2KT1A

Solution nmr structure of the sh3 domain from the p85beta subunit of phosphatidylinositol 3-kinase from h.sapiens, northeast structural genomics consortium target hr5531e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
b'MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit beta
molecule tags Protein binding
source organism Homo sapiens
publication title Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens, Northeast Structural Genomics Consortium Target HR5531E
rcsb
total genus 13
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kt1A00
4A63B 2PTKA 2ED0A 3RNJA 2HCKA 5GJWB 4HVUA 1M3AA 2A08A 1X27A 4RTVA 2DJQA 3ZL7C 2BTTA 1BU1A 1WIEA 1G2BA 2DRMA 1RLPC 4DEYA 3R6NA 2RPNA 4FSSA 1S1NA 3C0CA 1NG2A 2CT3A 1ZLMA 2X3XD 4ORZA 4OMNA 1WLPB 2KEAA 2W0ZA 4J9CA 3UATA 2DILA 2EYXA 1E6GA 4JPBW 1MV0B 2GTOA 1JXMA 1OPLA 4LE9A 2F2VA 1KFZA 2RQVA 1GCQA 2O9SA 2DLPA 1E6HA 2KBTA 2KNBB 2JTEA 1UUEA 3TVTA 4LNPA 1GCQC 2J6OA 2DYBA 1UE9A 1ZBJA 2EBPA 4GLMA 1E7OA 3RBBB 1K0SA 3PVLA 1YNZA 4F16A 4OMLA 1UTIA 2OAWA 2HDAA 4D8KA 3VS5A 1AWJA 1PRLC 1UECA 2EQIA 2MIOA 1SRMA 2KR3A 2ABLA 4Z89A 3JV3A 4OMMA 2XMFA 2GGRA 2YUPA 2J05A 2G6FX 2KRSA 1T3SA 1LCKA 2D8HA 1BB9A 4EIKA 2L0AA 1HSQA 4CC7A 2LJ0A 3CQTA 2BZ8A 4JJCA 2L2PA 1SHGA 1ARKA 1AD5A 2KYBA 3QWYA 2KT1A 2EYYA 2SRCA 2FEIA 4CC2A 1UFFA 2J06A 1JU5C 2KGTA 1NYFA 2MOXA 2ECZA 1B07A 1I07A 2AZSA 4OMPA 2EPDA 2FO0A 4J9GA 5ECAA 1WXBA 2RQUA 2FPEA 2LP5A 1M8MA 4RTWA 2L3QA 2DF6A 2DL5A 1OEBA 2E5KA 3EGUA 3VS6A 1K4US 2DVJA 1T0JA 2JMAA 1QWFA 1NLPC 2ROTA 3I5RA 2K6DA 4LN2A 1VYVA 5IHIA 2KT8A 4AFZC 3H0IA 2DM1A 1U5SA 5GJVB 1W1FA 2YUOA 5I22A 2EYWA 4J9FA 2CSIA 1GL5A 2EGEA 1GCPA 4HXJA 1YP5A 1TG0A 2FPFA 4R0KA 2DL8A 3M0SA 1UHCA 1Z9ZA 2NWMA 2OI3A 1J3TA 3NGPA 2AKLA 2ED1A 3UA7A 1X6GA 4Z88A 2JM8A 2JM9A 2KYMA 3FJ5A 4J9IA 2JW4A 1VA7A 2DE0X 1PNJA 3ULRB 1AZGB 5IH2A 1OV3A 2O9VA 1KSWA 3PE0A 2BZYA 1RLQC 1X2QA 4F17A 3UF4A 1VYUA 2O31A 2YDLA 1QKWA 1HD3A 2A36A 1XOVA 1X6BA 1YN8A 3M0UA 4GBQA 2ENMA 3NHNA 2LMJA 1AWOA 2DBMA 2H8HA 2KROA 1WXTA 3VRZA 4WCIA 2JT4A 4K11A 2LNHB 2LJ1A 2DL3A 2KXCA 1JEGA 5IXFA 1K1ZA 1MV3A 4KRTA 1WXUA 1UHFA 4AFSC 2DA9A 2C0IA 3M0TA 1U3OA 1SSHA 4Z8AA 2V1RA 1PKSA 4RTXA 2A28A 4QT7A 3H0HA 2D0NA 2KRMA 1Y57A 1WYXA 2VKNA 3VRYA 3EHRA 1B3QA 1FYNA 1SEMA 2OJ2A 1OOTA 2L3SA 2CREA 2IIMA 1TUCA 2EGCA 3VS2A 1A0NB 4ZNXA 2V1QA 1ZUKA 2F2WA 4M4ZA 1SRLA 4JJBA 1M30A 2HBWA 1CKBA 2HEQA 1KIKA 1H92A 1QLYA 3UA6A 2BZXA 1WA7A 1JQQA 2GTJA 2JMCA 2M51A 1ABOA 3PVQA 1SPKA 1NEGA 1UGVA 2M0YA 3KFVA 2J7IA 2NUZA 3QWXX 2CUDA 1Z9QA 4J9DA 4X1VA 2RNAA 4JJDA 1GRIA 4LUDA 1AWXA 2DL4A 1WX6A 3EG1A 4HVWA 1T3LA 3REAB 1UG1A 2LQWA 3TSWA 4D8DA 3M0QA 1VYTA 4F14A 2K79A 1NYGA 1PHTA 3THKA 2LCSA 2DL7A 2EW3A 4RTZA 2JS2A 2KXDA 4J9EA 4DEXA 1GBRA 2CUBA 3LH5A 1K9AA 2RQRA 2RQTA 1YWOA 5HCKA 2ROLA 1GBQA 1WI7A 2EGAA 2LJ3A 4CC4B 3I35A 1ZUYA 2LQNA 2AKKA 2FPDA 2SEMA 3VS1A 2B86A 5IHKA 1ABQA 2DMOA 1ZX6A 1CKAA 4AFQC 2AK5A 3I5SA 5L23A 2RF0A 3IQLA 2FG0A 3REBB 4AFUC 2EVRA 3EG3A 2RQWA 1W70A 1IO6A 2D1XA 5FWBA 1AWWA 1UDLA 1W6XA 2YSQA 4JZ4A 2K3BA 2O2OA 1YCSB 4LUEA 2J6KA 3NPFA 4IIMA 2CSQA 1AOJA 3U23A 3H0FA 2I0NA 1G83A 1NEBA 2AZVA 4J9BA 3M0RA 2LX7A 2L3PA 4RTYA 1EFNA 2JXBA 1WFWA 2VVKA 2RMOA 2KRNA 2YUNA 2D8JA 1ZUUA 1JXOA 3TSZA 2GQIA 2K2MA 1M3CA 1UJ0A 2J6FA 4HCKA 2ESWA 3EG0A 4OMOA 1UJYA 1V1CA 1QKXA 1T0HA 2X3WD 1M27C 5FWCA 1MUZA 2DX1A 4RTTA 2A37A 1QWEA 1GFCA 3GBQA 3SEMA 3NMZC 1K0XA 4HVVA 4AG2C 2F2XA 2PZ1A 1U06A 3VS0A 1AEYA 1M3BA 1K76A 2EYZA 1YWPA 2GBQA 2CH4A 2W10A 1CSKA 2C0TA 2CDTA 4AG1C 2K7AA 2KE9A 1NLOC 1KJWA 4E6RA 1BBZA 2YUQA 2P4RA 2QDLA 1BK2A 1SHFA 2PNIA 2EKHA 5IXBA 1H8KA 1I0CA 3VS7A 2K9GA 4CC3A 2GNCA 4J9HA 4RUGA 3EG2A 5I11A 1H3HA 4Y92A 2DNUA 3O5ZA 2LZ6B 1X43A 1OPKA 1JO8A 1NM7A 2O88A 2HSPA 2C0OA 1AVZC 1QCFA 4OMQA 1HJDA 4RTUA 2DRKA 2RN8A 3VS4A 1I1JA 3H41A 2DBKA 1FMKA 3A98A 1RUWA 1PWTA 3VS3A 1ZSGA 1RI9A 2YT6A 3SHWA 1N5ZA 2FRYA 1PRMC 1X69A 3I9QA 1AZEA 4IIOA 3EHQA 1X2KA 2MCNA 2CT4A 1Y0MA 2VWFA 1TUDA 1PKTA 2CH4W 1GFDA 5EC7A 5IHNA 4JZ3A 4ESRA 5FW9A 2JS0A 2FRWA 3M0PA 1WDXA
chains in the Genus database with same CATH superfamily
2DIGA 3GNGA 4A63B 3EFRA 2DD5A 3QZ5B 5GJWB 5CKEA 3CMEQ 4NS5A 3JCMc 3X25B 1YBYA 3ZL7C 1D0YA 2RM4A 3QBYA 3HPWA 1G2BA 1RLPC 3CCMQ 3R6NA 3OW2P 2RPNA 4M78B 1JJ2P 2CT3A 2HL3A 3RUXA 3FEOA 5IN1A 2ZPIB 1ZSZC 4OMNA 4NL3A 2DZCA 2KEAA 1D1CA 2OX7A 2EKOA 3EAEA 2EYXA 1JXMA 2F2VA 2DAQA 2GFUA 2RQVA 1OZ3A 1BKBA 1GCQA 4M77E 5CKDA 3PMIA 3G71T 3OYMA 1GCQC 2J6OA 1WHKA 1UE9A 1X6OA 4JUVA 2L5QA 4N4IA 4F16A 3SDZA 1UECA 5CO7A 3JV3A 4M7DG 2XMFA 2CKKA 4C5EA 5A0GA 5CR2A 1T3SA 4PLIA 1BB9A 3X20B 1HSQA 4M7AG 3DB4A 3CCET 1BI1A 1VQNA 2LJ0A 3CQTA 1JB0E 2BZ8A 3L2RA 3OSVA 3M9QA 1SHGA 1ARKA 5CCAA 1WPYA 1KG1A 2MI6A 1O9SA 5GAN5 1NYFA 2QG9B 2M02A 5KYYA 4IUQA 3RIRA 4KH1B 2CZ0B 5L8RE 1K8AU 4C8QC 2DL5A 4NL2A 2E5KA 3EFSA 5KYWA 1M2OA 1PD1A 4D6WA 1MMNA 1QVGS 1V29B 1VQ9Q 4M7AA 2VGNA 5I22A 2EYWA 2MK5A 4J9FA 4ZGJB 2EGEA 3CCMT 1GCPA 4HXJA 1KC8U 3QSUA 1TG0A 3OS0A 2FPFA 3CXCA 4PJOC 4A4FA 2ED1A 3M54A 3UA7A 2OTJT 1VQ4T 3OYIA 3OMGA 1TUGB 3LH0A 3PT9A 2KYMA 2RJFA 2XDDA 3X24B 2DE0X 1AZGB 1I4K1 1OV3A 3CMAT 4F7UE 4CI0C 4C92D 4LD6A 3CBMA 3JCMb 2O31A 2YDLA 2E70A 1HD3A 4QQ6A 1VQKQ 4C0FA 3PNWC 4M78E 2ENMA 1OULA 2KDSA 4IUVA 2KROA 2K57A 4N4GA 4DBHA 1TU0B 2XICA 2F69A 3VKIA 2LNHB 2LJ1A 1JEGA 1N9RA 4PJLA 2R5AA 3LWHA 4PJOD 5D6YA 1WXUA 4XK8E 5M9OA 2K5LA 4IUUA 5LJ5g 1PSFA 2DA9A 2C0IA 3RKYA 1C6VX 4Z8AA 1N8RC 3EFOB 4C5GA 3L2VA 2CYZB 2WSEE 6AT1B 2VKNA 4QVCA 1FYNA 2OJ2A 3QDRB 2F1LA 1KHIA 1TUCA 1A0NB 3I55T 4PLLA 1ZUKA 4M7DC 5GAOr 7AT1B 5CVIA 1CKBA 2RHUA 4FT2A 1S72Q 2FYKA 4R55A 4NOYA 2JMCA 3CPWA 1VQ8T 2FZKB 1ABOA 3SD4A 3PVQA 1YFNA 2QQRA 3JB9H 3FRNA 2XIDA 5D6XA 3CC2T 2BUDA 5CQXA 2CUDA 2MF2A 1M90R 2RNAA 3D7SB 1GRIA 4JJDA 4LUDA 2HAXA 4J7IA 2ZPHB 1OYXA 3EG1A 2NLUA 1T3LA 5GAMe 3REAB 5LJ3d 1KQ2A 4DBRA 1UG1A 1JRIA 1NPRA 5HK0A 2KI7A 4ZN3A 4PJOG 1PHTA 1YHQQ 4C8QD 4OF1A 2X51A 1BCOA 4TVRA 1GBRA 3HHTB 1JBMA 3SB2A 2QEXA 5CKBA 4F04B 1WQWA 4EMHA 1D09B 5GANf 2QA4T 4KGVB 4KUDK 1GBQA 5LJ5j 2XG8D 4CC4B 1KQSP 2GF7A 3I35A 1OZ2A 1ZUYA 1AT1B 4M7AE 1YCYA 2LDMA 4A54A 3RERA 1ABQA 3X26B 4PJOF 