5GMKm

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 12
structure length 82
sequence length 109
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkm00
5LJ5f 4J6YA 4M7AB 5GAOm 1H641 2E64A 2E1HA 2YLCA 2I2LA 3JB9I 2DKGA 1X01A 5GMKi 5GAN8 4JRKA 2EAYA 4M77D 3GIBA 5LJ5g 4M7DE 5GAMh 2RA2A 2RB6A 3L2ZA 4X9DA 2E41A 1U1TA 4XQ3A 3JCMV 2DEQA 5GANh 5LJ5j 4C92B 5GAOn 4EMHA 4RCCA 2FB7A 3BDUA 4M75G 4XU3A 5GAMd 4MMKA 4XTZA 2VC8A 3SB2A 4C8QA 5GANd 1LNXA 4F7UB 5GAOq 2DZ9A 4M78E 3JB9F 3BFMA 2E10A 4M75F 3RKWA 3PGGA 2Y90A 4M7AD 4C92A 1WQWA 3BW1A 4JLIA 3SWNA 5GAMg 5GAOl 5GANg 4F7UA 1WQ7A 4XU2A 5I21A 5GAMj 4PJOF 1I8FA 4M78C 4M77A 2DTHA 4WF2A 3JCMh 2FYKA 3BY7A 4M7DB 1D3BA 4OP0A 4PJOA 5LJ5e 1B34B 1U1SA 3JCMd 4N0AC 4NL3A 4XTUA 2HNIA 4M78B 5GMKh 3FIFA 2EJFA 3RKYA 2DVEA 4DQ2A 4QVDA 1I81A 4XU1A 4EMKC 3V8KA 4EMGA 3RIRA 4J6WA 3JB9G 4M7AA 3JCMg 5GAN2 1M8VA 4RCBA 4JRIA 4C8QG 1MGQA 5GAMe 3RUXA 4M75C 5GAMf 4M7DD 2YHTA 5GANe 1N9SA 1KQ1A 3V7CA 1LOJA 5LJ3h 4EMKB 5GANf 4A54A 4C8QF 4PJOG 2DXUA 2JN0A 4XTYA 3V8JA 4PNOA 5LJ3d 4XU0A 4JUVA 1KQ2A 4PJOC 3JCMc 2EWNA 5CAIA 5GMKj 4M75B 4M78D 3EFRA 4M77G 4C92F 5GAOr 5GANj 4XTWA 1I5LA 4HT8A 1HK9A 2RM4A 2RD1A 1Y96B 3HFOA 2ZGWA 1M5Q1 4M77F 5LJ3g 3JCMe 1YCYA 2DJZA 3L1AA 4J6XA 4M75E 1BIBA 3FB9A 4XTVA 3JCMf 5DY9A 4C8QE 5LJ3j 3V7SA 1HXDA 4NOYA 5GMKm 3JCMX 1TH7A 4NL2A 3V7RA 1B34A 5GAN3 4M7AG 3QUIA 3VU3C 3JB9D 3JCMP 4PJOE 5GMKe 4A53A 3JCMb 4X9CA 3RESA 4M75D 1WPYA 4M7DA 4M78A 1JRIA 1BIAA 4M7AF 2E65A 4C8QC 3JCMJ 4M77E 4C92G 5GAN6 4PJOD 4N0AA 4XTXA 4C92C 2EJGA 3SWNC 1LJOA 2CGHA 4F7UG 5LJ3e 2DXTA 5LJ3f 4C8QB 5GMKl 4EMKA 3JCMQ 3HSBA 3QSUA 3AHUA 4Y91A 2DTIA 4J5YA 4M77C 4F7UF 3JB9J 3JB9H 4PJOB 3INZA 4M7AE 3SWNB 4M75A 3QHSA 1I4K1 4M7DG 4MMLA 5GAN7 2DZCA 2DTOA 4HT9A 3RERA 4M77B 4M7DC 2K57A 1Y96A 1D3BB 1WNLA 4QVCA 1JBMA 2VXFA 2YLBA 3RKXA 4C92E 5GAN4 4M7DF 3FJPA 3HFNA 3EFSA 4M7AC 5LJ5h 1N9RA 4C8QD 4M78G 5GAOp 3QO3A 4F7UE 3M4GA 3V8LA 4HA8A 2EJ9A 5LJ5d 3JCMW 5GAN5 4V2SA 4M78F 2VXEA 2QTXA 4C92D
chains in the Genus database with same CATH superfamily
1TUCA 4HCZA 3RBBB 2EQKA 2WSCE 4XAXB 3M57A 1OI1A 3ZEHA 2MF2A 4C92B 1ZBJA 2AZVA 1X2QA 1K9MR 5GAOq 3REAB 2M9UA 3EGDA 2OX7A 3SWNA 1YWOA 2RQTA 2LJ3A 3HRUA 3PFSA 4CC2A 1K8AC 4M77A 4M78C 3OS5A 3HP9A 1B34B 5KYNA 2PVDB 3UF4A 3FIFA 1UTIA 2KRMA 4OF1A 2IIMA 1PG5B 1M8VA 4FYWB 3CEYA 1UGRB 3QZ5B 1W2BA 4D6WA 1EIFA 3CCUT 2F2XA 3CD6T 1H8KA 4PNOA 4MZPA 1QWFA 2EQMA 2HKQB 4KH1B 4XTWA 4FW1A 1UGQB 1BI1A 2F2VA 3M56A 1NJIU 2NUPB 4BI8B 4L5GA 2JT4A 1SKUB 3QJYA 3UT1A 2FO0A 5GAN3 1AEYA 1TS9A 2DBMA 2YUOA 3VS0A 2SRCA 4FL6A 3CC4Q 1VQ4A 2DRKA 4OMPA 3M58A 3CCJT 5IXBA 1V29B 4OMLA 4E7ZA 5CKDA 1RUWA 4ORZA 2EGEA 4A4EA 4JPBW 4HVVA 1X6OA 4F16A 1H92A 1QVFP 3M9QA 2LQ8A 1FMVA 4ZTFA 2RPNA 1ZUUA 4BY6B 3QWYA 1M2VA 2E64A 5A0DA 4JRKA 1EX4A 2FZCB 2WSFE 4XK8E 1SSHA 1D09B 4AFQC 3EG3A 4AG2C 3TVTA 3I55A 2KNBB 5IAYA 2FPDA 5KYXA 3I35A 4JZ4A 3JB9F 2XDDA 1WYXA 1YWPA 2DL3A 4M7AD 2GQVA 5CCAA 3OYMA 4QT7A 1M3CA 1U06A 2FYKA 3OSSC 1D3BA 4DEXA 1NYGA 2JS0A 3CQTA 1RLQC 3SHWA 2COZA 4RMOA 3O5ZA 4AFSC 1MV0B 1QWEA 4PJJA 1OOTA 3RIRA 2QQRA 1YHQT 3RUXA 3OYBA 1NJIC 1OPLA 2BUDA 2DE0X 4JZ3A 2JN0A 1SHFA 5HK3A 1VQPQ 4RTXA 1UB4A 2X4WA 1OULA 4E6RA 1VQOT 4C5GA 1NEBA 2A36A 2CZ1B 2Y4XA 1RAHB 1BI2A 4NOYA 3V7SA 3KXTA 4KGXB 4AG1C 3V7RA 4HCCA 1RAAB 1X27A 2V1RA 1IHVA 4PJLA 1KFZA 3SWNC 1VQ6T 2L2PA 3QDRB 1YI2A 2XIDA 4EMKA 5GMKl 3QSUA 2LJ1A 1G3YA 1EFNA 4M77C 3GPLA 3G71A 1QKWA 1YP5A 8ATCB 4M75A 1WIEA 2EGAA 4MMLA 3S6WA 1T0JA 2XICA 1KIKA 4LNPA 1JBMA 1O75A 3QO3A 4LUDA 4QQGA 4EIKA 2VXEA 2X35A 4F14A 2EYXA 2QK0A 3M59A 1WHHA 2VVKA 4X1VA 1S72T 2EAYA 2XDBA 1AWXA 3CMEA 2EW3A 2RB6A 3L2ZA 2DL7A 1NBEB 3JCMV 5GAOn 1E7OA 3CPWA 2VKNA 4XU3A 2ZZDA 4RTYA 3VRYA 2QQBA 5KYUB 1IGUA 1AVZC 1WQWA 3BW1A 5FU7C 3VUBA 5AYFA 1UDLA 4NL3A 2YUQA 1OEBA 2HNIA 4FIBA 2KY9A 4M78B 4M7DA 5CO7A 1VQNA 2CZ0B 2DVEA 1VIEA 3CCVQ 1W2BP 2CUDA 1OZ3A 1NG2A 4C5IA 3NFCA 1UGVA 4IUVA 2PZ1A 2AZSA 3UPUA 2E6NA 3OYYA 1XTDA 2MCNA 2CT4A 4E7KA 4GY5A 2ZCFB 2EYYA 5GMKj 3M0SA 3M0PA 3CMAQ 1PD1A 4DEYA 1Y96B 3MEWA 5J26A 3I56Q 1TUGB 1PCXA 1VQNT 3JCMX 3CCRA 4OMOA 1TH7A 3JV3A 3MCAB 1IGQA 4X9CA 4A63B 4J9BA 4IURA 1NM7A 3JCMJ 1MMGA 3CCMQ 1PKTA 4FYVB 4J9FA 3H0HA 2ECZA 2LNVA 2KXCA 3CBMA 4KBMB 3ZL7C 1YNZA 2QDLA 2JM8A 3S3OA 3NTKA 2DTOA 4HT9A 3RERA 2D8JA 3X26B 1KJWA 2L5QA 3JRZA 1QVGA 3OBWA 2JM9A 3EG2A 3OYDA 1FYNA 1H641 3CCUQ 4DOWA 3CD6Q 3EHQA 1J3TA 1IXDA 1D1CA 2DBKA 2QQ9A 4E7JA 2HQHA 2RK1A 2ENMA 2HKNA 3BDUA 3DB3A 2YRVA 3CCEQ 2L8DA 2K5LA 1IHWA 5IHIA 1K8AR 1PM3A 2ROLA 1RADB 4HXJA 5I11A 1GFCA 2PU9B 3Q1JA 2QXFA 5LJ5e 2K3YA 1SSFA 5D6YA 4KH0B 2K7AA 3CXCS 2RN8A 4EMKC 2EYWA 1K73R 1WJQA 2X51A 1R0BG 1Q7YU 2LCSA 3CC4A 4M75C 1LOJA 3LX7A 2J6FA 2QASA 2KROA 1FX7A 3P8BB 1M8MA 3OYNA 4E7IA 3VRZA 2AT1B 3M0RA 1I1JA 2ZGWA 2CS7A 3JCMe 3H0FA 3NTHA 4J6XA 1GCQA 3FB9A 3M53A 3QKJA 1Q86R 1WLPB 1YJWA 2F1LA 3RESA 1ZHIA 2CT3A 5IXFA 2RHIA 2CSQA 3N5BB 1PC0A 2EKOA 2LVMA 4BUGA 1YJNQ 4JDSA 4BE2A 3ZBDA 1G8XA 1E6HA 4GBQA 4JS4A 4M4ZA 7AT1B 1RAGB 4FM4B 1X69A 4Y91A 2VB6A 2X4YA 2RI3A 5J3BA 4A4GA 3EGDB 2XHCA 3SWNB 4N4GA 3MHXA 4M77B 4M7DC 1NPRA 4F17A 2VXFA 3C0CA 3H6ZA 4R56A 2RMOA 3RDVA 5A2QE 1BU1A 3G6EA 5KE2A 3THKA 4BE0A 3VV0A 1DJ7B 1YITT 2FZGB 2O9SA 4LDUA 4ME7A 2FHDA 2IG0A 5CQYA 3CPWP 5KYWA 1HJDA 1U1TA 3KUFA 3PTAA 2RJCA 4XTZA 3BE3A 4IUTA 4F7UB 1VQ7Q 1VQPA 4BB7A 5GAOl 4FT2A 5GANg 1BK2A 3G6ET 2RJDA 3A8OB 1Q7YC 4PJOF 2DIGA 2YUPA 1M90U 4GLKA 2GTJA 4N4IA 1QQJA 5I2MA 1VQ5T 1YJ9T 1QVFA 3M54A 3NHNA 3UATA 1I5OB 1U5SA 2EJFA 3RKYA 1U8RA 1KHCA 3HPWA 2KVQG 4KUIA 4ZGDB 3EHRA 5GAN2 3EAEA 1NJIR 1M1GA 1UEBA 3L2VA 3G4SQ 4IUUA 1RI9A 2RNAA 4XTYA 3E9FA 3PT9A 2EWNA 1WXUA 3QPHA 4C92F 1YCSB 4HT8A 2E5QA 2MWPA 3DB4A 1HK9A 2RM4A 1AHJB 5IH2A 2QEXT 5GJWB 3CCST 3A98A 2DJZA 1NZ9A 4LE9A 2DD4A 2LCLA 8AT1B 2HL3A 1M2VB 3A8HB 2KK4A 2FL7A 2DLPA 1NEGA 1MMAA 2ZPBB 2X3XD 1T3LA 2DXTA 3M0QA 2P0PA 4CC7A 2YSQA 2ROTA 4AT1B 2JXBA 2F5KA 4PLIA 4M7DG 2MMPA 2DZCA 3CCLQ 5HCKA 3PIPA 2MWOA 1KD1U 1D3BB 1GBQA 2LX9A 4KUDK 4M7DF 1QVGP 3GNGA 5LJ5h 3JSCA 2NUZA 1QP2A 5LJ5d 4V2SA 3CCVA 2ED0A 1JXMA 2E1HA 1N8RR 4FW2A 3CCQA 2F5TX 2HBWA 2OTJQ 2VGMA 1M90C 4FU6A 1D0XA 2QI2A 3FLGA 1LNXA 1MUZA 1GCQC 5CKHA 2OJ2A 2PUKB 3IQLA 3QZ9B 1JB0E 3CMAA 3I56A 4PJMA 4C0ZA 3JCMh 3UWNA 1F1BB 2YXYA 3JCMd 2A28A 3NMZC 1NLOC 2AKKA 2VV5A 2PQWA 3CC7T 3VS1A 3TREA 3CCMA 4C8QG 5GAMe 5EC7A 4OB0B 1G5VA 2PVGB 3FC3A 4EMKB 1UFFA 1R8OB 4C8QF 1VQMQ 2DXUA 4J7FA 4EPCA 4DBRA 4M75B 4M78D 4B6MA 1B3QA 3OSVA 2EBPA 4OB2B 2XD0A 1G2BA 4M75E 1WX6A 3BDLA 2K5IA 4BD3A 2EPDA 3D7SB 3OS1A 5A0GA 2OTLQ 1AZEA 2RI5A 1Q82U 1ZA1B 3MP6A 1RAFB 2YRCA 2J6OA 1BCMA 2CKKA 4IUPA 1T3SA 1Q81C 4N0AA 1KD1C 5LJ3e 2JTEA 