2VC8A

Crystal structure of the lsm domain of human edc3 (enhancer of decapping 3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Divergent Sm Fold in Edc3 Proteins Mediates Dcp1 Binding and P-Body Targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords ENHANCER OF MRNA-DECAPPING PROTEIN 3
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vc8A00
4XTYA 4C8QF 5LJ5e 4M77B 2I2LA 4XTVA 1I4K1 3JCMW 4M78E 4C92E 5DY9A 4A54A 4XU1A 5LJ3h 1B34A 1WNLA 4EMKA 4M78B 3VU3C 5CAIA 2DZ9A 4RCBA 3RIRA 5GAOr 4M7AG 1WPYA 4M7DC 5GAMf 5LJ3e 1Y96B 3V8JA 3JCMX 2E41A 4M77G 4XTZA 2EJGA 3M4GA 3SWNA 3V7CA 4C92C 4M77E 4X9CA 5GAN6 4MMKA 5LJ5d 5GMKl 4M78A 3JCMQ 5GANe 5GAOp 4M75C 3PGGA 4JUVA 4F7UB 2YLBA 4NOYA 4XQ3A 4XTXA 5LJ5j 4C8QA 1LOJA 4M77D 4F7UE 3JCMd 4M77C 4Y91A 4PJOB 4PJOD 4QVCA 3EFSA 3HFNA 3BY7A 1H641 2VXFA 4M75E 4M7AA 4N0AC 4M75G 4HA8A 1YCYA 4XU2A 3QHSA 4JRKA 5LJ3d 4MMLA 4OP0A 3L2ZA 4M7DD 1JRIA 2EAYA 3RKXA 3JCMV 4C8QG 4EMKB 2RD1A 3BW1A 4M7AD 1I8FA 3L1AA 2FB7A 3JCMh 5GANf 4M78F 4EMHA 2DEQA 3V7SA 3JB9D 1Y96A 3QUIA 1I81A 4M75A 5GAOm 1I5LA 4XU3A 4J6YA 1N9RA 3SWNB 3V8KA 5GAN3 2E64A 3RERA 3V8LA 4M7DE 5GANj 2VC8A 4C8QC 5GMKm 4C8QD 3JCMb 3QO3A 5GAMd 4M7DG 4PJOC 3SB2A 1BIAA 1D3BB 5GAMj 3QSUA 4XU0A 4C92G 4M7AF 2E10A 5LJ3j 1WQWA 4JRIA 5LJ5f 2DKGA 1BIBA 2QTXA 4M78D 4WF2A 3JCMJ 3JB9F 4M78G 3RKWA 1M8VA 2CGHA 2DXUA 5GAN4 5I21A 2YLCA 4M7AB 4M7DB 5GANg 2VXEA 1U1SA 4A53A 5GAN8 3RKYA 5GANh 2K57A 3FIFA 3RESA 3JCMf 4M7AE 4N0AA 2DTHA 4M75F 4EMGA 5GMKj 2DVEA 5GAMg 2RA2A 5GAN2 4M7DF 4J6WA 5LJ3g 2DJZA 4PNOA 5GMKi 5GMKe 2Y90A 4C92F 4QVDA 1HXDA 4J6XA 1KQ1A 2FYKA 4M75B 4M77F 4RCCA 4X9DA 3JCMP 3BFMA 5GAMe 4DQ2A 4F7UG 5GAN5 3JCMc 1HK9A 5GAOl 2EJ9A 2E1HA 2EWNA 2HNIA 4J5YA 3V7RA 3AHUA 1MGQA 2DXTA 2RM4A 4V2SA 5GANd 3BDUA 4NL3A 4C92D 1WQ7A 1X01A 3GIBA 4JLIA 3JB9J 5GAOq 1D3BA 1TH7A 4M75D 2JN0A 5GAOn 3INZA 3JB9H 4C8QE 1M5Q1 4NL2A 4EMKC 4PJOE 2ZGWA 2E65A 5GMKh 1U1TA 5LJ5h 4PJOG 4M7DA 3EFRA 5GAN7 5GAMh 3JB9G 2DTIA 4F7UF 1KQ2A 4HT9A 3JCMg 1LJOA 3SWNC 4C92A 4M77A 4F7UA 1LNXA 2EJFA 4PJOF 4M78C 3JCMe 1JBMA 5LJ3f 3RUXA 3JB9I 4C8QB 1B34B 4HT8A 4PJOA 2YHTA 2DTOA 3FJPA 4XTWA 4XTUA 2DZCA 3HSBA 4M7AC 2RB6A 3HFOA 1N9SA 3FB9A 5LJ5g 4C92B
chains in the Genus database with same CATH superfamily
2GFUA 3L42A 1PC0A 2YUOA 4M78E 1P92A 1UG1A 4FT4A 5DLQE 1WXTA 4RCBA 3EFOB 5KYWA 4KT0E 2HMAA 4RTWA 3SWNA 5LJ5d 4EDUA 3LGLA 1VQNA 1MMAA 2E3IA 3UATA 1LVKA 2YLBA 1ZUYA 3D7SB 4M77C 4RMOA 3EFSA 2BIVA 3PVQA 3OW2A 2CSQA 4M75G 1YHQA 2KAFA 2LDMA 4WTOB 1FYNA 5KE2A 2EFIA 3H9NA 2E3HA 2HBWA 1VQ4A 1I81A 1Q81R 1HYOA 4XU3A 3EGDA 5CK9A 1K9MR 1G3SA 1QQJA 4C8QD 4F16A 1D3BB 3GOXA 2ESWA 2O31A 2D6FA 1M8VA 5IXBA 4IKFA 1YITT 2KXCA 3RESA 4M75F 2V8JA 1BCMA 3NTHA 2OTLT 2DILA 2HBPA 1YWPA 1SHFA 2QQAA 3M59A 3OY9A 4FYVB 1NYFA 2E1HA 1WJRA 1CKAA 4AFQC 4C92D 2NUZA 3QDRB 2QASA 1KD1U 4NL2A 2RI5A 1U06A 3CQTA 4PLIA 2E65A 4BB7A 3EHQA 4E7SA 2XD0A 3PMIA 2DTIA 3QKJA 4VUBA 4PK4A 5FLXE 5KCHA 4J9HA 1SF9A 3JB9I 3MEWA 1GCQC 4JLGA 3CC2Q 1I07A 2JM8A 3FB9A 1VUBA 2O4XB 2SRCA 2KRMA 1OV3A 1B34A 2DZ9A 5LJ3e 4E7IA 2DX1A 5GANe 4M4ZA 3L2UA 4LUEA 3QIIA 4FW1A 4C8QA 3OYCA 2DRKA 4JRQA 2ROTA 4QVCA 2GFAA 2VGNA 3LWHA 2ZPGB 5D6YA 1V29B 5CKDA 3CC7A 2AKKA 1AOJA 2LP5A 2GTJA 2QQSA 1UGPB 3QUIA 1I5LA 1KSWA 4J6YA 2BZXA 1G83A 2QAZA 1UHFA 3OBWA 3NGPA 4HVWA 4M7DG 2HSEB 3A5ZB 1MNEA 3Q1JA 5GAMj 1QKWA 3L2QA 2HQHA 3S6WA 2PUKB 1QCFA 2VKNA 5I21A 1IRXA 1FX7A 1YIJA 1OZ2A 4FM4B 5GAN8 5KE3A 1M1KC 1WIEA 4QVDA 4R56A 2QQ9A 4DQ2A 1UGVA 3JCMc 3AHUA 3X20B 4MZPA 4ELYC 3CCRT 3QYHB 3MKDA 1NEGA 1G8XA 2CH4A 4LD6A 5C0MA 3DKMA 3EGUA 1IB8A 4EMKC 4GLKA 1M3CA 4IIOA 1JO8A 4PJLA 1PKTA 4M7DA 4Z88A 3JB9G 2SEMA 1TWBA 1M2VB 1YNZA 1YN8A 4CC2A 5KH6A 4ANJA 4QQGA 2QEXT 1AZEA 1TTHB 1VQPQ 2JTEA 1D1CA 1OX8A 4XTVA 1IREB 1VQLT 1WNLA 2K5FA 2JS2A 2MWPA 3DB3A 5AT1B 1WPYA 2EPDA 2MCNA 3UWNA 1AT1B 2LX9A 1PHTA 4HKEA 4JS5A 2K2VA 4JUVA 1KD1C 2W10A 3S3OA 3E1SA 1IHWA 2X4YA 1UUEA 2XICA 2BKDN 4HA8A 2LCLA 4PJNA 5FU7C 2O2OA 4E7LA 3HPWA 4M7DD 1NJIC 4C5IA 2A7YA 2DAQA 2FB7A 4B6MA 1UECA 2HEQA 2CP5A 4M75A 4TVRA 4OMOA 2LMJA 2DD5A 4J7IA 3CEYA 1TUGB 1B3QA 1SHGA 2KXDA 2LZ6B 3M55A 1E6GA 2CZ6B 1R8OB 4E7ZA 3NPFA 5GANg 2CUDA 3OYDA 5KYYB 2DTHA 3EG3A 1OX9A 2OJ2A 2XMFA 1PD0A 3M58A 1LCKA 1CSKA 1QP2A 3A98A 5KCOA 1YP5A 1W2BS 2F5KA 3MP8A 1MMDA 2EWNA 4J5YA 3M0TA 1WQ7A 1YWOA 1JXOA 3MEUA 2QTVA 1T0JA 3CCUQ 3ULRB 5HY6A 3FEOA 4UC4A 5GAN7 7AT1B 2GCXA 1MV3A 2CH4W 3CCST 2EQUA 1Z9QA 2E5QA 1VQKA 1TOVA 2HDAA 3TQ7P 5LJ3f 4KGZB 1BK2A 4N4GA 3CCUT 1RAAB 2A28A 1N9SA 2QGGA 4J9EA 3C95A 1AWXA 1K9AA 2CZ0B 4C8QF 4ZGEB 1N8RC 6AT1B 1SRLA 1Q95G 3AT1B 1D1AA 3OS2A 1X69A 2QA4T 3UA6A 2I0NA 2JNGA 4OGEA 3A8HB 4F17A 2X35A 5GAN6 2DL3A 3ASKA 4HCBA 1IGUA 1K0SA 4QT7A 3GNGA 2QA4Q 2EYQA 3A8LB 2PUOB 4PJOD 3CCQA 1YJWA 4N0AC 4LDVA 1UJ0A 4JRKA 1AVZC 4PJMA 3L2ZA 4C8QG 2QEXQ 1I8FA 1GBQA 1V1CA 2MWOA 1WXBA 4WCIA 1VQLQ 2KRSA 3GF5A 4JJNK 4BE0A 4LDUA 4RTTA 5D7UA 3G7ZA 1QVGP 1BIAA 1M1GA 5LJ3j 3E9FA 1WQWA 4IIMA 2K5LA 4DBQA 4OB3B 3EG0A 1ZUKA 1U1SA 1WDXA 2LX7A 4DEXA 1Y71A 2JTMA 2X9HA 4PNOA 4C92F 1VIFA 3JCMP 5CKEA 3OYHA 3I55T 3I56Q 3X25B 3CCMT 1RAIB 2E6ZA 5A0LA 2PVDB 3F70A 1WJQA 2BE9B 2RHYA 3QZ5B 2JS0A 5FRMA 4Z8AA 2RHXA 3CD6Q 1TS9A 4DOWA 5FWBA 3UA7A 2EYYA 1H3HA 1MV0B 2JM9A 4Z02A 1XTDA 4FSSA 2BZYA 2OAWA 2CS7A 2YUNA 2DTOA 5HKCA 2C06A 2DL8A 1SRMA 3HSBA 3HFOA 3CC4A 3VS1A 4HCCA 4PFPA 5DY9A 2DVJA 2F1LA 2KNBB 4M78B 1BI3A 2ZPIB 3T9NA 3M54A 2A37A 1YI2A 1T3LA 5ECAA 2OTJA 2RI3A 2LQ8A 2CP6A 1K73U 2CDTA 3RDVA 4ZTFA 3M56A 3CBMA 5J39A 2QGFB 4FSXA 2HAXA 2PQWA 4KUDK 2C0IA 1Y0MA 3H6ZA 2F2WA 1WLPB 4C0DC 1HJDA 4J8OA 3BW1A 2J6KA 3G71A 4LDWA 3VUBA 2L5QA 1JB0E 2CZ1B 3OS0A 2AZVA 1M8MA 1NPPA 1RLPC 1I5OB 3QBYA 3OYGA 3QSUA 4JZ4A 1W4SA 4CRIA 4L5GA 1VQ7Q 1W70A 2CP0A 3JCMJ 1YFNA 1H3ZA 3OS5A 4M7AB 2FPDA 2O01E 2LNVA 2K57A 4RTXA 3JCMf 3E2UA 4OMFB 5GMKj 1BU1A 3R6OA 3MPUB 1WHLA 3MHXA 1VQMQ 1AHJB 4X34A 1RABB 3CMAQ 2LTOA 4DBHA 2E70A 2RPNA 1WHHA 1T3SA 2EJ9A 1WJSA 4D8KA 4V2SA 2RM4A 2VV5A 4J9BA 3URGA 3OSSC 2F2XA 4N4HA 2D0NA 1VQMT 1TH7A 2DO3A 1FMKA 3TVTA 4PJOE 2CUBA 1TXQA 3JAME 1PG5B 1E6HA 2DMOA 4LD9K 3JCMg 4C92A 2RQUA 1JJ2S 2EJFA 4PJOF 1JBMA 5A0DA 2YHTA 3KUFA 4PFZA 2K4YA 3CCVQ 2RQRA 3TSZA 4C92B 1RL2A 2JZ2A 3RBBB 1Q81C 4KH0B 2F5TX 4A4EA 4ZGJB 4OMPA 1V76A 4XU1A 1VQ5A 4BI4A 3CCVT 4M7AG 1W2BA 3IQLA 2L3SA 2DFUA 3V7CA 1A0NB 2QQBA 3LGFA 3MP1A 2F69A 3KFVA 4RKUE 4C5EA 8ATCB 4PLLA 3GLXA 2DYIA 4OMMA 4XAXB 1TG0A 3I5SA 2J6OA 1QMCA 2HSPA 3HRUA 4MMLA 5FROA 2RD1A 3QYGB 4L59A 3VS4A 3OYKA 5M9OA 1XQHA 4M78F 2XKOC 2PZ1A 2GTOA 4OB1B 2A36A 4HVUA 1VYUA 1C0MA 2OTLQ 1NM7A 3RERA 5GANj 1VQ6A 4JDSA 3EGXB 3META 4GBQA 4C92G 1W2BP 3EH2A 5IXFA 2DKGA 2R5MA 1BKBA 4BE1A 1YBYA 4M7DB 