4A4EA

Solution structure of smn tudor domain in complex with symmetrically dimethylated arginine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords SURVIVAL MOTOR NEURON PROTEIN
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4eA00
4PL6A 1KHCA 2K3XA 5J26A 3DLMA 3OS1A 4BE2A 3MEAA 2RJCA 2RHXA 4GY5A 4E7JA 3OYHA 3LX7A 5FRMA 5FROA 3OYJA 2PQWA 1MHNA 4BACA 2RO0A 4E7IA 2EQMA 3OY9A 3L2WA 3OQ5A 2M16A 3S3NA 2RI2A 2RJDA 3OS2A 2LDMA 3MEVA 5J39A 2R58A 3E9GA 3UWNA 4BDYA 4QQDA 3M9QA 3OS0A 4BE1A 3S3MA 3FLGA 3NTHA 4C5IA 2B8AA 2HQEA 2MWOA 2NLUA 4C5GA 2F5KA 2RHZA 2M0OA 1RI0A 2RHYA 2R5MA 3QBYA 4OVAA 4LD6A 3QJ6A 2BIVA 3LYIA 3O8VA 5FRNA 2HQXA 4BE0A 4QW2A 4E7KA 2EQUA 4IUVA 2X4XA 4BDZA 4CRIA 2R5AA 4N4HA 2JTFA 3CEYA 3OYNA 5KH6A 4IUTA 3NTIA 3OMGA 5C0MA 2GF7A 3META 4A4GA 2X4YA 3SD4A 2QQRA 4IUPA 3S6WA 3KUFA 4RG2A 2LTOA 2L3RA 1G5VA 2FHDA 4HCZA 1OI1A 4X34A 2RHIA 4B9XA 4B9WA 3OYMA 3OYIA 3MEWA 4EDUA 1OYXA 1OZ2A 2X35A 4BD3A 5C6SA 2DIGA 3MP8A 3H6ZA 4IURA 2DAQA 3F70A 3OYEA 2GFAA 3OYAA 2IG0A 3P8HA 1OZ3A 1WJRA 5D6WA 3P8DA 3MP1A 3BDLA 3E9FA 3DB3A 2GFUA 4FU6A 4QQ6A 4Z02A 4FL6A 4E7HA 2RHUA 3LGFA 2EQKA 3LGLA 3ZEHA 5IAYA 5KCOA 3QKJA 4IUQA 4ZTFA 2BKDN 3OYGA 3GOXA 2MWPA 4QVZA 2E5QA 4C5HA 1WJSA 4UC4A 3H8ZA 3PMIA 3L42A 2O4XB 3PMTA 4L59A 5KE2A 3OYDA 5KE3A 2K3YA 2R57A 2RJFA 2L8DA 3OB9A 4II1A 3OYCA 3DB4A 2JZ2A 3OYKA 2CKKA 3LH0A 3QIIA 2EQJA 3UT1A 3MO8A 4C5EA 5IN1A 2EKOA 1H3ZA 2LRQA 4IKFA 2RJEA 2RI5A 3LLRA 2DIQA 3FEOA 4N4IA 3OYBA 4NS5A 3FC3A 3L2UA 4N4GA 5D6YA 2EFIA 5D6XA 2QQSA 2O4XA 4PLLA 1N27A 1WJQA 2X4WA 2G3RA 3OMCA 3ME9A 3S3OA 3ASKA 4E7LA 3FDRA 2VYTA 4Q5WA 2P0KA 2LVMA 4ZTJA 1XNIA 3Q1JA 2BUDA 2YRVA 2L89A 2WACA 2E6NA 2XDPA 3L2VA 3OYFA 2XK0A 3L2QA 3PFSA 4PLIA 1WGSA 3MP6A 3OYLA 4QQGA 2LCCA 3EAEA 1SSFA 3NTKA 3L2RA 5CIUA 3C4SA 2RI3A 4IUUA 2D9TA 3PNWC 4A4EA 2M1HA 5KCHA 5M9OA 4A4HA 3OA6A 4A4FA 3MEUA
chains in the Genus database with same CATH superfamily
1M8MA 2EQIA 3EHQA 5FU7B 4CI0C 1W1FA 1M2VA 2EYXA 2PQWA 2COWA 3G1JA 2XDDA 2EQMA 3OY9A 3OQ5A 5FLXE 1X2QA 1JRIA 1GRIA 1VQLA 4J9IA 3SDZA 2J05A 1U06A 2B8AA 4RTXA 1KD1C 2GGRA 1SEMA 1M27C 1VIEA 1E6GA 5FRNA 2O01E 1I5OB 3RMQA 4E7KA 5A0LA 2CREA 3PVLA 3WVEB 5L8RE 4BDZA 5I22A 1VQMT 1Z9QA 3OYNA 1E7OA 4PJOC 2OTJT 4HVVA 1I5LA 4C8QA 1BBZA 4JRQA 4RKUE 2MF2A 4B9XA 5I2SA 2RH2A 3TU4K 2XICA 3EFSA 2JN0A 1ZSZA 5GAN8 3CCQQ 5KYUB 1WHLA 1WYXA 3QUIA 1N5ZA 5KCOA 4M7DF 1IB8A 1I1JA 2BZYA 1WHJA 3G71A 3CCUQ 4PJLA 4XQ3A 3CCQT 4DQ2A 4KGZB 2RQUA 3LH5A 3SEMA 3HL8A 4Y92A 1KK7A 1M3CA 2E3IA 3O5ZA 1V29B 2V8IA 2LQNA 2V26A 5GAMf 4PLLA 4FSSA 2GTJA 3X25B 3S3OA 3JB9D 3M4GA 1M90U 1M2VB 2LVMA 1WNLA 5HK0A 2WACA 4XTZA 3C12A 4AMCA 3UDCA 2L3PA 1KC8U 2FPEA 2X4JA 3OYLA 1PKSA 2PU9B 2K5FA 4PNOA 3OS1A 3MEAA 3AHUA 4GY5A 3JCMW 3PGGA 1WXTA 1YIJA 1YIJQ 2RJDA 2LDMA 1SRMA 2DXUA 1PD0A 1I81A 3M9QA 3OW2S 4MDWA 1V76A 4C0FA 4M7DA 4IIOA 3FLGA 2VGNA 5IT9E 4R56A 2C06A 1NPPA 1YN8A 2NUTA 2MOXA 2QXFA 3LYIA 2HQXA 1MGQA 3CC4Q 3EG0A 1PG5B 2PVGB 3FRNA 1WQ7A 2GCXA 1VQ4Q 4J9DA 4O5VA 1FMVA 3JSCA 4A4GA 3UPUA 2DL3A 1VQ6T 2NUPB 1ZX6A 2QGFB 2E4HA 4M78G 1LOJA 1GXIE 4F7UG 3M5AA 3DB3A 4PFOA 4QQ6A 4Y91A 4X9CA 4TVRA 3A8OB 3LGLA 3NFCA 1NPRA 3AT1B 2XMFA 3QWXX 1NEBA 4N0AC 5KE2A 5GMKl 1WXUA 2LP5A 4E2FB 1D1CA 3VV0A 2E5KA 3V8KA 4C8QE 4BY6C 1QCNA 2FZGB 2YUQA 4J9EA 2MAMA 2RN8A 5L23A 1ACMB 2L5QA 3ASKA 2VYTA 2EYQA 2D1XA 3HTRA 4OB3B 3OYYA 4RTVA 2HNIA 5HKCA 3TCJA 4RMOA 3G4ST 5IHNA 4L5GA 3RDVA 5DY9A 1W6XA 3SWNC 4JRPA 3EHRA 3CXCP 2EGEA 3EGDB 2D9TA 2QTXA 3PNWC 5GAN4 1YJNA 1RADB 2J06A 3RR6A 2QQAA 5KYWB 1NLOC 1YBYA 2FL7A 5FRMA 4JJCA 4C8QD 2KSSA 1PWTA 4AFQC 4ZNXA 3S3NA 2EJGA 1TS9A 1BIAA 2KK4A 2RI2A 2LNHB 4LUEA 2M0YA 1YJ9T 1TH7A 3URGA 2KQWA 5HK3A 4ATOA 4M77C 3QJ6A 1M1FA 1BYMA 1X6OA 2AZSA 1XOVA 1Q82R 2ECZA 2DTHA 4BI4A 3I56A 1W2BA 2RK2A 3MKDA 4PJOE 2CYZB 1RACB 5KH6A 4JS5A 1UB4A 4GLMA 1NM7A 3LW5E 3META 4AT1B 2LTOA 4D8DA 2KDSA 3CCUA 1FWZA 3F70A 2LT4A 3JB9G 3HRUA 2HSPA 4CC2A 3E9FA 3CCJQ 1FMKA 1Y7XA 2KT8A 1RI9A 1QVFA 4ZTFA 4VUBA 5GJWB 2MWPA 1AWXA 3QG1A 1Q86C 2PVDB 1MMDA 2CZ0B 2LC4A 3CCQA 1K8AC 2OTLQ 3A8HB 3LH0A 2EQJA 2O9SA 4OB1B 4PJOA 1YCSB 2HBWA 2DIQA 2L0AA 3A8LB 3FC3A 3CQTA 2PNIA 4JPBW 3FB9A 4E7LA 2BTTA 4PK4A 1YI2A 2Z0WA 2JM8A 3OS5A 5GJVB 4J9HA 9ATCB 2E6NA 2XDPA 4FT4A 4JJNK 1M30A 2L2PA 3I9QA 1UGVA 3E19A 3OSVA 2LCCA 5AT1B 3J80E 1T0HA 2CUDA 3OA6A 5M9OA 4A4KA 4JZ3A 3A1PA 3HRTA 3VU3C 4J83A 2RHXA 1XJWB 4JZ4A 2LX9A 1TUCA 3OBYA 4M75D 3OW2A 1ZUUA 3VS0A 3E9GA 1N8RU 3G6EA 4QQDA 4BE1A 2CP5A 2K2MA 4OMQA 1UDLA 1KQ2A 4O6JA 5LJ3g 2VC8A 3I55Q 1B07A 2M51A 2KI7A 5GAOl 3CCLQ 3RUXA 3VRYA 2WSCE 4ZN1A 2QEXQ 2A3LA 3M0PA 2DYIA 1M1KU 1U3OA 4C8QF 4M78A 3CCLT 2H3JA 1RLQC 2CSQA 5LJ5f 2YLBA 3BDLA 2QEXT 2FEIA 4FL6A 2EYWA 1TG0A 3C94A 2DBKA 2ABLA 5IAYA 1FXXA 1HYOA 2DL4A 1VQ8A 2XDBA 1RAGB 5FU6B 3H8ZA 3PMIA 3CC7Q 3OYDA 2DEUA 2NYSA 2DETA 2LJ1A 3OYCA 2MPXC 4QVCA 2VVKA 4DBFA 1QLYA 1SKUB 3T9NA 5IN1A 5LL6S 4F16A 5KYNA 1B3QA 2KXDA 2EIFA 2O4XA 2P0QA 4D6WA 1WJQA 3OMCA 4JJDA 4WCIA 2RPNA 2OTJA 2BUDA 4EMGA 3A5ZB 2RK1A 1OOTA 1KSWA 3FJ5A 4LE9A 4FSXA 5DLOA 1Q82U 4A53A 2AZVA 3INZA 2XIDA 3M55A 3EFOA 1IHWA 4C8QC 2DZ9A 5GAMd 4N0AA 3ZBDA 3OYJA 2F69A 3VS1A 4MZMA 1D09B 4RUGA 3L2WA 5J3BA 3CMET 3BY7A 4BI8B 2R58A 2H3EB 1B34B 2K5LA 1D0ZA 4DOWA 2CP0A 1VQ8Q 1R0CB 3QBYA 3CCEA 1W2BS 3M54A 4M75E 4J6WA 1ZA2B 3I56T 3RMSA 2SRCA 1NBEB 5C0MA 2X3XD 1YP5A 4MZPA 1UJ0A 3MEWA 2CP7A 5I21A 1AOJA 2LZ6B 3ZFJA 5CVIA 1TUDA 3QDRB 2OTLA 3BDUA 4JDSA 1QVFS 2A36A 2RQRA 6AT1B 4KUIA 1VQ7Q 1WXBA 1N8RR 3LWIA 4PJOF 4HCKA 2JMAA 2JVVA 5KE3A 2R57A 2DERA 1EX4A 3OB9A 2KRNA 1M90C 1CKAA 1QVPA 4WTOB 2DZCA 1JJ2S 1H3ZA 3VS2A 4KRTA 4HVWA 2E3HA 4M75G 4FCYA 4RG8A 5GAOn 4DBRA 3JCMP 3GNGA 4ZTJA 3GIBA 3A8MB 1LCKA 4J9FA 2E64A 1QVFP 1BI0A 3HKSA 3L2QA 1KC8C 3L2RA 1Z9ZA 4V2SA 5CAIA 1KHCA 2QK0A 2PUOB 4DBQA 4BE2A 3L1AA 1QWFA 3CXCS 3N5BB 1WQWA 4BACA 1SRLA 2YXYA 4DBHA 2CGHA 4Z8AA 2XD0A 1R8OB 1BI2A 1JB0E 1W2BP 2CDTA 2PUKB 3JAME 4XU2A 1UE9A 2RHZA 1OULA 2RQTA 2LQWA 4XU0A 4IUVA 4CRIA 4QKUA 2ZPBB 2ENMA 1YJWT 3CEYA 1X75C 3NTIA 2XG8D 3CPFA 1U1SA 3EH2A 2VUBA 3RIRA 1G3WA 4HCZA 1NJIU 1LJOA 4FM4B 1O75A 1YWPA 5I2MA 1Y96B 3QXEB 1UUEA 5D7UA 3EFRA 1OZ3A 1VQ5Q 3CC2Q 4WF2A 2FRWA 5GMKm 1LNXA 4L6V5 4HT9A 1YIJT 3RKXA 2CZ6B 2MK5A 2Y90A 4QVZA 4RTYA 3VYGA 1NYFA 2CT3A 3M4YA 1YITT 5GMKj 1Y0MA 4M7DE 2YDLA 2VWFA 2JOYA 3TQ7P 2DM1A 1QVGS 1CKBA 1K0SA 3NMZC 1BIBA 4R0KA 4GBQA 2RJEA 3LLRA 2FPFA 4N4IA 1NLPC 1C1AA 3V8LA 2QQSA 4CC4B 2DXCA 3ME9A 3VS5A 2GQIA 2KYMA 3OW2P 1C0MA 4F14A 2YRVA 4CC3A 4C92F 2DRKA 3V8JA 1PNJA 1K9AA 3CPWP 3CPWS 1KQSA 3CCUT 4A4EA 1I0CA 3VKIA 2JW4A 5J26A 2DYBA 3R6NA 3H9NA 3KXTA 1M4ZA 