4A4EA

Solution structure of smn tudor domain in complex with symmetrically dimethylated arginine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL MOTOR NEURON PROTEIN
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4eA00
2RI5A 2M16A 1WJRA 3OMGA 4PLLA 5D6YA 3OYHA 2RJEA 4IUUA 3GOXA 5FRMA 2P0KA 2RHIA 3OYFA 2JZ2A 3OYDA 4BE2A 4A4EA 2DIGA 2R5MA 4A4HA 4E7HA 3BDLA 5D6WA 2E6NA 3C4SA 2DIQA 3NTHA 4L59A 2LTOA 3MP1A 2EQUA 5KCHA 2GF7A 2X4WA 1G5VA 4IUTA 2M0OA 3PMIA 5IN1A 3CEYA 4C5HA 3L2WA 3OQ5A 3OYCA 2RJDA 3M9QA 3FDRA 5D6XA 3OYMA 4NS5A 2MWPA 2RHUA 3S3NA 3OYGA 2R58A 4BACA 4B9XA 2WACA 3PFSA 3UWNA 2XK0A 3LGLA 3MP6A 1H3ZA 2LVMA 3E9FA 2F5KA 2M1HA 1MHNA 1XNIA 2RO0A 3OYIA 5KH6A 3H8ZA 3PNWC 4QQDA 2BKDN 2E5QA 4BDZA 2XDPA 4N4GA 4A4GA 5KE2A 3OYAA 1OZ2A 3DB4A 3QJ6A 4ZTJA 3F70A 3EAEA 4QW2A 4E7JA 3LGFA 3S3MA 4EDUA 2RI2A 3OYNA 4BDYA 1OI1A 3QKJA 4QVZA 3S3OA 4E7KA 1OYXA 2RI3A 4ZTFA 3OMCA 2QQSA 2EFIA 5J26A 3OYJA 2X4YA 2RJFA 3OY9A 3MEAA 3QIIA 5C6SA 2GFAA 2R5AA 4X34A 3LLRA 3L2RA 2PQWA 2R57A 3OYLA 2X35A 2IG0A 3OS0A 3OS2A 3ZEHA 4Z02A 2EQMA 5CIUA 2BIVA 4IUPA 4C5EA 3MEWA 3L2QA 2D9TA 4BE1A 4IKFA 2FHDA 3LX7A 2HQXA 3LYIA 4Q5WA 4HCZA 2GFUA 2K3XA 4FU6A 2B8AA 2BUDA 5FRNA 4QQ6A 4IURA 4E7IA 3L2VA 3FEOA 3LH0A 3MEUA 4IUVA 4LD6A 1OZ3A 5FROA 3OA6A 4BE0A 2K3YA 2RHXA 3PMTA 2O4XA 2MWOA 3FLGA 3UT1A 3OYBA 2EQKA 2L89A 4PLIA 4RG2A 3OS1A 5C0MA 3MP8A 2RHZA 4PL6A 2DAQA 2X4XA 4IUQA 4UC4A 4B9WA 3META 4C5IA 1WJQA 4OVAA 3E9GA 4N4HA 1RI0A 1N27A 3H6ZA 3NTIA 4BD3A 5M9OA 2EKOA 3QBYA 3ME9A 2VYTA 3DB3A 3O8VA 3DLMA 1WJSA 1KHCA 3NTKA 5KE3A 4II1A 4A4FA 2EQJA 1SSFA 3L2UA 4E7LA 2LRQA 2YRVA 3P8DA 5J39A 2LCCA 3FC3A 2G3RA 4CRIA 3OB9A 1WGSA 3MO8A 3S6WA 3SD4A 3OYKA 2HQEA 2RHYA 3MEVA 5KCOA 2L8DA 2CKKA 4FL6A 2RJCA 2O4XB 2QQRA 3L42A 3P8HA 4GY5A 4N4IA 4C5GA 2NLUA 4QQGA 3OYEA 3ASKA 2LDMA 3KUFA 5IAYA 2JTFA 2L3RA 3Q1JA
chains in the Genus database with same CATH superfamily
1VQLT 2KRNA 5AT1B 4F17A 2RH2A 2R5MA 2DXBA 1RADB 4FW2A 1UGPB 2HL5C 1XTDA 2KXDA 3P8BB 4CC3A 1T0JA 4M77A 2EIFA 1Z9ZA 3MCAB 1WHLA 2PVDB 1ZX6A 3QWXX 1UECA 3CMAT 2X9HA 3WVDB 1H92A 4CI0C 1VYVA 2RM4A 5GAOl 1TTHB 2VB6A 1M3BA 1WNLA 4HXJA 1W2BP 3CCUT 1RAEB 2LQNA 4N0AA 4C92F 1YJNA 3RNJA 3L2ZA 1PHTA 2AHJB 2H3JA 2V1QA 4C92G 2RF0A 2DK3A 5HY6A 4M4ZA 1U1SA 2FHDA 4E47A 4NL3A 5CO7A 3CQTA 2K2MA 2KEAA 2DD4A 4IURA 1Q81U 4JDSA 4F7UE 2MCNA 5FROA 2K3YA 4YTLA 1WHHA 3FLGA 3CCLQ 2DL8A 1HXDA 3META 3NGPA 2COZA 4C0GA 5CR2A 2QK0A 2QI2A 1UB4A 1M2OA 3C0CA 1NM7A 5KYWA 4M7DF 2VYTA 4QT7A 4LDXA 3G71T 2KXCA 3AHUA 1CSKA 3E2UA 3NTKA 1QVFA 1WGSA 1WHMA 4LXCA 1IB8A 3CBMA 2DYBA 2VC8A 4LN2A 4BI4A 4ZGDB 2JTFA 2L3RA 2XMFA 2RK1A 2P4TA 5CAIA 3EH1A 4BE2A 2F2XA 5LJ5h 1ARKA 2KDSA 1NEBA 3RKYA 3RMSA 1VQ6Q 1XJWB 1AT1B 2WSEE 4J5YA 2AIRB 2KSSA 4C5HA 3OYCA 3CCJT 1VA7A 1GCPA 2DETA 1VQMQ 4RTWA 2D8JA 4V2SA 4PJOG 3JCMV 3C94A 1PC0A 2GGRA 3I5RA 1NBEB 3G6ET 2RQRA 4R0KA 2MF2A 5GAN7 4J9BA 4AT1B 4E7ZA 3EHRA 1MMAA 5FU6B 2JM8A 3CC4A 1GBRA 1ZBXA 1SPKA 1PSFA 2DL3A 1Q86U 1JRIA 2PUOB 3SB2A 2EFIA 3CD6Q 1WA7A 2PNIA 2J6OA 3GLXA 1IO6A 2HD0A 4PFPA 2YUOA 1VQOA 1UHCA 1HSQA 2E4HA 2DLPA 2L3QA 3X26B 4KUDK 1YJNQ 2ABLA 2EQIA 2ZZDA 2COYA 2O88A 2QGFB 1PD0A 2PVOB 4HVWA 3QUIA 1W1FA 3FEOA 1UDLA 2K3BA 4L6V5 3T9NA 3OYBA 1WPYA 1BBZA 2L89A 2ZPHB 4LDWA 4M77F 2QEXA 3IQLA 4ORZA 3JB9I 3L1AA 2CP7A 2M9UA 2MPXC 1VQ7T 1UJYA 1QVFS 2CSQA 3J80E 2ED1A 3MPUB 2EYZA 2YWWA 5LJ5g 1SSFA 5I21A 1K8AR 4CRIA 3INZA 2HQEA 1IXDA 4C5GA 4M75D 3CMAQ 1LVKA 2L0AA 2ROTA 2NYSA 2GQIA 2DJZA 2RJEA 1I0CA 4M75E 4C8QD 2LJ3A 5KYUA 3CCMA 5GAOp 5IHIA 4OMNA 5GAN8 4IUTA 1YN8A 3HPWA 2K5FA 4JJCA 2DO3A 4M7DD 3OQ5A 4AMCA 3UPUA 1U1TA 2SRCA 5LJ5e 1M8VA 4M7DE 3CC2A 1CKAA 2KR3A 5LJ3d 2LVMA 4HT9A 3TCJA 1YWPA 2YSQA 1K9MR 1UGRB 3QZ5B 4QQDA 2WSFE 4KT0E 4BI3A 4BDZA 2F69A 4N4GA 2RPNA 1YBYA 3BDUA 2DRMA 1X75C 1Y57A 1WXUA 5AYFA 3G4ST 4BDYA 3CC7Q 1V1CA 3RR6A 1UJ0A 4JRPA 4M7AD 3MEAA 2XD0A 2VUBA 5CK9A 2YUNA 3LLRA 2D0NA 1VQKA 4PNOA 3ZEHA 3EFOB 8ATCB 4J9EA 2K3XA 3HHTB 5FU6C 4PK4A 1I5OB 2HSEB 3CPWP 1E7OA 1OEBA 2ZPIB 2O2OA 2JNGA 2X4XA 2K5IA 2ESWA 3R6NA 3A8OB 4M78D 3RERA 1R0BG 3MHXA 1MMDA 2HAXA 2E41A 1KD1R 4RCBA 1YJWQ 1AD5A 2EQJA 4C92B 1K8AC 1VQ4A 3S6WA 3PVLA 3OYKA 3EG9B 3MEVA 2CGHA 2Y90A 1YI2T 3O5ZA 2L2PA 2HZYA 4R55A 3HRSA 3GNGA 3JCMW 1JB0E 4D8DA 1IHVA 4IUUA 4HKEA 2WSCE 2JOYA 2DERA 2J05A 5HK0A 1LPLA 4M77D 3BDLA 4ATOA 5I2MA 4M77E 3WVEB 5GAMh 2COWA 3CCEA 2KI7A 3I9QA 2KRMA 4WTOB 1G3SA 2EWNA 5CCAA 2W0ZA 4HCKA 2YDLA 4CC4B 2NUZA 5GJWB 1XNIA 3OSVA 2FZCB 1K9MC 1K0XA 2CZ7B 2RA2A 2E5QA 4Y28E 1TS9A 1YIJA 2YLCA 2VASA 2CP6A 3CCVA 1I5LA 3S3OA 2LJ0A 2HL3A 2NUPA 2FL7A 3ZL7C 1AOJA 2FRYA 2FYKA 2HKNA 2EBPA 4MZTA 3QJYA 2X35A 3V8JA 1S72A 1YHQT 1OPKA 4XAXB 1FXXA 3REBB 1JJ2P 3JCMX 4A4KA 5GAOn 2HQXA 3I56Q 2GBQA 3CMEA 4O6JA 1ZUUA 2V1RA 1FWZA 1WDXA 4BE0A 3SWNB 5IHNA 5GANh 3VUBA 1X6GA 3TVTA 1WJQA 3CCQA 4MMLA 1KG1A 3QYGB 4N4HA 2EW3A 3ME9A 4FYVB 1QVGP 3O8VA 2QQAA 4ELYC 1KD1C 3EFRA 5KE3A 3JCMd 2LRQA 3P8DA 2F5TX 1R77A 1KSWA 5GAMg 1TWBA 1I07A 4DOWA 4F04B 1IRXA 1W4SA 1K4US 1LNXA 1WQWA 2DNUA 2D1XA 4PLLA 2VXFA 3OYDA 1OX9A 2CP0A 3TREA 1YITA 3M59A 2PUKB 2DRKA 1Q86R 3OS5A 5GAN4 2OAWA 2GF7A 3H9NA 3HRTA 1YJ9A 2FPEA 3M9QA 3FDRA 2XDDA 4C92C 3CPWA 4BACA 2OTJA 4OMLA 3AT1B 2KROA 5GAMe 4ELZC 1T3SA 2QAZA 2E12A 3CCLT 1QWEA 5KYXB 3A1PA 5DLOA 4LUDA 2YT6A 1VQPT 2LT4A 2OJ2A 1PRMC 4QVZA 5A0DA 4J83A 1VQNA 2LNHB 4RG8A 2KYBA 4C8QA 2E5KA 1YIJQ 1K8AU 1VQ8A 2GFAA 4X34A 4D6WA 2OTLA 1M1KR 1N9RA 4F7UF 4HA8A 3OS0A 1ZSZA 2RQTA 4IUPA 1MNEA 1FMKA 4J9IA 1ABQA 2H8HA 4JUVA 1K73R 3BY7A 4HCZA 4PKCC 4QQ6A 4JLGA 4F7UG 2A36A 3M0UA 1BYMA 1VQMT 2DAQA 3JB9H 3VS4A 1MNDA 3CMEQ 4ZN3A 2EJFA 3E9GA 2OI3A 3H6ZA 5KYWB 5GANe 3DKMA 2DL7A 3DLMA 4M7AA 1WJSA 3CCQQ 1K9MU 1YCYA 1Y7XA 1VQ5A 3MO8A 5KCOA 1X27A 1KIKA 3X25B 3GNFB 8AT1B 3ASKA 3H0IA 3CD6T 3U23A 4KH1B 2XHCA 3OYHA 5FLXE 2DJQA 1B3QA 2HMAA 3PGGA 3UF4A 4CC7A 1YJNT 3VS3A 3CPWS 2PTKA 5GAN5 5LJ3j 4XU2A 4E7SA 4EMGA 3OW2P 4M78A 1FMVA 3LWIA 2FRWA 4JPBW 2ZPBB 3LGLA 4HCBA 4K11A 4X1VA 2K5LA 2QGGA 2LMJA 4C0DB 1KQSP 2BKDN 1U3OA 1DJ7B 2E6ZA 1HK9A 2CH4W 9ATCB 1QVGA 2GTJA 1RACB 4QW2A 2LCLA 1D3BA 2MI6A 5LJ3f 4XTVA 1KD1U 1D0YA 2X4YA 2NUTA 1Q82C 3RKXA 3URGA 3CCRA 1M1KC 2JM9A 2BIVA 3EGXB 2OAUA 1BI1A 3M57A 3A98A 3SEMA 1VQ9A 3GPLA 4DBQA 1K73C 1G83A 4P5NA 4DEXA 1UTIA 2V26A 2G6FX 1SHGA 1SHFA 3H0FA 2MWOA 2HCKA 1SG5A 2H3EB 4N0AC 5C0MA 1K1ZA 1WFWA 3NHNA 2EJ9A 1AWJA 3G1JA 2CT3A 4JS4A 1RLPC 3N5BB 1UFFA 1FMWA 4IIOA 4F14A 3VJPA 1EZZB 4A4FA 3EH2A 2MK5A 4M75F 2KE9A 2J6FA 4XQ3A 2MOXA 3QG1A 5J3BA 5GMKi 3CC7T 3P8HA 1JXMA 2LDMA 4C8QF 1KQ1A 1JJ2S 4M75G 3CC4T 3OYFA 3R6OA 4FIBA 2DIGA 5KYUB 