1EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
128
Chain Sequence
MPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Initiation factor
molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 22
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eifA02
3BZKA 4RG2A 4AIMA 2UUCQ 2AWNA 3KJPA 4AQYL 1VQLT 1CSQA 4JOIC 4HIKA 1ASYA 2A8VA 2R93G 3CCST 1VQPA 1K8AU 1KD1C 1K9MC 2JK8A 1GM5A 1FJGL 4DR4L 3UDIA 3F2BA 2F4VL 4X62Q 2UXDL 1KC8C 4JBMA 1HJPA 1KD1U 1K9MU 3BU2A 5IT9E 2K14A 2Y0SE 4C3IH 4DV0Q 4BBRH 1S40A 4A3GG 3I4MH 3G4ST 1W3SA 1X56A 5IYBG 1KC8U 3ZJYC 4DV5Q 3RLNA 4LF6L 5C0XG 4B3TL 4HIMA 1PH1A 4BA2I 5GROA 3J80c 1QVFA 3ICEA 2NVXH 3OYYA 2LSSA 3LH0A 3GTGH 1YVCA 3HOXH 4DV3L 5C4XG 1H95A 3J80E 3H0GH 3PUYA 1EQRA 3LGJA 1KAWA 4NXMQ 4GKKQ 1MIUA 1N9WA 1DGSA 3WWVA 4A3KG 1NTGA 4DV7L 5C3EG 3H3VI 4J15A 4DV6L 4GLAC 1Q86C 1NMFA 2JA6H 4C2MH 4A3CH 1XMOQ 3NENA 1HNZL 2VQEL 4GOPA 3JC66 1PHJA 1N34L 2OCEA 2ALYB 3G6ET 4L5QA 3P8BB 1EIFA 1YJWA 1Q86U 2IHEA 3LGFA 1IXRA 2OTJT 4QL5A 2ZM6L 4A3IG 4WJ3M 4DAYB 2D62A 4YCUA 4HJ9A 5GAGC 2LXJA 5M3FG 3NEMA 1YHQA 2MI6A 3RLFA 1CKMA 3CC2T 3I7FA 3W1BA 1R9TH 1YITT 3TS2A 1E3PA 2VUMG 4TVRA 3K8AA 1CUKA 2E5LQ 2HT1A 5FLXE 2JA8H 1YNXA 2N3SA 3E0EA 4JYAL 4JV5L 1L0WA 1XPOA 1VQNT 2MO0A 3G48A 4A3MH 3RZDH 3KBGA 4LF4L 3J81i 1G51A 1BBWA 1MKHA 2I5HA 2VZAA 2UXBL 1IBML 4GOPC 2KBNA 4YY3L 2R92H 4UP9A 1HNWL 2K4KA 4A3FH 3GD7A 1LYLA 1VQ4T 3AFPA 4LWCA 1WCMG 4DV2Q 4JI2L 5C0XJ 1WJJA 3GO5A 1YHBA 2AKWB 2K5NA 5DLQE 1G291 2YTVA 4HJ7A 3CCSA 1O7IA 5IE8A 4A3DG 4DK6C 1KL9A 2PNHA 2ZJRA 2UUBQ 1HZ9A 1EYGA 1XNQQ 3AEVA 3M9BA 3PO2G 3BZCA 2D0OA 4KHPQ 2ID0A 4JI7Q 4JI6L 4POFA 3CPWS 4LF8L 4LNQA 4R1JA 3S1NH 1YJ9T 2I5MX 1SR3A 3M3YH 2NZHA 2E2IH 2F3IA 4JI4Q 3HOUG 2KCMA 3G4SA 3RLOA 5FJ8H 2E2JH 1QVFS 2Q2HA 3PV0A 1I5FA 1E7ZA 3PUZA 4IOCA 1NJIC 1X65A 2PI2E 4YWLA 3K7UC 3OW2A 1YHAA 2F52A 2L15A 3FKIH 1X55A 4YCWA 3ERSX 4ALPA 4X64L 1I94Q 3J7AF 2CCZA 4IPDA 3S24A 4BXXH 2HHHQ 4LFBL 3CMAA 1A63A 1FVIA 1NJIU 2MO1A 2YU9H 2E70A 1TWFH 3F2CA 4JC0A 1HZAA 1C7YA 2OTLT 5GADC 5M3MG 1N33Q 1I6HH 1A8VA 2CFMA 3E9HA 1GVPA 4JI0Q 1JE5A 3I4OA 4P73A 1Y1WG 4JI8L 5GQOA 1YJWT 1SN8A 5IP7H 3GTLH 5LMNW 4KI0A 3OTOL 4GS3A 3HOYG 3UDFA 4UPAA 1PH3A 3G6EA 3JAMi 2JEAI 4LF9Q 3UE0A 4B3RL 1TWCH 2CWAA 3W1GA 2OTJA 4B3ML 4DUYL 2LQ8A 2R93H 3LGLA 2R7FA 1GO3E 2VQFL 2H5XA 1IBKL 2QA4T 1Y1VG 1MJEA 1N36Q 4RG1A 4GN3B 2UU9Q 4LF5L 1PH4A 1YITA 1FGUA 3TRZA 5C0XI 3L2PA 4DR3L 5K36G 2OWOA 4A3GH 1SROA 5JEAJ 3W5OA 2JA7G 4OXPA 1X3EA 4YWMA 5IYBH 1VQNA 1SE8A 4BY7G 4QQDA 5IWAL 2KENA 1PV4A 3S16H 2CQOA 4IJHA 2BA1A 4A75A 1PH7A 3A0JA 4MTNA 2JA5G 1XPUA 1X3FA 5LL6S 2ATWA 1WFQA 4A93G 2JOYA 5C4XH 1Q12A 4LUOA 5LMNL 4LF7Q 1J6QA 3PF4A 2E6ZA 2MNAA 1VQ4A 4DR5Q 2WB1G 5IT9c 3J7A5 1JT8A 3F8TA 4LFAQ 4DV4Q 1HNXL 3RZOH 4DPGA 2ZTDA 5C3EH 1N8RC 1XJVA 4B3SQ 5LMUL 3KOJA 1VQ9T 1JJ2S 4JCVE 4P75A 5C44G 4NXNL 1N8RU 4GOPB 2BA0A 4YCVA 1B7YB 3PO3H 4A3BG 2EXDA 3CC4T 1IL2A 4R4CA 1XNRQ 1YZ6A 2JEBI 4JG2A 4DR1Q 1E1OA 1YJ9A 4A3IH 4LFCQ 4BBSG 4JI3L 1K73U 2AHOB 4AYBE 4LW1A 1QUQA 4ZN1A 2DO3A 1SRUA 1V1QA 1VQDA 4DAMA 4YHHL 3J81j 2B63G 1T9HA 1N32Q 2DUDA 2IY5B 3CMAT 1Z9FA 3KLWA 5EAYA 3HOVG 2IX0A 1PYSB 2VUMH 3ULLA 1TWAH 1P16A 2K5VA 4GNXA 1Q8KA 1VS0A 4A3EG 3DB4A 1U5KA 2N8NA 5DM7R 1Q46A 3RN2A 3S15H 2OTLA 1M90C 2A1AA 1JB7A 4OX9L 2R7ZG 4IFDI 1IBLQ 4JI5Q 4GLXA 3H3VH 1C9OA 2AWOA 3U4ZA 3J81c 1TWGH 1VQOT 5C4JH 4Y7NH 1M90U 1VQFA 1XMQL 1PH8A 4X65L 1VQMT 3CCVT 2WAQG 1PFSA 1WCMH 2B29A 3J81E 1Q82C 2PMZE 2QGQA 4RMFA 5FLXc 2UUAL 3T1HL 3RR5A 3EN2A 5BR8Q 4GKJQ 4HJAA 1A62A 2UUCL 2BH2A 1W2BS 2I5LX 1PH5A 3CCMT 2QA4A 1Q82U 1AE3A 1SLJA 4OONA 3D31A 3PO2H 1KQSS 1G6PA 1TXYA 3EIVA 3CCUA 4GNXC 4X34A 2DGYA 4K0KL 2XTIA 4DR6Q 3CXCA 2D0PA 3HOUH 1Q1EA 2L3RA 3CMET 4DV0L 3T1YQ 3CAMA 2FXQA 1CKNA 3GTMH 1WOCA 1CSPA 3BJUA 3S1RH 3S1QH 4DV5L 2JA9A 1UE6A 2CKZB 4IFDG 2MWPA 1YBYA 2PQAA 2VW9A 1L1OC 2UXCQ 1XTDA 5JEAG 3S2DH 4OO1G 1EQQA 1QVGA 1KIXA 1D7QA 3GTKH 4JBJA 1VQEA 4DR2Q 3GTQH 3H0GG 1OXXK 3PIPA 1P8LA 2IHFA 3M4QA 4IO9A 5M3MH 1PH9A 4NXML 4IOAA 4C3HH 2E8GA 4GKKL 3ULJA 1MJCA 1Y1WH 4BY1G 4PZ7A 4MZ9A 3G71A 3S2HH 1S72T 4KHZA 4PZ6A 1VQ9A 2RHQB 1HR0Q 1WI5A 2VNUD 1XMOL 4DUZQ 3CC4A 1IZ6A 2GVBA 3AFQA 3CP0A 3D0FA 1K8GA 2KHIA 3JAMc 5M5XH 4DV1Q 4R4IA 1Y14B 1X3GA 1J5EQ 2JVVA 4LF5Q 1U0LA 1Y1VH 2KVQG 3AQQA 3HKSA 3JAME 2NVYH 1SSFA 3PUWA 2E2HH 4A3LG 2JA7H 3KFUA 2JQOA 3U50C 2E5LL 4PMWA 5AJ3Q 3GTPH 3I56A 3FP9A 2R6GA 2B3GA 2RCNA 2RHSB 4P74A 1AE2A 3F2DA 4BY7H 5HY6A 2Q2IA 4JI1L 1IYJB 2HIXA 3HKZG 4EX5A 1AH9A 4AQYQ 3HOWG 1UE7A 4A93H 3KF8B 1PVOA 1VQOA 4DR4Q 1FJGQ 1EWIA 4A76A 1KHIA 2QEXT 3K80C 4H02A 2F4VQ 3CF5A 1VQMA 2UXDQ 3CCVA 1JJCB 1VQAA 2GN5A 1FL0A 1OXSC 5E7NA 4DKAC 2OQKA 1VQ5T 3RNUA 3CCUT 1K83H 4IFDJ 4X66L 3VDYA 2YV5A 1VQHA 4TQUS 2OQ0A 1UEBA 4QY7A 2VS1A 3CQZH 4QGUA 4DR7Q 3L0OA 4B3TQ 4LF6Q 3CCMA 4UY8C 2IT1A 4A3BH 3I4NG 3CXCS 1V43A 1YJNA 1XNQL 1I50H 1SFOH 3Q8DA 2KDSA 1VQ7T 4IPHA 4KHPL 4BBSH 2LVMA 1QVCA 1LTLA 1LUZA 1VQGA 2YTXA 3KF6A 3CMEA 4R4TA 4DV3Q 5FJ8G 3CCRT 1K0RA 1VQBA 2B63H 4HJ5A 4O0AA 1CKOA 4JI4L 3CCQT 1QUQB 