4A4EA

Solution structure of smn tudor domain in complex with symmetrically dimethylated arginine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL MOTOR NEURON PROTEIN
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4eA00
4GY5A 4BDYA 3OYHA 2X4XA 4QVZA 3MEVA 2LCCA 3E9GA 5FROA 4IKFA 2HQEA 3S3NA 4QQGA 4C5HA 3OY9A 4EDUA 2L8DA 4ZTFA 2K3XA 4B9XA 2R5MA 3CEYA 4RG2A 3OS0A 3SD4A 2M16A 4IUQA 2VYTA 2LDMA 5M9OA 3O8VA 3OYKA 4BACA 4Q5WA 3L2UA 2X4WA 4HCZA 3NTIA 3META 5J26A 2RHXA 5C0MA 4E7KA 3LLRA 3EAEA 3OYCA 3QIIA 2RI2A 2FHDA 2RHZA 3H6ZA 3NTKA 3E9FA 4QW2A 3P8DA 3ZEHA 2RHIA 2EKOA 2F5KA 1WJRA 4E7HA 2NLUA 3PMIA 2L89A 2RJCA 2EFIA 4IUPA 5FRNA 3LH0A 2M1HA 4IUTA 4ZTJA 3S3OA 2LRQA 3L2QA 1G5VA 3FDRA 3MP6A 3OYFA 2P0KA 3OYNA 2XDPA 2R57A 2BKDN 3M9QA 2GFUA 3BDLA 3MEAA 3L42A 4UC4A 4BD3A 3OYMA 4BE2A 5FRMA 2DIGA 2DAQA 3MEUA 4C5GA 4FL6A 4PLLA 2O4XA 3OMCA 1OZ3A 3S6WA 4A4GA 1XNIA 3ME9A 3OMGA 2E5QA 3DB4A 3ASKA 4IURA 4Z02A 3OYLA 2RHYA 4BE0A 3S3MA 1H3ZA 3F70A 5D6XA 3MP8A 4NS5A 1RI0A 4E7JA 3UWNA 4N4IA 2K3YA 2R58A 2PQWA 3OQ5A 2L3RA 2EQUA 2RJDA 2DIQA 1OI1A 2QQSA 1MHNA 2RHUA 4CRIA 3FC3A 2EQMA 3DB3A 4BE1A 2D9TA 3PFSA 4QQ6A 2XK0A 3DLMA 4PLIA 4X34A 2JZ2A 5KE3A 2RJEA 5J39A 3OA6A 3H8ZA 3OYGA 2IG0A 4N4HA 3NTHA 4LD6A 4B9WA 4A4HA 3OYJA 2MWPA 2RO0A 3LYIA 3OS2A 3PMTA 3MO8A 3QJ6A 2EQJA 4II1A 2LVMA 2JTFA 2WACA 5IAYA 1OYXA 3GOXA 4E7IA 3OS1A 2LTOA 3FEOA 2G3RA 4N4GA 3L2WA 3FLGA 2BIVA 4BDZA 5D6YA 3KUFA 5KCHA 3OYBA 3OYDA 1WJSA 4IUVA 4C5IA 1SSFA 4OVAA 2RI3A 4IUUA 2GF7A 5KH6A 3OYEA 3L2RA 2B8AA 3Q1JA 3LGFA 3C4SA 1N27A 4A4FA 2YRVA 5IN1A 4PL6A 2MWOA 3LGLA 4E7LA 4FU6A 2R5AA 3OB9A 2EQKA 3LX7A 2M0OA 4QQDA 3UT1A 5KCOA 4C5EA 5KE2A 3L2VA 3MP1A 2O4XB 3PNWC 3QKJA 3QBYA 2RJFA 3P8HA 2QQRA 2GFAA 4A4EA 2RI5A 1WJQA 5C6SA 5CIUA 3MEWA 3OYIA 5D6WA 4L59A 2X4YA 1OZ2A 2BUDA 2E6NA 2HQXA 1KHCA 1WGSA 2X35A 3OYAA 2CKKA
chains in the Genus database with same CATH superfamily
4ANJA 3M0SA 4JDSA 2J7IA 4M75F 3JAME 2VKNA 5GAOm 2EBPA 1PKTA 2LJ3A 5J3BA 4J9HA 2VYTA 2ZAEA 3EHQA 2BTTA 2F2VA 2E70A 3QYGB 1K73U 2QA4T 1X01A 5GJVB 1KHIA 2DL3A 3META 2VXEA 1CSKA 2Y90A 3I55T 1GCQC 3RNJA 1WJRA 3G4ST 1ZA1B 2GGRA 3X24B 5GMKm 4JLIA 1M9SA 2MCNA 3A8GB 3M4YA 3JCMf 1PD1A 1G5VA 1ABOA 2ZPEB 3GNFB 5LJ3f 2P0KA 3OYNA 1JQQA 4M7DD 1FMWA 4AFSC 2J6KA 1OZ3A 3ME9A 3OMGA 1WLPB 1H3ZA 1KD1R 5EG2A 5GJWB 5LJ3e 4J9IA 2OI3A 3DLLA 2C0OA 1S72T 5A2QE 2L3RA 2RHUA 4DBFA 3QZ5B 2MAMA 2E64A 4LD6A 5IHKA 4A4HA 5L8RE 1ZUKA 1YJWT 2V1RA 1WX6A 2ENMA 5GAOp 4M75G 4M77D 2JUFA 3SWNB 1Q82R 2K2MA 2HSPA 2CDTA 4F16A 3A8MB 1VOMA 2NUPB 2ROTA 4C8QC 1YITT 4BUGA 1VQNT 4C5IA 4PJJA 2QGGA 1O75A 4R56A 1K8AC 3AT1B 4Y92A 3V7RA 2K5LA 2E41A 2RPNA 4FYXB 4E47A 2CYZB 2EGAA 3MP1A 3NPFA 2H8HA 1VQ5T 2KQWA 1K9MC 2V26A 2JN0A 1OZ2A 2BUDA 1LJOA 4JPBW 3VV0A 1YI2T 2CP5A 2MI6A 2X4XA 1M30A 1G8XA 4OB3B 2FRYA 4B9XA 1SHFA 2DD4A 2DL7A 3R6OA 5LJ3d 2LDMA 4CC7A 2OTLQ 3CC2Q 4PJLA 4RCCA 3BE3A 4BACA 4C92D 5LJ5e 1VYUA 5J26A 6AT1B 4C0DC 5LL6S 1VQ7Q 2JTEA 5IHNA 3NTKA 3M53A 1TUGB 1Y57A 2X4JA 1VQPQ 1M2VB 2XIDA 2RQRA 2FPDA 3VJPA 2QEXQ 5CR2A 3MEAA 3OYMA 1VQ8Q 5FRMA 2CREA 5EC7A 3OS5A 3RMSA 1MMGA 1M1KU 1FX7A 2EYQA 2L3QA 1XNIA 3CMET 1NEBA 2P0PA 3CCVT 4HCCA 2EQUA 2XU8A 2B86A 3I5RA 4OMMA 2YSQA 3PGGA 1IHVA 4PJOF 2CP2A 4N4HA 1WHGA 4JLGA 2VGNA 3I5SA 4FM4B 2OAWA 5IAYA 5GAN3 3H0HA 2OTLA 2EJGA 4Y28E 3JCMg 4Z88A 3RIRA 3EFRA 1ACMB 5GANj 5LJ3g 3Q1JA 4OF1A 4CI0C 1VQ7A 3CCQQ 2BZ8A 5I22A 3JB9D 3OSVA 1X2QA 2VUBA 5GMKi 2XDBA 1RLPC 4LN2A 2LJ0A 2YHTA 5KYXA 1AT1B 2QEXA 4KULA 2CZ6B 3AHUA 3JCMQ 1Q7YU 1VQ8A 4J9DA 3NHNA 1X69A 3I56T 1IGUA 3UATA 1PCXA 4RG2A 2OTJQ 2M16A 2RM4A 2LJ1A 1A0NB 4M75E 5C0MA 4E7KA 2X51A 4M78D 2RHZA 2HNIA 4PJOG 2LQ8A 2K9GA 1DJ7B 1N9RA 2KYMA 3NMZC 4E7HA 4OB2B 2EFIA 1UUEA 2A3LA 1RACB 1HD3A 2V8IA 2DTHA 2R57A 1D0ZA 4BE2A 1D1AA 3UDCA 2JS0A 4M4ZA 1KQ2A 2O4XA 1YBYA 3CMAQ 4Z02A 2IPOB 3CCQA 2LT4A 1UE9A 1KQSA 1BIBA 2YDLA 3OYYA 1HSQA 4LUEA 3JB9H 4QT7A 1JU5C 2RJEA 5J39A 2F1LA 3VUBA 1WIEA 4EMKB 1GL5A 1YN8A 2XHCA 3M5AA 3J7AF 2LVMA 2DXCA 4C0ZA 2RA2A 1NYFA 4GBQA 2OTJA 4HT8A 4DOVA 3X26B 2EJ9A 4VUBA 3OYEA 3M57A 1Q82U 3VYHB 2RMOA 1KSWA 2K2VA 4QQDA 2X3XD 5GANf 3L1AA 1QVFA 3CC7T 3HRUA 1VQ6Q 2DXTA 1PHTA 2X4YA 1OV3A 1M1KC 2JMCA 4DQ2A 2CKKA 2G6FX 4HT9A 4J6XA 3VRZA 4KUDK 4EDUA 3TSZA 3CMAA 4J6YA 4OMFB 2A0FB 2HKNA 3CCET 1X2KA 4PJOB 3LLRA 2YXYA 2CT3A 3PVQA 4LDXA 5HK3A 1BI1A 1WI7A 3M4GA 1CKBA 1VQ9T 4ELZC 3QDFA 1KFZA 3N5BB 5AT1B 1JJ2P 1OX8A 3JCMb 3OYFA 2KT8A 2DYBA 3I35A 3M9QA 2HSEB 4AFZC 1AD5A 4XQ3A 5FU7C 2LNHB 3UA6A 3SDZA 2QTVA 4XTUA 4XK8E 3RMQA 1I0CA 1W2BP 1VQMA 3M0TA 1AWXA 3UA7A 3I9QA 1H3HA 4C8QD 3C0CA 1VQ6A 2KROA 4RTZA 1I81A 1OU8A 4M75C 1Q7YC 2DPPB 2QTXA 3HKSA 1IZ6A 5A0GA 2WSEE 4II1A 2E4HA 5L23A 2CUDA 4KGZB 2LC4A 1SRMA 1V76A 1Y0MA 3V8LA 1R0CB 2NUTB 2YRDA 1M90R 2DMOA 1ZLMA 3HRSA 4M7AE 4XU3A 1RAGB 2VGMA 2YRVA 1AZGB 3INZA 5CQYA 5IN1A 3QWYA 4GLKA 3LGLA 3CXCP 3PVLA 2HAXA 1M8MA 4JJNK 1EFNA 4KGXB 2XG8D 2YUQA 3JCMh 2PTKA 1JXMA 1TOVA 1T0HA 4WF2A 4IKFA 4X9CA 4C5HA 2DLPA 3NFCA 1RAAB 2KRNA 1WXUA 2R5MA 3CEYA 1NM7A 1QVPA 4EMGA 3ZL7C 1Y96B 1O9SA 1Q81U 1NYGA 1I07A 4HCZA 3CCJQ 1X6GA 3M0QA 3EG2A 1S1NA 3EGXB 2EQIA 3VS0A 3LH0A 4J7IA 1QWFA 3V8JA 3CCLT 2J05A 5ECAA 1NLOC 4M7AA 4JUVA 2NWMA 5GANg 4TVRA 1OU9A 1MMDA 2K5FA 1TH7A 1PKSA 1K4US 1JJ2S 2DTIA 3S6WA 1K76A 1QKXA 3A98A 4OGEA 2JNGA 2FZKB 1VQ4Q 4FSXA 1WYXA 2RNAA 1AWWA 3RDVA 2CSQA 2J06A 1PSFA 3EH1A 1TXQA 1VQKQ 1BKBA 1QCFA 5D7UA 4F7UA 1HK9A 2HDAA 3OYJA 3TVTA 3MO8A 2FYKA 1VIFA 5CKHA 2WACA 3CD6A 3H9NA 2EVRA 2CP0A 2ESWA 4XTYA 3D7SB 1CKAA 3L2WA 3CCRQ 1SSHA 3OYBA 4M7DF 2HL5C 3A8OB 3CCUQ 3CCJA 4ZGDB 1I8FA 4PL6A 2XDDA 4FU6A 3UT1A 4RTTA 3CPWP 3NGPA 2ZPFB 1WHJA 3CC4T 2O88A 2CZ1B 1ZUUA 2V8KA 2J6FA 4A53A 1D3BA 3CXCS 1KC8U 4C8QA 3OYHA 3OY9A 1N6AA 1MMNA 1VQ4A 3VU3C 5FLXE 4M77F 3M54A 1PRMC 3GLXA 3TCJA 2ZZDA 3P8BB 1VQKA 1IREB 4OMPA 5GAOr 4M7AC 3TEEA 3URGA 3CCRA 1N8RR 4M7DG 5LJ5j 4D6WA 3CCUA 4A4GA 4LDUA 3ASKA 1TU0B 2F5TX 4KRTA 4MZPA 3OQ5A 3RKYA 1E6HA 5HCKA 2HZYA 2OTLT 1XQHA 3CC2T 5AYFA 2PUOB 3DLMA 4C92F 1WNLA 2BE9B 1ZX6A 4NOYA 1MUZA 1C1AA 3CQTA 2VVKA 4HVUA 1VQ7T 1HXDA 2DEQA 3PMTA 4MDWA 4QVDA 4XU0A 4BY6B 3GOXA 4KT0E 3JCMe 1VQPT 1Q81C 1GFCA 1FWZA 4M77G 3PT9A 4N4GA 3T9NA 4J6WA 2QEXT 2X3WD 1YNZA 3X28B 1FMVA 2ATCB 4RTVA 2HQHA 2XMFA 4J9BA 2DVEA 1VQ8T 2AHJB 5CVIA 7AT1B 2MWOA 3EFOA 2R5AA 2NUZA 4PFOA 4ZN3A 2SRCA 4C5EA 3BY7A 1M2OA 3BW1A 4FW2A 3L2VA 2QQRA 2GFAA 5GAN2 5C6SA 4J9CA 1NZ9A 2PVDB 5KYUA 3QG1A 2HQXA 3CPWS 4MMKA 4A54A 3RBBB 5FROA 2LCCA 3E9GA 2CZ0B 2P4TA 1PC0A 3L2ZA 4JS4A 2L0AA 5GMKj 5CKDA 4Q5WA 4N0AC 2BZXA 1UJ0A 1QP2A 4IIOA 4C92G 1YFNA 1GBRA 3P8DA 2EKOA 1GBQA 