1RUWA 3I55A 1QCNA 5CKEA 1VQPQ 1VQLA 3CBOA 4OMMA 2KK4A 4XTUA 2RK2A 2FPDA 4NOYA 1VIFA 1VQOT 2AK5A 3CXCP 4M7DG 1N9SA 1M2VA 3UA7A 5DY9A 3JCMP 2KGTA 1QVGS 2DVEA 2EYYA 4AFQC 3J7AF 2DKGA 3TQ7P 3JCMJ 1K9AA 4FT2A 2E3HA 1OZ2A 1JQQA 5FWBA 4M7AF 1QMCA 3HP9A 1HYOA 3M58A 2F2VA 1YJWT 3RESA 3FJPA 3VV0A 2BE7D 4ME7A 3CCUA 3L2RA 2JS0A 3QO3A 4J9GA 5GAOm 2YRDA 4EMKA 5GAOq 3OS2A 4IIMA 4C0DC 1C0MA 1KJWA 1VOMA 2D9TA 1I4K1 1NJIR 1NLOC 4LD6A 3OW2A 4DQ2A 3X28B 2AT1B 2E65A 2LX7A 3MP8A 2RHZA 2DX1A 4M78F 4B9WA 1R0CB 4C5IA 1X2KA 4DBFA 1ZUYA 4GLMA 2QDYB 3E19A 1OQKA 2FPFA 1KQSA 3JB9J 3GIBA 3A8GB 2A37A 1TUGB 1U06A 3X20B 1ZHIA 4VUBA 2YRVA 3FC3A 1TH7A 3G71A 4J9HA 3VS5A 2RHYA 2AZSA 2O01E 1Y07A 2DEQA 2L8DA 3BE3A 4GY5A 1OU8A 1U5SA 5IT9E 4F7UB 1Q7YR 4FT4A 2AKLA 1M3AA 2P0KA 1Q82U 2XG8D 3JCMf 1D1BA 4JZ4A 2BZYA 3NTHA 1M1KU 4M77G 4DA4A 2J06A 2VV5A 2ZPGB 5GAOr 3HRUA 3L2WA 1B34B 3TSWA 5LJ3g 2DMOA 1H3HA 3I55Q 3I56T 1K73U 1W2BA 3WXMB 2WACA 2QTVA 1MMNA 3ER0A 3EGDB 2EAYA 3G6EA 2JMCA 1AEYA 4KGXB 4Y91A 1YWOA 1P92A 4C8QE 1Y0MA 3S3MA 3VU3C 2CZ1B 5I2SA 1RAHB 4KULA 2NUPB 3OMCA 2QQSA 1GBQA 3OYJA 1QKWA 3RUXA 1SRLA 2KQWA 2RNAA 1AWWA 4PJJA 2EQMA 3C95A 1B07A 2AKKA 5ECAA 2MYSA 2DBMA 4LNPA 3LX7A 1PM3A 3OW2S 4KGVB 4NL2A 3G7ZA 2JXBA 3EFSA 4OMFB 5GMKh 5IXBA 1NJIC 2QA4A 3V8KA 2QDLA 2VGNA 2F2WA 2NWMA 5LJ5d 4CC2A 1KQSS 1VIEA 4J9DA 2YUPA 3CC4Q 1PNJA 1GRIA 1ZQ1A 4J7IA 1KK7A 3VKIA 4FM4B 4EIKA 2L3PA 4E2FB 2SEMA 1MMGA 4Z8AA 4M7AE 3NTIA 1RABB 2A0FB 3ZBDA 2HEQA 3I5SA 3JCMc 4TVRA 4AFZC 1QW1A 1VQ7A 1ABOA 1VQOQ 1D0XA 2G3RA 1WZOA 2HDAA 2RJCA 2EYQA 2O4XB 1N8RR 1RAGB 1X43A 2DD5A 1IGUA 5D6YA 1YIJT 1Q7YC 4E6RA 1SF9A 4RCCA 2QEXQ 3UATA 4RTUA 1W2BS 2X3WD 4M78E 2KNBB 3RKWA 4AFUC 3ZFJA 2QXFA 3SFMA 2RB6A 3S3NA 1R8OB 2XK0A 2Z0WA 4LUEA 3VS6A 3PIOA 2EGAA 3OYIA 1QP2A 3CMET 3OBWA 3CBPA 5GAN3 4M75B 2IPOB 3TEEA 4A63B 1ZUKA 3EGUA 1OI1A 3EG2A 2JT4A 3CCQT 4C8QB 3CCMQ 2DA9A 3G4SA 3HTRA 3PIPA 5C6SA 2CREA 3V7RA 1BCMA 3OYLA 1EX4A 1IZ6A 2IG0A 2K2VA 1ZSZB 4M7DB 5CIUA 4J8OA 3MEWA 3VS2A 3CC2Q 3CCSA 3CXCS 2QYZA 2HQHA 3HL8A 5FRNA 1GCQC 1B7TA 1NEGA 2DZ9A 1TSFA 3A5ZB 1YITT 2ROLA 2BTTA 5GMKe 2MMPA 5CQYA 4LE9A 3HFNA 3JCMg 1UE9A 1AZEA 1AVZC 4XTWA 5CKFA 2P0PA 1T3LA 4FYXB 4MDXA 5GMKm 4M7AB 1KHCA 5EC7A 2LCSA 2OTJT 2L3SA 1VQKQ 1RI9A 5HK3A 1PG5B 1VYTA 5DLQE 1WIEA 1UUEA 1D1AA 1JU5C 1N8RC 2RQUA 4PFOA 1WXTA 4LDYA 2XI9A 4KH0B 4L59A 4QVDA 1VQNT 2X4WA 4JJNK 2X3XD 1VQ8T 2JN0A 1G3WA 2ZPFB 3CPFA 2ECZA 4M78B 4FYWB 3OYGA 3M53A 4OP0A 1NJIU 4HVUA 2DL5A 3MP6A 3M0RA 1TOVA 1VQ4Q 3VS0A 1NZ9A 2RD1A 3PNWC 3QZ9B 3GBQA 2JMAA 3OYAA 1BKBA 1BK2A 2DE0X 2YUQA 4M77B 3RBBB 4FSSA 2NUTB 4ZNXA 2R5AA 2FZGB 1TUCA 2BE9B 3CCEQ 3JCMb 1RAFB 3MJXA 4OB1B 4FCYA 1OX8A 1X6OA 3H41A 1UGSB 2LT1A 2CZ6B 3GF5A 3KFVA 2ZCFB 5DM7R 1BCOA 1Q7YU 1UHFA 2GFUA 4FU6A 2DTOA 4C92A 1XOVA 1OZ3A 4M75C 1IHWA 3PMTA 3CCSQ 1VYUA 4RG2A 5I22A 1Q82R 3EG0A 4PL6A 1NG2A 4C8QC 5GAMd 1X01A 3CCVQ 4X9CA 5EG2A 1M90R 4C0FA 2FG0A 3FIFA 4BD3A 1ZSZC 4OGCA 4M7DC 2EGCA 4XK8E 1MV0B 3RMQA 2LCCA 1S72Q 2FEIA 2HBPA 5GAN6 3VUZA 1UEBA 2CP5A 3NMZC 1ZSGA 2CSIA 4HCCA 3OMGA 1WJRA 1WI7A 5GAN2 1U8RA 2KMTA 4E7HA 4LDUA 2A08A 3MP1A 2DPPB 2EQUA 2V8JA 2E1HA 1G5VA 3HKSA 3PMIA 5IN1A 1SKUB 4F16A 2P0QA 5IXFA 4LDVA 4M7AC 1IREB 1AWOA 2CYZB 3CCRT 4NS5A 5L23A 3KXTA 1SEMA 3M5AA 3UWNA 1PWTA 1I81A 4EMHA 4DEYA 1YNZA 3V8LA 1VQ9T 1K76A 1LOJA 4Y92A 2CUBA 3VYGA 2RO0A 4JRQA 4PJOA 2M02A 3M0SA 5GANd 1G3YA 3QYHB 3CCLA 1JJ2A 4MDWA 5HCKA 3QSUA 3DB4A 3F70A 4O5VA 2RI2A 1M5Q1 1BIBA 3SWNA 1YITQ 3A8LB 2YRCA 3JAME 2J7IA 4M78C 1YJ9Q 1BU1A 4RTXA 2XU8A 2PQWA 4ZGJB 1H8KA 1NLPC 1N8RU 4BE1A 2OTJQ 2EKHA 1WQ7A 2K57A 5LJ5j 5IH2A 1X69A 1CKBA 3M55A 3PE0A 1SSHA 3OSSC 2PU9B 4PLIA 3QWYA 3OS1A 4Z89A 3I55T 4M77C 4UC4A 2CDTA 1VQ6A 1BI2A 1E6GA 1WHKA 1N27A 1WYXA 1M90C 4GBQA 1VQMA 1VQNQ 2DFUA 3X24B 1VQ8Q 1NYFA 2OTLQ 5LJ5f 1F1BB 3QXEB 3L2UA 3OB9A 3QDFA 3SD4A 2CKKA 4OGEA 4QQGA 4XU3A 3VRZA 1VUBA 1K0SA 1W6XA 1WHGA 2DXCA 3OYYA 2M16A 4OF1A 4A54A 2DXTA 5KYXA 2K9GA 3CD6A 5A0GA 2E6NA 2DIQA 2LTOA 2QQ9A 2BZXA 1QQJA 3JB9D 1Y96A 4ANJA 2LQWA 3SHWA 1M1GA 1WX6A 4J6YA 1KC8R 2RHUA 2XDBA 3RIRA 2R58A 4R56A 1I8FA 1EFNA 5CVIA 1V29B 1MHNA 1GFCA 1VQ5Q 4JZ3A 1QKXA 4DBHA 1M9SA 1TUDA 1ZA1B 4C8QG 5KE2A 2KAFA 4AFSC 1HJDA 3QKJA 4RKUE 2V8IA 3JRZA 1OYXA 1WHJA 2JJ9A 3QIIA 3QPHA 1YFNA 4MZPA 2L5QA 3THKA 5KYYA 1JEGA 7AT1B 4RTZA 2Y4XA 3L2QA 1ZBJA 3CMAA 1TXQA 2CS7A 5LJ3h 4BB7A 4JRIA 2QEXT 4LD9K 3M4GA 3M0TA 2OX7A 4IUQA 2GQVA 1TU0B 4QKUA 1H641 4J6XA 4M7AG 1D1CA 1HD3A 5A0LA 4PJOF 4EMKC 3BFMA 4HVVA 4C0ZA 3EHQA 3CCRQ 2LP5A 5GMKj 1V76A 2NLUA 3OYEA 1ACMB 1VQ9Q 2QG9B 4E7KA 3CCMT 2C06A 3CC7A 5FRMA 3C12A 4JRKA 2X4JA 4A4HA 1MV3A 1OOTA 1RLQC 4M78G 3QDRB 3UDCA 3M56A 3E1SA 2LJ1A 3CC2T 2RJDA 2LNVA 1M30A 2HSPA 1MGQA 5D6XA 2LC4A 2ATCB 5FW9A 1KC8C 3HSBA 2DBKA 1QCFA 1FX7A 1C1AA 3E9FA 4PJNA 4DBRA 3EGXA 4XTXA 2QA4T 1A0NB 5FWCA 1NYGA 3OBYA 1M90U 3UA6A 4ZTJA 4X9DA 1LJOA 3D7SB 3LGFA 1W70A 2EGEA 1OV3A 2RI3A 2W10A 1VQLQ 1VQKT 1OULA 2ZGWA 1AZGB 3CCJA 4C92D 1YJWA 3PT9A 1D0ZA 1O9SA 4J7FA 3PTAA 4C92E 3LYIA 4B6MA 4HT8A 3NPFA 2BUDA 4E7IA 4RTTA 3LWHA 5GAMj 2I0NA 3MEUA 4IUVA 4EPCA 2EQKA 2VVKA 1RAIB 5LJ3e 5HKCA 1Q95G 1S1NA 3JSCA 1BB9A 4FYYB 1MUZA 1M1FA 2YLBA 2RQVA 1VQ4T 2Y4YA 2JW4A 2PVGB 3CCUQ 2FB7A 4E7LA 2DVJA 4AG2C 3TSZA 1O75A 5GAMf 5CKDA 3L42A 2KYMA 3ULRB 4BY6B 3CXCA 3GOXA 2DM1A 2DZCA 2IIMA 3CCET 2JTMA 3SDZA 2A7YA 4KBMB 1Y71A 4PFZA 2M0OA 2D6FA 3CEYA 1X2QA 5A2QE 4PJOD 2ZPEB 2I2LA 2MWPA 3NFCA 4B9XA 3MKDA 2BZ8A 4PJOE 5GANj 3I56A 2YXYA 5CKBA 3JCMh 3CCST 2F5KA 4JJDA 2DYIA 2KBTA 3G71Q 3A8HB 5KH6A 3H8ZA 4OB2B 3CCVT 5IHKA 1M27C 1BIAA 2JS2A 1IGQA 2E10A 2QASA 2P4RA 3QJ6A 1M4ZA 4DOVA 2K4YA 3JV3A 1QP3A 4EDUA 5GMKl 3J81E 4ZTFA 1AHJB 1T0HA 2RMOA 3H0HA 4ZGEB 1S72T 4KGZB 4MMKA 5L8RE 5GANf 1Z9QA 3I35A 4Z02A 4FSXA 3REAB 4WCIA 3CCJQ 2O31A 1AWXA 4A53A 2DL4A 2B8AA 2A28A 4KRTA 4KUIA 2FVUA 3OA6A 3G6EQ 2C0TA 1QVPA 4F7UA 1I1JA 3VS7A 2XIDA 2FZKB 2EJGA 3RDVA 1KC8U 2E3IA 3DLLA 4OMOA 2A3LA 1X6BA 1NE8A 1M8MA 1BI0A 2DTHA 4D8KA 3KBGA 3PVQA 1B34A 2QQBA 1SRMA 2LQ8A 1KFZA 2QQRA 2DEUA 4XTZA 3KUFA 4PJLA 2K7AA 2E64A 2QA4Q 2RHIA 2JZ2A 4RTYA 5KYNA 1YJ9T 3VRYA 3EGDA 1Q81R 2P84A 2O9SA 1GCQA 3V7SA 5KCHA 1XQHA 3JCMQ 1PSEA 4GLKA 3OYMA 2RN8A 4Z88A 3M4YA 4ESRA 3PFSA 3EG1A 1PKTA 1VQ7Q 4WF2A 1RAAB 4BI8B 2IVWA 4BY6C 2M1HA 1YI2A 1ZA2B 4PJOB 5CKHA 2XDPA 1ZLMA 4A4GA 3JCMe 3VYHB 3EAEA 1QWFA 4OB3B 2OTLT 2J6KA 5J26A 1E6HA 3QHSA 3V7CA 3M0PA 2RQWA 2DF6A 1G3TA 1KHIA 2HBWA 4RUGA 2ZAEA 2DXUA 2HNIA 3EFOA 2EVRA 1G8XA 4RMOA 2D0QB 5GJVB 5FU7B 3L2VA 1D3BB 2FO0A 1OPLA 2MIOA 6AT1B 4J9CA 1NPPA 2MAMA 2O4XA 1OU9A 1PD1A 1TG0A 1PKSA 3UT1A 4QVCA 2ENMA 