1PSFA 3JCMQ 3CCEA 4PL6A 4OMFB 1M1FA 1Y7XA 2LCCA 3OMGA 4JRPA 4DBQA 3EGUA 3R6OA 4BI3A 1MMNA 4ZNXA 4Y28E 4HA8A 2CDTA 3SB2A 2CP5A 4CC3A 1OZ2A 2W10A 2DXBA 4M7DE 4X9DA 1UGSB 1M9SA 4BDYA 2ZPEB 1TWBA 4E2FB 4RTUA 1PRLC 1UUEA 4LDVA 2DYIA 5CKFA 4WF2A 1VQ4T 4MZMA 2K2VA 1VQ9Q 1TUDA 1U1SA 2L3QA 2CP2A 2JJ9A 1NE8A 2O01E 4J6WA 3JB9G 1YJNA 1N6AA 1G3TA 2AK5A 1I07A 2YHTA 5GANf 3X24B 2P0KA 4TVRA 1KG1A 3TEEA 1KQ2A 1M1KU 1Q82C 1B7TA 5GAOr 1YFNA 3F70A 1ABOA 3L1AA 4C8QE 1HXDA 4NL2A 3I55T 2X9HA 2BZ8A 2HQEA 5I22A 3WVEB 2KBTA 1CKAA 5CK9A 1FWZA 1NLPC 2DRMA 4MZTA 2R5MA 3EH1A 1X75C 2DILA 3E9GA 2LNHB 2CGHA 2AIRB 1VQ7A 1PKSA 3LW5E 1RI0A 3INZA 4RTVA 3MP1A 1VQ5Q 1RACB 4FSXA 1WDXA 3REBB 3EG1A 4HCKA 2V1QA 4PJOA 2M02A 4OB3B 3HL8A 1PSEA 2C06A 4FYYB 2M1HA 5GAN5 3L42A 1WXTA 2HBPA 3GLXA 2F69A 2QTXA 2RQWA 5LJ5f 4M77D 2GBQA 4JS5A 3G4SA 5GAMh 1SEMA 1JU5C 2LQNA 4EMHA 3CBPA 5GAMd 2X4JA 3HTRA 5CQXA 4IKFA 4X34A 3M0TA 2DL8A 2DNUA 1C1AA 3H9NA 3J7AF 4C92A 3ME9A 1BB9A 3M4YA 3M55A 1VYUA 1H3ZA 1G83A 4RTWA 1X43A 2LQWA 4KRTA 1W70A 5FW9A 1YI2T 2K5FA 4ESRA 4N0AC 1VQ8Q 4C5EA 3G71T 2VASA 1AD5A 2KDSA 2E3HA 3OQ5A 2XKOC 2DEUA 2VUBA 3EH2A 4HKEA 2DJQA 4RCBA 2RQVA 2BE7D 4RG2A 2KGTA 5FRMA 1N9SA 3V7CA 1UHCA 2RI2A 5LJ3h 1V76A 3M0UA 1LCKA 2K4YA 2W0ZA 1D1BA 3MPUB 5LJ3d 2D0NA 1YIJA 2E70A 1TU0B 1VQKA 4C0DC 5GANj 1I5LA 3CCLA 2BE9B 2DPPB 3UA7A 1YCYA 3CMET 5DY9A 5FU6C 4Z88A 3X28B 2GCXA 4FYXB 3OY9A 1VYVA 3PIOA 3VYHB 4M7AG 4RUGA 4M7AF 3RNJA 1VQLA 1KC8R 2DMOA 1K76A 5KYWB 2QA4Q 2OTJA 3MP8A 4HVUA 1JO8A 4P5NA 4D8DA 3EFOA 3TSZA 1ACMB 1PWTA 3CC2A 4VUBA 3QWXX 2ESWA 1OU9A 2GFAA 4C0FA 1U3OA 4N4HA 1FMWA 4O5VA 5HKCA 1ZSGA 1OX9A 4J7IA 1IB8A 3H41A 2D0QB 1T0HA 3VKIA 2ZPHB 4J83A 3MEVA 3MKDA 4B9XA 4RTZA 2QGFB 2YLCA 2L3SA 3M5AA 4XQ3A 3R6NA 5LJ5j 1VQMA 4RCCA 3CCRT 4D8KA 4MMKA 4C8QA 2DERA 2DZ9A 1UG1A 4F04B 4LDWA 3OW2S 1D1AA 3S3NA 3VYGA 1VIFA 2OTLA 2DYBA 5LL6S 5C0MA 3G1JA 2JS2A 5HK0A 2M51A 2GNCA 5CR2A 2P84A 4YTLA 2DD5A 2GTOA 5D6XA 1BI3A 2X3WD 4KGZB 2CUBA 2RJEA 3OYIA 1ZBXA 2VGNA 4PJOC 2CP7A 1M27C 1A0NB 2V8IA 2NYSA 2KT1A 2O88A 3NGPA 3PVLA 3C94A 3CCJQ 2QAZA 1G3WA 3META 3MJXA 2O4XA 1YBYA 1OX8A 4M75D 3UA6A 3OMCA 4RG8A 3A8GB 4ZGJB 1Q81R 1KD1R 1KQSS 2E5KA 5GAN6 1W6XA 1WHGA 4C92C 1JJ2S 1BI0A 4K11A 4OGCA 1W1FA 2C0IA 2K3BA 1QCOA 3JB9J 4M7AE 3QHSA 4C5HA 2B86A 2RK2A 4QQ6A 3VS3A 1RAEB 4ZTJA 3CC4T 1VQ9A 4ANJA 1N9RA 1ZSZA 4B9WA 3M4GA 3L2QA 4PFZA 4BI4A 1SRMA 3LH5A 4QQDA 3A1PA 1SRLA 4LDYA 2RQRA 2YDLA 2LT4A 1V1CA 2HCKA 2K2MA 2KR3A 2MI6A 2JOYA 2KRNA 2NLUA 2RA2A 2FB7A 3GF5A 4ELZC 1UECA 1YJWT 2CSIA 2DF6A 2Y90A 2KYBA 5DLOA 2XDPA 4XU2A 1YHQQ 4CI0C 5I2SA 1MNEA 5IT9E 2FG0A 3EG9A 2LMJA 1X2KA 4LDXA 4QVDA 2G6FX 4EMGA 3AT1B 2PUOB 1QCNA 4ZGEB 1MGQA 1VQOQ 1R77A 4C0GA 4BDZA 3EG0A 2PNIA 2MYSA 2FRWA 4PJOG 1Y07A 3QBYA 4DOVA 1Q82R 2JTMA 5FU7B 3DKMA 2XMFA 5KYYA 2HMAA 2ZPIB 1VQ6Q 1RABB 3OYCA 1RLPC 2LTOA 2JZ2A 5FU6B 1VQPT 2E65A 4JJCA 4OMNA 4C8QC 3HHTB 1IREB 2MPXC 4PK4A 4C92G 1WJSA 4DA4A 1QVFS 2O2OA 1Q95G 1Z9QA 4IIOA 2ABLA 3C12A 5GJVB 1M4ZA 1MNDA 3GNFB 1K9AA 2AHJB 2JUFA 1WGSA 1S72Q 2CP3A 1WNLA 1LVKA 3EGXA 3FJPA 1QKXA 1VQ8A 2K3XA 1QMCA 2EKHA 3VS6A 1PNJA 4J9HA 5KYXB 4J9DA 3VJPA 1FMKA 1ZLMA 3NTIA 5LJ5g 2L89A 1SPKA 2NUTA 1UJ0A 4HCBA 1Y71A 4KGVB 3RKWA 2VYTA 1CKBA 5GAMj 3RMQA 1AWWA 1KK7A 1K73U 4JJNK 3OYLA 2I0NA 3OB9A 4XTUA 4ZN3A 1UJYA 1UGPB 4M7AA 3JCMg 3PNWC 2D6FA 4R55A 2CH4W 2HSEB 2YWWA 3H8ZA 1VQNQ 1N5ZA 4A54A 3WVDB 3T9NA 2RHUA 1WHMA 9ATCB 4Z89A 1ZSZC 1HD3A 3CCVT 2FZKB 4BACA 1G3SA 2F2WA 4WCIA 1Q86U 5IN1A 3CCQT 1AWJA 3CXCP 3QDFA 5LJ3j 1M3BA 5GMKm 3JB9D 4PJOE 3OS2A 3KBGA 1AOJA 1CSKA 1BIAA 3CMAT 5FROA 1ZA2B 3I56T 4A4HA 3I5SA 4A4FA 3OYHA 4OGEA 3VUZA 4DBFA 5ECAA 3JB9H 3J81E 2H3EB 2ATCB 2DO3A 3CCMT 5KCOA 3OBYA 2HAXA 2K57A 2P4TA 2YLBA 4J8OA 4C92E 3ZFJA 3CCUA 2OAUA 3CD6A 2XI9A 3LH0A 2ZAEA 3JCMW 4OMMA 2OAWA 2KE9A 5GAN8 3GIBA 3JAME 4E47A 1IRXA 2DEQA 1K73C 2C0OA 1W2BS 2FPFA 4QW2A 3BFMA 4IIMA 1FXXA 1WHJA 2A37A 4HVWA 2QQAA 4F7UA 4M7DB 2P0QA 2DTHA 2FPEA 3BY7A 5FWBA 3CCJA 2V8JA 3CCET 3DLMA 1Z9ZA 3CBOA 3GOXA 2MAMA 1MHNA 1K0XA 1IZ6A 1Q86C 2QG9B 2KQWA 3QYHB 1KQ1A 3EFOB 4MDWA 2JW4A 2BIVA 5CKBA 1GL5A 3OYKA 3JCMc 1TXQA 2H3JA 4BE1A 2QQSA 2KEAA 4QKUA 1NYFA 4Z02A 3G7ZA 2M0YA 2VWFA 3OYFA 2MIOA 2RF0A 3VU3C 4A53A 1WZOA 2O31A 1XOVA 4PFOA 1TTHB 4J9IA 1YJWQ 5D6WA 2MK5A 2QGGA 3ER0A 5CKEA 4C8QB 2RHYA 3NPFA 4AMCA 3HKSA 3P8DA 2FVUA 1RAIB 1NPPA 1YITQ 2A3LA 1GXIE 1TSFA 1YJNT 1YHQA 1WA7A 2PVOB 3VS4A 2V26A 3LGLA 3HFNA 4CRIA 4M7AC 1QP3A 4M78G 1X6GA 1N8RU 2DX1A 2A08A 2GQIA 4M78F 2OI3A 1OV3A 4JLGA 2I2LA 2DKGA 1X01A 1VQOA 3G6EQ 1KHIA 4KT0E 2BTTA 5FLXE 1YJ9Q 2DFUA 2WSEE 2E3IA 2LRQA 1JEGA 3QG1A 1GBRA 1YN8A 2GFUA 5GAMg 2XG8D 4O6JA 2BKDN 5I21A 3OYJA 1VQ6A 3QYGB 5D7UA 1BCOA 1WHLA 2KI7A 1VQ7T 4LN2A 2O4XB 1K9MU 3LGFA 2J7IA 4DQ2A 2KAFA 2CP6A 2EQJA 2FRYA 2DL5A 2L3RA 2HDAA 2QEXQ 2J05A 2L0AA 2XK0A 4JRIA 4ELYC 2HL5C 3E19A 3CCSQ 2L3PA 3C95A 3FRNA 1X6BA 3V8JA 2LC4A 1Q7YR 2COWA 1OYXA 2H8HA 5CAIA 3EFRA 3SFMA 2KRSA 3QXEB 2DETA 1S72A 2E4HA 5LJ3g 3SEMA 3G4ST 3JCMf 1BIBA 1ZSZB 1M1KC 3OYEA 2WACA 3GBQA 1B34A 3QUIA 4EDUA 1WPYA 2EIFA 3WXMB 1BKBA 4QVZA 3VS5A 2Y4YA 1EZZB 2COYA 2HSPA 4J5YA 1N8RC 2RO0A 1PRMC 4E7HA 3CPWS 6AT1B 1ARKA 5IHKA 1UE9A 1UHFA 2JVVA 1N27A 3TQ7P 4QVCA 3A8MB 5GAN4 2NUPA 3EG9B 1KSWA 2HQXA 1PD0A 2LP5A 4Z8AA 2ED1A 3E1SA 3I5RA 1YIJT 1XQHA 3PMIA 5L23A 5GAOm 1VQKT 1QCFA 3X25B 1D0ZA 3JB9I 3CCLT 1JXOA 2V8KA 4AFUC 5KE3A 2CH4A 2DIQA 2RHZA 3L2WA 3CCQQ 3H0IA 4M78E 2KT8A 2O9VA 2P4RA 4PLLA 2LDMA 1K9MC 2QTVA 2M16A 3PGGA 3CC7Q 2YUNA 1BYMA 4JLIA 1K0SA 1I0CA 1VQLT 4JRQA 1RL2A 2J06A 4RKUE 5KYYB 1WQ7A 1K4US 1I8FA 2OTJT 2R58A 1OU8A 1M90R 2B8AA 2YT6A 3CC2T 2PTKA 2KYMA 2K9GA 4L6V5 5GANe 4J9GA 4PFPA 1TG0A 2CP0A 5IHNA 1QVPA 4XU0A 3OW2A 4M77G 3OA6A 2K6DA 1VOMA 5CIUA 2RD1A 4JJBA 3HFOA 4M77F 5EG2A 3QJ6A 2Z0WA 3EGXB 4XTVA 1VQMT 3CPFA 2EQIA 2KMTA 5GMKe 3JCMb 2LZ6B 2A0FB 1QVGS 2HD0A 2JNGA 3L2UA 2ZPGB 4A4KA 4PJOD 4XTXA 4F7UG 1LJOA 4L59A 1LPLA 2NUTB 3HSBA 3KFVA 2OTLT 2DTIA 1SF9A 4F7UF 1AWOA 3RMSA 2D9TA 4LUEA 4PJNA 1I4K1 1JQQA 5GAN7 3L2RA 1TOVA 1ZUKA 1QLYA 3CXCA 3ULRB 1W4SA 2M0OA 2IVWA 2RQUA 1AT1B 3EFSA 2DVJA 3A5ZB 3I9QA 3J80E 4C92D 1KQSA 4J6YA 1GRIA 4M7AB 1JJ2A 2CZ7B 1Y0MA 1ZX6A 2E41A 4NS5A 4FT4A 3PE0A 1VQ4Q 1D0YA 2JMCA 2RH2A 2EQUA 4ATOA 2QYZA 1HYOA 2X4XA 1OQKA 4FSSA 2KXDA 1VA7A 3MEUA 4Q5WA 2EGCA 4FCYA 4PKCC 4JJDA 2DL4A 3O8VA 3E2UA 2AKLA 1I81A 4J9CA 4XU1A 3FJ5A 1VYTA 2RHXA 5A0LA 2DAQA 2HEQA 4LD9K 2LJ0A 4M7DD 5GAMf 1VQ9T 4E7SA 1WXBA 3I55Q 4JUVA 5KCHA 5KYUA 1YITA 1VUBA 4OMQA 1C0MA 1SHGA 2DM1A 5J39A 1BBZA 2FEIA 5HY6A 1M30A 1KC8U 4OVAA 4Y92A 1ZUYA 4M78A 2EFIA 3FEOA 3GP8A 1WJRA 5FWCA 4MDXA 1C6VX 4M77E 1B07A 2YRDA 5C6SA 3OS0A 1VQ5A 