4FYXB 1Q7YC 5GANh 1Z9ZA 1M2VA 2EVRA 2LJ0A 2YUQA 4OGCA 1KQ1A 4MDXA 1ZSZA 4F04B 2JMCA 1M90C 2DIQA 3BDUA 4HVVA 4J9GA 4FL6A 1M3AA 3RNJA 1QVFA 1IO6A 3L2WA 2ZGWA 2JMAA 2MOXA 2BZ8A 3SEMA 2LJ1A 1NPRA 4LUDA 1NZ9A 3EG1A 2CP2A 1VQ7T 3JCMe 1QCNA 4XTUA 2DZCA 3CCUA 1VQ8A 1M27C 2EYXA 3OSVA 3CMAT 2BE7D 2KK4A 1X6GA 2E41A 4P5NA 2IIMA 4AFUC 2R57A 4BACA 3U23A 4M78A 2RNAA 1UDLA 2L3RA 2VWFA 3CCQQ 1K76A 2MAMA 1HD3A 5IAYA 2KYBA 3TU4K 4PJOB 3M5AA 1YJWT 4E2FB 1OULA 3CCQT 3HP9A 1JRIA 4DA4A 4E7JA 2LQKA 2NUPA 5D6WA 5KYNA 2DEQA 1VQOA 3N5BB 2J6FA 2DA9A 2D0QB 1BI2A 1X2QA 1KG1A 3P8BB 5GMKm 3M0PA 2V26A 2CYZB 4JS4A 3PNWC 4QQ6A 2ZPHB 2DE0X 1VQKT 1ZUUA 1AEYA 2DNUA 4R0KA 4C5GA 2VUBA 3M4YA 1ZSZB 2K9GA 3RKYA 5CQXA 5CIUA 1GBRA 1ARKA 3M9QA 1VYTA 3TSWA 1Y7XA 2V1RA 5GANd 2ROLA 1JEGA 1X01A 3GIBA 1UGRB 4JLIA 2XK0A 5GAOn 3ZBDA 1G3YA 2DF6A 2DEUA 3P8DA 2O88A 2RQWA 2XHCA 4IUQA 1TUDA 2PVGB 2GF7A 2J06A 1ZLMA 3FC3A 3OB9A 4M7AC 1MMNA 3NMZC 1VA7A 1Q7YU 1OZ3A 2YUPA 2B8AA 4A63B 4O6JA 3OYLA 4A54A 1N8RR 4Y28E 1VQ4Q 1O9SA 5FU6B 1QLYA 2FZGB 5GAMf 1QW1A 4MMKA 1B7TA 1VQ4T 2L2PA 1X43A 2DL5A 1D0YA 2RHZA 3TEEA 2DL7A 2HQXA 4JJBA 3CC2T 1VYVA 1H641 2NUTA 4CI0C 1S72Q 1MNDA 2NLUA 3CC7Q 2HL3A 1Y07A 1OPLA 3OW2P 1Q82R 4AG1C 4M7AD 1W6XA 3CCRA 1S72T 3EAEA 4E7HA 1S72A 2DXBA 2E5KA 4E47A 2CT3A 2EW3A 2NYSA 4DOVA 1UE9A 3QJYA 4AFZC 2COWA 4FU6A 1BIBA 2QTXA 3JB9F 2EQKA 3EGXA 2MIOA 5IHIA 1SG5A 2JT4A 1U3OA 3FIFA 3CCLT 2YT6A 2DJZA 3CCLA 1QVPA 3OQ5A 3VYHB 1HXDA 3J80E 4RCCA 2QG9B 4F7UG 1AZGB 1QVGS 4MDWA 2DXTA 2AZSA 1TU0B 3DB4A 2E12A 2EBPA 1BB9A 3P8HA 5GAOq 3MEVA 3O8VA 4LE9A 2L89A 2L0AA 3QZ9B 2MPXC 3QG1A 2YRVA 3HL8A 3EFRA 5GAMh 1LPLA 1TUCA 4HT9A 1O75A 2FRWA 4O5VA 1VQKQ 3FJ5A 1B34B 2DETA 1QVFP 2D9TA 2H3JA 1QWFA 4XTYA 4ZN1A 2I2LA 3JCMW 5LJ3h 2ABLA 2RI2A 3CCRQ 1EZZB 3OBYA 3TREA 3OYYA 2K3BA 3JCMX 4M77G 3G4ST 5FW9A 5LL6S 1F1BB 3REAB 2LCCA 2ED1A 5GAOp 4M75C 3MO8A 3HRTA 1AWWA 1PNJA 3MP6A 1JJ2P 4XTXA 2KSSA 2RH2A 2KT8A 2V8KA 2IG0A 2ZPEB 4J9DA 2Z0WA 1X2KA 1GFCA 2DD4A 1YCYA 4DEYA 4E6RA 5IH2A 5HCKA 4BY6C 4OP0A 2EAYA 1QP3A 3RKXA 4EMKB 3G6EA 1H92A 3V7SA 3CXCS 3UPUA 1K8AR 3CXCA 1N9RA 5GAN3 2COYA 5AYFA 3OYFA 2VC8A 4GLMA 2AKLA 3M57A 3ZFJA 3KBGA 3JCMb 3I55Q 3I56T 1Q82U 2A0FB 8AT1B 1YI2Q 2X51A 1BI0A 1D1BA 1WX6A 5C6SA 2QQRA 1YJNA 2P0QA 4EMGA 2DVEA 4RTVA 5LJ3g 4DBFA 2X3WD 3SD4A 3ZEHA 2Y90A 2DBKA 4KULA 5FU6C 1C1AA 1ZBXA 1NJIU 4IURA 1Y57A 2EQJA 2QEXA 4NL3A 3VRZA 4LNPA 3VS7A 1QVGA 1TSFA 1K8AC 3INZA 2HZYA 3OYMA 3LW5E 1K4US 2HKNA 3SWNC 3G1JA 1KHIA 4M78C 3WVEB 4C8QB 2ECZA 5KYUB 4R55A 2M0YA 4Y91A 1HSQA 2A3LA 4PJJA 1PKSA 3ME9A 3NHNA 4PFOA 5I2SA 3CCLQ 1UGQB 4KGVB 2P0KA 2KY9A 1J3TA 3RR6A 2JVVA 1ZSZC 4XTZA 2CP7A 5FWCA 4X9CA 3ZL7C 2HD0A 2KMTA 1PRMC 2AT1B 4C5HA 1KD1R 4M77D 2XI9A 3X26B 2CT4A 2OTLA 1PSFA 2VXFA 5GJVB 2O4XA 1K1ZA 2R5AA 2PTKA 4IUUA 2QA4A 5IHKA 5GANf 4HCZA 4L6V5 4CC3A 5D6XA 1GRIA 3OW2S 5CQYA 3RMQA 3OYBA 2E64A 3A8MB 3E19A 4CC7A 2RJFA 2KDSA 4BD3A 1AWOA 1UTIA 3NTKA 2HL5C 2W0ZA 4ZN3A 3NFCA 3VS0A 4M78G 1K8AU 4QQDA 4FYYB 1M1KU 1BI1A 2WSFE 4J6WA 1KC8C 4FT2A 1ZQ1A 4A4FA 2DLPA 1HK9A 3V7RA 2QYZA 2JUFA 1KHCA 1KFZA 1H8KA 2WSEE 2OI3A 1RAHB 1ZA1B 1D3BA 2LQNA 4EPCA 2AK5A 1UEBA 3JB9H 4C8QE 3VV0A 2LT4A 3VKIA 3CMAA 2L3QA 3ER0A 5GMKh 5IT9E 3UT1A 2KI7A 3CPFA 2ZPFB 3M0QA 1SSFA 3A8OB 1IZ6A 4GY5A 4OF1A 3BE3A 4A4KA 1SKUB 1ZSGA 1JQQA 2DJQA 2FEIA 4C0ZA 2X4JA 4DBRA 3I9QA 2M51A 3CMEQ 3CC4T 3L2VA 1AD5A 3RIRA 3HRSA 1Q86R 2X4WA 4B9WA 2J7IA 3LYIA 4JJDA 3G6EQ 4HXJA 1X27A 3JCMQ 3VUZA 1QVFS 1VQ5Q 4LN2A 3M53A 4CC4B 3I35A 4F7UE 2MK5A 1YHQT 4EIKA 2M9UA 1UJYA 4JPBW 3CC2A 1YITQ 3G71Q 5J3BA 5CCAA 1YHQQ 3JCMh 5J26A 3J81E 3CCEA 2MYSA 2CREA 2WACA 4QKUA 3V8KA 3G71T 4M7DE 1G3TA 5GAMd 2DXCA 4KGXB 2CSIA 4M7AF 2RQTA 1BYMA 2ED0A 4KBMB 2DXUA 3VS2A 3LX7A 4ZTJA 4A4GA 2RK1A 5GAN2 2DK3A 4AFSC 1GL5A 1M30A 3VS6A 4J6XA 2FYKA 4M75B 4ORZA 5CVIA 5GAOl 5GJWB 1Q82C 2CKKA 2WSCE 2V8IA 2IPOB 2RMOA 1NLOC 5LJ5h 2O9VA 4C0DB 1WXUA 3OA6A 1WA7A 2RO0A 1LJOA 1NG2A 3C12A 3PVLA 4J83A 3DLLA 4PJOA 2NWMA 1Q81U 3EFOA 2BTTA 3R6NA 2C0OA 2RQVA 1G3WA 3GPLA 2B86A 4C92E 3BDLA 4RG2A 1NE8A 3VS3A 3VU3C 2NUPB 5CAIA 4NS5A 1C6VX 1VQ6T 1VIEA 1X75C 5GAOr 1GCPA 1OU9A 4Y92A 2PVOB 5GMKl 5KYXB 1D0ZA 3J7AF 1VOMA 1G5VA 4B9XA 3SDZA 1VQ6Q 9ATCB 3QWYA 4C0GA 3M0UA 4OMQA 1RAEB 1X6BA 1Q86U 1IXDA 3H0FA 1QKXA 1VQLA 5HK3A 2KVQG 3QJ6A 1U8RA 2KYMA 3L1AA 2O9SA 5L23A 4ME7A 4EMHA 2DIGA 1Y96A 1WZOA 1N6AA 1VQ9Q 3CMET 4IUVA 3VJPA 3V8LA 4C8QC 2YXYA 3PFSA 3C4SA 5IN1A 2VB6A 5A2QE 2ZCFB 1OPKA 2EQMA 5LJ5f 4M78D 3G6ET 1M90R 3MCAB 3OMGA 3I56A 3OMCA 2MF2A 4M7AE 3EHRA 3L2RA 1VQPT 3BFMA 5GAMe 2YDLA 1K73R 1R0BG 3X28B 3HHTB 2KT1A 2GQIA 4KRTA 1PM3A 4BDZA 1MHNA 3EG9B 3H41A 3CPWP 3EG2A 2RK2A 3CPWA 2M0OA 1S1NA 1I0CA 2X4XA 4JJCA 4RTYA 1M1KR 4PJOG 2KROA 3C94A 1YIJQ 1UGSB 5KYXA 3CCVA 2JW4A 1XJWB 4F7UF 3SHWA 2DRMA 1OQKA 1G2BA 2XDDA 2K6DA 1YIJT 2BUDA 2RB6A 1VQ7A 2KRNA 2ZAEA 2JOYA 5LJ5g 2VGMA 1VQOT 5CO7A 1ZX6A 1RADB 2EGEA 2VASA 4EMKA 2R58A 2CZ7B 2FZCB 1IHVA 3REBB 4M7DC 1Y96B 4QVZA 1VQOQ 3M4GA 4C92C 1BCOA 1MMGA 2COZA 2MI6A 2QI2A 4OVAA 2YSQA 3OYJA 1XNIA 3S3NA 5I2MA 5LJ5j 1ABQA 1FMWA 5A0GA 1YJNQ 1OI1A 4ATOA 4M75E 2FVUA 1KQSA 2DM1A 1KQSS 1VQNQ 1YJNT 2XIDA 2ENMA 2NUTB 1SEMA 3QXEB 5GAOm 4MZMA 2XG8D 1PD1A 2K3XA 4PJOC 3PIOA 2Y4XA 4N4IA 5I11A 4WF2A 2RF0A 5GAN4 3LH5A 2LT1A 2DBMA 2VXEA 4E7KA 1KJWA 3CCSQ 1EIFA 1ZBJA 3QPHA 2EYWA 1VQ8Q 2LCSA 1YCSB 4M77F 1NYGA 3VYGA 1EX4A 4BDYA 2EGAA 1GXIE 4RUGA 2GGRA 1WGSA 2PNIA 3OYAA 4Z89A 1Q7YR 2LQWA 1VQ8T 1N27A 2GBQA 1VQ9T 1M5Q1 3WXMB 4LDYA 3PTAA 4RTZA 5I22A 2K3YA 4AT1B 2KBTA 4F14A 1RI9A 2EKHA 2ZPBB 3I55A 1PCXA 4XTWA 3LLRA 1R77A 1YJ9A 1M9SA 2M02A 3S3MA 2XDBA 3CCJT 2HQEA 1FXXA 3CCJA 1QWEA 3WVDB 2YRDA 4AMCA 3PIPA 3PMTA 3UDCA 3E9GA 3SFMA 1SPKA 4OMLA 2RJCA 4F7UB 2DYBA 1NLPC 1U5SA 4J9CA 2L8DA 4BUGA 2HKQB 2JTFA 1RAGB 4J9FA 3CCSA 1ABOA 1YI2T 4JZ3A 2L3PA 1X6OA 3CCET 1OOTA 5FU7B 3FRNA 1BBZA 2LC4A 1PWTA 3SB2A 1M2OA 1Q86C 4OB0B 4XU0A 2GQVA 3CCEQ 4FW2A 1QCOA 1YJ9T 3MJXA 2CGHA 4K11A 3CCMA 1CKBA 2YLCA 1YITA 1PSEA 3CC7T 1R0CB 1FMVA 4A53A 2P4RA 1PRLC 3HTRA 1KC8R 2H3EB 1YJ9Q 5GMKi 5GMKe 4X1VA 4KUIA 2K5IA 2RHUA 1WFWA 2K79A 1VQNT 1NJIR 2P4TA 3FDRA 3NTIA 4IUPA 1M3BA 1RACB 2IVWA 3PT9A 1M90U 1W1FA 3OYNA 2G3RA 3MEAA 5KYWB 3JV3A 4KH1B 4JRPA 2KQWA 2JJ9A 3H0IA 2DL4A 2M1HA 4LDXA 2ATCB 4AG2C 5L8RE 4YTLA 5CKBA 1JJ2A 1KIKA 4M77A 4F7UA 2OTJT 2QK0A 3THKA 5CKHA 4M77B 1RUWA 3VRYA 1I4K1 3TCJA 1VQMA 1KC8U 2LJ3A 4FIBA 4ZNXA 4OB2B 3GNFB 2EJGA 1FWZA 1WHKA 3I5RA 2HCKA 3OYEA 2XDPA 3PGGA 3QWXX 4BI3A 1K0XA 1K9MU 2EGCA 2XU8A 4II1A 2QDYB 2FHDA 3G4SA 2DERA 4FYWB 2OAUA 3GBQA 3QHSA 5LJ3d 2EQIA 4LXCA 3EGDB 2GNCA 2OX7A 3JCMV 1WHMA 3JSCA 3M0SA 3JB9D 4HCKA 1XOVA 3CCJQ 3G4SQ 1UHCA 2FPEA 1KQSP 2RJEA 5IHNA 