2SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SEX MUSCLE ABNORMAL PROTEIN 5)
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2semA00
3ZL7C 1BBZA 3GBQA 2FG0A 2CH4A 3JV3A 2VKNA 2FPEA 4J9EA 1GFCA 2KNBB 2LJ1A 1UGVA 2RQUA 3EG1A 2K6DA 3O5ZA 1RLPC 5L23A 2LZ6B 1GCPA 4OMOA 3EHRA 1T0JA 2J05A 4R0KA 1PWTA 2KYMA 1WXUA 2DM1A 2RF0A 2O9VA 1AZGB 5IH2A 1VYUA 2CSQA 1AOJA 4J9CA 4RTWA 5I11A 2JT4A 2L3PA 3TVTA 3PVLA 5EC7A 2AKLA 1ZUKA 2DVJA 1W70A 2FO0A 4LUEA 2D8HA 3SHWA 2IIMA 2RN8A 4HVWA 4Z89A 2GNCA 2L0AA 1KSWA 1YWPA 2ROLA 2RPNA 4OMNA 4HXJA 3M0RA 1ZUUA 4RTVA 2JMCA 2LCSA 1VA7A 4D8DA 1NG2A 4RTZA 3TSZA 3A98A 2LJ3A 4HVUA 1UFFA 4CC7A 1ARKA 2RQWA 3EG3A 2LX7A 2J7IA 2OJ2A 4QT7A 1H3HA 2GTOA 1A0NB 1YWOA 2CUBA 2PNIA 1K0SA 3VS5A 1ZUYA 2DX1A 3C0CA 1WFWA 4EIKA 2LQWA 3SEMA 3UATA 2DL7A 1PRLC 1GRIA 2PZ1A 1ZX6A 1QWEA 2SEMA 3KFVA 1I07A 1WA7A 2KE9A 3TSWA 1ABQA 2KEAA 2L3SA 3UA6A 2ENMA 1AWWA 5IHNA 2GTJA 1JQQA 4GBQA 1PRMC 1SPKA 4D8KA 2FEIA 2CSIA 1K4US 2EYYA 1OPLA 3EG0A 2GBQA 5IXFA 1X2KA 4RUGA 2DILA 2C0OA 1Y57A 4AFUC 2KRNA 4ESRA 1AWJA 2F2XA 2AK5A 2KGTA 1B3QA 2NUZA 1B07A 1HSQA 2P4RA 3M0UA 4AG2C 2B86A 2JS2A 1KJWA 2BTTA 1E6HA 2GGRA 1NYGA 1AD5A 2O2OA 2DL8A 2EW3A 2JS0A 1X2QA 1PKTA 1AWOA 1WXBA 2KBTA 2W10A 4LNPA 2DA9A 4X1VA 4CC4B 1VYVA 2L3QA 3NHNA 3CQTA 2CH4W 1YP5A 1K1ZA 1JXOA 1U3OA 2F2WA 4OMQA 4F14A 1WDXA 3REBB 2EYZA 1SSHA 3ULRB 2J6OA 4DEYA 1XOVA 1YN8A 1BU1A 2O31A 2CUDA 2OI3A 3IQLA 3H0IA 2MCNA 1QWFA 2D8JA 1AWXA 2K9GA 2YSQA 1YNZA 4FSSA 1UUEA 1UTIA 3VS3A 1WYXA 1EFNA 1K9AA 2W0ZA 1SEMA 2EPDA 2EKHA 4RTTA 1GBRA 1T3LA 3UF4A 3H0FA 4Z8AA 2K7AA 1KFZA 1BK2A 1UJYA 2RQRA 1W1FA 1RUWA 1X43A 3EGUA 3LH5A 1UHFA 1RLQC 1AVZC 2CREA 1Z9ZA 2EGAA 3VS2A 1MV3A 1RI9A 3I9QA 2JXBA 5FWBA 1GBQA 2RQVA 3VS7A 1PNJA 1WLPB 1OOTA 1GCQA 1TUCA 2DL5A 1MV0B 3NGPA 4J9GA 4IIOA 4OMPA 1AEYA 1PHTA 2RQTA 1M3AA 2SRCA 1E6GA 1KIKA 3PVQA 2JM8A 1Y0MA 2CT3A 4AFSC 2EQIA 2KT8A 2M0YA 1GL5A 2FPFA 1X69A 1JXMA 2DE0X 3UA7A 2ED0A 5HCKA 3VS1A 1OPKA 3H41A 5IXBA 4JJCA 1QKWA 1BB9A 2CT4A 1X6GA 4OMMA 3VRZA 2JMAA 1LCKA 2DBKA 2LJ0A 2ROTA 1Z9QA 4JZ4A 4DEXA 1J3TA 2A37A 2KROA 2DMOA 2A36A 1W6XA 2EYXA 2DRMA 2KRSA 1VYTA 4HCKA 1H8KA 2EBPA 1QCFA 4ZNXA 2O88A 1TUDA 2X3WD 2LQNA 2MOXA 1WIEA 4RTUA 5I22A 4LUDA 3M0TA 1JO8A 2F2VA 1CSKA 2V1RA 2ECZA 3NMZC 1X6BA 2YUOA 2DLPA 1TG0A 2QDLA 1UECA 1NM7A 2EYWA 2M51A 4IIMA 1IO6A 2O9SA 1SRLA 1G83A 2V1QA 4KRTA 2KXDA 2D0NA 1M30A 1CKBA 2J6FA 1HD3A 2PTKA 3THKA 2MIOA 4RTYA 3FJ5A 3PE0A 2FPDA 2J06A 2BZYA 5ECAA 2OAWA 2JW4A 4M4ZA 5FWCA 1JEGA 1K0XA 3VS6A 1WI7A 2KRMA 2VWFA 2FRYA 4CC3A 1OEBA 2KYBA 2C0IA 2DBMA 1OV3A 5FW9A 2JTEA 4Y92A 2FRWA 1UDLA 2ED1A 2YUNA 3H0HA 1U06A 2YUPA 2XMFA 2K79A 3EG2A 2RNAA 1SHFA 3M0QA 1X27A 2YUQA 5IHKA 2LMJA 1FYNA 1QLYA 2VVKA 2LP5A 3VRYA 1N5ZA 2J6KA 1GFDA 2L2PA 3I5SA 2EGEA 4HVVA 2YT6A 4JJDA 1M27C 5GJVB 2A08A 1UJ0A 2DRKA 2X3XD 2AZSA 1UHCA 4J9HA 1GCQC 1UE9A 1NYFA 5IHIA 2JM9A 4JJBA 2DYBA 1NEGA 1M3BA 4RTXA 4LN2A 3R6NA 2DL4A 4JPBW 1MUZA 2KXCA 3REAB 2HEQA 4K11A 4JZ3A 1ABOA 2DF6A 4A63B 1NLOC 1I0CA 2HSPA 2DL3A 1I1JA 4J9BA 4Z88A 3VS0A 2H8HA 2KR3A 2LNHB 4CC2A 2E5KA 1SRMA 2BZXA 1S1NA 3NPFA 2C0TA 3EHQA 2HBWA 4J9FA 3RNJA 3RBBB 2HDAA 3I5RA 1AZEA 4WCIA 3I35A 4J9IA 2NWMA 1T0HA 2G6FX 2D1XA 3M0SA 4J9DA 4AFQC 2KT1A 1HJDA 2YDLA 1YCSB 1WXTA 1NLPC 1U5SA 4E6RA 1JU5C 2EVRA 2A28A 1V1CA 1QKXA 2K2MA 3QWXX 2RMOA 3U23A 2I0NA 4AG1C 1ZSGA 1M3CA 2AZVA 1T3SA 1ZLMA 2ABLA 1NEBA 1ZBJA 2ESWA 1SHGA 3M0PA 2HCKA 1G2BA 4AFZC 2CDTA 2EGCA 4LE9A 2K3BA 1FMKA 4ORZA 1K76A 1PKSA 3QWYA 1M8MA 1UG1A 2DNUA 2AKKA 2BZ8A 4F16A 1CKAA 2DJQA 2GQIA 4OMLA 3VS4A 1WX6A 4GLMA 1H92A 5GJWB 1E7OA 4F17A
chains in the Genus database with same CATH superfamily
3ZL7C 2CH4A 3HP9A 1OULA 2VKNA 3JAME 1GFCA 4PJOC 4PFPA 4F7UE 1RLPC 4Z02A 5A2QE 5GAMj 3HSBA 1T0JA 3H6ZA 2J05A 3OBWA 2P4TA 1WXUA 2O9VA 2MPXC 5KYUA 1VYUA 2CP2A 1AOJA 4PFZA 5I11A 2L3PA 2CP3A 3PVLA 1ZUKA 3A8GB 2D8HA 3SHWA 4HVWA 1FMWA 4KULA 3V8LA 1QVGS 2RM4A 2LCSA 5CIUA 4D8DA 4C5HA 4X34A 3MHXA 3URGA 2NUPB 2XIDA 3A98A 2LJ3A 2QI2A 1LVKA 4HVUA 3CPFA 2DTOA 1FMVA 4HT9A 2ZGWA 1PSFA 1D3BA 2QAZA 4LDWA 5GAMg 1I4K1 1X75C 4XTVA 2E3IA 5CCAA 5GAMd 2GTOA 4E7ZA 1YWOA 1R0CB 1K0SA 3VS5A 4PJOB 3C0CA 4L59A 5GAN8 2HQEA 1VQ9T 3OW2S 3J7AF 3H9NA 1ZX6A 1G3TA 1M1KR 1LNXA 1QWEA 3CC2Q 3JRZA 4PLLA 2M16A 5KCOA 2KK4A 3M55A 1RACB 2EJGA 4EMKB 1AWWA 1TH7A 1B7TA 4GBQA 4IKFA 1D1BA 4QQDA 2FEIA 2EYYA 2X51A 4N0AC 2GBQA 2PU9B 3MPUB 3CCSA 4BDZA 3S6WA 1X2KA 2DEQA 1QVFS 3JB9D 4AFUC 1KHIA 3UWNA 2JZ2A 1WHJA 2AK5A 3CCVA 2KGTA 3JCMQ 3PMIA 3M0UA 1VQ5T 2B86A 1KJWA 2JNGA 2BTTA 1AD5A 5FU7B 1LOJA 3KBGA 4BE2A 3SWNB 2DL8A 3PIOA 3CCUA 1X2QA 1ZBXA 1PKTA 1VQNQ 2W10A 2E6NA 4LNPA 1YIJQ 2ZZDA 4X1VA 2DKGA 2L3QA 3OW2P 1KD1U 3CC7T 1YJNQ 1YP5A 2F2WA 4F14A 2D9TA 1Y96A 4M7AD 5KYWB 3QYHB 3M9QA 1QP3A 1VQ8Q 3QJYA 2LDMA 3MP6A 3VYHB 4DBFA 2G3RA 2MCNA 3ZFJA 1WGSA 4C8QC 1VQ6Q 1AWXA 4M77C 2EAYA 3SD4A 1YNZA 4FSSA 1UUEA 1WYXA 1GBRA 1MMDA 3HKSA 3L2WA 3E1SA 1YJ9A 5KH6A 4Z8AA 4E7LA 3D7SB 5D6WA 2LNVA 1W4SA 1M90U 1KFZA 1BK2A 1X43A 3EGUA 1NE8A 2H3EB 3CCJQ 2R5AA 3QYGB 4VUBA 2RHXA 2QEXQ 4ELZC 4PNOA 5FWBA 3JB9I 4XTUA 3VS7A 1B34B 2X4YA 1U1TA 1OOTA 2RK2A 2JUFA 3OYGA 5KCHA 2K3YA 1K9MC 2DL5A 3NGPA 3LLRA 1TU0B 5CQYA 4FYYB 5FRNA 4Q5WA 1AHJB 3OS5A 4AFSC 3M54A 3J80E 4PK4A 2LT1A 3M4YA 4FT4A 2KT8A 1OX8A 9ATCB 3FRNA 1X69A 4JS5A 4PJOG 5DM7R 5LJ3e 1JXMA 3CBOA 4M75D 1EIFA 2ED0A 2E6ZA 1M90R 4P5NA 1QKWA 1VQ7T 3M58A 1X6GA 5CAIA 3RR6A 4M7AB 3HRUA 2JMAA 4C8QF 5GAOl 4M77F 1Z9QA 3DLMA 1PSEA 5GMKh 4JJNK 4NL3A 2DMOA 1VYTA 3E2UA 1Q82U 4M78B 1JRIA 3HRSA 2Y4YA 3QZ5B 1WIEA 2HQHA 4LUDA 2LRQA 4MDWA 2DERA 2F2VA 4OB1B 4JDSA 3X20B 2V1RA 2QQSA 3NMZC 4C92D 1VOMA 1IHVA 4PL6A 3CC2A 4M7AE 3HTRA 5DLQE 2DYIA 2KXDA 1PM3A 2J6FA 4E7SA 3OYNA 2MIOA 4BY6B 1WZOA 2R57A 1VQ9A 2FPDA 2BZYA 5ECAA 2OAWA 4JRPA 1JEGA 4M4ZA 5FWCA 3EFOB 3OSVA 2KRMA 4ZN1A 4FYWB 3EGXA 4CC3A 1MMNA 3JCMW 3EG9A 4WF2A 3CCLQ 1OV3A 2JTEA 4J6WA 7AT1B 1UDLA 2YUNA 2YUPA 2XI9A 2K79A 2RHIA 1SHFA 4KT0E 4OGEA 3J81E 3M0QA 1FYNA 1QLYA 1KK7A 5LJ5e 1VQNA 2J6KA 2L2PA 3I5SA 5LJ3g 4HVVA 2YT6A 1M27C 4IURA 1VQ5A 4DBRA 1YJNA 5GJVB 