1WI7A 1YJ9A 5LJ3f 2XU8A 2E12A 2D1XA 3LWIA 2EVRA 4AFZC 2CYZB 3A8LB 1M2OA 4C0DB 4UC4A 3TCJA 3LYIA 2LT1A 1Y96A 4BY6C 3URGA 2GF7A 4C8QD 2A7YA 4F7UE 3HRSA 1PHTA 2CZ6B 3C4SA 4RTTA 2JTFA 4DBHA 1MMDA 2QEXA 4LD6A 5GMKi 5L8RE 5M9OA 3CCSA 2DXCA 3SD4A 3QIIA 5CVIA 5GANh 1XNIA 1MV3A 4M75G 1YI2Q 4KULA 4GLMA 2VC8A 5GANd 1S1NA 2G3RA 1SG5A 2E10A 1XJWB 3G71Q 4M75F 2DK3A 2R57A 2QDYB 2MOXA 4CC4B 2EYQA 2GGRA 3VS2A 1K1ZA 3LWHA 2E6ZA 4OP0A 4R0KA 3P8HA 3ASKA 1AZGB 3UDCA 4ZN1A 3TSWA 5GMKh 2KSSA 3V8KA 2RJFA 1ZQ1A 2JMAA 5KH6A 1K8AU 1P92A 4IUQA 3TU4K 1GCPA 2BZXA 1OPKA 2D8HA 2K79A 3CMEQ 3OW2P 3U23A 3PVQA 1R0CB 3MO8A 1VQ8T 3FDRA 1KC8C 3MEAA 3OYGA 4II1A 4LXCA 1IO6A 3PMTA 1HSQA 1O9SA 2NWMA 1M5Q1 3HRTA 1M1KR 1YIJQ 1WHKA 1VQKQ 3S3MA 2DA9A 1Q81U 3X20B 1M3AA 3JCMP 2LQKA 2QA4A 2BZYA 3OYAA 3RR6A 1JRIA 1QW1A 4WTOB 1GFDA 2LX7A 5FRNA 2SEMA 2EJGA 3VS7A 5DM7R 1H3HA 3SDZA 1VQLQ 4E7LA 3AHUA 1Y57A 4J9EA 3CC7A 4PJOB 2EYZA 5AT1B 1ABQA 1E6GA 5DLQE 3DLLA 2C0TA 2QA4T 3LLRA 2J6KA 3RKXA 3CC2Q 2IPOB 2ZPFB 5GAOp 2R5AA 3CCRQ 1WFWA 2HZYA 3V8LA 2CREA 2EJ9A 1KQSP 1JJ2P 4OB1B
chains in the Genus database with same CATH topology
1YITT 4B9XA 4LDUA 2YLCA 2I2LA 2DKGA 1X01A 2FHDA 2IG0A 4HCZA 4ME7A 1VQOA 5CQYA 2EQKA 2WSCE 4XAXB 3M57A 4BE0A 1KHIA 1OI1A 3M5AA 3ZEHA 1U1TA 3KUFA 4KT0E 4XQ3A 3PTAA 2MF2A 4C92B 5LJ5j 1VQMA 4RCCA 2RJCA 5FLXE 3CCRT 4MMKA 4XTZA 4C8QA 4IUTA 2WSEE 4F7UB 5GAOq 2DZ9A 2LRQA 4LDWA 1VQPA 2M9UA 4BB7A 5GAOl 3OW2S 3QG1A 3SWNA 2GFUA 5GAMg 3HRUA 2XG8D 4FT2A 4O6JA 3PFSA 5GANg 2BKDN 5I21A 3OYJA 3G6ET 1Q7YC 2RJDA 3A8OB 1K8AC 4PJOF 4M77A 4M78C 3S3NA 1VQ6A 3QYGB 2DIGA 3OS5A 3VYGA 1M90U 4GLKA 4N4IA 1VIFA 1VQ5T 5I2MA 3HP9A 1YJ9T 1QVFA 3M54A 1B34B 2OTLA 1VQ7T 2O4XB 2PVDB 5LL6S 5C0MA 3LGFA 1K9MU 3FIFA 2EJFA 3RKYA 4DQ2A 1KHCA 2KAFA 1U8RA 2EQJA 3HPWA 2KVQG 5HK0A 2L3RA 4OF1A 4KUIA 4ZGDB 5GAN2 3EAEA 1M8VA 2XK0A 5CR2A 4JRIA 3CEYA 4ELYC 1UGRB 3QZ5B 1W2BA 3E19A 4YTLA 1M1GA 1UEBA 3C95A 3L2VA 2DD5A 4D6WA 4IUUA 1EIFA 3FRNA 5D6XA 1BI3A 3CCUT 3CD6T 4XTYA 2LC4A 3E9FA 2RJEA 3PT9A 4PNOA 1ZBXA 3V8JA 2VGNA 1OYXA 4MZPA 3OYIA 4PJOC 2EWNA 2EQMA 3QPHA 5CAIA 3EFRA 3SFMA 4C92F 4HT8A 2E5QA 2MWPA 3DB4A 4XTWA 1HK9A 2RM4A 3QXEB 1AHJB 2QEXT 1UGQB 1S72A 2V8IA 1BI1A 5LJ3g 3M56A 3CCST 1NJIU 3G4ST 2DJZA 3JCMf 1BIBA 1NZ9A 4L5GA 4BI8B 1M1KC 3OYEA 2DD4A 3C94A 2WACA 2LCLA 3QJYA 3UT1A 1G3WA 1B34A 5GAN3 3QUIA 4EDUA 3META 2O4XA 1YBYA 4M75D 1WPYA 2EIFA 3WXMB 3A8HB 3OMCA 4RG8A 3A8GB 4ZGJB 2KK4A 1BKBA 2FL7A 4QVZA 2Y4YA 1KQSS 5GAN6 2ZPBB 4FL6A 1VQ4A 4C92C 1JJ2S 1BI0A 2DXTA 4OGCA 3M58A 3CCJT 2P0PA 4J5YA 1N8RC 2RO0A 4E7HA 3CPWS 3JB9J 4M7AE 3QHSA 1V29B 4C5HA 2F5KA 4PLIA 4M7DG 2MMPA 2RK2A 4QQ6A 2DZCA 5CKDA 2JVVA 3PIPA 2MWOA 1N27A 1KD1U 4ZTJA 3CC4T 1D3BB 2LX9A 4QVCA 4KUDK 4M7DF 1VQ9A 3A8MB 3GNGA 5GAN4 5LJ5h 1N9RA 3JSCA 4A4EA 4B9WA 2HQXA 3JB9G 1QP2A 1X6OA 3M4GA 3M9QA 2LQ8A 5LJ5d 3E1SA 3L2QA 4BI4A 4V2SA 4ZTFA 1YIJT 1XQHA 4QQDA 3PMIA 4BY6B 3CCVA 5GAOm 4LDYA 1VQKT 3X25B 2E64A 2E1HA 3JB9I 3CCLT 5A0DA 2LT4A 4JRKA 3CCQA 2WSFE 2F5TX 2MI6A 4XK8E 2JOYA 2NLUA 2RA2A 2V8KA 2VGMA 1M90C 5KE3A 4FU6A 2DIQA 3I55A 2FB7A 5IAYA 2RHZA 2QI2A 3FLGA 3GF5A 1LNXA 3L2WA 4ELZC 4M78E 3JB9F 1YJWT 4PLLA 2LDMA 2XDDA 5CKHA 1K9MC 2M16A 3PGGA 2PUKB 2Y90A 4M7AD 1BYMA 3QZ9B 1JB0E 4JLIA 5DLOA 2GQVA 3CMAA 5CCAA 4JRQA 3OYMA 3I56A 1RL2A 2XDPA 4RKUE 1VQLT 1WQ7A 4XU2A 4C0ZA 1I8FA 3JCMh 4CI0C 5I2SA 2FYKA 2OTJT 3UWNA 3OSSC 1D3BA 5IT9E 2R58A 3JCMd 4RMOA 2VV5A 4LDXA 2PQWA 3CC7T 2B8AA 4QVDA 3CC2T 3TREA 4EMGA 3CCMA 3RIRA 4ZGEB 2PUOB 4L6V5 2QQRA 4C8QG 1MGQA 5GAMe 1YHQT 3RUXA 3OYBA 4OB0B 4C0GA 2PVGB 5GANe 4BDZA 1NJIC 1G5VA 3FC3A 2BUDA 4EMKB 1R8OB 4C8QF 4PJOG 1Y07A 2DXUA 2JN0A 3QBYA 4J7FA 1QVPA 4DOVA 4EPCA 4XU0A 3OW2A 4M75B 4M78D 4M77G 2JTMA 5HK3A 3OA6A 3OSVA 4OB2B 5FU7B 5CIUA 2XD0A 2RD1A 1UB4A 2X4WA 3DKMA 3HFOA 4M77F 5EG2A 3QJ6A 1VQOT 4M75E 4C5GA 3BDLA 4BD3A 2K5IA 4XTVA 2CZ1B 2Y4XA 2ZPIB 3VV0A 3V7SA 1BI2A 4NOYA 3OS1A 3KXTA 1VQMT 3CPFA 3V7RA 5A0GA 2KMTA 2RI5A 3OYCA 5GMKe 4HCCA 3JCMb 1Q82U 3MP6A 2LTOA 1QVGS 2JZ2A 5FU6B 1VQPT 2HD0A 2E65A 4C8QC 2CKKA 3HHTB 1IREB 2JNGA 4IUPA 3L2UA 1Q81C 4C92G 1WJSA 2ZPGB 4A4KA 4DA4A 1QVFS 4PJOD 4N0AA 1KD1C 4XTXA 4F7UG 3SWNC 1LJOA 4L59A 5LJ3e 3QDRB 1VQ6T 1YI2A 1PSFA 3JCMQ 2XIDA 4EMKA 5GMKl 3HSBA 3QSUA 2OTLT 3CCEA 1G3YA 2DTIA 4PL6A 4M77C 4F7UF 3GPLA 3RMSA 3C12A 3G71A 1M4ZA 4OMFB 2D9TA 1M1FA 4M75A 1I4K1 1Y7XA 2LCCA 3GNFB 2AHJB 2JUFA 4MMLA 3OMGA 3S6WA 5GAN7 3L2RA 4JRPA 1WGSA 3CXCA 2XICA 2M0OA 1W4SA 2IVWA 1WNLA 1JBMA 1O75A 3R6OA 4BI3A 3FJPA 3EFSA 1VQ8A 3QO3A 4Y28E 3A5ZB 4HA8A 2K3XA 4QQGA 3SB2A 3J80E 2VXEA 2X35A 4C92D 1KQSA 4J6YA 4M7AB 1OZ2A 3M59A 3VJPA 1JJ2A 2CZ7B 1S72T 2EAYA 2DXBA 3NTIA 5LJ5g 3CD6A 4M7DE 2L89A 2XDBA 3CMEA 2RB6A 3L2ZA 4X9DA 2E41A 1UGSB 1M9SA 4NS5A 4FT4A 3JCMV 5GAOn 4BDYA 3CPWA 4XU3A 2ZPEB 2ZZDA 4HCBA 2QQBA 1Y71A 2RH2A 3RKWA 2EQUA 4ATOA 1WQWA 2VYTA 2X4XA 3BW1A 5FU7C 3VUBA 4LDVA 5GAMj 5AYFA 5CKFA 4WF2A 3RMQA 3MEUA 1VQ4T 4MZMA 1K73U 2K2VA 4Q5WA 4JJNK 1U1SA 4PKCC 3OYLA 4NL3A 3OB9A 4FIBA 2HNIA 4XTUA 4ZN3A 3O8VA 2KY9A 4M78B 4M7DA 5CO7A 1VQNA 2CZ0B 2DVEA 1I81A 1NE8A 4XU1A 1VIEA 2O01E 1OZ3A 1UGPB 4J6WA 4C5IA 2RHXA 3NFCA 3JCMg 4IUVA 5A0LA 3PNWC 1YJNA 2D6FA 2DAQA 4R55A 4LD9K 3UPUA 1N6AA 3H8ZA 1G3TA 4M7DD 2E6NA 3OYYA 2YHTA 5GAMf 1XTDA 5GANf 1VQ9T 3X24B 4A54A 3WVDB 4E7KA 2P0KA 4GY5A 4TVRA 2ZCFB 3T9NA 2RHUA 1KG1A 3TEEA 4JUVA 1KQ2A 5KCHA 5GMKj 1M1KU 1Q82C 1YITA 5GAOr 1VUBA 3CCVT 4BACA 1G3SA 3F70A 1Q86U 1Y96B 3MEWA 5IN1A 5J26A 5J39A 3CCQT 3L1AA 1VQNT 4C8QE 5LJ3j 5GMKm 1HXDA 5HY6A 3JCMX 3CCRA 1TH7A 4NL2A 3I55T 1KC8U 2HQEA 3JB9D 3MCAB 4PJOE 4OVAA 3KBGA 3OS2A 4X9CA 4IURA 3WVEB 4M78A 5CK9A 1BIAA 2EFIA 1FWZA 3JCMJ 3FEOA 3GP8A 1WJRA 3CMAT 4MDXA 4M77E 4MZTA 2R5MA 5FROA 5C6SA 3I56T 1X75C 4A4HA 3OS0A 3E9GA 1VQ5A 2CGHA 1YJ9A 2LNVA 5LJ3f 2XU8A 3CBMA 4KBMB 1VQ7A 4A4FA 3OYHA 4OGEA 2E12A 3VUZA 3LWIA 3LW5E 1RI0A 3JB9H 3INZA 3J81E 2CYZB 3MP1A 3A8LB 2DO3A 3CCMT 4C0DB 4FSXA 4UC4A 3NTKA 2DTOA 3S3OA 3RERA 4HT9A 3TCJA 5KCOA 3LYIA 3OBYA 2LT1A 2K57A 2HAXA 1Y96A 2P4TA 2YLBA 2GF7A 3URGA 4J8OA 3X26B 4BY6C 4C92E 4PJOA 3ZFJA 4C8QD 3CCUA 4OB3B 2A7YA 2OAUA 2L5QA 3HL8A 4F7UE 1PSEA 2XI9A 3HRSA 3JRZA 1QVGA 2C06A 3OBWA 2CZ6B 3C4SA 3LH0A 3JCMW 2M1HA 5GAN5 2JTFA 3L42A 2HBPA 3GLXA 2F69A 2QTXA 3OYDA 5LJ5f 1H641 2QEXA 4DOWA 5GAN8 4LD6A 5GMKi 5L8RE 5M9OA 4M77D 3CCSA 2DXCA 4JS5A 3G4SA 3GIBA 3SD4A 5GAMh 2QQ9A 3QIIA 2RK1A 5CVIA 4E47A 5GANh 2DEQA 3JAME 4E7JA 1XNIA 4M7AA 4EMHA 3CBPA 5GAMd 1K73C 2X4JA 3BDUA 3DB3A 2YRVA 4KULA 4M75G 5CQXA 2VC8A 5GANd 1W2BS 4QW2A 4IKFA 2G3RA 4X34A 3BFMA 2E10A 2L8DA 4M75F 2K5LA 1FXXA 2DK3A 3J7AF 4C92A 3ME9A 3M4YA 2R57A 3M55A 2QDYB 2QQAA 4F7UA 1H3ZA 4M7DB 