2AIRB 2P84A 3CMEA 1D0XA 4XK8E 2E10A 4JRIA 2YWWA 5DM7R 2A08A 1E7OA 2J05A 4IUTA 4N0AA 1NEBA 1N8RU 5GAMg 1RI0A 2RA2A 2D1XA 2FO0A 1T0HA 4BI8B 2PU9B 1M1FA 1VQPA 2KE9A 2V1QA 2HNIA 2FL7A 3DLMA 1WYXA 2CP3A 1UFFA 2YRCA 3JB9J 1M4ZA 1AWJA 2FG0A 2FZKB 2KGTA 4M75D 2JN0A 3CBOA 1WHJA 2KEAA 3X24B 2QXFA 4BY6B 2Y4YA 1SSHA 3CC4Q 1NBEB 5DLOA 1KQ2A 4OMNA 2DPPB 2MMPA 1RLQC 5KYYA 2EYZA 4BE2A 2C0TA 1RAFB 2LNHB 3CCMQ 3CPWS 4PKCC 3FJPA 2K2MA 4MZTA 5CR2A 3M0RA 1VQ5T 5FRNA 1OYXA 5LJ5e 5CKFA 3CD6T 2RHIA 2H8HA 3O5ZA 1OU8A 1N5ZA 1B07A 1ZHIA 3OYIA 1KK7A 3V8JA 2D8HA 1K73C 4Q5WA 1DJ7B 1JU5C 2KR3A 4M77E 2QDLA 3A8GB 2D8JA 4A4HA 2VVKA 2E4HA 3FLGA 3A1PA 3CXCP 2LVMA 4NOYA 4XQ3A 3QDFA 1LOJA 1VQ9A 3JCMd 5KYUA 3HFNA 3BY7A 2JXBA 2FRYA 4M7AA 4XU2A 2FPFA 1ACMB 2E6NA 1EFNA 2OTJQ 1JXMA 4J7FA 1WI7A 3GP8A 1D09B 4RTUA 3UF4A 2K7AA 3SWNB 1MUZA 3C0CA 4PL6A 3PE0A 1GCQA 1K9MC 3QO3A 3H8ZA 4D8DA 4C0FA 3KXTA 2RN8A 2ZZDA 3RKWA 3EH1A 2EKOA 2G6FX 3JRZA 3CD6A 3HKSA 1I1JA 3VS5A 4M7DF 2P0PA 3EG9A 3OS1A 4X9DA 4ELZC 1UB4A 5GAN5 4J9IA 4ESRA 2RJDA 4FCYA 5EG2A 1MGQA 3LWIA 2EIFA 1OEBA 2LRQA 2M16A 1WHGA 4D6WA 1GFDA 1ZA2B 1U1TA 3CBPA 2AHJB 3LH0A 4QW2A 3RMSA 4RG8A 2VYTA 2F2VA 5HK0A 1LNXA 3H0HA 1IGQA 4ZGDB 3RUXA 2X3XD 4HT8A 1YJWQ 5EC7A
chains in the Genus database with same CATH topology
2GFUA 2VGMA 4XTYA 4ZN1A 1VQOT 3L42A 2I2LA 3JCMW 4M78E 5CO7A 5DY9A 1P92A 5LJ3h 4FT4A 4EMKA 2RI2A 4M78B 5DLQE 1BI3A 2R58A 2ZPIB 3T9NA 4RCBA 2CZ7B 3M54A 3OBYA 3TREA 1YI2A 4M7DC 1Y96B 3OYYA 4KT0E 3JCMX 2OTJA 4M77G 3G4ST 2RI3A 4QVZA 2LQ8A 5LL6S 3M4GA 3SWNA 4C92C 1K73U 5LJ5d 4EDUA 3M56A 3CBMA 5J39A 4ZTFA 2MI6A 2LCCA 2QI2A 3LGLA 4FSXA 4M75C 3MO8A 4OVAA 5GAOp 2HAXA 3OYJA 1VQNA 3HRTA 1XNIA 2YLBA 3MP6A 4XTXA 3S3NA 5I2MA 5LJ5j 1VQPT 2PQWA 4KUDK 5A0GA 2KSSA 4M77C 2RH2A 2V8KA 3EFSA 4RMOA 2IG0A 1OI1A 2ZPEB 3H6ZA 4ATOA 4M75E 2BIVA 3OW2A 2FVUA 4M75G 2DD4A 1YHQA 2KAFA 1YCYA 1KQSA 4BY6C 4C0DC 4OP0A 1KQSS 2LDMA 2EAYA 1QP3A 3RKXA 5KE2A 4EMKB 4J8OA 3BW1A 1YJNT 2EFIA 2XIDA 3G6EA 3G71A 4LDWA 3V7SA 3CXCS 3UPUA 3QXEB 3VUBA 1I81A 5GAOm 1VQ4A 4MZMA 3CXCA 2L5QA 2XG8D 1N9RA 4XU3A 1JB0E 5CK9A 2CZ1B 5GAN3 3OS0A 5AYFA 3OYFA 2K3XA 1G3SA 1NPPA 2VC8A 3M57A 3ZFJA 3KBGA 4C8QD 3QBYA 3JCMb 4PJOC 3OYGA 3PIOA 2Y4XA 1D3BB 3I56T 3QSUA 4N4IA 1Q82U 1W4SA 4CRIA 3GOXA 4L5GA 4WF2A 3JCMJ 2D6FA 1M8VA 1H3ZA 5GAN4 1BI0A 3OS5A 2LT1A 4M7AB 5C6SA 2QQRA 2O01E 2VXEA 2P0QA 4E7KA 1YJNA 4IKFA 2LNVA 1YITT 2K57A 3JCMf 3RESA 4M75F 2V8JA 4EMGA 2DVEA 4OMFB 5GMKj 3NTHA 2OTLT 1EIFA 5LJ3g 3R6OA 3QPHA 2HBPA 3MHXA 3SD4A 3ZEHA 2Y90A 1AHJB 4KULA 4X34A 5FU6C 2QQAA 3M59A 2LTOA 1ZBXA 4M77F 3VYGA 2E70A 3OY9A 1NJIU 2EJ9A 2E1HA 1WJRA 1WJSA 4IURA 4BDYA 1GXIE 4V2SA 2RM4A 2EQJA 2QEXA 4NL3A 2VV5A 4C92D 1QVGA 3OYAA 1WGSA 3URGA 3OSSC 3QDRB 4N4HA 1VQMT 1VQ8T 1K8AC 1TH7A 1N27A 1VQ9T 3INZA 1KD1U 2DO3A 1M5Q1 2RI5A 4NL2A 4PJOE 4PLIA 2E65A 3WXMB 4BB7A 3OYMA 4LDYA 2XD0A 3LW5E 3JAME 3PTAA 3PMIA 4LD9K 2DTIA 3QKJA 3JCMg 2K3YA 4VUBA 3SWNC 4C92A 5FLXE 1KHIA 5KCHA 1JJ2S 2EJFA 4PJOF 4M78C 1JBMA 3WVEB 3JB9I 2ZPBB 3MEWA 4C8QB 5A0DA 3I55A 4JLGA 2YHTA 3KUFA 4R55A 2K4YA 4XTWA 3LLRA 1YJ9A 1M9SA 3FB9A 2O4XB 1VUBA 4Y91A 2A3LA 4C92B 3S3MA 1RL2A 2JZ2A 3ME9A 1Q81C 3CCJT 2F5TX 1FXXA 2HQEA 5I2SA 4A4EA 4ZGJB 3CCJA 4XU1A 1B34A 1UGQB 1VQ5A 3WVDB 3PIPA 4BI4A 2P0KA 2DZ9A 2KY9A 3CCVT 4M7AG 3PMTA 5LJ3e 1W2BA 2JVVA 4XTZA 3UDCA 4E7IA 3E9GA 3V7CA 3SFMA 4X9CA 2QQBA 3LGFA 5GANe 3MP1A 2F69A 2HD0A 2KMTA 4C5EA 4RKUE 2RJCA 4C5HA 4F7UB 3L2UA 3QIIA 4C8QA 4PLLA 3GLXA 4M77D 2L8DA 4XAXB 2XI9A 3OYCA 4JRQA 4BUGA 3X26B 4QVCA 2OTLA 1PSFA 2VXFA 2JTFA 2O4XA 3CCSA 2GFAA 2VGNA 2R5AA 4IUUA 2QA4A 3LWHA 3HRUA 4MMLA 2ZPGB 5D6YA 1V29B 5FROA 5CKDA 2RD1A 3QYGB 4L59A 3CC7A 1YI2T 3OYKA 5M9OA 5GANf 1XQHA 4M78F 2QQSA 4HCZA 2XKOC 4L6V5 1X6OA 5D6XA 1UGPB 3QUIA 1I5LA 3CCET 4OB1B 4J6YA 3OW2S 5CQYA 3RMQA 3OYBA 2E64A 3FRNA 3A8MB 5FU7B 3RERA 5GANj 1VQ6A 3E19A 2RJFA 3OBWA 2KDSA 2LC4A 3META 4JDSA 3A5ZB 4BD3A 3SB2A 4M7DG 1Q86C 3Q1JA 5GAMj 3NTKA 3L2QA 4OB0B 4XU0A 2GQVA 4C92G 4ZN3A 2DKGA 3NFCA 3S6WA 4M78G 2PUKB 1YJ9T 1K8AU 2CGHA 2R5MA 1BKBA 4BE1A 5I21A 1YBYA 3CCMA 1FX7A 2YLCA 4HCCA 4QQDA 4M7DB 1YITA 1YIJA 1PSEA 3CC7T 1OZ2A 4A53A 4FM4B 5GAN8 1Q7YC 5GANh 1M1KU 5KE3A 1M1KC 1BI1A 2WSFE 4J6WA 1KC8C 4FT2A 1ZQ1A 4A4FA 4OGCA 5GMKi 5GMKe 4QVDA 4KUIA 1KQ1A 2K5IA 2RHUA 4MDXA 4R56A 2QQ9A 4DQ2A 3JCMc 1HK9A 3AHUA 3V7RA 1VQNT 2JUFA 2P4TA 1KHCA 3FDRA 3NTIA 2DIQA 3BDUA 3X20B 4IUPA 1M90C 2IVWA 2WSEE 3PT9A 4FL6A 4MZPA 4ELYC 3CCRT 1M90U 1QVFA 3OYNA 1D3BA 2G3RA 3QYHB 3MEAA 4EPCA 1UEBA 4LD6A 5C0MA 3JB9H 4C8QE 4JRPA 3DKMA 3VV0A 2KQWA 4EMKC 2LT4A 3VKIA 2ZGWA 4GLKA 3L2WA 3CMAA 3ER0A 5GMKh 5IT9E 2M1HA 3UT1A 4LDXA 4M7DA 2XDBA 5L8RE 1NPRA 4YTLA 3JB9G 3CPFA 2ZPFB 1NZ9A 5CKBA 1JJ2A 1SSFA 3A8OB 4M77A 1IZ6A 4GY5A 4F7UA 3JCMe 1VQ7T 4OF1A 5KH6A 2OTJT 4QQGA 2QEXT 4A4KA 4XTUA 2DZCA 5CKHA 3CCUA 4C0ZA 2X4JA 4M77B 4XTVA 1I4K1 3TCJA 1VQMA 1VQ8A 1IREB 1VQLT 1KC8U 1WNLA 3CC4T 3L2VA 2K5FA 3OSVA 3CMAT 2MWPA 3DB3A 4FIBA 3RIRA 3HRSA 4OB2B 1WPYA 2KK4A 3GNFB 2E41A 4P5NA 3UWNA 2X4WA 4B9WA 3LYIA 2EJGA 1FWZA 2R57A 2LX9A 4BACA 4M78A 3JCMQ 3OYEA 2XDPA 3VUZA 3PGGA 1QVFS 2L3RA 4HKEA 4JS5A 4BI3A 2K2VA 4JUVA 1KD1C 3M53A 2MAMA 3S3OA 1K9MU 2XU8A 3E1SA 5IAYA 4F7UE 2X4YA 4II1A 3TU4K 1YHQT 4PJOB 2QDYB 2M9UA 3M5AA 2FHDA 2XICA 3G4SA 2BKDN 1YJWT 4HA8A 2LCLA 2OAUA 3QHSA 5FU7C 5LJ3d 3CCQT 3CC2A 4E7LA 3HPWA 4M7DD 3HP9A 1JRIA 3JCMV 5J3BA 5CCAA 4C5IA 4DA4A 4E7JA 2LQKA 2A7YA 5D6WA 1NJIC 3JSCA 2DAQA 2FB7A 3JCMh 5J26A 3J81E 3JB9D 2DEQA 3CCEA 1VQOA 3N5BB 1XOVA 4M75A 4TVRA 2D0QB 2WACA 1BI2A 3V8KA 3G71T 1KG1A 4M7DE 2DD5A 2RJEA 3P8BB 1G3TA 5GMKm 5GAMd 2DXCA 4J7IA 3CMEA 3CEYA 2CYZB 4JS4A 4XK8E 3PNWC 4QQ6A 2E10A 2ZPHB 4M7AF 4JRIA 1VQKT 3M55A 1BYMA 4KBMB 4C5GA 2CZ6B 1R8OB 2DXUA 5DM7R 3LX7A 2VUBA 3M4YA 4ZTJA 4A4GA 5GANg 4IUTA 3OYDA 3RKYA 5CQXA 2RK1A 5CIUA 4N0AA 2DTHA 5GAN2 1N8RU 5GAMg 1RI0A 2DK3A 2RA2A 3M58A 4BI8B 1QP2A 3M9QA 4J6XA 2FYKA 4M75B 5KCOA 2PU9B 1W2BS 1M1FA 5CVIA 2F5KA 1VQPA 5GAOl 3MP8A 2HNIA 1Y7XA 2EWNA 2FL7A 4J5YA 3DLMA 1Q82C 2CKKA 5GANd 1WQ7A 1X01A 1UGRB 4JLIA 2WSCE 2V8IA 3JB9J 3GIBA 1M4ZA 4M75D 2JN0A 2XK0A 5GAOn 3ZBDA 1G3YA 3MEUA 3CBOA 3P8DA 3X24B 2QXFA 4BY6B 2Y4YA 4C0DB 2XHCA 5LJ5h 3OA6A 4IUQA 2PVGB 5HY6A 2GF7A 3FEOA 4UC4A 5DLOA 5GAN7 2RO0A 1KQ2A 2DPPB 2MMPA 1LJOA 2GCXA 3CCST 2EQUA 4BE2A 1VQKA 2E5QA 3FC3A 3C12A 3OB9A 5LJ3f 4J83A 3DLLA 3CPWS 4N4GA 4PKCC 3FJPA 3CCUT 4M7AC 4PJOA 1N9SA 4MZTA 5CR2A 1Q7YU 3C95A 1VQ5T 5FRNA 2CZ0B 1OYXA 1OZ3A 4C8QF 4ZGEB 5LJ5e 1N8RC 1G3WA 2B8AA 3GPLA 4O6JA 4C92E 3BDLA 4RG2A 5CKFA 4A54A 3OYLA 1NE8A 2RHIA 4Y28E 3CD6T 1O9SA 3VU3C 5CAIA 4NS5A 5FU6B 1VQ6T 1VIEA 1ZHIA 3OS2A 3OYIA 1X75C 5GAOr 2QA4T 5GAMf 1QW1A 2JNGA 3V8JA 