4AFQC 2AK5A 5L23A 1RAHB 2B8AA 2EVRA 3BFMA 3L2QA 2RQWA 2A0FB 3MP1A 2YLCA 1IO6A 5FWBA 1VQKA 2JTMA 1AWWA 2YSQA 4ZTFA 4F7UB 2X9HA 4CRIA 4IIMA 5J39A 1WJRA 3WVEB 3SWNA 2LX7A 1WZOA 2L3PA 2QQBA 2VVKA 4M78C 1BI0A 2COWA 3A1PA 2MAMA 2QEXT 2K2MA 1M90C 4BI4A 4E7LA 3R6OA 1K73U 2X3WD 1M27C 5FWCA 1MUZA 2JNGA 3ME9A 4PFPA 2DX1A 2MWOA 4RTTA 1QWEA 1H3ZA 3NMZC 5KYXB 4AG2C 4C8QG 2PZ1A 3FC3A 3G6EA 3VS0A 4C5IA 1M3BA 1YITQ 3CCVQ 3EG9B 4BDZA 3MO8A 2C0TA 2CDTA 3VV0A 4AG1C 1TOVA 4XTVA 3G71Q 2GFAA 3MP6A 1QVFA 4M75E 3VYGA 4N0AC 4J83A 4M7DD 3META 1BI3A 5KE3A 1D3BA 2EKHA 5KYNA 5IXBA 1VQMQ 3V7CA 2YLBA 1I0CA 5GAN2 2MPXC 2CZ7B 4FYXB 3CPWS 2CP7A 4Y92A 5A2QE 2E41A 1FXXA 3A8LB 1IHWA 4MMLA 1OPKA 1NM7A 4RKUE 2C0OA 2E6ZA 5AYFA 4AT1B 2DRKA 3T9NA 1VQMA 1VQ7T 1ZSZB 4Z02A 1RUWA 4ZGDB 1RAGB 1RI9A 3SHWA 1Q86R 1ZA1B 1PRMC 3L2UA 3M56A 3CCLT 2HD0A 3MKDA 2CT4A 5FROA 3OYDA 4C8QE 1GFDA 2CP6A 3BE3A 4B9XA 1PCXA 2JS0A 2HQXA 4E7ZA 5C0MA 2RK1A 3RNJA 2VXFA 3P8BB 4HA8A 1M3AA 2A08A 3GNFB 1D1AA 4FL6A 1Y71A 2RHXA 1K73R 1P92A 3H9NA 4PJOA 4DEYA 1Q86U 1S1NA 3C0CA 2OTJQ 1NG2A 3OB9A 3C12A 3VUBA 4E7SA 2X3XD 1N6AA 1TTHB 4J9CA 2QK0A 2QDYB 2GTOA 4C92F 3CCJT 2YRCA 5KE2A 4LE9A 1MNEA 3J7AF 2BIVA 4E7KA 3CCRA 5HKCA 1VQKT 1XQHA 2KAFA 4J6XA 2DLPA 1E6HA 5I2SA 3OBYA 5LJ3j 2X4YA 2JTEA 4XQ3A 4C92C 2EYQA 2VB6A 4L5GA 4XTXA 2VASA 5GMKj 2FVUA 4GLMA 1E7OA 2EQKA 3RBBB 1K0SA 1U1SA 1UGQB 2OAWA 3M58A 3JB9J 3VS5A 4UC4A 2EQIA 5GAN3 4Z89A 4AMCA 3CC4Q 3HSBA 2GGRA 4JS5A 2J05A 2K3XA 2G6FX 1KQ1A 2KRSA 4M7AD 2O4XA 4EIKA 1VQ5T 4PJNA 1IZ6A 5KYXA 1WJSA 4M75A 1RACB 3S3MA 4XTWA 3QWYA 2CP5A 2DEQA 4BUGA 3EGXB 3JRZA 2EQMA 2LC4A 2SRCA 2FEIA 1KQSA 2LQ8A 2J06A 1I07A 3CMEA 4J9GA 4M75B 1Q81C 3CD6T 3QXEB 4ATOA 4XTUA 3E9FA 3V8LA 3MHXA 2JMAA 4PFZA 4KGZB 1D1BA 4FYWB 4BY6C 3BDUA 3RESA 3I5RA 5J26A 4MDWA 4AFZC 4EMKC 2DM1A 1U5SA 2YUOA 3TREA 2DTHA 1GL5A 4M78F 4XU0A 1YHQT 1I5OB 3M5AA 2X4JA 1C0MA 2F5TX 4XTZA 4Y28E 3M0SA 1UHCA 2JN0A 1Z9ZA 2NWMA 3J81E 2XDBA 1SG5A 1VIFA 1NJIC 3NFCA 3AT1B 1IREB 2BE7D 4J9IA 2JW4A 3ULRB 1PNJA 2VV5A 4FSXA 1KSWA 3G1JA 2BZYA 4II1A 4F17A 2EJ9A 2KQWA 4FYVB 2DK3A 1N9SA 2WSFE 2A36A 4M77B 3S6WA 2HNIA 2QYZA 2R57A 1ZQ1A 4GBQA 3JCMX 2LMJA 3CC4A 4JDSA 1YIJA 1RAFB 3I56T 4L59A 4PJOE 2KMTA 2HKQB 2P0PA 1MV3A 4KRTA 1NPPA 2H3JA 3TCJA 2E3HA 4C5HA 1U3OA 5GAOm 1M2VB 4DA4A 1VQLA 4RTXA 2EJFA 3OMCA 5D6WA 2D0NA 1Y57A 1VQ8A 2MWPA 3VRYA 3QJYA 5C6SA 4J6YA 3QUIA 1HXDA 2EGCA 4PFOA 3TEEA 1M30A 5J3BA 1KC8R 1VQ4A 4JLIA 2HEQA 2E5QA 3CC7A 3JCMV 1H92A 2D9TA 2BZXA 4XU1A 2XKOC 3X28B 5CKHA 3OYGA 4F7UG 4IKFA 4F7UA 2DKGA 1UGVA 2M0YA 1YJNA 2J7IA 5GAMd 1Q7YC 4X9CA 2RHYA 4ZTJA 2X4WA 2GCXA 3TSWA 3M0QA 4F14A 2KSSA 1OX8A 3BDLA 4M75F 4KT0E 1VQ6Q 2QGFB 1G3TA 3MJXA 2JS2A 2VGMA 4FYYB 2EQUA 1BCMA 1N27A 2ZPEB 1VQLT 1QVGP 4IURA 1OI1A 2CZ1B 3EGDA 2ZCFB 4LDXA 2AHJB 2E3IA 2LJ3A 2EGAA 2E6NA 4XTYA 3EG9A 2LQNA 3GOXA 3OYFA 1K8AC 1SF9A 2FPDA 3OYKA 3J80E 5IHKA 2DMOA 1ZX6A 3DLMA 1CKAA 3EGDB 4VUBA 2QASA 2IG0A 2DEUA 2FG0A 1WQ7A 3REBB 3CCRQ 2HQEA 4E47A 4MZPA 2ZGWA 3EG3A 2P84A 1W70A 2JJ9A 1LPLA 2D1XA 2NUTA 1R0CB 1G8XA 1RI0A 4JZ4A 2QAZA 2OTLT 4BE2A 4LUEA 3URGA 1EX4A 2V8JA 1YJWQ 3U23A 3H0FA 1BI2A 4J9BA 4JRPA 3M0RA 3QKJA 3QG1A 2YUNA 5A0DA 4O6JA 4KULA 5GANe 4JRQA 1ZUUA 1UGRB 3TSZA 2GQIA 4KUIA 1UJ0A 3QZ9B 4HCKA 2ESWA 3EG0A 1WHMA 1UJYA 4DOWA 3JB9F 2RB6A 1QCOA 1NE8A 1T0HA 2DXTA 1KD1C 4M77G 2A37A 5KYYB 3SEMA 4HVVA 2F2XA 4PJJA 1B7TA 1YJNT 2CP3A 2E1HA 1YWPA 5LJ3h 1NLOC 2BE9B 1JJ2S 2DTOA 2P4RA 5LJ5h 1PC0A 4BDYA 2PNIA 1KK7A 2EAYA 1Q7YU 2V26A 1OQKA 1X01A 1VQ7A 1QVGA 2GQVA 2E12A 2K9GA 3C4SA 4J9HA 4RUGA 3MEUA 4BB7A 2LRQA 3O5ZA 1X43A 2XDPA 2DXBA 1JO8A 2QA4Q 3HTRA 4B9WA 2JOYA 5KYUB 4JLGA 1HJDA 2P0KA 3L2ZA 4RTUA 4M75C 4IUTA 3CCQA 2QTVA 2DXUA 1XNIA 2HKNA 3VS3A 2QGGA 1MMGA 3CCEQ 1N5ZA 2PQWA 3I9QA 1Q95G 3C95A 1TUDA 2EJGA 1YITA 1WHHA 2OTLQ 3M53A 1YJWT 2JZ2A 5IHNA 4ZGEB 4XU3A 5FW9A 2DETA 1MMDA 2VXEA 3M0PA 3CCLQ 3HP9A 1VQOQ 1WDXA 1K9MC 3NTKA 2QXFA 2ED0A 2DIQA 2HCKA 4GY5A 2DJZA 4OGEA 2YRDA 3O8VA 2DJQA 1QVFP 3HRUA 2Z0WA 3F70A 2BTTA 1BU1A 2DRMA 1EZZB 4Q5WA 4FSSA 4X9DA 1ZLMA 4ORZA 3E2UA 1WLPB 4J5YA 1BIAA 3P8DA 1MV0B 1VQ4Q 3QDFA 3G4ST 4QVZA 2ZPFB 1NBEB 1OU8A 4C8QA 3OBWA 2O9SA 2NUPB 1BYMA 2E65A 2KBTA 2OTLA 2KNBB 1G3WA 2BKDN 2Y4XA 4RCCA 4A4GA 3CD6A 1LOJA 2DERA 1VQLQ 4LNPA 2M1HA 2EBPA 3QO3A 2L3RA 3CXCS 2COZA 4EMGA 2HBPA 4OP0A 1BIBA 1ZHIA 1M4ZA 1YNZA 4OMLA 1UTIA 1KHCA 4D8KA 3OS5A 4RG8A 4IUPA 4EMKB 1QW1A 1SRMA 1YIJQ 1YHQA 2YUPA 2RO0A 3OYEA 2D8HA 2HSEB 2PVGB 3VUZA 2E4HA 4C0ZA 3JCMQ 5GAN4 4CC7A 2HL5C 1N8RU 2VUBA 4JJCA 4RMOA 1I81A 3N5BB 5GMKm 1AD5A 2KYBA 5AT1B 1ZSZA 2KT1A 4M7DE 1XTDA 4CC2A 1WHGA 1UFFA 3OA6A 1JU5C 3PIOA 4HCBA 1VQPT 3TU4K 4OMPA 2KK4A 2EPDA 5ECAA 3LLRA 4BE1A 2RQUA 2FPEA 2LP5A 3TQ7P 1M8MA 4RTWA 3EH1A 3MEVA 4LDWA 4C0DC 4QKUA 3H8ZA 1Y7XA 1K4US 3I55A 2DVJA 1T0JA 1QWFA 2FB7A 2QQSA 1VQOA 3CCLA 2OAUA 1VYVA 3JCMh 3INZA 2KT8A 1VQ9A 5GJVB 1W1FA 1W2BA 3KBGA 5GANh 1YP5A 2VC8A 3L42A 3CMET 5GAMh 2DL8A 1RABB 1B34A 1J3TA 3NGPA 3WXMB 3JB9G 4ME7A 4Z88A 1K9MU 2JM8A 1I5LA 5GAN8 3FJ5A 5LJ5f 1R0BG 3ASKA 2Y90A 2O9VA 1D0XA 1VQ5A 3JB9I 1QQJA 3PE0A 1X2QA 5GAOn 3HKSA 4PK4A 3G4SQ 2KVQG 4C0GA 1VYUA 2ATCB 1QKWA 3EGXA 1XOVA 5FU7B 1X6BA 3M0UA 1AWOA 2H8HA 1W2BS 3JCMf 1WXTA 1VQ7Q 4WCIA 2DXCA 4B6MA 1Y96A 2JT4A 8AT1B 4K11A 2DL3A 2KXCA 5IXFA 2RI3A 1K1ZA 2WACA 3LYIA 1YIJT 1QP3A 1D3BB 4C92B 3CC4T 2NUPA 3M0TA 1PD0A 3OYAA 1SSHA 1PKSA 2HMAA 2D0QB 4PJMA 4KGXB 3H0HA 1TH7A 5LJ3g 4HKEA 1M1KU 1WYXA 3A8OB 4ANJA 4C92E 3QHSA 3CCST 1KD1U 3CCJA 2L3SA 2IIMA 1VQOT 1MNDA 1SRLA 4JJBA 4ZN1A 2MMPA 2HBWA 4QQGA 2Y4YA 1WNLA 3JAME 3HRSA 2EQJA 3E9GA 3CC2A 1JQQA 2GTJA 5D7UA 4M77C 3CCVT 3FLGA 4V2SA 2M51A 2RJCA 2NUTB 1M2VA 4E2FB 1YJNQ 3QWXX 3P8HA 4J9DA 4X1VA 4XAXB 1PSEA 2ZPGB 5CK9A 4DBFA 2DL4A 3I56A 5EG2A 1TXQA 2LQWA 4WF2A 1QMCA 2K79A 3CCSA 3OYJA 2A3LA 2VYTA 2DL7A 2EW3A 3CPFA 2PUOB 1HK9A 2RA2A 3E1SA 4J9EA 4DEXA 2CUBA 4M7AB 1K9AA 2RQTA 2JTFA 3CBOA 5HCKA 1WI7A 3ZBDA 2QQAA 2AKKA 2SEMA 1Q82U 1B34B 2IPOB 3UT1A 4FIBA 2KY9A 1MGQA 2RF0A 3IQLA 3OS2A 4M75D 1M1KC 1F1BB 4J7FA 3JB9D 1QVPA 2DFUA 2LT4A 3AHUA 1UDLA 1W6XA 1U1TA 3I56Q 2O2OA 3CEYA 4KH0B 2YRVA 3MEAA 5CAIA 3BW1A 