2SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
molecule keywords PROTEIN (SEX MUSCLE ABNORMAL PROTEIN 5)
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2semA00
1LCKA 2L3QA 1M8MA 4J9HA 4AFUC 5IXFA 1CKAA 2KRSA 4GBQA 2EPDA 5GJWB 2YDLA 1JEGA 2GNCA 3H0HA 1H8KA 2GGRA 1PRMC 2XMFA 2W0ZA 1ZUUA 2KR3A 2I0NA 3VS5A 1AWWA 2KXCA 1ZUYA 2LJ1A 2DYBA 2DF6A 2X3WD 2V1RA 3EG3A 2YUNA 2O31A 2VKNA 1UUEA 3C0CA 4D8KA 2BZXA 1B3QA 1SPKA 2NWMA 2CSIA 4HVWA 1IO6A 1M3CA 4M4ZA 4OMOA 4F16A 2J6KA 1UFFA 1NM7A 2C0IA 2EGCA 2FO0A 1BK2A 1KIKA 2BZYA 1KFZA 1G83A 3FJ5A 1RLQC 2EYYA 3A98A 3REAB 1YN8A 4HXJA 2JM8A 4RTWA 4RUGA 1B07A 1UDLA 2GTOA 2BZ8A 3TSZA 2C0TA 1AEYA 2JW4A 3M0TA 2DJQA 2DL7A 1JU5C 2CDTA 3VS7A 2ECZA 2PNIA 2OI3A 3H41A 2KT8A 1EFNA 1GFDA 4J9EA 2JMAA 3NPFA 2GBQA 4IIOA 1ZLMA 3I35A 1AD5A 1YNZA 4F17A 2SRCA 1U3OA 1G2BA 2AKKA 1UJYA 1PKSA 1AVZC 1GCPA 1AWXA 4DEYA 2KNBB 2K2MA 5FWBA 4RTXA 4Y92A 2KYMA 1OPLA 4D8DA 2EYZA 3QWYA 1X6GA 5I22A 2DLPA 2RQRA 1K0SA 2FPEA 1WLPB 2AZSA 4RTUA 2DM1A 2V1QA 1WX6A 2EYXA 2G6FX 4OMLA 1S1NA 1PRLC 5EC7A 4OMQA 3SEMA 4CC7A 4F14A 2ED0A 1XOVA 3UA6A 3EGUA 1YP5A 2GTJA 4ZNXA 5HCKA 3QWXX 1WDXA 4OMMA 3NHNA 1QWEA 2D8HA 4LNPA 2DBMA 2DMOA 2CH4A 1WXBA 3EHQA 3UF4A 1U06A 2CUBA 2A08A 1I0CA 2O9SA 1UTIA 2RQTA 2L0AA 4A63B 2KROA 2EQIA 5IHIA 2YUOA 1NLOC 2K3BA 2M0YA 1WFWA 1CSKA 1JQQA 2C0OA 2J6OA 2K7AA 2KXDA 1M30A 1M27C 4J9GA 2FEIA 3EHRA 1E7OA 1NLPC 1X43A 2RNAA 3VRZA 1MV3A 2CH4W 2MIOA 2YSQA 2QDLA 2F2VA 2LQWA 4AFZC 5IHNA 1K4US 2EKHA 1ARKA 3PE0A 3M0PA 2O88A 4OMPA 2O2OA 2O9VA 3EG2A 3H0FA 1QKXA 2L3PA 1M3AA 2D0NA 2X3XD 4J9BA 1OPKA 4EIKA 1AOJA 2FRWA 4J9IA 1WIEA 2KYBA 2DE0X 2EGEA 4FSSA 1GCQA 3M0SA 1YWOA 4Z89A 1X27A 2DRMA 3LH5A 1VA7A 3R6NA 3VS0A 1W1FA 3CQTA 3IQLA 2H8HA 1VYVA 1BB9A 1OEBA 2CT3A 1PNJA 2KEAA 2DA9A 1E6HA 1GRIA 3EG1A 3RBBB 1A0NB 2KBTA 2DBKA 2J6FA 1HSQA 2GQIA 4KRTA 2ESWA 1ABQA 1UJ0A 1WI7A 4WCIA 4CC2A 3EG0A 2HSPA 1KSWA 4ORZA 1GBRA 4X1VA 1K76A 5FWCA 1PWTA 1ZUKA 2JXBA 4OMNA 2A36A 1I1JA 3ULRB 1Y57A 2W10A 4CC3A 2MOXA 1RI9A 1JXOA 4GLMA 2J7IA 1GL5A 2OJ2A 1UGVA 4ESRA 1UECA 1Y0MA 2HCKA 2K79A 2HEQA 3JV3A 2MCNA 4IIMA 2BTTA 2JS0A 4JPBW 3PVQA 1UG1A 2L3SA 3SHWA 5IH2A 1QWFA 3O5ZA 1SHGA 2EYWA 4RTZA 4J9FA 2ABLA 3TVTA 2EBPA 1HD3A 1OOTA 2LJ3A 2LQNA 3VS3A 2FPDA 2K6DA 2KE9A 1N5ZA 2ROTA 1GBQA 2RPNA 4RTYA 2ED1A 1OV3A 2HBWA 1UHFA 2M51A 4AFSC 1RUWA 2FG0A 1YCSB 2ROLA 2RMOA 1NYGA 1JXMA 2RQVA 1SRMA 5FW9A 2CREA 1BU1A 1ZSGA 5IXBA 3H0IA 4JJDA 1FMKA 2F2WA 2CT4A 2JS2A 4JZ4A 2D1XA 2LZ6B 2KRMA 2DILA 2OAWA 1X2QA 1AWOA 4JJBA 2AK5A 2AKLA 1NEGA 2DL5A 2JT4A 1T0HA 4R0KA 1SEMA 3VS6A 1E6GA 3RNJA 3KFVA 1YWPA 2HDAA 2DL8A 2ENMA 4LE9A 2KRNA 1X2KA 1KJWA 1W6XA 1ZBJA 2LJ0A 4HVVA 4J9CA 4K11A 1X69A 2JTEA 2DL4A 3VRYA 1BBZA 2JM9A 1UE9A 3ZL7C 1NYFA 1J3TA 5GJVB 1MV0B 2DNUA 1K1ZA 1SHFA 1H3HA 2A28A 2YUQA 4Z88A 2B86A 2LP5A 2A37A 1ABOA 3M0UA 3THKA 2AZVA 2RF0A 1W70A 1WXTA 5ECAA 4AG1C 4HCKA 4LN2A 1Z9ZA 1U5SA 2E5KA 2L2PA 4J9DA 5IHKA 3M0QA 1I07A 1X6BA 3NGPA 3PVLA 1MUZA 4AG2C 4DEXA 3VS2A 2CUDA 2FRYA 2SEMA 2NUZA 4JZ3A 2D8JA 2LMJA 1T3SA 3U23A 1SSHA 1QLYA 3M0RA 2DVJA 4QT7A 3GBQA 1VYUA 2YUPA 4CC4B 1VYTA 3I5RA 2IIMA 4LUDA 5I11A 3VS4A 2RQWA 1RLPC 2RN8A 1K9AA 1WXUA 4LUEA 1ZX6A 3I9QA 2LX7A 1QKWA 2KGTA 3VS1A 1CKBA 2PZ1A 2VVKA 2YT6A 2J05A 2DX1A 1WYXA 2FPFA 2F2XA 3I5SA 1PKTA 2EW3A 3NMZC 3REBB 4HVUA 1NG2A 1WA7A 3UA7A 1QCFA 1V1CA 3TSWA 2RQUA 4JJCA 1AZEA 2K9GA 1GFCA 2DRKA 2DL3A 1AWJA 1TG0A 2EGAA 1HJDA 4AFQC 2LNHB 1K0XA 1NEBA 1UHCA 1T0JA 2P4RA 1Z9QA 1M3BA 5L23A 1T3LA 1AZGB 1FYNA 2VWFA 4E6RA 2KT1A 4Z8AA 2CSQA 3UATA 1JO8A 2JMCA 2LCSA 1TUDA 1GCQC 2J06A 2EVRA 1PHTA 1H92A 4RTTA 1TUCA 4RTVA 2PTKA 1SRLA
chains in the Genus database with same CATH superfamily
1LCKA 2MPXC 3MJXA 4KBMB 1CKAA 3GP8A 3OYDA 4XTVA 3V7SA 2YDLA 1H8KA 3J7AF 2PQWA 2LX9A 3G71Q 2KR3A 2I0NA 4DOWA 3L42A 3R6OA 3JCMX 1HXDA 3CCUQ 3HL8A 4D8KA 2BIVA 1K73U 2NWMA 4ATOA 4HVWA 1IO6A 1B34A 1K9MU 4OMOA 4F16A 2MK5A 2VXFA 2MMPA 4VUBA 2ZCFB 1VQ4T 2OTLT 4BDYA 2C0IA 1KIKA 2BZYA 2ZPEB 4NL2A 1Q81U 1KFZA 4E7HA 1G83A 3FJ5A 4M7DE 1D1BA 5GAMd 2EYYA 1HYOA 4HXJA 4RUGA 2JTFA 1UDLA 1DJ7B 2JW4A 3CMET 3JCMd 3URGA 1JU5C 2V26A 2CDTA 4C8QD 3CCLQ 4LDVA 4BI3A 3M53A 4HCZA 3QIIA 1KC8R 1WQWA 4J9EA 3OB9A 1QVGA 3I35A 2YHTA 5KCHA 4F17A 2QA4A 4C92B 1U3OA 4HT8A 1C6VX 3JRZA 3OS2A 3OMCA 4KULA 2BKDN 1RABB 2DTOA 1AVZC 5GAOl 2QEXT 4QVDA 2KNBB 2K2MA 1NJIC 1C0MA 1OPLA 4F7UG 4D8DA 4C8QG 1W2BA 2HZYA 2DO3A 3I56A 1N27A 5I22A 2DLPA 2RQRA 4JS4A 4EMKC 5A0DA 4IUQA 2G6FX 1MMGA 1S1NA 2HKQB 4FT4A 5EC7A 5GANd 4R56A 3SEMA 4ZGEB 4M7AE 4CC7A 4J6WA 1XOVA 2LT4A 3OSVA 5FRNA 3EGUA 1QCOA 2RJCA 3QWXX 3OYEA 2CH4A 2A3LA 1WJQA 2E1HA 1UTIA 2RQTA 5CK9A 2ZPBB 2EQMA 5AYFA 2XD0A 3X26B 3CC4A 3HRTA 2I2LA 4E7JA 1JQQA 1YITQ 2J6OA 2KXDA 3M55A 1E7OA 1NLPC 3VRZA 1MV3A 5CIUA 2CH4W 1X01A 5GANj 3CCQT 4Y28E 4MMLA 4DBHA 2XK0A 4OB0B 2BE7D 2LQWA 2CZ7B 1YJWT 2DXUA 4NS5A 3EG9B 3CCJQ 1QP3A 2RJFA 3PFSA 1YITT 4OMPA 5GAMh 2O2OA 2O9VA 5CKHA 3EG2A 3H0FA 1QKXA 2L3PA 2D0NA 1OPKA 4KGXB 3VUBA 5FU6B 1O75A 2FB7A 4PJOA 2PVGB 4M77B 1MMDA 4J9IA 2KY9A 3HFOA 4A4EA 4DBQA 1YWOA 1VA7A 1Q81R 3R6NA 3VS0A 4BB7A 1U8RA 3CQTA 4IKFA 3OBYA 5CKEA 1R0CB 2KEAA 1MMNA 1E6HA 3EG1A 3X25B 4HA8A 4M77G 4KRTA 5A2QE 2CP7A 2WSCE 1ABQA 1UJ0A 4M75B 4CC2A 1Q81C 2K2VA 3M54A 4ORZA 5J26A 3OYHA 2K57A 2DIQA 1IHWA 1BI2A 4KGVB 1YBYA 4M7AD 4F04B 1VOMA 3ULRB 2QI2A 4CC3A 3HRUA 1IGUA 1IZ6A 3F70A 4GLMA 2J7IA 3CMAT 4PJOC 4M78F 1SSFA 2K79A 1VQ7T 3PGGA 4EMKA 4E7IA 4PJOD 4IIMA 4J5YA 3CCMT 3SHWA 1QWFA 2DTIA 3O5ZA 3CCST 5KE3A 3UWNA 1N8RR 3CCSA 2MWOA 4FSXA 4FCYA 1HD3A 5GAMj 5KYWA 3RUXA 3JCMb 2LJ3A 3VS3A 1M2OA 2KE9A 1N5ZA 1GBQA 4RTYA 2M51A 1RUWA 1N9SA 3QUIA 3CMAA 1C1AA 5GAN6 1SRMA 4ANJA 3TCJA 1BU1A 2COZA 4IURA 3EGDB 3H0IA 4JJDA 4DA4A 2OTLQ 1FMKA 1OULA 3JAME 4EMKB 1JB0E 2JUFA 3E19A 3X24B 4Y91A 1X2QA 3V7RA 2COWA 2AKLA 1KQSS 3PT9A 1SEMA 1YJ9A 3JCMV 3VS6A 3CC4Q 3HRSA 1YWPA 2R5MA 1KK7A 2DL8A 1ZA2B 1VQLA 4TVRA 1QVPA 4MZTA 2QTXA 1G5VA 3JB9I 5LJ5e 1KJWA 1ZBJA 3NTIA 1YJWQ 4K11A 3J80E 3QYHB 1EX4A 2JTEA 4C8QC 2JM9A 1YFNA 1NYFA 2L89A 5GJVB 2KK4A 1VQKQ 1ZBXA 3VJPA 2EQKA 5FLXE 