2SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SEX MUSCLE ABNORMAL PROTEIN 5)
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2semA00
1X6BA 3UA7A 2A08A 2KR3A 2V1QA 1UECA 1TUDA 2O2OA 2OJ2A 4M4ZA 2CSQA 4F14A 2V1RA 2J7IA 2DX1A 1QWEA 2F2XA 2OAWA 1JU5C 1UDLA 1CKAA 2RN8A 2KXCA 2HBWA 2KT8A 1X6GA 1UUEA 3M0RA 1MV3A 2D8HA 4HXJA 3REAB 3QWXX 4AG1C 5FW9A 1V1CA 1SEMA 2YUOA 3CQTA 4OMMA 1AEYA 2L3QA 2AZSA 3R6NA 1AOJA 2HCKA 4A63B 2LMJA 1Z9QA 1U3OA 5I11A 3JV3A 1ZX6A 5HCKA 3PVLA 2C0OA 4JZ4A 4RTVA 4J9EA 1Y0MA 2BZXA 4RUGA 1GFDA 1I0CA 5FWBA 1ABQA 2KXDA 3GBQA 1GBRA 1SSHA 4IIOA 2KNBB 2KRSA 3VRZA 1SPKA 1TG0A 2ED1A 2DMOA 2DL3A 2ECZA 1WXUA 2EW3A 2JM9A 2DBMA 3QWYA 4AFSC 2RQUA 5IHKA 2HEQA 3VS6A 4HCKA 1HJDA 1JEGA 1BB9A 1WI7A 1PKTA 2ED0A 2LQNA 1M3BA 1OPKA 4HVUA 1VYUA 1KFZA 1E6HA 1K0XA 2HDAA 4OMPA 3THKA 2K6DA 3PE0A 1M30A 2GGRA 3EGUA 1AWJA 2FRWA 3ZL7C 2CDTA 3VS3A 2JMCA 4RTUA 2JXBA 2L3PA 4F17A 1AWOA 2F2VA 2RNAA 1YWPA 2RMOA 2A37A 4K11A 4OMNA 3VS2A 2GTOA 1EFNA 1BU1A 2YUPA 1QCFA 2B86A 4E6RA 1GFCA 1WLPB 1X69A 2LX7A 2CUBA 2GBQA 1OEBA 2CUDA 3EHRA 1X2QA 1UGVA 2O9VA 1UE9A 1I1JA 3I9QA 1H92A 2JMAA 1AWXA 2PZ1A 1JO8A 2IIMA 2RF0A 1GCQA 2BZ8A 2CSIA 1Y57A 3VS1A 2EGEA 1M3AA 1OPLA 3VS5A 2PNIA 2F2WA 2FO0A 1CSKA 2CT4A 1KJWA 2DL4A 3ULRB 1PRMC 2DRMA 2RQTA 2FRYA 1M8MA 1U5SA 4OMLA 2YDLA 3C0CA 3EG2A 4HVWA 4JJBA 1AVZC 2E5KA 3NHNA 2KT1A 2KRMA 1GRIA 3I5SA 2GNCA 1NYFA 3M0TA 2AK5A 2DYBA 2RPNA 1VA7A 2HSPA 3H0HA 2K9GA 1UFFA 1T3SA 1VYVA 2O88A 1FYNA 5GJVB 2DRKA 4J9CA 2ESWA 1K4US 2CREA 2J6KA 1A0NB 1NLPC 2NWMA 1JXOA 2JTEA 2D8JA 4RTZA 1G83A 2P4RA 4RTYA 2KRNA 1BBZA 1RLQC 3A98A 4Z8AA 1YP5A 2DILA 1XOVA 2EBPA 1KIKA 2M51A 3EG3A 1YN8A 2JM8A 1PRLC 3H0IA 5EC7A 2OI3A 1ZSGA 1W6XA 1ZUYA 1W1FA 1AZGB 2ABLA 2D0NA 2RQWA 3FJ5A 1T0HA 2H8HA 3I5RA 3VRYA 4LE9A 2EYXA 1T0JA 2DL8A 4RTXA 2EPDA 2K2MA 2YUNA 3EHQA 1GBQA 1UJYA 2X3XD 2C0TA 5IHNA 1NYGA 2A36A 4JJCA 1M27C 4AFQC 1I07A 2DM1A 1NEGA 3LH5A 1NM7A 3VS4A 2KROA 1MUZA 1M3CA 2J6OA 3M0SA 2ROLA 2PTKA 1PHTA 1SHGA 1WIEA 2SRCA 2CT3A 1X2KA 3TSZA 2FPFA 4QT7A 2QDLA 1X27A 3KFVA 1UHCA 2DE0X 4J9BA 2DA9A 2DBKA 5L23A 1SRLA 4HVVA 2FG0A 1JXMA 2NUZA 2BZYA 3UF4A 3H0FA 1S1NA 2EGCA 4RTTA 1YNZA 3NMZC 4AFZC 4CC7A 1NG2A 2J05A 2MCNA 1UJ0A 5GJWB 2LJ0A 2EGAA 1NLOC 1QWFA 4J9HA 4J9FA 2KYBA 3M0PA 1PWTA 2DL5A 3RBBB 4KRTA 4ZNXA 1IO6A 2BTTA 2RQVA 1BK2A 1Z9ZA 4FSSA 1GCQC 4OMOA 2EQIA 3VS0A 3M0QA 2KGTA 4CC2A 3UATA 2C0IA 3NPFA 2I0NA 1SRMA 1FMKA 2EKHA 1G2BA 2ENMA 1NEBA 2FEIA 4Z88A 2CH4W 1K0SA 2LP5A 2SEMA 3O5ZA 4CC3A 1B07A 2W0ZA 3UA6A 1X43A 2J06A 4LNPA 2LQWA 2L0AA 1OV3A 2VVKA 2AKKA 2JS2A 2J6FA 1VYTA 2KE9A 1K9AA 1QKWA 4D8KA 1H3HA 2O9SA 1ZLMA 4RTWA 1LCKA 4R0KA 2YT6A 2DLPA 2O31A 1E7OA 4J9IA 1AZEA 2DL7A 1QLYA 1GCPA 4AFUC 5IHIA 1GL5A 1E6GA 1K1ZA 2JT4A 1KSWA 3EG1A 1B3QA 1UTIA 1JQQA 4DEYA 2AKLA 3IQLA 1YWOA 1AD5A 4JZ3A 1ZUKA 3TVTA 2A28A 2EYYA 2EVRA 3TSWA 2W10A 1OOTA 3REBB 1YCSB 3H41A 1RLPC 2DVJA 2M0YA 4ORZA 4GBQA 2YUQA 1ZBJA 3NGPA 3RNJA 2G6FX 4AG2C 2YSQA 1SHFA 4D8DA 1U06A 1CKBA 2EYZA 4J9GA 4JJDA 2DF6A 2LZ6B 1T3LA 5IH2A 1K76A 4CC4B 2DNUA 2MIOA 4J9DA 3U23A 2FPDA 4WCIA 1ABOA 1WA7A 2AZVA 2VKNA 3SHWA 2K7AA 1PNJA 2L3SA 2XMFA 4GLMA 1ARKA 4JPBW 2LJ1A 2EYWA 2RQRA 2MOXA 1TUCA 1H8KA 3PVQA 2GQIA 1UHFA 4LUDA 2CH4A 4ESRA 2JW4A 4IIMA 3SEMA 1WXTA 3I35A 3VS7A 5IXFA 1WXBA 1W70A 2X3WD 1ZUUA 1WFWA 4DEXA 1RUWA 2K79A 2KEAA 1N5ZA 1HSQA 2LCSA 4OMQA 2K3BA 4LUEA 4EIKA 2D1XA 2ROTA 1RI9A 4X1VA 5IXBA 2FPEA 2JS0A 2LNHB 4LN2A 1MV0B 2L2PA 2DJQA 2KBTA 2GTJA 1J3TA 1WDXA 3EG0A 3M0UA 5I22A 2VWFA 2LJ3A 4F16A 1PKSA 4Z89A 1HD3A 1WYXA 4Y92A 1WX6A 5FWCA 1UG1A 1QKXA 5ECAA 2KYMA 1AWWA
chains in the Genus database with same CATH superfamily
1X6BA 3CCST 2KR3A 3QIIA 5D7UA 2XI9A 4M4ZA 2HL5C 2J7IA 2DX1A 1QWEA 3H9NA 4II1A 3URGA 2KXCA 2KT8A 1X6GA 3GIBA 1Q95G 2QTXA 2V8KA 1MV3A 2AHJB 4XTYA 2JOYA 4AG1C 4KBMB 1VQ9A 1D09B 5FW9A 2YUOA 4BI3A 2JNGA 3SWNC 5J3BA 2C06A 4IUPA 1UEBA 3I55T 2AZSA 1Q86R 2JTMA 2YLBA 3MP6A 3MEWA 4M78E 4C8QE 3CMEA 2B8AA 4A63B 2LMJA 2JTFA 1ZX6A 3CMAT 1YI2T 2C0OA 1FMWA 1Y0MA 2NUPB 1GFDA 4FT2A 5FWBA 3GBQA 5HKCA 4IUQA 2KRSA 3ASKA 3ZEHA 3VRZA 3LYIA 1SPKA 2DMOA 2M16A 2EW3A 5FU7B 2DBMA 3QWYA 3CMEQ 2WSFE 4FM4B 4HCKA 2XDDA 5GANg 1JEGA 3JCMJ 4M7AA 2K6DA 1M30A 2GGRA 3EGUA 1AWJA 1YJ9A 3CC4A 2EJGA 3L2VA 5CK9A 2L3PA 2L8DA 5DY9A 2COZA 2F2VA 2O01E 2RNAA 1JJ2P 2GTOA 1EFNA 1BU1A 2DTHA 1M2OA 5FU7C 4E6RA 1X69A 2LX7A 1QVPA 3CC4Q 1YJ9Q 3DB4A 4J7IA 3AT1B 2X9HA 3G4SA 5GAOr 3OYJA 1UE9A 3EG9B 3CCJA 4M7AF 2JMAA 5FLXE 1I81A 3ER0A 3M4GA 2IIMA 3MKDA 1KHCA 2Y4YA 2E1HA 1TUGB 1Y57A 4A4KA 1SKUB 2GQVA 3BDUA 2F2WA 1CSKA 2CT4A 2RQTA 2DRMA 4F7UE 6AT1B 3JCMX 2A0FB 3G4SQ 1FX7A 1M8MA 3HRSA 3RMQA 3CCJQ 4DBRA 2E4HA 2CS7A 2WACA 4HVWA 4JJBA 4EPCA 1AVZC 2RHIA 2E5KA 3NHNA 2KRMA 2CP6A 4M78G 2GNCA 1YHQQ 2DYBA 4C8QG 4PNOA 2EQMA 4JDSA 4ZGJB 1WJRA 4JRPA 2CZ1B 3H0HA 1UFFA 1T3SA 4M75D 4A4GA 3QJYA 4DA4A 2DXUA 1VYVA 4Q5WA 2LT4A 3JSCA 2ESWA 4X9DA 5D6WA 4PJJA 1K4US 3BW1A 3META 3CBPA 4JS5A 1YBYA 1NLPC 5A0GA 1IXDA 1B34A 1JXOA 4RTZA 4RTYA 2KRNA 4Z8AA 2LC4A 4R55A 2DILA 1XOVA 2JN0A 5GAN5 4WTOB 1YN8A 5LJ5j 2QYZA 4MZPA 3H0IA 5KYUA 3CCLA 1W6XA 1KQSA 3OY9A 4E7SA 1D3BA 2D0NA 5LJ3g 3M54A 1VQOT 2VUBA 1M1KC 4KGZB 3QZ9B 1ZSZB 3QDFA 3VRYA 1IREB 4C92A 3BFMA 2EYXA 4XTZA 2DD5A 3EFOB 4BD3A 3V8JA 1BI0A 3C4SA 2C0TA 5IHNA 2K3YA 3CCLQ 1U8RA 2AIRB 2EQUA 2DEUA 1VQNQ 4KGVB 3LH0A 4ZGEB 1WQWA 4F7UG 4A53A 4M7AC 2M0OA 1VQ7T 4LDVA 4NL2A 1X01A 1RAEB 5HK3A 4J5YA 4C92F 1K73U 1WJSA 3A1PA 4XTXA 3TSZA 4QT7A 3KFVA 3MEAA 1IRXA 1BIAA 3I56T 2HMAA 2QQRA 5LJ5h 4F7UA 4PJMA 3M53A 3F70A 2NUZA 4FIBA 3JB9I 1G3YA 5C6SA 2ZPHB 2MCNA 1K8AR 1NLOC 1WJQA 2F69A 3LWIA 2KYBA 4NL3A 5CAIA 3JB9G 2DETA 1VQ6Q 4J8OA 2VXEA 3QKJA 2D6FA 4EMKA 4ZN1A 1VIFA 3RIRA 4XTWA 4N4HA 2EQIA 4IKFA 2EKHA 4M78B 4B9WA 4C5HA 4F7UF 5AYFA 4Z88A 1RAFB 2FEIA 2XIDA 4C8QB 2HKQB 4F04B 4E7KA 1LNXA 3QG1A 2W0ZA 3BY7A 1X43A 2J06A 4LNPA 4PKCC 2AKKA 2JS2A 5GAN7 2J6FA 3G6ET 5IN1A 2KE9A 1K9AA 4JLGA 2RHZA 4LDYA 5KYXA 4JRKA 4M78C 2DL7A 3I56A 2O4XA 1M90C 4C8QC 2QQAA 1C0MA 4M78D 4AFUC 3JB9F 5IHIA 2DFUA 1GL5A 2CZ6B 2DZ9A 4RMOA 5KCHA 