1K73C 4Q5WA 4OGEA 1DJ7B 3A8HB 2X35A 4M77E 3A8GB 4MMKA 2PVOB 4A4HA 5GAN6 5GMKl 1VQ4T 3ASKA 4HCBA 3FLGA 3J7AF 1G5VA 4B9XA 3SDZA 3GNGA 2LVMA 2EYQA 2RHZA 4NOYA 4XQ3A 3TEEA 4C0GA 3A8LB 2HQXA 1LOJA 2PUOB 1VQ9A 3JCMd 4PJOD 3CCQA 3CC2T 3HFNA 1Q86U 3BY7A 1H641 1YJWA 1VQLA 5HK3A 4CI0C 2KVQG 3QJ6A 4M7AA 2NLUA 4N0AC 1U8RA 4LDVA 4XU2A 4JRKA 1Y07A 2E6NA 3L2ZA 4C8QG 4J7FA 4M7AD 1I8FA 3L1AA 3GP8A 4ME7A 4EMHA 2DIGA 3CCRA 1Y96A 1S72T 2MWOA 3EAEA 4E7HA 1N6AA 1S72A 2DXBA 3SWNB 3CMET 4IUVA 3GF5A 4E47A 4PL6A 3VJPA 4JJNK 4LDUA 4BE0A 3V8LA 4DOVA 4C8QC 3G7ZA 3QJYA 3PFSA 3QO3A 1K9MC 1M1GA 1BIAA 3C4SA 3H8ZA 4C0FA 3KXTA 4FU6A 5IN1A 5LJ3j 5A2QE 2ZCFB 3E9FA 1WQWA 2EQMA 5LJ5f 2K5LA 2ZZDA 4M78D 1BIBA 2QTXA 3G6ET 3MCAB 3OMGA 3JB9F 3RKWA 4OB3B 2EQKA 3I56A 3OMCA 2EKOA 1U1SA 3JRZA 2MF2A 3CD6A 4M7AE 3FIFA 3HKSA 3L2RA 3CCLT 4M7DF 2DJZA 1Y71A 2JTMA 4PNOA 3CCLA 2P0PA 1QVPA 3OQ5A 4C92F 3VYHB 1HXDA 1VIFA 4X9DA 3J80E 3OS1A 4RCCA 3JCMP 4ELZC 5CKEA 3OYHA 3I55T 3BFMA 1UB4A 5GAMe 4F7UG 5GAN5 3X28B 2RJDA 3HHTB 1QVGS 1MGQA 2DXTA 4MDWA 5EG2A 2EIFA 3DB4A 2E12A 2LRQA 3X25B 3LWIA 4BDZA 1MHNA 2M16A 2E6ZA 5A0LA 2PVDB 3P8HA 3F70A 5GAOq 3MEVA 4D6WA 1WJQA 2RHYA 3O8VA 3QZ5B 3CCMT 2RK2A 3CPWA 5FRMA 2M0OA 2X4XA 2L89A 2RHXA 3QZ9B 1U1TA 4PJOG 4DOWA 3QG1A 2YRVA 3C94A 1UGSB 3CCVA 3HL8A 3EFRA 3CBPA 5GAMh 2AHJB 3LH0A 4F7UF 1O75A 4HT9A 4QW2A 1XTDA 4O5VA 4RG8A 4Z02A 3RMSA 2VYTA 5HK0A 1LNXA 4ZGDB 3RUXA 1B34B 2CS7A 2XDDA 4HT8A 5HKCA 2D9TA 2DTOA 2H3JA 1YIJT 2C06A 2BUDA 3HSBA 2RB6A 1VQ7A 3HFOA 3CC4A 2JOYA 5LJ5g 1Q81U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTY A;  4C8Q F;  5LJ5 e;  4M77 B;  2I2L A;  4XTV A;  1I4K 1;  3JCM W;  4M78 E;  4C92 E;  5DY9 A;  4A54 A;  4XU1 A;  5LJ3 h;  1B34 A;  1WNL A;  4EMK A;  4M78 B;  3VU3 C;  5CAI A;  2DZ9 A;  4RCB A;  3RIR A;  5GAO r;  4M7A G;  1WPY A;  4M7D C;  5GAM f;  5LJ3 e;  1Y96 B;  3V8J A;  3JCM X;  2E41 A;  4M77 G;  4XTZ A;  2EJG A;  3M4G A;  3SWN A;  3V7C A;  4C92 C;  4M77 E;  4X9C A;  5GAN 6;  4MMK A;  5LJ5 d;  5GMK l;  4M78 A;  3JCM Q;  5GAN e;  5GAO p;  4M75 C;  3PGG A;  4JUV A;  4F7U B;  2YLB A;  4NOY A;  4XQ3 A;  4XTX A;  5LJ5 j;  4C8Q A;  1LOJ A;  4M77 D;  4F7U E;  3JCM d;  4M77 C;  4Y91 A;  4PJO B;  4PJO D;  4QVC A;  3EFS A;  3HFN A;  3BY7 A;  1H64 1;  2VXF A;  4M75 E;  4M7A A;  4N0A C;  4M75 G;  4HA8 A;  1YCY A;  4XU2 A;  3QHS A;  4JRK A;  5LJ3 d;  4MML A;  4OP0 A;  3L2Z A;  4M7D D;  1JRI A;  2EAY A;  3RKX A;  3JCM V;  4C8Q G;  4EMK B;  2RD1 A;  3BW1 A;  4M7A D;  1I8F A;  3L1A A;  2FB7 A;  3JCM h;  5GAN f;  4M78 F;  4EMH A;  2DEQ A;  3V7S A;  3JB9 D;  1Y96 A;  3QUI A;  1I81 A;  4M75 A;  5GAO m;  1I5L A;  4XU3 A;  4J6Y A;  1N9R A;  3SWN B;  3V8K A;  5GAN 3;  2E64 A;  3RER A;  3V8L A;  4M7D E;  5GAN j;  2VC8 A;  4C8Q C;  5GMK m;  4C8Q D;  3JCM b;  3QO3 A;  5GAM d;  4M7D G;  4PJO C;  3SB2 A;  1BIA A;  1D3B B;  5GAM j;  3QSU A;  4XU0 A;  4C92 G;  4M7A F;  2E10 A;  5LJ3 j;  1WQW A;  4JRI A;  5LJ5 f;  2DKG A;  1BIB A;  2QTX A;  4M78 D;  4WF2 A;  3JCM J;  3JB9 F;  4M78 G;  3RKW A;  1M8V A;  2CGH A;  2DXU A;  5GAN 4;  5I21 A;  2YLC A;  4M7A B;  4M7D B;  5GAN g;  2VXE A;  1U1S A;  4A53 A;  5GAN 8;  3RKY A;  5GAN h;  2K57 A;  3FIF A;  3RES A;  3JCM f;  4M7A E;  4N0A A;  2DTH A;  4M75 F;  4EMG A;  5GMK j;  2DVE A;  5GAM g;  2RA2 A;  5GAN 2;  4M7D F;  4J6W A;  5LJ3 g;  2DJZ A;  4PNO A;  5GMK i;  5GMK e;  2Y90 A;  4C92 F;  4QVD A;  1HXD A;  4J6X A;  1KQ1 A;  2FYK A;  4M75 B;  4M77 F;  4RCC A;  4X9D A;  3JCM P;  3BFM A;  5GAM e;  4DQ2 A;  4F7U G;  5GAN 5;  3JCM c;  1HK9 A;  5GAO l;  2EJ9 A;  2E1H A;  2EWN A;  2HNI A;  4J5Y A;  3V7R A;  3AHU A;  1MGQ A;  2DXT A;  2RM4 A;  4V2S A;  5GAN d;  3BDU A;  4NL3 A;  4C92 D;  1WQ7 A;  1X01 A;  3GIB A;  4JLI A;  3JB9 J;  5GAO q;  1D3B A;  1TH7 A;  4M75 D;  2JN0 A;  5GAO n;  3INZ A;  3JB9 H;  4C8Q E;  1M5Q 1;  4NL2 A;  4EMK C;  4PJO E;  2ZGW A;  2E65 A;  5GMK h;  1U1T A;  5LJ5 h;  4PJO G;  4M7D A;  3EFR A;  5GAN 7;  5GAM h;  3JB9 G;  2DTI A;  4F7U F;  1KQ2 A;  4HT9 A;  3JCM g;  1LJO A;  3SWN C;  4C92 A;  4M77 A;  4F7U A;  1LNX A;  2EJF A;  4PJO F;  4M78 C;  3JCM e;  1JBM A;  5LJ3 f;  3RUX A;  3JB9 I;  4C8Q B;  1B34 B;  4HT8 A;  4PJO A;  2YHT A;  2DTO A;  3FJP A;  4XTW A;  4XTU A;  2DZC A;  3HSB A;  4M7A C;  2RB6 A;  3HFO A;  1N9S A;  3FB9 A;  5LJ5 g;  4C92 B; 
#chains in the Genus database with same CATH topology
 2GFU A;  3L42 A;  1PC0 A;  2YUO A;  4M78 E;  1P92 A;  1UG1 A;  4FT4 A;  5DLQ E;  1WXT A;  4RCB A;  3EFO B;  5KYW A;  4KT0 E;  2HMA A;  4RTW A;  3SWN A;  5LJ5 d;  4EDU A;  3LGL A;  1VQN A;  1MMA A;  2E3I A;  3UAT A;  1LVK A;  2YLB A;  1ZUY A;  3D7S B;  4M77 C;  4RMO A;  3EFS A;  2BIV A;  3PVQ A;  3OW2 A;  2CSQ A;  4M75 G;  1YHQ A;  2KAF A;  2LDM A;  4WTO B;  1FYN A;  5KE2 A;  2EFI A;  3H9N A;  2E3H A;  2HBW A;  1VQ4 A;  1I81 A;  1Q81 R;  1HYO A;  4XU3 A;  3EGD A;  5CK9 A;  1K9M R;  1G3S A;  1QQJ A;  4C8Q D;  4F16 A;  1D3B B;  3GOX A;  2ESW A;  2O31 A;  2D6F A;  1M8V A;  5IXB A;  4IKF A;  1YIT T;  2KXC A;  3RES A;  4M75 F;  2V8J A;  1BCM A;  3NTH A;  2OTL T;  2DIL A;  2HBP A;  1YWP A;  1SHF A;  2QQA A;  3M59 A;  3OY9 A;  4FYV B;  1NYF A;  2E1H A;  1WJR A;  1CKA A;  4AFQ C;  4C92 D;  2NUZ A;  3QDR B;  2QAS A;  1KD1 U;  4NL2 A;  2RI5 A;  1U06 A;  3CQT A;  4PLI A;  2E65 A;  4BB7 A;  3EHQ A;  4E7S A;  2XD0 A;  3PMI A;  2DTI A;  3QKJ A;  4VUB A;  4PK4 A;  5FLX E;  5KCH A;  4J9H A;  1SF9 A;  3JB9 I;  3MEW A;  1GCQ C;  4JLG A;  3CC2 Q;  1I07 A;  2JM8 A;  3FB9 A;  1VUB A;  2O4X B;  2SRC A;  2KRM A;  1OV3 A;  1B34 A;  2DZ9 A;  5LJ3 e;  4E7I A;  2DX1 A;  5GAN e;  4M4Z A;  3L2U A;  4LUE A;  3QII A;  4FW1 A;  4C8Q A;  3OYC A;  2DRK A;  4JRQ A;  2ROT A;  4QVC A;  2GFA A;  2VGN A;  3LWH A;  2ZPG B;  5D6Y A;  1V29 B;  5CKD A;  3CC7 A;  2AKK A;  1AOJ A;  2LP5 A;  2GTJ A;  2QQS A;  1UGP B;  3QUI A;  1I5L A;  1KSW A;  4J6Y A;  2BZX A;  1G83 A;  2QAZ A;  1UHF A;  3OBW A;  3NGP A;  4HVW A;  4M7D G;  2HSE B;  3A5Z B;  1MNE A;  3Q1J A;  5GAM j;  1QKW A;  3L2Q A;  2HQH A;  3S6W A;  2PUK B;  1QCF A;  2VKN A;  5I21 A;  1IRX A;  1FX7 A;  1YIJ A;  1OZ2 A;  4FM4 B;  5GAN 8;  5KE3 A;  1M1K C;  1WIE A;  4QVD A;  4R56 A;  2QQ9 A;  4DQ2 A;  1UGV A;  3JCM c;  3AHU A;  3X20 B;  4MZP A;  4ELY C;  3CCR T;  3QYH B;  3MKD A;  1NEG A;  1G8X A;  2CH4 A;  4LD6 A;  5C0M A;  3DKM A;  3EGU A;  1IB8 A;  4EMK C;  4GLK A;  1M3C A;  4IIO A;  1JO8 A;  4PJL A;  1PKT A;  4M7D A;  4Z88 A;  3JB9 G;  2SEM A;  1TWB A;  1M2V B;  1YNZ A;  1YN8 A;  4CC2 A;  5KH6 A;  4ANJ A;  4QQG A;  2QEX T;  1AZE A;  1TTH B;  1VQP Q;  2JTE A;  1D1C A;  1OX8 A;  4XTV A;  1IRE B;  1VQL T;  