5GMKm

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
b'MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 12
structure length 82
sequence length 109
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkm00
3JB9I 3BW1A 4XQ3A 4PJOD 4C92C 2Y90A 4MMKA 4RCCA 4XTWA 5GMKj 1B34B 1B34A 3QUIA 4M7DD 4M7AB 4M7AA 2E64A 4PJOB 2E65A 5LJ3f 4JLIA 4C92G 5GAN2 4C8QD 4M77E 4PNOA 4M75A 4A54A 4M78D 3JB9F 5LJ5h 2HNIA 2VXFA 4J6XA 5LJ5g 4M7DB 2FB7A 2EJFA 3FJPA 3JCMc 2EAYA 4N0AA 4F7UA 4XU3A 5GAOq 3QO3A 4NL3A 2DXTA 4J6WA 3JCMV 4Y91A 3JCMf 5CAIA 2RB6A 4EMGA 4M78B 3BDUA 3JB9H 3VU3C 3PGGA 1M5Q1 1I81A 2DKGA 2DTOA 4X9DA 4EMKC 4C8QF 3JB9D 3JCMQ 3SWNA 4C92E 5LJ5j 5GAOl 1H641 1M8VA 2EJ9A 2RA2A 4M77D 3M4GA 3V8KA 5LJ3e 3L2ZA 1LOJA 4NL2A 1D3BB 4OP0A 2QTXA 5LJ3d 5GANe 4JRIA 3INZA 1YCYA 4QVDA 1WQWA 5GANd 4M7AC 3RKXA 2VC8A 4RCBA 2I2LA 4MMLA 4PJOA 4M75E 2K57A 3L1AA 3JCMe 1JBMA 4M75C 2DTHA 3FB9A 4DQ2A 2EJGA 3JCMd 5GAMf 4M7DA 5LJ3g 4M77F 4N0AC 4M7AG 4C92D 5GANh 3JB9J 4HT8A 3QHSA 4XU0A 5GANg 1Y96B 5GAN4 2DXUA 2YHTA 1LNXA 4XTXA 4C8QB 2VXEA 4C8QA 5GAN7 1U1SA 2RM4A 1N9SA 2DEQA 4M75G 4M78A 4NOYA 4XTVA 5I21A 1MGQA 3JCMX 5GAOm 4HA8A 1I8FA 2YLCA 3JCMh 4F7UG 3JCMg 4V2SA 1U1TA 3SWNC 2YLBA 5LJ3j 3GIBA 4QVCA 5GMKe 3EFRA 1KQ1A 5GANj 1D3BA 3BFMA 3RESA 4C92F 5LJ5f 4M7AE 4X9CA 5GAMe 3RUXA 4PJOC 3V8JA 4J6YA 4M77A 4M77B 5GAMd 5GAN3 4XU2A 5GAN5 3JCMb 2EWNA 4F7UE 4M75F 1LJOA 5LJ3h 1BIBA 4M7DC 4J5YA 1JRIA 1WQ7A 3HFOA 4A53A 4XTZA 4PJOG 4F7UF 1Y96A 4JRKA 4C8QC 2FYKA 1I4K1 1HK9A 5GAMh 4M78C 3RKWA 4EMKB 5GAMg 3RIRA 5GAOp 3V7SA 4M7AD 1TH7A 3V7CA 1WPYA 5LJ5e 4M7DG 3JCMJ 2CGHA 4C92B 2DVEA 4WF2A 1HXDA 4C92A 3EFSA 2DJZA 1N9RA 3HFNA 3FIFA 5LJ5d 5GAN8 4M75D 3JCMW 3JCMP 1KQ2A 2DZCA 4C8QG 5GAOr 4EMHA 4M78G 5DY9A 4XTYA 2E41A 2ZGWA 1I5LA 5GAMj 2DTIA 3V7RA 4PJOE 5GANf 4M75B 4XTUA 2RD1A 4M7AF 4JUVA 4M77C 2E10A 4PJOF 4F7UB 5GMKi 3RKYA 4M7DE 1BIAA 3SB2A 3RERA 3QSUA 5GAOn 4HT9A 2E1HA 5GMKh 3AHUA 5GAN6 1X01A 2JN0A 3JB9G 4M7DF 4XU1A 3V8LA 4C8QE 5GMKm 3HSBA 4M77G 4M78E 3BY7A 1WNLA 2DZ9A 4EMKA 3SWNB 4M78F 5GMKl
chains in the Genus database with same CATH superfamily
3N5BB 3JB9I 4BI4A 2OTJA 1GFDA 1C0MA 4E7SA 4E47A 1ZA1B 2HKQB 4OMLA 5FU6C 2CH4A 4BACA 2V26A 4C0DC 8ATCB 2R5AA 2HBWA 1WXTA 3CC4Q 3OSVA 1PD0A 2EAYA 1OI1A 3QO3A 4IURA 4J6WA 5KH6A 3CEYA 3FLGA 1TSFA 3PVLA 2EBPA 5KYXB 3SWNA 2AZVA 2EJ9A 2WSCE 5LJ3e 3I5SA 1VQ7Q 1C1AA 3INZA 1UGQB 5CKHA 4Q5WA 4ZTFA 3R6OA 2DL7A 1AZEA 2MMPA 5ECAA 1M3CA 4HT8A 3EAEA 2L2PA 3OMGA 1WJQA 1UECA 1YWPA 1S1NA 2A36A 2O4XB 5GAOm 2AK5A 5CQYA 4X1VA 1VQ4A 1Q82C 4JS4A 3I56T 4QVCA 3EFRA 3CCRQ 1VQKA 1D3BA 3UWNA 3G6EQ 1RUWA 1E7OA 4JLGA 4B9WA 3ZL7C 5IT9E 2DYIA 1WXBA 1RAGB 1WDXA 2LT1A 1P92A 1YI2A 4A53A 1TUCA 3CCQT 3HHTB 1Y96A 4LXCA 3V7SA 4C92A 3CBOA 5CR2A 4K11A 2RQVA 1W2BA 2PNIA 2DL8A 1QVFS 3UT1A 5GJVB 1FWZA 2LRQA 4PJOE 2DD4A 2RN8A 1JEGA 2QA4T 2ED0A 1W2BP 1KFZA 4II1A 4JJDA 1NEGA 3GBQA 1YJWA 2WSEE 1UGSB 3SWNB 1AZGB 3BW1A 1SSHA 4RCCA 4PJNA 1NM7A 1B34A 3QUIA 1VQPT 4M7AA 1LCKA 2SRCA 3RNJA 1VQNQ 2NUPA 5KYNA 3JB9F 2VXFA 4CI0C 2DD5A 2FO0A 3JCMc 2P4TA 4OVAA 4NL3A 2DXTA 2HSEB 2W0ZA 3JCMV 2CUDA 2FEIA 1E6HA 1RI0A 4C0ZA 1N27A 3LYIA 3OW2A 4FYWB 1GXIE 1M2VA 3QBYA 2RF0A 1MMGA 1D3BB 3C94A 4J9BA 4MDXA 4BUGA 2VASA 1QP2A 2I2LA 4M75E 1NLPC 1NJIR 5GAMf 1BKBA 1RLQC 1Y96B 2A08A 3S6WA 4GY5A 1M27C 4M78A 3A8MB 3CQTA 2OTJT 3HP9A 3EG3A 3JCMX 4QQGA 1X6OA 1MV0B 4F7UG 3VS5A 4FYVB 3EH2A 4V2SA 3PE0A 2MWPA 2XK0A 2E70A 3M53A 3MHXA 4HCCA 2DERA 2GGRA 2GFUA 2O9VA 4J6YA 4J8OA 1VQMQ 1YIJA 2FPEA 5CCAA 2FL7A 3CC7A 4AFUC 2YUQA 2X3XD 2EYWA 4PFZA 1OU8A 2P0PA 3OA6A 5GAN8 1BB9A 3CCEQ 1UTIA 3JSCA 2CSIA 2FHDA 4BY6B 2ZZDA 3VS4A 1PKTA 5GAMj 2NUPB 5J3BA 2QI2A 5GJWB 4HVVA 3L2QA 3M56A 1G3SA 2HEQA 3H0FA 1MNDA 2KNBB 3L2VA 1PM3A 2AKKA 4M78F 4VUBA 4JRQA 1H8KA 1M2VB 2YUNA 2O88A 2R57A 5C6SA 5D6XA 3HTRA 2X51A 5GMKj 2LDMA 2D8JA 2E64A 1M1KR 5LJ5g 1RLPC 1YJNT 1VQ8Q 4M78B 2JTEA 4RTUA 4DEXA 1N8RR 1OPKA 5FWCA 2K4YA 1YITT 2DYBA 3M9QA 3L2ZA 3LWIA 4OP0A 2QEXT 1PSEA 1MV3A 4RCBA 1JBMA 1ABQA 3CMET 1OX8A 2ZPEB 3I55A 2FPFA 3QXEB 4L6V5 3TQ7P 3QHSA 4C5GA 3JCMW 1VUBA 1X75C 3A8GB 2RM4A 2XICA 4M75G 2MK5A 2PVGB 2B86A 4OMMA 2KYBA 1QCFA 1IGQA 2MYSA 3C12A 3URGA 3WVEB 5GANj 3BFMA 2DMOA 2XKOC 4OMNA 2HDAA 2KVQG 2LP5A 2YSQA 4AFQC 3CMAA 1TOVA 1WQ7A 3HFOA 2QAZA 2KQWA 1ZUKA 3CPFA 2IG0A 2VGNA 4M7DG 2RJDA 4GLMA 1G3TA 3VUZA 3OS2A 1VQ6A 5CKDA 1OPLA 1H92A 4XTYA 1ZQ1A 2EQKA 2G6FX 3PTAA 2CH4W 1NYGA 2QTVA 2E10A 3OYAA 4C5HA 5CIUA 3SFMA 1K8AC 3RERA 5GAOn 2ZPHB 1WYXA 3GP8A 3V8LA 5FRMA 1GCQC 2LQ8A 4FIBA 4C5EA 1NPRA 4M77G 4FL6A 2E3IA 3BY7A 4EMKA 2A7YA 4XQ3A 1VQLA 3S3MA 2MAMA 1WHGA 3C0CA 4BY6C 2JUFA 2C06A 2KROA 3CCST 5LJ3f 4HCKA 3OYDA 4C8QD 1Z9ZA 4EPCA 4O5VA 2JZ2A 2KI7A 1U8RA 4X34A 1X2QA 1RAHB 2LX9A 5LL6S 1Y71A 2DIGA 1WHHA 5FW9A 2DETA 2YXYA 3SDZA 4BE1A 1X69A 2O01E 3OYBA 2O2OA 1RABB 1EX4A 2GTJA 1H3HA 4L5GA 3KFVA 3JCMe 1NZ9A 2F69A 2KY9A 3GNGA 1WHLA 2DO3A 3JB9J 4A63B 2K7AA 4CRIA 2DXUA 2WACA 4LD9K 2HD0A 1KHIA 2DL5A 5D6YA 3M4YA 2QQRA 4DOVA 3VYHB 2X4YA 5LJ3j 2ATCB 3G71T 4N4IA 4OB2B 2DBKA 3OB9A 4JRPA 4FCYA 3OS0A 3Q1JA 4X9CA 2VGMA 2LT4A 4FYYB 5C0MA 1UE9A 1R0BG 4EDUA 3JCMb 2LZ6B 4IUUA 3OYFA 4EMKB 1X6GA 2CP2A 3OBWA 2JOYA 5LJ5e 3RBBB 2ED1A 2V8KA 3HSBA 1M3BA 1UJ0A 2FZGB 4EMHA 3CCUT 2V1QA 3EG1A 5DY9A 4E7KA 2QGFB 1VIEA 3UATA 2ESWA 4DOWA 1G8XA 3CCLA 3PNWC 4HKEA 1UDLA 3RDVA 4E6RA 3CCMA 4XU1A 4Y92A 3MP6A 3MP1A 1C6VX 4FW1A 1X43A 1V29B 1Q81U 4MMKA 1YHQA 3ME9A 2X4WA 4KT0E 1UHCA 1AVZC 2K2MA 4QVZA 1QVGS 3MP8A 3MPUB 4A54A 5I2SA 1X2KA 3P8HA 3G4SA 4PFOA 4R55A 4E7LA 1IZ6A 4RUGA 1VQ6T 1OU9A 4PKCC 3WXMB 2DA9A 1VQ5A 2EQJA 3NPFA 2J05A 5IAYA 2LVMA 2VWFA 1UGVA 4E7IA 2EFIA 1VQ9T 1QVFA 1M90C 1W70A 2L3RA 3E1SA 4J9HA 2C0TA 3D7SB 2C0OA 2ROTA 5A2QE 4JDSA 1BCOA 4M77F 1YP5A 4PJLA 4C5IA 5GAN7 2ZCFB 5CK9A 1QVFP 1UGPB 3I35A 1VQLT 1KJWA 3HKSA 1I8FA 2MF2A 4FU6A 2F2WA 1VYUA 1UB4A 4BB7A 1WFWA 5CO7A 4LUEA 3CC4A 3GIBA 1KQ1A 3PMIA 3RESA 4HVUA 3HRTA 2DVJA 4M77B 1VQOT 1S72Q 4XU2A 4OB0B 2JMCA 3UA6A 3THKA 1IO6A 2JT4A 3MJXA 1VQ7A 3QIIA 3CD6T 4F04B 4AT1B 5GAMh 4J9IA 1OEBA 2DVEA 2GBQA 2LCCA 3QPHA 1K0SA 2ABLA 4OMFB 1I5LA 2X3WD 1BI0A 4RKUE 1BIAA 2M02A 5GMKh 1WJRA 2OJ2A 1H3ZA 5M9OA 3JB9G 5GMKm 3CCRA 2MIOA 2K5FA 3G6EA 4GLKA 2RPNA 2QASA 4PJOD 2E12A 5EC7A 4Z89A 1SF9A 3NTKA 3CC2T 4A4HA 3OSSC 4C92G 2LCSA 1SPKA 3J81E 3L2WA 1RAFB 1JO8A 3CCJT 4N0AA 1XNIA 3I5RA 2BZ8A 1Y0MA 2JS2A 2XIDA 3UPUA 5L23A 1BYMA 2Z0WA 3JRZA 1K76A 2RA2A 2SEMA 3OBYA 4FSSA 4Z8AA 4ME7A 3PIPA 4PK4A 3RKXA 2JTMA 1YJ9T 4M75C 1O75A 4DQ2A 1CSKA 3CCMT 4BE2A 2J06A 4JZ4A 4M7AG 3EGDA 5GANh 2DILA 1KC8C 1N9SA 4BDYA 2MCNA 1YHQT 1VQNA 3VKIA 4AG1C 2L3QA 3VYGA 2XDDA 3M55A 2LQNA 2KXCA 3CCQQ 