T;  5FU6 C;  4OGE A;  5J39 A;  2PVD B;  5IT9 E;  4M7D F;  1WPY A;  4RCC A;  4XTY A;  4EDU A;  5GAN 6;  2VUB A;  5GAN e;  4ZGJ B;  1VQP A;  1YJ9 T;  3OYF A;  4A54 A;  1VUB A;  4B9X A;  4LD9 K;  3M4Y A;  5FU6 B;  4J5Y A;  1W2B S;  4LDY A;  4M7D C;  4XU3 A;  1OI1 A;  3HRS A;  4ZGD B;  3RMQ A;  2DXU A;  1VQL A;  3F70 A;  4N4H A;  1KHC A;  2FB7 A;  2EFI A;  2L8D A;  2RHY A;  1YIJ A;  3TRE A;  2RJF A;  4RKU E;  3OSV A;  5LJ5 j;  1YHQ T;  5CO7 A;  3G6E T;  4UC4 A;  1VQM A;  2F69 A;  4ATO A;  3QPH A;  3QSU A;  3S3O A;  4M7D B;  4OVA A;  4QQG A;  3CCJ A;  1Y7X A;  4FT4 A;  2FVU A;  4IUU A;  3HRT A;  2RA2 A;  2R57 A;  3QJ6 A;  1WGS A;  3QZ5 B;  4II1 A;  5GAN 3;  2XG8 D;  1QW1 A;  3L2W A;  2FHD A;  1QVP A;  4MZT A;  1WNL A;  5GAO p;  3T9N A;  2JN0 A;  3PNW C;  3UT1 A;  4IUR A;  3L2U A;  2BUD A;  4V2S A;  4LDU A;  3J7A F;  2K5L A;  1VQ8 A;  2LNV A;  2OTJ T;  2GQV A;  1B34 A;  4BE1 A;  1KQS A;  2K57 A;  3OYI A;  4ELZ C;  5GMK j;  3HP9 A;  2H3J A;  4OP0 A;  1JJ2 S;  1VQ5 T;  4HT9 A;  3OBW A;  2P4T A;  2XDP A;  5HKC A;  1IZ6 A;  5HY6 A;  1NJI U;  5GAN h;  1UGQ B;  4L6V 5;  4RG8 A;  3CPW S;  4PNO A;  2DXC A;  2E10 A;  3NTK A;  2R5A A;  3PT9 A;  4L59 A;  4M78 G;  4NL3 A;  3HKS A;  1YJN A;  2NLU A;  2ZPH B;  1VQ7 A;  1QVF S;  2X4W A;  2L3R A;  3SFM A;  2QA4 A;  3M9Q A;  5I2S A;  4FM4 B;  2PVO B;  2CGH A;  3S6W A;  2RB6 A;  3L1A A;  1VQL T;  1OYX A;  3MEU A;  2EQU A;  5DLO A;  1K9M C;  2HNI A;  3OY9 A;  4N0A C;  5FU7 B;  3OA6 A;  1YIJ T;  1YBY A;  3G4S A;  2CKK A;  1VQM T;  1W2B A;  2HQE A;  3A8H B;  2XKO C;  2O4X B;  3Q1J A;  1U8R A;  3CCJ T;  2R58 A;  4MDX A;  3WVE B;  4KUD K;  4XTV A;  4HKE A;  3S3N A;  2RJC A;  3L2Q A;  3RER A;  3BY7 A;  5CVI A;  1I4K 1;  3JCM V;  1VQ4 A;  3CCL T;  4MML A;  3X26 B;  2JVV A;  2HBP A;  5DM7 R;  3JCM c;  4E47 A;  3J80 E;  2KAF A;  3M59 A;  4F7U G;  4JRK A;  2CZ1 B;  4RCB A;  2HAX A;  3VKI A;  2CZ7 B;  1K8A U;  3PMT A;  5IN1 A;  2MWP A;  1VQ8 T;  4O6J A;  4R56 A;  5GAN j;  4R55 A;  2QXF A;  2JTM A;  3MEA A;  4M75 G;  3A8L B;  4M75 C;  2RHX A;  4M78 D;  3CC7 A;  2K5F A;  5GAN f;  1MGQ A;  3GP8 A;  4C0F A;  2PU9 B;  2E64 A;  4M77 F;  1K9M U;  2ZPI B;  4ELY