4JS5A 2LX9A 1G2BA 1FYNA 4PJMA 4BUGA 1RI0A 2GCXA 1KQ2A 4ZN1A 5M9OA 4XTYA 1C6VX 4OMPA 3G4SQ 2JVVA 1VQ5T 2V8KA 2B86A 2KVQG 4RTVA 1UGQB 4II1A 1YHQA 2ED0A 2E70A 1N5ZA 3GP8A 4L5GA 3EG9A 3BW1A 2AZVA 2EPDA 1QLYA 2LQKA 1QCOA 3Q1JA 3M0QA 2RI5A 2JTEA 3HFOA 3JB9F 2JUFA 4A4EA 2M51A 5D6WA 3C4SA 1Q81C 1Y96B 2VKNA 3LH5A 2EYXA 4M75A 1LCKA 2K6DA 3LW5E 1RL2A 3FB9A 3JB9G 2HKQB 3FJ5A 2VXEA 2EYWA 2O9VA 2VGMA 2KT8A 4J6WA 5CQXA 2VWFA 4XU1A 1H3ZA 5GANg 2CT4A 1PCXA 4M7DA 2C0OA 2CH4A 1UGVA 2D8HA 1YI2Q 1QVFP 4E7JA 4JJBA 3OYNA 4AG1C 1UG1A 1VQ6T 1PRLC 2C0IA 2LZ6B 3VS1A 4OMQA 1M3CA 2XICA 1J3TA 4MZMA 1WLPB 2RJFA 3OY9A 1M2VB 2DILA 2GNCA 2CUDA 5KYYB 2R57A 4JLIA 1NPRA 4FW1A 2KY9A 2XKOC 2M0YA 4C5EA 1GL5A 1N6AA 1WXBA 1BI3A 5D7UA 1JBMA 1JXOA 2KT1A 2YHTA 4IKFA 4PJOC 4Q5WA 2K79A 2F1LA 3LH0A 1GFDA 2X51A 2RHXA 2QTXA 1VQPA 1GXIE 1YP5A 3SWNC 1JO8A 2CP3A 2CZ0B 2PZ1A 4OB0B 1EIFA 1YCSB 3EG3A 4OVAA 2GTOA 5I11A 4EMKB 2EKOA 3QBYA 1Q86C 3DB3A 4J9FA 2CP2A 5J39A 2DTIA 4XU0A 5FU7C 4FL6A 3M54A 3A8MB 1D09B 4N4IA 5LL6S 3FRNA 5IAYA 3TU4K 1YHQQ 2KRSA
chains in the Genus database with same CATH topology
1VQLT 2DD5A 4PLLA 3CCMT 4E7KA 5D6YA 2C06A 2VXFA 3CC7A 1YIJT 5FRMA 1Q7YC 3C12A 4JRKA 2X4JA 3OYDA 2RH2A 3TREA 2R5MA 4A4HA 1YITA 3M59A 2PUKB 4RCCA 3OS5A 2DXBA 5GAN4 2GF7A 1UGPB 3QDRB 4M78G 3UDCA 1W2BS 3M56A 3HRTA 4M78E 3E1SA 3RKWA 1YJ9A 1XTDA 3P8BB 3ZFJA 3CC2T 2RJDA 2LNVA 3M9QA 3FDRA 5D6XA 1MGQA 2LC4A 2QXFA 4M77A 3SFMA 2XDDA 2RB6A 3S3NA 4C92C 1R8OB 3CPWA 4BACA 1KC8C 2EIFA 3HSBA 2XK0A 3MCAB 2OTJA 2PVDB 5GAMe 1FX7A 4ELZC 3E9FA 2E12A 3CMAT 3CCLT 3WVDB 3PIOA 3OYIA 4XTXA 1QP2A 3CMET 2QA4T 4CI0C 3OBWA 5DLOA 2RM4A 3CBPA 5GAOl 5GAN3 1WNLA 3OBYA 1M90U 4M75B 1VQPT 4ZTJA 4X9DA 2LT4A 1LJOA 3TEEA 3LGFA 1OI1A 4QVZA 5A0DA 2RI3A 3CCUT 4N0AA 4J83A 3CCQT 1VQNA 4C92F 4RG8A 4C8QB 4C8QA 1VQKT 1YJNA 2ZGWA 3G4SA 1K8AU 1VQ8A 3PIPA 3L2ZA 2GFAA 5C6SA 2AHJB 4X34A 4D6WA 3CCJA 2OTLA 3V7RA 4C92D 1YJWA 3PT9A 3OYLA 1N9RA 2H3JA 1IZ6A 2IG0A 1O9SA 2K2VA 4HA8A 4F7UF 4J7FA 3OS0A 5CIUA 4M7DB 4C92G 3PTAA 4J8OA 4IUPA 2DK3A 3MEWA 5HY6A 4C92E 1U1SA 3CCSA 4JUVA 2FHDA 3LYIA 4E47A 3BY7A 4HCZA 4HT8A 4NL3A 5CO7A 4PKCC 2BUDA 3CXCS 3HL8A 4QQ6A 4JLGA 5FRNA 2DD4A 4IURA 4E7IA 4F7UG 3LWHA 1Q81U 5GAMj 3MEUA 4IUVA 4JDSA 4F7UE 5FROA 4EPCA 2K3YA 2DZ9A 4YTLA 1BYMA 3FLGA 2EQKA 3A5ZB 1YITT 5LJ3e 1VQMT 2DAQA 5HKCA 3JB9H 5GMKe 3JSCA 1HXDA 3META 4ZN3A 2MMPA 5CQYA 5CR2A 4C0GA 2EJFA 3E9GA 2QI2A 3HFNA 1UB4A 3H6ZA 3JCMg 4XTWA 4M7DF 1M1FA 5CKFA 2YLBA 5GANe 2VYTA 2P0PA 3DKMA 1VQ4T 3G71T 4LDXA 4MDXA 5GMKm 2Y4YA 3DLMA 4M7AB 3AHUA 1WJSA 2PVGB 1KHCA 2FB7A 3NTKA 1K9MU 4M7AA 4E7LA 2OTJT 1QVFA 1YCYA 5HK3A 1Y7XA 1O75A 5GAMf 1WGSA 3MO8A 1VQ5A 5KCOA 5DLQE 5CKDA 3L42A 3X25B 3CBMA 4BY6B 3GNFB 3CXCA 2VC8A 3ASKA 4BI4A 4ZGDB 2JTFA 2L3RA 3CD6T 1N8RC 2XHCA 3OYHA 5FLXE 3GOXA 2RK1A 2P4TA 4LDYA 5CAIA 2DZCA 4BE2A 3CCET 2JTMA 4V2SA 2XI9A 3SDZA 4L59A 5LJ5h 2KDSA 2A7YA 4KBMB 4QVDA 3PGGA 1VQNT 1Y71A 2X4WA 3RKYA 3RMSA 4JJNK 1YJNT 2M0OA 3CPWS 2WSEE 4J5YA 2JN0A 1G3WA 2KSSA 3CEYA 2ZPFB 3CPFA 4C5HA 4XU2A 5LJ3j 5GAN5 5A2QE 3OYCA 3CCJT 4PJOD 2ZPEB 4EMGA 2I2LA 2MWPA 3NFCA 4M78B 4M78A 3OYGA 3M53A 4OP0A 4PJOG 3JCMV 3C94A 4B9XA 2ZPBB 3LGLA 3LWIA 3MP6A 1NJIU 4HCBA 4PJOE 5GANj 3I56A 2K5LA 5CKBA 3JCMh 3G6ET 3CCST 2F5KA 4C0DB 2MF2A 5GAN7 3A8HB 5KH6A 1NZ9A 2RD1A 3H8ZA 3PNWC 3QZ9B 2BKDN 4OB2B 1DJ7B 3CCVT 2E6ZA 1HK9A 5FU6B 1QVGA 1BIAA 3CC4A 2E10A 3OYAA 3QJ6A 1M4ZA 1ZBXA 4QW2A 2K4YA 4DOVA 1PSFA 2LCLA 1QP3A 1D3BA 4EDUA 5GMKl 1BKBA 1Q86U 3J81E 1JRIA 2MI6A 2PUOB 5LJ3f 3SB2A 4XTVA 4ZTFA 1AHJB 2EFIA 1KD1U 4M77B 4ZGEB 1VQ8T 2X4YA 1S72T 4MMKA 3GLXA 5L8RE 1Q82C 2R5AA 3RKXA 3URGA 2HD0A 5GANf 3JCMb 1VQOA 3CCRA 4OB1B 1M1KC 3X26B 4Z02A 4FSXA 4KUDK 2BIVA 1X6OA 1UGSB 2LT1A 2CZ6B 2OAUA 2ZZDA 2ZCFB 1BI1A 3GF5A 3M57A 5DM7R 1Q7YU 1VQ9A 3GPLA 2GFUA 4A53A 2PVOB 1K73C 4FU6A 2B8AA 4P5NA 3QUIA 2DTOA 4C92A 1XOVA 3FEOA 4KUIA 1OZ3A 2FVUA 4M75C 3OA6A 4L6V5 3T9NA 3PMTA 2MWOA 3OYBA 1WPYA 2L89A 2ZPHB 4RG2A 4LDWA 4M77F 5C0MA 4N0AC 2QEXA 1QVPA 4PL6A 4F7UA 4C8QC 5GAMd 2EJ9A 2XIDA 1X01A 3JB9I 4X9CA 5EG2A 3L1AA 2EJGA 2M9UA 1KC8U 4C0FA 4JS4A 3FIFA 3N5BB 4BD3A 1VQ7T 3DLLA 2A3LA 1QVFS 1NE8A 3J80E 4M7DC 4OGCA 4XK8E 3VJPA 1BI0A 2DTHA 3RMQA 3KBGA 4A4FA 5LJ5g 1SSFA 5I21A 1B34A 2QQBA 2LCCA 4M75F 4CRIA 2HBPA 2LQ8A 3INZA 1KG1A 2HQEA 4XQ3A 5GMKi 3QG1A 2QQRA 5J3BA 3CC7T 3P8HA 5GAN6 3VUZA 4C5GA 4M75D 4XTZA 1UEBA 2LDMA 3KUFA 4C8QF 1KQ1A 1JJ2S 4HCCA 3OMGA 1WJRA 4M75G 2E64A 3CC4T 2RJEA 2DJZA 2RHIA 4M75E 2JZ2A 4C8QD 3R6OA 5GAN2 3OYFA 1U8RA 1YJ9T 2KMTA 2DIGA 4FIBA 4LDUA 4E7HA 3I55A 5CKEA 1VQLA 3CCMA 3MP1A 2DPPB 3V7SA 5GAOp 2EQUA 2V8JA 5KCHA 2E1HA 3CBOA 5GAN8 1G5VA 1XQHA 4IUTA 3JB9F 2KK4A 3JCMQ 3HKSA 2K5FA 3HPWA 3PMIA 5IN1A 4XTUA 2DO3A 4M7DD 3OQ5A 2RK2A 2P0QA 4NOYA 4LDVA 1PSEA 1IREB 1VIFA 4GLKA 1U1TA 3OYMA 3UPUA 4M7AC 2CYZB 3CCRT 4NS5A 5LJ5e 1VQOT 1M8VA 3M4YA 4M7DG 3KXTA 3M5AA 1N9SA 4M7DE 3CC2A 3PFSA 3UWNA 1I81A 4EMHA 5DY9A 4WF2A 5LJ3d 3JCMP 2LVMA 4HT9A 3TCJA 1QVGS 3V8LA 2IVWA 4BI8B 2DVEA 2M1HA 4BY6C 1VQ9T 1YI2A 1LOJA 3VYGA 2RO0A 1UGRB 4JRQA 4PJOB 4PJOA 3QZ5B 4QQDA 3J7AF 2DKGA 2WSFE 3JCMJ 5GANd 5CKHA 4KT0E 4BI3A 4BDZA 1G3YA 2F69A 2XDPA 3QYHB 4N4GA 4MDWA 4FT2A 4A4GA 1YBYA 1JJ2A 3CCLA 1OZ2A 3BDUA 3DB4A 3JCMe 3VYHB 3QSUA 3F70A 3EAEA 4O5VA 1X75C 2RI2A 3HP9A 4OB3B 5AYFA 3G4ST 4BDYA 4M7AF 1M5Q1 3M58A 1BIBA 3SWNA 2OTLT 5J26A 3A8LB 1YJWT 3RESA 4JRPA 3FJPA 4M7AD 3VV0A 3JAME 3QHSA 4ME7A 3MEAA 2XD0A 2VUBA 3V7CA 5CK9A 4M78C 3CCUA 3LLRA 3L2RA 1G3TA 2XU8A 2PQWA 3QO3A 1KHIA 4PNOA 1VQKA 5GAOm 4EMKA 3ZEHA 2DXUA 2HNIA 4ZGJB 5GAOq 3OS2A 4C0DC 1N8RU 2D9TA 1I4K1 4RMOA 4BE1A 1WQ7A 2D0QB 2K57A 5LJ5j 5FU7B 2K3XA 3HHTB 5FU6C 3L2VA 1D3BB 3M55A 4LD6A 3OSSC 1NPPA 2MAMA 2O4XA 4QVCA 3OW2A 2PU9B 3UT1A 4DQ2A 3X28B 4PLIA 4JS5A 2LX9A 2ZPIB 3OS1A 2E65A 3MP8A 2RHZA 4M78F 3I55T 2JNGA 2X4XA 4M77C 4UC4A 4B9WA 2K5IA 4C5IA 1VQ6A 1BI2A 4BUGA 2QDYB 3E19A 1RI0A 2GCXA 3A8OB 1N27A 4M78D 1KQSA 1KQ2A 4ZN1A 5M9OA 1M90C 1VQMA 4XTYA 3JB9J 3GIBA 3A8GB 3MHXA 2HAXA 2E41A 2JVVA 3X24B 1VQ5T 2V8KA 2KVQG 4RCBA 3X20B 5LJ5f 3QXEB 1UGQB 1ZHIA 2EQJA 4II1A 4VUBA 3L2UA 1YHQA 2YRVA 4C92B 3FC3A 1K8AC 1VQ4A 1TH7A 3OB9A 3S6WA 3G71A 2E70A 3SD4A 3OYKA 3GP8A 2RHYA 2O01E 2CGHA 3MEVA 1Y07A 2CKKA 2DEQA 2L8DA 2Y90A 3BW1A 4L5GA 1YI2T 4GY5A 4OGEA 4QQGA 4XU3A 4R55A 2LQKA 3HRSA 5IT9E 1VUBA 3Q1JA 4F7UB 3GNGA 3JCMW 1JB0E 2DXCA 2RI5A 2M16A 3OYYA 4FT4A 3HFOA 4IUUA 4OF1A 4HKEA 4A54A 2P0KA 2JOYA 2WSCE 5HK0A 1Q82U 2JUFA 2XG8D 4M77D 2DXTA 3JCMf 4A4EA 3CD6A 5A0GA 3BDLA 5D6WA 2E6NA 3C4SA 2DIQA 3NTHA 1Q81C 1M1KU 2LTOA 2QQ9A 4ATOA 4M77G 1Y96B 5I2MA 4DA4A 1Y96A 3JB9D 