3FC3A 2OAWA 2DL4A 4HCBA 3ER0A 5GAN3 5GAN5 3C4SA 2K2VA 4F7UE 1NLOC 2I0NA 4M7DC 2CZ7B 1VQ5T 4XTZA 1IHVA 2CSQA 5FU7C 3EHRA 1EFNA 1W1FA 2QG9B 2QA4Q 2JVVA 3C95A 3F70A 4OMQA 2DZCA 5GAOr 1V1CA 4M78G 1IB8A 3MEUA 2GTOA 1KG1A 4IUPA 3H9NA 2RD1A 3OS1A 4M77C 3EH1A 1NE8A 4HXJA 2KDSA 1BI3A 1BCMA 1VQPQ 1UGRB 1M2OA 1K9AA 1WHJA 4R0KA 1QLYA 2KT1A 3CC4T 2BZYA 4IKFA 1VQMA 4FW2A 3EGUA 1I0CA 2LX7A 2E65A 1D1BA 3QDFA 2HQEA 1VQ7T 3MEVA 3EGDB 1D1CA 2L3SA 3CBPA 3MCAB 1QW1A 2VUBA 3JCMf 2COZA 2L3PA 1WJSA 3CCEA 3MO8A 1N5ZA 3CCVA 3M54A 3NMZC 5GAOl 2O9SA 5CKEA 1KQSS 1OULA 1EIFA 1RI9A 1ZSZA 2VC8A 1W6XA 5IHKA 2K5LA 1YCSB 1Y57A 2ZPGB 1ZUUA 4F14A 2HL5C 3IQLA 2PUOB 2OTLT 4XU0A 4C8QA 1ZSGA 5KE3A 2F1LA 3GLXA 2F5KA 2A37A 3P8BB 2RNAA 1PC0A 1Q95G 5KCHA 2DF6A 4C92F 5LJ5f 2RI2A 1VQ8A 3M0UA 2DEUA 2DXBA 2RJEA 3QZ9B 4F16A 3RMSA 1LVKA 1RL2A 1KHCA 1I4K1 5DLOA 1UHFA 4UC4A 5AYFA 4C92B 2K5IA 2P4RA 1Q86C 2KK4A 2RHUA 2XMFA 3FIFA 1TS9A 4ZGJB 4M7AF 4JUVA 3X20B 4M7DE 1M1KC 1SRLA 2LNHB 1OQKA 2JMAA 4XK8E 1VQNT 4PLIA 1TU0B 2EQIA 1ABOA 1WNLA 2HL3A 3OYMA 1YN8A 3M0QA 3ZEHA 2COWA 1RAAB 3HPWA 1YJNQ 3H0IA 1B34B 1TWBA 4M7AB 3CPWS 4M77E 1K9MU 4J6XA 1YITQ 2HBPA 4JJNK 3H8ZA 4IIOA 4B9XA 1T3LA 2V1RA 3M0TA 2QEXQ 2HMAA 4DBQA 1VQ4T 1M5Q1 1I81A 2A0FB 2DKGA 4E7ZA 3NHNA 2QK0A 4RTYA 3CMEQ 3TSZA 1D0YA 1R77A 1VQKT 2AIRB 2GCXA 5IH2A 1AHJB 4ZTJA 2AKLA 3FDRA 2HSPA 4KH0B 4KULA 2CYZB 3QDRB 2HKNA 4QKUA 1YI2T 2DLPA 1M3AA 2EYQA 3QYGB 4DEYA 1VYTA 2CT4A 1VIFA 1RAIB 2M1HA 3SWNC 2RQTA 1V76A 1AWXA 1Q81R 4BI3A 2NUTA 3A98A 3LGLA 3CXCP 2QQAA 1K73C 2EYXA 1KD1U 2EQUA 2KMTA 1QVGA 1UG1A 2R58A 4FT4A 1IHWA 2E5KA 3DLMA 1VOMA 2AHJB 3CCVT 1YJWT 5GAMg 1GFCA 1QCNA 2CKKA 3JCMJ 1QVGP 1K4US 3EFSA 4KH1B 2CP0A 5KYYA 2M0YA 2J6KA 1TXQA 1WA7A 2J6FA 3OS5A 1PD1A 1KC8U 3ZFJA 3V7RA 2C0IA 2PZ1A 4J9FA 2QQBA 1MUZA 4IUQA 2DNUA 1KSWA 2KR3A 1QCOA 3VS0A 4KUIA 4HT9A 2RHYA 2DAQA 2JN0A 3MKDA 2K6DA 4A4EA 1BI1A 3CCSQ 2M51A 1YWOA 4C92C 3X28B 3TEEA 3HRSA 2M0OA 3GF5A 3CBMA 5FWBA 5GAN2 3J7AF 2DK3A 2HNIA 1Q82U 5CAIA 2D0NA 2RB6A 2KE9A 3OYYA 4ZN3A 2DFUA 1A0NB 1SHGA 2DM1A 2E4HA 2EVRA 2RHXA 2GQIA 3M4GA 2NUTB 5D7UA 3FRNA 1WQWA 4M7AC 2QXFA 8AT1B 4FYXB 3G7ZA 4CC4B 4PJOA 1YIJT 2KSSA 3CC7T 2DTHA 4P5NA 3LLRA 1HYOA 3G71Q 3I9QA 5GANg 2X35A 5A0DA 1QMCA 3TCJA 5I21A 3DB3A 2A28A 4C0FA 2YRDA 2LJ0A 5KYYB 1MMDA 2ZPBB 4WCIA 1QP3A 2DIQA 3VRYA 2B8AA 2XDBA 5AT1B 1B3QA 4AG2C 2X9HA 1VYVA 2P0QA 3CCUQ 1U3OA 1WZOA 1D0ZA 4M78C 3QWYA 3V7CA 3LWHA 1HXDA 2K79A 4E7HA 3VS3A 2JNGA 3OYCA 4IUVA 5HKCA 1ZBXA 3GOXA 5A0GA 1HJDA 2EW3A 1JXOA 2E41A 1I5OB 4N4GA 1K8AR 2RHZA 3U23A 4A4KA 4PJOF 2LMJA 2HAXA 1ZHIA 1OX9A 4FT2A 4RTTA 2D0QB 3ULRB 2CP5A 3OQ5A 5FROA 1ARKA 1AWJA 2YT6A 4PL6A 3S3NA 2GNCA 1AOJA 1S72A 2Y90A 3AT1B 4PJOB 2A3LA 1VQ6Q 1J3TA 2OAUA 3HL8A 3I55T 1XQHA 1GRIA 4JZ3A 1WXUA 1JB0E 1Q86U 4ELZC 4J9EA 2ZPIB 3CXCS 2P0KA 3REAB 2NLUA 2XDPA 2JM9A 3J80E 1VQ9Q 3OYNA 2JS0A 4C92E 2RQUA 2WSFE 1JXMA 4PJJA 2CP7A 1Y07A 1DJ7B 1Q7YC 4CC7A 2F5TX 2M9UA 1NG2A 2ZAEA 2FZCB 3L1AA 9ATCB 3CMAT 5HK0A 2CS7A 2K9GA 5LJ3g 5I22A 1YNZA 1JQQA 3KXTA 5GAN4 3KUFA 3TSWA 1R0CB 2YRCA 1VQOQ 3JCMh 2LJ1A 2JM8A 5FU6B 5GMKe 1XJWB 3VRZA 3A8HB 1RADB 4M7AE 3CD6Q 3DB4A 4C0DB 5KE2A 5GAMd 4OGEA 1WHKA 2IPOB 1IGUA 1E6GA 1LJOA 1WHMA 4LNPA 2H8HA 2R5MA 3RKWA 3OYJA 1NPPA 3QKJA 2RHIA 3MEAA 4WF2A 2DJZA 1KQ2A 4LE9A 3FEOA 4DA4A 1QWFA 2YUPA 1KQSA 1JU5C 2EYZA 4JJCA 3M5AA 4MZMA 1PCXA 1KQSP 1QQJA 4M78E 3CC2Q 3CCQA 1WX6A 1K73U 2HQXA 3V8KA 2JXBA 4EIKA 3CCJQ 3JAME 2DBMA 2PVOB 2QQ9A 1ZA2B 1WLPB 4MDWA 1RAEB 4JLIA 2RMOA 2EYYA 4LD6A 4ORZA 3EG0A 2QA4A 1SKUB 3BDUA 4CC3A 2O31A 1SEMA 5KYXA 2DTOA 3P8DA 4EMKC 3G1JA 1YJ9Q 4JS5A 1U5SA 3OYHA 3PIOA 3DKMA 1AD5A 4GBQA 3A8LB 4RTXA 5IXFA 1G3YA 5GANd 2FRWA 2ZPFB 7AT1B 2IVWA 4AMCA 2EJGA 1D0XA 2JTFA 3PT9A 4FM4B 3PVQA 3T9NA 1LNXA 1X6BA 5HCKA 1JJ2S 3JV3A 2BUDA 4NOYA 4J9DA 1S72T 2CZ1B 2NWMA 1I07A 2YLBA 1ZLMA 1IXDA 3TVTA 2OI3A 4IIMA 1K8AU 2NUZA 5CQXA 1B07A 3OYEA 2KYMA 3CCLT 2XD0A 4LN2A 3V8JA 4ATOA 4ZGDB 2RK1A 3CPWA 1RACB 4RTZA 1PNJA 1K9MR 3I56Q 1MNEA 1JRIA 2MI6A 4HCZA 3PMTA 3L42A 4RG2A 1QWEA 1WPYA 1FX7A 2CGHA 3CPWP 1PRLC 1U06A 4M75D 3NGPA 4C8QG 2D6FA 4QQDA 1FYNA 2L0AA 1VA7A 2DTIA 4MZTA 2H3JA 2F2XA 1R8OB 3G4ST 3WVDB 3SB2A 1EZZB 2PQWA 3S3OA 3QSUA 5KCOA 2QGGA 4Y28E 2PUKB 4LDYA 2HCKA 4XTWA 4NS5A 4KBMB 4M7DD 1SSFA 3EG2A 2LNVA 2LC4A 4PNOA 3RR6A 2E3HA 1KD1R 1HSQA 2V8JA 3JCMQ 6AT1B 4M77D 2CUBA 4KUDK 2QTXA 3LH0A 3VS6A 5LJ3d 4KGVB 2OTLQ 4D8KA 3REBB 1KC8R 1AWOA 1OZ2A 5FRNA 2AZSA 3UF4A 2BTTA 4YTLA 1G3WA 2DRKA 1XTDA 2LCLA 1YJNA 1NJIC 3VS7A 2X4JA 3SHWA 1XOVA 1OOTA 4OMOA 2VV5A 3TU4K 2G3RA 2QYZA 1YITA 5HY6A 3VV0A 3QG1A 1Z9QA 3M57A 2QEXA 2FRYA 3RUXA 2OTJQ 1NYFA 3RMQA 4B6MA 5LJ3h 3CMEA 3CCRT 3G6ET 3UDCA 1GCQA 1Q7YU 2P84A 4OB1B 3MEWA 1Q82R 3RIRA 5GAOp 4BDZA 1G5VA 3HFNA 2XI9A 1PWTA 2KRMA 1T0JA 4M4ZA 3VS2A 4J9GA 4QW2A 1PSFA 1GBQA 1ZUYA 2M16A 5GMKi 3RKYA 2D9TA 3EHQA 1BU1A 3AHUA 3X26B 4KGZB 2L8DA 5CVIA 2KGTA 3VUBA 3OYKA 1PG5B 1M90U 2YDLA 4KGXB 3OY9A 2FPDA 4AFZC 2FG0A 1IREB 3OW2P 1K0XA 4QQ6A 1VQ4Q 4RTVA 2XHCA 2OX7A 3LW5E 3QJ6A 4DBFA 5I11A 1VQKQ 3GPLA 5GAOq 2ECZA 4LDXA 1WIEA 2EGCA 1ZBJA 4C8QF 3H41A 1OYXA 5LJ5j 5IXBA 1H641 2VB6A 1N8RC 4QT7A 1YI2Q 4OMPA 4NL2A 3R6NA 3A5ZB 1YCYA 1LPLA 2BE9B 2JJ9A 2J6OA 1Q81C 1ZSZB 4A4FA 4MMLA 1G2BA 3QWXX 3CCSA 2KXDA 3TREA 4E7JA 2EKOA 4N0AC 1CKBA 4JJBA 1B7TA 2CP3A 4C8QB 1U1SA 2MPXC 4XTVA 1BBZA 2YWWA 2YUOA 2EIFA 3JCMg 1U1TA 1GCPA 1T0HA 1G83A 1M1FA 3LH5A 3META 2CREA 4J83A 4ZN1A 1YJWQ 3CCVQ 1TTHB 2RI5A 3A8OB 3SEMA 4CC2A 3ZBDA 3O8VA 2KBTA 3E9GA 4A4GA 1Q86R 1F1BB 3M0SA 4PJOG 4E2FB 1OV3A 4OF1A 2FYKA 3CXCA 1TH7A 1VQMT 1N9RA 3BDLA 1WGSA 2KAFA 4Z02A 3G71A 2KRNA 2ZGWA 2L89A 5GANf 2CT3A 4RMOA 4PFPA 2CP6A 3CCET 3QZ5B 3M59A 4XAXB 1X01A 3BE3A 2VKNA 1QKXA 1N6AA 4LDVA 3M0PA 5KYWA 3NFCA 2NYSA 1AEYA 2HQHA 5J26A 2LJ3A 3OYGA 5IN1A 4O6JA 1MHNA 3GNFB 3CCUA 2FZKB 5DM7R 2EQMA 2Y4XA 3O5ZA 2EJFA 4F7UA 2DRMA 4PJMA 4XU3A 4Y91A 1FMKA 4KRTA 3L2RA 3HRUA 2DE0X 1QKWA 2LTOA 1YIJQ 1W2BS 1O9SA 4FSXA 3JB9D 3CC7Q 4J9CA 1QVPA 1LOJA 2L5QA 2LQWA 3E2UA 3FJ5A 1VQ8T 4JRIA 1SG5A 1D09B 2QDYB 1M4ZA 2K57A 2RQRA 4HVWA 5CKBA 4C92D 2RK2A 1KIKA 3OYIA 2QDLA 1M30A 2VXEA 2EPDA 2H3EB 2MWOA 1M9SA 2GQVA 1K73R 4ZNXA 1MMNA 4MZPA 1ZSZC 4L59A 2EKHA 1VQ9A 3EFOA 4TVRA 2EWNA 1Y7XA 2FVUA 1UUEA 1BIBA 2XG8D 4F7UF 3OW2S 4C8QC 1HK9A 2PTKA 1BK2A 5KYWB 2RO0A 2JW4A 4BE0A 4M7AD 2VVKA 4ESRA 1ZX6A 2KT8A 3QYHB 4OGCA 2KRSA 1NJIU 5I2MA 1HD3A 4F7UB 1VQOA 4ANJA 2X4XA 3EGXA 5GAN6 1TUGB 4WTOB 3DLLA 3CD6A 1UFFA 1JJ2A 3I55Q 2KEAA 3H0HA 2BIVA 2BKDN 2CDTA 2VYTA 1PKSA 1JJ2P 4M75A 4M78D 3A1PA 4F17A 2FB7A 5DLQE 4EMGA 1PRMC 2BE7D 2RI3A 3VU3C 3PGGA 2RH2A 3CMAQ 4PLLA 1M8VA 2XU8A 3PFSA 1NBEB 4LDUA 2CZ0B 3KBGA 2PVDB 3CC2A 