1EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
128
Chain Sequence
b'MPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Initiation factor
total genus 22
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eifA02
2ZTCA 4YWLA 3J80c 5JEAJ 3H0GG 4DUZL 1KQSS 4X64Q 5IAYA 5M3MG 3GTJH 1VQGA 1EIYB 3I4MG 4GNXA 1I94L 2JA9A 5IY0A 3CD6T 4A3EG 4PZ6A 4GS3A 1XNRL 4LF9Q 2F4VQ 3PIPA 3RLFA 2JA5G 3PF4A 4BA2I 3RZOH 4BY7G 5J3BA 2LSSA 1OXTA 1NE3A 1SN8A 2JA6H 5JJIA 1YIJA 1S72T 4AYBG 2WB1G 2YTVA 1VQKA 2ALYB 4LF4Q 4NB3A 1XNQQ 2VUMG 2N49A 2JOYA 1N36L 3Q8DA 4BBSG 3G4ST 4PZ8A 5GAGC 3ULPA 3IRBA 1BKBA 2KENA 4GOPA 1XJVA 5FLXc 3GTLH 3H3VH 1KAWA 2ZJQA 4LF6L 1XTDA 4DR7Q 1X55A 1E3PA 3RN5A 4IFDI 1GVPA 1ASYA 1IBKQ 3F2DA 1TWGH 5JJLA 2EXDA 1S72A 3W1GA 1GO3E 2VQEL 4OONA 5C44G 3GO5A 2K4KA 5AJ3Q 1MJEA 1FGUA 1T9HA 3G4SA 4DV4Q 2CQOA 1LYLA 4X34A 3J80E 2ZJRA 1I6HH 1HH2P 3M7NA 2BH8A 2HIXA 1JJGA 1MJCA 5DM7R 1K8AC 2MI6A 2RHSB 1C9OA 1Y1VG 1L1OC 1VQ9T 4JI8L 3ULLA 2I5HA 2NN6G 5IE8A 4DR2Q 1IBML 3CP0A 2OQ0A 4A75A 1FJGQ 2VW9A 2F3IA 4C2MH 5JJKA 4WJ4A 2R6GA 4A3DH 4OWWB 4R4TA 3S17H 4UP8A 3J81i 1KD1U 1I94Q 4KHZA 4APVA 4JI6L 2VL6A 4QY7A 2RCNA 3RN2A 4DR5L 4IJLA 3A5ZB 1VQLT 1PH5A 4UY8C 1XNRQ 3RLOA 1E7ZA 5FLXE 3JAMi 3KF6A 1IXRA 1EUJA 2ID0A 3UDGA 1UE5A 2E6ZA 3LGFA 4HIKA 4LUZA 1Q81U 2A1AA 1N33L 4BY1H 1VQOT 2LXJA 4LFAQ 1XPRA 2A8VA 1VQPT 1Q86C 5M3FH 1K8GA 1N36Q 3ICEA 1SFOH 3GTMH 1YITA 3KOJA 4KI0A 5IYDG 2KHJA 2IHEA 3AYHB 4YY3L 1X3FA 3CC2T 2Z6KA 1K0RA 2ZM6Q 4LF6Q 4GKJQ 4IPGA 1NZ9A 1VQAA 5FJ8H 1J5EL 3U4VA 4A3MG 2R7DA 3ULJA 4HIDA 1KIXA 2R92G 2OQKA 1OXUA 2VQEQ 4H02A 2E2IH 1VQPA 1VQ8A 4A3JG 2IX1A 5BR8L 5IP7G 3K8AA 3KDFA 1EQRA 3J7A5 3TS2A 1VQ6T 2OTJT 3CC4T 4B3RL 1A8VA 3CC2A 1WJJA 4P74A 3KJOA 2IT1A 3VDYA 4UP9A 2ES2A 4BBRG 1IBMQ 1GD7A 2VQFL 1K73C 3GTKH 1U5KA 1K9MC 1Y1WG 2D0OA 3PO3G 3I55A 1Q7YC 2NVYH 2UXBL 1YHQT 3T1YL 1E1OA 2AWOA 1VQHA 5C4XG 1KC8U 1WCMH 4O2DA 2QEXT 3CCLA 4X64L 3TREA 2OCEA 2CCZA 4JI6Q 2JNGA 2OTLT 1VQ6A 1I50H 3A74A 4DR2L 3HOZH 1YHAA 3CMET 1Q8KA 4DR5Q 1VQ4A 5FLMG 2KDSA 2F4VL 3HOYG 1J5EQ 1RL2A 3LH0A 1YI2T 4A3GG 1YHBA 3S15H 4LUVA 5C0XG 5GAEC 1N33Q 1WOCA 2CKKA 1NPPA 2JVVA 3CCEA 1DGSA 2N78A 3S1NH 4JBMA 4IPCA 2QEXA 1C7YA 3CCSA 4GNXC 1N34L 1PHJA 1NJIC 3CMAT 4A3LH 3CMEA 3I56A 1HJPA 1WYDA 1VQ5T 2JA6G 4DR7L 1EIFA 3S1QH 3J81c 1I3QH 4NPSA 4IJHA 1JJCB 1VCIA 5LMNL 1EFWA 3JAMc 2KCTA 1PH1A 3KBGA 3HKSA 2JA7G 1PH6A 3G6ET 4DV4L 3CC7T 1OXVA 4A76A 1XNIA 3HFZB 1TWAH 4B3RQ 1KRTA 3HOXH 2MFIA 3UDXA 4BA1I 1XMOQ 3H3VI 4JBWA 2YTXA 2QA4A 5IWAQ 4EQ5A 2B63G 3GTPH 4A3FG 1VQDA 1UE1A 1Y14B 2B29A 4IPHA 1WFQA 2XHCA 1Q82U 1A0IA 1W2BS 2WP8J 1N8RU 2K5HA 3FP9A 4B3ML 4GLAC 1D8LA 3NELA 1YJNT 3E9HA 4J15A 4DR4Q 2RHQB 3U58A 2YYZA 4C3JH 4B3TL 3CCVT 2JA8G 3PUZA 5IP9H 3S2DH 1VQMA 4X62L 1JJ2A 3F8TA 4JI1Q 3CCJT 3J81E 3EIVA 3L0OA 4PMWA 1VQ7T 3BJUA 2Y0SE 4Y7NH 4A3DG 4ZN1A 1SR3A 4XIGS 4LFAL 4JYAL 4DK3C 3S1MH 1JE5A 5M5XH 4EX5A 2UUCQ 3JAME 2UXCQ 2DGYA 1L0WA 3HKZE 1XPUA 1N34Q 3OW2A 1CUKA 1VQBA 4OWTB 4IFDG 4LUOA 3CD6A 2HHHL 2ZM6L 4GKJL 2I0QA 2WAQG 4WJ3M 1AE2A 5H1SE 2MO0A 4BY1G 4OX9L 1YNXA 4A3IH 3CCJA 4JC0A 2ASBA 1G51A 4QL5A 5LMNQ 3PUXA 2AKWB 4QJFA 3HOVH 1VQNT 3D0FA 3OTOQ 4X66Q 4LFCL 4L5SA 2K50A 1P8LA 3U4ZA 4L5RC 4QQBX 4A3CH 1K83H 3KFUA 4JOIA 5IYBH 5GROA 1SRUA 1KRSA 2KCMA 3HOUH 2YU9H 3E9IA 3UDIA 4IPDA 1G6PA 4LF8Q 2VS1A 3UE0A 2UUAQ 4HJAA 1QZGA 4A93G 1MIUA 4L5TA 4A3BG 5C3EG 3UE1A 2E2JH 2JK8A 1VQNA 1FL0A 3RNUA 2ATWA 2R7ZG 4YWMA 4DV0L 1CSPA 3ERSX 3G71T 1TWHH 4B3MQ 3I4NH 3EN2A 3AQQA 5IYCG 2UXDQ 1YEZA 1SE8A 3HOWH 3M4PA 2WFWA 2UUBL 1UE6A 4B3TQ 3RR5A 5K36G 3L2PA 3ZJYC 1VQ9A 1X3GA 3K0XA 4AYBE 2BA0A 2WB1E 1Q46A 4X62Q 1PFSA 1KD1C 1Z9FA 2AMCB 4HIOA 2GVBA 3I4MH 2MWOA 1WCMG 4OWXB 5M3MH 4JYAQ 1KXLA 1E1TA 3GDEA 4R4OA 3BU2A 1L1OB 1P16A 2PQAB 3BZKA 1QVGA 3CW2C 4JBJA 4A3EH 4L5QA 2KVQG 2MNAA 1BBUA 4YWKA 2JA5H 1Q81C 1AH9A 2HHHQ 5LMUL 4BY7H 1VQLA 4JI7Q 5C0XJ 3CCRT 1LM0A 1W3SA 5M5WH 1QZHA 4NXNQ 1KL9A 3J7AF 1OXXK 4OX9Q 1UE7A 4BBSH 1EOVA 1VQOA 2JUFA 2ZTEA 4GLVB 2PI2E 1CKNB 3U50C 1G291 4DPGA 3OYYA 4X65Q 1XMQL 4LFCQ 4A3LG 1EWIA 1V43A 3CXCS 1YJWT 1WI5A 3FKIH 1M90U 1JT8A 3M4QA 3TQYA 4KHPQ 1XMOL 1S40A 3CCRA 1TXYA 5IWAL 3CCUT 4MNOA 1HR0W 2BA1A 3PO2G 5C44H 4R4IA 4DV0Q 4HJ7A 1LTLA 2PQAA 2IY5B 4A3KG 3HOXG 1IBLQ 3K7AH 2D62A 3M4OH 1YJ9T 2N3SA 1Y1VH 4RMFA 2OTJA 1FVIA 3CC4A 2MO1A 5GQOA 5J26A 3GTOH 4DR4L 1X65A 1KC8C 2IG0A 2LQ8A 2A19A 2E2HH 1AE3A 1HZBA 2EQSA 1JB7A 4JI1L 1K73U 1EQQA 3PGZA 4DUYL 3CQZH 3A5UA 2R93G 1YHQA 3P8BB 5LL6S 3JC66 1IL2A 1H95A 4ZN3A 4DAYB 1QVFA 3KLWA 2UUCL 1X6OA 3CCMT 2UXCL 3F2CA 2XTIA 1HNXL 1Q1EA 2OTLA 1UEBA 3FHWA 4YCVA 3BZCA 5LMUQ 4JI0Q 1N32L 1NBWA 3PSIA 3H15A 4RG2A 2JEAI 2UU9L 2XGTA 1GKHA 2CWPA 1YI2A 2KHIA 4LFBQ 4DV3Q 1VQJA 4PZ7A 3OTOL 5IYDH 4YHHL 3CPFA 4X66L 4IFDJ 1XMQQ 2ZJPA 3CCMA 2HIVA 2H5XA 4JV5Q 1J6QA 3EBEA 1B7YB 3PCOB 4P71A 3CMAA 3KJPA 4GOPC 1HZ9A 3S1RH 1TWFH 4A3MH 1XPOA 1QVCA 1VQ5A 4GN4B 1CKMA 2K5VA 3MXNB 3HOVG 4LF8L 5ELOA 4LNQA 4RG1A 2UUAL 4LWCA 2JE6I 5C4JH 1SSFA 3CPWA 4GNXB 4HJ9A 2LVMA 1M1GA 5IP7H 2NZHA 