4HKEA

Crystal structure of moxt of bacillus anthracis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDFLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Addiction module toxin component PemK
publication title Structural basis of Bacillus anthracis MoxXT disruption and the modulation of MoxT ribonuclease activity by rationally designed peptides
pubmed doi rcsb
source organism Bacillus anthracis
total genus 34
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hkeA00
1UB4A 1M1FA 4MZPA 4MZTA 3VUBA 1NE8A 2MF2A 3HPWA 5CKFA 4ELZC 5HK3A 5CK9A 4VUBA 5CO7A 3JRZA 3TCJA 5CKHA 4ELYC 4MDXA 5HK0A 3G7ZA 2VUBA 5CKEA 5CCAA 5HKCA 5CQYA 4OF1A 5CKBA 1VUBA 5DLOA 3NFCA 5CKDA 2KMTA 4ME7A 1X75C 4HKEA 5CR2A 2C06A 4MZMA 3JSCA 5CQXA
chains in the Genus database with same CATH superfamily
1KC8U 4A4GA 4EMHA 1LOJA 5GMKl 5GMKh 4PLLA 4X9CA 1GCPA 4DEXA 1UTIA 1PWTA 1QWFA 2HAXA 4M7AB 3UT1A 1VQOT 5KYWA 1I5LA 1OU9A 2W0ZA 2EQMA 1VQ9T 1C0MA 3OYGA 4PJOE 3LYIA 4J5YA 2ZPEB 4IUTA 2QQAA 5KE2A 4C8QB 5GAN4 2YUOA 4A4EA 1R8OB 2E41A 4BY6B 2MIOA 2V1QA 1UHFA 4M7DA 3M54A 1Y96A 4OF1A 3CCRA 2WSEE 3M4GA 2LC4A 3HRTA 2LCCA 1ZX6A 3DB3A 1K0XA 1QMCA 2LNVA 4DA4A 3OY9A 1VQ8A 5LL6S 2J06A 1BBZA 3E2UA 3FRNA 2EFIA 2C0TA 2KRMA 1RAAB 1I0CA 2BE9B 3RKXA 4O5VA 6AT1B 3ULRB 4J6YA 2FPEA 3M53A 4XTVA 3TQ7P 1KFZA 2JOYA 1IGQA 3VS4A 3HRSA 1QVFS 3CCJA 2RA2A 3UPUA 3CCRQ 4C92G 3FLGA 1KSWA 1K73C 2DTIA 3CCUT 1NYFA 4BI4A 1UB4A 3G4ST 3CD6Q 2B86A 3HKSA 1Q7YC 1VQ8Q 5LJ3d 1UGVA 2IVWA 1KQSS 4B6MA 2VB6A 1PRLC 2HNIA 3M59A 1W2BS 3JCMP 1YFNA 3VS7A 1BI0A 1NEGA 4Z02A 2DEUA 4M77B 3VS0A 1WFWA 4N4IA 4OMQA 5FU6C 2LMJA 4KRTA 1AZEA 4AFSC 3CMAA 2O9SA 1K9MC 3UDCA 2OTLA 1WHGA 2EQJA 1U5SA 1GFDA 4QVZA 1SF9A 1SPKA 1M3CA 4PL6A 3JRZA 4E7ZA 4EMGA 3PNWC 2FHDA 1WJQA 3EFRA 2DL3A 2GFUA 5GAOl 1W70A 5FLXE 1M1GA 1MV0B 2C06A 2LJ3A 1MV3A 1NJIU 4PFPA 4EDUA 3EG9B 1YHQT 3CCLA 4PJOF 1JRIA 4BI3A 3EGXB 4J9CA 3CMAQ 1YI2T 3HRUA 3CC4A 2ESWA 3JCMQ 1M1KC 1LCKA 1ZBJA 1BI2A 4IIMA 1W6XA 5CCAA 2HMAA 2MI6A 1UE9A 4E7HA 2CP3A 2LJ0A 2DYBA 1UGSB 2P84A 1H8KA 4AFZC 2CZ1B 4OMNA 2GFAA 1PKSA 1X01A 2EGAA 4C92C 1QVFP 3G1JA 1VQKA 4MMLA 4LNPA 2LNHB 1NBEB 2GQVA 3CQTA 3CCLQ 3V7SA 4F7UB 3QWYA 1I4K1 3SHWA 2CUBA 1M8VA 4BE2A 1KQSP 1YIJA 1VA7A 2QDLA 1Y07A 4M78B 1W2BP 4CI0C 1QW1A 1QVFA 1WNLA 2VGMA 3MP1A 2YXYA 1SEMA 3OYAA 2D8JA 2M9UA 4JJDA 4B9XA 2QAZA 2NWMA 3M4YA 3CC7T 4C92A 3GNFB 1KD1R 3M0PA 3CCMT 1G3TA 2FPDA 2XDPA 4OMFB 1Q86C 3OYBA 2QA4Q 3CCET 2COWA 3GBQA 3I5SA 3OSSC 5KYYA 3PIPA 3JB9H 1YIJQ 1AWJA 1RLPC 3OYYA 1F1BB 1TXQA 2RH2A 2AZVA 2QGGA 1ZSZA 4JLGA 4BI8B 5I2SA 2KRSA 3OYJA 3RKWA 4AG1C 2NLUA 3U23A 3OBYA 1WXTA 2C0IA 2ROLA 2QTVA 1MMDA 2QQRA 1NJIR 1SSFA 2Y90A 2YRDA 4XAXB 3PTAA 1QCFA 3E19A 3JSCA 1OPLA 1HYOA 2FZKB 4XTUA 1PHTA 2HDAA 3EFOB 1IHVA 4KULA 1NPRA 3SB2A 2E1HA 4PJOG 2DXBA 1UJYA 1M27C 2J05A 1PM3A 3BFMA 4JDSA 1VQ7Q 2PUKB 4LD9K 1VQ6A 4KUIA 4Z88A 2J6OA 4HCCA 2EPDA 2DXTA 2DNUA 3OB9A 3ZBDA 2HCKA 1X27A 4RTVA 2YT6A 2E3HA 4ZNXA 3M0SA 2MAMA 2M02A 3JB9F 5IN1A 3V8KA 2DILA 4GY5A 2PVDB 3G71A 2AKLA 2IIMA 5GANd 1OOTA 2A7YA 4DBFA 2LCLA 3QJYA 1WQ7A 4AG2C 5CK9A 4PLIA 4B9WA 2KI7A 4FM4B 3MJXA 5D6WA 3OS5A 2LTOA 3CMET 2V1RA 3S3NA 2WSFE 4D8DA 2RO0A 1YP5A 3VS6A 3CPWA 2I0NA 2KT1A 4CC4B 3G71Q 2QYZA 2DXUA 2RK2A 2FL7A 3L2WA 1JB0E 3SWNA 1ZQ1A 2M51A 2JS2A 1M8MA 5CKEA 2KXCA 1Y57A 3S3OA 2EYQA 3QDRB 1U1SA 3SEMA 4QKUA 4E6RA 4JJNK 5LJ5f 4FYWB 2FZCB 3A5ZB 1UUEA 1XTDA 5CQXA 2NUTA 4JS5A 1SKUB 3QG1A 2LP5A 1J3TA 2JS0A 1LPLA 5I11A 1QKXA 2JXBA 3EHQA 2DTHA 4QVDA 2Y4XA 4PJOA 2CZ6B 4HT9A 2ZPBB 3VV0A 5IHKA 2D0QB 2PUOB 4M7DD 1BCOA 2DX1A 3MP8A 1JU5C 3VS5A 1Z9QA 5DM7R 3RKYA 2O2OA 3P8HA 4ELYC 1UDLA 1YN8A 2EBPA 3FB9A 4OGCA 2LT4A 3C95A 2RJCA 3JB9G 3CCRT 2CT4A 1D0YA 4EMKA 2LRQA 1C1AA 2A3LA 1SSHA 4OMOA 3CD6T 1VQ8T 4NL2A 3M5AA 5LJ5j 4FL6A 3CXCS 2D6FA 4A4HA 1Q82R 1QVPA 2GTOA 1Q81R 2FO0A 2DYIA 3UA7A 4P5NA 4R55A 2CSQA 4OB0B 1OPKA 3M0QA 3H6ZA 1PKTA 2MCNA 3J80E 1YJNA 3OW2A 2M16A 1OYXA 1QP3A 1M5Q1 3M56A 5KYXA 1PD1A 2CUDA 2RI3A 2NUPB 1SG5A 4Q5WA 1AHJB 2ATCB 4FCYA 2GBQA 5KYUB 3H0HA 5GAN5 1LNXA 3GPLA 1JBMA 2DAQA 3LH5A 3L2RA 4OGEA 2LVMA 1ZHIA 2QEXQ 1H3HA 3OQ5A 3VRYA 3HFOA 1VQMA 3EGDB 3VUBA 2DL5A 4PJLA 2K57A 2ZCFB 2X3WD 2YRVA 2KRNA 1UGPB 3V7CA 5J3BA 3M0RA 2E5QA 5CQYA 3OYFA 1OEBA 2JM8A 1PC0A 1T0JA 3GLXA 1UFFA 3I9QA 2A08A 3J7AF 1K73R 2MOXA 1RI0A 2CSIA 1Q7YR 5EG2A 3CCQQ 1VQMQ 4M75G 1OX8A 3TU4K 3ASKA 4X1VA 3CXCP 2CDTA 1RABB 4KGZB 3V8LA 3JCMW 1YITA 5CKDA 1HK9A 4FYXB 4C0FA 1RI9A 1OULA 3CCVA 2NUZA 2XHCA 1WHMA 2LX7A 5KH6A 1ZA1B 3CBMA 3JCMd 3PIOA 1VQLA 2YHTA 5GAN8 1PG5B 3HPWA 3L2ZA 2K2VA 1PCXA 5FROA 2QA4T 2RF0A 4II1A 4RCBA 2H3JA 4DOWA 2EJ9A 2F2VA 2M1HA 4D8KA 2RI5A 5A2QE 1KJWA 5CIUA 3CCVQ 5FU7B 3C0CA 4MZPA 1I5OB 2RB6A 4Y92A 3R6NA 3VYGA 5IT9E 1VYUA 1HSQA 1X69A 1VQLQ 4VUBA 1UGQB 4RUGA 3FJPA 4J9EA 1M1KR 2EKOA 2XMFA 4BUGA 3A8LB 3H41A 3CCSA 1AZGB 1G2BA 2PTKA 1RUWA 1DJ7B 1KIKA 4WTOB 2JVVA 2ZPHB 2F5KA 2COYA 1WHJA 3QYGB 3VS2A 4PJNA 4WF2A 1UG1A 1M90C 1WHKA 3LLRA 4M7DC 1VQNA 2LCSA 1PD0A 4FW1A 3VKIA 5GAOp 2KNBB 1I1JA 2XD0A 3H0IA 2K7AA 1YJ9A 4HCKA 3CCSQ 3G6EA 1RLQC 1T3LA 3JCMf 1VQ7T 3BW1A 1UGRB 1V1CA 2CH4W 1N5ZA 1M3AA 1W4SA 2O88A 1H641 3NHNA 2X4WA 5GMKj 2HQHA 2E12A 2CT3A 4E47A 3LGFA 5I2MA 4RKUE 3JCMJ 4OMPA 2GCXA 4OB1B 4UC4A 2RQVA 2O4XA 1IO6A 1B34B 3M58A 5HY6A 5GAOq 5HCKA 1FXXA 1YJ9Q 1SRLA 1QKWA 1WX6A 1WIEA 1VQ5A 3RIRA 2GQIA 3JCMh 1WYXA 2OI3A 1M30A 2DJQA 2R58A 4MDWA 4M7AE 1ZUKA 2FG0A 2L8DA 2OJ2A 2QDYB 2ZPFB 2OAUA 4RG8A 3CC2A 4JS4A 2JW4A 2DTOA 3KUFA 5GAMd 3EH2A 1Q95G 2E64A 3G71T 1JXMA 4C8QE 3I56A 2ZPGB 3EG3A 5FW9A 2K2MA 1V76A 1KD1U 2GTJA 1NLPC 1VQPA 1EFNA 2LJ1A 3RDVA 1AD5A 3CCJQ 1N8RR 1D09B 1GL5A 2YLCA 2RI2A 4MZTA 3PT9A 2E65A 1GXIE 3TCJA 3I56Q 5M9OA 5J26A 1WXUA 3DB4A 5DY9A 2DIQA 1K4US 2X35A 5GAN3 2X51A 4J9GA 1U3OA 1FYNA 4PJMA 4CC3A 5A0DA 2CZ7B 2L3QA 4E7KA 2EQIA 3KFVA 2LX9A 1YWPA 2KR3A 4PJOD 2YLBA 2OTLQ 2B8AA 1O9SA 2X4JA 3GOXA 2L0AA 5GAMf 4M77E 1KHCA 2DVJA 3IQLA 2PVOB 5LJ3f 1ABOA 2RMOA 3JAME 1B3QA 2VASA 2HKNA 1B7TA 1AVZC 2BZXA 4HXJA 2DE0X 3JV3A 1K8AC 1MUZA 3EGUA 1QWEA 4PNOA 2F1LA 3CC4Q 2M0YA 1VQ4A 1H3ZA 5ECAA 1R0BG 3A8MB 4Y28E 4M7AF 3HL8A 1NG2A 1ZSZC 2EQKA 5D6XA 5IHIA 5KYWB 5GAMh 3NGPA 4M7AD 1VQKQ 2EJGA 3OSVA 