2VV5A 4M75A 4M77E 3WVEB 2ZPGB 5GAMh 5GAOr 3CCEA 3LW5E 3HRUA 3L2WA 1RL2A 3FB9A 3JB9G 1B34B 1M1GA 5LJ3g 4J6YA 3I56T 2VXEA 1K73U 1G3SA 1W2BA 2RHUA 2EWNA 2XDBA 2VGMA 3RIRA 3WXMB 2R58A 5CCAA 2WACA 1I8FA 4R56A 4J6WA 5CQXA 5CVIA 4XU1A 1H3ZA 5GANg 1V29B 1MHNA 4M7DA 1XNIA 3OSVA 3ER0A 1K9MC 2CZ7B 1M9SA 2RA2A 2EAYA 3G6EA 2E5QA 4Y28E 4Y91A 4C8QG 5KE2A 1YIJA 2YLCA 1P92A 2KAFA 4C8QE 4E7JA 3CCVA 3S3MA 3OYNA 3VU3C 3S3OA 1I5LA 3QKJA 2CZ1B 4RKUE 5I2SA 2V8IA 3JRZA 1OYXA 4KULA 1VQ6T 3OMCA 2QQSA 3OYJA 2XICA 2FL7A 4MZMA 3RUXA 2RJFA 3OY9A 3QIIA 3QPHA 2KQWA 4MZPA 2FYKA 2L5QA 2R57A 4MZTA 4JLIA 3QJYA 2X35A 3V8JA 1NPRA 1S72A 2KY9A 2EQMA 2XKOC 3C95A 4XAXB 1YHQT 4C5EA 1FXXA 1N6AA 2Y4XA 3L2QA 1BI3A 2D6FA 1JBMA 3JCMX 4A4KA 2YHTA 5GAOn 4IKFA 3LX7A 2HQXA 3CMAA 4PJOC 4Q5WA 3OW2S 4NL2A 2CS7A 5LJ3h 3G7ZA 4BB7A 4OMFB 3EFSA 5GMKh 4JRIA 3CMEA 4O6JA 1NJIC 2QEXT 2QA4A 1FWZA 3LH0A 4LD9K 3RERA 3V8KA 4BE0A 3SWNB 2RHXA 2VGNA 3M4GA 2QTXA 5LJ5d 1VQPA 1GXIE 5GANh 1KQSS 1VIEA 3SWNC 3VUBA 1ZQ1A 2CZ0B 4IUQA 4J7IA 2GQVA 3VKIA 4FM4B 1EIFA 1WJQA 1H641 4MMLA 4OB0B 3CCQA 3QYGB 4J6XA 4OVAA 4N4HA 4M7AG 4M7AE 3NTIA 4EMKB 2EKOA 3QBYA 3ME9A 5A0LA 3ZBDA 4PJOF 1Q86C 4EMKC 3JCMc 3DB3A 3O8VA 4TVRA 3BFMA 1QW1A 2QQAA 4C0ZA 4ELYC 1KD1C 1VQ7A 3EFRA 5KE3A 3JCMd 2LRQA 3P8DA 5J39A 5GMKj 2DTIA 2G3RA 2F5TX 4XU0A 5FU7C 5GAMg 4FL6A 4DOWA 2RJCA 3M54A 2EYQA 2O4XB 1W4SA 3A8MB 4N4IA 5LL6S 2NLUA 3OYEA 3FRNA 5IAYA 3TU4K 1LNXA 1WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI5 A;  2M16 A;  1WJR A;  3OMG A;  4PLL A;  5D6Y A;  3OYH A;  2RJE A;  4IUU A;  3GOX A;  5FRM A;  2P0K A;  2RHI A;  3OYF A;  2JZ2 A;  3OYD A;  4BE2 A;  4A4E A;  2DIG A;  2R5M A;  4A4H A;  4E7H A;  3BDL A;  5D6W A;  2E6N A;  3C4S A;  2DIQ A;  3NTH A;  4L59 A;  2LTO A;  3MP1 A;  2EQU A;  5KCH A;  2GF7 A;  2X4W A;  1G5V A;  4IUT A;  2M0O A;  3PMI A;  5IN1 A;  3CEY A;  4C5H A;  3L2W A;  3OQ5 A;  3OYC A;  2RJD A;  3M9Q A;  3FDR A;  5D6X A;  3OYM A;  4NS5 A;  2MWP A;  2RHU A;  3S3N A;  3OYG A;  2R58 A;  4BAC A;  4B9X A;  2WAC A;  3PFS A;  3UWN A;  2XK0 A;  3LGL A;  3MP6 A;  1H3Z A;  2LVM A;  3E9F A;  2F5K A;  2M1H A;  1MHN A;  1XNI A;  2RO0 A;  3OYI A;  5KH6 A;  3H8Z A;  3PNW C;  4QQD A;  2BKD N;  2E5Q A;  4BDZ A;  2XDP A;  4N4G A;  4A4G A;  5KE2 A;  3OYA A;  1OZ2 A;  3DB4 A;  3QJ6 A;  4ZTJ A;  3F70 A;  3EAE A;  4QW2 A;  4E7J A;  3LGF A;  3S3M A;  4EDU A;  2RI2 A;  3OYN A;  4BDY A;  1OI1 A;  3QKJ A;  4QVZ A;  3S3O A;  4E7K A;  1OYX A;  2RI3 A;  4ZTF A;  3OMC A;  2QQS A;  2EFI A;  5J26 A;  3OYJ A;  2X4Y A;  2RJF A;  3OY9 A;  3MEA A;  3QII A;  5C6S A;  2GFA A;  2R5A A;  4X34 A;  3LLR A;  3L2R A;  2PQW A;  2R57 A;  3OYL A;  2X35 A;  2IG0 A;  3OS0 A;  3OS2 A;  3ZEH A;  4Z02 A;  2EQM A;  5CIU A;  2BIV A;  4IUP A;  4C5E A;  3MEW A;  3L2Q A;  2D9T A;  4BE1 A;  4IKF A;  2FHD A;  3LX7 A;  2HQX A;  3LYI A;  4Q5W A;  4HCZ A;  2GFU A;  2K3X A;  4FU6 A;  2B8A A;  2BUD A;  5FRN A;  4QQ6 A;  4IUR A;  4E7I A;  3L2V A;  3FEO A;  3LH0 A;  3MEU A;  4IUV A;  4LD6 A;  1OZ3 A;  5FRO A;  3OA6 A;  4BE0 A;  2K3Y A;  2RHX A;  3PMT A;  2O4X A;  2MWO A;  3FLG A;  3UT1 A;  3OYB A;  2EQK A;  2L89 A;  4PLI A;  4RG2 A;  3OS1 A;  5C0M A;  3MP8 A;  2RHZ A;  4PL6 A;  2DAQ A;  2X4X A;  4IUQ A;  4UC4 A;  4B9W A;  3MET A;  4C5I A;  1WJQ A;  4OVA A;  3E9G A;  4N4H A;  1RI0 A;  1N27 A;  3H6Z A;  3NTI A;  4BD3 A;  5M9O A;  2EKO A;  3QBY A;  3ME9 A;  2VYT A;  3DB3 A;  3O8V A;  3DLM A;  1WJS A;  1KHC A;  3NTK A;  5KE3 A;  4II1 A;  4A4F A;  2EQJ A;  1SSF A;  3L2U A;  4E7L A;  2LRQ A;  2YRV A;  3P8D A;  5J39 A;  2LCC A;  3FC3 A;  2G3R A;  4CRI A;  3OB9 A;  1WGS A;  3MO8 A;  3S6W A;  3SD4 A;  3OYK A;  2HQE A;  2RHY A;  3MEV A;  5KCO A;  2L8D A;  2CKK A;  4FL6 A;  2RJC A;  2O4X B;  2QQR A;  3L42 A;  3P8H A;  4GY5 A;  4N4I A;  4C5G A;  2NLU A;  4QQG A;  3OYE A;  3ASK A;  2LDM A;  3KUF A;  5IAY A;  2JTF A;  2L3R A;  3Q1J A; 
#chains in the Genus database with same CATH topology
 1VQL T;  2KRN A;  5AT1 B;  4F17 A;  2RH2 A;  2R5M A;  2DXB A;  1RAD B;  4FW2 A;  1UGP B;  2HL5 C;  1XTD A;  2KXD A;  3P8B B;  4CC3 A;  1T0J A;  4M77 A;  2EIF A;  1Z9Z A;  3MCA B;  1WHL A;  2PVD B;  1ZX6 A;  3QWX X;  1UEC A;  3CMA T;  2X9H A;  3WVD B;  1H92 A;  4CI0 C;  1VYV A;  2RM4 A;  5GAO l;  1TTH B;  2VB6 A;  1M3B A;  1WNL A;  4HXJ A;  1W2B P;  3CCU T;  1RAE B;  2LQN A;  4N0A A;  4C92 F;  1YJN A;  3RNJ A;  3L2Z A;  1PHT A;  2AHJ B;  2H3J A;  2V1Q A;  4C92 G;  2RF0 A;  2DK3 A;  5HY6 A;  4M4Z A;  1U1S A;  2FHD A;  4E47 A;  4NL3 A;  5CO7 A;  3CQT A;  2K2M A;  2KEA A;  2DD4 A;  4IUR A;  1Q81 U;  4JDS A;  4F7U E;  2MCN A;  5FRO A;  2K3Y A;  4YTL A;  1WHH A;  3FLG A;  3CCL Q;  2DL8 A;  1HXD A;  3MET A;  3NGP A;  2COZ A;  4C0G A;  5CR2 A;  2QK0 A;  2QI2 A;  1UB4 A;  1M2O A;  3C0C A;  1NM7 A;  5KYW A;  4M7D F;  2VYT A;  4QT7 A;  4LDX A;  3G71 T;  2KXC A;  3AHU A;  1CSK A;  3E2U A;  3NTK A;  1QVF A;  1WGS A;  1WHM A;  4LXC A;  1IB8 A;  3CBM A;  2DYB A;  2VC8 A;  4LN2 A;  4BI4 A;  4ZGD B;  2JTF A;  2L3R A;  2XMF A;  2RK1 A;  2P4T A;  5CAI A;  3EH1 A;  4BE2 A;  2F2X A;  5LJ5 h;  1ARK A;  2KDS A;  1NEB A;  3RKY A;  3RMS A;  1VQ6 Q;  1XJW B;  1AT1 B;  2WSE E;  4J5Y A;  2AIR B;  2KSS A;  4C5H A;  3OYC A;  3CCJ T;  1VA7 A;  1GCP A;  2DET A;  1VQM Q;  4RTW A;  2D8J A;  4V2S A;  4PJO G;  3JCM V;  3C94 A;  1PC0 A;  2GGR A;  3I5R A;  1NBE B;  3G6E T;  2RQR A;  4R0K A;  2MF2 A;  5GAN 7;  4J9B A;  4AT1 B;  4E7Z A;  3EHR A;  1MMA A;  5FU6 B;  2JM8 A;  3CC4 A;  1GBR A;  1ZBX A;  1SPK A;  1PSF A;  2DL3 A;  1Q86 U;  1JRI A;  2PUO B;  3SB2 A;  2EFI A;  3CD6 Q;  1WA7 A;  2PNI A;  2J6O A;  3GLX A;  1IO6 A;  2HD0 A;  4PFP A;  2YUO A;  1VQO A;  1UHC A;  1HSQ A;  2E4H A;  2DLP A;  2L3Q A;  3X26 B;  4KUD K;  1YJN Q;  2ABL A;  2EQI A;  2ZZD A;  2COY A;  2O88 A;  2QGF B;  1PD0 A;  2PVO B;  4HVW A;  3QUI A;  1W1F A;  3FEO A;  1UDL A;  2K3B A;  4L6V 5;  3T9N A;  3OYB A;  1WPY A;  1BBZ A;  2L89 A;  2ZPH B;  4LDW A;  4M77 F;  2QEX A;  3IQL A;  4ORZ A;  3JB9 I;  3L1A A;  2CP7 A;  2M9U A;  2MPX C;  1VQ7 T;  1UJY A;  1QVF S;  2CSQ A;  3J80 E;  2ED1 A;  3MPU B;  2EYZ A;  2YWW A;  5LJ5 g;  1SSF A;  5I21 A;  1K8A R;  4CRI A;  3INZ A;  2HQE A;  1IXD A;  4C5G A;  4M75 D;  3CMA Q;  1LVK A;  2L0A A;  2ROT A;  2NYS A;  2GQI A;  2DJZ A;  2RJE A;  1I0C A;  4M75 E;  4C8Q D;  2LJ3 A;  5KYU A;  3CCM A;  5GAO p;  5IHI A;  4OMN A;  5GAN 8;  4IUT A;  1YN8 A;  3HPW A;  2K5F A;  4JJC A;  2DO3 A;  4M7D D;  3OQ5 A;  4AMC A;  3UPU A;  1U1T A;  2SRC A;  5LJ5 e;  1M8V A;  4M7D E;  3CC2 A;  