2VC8A

Crystal structure of the lsm domain of human edc3 (enhancer of decapping 3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENHANCER OF MRNA-DECAPPING PROTEIN 3
publication title A Divergent Sm Fold in Edc3 Proteins Mediates Dcp1 Binding and P-Body Targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vc8A00
3V8JA 1JBMA 5GANg 1HK9A 1HXDA 5LJ5h 5GAN2 1LJOA 4JRIA 3JB9D 4HT8A 2Y90A 4M7DG 5LJ3f 4XU3A 4C8QE 4M78D 1D3BB 2EAYA 4XTXA 1WQ7A 2YLCA 4JUVA 3FIFA 4C8QF 1TH7A 3SB2A 5GAOq 4V2SA 3JB9G 3JCMe 2FYKA 4PJOD 2FB7A 2DXTA 5LJ3d 1KQ1A 5GAN6 1I8FA 3EFRA 4XTVA 4PNOA 3JCMW 4C8QB 4DQ2A 4Y91A 3INZA 1LNXA 1YCYA 3BFMA 1Y96A 3JCMh 5GAMf 4XU2A 3JCMb 4EMHA 4C8QC 4X9CA 5GMKe 5LJ5g 2I2LA 4HT9A 4M7AA 4MMLA 2CGHA 3QSUA 4M77E 4M75A 4F7UE 5GAN5 1WQWA 5GAMj 3QO3A 4F7UF 2YLBA 5GAMd 2JN0A 5GMKh 5GANj 4OP0A 1B34A 2YHTA 3FJPA 3HFNA 4XTUA 4C8QD 1N9RA 3RKXA 4C92F 3JB9J 3QUIA 4M78A 3FB9A 4J5YA 4M77B 4N0AA 3V8LA 4F7UB 5GAN4 5GMKi 2EWNA 3JCMg 4M77C 4PJOA 1H641 4C8QG 3BDUA 4EMKA 4XQ3A 3SWNB 2E10A 5GMKm 5LJ3e 4QVCA 3BY7A 1I5LA 3SWNC 5GAOp 3L1AA 2EJGA 2VXFA 2DZ9A 2E65A 3BW1A 3RKYA 4EMGA 1D3BA 4M77D 5LJ3h 4A53A 5GMKl 3QHSA 5LJ5j 1LOJA 4RCCA 5GANf 4JRKA 4J6XA 5I21A 4M7DA 3HSBA 3JB9I 4M7AE 2ZGWA 2DTHA 5GAMe 4NL3A 1M8VA 2RD1A 4C92E 4M77G 4M75E 1WPYA 1MGQA 4F7UG 1KQ2A 4M7AF 3AHUA 4C92G 2DXUA 4M75F 5GANd 2HNIA 2RB6A 3RKWA 3VU3C 5GAMh 1Y96B 2EJ9A 3HFOA 1U1SA 2DTOA 3JCMQ 2VC8A 4M7AB 1U1TA 1WNLA 2VXEA 4C92B 2RA2A 4M75B 5LJ3g 3V8KA 3JB9H 3JCMc 4M7AC 4M78F 2E64A 1BIAA 4XU0A 3V7CA 4XTZA 4C92C 4A54A 4M75C 1BIBA 1I81A 1B34B 4J6YA 2DKGA 5LJ5f 4PJOE 3JCMP 4PJOF 4WF2A 2DTIA 5GMKj 5GAOn 3RUXA 2DZCA 4M7AD 1N9SA 2E1HA 2EJFA 4C92D 2RM4A 4M75D 4NOYA 3V7SA 4N0AC 5LJ5d 5GAMg 4XTWA 4PJOB 4EMKB 3RERA 4J6WA 4NL2A 4M7DE 4PJOC 5DY9A 5GANe 4EMKC 2DJZA 4C8QA 4M7AG 4M7DF 4RCBA 4X9DA 3JCMf 3GIBA 4M75G 5GAN3 5GAOm 5GAOr 4JLIA 3RIRA 3PGGA 5GANh 3EFSA 2DVEA 1JRIA 5CAIA 3JB9F 4M7DB 2DEQA 1I4K1 5LJ3j 3M4GA 1X01A 4M78E 3JCMX 1M5Q1 4HA8A 5GAN7 4QVDA 3JCMd 4M7DC 4M78G 5GAOl 3L2ZA 2QTXA 4PJOG 3RESA 4M77A 3V7RA 5GAN8 4F7UA 2E41A 4XTYA 4M78B 3JCMV 4C92A 4MMKA 4XU1A 5LJ5e 3JCMJ 4M7DD 2K57A 4M77F 3SWNA 4M78C
chains in the Genus database with same CATH superfamily
1Q7YU 4EDUA 3CEYA 4IUUA 1HJDA 5CKDA 2XD0A 2KY9A 2OTLA 2FL7A 2A28A 4DBHA 1AWXA 2QYZA 2RHUA 4Y92A 1KD1R 2DD5A 2YLCA 1AHJB 4LN2A 4MZMA 3LWHA 2GF7A 3M53A 3JCMW 2V26A 4PNOA 3CCMT 1OU8A 1Y96A 3ME9A 7AT1B 4HT9A 4LD9K 1D1AA 3A8GB 2HKNA 1K9AA 1SHFA 3THKA 5GANj 3HFNA 1WJSA 1X27A 1OULA 1UG1A 1VQPA 4C8QG 3OYAA 1VQLT 1AWJA 2CH4A 4MZTA 4C0DB 4CC2A 3GF5A 1VQNA 2E65A 5KYXB 3C0CA 1K8AC 4E2FB 1MUZA 2KAFA 3CPWA 3ZEHA 1M8VA 2B86A 2RD1A 2LTOA 2DXUA 3J81E 1VQMA 4IIOA 2P0KA 3VU3C 1U1TA 5D6WA 2VXEA 4JS5A 4HVUA 4C92C 1OQKA 5KE3A 3H41A 1M2VA 1Q7YC 1H92A 3HHTB 1D0YA 1V29B 2GBQA 4XTWA 4J6WA 3CCQA 4EMKC 3CPFA 1TUDA 1UE9A 4EPCA 2FZKB 2RI3A 2YT6A 1E6GA 3EFSA 1G3WA 2BZXA 3TREA 2A0FB 2QTXA 1RABB 4F7UA 2V1RA 3URGA 3DKMA 2EYYA 3JCMJ 3CC2Q 3G7ZA 1YJNQ 2H3EB 1QVPA 2DYBA 1UGRB 1KQSA 3DLMA 1JQQA 1WJQA 2EQJA 2XIDA 4FL6A 4C8QE 1WHLA 2DILA 2CP6A 3FIFA 1N27A 2HMAA 1XJWB 1W1FA 5LJ3d 4N4HA 2QA4T 2COYA 2LX9A 2F5TX 3CCEQ 1QMCA 2K7AA 2L3PA 3QSUA 5GAN5 2CP0A 5GAMd 3G4SA 3TSWA 2CH4W 4J5YA 1PRLC 2JNGA 4LDYA 3L42A 3JCMg 2KBTA 2DMOA 3CMAQ 2COZA 4BD3A 3RMQA 3LX7A 1YN8A 3E9FA 1TTHB 3SWNC 1WI7A 1VQ8A 1YHQA 2D0NA 1NJIU 3FJ5A 2QEXQ 3G6ET 4J7IA 9ATCB 4PJMA 3HSBA 3A8HB 2JM8A 4YTLA 1BU1A 3CC7Q 1FMKA 1GCQA 4E7SA 3RKWA 3KFVA 2DTOA 4RTZA 3RMSA 2HD0A 3VRYA 1BBZA 3EG2A 2K2MA 4C5IA 4M75C 1QW1A 1HYOA 1FX7A 4JDSA 2OJ2A 4C92D 2EFIA 5EC7A 2QXFA 3V7SA 2ZZDA 2DYIA 5LJ5d 2DIGA 4BE2A 1WHJA 2CP5A 3REBB 4A4EA 1R8OB 1VQ6A 2KSSA 4J9GA 1BKBA 2EYQA 4PK4A 5HY6A 2COWA 4P5NA 5CAIA 1H3HA 2KRMA 2QG9B 3I5SA 3I55T 3OS5A 4Z02A 4M77A 2BIVA 1JJ2S 4ZGJB 2L89A 5FRMA 3CBMA 1VQ5T 1HK9A 4E7JA 2RQUA 3CCUT 1GFCA 1F1BB 1FWZA 4XU3A 4XTXA 1KSWA 3GOXA 3CCSA 4F17A 2K3XA 3JB9G 1NJIC 4HCCA 2LP5A 4C8QB 3L2WA 1LNXA 3OS0A 4MMLA 2NUPA 2OAWA 5FU6C 2EKOA 2YLBA 3FC3A 1B34A 2P0QA 1UGQB 2YSQA 3JB9J 3CC4Q 1YNZA 1BI2A 3CD6Q 2O9SA 3OYKA 2PVGB 4OMLA 1BI1A 3TVTA 3MCAB 4IIMA 4PJOA 4QVCA 1VQOQ 2QGFB 1I5LA 2F1LA 1Q95G 3HRUA 1QLYA 3RKYA 1XOVA 4KT0E 4WTOB 2M51A 4M7DA 3LW5E 1VQ4A 2WACA 4RTYA 3OYNA 4N4GA 4F7UG 4ELZC 5CKFA 4DBFA 4OMNA 2HNIA 2RB6A 1RAIB 1TUGB 1Q86R 1ZA1B 2KR3A 1JU5C 4F04B 2V8KA 2EW3A 4ZGDB 2Y4XA 1MNEA 4J7FA 4M7AC 3A1PA 2HDAA 2C0IA 1M3CA 5FU7C 5GAOn 1UHFA 1UUEA 4M75D 1RADB 2RMOA 2FVUA 2EQMA 1EFNA 4NL2A 1ZX6A 2DJZA 1UB4A 3LGFA 3U23A 8ATCB 4GBQA 3CMEQ 4FYVB 3KXTA 3IQLA 1Q81R 1G3TA 3HTRA 4C92A 2RHZA 2LNHB 2RN8A 1YJ9T 2ZPHB 2DJQA 5GANg 4KGXB 1PD0A 4C0FA 3LYIA 3MO8A 4Z89A 4FYXB 2FEIA 5CKHA 4LNPA 2RHIA 3QIIA 1BI3A 1D0ZA 2L3SA 3M56A 4F7UE 5L23A 5IT9E 3M0UA 3UA7A 3PIPA 1Q82U 4C0GA 3UF4A 2M0OA 1M3BA 2ATCB 3ER0A 1RLPC 1KIKA 2JXBA 1WHKA 1D3BA 3VJPA 1YP5A 3CXCA 1OYXA 2VKNA 5GJWB 2DETA 3OYJA 2VASA 3L2VA 2M02A 4M77G 1EIFA 2JJ9A 1Y96B 3PIOA 1VQKQ 2JS0A 2VC8A 3LH5A 4LD6A 3TQ7P 4O5VA 5FWBA 4AFUC 3OYEA 1JJ2A 2D8HA 2RK2A 5J3BA 5CR2A 3MPUB 4OVAA 2CS7A 3OSSC 3C4SA 4Z88A 4M7AD 3CCJQ 2BZ8A 1NYGA 3I56Q 1U5SA 2ED0A 1M1KU 2D0QB 1BCOA 3CCLA 2A36A 3TSZA 2KRSA 1NE8A 3MEWA 3CCEA 1GBRA 1RI9A 2DAQA 2EQUA 4M78E 2LNVA 2DL4A 3H8ZA 4BY6C 5FLXE 4LUEA 3A5ZB 1WHMA 4PJOG 3V7RA 3VRZA 2E6NA 3JCMV 2E12A 3NTIA 2DEUA 2DRMA 1Q82C 1BB9A 2X4JA 1VQLQ 4E7KA 4KULA 3A8OB 4X1VA 4BACA 4M7DG 4XK8E 4FM4B 4E7ZA 3TEEA 2KQWA 1PKSA 5KE2A 4DQ2A 4Y91A 3CC7A 3S6WA 1BI0A 4FIBA 2EYXA 4E7HA 4M77E 3EHQA 2EKHA 3PT9A 4ZNXA 3M59A 2VUBA 3X26B 2L3QA 1FMWA 4JJCA 1RLQC 1WX6A 2CUBA 2CZ6B 4N0AA 4F7UB 4HVWA 1QWEA 4ORZA 4DEYA 2ZPEB 3E1SA 1MHNA 1M90U 3BY7A 2M0YA 3L1AA 1LVKA 2Y4YA 1M1KC 5GMKl 3M0TA 1U3OA 2OTLT 1YBYA 1FYNA 2RI5A 2VYTA 3AHUA 4C92G 4M75F 1X6BA 5GJVB 2HAXA 4HCKA 4A4FA 1NYFA 3DLLA 1NPPA 1ZQ1A 4D8KA 3EGUA 1CSKA 2ZPFB 5HCKA 4LDXA 1BIAA 4PJOE 2JT4A 3LWIA 2FHDA 1K73U 1MMGA 5GMKj 2CDTA 2DZCA 3META 2KRNA 2B8AA 4AG1C 2JW4A 5FROA 4E7LA 4J9IA 1GRIA 4M7DE 5KYUA 1VQ9T 3D7SB 1VQPT 4RCBA 1OX8A 4ATOA 1W2BA 1YWOA 2XDDA 3UA6A 4ZN3A 2NUTA 1Z9QA 4HCBA 1N8RU 2LMJA 2H3JA 3DB4A 3CC4A 3CD6A 4M78B 1NG2A 2J6FA 2YRVA 5J26A 1SG5A 4OB1B 4JJBA 1I1JA 1WXTA 3EG0A 1VQOA 3L2UA 1M90C 1O9SA 1NLOC 3G6EQ 4V2SA 3JCMe 5FRNA 3S3NA 2MYSA 1I8FA 4KBMB 1UJ0A 3JCMh 2OAUA 3L2RA 4DA4A 1M3AA 3CCQT 2X35A 2K2VA 1ZLMA 1KC8R 3M57A 2M9UA 1KQ2A 1NM7A 4NS5A 2K3YA 4M77B 3CBOA 4ZTJA 2LJ3A 2EWNA 1C1AA 1I0CA 4XQ3A 1K73C 2VGMA 2FZCB 2RQTA 1NZ9A 5GAOp 2OTJT 1RAAB 4C0DC 1IHWA 3PVLA 1W4SA 3CMEA 1B07A 3R6NA 4M7AF 2CZ7B 4RMOA 1QVFA 2EJ9A 3QKJA 3I55Q 1N8RC 3X20B 1S72T 2NUPB 2ABLA 2R57A 3M55A 2YUOA 1VUBA 1SPKA 3VS7A 1B34B 2J6OA 2L5QA 3CCUQ 3QZ9B 4HCZA 4ZTFA 4PJOB 2AK5A 1SF9A 