5LJ3h 3HP9A 1TWBA 1KQ2A 1VUBA 3RNJA 3D7SB 4C8QF 4LUEA 3HTRA 4C5GA 4MMKA 2R57A 4ATOA 3CPWS 1Y0MA 2KYMA 3VYHB 2C0OA 2QEXT 4PFZA 1S72A 1IHWA 1IZ6A 4M7DB 2RN8A 1FMWA 1Y96B 4BB7A 5LJ3j 4F7UE 2K4YA 2L3SA 3DKMA 1H92A 2H3EB 1XJWB 3V7RA 2HBWA 4M78E 2PNIA 3URGA 1OZ2A 2QQ9A 2ZPIB 4CC7A 3LX7A 2BIVA 2HBPA 2DETA 3CPFA 1O75A 1VQOA 1AWOA 1VQ9A 2YSQA 3TREA 3CCQT 2K3BA 1VQMT 4HT8A 1IB8A 4R0KA 1WLPB 2DD5A 1WGSA 2EYZA 4ORZA 3UA6A 1RAEB 4M75E 2G6FX 3I5RA 5AYFA 2HKQB 2QI2A 4IKFA 2DRMA 5GAOn 1Y71A 1VIFA 4AFUC 4RTYA 2DJZA 4HVVA 3P8BB 4BD3A 1G3YA 1MNEA 2V8IA 5C0MA 3X28B 4M77F 3C12A 3V8JA 1E6HA 2OTJA 1VQ9Q 4FSXA 5GMKm 4M77D 1V29B 1D3BA 3JCMc 1KC8C 4FYVB 3X24B 2ED1A 2K5FA 2X4XA 3JB9D 2FEIA 1NYGA 3M55A 3JCMb 1VQ6Q 3SWNC 3VS3A 4QQDA 1JJ2A 1XQHA 1I07A 3CPWP 1ZSGA 2L5QA 1WHLA 1Z9ZA 4XU0A 4M7AG 2XICA 2HQEA 5C6SA 3CCUA 2OTJQ 1Q82U 1Q81U 4LDWA 2DL4A 4KH1B 3G4SA 4NOYA 2L2PA 3PFSA 2P0PA 5FU6B 4RCCA 4RTZA 4E7SA 1VIEA 7AT1B 2DF6A 2KSSA 1UJ0A 2QQSA 2CP7A 4ZN1A 4C8QG 3OW2S 2BKDN 4NS5A 4EPCA 3VUZA 3TSZA 1GBQA 1QP2A 3OS0A 4PJOC 2JJ9A 4HVUA 1OI1A 4RTXA 5J39A 3CCUQ 2VVKA 2GF7A 2KROA 3X20B 4F7UF 2RJEA 4L59A 1PNJA 1JEGA 1M1FA 3AT1B 4FSSA 3OS2A 3JB9I 2KGTA 2P4RA 1SRMA 5D7UA 5LJ5g 2DFUA 3X26B 2AZSA 3QZ5B 4M78F 1N9RA 3OYEA 1NPPA 3HFNA 2ABLA 3QSUA 1ZUYA 4V2SA 2DO3A 1YHQA 2EKHA 1CKAA 3I55A 1I8FA 4EMKC 5GANf 4C92B 4XK8E 2EAYA 2RQTA 4DEYA 1YJ9T 4QT7A 3RBBB 4M75F 2F2WA 1K73U 5KYYB 4M75D 1Q7YU 2E6ZA 3QZ9B 3BDUA 4M77G 4F14A 2LDMA 1BU1A 2QASA 2E5KA 5CVIA 1X75C 4FIBA 3DLLA 1YHQQ 5KE3A 2LQ8A 1ZSZB 3I55Q 1TU0B 3JCMX 5GAOm 3WXMB 4Z89A 2KY9A 3OW2P 4PJJA 4IUQA 5FRMA 5GANh 1M90R 1NM7A 4TVRA 4E2FB 2AKKA 1K9MU 1A0NB 4RTTA 1JXOA 4IUUA 1S1NA 1T0HA 1BCMA 1NJIC 2MYSA 3EG1A 4C5EA 4M7AA 3OS1A 2AHJB 4N0AA 1ACMB 3CC7A 2JNGA 2X4YA 5I22A 1BK2A 4L5GA 3CCMA 4J9HA 1U1TA 2DPPB 3CCJT 3CCEA 4PFOA 1WHHA 4EIKA 4GLMA 4GBQA 4C8QA 2COZA 1WXBA 3L2QA 1TSFA 2K3YA 3I56T 2F69A 4NL3A 1Y7XA 1AWXA 2V8KA 2KYBA 3OYKA 4HCBA 1M1KU 1P92A 2QK0A 2D1XA 2RHUA 3RMQA 1K1ZA 4A4KA 1YJNQ 1GBRA 2DIGA 2FRYA 4F7UG 1RAIB 2EYWA 4KGXB 1WA7A 4LDVA 1D1AA 2M0OA 3CMAT 1QVGA 2OTLT 3TVTA 4XTZA 1X2KA 4M78G 4DBQA 2X3XD 4YTLA 1WQWA 4LUDA 1D1CA 1N6AA 2KT8A 1QCNA 2XI9A 4E7IA 1OX9A 2MMPA 1M2VA 2KBTA 2VC8A 2CGHA 3UATA 1GRIA 1PSFA 3CCLT 1U8RA 5LJ5e 4Y91A 3VRZA 3CC4T 3INZA 1Q86U 2A36A 4M77A 4XU2A 2QGFB 3SWNB 1YCYA 2JMAA 1E6GA 1R77A 3LH0A 1K9MR 3MO8A 3CEYA 1VQKT 3LGLA 3DLMA 1AT1B 2KAFA 3REAB 3S3MA 2NUTB 3QPHA 5FRNA 1YIJT 3LWHA 1BI3A 4FYYB 4KH0B 2E6NA 1YITQ 2DXCA 2R5MA 4PK4A 2RHZA 3QDFA 3MPUB 3VJPA 1D0ZA 3FDRA 5GAOr 1KQ1A 3EG9A 4KGVB 4ELZC 3CMEA 4AT1B 3OMGA 2DMOA 1C6VX 2G3RA 2JTFA 4OMMA 3EGXA 5GAN6 4PJOB 4J6XA 4FU6A 4J6WA 3AHUA 1ZA2B 1RAGB 2DLPA 4IUPA 4CC2A 1IREB 2A28A 1TS9A 3A1PA 1RADB 1CSKA 2CS7A 4ZGJB 2EQUA 2KDSA 4LE9A 2DL8A 4C0DC 2AT1B 1IRXA 2CP5A 1YCSB 3NTIA 4BACA 5CKFA 1N8RU 4OVAA 3R6OA 1BKBA 3CMEQ 2RQWA 2LQWA 4M75C 4F7UA 1R0CB 2P4TA 2DD4A 4IIOA 3TEEA 1TUDA 5GMKi 2O31A 3E9GA 4EMKB 1G83A 2MK5A 2I2LA 4M78A 2JMCA 4D6WA 3QYHB 3O5ZA 2VXFA 3A8OB 4J7FA 2VWFA 4OB3B 1Q82C 1Q81C 3JCMg 3QIIA 3ZL7C 2CZ0B 4IUVA 1N27A 3NTHA 3OBWA 4KUDK 1Q86R 1X6GA 1VQNQ 1QLYA 1YNZA 4F16A 1E7OA 2D9TA 4M75A 5IXFA 2P0QA 2DBKA 5KYXB 3G6EQ 1OV3A 1VQ6T 4J9IA 1YJWA 4K11A 1NLOC 3OYNA 2VKNA 2JTMA 5AT1B 2BUDA 4F17A 5I21A 2AIRB 3NTKA 1ZUUA 2XU8A 1TH7A 2DERA 2YUNA 3NFCA 4JUVA 2OTJT 1AWWA 3L42A 3CD6A 5KCHA 1OQKA 3GNGA 5L23A 2F5TX 1TG0A 2F2XA 2VYTA 3MCAB 2MF2A 2BE7D 2FRWA 3EFOA 4C5HA 1ARKA 3G7ZA 1YJWQ 1VQ5Q 3EG2A 3E9FA 3THKA 1NZ9A 4N4HA 5DLOA 1GCQC 5D6YA 3EG0A 1M2VB 2QTXA 1RAFB 2DBMA 3TSWA 3UWNA 3CC2Q 3A98A 5CAIA 2CREA 2MPXC 2CP2A 1UHCA 3UF4A 2DEQA 4QQ6A 5GMKe 2ZZDA 1HXDA 1KC8R 2DRKA 3ZEHA 4L6V5 2VXEA 1GCQA 3RR6A 1VQPQ 3RUXA 2LQKA 1D0XA 4ANJA 1LJOA 2XDDA 3RERA 2P0KA 3M9QA 5GJVB 1MHNA 3OMCA 4RTWA 2XDBA 1X2QA 2V8JA 4ESRA 4LD6A 1AOJA 3C4SA 2DK3A 4XTYA 3MP6A 2EGCA 4O6JA 1IGUA 2KEAA 2EGEA 3A8HB 3I55T 3PMIA 4LDYA 3I35A 5GAMg 2RQUA 1PRMC 2HD0A 2RM4A 5LJ3g 1ZLMA 4XQ3A 1FMKA 2LZ6B 3L1AA 3GF5A 3JCMe 2K5IA 4J8OA 4ZGDB 4FT4A 3WVDB 5KCOA 5IAYA 4HKEA 4KT0E 2JTEA 2K3XA 3REBB 5DLQE 3GP8A 1HJDA 1JO8A 2EWNA 2QA4A 1JJ2S 1NE8A 4CRIA 2FB7A 1KK7A 2J6KA 4MDXA 3EHRA 5IH2A 4AMCA 3JCMV 3MHXA 4E7JA 3EH1A 4LDXA 4BE1A 3MEVA 1B07A 1VQ4Q 4C0DB 4C8QD 2K6DA 4Z8AA 1YJNT 1KQSA 2KXDA 3META 1X6BA 3FJ5A 2QXFA 2YRCA 5GAMj 3Q1JA 2RHIA 1W2BA 3SFMA 1BI1A 2CH4A 1QCOA 4QVCA 4M75B 2H8HA 2O4XB 3H8ZA 4JZ4A 1VOMA 3SDZA 5FWBA 2E10A 1TUGB 3P8DA 2KK4A 5KYNA 3L2UA 2HL5C 3MEAA 3NPFA 1S72Q 2RHYA 5HK0A 1VQ7A 2EVRA 2QQBA 2BTTA 2O01E 2L89A 2E70A 4FW2A 1SHGA 2CP6A 2BZ8A 4JRPA 1KG1A 3PVQA 4AFQC 1EX4A 3VU3C 3CBPA 3VS1A 2EIFA 1IXDA 3PMTA 5HK3A 1G3WA 1VQOQ 1GFCA 1WPYA 2XG8D 2DZ9A 5CKHA 2Z0WA 1YWOA 4M7DE 1JJ2P 5IXBA 2VUBA 3ER0A 4RG2A 2NUPA 4J9DA 2K9GA 1D1BA 2XIDA 3QO3A 3O8VA 1WJSA 2DM1A 2QG9B 2ED0A 5KYUA 5A0GA 1N8RC 2EJFA 3OA6A 5LJ5d 1M4ZA 4A53A 1YITT 2MWPA 1I81A 1ABQA 3CCVT 2ROTA 1FMVA 2HSEB 4IURA 2GGRA 3EGDA 1YBYA 4PKCC 4JRKA 1VQLT 5GAMe 4ZN3A 3C94A 4JJCA 2LQNA 4LXCA 3WVEB 4A63B 4ZGEB 5LJ3e 1M90U 3MEWA 4F04B 4LDUA 3A8GB 2RK1A 3KBGA 2HEQA 3J81E 1BYMA 4HA8A 2EYYA 3QXEB 4WCIA 1MMNA 4RTUA 4OMLA 4DBRA 4QW2A 1XNIA 1U06A 3QUIA 2KMTA 4JJBA 1OZ3A 1RAHB 1K9AA 4DQ2A 3EAEA 2D8HA 3NMZC 3CCST 2KVQG 3E1SA 3G4SQ 3BY7A 2Y4YA 1FWZA 4J9BA 5FU7C 1M3BA 3PE0A 2ECZA 4DBHA 3M0TA 1G8XA 2D0NA 1QVGS 2NYSA 1FX7A 1W1FA 3HHTB 9ATCB 4M78D 2PQWA 4HVWA 3T9NA 4X34A 1AEYA 2RHXA 3LW5E 1VQNT 1BIAA 3OYLA 2XK0A 5GJWB 2A37A 4MZMA 4XU1A 1VYTA 2E4HA 1MMGA 1YI2A 3X25B 4RMOA 2SEMA 1EZZB 2JT4A 1WZOA 3G6ET 1KD1C 5GANg 5FWCA 1WJRA 3CBOA 1MNDA 2ZAEA 4M7AC 1BIBA 4JLIA 4N0AC 5CKBA 2FVUA 1WI7A 3MEUA 4ME7A 3OYHA 4A4FA 2J6FA 4M7DF 1K76A 4M4ZA 3FIFA 3OYIA 3ZFJA 4C8QC 1YI2Q 5LJ5h 2V26A 1XOVA 3KXTA 4BY6C 3LWIA 1X43A 3ME9A 1T3SA 1TTHB 4GLKA 2DL7A 4J83A 1YJWT 3OYMA 1VQ5T 2KE9A 8ATCB 2YDLA 2VGNA 1G5VA 3QHSA 2O9VA 1NEBA 1ZBXA 1VYVA 5IHNA 1WDXA 2DKGA 4J7IA 2SRCA 4C92E 5GAN2 3BE3A 1OU8A 4X9DA 2DZCA 2DA9A 2RNAA 1CKBA 1M2OA 3CC2T 4JRIA 4KBMB 1BB9A 1KHIA 4E7LA 5GANj 2JN0A 4XTXA 3L2VA 2JZ2A 1K0SA 2JM9A 1EIFA 2L3PA 2FYKA 3QJ6A 2ENMA 3MKDA 4A54A 3JB9J 1QVGP 2X9HA 4XU3A 2QEXA 2K79A 3OYDA 5EC7A 2AK5A 4JRQA 1B34A 2RJFA 2CKKA 4LN2A 1VQPT 3CC7Q 3PGGA 4ZTFA 3M57A 1M9SA 1QQJA 3CCMQ 3QBYA 2IG0A 2EW3A 1D3BB 4BDYA 3CCEQ 2A0FB 2E3IA 3S6WA 1JQQA 3QKJA 3QWXX 4BE0A 2HSPA 4M77C 1K8AU 2RQRA 2RD1A 1TUCA 2YWWA 3CCQA 2J7IA 1RACB 1LVKA 2R5AA 3FC3A 1UECA 2YUQA 1RL2A 2IPOB 3EFSA 4ZTJA 2WACA 4FT2A 4XTWA 2WSCE 4C5IA 2EYXA 4OP0A 3M0UA 3H9NA 8AT1B 5CR2A 2CP0A 2KQWA 2BZYA 4JZ3A 2LT1A 2PU9B 4QQGA 5A0LA 4M7DG 2FZGB 1PSEA 4N4GA 2RJDA 2L3RA 3H0FA 2RPNA 3RESA 3OYCA 2OX7A 5GANe 2XKOC 1HD3A 2ZGWA 2YUPA 1X6OA 2GNCA 2MWOA 1MGQA 5L8RE 1VQ4T 4OB2B 4BDZA 3CXCA 3FEOA 3RMSA 2PVGB 3F70A 2K5LA 1SHFA 2DVEA 4C92F 3PVLA 4C0GA 4HCZA 4M78C 4C92D 4C0ZA 1G3SA 2CYZB 2OAWA 4R56A 2JUFA 2HQXA 2HZYA 3GIBA 2HL3A 1UEBA 5CO7A 4J9FA 4DOVA 5GAN7 1MMAA 3BDLA 4JPBW 1S72T 2FPFA 5HKCA 2PZ1A 3HSBA 1K8AR 3N5BB 2W10A 3SD4A 1TOVA 1N9SA 2VV5A
