2VC8A

Crystal structure of the lsm domain of human edc3 (enhancer of decapping 3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Divergent Sm Fold in Edc3 Proteins Mediates Dcp1 Binding and P-Body Targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords ENHANCER OF MRNA-DECAPPING PROTEIN 3
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vc8A00
4XTVA 3RESA 1HXDA 4A54A 4M7AG 4C8QC 4NL2A 3EFSA 4F7UF 5LJ3g 3SWNA 1Y96B 4M77C 4M75G 1LNXA 4M78F 4M78D 4JUVA 4XU3A 4PJOA 4M7AB 4JRKA 4WF2A 4JLIA 1D3BB 4C8QG 4M7AC 4C92B 2FB7A 3L1AA 4M78A 5GMKl 3JCMd 4C8QF 1MGQA 3V7RA 3RERA 3SB2A 2DZCA 3JCMX 5GAMd 3SWNC 3JCMc 2RB6A 5GAN2 3SWNB 4M7DB 4M7DF 3RKYA 4PJOC 4C92F 2DXUA 4M75C 4C92D 5LJ5g 2EWNA 4NOYA 2DZ9A 4QVDA 4C8QB 2DVEA 5LJ3e 5LJ5e 1JBMA 5GANd 2YLBA 3VU3C 2RM4A 3FB9A 2EJ9A 4M78E 5GAN7 4M78B 2E65A 4XQ3A 3JB9I 1WNLA 3BW1A 3JCMW 2Y90A 1U1SA 5GAMg 2FYKA 4F7UG 3JCMJ 3AHUA 4EMKC 4DQ2A 4M7AF 5GAOl 1WPYA 4XTZA 5LJ3h 4C8QD 5GAN3 2ZGWA 1U1TA 3RIRA 4PJOE 5LJ5j 1KQ1A 4EMKB 1TH7A 4X9DA 2DXTA 5GAN6 2DEQA 2E10A 5GANg 5GAOm 5I21A 3EFRA 5GMKh 4V2SA 4N0AA 3JCMe 4C8QA 3QHSA 3BY7A 4Y91A 2K57A 3V7SA 4A53A 4M7DE 3INZA 3V8KA 3RKWA 3QUIA 1I8FA 1JRIA 4XU1A 4C92E 1Y96A 5GANh 3M4GA 3RKXA 4M7DC 3JCMf 4XTUA 4JRIA 4M7AA 1M8VA 1I81A 4M77E 4EMHA 4EMGA 1M5Q1 3PGGA 5LJ5d 4M7AD 3JCMb 2VXFA 4M77B 4J6YA 5GAMh 3BDUA 3JB9H 4OP0A 1LOJA 4XU0A 4M7AE 4M75E 2EJGA 4PJOF 3HSBA 1N9RA 3JB9F 4HT8A 4XTYA 1BIBA 1N9SA 3JCMh 5LJ3j 2HNIA 1YCYA 2E41A 4M77G 5GMKm 3L2ZA 3JCMP 4M7DA 3QO3A 5LJ3f 2E1HA 4PJOG 4C8QE 3JB9G 4RCCA 1X01A 5GAOn 3RUXA 2DKGA 3BFMA 3V8JA 4F7UA 2JN0A 2VXEA 3JCMV 2CGHA 1LJOA 2DTIA 2DTHA 4M7DG 5GAN8 4X9CA 5GAOq 1D3BA 2RD1A 5DY9A 5GAN5 1BIAA 1KQ2A 3JCMQ 1B34A 2EAYA 4J5YA 3GIBA 1I5LA 5GAN4 4N0AC 4XTWA 4C92G 4F7UE 2YHTA 1I4K1 4M78C 4M77F 4RCBA 4M7DD 1WQ7A 5GANf 2QTXA 4F7UB 4J6XA 4J6WA 4MMLA 3FIFA 3JCMg 3QSUA 3HFOA 2DJZA 4XTXA 2YLCA 5GANj 4HA8A 4M78G 5LJ5h 4M75D 4C92C 5GAOp 5GAOr 4NL3A 2DTOA 2E64A 5GAMf 3JB9J 4M75A 4HT9A 2RA2A 2VC8A 1HK9A 5GMKj 4QVCA 1B34B 5GAMj 2EJFA 4XU2A 1H641 3JB9D 4M77A 3V8LA 4PJOD 4PJOB 4PNOA 5GAMe 5LJ5f 5GMKi 1WQWA 4M77D 4EMKA 5GMKe 3FJPA 5CAIA 4C92A 2I2LA 5LJ3d 3V7CA 3HFNA 5GANe 4M75B 4M75F 4MMKA
chains in the Genus database with same CATH superfamily
1IB8A 1PSFA 5HKCA 1HSQA 5AYFA 5HCKA 3CPFA 2XK0A 3SFMA 3G4SA 2VGMA 3H8ZA 2KE9A 3UWNA 2DIQA 2CKKA 4EDUA 4OB0B 3JCMd 3ME9A 5GAMd 4B6MA 1GCQC 2QG9B 3WVDB 3HP9A 3VU3C 3QWXX 1RLQC 1K73U 5GAN3 3CCLQ 1U1TA 4ZGEB 2E4HA 4GY5A 4X9DA 5GMKh 1VQ6Q 1VYTA 1KSWA 3TSZA 5GANh 1CKAA 2ATCB 1XTDA 2KRMA 4M7AA 1ZBJA 8ATCB 3RMQA 3CXCA 4A63B 1BU1A 1G83A 2CH4W 3CCRA 4N4HA 2E1HA 4XAXB 2YDLA 2HSPA 3H9NA 3S3MA 3QYHB 4ZN1A 1G8XA 2A7YA 3SEMA 1ZSZA 1AD5A 1NJIU 2DVJA 2YRCA 1VQOQ 4IIMA 5GAN4 2DMOA 1WGSA 3UDCA 1F1BB 1KQSS 2VASA 4F17A 1H8KA 2D9TA 2LQWA 1J3TA 4QQDA 4Z89A 1B34B 4ANJA 1PM3A 4DBRA 1TXQA 1QLYA 3H0HA 1YBYA 5C0MA 2DRMA 3OBYA 2EYXA 5A0DA 5CAIA 2C0IA 3CCUA 3FJ5A 2XDPA 2HKNA 4A4KA 2CZ6B 5LJ3g 1TG0A 4M78D 2X35A 4XU3A 3OSSC 4M7AB 4AFSC 2DO3A 4R0KA 4C8QG 2BE7D 1WIEA 3OYCA 1Q7YC 5FWCA 1MV3A 5AT1B 2BE9B 3OMCA 4D8KA 4ZTJA 4Y92A 1QP2A 3S3NA 4M7DB 4KGZB 1TWBA 2JM8A 2QASA 1WFWA 1YITQ 1WZOA 4M75C 2ZPEB 1UGSB 4KGVB 2CP3A 2O4XB 3NTIA 2RJEA 4LDXA 3CC2A 2MYSA 1WXTA 1KQSP 3CXCP 1G2BA 4WTOB 1K0SA 2DXTA 4P5NA 5I21A 2PQWA 3TSWA 3VUZA 2H8HA 2K2MA 4C92E 1I8FA 2ED1A 3M0SA 3CMAQ 2KK4A 4QT7A 1IZ6A 3EHQA 4OP0A 4M75E 1YJ9Q 2EJGA 1OEBA 1N8RC 2QXFA 3MP6A 4DOVA 1Q95G 3MJXA 3VS6A 4RCCA 3M0PA 4PFOA 4F16A 2O31A 1RAHB 2FRYA 4F14A 4LXCA 1K9MU 3OW2S 1ABQA 5FWBA 5D6WA 2L2PA 4JS5A 2AZSA 1JXMA 4M77F 1WJRA 4R56A 3NMZC 4MMLA 3JCMg 1SSHA 4JRPA 1MMNA 2LNVA 4A4HA 1VUBA 3CCEA 4N4GA 2KGTA 2X51A 7AT1B 4AG2C 1JB0E 2KDSA 2CP5A 3S3OA 1GRIA 9ATCB 3CPWP 3A8HB 4MMKA 3QJ6A 2VVKA 4PJMA 1YJ9T 4F7UF 2L3RA 1LNXA 4IUPA 1PHTA 4MZMA 1LVKA 2VYTA 4WF2A 1PCXA 4RG8A 5M9OA 3CMAT 4HVVA 4PFPA 1QCOA 3QWYA 2RHXA 2L8DA 4IUUA 1O9SA 2EWNA 4IUVA 2RO0A 2MF2A 1WI7A 1VQ4Q 3JB9I 3J80E 3PE0A 1Q82R 1QCFA 1KC8U 3RIRA 2JMAA 2KI7A 3OYMA 1NYFA 2KROA 1G5VA 1PRMC 1QP3A 2K3YA 1E6HA 4ATOA 2YRDA 5HK0A 1BI1A 2DFUA 2MK5A 1JU5C 3INZA 4OMFB 1VQ5Q 2QQRA 1I07A 2X3XD 1EZZB 2PUOB 2OAWA 2H3JA 3OSVA 2C0TA 2EGEA 3H6ZA 4J6YA 1VQNA 2VWFA 5IH2A 2KSSA 3CC4A 3M55A 3MKDA 2HNIA 1UEBA 2KBTA 2M1HA 2JN0A 3JCMV 3REBB 3CCRT 1D3BA 4EPCA 3GIBA 3CMAA 2X4WA 1AVZC 1I4K1 4XK8E 2V8JA 2NUTB 3HRTA 2GBQA 2LZ6B 3VYHB 4XTXA 2EQMA 5LJ5h 1AZEA 4LUDA 1VQOT 1YJ9A 1VIEA 4VUBA 3G4SQ 3CMET 3M57A 3OYDA 1TU0B 3JV3A 2HBWA 3DLLA 2JTMA 4PJOB 4Y28E 4C5GA 4HCBA 1X69A 3TVTA 4ELYC 1JJ2S 3KBGA 4L59A 3JAME 1NBEB 4XTVA 3RESA 2GGRA 3TEEA 1OYXA 2F69A 2X9HA 2ZPFB 3URGA 3UT1A 1RI0A 1ZQ1A 3A8LB 4JLIA 3ER0A 1K8AC 1Y0MA 3RR6A 1D09B 4RTXA 4FYYB 2L3PA 3G7ZA 2SEMA 4E7SA 2J05A 1SHGA 3VS7A 1R0BG 2AKLA 3KFVA 3CD6T 1VQ8A 1TS9A 1W70A 5GAMg 1WJQA 3OA6A 3PT9A 1BCOA 4IUQA 2OTJQ 3QBYA 1BI3A 1UECA 4DBFA 8AT1B 1YJWT 1CSKA 3JCMf 4XTUA 5KE2A 4J9FA 4M7AD 4FYXB 3QJYA 2CZ1B 3DB3A 2RNAA 1U3OA 5KYYB 3CCQA 4Z8AA 2YRVA 2FPDA 3UF4A 2I0NA 3I9QA 3CC4T 2DD4A 1Y71A 4JLGA 3VYGA 1RADB 2CP7A 2KR3A 5IHNA 1UGVA 1YHQA 2QI2A 3PMTA 4MDXA 1CKBA 3M9QA 2QGGA 1NLPC 1MNDA 2YUNA 4ME7A 4II1A 2F5KA 3VS5A 2YLCA 2W10A 3CCST 2JM9A 2JVVA 4XU2A 2DL5A 1LPLA 3MEWA 1WQWA 1KK7A 2Y4YA 4JJCA 2P0PA 1U06A 4M77C 1RAGB 2OJ2A 1UTIA 3FRNA 3G71Q 2LJ0A 2F2XA 2JJ9A 3CC7Q 5CKBA 1VA7A 4ZNXA 1XNIA 1SSFA 2XMFA 1JQQA 2OTLA 4YTLA 1AOJA 2V8KA 2QA4A 1AEYA 5KCOA 3SD4A 1M1FA 3TU4K 3VRYA 3CC2T 4FT2A 4BACA 4DOWA 2LVMA 2YWWA 5GANd 2MPXC 2E70A 3FB9A 5FW9A 1IREB 3BW1A 2DD5A 2JNGA 4OGEA 4BUGA 5ECAA 2CREA 1IO6A 3VS1A 4KH0B 4C8QD 2XD0A 4KULA 3R6OA 4FT4A 2HZYA 2CDTA 1T3SA 4C8QA 1BI0A 3CQTA 4BE2A 1M9SA 2D0QB 3RKWA 1UGQB 5FU6B 3J7AF 1NE8A 3PIPA 4IKFA 2R5AA 1Y7XA 1NEBA 1D1CA 2BZ8A 3FEOA 1YJNQ 2G6FX 3JB9F 3D7SB 2LCCA 1BIBA 1S1NA 5KYWB 2E41A 4CC7A 2RHZA 1M2VA 5GMKm 1PNJA 4IUTA 4J9DA 3S6WA 1MMAA 1X01A 3RUXA 2RHYA 2FZCB 5I2MA 1VQ6A 1YI2A 2ZZDA 2PTKA 2CSQA 3E9GA 4R55A 1KD1U 4C92G 2E5KA 1X2QA 5GANf 2QTXA 4F7UB 5IAYA 2D0NA 1JXOA 4KRTA 3OYEA 1ZUUA 5GAMf 3JB9J 5DLQE 3T9NA 2RA2A 1K4US 5GJWB 1QQJA 2P84A 2RQWA 4J9GA 4ELZC 2QQSA 1M3CA 1S72T 4M75F 1NPPA 4NL2A 3EFSA 3I55Q 2DYIA 2ENMA 4JUVA 1S72Q 5KYXB 2RMOA 4LNPA 3L42A 1JEGA 2DERA 3VS0A 3A1PA 4KH1B 2RQRA 3I56A 2A36A 2KEAA 3M58A 2EPDA 5CQXA 4LD9K 1BK2A 5GAN2 5A2QE 3EG9A 4FW1A 5L23A 4E47A 2LJ3A 3QZ5B 2XHCA 2CZ0B 4E2FB 5FROA 3UATA 4E7KA 3VV0A 1PRLC 1Z9ZA 2ZPBB 4XTZA 3EFOA 3E19A 2DXCA 1SRMA 2DXBA 2CT3A 3ZFJA 4Y91A 1QWEA 1D1AA 1V76A 3G6EA 3LW5E 4FSXA 4C0GA 2RI3A 1ACMB 3X24B 2OX7A 2IG0A 1N9RA 3M0RA 4XTYA 1VQLA 1YCYA 4ZGDB 2LT1A 2QAZA 2SRCA 4PJOG 5GAOn 2DX1A 4X1VA 2HDAA 3META 1VQ4T 2DTHA 1WJSA 5DY9A 1KQ2A 4RUGA 4XTWA 1NJIR 4CRIA 