4XAXB 1PD1A 1RAEB 4LDXA 2ED1A 1VQLT 4E6RA 5GAN7 5GANj 5J39A 4C92D 2WSEE 1GFCA 3OS0A 3SB2A 1HXDA 2CZ7B 1JQQA 1W4SA 1WHMA 2BIVA 2DKGA 5CKEA 1VQ9Q 4M7AC 4PFPA 2E70A 3CD6T 3TVTA 1WHKA 1Y07A 3OMGA 3V7RA 1MNEA 1T3LA 2K9GA 1YI2T 1WPYA 2L3RA 2V1RA 3JB9F 8ATCB 3RNJA 5KYWA 3CD6Q 4BD3A 4RCBA 2MCNA 3EFOB 1GCQA 2YUPA 1K4US 4J6XA 3P8HA 4F7UA 4NL3A 5D6WA 1K0XA 2A28A 2P0PA 2OTLT 2CP6A 2ZPGB 5CCAA 1QMCA 1D1AA 2ZPEB 2BKDN 3BFMA 2H8HA 2F1LA 3PMTA 1YJ9A 1QWEA 2VXEA 5HCKA 2W10A 3RESA 2LRQA 3E2UA 4FT2A 4XTUA 2P4RA 5GAOr 2QDLA 3H0IA 1X01A 5CKHA 3X24B 2PZ1A 4Q5WA 2ZCFB 2QA4Q 4J7FA 1PM3A 2NUPA 2CSIA 5LJ3h 3HP9A 4F7UE 1K1ZA 3EGDA 4ZGEB 2L3QA 4IUUA 3TEEA 3MEUA 2RM4A 2HQHA 1QQJA 3EG9B 4FW2A 1X6BA 2A37A 1OEBA 2KGTA 1BK2A 1ZA1B 5ECAA 1UHCA 3UWNA 3M58A 4M77E 1HSQA 4OMFB 3HPWA 3HFOA 1U5SA 1ZUYA 3ZL7C 2RF0A 2X9HA 1M1GA 2J6FA 1EZZB 4KUDK 4A63B 4M77B 5AYFA 4RTTA 2KY9A 4LD9K 3MCAB 5GMKh 1K8AR 2F2VA 1S1NA 3VS4A 4FYXB 3RERA 2C0TA 1I4K1 1MMAA 4J5YA 1SF9A 4ME7A 1QKWA 2I0NA 1IZ6A 2DO3A 3OYAA 2CT4A 3HFNA 2ZGWA 4E47A 2DA9A 1N9SA 4M7DC 4J9BA 2EVRA 2LQKA 4JRIA 2O31A 5GAMe 3REAB 2D0NA 2COZA 1GBQA 1WJSA 1K73U 3QPHA 5LJ3j 3ER0A 4L59A 3QYHB 4KBMB 1SPKA 1QVGA 3GBQA 1UTIA 4RCCA 3UATA 3I55T 2DD5A 4M7DD 1OU8A 3M0SA 4C92A 3L2UA 1G8XA 4M75A 2M02A 2G3RA 2OX7A 1HD3A 5EC7A 1SG5A 4M7AD 4ORZA 3CCJT 4C92G 2HKNA 5KYXA 1KQ1A 2XU8A 3L2VA 4MMLA 1D1BA 3CPWA 1KQSS 2EGCA 3M0RA 1SSFA 4EPCA 2KAFA 3BE3A 2KRMA 2HMAA 4OGCA 3M0QA 2BZXA 2O2OA 2E65A 1BKBA 4D8KA 1VQ8T 2AK5A 2KEAA 3MPUB 2EYZA 4ELYC 2M16A 2EW3A 2VV5A 2BE9B 1BI1A 2CZ1B 3MEVA 3M0TA 2QTVA 1AT1B 1ZSGA 1YJ9Q 2LMJA 1NJIR 3JRZA 4QW2A 1AEYA 4PKCC 3GP8A 2KT1A 3CBOA 1JJ2P 2HL5C 3KBGA 4IUTA 4J9GA 5GANg 2V8JA 4RG2A 5DM7R 4M78F 3EG2A 4OGEA 1TWBA 3VJPA 3OYIA 1EIFA 2DEQA 5LJ3f 1HJDA 1VYTA 2QI2A 2P84A 3CCSA 1JEGA 2L3SA 1ZBJA 1IRXA 1NYGA 4J9CA 1WJRA 1MMGA 2K2VA 3HRSA 1Q7YC 5FW9A 2DVJA 3QYGB 3TREA 4M78C 4M77A 1V1CA 5LJ5d 3JCMg 1WDXA 4PJJA 1GL5A 1P92A 1VQ7A 3GNFB 1WFWA 4JLIA 2O4XB 3CMAA 2HAXA 4M4ZA 1S72T 1WIEA 2L8DA 4II1A 2E10A 1JXOA 3DB4A 1D0XA 1N8RC 1UECA 2DL7A 2V8KA 5FU7C 5IHKA 3UT1A 4M7AE 1J3TA 4OP0A 2RA2A 2OAWA 4NS5A 4ESRA 1QCOA 2ROLA 2X4WA 3SFMA 3JCMh 1FX7A 4DOVA 1QP2A 3CCEQ 4LDUA 1T3SA 3Q1JA 2LJ3A 4X1VA 2RI3A 1RAAB 1R0BG 4M78D 5KCHA 2YRCA 4M77G 1KJWA 1WZOA 4B6MA 1UFFA 3JCMb 4AFZC 3OYHA 2JTMA 4AFSC 1KHIA 1VQKQ 1MV0B 1Q86U 2RO0A 1H8KA 1K73R 3JCMc 1TUGB 3G6ET 1YJWQ 5CO7A 1B34A 4BDYA 1Q81C 3I5RA 4PJOD 2LNVA 2XHCA 4AG2C 2COYA 4EDUA 3RKYA 3CCMT 4BE0A 2EQUA 4GLKA 2X4XA 1BB9A 1C6VX 1PHTA 1IHVA 2GQVA 1QVGP 2KMTA 2KVQG 5LJ3e 4X34A 2JS2A 2CUBA 2NWMA 2SEMA 3X28B 4HCBA 3HHTB 1RAIB 2GFAA 2IG0A 1SSHA 3CXCA 3EGXA 3MP1A 3MJXA 3D7SB 1AZEA 3LGFA 4BB7A 1PRLC 2QGGA 4Z88A 2OI3A 1JO8A 3QSUA 2B86A 2KBTA 4C5HA 1E6HA 1MUZA 1YCYA 3CC7T 4RTZA 5KYXB 3DLLA 2DLPA 2NUTB 1N9RA 1BCOA 1LVKA 4M7AB 1TXQA 3VRZA 1TU0B 1UG1A 1TSFA 1YJWA 5D6YA 1ZHIA 1YHQT 4ELZC 2ATCB 2HBPA 5I11A 4IIMA 4AG1C 1JBMA 4AFUC 4DA4A 2HSEB 2P0KA 1XNIA 2EWNA 1M5Q1 1VQNA 3WVDB 4QT7A 4LUDA 3M56A 2HL3A 2FRYA 3C4SA 3CC2T 2RMOA 3DLMA 2OJ2A 3LX7A 2Y4XA 1QP3A 3G7ZA 4RTUA 1BU1A 3CMEQ 4M78E 3JCMJ 3CMEA 3CCVQ 3JCMf 4OMLA 5GAOq 1ZLMA 4DEYA 3GLXA 4EMKC 3EG1A 5CK9A 2JT4A 1H92A 4C92B 3CCET 2HQEA 3BW1A 3PVQA 5IXBA 2F5KA 1YI2Q 3O8VA 2YSQA 4LDVA 4LNPA 3CCVT 3I56Q 2AT1B 4A54A 2M9UA 4PJMA 1VQPA 8AT1B 2JTFA 4MDXA 2AIRB 5GAMj 1QW1A 1Y71A 1G5VA 2FVUA 1KQSP 4B9WA 4C92E 1IGUA 2X35A 2DFUA 1M1KC 1UGQB 2DAQA 3OYEA 3QDFA 3QWYA 1HK9A 2GBQA 1OPLA 2YUOA 1OU9A 2OAUA 2RHUA 5CQYA 4XU1A 3QKJA 2RQWA 3OYGA 2E12A 2IPOB 3JCMQ 2DILA 4OMPA 2D8HA 1O9SA 4JS4A 2RJFA 4M7DG 2VASA 2FG0A 2KE9A 2BZ8A 2CP3A 2QDYB 3JCMX 2CKKA 4BUGA 1QCFA 2JM9A 3A8GB 3R6OA 5GMKe 1OV3A 5GANd 1UEBA 2FYKA 4PJOB 1KG1A 4N4GA 5A0GA 4FIBA 5D6XA 3UA7A 1I07A 1UGPB 3FDRA 5LJ5h 1VQ5T 2RD1A 3QO3A 3M57A 1WHGA 7AT1B 1VQKA 3OYFA 4LDWA 2HKQB 1VQPQ 2XK0A 4OF1A 3CCRT 1CSKA 4LDYA 1YITQ 2M1HA 1VQOQ 4M7AF 1ZSZB 2MIOA 5FROA 2FZKB 1X2KA 3TSWA 2EPDA 3CCRQ 1RABB 3VUBA 2DD4A 4XTVA 1IREB 5CKDA 5GAN2 2DK3A 1X6GA 2K79A 3U23A 2KR3A 4C0ZA 3WXMB 1F1BB 2F5TX 2DTOA 2KXCA 2CS7A 3C95A 1PRMC 2M0OA 4OVAA 3VS7A 4LD6A 4KGXB 3IQLA 2K57A 1G83A 3CCMA 1ZUKA 1FYNA 1KD1U 4F7UB 3ULRB 1K73C 3PT9A 2GF7A 2NUZA 4C92C 1Q7YU 4M75C 3J81E 4KGVB 5GAOm 4EMKB 2J6KA 4R55A 2O9VA 3L2ZA 1AWOA 3EG9A 2D8JA 4F7UF 5A0DA 2DIGA 1RAFB 2JTEA 2DE0X 1SHFA 4M78B 1VOMA 4P5NA 3VS6A 4Z02A 1YWOA 3REBB 1YITA 2K5IA 2K3YA 4PJOG 2AKKA 2YUNA 1DJ7B 2PVOB 5GAN6 1NEGA 4FYVB 1ABQA 3JCMV 1Q81R 2YLCA 2FZCB 4M7AG 2ZZDA 1W70A 2EKOA 4XTYA 1OPKA 2RI5A 2MMPA 4OB0B 3NHNA 1G3YA 2EFIA 3DKMA 1M90R 1B7TA 1N27A 1YHQA 1VQMA 3V7CA 5IXFA 2X51A 1VYUA 1G2BA 3EGUA 2DL5A 4M77D 1VUBA 3UA6A 5CIUA 1VYVA 4XTXA 2VXFA 1WA7A 4QVDA 1VQ6Q 2RQVA 5LJ5e 3VS3A 2C0OA 1WLPB 1AHJB 2LJ0A 3QJYA 1VQ7T 2EAYA 5GAN5 1N6AA 2RNAA 1VQLQ 1NG2A 2ZPHB 2ED0A 2P4TA 3QZ9B 1S72A 3QHSA 2YRDA 1NZ9A 5GAN3 2MWOA 4XTWA 2RHYA 2DNUA 1NJIC 3CD6A 1ZQ1A 2DF6A 3RKWA 1VQ9T 2R5AA 5LJ5j 1KIKA 2MYSA 1YNZA 3H41A 1MMNA 3CCJA 1KC8R 3EG3A 3KFVA 5IH2A 3P8BB 1OX8A 4DEXA 1UGSB 1OI1A 2F2WA 4XU3A 1OYXA 1D0YA 1OZ2A 3NGPA 4C0DB 1UHFA 2AHJB 4CC7A 1VQMQ 2KNBB 2OTJQ 1ZBXA 4LXCA 4FU6A 3X26B 1G3SA 2ROTA 2JXBA 2EQKA 2FB7A 2JUFA 2QQBA 3GOXA 4EMKA 4C8QB 2E5QA 3CBMA 5KYYA 2WSFE 4M75B 4FYYB 2BE7D 4ZGDB 1SHGA 1AD5A 2LQ8A 3MHXA 3MO8A 2LX7A 1RL2A 2FO0A 2VKNA 4M75F 4J7IA 1T0JA 3FEOA 2VB6A 1GCQC 2IIMA 1Q7YR 2I2LA 2CH4W 1RUWA 1ZSZC 3PIOA 1VA7A 2QA4T 1VQOA 1D3BA 5FWCA 1PKTA 1GFDA 3SWNA 1GBRA 1M2OA 3I5SA 1VQKT 2C0IA 1IXDA 2CP2A 3PFSA 1WGSA 4PLIA 1MNDA 3EAEA 4EIKA 1Q95G 2JNGA 2E6ZA 4KULA 1WHHA 4OB2B 1I8FA 5CR2A 2DX1A 2EBPA 1XTDA 3THKA 1MV3A 1BCMA 3PTAA 3CMAT 2K4YA 5FU6C 1UJYA 3OS2A 4HA8A 1H3HA 2VGMA 4E7ZA 2DPPB 3CC7A 4C5IA 4Y28E 1RI0A 1Y57A 3H0HA 3JB9I 3CMAQ 2W0ZA 4N4HA 4C0GA 5GANh 4J8OA 5CKBA 5GANf 1PCXA 2QQRA 3KUFA 1K9MR 3UF4A 1YFNA 1M3BA 3CC4T 4ZN3A 1KD1R 4JLGA 1QKXA 3H6ZA 4IURA 2DMOA 2LT1A 3CCLA 3OSSC 5GAMh 1XQHA 3X20B 1NE8A 1ABOA 2QEXA 2GNCA 3ZEHA 1G3TA 1D3BB 3JV3A 2HCKA 3G6EQ 1YHQQ 4JUVA 3I55A 2QQ9A 2DXBA 1PC0A 3C0CA 3H0FA 4IKFA 1K9MU 5DLQE 2QAZA 3M0UA 3OYBA 3LWHA 5EG2A 2HD0A 4OMMA 4Z89A 5KYYB 5GAOp 5HY6A 4HCCA 2K6DA 4NL2A 1AZGB 3EGXB 1A0NB 1VQ6A 4FW1A 2DXTA 4OMNA 2V1QA 3VYHB 2EJ9A 1Y96A 3MP6A 3NTKA 2A08A 1VQ4A 2JMCA 1K9MC 4A4HA 1WX6A 2YT6A 4PL6A 1S72Q 3RBBB 2RJCA 3J7AF 4E7JA 3QZ5B 2EJFA 3G4SQ 3NPFA 1WI7A 2DJZA 1MHNA 3JCMe 4M7AA 2EKHA 2QG9B 1AWJA 1M3AA 1TOVA 1X69A 3VUZA 2X3WD 4HKEA 2A7YA 2R5MA 2LCSA 3M53A 2CH4A 3CCSQ 1K8AU 4ANJA 2AKLA 1RAHB 5GMKi 4ZGJB 2YHTA 1VQNT 2X4YA 3SD4A 4IUPA 2FHDA 1UGRB 2RHIA 5LJ3d 4XK8E 2FPDA 3CCST 5C6SA 4KH0B 5CQXA 1RLPC 3G71Q 1KFZA 3CCRA 2D0QB 2RB6A 3SHWA 