chains in the Genus database with same CATH topology
1KC8U 4A4GA 1OYXA 1QP3A 3A8HB 3M55A 4EMHA 3JCMb 3I55T 1M5Q1 3PMIA 1LOJA 3M56A 3SWNC 5GMKl 4LDYA 4QQDA 5GMKh 1XQHA 1JJ2A 4PLLA 5GAMg 4X9CA 2L5QA 4XU0A 4M7AG 2HD0A 2RI3A 2HQEA 2RM4A 2XICA 5LJ3g 4Q5WA 1AHJB 4XQ3A 2HAXA 4M7AB 3UT1A 5C6SA 1VQOT 1I5LA 2EQMA 3L1AA 3GF5A 3CCUA 3JCMe 3OYGA 1VQ9T 2K5IA 4J8OA 4ZGDB 4FT4A 1Q82U 4LDWA 3LYIA 1Q81U 4PJOE 5GAN5 1LNXA 3WVDB 5KCOA 3G4SA 4NOYA 3PFSA 5IAYA 3GPLA 1JBMA 4HKEA 4KT0E 2P0PA 5FU6B 4RCCA 2DAQA 1VIEA 3L2RA 2KSSA 4J5YA 2QQSA 4ZN1A 4OGEA 4C8QG 2LVMA 2K3XA 3OW2S 1ZHIA 2BKDN 2ZPEB 4IUTA 5DLQE 2QQAA 3OQ5A 5KE2A 4NS5A 3HFOA 4C8QB 4EPCA 5GAN4 1VQMA 3GP8A 3VUBA 2EWNA 2QA4A 4A4EA 2K57A 2ZCFB 1R8OB 3VUZA 1JJ2S 1NE8A 2YRVA 2E41A 4BY6B 1UGPB 3V7CA 4CRIA 2FB7A 5J3BA 1QP2A 3OS0A 4MDXA 2E5QA 4M7DA 5CQYA 3OYFA 3M54A 4PJOC 1Y96A 4OF1A 3CCRA 2WSEE 3M4GA 2LC4A 3HRTA 1OI1A 2LCCA 3JCMV 3MHXA 3DB3A 5J39A 4E7JA 4LDXA 2LNVA 4DA4A 3GLXA 4BE1A 2GF7A 3OY9A 3MEVA 5LL6S 1VQ8A 3X20B 4F7UF 2RJEA 3J7AF 4L59A 4C0DB 4C8QD 1M1FA 1RI0A 3OS2A 1YJNT 1KQSA 3JB9I 3FRNA 3META 5EG2A 2EFIA 5LJ5g 3X26B 2QXFA 3QZ5B 5GAMj 3Q1JA 4M78F 3RKXA 4M75G 2RHIA 1N9RA 1W2BA 3SFMA 1BI1A 4O5VA 4QVCA 4M75B 3TU4K 2O4XB 4J6YA 3M53A 1NPPA 3ASKA 4XTVA 3OYEA 3HFNA 3QSUA 4V2SA 3H8ZA 2JOYA 3V8LA 3JCMW 2DO3A 3HRSA 1YITA 5CKDA 1YHQA 1HK9A 1QVFS 3CCJA 2RA2A 4C0FA 3I55A 1I8FA 4EMKC 4C92G 3FLGA 3UPUA 5GANf 3SDZA 3CCVA 2DTIA 3CCUT 1K73C 4BI4A 2E10A 4C92B 2XHCA 1UB4A 4XK8E 2EAYA 1YJ9T 3P8DA 3G4ST 1Q7YC 3HKSA 5KH6A 5LJ3d 3CBMA 2IVWA 3JCMd 3PIOA 4M75F 1VQLA 2YHTA 1KQSS 5GAN8 1K73U 3HPWA 3L2ZA 2KK4A 2K2VA 3L2UA 3MEAA 4M75D 3M59A 2HNIA 5FROA 1W2BS 2RHYA 3JCMP 2E6ZA 1Q7YU 3QZ9B 5HK0A 1VQ7A 1BI0A 4Z02A 3BDUA 2QA4T 4M77G 4II1A 2LDMA 2QQBA 4RCBA 2H3JA 2O01E 4M77B 2L89A 5CVIA 1X75C 4N4IA 4FIBA 2E70A 4DOWA 5FU6C 3DLLA 2M1HA 2EJ9A 4JRPA 1KG1A 5KE3A 2RI5A 2LQ8A 5A2QE 5CIUA 3JCMX 5GAOm 3CMAA 3WXMB 3VU3C 3CBPA 5FU7B 2EIFA 4MZPA 1K9MC 2KY9A 3UDCA 2OTLA 2EQJA 2RB6A 3VYGA 5IT9E 3PMTA 4QVZA 4IUQA 5HK3A 1G3WA 5FRMA 4VUBA 1UGQB 4PL6A 5GANh 1WPYA 2XG8D 3FJPA 2DZ9A 3JRZA 4TVRA 5CKHA 4M7DE 1K9MU 2EKOA 2VUBA 4BUGA 3A8LB 3CCSA 3ER0A 4IUUA 4RG2A 4EMGA 3PNWC 2FHDA 1NJIC 1WJQA 4C5EA 2XIDA 3EFRA 3QO3A 3O8VA 4M7AA 1WJSA 2GFUA 5GAOl 1DJ7B 3OS1A 2AHJB 4N0AA 5FLXE 1M1GA 3CC7A 5A0GA 2JNGA 2JVVA 2X4YA 2ZPHB 1N8RC 2EJFA 3OA6A 2C06A 5LJ5d 1NJIU 4L5GA 1M4ZA 3CCMA 4A53A 4EDUA 1U1TA 1YHQT 2DPPB 1YITT 3CCLA 2MWPA 2F5KA 4PJOF 1I81A 3CCEA 1JRIA 3CCJT 4BI3A 3QYGB 3CCVT 4WF2A 1YI2T 1M90C 3HRUA 3LLRA 4C8QA 4IURA 3CC4A 3JCMQ 1M1KC 1VQNA 3L2QA 4M7DC 1YBYA 4PKCC 4JRKA 1VQLT 5GAMe 1BI2A 2K3YA 4ZN3A 3I56T 2F69A 3C94A 5CCAA 3VKIA 5GAOp 3WVEB 2MI6A 4ZGEB 4NL3A 1Y7XA 5LJ3e 2V8KA 4E7HA 1M90U 2XD0A 3OYKA 4HCBA 3MEWA 1UGSB 4LDUA 1YJ9A 1M1KU 1P92A 3A8GB 3G6EA 1VQ7T 3JCMf 2RK1A 3KBGA 2RHUA 1UGRB 2CZ1B 3BW1A 2GFAA 1X01A 3RMQA 4C92C 4A4KA 1VQKA 4MMLA 3J81E 1W4SA 2DIGA 1H641 1BYMA 2X4WA 4F7UG 5GMKj 2GQVA 2E12A 3V7SA 4HA8A 4E47A 4LDVA 4F7UB 1I4K1 3LGFA 2M0OA 3CMAT 1QVGA 1M8VA 3QXEB 5I2MA 4BE2A 1YIJA 2OTLT 4RKUE 4XTZA 4M78G 3JCMJ 2GCXA 4OB1B 4UC4A 1Y07A 1XNIA 4QW2A 4M78B 3QUIA 4CI0C 2KMTA 1QW1A 1QVFA 1WNLA 4YTLA 2O4XA 2VGMA 1B34B 1OZ3A 1WQWA 3M58A 3MP1A 5HY6A 1N6AA 4DQ2A 5GAOq 3EAEA 3OYAA 3CCST 2XI9A 2M9UA 4E7IA 1FXXA 2KVQG 3E1SA 3BY7A 2MMPA 4B9XA 2Y4YA 1FWZA 5FU7C 3M4YA 3CC7T 4C92A 2VC8A 3GNFB 1VQ5A 2CGHA 3RIRA 3CCMT 1G3TA 3JCMh 1PSFA 2XDPA 4OMFB 3CCLT 1U8RA 1Q86C 3OYBA 1QVGS 5LJ5e 3CCET 1FX7A 2R58A 4MDWA 3HHTB 4M7AE 3OSSC 4M78D 2PQWA 3T9NA 4Y91A 4X34A 2L8DA 3PIPA 3JB9H 3CC4T 2RHXA 2QDYB 3LW5E 1VQNT 1BIAA 3OYLA 3INZA 1Q86U 2XK0A 2ZPFB 2OAUA 4RG8A 4MZMA 3OYYA 4XU1A 4JS4A 3CC2A 4M77A 4XU2A 2DTOA 3KUFA 1YI2A 3SWNB 5GAMd 3X25B 1YCYA 4RMOA 2E64A 2RH2A 3G71T 3G6ET 1KD1C 4C8QE 3I56A 3LH0A 2ZPGB 4JLGA 3MO8A 4BI8B 5I2SA 3CEYA 1WJRA 5GANg 3CBOA 3OYJA 1VQKT 3RKWA 3LGLA 3DLMA 4M7AC 1BIBA 2NLUA 3OBYA 2KAFA 1KD1U 4JLIA 4N0AC 5CKBA 3S3MA 2FVUA 2QQRA 3MEUA 3QPHA 4ME7A 1VQPA 3OYHA 1SSFA 2Y90A 4A4FA 5FRNA 4XAXB 3LWHA 3PTAA 1YIJT 1BI3A 3E19A 4M7DF 3JSCA 2E6NA 2DXCA 2R5MA 3FIFA 3OYIA 2RHZA 3ZFJA 4XTUA 4KULA 2YLCA 2RI2A 3FDRA 4MZTA 3VJPA 4C8QC 1NPRA 5LJ5h 5GAOr 1XOVA 3SB2A 3PT9A 1KQ1A 3KXTA 2E65A 2E1HA 4ELZC 3CMEA 4PJOG 3OMGA 2DXBA 1GXIE 4BY6C 3LWIA 3TCJA 2G3RA 2JTFA 3ME9A 4PJOB 5GAN6 5M9OA 4J6XA 4FU6A 5J26A 4J6WA 3DB4A 4GLKA 2DIQA 5DY9A 3AHUA 2X35A 4J83A 1YJWT 3OYMA 1VQ5T 4IUPA 5GAN3 3BFMA 1IREB 4JDSA 2VGNA 1G5VA 3QHSA 2PUKB 4LD9K 1VQ6A 4KUIA 2CS7A 1ZBXA 4HCCA 4ZGJB 2DKGA 2EQUA 4J7IA 2KDSA 2DXTA 4C0DC 5A0DA 2CZ7B 4C92E 3OB9A 5GAN2 4E7KA 4X9DA 3ZBDA 2LX9A 2DZCA 3NTIA 3CC2T 4JRIA 4BACA 5CKFA 1N8RU 4KBMB 4PJOD 1KHIA 2YLBA 4E7LA 5GANj 2JN0A 2MAMA 2B8AA 4OVAA 4XTXA 3R6OA 1BKBA 1O9SA 3L2VA 2JZ2A 2X4JA 4M75C 4F7UA 2P4TA 3JB9F 1EIFA 2DD4A 3QJ6A 2FYKA 5IN1A 3TEEA 3V8KA 4A54A 3GOXA 5GMKi 3JB9J 3E9GA 4GY5A 4EMKB 5GAMf 2PVDB 4XU3A 2QEXA 4M77E 1KHCA 3G71A 2PVOB 5LJ3f 2I2LA 3OYDA 4M78A 4D6WA 4JRQA 3QYHB 1B34A 2RJFA 2CKKA 2VXFA 5GANd 3JAME 1VQPT 3A8OB 4J7FA 2A7YA 3PGGA 4OB3B 4ZTFA 3M57A 1Q81C 1Q82C 1M9SA 2LCLA 3QBYA 2IG0A 3JCMg 3QJYA 1WQ7A 1D3BB 3QIIA 4PLIA 5CK9A 4BDYA 2CZ0B 4B9WA 1K8AC 4IUVA 1N27A 3NTHA 3OBWA 4KUDK 4FM4B 3S6WA 5D6WA 3OS5A 4PNOA 2LTOA 3CMET 3QKJA 1VQ4A 3S3NA 1H3ZA 4BE0A 2WSFE 4M77C 2D9TA 4M75A 2RO0A 1K8AU 2RD1A 3CPWA 2P0QA 3A8MB 3CCQA 4Y28E 4M7AF 3HL8A 2EQKA 2DXUA 5D6XA 1VQ6T 2RK2A 2FL7A 2R5AA 3L2WA 1JB0E 3SWNA 5GAMh 1ZQ1A 3FC3A 4M7AD 1RL2A 1YJWA 