2K14A 3F2BA 3T1HQ 4POGA 1NTGA 1RIPA 4MZ9A 3I7FA 3WWVA 3G6EA 1SLJA 4R4CA 3CC7A 3CAMA 1N9WA 2AWNA 3G48A 5E7NA 4IOAA 2UXDL 1O7IA 4OO1I 4BBRH 1Q82C 1OTCA 2NVQH 1JMCA 1N8RC 1Y1WH 2OWOA 1LUZA 1M1KU 2F52A 3PUYA 4DUYQ 4JG2A 4C3IH 4DV5Q 1JJ2S 4A4IA 3GD7A 2G3RA 4AIMA 2NZOA 3HOWG 1PH8A 1PH3A 2NVXH 2Q2UA 2I5LX 1HZAA 1YJNA 3UDFA 1VQFA 1HNXQ 3S16H 1NY4A 3K7UC 3HOYH 1YIJT 1SROA 1KQSA 4JI2L 1N32Q 1VQKT 2VNUD 2MQHA 2PI2A 3L7ZC 3CCVA 4OXPA 4JI7L 4GKKQ 2UU9Q 3OW2S 1HNZQ 4NXNL 2DUDA 4BXXH 4DR3Q 3ER0A 2K5NA 1Q1BA 4JI5L 5M3FG 1VQ7A 1YZ6A 2RF4A 3RLNA 2HQLA 4YHHQ 1MKHA 4HJ5A 2NVTH 3RZDH 4Y52H 4X65L 1QUQB 1HZCA 2ZTDA 4QGUA 1IYJB 1PYSB 5FJ8G 5HY6A 1PH9A 2Z6KC 4KHPL 1VS0A 2CFMA 1X54A 5A2QE 4R4QA 4TVRA 5IT9c 4AH6A 2JA7H 3F1ZA 2JQOA 5M5YH 2R93H 4JBKA 4NXML 4DK6C 4QIWE 3J7ZC 1IBLL 3FKIG 4LF5Q 3KF6B 1K3RA 4JCVE 4DV2Q 4DR1Q 2GVAA 4P75A 1VQIA 1PH7A 4UPAA 2B63H 4DR6L 3K80C 3PV0A 1E22A 4A3FH 3I2ZA 1K8AU 2KBNA 1BBWA 1NMGA 2JJQA 4DV6Q 2E8GA 4PG3A 1X9NA 2LCLA 4B3SL 2FXQA 3H0GH 4K0KQ 1HNWL 2VZAA 5JEAG 4DV7L 1OXSC 1Z47A 3G71A 3NBHB 2VY3A 1QUQA 3PIOA 1VQEA 2UUBQ 3HOZG 4DNIA 1PV4A 5EAYA 1VQCA 4JI4L 2IX0A 2JA8H 1NPRA 2WAQE 4R1JA 4JI2Q 3SGIA 4JI0L 1QVGS 2NN6I 3DB3A 1E24A 2YV5A 4LF7Q 1C0AA 2V1CC 4IOCA 4TVAB 4DUZQ 1B8AA 4X6AH 1YITT 2K75A 3I4OA 2VUMH 2D0PA 4DV3L 1CSQA 3KDFB 4JI5Q 4LFBL 3TS0A 5IT9E 4AQYL 3NEMA 1Q86U 1Q12A 2Q2TA 1PH4A 1L2FA 3B6YA 3LGLA 1IZ6A 4JV5L 3AFQA 2GN5A 4TQUS 3A0JA 2Q2HA 2L3RA 2CWAA 1BVSA 2AHOB 3W5OA 3J81j 3PUVA 1GM5A 1VQ8T 2CKZB 1PA6A 2PMZE 4HIMA 3GTGH 1M90C 2PNHA 2YTYA 4NXMQ 2C35B 2Q2IA 1L1OA 3D31A 3T1HL 1CKOA 1PH2A 4JI3L 3J80i 1S3OA 3STBC 4DV1L 1YJWA 2QGQA 4DR6Q 3S2HH 3I55T 4XTCS 1ASZA 1V1QA 4A3BH 2JEBI 4A93H 1B70B 5C3EH 3CXCA 3CCUA 3CF5A 4HJ8A 4YCUA 3CCLT 2R7ZH 2I5MX 4POFA 2LXKA 3STBD 4B3SQ 1K9MU 1HNWQ 4QQDA 4DV7Q 2MWPA 1Q7YU 2IHFA 4P72A 5IYCH 1VQ4T 2N8NA 4JI8Q 4DV5L 1EYGA 1CKNA 1HR0L 1YJ9A 2E5LL 4JI4Q 1I5FA 1SMXA 4ME3A 2Z0SA 1QVFS 5IP9G 3NENA 3CCET 1TWCH 4GKKL 3DB4A 1HNZL 1PYBA 2B3GA 3M3YH 3TRZA 3CCQT 4DR3L 4DAMA 3CCST 4KLKA 3I56T 5LMNW 3DLLA 1X3EA 4GN5A 4C3HH 4AQYQ 3S14H 4LF9L 4LW1A 3AFPA 1PVOA 3K81C 1NJIU 3TEHB 4DKAC 4LF4L 1XNQL 2R92H 1KHIA 4BXXG 4A3IG 5C0XI 4O0AA 3PF5A 2Y0SG 2L15A 4P73A 5ELNA 3GTQH 3CCQA 4MTNA 5GADC 4A3JH 4CRIA 4IO9A 4YY3Q 3AEVA 2BH2A 4FDBA 3HKZG 4A3CG 3CPWS 2QA4T 4OO1G 1D7QA 5IYBG 4JI3Q 4UP7A 3HOUG 4DV1Q 4LF5L 4DV2L 1IBKL 4DR1L 4JOIC 1R9TH 1U0LA 2K52A 3PO2H 3KYHC 4YCWA 3PUWA 4GLXA 3M85A 5AJ3L 3PO3H 4DV6L 4GN3B 5BR8Q 5GAHC 1A62A 3M9BA 2EIFA 3MEFA 3S24A 5C4XH 2E70A 2R7FA 4A3KH 1A63A 3I4NG 4ALPA 4GOPB 4K0KL 5HGQA 1UWVA 1V9PA 3E0EA 1YVCA 1HR0Q 3LGJA 1NMFA 2E5LQ 2DO3A 4YTLA 1VQMT 1W2BA 1YBYA 1M1KC 3DM3A 3KF8B 5FLMH 2VQFQ 5DLQE 1FJGL 2HT1A 2UXBQ 4A3GH 3T1YQ 4LF7L 1X56A 3W1BA
chains in the Genus database with same CATH superfamily
3J7AV 2QI2A 5JEAJ 4DUZL 1KQSS 4X64Q 2CH4A 1YJNQ 5IY0A 2R57A 1ILPA 3CD6T 2HSPA 2LT4A 2PUKB 1XNRL 2VVKA 3V7SA 1CM9A 4BA2I 1R77A 3PIPA 4M7DG 2JMCA 4C1NI 4EGVA 1X75C 1MGQA 5JJIA 2RA2A 1OXTA 2BZYA 2A6HD 1S72T 4F17A 4ZTJA 2WB1G 1DM0B 1K0SA 5HKCA 2YTVA 4NB3A 4AFZC 5F2DA 1S5ED 4EDUA 2JOYA 1N36L 3TCJA 2I2LA 4F88A 1HHVA 4GOPA 3VV0A 3GTLH 5IN1A 3H3VH 4DR7Q 2F2VA 2GCXA 3JCMP 2K05A 3EFSA 3VR5A 3UATA 3BDOA 3PIP3 3DKMA 5C44G 4Z8AA 2K4KA 2DA9A 2XRQD 1FGUA 5KYWA 3G4SA 2IJ0A 2CQOA 1JORA 1LYLA 5EKLA 4X34A 2ZJRA 2HNIA 5KYYA 2HIXA 2EJFC 1BF4A 2LDMA 2MI6A 3M4YA 1C9OA 2QKIC 4JI8L 1JOQA 1TY2A 2DYBA 5IE8A 2NN6G 1YN8A 3JB9F 1KTKA 5C4HA 1C6VX 4C2MH 2RBMA 4KKUA 5CKFA 2C0IA 2LX7A 4A4HA 1M5Q1 1JU5C 3J81i 4Y7NB 1Y8PB 5AFWA 1NE8A 5E4WC 1ICFB 4IJLA 4DR5L 1WZOA 2E75C 2MMPA 1E7ZA 5FLXE 5DLOA 2AK5A 2F0LA 2L4NA 1IXRA 3PE0A 1EUJA 4PJOG 3J80L 4M77F 2E6ZA 3LGFA 2F1LA 4HIKA 1N33L 1VQOT 4RKLA 4LJZC 2HQEA 1VQPT 3KK7A 3PIO3 1M8AA 2RQTA 1YITA 3KOJA 4KI0A 3HOVB 2A5HA 3AYHB 5FOBB 1WHMA 1B50A 3A8GB 1X3FA 2MCNA 2DXUA 3SD4A 4LNPA 2JYOA 3BVZA 3VJPA 2A69D 5CAIA 5KNCA 1QCOA 3ULJA 3U9SA 4TSSA 1ZEQX 1EQVA 2VQEQ 2L3SA 2X4JA 2SNSA 3EHRA 3C1EA 2BE9B 1U8RA 3M0QA 5BR8L 1PLFA 2R5MA 1EQRA 1VQ6T 4F14A 3CC4T 4JRPA 2Z4IA 5IGFA 2MHVA 1GHKA 1AZGB 1ZBXA 1GUTA 1RAFB 2ES2A 3VUZA 3OBWA 1IBMQ 3QG1A 1GD7A 4FU6A 1A2TA 2NWMA 5GAOl 3I55A 1Q7YC 2EDGA 4N8FA 2K5LA 1VQHA 1SF9A 1NG2A 1GFDA 4X64L 2CCZA 5C4XG 4JI6Q 2JNGA 2OTLT 1I50H 3URYA 2O4XB 1T5EA 3H94A 5M3FB 3BG3A 3MPUB 2IPKD 2KDSA 1V8QA 4R8IA 2EQKA 2BE7D 1BDOA 4CKEA 3S15H 2KK4A 3Q1JA 4C92A 2EKHA 3CCEA 4XTWA 1LJOA 1RAEB 2Z0WA 1C7YA 5FO7B 2ENBA 4RA8A 1WTVA 4GNXC 3BVGA 3CMAT 3SWNB 4XT1B 4M77C 3E9FA 1WYDA 4A3LH 2E2IB 4DR7L 3JCMh 3J81c 4LDVA 3HG9A 1FYNA 5HURA 2DL3A 3OMGA 1STGA 1SHFA 1PH1A 3KBGA 4A4GA 2L8DA 3D4RA 2JA7G 4HEDA 3GTKB 1XNIA 3HFZB 4GY5A 5C0XG 4D6WA 3BS1A 1CKBA 3QPHA 1HXDA 5CV8A 3HP3A 1QCFA 2RQXA 1K76A 4EQ5A 2B63G 4JZ3A 2HEQA 2XVSA 4CC2A 4A3FG 3C2PA 1UE1A 3HOZB 4C0GA 1A0IA 4PJOD 1LLRD 1UAPA 3U23A 4KHVA 1GUOA 3SEBA 1WHLA 5BN5A 5C3WA 4N0AA 5CQYA 1D8LA 4M7AF 2EY5A 1YJNT 4FO2A 1KHCA 1UGPB 1O80A 1MV0B 1XWEA 2K01A 2KECA 3E9HA 3NHHA 4TKOB 2RHQB 3U58A 2YYZA 4B3TL 3T56B 2JA8G 1STYA 3PUZA 5IP9H 1WD1A 3S2DH 