1UECA 3JB9F 1UDLA 4IUTA 1G83A 2LRQA 4PKCC 3MCAB 4ZN1A 3FDRA 3MP6A 4EMHA 2W0ZA 4M7DB 3JCMd 2KRSA 4NL2A 4M75D 4BD3A 2KNBB 3M58A 3QUIA 4FL6A 1SHGA 4FYWB 1Q86C 1OOTA 4IURA 2H3EB 2E5QA 3DB4A 4HVVA 3R6NA 4BE0A 1WPYA 4E7JA 3UWNA 1IO6A 4ORZA 5KYNA 3FC3A 4D8KA 4CRIA 2OTJT 1M27C 2DRKA 2XK0A 3CBPA 4C0FA 5GANh 4AFQC 3JSCA 2YT6A 3H8ZA 4M78F 1KC8C 1WQ7A 2RO0A 2DF6A 2KDSA 4DBRA 2ZPGB 4M77B 1NJIR 1OYXA 3MJXA 2HEQA 2W10A 1ZBXA 2K6DA 2QGFB 1MGQA 1G3TA 3FIFA 5D6YA 1G3YA 2RI3A 1VYVA 2CH4W 2PUKB 3EHRA 2B8AA 3TREA 1U1TA 2JTMA 4E7ZA 4E7LA 4RTUA 2KE9A 2EQKA 3HHTB 1YCYA 2O9VA 3X25B 3JB9G 1SPKA 2O4XB 2FZGB 1UEBA 2RJFA 3P8HA 1R8OB 1TS9A 2O31A 2RI5A 3H41A 3SWNA 1YJWQ 1M3BA 5GAMj 1K73C 2E6NA 4LUDA 2HBPA 4BI8B 3BFMA 2KBTA 2E3HA 5FW9A 1AOJA 4BDYA 2DA9A 1BCMA 2GBQA 3FRNA 3C94A 3SEMA 2QA4A 3QWXX 2HMAA 3SD4A 1SF9A 3V8KA 2FL7A 5FWCA 4C92B 3A1PA 1GFDA 4R0KA 1WQWA 2VASA 4JJBA 2GQIA 3FB9A 3JCMV 4QW2A 4M78G 2F5KA 1UGSB 1FYNA 2RJCA 2VV5A 2AKKA 1KQSP 5CKFA 2HD0A 4ZTJA 1BU1A 1W70A 3QPHA 4OMOA 3M0UA 3VS4A 2XDPA 2BKDN 2HCKA 1VQ6T 1BYMA 3CCST 5GAN5 4C5GA 3JCMP 2QG9B 4PLLA 2DZCA 3F70A 4X9DA 4XTZA 1RI0A 4YTLA 1XTDA 1B7TA 2K3YA 4O5VA 1M2VA 4HXJA 2K4YA 5CCAA 1QW1A 2K79A 1KK7A 4E2FB 2DEUA 2CGHA 4X34A 1YJWA 4X1VA 4V2SA 1TTHB 1ZSZB 3G7ZA 3LYIA 3THKA 3QJ6A 2QK0A 3G71Q 2COWA 1QVFP 1AWOA 4XAXB 1U06A 1X6BA 2KEAA 2LZ6B 3FEOA 2JW4A 1U5SA 4MMLA 3V7CA 1I4K1 2ZPHB 1YJNQ 2YLBA 5FU6C 4OP0A 1QWEA 3BDUA 1K8AR 2CZ7B 4L5GA 1KD1U 1VQ5A 4M75A 5IXFA 2FPEA 3REBB 3SWNC 1H641 4C8QF 2QASA 1YI2A 3MEWA 3VS1A 1K9MR 2M9UA 2A08A 4D8DA 3EGDA 4RTYA 1GRIA 2JM9A 1B34B 1K0SA 2I0NA 1M3AA 5GAMf 4M7AD 2K3XA 1BCOA 3QYHB 4C0GA 2DL4A 4IIMA 2EYXA 1RADB 1VQMQ 5M9OA 4A4KA 1ARKA 3ULRB 3L2UA 2L2PA 4M78B 3OYCA 3QIIA 4LDYA 1Q86R 1M5Q1 4O6JA 2K5IA 1M1FA 2KSSA 1I1JA 1PSEA 4IUPA 2LNVA 1NEGA 5GANe 3G71A 1QP3A 1WZOA 3JV3A 4UC4A 2A37A 2E65A 3RUXA 2GCXA 2KYBA 1YJNA 3ER0A 1TG0A 2KGTA 3HRTA 1UHFA 4ELYC 2CSIA 1RUWA 4ATOA 2LT1A 2ABLA 2RK2A 1JRIA 3CBMA 5HK0A 4PLIA 2RQWA 3OYGA 3CCJT 1D1CA 2KI7A 2MOXA 4AT1B 3QZ9B 1ZBJA 2EYZA 1X6OA 4HCBA 4E7IA 4J9EA 1RL2A 2I2LA 2FEIA 1JXOA 5CKBA 3FLGA 4FW1A 4IUVA 1WFWA 2DBMA 1NJIU 4FYYB 2CP6A 2C06A 4ZGEB 4QKUA 3L2RA 1YIJQ 4WCIA 4AG2C 2HBWA 4ZGJB 2YWWA 3M0PA 1R0BG 4JJDA 5GANd 4PJOE 2IVWA 3VYGA 5CIUA 3OYIA 1KIKA 2DBKA 1V29B 1RAEB 3JB9J 3EG9B 1OX9A 5DLQE 3HFOA 2VB6A 2HQEA 3CCMQ 4QQGA 2EGCA 4F7UB 2EWNA 1K1ZA 2D6FA 3HTRA 1OPKA 4ZNXA 2X4WA 3NTIA 3CCRT 2RH2A 4OGCA 3GP8A 2DXBA 4XTWA 2D0QB 2DL8A 3EH2A 5FRNA 2D0NA 4KH1B 4Z89A 1OEBA 1QVGA 3CD6Q 3SB2A 2QQBA 2KY9A 3OW2A 4DEYA 2KAFA 1G2BA 4RTWA 4JRIA 3L42A 4FYVB 4MDXA 4EPCA 3MEUA 1VYTA 4PJOA 1KD1C 4AMCA 1YIJA 3O5ZA 2DVJA 1W4SA 2ED0A 2COYA 3G6EQ 3LH5A 4C8QB 1TSFA 5GAMg 1AHJB 2D9TA 4DEXA 1Y7XA 1SEMA 3IQLA 2IG0A 3H0FA 4LE9A 4KBMB 2MWPA 3OS2A 3VS6A 3JCMW 2K7AA 2OX7A 3TU4K 2F2XA 1IRXA 2QAZA 1Q82C 4ESRA 2RN8A 3CCMA 5FWBA 3OS1A 2AZSA 2M0YA 2O2OA 5IH2A 4F17A 2BIVA 4CC3A 4BI4A 2FG0A 2GQVA 5KYYB 5GAOq 5DY9A 4IUUA 1BI3A 2O9SA 3C12A 1N27A 3M56A 2D1XA 1WHLA 2VC8A 1NG2A 2RF0A 1W2BS 1Y71A 4PFPA 1LCKA 4ME7A 4A4EA 4PK4A 1PWTA 4C0DB 5LJ3j 3CBOA 2NUTA 4GY5A 1M1KR 3KBGA 1YWOA 3CPFA 2DM1A 5CO7A 2DETA 2DYIA 4OMLA 2PVGB 2CUBA 3G6EA 2F2WA 1YWPA 1JO8A 3E2UA 2JT4A 4J8OA 3SHWA 2MPXC 3QJYA 5CKEA 3KXTA 2EIFA 3RKWA 2KVQG 2L5QA 4J7FA 3PMIA 3QHSA 1N9SA 2M1HA 4LDWA 1WHKA 3GF5A 1EZZB 2RQVA 3GNGA 2KRMA 3L2QA 1D0XA 1FMKA 5A0DA 3QDRB 2DD5A 2F69A 2GFUA 3OSSC 2DE0X 1UGVA 2NYSA 2ZGWA 2L3PA 4PJOC 1UGRB 1QKWA 1V1CA 1IXDA 2FZCB 2LX7A 2AT1B 2KXDA 3WVEB 4N0AA 1Z9ZA 5KYWA 3JRZA 3MP8A 3RKXA 3EGXA 3UF4A 3DB3A 4BE1A 3E1SA 2K3BA 1UHCA 2WSCE 1OPLA 4K11A 4MZMA 4QVCA 1Q7YR 5GAN6 1VQLQ 2EPDA 2EQJA 2JM8A 4NL3A 1B3QA 4FT4A 1QMCA 2O01E 2FVUA 3LW5E 4HCKA 4EIKA 2EW3A 4XTXA 3CPWA 3QXEB 3H0IA 4Z8AA 3TSWA 5GMKh 4LDVA 2KMTA 2SEMA 1VA7A 1BI2A 1YHQQ 4L59A 4XU1A 4HKEA 1MNDA 2RQUA 5CK9A 4Y91A 3S3NA 4MZTA 4ZTFA 1YJ9Q 1EX4A 2L8DA 4AG1C 1NBEB 2JMAA 2ECZA 2XKOC 1BBZA 2GTJA 1M90U 2EYWA 5CQXA 2DZ9A 5IT9E 4RTXA 2QQAA 2RI2A 3CCLA 2EKHA 4RG8A 3CC4Q 2COZA 1MV3A 1VQLA 1VQOQ 4HVWA 2LP5A 1N5ZA 2DKGA 2ZPBB 1U3OA 2VXFA 1SRLA 5DLOA 5FU6B 1IHWA 2AIRB 1GXIE 2CP7A 2Z0WA 3X20B 2YUOA 2RD1A 2DIGA 2DNUA 2IIMA 4OMNA 3VRYA 2M02A 3E19A 4JRPA 1SG5A 3S3MA 5HY6A 4PJNA 1RAFB 2PQWA 2YRCA 3G1JA 2DIQA 4PJMA 3CCQT 5GAN4 1YHQA 1U8RA 1LNXA 2ZCFB 2JVVA 3OA6A 1NLPC 3LWHA 3FJPA 5GAOn 5KYXB 3J80E 3MHXA 4KUIA 2RB6A 3V7SA 2E1HA 2KR3A 1YJ9A 4J5YA 2QA4Q 1ABQA 3PIOA 1BB9A 1UGPB 1W1FA 1YCSB 5GAMh 1E6GA 5LJ5f 3I55Q 2MYSA 3G4SQ 3C4SA 4JZ4A 3CC4A 2OAUA 4RUGA 3LX7A 1VQOA 2Y4YA 2CP3A 1X43A 4B6MA 1TUDA 1JEGA 2FPFA 3QBYA 1WHMA 4F04B 2X35A 1ZSGA 4QVZA 3EG3A 2FRWA 1S72Q 3G71T 3EGUA 4M7DE 2E10A 1HJDA 3CMAT 2E6ZA 4DBQA 3O8VA 3PE0A 2H3JA 5FU7B 1QQJA 1YJNT 5IHIA 2FHDA 3MPUB 1KQ1A 2NUPA 2GTOA 2QDYB 1WA7A 2P4RA 1IGQA 2CT4A 1G3SA 1VQNQ 1K9AA 1YITQ 1PD0A 4RCBA 2E5KA 4M75B 1W6XA 3I55A 2C0IA 2DAQA 1U1SA 3G4SA 4JJCA 1TUCA 4M77E 5D6XA 1R77A 1I5OB 3CC2A 1UJYA 1VQ5Q 4M7AF 1UB4A 1IB8A 1UTIA 3EGDB 5LJ5d 3JB9I 2QQ9A 1VQMT 1XJWB 4M7DA 1YI2Q 1ZQ1A 3ZFJA 5GMKe 1VQPA 3VUZA 1WDXA 3C95A 1QCOA 3PIPA 1NPPA 2K57A 1Q95G 2LCSA 1S72A 1VUBA 4FSSA 5I2MA 3M55A 1WXBA 1M90C 1JB0E 1Q81R 1MV0B 3KUFA 5KCHA 2J6OA 3OYDA 1WJSA 1M3CA 1N8RU 3RERA 3EG1A 1LOJA 4F7UF 2LQKA 1JBMA 1G3WA 4P5NA 4DBHA 1K0XA 1T3LA 2DERA 3DKMA 4BY6C 4M77A 4C92E 4BI3A 3PTAA 1VQNA 3QKJA 3VS3A 4PNOA 1YITA 3JCMX 4R55A 2KXCA 1UGQB 2QXFA 2FB7A 3CMEQ 1TWBA 3OYAA 4DA4A 1KJWA 3UPUA 2ZPIB 3MEVA 3CCVQ 2FO0A 5I11A 3REAB 2DJZA 4LD9K 4L6V5 4XTVA 3OS0A 1WHHA 2QI2A 4M7AG 1AZEA 2V8JA 2RHXA 3EAEA 4PJOD 3E9FA 3ZEHA 3QSUA 2RHIA 5LJ5g 1PM3A 2L89A 2VWFA 1YIJT 2P0QA 3S3OA 2RQTA 1GCPA 1PNJA 3EG0A 4RMOA 2QYZA 3HPWA 1T3SA 2EGEA 4C92A 1BK2A 5GAN7 2DL5A 1UG1A 1Y07A 4F7UG 5CAIA 3OMCA 2JOYA 1M4ZA 3VS2A 5GAMe 2A36A 2CS7A 3CCMT 4N4IA 2OJ2A 4JRQA 1I5LA 2LQWA 1MHNA 1OI1A 1WXTA 1AVZC 3M0RA 3JCMJ 4M7DC 2BE7D 2M51A 2JZ2A 1BI0A 3I56Q 2YUNA 3CMEA 1KC8R 2L3SA 2EJFA 3VS5A 1KQSS 3CCVA 1OQKA 4RKUE 2LTOA 3CCSQ 1ZA2B 1AEYA 4BDZA 3CD6T 4E6RA 1SSFA 4OVAA 4JRKA 1M8VA 5HKCA 3LGFA 4C8QG 3J81E 1ZSZA 3OB9A 2M0OA 4M77C 1MNEA 4CC4B 3G6ET 5I2SA 4M78E 4OB1B 4J9FA 2DXUA 1HYOA 4GLMA 5I21A 1K73R 1NPRA 3WXMB 5IXBA 2KT1A 4M7AB 2P84A 4DOWA 1QVFS 1VIEA 1AWJA 1QVGP 2PNIA 4IUQA 5GAMd 5DM7R 4EMKA 3OW2P 3GPLA 3OYKA 1VQ4T 1D1BA 3U23A 2E3IA 4JZ3A 4FT2A 4OMQA 1RLQC 1YP5A 1VQKT 2LX9A 3I56A 2MMPA 1B34A 3WVDB 2HKQB 4BB7A 2PZ1A 3CCSA 1N8RC 4FCYA 3BDLA 1RAIB 4C92C 3A8HB 2MF2A 3HL8A 1UFFA 4M78A 4LXCA 2JS2A 1RABB 2YLCA 2RHYA 1E7OA 3CC7Q 3CCUT 1ZHIA 1JJ2A 1FXXA 2XI9A 1KG1A 4J83A 2QQSA 3OBWA 2EQMA 3PFSA 2PU9B 2C0TA 4QQ6A 1X75C 2YUPA 1LPLA 5KE3A 3RR6A 