4A3JG 1NE3A 4JBKA 4LUZA 3CCJT 3DB3A 1D8LA 1OXVA 1TWHH 1KRSA 3A5ZB 2Y0SG 5IP9G 4DV7Q 4O2DA 3HOVH 3HOZG 4OWXB 3S14H 4ME3A 4DV6Q 4PG3A 1I3QH 4A4IA 4A3KH 1EIYB 4APVA 2NZOA 4GNXB 1I94L 1HNZQ 2VQEQ 4A3EH 1N34Q 4IPCA 3G71T 3ER0A 2HHHL 4L5RC 3KDFA 2R7ZH 2ZM6Q 1K73C 5M5YH 2JNGA 1EUJA 1PH2A 1QZGA 2Z6KA 5IYCG 2JJQA 1N33L 4JI0L 1S72A 3L7ZC 1HH2P 1RL2A 2JUFA 1E24A 1OXTA 4BA1I 5M3FH 3MXNB 1YI2T 3OW2S 4AH6A 4L5SA 2EQSA 1V9PA 3A74A 4L5TA 4KLKA 3M4OH 4LF9L 4JYAQ 3SGIA 4JV5Q 3E9IA 1M1KC 1B70B 2NN6G 4IJLA 4P71A 3UDGA 5IYDG 2GVAA 3UE1A 4DK3C 4HIOA 2MWOA 2JE6I 4QIWE 4LF4Q 3I56T 4K0KQ 3CC7T 1M1KU 5FLMG 1N36L 3I55T 2UU9L 1PYBA 1UWVA 3CW2C 3CD6T 1YIJT 3M85A 1IBMQ 2UXBQ 2WB1E 4YY3Q 4GN5A 3CPWA 3STBD 3M4PA 4OO1I 1HNWQ 3CPFA 2HQLA 4YWKA 1VQKA 2HIVA 2V1CC 4HJ8A 1CKNB 1BKBA 1E22A 1L1OA 4UP8A 2Z6KC 3CCEA 1VQ6T 2WP8J 4JI2Q 2PQAB 2I0QA 2NVQH 3RN5A 3CCLT 1HZBA 5IY0A 3PSIA 2IX1A 5JJKA 3PUVA 2QEXA 4GLVB 3U58A 4LF7L 1GKHA 4A3DH 4JI6Q 4LF8Q 1VQ5A 4DR5L 1YJNT 2MQHA 3DLLA 4DV4L 1RIPA 1X9NA 4B3SL 4BY1H 4LFAL 4GN4B 4X62L 3KYHC 3PCOB 2XGTA 4BBRG 5GAEC 1XNIA 4FDBA 1VQ8T 4OWTB 3TREA 5J3BA 1XPRA 3I4MG 1HZCA 3PO3G 3J80i 1X6OA 2VY3A 4X6AH 1E1TA 1EOVA 1VQ7A 2N78A 1QZHA 4CRIA 4X64Q 3AYHB 2NVTH 4HIDA 4LFBQ 4DR1L 5IAYA 3CCRA 4LFCL 2AMCB 3CCQA 4XIGS 3HOXG 3A5UA 3CCJA 2BH8A 3H15A 4EQ5A 3GTOH 4A3LH 1N32L 1K3RA 2WAQE 4JI8Q 2PI2A 3B6YA 2KHJA 3NELA 1KXLA 4JI1Q 3K81C 1C0AA 2ZTEA 3OTOQ 2CWPA 4DNIA 2JA6G 4WJ4A 4A3CG 2K75A 4YTLA 2K52A 1Q81C 2LXKA 3DM3A 4MNOA 1JJGA 2CKKA 4B3RQ 3HOYH 2YTYA 3F1ZA 4NB3A 1PH6A 2WFWA 2EIFA 4B3MQ 3HOWH 1BVSA 4DUYQ 1IBLL 4JI5L 2ZTCA 3GDEA 3GTJH 1Q81U 5GAHC 3K7AH 2VQFQ 1IBKQ 3S1MH 1VQPT 2G3RA 3HFZB 4X66Q 1M1GA 1YI2A 4DR3Q 4POGA 2K50A 4LUVA 1VQLA 2JA8G 4NPSA 2R7DA 1NPRA 1UE1A 5BR8L 4GKJL 1OXUA 4IPGA 1NY4A 1VQCA 1KRTA 1HR0W 5JJLA 5IWAQ 3I4NH 2Z0SA 1JJ2A 1NMGA 1XNRL 3CC7A 1VQKT 4UP7A 3I55A 3NBHB 4A3MG 2Q2TA 3CD6A 1YIJA 3CCET 1NZ9A 1L2FA 1VCIA 2JA5H 3PGZA 1YEZA 3KF6B 2RF4A 4DR6L 5LMNQ 4P72A 3T1YL 4A3JH 2R92G 4OWWB 4A3FG 1VQ6A 1PA6A 3TQYA 1HNXQ 5IP9H 3UDXA 3HOZH 1A0IA 3KJOA 3PIOA 5LMUQ 5A2QE 2VL6A 4QJFA 3CCLA 2YYZA 2ZJQA 2UXCL 2KCTA 5J26A 1Q1BA 3STBC 4DV2L 4PZ8A 4NXNQ 2ZJPA 4DR2L 3MEFA 1X54A 2IG0A 4Y52H 4QQBX 1Q7YC 5C44H 3KDFB 3K0XA 3PF5A 1WYDA 5IYCH 2UUBL 4JI3Q 4C3JH 5HGQA 1Z47A 4TVAB 4XTCS 4YHHQ 4JI7L 1Q7YU 1VQ8A 2K5HA 3M7NA 1YHQT 1LM0A 2NN6I 5M5WH 1HR0L 2ES2A 3TEHB 2Q2UA 4JOIA 3EBEA 4ZN3A 4DUZL 3PUXA 3I2ZA 2A19A 1QVGS 1BBUA 3J7ZC 1VQIA 3FKIG 2XHCA 4R4QA 3S17H 1EFWA 5IYDH 5ELNA 3HKZE 3U4VA 4DV1L 4BXXG 3CC2A 1J5EL 1S3OA 1JMCA 1W2BA 1B8AA 1VQJA 3ULPA 4OX9Q 5FLMH 1NPPA 1KQSA 1NBWA 1SMXA 1OTCA 5H1SE 4AYBG 4JBWA 2N49A 4DR7L 1XMQQ 5JJIA 4X65Q 5ELOA 5IP7G 5AJ3L 2MFIA 2C35B 1L1OB 2LCLA 1ASZA 3TS0A 2UUAQ 1K8AC 3FHWA 1GD7A 1UE5A 4R4OA 3T1HQ 2ASBA 3IRBA
chains in the Genus database with same CATH superfamily
3BZKA 4AIMA 4J9CA 5EKKA 3KJPA 4AQYL 1LT5D 2QDLA 5LJ5h 3OS1A 4DR4L 3OW2P 3I56Q 3UDIA 1OX9A 2VKNA 4BBRB 4JBMA 1GHKA 3MEVA 3JCMQ 2Y0SE 4C3IH 1S40A 1I1JA 4C56C 3I90A 3OYKA 3G4ST 1X56A 2DFUA 4DV5Q 3UF4A 2DEQA 4LF6L 1Q95G 5ECAA 1PH1A 1K4US 1GCQA 2PZ1A 1WJQA 5FO8B 2D1XA 3ICEA 1K8AR 2NVXH 3OYYA 1E6GA 1KK7A 3K5NA 3GTGH 1CI3M 3MA2B 1B34A 4PNYA 1D0XA 1H95A 3V96A 1ABQA 5CO7A 3H0GH 1EQRA 3LGJA 3MKDA 3GV3A 3PUYA 4PV1C 1N9WA 3WWVA 4RMOA 2GFAA 3TSWA 2LS01 4KKSA 2A37A 5EKLA 4ZAIA 1KC8R 2YLCA 2P5ZX 2AIRB 1Q86C 1VQ8Q 3D7SB 4FYDA 2D0QB 4GOPA 1SXTA 3FEOA 2XG8D 3R93A 2DY8A 1N34L 3JB9I 2ALYB 2COWA 3G6ET 4ABNA 1YWPA 1HCZA 1HFGA 2BTTA 5KYXA 1YJWA 1Q86U 1SE3A 1M8MA 4J9FA 2OTJT 1D6EC 2D62A 4YCUA 3JB9H 3IFDA 2ZZDA 4RTVA 3X26B 1GUSA 1QP3A 2BE5C 2CZ6B 3R2IA 1CKMA 3CC2T 3RLFA 3LYIA 4M75E 3MAQA 2QASA 2LC4A 2N3SA 2K1BA 3E0EA 4XXEA 1WA7A 2RA4A 3PNWC 1L0WA 1STHA 2J6OA 3D4RA 4A3MH 2MMPA 1NYFA 3KBGA 4LF4L 1BBWA 4PJOG 1MKHA 1YNZA 1IBML 1BU1A 3GTJB 5FRNA 1HNWL 2K4KA 3EGXB 4A3FH 5GANd 3GD7A 2F5KA 2PVOB 2P0KA 4M4ZA 4LWCA 1HYOA 3VYUA 4JI2L 2VC8A 5C0XJ 2AKWB 3T9NA 4N9TA 1F2MA 3C0CA 4DK6C 1KL9A 2PNHA 1XNQQ 3FMCA 5IHNA 1UGVA 3SWNB 4E6RA 3M0RA 3L9AX 3BZCA 2D0OA 3M9BA 5LHY1 1EYGA 4JI7Q 5IXFA 1VF7A 3M3YB 3CCEQ 3TZUA 4PJOC 4R1JA 1V76A 1SR3A 4HAEA 2NZHA 2E2IH 2FB7A 3OYEA 2KCMA 3RLOA 1WXUA 3DM1A 3OYDA 2JJ9A 2Q2HA 1C4QA 1ENCA 1I5FA 2NLUA 1KSWA 3H6ZA 1EY4A 1X65A 3PUZA 1K8OA 1T5XD 3K7UC 2L15A 1AEXA 1RAHB 4EQOA 4X64L 1TU0B 5IGEA 2HHHQ 2YU9H 4ZGDB 1TWFH 3F2CA 4FW1A 3ZBDA 4JC0A 4PMCA 4JPBW 2RVLA 4MZMA 5GADC 2F0PA 3IKJA 2RH2A 3MHBA 3NWTA 1IBKL 3KFVA 1SN8A 3IAYA 3ASKA 5LMNW 1B44D 3HPWA 2GFUA 3HOYG 4DAVA 3C1EA 3UDFA 4C1NI 4K5XA 4FSXA 5J22A 4LF9Q 1SNDA 1BI3A 2AQ2B 2A08A 1LTID 2F3VA 2YLBA 5GAN8 2RI2A 4HMIA 3LGLA 3M53A 3H8ZA 1GO3E 5HCKA 2H5XA 4DNTB 2DZCA 4HVWA 5GANh 1W1FA 5GAN2 2PUKB 4RKUE 3GPLA 2QA4T 1Y1VG 3FRPB 1N36Q 2UU9Q 1YITA 3KLRA 3DWQA 3L2PA 4DR3L 2LJ0A 4A3GH 3F70A 3W5OA 4OXPA 2XKOC 1SRMA 1KTKA 4YWMA 5D65A 2OT2A 1SE8A 5M9OA 4OB3B 2KENA 4FYXB 1VUBA 2BA1A 4A75A 4EMGA 3D4DA 2JA5G 3EJIA 5LL6S 1FGBD 4CI0C 5GAN6 3VUZA 2FPEA 5C6AA 1ZA1B 4EMKA 4XQ3A 2QKIC 2WB1G 1EY5A 5KYWB 3S6WA 4LFAQ 1RJTA 1E0BA 3RZOH 1LNXA 