1WNL A;  2K5F A;  2JS2 A;  2MWP A;  3DB3 A;  5AT1 B;  1WPY A;  2EPD A;  2MCN A;  3UWN A;  1AT1 B;  2LX9 A;  1PHT A;  4HKE A;  4JS5 A;  2K2V A;  4JUV A;  1KD1 C;  2W10 A;  3S3O A;  3E1S A;  1IHW A;  2X4Y A;  1UUE A;  2XIC A;  2BKD N;  4HA8 A;  2LCL A;  4PJN A;  5FU7 C;  2O2O A;  4E7L A;  3HPW A;  4M7D D;  1NJI C;  4C5I A;  2A7Y A;  2DAQ A;  2FB7 A;  4B6M A;  1UEC A;  2HEQ A;  2CP5 A;  4M75 A;  4TVR A;  4OMO A;  2LMJ A;  2DD5 A;  4J7I A;  3CEY A;  1TUG B;  1B3Q A;  1SHG A;  2KXD A;  2LZ6 B;  3M55 A;  1E6G A;  2CZ6 B;  1R8O B;  4E7Z A;  3NPF A;  5GAN g;  2CUD A;  3OYD A;  5KYY B;  2DTH A;  3EG3 A;  1OX9 A;  2OJ2 A;  2XMF A;  1PD0 A;  3M58 A;  1LCK A;  1CSK A;  1QP2 A;  3A98 A;  5KCO A;  1YP5 A;  1W2B S;  2F5K A;  3MP8 A;  1MMD A;  2EWN A;  4J5Y A;  3M0T A;  1WQ7 A;  1YWO A;  1JXO A;  3MEU A;  2QTV A;  1T0J A;  3CCU Q;  3ULR B;  5HY6 A;  3FEO A;  4UC4 A;  5GAN 7;  7AT1 B;  2GCX A;  1MV3 A;  2CH4 W;  3CCS T;  2EQU A;  1Z9Q A;  2E5Q A;  1VQK A;  1TOV A;  2HDA A;  3TQ7 P;  5LJ3 f;  4KGZ B;  1BK2 A;  4N4G A;  3CCU T;  1RAA B;  2A28 A;  1N9S A;  2QGG A;  4J9E A;  3C95 A;  1AWX A;  1K9A A;  2CZ0 B;  4C8Q F;  4ZGE B;  1N8R C;  6AT1 B;  1SRL A;  1Q95 G;  3AT1 B;  1D1A A;  3OS2 A;  1X69 A;  2QA4 T;  3UA6 A;  2I0N A;  2JNG A;  4OGE A;  3A8H B;  4F17 A;  2X35 A;  5GAN 6;  2DL3 A;  3ASK A;  4HCB A;  1IGU A;  1K0S A;  4QT7 A;  3GNG A;  2QA4 Q;  2EYQ A;  3A8L B;  2PUO B;  4PJO D;  3CCQ A;  1YJW A;  4N0A C;  4LDV A;  1UJ0 A;  4JRK A;  1AVZ C;  4PJM A;  3L2Z A;  4C8Q G;  2QEX Q;  1I8F A;  1GBQ A;  1V1C A;  2MWO A;  1WXB A;  4WCI A;  1VQL Q;  2KRS A;  3GF5 A;  4JJN K;  4BE0 A;  4LDU A;  4RTT A;  5D7U A;  3G7Z A;  1QVG P;  1BIA A;  1M1G A;  5LJ3 j;  3E9F A;  1WQW A;  4IIM A;  2K5L A;  4DBQ A;  4OB3 B;  3EG0 A;  1ZUK A;  1U1S A;  1WDX A;  2LX7 A;  4DEX A;  1Y71 A;  2JTM A;  2X9H A;  4PNO A;  4C92 F;  1VIF A;  3JCM P;  5CKE A;  3OYH A;  3I55 T;  3I56 Q;  3X25 B;  3CCM T;  1RAI B;  2E6Z A;  5A0L A;  2PVD B;  3F70 A;  1WJQ A;  2BE9 B;  2RHY A;  3QZ5 B;  2JS0 A;  5FRM A;  4Z8A A;  2RHX A;  3CD6 Q;  1TS9 A;  4DOW A;  5FWB A;  3UA7 A;  2EYY A;  1H3H A;  1MV0 B;  2JM9 A;  4Z02 A;  1XTD A;  4FSS A;  2BZY A;  2OAW A;  2CS7 A;  2YUN A;  2DTO A;  5HKC A;  2C06 A;  2DL8 A;  1SRM A;  3HSB A;  3HFO A;  3CC4 A;  3VS1 A;  4HCC A;  4PFP A;  5DY9 A;  2DVJ A;  2F1L A;  2KNB B;  4M78 B;  1BI3 A;  2ZPI B;  3T9N A;  3M54 A;  2A37 A;  1YI2 A;  1T3L A;  5ECA A;  2OTJ A;  2RI3 A;  2LQ8 A;  2CP6 A;  1K73 U;  2CDT A;  3RDV A;  4ZTF A;  3M56 A;  3CBM A;  5J39 A;  2QGF B;  4FSX A;  2HAX A;  2PQW A;  4KUD K;  2C0I A;  1Y0M A;  3H6Z A;  2F2W A;  1WLP B;  4C0D C;  1HJD A;  4J8O A;  3BW1 A;  2J6K A;  3G71 A;  4LDW A;  3VUB A;  2L5Q A;  1JB0 E;  2CZ1 B;  3OS0 A;  2AZV A;  1M8M A;  1NPP A;  1RLP C;  1I5O B;  3QBY A;  3OYG A;  3QSU A;  4JZ4 A;  1W4S A;  4CRI A;  4L5G A;  1VQ7 Q;  1W70 A;  2CP0 A;  3JCM J;  1YFN A;  1H3Z A;  3OS5 A;  4M7A B;  2FPD A;  2O01 E;  2LNV A;  2K57 A;  4RTX A;  3JCM f;  3E2U A;  4OMF B;  5GMK j;  1BU1 A;  3R6O A;  3MPU B;  1WHL A;  3MHX A;  1VQM Q;  1AHJ B;  4X34 A;  1RAB B;  3CMA Q;  2LTO A;  4DBH A;  2E70 A;  2RPN A;  1WHH A;  1T3S A;  2EJ9 A;  1WJS A;  4D8K A;  4V2S A;  2RM4 A;  2VV5 A;  4J9B A;  3URG A;  3OSS C;  2F2X A;  4N4H A;  2D0N A;  1VQM T;  1TH7 A;  2DO3 A;  1FMK A;  3TVT A;  4PJO E;  2CUB A;  1TXQ A;  3JAM E;  1PG5 B;  1E6H A;  2DMO A;  4LD9 K;  3JCM g;  4C92 A;  2RQU A;  1JJ2 S;  2EJF A;  4PJO F;  1JBM A;  5A0D A;  2YHT A;  3KUF A;  4PFZ A;  2K4Y A;  3CCV Q;  2RQR A;  3TSZ A;  4C92 B;  1RL2 A;  2JZ2 A;  3RBB B;  1Q81 C;  4KH0 B;  2F5T X;  4A4E A;  4ZGJ B;  4OMP A;  1V76 A;  4XU1 A;  1VQ5 A;  4BI4 A;  3CCV T;  4M7A G;  1W2B A;  3IQL A;  2L3S A;  2DFU A;  3V7C A;  1A0N B;  2QQB A;  3LGF A;  3MP1 A;  2F69 A;  3KFV A;  4RKU E;  4C5E A;  8ATC B;  4PLL A;  3GLX A;  2DYI A;  4OMM A;  4XAX B;  1TG0 A;  3I5S A;  2J6O A;  1QMC A;  2HSP A;  3HRU A;  4MML A;  5FRO A;  2RD1 A;  3QYG B;  4L59 A;  3VS4 A;  3OYK A;  5M9O A;  1XQH A;  4M78 F;  2XKO C;  2PZ1 A;  2GTO A;  4OB1 B;  2A36 A;  4HVU A;  1VYU A;  1C0M A;  2OTL Q;  1NM7 A;  3RER A;  5GAN j;  1VQ6 A;  4JDS A;  3EGX B;  3MET A;  4GBQ A;  4C92 G;  1W2B P;  3EH2 A;  5IXF A;  2DKG A;  2R5M A;  1BKB A;  4BE1 A;  1YBY A;  4M7D B;  4FYX B;  1Q7Y C;  5GAN h;  1Z9Z A;  1M2V A;  2EVR A;  2LJ0 A;  2YUQ A;  4OGC A;  1KQ1 A;  4MDX A;  1ZSZ A;  4F04 B;  2JMC A;  1M90 C;  2DIQ A;  3BDU A;  4HVV A;  4J9G A;  4FL6 A;  1M3A A;  3RNJ A;  1QVF A;  1IO6 A;  3L2W A;  2ZGW A;  2JMA A;  2MOX A;  2BZ8 A;  3SEM A;  2LJ1 A;  1NPR A;  4LUD A;  1NZ9 A;  3EG1 A;  2CP2 A;  1VQ7 T;  3JCM e;  1QCN A;  4XTU A;  2DZC A;  3CCU A;  1VQ8 A;  1M27 C;  2EYX A;  3OSV A;  3CMA T;  2BE7 D;  2KK4 A;  1X6G A;  2E41 A;  4P5N A;  2IIM A;  4AFU C;  2R57 A;  4BAC A;  3U23 A;  4M78 A;  2RNA A;  1UDL A;  2L3R A;  2VWF A;  3CCQ Q;  1K76 A;  2MAM A;  1HD3 A;  5IAY A;  2KYB A;  3TU4 K;  4PJO B;  3M5A A;  1YJW T;  4E2F B;  1OUL A;  3CCQ T;  3HP9 A;  1JRI A;  4DA4 A;  4E7J A;  2LQK A;  2NUP A;  5D6W A;  5KYN A;  2DEQ A;  1VQO A;  3N5B B;  2J6F A;  2DA9 A;  2D0Q B;  1BI2 A;  1X2Q A;  1KG1 A;  3P8B B;  5GMK m;  3M0P A;  2V26 A;  2CYZ B;  4JS4 A;  3PNW C;  4QQ6 A;  2ZPH B;  2DE0 X;  1VQK T;  1ZUU A;  1AEY A;  2DNU A;  4R0K A;  4C5G A;  2VUB A;  3M4Y A;  1ZSZ B;  2K9G A;  3RKY A;  5CQX A;  5CIU A;  1GBR A;  1ARK A;  3M9Q A;  1VYT A;  3TSW A;  1Y7X A;  2V1R A;  5GAN d;  2ROL A;  1JEG A;  1X01 A;  3GIB A;  1UGR B;  4JLI A;  2XK0 A;  5GAO n;  3ZBD A;  1G3Y A;  2DF6 A;  2DEU A;  3P8D A;  2O88 A;  2RQW A;  2XHC A;  4IUQ A;  1TUD A;  2PVG B;  2GF7 A;  2J06 A;  1ZLM A;  3FC3 A;  3OB9 A;  4M7A C;  1MMN A;  3NMZ C;  1VA7 A;  1Q7Y U;  1OZ3 A;  2YUP A;  2B8A A;  4A63 B;  4O6J A;  3OYL A;  4A54 A;  1N8R R;  4Y28 E;  1VQ4 Q;  1O9S A;  5FU6 B;  1QLY A;  2FZG B;  5GAM f;  1QW1 A;  4MMK A;  1B7T A;  1VQ4 T;  2L2P A;  1X43 A;  2DL5 A;  1D0Y A;  2RHZ A;  3TEE A;  2DL7 A;  2HQX A;  4JJB A;  3CC2 T;  1VYV A;  1H64 1;  2NUT A;  4CI0 C;  1S72 Q;  1MND A;  2NLU A;  3CC7 Q;  2HL3 A;  1Y07 A;  1OPL A;  3OW2 P;  1Q82 R;  4AG1 C;  4M7A D;  1W6X A;  3CCR A;  1S72 T;  3EAE A;  4E7H A;  1S72 A;  2DXB A;  2E5K A;  4E47 A;  2CT3 A;  2EW3 A;  2NYS A;  4DOV A;  1UE9 A;  3QJY A;  4AFZ C;  2COW A;  4FU6 A;  1BIB A;  2QTX A;  3JB9 F;  2EQK A;  3EGX A;  2MIO A;  5IHI A;  1SG5 A;  2JT4 A;  1U3O A;  3FIF A;  3CCL T;  2YT6 A;  2DJZ A;  3CCL A;  1QVP A;  3OQ5 A;  3VYH B;  1HXD A;  3J80 E;  4RCC A;  2QG9 B;  4F7U G;  1AZG B;  1QVG S;  4MDW A;  2DXT A;  2AZS A;  1TU0 B;  3DB4 A;  2E12 A;  2EBP A;  1BB9 A;  3P8H