1T0JA 3A5ZB 4B9WA 2DO3A 1NE8A 2JTFA 1H8KA 3LWIA 2JJ9A 2E12A 1W2BA 3CCEQ 1EIFA 4E7SA 1B07A 5LJ3h 4WTOB 1D3BB 2AKLA 1SKUB 1XOVA 1QCNA 4HA8A 2DK3A 1PRLC 4A4FA 1ZSZC 1VQ9Q 3A8LB 3SFMA 4F7UE 4J9GA 1Z9QA 2XICA 5KE2A 2HL3A 1C0MA 2EYYA 2RK1A 3PNWC 8ATCB 1WJQA 3HFNA 1C6VX 4KGVB 5KYWB 4JS5A 1QLYA 1KHCA 1WGSA 3VS7A 1LVKA 2DRMA 4F14A 2LMJA 1X27A 2ROLA 1VQLT 3HSBA 5GAOl 2WSFE 1RI9A 3CXCA 4PFZA 4EMKC 3CC7A 2X9HA 1J3TA 2V1QA 3HP9A 2D8JA 2AK5A 4FIBA 2MK5A 2Y4XA 2DTOA 4XU2A 1K8AU 3H6ZA 1P92A 3VKIA 2BZYA 1QVGS 2NLUA 4KH0B 1GCQA 5GMKl 3EG9A 2KK4A 3OW2S 3ZBDA 4C8QE 3EFSA 4A63B 3CCEA 2XD0A 9ATCB 2DX1A 1YHQT 1K9MU 3MKDA 5GAN8 4M78C 3GBQA 1H92A 2QDLA 1RAHB 4OB0B 2A28A 3OYLA 5LJ5h 3M59A 4NS5A 2AZVA 2D8HA 1MMAA 1VQ9A 1M1GA 2LCLA 2PVOB 2A7YA 2ED1A 2R58A 1YJ9T 3KFVA 2RJDA 3OBYA 3QO3A 2MIOA 3JCMc 3GIBA 1Q86U 1F1BB 2JXBA 3NTHA 5A0LA 8AT1B 1Y96A 3EFOB 1D09B 1ZUYA 1NJIC 3TQ7P 1VQOT 1PG5B 2EAYA 3RESA 2G3RA 2DJQA 5KYUB 2GNCA 1D0YA 2CH4A 2GF7A 5KH6A 2LQNA 3FJ5A 3CCLQ 2DFUA 5KCOA 1BIAA 4LNPA 2DILA 4CC2A 5D6WA 1OULA 4AFUC 5KYYA
chains in the Genus database with same CATH topology
4WF2A 4JDSA 4M75F 1B34B 4QVZA 3JAME 4IKFA 4X9CA 4C5HA 5GAOm 3NFCA 5GAMf 4M7AD 5J3BA 2K3XA 3QYHB 2R5MA 3CEYA 4C0GA 3G71T 1QVPA 2VYTA 4EMGA 1Y96B 4M7DE 1O9SA 1Q81U 1K73U 2E10A 2E70A 3QYGB 4A4KA 2E6ZA 5M9OA 2QA4T 3O8VA 3CMAT 1X01A 3L2UA 1KHIA 4HCZA 3META 2VXEA 2H3JA 4M78B 5FU7B 3OYCA 2Y90A 3QIIA 4LDYA 3I55T 1YJNT 1M5Q1 2FHDA 4O6JA 2K5IA 1KQ1A 1M1FA 2KSSA 1WJRA 3G4ST 3X24B 1PSEA 2QDYB 4IUPA 3LH0A 2LNVA 4J7IA 4JLIA 5GMKm 1M9SA 3CCLT 3V8JA 3A8GB 3M4YA 5GANe 1G3SA 3JCMf 3G71A 4M7AA 1G5VA 4RCBA 2ZPEB 4JUVA 1QP3A 3GNFB 5LJ3f 2P0KA 3OYNA 4M7DD 4M75B 4UC4A 2E65A 3RUXA 2GCXA 5GANg 4TVRA 3I55A 2K5FA 1TH7A 1YJNA 2DAQA 3ER0A 1OZ3A 2DTIA 1U1SA 3S6WA 3G4SA 1JJ2S 3HRTA 2JNGA 3ME9A 3OMGA 4M77E 4OGEA 1H3ZA 5EG2A 5LJ3e 5D6XA 4ELYC 4FSXA 3DLLA 3CC2A 1S72T 4M7AF 1UB4A 5A2QE 2L3RA 4ATOA 2RHUA 1PSFA 2LT1A 5LJ5d 2RK2A 1BKBA 4LDXA 1JRIA 2QQ9A 3CBMA 3QZ5B 5HK0A 3JB9I 1VQMT 4PLIA 4M7DA 2MAMA 1ZQ1A 2E64A 4F7UA 3OYGA 1HK9A 3ZFJA 5GMKe 4LD6A 3CCJT 4A4HA 3OYJA 1VQPA 3QZ9B 3VUZA 5L8RE 1YJWT 3MO8A 2FYKA 1VIFA 3C95A 5CKHA 5GAOp 4M75G 3PIPA 2WACA 3CD6A 1NPPA 1X6OA 2K57A 2JUFA 4M77D 1VUBA 4E7IA 1S72A 4HCBA 3SWNB 4XTYA 1RL2A 2I2LA 5I2MA 3M55A 3L2WA 3A8MB 5CKBA 3FLGA 1YITT 1JB0E 4C8QC 3KUFA 4BUGA 5KCHA 3OYBA 3OYDA 1WJSA 4IUVA 1N8RU 4C5IA 3RERA 4M7DF 1O75A 1LOJA 4F7UF 4R56A 2LQKA 3A8OB 1K8AC 1NJIU 2C06A 3V7RA 4ZGEB 3L2RA 2K5LA 3CCJA 1JBMA 1G3WA 4ZGDB 4P5NA 2E41A 1I8FA 4PL6A 2XDDA 4FU6A 3UT1A 3DKMA 4E47A 2ZPFB 4BY6C 4ZGJB 2CYZB 3MP1A 4M77A 4C92E 1VQ5T 4BI3A 3CC4T 2KQWA 3PTAA 1VQNA 3QKJA 1YITA 4PNOA 5GANd 4PJOE 2IVWA 3VYGA 2CZ1B 5CIUA 3JCMX 1K9MC 3OYIA 2JN0A 2V8KA 1V29B 4R55A 1OZ2A 2BUDA 1LJOA 4A53A 1UGQB 3JB9J 2QXFA 2FB7A 1D3BA 3CXCS 3VV0A 5DLQE 3OYAA 4DA4A 1YI2T 1KC8U 4C8QA 3UPUA 3OYHA 2MI6A 2X4XA 2ZPIB 3MEVA 3HFOA 2HQEA 4QQGA 4OB3B 3OY9A 2DJZA 1N6AA 4B9XA 1VQ4A 3VU3C 4L6V5 4XTVA 2EWNA 4M77F 5FLXE 3M54A 4F7UB 3OS0A 2DD4A 2QI2A 3R6OA 5LJ3d 2LDMA 2D6FA 4M7AG 4RCCA 3GLXA 3TCJA 2ZZDA 3P8BB 4BACA 4C92D 2X4WA 5LJ5e 3NTIA 5J26A 2V8JA 2RHXA 3CCRT 1VQKA 2RH2A 3EAEA 4OGCA 4C0DC 3GP8A 2DXBA 4PJOD 1IREB 4XTWA 5LL6S 3NTKA 3E9FA 3M53A 5GAOr 2D0QB 3ZEHA 3QSUA 2RHIA 5LJ5g 2L89A 1YIJT 5FRNA 2X4JA 2XIDA 4M7AC 4LD9K 3TEEA 2P0QA 3S3OA 3URGA 3VJPA 1QVGA 3SB2A 2QQBA 2KY9A 5CR2A 3OW2A 4RMOA 2KAFA 3MEAA 4JRIA 3L42A 3CCRA 3OYMA 4MDXA 3HPWA 5FRMA 4EPCA 4C92A 3OS5A 5GAN7 3RMSA 4M7DG 5LJ5j 3MEUA 5CAIA 1Y07A 4F7UG 1M1KU 4D6WA 4PJOA 1FX7A 3OMCA 3CCUA 1KD1C 2EYQA 2JOYA 4A4GA 1XNIA 3CMET 1M4ZA 4LDUA 3ASKA 1YIJA 5GAMe 1W4SA 2P0PA 3CCVT 2F5TX 2CS7A 3CCMT 4MZPA 4N4IA 1I5LA 4JRQA 3OQ5A 4HCCA 3RKYA 2EQUA 1MHNA 1OI1A 2XU8A 4C8QB 5GAMg 3JCMJ 1AHJB 1XQHA 2D9TA 2OTLT 3CC2T 4M7DC 1Y7XA 3PGGA 5AYFA 2PUOB 3DLMA 4C92F 1WNLA 2JZ2A 4PJOF 4NOYA 2IG0A 4N4HA 1BI0A 4KBMB 1VQ7T 1HXDA 2MWPA 3OS2A 3CMEA 2DEQA 3PMTA 4JLGA 4MDWA 3JCMW 3TU4K 2EJFA 4QVDA 1KQSS 4XU0A 2VGNA 4FM4B 1Q82C 5IAYA 4BY6B 3CCVA 3GOXA 3CCMA 4KT0E 4RKUE 2LTOA 3JCMe 3OS1A 5GAN3 1VQPT 1Q81C 1FWZA 4M77G 3PT9A 4N4GA 4BDZA 2BIVA 3T9NA 2OTLA 4J6WA 4BI4A 2GQVA 2EJGA 2QEXT 3CD6T 5GAOq 1SSFA 4OVAA 4JRKA 4Y28E 3JCMg 5DY9A 4IUUA 3X28B 3RIRA 1M8VA 1BI3A 3EFRA 2DVEA 5GANj 1VQ8T 2AHJB 5CVIA 5HKCA 3C12A 5LJ3g 3Q1JA 3LGFA 4OF1A 1N27A 3M56A 4CI0C 1VQ7A 4C8QG 3JB9D 3OSVA 2VC8A 2MWOA 2VUBA 3J81E 2R5AA 3OB9A 5GMKi 2M0OA 4ZN3A 1W2BS 4M77C 4C5EA 3BY7A 2XDBA 1Y71A 3BW1A 3L2VA 2YHTA 4ME7A 2QQRA 2GFAA 4M78E 4A4EA 5I2SA 4OB1B 5C6SA 4KULA 5GAN2 3G6ET 2QEXA 4C0DB 2CZ6B 1NZ9A 2PVDB 5LJ3j 2DXUA 3AHUA 3QG1A 3JCMQ 1Q7YU 1VQ8A 2HQXA 5I21A 3CPWS 3CBOA 4MMKA 1NPRA 3WXMB 4A54A 4GY5A 3KBGA 5FROA 2LCCA 3CPFA 3E9GA 4M7AB 2CZ0B 3I56T 2P4TA 5CO7A 4DOWA 1QVFS 1VIEA 3L2ZA 4JS4A 4RG2A 2M16A 2RM4A 4IUQA 5GAMd 5GMKj 5DM7R 4M75E 4EMKA 2PVGB 5CKDA 3G6EA 3GPLA 3OYKA 1VQ4T 4Q5WA 4J8OA 4N0AC 5C0MA 1QP2A 4E7KA 3QJYA 4M78D 4C92G 2RHZA 5CKEA 2EIFA 3RKWA 2HNIA 4FT2A 3KXTA 4PJOG 3P8DA 2LQ8A 2EKOA 1DJ7B 1N9RA 2KVQG 2L5QA 4E7HA 3PMIA 4J7FA 2LX9A 3QHSA 4OB2B 1VQKT 2EFIA 3I56A 1N9SA 3JB9F 2MMPA 2M1HA 4LDWA 4IUTA 3GF5A 1B34A 3WVDB 2LRQA 2A3LA 3GNGA 3L2QA 4PKCC 4BB7A 3MCAB 4ZN1A 3FDRA 5A0DA 3MP6A 4EMHA 3CCSA 2V8IA 4M7DB 2DTHA 3JCMd 1N8RC 2R57A 2DD5A 2F69A 2GFUA 3BDLA 3OSSC 3QDRB 3A8HB 4M75D 4NL2A 3M58A 4BD3A 3QUIA 4C92C 4BE2A 2MF2A 2ZGWA 4PJOC 1UGRB 3HL8A 3UDCA 4FL6A 1KQ2A 4M78A 2O4XA 1Q86C 1YBYA 4IURA 4Z02A 2E5QA 3DB4A 3WVEB 2YLCA 4N0AA 2RHYA 3CCQA 4BE0A 1WPYA 2LT4A 3JRZA 3MP8A 4E7JA 3RKXA 1KQSA 3UWNA 3CCUT 1ZHIA 1BIBA 1JJ2A 1FXXA 2XI9A 3FC3A 3OYYA 2QQSA 4J83A 1KG1A 4CRIA 3OBWA 2EQMA 2OTJT 3DB3A 4BE1A 3E1SA 3PFSA 3JB9H 2PU9B 4QQ6A 2XK0A 3CBPA 1X75C 4C0FA 5GANh 2WSCE 3JSCA 2RJEA 5KE3A 5J39A 3A5ZB 3H8ZA 4M78F 4MZMA 3VUBA 4B9WA 4QVCA 1KC8C 5GAN6 4EMKB 1VQNT 2DO3A 1WQ7A 2XHCA 2RO0A 3M5AA 1NE8A 2KDSA 2EQJA 2ZPGB 3J7AF 4NL3A 2LVMA 4M77B 2JTFA 2DXCA 1OYXA 3LWIA 4C0ZA 2E12A 1W2BA 2RA2A 1EIFA 2OTJA 1ZBXA 4FT4A 1MGQA 1G3TA 3FIFA 5D6YA 5LJ3h 4HT8A 4DOVA 2O01E 1G3YA 1D3BB 3X26B 2FVUA 2RI3A 3LW5E 2PUKB 2EJ9A 4VUBA 1XOVA 3OYEA 2B8AA 4HA8A 2DK3A 3M57A 1U1TA 4XTXA 3TREA 3VYHB 3CPWA 1Q82U 4A4FA 3QXEB 2JTMA 3A8LB 3SFMA 4F7UE 4E7LA 2K2VA 2EQKA 2XICA 4QQDA 3HHTB 1YCYA 3X25B 5KE2A 5GMKh 5GANf 4LDVA 3JB9G 3L1AA 1Q7YC 1QVFA 2KMTA 3CC7T 2O4XB 1BI2A 2RK1A 3HRUA 3PNWC 1UEBA 2RJFA 3P8HA 1R8OB 3SWNA 2RI5A 1WJQA 3HFNA 5GAMj 4L59A 1K73C 2DXTA 2X4YA 4JS5A 2E6NA 1M1KC 2HBPA 1KHCA 3BFMA 4XU1A 1WGSA 4BI8B 4DQ2A 2CKKA 4HT9A 4HKEA 4J6XA 4BDYA 1VQLT 3HSBA 5CK9A 5GAOl 4Y91A 3S3NA 4KUDK 3FRNA 3C94A 4MZTA 4EDUA 2L8DA 2WSFE 3CMAA 2QA4A 