3O8VA 4JZ4A 3CBPA 1XJWB 1IRXA 2XKOC 4AFZC 1NG2A 2K6DA 4JS4A 1EFNA 3CPWA 1KD1C 3OYYA 3M56A 3C4SA 3MEAA 5GAMj 4RTZA 3PVQA 1H641 2G3RA 4PNOA 2E3HA 5GMKe 2R58A 3LWIA 4J9CA 1YI2Q 1K8AU 4A4EA 4FM4B 2OAUA 3EG3A 2M0YA 2COWA 1K9MC 4HVUA 1AWJA 2QTVA 4GLKA 1M1KC 4RTUA 3QXEB 3CCMQ 1M3AA 3V7RA 2EVRA 1B07A 1FWZA 2E3IA 1PKTA 1RACB 1ZX6A 2A28A 2B86A 1VQKQ 3C94A 2IVWA 4CC3A 2EJ9A 4D8DA 4M78E 1WNLA 3CCSA 1ZSGA 2C0OA 4F7UG 2KVQG 3X26B 2XICA 4C5EA 5J3BA 3PMIA 1G3SA 4BI3A 1WHMA 4TVRA 2BIVA 3VRZA 2DAQA 3V8KA 1UB4A 1HJDA 3RKXA 1GBRA 4M7DC 1HD3A 1H3HA 4JZ3A 1VQPA 2O01E 4F04B 1YCSB 3FLGA 3CCLA 5J39A 1JJ2P 1OU9A 2LQNA 4J9BA 4O6JA 1I0CA 5LJ3j 5FU7C 1VOMA 4M77G 1OZ2A 2JTEA 4M7DA 2RI5A 1YJWQ 1VYUA 4BDYA 1M90R 3BFMA 3V8JA 4F7UA 1PD1A 2FZGB 3GNFB 1UG1A 2L89A 3EGUA 4AG1C 4FW2A 2YHTA 1XOVA 3CCET 4OF1A 1PKSA 1NEGA 4J6XA 1D0ZA 3L2QA 2D8JA 1GCQA 3RNJA 2BKDN 4M78G 3CPWS 1WXBA 2HAXA 2DTOA 4HT9A 4C0ZA 2CYZB 1OX8A 2NWMA 3CBOA 2R5MA 1UGPB 2EJFA 2K79A 4GBQA 1YIJT 4M77A 1I1JA 1UUEA 2FVUA 5KYXA 5GMKi 3OYLA 1M90C 3LGLA 3QZ9B 3GLXA 2HMAA 1B7TA 3HL8A 4PL6A 2QEXQ 1X6OA 4A54A 1QVFA 3P8BB 3CCVQ 3OW2A 4Z88A 1UDLA 5CIUA 2DL3A 3CC2Q 1MGQA 1TOVA 3SB2A 1T0HA 3A8MB 3G1JA 2K3BA 3R6NA 1UHCA 4FSSA 2EQIA 1VQLT 2M02A 2EYQA 3H41A 1OULA 3C95A 2BUDA 5GAN7 4M78B 3CXCS 3JCMW 1P92A 2QK0A 1WHHA 2P0QA 1ZSZC 1KHIA 2FZKB 3M53A 1ZA1B 2E10A 4FIBA 5GAOm 5DM7R 3QHSA 3BY7A 3V7SA 3CCVT 2XDDA 1BBZA 4XU1A 1T3LA 4D6WA 4L5GA 3FC3A 3M54A 4B9XA 2NYSA 5KH6A 4PLIA 4M77B 3BDUA 2CT4A 2YSQA 2RQVA 4OGCA 4M7AE 3AT1B 4KT0E 4DEXA 1OPKA 1K1ZA 3MEUA 2WSCE 1Z9QA 5LJ3f 4C8QE 2DKGA 1NLOC 1N8RR 2CGHA 3EG1A 5GAN8 5I2SA 1KC8C 2RD1A 3E1SA 5IXBA 1M27C 1RL2A 3F70A 1ZA2B 2HSEB 1BYMA 4OMNA 1WYXA 4M78C 1RI9A 1V1CA 4J6WA 3QSUA 1G3WA 3EG0A 3M0UA 3MEVA 2HQHA 3OYHA 3CCJQ 4RTYA 5IXFA 2VC8A 1PG5B 4RMOA 1SHFA 2NLUA 1TUDA 4PJOD 3L2WA 2MCNA 1N5ZA 2QEXT 1QVPA 1AT1B 4UC4A 2RQTA 3HFNA 4BB7A 4M75B 2J06A 2F2VA 2L3QA 1AWXA 4M75G 3CD6Q 1E7OA 1D3BB 1QKWA 3GPLA 2CUBA 4C92B 3UA7A 2VV5A 3GP8A 2BZYA 3HTRA 4MZTA 2MIOA 2DZCA 4MDWA 3JCMX 4HXJA 3SWNB 2P4TA 3VKIA 1QWFA 3OYKA 4PKCC 1ZHIA 2E5QA 5CKDA 2B8AA 2LCLA 4RTWA 4MZPA 1RAAB 2GF7A 1SPKA 2JUFA 1U1SA 4J9IA 3OY9A 4EMKC 4PJOE 2LC4A 2DJQA 2AT1B 5CQYA 3JRZA 5GAN6 6AT1B 2A0FB 5FU6C 3KXTA 3SDZA 2DL4A 3CBMA 1ARKA 4IIOA 4LUEA 4J9EA 3G4ST 3CMEQ 2WSFE 5LJ5d 1K0XA 1OZ3A 4B9WA 5GAMh 4J8OA 3VS3A 3RBBB 1LOJA 1NYGA 2CP6A 1IGUA 3QDFA 2DETA 1VQ7T 4DBHA 2FL7A 4IURA 2DTIA 1K73C 5LL6S 1U5SA 1BIAA 3L2UA 3JCMQ 1B34A 1OV3A 2BTTA 1ABOA 2KXCA 2FEIA 4RTTA 5IHKA 1K9MR 2D6FA 3E2UA 3NHNA 1NPRA 2HBPA 1YNZA 4C0DB 1ZSZB 1M90U 4JRQA 3TCJA 3EHRA 2ABLA 4AT1B 2K3XA 3OYFA 4QVZA 1SRLA 4AFQC 2MOXA 2EGCA 5GANe 4LDWA 2JXBA 2HL5C 1NZ9A 5D6XA 2EFIA 3I35A 2JT4A 1NJIC 4QKUA 1K9AA 3L1AA 2GTJA 4M78A 2HCKA 3NTHA 2GFAA 1D0XA 3OQ5A 1OOTA 1Q86R 2MAMA 4DA4A 2E6ZA 2RB6A 2M51A 1H3ZA 3UA6A 5LJ5g 3DKMA 2LX9A 3ZBDA 1VQ7Q 2DVEA 1KFZA 2EYYA 2J6OA 3ASKA 4XQ3A 2Y90A 2LRQA 5D6YA 2XDBA 3ZL7C 1YIJA 1MNEA 2EYWA 1AHJB 4OB1B 2CZ7B 2KRNA 2DEQA 3DLMA 3G71T 3I5SA 5CK9A 2W0ZA 3OS2A 1KJWA 4EMHA 4OMQA 1YWPA 4ZTFA 3HSBA 1PC0A 2QYZA 1OI1A 2NUZA 4BI8B 2V8IA 2HEQA 2JS2A 2VXEA 1GCPA 2DL7A 3UPUA 2LQ8A 5GAOq 3O5ZA 5KE3A 1VQKT 3EGXA 3OYBA 4M7DD 2EQJA 1TUGB 4ZN3A 3CMEA 4LDUA 2O9VA 1RAEB 4BI4A 3CCMT 5GANj 2Z0WA 2LTOA 3CCVA 1FMVA 3SHWA 3EAEA 3VJPA 3X28B 3L2RA 4J83A 1VQOA 4M77D 1YFNA 1VQMA 1U8RA 2AHJB 3FJPA 4L6V5 1O75A 5KYWA 4NS5A 4PFZA 1K76A 2KYBA 2LDMA 3QPHA 2XG8D 2DF6A 4OMMA 3SWNA 4M78F 1BCMA 1ZBXA 1Q7YR 3A5ZB 4X34A 4QQ6A 1VQNT 4E7JA 2KYMA 3OW2P 4QQGA 1KIKA 2KQWA 4JJNK 3SWNC 3TREA 1TTHB 4KBMB 1Y07A 1JBMA 3EH2A 4LN2A 3PVLA 2E65A 4BY6C 1H92A 2ZPGB 3QIIA 2LQKA 4C0FA 1Q86U 5CKHA 4FYVB 2ZCFB 1BB9A 2OTLQ 4JJDA 1AZGB 5A0GA 4HKEA 5FRMA 2K57A 1YJNT 3CCMA 3NGPA 2HL3A 3OYJA 4E6RA 1UJYA 1C6VX 2RJCA 3JSCA 3JB9H 1VQKA 4HT8A 1KHCA 4RTVA 1M1GA 1GFDA 3CCSQ 1RABB 2FRWA 3EG9B 3C0CA 1JJ2A 1M30A 4JJBA 3VS4A 4FYWB 4X9CA 4HCZA 1PWTA 5L8RE 1VYVA 2K5LA 1YJNA 1BKBA 4HCCA 4LD6A 2NUPB 2PVGB 1NM7A 4C0DC 1VQPQ 2ROTA 4HA8A 5GAOr 3QYGB 3LH5A 2LMJA 1S72A 1M4ZA 5CKFA 3I55T 4RKUE 2NUTA 1KG1A 2DA9A 1Q81C 2A08A 3C12A 3I56T 2KAFA 1VQ5T 1MHNA 4C8QC 4GLMA 3X20B 4BE0A 2X4JA 2IPOB 3CCEQ 4PJJA 3QKJA 4PJOA 3M59A 1WLPB 2OTLT 2QQBA 3DB4A 3MP1A 2RF0A 2P4RA 2RPNA 1Y57A 2QQAA 4C5IA 2HKQB 4M7DF 2PUKB 2EYZA 4PJOC 2E6NA 1QVGA 3CCQQ 3WVEB 4A4GA 1X43A 3I55A 3MPUB 2DYBA 4KGXB 3ZEHA 1Q82C 1WHGA 1TSFA 4WCIA 3AHUA 2L3SA 4M7AF 3QG1A 3M0QA 3MHXA 2ZGWA 2KT1A 3A8GB 3OMGA 3REAB 4E7IA 1YN8A 5KYYA 2MWPA 4JDSA 3JCMe 2EQUA 4PJLA 2A3LA 2JW4A 1M8MA 4A53A 3NTKA 4ORZA 3OB9A 2MI6A 2MWOA 1Y96A 2RHIA 4EMGA 1M5Q1 3PGGA 3CCJT 1G3YA 2GTOA 2DILA 2EIFA 3NFCA 1RLPC 5D7UA 2ZPHB 1N9SA 3EGXB 3BDLA 1VQMT 3H0FA 3CCUT 1VQPT 2VGNA 1X6BA 1Q86C 4HVWA 4M7DG 3LGFA 2DEUA 5GAN5 2JOYA 2M0OA 3GBQA 2YUQA 4J5YA 4E7LA 1I5LA 2DBMA 2CSIA 5EC7A 2AKKA 2YXYA 1C0MA 2D8HA 4EIKA 2E64A 2J6FA 3HRUA 4OMOA 2PNIA 5IT9E 2QA4Q 1YITA 3HRSA 3TQ7P 2YUPA 2EBPA 3I56Q 1YHQQ 5LJ3d 3X25B 2O9SA 2QA4T 2CH4A 1Y96B 1PD0A 4JRKA 1YI2T 2HD0A 3P8HA 2K4YA 3CCJA 3M4YA 1FMKA 4C8QF 5KCHA 4M4ZA 2LX7A 3JCMc 3LYIA 1N8RU 1WDXA 1UE9A 5KYUA 2DXUA 4NOYA 4C8QB 2E12A 2EGAA 1YITT 2RM4A 1OX9A 1TUCA 5IHIA 3CCRQ 1W4SA 1WA7A 5EG2A 4ESRA 2QEXA 3LH0A 1QVFP 1D1BA 5GAOl 2JMCA 3CC4Q 1KD1R 1VQLQ 3LX7A 3OYNA 5J26A 2F1LA 3EFRA 1IXDA 3QUIA 1JRIA 1M2VB 1UGRB 2VUBA 2DBKA 2WSEE 1VQ4A 4M77E 2GQVA 3JCMb 5IN1A 2DE0X 2X3WD 2K2VA 4XU0A 4PJOF 3PTAA 3RMSA 4C5HA 1AWWA 1X2KA 2BZXA 2CUDA 2L0AA 1VQ8T 2PVDB 2NUPA 2DPPB 4CC4B 2JZ2A 4Z02A 1R77A 4LE9A 3H0IA 4OB3B 3EH1A 3A8OB 3CCQT 1ZUKA 1C1AA 4F7UE 1Q7YU 2QGFB 3OS0A 2EQKA 4KUIA 4BE1A 2F5TX 3FIFA 2DK3A 5KYUB 2WACA 4M75D 5GAOp 4NL3A 2AK5A 4LDVA 2M9UA 5GAMe 3EGDB 2AZVA 1T0JA 4J7IA 5CR2A 2I2LA 5KYNA 1JO8A 4M7AG 5I11A 3N5BB 1QKXA 4E7ZA 5A0LA 1VQ9Q 2VB6A 4FCYA 3E9FA 2FB7A 5GMKl 2A37A 2JTFA 2K5IA 1BI2A 2ROLA 4FU6A 2GCXA 1VQ5A 3RERA 1UJ0A 2OI3A 3RKYA 3Q1JA 4C92F 1GFCA 2LT4A 3GNGA 3THKA 1SEMA 4J9HA 5LJ5e 4N4IA 1X6GA 3JCMJ 4DQ2A 1WPYA 2Y4XA 1UFFA 3CC7A 3KUFA 2RH2A 2FG0A 2F2WA 2PVOB 3CD6A 1KQSA 2RI2A 1FMWA 1VQ8Q 1N6AA 1M8VA 1SF9A 2VKNA 3EFOB 3OYGA 1WHLA 1GXIE 2EKHA 4FL6A 1QCNA 1WHKA 3OS1A 3JB9G 1M2OA 1W2BS 2V1RA 3OS5A 1OPLA 1W1FA 2KY9A 2D1XA 1MMDA 2DNUA 1W2BP 4OMLA 1SG5A 1HYOA 4BDZA 2EAYA 5CCAA 2KNBB 1I5OB 1N27A 2CP0A 3LLRA 3IQLA 4OB2B 2EKOA 1SKUB 2DJZA 2J6KA 2DL8A 1XQHA 1YHQT 2HQXA 1FYNA 3BE3A 2FPFA 4QVCA 1UHFA 4CC2A 1V29B 2H3EB 5LJ5f 2X4XA 3PNWC 4E7HA 2LJ1A 2O88A 3V7CA 1PSEA 1OU8A 1HXDA 2GQIA 4DBQA 3QDRB 4HCKA 2QDLA 5GJVB 1W2BA 5FLXE 1QW1A 1M1KR 2OTJA 2J7IA 5HY6A 1ZUYA 1KC8R 2V1QA 2YUOA 2GNCA 5HK3A 3CCUQ 1AWOA 3NPFA 4C92D 2MMPA 4PJNA 4QVDA 1VQ9T 2FO0A 2YLBA 3J81E 1IHWA 3OYIA 2RK1A 1ZLMA 2M16A 2IIMA 4AFUC 2DM1A 2C06A 