2XD0A 2J6KA 2K2VA 2QTXA 3NPFA 5GANd 1XJWB 3LW5E 4BACA 2CSQA 1H641 2LX9A 2HQHA 1ZA2B 1AHJB 1M5Q1 1NEBA 3QYHB 1QP2A 4EPCA 1EFNA 2RMOA 5FLXE 1TSFA 3G6ET 3QJ6A 3PIPA 2RHZA 3UDCA 3PFSA 4OB0B 1C1AA 3HRTA 2J6FA 1FMVA 1IRXA 2R58A 3OYYA 2RH2A 3S3OA 3RKWA 1FX7A 2K5FA 2O4XB 3EH2A 3V7SA 1EIFA 3KUFA 4FW1A 3CCJQ 1VQ9T 3JCMJ 4A53A 1U06A 1OX9A 3L2WA 2CGHA 1K76A 3OS1A 3CCQT 2GBQA 2MYSA 1VQ8Q 4MMKA 1JJ2A 1CSKA 2ZZDA 3RMQA 5FU6B 1VIEA 4FW2A 3GPLA 1RAIB 3MP8A 3UWNA 1ACMB 2D6FA 1BK2A 4DBQA 2LTOA 4HCCA 1R8OB 4OB1B 4R56A 1H8KA 3C94A 3VS7A 2R5MA 5GAOp 1SKUB 2GNCA 1H3HA 2DNUA 2A7YA 1LNXA 1YJ9A 1Y07A 3PTAA 3CCUQ 4PL6A 1YJ9Q 3VJPA 2O88A 4X34A 4QW2A 3LGFA 3EFOA 3JCMW 1VQ5Q 4OMQA 1OU9A 1UB4A 1I1JA 1I8FA 1WHLA 4M77D 4M77A 4C8QB 1FMKA 3A98A 1SSFA 3WVDB 4QQDA 4C0DB 3ZEHA 2G3RA 3A5ZB 1X69A 4BD3A 2RI5A 1DJ7B 2LCCA 3A8MB 1AZEA 4IIOA 3EHQA 1X2KA 2MCNA 3CPWP 3CD6Q 5CQYA 3MPUB 1FMWA 2RI2A 5EC7A 4LDYA 4ESRA 1M1FA 2FRWA 2K3YA 1G5VA 4A4EA 4N0AA 4HT9A 4J8OA 3I55Q 1M8VA 4PJOB 2DZ9A 2PTKA 3G7ZA 4OVAA 5GAN6 3OYCA 5FRNA 4C92G 4HVUA 3OW2S 5GMKh 1X27A 4RTVA 1WIEA 3JCMd 4FCYA 4FM4B 2E10A 1O75A 1Q82C 3HL8A 2P0QA 4Y91A 2RJEA 4OB3B 5DLQE 2W0ZA 9ATCB 3UATA 3M4YA 2FL7A 4GLKA 2DILA 1WGSA 1E6GA 4JPBW 2V8IA 1OPLA 3OSSC 5CIUA 3OYNA 1KFZA 1YI2A 4BI3A 5IAYA 1K73C 1UUEA 3TVTA 5KYUA 8ATCB 1D0ZA 4A4HA 2DYBA 1ZBJA 3PMTA 4LDUA 3CCEA 1VQNT 3OYLA 1PM3A 4M78D 5KCOA 2CZ6B 3PVLA 2HDAA 1Q82R 4DOVA 2ZPBB 1AWJA 1PRLC 3CXCP 1UGPB 2MIOA 4JRIA 4O5VA 5GAOl 1V76A 2WSCE 2KR3A 2ABLA 2NYSA 4OMMA 3Q1JA 3LX7A 5KCHA 2PU9B 2QA4A 1LCKA 5KYWB 5GAN7 2L0AA 3M4GA 1K9MR 1Q86C 3V8JA 3FIFA 2L2PA 1G3YA 2OTJA 2H3EB 2EYYA 2XI9A 2COYA 2XU8A 2KGTA 2MOXA 4HT8A 1W4SA 2ECZA 1B07A 2X4XA 2AZSA 2FO0A 2F5KA 1WXBA 3G71A 2L3QA 3CC2Q 2DF6A 2E64A 1OEBA 3SWNC 3EGUA 3VS6A 1M90U 2DD4A 4M78A 1UEBA 5DLOA 4KBMB 3JCMe 1VQPQ 1NLPC 3A8HB 5HY6A 2ROTA 2K6DA 1IGQA 4LN2A 5IHIA 3GF5A 2XK0A 3H0IA 3L1AA 1RAAB 2RHIA 2CSIA 4C8QF 1VQPA 3S3NA 2QI2A 1MHNA 2FHDA 4R0KA 2QQ9A 2OI3A 2DVEA 4MZMA 2AKLA 4PKCC 1X6GA 5GAMf 4ELZC 2EWNA 2RK2A 4PNOA 4LD9K 2JM9A 2CP2A 4E7HA 3VU3C 1VA7A 3M59A 5IH2A 2C06A 2AIRB 1VUBA 1VQMT 1RLQC 2LQKA 1YJWA 3UF4A 4JJNK 1YJ9T 4P5NA 3BY7A 4L6V5 1YN8A 1QCNA 4WTOB 3DLLA 4OMFB 3NHNA 3G4SA 3FDRA 4M7DA 2DBMA 3VRZA 2K4YA 1KQSS 2PVOB 1IGUA 4QVDA 2LCLA 1HYOA 4LDVA 3OW2A 4E7IA 1UHFA 2FZGB 4AFSC 3MCAB 2O01E 3RDVA 1G3SA 2V1RA 3V8KA 2A28A 2YXYA 3SFMA 5I21A 4QT7A 5GMKl 2QEXQ 2KRMA 5GAMj 3CCVA 1M1GA 4M77F 3EHRA 1B3QA 2DPPB 1IHVA 1SEMA 3G6EQ 1OOTA 1YI2Q 1VQ6A 3E19A 2CREA 1VOMA 3HFNA 1NJIU 4DQ2A 3VS2A 4ZNXA 2V1QA 1IXDA 2F2WA 4M4ZA 2I2LA 1Q7YR 5HK3A 2LVMA 1KIKA 1QLYA 1TWBA 3UA6A 4JS4A 3VYHB 3MEWA 1WA7A 1KD1R 1YITT 2V8KA 5A0LA 1M1KR 3CCMA 2DYIA 1SPKA 1NEGA 3H6ZA 3PGGA 3KFVA 1UGSB 2NUZA 2EIFA 1TS9A 1Z9QA 5LJ5d 3A8GB 4EDUA 1K8AR 1AWXA 2LNVA 1S72A 1PG5B 3FB9A 2DTIA 1WX6A 1W2BP 4HVWA 3M55A 1RL2A 1Y96B 4D8DA 1VYTA 4YTLA 5GMKe 1NYGA 3THKA 3OQ5A 2LCSA 4RTZA 5LL6S 5GANg 5DM7R 5LJ3e 4OGCA 1N8RR 2KXDA 1LVKA 4RG2A 3LH5A 3CMAQ 3ER0A 2RQRA 3CCUT 2CP0A 1YWOA 2FZCB 4BI8B 3UPUA 2PUKB 2ROLA 2IVWA 3JSCA 1U8RA 3HFOA 3NTHA 4C92A 3VS1A 2B86A 3NTIA 4FU6A 2YWWA 5CKFA 4M75G 5GAMg 4ELYC 3I5SA 4AFUC 3GP8A 3QPHA 5FU6C 2DO3A 4N4HA 2K3BA 2AT1B 1YCSB 5GAOq 1KC8C 4J6WA 5FU7C 1IB8A 4F7UF 2YHTA 1AOJA 3ZFJA 3GIBA 2L89A 2I0NA 1G83A 2AZVA 5GMKi 4RTYA 3CC7T 5I2MA 2JXBA 1WFWA 2KRNA 3RMSA 2D8JA 2M16A 3LWIA 1JXOA 1X75C 1M3CA 1RADB 4OMOA 3CC7Q 1V1CA 1QKXA 4JRKA 1NZ9A 3OYBA 3RKXA 1S72T 5LJ5e 3OYHA 5FRMA 1GFCA 3GBQA 1K0XA 2HZYA 5GANj 1AEYA 3JCMP 2EYZA 2CH4A 1LJOA 2W10A 1QVFS 3QYGB 4XU2A 4M7DB 2K7AA 2KE9A 3QIIA 4RCBA 4EMKA 1KJWA 2LT1A 4E6RA 2XHCA 1BBZA 2YUQA 3CCQQ 4BE0A 2QDLA 1SHFA 2M9UA 1R77A 1Q81U 1FWZA 3V7RA 2CS7A 4OB2B 4CC3A 1NJIR 4MZTA 3EG2A 5I11A 1VQNQ 2LZ6B 1VQ6T 3CCUA 2JUFA 3GLXA 2PVDB 1WJQA 5IT9E 2EFIA 4M7AF 2HSPA 5DY9A 5KH6A 3FJPA 1GXIE 1MMAA 1AVZC 2JVVA 1QCFA 1ZBXA 2RN8A 4HCZA 3VS4A 2M0OA 3H41A 4M7DF 2DBKA 3M57A 4MDXA 3JCMg 3CCRT 4M7AC 3SWNB 1PWTA 1ZSGA 2YT6A 2ZAEA 2RJDA 2FRYA 4M78G 1WHJA 3OY9A 2K5IA 4FT4A 3LGLA 3CMAA 1RAEB 3CBPA 4BY6B 4A4KA 1Q81R 1Y0MA 2VWFA 1M9SA 1PKTA 2CH4W 1YI2T 3DKMA 4LXCA 4JZ3A 2L8DA 3CCSQ 2P4TA 2X35A 5LJ3f 2RD1A 3DB3A 3KXTA 4E7JA 3RR6A
chains in the Genus database with same CATH topology
4A63B 2PTKA 2ED0A 3RNJA 2HCKA 5GJWB 4HVUA 1M3AA 2A08A 1X27A 4RTVA 2DJQA 3ZL7C 2BTTA 1BU1A 1WIEA 1G2BA 2DRMA 1RLPC 4DEYA 3R6NA 2RPNA 4FSSA 1S1NA 3C0CA 1NG2A 2CT3A 1ZLMA 2X3XD 4ORZA 4OMNA 1WLPB 2KEAA 2W0ZA 4J9CA 3UATA 2DILA 2EYXA 1E6GA 4JPBW 1MV0B 2GTOA 1JXMA 1OPLA 4LE9A 2F2VA 1KFZA 2RQVA 1GCQA 2O9SA 2DLPA 1E6HA 2KBTA 2KNBB 2JTEA 1UUEA 3TVTA 4LNPA 1GCQC 2J6OA 2DYBA 1UE9A 1ZBJA 2EBPA 4GLMA 1E7OA 3RBBB 1K0SA 3PVLA 1YNZA 4F16A 4OMLA 1UTIA 2OAWA 2HDAA 4D8KA 3VS5A 1AWJA 1PRLC 1UECA 2EQIA 2MIOA 1SRMA 2KR3A 2ABLA 4Z89A 3JV3A 4OMMA 2XMFA 2GGRA 2YUPA 2J05A 2G6FX 2KRSA 1T3SA 1LCKA 2D8HA 1BB9A 4EIKA 2L0AA 1HSQA 4CC7A 2LJ0A 3CQTA 2BZ8A 4JJCA 2L2PA 1SHGA 1ARKA 1AD5A 2KYBA 3QWYA 2KT1A 2EYYA 2SRCA 2FEIA 4CC2A 1UFFA 2J06A 1JU5C 2KGTA 1NYFA 2MOXA 2ECZA 1B07A 1I07A 2AZSA 4OMPA 2EPDA 2FO0A 4J9GA 5ECAA 1WXBA 2RQUA 2FPEA 2LP5A 1M8MA 4RTWA 2L3QA 2DF6A 2DL5A 1OEBA 2E5KA 3EGUA 3VS6A 1K4US 2DVJA 1T0JA 2JMAA 1QWFA 1NLPC 2ROTA 3I5RA 2K6DA 4LN2A 1VYVA 5IHIA 2KT8A 4AFZC 3H0IA 2DM1A 1U5SA 5GJVB 1W1FA 2YUOA 5I22A 2EYWA 4J9FA 2CSIA 1GL5A 2EGEA 1GCPA 4HXJA 1YP5A 1TG0A 2FPFA 4R0KA 2DL8A 3M0SA 1UHCA 1Z9ZA 2NWMA 2OI3A 1J3TA 3NGPA 2AKLA 2ED1A 3UA7A 1X6GA 4Z88A 2JM8A 2JM9A 2KYMA 3FJ5A 4J9IA 2JW4A 1VA7A 2DE0X 1PNJA 3ULRB 1AZGB 5IH2A 1OV3A 2O9VA 1KSWA 3PE0A 2BZYA 1RLQC 1X2QA 4F17A 3UF4A 1VYUA 2O31A 2YDLA 1QKWA 1HD3A 2A36A 1XOVA 1X6BA 1YN8A 3M0UA 4GBQA 2ENMA 3NHNA 2LMJA 1AWOA 2DBMA 2H8HA 2KROA 1WXTA 3VRZA 4WCIA 2JT4A 4K11A 2LNHB 2LJ1A 2DL3A 2KXCA 1JEGA 5IXFA 1K1ZA 1MV3A 4KRTA 1WXUA 1UHFA 4AFSC 2DA9A 2C0IA 3M0TA 1U3OA 1SSHA 4Z8AA 2V1RA 1PKSA 4RTXA 2A28A 4QT7A 3H0HA 2D0NA 2KRMA 1Y57A 1WYXA 2VKNA 3VRYA 3EHRA 1B3QA 1FYNA 1SEMA 2OJ2A 1OOTA 2L3SA 2CREA 2IIMA 1TUCA 2EGCA 3VS2A 1A0NB 4ZNXA 2V1QA 1ZUKA 2F2WA 4M4ZA 1SRLA 4JJBA 1M30A 2HBWA 1CKBA 2HEQA 1KIKA 1H92A 1QLYA 3UA6A 2BZXA 1WA7A 1JQQA 2GTJA 2JMCA 2M51A 1ABOA 