A;  5GAO q;  3MEV A;  3O8V A;  4LE9 A;  2L89 A;  2L0A A;  3QZ9 B;  2MPX C;  3QG1 A;  2YRV A;  3HL8 A;  3EFR A;  5GAM h;  1LPL A;  1TUC A;  4HT9 A;  1O75 A;  2FRW A;  4O5V A;  1VQK Q;  3FJ5 A;  1B34 B;  2DET A;  1QVF P;  2D9T A;  2H3J A;  1QWF A;  4XTY A;  4ZN1 A;  2I2L A;  3JCM W;  5LJ3 h;  2ABL A;  2RI2 A;  3CCR Q;  1EZZ B;  3OBY A;  3TRE A;  3OYY A;  2K3B A;  3JCM X;  4M77 G;  3G4S T;  5FW9 A;  5LL6 S;  1F1B B;  3REA B;  2LCC A;  2ED1 A;  5GAO p;  4M75 C;  3MO8 A;  3HRT A;  1AWW A;  1PNJ A;  3MP6 A;  1JJ2 P;  4XTX A;  2KSS A;  2RH2 A;  2KT8 A;  2V8K A;  2IG0 A;  2ZPE B;  4J9D A;  2Z0W A;  1X2K A;  1GFC A;  2DD4 A;  1YCY A;  4DEY A;  4E6R A;  5IH2 A;  5HCK A;  4BY6 C;  4OP0 A;  2EAY A;  1QP3 A;  3RKX A;  4EMK B;  3G6E A;  1H92 A;  3V7S A;  3CXC S;  3UPU A;  1K8A R;  3CXC A;  1N9R A;  5GAN 3;  2COY A;  5AYF A;  3OYF A;  2VC8 A;  4GLM A;  2AKL A;  3M57 A;  3ZFJ A;  3KBG A;  3JCM b;  3I55 Q;  3I56 T;  1Q82 U;  2A0F B;  8AT1 B;  1YI2 Q;  2X51 A;  1BI0 A;  1D1B A;  1WX6 A;  5C6S A;  2QQR A;  1YJN A;  2P0Q A;  4EMG A;  2DVE A;  4RTV A;  5LJ3 g;  4DBF A;  2X3W D;  3SD4 A;  3ZEH A;  2Y90 A;  2DBK A;  4KUL A;  5FU6 C;  1C1A A;  1ZBX A;  1NJI U;  4IUR A;  1Y57 A;  2EQJ A;  2QEX A;  4NL3 A;  3VRZ A;  4LNP A;  3VS7 A;  1QVG A;  1TSF A;  1K8A C;  3INZ A;  2HZY A;  3OYM A;  3LW5 E;  1K4U S;  2HKN A;  3SWN C;  3G1J A;  1KHI A;  4M78 C;  3WVE B;  4C8Q B;  2ECZ A;  5KYU B;  4R55 A;  2M0Y A;  4Y91 A;  1HSQ A;  2A3L A;  4PJJ A;  1PKS A;  3ME9 A;  3NHN A;  4PFO A;  5I2S A;  3CCL Q;  1UGQ B;  4KGV B;  2P0K A;  2KY9 A;  1J3T A;  3RR6 A;  2JVV A;  1ZSZ C;  4XTZ A;  2CP7 A;  5FWC A;  4X9C A;  3ZL7 C;  2HD0 A;  2KMT A;  1PRM C;  2AT1 B;  4C5H A;  1KD1 R;  4M77 D;  2XI9 A;  3X26 B;  2CT4 A;  2OTL A;  1PSF A;  2VXF A;  5GJV B;  2O4X A;  1K1Z A;  2R5A A;  2PTK A;  4IUU A;  2QA4 A;  5IHK A;  5GAN f;  4HCZ A;  4L6V 5;  4CC3 A;  5D6X A;  1GRI A;  3OW2 S;  5CQY A;  3RMQ A;  3OYB A;  2E64 A;  3A8M B;  3E19 A;  4CC7 A;  2RJF A;  2KDS A;  4BD3 A;  1AWO A;  1UTI A;  3NTK A;  2HL5 C;  2W0Z A;  4ZN3 A;  3NFC A;  3VS0 A;  4M78 G;  1K8A U;  4QQD A;  4FYY B;  1M1K U;  1BI1 A;  2WSF E;  4J6W A;  1KC8 C;  4FT2 A;  1ZQ1 A;  4A4F A;  2DLP A;  1HK9 A;  3V7R A;  2QYZ A;  2JUF A;  1KHC A;  1KFZ A;  1H8K A;  2WSE E;  2OI3 A;  1RAH B;  1ZA1 B;  1D3B A;  2LQN A;  4EPC A;  2AK5 A;  1UEB A;  3JB9 H;  4C8Q E;  3VV0 A;  2LT4 A;  3VKI A;  3CMA A;  2L3Q A;  3ER0 A;  5GMK h;  5IT9 E;  3UT1 A;  2KI7 A;  3CPF A;  2ZPF B;  3M0Q A;  1SSF A;  3A8O B;  1IZ6 A;  4GY5 A;  4OF1 A;  3BE3 A;  4A4K A;  1SKU B;  1ZSG A;  1JQQ A;  2DJQ A;  2FEI A;  4C0Z A;  2X4J A;  4DBR A;  3I9Q A;  2M51 A;  3CME Q;  3CC4 T;  3L2V A;  1AD5 A;  3RIR A;  3HRS A;  1Q86 R;  2X4W A;  4B9W A;  2J7I A;  3LYI A;  4JJD A;  3G6E Q;  4HXJ A;  1X27 A;  3JCM Q;  3VUZ A;  1QVF S;  1VQ5 Q;  4LN2 A;  3M53 A;  4CC4 B;  3I35 A;  4F7U E;  2MK5 A;  1YHQ T;  4EIK A;  2M9U A;  1UJY A;  4JPB W;  3CC2 A;  1YIT Q;  3G71 Q;  5J3B A;  5CCA A;  1YHQ Q;  3JCM h;  5J26 A;  3J81 E;  3CCE A;  2MYS A;  2CRE A;  2WAC A;  4QKU A;  3V8K A;  3G71 T;  4M7D E;  1G3T A;  5GAM d;  2DXC A;  4KGX B;  2CSI A;  4M7A F;  2RQT A;  1BYM A;  2ED0 A;  4KBM B;  2DXU A;  3VS2 A;  3LX7 A;  4ZTJ A;  4A4G A;  2RK1 A;  5GAN 2;  2DK3 A;  4AFS C;  1GL5 A;  1M30 A;  3VS6 A;  4J6X A;  2FYK A;  4M75 B;  4ORZ A;  5CVI A;  5GAO l;  5GJW B;  1Q82 C;  2CKK A;  2WSC E;  2V8I A;  2IPO B;  2RMO A;  1NLO C;  5LJ5 h;  2O9V A;  4C0D B;  1WXU A;  3OA6 A;  1WA7 A;  2RO0 A;  1LJO A;  1NG2 A;  3C12 A;  3PVL A;  4J83 A;  3DLL A;  4PJO A;  2NWM A;  1Q81 U;  3EFO A;  2BTT A;  3R6N A;  2C0O A;  2RQV A;  1G3W A;  3GPL A;  2B86 A;  4C92 E;  3BDL A;  4RG2 A;  1NE8 A;  3VS3 A;  3VU3 C;  2NUP B;  5CAI A;  4NS5 A;  1C6V X;  1VQ6 T;  1VIE A;  1X75 C;  5GAO r;  1GCP A;  1OU9 A;  4Y92 A;  2PVO B;  5GMK l;  5KYX B;  1D0Z A;  3J7A F;  1VOM A;  1G5V A;  4B9X A;  3SDZ A;  1VQ6 Q;  9ATC B;  3QWY A;  4C0G A;  3M0U A;  4OMQ A;  1RAE B;  1X6B A;  1Q86 U;  1IXD A;  3H0F A;  1QKX A;  1VQL A;  5HK3 A;  2KVQ G;  3QJ6 A;  1U8R A;  2KYM A;  3L1A A;  2O9S A;  5L23 A;  4ME7 A;  4EMH A;  2DIG A;  1Y96 A;  1WZO A;  1N6A A;  1VQ9 Q;  3CME T;  4IUV A;  3VJP A;  3V8L A;  4C8Q C;  2YXY A;  3PFS A;  3C4S A;  5IN1 A;  2VB6 A;  5A2Q E;  2ZCF B;  1OPK A;  2EQM A;  5LJ5 f;  4M78 D;  3G6E T;  1M90 R;  3MCA B;  3OMG A;  3I56 A;  3OMC A;  2MF2 A;  4M7A E;  3EHR A;  3L2R A;  1VQP T;  3BFM A;  5GAM e;  2YDL A;  1K73 R;  1R0B G;  3X28 B;  3HHT B;  2KT1 A;  2GQI A;  4KRT A;  1PM3 A;  4BDZ A;  1MHN A;  3EG9 B;  3H41 A;  3CPW P;  3EG2 A;  2RK2 A;  3CPW A;  2M0O A;  1S1N A;  1I0C A;  2X4X A;  4JJC A;  4RTY A;  1M1K R;  4PJO G;  2KRO A;  3C94 A;  1YIJ Q;  1UGS B;  5KYX A;  3CCV A;  2JW4 A;  1XJW B;  4F7U F;  3SHW A;  2DRM A;  1OQK A;  1G2B A;  2XDD A;  2K6D A;  1YIJ T;  2BUD A;  2RB6 A;  1VQ7 A;  2KRN A;  2ZAE A;  2JOY A;  5LJ5 g;  2VGM A;  1VQO T;  5CO7 A;  1ZX6 A;  1RAD B;  2EGE A;  2VAS A;  4EMK A;  2R58 A;  2CZ7 B;  2FZC B;  1IHV A;  3REB B;  4M7D C;  1Y96 B;  4QVZ A;  1VQO Q;  3M4G A;  4C92 C;  1BCO A;  1MMG A;  2COZ A;  2MI6 A;  2QI2 A;  4OVA A;  2YSQ A;  3OYJ A;  1XNI A;  3S3N A;  5I2M A;  5LJ5 j;  1ABQ A;  1FMW A;  5A0G A;  1YJN Q;  1OI1 A;  4ATO A;  4M75 E;  2FVU A;  1KQS A;  2DM1 A;  1KQS S;  1VQN Q;  1YJN T;  2XID A;  2ENM A;  2NUT B;  1SEM A;  3QXE B;  5GAO m;  4MZM A;  2XG8 D;  1PD1 A;  2K3X A;  4PJO C;  3PIO A;  2Y4X A;  4N4I A;  5I11 A;  4WF2 A;  2RF0 A;  5GAN 4;  3LH5 A;  2LT1 A;  2DBM A;  2VXE A;  4E7K A;  1KJW A;  3CCS Q;  1EIF A;  1ZBJ A;  3QPH A;  2EYW A;  1VQ8 Q;  2LCS A;  1YCS B;  4M77 F;  1NYG A;  3VYG A;  1EX4 A;  4BDY A;  2EGA A;  1GXI E;  4RUG A;  2GGR A;  1WGS A;  2PNI A;  3OYA A;  4Z89 A;  1Q7Y R;  2LQW A;  1VQ8 T;  1N27 A;  2GBQ A;  1VQ9 T;  1M5Q 1;  3WXM B;  4LDY A;  3PTA A;  4RTZ A;  5I22 A;  2K3Y A;  4AT1 B;  2KBT A;  4F14 A;  1RI9 A;  2EKH A;  2ZPB B;  3I55 A;  1PCX A;  4XTW A;  3LLR A;  1R77 A;  1YJ9 A;  1M9S A;  2M02 A;  3S3M A;  2XDB A;  3CCJ T;  2HQE A;  1FXX A;  3CCJ A;  1QWE A;  3WVD B;  2YRD A;  4AMC A;  3PIP A;  3PMT A;  3UDC A;  3E9G A;  3SFM A;  1SPK A;  4OML A;  2RJC A;  4F7U B;  2DYB A;  1NLP C;  1U5S A;  4J9C A;  2L8D A;  4BUG A;  2HKQ B;  2JTF A;  1RAG B;  4J9F A;  3CCS A;  1ABO A;  1YI2 T;  4JZ3 A;  2L3P A;  1X6O A;  3CCE T;  1OOT A;  5FU7 B;  3FRN A;  1BBZ A;  2LC4 A;  1PWT A;  3SB2 A;  1M2O A;  1Q86 C;  4OB0 B;  4XU0 A;  2GQV A;  3CCE Q;  4FW2 A;  1QCO A;  1YJ9 T;  3MJX A;  2CGH A;  4K11 A;  3CCM A;  1CKB A;  2YLC A;  1YIT A;  1PSE A;  3CC7 T;  1R0C B;  1FMV A;  4A53 A;  2P4R A;  1PRL C;  