3EFOB 4JPBW 2DXCA 4RTWA 4N4HA 3FB9A 3VJPA 3NTIA 3JCMd 4LDWA 4M7DA 2RQWA 3CCJA 2E5QA 2QQSA 2YHTA 3OYLA 2DEQA 4HA8A 1KK7A 1I1JA 1PHTA 5IHIA 2CZ6B 2Y4YA 1FMWA 1M1KU 3LX7A 2HZYA 3L2UA 1TUDA 2RJCA 5GAMe 5D6WA 1FMVA 1VQLQ 4M77A 2EGEA 1YJ9A 4M75F 3EGXB 1N8RU 3VS1A 4J5YA 2K3XA 3X25B 4LUDA 1IRXA 2J7IA 5A0LA 5LJ5d 2BZXA 5CKFA 5HK3A 4J7FA 4OB3B 1SRMA 4M75B 4XTUA 4Z88A 1BI2A 4M7DF 4C8QE 2DZ9A 3EG9A 2F2VA 2E6NA 1YFNA 1M8MA 5EG2A 1AT1B 3OMCA 4D8DA 3I56A 4D6WA 1X27A 1ACMB 2COYA 3M0RA 3ASKA 1YBYA 4ZGEB 5LJ5h 5KYUA 1GBRA 4M7DB 2IIMA 3FJPA 2K3YA 4IUTA 4BD3A 5J39A 1NEBA 4R56A 5FU7B 2W10A 3X24B 4RG8A 2AT1B 3JB9H 2DL3A 4X9DA 5IHNA 1Q7YR 2ENMA 1MMAA 1SHFA 1W4SA 2D8HA 5GANe 3SD4A 4QVDA 2DPPB 2RJFA 2DX1A 1T3SA 1UEBA 3LGFA 4DBRA 2K3BA 3NTHA 1AWWA 2YRVA 3E19A 5FLXE 4XTXA 1FXXA 1K9MC 1OZ3A 1MGQA 2MOXA 3CCLQ 2YLCA 4BI8B 2ROLA 4DBHA 3CCMQ 2PU9B 3UA7A 1M90R 2GF7A 1WI7A 4PJOC 1VQPA 1GL5A 5L8RE 3M58A 4AFSC 1YHQQ 4C0GA 1D1AA 3H6ZA 3QJYA 2GFAA 4JRKA 2OTLA 3EG9B 2O4XA 2E6ZA 3G4SQ 4ELYC 3JCMP 2EGAA 3E9FA 2D1XA 2V8IA 1VQ5Q 1CKAA 4J7IA 5KYUB 1UJYA 2LQKA 2E1HA 1K1ZA 1M1GA 1TG0A 2DJQA 1KD1C 5GMKl
chains in the Genus database with same CATH topology
3N5BB 3JB9I 4BI4A 4C92C 1M90U 2OTJA 4MMKA 3X28B 3TEEA 4E47A 3ME9A 3OY9A 2X4WA 3HRSA 1YHQA 4KT0E 2M0OA 5FU6C 4BACA 4QVZA 1IREB 3GF5A 3CBMA 1QVGS 3MP8A 4QQ6A 5GAN2 2DK3A 3J7AF 4C0DC 2XHCA 4A54A 2R5AA 5I2SA 3LW5E 2HNIA 3QJ6A 3OSVA 3P8HA 2EAYA 3G4SA 3GPLA 1OI1A 5GAOq 3QO3A 4IURA 4J6WA 5CAIA 1Q82U 3OYLA 2RB6A 5KH6A 3CEYA 4R55A 4E7LA 1IZ6A 3FLGA 3OYYA 4ZN3A 4LDXA 1VQ6T 4PKCC 3WXMB 1VQ5A 2EQJA 4C8QF 3SWNA 1OYXA 5LJ5j 1H641 2RHXA 1N8RC 2EJ9A 2WSCE 3M4GA 5IAYA 2LVMA 5LJ3e 4NL2A 3A5ZB 3FRNA 3INZA 1YCYA 1UGQB 1WQWA 2QXFA 4M7AC 1Q81C 5CKHA 4Q5WA 4E7IA 2EFIA 3G7ZA 4A4FA 4MMLA 1VQ9T 1YIJT 1QVFA 2KSSA 4ZTFA 3CCSA 1M90C 2L3RA 3E1SA 3R6OA 3TREA 3CC7T 2DTHA 5A2QE 4E7JA 4JDSA 2MMPA 2EKOA 4P5NA 3LLRA 4M77F 4N0AC 4C5IA 4HT8A 3EAEA 5GANg 3OMGA 1WJQA 5GAN7 2X35A 4C8QB 2ZCFB 5A0DA 3TCJA 1U1SA 2O4XB 4XTVA 5CK9A 5I21A 1UGPB 5GAOm 1VQLT 4PJOA 2EIFA 3DB3A 1I8FA 3HKSA 5CQYA 2MF2A 3JCMg 4C0FA 4FU6A 1VQ4A 1U1TA 1UB4A 1Q82C 1M1FA 4BB7A 5CO7A 3I56T 4JS4A 3META 4QVCA 3CC4A 3GIBA 3EFRA 1KQ1A 2ZPBB 1D3BA 3PMIA 4J83A 3RESA 3UWNA 4ZN1A 1QP3A 3HRTA 4JLGA 4B9WA 5IT9E 2DIQA 2RI5A 3A8OB 4M77B 1VQOT 4XU2A 2B8AA 4OB0B 2XDBA 3ZBDA 3O8VA 3E9GA 2LT1A 4A4GA 1P92A 1YI2A 2P0QA 4A53A 1VQ7A 3QIIA 3HHTB 4PJOG 1Y96A 3CCQT 3CD6T 4OF1A 2FYKA 5GAMh 3CXCA 4M78C 3V7SA 1TH7A 3V7CA 3LWHA 1VQMT 4C92A 3CBOA 2DVEA 5CR2A 1HXDA 4E7HA 1N9RA 1W2BA 2JNGA 3BDLA 2LCCA 4IUVA 3QPHA 5HKCA 3OYCA 1ZBXA 3GOXA 5A0GA 1WGSA 2KAFA 1QVFS 3UT1A 4Z02A 3G71A 2E41A 2ZGWA 4N4GA 2L89A 4OMFB 1I5LA 1FWZA 1BI0A 2LRQA 2DD4A 5GANf 4PJOE 2RHZA 4A4KA 4RMOA 4PJOF 4RKUE 2QA4T 2HAXA 1ZHIA 1BIAA 4II1A 3CCET 3QZ5B 5GMKh 3M59A 1WJRA 1X01A 4XAXB 5M9OA 3JB9G 1H3ZA 4FT2A 5GMKm 3CCRA 2K5FA 3G6EA 2D0QB 1N6AA 3OQ5A 2WSEE 4LDVA 1YJWA 5FROA 1UGSB 3SWNB 4GLKA 4PL6A 3S3NA 3BW1A 2E12A 4PJOD 1S72A 2Y90A 3NFCA 4RCCA 5J26A 3OYGA 1B34A 3QUIA 5IN1A 1VQPT 4O6JA 4M7AA 1MHNA 3GNFB 3CCUA 4PJOB 3NTKA 3CC2T 2A3LA 4A4HA 5DM7R 2OAUA 3OSSC 4C92G 2EQMA 3HL8A 3J81E 3I55T 3L2WA 3JB9F 1XQHA 2Y4XA 2VXFA 4CI0C 2DD5A 1JB0E 2EJFA 3JCMc 4ELZC 4F7UA 4N0AA 3CCJT 4XU3A 1Q86U 1XNIA 2P4TA 2ZPIB 2DXTA 4OVAA 3JCMV 2P0KA 4Y91A 4NL3A 3CXCS 2XIDA 3L2RA 3HRUA 3UPUA 2NLUA 2XDPA 3J80E 1RI0A 2LTOA 4C0ZA 3OYNA 1W2BS 1O9SA 1N27A 3LYIA 3OW2A 1BYMA 3JRZA 4FSXA 3JB9D 1GXIE 4C92E 3QBYA 2RA2A 3OBYA 2WSFE 1QVPA 1LOJA 2L5QA 1D3BB 4LD9K 1VQ8T 1Y07A 1DJ7B 3C94A 4JRIA 4ME7A 3PIPA 1Q7YC 2F5TX 2M9UA 4MDXA 4BUGA 3RKXA 2QDYB 1QP2A 1M4ZA 2I2LA 2JTMA 4M75E 2K57A 3L1AA 1YJ9T 4M75C 3CMAT 1O75A 4DQ2A 2CS7A 5HK0A 3CCMT 4BE2A 5GAMf 5LJ3g 5CKBA 4C92D 2RK2A 5GANh 1BKBA 4M7AG 3OYIA 3KXTA 1Y96B 1KC8C 5GAN4 3KUFA 3S6WA 4GY5A 2VXEA 4M78A 1N9SA 4BDYA 3A8MB 2OTJT 3HP9A 3JCMX 4QQGA 1Q86C 3JCMh 1X6OA 1YHQT 1VQNA 3VKIA 4F7UG 2MWOA 1M9SA 4V2SA 2GQVA 2MWPA 2XK0A 2E70A 3M53A 3MHXA 5FU6B 3VYGA 5GMKe 2XDDA 3A8HB 3M55A 4HCCA 2GFUA 1JJ2S 4M7AE 3DB4A 3FC3A 4MZPA 4C0DB 5KE2A 4L59A 4HCBA 3ER0A 4J6YA 5GAMd 4J8OA 5GAN3 5GAN5 1VQ9A 4OGEA 3C4SA 1YIJA 2K2VA 4TVRA 5CCAA 2EWNA 1Y7XA 2FVUA 2FL7A 4F7UE 1LJOA 3CC7A 4M7DC 1BIBA 2XG8D 2CZ7B 4F7UF 1VQ5T 4XTZA 3OW2S 4C8QC 5FU7C 1HK9A 2R5MA 4M7DE 3RKWA 3OYJA 2RO0A 4BE0A 4M7AD 1NPPA 3QKJA 2P0PA 2RHIA 3MEAA 1VQKA 4WF2A 3OA6A 2DJZA 2JVVA 3C95A 3F70A 5GAN8 1KQ2A 2DZCA 3QYHB 5GAOr 3FEOA 4OGCA 3JSCA 4M78G 2FHDA 4BY6B 2ZZDA 4DA4A 3MEUA 1KG1A 1KQSA 5GAMj 4IUPA 1NJIU 5I2MA 2RD1A 5J3BA 3OS1A 4M77C 2QI2A 4F7UB 1VQOA 3L2QA 1NE8A 2X4XA 3M56A 1G3SA 2KDSA 1BI3A 3M5AA 4MZMA 5GAN6 1UGRB 3DLLA 4M78E 3L2VA 3CCQA 3CD6A 1K73U 2HQXA 3CC4T 1JJ2A 4M78F 4VUBA 3V8KA 4JRQA 2R57A 5C6SA 4IKFA 1VQMA 3JAME 5D6XA 2PVOB 2QQ9A 2BIVA 5GMKj 2LDMA 2BKDN 4MDWA 2E64A 2E65A 2VYTA 4JLIA 4M75A 4M78D 4LD6A 5LJ5g 2FB7A 2HQEA 1VQ7T 3MEVA 1YJNT 2QA4A 3CBPA 3MCAB 1QW1A 2VUBA 5DLQE 3JCMf 3CCEA 1WJSA 4EMGA 4M78B 3BDUA 3MO8A 3VU3C 2RI3A 3PGGA 2DTOA 3P8DA 4EMKC 3CCVA 2K4YA 2RH2A 3M54A 4JS5A 5GAOl 3OYHA 1YITT 4PLLA 3PIOA 1M8VA 2XU8A 3DKMA 5CKEA 3PFSA 3M9QA 3L2ZA 3LWIA 4OP0A 3A8LB 1KQSS 1EIFA 2QEXT 4LDUA 1PSEA 1G3YA 2CZ0B 5GANd 3KBGA 2VC8A 4RCBA 2PVDB 3CC2A 2ZPFB 2DXCA 1JBMA 2IVWA 4N4HA 3FB9A 2K5LA 3VJPA 3NTIA 2EJGA 3CMET 2ZPGB 3JCMd 2ZPEB 4LDWA 2JTFA 3I55A 4L6V5 2PUOB 3PT9A 3QXEB 4FM4B 4M7DA 3CCJA 3QHSA 4XU0A 2E5QA 2QQSA 4C5GA 2OTLT 2YHTA 3T9NA 1LNXA 1VUBA 4C8QA 1X75C 5KE3A 3A8GB 3GLXA 2BUDA 2F5KA 2DEQA 2RM4A 2XICA 4M75G 4NOYA 1S72T 3P8BB 2CZ1B 4HA8A 2PVGB 3C12A 2YLBA 3URGA 2CZ6B 2Y4YA 3WVEB 5KCHA 5GANj 4C92F 3BFMA 5LJ5f 2RI2A 1K8AU 1M1KU 3LX7A 1VQ8A 5CQXA 3L2UA 2RJCA 5GAMe 5D6WA 3OYEA 2XKOC 3CCLT 2XD0A 3V8JA 4M77A 4ATOA 2DXBA 4ZGDB 2RK1A 3CPWA 2KVQG 2RJEA 3QZ9B 1YJ9A 4M75F 3RMSA 3CMAA 1N8RU 4J5YA 1JRIA 1WQ7A 2K3XA 3HFOA 2MI6A 1RL2A 1KHCA 1I4K1 5DLOA 4HCZA 2KQWA 4UC4A 3PMTA 3CPFA 3L42A 3X25B 4RG2A 5AYFA 1WPYA 2IG0A 2VGNA 1FX7A 4M7DG 2CGHA 2K5IA 2RJDA 1G3TA 3VUZA 4C92B 5A0LA 5LJ5d 2KK4A 2RHUA 3FIFA 3OS2A 1VQ6A 4M75D 5CKDA 4C8QG 5CKFA 5HK3A 2D6FA 4XTYA 4QQDA 1ZQ1A 4J7FA 2EQKA 2DTIA 4OB3B 3PTAA 4MZTA 2H3JA 4M75B 4XTUA 4ZGJB 1R8OB 4M7AF 4JUVA 2E10A 3X20B 3OYAA 3G4ST 4C5HA 3WVDB 5CIUA 3SFMA 3SB2A 3S3OA 2PQWA 1K8AC 5GAOn 1BI2A 1M1KC 3RERA 3QSUA 5KCOA 2ZPHB 3GP8A 4M7DF 3V8LA 4C8QE 5FRMA 2LQ8A 4FIBA 4XK8E 4C5EA 4PLIA 1NPRA 4M77G 4FL6A 1VQNT 3BY7A 1WNLA 3OYMA 2DZ9A 4EMKA 2E6NA 2A7YA 3ZEHA 4XQ3A 1VQLA 4Y28E 3S3MA 5EG2A 2PUKB 4LDYA 3HPWA 2MAMA 4XTWA 3OMCA 4NS5A 1B34B 4KBMB 4M7DD 4M7AB 1SSFA 2JUFA 4BY6C 3I56A 2C06A 4D6WA 2LNVA 3CCST 5LJ3f 3CPWS 3OYDA 4C8QD 2LC4A 4M77E 3ASKA 4PNOA 1YBYA 4ZGEB 4EPCA 5LJ5h 4O5VA 1K9MU 4J6XA 