1EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
128
Chain Sequence
MPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Initiation factor
total genus 22
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eifA02
1I50H 2CKZB 2ZTEA 4C3IH 2NVXH 3H0GH 4L5SA 2R93G 5AJ3L 4DV1L 2UU9Q 2IY5B 3J7AF 4JI7Q 4POGA 1OXSC 4RG1A 5LMNW 4JBWA 3CMAA 4FDBA 3G4ST 1WI5A 3CPFA 1KC8C 4IFDJ 3I55A 1WYDA 2I5HA 4YCWA 4HIOA 1NMFA 2HQLA 3CC2A 1X55A 2MQHA 3CQZH 3J80i 1Q1BA 4GOPB 4GOPA 3UDGA 1PH8A 3P8BB 3CD6A 2UXDL 2OQ0A 3RZOH 5M3MG 4IPHA 1JT8A 3UDXA 3CXCS 4NB3A 4A3BH 3GTJH 1EOVA 2C35B 3G6ET 2YV5A 2OTJA 1PYSB 1VQ5A 3RZDH 1VCIA 2LCLA 3BU2A 2PQAB 2I5MX 2CCZA 2D0PA 2ZM6Q 4A3GG 4C3JH 3NELA 4R4CA 5IYBH 4DR4L 4OONA 4JI0L 2JA8H 2R92G 4DR1Q 1SR3A 3AFPA 2JOYA 2OTLA 1B8AA 2JA7G 4BY1G 2VNUD 3J81j 2NVTH 4DV6L 4A3DG 3HFZB 4HJ8A 3DB4A 1OXUA 1KD1U 1J5EQ 3PIOA 1VQ8T 3H3VI 3ULJA 2JE6I 1JMCA 1PHJA 2QGQA 4BY7H 1VQ6T 1XMOQ 1SROA 3HKZE 2WB1E 1K83H 1VQDA 3PSIA 4ZN3A 1VQ4T 4QJFA 5GROA 4DUYQ 3CCLA 3KOJA 3JAMi 1HR0L 3CCJT 5GAGC 1L1OC 5HGQA 1XJVA 2HIXA 1YJWA 4GNXA 2JA5G 3HOYH 1VQEA 5BR8Q 4C2MH 3ER0A 3CCRA 1G51A 4OXPA 4JOIA 4JBMA 3K80C 4DK3C 2DGYA 1Y1VH 2LVMA 3CCST 1NY4A 5GQOA 3STBD 2Q2UA 3S17H 2AKWB 4PMWA 5C44H 5LMUL 5M3FH 4A3JH 1UEBA 4LFAL 1G291 1PH3A 4IOAA 3DLLA 3PUWA 2XTIA 4GLXA 2AWOA 4IO9A 1AE3A 2AWNA 2PNHA 1FJGL 4IPCA 1S72A 4P75A 4A93G 1J6QA 5J26A 3STBC 5GADC 4GLAC 2IHFA 1HZ9A 3RLFA 1KD1C 5IP9G 2ALYB 4A3MG 4DUZQ 3LGFA 1LM0A 4JG2A 4DR6L 4GN4B 2E2JH 1NE3A 1IYJB 3M3YH 1W2BS 4LF6Q 4RMFA 2VUMH 1D7QA 4JYAQ 1EIFA 1D8LA 3I56T 1M1KU 3BZKA 2IHEA 4MTNA 2JUFA 3FKIH 5LMNQ 4B3TQ 4YCVA 2QA4A 3GTQH 5IP7H 3GTPH 3GTOH 1IZ6A 1YJ9A 1YEZA 4MNOA 2BH8A 3G71T 3TRZA 2DO3A 4GKKQ 4DV0L 2RHSB 3A74A 1SSFA 1YBYA 3ICEA 1KAWA 2UUBL 1CKMA 4RG2A 4OO1G 1OXTA 3KF6B 1WOCA 3ULPA 1YHBA 1IBKL 1B7YB 1PH4A 1KRSA 1IBLL 4B3ML 4IPDA 1XNIA 3TS2A 4MZ9A 4NPSA 4YY3L 1JJGA 2UUAQ 1FL0A 4P72A 2MI6A 1N33L 5FLXE 2QEXT 4LW1A 2VY3A 4X62L 1YZ6A 2GN5A 1PH7A 1BBWA 1EIYB 4A3BG 1YJNT 2XHCA 1IBMQ 4JI1L 1VQAA 2B63H 5FLXc 1HNZL 5C0XG 1LUZA 3T1YQ 4JI6L 3CCVT 4OX9L 3S14H 1GKHA 1TWHH 5A2QE 3OW2S 3G6EA 2AMCB 1YHAA 1XTDA 1VQNT 4O2DA 4LFCQ 5IYBG 3S1QH 1MKHA 1M1KC 2VQFL 2IX0A 1E1OA 2AHOB 4LF5L 5JEAG 4YHHL 4A3KH 2MNAA 1SE8A 1Y1WH 2HT1A 1TXYA 4DR7L 1VQ9T 3CMET 1LYLA 2JA9A 2K4KA 3F2BA 4UPAA 3U50C 1QZGA 2DUDA 4LF7Q 1VQLT 4A3CH 1X3FA 2OQKA 3A5UA 4HJ7A 2BA1A 4NXML 4P73A 1Q7YC 1UE1A 1V9PA 2K5NA 3PUYA 4Y7NH 4J15A 3J7A5 3PF4A 4BY7G 4K0KL 2UUCL 1VQ8A 4BXXG 2KCMA 4JI2L 4GKJQ 2E5LL 4YTLA 2E70A 2WAQG 1TWGH 5ELNA 2HHHL 4JBJA 3EIVA 3I4MH 4LFBL 1Y14B 1MJEA 5IT9c 4OO1I 2KVQG 1VQ4A 2D62A 3D0FA 4EQ5A 4X65L 1C7YA 2ZTDA 4LNQA 1N8RU 2UXCL 3LGLA 3CCJA 3U4ZA 3HOWH 5ELOA 2VQEQ 4DV5Q 3L2PA 4DR3L 2CQOA 1Y1VG 2MO1A 2N8NA 1VQPT 2LXKA 3FP9A 5C44G 5M3FG 5EAYA 4A3JG 4JI8Q 2Y0SG 3K8AA 1JE5A 3CCSA 1I94Q 5C0XJ 4HIMA 1HNXL 1FVIA 3A0JA 5C0XI 2UU9L 2RF4A 1QVGS 1PFSA 2RHQB 3S1RH 2E2IH 2NVQH 3ZJYC 1HZBA 3HOZH 1PH1A 3VDYA 4LF4L 1C0AA 1HNWQ 3I2ZA 4BA1I 4TVAB 3CCUA 1EQRA 2GVAA 2MO0A 3M85A 4DV7L 1Q46A 1WJJA 2Z6KA 3T1HQ 1A8VA 1E24A 4GS3A 2F4VL 2VUMG 3PO3H 1JJCB 4ALPA 3FKIG 2D0OA 1Q81U 2EXDA 1QUQB 5IP7G 2UXDQ 4OWWB 3PGZA 1QUQA 3JAME 4XIGS 1EYGA 3GD7A 3Q8DA 3K7UC 4APVA 2L3RA 2R7ZH 1UE6A 1VQ7A 3K81C 3WWVA 3ULLA 3CCMT 3AQQA 2K14A 2R6GA 3G71A 1K3RA 3IRBA 3M4PA 2ZM6L 4JI5Q 3CCQA 3W1BA 4DK6C 1YI2T 3J7ZC 3RN2A 3PO2G 1E3PA 2H5XA 3AYHB 3D31A 3NEMA 1I3QH 2YTXA 4A4IA 4C3HH 1GO3E 1H95A 1E22A 2GVBA 4DR1L 1X65A 4DR4Q 4IJHA 1XPOA 4JI0Q 1N32Q 4L5TA 1EWIA 4PG3A 4X64L 2QEXA 5IYCH 1J5EL 2B63G 1OXVA 1MJCA 1NTGA 3HOVH 1M1GA 1Q1EA 1YJNA 3UDIA 4GNXB 3GTMH 2YTYA 4KI0A 4X66Q 3AEVA 1I6HH 1Q82U 1XMOL 1VQMT 2LSSA 1LTLA 4UP7A 3CCVA 2CWPA 2ZJRA 3U4VA 1GM5A 1CSQA 5C4XH 1N9WA 2JQOA 4HIDA 4DV2Q 4PZ7A 4DUYL 4UY8C 4KHPL 3F8TA 1Q81C 1TWCH 1V43A 3CAMA 4X34A 4A3KG 1N34Q 1M90U 2WP8J 1Y1WG 1VQOT 1U5KA 2G3RA 2NVYH 4PZ8A 4DV4L 1PA6A 2JA6H 3S1NH 2UXBL 1CKNA 1HH2P 1YITT 1I5FA 5BR8L 4A3CG 2ZTCA 4P71A 3CMEA 3U58A 3PF5A 1X3GA 5IYDH 1RIPA 1VQHA 2KDSA 4JI4Q 3H3VH 3CC7T 3KLWA 1EUJA 3ERSX 5IY0A 3CPWA 4DNIA 3HOXG 4LUVA 5LMUQ 5C3EH 1OTCA 3KF8B 2JEAI 3CC4T 3TREA 3CMAT 1QVFA 1PYBA 1VQIA 1K8GA 3I4MG 2IG0A 3BJUA 1EFWA 1FJGQ 3I55T 3H0GG 3HOWG 1B70B 1X9NA 4QL5A 2ZJQA 3CD6T 4LF6L 3I4NH 1Q82C 4JYAL 4P74A 4LF9Q 4B3TL 2MFIA 1XMQL 3DB3A 5DM7R 1SRUA 2RCNA 4LUOA 1M90C 4GKKL 5DLQE 3G4SA 2KENA 1PH5A 1BKBA 4A3LH 2R7FA 4GOPC 4L5RC 4AQYL 1SMXA 3GO5A 4POFA 4DV0Q 1WCMH 3CP0A 3S1MH 3HOZG 2N78A 3E9IA 5IWAQ 4B3RL 1WFQA 4DR2Q 4A3FH 1IBKQ 4QQBX 2WAQE 1JJ2S 4DR5L 1IBLQ 2UUAL 3PO3G 3OTOL 4YY3Q 3EBEA 1NZ9A 1SFOH 1GD7A 1X56A 2K52A 4HIKA 3J81i 2R92H 3HOUH 1N36Q 4QIWE 2YU9H 4GLVB 1K8AU 4GN3B 4X62Q 2JA7H 4TQUS 3I7FA 1Q12A 4A76A 1NMGA 2BA0A 4KHZA 3F2CA 4JI1Q 4GN5A 2JA8G 2R7ZG 3T1YL 2L15A 1HNZQ 4DAMA 1JB7A 2E6ZA 2IT1A 2Y0SE 1VQJA 1NJIU 3I4OA 4LFCL 1KQSA 3E9HA 1VQFA 2A19A 5H1SE 2K5VA 1P8LA 3CCLT 1QZHA 3TEHB 2EQSA 3KJOA 4DV3Q 4NXNQ 4IFDG 3NBHB 1XNQQ 2I0QA 1R9TH 2JEBI 1A62A 1KRTA 4YHHQ 1X6OA 3J80E 1RL2A 1L1OB 2OWOA 2Q2IA 4XTCS 3S16H 1L1OA 