2EJGA 3OSVA 3OYNA 3EFSA 2JTMA 5LJ3h 3HP9A 4ZTJA 2WACA 4FT2A 2BUDA 5I21A 4XTWA 3NTKA 5CKEA 1KQ2A 3S3OA 2EYQA 2XU8A 3QDRB 1TH7A 1U1SA 1VUBA 2WSCE 3NFCA 4C5IA 4JUVA 2OTJT 4OP0A 4C8QF 4JJNK 4C5GA 5LJ5f 4MMKA 3L42A 3CD6A 5CR2A 5KCHA 2R57A 4ATOA 3A5ZB 3CPWS 1XTDA 5CQXA 4JS5A 2KQWA 3GNGA 3QG1A 2F5TX 3VYHB 2QEXT 1S72A 2LT1A 2PU9B 4QQGA 5A0LA 4M7DG 2VYTA 3MCAB 1IZ6A 1PSEA 2MF2A 4N4GA 4M7DB 1Y96B 2RJDA 4C5HA 4BB7A 5LJ3j 2L3RA 4F7UE 3RESA 2K4YA 3OYCA 3G7ZA 3E9FA 5GANe 3DKMA 2DTHA 2XKOC 4QVDA 1NZ9A 4N4HA 5DLOA 3V7RA 2Y4XA 2ZGWA 4PJOA 5D6YA 2CZ6B 1X6OA 4M78E 3URGA 1OZ2A 2QQ9A 4HT9A 2QTXA 2ZPIB 2MWOA 1MGQA 2ZPBB 3VV0A 3LX7A 2BIVA 5L8RE 1VQ4T 2HBPA 2D0QB 3CPFA 1O75A 1VQOA 4OB2B 3UWNA 2PUOB 4M7DD 4BDZA 1VQ9A 3CXCA 3MP8A 5CAIA 3FEOA 3TREA 3CCQT 1VQMT 2DEQA 4QQ6A 5GMKe 3RMSA 3RKYA 5DM7R 4HT8A 2PVGB 2ZZDA 3F70A 3P8HA 4ELYC 2DD5A 2K5LA 1WGSA 2DVEA 1HXDA 4C92F 3FB9A 4OGCA 4M75E 2LT4A 4C0GA 4HCZA 4M78C 3C95A 5AYFA 2QI2A 4C92D 4IKFA 2RJCA 3JB9G 4C0ZA 3CCRT 3ZEHA 5GAOn 1Y71A 1G3SA 2VXEA 2CYZB 4L6V5 4R56A 1VIFA 4EMKA 2JUFA 2LRQA 2DJZA 3RUXA 2A3LA 2LQKA 3P8BB 2HQXA 4BD3A 1LJOA 3CD6T 2XDDA 4NL2A 1VQ8T 1G3YA 3RERA 2P0KA 3M5AA 2V8IA 3M9QA 4FL6A 3X28B 5C0MA 4M77F 4A4HA 5LJ5j 3CXCS 2D6FA 3GIBA 3C12A 1QVPA 3V8JA 1UEBA 5CO7A 2OTJA 4DOVA 5GAN7 4FSXA 3BDLA 5GMKm 4P5NA 1S72T 1MHNA 4M77D 3OMCA 5HKCA 4R55A 1V29B 3HSBA 2XDBA 2V8JA 4OB0B 1D3BA 3JCMc 4LD6A 1KC8C 3H6ZA 3J80E 3X24B 3C4SA 3N5BB 2K5FA 2DK3A 1YJNA 3SD4A 2X4XA 4XTYA 1N9SA 3JB9D 3MP6A 3OW2A 2VV5A 4O6JA 2M16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UB4 A;  1M1F A;  4MZP A;  4MZT A;  3VUB A;  1NE8 A;  2MF2 A;  3HPW A;  5CKF A;  4ELZ C;  5HK3 A;  5CK9 A;  4VUB A;  5CO7 A;  3JRZ A;  3TCJ A;  5CKH A;  4ELY C;  4MDX A;  5HK0 A;  3G7Z A;  2VUB A;  5CKE A;  5CCA A;  5HKC A;  5CQY A;  4OF1 A;  5CKB A;  1VUB A;  5DLO A;  3NFC A;  5CKD A;  2KMT A;  4ME7 A;  1X75 C;  4HKE A;  5CR2 A;  2C06 A;  4MZM A;  3JSC A;  5CQX A; 
#chains in the Genus database with same CATH topology
 1KC8 U;  4A4G A;  4EMH A;  1LOJ A;  5GMK l;  5GMK h;  4PLL A;  4X9C A;  1GCP A;  4DEX A;  1UTI A;  1PWT A;  1QWF A;  2HAX A;  4M7A B;  3UT1 A;  1VQO T;  5KYW A;  1I5L A;  1OU9 A;  2W0Z A;  2EQM A;  1VQ9 T;  1C0M A;  3OYG A;  4PJO E;  3LYI A;  4J5Y A;  2ZPE B;  4IUT A;  2QQA A;  5KE2 A;  4C8Q B;  5GAN 4;  2YUO A;  4A4E A;  1R8O B;  2E41 A;  4BY6 B;  2MIO A;  2V1Q A;  1UHF A;  4M7D A;  3M54 A;  1Y96 A;  4OF1 A;  3CCR A;  2WSE E;  3M4G A;  2LC4 A;  3HRT A;  2LCC A;  1ZX6 A;  3DB3 A;  1K0X A;  1QMC A;  2LNV A;  4DA4 A;  3OY9 A;  1VQ8 A;  5LL6 S;  2J06 A;  1BBZ A;  3E2U A;  3FRN A;  2EFI A;  2C0T A;  2KRM A;  1RAA B;  1I0C A;  2BE9 B;  3RKX A;  4O5V A;  6AT1 B;  3ULR B;  4J6Y A;  2FPE A;  3M53 A;  4XTV A;  3TQ7 P;  1KFZ A;  2JOY A;  1IGQ A;  3VS4 A;  3HRS A;  1QVF S;  3CCJ A;  2RA2 A;  3UPU A;  3CCR Q;  4C92 G;  3FLG A;  1KSW A;  1K73 C;  2DTI A;  3CCU T;  1NYF A;  4BI4 A;  1UB4 A;  3G4S T;  3CD6 Q;  2B86 A;  3HKS A;  1Q7Y C;  1VQ8 Q;  5LJ3 d;  1UGV A;  2IVW A;  1KQS S;  4B6M A;  2VB6 A;  1PRL C;  2HNI A;  3M59 A;  1W2B S;  3JCM P;  1YFN A;  3VS7 A;  1BI0 A;  1NEG A;  4Z02 A;  2DEU A;  4M77 B;  3VS0 A;  1WFW A;  4N4I A;  4OMQ A;  5FU6 C;  2LMJ A;  4KRT A;  1AZE A;  4AFS C;  3CMA A;  2O9S A;  1K9M C;  3UDC A;  2OTL A;  1WHG A;  2EQJ A;  1U5S A;  1GFD A;  4QVZ A;  1SF9 A;  1SPK A;  1M3C A;  4PL6 A;  3JRZ A;  4E7Z A;  4EMG A;  3PNW C;  2FHD A;  1WJQ A;  3EFR A;  2DL3 A;  2GFU A;  5GAO l;  1W70 A;  5FLX E;  1M1G A;  1MV0 B;  2C06 A;  2LJ3 A;  1MV3 A;  1NJI U;  4PFP A;  4EDU A;  3EG9 B;  1YHQ T;  3CCL A;  4PJO F;  1JRI A;  4BI3 A;  3EGX B;  4J9C A;  3CMA Q;  1YI2 T;  3HRU A;  3CC4 A;  2ESW A;  3JCM Q;  1M1K C;  1LCK A;  1ZBJ A;  1BI2 A;  4IIM A;  1W6X A;  5CCA A;  2HMA A;  2MI6 A;  1UE9 A;  4E7H A;  2CP3 A;  2LJ0 A;  2DYB A;  1UGS B;  2P84 A;  1H8K A;  4AFZ C;  2CZ1 B;  4OMN A;  2GFA A;  1PKS A;  1X01 A;  2EGA A;  4C92 C;  1QVF P;  3G1J A;  1VQK A;  4MML A;  4LNP A;  2LNH B;  1NBE B;  2GQV A;  3CQT A;  3CCL Q;  3V7S A;  4F7U B;  3QWY A;  1I4K 1;  3SHW A;  2CUB A;  1M8V A;  4BE2 A;  1KQS P;  1YIJ A;  1VA7 A;  2QDL A;  1Y07 A;  4M78 B;  1W2B P;  4CI0 C;  1QW1 A;  1QVF A;  1WNL A;  2VGM A;  3MP1 A;  2YXY A;  1SEM A;  3OYA A;  2D8J A;  2M9U A;  4JJD A;  4B9X A;  2QAZ A;  2NWM A;  3M4Y A;  3CC7 T;  4C92 A;  3GNF B;  1KD1 R;  3M0P A;  3CCM T;  1G3T A;  2FPD A;  2XDP A;  4OMF B;  1Q86 C;  3OYB A;  2QA4 Q;  3CCE T;  2COW A;  3GBQ A;  3I5S A;  3OSS C;  5KYY A;  3PIP A;  3JB9 H;  1YIJ Q;  1AWJ A;  1RLP C;  3OYY A;  1F1B B;  1TXQ A;  2RH2 A;  2AZV A;  2QGG A;  1ZSZ A;  4JLG A;  4BI8 B;  5I2S A;  2KRS A;  3OYJ A;  3RKW A;  4AG1 C;  2NLU A;  3U23 A;  3OBY A;  1WXT A;  2C0I A;  2ROL A;  2QTV A;  1MMD A;  2QQR A;  1NJI R;  1SSF A;  2Y90 A;  2YRD A;  4XAX B;  3PTA A;  1QCF A;  3E19 A;  3JSC A;  1OPL A;  1HYO A;  2FZK B;  4XTU A;  1PHT A;  2HDA A;  3EFO B;  1IHV A;  4KUL A;  1NPR A;  3SB2 A;  2E1H A;  4PJO G;  2DXB A;  1UJY A;  1M27 C;  2J05 A;  1PM3 A;  3BFM A;  4JDS A;  1VQ7 Q;  2PUK B;  4LD9 K;  1VQ6 A;  4KUI A;  4Z88 A;  2J6O A;  4HCC A;  2EPD A;  2DXT A;  2DNU A;  3OB9 A;  3ZBD A;  2HCK A;  1X27 A;  4RTV A;  2YT6 A;  2E3H A;  4ZNX A;  3M0S A;  2MAM A;  2M02 A;  3JB9 F;  5IN1 A;  3V8K A;  2DIL A;  4GY5 A;  2PVD B;  3G71 A;  2AKL A;  2IIM A;  5GAN d;  1OOT A;  2A7Y A;  4DBF A;  2LCL A;  3QJY A;  1WQ7 A;  4AG2 C;  5CK9 A;  4PLI A;  4B9W A;  2KI7 A;  4FM4 B;  3MJX A;  5D6W A;  3OS5 A;  2LTO A;  3CME T;  2V1R A;  3S3N A;  2WSF E;  4D8D A;  2RO0 A;  1YP5 A;  3VS6 A;  3CPW A;  2I0N A;  2KT1 A;  4CC4 B;  3G71 Q;  2QYZ A;  2DXU A;  2RK2 A;  2FL7 A;  3L2W A;  1JB0 E;  3SWN A;  1ZQ1 A;  2M51 A;  2JS2 A;  1M8M A;  5CKE A;  2KXC A;  1Y57 A;  3S3O A;  2EYQ A;  3QDR B;  1U1S A;  3SEM A;  4QKU A;  4E6R A;  4JJN K;  5LJ5 f;  4FYW B;  2FZC B;  3A5Z B;  1UUE A;  1XTD A;  5CQX A;  2NUT A;  4JS5 A;  1SKU B;  3QG1 A;  2LP5 A;  1J3T A;  2JS0 A;  1LPL A;  5I11 A;  1QKX A;  2JXB A;  3EHQ A;  2DTH A;  4QVD A;  2Y4X A;  4PJO A;  2CZ6 B;  4HT9 A;  2ZPB B;  3VV0 A;  5IHK A;  2D0Q B;  2PUO B;  4M7D D;  1BCO A;  2DX1 A;  3MP8 A;  1JU5 C;  3VS5 