5C3EH 4FYYB 1WHMA 5LMUL 3KOJA 1BI2A 3BFMA 2CGHA 2GQIA 2ZPIB 1JJ2S 2BZYA 2KRMA 3EA6A 4NXNL 3D6WA 1BCPF 4A3BG 2BA0A 2EXDA 3CC4T 1KDBA 1O7LA 2FYKA 1YZ6A 3M56A 2JEBI 4BBSG 1WTWA 2EJ9A 2AHOB 4AYBE 2GBQA 4ZN1A 3VRYA 3CCLQ 1V1QA 4DAMA 5GMKe 2B63G 1N32Q 2RQUA 5J39A 2SDFA 2MF2A 5FO7B 1U3OA 1EX4A 2K5VA 3JCMW 2RK1A 4J9BA 4E2FB 1Q90A 2K5DA 1Q8KA 1N8RR 3JSCA 2QQSA 3DB4A 3SHWA 4PJOB 1ZBXA 1JO8A 4HA8A 4B9XA 5DM7R 4FO2A 2F03A 3S15H 3MEWA 2EZVA 4IALA 1TWGB 4CJ0B 3H3VH 1U1SA 1C9OA 5C4JB 1I5LA 5I2YA 1IYVA 2EJMA 4Y7NH 2K7VA 1VQFA 1AP0A 1DCZA 5D7UA 2WAQG 1WCMH 4RMFA 4EGVA 1R9TB 1Q82C 1PZJD 2SOBA 2O9VA 1R0BG 4RTXA 4M7DG 3T1HL 2HQXA 2H8HA 4HJAA 3P1HA 1M27C 1E7OA 2Y4YA 2HL5C 1Q82U 1AE3A 1MBYA 2I5LX 3QWNA 2QAZA 2EPDA 3EIVA 3CCUA 3RZDB 2DILA 3MP6A 2DK3A 3OQ5A 1KG1A 2F5TX 2DGYA 4L8JA 1Q86R 1GFDA 2D0PA 4K2KA 1WXBA 1U1TA 3OYIA 3P8DA 3T1YQ 2ZT9C 3I72A 4OL7A 4H0LC 3ZEHA 1L0YB 3RKWA 3DKMA 3GTMH 3BJUA 5CV4A 3S1RH 1BO0A 2JA9A 4OMQA 3CRLC 2VV5A 3EROA 1VQPQ 2EBPA 1O7YA 2PQAA 2HSEB 4C5IA 1L1OC 3GTKB 3SEBA 4M7DC 1R0CB 3MEAA 1RLPC 3GTQH 1IKMA 4CKEA 3F2UA 4KN7C 1EZZB 4KY7A 1P8LA 3PIPA 3M4QA 3MWYW 5M3MH 4NXML 4IOAA 4C3HH 1MJCA 4K8JA 4KHVA 4NKLA 1Y1WH 3EG9B 1S72T 5GAMf 1OO9B 2D2CC 1HR0Q 1V1PB 2VGNA 5ELCA 3IL8A 1WI5A 3JCMX 5IGDA 5IIFA 4A4GA 4N0AC 3CPWP 5C4ZA 3OYCA 3AFQA 3CP0A 4TKOB 5IT9L 4M78D 2KHIA 2KT1A 2RJDA 4RA8A 1Y1VB 5M5XH 4C5HA 4DV1Q 1Y14B 2JVVA 3C12A 4HVVA 2A6HC 2EY6A 2NVYB 4X3SA 2E2HB 1JOQA 4PFZA 1B3AA 4RGMA 4DXGA 5JPMC 2A3LA 2ATCB 1AWOA 1II3A 1YWOA 3GTPB 2JA7H 3KFUA 1HFNA 2L0AA 3SE0A 4PMWA 5AJ3Q 5J1ZA 2CQAA 2JTFA 1WHJA 3M58A 3ZFJA 1IYJB 3CRKC 2HIXA 1EYAA 1UEAB 4EX5A 4G7HC 3OS2A 1T0HA 3M59A 2BKDN 2FFKB 1VQOA 2WB1B 2QEXT 4G7ZC 4F04B 1I4HA 2UXDQ 3RESA 1VQMA 2P4TA 1PG5B 4PJOF 1OXSC 2OQKA 4HXJA 2FPDA 3RNUA 2XI9A 4KY5A 2YV5A 4TQUS 2OQ0A 1UEBA 3L2QA 4JJNK 3CQZH 3J81L 1RTNA 3L0OA 1I50B 2QQAA 2IT1A 2F0SA 1UGQB 2Z4IA 1SFOB 4BBSB 1HUNA 4F16A 2MPXC 1VQ7T 4IPHA 1ZSGA 2LVMA 1VQGA 4E7LA 3T53B 4IN3A 3BDLA 1SEBD 3CMEA 4Z88A 2V8JA 4DV3Q 1WQ7A 3QIIA 3MTSA 5EG2A 4O0AA 4HJ5A 3CCQT 1TWHB 3CEYA 3A8KE 1OV3A 4RCOA 3T16A 3REBB 4JBKA 5GAMj 1J9OA 2E5QA 3NMZC 5KYUA 2Y0SG 3A5ZB 5IP9G 4DK0A 4DV7Q 4JJCA 3QBYA 2LDMA 4ZKCB 4A4IA 1UHCA 2RK2A 2B8GA 2VQEQ 4A3EH 1HNZQ 4IPCA 3G71T 4L5RC 1MSHA 5DNFA 2BE9B 2R7ZH 4RCBA 3QUIA 2ZM6Q 1K73C 5M5YH 1IRXA 4A3IB 1N33L 1WLPB 3MO8A 4RHSA 3EFOB 2DA9A 3M54A 2LFNA 3L7ZC 3TP6A 2WAQB 4ORZA 2RSOA 1NE8A 4M7DB 2TMPA 3X24B 3CMAQ 2ZPGB 1YI2T 2VB3X 4FP5D 4L5SA 4AG1C 1NBEB 1EU4A 5KH6A 2VUMB 4KLKA 3SGIA 1TWAB 1BBZA 3E9IA 2NN6G 4P71A 1PZKD 2AQ1B 5AFWA 2G5DA 3SK4A 3HHTB 5AYFA 1RD9D 2KHSA 3C46A 1GRIA 3CC7T 2XDDA 4KGZB 1BQQT 4I7ZC 3SDZA 2D8HA 4GN5A 4E47A 1HXYD 3VUBA 3JV3A 4OO1I 4FYWB 1A2TA 4RCCA 1CHQD 1VQKA 2HIVA 4Q5WA 3VU3C 2SEMA 1BKBA 2A7YA 2Z6KC 4M75G 1VQMQ 2WP8J 4IFDH 2NVQB 2DLPA 4FCYA 4OO1H 5JEAH 2H1EA 4RKBA 2DM1A 2DBMA 3TEEA 4L5GA 1AT1B 3CCLT 1LTAD 3PSIA 5IY0A 2PNIA 3BZDB 6AT1B 1SDFA 2K03A 4GLVB 2Z1CA 2C9OA 1LCKA 2M51A 1ARKA 1F9PA 3SVMA 3MEUA 2QYZA 4OELB 4LF7L 4LF8Q 4DR5L 5GAMg 2CZ7B 1D1CA 1YJNT 4DV4L 1X9NA 1RIPA 2XNAC 4BY1H 1EL0A 4J9GA 3TQ7P 2KA7A 4C3IG 3KYHC 4X62L 2FJ2A 2FMMA 3TREA 3PMTA 5J3BA 3PO3G 1HZCA 2OAUA 3J80i 4DA2A 4X6AH 1E1TA 2KROA 2LQNA 4M75C 1JE4A 3QB3A 5LL6X 3HEJA 1MGQA 4ZTJA 4KH0B 3CCRA 4Q0FA 5GAMd 2J6KA 1PFNA 2A69C 2J7ZA 1YNJC 5HGTA 3GTOB 3CCJA 2V1RA 4FF4A 1NCVA 4EQ5A 4A3LH 1Y96B 4OB2B 2MUYA 2DAQA 4V190 3LLRA 2PI2A 4EQNA 1UNSA 2RJCA 4QB4A 3QO3A 4Y28E 2ZTEA 2CWPA 4DNIA 5I6YA 2QTXA 3A1PA 2LXKA 2KAFA 4MNOA 4JZ3A 3KUPA 4B3RQ 3HOYH 3LWHA 1T0JA 4NB3A 1PH6A 2WFWA 4B3MQ 3HOWH 1BVSA 1PDQA 1YFNA 2CHBD 3GP8A 3GDEA 2VQFQ 1B07A 3K7AH 3S1MH 5NUCA 3JB9G 1VQPT 1TXQA 3J7AV 3CHBD 2G3RA 1LV9A 1SPKA 1Z9ZA 4PJJA 2FINB 4F14A 5T1GA 1XJWB 4LUVA 3ZL7C 1SSHA 3OYBA 1PRTC 2A68C 2LT1A 1H3HA 1QW1A 2R7DA 1SYDA 5BR8L 2K32A 5JJZA 1NY4A 1VQCA 1KRTA 1HR0W 3RD4A 5JJLA 1SNOA 3VA5A 3Q24A 1STEA 3Q23A 2B39A 1E6HA 1BB9A 3I55A 3NBHB 4OHJA 4A3MG 2CP6A 1YIJA 2DL7A 1NZ9A 1HK9A 3HRTA 2HMAA 2JA5H 3L42A 5L8RE 1YEZA 3KF6B 4DR6L 2DJQA 4A3JH 4I7AA 2Y0SB 2AQ3B 1YNND 4A3FG 2CP5A 2FHDA 2RNAA 5JVH3 1PRMC 3UDXA 2K5QA 4PFOA 1A0IA 1D5XC 1H9KA 2KECA 1W70A 2EQIA 5A2QE 4IUUA 1ET6A 1AVZC 5J26A 2IVWA 4OB1B 3STBC 4DV2L 5GAMh 5C44B 1C0MA 3U9OA 5F2DA 2SEBD 4C0ZA 4QQBX 1B50A 4KUIA 2DL5A 1K1ZA 1WYDA 5IYCH 1ILPA 1I4GA 3VS1A 1Y0MA 5M5WB 3CCRQ 5FU7C 2V4DA 1YHQT 3OS0A 1F1BB 2K3XA 3G1JA 5CR2A 3CCJQ 2MJ8A 4JOIA 2Q2UA 2DBKA 1PTOF 4ZN3A 4DUZL 1PCXA 3TDQA 3U9SA 2CP7A 3A98A 1G3SA 3S17H 3EFXD 4OMFB 1VQIA 2XHCA 4ZNXA 1I3QB 2DN8A 3VJPA 3HKZE 3U4VA 3CC2A 5CC4A 1X75C 2Y90A 1SYBA 1JMCA 2X4XA 5I22A 1D3BB 3JCMV 5I2MA 1VQ9Q 3REAB 4TSSA 2O88A 3HTRA 4MZPA 4LDXA 2N49A 4AYBG 5IGBA 5H1SE 3AU7A 3OMCA 2F0LA 1HA5A 2ZXOA 4M75B 4X65Q 4A4EA 2YHTA 2F1MA 1TWBA 1W6JA 3MVVA 1QB5D 2L5TA 5CK9A 3TS0A 3H0HA 1K8AC 3V8JA 1JWSD 3VYRA 4C1NK 2HKQB 4GZYC 4CC3A 2UUCQ 1HUMA 1VQLT 1FMKA 1ML0D 3SEMA 2A8VA 3WVEB 5CV5A 2JK8A 1K8AU 1GM5A 3ZYYX 4JRIA 2F4VL 4X62Q 3G7ZA 1KC8C 4C3IB 1RI9A 1YIJQ 1HJPA 3X3NA 1EWHA 4A54A 2K14A 4A3GG 1O9SA 3I4MH 