1YNXA 3CCRT 3BZCA 1X54A 5IYCG 1CKOA 1VQ6A 4AYBG 4JI3Q 4UP8A 1KL9A 1YVCA 3PUXA 1XNRL 3HOVG 3J80c 4NXMQ 2OCEA 3CCET 4JCVE 1HR0W 4B3SL 3RLOA 2N3SA 4GNXC 3HOYG 3S2DH 3SGIA 4LF8L 1SLJA 1Q86U 1L0WA 4GKJL 4JI2Q 3CW2C 2NN6G 4JOIC 5LL6S 4H02A 4LWCA 4A75A 1L2FA 2I5LX 1DGSA 4A3IH 2HHHQ 2JA6G 4JV5Q 2F52A 4A93H 4LFBQ 3JC66 4X65Q 5FLMH 5K36G 2HIVA 1E1TA 2N49A 2Q2HA 4YWLA 4JI7L 5AJ3Q 4DV1Q 1YITA 1NJIC 2LXJA 4AIMA 1YJ9T 2B29A 3S24A 1S40A 4R1JA 3M7NA 4JI8L 4DPGA 1T9HA 1C9OA 1Q8KA 2B3GA 5GAEC 1I94L 5JEAJ 3CC7A 1YIJT 4OWTB 3H15A 4BBSH 2R7DA 3CXCA 3CF5A 1HNXQ 2YTVA 2FXQA 1PH9A 3PCOB 2VL6A 2NZHA 3EN2A 4KLKA 4Y52H 2VS1A 1YHQT 2WFWA 3TS0A 4YCUA 3I56A 1PVOA 3CC4A 1HNWL 1NBWA 5J3BA 3T1HL 1KXLA 1E7ZA 3DM3A 4LF4Q 3GTGH 4DV7Q 1VQCA 3I4NG 4PZ6A 4IFDI 3G48A 1N8RC 1P16A 3JAMc 1Q86C 2F4VQ 2A1AA 3KJPA 2CWAA 4A3LG 1HZAA 3F2DA 5IE8A 2ZJPA 1VQKT 4AH6A 2MWOA 3L0OA 1WCMG 3L7ZC 1S3OA 4JI5L 1KIXA 1ASYA 3M4QA 4YWMA 4L5QA 3GTLH 3KFUA 5FJ8H 2PQAA 1UE7A 3KBGA 4DV6Q 4A3FG 4BBRH 2CFMA 1W3SA 3AFQA 2NN6I 1K73U 5JJLA 4A3EH 2A8VA 3UDFA 3KYHC 3HOUG 1N32L 4JC0A 4X6AH 1V1QA 2V1CC 3PIPA 1VQNA 1A0IA 4X64Q 4TVRA 1IXRA 4OWXB 1Z9FA 5IAYA 1OXXK 2YYZA 5C4JH 1CKNB 2IX1A 3M4OH 4X66L 1G6PA 1VQ9A 1AE2A 5M5XH 1HJPA 4DV2L 2KHJA 3TQYA 4BXXH 3OYYA 4KHPQ 4DAYB 1VQLA 1N34L 1CUKA 2XGTA 1HR0Q 1PV4A 5JJKA 1VQBA 4IPGA 4DV4Q 4QQDA 4LFAQ 2UXBQ 2R93H 1KHIA 1O7IA 1TWFH 3RR5A 3W5OA 2JJQA 2BH2A 1FGUA 4JI4L 3PV0A 2CKKA 2Z0SA 2Q2TA 1W2BA 1Z47A 4DUZL 3CC2T 2K75A 1K73C 3CCEA 3RNUA 1PH6A 2JK8A 1QVCA 1SN8A 2NZOA 3J81E 3NENA 4DR6Q 3M9BA 3UE1A 1X3EA 3CPWS 5LMNL 1K9MU 2PMZE 5GAHC 4IOCA 4A3IG 3CCUT 2OTJT 5M3MH 3J81c 1VQ5T 1VQPA 1K0RA 5FLMG 1QVFS 4O0AA 4R4IA 3HKZG 2WB1G 4IJLA 4LF9L 2ES2A 3K7AH 2UUBQ 4HJ5A 4A3GH 1U0LA 3RN5A 1XMQQ 3LH0A 4B3MQ 1UWVA 1VQ7T 1MIUA 4AYBE 4BBSG 3K0XA 2OTLT 2Z6KC 1BVSA 4R4QA 1EQQA 3CCQT 2VZAA 2ASBA 1YIJA 1AH9A 1N33Q 5M5YH 4BA2I 4AQYQ 1JJ2A 1IBML 3PUZA 5IWAL 3HKSA 4BY1H 1Q7YU 4DR2L 4A3DH 3OW2A 3KF6A 4B3RQ 1YHQA 3PO2H 1VQGA 4ME3A 4WJ4A 2MWPA 4DR5Q 3OTOQ 1HZCA 4JI6Q 3MXNB 4DKAC 1N36L 1UE5A 4OX9Q 3GTKH 3CCMA 4HJ9A 2F3IA 3RLNA 3A5ZB 3S15H 1BBUA 1K9MC 1YI2A 4QGUA 2VQFQ 4QY7A 1YJWT 2PI2A 3MEFA 1A63A 1XPRA 2LQ8A 4DR7Q 4UP9A 1IL2A 1NPPA 3E0EA 5FJ8G 2K50A 5E7NA 4LF7L 1VQKA 2KCTA 3S2HH 2JNGA 4BBRG 2JA5H 2ID0A 1PH2A 4DV3L 2ATWA 4NXNL 4EX5A 1XNQL 1KC8U 2PI2E 2E2HH 2E8GA 2VW9A 4A3EG 1KQSS 2KHIA 1XPUA 3LGJA 4R4OA 2UUCQ 4K0KQ 1CSPA 1VS0A 3B6YA 4WJ3M 5C4XG 1S72T 1VQMA 4JI3L 4HJAA 2E5LQ 4JBKA 3W1GA 3KDFB 1K8AC 1XNRQ 3KDFA 3FHWA 3UE0A 4R4TA 4LUZA 2K5HA 4CRIA 3PUVA 4LF5Q 2KBNA 1VQOA 4YWKA 5IP9H 2VQEL 4B3SQ 4A3MH 2UXCQ 5M5WH 1TWAH 3HOXH 5IT9E 5IYDG 4DV5L 1GVPA 4LF8Q 1NPRA 2QA4T 2EIFA 4ZN1A 4DR3Q 1ASZA 2JVVA 4JV5L 5HY6A 3F1ZA 5JJIA 1QVGA 5C3EG 3GDEA
chains in the Genus database with same CATH superfamily
1ARKA 1QVGP 1G5VA 4A3KB 2A3LA 2DKGA 3U23A 3CXCP 2XU8A 2KY9A 1BCPB 4JI7Q 2JS2A 3BVGA 3SK4A 1BI1A 3JCMb 1JB3A 1M4VA 3VR4A 4OO1H 2NB0A 4Y7NB 3G4ST 3L1AA 2ECZA 2RHYA 3CPFA 2E5QA 4DBQA 1CK1A 3I55A 5GAOr 1G2SA 2C5CA 2DY7A 5GAN2 1G2BA 3CC2A 2K1BA 3V7CA 1CQFA 5GMKh 1RI0A 1WTQA 2UXDL 2OQ0A 3RZOH 1JT8A 1EU4A 2RA4A 3UDXA 2QI2A 1M2VB 4A3BH 3KUPA 2C35B 2YV5A 5A0LA 4MDWA 2C9OA 1VCIA 3BU2A 2CP2A 2PQAB 1EOTA 4A3GG 4ME5A 2F0KA 2PNIA 4M78G 2MIOA 2M00A 4PMBA 1PZJD 3MFGA 1MD2D 3EG9A 3EGDA 2HDLA 4DR1Q 1B8AA 1WTOA 1EY7A 3J81j 4DV6L 3NP8A 4A3DG 4HMJA 4KD3A 4G7ZC 4HJ8A 4HKEA 3DB4A 5J39A 1OXUA 1J5EQ 2NVQB 1AZEA 2JE6I 2X4JA 2RO0A 1VIFA 1II3A 2QGQA 2J0TD 4HT9A 4C8QD 3PMTA 1SROA 2WB1E 2MP1A 2H1EA 3PSIA 5GROA 4CC4B 3LX0A 1LTSD 4OMMA 5HGQA 3R2TA 2RQWA 4EGVA 2JA5G 3HOYH 4HMIA 4ZKCB 5DLOA 4C2MH 3L42A 2OXPA 4UC4A 4M7AB 1M27C 1YIJQ 1YNNC 2QKIC 4JOIA 4OXPA 3Q6SA 4M7AA 3RUXA 3E0JA 4JBMA 3HP9A 2Z1CA 4PJJA 2V8KA 4M75B 4C3HB 3RKYA 4A3JH 1Y71A 1GUTA 4IOAA 1PH3A 4M75A 4K5WA 3DLLA 2AKKA 1LJOA 4F87A 2FZCB 2DNEA 4M7AE 1B3QA 4OVAA 1J6QA 2ESWA 1KD1C 4C56C 4KUIA 2IVWA 1TVXA 4M75E 2RM4A 3LGFA 3EG1A 2E76C 2X6GA 3CAMA 3OIPA 1F1BB 4DUZQ 1UGPB 1UJYA 1IYJB 3SEBA 1W2BS 3PQIA 4A3EB 2E2JH 2VUMH 3I56T 3J80L 1GXIE 5C4XB 2FHDA 4R9WA 2KT8A 3FKIH 5IP7H 3R6NA 2B2TC 1WVLA 5CYUA 4DV0L 2YRVA 4HCKA 4BE1A 3A74A 4JJNK 1X6BA 1SNPA 3ICEA 4LUDA 4IQZA 3KF6B 2RVLA 1IBKL 1B7YB 3ONAB 1XNIA 4MZ9A 3M0TA 3TU4K 1JJGA 3EHQA 1FL0A 4P72A 1K76A 2VWFA 3QO3A 1V1PB 2PNRC 5TSSA 2DIQA 3M56A 4DOVA 1K28A 4LW1A 1V1PA 3RERA 4KUDK 4AT1B 1A0NB 1YZ6A 2GN5A 2VY3A 3LWEA 4X62L 1YJNT 1IBMQ 4RTVA 2ZT9C 3A8IE 4FF3A 1SNMA 5FLXc 2CSIA 2VGMA 4XQNA 4ZNXA 1GKHA 1TWHH 3TSSA 3OW2S 1XTDA 4BE0A 2GBQA 2EQKA 4C0DC 1EQTA 4LFCQ 1GCPA 2DTHA 3S1QH 1KLUD 1WD1A 2PVGB 5GAN7 1E1OA 2AHOB 2EQUA 3D6WA 4YHHL 1D5ZC 3VR5A 4WFN3 3C46A 2MNAA 4DQ2A 1Y1WH 4DR7L 1VQ9T 2FVUA 1IYUA 1RAIB 4PJOD 4UPAA 3U50C 2DN8A 1C8CA 1QZGA 1GBRA 3QR8A 1VQLT 3REAB 4HJ7A 3HG9A 1V9PA 4ODGA 1LCKA 4C8QF 1ESFA 1W6JA 3G7ZA 2RPNA 4M78B 2KCMA 4GKJQ 4HAEA 1MHNA 2E5LL 2HAXA 3C0CA 4F14A 1TWGH 2CGHA 3GLXA 3H8ZA 3H91A 4B6MA 1DYQA 5FKAC 3NMZC 1ILQA 4DF7A 3I4MH 1EFID 2AIRB 1AEYA 1KABA 3MP6A 1TU2B 4JJBA 2UXCL 1U8RA 1H9KA 2ZPGB 3CCJA 2KHSA 