2E70A 5CCAA 2HSEB 2VVKA 2X4XA 2CYZB 2HQXA 3OSVA 5GAN3 3OY9A 1JEGA 4JLIA 4LUDA 4M7DB 3EFOA 4RTWA 1M9SA 2J05A 1X75C 3GP8A 3H6ZA 2O2OA 5IHKA 2RK1A 3OW2S 2MPXC 3L2ZA 2DLPA 1UGSB 3R6OA 1OX9A 2HQHA 2DL5A 3QJ6A 1RAGB 1G83A 1ARKA 1OI1A 2DA9A 1J3TA 2JUFA 3EAEA 3PMIA 2KDSA 3OMCA 3M4YA 1E6HA 4HT8A 5LJ3f 4F14A 2KK4A 4XAXB 2K9GA 5HKCA 2FYKA 2FB7A 2DXTA 3NPFA 2FG0A 5GAMf 3ASKA 4X9CA 2BZYA 1Y71A 3QWYA 1VQKA 2CGHA 2JMAA 2HL3A 5CK9A 1RAHB 1GL5A 3HRTA 1D0XA 3OW2P 2FPFA 4JS4A 3N5BB 2QGGA 3CCJA 2DXBA 2LT4A 1WDXA 2DX1A 2CSQA 5A0DA 5I2SA 3I56A 4CC3A 3BW1A 1M4ZA 3A98A 5IHNA 2CP2A 1VIEA 4JZ4A 2P84A 3JB9I 5IAYA 1NBEB 2JTEA 1QQJA 1WPYA 2LCCA 2BTTA 3SD4A 3S3OA 3CCST 3CCVT 3WVEB 1CKAA 2QQRA 1YI2T 3MJXA 3MKDA 1OPLA 1YJ9Q 3V7CA 5LJ5f 2HSPA 1VQLA 4VUBA 1WJRA 1D09B 4WF2A 3KBGA 2DF6A 2JVVA 2OX7A 1G2BA 3RERA 2KROA 3MEVA 5GANe 4K11A 2XG8D 3E9GA 5L8RE 3G71Q 4QKUA 5KYWB 5GANh 1QVGP 1JRIA 5LJ3j 4IKFA 1ZUUA 5CKBA 3J7AF 1WXBA 1FMVA 4J9DA 1MMDA 1WIEA 1Y0MA 1RAFB 2K57A 5C0MA 5A0LA 1JXOA 3CQTA 2PUOB 3VKIA 1UGPB 4BDYA 2EYWA 4L6V5 5AYFA 1TH7A 3SB2A 4PJNA 3RDVA 2XKOC 1MMNA 2H8HA 3BFMA 3OYLA 4MDXA 4XU2A 1ZA2B 4JPBW 4QT7A 3VS6A 2XICA 4C8QC 4RG2A 1KFZA 1N5ZA 5D7UA 3VS3A 2AKLA 2QASA 1K8AR 1ZSZA 1WGSA 4J9CA 3OYBA 3RNJA 3OYHA 5GAN4 1X43A 2O88A 1YFNA 2MMPA 2AIRB 3M0RA 2DBMA 5IHIA 2P4RA 3QWXX 5LJ5j 4JRKA 3OYMA 4J6XA 1Q7YR 1KJWA 2X51A 2DRKA 2ZGWA 3HPWA 2EBPA 3QDFA 4WCIA 1TG0A 3VS5A 1IRXA 3MEUA 3OW2A 5IXBA 1VA7A 3QDRB 2CT4A 4M78F 2EIFA 2XDPA 2XDBA 4F16A 1MNDA 2V8IA 2DTIA 2ZPGB 1KG1A 4D8DA 1N9SA 1ZUYA 2D9TA 1YCSB 2QAZA 3PNWC 2GNCA 6AT1B 2F69A 5KYXA 1R0CB 4II1A 4X9DA 3EGXA 2RI2A 2HKQB 1MMAA 3LLRA 4BDZA 1KHCA 2E4HA 2GGRA 3S3MA 1AT1B 2F2VA 1I4K1 3JCMX 1Y7XA 1LCKA 3JSCA 2DIQA 1B7TA 2YXYA 3GLXA 2ZCFB 3EGDA 5DM7R 4M77F 1VIFA 1SHGA 2Z0WA 5GAOq 1IXDA 3WVDB 5KYUB 5A2QE 5FWCA 2ROLA 4FU6A 3INZA 1YCYA 3OS1A 2DNUA 3I55A 1U8RA 3CCLT 3H0FA 2EGAA 2NUTB 3QO3A 3CCET 2L2PA 1K9MC 4C8QD 2FZGB 2QI2A 4R55A 4JZ3A 3CCUA 1NEGA 3PVQA 2RPNA 1SKUB 4EMKA 2E10A 2QQAA 4BI3A 2RH2A 3VUBA 2EJGA 3UPUA 1VQ9Q 3C12A 4B9XA 4RTXA 3MP1A 1OOTA 4RUGA 2EQKA 2KE9A 1YITQ 2A3LA 1TS9A 1WHHA 2DTHA 3VV0A 3MHXA 2QTVA 1ZBJA 1KK7A 4JRPA 2ECZA 1WNLA 1KD1U 1UGVA 3JB9H 2GCXA 5KH6A 3V8KA 3CC7T 2SEMA 2JM9A 2GQVA 4XU0A 4PLLA 4ZN1A 3JCMP 1YIJQ 2DPPB 1IREB 4MZPA 2EVRA 2PNIA 2RM4A 4A4HA 3VYGA 2NLUA 1ZHIA 2CP7A 2QK0A 2WSEE 3HKSA 4FCYA 2HCKA 1AWWA 3FLGA 5GAOm 2QQ9A 3PGGA 2WSFE 3CC2A 3JCMd 1YJNA 2YUQA 3GNFB 1NJIR 1UECA 2KXCA 2DK3A 5DLOA 3SWNA 2I0NA 3QG1A 4PJJA 2MI6A 2DL7A 1PM3A 5GAN2 4QVZA 2X4YA 1WXUA 2OTJQ 1PSFA 4FYYB 3CCMQ 1FXXA 4PKCC 1M1FA 2HBPA 4HXJA 3SDZA 4D6WA 1YJWT 5KYYA 2NUZA 3CCRT 4C5EA 2YDLA 2JTMA 1RAEB 4M75A 3EFOB 1S72Q 1N6AA 2KXDA 1TWBA 3FEOA 2HL5C 3CMAA 4XTUA 1YJ9A 1VQ7T 1KD1C 4J9EA 5DLQE 2RJCA 1M2VB 3I9QA 2AZSA 2KYMA 2AT1B 2QEXA 5AT1B 2JOYA 2V1QA 3I5RA 3SHWA 1PSEA 3VS0A 1LOJA 2O01E 1TSFA 3G71A 3CPWS 2A7YA 1MGQA 1TU0B 2HBWA 1SSHA 3PFSA 4AT1B 4C5GA 5I11A 1NPRA 3VS2A 2RQWA 5FW9A 3HP9A 4MDWA 1SRMA 1QCNA 2RF0A 4OGEA 5LJ3g 2LQWA 4LE9A 1PCXA 2DE0X 2IPOB 1MV3A 3QXEB 2E1HA 4NOYA 5GAMg 4Q5WA 4BB7A 2DL3A 2ROTA 3P8BB 2JMCA 1T3LA 2R5MA 1OPKA 2LJ1A 5CVIA 3EH2A 2LX7A 1I07A 3Q1JA 4FT2A 1WYXA 3VS1A 3CPWP 3CMET 3FRNA 1GCQC 4XTYA 5M9OA 3M5AA 4M78C 3PTAA 1PWTA 1UHCA 2YUNA 5HK3A 4RTTA 3JB9D 5D6YA 1X2QA 3NHNA 4ELYC 2QA4Q 2EAYA 1WQ7A 1KQSS 3REAB 4C8QF 1WA7A 1XNIA 1S1NA 1TXQA 2G3RA 3OYFA 1VQNT 2PUKB 1KQ1A 3OYYA 2L0AA 4DBRA 4A4GA 3CCVQ 5ECAA 5LJ5g 4M7AA 1RACB 1YI2Q 4RKUE 2RHYA 2PZ1A 1VQMT 1AD5A 2LCSA 2K5FA 4O6JA 3P8DA 5IXFA 1Y07A 4AFQC 2RJDA 4BI8B 2FPEA 4M77C 2X9HA 2VXFA 1W70A 4ESRA 4N4IA 2EQIA 2LQ8A 1KQSP 2K6DA 4NL3A 1K4US 2GFUA 4C92E 5GANd 2AKKA 5CIUA 3QPHA 4FT4A 2CSIA 1ZSZB 1Z9ZA 2MAMA 4XTZA 1BIBA 3JRZA 1HD3A 3DB3A 5IN1A 2RJEA 2LQKA 2E5QA 3VYHB 2DVJA 4J9FA 1IB8A 4OB3B 2R58A 1OU9A 2CREA 3T9NA 4PJOC 2MIOA 2VGNA 1Q82R 3CCJT 4M75G 4PL6A 3I56T 3RIRA 2MWOA 3C95A 2DEQA 3WXMB 4M7DC 2DFUA 1VQ5Q 1G5VA 1QP2A 2J06A 3RESA 5GAN8 2F2WA 1VOMA 1M30A 3A8LB 4DOVA 2C0OA 4FSSA 3G4ST 1T3SA 4M78D 1Q86U 1VQ9A 1VQ8T 1YITA 1YHQT 2JZ2A 4IUVA 1QCFA 2ZAEA 1ZUKA 2KMTA 4KGZB 3EGXB 4UC4A 5GMKe 2WSCE 5I22A 1M1KR 2K5IA 1SEMA 4B9WA 5GMKh 3M0PA 3UATA 2BUDA 2EGCA 1N9RA 3RKXA 4BI4A 1YIJA 3O5ZA 2FRYA 2D1XA 2CUDA 3EGDB 1UFFA 2XK0A 2DZ9A 5IH2A 3H0IA 2ED1A 3RR6A 1GXIE 4M77D 1Q81U 3LH0A 1NLPC 3M54A 5I21A 1LPLA 1D1CA 4KUIA 8AT1B 2CKKA 3NTHA 5KCOA 2YRCA 1VQ6T 2YUPA 3CBPA 4M75E 4QQGA 4ANJA 2X3XD 2AZVA 2JS2A 4C92B 2IVWA 3NTKA 1Y57A 1C6VX 4E6RA 2QDYB 3OBYA 1SSFA 1X6OA 3KUFA 2O9VA 1QVGS 4DBQA 2OTJA 3CCMA 1JXMA 2M16A 4EMKB 1Q86C 4M7AG 2DBKA 3ZBDA 1VYVA 4GLMA 2K5LA 5GAOr 2ENMA 3JB9F 4PJOD 5KCHA 1X01A 3CCLQ 1M90R 1S72A 1XTDA 1U06A 1PRMC 4KUDK 1GBQA 1VYUA 4HKEA 4XU1A 4M7DD 2D8JA 1VYTA 2BE9B 2G6FX 2XI9A 1LJOA 3H0HA 2Y90A 5CO7A 1ACMB 1D3BB 4JUVA 1BK2A 2V8JA 4DOWA 1H8KA 1Q81C 2KEAA 2P0PA 4XTVA 1WHGA 1K73R 1M1GA 2QDLA 3JCMb 2X3WD 1VQ4T 1IGQA 4TVRA 4Y28E 3M9QA 5GAMj 4F7UF 1R77A 5CQYA 5C6SA 1AOJA 4KGVB 2F5KA 3ZFJA 4M78A 3X28B 2E5KA 3P8HA 1X69A 3SWNB 1N8RR 3MEAA 4LXCA 3EG1A 3MP8A 2GFAA 2LVMA 4R56A 2FO0A 4J9HA 3HRSA 3ZL7C 4PLIA 4M7AE 3FDRA 3CXCS 5J39A 1G8XA 4FW1A 2A08A 3MP6A 2O4XA 3EG9A 4QQ6A 4RTVA 5KYYB 3TU4K 3JCMQ 2E6ZA 4M75B 3JCMc 3UT1A 2AHJB 2BE7D 3H9NA 5KYNA 3TCJA 4JRQA 1ABQA 4OMPA 4LDWA 2R5AA 4LDVA 2L3RA 1EZZB 2QA4A 4N0AC 1NEBA 2KT8A 2CZ1B 2XU8A 4IUTA 1X6GA 4ZGEB 1YJWQ 4IUQA 3CCVA 4A4KA 3CCRQ 1K9MU 4HA8A 4QVDA 1YI2A 1ZSGA 3CXCP 4RG8A 4JJDA 1VQ7Q 2J6KA 2W10A 1UJYA 2E41A 4GLKA 2LRQA 2EYZA 4FW2A 3OYIA 2C06A 3G6EA 1RUWA 3OMGA 3BE3A 3JAME 4RTUA 4JRIA 1OZ3A 1JJ2P 2A37A 3HL8A 2VWFA 4IUPA 3UWNA 2PU9B 1AEYA 2HQEA 2PTKA 5FU6B 4E7IA 1B3QA 2FPDA 2OI3A 4AFSC 2LQNA 4C0ZA 2K79A 3M0SA 1AVZC 3GNGA 4ME7A 3QUIA 3FB9A 3CC2T 1IGUA 4QW2A 1DJ7B 1YJNT 5GMKi 4X34A 1M8MA 3BDUA 5LJ3e 2OTLQ 1QVGA 4M4ZA 2K4YA 1PHTA 4EMGA 3LGLA 4L59A 5LJ3h 4JJNK 4BE1A 4AFZC 1TOVA 1RI0A 4A53A 1G3YA 3E2UA 1V1CA 4RCCA 1PC0A 4QQDA 3SFMA 2C0TA 2VV5A 5GAMe 3OYDA 1SRLA 3NGPA 2RQVA 5GAMh 1QKXA 2PQWA 1VQ5A 1H3ZA 4M7AB 3F70A 2DXCA 3ULRB 2KGTA 5FU7B 1WLPB 4PJOF 2KT1A 4IURA 4OMQA 1VQPQ 2EJFA 3CMAT 1KC8U 2NYSA 1K76A 3QZ5B 3RBBB 1VQNQ 2E3HA 2QQSA 2DM1A 2J7IA 4M7DF 3EG3A 3PMTA 4OMMA 3JCMf 2QEXT 2O31A 3BDLA 1T0HA 2KYBA 2DVEA 1W2BS 2MOXA 3M4GA 5GAN7 4KH1B 1M5Q1 3O8VA 2K3BA 4M78G 5GAOl 1VQMQ 3QYGB 1BYMA 4CI0C 3G71T 3OQ5A 2LDMA 1K0XA 1P92A 1PNJA 1I5OB 2CT3A 5LJ5e 1M27C 4KRTA 1AWOA 2MK5A 1IZ6A 3X25B 5LJ5h 1RL2A 3J80E 3E19A 1T0JA 3M58A 1QWFA 2KVQG 3JV3A 2M1HA 3CCQQ 3GPLA 4JLGA 2RNAA 2CZ0B 3QBYA 4AMCA 4PFZA 5EG2A 4KH0B 1R0BG 4EMHA 5KYWA 2GQIA 2RQRA 1OEBA 1AZEA 2DL8A 3OYGA 2LT1A 4C5HA 5CQXA 1W2BP 2JN0A 4CRIA 1E7OA 2YHTA 3FJPA 5D6XA 4C92F 1TUCA 2IIMA 2EGEA 2FRWA 3V8LA 1O75A 