2VC8A

Crystal structure of the lsm domain of human edc3 (enhancer of decapping 3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ENHANCER OF MRNA-DECAPPING PROTEIN 3
publication title A Divergent Sm Fold in Edc3 Proteins Mediates Dcp1 Binding and P-Body Targeting.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vc8A00
3QHSA 4M7AB 2RA2A 3FJPA 1JBMA 1N9SA 1HK9A 5GMKl 4C92G 5GANj 4C8QE 4RCBA 3V8LA 3JCMf 2DXUA 5GAOl 2RM4A 4PJOB 4DQ2A 2DEQA 5GAN6 1B34A 3SWNC 4XTWA 4C92D 1BIAA 2JN0A 1H641 3SWNB 3L2ZA 5DY9A 4M75D 4C8QG 5GAN8 2Y90A 1WPYA 4XTYA 4PJOA 1X01A 3BDUA 4M7DA 2RB6A 4N0AA 4XTZA 3V8JA 2ZGWA 4M78A 5GAMj 2EWNA 3JB9G 5GAMe 5LJ5e 3JB9J 3JB9D 4WF2A 5LJ3h 1M5Q1 3V7RA 5LJ5d 1D3BA 4EMKC 3AHUA 3HFNA 4XU0A 3FIFA 5GANg 4EMHA 4HT9A 5GAN2 4EMKB 2I2LA 3JCMV 4XU2A 1N9RA 2RD1A 2VXEA 4EMKA 4PNOA 4X9DA 1JRIA 1U1TA 5GAOq 4JLIA 5GMKm 4M7AA 5GAN7 3JB9H 3QSUA 4C92F 4J6XA 5GANe 2DZ9A 4QVDA 1WQWA 3V7SA 4C92C 4JRKA 5GAOm 3RKXA 5GANd 1Y96B 4M75F 2VC8A 2YHTA 3JCMW 3JCMb 4MMLA 4M75C 4C92B 3RERA 5GAMg 5LJ5g 4PJOC 2FYKA 3SB2A 3HSBA 2DZCA 4M75B 4X9CA 3SWNA 4PJOE 4M7DE 3JCMg 4M78E 4F7UF 4M75A 5LJ3f 4C8QD 2EAYA 5GAOn 1KQ1A 4V2SA 4XTVA 5I21A 2DKGA 4XTUA 4F7UB 4NL2A 3V8KA 5GAN5 3JB9F 3HFOA 4PJOG 4Y91A 5GAMd 4F7UA 4M7DG 3PGGA 4M77F 3JCMc 3JCMe 2DXTA 4M78G 5GAOr 4M77C 3VU3C 4XTXA 3JCMd 2EJFA 4M7AC 4M7DF 4M77B 4PJOD 2HNIA 3JCMX 3RUXA 4J6YA 5GMKh 3V7CA 4M7DD 2EJ9A 4A54A 3FB9A 2DTOA 3BFMA 4M78D 3RIRA 1TH7A 4M77A 5LJ3j 4M7AE 1HXDA 1LNXA 1BIBA 2DTIA 2DTHA 3BY7A 3RKWA 2E41A 3EFRA 4M7AG 1Y96A 3GIBA 5GANh 4MMKA 4C92A 1I4K1 4XQ3A 4C8QF 1LJOA 4M75E 4C8QC 5CAIA 4M7AD 4HA8A 4C8QB 2DVEA 2E1HA 5GAN4 5GAMf 5LJ5f 3JB9I 2E64A 1MGQA 4C8QA 2YLCA 4F7UE 2FB7A 3JCMQ 5GAOp 1B34B 4A53A 2K57A 4M75G 4EMGA 3BW1A 4PJOF 2CGHA 2QTXA 3EFSA 1I8FA 5LJ3g 5LJ5h 1I81A 5GAMh 4J6WA 1KQ2A 1YCYA 1U1SA 2DJZA 4M78F 5GAN3 4N0AC 2YLBA 1I5LA 1LOJA 4M78C 4M7DC 4NOYA 3JCMh 5GMKi 4JUVA 4M77E 4OP0A 4NL3A 4F7UG 4HT8A 4M7DB 4M78B 4QVCA 3RESA 3JCMP 2E10A 3RKYA 5GANf 4J5YA 1WQ7A 4XU1A 5LJ3e 5LJ5j 1M8VA 3QUIA 3QO3A 5GMKj 2E65A 5LJ3d 1D3BB 4M77G 4C92E 4XU3A 3JCMJ 3L1AA 1WNLA 4RCCA 5GMKe 4M7AF 2EJGA 4JRIA 3M4GA 2VXFA 3INZA 4M77D
chains in the Genus database with same CATH superfamily
1VQ8T 5EG2A 4BDYA 1WLPB 3EG1A 2DM1A 3L2RA 1R0BG 5GAN6 4J8OA 8AT1B 4RTWA 5GAN8 1QVGS 3OYIA 2L3SA 2RB6A 2A3LA 4RTTA 4MDWA 2EQKA 5LJ5e 4II1A 2COYA 3WVDB 2K5LA 3H6ZA 4HCCA 5FU7C 2LCSA 5KYYB 2NYSA 1VQ8Q 4LDXA 5FLXE 2BUDA 5GANe 5CKFA 3VUBA 1UTIA 1VQLA 3CC7A 2G6FX 3G6EA 2FYKA 5D6WA 1UGQB 1WHGA 3FJ5A 2M02A 2D1XA 1QMCA 2M0OA 4EIKA 4LDWA 2VKNA 2RQRA 4A54A 1UDLA 4JS4A 3OSVA 5FU6B 2HSPA 4FW2A 2HD0A 2YT6A 1I5OB 2QQSA 3TU4K 5GAN4 2RK2A 2YUQA 3EGDB 5KYNA 1Q86U 2XDPA 4KUIA 2EBPA 2K57A 5GAMh 2KQWA 2D6FA 1VQ6A 1Q86R 2O9VA 3GBQA 4ZN1A 2DXBA 3VYGA 4OF1A 3CBOA 3JCMP 4J9EA 3OYAA 2K3BA 1OULA 4KGZB 5LJ5j 2PVGB 2H8HA 2K6DA 3M0RA 1AEYA 1H3HA 4ZTFA 4M7AF 2EJGA 3L2VA 3OYCA 4PFPA 1PRMC 2X4YA 3UPUA 1ZBXA 4B9WA 5GANj 4OB1B 3EG2A 4OMFB 5EC7A 2P84A 1AWJA 5IHKA 4C0GA 2F5TX 2F69A 2LQ8A 2KBTA 2X4XA 3S3OA 3M9QA 1RAEB 4Z8AA 2L3PA 2A28A 1PSFA 1WA7A 3EHQA 2P0KA 2KDSA 3CCEA 1UJYA 1QLYA 1O9SA 2CZ6B 3JRZA 2JMCA 3A1PA 2LMJA 3JB9H 5A0GA 4PJMA 4C92F 2VC8A 1NJIU 4LDVA 2BKDN 2FEIA 3CCJT 1NJIR 1TU0B 1NPRA 4PJNA 2AZSA 2DBKA 2JZ2A 3KBGA 1TH7A 1YP5A 1LNXA 3T9NA 3L2UA 2LVMA 2QEXT 3CC2A 2E3IA 3DLLA 4LDYA 4L6V5 2CKKA 4XQ3A 4MZTA 4D8DA 3CCJQ 1IHWA 2F2XA 4AFSC 3RMQA 1M3CA 4J7IA 4C5IA 1N5ZA 2CUBA 3BW1A 3I5SA 3CCQT 3I55A 4KGXB 1AHJB 2AT1B 4IUTA 3NMZC 1WHMA 4C5EA 1WQ7A 3CMEA 1WZOA 1N27A 3OQ5A 2LRQA 1TUDA 2QEXQ 3DKMA 4OMOA 2P0PA 2P4TA 1T3SA 1AD5A 1ZUUA 3R6NA 3INZA 1RI9A 1VYTA 4JLGA 3VUZA 2DJQA 2RQVA 2ATCB 3CCRA 2FPEA 2GFAA 1Q82C 2KY9A 3CCQQ 1PG5B 4PJOA 3OYNA 3C94A 4BDZA 2EQJA 1VQMA 4EMKC 3AHUA 1JU5C 1RAGB 2VV5A 2FZCB 2VXEA 4FYVB 4P5NA 1WI7A 5D6YA 4GY5A 2OTJA 2V1QA 3G7ZA 1KHIA 1WQWA 4IUPA 1D1CA 3CXCP 4EPCA 3CPWS 2D9TA 3SWNA 2CDTA 1OV3A 2HSEB 1G3YA 1UUEA 1OZ2A 2LJ3A 1X43A 4CRIA 4FCYA 2AHJB 3SEMA 4F17A 3HRUA 1VQ5A 2ROLA 1UECA 2ESWA 2RH2A 3A8MB 1R0CB 4PJOD 3THKA 3V7CA 1QKWA 3RIRA 1SRLA 4ZGJB 2P0QA 2DRMA 3NPFA 3GNFB 1IO6A 4RG2A 1ZQ1A 2QQRA 1YIJA 4PFZA 2E1HA 5LJ5f 1MGQA 4KT0E 3MP6A 4CC2A 1MUZA 4KRTA 5FW9A 2IIMA 4M77E 4NL3A 5GANf 3QBYA 3QYHB 4OB3B 2NUTA 2PVDB 3OYEA 1IGUA 2L3QA 2QDYB 3META 5M9OA 2RA2A 1UB4A 1GL5A 3EG9A 2J05A 2DXUA 2KAFA 3VS3A 1H641 2OAWA 4RUGA 1T3LA 4BY6C 1YNZA 2ZGWA 3SHWA 4E6RA 1ZX6A 3E9GA 2XG8D 2COZA 3N5BB 1M5Q1 1UGRB 1ZUYA 2B8AA 2QXFA 1ACMB 3PNWC 4DEYA 1M30A 4BE1A 5GAOq 5GAN7 2BTTA 1GCQC 3RKXA 2EKOA 3JCMb 2H3JA 5IHNA 1QVGA 2KT1A 2ZCFB 5DLOA 2GFUA 4Z88A 2MIOA 1KIKA 1WXTA 3ULRB 3VKIA 4F16A 1D0XA 2PVOB 3EG0A 1AOJA 3OA6A 1IRXA 2NUZA 2ZPEB 1Z9QA 3PGGA 4M77F 2F1LA 3PT9A 2K79A 2JS2A 2K9GA 2DK3A 2DTIA 1VQNT 2EYYA 2QDLA 3P8DA 3EFRA 1AWOA 2XKOC 3FLGA 3LH0A 4RG8A 5KE3A 1UHCA 1ZBJA 3A8LB 4C8QB 4C8QA 3LGFA 2EIFA 4EMGA 5I11A 4FYWB 3EFSA 3J80E 1HYOA 1Y71A 1YCYA 2LZ6B 4N0AC 1LPLA 5HY6A 1G8XA 5CK9A 2DIGA 1X75C 3OBWA 1SRMA 3GPLA 2HMAA 3EG3A 4PJJA 1VQNQ 2K3XA 4M77G 4C0FA 3PMIA 3L1AA 5GMKe 