3PVQA 1SPKA 1NEGA 1UGVA 2M0YA 3KFVA 2J7IA 2NUZA 3QWXX 2CUDA 1Z9QA 4J9DA 4X1VA 2RNAA 4JJDA 1GRIA 4LUDA 1AWXA 2DL4A 1WX6A 3EG1A 4HVWA 1T3LA 3REAB 1UG1A 2LQWA 3TSWA 4D8DA 3M0QA 1VYTA 4F14A 2K79A 1NYGA 1PHTA 3THKA 2LCSA 2DL7A 2EW3A 4RTZA 2JS2A 2KXDA 4J9EA 4DEXA 1GBRA 2CUBA 3LH5A 1K9AA 2RQRA 2RQTA 1YWOA 5HCKA 2ROLA 1GBQA 1WI7A 2EGAA 2LJ3A 4CC4B 3I35A 1ZUYA 2LQNA 2AKKA 2FPDA 2SEMA 3VS1A 2B86A 5IHKA 1ABQA 2DMOA 1ZX6A 1CKAA 4AFQC 2AK5A 3I5SA 5L23A 2RF0A 3IQLA 2FG0A 3REBB 4AFUC 2EVRA 3EG3A 2RQWA 1W70A 1IO6A 2D1XA 5FWBA 1AWWA 1UDLA 1W6XA 2YSQA 4JZ4A 2K3BA 2O2OA 1YCSB 4LUEA 2J6KA 3NPFA 4IIMA 2CSQA 1AOJA 3U23A 3H0FA 2I0NA 1G83A 1NEBA 2AZVA 4J9BA 3M0RA 2LX7A 2L3PA 4RTYA 1EFNA 2JXBA 1WFWA 2VVKA 2RMOA 2KRNA 2YUNA 2D8JA 1ZUUA 1JXOA 3TSZA 2GQIA 2K2MA 1M3CA 1UJ0A 2J6FA 4HCKA 2ESWA 3EG0A 4OMOA 1UJYA 1V1CA 1QKXA 1T0HA 2X3WD 1M27C 5FWCA 1MUZA 2DX1A 4RTTA 2A37A 1QWEA 1GFCA 3GBQA 3SEMA 3NMZC 1K0XA 4HVVA 4AG2C 2F2XA 2PZ1A 1U06A 3VS0A 1AEYA 1M3BA 1K76A 2EYZA 1YWPA 2GBQA 2CH4A 2W10A 1CSKA 2C0TA 2CDTA 4AG1C 2K7AA 2KE9A 1NLOC 1KJWA 4E6RA 1BBZA 2YUQA 2P4RA 2QDLA 1BK2A 1SHFA 2PNIA 2EKHA 5IXBA 1H8KA 1I0CA 3VS7A 2K9GA 4CC3A 2GNCA 4J9HA 4RUGA 3EG2A 5I11A 1H3HA 4Y92A 2DNUA 3O5ZA 2LZ6B 1X43A 1OPKA 1JO8A 1NM7A 2O88A 2HSPA 2C0OA 1AVZC 1QCFA 4OMQA 1HJDA 4RTUA 2DRKA 2RN8A 3VS4A 1I1JA 3H41A 2DBKA 1FMKA 3A98A 1RUWA 1PWTA 3VS3A 1ZSGA 1RI9A 2YT6A 3SHWA 1N5ZA 2FRYA 1PRMC 1X69A 3I9QA 1AZEA 4IIOA 3EHQA 1X2KA 2MCNA 2CT4A 1Y0MA 2VWFA 1TUDA 1PKTA 2CH4W 1GFDA 5EC7A 5IHNA 4JZ3A 4ESRA 5FW9A 2JS0A 2FRWA 3M0PA 1WDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A63 B;  2PTK A;  2ED0 A;  3RNJ A;  2HCK A;  5GJW B;  4HVU A;  1M3A A;  2A08 A;  1X27 A;  4RTV A;  2DJQ A;  3ZL7 C;  2BTT A;  1BU1 A;  1WIE A;  1G2B A;  2DRM A;  1RLP C;  4DEY A;  3R6N A;  2RPN A;  4FSS A;  1S1N A;  3C0C A;  1NG2 A;  2CT3 A;  1ZLM A;  2X3X D;  4ORZ A;  4OMN A;  1WLP B;  2KEA A;  2W0Z A;  4J9C A;  3UAT A;  2DIL A;  2EYX A;  1E6G A;  4JPB W;  1MV0 B;  2GTO A;  1JXM A;  1OPL A;  4LE9 A;  2F2V A;  1KFZ A;  2RQV A;  1GCQ A;  2O9S A;  2DLP A;  1E6H A;  2KBT A;  2KNB B;  2JTE A;  1UUE A;  3TVT A;  4LNP A;  1GCQ C;  2J6O A;  2DYB A;  1UE9 A;  1ZBJ A;  2EBP A;  4GLM A;  1E7O A;  3RBB B;  1K0S A;  3PVL A;  1YNZ A;  4F16 A;  4OML A;  1UTI A;  2OAW A;  2HDA A;  4D8K A;  3VS5 A;  1AWJ A;  1PRL C;  1UEC A;  2EQI A;  2MIO A;  1SRM A;  2KR3 A;  2ABL A;  4Z89 A;  3JV3 A;  4OMM A;  2XMF A;  2GGR A;  2YUP A;  2J05 A;  2G6F X;  2KRS A;  1T3S A;  1LCK A;  2D8H A;  1BB9 A;  4EIK A;  2L0A A;  1HSQ A;  4CC7 A;  2LJ0 A;  3CQT A;  2BZ8 A;  4JJC A;  2L2P A;  1SHG A;  1ARK A;  1AD5 A;  2KYB A;  3QWY A;  2KT1 A;  2EYY A;  2SRC A;  2FEI A;  4CC2 A;  1UFF A;  2J06 A;  1JU5 C;  2KGT A;  1NYF A;  2MOX A;  2ECZ A;  1B07 A;  1I07 A;  2AZS A;  4OMP A;  2EPD A;  2FO0 A;  4J9G A;  5ECA A;  1WXB A;  2RQU A;  2FPE A;  2LP5 A;  1M8M A;  4RTW A;  2L3Q A;  2DF6 A;  2DL5 A;  1OEB A;  2E5K A;  3EGU A;  3VS6 A;  1K4U S;  2DVJ A;  1T0J A;  2JMA A;  1QWF A;  1NLP C;  2ROT A;  3I5R A;  2K6D A;  4LN2 A;  1VYV A;  5IHI A;  2KT8 A;  4AFZ C;  3H0I A;  2DM1 A;  1U5S A;  5GJV B;  1W1F A;  2YUO A;  5I22 A;  2EYW A;  4J9F A;  2CSI A;  1GL5 A;  2EGE A;  1GCP A;  4HXJ A;  1YP5 A;  1TG0 A;  2FPF A;  4R0K A;  2DL8 A;  3M0S A;  1UHC A;  1Z9Z A;  2NWM A;  2OI3 A;  1J3T A;  3NGP A;  2AKL A;  2ED1 A;  3UA7 A;  1X6G A;  4Z88 A;  2JM8 A;  2JM9 A;  2KYM A;  3FJ5 A;  4J9I A;  2JW4 A;  1VA7 A;  2DE0 X;  1PNJ A;  3ULR B;  1AZG B;  5IH2 A;  1OV3 A;  2O9V A;  1KSW A;  3PE0 A;  2BZY A;  1RLQ C;  1X2Q A;  4F17 A;  3UF4 A;  1VYU A;  2O31 A;  2YDL A;  1QKW A;  1HD3 A;  2A36 A;  1XOV A;  1X6B A;  1YN8 A;  3M0U A;  4GBQ A;  2ENM A;  3NHN A;  2LMJ A;  1AWO A;  2DBM A;  2H8H A;  2KRO A;  1WXT A;  3VRZ A;  4WCI A;  2JT4 A;  4K11 A;  2LNH B;  2LJ1 A;  2DL3 A;  2KXC A;  1JEG A;  5IXF A;  1K1Z A;  1MV3 A;  4KRT A;  1WXU A;  1UHF A;  4AFS C;  2DA9 A;  2C0I A;  3M0T A;  1U3O A;  1SSH A;  4Z8A A;  2V1R A;  1PKS A;  4RTX A;  2A28 A;  4QT7 A;  3H0H A;  2D0N A;  2KRM A;  1Y57 A;  1WYX A;  2VKN A;  3VRY A;  3EHR A;  1B3Q A;  1FYN A;  1SEM A;  2OJ2 A;  1OOT A;  2L3S A;  2CRE A;  2IIM A;  1TUC A;  2EGC A;  3VS2 A;  1A0N B;  4ZNX A;  2V1Q A;  1ZUK A;  2F2W A;  4M4Z A;  1SRL A;  4JJB A;  1M30 A;  2HBW A;  1CKB A;  2HEQ A;  1KIK A;  1H92 A;  1QLY A;  3UA6 A;  2BZX A;  1WA7 A;  1JQQ A;  2GTJ A;  2JMC A;  2M51 A;  1ABO A;  3PVQ A;  1SPK A;  1NEG A;  1UGV A;  2M0Y A;  3KFV A;  2J7I A;  2NUZ A;  3QWX X;  2CUD A;  1Z9Q A;  4J9D A;  4X1V A;  2RNA A;  4JJD A;  1GRI A;  4LUD A;  1AWX A;  2DL4 A;  1WX6 A;  3EG1 A;  4HVW A;  1T3L A;  3REA B;  1UG1 A;  2LQW A;  3TSW A;  4D8D A;  3M0Q A;  1VYT A;  4F14 A;  2K79 A;  1NYG A;  1PHT A;  3THK A;  2LCS A;  2DL7 A;  2EW3 A;  4RTZ A;  2JS2 A;  2KXD A;  4J9E A;  4DEX A;  1GBR A;  2CUB A;  3LH5 A;  1K9A A;  2RQR A;  2RQT A;  1YWO A;  5HCK A;  2ROL A;  1GBQ A;  1WI7 A;  2EGA A;  2LJ3 A;  4CC4 B;  3I35 A;  1ZUY A;  2LQN A;  2AKK A;  2FPD A;  2SEM A;  3VS1 A;  2B86 A;  5IHK A;  1ABQ A;  2DMO A;  1ZX6 A;  1CKA A;  4AFQ C;  2AK5 A;  3I5S A;  5L23 A;  2RF0 A;  3IQL A;  2FG0 A;  3REB B;  4AFU C;  2EVR A;  3EG3 A;  2RQW A;  1W70 A;  1IO6 A;  2D1X A;  5FWB A;  1AWW A;  1UDL A;  1W6X A;  2YSQ A;  4JZ4 A;  2K3B A;  2O2O A;  1YCS B;  4LUE A;  2J6K A;  3NPF A;  4IIM A;  2CSQ A;  1AOJ A;  3U23 A;  3H0F A;  2I0N A;  1G83 A;  1NEB A;  2AZV A;  4J9B A;  3M0R A;  2LX7 A;  2L3P A;  4RTY A;  1EFN A;  2JXB A;  1WFW A;  2VVK A;  2RMO A;  2KRN A;  2YUN A;  2D8J A;  1ZUU A;  1JXO A;  3TSZ A;  2GQI A;  2K2M A;  1M3C A;  1UJ0 A;  2J6F A;  4HCK A;  2ESW A;  3EG0 A;  4OMO A;  1UJY A;  1V1C A;  1QKX A;  1T0H A;  2X3W D;  1M27 C;  5FWC A;  1MUZ A;  2DX1 A;  4RTT A;  2A37 A;  1QWE A;  1GFC A;  3GBQ A;  3SEM A;  3NMZ C;  1K0X A;  4HVV A;  4AG2 C;  2F2X A;  2PZ1 A;  1U06 A;  3VS0 A;  1AEY A;  1M3B A;  1K76 A;  2EYZ A;  1YWP A;  2GBQ A;  2CH4 A;  2W10 A;  1CSK A;  2C0T A;  2CDT A;  4AG1 C;  2K7A A;  2KE9 A;  1NLO C;  1KJW A;  4E6R A;  1BBZ A;  2YUQ A;  2P4R A;  2QDL A;  1BK2 A;  1SHF A;  2PNI A;  2EKH A;  5IXB A;  1H8K A;  1I0C A;  3VS7 A;  2K9G A;  4CC3 A;  2GNC A;  4J9H A;  4RUG A;  3EG2 A;  5I11 A;  1H3H A;  4Y92 A;  2DNU A;  3O5Z A;  2LZ6 B;  1X43 A;  1OPK A;  1JO8 A;  1NM7 A;  2O88 A;  2HSP A;  2C0O A;  1AVZ C;  1QCF A;  4OMQ A;  1HJD A;  4RTU A;  2DRK A;  2RN8 A;  3VS4 A;  1I1J A;  3H41 A;  2DBK A;  1FMK A;  3A98 A;  1RUW A;  1PWT A;  3VS3 A;  1ZSG A;  1RI9 A;  2YT6 A;  3SHW A;  1N5Z A;  2FRY A;  1PRM C;  1X69 A;  3I9Q A;  1AZE A;  4IIO A;  3EHQ A;  1X2K A;  2MCN A;  2CT4 A;  1Y0M A;  2VWF A;  1TUD A;  1PKT A;  2CH4 W;  1GFD A;  5EC7 A;  5IHN A;  4JZ3 A;  4ESR A;  5FW9 A;  2JS0 A;  2FRW A;  3M0P A;  1WDX A; 