1OZ2A 4R0KA 1BCMA 2LZ6B 1H641 2XHCA 2P4TA 1KC8C 2E3IA 3OBWA 3HFOA 1QP3A 1WFWA 1QVFS 1QKWA 1IO6A 1W6XA 3OYCA 4GY5A 2E64A 3OB9A 3CC4T 4A54A 3G4SQ 1I81A 3C94A 4J6YA 2DKGA 3CD6T 1WZOA 2PVOB 1ABOA 3RUXA 1ZBXA 5HK0A 2DO3A 1VQOT 2LJ0A 1IHVA 5I2MA 1VQ8Q 1K0SA 1YHQQ 4EIKA 4C8QA 1XQHA 2MCNA 2MWPA 4Z8AA 2RO0A 1A0NB 1GFDA 1CKBA 4AG2C 1K1ZA 4BY6B 2VB6A 1UTIA 1EX4A 1QCOA 2LCLA 1QVFP 3X24B 2KNBB 3EHRA 4OMOA 3V8JA 1JBMA 2QQBA 1HXDA 4B6MA 3GBQA 3G1JA 3VUZA 2D6FA 3OS2A 4BUGA 1K9MR 2DD4A 3VS4A 3PE0A 4PFOA 4A63B 4OF1A 3QJYA 4OB0B 1VQ6Q 5GAN6 2NWMA 3EFRA 3SEMA 4OB2B 4E47A 1HSQA 2ZPBB 4PJLA 2I2LA 2PVDB 2YWWA 1M2OA 4OGCA 1KHIA 2W0ZA 3A8MB 2HEQA 1WQWA 2ESWA 5CKEA 5A0GA 4OP0A 4J83A 3NFCA 2BKDN 1JB0E 1X2KA 1PKTA 2LC4A 1D1BA 1UEBA 5GMKm 4CC7A 4FYWB 2DERA 4J9BA 2SRCA 3EH1A 3QHSA 3CCSQ 5GANf 1YJWA 1AZGB 1G3SA 3CCRA 2MF2A 3OA6A 2ZPIB 2YRDA 4L5GA 1YITT 1U1SA 2JTFA 1VQ7A 2F2XA 1JO8A 3L2QA 3AT1B 2RA2A 2EPDA 5LL6S 4HVVA 1ZSZC 1C0MA 2X4WA 1V76A 2L8DA 4FSXA 2HZYA 3I35A 2GTJA 2KI7A 2IG0A 3NMZC 1K8AU 1YIJT 5DY9A 1UDLA 1PD1A 3GIBA 4OMFB 2RJFA 4LDUA 4PFPA 1OV3A 4CC4B 2RHXA 1VQ4Q 4BE0A 2CP3A 1VQKT 2GTOA 1GCPA 2O4XB 2XMFA 3EG9B 4DEXA 4J8OA 4MMKA 3UDCA 1YWPA 1MV0B 1PG5B 3QYHB 3M0QA
chains in the Genus database with same CATH topology
1Q7YU 4EDUA 3CEYA 2X4JA 4IUUA 2XI9A 5CKDA 2XD0A 2KY9A 4E7KA 1LJOA 2OTLA 4KULA 3A8OB 2FL7A 2Y90A 4BACA 5CO7A 4M7DG 4XK8E 2RHUA 4FM4B 1VIFA 1D3BB 3TEEA 2DD5A 2YLCA 1AHJB 4JUVA 2V8JA 2KQWA 5GAOq 4DOWA 4MZMA 1Q81C 3WVDB 3LWHA 5KE2A 2GF7A 2P0PA 3M53A 5A2QE 4XTVA 3JCMW 4PNOA 4FU6A 4Y91A 4DQ2A 3INZA 3CC7A 1YCYA 3CCMT 1M1GA 1Y96A 3ME9A 3JCMb 3S6WA 1BI0A 4FIBA 3OS1A 1VQ4T 4HT9A 4LD9K 3I55A 1U8RA 3CCLT 4TVRA 4M77E 4E7HA 4Y28E 3A8GB 3M9QA 3PT9A 3QO3A 3M59A 5GAMj 2VUBA 4F7UF 5CQYA 5GANj 5C6SA 3HFNA 3CCET 1WJSA 3X26B 1K9MC 4C8QD 2F5KA 2QI2A 4R55A 3ZFJA 2CZ6B 4M78A 4N0AA 4F7UB 3CCUA 3X28B 1VQPA 3P8HA 4C8QG 2ZPEB 3OYAA 4EMKA 3SWNB 1VQLT 2E10A 3E1SA 1MHNA 3MEAA 4MZTA 1M90U 2QQAA 4C0DB 3BY7A 4BI3A 2RH2A 3MP8A 2GFAA 3GF5A 3L1AA 2EJGA 2LVMA 2E65A 3VUBA 3UPUA 1VQNA 2Y4YA 3C12A 4B9XA 4R56A 1K8AC 1M1KC 5GMKl 3MP1A 2KAFA 3CPWA 2EQKA 3HRSA 2A3LA 2OTLT 4PLIA 3ZEHA 1YBYA 4M7AE 3FDRA 2DTHA 2RI5A 5J39A 2VYTA 3CXCS 1M8VA 2RD1A 3VV0A 3MHXA 2LTOA 3AHUA 4C92G 2DXUA 4M75F 3MP6A 2O4XA 3J81E 2HAXA 1VQMA 3VU3C 2P0KA 4QQ6A 4A4FA 4JRPA 3TU4K 3DLLA 3JCMQ 2E6ZA 1U1TA 1WNLA 1NPPA 2VXEA 1ZQ1A 5D6WA 1KD1U 3JB9H 2GCXA 4M75B 3V8KA 5KH6A 4JS5A 3CC7T 2ZPFB 3JCMc 2AHJB 2GQVA 4XU0A 1BIAA 4PLLA 3UT1A 4LDXA 4C92C 4ZN1A 3TCJA 4JRQA 4PJOE 5KE3A 3JCMP 3LWIA 2DPPB 2FHDA 1IREB 4LDWA 1Q7YC 1K73U 4MZPA 5GMKj 2R5AA 4LDVA 2L3RA 2DZCA 3HHTB 3META 2QA4A 2RM4A 4A4HA 1V29B 4N0AC 3VYGA 4XTWA 2B8AA 4J6WA 5FROA 4E7LA 2NLUA 4M7DE 3CCQA 1ZHIA 1VQ9T 4EMKC 3CPFA 2WSEE 2CZ1B 3HKSA 1VQPT 4RCBA 2XU8A 4IUTA 4ATOA 4EPCA 4ZGEB 1W2BA 2RI3A 3FLGA 4IUQA 5GAOm 3CCVA 2QQ9A 4A4KA 3PGGA 3EFSA 2XDDA 1K9MU 4ZN3A 2WSFE 4HA8A 3CC2A 4QVDA 3JCMd 1YI2A 1G3WA 1N8RU 4HCBA 1YJNA 2H3JA 4RG8A 3DB4A 3GNFB 3TREA 2QTXA 3CC4A 4F7UA 2E41A 3CD6A 3URGA 2DK3A 3DKMA 4GLKA 2LRQA 4M78B 3JCMJ 3G7ZA 2YRVA 5DLOA 3SWNA 3OYIA 2C06A 5J26A 1QVPA 3QG1A 4OB1B 3G6EA 2MI6A 3OMGA 1UGRB 5GAN2 4QVZA 3JAME 4JRIA 1VQOA 1KQSA 3L2UA 3DLMA 2X4YA 1WJQA 2EQJA 1OZ3A 2XIDA 4FL6A 4C8QE 1PSFA 1M90C 1O9SA 1FXXA 3FIFA 3HL8A 1N27A 4V2SA 4IUPA 3JCMe 3UWNA 5FRNA 3S3NA 4PKCC 2PU9B 5LJ3d 1M1FA 2HBPA 1I8FA 4N4HA 3SDZA 2QA4T 2LX9A 4D6WA 4KBMB 2F5TX 1YJWT 3JCMh 2OAUA 3L2RA 4DA4A 2HQEA 3CCRT 4C5EA 5FU6B 2JTMA 3CCQT 2X35A 2K2VA 3QSUA 4E7IA 3M57A 4M75A 2M9UA 5GAN5 1N6AA 4C0ZA 3FEOA 5GAMd 1KQ2A 3CMAA 4XTUA 1YJ9A 1VQ7T 1KD1C 3GNGA 3G4SA 5DLQE 4ME7A 3QUIA 2K3YA 4NS5A 2RJCA 3FB9A 4J5YA 4M77B 3CC2T 2JNGA 4QW2A 3CBOA 1DJ7B 4ZTJA 4LDYA 1YJNT 5GMKi 3L42A 2EWNA 4X34A 3JCMg 2QEXA 3BDUA 4XQ3A 4BD3A 3RMQA 1K73C 2VGMA 5LJ3e 3LX7A 1QVGA 1NZ9A 3E9FA 2JOYA 3SWNC 5GAOp 1VQ8A 2K4YA 1YHQA 2OTJT 4C0DC 4EMGA 3LGLA 4L59A 5LJ3h 4JJNK 4BE1A 1NJIU 1PSEA 1RI0A 4A53A 1G3YA 3G6ET 4J7IA 1LOJA 2O01E 4RCCA 1W4SA 4QQDA 3SFMA 3G71A 3HSBA 2VV5A 3A8HB 5GAMe 2A7YA 4YTLA 3CMEA 3CPWS 1BYMA 3OYDA 4M7AF 1MGQA 2CZ7B 3PFSA 4RMOA 3RKWA 4C5GA 1QVFA 5GAMh 1NPRA 2EJ9A 2PQWA 2DTOA 3QKJA 3RMSA 1N8RC 1VQ5A 3X20B 2HD0A 1H3ZA 3HP9A 4M7AB 3F70A 4MDWA 1S72T 3M55A 2R57A 4OGEA 5LJ3g 2DXCA 1VUBA 4C5IA 4M75C 1QW1A 1B34B 5FU7B 4PJOF 2L5QA 4IURA 3QZ9B 1FX7A 4JDSA 3QXEB 2E1HA 2EJFA 3CMAT 4C92D 2EFIA 4HCZA 4ZTFA 2QXFA 4NOYA 2ZZDA 3V7SA 5LJ5d 5GAMg 1KC8U 2DIGA 4BE2A 4PJOB 3QZ5B 4Q5WA 4BB7A 2QQSA 4A4EA 2E70A 5CCAA 4M7DF 1R8OB 1VQ6A 2KSSA 2X4XA 3PMTA 3JCMf 2CYZB 2HQXA 3BDLA 2QEXT 1BKBA 2EYQA 5HY6A 3OSVA 5GAN3 3OY9A 4P5NA 3P8BB 4JLIA 5CAIA 2DVEA 4M7DB 2R5MA 1M9SA 1W2BS 1X75C 3GP8A 3M4GA 5CVIA 5GAN7 3H6ZA 1M5Q1 2RK1A 3O8VA 3Q1JA 4FT2A 4M78G 3OW2S 5GAOl 3L2ZA 3QYGB 4CI0C 3I55T 3OS5A 1UGSB 3G71T 4Z02A 3OQ5A 3R6OA 4M77A 3CMET 2BIVA 3FRNA 2LDMA 3QJ6A 4XTYA 1JJ2S 1P92A 1OI1A 3M5AA 4ZGJB 2L89A 5M9OA 5LJ5e 5FRMA 2JUFA 4M78C 3PTAA 3CBMA 1VQ5T 1HK9A 3EAEA 3PMIA 4E7JA 1IZ6A 2KDSA 3OMCA 3X25B 1RL2A 3M4YA 5HK3A 5LJ5h 5D6YA 3E19A 3J80E 3CCUT 3JB9D 4HT8A 1FWZA 3M58A 5LJ3f 4XU3A 4ELYC 2EAYA 2KVQG 4XTXA 1WQ7A 1KQSS 2KK4A 1XNIA 4C8QF 4XAXB 2M1HA 3GOXA 3CCSA 2K3XA 2G3RA 3OYFA 4JLGA 5HKCA 3GPLA 3JB9G 2FYKA 1NJIC 4HCCA 1VQNT 2PUKB 2CZ0B 2FB7A 2DXTA 1KQ1A 3QBYA 3OYYA 4C8QB 3L2WA 5EG2A 1LNXA 5GAMf 4A4GA 4EMHA 3ASKA 5LJ5g 4X9CA 3OS0A 4M7AA 1Y71A 4MMLA 1VQKA 2CGHA 3OYGA 2LT1A 5FU6C 4C5HA 4RKUE 2EKOA 2RHYA 5CK9A 5CQXA 1VQMT 2YLBA 2JN0A 3FC3A 4CRIA 4C92F 1B34A 2P0QA 1UGQB 2YHTA 3FJPA 2K5FA 3HRTA 5D6XA 3JB9J 1BI2A 4O6JA 4JS4A 3N5BB 3OYKA 3V8LA 3P8DA 1Y07A 2PVGB 2RJDA 1BI1A 1O75A 1OZ2A 4BI8B 3MCAB 4M77C 2DXBA 1H641 2LT4A 3CCJA 4PJOA 5A0DA 4QVCA 5I2SA 3I56A 2XHCA 1I5LA 2P4TA 2VXFA 3BW1A 1M4ZA 3HRUA 1KC8C 3RKYA 1XOVA 4N4IA 4KT0E 1VIEA 4M7DA 3LW5E 2LQ8A 1VQ4A 3JB9I 2WACA 5IAYA 4NL3A 2GFUA 4C92E 3OYNA 4N4GA 1WPYA 2LCCA 4F7UG 4ELZC 3SD4A 5CKFA 3S3OA 3CCST 5GANd 2HNIA 2RB6A 3CCVT 3OBWA 3WVEB 3HFOA 2QQRA 5CIUA 3QPHA 2V8KA 4FT4A 4ZGDB 2Y4XA 1QP3A 1YI2T 1QVFS 4J7FA 4GY5A 3OYCA 4M7AC 2E64A 2MAMA 3OB9A 3V7CA 4XTZA 3CC4T 4A54A 5LJ5f 1BIBA 1I81A 3C94A 3DB3A 2DKGA 3JRZA 4J6YA 1VQLA 4VUBA 1WJRA 3CD6T 2PVOB 2RJEA 4WF2A 5IN1A 5FU7C 2LQKA 3KBGA 2E5QA 4M77F 3RUXA 5GAOn 2JVVA 1ZBXA 3VYHB 4M75D 4OB3B 5HK0A 2R58A 2DO3A 1VQOT 3RERA 2FVUA 2EQMA 4NL2A 5I2MA 3MEVA 3T9NA 4PJOC 5GANe 2DJZA 1UB4A 3LGFA 2VGNA 4C8QA 1XQHA 3CCJT 4M75G 2XG8D 3E9GA 2MWPA 4PL6A 5L8RE 2RO0A 3I56T 5GANh 3RIRA 2MWOA 1JRIA 3C95A 4BY6B 2DEQA 5LJ3j 4IKFA 3WXMB 5CKBA 4M7DC 3KXTA 3J7AF 1G5VA 1QP2A 1G3TA 3RESA 5GAN8 4C92A 2RHZA 2K57A 2LCLA 5C0MA 3A8LB 4DOVA 1YJ9T 3X24B 2ZPHB 3V8JA 3G4ST 1JBMA 2QQBA 5A0LA 5GANg 1HXDA 3VUZA 4C0FA 2PUOB 