3HTR A;  1KC8 R;  2H3E B;  1YJ9 Q;  5GMK i;  5GMK e;  4X1V A;  4KUI A;  2K5I A;  2RHU A;  1WFW A;  2K79 A;  1VQN T;  1NJI R;  2P4T A;  3FDR A;  3NTI A;  4IUP A;  1M3B A;  1RAC B;  2IVW A;  3PT9 A;  1M90 U;  1W1F A;  3OYN A;  2G3R A;  3MEA A;  5KYW B;  3JV3 A;  4KH1 B;  4JRP A;  2KQW A;  2JJ9 A;  3H0I A;  2DL4 A;  2M1H A;  4LDX A;  2ATC B;  4AG2 C;  5L8R E;  4YTL A;  5CKB A;  1JJ2 A;  1KIK A;  4M77 A;  4F7U A;  2OTJ T;  2QK0 A;  3THK A;  5CKH A;  4M77 B;  1RUW A;  3VRY A;  1I4K 1;  3TCJ A;  1VQM A;  1KC8 U;  2LJ3 A;  4FIB A;  4ZNX A;  4OB2 B;  3GNF B;  2EJG A;  1FWZ A;  1WHK A;  3I5R A;  2HCK A;  3OYE A;  2XDP A;  3PGG A;  3QWX X;  4BI3 A;  1K0X A;  1K9M U;  2EGC A;  2XU8 A;  4II1 A;  2QDY B;  2FHD A;  3G4S A;  2DER A;  4FYW B;  2OAU A;  3GBQ A;  3QHS A;  5LJ3 d;  2EQI A;  4LXC A;  3EGD B;  2GNC A;  2OX7 A;  3JCM V;  1WHM A;  3JSC A;  3M0S A;  3JB9 D;  4HCK A;  1XOV A;  3CCJ Q;  3G4S Q;  1UHC A;  2FPE A;  1KQS P;  2RJE A;  5IHN A;  2AIR B;  2P84 A;  3CME A;  1D0X A;  4XK8 E;  2E10 A;  4JRI A;  2YWW A;  5DM7 R;  2A08 A;  1E7O A;  2J05 A;  4IUT A;  4N0A A;  1NEB A;  1N8R U;  5GAM g;  1RI0 A;  2RA2 A;  2D1X A;  2FO0 A;  1T0H A;  4BI8 B;  2PU9 B;  1M1F A;  1VQP A;  2KE9 A;  2V1Q A;  2HNI A;  2FL7 A;  3DLM A;  1WYX A;  2CP3 A;  1UFF A;  2YRC A;  3JB9 J;  1M4Z A;  1AWJ A;  2FG0 A;  2FZK B;  2KGT A;  4M75 D;  2JN0 A;  3CBO A;  1WHJ A;  2KEA A;  3X24 B;  2QXF A;  4BY6 B;  2Y4Y A;  1SSH A;  3CC4 Q;  1NBE B;  5DLO A;  1KQ2 A;  4OMN A;  2DPP B;  2MMP A;  1RLQ C;  5KYY A;  2EYZ A;  4BE2 A;  2C0T A;  1RAF B;  2LNH B;  3CCM Q;  3CPW S;  4PKC C;  3FJP A;  2K2M A;  4MZT A;  5CR2 A;  3M0R A;  1VQ5 T;  5FRN A;  1OYX A;  5LJ5 e;  5CKF A;  3CD6 T;  2RHI A;  2H8H A;  3O5Z A;  1OU8 A;  1N5Z A;  1B07 A;  1ZHI A;  3OYI A;  1KK7 A;  3V8J A;  2D8H A;  1K73 C;  4Q5W A;  1DJ7 B;  1JU5 C;  2KR3 A;  4M77 E;  2QDL A;  3A8G B;  2D8J A;  4A4H A;  2VVK A;  2E4H A;  3FLG A;  3A1P A;  3CXC P;  2LVM A;  4NOY A;  4XQ3 A;  3QDF A;  1LOJ A;  1VQ9 A;  3JCM d;  5KYU A;  3HFN A;  3BY7 A;  2JXB A;  2FRY A;  4M7A A;  4XU2 A;  2FPF A;  1ACM B;  2E6N A;  1EFN A;  2OTJ Q;  1JXM A;  4J7F A;  1WI7 A;  3GP8 A;  1D09 B;  4RTU A;  3UF4 A;  2K7A A;  3SWN B;  1MUZ A;  3C0C A;  4PL6 A;  3PE0 A;  1GCQ A;  1K9M C;  3QO3 A;  3H8Z A;  4D8D A;  4C0F A;  3KXT A;  2RN8 A;  2ZZD A;  3RKW A;  3EH1 A;  2EKO A;  2G6F X;  3JRZ A;  3CD6 A;  3HKS A;  1I1J A;  3VS5 A;  4M7D F;  2P0P A;  3EG9 A;  3OS1 A;  4X9D A;  4ELZ C;  1UB4 A;  5GAN 5;  4J9I A;  4ESR A;  2RJD A;  4FCY A;  5EG2 A;  1MGQ A;  3LWI A;  2EIF A;  1OEB A;  2LRQ A;  2M16 A;  1WHG A;  4D6W A;  1GFD A;  1ZA2 B;  1U1T A;  3CBP A;  2AHJ B;  3LH0 A;  4QW2 A;  3RMS A;  4RG8 A;  2VYT A;  2F2V A;  5HK0 A;  1LNX A;  3H0H A;  1IGQ A;  4ZGD B;  3RUX A;  2X3X D;  4HT8 A;  1YJW Q;  5EC7 A; 
#chains in the Genus database with same CATH homology
 2GFU A;  2VGM A;  4XTY A;  4ZN1 A;  1VQO T;  3L42 A;  2I2L A;  3JCM W;  4M78 E;  5CO7 A;  5DY9 A;  1P92 A;  5LJ3 h;  4FT4 A;  4EMK A;  2RI2 A;  4M78 B;  5DLQ E;  1BI3 A;  2R58 A;  2ZPI B;  3T9N A;  4RCB A;  2CZ7 B;  3M54 A;  3OBY A;  3TRE A;  1YI2 A;  4M7D C;  1Y96 B;  3OYY A;  4KT0 E;  3JCM X;  2OTJ A;  4M77 G;  3G4S T;  2RI3 A;  4QVZ A;  2LQ8 A;  5LL6 S;  3M4G A;  3SWN A;  4C92 C;  1K73 U;  5LJ5 d;  4EDU A;  3M56 A;  3CBM A;  5J39 A;  4ZTF A;  2MI6 A;  2LCC A;  2QI2 A;  3LGL A;  4FSX A;  4M75 C;  3MO8 A;  4OVA A;  5GAO p;  2HAX A;  3OYJ A;  1VQN A;  3HRT A;  1XNI A;  2YLB A;  3MP6 A;  4XTX A;  3S3N A;  5I2M A;  5LJ5 j;  1VQP T;  2PQW A;  4KUD K;  5A0G A;  2KSS A;  4M77 C;  2RH2 A;  2V8K A;  3EFS A;  4RMO A;  2IG0 A;  1OI1 A;  2ZPE B;  3H6Z A;  4ATO A;  4M75 E;  2BIV A;  3OW2 A;  2FVU A;  4M75 G;  2DD4 A;  1YHQ A;  2KAF A;  1YCY A;  1KQS A;  4BY6 C;  4C0D C;  4OP0 A;  1KQS S;  2LDM A;  2EAY A;  1QP3 A;  3RKX A;  5KE2 A;  4EMK B;  4J8O A;  3BW1 A;  1YJN T;  2EFI A;  2XID A;  3G6E A;  3G71 A;  4LDW A;  3V7S A;  3CXC S;  3UPU A;  3QXE B;  3VUB A;  1I81 A;  5GAO m;  1VQ4 A;  4MZM A;  3CXC A;  2L5Q A;  2XG8 D;  1N9R A;  4XU3 A;  1JB0 E;  5CK9 A;  2CZ1 B;  5GAN 3;  3OS0 A;  5AYF A;  3OYF A;  2K3X A;  1G3S A;  1NPP A;  2VC8 A;  3M57 A;  3ZFJ A;  3KBG A;  4C8Q D;  3QBY A;  3JCM b;  4PJO C;  3OYG A;  3PIO A;  2Y4X A;  1D3B B;  3I56 T;  3QSU A;  4N4I A;  1Q82 U;  1W4S A;  4CRI A;  3GOX A;  4L5G A;  4WF2 A;  3JCM J;  2D6F A;  1M8V A;  1H3Z A;  5GAN 4;  1BI0 A;  3OS5 A;  2LT1 A;  4M7A B;  5C6S A;  2QQR A;  2O01 E;  2VXE A;  2P0Q A;  4E7K A;  1YJN A;  4IKF A;  2LNV A;  1YIT T;  2K57 A;  3JCM f;  3RES A;  4M75 F;  2V8J A;  4EMG A;  2DVE A;  4OMF B;  5GMK j;  3NTH A;  2OTL T;  1EIF A;  5LJ3 g;  3R6O A;  3QPH A;  2HBP A;  3MHX A;  3SD4 A;  3ZEH A;  2Y90 A;  1AHJ B;  4KUL A;  4X34 A;  5FU6 C;  2QQA A;  3M59 A;  2LTO A;  1ZBX A;  4M77 F;  3VYG A;  2E70 A;  3OY9 A;  1NJI U;  2EJ9 A;  2E1H A;  1WJR A;  1WJS A;  4IUR A;  4BDY A;  1GXI E;  4V2S A;  2RM4 A;  2EQJ A;  2QEX A;  4NL3 A;  2VV5 A;  4C92 D;  1QVG A;  3OYA A;  1WGS A;  3URG A;  3OSS C;  3QDR B;  4N4H A;  1VQM T;  1VQ8 T;  1K8A C;  1TH7 A;  1N27 A;  1VQ9 T;  3INZ A;  1KD1 U;  2DO3 A;  1M5Q 1;  2RI5 A;  4NL2 A;  4PJO E;  4PLI A;  2E65 A;  3WXM B;  4BB7 A;  3OYM A;  4LDY A;  2XD0 A;  3LW5 E;  3JAM E;  3PTA A;  3PMI A;  4LD9 K;  2DTI A;  3QKJ A;  3JCM g;  2K3Y A;  4VUB A;  3SWN C;  4C92 A;  5FLX E;  1KHI A;  5KCH A;  1JJ2 S;  2EJF A;  4PJO F;  4M78 C;  1JBM A;  3WVE B;  3JB9 I;  2ZPB B;  3MEW A;  4C8Q B;  5A0D A;  3I55 A;  4JLG A;  2YHT A;  3KUF A;  4R55 A;  2K4Y A;  4XTW A;  3LLR A;  1YJ9 A;  1M9S A;  3FB9 A;  2O4X B;  1VUB A;  4Y91 A;  2A3L A;  4C92 B;  3S3M A;  1RL2 A;  2JZ2 A;  3ME9 A;  1Q81 C;  3CCJ T;  2F5T X;  1FXX A;  2HQE A;  5I2S A;  4A4E A;  4ZGJ B;  3CCJ A;  4XU1 A;  1B34 A;  1UGQ B;  1VQ5 A;  3WVD B;  3PIP A;  4BI4 A;  2P0K A;  2DZ9 A;  2KY9 A;  3CCV T;  4M7A G;  3PMT A;  5LJ3 e;  1W2B A;  2JVV A;  4XTZ A;  3UDC A;  4E7I A;  3E9G A;  3V7C A;  3SFM A;  4X9C A;  2QQB A;  3LGF A;  5GAN e;  3MP1 A;  2F69 A;  2HD0 A;  2KMT A;  4C5E A;  4RKU E;  2RJC A;  4C5H A;  4F7U B;  3L2U A;  3QII A;  4C8Q A;  4PLL A;  3GLX A;  4M77 D;  2L8D A;  4XAX B;  2XI9 A;  3OYC A;  4JRQ A;  4BUG A;  3X26 B;  4QVC A;  2OTL A;  1PSF A;  2VXF A;  2JTF A;  2O4X A;  3CCS A;  2GFA A;  2VGN A;  2R5A A;  4IUU A;  2QA4 A;  3LWH A;  3HRU A;  4MML A;  2ZPG B;  5D6Y A;  1V29 B;  5FRO A;  5CKD A;  2RD1 A;  3QYG B;  4L59 A;  3CC7 A;  1YI2 T;  3OYK A;  5M9O A;  5GAN f;  1XQH A;  4M78 F;  2QQS A;  4HCZ A;  2XKO C;  4L6V 5;  1X6O A;  5D6X A;  1UGP B;  3QUI A;  1I5L A;  3CCE T;  4OB1 B;  4J6Y A;  3OW2 S;  