1B3QA 3PIOA 1YJWA 3CEYA 2DLPA 2DRKA 2K5FA 1KQ1A 4EMKB 3A98A 1QVGP 3HHTB 3GOXA 4KUDK 1VQ9A 4N0AA 2ED0A 2KT8A 2KRSA 5CO7A 2OTJT 1FX7A 3M4GA 4QW2A 1QVGS 1M1KU 1EX4A 3M5AA 2YT6A 1I81A 2XU8A 2RJFA 4BD3A 2O2OA 4CI0C 4PK4A 2QDYB 3JCMh 3GF5A 5C6SA 2FHDA 1IGQA 3HPWA 2COYA 3WXMB 1LJOA 3MO8A 3ULRB 3VUBA 3OYAA 1OQKA 2ESWA 4LDYA 2COZA 2L5QA 4Q5WA 5CKEA 4AMCA 3G71A 4PLLA 3EGDA 3G6ET 4O5VA 2X4YA 1EIFA 1MV0B 2DIGA 4DEYA 1HK9A 1K8AR 1R0CB 1A0NB 3MP8A 2K7AA 1X75C 3V8LA 1X27A 4EMKA 2EW3A 1Q81R 1D0YA 2KXDA 2RHUA 1VQ7A 2LNHB 4OVAA 1RAIB 2ECZA 1E6GA 1GBQA 4M7AC 1YWOA 2RQUA 2XI9A 1GL5A 2KMTA 1K73R 2CS7A 2K9GA 3L2VA 2QQ9A 1RAFB 1G3TA 2HQEA 2DZ9A 4A4FA 1RUWA 5LJ3e 1QVFS 2ZAEA 5CVIA 2PZ1A 3I5RA 4RG2A 2FYKA 1MUZA 5LJ3h 1Q81U 2CP2A 5LJ5j 2ZPIB 1TH7A 1DJ7B 3P8DA 3HKSA 5FRNA 5GANg 4V2SA 5I22A 2O4XA 4M7DE 3CC7T 2RN8A 3MCAB 1IHVA 3RDVA 4JRIA 1MMGA 3OBWA 2JS0A 3LWHA 2GFUA 2VXFA 1YIJQ 2LP5A 1VQ6T 4BY6B 1QMCA 2V26A 3JCMP 3L2ZA 1FXXA 3QO3A 3CCLT 1Q82U 5DLOA 4OMPA 3G6EQ 1VIFA 3VS2A 4J7FA 1W6XA 3FDRA 1VQNQ 4JPBW 2LCSA 1VQMQ 4N0AC 4RCBA 1WQ7A 2FPEA 3PFSA 1YP5A 5FU7B 1WHJA 3HFOA 4ZGJB 2RJDA 2P0KA 2AIRB 4K11A 1WXUA 4C92C 4M75A 2XIDA 3U23A 5GMKj 2RK2A 3M0TA 3EG2A 1LCKA 3JB9D 2R57A 1R8OB 1M3BA 2PU9B 4C92A 1WX6A
chains in the Genus database with same CATH topology
5HKCA 1PSFA 5AYFA 2QA4T 3CPFA 1Y96B 2XK0A 4M77C 4M75G 3SFMA 3G4SA 2VGMA 3FRNA 3H8ZA 4JRKA 3UWNA 1YI2T 2DIQA 2CKKA 2HD0A 3P8HA 1D3BB 3GPLA 4C92B 4EDUA 2K4YA 2VV5A 5CKBA 3CCJA 3M4YA 3GP8A 4OB0B 3JCMd 4C8QF 5KCHA 1XNIA 3ME9A 4MZTA 1SSFA 2DZCA 3CC2T 4MDWA 3JCMX 2OTLA 4YTLA 5GAMd 3JCMc 3SWNB 2P4TA 2V8KA 3LYIA 3VKIA 4BB7A 3OYKA 2QA4A 1N8RU 4PKCC 3WVDB 1ZHIA 1M1FA 2DXUA 2E5QA 3SD4A 5CKDA 4FT2A 4NOYA 2B8AA 2LCLA 4BACA 4DOWA 3HP9A 4MZPA 4C8QB 2E12A 2LVMA 1YITT 5GANd 2GF7A 3VU3C 2RM4A 2E70A 3FB9A 1IREB 1W4SA 2JUFA 3BW1A 1U1SA 2DD5A 2JNGA 5EG2A 4OGEA 4BUGA 3OY9A 2QEXA 3LH0A 1K73U 4EMKC 5GAOl 4PJOE 4C8QD 5GAN3 2XD0A 2LC4A 1U1TA 4KULA 3R6OA 4ZGEB 5CQYA 3LX7A 3JRZA 4FT4A 4GY5A 4X9DA 5J26A 5GAN6 3OYNA 5GMKh 3EFRA 1VQ5T 4C8QA 1BI0A 4BE2A 5FU6C 3KXTA 3SDZA 1M9SA 2D0QB 3RKWA 3QUIA 1JRIA 1UGQB 3CBMA 5FU6B 5GANh 1UGRB 2VUBA 3J7AF 1XTDA 1NE8A 2WSEE 4M7AA 3G4ST 1VQ4A 4M77E 2WSFE 2GQVA 3RMQA 5LJ5d 3PIPA 3CXCA 3JCMb 4IKFA 2R5AA 5IN1A 1OZ3A 4B9WA 5GAMh 1Y7XA 2K2VA 4J8OA 1LOJA 4XU0A 3FEOA 4PJOF 3JB9F 3PTAA 2LCCA 3RMSA 4C5HA 1BIBA 3CCRA 4N4HA 2E41A 2RHZA 5GMKm 1VQ7T 4IUTA 3S6WA 2E1HA 4XAXB 1VQ8T 3S3MA 1X01A 2PVDB 3RUXA 2DPPB 5KCOA 2FL7A 2RHYA 2JZ2A 4IURA 2DTIA 3QYHB 4Z02A 5I2MA 4ZN1A 1K73C 4OB3B 5LL6S 2A7YA 1VQ6A 1YI2A 3A8OB 5FRNA 1BIAA 3CCQT 2ZZDA 3L2UA 1NJIU 3JCMQ 1B34A 3E9GA 4R55A 5GAN4 1KD1U 4F7UE 4C92G 1WGSA 5GANf 1Q7YU 2QTXA 2EQKA 3UDCA 4KUIA 3OS0A 4F7UB 2F5TX 5IAYA 4BE1A 3FIFA 1KQSS 2D6FA 2DK3A 2D9TA 1NPRA 3OYEA 2WACA 4M75D 2HBPA 5GAOp 4C0DB 4NL3A 1M90U 5GAMf 3JB9J 4QQDA 5DLQE 3T9NA 2RA2A 3TCJA 4JRQA 1B34B 4LDVA 2M9UA 1YBYA 5GAMe 5C0MA 3OBYA 2K3XA 5A0DA 3OYFA 4QVZA 4ELZC 5CAIA 4J7IA 5CR2A 2I2LA 2QQSA 5GANe 3CCUA 4LDWA 4M75F 1S72T 1NPPA 2XDPA 4A4KA 4M7AG 4NL2A 1NZ9A 2CZ6B 3EFSA 3N5BB 5LJ3g 5D6XA 2EFIA 4M78D 2X35A 4JUVA 4XU3A 3OSSC 4M7AB 5A0LA 1NJIC 2DO3A 4C8QG 3E9FA 3OYCA 2FB7A 3L42A 3L1AA 4M78A 1Q7YC 5GMKl 2JTFA 2K5IA 1BI2A 3NTHA 4FU6A 2GCXA 1VQ5A 2GFAA 3OMCA 3I56A 3RERA 3M58A 3OQ5A 4ZTJA 1QP2A 2MAMA 4DA4A 2E6ZA 5CQXA 4LD9K 2RB6A 5GAN2 3S3NA 4M7DB 1H3ZA 3RKYA 3Q1JA 4C92F 5A2QE 2LT4A 3GNGA 4M75C 2ZPEB 3DKMA 5LJ5g 2LX9A 1UGSB 3ZBDA 4E47A 2DVEA 5LJ5e 4N4IA 3QZ5B 2O4XB 2XHCA 3ASKA 2CZ0B 4XQ3A 2Y90A 3NTIA 2RJEA 2LRQA 5FROA 3JCMJ 4E7KA 3VV0A 5D6YA 4DQ2A 4LDXA 2XDBA 3CC2A 1WPYA 2Y4XA 2ZPBB 4XTZA 3CC7A 3KUFA 1YIJA 2RH2A 3E19A 1AHJB 2DXCA 4OB1B 2CZ7B 2DXTA 2DEQA 2DXBA 3DLMA 4P5NA 5I21A 2PQWA 2PVOB 3ZFJA 3G71T 3CD6A 1KQSA 3VUZA 4Y91A 2RI2A 4ATOA 4C92E 1I8FA 5CK9A 3G6EA 3LW5E 4FSXA 4C0GA 1N6AA 3OS2A 2RI3A 2KK4A 1M8VA 4EMHA 3X24B 3OYGA 1GXIE 1IZ6A 4OP0A 4ZTFA 4M75E 2EJGA 3HSBA 2IG0A 1N9RA 4FL6A 3OS1A 4XTYA 1N8RC 1VQLA 1YCYA 2QXFA 3MP6A 4ZGDB 2LT1A 1OI1A 4DOVA 4BI8B 2V8IA 4PJOG 3JB9G 4RCCA 5GAOn 1W2BS 2VXEA 3OS5A 3META 3UPUA 1VQ4T 2DTHA 2KY9A 2LQ8A 3OW2S 5GAOq 1K9MU 5KE3A 1WJSA 5DY9A 5D6WA 1VQKT 1KQ2A 4JS5A 4BDZA 2EAYA 5CCAA 3OYBA 4XTWA 4M7DD 2EQJA 1N27A 3LLRA 4M77F 4ZN3A 1WJRA 4OB2B 4R56A 4CRIA 4LDUA 2EKOA 3CMEA 3O8VA 4MMLA 3JCMg 3CBPA 2DJZA 4BI4A 4JRPA 3CCMT 5GANj 2XKOC 2LNVA 4A4HA 2LTOA 3I56T 3CCVA 1XQHA 4JS4A 1VUBA 1YHQT 3CCEA 3CPWA 2HQXA 4N4GA 1KD1C 3OYYA 3EAEA 3VJPA 3X28B 3M56A 3C4SA 4QVCA 3MEAA 3L2RA 5GAMj 1V29B 1H641 4J83A 2G3RA 4PNOA 5LJ5f 2X4XA 1VQOA 4M77D 3PNWC 1VQMA 1JB0E 2AHJB 3FJPA 2KDSA 2R58A 4L6V5 5GMKe 3LWIA 4E7HA 1O75A 4NS5A 3S3OA 1K8AU 4A4EA 4FM4B 2OAUA 2LDMA 3A8HB 3QPHA 3V7CA 1PSEA 4MMKA 3QJ6A 2XG8D 1HXDA 1YJ9T 1K9MC 4F7UF 3SWNA 2L3RA 4M78F 1LNXA 4IUPA 3QDRB 1ZBXA 4MZMA 2VYTA 4WF2A 3A5ZB 4X34A 1W2BA 4RG8A 5FLXE 4GLKA 1M1KC 1QW1A 4QQ6A 2OTJA 1VQNT 4E7JA 5M9OA 5HY6A 3CMAT 3QXEB 4QQGA 3V7RA 3TU4K 1FWZA 2KQWA 4JJNK 3SWNC 5HK3A 2RHXA 2L8DA 4IUUA 1O9SA 4KBMB 3TREA 4C92D 2MMPA 2EWNA 4QVDA 1Y07A 1VQ9T 3C94A 4IUVA 1JBMA 2IVWA 2YLBA 3J81E 2RO0A 2EJ9A 2MF2A 4M78E 3OYIA 2E65A 2RK1A 4BY6C 1WNLA 2M16A 3JB9I 3J80E 3CCSA 2ZPGB 3QIIA 4F7UG 2KVQG 2LQKA 3X26B 3PIOA 4C0FA 1Q86U 2C06A 1YJWA 3CEYA 1KC8U 3RIRA 2XICA 5CKHA 4C5EA 2K5FA 3OYMA 1KQ1A 2ZCFB 4EMKB 5J3BA 1G5VA 1QP3A 2K3YA 3PMIA 3HHTB 3GOXA 1G3SA 5A0GA 4N0AA 4BI3A 1VQ9A 4KUDK 4HKEA 1BI1A 5HK0A 5FRMA 2K57A 1YJNT 4TVRA 2BIVA 3INZA 2DAQA 5CO7A 3V8KA 4OMFB 3CCMA 1UB4A 2OTJT 1FX7A 3M4GA 4QW2A 3RKXA 2QQRA 1QVGS 1M1KU 4M7DC 3OYJA 3M5AA 1I81A 2PUOB 2XU8A 2RJFA 2H3JA 4BD3A 3OSVA 2RJCA 3JSCA 1VQPA 3H6ZA 4CI0C 2O01E 4J6YA 1VQNA 1VQKA 3JB9H 3FLGA 3CCLA 2QDYB 2KSSA 5J39A 3CC4A 3M55A 4HT8A 1KHCA 3JCMh 1M1GA 3GF5A 2HNIA 4O6JA 5FU7C 5C6SA 1UEBA 1OZ2A 2FHDA 4M77G 5LJ3j 4M7DA 2RI5A 2M1HA 4BDYA 3BFMA 3HPWA 3V8JA 2JN0A 3GNFB 4F7UA 1JJ2A 3JCMV 3WXMB 1LJOA 3MO8A 3OYAA 4X9CA 3VUBA 3CCRT 4HCZA 1D3BA 2L89A 5L8RE 4EPCA 4LDYA 2K5LA 3GIBA 2L5QA 4Q5WA 5CKEA 2X4WA 3CMAA 1YJNA 2YHTA 1I4K1 1BKBA 2V8JA 4XK8E 3G71A 4HCCA 3HRTA 1XOVA 4PLLA 3CCET 4LD6A 4OF1A 4J6XA 2PVGB 3L2QA 3VYHB 4C0DC 4XTXA 3G6ET 2BKDN 2EQMA 4HA8A 2X4YA 4M78G 4O5VA 5LJ5h 1EIFA 3CPWS 5GAOr 1VQOT 2DIGA 1VIEA 1YJ9A 2DTOA 3QYGB 4VUBA 4C0ZA 3CMET 2HAXA 4HT9A 1S72A 2CYZB 1HK9A 3M57A 3OYDA 1M4ZA 3CBOA 2R5MA 3MP8A 5CKFA 1UGPB 2EJFA 3I55T 1X75C 3DLLA 4M77A 3V8LA 2JTMA 1YIJT 4PJOB 4RKUE 2FVUA 1KG1A 4Y28E 4C5GA 5GMKi 3OYLA 4EMKA 3LGLA 1M90C 4HCBA 3QZ9B 1Q81C 3GLXA 4ELYC 1JJ2S 3C12A 2RHUA 3HL8A 3KBGA 2KAFA 4L59A 4PL6A 3JAME 1X6OA 4XTVA 3RESA 1MHNA 4A54A 4C8QC 3P8BB 3X20B 1U8RA 4BE0A 2X4JA 1VQ7A 3OW2A 3TEEA 1QVFA 1OYXA 4OVAA 2F69A 3QKJA 5CIUA 2ZPFB 4PJOA 3M59A 3URGA 3UT1A 