1H641 4HT8A 3P8DA 1JU5C 2GFUA 2QASA 1Q81U 4E7HA 1U8RA 2K7AA 4KT0E 4IUQA 4LN2A 1R77A 3G71T 2DVEA 4FYWB 1Q82C 2EGAA 3M59A 3SWNB 4M77F 4J6YA 2QYZA 4RTWA 3CCVA 1JXMA 1GCPA 2DL8A 1LPLA 1VQPT 4M7DB 3HSBA 5IHIA 4PJNA 2E41A 3TSZA 2A0FB 2MI6A 5CKFA 1M1KR 2QA4A 1VQOT 2KROA 2ZPIB 2L89A 2K3BA 4K11A 2IVWA 4OMOA 4F04B 2O88A 2PTKA 2K3XA 2GTOA 1Q86R 4X9DA 1PSEA 4BI3A 2J7IA 3FJPA 1K76A 2ESWA 4JJBA 4E7IA 4PFZA 1ARKA 5FWBA 1U1TA 2LCLA 4MZTA 1JJ2A 3CBPA 1TTHB 5LJ5g 3S3MA 2XI9A 4HVUA 3NTHA 4F17A 2NLUA 4C5GA 2HDAA 3JB9H 2KRSA 2E1HA 2HEQA 3A98A 3E1SA 3CCMQ 5KYUA 3GPLA 1VQ5A 2JS0A 5A2QE 4KH1B 1BI3A 4C8QG 1FMWA 1VIFA 1X27A 4JRKA 3S6WA 4C0DC 2ZAEA 1AVZC 2HZYA 3OYMA 4MMKA 1PSFA 4YTLA 3MP8A 3CC4A 1IO6A 1EFNA 3JCMd 1M9SA 2JJ9A 2J6OA 3V7SA 2DRMA 3FIFA 3OBWA 2ZPFB 2G6FX 4UC4A 1OX9A 2DTIA 3L42A 2KYBA 1IGQA 2DBMA 3EH1A 4E7SA 3PIPA 2D6FA 2JZ2A 5GAMg 3OYKA 1VQNQ 3QIIA 4C5EA 2Y4YA 1AWWA 2DJQA 5GANe 1X43A 2XKOC 4BY6B 1VQ9A 1YJNQ 3GF5A 4EMHA 3I35A 2F2XA 2YWWA 3PE0A 3G4SA 1M8VA 4NOYA 3JB9J 3CC2A 4HXJA 4QQGA 1YJNT 1OQKA 1VQ4T 2EYYA 4A4FA
chains in the Genus database with same CATH topology
2VXFA 3INZA 2XIDA 3M55A 4OGCA 5FU7B 4C8QC 2DZ9A 5GAMd 4N0AA 4QVDA 4CI0C 2E65A 1BKBA 5LJ5e 3ZBDA 3OYJA 1VQ8T 2PQWA 2F69A 1AHJB 4ELYC 4MZMA 2XDDA 2EQMA 3QJYA 3OY9A 3OQ5A 3L2WA 2M16A 2EAYA 5FLXE 1JRIA 5J3BA 5GAN5 3CMET 2VV5A 1N6AA 3BY7A 1BI1A 2CZ1B 3MEVA 4BI8B 2R58A 1VQLA 3SDZA 2ZPHB 2P4TA 3QZ9B 1S72A 1B34B 2K5LA 3QHSA 4DOWA 1NZ9A 5GAN3 2B8AA 2MWOA 1KD1C 4XTWA 2RHYA 3QBYA 3CCEA 1VIEA 1W2BS 3JRZA 5FRNA 2O01E 3M54A 4M75E 3RMQA 4J6WA 4QW2A 1NJIC 1ZQ1A 4E7KA 5A0LA 3CD6A 3WVEB 4PKCC 5L8RE 3RKWA 3GP8A 4BDZA 1VQ9T 3I56T 2R5AA 3RMSA 5LJ5j 1VQMT 3CBOA 3OYNA 4PJOC 4IUTA 3KBGA 3CCJA 2OTJT 5C0MA 1I5LA 4C8QA 3P8BB 5GANg 2V8JA 4RG2A 5DM7R 1UGSB 4M78F 4MZPA 4JRQA 4RKUE 2MF2A 4OGEA 3VJPA 1OI1A 4B9XA 4XU3A 3OYIA 1EIFA 3MEWA 5I2SA 1OYXA 1OZ2A 2DEQA 2RH2A 5LJ3f 2QI2A 4C0DB 3CCSA 2AHJB 5I21A 3TU4K 2XICA 3ZFJA 3EFSA 2JN0A 5CVIA 5GAN8 1WJRA 1ZBXA 2K2VA 3HRSA 1Q7YC 3QDRB 2OTLA 3TREA 3BDUA 3QYGB 4FU6A 4M78C 4JDSA 1QVFS 4M77A 3X26B 1G3SA 5LJ5d 3JCMg 3QUIA 2EQKA 4KUIA 5KCOA 2FB7A 2JUFA 4M7DF 2QQBA 1P92A 4PJOF 4C8QB 4EMKA 3LWIA 3GOXA 2E5QA 1VQ7A 3CBMA 3GNFB 3G71A 2JVVA 2O4XB 2WSFE 4JLIA 4M75B 4XQ3A 3CMAA 5KE3A 4DQ2A 3CCQT 2HAXA 2R57A 1S72T 2L8DA 3OB9A 4II1A 2E10A 4ZGDB 3DB4A 3HL8A 1M90C 1N8RC 2V8KA 5FU7C 1QVPA 2LQ8A 3MHXA 3UT1A 3MO8A 1RL2A 4M7AE 2DZCA 4M75F 1JJ2S 1H3ZA 4J7IA 1V29B 2RA2A 4OP0A 3FEOA 2V8IA 4NS5A 2I2LA 5GAMf 4PLLA 4M75G 3PIOA 2X4WA 3X25B 2QA4T 4RG8A 3SFMA 3S3OA 3JB9D 1D3BA 3M4GA 3JCMh 5GAOn 3JCMP 1VQOA 1FX7A 1M90U 3GNGA 4DOVA 2LVMA 1QP2A 4ZTJA 1WNLA 4LDUA 3Q1JA 3GIBA 5HK0A 3A8MB 3SWNA 2WACA 2E64A 4XTZA 3C12A 3UDCA 1BI0A 1VQ7T 1KC8U 1VQKT 3HKSA 3L2QA 3PFSA 2X4JA 1WGSA 4PLIA 3OYLA 1KC8C 3EAEA 3L2RA 2PU9B 2RI3A 4M78D 5KCHA 2JNGA 4M77G 2E6ZA 2K5FA 4KULA 4PNOA 4V2SA 5CAIA 1KHCA 2PUOB 3OS1A 4BE2A 3MEAA 4OB2B 1I8FA 3AHUA 5CR2A 3JCMb 4GY5A 3OYHA 2JTMA 3L1AA 1KHIA 1XTDA 3JCMW 3PGGA 3CXCS 3N5BB 1WQWA 4BACA 3PTAA 1Q86U 2CGHA 2RO0A 1YIJA 3CMAT 2K4YA 5FU6C 1R8OB 2XD0A 2RJDA 1BI2A 1JB0E 2LDMA 4HA8A 3JCMc 3OS2A 3G6ET 2DXUA 5CO7A 1I81A 1B34A 4BDYA 2VGMA 3M9QA 3OW2S 2DPPB 4MDWA 3CC7A 1Q81C 4PJOD 4C0FA 2LNVA 2XHCA 4M7DA 3FLGA 2VGNA 5IT9E 4C5IA 2PUKB 4R56A 1NPPA 4XU2A 3JAME 4Y28E 2C06A 2RHZA 1RI0A 4EDUA 3RKYA 2QXFA 3LYIA 3CCMT 2HQXA 4BE0A 4XU0A 1MGQA 3JB9I 2EQUA 4GLKA 4IUVA 2X4XA 2PVGB 4CRIA 4N4HA 2ZPBB 1YJWT 3CEYA 3FRNA 1X75C 4C0GA 1WQ7A 2GCXA 2XG8D 3NTIA 4J8OA 5GANh 3CPFA 4O5VA 1U1SA 3JSCA 5CKBA 4A4GA 5GANf 2VUBA 2GQVA 3RIRA 1G3WA 2KMTA 2QQRA 3KUFA 2KVQG 3UPUA 5LJ3e 4HCZA 4X34A 1VQ6T 1NJIU 1LJOA 4FM4B 3X28B 3CC4T 4ZN3A 3HHTB 1O75A 4HCBA 4JLGA 3H6ZA 4IURA 5I2MA 4M78G 1LOJA 1Y96B 2LT1A 2GFAA 3QXEB 3CCLA 2IG0A 3EFRA 1OZ3A 3CXCA 1GXIE 4F7UG 3M5AA 3MP1A 3DB3A 3OSSC 4QQ6A 4WF2A 4X9CA 4Y91A 4TVRA 1XQHA 5GAMh 3X20B 3A8OB 3LGFA 1NE8A 4BB7A 2QEXA 3LGLA 5GMKm 1LNXA 4L6V5 3ZEHA 4HT9A 3NFCA 1YIJT 3RKXA 2Y90A 1NPRA 1G3TA 2CZ6B 4QVZA 3VYGA 3QSUA 1D3BB 4C5HA 3M4YA 4N0AC 1YITT 5KE2A 5GMKj 5GMKl 4M7DE 1YCYA 4JUVA 3CC7T 2JOYA 3DLLA 1QVGS 1N9RA 3VV0A 3I55A 3V8KA 1BIBA 4C8QE 2QQ9A 2DXBA 4M7AB 4BY6C 4IKFA 1K9MU 5DLQE 2RJEA 3LLRA 4N4IA 3OYBA 2MAMA 3V8LA 3LWHA 1YJWA 5D6YA 1ZHIA 5EG2A 2QQSA 1YHQT 4ELZC 2HD0A 2HBPA 2DXCA 5GAOp 1JBMA 3ME9A 5HY6A 4DA4A 4HCCA 2L5QA 3ASKA 4NL2A 2VYTA 2P0KA 2EYQA 1XNIA 2EWNA 1M5Q1 4OB3B 3WVDB 1VQNA 3OYYA 2YRVA 1VQ6A 5HKCA 2HNIA 2DXTA 3TCJA 4RMOA 3M56A 3G4ST 3VYHB 2EJ9A 4L5GA 1Y96A 3MP6A 5DY9A 4C92F 3V8JA 3NTKA 3SWNC 4JRPA 1VQ4A 3C4SA 3CC2T 1K9MC 3CPWS 2D9TA 2QTXA 3PNWC 4A4EA 5GAN4 3CCUT 4A4HA 1YJNA 3VKIA 4PL6A 5J26A 3DLMA 2QQAA 2RJCA 1YBYA 2FL7A 3J7AF 4E7JA 3QZ5B 3LX7A 3KXTA 2Y4XA 1M4ZA 4XAXB 2EJFA 5FRMA 1QP3A 4C8QD 2DJZA 3G7ZA 1MHNA 3JCMe 4M7AA 4LDXA 2KSSA 4M78E 3JCMJ 3CMEA 3JCMf 5GAOq 3S3NA 2EJGA 1VQLT 1BIAA 2KK4A 3VUZA 2RI2A 3GLXA 5GAN7 5GANj 5J39A 4HKEA 4EMKC 4C92D 5CK9A 1YJ9T 2A7YA 2WSEE 3OS0A 4C92B 1TH7A 3SB2A 3URGA 2KQWA 5HK3A 1HXDA 2HQEA 3BW1A 4M77C 3CCET 2CZ7B 4ATOA 2F5KA 1W4SA 2R5MA 2DKGA 2BIVA 1M1FA 3M53A 3O8VA 1X6OA 3QJ6A 4LDVA 1XOVA 5CKEA 3CCVT 4M7AC 1BYMA 2DTHA 4BI4A 4A54A 2E70A 2RK2A 3I56A 1W2BA 1K8AU 3CD6T 2M9UA 1VQPA 4PJOE 2CYZB 2JTFA 1Y07A 5KH6A 4MDXA 5GMKi 1UB4A 4ZGJB 4JS5A 3OMGA 3V7RA 2YHTA 3LW5E 3META 1VQNT 2X4YA 3SD4A 5GAMj 1QW1A 4IUPA 1Y71A 2LTOA 1WPYA 2L3RA 2FVUA 2FHDA 1YI2T 1G5VA 1UGRB 4B9WA 2RHIA 5LJ3d 3JB9F 4XK8E 4C92E 3CCST 2KDSA 2X35A 4BD3A 5C6SA 4RCBA 1UGQB 1M1KC 5CQXA 2DAQA 3CCRA 3CCUA 1FWZA 2D0QB 3F70A 3OYEA 2RB6A 2LT4A 4J6XA 3JB9G 1HK9A 3P8HA 1H641 3HRUA 4F7UA 5D6WA 3P8DA 4NL3A 3E9FA 4HT8A 1Y7XA 2GFUA 2P0PA 1Q81U 2OTLT 2ZPGB 2OAUA 5CCAA 4E7HA 2RHUA 5CQYA 1U8RA 4KT0E 1QVFA 4XU1A 4VUBA 4ZTFA 3QKJA 2ZPEB 4IUQA 2BKDN 3OYGA 2E12A 2MWPA 3G71T 3QG1A 2DVEA 3BFMA 3JCMQ 1Q86C 2PVDB 3PMTA 1O9SA 4JS4A 1YJ9A 1Q82C 2RJFA 4M7DG 2CZ0B 2LC4A 3CCQA 1K8AC 3M59A 3SWNB 2VXEA 2QDYB 4M77F 2CKKA 3JCMX 3A8HB 3LH0A 4J6YA 2EQJA 4BUGA 3A8GB 3CCVA 3R6OA 2LRQA 3RESA 5GMKe 4OB1B 5GANd 4FT2A 4PJOA 2DIQA 1UEBA 2FYKA 3A8LB 1VQPT 3FC3A 4M7DB 4PJOB 4N4GA 4XTUA 5A0GA 3HSBA 1KG1A 4FIBA 5D6XA 2E41A 5GAOr 1UGPB 1X01A 5CKHA 3X24B 2MI6A 3FB9A 5CKFA 4E7LA 3FDRA 5LJ5h 2QA4A 2RD1A 4Q5WA 1VQOT 2ZCFB 1VQ5T 3QO3A 1YI2A 2ZPIB 3OS5A 4J7FA 3M57A 2L89A 5LJ3h 2E6NA 2XDPA 4FT4A 4JJNK 1VQKA 3OYFA 4LDWA 3HP9A 2XK0A 3E19A 3OSVA 4OF1A 2IVWA 3CCRT 4LDYA 4F7UE 2LCCA 4ZGEB 3J80E 4IUUA 2M1HA 3OA6A 5M9OA 3TEEA 3MEUA 4A4KA 2RM4A 2K3XA 4M7AF 3HRTA 3VU3C 4J83A 2RHXA 4X9DA 1KQSA 1PSEA 5FROA 2LX9A 4BI3A 3FJPA 3OBYA 3VUBA 4E7IA 2DD4A 4XTVA 1IREB 5CKDA 5GAN2 2DK3A 1U1TA 