5GMKm

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 12
structure length 82
sequence length 109
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkm00
2EAYA 2YLBA 4X9DA 4HT8A 2CGHA 4NOYA 4C8QG 4C8QD 2EJFA 5LJ3h 1KQ1A 2DXTA 2RD1A 3FIFA 5GAN3 5GAOq 4M7AG 1N9SA 1U1TA 5LJ3d 3JCMg 5LJ5g 4M77B 5I21A 5GAOm 5GANj 1N9RA 3V8JA 2DKGA 4NL3A 2DEQA 5GAOl 5GANd 5LJ3j 4RCBA 5GAOr 2VXFA 1KQ2A 3JB9H 4XU0A 4MMKA 3JB9D 4M7AE 5LJ3g 4JRKA 5LJ5d 3JCMd 2FB7A 4WF2A 4F7UB 3JCMb 4XTZA 3JCMJ 4M7DE 4C8QC 5GANh 4M78C 4EMGA 1MGQA 1HK9A 4M75A 3V8LA 1BIAA 5GAMg 1WNLA 4M7DF 4EMKB 3BFMA 1M8VA 3BY7A 1JBMA 1D3BB 1B34B 3INZA 4C92C 3L1AA 4M78D 4C8QF 3QO3A 4C92A 5GAMh 4M7DA 5GAMd 4F7UE 5GMKj 4C8QE 1X01A 3BW1A 3SB2A 2DVEA 4M75C 1H641 4M77G 4M78F 2E10A 3JCMP 2I2LA 4PJOB 2DTIA 5GMKl 3GIBA 4PJOD 3RIRA 3V7SA 3HFNA 4M78G 1YCYA 5GAMe 2E41A 1LNXA 4M78A 3M4GA 4M7AF 1WPYA 4PJOC 3JB9F 4XTWA 5GAN8 4J6WA 3JCMW 2VXEA 1Y96A 4J6XA 4XU2A 4M7AA 4M7DG 1B34A 2DTHA 1LOJA 4M77C 1I4K1 4M77A 1I5LA 3V7RA 4M75B 2RM4A 4EMKA 3PGGA 1HXDA 4V2SA 4EMKC 1M5Q1 2EJ9A 4C92B 4M78E 4C92E 4QVCA 2E65A 2HNIA 2DZ9A 4XTVA 4XTXA 3FJPA 4PJOG 5LJ3e 5LJ5j 5GANg 2DJZA 3JCMf 4M78B 4N0AC 1WQ7A 2VC8A 2YHTA 4M75E 4EMHA 5LJ5f 4N0AA 3JCMX 4M77D 3SWNC 4XU3A 4F7UA 4PJOE 3AHUA 3V8KA 5CAIA 3BDUA 2RA2A 3EFRA 2EJGA 5DY9A 4QVDA 4PNOA 5GMKe 2QTXA 4F7UF 1D3BA 5GAMf 5GANe 4JRIA 2E1HA 3RESA 4M7DB 3HFOA 3JCMV 4C92G 4XTYA 4M77F 5GAN2 3JB9G 3RERA 2DXUA 4HT9A 3JCMh 3QUIA 2ZGWA 5LJ5h 1I8FA 4C8QB 2RB6A 4XTUA 1I81A 3SWNA 4M75G 3RUXA 3V7CA 2Y90A 2DTOA 1WQWA 4M7AB 3VU3C 4M7AD 3HSBA 4OP0A 4X9CA 1TH7A 5GMKh 4M7DC 5GAN6 5GAN5 4RCCA 2EWNA 5GANf 3L2ZA 4PJOF 3JCMQ 4HA8A 4A53A 4MMLA 1Y96B 5GMKm 3QHSA 3FB9A 4JUVA 1JRIA 2FYKA 3JCMc 4F7UG 5LJ3f 1BIBA 4J6YA 4A54A 1U1SA 4Y91A 4C92F 4J5YA 3EFSA 3RKYA 2E64A 1LJOA 2YLCA 4XU1A 4JLIA 4M77E 4C8QA 3RKXA 5GAN7 3JB9I 3SWNB 5GAMj 3JB9J 5LJ5e 3JCMe 3QSUA 4M7DD 4M75D 4NL2A 2DZCA 2JN0A 4M75F 4DQ2A 4M7AC 4PJOA 5GAN4 4XQ3A 3RKWA 5GMKi 4C92D 5GAOp 5GAOn 2K57A
chains in the Genus database with same CATH superfamily
3M0UA 3EGXB 2EJFA 3I56Q 3CMAT 2RD1A 1N9RA 2XG8D 3OS2A 3VYGA 1X6BA 5KYXA 2OAUA 3JB9D 5LJ5d 1K9MR 4AT1B 1NE8A 2VASA 4IURA 3MP8A 4BI8B 1BCOA 1HD3A 3INZA 2FZKB 3QG1A 1ZA1B 4PFOA 4M77G 2SRCA 2ZZDA 1Q86C 2L89A 2GTJA 3V7SA 3HFNA 2KQWA 4FYWB 2R57A 2J6OA 2YUPA 2GQIA 1EX4A 4J6XA 1AT1B 2BZYA 1VQNQ 2ZCFB 2L2PA 2PVOB 4IUQA 3EGUA 2K3YA 3LH5A 2GFUA 1PRLC 2J6KA 3HKSA 1M5Q1 2HBWA 3LYIA 2ZPHB 2DF6A 4BDYA 5LJ3e 1X75C 5DM7R 1RABB 1Y7XA 4M78B 5I11A 1K9MU 3RMSA 2H3JA 3ER0A 2ABLA 1BCMA 2YRDA 3NMZC 3MJXA 2RJDA 2XMFA 2HCKA 4J9HA 1OX8A 5DY9A 2QASA 2BKDN 3CMEA 2LP5A 2PQWA 4M7DB 1RUWA 3M59A 2LCLA 2Y4YA 4HKEA 5LJ5h 1I8FA 1QMCA 2ECZA 4QQDA 1TU0B 4K11A 2LNHB 3TVTA 3EGDA 5GANf 5D6YA 2RK1A 1UUEA 2L3QA 3EAEA 3EGXA 1AWOA 1IHVA 2A28A 2KEAA 2X9HA 3OYJA 3QKJA 1ABQA 1O75A 4NL2A 4CC2A 1ZSGA 5GMKi 4J9IA 1WHMA 1K9AA 2KMTA 5A0GA 2LT1A 2YUNA 4C8QG 1RLQC 1PKTA 2DXTA 5GAN3 5LJ5g 2C06A 3OYKA 2CP7A 5D7UA 1KQ2A 1I07A 3GNGA 4WTOB 1VQ4A 1KHCA 1H92A 4EMKB 3C12A 3BY7A 1XQHA 2RQTA 3OS0A 1PRMC 2DA9A 1T0JA 1SG5A 2COWA 1M2OA 4QT7A 3QDRB 3I35A 2V26A 2CSIA 2LC4A 4BI3A 1WJRA 3FRNA 3OW2S 3QPHA 2CP6A 2DD4A 2K3XA 3C0CA 4JJBA 5GAN8 1YI2A 3S6WA 1Y96A 3VRYA 4KULA 3M0PA 2QGFB 4BY6B 3CCQT 1YJ9T 4LUDA 3WXMB 2JMCA 3UF4A 3Q1JA 2XD0A 3CCEQ 3REAB 1S72A 1VOMA 2EIFA 3JCMX 4C0DB 1OX9A 1BI2A 4BE0A 4E2FB 1VYUA 2RA2A 3CD6A 2QG9B 2OI3A 2EYXA 4XTYA 1OZ3A 1V1CA 1KFZA 4KGXB 3UWNA 4ANJA 2HEQA 5A0LA 5C0MA 3QWYA 3THKA 2RQUA 5CIUA 4PJOF 2DE0X 2EW3A 2FPEA 2HL5C 3QHSA 1BIBA 1MNDA 1M27C 1SHGA 1UFFA 1AD5A 2YLCA 2FPDA 4C8QA 2KVQG 1YNZA 4HCZA 1IO6A 2ATCB 3PFSA 1YJWT 4ZTFA 2QTVA 3OYNA 3I55A 2EQMA 4A4FA 2K9GA 2RK2A 4LDVA 5FRMA 1M90U 1N27A 1K73C 2DKGA 2YDLA 1WXUA 3ZL7C 2YRCA 2EPDA 5GAOr 3CBPA 4RUGA 2JJ9A 2M9UA 5EG2A 3CC7Q 2EVRA 1NYFA 1KQSP 2DBMA 4C5EA 1PWTA 1E6HA 1RAEB 1FXXA 1JBMA 2BZXA 2QQRA 2LQ8A 2RHZA 1WJQA 4RTXA 3G6EA 1K76A 2LRQA 2E10A 2QK0A 4PJOB 5GMKl 2QEXA 2R58A 3MHXA 3IQLA 2DLPA 2E5KA 1UJYA 1WHGA 2CREA 1QVGP 4DOVA 2V1QA 4XTXA 2PTKA 2LMJA 4N0AA 1X2KA 4M77D 1GBQA 3NFCA 4DBRA 1VQMQ 2B86A 4AMCA 2JUFA 2A37A 5GJWB 3E9GA 3EH2A 4RTZA 3CCQQ 3CCMQ 2E6ZA 5GAN2 3ZFJA 3SDZA 4LD9K 3WVDB 2D8JA 4QQGA 1OQKA 3V7CA 3CCRA 3M0TA 1KG1A 4M7DC 1IRXA 5ECAA 2KXCA 1H3ZA 3GNFB 4DBFA 2MWOA 1Y57A 2FHDA 2MYSA 5KYXB 3SFMA 5GAOq 3CEYA 3NTKA 5GAN7 2QA4A 2G6FX 4M75D 4M75F 4PJOA 2AZSA 2P4RA 2DILA 3E19A 4BI4A 4HVUA 4J9DA 3I5SA 2KE9A 1A0NB 2C0OA 5CKEA 1XTDA 1SSHA 2DRMA 4RCBA 1NPPA 5D6XA 3JCMd 3OSSC 1TSFA 4F7UB 1YHQA 4OB0B 1HJDA 1YITA 3JSCA 2GF7A 3MKDA 3KXTA 4BY6C 3TCJA 2CZ6B 4M75C 1G83A 4DOWA 2DMOA 3DB4A 4M78G 3PVQA 4M7AF 1ZUKA 3G7ZA 4M7DG 2X3WD 1VQLQ 5J26A 4C0FA 1I5LA 3OBWA 2RJFA 3EG2A 1RI0A 1KIKA 2EYQA 4M78E 5KYYB 2E65A 3FJPA 3QWXX 1TUDA 3MP6A 1FX7A 2K3BA 3TSWA 4KH0B 4FIBA 3A8OB 5AYFA 4OMNA 3BDLA 1EFNA 4J7FA 4PNOA 2QTXA 1JU5C 2E1HA 1YJNT 1QVFA 2XI9A 3G4ST 3QBYA 4ZN3A 2VV5A 2DIGA 2VKNA 2JMAA 1V29B 1YN8A 4JS5A 2AK5A 2KROA 2ZPIB 3CC2T 2DM1A 3DKMA 3CCSQ 1U1SA 1ZUUA 2E64A 1LJOA 3SWNB 5LJ5e 4DQ2A 4LDYA 2OX7A 3EFOA 2QQBA 1RAFB 1M1GA 2CP2A 4LDUA 4A4KA 2DX1A 5LJ3h 4N4HA 3JCMg 4HCBA 1D1AA 2KRMA 5C6SA 1VQ9T 1PKSA 2Y4XA 3OS1A 1M8MA 1VQ4Q 2QDYB 3JCMb 2ED1A 5FWCA 3MO8A 2O2OA 3VUZA 7AT1B 3M56A 2LX7A 3CCUT 2IVWA 2MOXA 3VS2A 1W1FA 3OMCA 1SF9A 1X01A 3BW1A 2E12A 3NPFA 2JTFA 2L0AA 2RQVA 4R55A 1I5OB 1VQ5Q 1B07A 1VQ5T 3OMGA 1V76A 2MI6A 4C0GA 1DJ7B 1ABOA 1M3AA 1BK2A 3I55Q 4F14A 1B34A 4M77C 2VGMA 4C0ZA 4EDUA 2CSQA 3VS6A 2K5IA 1ZBJA 3OYBA 5KYWA 3OW2P 1W2BS 2RHUA 3CC4T 5GANg 1C0MA 2RQWA 2YHTA 4P5NA 4F16A 1M2VA 1Q86U 2RI2A 2V8KA 1EIFA 1E6GA 1PG5B 2EKOA 3FLGA 3CMEQ 3CCJA 2KRNA 1TWBA 3VV0A 1Y0MA 3CCUA 2D6FA 3CMAA 2PU9B 3NGPA 2LX9A 4TVRA 3G71Q 1JJ2A 1Q7YU 1AOJA 2R5MA 1VQLA 5L8RE 1G3WA 2CP3A 5FU7C 2KT8A 4JJNK 3QSUA 5HK3A 5KYUB 3H6ZA 1VQ6T 1KK7A 1YJ9A 3PTAA 3M0SA 5IT9E 4LNPA 1IGUA 1X2QA 4UC4A 2EAYA 1D09B 3M55A 4NOYA 1VQ5A 1KC8U 3UT1A 2JW4A 2DXCA 4PKCC 2EGAA 2HSPA 3JB9H 2FO0A 3OYLA 3JCMJ 2R5AA 1ZSZB 1M1KC 1YJNA 3N5BB 1IB8A 1SEMA 2HKNA 2K2MA 1Y71A 5GAMd 4FL6A 3CCVQ 4N4GA 4RG2A 3JCMP 3C4SA 1HSQA 1W2BP 2DO3A 3RIRA 1D0XA 1VIFA 2VGNA 2E41A 2RJCA 3M58A 2YUQA 4ZN1A 1GCQC 3CCET 4FT4A 4QW2A 3JB9F 1LVKA 5I2SA 1TUGB 2P0KA 4X34A 3ZEHA 4PFPA 3CCUQ 3QZ9B 1ZX6A 2DL8A 3HTRA 1R0BG 1AWJA 4QVCA 3CD6Q 1G5VA 4XTVA 2GFAA 2LJ0A 4IUPA 2DJZA 1WQ7A 3F70A 3OYEA 2DAQA 1IZ6A 4RTTA 5FRNA 1MV0B 3TREA 1UTIA 4RTVA 1IXDA 1SKUB 4FYVB 5GANe 1WZOA 4C92G 3GOXA 2HD0A 3FEOA 3CMET 4HT9A 1VUBA 2ZGWA 2CZ1B 4O5VA 2VWFA 4M75G 4RMOA 2DTOA 1H3HA 2RF0A 3CPWA 2KXDA 5M9OA 4VUBA 1Z9ZA 1PSFA 3CXCS 5HKCA 3URGA 3LGFA 4Y28E 2X4JA 3EFSA 4JLIA 3I55T 5CQXA 4R56A 3FDRA 2JN0A 2LJ3A 2Z0WA 