4RGTA 1F9PA 5COYA 1QG7A 1JJ2A 4CC7A 4E6RA 4E7IA 5EJWA 5D6XA 1VQ7T 1PTOB 4JYAL 1D5MC 3WVDB 2UUCQ 2ZCFB 4XQJA 4F16A 3W3AA 3OW2A 1H3HA 1VQBA 4OF1A 2FPEA 2DNUA 2R5AA 1B53A 4LUOA 2ED0A 2F5TX 4RGMA 2VB6A 3FC3A 4M7DF 2JS2A 2LRQA 3CCJA 5IH2A 2AKWB 4QJFA 2HKQB 3D0FA 2OEOA 3OTOQ 4E7LA 4EMKC 2DPPB 3MXUA 2NUTB 4FP5D 1SKUB 1K83H 3VS0A 1EIGA 4OO1H 2IWHA 1PKSA 1UEAB 2FHDA 1JXOA 5LJ3h 1ZKOA 2NUPA 2YU9H 4DF7A 2HAXA 4LF8Q 5JAVA 5FU7C 1W6KA 3JAML 1JB3A 1GRIA 5GMKe 1I07A 3V7CA 4L5TA 3UE1A 1M3AA 3WOEA 1VQNA 2K57A 2K2VA 4J8OA 4YWMA 3ERSX 2KMTA 1I4PA 4FSSA 2PW5A 3I73A 2EJ9A 2ROLA 4M4ZA 5FWCA 1EIHA 1JQQA 4LE9A 2ZGWA 4M7DE 3M4PA 2JN0A 2MP1A 2A6EC 2NYZD 1F2YA 2BA0A 2WB1E 1Q46A 4JPBW 1PFSA 4ZLTF 4M7AC 2GVBA 2QDLA 3GP8A 3CRLC 1LTBD 4OWXB 5M3MH 5AYFA 5HK3A 4J1MA 1AWWA 4R4OA 4M78C 1L1OB 3JCMb 3CW2C 2DXTA 5KYIA 1NEGA 2H3JA 3CQTA 4J6XA 3VU3C 1BBUA 2G9HD 4MMKA 3QWNA 1FMKA 1VQLA 2LY7A 2L9HA 5C0XJ 2VXFA 4XK8E 1LM0A 2F0VA 2I0NA 2P0PA 1JOOA 4OX9Q 3J7AF 3VS1A 3N52A 3MEUA 5LJ3d 4BBSH 2Q8TA 1NEBA 3SXHA 1KNEA 2DTOA 1PRTF 2ZTEA 4GLVB 2E74C 4CJ1B 1CKNB 2RJDA 4X65Q 4A3LG 2B2TC 1STEA 1H3ZA 2P5ZX 2E2JB 1LTRD 3I8ZA 2FPDA 3FKIH 1M90U 3RKWA 3TQYA 4L63B 4FW2A 4KHPQ 2FG0A 2M16A 3SK8A 3I4NB 5A0DA 3LLRA 1YNNC 4XU0A 2B39A 2F3VA 2KXDA 2WSFE 3OMCA 1AEYA 2BA1A 4ME5A 2ICIA 3NPPA 2EJFA 2K3BA 2RJEA 1RACB 3F70A 4BY6C 4DOVA 2VUBA 3HL8A 4ZGEB 3HRUA 4HJ7A 1OULA 3K7AH 2HCCA 3R6OA 1YJ9Q 2CDTA 4AMCA 2OTJA 5J26A 1ZYRC 1X65A 2XICA 3I55Q 1Z9QA 4J9IA 4AFQC 4PJOE 1AEXA 2LQ8A 2NUZA 2E2HH 5HCKA 1AE3A 1N6AA 3NWTA 4FF2A 3PQIA 4M7DB 2FZCB 1W2BP 1S5FD 3EQLC 4A4KA 5JPMC 3LH5A 1TUDA 2FYKA 4LN2A 1MD2D 3RUZA 2R93G 1H95A 1HTLD 5M5WB 2WB1B 1UJYA 3ITPA 1SNDA 2UUCL 3F2CA 3NP8A 4BACA 1HNXL 1Q1EA 2LS01 1UEBA 3FHWA 3SVMA 4BY6B 2XIDA 3BZCA 5LMUQ 2RQWA 4XTYA 1NBWA 3PSIA 4QF4A 3CCEQ 3H15A 1GKHA 3S3NA 2SEBD 3E19A 4BUGA 1G3YA 3CCQQ 3ONAB 4QVCA 3OTOL 2DZCA 3GOXA 3SHWA 2FFKB 3OB9A 3AB9A 5FO9B 4IFDJ 1X01A 2FZKB 5C44B 1ZQ1A 1J6QA 3KJPA 1RTNA 1JB7A 2DFUA 4A3MH 1QVCA 1VQ5A 1B07A 4EQNA 2KNBB 4LF8L 1E6GA 5EGTA 3VS5A 1PRTC 1PZKD 1KAAA 5C4JH 4OP0A 4ATOA 1AFPA 1ENFA 3JV3A 2LVMA 3MFYA 4JRKA 2F0SA 2K14A 4DAYA 1H641 2ED1A 4MZ9A 1RIPA 1TUCA 4IOAA 3CC7A 3G48A 2EGEA 4C92G 4ZCKA 4PNOA 3CQZB 2FEIA 3G7LA 4OB1B 4E7SA 4IALA 4ZGDB 3T4AC 3E6ZX 5CKEA 1FNVA 3DXJC 2RQRA 3M0TA 2B2VC 2QDBA 1QWFA 4DUYQ 2M51A 4JG2A 1DZ1A 4C3IH 4PJOB 2KOLA 1M3CA 5ECAA 2L2PA 4A4IA 3GD7A 1PRTB 5D3IB 1PH3A 1MNEA 2I5LX 4M1UB 2JS0A 3UDFA 2GGRA 1B9NA 1EOTA 1NY4A 2GA4B 4RTXA 4A63B 1KQSA 1F9QA 1HQRD 4CKCA 1N32Q 4L59A 4GKKQ 1HNZQ 1IO6A 1H9RA 1TR5A 2DUDA 2EE1A 4M77A 3IQLA 4XU3A 3IFDA 3VS3A 2HQLA 4YHHQ 4C8QF 1NYGA 1F2MA 3QKJA 4DEXA 4X65L 4Y52H 1O7LA 1HZCA 3S9WA 4LUEA 1GCQA 5I22A 5FJ8G 4HCZA 3A8JE 4PKCC 3EGXB 4KHPL 4OMPA 2EGCA 3SDZA 2ZXOA 1B4OA 2SDFA 3IKJA 5D3DA 2X3WD 3MFGA 4DK1A 4C1NK 5L37A 2KI7A 3VYRA 2EGAA 2JQOA 4ESRA 4LXCA 2E5KA 1I1JA 4NXML 1ZUUA 2MJ8A 1G8ZD 3FKIG 3KF6B 4O6JA 4DV2Q 4DR1Q 4H44C 1SG5A 4P75A 3CU7A 2EQJA 4DR6L 4IUTA 3V8KA 3PV0A 4LMQD 3SHLA 2Y90A 1ENCA 4R9WA 4DV6Q 1JXMA 2RHUA 2RJCA 3R8BA 1WHGA 1Q90A 1DONA 2LCLA 4B3SL 4G7OC 2FXQA 5J39A 1HNWL 4DV7L 3H3VC 5J1ZA 3K58A 2X4XA 1C0MA 1VQEA 2NUTA 3NFCA 2L3PA 1PMRA 2Y4XA 3PFSA 1VQCA 2Z8LA 1NPRA 5L23A 4HN7A 4RCNA 3DB3A 4KH0B 1E24A 4IUNA 4LF7Q 5ELBA 1SMYD 4IOCA 3A54A 3SEMA 1C1AA 1FGBD 3M5AA 1YITT 1F2LA 2K75A 2D0PA 3HFOA 1CSQA 2Z9HA 3KDFB 4JS4A 3TS0A 4ZAIA 4AQYL 4UDUC 1VQLQ 1M9SA 3NEMA 2Q2TA 2E41A 3MP1A 3LGLA 1TXQA 1SPKA 3SR1A 1HFNA 1MNDA 1X2KA 2JA7B 1NLPC 4L5GA 2CWAA 2HDLA 1BVSA 2AHOB 4C92D 3QWXX 3PUVA 1G3TA 2ECZA 4KY6A 3J81j 4EMKA 1GM5A 1PA6A 1VA7A 4C8QC 2GBQA 2PMZE 2JW4A 1HUNA 3K0YA 2B63B 4J9CA 3GTGH 1PWTA 2ZPGB 2E10A 1M90C 3VR6A 4A3FB 1A6XA 1O9SA 1O7YA 5GAMj 1L1OA 4ANJA 1EFNA 1XX8A 3P1HA 4C0ZA 1PSEA 2FL7A 4NL3A 1YJWA 3I55T 4A93H 4A3BH 3E2UA 3MTSA 5C3EH 1V29B 3CCUA 4MHEA 2R7ZH 2I5MX 1PCXA 1QWEA 2XG8D 2JA8B 5FWBA 1ET9A 1EY6A 2LXKA 3STBD 1K9MU 5LJ5e 2OTJQ 2IHFA 2VXEA 4P72A 5IYCH 2JXMB 1TH7A 4DAVA 4ZKCB 1EYGA 2YRCA 3NPFA 1VQ4Q 1CKNA 4RAUC 4JI4Q 1EWHA 4M7AA 1I5FA 5LJ5j 4HT8A 4ME3A 3BYYB 3CCET 1PM3A 5CKHA 1Y8OB 4GKKL 3DB4A 5CGKA 1HNZL 4K11A 2WIIB 1TOVA 5G3LF 2YT6A 5CKBA 2QEXQ 4C3IG 3CCQT 1G83A 1RI0A 2DL5A 1AHJB 1IW7D 9ATCB 2X6GA 4KBMB 4LF9L 6AT1B 4LW1A 5EPJA 3M56A 1OOTA 2JXBA 4MN3A 4YIJA 2CYZB 4JJNK 1NJIU 3TEHB 4OMQA 4DKAC 1AZQA 4LF4L 2G6FX 3OYEA 4BDZA 2R61A 5C0XI 1CHPD 1IGUA 2B2TA 1W6XA 1X6BA 2HKNA 3EG0A 4K2KA 4M7DA 2L5QA 3AT1B 1DJRD 4OB0B 2V8IA 1BCPF 4YY3Q 3SK6A 3T53B 3AEVA 1X69A 1LTSD 2ICEC 1ZA1B 4PV1C 3NGPA 2RHXA 3GIBA 4A3CG 2V8KA 2PMZB 3KBXA 4NDXA 4DV2L 1IBKL 2F0KA 2C0TA 3E1SA 2RVLA 1UGRB 4DR1L 5I21A 3TU4K 1HFGA 1TT2A 2VXWA 4DV6L 5KYXB 3BDCA 1A62A 1LTGD 1BK2A 2QQRA 3CC7Q 2KE9A 4QUCA 2DMOA 5C4XH 4A3KH 4GOPB 2A7YA 5HGQA 2GFUA 3FPUB 3TZDA 3VA7A 2VV5A 1UWVA 4WTOB 1YVCA 3DM1A 2EPDA 3M3YB 4BD3A 2DO3A 5DM63 4DR2L 3DM3A 4ZNXA 1T0HA 1I50B 1PKTA 2DD4A 4IURA 5DLQE 1FJGL 3URGA 4KY7A 4LF7L 1X56A 1WTHA 3W1BA 5GMKm 2OF1A 5IAYA 5KYWB 3GTJH 4JJBA 2EYJA 1TWBA 3META 2LC4A 1I94L 5KYYB 2PCFB 2K6AA 3VR4A 4KY5A 