2P0QA 2DTHA 2EYQA 3LWHA 3BY7A 2E6ZA 4OP0A 2PU9B 3Q1JA 2QXFA 5LJ5e 2K3YA 3CCJA 1YI2T 3P8HA 2V8JA 1SSFA 2K5FA 3CCET 4N0AC 3ASKA 5D6YA 4C5EA 3DLMA 3G71T 3UDCA 4ZN1A 5GMKh 3CBOA 2KDSA 3GOXA 2KSSA 3OQ5A 3CXCS 4EMKC 2XKOC 2MAMA 1MHNA 1WJQA 3V8KA 2RJFA 2VUBA 4HKEA 1IZ6A 1ZQ1A 5KH6A 4RCBA 1P92A 4IUQA 3TU4K 1Q7YU 1Q86C 4RG2A 1K8AU 3CC4A 4M75C 2KQWA 5FRMA 1N9SA 1KQ1A 3QYHB 1LOJA 2RI2A 3LX7A 4MDWA 5LJ3h 3V7CA 3MO8A 2BIVA 2K4YA 5CKBA 1VQ8T 3OYKA 3FDRA 1KC8C 3MEAA 5LJ3d 3OYGA 4II1A 3JCMc 1YIJA 3PMTA 1FX7A 2E70A 3P8BB 3OYNA 1VQKA 2H3JA 4C0DC 4BE1A 5GANj 1I5LA 3CCLA 1O9SA 4E7IA 2QQSA 2ZGWA 1M5Q1 2CS7A 2DPPB 3HRTA 3G7ZA 4Z02A 3JCMe 3NTHA 1YCYA 4J6XA 3OYFA 3FB9A 3CMET 3M53A 5DY9A 5FU6C 3X28B 3S3MA 2GCXA 3OY9A 1Q81U 3X20B 3QKJA 3PIOA 3VYHB 4M7AG 3VU3C 1YJWA 3JCMP 2LQKA 2QA4A 4A53A 3RESA 3OYAA 1ZHIA 1JRIA 1QW1A 2RHIA 4M7AF 1XOVA 1VQLA 3N5BB 2EKOA 2LVMA 4BUGA 4JDSA 5FRNA 5D6WA 3MP8A 3ZBDA 4BE2A 2OTJA 3ER0A 5CKEA 2EJGA 4JS4A 5DM7R 4FM4B 4P5NA 3SDZA 4C8QB 4E7LA 3AHUA 4Y91A 2RHYA 2X4YA 3HKSA 2RI3A 5J3BA 4A4GA 3P8DA 3CC7A 2FVUA 3CC2A 4PJOB 2XHCA 3SWNB 1NPPA 1GXIE 2A3LA 4N4GA 4VUBA 5DLQE 3DLLA 2GFAA 1YJNT 4C0FA 3MHXA 4M77B 1YHQA 4M7DC 2QA4T 2PVOB 1NPRA 3LLRA 4N4HA 2VXFA 3RKXA 4O5VA 5HKCA 3H6ZA 3LGLA 3HFNA 4CRIA 4R56A 4M7AC 2ZPFB 1QP3A 4J7IA 4M78G 2R5AA 5GAOp 1N8RU 3V8LA 5A2QE 2EJ9A 4OB1B 2D0QB 3G6EA 5KE2A 3VKIA 2ZPHB 4M78F 4J83A 3MEVA 1DJ7B 4JLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 f;  4J6Y A;  4M7A B;  5GAO m;  1H64 1;  2E64 A;  2E1H A;  2YLC A;  2I2L A;  3JB9 I;  2DKG A;  1X01 A;  5GMK i;  5GAN 8;  4JRK A;  2EAY A;  4M77 D;  3GIB A;  5LJ5 g;  4M7D E;  5GAM h;  2RA2 A;  2RB6 A;  3L2Z A;  4X9D A;  2E41 A;  1U1T A;  4XQ3 A;  3JCM V;  2DEQ A;  5GAN h;  5LJ5 j;  4C92 B;  5GAO n;  4EMH A;  4RCC A;  2FB7 A;  3BDU A;  4M75 G;  4XU3 A;  5GAM d;  4MMK A;  4XTZ A;  2VC8 A;  3SB2 A;  4C8Q A;  5GAN d;  1LNX A;  4F7U B;  5GAO q;  2DZ9 A;  4M78 E;  3JB9 F;  3BFM A;  2E10 A;  4M75 F;  3RKW A;  3PGG A;  2Y90 A;  4M7A D;  4C92 A;  1WQW A;  3BW1 A;  4JLI A;  3SWN A;  5GAM g;  5GAO l;  5GAN g;  4F7U A;  1WQ7 A;  4XU2 A;  5I21 A;  5GAM j;  4PJO F;  1I8F A;  4M78 C;  4M77 A;  2DTH A;  4WF2 A;  3JCM h;  2FYK A;  3BY7 A;  4M7D B;  1D3B A;  4OP0 A;  4PJO A;  5LJ5 e;  1B34 B;  1U1S A;  3JCM d;  4N0A C;  4NL3 A;  4XTU A;  2HNI A;  4M78 B;  5GMK h;  3FIF A;  2EJF A;  3RKY A;  2DVE A;  4DQ2 A;  4QVD A;  1I81 A;  4XU1 A;  4EMK C;  3V8K A;  4EMG A;  3RIR A;  4J6W A;  3JB9 G;  4M7A A;  3JCM g;  5GAN 2;  1M8V A;  4RCB A;  4JRI A;  4C8Q G;  1MGQ A;  5GAM e;  3RUX A;  4M75 C;  5GAM f;  4M7D D;  2YHT A;  5GAN e;  1N9S A;  1KQ1 A;  3V7C A;  1LOJ A;  5LJ3 h;  4EMK B;  5GAN f;  4A54 A;  4C8Q F;  4PJO G;  2DXU A;  2JN0 A;  4XTY A;  3V8J A;  4PNO A;  5LJ3 d;  4XU0 A;  4JUV A;  1KQ2 A;  4PJO C;  3JCM c;  2EWN A;  5CAI A;  5GMK j;  4M75 B;  4M78 D;  3EFR A;  4M77 G;  4C92 F;  5GAO r;  5GAN j;  4XTW A;  1I5L A;  4HT8 A;  1HK9 A;  2RM4 A;  2RD1 A;  1Y96 B;  3HFO A;  2ZGW A;  1M5Q 1;  4M77 F;  5LJ3 g;  3JCM e;  1YCY A;  2DJZ A;  3L1A A;  4J6X A;  4M75 E;  1BIB A;  3FB9 A;  4XTV A;  3JCM f;  5DY9 A;  4C8Q E;  5LJ3 j;  3V7S A;  1HXD A;  4NOY A;  5GMK m;  3JCM X;  1TH7 A;  4NL2 A;  3V7R A;  1B34 A;  5GAN 3;  4M7A G;  3QUI A;  3VU3 C;  3JB9 D;  3JCM P;  4PJO E;  5GMK e;  4A53 A;  3JCM b;  4X9C A;  3RES A;  4M75 D;  1WPY A;  4M7D A;  4M78 A;  1JRI A;  1BIA A;  4M7A F;  2E65 A;  4C8Q C;  3JCM J;  4M77 E;  4C92 G;  5GAN 6;  4PJO D;  4N0A A;  4XTX A;  4C92 C;  2EJG A;  3SWN C;  1LJO A;  2CGH A;  4F7U G;  5LJ3 e;  2DXT A;  5LJ3 f;  4C8Q B;  5GMK l;  4EMK A;  3JCM Q;  3HSB A;  3QSU A;  3AHU A;  4Y91 A;  2DTI A;  4J5Y A;  4M77 C;  4F7U F;  3JB9 J;  3JB9 H;  4PJO B;  3INZ A;  4M7A E;  3SWN B;  4M75 A;  3QHS A;  1I4K 1;  4M7D G;  4MML A;  5GAN 7;  2DZC A;  2DTO A;  4HT9 A;  3RER A;  4M77 B;  4M7D C;  2K57 A;  1Y96 A;  1D3B B;  1WNL A;  4QVC A;  1JBM A;  2VXF A;  2YLB A;  3RKX A;  4C92 E;  5GAN 4;  4M7D F;  3FJP A;  3HFN A;  3EFS A;  4M7A C;  5LJ5 h;  1N9R A;  4C8Q D;  4M78 G;  5GAO p;  3QO3 A;  4F7U E;  3M4G A;  3V8L A;  4HA8 A;  2EJ9 A;  5LJ5 d;  3JCM W;  5GAN 5;  4V2S A;  4M78 F;  2VXE A;  2QTX A;  4C92 D; 
#chains in the Genus database with same CATH topology
 1TUC A;  4HCZ A;  3RBB B;  2EQK A;  2WSC E;  4XAX B;  3M57 A;  1OI1 A;  3ZEH A;  2MF2 A;  4C92 B;  1ZBJ A;  2AZV A;  1X2Q A;  1K9M R;  5GAO q;  3REA B;  2M9U A;  3EGD A;  2OX7 A;  3SWN A;  1YWO A;  2RQT A;  2LJ3 A;  3HRU A;  3PFS A;  4CC2 A;  1K8A C;  4M77 A;  4M78 C;  3OS5 A;  3HP9 A;  1B34 B;  5KYN A;  2PVD B;  3UF4 A;  3FIF A;  1UTI A;  2KRM A;  4OF1 A;  2IIM A;  1PG5 B;  1M8V A;  4FYW B;  3CEY A;  1UGR B;  3QZ5 B;  1W2B A;  4D6W A;  1EIF A;  3CCU T;  2F2X A;  3CD6 T;  1H8K A;  4PNO A;  4MZP A;  1QWF A;  2EQM A;  2HKQ B;  4KH1 B;  4XTW A;  4FW1 A;  1UGQ B;  1BI1 A;  2F2V A;  3M56 A;  1NJI U;  2NUP B;  4BI8 B;  4L5G A;  2JT4 A;  1SKU B;  3QJY A;  3UT1 A;  2FO0 A;  5GAN 3;  1AEY A;  1TS9 A;  2DBM A;  2YUO A;  3VS0 A;  2SRC A;  4FL6 A;  3CC4 Q;  1VQ4 A;  2DRK A;  4OMP A;  3M58 A;  3CCJ T;  5IXB A;  1V29 B;  4OML A;  4E7Z A;  5CKD A;  1RUW A;  4ORZ A;  2EGE A;  4A4E A;  4JPB W;  4HVV A;  1X6O A;  4F16 A;  1H92 A;  1QVF P;  3M9Q A;  2LQ8 A;  1FMV A;  4ZTF A;  2RPN A;  1ZUU A;  4BY6 B;  3QWY A;  1M2V A;  2E64 A;  5A0D A;  4JRK A;  1EX4 A;  2FZC B;  2WSF E;  4XK8 E;  1SSH A;  1D09 B;  4AFQ C;  3EG3 A;  4AG2 C;  3TVT A;  3I55 A;  2KNB B;  5IAY A;  2FPD A;  5KYX A;  3I35 A;  4JZ4 A;  3JB9 F;  2XDD A;  1WYX A;  1YWP A;  2DL3 A;  4M7A D;  2GQV A;  5CCA A;  3OYM A;  4QT7 A;  1M3C A;  1U06 A;  2FYK A;  3OSS C;  1D3B A;  4DEX A;  1NYG A;  2JS0 A;  3CQT A;  1RLQ C;  3SHW A;  2COZ A;  4RMO A;  3O5Z A;  4AFS C;  1MV0 B;  1QWE A;  4PJJ A;  1OOT A;  3RIR A;  2QQR A;  1YHQ T;  3RUX A;  3OYB A;  1NJI C;  1OPL A;  2BUD A;  2DE0 X;  4JZ3 A;  2JN0 A;  1SHF A;  5HK3 A;  1VQP Q;  4RTX A;  1UB4 A;  2X4W A;  1OUL A;  4E6R A;  1VQO T;  4C5G A;  1NEB A;  2A36 A;  2CZ1 B;  2Y4X A;  1RAH B;  1BI2 A;  4NOY A;  3V7S A;  3KXT A;  4KGX B;  4AG1 C;  3V7R A;  4HCC A;  1RAA B;  1X27 A;  2V1R A;  1IHV A;  4PJL A;  1KFZ A;  3SWN C;  1VQ6 T;  2L2P A;  3QDR B;  1YI2 A;  2XID A;  4EMK A;  5GMK l;  3QSU A;  2LJ1 A;  1G3Y A;  1EFN A;  4M77 C;  3GPL A;  3G71 A;  1QKW A;  1YP5 A;  8ATC B;  4M75 A;  1WIE A;  2EGA A;  4MML A;  3S6W A;  1T0J A;  2XIC A;  1KIK A;  4LNP A;  1JBM A;  1O75 A;  3QO3 A;  4LUD A;  4QQG A;  4EIK A;  2VXE A;  2X35 A;  4F14 A;  2EYX A;  2QK0 A;  3M59 A;  1WHH A;  2VVK A;  4X1V A;  1S72 T;  2EAY A;  2XDB A;  1AWX A;  3CME A;  2EW3 A;  