4M7DB 2JZ2A 1U8RA 2HBPA 3FJPA 2K3YA 4X34A 4JJNK 4IUTA 4BD3A 3H8ZA 4B9XA 5J39A 4R56A 5FU7B 2LX9A 3X24B 4RG8A 5LL6S 3JB9H 1Y71A 1VQ4T 1M5Q1 1I81A 2DKGA 2V8JA 4X9DA 2DIGA 3JCMQ 1W4SA 4M77D 1VQKT 2GCXA 3SDZA 4KUDK 2QTXA 3LH0A 4BE1A 5LJ3d 5GANe 2O01E 3OYBA 4ZTJA 1AHJB 3SD4A 4QVDA 2DPPB 2RJFA 1Q7YU 4L5GA 1UEBA 3FDRA 3LGFA 2CYZB 4KULA 3JCMe 3QDRB 1NZ9A 1OZ2A 5FRNA 2F69A 1YI2T 2KY9A 3GNGA 2DO3A 2EYQA 4YTLA 3JB9J 1G3WA 3NTHA 1XTDA 2YRVA 2LCLA 3E19A 2DXUA 2WACA 4CRIA 4XTXA 5FLXE 1YJNA 1FXXA 3QYGB 2HD0A 1NJIC 1KHIA 1K9MC 1OZ3A 1MGQA 2X4JA 5D6YA 1XOVA 1VIFA 2YLCA 3M4YA 2M1HA 2QQRA 4BI8B 3SWNC 4DOVA 2VV5A 3VYHB 2G3RA 2X4YA 5LJ3j 3TU4K 1YITA 2PU9B 5HY6A 4BI3A 3G71T 3VV0A 3LGLA 3QG1A 4N4IA 4OB2B 3OB9A 4JRPA 2GF7A 2QQAA 3OS0A 3M57A 2QEXA 3Q1JA 4X9CA 1K73C 3RUXA 2VGMA 4PJOC 1VQPA 5L8RE 2LT4A 3M58A 5C0MA 3JCMb 2EQUA 4EDUA 1KD1U 2KMTA 1QVGA 3RMQA 2R58A 5LJ3h 3CMEA 3CCRT 4C0GA 3H6ZA 4FT4A 3G6ET 3UDCA 3DLMA 3QJYA 2GFAA 2AHJB 4JRKA 4OB1B 3MEWA 4IUUA 3OYFA 3CCVT 1YJWT 2OTLA 4EMKB 5GAMg 2O4XA 3RIRA 5GAOp 3OBWA 2E6ZA 2JOYA 5LJ5e 2CKKA 3JCMJ 4BDZA 1G5VA 2V8KA 4ELYC 3EFSA 3HFNA 2XI9A 3JCMP 3HSBA 3JCMW 4EMHA 3CCUT 3E9FA 4E7KA 5DY9A 2V8IA 3OS5A 1KC8U 4J7IA 3ZFJA 1VIEA 3V7RA 2QQBA 4DOWA 4QW2A 1PSFA 4IUQA 3CCLA 2M16A 5GMKi 2LQKA 3RKYA 4KUIA 4HT9A 3PNWC 2D9TA 2RHYA 4HKEA 2E1HA 3CCMA 2DAQA 3AHUA 2JN0A 3X26B 1M1GA 4XU1A 3MP6A 2L8DA 3MP1A 4A4EA 1BI1A 5CVIA 1KD1C 3VUBA 3OYKA 1V29B 1Q81U 5GMKl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 I;  3BW1 A;  4XQ3 A;  4PJO D;  4C92 C;  2Y90 A;  4MMK A;  4RCC A;  4XTW A;  5GMK j;  1B34 B;  1B34 A;  3QUI A;  4M7D D;  4M7A B;  4M7A A;  2E64 A;  4PJO B;  2E65 A;  5LJ3 f;  4JLI A;  4C92 G;  5GAN 2;  4C8Q D;  4M77 E;  4PNO A;  4M75 A;  4A54 A;  4M78 D;  3JB9 F;  5LJ5 h;  2HNI A;  2VXF A;  4J6X A;  5LJ5 g;  4M7D B;  2FB7 A;  2EJF A;  3FJP A;  3JCM c;  2EAY A;  4N0A A;  4F7U A;  4XU3 A;  5GAO q;  3QO3 A;  4NL3 A;  2DXT A;  4J6W A;  3JCM V;  4Y91 A;  3JCM f;  5CAI A;  2RB6 A;  4EMG A;  4M78 B;  3BDU A;  3JB9 H;  3VU3 C;  3PGG A;  1M5Q 1;  1I81 A;  2DKG A;  2DTO A;  4X9D A;  4EMK C;  4C8Q F;  3JB9 D;  3JCM Q;  3SWN A;  4C92 E;  5LJ5 j;  5GAO l;  1H64 1;  1M8V A;  2EJ9 A;  2RA2 A;  4M77 D;  3M4G A;  3V8K A;  5LJ3 e;  3L2Z A;  1LOJ A;  4NL2 A;  1D3B B;  4OP0 A;  2QTX A;  5LJ3 d;  5GAN e;  4JRI A;  3INZ A;  1YCY A;  4QVD A;  1WQW A;  5GAN d;  4M7A C;  3RKX A;  2VC8 A;  4RCB A;  2I2L A;  4MML A;  4PJO A;  4M75 E;  2K57 A;  3L1A A;  3JCM e;  1JBM A;  4M75 C;  2DTH A;  3FB9 A;  4DQ2 A;  2EJG A;  3JCM d;  5GAM f;  4M7D A;  5LJ3 g;  4M77 F;  4N0A C;  4M7A G;  4C92 D;  5GAN h;  3JB9 J;  4HT8 A;  3QHS A;  4XU0 A;  5GAN g;  1Y96 B;  5GAN 4;  2DXU A;  2YHT A;  1LNX A;  4XTX A;  4C8Q B;  2VXE A;  4C8Q A;  5GAN 7;  1U1S A;  2RM4 A;  1N9S A;  2DEQ A;  4M75 G;  4M78 A;  4NOY A;  4XTV A;  5I21 A;  1MGQ A;  3JCM X;  5GAO m;  4HA8 A;  1I8F A;  2YLC A;  3JCM h;  4F7U G;  3JCM g;  4V2S A;  1U1T A;  3SWN C;  2YLB A;  5LJ3 j;  3GIB A;  4QVC A;  5GMK e;  3EFR A;  1KQ1 A;  5GAN j;  1D3B A;  3BFM A;  3RES A;  4C92 F;  5LJ5 f;  4M7A E;  4X9C A;  5GAM e;  3RUX A;  4PJO C;  3V8J A;  4J6Y A;  4M77 A;  4M77 B;  5GAM d;  5GAN 3;  4XU2 A;  5GAN 5;  3JCM b;  2EWN A;  4F7U E;  4M75 F;  1LJO A;  5LJ3 h;  1BIB A;  4M7D C;  4J5Y A;  1JRI A;  1WQ7 A;  3HFO A;  4A53 A;  4XTZ A;  4PJO G;  4F7U F;  1Y96 A;  4JRK A;  4C8Q C;  2FYK A;  1I4K 1;  1HK9 A;  5GAM h;  4M78 C;  3RKW A;  4EMK B;  5GAM g;  3RIR A;  5GAO p;  3V7S A;  4M7A D;  1TH7 A;  3V7C A;  1WPY A;  5LJ5 e;  4M7D G;  3JCM J;  2CGH A;  4C92 B;  2DVE A;  4WF2 A;  1HXD A;  4C92 A;  3EFS A;  2DJZ A;  1N9R A;  3HFN A;  3FIF A;  5LJ5 d;  5GAN 8;  4M75 D;  3JCM W;  3JCM P;  1KQ2 A;  2DZC A;  4C8Q G;  5GAO r;  4EMH A;  4M78 G;  5DY9 A;  4XTY A;  2E41 A;  2ZGW A;  1I5L A;  5GAM j;  2DTI A;  3V7R A;  4PJO E;  5GAN f;  4M75 B;  4XTU A;  2RD1 A;  4M7A F;  4JUV A;  4M77 C;  2E10 A;  4PJO F;  4F7U B;  5GMK i;  3RKY A;  4M7D E;  1BIA A;  3SB2 A;  3RER A;  3QSU A;  5GAO n;  4HT9 A;  2E1H A;  5GMK h;  3AHU A;  5GAN 6;  1X01 A;  2JN0 A;  3JB9 G;  4M7D F;  4XU1 A;  3V8L A;  4C8Q E;  5GMK m;  3HSB A;  4M77 G;  4M78 E;  3BY7 A;  1WNL A;  2DZ9 A;  4EMK A;  3SWN B;  4M78 F;  5GMK l; 
#chains in the Genus database with same CATH topology
 3N5B B;  3JB9 I;  4BI4 A;  2OTJ A;  1GFD A;  1C0M A;  4E7S A;  4E47 A;  1ZA1 B;  2HKQ B;  4OML A;  5FU6 C;  2CH4 A;  4BAC A;  2V26 A;  4C0D C;  8ATC B;  2R5A A;  2HBW A;  1WXT A;  3CC4 Q;  3OSV A;  1PD0 A;  2EAY A;  1OI1 A;  3QO3 A;  4IUR A;  4J6W A;  5KH6 A;  3CEY A;  3FLG A;  1TSF A;  3PVL A;  2EBP A;  5KYX B;  3SWN A;  2AZV A;  2EJ9 A;  2WSC E;  5LJ3 e;  3I5S A;  1VQ7 Q;  1C1A A;  3INZ A;  1UGQ B;  5CKH A;  4Q5W A;  4ZTF A;  3R6O A;  2DL7 A;  1AZE A;  2MMP A;  5ECA A;  1M3C A;  4HT8 A;  3EAE A;  2L2P A;  3OMG A;  1WJQ A;  1UEC A;  1YWP A;  1S1N A;  2A36 A;  2O4X B;  5GAO m;  2AK5 A;  5CQY A;  4X1V A;  1VQ4 A;  1Q82 C;  4JS4 A;  3I56 T;  4QVC A;  3EFR A;  3CCR Q;  1VQK A;  1D3B A;  3UWN A;  3G6E Q;  1RUW A;  1E7O A;  4JLG A;  4B9W A;  3ZL7 C;  5IT9 E;  2DYI A;  1WXB A;  1RAG B;  1WDX A;  2LT1 A;  1P92 A;  1YI2 A;  4A53 A;  1TUC A;  3CCQ T;  3HHT B;  1Y96 A;  4LXC A;  3V7S A;  4C92 A;  3CBO A;  5CR2 A;  4K11 A;  2RQV A;  1W2B A;  2PNI A;  2DL8 A;  1QVF S;  3UT1 A;  5GJV B;  1FWZ A;  2LRQ A;  4PJO E;  2DD4 A;  2RN8 A;  1JEG A;  2QA4 T;  2ED0 A;  1W2B P;  1KFZ A;  4II1 A;  4JJD A;  1NEG A;  3GBQ A;  1YJW A;  2WSE E;  1UGS B;  3SWN B;  1AZG B;  3BW1 A;  1SSH A;  4RCC A;  4PJN A;  1NM7 A;  1B34 A;  3QUI A;  1VQP T;  4M7A A;  1LCK A;  2SRC A;  3RNJ A;  1VQN Q;  2NUP A;  5KYN A;  3JB9 F;  2VXF A;  4CI0 C;  2DD5 A;  2FO0 A;  3JCM c;  2P4T A;  4OVA A;  4NL3 A;  2DXT A;  2HSE B;  2W0Z A;  3JCM V;  2CUD A;  2FEI A;  1E6H A;  1RI0 A;  4C0Z A;  1N27 A;  3LYI A;  3OW2 A;  4FYW B;  1GXI E;  1M2V A;  3QBY A;  2RF0 A;  1MMG A;  1D3B B;  3C94 A;  4J9B A;  4MDX A;  4BUG A;  2VAS A;  1QP2 A;  2I2L A;  4M75 E;  1NLP C;  1NJI R;  5GAM f;  1BKB A;  1RLQ C;  1Y96 B;  2A08 A;  3S6W A;  4GY5 A;  1M27 C;  4M78 A;  3A8M B;  3CQT A;  2OTJ T;  3HP9 A;  3EG3 A;  3JCM X;  4QQG A;  1X6O A;  1MV0 B;  4F7U G;  3VS5 A;  4FYV B;  3EH2 A;  4V2S A;  3PE0 A;  2MWP A;  2XK0 A;  2E70 A;  3M53 A;  3MHX A;  4HCC A;  2DER A;  2GGR A;  2GFU A;  2O9V A;  4J6Y A;  4J8O A;  1VQM Q;  1YIJ A;  2FPE A;  5CCA A;  2FL7 A;  3CC7 A;  4AFU C;  2YUQ A;  2X3X D;  2EYW A;  4PFZ A;  1OU8 A;  2P0P A;  3OA6 A;  5GAN 8;  1BB9 A;  3CCE Q;  1UTI A;  3JSC A;  2CSI A;  2FHD A;  4BY6 B;  2ZZD A;  3VS4 A;  1PKT A;  5GAM j;  2NUP B;  5J3B A;  2QI2 A;  