4ANJA 4DV5Q 4FXGC 1GXDC 2QCPX 2LMCB 1PRTD 3H0HA 5EAYA 1R0CB 1X75C 2O88A 2Y0SG 3K8AA 2O2OA 4LDYA 5C0XJ 4HIMA 2UU9L 1CQVA 1IHWA 2RF4A 4Y92A 3OIQA 2H4OA 2HKNA 1MNEA 2DTOA 2LQNA 1PFSA 5KEEA 5KNCA 2JA5B 3ZJYC 1QP3A 3FPUB 4LF4L 3I2ZA 4DV7L 2NUTA 1EQRA 2P0PA 3SEMA 1SJED 2GVAA 2EGCA 3T1HQ 2Z6KA 3PO3H 2EPDA 1E24A 1B7TA 5ELFA 1WTPA 3QZ5B 1LO5D 3GV3A 1B07A 4N8FA 1YJWQ 1H8KA 4RTWA 4E2FB 4OWWB 1OZ2A 3GD7A 3Q8DA 4APVA 1N9SA 5IHKA 3VYHB 4DXGA 4ZUIA 3CCMT 3JCMX 1K4US 3G71A 1K3RA 3M4PA 3D6CA 1TS3A 4JI5Q 2F0NA 5LJ5j 3CCQA 4RTXA 5LJ5g 5CGKA 4J9IA 2K05A 5KIXA 3M0PA 3J81L 2H5XA 3PO2G 3VR2A 1H9JA 1M4ZA 3AYHB 1B3AA 2EAYA 3W2DA 1ZBJA 2COYA 4DR4Q 2E12A 2YSQA 4L5GA 1X65A 2D9UA 2GVBA 1J8IA 4BBSB 2XRQD 4L5TA 2AK5A 1AWOA 5DY9A 1EWIA 2WIIB 3G1JA 5CV6A 4PG3A 4TRDA 1JORA 1JXOA 1MGQA 2QQAA 4A54A 1OXVA 3HOVH 3QOJA 2E41A 3MHBA 4GNXB 3HHTB 4KI0A 5GAN8 3VKIA 1MMDA 1TOVA 1CZGA 2LSSA 2N88A 1ZBXA 3CQZB 2IY5B 4UY8C 3GBQA 4KH1B 1GL5A 2JQOA 4DUYL 1RADB 5KNBA 3F8TA 1Q81C 1EY5A 1V43A 2NN6H 1NYGA 4LUEA 2OI3A 4PJOF 3RKXA 1O7ZA 1VQOT 1U5KA 2G3RA 3C1EA 3GTJB 2JA6H 1CKNA 1HH2P 1YITT 2F4IA 1I5FA 2BUDA 5BR8L 2P4TA 3QSUA 2Q8IB 2ZTCA 4J8QA 4A3CG 4Y28E 3CMEA 1U06A 3U58A 4J8OA 3PF5A 2COWA 4N9PA 3GTLB 5K36H 4ID6A 2O9SA 3H3VH 3DWPA 4DAYA 2KT1A 1G91A 1BBXC 3L2WA 3CPWP 2FJ2A 2RD1A 3A8JE 3QO2A 2KEEA 3KF8B 1NR2A 1WQ7A 1ONLA 3T4AC 3KF8A 3CMAT 3TREA 1QVFA 3SR1A 3V2TA 2IG0A 3A8LB 3EAEA 3BJUA 3P8HA 2L11A 1E0BA 4FF1A 1B70B 1QQJA 2Y4XA 3EA6A 4LNPA 2ZJQA 2L5QA 4LF6L 3X20B 5KH6A 3CRKC 1Q82C 3CEYA 1PRTF 2E74C 2EY5A 3QOLA 5M5XB 4B3TL 1LTRD 5CMDA 5EKIA 1N9RA 2RCNA 3OS5A 4LUOA 5D3IB 5KYLA 1Q7YR 4WORA 4GKKL 3V05A 1PH5A 2KAFA 1CKAA 4A3LH 5M9OA 4AQYL 1SMXA 4POFA 2AHJB 4QIWB 2F03A 2R93B 1WCMH 3CP0A 1WDXA 1EZ8A 5IWAQ 1GRIA 2FYKA 4QKUA 3U9SA 2VV5A 1TUDA 4A3FH 3VUZA 1DD2A 2UUAL 4PJOG 1VYTA 1IBLQ 2GA4B 1K8OA 1R4PB 3MZ5A 1CTMA 1SFOH 1OQKA 4XQJA 1I5OB 4HIKA 3J81i 1Z9QA 2EY6A 2FPDA 1XX8A 4QIWE 1N36Q 1K8AU 2K57A 1X6GA 4PNYA 3H41A 2I0NA 2K2MA 4KHZA 3F2CA 2R7ZG 1W6KA 5M3MB 3T1YL 1WTWA 3GPLA 3VS5A 2WACA 4C5GA 3R93A 1HNZQ 2Y0SE 2A69D 3M3YB 1KQSA 4OB1B 2FPFA 3K7AB 5H1SE 2RQRA 4A4FA 5D3DA 2A6EC 1HSQA 1S1NA 4IFDG 2RB6A 3I5RA 4XTVA 1XNQQ 4RGTA 1R9TH 2JEBI 2I0QA 4R55A 1L1OB 3S16H 1ENAA 4U68A 1L1OA 4C8QB 1X54A 5IYCG 2VUBA 2B2VA 3REBB 1KDAA 2X3XD 3HPWA 2K6AA 1KL9A 1YVCA 4XT1B 3J80c 3JCMV 1V8QA 4X9CA 2OCEA 3A8MB 4DK0A 4B3SL 4IUPA 3PO2B 1WXBA 2RH2A 4DBHA 4NDXA 3SGIA 3HOYG 3U9OA 3M0QA 1SLJA 1OPLA 3GTKB 3PVQA 5KYUB 1QKXA 4XAXB 4BS9A 5NUCA 1SYCA 1G3SA 4PK4A 4BDYA 4BE2A 1MSGA 2F52A 3K59A 4LFBQ 4MMLA 2VC8A 3SD4A 3RMSA 3JC66 1RDPD 2DL4A 3BDOA 3VRZA 2HIVA 1NEBA 4JI7L 5C5MA 3MAQA 3S2HB 2YLBA 2BE5C 3S24A 3OYLA 2B29A 3M53A 3M7NA 1T9HA 2E2HB 3D4WA 1S5CD 5CO7A 4CDCC 3V8KA 2DL5A 4M7DC 2D9TA 2MAMA 2Z6BA 1C0MA 1YJNQ 3FMCA 2MMPA 1T5EA 3TP6A 4A3CH 2VS1A 1YHQT 2WFWA 1R0BG 3CC4A 2D8HA 2KECA 1ZA2B 2MGSA 5JJZA 5J3BA 1PZID 1AEXA 2MK5A 1HRJA 4L63B 1E7ZA 4F7XA 4IFDI 1VQCA 2HD3A 2LZ6B 5IXFA 3PTAA 5M5WB 2CZ0B 4HA8A 2CT3A 1FGBD 3EQLC 7AT1B 3CU7A 3KJPA 2CWAA 2HSEB 1Y07A 1KIXA 2MWOA 4OEMB 5C0XH 1TXQA 3N52A 1PG5B 1TIID 2J4XA 3M4QA 4DV6Q 2L89A 1WIEA 8AT1B 2EGEA 4DBRA 1STYA 1GBQA 1AZQA 3ULRB 4EQNA 2DRKA 1DJRD 1NEGA 3QYGB 3NHHA 5JJLA 3C4SA 4A3EH 3HOUG 1N32L 2NTTA 2O5JC 3C1FA 4NW2A 2O4XB 1HD3A 4IUQA 3KLSX 2X9HA 1VDZA 1V1CA 4BI4A 2I2LA 1PFMA 3GNFB 1AWXA 4GY5A 2F0JA 4LK1C 5IN1A 5EJWA 2IX1A 2EYPA 1OULA 4A3BB 4D6WA 4PJOB 2V26A 4DV2L 4JLIA 3OYYA 3AHUA 5GAN5 5GANj 2XGTA 2HCKA 5GANg 1PV4A 4FF4A 4J9CA 4LDVA 4LDXA 4DV4Q 1SKUB 3H6ZA 3NTKA 4QQDA 1SNCA 1QVPA 4PJOE 1UUPA 1NAPA 1KLGD 1O7IA 1TWFH 3W5OA 4CGYB 1UFFA 2DPPB 1WPYA 2VXEA 3GV6A 3GP8A 4JI4L 3M0UA 2F5KA 2Z0SA 2NLUA 1HTLD 5I22A 1M1KR 4Y91A 4DUZL 2RHIA 2X69A 3IL8A 1K73C 2SOBA 1PH6A 2JK8A 3WOFA 3PNWC 2A68D 2NZOA 3BVZA 3NENA 3I70A 3A8GB 3UE1A 1U1TA 1JE4A 3CRLC 5CKEA 4A3IG 2PMZE 4K6DA 4IOCA 1YNJC 1PRTB 1V76A 3A1PA 2OTJT 1KAAA 1ZYRC 4FYYB 4MMKA 4C0GA 5GAMj 2F0PA 5T1IA 3J81c 5FLMG 3HKZG 4IJLA 2DXCA 3N6RA 2XDPA 2ES2A 3HOYB 3ZBDA 4C2MB 5CV8A 4A3GH 5IT9L 4OMOA 2M51A 3L2UA 1TWCB 2LFNA 1VQ6Q 5IODA 4HXJA 4DNTB 3S1NB 4A3JB 1VYVA 4RGNA 1UECA 1B4OA 4L6V5 3URGA 1RODA 2RSOA 1YIJA 2VZAA 1JJ2A 1WD0A 1IBML 3PUZA 3HKSA 1M3AA 4A3DH 1TH7A 3EG2A 1O7LA 1UE9A 3P7JA 3SWNA 2EJFC 4XK8E 3OSOA 1WHHA 1WHMA 3MXNB 4DKAC 2E2JB 3AB9A 3J7AV 1H9MA 4OMPA 2VUMB 2SEBD 1KQSP 4HJ9A 3RLNA 1HXDA 3A5ZB 4DOWA 3S15H 4LDWA 3FKIB 2YUOA 1YITQ 4H7BA 5C4ZA 3JCMJ 1PLFA 3MC0B 2LQ8A 2LQKA 4DR7Q 1BXTA 1IYVA 3WOEA 1XTCD 1IL2A 5CKFA 2XWBB 1IKMA 3ERQA 2JNGA 3OYAA 2MUYA 2JA5H 5GAOm 4X3TA 1DXMA 3M58A 5LJ3d 2EJGC 1XPUA 2KHIA 4OGQC 1QG7A 3LGJA 1EY4A 1G2TA 2LNHB 3B6YA 2PO4A 1BK2A 2E5LQ 1TY2A 2BIVA 3SK8A 4FO2A 1K8AC 1WQWA 2L4NA 3T16A 3UE0A 2JP1A 4FYVB 3QDFA 4PJLA 1IW7C 1S5ED 2EYFA 2X51A 2UXCQ 1LVKA 2D1XA 1TWHB 3HOXH 5IT9E 4DV5L 3T51B 1GVPA 1HTPA 1NPRA 2QA4T 4ZN1A 4A4GA 2EYOA 2EPBA 3S1QB 1RAFB 5D6WA 1ZUUA 2HL3A 1QVGA 3GDEA 1I50H 5BN3A 1SHGA 2DEQA 2DFUA 2CKZB 4AG1C 1Y1WB 1GCQC 3DHQA 2B8AA 1U4MA 2UU9Q 2IL8A 2HQEA 1OXSC 4RG1A 4ELZC 5LMNW 4PJMA 4RA8A 