2D6FA 3LYIA 3OS2A 4BUGA 3MO8A 4M78D 1Q86U 1VQ9A 2DD4A 3VKIA 1UGPB 4BDYA 4L6V5 5AYFA 1TH7A 3SB2A 1VQ8T 1YITA 1YHQT 4OF1A 3QJYA 4OB0B 2JZ2A 4IUVA 5GAN6 5CKHA 2XKOC 3EFRA 2RHIA 4OB2B 3QIIA 2KMTA 1BI3A 3BFMA 4UC4A 4E47A 3OYLA 4MDXA 2ZPBB 4XU2A 2XICA 4C8QC 4RG2A 5GMKe 2I2LA 2PVDB 2WSCE 3M56A 4OGCA 1KHIA 3A8MB 4F7UE 2K5IA 1WGSA 1WQWA 3OYBA 5IT9E 5CKEA 4B9WA 5GMKh 5A0GA 4OP0A 4J83A 2BUDA 3NFCA 1N9RA 2BKDN 3RKXA 1JB0E 3PIPA 1Q82U 4BI4A 4C0GA 1YIJA 3OYHA 5GAN4 2M0OA 2LC4A 2MMPA 1UEBA 2XK0A 3ER0A 5GMKm 2DZ9A 1GXIE 1D3BA 4M77D 1Q81U 3LH0A 3VJPA 3QHSA 5LJ5j 5GANf 1OYXA 3M54A 4JRKA 4J6XA 5I21A 3OYMA 3CXCA 1YJWA 4KUIA 2CKKA 3OYJA 1G3SA 3NTHA 5KCOA 2MF2A 3CCRA 2ZGWA 3HPWA 3OA6A 3CBPA 3L2VA 1VQ6T 4M77G 4M75E 2ZPIB 4QQGA 1EIFA 4L5GA 1YITT 1Y96B 3PIOA 1U1SA 2JTFA 1VQ7A 3MEUA 2VC8A 3L2QA 3OW2A 4LD6A 4C92B 2IVWA 2RA2A 3NTKA 3QDRB 4O5VA 4M78F 3OYEA 5LL6S 1JJ2A 2EIFA 2RK2A 2XDPA 5J3BA 5CR2A 2XDBA 4OVAA 2CS7A 2V8IA 2QDYB 2X4WA 2DTIA 3OSSC 2L8DA 3C4SA 3OBYA 1SSFA 2ZPGB 1X6OA 3KUFA 4FSXA 1QVGS 1N9SA 4M7AD 1KG1A 2OTJA 3CCMA 2D9TA 2M16A 2IG0A 4EMKB 1K8AU 1M1KU 1YIJT 3PNWC 1Q86C 2D0QB 5DY9A 2F69A 3CCLA 4M7AG 4II1A 4X9DA 2RI2A 3ZBDA 3GIBA 4OMFB 2RJFA 3MEWA 1NE8A 2K5LA 3LLRA 4LDUA 4BDZA 1KHCA 3CCEA 3S3MA 5GAOr 2RHXA 2DAQA 2EQUA 3JB9F 4PJOD 1I4K1 3JCMX 4M78E 1X01A 2LNVA 5KCHA 3H8ZA 4BE0A 1Y7XA 4BY6C 5FLXE 1XTDA 1S72A 3A5ZB 4KUDK 3JSCA 1VQKT 2O4XB 2DIQA 4PJOG 4J8OA 3V7RA 2E6NA 4HKEA 3JCMV 2E12A 4MMKA 4XU1A 3UDCA 3GLXA 4M7DD 2ZCFB 3NTIA 5DM7R 3QYHB 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8J A;  1JBM A;  5GAN g;  1HK9 A;  1HXD A;  5LJ5 h;  5GAN 2;  1LJO A;  4JRI A;  3JB9 D;  4HT8 A;  2Y90 A;  4M7D G;  5LJ3 f;  4XU3 A;  4C8Q E;  4M78 D;  1D3B B;  2EAY A;  4XTX A;  1WQ7 A;  2YLC A;  4JUV A;  3FIF A;  4C8Q F;  1TH7 A;  3SB2 A;  5GAO q;  4V2S A;  3JB9 G;  3JCM e;  2FYK A;  4PJO D;  2FB7 A;  2DXT A;  5LJ3 d;  1KQ1 A;  5GAN 6;  1I8F A;  3EFR A;  4XTV A;  4PNO A;  3JCM W;  4C8Q B;  4DQ2 A;  4Y91 A;  3INZ A;  1LNX A;  1YCY A;  3BFM A;  1Y96 A;  3JCM h;  5GAM f;  4XU2 A;  3JCM b;  4EMH A;  4C8Q C;  4X9C A;  5GMK e;  5LJ5 g;  2I2L A;  4HT9 A;  4M7A A;  4MML A;  2CGH A;  3QSU A;  4M77 E;  4M75 A;  4F7U E;  5GAN 5;  1WQW A;  5GAM j;  3QO3 A;  4F7U F;  2YLB A;  5GAM d;  2JN0 A;  5GMK h;  5GAN j;  4OP0 A;  1B34 A;  2YHT A;  3FJP A;  3HFN A;  4XTU A;  4C8Q D;  1N9R A;  3RKX A;  4C92 F;  3JB9 J;  3QUI A;  4M78 A;  3FB9 A;  4J5Y A;  4M77 B;  4N0A A;  3V8L A;  4F7U B;  5GAN 4;  5GMK i;  2EWN A;  3JCM g;  4M77 C;  4PJO A;  1H64 1;  4C8Q G;  3BDU A;  4EMK A;  4XQ3 A;  3SWN B;  2E10 A;  5GMK m;  5LJ3 e;  4QVC A;  3BY7 A;  1I5L A;  3SWN C;  5GAO p;  3L1A A;  2EJG A;  2VXF A;  2DZ9 A;  2E65 A;  3BW1 A;  3RKY A;  4EMG A;  1D3B A;  4M77 D;  5LJ3 h;  4A53 A;  5GMK l;  3QHS A;  5LJ5 j;  1LOJ A;  4RCC A;  5GAN f;  4JRK A;  4J6X A;  5I21 A;  4M7D A;  3HSB A;  3JB9 I;  4M7A E;  2ZGW A;  2DTH A;  5GAM e;  4NL3 A;  1M8V A;  2RD1 A;  4C92 E;  4M77 G;  4M75 E;  1WPY A;  1MGQ A;  4F7U G;  1KQ2 A;  4M7A F;  3AHU A;  4C92 G;  2DXU A;  4M75 F;  5GAN d;  2HNI A;  2RB6 A;  3RKW A;  3VU3 C;  5GAM h;  1Y96 B;  2EJ9 A;  3HFO A;  1U1S A;  2DTO A;  3JCM Q;  2VC8 A;  4M7A B;  1U1T A;  1WNL A;  2VXE A;  4C92 B;  2RA2 A;  4M75 B;  5LJ3 g;  3V8K A;  3JB9 H;  3JCM c;  4M7A C;  4M78 F;  2E64 A;  1BIA A;  4XU0 A;  3V7C A;  4XTZ A;  4C92 C;  4A54 A;  4M75 C;  1BIB A;  1I81 A;  1B34 B;  4J6Y A;  2DKG A;  5LJ5 f;  4PJO E;  3JCM P;  4PJO F;  4WF2 A;  2DTI A;  5GMK j;  5GAO n;  3RUX A;  2DZC A;  4M7A D;  1N9S A;  2E1H A;  2EJF A;  4C92 D;  2RM4 A;  4M75 D;  4NOY A;  3V7S A;  4N0A C;  5LJ5 d;  5GAM g;  4XTW A;  4PJO B;  4EMK B;  3RER A;  4J6W A;  4NL2 A;  4M7D E;  4PJO C;  5DY9 A;  5GAN e;  4EMK C;  2DJZ A;  4C8Q A;  4M7A G;  4M7D F;  4RCB A;  4X9D A;  3JCM f;  3GIB A;  4M75 G;  5GAN 3;  5GAO m;  5GAO r;  4JLI A;  3RIR A;  3PGG A;  5GAN h;  3EFS A;  2DVE A;  1JRI A;  5CAI A;  3JB9 F;  4M7D B;  2DEQ A;  1I4K 1;  5LJ3 j;  3M4G A;  1X01 A;  4M78 E;  3JCM X;  1M5Q 1;  4HA8 A;  5GAN 7;  4QVD A;  3JCM d;  4M7D C;  4M78 G;  5GAO l;  3L2Z A;  2QTX A;  4PJO G;  3RES A;  4M77 A;  3V7R A;  5GAN 8;  4F7U A;  2E41 A;  4XTY A;  4M78 B;  3JCM V;  4C92 A;  4MMK A;  4XU1 A;  5LJ5 e;  3JCM J;  4M7D D;  2K57 A;  4M77 F;  3SWN A;  4M78 C; 
#chains in the Genus database with same CATH topology
 1Q7Y U;  4EDU A;  3CEY A;  4IUU A;  1HJD A;  5CKD A;  2XD0 A;  2KY9 A;  2OTL A;  2FL7 A;  2A28 A;  4DBH A;  1AWX A;  2QYZ A;  2RHU A;  4Y92 A;  1KD1 R;  2DD5 A;  2YLC A;  1AHJ B;  4LN2 A;  4MZM A;  3LWH A;  2GF7 A;  3M53 A;  3JCM W;  2V26 A;  4PNO A;  3CCM T;  1OU8 A;  1Y96 A;  3ME9 A;  7AT1 B;  4HT9 A;  4LD9 K;  1D1A A;  3A8G B;  2HKN A;  1K9A A;  1SHF A;  3THK A;  5GAN j;  3HFN A;  1WJS A;  1X27 A;  1OUL A;  1UG1 A;  1VQP A;  4C8Q G;  3OYA A;  1VQL T;  1AWJ A;  2CH4 A;  4MZT A;  4C0D B;  4CC2 A;  3GF5 A;  1VQN A;  2E65 A;  5KYX B;  3C0C A;  1K8A C;  4E2F B;  1MUZ A;  2KAF A;  3CPW A;  3ZEH A;  1M8V A;  2B86 A;  2RD1 A;  2LTO A;  2DXU A;  3J81 E;  1VQM A;  4IIO A;  2P0K A;  3VU3 C;  1U1T A;  5D6W A;  2VXE A;  4JS5 A;  4HVU A;  4C92 C;  1OQK A;  5KE3 A;  3H41 A;  1M2V A;  1Q7Y C;  1H92 A;  3HHT B;  1D0Y A;  1V29 B;  2GBQ A;  4XTW A;  4J6W A;  3CCQ A;  4EMK C;  3CPF A;  1TUD A;  1UE9 A;  4EPC A;  2FZK B;  2RI3 A;  2YT6 A;  1E6G A;  3EFS A;  1G3W A;  2BZX A;  3TRE A;  2A0F B;  2QTX A;  1RAB B;  4F7U A;  2V1R A;  3URG A;  3DKM A;  2EYY A;  3JCM J;  3CC2 Q;  3G7Z A;  1YJN Q;  2H3E B;  1QVP A;  2DYB A;  1UGR B;  1KQS A;  3DLM A;  1JQQ A;  1WJQ A;  2EQJ A;  2XID A;  4FL6 A;  4C8Q E;  1WHL A;  2DIL A;  2CP6 A;  3FIF A;  1N27 A;  2HMA A;  1XJW B;  1W1F A;  5LJ3 d;  4N4H A;  2QA4 T;  2COY A;  2LX9 A;  2F5T X;  3CCE Q;  1QMC A;  2K7A A;  2L3P A;  3QSU A;  5GAN 5;  2CP0 A;  5GAM d;  3G4S A;  3TSW A;  2CH4 W;  4J5Y A;  1PRL C;  2JNG A;  4LDY A;  3L42 A;  3JCM g;  2KBT A;  2DMO A;  3CMA Q;  2COZ A;  4BD3 A;  3RMQ A;  3LX7 A;  1YN8 A;  3E9F A;  1TTH B;  3SWN C;  1WI7 A;  1VQ8 A;  1YHQ A;  2D0N A;  1NJI U;  3FJ5 A;  2QEX Q;  3G6E T;  4J7I A;  9ATC B;  4PJM A;  3HSB A;  3A8H B;  2JM8 A;  4YTL A;  1BU1 A;  3CC7 Q;  1FMK A;  1GCQ A;  4E7S A;  3RKW A;  3KFV A;  2DTO A;  4RTZ A;  3RMS A;  2HD0 A;  3VRY A;  1BBZ A;  3EG2 A;  2K2M A;  4C5I A;  4M75 C;  1QW1 A;  1HYO A;  1FX7 A;  4JDS A;  2OJ2 A;  4C92 D;  2EFI A;  5EC7 A;  2QXF A;  3V7S A;  2ZZD A;  2DYI A;  5LJ5 d;  2DIG A;  4BE2 A;  1WHJ A;  2CP5 A;  3REB B;  4A4E A;  1R8O B;  1VQ6 A;  2KSS A;  4J9G A;  1BKB A;  2EYQ A;  4PK4 A;  5HY6 A;  2COW A;  4P5N A;  5CAI A;  1H3H A;  2KRM A;  2QG9 B;  3I5S A;  