4C8QD 3OW2A 3EH2A 1N8RU 1JRIA 2E6ZA 4LD6A 3EG1A 2AKLA 1IGUA 1ZUKA 3H6ZA 4B9XA 4MMKA 3UDCA 1QVFP 2EYYA 2E65A 2E6NA 4E7IA 1MMDA 1TH7A 3MO8A 2M0YA 4ORZA 4ZN3A 1LPLA 3SD4A 2X4JA 1QCNA 3OS5A 3V7RA 2YSQA 2RO0A 2EYZA 4JJDA 2K5FA 4EDUA 2LZ6B 1VQ5T 2DNUA 2AT1B 2AZVA 2VKNA 3RUXA 1Y71A 4A4FA 3SHWA 3HFNA 1PCXA 3G6EA 3JB9H 4F7UB 2FL7A 1PC0A 2LQKA 3HFOA 2RQRA 1U1TA 2MOXA 3RESA 1PSFA 4C0DB 2BE7D 1H8KA 1MNEA 4FW2A 3FLGA 2FVUA 4ESRA 1I8FA 1K9MC 2HL3A 1WXBA 3GP8A 2OTJT 3G6EQ 3CXCS 4OB2B 4DEXA 3L2ZA 2K79A 1N5ZA 4M77G 5GMKi 3J81E 4HCBA 2ROTA 2FPEA 2JS0A 2CP2A 4C0DC 3JCMh 1JBMA 1IHVA 5GAN3 1J3TA 3Q1JA 1WDXA 2DO3A 4M77A 2QGGA 1NZ9A 3RDVA 3EG0A 1KD1C 2VWFA 4PJOA 2QAZA 2JZ2A 4VUBA 2FZGB 1VQPA 3E1SA 4OGCA 2ZZDA 1WYXA 1WX6A 1VQKT 2OTLA 3HL8A 3GNGA 1UG1A 1QKXA 2KYMA 3GLXA 4D6WA 1X75C 5KYXB 1Q7YR 3N5BB 2X51A 3L2QA 2O4XB 4XU1A 2PVDB 1XNIA 2OJ2A 1TWBA 2CSQA 4J6YA 2V1RA 2OAWA 1VQPQ 1UDLA 5CIUA 2RN8A 4Z02A 2OTLQ 1Q7YU 2HBWA 3AHUA 2A3LA 4KH0B 2V26A 4KUIA 1UUEA 4M77F 2D8HA 2FZCB 4PJOF 5GMKl 1PD1A 2XHCA 1SEMA 1QCOA 3FIFA 2JJ9A 3CQTA 2OTJA 1AEYA 3MP8A 2IVWA 2MWOA 3C12A 5KH6A 2LNVA 3DLLA 1G8XA 1SG5A 3JCMf 1M4ZA 3M56A 5GAOn 2HCKA 5GAOq 2YHTA 1OI1A 1NJIR 4AT1B 1WHMA 1Z9QA 1U3OA 5I11A 3PVLA 4JZ4A 4RTVA 4J9EA 4RUGA 2E41A 1I0CA 1ABQA 5GAMd 2KNBB 1RAAB 4CRIA 4QQDA 3OSVA 4L59A 2MWPA 5KYYB 4AFSC 3EGDA 3OYDA 1DJ7B 2RA2A 5IHKA 3VS6A 1BB9A 2ZPGB 1TSFA 5CR2A 4HVUA 1UGRB 1K0XA 2LX9A 2HDAA 3PE0A 3OYCA 2QTVA 1MMAA 3ZL7C 2CDTA 2JMCA 2RHUA 3BDLA 4RTUA 2JXBA 4F17A 2NYSA 4OMNA 2A37A 5CCAA 4JS4A 4QQ6A 3KXTA 4M7AE 3HRUA 1D0ZA 3OW2P 1BI3A 7AT1B 1GFCA 4BB7A 1OEBA 2PVGB 1M1KR 2RI3A 2QDYB 3INZA 2ZPFB 3I9QA 2M02A 1H92A 3CMET 5FRNA 4DBFA 4MDWA 3J7AF 4FYYB 4DOWA 1GCQA 1M1KU 3VS1A 1M3AA 1OPLA 2E64A 2PNIA 2FO0A 1QVGP 3OYEA 1KJWA 2DL4A 2FRYA 2CP3A 2CKKA 4A4EA 1U5SA 4LXCA 5LJ5g 4ZTFA 2YRCA 1G3TA 2K2VA 2KT1A 3I5SA 1GRIA 4M77C 2V8IA 4QVCA 4KT0E 3CC4T 2AK5A 5KYWA 1YJ9T 3OYIA 3VJPA 3JCMQ 3HHTB 2RPNA 4M75A 2RK1A 3ZFJA 1WGSA 2QXFA 5IAYA 1RABB 3X25B 1H641 2K5IA 2PUKB 3QO3A 3QSUA 1A0NB 2MK5A 4FW1A 4X9CA 3JCMe 4JUVA 2NWMA 3VYGA 3M5AA 1TU0B 4GY5A 3FEOA 2P4RA 3A8LB 4OB1B 3G4ST 1LOJA 1RLQC 1FWZA 2KSSA 5L8RE 2YWWA 2F1LA 3CCJT 1BI2A 2M51A 4J6XA 3TEEA 4JRQA 1V76A 4M75F 1YHQT 1VQMA 1NPRA 3LLRA 4KH1B 5EC7A 3EGDB 2HSEB 4M7AG 2RQWA 2FYKA 3FJ5A 3PMTA 1T0HA 2QA4T 4OP0A 3I5RA 1Y96A 4L5GA 2MPXC 1IHWA 2P84A 1OQKA 2DL8A 4RTXA 2K2MA 1OX9A 2RJDA 1I4K1 2YUNA 2ATCB 3LGFA 2LT1A 1VQMQ 3EHQA 2X3XD 1UJYA 5I2SA 3WVDB 4JJCA 4DBHA 4AFQC 2DM1A 3LH5A 2EQJA 4C92E 1NM7A 1KQ1A 1WNLA 1M3CA 1R8OB 4PL6A 1P92A 4IUVA 3X28B 3CPWP 1UGPB 2ROLA 4N4IA 1PHTA 1SHGA 2XKOC 2VGMA 2DYIA 2CT3A 1X2KA 3CXCA 1Q82C 1M90U 3CD6T 2DXCA 1QP2A 2DE0X 2LCCA 2RD1A 2DBKA 2EFIA 1PG5B 3V7SA 1S1NA 2EGCA 1YNZA 2QQSA 2J05A 1YHQA 3QDRB 2EQKA 3CCLT 1UJ0A 3A5ZB 2HNIA 2LJ0A 3HTRA 2EGAA 2X4XA 4J9FA 3V8KA 1VQNT 2E5QA 3M0PA 2QA4A 4ZNXA 1IO6A 1PM3A 2DERA 4RKUE 2L5QA 1GCQC 1EZZB 3UATA 4KGXB 1G2BA 2ENMA 4L6V5 2LVMA 2RI5A 2QA4Q 3O5ZA 2R5AA 4OMFB 3A8GB 2QEXT 2MYSA 1VQLA 2QQBA 3JCMg 2VXFA 1QKWA 3OBWA 2O9SA 3QYGB 1ZLMA 2DIGA 2YLCA 1K9MU 2O31A 3CD6A 4ATOA 2K3XA 1VQ6T 3DB3A 3A8MB 1WHKA 3OYNA 1OX8A 2PQWA 4C92G 1VQLQ 3WXMB 1JQQA 1W4SA 1YJNQ 3TVTA 1G5VA 4B6MA 1M2VA 1KG1A 3CD6Q 4FT4A 3VUZA 2KQWA 1JJ2S 2LRQA 2E70A 2EVRA 4M7AB 1VQNA 2W10A 3JAME 3CCUQ 4LD9K 2KDSA 1UGSB 2DZCA 1RLPC 1KD1U 2YUQA 3M9QA 5LL6S 1ZBJA 1SHFA 2VB6A 1YIJT 2FB7A 1D1AA 2EAYA 1R0BG 3OMCA 4E7JA 4FCYA 1K73R 2RM4A 4J9DA 2QEXA 3OYLA 2E12A 2XMFA 4FYWB 5KYNA 1XJWB 3RR6A 4M7AD 3L2UA 2LJ1A 1VQ8A 2XG8D 1RACB 4FU6A 1KC8C 1VQ6A 3PVQA 2M9UA 5GAOp 4LUDA 2QEXQ 4IIMA 3SEMA 5IXFA 3RKXA 2DXBA 3EGXA 1RUWA 1VQ8Q 3MEUA 4OMQA 1UB4A 1MMGA 2K3BA 4LUEA 4Y91A 2D1XA 1R77A 5GAN2 3CC7A 5HK0A 5IXBA 4LN2A 1MV0B 2L2PA 2DJQA 3CEYA 4XU2A 2GTJA 4WF2A 1YIJA 1PKSA 2JUFA 1Y07A 2LTOA 1Q86C 2IG0A 4Y92A 1ZA1B 1B34B 1IGQA 1OYXA 4O6JA 5KE3A 3CCQA 3CC7Q 3QPHA 1AWWA 4M77E 3UA7A 2K4YA 2A08A 2X4YA 2X35A 4ANJA 1OU8A 3QJ6A 4PJOE 3CCRT 1TUDA 4MMLA 1YIJQ 1N8RR 2IPOB 2F2XA 4PK4A 1QQJA 1LJOA 1CKAA 2EWNA 5KYUB 3OYGA 3CCQQ 2FZKB 1D3BB 1MGQA 2L89A 5CVIA 4HXJA 3REAB 3QUIA 4C92B 3OYYA 3EFRA 3VUBA 1YITA 5FRMA 4OGEA 1WHJA 2PUOB 2KMTA 2L3QA 4C0ZA 1X6OA 3R6NA 4QQGA 2P0KA 1AOJA 1C1AA 1MHNA 1WZOA 3L1AA 1VIEA 2LQ8A 3UT1A 4PFZA 1HXDA 1V29B 2KXDA 4C5EA 1GBRA 1SSHA 1YITQ 4IIOA 4GLKA 3ZBDA 5GANd 3HP9A 4C92C 1VQPT 1TG0A 3VU3C 2DL3A 1N6AA 2ECZA 2OTLT 1WXUA 2JM9A 3OB9A 3OYAA 2EIFA 4C92D 4E7LA 3OS1A 2RQUA 2RH2A 4M7DA 1HJDA 3PTAA 2RJCA 4RG8A 1WI7A 2LQNA 1M3BA 1ZQ1A 1KFZA 4OMPA 3OS2A 2FRWA 4BI8B 4Y28E 3CCRA 1N9RA 5A0LA 1N9SA 5GAOl 2QQ9A 4BI4A 2KI7A 3CCVT 4AMCA 1YWPA 2RMOA 4K11A 2DK3A 4HT9A 2YUPA 4LDWA 4IUUA 1FXXA 3UPUA 2B86A 1WLPB 4EMKB 1KQSP 3CCRQ 1M1FA 5GANf 2CUDA 1YJWA 4M7DF 2XD0A 4BE1A 4PJOG 1O75A 1KK7A 5GMKm 3G1JA 2PZ1A 1JO8A 3C95A 2HD0A 3OMGA 4PJNA 2CSIA 3CCET 2EGEA 3HPWA 3VS5A 3G7ZA 4JLIA 1TXQA 4BACA 3ULRB 1VOMA 1YJWQ 4C5GA 3PFSA 3OYBA 4EMKC 4OMLA 3C0CA 4ZTJA 2DTOA 1FMVA 4XTVA 4FL6A 3M0TA 1SSFA 1QVFS 2EJFA 2K9GA 3JB9D 2YXYA 2Y90A 3CCVA 2DRKA 1I5OB 1VUBA 1Q82U 2CREA 3CBMA 5DLOA 1VQ4A 3FJPA 4M75E 1ZA2B 2QI2A 4QVZA 2P4TA 3SWNA 1BBZA 3A98A 4RCCA 4HA8A 2ZGWA 3MJXA 5GAMh 1JJ2A 1KIKA 3CCVQ 2LCLA 4C5IA 5LJ3d 3DKMA 8AT1B 2DXTA 5A2QE 4NS5A 1WHLA 1VQ4Q 1ZSGA 1ACMB 2L3RA 3X20B 3CCEA 1ZUYA 1AZGB 2EJ9A 2ZAEA 2M1HA 1NPPA 2GF7A 4LE9A 2G3RA 2EPDA 2BUDA 2XDBA 1GBQA 1M1GA 3CCEQ 1OULA 1I07A 1K8AC 1NEGA 5IT9E 5GMKe 2KROA 1MUZA 2NUPA 3NFCA 2J6OA 4NOYA 4A54A 4OVAA 5LJ3f 3OQ5A 2PTKA 2CGHA 1WIEA 5GANe 1EIFA 4KULA 2SRCA 5GAMf 4E7ZA 5CKEA 1PD0A 2FPFA 2R5MA 2QDLA 2V8JA 2BE9B 3L42A 2WSCE 3P8DA 2VYTA 4J9BA 2ZPBB 5L23A 4E7HA 4FSXA 4M77B 4HVVA 2FG0A 5CKHA 2ZPIB 4PJOB 1VQMT 4AFZC 2RI2A 4R56A 4CC7A 4JJNK 1NG2A 1RI0A 1S72A 3V8LA 4ELYC 3SDZA 1XQHA 1GXIE 2MMPA 4PJLA 4M75G 1PWTA 2RJFA 4V2SA 3RBBB 2BTTA 1ZHIA 2RQVA 1IB8A 1QW1A 4OMOA 3EG9A 3VS0A 3M58A 3M0QA 4CC2A 1S72Q 3NPFA 5M9OA 4PJOC 4M77D 1Q81C 1NEBA 2CH4W 2EYQA 2LP5A 3M4YA 2DVEA 2QGFB 2L0AA 3CC2T 4O5VA 1VYTA 4D8KA 1H3HA 1KC8U 1WPYA 3H8ZA 4RTWA 1LCKA 1XTDA 2YT6A 4J9IA 3VYHB 5CKDA 1AZEA 3L2RA 1W2BS 3GNFB 