2JZ2A 5C4HA 2DF6A 2M16A 1KC8C 4IFDJ 2Z8LA 1WYDA 4YCWA 4HIOA 2I46A 1NMFA 5ELCA 4KGZB 4FW2A 1X55A 3CQZH 1Q1BA 5KCOA 4N0AA 1STAA 1TWGB 3CXCS 4NB3A 4A4KA 2QEJC 3FLGA 3HRUA 2DXTA 2A6HC 5ELEA 4CDFC 1SSHA 5JAVA 3GTJH 3G6ET 1SYFA 2E6NA 2GQIA 1TY0A 2Z9HA 4E7HA 2EVBA 2YT6A 2DYIA 5CV5A 3JCMP 2F1MA 4R4CA 3CBOA 4XU2A 4XYQA 4OB0B 5C6AA 2KBTA 4V2SA 3LYIA 2XIWA 4DR4L 1OOTA 4OONA 1EY6A 3KLRA 5FO8B 1B34B 5DM63 3X3NA 2K3XA 1SR3A 3OYDA 1TR5A 1B34A 1M8MA 2JOYA 2EJFA 4BY1G 1EWHA 3HKZB 2CP0A 1KD1U 4AFSC 1TS4A 3JCMc 3ULJA 3H3VI 1QE6A 2Q8TA 1JMCA 4R8NA 4KH0B 1QNKA 2Z4IA 1F9QA 1PHJA 3PO3B 1ENFA 1VQPQ 4BD3A 4FCYA 4RG8A 3HKZE 1JWMD 3S9WA 3E5SA 1K83H 1VQDA 4PV1C 3WVEB 4ZN3A 1Y57A 4DUYQ 1ZUYA 5CBAE 2NWGA 3JAMi 4QW2A 1G8ZD 2PZUA 2EJGA 2V1QA 1EY0A 1LT3D 1GHJA 4JRPA 3I91A 1XJVA 2G9DA 1YJWA 4M7AF 2HIXA 2PZTA 3IFTA 2RJCA 5I9OA 3PMFA 1SEMA 5BR8Q 1QMCA 1G83A 2VASA 3F70A 4M75F 3TP7A 1MV3A 4J5YA 3A55A 3EFXD 2KCCA 2AKWB 1SDFA 4PMWA 5L37A 2A7YA 1XYIA 2YWWA 1YHQQ 1WGSA 1E7OA 1Q3LA 5CCAA 2PNHA 4FT2A 3TSZA 2HUGA 5J26A 5GADC 1UNSA 2J06A 4GLAC 3HOVB 4A3MG 4JG2A 2CUBA 1YI2Q 4GN4B 3QPHA 2XD0A 1NE3A 3M3YH 4LF6Q 4EMHA 1GCQA 4RMFA 1D8LA 4RHRA 4B3TQ 3FB9A 2JUFA 5LMNQ 1I4RA 3E9FA 1ZUKA 2O31A 2EJMA 1YJ9A 1YEZA 4MNOA 2BH8A 2JA6B 4FYWB 2DO3A 4GKKQ 2RHSB 2HKQB 1K9AA 2O9VA 3MEVA 1IB8A 1SSFA 3VV0A 4ATOA 1D5XC 2K5IA 1ZX6A 3JB9J 2UUBL 1JJ2P 4N4GA 4RG2A 1BCPC 2FMCA 1YHBA 5FOBB 2X4XA 3GQBA 1PH4A 1IBLL 1VQMQ 3NXWA 2YRDA 1BO0A 5I4DA 2UUAQ 5IH2A 5IHNA 1SEBD 3OBWA 2MI6A 2E1HA 2HD0A 2EKHA 2L8DA 2KSSA 5FLXE 2L0CA 2CZ1B 4FXDA 1F2MA 1M3BA 3NTHA 1EIYB 3D8GA 2B2UC 4Z02A 2R61A 1HNZL 5C0XG 3OSSC 3T1YQ 4FIBA 3PE0A 5A2QE 1Y96B 4C3JG 1PYWD 1SYGA 5ELDA 2R5AA 1ZLMA 2OF1A 3RBBB 5EBDA 4R8IA 4DA2A 2E4HA 4FXKC 1ZQ1A 4S3SA 2EYWA 3V7SA 2TSSA 2OJ2A 1DZ1A 2CHBD 3F2BA 3Q22A 4HSVA 2EJ9A 2GNCA 2DUDA 4LF7Q 5LJ5f 1WCMB 1Q86R 1X3FA 1LOJA 2OQKA 2BA1A 2PW5A 4P73A 3A5UA 1FWZA 2K5NA 4I7AA 3CD6Q 3PF4A 4J9BA 4A3FB 4BY7G 2RJDA 4K0KL 1NYFA 2UUCL 3NBHA 4HR7B 1PRLC 2WSCE 1SFOB 4N8X1 4XU1A 2KXCA 4YTLA 5GMKj 2OTJQ 2E70A 3FDRA 1J3TA 1S5DD 3SDZA 4LFBL 5CV9A 3SFMA 2R7ZB 3LNNA 5IT9c 2KGTA 2K4YA 3D0FA 3MXGA 4EQ5A 5LJ3e 4LNQA 2BZYA 2LCSA 1N8RU 4IN3A 4RTZA 5GAOq 1P92A 3K5OA 2JW4A 2PUKB 4OGEA 3GOXA 1Y1VG 3ND8A 2CZ7B 3HSBA 4KHVA 4OL7A 5C44G 1X3PA 1FMVA 3A7LA 5FU6B 3CHBD 1Y69U 4CDDC 2EFIA 1JE5A 3IQLA 1R9TB 1I94Q 1N5ZA 1KK7A 3S16B 1Y8OB 2DBMA 5C0XI 4G57A 2OEOA 2DL8A 3S1RH 4BACA 3QBYA 2E2IH 3ME9A 3VDYA 1WJRA 3M85A 1WYXA 3CCLQ 1A8VA 4GS3A 1PRMC 5CAIA 4JLGA 1IREB 4ALPA 2D0OA 4F7UG 1Q81U 2HEQA 4KY7A 3KFVA 1Z9ZA 3PGZA 2A0FB 2CW0D 1GUOA 2LKVA 4J6XA 3K7UC 3EG9B 3EGDB 3CCRQ 2R7ZH 2EYYA 1VQ7A 2Z4HA 2K14A 2EQIA 4M77C 3AQQA 4UAIA 5L23A 4A3MB 2TMPA 2WB1B 2K01A 2F0OA 4DNRB 1SAPA 3I5SA 4CJ2C 3RN2A 1E3PA 2GF7A 3NEMA 1FD7D 1CI3M 2FFKB 2YTXA 1AT1B 1I6VC 4ZTFA 1E22A 1Y8PB 5BN4A 4IFDH 3SVMA 4JI0Q 1N32Q 5EGTA 3BS1A 1WNLA 1PSFA 2J6KA 4IZ8A 2XICA 1PSEA 5IYCH 5EQ0A 1WXTA 5FROA 1HYOA 4ZGJB 1LLRD 1RLQC 1YJNA 2FMMA 1OEBA 2HQXA 1WHLA 4E7KA 5FWCA 2QA4Q 1Q82U 1OO9B 1PXUA 1XMOL 2X35A 2DERA 4UP7A 2RN8A 4YIJA 1GM5A 2K7VA 4DV2Q 3NFCA 4L59A 4BY6B 5CVIA 3QJYA 1TWCH 3NK9A 4X34A 1F9SA 3DEPA 3K57A 3S1NH 4DV4L 1EYDA 4N9TA 5LJ3h 2QQBA 4Z89A 1ZSZA 2K28A 3KBXA 2J6FA 4P71A 1A15A 2JN4A 1QCOA 4C3JB 4JI4Q 5IIFA 2XG8D 1GJXA 1EUJA 1N27A 2RQVA 3WXMB 4E7ZA 3CPWA 3HOXG 5IOCA 4LUVA 4V190 4M78C 4X3SA 4ZLTF 1F9RA 3MXUA 2JMAA 2MPXC 1I0CA 1A2TA 1M8VA 1VQIA 4HTHA 3G6EQ 3QHSA 1FJGQ 3TMEA 3JV3A 1Z7TA 3I55T 3G6JB 5I2MA 4EQPA 4ZK9B 5KNDA 1KJWA 4RCCA 3HOWG 1X9NA 1MUZA 4QL5A 2NTSA 3FDTA 2DETA 4BY7B 4JYAL 1STBA 1T3LA 2K7AA 3X28B 4P74A 2CQAA 2F2XA 3META 1WHKA 1GUSA 4IALA 3A98A 1HA5A 4JK1C 4OB2B 3FVQA 1RAHB 2J6OA 5DLQE 4EQOA 4CJ0B 2ROTA 4GOPC 1MGSA 3GO5A 1NLPC 3S1MH 1TWFB 1EIGA 3HOZG 1AWWA 3E6ZX 5IGDA 4I7ZC 5D65A 3V96A 1KDCA 4QQBX 3S17B 4P2CB 4YY3Q 2ZPHB 1NZ9A 2QQRA 1GD7A 2K52A 3OYGA 3V8LA 2R92H 3HOUH 1X2QA 4GN3B 2QK0A 4JI1Q 4GN5A 2L3PA 1K0SA 1CZWA 1KTKA 1E6GA 2L15A 3FRNA 2JS0A 3JCMe 1K3BC 2YHTA 1S4ZA 4HCEA 3E9HA 1VQFA 3MVVA 3JB9H 2RF0A 4RCBA 2H3EB 3VYTA 2EQSA 2AZSA 2K33A 4MTKA 2VGNA 1BBZA 4OGCA 2EOTA 2AQ1B 4B08A 4A3GB 1A62A 4F7UA 4J7IA 3J80E 4MN3A 1RL2A 2OWOA 4LF5Q 1N6AA 2K2VA 1QILA 1BUVT 4XTCS 4ZCKA 3CCUQ 3AMUA 1VQ6A 4AYBG 2E10A 2PVOB 1VMCA 3PUXA 4UP8A 2L12A 2RHUA 3NQIA 4NXMQ 4A3DB 1O80A 4F7UE 1HR0W 2HDMA 4FSXA 2N3SA 4GNXC 3S2DH 5AYFA 1L0WA 4NS5A 4JI2Q 2PUOB 2VVKA 3THKA 4QT7A 1O75A 4LWCA 4XTWA 1KDBA 1IGUA 2I5LX 3HGBA 4A3IH 2HHHQ 3S15B 4EIKA 1SNDA 2WINB 2DL3A 1ZEQX 4J83A 2QF7A 4JUVA 4X65Q 3OWEB 5FLMH 1G3TA 3RKWA 1E1TA 2E75C 1PTOC 4YWLA 1AW7A 1YITA 1NJIC 2XSCA 2RI5A 2LXJA 2YLCA 3K5NA 5FU7B 1S40A 1OI1A 2NUTB 4R1JA 4KMUC 1HQRD 2B3GA 1Q8KA 5GAEC 3WVDB 5GANf 2B2TA 4OWTB 3H15A 2R7DA 4ZRZA 3MHXA 1HNXQ 2PU9B 3PCOB 1X01A 2NZHA 2OX7A 3EN2A 4Y52H 4JS4A 1JEGA 2LJ3A 1X27A 2H8HA 1HNWL 1NBWA 1C48A 3NBIA 2RSNA 3DM3A 4ZTJA 3GTGH 3I4NG 3DM1A 4OP0A 2J7IA 2CP7A 1N8RC 2NWMA 2K5DA 3G48A 1P16A 3HOXB 1ML0D 4HCZA 1LT6D 1U9RA 2FZKB 3UT1A 3CBPA 2A1AA 2F0FA 2GCXA 5GJWB 4AMCA 2EDGA 3F2DA 5GAMf 1KIKA 