#chains in the Genus database with same CATH topology
 2DIG A;  3GNG A;  4A63 B;  3EFR A;  2DD5 A;  3QZ5 B;  5GJW B;  5CKE A;  3CME Q;  4NS5 A;  3JCM c;  3X25 B;  1YBY A;  3ZL7 C;  1D0Y A;  2RM4 A;  3QBY A;  3HPW A;  1G2B A;  1RLP C;  3CCM Q;  3R6N A;  3OW2 P;  2RPN A;  4M78 B;  1JJ2 P;  2CT3 A;  2HL3 A;  3RUX A;  3FEO A;  5IN1 A;  2ZPI B;  1ZSZ C;  4OMN A;  4NL3 A;  2DZC A;  2KEA A;  1D1C A;  2OX7 A;  2EKO A;  3EAE A;  2EYX A;  1JXM A;  2F2V A;  2DAQ A;  2GFU A;  2RQV A;  1OZ3 A;  1BKB A;  1GCQ A;  4M77 E;  5CKD A;  3PMI A;  3G71 T;  3OYM A;  1GCQ C;  2J6O A;  1WHK A;  1UE9 A;  1X6O A;  4JUV A;  2L5Q A;  4N4I A;  4F16 A;  3SDZ A;  1UEC A;  5CO7 A;  3JV3 A;  4M7D G;  2XMF A;  2CKK A;  4C5E A;  5A0G A;  5CR2 A;  1T3S A;  4PLI A;  1BB9 A;  3X20 B;  1HSQ A;  4M7A G;  3DB4 A;  3CCE T;  1BI1 A;  1VQN A;  2LJ0 A;  3CQT A;  1JB0 E;  2BZ8 A;  3L2R A;  3OSV A;  3M9Q A;  1SHG A;  1ARK A;  5CCA A;  1WPY A;  1KG1 A;  2MI6 A;  1O9S A;  5GAN 5;  1NYF A;  2QG9 B;  2M02 A;  5KYY A;  4IUQ A;  3RIR A;  4KH1 B;  2CZ0 B;  5L8R E;  1K8A U;  4C8Q C;  2DL5 A;  4NL2 A;  2E5K A;  3EFS A;  5KYW A;  1M2O A;  1PD1 A;  4D6W A;  1MMN A;  1QVG S;  1V29 B;  1VQ9 Q;  4M7A A;  2VGN A;  5I22 A;  2EYW A;  2MK5 A;  4J9F A;  4ZGJ B;  2EGE A;  3CCM T;  1GCP A;  4HXJ A;  1KC8 U;  3QSU A;  1TG0 A;  3OS0 A;  2FPF A;  3CXC A;  4PJO C;  4A4F A;  2ED1 A;  3M54 A;  3UA7 A;  2OTJ T;  1VQ4 T;  3OYI A;  3OMG A;  1TUG B;  3LH0 A;  3PT9 A;  2KYM A;  2RJF A;  2XDD A;  3X24 B;  2DE0 X;  1AZG B;  1I4K 1;  1OV3 A;  3CMA T;  4F7U E;  4CI0 C;  4C92 D;  4LD6 A;  3CBM A;  3JCM b;  2O31 A;  2YDL A;  2E70 A;  1HD3 A;  4QQ6 A;  1VQK Q;  4C0F A;  3PNW C;  4M78 E;  2ENM A;  1OUL A;  2KDS A;  4IUV A;  2KRO A;  2K57 A;  4N4G A;  4DBH A;  1TU0 B;  2XIC A;  2F69 A;  3VKI A;  2LNH B;  2LJ1 A;  1JEG A;  1N9R A;  4PJL A;  2R5A A;  3LWH A;  4PJO D;  5D6Y A;  1WXU A;  4XK8 E;  5M9O A;  2K5L A;  4IUU A;  5LJ5 g;  1PSF A;  2DA9 A;  2C0I A;  3RKY A;  1C6V X;  4Z8A A;  1N8R C;  3EFO B;  4C5G A;  3L2V A;  2CYZ B;  2WSE E;  6AT1 B;  2VKN A;  4QVC A;  1FYN A;  2OJ2 A;  3QDR B;  2F1L A;  1KHI A;  1TUC A;  1A0N B;  3I55 T;  4PLL A;  1ZUK A;  4M7D C;  5GAO r;  7AT1 B;  5CVI A;  1CKB A;  2RHU A;  4FT2 A;  1S72 Q;  2FYK A;  4R55 A;  4NOY A;  2JMC A;  3CPW A;  1VQ8 T;  2FZK B;  1ABO A;  3SD4 A;  3PVQ A;  1YFN A;  2QQR A;  3JB9 H;  3FRN A;  2XID A;  5D6X A;  3CC2 T;  2BUD A;  5CQX A;  2CUD A;  2MF2 A;  1M90 R;  2RNA A;  3D7S B;  1GRI A;  4JJD A;  4LUD A;  2HAX A;  4J7I A;  2ZPH B;  1OYX A;  3EG1 A;  2NLU A;  1T3L A;  5GAM e;  3REA B;  5LJ3 d;  1KQ2 A;  4DBR A;  1UG1 A;  1JRI A;  1NPR A;  5HK0 A;  2KI7 A;  4ZN3 A;  4PJO G;  1PHT A;  1YHQ Q;  4C8Q D;  4OF1 A;  2X51 A;  1BCO A;  4TVR A;  1GBR A;  3HHT B;  1JBM A;  3SB2 A;  2QEX A;  5CKB A;  4F04 B;  1WQW A;  4EMH A;  1D09 B;  5GAN f;  2QA4 T;  4KGV B;  4KUD K;  1GBQ A;  5LJ5 j;  2XG8 D;  4CC4 B;  1KQS P;  2GF7 A;  3I35 A;  1OZ2 A;  1ZUY A;  1AT1 B;  4M7A E;  1YCY A;  2LDM A;  4A54 A;  3RER A;  1ABQ A;  3X26 B;  4PJO F;  4AFQ C;  2AK5 A;  5L23 A;  1RAH B;  2B8A A;  2EVR A;  3BFM A;  3L2Q A;  2RQW A;  2A0F B;  3MP1 A;  2YLC A;  1IO6 A;  5FWB A;  1VQK A;  2JTM A;  1AWW A;  2YSQ A;  4ZTF A;  4F7U B;  2X9H A;  4CRI A;  4IIM A;  5J39 A;  1WJR A;  3WVE B;  3SWN A;  2LX7 A;  1WZO A;  2L3P A;  2QQB A;  2VVK A;  4M78 C;  1BI0 A;  2COW A;  3A1P A;  2MAM A;  2QEX T;  2K2M A;  1M90 C;  4BI4 A;  4E7L A;  3R6O A;  1K73 U;  2X3W D;  1M27 C;  5FWC A;  1MUZ A;  2JNG A;  3ME9 A;  4PFP A;  2DX1 A;  2MWO A;  4RTT A;  1QWE A;  1H3Z A;  3NMZ C;  5KYX B;  4AG2 C;  4C8Q G;  2PZ1 A;  3FC3 A;  3G6E A;  3VS0 A;  4C5I A;  1M3B A;  1YIT Q;  3CCV Q;  3EG9 B;  4BDZ A;  3MO8 A;  2C0T A;  2CDT A;  3VV0 A;  4AG1 C;  1TOV A;  4XTV A;  3G71 Q;  2GFA A;  3MP6 A;  1QVF A;  4M75 E;  3VYG A;  4N0A C;  4J83 A;  4M7D D;  3MET A;  1BI3 A;  5KE3 A;  1D3B A;  2EKH A;  5KYN A;  5IXB A;  1VQM Q;  3V7C A;  2YLB A;  1I0C A;  5GAN 2;  2MPX C;  2CZ7 B;  4FYX B;  3CPW S;  2CP7 A;  4Y92 A;  5A2Q E;  2E41 A;  1FXX A;  3A8L B;  1IHW A;  4MML A;  1OPK A;  1NM7 A;  4RKU E;  2C0O A;  2E6Z A;  5AYF A;  4AT1 B;  2DRK A;  3T9N A;  1VQM A;  1VQ7 T;  1ZSZ B;  4Z02 A;  1RUW A;  4ZGD B;  1RAG B;  1RI9 A;  3SHW A;  1Q86 R;  1ZA1 B;  1PRM C;  3L2U A;  3M56 A;  3CCL T;  2HD0 A;  3MKD A;  2CT4 A;  5FRO A;  3OYD A;  4C8Q E;  1GFD A;  2CP6 A;  3BE3 A;  4B9X A;  1PCX A;  2JS0 A;  2HQX A;  4E7Z A;  5C0M A;  2RK1 A;  3RNJ A;  2VXF A;  3P8B B;  4HA8 A;  1M3A A;  2A08 A;  3GNF B;  1D1A A;  4FL6 A;  1Y71 A;  2RHX A;  1K73 R;  1P92 A;  3H9N A;  4PJO A;  4DEY A;  1Q86 U;  1S1N A;  3C0C A;  2OTJ Q;  1NG2 A;  3OB9 A;  3C12 A;  3VUB A;  4E7S A;  2X3X D;  1N6A A;  1TTH B;  4J9C A;  2QK0 A;  2QDY B;  2GTO A;  4C92 F;  3CCJ T;  2YRC A;  5KE2 A;  4LE9 A;  1MNE A;  3J7A F;  2BIV A;  4E7K A;  3CCR A;  5HKC A;  1VQK T;  1XQH A;  2KAF A;  4J6X A;  2DLP A;  1E6H A;  5I2S A;  3OBY A;  5LJ3 j;  2X4Y A;  2JTE A;  4XQ3 A;  4C92 C;  2EYQ A;  2VB6 A;  4L5G A;  4XTX A;  2VAS A;  5GMK j;  2FVU A;  4GLM A;  1E7O A;  2EQK A;  3RBB B;  1K0S A;  1U1S A;  1UGQ B;  2OAW A;  3M58 A;  3JB9 J;  3VS5 A;  4UC4 A;  2EQI A;  5GAN 3;  4Z89 A;  4AMC A;  3CC4 Q;  3HSB A;  2GGR A;  4JS5 A;  2J05 A;  2K3X A;  2G6F X;  1KQ1 A;  2KRS A;  4M7A D;  2O4X A;  4EIK A;  1VQ5 T;  4PJN A;  1IZ6 A;  5KYX A;  1WJS A;  4M75 A;  1RAC B;  3S3M A;  4XTW A;  