2LCLA 4M75D 4MZTA 3CBPA 3OW2A 1JJ2A 4C0ZA 3E9GA 3UWNA 3M58A 1N8RU 4M77E 3WXMB 4QQDA 5LJ5g 3G6EA 2F5TX 4BE1A 2DTOA 3S3MA 2XI9A 4OMFB 3HPWA 2CS7A 3HFOA 3NTHA 2NLUA 3C95A 4C5GA 3JB9H 1KQ2A 2M0OA 4OVAA 4O6JA 5LJ3g 2E1HA 4LD6A 2VC8A 2K57A 3E1SA 3CCMA 5GAOl 1M1GA 4KUDK 3GPLA 1KD1U 1VQ5A 4F7UB 3RUXA 4M77B 5AYFA 5A2QE 2WSCE 2KY9A 1BI3A 1K73C 3PT9A 2GF7A 4C92C 4ZN1A 4LD9K 3MCAB 4C8QG 5GMKh 1VIFA 1Q7YU 4M75C 3J81E 5GAOm 4JRKA 3S6WA 4EMKB 2A3LA 4C0DC 4R55A 3L2ZA 3OYMA 1M1KU 3RERA 1I4K1 4F7UF 4J5YA 4C8QF 5A0DA 4MMKA 2DIGA 1PSFA 4YTLA 3MP8A 3CC4A 4M78A 3CCLT 2H3JA 4ME7A 3JCMd 4M78B 1IZ6A 2DO3A 3OYAA 5LJ5f 1M9SA 2YLBA 2ZGWA 3HFNA 4E47A 4P5NA 3BDLA 1N9SA 4M7DC 2QEXT 2LQKA 4FL6A 4JRIA 4Z02A 3V7SA 3C94A 5GAMe 5IAYA 3FIFA 3OBWA 1FXXA 2XDBA 2ZPFB 1VQ8A 1YITA 5FU6B 1WJSA 4UC4A 3QPHA 1K73U 3H8ZA 2DTIA 3ER0A 3PMIA 3L42A 5LJ3j 4L59A 3QYHB 3OYDA 2K5IA 2K3YA 4KBMB 1QVGA 4PJOG 3OYCA 1DJ7B 3PIPA 2PVOB 2D6FA 5GAN6 2JZ2A 5GAMg 3OYKA 4QVCA 4RCCA 3QIIA 3JCMV 4C5EA 2YLCA 3T9NA 4M7AG 5IN1A 2ZZDA 3I55T 2DD5A 2EKOA 4XTYA 5LL6S 4M7DD 2Y4YA 2RI5A 5GANe 2MMPA 4OB0B 4C92A 3L2UA 1G3YA 2EFIA 2EIFA 3DKMA 2O4XA 4M75A 1N27A 2P0QA 2XKOC 4BY6B 1WJQA 4D6WA 1VQ9A 2G3RA 3GF5A 3OMCA 1YHQA 1VQMA 3V7CA 4M7AD 3CCJT 2OTJA 4C92G 2BUDA 4EMGA 4EMHA 3A5ZB 1KQ1A 2RK1A 3G4SA 2XU8A 3L2VA 1M8VA 4M77D 4NOYA 1VUBA 4MMLA 3JB9J 4FSXA 3CPWA 1KQSS 4QQGA 3CC2A 1SSFA 5CIUA 4EPCA 5DLOA 1YJNT 2KAFA 1VQ4T 1Q82U 4A53A 4A4FA 4XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PL6 A;  1KHC A;  2K3X A;  5J26 A;  3DLM A;  3OS1 A;  4BE2 A;  3MEA A;  2RJC A;  2RHX A;  4GY5 A;  4E7J A;  3OYH A;  3LX7 A;  5FRM A;  5FRO A;  3OYJ A;  2PQW A;  1MHN A;  4BAC A;  2RO0 A;  4E7I A;  2EQM A;  3OY9 A;  3L2W A;  3OQ5 A;  2M16 A;  3S3N A;  2RI2 A;  2RJD A;  3OS2 A;  2LDM A;  3MEV A;  5J39 A;  2R58 A;  3E9G A;  3UWN A;  4BDY A;  4QQD A;  3M9Q A;  3OS0 A;  4BE1 A;  3S3M A;  3FLG A;  3NTH A;  4C5I A;  2B8A A;  2HQE A;  2MWO A;  2NLU A;  4C5G A;  2F5K A;  2RHZ A;  2M0O A;  1RI0 A;  2RHY A;  2R5M A;  3QBY A;  4OVA A;  4LD6 A;  3QJ6 A;  2BIV A;  3LYI A;  3O8V A;  5FRN A;  2HQX A;  4BE0 A;  4QW2 A;  4E7K A;  2EQU A;  4IUV A;  2X4X A;  4BDZ A;  4CRI A;  2R5A A;  4N4H A;  2JTF A;  3CEY A;  3OYN A;  5KH6 A;  4IUT A;  3NTI A;  3OMG A;  5C0M A;  2GF7 A;  3MET A;  4A4G A;  2X4Y A;  3SD4 A;  2QQR A;  4IUP A;  3S6W A;  3KUF A;  4RG2 A;  2LTO A;  2L3R A;  1G5V A;  2FHD A;  4HCZ A;  1OI1 A;  4X34 A;  2RHI A;  4B9X A;  4B9W A;  3OYM A;  3OYI A;  3MEW A;  4EDU A;  1OYX A;  1OZ2 A;  2X35 A;  4BD3 A;  5C6S A;  2DIG A;  3MP8 A;  3H6Z A;  4IUR A;  2DAQ A;  3F70 A;  3OYE A;  2GFA A;  3OYA A;  2IG0 A;  3P8H A;  1OZ3 A;  1WJR A;  5D6W A;  3P8D A;  3MP1 A;  3BDL A;  3E9F A;  3DB3 A;  2GFU A;  4FU6 A;  4QQ6 A;  4Z02 A;  4FL6 A;  4E7H A;  2RHU A;  3LGF A;  2EQK A;  3LGL A;  3ZEH A;  5IAY A;  5KCO A;  3QKJ A;  4IUQ A;  4ZTF A;  2BKD N;  3OYG A;  3GOX A;  2MWP A;  4QVZ A;  2E5Q A;  4C5H A;  1WJS A;  4UC4 A;  3H8Z A;  3PMI A;  3L42 A;  2O4X B;  3PMT A;  4L59 A;  5KE2 A;  3OYD A;  5KE3 A;  2K3Y A;  2R57 A;  2RJF A;  2L8D A;  3OB9 A;  4II1 A;  3OYC A;  3DB4 A;  2JZ2 A;  3OYK A;  2CKK A;  3LH0 A;  3QII A;  2EQJ A;  3UT1 A;  3MO8 A;  4C5E A;  5IN1 A;  2EKO A;  1H3Z A;  2LRQ A;  4IKF A;  2RJE A;  2RI5 A;  3LLR A;  2DIQ A;  3FEO A;  4N4I A;  3OYB A;  4NS5 A;  3FC3 A;  3L2U A;  4N4G A;  5D6Y A;  2EFI A;  5D6X A;  2QQS A;  2O4X A;  4PLL A;  1N27 A;  1WJQ A;  2X4W A;  2G3R A;  3OMC A;  3ME9 A;  3S3O A;  3ASK A;  4E7L A;  3FDR A;  2VYT A;  4Q5W A;  2P0K A;  2LVM A;  4ZTJ A;  1XNI A;  3Q1J A;  2BUD A;  2YRV A;  2L89 A;  2WAC A;  2E6N A;  2XDP A;  3L2V A;  3OYF A;  2XK0 A;  3L2Q A;  3PFS A;  4PLI A;  1WGS A;  3MP6 A;  3OYL A;  4QQG A;  2LCC A;  3EAE A;  1SSF A;  3NTK A;  3L2R A;  5CIU A;  3C4S A;  2RI3 A;  4IUU A;  2D9T A;  3PNW C;  4A4E A;  2M1H A;  5KCH A;  5M9O A;  4A4H A;  3OA6 A;  4A4F A;  3MEU A; 
#chains in the Genus database with same CATH topology
 1M8M A;  2EQI A;  3EHQ A;  5FU7 B;  4CI0 C;  1W1F A;  1M2V A;  2EYX A;  2PQW A;  2COW A;  3G1J A;  2XDD A;  2EQM A;  3OY9 A;  3OQ5 A;  5FLX E;  1X2Q A;  1JRI A;  1GRI A;  1VQL A;  4J9I A;  3SDZ A;  2J05 A;  1U06 A;  2B8A A;  4RTX A;  1KD1 C;  2GGR A;  1SEM A;  1M27 C;  1VIE A;  1E6G A;  5FRN A;  2O01 E;  1I5O B;  3RMQ A;  4E7K A;  5A0L A;  2CRE A;  3PVL A;  3WVE B;  5L8R E;  4BDZ A;  5I22 A;  1VQM T;  1Z9Q A;  3OYN A;  1E7O A;  4PJO C;  2OTJ T;  4HVV A;  1I5L A;  4C8Q A;  1BBZ A;  4JRQ A;  4RKU E;  2MF2 A;  4B9X A;  5I2S A;  2RH2 A;  3TU4 K;  2XIC A;  3EFS A;  2JN0 A;  1ZSZ A;  5GAN 8;  3CCQ Q;  5KYU B;  1WHL A;  1WYX A;  3QUI A;  1N5Z A;  5KCO A;  4M7D F;  1IB8 A;  1I1J A;  2BZY A;  1WHJ A;  3G71 A;  3CCU Q;  4PJL A;  4XQ3 A;  3CCQ T;  4DQ2 A;  4KGZ B;  2RQU A;  3LH5 A;  3SEM A;  3HL8 A;  4Y92 A;  1KK7 A;  1M3C A;  2E3I A;  3O5Z A;  1V29 B;  2V8I A;  2LQN A;  2V26 A;  5GAM f;  4PLL A;  4FSS A;  2GTJ A;  3X25 B;  3S3O A;  3JB9 D;  3M4G A;  1M90 U;  1M2V B;  2LVM A;  1WNL A;  5HK0 A;  2WAC A;  4XTZ A;  3C12 A;  4AMC A;  3UDC A;  2L3P A;  1KC8 U;  2FPE A;  2X4J A;  3OYL A;  1PKS A;  2PU9 B;  2K5F A;  4PNO A;  3OS1 A;  3MEA A;  3AHU A;  4GY5 A;  3JCM W;  3PGG A;  1WXT A;  1YIJ A;  1YIJ Q;  2RJD A;  2LDM A;  1SRM A;  2DXU A;  1PD0 A;  1I81 A;  3M9Q A;  3OW2 S;  4MDW A;  1V76 A;  4C0F A;  4M7D A;  4IIO A;  3FLG A;  2VGN A;  5IT9 E;  4R56 A;  2C06 A;  1NPP A;  1YN8 A;  2NUT A;  2MOX A;  2QXF A;  3LYI A;  2HQX A;  1MGQ A;  3CC4 Q;  3EG0 A;  1PG5 B;  2PVG B;  3FRN A;  1WQ7 A;  2GCX A;  1VQ4 Q;  4J9D A;  4O5V A;  1FMV A;  3JSC A;  4A4G A;  3UPU A;  2DL3 A;  1VQ6 T;  2NUP B;  1ZX6 A;  2QGF B;  2E4H A;  4M78 G;  1LOJ A;  1GXI E;  4F7U G;  3M5A A;  3DB3 A;  4PFO A;  4QQ6 A;  4Y91 A;  4X9C A;  4TVR A;  3A8O B;  3LGL A;  3NFC A;  1NPR A;  3AT1 B;  2XMF A;  3QWX X;  1NEB A;  4N0A C;  5KE2 A;  5GMK l;  1WXU A;  2LP5 A;  4E2F B;  1D1C A;  3VV0 A;  2E5K A;  3V8K A;  4C8Q E;  4BY6 C;  1QCN A;  2FZG B;  2YUQ A;  4J9E A;  2MAM A;  2RN8 A;  5L23 A;  1ACM B;  2L5Q A;  3ASK A;  2VYT A;  2EYQ A;  2D1X A;  3HTR A;  4OB3 B;  3OYY A;  4RTV A;  2HNI A;  5HKC A;  3TCJ A;  4RMO A;  3G4S T;  5IHN A;  4L5G A;  3RDV A;  5DY9 A;  1W6X A;  3SWN C;  4JRP A;  3EHR A;  3CXC P;  2EGE A;  3EGD B;  2D9T A;  2QTX A;  3PNW C;  5GAN 4;  1YJN A;  1RAD B;  2J06 A;  3RR6 A;  2QQA A;  5KYW B;  1NLO C;  1YBY A;  2FL7 A;  5FRM A;  4JJC A;  4C8Q D;  2KSS A;  1PWT A;  4AFQ C;  4ZNX A;  3S3N A;  2EJG A;  1TS9 A;  1BIA A;  2KK4 A;  2RI2 A;  2LNH B;  4LUE A;  2M0Y A;  1YJ9 T;  1TH7 