1M8VA 4FYVB 3T9NA 1E6GA 2KVQG 4XU3A 1K1ZA 2JT4A 1KSWA 1B3QA 4FYXB 4DEYA 3RKYA 3IQLA 1YWOA 1AD5A 4JZ3A 3QZ5B 2XDPA 2DD4A 3MHXA 5DLQE 1OOTA 4HCCA 2ZCFB 1YCSB 3H41A 3OW2S 2DVJA 1BKBA 4GBQA 2HKNA 1VQ9Q 1Q86U 1M5Q1 3RNJA 2G6FX 4AG2C 4HKEA 4D8DA 1U06A 1CKBA 5CKFA 2DJZA 5LJ3e 5J39A 1T3LA 5IH2A 2H3EB 1K76A 1M90R 3LX7A 2MIOA 3U23A 2FPDA 1ABOA 1VQLT 5GAMe 2K7AA 2GFAA 1NBEB 3CC2A 1F1BB 4GLMA 1ZSZA 1QVGS 4JPBW 3CCSA 1YJNT 4JRIA 3EFOA 3A8HB 1Y7XA 3CCUT 4PLIA 5CQXA 5AT1B 2GQIA 5J26A 3M55A 2CH4A 4J7FA 3PT9A 1WXTA 2RHYA 3I35A 3JCMV 3CC2Q 1W70A 1Q7YC 2F5TX 3CCSQ 2X3WD 1WFWA 3PNWC 2K57A 2KEAA 1HSQA 2LCSA 3I55A 3MCAB 4EIKA 1TTHB 5KYWB 4M75B 2CZ7B 4X1VA 2LNHB 4LDUA 3E2UA 2KBTA 3CMAA 1YI2A 4ZGDB 1EX4A 1YCYA 2MI6A 2D9TA 2LJ3A 4F16A 5I22A 3NTKA 3I55Q 1QVFA 3P8BB 1QP3A 4OB3B 3O8VA 1K9MR 1ZBXA 5ECAA 3P8HA 3MEVA 3TCJA 2XICA 4BE2A 1NJIC 4ELZC 2CP0A 8ATCB 1D1BA 3CMAQ 1YI2Q 4M75C 2LDMA 1HK9A 2V1QA 1UECA 1VQ8T 1YJNA 2O2OA 3A8OB 1NE8A 4F14A 1D1CA 1JU5C 2KK4A 5CO7A 1RAHB 4YTLA 3CCUA 4PFPA 1WHGA 1LVKA 2XK0A 4XAXB 4XTUA 4M78A 3M0RA 4C8QA 2DAQA 2PU9B 3QWXX 2E3IA 1V1CA 1Y96B 2MF2A 4OMMA 3FRNA 1KD1R 1PSEA 3NTIA 1AT1B 4HCZA 5I2MA 3JCMP 4EMGA 4IUTA 3CPWS 1G3WA 4IURA 9ATCB 5D6XA 3CC7T 4RG2A 3WVEB 2QK0A 3JV3A 5HCKA 3FDRA 2BZXA 1IZ6A 3C94A 2RB6A 3RKWA 3S3NA 4M78F 2ED1A 3S3OA 3GF5A 4C8QF 1MNDA 2P0QA 3CCQT 2P0PA 5GAMg 2HEQA 2RJEA 2F5KA 1PKTA 2ED0A 1RAGB 1OPKA 1VYUA 1E6HA 3THKA 1TOVA 2DEQA 3VS3A 3JCMb 4DOVA 2WSEE 4M7DE 3KUFA 1AWOA 3FB9A 3VS2A 2E10A 1ZSZC 2HBPA 3PGGA 4BDZA 1OZ2A 1QCFA 4DBQA 4UC4A 1YITT 2CUBA 2GBQA 4BDYA 3OYHA 2QASA 2KY9A 3VV0A 3EHRA 1X2QA 3SFMA 5GMKj 1UGVA 2O9VA 3KBGA 1I1JA 2DTIA 3BE3A 1AWXA 2HQEA 2DKGA 3GPLA 2RF0A 5GANj 2BZ8A 5LJ5d 1C6VX 2DIQA 1HYOA 3R6OA 5HY6A 3TU4K 1PRMC 2VC8A 4N0AA 2GFUA 1VQOA 2YDLA 2PVOB 3EG2A 1K8AU 5GAN4 3L2WA 4LDXA 1NYFA 2VGNA 1VA7A 2HSPA 3CXCP 3MP1A 1KQ2A 3LGLA 1VQOQ 3HRTA 3OYMA 2O88A 1YFNA 1FYNA 5GJVB 4J9CA 1M2VB 2BKDN 1W2BA 2D0QB 2J6KA 1VQ7A 2YRDA 4XU0A 5LJ5f 5GAOm 5GMKh 2JTEA 2MAMA 2D8JA 4QKUA 1G83A 4A4HA 1YJWT 4BY6B 4EMHA 4OF1A 1YP5A 1R0CB 3M59A 3SB2A 1QMCA 2EBPA 2HZYA 1RAIB 3QBYA 3EG3A 5GANh 2E3HA 2R58A 5FROA 2JM8A 1PRLC 2VV5A 1VQ7Q 5CQYA 3ME9A 2OI3A 4M7DG 3FC3A 1W1FA 1Q81R 2ABLA 1RADB 3LW5E 3OBYA 2H8HA 4ME7A 3I56Q 1T0JA 4BY6C 4QW2A 1Q81U 2RHXA 2YRVA 1NYGA 1U1SA 2A36A 1D0YA 3GOXA 1M27C 1M9SA 1QVGA 2HAXA 4BE0A 3VS4A 4QVDA 2CP5A 3EGXB 3PMIA 3M0SA 3E9FA 4XK8E 1KHIA 3X26B 1VQ4T 4MZTA 3JB9J 5KYYA 3E9GA 3VKIA 1X27A 3OSSC 1UHCA 2DA9A 5KCOA 5LJ3j 3S6WA 1SF9A 1OZ3A 3D7SB 1SRLA 5KE2A 4PFOA 5DM7R 1JXMA 3CPFA 2BZYA 3UF4A 4DQ2A 3H0FA 2A7YA 2X4WA 5GAMj 4RTTA 3NMZC 5D6YA 2CP7A 2EKOA 5GJWB 3UWNA 1QWFA 2JVVA 5CKBA 4J9HA 4E2FB 2CYZB 2H3JA 3MPUB 3CBOA 2DL5A 4PLLA 4KRTA 1BK2A 1Z9ZA 4FSSA 3TREA 2KGTA 1O9SA 2C0IA 2KAFA 2I0NA 1SRMA 1Q82R 1FMKA 2COYA 3G71T 4N0AC 4RCBA 3PIPA 2CZ0B 2Z0WA 1K0SA 3JCMd 1BCMA 1BCOA 2SEMA 4CC3A 1VQ5A 1B07A 3UA6A 2QG9B 2NUTA 2OX7A 5LJ5e 2LQWA 1OV3A 2VVKA 5I21A 3LWHA 5LJ3h 4R0KA 2FHDA 2DLPA 1E7OA 3OS0A 3JRZA 3V7CA 4HT8A 3CPWA 1VQ5Q 3X24B 3QYHB 1K73C 1QLYA 3QXEB 1N27A 1GCPA 3JCMW 2R57A 3S3MA 1S72T 4E47A 1UTIA 1UGQB 5GAN6 3PIOA 1D0XA 4M7DB 1AHJB 4C0GA 4X34A 2A28A 4MDXA 1MMNA 3EAEA 3CCMT 1BYMA 3JCMc 2VASA 3TSWA 3RERA 2NLUA 4BUGA 3REBB 1TS9A 2HQXA 3OYFA 4C0FA 2BIVA 2ZPEB 4CI0C 1KQSS 1BI1A 3NGPA 2OTJQ 4P5NA 3E19A 3G71A 4KUDK 1RL2A 4J9GA 1OU9A 2DF6A 3J80E 2XU8A 1NJIU 4MZMA 2K5LA 4CC4B 4M7DC 2HQHA 3M57A 1VQKA 2Y4XA 4WCIA 1WA7A 3HKSA 1W2BP 4M7DD 1PNJA 2L3SA 1ARKA 4TVRA 5FU6B 2EYWA 1H3ZA 3G71Q 2GCXA 5GAN8 1TUCA 1I5LA 1UHFA 1VQKQ 3OYKA 1WHHA 1WQ7A 2JW4A 2COWA 3VS7A 1JB0E 3QHSA 1VQ9T 1ZUUA 1BIBA 1B7TA 1N8RC 5FU6C 2DPPB 3CCMA 3TQ7P 1RI9A 4XQ3A 5A0DA 4OB0B 3DLMA 2NUTB 2I2LA 3M0UA 5EG2A 3NTHA 3OA6A 1G3SA 3EH1A 2RK2A 4N4GA 4PJOD 4J83A 1KC8R 4Z89A 1HD3A 5C0MA 3RMSA 2OAUA 3CCMQ 5FWCA 3HSBA 3EFSA 4J6WA 3SWNB
chains in the Genus database with same CATH topology
1X6BA 3UA7A 2A08A 2KR3A 2V1QA 1UECA 1TUDA 2O2OA 2OJ2A 4M4ZA 2CSQA 4F14A 2V1RA 2J7IA 2DX1A 1QWEA 2F2XA 2OAWA 1JU5C 1UDLA 1CKAA 2RN8A 2KXCA 2HBWA 2KT8A 1X6GA 1UUEA 3M0RA 1MV3A 2D8HA 4HXJA 3REAB 3QWXX 4AG1C 5FW9A 1V1CA 1SEMA 2YUOA 3CQTA 4OMMA 1AEYA 2L3QA 2AZSA 3R6NA 1AOJA 2HCKA 4A63B 2LMJA 1Z9QA 1U3OA 5I11A 3JV3A 1ZX6A 5HCKA 3PVLA 2C0OA 4JZ4A 4RTVA 4J9EA 1Y0MA 2BZXA 4RUGA 1GFDA 1I0CA 5FWBA 1ABQA 2KXDA 3GBQA 1GBRA 1SSHA 4IIOA 2KNBB 2KRSA 3VRZA 1SPKA 1TG0A 2ED1A 2DMOA 2DL3A 2ECZA 1WXUA 2EW3A 2JM9A 2DBMA 3QWYA 4AFSC 2RQUA 5IHKA 2HEQA 3VS6A 4HCKA 1HJDA 1JEGA 1BB9A 1WI7A 1PKTA 2ED0A 2LQNA 1M3BA 1OPKA 4HVUA 1VYUA 1KFZA 1E6HA 1K0XA 2HDAA 4OMPA 3THKA 2K6DA 3PE0A 1M30A 2GGRA 3EGUA 1AWJA 2FRWA 3ZL7C 2CDTA 3VS3A 2JMCA 4RTUA 2JXBA 2L3PA 4F17A 1AWOA 2F2VA 2RNAA 1YWPA 2RMOA 2A37A 4K11A 4OMNA 3VS2A 2GTOA 1EFNA 1BU1A 2YUPA 1QCFA 2B86A 4E6RA 1GFCA 1WLPB 1X69A 2LX7A 2CUBA 2GBQA 1OEBA 2CUDA 3EHRA 1X2QA 1UGVA 2O9VA 1UE9A 1I1JA 3I9QA 1H92A 2JMAA 1AWXA 2PZ1A 1JO8A 2IIMA 2RF0A 1GCQA 2BZ8A 2CSIA 1Y57A 3VS1A 2EGEA 1M3AA 1OPLA 3VS5A 2PNIA 2F2WA 2FO0A 1CSKA 2CT4A 1KJWA 2DL4A 3ULRB 1PRMC 2DRMA 2RQTA 2FRYA 1M8MA 1U5SA 4OMLA 2YDLA 3C0CA 3EG2A 4HVWA 4JJBA 1AVZC 2E5KA 3NHNA 2KT1A 2KRMA 1GRIA 3I5SA 2GNCA 1NYFA 3M0TA 2AK5A 2DYBA 2RPNA 1VA7A 2HSPA 3H0HA 2K9GA 1UFFA 1T3SA 1VYVA 2O88A 1FYNA 5GJVB 2DRKA 4J9CA 2ESWA 1K4US 2CREA 2J6KA 1A0NB 1NLPC 2NWMA 1JXOA 2JTEA 2D8JA 4RTZA 1G83A 2P4RA 4RTYA 2KRNA 1BBZA 1RLQC 3A98A 4Z8AA 1YP5A 2DILA 1XOVA 2EBPA 1KIKA 2M51A 3EG3A 1YN8A 2JM8A 1PRLC 3H0IA 5EC7A 2OI3A 1ZSGA 1W6XA 1ZUYA 1W1FA 1AZGB 2ABLA 2D0NA 2RQWA 3FJ5A 1T0HA 2H8HA 3I5RA 3VRYA 4LE9A 2EYXA 1T0JA 2DL8A 4RTXA 2EPDA 2K2MA 2YUNA 3EHQA 1GBQA 1UJYA 2X3XD 2C0TA 5IHNA 1NYGA 2A36A 4JJCA 1M27C 4AFQC 1I07A 2DM1A 1NEGA 3LH5A 1NM7A 3VS4A 2KROA 1MUZA 1M3CA 2J6OA 3M0SA 2ROLA 2PTKA 1PHTA 1SHGA 1WIEA 2SRCA 2CT3A 1X2KA 3TSZA 2FPFA 4QT7A 2QDLA 1X27A 3KFVA 1UHCA 2DE0X 4J9BA 2DA9A 2DBKA 5L23A 1SRLA 4HVVA 2FG0A 1JXMA 2NUZA 2BZYA 3UF4A 3H0FA 1S1NA 2EGCA 4RTTA 1YNZA 3NMZC 4AFZC 4CC7A 1NG2A 2J05A 2MCNA 1UJ0A 5GJWB 2LJ0A 2EGAA 1NLOC 1QWFA 4J9HA 4J9FA 2KYBA 3M0PA 1PWTA 2DL5A 3RBBB 4KRTA 4ZNXA 