A;  1Z9Q A;  5DM7 R;  3RKY A;  2O2O A;  3P8H A;  4ELY C;  1UDL A;  1YN8 A;  2EBP A;  3FB9 A;  4OGC A;  2LT4 A;  3C95 A;  2RJC A;  3JB9 G;  3CCR T;  2CT4 A;  1D0Y A;  4EMK A;  2LRQ A;  1C1A A;  2A3L A;  1SSH A;  4OMO A;  3CD6 T;  1VQ8 T;  4NL2 A;  3M5A A;  5LJ5 j;  4FL6 A;  3CXC S;  2D6F A;  4A4H A;  1Q82 R;  1QVP A;  2GTO A;  1Q81 R;  2FO0 A;  2DYI A;  3UA7 A;  4P5N A;  4R55 A;  2CSQ A;  4OB0 B;  1OPK A;  3M0Q A;  3H6Z A;  1PKT A;  2MCN A;  3J80 E;  1YJN A;  3OW2 A;  2M16 A;  1OYX A;  1QP3 A;  1M5Q 1;  3M56 A;  5KYX A;  1PD1 A;  2CUD A;  2RI3 A;  2NUP B;  1SG5 A;  4Q5W A;  1AHJ B;  2ATC B;  4FCY A;  2GBQ A;  5KYU B;  3H0H A;  5GAN 5;  1LNX A;  3GPL A;  1JBM A;  2DAQ A;  3LH5 A;  3L2R A;  4OGE A;  2LVM A;  1ZHI A;  2QEX Q;  1H3H A;  3OQ5 A;  3VRY A;  3HFO A;  1VQM A;  3EGD B;  3VUB A;  2DL5 A;  4PJL A;  2K57 A;  2ZCF B;  2X3W D;  2YRV A;  2KRN A;  1UGP B;  3V7C A;  5J3B A;  3M0R A;  2E5Q A;  5CQY A;  3OYF A;  1OEB A;  2JM8 A;  1PC0 A;  1T0J A;  3GLX A;  1UFF A;  3I9Q A;  2A08 A;  3J7A F;  1K73 R;  2MOX A;  1RI0 A;  2CSI A;  1Q7Y R;  5EG2 A;  3CCQ Q;  1VQM Q;  4M75 G;  1OX8 A;  3TU4 K;  3ASK A;  4X1V A;  3CXC P;  2CDT A;  1RAB B;  4KGZ B;  3V8L A;  3JCM W;  1YIT A;  5CKD A;  1HK9 A;  4FYX B;  4C0F A;  1RI9 A;  1OUL A;  3CCV A;  2NUZ A;  2XHC A;  1WHM A;  2LX7 A;  5KH6 A;  1ZA1 B;  3CBM A;  3JCM d;  3PIO A;  1VQL A;  2YHT A;  5GAN 8;  1PG5 B;  3HPW A;  3L2Z A;  2K2V A;  1PCX A;  5FRO A;  2QA4 T;  2RF0 A;  4II1 A;  4RCB A;  2H3J A;  4DOW A;  2EJ9 A;  2F2V A;  2M1H A;  4D8K A;  2RI5 A;  5A2Q E;  1KJW A;  5CIU A;  3CCV Q;  5FU7 B;  3C0C A;  4MZP A;  1I5O B;  2RB6 A;  4Y92 A;  3R6N A;  3VYG A;  5IT9 E;  1VYU A;  1HSQ A;  1X69 A;  1VQL Q;  4VUB A;  1UGQ B;  4RUG A;  3FJP A;  4J9E A;  1M1K R;  2EKO A;  2XMF A;  4BUG A;  3A8L B;  3H41 A;  3CCS A;  1AZG B;  1G2B A;  2PTK A;  1RUW A;  1DJ7 B;  1KIK A;  4WTO B;  2JVV A;  2ZPH B;  2F5K A;  2COY A;  1WHJ A;  3QYG B;  3VS2 A;  4PJN A;  4WF2 A;  1UG1 A;  1M90 C;  1WHK A;  3LLR A;  4M7D C;  1VQN A;  2LCS A;  1PD0 A;  4FW1 A;  3VKI A;  5GAO p;  2KNB B;  1I1J A;  2XD0 A;  3H0I A;  2K7A A;  1YJ9 A;  4HCK A;  3CCS Q;  3G6E A;  1RLQ C;  1T3L A;  3JCM f;  1VQ7 T;  3BW1 A;  1UGR B;  1V1C A;  2CH4 W;  1N5Z A;  1M3A A;  1W4S A;  2O88 A;  1H64 1;  3NHN A;  2X4W A;  5GMK j;  2HQH A;  2E12 A;  2CT3 A;  4E47 A;  3LGF A;  5I2M A;  4RKU E;  3JCM J;  4OMP A;  2GCX A;  4OB1 B;  4UC4 A;  2RQV A;  2O4X A;  1IO6 A;  1B34 B;  3M58 A;  5HY6 A;  5GAO q;  5HCK A;  1FXX A;  1YJ9 Q;  1SRL A;  1QKW A;  1WX6 A;  1WIE A;  1VQ5 A;  3RIR A;  2GQI A;  3JCM h;  1WYX A;  2OI3 A;  1M30 A;  2DJQ A;  2R58 A;  4MDW A;  4M7A E;  1ZUK A;  2FG0 A;  2L8D A;  2OJ2 A;  2QDY B;  2ZPF B;  2OAU A;  4RG8 A;  3CC2 A;  4JS4 A;  2JW4 A;  2DTO A;  3KUF A;  5GAM d;  3EH2 A;  1Q95 G;  2E64 A;  3G71 T;  1JXM A;  4C8Q E;  3I56 A;  2ZPG B;  3EG3 A;  5FW9 A;  2K2M A;  1V76 A;  1KD1 U;  2GTJ A;  1NLP C;  1VQP A;  1EFN A;  2LJ1 A;  3RDV A;  1AD5 A;  3CCJ Q;  1N8R R;  1D09 B;  1GL5 A;  2YLC A;  2RI2 A;  4MZT A;  3PT9 A;  2E65 A;  1GXI E;  3TCJ A;  3I56 Q;  5M9O A;  5J26 A;  1WXU A;  3DB4 A;  5DY9 A;  2DIQ A;  1K4U S;  2X35 A;  5GAN 3;  2X51 A;  4J9G A;  1U3O A;  1FYN A;  4PJM A;  4CC3 A;  5A0D A;  2CZ7 B;  2L3Q A;  4E7K A;  2EQI A;  3KFV A;  2LX9 A;  1YWP A;  2KR3 A;  4PJO D;  2YLB A;  2OTL Q;  2B8A A;  1O9S A;  2X4J A;  3GOX A;  2L0A A;  5GAM f;  4M77 E;  1KHC A;  2DVJ A;  3IQL A;  2PVO B;  5LJ3 f;  1ABO A;  2RMO A;  3JAM E;  1B3Q A;  2VAS A;  2HKN A;  1B7T A;  1AVZ C;  2BZX A;  4HXJ A;  2DE0 X;  3JV3 A;  1K8A C;  1MUZ A;  3EGU A;  1QWE A;  4PNO A;  2F1L A;  3CC4 Q;  2M0Y A;  1VQ4 A;  1H3Z A;  5ECA A;  1R0B G;  3A8M B;  4Y28 E;  4M7A F;  3HL8 A;  1NG2 A;  1ZSZ C;  2EQK A;  5D6X A;  5IHI A;  5KYW B;  5GAM h;  3NGP A;  4M7A D;  1VQK Q;  2EJG A;  3OSV A;  5LJ3 h;  3HP9 A;  1TWB A;  1KQ2 A;  1VUB A;  3RNJ A;  3D7S B;  4C8Q F;  4LUE A;  3HTR A;  4C5G A;  4MMK A;  2R57 A;  4ATO A;  3CPW S;  1Y0M A;  2KYM A;  3VYH B;  2C0O A;  2QEX T;  4PFZ A;  1S72 A;  1IHW A;  1IZ6 A;  4M7D B;  2RN8 A;  1FMW A;  1Y96 B;  4BB7 A;  5LJ3 j;  4F7U E;  2K4Y A;  2L3S A;  3DKM A;  1H92 A;  2H3E B;  1XJW B;  3V7R A;  2HBW A;  4M78 E;  2PNI A;  3URG A;  1OZ2 A;  2QQ9 A;  2ZPI B;  4CC7 A;  3LX7 A;  2BIV A;  2HBP A;  2DET A;  3CPF A;  1O75 A;  1VQO A;  1AWO A;  1VQ9 A;  2YSQ A;  3TRE A;  3CCQ T;  2K3B A;  1VQM T;  4HT8 A;  1IB8 A;  4R0K A;  1WLP B;  2DD5 A;  1WGS A;  2EYZ A;  4ORZ A;  3UA6 A;  1RAE B;  4M75 E;  2G6F X;  3I5R A;  5AYF A;  2HKQ B;  2QI2 A;  4IKF A;  2DRM A;  5GAO n;  1Y71 A;  1VIF A;  4AFU C;  4RTY A;  2DJZ A;  4HVV A;  3P8B B;  4BD3 A;  1G3Y A;  1MNE A;  2V8I A;  5C0M A;  3X28 B;  4M77 F;  3C12 A;  3V8J A;  1E6H A;  2OTJ A;  1VQ9 Q;  4FSX A;  5GMK m;  4M77 D;  1V29 B;  1D3B A;  3JCM c;  1KC8 C;  4FYV B;  3X24 B;  2ED1 A;  2K5F A;  2X4X A;  3JB9 D;  2FEI A;  1NYG A;  3M55 A;  3JCM b;  1VQ6 Q;  3SWN C;  3VS3 A;  4QQD A;  1JJ2 A;  1XQH A;  1I07 A;  3CPW P;  1ZSG A;  2L5Q A;  1WHL A;  1Z9Z A;  4XU0 A;  4M7A G;  2XIC A;  2HQE A;  5C6S A;  3CCU A;  2OTJ Q;  1Q82 U;  1Q81 U;  4LDW A;  2DL4 A;  4KH1 B;  3G4S A;  4NOY A;  2L2P A;  3PFS A;  2P0P A;  5FU6 B;  4RCC A;  4RTZ A;  4E7S A;  1VIE A;  7AT1 B;  2DF6 A;  2KSS A;  1UJ0 A;  2QQS A;  2CP7 A;  4ZN1 A;  4C8Q G;  3OW2 S;  2BKD N;  4NS5 A;  4EPC A;  3VUZ A;  3TSZ A;  1GBQ A;  1QP2 A;  3OS0 A;  4PJO C;  2JJ9 A;  4HVU A;  1OI1 A;  4RTX A;  5J39 A;  3CCU Q;  2VVK A;  2GF7 A;  2KRO A;  3X20 B;  4F7U F;  2RJE A;  4L59 A;  1PNJ A;  1JEG A;  1M1F A;  3AT1 B;  4FSS A;  3OS2 A;  3JB9 I;  2KGT A;  2P4R A;  1SRM A;  5D7U A;  5LJ5 g;  2DFU A;  3X26 B;  2AZS A;  3QZ5 B;  4M78 F;  1N9R A;  3OYE A;  1NPP A;  3HFN A;  2ABL A;  3QSU A;  1ZUY A;  4V2S A;  2DO3 A;  1YHQ A;  2EKH A;  1CKA A;  3I55 A;  1I8F A;  4EMK C;  5GAN f;  4C92 B;  4XK8 E;  2EAY A;  2RQT A;  4DEY A;  1YJ9 T;  4QT7 A;  3RBB B;  4M75 F;  2F2W A;  1K73 U;  5KYY B;  4M75 D;  1Q7Y U;  2E6Z A;  3QZ9 B;  3BDU A;  4M77 G;  4F14 A;  2LDM A;  1BU1 A;  2QAS A;  2E5K A;  5CVI A;  1X75 C;  4FIB A;  3DLL A;  1YHQ Q;  5KE3 A;  2LQ8 A;  1ZSZ B;  