5GJW B;  4HVV A;  3L2Q A;  3M56 A;  1G3S A;  2HEQ A;  3H0F A;  1MND A;  2KNB B;  3L2V A;  1PM3 A;  2AKK A;  4M78 F;  4VUB A;  4JRQ A;  1H8K A;  1M2V B;  2YUN A;  2O88 A;  2R57 A;  5C6S A;  5D6X A;  3HTR A;  2X51 A;  5GMK j;  2LDM A;  2D8J A;  2E64 A;  1M1K R;  5LJ5 g;  1RLP C;  1YJN T;  1VQ8 Q;  4M78 B;  2JTE A;  4RTU A;  4DEX A;  1N8R R;  1OPK A;  5FWC A;  2K4Y A;  1YIT T;  2DYB A;  3M9Q A;  3L2Z A;  3LWI A;  4OP0 A;  2QEX T;  1PSE A;  1MV3 A;  4RCB A;  1JBM A;  1ABQ A;  3CME T;  1OX8 A;  2ZPE B;  3I55 A;  2FPF A;  3QXE B;  4L6V 5;  3TQ7 P;  3QHS A;  4C5G A;  3JCM W;  1VUB A;  1X75 C;  3A8G B;  2RM4 A;  2XIC A;  4M75 G;  2MK5 A;  2PVG B;  2B86 A;  4OMM A;  2KYB A;  1QCF A;  1IGQ A;  2MYS A;  3C12 A;  3URG A;  3WVE B;  5GAN j;  3BFM A;  2DMO A;  2XKO C;  4OMN A;  2HDA A;  2KVQ G;  2LP5 A;  2YSQ A;  4AFQ C;  3CMA A;  1TOV A;  1WQ7 A;  3HFO A;  2QAZ A;  2KQW A;  1ZUK A;  3CPF A;  2IG0 A;  2VGN A;  4M7D G;  2RJD A;  4GLM A;  1G3T A;  3VUZ A;  3OS2 A;  1VQ6 A;  5CKD A;  1OPL A;  1H92 A;  4XTY A;  1ZQ1 A;  2EQK A;  2G6F X;  3PTA A;  2CH4 W;  1NYG A;  2QTV A;  2E10 A;  3OYA A;  4C5H A;  5CIU A;  3SFM A;  1K8A C;  3RER A;  5GAO n;  2ZPH B;  1WYX A;  3GP8 A;  3V8L A;  5FRM A;  1GCQ C;  2LQ8 A;  4FIB A;  4C5E A;  1NPR A;  4M77 G;  4FL6 A;  2E3I A;  3BY7 A;  4EMK A;  2A7Y A;  4XQ3 A;  1VQL A;  3S3M A;  2MAM A;  1WHG A;  3C0C A;  4BY6 C;  2JUF A;  2C06 A;  2KRO A;  3CCS T;  5LJ3 f;  4HCK A;  3OYD A;  4C8Q D;  1Z9Z A;  4EPC A;  4O5V A;  2JZ2 A;  2KI7 A;  1U8R A;  4X34 A;  1X2Q A;  1RAH B;  2LX9 A;  5LL6 S;  1Y71 A;  2DIG A;  1WHH A;  5FW9 A;  2DET A;  2YXY A;  3SDZ A;  4BE1 A;  1X69 A;  2O01 E;  3OYB A;  2O2O A;  1RAB B;  1EX4 A;  2GTJ A;  1H3H A;  4L5G A;  3KFV A;  3JCM e;  1NZ9 A;  2F69 A;  2KY9 A;  3GNG A;  1WHL A;  2DO3 A;  3JB9 J;  4A63 B;  2K7A A;  4CRI A;  2DXU A;  2WAC A;  4LD9 K;  2HD0 A;  1KHI A;  2DL5 A;  5D6Y A;  3M4Y A;  2QQR A;  4DOV A;  3VYH B;  2X4Y A;  5LJ3 j;  2ATC B;  3G71 T;  4N4I A;  4OB2 B;  2DBK A;  3OB9 A;  4JRP A;  4FCY A;  3OS0 A;  3Q1J A;  4X9C A;  2VGM A;  2LT4 A;  4FYY B;  5C0M A;  1UE9 A;  1R0B G;  4EDU A;  3JCM b;  2LZ6 B;  4IUU A;  3OYF A;  4EMK B;  1X6G A;  2CP2 A;  3OBW A;  2JOY A;  5LJ5 e;  3RBB B;  2ED1 A;  2V8K A;  3HSB A;  1M3B A;  1UJ0 A;  2FZG B;  4EMH A;  3CCU T;  2V1Q A;  3EG1 A;  5DY9 A;  4E7K A;  2QGF B;  1VIE A;  3UAT A;  2ESW A;  4DOW A;  1G8X A;  3CCL A;  3PNW C;  4HKE A;  1UDL A;  3RDV A;  4E6R A;  3CCM A;  4XU1 A;  4Y92 A;  3MP6 A;  3MP1 A;  1C6V X;  4FW1 A;  1X43 A;  1V29 B;  1Q81 U;  4MMK A;  1YHQ A;  3ME9 A;  2X4W A;  4KT0 E;  1UHC A;  1AVZ C;  2K2M A;  4QVZ A;  1QVG S;  3MP8 A;  3MPU B;  4A54 A;  5I2S A;  1X2K A;  3P8H A;  3G4S A;  4PFO A;  4R55 A;  4E7L A;  1IZ6 A;  4RUG A;  1VQ6 T;  1OU9 A;  4PKC C;  3WXM B;  2DA9 A;  1VQ5 A;  2EQJ A;  3NPF A;  2J05 A;  5IAY A;  2LVM A;  2VWF A;  1UGV A;  4E7I A;  2EFI A;  1VQ9 T;  1QVF A;  1M90 C;  1W70 A;  2L3R A;  3E1S A;  4J9H A;  2C0T A;  3D7S B;  2C0O A;  2ROT A;  5A2Q E;  4JDS A;  1BCO A;  4M77 F;  1YP5 A;  4PJL A;  4C5I A;  5GAN 7;  2ZCF B;  5CK9 A;  1QVF P;  1UGP B;  3I35 A;  1VQL T;  1KJW A;  3HKS A;  1I8F A;  2MF2 A;  4FU6 A;  2F2W A;  1VYU A;  1UB4 A;  4BB7 A;  1WFW A;  5CO7 A;  4LUE A;  3CC4 A;  3GIB A;  1KQ1 A;  3PMI A;  3RES A;  4HVU A;  3HRT A;  2DVJ A;  4M77 B;  1VQO T;  1S72 Q;  4XU2 A;  4OB0 B;  2JMC A;  3UA6 A;  3THK A;  1IO6 A;  2JT4 A;  3MJX A;  1VQ7 A;  3QII A;  3CD6 T;  4F04 B;  4AT1 B;  5GAM h;  4J9I A;  1OEB A;  2DVE A;  2GBQ A;  2LCC A;  3QPH A;  1K0S A;  2ABL A;  4OMF B;  1I5L A;  2X3W D;  1BI0 A;  4RKU E;  1BIA A;  2M02 A;  5GMK h;  1WJR A;  2OJ2 A;  1H3Z A;  5M9O A;  3JB9 G;  5GMK m;  3CCR A;  2MIO A;  2K5F A;  3G6E A;  4GLK A;  2RPN A;  2QAS A;  4PJO D;  2E12 A;  5EC7 A;  4Z89 A;  1SF9 A;  3NTK A;  3CC2 T;  4A4H A;  3OSS C;  4C92 G;  2LCS A;  1SPK A;  3J81 E;  3L2W A;  1RAF B;  1JO8 A;  3CCJ T;  4N0A A;  1XNI A;  3I5R A;  2BZ8 A;  1Y0M A;  2JS2 A;  2XID A;  3UPU A;  5L23 A;  1BYM A;  2Z0W A;  3JRZ A;  1K76 A;  2RA2 A;  2SEM A;  3OBY A;  4FSS A;  4Z8A A;  4ME7 A;  3PIP A;  4PK4 A;  3RKX A;  2JTM A;  1YJ9 T;  4M75 C;  1O75 A;  4DQ2 A;  1CSK A;  3CCM T;  4BE2 A;  2J06 A;  4JZ4 A;  4M7A G;  3EGD A;  5GAN h;  2DIL A;  1KC8 C;  1N9S A;  4BDY A;  2MCN A;  1YHQ T;  1VQN A;  3VKI A;  4AG1 C;  2L3Q A;  3VYG A;  2XDD A;  3M55 A;  2LQN A;  2KXC A;  3CCQ Q;  3FC3 A;  2OAW A;  2DL4 A;  4HCB A;  3ER0 A;  5GAN 3;  5GAN 5;  3C4S A;  2K2V A;  4F7U E;  1NLO C;  2I0N A;  4M7D C;  2CZ7 B;  1VQ5 T;  4XTZ A;  1IHV A;  2CSQ A;  5FU7 C;  3EHR A;  1EFN A;  1W1F A;  2QG9 B;  2QA4 Q;  2JVV A;  3C95 A;  3F70 A;  4OMQ A;  2DZC A;  5GAO r;  1V1C A;  4M78 G;  1IB8 A;  3MEU A;  2GTO A;  1KG1 A;  4IUP A;  3H9N A;  2RD1 A;  3OS1 A;  4M77 C;  3EH1 A;  1NE8 A;  4HXJ A;  2KDS A;  1BI3 A;  1BCM A;  1VQP Q;  1UGR B;  1M2O A;  1K9A A;  1WHJ A;  4R0K A;  1QLY A;  2KT1 A;  3CC4 T;  2BZY A;  4IKF A;  1VQM A;  4FW2 A;  3EGU A;  1I0C A;  2LX7 A;  2E65 A;  1D1B A;  3QDF A;  2HQE A;  1VQ7 T;  3MEV A;  3EGD B;  1D1C A;  2L3S A;  3CBP A;  3MCA B;  1QW1 A;  2VUB A;  3JCM f;  2COZ A;  2L3P A;  1WJS A;  3CCE A;  3MO8 A;  1N5Z A;  3CCV A;  3M54 A;  3NMZ C;  5GAO l;  2O9S A;  5CKE A;  1KQS S;  1OUL A;  1EIF A;  1RI9 A;  1ZSZ A;  2VC8 A;  1W6X A;  5IHK A;  2K5L A;  1YCS B;  1Y57 A;  2ZPG B;  1ZUU A;  4F14 A;  2HL5 C;  3IQL A;  2PUO B;  2OTL T;  4XU0 A;  4C8Q A;  1ZSG A;  5KE3 A;  2F1L A;  3GLX A;  2F5K A;  2A37 A;  3P8B B;  2RNA A;  1PC0 A;  1Q95 G;  5KCH A;  2DF6 A;  4C92 F;  5LJ5 f;  2RI2 A;  1VQ8 A;  3M0U A;  2DEU A;  2DXB A;  2RJE A;  3QZ9 B;  4F16 A;  3RMS A;  1LVK A;  1RL2 A;  1KHC A;  1I4K 1;  5DLO A;  1UHF A;  4UC4 A;  5AYF A;  4C92 B;  2K5I A;  2P4R A;  1Q86 C;  2KK4 A;  2RHU A;  2XMF A;  3FIF A;  1TS9 A;  4ZGJ B;  4M7A F;  4JUV A;  3X20 B;  4M7D E;  1M1K C;  1SRL A;  2LNH B;  1OQK A;  2JMA A;  4XK8 E;  1VQN T;  4PLI A;  1TU0 B;  2EQI A;  1ABO A;  1WNL A;  2HL3 A;  3OYM A;  1YN8 A;  3M0Q A;  3ZEH A;  2COW A;  1RAA B;  3HPW A;  1YJN Q;  3H0I A;  1B34 B;  1TWB A;  4M7A B;  3CPW S;  4M77 E;  1K9M U;  4J6X A;  1YIT Q;  2HBP A;  4JJN K;  3H8Z A;  4IIO A;  4B9X A;  1T3L A;  2V1R A;  3M0T A;  2QEX Q;  2HMA A;  4DBQ A;  1VQ4 T;  1M5Q 1;  1I81 A;  2A0F B;  2DKG A;  4E7Z A;  3NHN A;  2QK0 A;  4RTY A;  3CME Q;  3TSZ A;  1D0Y A;  1R77 A;  1VQK T;  2AIR B;  2GCX A;  5IH2 A;  1AHJ B;  4ZTJ A;  2AKL A;  3FDR A;  2HSP A;  4KH0 B;  4KUL A;  2CYZ B;  3QDR B;  2HKN A;  4QKU A;  1YI2 T;  2DLP A;  1M3A A;  2EYQ A;  3QYG B;  4DEY A;  1VYT A;  2CT4 A;  1VIF A;  1RAI B;  2M1H