1IO6A 2BTTA 2RQVA 1BK2A 1Z9ZA 4FSSA 1GCQC 4OMOA 2EQIA 3VS0A 3M0QA 2KGTA 4CC2A 3UATA 2C0IA 3NPFA 2I0NA 1SRMA 1FMKA 2EKHA 1G2BA 2ENMA 1NEBA 2FEIA 4Z88A 2CH4W 1K0SA 2LP5A 2SEMA 3O5ZA 4CC3A 1B07A 2W0ZA 3UA6A 1X43A 2J06A 4LNPA 2LQWA 2L0AA 1OV3A 2VVKA 2AKKA 2JS2A 2J6FA 1VYTA 2KE9A 1K9AA 1QKWA 4D8KA 1H3HA 2O9SA 1ZLMA 4RTWA 1LCKA 4R0KA 2YT6A 2DLPA 2O31A 1E7OA 4J9IA 1AZEA 2DL7A 1QLYA 1GCPA 4AFUC 5IHIA 1GL5A 1E6GA 1K1ZA 2JT4A 1KSWA 3EG1A 1B3QA 1UTIA 1JQQA 4DEYA 2AKLA 3IQLA 1YWOA 1AD5A 4JZ3A 1ZUKA 3TVTA 2A28A 2EYYA 2EVRA 3TSWA 2W10A 1OOTA 3REBB 1YCSB 3H41A 1RLPC 2DVJA 2M0YA 4ORZA 4GBQA 2YUQA 1ZBJA 3NGPA 3RNJA 2G6FX 4AG2C 2YSQA 1SHFA 4D8DA 1U06A 1CKBA 2EYZA 4J9GA 4JJDA 2DF6A 2LZ6B 1T3LA 5IH2A 1K76A 4CC4B 2DNUA 2MIOA 4J9DA 3U23A 2FPDA 4WCIA 1ABOA 1WA7A 2AZVA 2VKNA 3SHWA 2K7AA 1PNJA 2L3SA 2XMFA 4GLMA 1ARKA 4JPBW 2LJ1A 2EYWA 2RQRA 2MOXA 1TUCA 1H8KA 3PVQA 2GQIA 1UHFA 4LUDA 2CH4A 4ESRA 2JW4A 4IIMA 3SEMA 1WXTA 3I35A 3VS7A 5IXFA 1WXBA 1W70A 2X3WD 1ZUUA 1WFWA 4DEXA 1RUWA 2K79A 2KEAA 1N5ZA 1HSQA 2LCSA 4OMQA 2K3BA 4LUEA 4EIKA 2D1XA 2ROTA 1RI9A 4X1VA 5IXBA 2FPEA 2JS0A 2LNHB 4LN2A 1MV0B 2L2PA 2DJQA 2KBTA 2GTJA 1J3TA 1WDXA 3EG0A 3M0UA 5I22A 2VWFA 2LJ3A 4F16A 1PKSA 4Z89A 1HD3A 1WYXA 4Y92A 1WX6A 5FWCA 1UG1A 1QKXA 5ECAA 2KYMA 1AWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6B A;  3UA7 A;  2A08 A;  2KR3 A;  2V1Q A;  1UEC A;  1TUD A;  2O2O A;  2OJ2 A;  4M4Z A;  2CSQ A;  4F14 A;  2V1R A;  2J7I A;  2DX1 A;  1QWE A;  2F2X A;  2OAW A;  1JU5 C;  1UDL A;  1CKA A;  2RN8 A;  2KXC A;  2HBW A;  2KT8 A;  1X6G A;  1UUE A;  3M0R A;  1MV3 A;  2D8H A;  4HXJ A;  3REA B;  3QWX X;  4AG1 C;  5FW9 A;  1V1C A;  1SEM A;  2YUO A;  3CQT A;  4OMM A;  1AEY A;  2L3Q A;  2AZS A;  3R6N A;  1AOJ A;  2HCK A;  4A63 B;  2LMJ A;  1Z9Q A;  1U3O A;  5I11 A;  3JV3 A;  1ZX6 A;  5HCK A;  3PVL A;  2C0O A;  4JZ4 A;  4RTV A;  4J9E A;  1Y0M A;  2BZX A;  4RUG A;  1GFD A;  1I0C A;  5FWB A;  1ABQ A;  2KXD A;  3GBQ A;  1GBR A;  1SSH A;  4IIO A;  2KNB B;  2KRS A;  3VRZ A;  1SPK A;  1TG0 A;  2ED1 A;  2DMO A;  2DL3 A;  2ECZ A;  1WXU A;  2EW3 A;  2JM9 A;  2DBM A;  3QWY A;  4AFS C;  2RQU A;  5IHK A;  2HEQ A;  3VS6 A;  4HCK A;  1HJD A;  1JEG A;  1BB9 A;  1WI7 A;  1PKT A;  2ED0 A;  2LQN A;  1M3B A;  1OPK A;  4HVU A;  1VYU A;  1KFZ A;  1E6H A;  1K0X A;  2HDA A;  4OMP A;  3THK A;  2K6D A;  3PE0 A;  1M30 A;  2GGR A;  3EGU A;  1AWJ A;  2FRW A;  3ZL7 C;  2CDT A;  3VS3 A;  2JMC A;  4RTU A;  2JXB A;  2L3P A;  4F17 A;  1AWO A;  2F2V A;  2RNA A;  1YWP A;  2RMO A;  2A37 A;  4K11 A;  4OMN A;  3VS2 A;  2GTO A;  1EFN A;  1BU1 A;  2YUP A;  1QCF A;  2B86 A;  4E6R A;  1GFC A;  1WLP B;  1X69 A;  2LX7 A;  2CUB A;  2GBQ A;  1OEB A;  2CUD A;  3EHR A;  1X2Q A;  1UGV A;  2O9V A;  1UE9 A;  1I1J A;  3I9Q A;  1H92 A;  2JMA A;  1AWX A;  2PZ1 A;  1JO8 A;  2IIM A;  2RF0 A;  1GCQ A;  2BZ8 A;  2CSI A;  1Y57 A;  3VS1 A;  2EGE A;  1M3A A;  1OPL A;  3VS5 A;  2PNI A;  2F2W A;  2FO0 A;  1CSK A;  2CT4 A;  1KJW A;  2DL4 A;  3ULR B;  1PRM C;  2DRM A;  2RQT A;  2FRY A;  1M8M A;  1U5S A;  4OML A;  2YDL A;  3C0C A;  3EG2 A;  4HVW A;  4JJB A;  1AVZ C;  2E5K A;  3NHN A;  2KT1 A;  2KRM A;  1GRI A;  3I5S A;  2GNC A;  1NYF A;  3M0T A;  2AK5 A;  2DYB A;  2RPN A;  1VA7 A;  2HSP A;  3H0H A;  2K9G A;  1UFF A;  1T3S A;  1VYV A;  2O88 A;  1FYN A;  5GJV B;  2DRK A;  4J9C A;  2ESW A;  1K4U S;  2CRE A;  2J6K A;  1A0N B;  1NLP C;  2NWM A;  1JXO A;  2JTE A;  2D8J A;  4RTZ A;  1G83 A;  2P4R A;  4RTY A;  2KRN A;  1BBZ A;  1RLQ C;  3A98 A;  4Z8A A;  1YP5 A;  2DIL A;  1XOV A;  2EBP A;  1KIK A;  2M51 A;  3EG3 A;  1YN8 A;  2JM8 A;  1PRL C;  3H0I A;  5EC7 A;  2OI3 A;  1ZSG A;  1W6X A;  1ZUY A;  1W1F A;  1AZG B;  2ABL A;  2D0N A;  2RQW A;  3FJ5 A;  1T0H A;  2H8H A;  3I5R A;  3VRY A;  4LE9 A;  2EYX A;  1T0J A;  2DL8 A;  4RTX A;  2EPD A;  2K2M A;  2YUN A;  3EHQ A;  1GBQ A;  1UJY A;  2X3X D;  2C0T A;  5IHN A;  1NYG A;  2A36 A;  4JJC A;  1M27 C;  4AFQ C;  1I07 A;  2DM1 A;  1NEG A;  3LH5 A;  1NM7 A;  3VS4 A;  2KRO A;  1MUZ A;  1M3C A;  2J6O A;  3M0S A;  2ROL A;  2PTK A;  1PHT A;  1SHG A;  1WIE A;  2SRC A;  2CT3 A;  1X2K A;  3TSZ A;  2FPF A;  4QT7 A;  2QDL A;  1X27 A;  3KFV A;  1UHC A;  2DE0 X;  4J9B A;  2DA9 A;  2DBK A;  5L23 A;  1SRL A;  4HVV A;  2FG0 A;  1JXM A;  2NUZ A;  2BZY A;  3UF4 A;  3H0F A;  1S1N A;  2EGC A;  4RTT A;  1YNZ A;  3NMZ C;  4AFZ C;  4CC7 A;  1NG2 A;  2J05 A;  2MCN A;  1UJ0 A;  5GJW B;  2LJ0 A;  2EGA A;  1NLO C;  1QWF A;  4J9H A;  4J9F A;  2KYB A;  3M0P A;  1PWT A;  2DL5 A;  3RBB B;  4KRT A;  4ZNX A;  1IO6 A;  2BTT A;  2RQV A;  1BK2 A;  1Z9Z A;  4FSS A;  1GCQ C;  4OMO A;  2EQI A;  3VS0 A;  3M0Q A;  2KGT A;  4CC2 A;  3UAT A;  2C0I A;  3NPF A;  2I0N A;  1SRM A;  1FMK A;  2EKH A;  1G2B A;  2ENM A;  1NEB A;  2FEI A;  4Z88 A;  2CH4 W;  1K0S A;  2LP5 A;  2SEM A;  3O5Z A;  4CC3 A;  1B07 A;  2W0Z A;  3UA6 A;  1X43 A;  2J06 A;  4LNP A;  2LQW A;  2L0A A;  1OV3 A;  2VVK A;  2AKK A;  2JS2 A;  2J6F A;  1VYT A;  2KE9 A;  1K9A A;  1QKW A;  4D8K A;  1H3H A;  2O9S A;  1ZLM A;  4RTW A;  1LCK A;  4R0K A;  2YT6 A;  2DLP A;  2O31 A;  1E7O A;  4J9I A;  1AZE A;  2DL7 A;  1QLY A;  1GCP A;  4AFU C;  5IHI A;  1GL5 A;  1E6G A;  1K1Z A;  2JT4 A;  1KSW A;  3EG1 A;  1B3Q A;  1UTI A;  1JQQ A;  4DEY A;  2AKL A;  3IQL A;  1YWO A;  1AD5 A;  4JZ3 A;  1ZUK A;  3TVT A;  2A28 A;  2EYY A;  2EVR A;  3TSW A;  2W10 A;  1OOT A;  3REB B;  1YCS B;  3H41 A;  1RLP C;  2DVJ A;  2M0Y A;  4ORZ A;  4GBQ A;  2YUQ A;  1ZBJ A;  3NGP A;  3RNJ A;  2G6F X;  4AG2 C;  2YSQ A;  1SHF A;  4D8D A;  1U06 A;  1CKB A;  2EYZ A;  4J9G A;  4JJD A;  2DF6 A;  2LZ6 B;  1T3L A;  5IH2 A;  1K76 A;  4CC4 B;  2DNU A;  2MIO A;  4J9D A;  3U23 A;  2FPD A;  4WCI A;  1ABO A;  1WA7 A;  2AZV A;  2VKN A;  3SHW A;  2K7A A;  1PNJ A;  2L3S A;  2XMF A;  4GLM A;  1ARK A;  4JPB W;  2LJ1 A;  2EYW A;  2RQR A;  2MOX A;  1TUC A;  1H8K A;  3PVQ A;  2GQI A;  1UHF A;  4LUD A;  2CH4 A;  4ESR A;  2JW4 A;  4IIM A;  3SEM A;  1WXT A;  3I35 A;  3VS7 A;  5IXF A;  1WXB A;  1W70 A;  2X3W D;  1ZUU A;  1WFW A;  4DEX A;  1RUW A;  2K79 A;  2KEA A;  1N5Z A;  1HSQ A;  2LCS A;  4OMQ A;  2K3B A;  4LUE A;  4EIK A;  2D1X A;  2ROT A;  1RI9 A;  4X1V A;  5IXB A;  2FPE A;  2JS0 A;  2LNH B;  4LN2 A;  1MV0 B;  2L2P A;  2DJQ A;  2KBT A;  2GTJ A;  1J3T A;  1WDX A;  3EG0 A;  3M0U A;  5I22 A;  2VWF A;  2LJ3 A;  4F16 A;  1PKS A;  4Z89 A;  1HD3 A;  1WYX A;  4Y92 A;  1WX6 A;  5FWC A;  1UG1 A;  1QKX A;  5ECA A;  2KYM A;  1AWW A; 