2SEMA 1YWOA 2K57A 3E2UA 1WYXA 2EKHA 4E47A 1NLOC 2DEUA 3EG0A 2DRKA 1N5ZA 2CT4A 5GANd 3OYGA 1WI7A 2K5FA 5IHKA 2PNIA 4XU0A 4M7AE 4RTUA 4ZGEB 2DPPB 1GBRA 2LVMA 1BIAA 4QKUA 1UEBA 1YHQT 1B34B 2P4TA 3L42A 5CR2A 2K5LA 3SB2A 2XDPA 3QDFA 1IHWA 4E7IA 2RHIA 2GCXA 1R8OB 3G71T 2CYZB 3BE3A 1QCOA 1YJ9Q 4JJCA 1D0YA 1ZHIA 3J7AF 3M4GA 1WPYA 3TSZA 3MP1A 2QGGA 5FWBA 2CUBA 3M0RA 2XU8A 3G1JA 2A3LA 4LDWA 3VJPA 4D8DA 1BB9A 2RM4A 4EMKA 2ZPFB 2LJ1A 3GF5A 1BKBA 2OJ2A 1QWFA 3CQTA 1C1AA 5I2MA 2EBPA 3JCMf 4EMHA 2YUOA 4JDSA 5FLXE 4CC7A 2RHXA 5HK0A 2F1LA 1NEGA 1VQKT 1TTHB 2BIVA 3S3OA 3H9NA 2GQVA 5KE2A 4RKUE 1JQQA 2XDBA 4L59A 3H0IA 4M7AD 3CC7T 2J05A 4KUDK 3CCVT 4AFZC 1NJIU 1UHCA 5DLQE 3T9NA 1Y96B 2BTTA 4J8OA 2FYKA 4J9BA 3VUBA 3OYDA 1QP3A 1OPLA 5HY6A 5IHIA 3JB9I 3HRUA 2OAWA 2NUTA 3JAME 1M30A 4RTYA 5IH2A 3MEVA 4AFSC 3UA7A 1BI3A 2IG0A 1SSFA 4LN2A 2DL3A 1NPRA 5L23A 5GAOm 3JRZA 3G6EQ 5GAOl 1K0XA 2HSEB 3KBGA 1OEBA 4KGZB 1NJIC 1M3CA 3VRZA 2FB7A 4WF2A 2F2XA 4M78C 1VYTA 3CC7A 2NUPA 2JZ2A 1IGQA 4EIKA 4JS4A 3QO3A 2MK5A 3UA6A 1WHHA 4BE2A 2MWPA 1UG1A 4II1A 2QQ9A 4E7LA 3VS5A 1M2VB 2BUDA 4XTWA 4J7IA 1I4K1 2X4WA 3OYMA 2JOYA 2WSCE 3JV3A 3CCQA 3MEAA 1ZSZC 3CPWS 2O4XB 2MPXC 1N8RU 3CXCA 1TG0A 1X69A 5IXBA 2F69A 1OZ2A 1OOTA 3SD4A 4HVVA 4PJMA 1KQSS 5GMKe 1WXTA 1ACMB 2K2VA 2F2VA 5KYUA 3SEMA 1QVPA 1UGSB 2M51A 2J7IA 1S1NA 3M5AA 1S72Q 4C5HA 2RH2A 3CCVA 3FB9A 1FMVA 1YIJT 2OTLQ 1QWEA 2KY9A 3ASKA 4A54A 1YIJQ 4C92F 3EG1A 2YSQA 1YP5A 4ATOA 1YJWQ 3RKWA 2DIQA 1VQ9Q 2HQEA 3PNWC 2FPFA 1NEBA 2D0NA 5CKFA 1KC8R 2E6NA 1UB4A 1KQ1A 2KR3A 4KGVB 3OYHA 3A8LB 5I21A 5GANj 1BU1A 4O6JA 1OV3A 1MMNA 2A08A 2EQIA 3EG3A 2WACA 1QQJA 4MZTA 4ZGDB 1TOVA 3H8ZA 2OTJT 4MDXA 2PVDB 1QCFA 3V8LA 3MCAB 2MCNA 3FJ5A 4M4ZA 2IPOB 1F1BB 2M0YA 2KI7A 4C92C 3L1AA 2OTLA 1GL5A 2J06A 5KH6A 1I0CA 2L3RA 5KCOA 3J80E 1EZZB 4PJOD 3OYCA 2FVUA 1VQ6Q 4B9WA 5GAMe 4OMQA 4M78A 1WJSA 2QA4Q 1OU9A 4XU2A 2QXFA 2C0IA 4ZNXA 2ZPGB 1K8AC 1ARKA 1FMWA 4GLMA 1KHIA 3A5ZB 4C92E 4FYYB 3QYHB 4ORZA 1KD1C 2RO0A 4JLGA 2K4YA 1FWZA 1KSWA 4F7UA 1NM7A 1BI1A 4JZ4A 4F04B 1KJWA 4QVDA 2EYWA 3X20B 3PE0A 1MNEA 3JCMV 4M77F 1KC8C 3A8GB 1X27A 4C8QB 2RB6A 4XTUA 2NUTB 5FU6C 4M7AB 3G4SA 5J39A 5GAN5 1MMGA 1WXBA 3OQ5A 1TUCA 2RHYA 3I9QA 1VQNT 4XU1A 1PHTA 5KYNA 5GAMj 3JCMe 5KE3A 3CPFA 1VQ8T 1M1KR 4X9DA 3OY9A 4KBMB 3TEEA 2HQXA 4ESRA 4M7AG 1N9SA 1P92A 2KSSA 1GCQA 4OMOA 1G8XA 2KK4A 2M16A 1SHFA 2MMPA 1QVGS 1Q7YC 3A98A 3CC4Q 1MMAA 1XJWB 3LWHA 3QXEB 2K7AA 3CCLQ 3E1SA 3PMIA 1U5SA 1WHJA 2W10A 4C8QF 5GAMh 3CCST 4J9FA 4E7HA 1QVFS 2FEIA 3L2QA 3CCRT 4OVAA 2DVEA 3CCRQ 2C0TA 3RDVA 3GLXA 1UGRB 4IUTA 1NJIR 2RPNA 1B7TA 4PFZA 4PK4A 1BBZA 4KT0E 4HCKA 1VQOQ 3OYFA 3RR6A 2GTOA 6AT1B 2OTLT 4M7AA 1Z9QA 1TS9A 2BE9B 4M77A 1G3SA 1NYGA 4LUEA 3MEWA 2OTJA 1UJ0A 2HNIA 4IUUA 2DFUA 1FYNA 2DL4A 1H8KA 8ATCB 1PD1A 2QA4T 5CQYA 4GLKA 1YI2T 3BDUA 2EJGA 5GAMf 2QEXQ 2LQNA 1JJ2S 3P8DA 5I22A 3JCMh 1ZSZA 4ZGJB 3VU3C 4JRPA 3EG9A 4RCCA 3L2ZA 2JTEA 4HA8A 4MMLA 1YJNQ 3QYGB 1RL2A 4F7UG 1LCKA 1YI2Q 3PMTA 1IREB 1X6GA 5AT1B 3RKYA 3LX7A 4Y92A 3RKXA 3EH1A 5A0DA 4FT2A 3LLRA 4M7DD 1Q82U 2RMOA 2AKKA 2CP5A 1M90R 2B8AA 1VQKA 2ROTA 2A36A 2CKKA 2EQKA 2JM9A 4FW2A 3MPUB 3VKIA 5GAOn 3DB3A 2YLBA 4Z02A 2YT6A 2RI3A 4M77B 2WSEE 3V8JA 2PUOB 3X25B 4NL3A 1WDXA 4KRTA 1VYVA 1PCXA 4DBHA 1NG2A 4FSSA 1VQ8Q 1OYXA 1VQ7T 3GPLA 1WLPB 3LWIA 1VQ7Q 1UHFA 2DJQA 3RMQA 4M7DF 4Q5WA 4CC3A 3TU4K 4JZ3A 1RAGB 4M78D 4KUIA 1UGQB 4F7UE 2G3RA 2I2LA 3EHRA 3QJYA 2E70A 3DLLA 2LDMA 2LCSA 1D0ZA 2ESWA 5CKDA 3NTIA 2DTHA 3OYIA 2NUPB 2AKLA 2KYMA 4V2SA 2CZ0B 3META 4BDZA 5KYYA 4OB3B 5CK9A 1YCSB 2VC8A 4HVWA 1CKBA 3SWNC 3MEUA 3CPWP 1ZLMA 1R0CB 3V8KA 3EHQA 4DBQA 8AT1B 1M90C 1SRLA 1K73R 1Q81U 1X6OA 2HQHA 3CBMA 1ZQ1A 1D3BA 1OI1A 1RI9A 3HPWA 1RAIB 2DXUA 2F2WA 2JS0A 1NZ9A 1KD1R 4AG1C 1E7OA 1I81A 2QQSA 2Y90A 1BYMA 3HSBA 2JVVA 2BZ8A 1CSKA 1VA7A 2E3HA 3JCMQ 9ATCB 4A53A 1JB0E 1GXIE 3NHNA 2DBKA 2PVGB 3U23A 5GMKh 4J83A 3L2RA 4L6V5 1JXMA 5CO7A 1Q86R 4C92D 4QVZA 1AVZC 2F5TX 1TXQA 2DVJA 2DNUA 2NUZA 1U1TA 4E7SA 1AWWA 1YHQQ 4E7KA 1SRMA 1M9SA 1G3TA 2DK3A 2LT4A 5GANh 2A7YA 1HK9A 4A63B 2X4XA 2EQJA 1W2BA 2YRVA 2GNCA 2EYZA 2MAMA 2P0QA 1VQKQ 3AT1B 2O31A 2PUKB 1Q7YR 1WX6A 2L5QA 2YWWA 3G71A 1VQ4T 4PJOC 3CBOA 3HRSA 2VB6A 3JCMW 3I56T 3CMAQ 2E3IA 1BI0A 2H3EB 4EMKC 3LW5E 2EJ9A 3A8MB 2W0ZA 3CCJQ 3PIPA 4M75E 3KFVA 3CCJT 2OTJQ 2FRWA 4OMLA 1OPKA 2HZYA 3R6OA 2DERA 3UPUA 2O88A 2X4YA 3EG9B 2CDTA 3EFRA 1YWPA 2V1RA 1C6VX 1UGPB 1VQMA 4BD3A 3RERA 2JM8A 5CKHA 3M57A 5IXFA 5KCHA 2XK0A 2ZPBB 1KQSA 4D6WA 3SWNA 2ZAEA 5IHNA 3EFOB 1TH7A 2L3PA 1AEYA 5GMKm 1MMDA 4LD6A 1QKWA 1WIEA 2FL7A 1YFNA 1W6XA 3A1PA 1QW1A 2EGCA 1RLPC 2MF2A 1MUZA 5FU6B 1VQOT 3CXCP 3VYHB 3RNJA 3FC3A 2EGEA 1J3TA 4HT8A 2CGHA 2V8JA 3FIFA 3OW2A 2JTMA 3CCLA 1JO8A 2NWMA 3PVLA 4C0DC 1D1CA 3CC4A 4QQ6A 2VXFA 2QQAA 4B6MA 5A2QE 4PLIA 3GP8A 1JJ2P 2P0PA 5LJ3g 3A8HB 5LL6S 2O9SA 3NTHA 4MZMA 2KYBA 4E6RA 1MGQA 1WNLA 3S3NA 1KD1U 3HL8A 4PJNA 4R0KA 2RJEA 3H0HA 2JXBA 4C8QE 4FU6A 4DEXA 4GBQA 1T3SA 2VUBA 2DTIA 3QIIA 1PNJA 4FSXA 4MZPA 4C5GA 3V7RA 4M75B 1K8AU 1S72T 4CRIA 4L5GA 4C92B 2CZ7B 4OGEA 1GFDA 5LJ5j 4PJLA 1QVFP 3LH0A 4BE1A 3WVEB 4PJOE 2DL7A 3CC2Q 2FZGB 2DYBA 5CAIA 2KNBB 1B3QA 2LQKA 4IIOA 3M53A 5IN1A 4F7UF 1VQ6A 4E7ZA 5GJVB 1D1BA 3RUXA 1Q82C 3H0FA 2X51A 3CCEA 4AFUC 5GAN6 2EWNA 3M54A 3C94A 3X24B 4J9GA 4IKFA 1M1FA 2O4XA 3VS0A 1AZEA 4M7AC 2EQUA 2KGTA 3OYAA 2O01E 1YITQ 3L2VA 3P8HA 1YITT 3HHTB 3HP9A 1QLYA 5FU7B 2CUDA 2H8HA 3CD6T 1K0SA 4N4IA 4JRQA 1U8RA 5LJ3d 4Z88A 4PJJA 1YJWA 1JXOA 2KT1A 1MHNA 3QJ6A 2E4HA 1N8RR 2X35A 4JRKA 3UATA 2AHJB 4KH1B 2LQWA 4DEYA 4M75A 5GAMg 1K9MC 1G3YA 2CT3A 4FCYA 3G6ET 3SHWA 1RAHB 4C92A 5GMKj 4YTLA 3OS5A 2VVKA 2O9VA 1VQLT 1FMKA 4XAXB 4B9XA 1YCYA 2KAFA 1LNXA 2COZA 1YIJA 4RG8A 2VXEA 1LOJA 1UE9A 2EFIA 1HXDA 3REBB 3P8BB 3D7SB 1QKXA 3KUFA 3X26B 1GCPA 1XNIA 1GRIA 1W70A 5LJ5f 4N0AC 2M0OA 3OSVA 3G4SQ 4EPCA 3EGDB 5IAYA 1NBEB 1Q81R 2P84A 5KYWB 4JRIA 2AZVA 1QP2A 1VQMT 4GY5A 3QUIA 5D6WA 2X3XD 4OP0A 4X9CA 4LXCA 4A4GA 3CCMT 1QVGA 4J9CA 2XDDA 3E9FA 1VQNA 4MDWA 4A4EA 1K1ZA 1YBYA 4HXJA 1UDLA 2I0NA 4J6YA 1RADB 2NLUA 2RN8A 2L8DA 4C5IA 4M77E 2D9TA 1QCNA 1ZBXA 4ZTJA 2DZCA 4PLLA 2J6FA 1WA7A 2CH4W 5GAOp 1WFWA 1AZGB 4LDXA 1R77A 3PIOA 3LGLA 2CP0A 2M1HA 3J81E 2GBQA 1HYOA 3RBBB 1MV3A 2RQRA 1WHKA 2DEQA 1VQ7A 5LJ3j 1AHJB 1AWXA 1K73U 2EYYA 4MMKA 1I1JA 2XIDA 4XTZA 4C8QC 3CCSA 3DLMA 4HCCA 5CKBA 1PSEA 3BFMA 2KRSA 2CS7A 3R6NA 2JT4A 4BB7A 3S3MA 1K4US 4OB2B 4M78F 2HKQB 4RTWA 1Q81C 2E5QA 1W4SA 2FRYA 3TQ7P 3QZ5B 4ELZC 1UGVA 1ZUYA 2LNVA 3GBQA 4IUVA 2D1XA 2GGRA 4X1VA 1Q95G 2QYZA 2FG0A 3C95A 3VS1A 3L2WA 3VS3A 1LPLA 1G2BA 1VQPT 3VS4A 1RACB 4IIMA 5CCAA 3M4YA 4OMPA 4XU3A 4ELYC 1M4ZA 1N8RC 