4Z88A 5KYYB 3HKSA 3G6EA 3SDZA 1KQSP 2E41A 1W70A 1WXTA 2O4XB 2DXTA 4HCKA 4PJNA 3SWNA 1YITA 3CCRA 2E5KA 2CYZB 1B7TA 3BE3A 1M1KR 3NGPA 3PVLA 4II1A 3VS2A 2SEMA 1QVFS 1NPPA 4JZ3A 2X4YA 3A8HB 5CCAA 3J81E 4PJOB 2FZCB 3M0RA 2DVJA 4QT7A 6AT1B 2KI7A 3CC4T 3I55A 2RQWA 4DBRA 4MDWA 1KD1C 1ZX6A 2LX7A 3L2QA 4M78G 2KGTA 1I4K1 5L8RE 2E4HA 1CKBA 4PKCC 3LGFA 4ZTFA 2LC4A 3A8OB 2K3YA 1NE8A 3ZBDA 2FVUA 1PKTA 3NMZC 1VQKT 2YRDA 1QVFP 4RCBA 4M75D 4L5GA 4C8QE 3TSWA 1YIJA 4JJNK 3RKXA 2KDSA 1V29B 2P84A 2DL3A 1HJDA 1HK9A 2DD5A 2QA4Q 2HL3A 1KC8U 3I56T 3MP6A 1VQNT 4C5GA 4LDUA 5L23A 1U1SA 4C0DC 1P92A 2M0OA 2QG9B 1SF9A 5FU6C 5J39A 2QEXA 2LCSA 1TUDA 2QA4T 1Q7YU 3S3OA 1W4SA 1PHTA 1M4ZA 1ZSZA 2QQ9A 2DYIA 4M77E 1RAFB 5FU7C 3TU4K 4DOVA 1M8MA 1VIEA 4QKUA 4J9HA 4AFUC 5IXFA 5LL6S 1K9MR 2QASA 4GBQA 2EPDA 5KCOA 4OVAA 1D0YA 2RM4A 3CCVQ 2M9UA 2XMFA 3JSCA 2OTLA 1VQ4A 2KXCA 3CBOA 1TH7A 2YRCA 4B9WA 5GAN8 1UUEA 2BZXA 1M3CA 4M4ZA 3OW2A 1PD1A 1VQ6T 2J6KA 1FXXA 2OTJA 2FL7A 2FO0A 3CCLA 4PJOE 3LGLA 2JNGA 1RLQC 3REAB 2VASA 3CCSQ 1YN8A 1WHJA 3TSZA 3HSBA 2BZ8A 3AHUA 2PVOB 2HNIA 1AEYA 3D7SB 3M0TA 2AT1B 1IREB 5GAN4 5GMKl 3VS7A 1VQ9Q 2CP5A 4PFZA 1BI3A 3QZ9B 1IXDA 4X9DA 2RI5A 3CMAQ 2GBQA 1WNLA 2MYSA 3FDRA 3RKYA 2HL5C 2IG0A 3OYLA 2SRCA 3OSSC 2AKKA 3OYMA 3EFOA 3OYIA 3CCVT 1UJYA 1BIAA 3CCUA 2JOYA 3UDCA 4FYWB 1D3BB 4B6MA 2O4XA 5LJ5g 2VC8A 4RG2A 4FT2A 5LJ5j 3G71A 1VUBA 5FWBA 1VQMT 4C92D 1RAAB 5A0GA 4N4GA 4F7UE 3EH2A 4C92E 1N9RA 3CCRQ 1JJ2A 2V1QA 5GAN3 2K4YA 1UB4A 3JB9J 3JB9F 4OMQA 3C4SA 4F14A 2ZGWA 2ED0A 3CD6T 3QO3A 1VQMQ 3G1JA 4XAXB 1Q82R 2GTJA 4RG8A 3JCMf 2RI2A 4ZNXA 5KYUB 4OMMA 1WDXA 3Q1JA 1AT1B 2XDBA 4LNPA 4BUGA 3FJPA 2DAQA 4JDSA 1WPYA 4FW2A 1KQSA 4M7DC 4PK4A 3OA6A 4A63B 1EIFA 2EQIA 3G4SQ 4LXCA 5KE2A 2K3BA 2JVVA 1M90U 3CCJT 5GAMe 1CSKA 5DM7R 5GMKe 1YJNA 3RERA 4J9GA 3SB2A 2FEIA 3CCJA 3EHRA 1X43A 2E3HA 1UGRB 1LPLA 3OYCA 2MIOA 2E70A 2YSQA 2F2VA 5M9OA 2NUTA 2P0KA 1ZQ1A 1YJNT 2RI3A 2O88A 2NLUA 4L6V5 2CGHA 1ZA1B 3RIRA 4EIKA 2QGGA 4M78E 3CC7T 4M77F 4JRIA 2KYBA 2DE0X 4FSSA 1PCXA 1GCQA 4L59A 5LJ3h 1D1CA 3QBYA 2XHCA 1MGQA 4IUUA 3EAEA 4QQGA 1OEBA 4M77A 4NOYA 4M77D 3TREA 2XU8A 3RBBB 1A0NB 3L2ZA 3VUZA 1Q95G 1XNIA 2E5QA 1XJWB 2ESWA 2KVQG 2X4WA 1WI7A 3L2WA 4JS5A 1KSWA 4ZTJA 4X1VA 1KHCA 4M75C 4FL6A 4O6JA 2P0QA 3CCEA 1PWTA 1ZUKA 1VQ9A 2JXBA 2MWPA 3QPHA 3NTKA 1VQ8Q 9ATCB 2MOXA 3CCVA 1BI0A 3JB9G 2CS7A 4IUVA 4M78B 5LJ3d 3JB9D 3OMGA 1RADB 1UECA 1Y0MA 4PFPA 2RD1A 2HMAA 2LT1A 2DZ9A 1VQ5T 2CKKA 1U1TA 2QGFB 3QJ6A 5CVIA 4FM4B 3PVQA 1UG1A 2L3SA 3LW5E 1K8AU 5IH2A 1LNXA 2VV5A 3E2UA 3A8LB 3VV0A 1SHGA 3RMSA 4HKEA 3BW1A 1M1FA 4RTZA 4PLLA 4EDUA 4J9FA 4XU1A 3PIOA 3OY9A 4XQ3A 3TVTA 3LX7A 2CP2A 2DXCA 2LQNA 3EFSA 2K6DA 1R0BG 1PG5B 2ROTA 4OMFB 2LRQA 1D3BA 3OW2P 2ED1A 4AFSC 1UHFA 5GAOn 2RMOA 5LJ3j 4GLKA 4EMGA 4E2FB 2RQVA 3C12A 2CREA 4A53A 4PLIA 4OB3B 1N8RU 2F2WA 2JS2A 2D1XA 4M78D 2KMTA 2LQ8A 4JLIA 2OAWA 4FIBA 4UC4A 3KUFA 5C6SA 4JJBA 4M7AF 4QQ6A 2DL5A 1XQHA 1T0HA 4R0KA 2D6FA 2HDAA 2FYKA 5A0LA 5CAIA 4CRIA 4ELYC 1W6XA 3A5ZB 4HVVA 5D6XA 3RDVA 1X69A 3UPUA 1IB8A 2DL4A 2HQXA 4MZMA 4C8QA 4M75A 1K1ZA 4YTLA 5CKFA 4D6WA 2EKOA 2DERA 2DTHA 2LP5A 1WHKA 1ABOA 2AZVA 4WF2A 2RF0A 1O9SA 5HKCA 1FWZA 4FYVB 4LN2A 4C8QF 1WGSA 2L2PA 1SG5A 4J9DA 5IHKA 3M0QA 3MCAB 4E47A 3V8JA 1PSEA 1YIJT 2NUPA 1BKBA 2MI6A 3MHXA 2DVEA 1QP2A 3DLLA 1X75C 1VQKA 2FRYA 3H9NA 3SWNB 3MP8A 3OYYA 3H6ZA 5CKDA 4R55A 4QQDA 2LMJA 3U23A 3I55T 3RR6A 1YHQQ 2F69A 1OZ2A 3M9QA 2JN0A 2OX7A 4CC4B 2K5FA 4GY5A 1RLPC 1K9AA 3L2UA 2P0PA 1ACMB 4LUEA 3O8VA 3I9QA 4JRPA 2JZ2A 3MO8A 1S72A 3CCRT 1K8AR 2YLBA 4AMCA 1WYXA 3QDFA 4M7DG 4KT0E 3M4GA 5FU7B 2HAXA 2FHDA 3QKJA 4HVUA 2DK3A 3VKIA 3UA7A 1QCFA 1V1CA 1RAHB 1GFCA 5LJ5d 4M75G 2O01E 1AWJA 3P8HA 2EGAA 3DB4A 2LNHB 3CBPA 4P5NA 1KHIA 2EFIA 2EJGA 1NEBA 1UHCA 1H641 2ZPHB 5LJ3g 4C5IA 1T3LA 1VQLT 1FYNA 2VWFA 2KT1A 3GPLA 4Z8AA 1PM3A 1OU9A 1B34B 5HK3A 3L2VA 2QQAA 4OGCA 2F5TX 1UEBA 2AIRB 1BI1A 1VQOQ 2KQWA 2Y4YA 4BI8B 2PTKA 8AT1B 3FB9A 1XTDA 1GXIE 1YJ9T 4M7AG 2RB6A 3X20B 3HP9A 3L2RA 1M1GA 2GNCA 4JUVA 1FMVA 3H0HA 5LJ5f 1UGSB 1PRMC 5GANe 4A4FA 2W0ZA 1VQ8A 1VIFA 3VS5A 3OQ5A 1ZUYA 2DYBA 2DF6A 2X3WD 2VKNA 3OYBA 1B3QA 5KYXB 2KSSA 4IUPA 1W2BS 2CSIA 2QQBA 1V76A 1UFFA 1M5Q1 2Y4XA 3GNGA 2VYTA 3VYGA 1WHHA 1NM7A 2EGCA 3CCMQ 2YXYA 4A4KA 3INZA 1YI2Q 1NPRA 2VUBA 2RK2A 2YLCA 2C0TA 5GAMf 4ME7A 3CCMA 2DJQA 2PUKB 2DL7A 4OB2B 3DKMA 4N4HA 4KUDK 1RL2A 1VQ8T 3FC3A 5GANg 2PNIA 3H41A 2KT8A 4M7DF 1EFNA 1TS9A 1VQPT 5GAN7 3OYFA 1YNZA 1M1KU 4HCBA 5GAOr 4KUIA 1OX8A 1OX9A 2R57A 2ZPGB 4XU0A 1Q82U 1N6AA 4X9CA 3OYNA 1GCPA 4DEYA 1I5OB 1M8VA 2E6ZA 2K5LA 4FYYB 5DLOA 4RTXA 4Y92A 2ZPFB 5CO7A 4E7KA 1Q7YR 4LDYA 1X6GA 2WSEE 1K0SA 2FPEA 2AZSA 4C92G 2R58A 4RTUA 4ELZC 2DM1A 1WX6A 2EYXA 4E7LA 3ASKA 4OMLA 3E9FA 2PVDB 2QYZA 2NYSA 3UA6A 5GAOp 4M7AA 3NTHA 3P8DA 4RMOA 4QVCA 4J6YA 1KQ2A 2HBPA 2M16A 4BDZA 3M4YA 4LD9K 1QWEA 3OYJA 2DMOA 4KGZB 3C95A 3VYHB 2MF2A 1WXBA 3EHQA 3UF4A 1U06A 2CUBA 2YRVA 1YJWA 2VGNA 2A08A 2O9SA 2RHUA 2L0AA 1VQLQ 5IHIA 4N0AC 4F7UA 2C0OA 1S72T 1M30A 5GMKm 4O5VA 3UT1A 4C5HA 2ZAEA 2EJ9A 4FU6A 1WHMA 1KD1R 3CCQA 2QDLA 4F7UF 4AFZC 3M56A 3PE0A 1WJRA 1MMAA 1JRIA 1M3AA 3RKWA 1BCOA 3EGXA 4FW1A 2RHXA 1WIEA 1M1KC 5I2MA 3MP1A 1F1BB 2CZ0B 4Z89A 2DRMA 1QVFA 2RK1A 5EG2A 1W1FA 3IQLA 1ZSZC 1VYVA 1BB9A 2CT3A 1Q86R 4C0ZA 3CXCS 2DA9A 5D7UA 1GRIA 3CC7Q 4M75E 4ZGDB 2X4JA 2J6FA 1HSQA 2GQIA 2WACA 4EMHA 4XTWA 1I5LA 4N0AA 5DLQE 1TSFA 3VU3C 4WCIA 5KYWB 5GMKi 1K76A 2DZCA 5FWCA 3FRNA 4OMNA 2V8KA 3TEEA 5IT9E 3S3MA 2W10A 3A8MB 4LDWA 3CMEA 1OZ3A 4XU2A 4OP0A 3META 1TU0B 5GAOq 4HT9A 3CXCP 3GIBA 2OJ2A 1UGVA 4ESRA 2X4XA 2HEQA 2EQUA 2MCNA 3JCMQ 3QZ5B 1Y96B 2BTTA 2JS0A 2QTVA 1Y07A 2EYWA 3I56Q 2LQKA 3CMEQ 2EBPA 1D0ZA 3LH0A 5GAMg 4J7IA 2A7YA 1Y71A 3CEYA 1UGQB 1OYXA 1JJ2S 1OV3A 2HBWA 3TQ7P 2FG0A 4A4GA 4RCCA 2ROLA 4LD6A 2LCLA 2NUTB 1NYGA 2DEQA 1JXMA 5IXBA 5CQYA 2E65A 4C0FA 2D0QB 3SWNC 2R5AA 5GMKj 2LZ6B 2KRMA 4BY6B 2DILA 4M7AC 3KBGA 5KYNA 1AWOA 2AK5A 1NEGA 4M7AB 1RI0A 2JT4A 3X28B 3ZFJA 1WQ7A 3RNJA 3GLXA 3KFVA 3PTAA 2RHZA 1VQ9T 2ENMA 4LE9A 2KRNA 4FYXB 3NFCA 3BFMA 2LJ0A 4C92C 