4ZTFA 3CXCA 4EMKC 3SD4A 3CC7A 2XKOC 4J6YA 4OMFB 3V8KA 2FL7A 3CCET 4C92B 1M90U 3HP9A 1WQWA 5CQXA 4PJOB 2DZ9A 3LLRA 4FIBA 5IT9E 2Y4XA 2DTOA 4XU2A 2QQAA 2RI2A 3FB9A 1K8AU 3H6ZA 1P92A 3VKIA 3JCMV 4QW2A 4RG8A 5HK3A 3CCLA 1QVGS 4M78G 2F5KA 1BI1A 2NLUA 1UGSB 3M4GA 1VQLA 5GMKl 2RJCA 2KK4A 2VV5A 3OW2S 5CKFA 2ZPBB 2DKGA 2HD0A 4ELZC 4ZTJA 2VXFA 3ZBDA 1VQ9T 3N5BB 5FU6B 4C8QE 5DLOA 3EFSA 1GXIE 3QPHA 3JCMb 3OYFA 3CCEA 2XDPA 2BKDN 3M9QA 1VQ6T 2XD0A 3X20B 1BYMA 2RD1A 1YHQT 1K9MU 2DIGA 4XQ3A 5GAN8 4M78C 5FU7C 5GAN5 3CCST 4C5GA 3JCMP 4OB0B 4PLLA 3E19A 3SDZA 3OYLA 4JRPA 5LJ5h 3M59A 2DZCA 3S3MA 3F70A 4X9DA 4XTUA 4NS5A 4XTZA 1RI0A 5HY6A 4YTLA 1XTDA 4XK8E 1M1GA 3RMQA 2LCLA 2PVOB 1VQ9A 2A7YA 2K3YA 2PQWA 2R58A 1YJ9T 4O5VA 1VQMA 2RJDA 2DIQA 3OBYA 2K4YA 3CCQT 3QO3A 4C8QD 5CCAA 1QW1A 1VQ6A 1I81A 4M75C 2CGHA 3JCMc 5GAN4 4X34A 2DPPB 1U8RA 2QTXA 1YJWA 1YHQA 1LNXA 3HKSA 1Q86U 3GIBA 2ZCFB 2JVVA 3OA6A 3NTHA 5A0LA 4V2SA 1Y96A 3LWHA 1IZ6A 3FJPA 3G7ZA 3LYIA 5A0GA 1NJIC 2WSEE 3QJ6A 5GAOn 4II1A 3J80E 1VQOT 3MHXA 4KUIA 2RB6A 3V7SA 2E1HA 2EAYA 4XAXB 1YJ9A 2LC4A 3FEOA 4J5YA 3RESA 2G3RA 4MMLA 3V7CA 3PIOA 1I4K1 1UGPB 3V8LA 5GAMh 2ZPHB 5LJ5f 2YLBA 2GF7A 5FU6C 4OP0A 5KH6A 3HRSA 3BDUA 3C4SA 2CZ7B 4L5GA 4M7AE 4XU3A 2YRVA 2VGMA 1KD1U 3INZA 5IN1A 5CQYA 1VQ5A 4M75A 4GLKA 3CC4A 3LGLA 2OAUA 3LX7A 1VQOA 2HAXA 5KCOA 2Y4YA 4JJNK 3SWNC 1BIAA 1H641 3QBYA 2XG8D 4C8QF 1YI2A 3MEWA 5D6WA 3JCMh 1M90C 2M9UA 2X35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GY5 A;  4BDY A;  3OYH A;  2X4X A;  4QVZ A;  3MEV A;  2LCC A;  3E9G A;  5FRO A;  4IKF A;  2HQE A;  3S3N A;  4QQG A;  4C5H A;  3OY9 A;  4EDU A;  2L8D A;  4ZTF A;  2K3X A;  4B9X A;  2R5M A;  3CEY A;  4RG2 A;  3OS0 A;  3SD4 A;  2M16 A;  4IUQ A;  2VYT A;  2LDM A;  5M9O A;  3O8V A;  3OYK A;  4BAC A;  4Q5W A;  3L2U A;  2X4W A;  4HCZ A;  3NTI A;  3MET A;  5J26 A;  2RHX A;  5C0M A;  4E7K A;  3LLR A;  3EAE A;  3OYC A;  3QII A;  2RI2 A;  2FHD A;  2RHZ A;  3H6Z A;  3NTK A;  3E9F A;  4QW2 A;  3P8D A;  3ZEH A;  2RHI A;  2EKO A;  2F5K A;  1WJR A;  4E7H A;  2NLU A;  3PMI A;  2L89 A;  2RJC A;  2EFI A;  4IUP A;  5FRN A;  3LH0 A;  2M1H A;  4IUT A;  4ZTJ A;  3S3O A;  2LRQ A;  3L2Q A;  1G5V A;  3FDR A;  3MP6 A;  3OYF A;  2P0K A;  3OYN A;  2XDP A;  2R57 A;  2BKD N;  3M9Q A;  2GFU A;  3BDL A;  3MEA A;  3L42 A;  4UC4 A;  4BD3 A;  3OYM A;  4BE2 A;  5FRM A;  2DIG A;  2DAQ A;  3MEU A;  4C5G A;  4FL6 A;  4PLL A;  2O4X A;  3OMC A;  1OZ3 A;  3S6W A;  4A4G A;  1XNI A;  3ME9 A;  3OMG A;  2E5Q A;  3DB4 A;  3ASK A;  4IUR A;  4Z02 A;  3OYL A;  2RHY A;  4BE0 A;  3S3M A;  1H3Z A;  3F70 A;  5D6X A;  3MP8 A;  4NS5 A;  1RI0 A;  4E7J A;  3UWN A;  4N4I A;  2K3Y A;  2R58 A;  2PQW A;  3OQ5 A;  2L3R A;  2EQU A;  2RJD A;  2DIQ A;  1OI1 A;  2QQS A;  1MHN A;  2RHU A;  4CRI A;  3FC3 A;  2EQM A;  3DB3 A;  4BE1 A;  2D9T A;  3PFS A;  4QQ6 A;  2XK0 A;  3DLM A;  4PLI A;  4X34 A;  2JZ2 A;  5KE3 A;  2RJE A;  5J39 A;  3OA6 A;  3H8Z A;  3OYG A;  2IG0 A;  4N4H A;  3NTH A;  4LD6 A;  4B9W A;  4A4H A;  3OYJ A;  2MWP A;  2RO0 A;  3LYI A;  3OS2 A;  3PMT A;  3MO8 A;  3QJ6 A;  2EQJ A;  4II1 A;  2LVM A;  2JTF A;  2WAC A;  5IAY A;  1OYX A;  3GOX A;  4E7I A;  3OS1 A;  2LTO A;  3FEO A;  2G3R A;  4N4G A;  3L2W A;  3FLG A;  2BIV A;  4BDZ A;  5D6Y A;  3KUF A;  5KCH A;  3OYB A;  3OYD A;  1WJS A;  4IUV A;  4C5I A;  1SSF A;  4OVA A;  2RI3 A;  4IUU A;  2GF7 A;  5KH6 A;  3OYE A;  3L2R A;  2B8A A;  3Q1J A;  3LGF A;  3C4S A;  1N27 A;  4A4F A;  2YRV A;  5IN1 A;  4PL6 A;  2MWO A;  3LGL A;  4E7L A;  4FU6 A;  2R5A A;  3OB9 A;  2EQK A;  3LX7 A;  2M0O A;  4QQD A;  3UT1 A;  5KCO A;  4C5E A;  5KE2 A;  3L2V A;  3MP1 A;  2O4X B;  3PNW C;  3QKJ A;  3QBY A;  2RJF A;  3P8H A;  2QQR A;  2GFA A;  4A4E A;  2RI5 A;  1WJQ A;  5C6S A;  5CIU A;  3MEW A;  3OYI A;  5D6W A;  4L59 A;  2X4Y A;  1OZ2 A;  2BUD A;  2E6N A;  2HQX A;  1KHC A;  1WGS A;  2X35 A;  3OYA A;  2CKK A; 
#chains in the Genus database with same CATH topology
 4ANJ A;  3M0S A;  4JDS A;  2J7I A;  4M75 F;  3JAM E;  2VKN A;  5GAO m;  2EBP A;  1PKT A;  2LJ3 A;  5J3B A;  4J9H A;  2VYT A;  2ZAE A;  3EHQ A;  2BTT A;  2F2V A;  2E70 A;  3QYG B;  1K73 U;  2QA4 T;  1X01 A;  5GJV B;  1KHI A;  2DL3 A;  3MET A;  2VXE A;  1CSK A;  2Y90 A;  3I55 T;  1GCQ C;  3RNJ A;  1WJR A;  3G4S T;  1ZA1 B;  2GGR A;  3X24 B;  5GMK m;  4JLI A;  1M9S A;  2MCN A;  3A8G B;  3M4Y A;  3JCM f;  1PD1 A;  1G5V A;  1ABO A;  2ZPE B;  3GNF B;  5LJ3 f;  2P0K A;  3OYN A;  1JQQ A;  4M7D D;  1FMW A;  4AFS C;  2J6K A;  1OZ3 A;  3ME9 A;  3OMG A;  1WLP B;  1H3Z A;  1KD1 R;  5EG2 A;  5GJW B;  5LJ3 e;  4J9I A;  2OI3 A;  3DLL A;  2C0O A;  1S72 T;  5A2Q E;  2L3R A;  2RHU A;  4DBF A;  3QZ5 B;  2MAM A;  2E64 A;  4LD6 A;  5IHK A;  4A4H A;  5L8R E;  1ZUK A;  1YJW T;  2V1R A;  1WX6 A;  2ENM A;  5GAO p;  4M75 G;  4M77 D;  2JUF A;  3SWN B;  1Q82 R;  2K2M A;  2HSP A;  2CDT A;  4F16 A;  3A8M B;  1VOM A;  2NUP B;  2ROT A;  4C8Q C;  1YIT T;  4BUG A;  1VQN T;  4C5I A;  4PJJ A;  2QGG A;  1O75 A;  4R56 A;  1K8A C;  3AT1 B;  4Y92 A;  3V7R A;  2K5L A;  2E41 A;  2RPN A;  4FYX B;  4E47 A;  2CYZ B;  2EGA A;  3MP1 A;  3NPF A;  2H8H A;  1VQ5 T;  2KQW A;  1K9M C;  2V26 A;  2JN0 A;  1OZ2 A;  2BUD A;  1LJO A;  4JPB W;  3VV0 A;  1YI2 T;  2CP5 A;  2MI6 A;  2X4X A;  1M30 A;  1G8X A;  4OB3 B;  2FRY A;  4B9X A;  1SHF A;  2DD4 A;  2DL7 A;  3R6O A;  5LJ3 d;  2LDM A;  4CC7 A;  2OTL Q;  3CC2 Q;  4PJL A;  4RCC A;  3BE3 A;  4BAC A;  4C92 D;  5LJ5 e;  1VYU A;  5J26 A;  6AT1 B;  4C0D C;  5LL6 S;  1VQ7 Q;  2JTE A;  5IHN A;  3NTK A;  3M53 A;  1TUG B;  1Y57 A;  2X4J A;  1VQP Q;  1M2V B;  2XID A;  2RQR A;  2FPD A;  3VJP A;  2QEX Q;  5CR2 A;  3MEA A;  3OYM A;  1VQ8 Q;  5FRM A;  2CRE A;  5EC7 A;  3OS5 A;  3RMS A;  1MMG A;  1M1K U;  1FX7 A;  2EYQ A;  2L3Q A;  1XNI A;  3CME T;  1NEB A;  2P0P A;  3CCV T;  4HCC A;  2EQU A;  2XU8 A;  2B86 A;  3I5R A;  4OMM A;  2YSQ A;  3PGG A;  1IHV A;  4PJO F;  2CP2 A;  4N4H A;  1WHG A;  4JLG A;  2VGN A;  3I5S A;  4FM4 B;  2OAW A;  5IAY A;  5GAN 3;  3H0H A;  2OTL A;  2EJG A;  4Y28 E;  3JCM g;  4Z88 A;  3RIR A;  3EFR A;  1ACM B;  5GAN j;  5LJ3 g;  3Q1J A;  4OF1 A;  4CI0 C;  1VQ7 A;  3CCQ Q;  2BZ8 A;  5I22 A;  3JB9 D;  3OSV A;  1X2Q A;  2VUB A;  5GMK i;  2XDB A;  1RLP C;  4LN2 A;  2LJ0 A;  2YHT A;  5KYX A;  1AT1 B;  2QEX A;  4KUL A;  2CZ6 B;  3AHU A;  3JCM Q;  1Q7Y U;  1VQ8 A;  4J9D A;  3NHN A;  1X69 A;  3I56 T;  1IGU A;  3UAT A;  1PCX A;  4RG2 A;  2OTJ Q;  2M16 A;  2RM4 A;  2LJ1 A;  1A0N B;  4M75 E;  5C0M A;  4E7K A;  2X51 A;  4M78 D;  2RHZ A;  2HNI A;  