#chains in the Genus database with same CATH topology
 1X6B A;  3CCS T;  2KR3 A;  3QII A;  5D7U A;  2XI9 A;  4M4Z A;  2HL5 C;  2J7I A;  2DX1 A;  1QWE A;  3H9N A;  4II1 A;  3URG A;  2KXC A;  2KT8 A;  1X6G A;  3GIB A;  1Q95 G;  2QTX A;  2V8K A;  1MV3 A;  2AHJ B;  4XTY A;  2JOY A;  4AG1 C;  4KBM B;  1VQ9 A;  1D09 B;  5FW9 A;  2YUO A;  4BI3 A;  2JNG A;  3SWN C;  5J3B A;  2C06 A;  4IUP A;  1UEB A;  3I55 T;  2AZS A;  1Q86 R;  2JTM A;  2YLB A;  3MP6 A;  3MEW A;  4M78 E;  4C8Q E;  3CME A;  2B8A A;  4A63 B;  2LMJ A;  2JTF A;  1ZX6 A;  3CMA T;  1YI2 T;  2C0O A;  1FMW A;  1Y0M A;  2NUP B;  1GFD A;  4FT2 A;  5FWB A;  3GBQ A;  5HKC A;  4IUQ A;  2KRS A;  3ASK A;  3ZEH A;  3VRZ A;  3LYI A;  1SPK A;  2DMO A;  2M16 A;  2EW3 A;  5FU7 B;  2DBM A;  3QWY A;  3CME Q;  2WSF E;  4FM4 B;  4HCK A;  2XDD A;  5GAN g;  1JEG A;  3JCM J;  4M7A A;  2K6D A;  1M30 A;  2GGR A;  3EGU A;  1AWJ A;  1YJ9 A;  3CC4 A;  2EJG A;  3L2V A;  5CK9 A;  2L3P A;  2L8D A;  5DY9 A;  2COZ A;  2F2V A;  2O01 E;  2RNA A;  1JJ2 P;  2GTO A;  1EFN A;  1BU1 A;  2DTH A;  1M2O A;  5FU7 C;  4E6R A;  1X69 A;  2LX7 A;  1QVP A;  3CC4 Q;  1YJ9 Q;  3DB4 A;  4J7I A;  3AT1 B;  2X9H A;  3G4S A;  5GAO r;  3OYJ A;  1UE9 A;  3EG9 B;  3CCJ A;  4M7A F;  2JMA A;  5FLX E;  1I81 A;  3ER0 A;  3M4G A;  2IIM A;  3MKD A;  1KHC A;  2Y4Y A;  2E1H A;  1TUG B;  1Y57 A;  4A4K A;  1SKU B;  2GQV A;  3BDU A;  2F2W A;  1CSK A;  2CT4 A;  2RQT A;  2DRM A;  4F7U E;  6AT1 B;  3JCM X;  2A0F B;  3G4S Q;  1FX7 A;  1M8M A;  3HRS A;  3RMQ A;  3CCJ Q;  4DBR A;  2E4H A;  2CS7 A;  2WAC A;  4HVW A;  4JJB A;  4EPC A;  1AVZ C;  2RHI A;  2E5K A;  3NHN A;  2KRM A;  2CP6 A;  4M78 G;  2GNC A;  1YHQ Q;  2DYB A;  4C8Q G;  4PNO A;  2EQM A;  4JDS A;  4ZGJ B;  1WJR A;  4JRP A;  2CZ1 B;  3H0H A;  1UFF A;  1T3S A;  4M75 D;  4A4G A;  3QJY A;  4DA4 A;  2DXU A;  1VYV A;  4Q5W A;  2LT4 A;  3JSC A;  2ESW A;  4X9D A;  5D6W A;  4PJJ A;  1K4U S;  3BW1 A;  3MET A;  3CBP A;  4JS5 A;  1YBY A;  1NLP C;  5A0G A;  1IXD A;  1B34 A;  1JXO A;  4RTZ A;  4RTY A;  2KRN A;  4Z8A A;  2LC4 A;  4R55 A;  2DIL A;  1XOV A;  2JN0 A;  5GAN 5;  4WTO B;  1YN8 A;  5LJ5 j;  2QYZ A;  4MZP A;  3H0I A;  5KYU A;  3CCL A;  1W6X A;  1KQS A;  3OY9 A;  4E7S A;  1D3B A;  2D0N A;  5LJ3 g;  3M54 A;  1VQO T;  2VUB A;  1M1K C;  4KGZ B;  3QZ9 B;  1ZSZ B;  3QDF A;  3VRY A;  1IRE B;  4C92 A;  3BFM A;  2EYX A;  4XTZ A;  2DD5 A;  3EFO B;  4BD3 A;  3V8J A;  1BI0 A;  3C4S A;  2C0T A;  5IHN A;  2K3Y A;  3CCL Q;  1U8R A;  2AIR B;  2EQU A;  2DEU A;  1VQN Q;  4KGV B;  3LH0 A;  4ZGE B;  1WQW A;  4F7U G;  4A53 A;  4M7A C;  2M0O A;  1VQ7 T;  4LDV A;  4NL2 A;  1X01 A;  1RAE B;  5HK3 A;  4J5Y A;  4C92 F;  1K73 U;  1WJS A;  3A1P A;  4XTX A;  3TSZ A;  4QT7 A;  3KFV A;  3MEA A;  1IRX A;  1BIA A;  3I56 T;  2HMA A;  2QQR A;  5LJ5 h;  4F7U A;  4PJM A;  3M53 A;  3F70 A;  2NUZ A;  4FIB A;  3JB9 I;  1G3Y A;  5C6S A;  2ZPH B;  2MCN A;  1K8A R;  1NLO C;  1WJQ A;  2F69 A;  3LWI A;  2KYB A;  4NL3 A;  5CAI A;  3JB9 G;  2DET A;  1VQ6 Q;  4J8O A;  2VXE A;  3QKJ A;  2D6F A;  4EMK A;  4ZN1 A;  1VIF A;  3RIR A;  4XTW A;  4N4H A;  2EQI A;  4IKF A;  2EKH A;  4M78 B;  4B9W A;  4C5H A;  4F7U F;  5AYF A;  4Z88 A;  1RAF B;  2FEI A;  2XID A;  4C8Q B;  2HKQ B;  4F04 B;  4E7K A;  1LNX A;  3QG1 A;  2W0Z A;  3BY7 A;  1X43 A;  2J06 A;  4LNP A;  4PKC C;  2AKK A;  2JS2 A;  5GAN 7;  2J6F A;  3G6E T;  5IN1 A;  2KE9 A;  1K9A A;  4JLG A;  2RHZ A;  4LDY A;  5KYX A;  4JRK A;  4M78 C;  2DL7 A;  3I56 A;  2O4X A;  1M90 C;  4C8Q C;  2QQA A;  1C0M A;  4M78 D;  4AFU C;  3JB9 F;  5IHI A;  2DFU A;  1GL5 A;  2CZ6 B;  2DZ9 A;  4RMO A;  5KCH A;  4C8Q D;  3OW2 A;  3EH2 A;  1N8R U;  1JRI A;  2E6Z A;  4LD6 A;  3EG1 A;  2AKL A;  1IGU A;  1ZUK A;  3H6Z A;  4B9X A;  4MMK A;  3UDC A;  1QVF P;  2EYY A;  2E65 A;  2E6N A;  4E7I A;  1MMD A;  1TH7 A;  3MO8 A;  2M0Y A;  4ORZ A;  4ZN3 A;  1LPL A;  3SD4 A;  2X4J A;  1QCN A;  3OS5 A;  3V7R A;  2YSQ A;  2RO0 A;  2EYZ A;  4JJD A;  2K5F A;  4EDU A;  2LZ6 B;  1VQ5 T;  2DNU A;  2AT1 B;  2AZV A;  2VKN A;  3RUX A;  1Y71 A;  4A4F A;  3SHW A;  3HFN A;  1PCX A;  3G6E A;  3JB9 H;  4F7U B;  2FL7 A;  1PC0 A;  2LQK A;  3HFO A;  2RQR A;  1U1T A;  2MOX A;  3RES A;  1PSF A;  4C0D B;  2BE7 D;  1H8K A;  1MNE A;  4FW2 A;  3FLG A;  2FVU A;  4ESR A;  1I8F A;  1K9M C;  2HL3 A;  1WXB A;  3GP8 A;  2OTJ T;  3G6E Q;  3CXC S;  4OB2 B;  4DEX A;  3L2Z A;  2K79 A;  1N5Z A;  4M77 G;  5GMK i;  3J81 E;  4HCB A;  2ROT A;  2FPE A;  2JS0 A;  2CP2 A;  4C0D C;  3JCM h;  1JBM A;  1IHV A;  5GAN 3;  1J3T A;  3Q1J A;  1WDX A;  2DO3 A;  4M77 A;  2QGG A;  1NZ9 A;  3RDV A;  3EG0 A;  1KD1 C;  2VWF A;  4PJO A;  2QAZ A;  2JZ2 A;  4VUB A;  2FZG B;  1VQP A;  3E1S A;  4OGC A;  2ZZD A;  1WYX A;  1WX6 A;  1VQK T;  2OTL A;  3HL8 A;  3GNG A;  1UG1 A;  1QKX A;  2KYM A;  3GLX A;  4D6W A;  1X75 C;  5KYX B;  1Q7Y R;  3N5B B;  2X51 A;  3L2Q A;  2O4X B;  4XU1 A;  2PVD B;  1XNI A;  2OJ2 A;  1TWB A;  2CSQ A;  4J6Y A;  2V1R A;  2OAW A;  1VQP Q;  1UDL A;  5CIU A;  2RN8 A;  4Z02 A;  2OTL Q;  1Q7Y U;  2HBW A;  3AHU A;  2A3L A;  4KH0 B;  2V26 A;  4KUI A;  1UUE A;  4M77 F;  2D8H A;  2FZC B;  4PJO F;  5GMK l;  1PD1 A;  2XHC A;  1SEM A;  1QCO A;  3FIF A;  2JJ9 A;  3CQT A;  2OTJ A;  1AEY A;  3MP8 A;  2IVW A;  2MWO A;  3C12 A;  5KH6 A;  2LNV A;  3DLL A;  1G8X A;  1SG5 A;  3JCM f;  1M4Z A;  3M56 A;  5GAO n;  2HCK A;  5GAO q;  2YHT A;  1OI1 A;  1NJI R;  4AT1 B;  1WHM A;  1Z9Q A;  1U3O A;  5I11 A;  3PVL A;  4JZ4 A;  4RTV A;  4J9E A;  4RUG A;  2E41 A;  1I0C A;  1ABQ A;  5GAM d;  2KNB B;  1RAA B;  4CRI A;  4QQD