3OY9A 2HL5C 5LJ3d 2FZGB 3KXTA 4J7IA 4JJBA 3L2VA 1VQ8A 2DVEA 1Q86R 1VQKQ 3H8ZA 4ZTJA 4JPBW 1MUZA 2KXCA 2HEQA 4K11A 1ABOA 2H3JA 2M0OA 2YHTA 2HAXA 3CC7A 4ZGJB 1VQ6A 3CD6Q 3PMTA 1VQMT 4JRIA 4A63B 3VUZA 3M59A 2DL3A 5KYUB 1KC8R 1BI1A 2NLUA 4Z88A 1WQ7A 2H8HA 3CCET 4M75E 1U1SA 4C92B 1SRMA 3G6EQ 3NPFA 3ER0A 1VIFA 3MEVA 4J9FA 4PFOA 1M2OA 5GANe 2B8AA 2PVGB 2XHCA 4BB7A 4WCIA 4ATOA 1KD1C 4O5VA 1Q95G 2OTLT 4NOYA 2NWMA 1Q81R 3HPWA 4J9DA 4C8QG 4Y91A 1QP2A 1WXTA 2EVRA 3CEYA 1QKXA 2K2MA 2RMOA 2I0NA 2FZKB 1ZSGA 4AG1C 1MNEA 1M3CA 2AZVA 2IG0A 3EH2A 2XD0A 4C92E 1M8VA 4LD6A 4DBQA 2RJFA 1V76A 3OYLA 4IUTA 1FX7A 1D1AA 2KMTA 4M78G 2DXTA 2PUKB 2K3BA 1Y07A 2DD4A 4ELYC 1M90C 4KH0B 4A54A 1N8RU 3OYEA 1GXIE 3QXEB 1IREB 1NPPA 2D0QB 3VS4A 2GQIA 5GANj 3AHUA 3CCQQ 2P0KA 4GLMA 5GJWB 5A0DA 5LJ5g 2CYZB 2FZCB 4CRIA 5C0MA 2FG0A 3MCAB 2FPEA 4J9EA 1K8AU 1TWBA 4TVRA 3EG1A 2KI7A 2M02A 5L23A 3JCMe 2LZ6B 2V26A 4C0FA 3SFMA 2KYMA 4IUQA 3L1AA 2L5QA 4AMCA 5KE2A 2JT4A 4KUDK 5EC7A 3MJXA 2AHJB 2AKLA 3A5ZB 2RPNA 2ROLA 5GMKi 1KHCA 4XU0A 1TXQA 3M0RA 2JMCA 2COZA 1QQJA 1WHHA 5GANg 1K73U 4M7DF 1ZSZA 2DFUA 3SDZA 1NG2A 5GAN3 3TSZA 1MHNA 5GANd 3OW2A 1QMCA 2O4XA 4FYXB 1RAIB 3P8BB 4X9CA 3C94A 3I56Q 2E10A 1H3HA 4PJLA 3PIPA 1Q82C 2YRCA 1ZUYA 4HCBA 3CBPA 3HHTB 3CCUQ 1TOVA 2QGFB 4UC4A 1PCXA 2KAFA 2PZ1A 3G71T 4E7KA 3FDRA 3TSWA 2KEAA 4JLGA 3AT1B 3UA6A 4QVCA 4ME7A 3OYFA 1K4US 5CKFA 2DAQA 4OB2B 5IXFA 2GF7A 1VQKA 3JCMg 2HL3A 1Y57A 1ACMB 1OQKA 2XDBA 4JRQA 4PJOD 3JCMd 3CD6A 2NUZA 1HSQA 2JTFA 2XDDA 2K4YA 1VQ4T 2KQWA 4EMGA 2EJFA 1BI0A 2DO3A 2GCXA 3G6EA 3CPWA 2PQWA 2KBTA 1VYVA 1VQMA 3NHNA 3CQTA 2CH4W 2E12A 4M75A 1JXOA 3REBB 2EYZA 1YJWT 3L2UA 2J6OA 3CCEA 4XU3A 2K5FA 1YN8A 2MI6A 1BU1A 2CUDA 2OI3A 3IQLA 3H0IA 4V2SA 1S72T 4PJNA 3KUFA 1M1KU 4HA8A 2QG9B 2ZPFB 2OTLA 1VQPT 1D09B 3VS3A 2MMPA 2EPDA 2EKHA 2F1LA 5GAMf 3UF4A 4XU1A 1RADB 3GIBA 1W1FA 2K3XA 2RI3A 1UHFA 2ZAEA 5LL6S 2RJCA 4C0DB 3CCQA 2VXFA 5GAN6 2EGAA 3VS2A 1MV3A 3VU3C 2XDPA 4MMKA 4HCZA 1PNJA 1WLPB 2FYKA 2K2VA 1MV0B 4J9GA 4JRKA 4IIOA 1NPRA 1AEYA 2RQTA 1M1GA 4NS5A 4KUIA 3QIIA 4A4KA 2MAMA 3M56A 2QYZA 2BE7D 2CT3A 3L2ZA 3META 3TU4K 1AT1B 1GL5A 1YBYA 1N8RC 2CP5A 3T9NA 2DE0X 2COYA 4ZTFA 3VS1A 2ZPHB 1IXDA 1VQ9Q 3MP8A 4JJCA 4FU6A 2AIRB 1IRXA 5KYYB 1BB9A 2CT4A 1BYMA 2LC4A 3VRZA 1K8AC 2FB7A 1LCKA 2HNIA 3E19A 2EIFA 3FIFA 2ROTA 3GPLA 1Y7XA 4DEXA 4PJOE 1UB4A 2QQAA 3PNWC 2WSCE 1W6XA 3EGDB 4PKCC 2DRMA 3I56A 4ZN3A 2EQUA 4HCKA 4M7DA 5IT9E 2EBPA 1VQOT 4AT1B 2LQNA 3A8LB 4J6YA 3LYIA 3OB9A 1G3SA 4L6V5 5DLOA 4J8OA 5LJ5h 2E64A 4FT2A 3P8HA 2ECZA 2YLCA 4C8QD 1X6BA 2YUOA 5J39A 1YITT 2O01E 3QUIA 3JSCA 1VQ5Q 2QDLA 3M4GA 5CVIA 1UECA 2M51A 2EYWA 4IIMA 4YTLA 1RI0A 2O9SA 3CCRT 2V1QA 2X35A 1I5OB 3BY7A 4KRTA 4LXCA 5GAN2 3LWHA 2D0NA 2LQKA 1K73C 4JLIA 3I55T 3THKA 2KDSA 2CP7A 3PE0A 1YI2T 2E65A 1M5Q1 1R8OB 3CPWS 2E4HA 3O8VA 2X4XA 3CC7Q 3JB9J 2VXEA 3NTKA 2E70A 3OYDA 3JCMX 2K5LA 3OYYA 2R58A 4M78D 4HT8A 3M5AA 2CP6A 2FRYA 3BE3A 2KYBA 4N4HA 4BI4A 3CMET 3CC4T 3MEWA 3HL8A 2ED1A 1ZSZC 1U06A 2C06A 2RJDA 2RHZA 3VV0A 1W2BP 1X27A 2NUTB 3GP8A 4XTYA 3WVDB 2DK3A 3G7ZA 1GFDA 3INZA 1KQSP 1XQHA 1NJIR 2DRKA 4BDYA 6AT1B 1UE9A 3OA6A 4DQ2A 3UT1A 2AT1B 2CKKA 2RHYA 1M3BA 4RTXA 4LN2A 3CXCP 1IB8A 4N4IA 1RL2A 1M9SA 1QW1A 2DIQA 3LH0A 4F7UA 2Y4XA 4HKEA 3CPWP 3JCMc 1R77A 1D1CA 2HSPA 3QO3A 4KBMB 1YJWA 1I1JA 2QA4T 5KYXB 1G8XA 3QZ9B 4C8QB 4CC2A 2BZXA 4M77B 4II1A 2C0TA 1S72A 3EHQA 2HBWA 3JB9F 3MP1A 2WSFE 4BE0A 2HDAA 4A4HA 3PGGA 2EKOA 2QQ9A 3RIRA 3RKYA 3V7SA 3M0SA 2I2LA 2OTJT 1HJDA 4NL2A 4LDYA 1NLPC 1MNDA 3U23A 2QK0A 3G4ST 1VQ7Q 1X01A 4J6XA 1I8FA 4OP0A 2MK5A 1M1KC 1WPYA 3HFNA 4XTXA 2OAUA 2QTVA 1SHGA 2VUBA 1RAAB 2HCKA 3VYGA 3BDLA 1F1BB 4M7AF 2YRVA 3Q1JA 4M75C 4XU2A 4C5EA 4QVZA 4EPCA 4ORZA 3QWYA 4ANJA 3UPUA 2NYSA 1Q86U 1UG1A 2AKKA 5GAOq 4F16A 2DJQA 2VGMA 4EMHA 2YXYA 4F17A 1BBZA 3M57A 3GBQA 1IHWA 3JV3A 3FB9A 3CCMT 2NUPA 4BI8B 1KC8U 1FXXA 2RQUA 2BKDN 3LGLA 4M78E 4J5YA 4WTOB 1GCPA 2BUDA 4BACA 3EHRA 2ZPEB 4FIBA 5IN1A 5LJ3f 1BI3A 5C6SA 5J26A 1AZGB 5IH2A 2CSQA 2DXBA 4RMOA 2LCLA 3TVTA 1Q81U 3LGFA 2DVJA 2JTMA 4MZMA 1W70A 4C0ZA 4XTZA 3FJPA 2EQMA 2HD0A 1EZZB 1TSFA 2L0AA 3M53A 1KSWA 2VC8A 4OMNA 4HXJA 1M2VB 5GAMh 3JCMV 3C12A 1JJ2P 2M9UA 4RTZA 4EMKA 1D0YA 4MDXA 1UFFA 1ZQ1A 4FYVB 1TS9A 4CC7A 1PD1A 3QKJA 1ARKA 1YITA 4JUVA 4QQ6A 2LX7A 3GOXA 2J7IA 4LDUA 1N9RA 2OJ2A 3CBMA 4QT7A 4M75F 1WHLA 4OGCA 2YLBA 2CUBA 3I55A 2PNIA 2DX1A 4N4GA 1YI2A 2F69A 2LQWA 3SEMA 3UATA 1YFNA 1Q7YR 3SWNA 1GRIA 1VQMQ 2EQKA 3TCJA 2QDYB 2SEMA 5L8RE 3JCMb 1I07A 1LPLA 2KE9A 1ABQA 3CCEQ 2L3SA 4M77G 2ENMA 3OYMA 2BIVA 1PRMC 3CC4A 4M7DC 4E7HA 5KYWA 2MWOA 3EG0A 1YHQT 3GNGA 1D3BB 5FU6C 4RCCA 2OTLQ 3QBYA 4C92F 2HSEB 4XQ3A 5LJ5f 1QVPA 4ESRA 1AWJA 2F2XA 4J83A 1B07A 2A3LA 3OYIA 1H641 2EJ9A 3VJPA 5HKCA 2EWNA 1BIAA 1E6HA 4A4FA 1NYGA 1WJQA 2O2OA 1XTDA 2JS0A 2R5MA 1BCMA 3LW5E 2LVMA 2DA9A 4CC4B 4R56A 3A8HB 4B9WA 1U3OA 3OYKA 2HZYA 2VASA 3ULRB 4DEYA 1BI2A 1XOVA 2DD5A 3G1JA 4OVAA 2O31A 2WACA 1B34A 5J3BA 4CI0C 2FL7A 2V8KA 3N5BB 1VQ7A 5GANf 2FHDA 5GMKm 3UDCA 3S3NA 2QQBA 2K9GA 5HK3A 2YSQA 4A53A 1UTIA 5GMKe 1EFNA 2W0ZA 1SEMA 1VIEA 2JN0A 2VV5A 5CKBA 4KGXB 3H0FA 4BE1A 3CMAT 1UJYA 5GAN5 3G4SA 1TTHB 1RUWA 2QASA 3CCST 1AVZC 4KGVB 2CREA 1FWZA 1Z9ZA 1BCOA 3DLLA 3QJ6A 1KQ2A 1Y96B 3CCVT 3I9QA 4M7AA 1GBQA 2RQVA 4PJJA 4ZGDB 2PVDB 5A0GA 3TQ7P 3R6OA 1TUCA 1OZ2A 3V7RA 2VB6A 4LD9K 1VQLT 1M3AA 4RCBA 4MZTA 1E6GA 3CCMA 3X25B 2HQXA 2YRDA 4IUPA 5GMKj 2EQIA 4E7IA 2M0YA 3JCMf 2L89A 3JB9H 4X9DA 2VYTA 1C1AA 2A0FB 2ZPBB 3MEAA 2ATCB 5CQXA 1Q86C 1G5VA 3TEEA 3E9GA 3OS2A 3E9FA 3UA7A 2XKOC 2RI2A 5IXBA 1W2BA 2KY9A 2EQJA 1PD0A 3G71Q 1KC8C 1KQSA 4JZ4A 4F04B 2RO0A 2RB6A 4FW2A 3EFOA 1YJ9T 2A36A 3JCMP 2K5IA 1H8KA 3CXCA 1QCFA 3EH1A 4ZNXA 2O88A 1UGPB 2X3WD 4RTUA 2RH2A 1RAFB 1Q81C 3M0TA 1QCNA 1JO8A 1WNLA 3RKXA 4F7UF 2DLPA 2HMAA 1IO6A 3X26B 3OBYA 1VQ4Q 1UEBA 1M30A 1CKBA 3BW1A 2PTKA 4RTYA 1SF9A 3FJ5A 1KQ1A 2PVOB 2DXUA 2CZ7B 3VUBA 1R0BG 2ZPGB 2F5KA 4BD3A 2BE9B 2JW4A 1K0XA 4RG2A 4EDUA 3VS6A 1WI7A 5GMKl 1YJWQ 2VWFA 5LJ3h 3QDRB 2DBMA 3JCMJ 4E2FB 4BI3A 1S72Q 2FRWA 1YHQA 5I2MA 