2RB6 A;  3L2Z A;  2DL7 A;  1NBE B;  3JCM V;  5GAO n;  1E7O A;  3CPW A;  2VKN A;  4XU3 A;  2ZZD A;  4RTY A;  3VRY A;  2QQB A;  5KYU B;  1IGU A;  1AVZ C;  1WQW A;  3BW1 A;  5FU7 C;  3VUB A;  5AYF A;  1UDL A;  4NL3 A;  2YUQ A;  1OEB A;  2HNI A;  4FIB A;  2KY9 A;  4M78 B;  4M7D A;  5CO7 A;  1VQN A;  2CZ0 B;  2DVE A;  1VIE A;  3CCV Q;  1W2B P;  2CUD A;  1OZ3 A;  1NG2 A;  4C5I A;  3NFC A;  1UGV A;  4IUV A;  2PZ1 A;  2AZS A;  3UPU A;  2E6N A;  3OYY A;  1XTD A;  2MCN A;  2CT4 A;  4E7K A;  4GY5 A;  2ZCF B;  2EYY A;  5GMK j;  3M0S A;  3M0P A;  3CMA Q;  1PD1 A;  4DEY A;  1Y96 B;  3MEW A;  5J26 A;  3I56 Q;  1TUG B;  1PCX A;  1VQN T;  3JCM X;  3CCR A;  4OMO A;  1TH7 A;  3JV3 A;  3MCA B;  1IGQ A;  4X9C A;  4A63 B;  4J9B A;  4IUR A;  1NM7 A;  3JCM J;  1MMG A;  3CCM Q;  1PKT A;  4FYV B;  4J9F A;  3H0H A;  2ECZ A;  2LNV A;  2KXC A;  3CBM A;  4KBM B;  3ZL7 C;  1YNZ A;  2QDL A;  2JM8 A;  3S3O A;  3NTK A;  2DTO A;  4HT9 A;  3RER A;  2D8J A;  3X26 B;  1KJW A;  2L5Q A;  3JRZ A;  1QVG A;  3OBW A;  2JM9 A;  3EG2 A;  3OYD A;  1FYN A;  1H64 1;  3CCU Q;  4DOW A;  3CD6 Q;  3EHQ A;  1J3T A;  1IXD A;  1D1C A;  2DBK A;  2QQ9 A;  4E7J A;  2HQH A;  2RK1 A;  2ENM A;  2HKN A;  3BDU A;  3DB3 A;  2YRV A;  3CCE Q;  2L8D A;  2K5L A;  1IHW A;  5IHI A;  1K8A R;  1PM3 A;  2ROL A;  1RAD B;  4HXJ A;  5I11 A;  1GFC A;  2PU9 B;  3Q1J A;  2QXF A;  5LJ5 e;  2K3Y A;  1SSF A;  5D6Y A;  4KH0 B;  2K7A A;  3CXC S;  2RN8 A;  4EMK C;  2EYW A;  1K73 R;  1WJQ A;  2X51 A;  1R0B G;  1Q7Y U;  2LCS A;  3CC4 A;  4M75 C;  1LOJ A;  3LX7 A;  2J6F A;  2QAS A;  2KRO A;  1FX7 A;  3P8B B;  1M8M A;  3OYN A;  4E7I A;  3VRZ A;  2AT1 B;  3M0R A;  1I1J A;  2ZGW A;  2CS7 A;  3JCM e;  3H0F A;  3NTH A;  4J6X A;  1GCQ A;  3FB9 A;  3M53 A;  3QKJ A;  1Q86 R;  1WLP B;  1YJW A;  2F1L A;  3RES A;  1ZHI A;  2CT3 A;  5IXF A;  2RHI A;  2CSQ A;  3N5B B;  1PC0 A;  2EKO A;  2LVM A;  4BUG A;  1YJN Q;  4JDS A;  4BE2 A;  3ZBD A;  1G8X A;  1E6H A;  4GBQ A;  4JS4 A;  4M4Z A;  7AT1 B;  1RAG B;  4FM4 B;  1X69 A;  4Y91 A;  2VB6 A;  2X4Y A;  2RI3 A;  5J3B A;  4A4G A;  3EGD B;  2XHC A;  3SWN B;  4N4G A;  3MHX A;  4M77 B;  4M7D C;  1NPR A;  4F17 A;  2VXF A;  3C0C A;  3H6Z A;  4R56 A;  2RMO A;  3RDV A;  5A2Q E;  1BU1 A;  3G6E A;  5KE2 A;  3THK A;  4BE0 A;  3VV0 A;  1DJ7 B;  1YIT T;  2FZG B;  2O9S A;  4LDU A;  4ME7 A;  2FHD A;  2IG0 A;  5CQY A;  3CPW P;  5KYW A;  1HJD A;  1U1T A;  3KUF A;  3PTA A;  2RJC A;  4XTZ A;  3BE3 A;  4IUT A;  4F7U B;  1VQ7 Q;  1VQP A;  4BB7 A;  5GAO l;  4FT2 A;  5GAN g;  1BK2 A;  3G6E T;  2RJD A;  3A8O B;  1Q7Y C;  4PJO F;  2DIG A;  2YUP A;  1M90 U;  4GLK A;  2GTJ A;  4N4I A;  1QQJ A;  5I2M A;  1VQ5 T;  1YJ9 T;  1QVF A;  3M54 A;  3NHN A;  3UAT A;  1I5O B;  1U5S A;  2EJF A;  3RKY A;  1U8R A;  1KHC A;  3HPW A;  2KVQ G;  4KUI A;  4ZGD B;  3EHR A;  5GAN 2;  3EAE A;  1NJI R;  1M1G A;  1UEB A;  3L2V A;  3G4S Q;  4IUU A;  1RI9 A;  2RNA A;  4XTY A;  3E9F A;  3PT9 A;  2EWN A;  1WXU A;  3QPH A;  4C92 F;  1YCS B;  4HT8 A;  2E5Q A;  2MWP A;  3DB4 A;  1HK9 A;  2RM4 A;  1AHJ B;  5IH2 A;  2QEX T;  5GJW B;  3CCS T;  3A98 A;  2DJZ A;  1NZ9 A;  4LE9 A;  2DD4 A;  2LCL A;  8AT1 B;  2HL3 A;  1M2V B;  3A8H B;  2KK4 A;  2FL7 A;  2DLP A;  1NEG A;  1MMA A;  2ZPB B;  2X3X D;  1T3L A;  2DXT A;  3M0Q A;  2P0P A;  4CC7 A;  2YSQ A;  2ROT A;  4AT1 B;  2JXB A;  2F5K A;  4PLI A;  4M7D G;  2MMP A;  2DZC A;  3CCL Q;  5HCK A;  3PIP A;  2MWO A;  1KD1 U;  1D3B B;  1GBQ A;  2LX9 A;  4KUD K;  4M7D F;  1QVG P;  3GNG A;  5LJ5 h;  3JSC A;  2NUZ A;  1QP2 A;  5LJ5 d;  4V2S A;  3CCV A;  2ED0 A;  1JXM A;  2E1H A;  1N8R R;  4FW2 A;  3CCQ A;  2F5T X;  2HBW A;  2OTJ Q;  2VGM A;  1M90 C;  4FU6 A;  1D0X A;  2QI2 A;  3FLG A;  1LNX A;  1MUZ A;  1GCQ C;  5CKH A;  2OJ2 A;  2PUK B;  3IQL A;  3QZ9 B;  1JB0 E;  3CMA A;  3I56 A;  4PJM A;  4C0Z A;  3JCM h;  3UWN A;  1F1B B;  2YXY A;  3JCM d;  2A28 A;  3NMZ C;  1NLO C;  2AKK A;  2VV5 A;  2PQW A;  3CC7 T;  3VS1 A;  3TRE A;  3CCM A;  4C8Q G;  5GAM e;  5EC7 A;  4OB0 B;  1G5V A;  2PVG B;  3FC3 A;  4EMK B;  1UFF A;  1R8O B;  4C8Q F;  1VQM Q;  2DXU A;  4J7F A;  4EPC A;  4DBR A;  4M75 B;  4M78 D;  4B6M A;  1B3Q A;  3OSV A;  2EBP A;  4OB2 B;  2XD0 A;  1G2B A;  4M75 E;  1WX6 A;  3BDL A;  2K5I A;  4BD3 A;  2EPD A;  3D7S B;  3OS1 A;  5A0G A;  2OTL Q;  1AZE A;  2RI5 A;  1Q82 U;  1ZA1 B;  3MP6 A;  1RAF B;  2YRC A;  2J6O A;  1BCM A;  2CKK A;  4IUP A;  1T3S A;  1Q81 C;  4N0A A;  1KD1 C;  5LJ3 e;  2JTE A;  1PSF A;  3JCM Q;  3CCE A;  4PL6 A;  4OMF B;  1M1F A;  1Y7X A;  2LCC A;  3OMG A;  4JRP A;  4DBQ A;  3EGU A;  3R6O A;  4BI3 A;  1MMN A;  4ZNX A;  4Y28 E;  4HA8 A;  2CDT A;  3SB2 A;  2CP5 A;  4CC3 A;  1OZ2 A;  2W10 A;  2DXB A;  4M7D E;  4X9D A;  1UGS B;  1M9S A;  4BDY A;  2ZPE B;  1TWB A;  4E2F B;  4RTU A;  1PRL C;  1UUE A;  4LDV A;  2DYI A;  5CKF A;  4WF2 A;  1VQ4 T;  4MZM A;  2K2V A;  1VQ9 Q;  1TUD A;  1U1S A;  2L3Q A;  2CP2 A;  2JJ9 A;  1NE8 A;  2O01 E;  4J6W A;  3JB9 G;  1YJN A;  1N6A A;  1G3T A;  2AK5 A;  1I07 A;  2YHT A;  5GAN f;  3X24 B;  2P0K A;  4TVR A;  1KG1 A;  3TEE A;  1KQ2 A;  1M1K U;  1Q82 C;  1B7T A;  5GAO r;  1YFN A;  3F70 A;  1ABO A;  3L1A A;  4C8Q E;  1HXD A;  4NL2 A;  3I55 T;  2X9H A;  2BZ8 A;  2HQE A;  5I22 A;  3WVE B;  2KBT A;  1CKA A;  5CK9 A;  1FWZ A;  1NLP C;  2DRM A;  4MZT A;  2R5M A;  3EH1 A;  1X75 C;  2DIL A;  3E9G A;  2LNH B;  2CGH A;  2AIR B;  1VQ7 A;  1PKS A;  3LW5 E;  1RI0 A;  3INZ A;  4RTV A;  3MP1 A;  1VQ5 Q;  1RAC B;  4FSX A;  1WDX A;  3REB B;  3EG1 A;  4HCK A;  2V1Q A;  4PJO A;  2M02 A;  4OB3 B;  3HL8 A;  1PSE A;  2C06 A;  4FYY B;  2M1H A;  5GAN 5;  3L42 A;  1WXT A;  2HBP A;  3GLX A;  2F69 A;  2QTX A;  2RQW A;  5LJ5 f;  4M77 D;  2GBQ A;  4JS5 A;  3G4S A;  5GAM h;  1SEM A;  1JU5 C;  2LQN A;  4EMH A;  3CBP A;  5GAM d;  2X4J A;  3HTR A;  5CQX A;  4IKF A;  4X34 A;  3M0T A;  2DL8 A;  2DNU A;  1C1A A;  3H9N A;  3J7A F;  4C92 A;  3ME9 A;  1BB9 A;  3M4Y A;  3M55 A;  1VYU A;  1H3Z A;  1G83 A;  4RTW A;  1X43 A;  2LQW A;  4KRT A;  1W70 A;  5FW9 A;  1YI2 T;  2K5F A;  4ESR A;  4N0A C;  1VQ8 Q;  4C5E A;  3G71 T;  2VAS A;  1AD5 A;  2KDS A;  2E3H A;  3OQ5 A;  2XKO C;  2DEU A;  2VUB A;  3EH2 A;  4HKE A;  2DJQ A;  4RCB A;  2RQV A;  2BE7 D;  4RG2 A;  2KGT A;  5FRM A;  1N9S A;  3V7C A;  1UHC A;  2RI2 A;  5LJ3 h;  1V76 A;  3M0U A;  1LCK A;  2K4Y A;  2W0Z A;  1D1B A;  3MPU B;  5LJ3 d;  2D0N A;  1YIJ A;  2E70 A;  1TU0 B;  1VQK A;  4C0D C;  5GAN j;  1I5L A;  3CCL A;  2BE9 B;  2DPP B;  3UA7 A;  1YCY A;  3CME T;  5DY9 A;  5FU6 C;  4Z88 A;  3X28 B;  2GCX A;  4FYX B;  3OY9 A;  1VYV A;  3PIO A;  3VYH