2FZGB 2ZJPA 1I50B 5EKKA 1UGRB 1VQKT 3C2PA 3L7ZC 4ZGEB 5KGUA 4PLIA 1I4QA 5HGTA 1FYCA 4YWMA 1XWEA 2EYQA 2HL5C 2RDHA 5IHIA 2CH4A 1K73U 5T1GA 3SK5A 4DFAA 2A8VA 4JC0A 3E9GA 3ZL7C 1M9SA 4X6AH 1V1QA 1IO6A 1D0XA 2XRSD 4HEDA 3PIPA 1Q82R 1VQNA 2SNSA 1IL8A 3SB2A 4OWXB 4KKUA 1OPKA 1Z9FA 4FVMA 4CKBA 4CKCA 4J9DA 5C4JH 4R0KA 1CKNB 1OZ3A 3M4OH 3QJ6A 4N4IA 3PIP3 1AP0A 1GUWA 1OU8A 2RJEA 4WTOB 5GMKi 1HJPA 3G4SQ 3TQYA 3M4YA 2IW3A 1BDOA 1SPKA 4DAYB 3V7RA 4KKTA 3A8OB 2EWNA 3ZEHA 4AFQC 4D8KA 1HR0Q 5JJKA 1VQBA 4IPGA 1YNZA 4J9FA 1TSFA 1UGSB 1E2ZA 2B2WC 4C8QC 4F17A 1M3CA 2JJQA 3VS0A 2BH2A 1JU5C 3PV0A 3JB9D 1YNJD 1Z47A 1W2BP 2V8JA 2BDNA 1ZXTA 2K75A 3RNUA 5EKLA 5FWBA 2JTFA 3J81E 2NBFA 2JTMA 2SEMA 5LMNL 2B8GA 1FMWA 4R56A 1W70A 3S6WA 1K83B 2B2YC 2RKSA 1UDLA 3VS4A 3BYYB 1VQ5T 1VQPA 1KHCA 1QVFS 4O0AA 4X3UA 1SRLA 1U1SA 4ZKBB 1W6XA 1FNWA 3L2QA 4ILWA 4J6HA 4ABNA 5HKCA 2UUBQ 4JZ3A 4HJ5A 1U0LA 1XMQQ 1UWVA 4AYBE 1GUGA 2ZCFB 2R5MA 2CYZB 2OTLT 3K0XA 3RIRA 4R4QA 2F0MA 2LMJA 2SRCA 1NNXA 3CCQT 1PWTA 1RTNA 2Y0SB 4K11A 1EQQA 1AH9A 1D1AA 1W4SA 3HRTA 3L3OC 4F88A 2GTOA 4BY1H 1FMKA 4DR2L 2EYLA 1YHQA 2DJZA 1VQGA 4QB4A 2MWPA 3RNJA 4DR5Q 2Y90A 1HZCA 3W3AA 2DRMA 1UE5A 2BOSA 1TS9A 2DD5A 4KKSA 1PD1A 1RAEB 2F3IA 3N5BB 3X26B 1K9MC 1BBUA 1QWYA 1YI2A 1OV3A 4QGUA 3L2VA 4QY7A 2C0OA 2PI2A 4H13C 1ICFB 1O78A 4H0LC 2B63H 5I2SA 4QF4A 3E0EA 3DXJC 3HRZC 5E4XA 3R8BA 5FJ8G 4LF7L 2KCTA 3I4NB 4BBRG 5J1ZA 1PH2A 4DV3L 2ATWA 2MCNA 3E19A 4M7DG 1KC8U 1WJSA 2PI2E 5DEHA 1EU3A 2VW9A 1SG5A 1KQSS 4K0KQ 4R4OA 2D6FA 3I56Q 2UUCQ 1CSPA 4DGZA 4WJ3M 1GUNA 1S72T 1VQMA 3DWAA 4JI3L 4HJAA 3KDFB 3MP8A 3TP5A 1UHFA 1XNRQ 4P5NA 3KDFA 1HFGA 3URYA 1O7YA 4CRIA 4II1A 2KBNA 8ATCB 2RHZA 1OX9A 5ISRA 4A3MH 5KYXA 4LF8Q 1TQOA 2EIFA 2KR3A 1U5SA 4IIMA 1TS5A 3OYNA 1BI2A 1JICA 1RACB 5HY6A 3F1ZA 1LT4D 4J1MA 5JJIA 1IHVA 1I94L 5A0DA 4QVCA 1YN8A 2ZTEA 1D09B 2NVXH 3JB9F 1STHA 2AUJD 4XQQA 5AJ3L 4DV1L 3J7AF 2KUMA 3PMIA 1SE3A 3VYSA 3M9QA 1AVZC 3TEEA 2XNAC 4FYXB 3L2RA 4X9DA 4FDBA 1WI5A 4RCNA 2KEAA 2I5HA 4FF2A 1EY8A 4PJNA 1V1OA 2D8JA 2HCIA 4RKBA 1PH8A 3CD6A 3C3LA 4OELB 1WTRA 5C3WA 3GIBA 5GMKl 4IPHA 3QB3A 3K6OA 1CA6A 1JQQA 1VQ9Q 2ENMA 1EOVA 1DONA 2HBWA 3OHXC 3M57A 2OTJA 1VQLQ 1PYSB 4RHSA 3RZDH 2KYMA 3QWXX 4NL3A 2XIDA 2RCFA 3LLRA 2CCZA 2QXFA 1BCMA 4C3JH 3NELA 2G9HD 1HHVA 1E2VA 3JSCA 3OW7A 4JI0L 2JA8H 4KULA 3VS3A 2R92G 5E4WC 4OB3B 3AFPA 2VNUD 2DIGA 1MSHA 2L3QA 2NVTH 2FL7A 4AFUC 2A37A 1BB9A 3S1RB 2E2IB 5F2DA 1VQ8T 2EGAA 3PFSA 4FT4A 1W1FA 4ME7A 3HEJA 2IWHA 4K8IA 2M0OA 4BY7H 2F0VA 2JSOA 1Q95G 3JB9G 2OT2A 1XMOQ 2QTXA 2EE1A 3SHLA 3OMCA 4LD9K 1SYBA 1VQ4T 4QJFA 2RBMA 4C92C 3CCLA 3KOJA 4JVZA 1A3TA 2W10A 4XTYA 2ZXRA 1YWPA 4Z9CB 4ZQ3A 2K5LA 5CV4A 3EJIA 3OYHA 4DA4A 2K03A 3ER0A 2PMZB 3CCRA 1G51A 2QG9B 1L0XB 4RGMA 2XK0A 4WJ4A 4L8JA 3MA2B 4DK3C 1Y1VH 2LVMA 3CCST 1NY4A 5HK3A 2MOXA 2Q2UA 3S17H 1SYDA 5C44H 2FRYA 2XI9A 1UEBA 1X69A 4LFAL 4KT0E 1RHPA 1IKLA 1NM7A 1VOMA 5GAN4 2AWOA 4IO9A 3HFNA 1V29B 1FJGL 4P75A 3STBC 3CCMQ 3QWNA 3WDNA 5IP9G 2LJ0A 1LM0A 3VA5A 4DR6L 4M7DA 4JPBW 1WX6A 1M30A 2YRCA 3M7GA 2DX1A 1D7QA 4JYAQ 4E47A 1JBMA 2IIMA 4BUGA 3S3MA 2DZCA 2IHEA 4MTNA 3KK7A 2A5HA 2QA4A 4KY6A 2DJFC 1VQKQ 2WV6D 4YCVA 1IZ6A 4C3IG 3GTQH 3BE3A 4M7DE 3FC3A 1YBYA 1RTOA 5C5LA 1KAWA 4CJ1B 3OYJA 2SNMA 1OXTA 3MFYA 3JB9I 3ULPA 4IPDA 3SWNB 1K8AR 4KRTA 1D3BA 4YY3L 1HA6A 1E6HA 1QCBD 2DNCA 5A35A 1UUEA 2QEXT 1BU1A 2XWJB 1B9NA 2LT1A 5AT1B 1D1KA 1VQOQ 1PH7A 4JI1L 2A73B 2KI7A 4PNOA 1ZKOA 4K5VA 2CUDA 4Z8AA 1X32A 1FX7A 3OWFA 1BIBA 3CCVT 4OX9L 3S14H 4LD6A 2AMCB 3OQ5A 3G6EA 1X43A 1YHAA 4KTAA 4O2DA 1WLPB 5IYBG 1IHZA 4PFZA 1MKHA 2YXYA 1M1KC 2RDFA 4LF5L 4KGVB 5JEAG 5DNFA 3M0RA 1EQVA 3TCJA 1SE8A 3Q0AA 3CMAQ 3OB9A 2Z0WA 3QKJA 1TXYA 3EH2A 2K4KA 3JAML 2XMFA 1T3SA 1SMYD 3QIIA 3S1MB 4NXML 2DK3A 1ABOA 2PZWA 1UE1A 4J15A 5CK9A 2QDYB 4C92A 1PCXA 9ATCB 5I21A 5I6WA 4JI2L 1EEFD 3NHNA 3RD4A 3HOUB 2R92B 3I3CA 4K2LA 1VQ5Q 2LX9A 3VU3C 2HHHL 4JBJA 3EIVA 1Y14B 1MJEA 2PQWA 2FB7A 1LT5D 4X65L 3P8DA 2ZTDA 1C7YA 3EFOA 2KRNA 3LGLA 3U4ZA 3HOWH 4PQXA 1RUWA 5HCKA 1CT1D 2VQEQ 3BDLA 2B39A 1C4QA 4CKEA 4O42A 4UDUC 2OTLQ 2MO1A 3FP9A 2VB6A 1A3UA 5M3FG 1QWEA 3SK6A 2HMAA 2NUPA 4PLLA 2L55A 1HNXL 5EPJA 1FVIA 2F0UA 3A0JA 1WA7A 2D5DA 1QVGS 1PMRA 2JJ9A 5E3FA 4B9WA 3SXHA 3HOZH 2JMCA 4JJDA 1HZBA 1PH1A 4JS5A 4XTZA 1C0AA 1HNWQ 2NYSA 3CCUA 4TVAB 3S2DB 1WJJA 3I90A 4KJOA 4M77D 1JJCB 1WTHA 2KE9A 1F2YA 2O2LD 4LDUA 1EYGA 3JAME 4XIGS 4A3IB 1UGQB 2L3RA 4IIOA 1LTID 3NPPA 1MNDA 1UE6A 3K81C 5LHY1 1KQ1A 2RNAA 3ULLA 3D3RA 2K9GA 2PVDB 3IRBA 2QAZA 3QYHB 2FRWA 4Q5WA 2MHVA 2ZM6L 2KVMA 3HTRA 4EMKC 1JOQA 4WRDA 2YUPA 5C6SA 3EGXB 3INZA 2XVSA 5JVH3 3D31A 1BF4A 1I3QH 3H3VC 3EGXA 1H95A 1S72Q 2QDBA 4Q0FA 1PTOH 3K5MA 2X4YA 4J6WA 1CHPD 2LTOA 1YNND 2B63G 3KLSA 1Q1EA 1UAPA 3NWSA 3IAYA 3GTMH 3AEVA 3GTGB 2GGRA 4KK7A 2EBPA 1HCZA 2CWPA 2D2CC 3U4VA 3TZDA 3E3XA 1MMAA 2A08A 2LP5A 2CZ6B 1HR0L 3ZFJA 4A3KG 2WP8J 1SXTA 4D8DA 2NVYH 3P75A 2M02A 4PZ8A 3EGUA 5GAOn 2EQJA 4LXCA 3D4RA 1JWUD 2DVJA 4AG2C 5IYDH 2LS01 2FHTA 5KYWA 3CC7T 2DE0X 2K3YA 4JZ4A 2X6LA 