3I55 Q;  1TU0 B;  3JCM X;  5GAO m;  3WXM B;  4Z89 A;  2KY9 A;  3OW2 P;  4PJJ A;  4IUQ A;  5FRM A;  5GAN h;  1M90 R;  1NM7 A;  4TVR A;  4E2F B;  2AKK A;  1K9M U;  1A0N B;  4RTT A;  1JXO A;  4IUU A;  1S1N A;  1T0H A;  1BCM A;  1NJI C;  2MYS A;  3EG1 A;  4C5E A;  4M7A A;  3OS1 A;  2AHJ B;  4N0A A;  1ACM B;  3CC7 A;  2JNG A;  2X4Y A;  5I22 A;  1BK2 A;  4L5G A;  3CCM A;  4J9H A;  1U1T A;  2DPP B;  3CCJ T;  3CCE A;  4PFO A;  1WHH A;  4EIK A;  4GLM A;  4GBQ A;  4C8Q A;  2COZ A;  1WXB A;  3L2Q A;  1TSF A;  2K3Y A;  3I56 T;  2F69 A;  4NL3 A;  1Y7X A;  1AWX A;  2V8K A;  2KYB A;  3OYK A;  4HCB A;  1M1K U;  1P92 A;  2QK0 A;  2D1X A;  2RHU A;  3RMQ A;  1K1Z A;  4A4K A;  1YJN Q;  1GBR A;  2DIG A;  2FRY A;  4F7U G;  1RAI B;  2EYW A;  4KGX B;  1WA7 A;  4LDV A;  1D1A A;  2M0O A;  3CMA T;  1QVG A;  2OTL T;  3TVT A;  4XTZ A;  1X2K A;  4M78 G;  4DBQ A;  2X3X D;  4YTL A;  1WQW A;  4LUD A;  1D1C A;  1N6A A;  2KT8 A;  1QCN A;  2XI9 A;  4E7I A;  1OX9 A;  2MMP A;  1M2V A;  2KBT A;  2VC8 A;  2CGH A;  3UAT A;  1GRI A;  1PSF A;  3CCL T;  1U8R A;  5LJ5 e;  4Y91 A;  3VRZ A;  3CC4 T;  3INZ A;  1Q86 U;  2A36 A;  4M77 A;  4XU2 A;  2QGF B;  3SWN B;  1YCY A;  2JMA A;  1E6G A;  1R77 A;  3LH0 A;  1K9M R;  3MO8 A;  3CEY A;  1VQK T;  3LGL A;  3DLM A;  1AT1 B;  2KAF A;  3REA B;  3S3M A;  2NUT B;  3QPH A;  5FRN A;  1YIJ T;  3LWH A;  1BI3 A;  4FYY B;  4KH0 B;  2E6N A;  1YIT Q;  2DXC A;  2R5M A;  4PK4 A;  2RHZ A;  3QDF A;  3MPU B;  3VJP A;  1D0Z A;  3FDR A;  5GAO r;  1KQ1 A;  3EG9 A;  4KGV B;  4ELZ C;  3CME A;  4AT1 B;  3OMG A;  2DMO A;  1C6V X;  2G3R A;  2JTF A;  4OMM A;  3EGX A;  5GAN 6;  4PJO B;  4J6X A;  4FU6 A;  4J6W A;  3AHU A;  1ZA2 B;  1RAG B;  2DLP A;  4IUP A;  4CC2 A;  1IRE B;  2A28 A;  1TS9 A;  3A1P A;  1RAD B;  1CSK A;  2CS7 A;  4ZGJ B;  2EQU A;  2KDS A;  4LE9 A;  2DL8 A;  4C0D C;  2AT1 B;  1IRX A;  2CP5 A;  1YCS B;  3NTI A;  4BAC A;  5CKF A;  1N8R U;  4OVA A;  3R6O A;  1BKB A;  3CME Q;  2RQW A;  2LQW A;  4M75 C;  4F7U A;  1R0C B;  2P4T A;  2DD4 A;  4IIO A;  3TEE A;  1TUD A;  5GMK i;  2O31 A;  3E9G A;  4EMK B;  1G83 A;  2MK5 A;  2I2L A;  4M78 A;  2JMC A;  4D6W A;  3QYH B;  3O5Z A;  2VXF A;  3A8O B;  4J7F A;  2VWF A;  4OB3 B;  1Q82 C;  1Q81 C;  3JCM g;  3QII A;  3ZL7 C;  2CZ0 B;  4IUV A;  1N27 A;  3NTH A;  3OBW A;  4KUD K;  1Q86 R;  1X6G A;  1VQN Q;  1QLY A;  1YNZ A;  4F16 A;  1E7O A;  2D9T A;  4M75 A;  5IXF A;  2P0Q A;  2DBK A;  5KYX B;  3G6E Q;  1OV3 A;  1VQ6 T;  4J9I A;  1YJW A;  4K11 A;  1NLO C;  3OYN A;  2VKN A;  2JTM A;  5AT1 B;  2BUD A;  4F17 A;  5I21 A;  2AIR B;  3NTK A;  1ZUU A;  2XU8 A;  1TH7 A;  2DER A;  2YUN A;  3NFC A;  4JUV A;  2OTJ T;  1AWW A;  3L42 A;  3CD6 A;  5KCH A;  1OQK A;  3GNG A;  5L23 A;  2F5T X;  1TG0 A;  2F2X A;  2VYT A;  3MCA B;  2MF2 A;  2BE7 D;  2FRW A;  3EFO A;  4C5H A;  1ARK A;  3G7Z A;  1YJW Q;  1VQ5 Q;  3EG2 A;  3E9F A;  3THK A;  1NZ9 A;  4N4H A;  5DLO A;  1GCQ C;  5D6Y A;  3EG0 A;  1M2V B;  2QTX A;  1RAF B;  2DBM A;  3TSW A;  3UWN A;  3CC2 Q;  3A98 A;  5CAI A;  2CRE A;  2MPX C;  2CP2 A;  1UHC A;  3UF4 A;  2DEQ A;  4QQ6 A;  5GMK e;  2ZZD A;  1HXD A;  1KC8 R;  2DRK A;  3ZEH A;  4L6V 5;  2VXE A;  1GCQ A;  3RR6 A;  1VQP Q;  3RUX A;  2LQK A;  1D0X A;  4ANJ A;  1LJO A;  2XDD A;  3RER A;  2P0K A;  3M9Q A;  5GJV B;  1MHN A;  3OMC A;  4RTW A;  2XDB A;  1X2Q A;  2V8J A;  4ESR A;  4LD6 A;  1AOJ A;  3C4S A;  2DK3 A;  4XTY A;  3MP6 A;  2EGC A;  4O6J A;  1IGU A;  2KEA A;  2EGE A;  3A8H B;  3I55 T;  3PMI A;  4LDY A;  3I35 A;  5GAM g;  2RQU A;  1PRM C;  2HD0 A;  2RM4 A;  5LJ3 g;  1ZLM A;  4XQ3 A;  1FMK A;  2LZ6 B;  3L1A A;  3GF5 A;  3JCM e;  2K5I A;  4J8O A;  4ZGD B;  4FT4 A;  3WVD B;  5KCO A;  5IAY A;  4HKE A;  4KT0 E;  2JTE A;  2K3X A;  3REB B;  5DLQ E;  3GP8 A;  1HJD A;  1JO8 A;  2EWN A;  2QA4 A;  1JJ2 S;  1NE8 A;  4CRI A;  2FB7 A;  1KK7 A;  2J6K A;  4MDX A;  3EHR A;  5IH2 A;  4AMC A;  3JCM V;  3MHX A;  4E7J A;  3EH1 A;  4LDX A;  4BE1 A;  3MEV A;  1B07 A;  1VQ4 Q;  4C0D B;  4C8Q D;  2K6D A;  4Z8A A;  1YJN T;  1KQS A;  2KXD A;  3MET A;  1X6B A;  3FJ5 A;  2QXF A;  2YRC A;  5GAM j;  3Q1J A;  2RHI A;  1W2B A;  3SFM A;  1BI1 A;  2CH4 A;  1QCO A;  4QVC A;  4M75 B;  2H8H A;  2O4X B;  3H8Z A;  4JZ4 A;  1VOM A;  3SDZ A;  5FWB A;  2E10 A;  1TUG B;  3P8D A;  2KK4 A;  5KYN A;  3L2U A;  2HL5 C;  3MEA A;  3NPF A;  1S72 Q;  2RHY A;  5HK0 A;  1VQ7 A;  2EVR A;  2QQB A;  2BTT A;  2O01 E;  2L89 A;  2E70 A;  4FW2 A;  1SHG A;  2CP6 A;  2BZ8 A;  4JRP A;  1KG1 A;  3PVQ A;  4AFQ C;  1EX4 A;  3VU3 C;  3CBP A;  3VS1 A;  2EIF A;  1IXD A;  3PMT A;  5HK3 A;  1G3W A;  1VQO Q;  1GFC A;  1WPY A;  2XG8 D;  2DZ9 A;  5CKH A;  2Z0W A;  1YWO A;  4M7D E;  1JJ2 P;  5IXB A;  2VUB A;  3ER0 A;  4RG2 A;  2NUP A;  4J9D A;  2K9G A;  1D1B A;  2XID A;  3QO3 A;  3O8V A;  1WJS A;  2DM1 A;  2QG9 B;  2ED0 A;  5KYU A;  5A0G A;  1N8R C;  2EJF A;  3OA6 A;  5LJ5 d;  1M4Z A;  4A53 A;  1YIT T;  2MWP A;  1I81 A;  1ABQ A;  3CCV T;  2ROT A;  1FMV A;  2HSE B;  4IUR A;  2GGR A;  3EGD A;  1YBY A;  4PKC C;  4JRK A;  1VQL T;  5GAM e;  4ZN3 A;  3C94 A;  4JJC A;  2LQN A;  4LXC A;  3WVE B;  4A63 B;  4ZGE B;  5LJ3 e;  1M90 U;  3MEW A;  4F04 B;  4LDU A;  3A8G B;  2RK1 A;  3KBG A;  2HEQ A;  3J81 E;  1BYM A;  4HA8 A;  2EYY A;  3QXE B;  4WCI A;  1MMN A;  4RTU A;  4OML A;  4DBR A;  4QW2 A;  1XNI A;  1U06 A;  3QUI A;  2KMT A;  4JJB A;  1OZ3 A;  1RAH B;  1K9A A;  4DQ2 A;  3EAE A;  2D8H A;  3NMZ C;  3CCS T;  2KVQ G;  3E1S A;  3G4S Q;  3BY7 A;  2Y4Y A;  1FWZ A;  4J9B A;  5FU7 C;  1M3B A;  3PE0 A;  2ECZ A;  4DBH A;  3M0T A;  1G8X A;  2D0N A;  1QVG S;  2NYS A;  1FX7 A;  1W1F A;  3HHT B;  9ATC B;  4M78 D;  2PQW A;  4HVW A;  3T9N A;  4X34 A;  1AEY A;  2RHX A;  3LW5 E;  1VQN T;  1BIA A;  3OYL A;  2XK0 A;  5GJW B;  2A37 A;  4MZM A;  4XU1 A;  1VYT A;  2E4H A;  1MMG A;  1YI2 A;  3X25 B;  4RMO A;  2SEM A;  1EZZ B;  2JT4 A;  1WZO A;  3G6E T;  1KD1 C;  5GAN g;  5FWC A;  1WJR A;  3CBO A;  1MND A;  2ZAE A;  4M7A C;  1BIB A;  4JLI A;  4N0A C;  5CKB A;  2FVU A;  1WI7 A;  3MEU A;  4ME7 A;  3OYH A;  4A4F A;  2J6F A;  4M7D F;  1K76 A;  4M4Z A;  3FIF A;  3OYI A;  3ZFJ A;  4C8Q C;  1YI2 Q;  