A;  3OSV A;  4L59 A;  2MWP A;  5KYY B;  4AFS C;  3EGD A;  3OYD A;  1DJ7 B;  2RA2 A;  5IHK A;  3VS6 A;  1BB9 A;  2ZPG B;  1TSF A;  5CR2 A;  4HVU A;  1UGR B;  1K0X A;  2LX9 A;  2HDA A;  3PE0 A;  3OYC A;  2QTV A;  1MMA A;  3ZL7 C;  2CDT A;  2JMC A;  2RHU A;  3BDL A;  4RTU A;  2JXB A;  4F17 A;  2NYS A;  4OMN A;  2A37 A;  5CCA A;  4JS4 A;  4QQ6 A;  3KXT A;  4M7A E;  3HRU A;  1D0Z A;  3OW2 P;  1BI3 A;  7AT1 B;  1GFC A;  4BB7 A;  1OEB A;  2PVG B;  1M1K R;  2RI3 A;  2QDY B;  3INZ A;  2ZPF B;  3I9Q A;  2M02 A;  1H92 A;  3CME T;  5FRN A;  4DBF A;  4MDW A;  3J7A F;  4FYY B;  4DOW A;  1GCQ A;  1M1K U;  3VS1 A;  1M3A A;  1OPL A;  2E64 A;  2PNI A;  2FO0 A;  1QVG P;  3OYE A;  1KJW A;  2DL4 A;  2FRY A;  2CP3 A;  2CKK A;  4A4E A;  1U5S A;  4LXC A;  5LJ5 g;  4ZTF A;  2YRC A;  1G3T A;  2K2V A;  2KT1 A;  3I5S A;  1GRI A;  4M77 C;  2V8I A;  4QVC A;  4KT0 E;  3CC4 T;  2AK5 A;  5KYW A;  1YJ9 T;  3OYI A;  3VJP A;  3JCM Q;  3HHT B;  2RPN A;  4M75 A;  2RK1 A;  3ZFJ A;  1WGS A;  2QXF A;  5IAY A;  1RAB B;  3X25 B;  1H64 1;  2K5I A;  2PUK B;  3QO3 A;  3QSU A;  1A0N B;  2MK5 A;  4FW1 A;  4X9C A;  3JCM e;  4JUV A;  2NWM A;  3VYG A;  3M5A A;  1TU0 B;  4GY5 A;  3FEO A;  2P4R A;  3A8L B;  4OB1 B;  3G4S T;  1LOJ A;  1RLQ C;  1FWZ A;  2KSS A;  5L8R E;  2YWW A;  2F1L A;  3CCJ T;  1BI2 A;  2M51 A;  4J6X A;  3TEE A;  4JRQ A;  1V76 A;  4M75 F;  1YHQ T;  1VQM A;  1NPR A;  3LLR A;  4KH1 B;  5EC7 A;  3EGD B;  2HSE B;  4M7A G;  2RQW A;  2FYK A;  3FJ5 A;  3PMT A;  1T0H A;  2QA4 T;  4OP0 A;  3I5R A;  1Y96 A;  4L5G A;  2MPX C;  1IHW A;  2P84 A;  1OQK A;  2DL8 A;  4RTX A;  2K2M A;  1OX9 A;  2RJD A;  1I4K 1;  2YUN A;  2ATC B;  3LGF A;  2LT1 A;  1VQM Q;  3EHQ A;  2X3X D;  1UJY A;  5I2S A;  3WVD B;  4JJC A;  4DBH A;  4AFQ C;  2DM1 A;  3LH5 A;  2EQJ A;  4C92 E;  1NM7 A;  1KQ1 A;  1WNL A;  1M3C A;  1R8O B;  4PL6 A;  1P92 A;  4IUV A;  3X28 B;  3CPW P;  1UGP B;  2ROL A;  4N4I A;  1PHT A;  1SHG A;  2XKO C;  2VGM A;  2DYI A;  2CT3 A;  1X2K A;  3CXC A;  1Q82 C;  1M90 U;  3CD6 T;  2DXC A;  1QP2 A;  2DE0 X;  2LCC A;  2RD1 A;  2DBK A;  2EFI A;  1PG5 B;  3V7S A;  1S1N A;  2EGC A;  1YNZ A;  2QQS A;  2J05 A;  1YHQ A;  3QDR B;  2EQK A;  3CCL T;  1UJ0 A;  3A5Z B;  2HNI A;  2LJ0 A;  3HTR A;  2EGA A;  2X4X A;  4J9F A;  3V8K A;  1VQN T;  2E5Q A;  3M0P A;  2QA4 A;  4ZNX A;  1IO6 A;  1PM3 A;  2DER A;  4RKU E;  2L5Q A;  1GCQ C;  1EZZ B;  3UAT A;  4KGX B;  1G2B A;  2ENM A;  4L6V 5;  2LVM A;  2RI5 A;  2QA4 Q;  3O5Z A;  2R5A A;  4OMF B;  3A8G B;  2QEX T;  2MYS A;  1VQL A;  2QQB A;  3JCM g;  2VXF A;  1QKW A;  3OBW A;  2O9S A;  3QYG B;  1ZLM A;  2DIG A;  2YLC A;  1K9M U;  2O31 A;  3CD6 A;  4ATO A;  2K3X A;  1VQ6 T;  3DB3 A;  3A8M B;  1WHK A;  3OYN A;  1OX8 A;  2PQW A;  4C92 G;  1VQL Q;  3WXM B;  1JQQ A;  1W4S A;  1YJN Q;  3TVT A;  1G5V A;  4B6M A;  1M2V A;  1KG1 A;  3CD6 Q;  4FT4 A;  3VUZ A;  2KQW A;  1JJ2 S;  2LRQ A;  2E70 A;  2EVR A;  4M7A B;  1VQN A;  2W10 A;  3JAM E;  3CCU Q;  4LD9 K;  2KDS A;  1UGS B;  2DZC A;  1RLP C;  1KD1 U;  2YUQ A;  3M9Q A;  5LL6 S;  1ZBJ A;  1SHF A;  2VB6 A;  1YIJ T;  2FB7 A;  1D1A A;  2EAY A;  1R0B G;  3OMC A;  4E7J A;  4FCY A;  1K73 R;  2RM4 A;  4J9D A;  2QEX A;  3OYL A;  2E12 A;  2XMF A;  4FYW B;  5KYN A;  1XJW B;  3RR6 A;  4M7A D;  3L2U A;  2LJ1 A;  1VQ8 A;  2XG8 D;  1RAC B;  4FU6 A;  1KC8 C;  1VQ6 A;  3PVQ A;  2M9U A;  5GAO p;  4LUD A;  2QEX Q;  4IIM A;  3SEM A;  5IXF A;  3RKX A;  2DXB A;  3EGX A;  1RUW A;  1VQ8 Q;  3MEU A;  4OMQ A;  1UB4 A;  1MMG A;  2K3B A;  4LUE A;  4Y91 A;  2D1X A;  1R77 A;  5GAN 2;  3CC7 A;  5HK0 A;  5IXB A;  4LN2 A;  1MV0 B;  2L2P A;  2DJQ A;  3CEY A;  4XU2 A;  2GTJ A;  4WF2 A;  1YIJ A;  1PKS A;  2JUF A;  1Y07 A;  2LTO A;  1Q86 C;  2IG0 A;  4Y92 A;  1ZA1 B;  1B34 B;  1IGQ A;  1OYX A;  4O6J A;  5KE3 A;  3CCQ A;  3CC7 Q;  3QPH A;  1AWW A;  4M77 E;  3UA7 A;  2K4Y A;  2A08 A;  2X4Y A;  2X35 A;  4ANJ A;  1OU8 A;  3QJ6 A;  4PJO E;  3CCR T;  1TUD A;  4MML A;  1YIJ Q;  1N8R R;  2IPO B;  2F2X A;  4PK4 A;  1QQJ A;  1LJO A;  1CKA A;  2EWN A;  5KYU B;  3OYG A;  3CCQ Q;  2FZK B;  1D3B B;  1MGQ A;  2L89 A;  5CVI A;  4HXJ A;  3REA B;  3QUI A;  4C92 B;  3OYY A;  3EFR A;  3VUB A;  1YIT A;  5FRM A;  4OGE A;  1WHJ A;  2PUO B;  2KMT A;  2L3Q A;  4C0Z A;  1X6O A;  3R6N A;  4QQG A;  2P0K A;  1AOJ A;  1C1A A;  1MHN A;  1WZO A;  3L1A A;  1VIE A;  2LQ8 A;  3UT1 A;  4PFZ A;  1HXD A;  1V29 B;  2KXD A;  4C5E A;  1GBR A;  1SSH A;  1YIT Q;  4IIO A;  4GLK A;  3ZBD A;  5GAN d;  3HP9 A;  4C92 C;  1VQP T;  1TG0 A;  3VU3 C;  2DL3 A;  1N6A A;  2ECZ A;  2OTL T;  1WXU A;  2JM9 A;  3OB9 A;  3OYA A;  2EIF A;  4C92 D;  4E7L A;  3OS1 A;  2RQU A;  2RH2 A;  4M7D A;  1HJD A;  3PTA A;  2RJC A;  4RG8 A;  1WI7 A;  2LQN A;  1M3B A;  1ZQ1 A;  1KFZ A;  4OMP A;  3OS2 A;  2FRW A;  4BI8 B;  4Y28 E;  3CCR A;  1N9R A;  5A0L A;  1N9S A;  5GAO l;  2QQ9 A;  4BI4 A;  2KI7 A;  3CCV T;  4AMC A;  1YWP A;  2RMO A;  4K11 A;  2DK3 A;  4HT9 A;  2YUP A;  4LDW A;  4IUU A;  1FXX A;  3UPU A;  2B86 A;  1WLP B;  4EMK B;  1KQS P;  3CCR Q;  1M1F A;  5GAN f;  2CUD A;  1YJW A;  4M7D F;  2XD0 A;  4BE1 A;  4PJO G;  1O75 A;  1KK7 A;  5GMK m;  3G1J A;  2PZ1 A;  1JO8 A;  3C95 A;  2HD0 A;  3OMG A;  4PJN A;  2CSI A;  3CCE T;  2EGE A;  3HPW A;  3VS5 A;  3G7Z A;  4JLI A;  1TXQ A;  4BAC A;  3ULR B;  1VOM A;  1YJW Q;  4C5G A;  3PFS A;  3OYB A;  4EMK C;  4OML A;  3C0C A;  4ZTJ A;  2DTO A;  1FMV A;  4XTV A;  4FL6 A;  3M0T A;  1SSF A;  1QVF S;  2EJF A;  2K9G A;  3JB9 D;  2YXY A;  2Y90 A;  3CCV A;  2DRK A;  1I5O B;  1VUB A;  1Q82 U;  2CRE A;  3CBM A;  5DLO A;  1VQ4 A;  3FJP A;  4M75 E;  1ZA2 B;  2QI2 A;  4QVZ A;  2P4T A;  3SWN A;  1BBZ A;  3A98 A;  4RCC A;  4HA8 A;  2ZGW A;  3MJX A;  5GAM h;  1JJ2 A;  1KIK A;  3CCV Q;  2LCL A;  4C5I A;  5LJ3 d;  3DKM A;  8AT1 B;  2DXT A;  5A2Q E;  4NS5 A;  1WHL A;  1VQ4 Q;  1ZSG A;  1ACM B;  2L3R A;  3X20 B;  3CCE A;  1ZUY A;  1AZG B;  2EJ9 A;  2ZAE A;  2M1H A;  1NPP A;  2GF7 A;  4LE9 A;  2G3R A;  2EPD A;  2BUD A;  2XDB A;  1GBQ A;  1M1G