2SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/inhibitor
molecule keywords PROTEIN (SEX MUSCLE ABNORMAL PROTEIN 5)
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2semA00
2D1XA 2JM8A 2VKNA 4E6RA 2C0TA 2LMJA 2LQWA 4OMOA 2JTEA 4OMQA 1WIEA 2W10A 2EYWA 1QWEA 3PE0A 1B3QA 2KXCA 1MUZA 4HVUA 5IHNA 2CSQA 2K9GA 2FRWA 4ZNXA 1GCQC 2VWFA 2CSIA 3FJ5A 1KIKA 2RPNA 1QKXA 2YUPA 2ED1A 2KROA 2ENMA 3VS4A 3H0HA 2I0NA 4OMPA 2OI3A 1H3HA 2F2XA 2MCNA 1WLPB 3NGPA 3I9QA 1PKTA 2EGAA 2GNCA 2MIOA 4KRTA 2CDTA 2KR3A 4AG1C 2LJ0A 1GBQA 4GBQA 1K9AA 1M30A 1NLPC 4JJDA 3NHNA 2CREA 2DJQA 2LZ6B 1KSWA 2DRKA 2FO0A 2CT3A 2YUNA 4DEXA 1AOJA 2IIMA 2ROLA 2CUDA 2KXDA 1K1ZA 1GBRA 4LNPA 5GJVB 4D8DA 1BBZA 2JT4A 1TUCA 4ORZA 1SRLA 2CUBA 5IXFA 1J3TA 1BU1A 1VYVA 3EHQA 1E7OA 4HCKA 2F2VA 1E6HA 4J9CA 1WDXA 1T0HA 2HEQA 1GCQA 3REBB 3VS6A 4IIMA 3UA7A 1E6GA 2PZ1A 1OPLA 3CQTA 4JJCA 4LUEA 4AFUC 2SRCA 2EYXA 2J06A 4ESRA 4OMMA 2H8HA 4OMNA 1PRLC 2KRNA 2AZSA 4J9HA 1I07A 1ABOA 4CC4B 5FW9A 4J9DA 1M3AA 3M0TA 2J6FA 2YDLA 2ROTA 3M0SA 3ZL7C 1H8KA 2DLPA 2X3XD 1WXBA 2DRMA 2C0OA 2LP5A 3VS0A 4J9BA 1OEBA 4HXJA 1ZBJA 1UFFA 2O31A 2XMFA 1QCFA 2DX1A 1PNJA 2RQWA 2B86A 1UECA 2ECZA 2RQVA 1Z9ZA 1WX6A 1CKAA 3PVQA 1G2BA 2V1QA 5I22A 2RMOA 2DBMA 3O5ZA 1GRIA 3SHWA 1OOTA 2A37A 1T3SA 1EFNA 1U5SA 2KE9A 2ED0A 2GQIA 2L0AA 2A08A 4X1VA 2L3SA 3VS2A 2JW4A 2YSQA 1X43A 2O9SA 4RTZA 2FPDA 2J7IA 4HVWA 3UF4A 2JMAA 2YT6A 4Z8AA 2DNUA 1B07A 4J9FA 1I0CA 1JO8A 3M0QA 2JXBA 1MV3A 1X2QA 1W70A 1YNZA 2EYYA 3EG2A 1JEGA 1JU5C 2GTOA 3EG3A 2K2MA 2LNHB 2RQRA 2CT4A 2AKLA 2RQUA 2KT8A 1K76A 4DEYA 3M0UA 1WI7A 2KYMA 3EG0A 4JJBA 4CC2A 3TVTA 1HJDA 2BTTA 1FYNA 5HCKA 3H0FA 2FG0A 2KT1A 4F17A 2VVKA 1RUWA 2D8HA 4HVVA 4RTWA 1VYTA 1AWOA 2AK5A 2EW3A 1VA7A 1SHGA 3M0RA 1UG1A 2A36A 2KNBB 1ZLMA 2J6KA 2J05A 2JMCA 4IIOA 1U06A 2D0NA 4AG2C 1NEBA 5IHKA 1PRMC 2LX7A 2M51A 2PTKA 2GTJA 2RF0A 4QT7A 2G6FX 2GGRA 1NM7A 5IXBA 1CSKA 1WA7A 1X27A 1YWOA 2EKHA 3A98A 3THKA 2A28A 3SEMA 4D8KA 1GFDA 2DYBA 1AZEA 3PVLA 5L23A 4RTUA 4AFZC 2JS2A 1K0SA 4WCIA 4JPBW 2KRMA 2J6OA 4J9GA 2EGCA 1SSHA 3NMZC 2RNAA 4Z89A 2NUZA 2HSPA 2C0IA 2L3PA 1W1FA 2DBKA 3I5SA 2O2OA 4EIKA 2EVRA 3U23A 1UUEA 2DL4A 1ZX6A 3C0CA 1UDLA 2BZYA 3EGUA 5IH2A 2YUOA 4JZ4A 1HD3A 2K79A 4RTVA 2L3QA 1X6BA 1HSQA 3H0IA 3VS3A 1CKBA 2ABLA 2LJ3A 1PHTA 2DL5A 2DM1A 2O9VA 1AWXA 2K7AA 3LH5A 3UATA 1GFCA 2HBWA 2DMOA 1YCSB 3RNJA 1ARKA 3VS1A 1QLYA 3UA6A 1T0JA 1M3CA 2DILA 4F14A 1BB9A 2HCKA 3JV3A 2FPEA 1NG2A 1X6GA 2NWMA 1UTIA 2HDAA 5IHIA 2O88A 1AWJA 2FRYA 2JM9A 2D8JA 2LJ1A 3RBBB 2CH4W 1NLOC 2P4RA 2DVJA 1G83A 1BK2A 2KYBA 3GBQA 1RLQC 3EHRA 1PWTA 4RUGA 2DL3A 2FPFA 2KRSA 3NPFA 1GCPA 4CC3A 1KFZA 1NYFA 5EC7A 1AVZC 2AZVA 2W0ZA 4RTYA 1WXTA 1PKSA 5I11A 3I5RA 1X2KA 1WXUA 2DL8A 3M0PA 2PNIA 4JZ3A 1UJ0A 4LE9A 2CH4A 2EGEA 2OJ2A 1OPKA 2DF6A 1AZGB 1YWPA 1VYUA 1KJWA 1SEMA 2K6DA 1ZUYA 1FMKA 2KGTA 5FWBA 4Z88A 1Y0MA 1UHFA 1UE9A 4LN2A 4Y92A 2EQIA 5ECAA 1RLPC 4CC7A 3TSWA 1NYGA 1AWWA 1QKWA 1JQQA 3QWYA 3R6NA 2EPDA 1A0NB 2E5KA 4RTTA 1UJYA 1AEYA 1UGVA 1QWFA 3VRYA 1NEGA 1ABQA 1UHCA 3ULRB 1Z9QA 4GLMA 2GBQA 3VS5A 2EBPA 2DE0X 1IO6A 1N5ZA 1X69A 1LCKA 2AKKA 4F16A 4K11A 2QDLA 2OAWA 5FWCA 1GL5A 4J9EA 1V1CA 3IQLA 1SRMA 2M0YA 3VRZA 3H41A 1AD5A 5GJWB 2KBTA 1JXOA 2JS0A 2RQTA 1YN8A 2MOXA 3QWXX 1ZUKA 2BZ8A 1TUDA 1SPKA 2V1RA 1H92A 1T3LA 1U3OA 1RI9A 2FEIA 1MV0B 1Y57A 1YP5A 1TG0A 2F2WA 1ZUUA 1M8MA 4A63B 1WYXA 4R0KA 1ZSGA 3KFVA 2EYZA 2YUQA 1I1JA 4M4ZA 4AFQC 4FSSA 1OV3A 4RTXA 1XOVA 4AFSC 2DA9A 3VS7A 1K4US 2KEAA 2LQNA 1SHFA 3TSZA 2DL7A 3EG1A 2BZXA 4OMLA 4J9IA 2RN8A 2L2PA 1JXMA 2ESWA 4LUDA 1K0XA 1WFWA 1M3BA 2LCSA 3REAB 1S1NA 2X3WD 1M27C 2SEMA 3I35A 2K3BA 1W6XA
chains in the Genus database with same CATH superfamily
5KYWB 2C0TA 2LMJA 4OMOA 3A8LB 4TVRA 2EYWA 4M7DC 3PE0A 4HCBA 1MUZA 1JJ2A 3CCQQ 2FZKB 2XIDA 3VUZA 8ATCB 2PQWA 3CCVQ 2PUKB 1KIKA 2DK3A 2ENMA 2GFUA 3VS4A 1YI2A 2E41A 2E70A 2NUPB 4JRPA 4OMPA 2OI3A 1H3HA 2F2XA 3RR6A 2RI3A 1I5LA 4F7UA 2MWPA 2JUFA 4Q5WA 5IT9E 4J6YA 1VQLT 4NS5A 4JJDA 3ASKA 2A0FB 4M7AD 2CZ0B 2KMTA 2COWA 4JLIA 1KSWA 2DRKA 2FO0A 1TH7A 1AOJA 1K1ZA 4B9XA 1WGSA 1WNLA 2X4JA 2JT4A 1TUCA 2CUBA 2LC4A 2KDSA 2NLUA 5IXFA 5DY9A 1KQSA 1E7OA 4J9CA 3V8LA 1WDXA 1GCQA 1B34B 3VS6A 4LUEA 2PZ1A 4ZGEB 4JJCA 2G3RA 3H6ZA 2EYXA 1G3SA 1R8OB 1MMAA 4E2FB 3FC3A 3M4YA 3X25B 4QKUA 1YIJT 4IUPA 2OAUA 3CPWA 1YITA 3S3MA 3M0SA 4XU0A 3ZL7C 3CCEA 4M7AE 1WXBA 2DRMA 2LP5A 1IHWA 4FL6A 5LJ5e 1UFFA 3OS1A 1QCFA 1YJNA 4ZGDB 2ZPGB 4II1A 2QQ9A 1UECA 4FSXA 4PJOD 1VQ7Q 3V7RA 1VIFA 3META 4Y91A 2ZPHB 1D1BA 4N0AA 2RMOA 3I55A 1FMWA 2JOYA 1NBEB 2VV5A 5GMKh 2BE9B 1GRIA 1ZSZA 4XU2A 3SHWA 1Q7YC 5M9OA 1P92A 1VQ4Q 3RESA 2L0AA 1W2BS 2FZCB 2RH2A 3Q1JA 3KXTA 2FPDA 1D09B 1KK7A 4BD3A 2QK0A 2D9TA 3QDFA 2CZ6B 2JXBA 1JEGA 2F5TX 3HHTB 3D7SB 2RQRA 2QASA 3OYNA 2RQUA 2MF2A 4JRIA 4C0ZA 4BDZA 3EG0A 4JJBA 2E6ZA 4RMOA 2BIVA 4RKUE 2CP7A 5GAOn 4CC2A 1D0XA 4MMLA 2VVKA 4J7IA 1RUWA 1M90C 1UGSB 1NZ9A 5FRNA 2KY9A 1M2VA 4RTWA 3LGFA 1VYTA 3OYKA 5GAOm 3LGLA 2AK5A 4LDWA 2EW3A 3MP1A 2RJEA 4QVCA 2A36A 2KNBB 2LCCA 1QVGP 1ZLMA 4PJJA 2J05A 2OTLA 3EG9B 1VQLQ 4M77G 4IIOA 5GAMh 5FLXE 2COZA 1K9MC 1NEBA 1OX8A 5DLQE 3O8VA 4PJOG 4E7IA 1AT1B 3OYDA 1KQ2A 4PFZA 1BCMA 1NM7A 1EX4A 1W4SA 3PFSA 4AMCA 1YWOA 3MKDA 4JDSA 1EIFA 4X9DA 5L23A 2X35A 3G7ZA 4JUVA 1K0SA 2J6OA 4DBHA 2EGCA 1SSHA 3QIIA 2VB6A 3NTIA 4M75B 3RKWA 2O2OA 8AT1B 2DL4A 1ZX6A 4C92F 1UDLA 2RJCA 2VASA 1YIJQ 3SB2A 2XDBA 3VJPA 3OS2A 1Q81U 1RI0A 2L3QA 3H0IA 1PD0A 2DAQA 2XDDA 2E3IA 2IG0A 2DM1A 5D6WA 3LH5A 4XTZA 2L89A 3UATA 1OQKA 2HBWA 2DMOA 2Y4XA 3UA6A 1M3CA 1KC8C 3OYAA 4IUTA 4F14A 4JRQA 1YHQT 4LD9K 1VQ6T 4M7AB 2M0OA 1YJ9A 2YRVA 4X34A 2EYQA 3M55A 2D8JA 3PIPA 1Q7YR 2MPXC 1BK2A 2KYBA 5FROA 3OQ5A 1FX7A 2DIQA 3EHRA 1G5VA 4RUGA 4M78G 3NPFA 5GAOr 5EC7A 1G3TA 4FYYB 3V7SA 4R55A 2W0ZA 1MNEA 1OX9A 4OMFB 3MP8A 4C92D 2PU9B 4L59A 3CC7A 4LE9A 3CC4T 1QVFA 1OPKA 1AZGB 4B6MA 2DD4A 2KGTA 4NOYA 4M77A 5FU6B 4PJNA 4RG2A 4M75C 3JCMd 1Y0MA 3TREA 2L8DA 3X20B 3PIOA 5ECAA 2FVUA 2M1HA 3FEOA 1M90R 1IXDA 4F7UF 4RG8A 4WTOB 3HSBA 1AWWA 3QWYA 1BI3A 2P0PA 3CXCA 2YRCA 2EPDA 2FYKA 5HK0A 