2PZUA 3DEPA 5GAN3 3RLFA 4FT4A 3GTQB 4BY7G 2LSSA 1NE3A 2RNAA 1SN8A 2F0PA 1I4HA 2DZ9A 1YIJA 3LWEA 2CP0A 1VQKA 2ALYB 1XNQQ 3QHSA 1UJ0A 3D6CA 3T51B 3V7RA 4L6TB 3OWFA 4PZ8A 5GAGC 2W10A 3VDYA 3BYTB 1R9TB 2DN8A 1RI9A 4X1VA 4LF6L 4R0KA 4C92E 1S4ZA 1X55A 3ZFJA 2Q8RE 1EY0A 4IFDI 4Q5VA 3JB9G 3NTKA 1GVPA 3KF8A 1JQYD 4FXDA 2CW0C 3EGDA 1FMWA 4HKEA 4HAEA 5D65A 4G7HC 3OS1A 1LT3D 3GO5A 3OYHA 3ND9A 4DV4Q 2VYTA 4MIUA 3J81L 1HH2P 3JCMe 2BH8A 3OSSC 5GMKi 1MJCA 2NTSA 4OHJA 3WOFA 5LJ3g 2R93B 2C0OA 2AT1B 3L2QA 2B2VA 4M77G 2OQ0A 2VW9A 2EYHA 3EGXA 2K4YA 1C48A 2R6GA 2ZPEB 2EY6A 3MKDA 3D8GA 2ESWA 1ZBJA 2RI5A 3A1PA 3S17H 4UP8A 5NUCA 1KD1U 3S6WA 4APVA 1WTXA 1VOMA 3E0JA 3A5ZB 1VQLT 1XNRQ 1BCPB 1U1SA 3CKIB 5KYUB 2QQSA 3RLOA 3KF6A 3NXWA 2AUJD 2ID0A 4HMIA 2K03A 1M4ZA 1JEGA 3DUZA 2AQ1B 4V0BA 2A8VA 1I4QA 1VQOQ 2CZ7B 1A3TA 1R0BG 4AT1B 1IHVA 3JCMQ 1WJSA 1I5LA 1N36Q 1SFOH 3GTMH 5KYNA 1TWGB 5IYDG 1K73R 4YY3L 1TQOA 1R0CB 3EG9A 3CCRQ 3DLMA 3E9GA 1LV9A 3AU7A 4QKUA 1K83B 4BE0A 1LT5D 2DY8A 1KIXA 2B8GA 1I6HB 3VRYA 2FJ2A 4C92B 4H02A 3QSUA 3VYTA 2B2UC 4ABNA 4FF3A 1H9JA 5FLXL 2IX1A 2F0JA 3M57A 1OX9A 5IHIA 3VYGA 4X3KA 3KDFA 3TS2A 4R55A 4B3RL 2OTJT 1YJWQ 1A8VA 2F0MA 1ZUKA 3CC4Q 3CC2A 4OELB 1D09B 2IT1A 3OYFA 4UP9A 3BDLA 3CCUQ 5LL6X 1K73C 1K9MC 3VR2A 2NVYH 1NJIR 1S5DD 2AWOA 1R8OB 4XTVA 4EMGA 1KC8U 1OPKA 4V2SA 2QEXT 4RTTA 1N9SA 1IL8A 2KVMA 5JEAH 3A74A 2MYSA 4LDYA 4DR5Q 1GXDC 1Q8KA 1Z7TA 2RD1A 2JTEA 5LHY1 1B2TA 1YNZA 1JC7A 4FXGC 3HOYG 3TZUA 2NYSA 1GBQA 4LUVA 5E4XA 4EQPA 2FHTA 4PJJA 3JB9D 1N33Q 2CKKA 1KQSP 5GANe 2F1MA 2N78A 4JBMA 3L2ZA 2EVBA 4ILWA 3CCMQ 3CCSA 1N34L 4JZ4A 1G2TA 1NJIC 5GAN4 3CMEA 3I56A 3OYDA 2K7VA 4DGZA 5D7UA 1VQ5T 1NSNS 5C4ZA 1EIFA 4DBHA 3S1QH 4C8QA 4NPSA 4AG1C 1DYQA 3FKIB 1SRLA 1VCIA 3A8IE 4M77D 2KCTA 4QVDA 4WJWA 5CYUA 2H1EA 4M7AG 4DV4L 3CC7T 1OXVA 2V1RA 4A76A 2F69A 3QJYA 4WCIA 2YDLA 1TWAH 5CORA 4M78G 3UDXA 1QCNA 2RSOA 2HD0A 4FM4B 2YTXA 2NUCA 4NW2A 3GTPH 1NUCA 2BDNA 2LJ0A 5I9OA 2RDFA 4IPHA 3K5LA 4Z9CB 4NOYA 1Q82U 1ZSZC 1N8RU 1SHGA 2HQXA 1SE2A 1SYDA 3FP9A 3OIPA 3DMUA 4E2FB 3LWUA 4PJLA 4HTHA 3NTIA 3S1NB 3C0CA 3T13A 2NUPB 1KDAA 4XQ3A 5FROA 3TMEA 4PJNA 1VQMA 4X62L 4DEYA 3F8TA 2EXZA 3J81E 1MHNA 4PMWA 3BJUA 2B2YC 3OOCA 5KIXA 1VQ7Q 1SR3A 4XDXA 1TS9A 1JE5A 5KYXA 2EY1A 4OGEA 4S3SA 2GFAA 1XPUA 4OWTB 1WHHA 3AMUA 3EG2A 3TVTA 1CI3M 1YIJQ 2CGHA 5LJ5h 2I46A 3REAB 4RGNA 2I0QA 4WJ3M 4A3IH 4JC0A 4FL6A 2ASBA 2HSEB 1LPLA 3PUXA 1RUWA 5CR2A 4IUUA 4LFCL 1BNZA 3RUXA 2K50A 3U4ZA 1UB4A 4QQBX 3KFUA 4DA2A 2KCMA 1KRSA 3HOUH 2M9VA 4L8JA 3E9IA 2J7IA 4IPDA 1GXIE 1EZZB 2D0NA 3VS6A 4E7HA 3UE0A 1G6PA 2UUAQ 4R56A 2BZXA 2BZ8A 1QZGA 1LABA 2QCPX 2PQWA 4G4KA 1RAGB 1FL0A 2FPFA 2D9UA 3QYGB 2ATWA 1U5SA 4LD6A 1CSPA 1TIID 3VR3A 5IXFA 4DN4M 3FIFA 1NR4A 4PLIA 4FW1A 2UXDQ 4KD4A 4E7ZA 4C3IB 5IGCA 1MBYA 3HOWH 4B3TQ 4FF1A 4RHSA 2K5DA 3S1MB 3TP7A 3L2PA 5K36G 5M5XB 3LYIA 1VQ9A 3K0XA 3ZJYC 4POGA 2HBPA 1RABB 3ASKA 1KD1C 4JRQA 1BOSA 2P4RA 3I4MH 4JYAQ 5LJ5d 1KXLA 1E1TA 3GDEA 4AFUC 2PNRC 4J8QA 3X26B 4A3EH 4JBJA 2YWWA 4L5QA 2KVQG 2MNAA 1BI2A 2JA5H 4M7AD 4DK0A 1Q7YR 4ELYC 3PVQA 4JI7Q 1R4PB 3CCRT 1BIAA 1SRMA 1OXXK 4OVAA 1E0BA 1ENAA 3VYSA 1EOVA 1BO0A 1EFID 3U50C 1KC8R 2KGTA 3OYYA 3JCMf 1PRMC 4KUDK 5BN3A 1XMQL 1V43A 3M0RA 1YJWT 1WGSA 1YNJD 1ABOA 2X4YA 2EYLA 4HCSA 4M77E 1SYFA 2CP5A 1E2ZA 1UE9A 5KYUA 1TWHB 4K6LA 4QB4A 3CCUT 1TS3A 4MNOA 1HR0W 2B2WA 3PO2G 4M7DD 2KXCA 5GJVB 2IY5B 2PQAA 1YNND 1LTAD 1ML0D 4N9PA 2N3SA 1C8CA 1Y1VH 1ACMB 1FVIA 2AUKA 2DF6A 2IX3A 4PFOA 3KLSA 5I2XA 1KC8C 2IG0A 4BS9A 2QQ9A 4IQZA 1HZBA 2FMCA 1I4GA 2DJQA 2O01E 1SEBD 4BY7B 1PC0A 3OHXC 4F7UG 1YHQA 3P8BB 1JWMD 4DAYB 1RAHB 1RKNA 3CCMT 2J0TD 4RKBA 2LJ1A 4OB2B 1EY4A 1YCSB 1U4RA 1YI2A 1N9RA 5A0GA 2LT1A 4PZ7A 2FVUA 2CP7A 3CCSQ 1AOJA 4KT0E 3DWPA 3NQTA 4KJNA 3QZ5B 1DJ7B 1QQJA 3R93A 1H9MA 4MDXA 2ZJPA 4DBRA 2HIVA 2E2DC 4BE2A 3EBEA 3QIAA 4P71A 5HK0A 1HZ9A 2B2UA 3RERA 2K5VA 3RD4A 5CBAE 3M4OB 1D0ZA 4RG1A 2UUAL 4Y28E 2O5IC 4A53A 2L12A 4GNXB 3GTOB 1M1GA 4M77B 5CO7A 5IP7H 2DILA 3BE3A 4XTXA 2NZHA 3T1HQ 5LJ3f 1NTGA 2L0CA 3WWVA 1B1ZA 4R4CA 1PRTD 3CAMA 4D8DA 1N9WA 2UXDL 5IGGA 2HCKA 1KG1A 1Q82C 2AZVA 4BBRH 4M78F 1OTCA 1N8RC 2FMMA 1Y1WH 2EW3A 3FEOA 3BFMA 5GAOm 1M1KU 4J9BA 4HVUA 1OZ2A 3JCMd 3A8LB 4C8QG 4K14A 4DV5Q 4EMHA 1HRJA 2QGGA 4AIMA 3HOWG 2NVXH 2RSNA 1H92A 1HNXQ 2LQWA 1VQMQ 2SNMA 2VNUD 3FLGA 2C5CA 1YIJT 1YP5A 1VQKT 2PI2A 4JI7L 3CCVA 3GNFB 1T5XD 5C0XH 1LT6D 4ME7A 2P84A 1IKLA 4DR3Q 2RQUA 5E3FA 4XTUA 1Q1BA 3S1RB 4M7AE 1TWFB 3RLNA 2YHTA 3K57A 2NVTH 3RZDH 2KYBA 2JP1A 4M78E 1LTID 1VF5C 4PL6A 2ZTDA 2VGMA 4B9WA 5HY6A 4HCCA 2CFMA 2KCNA 1X54A 2E1HA 2DY7A 3G4SQ 2XSCA 5IT9c 1CTMA 2NVQB 1X3QA 1SE3A 2WINB 3A56A 2RDGA 4QIWE 3PMTA 3A8OB 5GANh 1K3RA 4LF5Q 5C4XB 2PUOB 2GVAA 4IZ8A 4ZRZA 1PH7A 4UPAA 1J8IA 4FVMA 1ZSZA 2CP6A 1E22A 3RR6A 5CV4A 3QWYA 3O13A 1NMGA 1IKMA 4EMKB 2RI3A 1X9NA 3S16B 1CZWA 3HOYB 3H0GH 2VZAA 1FX7A 2XMFA 3G71A 1JWUD 5FU7B 1UGQB 4WORA 1VQ9Q 4KD3A 1Y71A 3QBYA 4AFSC 4DNIA 1RADB 3OYAA 1UHCA 1GL5A 2NN6I 2RH2A 1U1TA 1OI1A 4X6AH 3EGUA 5I6WA 3M53A 1PNJA 