3I55 T;  3OS5 A;  4Z02 A;  4M77 A;  2BIV A;  1JJ2 S;  4ZGJ B;  2L89 A;  5FRM A;  3CBM A;  1VQ5 T;  1HK9 A;  4E7J A;  2RQU A;  3CCU T;  1GFC A;  1F1B B;  1FWZ A;  4XU3 A;  4XTX A;  1KSW A;  3GOX A;  3CCS A;  4F17 A;  2K3X A;  3JB9 G;  1NJI C;  4HCC A;  2LP5 A;  4C8Q B;  3L2W A;  1LNX A;  3OS0 A;  4MML A;  2NUP A;  2OAW A;  5FU6 C;  2EKO A;  2YLB A;  3FC3 A;  1B34 A;  2P0Q A;  1UGQ B;  2YSQ A;  3JB9 J;  3CC4 Q;  1YNZ A;  1BI2 A;  3CD6 Q;  2O9S A;  3OYK A;  2PVG B;  4OML A;  1BI1 A;  3TVT A;  3MCA B;  4IIM A;  4PJO A;  4QVC A;  1VQO Q;  2QGF B;  1I5L A;  2F1L A;  1Q95 G;  3HRU A;  1QLY A;  3RKY A;  1XOV A;  4KT0 E;  4WTO B;  2M51 A;  4M7D A;  3LW5 E;  1VQ4 A;  2WAC A;  4RTY A;  3OYN A;  4N4G A;  4F7U G;  4ELZ C;  5CKF A;  4DBF A;  4OMN A;  2HNI A;  2RB6 A;  1RAI B;  1TUG B;  1Q86 R;  1ZA1 B;  2KR3 A;  1JU5 C;  4F04 B;  2V8K A;  2EW3 A;  4ZGD B;  2Y4X A;  1MNE A;  4J7F A;  4M7A C;  3A1P A;  2HDA A;  2C0I A;  1M3C A;  5FU7 C;  5GAO n;  1UHF A;  1UUE A;  4M75 D;  1RAD B;  2RMO A;  2FVU A;  2EQM A;  1EFN A;  4NL2 A;  1ZX6 A;  2DJZ A;  1UB4 A;  3LGF A;  3U23 A;  8ATC B;  4GBQ A;  3CME Q;  4FYV B;  3KXT A;  3IQL A;  1Q81 R;  1G3T A;  3HTR A;  4C92 A;  2RHZ A;  2LNH B;  2RN8 A;  1YJ9 T;  2ZPH B;  2DJQ A;  5GAN g;  4KGX B;  1PD0 A;  4C0F A;  3LYI A;  3MO8 A;  4Z89 A;  4FYX B;  2FEI A;  5CKH A;  4LNP A;  2RHI A;  3QII A;  1BI3 A;  1D0Z A;  2L3S A;  3M56 A;  4F7U E;  5L23 A;  5IT9 E;  3M0U A;  3UA7 A;  3PIP A;  1Q82 U;  4C0G A;  3UF4 A;  2M0O A;  1M3B A;  2ATC B;  3ER0 A;  1RLP C;  1KIK A;  2JXB A;  1WHK A;  1D3B A;  3VJP A;  1YP5 A;  3CXC A;  1OYX A;  2VKN A;  5GJW B;  2DET A;  3OYJ A;  2VAS A;  3L2V A;  2M02 A;  4M77 G;  1EIF A;  2JJ9 A;  1Y96 B;  3PIO A;  1VQK Q;  2JS0 A;  2VC8 A;  3LH5 A;  4LD6 A;  3TQ7 P;  4O5V A;  5FWB A;  4AFU C;  3OYE A;  1JJ2 A;  2D8H A;  2RK2 A;  5J3B A;  5CR2 A;  3MPU B;  4OVA A;  2CS7 A;  3OSS C;  3C4S A;  4Z88 A;  4M7A D;  3CCJ Q;  2BZ8 A;  1NYG A;  3I56 Q;  1U5S A;  2ED0 A;  1M1K U;  2D0Q B;  1BCO A;  3CCL A;  2A36 A;  3TSZ A;  2KRS A;  1NE8 A;  3MEW A;  3CCE A;  1GBR A;  1RI9 A;  2DAQ A;  2EQU A;  4M78 E;  2LNV A;  2DL4 A;  3H8Z A;  4BY6 C;  5FLX E;  4LUE A;  3A5Z B;  1WHM A;  4PJO G;  3V7R A;  3VRZ A;  2E6N A;  3JCM V;  2E12 A;  3NTI A;  2DEU A;  2DRM A;  1Q82 C;  1BB9 A;  2X4J A;  1VQL Q;  4E7K A;  4KUL A;  3A8O B;  4X1V A;  4BAC A;  4M7D G;  4XK8 E;  4FM4 B;  4E7Z A;  3TEE A;  2KQW A;  1PKS A;  5KE2 A;  4DQ2 A;  4Y91 A;  3CC7 A;  3S6W A;  1BI0 A;  4FIB A;  2EYX A;  4E7H A;  4M77 E;  3EHQ A;  2EKH A;  3PT9 A;  4ZNX A;  3M59 A;  2VUB A;  3X26 B;  2L3Q A;  1FMW A;  4JJC A;  1RLQ C;  1WX6 A;  2CUB A;  2CZ6 B;  4N0A A;  4F7U B;  4HVW A;  1QWE A;  4ORZ A;  4DEY A;  2ZPE B;  3E1S A;  1MHN A;  1M90 U;  3BY7 A;  2M0Y A;  3L1A A;  1LVK A;  2Y4Y A;  1M1K C;  5GMK l;  3M0T A;  1U3O A;  2OTL T;  1YBY A;  1FYN A;  2RI5 A;  2VYT A;  3AHU A;  4C92 G;  4M75 F;  1X6B A;  5GJV B;  2HAX A;  4HCK A;  4A4F A;  1NYF A;  3DLL A;  1NPP A;  1ZQ1 A;  4D8K A;  3EGU A;  1CSK A;  2ZPF B;  5HCK A;  4LDX A;  1BIA A;  4PJO E;  2JT4 A;  3LWI A;  2FHD A;  1K73 U;  1MMG A;  5GMK j;  2CDT A;  2DZC A;  3MET A;  2KRN A;  2B8A A;  4AG1 C;  2JW4 A;  5FRO A;  4E7L A;  4J9I A;  1GRI A;  4M7D E;  5KYU A;  1VQ9 T;  3D7S B;  1VQP T;  4RCB A;  1OX8 A;  4ATO A;  1W2B A;  1YWO A;  2XDD A;  3UA6 A;  4ZN3 A;  2NUT A;  1Z9Q A;  4HCB A;  1N8R U;  2LMJ A;  2H3J A;  3DB4 A;  3CC4 A;  3CD6 A;  4M78 B;  1NG2 A;  2J6F A;  2YRV A;  5J26 A;  1SG5 A;  4OB1 B;  4JJB A;  1I1J A;  1WXT A;  3EG0 A;  1VQO A;  3L2U A;  1M90 C;  1O9S A;  1NLO C;  3G6E Q;  4V2S A;  3JCM e;  5FRN A;  3S3N A;  2MYS A;  1I8F A;  4KBM B;  1UJ0 A;  3JCM h;  2OAU A;  3L2R A;  4DA4 A;  1M3A A;  3CCQ T;  2X35 A;  2K2V A;  1ZLM A;  1KC8 R;  3M57 A;  2M9U A;  1KQ2 A;  1NM7 A;  4NS5 A;  2K3Y A;  4M77 B;  3CBO A;  4ZTJ A;  2LJ3 A;  2EWN A;  1C1A A;  1I0C A;  4XQ3 A;  1K73 C;  2VGM A;  2FZC B;  2RQT A;  1NZ9 A;  5GAO p;  2OTJ T;  1RAA B;  4C0D C;  1IHW A;  3PVL A;  1W4S A;  3CME A;  1B07 A;  3R6N A;  4M7A F;  2CZ7 B;  4RMO A;  1QVF A;  2EJ9 A;  3QKJ A;  3I55 Q;  1N8R C;  3X20 B;  1S72 T;  2NUP B;  2ABL A;  2R57 A;  3M55 A;  2YUO A;  1VUB A;  1SPK A;  3VS7 A;  1B34 B;  2J6O A;  2L5Q A;  3CCU Q;  3QZ9 B;  4HCZ A;  4ZTF A;  4PJO B;  2AK5 A;  1SF9 A;  2E70 A;  5CCA A;  2HSE B;  2VVK A;  2X4X A;  2CYZ B;  2HQX A;  3OSV A;  5GAN 3;  3OY9 A;  1JEG A;  4JLI A;  4LUD A;  4M7D B;  3EFO A;  4RTW A;  1M9S A;  2J05 A;  1X75 C;  3GP8 A;  3H6Z A;  2O2O A;  5IHK A;  2RK1 A;  3OW2 S;  2MPX C;  3L2Z A;  2DLP A;  1UGS B;  3R6O A;  1OX9 A;  2HQH A;  2DL5 A;  3QJ6 A;  1RAG B;  1G83 A;  1ARK A;  1OI1 A;  2DA9 A;  1J3T A;  2JUF A;  3EAE A;  3PMI A;  2KDS A;  3OMC A;  3M4Y A;  1E6H A;  4HT8 A;  5LJ3 f;  4F14 A;  2KK4 A;  4XAX B;  2K9G A;  5HKC A;  2FYK A;  2FB7 A;  2DXT A;  3NPF A;  2FG0 A;  5GAM f;  3ASK A;  4X9C A;  2BZY A;  1Y71 A;  3QWY A;  1VQK A;  2CGH A;  2JMA A;  2HL3 A;  5CK9 A;  1RAH B;  1GL5 A;  3HRT A;  1D0X A;  3OW2 P;  2FPF A;  4JS4 A;  3N5B B;  2QGG A;  3CCJ A;  2DXB A;  2LT4 A;  1WDX A;  2DX1 A;  2CSQ A;  5A0D A;  5I2S A;  3I56 A;  4CC3 A;  3BW1 A;  1M4Z A;  3A98 A;  5IHN A;  2CP2 A;  1VIE A;  4JZ4 A;  2P84 A;  3JB9 I;  5IAY A;  1NBE B;  2JTE A;  1QQJ A;  1WPY A;  2LCC A;  2BTT A;  3SD4 A;  3S3O A;  3CCS T;  3CCV T;  3WVE B;  1CKA A;  2QQR A;  1YI2 T;  3MJX A;  3MKD A;  1OPL A;  1YJ9 Q;  3V7C A;  5LJ5 f;  2HSP A;  1VQL A;  4VUB A;  1WJR A;  1D09 B;  4WF2 A;  3KBG A;  2DF6 A;  2JVV A;  2OX7 A;  1G2B A;  3RER A;  2KRO A;  3MEV A;  5GAN e;  4K11 A;  2XG8 D;  3E9G A;  5L8R E;  3G71 Q;  4QKU A;  5KYW B;  5GAN h;  1QVG P;  1JRI A;  5LJ3 j;  4IKF A;  1ZUU A;  5CKB A;  3J7A F;  1WXB A;  1FMV A;  4J9D A;  1MMD A;  1WIE A;  1Y0M A;  1RAF B;  2K57 A;  5C0M A;  5A0L A;  1JXO A;  3CQT A;  2PUO B;  3VKI A;  1UGP B;  4BDY A;  2EYW A;  4L6V 5;  5AYF A;  1TH7 A;  3SB2 A;  4PJN A;  3RDV A;  2XKO C;  1MMN A;  2H8H A;  3BFM A;  3OYL A;  4MDX A;  4XU2 A;  1ZA2 B;  4JPB W;  4QT7 A;  3VS6 A;  2XIC A;  4C8Q C;  4RG2 A;  1KFZ A;  1N5Z A;  5D7U A;  3VS3 A;  2AKL A;  2QAS A;  1K8A R;  1ZSZ A;  1WGS A;  4J9C A;  3OYB A;  3RNJ A;  3OYH A;  5GAN 4;  1X43 A;  2O88 A;  1YFN A;  2MMP A;  2AIR B;  3M0R A;  2DBM A;  5IHI A;  2P4R A;  3QWX X;  5LJ5 j;  4JRK A;  3OYM A;  4J6X A;  1Q7Y R;  1KJW A;  2X51 A;  2DRK A;  2ZGW A;  3HPW A;  2EBP A;  3QDF A;  4WCI A;  1TG0 A;  3VS5 A;  1IRX A;  3MEU A;  3OW2 A;  5IXB A;  1VA7 A;  3QDR B;  2CT4 A;  4M78 F;  2EIF A;  2XDP A;  2XDB A;  4F16 A;  1MND A;  2V8I A;  2DTI A;  2ZPG B;  1KG1 A;  4D8D A;  1N9S