B;  4M7A G;  4RUG A;  4M7A F;  3RNJ A;  1VQL A;  1KC8 R;  2DMO A;  1K76 A;  5KYW B;  2QA4 Q;  2OTJ A;  3MP8 A;  4HVU A;  1JO8 A;  4P5N A;  4D8D A;  3EFO A;  3TSZ A;  1ACM B;  1PWT A;  3CC2 A;  4VUB A;  3QWX X;  2ESW A;  1OU9 A;  2GFA A;  4C0F A;  1U3O A;  4N4H A;  1FMW A;  4O5V A;  5HKC A;  1ZSG A;  1OX9 A;  4J7I A;  1IB8 A;  3H41 A;  2D0Q B;  1T0H A;  3VKI A;  2ZPH B;  4J83 A;  3MEV A;  3MKD A;  4B9X A;  4RTZ A;  2QGF B;  2YLC A;  2L3S A;  3M5A A;  4XQ3 A;  3R6N A;  5LJ5 j;  1VQM A;  4RCC A;  3CCR T;  4D8K A;  4MMK A;  4C8Q A;  2DER A;  2DZ9 A;  1UG1 A;  4F04 B;  4LDW A;  3OW2 S;  1D1A A;  3S3N A;  3VYG A;  1VIF A;  2OTL A;  2DYB A;  5LL6 S;  5C0M A;  3G1J A;  2JS2 A;  5HK0 A;  2M51 A;  2GNC A;  5CR2 A;  2P84 A;  4YTL A;  2DD5 A;  2GTO A;  5D6X A;  1BI3 A;  2X3W D;  4KGZ B;  2CUB A;  2RJE A;  3OYI A;  1ZBX A;  2VGN A;  4PJO C;  2CP7 A;  1M27 C;  1A0N B;  2V8I A;  2NYS A;  2KT1 A;  2O88 A;  3NGP A;  3PVL A;  3C94 A;  3CCJ Q;  2QAZ A;  1G3W A;  3MET A;  3MJX A;  2O4X A;  1YBY A;  1OX8 A;  4M75 D;  3UA6 A;  3OMC A;  4RG8 A;  3A8G B;  4ZGJ B;  1Q81 R;  1KD1 R;  1KQS S;  2E5K A;  5GAN 6;  1W6X A;  1WHG A;  4C92 C;  1JJ2 S;  1BI0 A;  4K11 A;  4OGC A;  1W1F A;  2C0I A;  2K3B A;  1QCO A;  3JB9 J;  4M7A E;  3QHS A;  4C5H A;  2B86 A;  2RK2 A;  4QQ6 A;  3VS3 A;  1RAE B;  4ZTJ A;  3CC4 T;  1VQ9 A;  4ANJ A;  1N9R A;  1ZSZ A;  4B9W A;  3M4G A;  3L2Q A;  4PFZ A;  4BI4 A;  1SRM A;  3LH5 A;  4QQD A;  3A1P A;  1SRL A;  4LDY A;  2RQR A;  2YDL A;  2LT4 A;  1V1C A;  2HCK A;  2K2M A;  2KR3 A;  2MI6 A;  2JOY A;  2KRN A;  2NLU A;  2RA2 A;  2FB7 A;  3GF5 A;  4ELZ C;  1UEC A;  1YJW T;  2CSI A;  2DF6 A;  2Y90 A;  2KYB A;  5DLO A;  2XDP A;  4XU2 A;  1YHQ Q;  4CI0 C;  5I2S A;  1MNE A;  5IT9 E;  2FG0 A;  3EG9 A;  2LMJ A;  1X2K A;  4LDX A;  4QVD A;  2G6F X;  4EMG A;  3AT1 B;  2PUO B;  1QCN A;  4ZGE B;  1MGQ A;  1VQO Q;  1R77 A;  4C0G A;  4BDZ A;  3EG0 A;  2PNI A;  2MYS A;  2FRW A;  4PJO G;  1Y07 A;  3QBY A;  4DOV A;  1Q82 R;  2JTM A;  5FU7 B;  3DKM A;  2XMF A;  5KYY A;  2HMA A;  2ZPI B;  1VQ6 Q;  1RAB B;  3OYC A;  1RLP C;  2LTO A;  2JZ2 A;  5FU6 B;  1VQP T;  2E65 A;  4JJC A;  4OMN A;  4C8Q C;  3HHT B;  1IRE B;  2MPX C;  4PK4 A;  4C92 G;  1WJS A;  4DA4 A;  1QVF S;  2O2O A;  1Q95 G;  1Z9Q A;  4IIO A;  2ABL A;  3C12 A;  5GJV B;  1M4Z A;  1MND A;  3GNF B;  1K9A A;  2AHJ B;  2JUF A;  1WGS A;  1S72 Q;  2CP3 A;  1WNL A;  1LVK A;  3EGX A;  3FJP A;  1QKX A;  1VQ8 A;  2K3X A;  1QMC A;  2EKH A;  3VS6 A;  1PNJ A;  4J9H A;  5KYX B;  4J9D A;  3VJP A;  1FMK A;  1ZLM A;  3NTI A;  5LJ5 g;  2L89 A;  1SPK A;  2NUT A;  1UJ0 A;  4HCB A;  1Y71 A;  4KGV B;  3RKW A;  2VYT A;  1CKB A;  5GAM j;  3RMQ A;  1AWW A;  1KK7 A;  1K73 U;  4JJN K;  3OYL A;  2I0N A;  3OB9 A;  4XTU A;  4ZN3 A;  1UJY A;  1UGP B;  4M7A A;  3JCM g;  3PNW C;  2D6F A;  4R55 A;  2CH4 W;  2HSE B;  2YWW A;  3H8Z A;  1VQN Q;  1N5Z A;  4A54 A;  3WVD B;  3T9N A;  2RHU A;  1WHM A;  9ATC B;  4Z89 A;  1ZSZ C;  1HD3 A;  3CCV T;  2FZK B;  4BAC A;  1G3S A;  2F2W A;  4WCI A;  1Q86 U;  5IN1 A;  3CCQ T;  1AWJ A;  3CXC P;  3QDF A;  5LJ3 j;  1M3B A;  5GMK m;  3JB9 D;  4PJO E;  3OS2 A;  3KBG A;  1AOJ A;  1CSK A;  1BIA A;  3CMA T;  5FRO A;  1ZA2 B;  3I56 T;  4A4H A;  3I5S A;  4A4F A;  3OYH A;  4OGE A;  3VUZ A;  4DBF A;  5ECA A;  3JB9 H;  3J81 E;  2H3E B;  2ATC B;  2DO3 A;  3CCM T;  5KCO A;  3OBY A;  2HAX A;  2K57 A;  2P4T A;  2YLB A;  4J8O A;  4C92 E;  3ZFJ A;  3CCU A;  2OAU A;  3CD6 A;  2XI9 A;  3LH0 A;  2ZAE A;  3JCM W;  4OMM A;  2OAW A;  2KE9 A;  5GAN 8;  3GIB A;  3JAM E;  4E47 A;  1IRX A;  2DEQ A;  1K73 C;  2C0O A;  1W2B S;  2FPF A;  4QW2 A;  3BFM A;  4IIM A;  1FXX A;  1WHJ A;  2A37 A;  4HVW A;  2QQA A;  4F7U A;  4M7D B;  2P0Q A;  2DTH A;  2FPE A;  3BY7 A;  5FWB A;  3CCJ A;  2V8J A;  3CCE T;  3DLM A;  1Z9Z A;  3CBO A;  3GOX A;  2MAM A;  1MHN A;  1K0X A;  1IZ6 A;  1Q86 C;  2QG9 B;  2KQW A;  3QYH B;  1KQ1 A;  3EFO B;  4MDW A;  2JW4 A;  2BIV A;  5CKB A;  1GL5 A;  3OYK A;  3JCM c;  1TXQ A;  2H3J A;  4BE1 A;  2QQS A;  2KEA A;  4QKU A;  1NYF A;  4Z02 A;  3G7Z A;  2M0Y A;  2VWF A;  3OYF A;  2MIO A;  2RF0 A;  3VU3 C;  4A53 A;  1WZO A;  2O31 A;  1XOV A;  4PFO A;  1TTH B;  4J9I A;  1YJW Q;  5D6W A;  2MK5 A;  2QGG A;  3ER0 A;  5CKE A;  4C8Q B;  2RHY A;  3NPF A;  4AMC A;  3HKS A;  3P8D A;  2FVU A;  1RAI B;  1NPP A;  1YIT Q;  2A3L A;  1GXI E;  1TSF A;  1YJN T;  1YHQ A;  1WA7 A;  2PVO B;  3VS4 A;  2V26 A;  3LGL A;  3HFN A;  4CRI A;  4M7A C;  1QP3 A;  4M78 G;  1X6G A;  1N8R U;  2DX1 A;  2A08 A;  2GQI A;  4M78 F;  2OI3 A;  1OV3 A;  4JLG A;  2I2L A;  2DKG A;  1X01 A;  1VQO A;  3G6E Q;  1KHI A;  4KT0 E;  2BTT A;  5FLX E;  1YJ9 Q;  2DFU A;  2WSE E;  2E3I A;  2LRQ A;  1JEG A;  3QG1 A;  1GBR A;  1YN8 A;  2GFU A;  5GAM g;  2XG8 D;  4O6J A;  2BKD N;  5I21 A;  3OYJ A;  1VQ6 A;  3QYG B;  5D7U A;  1BCO A;  1WHL A;  2KI7 A;  1VQ7 T;  4LN2 A;  2O4X B;  1K9M U;  3LGF A;  2J7I A;  4DQ2 A;  2KAF A;  2CP6 A;  2EQJ A;  2FRY A;  2DL5 A;  2L3R A;  2HDA A;  2QEX Q;  2J05 A;  2L0A A;  2XK0 A;  4JRI A;  4ELY C;  2HL5 C;  3E19 A;  3CCS Q;  2L3P A;  3C95 A;  3FRN A;  1X6B A;  3V8J A;  2LC4 A;  1Q7Y R;  2COW A;  1OYX A;  2H8H A;  5CAI A;  3EFR A;  3SFM A;  2KRS A;  3QXE B;  2DET A;  1S72 A;  2E4H A;  5LJ3 g;  3SEM A;  3G4S T;  3JCM f;  1BIB A;  1ZSZ B;  1M1K C;  3OYE A;  2WAC A;  3GBQ A;  1B34 A;  3QUI A;  4EDU A;  1WPY A;  2EIF A;  3WXM B;  1BKB A;  4QVZ A;  3VS5 A;  2Y4Y A;  1EZZ B;  2COY A;  2HSP A;  4J5Y A;  1N8R C;  2RO0 A;  1PRM C;  4E7H A;  3CPW S;  6AT1 B;  1ARK A;  5IHK A;  1UE9 A;  1UHF A;  2JVV A;  1N27 A;  3TQ7 P;  4QVC A;  3A8M B;  5GAN 4;  2NUP A;  3EG9 B;  1KSW A;  2HQX A;  1PD0 A;  2LP5 A;  4Z8A A;  2ED1 A;  3E1S A;  3I5R A;  1YIJ T;  1XQH A;  3PMI A;  5L23 A;  5GAO m;  1VQK T;  1QCF A;  3X25 B;  1D0Z A;  3JB9 I;  3CCL T;  1JXO A;  2V8K A;  4AFU C;  5KE3 A;  2CH4 A;  2DIQ A;  2RHZ A;  3L2W A;  3CCQ Q;  3H0I A;  4M78 E;  2KT8 A;  2O9V A;  2P4R A;  4PLL A;  2LDM A;  1K9M C;  2QTV A;  2M16 A;  3PGG A;  3CC7 Q;  2YUN A;  1BYM A;  4JLI A;  1K0S A;  1I0C A;  1VQL T;  4JRQ A;  1RL2 A;  2J06 A;  4RKU E;  5KYY B;  1WQ7 A;  1K4U S;  1I8F A;  2OTJ T;  2R58 A;  1OU8 A;  1M90 R;  2B8A A;  2YT6 A;  3CC2 T;  2PTK A;  2KYM A;  2K9G A;  4L6V 5;  5GAN e;  4J9G A;  4PFP A;  1TG0 A;  2CP0 A;  5IHN A;  1QVP A;  4XU0 A;  3OW2 A;  4M77 G;  3OA6 A;  2K6D A;  1VOM A;  5CIU A;  2RD1 A;  4JJB A;  3HFO A;  4M77 F;  5EG2 A;  3QJ6 A;  2Z0W A;  3EGX B;  4XTV A;  1VQM T;  3CPF A;  2EQI A;  2KMT A;  5GMK e;  3JCM b;  2LZ6 B;  2A0F B;  1QVG S;  2HD0 A;  2JNG A;  3L2U