4J9CA 3SFMA 5I21A 4PFOA 1FX7A 1UE9A 1QMCA 5LJ3e 1J3TA 2VGMA 2M02A 1R77A 1MV0B 2DNUA 3JCMg 2QEXQ 1SHFA 2V8IA 2A28A 1H3HA 1W2BP 2RHIA 1Q86U 4QVZA 3OYGA 2RO0A 3G4ST 3OW2S 5D6YA 3M0UA 1Q86C 2E3IA 5ECAA 4AG1C 2KAFA 4C8QB 1Z9ZA 1U5SA 1BYMA 4A4HA 2CZ1B 3OYAA 2DPPB 5LJ3f 1X6BA 3CC7A 1MUZA 3G7ZA 5KYXA 4AG2C 3L1AA 2D8JA 3FEOA 1SSHA 3GBQA 2ZZDA 8ATCB 1VYUA 1VYTA 4LUDA 2IIMA 2NUPB 5I11A 2RJEA 4Q5WA 3VS4A 3M58A 4BY6C 4OGEA 2EAYA 1RACB 1WJSA 1WXUA 4A54A 7AT1B 3OBWA 5GANf 2VB6A 1QKWA 2XDPA 4X34A 3VS1A 2PZ1A 2VVKA 4M7DD 2YT6A 5AT1B 4PJOG 3V8LA 1TUGB 2J05A 2L3RA 1SKUB 2DX1A 2F2XA 4RKUE 3I5SA 2A0FB 4Z02A 2CP0A 3CCQQ 1NG2A 3LWIA 4JJCA 1AZEA 2K9GA 5GAN5 2DRKA 1TG0A 2EIFA 3EFRA 3M59A 1D0XA 1QQJA 1I81A 1K0XA 1T0JA 4XK8E 2P4RA 3C94A 1M3BA 4M77C 3HHTB 2WSFE 3CD6A 4E6RA 1VQ4Q 3I55Q 3UATA 3KXTA 5CKBA 1GCQC 4BACA 1YHQA 1Y96A 2B8AA 2M1HA 3LLRA 2CP6A 5IN1A 1VQPA 3MEUA 1H92A 4RTTA 1Q7YC 1VQMA 4RTVA 2RH2A 1NJIR 3CPFA 3G71T 1G3YA 1SRLA 2L3QA 4XTXA 3WXMB 3CCUT 2KRSA 2QXFA 3JCMh 5FRMA 2F1LA 2CZ6B 5GJWB 2E64A 1JEGA 4MDXA 4XTYA 2GGRA 2FZGB 4BD3A 3ER0A 1ZUUA 4PL6A 1AWWA 3N5BB 2LJ1A 3CXCA 2V1RA 3EG3A 2E6NA 3V8KA 2YUNA 2O31A 4C0DB 4WTOB 3EGDA 3C0CA 1N8RC 2XDDA 3LYIA 1SPKA 4E7ZA 3JCMW 3CCLT 3S6WA 4DQ2A 2OTJT 4XTZA 3CBMA 4E7SA 1BK2A 4B9XA 4C5EA 1VQ6A 2K5IA 1VQOA 4OB1B 3JB9H 1VQPQ 3A98A 1KD1U 2JM8A 3MEVA 2EJFA 4RTWA 1B07A 3SD4A 2GTOA 1BIBA 1VQ6Q 2ZPIB 4BI4A 1OU8A 2ECZA 2OTJQ 2HQHA 3CPWS 1TWBA 2OI3A 4PJLA 1AHJB 4M7DB 1NZ9A 1GFDA 4IIOA 2JMAA 3DLMA 3QDRB 1ZLMA 3NPFA 1YI2T 1AD5A 2MAMA 4C92F 4KH1B 1LVKA 4XU3A 3E1SA 2P4TA 1G2BA 3GOXA 2DIGA 3HPWA 2HQEA 1PKSA 5GAOm 1AWXA 1Q82C 1VQ5Q 5CR2A 2LDMA 2KYMA 1M2VA 1I8FA 2RA2A 4C92A 2G3RA 2EYZA 3QWYA 4BE1A 5GANh 2COYA 4MMKA 1WLPB 3GNFB 3CPWP 4N4IA 1PRLC 2QQRA 3FLGA 4PJMA 2LTOA 2DD4A 1YP5A 1VQNA 1TXQA 1M90C 5HCKA 1TOVA 2XIDA 2YWWA 3NHNA 2D8HA 2QDYB 1G8XA 2DBMA 4M7DA 3QSUA 1QCNA 3QHSA 3MEAA 2HSEB 1VQNQ 1I0CA 2DJZA 2BE9B 3GF5A 3BDUA 2Z0WA 3JCMc 3CC2T 2KROA 2X9HA 1K73R 2YUOA 1M9SA 1NLOC 2M0YA 2XICA 4KH0B 3PIPA 1WFWA 3A1PA 5KH6A 2K7AA 1M2VB 2GQVA 1M27C 3EG9A 2RNAA 1TTHB 3CC2A 1LJOA 3ZEHA 2XI9A 4F7UB 2X35A 5IHNA 1K4US 2EKHA 2LCCA 2LVMA 5FROA 1ARKA 3M0PA 2D9TA 2ATCB 4C0GA 5D6WA 2X3XD 4J9BA 4AT1B 3CD6Q 1AOJA 2FRWA 2EGEA 3M0SA 4M78A 1ZSZB 1IGQA 4NL3A 2EYQA 3RESA 1X27A 1KQ1A 3LH5A 5LJ5h 1Y7XA 2L8DA 2H8HA 1YIJQ 3G6ET 1PNJA 4BE0A 1BCMA 2KBTA 2DBKA 1OI1A 4IUTA 3S3NA 1X6OA 2DXBA 4J6XA 3V7CA 2K3XA 1S72Q 4BE2A 4M75F 4JRQA 3EG0A 4J7FA 2HSPA 1GBRA 5KYYA 3HTRA 2IPOB 2GF7A 3QJYA 2A36A 4J8OA 1I1JA 2IVWA 1OQKA 1Y57A 4DBFA 1RI9A 3PMIA 1JBMA 2E10A 1JXOA 3QG1A 3HFNA 1GL5A 1YI2A 3MKDA 2GFAA 2HCKA 1G3SA 1VQOT 3JV3A 2HD0A 4J83A 2FZKB 5I2SA 2EQJA 1QW1A 4JPBW 5J3BA 1G3TA 4V2SA 1WHLA 2ABLA 1VQ5A 1OOTA 1IRXA 3M57A 3EFOB 2GCXA 3CCEQ 2FPDA 4JLGA 1PC0A 3BY7A 2RPNA 4PJJA 1RAIB 1PSFA 3JCMP 1YCSB 1M90R 2DFUA 4XTUA 5FW9A 2Y90A 1ZSGA 2X51A 3QXEB 1PD0A 2CT4A 3MPUB 1YJ9Q 4JZ4A 2HKNA 3CCET 1VQ7A 2EWNA 3EGXB 2GFUA 2BUDA 1YHQT 4LDXA 2PU9B 1E6GA 2DETA 2V8JA 3CPWA 3H8ZA 4EPCA 3PMTA 1X2KA 2PUOB 2QK0A 1RAGB 3VRYA 1BBZA 4QW2A 3ZL7C 1RAEB 5GAN2 2C06A 2YUQA 4ZN3A 3CC2Q 2B86A 2A37A 3OS5A 3OS0A 3BDLA 1JJ2P 3THKA 1NJIU 3WVEB 1WHGA 5HK0A 2QAZA 1K8AC 2DKGA 5GMKh 1FMWA 3EH1A 5DY9A 4HCCA 2QQSA 5CQXA 1QVGP 1KC8C 1I07A 3E9GA 3G6EQ 1ZHIA 1H3ZA 4DEXA 3AT1B 2CUDA 2NUZA 1IHVA 3P8BB 2OAUA 2H3JA 1T3SA 3ME9A 4M78C 3WVDB 4PJOF 3OS1A 1QLYA 2RJDA 2XG8D 2H3EB 2YUPA 4ZN1A 3JCMJ 3I5RA 1LOJA 3LWHA 3RMQA 3JCMe 2RN8A 2JJ9A 1YCYA 4OF1A 2F5KA 1D09B 2AHJB 1KG1A 1QVGS 2FPFA 2XKOC 1K9MC 2EW3A 4JRKA 3REBB 1K73C 1VQ7Q 1EZZB 3DB3A 3M5AA 1D1AA 1WA7A 2RQUA 3T9NA 4CI0C 2VXEA 3A8GB 2JTMA 4AFQC 1YJNQ 3QYGB 1MNDA 5C0MA 1G3WA 1MNEA 1WZOA 1Z9QA 4PNOA 5IAYA 3G4SA 1UGPB 2DEUA 3PNWC 1AZGB 1MHNA 3OYKA 2RHYA 2LNVA 2CSQA 1JO8A 2JMCA 5HY6A 2CP3A 3FIFA 3MEWA 1R8OB 2J06A 2EVRA 1TUCA 4ZGJB 2E12A 5KYUA 1NBEB 2L5QA 4MZPA
chains in the Genus database with same CATH topology
1LCKA 2L3QA 1M8MA 4J9HA 4AFUC 5IXFA 1CKAA 2KRSA 4GBQA 2EPDA 5GJWB 2YDLA 1JEGA 2GNCA 3H0HA 1H8KA 2GGRA 1PRMC 2XMFA 2W0ZA 1ZUUA 2KR3A 2I0NA 3VS5A 1AWWA 2KXCA 1ZUYA 2LJ1A 2DYBA 2DF6A 2X3WD 2V1RA 3EG3A 2YUNA 2O31A 2VKNA 1UUEA 3C0CA 4D8KA 2BZXA 1B3QA 1SPKA 2NWMA 2CSIA 4HVWA 1IO6A 1M3CA 4M4ZA 4OMOA 4F16A 2J6KA 1UFFA 1NM7A 2C0IA 2EGCA 2FO0A 1BK2A 1KIKA 2BZYA 1KFZA 1G83A 3FJ5A 1RLQC 2EYYA 3A98A 3REAB 1YN8A 4HXJA 2JM8A 4RTWA 4RUGA 1B07A 1UDLA 2GTOA 2BZ8A 3TSZA 2C0TA 1AEYA 2JW4A 3M0TA 2DJQA 2DL7A 1JU5C 2CDTA 3VS7A 2ECZA 2PNIA 2OI3A 3H41A 2KT8A 1EFNA 1GFDA 4J9EA 2JMAA 3NPFA 2GBQA 4IIOA 1ZLMA 3I35A 1AD5A 1YNZA 4F17A 2SRCA 1U3OA 1G2BA 2AKKA 1UJYA 1PKSA 1AVZC 1GCPA 1AWXA 4DEYA 2KNBB 2K2MA 5FWBA 4RTXA 4Y92A 2KYMA 1OPLA 4D8DA 2EYZA 3QWYA 1X6GA 5I22A 2DLPA 2RQRA 1K0SA 2FPEA 1WLPB 2AZSA 4RTUA 2DM1A 2V1QA 1WX6A 2EYXA 2G6FX 4OMLA 1S1NA 1PRLC 5EC7A 4OMQA 3SEMA 4CC7A 4F14A 2ED0A 1XOVA 3UA6A 3EGUA 1YP5A 2GTJA 4ZNXA 5HCKA 3QWXX 1WDXA 4OMMA 3NHNA 1QWEA 2D8HA 4LNPA 2DBMA 2DMOA 2CH4A 1WXBA 3EHQA 3UF4A 1U06A 2CUBA 2A08A 1I0CA 2O9SA 1UTIA 2RQTA 2L0AA 4A63B 2KROA 2EQIA 5IHIA 2YUOA 1NLOC 2K3BA 2M0YA 1WFWA 1CSKA 1JQQA 2C0OA 2J6OA 2K7AA 2KXDA 1M30A 1M27C 4J9GA 2FEIA 3EHRA 1E7OA 1NLPC 1X43A 2RNAA 3VRZA 1MV3A 2CH4W 2MIOA 2YSQA 2QDLA 2F2VA 2LQWA 4AFZC 5IHNA 1K4US 2EKHA 1ARKA 3PE0A 3M0PA 2O88A 4OMPA 2O2OA 2O9VA 3EG2A 3H0FA 1QKXA 2L3PA 1M3AA 2D0NA 2X3XD 4J9BA 1OPKA 4EIKA 1AOJA 2FRWA 4J9IA 1WIEA 2KYBA 2DE0X 2EGEA 4FSSA 1GCQA 3M0SA 1YWOA 4Z89A 1X27A 2DRMA 3LH5A 1VA7A 3R6NA 3VS0A 1W1FA 3CQTA 3IQLA 2H8HA 1VYVA 1BB9A 1OEBA 2CT3A 1PNJA 2KEAA 2DA9A 1E6HA 1GRIA 3EG1A 3RBBB 1A0NB 2KBTA 2DBKA 2J6FA 1HSQA 2GQIA 4KRTA 2ESWA 1ABQA 1UJ0A 1WI7A 4WCIA 4CC2A 3EG0A 2HSPA 1KSWA 4ORZA 1GBRA 4X1VA 1K76A 5FWCA 1PWTA 1ZUKA 2JXBA 4OMNA 2A36A 1I1JA 3ULRB 1Y57A 2W10A 4CC3A 2MOXA 1RI9A 1JXOA 4GLMA 2J7IA 1GL5A 2OJ2A 1UGVA 4ESRA 1UECA 1Y0MA 2HCKA 2K79A 2HEQA 3JV3A 2MCNA 4IIMA 2BTTA 2JS0A 4JPBW 3PVQA 1UG1A 2L3SA 3SHWA 5IH2A 1QWFA 3O5ZA 1SHGA 2EYWA 4RTZA 4J9FA 2ABLA 3TVTA 2EBPA 1HD3A 1OOTA 2LJ3A 2LQNA 3VS3A 2FPDA 2K6DA 2KE9A 1N5ZA 2ROTA 1GBQA 2RPNA 4RTYA 2ED1A 1OV3A 2HBWA 