A;  3SWN C;  2RQT A;  1V76 A;  1AWX A;  1Q81 R;  4BI3 A;  2NUT A;  3A98 A;  3LGL A;  3CXC P;  2QQA A;  1K73 C;  2EYX A;  1KD1 U;  2EQU A;  2KMT A;  1QVG A;  1UG1 A;  2R58 A;  4FT4 A;  1IHW A;  2E5K A;  3DLM A;  1VOM A;  2AHJ B;  3CCV T;  1YJW T;  5GAM g;  1GFC A;  1QCN A;  2CKK A;  3JCM J;  1QVG P;  1K4U S;  3EFS A;  4KH1 B;  2CP0 A;  5KYY A;  2M0Y A;  2J6K A;  1TXQ A;  1WA7 A;  2J6F A;  3OS5 A;  1PD1 A;  1KC8 U;  3ZFJ A;  3V7R A;  2C0I A;  2PZ1 A;  4J9F A;  2QQB A;  1MUZ A;  4IUQ A;  2DNU A;  1KSW A;  2KR3 A;  1QCO A;  3VS0 A;  4KUI A;  4HT9 A;  2RHY A;  2DAQ A;  2JN0 A;  3MKD A;  2K6D A;  4A4E A;  1BI1 A;  3CCS Q;  2M51 A;  1YWO A;  4C92 C;  3X28 B;  3TEE A;  3HRS A;  2M0O A;  3GF5 A;  3CBM A;  5FWB A;  5GAN 2;  3J7A F;  2DK3 A;  2HNI A;  1Q82 U;  5CAI A;  2D0N A;  2RB6 A;  2KE9 A;  3OYY A;  4ZN3 A;  2DFU A;  1A0N B;  1SHG A;  2DM1 A;  2E4H A;  2EVR A;  2RHX A;  2GQI A;  3M4G A;  2NUT B;  5D7U A;  3FRN A;  1WQW A;  4M7A C;  2QXF A;  8AT1 B;  4FYX B;  3G7Z A;  4CC4 B;  4PJO A;  1YIJ T;  2KSS A;  3CC7 T;  2DTH A;  4P5N A;  3LLR A;  1HYO A;  3G71 Q;  3I9Q A;  5GAN g;  2X35 A;  5A0D A;  1QMC A;  3TCJ A;  5I21 A;  3DB3 A;  2A28 A;  4C0F A;  2YRD A;  2LJ0 A;  5KYY B;  1MMD A;  2ZPB B;  4WCI A;  1QP3 A;  2DIQ A;  3VRY A;  2B8A A;  2XDB A;  5AT1 B;  1B3Q A;  4AG2 C;  2X9H A;  1VYV A;  2P0Q A;  3CCU Q;  1U3O A;  1WZO A;  1D0Z A;  4M78 C;  3QWY A;  3V7C A;  3LWH A;  1HXD A;  2K79 A;  4E7H A;  3VS3 A;  2JNG A;  3OYC A;  4IUV A;  5HKC A;  1ZBX A;  3GOX A;  5A0G A;  1HJD A;  2EW3 A;  1JXO A;  2E41 A;  1I5O B;  4N4G A;  1K8A R;  2RHZ A;  3U23 A;  4A4K A;  4PJO F;  2LMJ A;  2HAX A;  1ZHI A;  1OX9 A;  4FT2 A;  4RTT A;  2D0Q B;  3ULR B;  2CP5 A;  3OQ5 A;  5FRO A;  1ARK A;  1AWJ A;  2YT6 A;  4PL6 A;  3S3N A;  2GNC A;  1AOJ A;  1S72 A;  2Y90 A;  3AT1 B;  4PJO B;  2A3L A;  1VQ6 Q;  1J3T A;  2OAU A;  3HL8 A;  3I55 T;  1XQH A;  1GRI A;  4JZ3 A;  1WXU A;  1JB0 E;  1Q86 U;  4ELZ C;  4J9E A;  2ZPI B;  3CXC S;  2P0K A;  3REA B;  2NLU A;  2XDP A;  2JM9 A;  3J80 E;  1VQ9 Q;  3OYN A;  2JS0 A;  4C92 E;  2RQU A;  2WSF E;  1JXM A;  4PJJ A;  2CP7 A;  1Y07 A;  1DJ7 B;  1Q7Y C;  4CC7 A;  2F5T X;  2M9U A;  1NG2 A;  2ZAE A;  2FZC B;  3L1A A;  9ATC B;  3CMA T;  5HK0 A;  2CS7 A;  2K9G A;  5LJ3 g;  5I22 A;  1YNZ A;  1JQQ A;  3KXT A;  5GAN 4;  3KUF A;  3TSW A;  1R0C B;  2YRC A;  1VQO Q;  3JCM h;  2LJ1 A;  2JM8 A;  5FU6 B;  5GMK e;  1XJW B;  3VRZ A;  3A8H B;  1RAD B;  4M7A E;  3CD6 Q;  3DB4 A;  4C0D B;  5KE2 A;  5GAM d;  4OGE A;  1WHK A;  2IPO B;  1IGU A;  1E6G A;  1LJO A;  1WHM A;  4LNP A;  2H8H A;  2R5M A;  3RKW A;  3OYJ A;  1NPP A;  3QKJ A;  2RHI A;  3MEA A;  4WF2 A;  2DJZ A;  1KQ2 A;  4LE9 A;  3FEO A;  4DA4 A;  1QWF A;  2YUP A;  1KQS A;  1JU5 C;  2EYZ A;  4JJC A;  3M5A A;  4MZM A;  1PCX A;  1KQS P;  1QQJ A;  4M78 E;  3CC2 Q;  3CCQ A;  1WX6 A;  1K73 U;  2HQX A;  3V8K A;  2JXB A;  4EIK A;  3CCJ Q;  3JAM E;  2DBM A;  2PVO B;  2QQ9 A;  1ZA2 B;  1WLP B;  4MDW A;  1RAE B;  4JLI A;  2RMO A;  2EYY A;  4LD6 A;  4ORZ A;  3EG0 A;  2QA4 A;  1SKU B;  3BDU A;  4CC3 A;  2O31 A;  1SEM A;  5KYX A;  2DTO A;  3P8D A;  4EMK C;  3G1J A;  1YJ9 Q;  4JS5 A;  1U5S A;  3OYH A;  3PIO A;  3DKM A;  1AD5 A;  4GBQ A;  3A8L B;  4RTX A;  5IXF A;  1G3Y A;  5GAN d;  2FRW A;  2ZPF B;  7AT1 B;  2IVW A;  4AMC A;  2EJG A;  1D0X A;  2JTF A;  3PT9 A;  4FM4 B;  3PVQ A;  3T9N A;  1LNX A;  1X6B A;  5HCK A;  1JJ2 S;  3JV3 A;  2BUD A;  4NOY A;  4J9D A;  1S72 T;  2CZ1 B;  2NWM A;  1I07 A;  2YLB A;  1ZLM A;  1IXD A;  3TVT A;  2OI3 A;  4IIM A;  1K8A U;  2NUZ A;  5CQX A;  1B07 A;  3OYE A;  2KYM A;  3CCL T;  2XD0 A;  4LN2 A;  3V8J A;  4ATO A;  4ZGD B;  2RK1 A;  3CPW A;  1RAC B;  4RTZ A;  1PNJ A;  1K9M R;  3I56 Q;  1MNE A;  1JRI A;  2MI6 A;  4HCZ A;  3PMT A;  3L42 A;  4RG2 A;  1QWE A;  1WPY A;  1FX7 A;  2CGH A;  3CPW P;  1PRL C;  1U06 A;  4M75 D;  3NGP A;  4C8Q G;  2D6F A;  4QQD A;  1FYN A;  2L0A A;  1VA7 A;  2DTI A;  4MZT A;  2H3J A;  2F2X A;  1R8O B;  3G4S T;  3WVD B;  3SB2 A;  1EZZ B;  2PQW A;  3S3O A;  3QSU A;  5KCO A;  2QGG A;  4Y28 E;  2PUK B;  4LDY A;  2HCK A;  4XTW A;  4NS5 A;  4KBM B;  4M7D D;  1SSF A;  3EG2 A;  2LNV A;  2LC4 A;  4PNO A;  3RR6 A;  2E3H A;  1KD1 R;  1HSQ A;  2V8J A;  3JCM Q;  6AT1 B;  4M77 D;  2CUB A;  4KUD K;  2QTX A;  3LH0 A;  3VS6 A;  5LJ3 d;  4KGV B;  2OTL Q;  4D8K A;  3REB B;  1KC8 R;  1AWO A;  1OZ2 A;  5FRN A;  2AZS A;  3UF4 A;  2BTT A;  4YTL A;  1G3W A;  2DRK A;  1XTD A;  2LCL A;  1YJN A;  1NJI C;  3VS7 A;  2X4J A;  3SHW A;  1XOV A;  1OOT A;  4OMO A;  2VV5 A;  3TU4 K;  2G3R A;  2QYZ A;  1YIT A;  5HY6 A;  3VV0 A;  3QG1 A;  1Z9Q A;  3M57 A;  2QEX A;  2FRY A;  3RUX A;  2OTJ Q;  1NYF A;  3RMQ A;  4B6M A;  5LJ3 h;  3CME A;  3CCR T;  3G6E T;  3UDC A;  1GCQ A;  1Q7Y U;  2P84 A;  4OB1 B;  3MEW A;  1Q82 R;  3RIR A;  5GAO p;  4BDZ A;  1G5V A;  3HFN A;  2XI9 A;  1PWT A;  2KRM A;  1T0J A;  4M4Z A;  3VS2 A;  4J9G A;  4QW2 A;  1PSF A;  1GBQ A;  1ZUY A;  2M16 A;  5GMK i;  3RKY A;  2D9T A;  3EHQ A;  1BU1 A;  3AHU A;  3X26 B;  4KGZ B;  2L8D A;  5CVI A;  2KGT A;  3VUB A;  3OYK A;  1PG5 B;  1M90 U;  2YDL A;  4KGX B;  3OY9 A;  2FPD A;  4AFZ C;  2FG0 A;  1IRE B;  3OW2 P;  1K0X A;  4QQ6 A;  1VQ4 Q;  4RTV A;  2XHC A;  2OX7 A;  3LW5 E;  3QJ6 A;  4DBF A;  5I11 A;  1VQK Q;  3GPL A;  5GAO q;  2ECZ A;  4LDX A;  1WIE A;  2EGC A;  1ZBJ A;  4C8Q F;  3H41 A;  1OYX A;  5LJ5 j;  5IXB A;  1H64 1;  2VB6 A;  1N8R C;  4QT7 A;  1YI2 Q;  4OMP A;  4NL2 A;  3R6N A;  3A5Z B;  1YCY A;  1LPL A;  2BE9 B;  2JJ9 A;  2J6O A;  1Q81 C;  1ZSZ B;  4A4F A;  4MML A;  1G2B A;  3QWX X;  3CCS A;  2KXD A;  3TRE A;  4E7J A;  2EKO A;  4N0A C;  1CKB A;  4JJB A;  1B7T A;  2CP3 A;  4C8Q B;  1U1S A;  2MPX C;  4XTV A;  1BBZ A;  2YWW A;  2YUO A;  2EIF A;  3JCM g;  1U1T A;  1GCP A;  1T0H A;  1G83 A;  1M1F A;  3LH5 A;  3MET A;  2CRE A;  4J83 A;  4ZN1 A;  1YJW Q;  3CCV Q;  1TTH B;  2RI5 A;  3A8O B;  3SEM A;  4CC2 A;  3ZBD A;  3O8V A;  2KBT A;  3E9G A;  4A4G A;  1Q86 R;  1F1B B;  3M0S A;  4PJO G;  4E2F B;  1OV3 A;  4OF1 A;  2FYK A;  3CXC A;  1TH7 A;  1VQM T;  1N9R A;  3BDL A;  1WGS A;  2KAF A;  4Z02 A;  3G71 A;  2KRN A;  2ZGW A;  2L89 A;  5GAN f;  2CT3 A;  4RMO A;  4PFP A;  2CP6 A;  3CCE T;  3QZ5 B;  3M59 A;  4XAX B;  1X01 A;  3BE3 A;  2VKN A;  1QKX A;  1N6A A;  4LDV A;  3M0P A;  5KYW A;  3NFC A;  2NYS A;  1AEY A;  2HQH A;  5J26 A;  2LJ3 A;  3OYG A;  5IN1 A;  4O6J A;  1MHN A;  3GNF B;  3CCU A;  2FZK B;  5DM7 R;  2EQM A;  2Y4X A;  3O5Z A;  2EJF A;  4F7U A;  2DRM A;  4PJM A;  4XU3 A;  4Y91 A;  1FMK A;  4KRT A;  3L2R A;  3HRU A;  2DE0 X;  