3H0HA 3SB2A 1K9MR 4EMKC 4C92A 1VQPQ 4M7DG 5IHKA 1HYOA 2VVKA 2LP5A 4C5GA 1D0XA 2RJEA 1Y71A 1YCYA 1UJ0A 2X3XD 3L2QA 4J9HA 1GCQC 5FLXE 5IHIA 2JM9A 2HKNA 1H3ZA 3GF5A 2E3HA 2DL4A 5FU7C 4JZ3A 2DF6A 3SWNC 2X4JA 1EX4A 3EGXB 1NLOC 1IZ6A 2CP0A 3EG9B 3CC2T 4J9BA 3VS0A 1HXDA 5EG2A 4D6WA 2E5KA 1S1NA 1IGUA 3PTAA 3RBBB 3I5RA 1AZEA 4DBHA 4PJOF 3I35A 2G6FX 2E41A 2P84A 3C4SA 1OI1A 2YDLA 4C5IA 2GFAA 1JJ2A 3CMAA 1V1CA 5I21A 5GAOm 1OU9A 1QVGP 1ZHIA 1T3SA 2MF2A 1W2BS 2ABLA 1ZA1B 1NEBA 2L3RA 2QTXA 3OMCA 2DETA 1I81A 3F70A 2ESWA 1NJIU 2QXFA 1KQSS 1VQNT 2L8DA 1YIJT 4AFZC 1G2BA 4MMLA 4M77D 2ZCFB 2RD1A 4QVDA 1YJNT 2EGCA 3QPHA 4LE9A 4XTWA 4F7UG 4RKUE 1K76A 1VQOQ 1JBMA 2DNUA 1SG5A 3CXCS 3RKWA 4OMLA 4DOVA 1VQLA 3NTHA 1VQ8T 1WX6A 5FROA 1H92A 1E7OA 4FCYA 3MKDA 1XNIA 1N9SA 3RUXA 1YITQ 2DEUA 5CO7A 2KNBB 2LJ1A 5D6XA 3QDFA 1M1FA 4LDVA 5GAN4 5GAOr 1VQ6T 1UGVA 3G71A 4OB0B 2LTOA 2K6DA 3O5ZA 4OMOA 3CCRQ 4O6JA 3RMQA 3OYBA 4GY5A 3FLGA 2CZ1B 3VKIA 4R0KA 1PWTA 3I55Q 1NBEB 4PJMA 2DM1A 2RF0A 1YI2Q 1C6VX 4J9CA 1N6AA 1QCOA 4RTWA 4FSXA 4OMFB 3TREA 5GANh 3CCJT 2X9HA 2FO0A 4LUEA 1QVFP 3PFSA 1LJOA 2QEXT 3OMGA 4Z89A 2IIMA 2RN8A 2Z0WA 2GNCA 1YWPA 4J7FA 1WHKA 3S3OA 4M7AC 1ZUUA 4RTVA 3CMEQ 3CC4Q 3GLXA 1VA7A 1VQ4A 2EYQA 2QQRA 3EAEA 4M78C 5CKEA 1G3YA 5GAOn 2YWWA 2RQWA 5HK0A 3EG3A 1SSFA 3BFMA 4LDXA 1KD1R 2WSEE 5DY9A 2LT4A 4FW1A 1A0NB 4BUGA 3DB3A 2RHUA 2COWA 2IPOB 8AT1B 1WFWA 2CZ6B 1BIBA 4EIKA 3PT9A 1WHGA 4DA4A 2DL7A 4KH1B 4HCCA 5D6YA 1PRLC 1OZ3A 1RAGB 4BY6C 3OYCA 3BDUA 1VQPA 1O75A 3KFVA 3JCMh 1WA7A 2QA4Q 3FEOA 1ZSZB 3NFCA 5IHNA 3A1PA 2GTJA 1JQQA 3OYJA 4OF1A 1MMGA 2RK1A 1SPKA 2DJZA 2O4XB 2CSIA 4D8KA 1OPLA 4RUGA 2DILA 2C0OA 3EFRA 2KRNA 2A7YA 2XU8A 4C8QE 2OTJQ 3X24B 4M77E 1B3QA 5KYNA 2P4RA 4AG2C 3L2RA 2JS2A 1OX9A 1JJ2S 2GGRA 3G4SQ 1UGSB 4QW2A 2LQ8A 2EW3A 2E1HA 4R55A 1MGQA 1AWOA 1WXBA 3RESA 4M78F 1WQWA 1JB0E 2OX7A 5LJ3j 1K1ZA 4OMQA 1WDXA 1O9SA 5A0LA 1SSHA 1U8RA 2JJ9A 1WJSA 3QHSA 1MMAA 3CCLT 1Q7YU 1C0MA 1QWFA 2D8JA 3CCMQ 5CK9A 4PJOA 4C92C 5IAYA 2V8JA 1UGQB 3EFSA 5CKDA 1K9AA 4RTTA 1T3LA 3X28B 3A8OB 2K7AA 2F5TX 2RQRA 3OQ5A 5AYFA 4E7JA 1VQOA 3QSUA 2JOYA 1HK9A 3LH5A 2MYSA 5D7UA 1RLQC 1Q82R 2CS7A 4MZPA 3V7CA 4M75B 1VQKT 3NTIA 5KYYA 1YIJA 1RI9A 2JXBA 2DZ9A 3CD6T 1G3WA 4C0GA 2LX9A 3CCRA 1GCQA 1DJ7B 4OMPA 1PHTA 4JS4A 3EGDA 4M7DD 2SRCA 3G6ET 2HBPA 4PLIA 3MO8A 4FM4B 1KIKA 3PVQA 1NJIC 2JM8A 1Y0MA 3JB9G 2LCCA 5FRMA 4A4EA 2FPFA 3LWIA 1V29B 1IGQA 2GFUA 1N27A 5HCKA 3CMEA 2JVVA 1OPKA 3H41A 5LJ5j 3CCJA 1M4ZA 2XICA 4OMMA 1ZA2B 2DBKA 1TUGB 2QEXA 2LJ0A 2PUOB 4Y28E 3FC3A 1J3TA 2A37A 3OS1A 2KROA 2EYXA 4QKUA 2KRSA 3OSSC 2DXCA 4M7AG 2XG8D 2P0PA 1TUDA 1YHQQ 4N0AA 2MOXA 5GAOp 1NZ9A 3WXMB 5I22A 4KGZB 1PG5B 3CCQT 5KE3A 2DIGA 2KVQG 1CSKA 3C95A 2QGGA 3HRTA 2DTIA 1TG0A 2KSSA 2NUTA 1NM7A 2ZPIB 3RMSA 2QA4A 3OYHA 1SRLA 1G83A 2V8IA 4QQGA 5HY6A 5AT1B 1SKUB 1HD3A 5GAN7 1I5LA 2J06A 2CGHA 3HFOA 4XAXB 3ASKA 5LJ5d 1WHMA 4OB3B 3ZBDA 4ZGEB 3RDVA 2OTJA 4M7DB 1QVGA 8ATCB 1OEBA 2FVUA 2C0IA 5FU6B 1OYXA 5FW9A 2Y90A 1X6OA 4A4GA 4Y92A 5KYXA 2XMFA 3P8DA 3EG2A 4C8QA 2RI5A 4IUVA 2RNAA 4M77A 4B9XA 5CR2A 2YUQA 5I2SA 2LMJA 3RERA 2CZ0B 3VRYA 1N5ZA 3ME9A 3S3MA 2EGEA 4JJDA 2A08A 4IUUA 2MWPA 2AZSA 3CMAQ 1UHCA 3WVEB 1RAEB 3V8JA 3I56T 1NYFA 3CCSQ 3MEUA 4M75G 2DYBA 1NEGA 1N8RR 3LX7A 4M7DE 3R6NA 3CCUT 5CKHA 3REAB 3OYAA 4M78A 3DB4A 3CCVQ 1P92A 1I0CA 2DTHA 1K8AR 1BKBA 4GLKA 3ZEHA 3QG1A 2M1HA 4DOWA 2KR3A 4E47A 2LNHB 1VQLQ 4L5GA 2XK0A 3CCLA 1VUBA 4FL6A 3RNJA 1QVFA 2GQVA 2X4WA 1RABB 4J9IA 1T0HA 2DPPB 2IVWA 2D1XA 2D6FA 4AFQC 2KT1A 4C92G 1YCSB 2VGNA 2E5QA 2HKQB 3GNFB 5GAMe 1U5SA 4E6RA 1JU5C 3OS0A 2A28A 4RG8A 3QWXX 4B6MA 1WJRA 1XJWB 1Q7YC 1K9MU 2RA2A 4F7UB 1KG1A 1ZLMA 2P0QA 2DZCA 1K73R 1D0ZA 1UGRB 2K57A 1ZBJA 2EFIA 3M0PA 1PC0A 4C0DC 1YJ9Q 2CDTA 1RAHB 5M9OA 1FMKA 1PKSA 1M8MA 4XK8E 2BZ8A 1M2VA 1CKAA 3A8MB 3DKMA 3L42A 3V8KA 1OU8A
chains in the Genus database with same CATH topology
3ZL7C 1BBZA 3GBQA 2FG0A 2CH4A 3JV3A 2VKNA 2FPEA 4J9EA 1GFCA 2KNBB 2LJ1A 1UGVA 2RQUA 3EG1A 2K6DA 3O5ZA 1RLPC 5L23A 2LZ6B 1GCPA 4OMOA 3EHRA 1T0JA 2J05A 4R0KA 1PWTA 2KYMA 1WXUA 2DM1A 2RF0A 2O9VA 1AZGB 5IH2A 1VYUA 2CSQA 1AOJA 4J9CA 4RTWA 5I11A 2JT4A 2L3PA 3TVTA 3PVLA 5EC7A 2AKLA 1ZUKA 2DVJA 1W70A 2FO0A 4LUEA 2D8HA 3SHWA 2IIMA 2RN8A 4HVWA 4Z89A 2GNCA 2L0AA 1KSWA 1YWPA 2ROLA 2RPNA 4OMNA 4HXJA 3M0RA 1ZUUA 4RTVA 2JMCA 2LCSA 1VA7A 4D8DA 1NG2A 4RTZA 3TSZA 3A98A 2LJ3A 4HVUA 1UFFA 4CC7A 1ARKA 2RQWA 3EG3A 2LX7A 2J7IA 2OJ2A 4QT7A 1H3HA 2GTOA 1A0NB 1YWOA 2CUBA 2PNIA 1K0SA 3VS5A 1ZUYA 2DX1A 3C0CA 1WFWA 4EIKA 2LQWA 3SEMA 3UATA 2DL7A 1PRLC 1GRIA 2PZ1A 1ZX6A 1QWEA 2SEMA 3KFVA 1I07A 1WA7A 2KE9A 3TSWA 1ABQA 2KEAA 2L3SA 3UA6A 2ENMA 1AWWA 5IHNA 2GTJA 1JQQA 4GBQA 1PRMC 1SPKA 4D8KA 2FEIA 2CSIA 1K4US 2EYYA 1OPLA 3EG0A 2GBQA 5IXFA 1X2KA 4RUGA 2DILA 2C0OA 1Y57A 4AFUC 2KRNA 4ESRA 1AWJA 2F2XA 2AK5A 2KGTA 1B3QA 2NUZA 1B07A 1HSQA 2P4RA 3M0UA 4AG2C 2B86A 2JS2A 1KJWA 2BTTA 1E6HA 2GGRA 1NYGA 1AD5A 2O2OA 2DL8A 2EW3A 2JS0A 1X2QA 1PKTA 1AWOA 1WXBA 2KBTA 2W10A 4LNPA 2DA9A 4X1VA 4CC4B 1VYVA 2L3QA 3NHNA 3CQTA 2CH4W 1YP5A 1K1ZA 1JXOA 1U3OA 2F2WA 4OMQA 4F14A 1WDXA 3REBB 2EYZA 1SSHA 3ULRB 2J6OA 4DEYA 1XOVA 1YN8A 1BU1A 2O31A 2CUDA 2OI3A 3IQLA 3H0IA 2MCNA 1QWFA 2D8JA 1AWXA 2K9GA 2YSQA 1YNZA 4FSSA 1UUEA 1UTIA 3VS3A 1WYXA 1EFNA 1K9AA 2W0ZA 1SEMA 2EPDA 2EKHA 4RTTA 1GBRA 1T3LA 3UF4A 3H0FA 4Z8AA 2K7AA 1KFZA 1BK2A 1UJYA 2RQRA 1W1FA 1RUWA 1X43A 3EGUA 3LH5A 1UHFA 1RLQC 1AVZC 2CREA 1Z9ZA 2EGAA 3VS2A 1MV3A 1RI9A 3I9QA 2JXBA 5FWBA 1GBQA 2RQVA 3VS7A 1PNJA 1WLPB 1OOTA 1GCQA 1TUCA 2DL5A 1MV0B 3NGPA 4J9GA 4IIOA 4OMPA 1AEYA 1PHTA 2RQTA 1M3AA 2SRCA 1E6GA 1KIKA 3PVQA 2JM8A 1Y0MA 2CT3A 4AFSC 2EQIA 2KT8A 2M0YA 1GL5A 2FPFA 1X69A 1JXMA 2DE0X 3UA7A 2ED0A 5HCKA 3VS1A 1OPKA 3H41A 5IXBA 4JJCA 1QKWA 1BB9A 2CT4A 1X6GA 4OMMA 3VRZA 2JMAA 1LCKA 2DBKA 2LJ0A 2ROTA 1Z9QA 4JZ4A 4DEXA 1J3TA 2A37A 2KROA 2DMOA 2A36A 1W6XA 2EYXA 2DRMA 2KRSA 1VYTA 4HCKA 1H8KA 2EBPA 1QCFA 4ZNXA 2O88A 1TUDA 2X3WD 2LQNA 2MOXA 1WIEA 4RTUA 5I22A 4LUDA 3M0TA 1JO8A 2F2VA 1CSKA 2V1RA 2ECZA 3NMZC 1X6BA 2YUOA 2DLPA 1TG0A 2QDLA 1UECA 