A;  3CCE Q;  1OUL A;  1I07 A;  1K8A C;  1NEG A;  5IT9 E;  5GMK e;  2KRO A;  1MUZ A;  2NUP A;  3NFC A;  2J6O A;  4NOY A;  4A54 A;  4OVA A;  5LJ3 f;  3OQ5 A;  2PTK A;  2CGH A;  1WIE A;  5GAN e;  1EIF A;  4KUL A;  2SRC A;  5GAM f;  4E7Z A;  5CKE A;  1PD0 A;  2FPF A;  2R5M A;  2QDL A;  2V8J A;  2BE9 B;  3L42 A;  2WSC E;  3P8D A;  2VYT A;  4J9B A;  2ZPB B;  5L23 A;  4E7H A;  4FSX A;  4M77 B;  4HVV A;  2FG0 A;  5CKH A;  2ZPI B;  4PJO B;  1VQM T;  4AFZ C;  2RI2 A;  4R56 A;  4CC7 A;  4JJN K;  1NG2 A;  1RI0 A;  1S72 A;  3V8L A;  4ELY C;  3SDZ A;  1XQH A;  1GXI E;  2MMP A;  4PJL A;  4M75 G;  1PWT A;  2RJF A;  4V2S A;  3RBB B;  2BTT A;  1ZHI A;  2RQV A;  1IB8 A;  1QW1 A;  4OMO A;  3EG9 A;  3VS0 A;  3M58 A;  3M0Q A;  4CC2 A;  1S72 Q;  3NPF A;  5M9O A;  4PJO C;  4M77 D;  1Q81 C;  1NEB A;  2CH4 W;  2EYQ A;  2LP5 A;  3M4Y A;  2DVE A;  2QGF B;  2L0A A;  3CC2 T;  4O5V A;  1VYT A;  4D8K A;  1H3H A;  1KC8 U;  1WPY A;  3H8Z A;  4RTW A;  1LCK A;  1XTD A;  2YT6 A;  4J9I A;  3VYH B;  5CKD A;  1AZE A;  3L2R A;  1W2B S;  3GNF B;  1M8V A;  4FYV B;  3T9N A;  1E6G A;  2KVQ G;  4XU3 A;  1K1Z A;  2JT4 A;  1KSW A;  1B3Q A;  4FYX B;  4DEY A;  3RKY A;  3IQL A;  1YWO A;  1AD5 A;  4JZ3 A;  3QZ5 B;  2XDP A;  2DD4 A;  3MHX A;  5DLQ E;  1OOT A;  4HCC A;  2ZCF B;  1YCS B;  3H41 A;  3OW2 S;  2DVJ A;  1BKB A;  4GBQ A;  2HKN A;  1VQ9 Q;  1Q86 U;  1M5Q 1;  3RNJ A;  2G6F X;  4AG2 C;  4HKE A;  4D8D A;  1U06 A;  1CKB A;  5CKF A;  2DJZ A;  5LJ3 e;  5J39 A;  1T3L A;  5IH2 A;  2H3E B;  1K76 A;  1M90 R;  3LX7 A;  2MIO A;  3U23 A;  2FPD A;  1ABO A;  1VQL T;  5GAM e;  2K7A A;  2GFA A;  1NBE B;  3CC2 A;  1F1B B;  4GLM A;  1ZSZ A;  1QVG S;  4JPB W;  3CCS A;  1YJN T;  4JRI A;  3EFO A;  3A8H B;  1Y7X A;  3CCU T;  4PLI A;  5CQX A;  5AT1 B;  2GQI A;  5J26 A;  3M55 A;  2CH4 A;  4J7F A;  3PT9 A;  1WXT A;  2RHY A;  3I35 A;  3JCM V;  3CC2 Q;  1W70 A;  1Q7Y C;  2F5T X;  3CCS Q;  2X3W D;  1WFW A;  3PNW C;  2K57 A;  2KEA A;  1HSQ A;  2LCS A;  3I55 A;  3MCA B;  4EIK A;  1TTH B;  5KYW B;  4M75 B;  2CZ7 B;  4X1V A;  2LNH B;  4LDU A;  3E2U A;  2KBT A;  3CMA A;  1YI2 A;  4ZGD B;  1EX4 A;  1YCY A;  2MI6 A;  2D9T A;  2LJ3 A;  4F16 A;  5I22 A;  3NTK A;  3I55 Q;  1QVF A;  3P8B B;  1QP3 A;  4OB3 B;  3O8V A;  1K9M R;  1ZBX A;  5ECA A;  3P8H A;  3MEV A;  3TCJ A;  2XIC A;  4BE2 A;  1NJI C;  4ELZ C;  2CP0 A;  8ATC B;  1D1B A;  3CMA Q;  1YI2 Q;  4M75 C;  2LDM A;  1HK9 A;  2V1Q A;  1UEC A;  1VQ8 T;  1YJN A;  2O2O A;  3A8O B;  1NE8 A;  4F14 A;  1D1C A;  1JU5 C;  2KK4 A;  5CO7 A;  1RAH B;  4YTL A;  3CCU A;  4PFP A;  1WHG A;  1LVK A;  2XK0 A;  4XAX B;  4XTU A;  4M78 A;  3M0R A;  4C8Q A;  2DAQ A;  2PU9 B;  3QWX X;  2E3I A;  1V1C A;  1Y96 B;  2MF2 A;  4OMM A;  3FRN A;  1KD1 R;  1PSE A;  3NTI A;  1AT1 B;  4HCZ A;  5I2M A;  3JCM P;  4EMG A;  4IUT A;  3CPW S;  1G3W A;  4IUR A;  9ATC B;  5D6X A;  3CC7 T;  4RG2 A;  3WVE B;  2QK0 A;  3JV3 A;  5HCK A;  3FDR A;  2BZX A;  1IZ6 A;  3C94 A;  2RB6 A;  3RKW A;  3S3N A;  4M78 F;  2ED1 A;  3S3O A;  3GF5 A;  4C8Q F;  1MND A;  2P0Q A;  3CCQ T;  2P0P A;  5GAM g;  2HEQ A;  2RJE A;  2F5K A;  1PKT A;  2ED0 A;  1RAG B;  1OPK A;  1VYU A;  1E6H A;  3THK A;  1TOV A;  2DEQ A;  3VS3 A;  3JCM b;  4DOV A;  2WSE E;  4M7D E;  3KUF A;  1AWO A;  3FB9 A;  3VS2 A;  2E10 A;  1ZSZ C;  2HBP A;  3PGG A;  4BDZ A;  1OZ2 A;  1QCF A;  4DBQ A;  4UC4 A;  1YIT T;  2CUB A;  2GBQ A;  4BDY A;  3OYH A;  2QAS A;  2KY9 A;  3VV0 A;  3EHR A;  1X2Q A;  3SFM A;  5GMK j;  1UGV A;  2O9V A;  3KBG A;  1I1J A;  2DTI A;  3BE3 A;  1AWX A;  2HQE A;  2DKG A;  3GPL A;  2RF0 A;  5GAN j;  2BZ8 A;  5LJ5 d;  1C6V X;  2DIQ A;  1HYO A;  3R6O A;  5HY6 A;  3TU4 K;  1PRM C;  2VC8 A;  4N0A A;  2GFU A;  1VQO A;  2YDL A;  2PVO B;  3EG2 A;  1K8A U;  5GAN 4;  3L2W A;  4LDX A;  1NYF A;  2VGN A;  1VA7 A;  2HSP A;  3CXC P;  3MP1 A;  1KQ2 A;  3LGL A;  1VQO Q;  3HRT A;  3OYM A;  2O88 A;  1YFN A;  1FYN A;  5GJV B;  4J9C A;  1M2V B;  2BKD N;  1W2B A;  2D0Q B;  2J6K A;  1VQ7 A;  2YRD A;  4XU0 A;  5LJ5 f;  5GAO m;  5GMK h;  2JTE A;  2MAM A;  2D8J A;  4QKU A;  1G83 A;  4A4H A;  1YJW T;  4BY6 B;  4EMH A;  4OF1 A;  1YP5 A;  1R0C B;  3M59 A;  3SB2 A;  1QMC A;  2EBP A;  2HZY A;  1RAI B;  3QBY A;  3EG3 A;  5GAN h;  2E3H A;  2R58 A;  5FRO A;  2JM8 A;  1PRL C;  2VV5 A;  1VQ7 Q;  5CQY A;  3ME9 A;  2OI3 A;  4M7D G;  3FC3 A;  1W1F A;  1Q81 R;  2ABL A;  1RAD B;  3LW5 E;  3OBY A;  2H8H A;  4ME7 A;  3I56 Q;  1T0J A;  4BY6 C;  4QW2 A;  1Q81 U;  2RHX A;  2YRV A;  1NYG A;  1U1S A;  2A36 A;  1D0Y A;  3GOX A;  1M27 C;  1M9S A;  1QVG A;  2HAX A;  4BE0 A;  3VS4 A;  4QVD A;  2CP5 A;  3EGX B;  3PMI A;  3M0S A;  3E9F A;  4XK8 E;  1KHI A;  3X26 B;  1VQ4 T;  4MZT A;  3JB9 J;  5KYY A;  3E9G A;  3VKI A;  1X27 A;  3OSS C;  1UHC A;  2DA9 A;  5KCO A;  5LJ3 j;  3S6W A;  1SF9 A;  1OZ3 A;  3D7S B;  1SRL A;  5KE2 A;  4PFO A;  5DM7 R;  1JXM A;  3CPF A;  2BZY A;  3UF4 A;  4DQ2 A;  3H0F A;  2A7Y A;  2X4W A;  5GAM j;  4RTT A;  3NMZ C;  5D6Y A;  2CP7 A;  2EKO A;  5GJW B;  3UWN A;  1QWF A;  2JVV A;  5CKB A;  4J9H A;  4E2F B;  2CYZ B;  2H3J A;  3MPU B;  3CBO A;  2DL5 A;  4PLL A;  4KRT A;  1BK2 A;  1Z9Z A;  4FSS A;  3TRE A;  2KGT A;  1O9S A;  2C0I A;  2KAF A;  2I0N A;  1SRM A;  1Q82 R;  1FMK A;  2COY A;  3G71 T;  4N0A C;  4RCB A;  3PIP A;  2CZ0 B;  2Z0W A;  1K0S A;  3JCM d;  1BCM A;  1BCO A;  2SEM A;  4CC3 A;  1VQ5 A;  1B07 A;  3UA6 A;  2QG9 B;  2NUT A;  2OX7 A;  5LJ5 e;  2LQW A;  1OV3 A;  2VVK A;  5I21 A;  3LWH A;  5LJ3 h;  4R0K A;  2FHD A;  2DLP A;  1E7O A;  3OS0 A;  3JRZ A;  3V7C A;  4HT8 A;  3CPW A;  1VQ5 Q;  3X24 B;  3QYH B;  1K73 C;  1QLY A;  3QXE B;  1N27 A;  1GCP A;  3JCM W;  2R57 A;  3S3M A;  1S72 T;  4E47 A;  1UTI A;  1UGQ B;  5GAN 6;  3PIO A;  1D0X A;  4M7D B;  1AHJ B;  4C0G A;  4X34 A;  2A28 A;  4MDX A;  1MMN A;  3EAE A;  3CCM T;  1BYM A;  3JCM c;  2VAS A;  3TSW A;  3RER A;  2NLU A;  4BUG A;  3REB B;  1TS9 A;  2HQX A;  3OYF A;  4C0F A;  2BIV A;  2ZPE B;  4CI0 C;  1KQS S;  1BI1 A;  3NGP A;  2OTJ Q;  4P5N A;  3E19 A;  3G71 A;  4KUD K;  1RL2 A;  4J9G A;  1OU9 A;  2DF6 A;  3J80 E;  2XU8 A;  1NJI U;  4MZM A;  2K5L A;  4CC4 B;  4M7D C;  2HQH A;  3M57 A;  1VQK A;  2Y4X A;  4WCI A;  1WA7 A;  3HKS A;  1W2B P;  4M7D D;  1PNJ A;  2L3S A;  1ARK A;  4TVR A;  5FU6 B;  2EYW A;  1H3Z A;  3G71 Q;  2GCX A;  5GAN 8;  1TUC A;  1I5L A;  1UHF A;  1VQK Q;  3OYK A;  1WHH A;  1WQ7 A;  2JW4 A;  2COW A;  3VS7 A;  1JB0 E;  3QHS A;  1VQ9 T;  1ZUU A;  1BIB A;  1B7T A;  1N8R C;  5FU6 C;  2DPP B;  3CCM A;  3TQ7 P;  1RI9 A;  4XQ3 A;  5A0D A;  4OB0 B;  3DLM A;  2NUT B;  2I2L A;  3M0U A;  5EG2 A;  3NTH A;  3OA6 A;  1G3S A;  3EH1 A;  2RK2 A;  4N4G A;  4PJO D;  4J83 A;  1KC8 R;  4Z89 A;  1HD3 A;  5C0M A;  3RMS A;  2OAU A;  3CCM Q;  5FWC A;  3HSB A;  3EFS A;  4J6W A;  3SWN B; 