4DNIA 5LMUQ 1SF9A 1STNA 2JEAI 1C1AA 5JPNC 5C4JB 1EIHA 4RUGA 3BDUA 1NR4A 2KEDA 3M4OB 4F8MA 4N4HA 4LE9A 3OYMA 3I4NH 1U4RA 3I9QA 1STEA 1XMQL 3S3NA 1G3YA 2QYZA 1SRMA 3TBIB 2DILA 3JCMd 1JRIA 5FU6C 1M90C 4A4EA 1BCOA 3G4SA 2DXBA 4RTTA 2R7FA 2A68C 2ZXPA 2EXZA 4PFPA 1S5BD 5CKBA 2DXUA 1QP2A 3E1SA 5GAN3 4J9EA 1VQ8Q 2WKDA 2N78A 1OU9A 1WFQA 4DR2Q 2JN0A 2K5FA 1H9SA 2LCCA 1ZA1B 3I35A 4C5EA 2FINB 3G7LA 3EG0A 3EBEA 4HN7A 1CKBA 1X56A 4CC2A 4A53A 1VQ4Q 3M59A 2YU9H 4GLVB 2JA7H 3P20A 3I7FA 1H3HA 3RDVA 1Q12A 1BI0A 1NMGA 1PFNA 2BA0A 1I4K1 4A76A 3HP3A 2JA8G 4DEXA 5KYNA 1EYCA 5CBEE 1PDQA 3OSVA 3JRZA 4DAMA 1TKWB 4HVUA 3EH1A 3VYGA 1JB7A 2A36A 2P4RA 1VQJA 1NJIU 2F2VA 3I4OA 4F7UF 5K5PA 3CCSQ 4C1NI 2EYHA 1D0YA 5D14A 3MEAA 4DV3Q 1BI3A 3J7YW 3NBHB 2KNBB 4XDXA 5KE3A 4MDXA 2JM8A 5LJ5d 2EYJA 1X6OA 3UF4A 1YNXA 3BZCA 2JXMB 3E2UA 4K14A 1CKOA 2F0DA 2YDLA 4IKFA 1RAAB 4A63B 4JI3Q 4BY1B 1XNRL 1D1BA 3BFMA 1A2UA 3BVMA 3CCET 4C0FA 1NSNS 3I4MB 2PYKA 3RLOA 1I07A 4LF8L 1HXYD 1PTOD 4JOIC 5LL6S 1Y8NB 4H02A 4A75A 4M7AC 3AU7A 1DGSA 1PD0A 4M77G 1F9PA 4A93H 4M75C 1NLOC 5IGEA 2CDTA 2N49A 2H3JA 2Q2HA 2BZ8A 5AJ3Q 4DV1Q 2K3BA 2K5QA 1MHWC 1UHCA 4IUVA 4AIMA 1YJ9T 3NWTA 2HQHA 1NCVA 4JI8L 4DPGA 1H92A 2QEXQ 5JEAJ 2VXFA 1B9MA 4KV6A 2FXQA 4HVVA 1PH9A 2VL6A 2ICIA 4K8JA 5IGGA 1L0YB 1TUCA 1VF5C 2LY7A 3TS0A 3MPUB 4YCUA 3I56A 3CCVQ 1PVOA 4XU3A 2ZAEA 3A7AB 3EFRA 1NE8A 1UG1A 4J7FA 3JAMc 1Q86C 2F4VQ 3UI2A 2K5WA 2L1BA 1I81A 3VYRA 2EZVA 3NGPA 4DEYA 1WTXA 2B2UA 1M2VA 5IE8A 4LN2A 1KD1R 5IGBA 4AH6A 2NVXB 5LJ3j 1BR9A 3C94A 5LJ3g 1R4QB 4L5QA 3KFUA 2L2PA 5FJ8H 2PQAA 4PFOA 3KBGA 4BB7A 1LABA 1UE7A 1SNOA 4XU0A 4BBRH 2DA9A 3AFQA 3OMGA 3UDFA 3KYHC 2P0KA 5I2YA 3H9NA 5HK0A 2ZZDA 2PCFB 1A0IA 4X64Q 2F0GA 1OXXK 4X66L 1G6PA 1ZSZB 2E65A 4L6TB 3SHWA 4IUTA 3RZDB 2GFAA 3O8VA 1VQ9A 1AE2A 1Q8IA 4BXXH 5FK9C 2JT4A 2CP5A 5D6XA 1SHFA 4A4HA 4KHPQ 2RA2A 1VQLA 1N34L 1NBEB 1PHTA 3TDQA 1CUKA 3STBD 2KCNA 5FRMA 2JA8B 4LFAQ 2UXBQ 2XDBA 1KHIA 3RR5A 2NVTB 2Q2TA 1W2BA 2LC4A 5FO7B 4Q5VA 3CC2T 1PTOF 3CBMA 2JM9A 2KOLA 2M9VA 1QVCA 3H0FA 1SN8A 3UA6A 4DR6Q 3OYCA 4CHTB 4DN4M 1X3EA 3CPWS 5COYA 1K9MU 3CQTA 5GAHC 2LRQA 1SBBB 3VS7A 2EY2A 1FYNA 3LWUA 2AT1B 2JYOA 3OYIA 3DEOA 4ULLA 4LF9L 1NG2A 4E7SA 1JQYD 1TTHB 3LH0A 5FU7C 2ZPBB 2YUNA 1VQ7T 1MIUA 1VYUA 1Y1VB 2RJFA 2QILA 2Z6KC 1BVSA 1VF7A 4BBSG 5C44B 2I07B 4LAAA 2KA7A 4M77B 5CR3A 1R8OB 5M5YH 4M77A 3O13A 3Q1JA 2WSFE 3OS0A 4BI8B 1Q7YU 1DOLA 1ET9A 2A6ED 3Q24A 4O6JA 3OW2A 3KF6A 4B3RQ 3VRYA 4WCIA 3FEWX 4ME3A 4RCOA 2M1HA 2Q8RE 3IFDA 3OTOQ 4FSSA 1WXUA 1TT2A 4M77E 1RKNA 3NPFA 3RUZA 3UA7A 3CCMA 4OX9Q 4G4KA 3MJXA 2VB2X 1K8MA 4RGOS 4DAPA 4I65A 3BW1A 3SE0A 1NJIR 1HUMA 4F7UB 3GTQB 3MO8A 3MP1A 2M9UA 3HFOA 1G3WA 4RKLA 1F77A 3FRPB 3TVTA 4UP9A 2AUKA 1NPPA 1ACMB 4G7OC 2RQXA 1YWOA 5E7NA 4ORZA 1VQKA 4F16A 3CC7Q 2F69A 1XQHA 4JJCA 2WSEE 4NXNL 4EX5A 3GF5A 2E8GA 2XDDA 1JWSD 1KSWA 2ZXOA 5EBCA 3F2UA 2F2WA 1N8RR 4C0ZA 2BE5D 3W1GA 1DM0B 3FHWA 4R4TA 2K6DA 2K5HA 4BWGB 4M7DD 5BN5A 1AHJB 1VQOA 3I8ZA 3MTSA 4YWKA 5HURA 5IP9H 5LJ5e 2VQEL 5JVG3 2ATCB 2F3WA 5IYDG 3S14B 4M78A 1QW1A 3DKMA 1EFNA 2FO0A 1Y7XA 3OY9A 1UB4A 4KGXB 3NE5B 4RWSC 1BNZA 5FRNA 1MMGA 1RAGB 2JVVA 4XTXA 5KYYB 1UEAB 1EWCA 1ASZA 1EZZB 4JV5L 3FJ5A 5KYYA 2ED1A 2X3WD 5GAN6 2AQ3B 2R93G 4C3IH 4L5SA 3H0GH 3M0SA 4NKLA 4M78E 2DVEA 2KROA 3JCMg 5GANd 4MIUA 1YCYA 4POGA 4QVDA 4JBWA 3CMAA 4C1NK 2GQVA 1I8FA 1Q81R 3VUBA 2RK2A 1DOMA 4KJNA 2HQLA 3J80i 4O5VA 2MQHA 4GOPB 1HUNA 3QXEB 4GOPA 3UDGA 4Z88A 3P8BB 1LV9A 1RJTA 1WTVA 4QCLA 1ILPA 2LT4A 5M3MG 5GJVB 1I5LA 4FL6A 2D0QB 2X4WA 1VQ5A 1K0XA 2WKCA 2LCLA 3HOWB 3JCMh 2I5MX 1JOOA 1ZHIA 2C0TA 4C0DB 4E6RA 5GAMd 2D0PA 4KD4A 5KRUA 2ZM6Q 1RF2D 1U4PA 3NQTA 3QZ9B 1H9RA 2HDAA 5IYBH 1D0ZA 3NUCA 2ED0A 1JO8A 1F2ZA 1HK9A 1B53A 4XXEA 4C8QG 1WHJA 4AFZC 5JEAH 2K79A 2OTLA 2JA7G 1SYEA 5FW9A 5E1FA 3I73A 1LPLA 3BDCA 4GZYC 3CCEQ 2DAQA 3HFZB 1CA5A 2EYMA 2OAWA 3PIOA 2CW0C 4C92D 2E2DC 3HOZB 5CR2A 2EW3A 3MXNA 1Y0MA 5IGCA 4GLKA 1VQ6T 3PIO3 1NUCA 4CC7A 5DAUA 3VS1A 4JW0A 1M5Q1 3TSWA 1PM3A 4OMQA 1FXXA 2HSPA 3CCJT 2NUCA 2FG0A 5GAGC 4DR5L 2PZ1A 2MYSA 1EEID 1L1OC 1BQQT 2OAUA 4GNXA 1JOKA 5GMKm 3H94A 2B2VC 1YJ9Q 1VQEA 5LJ5h 1T5XD 4RH6A 3PVLA 5JPMC 1QCNA 1KFZA 1HFNA 1KG1A 4E7JA 3OYEA 1ZYRD 2DGYA 4OMLA 1ET6A 3K80C 4OHJA 5GQOA 2DZ9A 5JOBA 1I3QB 5LMUL 5M3FH 1G291 3A8HB 3UPUA 3HZXA 3ITPA 1RCVD 3PUWA 2XTIA 1PTOB 3OOCA 2VKNA 4GLXA 1AE3A 2AWNA 4CBVA 4M7DF 4IPCA 1S72A 4E6IA 4A93G 2RK1A 4AYBB 2IHFA 1C6VX 1HZ9A 4K2KA 1K9MR 3RLFA 1U4LA 1VA7A 1UTIA 2ALYB 3GNGA 2QW7A 2EQMA 4QQGA 1D5MC 1LTTD 1STGA 3A8KE 3GTMB 2ZGWA 3VJPA 1EY9A 1EL0A 1EIFA 4HCBA 3HS0C 1M1KU 4EDUA 3BZKA 2MJ8A 2XN9C 1FNVA 3MEHA 3QDRB 3GTPH 3GTOH 2CSQA 2RI2A 3G71T 2RMOA 2F0IA 2NVYB 3TRZA 2ENBA 3EVQA 1AOJA 3T9NA 4OIKA 3X3MA 4HVWA 1CKMA 4OO1G 1QLYA 1WOCA 3DMUA 3FJPA 4B3ML 2QDLA 4MZTA 1KRSA 3TS2A 1X2KA 3OW2P 4NPSA 3HRSA 1IRXA 4J6YA 3H09A 4XTUA 1N33L 5EC7A 1WJQA 3RR6A 1BBWA 3MEWA 4A3BG 1UJ0A 2XHCA 1JR0D 1I4XA 1VQAA 4JRQA 4M1UB 2JXBA 4IUUA 3TZUA 1TG0A 2FEIA 2QGFB 3M54A 1ICWA 1LUZA 4HCSA 4JI6L 1RLPC 1AZGB 