2D8HA 3O5ZA 2MIOA 4AG2C 3OYYA 2KDSA 2WSFE 3RESA 2QDLA 3HFOA 3M0QA 3JB9G 4JJDA 2AIRB 3PT9A 2XKOC 2JNGA 4CC4B 3O8VA 1VQPQ 2XHCA 1T3LA 3OBYA 2LCCA 4FW1A 1OU8A 3JCMc 1JRIA 5J3BA 1UECA 4BUGA 3UDCA 2KBTA 3X28B 4F17A 1VQOA 3JB9J 5FROA 3CCLT 1Q82R 4LE9A 2K79A 2ZPEB 2ED0A 2RI5A 5GAN4 2DL5A 4XQ3A 5HCKA 3I56A 1Y07A 1NLPC 2DD5A 4C8QD 2QAZA 4M7DA 2YXYA 4WCIA 4PL6A 4AFQC 5FW9A 3HRTA 3ZBDA 4A4HA 4XK8E 4ME7A 1M3BA 1VQ9A 4M7DE 4EMGA 2HDAA 1M8VA 1WGSA 1PM3A 2M02A 1D3BB 2ROLA 1VQ8A 1SPKA 1WHLA 1H641 3I5RA 1PC0A 3GIBA 1PD0A 1T0HA 4E7JA 5DLOA 2NYSA 2CH4A 4CI0C 3CCMA 2ENMA 4J6WA 2K6DA 4NS5A 2QEXT 3VS7A 2VYTA 3CC2A 1XOVA 2V8IA 3OA6A 2L3SA 4OMMA 2QI2A 2HAXA 4OF1A 2LTOA 3M9QA 4FYXB 3PGGA 1VQPA 1K8AR 2D0QB 2FZCB 2DZ9A 4PJOG 4FM4B 1O9SA 4OB1B 1U06A 2XICA 4DA4A 4JPBW 4Z8AA 2AT1B 4OMFB 5EC7A 2DETA 2COYA 3AHUA 1N6AA 1CKAA 2HBPA 2DYIA 2PZ1A 3L2UA 2RNAA 1OULA 1ZA2B 4Z89A 1WQWA 1U3OA 3H41A 2JS2A 3ULRB 2LZ6B 1GFCA 2HMAA 4D8KA 4JUVA 5LJ3f 2IIMA 4OGCA 2HL3A 4Y91A 4J5YA 1VIEA 3OB9A 3ME9A 1X43A 2F5KA 2A0FB 4BACA 1JEGA 2BE7D 2DXBA 4J9EA 5CVIA 1M1KU 1RAAB
chains in the Genus database with same CATH topology
4HT8A 2CGHA 2V8JA 4LDUA 5CKFA 4A4KA 2E6NA 2EJFA 1UB4A 1KQ1A 2RD1A 3FIFA 5LJ3h 2JTMA 4N4HA 3OYHA 3OW2A 3CCLA 3JCMg 3A8LB 5I21A 5GANj 1N9RA 4HCBA 2XG8D 5C6SA 4O6JA 3OS2A 3VYGA 4C0DC 1VQ9T 3CC4A 2Y4XA 2VXFA 2QQAA 4QQ6A 2OAUA 4PLIA 5A2QE 3OS1A 3GP8A 2P0PA 3JB9D 2WACA 2QDYB 4MZTA 4ZGDB 5LJ3g 5LJ5d 3H8ZA 3JCMb 3A8HB 1NE8A 3MO8A 3NTHA 4MZMA 2PVDB 5LL6S 3VUZA 4MDXA 4IURA 2OTJT 1MGQA 3MCAB 3V8LA 1WNLA 3MP8A 3M56A 3CCUT 3S3NA 2IVWA 1KD1U 4BI8B 3HL8A 3INZA 4C92C 3L1AA 3QG1A 3OMCA 2RJEA 4C8QE 1X01A 2OTLA 4FU6A 3BW1A 2E12A 2JTFA 4M77G 2ZZDA 5KH6A 2L3RA 4R55A 5KCOA 3J80E 1Q86C 2L89A 2VUBA 2DTIA 4PJOD 3OYCA 2FVUA 3QIIA 4B9WA 3V7SA 3HFNA 5GAMe 2KQWA 4FSXA 2R57A 1VQ5T 4M78A 1WJSA 3OMGA 2MI6A 4C0GA 1DJ7B 4XU2A 4J6XA 2QXFA 1B34A 4M77C 2VGMA 4MZPA 2ZPGB 2ZCFB 4C5GA 1K8AC 2PVOB 4IUQA 3V7RA 4C0ZA 4M75B 2K3YA 1KHIA 4EDUA 2GFUA 1K8AU 1S72T 3HKSA 1M5Q1 3LYIA 4CRIA 2ZPHB 2K5IA 3A5ZB 4L5GA 4C92B 4C92E 3OYBA 4BDYA 2CZ7B 4OGEA 1W2BS 2RHUA 3QYHB 5LJ3e 1X75C 5DM7R 5LJ5j 3CC4T 5GANg 1Y7XA 4M78B 2YHTA 1KD1C 2RO0A 4P5NA 3LH0A 1K9MU 4JLGA 3RMSA 2H3JA 2K4YA 1FWZA 3ER0A 4BE1A 1Q86U 2RI2A 2V8KA 1EIFA 2EKOA 3WVEB 4F7UA 3FLGA 3CCJA 4PJOE 5CAIA 2LQKA 2RJDA 3M53A 1BI1A 5IN1A 5DY9A 4QVDA 4F7UF 2BKDN 3CMEA 3X20B 3VV0A 2PQWA 4M7DB 3JCMV 3M59A 3CCUA 2LCLA 4M77F 2Y4YA 1KC8C 1VQ6A 4HKEA 3A8GB 5LJ5h 3CMAA 2D6FA 1I8FA 2PU9B 4C8QB 2RB6A 4QQDA 4XTUA 2LX9A 3RUXA 1Q82C 5FU6C 4M7AB 3CCEA 4TVRA 3G4SA 1JJ2A 5J39A 5GAN6 5GAN5 1Q7YU 2EWNA 5GANf 5D6YA 2RK1A 3M54A 3C94A 3OQ5A 3X24B 2R5MA 3EAEA 1VQLA 4IKFA 5L8RE 1G3WA 1M1FA 2RHYA 2O4XA 3OYJA 5FU7C 1VQNT 3QKJA 4XU1A 4M7AC 2EQUA 1O75A 5GAMj 5HK3A 2O01E 3JCMe 3H6ZA 3OYAA 4NL2A 4JJNK 1VQ6T 1YJ9A 3L2VA 3P8HA 1YITT 3PTAA 3HHTB 3HP9A 5KE3A 5GMKi 5IT9E 3CPFA 4UC4A 5FU7B 1VQ8T 2EAYA 4X9DA 3OY9A 2KMTA 5A0GA 3M55A 3CD6T 2LT1A 4KBMB 2HQXA 4NOYA 3TEEA 4C8QG 4N4IA 1KC8U 1VQ5A 2DXTA 4JRQA 5GAN3 1U8RA 4M7AG 1N9SA 5LJ3d 3UT1A 5LJ5g 1YJWA 2DXCA 2C06A 1P92A 4PKCC 2KSSA 3OYKA 1KQ2A 1MHNA 2KK4A 2M16A 3QJ6A 2MMPA 3JB9H 3GNGA 3OYLA 1VQ4A 1Q7YC 1QVGS 2X35A 4JRKA 1KHCA 3JCMJ 2R5AA 2AHJB 3CMAT 3LWHA 3QXEB 1M1KC 4M75A 5GAMg 1K9MC 4EMKB 1G3YA 3C12A 3BY7A 3E1SA 3PMIA 1XQHA 3N5BB 3G6ET 1YJNA 5GAMh 4E7HA 4C8QF 3CCST 1QVFS 3OS0A 4C92A 1Y71A 3L2QA 5GAMd 5GMKj 4YTLA 3CCRT 3OS5A 4FL6A 4OVAA 2DVEA 1VQLT 4N4GA 3GLXA 1UGRB 3C4SA 4RG2A 3QDRB 3JCMP 2LC4A 4IUTA 4XAXB 4BI3A 1WJRA 2DO3A 3FRNA 3QPHA 3RIRA 3OW2S 1VIFA 1YCYA 4KT0E 4B9XA 2KAFA 2E41A 1LNXA 2VGNA 2RJCA 3M58A 3OYFA 4ZN1A 3CCET 2DD4A 4FT4A 2K3XA 4QW2A 4RG8A 1YI2A 5GAN8 5I2SA 1YIJA 3S6WA 2OTLT 2VXEA 1Y96A 4M7AA 4KULA 1LOJA 2P0KA 4X34A 3ZEHA 4BY6B 4M77A 3CCQT 1YJ9T 4M7DD 1G3SA 2EFIA 3WXMB 3QZ9B 1HXDA 3Q1JA 3MEWA 3P8BB 2OTJA 2XD0A 4QVCA 1G5VA 2HNIA 3KUFA 4XTVA 3X26B 2GFAA 1XNIA 1S72A 2EIFA 2DJZA 4IUPA 4IUUA 4N0AC 5LJ5f 1WQ7A 3F70A 3OYEA 2M0OA 3OSVA 3JCMX 2DAQA 1IZ6A 4C0DB 2QA4T 4EPCA 1BI2A 4BE0A 5CQYA 4GLKA 1YI2T 5FRNA 3BDUA 2RA2A 3TREA 3CD6A 5IAYA 2EJGA 5GAMf 5GANe 4JRIA 1JJ2S 3P8DA 4C92G 4XTYA 3GOXA 1OZ3A 1QP2A 2HD0A 1VQMT 3FEOA 4GY5A 3CMET 4HT9A 3JCMh 3QUIA 1VUBA 2ZGWA 2CZ1B 4O5VA 4M75G 3UWNA 5D6WA 4RMOA 2DTOA 5A0LA 4ZGJB 3VU3C 4OP0A 4X9CA 4A4GA 5C0MA 3CPWA 3CCMT 4JRPA 1QVGA 5M9OA 4RCCA 4VUBA 5CIUA 3L2ZA 4PJOF 2XDDA 1PSFA 3CXCS 3E9FA 4HA8A 4MMLA 5HKCA 3URGA 1VQNA 3QYGB 4MDWA 1RL2A 3QHSA 4A4EA 1YBYA 4F7UG 3LGFA 1BIBA 4Y28E 4J6YA 2NLUA 3PMTA 2L8DA 1IREB 2X4JA 4C5IA 3EFSA 3RKYA 3LX7A 2YLCA 4C8QA 4JLIA 2KVQG 2D9TA 4M77E 4HCZA 1ZBXA 3RKXA 3PFSA 5CQXA 4FT2A 5A0DA 3FDRA 3LLRA 4R56A 4ZTJA 2DZCA 2JN0A 4ZTFA 4PLLA 1YJWT 1Q82U 3OYNA 3I55A 2EQMA 2B8AA 1VQKA 4A4FA 5GAOp 3JB9F 2CKKA 2EQKA 3VKIA 5GAOn 2K57A 4LDXA 3DB3A 2RK2A 2YLBA 4Z02A 3LGLA 4LDVA 3PIOA 2M1HA 5FRMA 3J81E 1M90U 2RI3A 4M77B 4E47A 1N27A 2WSEE 3V8JA 2DKGA 2PUOB 3X25B 2DEQA 4NL3A 1K73C 5GANd 3OYGA 1VQ7A 5LJ3j 2K5FA 1AHJB 5GAOr 3CBPA 1K73U 1OYXA 4XU0A 2M9UA 4MMKA 1VQ7T 5EG2A 3GPLA 4M7AE 3LWIA 2XIDA 4ZGEB 4XTZA 4C8QC 3CCSA 4C5EA 3DLMA 3RMQA 2DPPB 2LVMA 1BIAA 5CKBA 1PSEA 1UEBA 4Q5WA 1FXXA 3BFMA 4HCCA 3TU4K 1JBMA 2CS7A 1YHQT 2QQRA 1B34B 2LQ8A 4M78D 2P4TA 2RHZA 3L42A 4KUIA 1UGQB 4BB7A 1WJQA 4F7UE 5CR2A 3S3MA 2K5LA 3SB2A 2G3RA 2XDPA 4OB2B 3G6EA 4M78F 2LRQA 2E10A 2I2LA 2RHIA 2GCXA 1R8OB 3G71T 4E7IA 3QJYA 2E70A 4PJOB 1Q81C 2CYZB 1W4SA 2E5QA 5GMKl 3DLLA 2LDMA 3QZ5B 4ELZC 1ZHIA 3J7AF 2QEXA 3M4GA 2R58A 1WPYA 3MHXA 2LNVA 3MP1A 2XU8A 5CKDA 3NTIA 2DTHA 3OYIA 2A3LA 4LDWA 4IUVA 3VJPA 2RM4A 4DOVA 4EMKA 3C95A 2ZPFB 4V2SA 3GF5A 1BKBA 2CZ0B 3META 4BDZA 3L2WA 4XTXA 5I2MA 4OB3B 1VQPT 5CK9A 3JCMf 4EMHA 2VC8A 4N0AA 4JDSA 4M77D 3SWNC 5CCAA 3M4YA 3MEUA 3NFCA 5FLXE 4XU3A 4ELYC 1M4ZA 1N8RC 3V8KA 2JUFA 2RHXA 5HK0A 1M90C 3E9GA 1Q81U 1X6OA 1VQKT 3CBMA 2BIVA 1ZQ1A 1D3BA 3S3OA 1OI1A 2E6ZA 2KDSA 2WSFE 3OYYA 3RESA 3HPWA 3HFOA 5GAN2 3JB9G 3ZFJA 2DXUA 3SDZA 4LD9K 1NZ9A 3WVDB 2GQVA 5KE2A 1I81A 2QQSA 4QQGA 4RKUE 3V7CA 4M7DF 2Y90A 2XDBA 1BYMA 4L59A 3CCRA 3PT9A 4M7AD 2XKOC 3HSBA 2JVVA 2JNGA 1KG1A 3CC7T 3O8VA 4KUDK 3CCVT 4M7DC 1NJIU 2XHCA 3JCMQ 1H3ZA 5DLQE 3T9NA 3OBYA 2LCCA 4A53A 1Y96B 3GNFB 2MWOA 4J8OA 1JB0E 3JCMc 1JRIA 2FYKA 5J3BA 1GXIE 3VUBA 4BUGA 3OYDA 2PVGB 3UDCA 3X28B 2FHDA 5GMKh 5GAOq 1QP3A 3SFMA 3CEYA 3NTKA 5HY6A 5GAN7 2QA4A 3JB9J 4J83A 3JB9I 3HRUA 1VQOA 5FROA 3JAME 4L6V5 3L2RA 3CCLT 4M75D 4M75F 2ZPEB 2RI5A 4PJOA 5GAN4 5CO7A 3MEVA 4XQ3A 4C92D 3I56A 1BI3A 2IG0A 1Y07A 4QVZA 2F5TX 1SSFA 3E19A 4BI4A 2DD5A 1NPRA 4C8QD 1U1TA 4M7DA 5GAOm 4PL6A 3JRZA 3HRTA 5CKEA 5GAOl 1XTDA 3KBGA 4RCBA 3ZBDA 4A4HA 4XK8E 4E7KA 4ME7A 1NPPA 1M9SA 