1IGUA 1LJOA 3CBPA 1KC8U 2M2LA 4F7UF 4JRKA 1LLRD 1SMYC 4IUQA 3GNGA 1AEYA 1JR0D 2X69A 5GROA 3GTGB 2AKLA 2LMJA 1AD5A 4XTXA 3H9NA 2LSSA 3LH0A 3PGGA 3H0GB 4M78E 2YUNA 1X69A 2HSPA 1C1AA 4CJ2C 1KAWA 4GKKQ 3CCMQ 1KD1R 1MIUA 4N8FA 4A3KG 5CV7A 5C3EG 2EYLA 1F2YA 1SNCA 3RMSA 1M8VA 1S5CD 4DV6L 1JCKB 2JA6H 1BIAA 2F69A 1AOJA 4C2MH 3NENA 4A3CH 1PHJA 5KIXA 1PLFA 4RTTA 3QZ5B 2OCEA 1TSFA 2NTSA 5DM73 2EAYA 2RN8A 1EIFA 3O5ZA 3JCMf 1U4MA 2E1HA 3LGFA 1MMNA 4QL5A 1HQRD 1RI0A 2DD4A 2LXJA 4RGTA 3RMQA 3M55A 1R8OB 4M7AF 5FWCA 2RHUA 3BY7A 3L2UA 1U5SA 5CKBA 1S1NA 2C0TA 2COZA 2DXTA 3K8AA 5FLXE 1SBBB 1YNXA 1RAFB 2CW0D 2HT1A 1F9QA 1NAPA 2M9UA 3FPUB 4JYAL 3TZDA 2DTHA 4A3MB 1JWMD 2DRMA 1WDXA 4M77A 3L2ZA 5JVG3 1JXOA 4GLKA 5I2SA 4MZTA 4V0BA 4J5YA 2EDGA 4QQ6A 1G51A 5FU7B 2VZAA 2K7AA 1TIID 2UXBL 3TVTA 3VKIA 4HEDA 4A3FB 1BOSA 1BXTA 1JB0E 1MD2D 4UP9A 2R92H 1W4SA 5A35A 2PYKA 2KE9A 1RCVD 3AFPA 4DV2Q 1PSEA 1WCMG 1I6VC 3H0IA 3X20B 1M3AA 1YHBA 5G3LD 1UHFA 1G291 4K8IA 4UC4A 4HJ7A 3CCSA 3OYGA 1EEFD 4A3DG 4M75F 2LJ3A 2OJ2A 4IIMA 5GJVB 3OYHA 2ZJRA 4Q5VA 2EQKA 4J6WA 1UE9A 4JI6L 2E2IB 1QKXA 3VRZA 3CU7A 1WD1A 1WIEA 1EFNA 2A36A 2RB6A 2I5MX 2RBMA 4K14A 2YUOA 3H3VC 1F2ZA 2Z6BA 1IW7D 2CYZB 4A53A 1ZLMA 5HK0A 2JTEA 2HDMA 1I81A 4AMCA 2AK5A 1E7ZA 3HOZB 4IOCA 1LTSD 4XU3A 2F0WA 3OW2A 2RF0A 2KR3A 1TUCA 1X55A 2P4RA 1IREB 1TWFB 4HKEA 1ICWA 4J8OA 4H7BA 4AYBB 1M2VA 1D2BA 2KCCA 1WHLA 3D6CA 3PMFA 5KNBA 2EJFA 3DEPA 5M3MG 1NLOC 5CAIA 2CFMA 4C3HG 1I6HH 1JE5A 3I4OA 1NM7A 1Y1WG 4JI8L 1F9SA 1H9SA 5IP7H 3META 4XTZA 2KCNA 1B9NA 4PKCC 2EOTA 2RQXA 4FF3A 5IH2A 1TWCH 3W1GA 4F7UA 3LWIA 2PW5A 5GMKl 2LCSA 4DUYL 3JCMc 4ZYSA 1B4OA 4JDSA 2F0JA 2R93H 2NN6H 1G91A 4MIUA 1LO5D 1HRJA 1HPCA 2HKNA 3MC0B 4N8X1 1MJEA 2JSOA 1O80A 2LZ6B 1PH4A 1QVGP 2EVRA 3LX7A 5C0XI 5I2XA 2DRKA 1VMPA 2L0CA 2JA7G 1QNUA 1X3EA 1OQKA 5IYBH 1VQNA 3CQTA 1PM3A 5EGTA 3L2VA 5C0XH 3S16H 1UGSB 3RKYA 2CQOA 1ZA2B 1PH7A 3A0JA 1XPUA 1X3FA 2K2VA 3KF8A 2XIDA 2OI3A 2E64A 1M3CA 3EHRA 2JOYA 1DJRD 2Z4HA 2NUPB 3CCSQ 1Q12A 4LUOA 5HKCA 1I4K1 1MV0B 2CS7A 1J6QA 4BDYA 1J3TA 2E6ZA 3RNJA 1VQ4A 3PF4A 1ZSZA 2RHIA 3NFCA 4B3SQ 2ZTDA 1WQWA 1N8RC 1T3LA 4M7AA 1XJVA 1JOOA 1VQ9T 2KUMA 4DA4A 1N8RU 3JCMg 3PO3H 3E1SA 4L59A 3QSUA 1R4QB 4IUNA 2C06A 4R4CA 4DR1Q 1E1OA 1YJ9A 1I4QA 2DNCA 2JN4A 4LFCQ 2HCKA 1M3BA 4OVAA 3HOXB 3SFMA 3JCMP 4KK7A 4K2LA 4NL3A 2GNCA 2YRDA 2IY5B 2IL8A 4MMKA 5IGFA 5EAYA 2IIMA 1PYSB 5KYYB 2WIIB 4K6DA 5IHKA 1QG7A 4DAPA 4EVOA 1RUWA 1KFZA 2DETA 2X3WD 4A3EG 3S15B 1JB3A 2O5JC 2N8NA 1CQFA 1GFCA 1Q46A 2OTLA 1JB7A 1PZID 4ZLTF 4OX9L 2R7ZG 2NWMA 4HVUA 4JI5Q 2IX3A 2H3EB 4ME5A 3NTKA 2HD0A 4GLXA 2AWOA 2YT6A 3OY9A 1K3BC 5KRUA 4Y7NB 3HSBA 1WTRA 2EWNA 2HQHA 1PH8A 1WCMB 3QWXX 3MXNA 3V7RA 3CCVT 1PFSA 2B29A 2PMZE 2UUAL 2JW4A 1BIBA 2JA8B 4GKJQ 2F2VA 1A62A 2XICA 2LQWA 1W2BS 3CCMT 1VQNQ 1ET9A 1BCPD 3QOJA 1XNRQ 4GBQA 3C4SA 1KQSS 1SJED 3D31A 3PO2H 3A8IE 4GNXC 1PKSA 4OMMA 2XTIA 4K0KL 3M0TA 3CXCA 4C8QB 2EJGA 1B1ZA 2L3RA 4DV0L 3S1RB 3HOUH 3CAMA 3GTMB 2FXQA 2QXFA 4K5WA 3S1QH 1S5DD 3R6OA 1AZQA 4IFDG 1VQ4Q 3OYAA 3TU4K 4G4KA 1PRLC 2KMTA 2UXCQ 1XTDA 5JEAG 3S2DH 4OO1G 5KE3A 1CTMA 1UAPA 1ZUUA 4CC7A 1D7QA 4JBJA 1B9MA 1VQEA 3A7LA 3H09A 3PTAA 4RFBA 2XU8A 5LJ3j 2BOSA 2YXYA 1OXXK 2DE0X 2IHFA 2B8AA 3OW7A 1MMGA 3ULJA 2HAXA 4BY1G 1YJ9Q 1QJOA 3G71A 3S2HH 4XTVA 1BK2A 2V8IA 2RHQB 4N9PA 1XMOL 5ELDA 1NG2A 2ZPBB 2GVBA 4XDXA 5M5XB 3KK7A 1SJHD 4C92A 5C3XA 1W6XA 5HK3A 2L1BA 4R4IA 3NWSA 1U0LA 4FF2A 4MTKA 2K6DA 2KVQG 1QWFA 2MAMA 3EHQA 2IJ0A 3V2TA 4DOVA 5JOBA 4A3LG 2HEQA 4K11A 4DKAC 3L3OC 4BI8B 2OXPA 4EIKA 3DMUA 3U50C 4MDWA 3THKA 5EJWA 4RKLA 2GCXA 2E5LL 1YJWQ 1M5Q1 4X3TA 3FP9A 2KXCA 2B3GA 1GXIE 2R6GA 2RCNA 1AE2A 3F2DA 5HY6A 1O78A 4LDWA 2B8FA 2Q2IA 2NWGA 3HKZG 3UI2A 4AQYQ 3HOWG 1PVOA 2L89A 3HP3A 3P8HA 4DR4Q 4TRDA 2JYOA 5KYUB 2X4JA 1FL0A 3MCAB 5GMKh 1SNQA 2PZTA 3OYLA 1VIFA 3JCMe 1K83H 3CQZB 4X66L 5CORA 2FZCB 2R57A 1VQHA 2BE5D 3EGDB 4QGUA 1HD3A 1U06A 4CC4B 2VS1A 2R5MA 4LF6Q 2XDBA 1ZX6A 2PVDB 1KDCA 4U68A 1ZYRD 3CXCS 1V43A 1YJNA 2PUOB 2B2TC 1FNWA 1LUZA 1U9RA 2YTXA 1HA6A 5C4HA 2DL4A 4DQ2A 1K0RA 2N88A 4JI4L 2F0KA 1CKOA 3I5RA 1QUQB 2LY7A 4A3JG 5C5MA 1QE6A 1GBQA 1D8LA 1OXVA 3HOVH 1WZOA 4O2DA 3ULRB 4ME3A 4A3KH 4PG3A 3EFSA 4GNXB 1I94L 4C8QF 1N34Q 4C5EA 1S5BD 4JJBA 1EY7A 5M5YB 1TKWB 2LP5A 1FWZA 3S3OA 4VUBA 1GUNA 5ELFA 3AT1B 4M1UB 2JNGA 2CZ1B 3ITPA 4M78G 1T5EA 2JJQA 5IYCG 1D1BA 4I65A 2RJFA 1JJ2P 2CT4A 3V7SA 4HCBA 4JI0L 4ZRZA 2PVGB 1RL2A 4E7JA 3DWAA 1AWWA 1G5VA 1D1KA 1C6VX 2F2WA 2JUFA 3QHSA 5D6XA 3UDCA 1KDAA 2F0DA 2X6LA 4AH6A 4BA1I 3A74A 2NUCA 3QJYA 3M4OH 3Q6SA 2PQWA 1B70B 5KCHA 4OMLA 4XT3B 2JE6I 4K0KQ 4N4HA 4JS4A 3I56T 4XYOA 4LF4Q 2EKOA 1HXDA 2C0OA 1KIKA 1KNAA 4XU1A 3RUXA 1UWVA 1D0ZA 1EYDA 4FNFA 5I6WA 1IBMQ 3CPWA 4M78C 1CQVA 5CV8A 1HNWQ 3CPFA 2HQLA 4YWKA 1CKNB 1E22A 4IURA 4JI2Q 2A73B 1P92A 1UJYA 2FRWA 1YITQ 1UJ0A 4WJWA 3WDNA 1XTCD 3PUVA 3M4GA 2X51A 2L12A 2ICEC 4LNPA 1X43A 2GGRA 2E75C 4A3DH 1E2VA 4BY1B 1VQ5A 2F0OA 4FL6A 2AZVA 4C5GA 1GUOA 2MQHA 3DLLA 4O42A 2B2VA 2CUDA 2DIGA 2P0QA 2CZ0B 4GN4B 4KKTA 3E2UA 