1UHFA 2M51A 4AFSC 1RUWA 2FG0A 1YCSB 2ROLA 2RMOA 1NYGA 1JXMA 2RQVA 1SRMA 5FW9A 2CREA 1BU1A 1ZSGA 5IXBA 3H0IA 4JJDA 1FMKA 2F2WA 2CT4A 2JS2A 4JZ4A 2D1XA 2LZ6B 2KRMA 2DILA 2OAWA 1X2QA 1AWOA 4JJBA 2AK5A 2AKLA 1NEGA 2DL5A 2JT4A 1T0HA 4R0KA 1SEMA 3VS6A 1E6GA 3RNJA 3KFVA 1YWPA 2HDAA 2DL8A 2ENMA 4LE9A 2KRNA 1X2KA 1KJWA 1W6XA 1ZBJA 2LJ0A 4HVVA 4J9CA 4K11A 1X69A 2JTEA 2DL4A 3VRYA 1BBZA 2JM9A 1UE9A 3ZL7C 1NYFA 1J3TA 5GJVB 1MV0B 2DNUA 1K1ZA 1SHFA 1H3HA 2A28A 2YUQA 4Z88A 2B86A 2LP5A 2A37A 1ABOA 3M0UA 3THKA 2AZVA 2RF0A 1W70A 1WXTA 5ECAA 4AG1C 4HCKA 4LN2A 1Z9ZA 1U5SA 2E5KA 2L2PA 4J9DA 5IHKA 3M0QA 1I07A 1X6BA 3NGPA 3PVLA 1MUZA 4AG2C 4DEXA 3VS2A 2CUDA 2FRYA 2SEMA 2NUZA 4JZ3A 2D8JA 2LMJA 1T3SA 3U23A 1SSHA 1QLYA 3M0RA 2DVJA 4QT7A 3GBQA 1VYUA 2YUPA 4CC4B 1VYTA 3I5RA 2IIMA 4LUDA 5I11A 3VS4A 2RQWA 1RLPC 2RN8A 1K9AA 1WXUA 4LUEA 1ZX6A 3I9QA 2LX7A 1QKWA 2KGTA 3VS1A 1CKBA 2PZ1A 2VVKA 2YT6A 2J05A 2DX1A 1WYXA 2FPFA 2F2XA 3I5SA 1PKTA 2EW3A 3NMZC 3REBB 4HVUA 1NG2A 1WA7A 3UA7A 1QCFA 1V1CA 3TSWA 2RQUA 4JJCA 1AZEA 2K9GA 1GFCA 2DRKA 2DL3A 1AWJA 1TG0A 2EGAA 1HJDA 4AFQC 2LNHB 1K0XA 1NEBA 1UHCA 1T0JA 2P4RA 1Z9QA 1M3BA 5L23A 1T3LA 1AZGB 1FYNA 2VWFA 4E6RA 2KT1A 4Z8AA 2CSQA 3UATA 1JO8A 2JMCA 2LCSA 1TUDA 1GCQC 2J06A 2EVRA 1PHTA 1H92A 4RTTA 1TUCA 4RTVA 2PTKA 1SRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCK A;  2L3Q A;  1M8M A;  4J9H A;  4AFU C;  5IXF A;  1CKA A;  2KRS A;  4GBQ A;  2EPD A;  5GJW B;  2YDL A;  1JEG A;  2GNC A;  3H0H A;  1H8K A;  2GGR A;  1PRM C;  2XMF A;  2W0Z A;  1ZUU A;  2KR3 A;  2I0N A;  3VS5 A;  1AWW A;  2KXC A;  1ZUY A;  2LJ1 A;  2DYB A;  2DF6 A;  2X3W D;  2V1R A;  3EG3 A;  2YUN A;  2O31 A;  2VKN A;  1UUE A;  3C0C A;  4D8K A;  2BZX A;  1B3Q A;  1SPK A;  2NWM A;  2CSI A;  4HVW A;  1IO6 A;  1M3C A;  4M4Z A;  4OMO A;  4F16 A;  2J6K A;  1UFF A;  1NM7 A;  2C0I A;  2EGC A;  2FO0 A;  1BK2 A;  1KIK A;  2BZY A;  1KFZ A;  1G83 A;  3FJ5 A;  1RLQ C;  2EYY A;  3A98 A;  3REA B;  1YN8 A;  4HXJ A;  2JM8 A;  4RTW A;  4RUG A;  1B07 A;  1UDL A;  2GTO A;  2BZ8 A;  3TSZ A;  2C0T A;  1AEY A;  2JW4 A;  3M0T A;  2DJQ A;  2DL7 A;  1JU5 C;  2CDT A;  3VS7 A;  2ECZ A;  2PNI A;  2OI3 A;  3H41 A;  2KT8 A;  1EFN A;  1GFD A;  4J9E A;  2JMA A;  3NPF A;  2GBQ A;  4IIO A;  1ZLM A;  3I35 A;  1AD5 A;  1YNZ A;  4F17 A;  2SRC A;  1U3O A;  1G2B A;  2AKK A;  1UJY A;  1PKS A;  1AVZ C;  1GCP A;  1AWX A;  4DEY A;  2KNB B;  2K2M A;  5FWB A;  4RTX A;  4Y92 A;  2KYM A;  1OPL A;  4D8D A;  2EYZ A;  3QWY A;  1X6G A;  5I22 A;  2DLP A;  2RQR A;  1K0S A;  2FPE A;  1WLP B;  2AZS A;  4RTU A;  2DM1 A;  2V1Q A;  1WX6 A;  2EYX A;  2G6F X;  4OML A;  1S1N A;  1PRL C;  5EC7 A;  4OMQ A;  3SEM A;  4CC7 A;  4F14 A;  2ED0 A;  1XOV A;  3UA6 A;  3EGU A;  1YP5 A;  2GTJ A;  4ZNX A;  5HCK A;  3QWX X;  1WDX A;  4OMM A;  3NHN A;  1QWE A;  2D8H A;  4LNP A;  2DBM A;  2DMO A;  2CH4 A;  1WXB A;  3EHQ A;  3UF4 A;  1U06 A;  2CUB A;  2A08 A;  1I0C A;  2O9S A;  1UTI A;  2RQT A;  2L0A A;  4A63 B;  2KRO A;  2EQI A;  5IHI A;  2YUO A;  1NLO C;  2K3B A;  2M0Y A;  1WFW A;  1CSK A;  1JQQ A;  2C0O A;  2J6O A;  2K7A A;  2KXD A;  1M30 A;  1M27 C;  4J9G A;  2FEI A;  3EHR A;  1E7O A;  1NLP C;  1X43 A;  2RNA A;  3VRZ A;  1MV3 A;  2CH4 W;  2MIO A;  2YSQ A;  2QDL A;  2F2V A;  2LQW A;  4AFZ C;  5IHN A;  1K4U S;  2EKH A;  1ARK A;  3PE0 A;  3M0P A;  2O88 A;  4OMP A;  2O2O A;  2O9V A;  3EG2 A;  3H0F A;  1QKX A;  2L3P A;  1M3A A;  2D0N A;  2X3X D;  4J9B A;  1OPK A;  4EIK A;  1AOJ A;  2FRW A;  4J9I A;  1WIE A;  2KYB A;  2DE0 X;  2EGE A;  4FSS A;  1GCQ A;  3M0S A;  1YWO A;  4Z89 A;  1X27 A;  2DRM A;  3LH5 A;  1VA7 A;  3R6N A;  3VS0 A;  1W1F A;  3CQT A;  3IQL A;  2H8H A;  1VYV A;  1BB9 A;  1OEB A;  2CT3 A;  1PNJ A;  2KEA A;  2DA9 A;  1E6H A;  1GRI A;  3EG1 A;  3RBB B;  1A0N B;  2KBT A;  2DBK A;  2J6F A;  1HSQ A;  2GQI A;  4KRT A;  2ESW A;  1ABQ A;  1UJ0 A;  1WI7 A;  4WCI A;  4CC2 A;  3EG0 A;  2HSP A;  1KSW A;  4ORZ A;  1GBR A;  4X1V A;  1K76 A;  5FWC A;  1PWT A;  1ZUK A;  2JXB A;  4OMN A;  2A36 A;  1I1J A;  3ULR B;  1Y57 A;  2W10 A;  4CC3 A;  2MOX A;  1RI9 A;  1JXO A;  4GLM A;  2J7I A;  1GL5 A;  2OJ2 A;  1UGV A;  4ESR A;  1UEC A;  1Y0M A;  2HCK A;  2K79 A;  2HEQ A;  3JV3 A;  2MCN A;  4IIM A;  2BTT A;  2JS0 A;  4JPB W;  3PVQ A;  1UG1 A;  2L3S A;  3SHW A;  5IH2 A;  1QWF A;  3O5Z A;  1SHG A;  2EYW A;  4RTZ A;  4J9F A;  2ABL A;  3TVT A;  2EBP A;  1HD3 A;  1OOT A;  2LJ3 A;  2LQN A;  3VS3 A;  2FPD A;  2K6D A;  2KE9 A;  1N5Z A;  2ROT A;  1GBQ A;  2RPN A;  4RTY A;  2ED1 A;  1OV3 A;  2HBW A;  1UHF A;  2M51 A;  4AFS C;  1RUW A;  2FG0 A;  1YCS B;  2ROL A;  2RMO A;  1NYG A;  1JXM A;  2RQV A;  1SRM A;  5FW9 A;  2CRE A;  1BU1 A;  1ZSG A;  5IXB A;  3H0I A;  4JJD A;  1FMK A;  2F2W A;  2CT4 A;  2JS2 A;  4JZ4 A;  2D1X A;  2LZ6 B;  2KRM A;  2DIL A;  2OAW A;  1X2Q A;  1AWO A;  4JJB A;  2AK5 A;  2AKL A;  1NEG A;  2DL5 A;  2JT4 A;  1T0H A;  4R0K A;  1SEM A;  3VS6 A;  1E6G A;  3RNJ A;  3KFV A;  1YWP A;  2HDA A;  2DL8 A;  2ENM A;  4LE9 A;  2KRN A;  1X2K A;  1KJW A;  1W6X A;  1ZBJ A;  2LJ0 A;  4HVV A;  4J9C A;  4K11 A;  1X69 A;  2JTE A;  2DL4 A;  3VRY A;  1BBZ A;  2JM9 A;  1UE9 A;  3ZL7 C;  1NYF A;  1J3T A;  5GJV B;  1MV0 B;  2DNU A;  1K1Z A;  1SHF A;  1H3H A;  2A28 A;  2YUQ A;  4Z88 A;  2B86 A;  2LP5 A;  2A37 A;  1ABO A;  3M0U A;  3THK A;  2AZV A;  2RF0 A;  1W70 A;  1WXT A;  5ECA A;  4AG1 C;  4HCK A;  4LN2 A;  1Z9Z A;  1U5S A;  2E5K A;  2L2P A;  4J9D A;  5IHK A;  3M0Q A;  1I07 A;  1X6B A;  3NGP A;  3PVL A;  1MUZ A;  4AG2 C;  4DEX A;  3VS2 A;  2CUD A;  2FRY A;  2SEM A;  2NUZ A;  4JZ3 A;  2D8J A;  2LMJ A;  1T3S A;  3U23 A;  1SSH A;  1QLY A;  3M0R A;  2DVJ A;  4QT7 A;  3GBQ A;  1VYU A;  2YUP A;  4CC4 B;  1VYT A;  3I5R A;  2IIM A;  4LUD A;  5I11 A;  3VS4 A;  2RQW A;  1RLP C;  2RN8 A;  1K9A A;  1WXU A;  4LUE A;  1ZX6 A;  3I9Q A;  2LX7 A;  1QKW A;  2KGT A;  3VS1 A;  1CKB A;  2PZ1 A;  2VVK A;  2YT6 A;  2J05 A;  2DX1 A;  1WYX A;  2FPF A;  2F2X A;  3I5S A;  1PKT A;  2EW3 A;  3NMZ C;  3REB B;  4HVU A;  1NG2 A;  1WA7 A;  3UA7 A;  1QCF A;  1V1C A;  3TSW A;  2RQU A;  4JJC A;  1AZE A;  2K9G A;  1GFC A;  2DRK A;  2DL3 A;  1AWJ A;  1TG0 A;  2EGA A;  1HJD A;  4AFQ C;  2LNH B;  1K0X A;  1NEB A;  1UHC A;  1T0J A;  2P4R A;  1Z9Q A;  1M3B A;  5L23 A;  1T3L A;  1AZG B;  1FYN A;  2VWF A;  4E6R A;  2KT1 A;  4Z8A A;  2CSQ A;  3UAT A;  1JO8 A;  2JMC A;  2LCS A;  1TUD A;  1GCQ C;  2J06 A;  2EVR A;  1PHT A;  1H92 A;  4RTT A;  1TUC A;  4RTV A;  2PTK A;  1SRL A; 