1CKA A;  2KR3 A;  5LJ3 d;  2LVM A;  4HT9 A;  3TCJ A;  1YWP A;  2YSQ A;  1K9M R;  1UGR B;  3QZ5 B;  4QQD A;  2WSF E;  4KT0 E;  4BI3 A;  4BDZ A;  2F69 A;  4N4G A;  2RPN A;  1YBY A;  3BDU A;  2DRM A;  1X75 C;  1Y57 A;  1WXU A;  5AYF A;  3G4S T;  4BDY A;  3CC7 Q;  1V1C A;  3RR6 A;  1UJ0 A;  4JRP A;  4M7A D;  3MEA A;  2XD0 A;  2VUB A;  5CK9 A;  2YUN A;  3LLR A;  2D0N A;  1VQK A;  4PNO A;  3ZEH A;  3EFO B;  8ATC B;  4J9E A;  2K3X A;  3HHT B;  5FU6 C;  4PK4 A;  1I5O B;  2HSE B;  3CPW P;  1E7O A;  1OEB A;  2ZPI B;  2O2O A;  2JNG A;  2X4X A;  2K5I A;  2ESW A;  3R6N A;  3A8O B;  4M78 D;  3RER A;  1R0B G;  3MHX A;  1MMD A;  2HAX A;  2E41 A;  1KD1 R;  4RCB A;  1YJW Q;  1AD5 A;  2EQJ A;  4C92 B;  1K8A C;  1VQ4 A;  3S6W A;  3PVL A;  3OYK A;  3EG9 B;  3MEV A;  2CGH A;  2Y90 A;  1YI2 T;  3O5Z A;  2L2P A;  2HZY A;  4R55 A;  3HRS A;  3GNG A;  3JCM W;  1JB0 E;  4D8D A;  1IHV A;  4IUU A;  4HKE A;  2WSC E;  2JOY A;  2DER A;  2J05 A;  5HK0 A;  1LPL A;  4M77 D;  3BDL A;  4ATO A;  5I2M A;  4M77 E;  3WVE B;  5GAM h;  2COW A;  3CCE A;  2KI7 A;  3I9Q A;  2KRM A;  4WTO B;  1G3S A;  2EWN A;  5CCA A;  2W0Z A;  4HCK A;  2YDL A;  4CC4 B;  2NUZ A;  5GJW B;  1XNI A;  3OSV A;  2FZC B;  1K9M C;  1K0X A;  2CZ7 B;  2RA2 A;  2E5Q A;  4Y28 E;  1TS9 A;  1YIJ A;  2YLC A;  2VAS A;  2CP6 A;  3CCV A;  1I5L A;  3S3O A;  2LJ0 A;  2HL3 A;  2NUP A;  2FL7 A;  3ZL7 C;  1AOJ A;  2FRY A;  2FYK A;  2HKN A;  2EBP A;  4MZT A;  3QJY A;  2X35 A;  3V8J A;  1S72 A;  1YHQ T;  1OPK A;  4XAX B;  1FXX A;  3REB B;  1JJ2 P;  3JCM X;  4A4K A;  5GAO n;  2HQX A;  3I56 Q;  2GBQ A;  3CME A;  4O6J A;  1ZUU A;  2V1R A;  1FWZ A;  1WDX A;  4BE0 A;  3SWN B;  5IHN A;  5GAN h;  3VUB A;  1X6G A;  3TVT A;  1WJQ A;  3CCQ A;  4MML A;  1KG1 A;  3QYG B;  4N4H A;  2EW3 A;  3ME9 A;  4FYV B;  1QVG P;  3O8V A;  2QQA A;  4ELY C;  1KD1 C;  3EFR A;  5KE3 A;  3JCM d;  2LRQ A;  3P8D A;  2F5T X;  1R77 A;  1KSW A;  5GAM g;  1TWB A;  1I07 A;  4DOW A;  4F04 B;  1IRX A;  1W4S A;  1K4U S;  1LNX A;  1WQW A;  2DNU A;  2D1X A;  4PLL A;  2VXF A;  3OYD A;  1OX9 A;  2CP0 A;  3TRE A;  1YIT A;  3M59 A;  2PUK B;  2DRK A;  1Q86 R;  3OS5 A;  5GAN 4;  2OAW A;  2GF7 A;  3H9N A;  3HRT A;  1YJ9 A;  2FPE A;  3M9Q A;  3FDR A;  2XDD A;  4C92 C;  3CPW A;  4BAC A;  2OTJ A;  4OML A;  3AT1 B;  2KRO A;  5GAM e;  4ELZ C;  1T3S A;  2QAZ A;  2E12 A;  3CCL T;  1QWE A;  5KYX B;  3A1P A;  5DLO A;  4LUD A;  2YT6 A;  1VQP T;  2LT4 A;  2OJ2 A;  1PRM C;  4QVZ A;  5A0D A;  4J83 A;  1VQN A;  2LNH B;  4RG8 A;  2KYB A;  4C8Q A;  2E5K A;  1YIJ Q;  1K8A U;  1VQ8 A;  2GFA A;  4X34 A;  4D6W A;  2OTL A;  1M1K R;  1N9R A;  4F7U F;  4HA8 A;  3OS0 A;  1ZSZ A;  2RQT A;  4IUP A;  1MNE A;  1FMK A;  4J9I A;  1ABQ A;  2H8H A;  4JUV A;  1K73 R;  3BY7 A;  4HCZ A;  4PKC C;  4QQ6 A;  4JLG A;  4F7U G;  2A36 A;  3M0U A;  1BYM A;  1VQM T;  2DAQ A;  3JB9 H;  3VS4 A;  1MND A;  3CME Q;  4ZN3 A;  2EJF A;  3E9G A;  2OI3 A;  3H6Z A;  5KYW B;  5GAN e;  3DKM A;  2DL7 A;  3DLM A;  4M7A A;  1WJS A;  3CCQ Q;  1K9M U;  1YCY A;  1Y7X A;  1VQ5 A;  3MO8 A;  5KCO A;  1X27 A;  1KIK A;  3X25 B;  3GNF B;  8AT1 B;  3ASK A;  3H0I A;  3CD6 T;  3U23 A;  4KH1 B;  2XHC A;  3OYH A;  5FLX E;  2DJQ A;  1B3Q A;  2HMA A;  3PGG A;  3UF4 A;  4CC7 A;  1YJN T;  3VS3 A;  3CPW S;  2PTK A;  5GAN 5;  5LJ3 j;  4XU2 A;  4E7S A;  4EMG A;  3OW2 P;  4M78 A;  1FMV A;  3LWI A;  2FRW A;  4JPB W;  2ZPB B;  3LGL A;  4HCB A;  4K11 A;  4X1V A;  2K5L A;  2QGG A;  2LMJ A;  4C0D B;  1KQS P;  2BKD N;  1U3O A;  1DJ7 B;  2E6Z A;  1HK9 A;  2CH4 W;  9ATC B;  1QVG A;  2GTJ A;  1RAC B;  4QW2 A;  2LCL A;  1D3B A;  2MI6 A;  5LJ3 f;  4XTV A;  1KD1 U;  1D0Y A;  2X4Y A;  2NUT A;  1Q82 C;  3RKX A;  3URG A;  3CCR A;  1M1K C;  2JM9 A;  2BIV A;  3EGX B;  2OAU A;  1BI1 A;  3M57 A;  3A98 A;  3SEM A;  1VQ9 A;  3GPL A;  4DBQ A;  1K73 C;  1G83 A;  4P5N A;  4DEX A;  1UTI A;  2V26 A;  2G6F X;  1SHG A;  1SHF A;  3H0F A;  2MWO A;  2HCK A;  1SG5 A;  2H3E B;  4N0A C;  5C0M A;  1K1Z A;  1WFW A;  3NHN A;  2EJ9 A;  1AWJ A;  3G1J A;  2CT3 A;  4JS4 A;  1RLP C;  3N5B B;  1UFF A;  1FMW A;  4IIO A;  4F14 A;  3VJP A;  1EZZ B;  4A4F A;  3EH2 A;  2MK5 A;  4M75 F;  2KE9 A;  2J6F A;  4XQ3 A;  2MOX A;  3QG1 A;  5J3B A;  5GMK i;  3CC7 T;  3P8H A;  1JXM A;  2LDM A;  4C8Q F;  1KQ1 A;  1JJ2 S;  4M75 G;  3CC4 T;  3OYF A;  3R6O A;  4FIB A;  2DIG A;  5KYU B;  1RUW A;  3I55 A;  1QCN A;  5CKE A;  1VQP Q;  1VQL A;  3CBO A;  4OMM A;  2KK4 A;  4XTU A;  2RK2 A;  2FPD A;  4NOY A;  1VIF A;  1VQO T;  2AK5 A;  3CXC P;  4M7D G;  1N9S A;  1M2V A;  3UA7 A;  5DY9 A;  3JCM P;  2KGT A;  1QVG S;  2DVE A;  2EYY A;  4AFQ C;  3J7A F;  2DKG A;  3TQ7 P;  3JCM J;  1K9A A;  4FT2 A;  2E3H A;  1OZ2 A;  1JQQ A;  5FWB A;  4M7A F;  1QMC A;  3HP9 A;  1HYO A;  3M58 A;  2F2V A;  1YJW T;  3RES A;  3FJP A;  3VV0 A;  2BE7 D;  4ME7 A;  3CCU A;  3L2R A;  2JS0 A;  3QO3 A;  4J9G A;  5GAO m;  2YRD A;  4EMK A;  5GAO q;  3OS2 A;  4IIM A;  4C0D C;  1C0M A;  1KJW A;  1VOM A;  2D9T A;  1I4K 1;  1NJI R;  1NLO C;  4LD6 A;  3OW2 A;  4DQ2 A;  3X28 B;  2AT1 B;  2E65 A;  2LX7 A;  3MP8 A;  2RHZ A;  2DX1 A;  4M78 F;  4B9W A;  1R0C B;  4C5I A;  1X2K A;  4DBF A;  1ZUY A;  4GLM A;  2QDY B;  3E19 A;  1OQK A;  2FPF A;  1KQS A;  3JB9 J;  3GIB A;  3A8G B;  2A37 A;  1TUG B;  1U06 A;  3X20 B;  1ZHI A;  4VUB A;  2YRV A;  3FC3 A;  1TH7 A;  3G71 A;  4J9H A;  3VS5 A;  2RHY A;  2AZS A;  2O01 E;  1Y07 A;  2DEQ A;  2L8D A;  3BE3 A;  4GY5 A;  1OU8 A;  1U5S A;  5IT9 E;  4F7U B;  1Q7Y R;  4FT4 A;  2AKL A;  1M3A A;  2P0K A;  1Q82 U;  2XG8 D;  3JCM f;  1D1B A;  4JZ4 A;  2BZY A;  3NTH A;  1M1K U;  4M77 G;  4DA4 A;  2J06 A;  2VV5 A;  2ZPG B;  5GAO r;  3HRU A;  3L2W A;  1B34 B;  3TSW A;  5LJ3 g;  2DMO A;  1H3H A;  3I55 Q;  3I56 T;  1K73 U;  1W2B A;  3WXM B;  2WAC A;  2QTV A;  1MMN A;  3ER0 A;  3EGD B;  2EAY A;  3G6E A;  2JMC A;  1AEY A;  4KGX B;  4Y91 A;  1YWO A;  1P92 A;  4C8Q E;  1Y0M A;  3S3M A;  3VU3 C;  2CZ1 B;  5I2S A;  1RAH B;  4KUL A;  2NUP B;  3OMC A;  2QQS A;  1GBQ A;  3OYJ A;  1QKW A;  3RUX A;  1SRL A;  2KQW A;  2RNA A;  1AWW A;  4PJJ A;  2EQM A;  3C95 A;  1B07 A;  2AKK A;  5ECA A;  2MYS A;  2DBM A;  4LNP A;  3LX7 A;  1PM3 A;  3OW2 S;  4KGV B;  4NL2 A;  3G7Z A;  2JXB A;  3EFS A;  4OMF B;  5GMK h;  5IXB A;  1NJI C;  2QA4 A;  3V8K A;  2QDL A;  2VGN A;  2F2W A;  2NWM A;  5LJ5 d;  4CC2 A;  1KQS S;  1VIE A;  4J9D A;  2YUP A;  3CC4 Q;  1PNJ A;  1GRI A;  1ZQ1 A;  4J7I A;  1KK7 A;  3VKI A;  4FM4 B;  4EIK A;  2L3P A;  4E2F B;  2SEM A;  1MMG A;  4Z8A A;  4M7A E;  3NTI A;  1RAB