#chains in the Genus database with same CATH homology
 1X6B A;  3UA7 A;  2A08 A;  2KR3 A;  2V1Q A;  1UEC A;  1TUD A;  2O2O A;  2OJ2 A;  4M4Z A;  2CSQ A;  4F14 A;  2V1R A;  2J7I A;  2DX1 A;  1QWE A;  2F2X A;  2OAW A;  1JU5 C;  1UDL A;  1CKA A;  2RN8 A;  2KXC A;  2HBW A;  2KT8 A;  1X6G A;  1UUE A;  3M0R A;  1MV3 A;  2D8H A;  4HXJ A;  3REA B;  3QWX X;  4AG1 C;  5FW9 A;  1V1C A;  1SEM A;  2YUO A;  3CQT A;  4OMM A;  1AEY A;  2L3Q A;  2AZS A;  3R6N A;  1AOJ A;  2HCK A;  4A63 B;  2LMJ A;  1Z9Q A;  1U3O A;  5I11 A;  3JV3 A;  1ZX6 A;  5HCK A;  3PVL A;  2C0O A;  4JZ4 A;  4RTV A;  4J9E A;  1Y0M A;  2BZX A;  4RUG A;  1GFD A;  1I0C A;  5FWB A;  1ABQ A;  2KXD A;  3GBQ A;  1GBR A;  1SSH A;  4IIO A;  2KNB B;  2KRS A;  3VRZ A;  1SPK A;  1TG0 A;  2ED1 A;  2DMO A;  2DL3 A;  2ECZ A;  1WXU A;  2EW3 A;  2JM9 A;  2DBM A;  3QWY A;  4AFS C;  2RQU A;  5IHK A;  2HEQ A;  3VS6 A;  4HCK A;  1HJD A;  1JEG A;  1BB9 A;  1WI7 A;  1PKT A;  2ED0 A;  2LQN A;  1M3B A;  1OPK A;  4HVU A;  1VYU A;  1KFZ A;  1E6H A;  1K0X A;  2HDA A;  4OMP A;  3THK A;  2K6D A;  3PE0 A;  1M30 A;  2GGR A;  3EGU A;  1AWJ A;  2FRW A;  3ZL7 C;  2CDT A;  3VS3 A;  2JMC A;  4RTU A;  2JXB A;  2L3P A;  4F17 A;  1AWO A;  2F2V A;  2RNA A;  1YWP A;  2RMO A;  2A37 A;  4K11 A;  4OMN A;  3VS2 A;  2GTO A;  1EFN A;  1BU1 A;  2YUP A;  1QCF A;  2B86 A;  4E6R A;  1GFC A;  1WLP B;  1X69 A;  2LX7 A;  2CUB A;  2GBQ A;  1OEB A;  2CUD A;  3EHR A;  1X2Q A;  1UGV A;  2O9V A;  1UE9 A;  1I1J A;  3I9Q A;  1H92 A;  2JMA A;  1AWX A;  2PZ1 A;  1JO8 A;  2IIM A;  2RF0 A;  1GCQ A;  2BZ8 A;  2CSI A;  1Y57 A;  3VS1 A;  2EGE A;  1M3A A;  1OPL A;  3VS5 A;  2PNI A;  2F2W A;  2FO0 A;  1CSK A;  2CT4 A;  1KJW A;  2DL4 A;  3ULR B;  1PRM C;  2DRM A;  2RQT A;  2FRY A;  1M8M A;  1U5S A;  4OML A;  2YDL A;  3C0C A;  3EG2 A;  4HVW A;  4JJB A;  1AVZ C;  2E5K A;  3NHN A;  2KT1 A;  2KRM A;  1GRI A;  3I5S A;  2GNC A;  1NYF A;  3M0T A;  2AK5 A;  2DYB A;  2RPN A;  1VA7 A;  2HSP A;  3H0H A;  2K9G A;  1UFF A;  1T3S A;  1VYV A;  2O88 A;  1FYN A;  5GJV B;  2DRK A;  4J9C A;  2ESW A;  1K4U S;  2CRE A;  2J6K A;  1A0N B;  1NLP C;  2NWM A;  1JXO A;  2JTE A;  2D8J A;  4RTZ A;  1G83 A;  2P4R A;  4RTY A;  2KRN A;  1BBZ A;  1RLQ C;  3A98 A;  4Z8A A;  1YP5 A;  2DIL A;  1XOV A;  2EBP A;  1KIK A;  2M51 A;  3EG3 A;  1YN8 A;  2JM8 A;  1PRL C;  3H0I A;  5EC7 A;  2OI3 A;  1ZSG A;  1W6X A;  1ZUY A;  1W1F A;  1AZG B;  2ABL A;  2D0N A;  2RQW A;  3FJ5 A;  1T0H A;  2H8H A;  3I5R A;  3VRY A;  4LE9 A;  2EYX A;  1T0J A;  2DL8 A;  4RTX A;  2EPD A;  2K2M A;  2YUN A;  3EHQ A;  1GBQ A;  1UJY A;  2X3X D;  2C0T A;  5IHN A;  1NYG A;  2A36 A;  4JJC A;  1M27 C;  4AFQ C;  1I07 A;  2DM1 A;  1NEG A;  3LH5 A;  1NM7 A;  3VS4 A;  2KRO A;  1MUZ A;  1M3C A;  2J6O A;  3M0S A;  2ROL A;  2PTK A;  1PHT A;  1SHG A;  1WIE A;  2SRC A;  2CT3 A;  1X2K A;  3TSZ A;  2FPF A;  4QT7 A;  2QDL A;  1X27 A;  3KFV A;  1UHC A;  2DE0 X;  4J9B A;  2DA9 A;  2DBK A;  5L23 A;  1SRL A;  4HVV A;  2FG0 A;  1JXM A;  2NUZ A;  2BZY A;  3UF4 A;  3H0F A;  1S1N A;  2EGC A;  4RTT A;  1YNZ A;  3NMZ C;  4AFZ C;  4CC7 A;  1NG2 A;  2J05 A;  2MCN A;  1UJ0 A;  5GJW B;  2LJ0 A;  2EGA A;  1NLO C;  1QWF A;  4J9H A;  4J9F A;  2KYB A;  3M0P A;  1PWT A;  2DL5 A;  3RBB B;  4KRT A;  4ZNX A;  1IO6 A;  2BTT A;  2RQV A;  1BK2 A;  1Z9Z A;  4FSS A;  1GCQ C;  4OMO A;  2EQI A;  3VS0 A;  3M0Q A;  2KGT A;  4CC2 A;  3UAT A;  2C0I A;  3NPF A;  2I0N A;  1SRM A;  1FMK A;  2EKH A;  1G2B A;  2ENM A;  1NEB A;  2FEI A;  4Z88 A;  2CH4 W;  1K0S A;  2LP5 A;  2SEM A;  3O5Z A;  4CC3 A;  1B07 A;  2W0Z A;  3UA6 A;  1X43 A;  2J06 A;  4LNP A;  2LQW A;  2L0A A;  1OV3 A;  2VVK A;  2AKK A;  2JS2 A;  2J6F A;  1VYT A;  2KE9 A;  1K9A A;  1QKW A;  4D8K A;  1H3H A;  2O9S A;  1ZLM A;  4RTW A;  1LCK A;  4R0K A;  2YT6 A;  2DLP A;  2O31 A;  1E7O A;  4J9I A;  1AZE A;  2DL7 A;  1QLY A;  1GCP A;  4AFU C;  5IHI A;  1GL5 A;  1E6G A;  1K1Z A;  2JT4 A;  1KSW A;  3EG1 A;  1B3Q A;  1UTI A;  1JQQ A;  4DEY A;  2AKL A;  3IQL A;  1YWO A;  1AD5 A;  4JZ3 A;  1ZUK A;  3TVT A;  2A28 A;  2EYY A;  2EVR A;  3TSW A;  2W10 A;  1OOT A;  3REB B;  1YCS B;  3H41 A;  1RLP C;  2DVJ A;  2M0Y A;  4ORZ A;  4GBQ A;  2YUQ A;  1ZBJ A;  3NGP A;  3RNJ A;  2G6F X;  4AG2 C;  2YSQ A;  1SHF A;  4D8D A;  1U06 A;  1CKB A;  2EYZ A;  4J9G A;  4JJD A;  2DF6 A;  2LZ6 B;  1T3L A;  5IH2 A;  1K76 A;  4CC4 B;  2DNU A;  2MIO A;  4J9D A;  3U23 A;  2FPD A;  4WCI A;  1ABO A;  1WA7 A;  2AZV A;  2VKN A;  3SHW A;  2K7A A;  1PNJ A;  2L3S A;  2XMF A;  4GLM A;  1ARK A;  4JPB W;  2LJ1 A;  2EYW A;  2RQR A;  2MOX A;  1TUC A;  1H8K A;  3PVQ A;  2GQI A;  1UHF A;  4LUD A;  2CH4 A;  4ESR A;  2JW4 A;  4IIM A;  3SEM A;  1WXT A;  3I35 A;  3VS7 A;  5IXF A;  1WXB A;  1W70 A;  2X3W D;  1ZUU A;  1WFW A;  4DEX A;  1RUW A;  2K79 A;  2KEA A;  1N5Z A;  1HSQ A;  2LCS A;  4OMQ A;  2K3B A;  4LUE A;  4EIK A;  2D1X A;  2ROT A;  1RI9 A;  4X1V A;  5IXB A;  2FPE A;  2JS0 A;  2LNH B;  4LN2 A;  1MV0 B;  2L2P A;  2DJQ A;  2KBT A;  2GTJ A;  1J3T A;  1WDX A;  3EG0 A;  3M0U A;  5I22 A;  2VWF A;  2LJ3 A;  4F16 A;  1PKS A;  4Z89 A;  1HD3 A;  1WYX A;  4Y92 A;  1WX6 A;  5FWC A;  1UG1 A;  1QKX A;  5ECA A;  2KYM A;  1AWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...