1RI0A 2OTLT 1ZQ1A 2QQBA 3A8LB 3ER0A 4JLIA 1K8AC 3DB4A 4M7AC 3MP1A 2XI9A 1MGQA 2KMTA 3SB2A 3G7ZA 2CS7A 3A8MB 2QQAA 4C5IA 3L2VA 2QQ9A 4M7DF 2PUKB 1G3TA 4PJOC 1VQLT 2E6NA 2HQEA 1QVGA 3WVEB 2DZ9A 4A4FA 2EYQA 4A4GA 5LJ3e 3I55A 1VQ8A 3C95A 1QVFS 3CD6T 5CVIA 2BUDA 3ZEHA 5GAN7 1Q82C 4M78B 3CXCS 3JCMW 1P92A 5GAMg 1WJQA 4RG2A 2FYKA 3AHUA 2P0QA 3OA6A 4M7AF 3QG1A 3MHXA 3PT9A 5LJ3h 1Q81U 2ZGWA 3A8GB 3OMGA 5LJ5j 2ZPIB 1KHIA 1DJ7B 1TH7A 3HKSA 3P8DA 4IUQA 4E7IA 3M53A 4FIBA 2E10A 5GANg 5GAOm 2MWPA 4V2SA 5DM7R 4JDSA 3JCMe 2EQUA 3QHSA 2A3LA 3BY7A 2O4XA 3QBYA 3V7SA 4A53A 3CCVT 2XDDA 4M7DE 3NTKA 3OB9A 4XU1A 2MI6A 2MWOA 1Y96A 1BI3A 3CC7T 1YJWT 3MCAB 3JCMf 4XTUA 4D6WA 5KE2A 4JRIA 2RHIA 3OBWA 4L5GA 3FC3A 3M54A 4EMGA 1M5Q1 2GFUA 3PGGA 3LWHA 4M7AD 3CCJT 1G3YA 2VXFA 3QJYA 2CZ1B 3DB3A 4M77B 4PLIA 4B9XA 5KH6A 3BDUA 3CCQA 2EIFA 4M7AE 4OGCA 4KT0E 3NFCA 1VQ6T 2YRVA 2ZPHB 4BY6B 1N9SA 3BDLA 3JCMP 3L2ZA 1VQMT 1FXXA 3MEUA 3QO3A 2WSCE 3CC4T 5LJ3f 4C8QE 3CCLT 2DD4A 1Q82U 3CCUT 5DLOA 2DKGA 1VQPT 1Y71A 1VIFA 4JLGA 3VYGA 2CGHA 2VGNA 1Q86C 4J7FA 4M7DG 5GAN8 5I2SA 1KC8C 3LGFA 1YHQA 2QI2A 2RD1A 5GAN5 2JOYA 3E1SA 3PMTA 4MDXA 3FDRA 1RL2A 2M0OA 3F70A 3M9QA 4J5YA 4E7LA 1BYMA 1I5LA 4N0AC 4M78C 4RCBA 1WQ7A 3PFSA 4ME7A 4II1A 2F5KA 5FU7B 4J6WA 3QSUA 1G3WA 3HFOA 3MEVA 4ZGJB 2YLCA 2RJDA 2P0KA 3OYHA 4C92C 2E64A 4M75A 2XIDA 2VC8A 2RK2A 5GMKj 3CCST 3HRUA 4RMOA 5IT9E 2JVVA 4XU2A 2NLUA 3JB9D 4PJOD 3L2WA 1YITA 3HRSA 2R57A 3MEWA 1R8OB 1WQWA 2QEXT 2PU9B 4C92A 1QVPA 2Y4YA 4UC4A 2P0PA 5LJ3d 3X25B 3HFNA 4M75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTV A;  3RES A;  1HXD A;  4A54 A;  4M7A G;  4C8Q C;  4NL2 A;  3EFS A;  4F7U F;  5LJ3 g;  3SWN A;  1Y96 B;  4M77 C;  4M75 G;  1LNX A;  4M78 F;  4M78 D;  4JUV A;  4XU3 A;  4PJO A;  4M7A B;  4JRK A;  4WF2 A;  4JLI A;  1D3B B;  4C8Q G;  4M7A C;  4C92 B;  2FB7 A;  3L1A A;  4M78 A;  5GMK l;  3JCM d;  4C8Q F;  1MGQ A;  3V7R A;  3RER A;  3SB2 A;  2DZC A;  3JCM X;  5GAM d;  3SWN C;  3JCM c;  2RB6 A;  5GAN 2;  3SWN B;  4M7D B;  4M7D F;  3RKY A;  4PJO C;  4C92 F;  2DXU A;  4M75 C;  4C92 D;  5LJ5 g;  2EWN A;  4NOY A;  2DZ9 A;  4QVD A;  4C8Q B;  2DVE A;  5LJ3 e;  5LJ5 e;  1JBM A;  5GAN d;  2YLB A;  3VU3 C;  2RM4 A;  3FB9 A;  2EJ9 A;  4M78 E;  5GAN 7;  4M78 B;  2E65 A;  4XQ3 A;  3JB9 I;  1WNL A;  3BW1 A;  3JCM W;  2Y90 A;  1U1S A;  5GAM g;  2FYK A;  4F7U G;  3JCM J;  3AHU A;  4EMK C;  4DQ2 A;  4M7A F;  5GAO l;  1WPY A;  4XTZ A;  5LJ3 h;  4C8Q D;  5GAN 3;  2ZGW A;  1U1T A;  3RIR A;  4PJO E;  5LJ5 j;  1KQ1 A;  4EMK B;  1TH7 A;  4X9D A;  2DXT A;  5GAN 6;  2DEQ A;  2E10 A;  5GAN g;  5GAO m;  5I21 A;  3EFR A;  5GMK h;  4V2S A;  4N0A A;  3JCM e;  4C8Q A;  3QHS A;  3BY7 A;  4Y91 A;  2K57 A;  3V7S A;  4A53 A;  4M7D E;  3INZ A;  3V8K A;  3RKW A;  3QUI A;  1I8F A;  1JRI A;  4XU1 A;  4C92 E;  1Y96 A;  5GAN h;  3M4G A;  3RKX A;  4M7D C;  3JCM f;  4XTU A;  4JRI A;  4M7A A;  1M8V A;  1I81 A;  4M77 E;  4EMH A;  4EMG A;  1M5Q 1;  3PGG A;  5LJ5 d;  4M7A D;  3JCM b;  2VXF A;  4M77 B;  4J6Y A;  5GAM h;  3BDU A;  3JB9 H;  4OP0 A;  1LOJ A;  4XU0 A;  4M7A E;  4M75 E;  2EJG A;  4PJO F;  3HSB A;  1N9R A;  3JB9 F;  4HT8 A;  4XTY A;  1BIB A;  1N9S A;  3JCM h;  5LJ3 j;  2HNI A;  1YCY A;  2E41 A;  4M77 G;  5GMK m;  3L2Z A;  3JCM P;  4M7D A;  3QO3 A;  5LJ3 f;  2E1H A;  4PJO G;  4C8Q E;  3JB9 G;  4RCC A;  1X01 A;  5GAO n;  3RUX A;  2DKG A;  3BFM A;  3V8J A;  4F7U A;  2JN0 A;  2VXE A;  3JCM V;  2CGH A;  1LJO A;  2DTI A;  2DTH A;  4M7D G;  5GAN 8;  4X9C A;  5GAO q;  1D3B A;  2RD1 A;  5DY9 A;  5GAN 5;  1BIA A;  1KQ2 A;  3JCM Q;  1B34 A;  2EAY A;  4J5Y A;  3GIB A;  1I5L A;  5GAN 4;  4N0A C;  4XTW A;  4C92 G;  4F7U E;  2YHT A;  1I4K 1;  4M78 C;  4M77 F;  4RCB A;  4M7D D;  1WQ7 A;  5GAN f;  2QTX A;  4F7U B;  4J6X A;  4J6W A;  4MML A;  3FIF A;  3JCM g;  3QSU A;  3HFO A;  2DJZ A;  4XTX A;  2YLC A;  5GAN j;  4HA8 A;  4M78 G;  5LJ5 h;  4M75 D;  4C92 C;  5GAO p;  5GAO r;  4NL3 A;  2DTO A;  2E64 A;  5GAM f;  3JB9 J;  4M75 A;  4HT9 A;  2RA2 A;  2VC8 A;  1HK9 A;  5GMK j;  4QVC A;  1B34 B;  5GAM j;  2EJF A;  4XU2 A;  1H64 1;  3JB9 D;  4M77 A;  3V8L A;  4PJO D;  4PJO B;  4PNO A;  5GAM e;  5LJ5 f;  5GMK i;  1WQW A;  4M77 D;  4EMK A;  5GMK e;  3FJP A;  5CAI A;  4C92 A;  2I2L A;  5LJ3 d;  3V7C A;  3HFN A;  5GAN e;  4M75 B;  4M75 F;  4MMK A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  1PSF A;  5HKC A;  1HSQ A;  5AYF A;  5HCK A;  3CPF A;  2XK0 A;  3SFM A;  3G4S A;  2VGM A;  3H8Z A;  2KE9 A;  3UWN A;  2DIQ A;  2CKK A;  4EDU A;  4OB0 B;  3JCM d;  3ME9 A;  5GAM d;  4B6M A;  1GCQ C;  2QG9 B;  3WVD B;  3HP9 A;  3VU3 C;  3QWX X;  1RLQ C;  1K73 U;  5GAN 3;  3CCL Q;  1U1T A;  4ZGE B;  2E4H A;  4GY5 A;  4X9D A;  5GMK h;  1VQ6 Q;  1VYT A;  1KSW A;  3TSZ A;  5GAN h;  1CKA A;  2ATC B;  1XTD A;  2KRM A;  4M7A A;  1ZBJ A;  8ATC B;  3RMQ A;  3CXC A;  4A63 B;  1BU1 A;  1G83 A;  2CH4 W;  3CCR A;  4N4H A;  2E1H A;  4XAX B;  2YDL A;  2HSP A;  3H9N A;  3S3M A;  3QYH B;  4ZN1 A;  1G8X A;  2A7Y A;  3SEM A;  1ZSZ A;  1AD5 A;  1NJI U;  2DVJ A;  2YRC A;  1VQO Q;  4IIM A;  5GAN 4;  2DMO A;  1WGS A;  3UDC A;  1F1B B;  1KQS S;  2VAS A;  4F17 A;  1H8K A;  2D9T A;  2LQW A;  1J3T A;  4QQD A;  4Z89 A;  1B34 B;  4ANJ A;  1PM3 A;  4DBR A;  1TXQ A;  1QLY A;  3H0H A;  1YBY A;  5C0M A;  2DRM A;  3OBY A;  2EYX A;  5A0D A;  5CAI A;  2C0I A;  3CCU A;  3FJ5 A;  2XDP A;  2HKN A;  4A4K A;  2CZ6 B;  5LJ3 g;  1TG0 A;  4M78 D;  2X35 A;  4XU3 A;  3OSS C;  4M7A B;  4AFS C;  2DO3 A;  4R0K A;  4C8Q G;  2BE7 D;  1WIE A;  3OYC A;  1Q7Y C;  5FWC A;  1MV3 A;  5AT1 B;  2BE9 B;  3OMC A;  4D8K A;  4ZTJ A;  4Y92 A;  1QP2 A;  3S3N A;  4M7D B;  4KGZ B;  1TWB A;  2JM8 A;  2QAS A;  1WFW A;  1YIT Q;  1WZO A;  4M75 C;  2ZPE B;  1UGS B;  4KGV B;  2CP3 A;  2O4X B;  3NTI A;  2RJE A;  4LDX A;  3CC2 A;  2MYS A;  1WXT A;  1KQS P;  3CXC P;  1G2B A;  4WTO B;  1K0S A;  2DXT A;  4P5N A;  5I21 A;  2PQW A;  3TSW A;  3VUZ A;  2H8H A;  2K2M A;  4C92 E;  1I8F A;  2ED1 A;  3M0S A;  3CMA Q;  2KK4 A;  4QT7 A;  1IZ6 A;  3EHQ A;  4OP0 A;  4M75 E;  1YJ9 Q;  2EJG A;  1OEB A;  1N8R C;  2QXF A;  3MP6 A;  4DOV A;  1Q95 G;  3MJX A;  3VS6 A;  4RCC A;  3M0P A;  4PFO A;  4F16 A;  2O31 A;  1RAH B;  2FRY A;  4F14 A;  4LXC A;  1K9M U;  3OW2 S;  1ABQ A;  5FWB A;  5D6W A;  2L2P A;  4JS5 A;  2AZS A;  1JXM A;  4M77 F;  1WJR A;  4R56 A;  3NMZ C;  4MML A;  3JCM g;  1SSH A;  4JRP A;  1MMN A;  2LNV A;  4A4H A;  1VUB A;  3CCE A;  4N4G A;  2KGT A;  2X51 A;  7AT1 B;  4AG2 C;  1JB0 E;  2KDS A;  2CP5 A;  3S3O A;  1GRI A;  9ATC B;  3CPW P;  3A8H B;  4MMK A;  3QJ6 A;  2VVK A;  4PJM A;  1YJ9 T;  4F7U