4ESRA 2HEQA 4M7AC 2LQNA 3QYGB 3QHSA 3EGXA 1V29B 3L2QA 2JVVA 2V8JA 2C0IA 4BI3A 1BI0A 3M0SA 2RNAA 1K9AA 4JJCA 4E47A 4M75D 1K9MU 5FROA 2CH4W 4R55A 4OVAA 2KK4A 4KBMB 1XNIA 3JB9G 1KQSS 1K9MR 4E7SA 4J9FA 3Q1JA 3VRYA 3JB9J 1CSKA 3ER0A 1Q86C 4PLIA 1N9RA 2X3XD 1YJNT 5FU7B 3LX7A 4Y28E 3VRZA 4QVDA 3QSUA 4C92C 2E12A 1W2BS 1XJWB 1Y96B 3VS4A 3M0PA 1HJDA 3EHRA 5LJ5g 1G3TA 3ZBDA 1KG1A 4HCKA 3OW2S 1AZGB 2Y4YA 1D0YA 4ATOA 1ZLMA 2F2WA 3HFOA 1RAAB 2YRDA 2DD5A 4J6YA 2JS0A 2ENMA 3VV0A 3KFVA 4FYXB 2DERA 1YJNQ 1XOVA 4DBRA 2QAZA 1QCOA 1UGSB 3RKWA 2E41A 2P4RA 2J6KA 1NG2A 2CSQA 1BI3A 3HL8A 1N8RU 2DFUA 1SF9A 2DNUA 2GTJA 3MKDA 2JTMA 2VGNA 3S6WA 2M0YA 4CI0C 2O88A 3MEAA 4N4IA 2V8KA 1FMWA 1U3OA 2BZYA 5DM7R 2L89A 1M2OA 4HVUA 4HT9A 2KEAA 1MV0B 3LYIA 3G4ST 1NJIC 6AT1B 3NTIA 1M4ZA 4XU1A 1M8VA 1X27A 2E65A 3NGPA 4OB2B 1M1KU 4RCCA 1BI1A 5KH6A 2XDDA 1M1KR 3C0CA 3V8LA 1PWTA 3OBYA 3KXTA 2DL7A 2A7YA 1NLPC 2KYMA 5LL6S 2GCXA 2C0TA 3CMAT 1BK2A 2Y4XA 2NUPA 2FL7A 3HTRA 4M7DA 1WXUA 3GLXA 1GBRA 4M78A 4IUUA 4IIMA 3G4SQ 2E5KA 3P8HA 3OB9A 3CCLT 3HFNA 4EMHA 3M0QA 2RPNA 2I2LA 2RD1A 5I2MA 2V26A 2KROA 4OB0B 5L8RE 1SPKA 3IQLA 2KRMA 3SB2A 3X25B 4DOVA 3GP8A 4AFZC 1YHQT 4MZPA 1K73U 3CMAQ 1MMAA 2LT1A 2XMFA 2WACA 1H8KA 3VS0A 3HPWA 3CCMT 1K73R 1FYNA 5GAOr 3CCLQ 1AZEA 5D6XA 4M7DD 1YJWT 4M7AE 4M78D 4RTXA 1VQPT 1S1NA 2KE9A 5KYYA 3CPWA 1NE8A 3VS7A 1WJSA 4PJLA 2DXCA 1RAFB 1NEGA 2HQXA 2ZPHB 3REBB 5GANh 1V1CA 2J6OA 1OPKA 1YHQQ 1R77A 2E64A 3JCMQ 1B34B 4PJOF 3CCMQ 3RMSA 2QA4A 1FMVA 3UATA 2LNHB 1RAIB 4JJNK 2MK5A 1YJWQ 4J5YA 2MI6A 3NTKA 1VQPQ 2KR3A 3QUIA 5LJ3d 2J7IA 3EAEA 4C92E 3JCMJ 1JQQA 4IURA 2ZPGB 3OYDA 1OU9A 2HKNA 1JBMA 1XTDA 2ZPIB 4GBQA 3A5ZB 4FT4A 4ME7A 1UJ0A 3EGDA 1SG5A 4JJBA 3H0HA 3E19A 5A0DA 2BZXA 2MF2A 3QDFA 3CCVA 2GF7A 4FIBA 5GAMe 1UGPB 1WHKA 4RMOA 3V7RA 3LWHA 3QJ6A 1BI2A 4EMKB 2ZAEA 2KMTA 3CD6T 1IHVA 2CP0A 1VQ7T 4EMKA 3RNJA 2HDAA 2RQTA 1T0HA 2QASA 4MMLA 2DD4A 4BI4A 2RHYA 4KULA 1JXOA 3FEOA 1QWFA 3TEEA 4E7LA 2DILA 2LDMA 4F7UB 4CC3A 2AK5A 3HP9A 4F7UA 5FRNA 1E6GA 1NZ9A 4M77C 3JCMd 2KYBA 4FU6A 3OYJA 3QJYA 1MMDA 3J7AF 3CD6Q 1D0ZA 1LVKA 4HVVA 3UA6A 1VQ7Q 3NHNA 4M7AG 1YBYA 2EQMA 1OQKA 3M53A 2E70A 1MMGA 3TSZA 4O6JA 4E2FB 4M75E 4OGEA 2CP5A 1X6BA 4HXJA 4AFQC 5LJ3g 1YITT 3MEWA 2EYXA 4RTYA 3UA7A 5GMKi 4ORZA 2BIVA 2DF6A 2OI3A 3E2UA 2YSQA 2F5KA 1KHCA 4DEXA 2IVWA 3CBPA 1TXQA 1SSHA 2WSFE 3M4GA 4LD6A 1OU8A 4QW2A 5AT1B 5C6SA 4LUDA 4J7FA 3QIIA 4C92G 2LCLA 3CCLA 1M2VB 5CIUA 3TREA 2DYBA 1QQJA 2JN0A 1VQ8A 1MNEA 4KH1B 1JXMA 5DY9A 1YITQ 1X01A 4XTZA 4BY6B 4TVRA 2K7AA 1OPLA 4FSSA 2HQEA 4XAXB 3I56T 2MYSA 5KCHA 2XK0A 4JDSA 1ZSZC 5ECAA 4X9DA 5CKEA 2X51A 1RLQC 3OYYA 4M75F 4N4GA 2DZCA 2RI3A 1GCQA 1KQSA 3JCMg 3PMTA 1PC0A 1HD3A 3MP1A 2VUBA 4ZN3A 1P92A 5CKDA 2KXDA 1JJ2S 1M3AA 3I56Q 2BE9B 4HVWA 2MWOA 4F04B 4DA4A 4DBFA 1WHJA 2LX7A 1W2BA 2K4YA 2RI5A 1K9MC 2G3RA 4J9DA 3GIBA 4B9XA 2D0QB 4MMKA 3CC4T 3LH5A 3JV3A 1A0NB 3E9FA 3OW2A 5CR2A 3LWIA 1QVGP 1PRLC 3BDLA 2EYZA 3JB9I 1RI0A 4QKUA 4MZMA 4M75G 4VUBA 2ABLA 4ELYC 2YWWA 1C1AA 2WSCE 3OS0A 5LJ3e 1NYFA 2VWFA 2LT4A 1D3BB 3JAME 1RUWA 3F70A 2K2MA 5L23A 3CC4Q 4L5GA 4C0DC 1V76A 1Q81U 4M7AB 4X1VA 4NS5A 4R0KA 1O75A 4RCBA 3CCST 1M3BA 1Q81R 2JTEA 4DQ2A 2RJEA 1FXXA 1VQ4T 4RTUA 1D09B 1EX4A 5I22A 1YWPA 2OJ2A 1N8RC 3M57A 5I2SA 1RACB 1W6XA 4A4GA 2FRWA 3H9NA 3RDVA 1PD0A 2CS7A 2O31A 2PNIA 3O5ZA 4PNOA 5GMKm 3M0UA 1QVFS 2EYWA 3QXEB 4N4HA 1WX6A 1FMKA 2DZ9A 3CCSQ 2MPXC 1K0SA 4C92B 3KUFA 2FVUA 2B86A 1VQ4Q 2AIRB 2DO3A 2PTKA 3UF4A 2CSIA 2DLPA 2HQHA 1M1KC 3V8KA 2DVJA 1AWXA 2J06A 4Y91A 3CCJA 2YXYA 3JCMc 3JCMe 5IAYA 1PSEA 1GBQA 1PHTA 1VQKT 1R8OB 2CP6A 5LJ3j 2A36A 2AKLA 2L5QA 3A8OB 3WXMB 2WSEE 4E7KA 3BY7A 3SDZA 5KCOA 1NPPA 4CC7A 1GRIA 2AKKA 2W0ZA 4D6WA 2QEXA 2K3YA 4HA8A 1YJ9T 3CQTA 5GAMf 2V8IA 3FDRA 2YLCA 4FSXA 2AZVA 1BCOA 2XICA 4M7DF 4PJOC 4J6WA 1U1SA 2DJZA 4M78F 1I5LA 4QQDA 4JUVA 3UWNA 2CYZB 2RI2A 4QQGA 1VQKQ 3CCQA 3H41A 3C95A 2OAUA 3LW5E 1TG0A 2NWMA 5CVIA 1K73C 1M9SA 1QCFA 1TUGB 1AWWA 3PIPA 2D8JA 1G83A 4F14A 3GF5A 2A0FB 5HKCA 4O5VA 2QK0A 3I56A 1YJ9Q 2HKQB 2RM4A 3A8GB 3SWNC 2DMOA 5IN1A 3S3NA 3L2ZA 2RQUA 1X2QA 4B6MA 4BACA 1M90U 4A4EA 1OI1A 2SRCA 1TUCA 1M90R 2O01E 5FRMA 4C5GA 2HL5C 2RMOA 1OOTA 1VQLT 2EQUA 1SKUB 3UT1A 2YRVA 1ARKA 5IXBA 2KVQG 4EDUA 3V7SA 1D1BA 1KSWA 1C6VX 1TS9A 1WXBA 4DBQA 1CKAA 3OS5A 1JEGA 1OX9A 1ZSGA 1YWOA 4C8QD 2E5QA 2JW4A 1TTHB 3OS2A 1SHGA 4A63B 5GAMd 3FC3A 2DXTA 2PZ1A 2K5IA 3L42A 2XU8A 4AT1B 2H3EB 2OX7A 1VQLQ 1KC8U 2GQIA 2CZ7B 3CC7Q 4D8KA 1SSFA 2KRNA 4C5HA 1KC8R 3RR6A 2DE0X 3O8VA 1Y96A 3DLMA 5AYFA 5J39A 2DL8A 2EW3A 1OEBA 1IXDA 2JM8A 5GJVB 1VQ6T 2JOYA 1B7TA 3CCUT 1K8AU 2DPPB 5GAOp 3C12A 1K8AR 2EGCA 1KQ2A 2XI9A 1QKXA 3MO8A 1KD1U 3ASKA 1LOJA 4QVCA 4LXCA 1KD1R 1Q7YU 4Z02A 2CP3A 5GMKj 2HAXA 2LC4A 5HK0A 3VS2A 3CPWP 1Q7YR 2FO0A 4LE9A 1N9SA 4A4KA 4A4FA 1VQ6Q 2DEUA 5DLQE 3CCUQ 1IGQA 4FT2A 4XTWA 2DA9A 4L59A 1IB8A 4K11A 4XTYA 3CCET 5KYWB 4C0ZA 2L8DA 2JNGA 3E1SA 1E7OA 5KYWA 4ZTJA 2CZ0B 3MEUA 3H0FA 3R6OA 3CBMA 4WF2A 4AMCA 1OYXA 5D7UA 2DL3A 5GAN2 3QWYA 3OY9A 3JCMV 4XU2A 2EYQA 2XIDA 2MAMA 4JLIA 3VS5A 