3J7AF 1A0NB 3H9NA 2DPPB 4RTTA 4DOVA 5CQXA 3DB4A 5HK3A 1KC8U 3FIFA 1UJYA 5D7UA 1AEYA 2HNIA 3OS0A 4QVDA 1N6AA 3CCRT 3QYGB 1K9MR 2DZ9A 2E10A 1QWFA 4DA4A 1F1BB 5LJ3d 1RL2A 3CCJT 5KYXA 3LWHA 1UHCA 2ZPBB 4GLMA 2GBQA 3VS5A 1YJWA 2DE0X 4C92E 1X69A 4K11A 2QDLA 2OAWA 5FWCA 4E47A 3ER0A 1Q82C 2M0YA 2OTJT 2O4XB 5A0LA 4M7DG 1AD5A 2RB6A 2MK5A 4O5VA 2LTOA 3OYMA 1JXOA 2JTFA 1YN8A 3CD6A 2DETA 3JCMQ 2M9UA 3QBYA 4UC4A 1VQPA 2DEQA 2V1RA 5KCOA 5FU7B 3CEYA 1RAGB 4J7FA 3BE3A 3RIRA 1MV0B 1Y57A 1YP5A 1TG0A 3KFVA 4OVAA 3G6EA 4JS4A 2QEXA 2KVQG 3JB9F 1VQNT 3VUBA 4A53A 5KCHA 3TSZA 2QTXA 1VQMT 2DYIA 3EG1A 1K8AC 5GAN7 2ZPEB 3UWNA 3A8GB 4HA8A 4M78A 1OULA 1KC8R 1D1CA 1YHQQ 2L2PA 2ZPFB 3VU3C 1UGRB 1JXMA 2ESWA 3GP8A 1M2OA 3NFCA 1M3BA 5GANg 5I2MA 1DJ7B 4PJMA 3NTKA 2RQWA 1W6XA 4CC7A 1BI1A 2D1XA 2JM8A 2VKNA 2WSCE 3GIBA 4OMQA 3JCMh 3BW1A 3E19A 3OB9A 3MEUA 1B3QA 2KXCA 5IHNA 4F7UE 5KE2A 1ZBXA 1LPLA 3FJ5A 2ED1A 5IN1A 3CC4Q 1BIAA 3EH1A 1FXXA 2HKNA 1SSFA 2MCNA 1WLPB 3NGPA 3I9QA 2R5MA 2GNCA 2RK1A 3JB9D 2CDTA 5LJ3h 4C8QA 3CMEQ 1M30A 3RDVA 2LZ6B 4EMKC 1M1FA 4QQGA 2PVOB 2E4HA 3CCLT 2YUNA 2CUDA 2KSSA 2KQWA 2KXDA 4BE1A 2RHUA 1GBRA 1M5Q1 4M7DA 1RACB 4D8DA 4A4EA 1C6VX 4ORZA 1BU1A 3OW2A 2F2VA 3EFOB 5A0GA 4NL3A 1E6HA 3VKIA 3CCJQ 3JB9I 2HEQA 3REBB 2QA4Q 1VQKT 1E6GA 3CQTA 3DB3A 4AFUC 3HFNA 2LDMA 3CCMT 5LL6S 3MEWA 4L5GA 4OMMA 5I2SA 1VQOA 1XQHA 2H8HA 4OMNA 4A4GA 4FU6A 1Q82R 3AT1B 2AZSA 4QQ6A 2OTJQ 1I07A 5GANj 4J9DA 1SKUB 2E5QA 1IGUA 2YDLA 4C92B 1X01A 2X3XD 3RKXA 3MEAA 4J9BA 1OEBA 3JCMc 2XMFA 1KQ1A 1XNIA 4LDXA 2GFAA 1QP3A 2B86A 1ZQ1A 1BI0A 2RQVA 2YLCA 1Z9ZA 4J8OA 1OI1A 1WX6A 3JB9G 1D3BA 3F70A 3SWNA 1VQNQ 4MDXA 3OYEA 2DTOA 2A37A 1VQMQ 3PGGA 4ANJA 1T3SA 5GANf 1K8AR 5FRMA 2H3EB 2A08A 3V8JA 1I8FA 3M56A 1R77A 1H641 4J83A 4HVWA 5KYWA 1JBMA 2JMAA 2YT6A 1JJ2P 3QZ5B 2DNUA 4VUBA 1JO8A 2DKGA 1MV3A 1X2QA 2P4TA 2HMAA 1YI2T 4OB3B 2LNHB 2KT8A 1VQ5Q 4BI3A 1K76A 4PLLA 3M0UA 1RABB 4XTYA 3TVTA 2YWWA 2BTTA 2HKQB 2NUPA 1MMNA 5KYUA 2FG0A 4BACA 3CC2A 2F1LA 3QDRB 4PNOA 5GAN6 4M77F 4HCCA 2D8HA 2LVMA 1UEBA 5DLOA 3CMAT 4DOWA 4FYXB 1AWOA 1ZA1B 5GAN3 4PJOF 4F7UB 3EGDB 2JMCA 1I81A 5GMKj 2ZPIB 5CKEA 3JAME 1KQSP 3FDRA 2D0QB 5IHKA 1PRMC 2LX7A 2PTKA 1WJSA 2EQKA 1CSKA 3CCLQ 3SWNC 4BY6C 5LJ5h 1WHJA 3A98A 1G3YA 1VQLA 1C0MA 2WSEE 4XTUA 5GANe 5DM7R 3JCMX 3G71Q 3FB9A 3PVLA 3CBPA 1YITT 3HRTA 4XU1A 3CPWP 4WCIA 4JPBW 3CCUA 3CCET 2VGMA 4BB7A 1VQKQ 3CCMQ 1W1FA 3R6OA 1Y7XA 2DBKA 4A4HA 1YJNT 2EVRA 3C0CA 3JSCA 5IH2A 5GMKm 2K3XA 2PVGB 4M77D 1HD3A 9ATCB 4PK4A 4JS5A 1X6BA 3PT9A 1RAEB 2ABLA 2DL5A 1HK9A 4C5HA 4IKFA 2K7AA 4EDUA 4E7LA 5GAN4 1ARKA 2E12A 2JN0A 2FPEA 1NG2A 1X6GA 1Y96B 4OGCA 2MMPA 2NWMA 3GF5A 4DBRA 1UTIA 2HDAA 5IHIA 4HT8A 1TUGB 5CVIA 2R5AA 3QJ6A 4M78F 1X75C 1NLOC 4X9CA 2X4XA 3GBQA 1W2BA 2K57A 2EFIA 3S3OA 2L5QA 3QYHB 4QQDA 2DL3A 1KG1A 2KRSA 4N4IA 3G4SA 3OYGA 5J39A 5D6YA 2CS7A 4M77E 2AZVA 5CO7A 1G8XA 5KE3A 5IAYA 4C5GA 5GAMf 1X2KA 1WXUA 2QGGA 1Q81C 2E65A 4PJOE 3V7CA 1FMKA 2AT1B 1TXQA 4BE0A 5FWBA 5GMKe 5CCAA 3A5ZB 4ZTJA 3OYYA 2PUOB 4LN2A 3KUFA 2EQIA 5C0MA 3L2WA 1NYGA 1QKWA 1JQQA 3R6NA 3VYGA 4C8QF 3TU4K 3CMAQ 1S72A 1M2VB 3JB9J 2RA2A 2E5KA 1KHIA 2GF7A 6AT1B 3L1AA 2XDPA 4M78D 1UGVA 1LNXA 1QVGS 3J80E 2NUTA 3VRYA 3OYIA 2P0KA 5AT1B 3HKSA 1ABQA 3ULRB 1K73U 4YTLA 4M7DF 2EBPA 1IO6A 1N5ZA 2AKKA 1WQ7A 4ZTFA 3HFOA 1V1CA 4ZGJB 3H41A 5GAOp 1YITQ 4M75A 1WHMA 2KBTA 2RQTA 4QVZA 3CCEQ 3DLMA 2MOXA 3FJPA 4XTVA 2BZ8A 3QPHA 1TUDA 3M53A 1SPKA 2RHXA 4C0DB 3HPWA 3URGA 2MAMA 1YJNQ 2CP2A 3QJYA 1QVPA 2FHDA 4V2SA 3A8MB 3PMTA 4A63B 3WVDB 2EYZA 1YJ9T 4M78E 2YUQA 4C8QD 2RI5A 2XHCA 3SD4A 2DA9A 3VS7A 1GXIE 1V76A 1K4US 4ELZC 2RD1A 3GNFB 1M1KU 4KUIA 1TTHB 5KYNA 3HRUA 2LCLA 5CQYA 4J9IA 2CGHA 4M7DD 1WFWA 1QW1A 3L2VA 2HL5C 2K3BA 3BFMA 2M16A 3CPFA 4E6RA 4MZTA 1WJQA 1QVFP 2LQWA 3LYIA 4CRIA 2JTEA 1MGQA 3M57A 1YHQA 1WHGA 1WIEA 1VQ9A 2W10A 3AHUA 3P8BB 1RAAB 1Q86U 1IHVA 4HVUA 3HTRA 2QQRA 3EAEA 2K9GA 4C8QE 3L2RA 2C06A 1Q81R 3E1SA 2CSIA 1QKXA 4LXCA 3H0HA 3CXCP 4C5IA 4FYWB 1U1SA 3A8OB 1OU9A 1NPPA 1WZOA 2EGAA 3BDLA 4M77B 2EJGA 4AG1C 1D0ZA 1GBQA 1K9AA 4JRKA 1OU8A 2EIFA 4M7DE 3M59A 2V8JA 3NHNA 2CREA 2DXCA 4PJOB 2HZYA 2CP6A 4OP0A 1YJWT 3QZ9B 3RKYA 4C8QG 4ATOA 2IIMA 3EGXB 2X4WA 3CMEA 1FWZA 4LNPA 3V8KA 4BDYA 3BY7A 5GJVB 3X26B 1H3ZA 1SG5A 1J3TA 1SRLA 4HKEA 3CD6T 4M7AC 4HCKA 3HP9A 2EWNA 2AHJB 1T0HA 2RHYA 1G3WA 1VQPT 2MYSA 4IIMA 1BYMA 1OPLA 2SRCA 2J06A 4ESRA 3DLLA 2P0QA 2KAFA 2QI2A 1VQ8A 2WACA 2MWOA 2HD0A 3G6ET 2QEXT 2QA4A 2ATCB 2F5KA 3M5AA 2ROTA 1H8KA 1R0CB 1JRIA 1C1AA 4EMKA 2DLPA 2K5IA 3VS0A 2VXEA 1U1TA 2OX7A 5FU6C 5GMKl 4XTWA 5KYYB 2DIGA 1YJ9Q 2LNVA 3UPUA 3PVQA 1G2BA 2V1QA 5I22A 1YBYA 2DBMA 2IPOB 3I56A 1VQ6Q 3BDUA 1OOTA 3CCST 1PSFA 4X1VA 2L3SA 4M78B 1QCNA 2E1HA 2QGFB 3M4GA 4BI4A 2QTVA 4JLGA 2YSQA 1X43A 1NJIU 2J7IA 3MJXA 2CYZB 3UF4A 2DO3A 3C4SA 4Z8AA 4P5NA 1KD1U 2CZ7B 2L3RA 1YNZA 2EYYA 5CKBA 4XTXA 4KUDK 3EG2A 2GTOA 2JVVA 3EG3A 3C12A 4WF2A 2CT4A 4Y28E 2AKLA 4JJNK 2EQMA 7AT1B 2QQSA 5CKDA 2KYMA 4MZMA 4NL2A 3OMCA 2CZ1B 2BE7D 2F69A 2O01E 5A0DA 2DTHA 4FT4A 2JTMA 2VC8A 4FW2A 3CCQA 1N9SA 3ZFJA 5HKCA 2I2LA 1VQ5A 5FU7C 3CCVA 1PCXA 3GLXA 3VYHB 5HY6A 1SHGA 3M0RA 1N8RU 5C6SA 5GAOl 1PC0A 4XQ3A 2K2VA 1WHKA 3DKMA 2EJFA 1QMCA 2D0NA 5GANd 3OW2P 4E7SA 3M9QA 4AG2C 2M51A 1YJWQ 2GTJA 3N5BB 4J5YA 2RF0A 2MI6A 3CCRQ 3OSSC 4KH1B 2G6FX 2GGRA 5IXBA 1BCOA 2K4YA 2H3JA 1VQOT 1WA7A 1X27A 2EKHA 2A28A 2RJFA 4A54A 2XKOC 4D8KA 4IUQA 5EG2A 1GFDA 4M7DB 3OW2S 3LX7A 3CD6Q 4RTUA 2JS2A 4FM4B 5GAN8 4J9GA 3E2UA 4OF1A 1TWBA 1VQPQ 3CCLA 2RNAA 1TS9A 3P8DA 2L3PA 3ME9A 4M75F 5CIUA 3G71A 4EIKA 2DVEA 2DEUA 3U23A 2EJ9A 2GCXA 1M4ZA 2BZYA 2K5LA 3S3NA 4E7KA 3SFMA 1MMGA 3G6EQ 4JZ4A 1X6OA 2K79A 2QAZA 1HSQA 2RHZA 4GLKA 3VS3A 1PHTA 2Z0WA 1RAFB 2O9VA 1AWXA 1UB4A 2V8IA 2QXFA 1GFCA 4A4KA 3RNJA 3OBWA 3MCAB 1R0BG 3VS1A 1BB9A 1I4K1 1MHNA 3OS5A 3GNGA 2DFUA 1XJWB 1VQ7A 2Y4YA 2RK2A 4E7HA 3MP6A 3JCMV 4PJLA 2FRYA 2JM9A 3RBBB 2LJ1A 2CH4W 4E7JA 2X9HA 2P4RA 3CCSQ 2DVJA 2FL7A 4KT0E 4LDUA 4N4HA 5GMKi 3FLGA 1VQ4A 4PFPA 3L2ZA 3E9FA 3X28B 4C5EA 4PFOA 5CKHA 3OMGA 2KK4A 1JJ2S 5GAOq 1HXDA 3CC2T 1WXTA 