F;  2L3R A;  1LNX A;  4IUP A;  1PHT A;  4MZM A;  1LVK A;  2VYT A;  4WF2 A;  1PCX A;  4RG8 A;  5M9O A;  3CMA T;  4HVV A;  4PFP A;  1QCO A;  3QWY A;  2RHX A;  2L8D A;  4IUU A;  1O9S A;  2EWN A;  4IUV A;  2RO0 A;  2MF2 A;  1WI7 A;  1VQ4 Q;  3JB9 I;  3J80 E;  3PE0 A;  1Q82 R;  1QCF A;  1KC8 U;  3RIR A;  2JMA A;  2KI7 A;  3OYM A;  1NYF A;  2KRO A;  1G5V A;  1PRM C;  1QP3 A;  2K3Y A;  1E6H A;  4ATO A;  2YRD A;  5HK0 A;  1BI1 A;  2DFU A;  2MK5 A;  1JU5 C;  3INZ A;  4OMF B;  1VQ5 Q;  2QQR A;  1I07 A;  2X3X D;  1EZZ B;  2PUO B;  2OAW A;  2H3J A;  3OSV A;  2C0T A;  2EGE A;  3H6Z A;  4J6Y A;  1VQN A;  2VWF A;  5IH2 A;  2KSS A;  3CC4 A;  3M55 A;  3MKD A;  2HNI A;  1UEB A;  2KBT A;  2M1H A;  2JN0 A;  3JCM V;  3REB B;  3CCR T;  1D3B A;  4EPC A;  3GIB A;  3CMA A;  2X4W A;  1AVZ C;  1I4K 1;  4XK8 E;  2V8J A;  2NUT B;  3HRT A;  2GBQ A;  2LZ6 B;  3VYH B;  4XTX A;  2EQM A;  5LJ5 h;  1AZE A;  4LUD A;  1VQO T;  1YJ9 A;  1VIE A;  4VUB A;  3G4S Q;  3CME T;  3M57 A;  3OYD A;  1TU0 B;  3JV3 A;  2HBW A;  3DLL A;  2JTM A;  4PJO B;  4Y28 E;  4C5G A;  4HCB A;  1X69 A;  3TVT A;  4ELY C;  1JJ2 S;  3KBG A;  4L59 A;  3JAM E;  1NBE B;  4XTV A;  3RES A;  2GGR A;  3TEE A;  1OYX A;  2F69 A;  2X9H A;  2ZPF B;  3URG A;  3UT1 A;  1RI0 A;  1ZQ1 A;  3A8L B;  4JLI A;  3ER0 A;  1K8A C;  1Y0M A;  3RR6 A;  1D09 B;  4RTX A;  4FYY B;  2L3P A;  3G7Z A;  2SEM A;  4E7S A;  2J05 A;  1SHG A;  3VS7 A;  1R0B G;  2AKL A;  3KFV A;  3CD6 T;  1VQ8 A;  1TS9 A;  1W70 A;  5GAM g;  1WJQ A;  3OA6 A;  3PT9 A;  1BCO A;  4IUQ A;  2OTJ Q;  3QBY A;  1BI3 A;  1UEC A;  4DBF A;  8AT1 B;  1YJW T;  1CSK A;  3JCM f;  4XTU A;  5KE2 A;  4J9F A;  4M7A D;  4FYX B;  3QJY A;  2CZ1 B;  3DB3 A;  2RNA A;  1U3O A;  5KYY B;  3CCQ A;  4Z8A A;  2YRV A;  2FPD A;  3UF4 A;  2I0N A;  3I9Q A;  3CC4 T;  2DD4 A;  1Y71 A;  4JLG A;  3VYG A;  1RAD B;  2CP7 A;  2KR3 A;  5IHN A;  1UGV A;  1YHQ A;  2QI2 A;  3PMT A;  4MDX A;  1CKB A;  3M9Q A;  2QGG A;  1NLP C;  1MND A;  2YUN A;  4ME7 A;  4II1 A;  2F5K A;  3VS5 A;  2YLC A;  2W10 A;  3CCS T;  2JM9 A;  2JVV A;  4XU2 A;  2DL5 A;  1LPL A;  3MEW A;  1WQW A;  1KK7 A;  2Y4Y A;  4JJC A;  2P0P A;  1U06 A;  4M77 C;  1RAG B;  2OJ2 A;  1UTI A;  3FRN A;  3G71 Q;  2LJ0 A;  2F2X A;  2JJ9 A;  3CC7 Q;  5CKB A;  1VA7 A;  4ZNX A;  1XNI A;  1SSF A;  2XMF A;  1JQQ A;  2OTL A;  4YTL A;  1AOJ A;  2V8K A;  2QA4 A;  1AEY A;  5KCO A;  3SD4 A;  1M1F A;  3TU4 K;  3VRY A;  3CC2 T;  4FT2 A;  4BAC A;  4DOW A;  2LVM A;  2YWW A;  5GAN d;  2MPX C;  2E70 A;  3FB9 A;  5FW9 A;  1IRE B;  3BW1 A;  2DD5 A;  2JNG A;  4OGE A;  4BUG A;  5ECA A;  2CRE A;  1IO6 A;  3VS1 A;  4KH0 B;  4C8Q D;  2XD0 A;  4KUL A;  3R6O A;  4FT4 A;  2HZY A;  2CDT A;  1T3S A;  4C8Q A;  1BI0 A;  3CQT A;  4BE2 A;  1M9S A;  2D0Q B;  3RKW A;  1UGQ B;  5FU6 B;  3J7A F;  1NE8 A;  3PIP A;  4IKF A;  2R5A A;  1Y7X A;  1NEB A;  1D1C A;  2BZ8 A;  3FEO A;  1YJN Q;  2G6F X;  3JB9 F;  3D7S B;  2LCC A;  1BIB A;  1S1N A;  5KYW B;  2E41 A;  4CC7 A;  2RHZ A;  1M2V A;  5GMK m;  1PNJ A;  4IUT A;  4J9D A;  3S6W A;  1MMA A;  1X01 A;  3RUX A;  2RHY A;  2FZC B;  5I2M A;  1VQ6 A;  1YI2 A;  2ZZD A;  2PTK A;  2CSQ A;  3E9G A;  4R55 A;  1KD1 U;  4C92 G;  2E5K A;  1X2Q A;  5GAN f;  2QTX A;  4F7U B;  5IAY A;  2D0N A;  1JXO A;  4KRT A;  3OYE A;  1ZUU A;  5GAM f;  3JB9 J;  5DLQ E;  3T9N A;  2RA2 A;  1K4U S;  5GJW B;  1QQJ A;  2P84 A;  2RQW A;  4J9G A;  4ELZ C;  2QQS A;  1M3C A;  1S72 T;  4M75 F;  1NPP A;  4NL2 A;  3EFS A;  3I55 Q;  2DYI A;  2ENM A;  4JUV A;  1S72 Q;  5KYX B;  2RMO A;  4LNP A;  3L42 A;  1JEG A;  2DER A;  3VS0 A;  3A1P A;  4KH1 B;  2RQR A;  3I56 A;  2A36 A;  2KEA A;  3M58 A;  2EPD A;  5CQX A;  4LD9 K;  1BK2 A;  5GAN 2;  5A2Q E;  3EG9 A;  4FW1 A;  5L23 A;  4E47 A;  2LJ3 A;  3QZ5 B;  2XHC A;  2CZ0 B;  4E2F B;  5FRO A;  3UAT A;  4E7K A;  3VV0 A;  1PRL C;  1Z9Z A;  2ZPB B;  4XTZ A;  3EFO A;  3E19 A;  2DXC A;  1SRM A;  2DXB A;  2CT3 A;  3ZFJ A;  4Y91 A;  1QWE A;  1D1A A;  1V76 A;  3G6E A;  3LW5 E;  4FSX A;  4C0G A;  2RI3 A;  1ACM B;  3X24 B;  2OX7 A;  2IG0 A;  1N9R A;  3M0R A;  4XTY A;  1VQL A;  1YCY A;  4ZGD B;  2LT1 A;  2QAZ A;  2SRC A;  4PJO G;  5GAO n;  2DX1 A;  4X1V A;  2HDA A;  3MET A;  1VQ4 T;  2DTH A;  1WJS A;  5DY9 A;  1KQ2 A;  4RUG A;  4XTW A;  1NJI R;  4CRI A;  3O8V A;  4JZ4 A;  3CBP A;  1XJW B;  1IRX A;  2XKO C;  4AFZ C;  1NG2 A;  2K6D A;  4JS4 A;  1EFN A;  3CPW A;  1KD1 C;  3OYY A;  3M56 A;  3C4S A;  3MEA A;  5GAM j;  4RTZ A;  3PVQ A;  1H64 1;  2G3R A;  4PNO A;  2E3H A;  5GMK e;  2R58 A;  3LWI A;  4J9C A;  1YI2 Q;  1K8A U;  4A4E A;  4FM4 B;  2OAU A;  3EG3 A;  2M0Y A;  2COW A;  1K9M C;  4HVU A;  1AWJ A;  2QTV A;  4GLK A;  1M1K C;  4RTU A;  3QXE B;  3CCM Q;  1M3A A;  3V7R A;  2EVR A;  1B07 A;  1FWZ A;  2E3I A;  1PKT A;  1RAC B;  1ZX6 A;  2A28 A;  2B86 A;  1VQK Q;  3C94 A;  2IVW A;  4CC3 A;  2EJ9 A;  4D8D A;  4M78 E;  1WNL A;  3CCS A;  1ZSG A;  2C0O A;  4F7U G;  2KVQ G;  3X26 B;  2XIC A;  4C5E A;  5J3B A;  3PMI A;  1G3S A;  4BI3 A;  1WHM A;  4TVR A;  2BIV A;  3VRZ A;  2DAQ A;  3V8K A;  1UB4 A;  1HJD A;  3RKX A;  1GBR A;  4M7D C;  1HD3 A;  1H3H A;  4JZ3 A;  1VQP A;  2O01 E;  4F04 B;  1YCS B;  3FLG A;  3CCL A;  5J39 A;  1JJ2 P;  1OU9 A;  2LQN A;  4J9B A;  4O6J A;  1I0C A;  5LJ3 j;  5FU7 C;  1VOM A;  4M77 G;  1OZ2 A;  2JTE A;  4M7D A;  2RI5 A;  1YJW Q;  1VYU A;  4BDY A;  1M90 R;  3BFM A;  3V8J A;  4F7U A;  1PD1 A;  2FZG B;  3GNF B;  1UG1 A;  2L89 A;  3EGU A;  4AG1 C;  4FW2 A;  2YHT A;  1XOV A;  3CCE T;  4OF1 A;  1PKS A;  1NEG A;  4J6X A;  1D0Z A;  3L2Q A;  2D8J A;  1GCQ A;  3RNJ A;  2BKD N;  4M78 G;  3CPW S;  1WXB A;  2HAX A;  2DTO A;  4HT9 A;  4C0Z A;  2CYZ B;  1OX8 A;  2NWM A;  3CBO A;  2R5M A;  1UGP B;  2EJF A;  2K79 A;  4GBQ A;  1YIJ T;  4M77 A;  1I1J A;  1UUE A;  2FVU A;  5KYX A;  5GMK i;  3OYL A;  1M90 C;  3LGL A;  3QZ9 B;  3GLX A;  2HMA A;  1B7T A;  3HL8 A;  4PL6 A;  2QEX Q;  1X6O A;  4A54 A;  1QVF A;  3P8B B;  3CCV Q;  3OW2 A;  4Z88 A;  1UDL A;  5CIU A;  2DL3 A;  3CC2 Q;  1MGQ A;  1TOV A;  3SB2 A;  1T0H A;  3A8M B;  3G1J A;  2K3B A;  3R6N A;  1UHC A;  4FSS A;  2EQI A;  1VQL T;  2M02 A;  2EYQ A;  3H41 A;  1OUL A;  3C95 A;  2BUD A;  5GAN 7;  4M78 B;  3CXC S;  3JCM W;  1P92 A;  2QK0 A;  1WHH A;  2P0Q A;  1ZSZ C;  1KHI A;  2FZK B;  3M53 A;  1ZA1 B;  2E10 A;  4FIB A;  5GAO m;  5DM7 R;  3QHS A;  3BY7 A;  3V7S A;  3CCV T;  2XDD A;  1BBZ A;  4XU1 A;  1T3L A;  4D6W A;  4L5G A;  3FC3 A;  3M54 A;  4B9X A;  2NYS A;  5KH6 A;  4PLI A;  4M77 B;  3BDU A;  2CT4 A;  2YSQ A;  2RQV A;  4OGC A;  4M7A E;  3AT1 B;  4KT0 E;  4DEX A;  1OPK A;  1K1Z A;  3MEU A;  2WSC E;  1Z9Q A;  