4PJO G;  2LQ8 A;  2K9G A;  1DJ7 B;  1N9R A;  2KYM A;  3NMZ C;  4E7H A;  4OB2 B;  2EFI A;  1UUE A;  2A3L A;  1RAC B;  1HD3 A;  2V8I A;  2DTH A;  2R57 A;  1D0Z A;  4BE2 A;  1D1A A;  3UDC A;  2JS0 A;  4M4Z A;  1KQ2 A;  2O4X A;  1YBY A;  3CMA Q;  4Z02 A;  2IPO B;  3CCQ A;  2LT4 A;  1UE9 A;  1KQS A;  1BIB A;  2YDL A;  3OYY A;  1HSQ A;  4LUE A;  3JB9 H;  4QT7 A;  1JU5 C;  2RJE A;  5J39 A;  2F1L A;  3VUB A;  1WIE A;  4EMK B;  1GL5 A;  1YN8 A;  2XHC A;  3M5A A;  3J7A F;  2LVM A;  2DXC A;  4C0Z A;  2RA2 A;  1NYF A;  4GBQ A;  2OTJ A;  4HT8 A;  4DOV A;  3X26 B;  2EJ9 A;  4VUB A;  3OYE A;  3M57 A;  1Q82 U;  3VYH B;  2RMO A;  1KSW A;  2K2V A;  4QQD A;  2X3X D;  5GAN f;  3L1A A;  1QVF A;  3CC7 T;  3HRU A;  1VQ6 Q;  2DXT A;  1PHT A;  2X4Y A;  1OV3 A;  1M1K C;  2JMC A;  4DQ2 A;  2CKK A;  2G6F X;  4HT9 A;  4J6X A;  3VRZ A;  4KUD K;  4EDU A;  3TSZ A;  3CMA A;  4J6Y A;  4OMF B;  2A0F B;  2HKN A;  3CCE T;  1X2K A;  4PJO B;  3LLR A;  2YXY A;  2CT3 A;  3PVQ A;  4LDX A;  5HK3 A;  1BI1 A;  1WI7 A;  3M4G A;  1CKB A;  1VQ9 T;  4ELZ C;  3QDF A;  1KFZ A;  3N5B B;  5AT1 B;  1JJ2 P;  1OX8 A;  3JCM b;  3OYF A;  2KT8 A;  2DYB A;  3I35 A;  3M9Q A;  2HSE B;  4AFZ C;  1AD5 A;  4XQ3 A;  5FU7 C;  2LNH B;  3UA6 A;  3SDZ A;  2QTV A;  4XTU A;  4XK8 E;  3RMQ A;  1I0C A;  1W2B P;  1VQM A;  3M0T A;  1AWX A;  3UA7 A;  3I9Q A;  1H3H A;  4C8Q D;  3C0C A;  1VQ6 A;  2KRO A;  4RTZ A;  1I81 A;  1OU8 A;  4M75 C;  1Q7Y C;  2DPP B;  2QTX A;  3HKS A;  1IZ6 A;  5A0G A;  2WSE E;  4II1 A;  2E4H A;  5L23 A;  2CUD A;  4KGZ B;  2LC4 A;  1SRM A;  1V76 A;  1Y0M A;  3V8L A;  1R0C B;  2NUT B;  2YRD A;  1M90 R;  2DMO A;  1ZLM A;  3HRS A;  4M7A E;  4XU3 A;  1RAG B;  2VGM A;  2YRV A;  1AZG B;  3INZ A;  5CQY A;  5IN1 A;  3QWY A;  4GLK A;  3LGL A;  3CXC P;  3PVL A;  2HAX A;  1M8M A;  4JJN K;  1EFN A;  4KGX B;  2XG8 D;  2YUQ A;  3JCM h;  2PTK A;  1JXM A;  1TOV A;  1T0H A;  4WF2 A;  4IKF A;  4X9C A;  4C5H A;  2DLP A;  3NFC A;  1RAA B;  2KRN A;  1WXU A;  2R5M A;  3CEY A;  1NM7 A;  1QVP A;  4EMG A;  3ZL7 C;  1Y96 B;  1O9S A;  1Q81 U;  1NYG A;  1I07 A;  4HCZ A;  3CCJ Q;  1X6G A;  3M0Q A;  3EG2 A;  1S1N A;  3EGX B;  2EQI A;  3VS0 A;  3LH0 A;  4J7I A;  1QWF A;  3V8J A;  3CCL T;  2J05 A;  5ECA A;  1NLO C;  4M7A A;  4JUV A;  2NWM A;  5GAN g;  4TVR A;  1OU9 A;  1MMD A;  2K5F A;  1TH7 A;  1PKS A;  1K4U S;  1JJ2 S;  2DTI A;  3S6W A;  1K76 A;  1QKX A;  3A98 A;  4OGE A;  2JNG A;  2FZK B;  1VQ4 Q;  4FSX A;  1WYX A;  2RNA A;  1AWW A;  3RDV A;  2CSQ A;  2J06 A;  1PSF A;  3EH1 A;  1TXQ A;  1VQK Q;  1BKB A;  1QCF A;  5D7U A;  4F7U A;  1HK9 A;  2HDA A;  3OYJ A;  3TVT A;  3MO8 A;  2FYK A;  1VIF A;  5CKH A;  2WAC A;  3CD6 A;  3H9N A;  2EVR A;  2CP0 A;  2ESW A;  4XTY A;  3D7S B;  1CKA A;  3L2W A;  3CCR Q;  1SSH A;  3OYB A;  4M7D F;  2HL5 C;  3A8O B;  3CCU Q;  3CCJ A;  4ZGD B;  1I8F A;  4PL6 A;  2XDD A;  4FU6 A;  3UT1 A;  4RTT A;  3CPW P;  3NGP A;  2ZPF B;  1WHJ A;  3CC4 T;  2O88 A;  2CZ1 B;  1ZUU A;  2V8K A;  2J6F A;  4A53 A;  1D3B A;  3CXC S;  1KC8 U;  4C8Q A;  3OYH A;  3OY9 A;  1N6A A;  1MMN A;  1VQ4 A;  3VU3 C;  5FLX E;  4M77 F;  3M54 A;  1PRM C;  3GLX A;  3TCJ A;  2ZZD A;  3P8B B;  1VQK A;  1IRE B;  4OMP A;  5GAO r;  4M7A C;  3TEE A;  3URG A;  3CCR A;  1N8R R;  4M7D G;  5LJ5 j;  4D6W A;  3CCU A;  4A4G A;  4LDU A;  3ASK A;  1TU0 B;  2F5T X;  4KRT A;  4MZP A;  3OQ5 A;  3RKY A;  1E6H A;  5HCK A;  2HZY A;  2OTL T;  1XQH A;  3CC2 T;  5AYF A;  2PUO B;  3DLM A;  4C92 F;  1WNL A;  2BE9 B;  1ZX6 A;  4NOY A;  1MUZ A;  1C1A A;  3CQT A;  2VVK A;  4HVU A;  1VQ7 T;  1HXD A;  2DEQ A;  3PMT A;  4MDW A;  4QVD A;  4XU0 A;  4BY6 B;  3GOX A;  4KT0 E;  3JCM e;  1VQP T;  1Q81 C;  1GFC A;  1FWZ A;  4M77 G;  3PT9 A;  4N4G A;  3T9N A;  4J6W A;  2QEX T;  2X3W D;  1YNZ A;  3X28 B;  1FMV A;  2ATC B;  4RTV A;  2HQH A;  2XMF A;  4J9B A;  2DVE A;  1VQ8 T;  2AHJ B;  5CVI A;  7AT1 B;  2MWO A;  3EFO A;  2R5A A;  2NUZ A;  4PFO A;  4ZN3 A;  2SRC A;  4C5E A;  3BY7 A;  1M2O A;  3BW1 A;  4FW2 A;  3L2V A;  2QQR A;  2GFA A;  5GAN 2;  5C6S A;  4J9C A;  1NZ9 A;  2PVD B;  5KYU A;  3QG1 A;  2HQX A;  3CPW S;  4MMK A;  4A54 A;  3RBB B;  5FRO A;  2LCC A;  3E9G A;  2CZ0 B;  2P4T A;  1PC0 A;  3L2Z A;  4JS4 A;  2L0A A;  5GMK j;  5CKD A;  4Q5W A;  4N0A C;  2BZX A;  1UJ0 A;  1QP2 A;  4IIO A;  4C92 G;  1YFN A;  1GBR A;  3P8D A;  2EKO A;  1GBQ A;  1UEC A;  3JB9 F;  1UDL A;  4IUT A;  1G83 A;  2LRQ A;  4PKC C;  3MCA B;  4ZN1 A;  3FDR A;  3MP6 A;  4EMH A;  2W0Z A;  4M7D B;  3JCM d;  2KRS A;  4NL2 A;  4M75 D;  4BD3 A;  2KNB B;  3M58 A;  3QUI A;  4FL6 A;  1SHG A;  4FYW B;  1Q86 C;  1OOT A;  4IUR A;  2H3E B;  2E5Q A;  3DB4 A;  4HVV A;  3R6N A;  4BE0 A;  1WPY A;  4E7J A;  3UWN A;  1IO6 A;  4ORZ A;  5KYN A;  3FC3 A;  4D8K A;  4CRI A;  2OTJ T;  1M27 C;  2DRK A;  2XK0 A;  3CBP A;  4C0F A;  5GAN h;  4AFQ C;  3JSC A;  2YT6 A;  3H8Z A;  4M78 F;  1KC8 C;  1WQ7 A;  2RO0 A;  2DF6 A;  2KDS A;  4DBR A;  2ZPG B;  4M77 B;  1NJI R;  1OYX A;  3MJX A;  2HEQ A;  2W10 A;  1ZBX A;  2K6D A;  2QGF B;  1MGQ A;  1G3T A;  3FIF A;  5D6Y A;  1G3Y A;  2RI3 A;  1VYV A;  2CH4 W;  2PUK B;  3EHR A;  2B8A A;  3TRE A;  1U1T A;  2JTM A;  4E7Z A;  4E7L A;  4RTU A;  2KE9 A;  2EQK A;  3HHT B;  1YCY A;  2O9V A;  3X25 B;  3JB9 G;  1SPK A;  2O4X B;  2FZG B;  1UEB A;  2RJF A;  3P8H A;  1R8O B;  1TS9 A;  2O31 A;  2RI5 A;  3H41 A;  3SWN A;  1YJW Q;  1M3B A;  5GAM j;  1K73 C;  2E6N A;  4LUD A;  2HBP A;  4BI8 B;  3BFM A;  2KBT A;  2E3H A;  5FW9 A;  1AOJ A;  4BDY A;  2DA9 A;  1BCM A;  2GBQ A;  3FRN A;  3C94 A;  3SEM A;  2QA4 A;  3QWX X;  2HMA A;  3SD4 A;  1SF9 A;  3V8K A;  2FL7 A;  5FWC A;  4C92 B;  3A1P A;  1GFD A;  4R0K A;  1WQW A;  2VAS A;  4JJB A;  2GQI A;  3FB9 A;  3JCM V;  4QW2 A;  4M78 G;  2F5K A;  1UGS B;  1FYN A;  2RJC A;  2VV5 A;  2AKK A;  1KQS P;  5CKF A;  2HD0 A;  4ZTJ A;  1BU1 A;  1W70 A;  3QPH A;  4OMO A;  3M0U A;  3VS4 A;  2XDP A;  2BKD N;  2HCK A;  1VQ6 T;  1BYM A;  3CCS T;  5GAN 5;  4C5G A;  3JCM P;  2QG9 B;  4PLL A;  2DZC A;  3F70 A;  4X9D A;  4XTZ A;  1RI0 A;  4YTL A;  1XTD A;  1B7T A;  2K3Y A;  4O5V A;  1M2V A;  4HXJ A;  2K4Y A;  5CCA A;  1QW1 A;  2K79 A;  1KK7 A;  4E2F B;  2DEU A;  2CGH A;  4X34 A;  1YJW A;  4X1V A;  4V2S A;  1TTH B;  1ZSZ B;  3G7Z A;  3LYI A;  3THK A;  3QJ6 A;  2QK0 A;  3G71 Q;  2COW A;  1QVF P;  1AWO A;  4XAX B;  1U06 A;  1X6B A;  2KEA A;  2LZ6 B;  3FEO A;  2JW4 A;  1U5S A;  4MML A;  3V7C A;  1I4K 1;  2ZPH B;  1YJN Q;  2YLB A;  5FU6 C;  4OP0 A;  1QWE A;  3BDU A;  1K8A R;  2CZ7 B;  4L5G A;  1KD1 U;  1VQ5 