3QWY A;  2CP5 A;  2DEQ A;  4BUG A;  3EGX B;  3JRZ A;  2EQM A;  2LC4 A;  2SRC A;  2FEI A;  1KQS A;  2LQ8 A;  2J06 A;  1I07 A;  3CME A;  4J9G A;  4M75 B;  1Q81 C;  3CD6 T;  3QXE B;  4ATO A;  4XTU A;  3E9F A;  3V8L A;  3MHX A;  2JMA A;  4PFZ A;  4KGZ B;  1D1B A;  4FYW B;  4BY6 C;  3BDU A;  3RES A;  3I5R A;  5J26 A;  4MDW A;  4AFZ C;  4EMK C;  2DM1 A;  1U5S A;  2YUO A;  3TRE A;  2DTH A;  1GL5 A;  4M78 F;  4XU0 A;  1YHQ T;  1I5O B;  3M5A A;  2X4J A;  1C0M A;  2F5T X;  4XTZ A;  4Y28 E;  3M0S A;  1UHC A;  2JN0 A;  1Z9Z A;  2NWM A;  3J81 E;  2XDB A;  1SG5 A;  1VIF A;  1NJI C;  3NFC A;  3AT1 B;  1IRE B;  2BE7 D;  4J9I A;  2JW4 A;  3ULR B;  1PNJ A;  2VV5 A;  4FSX A;  1KSW A;  3G1J A;  2BZY A;  4II1 A;  4F17 A;  2EJ9 A;  2KQW A;  4FYV B;  2DK3 A;  1N9S A;  2WSF E;  2A36 A;  4M77 B;  3S6W A;  2HNI A;  2QYZ A;  2R57 A;  1ZQ1 A;  4GBQ A;  3JCM X;  2LMJ A;  3CC4 A;  4JDS A;  1YIJ A;  1RAF B;  3I56 T;  4L59 A;  4PJO E;  2KMT A;  2HKQ B;  2P0P A;  1MV3 A;  4KRT A;  1NPP A;  2H3J A;  3TCJ A;  2E3H A;  4C5H A;  1U3O A;  5GAO m;  1M2V B;  4DA4 A;  1VQL A;  4RTX A;  2EJF A;  3OMC A;  5D6W A;  2D0N A;  1Y57 A;  1VQ8 A;  2MWP A;  3VRY A;  3QJY A;  5C6S A;  4J6Y A;  3QUI A;  1HXD A;  2EGC A;  4PFO A;  3TEE A;  1M30 A;  5J3B A;  1KC8 R;  1VQ4 A;  4JLI A;  2HEQ A;  2E5Q A;  3CC7 A;  3JCM V;  1H92 A;  2D9T A;  2BZX A;  4XU1 A;  2XKO C;  3X28 B;  5CKH A;  3OYG A;  4F7U G;  4IKF A;  4F7U A;  2DKG A;  1UGV A;  2M0Y A;  1YJN A;  2J7I A;  5GAM d;  1Q7Y C;  4X9C A;  2RHY A;  4ZTJ A;  2X4W A;  2GCX A;  3TSW A;  3M0Q A;  4F14 A;  2KSS A;  1OX8 A;  3BDL A;  4M75 F;  4KT0 E;  1VQ6 Q;  2QGF B;  1G3T A;  3MJX A;  2JS2 A;  2VGM A;  4FYY B;  2EQU A;  1BCM A;  1N27 A;  2ZPE B;  1VQL T;  1QVG P;  4IUR A;  1OI1 A;  2CZ1 B;  3EGD A;  2ZCF B;  4LDX A;  2AHJ B;  2E3I A;  2LJ3 A;  2EGA A;  2E6N A;  4XTY A;  3EG9 A;  2LQN A;  3GOX A;  3OYF A;  1K8A C;  1SF9 A;  2FPD A;  3OYK A;  3J80 E;  5IHK A;  2DMO A;  1ZX6 A;  3DLM A;  1CKA A;  3EGD B;  4VUB A;  2QAS A;  2IG0 A;  2DEU A;  2FG0 A;  1WQ7 A;  3REB B;  3CCR Q;  2HQE A;  4E47 A;  4MZP A;  2ZGW A;  3EG3 A;  2P84 A;  1W70 A;  2JJ9 A;  1LPL A;  2D1X A;  2NUT A;  1R0C B;  1G8X A;  1RI0 A;  4JZ4 A;  2QAZ A;  2OTL T;  4BE2 A;  4LUE A;  3URG A;  1EX4 A;  2V8J A;  1YJW Q;  3U23 A;  3H0F A;  1BI2 A;  4J9B A;  4JRP A;  3M0R A;  3QKJ A;  3QG1 A;  2YUN A;  5A0D A;  4O6J A;  4KUL A;  5GAN e;  4JRQ A;  1ZUU A;  1UGR B;  3TSZ A;  2GQI A;  4KUI A;  1UJ0 A;  3QZ9 B;  4HCK A;  2ESW A;  3EG0 A;  1WHM A;  1UJY A;  4DOW A;  3JB9 F;  2RB6 A;  1QCO A;  1NE8 A;  1T0H A;  2DXT A;  1KD1 C;  4M77 G;  2A37 A;  5KYY B;  3SEM A;  4HVV A;  2F2X A;  4PJJ A;  1B7T A;  1YJN T;  2CP3 A;  2E1H A;  1YWP A;  5LJ3 h;  1NLO C;  2BE9 B;  1JJ2 S;  2DTO A;  2P4R A;  5LJ5 h;  1PC0 A;  4BDY A;  2PNI A;  1KK7 A;  2EAY A;  1Q7Y U;  2V26 A;  1OQK A;  1X01 A;  1VQ7 A;  1QVG A;  2GQV A;  2E12 A;  2K9G A;  3C4S A;  4J9H A;  4RUG A;  3MEU A;  4BB7 A;  2LRQ A;  3O5Z A;  1X43 A;  2XDP A;  2DXB A;  1JO8 A;  2QA4 Q;  3HTR A;  4B9W A;  2JOY A;  5KYU B;  4JLG A;  1HJD A;  2P0K A;  3L2Z A;  4RTU A;  4M75 C;  4IUT A;  3CCQ A;  2QTV A;  2DXU A;  1XNI A;  2HKN A;  3VS3 A;  2QGG A;  1MMG A;  3CCE Q;  1N5Z A;  2PQW A;  3I9Q A;  1Q95 G;  3C95 A;  1TUD A;  2EJG A;  1YIT A;  1WHH A;  2OTL Q;  3M53 A;  1YJW T;  2JZ2 A;  5IHN A;  4ZGE B;  4XU3 A;  5FW9 A;  2DET A;  1MMD A;  2VXE A;  3M0P A;  3CCL Q;  3HP9 A;  1VQO Q;  1WDX A;  1K9M C;  3NTK A;  2QXF A;  2ED0 A;  2DIQ A;  2HCK A;  4GY5 A;  2DJZ A;  4OGE A;  2YRD A;  3O8V A;  2DJQ A;  1QVF P;  3HRU A;  2Z0W A;  3F70 A;  2BTT A;  1BU1 A;  2DRM A;  1EZZ B;  4Q5W A;  4FSS A;  4X9D A;  1ZLM A;  4ORZ A;  3E2U A;  1WLP B;  4J5Y A;  1BIA A;  3P8D A;  1MV0 B;  1VQ4 Q;  3QDF A;  3G4S T;  4QVZ A;  2ZPF B;  1NBE B;  1OU8 A;  4C8Q A;  3OBW A;  2O9S A;  2NUP B;  1BYM A;  2E65 A;  2KBT A;  2OTL A;  2KNB B;  1G3W A;  2BKD N;  2Y4X A;  4RCC A;  4A4G A;  3CD6 A;  1LOJ A;  2DER A;  1VQL Q;  4LNP A;  2M1H A;  2EBP A;  3QO3 A;  2L3R A;  3CXC S;  2COZ A;  4EMG A;  2HBP A;  4OP0 A;  1BIB A;  1ZHI A;  1M4Z A;  1YNZ A;  4OML A;  1UTI A;  1KHC A;  4D8K A;  3OS5 A;  4RG8 A;  4IUP A;  4EMK B;  1QW1 A;  1SRM A;  1YIJ Q;  1YHQ A;  2YUP A;  2RO0 A;  3OYE A;  2D8H A;  2HSE B;  2PVG B;  3VUZ A;  2E4H A;  4C0Z A;  3JCM Q;  5GAN 4;  4CC7 A;  2HL5 C;  1N8R U;  2VUB A;  4JJC A;  4RMO A;  1I81 A;  3N5B B;  5GMK m;  1AD5 A;  2KYB A;  5AT1 B;  1ZSZ A;  2KT1 A;  4M7D E;  1XTD A;  4CC2 A;  1WHG A;  1UFF A;  3OA6 A;  1JU5 C;  3PIO A;  4HCB A;  1VQP T;  3TU4 K;  4OMP A;  2KK4 A;  2EPD A;  5ECA A;  3LLR A;  4BE1 A;  2RQU A;  2FPE A;  2LP5 A;  3TQ7 P;  1M8M A;  4RTW A;  3EH1 A;  3MEV A;  4LDW A;  4C0D C;  4QKU A;  3H8Z A;  1Y7X A;  1K4U S;  3I55 A;  2DVJ A;  1T0J A;  1QWF A;  2FB7 A;  2QQS A;  1VQO A;  3CCL A;  2OAU A;  1VYV A;  3JCM h;  3INZ A;  2KT8 A;  1VQ9 A;  5GJV B;  1W1F A;  1W2B A;  3KBG A;  5GAN h;  1YP5 A;  2VC8 A;  3L42 A;  3CME T;  5GAM h;  2DL8 A;  1RAB B;  1B34 A;  1J3T A;  3NGP A;  3WXM B;  3JB9 G;  4ME7 A;  4Z88 A;  1K9M U;  2JM8 A;  1I5L A;  5GAN 8;  3FJ5 A;  5LJ5 f;  1R0B G;  3ASK A;  2Y90 A;  2O9V A;  1D0X A;  1VQ5 A;  3JB9 I;  1QQJ A;  3PE0 A;  1X2Q A;  5GAO n;  3HKS A;  4PK4 A;  3G4S Q;  2KVQ G;  4C0G A;  1VYU A;  2ATC B;  1QKW A;  3EGX A;  1XOV A;  5FU7 B;  1X6B A;  3M0U A;  1AWO A;  2H8H A;  1W2B S;  3JCM f;  1WXT A;  1VQ7 Q;  4WCI A;  2DXC A;  4B6M A;  1Y96 A;  2JT4 A;  8AT1 B;  4K11 A;  2DL3 A;  2KXC A;  5IXF A;  2RI3 A;  1K1Z A;  2WAC A;  3LYI A;  1YIJ T;  1QP3 A;  1D3B B;  4C92 B;  3CC4 T;  2NUP A;  3M0T A;  1PD0 A;  3OYA A;  1SSH A;  1PKS A;  2HMA A;  2D0Q B;  4PJM A;  4KGX B;  3H0H A;  1TH7 A;  5LJ3 g;  4HKE A;  1M1K U;  1WYX A;  3A8O B;  4ANJ A;  4C92 E;  3QHS A;  3CCS T;  1KD1 U;  3CCJ A;  2L3S A;  2IIM A;  1VQO T;  1MND A;  1SRL A;  4JJB A;  4ZN1 A;  2MMP A;  2HBW A;  4QQG A;  2Y4Y A;  1WNL A;  3JAM E;  3HRS A;  2EQJ A;  3E9G A;  3CC2 A;  1JQQ A;  2GTJ A;  5D7U A;  4M77 C;  3CCV T;  3FLG A;  4V2S A;  2M51 A;  2RJC A;  2NUT B;  1M2V A;  4E2F B;  