5LJ3 f;  4C8Q E;  2DKG A;  1NLO C;  1N8R R;  2CGH A;  3EG1 A;  5GAN 8;  5I2S A;  1KC8 C;  2RD1 A;  3E1S A;  5IXB A;  1M27 C;  1RL2 A;  3F70 A;  1ZA2 B;  2HSE B;  1BYM A;  4OMN A;  1WYX A;  4M78 C;  1RI9 A;  1V1C A;  4J6W A;  3QSU A;  1G3W A;  3EG0 A;  3M0U A;  3MEV A;  2HQH A;  3OYH A;  3CCJ Q;  4RTY A;  5IXF A;  2VC8 A;  1PG5 B;  4RMO A;  1SHF A;  2NLU A;  1TUD A;  4PJO D;  3L2W A;  2MCN A;  1N5Z A;  2QEX T;  1QVP A;  1AT1 B;  4UC4 A;  2RQT A;  3HFN A;  4BB7 A;  4M75 B;  2J06 A;  2F2V A;  2L3Q A;  1AWX A;  4M75 G;  3CD6 Q;  1E7O A;  1D3B B;  1QKW A;  3GPL A;  2CUB A;  4C92 B;  3UA7 A;  2VV5 A;  3GP8 A;  2BZY A;  3HTR A;  4MZT A;  2MIO A;  2DZC A;  4MDW A;  3JCM X;  4HXJ A;  3SWN B;  2P4T A;  3VKI A;  1QWF A;  3OYK A;  4PKC C;  1ZHI A;  2E5Q A;  5CKD A;  2B8A A;  2LCL A;  4RTW A;  4MZP A;  1RAA B;  2GF7 A;  1SPK A;  2JUF A;  1U1S A;  4J9I A;  3OY9 A;  4EMK C;  4PJO E;  2LC4 A;  2DJQ A;  2AT1 B;  5CQY A;  3JRZ A;  5GAN 6;  6AT1 B;  2A0F B;  5FU6 C;  3KXT A;  3SDZ A;  2DL4 A;  3CBM A;  1ARK A;  4IIO A;  4LUE A;  4J9E A;  3G4S T;  3CME Q;  2WSF E;  5LJ5 d;  1K0X A;  1OZ3 A;  4B9W A;  5GAM h;  4J8O A;  3VS3 A;  3RBB B;  1LOJ A;  1NYG A;  2CP6 A;  1IGU A;  3QDF A;  2DET A;  1VQ7 T;  4DBH A;  2FL7 A;  4IUR A;  2DTI A;  1K73 C;  5LL6 S;  1U5S A;  1BIA A;  3L2U A;  3JCM Q;  1B34 A;  1OV3 A;  2BTT A;  1ABO A;  2KXC A;  2FEI A;  4RTT A;  5IHK A;  1K9M R;  2D6F A;  3E2U A;  3NHN A;  1NPR A;  2HBP A;  1YNZ A;  4C0D B;  1ZSZ B;  1M90 U;  4JRQ A;  3TCJ A;  3EHR A;  2ABL A;  4AT1 B;  2K3X A;  3OYF A;  4QVZ A;  1SRL A;  4AFQ C;  2MOX A;  2EGC A;  5GAN e;  4LDW A;  2JXB A;  2HL5 C;  1NZ9 A;  5D6X A;  2EFI A;  3I35 A;  2JT4 A;  1NJI C;  4QKU A;  1K9A A;  3L1A A;  2GTJ A;  4M78 A;  2HCK A;  3NTH A;  2GFA A;  1D0X A;  3OQ5 A;  1OOT A;  1Q86 R;  2MAM A;  4DA4 A;  2E6Z A;  2RB6 A;  2M51 A;  1H3Z A;  3UA6 A;  5LJ5 g;  3DKM A;  2LX9 A;  3ZBD A;  1VQ7 Q;  2DVE A;  1KFZ A;  2EYY A;  2J6O A;  3ASK A;  4XQ3 A;  2Y90 A;  2LRQ A;  5D6Y A;  2XDB A;  3ZL7 C;  1YIJ A;  1MNE A;  2EYW A;  1AHJ B;  4OB1 B;  2CZ7 B;  2KRN A;  2DEQ A;  3DLM A;  3G71 T;  3I5S A;  5CK9 A;  2W0Z A;  3OS2 A;  1KJW A;  4EMH A;  4OMQ A;  1YWP A;  4ZTF A;  3HSB A;  1PC0 A;  2QYZ A;  1OI1 A;  2NUZ A;  4BI8 B;  2V8I A;  2HEQ A;  2JS2 A;  2VXE A;  1GCP A;  2DL7 A;  3UPU A;  2LQ8 A;  5GAO q;  3O5Z A;  5KE3 A;  1VQK T;  3EGX A;  3OYB A;  4M7D D;  2EQJ A;  1TUG B;  4ZN3 A;  3CME A;  4LDU A;  2O9V A;  1RAE B;  4BI4 A;  3CCM T;  5GAN j;  2Z0W A;  2LTO A;  3CCV A;  1FMV A;  3SHW A;  3EAE A;  3VJP A;  3X28 B;  3L2R A;  4J83 A;  1VQO A;  4M77 D;  1YFN A;  1VQM A;  1U8R A;  2AHJ B;  3FJP A;  4L6V 5;  1O75 A;  5KYW A;  4NS5 A;  4PFZ A;  1K76 A;  2KYB A;  2LDM A;  3QPH A;  2XG8 D;  2DF6 A;  4OMM A;  3SWN A;  4M78 F;  1BCM A;  1ZBX A;  1Q7Y R;  3A5Z B;  4X34 A;  4QQ6 A;  1VQN T;  4E7J A;  2KYM A;  3OW2 P;  4QQG A;  1KIK A;  2KQW A;  4JJN K;  3SWN C;  3TRE A;  1TTH B;  4KBM B;  1Y07 A;  1JBM A;  3EH2 A;  4LN2 A;  3PVL A;  2E65 A;  4BY6 C;  1H92 A;  2ZPG B;  3QII A;  2LQK A;  4C0F A;  1Q86 U;  5CKH A;  4FYV B;  2ZCF B;  1BB9 A;  2OTL Q;  4JJD A;  1AZG B;  5A0G A;  4HKE A;  5FRM A;  2K57 A;  1YJN T;  3CCM A;  3NGP A;  2HL3 A;  3OYJ A;  4E6R A;  1UJY A;  1C6V X;  2RJC A;  3JSC A;  3JB9 H;  1VQK A;  4HT8 A;  1KHC A;  4RTV A;  1M1G A;  1GFD A;  3CCS Q;  1RAB B;  2FRW A;  3EG9 B;  3C0C A;  1JJ2 A;  1M30 A;  4JJB A;  3VS4 A;  4FYW B;  4X9C A;  4HCZ A;  1PWT A;  5L8R E;  1VYV A;  2K5L A;  1YJN A;  1BKB A;  4HCC A;  4LD6 A;  2NUP B;  2PVG B;  1NM7 A;  4C0D C;  1VQP Q;  2ROT A;  4HA8 A;  5GAO r;  3QYG B;  3LH5 A;  2LMJ A;  1S72 A;  1M4Z A;  5CKF A;  3I55 T;  4RKU E;  2NUT A;  1KG1 A;  2DA9 A;  1Q81 C;  2A08 A;  3C12 A;  3I56 T;  2KAF A;  1VQ5 T;  1MHN A;  4C8Q C;  4GLM A;  3X20 B;  4BE0 A;  2X4J A;  2IPO B;  3CCE Q;  4PJJ A;  3QKJ A;  4PJO A;  3M59 A;  1WLP B;  2OTL T;  2QQB A;  3DB4 A;  3MP1 A;  2RF0 A;  2P4R A;  2RPN A;  1Y57 A;  2QQA A;  4C5I A;  2HKQ B;  4M7D F;  2PUK B;  2EYZ A;  4PJO C;  2E6N A;  1QVG A;  3CCQ Q;  3WVE B;  4A4G A;  1X43 A;  3I55 A;  3MPU B;  2DYB A;  4KGX B;  3ZEH A;  1Q82 C;  1WHG A;  1TSF A;  4WCI A;  3AHU A;  2L3S A;  4M7A F;  3QG1 A;  3M0Q A;  3MHX A;  2ZGW A;  2KT1 A;  3A8G B;  3OMG A;  3REA B;  4E7I A;  1YN8 A;  5KYY A;  2MWP A;  4JDS A;  3JCM e;  2EQU A;  4PJL A;  2A3L A;  2JW4 A;  1M8M A;  4A53 A;  3NTK A;  4ORZ A;  3OB9 A;  2MI6 A;  2MWO A;  1Y96 A;  2RHI A;  4EMG A;  1M5Q 1;  3PGG A;  3CCJ T;  1G3Y A;  2GTO A;  2DIL A;  2EIF A;  3NFC A;  1RLP C;  5D7U A;  2ZPH B;  1N9S A;  3EGX B;  3BDL A;  1VQM T;  3H0F A;  3CCU T;  1VQP T;  2VGN A;  1X6B A;  1Q86 C;  4HVW A;  4M7D G;  3LGF A;  2DEU A;  5GAN 5;  2JOY A;  2M0O A;  3GBQ A;  2YUQ A;  4J5Y A;  4E7L A;  1I5L A;  2DBM A;  2CSI A;  5EC7 A;  2AKK A;  2YXY A;  1C0M A;  2D8H A;  4EIK A;  2E64 A;  2J6F A;  3HRU A;  4OMO A;  2PNI A;  5IT9 E;  2QA4 Q;  1YIT A;  3HRS A;  3TQ7 P;  2YUP A;  2EBP A;  3I56 Q;  1YHQ Q;  5LJ3 d;  3X25 B;  2O9S A;  2QA4 T;  2CH4 A;  1Y96 B;  1PD0 A;  4JRK A;  1YI2 T;  2HD0 A;  3P8H A;  2K4Y A;  3CCJ A;  3M4Y A;  1FMK A;  4C8Q F;  5KCH A;  4M4Z A;  2LX7 A;  3JCM c;  3LYI A;  1N8R U;  1WDX A;  1UE9 A;  5KYU A;  2DXU A;  4NOY A;  4C8Q B;  2E12 A;  2EGA A;  1YIT T;  2RM4 A;  1OX9 A;  1TUC A;  5IHI A;  3CCR Q;  1W4S A;  1WA7 A;  5EG2 A;  4ESR A;  2QEX A;  3LH0 A;  1QVF P;  1D1B A;  5GAO l;  2JMC A;  3CC4 Q;  1KD1 R;  1VQL Q;  3LX7 A;  3OYN A;  5J26 A;  2F1L A;  3EFR A;  1IXD A;  3QUI A;  1JRI A;  1M2V B;  1UGR B;  2VUB A;  2DBK A;  2WSE E;  1VQ4 A;  4M77 E;  2GQV A;  3JCM b;  5IN1 A;  2DE0 X;  2X3W D;  2K2V A;  4XU0 A;  4PJO F;  3PTA A;  3RMS A;  4C5H A;  1AWW A;  1X2K A;  2BZX A;  2CUD A;  2L0A A;  1VQ8 T;  2PVD B;  2NUP A;  2DPP B;  4CC4 B;  2JZ2 A;  4Z02 A;  1R77 A;  4LE9 A;  3H0I A;  4OB3 B;  3EH1 A;  3A8O B;  3CCQ T;  1ZUK A;  1C1A A;  4F7U E;  1Q7Y U;  2QGF B;  3OS0 A;  2EQK A;  4KUI A;  4BE1 A;  2F5T X;  3FIF A;  2DK3 A;  5KYU B;  2WAC A;  4M75 D;  5GAO p;  4NL3 A;  2AK5 A;  4LDV A;  2M9U A;  5GAM e;  3EGD B;  2AZV A;  1T0J A;  4J7I A;  5CR2 A;  2I2L A;  5KYN A;  1JO8 A;  4M7A G;  5I11 A;  3N5B B;  1QKX A;  4E7Z A;  5A0L A;  1VQ9 Q;  2VB6 A;  4FCY A;  3E9F A;  2FB7 A;  5GMK l;  2A37 A;  2JTF A;  2K5I A;  1BI2 A;  2ROL A;  4FU6 A;  2GCX A;  1VQ5 A;  3RER A;  1UJ0 A;  2OI3 A;  3RKY A;  3Q1J A;  4C92 F;  1GFC A;  2LT4 A;  3GNG A;  3THK A;  1SEM A;  4J9H A;  5LJ5 e;  4N4I A;  1X6G A;  3JCM J;  4DQ2 A;  1WPY A;  2Y4X A;  1UFF A;  3CC7 A;  3KUF A;  2RH2 A;  2FG0 A;  2F2W A;  2PVO B;  3CD6 A;  1KQS A;  2RI2 A;  1FMW A;  