1EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
128
Chain Sequence
MPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Initiation factor
total genus 22
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eifA02
1SE8A 2D0OA 1NJIC 3TS0A 3E0EA 4R4CA 4YWMA 5C0XJ 2JA5H 3K7UC 5IP7G 4DV5Q 2YU9H 1VQPA 2JA8G 1U0LA 2I5LX 3J81j 2UXBL 3STBC 5IAYA 3PUVA 1VS0A 1G6PA 3CMAT 4A3KG 2E2HH 1IZ6A 5FLMH 3J81i 5K36G 2UUAL 3A5UA 1YHQT 4TVRA 4BY1H 3PIPA 5FLXE 3I2ZA 1AE3A 2N49A 1N32L 1IBLL 1QVGA 4QL5A 5IYBH 5JJIA 1QUQA 4KI0A 2YTXA 2E2IH 3CC4A 2HIXA 1E22A 5C4XH 3F2DA 2VY3A 3TS2A 2LQ8A 3FKIG 1YITA 1G291 4MZ9A 3BZKA 1PH5A 4LF9Q 3RZDH 1PH4A 2IG0A 1BBUA 3CP0A 5BR8Q 3PUXA 1SRUA 2AWNA 2AKWB 1E1TA 5M3MG 5IWAQ 3P8BB 4DR1L 1VQ8T 4JBWA 1LYLA 3KDFB 1YJNT 1QZGA 3I7FA 3HOXH 1X65A 2ZTCA 2PI2A 4GKJQ 3CMAA 4DR3Q 3PUWA 1E1OA 3UE1A 4EX5A 5EAYA 3OTOL 2VL6A 1I5FA 2YV5A 3S24A 3W1BA 4LFAL 1DGSA 4A4IA 3KDFA 4B3SQ 1YJ9A 2LCLA 4GN3B 3CW2C 2MNAA 2WFWA 3T1YL 1EFWA 4A3BH 1PHJA 3PF4A 4NXNL 3M4QA 3D0FA 4LF7L 3I4NH 1EYGA 1UE7A 4A3MH 1KC8C 1AH9A 4JI8L 4C3HH 5M5WH 4DR5Q 2ATWA 5M5YH 4JOIA 2NVQH 4GNXB 2F4VQ 1MKHA 4A3JH 3EIVA 3CCLT 1XMOL 4GOPC 4X66Q 1CKNB 2UU9Q 2CWPA 5IT9c 1EOVA 1QVCA 3H15A 1XMQQ 5AJ3L 4JYAQ 1C0AA 1H95A 3L2PA 4AIMA 2RCNA 2K5NA 3TRZA 1O7IA 4DV7L 4OONA 3HOUG 2EQSA 2R7FA 1VQKT 1CKNA 2QEXT 4P72A 1X54A 2R6GA 1HR0W 3I56A 4DV4L 4OWTB 4A3FH 3GTLH 3RZOH 1X56A 2K14A 3LGLA 5IE8A 5C3EH 4LFCQ 1N36Q 1N8RU 3UDGA 4P73A 5FLXc 4JI5Q 3CCJT 1J6QA 3D31A 3GTGH 5J26A 1YHAA 4NPSA 4L5SA 5DM7R 2ZTEA 1QZHA 1PA6A 2Q2TA 4XIGS 2YTYA 2Z6KC 1TWHH 2JOYA 1Q81U 3I4OA 3KJPA 2E8GA 1XPOA 1Q7YU 1Q1BA 4R4QA 4DV3L 2JEBI 4QY7A 1YJWT 1NPRA 4QGUA 4GLXA 2ES2A 3M4OH 2DGYA 3G71A 3H3VH 1YBYA 4ZN1A 1VQKA 3L0OA 2QEXA 4DR7L 4HIKA 4LF9L 5IYDH 2LSSA 2JA8H 2ASBA 4YY3L 3S16H 2AWOA 2ZTDA 1VQCA 5BR8L 4JI0Q 4BY7G 1MIUA 3S14H 4GLAC 1A0IA 3CCEA 3PO3G 1RL2A 1PFSA 1K9MC 2CKKA 2QA4T 4B3TL 2R7DA 1XNRQ 2JA6G 4GKJL 3A74A 2B63H 3E9HA 1BVSA 4YCUA 3DB3A 3DLLA 1A8VA 4DR3L 1PH1A 4A3LG 4JV5Q 4OWWB 1XNQL 1VQ9T 1NPPA 4P75A 2A19A 2PQAA 1TWFH 2JJQA 2V1CC 4UP8A 4B3SL 1JJ2A 4QQDA 4GOPB 1YJWA 2MI6A 4BBRH 1VCIA 1HR0Q 3F8TA 2CCZA 4LF4L 4MNOA 1OXSC 1T9HA 3HKZG 5A2QE 2EIFA 5M3FH 4A3GG 1YHBA 2UUBQ 1LM0A 4EQ5A 3A0JA 2CFMA 4KHPQ 3G6ET 1VQNA 1N8RC 2UU9L 4KLKA 2JK8A 3PUYA 4IPDA 3KOJA 1EWIA 3GTQH 1V1QA 1Q82U 2QA4A 2DUDA 4DUYL 1VQPT 1Q86U 2KDSA 3PO2G 3I4MG 1VQEA 1BKBA 4X64Q 3CCMA 3S1QH 3K81C 4IPGA 2XGTA 4PZ7A 2OQ0A 2VW9A 1Q7YC 1VQ9A 1PYSB 2VQFL 4GKKQ 4DR6Q 2IY5B 3HFZB 4JOIC 4LFCL 2N8NA 1QVFA 4KHZA 4LUOA 5GAGC 3PF5A 4BXXG 4IOAA 2KBNA 4IJHA 5LMNW 4DV6Q 4BBSG 2D62A 2NVTH 2Q2HA 4QIWE 3UE0A 1I94Q 1X9NA 1KHIA 1JJ2S 4A3CH 1Q8KA 3CC4T 3CF5A 4JI1L 2RF4A 4QQBX 3Q8DA 1CSQA 3KLWA 1Y1WH 4IFDG 1KC8U 1UE5A 3UDXA 4YHHL 2VQEQ 4UY8C 3S2HH 5ELOA 1SN8A 2PMZE 4DNIA 2B3GA 2IHFA 1BBWA 2GN5A 4LW1A 1B7YB 1W3SA 2WAQE 1ASYA 5FJ8H 1EQRA 4JI0L 1NY4A 1JJCB 1QUQB 4JI6Q 1B70B 1M90C 2IX1A 1NZ9A 1RIPA 1YJ9T 2IX0A 3UDFA 3K0XA 3GTMH 4UP7A 2PNHA 1HNXL 4DR2L 1IL2A 5JJKA 2I5HA 4JV5L 2VUMH 1HNZL 1QVFS 1MJCA 2C35B 3J81c 3K7AH 1PH3A 4IFDI 1SFOH 1PH7A 3T1HQ 3K8AA 1VQOA 1GKHA 2Y0SE 4GLVB 1Q82C 1VQBA 3WWVA 5H1SE 1FGUA 1Q86C 4DV1L 1HNWQ 4UPAA 3SGIA 5DLQE 3CPFA 1HR0L 3HOYH 2UXDQ 2NN6G 4L5RC 4LUVA 5LMUL 1CKOA 2UXCL 1VQ6A 4IFDJ 3S1RH 4A76A 2R92G 1CKMA 1UE6A 3DM3A 3PCOB 5C44G 4LF6Q 3JAME 1WJJA 5LMNQ 4B3MQ 4NB3A 5IY0A 4LFBL 4B3RQ 3I56T 3J80i 2VNUD 1D7QA 3TEHB 3RLOA 4JBJA 3GD7A 3GTKH 2F52A 4AH6A 3MEFA 4DKAC 3ULPA 1WCMH 1OXXK 1G51A 2ZJPA 3J7ZC 4DR4Q 1YVCA 1E24A 4X64L 3H0GH 1TXYA 4MTNA 3U4ZA 4C3IH 2L15A 3AYHB 3J80c 1K9MU 3HOVH 1JMCA 4DR6L 1KXLA 3KF8B 4BA2I 1IBML 2KVQG 4UP9A 3CAMA 3U58A 4RG1A 1OXTA 2NN6I 2GVAA 4DV6L 1SROA 2N3SA 1TWAH 2CQOA 1K3RA 2YTVA 3PGZA 4AYBG 3VDYA 1I94L 3W1GA 4A3EG 1N33Q 4A93H 3G71T 3U50C 4APVA 4DAMA 4A3IH 2JVVA 4JI4Q 1WYDA 3CMEA 3BU2A 3RN5A 3PO2H 1HH2P 4XTCS 5IYCG 2VQEL 4NXMQ 2R7ZG 4K0KQ 4P74A 1OXVA 4X62Q 3DB4A 1NE3A 4C3JH 1GD7A 4HIDA 3CCET 4DV5L 2MO0A 2HHHQ 3IRBA 2JA7G 2VS1A 1B8AA 1E3PA 3RNUA 2CWAA 3FHWA 1X3GA 4GN5A 1JE5A 2KHIA 4BBSH 2ZJQA 5GAEC 1P16A 1FJGQ 2E5LQ 2K4KA 2G3RA 3F2CA 4A3DG 1X6OA 1E7ZA 3ULLA 4Y52H 1Y1VH 1Q46A 3GTOH 3JAMi 3HOZG 1U5KA 4IOCA 1VQAA 1S40A 4RG2A 3PIOA 2AMCB 4L5TA 5IP9H 3CPWS 4LF8Q 3HOWH 5GAHC 3S2DH 4IPHA 1K73C 4OX9Q 3KBGA 4X65Q 5IP7H 2JA5G 4GN4B 1VQNT 4PZ6A 3JAMc 4WJ3M 1HNWL 2BH2A 3TREA 4FDBA 5IWAL 4A3KH 2UXDL 1IXRA 4BA1I 5FLMG 4ZN3A 2PQAB 1IYJB 1NBWA 5LMNL 3W5OA 4BY1G 1ASZA 3CCMT 1WI5A 4Y7NH 1XTDA 5IYBG 3OYYA 1GO3E 1J5EQ 1L0WA 4WJ4A 2LXJA 4C2MH 2CKZB 2ALYB 3FKIH 2NZHA 1PH2A 4DR4L 1L1OC 3PV0A 1HZCA 1M90U 2NVYH 4IO9A 3I55T 4DR5L 5M3MH 1VQ7A 3HKZE 1XJVA 4AQYQ 4DAYB 1K8GA 1VQ4T 2F4VL 2RHQB 3J7AF 4X66L 2UUAQ 2R92H 1XMQL 1VQHA 3HOXG 4JYAL 2JE6I 2K5HA 1CSPA 2H5XA 2E6ZA 2XHCA 3GDEA 1N32Q 1IBLQ 4JI4L 2Q2IA 3ICEA 2ZM6Q 1EQQA 3NBHB 3CCST 4A3BG 3G4SA 2L3RA 3CC7A 1VQDA 1Y14B 1N9WA 1KD1C 3I4NG 2IHEA 4JI7Q 4A3MG 4YWKA 2MWPA 1N36L 3ZJYC 4HJAA 2I5MX 2OCEA 1C9OA 1NTGA 4JI5L 4DR1Q 3CCQT 4A3JG 4JG2A 4LNQA 3I55A 1S3OA 1M1KU 3CCRT 2HQLA 3OW2S 