2VUMH 1YITQ 1KABA 2QASA 4CC3A 2MF2A 3I70A 2RJFA 2A73B 1QVFP 4F8MA 3H41A 3C95A 3P8HA 4M7AB 5M5YB 1UFFA 2QDYB 4AG2C 2K04A 2Q2HA 2X69A 3A0JA 3W5OA 4J9GA 5GANd 1IB8A 4M78B 3PNWC 4FYVB 1KLGD 2JM9A 1X32A 3FB9A 3LW5E 2BTTA 2PNHA 4NXMQ 2E6NA 3A98A 1A15A 2C35B 2Q2IA 3OPOA 3T1HL 2H8HA 1CKOA 3E3XA 1KK7A 4JI3L 1PH2A 4C8QD 3J80i 1S3OA 4DV1L 1IREB 3S2HH 2PU9B 4DR6Q 1LO5D 1ASZA 2KY9A 4QIWB 3CXCA 4C5IA 2EQMA 2KQWA 3FVQA 3VA5A 3CF5A 3T16A 4XU1A 4N8X1 1UDLA 2A37A 1HTPA 2EY2A 5KCOA 4POFA 2KSSA 4B3SQ 1IYVA 3CPWP 4F87A 1ZHIA 4DV7Q 1HNWQ 1BIBA 4DV5L 1HR0L 2XWBB 2E5LL 2KROA 1XYIA 3PVLA 2YUOA 1SMXA 3A8HB 4DOWA 1QVFS 5ELEA 5IP9G 2XWJB 3NENA 1MUZA 1YHQQ 3QDRB 3UA6A 2EPBA 1EYDA 1X3PA 4U673 1PYBA 3H09A 2F0NA 5I2YA 4DR3L 3CCST 2CVRA 1SNPA 2RB6A 3I56T 4KLKA 3TSSA 5LMNW 4GN5A 4F7UF 4C3HH 4AQYQ 4M75F 3GPLA 3QO2A 5GAOr 3AFPA 2K2MA 2VASA 3K81C 2A28A 5CV6A 2QGFB 4WRDA 4II1A 2R92H 1PFBA 2MOXA 4O0AA 3LX7A 3Q24A 1TUGB 2L15A 2Y0SG 4P73A 3PF5A 3OYBA 2LX9A 4OMMA 4J7IA 5ELDA 1NNXA 4IO9A 4FDBA 1PHTA 4A4EA 3CPWS 1D5ZC 1GHJA 2EFIA 1G5VA 4OO1G 4P5NA 4LF5L 4X3SA 5BN4A 1U0LA 2K52A 3TDQA 3I3CA 2LCSA 1GUSA 4PNYA 4GLXA 2YXYA 3EG1A 1CA5A 5AJ3L 3PO3H 2KT8A 4FYWB 4F7UE 4HR7B 5GAHC 3M9BA 3S24A 4N4HA 8ATCB 4ALPA 1VIFA 2K1BA 1D3BA 4YTLA 1M1KC 1VQMT 1FR3A 4RH6A 2DTHA 3KF8B 2AIRB 2VQFQ 1RCVD 4A3GH 3EGDB 3HTRA 3T1YQ 2A08A 3S14B 4DA4A 2LMCB 2ZTCA 3J80c 3H0GG 1ZA2B 4DBFA 5M3MG 1VYUA 4XTZA 3OYGA 4GNXA 4O42A 2AKLA 2JA9A 1CHQD 2MPMA 4PZ6A 1Y0MA 3SK4A 4GS3A 2PW7A 1G8XA 4LF9Q 2F4VQ 1EWCA 1WNLA 1A3UA 3CCJQ 2J6KA 4AYBG 4LF4Q 2VUMG 2N49A 3Q8DA 4BBSG 4M75C 3G4ST 1KJWA 4BI8B 2YUQA 3ULPA 1D2BA 2KENA 2L55A 5G3LD 3PO2B 1KAWA 2ZJQA 1XTDA 5ISRA 1PRLC 1WTPA 2KEDA 3RKYA 2NB0A 4RFBA 5M9OA 1TWAB 3KLRA 1IBKQ 2RPNA 3ZYYX 5FU6C 5JJLA 1S72A 4OEMB 1VYVA 1GO3E 3W1GA 1Q8IA 1VQNQ 4OONA 3RMHA 1T9HA 4NP5A 5KE3A 3GTPB 1IGQA 4C8QE 1NAPA 1UGSB 4MMLA 2RCFA 3D4DA 5KGUA 3M7NA 2CW0D 1JJGA 1UG1A 5DM7R 3Q0AA 1WTWA 2DL8A 1BCPD 4HVWA 2EYFA 3EG9B 5CIUA 1BI1A 4F7UB 1VQ9T 2I5HA 1RDPD 2KBTA 2QF7A 4DR2Q 4A75A 1QWYA 1NYFA 1EEFD 1FJGQ 1QB5D 1M90R 5JJKA 1PFNA 3G71Q 5GAN5 4OWWB 1I94Q 3N5BB 4QQGA 5FU6B 1TSFA 2RCNA 5FK9C 5EKIA 2DKGA 4UY8C 2L89A 1OX8A 5FKAC 3JAMi 1UECA 3HP9A 3GBQA 1ONLA 2MPXC 1U4PA 3OWEB 4C5GA 1UE5A 3GTLB 4LUZA 1Q81U 2A1AA 4EPCA 2LXJA 3HRSA 4Q5WA 4LFAQ 3MA2B 4IIOA 2K32A 5M3FH 1WTQA 1XPRA 1K8GA 5GAMe 1SBBB 1W6JA 1D5XC 2A3LA 1B7TA 3LWIA 2KHJA 1M8VA 4C3HG 1D0XA 2ZM6Q 4LF6Q 4XQQA 4GKJQ 1V76A 3UI2A 1VQAA 1D0YA 2K3XA 4A3MG 2R7DA 4HIDA 2R92G 3D7SB 2KJXA 1OXUA 2ZPFB 4EQOA 4FXKC 2H4OA 2E2IH 1VQPA 4J9DA 3ZBDA 1SNQA 3I5SA 3NTHA 1VQ8A 4RCOA 3K8AA 3J7A5 2H3EB 1X2QA 2KRSA 2XDBA 4C2MB 1QNUA 3KJOA 4RCCA 2JT4A 5GAOq 2WACA 5CQXA 4C8QB 2AHJB 1WHJA 1I4XA 4MTKA 2VQFL 3GTKH 2TSSA 3HOWB 2D0OA 4FCYA 3PO3G 2QYZA 1YHQT 3T1YL 4J9FA 5GAN8 4M78A 2JZ2A 2WV6D 2N88A 1BI0A 1WCMH 4O2DA 3CCLA 1AZPA 2OCEA 2YRVA 1PSFA 1ARKA 1VQ6A 3QOLA 3HOZH 4LK1C 4KJOA 3H6ZA 2LKVA 4K2LA 5FRNA 1Q3LA 2GTJA 1AP0A 1XTCD 2F4VL 3Q23A 1J5EQ 2RN8A 1YI2T 1HXYD 4A3GG 4HMJA 2L3QA 2D5DA 2DTIA 1KQ2A 1DGSA 4E7JA 1WOCA 4NMZA 5A35A 4BI4A 4BWGB 2CUBA 4HCBA 1K4US 2HMAA 3EFXD 3EH1A 1SYCA 3BVMA 1BBZA 4CJ2C 3R6NA 1PTOH 2DRKA 4I7ZC 3M55A 1VQ5Q 1OU9A 1I3QH 1RLPC 4C5EA 2GQIA 3JCMg 1SSOA 4CDFC 3WDNA 4IJHA 2F5KA 1JJCB 5LMNL 3JAMc 4QUFA 1MMGA 3QIIA 5FW9A 1J3TA 1PH6A 1SAPA 4B3RQ 2HQHA 3HOXH 3JB9J 2MFIA 4KN4C 2LNHB 3G1JA 4RTWA 3H91A 3SFMA 1MSGA 1G3SA 3H6MA 2CP3A 1O75A 1VQDA 5DY9A 2KEAA 1Y14B 3QYHB 2B29A 4C0DC 4XU2A 3HHTB 4RMOA 1OV3A 2K5HA 1A0NB 4J6HA 4B3ML 1LNXA 2AZSA 4GLAC 4J9EA 3RIRA 3NELA 4DNRB 3S15B 2CUDA 3C46A 4J15A 3ZEHA 2YLBA 4C3JH 3CCVT 1Q95G 2EYPA 1X43A 4ZUIA 1KDBA 4JI1Q 3CCJT 4FYYB 2Y0SE 4LFAL 5CVIA 2F0FA 1JRIA 4XXEA 4D8KA 3JCMW 2PVOB 2DGYA 2UXCQ 4JW0A 5KH6A 1N34Q 3EFRA 2HHHL 3NE5B 4ZK9B 2HUGA 2ZM6L 4GKJL 2DK3A 4J7FA 4LDXA 2PQEA 1BB9A 4Z88A 2WAQG 1AE2A 4H7BA 2MO0A 5H1SE 1A3VA 1YNXA 3K5NA 1G51A 4QL5A 1QJOA 3EJIA 3S3OA 2FZGB 1VQNT 4X66Q 3L2VA 3OBYA 1J9OA 3VYHB 3OIQA 4L5SA 1GUNA 5IHNA 2ZPIB 4GLKA 5KNDA 2Z4HA 1W4SA 5GROA 2LQKA 2KEEA 3F2UA 5IYBH 3UDIA 2DVJA 1UHFA 1DOMA 3I35A 1K9AA 3SE0A 4A93G 1MIUA 4A3BG 2L0AA 5C3EG 2EYMA 2E2JH 2JK8A 2R7ZG 1BR9A 4KRTA 2QAZA 4DV0L 4NKLA 3G71T 3I4NH 3CXCP 3S2DB 1KDCA 3EN2A 1S5BD 3AQQA 5IYCG 3EHQA 2E64A 2DX1A 2QK0A 5GANg 3ZL7C 2WFWA 3RR5A 3NUCA 2PZTA 2VKNA 1RODA 3C12A 1X3GA 4AYBE 1J5EL 1TU0B 1AW7A 4X62Q 1Z9FA 2AMCB 3JCMV 1K1ZA 3EVQA 4HIOA 1JWSD 2X9HA 5KE2A 1STAA 1WCMG 2XRSD 1SMYC 3BU2A 5CKDA 2PQAB 5A2QL 3FEWX 2A68C 2V4DA 2Y0SB 1Q81C 3OYLA 1K9MR 2ENMA 1PZJD 2MGSA 1QZHA 4F7UA 5M5WH 4M75A 4NXNQ 1KL9A 2XK0A 1HD3A 1I8FA 1UE7A 1RJTA 4C5HA 2Z6BA 2YU9B 1TS2A 1EY7A 2RA4A 4KKTA 2PI2E 4I7AA 4DPGA 1BBXC 4LFCQ 1K0XA 1E2VA 1EWIA 3CXCS 4KKSA 1GUWA 2EBPA 2LJ3A 1WXBA 2PNIA 3M4QA 3PMIA 4KK7A 1WHKA 5IXBA 1TXYA 4PMBA 1TVXA 4MZMA 1VQ8Q 2CQAA 3N6RA 1KQ1A 3BDUA 5C44H 4R4IA 3RKXA 3OS5A 1JBMA 3M58A 2EVRA 2CSQA 2AQ2B 3K5OA 1LTLA 4KMUC 4HCEA 2DIQA 3HOXG 1B3QA 4A3KG 4JUVA 1EYAA 1U4LA 3TQ7P 3H0GB 4RMFA 1OU8A 2MO1A 5GQOA 2YUNA 2NN6H 5M3MB 1GFCA 5IT9L 4LD9K 1QCBD 