#chains in the Genus database with same CATH topology
 1LCK A;  2MPX C;  3MJX A;  4KBM B;  1CKA A;  3GP8 A;  3OYD A;  4XTV A;  3V7S A;  2YDL A;  1H8K A;  3J7A F;  2PQW A;  2LX9 A;  3G71 Q;  2KR3 A;  2I0N A;  4DOW A;  3L42 A;  3R6O A;  3JCM X;  1HXD A;  3CCU Q;  3HL8 A;  4D8K A;  2BIV A;  1K73 U;  2NWM A;  4ATO A;  4HVW A;  1IO6 A;  1B34 A;  1K9M U;  4OMO A;  4F16 A;  2MK5 A;  2VXF A;  2MMP A;  4VUB A;  2ZCF B;  1VQ4 T;  2OTL T;  4BDY A;  2C0I A;  1KIK A;  2BZY A;  2ZPE B;  4NL2 A;  1Q81 U;  1KFZ A;  4E7H A;  1G83 A;  3FJ5 A;  4M7D E;  1D1B A;  5GAM d;  2EYY A;  1HYO A;  4HXJ A;  4RUG A;  2JTF A;  1UDL A;  1DJ7 B;  2JW4 A;  3CME T;  3JCM d;  3URG A;  1JU5 C;  2V26 A;  2CDT A;  4C8Q D;  3CCL Q;  4LDV A;  4BI3 A;  3M53 A;  4HCZ A;  3QII A;  1KC8 R;  1WQW A;  4J9E A;  3OB9 A;  1QVG A;  3I35 A;  2YHT A;  5KCH A;  4F17 A;  2QA4 A;  4C92 B;  1U3O A;  4HT8 A;  1C6V X;  3JRZ A;  3OS2 A;  3OMC A;  4KUL A;  2BKD N;  1RAB B;  2DTO A;  1AVZ C;  5GAO l;  2QEX T;  4QVD A;  2KNB B;  2K2M A;  1NJI C;  1C0M A;  1OPL A;  4F7U G;  4D8D A;  4C8Q G;  1W2B A;  2HZY A;  2DO3 A;  3I56 A;  1N27 A;  5I22 A;  2DLP A;  2RQR A;  4JS4 A;  4EMK C;  5A0D A;  4IUQ A;  2G6F X;  1MMG A;  1S1N A;  2HKQ B;  4FT4 A;  5EC7 A;  5GAN d;  4R56 A;  3SEM A;  4ZGE B;  4M7A E;  4CC7 A;  4J6W A;  1XOV A;  2LT4 A;  3OSV A;  5FRN A;  3EGU A;  1QCO A;  2RJC A;  3QWX X;  3OYE A;  2CH4 A;  2A3L A;  1WJQ A;  2E1H A;  1UTI A;  2RQT A;  5CK9 A;  2ZPB B;  2EQM A;  5AYF A;  2XD0 A;  3X26 B;  3CC4 A;  3HRT A;  2I2L A;  4E7J A;  1JQQ A;  1YIT Q;  2J6O A;  2KXD A;  3M55 A;  1E7O A;  1NLP C;  3VRZ A;  1MV3 A;  5CIU A;  2CH4 W;  1X01 A;  5GAN j;  3CCQ T;  4Y28 E;  4MML A;  4DBH A;  2XK0 A;  4OB0 B;  2BE7 D;  2LQW A;  2CZ7 B;  1YJW T;  2DXU A;  4NS5 A;  3EG9 B;  3CCJ Q;  1QP3 A;  2RJF A;  3PFS A;  1YIT T;  4OMP A;  5GAM h;  2O2O A;  2O9V A;  5CKH A;  3EG2 A;  3H0F A;  1QKX A;  2L3P A;  2D0N A;  1OPK A;  4KGX B;  3VUB A;  5FU6 B;  1O75 A;  2FB7 A;  4PJO A;  2PVG B;  4M77 B;  1MMD A;  4J9I A;  2KY9 A;  3HFO A;  4A4E A;  4DBQ A;  1YWO A;  1VA7 A;  1Q81 R;  3R6N A;  3VS0 A;  4BB7 A;  1U8R A;  3CQT A;  4IKF A;  3OBY A;  5CKE A;  1R0C B;  2KEA A;  1MMN A;  1E6H A;  3EG1 A;  3X25 B;  4HA8 A;  4M77 G;  4KRT A;  5A2Q E;  2CP7 A;  2WSC E;  1ABQ A;  1UJ0 A;  4M75 B;  4CC2 A;  1Q81 C;  2K2V A;  3M54 A;  4ORZ A;  5J26 A;  3OYH A;  2K57 A;  2DIQ A;  1IHW A;  1BI2 A;  4KGV B;  1YBY A;  4M7A D;  4F04 B;  1VOM A;  3ULR B;  2QI2 A;  4CC3 A;  3HRU A;  1IGU A;  1IZ6 A;  3F70 A;  4GLM A;  2J7I A;  3CMA T;  4PJO C;  4M78 F;  1SSF A;  2K79 A;  1VQ7 T;  3PGG A;  4EMK A;  4E7I A;  4PJO D;  4IIM A;  4J5Y A;  3CCM T;  3SHW A;  1QWF A;  2DTI A;  3O5Z A;  3CCS T;  5KE3 A;  3UWN A;  1N8R R;  3CCS A;  2MWO A;  4FSX A;  4FCY A;  1HD3 A;  5GAM j;  5KYW A;  3RUX A;  3JCM b;  2LJ3 A;  3VS3 A;  1M2O A;  2KE9 A;  1N5Z A;  1GBQ A;  4RTY A;  2M51 A;  1RUW A;  1N9S A;  3QUI A;  3CMA A;  1C1A A;  5GAN 6;  1SRM A;  4ANJ A;  3TCJ A;  1BU1 A;  2COZ A;  4IUR A;  3EGD B;  3H0I A;  4JJD A;  4DA4 A;  2OTL Q;  1FMK A;  1OUL A;  3JAM E;  4EMK B;  1JB0 E;  2JUF A;  3E19 A;  3X24 B;  4Y91 A;  1X2Q A;  3V7R A;  2COW A;  2AKL A;  1KQS S;  3PT9 A;  1SEM A;  1YJ9 A;  3JCM V;  3VS6 A;  3CC4 Q;  3HRS A;  1YWP A;  2R5M A;  1KK7 A;  2DL8 A;  1ZA2 B;  1VQL A;  4TVR A;  1QVP A;  4MZT A;  2QTX A;  1G5V A;  3JB9 I;  5LJ5 e;  1KJW A;  1ZBJ A;  3NTI A;  1YJW Q;  4K11 A;  3J80 E;  3QYH B;  1EX4 A;  2JTE A;  4C8Q C;  2JM9 A;  1YFN A;  1NYF A;  2L89 A;  5GJV B;  2KK4 A;  1VQK Q;  1ZBX A;  3VJP A;  2EQK A;  5FLX E;  4Z88 A;  5KYY B;  3HKS A;  3G6E A;  3SDZ A;  1KQS P;  2E41 A;  1W70 A;  1WXT A;  2O4X B;  2DXT A;  4HCK A;  4PJN A;  3SWN A;  1YIT A;  3CCR A;  2E5K A;  2CYZ B;  1B7T A;  3BE3 A;  1M1K R;  3NGP A;  3PVL A;  4II1 A;  3VS2 A;  2SEM A;  1QVF S;  1NPP A;  4JZ3 A;  2X4Y A;  3A8H B;  5CCA A;  3J81 E;  4PJO B;  2FZC B;  3M0R A;  2DVJ A;  4QT7 A;  6AT1 B;  2KI7 A;  3CC4 T;  3I55 A;  2RQW A;  4DBR A;  4MDW A;  1KD1 C;  1ZX6 A;  2LX7 A;  3L2Q A;  4M78 G;  2KGT A;  1I4K 1;  5L8R E;  2E4H A;  1CKB A;  4PKC C;  3LGF A;  4ZTF A;  2LC4 A;  3A8O B;  2K3Y A;  1NE8 A;  3ZBD A;  2FVU A;  1PKT A;  3NMZ C;  1VQK T;  2YRD A;  1QVF P;  4RCB A;  4M75 D;  4L5G A;  4C8Q E;  3TSW A;  1YIJ A;  4JJN K;  3RKX A;  2KDS A;  1V29 B;  2P84 A;  2DL3 A;  1HJD A;  1HK9 A;  2DD5 A;  2QA4 Q;  2HL3 A;  1KC8 U;  3I56 T;  3MP6 A;  1VQN T;  4C5G A;  4LDU A;  5L23 A;  1U1S A;  4C0D C;  1P92 A;  2M0O A;  2QG9 B;  1SF9 A;  5FU6 C;  5J39 A;  2QEX A;  2LCS A;  1TUD A;  2QA4 T;  1Q7Y U;  3S3O A;  1W4S A;  1PHT A;  1M4Z A;  1ZSZ A;  2QQ9 A;  2DYI A;  4M77 E;  1RAF B;  5FU7 C;  3TU4 K;  4DOV A;  1M8M A;  1VIE A;  4QKU A;  4J9H A;  4AFU C;  5IXF A;  5LL6 S;  1K9M R;  2QAS A;  4GBQ A;  2EPD A;  5KCO A;  4OVA A;  1D0Y A;  2RM4 A;  3CCV Q;  2M9U A;  2XMF A;  3JSC A;  2OTL A;  1VQ4 A;  2KXC A;  3CBO A;  1TH7 A;  2YRC A;  4B9W A;  5GAN 8;  1UUE A;  2BZX A;  1M3C A;  4M4Z A;  3OW2 A;  1PD1 A;  1VQ6 T;  2J6K A;  1FXX A;  2OTJ A;  2FL7 A;  2FO0 A;  3CCL A;  4PJO E;  3LGL A;  2JNG A;  1RLQ C;  3REA B;  2VAS A;  3CCS Q;  1YN8 A;  1WHJ A;  3TSZ A;  3HSB A;  2BZ8 A;  3AHU A;  2PVO B;  2HNI A;  1AEY A;  3D7S B;  3M0T A;  2AT1 B;  1IRE B;  5GAN 4;  5GMK l;  3VS7 A;  1VQ9 Q;  2CP5 A;  4PFZ A;  1BI3 A;  3QZ9 B;  1IXD A;  4X9D A;  2RI5 A;  3CMA Q;  2GBQ A;  1WNL A;  2MYS A;  3FDR A;  3RKY A;  2HL5 C;  2IG0 A;  3OYL A;  2SRC A;  3OSS C;  2AKK A;  3OYM A;  3EFO A;  3OYI A;  3CCV T;  1UJY A;  1BIA A;  3CCU A;  2JOY A;  3UDC