1QKW A;  2LTO A;  1YIJ Q;  1W2B S;  1O9S A;  4FSX A;  3JB9 D;  3CC7 Q;  4J9C A;  1QVP A;  1LOJ A;  2L5Q A;  2LQW A;  3E2U A;  3FJ5 A;  1VQ8 T;  4JRI A;  1SG5 A;  1D09 B;  2QDY B;  1M4Z A;  2K57 A;  2RQR A;  4HVW A;  5CKB A;  4C92 D;  2RK2 A;  1KIK A;  3OYI A;  2QDL A;  1M30 A;  2VXE A;  2EPD A;  2H3E B;  2MWO A;  1M9S A;  2GQV A;  1K73 R;  4ZNX A;  1MMN A;  4MZP A;  1ZSZ C;  4L59 A;  2EKH A;  1VQ9 A;  3EFO A;  4TVR A;  2EWN A;  1Y7X A;  2FVU A;  1UUE A;  1BIB A;  2XG8 D;  4F7U F;  3OW2 S;  4C8Q C;  1HK9 A;  2PTK A;  1BK2 A;  5KYW B;  2RO0 A;  2JW4 A;  4BE0 A;  4M7A D;  2VVK A;  4ESR A;  1ZX6 A;  2KT8 A;  3QYH B;  4OGC A;  2KRS A;  1NJI U;  5I2M A;  1HD3 A;  4F7U B;  1VQO A;  4ANJ A;  2X4X A;  3EGX A;  5GAN 6;  1TUG B;  4WTO B;  3DLL A;  3CD6 A;  1UFF A;  1JJ2 A;  3I55 Q;  2KEA A;  3H0H A;  2BIV A;  2BKD N;  2CDT A;  2VYT A;  1PKS A;  1JJ2 P;  4M75 A;  4M78 D;  3A1P A;  4F17 A;  2FB7 A;  5DLQ E;  4EMG A;  1PRM C;  2BE7 D;  2RI3 A;  3VU3 C;  3PGG A;  2RH2 A;  3CMA Q;  4PLL A;  1M8V A;  2XU8 A;  3PFS A;  1NBE B;  4LDU A;  2CZ0 B;  3KBG A;  2PVD B;  3CC2 A;  3EFO B;  4JPB W;  2DXC A;  4RTW A;  4N4H A;  3FB9 A;  3VJP A;  3NTI A;  3JCM d;  4LDW A;  4M7D A;  2RQW A;  3CCJ A;  2E5Q A;  2QQS A;  2YHT A;  3OYL A;  2DEQ A;  4HA8 A;  1KK7 A;  1I1J A;  1PHT A;  5IHI A;  2CZ6 B;  2Y4Y A;  1FMW A;  1M1K U;  3LX7 A;  2HZY A;  3L2U A;  1TUD A;  2RJC A;  5GAM e;  5D6W A;  1FMV A;  1VQL Q;  4M77 A;  2EGE A;  1YJ9 A;  4M75 F;  3EGX B;  1N8R U;  3VS1 A;  4J5Y A;  2K3X A;  3X25 B;  4LUD A;  1IRX A;  2J7I A;  5A0L A;  5LJ5 d;  2BZX A;  5CKF A;  5HK3 A;  4J7F A;  4OB3 B;  1SRM A;  4M75 B;  4XTU A;  4Z88 A;  1BI2 A;  4M7D F;  4C8Q E;  2DZ9 A;  3EG9 A;  2F2V A;  2E6N A;  1YFN A;  1M8M A;  5EG2 A;  1AT1 B;  3OMC A;  4D8D A;  3I56 A;  4D6W A;  1X27 A;  1ACM B;  2COY A;  3M0R A;  3ASK A;  1YBY A;  4ZGE B;  5LJ5 h;  5KYU A;  1GBR A;  4M7D B;  2IIM A;  3FJP A;  2K3Y A;  4IUT A;  4BD3 A;  5J39 A;  1NEB A;  4R56 A;  5FU7 B;  2W10 A;  3X24 B;  4RG8 A;  2AT1 B;  3JB9 H;  2DL3 A;  4X9D A;  5IHN A;  1Q7Y R;  2ENM A;  1MMA A;  1SHF A;  1W4S A;  2D8H A;  5GAN e;  3SD4 A;  4QVD A;  2DPP B;  2RJF A;  2DX1 A;  1T3S A;  1UEB A;  3LGF A;  4DBR A;  2K3B A;  3NTH A;  1AWW A;  2YRV A;  3E19 A;  5FLX E;  4XTX A;  1FXX A;  1K9M C;  1OZ3 A;  1MGQ A;  2MOX A;  3CCL Q;  2YLC A;  4BI8 B;  2ROL A;  4DBH A;  3CCM Q;  2PU9 B;  3UA7 A;  1M90 R;  2GF7 A;  1WI7 A;  4PJO C;  1VQP A;  1GL5 A;  5L8R E;  3M58 A;  4AFS C;  1YHQ Q;  4C0G A;  1D1A A;  3H6Z A;  3QJY A;  2GFA A;  4JRK A;  2OTL A;  3EG9 B;  2O4X A;  2E6Z A;  3G4S Q;  4ELY C;  3JCM P;  2EGA A;  3E9F A;  2D1X A;  2V8I A;  1VQ5 Q;  1CKA A;  4J7I A;  5KYU B;  1UJY A;  2LQK A;  2E1H A;  1K1Z A;  1M1G A;  1TG0 A;  2DJQ A;  1KD1 C;  5GMK l; 
#chains in the Genus database with same CATH homology
 3N5B B;  3JB9 I;  4BI4 A;  4C92 C;  1M90 U;  2OTJ A;  4MMK A;  3X28 B;  3TEE A;  4E47 A;  3ME9 A;  3OY9 A;  2X4W A;  3HRS A;  1YHQ A;  4KT0 E;  2M0O A;  5FU6 C;  4BAC A;  4QVZ A;  1IRE B;  3GF5 A;  3CBM A;  1QVG S;  3MP8 A;  4QQ6 A;  5GAN 2;  2DK3 A;  3J7A F;  4C0D C;  2XHC A;  4A54 A;  2R5A A;  5I2S A;  3LW5 E;  2HNI A;  3QJ6 A;  3OSV A;  3P8H A;  2EAY A;  3G4S A;  3GPL A;  1OI1 A;  5GAO q;  3QO3 A;  4IUR A;  4J6W A;  5CAI A;  1Q82 U;  3OYL A;  2RB6 A;  5KH6 A;  3CEY A;  4R55 A;  4E7L A;  1IZ6 A;  3FLG A;  3OYY A;  4ZN3 A;  4LDX A;  1VQ6 T;  4PKC C;  3WXM B;  1VQ5 A;  2EQJ A;  4C8Q F;  3SWN A;  1OYX A;  5LJ5 j;  1H64 1;  2RHX A;  1N8R C;  2EJ9 A;  2WSC E;  3M4G A;  5IAY A;  2LVM A;  5LJ3 e;  4NL2 A;  3A5Z B;  3FRN A;  3INZ A;  1YCY A;  1UGQ B;  1WQW A;  2QXF A;  4M7A C;  1Q81 C;  5CKH A;  4Q5W A;  4E7I A;  2EFI A;  3G7Z A;  4A4F A;  4MML A;  1VQ9 T;  1YIJ T;  1QVF A;  2KSS A;  4ZTF A;  3CCS A;  1M90 C;  2L3R A;  3E1S A;  3R6O A;  3TRE A;  3CC7 T;  2DTH A;  5A2Q E;  4E7J A;  4JDS A;  2MMP A;  2EKO A;  4P5N A;  3LLR A;  4M77 F;  4N0A C;  4C5I A;  4HT8 A;  3EAE A;  5GAN g;  3OMG A;  1WJQ A;  5GAN 7;  2X35 A;  4C8Q B;  2ZCF B;  5A0D A;  3TCJ A;  1U1S A;  2O4X B;  4XTV A;  5CK9 A;  5I21 A;  1UGP B;  5GAO m;  1VQL T;  4PJO A;  2EIF A;  3DB3 A;  1I8F A;  3HKS A;  5CQY A;  2MF2 A;  3JCM g;  4C0F A;  4FU6 A;  1VQ4 A;  1U1T A;  1UB4 A;  1Q82 C;  1M1F A;  4BB7 A;  5CO7 A;  3I56 T;  4JS4 A;  3MET A;  4QVC A;  3CC4 A;  3GIB A;  3EFR A;  1KQ1 A;  2ZPB B;  1D3B A;  3PMI A;  4J83 A;  3RES A;  3UWN A;  4ZN1 A;  1QP3 A;  3HRT A;  4JLG A;  4B9W A;  5IT9 E;  2DIQ A;  2RI5 A;  3A8O B;  4M77 B;  1VQO T;  4XU2 A;  2B8A A;  4OB0 B;  2XDB A;  3ZBD A;  3O8V A;  3E9G A;  2LT1 A;  4A4G A;  1P92 A;  1YI2 A;  2P0Q A;  4A53 A;  1VQ7 A;  3QII A;  3HHT B;  4PJO G;  1Y96 A;  3CCQ T;  3CD6 T;  4OF1 A;  2FYK A;  5GAM h;  3CXC A;  4M78 C;  3V7S A;  1TH7 A;  3V7C A;  3LWH A;  1VQM T;  4C92 A;  3CBO A;  2DVE A;  5CR2 A;  1HXD A;  4E7H A;  1N9R A;  1W2B A;  2JNG A;  3BDL A;  2LCC A;  4IUV A;  3QPH A;  5HKC A;  3OYC A;  1ZBX A;  3GOX A;  5A0G A;  1WGS A;  2KAF A;  1QVF S;  3UT1 A;  4Z02 A;  3G71 A;  2E41 A;  2ZGW A;  4N4G A;  2L89 A;  4OMF B;  1I5L A;  1FWZ A;  1BI0 A;  2LRQ A;  2DD4 A;  5GAN f;  4PJO E;  2RHZ A;  4A4K A;  4RMO A;  4PJO F;  4RKU E;  2QA4 T;  2HAX A;  1ZHI A;  1BIA A;  4II1 A;  3CCE T;  3QZ5 B;  5GMK h;  3M59 A;  1WJR A;  1X01 A;  4XAX B;  5M9O A;  3JB9 G;  1H3Z A;  4FT2 A;  5GMK m;  3CCR A;  2K5F A;  3G6E A;  2D0Q B;  1N6A A;  3OQ5 A;  2WSE E;  4LDV A;  1YJW A;  5FRO A;  1UGS B;  3SWN B;  4GLK A;  4PL6 A;  3S3N A;  3BW1 A;  2E12 A;  4PJO D;  1S72 A;  2Y90 A;  3NFC A;  4RCC A;  5J26 A;  3OYG A;  1B34 A;  3QUI A;  5IN1 A;  1VQP T;  4O6J A;  4M7A A;  1MHN A;  3GNF B;  3CCU A;  4PJO B;  3NTK A;  3CC2 T;  2A3L A;  4A4H A;  5DM7 R;  2OAU A;  3OSS C;  4C92 G;  2EQM A;  3HL8 A;  3J81 E;  3I55 T;  3L2W A;  3JB9 F;  1XQH A;  2Y4X A;  2VXF A;  4CI0 C;  2DD5 A;  1JB0 E;  2EJF A;  3JCM c;  4ELZ C;  4F7U A;  4N0A A;  3CCJ T;  4XU3 A;  1Q86 U;  1XNI A;  2P4T A;  2ZPI B;  2DXT A;  4OVA A;  3JCM V;  2P0K A;  4Y91 A;  4NL3 A;  3CXC S;  2XID A;  3L2R A;  3HRU A;  3UPU A;  2NLU A;  2XDP A;  3J80 E;  1RI0 A;  2LTO A;  4C0Z A;  3OYN A;  1W2B S;  1O9S A;  1N27 A;  3LYI A;  3OW2 A;  1BYM A;  3JRZ A;  4FSX A;  3JB9 D;  1GXI E;  4C92 E;  3QBY A;  2RA2 A;  3OBY A;  2WSF E;  1QVP A;  1LOJ A;  2L5Q A;  1D3B B;  4LD9 K;  1VQ8 T;  1Y07 A;  1DJ7 B;  3C94 A;  4JRI A;  4ME7 A;  3PIP A;  1Q7Y C;  2F5T X;  2M9U A;  4MDX A;  4BUG A;  3RKX A;  2QDY B;  1QP2 A;  1M4Z A;  2I2L A;  2JTM A;  4M75 E;  2K57 A;  3L1A A;  1YJ9 T;  4M75 C;  3CMA T;  1O75 A;  4DQ2 A;  2CS7 A;  5HK0 A;  3CCM T;  4BE2 