3KBGA 4M75D 5I11A 2YRDA 5GAMg 4OB1B 3I5RA 2DL8A 4F04B 1UJ0A 2CH4A 2EGEA 4XAXB 2OJ2A 1YWPA 1SEMA 2K6DA 1ZUYA 5GANh 3QO3A 5LJ5f 1UHFA 4DBFA 1VUBA 4C92C 2GQVA 5KYUB 2LQ8A 1MNDA 3EGDA 2CP0A 2P84A 3EH2A 4KGZB 3T9NA 4IURA 2YHTA 1AHJB 1D1AA 1WHHA 3CCUT 2R58A 2R57A 1BI2A 2DTIA 1KQSS 2QQAA 2DXUA 1B34A 4M75E 3UT1A 3CMAA 1Z9QA 2ZZDA 2HQEA 1OYXA 3LLRA 1PD1A 4ZN3A 3INZA 1VQOQ 1SF9A 4J9EA 3JCMb 3IQLA 4RCBA 2FB7A 1QQJA 5GAMd 2JS0A 3WVEB 3QWXX 3OYFA 3CPWS 1ZUKA 2CKKA 5CR2A 3I55T 4M75G 2RM4A 5A2QE 1T3LA 1U3OA 1RI9A 2FEIA 1BKBA 1ZUUA 3OYHA 1WQWA 3EFRA 1ZSGA 3SDZA 5D6XA 1N27A 1YIJA 5GAMj 4KGXB 4AFQC 1OV3A 1XOVA 1Y71A 3X24B 2DL7A 1Y96A 4N4GA 1W2BP 2COYA 1K73C 1ZSZB 3G4ST 2RN8A 2QG9B 4LUDA 5L8RE 1K0XA 2LCSA 3REAB 1NE8A 4OGEA 2XG8D 1V29B 4M7AG 2SEMA 4FIBA 3I35A 3QKJA 4E7ZA 3L2QA 2YXYA 2E64A 1YCYA 1YI2Q 2HL3A 1QWEA 4B9WA 2M02A 3JRZA 3LW5E 3PMIA 4ZN1A 3CC2Q 2CSQA 2OTLT 1B7TA 2FRWA 4ZNXA 2JNGA 4MDWA 1GCQC 2VWFA 3E9GA 2RPNA 2YUPA 2KROA 4RCCA 4BI8B 1S72T 5CK9A 2I0NA 2EQUA 1PKTA 4C0GA 2MIOA 4KRTA 5CAIA 3EG9A 1M1KC 2KR3A 2DZCA 2LJ0A 4GBQA 1NLPC 4QW2A 2DJQA 3A1PA 1M9SA 2IVWA 4J6XA 4CI0C 2CT3A 2ZAEA 4DEXA 2LQKA 2HAXA 1UGPB 2VGNA 2ROLA 2V26A 4IUUA 1QVGA 1BBZA 3CCUQ 3MPUB 1VYVA 1LJOA 2NUTB 3EHQA 3HL8A 3OY9A 1Q86C 1Q7YU 4N0AC 1WHLA 3A8HB 4D6WA 4HT9A 3JCMW 2K5FA 3UA7A 1RADB 1ZSZC 2HQHA 1PRLC 2KRNA 4J9HA 3WXMB 2QQBA 1ABOA 3QXEB 4CC4B 5FW9A 2A3LA 5GAMe 2JZ2A 1M3AA 3M0TA 2J6FA 1D0YA 3JCMP 3RMSA 4FYVB 1O9SA 3QUIA 4EMHA 3I55Q 1N9RA 2C0OA 3OYLA 3QHSA 4HXJA 1ZBJA 2O31A 2DX1A 1PNJA 2BUDA 2BKDN 4Z02A 4LDVA 4EMGA 2ECZA 1IREB 4M7AA 1M90U 3JCMg 1CKAA 2KI7A 2B8AA 3O5ZA 4KGVB 3RUXA 3OYCA 2RO0A 2YLBA 1VQ9T 1K73R 1EFNA 1U5SA 2KE9A 2ED0A 2GQIA 3CC7T 1LVKA 3VS2A 3G4SQ 1K9MU 2JW4A 2QYZA 1RAHB 3TQ7P 2O9SA 4RTZA 1TSFA 1Y07A 1B07A 4J9FA 4C0FA 1VQ6A 2CP3A 1I0CA 2DXBA 5LJ3g 3M0QA 3MHXA 1W70A 3S6WA 1YFNA 1JU5C 2K2MA 4R56A 1IRXA 3J81E 1Q95G 2X51A 1QVFS 4BUGA 4DEYA 1WI7A 2EKOA 4PLIA 1HJDA 2DD5A 2OTLQ 3H8ZA 1FYNA 5HCKA 3H0FA 2KT1A 4DBQA 4F17A 4C0DC 1S72Q 4HVVA 3EFSA 1PG5B 3C95A 3CC4A 3CMET 3CXCS 3OA6A 4EPCA 4PKCC 1VA7A 4PJOA 3JB9H 2X4YA 1UG1A 3OYBA 1M1KR 2J6KA 1PSEA 1VOMA 3P8HA 1U06A 5GAN5 3G1JA 2K3YA 3JCMJ 1NJIC 2XICA 3EGXA 2JJ9A 1IGQA 1KD1C 4QT7A 5CKFA 4FCYA 1NPRA 1ZHIA 1M8VA 3QSUA 1VQ8T 3THKA 5KYXB 3GPLA 1IB8A 3CBMA 3SEMA 2O4XA 2DYBA 5GAN2 1AZEA 1ACMB 3M58A 2QA4T 3HRSA 4AFZC 1Q86R 1OZ2A 4XU3A 3CCRA 2KRMA 4LDYA 2ZGWA 3NMZC 4OB0B 2D6FA 4Z89A 3CCJA 2NUZA 3UDCA 4IUVA 1U8RA 4FT2A 2HSPA 2C0IA 4GY5A 2EAYA 3I5SA 4J6WA 1UUEA 3EGUA 2OTJA 2YUOA 5AYFA 5LJ3j 1QCOA 4ME7A 1KHCA 2RJDA 1N8RC 4RTVA 2RHIA 3I56T 1CKBA 2LJ3A 4C92G 3OYJA 4EMKB 3RMQA 3TCJA 3JCMf 5KYYA 1YCSB 3QG1A 3MO8A 1QLYA 1T0JA 2DILA 4M77C 2HCKA 3JV3A 2PVDB 2AIRB 2O88A 2NYSA 1VIEA 4PJOC 1AWJA 3L2UA 1VQNA 2LT4A 4PL6A 4L6V5 4ELYC 1G83A 1VQ9Q 5LJ3f 2HQXA 1VQMA 1RLQC 3CC7Q 3NTHA 1PWTA 2FPFA 1GCPA 4CC3A 3LH0A 4LD6A 1KFZA 3VV0A 1NYFA 3FRNA 1AVZC 1OZ3A 2RI2A 1QP2A 3CCQT 4RTYA 2EQJA 1PKSA 3CCSA 1FMVA 1VQ5T 3M0PA 2PNIA 1JB0E 1LOJA 4JZ3A 3CCVT 1BIBA 1Q82U 2DF6A 1VYUA 1KJWA 2E6NA 4FW1A 5LJ5g 4Z88A 4MZPA 3ZEHA 1RAIB 2E3HA 1UE9A 5KH6A 4O6JA 4Y92A 2LRQA 4MMKA 3MEVA 1RLPC 2XU8A 4C8QB 3TSWA 4XK8E 4AT1B 2HSEB 1TOVA 3JCMe 3OSVA 4KULA 1IZ6A 1MMDA 2VYTA 5J26A 1M1GA 4F7UG 2V8KA 1ZA2B 2Y90A 1UGQB 3EFOA 3C94A 1XTDA 2CP5A 5I21A 1NEGA 1NJIR 2XD0A 1K8AU 1KD1R 1TU0B 1LCKA 4F16A 3PTAA 3G71T 1VQ8Q 1GL5A 4OB2B 2XI9A 1SRMA 4M78C 3VRZA 2A7YA 5LJ3e 1WJRA 2QDYB 5GJWB 3L42A 2FZGB 4A4FA 4C92A 3CBOA 1PM3A 2QEXQ 3OBYA 1VQKA 5LJ5d 1H92A 4KH0B 3CCMA 1HYOA 1WPYA 3GOXA 2F2WA 1M8MA 3M54A 1WYXA 4R0KA 4KBMB 1VQ7T 5J3BA 1I1JA 4M4ZA 1N8RR 4FSSA 2ZCFB 3I56Q 4RTXA 4AFSC 2DJZA 1O75A 1EZZB 2KEAA 2LT1A 2LQNA 1SHFA 4BE2A 2WSFE 4DQ2A 1D3BB 1I5OB 3SWNB 4BY6B 2DXTA 4M7AF 5LJ5j 3ZBDA 2BZXA 1VQ4T 4OMLA 2DERA 2HBPA 3LWIA 2LX9A 2VXFA 4C8QC 3TEEA 2XK0A 4HCZA 1S1NA 2VUBA 2X3WD 1M27C 3PNWC 3RERA
chains in the Genus database with same CATH topology
2D1XA 2JM8A 2VKNA 4E6RA 2C0TA 2LMJA 2LQWA 4OMOA 2JTEA 4OMQA 1WIEA 2W10A 2EYWA 1QWEA 3PE0A 1B3QA 2KXCA 1MUZA 4HVUA 5IHNA 2CSQA 2K9GA 2FRWA 4ZNXA 1GCQC 2VWFA 2CSIA 3FJ5A 1KIKA 2RPNA 1QKXA 2YUPA 2ED1A 2KROA 2ENMA 3VS4A 3H0HA 2I0NA 4OMPA 2OI3A 1H3HA 2F2XA 2MCNA 1WLPB 3NGPA 3I9QA 1PKTA 2EGAA 2GNCA 2MIOA 4KRTA 2CDTA 2KR3A 4AG1C 2LJ0A 1GBQA 4GBQA 1K9AA 1M30A 1NLPC 4JJDA 3NHNA 2CREA 2DJQA 2LZ6B 1KSWA 2DRKA 2FO0A 2CT3A 2YUNA 4DEXA 1AOJA 2IIMA 2ROLA 2CUDA 2KXDA 1K1ZA 1GBRA 4LNPA 5GJVB 4D8DA 1BBZA 2JT4A 1TUCA 4ORZA 1SRLA 2CUBA 5IXFA 1J3TA 1BU1A 1VYVA 3EHQA 1E7OA 4HCKA 2F2VA 1E6HA 4J9CA 1WDXA 1T0HA 2HEQA 1GCQA 3REBB 3VS6A 4IIMA 3UA7A 1E6GA 2PZ1A 1OPLA 3CQTA 4JJCA 4LUEA 4AFUC 2SRCA 2EYXA 2J06A 4ESRA 4OMMA 2H8HA 4OMNA 1PRLC 2KRNA 2AZSA 4J9HA 1I07A 1ABOA 4CC4B 5FW9A 4J9DA 1M3AA 3M0TA 2J6FA 2YDLA 2ROTA 3M0SA 3ZL7C 1H8KA 2DLPA 2X3XD 1WXBA 2DRMA 2C0OA 2LP5A 3VS0A 4J9BA 1OEBA 4HXJA 1ZBJA 1UFFA 2O31A 2XMFA 1QCFA 2DX1A 1PNJA 2RQWA 2B86A 1UECA 2ECZA 2RQVA 1Z9ZA 1WX6A 1CKAA 3PVQA 1G2BA 2V1QA 5I22A 2RMOA 2DBMA 3O5ZA 1GRIA 3SHWA 1OOTA 2A37A 1T3SA 1EFNA 1U5SA 2KE9A 2ED0A 2GQIA 2L0AA 2A08A 4X1VA 2L3SA 3VS2A 2JW4A 2YSQA 1X43A 2O9SA 4RTZA 2FPDA 2J7IA 4HVWA 3UF4A 2JMAA 2YT6A 4Z8AA 2DNUA 1B07A 4J9FA 1I0CA 1JO8A 3M0QA 2JXBA 1MV3A 1X2QA 1W70A 1YNZA 2EYYA 3EG2A 1JEGA 1JU5C 2GTOA 3EG3A 2K2MA 2LNHB 2RQRA 2CT4A 2AKLA 2RQUA 2KT8A 1K76A 4DEYA 3M0UA 1WI7A 2KYMA 3EG0A 4JJBA 4CC2A 3TVTA 1HJDA 2BTTA 1FYNA 5HCKA 3H0FA 2FG0A 2KT1A 4F17A 2VVKA 1RUWA 2D8HA 4HVVA 4RTWA 1VYTA 1AWOA 2AK5A 2EW3A 1VA7A 1SHGA 3M0RA 1UG1A 2A36A 2KNBB 1ZLMA 2J6KA 2J05A 2JMCA 4IIOA 1U06A 2D0NA 4AG2C 1NEBA 5IHKA 1PRMC 2LX7A 2M51A 2PTKA 2GTJA 2RF0A 4QT7A 2G6FX 2GGRA 1NM7A 5IXBA 1CSKA 1WA7A 1X27A 1YWOA 2EKHA 3A98A 3THKA 2A28A 3SEMA 4D8KA 1GFDA 2DYBA 1AZEA 3PVLA 5L23A 4RTUA 4AFZC 2JS2A 1K0SA 4WCIA 4JPBW 2KRMA 2J6OA 4J9GA 2EGCA 1SSHA 3NMZC 2RNAA 4Z89A 2NUZA 2HSPA 2C0IA 2L3PA 1W1FA 2DBKA 3I5SA 2O2OA 4EIKA 2EVRA 3U23A 1UUEA 2DL4A 1ZX6A 3C0CA 1UDLA 2BZYA 3EGUA 5IH2A 2YUOA 4JZ4A 1HD3A 2K79A 4RTVA 2L3QA 1X6BA 1HSQA 3H0IA 3VS3A 1CKBA 2ABLA 2LJ3A 1PHTA 2DL5A 2DM1A 2O9VA 1AWXA 2K7AA 