A;  4FYW B;  1D3B B;  4B6M A;  2O4X A;  5LJ5 g;  2VC8 A;  4RG2 A;  4FT2 A;  5LJ5 j;  3G71 A;  1VUB A;  5FWB A;  1VQM T;  4C92 D;  1RAA B;  5A0G A;  4N4G A;  4F7U E;  3EH2 A;  4C92 E;  1N9R A;  3CCR Q;  1JJ2 A;  2V1Q A;  5GAN 3;  2K4Y A;  1UB4 A;  3JB9 J;  3JB9 F;  4OMQ A;  3C4S A;  4F14 A;  2ZGW A;  2ED0 A;  3CD6 T;  3QO3 A;  1VQM Q;  3G1J A;  4XAX B;  1Q82 R;  2GTJ A;  4RG8 A;  3JCM f;  2RI2 A;  4ZNX A;  5KYU B;  4OMM A;  1WDX A;  3Q1J A;  1AT1 B;  2XDB A;  4LNP A;  4BUG A;  3FJP A;  2DAQ A;  4JDS A;  1WPY A;  4FW2 A;  1KQS A;  4M7D C;  4PK4 A;  3OA6 A;  4A63 B;  1EIF A;  2EQI A;  3G4S Q;  4LXC A;  5KE2 A;  2K3B A;  2JVV A;  1M90 U;  3CCJ T;  5GAM e;  1CSK A;  5DM7 R;  5GMK e;  1YJN A;  3RER A;  4J9G A;  3SB2 A;  2FEI A;  3CCJ A;  3EHR A;  1X43 A;  2E3H A;  1UGR B;  1LPL A;  3OYC A;  2MIO A;  2E70 A;  2YSQ A;  2F2V A;  5M9O A;  2NUT A;  2P0K A;  1ZQ1 A;  1YJN T;  2RI3 A;  2O88 A;  2NLU A;  4L6V 5;  2CGH A;  1ZA1 B;  3RIR A;  4EIK A;  2QGG A;  4M78 E;  3CC7 T;  4M77 F;  4JRI A;  2KYB A;  2DE0 X;  4FSS A;  1PCX A;  1GCQ A;  4L59 A;  5LJ3 h;  1D1C A;  3QBY A;  2XHC A;  1MGQ A;  4IUU A;  3EAE A;  4QQG A;  1OEB A;  4M77 A;  4NOY A;  4M77 D;  3TRE A;  2XU8 A;  3RBB B;  1A0N B;  3L2Z A;  3VUZ A;  1Q95 G;  1XNI A;  2E5Q A;  1XJW B;  2ESW A;  2KVQ G;  2X4W A;  1WI7 A;  3L2W A;  4JS5 A;  1KSW A;  4ZTJ A;  4X1V A;  1KHC A;  4M75 C;  4FL6 A;  4O6J A;  2P0Q A;  3CCE A;  1PWT A;  1ZUK A;  1VQ9 A;  2JXB A;  2MWP A;  3QPH A;  3NTK A;  1VQ8 Q;  9ATC B;  2MOX A;  3CCV A;  1BI0 A;  3JB9 G;  2CS7 A;  4IUV A;  4M78 B;  5LJ3 d;  3JB9 D;  3OMG A;  1RAD B;  1UEC A;  1Y0M A;  4PFP A;  2RD1 A;  2HMA A;  2LT1 A;  2DZ9 A;  1VQ5 T;  2CKK A;  1U1T A;  2QGF B;  3QJ6 A;  5CVI A;  4FM4 B;  3PVQ A;  1UG1 A;  2L3S A;  3LW5 E;  1K8A U;  5IH2 A;  1LNX A;  2VV5 A;  3E2U A;  3A8L B;  3VV0 A;  1SHG A;  3RMS A;  4HKE A;  3BW1 A;  1M1F A;  4RTZ A;  4PLL A;  4EDU A;  4J9F A;  4XU1 A;  3PIO A;  3OY9 A;  4XQ3 A;  3TVT A;  3LX7 A;  2CP2 A;  2DXC A;  2LQN A;  3EFS A;  2K6D A;  1R0B G;  1PG5 B;  2ROT A;  4OMF B;  2LRQ A;  1D3B A;  3OW2 P;  2ED1 A;  4AFS C;  1UHF A;  5GAO n;  2RMO A;  5LJ3 j;  4GLK A;  4EMG A;  4E2F B;  2RQV A;  3C12 A;  2CRE A;  4A53 A;  4PLI A;  4OB3 B;  1N8R U;  2F2W A;  2JS2 A;  2D1X A;  4M78 D;  2KMT A;  2LQ8 A;  4JLI A;  2OAW A;  4FIB A;  4UC4 A;  3KUF A;  5C6S A;  4JJB A;  4M7A F;  4QQ6 A;  2DL5 A;  1XQH A;  1T0H A;  4R0K A;  2D6F A;  2HDA A;  2FYK A;  5A0L A;  5CAI A;  4CRI A;  4ELY C;  1W6X A;  3A5Z B;  4HVV A;  5D6X A;  3RDV A;  1X69 A;  3UPU A;  1IB8 A;  2DL4 A;  2HQX A;  4MZM A;  4C8Q A;  4M75 A;  1K1Z A;  4YTL A;  5CKF A;  4D6W A;  2EKO A;  2DER A;  2DTH A;  2LP5 A;  1WHK A;  1ABO A;  2AZV A;  4WF2 A;  2RF0 A;  1O9S A;  5HKC A;  1FWZ A;  4FYV B;  4LN2 A;  4C8Q F;  1WGS A;  2L2P A;  1SG5 A;  4J9D A;  5IHK A;  3M0Q A;  3MCA B;  4E47 A;  3V8J A;  1PSE A;  1YIJ T;  2NUP A;  1BKB A;  2MI6 A;  3MHX A;  2DVE A;  1QP2 A;  3DLL A;  1X75 C;  1VQK A;  2FRY A;  3H9N A;  3SWN B;  3MP8 A;  3OYY A;  3H6Z A;  5CKD A;  4R55 A;  4QQD A;  2LMJ A;  3U23 A;  3I55 T;  3RR6 A;  1YHQ Q;  2F69 A;  1OZ2 A;  3M9Q A;  2JN0 A;  2OX7 A;  4CC4 B;  2K5F A;  4GY5 A;  1RLP C;  1K9A A;  3L2U A;  2P0P A;  1ACM B;  4LUE A;  3O8V A;  3I9Q A;  4JRP A;  2JZ2 A;  3MO8 A;  1S72 A;  3CCR T;  1K8A R;  2YLB A;  4AMC A;  1WYX A;  3QDF A;  4M7D G;  4KT0 E;  3M4G A;  5FU7 B;  2HAX A;  2FHD A;  3QKJ A;  4HVU A;  2DK3 A;  3VKI A;  3UA7 A;  1QCF A;  1V1C A;  1RAH B;  1GFC A;  5LJ5 d;  4M75 G;  2O01 E;  1AWJ A;  3P8H A;  2EGA A;  3DB4 A;  2LNH B;  3CBP A;  4P5N A;  1KHI A;  2EFI A;  2EJG A;  1NEB A;  1UHC A;  1H64 1;  2ZPH B;  5LJ3 g;  4C5I A;  1T3L A;  1VQL T;  1FYN A;  2VWF A;  2KT1 A;  3GPL A;  4Z8A A;  1PM3 A;  1OU9 A;  1B34 B;  5HK3 A;  3L2V A;  2QQA A;  4OGC A;  2F5T X;  1UEB A;  2AIR B;  1BI1 A;  1VQO Q;  2KQW A;  2Y4Y A;  4BI8 B;  2PTK A;  8AT1 B;  3FB9 A;  1XTD A;  1GXI E;  1YJ9 T;  4M7A G;  2RB6 A;  3X20 B;  3HP9 A;  3L2R A;  1M1G A;  2GNC A;  4JUV A;  1FMV A;  3H0H A;  5LJ5 f;  1UGS B;  1PRM C;  5GAN e;  4A4F A;  2W0Z A;  1VQ8 A;  1VIF A;  3VS5 A;  3OQ5 A;  1ZUY A;  2DYB A;  2DF6 A;  2X3W D;  2VKN A;  3OYB A;  1B3Q A;  5KYX B;  2KSS A;  4IUP A;  1W2B S;  2CSI A;  2QQB A;  1V76 A;  1UFF A;  1M5Q 1;  2Y4X A;  3GNG A;  2VYT A;  3VYG A;  1WHH A;  1NM7 A;  2EGC A;  3CCM Q;  2YXY A;  4A4K A;  3INZ A;  1YI2 Q;  1NPR A;  2VUB A;  2RK2 A;  2YLC A;  2C0T A;  5GAM f;  4ME7 A;  3CCM A;  2DJQ A;  2PUK B;  2DL7 A;  4OB2 B;  3DKM A;  4N4H A;  4KUD K;  1RL2 A;  1VQ8 T;  3FC3 A;  5GAN g;  2PNI A;  3H41 A;  2KT8 A;  4M7D F;  1EFN A;  1TS9 A;  1VQP T;  5GAN 7;  3OYF A;  1YNZ A;  1M1K U;  4HCB A;  5GAO r;  4KUI A;  1OX8 A;  1OX9 A;  2R57 A;  2ZPG B;  4XU0 A;  1Q82 U;  1N6A A;  4X9C A;  3OYN A;  1GCP A;  4DEY A;  1I5O B;  1M8V A;  2E6Z A;  2K5L A;  4FYY B;  5DLO A;  4RTX A;  4Y92 A;  2ZPF B;  5CO7 A;  4E7K A;  1Q7Y R;  4LDY A;  1X6G A;  2WSE E;  1K0S A;  2FPE A;  2AZS A;  4C92 G;  2R58 A;  4RTU A;  4ELZ C;  2DM1 A;  1WX6 A;  2EYX A;  4E7L A;  3ASK A;  4OML A;  3E9F A;  2PVD B;  2QYZ A;  2NYS A;  3UA6 A;  5GAO p;  4M7A A;  3NTH A;  3P8D A;  4RMO A;  4QVC A;  4J6Y A;  1KQ2 A;  2HBP A;  2M16 A;  4BDZ A;  3M4Y A;  4LD9 K;  1QWE A;  3OYJ A;  2DMO A;  4KGZ B;  3C95 A;  3VYH B;  2MF2 A;  1WXB A;  3EHQ A;  3UF4 A;  1U06 A;  2CUB A;  2YRV A;  1YJW A;  2VGN A;  2A08 A;  2O9S A;  2RHU A;  2L0A A;  1VQL Q;  5IHI A;  4N0A C;  4F7U A;  2C0O A;  1S72 T;  1M30 A;  5GMK m;  4O5V A;  3UT1 A;  4C5H A;  2ZAE A;  2EJ9 A;  4FU6 A;  1WHM A;  1KD1 R;  3CCQ A;  2QDL A;  4F7U F;  4AFZ C;  3M56 A;  3PE0 A;  1WJR A;  1MMA A;  1JRI A;  1M3A A;  3RKW A;  1BCO A;  3EGX A;  4FW1 A;  2RHX A;  1WIE A;  1M1K C;  5I2M A;  3MP1 A;  1F1B B;  2CZ0 B;  4Z89 A;  2DRM A;  1QVF A;  2RK1 A;  5EG2 A;  1W1F A;  3IQL A;  1ZSZ C;  1VYV A;  1BB9 A;  2CT3 A;  1Q86 R;  4C0Z A;  3CXC S;  2DA9 A;  5D7U A;  1GRI A;  3CC7 Q;  4M75 E;  4ZGD B;  2X4J A;  2J6F A;  1HSQ A;  2GQI A;  2WAC A;  4EMH A;  