A;  3URG A;  2KQW A;  5HK3 A;  4ATO A;  4M77 C;  3QJ6 A;  1M1F A;  1BYM A;  1X6O A;  2AZS A;  1XOV A;  1Q82 R;  2ECZ A;  2DTH A;  4BI4 A;  3I56 A;  1W2B A;  2RK2 A;  3MKD A;  4PJO E;  2CYZ B;  1RAC B;  5KH6 A;  4JS5 A;  1UB4 A;  4GLM A;  1NM7 A;  3LW5 E;  3MET A;  4AT1 B;  2LTO A;  4D8D A;  2KDS A;  3CCU A;  1FWZ A;  3F70 A;  2LT4 A;  3JB9 G;  3HRU A;  2HSP A;  4CC2 A;  3E9F A;  3CCJ Q;  1FMK A;  1Y7X A;  2KT8 A;  1RI9 A;  1QVF A;  4ZTF A;  4VUB A;  5GJW B;  2MWP A;  1AWX A;  3QG1 A;  1Q86 C;  2PVD B;  1MMD A;  2CZ0 B;  2LC4 A;  3CCQ A;  1K8A C;  2OTL Q;  3A8H B;  3LH0 A;  2EQJ A;  2O9S A;  4OB1 B;  4PJO A;  1YCS B;  2HBW A;  2DIQ A;  2L0A A;  3A8L B;  3FC3 A;  3CQT A;  2PNI A;  4JPB W;  3FB9 A;  4E7L A;  2BTT A;  4PK4 A;  1YI2 A;  2Z0W A;  2JM8 A;  3OS5 A;  5GJV B;  4J9H A;  9ATC B;  2E6N A;  2XDP A;  4FT4 A;  4JJN K;  1M30 A;  2L2P A;  3I9Q A;  1UGV A;  3E19 A;  3OSV A;  2LCC A;  5AT1 B;  3J80 E;  1T0H A;  2CUD A;  3OA6 A;  5M9O A;  4A4K A;  4JZ3 A;  3A1P A;  3HRT A;  3VU3 C;  4J83 A;  2RHX A;  1XJW B;  4JZ4 A;  2LX9 A;  1TUC A;  3OBY A;  4M75 D;  3OW2 A;  1ZUU A;  3VS0 A;  3E9G A;  1N8R U;  3G6E A;  4QQD A;  4BE1 A;  2CP5 A;  2K2M A;  4OMQ A;  1UDL A;  1KQ2 A;  4O6J A;  5LJ3 g;  2VC8 A;  3I55 Q;  1B07 A;  2M51 A;  2KI7 A;  5GAO l;  3CCL Q;  3RUX A;  3VRY A;  2WSC E;  4ZN1 A;  2QEX Q;  2A3L A;  3M0P A;  2DYI A;  1M1K U;  1U3O A;  4C8Q F;  4M78 A;  3CCL T;  2H3J A;  1RLQ C;  2CSQ A;  5LJ5 f;  2YLB A;  3BDL A;  2QEX T;  2FEI A;  4FL6 A;  2EYW A;  1TG0 A;  3C94 A;  2DBK A;  2ABL A;  5IAY A;  1FXX A;  1HYO A;  2DL4 A;  1VQ8 A;  2XDB A;  1RAG B;  5FU6 B;  3H8Z A;  3PMI A;  3CC7 Q;  3OYD A;  2DEU A;  2NYS A;  2DET A;  2LJ1 A;  3OYC A;  2MPX C;  4QVC A;  2VVK A;  4DBF A;  1QLY A;  1SKU B;  3T9N A;  5IN1 A;  5LL6 S;  4F16 A;  5KYN A;  1B3Q A;  2KXD A;  2EIF A;  2O4X A;  2P0Q A;  4D6W A;  1WJQ A;  3OMC A;  4JJD A;  4WCI A;  2RPN A;  2OTJ A;  2BUD A;  4EMG A;  3A5Z B;  2RK1 A;  1OOT A;  1KSW A;  3FJ5 A;  4LE9 A;  4FSX A;  5DLO A;  1Q82 U;  4A53 A;  2AZV A;  3INZ A;  2XID A;  3M55 A;  3EFO A;  1IHW A;  4C8Q C;  2DZ9 A;  5GAM d;  4N0A A;  3ZBD A;  3OYJ A;  2F69 A;  3VS1 A;  4MZM A;  1D09 B;  4RUG A;  3L2W A;  5J3B A;  3CME T;  3BY7 A;  4BI8 B;  2R58 A;  2H3E B;  1B34 B;  2K5L A;  1D0Z A;  4DOW A;  2CP0 A;  1VQ8 Q;  1R0C B;  3QBY A;  3CCE A;  1W2B S;  3M54 A;  4M75 E;  4J6W A;  1ZA2 B;  3I56 T;  3RMS A;  2SRC A;  1NBE B;  5C0M A;  2X3X D;  1YP5 A;  4MZP A;  1UJ0 A;  3MEW A;  2CP7 A;  5I21 A;  1AOJ A;  2LZ6 B;  3ZFJ A;  5CVI A;  1TUD A;  3QDR B;  2OTL A;  3BDU A;  4JDS A;  1QVF S;  2A36 A;  2RQR A;  6AT1 B;  4KUI A;  1VQ7 Q;  1WXB A;  1N8R R;  3LWI A;  4PJO F;  4HCK A;  2JMA A;  2JVV A;  5KE3 A;  2R57 A;  2DER A;  1EX4 A;  3OB9 A;  2KRN A;  1M90 C;  1CKA A;  1QVP A;  4WTO B;  2DZC A;  1JJ2 S;  1H3Z A;  3VS2 A;  4KRT A;  4HVW A;  2E3H A;  4M75 G;  4FCY A;  4RG8 A;  5GAO n;  4DBR A;  3JCM P;  3GNG A;  4ZTJ A;  3GIB A;  3A8M B;  1LCK A;  4J9F A;  2E64 A;  1QVF P;  1BI0 A;  3HKS A;  3L2Q A;  1KC8 C;  3L2R A;  1Z9Z A;  4V2S A;  5CAI A;  1KHC A;  2QK0 A;  2PUO B;  4DBQ A;  4BE2 A;  3L1A A;  1QWF A;  3CXC S;  3N5B B;  1WQW A;  4BAC A;  1SRL A;  2YXY A;  4DBH A;  2CGH A;  4Z8A A;  2XD0 A;  1R8O B;  1BI2 A;  1JB0 E;  1W2B P;  2CDT A;  2PUK B;  3JAM E;  4XU2 A;  1UE9 A;  2RHZ A;  1OUL A;  2RQT A;  2LQW A;  4XU0 A;  4IUV A;  4CRI A;  4QKU A;  2ZPB B;  2ENM A;  1YJW T;  3CEY A;  1X75 C;  3NTI A;  2XG8 D;  3CPF A;  1U1S A;  3EH2 A;  2VUB A;  3RIR A;  1G3W A;  4HCZ A;  1NJI U;  1LJO A;  4FM4 B;  1O75 A;  1YWP A;  5I2M A;  1Y96 B;  3QXE B;  1UUE A;  5D7U A;  3EFR A;  1OZ3 A;  1VQ5 Q;  3CC2 Q;  4WF2 A;  2FRW A;  5GMK m;  1LNX A;  4L6V 5;  4HT9 A;  1YIJ T;  3RKX A;  2CZ6 B;  2MK5 A;  2Y90 A;  4QVZ A;  4RTY A;  3VYG A;  1NYF A;  2CT3 A;  3M4Y A;  1YIT T;  5GMK j;  1Y0M A;  4M7D E;  2YDL A;  2VWF A;  2JOY A;  3TQ7 P;  2DM1 A;  1QVG S;  1CKB A;  1K0S A;  3NMZ C;  1BIB A;  4R0K A;  4GBQ A;  2RJE A;  3LLR A;  2FPF A;  4N4I A;  1NLP C;  1C1A A;  3V8L A;  2QQS A;  4CC4 B;  2DXC A;  3ME9 A;  3VS5 A;  2GQI A;  2KYM A;  3OW2 P;  1C0M A;  4F14 A;  2YRV A;  4CC3 A;  4C92 F;  2DRK A;  3V8J A;  1PNJ A;  1K9A A;  3CPW P;  3CPW S;  1KQS A;  3CCU T;  4A4E A;  1I0C A;  3VKI A;  2JW4 A;  5J26 A;  2DYB A;  3R6N A;  3H9N A;  3KXT A;  1M4Z A;  4XAX B;  1PD1 A;  1RAE B;  4LDX A;  2ED1 A;  1VQL T;  4E6R A;  5GAN 7;  5GAN j;  5J39 A;  4C92 D;  2WSE E;  1GFC A;  3OS0 A;  3SB2 A;  1HXD A;  2CZ7 B;  1JQQ A;  1W4S A;  1WHM A;  2BIV A;  2DKG A;  5CKE A;  1VQ9 Q;  4M7A C;  4PFP A;  2E70 A;  3CD6 T;  3TVT A;  1WHK A;  1Y07 A;  3OMG A;  3V7R A;  1MNE A;  1T3L A;  2K9G A;  1YI2 T;  1WPY A;  2L3R A;  2V1R A;  3JB9 F;  8ATC B;  3RNJ A;  5KYW A;  3CD6 Q;  4BD3 A;  4RCB A;  2MCN A;  3EFO B;  1GCQ A;  2YUP A;  1K4U S;  4J6X A;  3P8H A;  4F7U A;  4NL3 A;  5D6W A;  1K0X A;  2A28 A;  2P0P A;  2OTL T;  2CP6 A;  2ZPG B;  5CCA A;  1QMC A;  1D1A A;  2ZPE B;  2BKD N;  3BFM A;  2H8H A;  2F1L A;  3PMT A;  1YJ9 A;  1QWE A;  2VXE A;  5HCK A;  2W10 A;  3RES A;  2LRQ A;  3E2U A;  4FT2 A;  4XTU A;  2P4R A;  5GAO r;  2QDL A;  3H0I A;  1X01 A;  5CKH A;  3X24 B;  2PZ1 A;  4Q5W A;  2ZCF B;  2QA4 Q;  4J7F A;  1PM3 A;  2NUP A;  2CSI A;  5LJ3 h;  3HP9 A;  4F7U E;  1K1Z A;  3EGD A;  4ZGE B;  2L3Q A;  4IUU A;  3TEE A;  3MEU A;  2RM4 A;  2HQH A;  1QQJ A;  3EG9 B;  4FW2 A;  1X6B A;  2A37 A;  1OEB A;  2KGT A;  1BK2 A;  1ZA1 B;  5ECA A;  1UHC A;  3UWN A;  3M58 A;  4M77 E;  1HSQ A;  4OMF B;  3HPW A;  3HFO A;  1U5S A;  1ZUY A;  3ZL7 C;  2RF0 A;  2X9H A;  1M1G A;  2J6F A;  1EZZ B;  4KUD K;  4A63 B;  4M77 B;  5AYF A;  4RTT A;  2KY9 A;  4LD9 K;  3MCA B;  5GMK h;  1K8A R;  2F2V A;  1S1N A;  3VS4 A;  4FYX B;  3RER A;  2C0T A;  1I4K 1;  1MMA A;  4J5Y A;  1SF9 A;  4ME7 A;  1QKW A;  2I0N A;  1IZ6 A;  2DO3 A;  3OYA A;  2CT4 A;  3HFN A;  2ZGW A;  4E47 A;  2DA9 A;  1N9S A;  4M7D C;  4J9B A;  2EVR A;  2LQK A;  4JRI A;  2O31 A;  5GAM e;  3REA B;  2D0N A;  2COZ A;  1GBQ A;  1WJS A;  1K73 U;  3QPH A;  5LJ3 j;  3ER0 A;  4L59 A;  3QYH B;  4KBM B;  1SPK A;  1QVG A;  3GBQ A;  1UTI A;  4RCC A;  3UAT A;  3I55 T;  2DD5 A;  4M7D D;  1OU8 A;  3M0S A;  4C92 A;  3L2U A;  1G8X A;  4M75 A;  2M02 A;  2G3R A;  2OX7 A;  1HD3 A;  5EC7 A;  1SG5 A;  4M7A D;  4ORZ A;  3CCJ T;  4C92 G;  2HKN A;  5KYX A;  1KQ1 A;  2XU8 A;  3L2V A;  4MML A;  1D1B A;  3CPW A;  1KQS S;  2EGC A;  3M0R A;  1SSF A;  4EPC A;  2KAF A;  3BE3 A;  2KRM A;  2HMA A;  4OGC A;  3M0Q A;  2BZX A;  2O2O A;  2E65 A;  