2EFIA 4PL6A 4JRKA 5GAOm 5GJWB 2YUNA 4M75C 1DJ7B 5GAMg 1D1AA 4PJOE 2L2PA 2M51A 5IH2A 3QZ9B 4E7JA 5LJ3f 1GCPA 4QVZA 3CCEQ 1KQ1A 3ZEHA 1X6GA 2XD0A 5KE2A 2CT3A 1VYUA 1PNJA 2A08A 4M77B 3RUXA 3CC2T 3A8HB 1WHLA 4M77A 1NBEB 2YUOA 5J26A 2M1HA 1IZ6A 1CKBA 1VQ9T 2EVRA 2MMPA 2QI2A 5KYUB 4J9BA 1VQNA 1K4US 3ZFJA 4JZ3A 5KYUA 1UEBA 3I55T 1X6OA 2DVEA 2XHCA 1JJ2A 2CP7A 3FRNA 2ED0A 1UHFA 2HBWA 2FB7A 2SEMA 1MNDA 3CXCS 5LJ5h 3OSSC 3CMET 3OYHA 4OP0A 5FWBA 1K1ZA 1U06A 3CC2Q 2E6NA 5CKBA 3LLRA 2EKHA 4IIOA 4WTOB 1G2BA 3EH2A 3CCRT 1VQ9Q 2VXFA 4IUVA 1QWEA 4DBHA 4M77D 3GOXA 1VUBA 3I55Q 3JCMf 3X20B 1U5SA 1B34A 2K2VA 2QGFB 4XK8E 2HL3A 3CMEQ 1VQMT 4JPBW 3V8JA 1KJWA 3M5AA 4KGVB 7AT1B 2OTJT 3JB9D 3I35A 3PE0A 3C4SA 2HBPA 4J9IA 1ZSZB 3L2WA 3CCRQ 1ZSZA 4J9GA 2CT4A 1SHFA 8ATCB 1XQHA 1PKSA 2YHTA 2QQBA 1YJNA 1Y7XA 4GLKA 1I0CA 2QYZA 2GGRA 3OYKA 1VQ5T 5GAOn 3M0TA 1VQMQ 2FPDA 4JZ4A 1TSFA 2NLUA 4PJOG 3J81E 4RKUE 1Q81C 2IG0A 2FZGB 2OTJQ 2E3HA 2RHUA 3JCMX 1QVFA 3RBBB 3CCUA 3G1JA 1ABQA 1VQOT 1BIBA 1YN8A 4E7IA 3PTAA 1WJRA 1YIJT 4LUEA 3M59A 3H8ZA 2GBQA 2R57A 3DB3A 1KQSP 1VQ5Q 4JJDA 3MPUB 2F2VA 2VVKA 3I9QA 1KFZA 3OYLA 4KUDK 4M7DC 3OMCA 4M78C 1M1FA 2DL4A 4HT8A 2VGMA 5HK3A 1K76A 3RKYA 1WIEA 1TOVA 2FRYA 4OMMA 1VQOQ 1W2BP 4BE2A 5HCKA 3G4SA 1YIJQ 1YFNA 1ZA2B 1BCMA 1F1BB 4RTZA 3FJPA 5CQXA 5CQYA 4C0DB 5GMKl 1HK9A 3OMGA 3OW2P 4HCZA 4C8QE 3SFMA 2DEQA 1BIAA 2KRSA 4OMQA 4LD9K 3BDUA 2HZYA 5GAMj 4JRQA 4QQ6A 3CMAA 2EPDA 4XU0A 3FIFA 2EGEA 3P8BB 4DOWA 2ZPBB 1BU1A 1JRIA 4E7HA 2RHZA 4LN2A 4J6XA 2LJ0A 2VASA 3A98A 4UC4A 1M2VA 2GNCA 1M1GA 4ZNXA 3HSBA 1FWZA 4X9CA 2EGAA 1BKBA 5C0MA 2X3WD 4OGCA 3U23A 5IT9E 2EAYA 1I1JA 2CREA 2LNVA 3M56A 5I21A 4XTUA 4V2SA 3QWXX 5GAN5 5IXFA 2GQVA 1VQ9A 1PD1A 2X9HA 4BI8B 1B3QA 2Z0WA 1QW1A 1YHQA 3VU3C 3TSWA 1EIFA 2HNIA 2JMAA 1NYGA 2EJ9A 3CCMA 1Y0MA 1BBZA 4JS5A 2CP2A 2YUPA 5FU6C 1UE9A 1YJWA 3QKJA 1M90C 1VQPA 4YTLA 1YI2T 4C8QF 2KSSA 5CAIA 2RHXA 1BB9A 1S72T 1WYXA 2QQ9A 3MP8A 4A53A 2CGHA 2MWPA 2QTXA 3OYFA 2R5AA 4PJOB 4NOYA 2DBMA 4MDXA 2E10A 4Z89A 2E4HA 2K5FA 1ZA1B 5A0LA 4J9CA 2DAQA 2PU9B 4OMNA 2FZKB 1AT1B 4JRIA 1YI2Q 3MEVA 2PUOB 3PVLA 2FPFA 1WHHA 1WJQA 1RAHB 3JSCA 1S72Q 2YDLA 1KC8C 1JO8A 3SWNB 4C8QG 3S3MA 1VA7A 3PFSA 2D0NA 4N0AA 4FW1A 1EFNA 1QP2A 2RJCA 2KI7A 5LJ3h 1D3BA 1HSQA 1K8AC 3UDCA 2COWA 2KXCA 1W4SA 4JRPA 1E6HA 2PUKB 3I5RA 3OYBA 4X34A 1X2KA 4BD3A 4M7AA 2I0NA 2OTLT 3WVEB 1KD1C 1KK7A 3CD6A 3JCMW 3RERA 4IUQA 1VQ7A 1UGVA 2XDBA 2QG9B 3M55A 3CEYA 1Q7YC 4M7DE 1VQOA 4M78E 3EGUA 5J3BA 2DKGA 3M4YA 3MCAB 4ZGEB 1GFDA 2LJ1A 1PM3A 5CKHA 1ZUKA 4R56A 2FHDA 1JB0E 2NUTB 4PK4A 4ELZC 2OTLQ 2VYTA 1X69A 3HKSA 2O2OA 4C92A 1NEBA 2L0AA 3VS1A 1IREB 2ZZDA 1QCNA 4M7AD 2RJFA 2X4WA 3EG9B 2W10A 3CPFA 3H0IA 2FG0A 3GNGA 2E6ZA 3D7SB 3NTHA 2L3RA 3TVTA 1T0JA 1I8FA 3G71T 3QDRB 1H92A 5GAN3 2YLBA 1PKTA 3JCMh 5CO7A 1RL2A 3RESA 2QTVA 1MHNA 2RF0A 4AG1C 1YITA 2RK1A 1Y57A 2X4JA 2DIQA 4WCIA 4IKFA 2KNBB 3BE3A 2R5MA 3PIOA 2CH4A 3CXCA 5GAOl 2M16A 4OMPA 4ANJA 2JUFA 4C92D 1K0XA 3TQ7P 4ZGDB 4M4ZA 4J9HA 3G71Q 1WPYA 1WFWA 4KH0B 4Q5WA 1VIEA 3X26B 2ROTA 2LQWA 3X28B 5FWCA 2QGGA 2DL5A 5LJ5d 2M9UA 2RHIA 2RO0A 2JJ9A 4FYYB 2KT8A 2DRKA 2DX1A 1U1TA 3REAB 1WDXA 5GANd 3MHXA 1MMNA 4M75B 3X24B 3ZL7C 2JT4A 4FL6A 4M75A 4LDUA 4XTVA 1LCKA 3JB9F 1QP3A 4M7DG 1YI2A 4CC4B 4BUGA 4M78G 2BZ8A 4HKEA 2EJFA 5CCAA 3NFCA 2O4XB 3CC7T 5GMKh 3G6ET 3FB9A 3BFMA 1S72A 1QVPA 4PFOA 2O4XA 5IHIA 1Q82U 4OMLA 3SD4A 2LCCA 1Q82R 2JTFA 2JM9A 1VYVA 3LGLA 1LJOA 3EH1A 3EGXB 1GXIE 1M8MA 2QA4T 2LQKA 2V1RA 3EFOB 3CC4A 2HCKA 2D8HA 4F7UE 2ECZA 1Z9ZA 2GTOA 1YCSB 3EFOA 3HRTA 2ED1A 1U8RA 1BYMA 3HRSA 2IPOB 2LTOA 1RADB 9ATCB 3G6EQ 1ZHIA 1J3TA 1PCXA 4A4HA 3OS1A 2A37A 1Q95G 3AT1B 2O9SA 1WNLA 2KGTA 4AFUC 1G3WA 1I07A 1W70A 2QA4Q 1JJ2P 1H3ZA 3QZ5B 1VIFA 4GLMA 2C06A 3M54A 3CCVT 3CCSA 2Y90A 2OTLA 1FX7A 1N6AA 3VS6A 1OX8A 4BE0A 2J6FA 2EWNA 1VQ4A 2CUDA 1EZZB 3QPHA 1OZ3A 4PKCC 3HHTB 4RTVA 5GANg 2EQIA 1W1FA 1TWBA 2LX9A 4FM4B 3VYHB 2C0OA 4PLLA 4Y92A 3PVQA 3M58A 1B07A 2JXBA 2DYIA 1WGSA 1M27C 3URGA 3MJXA 3TCJA 1G5VA 2X35A 4F7UF 4E7ZA 2CZ1B 3CCVQ 2R58A 1GFCA 2MCNA 1Y07A 2ZPFB 4NL2A 1N8RR 2DETA 1NLOC 3ME9A 4BB7A 1NM7A 2YRCA 4XTXA 5KYXB 1AVZC 2RJDA 2LP5A 1G3SA 2DTOA 5KYXA 4LNPA 3OYMA 2MOXA 1HXDA 4HCBA 1UG1A 1VOMA 3G71A 2DTHA 1VQKA 5A2QE 4J83A 1RLPC 1I4K1 4C8QC 1SEMA 3QG1A 1RABB 4AG2C 2RQWA 3VJPA 2RN8A 1MV3A 1YJ9A 1I81A 1C0MA 1UFFA 2NUPB 4M7DB 4F7UG 2VB6A 3OYGA 4M78B 2BE7D 2QQAA 1QVFP 3QO3A 4XU3A 4QT7A 3DB4A 1ABOA 2PQWA
chains in the Genus database with same CATH topology