1K28A 4Z02A 1MI2A 3WVEB 2A0FB 2A19A 1O78A 1KLUD 2IW3A 3CCLQ 2PYKA 1BCMA 4KH1B 4JI1L 1BI3A 5JPNC 5DEHA 5ELCA 1D1CA 1FNUA 1C4QA 1SYGA 3CQZH 4XYOA 1YFNA 3JC66 3C4SA 5LL6S 2ZXRA 5DAUA 2SOBA 4AYBB 1QVFA 2VB2X 2VUMB 4N0AC 2UXCL 4MZTA 5C6SA 1SE4A 2XTIA 1IRXA 4C3JG 4BBSB 1MMAA 4QQ6A 3DWQA 1M30A 1QMCA 2FRYA 4BB7A 4X3UA 2XGTA 2UU9L 2LFNA 2QQAA 4DV3Q 1VQJA 3WXMB 3HGBA 2ZAEA 4X66L 3K59A 4E6IA 1XMQQ 5LJ5f 2MK5A 1Y57A 1DCZA 1MMNA 2H5XA 3PCOB 2GNCA 4QCLA 2F0HA 1G91A 2L1BA 1KNAA 1CT1D 4GN4B 1CKMA 3IFTA 3K7AB 5ELOA 4LNQA 3CBOA 1PD1A 4LWCA 5T1IA 2JE6I 1B34A 2XIWA 4OMNA 1M2VB 4QW2A 3CPWA 1V1OA 5DNFA 5DM73 4GBQA 3F2BA 2RK1A 2E2HB 1Z9ZA 3I7FA 2GTOA 3G6EA 4PLLA 5E7NA 5GAMh 3O8VA 1QNKA 2EYOA 1MMDA 1HUMA 1JMCA 1EY5A 2QEJC 2OWOA 1HPCA 1LUZA 3SK5A 2F52A 3PUYA 1ZLMA 5EG2A 3C1FA 2E4HA 1JOKA 2NZOA 2UUBL 1HZAA 1VQFA 4FIBA 3IL8A 2NWGA 4KN7C 5IIFA 2R3ZA 4JI2L 2DVEA 4K5XA 4C3HB 2MQHA 1ZSZB 2P0KA 1VQKQ 3PGGA 3MXNA 4OXPA 5KNBA 1M1FA 2LNVA 2J06A 1STHA 4NXNL 1YCYA 3ER0A 2K5NA 1VF7A 4JI5L 2B86A 2IIMA 1YZ6A 2L11A 2RF4A 2X35A 4J6YA 4A3MB 2R92B 2DE0X 2XNAC 3L9AX 5D14A 1QVGP 5C4JB 1LOJA 1S40A 2PZ1A 3KFVA 1KD1R 2NTTA 4QGUA 1X6GA 2OAUA 2QILA 5C5MA 2Z6KC 2F0WA 4ID6A 5GAMd 3MO8A 5A2QE 3LX0A 4TVRA 3X25B 3SB2A 4IN3A 4QVZA 2JSOA 2JA7H 1T0JA 2K5QA 4PQXA 1SXTA 3TP8A 3PO3B 2X3XD 1SJHD 4DK6C 3J7ZC 1M27C 1TY0A 2Z1CA 1HA6A 4JCVE 1GBRA 2P0QA 3PTAA 4RTZA 3FDTA 1I4K1 1H8KA 2LQNA 3M9QA 3JB9I 1VQIA 2B63H 1HSQA 2V1QA 4A3FH 3I2ZA 1K8AU 1BBWA 2KAFA 1OO9B 1QW1A 1F9RA 2E8GA 4PG3A 3MC0B 1RTOA 2EZVA 3H9NA 4A3GB 2SRCA 5JEAG 1CQVA 3JCMX 3NBHB 1D6EC 4DXGA 1WJRA 2IPOB 4IIMA 3EAEA 3PIOA 2D8HA 1VUBA 1QUQA 2A6ED 2OI3A 5EAYA 1PV4A 2JA8H 4O5VA 4R1JA 2WAQE 3NSWA 1QVGS 1C0AA 3AHUA 2YV5A 1WD0A 2DXBA 2V1CC 2O5JC 4TVAB 1M3BA 4M78D 1LTTD 4DV3L 5IT9E 1Y8NB 2VGNA 4B9XA 1WIEA 3RDVA 5GAN6 1YWOA 1Q86U 4OGQC 4PMCA 1TS4A 1PH4A 1JB0E 3UT1A 3B6YA 3NWSA 1FWZA 2DL7A 1TTHB 3AFQA 2F0EA 2EYQA 2L3RA 1LACA 1JR0D 1OQKA 3X20B 4JRIA 2PVDB 2RM4A 1HK9A 1VQ8T 1WTOA 1AN8A 1EY8A 2D6FA 2J7ZA 3TP5A 5JJZA 2EYZA 2C06A 3M4GA 2ATCB 1V1PB 2YTYA 3CC2Q 2PZWA 3D31A 2EYWA 2GQVA 3W2DA 3NK9A 1EU4A 1JT8A 4CI0C 1PTOF 1KFZA 2ZXPA 3V8LA 4XTCS 1V1QA 2CZ1B 1B70B 2O9VA 3A7LA 5TSSA 4HJ8A 4XAXB 3CCLT 4OMLA 2R58A 1EL0A 3QO3A 2HDAA 1NCVA 2DXCA 4K6DA 4ORZA 4QQDA 1I0CA 2E5QA 2MWPA 3JSCA 2CH4W 2CP2A 4M75G 1ZYRD 2N8NA 5IGEA 5GAN2 1TU2B 4Y92A 2RO0A 1FMVA 4ULLA 3QJ6A 1YJ9A 5I4DA 2BCOA 2X51A 3I9QA 3PT9A 4Q0FA 2D8JA 3SWNC 1EX4A 2F0QA 2Q8IB 1VYTA 1TWCH 2DL4A 2OAWA 3M3YH 4ZYSA 3TRZA 2WAQB 3NMZC 1QVPA 2K5FA 1DXMA 2CHBD 4LUDA 1P92A 3CMEQ 1RAAB 3I56Q 1Q82R 1N8RR 1UTIA 2NLUA 2RK2A 1X3EA 2BOSA 2L5TA 3EROA 1Y7XA 1D3BB 3TBIB 1QP2A 1WDXA 2Y4YA 3GTGB 1PVOA 3A55A 3P20A 1FXXA 1QP3A 4XYQA 4A3IG 1B44D 2DD5A 4DBQA 2ZT9C 2DJGC 3GTQH 3CCQA 3DEOA 2LMJA 3VS4A 4MTNA 2XN9C 5GADC 4CRIA 1KIKA 4A3JH 4A93B 4CDDC 4A3BB 5C3EB 3CHBD 3HKZG 3GP7A 5D6YA 1D7QA 2ZPBB 2R7ZB 4JI3Q 3UDCA 1DOLA 1FNWA 1PZID 4DV1Q 3HOUG 1B9MA 4HSVA 1G6ZA 2A36A 3MP6A 1GCQC 2BE5C 4JOIC 4K5WA 1R9TH 4QT7A 1AWXA 1GCPA 4FSXA 3PUWA 1WFWA 1W70A 1CZGA 2YUPA 3ND8A 3G6EQ 2EIFA 2I07B 2QW7A 5GANf 3MEFA 3FRNA 1PTOC 1Y96A 1EYCA 1ZXTA 2YLCA 1HR0Q 2PVGB 2VWFA 1SEMA 2E3HA 4PFZA 1SNCA 1WCMB 2C9OA 2E76C 2G9DA 1I4RA 4DFAA 2E5LQ 1YBYA 5EQ0A 2FO0A 5FLMH 2HT1A 2K6DA 2UXBQ 4N4IA 4JVZA 4YWLA 5A0LA 3I4MG 2R93H 4Y91A 1EIYB 2EYXA 1VQGA 2A6HC 1M2VA 2HCIA 3QUIA 4A3EG 3TEEA 4B6MA 3TN2A 3H0IA 2JA5G 3PF4A 3RZOH 3EH2A 5J3BA 2JA6H 1F2ZA 1PYWD 2EKOA 3MCAB 2KRMA 1BCOA 2KYMA 2E3IA 2K5WA 2OT2A 3L1AA 3REBB 2EWNA 1K8AR 1I3QB 4F04B 1CFMA 5E1FA 3IRBA 4FF4A 1BKBA 4X9CA 4VUBA 2DNEA 4RHRA 4IUQA 1DOKA 5C6AA 5FLXc 4XT3B 1XJVA 3ME9A 1E3PA 2M02A 3RN5A 1E2WA 1I81A 3IAYA 1ASYA 3UA7A 4M75D 3F2DA 2RQVA 3OQ5A 1TWGH 2PTKA 4A3KB 2EXDA 3HOXB 2VQEL 4ELZC 3MJXA 4PJMA 5AJ3Q 1MJEA 1F9SA 2RHYA 3NHNA 1OZ3A 4X9DA 3J80E 5IGDA 1I6HH 1JICA 3Q22A 2PPBC 1K8AC 4OIJA 4J5YA 1Q86R 3MEAA 1Y1VG 1L1OC 3HFNA 2RHSB 3ULLA 5C3XA 3GTJB 1AT1B 1RD9D 3CP0A 3V2TA 1IBML 1B3AA 4DNTB 2IL8A 2B2YA 4N9TA 4WFN3 2F3IA 4C3JB 4LAAA 4WJ4A 4A3DH 1WXUA 1G3WA 5GMKj 4R4TA 1NLOC 1FD7D 4OIKA 1SJED 4KHZA 4JI6L 2VL6A 4QY7A 3RN2A 1PH5A 2WKCA 3I4LA 2F3WA 4J6WA 1SDFA 4IFDH 1LVKA 3OYMA 1AD5A 1JE4A 1MV3A 3UDGA 3I90A 2XDDA 3H8ZA 4BY1H 2RI2A 1Q86C 2A69C 1N5ZA 3KXTA 3VUBA 2MIOA 4ZTFA 3KUPA 3ICEA 5IOCA 4GZYC 1LCKA 2K28A 2IHEA 5IODA 5CK9A 4KTAA 1SNOA 3CC2T 2Z6KA 1K0RA 3NBHA 4MZPA 4IPGA 1D1BA 1NZ9A 2JN4A 5FJ8H 3U4VA 1TS5A 2K7AA 2G5DA 1XOVA 4PJOF 1YNJC 2OQKA 4K8IA 5EKKA 1AWOA 3CBPA 4X3TA 1BQQT 4A3JG 2O9SA 1I5OB 3VRZA 5IP7G 1F1BB 4M7DC 5JVH3 4P74A 1VDZA 1WJJA 1KSWA 5I6YA 3MEVA 2F2WA 4BI3A 1S5CD 3M0PA 3S17B 4BBRG 3INZA 2EQUA 2A74C 3TSZA 3CEYA 3T9NA 3KUFA 1O7ZA 1U5KA 1Y1WG 2M00A 1IXDA 2UXBL 1E1OA 3GV6A 5CV7A 1STBA 4DXFA 3TREA 1QKXA 2NBFA 1VIEA 2DBMA 3MEHA 2F2XA 4RTVA 2M0YA 1V1PA 2COWA 3JCMc 3CMET 1HQMC 3MHXA 1YHAA 1VQ4A 1STNA 3OS2A 5FLMG 2CS7A 4OB3B 1SFOB 1RL2A 3LH0A 5KCHA 1GUGA 1SNMA 1YI2Q 1YHBA 1WQ7A 4CBVA 3GTMB 1XQHA 2B8FA 5GAEC 1ET6A 4B08A 1V1CA 3MZ5A 3HS0C 1NPPA 2JVVA 3FJPA 1WVLA 3S1NH 4IPCA 2XI9A 