5CQY A;  3RMQ A;  3OYB A;  2E64 A;  3FRN A;  3A8M B;  5FU7 B;  3RER A;  5GAN j;  1VQ6 A;  3E19 A;  2RJF A;  3OBW A;  2KDS A;  2LC4 A;  3MET A;  4JDS A;  3A5Z B;  4BD3 A;  3SB2 A;  4M7D G;  1Q86 C;  3Q1J A;  5GAM j;  3NTK A;  3L2Q A;  4OB0 B;  4XU0 A;  2GQV A;  4C92 G;  4ZN3 A;  2DKG A;  3NFC A;  3S6W A;  4M78 G;  2PUK B;  1YJ9 T;  1K8A U;  2CGH A;  2R5M A;  1BKB A;  4BE1 A;  5I21 A;  1YBY A;  3CCM A;  1FX7 A;  2YLC A;  4HCC A;  4QQD A;  4M7D B;  1YIT A;  1YIJ A;  1PSE A;  3CC7 T;  1OZ2 A;  4A53 A;  4FM4 B;  5GAN 8;  1Q7Y C;  5GAN h;  1M1K U;  5KE3 A;  1M1K C;  1BI1 A;  2WSF E;  4J6W A;  1KC8 C;  4FT2 A;  1ZQ1 A;  4A4F A;  4OGC A;  5GMK i;  5GMK e;  4QVD A;  4KUI A;  1KQ1 A;  2K5I A;  2RHU A;  4MDX A;  4R56 A;  2QQ9 A;  4DQ2 A;  3JCM c;  1HK9 A;  3AHU A;  3V7R A;  1VQN T;  2JUF A;  2P4T A;  1KHC A;  3FDR A;  3NTI A;  2DIQ A;  3BDU A;  3X20 B;  4IUP A;  1M90 C;  2IVW A;  2WSE E;  3PT9 A;  4FL6 A;  4MZP A;  4ELY C;  3CCR T;  1M90 U;  1QVF A;  3OYN A;  1D3B A;  2G3R A;  3QYH B;  3MEA A;  4EPC A;  1UEB A;  4LD6 A;  5C0M A;  3JB9 H;  4C8Q E;  4JRP A;  3DKM A;  3VV0 A;  2KQW A;  4EMK C;  2LT4 A;  3VKI A;  2ZGW A;  4GLK A;  3L2W A;  3CMA A;  3ER0 A;  5GMK h;  5IT9 E;  2M1H A;  3UT1 A;  4LDX A;  4M7D A;  2XDB A;  5L8R E;  1NPR A;  4YTL A;  3JB9 G;  3CPF A;  2ZPF B;  1NZ9 A;  5CKB A;  1JJ2 A;  1SSF A;  3A8O B;  4M77 A;  1IZ6 A;  4GY5 A;  4F7U A;  3JCM e;  1VQ7 T;  4OF1 A;  5KH6 A;  2OTJ T;  4QQG A;  2QEX T;  4A4K A;  4XTU A;  2DZC A;  5CKH A;  3CCU A;  4C0Z A;  2X4J A;  4M77 B;  4XTV A;  1I4K 1;  3TCJ A;  1VQM A;  1VQ8 A;  1IRE B;  1VQL T;  1KC8 U;  1WNL A;  3CC4 T;  3L2V A;  2K5F A;  3OSV A;  3CMA T;  2MWP A;  3DB3 A;  4FIB A;  3RIR A;  3HRS A;  4OB2 B;  1WPY A;  2KK4 A;  3GNF B;  2E41 A;  4P5N A;  3UWN A;  2X4W A;  4B9W A;  3LYI A;  2EJG A;  1FWZ A;  2R57 A;  2LX9 A;  4BAC A;  4M78 A;  3JCM Q;  3OYE A;  2XDP A;  3VUZ A;  3PGG A;  1QVF S;  2L3R A;  4HKE A;  4JS5 A;  4BI3 A;  2K2V A;  4JUV A;  1KD1 C;  3M53 A;  2MAM A;  3S3O A;  1K9M U;  2XU8 A;  3E1S A;  5IAY A;  4F7U E;  2X4Y A;  4II1 A;  3TU4 K;  1YHQ T;  4PJO B;  2QDY B;  2M9U A;  3M5A A;  2FHD A;  2XIC A;  3G4S A;  2BKD N;  1YJW T;  4HA8 A;  2LCL A;  2OAU A;  3QHS A;  5FU7 C;  5LJ3 d;  3CCQ T;  3CC2 A;  4E7L A;  3HPW A;  4M7D D;  3HP9 A;  1JRI A;  3JCM V;  5J3B A;  5CCA A;  4C5I A;  4DA4 A;  4E7J A;  2LQK A;  2A7Y A;  5D6W A;  1NJI C;  3JSC A;  2DAQ A;  2FB7 A;  3JCM h;  5J26 A;  3J81 E;  3JB9 D;  2DEQ A;  3CCE A;  1VQO A;  3N5B B;  1XOV A;  4M75 A;  4TVR A;  2D0Q B;  2WAC A;  1BI2 A;  3V8K A;  3G71 T;  1KG1 A;  4M7D E;  2DD5 A;  2RJE A;  3P8B B;  1G3T A;  5GMK m;  5GAM d;  2DXC A;  4J7I A;  3CME A;  3CEY A;  2CYZ B;  4JS4 A;  4XK8 E;  3PNW C;  4QQ6 A;  2E10 A;  2ZPH B;  4M7A F;  4JRI A;  1VQK T;  3M55 A;  1BYM A;  4KBM B;  4C5G A;  2CZ6 B;  1R8O B;  2DXU A;  5DM7 R;  3LX7 A;  2VUB A;  3M4Y A;  4ZTJ A;  4A4G A;  5GAN g;  4IUT A;  3OYD A;  3RKY A;  5CQX A;  2RK1 A;  5CIU A;  4N0A A;  2DTH A;  5GAN 2;  1N8R U;  5GAM g;  1RI0 A;  2DK3 A;  2RA2 A;  3M58 A;  4BI8 B;  1QP2 A;  3M9Q A;  4J6X A;  2FYK A;  4M75 B;  5KCO A;  2PU9 B;  1W2B S;  1M1F A;  5CVI A;  2F5K A;  1VQP A;  5GAO l;  3MP8 A;  2HNI A;  1Y7X A;  2EWN A;  2FL7 A;  4J5Y A;  3DLM A;  1Q82 C;  2CKK A;  5GAN d;  1WQ7 A;  1X01 A;  1UGR B;  4JLI A;  2WSC E;  2V8I A;  3JB9 J;  3GIB A;  1M4Z A;  4M75 D;  2JN0 A;  2XK0 A;  5GAO n;  3ZBD A;  1G3Y A;  3MEU A;  3CBO A;  3P8D A;  3X24 B;  2QXF A;  4BY6 B;  2Y4Y A;  4C0D B;  2XHC A;  5LJ5 h;  3OA6 A;  4IUQ A;  2PVG B;  5HY6 A;  2GF7 A;  3FEO A;  4UC4 A;  5DLO A;  5GAN 7;  2RO0 A;  1KQ2 A;  2DPP B;  2MMP A;  1LJO A;  2GCX A;  3CCS T;  2EQU A;  4BE2 A;  1VQK A;  2E5Q A;  3FC3 A;  3C12 A;  3OB9 A;  5LJ3 f;  4J83 A;  3DLL A;  3CPW S;  4N4G A;  4PKC C;  3FJP A;  3CCU T;  4M7A C;  4PJO A;  1N9S A;  4MZT A;  5CR2 A;  1Q7Y U;  3C95 A;  1VQ5 T;  5FRN A;  2CZ0 B;  1OYX A;  1OZ3 A;  4C8Q F;  4ZGE B;  5LJ5 e;  1N8R C;  1G3W A;  2B8A A;  3GPL A;  4O6J A;  4C92 E;  3BDL A;  4RG2 A;  5CKF A;  4A54 A;  3OYL A;  1NE8 A;  2RHI A;  4Y28 E;  3CD6 T;  1O9S A;  3VU3 C;  5CAI A;  4NS5 A;  5FU6 B;  1VQ6 T;  1VIE A;  1ZHI A;  3OS2 A;  3OYI A;  1X75 C;  5GAO r;  2QA4 T;  5GAM f;  1QW1 A;  2JNG A;  3V8J A;  1K73 C;  4Q5W A;  4OGE A;  1DJ7 B;  3A8H B;  2X35 A;  4M77 E;  3A8G B;  4MMK A;  2PVO B;  4A4H A;  5GAN 6;  5GMK l;  1VQ4 T;  3ASK A;  4HCB A;  3FLG A;  3J7A F;  1G5V A;  4B9X A;  3SDZ A;  3GNG A;  2LVM A;  2EYQ A;  2RHZ A;  4NOY A;  4XQ3 A;  3TEE A;  4C0G A;  3A8L B;  2HQX A;  1LOJ A;  2PUO B;  1VQ9 A;  3JCM d;  4PJO D;  3CCQ A;  3CC2 T;  3HFN A;  1Q86 U;  3BY7 A;  1H64 1;  1YJW A;  1VQL A;  5HK3 A;  4CI0 C;  2KVQ G;  3QJ6 A;  4M7A A;  2NLU A;  4N0A C;  1U8R A;  4LDV A;  4XU2 A;  4JRK A;  1Y07 A;  2E6N A;  3L2Z A;  4C8Q G;  4J7F A;  4M7A D;  1I8F A;  3L1A A;  3GP8 A;  4ME7 A;  4EMH A;  2DIG A;  3CCR A;  1Y96 A;  1S72 T;  2MWO A;  3EAE A;  4E7H A;  1N6A A;  1S72 A;  2DXB A;  3SWN B;  3CME T;  4IUV A;  3GF5 A;  4E47 A;  4PL6 A;  3VJP A;  4JJN K;  4LDU A;  4BE0 A;  3V8L A;  4DOV A;  4C8Q C;  3G7Z A;  3QJY A;  3PFS A;  3QO3 A;  1K9M C;  1M1G A;  1BIA A;  3C4S A;  3H8Z A;  4C0F A;  3KXT A;  4FU6 A;  5IN1 A;  5LJ3 j;  5A2Q E;  2ZCF B;  3E9F A;  1WQW A;  2EQM A;  5LJ5 f;  2K5L A;  2ZZD A;  4M78 D;  1BIB A;  2QTX A;  3G6E T;  3MCA B;  3OMG A;  3JB9 F;  3RKW A;  4OB3 B;  2EQK A;  3I56 A;  3OMC A;  2EKO A;  1U1S A;  3JRZ A;  2MF2 A;  3CD6 A;  4M7A E;  3FIF A;  3HKS A;  3L2R A;  3CCL T;  4M7D F;  2DJZ A;  1Y71 A;  2JTM A;  4PNO A;  3CCL A;  2P0P A;  1QVP A;  3OQ5 A;  4C92 F;  3VYH B;  1HXD A;  1VIF A;  4X9D A;  3J80 E;  3OS1 A;  4RCC A;  3JCM P;  4ELZ C;  5CKE A;  3OYH A;  3I55 T;  3BFM A;  1UB4 A;  5GAM e;  4F7U G;  5GAN 5;  3X28 B;  2RJD A;  3HHT B;  1QVG S;  1MGQ A;  2DXT A;  4MDW A;  5EG2 A;  2EIF A;  3DB4 A;  2E12 A;  2LRQ A;  3X25 B;  3LWI A;  4BDZ A;  1MHN A;  2M16 A;  2E6Z A;  5A0L A;  2PVD B;  3P8H A;  3F70 A;  5GAO q;  3MEV A;  4D6W A;  1WJQ A;  2RHY A;  3O8V A;  3QZ5 B;  3CCM T;  2RK2 A;  3CPW A;  5FRM A;  2M0O A;  2X4X A;  2L89 A;  2RHX A;  3QZ9 B;  1U1T A;  4PJO G;  4DOW A;  3QG1 A;  2YRV A;  3C94 A;  1UGS B;  3CCV A;  3HL8 A;  3EFR A;  3CBP A;  5GAM h;  2AHJ B;  3LH0 A;  4F7U F;  1O75 A;  4HT9 A;  4QW2 A;  1XTD A;  4O5V A;  4RG8 A;  4Z02 A;  3RMS A;  2VYT A;  5HK0 A;  1LNX A;  4ZGD B;  3RUX A;  1B34 B;  2CS7 A;  2XDD A;  4HT8 A;  5HKC A;  2D9T A;  2DTO A;  2H3J A;  1YIJ T;  2C06 A;  2BUD A;  3HSB A;  2RB6 A;  1VQ7 A;  3HFO A;  3CC4 A;  2JOY A;  5LJ5 g;  1Q81 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...