1Q81U 3QHSA 4M7AB 1VQ8T 3FJPA 5CQXA 5CQYA 4C0DB 4NS5A 5GMKl 1HK9A 3OMGA 1O75A 4HCZA 5EG2A 1V29B 4RCBA 3SFMA 4C8QE 3L2QA 3CCST 4BDYA 2JVVA 3L2RA 2V8JA 4BI3A 4DQ2A 2DEQA 2RJEA 5GAN6 4J8OA 1FXXA 1BIAA 1BI0A 1VQ4T 4E47A 4M75D 1K9MU 5GAN8 5FROA 4R55A 4LD9K 4OVAA 1QVGS 2KK4A 3BDUA 4KBMB 3OYIA 2RB6A 1XNIA 3JB9G 5GAMj 1KQSS 1N8RC 3M57A 2A3LA 4JRQA 4QQ6A 4MDWA 2EQKA 3Q1JA 3CMAA 5LJ5e 4II1A 3JB9J 5I2SA 3WVDB 4A4GA 4XU0A 3FIFA 2K5LA 3P8BB 3ER0A 1Q86C 3H6ZA 2CS7A 4HCCA 4DOWA 4PLIA 2ZPBB 1N9RA 1YJNT 4PNOA 5FU7C 1JRIA 5GMKm 1QVFS 3QXEB 4E7HA 5FU7B 4LDXA 4N4HA 2RHZA 5FLXE 2BUDA 3LX7A 4J6XA 4Y28E 2DZ9A 5CKFA 5GANe 4QVDA 3VUBA 4C92C 2E12A 4UC4A 1W2BS 1VQLA 1Y96B 4C92B 3CC7A 3G6EA 1M1GA 3KUFA 2FYKA 5D6WA 1UGQB 5LJ5g 3HSBA 1G3TA 1FWZA 2FVUA 4X9CA 3ZBDA 1BKBA 2DO3A 5C0MA 1KG1A 4OGCA 5IT9E 2EAYA 3OW2S 2M0OA 3M56A 2LNVA 4V2SA 5I21A 4XTUA 1M1KC 5GAN5 2Y4YA 3V8KA 2GQVA 4LDWA 1VQ9A 4ATOA 3HFOA 4Y91A 4BI8B 3CCJA 1QW1A 1YHQA 3JCMc 3JCMe 3VU3C 5IAYA 1PSEA 2DD5A 1EIFA 2HNIA 4J6YA 1R8OB 1VQKT 2EJ9A 4A54A 3CCMA 1VQ6A 5LJ3j 3VV0A 2L5QA 3A8OB 4JS5A 1XOVA 3WXMB 2WSEE 4JS4A 4E7KA 3BY7A 3SDZA 5FU6C 1NPPA 1UGSB 5KCOA 3RKWA 2E41A 1YJWA 3QKJA 3OSVA 5FU6B 1BI3A 1VQPA 1M90C 4YTLA 3HL8A 1N8RU 1YI2T 2JTMA 4C8QF 2VGNA 2KSSA 2HD0A 3S6WA 4D6WA 2QQSA 5CAIA 2QEXA 2K3YA 4HA8A 1YJ9T 4CI0C 2RHXA 3TU4K 5GAN4 5GAMf 1S72T 2QQ9A 2RK2A 2V8IA 3MEAA 3MP8A 3FDRA 1Q86U 2YLCA 4FSXA 4N4IA 2V8KA 2XDPA 4KUIA 4A53A 2K57A 2CGHA 2MWPA 2QTXA 5DM7R 2KQWA 2L89A 2XICA 5GAMh 2R5AA 4J6WA 2D6FA 1U1SA 2DJZA 4M78F 1I5LA 4QQDA 4HT9A 4M7DF 4PJOB 4ZN1A 4NOYA 2DXBA 4JUVA 3LYIA 4OF1A 3CBOA 3UWNA 3VYGA 3G4ST 2CYZB 2RI2A 4QQGA 2E10A 3OYAA 3JCMP 4MDXA 3CCQA 1NJIC 3NTIA 1M4ZA 2K5FA 3C95A 4XU1A 5A0LA 2OAUA 3LW5E 5LJ5j 3OYFA 1M8VA 2PVGB 2DAQA 2E65A 2PU9B 5CVIA 1K73C 1M9SA 4OB2B 4ZTFA 1M1KU 4RCCA 1BI1A 4M7AF 2EJGA 4JRIA 3PIPA 3L2VA 5KH6A 3OYCA 2XDDA 2X4YA 3UPUA 1ZBXA 3MEVA 2PUOB 4B9WA 3GF5A 5HKCA 5GANj 5GANh 4O5VA 4OB1B 3I56A 3V8LA 1WJQA 4OMFB 3JSCA 3OBYA 3KXTA 2RM4A 2A7YA 3A8GB 5LL6S 3SWNC 4C0GA 2F5TX 2F69A 2GCXA 2LQ8A 1KC8C 5IN1A 3SWNB 3L2ZA 3S3NA 2X4XA 4C8QG 3S3MA 3CMAT 3S3OA 3M9QA 2Y4XA 3PFSA 2FL7A 4M7DA 3GLXA 4N0AA 4BACA 1M90U 4A4EA 4M78A 1OI1A 4IUUA 1QP2A 2RJCA 1PSFA 3P8HA 3OB9A 2P0KA 3CCLT 2KDSA 3CCEA 5LJ3h 1D3BA 2O01E 5FRMA 3HFNA 1K8AC 3UDCA 1O9SA 2CZ6B 1W4SA 4EMHA 4JRPA 4C5GA 2PUKB 2I2LA 1VQLT 2EQUA 3JRZA 2RD1A 5I2MA 3OYBA 4X34A 4M7AA 4BD3A 4OB0B 3UT1A 2YRVA 5L8RE 3WVEB 1KD1C 2OTLT 3JB9H 5A0GA 2KVQG 4C92F 3QSUA 4EDUA 3V7SA 3CD6A 3JCMW 3RERA 2VC8A 4IUQA 1VQ7A 1NJIU 4LDVA 2XDBA 3SB2A 2BKDN 3M55A 3X25B 3CEYA 3CCJT 1Q7YC 4DOVA 4M7DE 3GP8A 1VQOA 3OS5A 1YHQT 4M78E 4MZPA 1K73U 4C8QD 2LT1A 2E5QA 5J3BA 2DKGA 2WACA 3HPWA 1NPRA 3M4YA 3OS2A 3MCAB 5GAMd 3CCMT 4ZGEB 3FC3A 2DXTA 5GAOr 2JZ2A 3KBGA 2K5IA 5D6XA 4M7DD 3L42A 1YJWT 4M7AE 4M78D 5CKHA 2XU8A 1TH7A 1VQPT 1KC8U 1LNXA 2CZ7B 3QYGB 4R56A 2FHDA 3T9NA 1SSFA 3CPWA 1JB0E 3L2UA 2LVMA 4ELZC 2QEXT 4C5HA 2VYTA 3CC2A 1NE8A 3HKSA 3DLLA 1Y96A 3DLMA 1WJSA 2DXCA 2HQXA 2ZPHB 3O8VA 4L6V5 4LDYA 5AYFA 2CKKA 4C92A 5J39A 4XQ3A 1IREB 2ZZDA 4MZTA 4M7AD 2RJFA 2X4WA 1VQ6T 2JOYA 3CPFA 3GNGA 3CCUT 1K8AU 2DPPB 2E6ZA 2E64A 3RMQA 3JCMQ 3NTHA 5GAOp 4J7IA 1B34B 3C12A 4C5IA 2L3RA 3BW1A 4PJOF 3CCQT 3RMSA 1I8FA 2XI9A 3QDRB 3I55A 3G71T 1KQ2A 1AHJB 3MO8A 2QA4A 4IUTA 5GAN3 2YLBA 3ASKA 1LOJA 1KD1U 3JCMh 5CO7A 1RL2A 4QVCA 4C5EA 3RESA 4JJNK 4J5YA 2MI6A 1WQ7A 3NTKA 1MHNA 3CMEA 3QUIA 1YITA 1Q7YU 4Z02A 2RK1A 5LJ3d 5GMKj 1N27A 3OQ5A 2HAXA 2LC4A 2LRQA 3EAEA 4C92E 5HK0A 3DKMA 3JCMJ 2P0PA 2P4TA 2X4JA 2DIQA 4IKFA 4IURA 2ZPGB 3INZA 4JLGA 3OYDA 3VUZA 2R5MA 1JBMA 3PIOA 1N9SA 1XTDA 2ZPIB 4A4KA 4A4FA 3A5ZB 4FT4A 4ME7A 3CXCA 5DLQE 3CCRA 5GAOl 4FT2A 2M16A 4XTWA 4C92D 2JUFA 2GFAA 1Q82C 4ZGDB 2KY9A 4L59A 1WPYA 4XTYA 3CCET 4PJOA 4C0ZA 3OYNA 4Q5WA 2L8DA 1VIEA 2JNGA 3E19A 5A0DA 3E1SA 3X26B 3C94A 4BDZA 2MF2A 4ZTJA 3X28B 2CZ0B 3MEUA 3R6OA 3CCVA 2GF7A 4FIBA 5GAMe 1UGPB 3CBMA 2EQJA 4WF2A 4RMOA 3V7RA 1OYXA 4C0DC 2M9UA 2RHIA 4EMKC 2RO0A 5LJ5d 1VQMA 3LWHA 3QJ6A 3AHUA 5GAN2 1BI2A 4EMKB 2KMTA 3OY9A 3JCMV 3CD6T 2VV5A 4XU2A 2EYQA 1VQ7T 2VXEA 5D6YA 4EMKA 2XIDA 4P5NA 1U1TA 4GY5A 2OTJA 2MAMA 4JLIA 3G7ZA 2EFIA 4PL6A 1KHIA 1WQWA 4JRKA 5GAOm 5GANd 4IUPA 3MHXA 4MMLA 4M75C 2DD4A 1DJ7B 4BI4A 4EPCA 2RHYA 5GAMg 3CPWS 2D9TA 4M75B 3X24B 4KULA 3SWNA 4PJOE 3QZ9B 3FEOA 4FL6A 4E7JA 4M75A 1G3YA 4QVZA 4LDUA 5LJ3f 3TEEA 1OZ2A 1KQ1A 4E7LA 3ZEHA 4XTVA 2LDMA 4F7UB 5KE2A 4CRIA 2XD0A 3JB9F 2AHJB 3HP9A 1QP3A 3HRUA 4F7UA 1YI2A 5FRNA 4M7DG 4BUGA 4M78G 1NZ9A 4M77C 1VQ5A 4HKEA 2RH2A 3JCMd 2EJFA 3A8MB 5CCAA 3NFCA 4M77B 4PJOD 2O4XB 4FU6A 3OYJA 3QJYA 3RUXA 3CC2T 5GMKh 3V7CA 3G6ET 3CC7T 3A8HB 3BFMA 3FB9A 1QVPA 3RIRA 1S72A 4M77A 3J7AF 2O4XA 5J26A 1Q82U 4ZGJB 2M1HA 2P0QA 3GNFB 1IZ6A 2LCCA 3SD4A 4RG2A 1VQ9T 4M7AG 2JTFA 1YBYA 1ZQ1A 2EQMA 2MMPA 2QI2A 3M53A 3LGLA 2E70A 4O6JA 1VQNA 1LJOA 4M75E 3ZFJA 2QQRA 1YIJA 1GXIE 4OGEA 1UEBA 3I55T 1X6OA 2QA4T 2DVEA 2E1HA 2LQKA 2XHCA 1JJ2A 5LJ5f 3CC4A 3FRNA 1MGQA 4F7UE 4KT0E 2FB7A 3MP6A 3HRTA 5LJ3g 5LJ5h 3CXCS 3OSSC 3CMET 1U8RA 1YITT 1BYMA 3MEWA 3HRSA 2LTOA 5GMKi 4M77E 4NL3A 4OP0A 3OYHA 2BIVA 5GANf 2E6NA 3QBYA 2F5KA 5CKBA 1KHCA 1ZHIA 3QYHB 4A4HA 3OS1A 3LLRA 4OB3B 2IVWA 2PVDB 3CBPA 1WNLA 3OYEA 3CCRT 2WSFE 2VXFA 2QDYB 1G3WA 3M4GA 4IUVA 4LD6A 4M77D 1QVGA 3META 5M9OA 4QW2A 2RA2A 5C6SA 3GOXA 4J7FA 3QIIA 1UB4A 1VUBA 4C92G 2LCLA 3CCLA 3JCMf 2DXUA 3X20B 2KAFA 1B34A 5CIUA 3TREA 3QZ5B 2K2VA 2JN0A 1VIFA 1VQ8A 1H641 2C06A 1H3ZA 3M54A 5DY9A 4XK8E 3CCVT 3CCSA 2Y90A 4BY6C 1X01A 2OTLA 1FX7A 1N6AA 1VQMT 4BE0A 4XTZA 3V8JA 2ZGWA 4BY6B 4TVRA 2EWNA 1VQ4A 3M5AA 3E9GA 1OZ3A 