B;  2A0F B;  3ZBD A;  2HEQ A;  3I5S A;  3JCM c;  4TVR A;  4AFZ C;  1QW1 A;  1VQ7 A;  1ABO A;  1VQO Q;  1D0X A;  2G3R A;  1WZO A;  2HDA A;  2RJC A;  2EYQ A;  2O4X B;  1N8R R;  1RAG B;  1X43 A;  2DD5 A;  1IGU A;  5D6Y A;  1YIJ T;  1Q7Y C;  4E6R A;  1SF9 A;  4RCC A;  2QEX Q;  3UAT A;  4RTU A;  1W2B S;  2X3W D;  4M78 E;  2KNB B;  3RKW A;  4AFU C;  3ZFJ A;  2QXF A;  3SFM A;  2RB6 A;  3S3N A;  1R8O B;  2XK0 A;  2Z0W A;  4LUE A;  3VS6 A;  3PIO A;  2EGA A;  3OYI A;  1QP2 A;  3CME T;  3OBW A;  3CBP A;  5GAN 3;  4M75 B;  2IPO B;  3TEE A;  4A63 B;  1ZUK A;  3EGU A;  1OI1 A;  3EG2 A;  2JT4 A;  3CCQ T;  4C8Q B;  3CCM Q;  2DA9 A;  3G4S A;  3HTR A;  3PIP A;  5C6S A;  2CRE A;  3V7R A;  1BCM A;  3OYL A;  1EX4 A;  1IZ6 A;  2IG0 A;  2K2V A;  1ZSZ B;  4M7D B;  5CIU A;  4J8O A;  3MEW A;  3VS2 A;  3CC2 Q;  3CCS A;  3CXC S;  2QYZ A;  2HQH A;  3HL8 A;  5FRN A;  1GCQ C;  1B7T A;  1NEG A;  2DZ9 A;  1TSF A;  3A5Z B;  1YIT T;  2ROL A;  2BTT A;  5GMK e;  2MMP A;  5CQY A;  4LE9 A;  3HFN A;  3JCM g;  1UE9 A;  1AZE A;  1AVZ C;  4XTW A;  5CKF A;  2P0P A;  1T3L A;  4FYX B;  4MDX A;  5GMK m;  4M7A B;  1KHC A;  5EC7 A;  2LCS A;  2OTJ T;  2L3S A;  1VQK Q;  1RI9 A;  5HK3 A;  1PG5 B;  1VYT A;  5DLQ E;  1WIE A;  1UUE A;  1D1A A;  1JU5 C;  1N8R C;  2RQU A;  4PFO A;  1WXT A;  4LDY A;  2XI9 A;  4KH0 B;  4L59 A;  4QVD A;  1VQN T;  2X4W A;  4JJN K;  2X3X D;  1VQ8 T;  2JN0 A;  1G3W A;  2ZPF B;  3CPF A;  2ECZ A;  4M78 B;  4FYW B;  3OYG A;  3M53 A;  4OP0 A;  1NJI U;  4HVU A;  2DL5 A;  3MP6 A;  3M0R A;  1TOV A;  1VQ4 Q;  3VS0 A;  1NZ9 A;  2RD1 A;  3PNW C;  3QZ9 B;  3GBQ A;  2JMA A;  3OYA A;  1BKB A;  1BK2 A;  2DE0 X;  2YUQ A;  4M77 B;  3RBB B;  4FSS A;  2NUT B;  4ZNX A;  2R5A A;  2FZG B;  1TUC A;  2BE9 B;  3CCE Q;  3JCM b;  1RAF B;  3MJX A;  4OB1 B;  4FCY A;  1OX8 A;  1X6O A;  3H41 A;  1UGS B;  2LT1 A;  2CZ6 B;  3GF5 A;  3KFV A;  2ZCF B;  5DM7 R;  1BCO A;  1Q7Y U;  1UHF A;  2GFU A;  4FU6 A;  2DTO A;  4C92 A;  1XOV A;  1OZ3 A;  4M75 C;  1IHW A;  3PMT A;  3CCS Q;  1VYU A;  4RG2 A;  5I22 A;  1Q82 R;  3EG0 A;  4PL6 A;  1NG2 A;  4C8Q C;  5GAM d;  1X01 A;  3CCV Q;  4X9C A;  5EG2 A;  1M90 R;  4C0F A;  2FG0 A;  3FIF A;  4BD3 A;  1ZSZ C;  4OGC A;  4M7D C;  2EGC A;  4XK8 E;  1MV0 B;  3RMQ A;  2LCC A;  1S72 Q;  2FEI A;  2HBP A;  5GAN 6;  3VUZ A;  1UEB A;  2CP5 A;  3NMZ C;  1ZSG A;  2CSI A;  4HCC A;  3OMG A;  1WJR A;  1WI7 A;  5GAN 2;  1U8R A;  2KMT A;  4E7H A;  4LDU A;  2A08 A;  3MP1 A;  2DPP B;  2EQU A;  2V8J A;  2E1H A;  1G5V A;  3HKS A;  3PMI A;  5IN1 A;  1SKU B;  4F16 A;  2P0Q A;  5IXF A;  4LDV A;  4M7A C;  1IRE B;  1AWO A;  2CYZ B;  3CCR T;  4NS5 A;  5L23 A;  3KXT A;  1SEM A;  3M5A A;  3UWN A;  1PWT A;  1I81 A;  4EMH A;  4DEY A;  1YNZ A;  3V8L A;  1VQ9 T;  1K76 A;  1LOJ A;  4Y92 A;  2CUB A;  3VYG A;  2RO0 A;  4JRQ A;  4PJO A;  2M02 A;  3M0S A;  5GAN d;  1G3Y A;  3QYH B;  3CCL A;  1JJ2 A;  4MDW A;  5HCK A;  3QSU A;  3DB4 A;  3F70 A;  4O5V A;  2RI2 A;  1M5Q 1;  1BIB A;  3SWN A;  1YIT Q;  3A8L B;  2YRC A;  3JAM E;  2J7I A;  4M78 C;  1YJ9 Q;  1BU1 A;  4RTX A;  2XU8 A;  2PQW A;  4ZGJ B;  1H8K A;  1NLP C;  1N8R U;  4BE1 A;  2OTJ Q;  2EKH A;  1WQ7 A;  2K57 A;  5LJ5 j;  5IH2 A;  1X69 A;  1CKB A;  3M55 A;  3PE0 A;  1SSH A;  3OSS C;  2PU9 B;  4PLI A;  3QWY A;  3OS1 A;  4Z89 A;  3I55 T;  4M77 C;  4UC4 A;  2CDT A;  1VQ6 A;  1BI2 A;  1E6G A;  1WHK A;  1N27 A;  1WYX A;  1M90 C;  4GBQ A;  1VQM A;  1VQN Q;  2DFU A;  3X24 B;  1VQ8 Q;  1NYF A;  2OTL Q;  5LJ5 f;  1F1B B;  3QXE B;  3L2U A;  3OB9 A;  3QDF A;  3SD4 A;  2CKK A;  4OGE A;  4QQG A;  4XU3 A;  3VRZ A;  1VUB A;  1K0S A;  1W6X A;  1WHG A;  2DXC A;  3OYY A;  2M16 A;  4OF1 A;  4A54 A;  2DXT A;  5KYX A;  2K9G A;  3CD6 A;  5A0G A;  2E6N A;  2DIQ A;  2LTO A;  2QQ9 A;  2BZX A;  1QQJ A;  3JB9 D;  1Y96 A;  4ANJ A;  2LQW A;  3SHW A;  1M1G A;  1WX6 A;  4J6Y A;  1KC8 R;  2RHU A;  2XDB A;  3RIR A;  2R58 A;  4R56 A;  1I8F A;  1EFN A;  5CVI A;  1V29 B;  1MHN A;  1GFC A;  1VQ5 Q;  4JZ3 A;  1QKX A;  4DBH A;  1M9S A;  1TUD A;  1ZA1 B;  4C8Q G;  5KE2 A;  2KAF A;  4AFS C;  1HJD A;  3QKJ A;  4RKU E;  2V8I A;  3JRZ A;  1OYX A;  1WHJ A;  2JJ9 A;  3QII A;  3QPH A;  1YFN A;  4MZP A;  2L5Q A;  3THK A;  5KYY A;  1JEG A;  7AT1 B;  4RTZ A;  2Y4X A;  3L2Q A;  1ZBJ A;  3CMA A;  1TXQ A;  2CS7 A;  5LJ3 h;  4BB7 A;  4JRI A;  2QEX T;  4LD9 K;  3M4G A;  3M0T A;  2OX7 A;  4IUQ A;  2GQV A;  1TU0 B;  4QKU A;  1H64 1;  4J6X A;  4M7A G;  1D1C A;  1HD3 A;  5A0L A;  4PJO F;  4EMK C;  3BFM A;  4HVV A;  4C0Z A;  3EHQ A;  3CCR Q;  2LP5 A;  5GMK j;  1V76 A;  2NLU A;  3OYE A;  1ACM B;  1VQ9 Q;  2QG9 B;  4E7K A;  3CCM T;  2C06 A;  3CC7 A;  5FRM A;  3C12 A;  4JRK A;  2X4J A;  4A4H A;  1MV3 A;  1OOT A;  1RLQ C;  4M78 G;  3QDR B;  3UDC A;  3M56 A;  3E1S A;  2LJ1 A;  3CC2 T;  2RJD A;  2LNV A;  1M30 A;  2HSP A;  1MGQ A;  5D6X A;  2LC4 A;  2ATC B;  5FW9 A;  1KC8 C;  3HSB A;  2DBK A;  1QCF A;  1FX7 A;  1C1A A;  3E9F A;  4PJN A;  4DBR A;  3EGX A;  4XTX A;  2QA4 T;  1A0N B;  5FWC A;  1NYG A;  3OBY A;  1M90 U;  3UA6 A;  4ZTJ A;  4X9D A;  1LJO A;  3D7S B;  3LGF A;  1W70 A;  2EGE A;  1OV3 A;  2RI3 A;  2W10 A;  1VQL Q;  1VQK T;  1OUL A;  2ZGW A;  1AZG B;  3CCJ A;  4C92 D;  1YJW A;  3PT9 A;  1D0Z A;  1O9S A;  4J7F A;  3PTA A;  4C92 E;  3LYI A;  4B6M A;  4HT8 A;  3NPF A;  2BUD A;  4E7I A;  4RTT A;  3LWH A;  5GAM j;  2I0N A;  3MEU A;  4IUV A;  4EPC A;  2EQK A;  2VVK A;  1RAI B;  5LJ3 e;  5HKC A;  1Q95 G;  1S1N A;  3JSC A;  1BB9 A;  4FYY B;  1MUZ A;  1M1F A;  2YLB A;  2RQV A;  1VQ4 T;  2Y4Y A;  2JW4 A;  2PVG B;  3CCU Q;  2FB7 A;  4E7L A;  2DVJ A;  4AG2 C;  3TSZ A;  1O75 A;  5GAM f;  5CKD A;  3L42 A;  2KYM A;  3ULR B;  4BY6 B;  3CXC A;  3GOX A;  2DM1 A;  2DZC A;  2IIM A;  3CCE T;  2JTM A;  3SDZ A;  2A7Y A;  4KBM B;  1Y71 A;  4PFZ A;  2M0O A;  2D6F A;  3CEY A;  1X2Q A;  5A2Q E;  4PJO D;  2ZPE B;  2I2L A;  2MWP A;  3NFC A;  4B9X A;  3MKD A;  2BZ8 A;  4PJO E;  5GAN j;  3I56 A;  2YXY A;  5CKB A;  3JCM h;  3CCS T;  2F5K A;  4JJD A;  2DYI A;  2KBT A;  3G71 Q;  3A8H B;  5KH6 A;  3H8Z A;  4OB2 B;  3CCV T;  5IHK A;  1M27 C;  1BIA A;  2JS2 A;  1IGQ A;  2E10 A;  2QAS A;  2P4R A;  3QJ6 A;  1M4Z A;  4DOV A;  2K4Y A;  3JV3 A;  1QP3 A;  4EDU A;  5GMK l;  3J81 E;  4ZTF A;  1AHJ B;  1T0H A;  2RMO A;  3H0H A;  4ZGE B;  1S72 T;  4KGZ B;  4MMK A;  5L8R E;  5GAN f;  1Z9Q A;  3I35 A;  4Z02 A;  4FSX A;  3REA B;  4WCI A;  3CCJ Q;  2O31 A;  1AWX A;  4A53 A;  2DL4 A;  2B8A A;  2A28 A;  4KRT A;  4KUI A;  2FVU A;  3OA6 A;  3G6E Q;  2C0T A;  1QVP A;  4F7U A;  