1A62A 1V9PA 1VQ4A 1UWVA 2B29A 2WB1G 4QJFA 4JI3Q 1KAWA 2I0QA 3OTOQ 1VQOT 1Q12A 3HOUH 2DO3A 5GQOA 4LFAQ 4OWXB 4DK3C 4X34A 1VQ5A 4IPCA 2YYZA 5JEAG 2OTJA 1VQMA 4POGA 1JT8A 1PV4A 4LF8L 1P8LA 1X3FA 1Z47A 4YCVA 1X55A 1AE2A 4A3FG 4LF7Q 1S72A 3KF6A 1VQ6T 3CCSA 3JC66 3LGFA 3AQQA 3KYHC 3M4PA 1KRTA 4X65L 5C3EG 3ULJA 1KIXA 4R4TA 3CD6A 4JCVE 1XPRA 5AJ3Q 1XNRL 1VQIA 1Z9FA 1PVOA 4X6AH 3CCQA 4LWCA 5GROA 3CXCS 4GNXC 3HOZH 4DV7Q 4LF5Q 3CCRA 2D0PA 2JA9A 5IT9E 2IT1A 3GTPH 5ELNA 3LH0A 2VZAA 4DV4Q 1J5EL 1W2BS 3RN2A 5HGQA 2K52A 1L1OA 1VQFA 4GS3A 4YCWA 5IYDG 4DUZQ 1KQSS 3S17H 3S1NH 1FL0A 2WAQG 4BY7H 3G48A 2UUBL 3RLFA 4AQYL 3B6YA 3PO3H 1YI2T 1YZ6A 4YTLA 5JEAJ 1I6HH 1M1GA 3ER0A 3CMET 5LL6S 1L2FA 2F3IA 3BJUA 3L7ZC 3CCUT 1K73U 2KCMA 3NENA 1R9TH 2HIVA 1IBKQ 3LGJA 4DK6C 2B63G 1M1KC 4CRIA 3CCVT 2ZM6L 4DV3Q 3HKSA 2A8VA 1C7YA 2AHOB 2MFIA 1XPUA 2Y0SG 3GO5A 3CC2A 4DR7Q 3H3VI 3MXNB 4DV2Q 4JI7L 4GKKL 4BBRG 1NMFA 4RMFA 2QGQA 4YY3Q 3CPWA 1KRSA 1PH6A 4A3GH 2R93G 4ALPA 5M3FG 1YEZA 4OXPA 1CUKA 3CQZH 3U4VA 4AYBE 1EIFA 4B3TQ 2FXQA 1I3QH 1TWGH 1YI2A 3E9IA 2KCTA 4JI3L 1N34Q 5HY6A 1XNQQ 4HJ8A 2UUCQ 1YHQA 2E70A 2LVMA 2WP8J 1K8AU 3I4MH 3CCUA 1V43A 4P71A 2JEAI 1VQLT 2E2JH 2OQKA 3CCVA 2A1AA 4ME3A 4LF4Q 2OTLT 4BXXH 3ERSX 1SR3A 1K83H 1QVGS 4JI2Q 3RR5A 1HZAA 4JI6L 3M85A 4HJ7A 2BH8A 5M5XH 4A3CG 4R4IA 2ID0A 1KD1U 1VQ8A 1OXUA 1D8LA 1YJNA 2K50A 2RHSB 3AFQA 3EBEA 4GNXA 4DUYQ 1Y1WG 1EUJA 4LF5L 4A75A 4H02A 4O2DA 1WOCA 1YIJT 1VQ7T 3T1HL 4DV0Q 5JJLA 2VQFQ 2Q2UA 4HJ5A 4A3LH 1K0RA 3F1ZA 1OTCA 2HT1A 2JQOA 1VQLA 4DUZL 1JJGA 3AFPA 1Q1EA 3RLNA 5FJ8G 2Z0SA 1HZ9A 3GTJH 1GVPA 2OTLA 4LF6L 2K75A 4R1JA 3S15H 3G4ST 4B3ML 4YWLA 3CC7T 3CCLA 4JI1Q 2ZJRA 4B3RL 4KHPL 2NZOA 2LXKA 1IBKL 2VUMG 4YHHQ 1UE1A 4DPGA 5C4XG 3OW2A 1WFQA 2MQHA 3AEVA 3UDIA 1SMXA 4R4OA 1K8AC 2EXDA 2UXBQ 1YIJA 4DV2L 3KFUA 3HOYG 4PG3A 1SSFA 1I50H 5C44H 1PH9A 1VQ5T 2OTJT 1VQMT 4HJ9A 3S1MH 4HIOA 1HNXQ 1N33L 4DR2Q 2XTIA 3CCJA 1NJIU 4IJLA 3NEMA 4TVAB 1FVIA 1N34L 1S72T 3M9BA 1HNZQ 3M7NA 1LTLA 2UUCL 5GADC 1WCMG 4NXML 5J3BA 4K0KL 4TQUS 3CD6T 5C4JH 3CXCA 1HJPA 3PUZA 3EN2A 4X62L 3H0GG 4L5QA 4LUZA 4DV1Q 2PI2E 2HHHL 4OO1G 1NMGA 2NVXH 3HOVG 1XNIA 3K80C 3J81E 3M3YH 2R93H 2GVBA 5LMUQ 2UXCQ 1W2BA 4O0AA 2JA6H 2BA0A 3NELA 5E7NA 5C0XG 3KJOA 1FJGL 4JI2L 4GOPA 2E5LL 1KL9A 4A3EH 1KQSA 1VQJA 3J7A5 2WB1E 3KF6B 1UEBA 4LFBQ 4A93G 2KHJA 4JBKA 4A3IG 2MO1A 2KENA 1MJEA 3BZCA 3T1YQ 1YNXA 2N78A 4PMWA 5IYCH 2R7ZH 4NXNQ 4OX9L 1A63A 1Q81C 4DV0L 2OWOA 2JA7H 4JI8Q 4JC0A 4JBMA 3A5ZB 4J15A 1XMOQ 1IBMQ 4OO1I 1TWCH 1VQGA 4HIMA 4PZ8A 2JUFA 2BA1A 3F2BA 2JNGA 5C0XI 4A3DH 3PSIA 3J80E 1PH8A 3TQYA 1X3EA 1GM5A 3STBD 2MWOA 1LUZA 1Y1VG 3G6EA 1L1OB 4POFA 1PYBA 1JB7A 1HZBA 3CC2T 1SLJA 2K5VA 2Z6KA 1YITT 3FP9A 1EIYB 5IP9G 3HOWG
chains in the Genus database with same CATH superfamily
1SE8A 1NJIC 3TS0A 4YWMA 4JUVA 2NZ1D 2YU9H 5HKCA 1MMGA 2I5LX 4A3GB 2HD3A 5IAYA 2J7ZA 1VS0A 4FO2A 1Y8OB 1RLPC 1IZ6A 3VR3A 1BK2A 3J81i 4NOYA 1D1AA 3QSUA 2HCIA 3A5UA 3LYIA 2CH4A 4IKFA 1TQOA 4P2CB 1KDBA 3I2ZA 1NBEB 2RJCA 2XNAC 3QXEB 1ZA2B 4M78F 4ELZC 1IBLL 1GRIA 2LNVA 2NYSA 3FVQA 3R6OA 1D2BA 5C4XH 1EQTA 2HBWA 3F70A 5E3FA 3TS2A 2LQ8A 4I7ZC 4LMQD 4R8NA 1DOLA 3S3OA 2IG0A 3RUXA 1SRUA 4DR1L 4EMGA 3OYDA 5JAVA 4RHRA 3K57A 4JBWA 4X9CA 4C92F 4IUTA 1HA6A 3RMQA 3I7FA 3HOXH 3IL8A 3PIO3 2PI2A 3K6OA 1Y8PB 2SOBA 2PNRC 2LFNA 3PUWA 4M4ZA 5EAYA 3K5MA 2VL6A 1IW7C 2GGRA 3KDFA 3DEPA 5JVG3 2LCLA 1YJ9Q 3CW2C 2WFWA 1EFWA 8ATCB 1PHJA 2F4IA 2NB0A 5IGDA 3PF4A 1M3CA 1BU1A 1G3WA 1KQ1A 1CHQD 1BI0A 2JYOA 4H44C 4JI8L 5CQXA 4DR5Q 5M5YH 4JOIA 4GNXB 3VUBA 4ZUJA 4A3JH 2KUMA 1LJOA 2DAQA 1RADB 5GAOq 4F7UE 2XDBA 1XMQQ 3MXPA 3S15B 2EJGC 2QQBA 2HKQB 3JCMJ 1KC8R 1TS5A 3H09A 5COYA 3TSWA 3NXWA 5IXBA 1CKNA 5JEAH 2QEXT 2R6GA 2PZ1A 3I56Q 3LWIA 4O6JA 1LVKA 5C3EH 1U1SA 1WDXA 2YUOA 1ET9A 1MSHA 3IKJA 4K14A 1G8ZD 1XTCD 1PKTA 4CC2A 2CGHA 4FL6A 4TSSA 3D31A 3GTGH 1HD3A 1SYDA 3I72A 4L5SA 1ZBJA 1FNUA 1QZHA 2Q2TA 1FYNA 4XIGS 1BYMA 4QUCA 3NTKA 1R77A 2JOYA 1TWHH 2IX3A 4ME5A 1XPOA 1WFWA 4K11A 4R4QA 4CGYB 2E76C 4QY7A 4QGUA 1NPRA 1A6XA 1E7OA 1GHJA 5E1FA 3ZYYX 4X1VA 1VQKQ 2QEXA 2V1QA 1AEYA 2F0NA 4HIKA 5IYDH 3T13A 3MHBA 2JTFA 2QQAA 4YY3L 1DM0B 2ASBA 4BDYA 2NUTB 2IVWA 5CGKA 2L12A 3S14H 2Y4YA 2SEMA 2FHDA 3CCEQ 2LCSA 1A0IA 2RHIA 1PFSA 2K5DA 4PNOA 4RCOA 2QA4T 2QW7A 1KNEA 2FRYA 4A3EB 2A6ED 4B3TL 2H4OA 3QHSA 2F2VA 1XOVA 3DB3A 5DLOA 3J81L 4DR3L 5EKIA 2LP5A 1VQ9T 1YNZA 2A19A 1VDZA 3CQTA 4ORZA 2DM1A 5LJ5g 1JJ2A 1FMVA 3TBIB 1K9MR 4J83A 4BBRH 1HR0Q 2RM4A 3EG1A 4LF4L 1WHKA 1FNWA 1OXSC 4A3GG 2EIFA 2CH4W 1HQRD 1YHBA 1LM0A 4EQ5A 1EEID 1VQNA 4LDXA 1N8RC 2JK8A 2EJGA 3QDRB 4E7KA 2DEUA 3C94A 4OMQA 1JWUD 1Q82U 2QA4A 2K4YA 2DUDA 4DUYL 1ZA1B 1VA7A 2KDSA 2X4XA 2EVBA 3S1QH 2KMTA 1QCBD 4A4FA 2XGTA 2OQ0A 5CYUA 1PYSB 2K3XA 1VQ9A 2CW0C 3J80L 2VW9A 4DR6Q 2IY5B 3VRZA 2RQWA 4LFCL 1TIID 3NBHA 3PF5A 2H3JA 5LMNW 1STAA 2NVTH 1AWJA 1BQQT 3D6CA 3TP6A 3HRZC 3GNGA 2VXFA 1KHIA 5GAOm 5D14A 1TR5A 4BY1B 2DNUA 2RNAA 3KLWA 3NUCA 3RKWA 4RAUC 5F2DA 3U9SA 3OSVA 1RAHB 1SE4A 2EKHA 5CK9A 1RCVD 