1NJIC 1G3TA 2DK3A 5D6XA 3JCMd 3OSSC 2FB7A 4WF2A 4F7UB 1YHQA 2LT4A 1VQ9A 4OB0B 5GANh 4M7DE 4M78C 4EMGA 2A7YA 1YITA 1HK9A 3JSCA 1M8VA 1WGSA 2GF7A 3CC7A 2X4XA 2JZ2A 3KXTA 1D3BB 2EQJA 4JS4A 1VQ8A 1W2BA 3QO3A 2YRVA 4BY6C 3TCJA 2CZ6B 4M75C 1H641 2MAMA 2P0QA 4BE2A 2MWPA 4DOWA 2PUKB 3GIBA 4II1A 2L5QA 3DB4A 2QQ9A 4M78G 4E7JA 5DLOA 4E7LA 3G71A 1VQ4T 4CI0C 4M7AF 2BUDA 3G7ZA 3CBOA 3CCMA 4PJOC 3HRSA 4XTWA 4J7IA 4J6WA 3JCMW 4NS5A 4M7DG 3I56T 2QEXT 1I4K1 2VYTA 2X4WA 1XOVA 2V8IA 5J26A 4C0FA 3OYMA 3OA6A 1I5LA 3CC2A 1BI0A 2JOYA 2QI2A 3OBWA 4OF1A 2HAXA 2LTOA 2RJFA 2WSCE 3M9QA 3PGGA 1VQPA 3CCQA 4EMKC 3LW5E 1RI0A 2D0QB 2EJ9A 2EYQA 3MEAA 4M78E 2E65A 2DZ9A 3A8MB 3CPWS 4PJOG 3FJPA 4FM4B 2O4XB 1O9SA 4OB1B 3MP6A 3PIPA 1FX7A 4M75E 2XICA 4DA4A 3CXCA 3CCJT 1N8RU 4OMFB 3R6OA 2F69A 1OZ2A 3AHUA 3UPUA 4FIBA 2X4YA 3A8OB 5AYFA 3SD4A 1N6AA 3EFRA 1KQSS 2HBPA 3BDLA 4J7FA 4PNOA 5GMKe 2QTXA 1UGPB 1VQMA 2E1HA 4BD3A 3RERA 3L2UA 1YJNT 2K2VA 1QVFA 2XI9A 3M57A 5CKHA 3G4ST 3QBYA 2XK0A 5KCHA 3QSUA 2ZPBB 1KQSA 4D6WA 3SWNA 3I55T 4ZN3A 1WQWA 2VV5A 2DIGA 1QVPA 1TH7A 1UGSB 1V29B 4JS5A 3M5AA 2ZPIB 4C5HA 5GMKm 3CC2T 2FL7A 2RH2A 4LD6A 3FB9A 4JUVA 3DKMA 3CCVA 1YIJT 5LJ3f 2KY9A 4OGCA 3ASKA 1QW1A 4A54A 1U1SA 4Y91A 4C92F 4J5YA 1VIEA 3OB9A 2E64A 1LJOA 3ME9A 3SWNB 5LJ5e 2F5KA 4BACA 4DQ2A 2MF2A 4LDYA 4ATOA 5FU6B 1VQOT 3RKWA 2DIQA 2HQEA 2QQBA 2DXBA 3PNWC 3VYHB 5CVIA 1M1KU 3FC3A 1M1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAY A;  2YLB A;  4X9D A;  4HT8 A;  2CGH A;  4NOY A;  4C8Q G;  4C8Q D;  2EJF A;  5LJ3 h;  1KQ1 A;  2DXT A;  2RD1 A;  3FIF A;  5GAN 3;  5GAO q;  4M7A G;  1N9S A;  1U1T A;  5LJ3 d;  3JCM g;  5LJ5 g;  4M77 B;  5I21 A;  5GAO m;  5GAN j;  1N9R A;  3V8J A;  2DKG A;  4NL3 A;  2DEQ A;  5GAO l;  5GAN d;  5LJ3 j;  4RCB A;  5GAO r;  2VXF A;  1KQ2 A;  3JB9 H;  4XU0 A;  4MMK A;  3JB9 D;  4M7A E;  5LJ3 g;  4JRK A;  5LJ5 d;  3JCM d;  2FB7 A;  4WF2 A;  4F7U B;  3JCM b;  4XTZ A;  3JCM J;  4M7D E;  4C8Q C;  5GAN h;  4M78 C;  4EMG A;  1MGQ A;  1HK9 A;  4M75 A;  3V8L A;  1BIA A;  5GAM g;  1WNL A;  4M7D F;  4EMK B;  3BFM A;  1M8V A;  3BY7 A;  1JBM A;  1D3B B;  1B34 B;  3INZ A;  4C92 C;  3L1A A;  4M78 D;  4C8Q F;  3QO3 A;  4C92 A;  5GAM h;  4M7D A;  5GAM d;  4F7U E;  5GMK j;  4C8Q E;  1X01 A;  3BW1 A;  3SB2 A;  2DVE A;  4M75 C;  1H64 1;  4M77 G;  4M78 F;  2E10 A;  3JCM P;  2I2L A;  4PJO B;  2DTI A;  5GMK l;  3GIB A;  4PJO D;  3RIR A;  3V7S A;  3HFN A;  4M78 G;  1YCY A;  5GAM e;  2E41 A;  1LNX A;  4M78 A;  3M4G A;  4M7A F;  1WPY A;  4PJO C;  3JB9 F;  4XTW A;  5GAN 8;  4J6W A;  3JCM W;  2VXE A;  1Y96 A;  4J6X A;  4XU2 A;  4M7A A;  4M7D G;  1B34 A;  2DTH A;  1LOJ A;  4M77 C;  1I4K 1;  4M77 A;  1I5L A;  3V7R A;  4M75 B;  2RM4 A;  4EMK A;  3PGG A;  1HXD A;  4V2S A;  4EMK C;  1M5Q 1;  2EJ9 A;  4C92 B;  4M78 E;  4C92 E;  4QVC A;  2E65 A;  2HNI A;  2DZ9 A;  4XTV A;  4XTX A;  3FJP A;  4PJO G;  5LJ3 e;  5LJ5 j;  5GAN g;  2DJZ A;  3JCM f;  4M78 B;  4N0A C;  1WQ7 A;  2VC8 A;  2YHT A;  4M75 E;  4EMH A;  5LJ5 f;  4N0A A;  3JCM X;  4M77 D;  3SWN C;  4XU3 A;  4F7U A;  4PJO E;  3AHU A;  3V8K A;  5CAI A;  3BDU A;  2RA2 A;  3EFR A;  2EJG A;  5DY9 A;  4QVD A;  4PNO A;  5GMK e;  2QTX A;  4F7U F;  1D3B A;  5GAM f;  5GAN e;  4JRI A;  2E1H A;  3RES A;  4M7D B;  3HFO A;  3JCM V;  4C92 G;  4XTY A;  4M77 F;  5GAN 2;  3JB9 G;  3RER A;  2DXU A;  4HT9 A;  3JCM h;  3QUI A;  2ZGW A;  5LJ5 h;  1I8F A;  4C8Q B;  2RB6 A;  4XTU A;  1I81 A;  3SWN A;  4M75 G;  3RUX A;  3V7C A;  2Y90 A;  2DTO A;  1WQW A;  4M7A B;  3VU3 C;  4M7A D;  3HSB A;  4OP0 A;  4X9C A;  1TH7 A;  5GMK h;  4M7D C;  5GAN 6;  5GAN 5;  4RCC A;  2EWN A;  5GAN f;  3L2Z A;  4PJO F;  3JCM Q;  4HA8 A;  4A53 A;  4MML A;  1Y96 B;  5GMK m;  3QHS A;  3FB9 A;  4JUV A;  1JRI A;  2FYK A;  3JCM c;  4F7U G;  5LJ3 f;  1BIB A;  4J6Y A;  4A54 A;  1U1S A;  4Y91 A;  4C92 F;  4J5Y A;  3EFS A;  3RKY A;  2E64 A;  1LJO A;  2YLC A;  4XU1 A;  4JLI A;  4M77 E;  4C8Q A;  3RKX A;  5GAN 7;  3JB9 I;  3SWN B;  5GAM j;  3JB9 J;  5LJ5 e;  3JCM e;  3QSU A;  4M7D D;  4M75 D;  4NL2 A;  2DZC A;  2JN0 A;  4M75 F;  4DQ2 A;  4M7A C;  4PJO A;  5GAN 4;  4XQ3 A;  3RKW A;  5GMK i;  4C92 D;  5GAO p;  5GAO n;  2K57 A; 
#chains in the Genus database with same CATH topology
 3M0U A;  3EGX B;  2EJF A;  3I56 Q;  3CMA T;  2RD1 A;  1N9R A;  2XG8 D;  3OS2 A;  3VYG A;  1X6B A;  5KYX A;  2OAU A;  3JB9 D;  5LJ5 d;  1K9M R;  4AT1 B;  1NE8 A;  2VAS A;  4IUR A;  3MP8 A;  4BI8 B;  1BCO A;  1HD3 A;  3INZ A;  2FZK B;  3QG1 A;  1ZA1 B;  4PFO A;  4M77 G;  2SRC A;  2ZZD A;  1Q86 C;  2L89 A;  2GTJ A;  3V7S A;  3HFN A;  2KQW A;  4FYW B;  2R57 A;  2J6O A;  2YUP A;  2GQI A;  1EX4 A;  4J6X A;  1AT1 B;  2BZY A;  1VQN Q;  2ZCF B;  2L2P A;  2PVO B;  4IUQ A;  3EGU A;  2K3Y A;  3LH5 A;  2GFU A;  1PRL C;  2J6K A;  3HKS A;  1M5Q 1;  2HBW A;  3LYI A;  2ZPH B;  2DF6 A;  4BDY A;  5LJ3 e;  1X75 C;  5DM7 R;  1RAB B;  1Y7X A;  4M78 B;  5I11 A;  1K9M U;  3RMS A;  2H3J A;  3ER0 A;  2ABL A;  1BCM A;  2YRD A;  3NMZ C;  3MJX A;  2RJD A;  2XMF A;  2HCK A;  4J9H A;  1OX8 A;  5DY9 A;  2QAS A;  2BKD N;  3CME A;  2LP5 A;  2PQW A;  4M7D B;  1RUW A;  3M59 A;  2LCL A;  2Y4Y A;  4HKE A;  5LJ5 h;  1I8F A;  1QMC A;  2ECZ A;  4QQD A;  1TU0 B;  4K11 A;  2LNH B;  3TVT A;  3EGD A;  5GAN f;  5D6Y A;  2RK1 A;  1UUE A;  2L3Q A;  3EAE A;  3EGX A;  1AWO A;  1IHV A;  2A28 A;  2KEA A;  2X9H A;  3OYJ A;  3QKJ A;  1ABQ A;  1O75 A;  4NL2 A;  4CC2 A;  1ZSG A;  5GMK i;  4J9I A;  1WHM A;  1K9A A;  2KMT A;  5A0G A;  2LT1 A;  2YUN A;  4C8Q G;  1RLQ C;  1PKT A;  2DXT A;  5GAN 3;  5LJ5 g;  2C06 A;  3OYK A;  2CP7 A;  5D7U A;  1KQ2 A;  1I07 A;  3GNG A;  4WTO B;  1VQ4 A;  1KHC A;  1H92 A;  4EMK B;  3C12 A;  3BY7 A;  1XQH A;  2RQT A;  3OS0 A;  1PRM C;  2DA9 A;  1T0J A;  1SG5 A;  2COW A;  1M2O A;  4QT7 A;  3QDR B;  3I35 A;  2V26 A;  2CSI A;  2LC4 A;  4BI3 A;  1WJR A;  3FRN A;  3OW2 S;  3QPH A;  2CP6 A;  2DD4 A;  2K3X A;  3C0C A;  4JJB A;  5GAN 8;  1YI2 A;  3S6W A;  1Y96 A;  3VRY A;  4KUL A;  3M0P A;  2QGF B;  4BY6 B;  3CCQ T;  1YJ9 T;  4LUD A;  3WXM B;  2JMC A;  3UF4 A;  3Q1J A;  2XD0 A;  3CCE Q;  3REA B;  1S72 A;  1VOM A;  2EIF A;  3JCM X;  4C0D B;  1OX9 A;  1BI2 A;  4BE0 A;  4E2F B;  1VYU A;  2RA2 A;  3CD6 A;  2QG9 B;  2OI3 A;  2EYX A;  4XTY A;  1OZ3 A;  1V1C A;  1KFZ A;  4KGX B;  3UWN A;  4ANJ A;  2HEQ A;  5A0L A;  5C0M A;  3QWY A;  3THK A;  2RQU A;  5CIU A;  4PJO F;  2DE0 X;  2EW3 A;  2FPE A;  2HL5 C;  3QHS A;  1BIB A;  1MND A;  1M27 C;  1SHG A;  1UFF A;  1AD5 A;  2YLC A;  2FPD A;  4C8Q A;  2KVQ G;  1YNZ A;  4HCZ A;  1IO6 A;  2ATC B;  3PFS A;  1YJW T;  