3QPHA 2XG8D 4PKCC 2HQEA 4XAXB 2OTJT 3I56T 3JB9D 3N5BB 3C4SA 1M5Q1 5KCHA 2XK0A 4JDSA 1UGRB 3HHTB 5GANg 2B8AA 2HBPA 2QXFA 3L2WA 3PNWC 4BE1A 4X9DA 2LX9A 5GAOq 4FM4B 5CKEA 3VYHB 5GAN7 4PLLA 3OYYA 3M58A 3RKXA 4M75F 1XQHA 2YHTA 1WGSA 2EKOA 2QQBA 2H3JA 3URGA 3JCMb 2ZCFB 3TCJA 4N4GA 5DLOA 1YJNA 2GFUA 1Y7XA 4GLKA 2DZCA 2RI3A 1KQSA 1G5VA 2X35A 3JCMg 3PMTA 3VKIA 4F7UF 2CZ1B 3OYKA 1VQ5T 2R58A 5GAOn 3MP1A 2VUBA 4ZN3A 1P92A 1Y07A 2PVOB 2ZPFB 4NL2A 5CKDA 3OA6A 3ME9A 4PJOG 2NLUA 3J81E 2ZPEB 4RKUE 4BB7A 2IG0A 3PGGA 4M77F 1Q81C 1JJ2S 4XTXA 2RJDA 2MWOA 2RHUA 3JCMX 1QVFA 1G3SA 3CCUA 4DA4A 2DTOA 3OYMA 3PT9A 1HXDA 1W2BA 1VQOT 1BIBA 4HCBA 4E7IA 2DK3A 2DTIA 3PTAA 2RI5A 2K4YA 1K9MC 1VQNT 3G71A 1WJRA 2DTHA 2G3RA 1YIJT 1VQKA 3P8DA 3M59A 3EFRA 3H8ZA 5A2QE 4J83A 2XKOC 3FLGA 3LH0A 4RG8A 4B9XA 5KE3A 2D0QB 4MMKA 3CC4T 1I4K1 3GIBA 3E9FA 3OW2A 2R57A 5CR2A 4C8QC 3LWIA 3DB3A 3A8LB 4C8QB 3BDLA 3QG1A 3JB9I 1RI0A 4C8QA 3LGFA 3VJPA 2EIFA 4MZMA 4M75G 4EMGA 3EFSA 3J80E 1I81A 1YJ9A 1Y71A 1YCYA 3OYLA 4KUDK 4M7DC 4N0AC 4PJOC 3OMCA 4M78C 1M1FA 4VUBA 5HY6A 4HT8A 2VGMA 4M7DB 4F7UG 4ELYC 3OYGA 4M78B 5HK3A 5CK9A 3RKYA 2DIGA 1X75C 2WSCE 2QQAA 3OS0A 3OBWA 5LJ3e 3QO3A 3GPLA 2LT4A 2K3XA 1D3BB 4M77G 4C0FA 3G4SA 4BE2A 3PMIA 4XU3A 3L1AA 5GMKe 3JAME 3DB4A 3F70A 4M7AC 4L5GA 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHS A;  4M7A B;  2RA2 A;  3FJP A;  1JBM A;  1N9S A;  1HK9 A;  5GMK l;  4C92 G;  5GAN j;  4C8Q E;  4RCB A;  3V8L A;  3JCM f;  2DXU A;  5GAO l;  2RM4 A;  4PJO B;  4DQ2 A;  2DEQ A;  5GAN 6;  1B34 A;  3SWN C;  4XTW A;  4C92 D;  1BIA A;  2JN0 A;  1H64 1;  3SWN B;  3L2Z A;  5DY9 A;  4M75 D;  4C8Q G;  5GAN 8;  2Y90 A;  1WPY A;  4XTY A;  4PJO A;  1X01 A;  3BDU A;  4M7D A;  2RB6 A;  4N0A A;  4XTZ A;  3V8J A;  2ZGW A;  4M78 A;  5GAM j;  2EWN A;  3JB9 G;  5GAM e;  5LJ5 e;  3JB9 J;  3JB9 D;  4WF2 A;  5LJ3 h;  1M5Q 1;  3V7R A;  5LJ5 d;  1D3B A;  4EMK C;  3AHU A;  3HFN A;  4XU0 A;  3FIF A;  5GAN g;  4EMH A;  4HT9 A;  5GAN 2;  4EMK B;  2I2L A;  3JCM V;  4XU2 A;  1N9R A;  2RD1 A;  2VXE A;  4EMK A;  4PNO A;  4X9D A;  1JRI A;  1U1T A;  5GAO q;  4JLI A;  5GMK m;  4M7A A;  5GAN 7;  3JB9 H;  3QSU A;  4C92 F;  4J6X A;  5GAN e;  2DZ9 A;  4QVD A;  1WQW A;  3V7S A;  4C92 C;  4JRK A;  5GAO m;  3RKX A;  5GAN d;  1Y96 B;  4M75 F;  2VC8 A;  2YHT A;  3JCM W;  3JCM b;  4MML A;  4M75 C;  4C92 B;  3RER A;  5GAM g;  5LJ5 g;  4PJO C;  2FYK A;  3SB2 A;  3HSB A;  2DZC A;  4M75 B;  4X9C A;  3SWN A;  4PJO E;  4M7D E;  3JCM g;  4M78 E;  4F7U F;  4M75 A;  5LJ3 f;  4C8Q D;  2EAY A;  5GAO n;  1KQ1 A;  4V2S A;  4XTV A;  5I21 A;  2DKG A;  4XTU A;  4F7U B;  4NL2 A;  3V8K A;  5GAN 5;  3JB9 F;  3HFO A;  4PJO G;  4Y91 A;  5GAM d;  4F7U A;  4M7D G;  3PGG A;  4M77 F;  3JCM c;  3JCM e;  2DXT A;  4M78 G;  5GAO r;  4M77 C;  3VU3 C;  4XTX A;  3JCM d;  2EJF A;  4M7A C;  4M7D F;  4M77 B;  4PJO D;  2HNI A;  3JCM X;  3RUX A;  4J6Y A;  5GMK h;  3V7C A;  4M7D D;  2EJ9 A;  4A54 A;  3FB9 A;  2DTO A;  3BFM A;  4M78 D;  3RIR A;  1TH7 A;  4M77 A;  5LJ3 j;  4M7A E;  1HXD A;  1LNX A;  1BIB A;  2DTI A;  2DTH A;  3BY7 A;  3RKW A;  2E41 A;  3EFR A;  4M7A G;  1Y96 A;  3GIB A;  5GAN h;  4MMK A;  4C92 A;  1I4K 1;  4XQ3 A;  4C8Q F;  1LJO A;  4M75 E;  4C8Q C;  5CAI A;  4M7A D;  4HA8 A;  4C8Q B;  2DVE A;  2E1H A;  5GAN 4;  5GAM f;  5LJ5 f;  3JB9 I;  2E64 A;  1MGQ A;  4C8Q A;  2YLC A;  4F7U E;  2FB7 A;  3JCM Q;  5GAO p;  1B34 B;  4A53 A;  2K57 A;  4M75 G;  4EMG A;  3BW1 A;  4PJO F;  2CGH A;  2QTX A;  3EFS A;  1I8F A;  5LJ3 g;  5LJ5 h;  1I81 A;  5GAM h;  4J6W A;  1KQ2 A;  1YCY A;  1U1S A;  2DJZ A;  4M78 F;  5GAN 3;  4N0A C;  2YLB A;  1I5L A;  1LOJ A;  4M78 C;  4M7D C;  4NOY A;  3JCM h;  5GMK i;  4JUV A;  4M77 E;  4OP0 A;  4NL3 A;  4F7U G;  4HT8 A;  4M7D B;  4M78 B;  4QVC A;  3RES A;  3JCM P;  2E10 A;  3RKY A;  5GAN f;  4J5Y A;  1WQ7 A;  4XU1 A;  5LJ3 e;  5LJ5 j;  1M8V A;  3QUI A;  3QO3 A;  5GMK j;  2E65 A;  5LJ3 d;  1D3B B;  4M77 G;  4C92 E;  4XU3 A;  3JCM J;  3L1A A;  1WNL A;  4RCC A;  5GMK e;  4M7A F;  2EJG A;  4JRI A;  3M4G A;  2VXF A;  3INZ A;  4M77 D; 
#chains in the Genus database with same CATH topology
 1VQ8 T;  5EG2 A;  4BDY A;  1WLP B;  3EG1 A;  2DM1 A;  3L2R A;  1R0B G;  5GAN 6;  4J8O A;  8AT1 B;  4RTW A;  5GAN 8;  1QVG S;  3OYI A;  2L3S A;  2RB6 A;  2A3L A;  4RTT A;  4MDW A;  2EQK A;  5LJ5 e;  4II1 A;  2COY A;  3WVD B;  2K5L A;  3H6Z A;  4HCC A;  5FU7 C;  2LCS A;  5KYY B;  2NYS A;  1VQ8 Q;  4LDX A;  5FLX E;  2BUD A;  5GAN e;  5CKF A;  3VUB A;  1UTI A;  1VQL A;  3CC7 A;  2G6F X;  3G6E A;  2FYK A;  5D6W A;  1UGQ B;  1WHG A;  3FJ5 A;  2M02 A;  2D1X A;  1QMC A;  2M0O A;  4EIK A;  4LDW A;  2VKN A;  2RQR A;  4A54 A;  1UDL A;  4JS4 A;  3OSV A;  5FU6 B;  2HSP A;  4FW2 A;  2HD0 A;  2YT6 A;  1I5O B;  2QQS A;  3TU4 K;  5GAN 4;  2RK2 A;  2YUQ A;  3EGD B;  5KYN A;  1Q86 U;  2XDP A;  4KUI A;  2EBP A;  2K57 A;  5GAM h;  2KQW A;  2D6F A;  1VQ6 A;  1Q86 R;  2O9V A;  3GBQ A;  4ZN1 A;  2DXB A;  3VYG A;  4OF1 A;  3CBO A;  3JCM P;  4J9E A;  