3R2TA 1G5VA 4II1A 2V1RA 4LE9A 3CCSQ 3HP3A 1B7YB 1RODA 1QP2A 2KT8A 4RCCA 5FJ8H 1CA6A 1GXDC 4JI6Q 1ZSZC 1TS2A 1NZ9A 2F0OA 3P20A 3L2QA 1YJ9T 2IX0A 1Y71A 4DBQA 4HR7B 4FT4A 2PNHA 1HNXL 3CCQQ 4Q0FA 5JJKA 4FYXB 3REBB 2L9HA 2B8AA 3S6WA 1QVFS 2C35B 3I73A 4A3BB 5HK3A 1NUCA 1I8FA 4DFAA 2X9HA 2L0AA 1VQOA 1GKHA 1M90R 1VIEA 2Y0SE 3I4NB 2NTTA 3D6WA 4A3MB 1FGUA 1NR2A 2YSQA 4UPAA 3SGIA 5M5WB 2B8GA 1CT1D 2UXCL 5HK0A 1T3SA 4EDUA 1FD7D 2EVRA 2P5ZX 4ZGEB 4EVOA 1UE6A 3DM3A 4JPBW 2KQWA 2LT1A 3EG9A 1WJJA 1R0BG 2HCCA 1ARKA 1EY5A 2NWGA 4RGMA 3I56T 1Q86R 2VNUD 5LJ5d 1PYWD 1D7QA 4JBJA 4EQNA 2K28A 3C1EA 2DL7A 4ANJA 1F77A 2ZJPA 3J7ZC 2RMOA 4JLGA 1YVCA 3GTLB 1E24A 4PQXA 4QCLA 2OT2A 3U4ZA 2L15A 3OIPA 1M1FA 3SEBA 1PC0A 1QG7A 3NBIA 1QW1A 4XQQA 4OO1H 1C6VX 1M2VB 1T0JA 4XU1A 5KYWB 5TSSA 1U8RA 4RG1A 2BDNA 4DV6L 2K9GA 2O31A 4DOWA 3RDVA 1TWAH 3VDYA 4A3EG 3KF8A 1E6GA 4A93H 3RNJA 2RCFA 3JRZA 4A54A 3U50C 4DAMA 3K5LA 2EKOA 4DA2A 1F2MA 3CMEA 4QVDA 3RN5A 2VB3X 5IYCG 4XTCS 1O7YA 3PO2H 1AW7A 1OXVA 2PMZB 1H8KA 3CCET 1D1BA 3S16B 1B8AA 2WAQB 2L2PA 1SMYC 1X3GA 4PJLA 1MMDA 3DXJC 4BBSH 1FJGQ 5BN3A 1RDPD 1EIHA 2HMAA 2K4KA 3F2CA 1ZSZA 2P4TA 1E7ZA 3RKYA 1ZYRC 3PT9A 4R8IA 4RTXA 1VQAA 1S40A 2RDHA 3PIOA 2BZXA 5IP9H 4GZYC 3GQBA 4OMFB 1V29B 3BVMA 4X65Q 2V8KA 4BI4A 5T1IA 3QJ6A 4GN4B 2HDMA 4PZ6A 4RCNA 1FXXA 2IIMA 1IKMA 1EYCA 2XG8D 2Z6BA 1TTHB 2F5KA 3MEAA 5FU7C 2JXBA 2Z4HA 4NP5A 1Z9QA 5CKDA 4R9WA 4KBMB 3HPWA 2OTLQ 2YRVA 4A4EA 1IYJB 2EJFC 2ICIA 3QIAA 5EKLA 1PXUA 4BY1G 1SJHD 1WI5A 1XTDA 3JV3A 2KGTA 3OYYA 4BACA 3TSZA 2EOTA 2EYOA 2RI2A 2CKZB 1NG2A 5CO7A 2MUYA 1PH2A 1F9QA 4FIBA 4C0DB 3PV0A 2F0QA 2RVLA 1M3AA 4I65A 2ECZA 2MJ8A 2ZPIB 3M4GA 1YIJQ 5FRNA 3A8KE 3TMEA 1B34A 4DR5L 4ME7A 2DK3A 4C8QB 3J7AF 4KULA 4OP0A 1XMQL 2O2LD 1GL5A 2H5XA 3M0PA 3OB9A 2XHCA 5ELFA 3GBQA 3JB9G 3M0RA 2Q2IA 3CU7A 1Y1WB 4JI4L 3CCST 3I70A 2E75C 4A3BG 4QQ6A 4M75B 3R6NA 1STGA 2A73B 1N9WA 3VYUA 3NPPA 3I4NG 1STYA 4JI7Q 2VYTA 2YUNA 4A3MG 5GANg 4KD3A 4HJAA 4L5GA 3C3LA 2B2WA 2QQ9A 1BCOA 2FMMA 3PIP3 3DWAA 3CCQT 4Q5WA 3OW2S 1A62A 1V9PA 2LX9A 2E74C 1GFDA 3AB9A 2B29A 2C9OA 2F0LA 4QJFA 5I4DA 2DO3A 4OWXB 3BVGA 2VUMB 4X34A 2F3WA 4IPCA 3BS1A 3JB9I 1VQMA 2OTJA 1WTQA 4POGA 4OB3B 1AE2A 3FDTA 4M7DB 3KF6A 3G1JA 3CCSA 2WKDA 2VXEA 3A1PA 2IJ0A 3VR4A 3CD6A 3I8ZA 3SE0A 3L2ZA 1NNXA 4JCVE 1XPRA 2AQ2B 2NBFA 1SSOA 2LS01 1VQIA 3CCQA 4LWCA 2EJFA 4HMJA 4DV7Q 4LF5Q 2K32A 1LPLA 4NMZA 2GNCA 1WCMB 2JA9A 3IQLA 2Q8TA 1TS9A 5ELNA 2WSEE 2A3LA 1J5EL 3L2VA 4ID6A 3VS3A 1QCFA 2PVOB 1ZUYA 2K52A 4K6LA 4C3IB 4YCWA 2F0FA 3HOVB 3P8HA 4HMIA 2RJEA 1EZ8A 2WAQG 3G48A 3RLFA 4AQYL 2B2TC 3B6YA 1YZ6A 2DKGA 4N8FA 1DJ7B 2K57A 4N9PA 3W1BA 5LL6S 1K73U 2R61A 4J9DA 1SEBD 3LGJA 4RGTA 1M1KC 5ECAA 1GUSA 3CCVT 2ZM6L 2BE9B 3ZL7C 3HKSA 5C4ZA 1UHCA 5CV4A 5L37A 1YITQ 3MXNB 4DV2Q 3FJ5A 4PK4A 3CPWA 4A3GH 1SHGA 3EH1A 3NQIA 5LJ5h 1YEZA 4OXPA 4HSPA 3U4VA 1SBBB 1SF9A 1I4PA 1FMKA 4ULLA 4OGEA 1Y1VB 3GTOB 3E9IA 3HFOA 2A68C 2KYBA 4Y52H 4HJ8A 1BBXC 1YHQA 2TSSA 4M78E 2VXWA 1OV3A 5GANd 2OXPA 2OQKA 3CCVA 1RAEB 2E3HA 2K2VA 1TVXA 2LKVA 4M78C 2OTLT 3MHXA 3VS7A 2GCXA 3K5NA 2I2LA 3TQ7P 1GUTA 2AKLA 1K83H 4A3KB 4C8QG 2CZ0B 3C46A 1HZAA 4JI6L 1UB4A 4C92E 3H6ZA 4HJ7A 5KIXA 4A3CG 1EYAA 2CP6A 4OVAA 2A69C 1KG1A 5JPMC 1KD1U 1VQ8Q 4Y7NB 1D8LA 2QGFB 3AFQA 3FPPA 3P8DA 1Y1WG 4C92C 2YLBA 2PQWA 2E6NA 3VA7A 2SEBD 4H02A 3EJIA 4A75A 4C1NI 4M75G 1YIJT 5BN4A 5IIFA 1TT2A 5A0DA 2VQFQ 2L89A 2Q2UA 2O01E 5JJLA 2E64A 1K0RA 3F1ZA 1RI0A 3QZ5B 2JQOA 4L63B 2HT1A 1JJGA 2EYZA 5M3MB 5GAOp 3EAEA 2QASA 3UDCA 4PJNA 2B2TA 2FO0A 4BE1A 4DK1A 2OTLA 1AHJB 2G6FX 1LLRD 2DL4A 2K75A 3S15H 4JI1Q 2EQKA 3CCLA 2WINB 1IHZA 4KHPL 4BWGB 4J9EA 1PG5B 2VUMG 1JXOA 1I07A 5KE2A 1M27C 2DFUA 1X32A 5C4XG 4LDWA 1OX8A 2BTTA 4CI0C 4PLIA 2MQHA 1HUNA 2EYHA 5I11A 3UDIA 2M02A 4M7DG 5CKBA 1K8AC 2I07B 3RKXA 1CTMA 1YIJA 1TUCA 4N0AC 2KROA 4CBVA 2B86A 1H9RA 1I50H 3EROA 4KHVA 1PH9A 4XQNA 1K1ZA 4EQOA 5KNBA 3I5RA 1GCQA 2RK2A 1NJIU 2XTIA 4IJLA 2L8DA 1N34L 1JWSD 4E6RA 1WVLA 3JCMg 5I21A 2K05A 1WCMG 1Z7TA 5I22A 1QWYA 4PNYA 3O8VA 5GJVB 2DXTA 3EN2A 1OU9A 3MEHA 4C3IG 4RMOA 1NMGA 3HOVG 4M78A 1O75A 2MPMA 2FPEA 2XKOC 2GVBA 1ZEQX 5CR2A 5LMUQ 1WHJA 3G7ZA 5NUCA 1FJGL 1KL9A 4A3EH 3PVQA 4LFBQ 3HOZB 3WDNA 4G7ZC 3PVLA 2LJ1A 4KJOA 3BZCA 4GY5A 2N78A 5GJWB 5IYCH 4MDXA 2YLCA 2KA7A 5IGGA 2XIWA 4ESRA 1PLFA 4DV0L 1NLOC 2PNIA 4JI8Q 1YWPA 3A5ZB 2FG0A 3S1NB 3BE3A 2K2MA 5EG2A 4BY7B 1V8QA 1VQGA 3CBPA 2JUFA 3EGDB 5GMKe 4JS5A 1Y96A 3M54A 1D1IA 1PTOB 1I6HB 1P92A 2JNGA 1PM3A 1D6EC 3URGA 1X3EA 3TQYA 1CQVA 3GP8A 1Y1VG 2RDGA 3G6EA 4LK1C 4POFA 3T16A 1RKNA 5FWBA 3K7UC 1YITT 1HSQA 5EBCA 1DOMA 2D0OA 4BE2A 3LWEA 4E7JA 4K5WA 1LV9A 5C0XJ 4DV5Q 3I35A 1I4QA 1U0LA 1TKWB 2LQKA 4PFOA 4A63B 1F2ZA 2E41A 3WVEB 3STBC 3J81j 1YNNC 3G6JB 4A3KG 4N0AA 1KLUD 1PD0A 5K36G 4A4HA 4TRDA 1PD1A 4LD9K 4CJ0B 3REAB 5GMKi 4J8OA 4BY1H 1QWEA 3PIPA 1TWGB 1GCPA 2N49A 4M77A 1C8CA 4WF2A 3CC4A 4OHJA 3JCMe 2VY3A 2XWBB 1BOSA 1YITA 3PGGA 4N4GA 4PJOA 3X28B 1G291 3BZKA 1H3ZA 5LJ3g 4MZ9A 3SK8A 1SKUB 1QWFA 3CP0A 3PUXA 2AKWB 5M3MG 1EY4A 