4ZTF A;  2QTV A;  3OYN A;  3I55 A;  2EQM A;  4A4F A;  2K9G A;  2RK2 A;  4LDV A;  5FRM A;  1M90 U;  1N27 A;  1K73 C;  2DKG A;  2YDL A;  1WXU A;  3ZL7 C;  2YRC A;  2EPD A;  5GAO r;  3CBP A;  4RUG A;  2JJ9 A;  2M9U A;  5EG2 A;  3CC7 Q;  2EVR A;  1NYF A;  1KQS P;  2DBM A;  4C5E A;  1PWT A;  1E6H A;  1RAE B;  1FXX A;  1JBM A;  2BZX A;  2QQR A;  2LQ8 A;  2RHZ A;  1WJQ A;  4RTX A;  3G6E A;  1K76 A;  2LRQ A;  2E10 A;  2QK0 A;  4PJO B;  5GMK l;  2QEX A;  2R58 A;  3MHX A;  3IQL A;  2DLP A;  2E5K A;  1UJY A;  1WHG A;  2CRE A;  1QVG P;  4DOV A;  2V1Q A;  4XTX A;  2PTK A;  2LMJ A;  4N0A A;  1X2K A;  4M77 D;  1GBQ A;  3NFC A;  4DBR A;  1VQM Q;  2B86 A;  4AMC A;  2JUF A;  2A37 A;  5GJW B;  3E9G A;  3EH2 A;  4RTZ A;  3CCQ Q;  3CCM Q;  2E6Z A;  5GAN 2;  3ZFJ A;  3SDZ A;  4LD9 K;  3WVD B;  2D8J A;  4QQG A;  1OQK A;  3V7C A;  3CCR A;  3M0T A;  1KG1 A;  4M7D C;  1IRX A;  5ECA A;  2KXC A;  1H3Z A;  3GNF B;  4DBF A;  2MWO A;  1Y57 A;  2FHD A;  2MYS A;  5KYX B;  3SFM A;  5GAO q;  3CEY A;  3NTK A;  5GAN 7;  2QA4 A;  2G6F X;  4M75 D;  4M75 F;  4PJO A;  2AZS A;  2P4R A;  2DIL A;  3E19 A;  4BI4 A;  4HVU A;  4J9D A;  3I5S A;  2KE9 A;  1A0N B;  2C0O A;  5CKE A;  1XTD A;  1SSH A;  2DRM A;  4RCB A;  1NPP A;  5D6X A;  3JCM d;  3OSS C;  1TSF A;  4F7U B;  1YHQ A;  4OB0 B;  1HJD A;  1YIT A;  3JSC A;  2GF7 A;  3MKD A;  3KXT A;  4BY6 C;  3TCJ A;  2CZ6 B;  4M75 C;  1G83 A;  4DOW A;  2DMO A;  3DB4 A;  4M78 G;  3PVQ A;  4M7A F;  1ZUK A;  3G7Z A;  4M7D G;  2X3W D;  1VQL Q;  5J26 A;  4C0F A;  1I5L A;  3OBW A;  2RJF A;  3EG2 A;  1RI0 A;  1KIK A;  2EYQ A;  4M78 E;  5KYY B;  2E65 A;  3FJP A;  3QWX X;  1TUD A;  3MP6 A;  1FX7 A;  2K3B A;  3TSW A;  4KH0 B;  4FIB A;  3A8O B;  5AYF A;  4OMN A;  3BDL A;  1EFN A;  4J7F A;  4PNO A;  2QTX A;  1JU5 C;  2E1H A;  1YJN T;  1QVF A;  2XI9 A;  3G4S T;  3QBY A;  4ZN3 A;  2VV5 A;  2DIG A;  2VKN A;  2JMA A;  1V29 B;  1YN8 A;  4JS5 A;  2AK5 A;  2KRO A;  2ZPI B;  3CC2 T;  2DM1 A;  3DKM A;  3CCS Q;  1U1S A;  1ZUU A;  2E64 A;  1LJO A;  3SWN B;  5LJ5 e;  4DQ2 A;  4LDY A;  2OX7 A;  3EFO A;  2QQB A;  1RAF B;  1M1G A;  2CP2 A;  4LDU A;  4A4K A;  2DX1 A;  5LJ3 h;  4N4H A;  3JCM g;  4HCB A;  1D1A A;  2KRM A;  5C6S A;  1VQ9 T;  1PKS A;  2Y4X A;  3OS1 A;  1M8M A;  1VQ4 Q;  2QDY B;  3JCM b;  2ED1 A;  5FWC A;  3MO8 A;  2O2O A;  3VUZ A;  7AT1 B;  3M56 A;  2LX7 A;  3CCU T;  2IVW A;  2MOX A;  3VS2 A;  1W1F A;  3OMC A;  1SF9 A;  1X01 A;  3BW1 A;  2E12 A;  3NPF A;  2JTF A;  2L0A A;  2RQV A;  4R55 A;  1I5O B;  1VQ5 Q;  1B07 A;  1VQ5 T;  3OMG A;  1V76 A;  2MI6 A;  4C0G A;  1DJ7 B;  1ABO A;  1M3A A;  1BK2 A;  3I55 Q;  4F14 A;  1B34 A;  4M77 C;  2VGM A;  4C0Z A;  4EDU A;  2CSQ A;  3VS6 A;  2K5I A;  1ZBJ A;  3OYB A;  5KYW A;  3OW2 P;  1W2B S;  2RHU A;  3CC4 T;  5GAN g;  1C0M A;  2RQW A;  2YHT A;  4P5N A;  4F16 A;  1M2V A;  1Q86 U;  2RI2 A;  2V8K A;  1EIF A;  1E6G A;  1PG5 B;  2EKO A;  3FLG A;  3CME Q;  3CCJ A;  2KRN A;  1TWB A;  3VV0 A;  1Y0M A;  3CCU A;  2D6F A;  3CMA A;  2PU9 B;  3NGP A;  2LX9 A;  4TVR A;  3G71 Q;  1JJ2 A;  1Q7Y U;  1AOJ A;  2R5M A;  1VQL A;  5L8R E;  1G3W A;  2CP3 A;  5FU7 C;  2KT8 A;  4JJN K;  3QSU A;  5HK3 A;  5KYU B;  3H6Z A;  1VQ6 T;  1KK7 A;  1YJ9 A;  3PTA A;  3M0S A;  5IT9 E;  4LNP A;  1IGU A;  1X2Q A;  4UC4 A;  2EAY A;  1D09 B;  3M55 A;  4NOY A;  1VQ5 A;  1KC8 U;  3UT1 A;  2JW4 A;  2DXC A;  4PKC C;  2EGA A;  2HSP A;  3JB9 H;  2FO0 A;  3OYL A;  3JCM J;  2R5A A;  1ZSZ B;  1M1K C;  1YJN A;  3N5B B;  1IB8 A;  1SEM A;  2HKN A;  2K2M A;  1Y71 A;  5GAM d;  4FL6 A;  3CCV Q;  4N4G A;  4RG2 A;  3JCM P;  3C4S A;  1HSQ A;  1W2B P;  2DO3 A;  3RIR A;  1D0X A;  1VIF A;  2VGN A;  2E41 A;  2RJC A;  3M58 A;  2YUQ A;  4ZN1 A;  1GCQ C;  3CCE T;  4FT4 A;  4QW2 A;  3JB9 F;  1LVK A;  5I2S A;  1TUG B;  2P0K A;  4X34 A;  3ZEH A;  4PFP A;  3CCU Q;  3QZ9 B;  1ZX6 A;  2DL8 A;  3HTR A;  1R0B G;  1AWJ A;  4QVC A;  3CD6 Q;  1G5V A;  4XTV A;  2GFA A;  2LJ0 A;  4IUP A;  2DJZ A;  1WQ7 A;  3F70 A;  3OYE A;  2DAQ A;  1IZ6 A;  4RTT A;  5FRN A;  1MV0 B;  3TRE A;  1UTI A;  4RTV A;  1IXD A;  1SKU B;  4FYV B;  5GAN e;  1WZO A;  4C92 G;  3GOX A;  2HD0 A;  3FEO A;  3CME T;  4HT9 A;  1VUB A;  2ZGW A;  2CZ1 B;  4O5V A;  2VWF A;  4M75 G;  4RMO A;  2DTO A;  1H3H A;  2RF0 A;  3CPW A;  2KXD A;  5M9O A;  4VUB A;  1Z9Z A;  1PSF A;  3CXC S;  5HKC A;  3URG A;  3LGF A;  4Y28 E;  2X4J A;  3EFS A;  4JLI A;  3I55 T;  5CQX A;  4R56 A;  3FDR A;  2JN0 A;  2LJ3 A;  2Z0W A;  2SEM A;  1YWO A;  2K57 A;  3E2U A;  1WYX A;  2EKH A;  4E47 A;  1NLO C;  2DEU A;  3EG0 A;  2DRK A;  1N5Z A;  2CT4 A;  5GAN d;  3OYG A;  1WI7 A;  2K5F A;  5IHK A;  2PNI A;  4XU0 A;  4M7A E;  4RTU A;  4ZGE B;  2DPP B;  1GBR A;  2LVM A;  1BIA A;  4QKU A;  1UEB A;  1YHQ T;  1B34 B;  2P4T A;  3L42 A;  5CR2 A;  2K5L A;  3SB2 A;  2XDP A;  3QDF A;  1IHW A;  4E7I A;  2RHI A;  2GCX A;  1R8O B;  3G71 T;  2CYZ B;  3BE3 A;  1QCO A;  1YJ9 Q;  4JJC A;  1D0Y A;  1ZHI A;  3J7A F;  3M4G A;  1WPY A;  3TSZ A;  3MP1 A;  2QGG A;  5FWB A;  2CUB A;  3M0R A;  2XU8 A;  3G1J A;  2A3L A;  4LDW A;  3VJP A;  4D8D A;  1BB9 A;  2RM4 A;  4EMK A;  2ZPF B;  2LJ1 A;  3GF5 A;  1BKB A;  2OJ2 A;  1QWF A;  3CQT A;  1C1A A;  5I2M A;  2EBP A;  3JCM f;  4EMH A;  2YUO A;  4JDS A;  5FLX E;  4CC7 A;  2RHX A;  5HK0 A;  2F1L A;  1NEG A;  1VQK T;  1TTH B;  2BIV A;  3S3O A;  3H9N A;  2GQV A;  5KE2 A;  4RKU E;  1JQQ A;  2XDB A;  4L59 A;  3H0I A;  4M7A D;  3CC7 T;  2J05 A;  4KUD K;  3CCV T;  4AFZ C;  1NJI U;  1UHC A;  5DLQ E;  3T9N A;  1Y96 B;  2BTT A;  4J8O A;  2FYK A;  4J9B A;  3VUB A;  3OYD A;  1QP3 A;  1OPL A;  5HY6 A;  5IHI A;  3JB9 I;  3HRU A;  2OAW A;  2NUT A;  3JAM E;  1M30 A;  4RTY A;  5IH2 A;  3MEV A;  4AFS C;  3UA7 A;  1BI3 A;  2IG0 A;  1SSF A;  4LN2 A;  2DL3 A;  1NPR A;  5L23 A;  5GAO m;  3JRZ A;  3G6E Q;  5GAO l;  1K0X A;  2HSE B;  3KBG A;  1OEB A;  4KGZ B;  1NJI C;  1M3C A;  3VRZ A;  2FB7 A;  4WF2 A;  2F2X A;  4M78 C;  1VYT A;  3CC7 A;  2NUP A;  2JZ2 A;  1IGQ A;  4EIK A;  4JS4 A;  3QO3 A;  2MK5 A;  3UA6 A;  1WHH A;  4BE2 A;  2MWP A;  1UG1 A;  4II1 A;  2QQ9 A;  4E7L A;  3VS5 A;  1M2V B;  2BUD A;  4XTW A;  4J7I A;  1I4K 1;  2X4W A;  3OYM A;  2JOY A;  2WSC E;  3JV3 A;  3CCQ A;  3MEA A;  1ZSZ C;  3CPW S;  2O4X B;  2MPX C;  1N8R U;  3CXC A;  1TG0 A;  1X69 A;  5IXB A;  2F69 A;  1OZ2 A;  1OOT A;  3SD4 A;  4HVV A;  4PJM A;  1KQS S;  5GMK e;  1WXT A;  1ACM B;  2K2V A;  2F2V A;  5KYU A;  3SEM A;  1QVP A;  1UGS B;  2M51 A;  2J7I A;  1S1N A;  3M5A A;  1S72 Q;  4C5H A;  2RH2 A;  3CCV A;  3FB9 A;  1FMV A;  1YIJ T;  2OTL Q;  1QWE A;  2KY9 A;  3ASK A;  4A54 