1YJN Q;  3QWX X;  3P8H A;  4J9D A;  4X1V A;  4XAX B;  1PSE A;  2ZPG B;  5CK9 A;  4DBF A;  2DL4 A;  3I56 A;  5EG2 A;  1TXQ A;  2LQW A;  4WF2 A;  1QMC A;  2K79 A;  3CCS A;  3OYJ A;  2A3L A;  2VYT A;  2DL7 A;  2EW3 A;  3CPF A;  2PUO B;  1HK9 A;  2RA2 A;  3E1S A;  4J9E A;  4DEX A;  2CUB A;  4M7A B;  1K9A A;  2RQT A;  2JTF A;  3CBO A;  5HCK A;  1WI7 A;  3ZBD A;  2QQA A;  2AKK A;  2SEM A;  1Q82 U;  1B34 B;  2IPO B;  3UT1 A;  4FIB A;  2KY9 A;  1MGQ A;  2RF0 A;  3IQL A;  3OS2 A;  4M75 D;  1M1K C;  1F1B B;  4J7F A;  3JB9 D;  1QVP A;  2DFU A;  2LT4 A;  3AHU A;  1UDL A;  1W6X A;  1U1T A;  3I56 Q;  2O2O A;  3CEY A;  4KH0 B;  2YRV A;  3MEA A;  5CAI A;  3BW1 A;  2XD0 A;  2J6K A;  2K2V A;  2QTX A;  3NPF A;  5GAN d;  1XJW B;  3LW5 E;  4BAC A;  2CSQ A;  1H64 1;  2LX9 A;  2HQH A;  1ZA2 B;  1AHJ B;  1M5Q 1;  1NEB A;  3QYH B;  1QP2 A;  4EPC A;  1EFN A;  2RMO A;  5FLX E;  1TSF A;  3G6E T;  3QJ6 A;  3PIP A;  2RHZ A;  3UDC A;  3PFS A;  4OB0 B;  1C1A A;  3HRT A;  2J6F A;  1FMV A;  1IRX A;  2R58 A;  3OYY A;  2RH2 A;  3S3O A;  3RKW A;  1FX7 A;  2K5F A;  2O4X B;  3EH2 A;  3V7S A;  1EIF A;  3KUF A;  4FW1 A;  3CCJ Q;  1VQ9 T;  3JCM J;  4A53 A;  1U06 A;  1OX9 A;  3L2W A;  2CGH A;  1K76 A;  3OS1 A;  3CCQ T;  2GBQ A;  2MYS A;  1VQ8 Q;  4MMK A;  1JJ2 A;  1CSK A;  2ZZD A;  3RMQ A;  5FU6 B;  1VIE A;  4FW2 A;  3GPL A;  1RAI B;  3MP8 A;  3UWN A;  1ACM B;  2D6F A;  1BK2 A;  4DBQ A;  2LTO A;  4HCC A;  1R8O B;  4OB1 B;  4R56 A;  1H8K A;  3C94 A;  3VS7 A;  2R5M A;  5GAO p;  1SKU B;  2GNC A;  1H3H A;  2DNU A;  2A7Y A;  1LNX A;  1YJ9 A;  1Y07 A;  3PTA A;  3CCU Q;  4PL6 A;  1YJ9 Q;  3VJP A;  2O88 A;  4X34 A;  4QW2 A;  3LGF A;  3EFO A;  3JCM W;  1VQ5 Q;  4OMQ A;  1OU9 A;  1UB4 A;  1I1J A;  1I8F A;  1WHL A;  4M77 D;  4M77 A;  4C8Q B;  1FMK A;  3A98 A;  1SSF A;  3WVD B;  4QQD A;  4C0D B;  3ZEH A;  2G3R A;  3A5Z B;  1X69 A;  4BD3 A;  2RI5 A;  1DJ7 B;  2LCC A;  3A8M B;  1AZE A;  4IIO A;  3EHQ A;  1X2K A;  2MCN A;  3CPW P;  3CD6 Q;  5CQY A;  3MPU B;  1FMW A;  2RI2 A;  5EC7 A;  4LDY A;  4ESR A;  1M1F A;  2FRW A;  2K3Y A;  1G5V A;  4A4E A;  4N0A A;  4HT9 A;  4J8O A;  3I55 Q;  1M8V A;  4PJO B;  2DZ9 A;  2PTK A;  3G7Z A;  4OVA A;  5GAN 6;  3OYC A;  5FRN A;  4C92 G;  4HVU A;  3OW2 S;  5GMK h;  1X27 A;  4RTV A;  1WIE A;  3JCM d;  4FCY A;  4FM4 B;  2E10 A;  1O75 A;  1Q82 C;  3HL8 A;  2P0Q A;  4Y91 A;  2RJE A;  4OB3 B;  5DLQ E;  2W0Z A;  9ATC B;  3UAT A;  3M4Y A;  2FL7 A;  4GLK A;  2DIL A;  1WGS A;  1E6G A;  4JPB W;  2V8I A;  1OPL A;  3OSS C;  5CIU A;  3OYN A;  1KFZ A;  1YI2 A;  4BI3 A;  5IAY A;  1K73 C;  1UUE A;  3TVT A;  5KYU A;  8ATC B;  1D0Z A;  4A4H A;  2DYB A;  1ZBJ A;  3PMT A;  4LDU A;  3CCE A;  1VQN T;  3OYL A;  1PM3 A;  4M78 D;  5KCO A;  2CZ6 B;  3PVL A;  2HDA A;  1Q82 R;  4DOV A;  2ZPB B;  1AWJ A;  1PRL C;  3CXC P;  1UGP B;  2MIO A;  4JRI A;  4O5V A;  5GAO l;  1V76 A;  2WSC E;  2KR3 A;  2ABL A;  2NYS A;  4OMM A;  3Q1J A;  3LX7 A;  5KCH A;  2PU9 B;  2QA4 A;  1LCK A;  5KYW B;  5GAN 7;  2L0A A;  3M4G A;  1K9M R;  1Q86 C;  3V8J A;  3FIF A;  2L2P A;  1G3Y A;  2OTJ A;  2H3E B;  2EYY A;  2XI9 A;  2COY A;  2XU8 A;  2KGT A;  2MOX A;  4HT8 A;  1W4S A;  2ECZ A;  1B07 A;  2X4X A;  2AZS A;  2FO0 A;  2F5K A;  1WXB A;  3G71 A;  2L3Q A;  3CC2 Q;  2DF6 A;  2E64 A;  1OEB A;  3SWN C;  3EGU A;  3VS6 A;  1M90 U;  2DD4 A;  4M78 A;  1UEB A;  5DLO A;  4KBM B;  3JCM e;  1VQP Q;  1NLP C;  3A8H B;  5HY6 A;  2ROT A;  2K6D A;  1IGQ A;  4LN2 A;  5IHI A;  3GF5 A;  2XK0 A;  3H0I A;  3L1A A;  1RAA B;  2RHI A;  2CSI A;  4C8Q F;  1VQP A;  3S3N A;  2QI2 A;  1MHN A;  2FHD A;  4R0K A;  2QQ9 A;  2OI3 A;  2DVE A;  4MZM A;  2AKL A;  4PKC C;  1X6G A;  5GAM f;  4ELZ C;  2EWN A;  2RK2 A;  4PNO A;  4LD9 K;  2JM9 A;  2CP2 A;  4E7H A;  3VU3 C;  1VA7 A;  3M59 A;  5IH2 A;  2C06 A;  2AIR B;  1VUB A;  1VQM T;  1RLQ C;  2LQK A;  1YJW A;  3UF4 A;  4JJN K;  1YJ9 T;  4P5N A;  3BY7 A;  4L6V 5;  1YN8 A;  1QCN A;  4WTO B;  3DLL A;  4OMF B;  3NHN A;  3G4S A;  3FDR A;  4M7D A;  2DBM A;  3VRZ A;  2K4Y A;  1KQS S;  2PVO B;  1IGU A;  4QVD A;  2LCL A;  1HYO A;  4LDV A;  3OW2 A;  4E7I A;  1UHF A;  2FZG B;  4AFS C;  3MCA B;  2O01 E;  3RDV A;  1G3S A;  2V1R A;  3V8K A;  2A28 A;  2YXY A;  3SFM A;  5I21 A;  4QT7 A;  5GMK l;  2QEX Q;  2KRM A;  5GAM j;  3CCV A;  1M1G A;  4M77 F;  3EHR A;  1B3Q A;  2DPP B;  1IHV A;  1SEM A;  3G6E Q;  1OOT A;  1YI2 Q;  1VQ6 A;  3E19 A;  2CRE A;  1VOM A;  3HFN A;  1NJI U;  4DQ2 A;  3VS2 A;  4ZNX A;  2V1Q A;  1IXD A;  2F2W A;  4M4Z A;  2I2L A;  1Q7Y R;  5HK3 A;  2LVM A;  1KIK A;  1QLY A;  1TWB A;  3UA6 A;  4JS4 A;  3VYH B;  3MEW A;  1WA7 A;  1KD1 R;  1YIT T;  2V8K A;  5A0L A;  1M1K R;  3CCM A;  2DYI A;  1SPK A;  1NEG A;  3H6Z A;  3PGG A;  3KFV A;  1UGS B;  2NUZ A;  2EIF A;  1TS9 A;  1Z9Q A;  5LJ5 d;  3A8G B;  4EDU A;  1K8A R;  1AWX A;  2LNV A;  1S72 A;  1PG5 B;  3FB9 A;  2DTI A;  1WX6 A;  1W2B P;  4HVW A;  3M55 A;  1RL2 A;  1Y96 B;  4D8D A;  1VYT A;  4YTL A;  5GMK e;  1NYG A;  3THK A;  3OQ5 A;  2LCS A;  4RTZ A;  5LL6 S;  5GAN g;  5DM7 R;  5LJ3 e;  4OGC A;  1N8R R;  2KXD A;  1LVK A;  4RG2 A;  3LH5 A;  3CMA Q;  3ER0 A;  2RQR A;  3CCU T;  2CP0 A;  1YWO A;  2FZC B;  4BI8 B;  3UPU A;  2PUK B;  2ROL A;  2IVW A;  3JSC A;  1U8R A;  3HFO A;  3NTH A;  4C92 A;  3VS1 A;  2B86 A;  3NTI A;  4FU6 A;  2YWW A;  5CKF A;  4M75 G;  5GAM g;  4ELY C;  3I5S A;  4AFU C;  3GP8 A;  3QPH A;  5FU6 C;  2DO3 A;  4N4H A;  2K3B A;  2AT1 B;  1YCS B;  5GAO q;  1KC8 C;  4J6W A;  5FU7 C;  1IB8 A;  4F7U F;  2YHT A;  1AOJ A;  3ZFJ A;  3GIB A;  2L89 A;  2I0N A;  1G83 A;  2AZV A;  5GMK i;  4RTY A;  3CC7 T;  5I2M A;  2JXB A;  1WFW A;  2KRN A;  3RMS A;  2D8J A;  2M16 A;  3LWI A;  1JXO A;  1X75 C;  1M3C A;  1RAD B;  4OMO A;  3CC7 Q;  1V1C A;  1QKX A;  4JRK A;  1NZ9 A;  3OYB A;  3RKX A;  1S72 T;  5LJ5 e;  3OYH A;  5FRM A;  1GFC A;  3GBQ A;  1K0X A;  2HZY A;  5GAN j;  1AEY A;  3JCM P;  2EYZ A;  2CH4 A;  1LJO A;  2W10 A;  1QVF S;  3QYG B;  4XU2 A;  4M7D B;  2K7A A;  2KE9 A;  3QII A;  4RCB A;  4EMK A;  1KJW A;  2LT1 A;  4E6R A;  2XHC A;  1BBZ A;  2YUQ A;  3CCQ Q;  4BE0 A;  2QDL A;  1SHF A;  2M9U A;  1R77 A;  1Q81 U;  1FWZ A;  3V7R A;  2CS7 A;  4OB2 B;  4CC3 A;  1NJI R;  4MZT A;  3EG2 A;  5I11 A;  1VQN Q;  2LZ6 B;  1VQ6 T;  3CCU A;  2JUF A;  3GLX A;  2PVD B;  1WJQ A;  5IT9 E;  2EFI A;  4M7A F;  2HSP A;  5DY9 A;  5KH6 A;  3FJP A;  1GXI E;  1MMA A;  1AVZ C;  2JVV A;  1QCF A;  1ZBX A;  2RN8 A;  4HCZ A;  3VS4 A;  2M0O A;  3H41 A;  4M7D F;  2DBK A;  3M57 A;  4MDX A;  3JCM g;  3CCR T;  4M7A C;  3SWN B;  1PWT A;  1ZSG A;  2YT6 A;  2ZAE A;  2RJD A;  2FRY A;  4M78 G;  1WHJ A;  3OY9 A;  2K5I A;  4FT4 A;  3LGL A;  3CMA A;  1RAE B;  3CBP A;  4BY6 B;  4A4K A;  1Q81 R;  1Y0M A;  2VWF A;  1M9S A;  1PKT A;  2CH4 W;  1YI2 T;  3DKM A;  4LXC A;  4JZ3 A;  2L8D A;  3CCS Q;  2P4T A;  2X35 A;  5LJ3 f;  2RD1 A;  3DB3 A;  3KXT A;  4E7J A;  3RR6 A; 