1NM7A 2EYWA 2M51A 4IIMA 1IO6A 2O9SA 1SRLA 1G83A 2V1QA 4KRTA 2KXDA 2D0NA 1M30A 1CKBA 2J6FA 1HD3A 2PTKA 3THKA 2MIOA 4RTYA 3FJ5A 3PE0A 2FPDA 2J06A 2BZYA 5ECAA 2OAWA 2JW4A 4M4ZA 5FWCA 1JEGA 1K0XA 3VS6A 1WI7A 2KRMA 2VWFA 2FRYA 4CC3A 1OEBA 2KYBA 2C0IA 2DBMA 1OV3A 5FW9A 2JTEA 4Y92A 2FRWA 1UDLA 2ED1A 2YUNA 3H0HA 1U06A 2YUPA 2XMFA 2K79A 3EG2A 2RNAA 1SHFA 3M0QA 1X27A 2YUQA 5IHKA 2LMJA 1FYNA 1QLYA 2VVKA 2LP5A 3VRYA 1N5ZA 2J6KA 1GFDA 2L2PA 3I5SA 2EGEA 4HVVA 2YT6A 4JJDA 1M27C 5GJVB 2A08A 1UJ0A 2DRKA 2X3XD 2AZSA 1UHCA 4J9HA 1GCQC 1UE9A 1NYFA 5IHIA 2JM9A 4JJBA 2DYBA 1NEGA 1M3BA 4RTXA 4LN2A 3R6NA 2DL4A 4JPBW 1MUZA 2KXCA 3REAB 2HEQA 4K11A 4JZ3A 1ABOA 2DF6A 4A63B 1NLOC 1I0CA 2HSPA 2DL3A 1I1JA 4J9BA 4Z88A 3VS0A 2H8HA 2KR3A 2LNHB 4CC2A 2E5KA 1SRMA 2BZXA 1S1NA 3NPFA 2C0TA 3EHQA 2HBWA 4J9FA 3RNJA 3RBBB 2HDAA 3I5RA 1AZEA 4WCIA 3I35A 4J9IA 2NWMA 1T0HA 2G6FX 2D1XA 3M0SA 4J9DA 4AFQC 2KT1A 1HJDA 2YDLA 1YCSB 1WXTA 1NLPC 1U5SA 4E6RA 1JU5C 2EVRA 2A28A 1V1CA 1QKXA 2K2MA 3QWXX 2RMOA 3U23A 2I0NA 4AG1C 1ZSGA 1M3CA 2AZVA 1T3SA 1ZLMA 2ABLA 1NEBA 1ZBJA 2ESWA 1SHGA 3M0PA 2HCKA 1G2BA 4AFZC 2CDTA 2EGCA 4LE9A 2K3BA 1FMKA 4ORZA 1K76A 1PKSA 3QWYA 1M8MA 1UG1A 2DNUA 2AKKA 2BZ8A 4F16A 1CKAA 2DJQA 2GQIA 4OMLA 3VS4A 1WX6A 4GLMA 1H92A 5GJWB 1E7OA 4F17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL7 C;  1BBZ A;  3GBQ A;  2FG0 A;  2CH4 A;  3JV3 A;  2VKN A;  2FPE A;  4J9E A;  1GFC A;  2KNB B;  2LJ1 A;  1UGV A;  2RQU A;  3EG1 A;  2K6D A;  3O5Z A;  1RLP C;  5L23 A;  2LZ6 B;  1GCP A;  4OMO A;  3EHR A;  1T0J A;  2J05 A;  4R0K A;  1PWT A;  2KYM A;  1WXU A;  2DM1 A;  2RF0 A;  2O9V A;  1AZG B;  5IH2 A;  1VYU A;  2CSQ A;  1AOJ A;  4J9C A;  4RTW A;  5I11 A;  2JT4 A;  2L3P A;  3TVT A;  3PVL A;  5EC7 A;  2AKL A;  1ZUK A;  2DVJ A;  1W70 A;  2FO0 A;  4LUE A;  2D8H A;  3SHW A;  2IIM A;  2RN8 A;  4HVW A;  4Z89 A;  2GNC A;  2L0A A;  1KSW A;  1YWP A;  2ROL A;  2RPN A;  4OMN A;  4HXJ A;  3M0R A;  1ZUU A;  4RTV A;  2JMC A;  2LCS A;  1VA7 A;  4D8D A;  1NG2 A;  4RTZ A;  3TSZ A;  3A98 A;  2LJ3 A;  4HVU A;  1UFF A;  4CC7 A;  1ARK A;  2RQW A;  3EG3 A;  2LX7 A;  2J7I A;  2OJ2 A;  4QT7 A;  1H3H A;  2GTO A;  1A0N B;  1YWO A;  2CUB A;  2PNI A;  1K0S A;  3VS5 A;  1ZUY A;  2DX1 A;  3C0C A;  1WFW A;  4EIK A;  2LQW A;  3SEM A;  3UAT A;  2DL7 A;  1PRL C;  1GRI A;  2PZ1 A;  1ZX6 A;  1QWE A;  2SEM A;  3KFV A;  1I07 A;  1WA7 A;  2KE9 A;  3TSW A;  1ABQ A;  2KEA A;  2L3S A;  3UA6 A;  2ENM A;  1AWW A;  5IHN A;  2GTJ A;  1JQQ A;  4GBQ A;  1PRM C;  1SPK A;  4D8K A;  2FEI A;  2CSI A;  1K4U S;  2EYY A;  1OPL A;  3EG0 A;  2GBQ A;  5IXF A;  1X2K A;  4RUG A;  2DIL A;  2C0O A;  1Y57 A;  4AFU C;  2KRN A;  4ESR A;  1AWJ A;  2F2X A;  2AK5 A;  2KGT A;  1B3Q A;  2NUZ A;  1B07 A;  1HSQ A;  2P4R A;  3M0U A;  4AG2 C;  2B86 A;  2JS2 A;  1KJW A;  2BTT A;  1E6H A;  2GGR A;  1NYG A;  1AD5 A;  2O2O A;  2DL8 A;  2EW3 A;  2JS0 A;  1X2Q A;  1PKT A;  1AWO A;  1WXB A;  2KBT A;  2W10 A;  4LNP A;  2DA9 A;  4X1V A;  4CC4 B;  1VYV A;  2L3Q A;  3NHN A;  3CQT A;  2CH4 W;  1YP5 A;  1K1Z A;  1JXO A;  1U3O A;  2F2W A;  4OMQ A;  4F14 A;  1WDX A;  3REB B;  2EYZ A;  1SSH A;  3ULR B;  2J6O A;  4DEY A;  1XOV A;  1YN8 A;  1BU1 A;  2O31 A;  2CUD A;  2OI3 A;  3IQL A;  3H0I A;  2MCN A;  1QWF A;  2D8J A;  1AWX A;  2K9G A;  2YSQ A;  1YNZ A;  4FSS A;  1UUE A;  1UTI A;  3VS3 A;  1WYX A;  1EFN A;  1K9A A;  2W0Z A;  1SEM A;  2EPD A;  2EKH A;  4RTT A;  1GBR A;  1T3L A;  3UF4 A;  3H0F A;  4Z8A A;  2K7A A;  1KFZ A;  1BK2 A;  1UJY A;  2RQR A;  1W1F A;  1RUW A;  1X43 A;  3EGU A;  3LH5 A;  1UHF A;  1RLQ C;  1AVZ C;  2CRE A;  1Z9Z A;  2EGA A;  3VS2 A;  1MV3 A;  1RI9 A;  3I9Q A;  2JXB A;  5FWB A;  1GBQ A;  2RQV A;  3VS7 A;  1PNJ A;  1WLP B;  1OOT A;  1GCQ A;  1TUC A;  2DL5 A;  1MV0 B;  3NGP A;  4J9G A;  4IIO A;  4OMP A;  1AEY A;  1PHT A;  2RQT A;  1M3A A;  2SRC A;  1E6G A;  1KIK A;  3PVQ A;  2JM8 A;  1Y0M A;  2CT3 A;  4AFS C;  2EQI A;  2KT8 A;  2M0Y A;  1GL5 A;  2FPF A;  1X69 A;  1JXM A;  2DE0 X;  3UA7 A;  2ED0 A;  5HCK A;  3VS1 A;  1OPK A;  3H41 A;  5IXB A;  4JJC A;  1QKW A;  1BB9 A;  2CT4 A;  1X6G A;  4OMM A;  3VRZ A;  2JMA A;  1LCK A;  2DBK A;  2LJ0 A;  2ROT A;  1Z9Q A;  4JZ4 A;  4DEX A;  1J3T A;  2A37 A;  2KRO A;  2DMO A;  2A36 A;  1W6X A;  2EYX A;  2DRM A;  2KRS A;  1VYT A;  4HCK A;  1H8K A;  2EBP A;  1QCF A;  4ZNX A;  2O88 A;  1TUD A;  2X3W D;  2LQN A;  2MOX A;  1WIE A;  4RTU A;  5I22 A;  4LUD A;  3M0T A;  1JO8 A;  2F2V A;  1CSK A;  2V1R A;  2ECZ A;  3NMZ C;  1X6B A;  2YUO A;  2DLP A;  1TG0 A;  2QDL A;  1UEC A;  1NM7 A;  2EYW A;  2M51 A;  4IIM A;  1IO6 A;  2O9S A;  1SRL A;  1G83 A;  2V1Q A;  4KRT A;  2KXD A;  2D0N A;  1M30 A;  1CKB A;  2J6F A;  1HD3 A;  2PTK A;  3THK A;  2MIO A;  4RTY A;  3FJ5 A;  3PE0 A;  2FPD A;  2J06 A;  2BZY A;  5ECA A;  2OAW A;  2JW4 A;  4M4Z A;  5FWC A;  1JEG A;  1K0X A;  3VS6 A;  1WI7 A;  2KRM A;  2VWF A;  2FRY A;  4CC3 A;  1OEB A;  2KYB A;  2C0I A;  2DBM A;  1OV3 A;  5FW9 A;  2JTE A;  4Y92 A;  2FRW A;  1UDL A;  2ED1 A;  2YUN A;  3H0H A;  1U06 A;  2YUP A;  2XMF A;  2K79 A;  3EG2 A;  2RNA A;  1SHF A;  3M0Q A;  1X27 A;  2YUQ A;  5IHK A;  2LMJ A;  1FYN A;  1QLY A;  2VVK A;  2LP5 A;  3VRY A;  1N5Z A;  2J6K A;  1GFD A;  2L2P A;  3I5S A;  2EGE A;  4HVV A;  2YT6 A;  4JJD A;  1M27 C;  5GJV B;  2A08 A;  1UJ0 A;  2DRK A;  2X3X D;  2AZS A;  1UHC A;  4J9H A;  1GCQ C;  1UE9 A;  1NYF A;  5IHI A;  2JM9 A;  4JJB A;  2DYB A;  1NEG A;  1M3B A;  4RTX A;  4LN2 A;  3R6N A;  2DL4 A;  4JPB W;  1MUZ A;  2KXC A;  3REA B;  2HEQ A;  4K11 A;  4JZ3 A;  1ABO A;  2DF6 A;  4A63 B;  1NLO C;  1I0C A;  2HSP A;  2DL3 A;  1I1J A;  4J9B A;  4Z88 A;  3VS0 A;  2H8H A;  2KR3 A;  2LNH B;  4CC2 A;  2E5K A;  1SRM A;  2BZX A;  1S1N A;  3NPF A;  2C0T A;  3EHQ A;  2HBW A;  4J9F A;  3RNJ A;  3RBB B;  2HDA A;  3I5R A;  1AZE A;  4WCI A;  3I35 A;  4J9I A;  2NWM A;  1T0H A;  2G6F X;  2D1X A;  3M0S A;  4J9D A;  4AFQ C;  2KT1 A;  1HJD A;  2YDL A;  1YCS B;  1WXT A;  1NLP C;  1U5S A;  4E6R A;  1JU5 C;  2EVR A;  2A28 A;  1V1C A;  1QKX A;  2K2M A;  3QWX X;  2RMO A;  3U23 A;  2I0N A;  4AG1 C;  1ZSG A;  1M3C A;  2AZV A;  1T3S A;  1ZLM A;  2ABL A;  1NEB A;  1ZBJ A;  2ESW A;  1SHG A;  3M0P A;  2HCK A;  1G2B A;  4AFZ C;  2CDT A;  2EGC A;  4LE9 A;  2K3B A;  1FMK A;  4ORZ A;  1K76 A;  1PKS A;  3QWY A;  1M8M A;  1UG1 A;  2DNU A;  2AKK A;  2BZ8 A;  4F16 A;  1CKA A;  2DJQ A;  2GQI A;  4OML A;  3VS4 A;  1WX6 A;  4GLM A;  1H92 A;  5GJW B;  1E7O A;  4F17 A; 