5LJ5 h;  2V26 A;  1XOV A;  3KXT A;  4BY6 C;  3LWI A;  1X43 A;  3ME9 A;  1T3S A;  1TTH B;  4GLK A;  2DL7 A;  4J83 A;  1YJW T;  3OYM A;  1VQ5 T;  2KE9 A;  8ATC B;  2YDL A;  2VGN A;  1G5V A;  3QHS A;  2O9V A;  1NEB A;  1ZBX A;  1VYV A;  5IHN A;  1WDX A;  2DKG A;  4J7I A;  2SRC A;  4C92 E;  5GAN 2;  3BE3 A;  1OU8 A;  4X9D A;  2DZC A;  2DA9 A;  2RNA A;  1CKB A;  1M2O A;  3CC2 T;  4JRI A;  4KBM B;  1BB9 A;  1KHI A;  4E7L A;  5GAN j;  2JN0 A;  4XTX A;  3L2V A;  2JZ2 A;  1K0S A;  2JM9 A;  1EIF A;  2L3P A;  2FYK A;  3QJ6 A;  2ENM A;  3MKD A;  4A54 A;  3JB9 J;  1QVG P;  2X9H A;  4XU3 A;  2QEX A;  2K79 A;  3OYD A;  5EC7 A;  2AK5 A;  4JRQ A;  1B34 A;  2RJF A;  2CKK A;  4LN2 A;  1VQP T;  3CC7 Q;  3PGG A;  4ZTF A;  3M57 A;  1M9S A;  1QQJ A;  3CCM Q;  3QBY A;  2IG0 A;  2EW3 A;  1D3B B;  4BDY A;  3CCE Q;  2A0F B;  2E3I A;  3S6W A;  1JQQ A;  3QKJ A;  3QWX X;  4BE0 A;  2HSP A;  4M77 C;  1K8A U;  2RQR A;  2RD1 A;  1TUC A;  2YWW A;  3CCQ A;  2J7I A;  1RAC B;  1LVK A;  2R5A A;  3FC3 A;  1UEC A;  2YUQ A;  1RL2 A;  2IPO B;  3EFS A;  4ZTJ A;  2WAC A;  4FT2 A;  4XTW A;  2WSC E;  4C5I A;  2EYX A;  4OP0 A;  3M0U A;  3H9N A;  8AT1 B;  5CR2 A;  2CP0 A;  2KQW A;  2BZY A;  4JZ3 A;  2LT1 A;  2PU9 B;  4QQG A;  5A0L A;  4M7D G;  2FZG B;  1PSE A;  4N4G A;  2RJD A;  2L3R A;  3H0F A;  2RPN A;  3RES A;  3OYC A;  2OX7 A;  5GAN e;  2XKO C;  1HD3 A;  2ZGW A;  2YUP A;  1X6O A;  2GNC A;  2MWO A;  1MGQ A;  5L8R E;  1VQ4 T;  4OB2 B;  4BDZ A;  3CXC A;  3FEO A;  3RMS A;  2PVG B;  3F70 A;  2K5L A;  1SHF A;  2DVE A;  4C92 F;  3PVL A;  4C0G A;  4HCZ A;  4M78 C;  4C92 D;  4C0Z A;  1G3S A;  2CYZ B;  2OAW A;  4R56 A;  2JUF A;  2HQX A;  2HZY A;  3GIB A;  2HL3 A;  1UEB A;  5CO7 A;  4J9F A;  4DOV A;  5GAN 7;  1MMA A;  3BDL A;  4JPB W;  1S72 T;  2FPF A;  5HKC A;  2PZ1 A;  3HSB A;  1K8A R;  3N5B B;  2W10 A;  3SD4 A;  1TOV A;  1N9S A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 1KC8 U;  4A4G A;  1OYX A;  1QP3 A;  3A8H B;  3M55 A;  4EMH A;  3JCM b;  3I55 T;  1M5Q 1;  3PMI A;  1LOJ A;  3M56 A;  3SWN C;  5GMK l;  4LDY A;  4QQD A;  5GMK h;  1XQH A;  1JJ2 A;  4PLL A;  5GAM g;  4X9C A;  2L5Q A;  4XU0 A;  4M7A G;  2HD0 A;  2RI3 A;  2HQE A;  2RM4 A;  2XIC A;  5LJ3 g;  4Q5W A;  1AHJ B;  4XQ3 A;  2HAX A;  4M7A B;  3UT1 A;  5C6S A;  1VQO T;  1I5L A;  2EQM A;  3L1A A;  3GF5 A;  3CCU A;  3JCM e;  3OYG A;  1VQ9 T;  2K5I A;  4J8O A;  4ZGD B;  4FT4 A;  1Q82 U;  4LDW A;  3LYI A;  1Q81 U;  4PJO E;  5GAN 5;  1LNX A;  3WVD B;  5KCO A;  3G4S A;  4NOY A;  3PFS A;  5IAY A;  3GPL A;  1JBM A;  4HKE A;  4KT0 E;  2P0P A;  5FU6 B;  4RCC A;  2DAQ A;  1VIE A;  3L2R A;  2KSS A;  4J5Y A;  2QQS A;  4ZN1 A;  4OGE A;  4C8Q G;  2LVM A;  2K3X A;  3OW2 S;  1ZHI A;  2BKD N;  2ZPE B;  4IUT A;  5DLQ E;  2QQA A;  3OQ5 A;  5KE2 A;  4NS5 A;  3HFO A;  4C8Q B;  4EPC A;  5GAN 4;  1VQM A;  3GP8 A;  3VUB A;  2EWN A;  2QA4 A;  4A4E A;  2K57 A;  2ZCF B;  1R8O B;  3VUZ A;  1JJ2 S;  1NE8 A;  2YRV A;  2E41 A;  4BY6 B;  1UGP B;  3V7C A;  4CRI A;  2FB7 A;  5J3B A;  1QP2 A;  3OS0 A;  4MDX A;  2E5Q A;  4M7D A;  5CQY A;  3OYF A;  3M54 A;  4PJO C;  1Y96 A;  4OF1 A;  3CCR A;  2WSE E;  3M4G A;  2LC4 A;  3HRT A;  1OI1 A;  2LCC A;  3JCM V;  3MHX A;  3DB3 A;  5J39 A;  4E7J A;  4LDX A;  2LNV A;  4DA4 A;  3GLX A;  4BE1 A;  2GF7 A;  3OY9 A;  3MEV A;  5LL6 S;  1VQ8 A;  3X20 B;  4F7U F;  2RJE A;  3J7A F;  4L59 A;  4C0D B;  4C8Q D;  1M1F A;  1RI0 A;  3OS2 A;  1YJN T;  1KQS A;  3JB9 I;  3FRN A;  3MET A;  5EG2 A;  2EFI A;  5LJ5 g;  3X26 B;  2QXF A;  3QZ5 B;  5GAM j;  3Q1J A;  4M78 F;  3RKX A;  4M75 G;  2RHI A;  1N9R A;  1W2B A;  3SFM A;  1BI1 A;  4O5V A;  4QVC A;  4M75 B;  3TU4 K;  2O4X B;  4J6Y A;  3M53 A;  1NPP A;  3ASK A;  4XTV A;  3OYE A;  3HFN A;  3QSU A;  4V2S A;  3H8Z A;  2JOY A;  3V8L A;  3JCM W;  2DO3 A;  3HRS A;  1YIT A;  5CKD A;  1YHQ A;  1HK9 A;  1QVF S;  3CCJ A;  2RA2 A;  4C0F A;  3I55 A;  1I8F A;  4EMK C;  4C92 G;  3FLG A;  3UPU A;  5GAN f;  3SDZ A;  3CCV A;  2DTI A;  3CCU T;  1K73 C;  4BI4 A;  2E10 A;  4C92 B;  2XHC A;  1UB4 A;  4XK8 E;  2EAY A;  1YJ9 T;  3P8D A;  3G4S T;  1Q7Y C;  3HKS A;  5KH6 A;  5LJ3 d;  3CBM A;  2IVW A;  3JCM d;  3PIO A;  4M75 F;  1VQL A;  2YHT A;  1KQS S;  5GAN 8;  1K73 U;  3HPW A;  3L2Z A;  2KK4 A;  2K2V A;  3L2U A;  3MEA A;  4M75 D;  3M59 A;  2HNI A;  5FRO A;  1W2B S;  2RHY A;  3JCM P;  2E6Z A;  1Q7Y U;  3QZ9 B;  5HK0 A;  1VQ7 A;  1BI0 A;  4Z02 A;  3BDU A;  2QA4 T;  4M77 G;  4II1 A;  2LDM A;  2QQB A;  4RCB A;  2H3J A;  2O01 E;  4M77 B;  2L89 A;  5CVI A;  1X75 C;  4N4I A;  4FIB A;  2E70 A;  4DOW A;  5FU6 C;  3DLL A;  2M1H A;  2EJ9 A;  4JRP A;  1KG1 A;  5KE3 A;  2RI5 A;  2LQ8 A;  5A2Q E;  5CIU A;  3JCM X;  5GAO m;  3CMA A;  3WXM B;  3VU3 C;  3CBP A;  5FU7 B;  2EIF A;  4MZP A;  1K9M C;  2KY9 A;  3UDC A;  2OTL A;  2EQJ A;  2RB6 A;  3VYG A;  5IT9 E;  3PMT A;  4QVZ A;  4IUQ A;  5HK3 A;  1G3W A;  5FRM A;  4VUB A;  1UGQ B;  4PL6 A;  5GAN h;  1WPY A;  2XG8 D;  3FJP A;  2DZ9 A;  3JRZ A;  4TVR A;  5CKH A;  4M7D E;  1K9M U;  2EKO A;  2VUB A;  4BUG A;  3A8L B;  3CCS A;  3ER0 A;  4IUU A;  4RG2 A;  4EMG A;  3PNW C;  2FHD A;  1NJI C;  1WJQ A;  4C5E A;  2XID A;  3EFR A;  3QO3 A;  3O8V A;  4M7A A;  1WJS A;  2GFU A;  5GAO l;  1DJ7 B;  3OS1 A;  2AHJ B;  4N0A A;  5FLX E;  1M1G A;  3CC7 A;  5A0G A;  2JNG A;  2JVV A;  2X4Y A;  2ZPH B;  1N8R C;  2EJF A;  3OA6 A;  2C06 A;  5LJ5 d;  1NJI U;  4L5G A;  1M4Z A;  3CCM A;  4A53 A;  4EDU A;  1U1T A;  1YHQ T;  2DPP B;  1YIT T;  3CCL A;  2MWP A;  2F5K A;  4PJO F;  1I81 A;  3CCE A;  1JRI A;  3CCJ T;  4BI3 A;  3QYG B;  3CCV T;  4WF2 A;  1YI2 T;  1M90 C;  3HRU A;  3LLR A;  4C8Q A;  4IUR A;  3CC4 A;  3JCM Q;  1M1K C;  1VQN A;  3L2Q A;  4M7D C;  1YBY A;  4PKC C;  4JRK A;  1VQL T;  5GAM e;  1BI2 A;  2K3Y A;  4ZN3 A;  3I56 T;  2F69 A;  3C94 A;  5CCA A;  3VKI A;  5GAO p;  3WVE B;  2MI6 A;  4ZGE B;  4NL3 A;  1Y7X A;  5LJ3 e;  2V8K A;  4E7H A;  1M90 U;  2XD0 A;  3OYK A;  4HCB A;  3MEW A;  1UGS B;  4LDU A;  1YJ9 A;  1M1K U;  1P92 A;  3A8G B;  3G6E A;  1VQ7 T;  3JCM f;  2RK1 A;  3KBG A;  2RHU A;  1UGR B;  2CZ1 B;  3BW1 A;  2GFA A;  1X01 A;  3RMQ A;  4C92 C;  