3LH5A 3UATA 1GFCA 2HBWA 2DMOA 1YCSB 3RNJA 1ARKA 3VS1A 1QLYA 3UA6A 1T0JA 1M3CA 2DILA 4F14A 1BB9A 2HCKA 3JV3A 2FPEA 1NG2A 1X6GA 2NWMA 1UTIA 2HDAA 5IHIA 2O88A 1AWJA 2FRYA 2JM9A 2D8JA 2LJ1A 3RBBB 2CH4W 1NLOC 2P4RA 2DVJA 1G83A 1BK2A 2KYBA 3GBQA 1RLQC 3EHRA 1PWTA 4RUGA 2DL3A 2FPFA 2KRSA 3NPFA 1GCPA 4CC3A 1KFZA 1NYFA 5EC7A 1AVZC 2AZVA 2W0ZA 4RTYA 1WXTA 1PKSA 5I11A 3I5RA 1X2KA 1WXUA 2DL8A 3M0PA 2PNIA 4JZ3A 1UJ0A 4LE9A 2CH4A 2EGEA 2OJ2A 1OPKA 2DF6A 1AZGB 1YWPA 1VYUA 1KJWA 1SEMA 2K6DA 1ZUYA 1FMKA 2KGTA 5FWBA 4Z88A 1Y0MA 1UHFA 1UE9A 4LN2A 4Y92A 2EQIA 5ECAA 1RLPC 4CC7A 3TSWA 1NYGA 1AWWA 1QKWA 1JQQA 3QWYA 3R6NA 2EPDA 1A0NB 2E5KA 4RTTA 1UJYA 1AEYA 1UGVA 1QWFA 3VRYA 1NEGA 1ABQA 1UHCA 3ULRB 1Z9QA 4GLMA 2GBQA 3VS5A 2EBPA 2DE0X 1IO6A 1N5ZA 1X69A 1LCKA 2AKKA 4F16A 4K11A 2QDLA 2OAWA 5FWCA 1GL5A 4J9EA 1V1CA 3IQLA 1SRMA 2M0YA 3VRZA 3H41A 1AD5A 5GJWB 2KBTA 1JXOA 2JS0A 2RQTA 1YN8A 2MOXA 3QWXX 1ZUKA 2BZ8A 1TUDA 1SPKA 2V1RA 1H92A 1T3LA 1U3OA 1RI9A 2FEIA 1MV0B 1Y57A 1YP5A 1TG0A 2F2WA 1ZUUA 1M8MA 4A63B 1WYXA 4R0KA 1ZSGA 3KFVA 2EYZA 2YUQA 1I1JA 4M4ZA 4AFQC 4FSSA 1OV3A 4RTXA 1XOVA 4AFSC 2DA9A 3VS7A 1K4US 2KEAA 2LQNA 1SHFA 3TSZA 2DL7A 3EG1A 2BZXA 4OMLA 4J9IA 2RN8A 2L2PA 1JXMA 2ESWA 4LUDA 1K0XA 1WFWA 1M3BA 2LCSA 3REAB 1S1NA 2X3WD 1M27C 2SEMA 3I35A 2K3BA 1W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1X A;  2JM8 A;  2VKN A;  4E6R A;  2C0T A;  2LMJ A;  2LQW A;  4OMO A;  2JTE A;  4OMQ A;  1WIE A;  2W10 A;  2EYW A;  1QWE A;  3PE0 A;  1B3Q A;  2KXC A;  1MUZ A;  4HVU A;  5IHN A;  2CSQ A;  2K9G A;  2FRW A;  4ZNX A;  1GCQ C;  2VWF A;  2CSI A;  3FJ5 A;  1KIK A;  2RPN A;  1QKX A;  2YUP A;  2ED1 A;  2KRO A;  2ENM A;  3VS4 A;  3H0H A;  2I0N A;  4OMP A;  2OI3 A;  1H3H A;  2F2X A;  2MCN A;  1WLP B;  3NGP A;  3I9Q A;  1PKT A;  2EGA A;  2GNC A;  2MIO A;  4KRT A;  2CDT A;  2KR3 A;  4AG1 C;  2LJ0 A;  1GBQ A;  4GBQ A;  1K9A A;  1M30 A;  1NLP C;  4JJD A;  3NHN A;  2CRE A;  2DJQ A;  2LZ6 B;  1KSW A;  2DRK A;  2FO0 A;  2CT3 A;  2YUN A;  4DEX A;  1AOJ A;  2IIM A;  2ROL A;  2CUD A;  2KXD A;  1K1Z A;  1GBR A;  4LNP A;  5GJV B;  4D8D A;  1BBZ A;  2JT4 A;  1TUC A;  4ORZ A;  1SRL A;  2CUB A;  5IXF A;  1J3T A;  1BU1 A;  1VYV A;  3EHQ A;  1E7O A;  4HCK A;  2F2V A;  1E6H A;  4J9C A;  1WDX A;  1T0H A;  2HEQ A;  1GCQ A;  3REB B;  3VS6 A;  4IIM A;  3UA7 A;  1E6G A;  2PZ1 A;  1OPL A;  3CQT A;  4JJC A;  4LUE A;  4AFU C;  2SRC A;  2EYX A;  2J06 A;  4ESR A;  4OMM A;  2H8H A;  4OMN A;  1PRL C;  2KRN A;  2AZS A;  4J9H A;  1I07 A;  1ABO A;  4CC4 B;  5FW9 A;  4J9D A;  1M3A A;  3M0T A;  2J6F A;  2YDL A;  2ROT A;  3M0S A;  3ZL7 C;  1H8K A;  2DLP A;  2X3X D;  1WXB A;  2DRM A;  2C0O A;  2LP5 A;  3VS0 A;  4J9B A;  1OEB A;  4HXJ A;  1ZBJ A;  1UFF A;  2O31 A;  2XMF A;  1QCF A;  2DX1 A;  1PNJ A;  2RQW A;  2B86 A;  1UEC A;  2ECZ A;  2RQV A;  1Z9Z A;  1WX6 A;  1CKA A;  3PVQ A;  1G2B A;  2V1Q A;  5I22 A;  2RMO A;  2DBM A;  3O5Z A;  1GRI A;  3SHW A;  1OOT A;  2A37 A;  1T3S A;  1EFN A;  1U5S A;  2KE9 A;  2ED0 A;  2GQI A;  2L0A A;  2A08 A;  4X1V A;  2L3S A;  3VS2 A;  2JW4 A;  2YSQ A;  1X43 A;  2O9S A;  4RTZ A;  2FPD A;  2J7I A;  4HVW A;  3UF4 A;  2JMA A;  2YT6 A;  4Z8A A;  2DNU A;  1B07 A;  4J9F A;  1I0C A;  1JO8 A;  3M0Q A;  2JXB A;  1MV3 A;  1X2Q A;  1W70 A;  1YNZ A;  2EYY A;  3EG2 A;  1JEG A;  1JU5 C;  2GTO A;  3EG3 A;  2K2M A;  2LNH B;  2RQR A;  2CT4 A;  2AKL A;  2RQU A;  2KT8 A;  1K76 A;  4DEY A;  3M0U A;  1WI7 A;  2KYM A;  3EG0 A;  4JJB A;  4CC2 A;  3TVT A;  1HJD A;  2BTT A;  1FYN A;  5HCK A;  3H0F A;  2FG0 A;  2KT1 A;  4F17 A;  2VVK A;  1RUW A;  2D8H A;  4HVV A;  4RTW A;  1VYT A;  1AWO A;  2AK5 A;  2EW3 A;  1VA7 A;  1SHG A;  3M0R A;  1UG1 A;  2A36 A;  2KNB B;  1ZLM A;  2J6K A;  2J05 A;  2JMC A;  4IIO A;  1U06 A;  2D0N A;  4AG2 C;  1NEB A;  5IHK A;  1PRM C;  2LX7 A;  2M51 A;  2PTK A;  2GTJ A;  2RF0 A;  4QT7 A;  2G6F X;  2GGR A;  1NM7 A;  5IXB A;  1CSK A;  1WA7 A;  1X27 A;  1YWO A;  2EKH A;  3A98 A;  3THK A;  2A28 A;  3SEM A;  4D8K A;  1GFD A;  2DYB A;  1AZE A;  3PVL A;  5L23 A;  4RTU A;  4AFZ C;  2JS2 A;  1K0S A;  4WCI A;  4JPB W;  2KRM A;  2J6O A;  4J9G A;  2EGC A;  1SSH A;  3NMZ C;  2RNA A;  4Z89 A;  2NUZ A;  2HSP A;  2C0I A;  2L3P A;  1W1F A;  2DBK A;  3I5S A;  2O2O A;  4EIK A;  2EVR A;  3U23 A;  1UUE A;  2DL4 A;  1ZX6 A;  3C0C A;  1UDL A;  2BZY A;  3EGU A;  5IH2 A;  2YUO A;  4JZ4 A;  1HD3 A;  2K79 A;  4RTV A;  2L3Q A;  1X6B A;  1HSQ A;  3H0I A;  3VS3 A;  1CKB A;  2ABL A;  2LJ3 A;  1PHT A;  2DL5 A;  2DM1 A;  2O9V A;  1AWX A;  2K7A A;  3LH5 A;  3UAT A;  1GFC A;  2HBW A;  2DMO A;  1YCS B;  3RNJ A;  1ARK A;  3VS1 A;  1QLY A;  3UA6 A;  1T0J A;  1M3C A;  2DIL A;  4F14 A;  1BB9 A;  2HCK A;  3JV3 A;  2FPE A;  1NG2 A;  1X6G A;  2NWM A;  1UTI A;  2HDA A;  5IHI A;  2O88 A;  1AWJ A;  2FRY A;  2JM9 A;  2D8J A;  2LJ1 A;  3RBB B;  2CH4 W;  1NLO C;  2P4R A;  2DVJ A;  1G83 A;  1BK2 A;  2KYB A;  3GBQ A;  1RLQ C;  3EHR A;  1PWT A;  4RUG A;  2DL3 A;  2FPF A;  2KRS A;  3NPF A;  1GCP A;  4CC3 A;  1KFZ A;  1NYF A;  5EC7 A;  1AVZ C;  2AZV A;  2W0Z A;  4RTY A;  1WXT A;  1PKS A;  5I11 A;  3I5R A;  1X2K A;  1WXU A;  2DL8 A;  3M0P A;  2PNI A;  4JZ3 A;  1UJ0 A;  4LE9 A;  2CH4 A;  2EGE A;  2OJ2 A;  1OPK A;  2DF6 A;  1AZG B;  1YWP A;  1VYU A;  1KJW A;  1SEM A;  2K6D A;  1ZUY A;  1FMK A;  2KGT A;  5FWB A;  4Z88 A;  1Y0M A;  1UHF A;  1UE9 A;  4LN2 A;  4Y92 A;  2EQI A;  5ECA A;  1RLP C;  4CC7 A;  3TSW A;  1NYG A;  1AWW A;  1QKW A;  1JQQ A;  3QWY A;  3R6N A;  2EPD A;  1A0N B;  2E5K A;  4RTT A;  1UJY A;  1AEY A;  1UGV A;  1QWF A;  3VRY A;  1NEG A;  1ABQ A;  1UHC A;  3ULR B;  1Z9Q A;  4GLM A;  2GBQ A;  3VS5 A;  2EBP A;  2DE0 X;  1IO6 A;  1N5Z A;  1X69 A;  1LCK A;  2AKK A;  4F16 A;  4K11 A;  2QDL A;  2OAW A;  5FWC A;  1GL5 A;  4J9E A;  1V1C A;  3IQL A;  1SRM A;  2M0Y A;  3VRZ A;  3H41 A;  1AD5 A;  5GJW B;  2KBT A;  1JXO A;  2JS0 A;  2RQT A;  1YN8 A;  2MOX A;  3QWX X;  1ZUK A;  2BZ8 A;  1TUD A;  1SPK A;  2V1R A;  1H92 A;  1T3L A;  1U3O A;  1RI9 A;  2FEI A;  1MV0 B;  1Y57 A;  1YP5 A;  1TG0 A;  2F2W A;  1ZUU A;  1M8M A;  4A63 B;  1WYX A;  4R0K A;  1ZSG A;  3KFV A;  2EYZ A;  2YUQ A;  1I1J A;  4M4Z A;  4AFQ C;  4FSS A;  1OV3 A;  4RTX A;  1XOV A;  4AFS C;  2DA9 A;  3VS7 A;  1K4U S;  2KEA A;  2LQN A;  1SHF A;  3TSZ A;  2DL7 A;  3EG1 A;  2BZX A;  4OML A;  4J9I A;  2RN8 A;  2L2P A;  1JXM A;  2ESW A;  4LUD A;  1K0X A;  1WFW A;  1M3B A;  2LCS A;  3REA B;  1S1N A;  2X3W D;  1M27 C;  2SEM A;  3I35 A;  2K3B A;  1W6X A; 