3P8BB 4XTVA 3RIRA 3ME9A 1VQ8T 2C0IA 3KDFB 2ZPBB 4XT3B 2E4HA 5AT1B 2ZTCA 1UNSA 1EFID 5M5XB 2K5LA 1JC7A 4DR3Q 1QCNA 1WZOA 4QT7A 2F0TA 2ZXPA 3JB9H 3UE1A 2COYA 3VYGA 1DGSA 4DAVA 3IFDA 4A3BH 4GN3B 3LWUA 1UUPA 3D3RA 5T1GA 1ZLMA 2BE5D 3VYRA 1PRTD 3M4QA 2PPBC 3I4NH 3PTAA 3GF5A 3Q6SA 4A3MH 3SEMA 1KC8C 1AH9A 4HCBA 4F16A 2V8JA 5M5WH 2JP1A 2QXFA 2K6DA 4OB2B 4GOPC 1JICA 2PZUA 1CKNB 3TDQA 5IT9c 1EOVA 3OYBA 5GANh 1JE4A 1EY6A 1T0HA 2J0TD 4AIMA 2AQ3B 1JQYD 2RCNA 2K5NA 3OQ5A 4M75D 1GHKA 4DV7L 2R7FA 1TY2A 4QKUA 2DZCA 2NUPB 3HSBA 3GTLH 3OMCA 4BD3A 3OYNA 4RFBA 4LFCQ 3X25B 1N36Q 5CR3A 1N8RU 4RHSA 4OMMA 1WHMA 1FGBD 5FLXc 2MF2A 3VS1A 4EQPA 5KYIA 4JI5Q 3MJXA 3OS2A 2CP0A 3QJYA 2JN4A 5C44B 2DJQA 5J26A 1LO5D 2KCCA 3BYTB 4NPSA 4DNRB 3S1MB 1ZBXA 1PA6A 1SE3A 2PVGB 2YTYA 2Z6KC 1M4VA 1ZQ1A 5GMKm 3OYHA 3I4OA 4QB4A 1EIGA 2E8GA 3QG1A 4XU0A 1J3TA 3VKIA 2JEBI 1Z6HA 2ES2A 4GLXA 4M77D 3G71A 5C4JB 2LX7A 1WIEA 3L0OA 2LSSA 1VIFA 3S16H 2NVXB 4QUFA 5LJ3e 4KV6A 5BR8L 4IQZA 1OPLA 4BY7G 2R93B 4PJOD 5JOBA 4AYBB 4DA4A 2D8JA 1K9MC 1XNRQ 1ABQA 4ZTJA 2COWA 2E5KA 4KT0E 1FYCA 1STNA 1F1BB 1BVSA 3HOZG 1A8VA 3QB3A 5C6SA 2DYIA 3V7SA 1D1KA 4L6V5 1JOOA 5CV8A 3X3NA 2PQAA 4B3SL 4ZQ3A 5LJ5f 1JCKB 3FIFA 1AZQA 1SRLA 3HRUA 1ENCA 2XRQD 2A6EC 3EFOB 1X3PA 3FRPB 4MNOA 1B50A 2FB7A 4IUNA 3VYHB 2OF1A 3OS1A 5KCOA 1ICWA 2CFMA 1WTRA 4FVMA 1VQNQ 3N5BB 4F7UB 1XXGA 2JZ2A 2UU9L 3KOJA 4CKBA 4MDWA 2EY5A 2QA4Q 3M0TA 3PO2G 4EGVA 2X3WD 3CCMA 3VS2A 1RHPA 4IPGA 5ELEA 2VQFL 4YIJA 2JA5B 1OZ3A 3TP7A 4JOIC 3QUIA 1VYTA 4LUOA 4IOAA 2QTXA 4DV6Q 4BBSG 1NLPC 2K3YA 1G91A 4QIWE 3I55Q 1DJRD 1X9NA 4OB1B 3T9NA 4A3CH 4S3SA 2OAWA 3SD4A 2AUKA 2RF4A 3VRYA 3MFYA 4JI1L 1CSKA 2K33A 1Y1WH 4UY8C 2E2IB 3SDZA 4F8MA 2DMOA 2K5WA 5CV6A 2HUGA 1TY0A 3NK9A 3W2DA 2GN5A 2CDTA 2R58A 1VF7A 3RZDB 1G2BA 4E2FB 1W3SA 4N8X1 1D5ZC 5I9OA 4G7OC 3DM1A 4LN2A 5FU6C 1QUQB 1JJCB 4DGZA 4ODGA 2DF6A 1M90C 1B70B 1HRJA 1D3BA 4XAXB 5D3DA 4UP7A 2DRKA 2Z4IA 1W6KA 2CSIA 1RTNA 3CRLC 3RD4A 1D0YA 2VUMH 1RI9A 3VR6A 4BI3A 4NS5A 2CP5A 3GLXA 2F0HA 2GBQA 4KH1B 3T1HQ 2LTOA 3C12A 1VQOQ 1VQBA 3A55A 3A7LA 2RSNA 1Q86C 1CM9A 1PRTF 3EG9B 4LNPA 1K76A 5DLQE 2ENMA 3EVQA 5EJWA 4K5VA 5FO7B 2D9UA 4JW0A 1K83B 4L5RC 1AT1B 2YDLA 1TWBA 5LMUL 4IFDJ 2X4YA 1PRMC 2IPKD 4A76A 2GFAA 3E3XA 5C44G 1D5MC 1NAPA 4LF6Q 1IO6A 1F9PA 2WB1B 1WYXA 4NB3A 4X3UA 4LFBL 4B3RQ 1GUWA 4OF1A 3J80i 5KNDA 3RLOA 2Q8IB 3PNWC 3ULPA 1WCMH 1EWHA 2ED0A 4M75F 2N88A 2RHUA 4F14A 5CCAA 1MD2D 5CV9A 5LJ5j 4A3FB 4X64L 1V1OA 1TXYA 3RZOB 1BR9A 4C3IH 3AYHB 3HOVH 2A7YA 3JCMh 3KF8B 3OHXC 1KXLA 2B2UC 3CAMA 2KRMA 4QF4A 2J05A 1EZZB 1N9RA 5AFWA 3U58A 4KY5A 2N3SA 1AOJA 1I81A 1ZHIA 4AYBG 2KT1A 3BDOA 1N33Q 3C4SA 1X69A 4X3TA 4JRQA 4XU2A 4JI4Q 4Y92A 5GAMe 1R4QB 5KRUA 1MNDA 3D4RA 3SK5A 2VASA 2JSOA 2Z8LA 3CMEQ 3M4OB 2VQEL 2A28A 4OGCA 1QCOA 5CKHA 4M7AA 4X62Q 2E1HA 3DB4A 1NE3A 1A3TA 3RMHA 4ZYSA 4DV5L 3PE0A 2MO0A 4M77F 3IRBA 2JA8B 1UGQB 1V1PB 1BCPD 3RNUA 3H6MA 4IUPA 2JJ9A 1JE5A 1HXYD 4GN5A 3URYA 4AMCA 1KIKA 1P16A 1I50B 3IFTA 5GAEC 3CXCP 2G3RA 3Q23A 4F7UG 4PJOF 2E10A 1RD9D 1W4SA 1LABA 1CKAA 1Y1VH 3GTOH 1U5KA 4IOCA 2DTIA 1B53A 4KGZB 4L5TA 4ZLTF 2DBMA 3CPWS 5FO8B 2CP7A 2BUDA 4K5XA 4IPHA 4OMOA 3HZXA 2Y0SB 3S3NA 1KQSP 2JA5G 1VQNT 5FK9C 3NHNA 3JAMc 1HK9A 2GFUA 2Y90A 2BH2A 5D3IB 1VQLQ 2ATCB 4Y28E 2PZTA 4A3KH 3SHLA 4BA1I 4E7IA 5K36H 2C0OA 2DD5A 1K73R 2A5HA 2PVDB 4ZGJB 3T53B 4Z9CB 1NBWA 5EPLA 5LMNL 1DONA 1HQMC 4D6WA 2L1BA 2O88A 1ASZA 4Y7NH 3HG9A 3GTQB 2DBKA 1H9MA 3HEJA 1M9SA 1J5EQ 4AFUC 1B34B 2LXJA 5JPNC 1GBQA 1YFNA 2Y4XA 1TS4A 1H92A 1EY8A 1K8OA 2YHTA 3I55T 2RHXA 5M3MH 1VQ7A 4AQYQ 4FCYA 4DAYB 1VQ4T 2B2UA 2RHQB 1K8GA 1AZPA 2UUAQ 2K5IA 3LWHA 2DILA 1XYIA 5LJ3h 2JE6I 2F0GA 1PSEA 2E6ZA 2XI9A 5I6YA 2DEQA 2ROTA 2VWFA 4RUGA 2ZM6Q 1EQQA 1EX4A 2O9VA 3ZFJA 2QF7A 4BA2I 1VF5C 3MP6A 4JRIA 5IODA 2EGEA 3QKJA 3OYEA 5GANf 2K5QA 4UC4A 1M8AA 4YWKA 5J39A 1N36L 1S5CD 3ZJYC 3EHRA 4M7AD 4JI5L 2AHJB 3RMSA 1EY7A 4JG2A 2K04A 4LNQA 3I55A 1M1KU 3SB2A 2PO4A 4AFZC 4OMNA 3OA6A 2FEIA 1VQ4A 1KD1R 1ABOA 2WB1G 4G4KA 1I0CA 1VQOT 4JK1C 5EBDA 2XICA 1IGUA 2E2DC 1U5SA 4LFAQ 2YYZA 2EYJA 1OX9A 2OTJQ 1VQMQ 4KD4A 1JT8A 1PV4A 4HCEA 4LF8L 4HEDA 5C3XA 3OYFA 1Z47A 1X55A 5FU7B 1LT5D 4HVVA 1S72A 5ELDA 4A3FG 3JC66 1KIXA 5L23A 3AQQA 2X3XD 4HT8A 2R3ZA 3I5SA 1X6BA 1KRTA 3TN2A 4CDEC 2EXZA 1YCYA 3HOYB 3X26B 4A4KA 3CD6Q 2X69A 3R2IA 1DZ1A 1Q90A 3SWNA 3MPUB 1XNRL 4RKLA 4X6AH 4X9DA 4CC4B 4GNXC 2AT1B 3HOZH 5CV5A 4HCZA 2YUQA 3QYGB 4XTUA 2PCFB 4CC7A 4GBQA 4ZTFA 4ZNXA 5IT9E 4KTAA 2O5JC 3LH0A 2EYXA 4DV4Q 1SPKA 3RN2A 5K5PA 7AT1B 1SYGA 1JU5C 1B07A 3JCMb 1HFGA 3VR2A 2K7AA 2M2LA 5IGBA 3A8OB 3S1NH 2F0SA 1FL0A 4BY7H 1JXMA 4E7SA 1SYEA 2EYQA 1YI2T 2BOSA 2DXBA 2EQJA 1PTOH 1I6HH 3FDRA 1M1GA 3ER0A 3CMET 1NJIR 4EMHA 4JJNK 2F3IA 3IAYA 3CCUT 4KHPQ 3WOEA 2HIVA 2KCNA 1MNEA 5IHIA 1G8XA 5IH2A 3U9OA 4DK6C 5FOBB 3A8JE 2RF0A 2A8VA 4IALA 2KE9A 3OY9A 3J7YW 3EH2A 2MFIA 1UGRB 4XDXA 2Y0SG 2MK5A 4XT1B 3UI2A 4C3JB 1XPUA 1DXMA 3H3VI 4DR7Q 1S5DD 1PH6A 3L3OC 4PJMA 4QVCA 4L8JA 3X3MA 2QDYB 4PJJA 3EGXB 1BCPF 1IREB 2BZYA 2QQSA 