A;  5GAM f;  5LJ3 g;  5CKB A;  4C92 D;  2RK2 A;  5GAN h;  1BKB A;  4M7A G;  3OYI A;  3KXT A;  1Y96 B;  1KC8 C;  5GAN 4;  3KUF A;  3S6W A;  4GY5 A;  2VXE A;  4M78 A;  1N9S A;  4BDY A;  3A8M B;  2OTJ T;  3HP9 A;  3JCM X;  4QQG A;  1Q86 C;  3JCM h;  1X6O A;  1YHQ T;  1VQN A;  3VKI A;  4F7U G;  2MWO A;  1M9S A;  4V2S A;  2GQV A;  2MWP A;  2XK0 A;  2E70 A;  3M53 A;  3MHX A;  5FU6 B;  3VYG A;  5GMK e;  2XDD A;  3A8H B;  3M55 A;  4HCC A;  2GFU A;  1JJ2 S;  4M7A E;  3DB4 A;  3FC3 A;  4MZP A;  4C0D B;  5KE2 A;  4L59 A;  4HCB A;  3ER0 A;  4J6Y A;  5GAM d;  4J8O A;  5GAN 3;  5GAN 5;  1VQ9 A;  4OGE A;  3C4S A;  1YIJ A;  2K2V A;  4TVR A;  5CCA A;  2EWN A;  1Y7X A;  2FVU A;  2FL7 A;  4F7U E;  1LJO A;  3CC7 A;  4M7D C;  1BIB A;  2XG8 D;  2CZ7 B;  4F7U F;  1VQ5 T;  4XTZ A;  3OW2 S;  4C8Q C;  5FU7 C;  1HK9 A;  2R5M A;  4M7D E;  3RKW A;  3OYJ A;  2RO0 A;  4BE0 A;  4M7A D;  1NPP A;  3QKJ A;  2P0P A;  2RHI A;  3MEA A;  1VQK A;  4WF2 A;  3OA6 A;  2DJZ A;  2JVV A;  3C95 A;  3F70 A;  5GAN 8;  1KQ2 A;  2DZC A;  3QYH B;  5GAO r;  3FEO A;  4OGC A;  3JSC A;  4M78 G;  2FHD A;  4BY6 B;  2ZZD A;  4DA4 A;  3MEU A;  1KG1 A;  1KQS A;  5GAM j;  4IUP A;  1NJI U;  5I2M A;  2RD1 A;  5J3B A;  3OS1 A;  4M77 C;  2QI2 A;  4F7U B;  1VQO A;  3L2Q A;  1NE8 A;  2X4X A;  3M56 A;  1G3S A;  2KDS A;  1BI3 A;  3M5A A;  4MZM A;  5GAN 6;  1UGR B;  3DLL A;  4M78 E;  3L2V A;  3CCQ A;  3CD6 A;  1K73 U;  2HQX A;  3CC4 T;  1JJ2 A;  4M78 F;  4VUB A;  3V8K A;  4JRQ A;  2R57 A;  5C6S A;  4IKF A;  1VQM A;  3JAM E;  5D6X A;  2PVO B;  2QQ9 A;  2BIV A;  5GMK j;  2LDM A;  2BKD N;  4MDW A;  2E64 A;  2E65 A;  2VYT A;  4JLI A;  4M75 A;  4M78 D;  4LD6 A;  5LJ5 g;  2FB7 A;  2HQE A;  1VQ7 T;  3MEV A;  1YJN T;  2QA4 A;  3CBP A;  3MCA B;  1QW1 A;  2VUB A;  5DLQ E;  3JCM f;  3CCE A;  1WJS A;  4EMG A;  4M78 B;  3BDU A;  3MO8 A;  3VU3 C;  2RI3 A;  3PGG A;  2DTO A;  3P8D A;  4EMK C;  3CCV A;  2K4Y A;  2RH2 A;  3M54 A;  4JS5 A;  5GAO l;  3OYH A;  1YIT T;  4PLL A;  3PIO A;  1M8V A;  2XU8 A;  3DKM A;  5CKE A;  3PFS A;  3M9Q A;  3L2Z A;  3LWI A;  4OP0 A;  3A8L B;  1KQS S;  1EIF A;  2QEX T;  4LDU A;  1PSE A;  1G3Y A;  2CZ0 B;  5GAN d;  3KBG A;  2VC8 A;  4RCB A;  2PVD B;  3CC2 A;  2ZPF B;  2DXC A;  1JBM A;  2IVW A;  4N4H A;  3FB9 A;  2K5L A;  3VJP A;  3NTI A;  2EJG A;  3CME T;  2ZPG B;  3JCM d;  2ZPE B;  4LDW A;  2JTF A;  3I55 A;  4L6V 5;  2PUO B;  3PT9 A;  3QXE B;  4FM4 B;  4M7D A;  3CCJ A;  3QHS A;  4XU0 A;  2E5Q A;  2QQS A;  4C5G A;  2OTL T;  2YHT A;  3T9N A;  1LNX A;  1VUB A;  4C8Q A;  1X75 C;  5KE3 A;  3A8G B;  3GLX A;  2BUD A;  2F5K A;  2DEQ A;  2RM4 A;  2XIC A;  4M75 G;  4NOY A;  1S72 T;  3P8B B;  2CZ1 B;  4HA8 A;  2PVG B;  3C12 A;  2YLB A;  3URG A;  2CZ6 B;  2Y4Y A;  3WVE B;  5KCH A;  5GAN j;  4C92 F;  3BFM A;  5LJ5 f;  2RI2 A;  1K8A U;  1M1K U;  3LX7 A;  1VQ8 A;  5CQX A;  3L2U A;  2RJC A;  5GAM e;  5D6W A;  3OYE A;  2XKO C;  3CCL T;  2XD0 A;  3V8J A;  4M77 A;  4ATO A;  2DXB A;  4ZGD B;  2RK1 A;  3CPW A;  2KVQ G;  2RJE A;  3QZ9 B;  1YJ9 A;  4M75 F;  3RMS A;  3CMA A;  1N8R U;  4J5Y A;  1JRI A;  1WQ7 A;  2K3X A;  3HFO A;  2MI6 A;  1RL2 A;  1KHC A;  1I4K 1;  5DLO A;  4HCZ A;  2KQW A;  4UC4 A;  3PMT A;  3CPF A;  3L42 A;  3X25 B;  4RG2 A;  5AYF A;  1WPY A;  2IG0 A;  2VGN A;  1FX7 A;  4M7D G;  2CGH A;  2K5I A;  2RJD A;  1G3T A;  3VUZ A;  4C92 B;  5A0L A;  5LJ5 d;  2KK4 A;  2RHU A;  3FIF A;  3OS2 A;  1VQ6 A;  4M75 D;  5CKD A;  4C8Q G;  5CKF A;  5HK3 A;  2D6F A;  4XTY A;  4QQD A;  1ZQ1 A;  4J7F A;  2EQK A;  2DTI A;  4OB3 B;  3PTA A;  4MZT A;  2H3J A;  4M75 B;  4XTU A;  4ZGJ B;  1R8O B;  4M7A F;  4JUV A;  2E10 A;  3X20 B;  3OYA A;  3G4S T;  4C5H A;  3WVD B;  5CIU A;  3SFM A;  3SB2 A;  3S3O A;  2PQW A;  1K8A C;  5GAO n;  1BI2 A;  1M1K C;  3RER A;  3QSU A;  5KCO A;  2ZPH B;  3GP8 A;  4M7D F;  3V8L A;  4C8Q E;  5FRM A;  2LQ8 A;  4FIB A;  4XK8 E;  4C5E A;  4PLI A;  1NPR A;  4M77 G;  4FL6 A;  1VQN T;  3BY7 A;  1WNL A;  3OYM A;  2DZ9 A;  4EMK A;  2E6N A;  2A7Y A;  3ZEH A;  4XQ3 A;  1VQL A;  4Y28 E;  3S3M A;  5EG2 A;  2PUK B;  4LDY A;  3HPW A;  2MAM A;  4XTW A;  3OMC A;  4NS5 A;  1B34 B;  4KBM B;  4M7D D;  4M7A B;  1SSF A;  2JUF A;  4BY6 C;  3I56 A;  2C06 A;  4D6W A;  2LNV A;  3CCS T;  5LJ3 f;  3CPW S;  3OYD A;  4C8Q D;  2LC4 A;  4M77 E;  3ASK A;  4PNO A;  1YBY A;  4ZGE B;  4EPC A;  5LJ5 h;  4O5V A;  1K9M U;  4J6X A;  4M7D B;  2JZ2 A;  1U8R A;  2HBP A;  3FJP A;  2K3Y A;  4X34 A;  4JJN K;  4IUT A;  4BD3 A;  3H8Z A;  4B9X A;  5J39 A;  4R56 A;  5FU7 B;  2LX9 A;  3X24 B;  4RG8 A;  5LL6 S;  3JB9 H;  1Y71 A;  1VQ4 T;  1M5Q 1;  1I81 A;  2DKG A;  2V8J A;  4X9D A;  2DIG A;  3JCM Q;  1W4S A;  4M77 D;  1VQK T;  2GCX A;  3SDZ A;  4KUD K;  2QTX A;  3LH0 A;  4BE1 A;  5LJ3 d;  5GAN e;  2O01 E;  3OYB A;  4ZTJ A;  1AHJ B;  3SD4 A;  4QVD A;  2DPP B;  2RJF A;  1Q7Y U;  4L5G A;  1UEB A;  3FDR A;  3LGF A;  2CYZ B;  4KUL A;  3JCM e;  3QDR B;  1NZ9 A;  1OZ2 A;  5FRN A;  2F69 A;  1YI2 T;  2KY9 A;  3GNG A;  2DO3 A;  2EYQ A;  4YTL A;  3JB9 J;  1G3W A;  3NTH A;  1XTD A;  2YRV A;  2LCL A;  3E19 A;  2DXU A;  2WAC A;  4CRI A;  4XTX A;  5FLX E;  1YJN A;  1FXX A;  3QYG B;  2HD0 A;  1NJI C;  1KHI A;  1K9M C;  1OZ3 A;  1MGQ A;  2X4J A;  5D6Y A;  1XOV A;  1VIF A;  2YLC A;  3M4Y A;  2M1H A;  2QQR A;  4BI8 B;  3SWN C;  4DOV A;  2VV5 A;  3VYH B;  2G3R A;  2X4Y A;  5LJ3 j;  3TU4 K;  1YIT A;  2PU9 B;  5HY6 A;  4BI3 A;  3G71 T;  3VV0 A;  3LGL A;  3QG1 A;  4N4I A;  4OB2 B;  3OB9 A;  4JRP A;  2GF7 A;  2QQA A;  3OS0 A;  3M57 A;  2QEX A;  3Q1J A;  4X9C A;  1K73 C;  3RUX A;  2VGM A;  4PJO C;  1VQP A;  5L8R E;  2LT4 A;  3M58 A;  5C0M A;  3JCM b;  2EQU A;  4EDU A;  1KD1 U;  2KMT A;  1QVG A;  3RMQ A;  2R58 A;  5LJ3 h;  3CME A;  3CCR T;  4C0G A;  3H6Z A;  4FT4 A;  3G6E T;  3UDC A;  3DLM A;  3QJY A;  2GFA A;  2AHJ B;  4JRK A;  4OB1 B;  3MEW A;  4IUU A;  3OYF A;  3CCV T;  1YJW T;  2OTL A;  4EMK B;  5GAM g;  2O4X A;  3RIR A;  5GAO p;  3OBW A;  2E6Z A;  2JOY A;  5LJ5 e;  2CKK A;  3JCM J;  4BDZ A;  1G5V A;  2V8K A;  4ELY C;  3EFS A;  3HFN A;  2XI9 A;  3JCM P;  3HSB A;  3JCM W;  4EMH A;  3CCU T;  3E9F A;  4E7K A;  5DY9 A;  2V8I A;  3OS5 A;  1KC8 U;  4J7I A;  3ZFJ A;  1VIE A;  3V7R A;  2QQB A;  4DOW A;  4QW2 A;  1PSF A;  4IUQ A;  3CCL A;  2M16 A;  5GMK i;  2LQK A;  3RKY A;  4KUI A;  4HT9 A;  3PNW C;  2D9T A;  2RHY A;  4HKE A;  2E1H A;  3CCM A;  2DAQ A;  3AHU A;  2JN0 A;  3X26 B;  1M1G A;  4XU1 A;  3MP6 A;  2L8D A;  3MP1 A;  4A4E A;  1BI1 A;  5CVI A;  1KD1 C;  3VUB A;  3OYK A;  1V29 B;  1Q81 U;  5GMK l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...