#chains in the Genus database with same CATH topology
 5KYW B;  2C0T A;  2LMJ A;  4OMO A;  3A8L B;  4TVR A;  2EYW A;  4M7D C;  3PE0 A;  4HCB A;  1MUZ A;  1JJ2 A;  3CCQ Q;  2FZK B;  2XID A;  3VUZ A;  8ATC B;  2PQW A;  3CCV Q;  2PUK B;  1KIK A;  2DK3 A;  2ENM A;  2GFU A;  3VS4 A;  1YI2 A;  2E41 A;  2E70 A;  2NUP B;  4JRP A;  4OMP A;  2OI3 A;  1H3H A;  2F2X A;  3RR6 A;  2RI3 A;  1I5L A;  4F7U A;  2MWP A;  2JUF A;  4Q5W A;  5IT9 E;  4J6Y A;  1VQL T;  4NS5 A;  4JJD A;  3ASK A;  2A0F B;  4M7A D;  2CZ0 B;  2KMT A;  2COW A;  4JLI A;  1KSW A;  2DRK A;  2FO0 A;  1TH7 A;  1AOJ A;  1K1Z A;  4B9X A;  1WGS A;  1WNL A;  2X4J A;  2JT4 A;  1TUC A;  2CUB A;  2LC4 A;  2KDS A;  2NLU A;  5IXF A;  5DY9 A;  1KQS A;  1E7O A;  4J9C A;  3V8L A;  1WDX A;  1GCQ A;  1B34 B;  3VS6 A;  4LUE A;  2PZ1 A;  4ZGE B;  4JJC A;  2G3R A;  3H6Z A;  2EYX A;  1G3S A;  1R8O B;  1MMA A;  4E2F B;  3FC3 A;  3M4Y A;  3X25 B;  4QKU A;  1YIJ T;  4IUP A;  2OAU A;  3CPW A;  1YIT A;  3S3M A;  3M0S A;  4XU0 A;  3ZL7 C;  3CCE A;  4M7A E;  1WXB A;  2DRM A;  2LP5 A;  1IHW A;  4FL6 A;  5LJ5 e;  1UFF A;  3OS1 A;  1QCF A;  1YJN A;  4ZGD B;  2ZPG B;  4II1 A;  2QQ9 A;  1UEC A;  4FSX A;  4PJO D;  1VQ7 Q;  3V7R A;  1VIF A;  3MET A;  4Y91 A;  2ZPH B;  1D1B A;  4N0A A;  2RMO A;  3I55 A;  1FMW A;  2JOY A;  1NBE B;  2VV5 A;  5GMK h;  2BE9 B;  1GRI A;  1ZSZ A;  4XU2 A;  3SHW A;  1Q7Y C;  5M9O A;  1P92 A;  1VQ4 Q;  3RES A;  2L0A A;  1W2B S;  2FZC B;  2RH2 A;  3Q1J A;  3KXT A;  2FPD A;  1D09 B;  1KK7 A;  4BD3 A;  2QK0 A;  2D9T A;  3QDF A;  2CZ6 B;  2JXB A;  1JEG A;  2F5T X;  3HHT B;  3D7S B;  2RQR A;  2QAS A;  3OYN A;  2RQU A;  2MF2 A;  4JRI A;  4C0Z A;  4BDZ A;  3EG0 A;  4JJB A;  2E6Z A;  4RMO A;  2BIV A;  4RKU E;  2CP7 A;  5GAO n;  4CC2 A;  1D0X A;  4MML A;  2VVK A;  4J7I A;  1RUW A;  1M90 C;  1UGS B;  1NZ9 A;  5FRN A;  2KY9 A;  1M2V A;  4RTW A;  3LGF A;  1VYT A;  3OYK A;  5GAO m;  3LGL A;  2AK5 A;  4LDW A;  2EW3 A;  3MP1 A;  2RJE A;  4QVC A;  2A36 A;  2KNB B;  2LCC A;  1QVG P;  1ZLM A;  4PJJ A;  2J05 A;  2OTL A;  3EG9 B;  1VQL Q;  4M77 G;  4IIO A;  5GAM h;  5FLX E;  2COZ A;  1K9M C;  1NEB A;  1OX8 A;  5DLQ E;  3O8V A;  4PJO G;  4E7I A;  1AT1 B;  3OYD A;  1KQ2 A;  4PFZ A;  1BCM A;  1NM7 A;  1EX4 A;  1W4S A;  3PFS A;  4AMC A;  1YWO A;  3MKD A;  4JDS A;  1EIF A;  4X9D A;  5L23 A;  2X35 A;  3G7Z A;  4JUV A;  1K0S A;  2J6O A;  4DBH A;  2EGC A;  1SSH A;  3QII A;  2VB6 A;  3NTI A;  4M75 B;  3RKW A;  2O2O A;  8AT1 B;  2DL4 A;  1ZX6 A;  4C92 F;  1UDL A;  2RJC A;  2VAS A;  1YIJ Q;  3SB2 A;  2XDB A;  3VJP A;  3OS2 A;  1Q81 U;  1RI0 A;  2L3Q A;  3H0I A;  1PD0 A;  2DAQ A;  2XDD A;  2E3I A;  2IG0 A;  2DM1 A;  5D6W A;  3LH5 A;  4XTZ A;  2L89 A;  3UAT A;  1OQK A;  2HBW A;  2DMO A;  2Y4X A;  3UA6 A;  1M3C A;  1KC8 C;  3OYA A;  4IUT A;  4F14 A;  4JRQ A;  1YHQ T;  4LD9 K;  1VQ6 T;  4M7A B;  2M0O A;  1YJ9 A;  2YRV A;  4X34 A;  2EYQ A;  3M55 A;  2D8J A;  3PIP A;  1Q7Y R;  2MPX C;  1BK2 A;  2KYB A;  5FRO A;  3OQ5 A;  1FX7 A;  2DIQ A;  3EHR A;  1G5V A;  4RUG A;  4M78 G;  3NPF A;  5GAO r;  5EC7 A;  1G3T A;  4FYY B;  3V7S A;  4R55 A;  2W0Z A;  1MNE A;  1OX9 A;  4OMF B;  3MP8 A;  4C92 D;  2PU9 B;  4L59 A;  3CC7 A;  4LE9 A;  3CC4 T;  1QVF A;  1OPK A;  1AZG B;  4B6M A;  2DD4 A;  2KGT A;  4NOY A;  4M77 A;  5FU6 B;  4PJN A;  4RG2 A;  4M75 C;  3JCM d;  1Y0M A;  3TRE A;  2L8D A;  3X20 B;  3PIO A;  5ECA A;  2FVU A;  2M1H A;  3FEO A;  1M90 R;  1IXD A;  4F7U F;  4RG8 A;  4WTO B;  3HSB A;  1AWW A;  3QWY A;  1BI3 A;  2P0P A;  3CXC A;  2YRC A;  2EPD A;  2FYK A;  5HK0 A;  3J7A F;  1A0N B;  3H9N A;  2DPP B;  4RTT A;  4DOV A;  5CQX A;  3DB4 A;  5HK3 A;  1KC8 U;  3FIF A;  1UJY A;  5D7U A;  1AEY A;  2HNI A;  3OS0 A;  4QVD A;  1N6A A;  3CCR T;  3QYG B;  1K9M R;  2DZ9 A;  2E10 A;  1QWF A;  4DA4 A;  1F1B B;  5LJ3 d;  1RL2 A;  3CCJ T;  5KYX A;  3LWH A;  1UHC A;  2ZPB B;  4GLM A;  2GBQ A;  3VS5 A;  1YJW A;  2DE0 X;  4C92 E;  1X69 A;  4K11 A;  2QDL A;  2OAW A;  5FWC A;  4E47 A;  3ER0 A;  1Q82 C;  2M0Y A;  2OTJ T;  2O4X B;  5A0L A;  4M7D G;  1AD5 A;  2RB6 A;  2MK5 A;  4O5V A;  2LTO A;  3OYM A;  1JXO A;  2JTF A;  1YN8 A;  3CD6 A;  2DET A;  3JCM Q;  2M9U A;  3QBY A;  4UC4 A;  1VQP A;  2DEQ A;  2V1R A;  5KCO A;  5FU7 B;  3CEY A;  1RAG B;  4J7F A;  3BE3 A;  3RIR A;  1MV0 B;  1Y57 A;  1YP5 A;  1TG0 A;  3KFV A;  4OVA A;  3G6E A;  4JS4 A;  2QEX A;  2KVQ G;  3JB9 F;  1VQN T;  3VUB A;  4A53 A;  5KCH A;  3TSZ A;  2QTX A;  1VQM T;  2DYI A;  3EG1 A;  1K8A C;  5GAN 7;  2ZPE B;  3UWN A;  3A8G B;  4HA8 A;  4M78 A;  1OUL A;  1KC8 R;  1D1C A;  1YHQ Q;  2L2P A;  2ZPF B;  3VU3 C;  1UGR B;  1JXM A;  2ESW A;  3GP8 A;  1M2O A;  3NFC A;  1M3B A;  5GAN g;  5I2M A;  1DJ7 B;  4PJM A;  3NTK A;  2RQW A;  1W6X A;  4CC7 A;  1BI1 A;  2D1X A;  2JM8 A;  2VKN A;  2WSC E;  3GIB A;  4OMQ A;  3JCM h;  3BW1 A;  3E19 A;  3OB9 A;  3MEU A;  1B3Q A;  2KXC A;  5IHN A;  4F7U E;  5KE2 A;  1ZBX A;  1LPL A;  3FJ5 A;  2ED1 A;  5IN1 A;  3CC4 Q;  1BIA A;  3EH1 A;  1FXX A;  2HKN A;  1SSF A;  2MCN A;  1WLP B;  3NGP A;  3I9Q A;  2R5M A;  2GNC A;  2RK1 A;  3JB9 D;  2CDT A;  5LJ3 h;  4C8Q A;  3CME Q;  1M30 A;  3RDV A;  2LZ6 B;  4EMK C;  1M1F A;  4QQG A;  2PVO B;  2E4H A;  3CCL T;  2YUN A;  2CUD A;  2KSS A;  2KQW A;  2KXD A;  4BE1 A;  2RHU A;  1GBR A;  1M5Q 1;  4M7D A;  1RAC B;  4D8D A;  4A4E A;  1C6V X;  4ORZ A;  1BU1 A;  3OW2 A;  2F2V A;  3EFO B;  5A0G A;  4NL3 A;  1E6H A;  3VKI A;  3CCJ Q;  3JB9 I;  2HEQ A;  3REB B;  2QA4 Q;  1VQK T;  1E6G A;  3CQT A;  3DB3 A;  4AFU C;  3HFN A;  2LDM A;  3CCM T;  