A;  1ZUY A;  2D9T A;  1YCS B;  2QAZ A;  3PNW C;  2GNC A;  6AT1 B;  2F69 A;  5KYX A;  1R0C B;  4II1 A;  4X9D A;  3EGX A;  2RI2 A;  2HKQ B;  1MMA A;  3LLR A;  4BDZ A;  1KHC A;  2E4H A;  2GGR A;  3S3M A;  1AT1 B;  2F2V A;  1I4K 1;  3JCM X;  1Y7X A;  1LCK A;  3JSC A;  2DIQ A;  1B7T A;  2YXY A;  3GLX A;  2ZCF B;  3EGD A;  5DM7 R;  4M77 F;  1VIF A;  1SHG A;  2Z0W A;  5GAO q;  1IXD A;  3WVD B;  5KYU B;  5A2Q E;  5FWC A;  2ROL A;  4FU6 A;  3INZ A;  1YCY A;  3OS1 A;  2DNU A;  3I55 A;  1U8R A;  3CCL T;  3H0F A;  2EGA A;  2NUT B;  3QO3 A;  3CCE T;  2L2P A;  1K9M C;  4C8Q D;  2FZG B;  2QI2 A;  4R55 A;  4JZ3 A;  3CCU A;  1NEG A;  3PVQ A;  2RPN A;  1SKU B;  4EMK A;  2E10 A;  2QQA A;  4BI3 A;  2RH2 A;  3VUB A;  2EJG A;  3UPU A;  1VQ9 Q;  3C12 A;  4B9X A;  4RTX A;  3MP1 A;  1OOT A;  4RUG A;  2EQK A;  2KE9 A;  1YIT Q;  2A3L A;  1TS9 A;  1WHH A;  2DTH A;  3VV0 A;  3MHX A;  2QTV A;  1ZBJ A;  1KK7 A;  4JRP A;  2ECZ A;  1WNL A;  1KD1 U;  1UGV A;  3JB9 H;  2GCX A;  5KH6 A;  3V8K A;  3CC7 T;  2SEM A;  2JM9 A;  2GQV A;  4XU0 A;  4PLL A;  4ZN1 A;  3JCM P;  1YIJ Q;  2DPP B;  1IRE B;  4MZP A;  2EVR A;  2PNI A;  2RM4 A;  4A4H A;  3VYG A;  2NLU A;  1ZHI A;  2CP7 A;  2QK0 A;  2WSE E;  3HKS A;  4FCY A;  2HCK A;  1AWW A;  3FLG A;  5GAO m;  2QQ9 A;  3PGG A;  2WSF E;  3CC2 A;  3JCM d;  1YJN A;  2YUQ A;  3GNF B;  1NJI R;  1UEC A;  2KXC A;  2DK3 A;  5DLO A;  3SWN A;  2I0N A;  3QG1 A;  4PJJ A;  2MI6 A;  2DL7 A;  1PM3 A;  5GAN 2;  4QVZ A;  2X4Y A;  1WXU A;  2OTJ Q;  1PSF A;  4FYY B;  3CCM Q;  1FXX A;  4PKC C;  1M1F A;  2HBP A;  4HXJ A;  3SDZ A;  4D6W A;  1YJW T;  5KYY A;  2NUZ A;  3CCR T;  4C5E A;  2YDL A;  2JTM A;  1RAE B;  4M75 A;  3EFO B;  1S72 Q;  1N6A A;  2KXD A;  1TWB A;  3FEO A;  2HL5 C;  3CMA A;  4XTU A;  1YJ9 A;  1VQ7 T;  1KD1 C;  4J9E A;  5DLQ E;  2RJC A;  1M2V B;  3I9Q A;  2AZS A;  2KYM A;  2AT1 B;  2QEX A;  5AT1 B;  2JOY A;  2V1Q A;  3I5R A;  3SHW A;  1PSE A;  3VS0 A;  1LOJ A;  2O01 E;  1TSF A;  3G71 A;  3CPW S;  2A7Y A;  1MGQ A;  1TU0 B;  2HBW A;  1SSH A;  3PFS A;  4AT1 B;  4C5G A;  5I11 A;  1NPR A;  3VS2 A;  2RQW A;  5FW9 A;  3HP9 A;  4MDW A;  1SRM A;  1QCN A;  2RF0 A;  4OGE A;  5LJ3 g;  2LQW A;  4LE9 A;  1PCX A;  2DE0 X;  2IPO B;  1MV3 A;  3QXE B;  2E1H A;  4NOY A;  5GAM g;  4Q5W A;  4BB7 A;  2DL3 A;  2ROT A;  3P8B B;  2JMC A;  1T3L A;  2R5M A;  1OPK A;  2LJ1 A;  5CVI A;  3EH2 A;  2LX7 A;  1I07 A;  3Q1J A;  4FT2 A;  1WYX A;  3VS1 A;  3CPW P;  3CME T;  3FRN A;  1GCQ C;  4XTY A;  5M9O A;  3M5A A;  4M78 C;  3PTA A;  1PWT A;  1UHC A;  2YUN A;  5HK3 A;  4RTT A;  3JB9 D;  5D6Y A;  1X2Q A;  3NHN A;  4ELY C;  2QA4 Q;  2EAY A;  1WQ7 A;  1KQS S;  3REA B;  4C8Q F;  1WA7 A;  1XNI A;  1S1N A;  1TXQ A;  2G3R A;  3OYF A;  1VQN T;  2PUK B;  1KQ1 A;  3OYY A;  2L0A A;  4DBR A;  4A4G A;  3CCV Q;  5ECA A;  5LJ5 g;  4M7A A;  1RAC B;  1YI2 Q;  4RKU E;  2RHY A;  2PZ1 A;  1VQM T;  1AD5 A;  2LCS A;  2K5F A;  4O6J A;  3P8D A;  5IXF A;  1Y07 A;  4AFQ C;  2RJD A;  4BI8 B;  2FPE A;  4M77 C;  2X9H A;  2VXF A;  1W70 A;  4ESR A;  4N4I A;  2EQI A;  2LQ8 A;  1KQS P;  2K6D A;  4NL3 A;  1K4U S;  2GFU A;  4C92 E;  5GAN d;  2AKK A;  5CIU A;  3QPH A;  4FT4 A;  2CSI A;  1ZSZ B;  1Z9Z A;  2MAM A;  4XTZ A;  1BIB A;  3JRZ A;  1HD3 A;  3DB3 A;  5IN1 A;  2RJE A;  2LQK A;  2E5Q A;  3VYH B;  2DVJ A;  4J9F A;  1IB8 A;  4OB3 B;  2R58 A;  1OU9 A;  2CRE A;  3T9N A;  4PJO C;  2MIO A;  2VGN A;  1Q82 R;  3CCJ T;  4M75 G;  4PL6 A;  3I56 T;  3RIR A;  2MWO A;  3C95 A;  2DEQ A;  3WXM B;  4M7D C;  2DFU A;  1VQ5 Q;  1G5V A;  1QP2 A;  2J06 A;  3RES A;  5GAN 8;  2F2W A;  1VOM A;  1M30 A;  3A8L B;  4DOV A;  2C0O A;  4FSS A;  3G4S T;  1T3S A;  4M78 D;  1Q86 U;  1VQ9 A;  1VQ8 T;  1YIT A;  1YHQ T;  2JZ2 A;  4IUV A;  1QCF A;  2ZAE A;  1ZUK A;  2KMT A;  4KGZ B;  3EGX B;  4UC4 A;  5GMK e;  2WSC E;  5I22 A;  1M1K R;  2K5I A;  1SEM A;  4B9W A;  5GMK h;  3M0P A;  3UAT A;  2BUD A;  2EGC A;  1N9R A;  3RKX A;  4BI4 A;  1YIJ A;  3O5Z A;  2FRY A;  2D1X A;  2CUD A;  3EGD B;  1UFF A;  2XK0 A;  2DZ9 A;  5IH2 A;  3H0I A;  2ED1 A;  3RR6 A;  1GXI E;  4M77 D;  1Q81 U;  3LH0 A;  1NLP C;  3M54 A;  5I21 A;  1LPL A;  1D1C A;  4KUI A;  8AT1 B;  2CKK A;  3NTH A;  5KCO A;  2YRC A;  1VQ6 T;  2YUP A;  3CBP A;  4M75 E;  4QQG A;  4ANJ A;  2X3X D;  2AZV A;  2JS2 A;  4C92 B;  2IVW A;  3NTK A;  1Y57 A;  1C6V X;  4E6R A;  2QDY B;  3OBY A;  1SSF A;  1X6O A;  3KUF A;  2O9V A;  1QVG S;  4DBQ A;  2OTJ A;  3CCM A;  1JXM A;  2M16 A;  4EMK B;  1Q86 C;  4M7A G;  2DBK A;  3ZBD A;  1VYV A;  4GLM A;  2K5L A;  5GAO r;  2ENM A;  3JB9 F;  4PJO D;  5KCH A;  1X01 A;  3CCL Q;  1M90 R;  1S72 A;  1XTD A;  1U06 A;  1PRM C;  4KUD K;  1GBQ A;  1VYU A;  4HKE A;  4XU1 A;  4M7D D;  2D8J A;  1VYT A;  2BE9 B;  2G6F X;  2XI9 A;  1LJO A;  3H0H A;  2Y90 A;  5CO7 A;  1ACM B;  1D3B B;  4JUV A;  1BK2 A;  2V8J A;  4DOW A;  1H8K A;  1Q81 C;  2KEA A;  2P0P A;  4XTV A;  1WHG A;  1K73 R;  1M1G A;  2QDL A;  3JCM b;  2X3W D;  1VQ4 T;  1IGQ A;  4TVR A;  4Y28 E;  3M9Q A;  5GAM j;  4F7U F;  1R77 A;  5CQY A;  5C6S A;  1AOJ A;  4KGV B;  2F5K A;  3ZFJ A;  4M78 A;  3X28 B;  2E5K A;  3P8H A;  1X69 A;  3SWN B;  1N8R R;  3MEA A;  4LXC A;  3EG1 A;  3MP8 A;  2GFA A;  2LVM A;  4R56 A;  2FO0 A;  4J9H A;  3HRS A;  3ZL7 C;  4PLI A;  4M7A E;  3FDR A;  3CXC S;  5J39 A;  1G8X A;  4FW1 A;  2A08 A;  3MP6 A;  2O4X A;  3EG9 A;  4QQ6 A;  4RTV A;  5KYY B;  3TU4 K;  3JCM Q;  2E6Z A;  4M75 B;  3JCM c;  3UT1 A;  2AHJ B;  2BE7 D;  3H9N A;  5KYN A;  3TCJ A;  4JRQ A;  1ABQ A;  4OMP A;  4LDW A;  2R5A A;  4LDV A;  2L3R A;  1EZZ B;  2QA4 A;  4N0A C;  1NEB A;  2KT8 A;  2CZ1 B;  2XU8 A;  4IUT A;  1X6G A;  4ZGE B;  1YJW Q;  4IUQ A;  3CCV A;  4A4K A;  3CCR Q;  1K9M U;  4HA8 A;  4QVD A;  1YI2 A;  1ZSG A;  3CXC P;  4RG8 A;  4JJD A;  1VQ7 Q;  2J6K A;  2W10 A;  1UJY A;  2E41 A;  4GLK A;  2LRQ A;  2EYZ A;  4FW2 A;  3OYI A;  2C06 A;  3G6E A;  1RUW A;  3OMG A;  3BE3 A;  3JAM E;  4RTU A;  4JRI A;  1OZ3 A;  1JJ2 P;  2A37 A;  3HL8 A;  2VWF A;  4IUP A;  3UWN A;  2PU9 B;  1AEY A;  2HQE A;  2PTK A;  5FU6 B;  4E7I A;  1B3Q A;  2FPD A;  2OI3 A;  4AFS C;  2LQN A;  4C0Z A;  2K79 A;  3M0S A;  1AVZ C;  3GNG A;  4ME7 A;  3QUI A;  3FB9 A;  3CC2 T;  1IGU A;  4QW2 A;  1DJ7 B;  1YJN T;  5GMK i;  4X34 A;  1M8M A;  3BDU A;  5LJ3 e;  2OTL Q;  1QVG A;  4M4Z A;  2K4Y A;  1PHT A;  4EMG A;  3LGL A;  4L59 A;  5LJ3 h;  4JJN K;  4BE1 A;  4AFZ C;  1TOV A;  1RI0 A;  4A53 A;  1G3Y A;  3E2U A;  1V1C A;  4RCC A;  1PC0 A;  4QQD A;  3SFM A;  2C0T A;  2VV5 A;  5GAM e;  3OYD A;  1SRL A;  3NGP A;  2RQV A;  5GAM h;  1QKX A;  2PQW A;  1VQ5 A;  1H3Z A;  4M7A B;  3F70 