A;  1YIJ Q;  4C92 F;  3EG1 A;  2YSQ A;  1YP5 A;  4ATO A;  1YJW Q;  3RKW A;  2DIQ A;  1VQ9 Q;  2HQE A;  3PNW C;  2FPF A;  1NEB A;  2D0N A;  5CKF A;  1KC8 R;  2E6N A;  1UB4 A;  1KQ1 A;  2KR3 A;  4KGV B;  3OYH A;  3A8L B;  5I21 A;  5GAN j;  1BU1 A;  4O6J A;  1OV3 A;  1MMN A;  2A08 A;  2EQI A;  3EG3 A;  2WAC A;  1QQJ A;  4MZT A;  4ZGD B;  1TOV A;  3H8Z A;  2OTJ T;  4MDX A;  2PVD B;  1QCF A;  3V8L A;  3MCA B;  2MCN A;  3FJ5 A;  4M4Z A;  2IPO B;  1F1B B;  2M0Y A;  2KI7 A;  4C92 C;  3L1A A;  2OTL A;  1GL5 A;  2J06 A;  5KH6 A;  1I0C A;  2L3R A;  5KCO A;  3J80 E;  1EZZ B;  4PJO D;  3OYC A;  2FVU A;  1VQ6 Q;  4B9W A;  5GAM e;  4OMQ A;  4M78 A;  1WJS A;  2QA4 Q;  1OU9 A;  4XU2 A;  2QXF A;  2C0I A;  4ZNX A;  2ZPG B;  1K8A C;  1ARK A;  1FMW A;  4GLM A;  1KHI A;  3A5Z B;  4C92 E;  4FYY B;  3QYH B;  4ORZ A;  1KD1 C;  2RO0 A;  4JLG A;  2K4Y A;  1FWZ A;  1KSW A;  4F7U A;  1NM7 A;  1BI1 A;  4JZ4 A;  4F04 B;  1KJW A;  4QVD A;  2EYW A;  3X20 B;  3PE0 A;  1MNE A;  3JCM V;  4M77 F;  1KC8 C;  3A8G B;  1X27 A;  4C8Q B;  2RB6 A;  4XTU A;  2NUT B;  5FU6 C;  4M7A B;  3G4S A;  5J39 A;  5GAN 5;  1MMG A;  1WXB A;  3OQ5 A;  1TUC A;  2RHY A;  3I9Q A;  1VQN T;  4XU1 A;  1PHT A;  5KYN A;  5GAM j;  3JCM e;  5KE3 A;  3CPF A;  1VQ8 T;  1M1K R;  4X9D A;  3OY9 A;  4KBM B;  3TEE A;  2HQX A;  4ESR A;  4M7A G;  1N9S A;  1P92 A;  2KSS A;  1GCQ A;  4OMO A;  1G8X A;  2KK4 A;  2M16 A;  1SHF A;  2MMP A;  1QVG S;  1Q7Y C;  3A98 A;  3CC4 Q;  1MMA A;  1XJW B;  3LWH A;  3QXE B;  2K7A A;  3CCL Q;  3E1S A;  3PMI A;  1U5S A;  1WHJ A;  2W10 A;  4C8Q F;  5GAM h;  3CCS T;  4J9F A;  4E7H A;  1QVF S;  2FEI A;  3L2Q A;  3CCR T;  4OVA A;  2DVE A;  3CCR Q;  2C0T A;  3RDV A;  3GLX A;  1UGR B;  4IUT A;  1NJI R;  2RPN A;  1B7T A;  4PFZ A;  4PK4 A;  1BBZ A;  4KT0 E;  4HCK A;  1VQO Q;  3OYF A;  3RR6 A;  2GTO A;  6AT1 B;  2OTL T;  4M7A A;  1Z9Q A;  1TS9 A;  2BE9 B;  4M77 A;  1G3S A;  1NYG A;  4LUE A;  3MEW A;  2OTJ A;  1UJ0 A;  2HNI A;  4IUU A;  2DFU A;  1FYN A;  2DL4 A;  1H8K A;  8ATC B;  1PD1 A;  2QA4 T;  5CQY A;  4GLK A;  1YI2 T;  3BDU A;  2EJG A;  5GAM f;  2QEX Q;  2LQN A;  1JJ2 S;  3P8D A;  5I22 A;  3JCM h;  1ZSZ A;  4ZGJ B;  3VU3 C;  4JRP A;  3EG9 A;  4RCC A;  3L2Z A;  2JTE A;  4HA8 A;  4MML A;  1YJN Q;  3QYG B;  1RL2 A;  4F7U G;  1LCK A;  1YI2 Q;  3PMT A;  1IRE B;  1X6G A;  5AT1 B;  3RKY A;  3LX7 A;  4Y92 A;  3RKX A;  3EH1 A;  5A0D A;  4FT2 A;  3LLR A;  4M7D D;  1Q82 U;  2RMO A;  2AKK A;  2CP5 A;  1M90 R;  2B8A A;  1VQK A;  2ROT A;  2A36 A;  2CKK A;  2EQK A;  2JM9 A;  4FW2 A;  3MPU B;  3VKI A;  5GAO n;  3DB3 A;  2YLB A;  4Z02 A;  2YT6 A;  2RI3 A;  4M77 B;  2WSE E;  3V8J A;  2PUO B;  3X25 B;  4NL3 A;  1WDX A;  4KRT A;  1VYV A;  1PCX A;  4DBH A;  1NG2 A;  4FSS A;  1VQ8 Q;  1OYX A;  1VQ7 T;  3GPL A;  1WLP B;  3LWI A;  1VQ7 Q;  1UHF A;  2DJQ A;  3RMQ A;  4M7D F;  4Q5W A;  4CC3 A;  3TU4 K;  4JZ3 A;  1RAG B;  4M78 D;  4KUI A;  1UGQ B;  4F7U E;  2G3R A;  2I2L A;  3EHR A;  3QJY A;  2E70 A;  3DLL A;  2LDM A;  2LCS A;  1D0Z A;  2ESW A;  5CKD A;  3NTI A;  2DTH A;  3OYI A;  2NUP B;  2AKL A;  2KYM A;  4V2S A;  2CZ0 B;  3MET A;  4BDZ A;  5KYY A;  4OB3 B;  5CK9 A;  1YCS B;  2VC8 A;  4HVW A;  1CKB A;  3SWN C;  3MEU A;  3CPW P;  1ZLM A;  1R0C B;  3V8K A;  3EHQ A;  4DBQ A;  8AT1 B;  1M90 C;  1SRL A;  1K73 R;  1Q81 U;  1X6O A;  2HQH A;  3CBM A;  1ZQ1 A;  1D3B A;  1OI1 A;  1RI9 A;  3HPW A;  1RAI B;  2DXU A;  2F2W A;  2JS0 A;  1NZ9 A;  1KD1 R;  4AG1 C;  1E7O A;  1I81 A;  2QQS A;  2Y90 A;  1BYM A;  3HSB A;  2JVV A;  2BZ8 A;  1CSK A;  1VA7 A;  2E3H A;  3JCM Q;  9ATC B;  4A53 A;  1JB0 E;  1GXI E;  3NHN A;  2DBK A;  2PVG B;  3U23 A;  5GMK h;  4J83 A;  3L2R A;  4L6V 5;  1JXM A;  5CO7 A;  1Q86 R;  4C92 D;  4QVZ A;  1AVZ C;  2F5T X;  1TXQ A;  2DVJ A;  2DNU A;  2NUZ A;  1U1T A;  4E7S A;  1AWW A;  1YHQ Q;  4E7K A;  1SRM A;  1M9S A;  1G3T A;  2DK3 A;  2LT4 A;  5GAN h;  2A7Y A;  1HK9 A;  4A63 B;  2X4X A;  2EQJ A;  1W2B A;  2YRV A;  2GNC A;  2EYZ A;  2MAM A;  2P0Q A;  1VQK Q;  3AT1 B;  2O31 A;  2PUK B;  1Q7Y R;  1WX6 A;  2L5Q A;  2YWW A;  3G71 A;  1VQ4 T;  4PJO C;  3CBO A;  3HRS A;  2VB6 A;  3JCM W;  3I56 T;  3CMA Q;  2E3I A;  1BI0 A;  2H3E B;  4EMK C;  3LW5 E;  2EJ9 A;  3A8M B;  2W0Z A;  3CCJ Q;  3PIP A;  4M75 E;  3KFV A;  3CCJ T;  2OTJ Q;  2FRW A;  4OML A;  1OPK A;  2HZY A;  3R6O A;  2DER A;  3UPU A;  2O88 A;  2X4Y A;  3EG9 B;  2CDT A;  3EFR A;  1YWP A;  2V1R A;  1C6V X;  1UGP B;  1VQM A;  4BD3 A;  3RER A;  2JM8 A;  5CKH A;  3M57 A;  5IXF A;  5KCH A;  2XK0 A;  2ZPB B;  1KQS A;  4D6W A;  3SWN A;  2ZAE A;  5IHN A;  3EFO B;  1TH7 A;  2L3P A;  1AEY A;  5GMK m;  1MMD A;  4LD6 A;  1QKW A;  1WIE A;  2FL7 A;  1YFN A;  1W6X A;  3A1P A;  1QW1 A;  2EGC A;  1RLP C;  2MF2 A;  1MUZ A;  5FU6 B;  1VQO T;  3CXC P;  3VYH B;  3RNJ A;  3FC3 A;  2EGE A;  1J3T A;  4HT8 A;  2CGH A;  2V8J A;  3FIF A;  3OW2 A;  2JTM A;  3CCL A;  1JO8 A;  2NWM A;  3PVL A;  4C0D C;  1D1C A;  3CC4 A;  4QQ6 A;  2VXF A;  2QQA A;  4B6M A;  5A2Q E;  4PLI A;  3GP8 A;  1JJ2 P;  2P0P A;  5LJ3 g;  3A8H B;  5LL6 S;  2O9S A;  3NTH A;  4MZM A;  2KYB A;  4E6R A;  1MGQ A;  1WNL A;  3S3N A;  1KD1 U;  3HL8 A;  4PJN A;  4R0K A;  2RJE A;  3H0H A;  2JXB A;  4C8Q E;  4FU6 A;  4DEX A;  4GBQ A;  1T3S A;  2VUB A;  2DTI A;  3QII A;  1PNJ A;  4FSX A;  4MZP A;  4C5G A;  3V7R A;  4M75 B;  1K8A U;  1S72 T;  4CRI A;  4L5G A;  4C92 B;  2CZ7 B;  4OGE A;  1GFD A;  5LJ5 j;  4PJL A;  1QVF P;  3LH0 A;  4BE1 A;  3WVE B;  4PJO E;  2DL7 A;  3CC2 Q;  2FZG B;  2DYB A;  5CAI A;  2KNB B;  1B3Q A;  2LQK A;  4IIO A;  3M53 A;  5IN1 A;  4F7U F;  1VQ6 A;  4E7Z A;  5GJV B;  1D1B A;  3RUX A;  1Q82 C;  3H0F A;  2X51 A;  3CCE A;  4AFU C;  5GAN 6;  2EWN A;  3M54 A;  3C94 A;  3X24 B;  4J9G A;  4IKF A;  1M1F A;  2O4X A;  3VS0 A;  1AZE A;  4M7A C;  2EQU A;  2KGT A;  3OYA A;  2O01 E;  1YIT Q;  3L2V A;  3P8H A;  1YIT T;  3HHT B;  3HP9 A;  1QLY A;  5FU7 B;  2CUD A;  2H8H A;  3CD6 T;  1K0S A;  4N4I A;  4JRQ A;  1U8R A;  5LJ3 d;  4Z88 A;  4PJJ A;  1YJW A;  1JXO A;  2KT1 A;  1MHN A;  3QJ6 A;  2E4H A;  1N8R R;  2X35 A;  4JRK A;  3UAT A;  2AHJ B;  4KH1 B;  2LQW A;  4DEY A;  4M75 A;  5GAM g;  1K9M C;  1G3Y A;  2CT3 A;  4FCY A;  3G6E T;  3SHW A;  1RAH B;  4C92 A;  5GMK j;  4YTL A;  3OS5 A;  2VVK A;  2O9V A;  1VQL T;  1FMK A;  4XAX B;  4B9X A;  1YCY A;  2KAF A;  1LNX A;  2COZ A;  1YIJ A;  4RG8 A;  2VXE A;  1LOJ A;  1UE9 A;  2EFI A;  1HXD A;  3REB B;  3P8B B;  3D7S B;  1QKX A;  3KUF A;  3X26 B;  1GCP A;  1XNI A;  1GRI A;  1W70 A;  5LJ5 f;  4N0A C;  2M0O A;  3OSV A;  3G4S Q;  4EPC A;  3EGD B;  5IAY A;  