5LL6 S;  3MEW A;  4L5G A;  4OMM A;  5I2S A;  1VQO A;  1XQH A;  2H8H A;  4OMN A;  4A4G A;  4FU6 A;  1Q82 R;  3AT1 B;  2AZS A;  4QQ6 A;  2OTJ Q;  1I07 A;  5GAN j;  4J9D A;  1SKU B;  2E5Q A;  1IGU A;  2YDL A;  4C92 B;  1X01 A;  2X3X D;  3RKX A;  3MEA A;  4J9B A;  1OEB A;  3JCM c;  2XMF A;  1KQ1 A;  1XNI A;  4LDX A;  2GFA A;  1QP3 A;  2B86 A;  1ZQ1 A;  1BI0 A;  2RQV A;  2YLC A;  1Z9Z A;  4J8O A;  1OI1 A;  1WX6 A;  3JB9 G;  1D3B A;  3F70 A;  3SWN A;  1VQN Q;  4MDX A;  3OYE A;  2DTO A;  2A37 A;  1VQM Q;  3PGG A;  4ANJ A;  1T3S A;  5GAN f;  1K8A R;  5FRM A;  2H3E B;  2A08 A;  3V8J A;  1I8F A;  3M56 A;  1R77 A;  1H64 1;  4J83 A;  4HVW A;  5KYW A;  1JBM A;  2JMA A;  2YT6 A;  1JJ2 P;  3QZ5 B;  2DNU A;  4VUB A;  1JO8 A;  2DKG A;  1MV3 A;  1X2Q A;  2P4T A;  2HMA A;  1YI2 T;  4OB3 B;  2LNH B;  2KT8 A;  1VQ5 Q;  4BI3 A;  1K76 A;  4PLL A;  3M0U A;  1RAB B;  4XTY A;  3TVT A;  2YWW A;  2BTT A;  2HKQ B;  2NUP A;  1MMN A;  5KYU A;  2FG0 A;  4BAC A;  3CC2 A;  2F1L A;  3QDR B;  4PNO A;  5GAN 6;  4M77 F;  4HCC A;  2D8H A;  2LVM A;  1UEB A;  5DLO A;  3CMA T;  4DOW A;  4FYX B;  1AWO A;  1ZA1 B;  5GAN 3;  4PJO F;  4F7U B;  3EGD B;  2JMC A;  1I81 A;  5GMK j;  2ZPI B;  5CKE A;  3JAM E;  1KQS P;  3FDR A;  2D0Q B;  5IHK A;  1PRM C;  2LX7 A;  2PTK A;  1WJS A;  2EQK A;  1CSK A;  3CCL Q;  3SWN C;  4BY6 C;  5LJ5 h;  1WHJ A;  3A98 A;  1G3Y A;  1VQL A;  1C0M A;  2WSE E;  4XTU A;  5GAN e;  5DM7 R;  3JCM X;  3G71 Q;  3FB9 A;  3PVL A;  3CBP A;  1YIT T;  3HRT A;  4XU1 A;  3CPW P;  4WCI A;  4JPB W;  3CCU A;  3CCE T;  2VGM A;  4BB7 A;  1VQK Q;  3CCM Q;  1W1F A;  3R6O A;  1Y7X A;  2DBK A;  4A4H A;  1YJN T;  2EVR A;  3C0C A;  3JSC A;  5IH2 A;  5GMK m;  2K3X A;  2PVG B;  4M77 D;  1HD3 A;  9ATC B;  4PK4 A;  4JS5 A;  1X6B A;  3PT9 A;  1RAE B;  2ABL A;  2DL5 A;  1HK9 A;  4C5H A;  4IKF A;  2K7A A;  4EDU A;  4E7L A;  5GAN 4;  1ARK A;  2E12 A;  2JN0 A;  2FPE A;  1NG2 A;  1X6G A;  1Y96 B;  4OGC A;  2MMP A;  2NWM A;  3GF5 A;  4DBR A;  1UTI A;  2HDA A;  5IHI A;  4HT8 A;  1TUG B;  5CVI A;  2R5A A;  3QJ6 A;  4M78 F;  1X75 C;  1NLO C;  4X9C A;  2X4X A;  3GBQ A;  1W2B A;  2K57 A;  2EFI A;  3S3O A;  2L5Q A;  3QYH B;  4QQD A;  2DL3 A;  1KG1 A;  2KRS A;  4N4I A;  3G4S A;  3OYG A;  5J39 A;  5D6Y A;  2CS7 A;  4M77 E;  2AZV A;  5CO7 A;  1G8X A;  5KE3 A;  5IAY A;  4C5G A;  5GAM f;  1X2K A;  1WXU A;  2QGG A;  1Q81 C;  2E65 A;  4PJO E;  3V7C A;  1FMK A;  2AT1 B;  1TXQ A;  4BE0 A;  5FWB A;  5GMK e;  5CCA A;  3A5Z B;  4ZTJ A;  3OYY A;  2PUO B;  4LN2 A;  3KUF A;  2EQI A;  5C0M A;  3L2W A;  1NYG A;  1QKW A;  1JQQ A;  3R6N A;  3VYG A;  4C8Q F;  3TU4 K;  3CMA Q;  1S72 A;  1M2V B;  3JB9 J;  2RA2 A;  2E5K A;  1KHI A;  2GF7 A;  6AT1 B;  3L1A A;  2XDP A;  4M78 D;  1UGV A;  1LNX A;  1QVG S;  3J80 E;  2NUT A;  3VRY A;  3OYI A;  2P0K A;  5AT1 B;  3HKS A;  1ABQ A;  3ULR B;  1K73 U;  4YTL A;  4M7D F;  2EBP A;  1IO6 A;  1N5Z A;  2AKK A;  1WQ7 A;  4ZTF A;  3HFO A;  1V1C A;  4ZGJ B;  3H41 A;  5GAO p;  1YIT Q;  4M75 A;  1WHM A;  2KBT A;  2RQT A;  4QVZ A;  3CCE Q;  3DLM A;  2MOX A;  3FJP A;  4XTV A;  2BZ8 A;  3QPH A;  1TUD A;  3M53 A;  1SPK A;  2RHX A;  4C0D B;  3HPW A;  3URG A;  2MAM A;  1YJN Q;  2CP2 A;  3QJY A;  1QVP A;  2FHD A;  4V2S A;  3A8M B;  3PMT A;  4A63 B;  3WVD B;  2EYZ A;  1YJ9 T;  4M78 E;  2YUQ A;  4C8Q D;  2RI5 A;  2XHC A;  3SD4 A;  2DA9 A;  3VS7 A;  1GXI E;  1V76 A;  1K4U S;  4ELZ C;  2RD1 A;  3GNF B;  1M1K U;  4KUI A;  1TTH B;  5KYN A;  3HRU A;  2LCL A;  5CQY A;  4J9I A;  2CGH A;  4M7D D;  1WFW A;  1QW1 A;  3L2V A;  2HL5 C;  2K3B A;  3BFM A;  2M16 A;  3CPF A;  4E6R A;  4MZT A;  1WJQ A;  1QVF P;  2LQW A;  3LYI A;  4CRI A;  2JTE A;  1MGQ A;  3M57 A;  1YHQ A;  1WHG A;  1WIE A;  1VQ9 A;  2W10 A;  3AHU A;  3P8B B;  1RAA B;  1Q86 U;  1IHV A;  4HVU A;  3HTR A;  2QQR A;  3EAE A;  2K9G A;  4C8Q E;  3L2R A;  2C06 A;  1Q81 R;  3E1S A;  2CSI A;  1QKX A;  4LXC A;  3H0H A;  3CXC P;  4C5I A;  4FYW B;  1U1S A;  3A8O B;  1OU9 A;  1NPP A;  1WZO A;  2EGA A;  3BDL A;  4M77 B;  2EJG A;  4AG1 C;  1D0Z A;  1GBQ A;  1K9A A;  4JRK A;  1OU8 A;  2EIF A;  4M7D E;  3M59 A;  2V8J A;  3NHN A;  2CRE A;  2DXC A;  4PJO B;  2HZY A;  2CP6 A;  4OP0 A;  1YJW T;  3QZ9 B;  3RKY A;  4C8Q G;  4ATO A;  2IIM A;  3EGX B;  2X4W A;  3CME A;  1FWZ A;  4LNP A;  3V8K A;  4BDY A;  3BY7 A;  5GJV B;  3X26 B;  1H3Z A;  1SG5 A;  1J3T A;  1SRL A;  4HKE A;  3CD6 T;  4M7A C;  4HCK A;  3HP9 A;  2EWN A;  2AHJ B;  1T0H A;  2RHY A;  1G3W A;  1VQP T;  2MYS A;  4IIM A;  1BYM A;  1OPL A;  2SRC A;  2J06 A;  4ESR A;  3DLL A;  2P0Q A;  2KAF A;  2QI2 A;  1VQ8 A;  2WAC A;  2MWO A;  2HD0 A;  3G6E T;  2QEX T;  2QA4 A;  2ATC B;  2F5K A;  3M5A A;  2ROT A;  1H8K A;  1R0C B;  1JRI A;  1C1A A;  4EMK A;  2DLP A;  2K5I A;  3VS0 A;  2VXE A;  1U1T A;  2OX7 A;  5FU6 C;  5GMK l;  4XTW A;  5KYY B;  2DIG A;  1YJ9 Q;  2LNV A;  3UPU A;  3PVQ A;  1G2B A;  2V1Q A;  5I22 A;  1YBY A;  2DBM A;  2IPO B;  3I56 A;  1VQ6 Q;  3BDU A;  1OOT A;  3CCS T;  1PSF A;  4X1V A;  2L3S A;  4M78 B;  1QCN A;  2E1H A;  2QGF B;  3M4G A;  4BI4 A;  2QTV A;  4JLG A;  2YSQ A;  1X43 A;  1NJI U;  2J7I A;  3MJX A;  2CYZ B;  3UF4 A;  2DO3 A;  3C4S A;  4Z8A A;  4P5N A;  1KD1 U;  2CZ7 B;  2L3R A;  1YNZ A;  2EYY A;  5CKB A;  4XTX A;  4KUD K;  3EG2 A;  2GTO A;  2JVV A;  3EG3 A;  3C12 A;  4WF2 A;  2CT4 A;  4Y28 E;  2AKL A;  4JJN K;  2EQM A;  7AT1 B;  2QQS A;  5CKD A;  2KYM A;  4MZM A;  4NL2 A;  3OMC A;  2CZ1 B;  2BE7 D;  2F69 A;  2O01 E;  5A0D A;  2DTH A;  4FT4 A;  2JTM A;  2VC8 A;  4FW2 A;  3CCQ A;  1N9S A;  3ZFJ A;  5HKC A;  2I2L A;  1VQ5 A;  5FU7 C;  3CCV A;  1PCX A;  3GLX A;  3VYH B;  5HY6 A;  1SHG A;  3M0R A;  1N8R U;  5C6S A;  5GAO l;  1PC0 A;  4XQ3 A;  2K2V A;  1WHK A;  3DKM A;  2EJF A;  1QMC A;  2D0N A;  5GAN d;  3OW2 P;  4E7S A;  3M9Q A;  4AG2 C;  2M51 A;  1YJW Q;  2GTJ A;  3N5B B;  4J5Y A;  2RF0 A;  2MI6 A;  3CCR Q;  3OSS C;  4KH1 B;  2G6F X;  2GGR A;  5IXB A;  1BCO A;  2K4Y A;  2H3J A;  1VQO T;  1WA7 A;  1X27 A;  2EKH A;  2A28 A;  2RJF A;  4A54 