#chains in the Genus database with same CATH topology
 3ZL7 C;  2CH4 A;  3HP9 A;  1OUL A;  2VKN A;  3JAM E;  1GFC A;  4PJO C;  4PFP A;  4F7U E;  1RLP C;  4Z02 A;  5A2Q E;  5GAM j;  3HSB A;  1T0J A;  3H6Z A;  2J05 A;  3OBW A;  2P4T A;  1WXU A;  2O9V A;  2MPX C;  5KYU A;  1VYU A;  2CP2 A;  1AOJ A;  4PFZ A;  5I11 A;  2L3P A;  2CP3 A;  3PVL A;  1ZUK A;  3A8G B;  2D8H A;  3SHW A;  4HVW A;  1FMW A;  4KUL A;  3V8L A;  1QVG S;  2RM4 A;  2LCS A;  5CIU A;  4D8D A;  4C5H A;  4X34 A;  3MHX A;  3URG A;  2NUP B;  2XID A;  3A98 A;  2LJ3 A;  2QI2 A;  1LVK A;  4HVU A;  3CPF A;  2DTO A;  1FMV A;  4HT9 A;  2ZGW A;  1PSF A;  1D3B A;  2QAZ A;  4LDW A;  5GAM g;  1I4K 1;  1X75 C;  4XTV A;  2E3I A;  5CCA A;  5GAM d;  2GTO A;  4E7Z A;  1YWO A;  1R0C B;  1K0S A;  3VS5 A;  4PJO B;  3C0C A;  4L59 A;  5GAN 8;  2HQE A;  1VQ9 T;  3OW2 S;  3J7A F;  3H9N A;  1ZX6 A;  1G3T A;  1M1K R;  1LNX A;  1QWE A;  3CC2 Q;  3JRZ A;  4PLL A;  2M16 A;  5KCO A;  2KK4 A;  3M55 A;  1RAC B;  2EJG A;  4EMK B;  1AWW A;  1TH7 A;  1B7T A;  4GBQ A;  4IKF A;  1D1B A;  4QQD A;  2FEI A;  2EYY A;  2X51 A;  4N0A C;  2GBQ A;  2PU9 B;  3MPU B;  3CCS A;  4BDZ A;  3S6W A;  1X2K A;  2DEQ A;  1QVF S;  3JB9 D;  4AFU C;  1KHI A;  3UWN A;  2JZ2 A;  1WHJ A;  2AK5 A;  3CCV A;  2KGT A;  3JCM Q;  3PMI A;  3M0U A;  1VQ5 T;  2B86 A;  1KJW A;  2JNG A;  2BTT A;  1AD5 A;  5FU7 B;  1LOJ A;  3KBG A;  4BE2 A;  3SWN B;  2DL8 A;  3PIO A;  3CCU A;  1X2Q A;  1ZBX A;  1PKT A;  1VQN Q;  2W10 A;  2E6N A;  4LNP A;  1YIJ Q;  2ZZD A;  4X1V A;  2DKG A;  2L3Q A;  3OW2 P;  1KD1 U;  3CC7 T;  1YJN Q;  1YP5 A;  2F2W A;  4F14 A;  2D9T A;  1Y96 A;  4M7A D;  5KYW B;  3QYH B;  3M9Q A;  1QP3 A;  1VQ8 Q;  3QJY A;  2LDM A;  3MP6 A;  3VYH B;  4DBF A;  2G3R A;  2MCN A;  3ZFJ A;  1WGS A;  4C8Q C;  1VQ6 Q;  1AWX A;  4M77 C;  2EAY A;  3SD4 A;  1YNZ A;  4FSS A;  1UUE A;  1WYX A;  1GBR A;  1MMD A;  3HKS A;  3L2W A;  3E1S A;  1YJ9 A;  5KH6 A;  4Z8A A;  4E7L A;  3D7S B;  5D6W A;  2LNV A;  1W4S A;  1M90 U;  1KFZ A;  1BK2 A;  1X43 A;  3EGU A;  1NE8 A;  2H3E B;  3CCJ Q;  2R5A A;  3QYG B;  4VUB A;  2RHX A;  2QEX Q;  4ELZ C;  4PNO A;  5FWB A;  3JB9 I;  4XTU A;  3VS7 A;  1B34 B;  2X4Y A;  1U1T A;  1OOT A;  2RK2 A;  2JUF A;  3OYG A;  5KCH A;  2K3Y A;  1K9M C;  2DL5 A;  3NGP A;  3LLR A;  1TU0 B;  5CQY A;  4FYY B;  5FRN A;  4Q5W A;  1AHJ B;  3OS5 A;  4AFS C;  3M54 A;  3J80 E;  4PK4 A;  2LT1 A;  3M4Y A;  4FT4 A;  2KT8 A;  1OX8 A;  9ATC B;  3FRN A;  1X69 A;  4JS5 A;  4PJO G;  5DM7 R;  5LJ3 e;  1JXM A;  3CBO A;  4M75 D;  1EIF A;  2ED0 A;  2E6Z A;  1M90 R;  4P5N A;  1QKW A;  1VQ7 T;  3M58 A;  1X6G A;  5CAI A;  3RR6 A;  4M7A B;  3HRU A;  2JMA A;  4C8Q F;  5GAO l;  4M77 F;  1Z9Q A;  3DLM A;  1PSE A;  5GMK h;  4JJN K;  4NL3 A;  2DMO A;  1VYT A;  3E2U A;  1Q82 U;  4M78 B;  1JRI A;  3HRS A;  2Y4Y A;  3QZ5 B;  1WIE A;  2HQH A;  4LUD A;  2LRQ A;  4MDW A;  2DER A;  2F2V A;  4OB1 B;  4JDS A;  3X20 B;  2V1R A;  2QQS A;  3NMZ C;  4C92 D;  1VOM A;  1IHV A;  4PL6 A;  3CC2 A;  4M7A E;  3HTR A;  5DLQ E;  2DYI A;  2KXD A;  1PM3 A;  2J6F A;  4E7S A;  3OYN A;  2MIO A;  4BY6 B;  1WZO A;  2R57 A;  1VQ9 A;  2FPD A;  2BZY A;  5ECA A;  2OAW A;  4JRP A;  1JEG A;  4M4Z A;  5FWC A;  3EFO B;  3OSV A;  2KRM A;  4ZN1 A;  4FYW B;  3EGX A;  4CC3 A;  1MMN A;  3JCM W;  3EG9 A;  4WF2 A;  3CCL Q;  1OV3 A;  2JTE A;  4J6W A;  7AT1 B;  1UDL A;  2YUN A;  2YUP A;  2XI9 A;  2K79 A;  2RHI A;  1SHF A;  4KT0 E;  4OGE A;  3J81 E;  3M0Q A;  1FYN A;  1QLY A;  1KK7 A;  5LJ5 e;  1VQN A;  2J6K A;  2L2P A;  3I5S A;  5LJ3 g;  4HVV A;  2YT6 A;  1M27 C;  4IUR A;  1VQ5 A;  4DBR A;  1YJN A;  5GJV B;  3OY9 A;  2HL5 C;  5LJ3 d;  2FZG B;  3KXT A;  4J7I A;  4JJB A;  3L2V A;  1VQ8 A;  2DVE A;  1Q86 R;  1VQK Q;  3H8Z A;  4ZTJ A;  4JPB W;  1MUZ A;  2KXC A;  2HEQ A;  4K11 A;  1ABO A;  2H3J A;  2M0O A;  2YHT A;  2HAX A;  3CC7 A;  4ZGJ B;  1VQ6 A;  3CD6 Q;  3PMT A;  1VQM T;  4JRI A;  4A63 B;  3VUZ A;  3M59 A;  2DL3 A;  5KYU B;  1KC8 R;  1BI1 A;  2NLU A;  4Z88 A;  1WQ7 A;  2H8H A;  3CCE T;  4M75 E;  1U1S A;  4C92 B;  1SRM A;  3G6E Q;  3NPF A;  3ER0 A;  1VIF A;  3MEV A;  4J9F A;  4PFO A;  1M2O A;  5GAN e;  2B8A A;  2PVG B;  2XHC A;  4BB7 A;  4WCI A;  4ATO A;  1KD1 C;  4O5V A;  1Q95 G;  2OTL T;  4NOY A;  2NWM A;  1Q81 R;  3HPW A;  4J9D A;  4C8Q G;  4Y91 A;  1QP2 A;  1WXT A;  2EVR A;  3CEY A;  1QKX A;  2K2M A;  2RMO A;  2I0N A;  2FZK B;  1ZSG A;  4AG1 C;  1MNE A;  1M3C A;  2AZV A;  2IG0 A;  3EH2 A;  2XD0 A;  4C92 E;  1M8V A;  4LD6 A;  4DBQ A;  2RJF A;  1V76 A;  3OYL A;  4IUT A;  1FX7 A;  1D1A A;  2KMT A;  4M78 G;  2DXT A;  2PUK B;  2K3B A;  1Y07 A;  2DD4 A;  4ELY C;  1M90 C;  4KH0 B;  4A54 A;  1N8R U;  3OYE A;  1GXI E;  3QXE B;  1IRE B;  1NPP A;  2D0Q B;  3VS4 A;  2GQI A;  5GAN j;  3AHU A;  3CCQ Q;  2P0K A;  4GLM A;  5GJW B;  5A0D A;  5LJ5 g;  2CYZ B;  2FZC B;  4CRI A;  5C0M A;  2FG0 A;  3MCA B;  2FPE A;  4J9E A;  1K8A U;  1TWB A;  4TVR A;  3EG1 A;  2KI7 A;  2M02 A;  5L23 A;  3JCM e;  2LZ6 B;  2V26 A;  4C0F A;  3SFM A;  2KYM A;  4IUQ A;  3L1A A;  2L5Q A;  4AMC A;  5KE2 A;  2JT4 A;  4KUD K;  5EC7 A;  3MJX A;  2AHJ B;  2AKL A;  3A5Z B;  2RPN A;  2ROL A;  5GMK i;  1KHC A;  4XU0 A;  1TXQ A;  3M0R A;  2JMC A;  2COZ A;  1QQJ A;  1WHH A;  5GAN g;  1K73 U;  4M7D F;  1ZSZ A;  2DFU A;  3SDZ A;  1NG2 A;  5GAN 3;  3TSZ A;  1MHN A;  5GAN d;  3OW2 A;  1QMC A;  2O4X A;  4FYX B;  1RAI B;  3P8B B;  4X9C A;  3C94 A;  3I56 Q;  2E10 A;  1H3H A;  4PJL A;  3PIP A;  1Q82 C;  2YRC A;  1ZUY A;  4HCB A;  3CBP A;  3HHT B;  3CCU Q;  1TOV A;  2QGF B;  4UC4 A;  1PCX