4JRKA 2W10A 5D6WA 3D4WA 1CK1A 3CMAQ 1YI2A 1TWGH 1N34Q 1CHPD 5HY6A 1JQQA 1YHQQ 1PKSA 2LVMA 2J06A 1K8AU 1T5XD 3CCUA 1W6JA 2K7VA 5I2XA 4KKTA 5EPKA 3S2DB 4X3KA 5GAOr 2JEAI 1Y57A 1VQLT 2YT6A 3CCVQ 2EJ9A 2E12A 2RQXA 1K4US 2KNBB 2RN8A 2B2WC 5GANj 1SE2A 4E47A 2EWNA 3OBYA 4IZ8A 3MTSA 3G7LA 2QG9B 2M0YA 2BH8A 5M5XH 5KYLA 1GXIE 3KK7A 1MHNA 3OWEB 5JVH3 3A54A 2K50A 4GNXA 1YJNA 1EUJA 4Z88A 1C0MA 1Q3LA 2MAMA 1PSFA 3T1HL 4DV0Q 4E7LA 3K0YA 3KUPA 4AG1C 3PFSA 3ZBDA 2Z9HA 3HGBA 1PFNA 4PKCC 3TZDA 5GAN4 1VQLA 3TP8A 2EY6A 1ZX6A 1S5BD 3L2WA 1DYQA 3N52A 2F1LA 2R92B 2PUOB 2JMCA 9ATCB 4LF6L 4J8QA 3H94A 3CCLQ 1KAAA 3EG0A 2ZJRA 1QVFP 4IUVA 3VV0A 3BDCA 4B3RL 1IBKL 2O4XB 1K8MA 4XK8E 4DPGA 3MEWA 1PFBA 3AEVA 4U68A 2ED1A 1BI1A 1EQVA 4R56A 2QAZA 3HOYG 1AFPA 2G9DA 4PG3A 1H9SB 2CP2A 2CUBA 1JWMD 1SSFA 3FEOA 1WHGA 2XDPA 4M7AF 3BVZA 4L6TB 5C44H 2OTJT 1VQMT 4HJ9A 3S1MH 1H641 5D65A 1O80A 5I2YA 4HIOA 3FLGA 1N33L 3CCJA 3BY7A 3QWXX 2LZ6B 2NUTA 1FVIA 3JCMf 1Y7XA 3A8HB 5KYYB 2MIOA 2RQTA 4M78B 1EZ6A 1YP5A 1LTLA 5GADC 3NTIA 2UUCL 3QWNA 3CD6T 5C4JH 3Q1JA 3CXCA 4X62L 3PUZA 4LD6A 4L5QA 4LUZA 3QIIA 4DV1Q 2FINB 2PYKA 1YJWQ 2NVXH 1V1CA 4DN4M 3K80C 2HEQA 2R93H 2DL5A 4EPCA 2FJ2A 3LW5E 5C0XG 4UAIA 4JI2L 4C92B 2DVEA 3EG2A 4JJBA 4IIMA 3VS0A 1KQSA 1PCXA 4PMBA 4U673 1UEBA 2D8HA 2KEAA 5GAN8 1MJEA 1B3QA 3GTPB 4HA8A 1GUGA 2L0CA 2RKSA 1RACB 1A63A 1N8RR 2OWOA 4C3JG 4JC0A 2PZWA 4J15A 5LHY1 1IBMQ 5BN5A 3MCAB 3UATA 5IT9L 3PO3B 3D4DA 3LNNA 2WV6D 2BA1A 1JOKA 1VYVA 3F2BA 1U3OA 5C0XI 2HSPA 2ICEC 1H9KA 1TXQA 1AWOA 2AQ1B 2MWOA 1LT4D 1R9TB 1L1OB 3G6EQ 5KGUA 2GQIA 3M53A 1SLJA 1ML0D 3FP9A 4FSXA 4RG8A 3EA6A 2KEDA 4NKLA 4KH0B 2JA5H 5IP7G 2L3PA 1VQPA 5FLXL 2KI7A 2G9HD 3HKZB 2UXBL 3PUVA 1RABB 1TUGB 5EPJA 3CMAT 4J9BA 2RSOA 3I4LA 5GMKj 4EIKA 5GAN5 1HJDA 3CQZB 2UUAL 1K9AA 1YHQT 1E6HA 4LUDA 2A74C 2XN9C 1X01A 2RQRA 1M5Q1 1AZEA 2C0TA 2EYMA 4J5YA 5JJIA 2NUZA 1B9MA 4KI0A 2HIXA 3CC4Q 1WXUA 3DLMA 3T51B 4KUIA 2E2IH 3I4MB 4J6WA 4BDZA 2DIQA 1G2TA 4PFPA 5GAN6 5LJ3f 3R3OA 3RZDH 1PH4A 5BR8Q 3H0IA 3SVMA 2IW3A 5IWAQ 1SNMA 2NLUA 1E1TA 2DXCA 2CUDA 1EU3A 1QZGA 2FHTA 2E65A 3C95A 1GCQC 4KGVB 1BF4A 3CMAA 1ESRA 4JRPA 1K0XA 1LACA 5CQYA 3A8MB 1JB3A 2IL8A 2QCPX 4OGQC 4PFZA 2HKNA 2YV5A 2P0QA 3T4AC 4LFAL 4B3SQ 2FPFA 3T1YL 1JEGA 1BIAA 2ZPEB 2FYKA 4NXNL 4C5IA 2LC4A 4KKSA 4FF4A 4OMLA 4RTTA 4ZKBB 1EYGA 2O9SA 1UE7A 3UA6A 4XYQA 3M58A 3QOJA 2D9TA 1HHVA 1U9RA 4JDSA 4J9GA 1MKHA 3C1FA 2ZXRA 3CCLT 1QNKA 3KLSA 1OQKA 4RWSC 2EYPA 1PRLC 1T3LA 1HPCA 3H15A 3MXUA 1QVCA 2UU9Q 3GTJB 4JYAQ 2DRMA 1C0AA 2RJDA 2BE5C 1PRTC 3L2PA 2EGAA 1M2VA 1O7IA 1STHA 2EQSA 4ABNA 2SNMA 4M78G 4P72A 4XTYA 1HR0W 4M75E 4DV4L 3L2UA 4OWTB 4A3FH 2XVSA 3RZOH 1X56A 2F0EA 1Y07A 4FYVB 2QI2A 3UDGA 4M75C 2FL7A 3R93A 2A6HD 1J6QA 2L11A 3EGUA 4DXGA 4C92G 1YHAA 5DM7R 2ZTEA 2ESWA 1Q81U 3MC0B 3BFMA 2DJGC 1Q1BA 4B9XA 2VUBA 2AZVA 1YJWT 5JJZA 3M4OH 2DL3A 2DGYA 3ITPA 3H3VH 3G71Q 3TU4K 4GLKA 4Z8AA 2PW5A 3RUZA 3M56A 4DR7L 4LF9L 2JA8H 1WQWA 4M77E 5KYUB 2AWOA 2ZTDA 1Y69U 4EMKB 1AP0A 2DTOA 1M30A 2LJ3A 3MFGA 4GLAC 3PO3G 1ENFA 3JB9D 2QYZA 3ERQA 5J22A 1U4PA 2B2YC 1BBZA 4M77C 2EY2A 2KYMA 2R7DA 3K59A 2M1HA 3A74A 4GKJL 5KCHA 4PJOE 3E9HA 1CZWA 3DLLA 4LXCA 2F0UA 4DXFA 4FSSA 2QDBA 5A2QL 4OWWB 1M8MA 1NPPA 4P75A 3BYYB 2R7ZB 4UP8A 3OS0A 1WD0A 3TVTA 2HL3A 4PJOC 4QQDA 2EY1A 5KNCA 4FXDA 1RJTA 4GOPB 1YJWA 3D7SB 3QO3A 2CCZA 5LJ3j 1MHWC 1SRMA 2AUJD 1T9HA 3HKZG 1VUBA 1ZUUA 1TWCB 3BZDB 3A0JA 2AKKA 3TP5A 2XK0A 3G6ET 1GOZA 1G3TA 1ESFA 1NCVA 4IPDA 4DKAC 3V8JA 4A3DB 1KDCA 1MV3A 2KY9A 1EWIA 3GTQH 4BY6C 4JZ4A 2CZ6B 4C8QA 1Q86U 3I4MG 1XJWB 3BG3A 1KFZA 1UECA 4JZ3A 3CCMQ 1A0NB 4X64Q 1Q7YC 4AFQC 4WORA 1SNCA 3PQIA 2KBTA 1QVFA 2DVJA 2EQUA 4BXXG 2KBNA 4M75A 4IJHA 2E2HB 3VJPA 1LT6D 3UE0A 2M9VA 1WQ7A 1JJ2S 2M00A 1Q8KA 3CC4T 4IN3A 1DD2A 4QQBX 1KK7A 2HSEB 1DCZA 4IFDG 4Z02A 3MVVA 3UDXA 2VQEQ 2D2CC 2QILA 3OYJA 1J8IA 4K2KA 5ELOA 2ABLA 4DNIA 3EFXD 1CKBA 1U4MA 2VVKA 2IHFA 4CKEA 2HL5C 3MEUA 4CHTB 2R57A 3E2UA 1SJED 1X6GA 1ASYA 2E5QA 4JI0L 1NY4A 2CT3A 2F0MA 4J9HA 4M7DA 1WXTA 1VMCA 3UDFA 2B2YA 4WCIA 4KK7A 3CBOA 4JV5L 2G5DA 3OPOA 2HNIA 3CCRQ 1MJCA 2QDLA 2EAYA 2I0NA 1ENAA 4HSVA 4IFDI 3A8IE 3W3AA 1PH7A 1AZGB 2VV5A 4GLVB 3WWVA 5H1SE 3JAML 4FF2A 2DE0X 4JS4A 4HVWA 4DV1L 2CT4A 3HOYH 4C3HB 3CPFA 2NVQB 2NN6G 2JMAA 1CKOA 3L9AX 1VQ6A 4LJZC 1R0CB 3P1HA 5CBEE 1CKMA 3PCOB 3JCMd 2SRCA 5LMNQ 2EPDA 1Q82R 3DHQA 3TSSA 3L2RA 5A0GA 3TEHB 2O2OA 3GTKH 3GD7A 2F52A 2QTVA 4FW2A 4WFN3 1G51A 1TU2B 3L42A 2LJ0A 4C8QD 4MTNA 1UAPA 2XSCA 3C2PA 1N9SA 2B2VC 2YRDA 4G57A 3HTRA 1JMCA 5ELBA 1D0ZA 1PHTA 1IBML 1FWZA 2KVQG 2VKNA 4UP9A 5CMDA 1II3A 1WTXA 5C0XH 2NN6I 2GVAA 2HCKA 1RTOA 3SXHA 4QIWB 2CQOA 4MZPA 2YTVA 1I94L 3MXNA 3MO8A 3W1GA 2EZVA 3G71T 2X6GA 1IHVA 2QK0A 1JO8A 1WGSA 1HXDA 3M4YA 3OYMA 3QWYA 1G3YA 1HH2P 2ZXOA 1GUNA 3VS4A 2R7ZG 1A2TA 1PZKD 4P74A 5FU6B 1GD7A 1OULA 4C3JH 3H41A 2YRCA 2I46A 2HHHQ 5KE3A 4HXJA 2VS1A 1LT3D 1E3PA 1B1ZA 2CWAA 1SNPA 2KHIA 4KN7C 4FP5D 1X43A 5KEEA 4JJDA 5DAUA 3PMFA 4OMPA 4A3DG 1X6OA 3JB9F 1GBRA 2L5TA 2PW7A 1Q46A 3NWTA 3ULLA 3OYLA 