A;  2XKO C;  4D8K A;  4IUQ A;  5EG2 A;  1GFD A;  4M7D B;  3OW2 S;  3LX7 A;  3CD6 Q;  4RTU A;  2JS2 A;  4FM4 B;  5GAN 8;  4J9G A;  3E2U A;  4OF1 A;  1TWB A;  1VQP Q;  3CCL A;  2RNA A;  1TS9 A;  3P8D A;  2L3P A;  3ME9 A;  4M75 F;  5CIU A;  3G71 A;  4EIK A;  2DVE A;  2DEU A;  3U23 A;  2EJ9 A;  2GCX A;  1M4Z A;  2BZY A;  2K5L A;  3S3N A;  4E7K A;  3SFM A;  1MMG A;  3G6E Q;  4JZ4 A;  1X6O A;  2K79 A;  2QAZ A;  1HSQ A;  2RHZ A;  4GLK A;  3VS3 A;  1PHT A;  2Z0W A;  1RAF B;  2O9V A;  1AWX A;  1UB4 A;  2V8I A;  2QXF A;  1GFC A;  4A4K A;  3RNJ A;  3OBW A;  3MCA B;  1R0B G;  3VS1 A;  1BB9 A;  1I4K 1;  1MHN A;  3OS5 A;  3GNG A;  2DFU A;  1XJW B;  1VQ7 A;  2Y4Y A;  2RK2 A;  4E7H A;  3MP6 A;  3JCM V;  4PJL A;  2FRY A;  2JM9 A;  3RBB B;  2LJ1 A;  2CH4 W;  4E7J A;  2X9H A;  2P4R A;  3CCS Q;  2DVJ A;  2FL7 A;  4KT0 E;  4LDU A;  4N4H A;  5GMK i;  3FLG A;  1VQ4 A;  4PFP A;  3L2Z A;  3E9F A;  3X28 B;  4C5E A;  4PFO A;  5CKH A;  3OMG A;  2KK4 A;  1JJ2 S;  5GAO q;  1HXD A;  3CC2 T;  1WXT A;  3KBG A;  4M75 D;  5I11 A;  2YRD A;  5GAM g;  4OB1 B;  3I5R A;  2DL8 A;  4F04 B;  1UJ0 A;  2CH4 A;  2EGE A;  4XAX B;  2OJ2 A;  1YWP A;  1SEM A;  2K6D A;  1ZUY A;  5GAN h;  3QO3 A;  5LJ5 f;  1UHF A;  4DBF A;  1VUB A;  4C92 C;  2GQV A;  5KYU B;  2LQ8 A;  1MND A;  3EGD A;  2CP0 A;  2P84 A;  3EH2 A;  4KGZ B;  3T9N A;  4IUR A;  2YHT A;  1AHJ B;  1D1A A;  1WHH A;  3CCU T;  2R58 A;  2R57 A;  1BI2 A;  2DTI A;  1KQS S;  2QQA A;  2DXU A;  1B34 A;  4M75 E;  3UT1 A;  3CMA A;  1Z9Q A;  2ZZD A;  2HQE A;  1OYX A;  3LLR A;  1PD1 A;  4ZN3 A;  3INZ A;  1VQO Q;  1SF9 A;  4J9E A;  3JCM b;  3IQL A;  4RCB A;  2FB7 A;  1QQJ A;  5GAM d;  2JS0 A;  3WVE B;  3QWX X;  3OYF A;  3CPW S;  1ZUK A;  2CKK A;  5CR2 A;  3I55 T;  4M75 G;  2RM4 A;  5A2Q E;  1T3L A;  1U3O A;  1RI9 A;  2FEI A;  1BKB A;  1ZUU A;  3OYH A;  1WQW A;  3EFR A;  1ZSG A;  3SDZ A;  5D6X A;  1N27 A;  1YIJ A;  5GAM j;  4KGX B;  4AFQ C;  1OV3 A;  1XOV A;  1Y71 A;  3X24 B;  2DL7 A;  1Y96 A;  4N4G A;  1W2B P;  2COY A;  1K73 C;  1ZSZ B;  3G4S T;  2RN8 A;  2QG9 B;  4LUD A;  5L8R E;  1K0X A;  2LCS A;  3REA B;  1NE8 A;  4OGE A;  2XG8 D;  1V29 B;  4M7A G;  2SEM A;  4FIB A;  3I35 A;  3QKJ A;  4E7Z A;  3L2Q A;  2YXY A;  2E64 A;  1YCY A;  1YI2 Q;  2HL3 A;  1QWE A;  4B9W A;  2M02 A;  3JRZ A;  3LW5 E;  3PMI A;  4ZN1 A;  3CC2 Q;  2CSQ A;  2OTL T;  1B7T A;  2FRW A;  4ZNX A;  2JNG A;  4MDW A;  1GCQ C;  2VWF A;  3E9G A;  2RPN A;  2YUP A;  2KRO A;  4RCC A;  4BI8 B;  1S72 T;  5CK9 A;  2I0N A;  2EQU A;  1PKT A;  4C0G A;  2MIO A;  4KRT A;  5CAI A;  3EG9 A;  1M1K C;  2KR3 A;  2DZC A;  2LJ0 A;  4GBQ A;  1NLP C;  4QW2 A;  2DJQ A;  3A1P A;  1M9S A;  2IVW A;  4J6X A;  4CI0 C;  2CT3 A;  2ZAE A;  4DEX A;  2LQK A;  2HAX A;  1UGP B;  2VGN A;  2ROL A;  2V26 A;  4IUU A;  1QVG A;  1BBZ A;  3CCU Q;  3MPU B;  1VYV A;  1LJO A;  2NUT B;  3EHQ A;  3HL8 A;  3OY9 A;  1Q86 C;  1Q7Y U;  4N0A C;  1WHL A;  3A8H B;  4D6W A;  4HT9 A;  3JCM W;  2K5F A;  3UA7 A;  1RAD B;  1ZSZ C;  2HQH A;  1PRL C;  2KRN A;  4J9H A;  3WXM B;  2QQB A;  1ABO A;  3QXE B;  4CC4 B;  5FW9 A;  2A3L A;  5GAM e;  2JZ2 A;  1M3A A;  3M0T A;  2J6F A;  1D0Y A;  3JCM P;  3RMS A;  4FYV B;  1O9S A;  3QUI A;  4EMH A;  3I55 Q;  1N9R A;  2C0O A;  3OYL A;  3QHS A;  4HXJ A;  1ZBJ A;  2O31 A;  2DX1 A;  1PNJ A;  2BUD A;  2BKD N;  4Z02 A;  4LDV A;  4EMG A;  2ECZ A;  1IRE B;  4M7A A;  1M90 U;  3JCM g;  1CKA A;  2KI7 A;  2B8A A;  3O5Z A;  4KGV B;  3RUX A;  3OYC A;  2RO0 A;  2YLB A;  1VQ9 T;  1K73 R;  1EFN A;  1U5S A;  2KE9 A;  2ED0 A;  2GQI A;  3CC7 T;  1LVK A;  3VS2 A;  3G4S Q;  1K9M U;  2JW4 A;  2QYZ A;  1RAH B;  3TQ7 P;  2O9S A;  4RTZ A;  1TSF A;  1Y07 A;  1B07 A;  4J9F A;  4C0F A;  1VQ6 A;  2CP3 A;  1I0C A;  2DXB A;  5LJ3 g;  3M0Q A;  3MHX A;  1W70 A;  3S6W A;  1YFN A;  1JU5 C;  2K2M A;  4R56 A;  1IRX A;  3J81 E;  1Q95 G;  2X51 A;  1QVF S;  4BUG A;  4DEY A;  1WI7 A;  2EKO A;  4PLI A;  1HJD A;  2DD5 A;  2OTL Q;  3H8Z A;  1FYN A;  5HCK A;  3H0F A;  2KT1 A;  4DBQ A;  4F17 A;  4C0D C;  1S72 Q;  4HVV A;  3EFS A;  1PG5 B;  3C95 A;  3CC4 A;  3CME T;  3CXC S;  3OA6 A;  4EPC A;  4PKC C;  1VA7 A;  4PJO A;  3JB9 H;  2X4Y A;  1UG1 A;  3OYB A;  1M1K R;  2J6K A;  1PSE A;  1VOM A;  3P8H A;  1U06 A;  5GAN 5;  3G1J A;  2K3Y A;  3JCM J;  1NJI C;  2XIC A;  3EGX A;  2JJ9 A;  1IGQ A;  1KD1 C;  4QT7 A;  5CKF A;  4FCY A;  1NPR A;  1ZHI A;  1M8V A;  3QSU A;  1VQ8 T;  3THK A;  5KYX B;  3GPL A;  1IB8 A;  3CBM A;  3SEM A;  2O4X A;  2DYB A;  5GAN 2;  1AZE A;  1ACM B;  3M58 A;  2QA4 T;  3HRS A;  4AFZ C;  1Q86 R;  1OZ2 A;  4XU3 A;  3CCR A;  2KRM A;  4LDY A;  2ZGW A;  3NMZ C;  4OB0 B;  2D6F A;  4Z89 A;  3CCJ A;  2NUZ A;  3UDC A;  4IUV A;  1U8R A;  4FT2 A;  2HSP A;  2C0I A;  4GY5 A;  2EAY A;  3I5S A;  4J6W A;  1UUE A;  3EGU A;  2OTJ A;  2YUO A;  5AYF A;  5LJ3 j;  1QCO A;  4ME7 A;  1KHC A;  2RJD A;  1N8R C;  4RTV A;  2RHI A;  3I56 T;  1CKB A;  2LJ3 A;  4C92 G;  3OYJ A;  4EMK B;  3RMQ A;  3TCJ A;  3JCM f;  5KYY A;  1YCS B;  3QG1 A;  3MO8 A;  1QLY A;  1T0J A;  2DIL A;  4M77 C;  2HCK A;  3JV3 A;  2PVD B;  2AIR B;  2O88 A;  2NYS A;  1VIE A;  4PJO C;  1AWJ A;  3L2U A;  1VQN A;  2LT4 A;  4PL6 A;  4L6V 5;  4ELY C;  1G83 A;  1VQ9 Q;  5LJ3 f;  2HQX A;  1VQM A;  1RLQ C;  3CC7 Q;  3NTH A;  1PWT A;  2FPF A;  1GCP A;  4CC3 A;  3LH0 A;  4LD6 A;  1KFZ A;  3VV0 A;  1NYF A;  3FRN A;  1AVZ C;  1OZ3 A;  2RI2 A;  1QP2 A;  3CCQ T;  4RTY A;  2EQJ A;  1PKS A;  3CCS A;  1FMV A;  1VQ5 T;  3M0P A;  2PNI A;  1JB0 E;  1LOJ A;  4JZ3 A;  3CCV T;  1BIB A;  1Q82 U;  2DF6 A;  1VYU A;  1KJW A;  2E6N A;  4FW1 A;  5LJ5 g;  4Z88 A;  4MZP A;  3ZEH A;  1RAI B;  2E3H A;  1UE9 A;  5KH6 A;  4O6J A;  4Y92 A;  2LRQ A;  4MMK A;  3MEV A;  1RLP C;  2XU8 A;  4C8Q B;  3TSW A;  4XK8 E;  4AT1 B;  2HSE B;  1TOV A;  3JCM e;  3OSV A;  4KUL A;  1IZ6 A;  1MMD A;  2VYT A;  5J26 A;  1M1G A;  4F7U G;  2V8K A;  1ZA2 B;  2Y90 A;  1UGQ B;  3EFO A;  3C94 A;  1XTD A;  2CP5 A;  5I21 A;  1NEG A;  1NJI R;  2XD0 A;  1K8A U;  1KD1 R;  1TU0 B;  1LCK A;  4F16 A;  3PTA A;  3G71 T;  1VQ8 Q;  1GL5 A;  4OB2 B;  2XI9 A;  1SRM A;  4M78 C;  3VRZ A;  2A7Y A;  5LJ3 e;  1WJR A;  2QDY B;  5GJW B;  3L42 A;  2FZG B;  4A4F A;  4C92 A;  3CBO A;  1PM3 A;  2QEX Q;  3OBY A;  1VQK A;  5LJ5 d;  1H92 A;  4KH0 B;  3CCM A;  1HYO A;  1WPY A;  3GOX A;  2F2W A;  1M8M A;  3M54 A;  1WYX A;  4R0K A;  4KBM B;  1VQ7 T;  5J3B A;  1I1J A;  4M4Z A;  1N8R R;  4FSS A;  2ZCF B;  3I56 Q;  4RTX A;  4AFS C;  2DJZ A;  1O75 A;  1EZZ B;  2KEA A;  2LT1 A;  2LQN A;  1SHF A;  4BE2 A;  2WSF E;  4DQ2 A;  1D3B B;  1I5O B;  3SWN B;  4BY6 B;  2DXT A;  4M7A F;  5LJ5 j;  3ZBD A;  2BZX A;  1VQ4 T;  4OML A;  2DER A;  2HBP A;  3LWI A;  2LX9 A;  2VXF A;  4C8Q C;  3TEE A;  2XK0 A;  4HCZ A;  1S1N A;  2VUB A;  2X3W D;  1M27 C;  3PNW C;  3RER A; 