A;  4M75 A;  5IXF A;  2FPE A;  3REB B;  3SWN C;  1H64 1;  4C8Q F;  2QAS A;  1YI2 A;  3MEW A;  3VS1 A;  1K9M R;  2M9U A;  2A08 A;  4D8D A;  3EGD A;  4RTY A;  1GRI A;  2JM9 A;  1B34 B;  1K0S A;  2I0N A;  1M3A A;  5GAM f;  4M7A D;  2K3X A;  1BCO A;  3QYH B;  4C0G A;  2DL4 A;  4IIM A;  2EYX A;  1RAD B;  1VQM Q;  5M9O A;  4A4K A;  1ARK A;  3ULR B;  3L2U A;  2L2P A;  4M78 B;  3OYC A;  3QII A;  4LDY A;  1Q86 R;  1M5Q 1;  4O6J A;  2K5I A;  1M1F A;  2KSS A;  1I1J A;  1PSE A;  4IUP A;  2LNV A;  1NEG A;  5GAN e;  3G71 A;  1QP3 A;  1WZO A;  3JV3 A;  4UC4 A;  2A37 A;  2E65 A;  3RUX A;  2GCX A;  2KYB A;  1YJN A;  3ER0 A;  1TG0 A;  2KGT A;  3HRT A;  1UHF A;  4ELY C;  2CSI A;  1RUW A;  4ATO A;  2LT1 A;  2ABL A;  2RK2 A;  1JRI A;  3CBM A;  5HK0 A;  4PLI A;  2RQW A;  3OYG A;  3CCJ T;  1D1C A;  2KI7 A;  2MOX A;  4AT1 B;  3QZ9 B;  1ZBJ A;  2EYZ A;  1X6O A;  4HCB A;  4E7I A;  4J9E A;  1RL2 A;  2I2L A;  2FEI A;  1JXO A;  5CKB A;  3FLG A;  4FW1 A;  4IUV A;  1WFW A;  2DBM A;  1NJI U;  4FYY B;  2CP6 A;  2C06 A;  4ZGE B;  4QKU A;  3L2R A;  1YIJ Q;  4WCI A;  4AG2 C;  2HBW A;  4ZGJ B;  2YWW A;  3M0P A;  1R0B G;  4JJD A;  5GAN d;  4PJO E;  2IVW A;  3VYG A;  5CIU A;  3OYI A;  1KIK A;  2DBK A;  1V29 B;  1RAE B;  3JB9 J;  3EG9 B;  1OX9 A;  5DLQ E;  3HFO A;  2VB6 A;  2HQE A;  3CCM Q;  4QQG A;  2EGC A;  4F7U B;  2EWN A;  1K1Z A;  2D6F A;  3HTR A;  1OPK A;  4ZNX A;  2X4W A;  3NTI A;  3CCR T;  2RH2 A;  4OGC A;  3GP8 A;  2DXB A;  4XTW A;  2D0Q B;  2DL8 A;  3EH2 A;  5FRN A;  2D0N A;  4KH1 B;  4Z89 A;  1OEB A;  1QVG A;  3CD6 Q;  3SB2 A;  2QQB A;  2KY9 A;  3OW2 A;  4DEY A;  2KAF A;  1G2B A;  4RTW A;  4JRI A;  3L42 A;  4FYV B;  4MDX A;  4EPC A;  3MEU A;  1VYT A;  4PJO A;  1KD1 C;  4AMC A;  1YIJ A;  3O5Z A;  2DVJ A;  1W4S A;  2ED0 A;  2COY A;  3G6E Q;  3LH5 A;  4C8Q B;  1TSF A;  5GAM g;  1AHJ B;  2D9T A;  4DEX A;  1Y7X A;  1SEM A;  3IQL A;  2IG0 A;  3H0F A;  4LE9 A;  4KBM B;  2MWP A;  3OS2 A;  3VS6 A;  3JCM W;  2K7A A;  2OX7 A;  3TU4 K;  2F2X A;  1IRX A;  2QAZ A;  1Q82 C;  4ESR A;  2RN8 A;  3CCM A;  5FWB A;  3OS1 A;  2AZS A;  2M0Y A;  2O2O A;  5IH2 A;  4F17 A;  2BIV A;  4CC3 A;  4BI4 A;  2FG0 A;  2GQV A;  5KYY B;  5GAO q;  5DY9 A;  4IUU A;  1BI3 A;  2O9S A;  3C12 A;  1N27 A;  3M56 A;  2D1X A;  1WHL A;  2VC8 A;  1NG2 A;  2RF0 A;  1W2B S;  1Y71 A;  4PFP A;  1LCK A;  4ME7 A;  4A4E A;  4PK4 A;  1PWT A;  4C0D B;  5LJ3 j;  3CBO A;  2NUT A;  4GY5 A;  1M1K R;  3KBG A;  1YWO A;  3CPF A;  2DM1 A;  5CO7 A;  2DET A;  2DYI A;  4OML A;  2PVG B;  2CUB A;  3G6E A;  2F2W A;  1YWP A;  1JO8 A;  3E2U A;  2JT4 A;  4J8O A;  3SHW A;  2MPX C;  3QJY A;  5CKE A;  3KXT A;  2EIF A;  3RKW A;  2KVQ G;  2L5Q A;  4J7F A;  3PMI A;  3QHS A;  1N9S A;  2M1H A;  4LDW A;  1WHK A;  3GF5 A;  1EZZ B;  2RQV A;  3GNG A;  2KRM A;  3L2Q A;  1D0X A;  1FMK A;  5A0D A;  3QDR B;  2DD5 A;  2F69 A;  2GFU A;  3OSS C;  2DE0 X;  1UGV A;  2NYS A;  2ZGW A;  2L3P A;  4PJO C;  1UGR B;  1QKW A;  1V1C A;  1IXD A;  2FZC B;  2LX7 A;  2AT1 B;  2KXD A;  3WVE B;  4N0A A;  1Z9Z A;  5KYW A;  3JRZ A;  3MP8 A;  3RKX A;  3EGX A;  3UF4 A;  3DB3 A;  4BE1 A;  3E1S A;  2K3B A;  1UHC A;  2WSC E;  1OPL A;  4K11 A;  4MZM A;  4QVC A;  1Q7Y R;  5GAN 6;  1VQL Q;  2EPD A;  2EQJ A;  2JM8 A;  4NL3 A;  1B3Q A;  4FT4 A;  1QMC A;  2O01 E;  2FVU A;  3LW5 E;  4HCK A;  4EIK A;  2EW3 A;  4XTX A;  3CPW A;  3QXE B;  3H0I A;  4Z8A A;  3TSW A;  5GMK h;  4LDV A;  2KMT A;  2SEM A;  1VA7 A;  1BI2 A;  1YHQ Q;  4L59 A;  4XU1 A;  4HKE A;  1MND A;  2RQU A;  5CK9 A;  4Y91 A;  3S3N A;  4MZT A;  4ZTF A;  1YJ9 Q;  1EX4 A;  2L8D A;  4AG1 C;  1NBE B;  2JMA A;  2ECZ A;  2XKO C;  1BBZ A;  2GTJ A;  1M90 U;  2EYW A;  5CQX A;  2DZ9 A;  5IT9 E;  4RTX A;  2QQA A;  2RI2 A;  3CCL A;  2EKH A;  4RG8 A;  3CC4 Q;  2COZ A;  1MV3 A;  1VQL A;  1VQO Q;  4HVW A;  2LP5 A;  1N5Z A;  2DKG A;  2ZPB B;  1U3O A;  2VXF A;  1SRL A;  5DLO A;  5FU6 B;  1IHW A;  2AIR B;  1GXI E;  2CP7 A;  2Z0W A;  3X20 B;  2YUO A;  2RD1 A;  2DIG A;  2DNU A;  2IIM A;  4OMN A;  3VRY A;  2M02 A;  3E19 A;  4JRP A;  1SG5 A;  3S3M A;  5HY6 A;  4PJN A;  1RAF B;  2PQW A;  2YRC A;  3G1J A;  2DIQ A;  4PJM A;  3CCQ T;  5GAN 4;  1YHQ A;  1U8R A;  1LNX A;  2ZCF B;  2JVV A;  3OA6 A;  1NLP C;  3LWH A;  3FJP A;  5GAO n;  5KYX B;  3J80 E;  3MHX A;  4KUI A;  2RB6 A;  3V7S A;  2E1H A;  2KR3 A;  1YJ9 A;  4J5Y A;  2QA4 Q;  1ABQ A;  3PIO A;  1BB9 A;  1UGP B;  1W1F A;  1YCS B;  5GAM h;  1E6G A;  5LJ5 f;  3I55 Q;  2MYS A;  3G4S Q;  3C4S A;  4JZ4 A;  3CC4 A;  2OAU A;  4RUG A;  3LX7 A;  1VQO A;  2Y4Y A;  2CP3 A;  1X43 A;  4B6M A;  1TUD A;  1JEG A;  2FPF A;  3QBY A;  1WHM A;  4F04 B;  2X35 A;  1ZSG A;  4QVZ A;  3EG3 A;  2FRW A;  1S72 Q;  3G71 T;  3EGU A;  4M7D E;  2E10 A;  1HJD A;  3CMA T;  2E6Z A;  4DBQ A;  3O8V A;  3PE0 A;  2H3J A;  5FU7 B;  1QQJ A;  1YJN T;  5IHI A;  2FHD A;  3MPU B;  1KQ1 A;  2NUP A;  2GTO A;  2QDY B;  1WA7 A;  2P4R A;  1IGQ A;  2CT4 A;  1G3S A;  1VQN Q;  1K9A A;  1YIT Q;  1PD0 A;  4RCB A;  2E5K A;  4M75 B;  1W6X A;  3I55 A;  2C0I A;  2DAQ A;  1U1S A;  3G4S A;  4JJC A;  1TUC A;  4M77 E;  5D6X A;  1R77 A;  1I5O B;  3CC2 A;  1UJY A;  1VQ5 Q;  4M7A F;  1UB4 A;  1IB8 A;  1UTI A;  3EGD B;  5LJ5 d;  3JB9 I;  2QQ9 A;  1VQM T;  1XJW B;  4M7D A;  1YI2 Q;  1ZQ1 A;  3ZFJ A;  5GMK e;  1VQP A;  3VUZ A;  1WDX A;  3C95 A;  1QCO A;  3PIP A;  1NPP A;  2K57 A;  1Q95 G;  2LCS A;  1S72 A;  1VUB A;  4FSS A;  5I2M A;  3M55 A;  1WXB A;  1M90 C;  1JB0 E;  1Q81 R;  1MV0 B;  3KUF A;  5KCH A;  2J6O A;  3OYD A;  1WJS A;  1M3C A;  1N8R U;  3RER A;  3EG1 A;  1LOJ A;  4F7U F;  2LQK A;  1JBM A;  1G3W A;  4P5N A;  4DBH A;  1K0X A;  1T3L A;  2DER A;  3DKM A;  4BY6 C;  4M77 A;  4C92 E;  4BI3 A;  3PTA A;  1VQN A;  3QKJ A;  3VS3 A;  4PNO A;  1YIT A;  3JCM X;  4R55 A;  2KXC A;  1UGQ B;  2QXF A;  2FB7 A;  3CME Q;  1TWB A;  3OYA A;  4DA4 A;  1KJW A;  3UPU A;  2ZPI B;  3MEV A;  3CCV Q;  2FO0 A;  5I11 A;  3REA B;  2DJZ A;  4LD9 K;  4L6V 5;  4XTV A;  3OS0 A;  1WHH A;  2QI2 A;  4M7A G;  1AZE A;  2V8J A;  2RHX A;  3EAE A;  4PJO D;  3E9F A;  3ZEH A;  3QSU A;  2RHI A;  5LJ5 g;  1PM3 A;  2L89 A;  2VWF A;  1YIJ T;  2P0Q A;  3S3O A;  2RQT A;  1GCP A;  1PNJ A;  3EG0 A;  4RMO A;  2QYZ A;  3HPW A;  1T3S A;  2EGE A;  4C92 A;  1BK2 A;  5GAN 7;  2DL5 A;  1UG1 A;  1Y07 A;  4F7U G;  5CAI A;  3OMC A;  2JOY A;  1M4Z A;  3VS2 A;  5GAM e;  2A36 A;  2CS7 A;  3CCM T;  4N4I A;  2OJ2 A;  4JRQ A;  1I5L A;  2LQW A;  1MHN A;  1OI1 A;  1WXT A;  1AVZ C;  3M0R A;  3JCM J;  4M7D C;  2BE7 D;  2M51 A;  2JZ2 A;  1BI0 A;  