3VR5A 5GAMj 3DEOA 2B63B 1KTKA 4M7DD 4RG2A 1F9SA 1W2BP 1BCPC 4LF8Q 1TWFB 2EPBA 5GAHC 2VC8A 1TU0B 3S2DH 3E9GA 1K73C 1QKWA 4FM4B 5IP7H 3OYCA 2D0QB 2RI5A 4WJ3M 4KUDK 1HNWL 1OO9B 2NYZD 3TREA 3QOLA 2V26A 4FDBA 5IWAL 5M3FB 2UXDL 5D6YA 4ZN3A 5FLMG 1QLYA 3FEWX 1X75C 4R0KA 4DAPA 2K3BA 4E6IA 3NPFA 3CHBD 3CCMT 1I6VC 5GAOl 3BDLA 3LX7A 3M0UA 5LJ3d 5IYBG 2NUCA 3H0FA 2DY7A 1L0WA 4WJ4A 4DR4L 4FYYB 2CZ7B 2FPDA 4F7XA 1HZCA 1UTIA 1WLPB 1D5XC 5A0LA 2B2VA 1VQ7Q 1RLQC 5FROA 2JTMA 4DEYA 3MA2B 3OWFA 1IYVA 5IGCA 3SFMA 2GTJA 2R92H 4RTYA 1VQHA 4JYAL 1CSPA 1ACMB 1BXTA 3GDEA 3KLSX 1MGQA 4UHVA 2J6OA 4DBRA 4HCSA 1N32Q 2DXUA 4A4GA 1EU4A 3NBHB 3S2HB 3G4SA 2L3RA 3CC7A 2DZ9A 4J7FA 1VQDA 2WSFE 2D6FA 2DIGA 1Y14B 1NE8A 2A37A 2X4JA 1KD1C 4HAEA 2F03A 1IKLA 4C3HG 1QVGP 2OCEA 1C9OA 3HS0C 4N9TA 4LDYA 4C56C 1WI7A 3N6RA 1S3OA 1NYFA 4D8DA 3CCRT 4OEMB 4M7AE 2KXDA 1XQHA 2XDDA 1VQ4Q 5GAMg 2TMPA 3GTMB 5DNFA 2I0QA 3OTOQ 4LUEA 2DY8A 2J6FA 4O5VA 2RD1A 3V7CA 2B8FA 1VQ5A 1ZUKA 4V2SA 1NR4A 2F0KA 4WRDA 3HL8A 3K7AB 4M7AC 1SFOB 1D1CA 1P8LA 4ZAIA 1X3FA 3R8BA 4YCVA 1B4OA 4K6DA 4LF7Q 1S72Q 3KYHC 4KGXB 3ULJA 2CZ1B 1OZ2A 2JN0A 2C5CA 4R4TA 1C1AA 5E4XA 1CQFA 4C0FA 3S1RB 2LY7A 5AJ3Q 1Z9FA 1PVOA 2EDGA 1WHLA 5GROA 3CXCS 5FRMA 4ATOA 5EQ0A 5GMKh 3CCRA 4CDFC 4ZK9B 2D0PA 2IT1A 3GTPH 4RGNA 1TG0A 1CZGA 2VZAA 3ASKA 8AT1B 1SNOA 3H0GB 1SG5A 1BCMA 3GIBA 1VQFA 4DBFA 4GS3A 1KQSS 2PQEA 3NWSA 1OPKA 4C8QF 4KJNA 5EC7A 1X2QA 5EKKA 3PO3H 2DD4A 4YTLA 4A53A 5JEAJ 1WTHA 4FU6A 1XWEA 1L2FA 3L7ZC 2Z0WA 2KCMA 3NENA 1WNLA 1R9TH 2B63G 4A3IB 1IBKQ 1BDOA 4CRIA 4DV3Q 3DWQA 1QJOA 2EW3A 2AHOB 2OAUA 2HBPA 2KRSA 1O9SA 3OYIA 3CC2A 3GO5A 2HZYA 4C5GA 3JCMW 1B3AA 1KRSA 2R93G 4ALPA 3CBMA 3HRTA 5M3FG 1WHHA 4AFSC 5C3WA 1CUKA 3CQZH 5C6AA 1WPYA 2PUKB 4BE0A 1EIFA 2SDFA 2LMJA 3AHUA 1I4GA 2FXQA 4AYBE 2AZSA 3EHQA 4ZGDB 1TSFA 3GPLA 1YI2Q 4CDDC 2DYBA 4JI3L 3K58A 2HQHA 1XNQQ 1N6AA 2UUCQ 1Q95G 2E70A 3HOWB 4GKKQ 5I6WA 3I4MH 2FZKB 3OS5A 5D6XA 3ULRB 3CCUQ 5CKFA 1V43A 3MWYW 4P71A 4M7DF 1BI3A 2D1XA 2ZCFB 3SK4A 1ZSZB 2K03A 2VGNA 2LCCA 4BXXH 1QVPA 5GAMd 4JI2Q 1QOHA 3RR5A 3I90A 1EYDA 3M85A 3K5OA 4J9IA 4DF7A 4F87A 2ID0A 1OXUA 3EFRA 4IFDH 1MBYA 1YJNQ 2RHSB 1EY0A 1ICFB 2RK1A 5IHNA 2WSCE 1S5FD 5CV7A 5KYXA 4O2DA 1MUZA 2JS2A 1VQ7T 4C2MB 1AWWA 3FKIB 4A3LH 2NVYB 1OTCA 1PTOD 2XWJB 4DUZL 2LQNA 3AFPA 3SWNC 3RLNA 5HURA 2Z0SA 3LLRA 5GAOn 1HZ9A 2NUPA 2XD0A 1O7ZA 4VUBA 2K6AA 2RDFA 3GTJH 1YNJD 4R1JA 4TKOB 5CKEA 2E3IA 1K3BC 1IYUA 4ZRZA 3V7RA 2NZOA 1ILQA 5DM73 4YHHQ 3BW1A 1UE1A 3RERA 5EGTA 1WFQA 4RA8A 1ZSGA 4Q5VA 2VGMA 2W0ZA 2EXDA 2UXBQ 3KFUA 4FYDA 2NN6H 4Y91A 3LH5A 5CAIA 2ZAEA 3META 1QILA 1STEA 1UE9A 3AT1B 4DR2Q 3CCJQ 2P0KA 3HOUB 4TVAB 2EE1A 1HNZQ 1QQJA 1S72T 3M9BA 1O7LA 1MSGA 2KXCA 4DOVA 1L0YB 4TQUS 1HJPA 4MHEA 3H0GG 1W1FA 1OI1A 3NSWA 3DWPA 3NGPA 3SR1A 2HHHL 1TUDA 4KN4C 4IUQA 3MP8A 4G7HC 1EEFD 5G3LD 2RQUA 1W2BA 2BA0A 1FMWA 1B7TA 3NELA 5E7NA 3GV6A 2QKIC 4AT1B 1VQJA 3E1SA 3EFOA 3E0JA 2WB1E 3KF6B 4NW2A 1OOTA 2KHJA 4JBKA 4R55A 2XRSD 4A3IG 2KENA 2X6LA 3T1YQ 2BDOA 5GAN2 2P4RA 1V76A 4PMWA 2R7ZH 2F2XA 4NXNQ 4F7UA 1KDAA 2ZZDA 3GOXA 1ET6A 2KQ3A 4V190 1AWXA 1NEGA 4C1NK 3S17B 1HCZA 4XTZA 1M2OA 1TWCH 3SK6A 4HT9A 2LQWA 2CS7A 4O42A 4A3DH 2JA6B 1LNXA 1Q81R 1T5EA 3E19A 3PSIA 1PH8A 3MKDA 4C0GA 1LUZA 1Q8IA 2B39A 1BI2A 2J4XA 3JCMX 1X27A 2KSSA 3CPWP 1HZBA 3M0QA 1EIYB 3HOWG 1RAGB 4FT2A 3E0EA 4AG2C 4R4CA 1PWTA 3HP9A 5CORA 1VQPQ 2JA8G 1EWCA 4RKBA 1G6PA 2EQMA 1SAPA 2OX7A 2L5QA 2E2HH 3H3VC 5FLMH 4UDUC 2BCOA 3RBBB 1I4HA 4TVRA 4XTWA 1I3QB 5FLXE 2VB2X 1AE3A 3CRKC 2QGGA 4Z89A 1U4LA 2DPPB 3E5SA 2J7IA 1N32L 2MOXA 1QVGA 4QL5A 5IYBH 3DKMA 1QUQA 2YTXA 1E22A 3F2DA 2KEEA 2E2JB 2CREA 3S3MA 3FKIG 1EFNA 4LF9Q 5LJ5e 1IW7D 4B6MA 4J9CA 1K28A 1BBUA 1PZJD 4MN3A 2AWNA 3NTHA 1UJ0A 4KY6A 3X24B 1S1NA 1LYLA 2H8HA 1YJNT 1I5OB 1X65A 4PLLA 4GKJQ 1GJXA 2CHBD 4XQJA 2L55A 1E1OA 4EX5A 3OTOL 5E4WC 1I5FA 3UT1A 3S24A 5CBAE 4A4IA 1YJ9A 1SYBA 3DUZA 2FVUA 4OELB 3D0FA 4LF7L 4XXEA 2QQRA 2Q8RE 4F88A 3VU3C 1STBA 5FO9B 2RHYA 3KBXA 1U06A 4C3HH 2ATWA 2NVQH 2F4VQ 1XMOL 3EIVA 5LL6X 2P0PA 3FB9A 5GAN3 2EYLA 4XTXA 1PTOF 1YWOA 3KFVA 2F0WA 2CWPA 2CVRA 2HDLA 5I9PA 4X66Q 1H95A 5AJ3L 3JCMc 4BI8B 2OI3A 2HQEA 3TRZA 2JM9A 2KOLA 4OONA 6AT1B 3HOUG 4M1UB 1VQKT 1KHCA 4J7IA 1RAAB 1KABA 1PZID 2XIDA 4BUGA 5IHKA 1X54A 1BUVT 3I56A 2ZPFB 2M9UA 5GAMh 2K14A 5C5LA 3LGLA 4C0ZA 5IE8A 5HCKA 1HA5A 4P73A 3WVDB 2L4NA 1H3HA 3CCJT 5D7UA 1WD1A 2GQVA 4F04B 2OEOA 1ILPA 3V8LA 1V1PA 2MP1A 1AEXA 3EFSA 3KJPA 1TH7A 3QDFA 1Q7YU 4DV3L 4FXGC 1H9JA 3O5ZA 2MCNA 2LRQA 1IXDA 1YBYA 4ZN1A 1D0XA 4RTWA 2A6HC 1VQKA 5IXFA 1WTWA 2LDMA 3QPHA 4QW2A 2FZCB 5GAN7 1W70A 3TEEA 1VQCA 1MIUA 1UGVA 4JI0Q 3M3YB 3CCEA 1RL2A 2AK5A 5G3LF 2CKKA 4HVUA 5FKAC 2JA6G 1WA7A 1W6XA 2B63H 1I4XA 4JV5Q 4YCUA 2EYWA 1Y8NB 1PNJA 5C0MA 1XNQL 5FWCA 3DMUA 3A98A 4RH6A 1TWFH 2JJQA 2V1CC 2HD0A 1I5LA 1A2UA 1CFMA 2JA7B 2M51A 2MI6A 1VCIA 1FX7A 3F8TA 4M8AA 1PRTB 5A2QE 5M3FH 4PL6A 5KYNA 2UUBQ 1OYXA 2RHZA 2CW0D 4KLKA 2LNHB 3FMCA 3PUYA 2DJZA 2N55A 4FF3A 1S4ZA 1MI2A 4FYWB 4GLMA 1XX8A 1G83A 1V1QA 4DAYA 