1BKB A;  4D8K A;  1VQ8 T;  2AK5 A;  2KEA A;  3MPU B;  2EYZ A;  4ELY C;  2M16 A;  2EW3 A;  2VV5 A;  2BE9 B;  1BI1 A;  2CZ1 B;  3MEV A;  3M0T A;  2QTV A;  1AT1 B;  1ZSG A;  1YJ9 Q;  2LMJ A;  1NJI R;  3JRZ A;  4QW2 A;  1AEY A;  4PKC C;  3GP8 A;  2KT1 A;  3CBO A;  1JJ2 P;  2HL5 C;  3KBG A;  4IUT A;  4J9G A;  5GAN g;  2V8J A;  4RG2 A;  5DM7 R;  4M78 F;  3EG2 A;  4OGE A;  1TWB A;  3VJP A;  3OYI A;  1EIF A;  2DEQ A;  5LJ3 f;  1HJD A;  1VYT A;  2QI2 A;  2P84 A;  3CCS A;  1JEG A;  2L3S A;  1ZBJ A;  1IRX A;  1NYG A;  4J9C A;  1WJR A;  1MMG A;  2K2V A;  3HRS A;  1Q7Y C;  5FW9 A;  2DVJ A;  3QYG B;  3TRE A;  4M78 C;  4M77 A;  1V1C A;  5LJ5 d;  3JCM g;  1WDX A;  4PJJ A;  1GL5 A;  1P92 A;  1VQ7 A;  3GNF B;  1WFW A;  4JLI A;  2O4X B;  3CMA A;  2HAX A;  4M4Z A;  1S72 T;  1WIE A;  2L8D A;  4II1 A;  2E10 A;  1JXO A;  3DB4 A;  1D0X A;  1N8R C;  1UEC A;  2DL7 A;  2V8K A;  5FU7 C;  5IHK A;  3UT1 A;  4M7A E;  1J3T A;  4OP0 A;  2RA2 A;  2OAW A;  4NS5 A;  4ESR A;  1QCO A;  2ROL A;  2X4W A;  3SFM A;  3JCM h;  1FX7 A;  4DOV A;  1QP2 A;  3CCE Q;  4LDU A;  1T3S A;  3Q1J A;  2LJ3 A;  4X1V A;  2RI3 A;  1RAA B;  1R0B G;  4M78 D;  5KCH A;  2YRC A;  4M77 G;  1KJW A;  1WZO A;  4B6M A;  1UFF A;  3JCM b;  4AFZ C;  3OYH A;  2JTM A;  4AFS C;  1KHI A;  1VQK Q;  1MV0 B;  1Q86 U;  2RO0 A;  1H8K A;  1K73 R;  3JCM c;  1TUG B;  3G6E T;  1YJW Q;  5CO7 A;  1B34 A;  4BDY A;  1Q81 C;  3I5R A;  4PJO D;  2LNV A;  2XHC A;  4AG2 C;  2COY A;  4EDU A;  3RKY A;  3CCM T;  4BE0 A;  2EQU A;  4GLK A;  2X4X A;  1BB9 A;  1C6V X;  1PHT A;  1IHV A;  2GQV A;  1QVG P;  2KMT A;  2KVQ G;  5LJ3 e;  4X34 A;  2JS2 A;  2CUB A;  2NWM A;  2SEM A;  3X28 B;  4HCB A;  3HHT B;  1RAI B;  2GFA A;  2IG0 A;  1SSH A;  3CXC A;  3EGX A;  3MP1 A;  3MJX A;  3D7S B;  1AZE A;  3LGF A;  4BB7 A;  1PRL C;  2QGG A;  4Z88 A;  2OI3 A;  1JO8 A;  3QSU A;  2B86 A;  2KBT A;  4C5H A;  1E6H A;  1MUZ A;  1YCY A;  3CC7 T;  4RTZ A;  5KYX B;  3DLL A;  2DLP A;  2NUT B;  1N9R A;  1BCO A;  1LVK A;  4M7A B;  1TXQ A;  3VRZ A;  1TU0 B;  1UG1 A;  1TSF A;  1YJW A;  5D6Y A;  1ZHI A;  1YHQ T;  4ELZ C;  2ATC B;  2HBP A;  5I11 A;  4IIM A;  4AG1 C;  1JBM A;  4AFU C;  4DA4 A;  2HSE B;  2P0K A;  1XNI A;  2EWN A;  1M5Q 1;  1VQN A;  3WVD B;  4QT7 A;  4LUD A;  3M56 A;  2HL3 A;  2FRY A;  3C4S A;  3CC2 T;  2RMO A;  3DLM A;  2OJ2 A;  3LX7 A;  2Y4X A;  1QP3 A;  3G7Z A;  4RTU A;  1BU1 A;  3CME Q;  4M78 E;  3JCM J;  3CME A;  3CCV Q;  3JCM f;  4OML A;  5GAO q;  1ZLM A;  4DEY A;  3GLX A;  4EMK C;  3EG1 A;  5CK9 A;  2JT4 A;  1H92 A;  4C92 B;  3CCE T;  2HQE A;  3BW1 A;  3PVQ A;  5IXB A;  2F5K A;  1YI2 Q;  3O8V A;  2YSQ A;  4LDV A;  4LNP A;  3CCV T;  3I56 Q;  2AT1 B;  4A54 A;  2M9U A;  4PJM A;  1VQP A;  8AT1 B;  2JTF A;  4MDX A;  2AIR B;  5GAM j;  1QW1 A;  1Y71 A;  1G5V A;  2FVU A;  1KQS P;  4B9W A;  4C92 E;  1IGU A;  2X35 A;  2DFU A;  1M1K C;  1UGQ B;  2DAQ A;  3OYE A;  3QDF A;  3QWY A;  1HK9 A;  2GBQ A;  1OPL A;  2YUO A;  1OU9 A;  2OAU A;  2RHU A;  5CQY A;  4XU1 A;  3QKJ A;  2RQW A;  3OYG A;  2E12 A;  2IPO B;  3JCM Q;  2DIL A;  4OMP A;  2D8H A;  1O9S A;  4JS4 A;  2RJF A;  4M7D G;  2VAS A;  2FG0 A;  2KE9 A;  2BZ8 A;  2CP3 A;  2QDY B;  3JCM X;  2CKK A;  4BUG A;  1QCF A;  2JM9 A;  3A8G B;  3R6O A;  5GMK e;  1OV3 A;  5GAN d;  1UEB A;  2FYK A;  4PJO B;  1KG1 A;  4N4G A;  5A0G A;  4FIB A;  5D6X A;  3UA7 A;  1I07 A;  1UGP B;  3FDR A;  5LJ5 h;  1VQ5 T;  2RD1 A;  3QO3 A;  3M57 A;  1WHG A;  7AT1 B;  1VQK A;  3OYF A;  4LDW A;  2HKQ B;  1VQP Q;  2XK0 A;  4OF1 A;  3CCR T;  1CSK A;  4LDY A;  1YIT Q;  2M1H A;  1VQO Q;  4M7A F;  1ZSZ B;  2MIO A;  5FRO A;  2FZK B;  1X2K A;  3TSW A;  2EPD A;  3CCR Q;  1RAB B;  3VUB A;  2DD4 A;  4XTV A;  1IRE B;  5CKD A;  5GAN 2;  2DK3 A;  1X6G A;  2K79 A;  3U23 A;  2KR3 A;  4C0Z A;  3WXM B;  1F1B B;  2F5T X;  2DTO A;  2KXC A;  2CS7 A;  3C95 A;  1PRM C;  2M0O A;  4OVA A;  3VS7 A;  4LD6 A;  4KGX B;  3IQL A;  2K57 A;  1G83 A;  3CCM A;  1ZUK A;  1FYN A;  1KD1 U;  4F7U B;  3ULR B;  1K73 C;  3PT9 A;  2GF7 A;  2NUZ A;  4C92 C;  1Q7Y U;  4M75 C;  3J81 E;  4KGV B;  5GAO m;  4EMK B;  2J6K A;  4R55 A;  2O9V A;  3L2Z A;  1AWO A;  3EG9 A;  2D8J A;  4F7U F;  5A0D A;  2DIG A;  1RAF B;  2JTE A;  2DE0 X;  1SHF A;  4M78 B;  1VOM A;  4P5N A;  3VS6 A;  4Z02 A;  1YWO A;  3REB B;  1YIT A;  2K5I A;  2K3Y A;  4PJO G;  2AKK A;  2YUN A;  1DJ7 B;  2PVO B;  5GAN 6;  1NEG A;  4FYV B;  1ABQ A;  3JCM V;  1Q81 R;  2YLC A;  2FZC B;  4M7A G;  2ZZD A;  1W70 A;  2EKO A;  4XTY A;  1OPK A;  2RI5 A;  2MMP A;  4OB0 B;  3NHN A;  1G3Y A;  2EFI A;  3DKM A;  1M90 R;  1B7T A;  1N27 A;  1YHQ A;  1VQM A;  3V7C A;  5IXF A;  2X51 A;  1VYU A;  1G2B A;  3EGU A;  2DL5 A;  4M77 D;  1VUB A;  3UA6 A;  5CIU A;  1VYV A;  4XTX A;  2VXF A;  1WA7 A;  4QVD A;  1VQ6 Q;  2RQV A;  5LJ5 e;  3VS3 A;  2C0O A;  1WLP B;  1AHJ B;  2LJ0 A;  3QJY A;  1VQ7 T;  2EAY A;  5GAN 5;  1N6A A;  2RNA A;  1VQL Q;  1NG2 A;  2ZPH B;  2ED0 A;  2P4T A;  3QZ9 B;  1S72 A;  3QHS A;  2YRD A;  1NZ9 A;  5GAN 3;  2MWO A;  4XTW A;  2RHY A;  2DNU A;  1NJI C;  3CD6 A;  1ZQ1 A;  2DF6 A;  3RKW A;  1VQ9 T;  2R5A A;  5LJ5 j;  1KIK A;  2MYS A;  1YNZ A;  3H41 A;  1MMN A;  3CCJ A;  1KC8 R;  3EG3 A;  3KFV A;  5IH2 A;  3P8B B;  1OX8 A;  4DEX A;  1UGS B;  1OI1 A;  2F2W A;  4XU3 A;  1OYX A;  1D0Y A;  1OZ2 A;  3NGP A;  4C0D B;  1UHF A;  2AHJ B;  4CC7 A;  1VQM Q;  2KNB B;  2OTJ Q;  1ZBX A;  4LXC A;  4FU6 A;  3X26 B;  1G3S A;  2ROT A;  2JXB A;  2EQK A;  2FB7 A;  2JUF A;  2QQB A;  3GOX A;  4EMK A;  4C8Q B;  2E5Q A;  3CBM A;  5KYY A;  2WSF E;  4M75 B;  4FYY B;  2BE7 D;  4ZGD B;  1SHG A;  1AD5 A;  2LQ8 A;  3MHX A;  3MO8 A;  2LX7 A;  1RL2 A;  2FO0 A;  2VKN A;  4M75 F;  4J7I A;  1T0J A;  3FEO A;  2VB6 A;  1GCQ C;  2IIM A;  1Q7Y R;  2I2L A;  2CH4 W;  1RUW A;  1ZSZ C;  3PIO A;  1VA7 A;  2QA4 T;  1VQO A;  1D3B A;  5FWC A;  1PKT A;  1GFD A;  3SWN A;  1GBR A;  1M2O A;  3I5S A;  1VQK T;  2C0I A;  1IXD A;  2CP2 A;  3PFS A;  1WGS A;  4PLI A;  1MND A;  3EAE A;  4EIK A;  1Q95 G;  2JNG A;  2E6Z A;  4KUL A;  1WHH A;  4OB2 B;  1I8F A;  5CR2 A;  2DX1 A;  2EBP A;  1XTD A;  3THK A;  1MV3 A;  1BCM A;  3PTA A;  3CMA T;  2K4Y A;  5FU6 C;  1UJY A;  3OS2 A;  4HA8 A;  1H3H A;  2VGM A;  4E7Z A;  2DPP B;  3CC7 A;  4C5I A;  4Y28 E;  1RI0 A;  1Y57 A;  3H0H A;  3JB9 I;  3CMA Q;  2W0Z A;  4N4H A;  4C0G A;  5GAN h;  4J8O A;  5CKB A;  5GAN f;  1PCX A;  2QQR A;  3KUF A;  1K9M R;  3UF4 A;  1YFN A;  1M3B A;  3CC4 T;  4ZN3 A;  1KD1 R;  4JLG A;  1QKX A;  3H6Z A;  4IUR A;  2DMO A;  2LT1 A;  3CCL A;  3OSS C;  5GAM