2XGTA 4ODGA 4FDBA 3I4MG 1VQ8T 1Y57A 5IODA 1XPRA 1AW7A 2QTVA 2NZ1D 4KY6A 3QYGB 4J7FA 2N78A 1QZHA 4X64Q 3R6NA 3A55A 2NVTH 2D8JA 2R3ZA 3VS6A 5IAYA 1R77A 4S3SA 1IXDA 1WPYA 3GV6A 1WD0A 3H15A 2BH8A 1KAAA 2XRQD 1GHJA 3OPOA 5E4XA 2QQBA 2B2WC 3ME9A 4RG8A 1BI0A 1EQVA 3H41A 1I07A 2EGCA 3B6YA 4MMLA 3NELA 4B9WA 7AT1B 1G2TA 1C0AA 2B2UC 2JA6G 4WJ4A 4A3CG 3HOYB 1QCOA 2DL3A 4YTLA 4DEXA 2K52A 2BDNA 1AWXA 4M77G 3DM3A 3HKZB 2COYA 2CH4A 3M4YA 3UATA 4NW2A 2PTKA 4O5VA 4F8MA 2QILA 3K7AB 3S1MB 1PXUA 1IBLL 1QLYA 4QMGA 2M0OA 2RD1A 4OIKA 3GTJH 1PWTA 1IBKQ 2WKCA 1BUVT 1OI1A 4X66Q 1M1GA 4AFZC 1TS2A 4DR3Q 4POGA 1MGSA 2K50A 1VQLA 4ZTFA 2K2MA 2QK0A 5LJ3e 1UE1A 1JQQA 3PFSA 1OXUA 3TSSA 2F1LA 3OOCA 2DYBA 3VS7A 4ZUJA 3EH1A 3DWPA 5FOBB 1JBMA 5FLMG 1NEGA 2EY5A 2J4XA 3VV0A 2Q2TA 4J6HA 3CD6A 3CCET 4JJDA 2JA5B 2BZ8A 1VCIA 2RF4A 3EGXA 2R92G 4OWWB 1VQ6A 3I70A 1VQ5Q 2CSIA 3RR6A 5LMUQ 1CT1D 1H8KA 3CCUQ 2VL6A 1GOZA 2CREA 5EPLA 4KRTA 4NXNQ 3OBYA 2IPKD 5I4DA 4DR2L 3SWNA 1X54A 2IG0A 4A3BB 4M78B 4D8KA 1GL5A 3DUZA 3KDFB 2OX7A 2ROTA 3FIFA 3QIAA 1N9RA 3J81j 2UUBL 3EGUA 3T13A 3URYA 2B63B 2C0IA 4XK8E 3OMGA 2P84A 3TEHB 4DU9A 1CA5A 3S17B 3KLSA 3PUXA 1AZGB 4J9HA 1NLPC 1BBUA 3S14B 1RAGB 5IYDH 2RJEA 1VOMA 4HN7A 5EBDA 1G3TA 1J5EL 3V8LA 1VQJA 4HT9A 2EE1A 2CDTA 4PLLA 3TP8A 5FLMH 3ULPA 1OTCA 2B2YC 1Q7YR 2VXWA 2W10A 4LDVA 1G3WA 3M7GA 5ELOA 5IP7G 2GA4B 2HL3A 1L1OB 2LCLA 4O6JA 1JRIA 2ZAEA 1UE5A 3T1HQ 4Z8AA 3IRBA 4M77D 1WNLA 2M16A 2LT4A 2GF7A 2DVJA 1CSQA 1ASYA 3L2WA 1LACA 2IW3A 1M9SA 1XWEA 1KD1C 1K9MC 1FJGL 2R93G 2B86A 3F2BA 5K5PA 1BCMA 1ZUKA 3QYHB 3GQBA 3CD6Q 3S9WA 1KD1U 1K9MU 5IT9E 3PIO3 2K05A 1OPLA 3OBWA 2VB2X 4L6TB 3SK5A 2J05A 5IYBG 4DR7L 3JAML 4K6LA 3RLNA 1VQOQ 1STAA 4JLIA 5C0XG 4HIMA 1A3VA 2R58A 2LTOA 1PTOD 4FXKC 4B3TL 2LX7A 4BA2I 3ERQA 4OGQC 1KQ2A 5C0MA 4ZGJB 1QVFA 3J80c 5CV9A 2O4XB 4JW0A 5IGCA 2RMOA 4LXCA 3X25B 4R55A 1YVCA 4KTAA 4CDCC 2RO0A 1Z6HA 1OULA 3J80E 1IO6A 4NXMQ 5KYWA 4UAIA 4KV6A 3D4WA 1DGSA 1DONA 2AZSA 1SF9A 4PJLA 2JA6B 1BBXC 4J15A 2E3IA 4GLAC 3RMHA 1NMFA 3T4AC 3VS2A 3CMEQ 4FXDA 8ATCB 3JC66 2TSSA 1YNNC 3LH5A 3P8BB 3UA6A 1C8CA 2KYBA 2IHEA 1YCSB 4DAYB 3P75A 2KRSA 3T51B 4HT8A 1GCQC 1HJDA 3K59A 5M3FG 3NEMA 4F87A 5CVIA 3MXGA 3W1BA 2F0TA 1R9TH 1YITT 2I46A 2HCIA 4M78F 3FRNA 5A0DA 1E3PA 5FW9A 4TVRA 3K58A 2KGTA 2Z8LA 3V05A 3FEWX 4JV5L 1XPOA 3L1AA 4OP0A 4PJOA 3IQLA 3VR3A 1F77A 4QVCA 2AT1B 3RZDH 1O75A 3J81i 2I5HA 2CP0A 3VA7A 5GAN7 1MNDA 2R92B 4GOPC 4RTZA 2KBNA 4YY3L 2MOXA 2RQTA 4CGYB 5FKAC 3NTIA 1AZPA 1QNKA 1LTBD 4LN2A 4EDUA 1QWYA 5C5LA 3S3NA 1Y8NB 5COYA 3S16B 1WJJA 2ZPHB 3GBQA 3KUFA 4JRQA 1O7IA 1X3QA 3LWUA 3M57A 4WF2A 4JLGA 1I4PA 2UUBQ 3PO2G 2RSNA 4F17A 2GTOA 2VXEA 1VQKQ 2ID0A 2LX9A 1MUZA 3WVDB 4DBQA 4QW2A 4M7DF 3S1NH 1GCPA 3HOUG 2F3IA 1SKUB 1TTHB 3BVZA 4KD3A 3G4SA 3O8VA 4PNOA 4M7AD 2E2JH 1X32A 1QVFS 1Y07A 1K0XA 3PV0A 2E6NA 4B6MA 2PI2E 2G6FX 3L2RA 2XSCA 3FDTA 3QOLA 1EZ6A 2MK5A 2F52A 3FKIH 4YCWA 4GY5A 2KBTA 4C92G 3J7AF 1SE4A 4IPDA 4PK4A 3S24A 4ALPA 4LFBL 1A63A 2VXFA 4FT2A 2FPFA 2E70A 1HZAA 3A56A 5CIUA 1SAPA 2K5LA 2L3PA 2A6EC 1N33Q 1A8VA 1G8XA 2KVMA 3E9HA 3EG9A 1I4RA 4AFQC 4BD3A 4LE9A 1V1PA 2F0QA 2RCFA 3QO2A 1I0CA 4M8AA 5GQOA 2I0NA 3GTLH 2NUTB 2DPPB 1H641 2Q8IB 5EPKA 3OTOL 4WFN3 2DJZA 1PH3A 1TWCB 4UPAA 3G6EA 4QUFA 3JAMi 2JEAI 1WTVA 3Q1JA 4R0KA 1EY8A 2OTJA 3R8BA 5DLOA 1TT2A 5GAOr 4BWGB 3GOXA 3ND9A 1B53A 2FMCA 1BNZA 4A4HA 3K6OA 3QPHA 4E7HA 4RG1A 1FGUA 1ENFA 5EQ0A 3K57A 1XQHA 5LJ5f 3MFGA 2OWOA 1DYQA 5JEAJ 3CBMA 4DEYA 4XQNA 4J9EA 4FW2A 2RHZA 4OMPA 3KBXA 2KSSA 3MP1A 5D6YA 1SYCA 3I3CA 3HZXA 4LAAA 4FF1A 3E9GA 4J9DA 4QQDA 1F2LA 5IWAL 3PIP3 4PFPA 9ATCB 4IJHA 1OOTA 4PLIA 2JP1A 2SNMA 4XU0A 2XDPA 4KUDK 5KCOA 1WFQA 2ATWA 2RQVA 4LDYA 1IGQA 2CW0C 4CDDC 5C4XH 5DM63 1B34B 5LMNL 4LF7Q 1EY6A 3SK6A 4DR5Q 3J7A5 1S4ZA 2VYTA 2L11A 4DV4Q 1EY9A 4IIOA 1HNXL 2CH4W 3OHXC 4DPGA 4BB7A 1I8FA 1ZHIA 4CC2A 3I55Q 2KI7A 1HTLD 4RTWA 1VIEA 5GAOn 3G4SQ 4JCVE 3PO3B 4P75A 4IZ8A 3I5SA 4GOPB 4YCVA 1H9JA 1B7YB 1LT6D 1IL2A 4A3IH 4JG2A 5KYXB 4JI3L 2NVXB 2E12A 3JCMb 4YHHL 1VQDA 1EIGA 2PQEA 3CMAT 1Z9FA 1I5OB 3VR5A 1PRTB 3HOVG 2VUMH 3C95A 2WV6D 3E6ZX 1K9MR 3ULLA 1TWAH 5CBAE 2ZXPA 2NTTA 4EMKC 5KEEA 2JS2A 3GF5A 4NOYA 1VS0A 4C92D 1IW7C 1D1IA 3RN2A 4ZKBB 3G6EQ 3BYYB 1A3UA 2D9TA 2OTJQ 2K33A 2RI5A 3EFOA 1WFWA 3FPPA 4MHEA 1VQOT 4UDUC 5EC7A 2N55A 3BE3A 5LJ5j 1XMQL 4M7DA 2YWWA 2JN0A 4DGZA 1Y8OB 2H4OA 1VQMT 3CC2Q 4JVZA 5FLXc 3H6MA 1MHNA 4JS5A 2EVBA 2EYFA 3C1FA 3EN2A 3RR5A 5BR8Q 3S3MA 1WTHA 2MIOA 4J8QA 3PO2B 2BH2A 4RHRA 3TN2A 2QA4A 2HUGA 5IHIA 1WTXA 1PH5A 1SHGA 1TG0A 4BE0A 1ILQA 1PTOH 1MI2A 5GMKm 1KLUD 1IHZA 3INZA 4DR6Q 4N0AA 1M90R 3CMET 2BIVA 4CHTB 3S1QB 1JXMA 1CSPA 4DV5L 3VYHB 1LT4D 1SSOA 1UE6A 2CKZB 3S2DB 1YBYA 4RWSC 2VW9A 1RODA 2DYIA 2HBWA 3A8HB 1STNA 1DM0B 1QVGA 4JZ4A 1M4ZA 4BUGA 2ZGWA 2M02A 3H91A 3K5MA 3PMIA 1EIHA 4OMOA 1LOJA 1XXGA 4EMHA 3S2HB 2E8GA 1DOMA 4K5VA 2F0IA 3NHHA 2RQRA 4ANJA 4PZ7A 1C48A 4CKCA 2KEAA 4KHZA 4PZ6A 3HFOA 3HRUA 1TS4A 3M5AA 2VNUD 3X28B 1EU3A 3A8MB 4DUZQ 2F2XA 3CC4A 1CHPD 2PZUA 2HBPA 1U4RA 3D0FA 