1NBE B;  1Q81 R;  2P84 A;  5KYW B;  4JRI A;  2AZV A;  1QP2 A;  1VQM T;  4GY5 A;  3QUI A;  5D6W A;  2X3X D;  4OP0 A;  4X9C A;  4LXC A;  4A4G A;  3CCM T;  1QVG A;  4J9C A;  2XDD A;  3E9F A;  1VQN A;  4MDW A;  4A4E A;  1K1Z A;  1YBY A;  4HXJ A;  1UDL A;  2I0N A;  4J6Y A;  1RAD B;  2NLU A;  2RN8 A;  2L8D A;  4C5I A;  4M77 E;  2D9T A;  1QCN A;  1ZBX A;  4ZTJ A;  2DZC A;  4PLL A;  2J6F A;  1WA7 A;  2CH4 W;  5GAO p;  1WFW A;  1AZG B;  4LDX A;  1R77 A;  3PIO A;  3LGL A;  2CP0 A;  2M1H A;  3J81 E;  2GBQ A;  1HYO A;  3RBB B;  1MV3 A;  2RQR A;  1WHK A;  2DEQ A;  1VQ7 A;  5LJ3 j;  1AHJ B;  1AWX A;  1K73 U;  2EYY A;  4MMK A;  1I1J A;  2XID A;  4XTZ A;  4C8Q C;  3CCS A;  3DLM A;  4HCC A;  5CKB A;  1PSE A;  3BFM A;  2KRS A;  2CS7 A;  3R6N A;  2JT4 A;  4BB7 A;  3S3M A;  1K4U S;  4OB2 B;  4M78 F;  2HKQ B;  4RTW A;  1Q81 C;  2E5Q A;  1W4S A;  2FRY A;  3TQ7 P;  3QZ5 B;  4ELZ C;  1UGV A;  1ZUY A;  2LNV A;  3GBQ A;  4IUV A;  2D1X A;  2GGR A;  4X1V A;  1Q95 G;  2QYZ A;  2FG0 A;  3C95 A;  3VS1 A;  3L2W A;  3VS3 A;  1LPL A;  1G2B A;  1VQP T;  3VS4 A;  1RAC B;  4IIM A;  5CCA A;  3M4Y A;  4OMP A;  4XU3 A;  4ELY C;  1M4Z A;  1N8R C;  2D8H A;  3O5Z A;  2MIO A;  4AG2 C;  3OYY A;  2KDS A;  2WSF E;  3RES A;  2QDL A;  3HFO A;  3M0Q A;  3JB9 G;  4JJD A;  2AIR B;  3PT9 A;  2XKO C;  2JNG A;  4CC4 B;  3O8V A;  1VQP Q;  2XHC A;  1T3L A;  3OBY A;  2LCC A;  4FW1 A;  1OU8 A;  3JCM c;  1JRI A;  5J3B A;  1UEC A;  4BUG A;  3UDC A;  2KBT A;  3X28 B;  4F17 A;  1VQO A;  3JB9 J;  5FRO A;  3CCL T;  1Q82 R;  4LE9 A;  2K79 A;  2ZPE B;  2ED0 A;  2RI5 A;  5GAN 4;  2DL5 A;  4XQ3 A;  5HCK A;  3I56 A;  1Y07 A;  1NLP C;  2DD5 A;  4C8Q D;  2QAZ A;  4M7D A;  2YXY A;  4WCI A;  4PL6 A;  4AFQ C;  5FW9 A;  3HRT A;  3ZBD A;  4A4H A;  4XK8 E;  4ME7 A;  1M3B A;  1VQ9 A;  4M7D E;  4EMG A;  2HDA A;  1M8V A;  1WGS A;  1PM3 A;  2M02 A;  1D3B B;  2ROL A;  1VQ8 A;  1SPK A;  1WHL A;  1H64 1;  3I5R A;  1PC0 A;  3GIB A;  1PD0 A;  1T0H A;  4E7J A;  5DLO A;  2NYS A;  2CH4 A;  4CI0 C;  3CCM A;  2ENM A;  4J6W A;  2K6D A;  4NS5 A;  2QEX T;  3VS7 A;  2VYT A;  3CC2 A;  1XOV A;  2V8I A;  3OA6 A;  2L3S A;  4OMM A;  2QI2 A;  2HAX A;  4OF1 A;  2LTO A;  3M9Q A;  4FYX B;  3PGG A;  1VQP A;  1K8A R;  2D0Q B;  2FZC B;  2DZ9 A;  4PJO G;  4FM4 B;  1O9S A;  4OB1 B;  1U06 A;  2XIC A;  4DA4 A;  4JPB W;  4Z8A A;  2AT1 B;  4OMF B;  5EC7 A;  2DET A;  2COY A;  3AHU A;  1N6A A;  1CKA A;  2HBP A;  2DYI A;  2PZ1 A;  3L2U A;  2RNA A;  1OUL A;  1ZA2 B;  4Z89 A;  1WQW A;  1U3O A;  3H41 A;  2JS2 A;  3ULR B;  2LZ6 B;  1GFC A;  2HMA A;  4D8K A;  4JUV A;  5LJ3 f;  2IIM A;  4OGC A;  2HL3 A;  4Y91 A;  4J5Y A;  1VIE A;  3OB9 A;  3ME9 A;  1X43 A;  2F5K A;  2A0F B;  4BAC A;  1JEG A;  2BE7 D;  2DXB A;  4J9E A;  5CVI A;  1M1K U;  1RAA B; 
#chains in the Genus database with same CATH homology
 4HT8 A;  2CGH A;  2V8J A;  4LDU A;  5CKF A;  4A4K A;  2E6N A;  2EJF A;  1UB4 A;  1KQ1 A;  2RD1 A;  3FIF A;  5LJ3 h;  2JTM A;  4N4H A;  3OYH A;  3OW2 A;  3CCL A;  3JCM g;  3A8L B;  5I21 A;  5GAN j;  1N9R A;  4HCB A;  2XG8 D;  5C6S A;  4O6J A;  3OS2 A;  3VYG A;  4C0D C;  1VQ9 T;  3CC4 A;  2Y4X A;  2VXF A;  2QQA A;  4QQ6 A;  2OAU A;  4PLI A;  5A2Q E;  3OS1 A;  3GP8 A;  2P0P A;  3JB9 D;  2WAC A;  2QDY B;  4MZT A;  4ZGD B;  5LJ3 g;  5LJ5 d;  3H8Z A;  3JCM b;  3A8H B;  1NE8 A;  3MO8 A;  3NTH A;  4MZM A;  2PVD B;  5LL6 S;  3VUZ A;  4MDX A;  4IUR A;  2OTJ T;  1MGQ A;  3MCA B;  3V8L A;  1WNL A;  3MP8 A;  3M56 A;  3CCU T;  3S3N A;  2IVW A;  1KD1 U;  4BI8 B;  3HL8 A;  3INZ A;  4C92 C;  3L1A A;  3QG1 A;  3OMC A;  2RJE A;  4C8Q E;  1X01 A;  2OTL A;  4FU6 A;  3BW1 A;  2E12 A;  2JTF A;  4M77 G;  2ZZD A;  5KH6 A;  2L3R A;  4R55 A;  5KCO A;  3J80 E;  1Q86 C;  2L89 A;  2VUB A;  2DTI A;  4PJO D;  3OYC A;  2FVU A;  3QII A;  4B9W A;  3V7S A;  3HFN A;  5GAM e;  2KQW A;  4FSX A;  2R57 A;  1VQ5 T;  4M78 A;  1WJS A;  3OMG A;  2MI6 A;  4C0G A;  1DJ7 B;  4XU2 A;  4J6X A;  2QXF A;  1B34 A;  4M77 C;  2VGM A;  4MZP A;  2ZPG B;  2ZCF B;  4C5G A;  1K8A C;  2PVO B;  4IUQ A;  3V7R A;  4C0Z A;  4M75 B;  2K3Y A;  1KHI A;  4EDU A;  2GFU A;  1K8A U;  1S72 T;  3HKS A;  1M5Q 1;  3LYI A;  4CRI A;  2ZPH B;  2K5I A;  3A5Z B;  4L5G A;  4C92 B;  4C92 E;  3OYB A;  4BDY A;  2CZ7 B;  4OGE A;  1W2B S;  2RHU A;  3QYH B;  5LJ3 e;  1X75 C;  5DM7 R;  5LJ5 j;  3CC4 T;  5GAN g;  1Y7X A;  4M78 B;  2YHT A;  1KD1 C;  2RO0 A;  4P5N A;  3LH0 A;  1K9M U;  4JLG A;  3RMS A;  2H3J A;  2K4Y A;  1FWZ A;  3ER0 A;  4BE1 A;  1Q86 U;  2RI2 A;  2V8K A;  1EIF A;  2EKO A;  3WVE B;  4F7U A;  3FLG A;  3CCJ A;  4PJO E;  5CAI A;  2LQK A;  2RJD A;  3M53 A;  1BI1 A;  5IN1 A;  5DY9 A;  4QVD A;  4F7U F;  2BKD N;  3CME A;  3X20 B;  3VV0 A;  2PQW A;  4M7D B;  3JCM V;  3M59 A;  3CCU A;  2LCL A;  4M77 F;  2Y4Y A;  1KC8 C;  1VQ6 A;  4HKE A;  3A8G B;  5LJ5 h;  3CMA A;  2D6F A;  1I8F A;  2PU9 B;  4C8Q B;  2RB6 A;  4QQD A;  4XTU A;  2LX9 A;  3RUX A;  1Q82 C;  5FU6 C;  4M7A B;  3CCE A;  4TVR A;  3G4S A;  1JJ2 A;  5J39 A;  5GAN 6;  5GAN 5;  1Q7Y U;  2EWN A;  5GAN f;  5D6Y A;  2RK1 A;  3M54 A;  3C94 A;  3OQ5 A;  3X24 B;  2R5M A;  3EAE A;  1VQL A;  4IKF A;  5L8R E;  1G3W A;  1M1F A;  2RHY A;  2O4X A;  3OYJ A;  5FU7 C;  1VQN T;  3QKJ A;  4XU1 A;  4M7A C;  2EQU A;  1O75 A;  5GAM j;  5HK3 A;  2O01 E;  3JCM e;  3H6Z A;  3OYA A;  4NL2 A;  4JJN K;  1VQ6 T;  1YJ9 A;  3L2V A;  3P8H A;  1YIT T;  3PTA A;  3HHT B;  3HP9 A;  5KE3 A;  5GMK i;  5IT9 E;  3CPF A;  4UC4 A;  5FU7 B;  1VQ8 T;  2EAY A;  4X9D A;  3OY9 A;  2KMT A;  5A0G A;  3M55 A;  3CD6 T;  2LT1 A;  4KBM B;  2HQX A;  4NOY A;  3TEE A;  4C8Q G;  4N4I A;  1KC8 U;  1VQ5 A;  2DXT A;  4JRQ A;  5GAN 3;  1U8R A;  4M7A G;  1N9S A;  5LJ3 d;  3UT1 A;  5LJ5 g;  1YJW A;  2DXC A;  2C06 A;  1P92 A;  4PKC C;  2KSS A;  3OYK A;  1KQ2 A;  1MHN A;  2KK4 A;  2M16 A;  3QJ6 A;  2MMP A;  3JB9 H;  3GNG A;  3OYL A;  1VQ4 A;  1Q7Y C;  1QVG S;  2X35 A;  4JRK A;  1KHC A;  3JCM J;  2R5A A;  2AHJ B;  3CMA T;  3LWH A;  3QXE B;  1M1K C;  4M75 A;  5GAM g;  1K9M C;  4EMK B;  1G3Y A;  3C12 A;  3BY7 A;  3E1S A;  3PMI A;  1XQH A;  3N5B B;  3G6E T;  1YJN A;  5GAM h;  4E7H A;  4C8Q F;  3CCS T;  1QVF S;  3OS0 A;  4C92 A;  1Y71 A;  3L2Q A;  5GAM d;  5GMK j;  4YTL A;  3CCR T;  3OS5 A;  4FL6 A;  4OVA A;  2DVE A;  1VQL T;  4N4G A;  3GLX A;  1UGR B;  3C4S A;  4RG2 A;  3QDR B;  3JCM P;  2LC4 A;  4IUT A;  4XAX B;  4BI3 A;  1WJR A;  2DO3 A;  3FRN A;  3QPH A;  3RIR A;  3OW2 S;  1VIF A;  1YCY A;  4KT0 E;  4B9X A;  2KAF A;  2E41 A;  1LNX A;  2VGN A;  2RJC A;  3M58 A;  3OYF A;  4ZN1 A;  3CCE T;  2DD4 A;  4FT4 A;  2K3X A;  4QW2 A;  