A;  2DXC A;  3ULR B;  2KGT A;  5FU7 B;  1WLP B;  4PJO F;  2KT1 A;  4IUR A;  4OMQ A;  1VQP Q;  2EJF A;  3CMA T;  1KC8 U;  2NYS A;  1K76 A;  3QZ5 B;  3RBB B;  1VQN Q;  2E3H A;  2QQS A;  2DM1 A;  2J7I A;  4M7D F;  3EG3 A;  3PMT A;  4OMM A;  3JCM f;  2QEX T;  2O31 A;  3BDL A;  1T0H A;  2KYB A;  2DVE A;  1W2B S;  2MOX A;  3M4G A;  5GAN 7;  4KH1 B;  1M5Q 1;  3O8V A;  2K3B A;  4M78 G;  5GAO l;  1VQM Q;  3QYG B;  1BYM A;  4CI0 C;  3G71 T;  3OQ5 A;  2LDM A;  1K0X A;  1P92 A;  1PNJ A;  1I5O B;  2CT3 A;  5LJ5 e;  1M27 C;  4KRT A;  1AWO A;  2MK5 A;  1IZ6 A;  3X25 B;  5LJ5 h;  1RL2 A;  3J80 E;  3E19 A;  1T0J A;  3M58 A;  1QWF A;  2KVQ G;  3JV3 A;  2M1H A;  3CCQ Q;  3GPL A;  4JLG A;  2RNA A;  2CZ0 B;  3QBY A;  4AMC A;  4PFZ A;  5EG2 A;  4KH0 B;  1R0B G;  4EMH A;  5KYW A;  2GQI A;  2RQR A;  1OEB A;  1AZE A;  2DL8 A;  3OYG A;  2LT1 A;  4C5H A;  5CQX A;  1W2B P;  2JN0 A;  4CRI A;  1E7O A;  2YHT A;  3FJP A;  5D6X A;  4C92 F;  1TUC A;  2IIM A;  2EGE A;  2FRW A;  3V8L A;  1O75 A;  1OZ2 A;  4R0K A;  1BCM A;  2LZ6 B;  1H64 1;  2XHC A;  2P4T A;  1KC8 C;  2E3I A;  3OBW A;  3HFO A;  1QP3 A;  1WFW A;  1QVF S;  1QKW A;  1IO6 A;  1W6X A;  3OYC A;  4GY5 A;  2E64 A;  3OB9 A;  3CC4 T;  4A54 A;  3G4S Q;  1I81 A;  3C94 A;  4J6Y A;  2DKG A;  3CD6 T;  1WZO A;  2PVO B;  1ABO A;  3RUX A;  1ZBX A;  5HK0 A;  2DO3 A;  1VQO T;  2LJ0 A;  1IHV A;  5I2M A;  1VQ8 Q;  1K0S A;  1YHQ Q;  4EIK A;  4C8Q A;  1XQH A;  2MCN A;  2MWP A;  4Z8A A;  2RO0 A;  1A0N B;  1GFD A;  1CKB A;  4AG2 C;  1K1Z A;  4BY6 B;  2VB6 A;  1UTI A;  1EX4 A;  1QCO A;  2LCL A;  1QVF P;  3X24 B;  2KNB B;  3EHR A;  4OMO A;  3V8J A;  1JBM A;  2QQB A;  1HXD A;  4B6M A;  3GBQ A;  3G1J A;  3VUZ A;  2D6F A;  3OS2 A;  4BUG A;  1K9M R;  2DD4 A;  3VS4 A;  3PE0 A;  4PFO A;  4A63 B;  4OF1 A;  3QJY A;  4OB0 B;  1VQ6 Q;  5GAN 6;  2NWM A;  3EFR A;  3SEM A;  4OB2 B;  4E47 A;  1HSQ A;  2ZPB B;  4PJL A;  2I2L A;  2PVD B;  2YWW A;  1M2O A;  4OGC A;  1KHI A;  2W0Z A;  3A8M B;  2HEQ A;  1WQW A;  2ESW A;  5CKE A;  5A0G A;  4OP0 A;  4J83 A;  3NFC A;  2BKD N;  1JB0 E;  1X2K A;  1PKT A;  2LC4 A;  1D1B A;  1UEB A;  5GMK m;  4CC7 A;  4FYW B;  2DER A;  4J9B A;  2SRC A;  3EH1 A;  3QHS A;  3CCS Q;  5GAN f;  1YJW A;  1AZG B;  1G3S A;  3CCR A;  2MF2 A;  3OA6 A;  2ZPI B;  2YRD A;  4L5G A;  1YIT T;  1U1S A;  2JTF A;  1VQ7 A;  2F2X A;  1JO8 A;  3L2Q A;  3AT1 B;  2RA2 A;  2EPD A;  5LL6 S;  4HVV A;  1ZSZ C;  1C0M A;  2X4W A;  1V76 A;  2L8D A;  4FSX A;  2HZY A;  3I35 A;  2GTJ A;  2KI7 A;  2IG0 A;  3NMZ C;  1K8A U;  1YIJ T;  5DY9 A;  1UDL A;  1PD1 A;  3GIB A;  4OMF B;  2RJF A;  4LDU A;  4PFP A;  1OV3 A;  4CC4 B;  2RHX A;  1VQ4 Q;  4BE0 A;  2CP3 A;  1VQK T;  2GTO A;  1GCP A;  2O4X B;  2XMF A;  3EG9 B;  4DEX A;  4J8O A;  4MMK A;  3UDC A;  1YWP A;  1MV0 B;  1PG5 B;  3QYH B;  3M0Q A; 
#chains in the Genus database with same CATH homology
 1Q7Y U;  4EDU A;  3CEY A;  2X4J A;  4IUU A;  2XI9 A;  5CKD A;  2XD0 A;  2KY9 A;  4E7K A;  1LJO A;  2OTL A;  4KUL A;  3A8O B;  2FL7 A;  2Y90 A;  4BAC A;  5CO7 A;  4M7D G;  4XK8 E;  2RHU A;  4FM4 B;  1VIF A;  1D3B B;  3TEE A;  2DD5 A;  2YLC A;  1AHJ B;  4JUV A;  2V8J A;  2KQW A;  5GAO q;  4DOW A;  4MZM A;  1Q81 C;  3WVD B;  3LWH A;  5KE2 A;  2GF7 A;  2P0P A;  3M53 A;  5A2Q E;  4XTV A;  3JCM W;  4PNO A;  4FU6 A;  4Y91 A;  4DQ2 A;  3INZ A;  3CC7 A;  1YCY A;  3CCM T;  1M1G A;  1Y96 A;  3ME9 A;  3JCM b;  3S6W A;  1BI0 A;  4FIB A;  3OS1 A;  1VQ4 T;  4HT9 A;  4LD9 K;  3I55 A;  1U8R A;  3CCL T;  4TVR A;  4M77 E;  4E7H A;  4Y28 E;  3A8G B;  3M9Q A;  3PT9 A;  3QO3 A;  3M59 A;  5GAM j;  2VUB A;  4F7U F;  5CQY A;  5GAN j;  5C6S A;  3HFN A;  3CCE T;  1WJS A;  3X26 B;  1K9M C;  4C8Q D;  2F5K A;  2QI2 A;  4R55 A;  3ZFJ A;  2CZ6 B;  4M78 A;  4N0A A;  4F7U B;  3CCU A;  3X28 B;  1VQP A;  3P8H A;  4C8Q G;  2ZPE B;  3OYA A;  4EMK A;  3SWN B;  1VQL T;  2E10 A;  3E1S A;  1MHN A;  3MEA A;  4MZT A;  1M90 U;  2QQA A;  4C0D B;  3BY7 A;  4BI3 A;  2RH2 A;  3MP8 A;  2GFA A;  3GF5 A;  3L1A A;  2EJG A;  2LVM A;  2E65 A;  3VUB A;  3UPU A;  1VQN A;  2Y4Y A;  3C12 A;  4B9X A;  4R56 A;  1K8A C;  1M1K C;  5GMK l;  3MP1 A;  2KAF A;  3CPW A;  2EQK A;  3HRS A;  2A3L A;  2OTL T;  4PLI A;  3ZEH A;  1YBY A;  4M7A E;  3FDR A;  2DTH A;  2RI5 A;  5J39 A;  2VYT A;  3CXC S;  1M8V A;  2RD1 A;  3VV0 A;  3MHX A;  2LTO A;  3AHU A;  4C92 G;  2DXU A;  4M75 F;  3MP6 A;  2O4X A;  3J81 E;  2HAX A;  1VQM A;  3VU3 C;  2P0K A;  4QQ6 A;  4A4F A;  4JRP A;  3TU4 K;  3DLL A;  3JCM Q;  2E6Z A;  1U1T A;  1WNL A;  1NPP A;  2VXE A;  1ZQ1 A;  5D6W A;  1KD1 U;  3JB9 H;  2GCX A;  4M75 B;  3V8K A;  5KH6 A;  4JS5 A;  3CC7 T;  2ZPF B;  3JCM c;  2AHJ B;  2GQV A;  4XU0 A;  1BIA A;  4PLL A;  3UT1 A;  4LDX A;  4C92 C;  4ZN1 A;  3TCJ A;  4JRQ A;  4PJO E;  5KE3 A;  3JCM P;  3LWI A;  2DPP B;  2FHD A;  1IRE B;  4LDW A;  1Q7Y C;  1K73 U;  4MZP A;  5GMK j;  2R5A A;  4LDV A;  2L3R A;  2DZC A;  3HHT B;  3MET A;  2QA4 A;  2RM4 A;  4A4H A;  1V29 B;  4N0A C;  3VYG A;  4XTW A;  2B8A A;  4J6W A;  5FRO A;  4E7L A;  2NLU A;  4M7D E;  3CCQ A;  1ZHI A;  1VQ9 T;  4EMK C;  3CPF A;  2WSE E;  2CZ1 B;  3HKS A;  1VQP T;  4RCB A;  2XU8 A;  4IUT A;  4ATO A;  4EPC A;  4ZGE B;  1W2B A;  2RI3 A;  3FLG A;  4IUQ A;  5GAO m;  3CCV A;  2QQ9 A;  4A4K A;  3PGG A;  3EFS A;  2XDD A;  1K9M U;  4ZN3 A;  2WSF E;  4HA8 A;  3CC2 A;  4QVD A;  3JCM d;  1YI2 A;  1G3W A;  1N8R U;  4HCB A;  1YJN A;  2H3J A;  4RG8 A;  3DB4 A;  3GNF B;  3TRE A;  2QTX A;  3CC4 A;  4F7U A;  2E41 A;  3CD6 A;  3URG A;  2DK3 A;  3DKM A;  4GLK A;  2LRQ A;  4M78 B;  3JCM J;  3G7Z A;  2YRV A;  5DLO A;  3SWN A;  3OYI A;  2C06 A;  5J26 A;  1QVP A;  3QG1 A;  4OB1 B;  3G6E A;  2MI6 A;  3OMG A;  1UGR B;  5GAN 2;  4QVZ A;  3JAM E;  4JRI A;  1VQO A;  1KQS A;  3L2U A;  3DLM A;  2X4Y A;  1WJQ A;  2EQJ A;  1OZ3 A;  2XID A;  4FL6 A;  4C8Q E;  1PSF A;  1M90 C;  1O9S A;  1FXX A;  3FIF A;  3HL8 A;  1N27 A;  4V2S A;  4IUP A;  3JCM e;  3UWN A;  5FRN A;  3S3N A;  4PKC C;  2PU9 B;  5LJ3 d;  1M1F A;  2HBP A;  1I8F A;  4N4H A;  3SDZ A;  2QA4 T;  2LX9 A;  4D6W A;  4KBM B;  2F5T X;  1YJW T;  3JCM h;  2OAU A;  3L2R A;  4DA4 A;  2HQE A;  3CCR T;  4C5E A;  5FU6 B;  2JTM A;  3CCQ T;  2X35 A;  2K2V A;  3QSU A;  4E7I A;  3M57 A;  4M75 A;  2M9U A;  5GAN 5;  1N6A A;  4C0Z A;  3FEO A;  5GAM d;  1KQ2 A;  3CMA A;  4XTU A;  1YJ9 A;  1VQ7 T;  1KD1 C;  3GNG A;  3G4S A;  5DLQ E;  4ME7 A;  3QUI A;  2K3Y A;  4NS5 A;  2RJC A;  3FB9 A;  4J5Y A;  4M77 B;  3CC2 T;  2JNG A;  4QW2 A;  3CBO A;  1DJ7 B;  4ZTJ A;  4LDY A;  1YJN T;  5GMK i;  3L42 A;  2EWN A;  4X34 A;  3JCM g;  2QEX A;  3BDU A;  4XQ3 A;  