3C3LA 1A15A 4QVZA 3QR8A 4XU2A 1TU2B 2A5HA 2RKSA 4CJ1B 1X3GA 4M77E 3MPUB 2OEOA 4KD4A 2YU9B 2RM4A 1Y8PB 5I9PA 2K57A 5LJ5g 2O2LD 3AQQA 4ZCKA 3HKSA 1Y96A 4FYVB 5A0GA 3PQIA 1FNVA 5K36H 2QW7A 2CUBA 3FVQA 3NQTA 3HFNA 2RPNA 1LTRD 4IUVA 2GTJA 1WHHA 3I56A 2RHSB 2I07B 4BY7H 4P74A 2PU9B 1UUPA 4JI1L 2OAWA 2K28A 1UUEA 1PRTF 2KQ3A 3GIBA 1AH9A 4A93H 4ZGEB 4X3KA 5FRMA 2QA4Q 4JRPA 1S5FD 3K80C 3SHLA 2F4VQ 3N5BB 1G8ZD 1VQAA 4EMKB 1K83B 2DEUA 2NYZD 5E7NA 1RAAB 2EYWA 3M0PA 3E3XA 4A3GB 2DJGC 1ZXTA 2LMCB 1H3ZA 1Y69U 4QY7A 2QI2A 2XN9C 3OA6A 4UY8C 3JB9F 1CSKA 3NBHA 1XNQL 2JM9A 1QCFA 3Q8DA 1JQYD 4KHPL 1KNEA 1PYWD 1LTLA 1QVCA 1LTGD 1SEMA 3BVMA 3KF6A 4R4TA 4CBVA 5FJ8G 3CCRT 1ESFA 1ZKOA 3I35A 3GNFB 4IUPA 2DXCA 4Z89A 3CCJT 3DB3A 3UT1A 1BCPC 1ICFB 4LUZA 2EYJA 5CGKA 1KRSA 4A3KB 2DNUA 5DY9A 3RZOB 5C3EB 2PZWA 3EVQA 4OWXB 4DV6Q 1I3QH 4RAUC 2NZOA 4FXGC 4OIJA 4R9WA 3JRZA 4RCNA 2MPMA 4XYQA 1DXMA 2PNRC 5ISRA 2HHHL 2PO4A 1Y7XA 1U4LA 2CVRA 2ZCFB 3NUCA 3CC4Q 2JT4A 4F7UE 1PH2A 1QZGA 4HTHA 1PKTA 2Z6KA 4LD9K 1BF4A 2E74C 1S72A 5BN4A 1L0XB 1S5ED 1EY0A 1UB4A 5LJ3f 1V29B 1KQ1A 5GANj 3BG3A 5M3FH 1OXTA 3M4OB 1V1CA 3OW2S 1CKAA 5CR3A 3OYJA 3TP5A 1CKBA 2X9HA 1HQMC 2JXMB 4JYAQ 4JK1C 4LF9L 1M1KC 4IJLA 2IPOB 1ENAA 5IYDG 2FZKB 4U673 3I91A 3JCMd 5E4WC 4BACA 1D3BA 1FMVA 3UE1A 4QIWE 3JCMJ 4DK3C 1M1KU 4HSVA 2EYQA 3I55T 4MN3A 3RBBB 1PYBA 1RF2D 3CW2C 1YIJT 3M85A 2DTIA 2UU9L 2PPBC 3PVLA 4M75A 2K04A 3NGPA 5A0LA 4PJMA 2V1CC 4RH6A 1OYXA 2BDOA 2WACA 3CCEA 2WSEE 3OSSC 2JMCA 4DOWA 1H9RA 3K0YA 3BS1A 4M7AE 4LK1C 1WJSA 2EY2A 1UG1A 1GBRA 2PQAB 4WORA 5KYLA 2A28A 5CMDA 5EKIA 2JTMA 3RN5A 2IX1A 2EYYA 4C8QD 5CKHA 1SNPA 1VF5C 2AUKA 4ID6A 2QEXA 4A3DB 2XVSA 4J6XA 5CKFA 3U58A 1GKHA 1FYNA 2DY7A 4JI6Q 8AT1B 2EYHA 3VS5A 5G3LF 1NYGA 4LFAL 2LCCA 2EQMA 2G9DA 1W2BP 1NSNS 3PCOB 1JICA 1XNIA 5GMKi 4OWTB 1KQSP 1OPKA 3SK8A 5BN5A 3DXJC 4HCSA 5AT1B 2NVTB 1VQ7A 1K8MA 5LJ5e 4L6V5 3AYHB 4HIDA 4DBRA 3RERA 2F0NA 5JAVA 4ULLA 3GTQB 3QJ6A 2AMCB 3CCQA 4XIGS 2LRQA 2XD0A 1CA6A 1ZYRC 3OWFA 5DEHA 4QKUA 5KYIA 1N32L 5GANg 4WCIA 5M3MB 4C3HB 1K3RA 3VYGA 2DVEA 4JI8Q 5BN3A 1Y1WB 2KHJA 5KGUA 3E0JA 4OEMB 1KXLA 4C0FA 2VASA 1S72Q 3OSOA 4JI1Q 4RTYA 3JCMh 4KGVB 5L23A 2X4WA 2F0VA 4KKUA 1JJGA 3M0QA 2YUPA 4G7OC 3VR6A 2YTYA 5I21A 2EIFA 4DUYQ 1PFMA 1BCPB 1IKLA 2L9HA 1QCBD 5D3IB 4XQJA 2VUBA 2QGGA 1YI2A 1ZBJA 3NP8A 2FVUA 3A8OB 2OTLQ 2JA7B 1NPRA 3HGBA 1H92A 1M30A 2IWHA 4HMJA 1B2TA 1Y71A 2JM8A 1JJ2A 1NMGA 2Z0SA 3I4NH 3OSVA 1M2OA 3CC7A 3E5SA 4UP7A 1OZ2A 1ESRA 1Q81R 2EYXA 1JOKA 1SYEA 1OZ3A 3PGZA 2GQVA 3J7YW 3KXTA 3T1YL 2QEXQ 1B7TA 2KY9A 5FWBA 1EWCA 1FD7D 1QP2A 1PA6A 3HOZH 1GUTA 1ZEQX 1VYTA 2AUJD 3PIOA 1NUCA 1Q3LA 3CCLA 1TVXA 4BI3A 4F7XA 2KCTA 2O9SA 1Q1BA 2DXUA 2E76C 4PZ8A 1IYUA 4C0DC 3K5LA 2ZJPA 1WX6A 4H44C 2WSFE 1Q7YC 4XTYA 4C92E 1STBA 3K0XA 1VQ7Q 1WTPA 1U4PA 5EPJA 4C3JH 5LJ3g 2EQUA 1Z47A 4TVAB 1Q7YU 2K5HA 2L8DA 4KBMB 2FEIA 2J06A 3CXCP 3CCQQ 1LM0A 1V1OA 1HR0L 3IFTA 3M7NA 4LUDA 4PL6A 1GUGA 3SR1A 3OS5A 3I2ZA 2K3BA 1SYFA 2YRVA 2F0EA 2ECZA 4R56A 3UWNA 4FT4A 3FKIG 1FXXA 3K5OA 2CSQA 5E1FA 4DV1L 4A3EB 3TSZA 1S3OA 3G71Q 1YN8A 5LJ3d 1B8AA 2D9UA 4OX9Q 1NPPA 2R7ZB 3JB9J 1E2WA 1NBWA 3H94A 1CZGA 4PQXA 2K79A 3E19A 3TP7A 3NPFA 2KYMA 5JJIA 4Z02A 2QDBA 1MMDA 5AJ3L 4E7KA 4R8NA 5FROA 4A63B 4QF4A 1K28A 2UUAQ 1YI2Q 2ASBA 1GD7A 5JPNC 1BI1A 4PJOD 2QDYB 2HZYA 4RG2A 5KNCA 2AWNA 4CDEC 4JOIC 4HIKA 4AT1B 3CCST 1VQPA 1XX8A 2PCFB 3NSWA 1TH7A 2AKKA 4PMBA 2ZPEB 3M9QA 3CC7Q 1CZWA 2UXDL 1RADB 4A4KA 4LMQD 4EQPA 1UECA 1VMCA 3O13A 1N27A 3BU2A 4DV0Q 2ED0A 3RDVA 2M9VA 2KNBB 3EG3A 1MNEA 4BBRH 1LTTD 4ESRA 1W3SA 2ROLA 5ELBA 4XTUA 3ZJYC 1N9SA 3VDYA 3HRSA 1WHGA 1EFID 2RI3A 4KHPQ 1RABB 2Z0WA 3EFRA 4CKBA 3HS0C 1TUDA 5GANe 1EZ8A 2DX1A 2NUPA 3R2TA 2FHTA 3NXWA 3A8GB 3HOXH 4II1A 2M00A 1D5ZC 4FSSA 2XWBB 4DV3L 2HCCA 5C4XG 1WJRA 2RHXA 3VS3A 1G83A 1SE2A 2ED1A 1M1KR 1VDZA 1TS9A 1LPLA 1RACB 2K9GA 2L5QA 1YJNQ 1NTGA 4J1MA 4DV7L 5CQYA 3H3VI 1X6GA 1BYMA 2E65A 2BE7D 3VS0A 2EYPA 3G7LA 3UA7A 1XMOQ 1M4VA 5LJ3h 2G9HD 2VQEL 1HNZL 3QXEB 3W3AA 2JZ2A 1A6XA 2VVKA 3UPUA 2EYOA 1M8AA 4L5QA 1T3SA 4KJOA 1X2KA 3T56B 2ZM6L 4WJ3M 1IXRA 1ONLA 4L63B 4A3IG 4X1VA 2BUDA 5GAGC 4HJ9A 1PFBA 1RAIB 1XOVA 1YHQA 2MI6A 1QKWA 2RDHA 3I7FA 2F0MA 4LD6A 3TS2A 1PNJA 5KYYA 2FRYA 4C0DB 2X6GA 1CUKA 1LT3D 2EXZA 3N6RA 2E5LQ 2JA8H 2VUMG 3URGA 1CFMA 5L37A 1WGSA 2HD3A 1VQNT 2MO0A 3G48A 4V2SA 3GLXA 1F9RA 2ABLA 3HOWB 4ILWA 1CK1A 4OMNA 5GAN3 1G6ZA 4WTOB 4DBHA 2QGFB 3TMEA 4KULA 3X3MA 3QKJA 1JC7A 3EG2A 5CQXA 1IHWA 2AHJB 3V8KA 1VQ4T 1LYLA 5T1IA 1H9MA 3EH2A 1IL8A 4N4IA 3GO5A 2K5NA 5DLQE 3EAEA 2YTVA 5IE8A 1EQTA 5EBCA 4BY6C 1DOLA 1HZ9A 4JUVA 5ELEA 3VR4A 3AEVA 4NP5A 3S1NB 2Y4XA 1QQJA 2ZPFB 3CPWS 1KLGD 4POFA 4C8QA 4LF8L 4LNQA 4M77C 1YJ9T 2HDLA 2EPBA 2XWJB 3LW5E 4WRDA 1OU8A 5CV6A 3LX0A 4JI4Q 3M3YH 2E2JB 2YDLA 4A3JB 5FJ8H 1G2SA 3D3RA 4DXFA 3FKIB 2MYSA 1NJIC 4XAXB 2K01A 4YWLA 1YHAA 2FZGB 3M0UA 3ERSX 2KQWA 1I94Q 2CCZA 2EYMA 2Q8TA 2EYZA 4BXXH 3CMAA 2C5CA 2XIWA 4OGCA 1YP5A 4HCZA 1NJIU 1DOKA 1FVIA 1KABA 2MO1A 1VA7A 3QDFA 2SNSA 1C7YA 2OTLT 3OIPA 4RTUA 