#chains in the Genus database with same CATH homology
 4A63 B;  2PTK A;  2ED0 A;  3RNJ A;  2HCK A;  5GJW B;  4HVU A;  1M3A A;  2A08 A;  1X27 A;  4RTV A;  2DJQ A;  3ZL7 C;  2BTT A;  1BU1 A;  1WIE A;  1G2B A;  2DRM A;  1RLP C;  4DEY A;  3R6N A;  2RPN A;  4FSS A;  1S1N A;  3C0C A;  1NG2 A;  2CT3 A;  1ZLM A;  2X3X D;  4ORZ A;  4OMN A;  1WLP B;  2KEA A;  2W0Z A;  4J9C A;  3UAT A;  2DIL A;  2EYX A;  1E6G A;  4JPB W;  1MV0 B;  2GTO A;  1JXM A;  1OPL A;  4LE9 A;  2F2V A;  1KFZ A;  2RQV A;  1GCQ A;  2O9S A;  2DLP A;  1E6H A;  2KBT A;  2KNB B;  2JTE A;  1UUE A;  3TVT A;  4LNP A;  1GCQ C;  2J6O A;  2DYB A;  1UE9 A;  1ZBJ A;  2EBP A;  4GLM A;  1E7O A;  3RBB B;  1K0S A;  3PVL A;  1YNZ A;  4F16 A;  4OML A;  1UTI A;  2OAW A;  2HDA A;  4D8K A;  3VS5 A;  1AWJ A;  1PRL C;  1UEC A;  2EQI A;  2MIO A;  1SRM A;  2KR3 A;  2ABL A;  4Z89 A;  3JV3 A;  4OMM A;  2XMF A;  2GGR A;  2YUP A;  2J05 A;  2G6F X;  2KRS A;  1T3S A;  1LCK A;  2D8H A;  1BB9 A;  4EIK A;  2L0A A;  1HSQ A;  4CC7 A;  2LJ0 A;  3CQT A;  2BZ8 A;  4JJC A;  2L2P A;  1SHG A;  1ARK A;  1AD5 A;  2KYB A;  3QWY A;  2KT1 A;  2EYY A;  2SRC A;  2FEI A;  4CC2 A;  1UFF A;  2J06 A;  1JU5 C;  2KGT A;  1NYF A;  2MOX A;  2ECZ A;  1B07 A;  1I07 A;  2AZS A;  4OMP A;  2EPD A;  2FO0 A;  4J9G A;  5ECA A;  1WXB A;  2RQU A;  2FPE A;  2LP5 A;  1M8M A;  4RTW A;  2L3Q A;  2DF6 A;  2DL5 A;  1OEB A;  2E5K A;  3EGU A;  3VS6 A;  1K4U S;  2DVJ A;  1T0J A;  2JMA A;  1QWF A;  1NLP C;  2ROT A;  3I5R A;  2K6D A;  4LN2 A;  1VYV A;  5IHI A;  2KT8 A;  4AFZ C;  3H0I A;  2DM1 A;  1U5S A;  5GJV B;  1W1F A;  2YUO A;  5I22 A;  2EYW A;  4J9F A;  2CSI A;  1GL5 A;  2EGE A;  1GCP A;  4HXJ A;  1YP5 A;  1TG0 A;  2FPF A;  4R0K A;  2DL8 A;  3M0S A;  1UHC A;  1Z9Z A;  2NWM A;  2OI3 A;  1J3T A;  3NGP A;  2AKL A;  2ED1 A;  3UA7 A;  1X6G A;  4Z88 A;  2JM8 A;  2JM9 A;  2KYM A;  3FJ5 A;  4J9I A;  2JW4 A;  1VA7 A;  2DE0 X;  1PNJ A;  3ULR B;  1AZG B;  5IH2 A;  1OV3 A;  2O9V A;  1KSW A;  3PE0 A;  2BZY A;  1RLQ C;  1X2Q A;  4F17 A;  3UF4 A;  1VYU A;  2O31 A;  2YDL A;  1QKW A;  1HD3 A;  2A36 A;  1XOV A;  1X6B A;  1YN8 A;  3M0U A;  4GBQ A;  2ENM A;  3NHN A;  2LMJ A;  1AWO A;  2DBM A;  2H8H A;  2KRO A;  1WXT A;  3VRZ A;  4WCI A;  2JT4 A;  4K11 A;  2LNH B;  2LJ1 A;  2DL3 A;  2KXC A;  1JEG A;  5IXF A;  1K1Z A;  1MV3 A;  4KRT A;  1WXU A;  1UHF A;  4AFS C;  2DA9 A;  2C0I A;  3M0T A;  1U3O A;  1SSH A;  4Z8A A;  2V1R A;  1PKS A;  4RTX A;  2A28 A;  4QT7 A;  3H0H A;  2D0N A;  2KRM A;  1Y57 A;  1WYX A;  2VKN A;  3VRY A;  3EHR A;  1B3Q A;  1FYN A;  1SEM A;  2OJ2 A;  1OOT A;  2L3S A;  2CRE A;  2IIM A;  1TUC A;  2EGC A;  3VS2 A;  1A0N B;  4ZNX A;  2V1Q A;  1ZUK A;  2F2W A;  4M4Z A;  1SRL A;  4JJB A;  1M30 A;  2HBW A;  1CKB A;  2HEQ A;  1KIK A;  1H92 A;  1QLY A;  3UA6 A;  2BZX A;  1WA7 A;  1JQQ A;  2GTJ A;  2JMC A;  2M51 A;  1ABO A;  3PVQ A;  1SPK A;  1NEG A;  1UGV A;  2M0Y A;  3KFV A;  2J7I A;  2NUZ A;  3QWX X;  2CUD A;  1Z9Q A;  4J9D A;  4X1V A;  2RNA A;  4JJD A;  1GRI A;  4LUD A;  1AWX A;  2DL4 A;  1WX6 A;  3EG1 A;  4HVW A;  1T3L A;  3REA B;  1UG1 A;  2LQW A;  3TSW A;  4D8D A;  3M0Q A;  1VYT A;  4F14 A;  2K79 A;  1NYG A;  1PHT A;  3THK A;  2LCS A;  2DL7 A;  2EW3 A;  4RTZ A;  2JS2 A;  2KXD A;  4J9E A;  4DEX A;  1GBR A;  2CUB A;  3LH5 A;  1K9A A;  2RQR A;  2RQT A;  1YWO A;  5HCK A;  2ROL A;  1GBQ A;  1WI7 A;  2EGA A;  2LJ3 A;  4CC4 B;  3I35 A;  1ZUY A;  2LQN A;  2AKK A;  2FPD A;  2SEM A;  3VS1 A;  2B86 A;  5IHK A;  1ABQ A;  2DMO A;  1ZX6 A;  1CKA A;  4AFQ C;  2AK5 A;  3I5S A;  5L23 A;  2RF0 A;  3IQL A;  2FG0 A;  3REB B;  4AFU C;  2EVR A;  3EG3 A;  2RQW A;  1W70 A;  1IO6 A;  2D1X A;  5FWB A;  1AWW A;  1UDL A;  1W6X A;  2YSQ A;  4JZ4 A;  2K3B A;  2O2O A;  1YCS B;  4LUE A;  2J6K A;  3NPF A;  4IIM A;  2CSQ A;  1AOJ A;  3U23 A;  3H0F A;  2I0N A;  1G83 A;  1NEB A;  2AZV A;  4J9B A;  3M0R A;  2LX7 A;  2L3P A;  4RTY A;  1EFN A;  2JXB A;  1WFW A;  2VVK A;  2RMO A;  2KRN A;  2YUN A;  2D8J A;  1ZUU A;  1JXO A;  3TSZ A;  2GQI A;  2K2M A;  1M3C A;  1UJ0 A;  2J6F A;  4HCK A;  2ESW A;  3EG0 A;  4OMO A;  1UJY A;  1V1C A;  1QKX A;  1T0H A;  2X3W D;  1M27 C;  5FWC A;  1MUZ A;  2DX1 A;  4RTT A;  2A37 A;  1QWE A;  1GFC A;  3GBQ A;  3SEM A;  3NMZ C;  1K0X A;  4HVV A;  4AG2 C;  2F2X A;  2PZ1 A;  1U06 A;  3VS0 A;  1AEY A;  1M3B A;  1K76 A;  2EYZ A;  1YWP A;  2GBQ A;  2CH4 A;  2W10 A;  1CSK A;  2C0T A;  2CDT A;  4AG1 C;  2K7A A;  2KE9 A;  1NLO C;  1KJW A;  4E6R A;  1BBZ A;  2YUQ A;  2P4R A;  2QDL A;  1BK2 A;  1SHF A;  2PNI A;  2EKH A;  5IXB A;  1H8K A;  1I0C A;  3VS7 A;  2K9G A;  4CC3 A;  2GNC A;  4J9H A;  4RUG A;  3EG2 A;  5I11 A;  1H3H A;  4Y92 A;  2DNU A;  3O5Z A;  2LZ6 B;  1X43 A;  1OPK A;  1JO8 A;  1NM7 A;  2O88 A;  2HSP A;  2C0O A;  1AVZ C;  1QCF A;  4OMQ A;  1HJD A;  4RTU A;  2DRK A;  2RN8 A;  3VS4 A;  1I1J A;  3H41 A;  2DBK A;  1FMK A;  3A98 A;  1RUW A;  1PWT A;  3VS3 A;  1ZSG A;  1RI9 A;  2YT6 A;  3SHW A;  1N5Z A;  2FRY A;  1PRM C;  1X69 A;  3I9Q A;  1AZE A;  4IIO A;  3EHQ A;  1X2K A;  2MCN A;  2CT4 A;  1Y0M A;  2VWF A;  1TUD A;  1PKT A;  2CH4 W;  1GFD A;  5EC7 A;  5IHN A;  4JZ3 A;  4ESR A;  5FW9 A;  2JS0 A;  2FRW A;  3M0P A;  1WDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...