4F04B 2AQ2B 3D4DA 1VQNT 3O5ZA 2F0SA 2VQFL 2IX0A 1KNEA 2CP6A 2KRMA 1IW7D 5CQYA 1ESRA 4A3KH 2KQ3A 2V1RA 2MF2A 4KN4C 2HT1A 1MMNA 3CMET 4HCCA 3KXTA 1LYLA 2JA9A 2NZ1D 2V4DA 4OIJA 3L2ZA 1A6XA 4C92F 1D1CA 3I55Q 4CC3A 1LACA 1M2OA 5IXBA 2IX3A 4DAVA 5KE2A 3CC2Q 5I2XA 2ZPEB 1Q7YC 3PUYA 4DK1A 4Y7NH 3OYBA 4GBQA 3J7A5 4VUBA 3K58A 5KYXB 1VQ8A 4FP5D 3QUIA 4V0BA 4BXXG 1EZ6A 4PJOC 1PZKD 5CKHA 2B2WA 5ELNA 2WAQG 4C8QA 1WI7A 1QNUA 2J7ZA 1LTBD 5EPLA 2YU9B 2JA7B 4M4ZA 4OO1I 1AWJA 2KVQG 1VQ4A 2D62A 4RTUA 1CHQD 2DEUA 1AZPA 1VMPA 5ELOA 4PKCC 4C8QE 4FNFA 3L2PA 4RFBA 1VQ7Q 4DR3L 2EVRA 2CQOA 1E2WA 4XQ3A 5KYUA 1VQPT 2LXKA 2N8NA 4NP5A 4A3JG 1DCZA 2B2YA 4MZPA 2A6HD 4JI8Q 2BDOA 3CCSA 3D7SB 3PGGA 4QQ6A 4XT3B 3EROA 3ZYYX 1XOVA 2DLPA 3ASKA 2DY8A 2RHQB 5AFWA 2B86A 3MWYW 2NVQH 1MBYA 1PRTC 2P84A 5I9PA 4E7IA 1YFNA 4BA1I 2VUMG 1Q46A 2VB3X 1JC7A 3K5LA 2F4VL 3H0IA 3ND9A 4C92G 3VR3A 3FKIG 2FPEA 1AFPA 1PFBA 2VXWA 2KQWA 1QUQB 2EXDA 5IP7G 2KJXA 2UXDQ 1I6HB 1G8XA 5GANe 1QUQA 5FO9B 3NSWA 4A93B 4UHVA 3WWVA 3GP7A 4EPCA 1VIEA 1QKWA 1WFWA 1XJWB 1K73R 2R6GA 2PTKA 1TWAB 3W1BA 4DK6C 1YI2T 4FU6A 3J7ZC 3RESA 5IGFA 3MKDA 3SWNC 4A4IA 4C3HH 1GO3E 2EYXA 4DR1L 4G7HC 4IJHA 1XPOA 3BG3A 4JDSA 3TN2A 4DBFA 4X64L 2QEXA 2ROLA 1B44D 3NTIA 2O01E 1J5EL 5GAMe 1ABQA 3LX7A 4NOYA 2DNUA 1MJCA 1NTGA 1M1GA 4DXFA 3UDIA 5J22A 2QTVA 2YTYA 1I6HH 4X66Q 3IKJA 1VQMT 2RDGA 2E5KA 1LTLA 1H641 2L9HA 3CCVA 2ZJRA 1KNAA 2HBPA 1CSQA 1N9WA 5C4XH 4HIDA 4KHPL 4PZ7A 4HT8A 3RZOB 2O4XA 1GFCA 2KYBA 5CIUA 1PKSA 1M90U 1Y1WG 5CV7A 1N34Q 1PA6A 1FR3A 2UXBL 2E3HA 1XXGA 1I1JA 3H6MA 2CS7A 4PJOA 1HQMC 4IURA 1X3GA 2O5IC 5D7UA 1RIPA 2CP3A 2KDSA 4FM4B 1VQHA 3K0YA 3KLWA 4HSPA 5ELBA 4BBRB 4PL6A 2ICEC 3ERSX 3R2IA 5IY0A 4M7DB 3LWIA 4NL2A 3M4GA 1I4HA 5C3EH 2M0YA 4C5IA 1OTCA 2AKLA 2E64A 4OMNA 2K32A 3CC4T 3EHRA 1BCPD 1PYBA 1K8GA 1I4PA 3I4MG 1QVFP 1QCFA 1EFWA 2BTTA 1D6EC 5KCHA 3H0GG 2KK4A 2AZVA 3UATA 3CD6T 2CH4W 4LF9Q 2MFIA 4KY5A 3DB3A 5DM7R 1D3BB 2XKOC 2SDFA 1SRUA 5GANh 2WAQB 3BY7A 5CQXA 2R57A 5GAMg 1TS2A 2KENA 3AT1B 1BKBA 4L5RC 1RI9A 4DV0Q 4N0AC 5C0MA 4E7LA 1H3ZA 2MPMA 4RAUC 4KN7C 3E9IA 5GAOp 4B3RL 2B8FA 1IBKQ 2WAQE 1JJ2S 3V8JA 3C95A 3PO3G 4MZMA 2EYZA 3OTOL 2PQEA 1EX4A 4GLMA 1U3OA 1KQ2A 1YP5A 4LJZC 4BDZA 2A28A 1PNJA 3CCJQ 2C06A 4QUCA 5ECAA 4TQUS 4WJWA 4X62Q 5GAMh 1WZOA 2EY1A 5I11A 1QWFA 3DUZA 1BIAA 1KC8R 2E6ZA 2HNIA 2IT1A 4ZYSA 4LFCL 3Q23A 2DL7A 3FIFA 4FW1A 6AT1B 4CI0C 2A19A 3C12A 3VS6A 3CCLT 1P8LA 2K5VA 3TEHB 1QZHA 2PPBC 3KJOA 4C92B 1LTGD 4ZGDB 1QB5D 1M8AA 4NXNQ 1PKTA 3KUFA 3DLMA 1KRTA 4YHHQ 3T13A 2Q2IA 1I4GA 3R6OA 2RQUA 2A69C 5LJ3f 3M55A 3CCRT 2F0HA 5M5YB 3HOVG 2IPKD 5C3XA 2BE7D 4M7AD 2LNVA 5G3LD 1F2LA 2F0QA 4C92E 4JCVE 2R3ZA 3OYFA 3T53B 3EFOB 5LL6X 1CFMA 2GTJA 4M75D 1ENCA 5I6YA 2CT4A 4GKJL 2LJ1A 1Q86U 4X3KA 1TWBA 2G5DA 5C3EB 5D6YA 4BI3A 4RMOA 2RHXA 3CKIB 4U673 3MEUA 3M5AA 1WHGA 4JRIA 2NN6G 3CW2C 4M8AA 2F5TX 3OBYA 3G71Q 1L2FA 2JA6G 2QQSA 4KBMB 4ZAIA 3CCQQ 2NUPB 4JV5Q 2C0IA 1FNUA 4MHEA 2NUZA 1JB0E 4EMGA 1ZSGA 3QWYA 4XYOA 3VYUA 5K36G 1B50A 1X3QA 1RD9D 2RQTA 2M2LA 1C9OA 3LW5E 3UWNA 3CC7A 2RI3A 2JTEA 1YIJT 1BCPF 1DOKA 1GFDA 2F0EA 3CXCA 4K5XA 4BBSH 3CF5A 2YTVA 4KLKA 1MV0B 2ZPFB 4J9HA 5EG2A 1D2BA 3T1HL 2L3SA 1KXLA 1VQNQ 4LF4Q 4ELYC 2QGGA 3MCAB 4DV7Q 4PZ6A 2ZPIB 2COZA 2PW7A 2NYZD 3I4LA 1OYXA 2BKDN 3VR6A 3TQ7P 1Q90A 3BZDB 1JXMA 3CMEQ 1T0HA 4C5HA 3QG1A 1HZAA 4NMZA 4A3LG 4OF1A 3BYTB 2ABLA 4PMCA 3L0OA 4C3IB 1WCMG 3H0GB 1S3OA 4QMGA 2BZXA 1A3VA 3L9AX 4JI5L 2KMTA 1ASYA 3GTLH 1AD5A 4A3FG 1B1ZA 5KYIA 2V8IA 1QJOA 1W3SA 2CFMA 3MXPA 2F0TA 2NN6I 4QUFA 2K04A 2DMOA 4X1VA 5CKDA 3VA7A 4ZUJA 2V1CC 2VYTA 4J9GA 4TVRA 1IXRA 2F0WA 5IAYA 2YYZA 2DJGC 5DM73 2CREA 3A56A 4M78D 1M90R 1S5FD 2YUQA 5M5XH 1M1FA 1J9OA 3DWQA 3T56B 2KHJA 5KYWB 1IXDA 3I72A 2DD4A 2LDMA 3OS1A 2W0ZA 2F3VA 3FPPA 5FLXL 1T0JA 4IUNA 2LX7A 2BCOA 2L0AA 1K1ZA 1VUBA 5G3LF 2R93H 1O9SA 4ESRA 3EG3A 1FGUA 1SJHD 1EYAA 1TUGB 2CKKA 1SE4A 1LNXA 5A2QL 3JCMW 2L5TA 3A54A 2IPOB 3TP8A 3OA6A 2P0QA 3CCEA 3LH5A 2BE9B 1GHKA 3M9BA 4DU9A 2DBKA 4JRKA 5CC4A 2Y4YA 4LMQD 2QQ9A 3CCUT 5M3MH 2CVRA 5CORA 1QOHA 1K0RA 5GAOl 2HZYA 4R4IA 2HCCA 2F1LA 2DTIA 2WB1G 1BOSA 5EPKA 2DYBA 3K7AH 4TSSA 1D1IA 1SSOA 1H9SB 3RN5A 3P1HA 4M77F 4B3MQ 2EKOA 1MI2A 5M3FB 1CSKA 3EFSA 4RKUE 5GMKe 2ASBA 1N33Q 4BA2I 4AQYQ 1UGVA 3JCMf 4EMKB 1G6ZA 5IWAL 2DM1A 4RTYA 1LTAD 4EMKA 1YCSB 3R3OA 3RMHA 1Z6HA 1BYMA 1IGQA 3X24B 1R77A 1JCKB 1PC0A 3PO2H 5L8RE 1SE2A 3OS2A 1OX8A 4JI6Q 3OPOA 4M7AG 1N36L 3GTKH 3X25B 1HPCA 3PT9A 3OYKA 4M75G 4C3HG 4OMFB 2VQFQ 2D0NA 1AN8A 2DJQA 1YJWT 3GTOB 2QASA 3MEFA 3HL8A 3GTPB 1A63A 1XPRA 4EVOA 2KXDA 3QIAA 3LWHA 2K50A 2IJ0A 3S2HH 2F0LA 1Y96A 2P5ZX 2ID0A 1XNQL 2J05A 2E2HH 4A3EG 1RABB 4O1NA 3CC4Q 1VS0A 5C4XG 2GFUA 4CDEC 3RMQA 2E3IA 4JBKA 4TKOB 1TU0B 3VS2A 4BY6C 1CM9A 2A74C 4M78F 4H44C 4QVZA 4K6LA 4LUZA 2B63B 2KRSA 2LQWA 3PUVA 4FYDA 1ZSZC 4B9XA 2N55A 4B3SQ 5M5WH 1TWAH 3FEOA 3S3OA 5A0GA 1DJ7B 1SMYC 1B2TA 1GOZA 4WF2A 2R58A 3UDCA 1HJDA 1SNQA 4DR3Q 2G6FX 3JCMQ 2MO0A 5C3EG
chains in the Genus database with same CATH topology