4RG8 A;  1YI2 A;  5GAN 8;  5I2S A;  1YIJ A;  3S6W A;  2OTL T;  2VXE A;  1Y96 A;  4M7A A;  4KUL A;  1LOJ A;  2P0K A;  4X34 A;  3ZEH A;  4BY6 B;  4M77 A;  3CCQ T;  1YJ9 T;  4M7D D;  1G3S A;  2EFI A;  3WXM B;  3QZ9 B;  1HXD A;  3Q1J A;  3MEW A;  3P8B B;  2OTJ A;  2XD0 A;  4QVC A;  1G5V A;  2HNI A;  3KUF A;  4XTV A;  3X26 B;  2GFA A;  1XNI A;  1S72 A;  2EIF A;  2DJZ A;  4IUP A;  4IUU A;  4N0A C;  5LJ5 f;  1WQ7 A;  3F70 A;  3OYE A;  2M0O A;  3OSV A;  3JCM X;  2DAQ A;  1IZ6 A;  4C0D B;  2QA4 T;  4EPC A;  1BI2 A;  4BE0 A;  5CQY A;  4GLK A;  1YI2 T;  5FRN A;  3BDU A;  2RA2 A;  3TRE A;  3CD6 A;  5IAY A;  2EJG A;  5GAM f;  5GAN e;  4JRI A;  1JJ2 S;  3P8D A;  4C92 G;  4XTY A;  3GOX A;  1OZ3 A;  1QP2 A;  2HD0 A;  1VQM T;  3FEO A;  4GY5 A;  3CME T;  4HT9 A;  3JCM h;  3QUI A;  1VUB A;  2ZGW A;  2CZ1 B;  4O5V A;  4M75 G;  3UWN A;  5D6W A;  4RMO A;  2DTO A;  5A0L A;  4ZGJ B;  3VU3 C;  4OP0 A;  4X9C A;  4A4G A;  5C0M A;  3CPW A;  3CCM T;  4JRP A;  1QVG A;  5M9O A;  4RCC A;  4VUB A;  5CIU A;  3L2Z A;  4PJO F;  2XDD A;  1PSF A;  3CXC S;  3E9F A;  4HA8 A;  4MML A;  5HKC A;  3URG A;  1VQN A;  3QYG B;  4MDW A;  1RL2 A;  3QHS A;  4A4E A;  1YBY A;  4F7U G;  3LGF A;  1BIB A;  4Y28 E;  4J6Y A;  2NLU A;  3PMT A;  2L8D A;  1IRE B;  2X4J A;  4C5I A;  3EFS A;  3RKY A;  3LX7 A;  2YLC A;  4C8Q A;  4JLI A;  2KVQ G;  2D9T A;  4M77 E;  4HCZ A;  1ZBX A;  3RKX A;  3PFS A;  5CQX A;  4FT2 A;  5A0D A;  3FDR A;  3LLR A;  4R56 A;  4ZTJ A;  2DZC A;  2JN0 A;  4ZTF A;  4PLL A;  1YJW T;  1Q82 U;  3OYN A;  3I55 A;  2EQM A;  2B8A A;  1VQK A;  4A4F A;  5GAO p;  3JB9 F;  2CKK A;  2EQK A;  3VKI A;  5GAO n;  2K57 A;  4LDX A;  3DB3 A;  2RK2 A;  2YLB A;  4Z02 A;  3LGL A;  4LDV A;  3PIO A;  2M1H A;  5FRM A;  3J81 E;  1M90 U;  2RI3 A;  4M77 B;  4E47 A;  1N27 A;  2WSE E;  3V8J A;  2DKG A;  2PUO B;  3X25 B;  2DEQ A;  4NL3 A;  1K73 C;  5GAN d;  3OYG A;  1VQ7 A;  5LJ3 j;  2K5F A;  1AHJ B;  5GAO r;  3CBP A;  1K73 U;  1OYX A;  4XU0 A;  2M9U A;  4MMK A;  1VQ7 T;  5EG2 A;  3GPL A;  4M7A E;  3LWI A;  2XID A;  4ZGE B;  4XTZ A;  4C8Q C;  3CCS A;  4C5E A;  3DLM A;  3RMQ A;  2DPP B;  2LVM A;  1BIA A;  5CKB A;  1PSE A;  1UEB A;  4Q5W A;  1FXX A;  3BFM A;  4HCC A;  3TU4 K;  1JBM A;  2CS7 A;  1YHQ T;  2QQR A;  1B34 B;  2LQ8 A;  4M78 D;  2P4T A;  2RHZ A;  3L42 A;  4KUI A;  1UGQ B;  4BB7 A;  1WJQ A;  4F7U E;  5CR2 A;  3S3M A;  2K5L A;  3SB2 A;  2G3R A;  2XDP A;  4OB2 B;  3G6E A;  4M78 F;  2LRQ A;  2E10 A;  2I2L A;  2RHI A;  2GCX A;  1R8O B;  3G71 T;  4E7I A;  3QJY A;  2E70 A;  4PJO B;  1Q81 C;  2CYZ B;  1W4S A;  2E5Q A;  5GMK l;  3DLL A;  2LDM A;  3QZ5 B;  4ELZ C;  1ZHI A;  3J7A F;  2QEX A;  3M4G A;  2R58 A;  1WPY A;  3MHX A;  2LNV A;  3MP1 A;  2XU8 A;  5CKD A;  3NTI A;  2DTH A;  3OYI A;  2A3L A;  4LDW A;  4IUV A;  3VJP A;  2RM4 A;  4DOV A;  4EMK A;  3C95 A;  2ZPF B;  4V2S A;  3GF5 A;  1BKB A;  2CZ0 B;  3MET A;  4BDZ A;  3L2W A;  4XTX A;  5I2M A;  4OB3 B;  1VQP T;  5CK9 A;  3JCM f;  4EMH A;  2VC8 A;  4N0A A;  4JDS A;  4M77 D;  3SWN C;  5CCA A;  3M4Y A;  3MEU A;  3NFC A;  5FLX E;  4XU3 A;  4ELY C;  1M4Z A;  1N8R C;  3V8K A;  2JUF A;  2RHX A;  5HK0 A;  1M90 C;  3E9G A;  1Q81 U;  1X6O A;  1VQK T;  3CBM A;  2BIV A;  1ZQ1 A;  1D3B A;  3S3O A;  1OI1 A;  2E6Z A;  2KDS A;  2WSF E;  3OYY A;  3RES A;  3HPW A;  3HFO A;  5GAN 2;  3JB9 G;  3ZFJ A;  2DXU A;  3SDZ A;  4LD9 K;  1NZ9 A;  3WVD B;  2GQV A;  5KE2 A;  1I81 A;  2QQS A;  4QQG A;  4RKU E;  3V7C A;  4M7D F;  2Y90 A;  2XDB A;  1BYM A;  4L59 A;  3CCR A;  3PT9 A;  4M7A D;  2XKO C;  3HSB A;  2JVV A;  2JNG A;  1KG1 A;  3CC7 T;  3O8V A;  4KUD K;  3CCV T;  4M7D C;  1NJI U;  2XHC A;  3JCM Q;  1H3Z A;  5DLQ E;  3T9N A;  3OBY A;  2LCC A;  4A53 A;  1Y96 B;  3GNF B;  2MWO A;  4J8O A;  1JB0 E;  3JCM c;  1JRI A;  2FYK A;  5J3B A;  1GXI E;  3VUB A;  4BUG A;  3OYD A;  2PVG B;  3UDC A;  3X28 B;  2FHD A;  5GMK h;  5GAO q;  1QP3 A;  3SFM A;  3CEY A;  3NTK A;  5HY6 A;  5GAN 7;  2QA4 A;  3JB9 J;  4J83 A;  3JB9 I;  3HRU A;  1VQO A;  5FRO A;  3JAM E;  4L6V 5;  3L2R A;  3CCL T;  4M75 D;  4M75 F;  2ZPE B;  2RI5 A;  4PJO A;  5GAN 4;  5CO7 A;  3MEV A;  4XQ3 A;  4C92 D;  3I56 A;  1BI3 A;  2IG0 A;  1Y07 A;  4QVZ A;  2F5T X;  1SSF A;  3E19 A;  4BI4 A;  2DD5 A;  1NPR A;  4C8Q D;  1U1T A;  4M7D A;  5GAO m;  4PL6 A;  3JRZ A;  3HRT A;  5CKE A;  5GAO l;  1XTD A;  3KBG A;  4RCB A;  3ZBD A;  4A4H A;  4XK8 E;  4E7K A;  4ME7 A;  1NPP A;  1M9S A;  1NJI C;  1G3T A;  2DK3 A;  5D6X A;  3JCM d;  3OSS C;  2FB7 A;  4WF2 A;  4F7U B;  1YHQ A;  2LT4 A;  1VQ9 A;  4OB0 B;  5GAN h;  4M7D E;  4M78 C;  4EMG A;  2A7Y A;  1YIT A;  1HK9 A;  3JSC A;  1M8V A;  1WGS A;  2GF7 A;  3CC7 A;  2X4X A;  2JZ2 A;  3KXT A;  1D3B B;  2EQJ A;  4JS4 A;  1VQ8 A;  1W2B A;  3QO3 A;  2YRV A;  4BY6 C;  3TCJ A;  2CZ6 B;  4M75 C;  1H64 1;  2MAM A;  2P0Q A;  4BE2 A;  2MWP A;  4DOW A;  2PUK B;  3GIB A;  4II1 A;  2L5Q A;  3DB4 A;  2QQ9 A;  4M78 G;  4E7J A;  5DLO A;  4E7L A;  3G71 A;  1VQ4 T;  4CI0 C;  4M7A F;  2BUD A;  3G7Z A;  3CBO A;  3CCM A;  4PJO C;  3HRS A;  4XTW A;  4J7I A;  4J6W A;  3JCM W;  4NS5 A;  4M7D G;  3I56 T;  2QEX T;  1I4K 1;  2VYT A;  2X4W A;  1XOV A;  2V8I A;  5J26 A;  4C0F A;  3OYM A;  3OA6 A;  1I5L A;  3CC2 A;  1BI0 A;  2JOY A;  2QI2 A;  3OBW A;  4OF1 A;  2HAX A;  2LTO A;  2RJF A;  2WSC E;  3M9Q A;  3PGG A;  1VQP A;  3CCQ A;  4EMK C;  3LW5 E;  1RI0 A;  2D0Q B;  2EJ9 A;  2EYQ A;  3MEA A;  4M78 E;  2E65 A;  2DZ9 A;  3A8M B;  3CPW S;  4PJO G;  3FJP A;  4FM4 B;  2O4X B;  1O9S A;  4OB1 B;  3MP6 A;  3PIP A;  1FX7 A;  4M75 E;  2XIC A;  4DA4 A;  3CXC A;  3CCJ T;  1N8R U;  4OMF B;  3R6O A;  2F69 A;  1OZ2 A;  3AHU A;  3UPU A;  4FIB A;  2X4Y A;  3A8O B;  5AYF A;  3SD4 A;  1N6A A;  3EFR A;  1KQS S;  2HBP A;  3BDL A;  4J7F A;  4PNO A;  5GMK e;  2QTX A;  1UGP B;  1VQM A;  2E1H A;  4BD3 A;  3RER A;  3L2U A;  1YJN T;  2K2V A;  1QVF A;  2XI9 A;  3M57 A;  5CKH A;  3G4S T;  3QBY A;  2XK0 A;  5KCH A;  3QSU A;  2ZPB B;  1KQS A;  4D6W A;  3SWN A;  3I55 T;  4ZN3 A;  1WQW A;  2VV5 A;  2DIG A;  1QVP A;  1TH7 A;  1UGS B;  1V29 B;  4JS5 A;  3M5A A;  2ZPI B;  4C5H A;  5GMK m;  3CC2 T;  2FL7 A;  2RH2 A;  4LD6 A;  3FB9 A;  4JUV A;  3DKM A;  3CCV A;  1YIJ T;  5LJ3 f;  2KY9 A;  4OGC A;  3ASK A;  1QW1 A;  4A54 A;  1U1S A;  4Y91 A;  4C92 F;  4J5Y A;  1VIE A;  3OB9 A;  2E64 A;  1LJO A;  3ME9 A;  3SWN B;  5LJ5 e;  2F5K A;  4BAC A;  4DQ2 A;  2MF2 A;  4LDY A;  4ATO A;  5FU6 B;  1VQO T;  3RKW A;  2DIQ A;  2HQE A;  2QQB A;  2DXB A;  3PNW C;  3VYH B;  5CVI A;  1M1K U;  3FC3 A;  1M1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...