#chains in the Genus database with same CATH homology
 2D1X A;  2JM8 A;  2VKN A;  4E6R A;  2C0T A;  2LMJ A;  2LQW A;  4OMO A;  2JTE A;  4OMQ A;  1WIE A;  2W10 A;  2EYW A;  1QWE A;  3PE0 A;  1B3Q A;  2KXC A;  1MUZ A;  4HVU A;  5IHN A;  2CSQ A;  2K9G A;  2FRW A;  4ZNX A;  1GCQ C;  2VWF A;  2CSI A;  3FJ5 A;  1KIK A;  2RPN A;  1QKX A;  2YUP A;  2ED1 A;  2KRO A;  2ENM A;  3VS4 A;  3H0H A;  2I0N A;  4OMP A;  2OI3 A;  1H3H A;  2F2X A;  2MCN A;  1WLP B;  3NGP A;  3I9Q A;  1PKT A;  2EGA A;  2GNC A;  2MIO A;  4KRT A;  2CDT A;  2KR3 A;  4AG1 C;  2LJ0 A;  1GBQ A;  4GBQ A;  1K9A A;  1M30 A;  1NLP C;  4JJD A;  3NHN A;  2CRE A;  2DJQ A;  2LZ6 B;  1KSW A;  2DRK A;  2FO0 A;  2CT3 A;  2YUN A;  4DEX A;  1AOJ A;  2IIM A;  2ROL A;  2CUD A;  2KXD A;  1K1Z A;  1GBR A;  4LNP A;  5GJV B;  4D8D A;  1BBZ A;  2JT4 A;  1TUC A;  4ORZ A;  1SRL A;  2CUB A;  5IXF A;  1J3T A;  1BU1 A;  1VYV A;  3EHQ A;  1E7O A;  4HCK A;  2F2V A;  1E6H A;  4J9C A;  1WDX A;  1T0H A;  2HEQ A;  1GCQ A;  3REB B;  3VS6 A;  4IIM A;  3UA7 A;  1E6G A;  2PZ1 A;  1OPL A;  3CQT A;  4JJC A;  4LUE A;  4AFU C;  2SRC A;  2EYX A;  2J06 A;  4ESR A;  4OMM A;  2H8H A;  4OMN A;  1PRL C;  2KRN A;  2AZS A;  4J9H A;  1I07 A;  1ABO A;  4CC4 B;  5FW9 A;  4J9D A;  1M3A A;  3M0T A;  2J6F A;  2YDL A;  2ROT A;  3M0S A;  3ZL7 C;  1H8K A;  2DLP A;  2X3X D;  1WXB A;  2DRM A;  2C0O A;  2LP5 A;  3VS0 A;  4J9B A;  1OEB A;  4HXJ A;  1ZBJ A;  1UFF A;  2O31 A;  2XMF A;  1QCF A;  2DX1 A;  1PNJ A;  2RQW A;  2B86 A;  1UEC A;  2ECZ A;  2RQV A;  1Z9Z A;  1WX6 A;  1CKA A;  3PVQ A;  1G2B A;  2V1Q A;  5I22 A;  2RMO A;  2DBM A;  3O5Z A;  1GRI A;  3SHW A;  1OOT A;  2A37 A;  1T3S A;  1EFN A;  1U5S A;  2KE9 A;  2ED0 A;  2GQI A;  2L0A A;  2A08 A;  4X1V A;  2L3S A;  3VS2 A;  2JW4 A;  2YSQ A;  1X43 A;  2O9S A;  4RTZ A;  2FPD A;  2J7I A;  4HVW A;  3UF4 A;  2JMA A;  2YT6 A;  4Z8A A;  2DNU A;  1B07 A;  4J9F A;  1I0C A;  1JO8 A;  3M0Q A;  2JXB A;  1MV3 A;  1X2Q A;  1W70 A;  1YNZ A;  2EYY A;  3EG2 A;  1JEG A;  1JU5 C;  2GTO A;  3EG3 A;  2K2M A;  2LNH B;  2RQR A;  2CT4 A;  2AKL A;  2RQU A;  2KT8 A;  1K76 A;  4DEY A;  3M0U A;  1WI7 A;  2KYM A;  3EG0 A;  4JJB A;  4CC2 A;  3TVT A;  1HJD A;  2BTT A;  1FYN A;  5HCK A;  3H0F A;  2FG0 A;  2KT1 A;  4F17 A;  2VVK A;  1RUW A;  2D8H A;  4HVV A;  4RTW A;  1VYT A;  1AWO A;  2AK5 A;  2EW3 A;  1VA7 A;  1SHG A;  3M0R A;  1UG1 A;  2A36 A;  2KNB B;  1ZLM A;  2J6K A;  2J05 A;  2JMC A;  4IIO A;  1U06 A;  2D0N A;  4AG2 C;  1NEB A;  5IHK A;  1PRM C;  2LX7 A;  2M51 A;  2PTK A;  2GTJ A;  2RF0 A;  4QT7 A;  2G6F X;  2GGR A;  1NM7 A;  5IXB A;  1CSK A;  1WA7 A;  1X27 A;  1YWO A;  2EKH A;  3A98 A;  3THK A;  2A28 A;  3SEM A;  4D8K A;  1GFD A;  2DYB A;  1AZE A;  3PVL A;  5L23 A;  4RTU A;  4AFZ C;  2JS2 A;  1K0S A;  4WCI A;  4JPB W;  2KRM A;  2J6O A;  4J9G A;  2EGC A;  1SSH A;  3NMZ C;  2RNA A;  4Z89 A;  2NUZ A;  2HSP A;  2C0I A;  2L3P A;  1W1F A;  2DBK A;  3I5S A;  2O2O A;  4EIK A;  2EVR A;  3U23 A;  1UUE A;  2DL4 A;  1ZX6 A;  3C0C A;  1UDL A;  2BZY A;  3EGU A;  5IH2 A;  2YUO A;  4JZ4 A;  1HD3 A;  2K79 A;  4RTV A;  2L3Q A;  1X6B A;  1HSQ A;  3H0I A;  3VS3 A;  1CKB A;  2ABL A;  2LJ3 A;  1PHT A;  2DL5 A;  2DM1 A;  2O9V A;  1AWX A;  2K7A A;  3LH5 A;  3UAT A;  1GFC A;  2HBW A;  2DMO A;  1YCS B;  3RNJ A;  1ARK A;  3VS1 A;  1QLY A;  3UA6 A;  1T0J A;  1M3C A;  2DIL A;  4F14 A;  1BB9 A;  2HCK A;  3JV3 A;  2FPE A;  1NG2 A;  1X6G A;  2NWM A;  1UTI A;  2HDA A;  5IHI A;  2O88 A;  1AWJ A;  2FRY A;  2JM9 A;  2D8J A;  2LJ1 A;  3RBB B;  2CH4 W;  1NLO C;  2P4R A;  2DVJ A;  1G83 A;  1BK2 A;  2KYB A;  3GBQ A;  1RLQ C;  3EHR A;  1PWT A;  4RUG A;  2DL3 A;  2FPF A;  2KRS A;  3NPF A;  1GCP A;  4CC3 A;  1KFZ A;  1NYF A;  5EC7 A;  1AVZ C;  2AZV A;  2W0Z A;  4RTY A;  1WXT A;  1PKS A;  5I11 A;  3I5R A;  1X2K A;  1WXU A;  2DL8 A;  3M0P A;  2PNI A;  4JZ3 A;  1UJ0 A;  4LE9 A;  2CH4 A;  2EGE A;  2OJ2 A;  1OPK A;  2DF6 A;  1AZG B;  1YWP A;  1VYU A;  1KJW A;  1SEM A;  2K6D A;  1ZUY A;  1FMK A;  2KGT A;  5FWB A;  4Z88 A;  1Y0M A;  1UHF A;  1UE9 A;  4LN2 A;  4Y92 A;  2EQI A;  5ECA A;  1RLP C;  4CC7 A;  3TSW A;  1NYG A;  1AWW A;  1QKW A;  1JQQ A;  3QWY A;  3R6N A;  2EPD A;  1A0N B;  2E5K A;  4RTT A;  1UJY A;  1AEY A;  1UGV A;  1QWF A;  3VRY A;  1NEG A;  1ABQ A;  1UHC A;  3ULR B;  1Z9Q A;  4GLM A;  2GBQ A;  3VS5 A;  2EBP A;  2DE0 X;  1IO6 A;  1N5Z A;  1X69 A;  1LCK A;  2AKK A;  4F16 A;  4K11 A;  2QDL A;  2OAW A;  5FWC A;  1GL5 A;  4J9E A;  1V1C A;  3IQL A;  1SRM A;  2M0Y A;  3VRZ A;  3H41 A;  1AD5 A;  5GJW B;  2KBT A;  1JXO A;  2JS0 A;  2RQT A;  1YN8 A;  2MOX A;  3QWX X;  1ZUK A;  2BZ8 A;  1TUD A;  1SPK A;  2V1R A;  1H92 A;  1T3L A;  1U3O A;  1RI9 A;  2FEI A;  1MV0 B;  1Y57 A;  1YP5 A;  1TG0 A;  2F2W A;  1ZUU A;  1M8M A;  4A63 B;  1WYX A;  4R0K A;  1ZSG A;  3KFV A;  2EYZ A;  2YUQ A;  1I1J A;  4M4Z A;  4AFQ C;  4FSS A;  1OV3 A;  4RTX A;  1XOV A;  4AFS C;  2DA9 A;  3VS7 A;  1K4U S;  2KEA A;  2LQN A;  1SHF A;  3TSZ A;  2DL7 A;  3EG1 A;  2BZX A;  4OML A;  4J9I A;  2RN8 A;  2L2P A;  1JXM A;  2ESW A;  4LUD A;  1K0X A;  1WFW A;  1M3B A;  2LCS A;  3REA B;  1S1N A;  2X3W D;  1M27 C;  2SEM A;  3I35 A;  2K3B A;  1W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...