3OYA A;  2K3B A;  1OUL A;  4KGZ B;  5LJ5 j;  2PVG B;  2H8H A;  2K6D A;  3M0R A;  1AEY A;  1H3H A;  4ZTF A;  4M7A F;  2EJG A;  3L2V A;  3OYC A;  4PFP A;  1PRM C;  2X4Y A;  3UPU A;  1ZBX A;  4B9W A;  5GAN j;  4OB1 B;  3EG2 A;  4OMF B;  5EC7 A;  2P84 A;  1AWJ A;  5IHK A;  4C0G A;  2F5T X;  2F69 A;  2LQ8 A;  2KBT A;  2X4X A;  3S3O A;  3M9Q A;  1RAE B;  4Z8A A;  2L3P A;  2A28 A;  1PSF A;  1WA7 A;  3EHQ A;  2P0K A;  2KDS A;  3CCE A;  1UJY A;  1QLY A;  1O9S A;  2CZ6 B;  3JRZ A;  2JMC A;  3A1P A;  2LMJ A;  3JB9 H;  5A0G A;  4PJM A;  4C92 F;  2VC8 A;  1NJI U;  4LDV A;  2BKD N;  2FEI A;  3CCJ T;  1NJI R;  1TU0 B;  1NPR A;  4PJN A;  2AZS A;  2DBK A;  2JZ2 A;  3KBG A;  1TH7 A;  1YP5 A;  1LNX A;  3T9N A;  3L2U A;  2LVM A;  2QEX T;  3CC2 A;  2E3I A;  3DLL A;  4LDY A;  4L6V 5;  2CKK A;  4XQ3 A;  4MZT A;  4D8D A;  3CCJ Q;  1IHW A;  2F2X A;  4AFS C;  3RMQ A;  1M3C A;  4J7I A;  4C5I A;  1N5Z A;  2CUB A;  3BW1 A;  3I5S A;  3CCQ T;  3I55 A;  4KGX B;  1AHJ B;  2AT1 B;  4IUT A;  3NMZ C;  1WHM A;  4C5E A;  1WQ7 A;  3CME A;  1WZO A;  1N27 A;  3OQ5 A;  2LRQ A;  1TUD A;  2QEX Q;  3DKM A;  4OMO A;  2P0P A;  2P4T A;  1T3S A;  1AD5 A;  1ZUU A;  3R6N A;  3INZ A;  1RI9 A;  1VYT A;  4JLG A;  3VUZ A;  2DJQ A;  2RQV A;  2ATC B;  3CCR A;  2FPE A;  2GFA A;  1Q82 C;  2KY9 A;  3CCQ Q;  1PG5 B;  4PJO A;  3OYN A;  3C94 A;  4BDZ A;  2EQJ A;  1VQM A;  4EMK C;  3AHU A;  1JU5 C;  1RAG B;  2VV5 A;  2FZC B;  2VXE A;  4FYV B;  4P5N A;  1WI7 A;  5D6Y A;  4GY5 A;  2OTJ A;  2V1Q A;  3G7Z A;  1KHI A;  1WQW A;  4IUP A;  1D1C A;  3CXC P;  4EPC A;  3CPW S;  2D9T A;  3SWN A;  2CDT A;  1OV3 A;  2HSE B;  1G3Y A;  1UUE A;  1OZ2 A;  2LJ3 A;  1X43 A;  4CRI A;  4FCY A;  2AHJ B;  3SEM A;  4F17 A;  3HRU A;  1VQ5 A;  2ROL A;  1UEC A;  2ESW A;  2RH2 A;  3A8M B;  1R0C B;  4PJO D;  3THK A;  3V7C A;  1QKW A;  3RIR A;  1SRL A;  4ZGJ B;  2P0Q A;  2DRM A;  3NPF A;  3GNF B;  1IO6 A;  4RG2 A;  1ZQ1 A;  2QQR A;  1YIJ A;  4PFZ A;  2E1H A;  5LJ5 f;  1MGQ A;  4KT0 E;  3MP6 A;  4CC2 A;  1MUZ A;  4KRT A;  5FW9 A;  2IIM A;  4M77 E;  4NL3 A;  5GAN f;  3QBY A;  3QYH B;  4OB3 B;  2NUT A;  2PVD B;  3OYE A;  1IGU A;  2L3Q A;  2QDY B;  3MET A;  5M9O A;  2RA2 A;  1UB4 A;  1GL5 A;  3EG9 A;  2J05 A;  2DXU A;  2KAF A;  3VS3 A;  1H64 1;  2OAW A;  4RUG A;  1T3L A;  4BY6 C;  1YNZ A;  2ZGW A;  3SHW A;  4E6R A;  1ZX6 A;  3E9G A;  2XG8 D;  2COZ A;  3N5B B;  1M5Q 1;  1UGR B;  1ZUY A;  2B8A A;  2QXF A;  1ACM B;  3PNW C;  4DEY A;  1M30 A;  4BE1 A;  5GAO q;  5GAN 7;  2BTT A;  1GCQ C;  3RKX A;  2EKO A;  3JCM b;  2H3J A;  5IHN A;  1QVG A;  2KT1 A;  2ZCF B;  5DLO A;  2GFU A;  4Z88 A;  2MIO A;  1KIK A;  1WXT A;  3ULR B;  3VKI A;  4F16 A;  1D0X A;  2PVO B;  3EG0 A;  1AOJ A;  3OA6 A;  1IRX A;  2NUZ A;  2ZPE B;  1Z9Q A;  3PGG A;  4M77 F;  2F1L A;  3PT9 A;  2K79 A;  2JS2 A;  2K9G A;  2DK3 A;  2DTI A;  1VQN T;  2EYY A;  2QDL A;  3P8D A;  3EFR A;  1AWO A;  2XKO C;  3FLG A;  3LH0 A;  4RG8 A;  5KE3 A;  1UHC A;  1ZBJ A;  3A8L B;  4C8Q B;  4C8Q A;  3LGF A;  2EIF A;  4EMG A;  5I11 A;  4FYW B;  3EFS A;  3J80 E;  1HYO A;  1Y71 A;  1YCY A;  2LZ6 B;  4N0A C;  1LPL A;  5HY6 A;  1G8X A;  5CK9 A;  2DIG A;  1X75 C;  3OBW A;  1SRM A;  3GPL A;  2HMA A;  3EG3 A;  4PJJ A;  1VQN Q;  2K3X A;  4M77 G;  4C0F A;  3PMI A;  3L1A A;  5GMK e;  4ESR A;  2HEQ A;  4M7A C;  2LQN A;  3QYG B;  3QHS A;  3EGX A;  1V29 B;  3L2Q A;  2JVV A;  2V8J A;  2C0I A;  4BI3 A;  1BI0 A;  3M0S A;  2RNA A;  1K9A A;  4JJC A;  4E47 A;  4M75 D;  1K9M U;  5FRO A;  2CH4 W;  4R55 A;  4OVA A;  2KK4 A;  4KBM B;  1XNI A;  3JB9 G;  1KQS S;  1K9M R;  4E7S A;  4J9F A;  3Q1J A;  3VRY A;  3JB9 J;  1CSK A;  3ER0 A;  1Q86 C;  4PLI A;  1N9R A;  2X3X D;  1YJN T;  5FU7 B;  3LX7 A;  4Y28 E;  3VRZ A;  4QVD A;  3QSU A;  4C92 C;  2E12 A;  1W2B S;  1XJW B;  1Y96 B;  3VS4 A;  3M0P A;  1HJD A;  3EHR A;  5LJ5 g;  1G3T A;  3ZBD A;  1KG1 A;  4HCK A;  3OW2 S;  1AZG B;  2Y4Y A;  1D0Y A;  4ATO A;  1ZLM A;  2F2W A;  3HFO A;  1RAA B;  2YRD A;  2DD5 A;  4J6Y A;  2JS0 A;  2ENM A;  3VV0 A;  3KFV A;  4FYX B;  2DER A;  1YJN Q;  1XOV A;  4DBR A;  2QAZ A;  1QCO A;  1UGS B;  3RKW A;  2E41 A;  2P4R A;  2J6K A;  1NG2 A;  2CSQ A;  1BI3 A;  3HL8 A;  1N8R U;  2DFU A;  1SF9 A;  2DNU A;  2GTJ A;  3MKD A;  2JTM A;  2VGN A;  3S6W A;  2M0Y A;  4CI0 C;  2O88 A;  3MEA A;  4N4I A;  2V8K A;  1FMW A;  1U3O A;  2BZY A;  5DM7 R;  2L89 A;  1M2O A;  4HVU A;  4HT9 A;  2KEA A;  1MV0 B;  3LYI A;  3G4S T;  1NJI C;  6AT1 B;  3NTI A;  1M4Z A;  4XU1 A;  1M8V A;  1X27 A;  2E65 A;  3NGP A;  4OB2 B;  1M1K U;  4RCC A;  1BI1 A;  5KH6 A;  2XDD A;  1M1K R;  3C0C A;  3V8L A;  1PWT A;  3OBY A;  3KXT A;  2DL7 A;  2A7Y A;  1NLP C;  2KYM A;  5LL6 S;  2GCX A;  2C0T A;  3CMA T;  1BK2 A;  2Y4X A;  2NUP A;  2FL7 A;  3HTR A;  4M7D A;  1WXU A;  3GLX A;  1GBR A;  4M78 A;  4IUU A;  4IIM A;  3G4S Q;  2E5K A;  3P8H A;  3OB9 A;  3CCL T;  3HFN A;  4EMH A;  3M0Q A;  2RPN A;  2I2L A;  2RD1 A;  5I2M A;  2V26 A;  2KRO A;  4OB0 B;  5L8R E;  1SPK A;  3IQL A;  2KRM A;  3SB2 