h;  1XQH A;  3X20 B;  1NE8 A;  1ABO A;  2QEX A;  2GNC A;  3ZEH A;  1G3T A;  1D3B B;  3JV3 A;  2HCK A;  3G6E Q;  1YHQ Q;  4JUV A;  3I55 A;  2QQ9 A;  2DXB A;  1PC0 A;  3C0C A;  3H0F A;  4IKF A;  1K9M U;  5DLQ E;  2QAZ A;  3M0U A;  3OYB A;  3LWH A;  5EG2 A;  2HD0 A;  4OMM A;  4Z89 A;  5KYY B;  5GAO p;  5HY6 A;  4HCC A;  2K6D A;  4NL2 A;  1AZG B;  3EGX B;  1A0N B;  1VQ6 A;  4FW1 A;  2DXT A;  4OMN A;  2V1Q A;  3VYH B;  2EJ9 A;  1Y96 A;  3MP6 A;  3NTK A;  2A08 A;  1VQ4 A;  2JMC A;  1K9M C;  4A4H A;  1WX6 A;  2YT6 A;  4PL6 A;  1S72 Q;  3RBB B;  2RJC A;  3J7A F;  4E7J A;  3QZ5 B;  2EJF A;  3G4S Q;  3NPF A;  1WI7 A;  2DJZ A;  1MHN A;  3JCM e;  4M7A A;  2EKH A;  2QG9 B;  1AWJ A;  1M3A A;  1TOV A;  1X69 A;  3VUZ A;  2X3W D;  4HKE A;  2A7Y A;  2R5M A;  2LCS A;  3M53 A;  2CH4 A;  3CCS Q;  1K8A U;  4ANJ A;  2AKL A;  1RAH B;  5GMK i;  4ZGJ B;  2YHT A;  1VQN T;  2X4Y A;  3SD4 A;  4IUP A;  2FHD A;  1UGR B;  2RHI A;  5LJ3 d;  4XK8 E;  2FPD A;  3CCS T;  5C6S A;  4KH0 B;  5CQX A;  1RLP C;  3G71 Q;  1KFZ A;  3CCR A;  2D0Q B;  2RB6 A;  3SHW A;  1H64 1;  4HT8 A;  3P8D A;  1JU5 C;  2GFU A;  2QAS A;  1Q81 U;  4E7H A;  1U8R A;  2K7A A;  4KT0 E;  4IUQ A;  4LN2 A;  1R77 A;  3G71 T;  2DVE A;  4FYW B;  1Q82 C;  2EGA A;  3M59 A;  3SWN B;  4M77 F;  4J6Y A;  2QYZ A;  4RTW A;  3CCV A;  1JXM A;  1GCP A;  2DL8 A;  1LPL A;  1VQP T;  4M7D B;  3HSB A;  5IHI A;  4PJN A;  2E41 A;  3TSZ A;  2A0F B;  2MI6 A;  5CKF A;  1M1K R;  2QA4 A;  1VQO T;  2KRO A;  2ZPI B;  2L89 A;  2K3B A;  4K11 A;  2IVW A;  4OMO A;  4F04 B;  2O88 A;  2PTK A;  2K3X A;  2GTO A;  1Q86 R;  4X9D A;  1PSE A;  4BI3 A;  2J7I A;  3FJP A;  1K76 A;  2ESW A;  4JJB A;  4E7I A;  4PFZ A;  1ARK A;  5FWB A;  1U1T A;  2LCL A;  4MZT A;  1JJ2 A;  3CBP A;  1TTH B;  5LJ5 g;  3S3M A;  2XI9 A;  4HVU A;  3NTH A;  4F17 A;  2NLU A;  4C5G A;  2HDA A;  3JB9 H;  2KRS A;  2E1H A;  2HEQ A;  3A98 A;  3E1S A;  3CCM Q;  5KYU A;  3GPL A;  1VQ5 A;  2JS0 A;  5A2Q E;  4KH1 B;  1BI3 A;  4C8Q G;  1FMW A;  1VIF A;  1X27 A;  4JRK A;  3S6W A;  4C0D C;  2ZAE A;  1AVZ C;  2HZY A;  3OYM A;  4MMK A;  1PSF A;  4YTL A;  3MP8 A;  3CC4 A;  1IO6 A;  1EFN A;  3JCM d;  1M9S A;  2JJ9 A;  2J6O A;  3V7S A;  2DRM A;  3FIF A;  3OBW A;  2ZPF B;  2G6F X;  4UC4 A;  1OX9 A;  2DTI A;  3L42 A;  2KYB A;  1IGQ A;  2DBM A;  3EH1 A;  4E7S A;  3PIP A;  2D6F A;  2JZ2 A;  5GAM g;  3OYK A;  1VQN Q;  3QII A;  4C5E A;  2Y4Y A;  1AWW A;  2DJQ A;  5GAN e;  1X43 A;  2XKO C;  4BY6 B;  1VQ9 A;  1YJN Q;  3GF5 A;  4EMH A;  3I35 A;  2F2X A;  2YWW A;  3PE0 A;  3G4S A;  1M8V A;  4NOY A;  3JB9 J;  3CC2 A;  4HXJ A;  4QQG A;  1YJN T;  1OQK A;  1VQ4 T;  2EYY A;  4A4F A; 
#chains in the Genus database with same CATH homology
 2VXF A;  3INZ A;  2XID A;  3M55 A;  4OGC A;  5FU7 B;  4C8Q C;  2DZ9 A;  5GAM d;  4N0A A;  4QVD A;  4CI0 C;  2E65 A;  1BKB A;  5LJ5 e;  3ZBD A;  3OYJ A;  1VQ8 T;  2PQW A;  2F69 A;  1AHJ B;  4ELY C;  4MZM A;  2XDD A;  2EQM A;  3QJY A;  3OY9 A;  3OQ5 A;  3L2W A;  2M16 A;  2EAY A;  5FLX E;  1JRI A;  5J3B A;  5GAN 5;  3CME T;  2VV5 A;  1N6A A;  3BY7 A;  1BI1 A;  2CZ1 B;  3MEV A;  4BI8 B;  2R58 A;  1VQL A;  3SDZ A;  2ZPH B;  2P4T A;  3QZ9 B;  1S72 A;  1B34 B;  2K5L A;  3QHS A;  4DOW A;  1NZ9 A;  5GAN 3;  2B8A A;  2MWO A;  1KD1 C;  4XTW A;  2RHY A;  3QBY A;  3CCE A;  1VIE A;  1W2B S;  3JRZ A;  5FRN A;  2O01 E;  3M54 A;  4M75 E;  3RMQ A;  4J6W A;  4QW2 A;  1NJI C;  1ZQ1 A;  4E7K A;  5A0L A;  3CD6 A;  3WVE B;  4PKC C;  5L8R E;  3RKW A;  3GP8 A;  4BDZ A;  1VQ9 T;  3I56 T;  2R5A A;  3RMS A;  5LJ5 j;  1VQM T;  3CBO A;  3OYN A;  4PJO C;  4IUT A;  3KBG A;  3CCJ A;  2OTJ T;  5C0M A;  1I5L A;  4C8Q A;  3P8B B;  5GAN g;  2V8J A;  4RG2 A;  5DM7 R;  1UGS B;  4M78 F;  4MZP A;  4JRQ A;  4RKU E;  2MF2 A;  4OGE A;  3VJP A;  1OI1 A;  4B9X A;  4XU3 A;  3OYI A;  1EIF A;  3MEW A;  5I2S A;  1OYX A;  1OZ2 A;  2DEQ A;  2RH2 A;  5LJ3 f;  2QI2 A;  4C0D B;  3CCS A;  2AHJ B;  5I21 A;  3TU4 K;  2XIC A;  3ZFJ A;  3EFS A;  2JN0 A;  5CVI A;  5GAN 8;  1WJR A;  1ZBX A;  2K2V A;  3HRS A;  1Q7Y C;  3QDR B;  2OTL A;  3TRE A;  3BDU A;  3QYG B;  4FU6 A;  4M78 C;  4JDS A;  1QVF S;  4M77 A;  3X26 B;  1G3S A;  5LJ5 d;  3JCM g;  3QUI A;  2EQK A;  4KUI A;  5KCO A;  2FB7 A;  2JUF A;  4M7D F;  2QQB A;  1P92 A;  4PJO F;  4C8Q B;  4EMK A;  3LWI A;  3GOX A;  2E5Q A;  1VQ7 A;  3CBM A;  3GNF B;  3G71 A;  2JVV A;  2O4X B;  2WSF E;  4JLI A;  4M75 B;  4XQ3 A;  3CMA A;  5KE3 A;  4DQ2 A;  3CCQ T;  2HAX A;  2R57 A;  1S72 T;  2L8D A;  3OB9 A;  4II1 A;  2E10 A;  4ZGD B;  3DB4 A;  3HL8 A;  1M90 C;  1N8R C;  2V8K A;  5FU7 C;  1QVP A;  2LQ8 A;  3MHX A;  3UT1 A;  3MO8 A;  1RL2 A;  4M7A E;  2DZC A;  4M75 F;  1JJ2 S;  1H3Z A;  4J7I A;  1V29 B;  2RA2 A;  4OP0 A;  3FEO A;  2V8I A;  4NS5 A;  2I2L A;  5GAM f;  4PLL A;  4M75 G;  3PIO A;  2X4W A;  3X25 B;  2QA4 T;  4RG8 A;  3SFM A;  3S3O A;  3JB9 D;  1D3B A;  3M4G A;  3JCM h;  5GAO n;  3JCM P;  1VQO A;  1FX7 A;  1M90 U;  3GNG A;  4DOV A;  2LVM A;  1QP2 A;  4ZTJ A;  1WNL A;  4LDU A;  3Q1J A;  3GIB A;  5HK0 A;  3A8M B;  3SWN A;  2WAC A;  2E64 A;  4XTZ A;  3C12 A;  3UDC A;  1BI0 A;  1VQ7 T;  1KC8 U;  1VQK T;  3HKS A;  3L2Q A;  3PFS A;  2X4J A;  1WGS A;  4PLI A;  3OYL A;  1KC8 C;  3EAE A;  3L2R A;  2PU9 B;  2RI3 A;  4M78 D;  5KCH A;  2JNG A;  4M77 G;  2E6Z A;  2K5F A;  4KUL A;  4PNO A;  4V2S A;  5CAI A;  1KHC A;  2PUO B;  3OS1 A;  4BE2 A;  3MEA A;  4OB2 B;  1I8F A;  3AHU A;  5CR2 A;  3JCM b;  4GY5 A;  3OYH A;  2JTM A;  3L1A A;  1KHI A;  1XTD A;  3JCM W;  3PGG A;  3CXC S;  3N5B B;  1WQW A;  4BAC A;  3PTA A;  1Q86 U;  2CGH A;  2RO0 A;  1YIJ A;  3CMA T;  2K4Y A;  5FU6 C;  1R8O B;  2XD0 A;  2RJD A;  1BI2 A;  1JB0 E;  2LDM A;  4HA8 A;  3JCM c;  3OS2 A;  3G6E T;  2DXU A;  5CO7 A;  1I81 A;  1B34 A;  4BDY A;  2VGM A;  3M9Q A;  3OW2 S;  2DPP B;  4MDW A;  3CC7 A;  1Q81 C;  4PJO D;  4C0F A;  2LNV A;  2XHC A;  4M7D A;  3FLG A;  2VGN A;  5IT9 E;  4C5I A;  2PUK B;  4R56 A;  1NPP A;  4XU2 A;  3JAM E;  4Y28 E;  2C06 A;  2RHZ A;  1RI0 A;  4EDU A;  3RKY A;  2QXF A;  3LYI A;  3CCM T;  2HQX A;  4BE0 A;  4XU0 A;  1MGQ A;  3JB9 I;  2EQU A;  4GLK A;  4IUV A;  2X4X A;  2PVG B;  4CRI A;  4N4H A;  2ZPB B;  1YJW T;  3CEY A;  3FRN A;  1X75 C;  4C0G A;  1WQ7 A;  2GCX A;  2XG8 D;  3NTI A;  4J8O A;  5GAN h;  3CPF A;  4O5V A;  1U1S A;  3JSC A;  5CKB A;  4A4G A;  5GAN f;  2VUB A;  2GQV A;  3RIR A;  1G3W A;  2KMT A;  2QQR A;  3KUF A;  2KVQ G;  3UPU A;  5LJ3 e;  4HCZ A;  4X34 A;  1VQ6 T;  1NJI U;  1LJO A;  4FM4 B;  3X28 B;  3CC4 T;  4ZN3 A;  3HHT B;  