3I56 Q;  2YUN A;  3CME A;  1KC8 R;  2L3S A;  2EJF A;  3VS5 A;  1KQS S;  3CCV A;  1OQK A;  4RKU E;  2LTO A;  3CCS Q;  1ZA2 B;  1AEY A;  4BDZ A;  3CD6 T;  4E6R A;  1SSF A;  4OVA A;  4JRK A;  1M8V A;  5HKC A;  3LGF A;  4C8Q G;  3J81 E;  1ZSZ A;  3OB9 A;  2M0O A;  4M77 C;  1MNE A;  4CC4 B;  3G6E T;  5I2S A;  4M78 E;  4OB1 B;  4J9F A;  2DXU A;  1HYO A;  4GLM A;  5I21 A;  1K73 R;  1NPR A;  3WXM B;  5IXB A;  2KT1 A;  4M7A B;  2P84 A;  4DOW A;  1QVF S;  1VIE A;  1AWJ A;  1QVG P;  2PNI A;  4IUQ A;  5GAM d;  5DM7 R;  4EMK A;  3OW2 P;  3GPL A;  3OYK A;  1VQ4 T;  1D1B A;  3U23 A;  2E3I A;  4JZ3 A;  4FT2 A;  4OMQ A;  1RLQ C;  1YP5 A;  1VQK T;  2LX9 A;  3I56 A;  2MMP A;  1B34 A;  3WVD B;  2HKQ B;  4BB7 A;  2PZ1 A;  3CCS A;  1N8R C;  4FCY A;  3BDL A;  1RAI B;  4C92 C;  3A8H B;  2MF2 A;  3HL8 A;  1UFF A;  4M78 A;  4LXC A;  2JS2 A;  1RAB B;  2YLC A;  2RHY A;  1E7O A;  3CC7 Q;  3CCU T;  1ZHI A;  1JJ2 A;  1FXX A;  2XI9 A;  1KG1 A;  4J83 A;  2QQS A;  3OBW A;  2EQM A;  3PFS A;  2PU9 B;  2C0T A;  4QQ6 A;  1X75 C;  2YUP A;  1LPL A;  5KE3 A;  3RR6 A;  1T0J A;  3A5Z B;  4B9W A;  2DO3 A;  1NE8 A;  2JTF A;  1H8K A;  3LWI A;  2JJ9 A;  2E12 A;  1W2B A;  3CCE Q;  1EIF A;  4E7S A;  1B07 A;  5LJ3 h;  4WTO B;  1D3B B;  2AKL A;  1SKU B;  1XOV A;  1QCN A;  4HA8 A;  2DK3 A;  1PRL C;  4A4F A;  1ZSZ C;  1VQ9 Q;  3A8L B;  3SFM A;  4F7U E;  4J9G A;  1Z9Q A;  2XIC A;  5KE2 A;  2HL3 A;  1C0M A;  2EYY A;  2RK1 A;  3PNW C;  8ATC B;  1WJQ A;  3HFN A;  1C6V X;  4KGV B;  5KYW B;  4JS5 A;  1QLY A;  1KHC A;  1WGS A;  3VS7 A;  1LVK A;  2DRM A;  4F14 A;  2LMJ A;  1X27 A;  2ROL A;  1VQL T;  3HSB A;  5GAO l;  2WSF E;  1RI9 A;  3CXC A;  4PFZ A;  4EMK C;  3CC7 A;  2X9H A;  1J3T A;  2V1Q A;  3HP9 A;  2D8J A;  2AK5 A;  4FIB A;  2MK5 A;  2Y4X A;  2DTO A;  4XU2 A;  1K8A U;  3H6Z A;  1P92 A;  3VKI A;  2BZY A;  1QVG S;  2NLU A;  4KH0 B;  1GCQ A;  5GMK l;  3EG9 A;  2KK4 A;  3OW2 S;  3ZBD A;  4C8Q E;  3EFS A;  4A63 B;  3CCE A;  2XD0 A;  9ATC B;  2DX1 A;  1YHQ T;  1K9M U;  3MKD A;  5GAN 8;  4M78 C;  3GBQ A;  1H92 A;  2QDL A;  1RAH B;  4OB0 B;  2A28 A;  3OYL A;  5LJ5 h;  3M59 A;  4NS5 A;  2AZV A;  2D8H A;  1MMA A;  1VQ9 A;  1M1G A;  2LCL A;  2PVO B;  2A7Y A;  2ED1 A;  2R58 A;  1YJ9 T;  3KFV A;  2RJD A;  3OBY A;  3QO3 A;  2MIO A;  3JCM c;  3GIB A;  1Q86 U;  1F1B B;  2JXB A;  3NTH A;  5A0L A;  8AT1 B;  1Y96 A;  3EFO B;  1D09 B;  1ZUY A;  1NJI C;  3TQ7 P;  1VQO T;  1PG5 B;  2EAY A;  3RES A;  2G3R A;  2DJQ A;  5KYU B;  2GNC A;  1D0Y A;  2CH4 A;  2GF7 A;  5KH6 A;  2LQN A;  3FJ5 A;  3CCL Q;  2DFU A;  5KCO A;  1BIA A;  4LNP A;  2DIL A;  4CC2 A;  5D6W A;  1OUL A;  4AFU C;  5KYY A; 
#chains in the Genus database with same CATH homology
 4WF2 A;  4JDS A;  4M75 F;  1B34 B;  4QVZ A;  3JAM E;  4IKF A;  4X9C A;  4C5H A;  5GAO m;  3NFC A;  5GAM f;  4M7A D;  5J3B A;  2K3X A;  3QYH B;  2R5M A;  3CEY A;  4C0G A;  3G71 T;  1QVP A;  2VYT A;  4EMG A;  1Y96 B;  4M7D E;  1O9S A;  1Q81 U;  1K73 U;  2E10 A;  2E70 A;  3QYG B;  4A4K A;  2E6Z A;  5M9O A;  2QA4 T;  3O8V A;  3CMA T;  1X01 A;  3L2U A;  1KHI A;  4HCZ A;  3MET A;  2VXE A;  2H3J A;  4M78 B;  5FU7 B;  3OYC A;  2Y90 A;  3QII A;  4LDY A;  3I55 T;  1YJN T;  1M5Q 1;  2FHD A;  4O6J A;  2K5I A;  1KQ1 A;  1M1F A;  2KSS A;  1WJR A;  3G4S T;  3X24 B;  1PSE A;  2QDY B;  4IUP A;  3LH0 A;  2LNV A;  4J7I A;  4JLI A;  5GMK m;  1M9S A;  3CCL T;  3V8J A;  3A8G B;  3M4Y A;  5GAN e;  1G3S A;  3JCM f;  3G71 A;  4M7A A;  1G5V A;  4RCB A;  2ZPE B;  4JUV A;  1QP3 A;  3GNF B;  5LJ3 f;  2P0K A;  3OYN A;  4M7D D;  4M75 B;  4UC4 A;  2E65 A;  3RUX A;  2GCX A;  5GAN g;  4TVR A;  3I55 A;  2K5F A;  1TH7 A;  1YJN A;  2DAQ A;  3ER0 A;  1OZ3 A;  2DTI A;  1U1S A;  3S6W A;  3G4S A;  1JJ2 S;  3HRT A;  2JNG A;  3ME9 A;  3OMG A;  4M77 E;  4OGE A;  1H3Z A;  5EG2 A;  5LJ3 e;  5D6X A;  4ELY C;  4FSX A;  3DLL A;  3CC2 A;  1S72 T;  4M7A F;  1UB4 A;  5A2Q E;  2L3R A;  4ATO A;  2RHU A;  1PSF A;  2LT1 A;  5LJ5 d;  2RK2 A;  1BKB A;  4LDX A;  1JRI A;  2QQ9 A;  3CBM A;  3QZ5 B;  5HK0 A;  3JB9 I;  1VQM T;  4PLI A;  4M7D A;  2MAM A;  1ZQ1 A;  2E64 A;  4F7U A;  3OYG A;  1HK9 A;  3ZFJ A;  5GMK e;  4LD6 A;  3CCJ T;  4A4H A;  3OYJ A;  1VQP A;  3QZ9 B;  3VUZ A;  5L8R E;  1YJW T;  3MO8 A;  2FYK A;  1VIF A;  3C95 A;  5CKH A;  5GAO p;  4M75 G;  3PIP A;  2WAC A;  3CD6 A;  1NPP A;  1X6O A;  2K57 A;  2JUF A;  4M77 D;  1VUB A;  4E7I A;  1S72 A;  4HCB A;  3SWN B;  4XTY A;  1RL2 A;  2I2L A;  5I2M A;  3M55 A;  3L2W A;  3A8M B;  5CKB A;  3FLG A;  1YIT T;  1JB0 E;  4C8Q C;  3KUF A;  4BUG A;  5KCH A;  3OYB A;  3OYD A;  1WJS A;  4IUV A;  1N8R U;  4C5I A;  3RER A;  4M7D F;  1O75 A;  1LOJ A;  4F7U F;  4R56 A;  2LQK A;  3A8O B;  1K8A C;  1NJI U;  2C06 A;  3V7R A;  4ZGE B;  3L2R A;  2K5L A;  3CCJ A;  1JBM A;  1G3W A;  4ZGD B;  4P5N A;  2E41 A;  1I8F A;  4PL6 A;  2XDD A;  4FU6 A;  3UT1 A;  3DKM A;  4E47 A;  2ZPF B;  4BY6 C;  4ZGJ B;  2CYZ B;  3MP1 A;  4M77 A;  4C92 E;  1VQ5 T;  4BI3 A;  3CC4 T;  2KQW A;  3PTA A;  1VQN A;  3QKJ A;  1YIT A;  4PNO A;  5GAN d;  4PJO E;  2IVW A;  3VYG A;  2CZ1 B;  5CIU A;  3JCM X;  1K9M C;  3OYI A;  2JN0 A;  2V8K A;  1V29 B;  4R55 A;  1OZ2 A;  2BUD A;  1LJO A;  4A53 A;  1UGQ B;  3JB9 J;  2QXF A;  2FB7 A;  1D3B A;  3CXC S;  3VV0 A;  5DLQ E;  3OYA A;  4DA4 A;  1YI2 T;  1KC8 U;  4C8Q A;  3UPU A;  3OYH A;  2MI6 A;  2X4X A;  2ZPI B;  3MEV A;  3HFO A;  2HQE A;  4QQG A;  4OB3 B;  3OY9 A;  2DJZ A;  1N6A A;  4B9X A;  1VQ4 A;  3VU3 C;  4L6V 5;  4XTV A;  2EWN A;  4M77 F;  5FLX E;  3M54 A;  4F7U B;  3OS0 A;  2DD4 A;  2QI2 A;  3R6O A;  5LJ3 d;  2LDM A;  2D6F A;  4M7A G;  4RCC A;  3GLX A;  3TCJ A;  2ZZD A;  3P8B B;  4BAC A;  4C92 D;  2X4W A;  5LJ5 e;  3NTI A;  5J26 A;  2V8J A;  2RHX A;  3CCR T;  1VQK A;  2RH2 A;  3EAE A;  4OGC A;  4C0D C;  3GP8 A;  2DXB A;  4PJO D;  1IRE B;  4XTW A;  5LL6 S;  3NTK A;  3E9F A;  3M53 A;  5GAO r;  2D0Q B;  3ZEH A;  3QSU A;  2RHI A;  5LJ5 g;  2L89 A;  1YIJ T;  5FRN A;  2X4J A;  2XID A;  4M7A C;  4LD9 K;  3TEE A;  2P0Q A;  3S3O A;  3URG A;  3VJP A;  1QVG A;  3SB2 A;  2QQB A;  2KY9 A;  5CR2 A;  3OW2 A;  4RMO A;  2KAF A;  3MEA A;  4JRI A;  3L42 A;  3CCR A;  3OYM A;  4MDX A;  3HPW A;  5FRM A;  4EPC A;  4C92 A;  3OS5 A;  5GAN 7;  3RMS A;  4M7D G;  5LJ5 j;  3MEU A;  5CAI A;  1Y07 A;  4F7U G;  1M1K U;  4D6W A;  4PJO A;  1FX7 A;  3OMC A;  3CCU A;  1KD1 C;  2EYQ A;  2JOY A;  4A4G A;  1XNI A;  3CME T;  1M4Z A;  4LDU A;  3ASK A;  1YIJ A;  5GAM e;  1W4S A;  2P0P A;  3CCV T;  2F5T X;  2CS7 A;  3CCM T;  4MZP A;  4N4I A;  