1I6VC 2QEXA 3C3LA 3VKIA 2HZYA 1M1KR 4E7KA 2F0IA 2QTVA 1PHJA 2DYIA 3I5RA 1HJPA 4UAIA 3RESA 2JA6G 4CC4B 1U4MA 4XQNA 1N27A 3OYCA 2M2LA 3X28B 4H0LC 4OGCA 5CV5A 1EFWA 5GJWB 2V8JA 3HKSA 1PFMA 3G6ET 5GAN7 1R4QB 4M75E 1PDQA 4PFPA 3UPUA 3FRPB 1QKWA 3A8MB 5C0MA 2NVYB 1KRTA 1HYOA 2DLPA 2O4XA 4PJOC 1L0YB 4U68A 4BA1I 1XMOQ 3H3VI 4JBWA 5IWAQ 2QA4A 2RF0A 4R8NA 2CT4A 1JO8A 1WFQA 4V190 2KT1A 2XHCA 2WP8J 1W2BS 4FYXB 2BIVA 3O5ZA 1OPLA 2JM8A 1FYCA 1H9SB 7AT1B 1BUVT 4ZUJA 4CGYB 3SWNA 1QLYA 5GAMg 2AKKA 4ZQ3A 4DR4Q 2DEQA 2RDHA 3CCVQ 2IVWA 4JJCA 3UWNA 1CA6A 2BDOA 1WYXA 3EIVA 2GF7A 3L0OA 4Y7NH 3FPPA 4A3DG 4ZN1A 4XIGS 2FRWA 2KRNA 2OXPA 4DK3C 3HRZC 3S1MH 3S1QB 5M5XH 4EX5A 3JAME 2O88A 2TMPA 4QMGA 1L0WA 4DAPA 3HKZE 3M59A 1CUKA 1F77A 3ULRB 4UC4A 4IFDG 3CD6A 1SYBA 1WA7A 4JJDA 1OEBA 5LJ5g 4BY1G 4OX9L 2XU8A 2LTOA 3HOVH 2J4XA 2KQ3A 5LMNQ 3A8KE 2YRDA 3L2UA 3HEJA 3MXGA 1PXUA 2MAMA 3MHBA 4KV6A 1ZUYA 1P8LA 4L5RC 2F0UA 4A3CH 1QOHA 2DEUA 4JOIA 2LCCA 3VYUA 1YWPA 1SRUA 3RMQA 4OMFB 1ICWA 1QILA 5GAOn 1IYUA 4FNFA 4KGZB 2VS1A 4FT2A 4M75B 2KUMA 4HJAA 1T3SA 3HPWA 4C56C 3L3OC 5EPKA 3EG3A 3EA6A 3J7YW 3RNUA 4EVOA 1CKAA 3MWYW 3OSVA 1TWHH 4B3MQ 3L42A 2CREA 2F0OA 3L2WA 2F4IA 1YEZA 1SE8A 3M7GA 1D1KA 1UE6A 2RHZA 1VMCA 2WSCE 1ZSGA 4LDUA 3LNNA 3X3MA 3X3NA 4RTYA 4RG8A 2MWOA 2CZ6B 5IGBA 3VS7A 4KGVB 2E65A 1P16A 3BZKA 2JTMA 2LZ6B 1QVGA 2WKDA 5GAOp 4A3IB 2EYYA 4YWKA 1Y69U 1AH9A 2HHHQ 4RUGA 5LMUL 4BY7H 4M8AA 1M2OA 4L6V5 1W3SA 3OSOA 1K8MA 5L8RE 3HKZB 1ZX6A 3UF4A 2O31A 2A68D 1WJQA 3HOUB 5KEEA 1VQOA 1RHPA 2CSIA 5EC7A 2JUFA 4CJ0B 4CHTB 4O1NA 3OS0A 1G291 1SSHA 2EJGC 2B8AA 1L0XB 1WI5A 3JB9H 1NM7A 4HT9A 1ABQA 1XMOL 3CCRA 3KLSX 5IWAL 2XD0A 1HA5A 3E5SA 2DIGA 2WSEE 1EU3A 4JK1C 4FYDA 1NR2A 3Q6SA 1WQWA 2D1XA 2KCCA 3QR8A 4DV0Q 1WXTA 1AVZC 1ESRA 2QG9B 3LWHA 4ODGA 1IBLQ 3M4OH 2D62A 1E6HA 1YJ9T 2E12A 4JLGA 3I4MB 2X4WA 3CC4A 3GTOH 1IHWA 4DR4L 2K79A 2OJ2A 1U06A 2JTFA 4KGXB 4A3EB 3FDRA 2EQSA 2D9TA 5GMKl 2NZ1D 5I2MA 3HZXA 1K73U 1EQQA 1B34B 2M1HA 3PGZA 4DUYL 2JA5B 3A5UA 1IL2A 2OX7A 2ZPHB 4ZN3A 3FMCA 3KLWA 1X6OA 3OYKA 2K9GA 4JI0Q 2OTLA 4YCVA 4JDSA 1N32L 2HDMA 4RTUA 4RG2A 3D3RA 4K5VA 2JEAI 4Z89A 3G7ZA 2CWPA 1PD0A 2EAYA 3HSBA 2KHIA 5CV9A 4LFBQ 3QOJA 2DBKA 1JJ2P 3R3OA 1CQFA 3QB3A 4DQ2A 3GLXA 5GMKh 4N4GA 1SYEA 5IYDH 1GJXA 4YHHL 3CPFA 1D1IA 1H9KA 2KR3A 1UUPA 3CCMA 3R2TA 2HD3A 1Z6HA 4JV5Q 4HVVA 1B7YB 1GOZA 3CMAA 3OW2P 4GOPC 3S1RH 1XPOA 1TWFH 3EFOB 3RNJA 3MEWA 3MXNB 3HOVG 3D6WA 4ZGJB 4K8JA 2XDPA 1WX6A 1SSFA 3CBMA 3V8JA 1EQTA 1Y1VB 4HJ9A 1U9RA 4IUVA 3OYJA 2DM1A 4NL2A 3OW7A 3QXEB 2QA4Q 1SLJA 2AWNA 1T3LA 1O7IA 4OO1I 2NVQH 5EBDA 1BU1A 4IUPA 3RMSA 1JCKB 1XXGA 3D4WA 2LP5A 3TP6A 5KYLA 3QZ9B 5KRUA 3ERQA 2F0TA 2COZA 1IHZA 4I65A 5J22A 1TWCB 1JJ2S 2G3RA 3H0HA 2DJFC 1PH8A 3BW1A 2Q2UA 1YJNA 3S16H 2O2LD 3X24B 4C92F 3K7UC 3HOYH 4C0DB 1SROA 3L7ZC 1AWJA 1UUEA 8AT1B 3OW2S 1VMPA 2UU9Q 4TRDA 5EPLA 4RCBA 2DERA 4BXXH 5I11A 2RMOA 2EOTA 5M3FG 1VQ7A 3S3MA 1X27A 2RHIA 3CD6Q 4HJ5A 1MKHA 2KA7A 1UNSA 1LT4D 3OYNA 4OMOA 1QUQB 1AZEA 1H9SA 3GV3A 5EBCA 5JOBA 3MXPA 1BXTA 4A3JB 2PO4A 1IYJB 1HJDA 1PYSB 1S72Q 2MUYA 3CRKC 1PH9A 1Y07A 2BKDN 1VS0A 2CT3A 2DAQA 4BE1A 5C5LA 4F7XA 4R4QA 3V05A 4WF2A 4AH6A 5JVG3 5D6WA 3F1ZA 4BBRB 4PJOA 1Q81R 2DETA 5M5YH 1MHWC 4JBKA 1OYXA 1Y1WB 1U3OA 4OL7A 5T1GA 1IBLL 4C0FA 3OA6A 3MAQA 2M9UA 3THKA 2F0DA 3I72A 2QQBA 4IKFA 3P7JA 3U9OA 4CDCC 3K80C 2AQ3B 3TSWA 1BCPC 1MGSA 2KBNA 4BDYA 2JJQA 2QTXA 4HCKA 2NVXB 1G2SA 3OYIA 3OY9A 1RLQC 2B2WC 4G7ZC 2K3YA 2ZZDA 4K0KQ 5FRMA 1EY9A 1OXSC 2FB7A 1Z47A 2J6FA 4G57A 2VY3A 1D1AA 1MSHA 1WPYA 3V96A 2UUBQ 3HOZG 4JI4L 2IX0A 4JI0L 2YSQA 4JI2Q 3SGIA 2BUDA 3A7AB 4LDWA 2NVTB 3NBIA 3RZDB 5CCAA 4DUZQ 4HXJA 1B8AA 1II3A 3RZOB 2JA6B 3I4OA 4LFBL 2EJMA 4JI5Q 3G6JB 3GNGA 4JLIA 5I2SA 3K6OA 1A2UA 4C92C 3GQBA 1NBEB 1CK1A 1TG0A 3HRTA 3VS2A 3JCMJ 1Q12A 3M0SA 1L2FA 1RAIB 2HBWA 1IZ6A 4JV5L 3C94A 2VC8A 3P8DA 2GN5A 4E47A 4TQUS 1TKWB 1VQPQ 2ROTA 2CKZB 3PMFA 4HIMA 1G2BA 1M4VA 4CKBA 2V26A 2RKSA 5AT1B 3R2IA 1PG5B 2M0OA 3FJ5A 1HCZA 3RBBB 2F0GA 4RGOS 3STBC 2J6OA 2JJ9A 2QGQA 1WLPB 3L2RA 2JEBI 3I91A 4RWSC 2F03A 1ILQA 3M0UA 4KUIA 2K5IA 1BYMA 4YCUA 2D2CC 4J9HA 4JS5A 1EZ8A 3M54A 1RF2D 2DJZA 5GAMf 1VQ6Q 1Q7YU 1QE6A 4P2CB 2HL3A 5I9PA 5IHKA 1VQ4T 4JI8Q 4J83A 4A3DB 4HA8A 2JMAA 5K36H 4KULA 1IW7C 2EQIA 4DU9A 1UGVA 2Z0SA 3BY7A 2XKOC 4MDWA 5HGTA 3DHQA 4EIKA 2B3GA 5CR3A 2N55A 2DRMA 5LJ3e 2O2OA 1E7OA 4UHVA 2P4TA 4DAMA 4HSPA 2QXFA 4ZKBB 2OTLQ 2DNCA 4BY1B 3DLLA 1Y96B 1ESFA 3S14H 2W0ZA 5LJ3j 1K3BC 3MP8A 2FINB 1WTRA 4GLMA 4NS5A 2K33A 3K5MA 1W1FA 4PK4A 1XNQL 1KHIA 1EZ6A 4BXXG 4RKUE 5CC4A 2EJGA 3GF5A 1M8MA 4A54A 5ELNA 3S2HB 3P75A 4CDEC 4A4FA 3CMAQ 5GANj 5K5PA 2BH2A 3BZDB 3H0FA 2QA4T 3DWAA 3NQIA 1XJWB 5IYBG 4UP7A 2COYA 3MVVA 2VB3X 3JRZA 3PO2H 2CZ0B 3KYHC 4YCWA 2SEMA 3M85A 2J05A 5FO8B 4GN3B 5BR8Q 1K8OA 1A63A 2E70A 2R7FA 1DD2A 3I4NG 2ABLA 4K0KL 1CSKA 3QDFA 1EEID 2BE5D 5ELFA 1V9PA 2X6LA 3E0EA 5CMDA 3LGJA 1NMFA 1S1NA 2HL5C 1WI7A 2D0QB 1W2BA 4H13C 5CBEE 3EFOA 2KHSA 1PTOD
chains in the Genus database with same CATH topology