A;  3X25 B;  4DOV A;  3GP8 A;  4AFZ C;  1YHQ T;  4MZP A;  1K73 U;  3CMA Q;  1MMA A;  2LT1 A;  2XMF A;  2WAC A;  1H8K A;  3VS0 A;  3HPW A;  3CCM T;  1K73 R;  1FYN A;  5GAO r;  3CCL Q;  1AZE A;  5D6X A;  4M7D D;  1YJW T;  4M7A E;  4M78 D;  4RTX A;  1VQP T;  1S1N A;  2KE9 A;  5KYY A;  3CPW A;  1NE8 A;  3VS7 A;  1WJS A;  4PJL A;  2DXC A;  1RAF B;  1NEG A;  2HQX A;  2ZPH B;  3REB B;  5GAN h;  1V1C A;  2J6O A;  1OPK A;  1YHQ Q;  1R77 A;  2E64 A;  3JCM Q;  1B34 B;  4PJO F;  3CCM Q;  3RMS A;  2QA4 A;  1FMV A;  3UAT A;  2LNH B;  1RAI B;  4JJN K;  2MK5 A;  1YJW Q;  4J5Y A;  2MI6 A;  3NTK A;  1VQP Q;  2KR3 A;  3QUI A;  5LJ3 d;  2J7I A;  3EAE A;  4C92 E;  3JCM J;  1JQQ A;  4IUR A;  2ZPG B;  3OYD A;  1OU9 A;  2HKN A;  1JBM A;  1XTD A;  2ZPI B;  4GBQ A;  3A5Z B;  4FT4 A;  4ME7 A;  1UJ0 A;  3EGD A;  1SG5 A;  4JJB A;  3H0H A;  3E19 A;  5A0D A;  2BZX A;  2MF2 A;  3QDF A;  3CCV A;  2GF7 A;  4FIB A;  5GAM e;  1UGP B;  1WHK A;  4RMO A;  3V7R A;  3LWH A;  3QJ6 A;  1BI2 A;  4EMK B;  2ZAE A;  2KMT A;  3CD6 T;  1IHV A;  2CP0 A;  1VQ7 T;  4EMK A;  3RNJ A;  2HDA A;  2RQT A;  1T0H A;  2QAS A;  4MML A;  2DD4 A;  4BI4 A;  2RHY A;  4KUL A;  1JXO A;  3FEO A;  1QWF A;  3TEE A;  4E7L A;  2DIL A;  2LDM A;  4F7U B;  4CC3 A;  2AK5 A;  3HP9 A;  4F7U A;  5FRN A;  1E6G A;  1NZ9 A;  4M77 C;  3JCM d;  2KYB A;  4FU6 A;  3OYJ A;  3QJY A;  1MMD A;  3J7A F;  3CD6 Q;  1D0Z A;  1LVK A;  4HVV A;  3UA6 A;  1VQ7 Q;  3NHN A;  4M7A G;  1YBY A;  2EQM A;  1OQK A;  3M53 A;  2E70 A;  1MMG A;  3TSZ A;  4O6J A;  4E2F B;  4M75 E;  4OGE A;  2CP5 A;  1X6B A;  4HXJ A;  4AFQ C;  5LJ3 g;  1YIT T;  3MEW A;  2EYX A;  4RTY A;  3UA7 A;  5GMK i;  4ORZ A;  2BIV A;  2DF6 A;  2OI3 A;  3E2U A;  2YSQ A;  2F5K A;  1KHC A;  4DEX A;  2IVW A;  3CBP A;  1TXQ A;  1SSH A;  2WSF E;  3M4G A;  4LD6 A;  1OU8 A;  4QW2 A;  5AT1 B;  5C6S A;  4LUD A;  4J7F A;  3QII A;  4C92 G;  2LCL A;  3CCL A;  1M2V B;  5CIU A;  3TRE A;  2DYB A;  1QQJ A;  2JN0 A;  1VQ8 A;  1MNE A;  4KH1 B;  1JXM A;  5DY9 A;  1YIT Q;  1X01 A;  4XTZ A;  4BY6 B;  4TVR A;  2K7A A;  1OPL A;  4FSS A;  2HQE A;  4XAX B;  3I56 T;  2MYS A;  5KCH A;  2XK0 A;  4JDS A;  1ZSZ C;  5ECA A;  4X9D A;  5CKE A;  2X51 A;  1RLQ C;  3OYY A;  4M75 F;  4N4G A;  2DZC A;  2RI3 A;  1GCQ A;  1KQS A;  3JCM g;  3PMT A;  1PC0 A;  1HD3 A;  3MP1 A;  2VUB A;  4ZN3 A;  1P92 A;  5CKD A;  2KXD A;  1JJ2 S;  1M3A A;  3I56 Q;  2BE9 B;  4HVW A;  2MWO A;  4F04 B;  4DA4 A;  4DBF A;  1WHJ A;  2LX7 A;  1W2B A;  2K4Y A;  2RI5 A;  1K9M C;  2G3R A;  4J9D A;  3GIB A;  4B9X A;  2D0Q B;  4MMK A;  3CC4 T;  3LH5 A;  3JV3 A;  1A0N B;  3E9F A;  3OW2 A;  5CR2 A;  3LWI A;  1QVG P;  1PRL C;  3BDL A;  2EYZ A;  3JB9 I;  1RI0 A;  4QKU A;  4MZM A;  4M75 G;  4VUB A;  2ABL A;  4ELY C;  2YWW A;  1C1A A;  2WSC E;  3OS0 A;  5LJ3 e;  1NYF A;  2VWF A;  2LT4 A;  1D3B B;  3JAM E;  1RUW A;  3F70 A;  2K2M A;  5L23 A;  3CC4 Q;  4L5G A;  4C0D C;  1V76 A;  1Q81 U;  4M7A B;  4X1V A;  4NS5 A;  4R0K A;  1O75 A;  4RCB A;  3CCS T;  1M3B A;  1Q81 R;  2JTE A;  4DQ2 A;  2RJE A;  1FXX A;  1VQ4 T;  4RTU A;  1D09 B;  1EX4 A;  5I22 A;  1YWP A;  2OJ2 A;  1N8R C;  3M57 A;  5I2S A;  1RAC B;  1W6X A;  4A4G A;  2FRW A;  3H9N A;  3RDV A;  1PD0 A;  2CS7 A;  2O31 A;  2PNI A;  3O5Z A;  4PNO A;  5GMK m;  3M0U A;  1QVF S;  2EYW A;  3QXE B;  4N4H A;  1WX6 A;  1FMK A;  2DZ9 A;  3CCS Q;  2MPX C;  1K0S A;  4C92 B;  3KUF A;  2FVU A;  2B86 A;  1VQ4 Q;  2AIR B;  2DO3 A;  2PTK A;  3UF4 A;  2CSI A;  2DLP A;  2HQH A;  1M1K C;  3V8K A;  2DVJ A;  1AWX A;  2J06 A;  4Y91 A;  3CCJ A;  2YXY A;  3JCM c;  3JCM e;  5IAY A;  1PSE A;  1GBQ A;  1PHT A;  1VQK T;  1R8O B;  2CP6 A;  5LJ3 j;  2A36 A;  2AKL A;  2L5Q A;  3A8O B;  3WXM B;  2WSE E;  4E7K A;  3BY7 A;  3SDZ A;  5KCO A;  1NPP A;  4CC7 A;  1GRI A;  2AKK A;  2W0Z A;  4D6W A;  2QEX A;  2K3Y A;  4HA8 A;  1YJ9 T;  3CQT A;  5GAM f;  2V8I A;  3FDR A;  2YLC A;  4FSX A;  2AZV A;  1BCO A;  2XIC A;  4M7D F;  4PJO C;  4J6W A;  1U1S A;  2DJZ A;  4M78 F;  1I5L A;  4QQD A;  4JUV A;  3UWN A;  2CYZ B;  2RI2 A;  4QQG A;  1VQK Q;  3CCQ A;  3H41 A;  3C95 A;  2OAU A;  3LW5 E;  1TG0 A;  2NWM A;  5CVI A;  1K73 C;  1M9S A;  1QCF A;  1TUG B;  1AWW A;  3PIP A;  2D8J A;  1G83 A;  4F14 A;  3GF5 A;  2A0F B;  5HKC A;  4O5V A;  2QK0 A;  3I56 A;  1YJ9 Q;  2HKQ B;  2RM4 A;  3A8G B;  3SWN C;  2DMO A;  5IN1 A;  3S3N A;  3L2Z A;  2RQU A;  1X2Q A;  4B6M A;  4BAC A;  1M90 U;  4A4E A;  1OI1 A;  2SRC A;  1TUC A;  1M90 R;  2O01 E;  5FRM A;  4C5G A;  2HL5 C;  2RMO A;  1OOT A;  1VQL T;  2EQU A;  1SKU B;  3UT1 A;  2YRV A;  1ARK A;  5IXB A;  2KVQ G;  4EDU A;  3V7S A;  1D1B A;  1KSW A;  1C6V X;  1TS9 A;  1WXB A;  4DBQ A;  1CKA A;  3OS5 A;  1JEG A;  1OX9 A;  1ZSG A;  1YWO A;  4C8Q D;  2E5Q A;  2JW4 A;  1TTH B;  3OS2 A;  1SHG A;  4A63 B;  5GAM d;  3FC3 A;  2DXT A;  2PZ1 A;  2K5I A;  3L42 A;  2XU8 A;  4AT1 B;  2H3E B;  2OX7 A;  1VQL Q;  1KC8 U;  2GQI A;  2CZ7 B;  3CC7 Q;  4D8K A;  1SSF A;  2KRN A;  4C5H A;  1KC8 R;  3RR6 A;  2DE0 X;  3O8V A;  1Y96 A;  