1I5L A;  4JRQ A;  3OQ5 A;  4HCC A;  3RKY A;  2EQU A;  1MHN A;  1OI1 A;  2XU8 A;  4C8Q B;  5GAM g;  3JCM J;  1AHJ B;  1XQH A;  2D9T A;  2OTL T;  3CC2 T;  4M7D C;  1Y7X A;  3PGG A;  5AYF A;  2PUO B;  3DLM A;  4C92 F;  1WNL A;  2JZ2 A;  4PJO F;  4NOY A;  2IG0 A;  4N4H A;  1BI0 A;  4KBM B;  1VQ7 T;  1HXD A;  2MWP A;  3OS2 A;  3CME A;  2DEQ A;  3PMT A;  4JLG A;  4MDW A;  3JCM W;  3TU4 K;  2EJF A;  4QVD A;  1KQS S;  4XU0 A;  2VGN A;  4FM4 B;  1Q82 C;  5IAY A;  4BY6 B;  3CCV A;  3GOX A;  3CCM A;  4KT0 E;  4RKU E;  2LTO A;  3JCM e;  3OS1 A;  5GAN 3;  1VQP T;  1Q81 C;  1FWZ A;  4M77 G;  3PT9 A;  4N4G A;  4BDZ A;  2BIV A;  3T9N A;  2OTL A;  4J6W A;  4BI4 A;  2GQV A;  2EJG A;  2QEX T;  3CD6 T;  5GAO q;  1SSF A;  4OVA A;  4JRK A;  4Y28 E;  3JCM g;  5DY9 A;  4IUU A;  3X28 B;  3RIR A;  1M8V A;  1BI3 A;  3EFR A;  2DVE A;  5GAN j;  1VQ8 T;  2AHJ B;  5CVI A;  5HKC A;  3C12 A;  5LJ3 g;  3Q1J A;  3LGF A;  4OF1 A;  1N27 A;  3M56 A;  4CI0 C;  1VQ7 A;  4C8Q G;  3JB9 D;  3OSV A;  2VC8 A;  2MWO A;  2VUB A;  3J81 E;  2R5A A;  3OB9 A;  5GMK i;  2M0O A;  4ZN3 A;  1W2B S;  4M77 C;  4C5E A;  3BY7 A;  2XDB A;  1Y71 A;  3BW1 A;  3L2V A;  2YHT A;  4ME7 A;  2QQR A;  2GFA A;  4M78 E;  4A4E A;  5I2S A;  4OB1 B;  5C6S A;  4KUL A;  5GAN 2;  3G6E T;  2QEX A;  4C0D B;  2CZ6 B;  1NZ9 A;  2PVD B;  5LJ3 j;  2DXU A;  3AHU A;  3QG1 A;  3JCM Q;  1Q7Y U;  1VQ8 A;  2HQX A;  5I21 A;  3CPW S;  3CBO A;  4MMK A;  1NPR A;  3WXM B;  4A54 A;  4GY5 A;  3KBG A;  5FRO A;  2LCC A;  3CPF A;  3E9G A;  4M7A B;  2CZ0 B;  3I56 T;  2P4T A;  5CO7 A;  4DOW A;  1QVF S;  1VIE A;  3L2Z A;  4JS4 A;  4RG2 A;  2M16 A;  2RM4 A;  4IUQ A;  5GAM d;  5GMK j;  5DM7 R;  4M75 E;  4EMK A;  2PVG B;  5CKD A;  3G6E A;  3GPL A;  3OYK A;  1VQ4 T;  4Q5W A;  4J8O A;  4N0A C;  5C0M A;  1QP2 A;  4E7K A;  3QJY A;  4M78 D;  4C92 G;  2RHZ A;  5CKE A;  2EIF A;  3RKW A;  2HNI A;  4FT2 A;  3KXT A;  4PJO G;  3P8D A;  2LQ8 A;  2EKO A;  1DJ7 B;  1N9R A;  2KVQ G;  2L5Q A;  4E7H A;  3PMI A;  4J7F A;  2LX9 A;  3QHS A;  4OB2 B;  1VQK T;  2EFI A;  3I56 A;  1N9S A;  3JB9 F;  2MMP A;  2M1H A;  4LDW A;  4IUT A;  3GF5 A;  1B34 A;  3WVD B;  2LRQ A;  2A3L A;  3GNG A;  3L2Q A;  4PKC C;  4BB7 A;  3MCA B;  4ZN1 A;  3FDR A;  5A0D A;  3MP6 A;  4EMH A;  3CCS A;  2V8I A;  4M7D B;  2DTH A;  3JCM d;  1N8R C;  2R57 A;  2DD5 A;  2F69 A;  2GFU A;  3BDL A;  3OSS C;  3QDR B;  3A8H B;  4M75 D;  4NL2 A;  3M58 A;  4BD3 A;  3QUI A;  4C92 C;  4BE2 A;  2MF2 A;  2ZGW A;  4PJO C;  1UGR B;  3HL8 A;  3UDC A;  4FL6 A;  1KQ2 A;  4M78 A;  2O4X A;  1Q86 C;  1YBY A;  4IUR A;  4Z02 A;  2E5Q A;  3DB4 A;  3WVE B;  2YLC A;  4N0A A;  2RHY A;  3CCQ A;  4BE0 A;  1WPY A;  2LT4 A;  3JRZ A;  3MP8 A;  4E7J A;  3RKX A;  1KQS A;  3UWN A;  3CCU T;  1ZHI A;  1BIB A;  1JJ2 A;  1FXX A;  2XI9 A;  3FC3 A;  3OYY A;  2QQS A;  4J83 A;  1KG1 A;  4CRI A;  3OBW A;  2EQM A;  2OTJ T;  3DB3 A;  4BE1 A;  3E1S A;  3PFS A;  3JB9 H;  2PU9 B;  4QQ6 A;  2XK0 A;  3CBP A;  1X75 C;  4C0F A;  5GAN h;  2WSC E;  3JSC A;  2RJE A;  5KE3 A;  5J39 A;  3A5Z B;  3H8Z A;  4M78 F;  4MZM A;  3VUB A;  4B9W A;  4QVC A;  1KC8 C;  5GAN 6;  4EMK B;  1VQN T;  2DO3 A;  1WQ7 A;  2XHC A;  2RO0 A;  3M5A A;  1NE8 A;  2KDS A;  2EQJ A;  2ZPG B;  3J7A F;  4NL3 A;  2LVM A;  4M77 B;  2JTF A;  2DXC A;  1OYX A;  3LWI A;  4C0Z A;  2E12 A;  1W2B A;  2RA2 A;  1EIF A;  2OTJ A;  1ZBX A;  4FT4 A;  1MGQ A;  1G3T A;  3FIF A;  5D6Y A;  5LJ3 h;  4HT8 A;  4DOV A;  2O01 E;  1G3Y A;  1D3B B;  3X26 B;  2FVU A;  2RI3 A;  3LW5 E;  2PUK B;  2EJ9 A;  4VUB A;  1XOV A;  3OYE A;  2B8A A;  4HA8 A;  2DK3 A;  3M57 A;  1U1T A;  4XTX A;  3TRE A;  3VYH B;  3CPW A;  1Q82 U;  4A4F A;  3QXE B;  2JTM A;  3A8L B;  3SFM A;  4F7U E;  4E7L A;  2K2V A;  2EQK A;  2XIC A;  4QQD A;  3HHT B;  1YCY A;  3X25 B;  5KE2 A;  5GMK h;  5GAN f;  4LDV A;  3JB9 G;  3L1A A;  1Q7Y C;  1QVF A;  2KMT A;  3CC7 T;  2O4X B;  1BI2 A;  2RK1 A;  3HRU A;  3PNW C;  1UEB A;  2RJF A;  3P8H A;  1R8O B;  3SWN A;  2RI5 A;  1WJQ A;  3HFN A;  5GAM j;  4L59 A;  1K73 C;  2DXT A;  2X4Y A;  4JS5 A;  2E6N A;  1M1K C;  2HBP A;  1KHC A;  3BFM A;  4XU1 A;  1WGS A;  4BI8 B;  4DQ2 A;  2CKK A;  4HT9 A;  4HKE A;  4J6X A;  4BDY A;  1VQL T;  3HSB A;  5CK9 A;  5GAO l;  4Y91 A;  3S3N A;  4KUD K;  3FRN A;  3C94 A;  4MZT A;  4EDU A;  2L8D A;  2WSF E;  3CMA A;  2QA4 A;  4ZTF A;  3CXC A;  4EMK C;  3SD4 A;  3CC7 A;  2XKO C;  4J6Y A;  4OMF B;  3V8K A;  2FL7 A;  3CCE T;  4C92 B;  1M90 U;  3HP9 A;  1WQW A;  5CQX A;  4PJO B;  2DZ9 A;  3LLR A;  4FIB A;  5IT9 E;  2Y4X A;  2DTO A;  4XU2 A;  2QQA A;  2RI2 A;  3FB9 A;  1K8A U;  3H6Z A;  1P92 A;  3VKI A;  3JCM V;  4QW2 A;  4RG8 A;  5HK3 A;  3CCL A;  1QVG S;  4M78 G;  2F5K A;  1BI1 A;  2NLU A;  1UGS B;  3M4G A;  1VQL A;  5GMK l;  2RJC A;  2KK4 A;  2VV5 A;  3OW2 S;  5CKF A;  2ZPB B;  2DKG A;  2HD0 A;  4ELZ C;  4ZTJ A;  2VXF A;  3ZBD A;  1VQ9 T;  3N5B B;  5FU6 B;  4C8Q E;  5DLO A;  3EFS A;  1GXI E;  3QPH A;  3JCM b;  3OYF A;  3CCE A;  2XDP A;  2BKD N;  3M9Q A;  1VQ6 T;  2XD0 A;  3X20 B;  1BYM A;  2RD1 A;  1YHQ T;  1K9M U;  2DIG A;  4XQ3 A;  5GAN 8;  4M78 C;  5FU7 C;  5GAN 5;  3CCS T;  4C5G A;  3JCM P;  4OB0 B;  4PLL A;  3E19 A;  3SDZ A;  3OYL A;  4JRP A;  5LJ5 h;  3M59 A;  2DZC A;  3S3M A;  3F70 A;  4X9D A;  4XTU A;  4NS5 A;  4XTZ A;  1RI0 A;  5HY6 A;  4YTL A;  1XTD A;  4XK8 E;  1M1G A;  3RMQ A;  2LCL A;  2PVO B;  1VQ9 A;  2A7Y A;  2K3Y A;  2PQW A;  2R58 A;  1YJ9 T;  4O5V A;  1VQM A;  2RJD A;  2DIQ A;  3OBY A;  2K4Y A;  3CCQ T;  3QO3 A;  4C8Q D;  5CCA A;  1QW1 A;  1VQ6 A;  1I81 A;  4M75 C;  2CGH A;  3JCM c;  5GAN 4;  4X34 A;  2DPP B;  1U8R A;  2QTX A;  1YJW A;  1YHQ A;  1LNX A;  3HKS A;  1Q86 U;  3GIB A;  2ZCF B;  2JVV A;  3OA6 A;  3NTH A;  5A0L A;  4V2S A;  1Y96 A;  3LWH A;  1IZ6 A;  3FJP A;  3G7Z A;  3LYI A;  5A0G A;  1NJI C;  2WSE E;  3QJ6 A;  5GAO n;  4II1 A;  3J80 E;  1VQO T;  3MHX A;  4KUI A;  2RB6 A;  3V7S A;  2E1H A;  2EAY A;  4XAX B;  1YJ9 A;  2LC4 A;  3FEO A;  4J5Y A;  3RES A;  2G3R A;  4MML A;  3V7C A;  3PIO A;  1I4K 1;  1UGP B;  3V8L A;  5GAM h;  2ZPH B;  5LJ5 f;  2YLB A;  2GF7 A;  5FU6 C;  4OP0 A;  5KH6 A;  3HRS A;  3BDU A;  3C4S A;  2CZ7 B;  4L5G A;  4M7A E;  4XU3 A;  2YRV A;  2VGM A;  1KD1 U;  3INZ A;  5IN1 A;  5CQY A;  1VQ5 A;  4M75 A;  4GLK A;  3CC4 A;  3LGL A;  2OAU A;  3LX7 A;  1VQO A;  2HAX A;  5KCO A;  2Y4Y A;  4JJN K;  3SWN C;  1BIA A;  1H64 1;  3QBY A;  2XG8 D;  4C8Q F;  1YI2 A;  3MEW A;  5D6W A;  3JCM h;  1M90 C;  2M9U A;  2X35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...