A;  2ZPG B;  4A4K A;  4PJO D;  4XTX A;  4F7U G;  1LJO A;  4L59 A;  1LPL A;  2NUT B;  3HSB A;  3KFV A;  2OTL T;  2DTI A;  1SF9 A;  4F7U F;  1AWO A;  3RMS A;  2D9T A;  4LUE A;  4PJN A;  1I4K 1;  1JQQ A;  5GAN 7;  3L2R A;  1TOV A;  1ZUK A;  1QLY A;  3CXC A;  3ULR B;  1W4S A;  2M0O A;  2IVW A;  2RQU A;  1AT1 B;  3EFS A;  2DVJ A;  3A5Z B;  3I9Q A;  3J80 E;  4C92 D;  1KQS A;  4J6Y A;  1GRI A;  4M7A B;  1JJ2 A;  2CZ7 B;  1Y0M A;  1ZX6 A;  2E41 A;  4NS5 A;  4FT4 A;  3PE0 A;  1VQ4 Q;  1D0Y A;  2JMC A;  2RH2 A;  2EQU A;  4ATO A;  2QYZ A;  1HYO A;  2X4X A;  1OQK A;  4FSS A;  2KXD A;  1VA7 A;  3MEU A;  4Q5W A;  2EGC A;  4FCY A;  4PKC C;  4JJD A;  2DL4 A;  3O8V A;  3E2U A;  2AKL A;  1I81 A;  4J9C A;  4XU1 A;  3FJ5 A;  1VYT A;  2RHX A;  5A0L A;  2DAQ A;  2HEQ A;  4LD9 K;  2LJ0 A;  4M7D D;  5GAM f;  1VQ9 T;  4E7S A;  1WXB A;  3I55 Q;  4JUV A;  5KCH A;  5KYU A;  1YIT A;  1VUB A;  4OMQ A;  1C0M A;  1SHG A;  2DM1 A;  5J39 A;  1BBZ A;  2FEI A;  5HY6 A;  1M30 A;  1KC8 U;  4OVA A;  4Y92 A;  1ZUY A;  4M78 A;  2EFI A;  3FEO A;  3GP8 A;  1WJR A;  5FWC A;  4MDX A;  1C6V X;  4M77 E;  1B07 A;  2YRD A;  5C6S A;  3OS0 A;  1VQ5 A;  1WI7 A;  1YJ9 A;  5LJ3 f;  2XU8 A;  2E12 A;  2D1X A;  3LWI A;  2EVR A;  4AFZ C;  2CYZ B;  3A8L B;  1M2O A;  4C0D B;  4UC4 A;  3TCJ A;  3LYI A;  2LT1 A;  1Y96 A;  4BY6 C;  3URG A;  2GF7 A;  4C8Q D;  2A7Y A;  4F7U E;  3HRS A;  1PHT A;  2CZ6 B;  3C4S A;  4RTT A;  2JTF A;  4DBH A;  1MMD A;  2QEX A;  4LD6 A;  5GMK i;  5L8R E;  5M9O A;  3CCS A;  2DXC A;  3SD4 A;  3QII A;  5CVI A;  5GAN h;  1XNI A;  1MV3 A;  4M75 G;  1YI2 Q;  4KUL A;  4GLM A;  2VC8 A;  5GAN d;  1S1N A;  2G3R A;  1SG5 A;  2E10 A;  1XJW B;  3G71 Q;  4M75 F;  2DK3 A;  2R57 A;  2QDY B;  2MOX A;  4CC4 B;  2EYQ A;  2GGR A;  3VS2 A;  1K1Z A;  3LWH A;  2E6Z A;  4OP0 A;  4R0K A;  3P8H A;  3ASK A;  1AZG B;  3UDC A;  4ZN1 A;  3TSW A;  5GMK h;  2KSS A;  3V8K A;  2RJF A;  1ZQ1 A;  2JMA A;  5KH6 A;  1K8A U;  1P92 A;  4IUQ A;  3TU4 K;  1GCP A;  2BZX A;  1OPK A;  2D8H A;  2K79 A;  3CME Q;  3OW2 P;  3U23 A;  3PVQ A;  1R0C B;  3MO8 A;  1VQ8 T;  3FDR A;  1KC8 C;  3MEA A;  3OYG A;  4II1 A;  4LXC A;  1IO6 A;  3PMT A;  1HSQ A;  1O9S A;  2NWM A;  1M5Q 1;  3HRT A;  1M1K R;  1YIJ Q;  1WHK A;  1VQK Q;  3S3M A;  2DA9 A;  1Q81 U;  3X20 B;  1M3A A;  3JCM P;  2LQK A;  2QA4 A;  2BZY A;  3OYA A;  3RR6 A;  1JRI A;  1QW1 A;  4WTO B;  1GFD A;  2LX7 A;  5FRN A;  2SEM A;  2EJG A;  3VS7 A;  5DM7 R;  1H3H A;  3SDZ A;  1VQL Q;  4E7L A;  3AHU A;  1Y57 A;  4J9E A;  3CC7 A;  4PJO B;  2EYZ A;  5AT1 B;  1ABQ A;  1E6G A;  5DLQ E;  3DLL A;  2C0T A;  2QA4 T;  3LLR A;  2J6K A;  3RKX A;  3CC2 Q;  2IPO B;  2ZPF B;  5GAO p;  2R5A A;  3CCR Q;  1WFW A;  2HZY A;  3V8L A;  2CRE A;  2EJ9 A;  1KQS P;  1JJ2 P;  4OB1 B; 
#chains in the Genus database with same CATH homology
 1YIT T;  4B9X A;  4LDU A;  2YLC A;  2I2L A;  2DKG A;  1X01 A;  2FHD A;  2IG0 A;  4HCZ A;  4ME7 A;  1VQO A;  5CQY A;  2EQK A;  2WSC E;  4XAX B;  3M57 A;  4BE0 A;  1KHI A;  1OI1 A;  3M5A A;  3ZEH A;  1U1T A;  3KUF A;  4KT0 E;  4XQ3 A;  3PTA A;  2MF2 A;  4C92 B;  5LJ5 j;  1VQM A;  4RCC A;  2RJC A;  5FLX E;  3CCR T;  4MMK A;  4XTZ A;  4C8Q A;  4IUT A;  2WSE E;  4F7U B;  5GAO q;  2DZ9 A;  2LRQ A;  4LDW A;  1VQP A;  2M9U A;  4BB7 A;  5GAO l;  3OW2 S;  3QG1 A;  3SWN A;  2GFU A;  5GAM g;  3HRU A;  2XG8 D;  4FT2 A;  4O6J A;  3PFS A;  5GAN g;  2BKD N;  5I21 A;  3OYJ A;  3G6E T;  1Q7Y C;  2RJD A;  3A8O B;  1K8A C;  4PJO F;  4M77 A;  4M78 C;  3S3N A;  1VQ6 A;  3QYG B;  2DIG A;  3OS5 A;  3VYG A;  1M90 U;  4GLK A;  4N4I A;  1VIF A;  1VQ5 T;  5I2M A;  3HP9 A;  1YJ9 T;  1QVF A;  3M54 A;  1B34 B;  2OTL A;  1VQ7 T;  2O4X B;  2PVD B;  5LL6 S;  5C0M A;  3LGF A;  1K9M U;  3FIF A;  2EJF A;  3RKY A;  4DQ2 A;  1KHC A;  2KAF A;  1U8R A;  2EQJ A;  3HPW A;  2KVQ G;  5HK0 A;  2L3R A;  4OF1 A;  4KUI A;  4ZGD B;  5GAN 2;  3EAE A;  1M8V A;  2XK0 A;  5CR2 A;  4JRI A;  3CEY A;  4ELY C;  1UGR B;  3QZ5 B;  1W2B A;  3E19 A;  4YTL A;  1M1G A;  1UEB A;  3C95 A;  3L2V A;  2DD5 A;  4D6W A;  4IUU A;  1EIF A;  3FRN A;  5D6X A;  1BI3 A;  3CCU T;  3CD6 T;  4XTY A;  2LC4 A;  3E9F A;  2RJE A;  3PT9 A;  4PNO A;  1ZBX A;  3V8J A;  2VGN A;  1OYX A;  4MZP A;  3OYI A;  4PJO C;  2EWN A;  2EQM A;  3QPH A;  5CAI A;  3EFR A;  3SFM A;  4C92 F;  4HT8 A;  2E5Q A;  2MWP A;  3DB4 A;  4XTW A;  1HK9 A;  2RM4 A;  3QXE B;  1AHJ B;  2QEX T;  1UGQ B;  1S72 A;  2V8I A;  1BI1 A;  5LJ3 g;  3M56 A;  3CCS T;  1NJI U;  3G4S T;  2DJZ A;  3JCM f;  1BIB A;  1NZ9 A;  4L5G A;  4BI8 B;  1M1K C;  3OYE A;  2DD4 A;  3C94 A;  2WAC A;  2LCL A;  3QJY A;  3UT1 A;  1G3W A;  1B34 A;  5GAN 3;  3QUI A;  4EDU A;  3MET A;  2O4X A;  1YBY A;  4M75 D;  1WPY A;  2EIF A;  3WXM B;  3A8H B;  3OMC A;  4RG8 A;  3A8G B;  4ZGJ B;  2KK4 A;  1BKB A;  2FL7 A;  4QVZ A;  2Y4Y A;  1KQS S;  5GAN 6;  2ZPB B;  4FL6 A;  1VQ4 A;  4C92 C;  1JJ2 S;  1BI0 A;  2DXT A;  4OGC A;  3M58 A;  3CCJ T;  2P0P A;  4J5Y A;  1N8R C;  2RO0 A;  4E7H A;  3CPW S;  3JB9 J;  4M7A E;  3QHS A;  1V29 B;  4C5H A;  2F5K A;  4PLI A;  4M7D G;  2MMP A;  2RK2 A;  4QQ6 A;  2DZC A;  5CKD A;  2JVV A;  3PIP A;  2MWO A;  1N27 A;  1KD1 U;  4ZTJ A;  3CC4 T;  1D3B B;  2LX9 A;  4QVC A;  4KUD K;  4M7D F;  1VQ9 A;  3A8M B;  3GNG A;  5GAN 4;  5LJ5 h;  1N9R A;  3JSC A;  4A4E A;  4B9W A;  2HQX A;  3JB9 G;  1QP2 A;  1X6O A;  3M4G A;  3M9Q A;  2LQ8 A;  5LJ5 d;  3E1S A;  3L2Q A;  4BI4 A;  4V2S A;  4ZTF A;  1YIJ T;  1XQH A;  4QQD A;  3PMI A;  4BY6 B;  3CCV A;  5GAO m;  4LDY A;  1VQK T;  3X25 B;  2E64 A;  2E1H A;  3JB9 I;  3CCL T;  5A0D A;  2LT4 A;  4JRK A;  3CCQ A;  2WSF E;  2F5T X;  2MI6 A;  4XK8 E;  2JOY A;  2NLU A;  2RA2 A;  2V8K A;  2VGM A;  1M90 C;  5KE3 A;  4FU6 A;  2DIQ A;  3I55 A;  2FB7 A;  5IAY A;  2RHZ A;  2QI2 A;  3FLG A;  3GF5 A;  1LNX A;  3L2W A;  4ELZ C;  4M78 E;  3JB9 F;  1YJW T;  4PLL A;  2LDM A;  2XDD A;  5CKH A;  1K9M C;  2M16 A;  3PGG A;  2PUK B;  2Y90 A;  4M7A D;  1BYM A;  3QZ9 B;  1JB0 E;  4JLI A;  5DLO A;  2GQV A;  3CMA A;  5CCA A;  4JRQ A;  3OYM A;  3I56 A;  1RL2 A;  2XDP A;  4RKU E;  1VQL T;  1WQ7 A;  4XU2 A;  4C0Z A;  1I8F A;  3JCM h;  4CI0 C;  5I2S A;  2FYK A;  2OTJ T;  3UWN A;  3OSS C;  1D3B A;  5IT9 E;  2R58 A;  3JCM d;  4RMO A;  2VV5 A;  4LDX A;  2PQW A;  3CC7 T;  2B8A A;  4QVD A;  3CC2 T;  3TRE A;  4EMG A;  3CCM A;  3RIR A;  4ZGE B;  2PUO B;  4L6V 5;  2QQR A;  4C8Q G;  1MGQ A;  5GAM e;  1YHQ T;  3RUX A;  3OYB A;  4OB0 B;  4C0G A;  2PVG B;  5GAN e;  4BDZ A;  1NJI C;  1G5V A;  3FC3 A;  2BUD A;  4EMK B;  1R8O B;  4C8Q F;  4PJO G;  1Y07 A;  2DXU A;  2JN0 A;  3QBY A;  