1VQ8 Q;  1N6A A;  1M8V A;  1SF9 A;  2VKN A;  3EFO B;  3OYG A;  1WHL A;  1GXI E;  2EKH A;  4FL6 A;  1QCN A;  1WHK A;  3OS1 A;  3JB9 G;  1M2O A;  1W2B S;  2V1R A;  3OS5 A;  1OPL A;  1W1F A;  2KY9 A;  2D1X A;  1MMD A;  2DNU A;  1W2B P;  4OML A;  1SG5 A;  1HYO A;  4BDZ A;  2EAY A;  5CCA A;  2KNB B;  1I5O B;  1N27 A;  2CP0 A;  3LLR A;  3IQL A;  4OB2 B;  2EKO A;  1SKU B;  2DJZ A;  2J6K A;  2DL8 A;  1XQH A;  1YHQ T;  2HQX A;  1FYN A;  3BE3 A;  2FPF A;  4QVC A;  1UHF A;  4CC2 A;  1V29 B;  2H3E B;  5LJ5 f;  2X4X A;  3PNW C;  4E7H A;  2LJ1 A;  2O88 A;  3V7C A;  1PSE A;  1OU8 A;  1HXD A;  2GQI A;  4DBQ A;  3QDR B;  4HCK A;  2QDL A;  5GJV B;  1W2B A;  5FLX E;  1QW1 A;  1M1K R;  2OTJ A;  2J7I A;  5HY6 A;  1ZUY A;  1KC8 R;  2V1Q A;  2YUO A;  2GNC A;  5HK3 A;  3CCU Q;  1AWO A;  3NPF A;  4C92 D;  2MMP A;  4PJN A;  4QVD A;  1VQ9 T;  2FO0 A;  2YLB A;  3J81 E;  1IHW A;  3OYI A;  2RK1 A;  1ZLM A;  2M16 A;  2IIM A;  4AFU C;  2DM1 A;  2C06 A;  1B3Q A;  3PIO A;  1YJW A;  3CEY A;  2DLP A;  2DRK A;  2K5F A;  1KQ1 A;  4EMK B;  3A98 A;  1QVG P;  3HHT B;  3GOX A;  4KUD K;  1VQ9 A;  4N0A A;  2ED0 A;  2KT8 A;  2KRS A;  5CO7 A;  2OTJ T;  1FX7 A;  3M4G A;  4QW2 A;  1QVG S;  1M1K U;  1EX4 A;  3M5A A;  2YT6 A;  1I81 A;  2XU8 A;  2RJF A;  4BD3 A;  2O2O A;  4CI0 C;  4PK4 A;  2QDY B;  3JCM h;  3GF5 A;  5C6S A;  2FHD A;  1IGQ A;  3HPW A;  2COY A;  3WXM B;  1LJO A;  3MO8 A;  3ULR B;  3VUB A;  3OYA A;  1OQK A;  2ESW A;  4LDY A;  2COZ A;  2L5Q A;  4Q5W A;  5CKE A;  4AMC A;  3G71 A;  4PLL A;  3EGD A;  3G6E T;  4O5V A;  2X4Y A;  1EIF A;  1MV0 B;  2DIG A;  4DEY A;  1HK9 A;  1K8A R;  1R0C B;  1A0N B;  3MP8 A;  2K7A A;  1X75 C;  3V8L A;  1X27 A;  4EMK A;  2EW3 A;  1Q81 R;  1D0Y A;  2KXD A;  2RHU A;  1VQ7 A;  2LNH B;  4OVA A;  1RAI B;  2ECZ A;  1E6G A;  1GBQ A;  4M7A C;  1YWO A;  2RQU A;  2XI9 A;  1GL5 A;  2KMT A;  1K73 R;  2CS7 A;  2K9G A;  3L2V A;  2QQ9 A;  1RAF B;  1G3T A;  2HQE A;  2DZ9 A;  4A4F A;  1RUW A;  5LJ3 e;  1QVF S;  2ZAE A;  5CVI A;  2PZ1 A;  3I5R A;  4RG2 A;  2FYK A;  1MUZ A;  5LJ3 h;  1Q81 U;  2CP2 A;  5LJ5 j;  2ZPI B;  1TH7 A;  1DJ7 B;  3P8D A;  3HKS A;  5FRN A;  5GAN g;  4V2S A;  5I22 A;  2O4X A;  4M7D E;  3CC7 T;  2RN8 A;  3MCA B;  1IHV A;  3RDV A;  4JRI A;  1MMG A;  3OBW A;  2JS0 A;  3LWH A;  2GFU A;  2VXF A;  1YIJ Q;  2LP5 A;  1VQ6 T;  4BY6 B;  1QMC A;  2V26 A;  3JCM P;  3L2Z A;  1FXX A;  3QO3 A;  3CCL T;  1Q82 U;  5DLO A;  4OMP A;  3G6E Q;  1VIF A;  3VS2 A;  4J7F A;  1W6X A;  3FDR A;  1VQN Q;  4JPB W;  2LCS A;  1VQM Q;  4N0A C;  4RCB A;  1WQ7 A;  2FPE A;  3PFS A;  1YP5 A;  5FU7 B;  1WHJ A;  3HFO A;  4ZGJ B;  2RJD A;  2P0K A;  2AIR B;  4K11 A;  1WXU A;  4C92 C;  4M75 A;  2XID A;  3U23 A;  5GMK j;  2RK2 A;  3M0T A;  3EG2 A;  1LCK A;  3JB9 D;  2R57 A;  1R8O B;  1M3B A;  2PU9 B;  4C92 A;  1WX6 A; 
#chains in the Genus database with same CATH homology
 5HKC A;  1PSF A;  5AYF A;  2QA4 T;  3CPF A;  1Y96 B;  2XK0 A;  4M77 C;  4M75 G;  3SFM A;  3G4S A;  2VGM A;  3FRN A;  3H8Z A;  4JRK A;  3UWN A;  1YI2 T;  2DIQ A;  2CKK A;  2HD0 A;  3P8H A;  1D3B B;  3GPL A;  4C92 B;  4EDU A;  2K4Y A;  2VV5 A;  5CKB A;  3CCJ A;  3M4Y A;  3GP8 A;  4OB0 B;  3JCM d;  4C8Q F;  5KCH A;  1XNI A;  3ME9 A;  4MZT A;  1SSF A;  2DZC A;  3CC2 T;  4MDW A;  3JCM X;  2OTL A;  4YTL A;  5GAM d;  3JCM c;  3SWN B;  2P4T A;  2V8K A;  3LYI A;  3VKI A;  4BB7 A;  3OYK A;  2QA4 A;  1N8R U;  4PKC C;  3WVD B;  1ZHI A;  1M1F A;  2DXU A;  2E5Q A;  3SD4 A;  5CKD A;  4FT2 A;  4NOY A;  2B8A A;  2LCL A;  4BAC A;  4DOW A;  3HP9 A;  4MZP A;  4C8Q B;  2E12 A;  2LVM A;  1YIT T;  5GAN d;  2GF7 A;  3VU3 C;  2RM4 A;  2E70 A;  3FB9 A;  1IRE B;  1W4S A;  2JUF A;  3BW1 A;  1U1S A;  2DD5 A;  2JNG A;  5EG2 A;  4OGE A;  4BUG A;  3OY9 A;  2QEX A;  3LH0 A;  1K73 U;  4EMK C;  5GAO l;  4PJO E;  4C8Q D;  5GAN 3;  2XD0 A;  2LC4 A;  1U1T A;  4KUL A;  3R6O A;  4ZGE B;  5CQY A;  3LX7 A;  3JRZ A;  4FT4 A;  4GY5 A;  4X9D A;  5J26 A;  5GAN 6;  3OYN A;  5GMK h;  3EFR A;  1VQ5 T;  4C8Q A;  1BI0 A;  4BE2 A;  5FU6 C;  3KXT A;  3SDZ A;  1M9S A;  2D0Q B;  3RKW A;  3QUI A;  1JRI A;  1UGQ B;  3CBM A;  5FU6 B;  5GAN h;  1UGR B;  2VUB A;  3J7A F;  1XTD A;  1NE8 A;  2WSE E;  4M7A A;  3G4S T;  1VQ4 A;  4M77 E;  2WSF E;  2GQV A;  3RMQ A;  5LJ5 d;  3PIP A;  3CXC A;  3JCM b;  4IKF A;  2R5A A;  5IN1 A;  1OZ3 A;  4B9W A;  5GAM h;  1Y7X A;  2K2V A;  4J8O A;  1LOJ A;  4XU0 A;  3FEO A;  4PJO F;  3JB9 F;  3PTA A;  2LCC A;  3RMS A;  4C5H A;  1BIB A;  3CCR A;  4N4H A;  2E41 A;  2RHZ A;  5GMK m;  1VQ7 T;  4IUT A;  3S6W A;  2E1H A;  4XAX B;  1VQ8 T;  3S3M A;  1X01 A;  2PVD B;  3RUX A;  2DPP B;  5KCO A;  2FL7 A;  2RHY A;  2JZ2 A;  4IUR A;  2DTI A;  3QYH B;  4Z02 A;  5I2M A;  4ZN1 A;  1K73 C;  4OB3 B;  5LL6 S;  2A7Y A;  1VQ6 A;  1YI2 A;  3A8O B;  5FRN A;  1BIA A;  3CCQ T;  2ZZD A;  3L2U A;  1NJI U;  3JCM Q;  1B34 A;  3E9G A;  4R55 A;  5GAN 4;  1KD1 U;  4F7U E;  4C92 G;  1WGS A;  5GAN f;  1Q7Y U;  2QTX A;  2EQK A;  3UDC A;  4KUI A;  3OS0 A;  4F7U B;  2F5T X;  5IAY A;  4BE1 A;  3FIF A;  1KQS S;  2D6F A;  2DK3 A;  2D9T A;  1NPR A;  3OYE A;  2WAC A;  4M75 D;  2HBP A;  5GAO p;  4C0D B;  4NL3 A;  1M90 U;  5GAM f;  3JB9 J;  4QQD A;  5DLQ E;  3T9N A;  2RA2 A;  3TCJ A;  4JRQ A;  1B34 B;  4LDV A;  2M9U A;  1YBY A;  5GAM e;  5C0M A;  3OBY A;  2K3X A;  5A0D A;  3OYF A;  4QVZ A;  4ELZ C;  5CAI A;  4J7I A;  5CR2 A;  2I2L A;  2QQS A;  5GAN e;  3CCU A;  4LDW A;  4M75 F;  1S72 T;  1NPP A;  2XDP A;  4A4K A;  4M7A G;  4NL2 A;  1NZ9 A;  2CZ6 B;  3EFS A;  3N5B B;  5LJ3 g;  5D6X A;  2EFI A;  4M78 D;  2X35 A;  4JUV A;  4XU3 A;  3OSS C;  4M7A B;  5A0L A;  1NJI C;  2DO3 A;  4C8Q G;  3E9F A;  3OYC A;  2FB7 A;  3L42 A;  3L1A A;  4M78 A;  1Q7Y C;  5GMK l;  2JTF A;  2K5I A;  1BI2 A;  3NTH A;  4FU6 A;  2GCX A;  1VQ5 A;  2GFA A;  3OMC A;  3I56 A;  3RER A;  3M58 A;  3OQ5 A;  4ZTJ A;  1QP2 A;  2MAM A;  4DA4 A;  2E6Z A;  5CQX A;  4LD9 K;  2RB6 A;  5GAN 2;  3S3N A;  4M7D B;  1H3Z A;  3RKY A;  3Q1J A;  4C92 F;  5A2Q E;  2LT4 A;  3GNG A;  4M75 C;  2ZPE B;  3DKM A;  5LJ5 g;  2LX9 A;  1UGS B;  3ZBD A;  4E47 A;  2DVE A;  5LJ5 e;  4N4I A;  3QZ5 B;  2O4X B;  2XHC A;  3ASK A;  2CZ0 B;  4XQ3 A;  2Y90 A;  3NTI A;  2RJE A;  2LRQ A;  5FRO A;  3JCM J;  4E7K A;  3VV0 A;  5D6Y A;  4DQ2 A;  4LDX A;  2XDB A;  3CC2 A;  1WPY A;  2Y4X A;  2ZPB B;  4XTZ A;  3CC7 A;  3KUF A;  1YIJ A;  2RH2 A;  3E19 A;  1AHJ B;  2DXC A;  4OB1 B;  2CZ7 B;  2DXT A;  2DEQ A;  2DXB A;  3DLM A;  4P5N A;  5I21 A;  2PQW A;  2PVO B;  3ZFJ A;  3G71 T;  3CD6 A;  1KQS A;  3VUZ A;  4Y91 A;  2RI2 A;  4ATO A;  4C92 E;  1I8F A;  5CK9 A;  3G6E A;  3LW5 