1G5VA 2A3LA 2DKGA 2XU8A 2KY9A 4JI7Q 1BI1A 3JCMb 3G4ST 3L1AA 3CPFA 2RHYA 2E5QA 3I55A 5GAOr 5GAN2 3CC2A 3V7CA 5GMKh 1RI0A 2UXDL 2OQ0A 3RZOH 1JT8A 3UDXA 2QI2A 4A3BH 2C35B 2YV5A 5A0LA 4MDWA 1VCIA 3BU2A 2PQAB 4A3GG 4M78G 4DR1Q 1B8AA 3J81j 4DV6L 4A3DG 4HJ8A 4HKEA 3DB4A 5J39A 1OXUA 1J5EQ 2JE6I 2X4JA 2RO0A 1VIFA 2QGQA 4HT9A 4C8QD 3PMTA 1SROA 2WB1E 3PSIA 5GROA 5HGQA 2JA5G 3HOYH 5DLOA 4C2MH 3L42A 4UC4A 4M7AB 4OXPA 4JOIA 4JBMA 4M7AA 3RUXA 3HP9A 2V8KA 4M75B 4A3JH 3RKYA 4IOAA 1Y71A 1PH3A 4M75A 3DLLA 1LJOA 4M7AE 4OVAA 1J6QA 1KD1C 4KUIA 2IVWA 4M75E 2RM4A 3LGFA 4DUZQ 2E2JH 1UGPB 1IYJB 1W2BS 2VUMH 3I56T 1GXIE 2FHDA 3FKIH 5IP7H 4DV0L 2YRVA 4BE1A 3A74A 4JJNK 3ICEA 3KF6B 1IBKL 1B7YB 1XNIA 4MZ9A 3TU4K 1JJGA 1FL0A 4P72A 3QO3A 2DIQA 3M56A 4DOVA 4LW1A 2VY3A 3RERA 4KUDK 4X62L 1YZ6A 2GN5A 1YJNT 1IBMQ 5FLXc 2VGMA 1GKHA 1TWHH 3OW2S 1XTDA 4BE0A 4LFCQ 2EQKA 4C0DC 2DTHA 3S1QH 2PVGB 5GAN7 1E1OA 2AHOB 2EQUA 4YHHL 2MNAA 4DQ2A 1Y1WH 4DR7L 1VQ9T 2FVUA 4PJOD 4UPAA 3U50C 1QZGA 1VQLT 4HJ7A 1V9PA 4C8QF 3G7ZA 4M78B 2KCMA 4GKJQ 1MHNA 2E5LL 2HAXA 1TWGH 2CGHA 3GLXA 3H8ZA 3I4MH 3MP6A 2UXCL 1U8RA 2ZPGB 3CCJA 4DV5Q 5EAYA 1X75C 2Y0SG 3K8AA 4LDYA 5C0XJ 4HIMA 2UU9L 2RF4A 2DTOA 1PFSA 3ZJYC 1QP3A 4LF4L 3I2ZA 4DV7L 1EQRA 2GVAA 2P0PA 3T1HQ 3PO3H 2Z6KA 1E24A 3QZ5B 4OWWB 1OZ2A 3GD7A 3Q8DA 4APVA 1N9SA 3VYHB 3CCMT 3JCMX 3G71A 1K3RA 3M4PA 4JI5Q 5LJ5j 3CCQA 5LJ5g 3PO2G 2H5XA 1M4ZA 3AYHB 2EAYA 4DR4Q 2E12A 4L5GA 1X65A 2GVBA 4L5TA 5DY9A 1EWIA 4PG3A 1MGQA 2QQAA 4A54A 1OXVA 3HOVH 2E41A 4GNXB 3HHTB 4KI0A 5GAN8 3VKIA 2LSSA 1ZBXA 2IY5B 4UY8C 2JQOA 4DUYL 3F8TA 1V43A 1Q81C 3CAMA 4PJOF 3RKXA 1VQOT 1U5KA 2G3RA 2JA6H 1CKNA 1HH2P 1YITT 1I5FA 2BUDA 5BR8L 2P4TA 3QSUA 4A3CG 2ZTCA 4Y28E 3CMEA 3U58A 4J8OA 3PF5A 3H3VH 3L2WA 2RD1A 3KF8B 1WQ7A 3CMAT 3TREA 1QVFA 2IG0A 3A8LB 3EAEA 3BJUA 3P8HA 1B70B 2Y4XA 2ZJQA 2L5QA 4LF6L 3X20B 5KH6A 1Q82C 3CEYA 4B3TL 1N9RA 2RCNA 3OS5A 4LUOA 4GKKL 1PH5A 2KAFA 4A3LH 5M9OA 4AQYL 1SMXA 4POFA 2AHJB 1WCMH 3CP0A 5IWAQ 2FYKA 2VV5A 4A3FH 3VUZA 2UUAL 4PJOG 1IBLQ 1SFOH 4HIKA 3J81i 1N36Q 4QIWE 1K8AU 2K57A 4KHZA 3F2CA 2R7ZG 3T1YL 3GPLA 4C5GA 2WACA 1HNZQ 2Y0SE 1KQSA 4OB1B 5H1SE 4A4FA 4IFDG 2RB6A 4XTVA 1XNQQ 2I0QA 1R9TH 2JEBI 4R55A 1L1OB 3S16H 1L1OA 4C8QB 1X54A 5IYCG 2VUBA 3HPWA 1KL9A 1YVCA 3J80c 3JCMV 4X9CA 2OCEA 3A8MB 4B3SL 4IUPA 3HOYG 2RH2A 3SGIA 1SLJA 4XAXB 1G3SA 4BDYA 4BE2A 2F52A 4LFBQ 4MMLA 2VC8A 3SD4A 3RMSA 3JC66 2HIVA 4JI7L 2YLBA 3S24A 3OYLA 2B29A 3M53A 3M7NA 1T9HA 5CO7A 4M7DC 3V8KA 2D9TA 2MAMA 2MMPA 2VS1A 1YHQT 2WFWA 3CC4A 5J3BA 1E7ZA 4IFDI 1VQCA 3PTAA 2CZ0B 4HA8A 3KJPA 2CWAA 1Y07A 1KIXA 2MWOA 3M4QA 4DV6Q 2L89A 3QYGB 5JJLA 3C4SA 4A3EH 3HOUG 1N32L 2O4XB 4IUQA 4BI4A 2I2LA 3GNFB 4GY5A 2IX1A 5IN1A 4D6WA 4PJOB 4DV2L 4JLIA 3OYYA 3AHUA 5GAN5 5GANj 2XGTA 5GANg 1PV4A 4LDVA 4LDXA 4DV4Q 3H6ZA 3NTKA 4QQDA 1QVPA 4PJOE 1O7IA 1TWFH 3W5OA 2DPPB 1WPYA 2VXEA 3GP8A 4JI4L 2F5KA 2Z0SA 2NLUA 4DUZL 4Y91A 2RHIA 1K73C 1PH6A 2JK8A 3PNWC 2NZOA 3NENA 3A8GB 3UE1A 1U1TA 5CKEA 4A3IG 2PMZE 4IOCA 2OTJT 4MMKA 5GAMj 4C0GA 3J81c 5FLMG 3HKZG 4IJLA 2DXCA 2XDPA 2ES2A 3ZBDA 4A3GH 3L2UA 4L6V5 3URGA 2VZAA 1YIJA 1JJ2A 1IBML 3PUZA 3HKSA 4A3DH 1TH7A 3SWNA 4XK8E 3MXNB 4DKAC 4HJ9A 3RLNA 1HXDA 3A5ZB 4DOWA 3S15H 4LDWA 3JCMJ 2LQ8A 2LQKA 4DR7Q 1IL2A 5CKFA 2JNGA 3OYAA 2JA5H 5GAOm 3M58A 5LJ3d 1XPUA 2KHIA 3LGJA 3B6YA 2E5LQ 2BIVA 1K8AC 1WQWA 3UE0A 2UXCQ 4DV5L 3HOXH 5IT9E 1GVPA 1NPRA 2QA4T 4ZN1A 4A4GA 5D6WA 1QVGA 3GDEA 1I50H 2DEQA 2CKZB 2B8AA 2UU9Q 2HQEA 1OXSC 4RG1A 4ELZC 5LMNW 2JZ2A 4IFDJ 2M16A 1KC8C 1WYDA 4YCWA 4HIOA 1NMFA 1X55A 3CQZH 1Q1BA 5KCOA 4N0AA 3CXCS 4NB3A 4A4KA 3FLGA 3HRUA 2DXTA 3GTJH 3G6ET 2E6NA 4E7HA 3JCMP 4R4CA 3CBOA 4XU2A 4OB0B 4V2SA 3LYIA 4DR4L 4OONA 1B34B 2K3XA 1SR3A 3OYDA 1B34A 2JOYA 2EJFA 4BY1G 1KD1U 3H3VI 3JCMc 3ULJA 1JMCA 1PHJA 4BD3A 4RG8A 3HKZE 1K83H 1VQDA 3WVEB 4ZN3A 4DUYQ 3JAMi 4QW2A 2EJGA 1XJVA 4JRPA 2HIXA 1YJWA 4M7AF 2RJCA 5BR8Q 3F70A 4M75F 4J5YA 2AKWB 4PMWA 2A7YA 1WGSA 5CCAA 2PNHA 4FT2A 5J26A 5GADC 4GLAC 4A3MG 4JG2A 4GN4B 3QPHA 2XD0A 1NE3A 3M3YH 4LF6Q 4EMHA 4RMFA 1D8LA 4B3TQ 3FB9A 2JUFA 5LMNQ 3E9FA 1YJ9A 1YEZA 4MNOA 2BH8A 2DO3A 4GKKQ 2RHSB 3MEVA 1SSFA 3VV0A 4ATOA 2K5IA 3JB9J 2UUBL 4N4GA 4RG2A 1YHBA 2X4XA 1PH4A 1IBLL 2UUAQ 3OBWA 2MI6A 2E1HA 2HD0A 2L8DA 2KSSA 5FLXE 2CZ1B 3NTHA 1EIYB 4Z02A 1HNZL 5C0XG 3OSSC 3T1YQ 4FIBA 5A2QE 1Y96B 2R5AA 1ZQ1A 3V7SA 3F2BA 2EJ9A 2DUDA 4LF7Q 5LJ5f 4A3CH 1X3FA 2OQKA 1LOJA 3A5UA 2BA1A 4P73A 1FWZA 2K5NA 3PF4A 4BY7G 2RJDA 4K0KL 2UUCL 2WSCE 4XU1A 4YTLA 5GMKj 2E70A 3FDRA 3SDZA 4LFBL 3SFMA 5IT9c 2K4YA 3D0FA 4EQ5A 5LJ3e 4LNQA 1N8RU 5GAOq 1P92A 2PUKB 4OGEA 3GOXA 1Y1VG 2CZ7B 3HSBA 5C44G 5FU6B 2EFIA 1JE5A 1I94Q 5C0XI 3S1RH 4BACA 3QBYA 2E2IH 3ME9A 3VDYA 1WJRA 3M85A 1A8VA 4GS3A 5CAIA 4JLGA 1IREB 4ALPA 2D0OA 4F7UG 1Q81U 3PGZA 4J6XA 3K7UC 2R7ZH 1VQ7A 3AQQA 2K14A 4M77C 3RN2A 1E3PA 2GF7A 3NEMA 2YTXA 4ZTFA 1E22A 4JI0Q 1N32Q 1WNLA 1PSFA 2XICA 1PSEA 5IYCH 5FROA 4ZGJB 1YJNA 2HQXA 4E7KA 1Q82U 1XMOL 2X35A 4UP7A 1GM5A 4DV2Q 3NFCA 4L59A 4BY6B 5CVIA 3QJYA 1TWCH 4X34A 3S1NH