4J7F A;  1QVP A;  4DOV A;  4EPC A;  4XU0 A;  3OW2 A;  4M75 B;  4M78 D;  4M77 G;  2JTM A;  5HK3 A;  3OA6 A;  3OSV A;  4OB2 B;  5FU7 B;  5CIU A;  2XD0 A;  2RD1 A;  1UB4 A;  2X4W A;  3DKM A;  3HFO A;  4M77 F;  5EG2 A;  3QJ6 A;  1VQO T;  4M75 E;  4C5G A;  3BDL A;  4BD3 A;  2K5I A;  4XTV A;  2CZ1 B;  2Y4X A;  2ZPI B;  3VV0 A;  3V7S A;  1BI2 A;  4NOY A;  3OS1 A;  3KXT A;  1VQM T;  3CPF A;  3V7R A;  5A0G A;  2KMT A;  2RI5 A;  3OYC A;  5GMK e;  4HCC A;  3JCM b;  1Q82 U;  3MP6 A;  2LTO A;  1QVG S;  2JZ2 A;  5FU6 B;  1VQP T;  2HD0 A;  2E65 A;  4C8Q C;  2CKK A;  3HHT B;  1IRE B;  2JNG A;  4IUP A;  3L2U A;  1Q81 C;  4C92 G;  1WJS A;  2ZPG B;  4A4K A;  4DA4 A;  1QVF S;  4PJO D;  4N0A A;  1KD1 C;  4XTX A;  4F7U G;  3SWN C;  1LJO A;  4L59 A;  5LJ3 e;  3QDR B;  1VQ6 T;  1YI2 A;  1PSF A;  3JCM Q;  2XID A;  4EMK A;  5GMK l;  3HSB A;  3QSU A;  2OTL T;  3CCE A;  1G3Y A;  2DTI A;  4PL6 A;  4M77 C;  4F7U F;  3GPL A;  3RMS A;  3C12 A;  3G71 A;  1M4Z A;  4OMF B;  2D9T A;  1M1F A;  4M75 A;  1I4K 1;  1Y7X A;  2LCC A;  3GNF B;  2AHJ B;  2JUF A;  4MML A;  3OMG A;  3S6W A;  5GAN 7;  3L2R A;  4JRP A;  1WGS A;  3CXC A;  2XIC A;  2M0O A;  1W4S A;  2IVW A;  1WNL A;  1JBM A;  1O75 A;  3R6O A;  4BI3 A;  3FJP A;  3EFS A;  1VQ8 A;  3QO3 A;  4Y28 E;  3A5Z B;  4HA8 A;  2K3X A;  4QQG A;  3SB2 A;  3J80 E;  2VXE A;  2X35 A;  4C92 D;  1KQS A;  4J6Y A;  4M7A B;  1OZ2 A;  3M59 A;  3VJP A;  1JJ2 A;  2CZ7 B;  1S72 T;  2EAY A;  2DXB A;  3NTI A;  5LJ5 g;  3CD6 A;  4M7D E;  2L89 A;  2XDB A;  3CME A;  2RB6 A;  3L2Z A;  4X9D A;  2E41 A;  1UGS B;  1M9S A;  4NS5 A;  4FT4 A;  3JCM V;  5GAO n;  4BDY A;  3CPW A;  4XU3 A;  2ZPE B;  2ZZD A;  4HCB A;  2QQB A;  1Y71 A;  2RH2 A;  3RKW A;  2EQU A;  4ATO A;  1WQW A;  2VYT A;  2X4X A;  3BW1 A;  5FU7 C;  3VUB A;  4LDV A;  5GAM j;  5AYF A;  5CKF A;  4WF2 A;  3RMQ A;  3MEU A;  1VQ4 T;  4MZM A;  1K73 U;  2K2V A;  4Q5W A;  4JJN K;  1U1S A;  4PKC C;  3OYL A;  4NL3 A;  3OB9 A;  4FIB A;  2HNI A;  4XTU A;  4ZN3 A;  3O8V A;  2KY9 A;  4M78 B;  4M7D A;  5CO7 A;  1VQN A;  2CZ0 B;  2DVE A;  1I81 A;  1NE8 A;  4XU1 A;  1VIE A;  2O01 E;  1OZ3 A;  1UGP B;  4J6W A;  4C5I A;  2RHX A;  3NFC A;  3JCM g;  4IUV A;  5A0L A;  3PNW C;  1YJN A;  2D6F A;  2DAQ A;  4R55 A;  4LD9 K;  3UPU A;  1N6A A;  3H8Z A;  1G3T A;  4M7D D;  2E6N A;  3OYY A;  2YHT A;  5GAM f;  1XTD A;  5GAN f;  1VQ9 T;  3X24 B;  4A54 A;  3WVD B;  4E7K A;  2P0K A;  4GY5 A;  4TVR A;  2ZCF B;  3T9N A;  2RHU A;  1KG1 A;  3TEE A;  4JUV A;  1KQ2 A;  5KCH A;  5GMK j;  1M1K U;  1Q82 C;  1YIT A;  5GAO r;  1VUB A;  3CCV T;  4BAC A;  1G3S A;  3F70 A;  1Q86 U;  1Y96 B;  3MEW A;  5IN1 A;  5J26 A;  5J39 A;  3CCQ T;  3L1A A;  1VQN T;  4C8Q E;  5LJ3 j;  5GMK m;  1HXD A;  5HY6 A;  3JCM X;  3CCR A;  1TH7 A;  4NL2 A;  3I55 T;  1KC8 U;  2HQE A;  3JB9 D;  3MCA B;  4PJO E;  4OVA A;  3KBG A;  3OS2 A;  4X9C A;  4IUR A;  3WVE B;  4M78 A;  5CK9 A;  1BIA A;  2EFI A;  1FWZ A;  3JCM J;  3FEO A;  3GP8 A;  1WJR A;  3CMA T;  4MDX A;  4M77 E;  4MZT A;  2R5M A;  5FRO A;  5C6S A;  3I56 T;  1X75 C;  4A4H A;  3OS0 A;  3E9G A;  1VQ5 A;  2CGH A;  1YJ9 A;  2LNV A;  5LJ3 f;  2XU8 A;  3CBM A;  4KBM B;  1VQ7 A;  4A4F A;  3OYH A;  4OGE A;  2E12 A;  3VUZ A;  3LWI A;  3LW5 E;  1RI0 A;  3JB9 H;  3INZ A;  3J81 E;  2CYZ B;  3MP1 A;  3A8L B;  2DO3 A;  3CCM T;  4C0D B;  4FSX A;  4UC4 A;  3NTK A;  2DTO A;  3S3O A;  3RER A;  4HT9 A;  3TCJ A;  5KCO A;  3LYI A;  3OBY A;  2LT1 A;  2K57 A;  2HAX A;  1Y96 A;  2P4T A;  2YLB A;  2GF7 A;  3URG A;  4J8O A;  3X26 B;  4BY6 C;  4C92 E;  4PJO A;  3ZFJ A;  4C8Q D;  3CCU A;  4OB3 B;  2A7Y A;  2OAU A;  2L5Q A;  3HL8 A;  4F7U E;  1PSE A;  2XI9 A;  3HRS A;  3JRZ A;  1QVG A;  2C06 A;  3OBW A;  2CZ6 B;  3C4S A;  3LH0 A;  3JCM W;  2M1H A;  5GAN 5;  2JTF A;  3L42 A;  2HBP A;  3GLX A;  2F69 A;  2QTX A;  3OYD A;  5LJ5 f;  1H64 1;  2QEX A;  4DOW A;  5GAN 8;  4LD6 A;  5GMK i;  5L8R E;  5M9O A;  4M77 D;  3CCS A;  2DXC A;  4JS5 A;  3G4S A;  3GIB A;  3SD4 A;  5GAM h;  2QQ9 A;  3QII A;  2RK1 A;  5CVI A;  4E47 A;  5GAN h;  2DEQ A;  3JAM E;  4E7J A;  1XNI A;  4M7A A;  4EMH A;  3CBP A;  5GAM d;  1K73 C;  2X4J A;  3BDU A;  3DB3 A;  2YRV A;  4KUL A;  4M75 G;  5CQX A;  2VC8 A;  5GAN d;  1W2B S;  4QW2 A;  4IKF A;  2G3R A;  4X34 A;  3BFM A;  2E10 A;  2L8D A;  4M75 F;  2K5L A;  1FXX A;  2DK3 A;  3J7A F;  4C92 A;  3ME9 A;  3M4Y A;  2R57 A;  3M55 A;  2QDY B;  2QQA A;  4F7U A;  1H3Z A;  4M7D B;  2P0Q A;  2DTH A;  2EYQ A;  3LWH A;  3BY7 A;  2E6Z A;  4OP0 A;  2PU9 B;  3Q1J A;  2QXF A;  5LJ5 e;  2K3Y A;  3CCJ A;  1YI2 T;  3P8H A;  2V8J A;  1SSF A;  2K5F A;  3CCE T;  4N0A C;  3ASK A;  5D6Y A;  4C5E A;  3DLM A;  3G71 T;  3UDC A;  4ZN1 A;  5GMK h;  3CBO A;  2KDS A;  3GOX A;  2KSS A;  3OQ5 A;  3CXC S;  4EMK C;  2XKO C;  2MAM A;  1MHN A;  1WJQ A;  3V8K A;  2RJF A;  2VUB A;  4HKE A;  1IZ6 A;  1ZQ1 A;  5KH6 A;  4RCB A;  1P92 A;  4IUQ A;  3TU4 K;  1Q7Y U;  1Q86 C;  4RG2 A;  1K8A U;  3CC4 A;  4M75 C;  2KQW A;  5FRM A;  1N9S A;  1KQ1 A;  3QYH B;  1LOJ A;  2RI2 A;  3LX7 A;  4MDW A;  5LJ3 h;  3V7C A;  3MO8 A;  2BIV A;  2K4Y A;  5CKB A;  1VQ8 T;  3OYK A;  3FDR A;  1KC8 C;  3MEA A;  5LJ3 d;  3OYG A;  4II1 A;  3JCM c;  1YIJ A;  3PMT A;  1FX7 A;  2E70 A;  3P8B B;  3OYN A;  1VQK A;  2H3J A;  4C0D C;  4BE1 A;  5GAN j;  1I5L A;  3CCL A;  1O9S A;  4E7I A;  2QQS A;  2ZGW A;  1M5Q 1;  2CS7 A;  2DPP B;  3HRT A;  3G7Z A;  4Z02 A;  3JCM e;  3NTH A;  1YCY A;  4J6X A;  3OYF A;  3FB9 A;  3CME T;  3M53 A;  5DY9 A;  5FU6 C;  3X28 B;  3S3M A;  2GCX A;  3OY9 A;  1Q81 U;  3X20 B;  3QKJ A;  3PIO A;  3VYH B;  4M7A G;  3VU3 C;  1YJW A;  3JCM P;  2LQK A;  2QA4 A;  4A53 A;  3RES A;  3OYA A;  1ZHI A;  1JRI A;  1QW1 A;  2RHI A;  4M7A F;  1XOV A;  1VQL A;  3N5B B;  2EKO A;  2LVM A;  4BUG A;  4JDS A;  5FRN A;  5D6W A;  3MP8 A;  3ZBD A;  4BE2 A;  2OTJ A;  3ER0 A;  5CKE A;  2EJG A;  4JS4 A;  5DM7 R;  4FM4 B;  4P5N A;  3SDZ A;  4C8Q B;  4E7L A;  3AHU A;  4Y91 A;  2RHY A;  2X4Y A;  3HKS A;  2RI3 A;  5J3B A;  4A4G A;  3P8D A;  3CC7 A;  2FVU A;  3CC2 A;  4PJO B;  2XHC A;  3SWN B;  1NPP A;  1GXI E;  2A3L A;  4N4G A;  4VUB A;  5DLQ E;  3DLL A;  2GFA A;  1YJN T;  4C0F A;  3MHX A;  4M77 B;  1YHQ A;  4M7D C;  2QA4 T;  2PVO B;  1NPR A;  3LLR A;  4N4H A;  2VXF A;  3RKX A;  4O5V A;  5HKC A;  3H6Z A;  3LGL A;  3HFN A;  4CRI A;  4R56 A;  4M7A C;  2ZPF B;  1QP3 A;  4J7I A;  4M78 G;  2R5A A;  5GAO p;  1N8R U;  3V8L A;  5A2Q E;  2EJ9 A;  4OB1 B;  2D0Q B;  3G6E A;  5KE2 A;  3VKI A;  2ZPH B;  4M78 F;  4J83 A;  3MEV A;  1DJ7 B;  4JLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...