1I1J A;  3VS7 A;  2XID A;  2FZK B;  2EJG A;  3RDV A;  1KC8 U;  2E3I A;  3DLL A;  4OMO A;  2A3L A;  1X6B A;  1NE8 A;  1M8M A;  1BI0 A;  2DTH A;  4D8K A;  3KBG A;  3PVQ A;  1B34 A;  2QQB A;  1SRM A;  2LQ8 A;  1KFZ A;  2QQR A;  2DEU A;  4XTZ A;  3KUF A;  4PJL A;  2K7A A;  2E64 A;  2QA4 Q;  2RHI A;  2JZ2 A;  4RTY A;  5KYN A;  1YJ9 T;  3VRY A;  3EGD A;  1Q81 R;  2P84 A;  2O9S A;  1GCQ A;  3V7S A;  5KCH A;  1XQH A;  3JCM Q;  1PSE A;  4GLK A;  3OYM A;  2RN8 A;  4Z88 A;  3M4Y A;  4ESR A;  3PFS A;  3EG1 A;  1PKT A;  1VQ7 Q;  4WF2 A;  1RAA B;  4BI8 B;  2IVW A;  4BY6 C;  2M1H A;  1YI2 A;  1ZA2 B;  4PJO B;  5CKH A;  2XDP A;  1ZLM A;  4A4G A;  3JCM e;  3VYH B;  3EAE A;  1QWF A;  4OB3 B;  2OTL T;  2J6K A;  5J26 A;  1E6H A;  3QHS A;  3V7C A;  3M0P A;  2RQW A;  2DF6 A;  1G3T A;  1KHI A;  2HBW A;  4RUG A;  2ZAE A;  2DXU A;  2HNI A;  3EFO A;  2EVR A;  1G8X A;  4RMO A;  2D0Q B;  5GJV B;  5FU7 B;  3L2V A;  1D3B B;  2FO0 A;  1OPL A;  2MIO A;  6AT1 B;  4J9C A;  1NPP A;  2MAM A;  2O4X A;  1OU9 A;  1PD1 A;  1TG0 A;  1PKS A;  3UT1 A;  4QVC A;  2ENM A;  4JS5 A;  2LX9 A;  1G2B A;  1FYN A;  4PJM A;  4BUG A;  1RI0 A;  2GCX A;  1KQ2 A;  4ZN1 A;  5M9O A;  4XTY A;  1C6V X;  4OMP A;  3G4S Q;  2JVV A;  1VQ5 T;  2V8K A;  2B86 A;  2KVQ G;  4RTV A;  1UGQ B;  4II1 A;  1YHQ A;  2ED0 A;  2E70 A;  1N5Z A;  3GP8 A;  4L5G A;  3EG9 A;  3BW1 A;  2AZV A;  2EPD A;  1QLY A;  2LQK A;  1QCO A;  3Q1J A;  3M0Q A;  2RI5 A;  2JTE A;  3HFO A;  3JB9 F;  2JUF A;  4A4E A;  2M51 A;  5D6W A;  3C4S A;  1Q81 C;  1Y96 B;  2VKN A;  3LH5 A;  2EYX A;  4M75 A;  1LCK A;  2K6D A;  3LW5 E;  1RL2 A;  3FB9 A;  3JB9 G;  2HKQ B;  3FJ5 A;  2VXE A;  2EYW A;  2O9V A;  2VGM A;  2KT8 A;  4J6W A;  5CQX A;  2VWF A;  4XU1 A;  1H3Z A;  5GAN g;  2CT4 A;  1PCX A;  4M7D A;  2C0O A;  2CH4 A;  1UGV A;  2D8H A;  1YI2 Q;  1QVF P;  4E7J A;  4JJB A;  3OYN A;  4AG1 C;  1UG1 A;  1VQ6 T;  1PRL C;  2C0I A;  2LZ6 B;  3VS1 A;  4OMQ A;  1M3C A;  2XIC A;  1J3T A;  4MZM A;  1WLP B;  2RJF A;  3OY9 A;  1M2V B;  2DIL A;  2GNC A;  2CUD A;  5KYY B;  2R57 A;  4JLI A;  1NPR A;  4FW1 A;  2KY9 A;  2XKO C;  2M0Y A;  4C5E A;  1GL5 A;  1N6A A;  1WXB A;  1BI3 A;  5D7U A;  1JBM A;  1JXO A;  2KT1 A;  2YHT A;  4IKF A;  4PJO C;  4Q5W A;  2K79 A;  2F1L A;  3LH0 A;  1GFD A;  2X51 A;  2RHX A;  2QTX A;  1VQP A;  1GXI E;  1YP5 A;  3SWN C;  1JO8 A;  2CP3 A;  2CZ0 B;  2PZ1 A;  4OB0 B;  1EIF A;  1YCS B;  3EG3 A;  4OVA A;  2GTO A;  5I11 A;  4EMK B;  2EKO A;  3QBY A;  1Q86 C;  3DB3 A;  4J9F A;  2CP2 A;  5J39 A;  2DTI A;  4XU0 A;  5FU7 C;  4FL6 A;  3M54 A;  3A8M B;  1D09 B;  4N4I A;  5LL6 S;  3FRN A;  5IAY A;  3TU4 K;  1YHQ Q;  2KRS A; 
#chains in the Genus database with same CATH homology
 1VQL T;  2DD5 A;  4PLL A;  3CCM T;  4E7K A;  5D6Y A;  2C06 A;  2VXF A;  3CC7 A;  1YIJ T;  5FRM A;  1Q7Y C;  3C12 A;  4JRK A;  2X4J A;  3OYD A;  2RH2 A;  3TRE A;  2R5M A;  4A4H A;  1YIT A;  3M59 A;  2PUK B;  4RCC A;  3OS5 A;  2DXB A;  5GAN 4;  2GF7 A;  1UGP B;  3QDR B;  4M78 G;  3UDC A;  1W2B S;  3M56 A;  3HRT A;  4M78 E;  3E1S A;  3RKW A;  1YJ9 A;  1XTD A;  3P8B B;  3ZFJ A;  3CC2 T;  2RJD A;  2LNV A;  3M9Q A;  3FDR A;  5D6X A;  1MGQ A;  2LC4 A;  2QXF A;  4M77 A;  3SFM A;  2XDD A;  2RB6 A;  3S3N A;  4C92 C;  1R8O B;  3CPW A;  4BAC A;  1KC8 C;  2EIF A;  3HSB A;  2XK0 A;  3MCA B;  2OTJ A;  2PVD B;  5GAM e;  1FX7 A;  4ELZ C;  3E9F A;  2E12 A;  3CMA T;  3CCL T;  3WVD B;  3PIO A;  3OYI A;  4XTX A;  1QP2 A;  3CME T;  2QA4 T;  4CI0 C;  3OBW A;  5DLO A;  2RM4 A;  3CBP A;  5GAO l;  5GAN 3;  1WNL A;  3OBY A;  1M90 U;  4M75 B;  1VQP T;  4ZTJ A;  4X9D A;  2LT4 A;  1LJO A;  3TEE A;  3LGF A;  1OI1 A;  4QVZ A;  5A0D A;  2RI3 A;  3CCU T;  4N0A A;  4J83 A;  3CCQ T;  1VQN A;  4C92 F;  4RG8 A;  4C8Q B;  4C8Q A;  1VQK T;  1YJN A;  2ZGW A;  3G4S A;  1K8A U;  1VQ8 A;  3PIP A;  3L2Z A;  2GFA A;  5C6S A;  2AHJ B;  4X34 A;  4D6W A;  3CCJ A;  2OTL A;  3V7R A;  4C92 D;  1YJW A;  3PT9 A;  3OYL A;  1N9R A;  2H3J A;  1IZ6 A;  2IG0 A;  1O9S A;  2K2V A;  4HA8 A;  4F7U F;  4J7F A;  3OS0 A;  5CIU A;  4M7D B;  4C92 G;  3PTA A;  4J8O A;  4IUP A;  2DK3 A;  3MEW A;  5HY6 A;  4C92 E;  1U1S A;  3CCS A;  4JUV A;  2FHD A;  3LYI A;  4E47 A;  3BY7 A;  4HCZ A;  4HT8 A;  4NL3 A;  5CO7 A;  4PKC C;  2BUD A;  3CXC S;  3HL8 A;  4QQ6 A;  4JLG A;  5FRN A;  2DD4 A;  4IUR A;  4E7I A;  4F7U G;  3LWH A;  1Q81 U;  5GAM j;  3MEU A;  4IUV A;  4JDS A;  4F7U E;  5FRO A;  4EPC A;  2K3Y A;  2DZ9 A;  4YTL A;  1BYM A;  3FLG A;  2EQK A;  3A5Z B;  1YIT T;  5LJ3 e;  1VQM T;  2DAQ A;  5HKC A;  3JB9 H;  5GMK e;  3JSC A;  1HXD A;  3MET A;  4ZN3 A;  2MMP A;  5CQY A;  5CR2 A;  4C0G A;  2EJF A;  3E9G A;  2QI2 A;  3HFN A;  1UB4 A;  3H6Z A;  3JCM g;  4XTW A;  4M7D F;  1M1F A;  5CKF A;  2YLB A;  5GAN e;  2VYT A;  2P0P A;  3DKM A;  1VQ4 T;  3G71 T;  4LDX A;  4MDX A;  5GMK m;  2Y4Y A;  3DLM A;  4M7A B;  3AHU A;  1WJS A;  2PVG B;  1KHC A;  2FB7 A;  3NTK A;  1K9M U;  4M7A A;  4E7L A;  2OTJ T;  1QVF A;  1YCY A;  5HK3 A;  1Y7X A;  1O75 A;  5GAM f;  1WGS A;  3MO8 A;  1VQ5 A;  5KCO A;  5DLQ E;  5CKD A;  3L42 A;  3X25 B;  3CBM A;  4BY6 B;  3GNF B;  3CXC A;  2VC8 A;  3ASK A;  4BI4 A;  4ZGD B;  2JTF A;  2L3R A;  3CD6 T;  1N8R C;  2XHC A;  3OYH A;  5FLX E;  3GOX A;  2RK1 A;  2P4T A;  4LDY A;  5CAI A;  2DZC A;  4BE2 A;  3CCE T;  2JTM A;  4V2S A;  2XI9 A;  3SDZ A;  4L59 A;  5LJ5 h;  2KDS A;  2A7Y A;  4KBM B;  4QVD A;  3PGG A;  1VQN T;  1Y71 A;  2X4W A;  3RKY A;  3RMS A;  4JJN K;  1YJN T;  2M0O A;  3CPW S;  2WSE E;  4J5Y A;  2JN0 A;  1G3W A;  2KSS A;  3CEY A;  2ZPF B;  3CPF A;  4C5H A;  4XU2 A;  5LJ3 j;  5GAN 5;  5A2Q E;  3OYC A;  3CCJ T;  4PJO D;  2ZPE B;  4EMG A;  2I2L A;  2MWP A;  3NFC A;  4M78 B;  4M78 A;  3OYG A;  3M53 A;  4OP0 A;  4PJO G;  3JCM V;  3C94 A;  4B9X A;  2ZPB B;  3LGL A;  3LWI A;  3MP6 A;  1NJI U;  4HCB A;  4PJO E;  5GAN j;  3I56 A;  2K5L A;  5CKB A;  3JCM h;  3G6E T;  3CCS T;  2F5K A;  4C0D B;  2MF2 A;  5GAN 7;  3A8H B;  5KH6 A;  1NZ9 A;  2RD1 A;  3H8Z A;  3PNW C;  3QZ9 B;  2BKD N;  4OB2 B;  1DJ7 B;  3CCV T;  2E6Z A;  1HK9 A;  5FU6 B;  1QVG A;  1BIA A;  3CC4 A;  2E10 A;  3OYA A;  3QJ6 A;  1M4Z A;  1ZBX A;  4QW2 A;  2K4Y A;  4DOV A;  1PSF A;  2LCL A;  1QP3 A;  1D3B A;  4EDU A;  5GMK l;  1BKB A;  1Q86 U;  3J81 E;  1JRI A;  2MI6 A;  2PUO B;  5LJ3 f;  3SB2 A;  4XTV A;  4ZTF A;  1AHJ B;  2EFI A;  1KD1 U;  4M77 B;  4ZGE B;  1VQ8 T;  2X4Y A;  1S72 T;  4MMK A;  3GLX A;  5L8R E;  1Q82 C;  2R5A A;  3RKX A;  3URG A;  2HD0 A;  5GAN f;  3JCM b;  1VQO A;  3CCR A;  4OB1 B;  