1O75 A;  4HCB A;  4JLG A;  3H6Z A;  4IUR A;  5I2M A;  4M78 G;  1LOJ A;  1Y96 B;  2LT1 A;  2GFA A;  3QXE B;  3CCL A;  2IG0 A;  3EFR A;  1OZ3 A;  3CXC A;  1GXI E;  4F7U G;  3M5A A;  3MP1 A;  3DB3 A;  3OSS C;  4QQ6 A;  4WF2 A;  4X9C A;  4Y91 A;  4TVR A;  1XQH A;  5GAM h;  3X20 B;  3A8O B;  3LGF A;  1NE8 A;  4BB7 A;  2QEX A;  3LGL A;  5GMK m;  1LNX A;  4L6V 5;  3ZEH A;  4HT9 A;  3NFC A;  1YIJ T;  3RKX A;  2Y90 A;  1NPR A;  1G3T A;  2CZ6 B;  4QVZ A;  3VYG A;  3QSU A;  1D3B B;  4C5H A;  3M4Y A;  4N0A C;  1YIT T;  5KE2 A;  5GMK j;  5GMK l;  4M7D E;  1YCY A;  4JUV A;  3CC7 T;  2JOY A;  3DLL A;  1QVG S;  1N9R A;  3VV0 A;  3I55 A;  3V8K A;  1BIB A;  4C8Q E;  2QQ9 A;  2DXB A;  4M7A B;  4BY6 C;  4IKF A;  1K9M U;  5DLQ E;  2RJE A;  3LLR A;  4N4I A;  3OYB A;  2MAM A;  3V8L A;  3LWH A;  1YJW A;  5D6Y A;  1ZHI A;  5EG2 A;  2QQS A;  1YHQ T;  4ELZ C;  2HD0 A;  2HBP A;  2DXC A;  5GAO p;  1JBM A;  3ME9 A;  5HY6 A;  4DA4 A;  4HCC A;  2L5Q A;  3ASK A;  4NL2 A;  2VYT A;  2P0K A;  2EYQ A;  1XNI A;  2EWN A;  1M5Q 1;  4OB3 B;  3WVD B;  1VQN A;  3OYY A;  2YRV A;  1VQ6 A;  5HKC A;  2HNI A;  2DXT A;  3TCJ A;  4RMO A;  3M56 A;  3G4S T;  3VYH B;  2EJ9 A;  4L5G A;  1Y96 A;  3MP6 A;  5DY9 A;  4C92 F;  3V8J A;  3NTK A;  3SWN C;  4JRP A;  1VQ4 A;  3C4S A;  3CC2 T;  1K9M C;  3CPW S;  2D9T A;  2QTX A;  3PNW C;  4A4E A;  5GAN 4;  3CCU T;  4A4H A;  1YJN A;  3VKI A;  4PL6 A;  5J26 A;  3DLM A;  2QQA A;  2RJC A;  1YBY A;  2FL7 A;  3J7A F;  4E7J A;  3QZ5 B;  3LX7 A;  3KXT A;  2Y4X A;  1M4Z A;  4XAX B;  2EJF A;  5FRM A;  1QP3 A;  4C8Q D;  2DJZ A;  3G7Z A;  1MHN A;  3JCM e;  4M7A A;  4LDX A;  2KSS A;  4M78 E;  3JCM J;  3CME A;  3JCM f;  5GAO q;  3S3N A;  2EJG A;  1VQL T;  1BIA A;  2KK4 A;  3VUZ A;  2RI2 A;  3GLX A;  5GAN 7;  5GAN j;  5J39 A;  4HKE A;  4EMK C;  4C92 D;  5CK9 A;  1YJ9 T;  2A7Y A;  2WSE E;  3OS0 A;  4C92 B;  1TH7 A;  3SB2 A;  3URG A;  2KQW A;  5HK3 A;  1HXD A;  2HQE A;  3BW1 A;  4M77 C;  3CCE T;  2CZ7 B;  4ATO A;  2F5K A;  1W4S A;  2R5M A;  2DKG A;  2BIV A;  1M1F A;  3M53 A;  3O8V A;  1X6O A;  3QJ6 A;  4LDV A;  1XOV A;  5CKE A;  3CCV T;  4M7A C;  1BYM A;  2DTH A;  4BI4 A;  4A54 A;  2E70 A;  2RK2 A;  3I56 A;  1W2B A;  1K8A U;  3CD6 T;  2M9U A;  1VQP A;  4PJO E;  2CYZ B;  2JTF A;  1Y07 A;  5KH6 A;  4MDX A;  5GMK i;  1UB4 A;  4ZGJ B;  4JS5 A;  3OMG A;  3V7R A;  2YHT A;  3LW5 E;  3MET A;  1VQN T;  2X4Y A;  3SD4 A;  5GAM j;  1QW1 A;  4IUP A;  1Y71 A;  2LTO A;  1WPY A;  2L3R A;  2FVU A;  2FHD A;  1YI2 T;  1G5V A;  1UGR B;  4B9W A;  2RHI A;  5LJ3 d;  3JB9 F;  4XK8 E;  4C92 E;  3CCS T;  2KDS A;  2X35 A;  4BD3 A;  5C6S A;  4RCB A;  1UGQ B;  1M1K C;  5CQX A;  2DAQ A;  3CCR A;  3CCU A;  1FWZ A;  2D0Q B;  3F70 A;  3OYE A;  2RB6 A;  2LT4 A;  4J6X A;  3JB9 G;  1HK9 A;  3P8H A;  1H64 1;  3HRU A;  4F7U A;  5D6W A;  3P8D A;  4NL3 A;  3E9F A;  4HT8 A;  1Y7X A;  2GFU A;  2P0P A;  1Q81 U;  2OTL T;  2ZPG B;  2OAU A;  5CCA A;  4E7H A;  2RHU A;  5CQY A;  1U8R A;  4KT0 E;  1QVF A;  4XU1 A;  4VUB A;  4ZTF A;  3QKJ A;  2ZPE B;  4IUQ A;  2BKD N;  3OYG A;  2E12 A;  2MWP A;  3G71 T;  3QG1 A;  2DVE A;  3BFM A;  3JCM Q;  1Q86 C;  2PVD B;  3PMT A;  1O9S A;  4JS4 A;  1YJ9 A;  1Q82 C;  2RJF A;  4M7D G;  2CZ0 B;  2LC4 A;  3CCQ A;  1K8A C;  3M59 A;  3SWN B;  2VXE A;  2QDY B;  4M77 F;  2CKK A;  3JCM X;  3A8H B;  3LH0 A;  4J6Y A;  2EQJ A;  4BUG A;  3A8G B;  3CCV A;  3R6O A;  2LRQ A;  3RES A;  5GMK e;  4OB1 B;  5GAN d;  4FT2 A;  4PJO A;  2DIQ A;  1UEB A;  2FYK A;  3A8L B;  1VQP T;  3FC3 A;  4M7D B;  4PJO B;  4N4G A;  4XTU A;  5A0G A;  3HSB A;  1KG1 A;  4FIB A;  5D6X A;  2E41 A;  5GAO r;  1UGP B;  1X01 A;  5CKH A;  3X24 B;  2MI6 A;  3FB9 A;  5CKF A;  4E7L A;  3FDR A;  5LJ5 h;  2QA4 A;  2RD1 A;  4Q5W A;  1VQO T;  2ZCF B;  1VQ5 T;  3QO3 A;  1YI2 A;  2ZPI B;  3OS5 A;  4J7F A;  3M57 A;  2L89 A;  5LJ3 h;  2E6N A;  2XDP A;  4FT4 A;  4JJN K;  1VQK A;  3OYF A;  4LDW A;  3HP9 A;  2XK0 A;  3E19 A;  3OSV A;  4OF1 A;  2IVW A;  3CCR T;  4LDY A;  4F7U E;  2LCC A;  4ZGE B;  3J80 E;  4IUU A;  2M1H A;  3OA6 A;  5M9O A;  3TEE A;  3MEU A;  4A4K A;  2RM4 A;  2K3X A;  4M7A F;  3HRT A;  3VU3 C;  4J83 A;  2RHX A;  4X9D A;  1KQS A;  1PSE A;  5FRO A;  2LX9 A;  4BI3 A;  3FJP A;  3OBY A;  3VUB A;  4E7I A;  2DD4 A;  4XTV A;  1IRE B;  5CKD A;  5GAN 2;  2DK3 A;  1U1T A;  2LCL A;  4M75 D;  4MZT A;  3CBP A;  3OW2 A;  1JJ2 A;  4C0Z A;  3E9G A;  3UWN A;  3M58 A;  1N8R U;  4M77 E;  3WXM B;  4QQD A;  5LJ5 g;  3G6E A;  2F5T X;  4BE1 A;  2DTO A;  3S3M A;  2XI9 A;  4OMF B;  3HPW A;  2CS7 A;  3HFO A;  3NTH A;  2NLU A;  3C95 A;  4C5G A;  3JB9 H;  1KQ2 A;  2M0O A;  4OVA A;  4O6J A;  5LJ3 g;  2E1H A;  4LD6 A;  2VC8 A;  2K57 A;  3E1S A;  3CCM A;  5GAO l;  1M1G A;  4KUD K;  3GPL A;  1KD1 U;  1VQ5 A;  4F7U B;  3RUX A;  4M77 B;  5AYF A;  5A2Q E;  2WSC E;  2KY9 A;  1BI3 A;  1K73 C;  3PT9 A;  2GF7 A;  4C92 C;  4ZN1 A;  4LD9 K;  3MCA B;  4C8Q G;  5GMK h;  1VIF A;  1Q7Y U;  4M75 C;  3J81 E;  5GAO m;  4JRK A;  3S6W A;  4EMK B;  2A3L A;  4C0D C;  4R55 A;  3L2Z A;  3OYM A;  1M1K U;  3RER A;  1I4K 1;  4F7U F;  4J5Y A;  4C8Q F;  5A0D A;  4MMK A;  2DIG A;  1PSF A;  4YTL A;  3MP8 A;  3CC4 A;  4M78 A;  3CCL T;  2H3J A;  4ME7 A;  3JCM d;  4M78 B;  1IZ6 A;  2DO3 A;  3OYA A;  5LJ5 f;  1M9S A;  2YLB A;  2ZGW A;  3HFN A;  4E47 A;  4P5N A;  3BDL A;  1N9S A;  4M7D C;  2QEX T;  2LQK A;  4FL6 A;  4JRI A;  4Z02 A;  3V7S A;  3C94 A;  5GAM e;  5IAY A;  3FIF A;  3OBW A;  1FXX A;  2XDB A;  2ZPF B;  1VQ8 A;  1YIT A;  5FU6 B;  1WJS A;  4UC4 A;  3QPH A;  1K73 U;  3H8Z A;  2DTI A;  3ER0 A;  3PMI A;  3L42 A;  5LJ3 j;  4L59 A;  3QYH B;  3OYD A;  2K5I A;  2K3Y A;  4KBM B;  1QVG A;  4PJO G;  3OYC A;  1DJ7 B;  3PIP A;  2PVO B;  2D6F A;  5GAN 6;  2JZ2 A;  5GAM g;  3OYK A;  4QVC A;  4RCC A;  3QII A;  3JCM V;  4C5E A;  2YLC A;  3T9N A;  4M7A G;  5IN1 A;  2ZZD A;  3I55 T;  2DD5 A;  2EKO A;  4XTY A;  5LL6 S;  4M7D D;  2Y4Y A;  2RI5 A;  5GAN e;  2MMP A;  4OB0 B;  4C92 A;  3L2U A;  1G3Y A;  2EFI A;  2EIF A;  3DKM A;  2O4X A;  4M75 A;  1N27 A;  2P0Q A;  2XKO C;  4BY6 B;  1WJQ A;  4D6W A;  1VQ9 A;  2G3R A;  3GF5 A;  3OMC A;  1YHQ A;  1VQM A;  3V7C A;  4M7A D;  3CCJ T;  2OTJ A;  4C92 G;  2BUD A;  4EMG A;  4EMH A;  3A5Z B;  1KQ1 A;  2RK1 A;  3G4S A;  2XU8 A;  3L2V A;  1M8V A;  4M77 D;  4NOY A;  1VUB A;  4MML A;  3JB9 J;  4FSX A;  3CPW A;  1KQS S;  4QQG A;  3CC2 A;  1SSF A;  5CIU A;  4EPC A;  5DLO A;  1YJN T;  2KAF A;  1VQ4 T;  1Q82 U;  4A53 A;  4A4F A;  4XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...