E;  4FSX A;  4C0G A;  1N6A A;  3OS2 A;  2RI3 A;  2KK4 A;  1M8V A;  4EMH A;  3X24 B;  3OYG A;  1GXI E;  1IZ6 A;  4OP0 A;  4ZTF A;  4M75 E;  2EJG A;  3HSB A;  2IG0 A;  1N9R A;  4FL6 A;  3OS1 A;  4XTY A;  1N8R C;  1VQL A;  1YCY A;  2QXF A;  3MP6 A;  4ZGD B;  2LT1 A;  1OI1 A;  4DOV A;  4BI8 B;  2V8I A;  4PJO G;  3JB9 G;  4RCC A;  5GAO n;  1W2B S;  2VXE A;  3OS5 A;  3MET A;  3UPU A;  1VQ4 T;  2DTH A;  2KY9 A;  2LQ8 A;  3OW2 S;  5GAO q;  1K9M U;  5KE3 A;  1WJS A;  5DY9 A;  5D6W A;  1VQK T;  1KQ2 A;  4JS5 A;  4BDZ A;  2EAY A;  5CCA A;  3OYB A;  4XTW A;  4M7D D;  2EQJ A;  1N27 A;  3LLR A;  4M77 F;  4ZN3 A;  1WJR A;  4OB2 B;  4R56 A;  4CRI A;  4LDU A;  2EKO A;  3CME A;  3O8V A;  4MML A;  3JCM g;  3CBP A;  2DJZ A;  4BI4 A;  4JRP A;  3CCM T;  5GAN j;  2XKO C;  2LNV A;  4A4H A;  2LTO A;  3I56 T;  3CCV A;  1XQH A;  4JS4 A;  1VUB A;  1YHQ T;  3CCE A;  3CPW A;  2HQX A;  4N4G A;  1KD1 C;  3OYY A;  3EAE A;  3VJP A;  3X28 B;  3M56 A;  3C4S A;  4QVC A;  3MEA A;  3L2R A;  5GAM j;  1V29 B;  1H64 1;  4J83 A;  2G3R A;  4PNO A;  5LJ5 f;  2X4X A;  1VQO A;  4M77 D;  3PNW C;  1VQM A;  1JB0 E;  2AHJ B;  3FJP A;  2KDS A;  2R58 A;  4L6V 5;  5GMK e;  3LWI A;  4E7H A;  1O75 A;  4NS5 A;  3S3O A;  1K8A U;  4A4E A;  4FM4 B;  2OAU A;  2LDM A;  3A8H B;  3QPH A;  3V7C A;  1PSE A;  4MMK A;  3QJ6 A;  2XG8 D;  1HXD A;  1YJ9 T;  1K9M C;  4F7U F;  3SWN A;  2L3R A;  4M78 F;  1LNX A;  4IUP A;  3QDR B;  1ZBX A;  4MZM A;  2VYT A;  4WF2 A;  3A5Z B;  4X34 A;  1W2B A;  4RG8 A;  5FLX E;  4GLK A;  1M1K C;  1QW1 A;  4QQ6 A;  2OTJ A;  1VQN T;  4E7J A;  5M9O A;  5HY6 A;  3CMA T;  3QXE B;  4QQG A;  3V7R A;  3TU4 K;  1FWZ A;  2KQW A;  4JJN K;  3SWN C;  5HK3 A;  2RHX A;  2L8D A;  4IUU A;  1O9S A;  4KBM B;  3TRE A;  4C92 D;  2MMP A;  2EWN A;  4QVD A;  1Y07 A;  1VQ9 T;  3C94 A;  4IUV A;  1JBM A;  2IVW A;  2YLB A;  3J81 E;  2RO0 A;  2EJ9 A;  2MF2 A;  4M78 E;  3OYI A;  2E65 A;  2RK1 A;  4BY6 C;  1WNL A;  2M16 A;  3JB9 I;  3J80 E;  3CCS A;  2ZPG B;  3QII A;  4F7U G;  2KVQ G;  2LQK A;  3X26 B;  3PIO A;  4C0F A;  1Q86 U;  2C06 A;  1YJW A;  3CEY A;  1KC8 U;  3RIR A;  2XIC A;  5CKH A;  4C5E A;  2K5F A;  3OYM A;  1KQ1 A;  2ZCF B;  4EMK B;  5J3B A;  1G5V A;  1QP3 A;  2K3Y A;  3PMI A;  3HHT B;  3GOX A;  1G3S A;  5A0G A;  4N0A A;  4BI3 A;  1VQ9 A;  4KUD K;  4HKE A;  1BI1 A;  5HK0 A;  5FRM A;  2K57 A;  1YJN T;  4TVR A;  2BIV A;  3INZ A;  2DAQ A;  5CO7 A;  3V8K A;  4OMF B;  3CCM A;  1UB4 A;  2OTJ T;  1FX7 A;  3M4G A;  4QW2 A;  3RKX A;  2QQR A;  1QVG S;  1M1K U;  4M7D C;  3OYJ A;  3M5A A;  1I81 A;  2PUO B;  2XU8 A;  2RJF A;  2H3J A;  4BD3 A;  3OSV A;  2RJC A;  3JSC A;  1VQP A;  3H6Z A;  4CI0 C;  2O01 E;  4J6Y A;  1VQN A;  1VQK A;  3JB9 H;  3FLG A;  3CCL A;  2QDY B;  2KSS A;  5J39 A;  3CC4 A;  3M55 A;  4HT8 A;  1KHC A;  3JCM h;  1M1G A;  3GF5 A;  2HNI A;  4O6J A;  5FU7 C;  5C6S A;  1UEB A;  1OZ2 A;  2FHD A;  4M77 G;  5LJ3 j;  4M7D A;  2RI5 A;  2M1H A;  4BDY A;  3BFM A;  3HPW A;  3V8J A;  2JN0 A;  3GNF B;  4F7U A;  1JJ2 A;  3JCM V;  3WXM B;  1LJO A;  3MO8 A;  3OYA A;  4X9C A;  3VUB A;  3CCR T;  4HCZ A;  1D3B A;  2L89 A;  5L8R E;  4EPC A;  4LDY A;  2K5L A;  3GIB A;  2L5Q A;  4Q5W A;  5CKE A;  2X4W A;  3CMA A;  1YJN A;  2YHT A;  1I4K 1;  1BKB A;  2V8J A;  4XK8 E;  3G71 A;  4HCC A;  3HRT A;  1XOV A;  4PLL A;  3CCE T;  4LD6 A;  4OF1 A;  4J6X A;  2PVG B;  3L2Q A;  3VYH B;  4C0D C;  4XTX A;  3G6E T;  2BKD N;  2EQM A;  4HA8 A;  2X4Y A;  4M78 G;  4O5V A;  5LJ5 h;  1EIF A;  3CPW S;  5GAO r;  1VQO T;  2DIG A;  1VIE A;  1YJ9 A;  2DTO A;  3QYG B;  4VUB A;  4C0Z A;  3CME T;  2HAX A;  4HT9 A;  1S72 A;  2CYZ B;  1HK9 A;  3M57 A;  3OYD A;  1M4Z A;  3CBO A;  2R5M A;  3MP8 A;  5CKF A;  1UGP B;  2EJF A;  3I55 T;  1X75 C;  3DLL A;  4M77 A;  3V8L A;  2JTM A;  1YIJ T;  4PJO B;  4RKU E;  2FVU A;  1KG1 A;  4Y28 E;  4C5G A;  5GMK i;  3OYL A;  4EMK A;  3LGL A;  1M90 C;  4HCB A;  3QZ9 B;  1Q81 C;  3GLX A;  4ELY C;  1JJ2 S;  3C12 A;  2RHU A;  3HL8 A;  3KBG A;  2KAF A;  4L59 A;  4PL6 A;  3JAM E;  1X6O A;  4XTV A;  3RES A;  1MHN A;  4A54 A;  4C8Q C;  3P8B B;  3X20 B;  1U8R A;  4BE0 A;  2X4J A;  1VQ7 A;  3OW2 A;  3TEE A;  1QVF A;  1OYX A;  4OVA A;  2F69 A;  3QKJ A;  5CIU A;  2ZPF B;  4PJO A;  3M59 A;  3URG A;  3UT1 A;  1RI0 A;  2OTL T;  1ZQ1 A;  2QQB A;  3A8L B;  3ER0 A;  4JLI A;  1K8A C;  3DB4 A;  4M7A C;  3MP1 A;  2XI9 A;  1MGQ A;  2KMT A;  3SB2 A;  3G7Z A;  2CS7 A;  3A8M B;  2QQA A;  4C5I A;  3L2V A;  2QQ9 A;  4M7D F;  2PUK B;  1G3T A;  4PJO C;  1VQL T;  2E6N A;  2HQE A;  1QVG A;  3WVE B;  2DZ9 A;  4A4F A;  2EYQ A;  4A4G A;  5LJ3 e;  3I55 A;  1VQ8 A;  3C95 A;  1QVF S;  3CD6 T;  5CVI A;  2BUD A;  3ZEH A;  5GAN 7;  1Q82 C;  4M78 B;  3CXC S;  3JCM W;  1P92 A;  5GAM g;  1WJQ A;  4RG2 A;  2FYK A;  3AHU A;  2P0Q A;  3OA6 A;  4M7A F;  3QG1 A;  3MHX A;  3PT9 A;  5LJ3 h;  1Q81 U;  2ZGW A;  3A8G B;  3OMG A;  5LJ5 j;  2ZPI B;  1KHI A;  1DJ7 B;  1TH7 A;  3HKS A;  3P8D A;  4IUQ A;  4E7I A;  3M53 A;  4FIB A;  2E10 A;  5GAN g;  5GAO m;  2MWP A;  4V2S A;  5DM7 R;  4JDS A;  3JCM e;  2EQU A;  3QHS A;  2A3L A;  3BY7 A;  2O4X A;  3QBY A;  3V7S A;  4A53 A;  3CCV T;  2XDD A;  4M7D E;  3NTK A;  3OB9 A;  4XU1 A;  2MI6 A;  2MWO A;  1Y96 A;  1BI3 A;  3CC7 T;  1YJW T;  3MCA B;  3JCM f;  4XTU A;  4D6W A;  5KE2 A;  4JRI A;  2RHI A;  3OBW A;  4L5G A;  3FC3 A;  3M54 A;  4EMG A;  1M5Q 1;  2GFU A;  3PGG A;  3LWH A;  4M7A D;  3CCJ T;  1G3Y A;  2VXF A;  3QJY A;  2CZ1 B;  3DB3 A;  4M77 B;  4PLI A;  4B9X A;  5KH6 A;  3BDU A;  3CCQ A;  2EIF A;  4M7A E;  4OGC A;  4KT0 E;  3NFC A;  1VQ6 T;  2YRV A;  2ZPH B;  4BY6 B;  1N9S A;  3BDL A;  3JCM P;  3L2Z A;  1VQM T;  1FXX A;  3MEU A;  3QO3 A;  2WSC E;  3CC4 T;  5LJ3 f;  4C8Q E;  3CCL T;  2DD4 A;  1Q82 U;  3CCU T;  5DLO A;  2DKG A;  1VQP T;  1Y71 A;  1VIF A;  4JLG A;  3VYG A;  2CGH A;  2VGN A;  1Q86 C;  4J7F A;  4M7D G;  5GAN 8;  5I2S A;  1KC8 C;  3LGF A;  1YHQ A;  2QI2 A;  2RD1 A;  5GAN 5;  2JOY A;  3E1S A;  3PMT A;  4MDX A;  3FDR A;  1RL2 A;  2M0O A;  3F70 A;  3M9Q A;  4J5Y A;  4E7L A;  1BYM A;  1I5L A;  4N0A C;  4M78 C;  4RCB A;  1WQ7 A;  3PFS A;  4ME7 A;  4II1 A;  2F5K A;  5FU7 B;  4J6W A;  3QSU A;  1G3W A;  3HFO A;  3MEV A;  4ZGJ B;  2YLC A;  2RJD A;  2P0K A;  3OYH A;  4C92 C;  2E64 A;  4M75 A;  2XID A;  2VC8 A;  2RK2 A;  5GMK j;  3CCS T;  3HRU A;  4RMO A;  5IT9 E;  2JVV A;  4XU2 A;  2NLU A;  3JB9 D;  4PJO D;  3L2W A;  1YIT A;  3HRS A;  2R57 A;  3MEW A;  1R8O B;  1WQW A;  2QEX T;  2PU9 B;  4C92 A;  1QVP A;  2Y4Y A;  4UC4 A;  2P0P A;  5LJ3 d;  3X25 B;  3HFN A;  4M75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...