4A4K A;  1VQK A;  4MML A;  3J81 E;  1W4S A;  2DIG A;  1H64 1;  1BYM A;  2X4W A;  4F7U G;  5GMK j;  2GQV A;  2E12 A;  3V7S A;  4HA8 A;  4E47 A;  4LDV A;  4F7U B;  1I4K 1;  3LGF A;  2M0O A;  3CMA T;  1QVG A;  1M8V A;  3QXE B;  5I2M A;  4BE2 A;  1YIJ A;  2OTL T;  4RKU E;  4XTZ A;  4M78 G;  3JCM J;  2GCX A;  4OB1 B;  4UC4 A;  1Y07 A;  1XNI A;  4QW2 A;  4M78 B;  3QUI A;  4CI0 C;  2KMT A;  1QW1 A;  1QVF A;  1WNL A;  4YTL A;  2O4X A;  2VGM A;  1B34 B;  1OZ3 A;  1WQW A;  3M58 A;  3MP1 A;  5HY6 A;  1N6A A;  4DQ2 A;  5GAO q;  3EAE A;  3OYA A;  3CCS T;  2XI9 A;  2M9U A;  4E7I A;  1FXX A;  2KVQ G;  3E1S A;  3BY7 A;  2MMP A;  4B9X A;  2Y4Y A;  1FWZ A;  5FU7 C;  3M4Y A;  3CC7 T;  4C92 A;  2VC8 A;  3GNF B;  1VQ5 A;  2CGH A;  3RIR A;  3CCM T;  1G3T A;  3JCM h;  1PSF A;  2XDP A;  4OMF B;  3CCL T;  1U8R A;  1Q86 C;  3OYB A;  1QVG S;  5LJ5 e;  3CCE T;  1FX7 A;  2R58 A;  4MDW A;  3HHT B;  4M7A E;  3OSS C;  4M78 D;  2PQW A;  3T9N A;  4Y91 A;  4X34 A;  2L8D A;  3PIP A;  3JB9 H;  3CC4 T;  2RHX A;  2QDY B;  3LW5 E;  1VQN T;  1BIA A;  3OYL A;  3INZ A;  1Q86 U;  2XK0 A;  2ZPF B;  2OAU A;  4RG8 A;  4MZM A;  3OYY A;  4XU1 A;  4JS4 A;  3CC2 A;  4M77 A;  4XU2 A;  2DTO A;  3KUF A;  1YI2 A;  3SWN B;  5GAM d;  3X25 B;  1YCY A;  4RMO A;  2E64 A;  2RH2 A;  3G71 T;  3G6E T;  1KD1 C;  4C8Q E;  3I56 A;  3LH0 A;  2ZPG B;  4JLG A;  3MO8 A;  4BI8 B;  5I2S A;  3CEY A;  1WJR A;  5GAN g;  3CBO A;  3OYJ A;  1VQK T;  3RKW A;  3LGL A;  3DLM A;  4M7A C;  1BIB A;  2NLU A;  3OBY A;  2KAF A;  1KD1 U;  4JLI A;  4N0A C;  5CKB A;  3S3M A;  2FVU A;  2QQR A;  3MEU A;  3QPH A;  4ME7 A;  1VQP A;  3OYH A;  1SSF A;  2Y90 A;  4A4F A;  5FRN A;  4XAX B;  3LWH A;  3PTA A;  1YIJ T;  1BI3 A;  3E19 A;  4M7D F;  3JSC A;  2E6N A;  2DXC A;  2R5M A;  3FIF A;  3OYI A;  2RHZ A;  3ZFJ A;  4XTU A;  4KUL A;  2YLC A;  2RI2 A;  3FDR A;  4MZT A;  3VJP A;  4C8Q C;  1NPR A;  5LJ5 h;  5GAO r;  1XOV A;  3SB2 A;  3PT9 A;  1KQ1 A;  3KXT A;  2E65 A;  2E1H A;  4ELZ C;  3CME A;  4PJO G;  3OMG A;  2DXB A;  1GXI E;  4BY6 C;  3LWI A;  3TCJ A;  2G3R A;  2JTF A;  3ME9 A;  4PJO B;  5GAN 6;  5M9O A;  4J6X A;  4FU6 A;  5J26 A;  4J6W A;  3DB4 A;  4GLK A;  2DIQ A;  5DY9 A;  3AHU A;  2X35 A;  4J83 A;  1YJW T;  3OYM A;  1VQ5 T;  4IUP A;  5GAN 3;  3BFM A;  1IRE B;  4JDS A;  2VGN A;  1G5V A;  3QHS A;  2PUK B;  4LD9 K;  1VQ6 A;  4KUI A;  2CS7 A;  1ZBX A;  4HCC A;  4ZGJ B;  2DKG A;  2EQU A;  4J7I A;  2KDS A;  2DXT A;  4C0D C;  5A0D A;  2CZ7 B;  4C92 E;  3OB9 A;  5GAN 2;  4E7K A;  4X9D A;  3ZBD A;  2LX9 A;  2DZC A;  3NTI A;  3CC2 T;  4JRI A;  4BAC A;  5CKF A;  1N8R U;  4KBM B;  4PJO D;  1KHI A;  2YLB A;  4E7L A;  5GAN j;  2JN0 A;  2MAM A;  2B8A A;  4OVA A;  4XTX A;  3R6O A;  1BKB A;  1O9S A;  3L2V A;  2JZ2 A;  2X4J A;  4M75 C;  4F7U A;  2P4T A;  3JB9 F;  1EIF A;  2DD4 A;  3QJ6 A;  2FYK A;  5IN1 A;  3TEE A;  3V8K A;  4A54 A;  3GOX A;  5GMK i;  3JB9 J;  3E9G A;  4GY5 A;  4EMK B;  5GAM f;  2PVD B;  4XU3 A;  2QEX A;  4M77 E;  1KHC A;  3G71 A;  2PVO B;  5LJ3 f;  2I2L A;  3OYD A;  4M78 A;  4D6W A;  4JRQ A;  3QYH B;  1B34 A;  2RJF A;  2CKK A;  2VXF A;  5GAN d;  3JAM E;  1VQP T;  3A8O B;  4J7F A;  2A7Y A;  3PGG A;  4OB3 B;  4ZTF A;  3M57 A;  1Q81 C;  1Q82 C;  1M9S A;  2LCL A;  3QBY A;  2IG0 A;  3JCM g;  3QJY A;  1WQ7 A;  1D3B B;  3QII A;  4PLI A;  5CK9 A;  4BDY A;  2CZ0 B;  4B9W A;  1K8A C;  4IUV A;  1N27 A;  3NTH A;  3OBW A;  4KUD K;  4FM4 B;  3S6W A;  5D6W A;  3OS5 A;  4PNO A;  2LTO A;  3CME T;  3QKJ A;  1VQ4 A;  3S3N A;  1H3Z A;  4BE0 A;  2WSF E;  4M77 C;  2D9T A;  4M75 A;  2RO0 A;  1K8A U;  2RD1 A;  3CPW A;  2P0Q A;  3A8M B;  3CCQ A;  4Y28 E;  4M7A F;  3HL8 A;  2EQK A;  2DXU A;  5D6X A;  1VQ6 T;  2RK2 A;  2FL7 A;  2R5A A;  3L2W A;  1JB0 E;  3SWN A;  5GAM h;  1ZQ1 A;  3FC3 A;  4M7A D;  1RL2 A;  1YJW A;  2EJG A;  3OSV A;  3OYN A;  3EFS A;  2JTM A;  5LJ3 h;  3HP9 A;  4ZTJ A;  2WAC A;  4FT2 A;  2BUD A;  5I21 A;  4XTW A;  3NTK A;  5CKE A;  1KQ2 A;  3S3O A;  2EYQ A;  2XU8 A;  3QDR B;  1TH7 A;  1U1S A;  1VUB A;  2WSC E;  3NFC A;  4C5I A;  4JUV A;  2OTJ T;  4OP0 A;  4C8Q F;  4JJN K;  4C5G A;  5LJ5 f;  4MMK A;  3L42 A;  3CD6 A;  5CR2 A;  5KCH A;  2R57 A;  4ATO A;  3A5Z B;  3CPW S;  1XTD A;  5CQX A;  4JS5 A;  2KQW A;  3GNG A;  3QG1 A;  2F5T X;  3VYH B;  2QEX T;  1S72 A;  2LT1 A;  2PU9 B;  4QQG A;  5A0L A;  4M7D G;  2VYT A;  3MCA B;  1IZ6 A;  1PSE A;  2MF2 A;  4N4G A;  4M7D B;  1Y96 B;  2RJD A;  4C5H A;  4BB7 A;  5LJ3 j;  2L3R A;  4F7U E;  3RES A;  2K4Y A;  3OYC A;  3G7Z A;  3E9F A;  5GAN e;  3DKM A;  2DTH A;  2XKO C;  4QVD A;  1NZ9 A;  4N4H A;  5DLO A;  3V7R A;  2Y4X A;  2ZGW A;  4PJO A;  5D6Y A;  2CZ6 B;  1X6O A;  4M78 E;  3URG A;  1OZ2 A;  2QQ9 A;  4HT9 A;  2QTX A;  2ZPI B;  2MWO A;  1MGQ A;  2ZPB B;  3VV0 A;  3LX7 A;  2BIV A;  5L8R E;  1VQ4 T;  2HBP A;  2D0Q B;  3CPF A;  1O75 A;  1VQO A;  4OB2 B;  3UWN A;  2PUO B;  4M7D D;  4BDZ A;  1VQ9 A;  3CXC A;  3MP8 A;  5CAI A;  3FEO A;  3TRE A;  3CCQ T;  1VQM T;  2DEQ A;  4QQ6 A;  5GMK e;  3RMS A;  3RKY A;  5DM7 R;  4HT8 A;  2PVG B;  2ZZD A;  3F70 A;  3P8H A;  4ELY C;  2DD5 A;  2K5L A;  1WGS A;  2DVE A;  1HXD A;  4C92 F;  3FB9 A;  4OGC A;  4M75 E;  2LT4 A;  4C0G A;  4HCZ A;  4M78 C;  3C95 A;  5AYF A;  2QI2 A;  4C92 D;  4IKF A;  2RJC A;  3JB9 G;  4C0Z A;  3CCR T;  3ZEH A;  5GAO n;  1Y71 A;  1G3S A;  2VXE A;  2CYZ B;  4L6V 5;  4R56 A;  1VIF A;  4EMK A;  2JUF A;  2LRQ A;  2DJZ A;  3RUX A;  2A3L A;  2LQK A;  3P8B B;  2HQX A;  4BD3 A;  1LJO A;  3CD6 T;  2XDD A;  4NL2 A;  1VQ8 T;  1G3Y A;  3RER A;  2P0K A;  3M5A A;  2V8I A;  3M9Q A;  4FL6 A;  3X28 B;  5C0M A;  4M77 F;  4A4H A;  5LJ5 j;  3CXC S;  2D6F A;  3GIB A;  3C12 A;  1QVP A;  3V8J A;  1UEB A;  5CO7 A;  2OTJ A;  4DOV A;  5GAN 7;  4FSX A;  3BDL A;  5GMK m;  4P5N A;  1S72 T;  1MHN A;  4M77 D;  3OMC A;  5HKC A;  4R55 A;  1V29 B;  3HSB A;  2XDB A;  2V8J A;  4OB0 B;  1D3B A;  3JCM c;  4LD6 A;  1KC8 C;  3H6Z A;  3J80 E;  3X24 B;  3C4S A;  3N5B B;  2K5F A;  2DK3 A;  1YJN A;  3SD4 A;  2X4X A;  4XTY A;  1N9S A;  3JB9 D;  3MP6 A;  3OW2 A;  2VV5 A;  4O6J A;  2M16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...