A;  2KAF A;  2PZ1 A;  3G71 T;  4E7K A;  3FDR A;  3TSW A;  2KEA A;  4JLG A;  3AT1 B;  3UA6 A;  4QVC A;  4ME7 A;  3OYF A;  1K4U S;  5CKF A;  2DAQ A;  4OB2 B;  5IXF A;  2GF7 A;  1VQK A;  3JCM g;  2HL3 A;  1Y57 A;  1ACM B;  1OQK A;  2XDB A;  4JRQ A;  4PJO D;  3JCM d;  3CD6 A;  2NUZ A;  1HSQ A;  2JTF A;  2XDD A;  2K4Y A;  1VQ4 T;  2KQW A;  4EMG A;  2EJF A;  1BI0 A;  2DO3 A;  2GCX A;  3G6E A;  3CPW A;  2PQW A;  2KBT A;  1VYV A;  1VQM A;  3NHN A;  3CQT A;  2CH4 W;  2E12 A;  4M75 A;  1JXO A;  3REB B;  2EYZ A;  1YJW T;  3L2U A;  2J6O A;  3CCE A;  4XU3 A;  2K5F A;  1YN8 A;  2MI6 A;  1BU1 A;  2CUD A;  2OI3 A;  3IQL A;  3H0I A;  4V2S A;  1S72 T;  4PJN A;  3KUF A;  1M1K U;  4HA8 A;  2QG9 B;  2ZPF B;  2OTL A;  1VQP T;  1D09 B;  3VS3 A;  2MMP A;  2EPD A;  2EKH A;  2F1L A;  5GAM f;  3UF4 A;  4XU1 A;  1RAD B;  3GIB A;  1W1F A;  2K3X A;  2RI3 A;  1UHF A;  2ZAE A;  5LL6 S;  2RJC A;  4C0D B;  3CCQ A;  2VXF A;  5GAN 6;  2EGA A;  3VS2 A;  1MV3 A;  3VU3 C;  2XDP A;  4MMK A;  4HCZ A;  1PNJ A;  1WLP B;  2FYK A;  2K2V A;  1MV0 B;  4J9G A;  4JRK A;  4IIO A;  1NPR A;  1AEY A;  2RQT A;  1M1G A;  4NS5 A;  4KUI A;  3QII A;  4A4K A;  2MAM A;  3M56 A;  2QYZ A;  2BE7 D;  2CT3 A;  3L2Z A;  3MET A;  3TU4 K;  1AT1 B;  1GL5 A;  1YBY A;  1N8R C;  2CP5 A;  3T9N A;  2DE0 X;  2COY A;  4ZTF A;  3VS1 A;  2ZPH B;  1IXD A;  1VQ9 Q;  3MP8 A;  4JJC A;  4FU6 A;  2AIR B;  1IRX A;  5KYY B;  1BB9 A;  2CT4 A;  1BYM A;  2LC4 A;  3VRZ A;  1K8A C;  2FB7 A;  1LCK A;  2HNI A;  3E19 A;  2EIF A;  3FIF A;  2ROT A;  3GPL A;  1Y7X A;  4DEX A;  4PJO E;  1UB4 A;  2QQA A;  3PNW C;  2WSC E;  1W6X A;  3EGD B;  4PKC C;  2DRM A;  3I56 A;  4ZN3 A;  2EQU A;  4HCK A;  4M7D A;  5IT9 E;  2EBP A;  1VQO T;  4AT1 B;  2LQN A;  3A8L B;  4J6Y A;  3LYI A;  3OB9 A;  1G3S A;  4L6V 5;  5DLO A;  4J8O A;  5LJ5 h;  2E64 A;  4FT2 A;  3P8H A;  2ECZ A;  2YLC A;  4C8Q D;  1X6B A;  2YUO A;  5J39 A;  1YIT T;  2O01 E;  3QUI A;  3JSC A;  1VQ5 Q;  2QDL A;  3M4G A;  5CVI A;  1UEC A;  2M51 A;  2EYW A;  4IIM A;  4YTL A;  1RI0 A;  2O9S A;  3CCR T;  2V1Q A;  2X35 A;  1I5O B;  3BY7 A;  4KRT A;  4LXC A;  5GAN 2;  3LWH A;  2D0N A;  2LQK A;  1K73 C;  4JLI A;  3I55 T;  3THK A;  2KDS A;  2CP7 A;  3PE0 A;  1YI2 T;  2E65 A;  1M5Q 1;  1R8O B;  3CPW S;  2E4H A;  3O8V A;  2X4X A;  3CC7 Q;  3JB9 J;  2VXE A;  3NTK A;  2E70 A;  3OYD A;  3JCM X;  2K5L A;  3OYY A;  2R58 A;  4M78 D;  4HT8 A;  3M5A A;  2CP6 A;  2FRY A;  3BE3 A;  2KYB A;  4N4H A;  4BI4 A;  3CME T;  3CC4 T;  3MEW A;  3HL8 A;  2ED1 A;  1ZSZ C;  1U06 A;  2C06 A;  2RJD A;  2RHZ A;  3VV0 A;  1W2B P;  1X27 A;  2NUT B;  3GP8 A;  4XTY A;  3WVD B;  2DK3 A;  3G7Z A;  1GFD A;  3INZ A;  1KQS P;  1XQH A;  1NJI R;  2DRK A;  4BDY A;  6AT1 B;  1UE9 A;  3OA6 A;  4DQ2 A;  3UT1 A;  2AT1 B;  2CKK A;  2RHY A;  1M3B A;  4RTX A;  4LN2 A;  3CXC P;  1IB8 A;  4N4I A;  1RL2 A;  1M9S A;  1QW1 A;  2DIQ A;  3LH0 A;  4F7U A;  2Y4X A;  4HKE A;  3CPW P;  3JCM c;  1R77 A;  1D1C A;  2HSP A;  3QO3 A;  4KBM B;  1YJW A;  1I1J A;  2QA4 T;  5KYX B;  1G8X A;  3QZ9 B;  4C8Q B;  4CC2 A;  2BZX A;  4M77 B;  4II1 A;  2C0T A;  1S72 A;  3EHQ A;  2HBW A;  3JB9 F;  3MP1 A;  2WSF E;  4BE0 A;  2HDA A;  4A4H A;  3PGG A;  2EKO A;  2QQ9 A;  3RIR A;  3RKY A;  3V7S A;  3M0S A;  2I2L A;  2OTJ T;  1HJD A;  4NL2 A;  4LDY A;  1NLP C;  1MND A;  3U23 A;  2QK0 A;  3G4S T;  1VQ7 Q;  1X01 A;  4J6X A;  1I8F A;  4OP0 A;  2MK5 A;  1M1K C;  1WPY A;  3HFN A;  4XTX A;  2OAU A;  2QTV A;  1SHG A;  2VUB A;  1RAA B;  2HCK A;  3VYG A;  3BDL A;  1F1B B;  4M7A F;  2YRV A;  3Q1J A;  4M75 C;  4XU2 A;  4C5E A;  4QVZ A;  4EPC A;  4ORZ A;  3QWY A;  4ANJ A;  3UPU A;  2NYS A;  1Q86 U;  1UG1 A;  2AKK A;  5GAO q;  4F16 A;  2DJQ A;  2VGM A;  4EMH A;  2YXY A;  4F17 A;  1BBZ A;  3M57 A;  3GBQ A;  1IHW A;  3JV3 A;  3FB9 A;  3CCM T;  2NUP A;  4BI8 B;  1KC8 U;  1FXX A;  2RQU A;  2BKD N;  3LGL A;  4M78 E;  4J5Y A;  4WTO B;  1GCP A;  2BUD A;  4BAC A;  3EHR A;  2ZPE B;  4FIB A;  5IN1 A;  5LJ3 f;  1BI3 A;  5C6S A;  5J26 A;  1AZG B;  5IH2 A;  2CSQ A;  2DXB A;  4RMO A;  2LCL A;  3TVT A;  1Q81 U;  3LGF A;  2DVJ A;  2JTM A;  4MZM A;  1W70 A;  4C0Z A;  4XTZ A;  3FJP A;  2EQM A;  2HD0 A;  1EZZ B;  1TSF A;  2L0A A;  3M53 A;  1KSW A;  2VC8 A;  4OMN A;  4HXJ A;  1M2V B;  5GAM h;  3JCM V;  3C12 A;  1JJ2 P;  2M9U A;  4RTZ A;  4EMK A;  1D0Y A;  4MDX A;  1UFF A;  1ZQ1 A;  4FYV B;  1TS9 A;  4CC7 A;  1PD1 A;  3QKJ A;  1ARK A;  1YIT A;  4JUV A;  4QQ6 A;  2LX7 A;  3GOX A;  2J7I A;  4LDU A;  1N9R A;  2OJ2 A;  3CBM A;  4QT7 A;  4M75 F;  1WHL A;  4OGC A;  2YLB A;  2CUB A;  3I55 A;  2PNI A;  2DX1 A;  4N4G A;  1YI2 A;  2F69 A;  2LQW A;  3SEM A;  3UAT A;  1YFN A;  1Q7Y R;  3SWN A;  1GRI A;  1VQM Q;  2EQK A;  3TCJ A;  2QDY B;  2SEM A;  5L8R E;  3JCM b;  1I07 A;  1LPL A;  2KE9 A;  1ABQ A;  3CCE Q;  2L3S A;  4M77 G;  2ENM A;  3OYM A;  2BIV A;  1PRM C;  3CC4 A;  4M7D C;  4E7H A;  5KYW A;  2MWO A;  3EG0 A;  1YHQ T;  3GNG A;  1D3B B;  5FU6 C;  4RCC A;  2OTL Q;  3QBY A;  4C92 F;  2HSE B;  4XQ3 A;  5LJ5 f;  1QVP A;  4ESR A;  1AWJ A;  2F2X A;  4J83 A;  1B07 A;  2A3L A;  3OYI A;  1H64 1;  2EJ9 A;  3VJP A;  5HKC A;  2EWN A;  1BIA A;  1E6H A;  4A4F A;  1NYG A;  1WJQ A;  2O2O A;  1XTD A;  2JS0 A;  2R5M A;  1BCM A;  3LW5 E;  2LVM A;  2DA9 A;  4CC4 B;  4R56 A;  3A8H B;  4B9W A;  1U3O A;  3OYK A;  2HZY A;  2VAS A;  3ULR B;  4DEY A;  1BI2 A;  1XOV A;  2DD5 A;  3G1J A;  4OVA A;  2O31 A;  2WAC A;  1B34 A;  5J3B A;  4CI0 C;  2FL7 A;  2V8K A;  3N5B B;  1VQ7 A;  5GAN f;  2FHD A;  5GMK m;  3UDC A;  3S3N A;  2QQB A;  2K9G A;  5HK3 A;  2YSQ A;  4A53 A;  1UTI A;  5GMK e;  1EFN A;  2W0Z A;  1SEM A;  1VIE A;  2JN0 A;  2VV5 A;  5CKB A;  4KGX B;  3H0F A;  4BE1 A;  3CMA T;  1UJY A;  5GAN 5;  3G4S A;  1TTH B;  1RUW A;  2QAS A;  3CCS T;  1AVZ C;  4KGV B;  2CRE A;  1FWZ A;  1Z9Z A;  1BCO A;  3DLL A;  3QJ6 A;  1KQ2 A;  1Y96 B;  3CCV T;  3I9Q A;  4M7A A;  1GBQ A;  2RQV A;  4PJJ A;  4ZGD B;  2PVD B;  5A0G A;  3TQ7 P;  3R6O A;  1TUC A;  1OZ2 A;  3V7R A;  2VB6 A;  4LD9 