4XTW A;  1I5L A;  4N0A A;  5DLQ E;  1TSF A;  3VU3 C;  4WCI A;  5KYW B;  5GMK i;  1K76 A;  2DZC A;  5FWC A;  3FRN A;  4OMN A;  2V8K A;  3TEE A;  5IT9 E;  3S3M A;  2W10 A;  3A8M B;  4LDW A;  3CME A;  1OZ3 A;  4XU2 A;  4OP0 A;  3MET A;  1TU0 B;  5GAO q;  4HT9 A;  3CXC P;  3GIB A;  2OJ2 A;  1UGV A;  4ESR A;  2X4X A;  2HEQ A;  2EQU A;  2MCN A;  3JCM Q;  3QZ5 B;  1Y96 B;  2BTT A;  2JS0 A;  2QTV A;  1Y07 A;  2EYW A;  3I56 Q;  2LQK A;  3CME Q;  2EBP A;  1D0Z A;  3LH0 A;  5GAM g;  4J7I A;  2A7Y A;  1Y71 A;  3CEY A;  1UGQ B;  1OYX A;  1JJ2 S;  1OV3 A;  2HBW A;  3TQ7 P;  2FG0 A;  4A4G A;  4RCC A;  2ROL A;  4LD6 A;  2LCL A;  2NUT B;  1NYG A;  2DEQ A;  1JXM A;  5IXB A;  5CQY A;  2E65 A;  4C0F A;  2D0Q B;  3SWN C;  2R5A A;  5GMK j;  2LZ6 B;  2KRM A;  4BY6 B;  2DIL A;  4M7A C;  3KBG A;  5KYN A;  1AWO A;  2AK5 A;  1NEG A;  4M7A B;  1RI0 A;  2JT4 A;  3X28 B;  3ZFJ A;  1WQ7 A;  3RNJ A;  3GLX A;  3KFV A;  3PTA A;  2RHZ A;  1VQ9 T;  2ENM A;  4LE9 A;  2KRN A;  4FYX B;  3NFC A;  3BFM A;  2LJ0 A;  4C92 C;  4J9C A;  3SFM A;  5I21 A;  4PFO A;  1FX7 A;  1UE9 A;  1QMC A;  5LJ3 e;  1J3T A;  2VGM A;  2M02 A;  1R77 A;  1MV0 B;  2DNU A;  3JCM g;  2QEX Q;  1SHF A;  2V8I A;  2A28 A;  1H3H A;  1W2B P;  2RHI A;  1Q86 U;  4QVZ A;  3OYG A;  2RO0 A;  3G4S T;  3OW2 S;  5D6Y A;  3M0U A;  1Q86 C;  2E3I A;  5ECA A;  4AG1 C;  2KAF A;  4C8Q B;  1Z9Z A;  1U5S A;  1BYM A;  4A4H A;  2CZ1 B;  3OYA A;  2DPP B;  5LJ3 f;  1X6B A;  3CC7 A;  1MUZ A;  3G7Z A;  5KYX A;  4AG2 C;  3L1A A;  2D8J A;  3FEO A;  1SSH A;  3GBQ A;  2ZZD A;  8ATC B;  1VYU A;  1VYT A;  4LUD A;  2IIM A;  2NUP B;  5I11 A;  2RJE A;  4Q5W A;  3VS4 A;  3M58 A;  4BY6 C;  4OGE A;  2EAY A;  1RAC B;  1WJS A;  1WXU A;  4A54 A;  7AT1 B;  3OBW A;  5GAN f;  2VB6 A;  1QKW A;  2XDP A;  4X34 A;  3VS1 A;  2PZ1 A;  2VVK A;  4M7D D;  2YT6 A;  5AT1 B;  4PJO G;  3V8L A;  1TUG B;  2J05 A;  2L3R A;  1SKU B;  2DX1 A;  2F2X A;  4RKU E;  3I5S A;  2A0F B;  4Z02 A;  2CP0 A;  3CCQ Q;  1NG2 A;  3LWI A;  4JJC A;  1AZE A;  2K9G A;  5GAN 5;  2DRK A;  1TG0 A;  2EIF A;  3EFR A;  3M59 A;  1D0X A;  1QQJ A;  1I81 A;  1K0X A;  1T0J A;  4XK8 E;  2P4R A;  3C94 A;  1M3B A;  4M77 C;  3HHT B;  2WSF E;  3CD6 A;  4E6R A;  1VQ4 Q;  3I55 Q;  3UAT A;  3KXT A;  5CKB A;  1GCQ C;  4BAC A;  1YHQ A;  1Y96 A;  2B8A A;  2M1H A;  3LLR A;  2CP6 A;  5IN1 A;  1VQP A;  3MEU A;  1H92 A;  4RTT A;  1Q7Y C;  1VQM A;  4RTV A;  2RH2 A;  1NJI R;  3CPF A;  3G71 T;  1G3Y A;  1SRL A;  2L3Q A;  4XTX A;  3WXM B;  3CCU T;  2KRS A;  2QXF A;  3JCM h;  5FRM A;  2F1L A;  2CZ6 B;  5GJW B;  2E64 A;  1JEG A;  4MDX A;  4XTY A;  2GGR A;  2FZG B;  4BD3 A;  3ER0 A;  1ZUU A;  4PL6 A;  1AWW A;  3N5B B;  2LJ1 A;  3CXC A;  2V1R A;  3EG3 A;  2E6N A;  3V8K A;  2YUN A;  2O31 A;  4C0D B;  4WTO B;  3EGD A;  3C0C A;  1N8R C;  2XDD A;  3LYI A;  1SPK A;  4E7Z A;  3JCM W;  3CCL T;  3S6W A;  4DQ2 A;  2OTJ T;  4XTZ A;  3CBM A;  4E7S A;  1BK2 A;  4B9X A;  4C5E A;  1VQ6 A;  2K5I A;  1VQO A;  4OB1 B;  3JB9 H;  1VQP Q;  3A98 A;  1KD1 U;  2JM8 A;  3MEV A;  2EJF A;  4RTW A;  1B07 A;  3SD4 A;  2GTO A;  1BIB A;  1VQ6 Q;  2ZPI B;  4BI4 A;  1OU8 A;  2ECZ A;  2OTJ Q;  2HQH A;  3CPW S;  1TWB A;  2OI3 A;  4PJL A;  1AHJ B;  4M7D B;  1NZ9 A;  1GFD A;  4IIO A;  2JMA A;  3DLM A;  3QDR B;  1ZLM A;  3NPF A;  1YI2 T;  1AD5 A;  2MAM A;  4C92 F;  4KH1 B;  1LVK A;  4XU3 A;  3E1S A;  2P4T A;  1G2B A;  3GOX A;  2DIG A;  3HPW A;  2HQE A;  1PKS A;  5GAO m;  1AWX A;  1Q82 C;  1VQ5 Q;  5CR2 A;  2LDM A;  2KYM A;  1M2V A;  1I8F A;  2RA2 A;  4C92 A;  2G3R A;  2EYZ A;  3QWY A;  4BE1 A;  5GAN h;  2COY A;  4MMK A;  1WLP B;  3GNF B;  3CPW P;  4N4I A;  1PRL C;  2QQR A;  3FLG A;  4PJM A;  2LTO A;  2DD4 A;  1YP5 A;  1VQN A;  1TXQ A;  1M90 C;  5HCK A;  1TOV A;  2XID A;  2YWW A;  3NHN A;  2D8H A;  2QDY B;  1G8X A;  2DBM A;  4M7D A;  3QSU A;  1QCN A;  3QHS A;  3MEA A;  2HSE B;  1VQN Q;  1I0C A;  2DJZ A;  2BE9 B;  3GF5 A;  3BDU A;  2Z0W A;  3JCM c;  3CC2 T;  2KRO A;  2X9H A;  1K73 R;  2YUO A;  1M9S A;  1NLO C;  2M0Y A;  2XIC A;  4KH0 B;  3PIP A;  1WFW A;  3A1P A;  5KH6 A;  2K7A A;  1M2V B;  2GQV A;  1M27 C;  3EG9 A;  2RNA A;  1TTH B;  3CC2 A;  1LJO A;  3ZEH A;  2XI9 A;  4F7U B;  2X35 A;  5IHN A;  1K4U S;  2EKH A;  2LCC A;  2LVM A;  5FRO A;  1ARK A;  3M0P A;  2D9T A;  2ATC B;  4C0G A;  5D6W A;  2X3X D;  4J9B A;  4AT1 B;  3CD6 Q;  1AOJ A;  2FRW A;  2EGE A;  3M0S A;  4M78 A;  1ZSZ B;  1IGQ A;  4NL3 A;  2EYQ A;  3RES A;  1X27 A;  1KQ1 A;  3LH5 A;  5LJ5 h;  1Y7X A;  2L8D A;  2H8H A;  1YIJ Q;  3G6E T;  1PNJ A;  4BE0 A;  1BCM A;  2KBT A;  2DBK A;  1OI1 A;  4IUT A;  3S3N A;  1X6O A;  2DXB A;  4J6X A;  3V7C A;  2K3X A;  1S72 Q;  4BE2 A;  4M75 F;  4JRQ A;  3EG0 A;  4J7F A;  2HSP A;  1GBR A;  5KYY A;  3HTR A;  2IPO B;  2GF7 A;  3QJY A;  2A36 A;  4J8O A;  1I1J A;  2IVW A;  1OQK A;  1Y57 A;  4DBF A;  1RI9 A;  3PMI A;  1JBM A;  2E10 A;  1JXO A;  3QG1 A;  3HFN A;  1GL5 A;  1YI2 A;  3MKD A;  2GFA A;  2HCK A;  1G3S A;  1VQO T;  3JV3 A;  2HD0 A;  4J83 A;  2FZK B;  5I2S A;  2EQJ A;  1QW1 A;  4JPB W;  5J3B A;  1G3T A;  4V2S A;  1WHL A;  2ABL A;  1VQ5 A;  1OOT A;  1IRX A;  3M57 A;  3EFO B;  2GCX A;  3CCE Q;  2FPD A;  4JLG A;  1PC0 A;  3BY7 A;  2RPN A;  4PJJ A;  1RAI B;  1PSF A;  3JCM P;  1YCS B;  1M90 R;  2DFU A;  4XTU A;  5FW9 A;  2Y90 A;  1ZSG A;  2X51 A;  3QXE B;  1PD0 A;  2CT4 A;  3MPU B;  1YJ9 Q;  4JZ4 A;  2HKN A;  3CCE T;  1VQ7 A;  2EWN A;  3EGX B;  2GFU A;  2BUD A;  1YHQ T;  4LDX A;  2PU9 B;  1E6G A;  2DET A;  2V8J A;  3CPW A;  3H8Z A;  4EPC A;  3PMT A;  1X2K A;  2PUO B;  2QK0 A;  1RAG B;  3VRY A;  1BBZ A;  4QW2 A;  3ZL7 C;  1RAE B;  5GAN 2;  2C06 A;  2YUQ A;  4ZN3 A;  3CC2 Q;  2B86 A;  2A37 A;  3OS5 A;  3OS0 A;  3BDL A;  1JJ2 P;  3THK A;  1NJI U;  3WVE B;  1WHG A;  5HK0 A;  2QAZ A;  1K8A C;  2DKG A;  5GMK h;  1FMW A;  3EH1 A;  5DY9 A;  4HCC A;  2QQS A;  5CQX A;  1QVG P;  1KC8 C;  1I07 A;  3E9G A;  3G6E Q;  1ZHI A;  1H3Z A;  4DEX A;  3AT1 B;  2CUD A;  2NUZ A;  1IHV A;  3P8B B;  2OAU A;  2H3J A;  1T3S A;  3ME9 A;  4M78 C;  3WVD B;  4PJO F;  3OS1 A;  1QLY A;  2RJD A;  2XG8 D;  2H3E B;  2YUP A;  4ZN1 A;  3JCM J;  3I5R A;  1LOJ A;  3LWH A;  3RMQ A;  3JCM e;  2RN8 A;  2JJ9 A;  1YCY A;  4OF1 A;  2F5K A;  1D09 B;  2AHJ B;  1KG1 A;  1QVG S;  2FPF A;  2XKO C;  1K9M C;  2EW3 A;  4JRK A;  3REB B;  1K73 C;  1VQ7 Q;  1EZZ B;  3DB3 A;  3M5A A;  1D1A A;  1WA7 A;  2RQU A;  3T9N A;  4CI0 C;  2VXE A;  3A8G B;  2JTM A;  4AFQ C;  1YJN Q;  3QYG B;  1MND A;  5C0M A;  1G3W A;  1MNE A;  1WZO A;  1Z9Q A;  4PNO A;  5IAY A;  3G4S A;  1UGP B;  2DEU A;  3PNW C;  1AZG B;  1MHN A;  3OYK A;  2RHY A;  2LNV A;  2CSQ A;  1JO8 A;  2JMC A;  5HY6 A;  2CP3 A;  3FIF A;  3MEW A;  1R8O B;  2J06 A;  2EVR A;  1TUC A;  4ZGJ B;  2E12 A;  5KYU A;  1NBE B;  2L5Q A;  4MZP A; 