1SRLA 1PTOC 2F0FA 4G57A 4DFAA 2K5FA 1GVPA 4JI0Q 3J80L 5CYUA 2O5IC 3NBIA 4P73A 3GTLB 2DERA 3WXMB 1YJWT 2QQRA 2QCPX 2YUQA 3OYFA 4KI0A 3A8JE 3W2DA 1YHQQ 4GS3A 1DD2A 4H13C 3LNNA 3UE0A 4B3RL 2CWAA 1M1FA 3OYMA 1QMCA 1MHWC 4DN4M 4B3ML 4OF1A 5IN1A 1IB8A 2CT3A 2LQ8A 4ZUIA 2JMAA 5GJWB 3CKIB 1X2QA 2R7FA 4IKFA 3GP7A 2VQFL 2K4YA 4F7UG 4C8QE 5KE2A 5E3FA 4KN4C 4E7SA 1HTPA 1QILA 4GN3B 4LF5L 3TRZA 1AFPA 3DHQA 3TBIB 3PT9A 1A2UA 4M7DD 5K36G 5I9OA 1SROA 3QWYA 2CP2A 4BI4A 3FC3A 2DKGA 3M0SA 1TS5A 2EJFC 1OX8A 4BY7G 1MSGA 1RAEB 3P20A 1J8IA 1PV4A 4P5NA 1MV3A 5IOCA 2J7IA 4MTNA 3QDRB 5C4XB 2KXDA 4J7IA 3PE0A 4A93G 1VQLQ 1RLQC 1EOTA 1FYCA 1UFFA 4YIJA 2MNAA 2FG0A 3A54A 2V8KA 1JT8A 5IT9c 3F8TA 3EG1A 5GAOp 1RTOA 3I4LA 1O7ZA 1PD0A 1RDPD 3EGDA 2QEJC 3U23A 2E5KA 3I4MB 2X3XD 4HCCA 3FLGA 2A6HD 4M7AG 2KEEA 5C44G 2OF1A 3ONAB 1PD1A 2RQWA 1VQ6Q 4DBFA 5C3WA 1UTIA 1K73U 4Z9CB 5DAUA 4LW1A 1QUQA 1NEBA 2DO3A 2EFIA 1QCNA 3BW1A 5GAOm 1SRUA 2RDFA 5CBEE 1T9HA 2HNIA 2DUDA 4ELYC 1G6PA 4KMUC 3KLWA 2LJ1A 3EG0A 2IX0A 2NBFA 2XMFA 5TSSA 2RDGA 3RUZA 4BY6B 1P16A 4XQQA 1U8RA 4GNXA 3R3OA 2ENMA 2BCOA 1ZSZC 2HDAA 5GAOq 4C2MB 3MJXA 4M7AC 4M77B 1U5KA 1OU9A 1BR9A 1M90C 2A1AA 2VWFA 5A2QL 4IFDI 2LNVA 5GAN4 1IBLQ 2LQKA 3U4ZA 3J81c 1TWGH 5C4JH 1M90U 4X65L 3TCJA 1WXTA 3MP8A 3J81E 2QGQA 1LVKA 4FM4B 4NL2A 3H0FA 2WKDA 2E41A 1JEGA 2EGAA 2UUCL 1PTOB 5I11A 2F4IA 3A8LB 3AB9A 3NK9A 1SLJA 4OONA 2M0YA 1TXYA 2MGSA 4RUGA 4X34A 4GLMA 2DXBA 2L55A 2JXBA 2QG9B 2X35A 4J6YA 3A7AB 1Q1EA 1CKNA 1Q8IA 1WOCA 1FMWA 3VR2A 4BE1A 2MWPA 2I2LA 4KGXB 3VS4A 3C94A 1EQQA 1KIXA 1Q82R 3GTKH 2KRNA 4DR2Q 3H0GG 4DK1A 2KEDA 1I4XA 1LABA 3C2PA 4IO9A 1M2VB 1PH9A 4KT0E 4GKKL 4HCKA 5GAOl 4MZ9A 4DNRB 1PMRA 3QG1A 1VQ9A 1H9SB 1ACMB 4KH1B 1G2BA 3BYTB 4XTWA 2EJGC 2PW7A 1IZ6A 1TQOA 1K8GA 2F3WA 3JAMc 4F7UB 4PJOE 1RHPA 3WOEA 1J5EQ 1IHVA 4LF5Q 2WSCE 1QVFP 1ZUYA 1Y1VH 2KT8A 2ENBA 2XK0A 4N4GA 3PVQA 4J9IA 3JAME 2NVYH 1SSFA 1AN8A 3PUWA 4IQZA 2E2HH 3I9QA 1I6HB 4BDZA 1RKNA 2JQOA 3SXHA 2B2TA 1Z7TA 3MZ5A 4BY7B 3HL8A 5D3DA 1FR3A 3GTPH 2L3QA 2MCNA 1TY0A 1W6KA 3NQIA 2KOLA 4ME7A 4A93B 1D09B 4QIWB 2DMOA 1TUGB 2NYSA 1UE7A 3KF8B 1STGA 1AZEA 3Q0AA 1EWIA 4A76A 1FJGQ 1KHIA 2R93B 1HSQA 1X01A 4LUEA 1NJIR 3MFYA 4B08A 4H02A 2F0UA 4C92C 3V7CA 3CF5A 3CCVA 4M75D 4QT7A 1K9AA 1FNUA 1JJCB 2F0GA 2GN5A 4M77F 1VQ5T 1ZSZB 2DJFC 1HHVA 1AHJB 1TR5A 2K5IA 3CCUT 4IFDJ 4M7AB 4DF7A 3FDRA 4X9CA 1NR2A 4DR7Q 2D6FA 4XT1B 2PMZB 1UGPB 2A69D 2L4NA 1YNJD 3CCMA 2R5AA 3BDCA 5FO9B 1EEID 4B3TQ 4A3BH 1QOHA 3I4NG 1SHFA 5CKEA 3MXPA 1D1AA 1I50H 1SFOH 2KDSA 5FLXL 4QVDA 4BBSH 2RHYA 3DEOA 3OIQA 3G6JB 4AG2C 1VYVA 3RIRA 3NHNA 1VQBA 2B63H 5JJKA 1Z9QA 2Q8RE 1NE3A 4OGEA 2L2PA 2D5DA 2WINB 2V1QA 1E2ZA 3AMUA 2VB6A 4AFSC 1TWHH 5HURA 3HOZG 5FU6C 4FVMA 3S14H 2NB0A 1EIYB 4APVA 1GXDC 3HRZC 3ER0A 1JWUD 1NR4A 2ZXRA 4M78A 1X27A 3EQLC 1JORA 3KDFA 2O31A 4RGOS 1EUJA 1PRTD 2A68D 4AFUC 4C3JG 1N6AA 1HH2P 2MHVA 4RGNA 4BS9A 5M3FB 4E6IA 3OYNA 5D14A 1TS3A 1E24A 3MXNB 1WI7A 2EQSA 1V9PA 4ZK9B 2DTOA 2HQEA 4L5TA 4E7ZA 1GJXA 5GAMe 2QF7A 4JV5Q 4FIBA 1GUWA 2R61A 2E3HA 3UDGA 5CCAA 2K3YA 4X3UA 2L3SA 3D8GA 4D8DA 3JB9D 3FB9A 3BDUA 3QZ9B 2SRCA 4X9DA 2GVAA 2MWOA 2DF6A 4MDXA 2KJXA 2MP1A 4HIOA 3MXUA 4FU6A 2ICIA 3CD6T 4IUTA 1TY2A 2J0TD 2WB1E 4YY3Q 4A4FA 3HG9A 1ABOA 2CP3A 1K73R 1STYA 3M4PA 3STBD 4EPCA 4HJ8A 2A6ED 1L1OA 4UP8A 1FX7A 2X4YA 5IXBA 1VQ6T 3CCVQ 2QQ9A 3I73A 5CKDA 1ZQ1A 2I0QA 2NVQH 1CM9A 2LKVA 1HZBA 2B2WA 5KNDA 1D5MC 3Q22A 2VGMA 4QCLA 2F0HA 2E4HA 2EKHA 5IGGA 3ND8A 3AHUA 2B2UA 1K76A 2BZXA 4Y92A 3VYSA 4B3SL 3HOUB 4HSPA 4BBRG 3BVGA 1K0SA 5GAEC 4HR7B 4LJZC 4ATOA 1X6OA 2VY3A 1DZ1A 1V8QA 3SB2A 1EOVA 1PC0A 4CRIA 1X6BA 4KJNA 2O4XA 2E2DC 4LFBQ 4C92B 4DR1L 1SG5A 3MEHA 4LFCL 1B3QA 3NPPA 3HOXG 3OB9A 2Z9HA 3A5UA 3DLMA 2NUZA 1WVLA 3GTOH 4NMZA 1NNXA 2E10A 1G3YA 4BE2A 2W0ZA 2WAQE 4HCEA 4M7DE 4R8IA 3K81C 1UDLA 3OTOQ 2K75A 4P2CB 2DD5A 1Q81C 4ELZC 2B2VC 2CKKA 5C6SA 4E7IA 3F1ZA 2V26A 1KJWA 2DZ9A 3VYTA 4DAYA 4JI5L 2ZTCA 1Q81U 5GAHC 2YRCA 3FJPA 1D0YA 5FU6B 2K6AA 4QUCA 3HFZB 1BDOA 1SMYD 2P0PA 4C0GA 5FK9C 4PJNA 4QQGA 2KK4A 4NPSA 2JA8G 1A3TA 4GKJL 3CBOA 4ZQ3A 3I4NB 2O2OA 4IPGA 5GANf 1N5ZA 5IWAQ 3P7JA 2EGEA 2DIQA 2H3JA 2EY1A 5D6WA 1XNRL 4NDXA 1VQKT 1N36L 3RKXA 1WYXA 2EW3A 1L2FA 4CDFC 2UXBQ 4C8QG 1UGRB 3N52A 1VYUA 4P72A 3SD4A 1JU5C 5LJ5d 5LMNQ 4Y91A 4OB0B 3KLSX 2DNEA 3TQYA 3BDOA 1HNXQ 5IP9H 1KHCA 1PSFA 3KJOA 4O1NA 5GAN5 1DJ7B 2FL7A 2YYZA 4QJFA 2ZJQA 2UXCL 1YCYA 2B2YA 1A0NB 1X3PA 4F88A 1R4PB 1BCOA 3MEFA 4Y52H 1TOVA 5C44H 4C3JB 1WHKA 3PF5A 3I8ZA 2O01E 2A74C 3WOFA 4JI3Q 5HGQA 3FJ5A 4XTCS 2K5WA 4YHHQ 1XYIA 4JI7L 4C8QC 1VQ8A 1WTOA 1EYCA 1SYGA 2NN6I 4J83A 5M5WH 3OWEB 2ES2A 2LNHB 3EBEA 3HOVB 3NTHA 1SNMA 2A19A 2EQJA 1QVGS 3J7ZC 3LWEA 4R4QA 1EFWA 2A0FB 5ELNA 2XRSD 4BXXG 1QVPA 2FO0A 2RA2A 3HP9A 2J6FA 1MMAA 1W2BA 3MHXA 2ESWA 2D0NA 1WTQA 4LDUA 1KQSA 1SMXA 2M1HA 4JBWA 4UHVA 2DL8A 4D6WA 2JS0A 3E9FA 3SWNC 1XMQQ 4C92F 4NS5A 3NE5B 2NUTA 2MFIA 2C35B 1ASZA 1QWEA 3FHWA 2YSQA 1PHTA 5GMKj 4R4OA 1AWJA 5KYNA 1OEBA
chains in the Genus database with same CATH topology