K;  1VQL T;  1M3A A;  4RCB A;  4MZT A;  1E6G A;  3CCM A;  3X25 B;  2HQX A;  2YRD A;  4IUP A;  5GMK j;  2EQI A;  4E7I A;  2M0Y A;  3JCM f;  2L89 A;  3JB9 H;  4X9D A;  2VYT A;  1C1A A;  2A0F B;  2ZPB B;  3MEA A;  2ATC B;  5CQX A;  1Q86 C;  1G5V A;  3TEE A;  3E9G A;  3OS2 A;  3E9F A;  3UA7 A;  2XKO C;  2RI2 A;  5IXB A;  1W2B A;  2KY9 A;  2EQJ A;  1PD0 A;  3G71 Q;  1KC8 C;  1KQS A;  4JZ4 A;  4F04 B;  2RO0 A;  2RB6 A;  4FW2 A;  3EFO A;  1YJ9 T;  2A36 A;  3JCM P;  2K5I A;  1H8K A;  3CXC A;  1QCF A;  3EH1 A;  4ZNX A;  2O88 A;  1UGP B;  2X3W D;  4RTU A;  2RH2 A;  1RAF B;  1Q81 C;  3M0T A;  1QCN A;  1JO8 A;  1WNL A;  3RKX A;  4F7U F;  2DLP A;  2HMA A;  1IO6 A;  3X26 B;  3OBY A;  1VQ4 Q;  1UEB A;  1M30 A;  1CKB A;  3BW1 A;  2PTK A;  4RTY A;  1SF9 A;  3FJ5 A;  1KQ1 A;  2PVO B;  2DXU A;  2CZ7 B;  3VUB A;  1R0B G;  2ZPG B;  2F5K A;  4BD3 A;  2BE9 B;  2JW4 A;  1K0X A;  4RG2 A;  4EDU A;  3VS6 A;  1WI7 A;  5GMK l;  1YJW Q;  2VWF A;  5LJ3 h;  3QDR B;  2DBM A;  3JCM J;  4E2F B;  4BI3 A;  1S72 Q;  2FRW A;  1YHQ A;  5I2M A;  3H0H A;  3SB2 A;  1K9M R;  4EMK C;  4C92 A;  1VQP Q;  4M7D G;  5IHK A;  1HYO A;  2VVK A;  2LP5 A;  4C5G A;  1D0X A;  2RJE A;  1Y71 A;  1YCY A;  1UJ0 A;  2X3X D;  3L2Q A;  4J9H A;  1GCQ C;  5FLX E;  5IHI A;  2JM9 A;  2HKN A;  1H3Z A;  3GF5 A;  2E3H A;  2DL4 A;  5FU7 C;  4JZ3 A;  2DF6 A;  3SWN C;  2X4J A;  1EX4 A;  3EGX B;  1NLO C;  1IZ6 A;  2CP0 A;  3EG9 B;  3CC2 T;  4J9B A;  3VS0 A;  1HXD A;  5EG2 A;  4D6W A;  2E5K A;  1S1N A;  1IGU A;  3PTA A;  3RBB B;  3I5R A;  1AZE A;  4DBH A;  4PJO F;  3I35 A;  2G6F X;  2E41 A;  2P84 A;  3C4S A;  1OI1 A;  2YDL A;  4C5I A;  2GFA A;  1JJ2 A;  3CMA A;  1V1C A;  5I21 A;  5GAO m;  1OU9 A;  1QVG P;  1ZHI A;  1T3S A;  2MF2 A;  1W2B S;  2ABL A;  1ZA1 B;  1NEB A;  2L3R A;  2QTX A;  3OMC A;  2DET A;  1I81 A;  3F70 A;  2ESW A;  1NJI U;  2QXF A;  1KQS S;  1VQN T;  2L8D A;  1YIJ T;  4AFZ C;  1G2B A;  4MML A;  4M77 D;  2ZCF B;  2RD1 A;  4QVD A;  1YJN T;  2EGC A;  3QPH A;  4LE9 A;  4XTW A;  4F7U G;  4RKU E;  1K76 A;  1VQO Q;  1JBM A;  2DNU A;  1SG5 A;  3CXC S;  3RKW A;  4OML A;  4DOV A;  1VQL A;  3NTH A;  1VQ8 T;  1WX6 A;  5FRO A;  1H92 A;  1E7O A;  4FCY A;  3MKD A;  1XNI A;  1N9S A;  3RUX A;  1YIT Q;  2DEU A;  5CO7 A;  2KNB B;  2LJ1 A;  5D6X A;  3QDF A;  1M1F A;  4LDV A;  5GAN 4;  5GAO r;  1VQ6 T;  1UGV A;  3G71 A;  4OB0 B;  2LTO A;  2K6D A;  3O5Z A;  4OMO A;  3CCR Q;  4O6J A;  3RMQ A;  3OYB A;  4GY5 A;  3FLG A;  2CZ1 B;  3VKI A;  4R0K A;  1PWT A;  3I55 Q;  1NBE B;  4PJM A;  2DM1 A;  2RF0 A;  1YI2 Q;  1C6V X;  4J9C A;  1N6A A;  1QCO A;  4RTW A;  4FSX A;  4OMF B;  3TRE A;  5GAN h;  3CCJ T;  2X9H A;  2FO0 A;  4LUE A;  1QVF P;  3PFS A;  1LJO A;  2QEX T;  3OMG A;  4Z89 A;  2IIM A;  2RN8 A;  2Z0W A;  2GNC A;  1YWP A;  4J7F A;  1WHK A;  3S3O A;  4M7A C;  1ZUU A;  4RTV A;  3CME Q;  3CC4 Q;  3GLX A;  1VA7 A;  1VQ4 A;  2EYQ A;  2QQR A;  3EAE A;  4M78 C;  5CKE A;  1G3Y A;  5GAO n;  2YWW A;  2RQW A;  5HK0 A;  3EG3 A;  1SSF A;  3BFM A;  4LDX A;  1KD1 R;  2WSE E;  5DY9 A;  2LT4 A;  4FW1 A;  1A0N B;  4BUG A;  3DB3 A;  2RHU A;  2COW A;  2IPO B;  8AT1 B;  1WFW A;  2CZ6 B;  1BIB A;  4EIK A;  3PT9 A;  1WHG A;  4DA4 A;  2DL7 A;  4KH1 B;  4HCC A;  5D6Y A;  1PRL C;  1OZ3 A;  1RAG B;  4BY6 C;  3OYC A;  3BDU A;  1VQP A;  1O75 A;  3KFV A;  3JCM h;  1WA7 A;  2QA4 Q;  3FEO A;  1ZSZ B;  3NFC A;  5IHN A;  3A1P A;  2GTJ A;  1JQQ A;  3OYJ A;  4OF1 A;  1MMG A;  2RK1 A;  1SPK A;  2DJZ A;  2O4X B;  2CSI A;  4D8K A;  1OPL A;  4RUG A;  2DIL A;  2C0O A;  3EFR A;  2KRN A;  2A7Y A;  2XU8 A;  4C8Q E;  2OTJ Q;  3X24 B;  4M77 E;  1B3Q A;  5KYN A;  2P4R A;  4AG2 C;  3L2R A;  2JS2 A;  1OX9 A;  1JJ2 S;  2GGR A;  3G4S Q;  1UGS B;  4QW2 A;  2LQ8 A;  2EW3 A;  2E1H A;  4R55 A;  1MGQ A;  1AWO A;  1WXB A;  3RES A;  4M78 F;  1WQW A;  1JB0 E;  2OX7 A;  5LJ3 j;  1K1Z A;  4OMQ A;  1WDX A;  1O9S A;  5A0L A;  1SSH A;  1U8R A;  2JJ9 A;  1WJS A;  3QHS A;  1MMA A;  3CCL T;  1Q7Y U;  1C0M A;  1QWF A;  2D8J A;  3CCM Q;  5CK9 A;  4PJO A;  4C92 C;  5IAY A;  2V8J A;  1UGQ B;  3EFS A;  5CKD A;  1K9A A;  4RTT A;  1T3L A;  3X28 B;  3A8O B;  2K7A A;  2F5T X;  2RQR A;  3OQ5 A;  5AYF A;  4E7J A;  1VQO A;  3QSU A;  2JOY A;  1HK9 A;  3LH5 A;  2MYS A;  5D7U A;  1RLQ C;  1Q82 R;  2CS7 A;  4MZP A;  3V7C A;  4M75 B;  1VQK T;  3NTI A;  5KYY A;  1YIJ A;  1RI9 A;  2JXB A;  2DZ9 A;  3CD6 T;  1G3W A;  4C0G A;  2LX9 A;  3CCR A;  1GCQ A;  1DJ7 B;  4OMP A;  1PHT A;  4JS4 A;  3EGD A;  4M7D D;  2SRC A;  3G6E T;  2HBP A;  4PLI A;  3MO8 A;  4FM4 B;  1KIK A;  3PVQ A;  1NJI C;  2JM8 A;  1Y0M A;  3JB9 G;  2LCC A;  5FRM A;  4A4E A;  2FPF A;  3LWI A;  1V29 B;  1IGQ A;  2GFU A;  1N27 A;  5HCK A;  3CME A;  2JVV A;  1OPK A;  3H41 A;  5LJ5 j;  3CCJ A;  1M4Z A;  2XIC A;  4OMM A;  1ZA2 B;  2DBK A;  1TUG B;  2QEX A;  2LJ0 A;  2PUO B;  4Y28 E;  3FC3 A;  1J3T A;  2A37 A;  3OS1 A;  2KRO A;  2EYX A;  4QKU A;  2KRS A;  3OSS C;  2DXC A;  4M7A G;  2XG8 D;  2P0P A;  1TUD A;  1YHQ Q;  4N0A A;  2MOX A;  5GAO p;  1NZ9 A;  3WXM B;  5I22 A;  4KGZ B;  1PG5 B;  3CCQ T;  5KE3 A;  2DIG A;  2KVQ G;  1CSK A;  3C95 A;  2QGG A;  3HRT A;  2DTI A;  1TG0 A;  2KSS A;  2NUT A;  1NM7 A;  2ZPI B;  3RMS A;  2QA4 A;  3OYH A;  1SRL A;  1G83 A;  2V8I A;  4QQG A;  5HY6 A;  5AT1 B;  1SKU B;  1HD3 A;  5GAN 7;  1I5L A;  2J06 A;  2CGH A;  3HFO A;  4XAX B;  3ASK A;  5LJ5 d;  1WHM A;  4OB3 B;  3ZBD A;  4ZGE B;  3RDV A;  2OTJ A;  4M7D B;  1QVG A;  8ATC B;  1OEB A;  2FVU A;  2C0I A;  5FU6 B;  1OYX A;  5FW9 A;  2Y90 A;  1X6O A;  4A4G A;  4Y92 A;  5KYX A;  2XMF A;  3P8D A;  3EG2 A;  4C8Q A;  2RI5 A;  4IUV A;  2RNA A;  4M77 A;  4B9X A;  5CR2 A;  2YUQ A;  5I2S A;  2LMJ A;  3RER A;  2CZ0 B;  3VRY A;  1N5Z A;  3ME9 A;  3S3M A;  2EGE A;  4JJD A;  2A08 A;  4IUU A;  2MWP A;  2AZS A;  3CMA Q;  1UHC A;  3WVE B;  1RAE B;  3V8J A;  3I56 T;  1NYF A;  3CCS Q;  3MEU A;  4M75 G;  2DYB A;  1NEG A;  1N8R R;  3LX7 A;  4M7D E;  3R6N A;  3CCU T;  5CKH A;  3REA B;  3OYA A;  4M78 A;  3DB4 A;  3CCV Q;  1P92 A;  1I0C A;  2DTH A;  1K8A R;  1BKB A;  4GLK A;  3ZEH A;  3QG1 A;  2M1H A;  4DOW A;  2KR3 A;  4E47 A;  2LNH B;  1VQL Q;  4L5G A;  2XK0 A;  3CCL A;  1VUB A;  4FL6 A;  3RNJ A;  1QVF A;  2GQV A;  2X4W A;  1RAB B;  4J9I A;  1T0H A;  2DPP B;  2IVW A;  2D1X A;  2D6F A;  4AFQ C;  2KT1 A;  4C92 G;  1YCS B;  2VGN A;  2E5Q A;  2HKQ B;  3GNF B;  5GAM e;  1U5S A;  4E6R A;  1JU5 C;  3OS0 A;  2A28 A;  4RG8 A;  3QWX X;  4B6M A;  1WJR A;  1XJW B;  1Q7Y C;  1K9M U;  2RA2 A;  4F7U B;  1KG1 A;  1ZLM A;  2P0Q A;  2DZC A;  1K73 R;  1D0Z A;  1UGR B;  2K57 A;  1ZBJ A;  2EFI A;  3M0P A;  1PC0 A;  4C0D C;  1YJ9 Q;  2CDT A;  1RAH B;  5M9O A;  1FMK A;  1PKS A;  1M8M A;  4XK8 E;  2BZ8 A;  1M2V A;  1CKA A;  3A8M B;  3DKM A;  3L42 A;  3V8K A;  1OU8 A; 