1M1K C;  3X26 B;  4Z02 A;  4FSX A;  4KUD K;  2BIV A;  1X6O A;  1UGS B;  2LT1 A;  2CZ6 B;  2OAU A;  2ZZD A;  2ZCF B;  1BI1 A;  3GF5 A;  3M57 A;  5DM7 R;  1Q7Y U;  1VQ9 A;  3GPL A;  2GFU A;  4A53 A;  2PVO B;  1K73 C;  4FU6 A;  2B8A A;  4P5N A;  3QUI A;  2DTO A;  4C92 A;  1XOV A;  3FEO A;  4KUI A;  1OZ3 A;  2FVU A;  4M75 C;  3OA6 A;  4L6V 5;  3T9N A;  3PMT A;  2MWO A;  3OYB A;  1WPY A;  2L89 A;  2ZPH B;  4RG2 A;  4LDW A;  4M77 F;  5C0M A;  4N0A C;  2QEX A;  1QVP A;  4PL6 A;  4F7U A;  4C8Q C;  5GAM d;  2EJ9 A;  2XID A;  1X01 A;  3JB9 I;  4X9C A;  5EG2 A;  3L1A A;  2EJG A;  2M9U A;  1KC8 U;  4C0F A;  4JS4 A;  3FIF A;  3N5B B;  4BD3 A;  1VQ7 T;  3DLL A;  2A3L A;  1QVF S;  1NE8 A;  3J80 E;  4M7D C;  4OGC A;  4XK8 E;  3VJP A;  1BI0 A;  2DTH A;  3RMQ A;  3KBG A;  4A4F A;  5LJ5 g;  1SSF A;  5I21 A;  1B34 A;  2QQB A;  2LCC A;  4M75 F;  4CRI A;  2HBP A;  2LQ8 A;  3INZ A;  1KG1 A;  2HQE A;  4XQ3 A;  5GMK i;  3QG1 A;  2QQR A;  5J3B A;  3CC7 T;  3P8H A;  5GAN 6;  3VUZ A;  4C5G A;  4M75 D;  4XTZ A;  1UEB A;  2LDM A;  3KUF A;  4C8Q F;  1KQ1 A;  1JJ2 S;  4HCC A;  3OMG A;  1WJR A;  4M75 G;  2E64 A;  3CC4 T;  2RJE A;  2DJZ A;  2RHI A;  4M75 E;  2JZ2 A;  4C8Q D;  3R6O A;  5GAN 2;  3OYF A;  1U8R A;  1YJ9 T;  2KMT A;  2DIG A;  4FIB A;  4LDU A;  4E7H A;  3I55 A;  5CKE A;  1VQL A;  3CCM A;  3MP1 A;  2DPP B;  3V7S A;  5GAO p;  2EQU A;  2V8J A;  5KCH A;  2E1H A;  3CBO A;  5GAN 8;  1G5V A;  1XQH A;  4IUT A;  3JB9 F;  2KK4 A;  3JCM Q;  3HKS A;  2K5F A;  3HPW A;  3PMI A;  5IN1 A;  4XTU A;  2DO3 A;  4M7D D;  3OQ5 A;  2RK2 A;  2P0Q A;  4NOY A;  4LDV A;  1PSE A;  1IRE B;  1VIF A;  4GLK A;  1U1T A;  3OYM A;  3UPU A;  4M7A C;  2CYZ B;  3CCR T;  4NS5 A;  5LJ5 e;  1VQO T;  1M8V A;  3M4Y A;  4M7D G;  3KXT A;  3M5A A;  1N9S A;  4M7D E;  3CC2 A;  3PFS A;  3UWN A;  1I81 A;  4EMH A;  5DY9 A;  4WF2 A;  5LJ3 d;  3JCM P;  2LVM A;  4HT9 A;  3TCJ A;  1QVG S;  3V8L A;  2IVW A;  4BI8 B;  2DVE A;  2M1H A;  4BY6 C;  1VQ9 T;  1YI2 A;  1LOJ A;  3VYG A;  2RO0 A;  1UGR B;  4JRQ A;  4PJO B;  4PJO A;  3QZ5 B;  4QQD A;  3J7A F;  2DKG A;  2WSF E;  3JCM J;  5GAN d;  5CKH A;  4KT0 E;  4BI3 A;  4BDZ A;  1G3Y A;  2F69 A;  2XDP A;  3QYH B;  4N4G A;  4MDW A;  4FT2 A;  4A4G A;  1YBY A;  1JJ2 A;  3CCL A;  1OZ2 A;  3BDU A;  3DB4 A;  3JCM e;  3VYH B;  3QSU A;  3F70 A;  3EAE A;  4O5V A;  1X75 C;  2RI2 A;  3HP9 A;  4OB3 B;  5AYF A;  3G4S T;  4BDY A;  4M7A F;  1M5Q 1;  3M58 A;  1BIB A;  3SWN A;  2OTL T;  5J26 A;  3A8L B;  1YJW T;  3RES A;  4JRP A;  3FJP A;  4M7A D;  3VV0 A;  3JAM E;  3QHS A;  4ME7 A;  3MEA A;  2XD0 A;  2VUB A;  3V7C A;  5CK9 A;  4M78 C;  3CCU A;  3LLR A;  3L2R A;  1G3T A;  2XU8 A;  2PQW A;  3QO3 A;  1KHI A;  4PNO A;  1VQK A;  5GAO m;  4EMK A;  3ZEH A;  2DXU A;  2HNI A;  4ZGJ B;  5GAO q;  3OS2 A;  4C0D C;  1N8R U;  2D9T A;  1I4K 1;  4RMO A;  4BE1 A;  1WQ7 A;  2D0Q B;  2K57 A;  5LJ5 j;  5FU7 B;  2K3X A;  3HHT B;  5FU6 C;  3L2V A;  1D3B B;  3M55 A;  4LD6 A;  3OSS C;  1NPP A;  2MAM A;  2O4X A;  4QVC A;  3OW2 A;  2PU9 B;  3UT1 A;  4DQ2 A;  3X28 B;  4PLI A;  4JS5 A;  2LX9 A;  2ZPI B;  3OS1 A;  2E65 A;  3MP8 A;  2RHZ A;  4M78 F;  3I55 T;  2JNG A;  2X4X A;  4M77 C;  4UC4 A;  4B9W A;  2K5I A;  4C5I A;  1VQ6 A;  1BI2 A;  4BUG A;  2QDY B;  3E19 A;  1RI0 A;  2GCX A;  3A8O B;  1N27 A;  4M78 D;  1KQS A;  1KQ2 A;  4ZN1 A;  5M9O A;  1M90 C;  1VQM A;  4XTY A;  3JB9 J;  3GIB A;  3A8G B;  3MHX A;  2HAX A;  2E41 A;  2JVV A;  3X24 B;  1VQ5 T;  2V8K A;  2KVQ G;  4RCB A;  3X20 B;  5LJ5 f;  3QXE B;  1UGQ B;  1ZHI A;  2EQJ A;  4II1 A;  4VUB A;  3L2U A;  1YHQ A;  2YRV A;  4C92 B;  3FC3 A;  1K8A C;  1VQ4 A;  1TH7 A;  3OB9 A;  3S6W A;  3G71 A;  2E70 A;  3SD4 A;  3OYK A;  3GP8 A;  2RHY A;  2O01 E;  2CGH A;  3MEV A;  1Y07 A;  2CKK A;  2DEQ A;  2L8D A;  2Y90 A;  3BW1 A;  4L5G A;  1YI2 T;  4GY5 A;  4OGE A;  4QQG A;  4XU3 A;  4R55 A;  2LQK A;  3HRS A;  5IT9 E;  1VUB A;  3Q1J A;  4F7U B;  3GNG A;  3JCM W;  1JB0 E;  2DXC A;  2RI5 A;  2M16 A;  3OYY A;  4FT4 A;  3HFO A;  4IUU A;  4OF1 A;  4HKE A;  4A54 A;  2P0K A;  2JOY A;  2WSC E;  5HK0 A;  1Q82 U;  2JUF A;  2XG8 D;  4M77 D;  2DXT A;  3JCM f;  4A4E A;  3CD6 A;  5A0G A;  3BDL A;  5D6W A;  2E6N A;  3C4S A;  2DIQ A;  3NTH A;  1Q81 C;  1M1K U;  2LTO A;  2QQ9 A;  4ATO A;  4M77 G;  1Y96 B;  5I2M A;  4DA4 A;  1Y96 A;  3JB9 D;  2VV5 A;  4M75 A;  4M77 E;  3WVE B;  2ZPG B;  5GAM h;  5GAO r;  3CCE A;  3LW5 E;  3HRU A;  3L2W A;  1RL2 A;  3FB9 A;  3JB9 G;  1B34 B;  1M1G A;  5LJ3 g;  4J6Y A;  3I56 T;  2VXE A;  1K73 U;  1G3S A;  1W2B A;  2RHU A;  2EWN A;  2XDB A;  2VGM A;  3RIR A;  3WXM B;  2R58 A;  5CCA A;  2WAC A;  1I8F A;  4R56 A;  4J6W A;  5CQX A;  5CVI A;  4XU1 A;  1H3Z A;  5GAN g;  1V29 B;  1MHN A;  4M7D A;  1XNI A;  3OSV A;  3ER0 A;  1K9M C;  2CZ7 B;  1M9S A;  2RA2 A;  2EAY A;  3G6E A;  2E5Q A;  4Y28 E;  4Y91 A;  4C8Q G;  5KE2 A;  1YIJ A;  2YLC A;  1P92 A;  2KAF A;  4C8Q E;  4E7J A;  3CCV A;  3S3M A;  3OYN A;  3VU3 C;  3S3O A;  1I5L A;  3QKJ A;  2CZ1 B;  4RKU E;  5I2S A;  2V8I A;  3JRZ A;  1OYX A;  4KUL A;  1VQ6 T;  3OMC A;  2QQS A;  3OYJ A;  2XIC A;  2FL7 A;  4MZM A;  3RUX A;  2RJF A;  3OY9 A;  3QII A;  3QPH A;  2KQW A;  4MZP A;  2FYK A;  2L5Q A;  2R57 A;  4MZT A;  4JLI A;  3QJY A;  2X35 A;  3V8J A;  1NPR A;  1S72 A;  2KY9 A;  2EQM A;  2XKO C;  3C95 A;  4XAX B;  1YHQ T;  4C5E A;  1FXX A;  1N6A A;  2Y4X A;  3L2Q A;  1BI3 A;  2D6F A;  1JBM A;  3JCM X;  4A4K A;  2YHT A;  5GAO n;  4IKF A;  3LX7 A;  2HQX A;  3CMA A;  4PJO C;  4Q5W A;  3OW2 S;  4NL2 A;  2CS7 A;  5LJ3 h;  3G7Z A;  4BB7 A;  4OMF B;  3EFS A;  5GMK h;  4JRI A;  3CME A;  4O6J A;  1NJI C;  2QEX T;  2QA4 A;  1FWZ A;  3LH0 A;  4LD9 K;  3RER A;  3V8K A;  4BE0 A;  3SWN B;  2RHX A;  2VGN A;  3M4G A;  2QTX A;  5LJ5 d;  1VQP A;  1GXI E;  5GAN h;  1KQS S;  1VIE A;  3SWN C;  3VUB A;  1ZQ1 A;  2CZ0 B;  4IUQ A;  4J7I A;  2GQV A;  3VKI A;  4FM4 B;  1EIF A;  1WJQ A;  1H64 1;  4MML A;  4OB0 B;  3CCQ A;  3QYG B;  4J6X A;  4OVA A;  4N4H A;  4M7A G;  4M7A E;  3NTI A;  4EMK B;  2EKO A;  3QBY A;  3ME9 A;  5A0L A;  3ZBD A;  4PJO F;  1Q86 C;  4EMK C;  3JCM c;  3DB3 A;  3O8V A;  4TVR A;  3BFM A;  1QW1 A;  2QQA A;  4C0Z A;  4ELY C;  1KD1 C;  1VQ7 A;  3EFR A;  5KE3 A;  3JCM d;  2LRQ A;  3P8D A;  5J39 A;  5GMK j;  2DTI A;  2G3R A;  2F5T X;  4XU0 A;  5FU7 C;  5GAM g;  4FL6 A;  4DOW A;  2RJC A;  3M54 A;  2EYQ A;  2O4X B;  1W4S A;  3A8M B;  4N4I A;  5LL6 S;  2NLU A;  3OYE A;  3FRN A;  5IAY A;  3TU4 K;  1LNX A;  1WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...