4BD3 A;  3RMQ A;  1K73 C;  2VGM A;  5LJ3 e;  3LX7 A;  1QVG A;  1NZ9 A;  3E9F A;  2JOY A;  3SWN C;  5GAO p;  1VQ8 A;  2K4Y A;  1YHQ A;  2OTJ T;  4C0D C;  4EMG A;  3LGL A;  4L59 A;  5LJ3 h;  4JJN K;  4BE1 A;  1NJI U;  1PSE A;  1RI0 A;  4A53 A;  1G3Y A;  3G6E T;  4J7I A;  1LOJ A;  2O01 E;  4RCC A;  1W4S A;  4QQD A;  3SFM A;  3G71 A;  3HSB A;  2VV5 A;  3A8H B;  5GAM e;  2A7Y A;  4YTL A;  3CME A;  3CPW S;  1BYM A;  3OYD A;  4M7A F;  1MGQ A;  2CZ7 B;  3PFS A;  4RMO A;  3RKW A;  4C5G A;  1QVF A;  5GAM h;  1NPR A;  2EJ9 A;  2PQW A;  2DTO A;  3QKJ A;  3RMS A;  1N8R C;  1VQ5 A;  3X20 B;  2HD0 A;  1H3Z A;  3HP9 A;  4M7A B;  3F70 A;  4MDW A;  1S72 T;  3M55 A;  2R57 A;  4OGE A;  5LJ3 g;  2DXC A;  1VUB A;  4C5I A;  4M75 C;  1QW1 A;  1B34 B;  5FU7 B;  4PJO F;  2L5Q A;  4IUR A;  3QZ9 B;  1FX7 A;  4JDS A;  3QXE B;  2E1H A;  2EJF A;  3CMA T;  4C92 D;  2EFI A;  4HCZ A;  4ZTF A;  2QXF A;  4NOY A;  2ZZD A;  3V7S A;  5LJ5 d;  5GAM g;  1KC8 U;  2DIG A;  4BE2 A;  4PJO B;  3QZ5 B;  4Q5W A;  4BB7 A;  2QQS A;  4A4E A;  2E70 A;  5CCA A;  4M7D F;  1R8O B;  1VQ6 A;  2KSS A;  2X4X A;  3PMT A;  3JCM f;  2CYZ B;  2HQX A;  3BDL A;  2QEX T;  1BKB A;  2EYQ A;  5HY6 A;  3OSV A;  5GAN 3;  3OY9 A;  4P5N A;  3P8B B;  4JLI A;  5CAI A;  2DVE A;  4M7D B;  2R5M A;  1M9S A;  1W2B S;  1X75 C;  3GP8 A;  3M4G A;  5CVI A;  5GAN 7;  3H6Z A;  1M5Q 1;  2RK1 A;  3O8V A;  3Q1J A;  4FT2 A;  4M78 G;  3OW2 S;  5GAO l;  3L2Z A;  3QYG B;  4CI0 C;  3I55 T;  3OS5 A;  1UGS B;  3G71 T;  4Z02 A;  3OQ5 A;  3R6O A;  4M77 A;  3CME T;  2BIV A;  3FRN A;  2LDM A;  3QJ6 A;  4XTY A;  1JJ2 S;  1P92 A;  1OI1 A;  3M5A A;  4ZGJ B;  2L89 A;  5M9O A;  5LJ5 e;  5FRM A;  2JUF A;  4M78 C;  3PTA A;  3CBM A;  1VQ5 T;  1HK9 A;  3EAE A;  3PMI A;  4E7J A;  1IZ6 A;  2KDS A;  3OMC A;  3X25 B;  1RL2 A;  3M4Y A;  5HK3 A;  5LJ5 h;  5D6Y A;  3E19 A;  3J80 E;  3CCU T;  3JB9 D;  4HT8 A;  1FWZ A;  3M58 A;  5LJ3 f;  4XU3 A;  4ELY C;  2EAY A;  2KVQ G;  4XTX A;  1WQ7 A;  1KQS S;  2KK4 A;  1XNI A;  4C8Q F;  4XAX B;  2M1H A;  3GOX A;  3CCS A;  2K3X A;  2G3R A;  3OYF A;  4JLG A;  5HKC A;  3GPL A;  3JB9 G;  2FYK A;  1NJI C;  4HCC A;  1VQN T;  2PUK B;  2CZ0 B;  2FB7 A;  2DXT A;  1KQ1 A;  3QBY A;  3OYY A;  4C8Q B;  3L2W A;  5EG2 A;  1LNX A;  5GAM f;  4A4G A;  4EMH A;  3ASK A;  5LJ5 g;  4X9C A;  3OS0 A;  4M7A A;  1Y71 A;  4MML A;  1VQK A;  2CGH A;  3OYG A;  2LT1 A;  5FU6 C;  4C5H A;  4RKU E;  2EKO A;  2RHY A;  5CK9 A;  5CQX A;  1VQM T;  2YLB A;  2JN0 A;  3FC3 A;  4CRI A;  4C92 F;  1B34 A;  2P0Q A;  1UGQ B;  2YHT A;  3FJP A;  2K5F A;  3HRT A;  5D6X A;  3JB9 J;  1BI2 A;  4O6J A;  4JS4 A;  3N5B B;  3OYK A;  3V8L A;  3P8D A;  1Y07 A;  2PVG B;  2RJD A;  1BI1 A;  1O75 A;  1OZ2 A;  4BI8 B;  3MCA B;  4M77 C;  2DXB A;  1H64 1;  2LT4 A;  3CCJ A;  4PJO A;  5A0D A;  4QVC A;  5I2S A;  3I56 A;  2XHC A;  1I5L A;  2P4T A;  2VXF A;  3BW1 A;  1M4Z A;  3HRU A;  1KC8 C;  3RKY A;  1XOV A;  4N4I A;  4KT0 E;  1VIE A;  4M7D A;  3LW5 E;  2LQ8 A;  1VQ4 A;  3JB9 I;  2WAC A;  5IAY A;  4NL3 A;  2GFU A;  4C92 E;  3OYN A;  4N4G A;  1WPY A;  2LCC A;  4F7U G;  4ELZ C;  3SD4 A;  5CKF A;  3S3O A;  3CCS T;  5GAN d;  2HNI A;  2RB6 A;  3CCV T;  3OBW A;  3WVE B;  3HFO A;  2QQR A;  5CIU A;  3QPH A;  2V8K A;  4FT4 A;  4ZGD B;  2Y4X A;  1QP3 A;  1YI2 T;  1QVF S;  4J7F A;  4GY5 A;  3OYC A;  4M7A C;  2E64 A;  2MAM A;  3OB9 A;  3V7C A;  4XTZ A;  3CC4 T;  4A54 A;  5LJ5 f;  1BIB A;  1I81 A;  3C94 A;  3DB3 A;  2DKG A;  3JRZ A;  4J6Y A;  1VQL A;  4VUB A;  1WJR A;  3CD6 T;  2PVO B;  2RJE A;  4WF2 A;  5IN1 A;  5FU7 C;  2LQK A;  3KBG A;  2E5Q A;  4M77 F;  3RUX A;  5GAO n;  2JVV A;  1ZBX A;  3VYH B;  4M75 D;  4OB3 B;  5HK0 A;  2R58 A;  2DO3 A;  1VQO T;  3RER A;  2FVU A;  2EQM A;  4NL2 A;  5I2M A;  3MEV A;  3T9N A;  4PJO C;  5GAN e;  2DJZ A;  1UB4 A;  3LGF A;  2VGN A;  4C8Q A;  1XQH A;  3CCJ T;  4M75 G;  2XG8 D;  3E9G A;  2MWP A;  4PL6 A;  5L8R E;  2RO0 A;  3I56 T;  5GAN h;  3RIR A;  2MWO A;  1JRI A;  3C95 A;  4BY6 B;  2DEQ A;  5LJ3 j;  4IKF A;  3WXM B;  5CKB A;  4M7D C;  3KXT A;  3J7A F;  1G5V A;  1QP2 A;  1G3T A;  3RES A;  5GAN 8;  4C92 A;  2RHZ A;  2K57 A;  2LCL A;  5C0M A;  3A8L B;  4DOV A;  1YJ9 T;  3X24 B;  2ZPH B;  3V8J A;  3G4S T;  1JBM A;  2QQB A;  5A0L A;  5GAN g;  1HXD A;  3VUZ A;  4C0F A;  2PUO B;  2D6F A;  3LYI A;  3OS2 A;  4BUG A;  3MO8 A;  4M78 D;  1Q86 U;  1VQ9 A;  2DD4 A;  3VKI A;  1UGP B;  4BDY A;  4L6V 5;  5AYF A;  1TH7 A;  3SB2 A;  1VQ8 T;  1YIT A;  1YHQ T;  4OF1 A;  3QJY A;  4OB0 B;  2JZ2 A;  4IUV A;  5GAN 6;  5CKH A;  2XKO C;  3EFR A;  2RHI A;  4OB2 B;  3QII A;  2KMT A;  1BI3 A;  3BFM A;  4UC4 A;  4E47 A;  3OYL A;  4MDX A;  2ZPB B;  4XU2 A;  2XIC A;  4C8Q C;  4RG2 A;  5GMK e;  2I2L A;  2PVD B;  2WSC E;  3M56 A;  4OGC A;  1KHI A;  3A8M B;  4F7U E;  2K5I A;  1WGS A;  1WQW A;  3OYB A;  5IT9 E;  5CKE A;  4B9W A;  5GMK h;  5A0G A;  4OP0 A;  4J83 A;  2BUD A;  3NFC A;  1N9R A;  2BKD N;  3RKX A;  1JB0 E;  3PIP A;  1Q82 U;  4BI4 A;  4C0G A;  1YIJ A;  3OYH A;  5GAN 4;  2M0O A;  2LC4 A;  2MMP A;  1UEB A;  2XK0 A;  3ER0 A;  5GMK m;  2DZ9 A;  1GXI E;  1D3B A;  4M77 D;  1Q81 U;  3LH0 A;  3VJP A;  3QHS A;  5LJ5 j;  5GAN f;  1OYX A;  3M54 A;  4JRK A;  4J6X A;  5I21 A;  3OYM A;  3CXC A;  1YJW A;  4KUI A;  2CKK A;  3OYJ A;  1G3S A;  3NTH A;  5KCO A;  2MF2 A;  3CCR A;  2ZGW A;  3HPW A;  3OA6 A;  3CBP A;  3L2V A;  1VQ6 T;  4M77 G;  4M75 E;  2ZPI B;  4QQG A;  1EIF A;  4L5G A;  1YIT T;  1Y96 B;  3PIO A;  1U1S A;  2JTF A;  1VQ7 A;  3MEU A;  2VC8 A;  3L2Q A;  3OW2 A;  4LD6 A;  4C92 B;  2IVW A;  2RA2 A;  3NTK A;  3QDR B;  4O5V A;  4M78 F;  3OYE A;  5LL6 S;  1JJ2 A;  2EIF A;  2RK2 A;  2XDP A;  5J3B A;  5CR2 A;  2XDB A;  4OVA A;  2CS7 A;  2V8I A;  2QDY B;  2X4W A;  2DTI A;  3OSS C;  2L8D A;  3C4S A;  3OBY A;  1SSF A;  2ZPG B;  1X6O A;  3KUF A;  4FSX A;  1QVG S;  1N9S A;  4M7A D;  1KG1 A;  2OTJ A;  3CCM A;  2D9T A;  2M16 A;  2IG0 A;  4EMK B;  1K8A U;  1M1K U;  1YIJ T;  3PNW C;  1Q86 C;  2D0Q B;  5DY9 A;  2F69 A;  3CCL A;  4M7A G;  4II1 A;  4X9D A;  2RI2 A;  3ZBD A;  3GIB A;  4OMF B;  2RJF A;  3MEW A;  1NE8 A;  2K5L A;  3LLR A;  4LDU A;  4BDZ A;  1KHC A;  3CCE A;  3S3M A;  5GAO r;  2RHX A;  2DAQ A;  2EQU A;  3JB9 F;  4PJO D;  1I4K 1;  3JCM X;  4M78 E;  1X01 A;  2LNV A;  5KCH A;  3H8Z A;  4BE0 A;  1Y7X A;  4BY6 C;  5FLX E;  1XTD A;  1S72 A;  3A5Z B;  4KUD K;  3JSC A;  1VQK T;  2O4X B;  2DIQ A;  4PJO G;  4J8O A;  3V7R A;  2E6N A;  4HKE A;  3JCM V;  2E12 A;  4MMK A;  4XU1 A;  3UDC A;  3GLX A;  4M7D D;  2ZCF B;  3NTI A;  5DM7 R;  3QYH B;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...