#chains in the Genus database with same CATH homology
 1LCK A;  2L3Q A;  1M8M A;  4J9H A;  4AFU C;  5IXF A;  1CKA A;  2KRS A;  4GBQ A;  2EPD A;  5GJW B;  2YDL A;  1JEG A;  2GNC A;  3H0H A;  1H8K A;  2GGR A;  1PRM C;  2XMF A;  2W0Z A;  1ZUU A;  2KR3 A;  2I0N A;  3VS5 A;  1AWW A;  2KXC A;  1ZUY A;  2LJ1 A;  2DYB A;  2DF6 A;  2X3W D;  2V1R A;  3EG3 A;  2YUN A;  2O31 A;  2VKN A;  1UUE A;  3C0C A;  4D8K A;  2BZX A;  1B3Q A;  1SPK A;  2NWM A;  2CSI A;  4HVW A;  1IO6 A;  1M3C A;  4M4Z A;  4OMO A;  4F16 A;  2J6K A;  1UFF A;  1NM7 A;  2C0I A;  2EGC A;  2FO0 A;  1BK2 A;  1KIK A;  2BZY A;  1KFZ A;  1G83 A;  3FJ5 A;  1RLQ C;  2EYY A;  3A98 A;  3REA B;  1YN8 A;  4HXJ A;  2JM8 A;  4RTW A;  4RUG A;  1B07 A;  1UDL A;  2GTO A;  2BZ8 A;  3TSZ A;  2C0T A;  1AEY A;  2JW4 A;  3M0T A;  2DJQ A;  2DL7 A;  1JU5 C;  2CDT A;  3VS7 A;  2ECZ A;  2PNI A;  2OI3 A;  3H41 A;  2KT8 A;  1EFN A;  1GFD A;  4J9E A;  2JMA A;  3NPF A;  2GBQ A;  4IIO A;  1ZLM A;  3I35 A;  1AD5 A;  1YNZ A;  4F17 A;  2SRC A;  1U3O A;  1G2B A;  2AKK A;  1UJY A;  1PKS A;  1AVZ C;  1GCP A;  1AWX A;  4DEY A;  2KNB B;  2K2M A;  5FWB A;  4RTX A;  4Y92 A;  2KYM A;  1OPL A;  4D8D A;  2EYZ A;  3QWY A;  1X6G A;  5I22 A;  2DLP A;  2RQR A;  1K0S A;  2FPE A;  1WLP B;  2AZS A;  4RTU A;  2DM1 A;  2V1Q A;  1WX6 A;  2EYX A;  2G6F X;  4OML A;  1S1N A;  1PRL C;  5EC7 A;  4OMQ A;  3SEM A;  4CC7 A;  4F14 A;  2ED0 A;  1XOV A;  3UA6 A;  3EGU A;  1YP5 A;  2GTJ A;  4ZNX A;  5HCK A;  3QWX X;  1WDX A;  4OMM A;  3NHN A;  1QWE A;  2D8H A;  4LNP A;  2DBM A;  2DMO A;  2CH4 A;  1WXB A;  3EHQ A;  3UF4 A;  1U06 A;  2CUB A;  2A08 A;  1I0C A;  2O9S A;  1UTI A;  2RQT A;  2L0A A;  4A63 B;  2KRO A;  2EQI A;  5IHI A;  2YUO A;  1NLO C;  2K3B A;  2M0Y A;  1WFW A;  1CSK A;  1JQQ A;  2C0O A;  2J6O A;  2K7A A;  2KXD A;  1M30 A;  1M27 C;  4J9G A;  2FEI A;  3EHR A;  1E7O A;  1NLP C;  1X43 A;  2RNA A;  3VRZ A;  1MV3 A;  2CH4 W;  2MIO A;  2YSQ A;  2QDL A;  2F2V A;  2LQW A;  4AFZ C;  5IHN A;  1K4U S;  2EKH A;  1ARK A;  3PE0 A;  3M0P A;  2O88 A;  4OMP A;  2O2O A;  2O9V A;  3EG2 A;  3H0F A;  1QKX A;  2L3P A;  1M3A A;  2D0N A;  2X3X D;  4J9B A;  1OPK A;  4EIK A;  1AOJ A;  2FRW A;  4J9I A;  1WIE A;  2KYB A;  2DE0 X;  2EGE A;  4FSS A;  1GCQ A;  3M0S A;  1YWO A;  4Z89 A;  1X27 A;  2DRM A;  3LH5 A;  1VA7 A;  3R6N A;  3VS0 A;  1W1F A;  3CQT A;  3IQL A;  2H8H A;  1VYV A;  1BB9 A;  1OEB A;  2CT3 A;  1PNJ A;  2KEA A;  2DA9 A;  1E6H A;  1GRI A;  3EG1 A;  3RBB B;  1A0N B;  2KBT A;  2DBK A;  2J6F A;  1HSQ A;  2GQI A;  4KRT A;  2ESW A;  1ABQ A;  1UJ0 A;  1WI7 A;  4WCI A;  4CC2 A;  3EG0 A;  2HSP A;  1KSW A;  4ORZ A;  1GBR A;  4X1V A;  1K76 A;  5FWC A;  1PWT A;  1ZUK A;  2JXB A;  4OMN A;  2A36 A;  1I1J A;  3ULR B;  1Y57 A;  2W10 A;  4CC3 A;  2MOX A;  1RI9 A;  1JXO A;  4GLM A;  2J7I A;  1GL5 A;  2OJ2 A;  1UGV A;  4ESR A;  1UEC A;  1Y0M A;  2HCK A;  2K79 A;  2HEQ A;  3JV3 A;  2MCN A;  4IIM A;  2BTT A;  2JS0 A;  4JPB W;  3PVQ A;  1UG1 A;  2L3S A;  3SHW A;  5IH2 A;  1QWF A;  3O5Z A;  1SHG A;  2EYW A;  4RTZ A;  4J9F A;  2ABL A;  3TVT A;  2EBP A;  1HD3 A;  1OOT A;  2LJ3 A;  2LQN A;  3VS3 A;  2FPD A;  2K6D A;  2KE9 A;  1N5Z A;  2ROT A;  1GBQ A;  2RPN A;  4RTY A;  2ED1 A;  1OV3 A;  2HBW A;  1UHF A;  2M51 A;  4AFS C;  1RUW A;  2FG0 A;  1YCS B;  2ROL A;  2RMO A;  1NYG A;  1JXM A;  2RQV A;  1SRM A;  5FW9 A;  2CRE A;  1BU1 A;  1ZSG A;  5IXB A;  3H0I A;  4JJD A;  1FMK A;  2F2W A;  2CT4 A;  2JS2 A;  4JZ4 A;  2D1X A;  2LZ6 B;  2KRM A;  2DIL A;  2OAW A;  1X2Q A;  1AWO A;  4JJB A;  2AK5 A;  2AKL A;  1NEG A;  2DL5 A;  2JT4 A;  1T0H A;  4R0K A;  1SEM A;  3VS6 A;  1E6G A;  3RNJ A;  3KFV A;  1YWP A;  2HDA A;  2DL8 A;  2ENM A;  4LE9 A;  2KRN A;  1X2K A;  1KJW A;  1W6X A;  1ZBJ A;  2LJ0 A;  4HVV A;  4J9C A;  4K11 A;  1X69 A;  2JTE A;  2DL4 A;  3VRY A;  1BBZ A;  2JM9 A;  1UE9 A;  3ZL7 C;  1NYF A;  1J3T A;  5GJV B;  1MV0 B;  2DNU A;  1K1Z A;  1SHF A;  1H3H A;  2A28 A;  2YUQ A;  4Z88 A;  2B86 A;  2LP5 A;  2A37 A;  1ABO A;  3M0U A;  3THK A;  2AZV A;  2RF0 A;  1W70 A;  1WXT A;  5ECA A;  4AG1 C;  4HCK A;  4LN2 A;  1Z9Z A;  1U5S A;  2E5K A;  2L2P A;  4J9D A;  5IHK A;  3M0Q A;  1I07 A;  1X6B A;  3NGP A;  3PVL A;  1MUZ A;  4AG2 C;  4DEX A;  3VS2 A;  2CUD A;  2FRY A;  2SEM A;  2NUZ A;  4JZ3 A;  2D8J A;  2LMJ A;  1T3S A;  3U23 A;  1SSH A;  1QLY A;  3M0R A;  2DVJ A;  4QT7 A;  3GBQ A;  1VYU A;  2YUP A;  4CC4 B;  1VYT A;  3I5R A;  2IIM A;  4LUD A;  5I11 A;  3VS4 A;  2RQW A;  1RLP C;  2RN8 A;  1K9A A;  1WXU A;  4LUE A;  1ZX6 A;  3I9Q A;  2LX7 A;  1QKW A;  2KGT A;  3VS1 A;  1CKB A;  2PZ1 A;  2VVK A;  2YT6 A;  2J05 A;  2DX1 A;  1WYX A;  2FPF A;  2F2X A;  3I5S A;  1PKT A;  2EW3 A;  3NMZ C;  3REB B;  4HVU A;  1NG2 A;  1WA7 A;  3UA7 A;  1QCF A;  1V1C A;  3TSW A;  2RQU A;  4JJC A;  1AZE A;  2K9G A;  1GFC A;  2DRK A;  2DL3 A;  1AWJ A;  1TG0 A;  2EGA A;  1HJD A;  4AFQ C;  2LNH B;  1K0X A;  1NEB A;  1UHC A;  1T0J A;  2P4R A;  1Z9Q A;  1M3B A;  5L23 A;  1T3L A;  1AZG B;  1FYN A;  2VWF A;  4E6R A;  2KT1 A;  4Z8A A;  2CSQ A;  3UAT A;  1JO8 A;  2JMC A;  2LCS A;  1TUD A;  1GCQ C;  2J06 A;  2EVR A;  1PHT A;  1H92 A;  4RTT A;  1TUC A;  4RTV A;  2PTK A;  1SRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...