3BZKA 4AIMA 3KJPA 4AQYL 5LJ5h 3OS1A 4DR4L 3UDIA 4JBMA 3MEVA 3JCMQ 2Y0SE 4C3IH 1S40A 3OYKA 3G4ST 1X56A 4DV5Q 2DEQA 4LF6L 1PH1A 1WJQA 3ICEA 2NVXH 3OYYA 3GTGH 1B34A 1H95A 3H0GH 5CO7A 3PUYA 1EQRA 3LGJA 1N9WA 3WWVA 4RMOA 2GFAA 2YLCA 1Q86C 2D0QB 4GOPA 1N34L 3FEOA 2XG8D 3JB9I 2ALYB 3G6ET 1YJWA 1Q86U 2OTJT 2D62A 4YCUA 3JB9H 2ZZDA 3X26B 1QP3A 2CZ6B 3RLFA 1CKMA 3CC2T 3LYIA 4M75E 2LC4A 2N3SA 3E0EA 3PNWC 1L0WA 4A3MH 2MMPA 3KBGA 4LF4L 1BBWA 4PJOG 1MKHA 1IBML 5FRNA 1HNWL 2K4KA 4A3FH 5GANd 3GD7A 2F5KA 2PVOB 2P0KA 4LWCA 4JI2L 2VC8A 5C0XJ 2AKWB 3T9NA 4DK6C 1KL9A 2PNHA 1XNQQ 1EYGA 3SWNB 4KHPQ 3M9BA 3BZCA 2D0OA 4JI7Q 4PJOC 4R1JA 1SR3A 2NZHA 2E2IH 2FB7A 3OYEA 2KCMA 3RLOA 3OYDA 2Q2HA 3PUZA 1I5FA 2NLUA 3H6ZA 1X65A 3K7UC 2L15A 4X64L 2HHHQ 2YU9H 4ZGDB 1TWFH 3F2CA 3ZBDA 4JC0A 5GADC 4MZMA 2RH2A 1SN8A 3ASKA 5LMNW 3HPWA 2GFUA 3HOYG 3UDFA 4FSXA 4LF9Q 1BI3A 2YLBA 5GAN8 2RI2A 3LGLA 3M53A 3H8ZA 1GO3E 2H5XA 1IBKL 3GPLA 2QA4T 2DZCA 5GANh 5GAN2 2PUKB 4RKUE 1Y1VG 1N36Q 2UU9Q 1YITA 3L2PA 4DR3L 4A3GH 3F70A 3W5OA 4OXPA 2XKOC 4YWMA 1SE8A 5M9OA 4OB3B 2KENA 1VUBA 2BA1A 4A75A 4EMGA 2JA5G 5LL6S 4CI0C 5GAN6 3VUZA 4EMKA 4XQ3A 2WB1G 4LFAQ 3S6WA 3RZOH 1LNXA 5C3EH 5LMUL 3KOJA 1BI2A 3BFMA 2CGHA 1JJ2S 2ZPIB 4NXNL 4A3BG 2BA0A 2EXDA 3CC4T 2FYKA 1YZ6A 3M56A 2JEBI 4BBSG 2EJ9A 2AHOB 4AYBE 4ZN1A 1V1QA 2B63G 4DAMA 5GMKe 1N32Q 5J39A 2MF2A 2K5VA 3JCMW 2RK1A 1Q8KA 3JSCA 2QQSA 3DB4A 4PJOB 1ZBXA 4HA8A 4B9XA 5DM7R 3S15H 3MEWA 3H3VH 1U1SA 1C9OA 1I5LA 4Y7NH 1VQFA 2WAQG 1WCMH 4RMFA 1Q82C 4M7DG 3T1HL 2HQXA 4HJAA 2Y4YA 2I5LX 1Q82U 1AE3A 3EIVA 3CCUA 3MP6A 2DK3A 3OQ5A 1KG1A 2F5TX 2DGYA 2D0PA 3OYIA 1U1TA 3P8DA 3T1YQ 3ZEHA 3RKWA 3DKMA 3GTMH 3BJUA 3S1RH 2JA9A 2VV5A 2PQAA 4C5IA 1L1OC 4M7DC 3MEAA 3GTQH 1P8LA 3PIPA 3M4QA 5M3MH 4NXML 4IOAA 4C3HH 1MJCA 1Y1WH 1S72T 5GAMf 1HR0Q 2VGNA 1WI5A 3JCMX 4A4GA 4N0AC 3OYCA 3AFQA 3CP0A 4M78D 2KHIA 2RJDA 5M5XH 4DV1Q 4C5HA 1Y14B 2JVVA 3C12A 2A3LA 2JA7H 3KFUA 4PMWA 5AJ3Q 2JTFA 3M58A 3ZFJA 1IYJB 2HIXA 4EX5A 3OS2A 3M59A 2BKDN 1VQOA 2QEXT 2UXDQ 3RESA 1VQMA 2P4TA 1OXSC 4PJOF 2OQKA 3RNUA 2XI9A 2YV5A 4TQUS 2OQ0A 1UEBA 3L2QA 4JJNK 3CQZH 3L0OA 2IT1A 2QQAA 1UGQB 1VQ7T 4IPHA 2LVMA 1VQGA 4E7LA 3BDLA 3CMEA 2V8JA 4DV3Q 1WQ7A 3QIIA 5EG2A 4O0AA 4HJ5A 3CCQT 3CEYA 4JBKA 5GAMj 2E5QA 2Y0SG 4DV7Q 3A5ZB 5IP9G 3QBYA 2LDMA 4A4IA 2RK2A 1HNZQ 2VQEQ 4A3EH 4IPCA 3G71T 4L5RC 2R7ZH 4RCBA 3QUIA 2ZM6Q 1K73C 5M5YH 1N33L 3MO8A 3L7ZC 3M54A 1NE8A 4M7DB 3X24B 2ZPGB 1YI2T 4L5SA 5KH6A 4KLKA 3SGIA 3E9IA 4P71A 2NN6G 3HHTB 5AYFA 3CC7T 2XDDA 3SDZA 4GN5A 4E47A 3VUBA 4OO1I 4RCCA 1VQKA 2HIVA 4Q5WA 3VU3C 1BKBA 2A7YA 2Z6KC 4M75G 2WP8J 3TEEA 4L5GA 3CCLT 5IY0A 3PSIA 4GLVB 4LF7L 3MEUA 4LF8Q 4DR5L 5GAMg 2CZ7B 1YJNT 4DV4L 1X9NA 1RIPA 4BY1H 4X62L 3KYHC 3TREA 3PMTA 5J3BA 3PO3G 1HZCA 2OAUA 3J80i 4X6AH 1E1TA 4M75C 1MGQA 4ZTJA 3CCRA 5GAMd 3CCJA 4EQ5A 4A3LH 1Y96B 4OB2B 2DAQA 3LLRA 2PI2A 2RJCA 3QO3A 4Y28E 2ZTEA 2CWPA 4DNIA 2QTXA 2LXKA 2KAFA 4MNOA 4B3RQ 3HOYH 3LWHA 4NB3A 1PH6A 4B3MQ 2WFWA 3HOWH 1BVSA 3GP8A 3GDEA 2VQFQ 3K7AH 3S1MH 3JB9G 1VQPT 2G3RA 4LUVA 3OYBA 2LT1A 2R7DA 1QW1A 5BR8L 1NY4A 1VQCA 1KRTA 1HR0W 5JJLA 4A3MG 3I55A 3NBHB 1YIJA 1NZ9A 1HK9A 3HRTA 2JA5H 3L42A 5L8RE 1YEZA 3KF6B 4DR6L 4A3JH 4A3FG 2FHDA 3UDXA 1A0IA 5A2QE 4IUUA 5J26A 4DV2L 2IVWA 4OB1B 3STBC 5GAMh 4QQBX 4C0ZA 4KUIA 1WYDA 5IYCH 5FU7C 1YHQT 3OS0A 5CR2A 2K3XA 2Q2UA 4JOIA 4ZN3A 4DUZL 1G3SA 3S17H 4OMFB 1VQIA 2XHCA 3VJPA 3HKZE 3U4VA 3CC2A 1JMCA 1X75C 2Y90A 2X4XA 1D3BB 3JCMV 5I2MA 4LDXA 4MZPA 4AYBG 5H1SE 2N49A 3OMCA 4M75B 4X65Q 4A4EA 2YHTA 5CK9A 3TS0A 1K8AC 3V8JA 2UUCQ 1VQLT 2A8VA 3WVEB 2JK8A 1K8AU 1GM5A 4JRIA 2F4VL 4X62Q 3G7ZA 1KC8C 1HJPA 4A3GG 4A54A 2K14A 1O9SA 3I4MH 1LJOA 3CBPA 1KC8U 4F7UF 4JRKA 4IUQA 3GNGA 5GROA 4XTXA 2LSSA 3LH0A 3PGGA 4M78E 1KAWA 4GKKQ 1MIUA 4A3KG 5C3EG 3RMSA 1M8VA 4DV6L 2JA6H 1BIAA 2F69A 4C2MH 4A3CH 3NENA 1PHJA 3QZ5B 2OCEA 2EAYA 1EIFA 3JCMf 2E1HA 3LGFA 4QL5A 1RI0A 2DD4A 2LXJA 3RMQA 3M55A 1R8OB 4M7AF 2RHUA 3BY7A 3L2UA 5CKBA 2DXTA 3K8AA 2HT1A 5FLXE 1YNXA 4JYAL 2M9UA 2DTHA 4M77A 3L2ZA 4GLKA 5I2SA 4MZTA 4J5YA 4QQ6A 1G51A 5FU7B 2VZAA 2UXBL 3VKIA 2R92H 1JB0E 4UP9A 1W4SA 3AFPA 4DV2Q 1PSEA 1WCMG 3X20B 1YHBA 1G291 4UC4A 4HJ7A 3CCSA 3OYGA 4A3DG 4M75F 2ZJRA 3OYHA 2EQKA 4J6WA 4JI6L 2RB6A 2I5MX 2CYZB 4A53A 5HK0A 1I81A 1E7ZA 4IOCA 4XU3A 3OW2A 1X55A 1IREB 4HKEA 4J8OA 2EJFA 5M3MG 1I6HH 5CAIA 2CFMA 1JE5A 3I4OA 1Y1WG 4JI8L 5IP7H 3META 4XTZA 4PKCC 1TWCH 3W1GA 4F7UA 3LWIA 5GMKl 4DUYL 3JCMc 2R93H 4JDSA 1MJEA 1PH4A 3LX7A 5C0XI 2JA7G 1X3EA 5IYBH 1VQNA 3L2VA 3S16H 1UGSB 3RKYA 2CQOA 1PH7A 3A0JA 1XPUA 1X3FA 2K2VA 2XIDA 2E64A 2JOYA 1Q12A 4LUOA 5HKCA 1I4K1 2CS7A 1J6QA 4BDYA 3PF4A 2E6ZA 1VQ4A 2RHIA 3NFCA 4B3SQ 2ZTDA 1WQWA 1N8RC 4M7AA 1XJVA 1VQ9T 4DA4A 1N8RU 3JCMg 3PO3H 3E1SA 4L59A 3QSUA 4R4CA 2C06A 4DR1Q 1E1OA 1YJ9A 4LFCQ 4OVAA 3SFMA 3JCMP 4NL3A 2IY5B 4MMKA 5EAYA 1PYSB 4A3EG 2N8NA 1Q46A 2OTLA 1JB7A 2R7ZG 4OX9L 4JI5Q 4GLXA 3NTKA 2HD0A 2AWOA 3OY9A 3HSBA 2EWNA 1PH8A 3V7RA 3CCVT 1PFSA 2B29A 2PMZE 2UUAL 1BIBA 4GKJQ 1A62A 2XICA 1W2BS 1XNRQ 3CCMT