3H0HA 4MMKA 1LTID 1VQPT 3I3CA 1I1JA 1VQEA 1BKBA 1AD5A 3K81C 3V96A 1Y96B 1OU8A 4PZ7A 3Q22A 4MTKA 1O78A 1RAIB 2YU9B 3HFNA 3HFZB 4N4HA 4CC3A 2DNCA 2N8NA 2P84A 2HDAA 1JB0E 2NTSA 2CSQA 4OL7A 4KHZA 5GAGC 3NP8A 1G3SA 2X35A 2D62A 3JSCA 1WJSA 2Q2HA 1I94Q 2GA4B 1Y0MA 1I4RA 2K1BA 4OIKA 4OIJA 2PU9B 3Q8DA 4MZTA 4RCBA 1CSQA 1E0BA 1KC8U 1UE5A 4DQ2A 4YHHL 3S2HH 3I91A 3WXMB 1F2YA 5C4XB 1HTPA 1SN8A 2HQXA 2PMZE 2B3GA 1BBWA 4HTHA 2X51A 5ELCA 2R5AA 4LW1A 2WAQE 4M77B 5IN1A 1EQRA 1SNDA 4KY7A 1AN8A 3ZEHA 2IX1A 3HOXB 1GUOA 1RIPA 2KR3A 2H1EA 4I7AA 4J6XA 3GTMH 3K0XA 4H7BA 1J9OA 5CVIA 1X3QA 1UGSB 4PJOB 4DR2L 1IL2A 2I5HA 2X4WA 2ZGWA 1HNZL 4BS9A 2YXYA 1ONLA 3V05A 3NFCA 1UGPB 3K7AH 3J81c 1JBMA 1SFOH 1PH3A 3K8AA 4WTOB 1Q82C 1HUMA 1HNWQ 4C5EA 1HR0L 2UXDQ 2WIIB 3C0CA 2RBMA 5M5YB 3JCMV 3A8LB 1A15A 4LUVA 4A3JB 4DNTB 2LMCB 1VQ6Q 3S1RH 4F7UF 2R92G 4BY6B 3SHWA 3JAME 3TZUA 4CJ2C 4B3MQ 5IY0A 2K01A 1VOMA 2K5FA 4HCKA 3MP1A 4H0LC 2RH2A 5DY9A 2RA4A 2DTHA 4XQ3A 3MEFA 2F0VA 3JCMP 4DBHA 4LDUA 1OXXK 4AH6A 5GMKl 4DR4Q 2DLPA 4KKUA 3FRNA 2A36A 3H0GH 5C3EB 2K79A 3J80c 1K9MU 1LTAD 4DR6L 3I9QA 1IB8A 5GANe 1IL8A 2KVMA 4E7ZA 4C8QE 1X2KA 2EFIA 4C0DC 3OW2P 1OXTA 1SYCA 1SROA 2RI3A 4HKEA 3GTGB 1UFFA 1K3RA 3PGZA 5KYWA 1RF2D 3QBYA 4K8JA 4C8QC 4APVA 4A3IH 1SMYD 2JVVA 1TWHB 2F0JA 2JW4A 1WYDA 4WJWA 1G6ZA 3VYSA 3OYAA 3BU2A 3EGXA 1SYFA 4NXMQ 2KECA 4K0KQ 5I2SA 4K2LA 1QMCA 2V8IA 1QP3A 1ZYRD 1OEBA 2D5DA 2BZ8A 4HIDA 3V2TA 2RB6A 4RTUA 2JA7G 2COZA 3M9QA 1HFNA 3QYHB 3FHWA 3GP7A 3OOCA 3S14B 2KAFA 2ZJQA 3WOFA 5M9OA 4PMCA 1JR0D 3NQTA 1GFCA 2E5LQ 4RKUE 1N5ZA 4OB0B 5DM63 3JAMi 1MMNA 2DN8A 2AMCB 1C48A 3HOWH 4DK0A 2KK4A 2QEJC 4N4IA 1LTRD 3KXTA 1SEMA 4OX9Q 3KBGA 4HCCA 4M7DE 3AU7A 4FXKC 1QNUA 3M5AA 1A3UA 4BBRB 2PTKA 1WTPA 2EGCA 3U23A 2CYZB 3PMTA 3PMIA 4M7DC 1IXRA 3HHTB 3JCMQ 1FNVA 4NL2A 2PQAB 4JLIA 1S5ED 4X3SA 1QKXA 1K0SA 3W5OA 1WJRA 2JTEA 2KRNA 1B44D 1KNAA 4L59A 1NYGA 1IHWA 3MEVA 4H13C 1GO3E 1ZKOA 3A7AB 2JT4A 3M0SA 1B2TA 4C2MH 3HRSA 3UPUA 3S1QB 2ALYB 3FKIH 2NZHA 3GTKB 1NEBA 1L1OC 3E9FA 1G2SA 2KJXA 3GV3A 3M7GA 1PH5A 1M90U 2NVYH 2SNSA 2R5MA 4IO9A 2O4XA 1XJVA 3HKZE 4M77G 2F4VL 2EYYA 2F2WA 2WACA 3OMGA 3VS6A 4X66L 2NVTB 4ILWA 1UG1A 4C5HA 3HOXG 1SNQA 2K5HA 4JJCA 3RR6A 5AYFA 3F2UA 4CDCC 4PJOG 3QZ9B 1IBLQ 3ICEA 1H9SA 1UEAB 2F3VA 2BE7D 3TCJA 3G4SQ 3CC7Q 1R8OB 4DU9A 2IHEA 3E6ZX 4RTVA 1AVZC 3KUFA 2MWPA 2RJFA 5KYYA 4RTZA 2HAXA 2I5MX 4DR1Q 1NTGA 4A3JG 3A56A 1RAFB 2HQLA 4MZMA 5CIUA 3THKA 1BCPB 1PDQA 1U1TA 5GAMf 1E2ZA 1UWVA 3OIQA 3OW7A 1SHFA 3KLRA 3LX0A 3P7JA 1KAWA 1TS3A 5ISRA 4JI3Q 1Q12A 3HOUH 5GQOA 4DK3C 4J6YA 1VQ5Q 5JEAG 2FZGB 2ZPHB 4IIOA 4NL3A 1C4QA 1BNZA 4J6HA 4C92A 2DL8A 1BIBA 3M4PA 4X65L 1VQ6T 2MNAA 5C3EG 3LGFA 1D3BB 1PH1A 4A3LG 1LOJA 4J9FA 3JB9J 3FPUB 1UHFA 1PMRA 3UF4A 1IGQA 3H8ZA 4LDVA 1SSHA 5CC4A 1HYOA 5IOCA 4E7HA 4FNFA 2RA2A 2J6KA 4CKCA 2RQVA 3X20B 4D8KA 3J7AV 3VYTA 2F1MA 2MMPA 2JM8A 1W2BS 1PFMA 1F2LA 3NHHA 3VUZA 4IURA 2YUPA 3FC3A 2V4DA 4QMGA 5HGQA 1L1OA 3Q24A 2DNEA 5IYDG 4DUZQ 3S17H 1UDLA 1YCSB 3NMZC 2UUBL 2EJMA 2DERA 2MYSA 4B08A 2RPNA 1DOKA 2RO0A 1TWAB 2JXMB 3VA5A 1KLGD 3CF5A 3BJUA 2JA6H 2F0DA 4FF1A 4A93B 3ND9A 3RESA 4V0BA 1WTOA 2FMCA 3OSOA 1M3BA 3INZA 1YN8A 3S9WA 2MGSA 3PO2B 4HN7A 1C7YA 2XU8A 2FFKB 1KSWA 2DA9A 3CC2Q 2A68D 4JI7L 4GKKL 4BBRG 2F69A 1NMFA 2QGQA 1NSNS 4RMFA 4YY3Q 3T56B 1M1KR 1I4K1 4BBSB 1Z9ZA 2EBPA 3A8GB 4B3TQ 1NM7A 4M78D 4M7AB 2BIVA 5J1ZA 1I3QH 3CEYA 5IGFA 2M0OA 2KHSA 4EMKC 1F9RA 2KCTA 2ENBA 1E2WA 2MPXC 3EQLC 4K8IA 5C5MA 2O5IC 1MMAA 2C06A 1U4RA 3BDUA 2WP8J 4P5NA 3CKIB 5DEHA 3V8KA 3FJPA 4ELYC 2A69D 2E2JH 2A08A 5L8RE 2A1AA 4ME3A 4LF4Q 1VYUA 1M4ZA 4XU3A 4C92D 3MXGA 2A0FB 3ERSX 3O13A 3ONAB 1SR3A 1QVGS 1RUWA 1JJ2P 1BB9A 5KYXB 2GTOA 1UJYA 4R4IA 2DX1A 4KRTA 1VQ8A 3EBEA 2DJFC 4O1NA 4LF5L 4DUYQ 3QR8A 2F0PA 5HGTA 1WOCA 5FW9A 4HJ5A 5I2MA 4MIUA 3OYGA 2Z1CA 1Q1EA 5FJ8G 3M55A 3UA7A 3P75A 2FRWA 1GVPA 2OJ2A 1M8VA 2IPOB 4FW1A 3QO2A 5IGEA 3M57A 3G4ST 2F5TX 4J1MA 3CC7T 1UUEA 1ZXTA 4ZCKA 4YWLA 1JRIA 4B3ML 1N27A 4ZUIA 2LXKA 3ND8A 3L1AA 1PTOC 3AMUA 2H3EB 4RGOS 3OW2A 3NE5B 3UWNA 4MMLA 1LTTD 1SMXA 3D8GA 3MZ5A 4R4OA 1YNJC 2M16A 2QEXQ 2ROLA 4DV2L 2WKCA 4QVZA 2LT4A 1QE6A 5C4HA 5A35A 2CP3A 1KQ2A 2IWHA 3Q0AA 1EL0A 1WX6A 1VQ5T 1CI3M 1WJQA 1KJWA 1HNXQ 3M59A 5KYUA 1K8AR 3NEMA 4EMKA 1LTGD 3M7NA 1L0XB 2YWWA 2CQAA 1JOQA 4NXML 5J3BA 4K0KL 1TOVA 1LTBD 1LCKA 4CJ1B 2DETA 1R4PB 2PI2E 3GNFB 4OO1G 3EG3A 1BO0A 1JORA 1XNIA 3J81E 4KMUC 3OSSC 3OYKA 4B9WA 1EY9A 2F0IA 3M3YH 4O0AA 2L3QA 2UXCQ 4BB7A 2GF7A 4IUUA 3KJOA 1B9NA 4GOPA 5KH6A 2E5LL 1EOTA 2EYFA 2L3SA 1CA5A 4NDXA 3J7A5 4A93G 2MO1A 3OBWA 1YNXA 1SDFA 4JVZA 1VMPA 1WTVA 2D0NA 2JS0A 2XMFA 4ZKCB 4OX9L 3SWNB 1SXTA 1D09B 2VB6A 4QQGA 1IRXA 1Q81C 1LTSD 1FR3A 3H91A 2JA7H 2ZPGB 1VQ9Q 4JBMA 2NWMA 3H9NA 4LAAA 1A3VA 1QB5D 1XMOQ 4XYOA 4OO1I 2ZT9C 4HIMA 1MGSA 4PZ8A 1WXBA 3MAQA 1HTLD 3J80E 1MV0B 2BKDN 4M7AG 2AIRB 1E2VA 1Q7YR 4F17A 3VS5A 2MHVA 3STBD 1GM5A 1YNND 1PYBA 1JB7A 3EGDA 3CC2T 4DEXA 2K5VA 2Z6KA 2EQIA 4PV1C 5IP9G
chains in the Genus database with same CATH topology