C;  1M90 U;  3I56 A;  3MEV A;  4C5G A;  5CAI A;  4C0Z A;  3SWN A;  5GAN 8;  1O75 A;  4JS5 A;  1JBM A;  4M75 B;  1N9S A;  1M4Z A;  3OB9 A;  2CZ0 B;  3OMG A;  1YJN T;  1JJ2 A;  1VQO A;  3DB3 A;  4M77 C;  1VQ7 T;  2QQR A;  2I2L A;  3CXC A;  2QA4 T;  3CPF A;  3LWH A;  1UB4 A;  2KK4 A;  3MEW A;  4NL2 A;  3JB9 F;  5CR2 A;  1EIF A;  2VYT A;  1P92 A;  1LOJ A;  2R5M A;  2V8K A;  1N8R U;  2LRQ A;  4M77 B;  1VQ6 A;  2K4Y A;  3E1S A;  3LYI A;  3BDU A;  4PLI A;  3PFS A;  3X28 B;  3H6Z A;  1QVF A;  1KQS S;  3RKY A;  2DIG A;  3E9G A;  2MF2 A;  3JCM J;  5GAN d;  4EPC A;  1H3Z A;  1NPP A;  1LNX A;  4TVR A;  2DZ9 A;  3QII A;  4JJN K;  1PSE A;  2QDY B;  2AHJ B;  3QO3 A;  2DXB A;  1VQN A;  3JB9 H;  3GNF B;  1KQ1 A;  3G71 A;  2KMT A;  4M75 D;  3PIO A;  2DD5 A;  2V8J A;  2JNG A;  2DEQ A;  4RG2 A;  4RMO A;  1M1K U;  2PQW A;  5CK9 A;  3GLX A;  3PGG A;  3P8B B;  2ZPF B;  3BW1 A;  1X01 A;  2E70 A;  5A0D A;  4M7A G;  4M7A C;  2GCX A;  3DKM A;  4IUP A;  3OS0 A;  4XU2 A;  3JCM W;  3CC2 A;  1Y71 A;  1AHJ B;  3A8M B;  4JRI A;  1IRE B;  2E41 A;  4ZGE B;  2E5Q A;  4VUB A;  5GMK h;  1M8V A;  3OS5 A;  3MP6 A;  4M7A B;  3C94 A;  3VJP A;  5I21 A;  3AHU A;  1BI3 A;  3I56 T;  4ZTJ A;  1XOV A;  1QVG A;  1ZBX A;  3CC4 A;  1S72 A;  2RM4 A;  4M7D G;  1X6O A;  3OYA A;  1WQ7 A;  1K73 U;  3WXM B;  2FL7 A;  4MMK A;  3OYE A;  2DXT A;  2DJZ A;  1Q81 U;  3M57 A;  4P5N A;  5C6S A;  1VQO T;  3HL8 A;  4QQ6 A;  3LWI A;  1NJI C;  3TCJ A;  3JB9 I;  1BKB A;  5A0L A;  4J7F A;  5A2Q E;  2ZPG B;  2EKO A;  1YIT A;  2ZCF B;  1I81 A;  4OF1 A;  4M78 A;  1WQW A;  2YHT A;  3QZ9 B;  2L5Q A;  2LC4 A;  4PJO A;  3OQ5 A;  2XK0 A;  1VQ6 T;  5GMK i;  3X20 B;  4OB2 B;  1LJO A;  4EMK C;  2RI3 A;  4C8Q A;  4M7A D;  2WAC A;  3DLL A;  5LJ3 g;  2RO0 A;  3L2R A;  3FIF A;  4FIB A;  5DY9 A;  1VQK A;  2IG0 A;  2E1H A;  5FLX E;  5GAN 7;  1VQN T;  4KBM B;  3UDC A;  3DLM A;  4EMK B;  1ZQ1 A;  1H64 1;  3MP1 A;  1UGP B;  3C12 A;  4GLK A;  4FL6 A;  4C0D B;  5LJ3 e;  2LQK A;  1NPR A;  3FB9 A;  4C92 A;  3CXC S;  2P0K A;  3CC2 T;  4M7D D;  5GMK m;  3RUX A;  2XDD A;  3QUI A;  4OGC A;  1VQP T;  1K8A C;  2YRV A;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...