#chains in the Genus database with same CATH homology
 3ZL7 C;  1BBZ A;  3GBQ A;  2FG0 A;  2CH4 A;  3JV3 A;  2VKN A;  2FPE A;  4J9E A;  1GFC A;  2KNB B;  2LJ1 A;  1UGV A;  2RQU A;  3EG1 A;  2K6D A;  3O5Z A;  1RLP C;  5L23 A;  2LZ6 B;  1GCP A;  4OMO A;  3EHR A;  1T0J A;  2J05 A;  4R0K A;  1PWT A;  2KYM A;  1WXU A;  2DM1 A;  2RF0 A;  2O9V A;  1AZG B;  5IH2 A;  1VYU A;  2CSQ A;  1AOJ A;  4J9C A;  4RTW A;  5I11 A;  2JT4 A;  2L3P A;  3TVT A;  3PVL A;  5EC7 A;  2AKL A;  1ZUK A;  2DVJ A;  1W70 A;  2FO0 A;  4LUE A;  2D8H A;  3SHW A;  2IIM A;  2RN8 A;  4HVW A;  4Z89 A;  2GNC A;  2L0A A;  1KSW A;  1YWP A;  2ROL A;  2RPN A;  4OMN A;  4HXJ A;  3M0R A;  1ZUU A;  4RTV A;  2JMC A;  2LCS A;  1VA7 A;  4D8D A;  1NG2 A;  4RTZ A;  3TSZ A;  3A98 A;  2LJ3 A;  4HVU A;  1UFF A;  4CC7 A;  1ARK A;  2RQW A;  3EG3 A;  2LX7 A;  2J7I A;  2OJ2 A;  4QT7 A;  1H3H A;  2GTO A;  1A0N B;  1YWO A;  2CUB A;  2PNI A;  1K0S A;  3VS5 A;  1ZUY A;  2DX1 A;  3C0C A;  1WFW A;  4EIK A;  2LQW A;  3SEM A;  3UAT A;  2DL7 A;  1PRL C;  1GRI A;  2PZ1 A;  1ZX6 A;  1QWE A;  2SEM A;  3KFV A;  1I07 A;  1WA7 A;  2KE9 A;  3TSW A;  1ABQ A;  2KEA A;  2L3S A;  3UA6 A;  2ENM A;  1AWW A;  5IHN A;  2GTJ A;  1JQQ A;  4GBQ A;  1PRM C;  1SPK A;  4D8K A;  2FEI A;  2CSI A;  1K4U S;  2EYY A;  1OPL A;  3EG0 A;  2GBQ A;  5IXF A;  1X2K A;  4RUG A;  2DIL A;  2C0O A;  1Y57 A;  4AFU C;  2KRN A;  4ESR A;  1AWJ A;  2F2X A;  2AK5 A;  2KGT A;  1B3Q A;  2NUZ A;  1B07 A;  1HSQ A;  2P4R A;  3M0U A;  4AG2 C;  2B86 A;  2JS2 A;  1KJW A;  2BTT A;  1E6H A;  2GGR A;  1NYG A;  1AD5 A;  2O2O A;  2DL8 A;  2EW3 A;  2JS0 A;  1X2Q A;  1PKT A;  1AWO A;  1WXB A;  2KBT A;  2W10 A;  4LNP A;  2DA9 A;  4X1V A;  4CC4 B;  1VYV A;  2L3Q A;  3NHN A;  3CQT A;  2CH4 W;  1YP5 A;  1K1Z A;  1JXO A;  1U3O A;  2F2W A;  4OMQ A;  4F14 A;  1WDX A;  3REB B;  2EYZ A;  1SSH A;  3ULR B;  2J6O A;  4DEY A;  1XOV A;  1YN8 A;  1BU1 A;  2O31 A;  2CUD A;  2OI3 A;  3IQL A;  3H0I A;  2MCN A;  1QWF A;  2D8J A;  1AWX A;  2K9G A;  2YSQ A;  1YNZ A;  4FSS A;  1UUE A;  1UTI A;  3VS3 A;  1WYX A;  1EFN A;  1K9A A;  2W0Z A;  1SEM A;  2EPD A;  2EKH A;  4RTT A;  1GBR A;  1T3L A;  3UF4 A;  3H0F A;  4Z8A A;  2K7A A;  1KFZ A;  1BK2 A;  1UJY A;  2RQR A;  1W1F A;  1RUW A;  1X43 A;  3EGU A;  3LH5 A;  1UHF A;  1RLQ C;  1AVZ C;  2CRE A;  1Z9Z A;  2EGA A;  3VS2 A;  1MV3 A;  1RI9 A;  3I9Q A;  2JXB A;  5FWB A;  1GBQ A;  2RQV A;  3VS7 A;  1PNJ A;  1WLP B;  1OOT A;  1GCQ A;  1TUC A;  2DL5 A;  1MV0 B;  3NGP A;  4J9G A;  4IIO A;  4OMP A;  1AEY A;  1PHT A;  2RQT A;  1M3A A;  2SRC A;  1E6G A;  1KIK A;  3PVQ A;  2JM8 A;  1Y0M A;  2CT3 A;  4AFS C;  2EQI A;  2KT8 A;  2M0Y A;  1GL5 A;  2FPF A;  1X69 A;  1JXM A;  2DE0 X;  3UA7 A;  2ED0 A;  5HCK A;  3VS1 A;  1OPK A;  3H41 A;  5IXB A;  4JJC A;  1QKW A;  1BB9 A;  2CT4 A;  1X6G A;  4OMM A;  3VRZ A;  2JMA A;  1LCK A;  2DBK A;  2LJ0 A;  2ROT A;  1Z9Q A;  4JZ4 A;  4DEX A;  1J3T A;  2A37 A;  2KRO A;  2DMO A;  2A36 A;  1W6X A;  2EYX A;  2DRM A;  2KRS A;  1VYT A;  4HCK A;  1H8K A;  2EBP A;  1QCF A;  4ZNX A;  2O88 A;  1TUD A;  2X3W D;  2LQN A;  2MOX A;  1WIE A;  4RTU A;  5I22 A;  4LUD A;  3M0T A;  1JO8 A;  2F2V A;  1CSK A;  2V1R A;  2ECZ A;  3NMZ C;  1X6B A;  2YUO A;  2DLP A;  1TG0 A;  2QDL A;  1UEC A;  1NM7 A;  2EYW A;  2M51 A;  4IIM A;  1IO6 A;  2O9S A;  1SRL A;  1G83 A;  2V1Q A;  4KRT A;  2KXD A;  2D0N A;  1M30 A;  1CKB A;  2J6F A;  1HD3 A;  2PTK A;  3THK A;  2MIO A;  4RTY A;  3FJ5 A;  3PE0 A;  2FPD A;  2J06 A;  2BZY A;  5ECA A;  2OAW A;  2JW4 A;  4M4Z A;  5FWC A;  1JEG A;  1K0X A;  3VS6 A;  1WI7 A;  2KRM A;  2VWF A;  2FRY A;  4CC3 A;  1OEB A;  2KYB A;  2C0I A;  2DBM A;  1OV3 A;  5FW9 A;  2JTE A;  4Y92 A;  2FRW A;  1UDL A;  2ED1 A;  2YUN A;  3H0H A;  1U06 A;  2YUP A;  2XMF A;  2K79 A;  3EG2 A;  2RNA A;  1SHF A;  3M0Q A;  1X27 A;  2YUQ A;  5IHK A;  2LMJ A;  1FYN A;  1QLY A;  2VVK A;  2LP5 A;  3VRY A;  1N5Z A;  2J6K A;  1GFD A;  2L2P A;  3I5S A;  2EGE A;  4HVV A;  2YT6 A;  4JJD A;  1M27 C;  5GJV B;  2A08 A;  1UJ0 A;  2DRK A;  2X3X D;  2AZS A;  1UHC A;  4J9H A;  1GCQ C;  1UE9 A;  1NYF A;  5IHI A;  2JM9 A;  4JJB A;  2DYB A;  1NEG A;  1M3B A;  4RTX A;  4LN2 A;  3R6N A;  2DL4 A;  4JPB W;  1MUZ A;  2KXC A;  3REA B;  2HEQ A;  4K11 A;  4JZ3 A;  1ABO A;  2DF6 A;  4A63 B;  1NLO C;  1I0C A;  2HSP A;  2DL3 A;  1I1J A;  4J9B A;  4Z88 A;  3VS0 A;  2H8H A;  2KR3 A;  2LNH B;  4CC2 A;  2E5K A;  1SRM A;  2BZX A;  1S1N A;  3NPF A;  2C0T A;  3EHQ A;  2HBW A;  4J9F A;  3RNJ A;  3RBB B;  2HDA A;  3I5R A;  1AZE A;  4WCI A;  3I35 A;  4J9I A;  2NWM A;  1T0H A;  2G6F X;  2D1X A;  3M0S A;  4J9D A;  4AFQ C;  2KT1 A;  1HJD A;  2YDL A;  1YCS B;  1WXT A;  1NLP C;  1U5S A;  4E6R A;  1JU5 C;  2EVR A;  2A28 A;  1V1C A;  1QKX A;  2K2M A;  3QWX X;  2RMO A;  3U23 A;  2I0N A;  4AG1 C;  1ZSG A;  1M3C A;  2AZV A;  1T3S A;  1ZLM A;  2ABL A;  1NEB A;  1ZBJ A;  2ESW A;  1SHG A;  3M0P A;  2HCK A;  1G2B A;  4AFZ C;  2CDT A;  2EGC A;  4LE9 A;  2K3B A;  1FMK A;  4ORZ A;  1K76 A;  1PKS A;  3QWY A;  1M8M A;  1UG1 A;  2DNU A;  2AKK A;  2BZ8 A;  4F16 A;  1CKA A;  2DJQ A;  2GQI A;  4OML A;  3VS4 A;  1WX6 A;  4GLM A;  1H92 A;  5GJW B;  1E7O A;  4F17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...