1SE8A 1NJIC 3TS0A 4YWMA 4JUVA 2YU9H 5HKCA 2I5LX 5IAYA 1VS0A 1IZ6A 3J81i 4NOYA 3QSUA 3A5UA 3LYIA 4IKFA 3I2ZA 2RJCA 3QXEB 4ELZC 4M78F 1IBLL 2LNVA 3R6OA 5C4XH 3F70A 3TS2A 2LQ8A 3S3OA 2IG0A 3RUXA 1SRUA 4DR1L 4EMGA 3OYDA 4JBWA 4X9CA 4C92F 4IUTA 3RMQA 3I7FA 3HOXH 2PI2A 3PUWA 5EAYA 2VL6A 3KDFA 2LCLA 3CW2C 2WFWA 1EFWA 1PHJA 3PF4A 1G3WA 1KQ1A 1BI0A 4JI8L 5CQXA 4DR5Q 5M5YH 4JOIA 4GNXB 3VUBA 4A3JH 1LJOA 2DAQA 5GAOq 2XDBA 4F7UE 1XMQQ 2QQBA 3JCMJ 1CKNA 2QEXT 2R6GA 3LWIA 4O6JA 5C3EH 1U1SA 2CGHA 4FL6A 3D31A 3GTGH 4L5SA 1QZHA 2Q2TA 4XIGS 1BYMA 3NTKA 1TWHH 2JOYA 1XPOA 4R4QA 4QY7A 4QGUA 1NPRA 2QEXA 4HIKA 5IYDH 2JTFA 2QQAA 4YY3L 2ASBA 4BDYA 2IVWA 3S14H 2Y4YA 1A0IA 2FHDA 1PFSA 2RHIA 4PNOA 2QA4T 4B3TL 3QHSA 5DLOA 1XOVA 3DB3A 4DR3L 1VQ9T 2A19A 5LJ5g 1JJ2A 4J83A 4BBRH 1HR0Q 2RM4A 4LF4L 1OXSC 4A3GG 2EIFA 1YHBA 1LM0A 4EQ5A 1VQNA 4LDXA 1N8RC 2JK8A 2EJGA 3QDRB 4E7KA 3C94A 1Q82U 2QA4A 2K4YA 2DUDA 4DUYL 2KDSA 2X4XA 3S1QH 2KMTA 3GTKH 4A4FA 2XGTA 2OQ0A 2VW9A 1PYSB 2K3XA 1VQ9A 2IY5B 4DR6Q 4LFCL 3PF5A 2H3JA 5LMNW 2NVTH 3GNGA 2VXFA 1KHIA 5GAOm 3KLWA 3RKWA 3OSVA 5CK9A 1G5VA 4II1A 1B7YB 1QP2A 4RCCA 5FJ8H 4JI6Q 1NZ9A 3L2QA 1YJ9T 2IX0A 1Y71A 4FT4A 2PNHA 1HNXL 5JJKA 2B8AA 3S6WA 1QVFS 2C35B 5HK3A 1I8FA 1VQOA 1GKHA 2Y0SE 1VIEA 1FGUA 4UPAA 3SGIA 2UXCL 5HK0A 4EDUA 4ZGEB 1UE6A 3DM3A 2KQWA 2LT1A 1WJJA 1D7QA 2VNUD 3I56T 5LJ5d 4JBJA 2ZJPA 3J7ZC 4JLGA 1YVCA 1E24A 3U4ZA 2L15A 1M1FA 1QW1A 4XU1A 1U8RA 4RG1A 4DV6L 4DOWA 1TWAH 3VDYA 4A3EG 4A93H 3JRZA 4A54A 3U50C 4DAMA 2EKOA 3CMEA 4QVDA 3RN5A 3PO2H 5IYCG 4XTCS 1OXVA 3CCET 1B8AA 1X3GA 4BBSH 1FJGQ 2K4KA 3F2CA 2P4TA 1E7ZA 3RKYA 3PT9A 1VQAA 1S40A 3PIOA 5IP9H 4OMFB 1V29B 4X65Q 2V8KA 4BI4A 3QJ6A 4GN4B 4PZ6A 1FXXA 2XG8D 2F5KA 3MEAA 5FU7C 5CKDA 4KBMB 3HPWA 1IYJB 2YRVA 4A4EA 4BY1G 1WI5A 1XTDA 3OYYA 4BACA 2RI2A 2CKZB 5CO7A 1PH2A 4FIBA 4C0DB 3PV0A 4DR5L 2ZPIB 3M4GA 5FRNA 1B34A 4ME7A 2DK3A 4C8QB 3J7AF 4KULA 4OP0A 1XMQL 2H5XA 2XHCA 3OB9A 3JB9G 4JI4L 2Q2IA 3CCST 4A3BG 4QQ6A 4M75B 1N9WA 3I4NG 4JI7Q 2VYTA 4A3MG 5GANg 4HJAA 4L5GA 2QQ9A 3CCQT 4Q5WA 1V9PA 3OW2S 1A62A 2LX9A 2B29A 4QJFA 2DO3A 4OWXB 4X34A 4IPCA 3JB9I 1VQMA 2OTJA 4POGA 4OB3B 1AE2A 3KF6A 4M7DB 3CCSA 2VXEA 3CD6A 3L2ZA 4JCVE 1XPRA 1VQIA 3CCQA 4LWCA 2EJFA 4DV7Q 4LF5Q 2JA9A 5ELNA 2WSEE 2A3LA 1J5EL 3L2VA 2PVOB 2K52A 4YCWA 3P8HA 2RJEA 2WAQG 3G48A 3RLFA 4AQYL 3B6YA 1YZ6A 2DKGA 1DJ7B 2K57A 3W1BA 5LL6S 1K73U 3LGJA 1M1KC 3CCVT 2ZM6L 3HKSA 3MXNB 4DV2Q 3CPWA 4A3GH 5LJ5h 1YEZA 4OXPA 3U4VA 4OGEA 3E9IA 3HFOA 4HJ8A 1YHQA 4M78E 5GANd 2OQKA 3CCVA 2K2VA 4M78C 2OTLT 3MHXA 2GCXA 2I2LA 1K83H 4C8QG 2CZ0B 1HZAA 4JI6L 1UB4A 4C92E 3H6ZA 4HJ7A 4A3CG 4OVAA 1KG1A 1KD1U 1D8LA 3AFQA 1Y1WG 3P8DA 4C92C 2YLBA 2PQWA 2E6NA 4A75A 4H02A 4M75G 1YIJT 5JJLA 5A0DA 2VQFQ 2L89A 2Q2UA 2O01E 2E64A 1K0RA 3F1ZA 1RI0A 3QZ5B 2JQOA 2HT1A 1JJGA 5GAOp 3EAEA 3UDCA 4BE1A 2OTLA 1AHJB 2K75A 3S15H 4JI1Q 2EQKA 3CCLA 4KHPL 2VUMG 5KE2A 5C4XG 4LDWA 4CI0C 4PLIA 2MQHA 3UDIA 4M7DG 5CKBA 1K8AC 3RKXA 1YIJA 4N0AC 1I50H 1PH9A 2RK2A 2XTIA 1NJIU 4IJLA 2L8DA 1N34L 3JCMg 5I21A 1WCMG 3O8VA 2DXTA 3EN2A 4RMOA 1NMGA 3HOVG 4M78A 1O75A 2XKOC 2GVBA 5LMUQ 5CR2A 1FJGL 3G7ZA 1KL9A 4A3EH 4LFBQ 3BZCA 4GY5A 2N78A 5IYCH 4MDXA 2YLCA 4DV0L 4JI8Q 3A5ZB 5EG2A 1VQGA 3CBPA 2JUFA 5GMKe 4JS5A 1Y96A 3M54A 1P92A 2JNGA 3URGA 1X3EA 3TQYA 3GP8A 1Y1VG 4POFA 3G6EA 3K7UC 1YITT 2D0OA 4BE2A 4E7JA 5C0XJ 4DV5Q 1U0LA 2LQKA 3J81j 2E41A 3WVEB 3STBC 4A3KG 4N0AA 5K36G 4A4HA 4LD9K 5GMKi 4J8OA 4BY1H 3PIPA 2N49A 4M77A 4WF2A 3CC4A 3JCMe 2VY3A 1YITA 3PGGA 4N4GA 4PJOA 3X28B 1G291 3BZKA 1H3ZA 5LJ3g 4MZ9A 1PH5A 3CP0A 3PUXA 2AKWB 5M3MG 3P8BB 4XTVA 3RIRA 3ME9A 1VQ8T 3KDFB 2ZPBB 2ZTCA 2K5LA 4DR3Q 3UE1A 3JB9H 3VYGA 1DGSA 4A3BH 4GN3B 3M4QA 3I4NH 3PTAA 3GF5A 4A3MH 1KC8C 1AH9A 4HCBA 2V8JA 5M5WH 2QXFA 4OB2B 4GOPC 1CKNB 5IT9c 1EOVA 3OYBA 5GANh 4AIMA 2RCNA 2K5NA 3OQ5A 4M75D 4DV7L 2R7FA 2DZCA 3HSBA 3GTLH 3OMCA 4BD3A 3OYNA 4LFCQ 3X25B 1N36Q 1N8RU 5FLXc 2MF2A 4JI5Q 3OS2A 3QJYA 5J26A 4NPSA 1ZBXA 1PA6A 2PVGB 2YTYA 2Z6KC 3I4OA 1ZQ1A 5GMKm 3OYHA 2E8GA 3QG1A 4XU0A 3VKIA 2JEBI 2ES2A 4GLXA 4M77D 3G71A 3L0OA 2LSSA 1VIFA 3S16H 5LJ3e 5BR8L 4BY7G 4PJOD 4DA4A 1K9MC 1XNRQ 4ZTJA 4KT0E 1BVSA 1A8VA 5C6SA 3V7SA 4L6V5 2PQAA 4B3SL 5LJ5f 3FIFA 3HRUA 4MNOA 2FB7A 3VYHB 3OS1A 5KCOA 2CFMA 3N5BB 4F7UB 2UU9L 2JZ2A 3KOJA 4MDWA 3PO2G 3CCMA 4IPGA 2VQFL 1OZ3A 4JOIC 3QUIA 4LUOA 4IOAA 2QTXA 4DV6Q 4BBSG 2K3YA 4QIWE 1X9NA 4OB1B 3T9NA 4A3CH 4JI1L 3SD4A 2RF4A 1Y1WH 4UY8C 3SDZA 2GN5A 2R58A 1W3SA 5FU6C 1QUQB 1JJCB 1B70B 1M90C 1D3BA 4XAXB 4UP7A 2VUMH 4BI3A 4NS5A 3GLXA 3T1HQ 2LTOA 3C12A 1VQBA 1Q86C 5DLQE 4L5RC 5LMUL 4IFDJ 2X4YA 4A76A 2GFAA 5C44G 4LF6Q 4NB3A 4LFBL 4B3RQ 4OF1A 3J80i 3RLOA 3PNWC 3ULPA 1WCMH 4M75F 2RHUA 5CCAA 5LJ5j 4X64L 1TXYA 4C3IH 3AYHB 3HOVH 2A7YA 3JCMh 3KF8B 1KXLA 3CAMA 3U58A 1N9RA 2N3SA 1ZHIA 1I81A 4AYBG 1N33Q 3C4SA 4JI4Q 4JRQA 4XU2A 5GAMe 2VQEL 4OGCA 5CKHA 4M7AA 4X62Q 2E1HA 3DB4A 1NE3A 4DV5L 2MO0A 4M77F 3IRBA 1UGQB 3RNUA 4IUPA 1JE5A 4GN5A 5GAEC 1P16A 2G3RA 4F7UG 4PJOF 2E10A 1W4SA 1Y1VH 3GTOH 1U5KA 4IOCA