2QI2A 5JEAJ 4DUZL 1KQSS 4X64Q 5IY0A 2R57A 3CD6T 2LT4A 2PUKB 1XNRL 3V7SA 4BA2I 3PIPA 4M7DG 1X75C 1MGQA 5JJIA 2RA2A 1OXTA 1S72T 4ZTJA 2WB1G 2YTVA 5HKCA 4NB3A 4EDUA 2JOYA 1N36L 3TCJA 2I2LA 4GOPA 3VV0A 3GTLH 5IN1A 3H3VH 4DR7Q 2GCXA 3JCMP 3EFSA 3DKMA 5C44G 2K4KA 1FGUA 3G4SA 2CQOA 1LYLA 4X34A 2ZJRA 2HNIA 2HIXA 2LDMA 2MI6A 3M4YA 1C9OA 4JI8L 5IE8A 2NN6G 3JB9F 4C2MH 5CKFA 4A4HA 1M5Q1 3J81i 1NE8A 4DR5L 4IJLA 2MMPA 1E7ZA 5FLXE 5DLOA 1IXRA 1EUJA 4PJOG 4M77F 2E6ZA 3LGFA 4HIKA 1N33L 1VQOT 2HQEA 1VQPT 1YITA 3KOJA 4KI0A 3AYHB 3A8GB 1X3FA 2DXUA 3SD4A 3VJPA 5CAIA 3ULJA 2VQEQ 2X4JA 5BR8L 1U8RA 2R5MA 1EQRA 1VQ6T 3CC4T 4JRPA 1ZBXA 2ES2A 3VUZA 3OBWA 1IBMQ 3QG1A 1GD7A 4FU6A 5GAOl 3I55A 1Q7YC 2K5LA 1VQHA 4X64L 2CCZA 4JI6Q 2JNGA 2OTLT 1I50H 2O4XB 2KDSA 2EQKA 3S15H 2KK4A 3Q1JA 4C92A 3CCEA 4XTWA 1LJOA 1C7YA 4GNXC 3CMAT 3SWNB 4A3LH 4M77C 3E9FA 1WYDA 4DR7L 3JCMh 3J81c 4LDVA 3OMGA 1PH1A 3KBGA 4A4GA 2L8DA 2JA7G 1XNIA 3HFZB 4GY5A 4D6WA 3QPHA 1HXDA 4EQ5A 2B63G 4A3FG 1UE1A 4C0GA 1A0IA 4PJOD 4N0AA 5CQYA 1D8LA 4M7AF 1YJNT 1KHCA 1UGPB 3E9HA 2RHQB 3U58A 2YYZA 4B3TL 2JA8G 3PUZA 5IP9H 3S2DH 1JJ2A 4E7IA 5D6XA 1VQ7T 4JYAL 3WVDB 2UUCQ 2ZCFB 3OW2A 1VQBA 4OF1A 2R5AA 4LUOA 2F5TX 3FC3A 4M7DF 2LRQA 3CCJA 2AKWB 4QJFA 3D0FA 3OTOQ 4E7LA 4EMKC 2DPPB 1K83H 2FHDA 5LJ3h 2YU9H 2HAXA 4LF8Q 5FU7C 5GMKe 4L5TA 3V7CA 3UE1A 1VQNA 2K57A 2K2VA 4J8OA 4YWMA 3ERSX 2KMTA 2EJ9A 2ZGWA 4M7DE 3M4PA 2JN0A 2BA0A 2WB1E 1Q46A 1PFSA 4M7AC 2GVBA 3GP8A 4OWXB 5M3MH 5AYFA 5HK3A 4R4OA 4M78C 1L1OB 3JCMb 3CW2C 2DXTA 2H3JA 4J6XA 3VU3C 1BBUA 4MMKA 1VQLA 5C0XJ 2VXFA 4XK8E 1LM0A 2P0PA 4OX9Q 3J7AF 3MEUA 5LJ3d 4BBSH 2DTOA 2ZTEA 4GLVB 4X65Q 1CKNB 2RJDA 4A3LG 1H3ZA 3FKIH 1M90U 3RKWA 3TQYA 4KHPQ 2M16A 5A0DA 3LLRA 4XU0A 2WSFE 3OMCA 2BA1A 2EJFA 2RJEA 3F70A 4BY6C 4DOVA 2VUBA 3HL8A 4ZGEB 3HRUA 4HJ7A 3K7AH 3R6OA 2OTJA 5J26A 1X65A 2XICA 4PJOE 2LQ8A 2E2HH 1AE3A 1N6AA 4M7DB 4A4KA 2R93G 2FYKA 1H95A 2UUCL 3F2CA 4BACA 1HNXL 1Q1EA 1UEBA 3FHWA 4BY6B 2XIDA 3BZCA 5LMUQ 4XTYA 1NBWA 3PSIA 3H15A 1GKHA 3S3NA 3E19A 4BUGA 1G3YA 4QVCA 3OTOL 2DZCA 3GOXA 4IFDJ 3OB9A 1X01A 1ZQ1A 1J6QA 3KJPA 1JB7A 4A3MH 1QVCA 1VQ5A 4LF8L 5C4JH 4OP0A 4ATOA 2LVMA 4JRKA 2K14A 1H641 4MZ9A 1RIPA 4IOAA 3CC7A 3G48A 4C92G 4PNOA 4OB1B 4ZGDB 5CKEA 4DUYQ 4JG2A 4C3IH 4PJOB 4A4IA 3GD7A 1PH3A 2I5LX 3UDFA 1NY4A 1N32Q 1KQSA 4L59A 4GKKQ 1HNZQ 2DUDA 4M77A 4XU3A 2HQLA 4YHHQ 4C8QF 4Y52H 3QKJA 4X65L 1HZCA 5FJ8G 4HCZA 4PKCC 4KHPL 3SDZA 2JQOA 4NXML 3FKIG 3KF6B 4O6JA 4DV2Q 4DR1Q 4P75A 4DR6L 2EQJA 4IUTA 3V8KA 3PV0A 2Y90A 4DV6Q 2RHUA 2RJCA 2LCLA 4B3SL 2FXQA 5J39A 1HNWL 4DV7L 2X4XA 1VQEA 3NFCA 2Y4XA 3PFSA 1VQCA 1NPRA 3DB3A 1E24A 4LF7Q 4IOCA 3M5AA 1YITT 2K75A 2D0PA 3HFOA 1CSQA 3KDFB 4JS4A 3TS0A 4AQYL 3NEMA 1M9SA 2Q2TA 2E41A 3LGLA 3MP1A 4L5GA 2CWAA 1BVSA 2AHOB 4C92D 3J81j 3PUVA 1G3TA 1GM5A 4EMKA 1PA6A 4C8QC 2PMZE 3GTGH 2ZPGB 1M90C 2E10A 1O9SA 5GAMj 1L1OA 4C0ZA 1PSEA 2FL7A 4NL3A 1YJWA 3I55T 4A93H 4A3BH 5C3EH 1V29B 3CCUA 2R7ZH 2I5MX 2XG8D 2LXKA 3STBD 1K9MU 5LJ5e 2IHFA 2VXEA 4P72A 5IYCH 1TH7A 1EYGA 1CKNA 4JI4Q 4M7AA 1I5FA 5LJ5j 4HT8A 4ME3A 3CCET 5CKHA 4GKKL 3DB4A 1HNZL 5CKBA 3CCQT 1RI0A 1AHJB 4KBMB 4LF9L 4LW1A 3M56A 2CYZB 4JJNK 1NJIU 3TEHB 4DKAC 4LF4L 3OYEA 4BDZA 5C0XI 4M7DA 2L5QA 4OB0B 2V8IA 4YY3Q 3AEVA 4A3CG 3GIBA 2RHXA 2V8KA 4DV2L 1IBKL 3E1SA 4DR1L 1UGRB 5I21A 3TU4K 4DV6L 1A62A 2QQRA 5C4XH 4A3KH 4GOPB 2A7YA 5HGQA 2GFUA 2VV5A 1UWVA 1YVCA 4BD3A 2DO3A 4DR2L 3DM3A 2DD4A 4IURA 5DLQE 1FJGL 3URGA 4LF7L 1X56A 3W1BA 5GMKm 5IAYA 3GTJH 3META 1I94L 2LC4A 5GAN3 3RLFA 4FT4A 4BY7G 2LSSA 1NE3A 1SN8A 2DZ9A 1YIJA 1VQKA 2ALYB 1XNQQ 3QHSA 3V7RA 4PZ8A 5GAGC 4LF6L 4C92E 1X55A 3ZFJA 4IFDI 3JB9G 3NTKA 1GVPA 4HKEA 3OS1A 3GO5A 3OYHA 4DV4Q 2VYTA 1HH2P 3JCMe 2BH8A 3OSSC 5GMKi 1MJCA 5LJ3g 3L2QA 4M77G 2OQ0A 2VW9A 2K4YA 2R6GA 2ZPEB 2RI5A 3S17H 4UP8A 1KD1U 3S6WA 4APVA 3A5ZB 1VQLT 1XNRQ 1U1SA 2QQSA 3RLOA 3KF6A 2ID0A 1M4ZA 2A8VA 2CZ7B 3JCMQ 1N36Q 1WJSA 1I5LA 1SFOH 3GTMH 5IYDG 4YY3L 3DLMA 3E9GA 4BE0A 1KIXA 4C92B 4H02A 3QSUA 2IX1A 3M57A 3VYGA 3KDFA 3TS2A 4R55A 4B3RL 2OTJT 1A8VA 3CC2A 2IT1A 3OYFA 4UP9A 3BDLA 1K73C 1K9MC 2NVYH 2AWOA 1R8OB 4XTVA 4EMGA 1KC8U 4V2SA 5C4XG 2QEXT 1N9SA 3A74A 4LDYA 4DR5Q 1Q8KA 2RD1A 3HOYG 4LUVA 1N33Q 3JB9D 2CKKA 5GANe 2N78A 4JBMA 3L2ZA 3CCSA 1N34L 1NJIC 5GAN4 3CMEA 3I56A 3OYDA 1VQ5T 1EIFA 3S1QH 4C8QA 4NPSA 1VCIA 4M77D 2KCTA 4QVDA 4M7AG 4DV4L 3CC7T 1OXVA 4A76A 2F69A 3QJYA 1TWAH 4M78G 3UDXA 2YTXA 2HD0A 4FM4B 3GTPH 4IPHA 4NOYA 1Q82U 1N8RU 2HQXA 3FP9A 3NTIA 4XQ3A 5FROA 1VQMA 4X62L 3F8TA 3J81E 1MHNA 4PMWA 3BJUA 1SR3A 1JE5A 4OGEA 1XPUA 2GFAA 4OWTB 2CGHA 5LJ5h 2I0QA 4WJ3M 4A3IH 4JC0A 4FL6A 2ASBA 3PUXA 5CR2A 4IUUA 4LFCL 3RUXA 2K50A 3U4ZA 1UB4A 4QQBX 3KFUA 2KCMA 1KRSA 3HOUH 3E9IA 4IPDA 1GXIE 1G6PA 4E7HA 3UE0A 2UUAQ 4R56A 1QZGA 2PQWA 1FL0A 2ATWA 3QYGB 4LD6A 1CSPA 3FIFA 4PLIA 2UXDQ 3HOWH 4B3TQ 5K36G 3L2PA 3LYIA 1VQ9A 3K0XA 3ZJYC 4POGA 2HBPA 3ASKA 1KD1C 4JRQA 3I4MH 4JYAQ 5LJ5d 1KXLA 1E1TA 3GDEA 3X26B 4A3EH 4JBJA 4L5QA 2KVQG 2MNAA 1BI2A 2JA5H 4M7AD 4ELYC 4JI7Q 3CCRT 1BIAA 1OXXK