3DLM A;  5AYF A;  5J39 A;  2DL8 A;  2EW3 A;  1OEB A;  1IXD A;  2JM8 A;  5GJV B;  1VQ6 T;  2JOY A;  1B7T A;  3CCU T;  1K8A U;  2DPP B;  5GAO p;  3C12 A;  1K8A R;  2EGC A;  1KQ2 A;  2XI9 A;  1QKX A;  3MO8 A;  1KD1 U;  3ASK A;  1LOJ A;  4QVC A;  4LXC A;  1KD1 R;  1Q7Y U;  4Z02 A;  2CP3 A;  5GMK j;  2HAX A;  2LC4 A;  5HK0 A;  3VS2 A;  3CPW P;  1Q7Y R;  2FO0 A;  4LE9 A;  1N9S A;  4A4K A;  4A4F A;  1VQ6 Q;  2DEU A;  5DLQ E;  3CCU Q;  1IGQ A;  4FT2 A;  4XTW A;  2DA9 A;  4L59 A;  1IB8 A;  4K11 A;  4XTY A;  3CCE T;  5KYW B;  4C0Z A;  2L8D A;  2JNG A;  3E1S A;  1E7O A;  5KYW A;  4ZTJ A;  2CZ0 B;  3MEU A;  3H0F A;  3R6O A;  3CBM A;  4WF2 A;  4AMC A;  1OYX A;  5D7U A;  2DL3 A;  5GAN 2;  3QWY A;  3OY9 A;  3JCM V;  4XU2 A;  2EYQ A;  2XID A;  2MAM A;  4JLI A;  3VS5 A;  2EFI A;  4PL6 A;  4JRK A;  5GAO m;  5GJW B;  2YUN A;  4M75 C;  1DJ7 B;  5GAM g;  1D1A A;  4PJO E;  2L2P A;  2M51 A;  5IH2 A;  3QZ9 B;  4E7J A;  5LJ3 f;  1GCP A;  4QVZ A;  3CCE Q;  1KQ1 A;  3ZEH A;  1X6G A;  2XD0 A;  5KE2 A;  2CT3 A;  1VYU A;  1PNJ A;  2A08 A;  4M77 B;  3RUX A;  3CC2 T;  3A8H B;  1WHL A;  4M77 A;  1NBE B;  2YUO A;  5J26 A;  2M1H A;  1IZ6 A;  1CKB A;  1VQ9 T;  2EVR A;  2MMP A;  2QI2 A;  5KYU B;  4J9B A;  1VQN A;  1K4U S;  3ZFJ A;  4JZ3 A;  5KYU A;  1UEB A;  3I55 T;  1X6O A;  2DVE A;  2XHC A;  1JJ2 A;  2CP7 A;  3FRN A;  2ED0 A;  1UHF A;  2HBW A;  2FB7 A;  2SEM A;  1MND A;  3CXC S;  5LJ5 h;  3OSS C;  3CME T;  3OYH A;  4OP0 A;  5FWB A;  1K1Z A;  1U06 A;  3CC2 Q;  2E6N A;  5CKB A;  3LLR A;  2EKH A;  4IIO A;  4WTO B;  1G2B A;  3EH2 A;  3CCR T;  1VQ9 Q;  2VXF A;  4IUV A;  1QWE A;  4DBH A;  4M77 D;  3GOX A;  1VUB A;  3I55 Q;  3JCM f;  3X20 B;  1U5S A;  1B34 A;  2K2V A;  2QGF B;  4XK8 E;  2HL3 A;  3CME Q;  1VQM T;  4JPB W;  3V8J A;  1KJW A;  3M5A A;  4KGV B;  7AT1 B;  2OTJ T;  3JB9 D;  3I35 A;  3PE0 A;  3C4S A;  2HBP A;  4J9I A;  1ZSZ B;  3L2W A;  3CCR Q;  1ZSZ A;  4J9G A;  2CT4 A;  1SHF A;  8ATC B;  1XQH A;  1PKS A;  2YHT A;  2QQB A;  1YJN A;  1Y7X A;  4GLK A;  1I0C A;  2QYZ A;  2GGR A;  3OYK A;  1VQ5 T;  5GAO n;  3M0T A;  1VQM Q;  2FPD A;  4JZ4 A;  1TSF A;  2NLU A;  4PJO G;  3J81 E;  4RKU E;  1Q81 C;  2IG0 A;  2FZG B;  2OTJ Q;  2E3H A;  2RHU A;  3JCM X;  1QVF A;  3RBB B;  3CCU A;  3G1J A;  1ABQ A;  1VQO T;  1BIB A;  1YN8 A;  4E7I A;  3PTA A;  1WJR A;  1YIJ T;  4LUE A;  3M59 A;  3H8Z A;  2GBQ A;  2R57 A;  3DB3 A;  1KQS P;  1VQ5 Q;  4JJD A;  3MPU B;  2F2V A;  2VVK A;  3I9Q A;  1KFZ A;  3OYL A;  4KUD K;  4M7D C;  3OMC A;  4M78 C;  1M1F A;  2DL4 A;  4HT8 A;  2VGM A;  5HK3 A;  1K76 A;  3RKY A;  1WIE A;  1TOV A;  2FRY A;  4OMM A;  1VQO Q;  1W2B P;  4BE2 A;  5HCK A;  3G4S A;  1YIJ Q;  1YFN A;  1ZA2 B;  1BCM A;  1F1B B;  4RTZ A;  3FJP A;  5CQX A;  5CQY A;  4C0D B;  5GMK l;  1HK9 A;  3OMG A;  3OW2 P;  4HCZ A;  4C8Q E;  3SFM A;  2DEQ A;  1BIA A;  2KRS A;  4OMQ A;  4LD9 K;  3BDU A;  2HZY A;  5GAM j;  4JRQ A;  4QQ6 A;  3CMA A;  2EPD A;  4XU0 A;  3FIF A;  2EGE A;  3P8B B;  4DOW A;  2ZPB B;  1BU1 A;  1JRI A;  4E7H A;  2RHZ A;  4LN2 A;  4J6X A;  2LJ0 A;  2VAS A;  3A98 A;  4UC4 A;  1M2V A;  2GNC A;  1M1G A;  4ZNX A;  3HSB A;  1FWZ A;  4X9C A;  2EGA A;  1BKB A;  5C0M A;  2X3W D;  4OGC A;  3U23 A;  5IT9 E;  2EAY A;  1I1J A;  2CRE A;  2LNV A;  3M56 A;  5I21 A;  4XTU A;  4V2S A;  3QWX X;  5GAN 5;  5IXF A;  2GQV A;  1VQ9 A;  1PD1 A;  2X9H A;  4BI8 B;  1B3Q A;  2Z0W A;  1QW1 A;  1YHQ A;  3VU3 C;  3TSW A;  1EIF A;  2HNI A;  2JMA A;  1NYG A;  2EJ9 A;  3CCM A;  1Y0M A;  1BBZ A;  4JS5 A;  2CP2 A;  2YUP A;  5FU6 C;  1UE9 A;  1YJW A;  3QKJ A;  1M90 C;  1VQP A;  4YTL A;  1YI2 T;  4C8Q F;  2KSS A;  5CAI A;  2RHX A;  1BB9 A;  1S72 T;  1WYX A;  2QQ9 A;  3MP8 A;  4A53 A;  2CGH A;  2MWP A;  2QTX A;  3OYF A;  2R5A A;  4PJO B;  4NOY A;  2DBM A;  4MDX A;  2E10 A;  4Z89 A;  2E4H A;  2K5F A;  1ZA1 B;  5A0L A;  4J9C A;  2DAQ A;  2PU9 B;  4OMN A;  2FZK B;  1AT1 B;  4JRI A;  1YI2 Q;  3MEV A;  2PUO B;  3PVL A;  2FPF A;  1WHH A;  1WJQ A;  1RAH B;  3JSC A;  1S72 Q;  2YDL A;  1KC8 C;  1JO8 A;  3SWN B;  4C8Q G;  3S3M A;  1VA7 A;  3PFS A;  2D0N A;  4N0A A;  4FW1 A;  1EFN A;  1QP2 A;  2RJC A;  2KI7 A;  5LJ3 h;  1D3B A;  1HSQ A;  1K8A C;  3UDC A;  2COW A;  2KXC A;  1W4S A;  4JRP A;  1E6H A;  2PUK B;  3I5R A;  3OYB A;  4X34 A;  1X2K A;  4BD3 A;  4M7A A;  2I0N A;  2OTL T;  3WVE B;  1KD1 C;  1KK7 A;  3CD6 A;  3JCM W;  3RER A;  4IUQ A;  1VQ7 A;  1UGV A;  2XDB A;  2QG9 B;  3M55 A;  3CEY A;  1Q7Y C;  4M7D E;  1VQO A;  4M78 E;  3EGU A;  5J3B A;  2DKG A;  3M4Y A;  3MCA B;  4ZGE B;  1GFD A;  2LJ1 A;  1PM3 A;  5CKH A;  1ZUK A;  4R56 A;  2FHD A;  1JB0 E;  2NUT B;  4PK4 A;  4ELZ C;  2OTL Q;  2VYT A;  1X69 A;  3HKS A;  2O2O A;  4C92 A;  1NEB A;  2L0A A;  3VS1 A;  1IRE B;  2ZZD A;  1QCN A;  4M7A D;  2RJF A;  2X4W A;  3EG9 B;  2W10 A;  3CPF A;  3H0I A;  2FG0 A;  3GNG A;  2E6Z A;  3D7S B;  3NTH A;  2L3R A;  3TVT A;  1T0J A;  1I8F A;  3G71 T;  3QDR B;  1H92 A;  5GAN 3;  2YLB A;  1PKT A;  3JCM h;  5CO7 A;  1RL2 A;  3RES A;  2QTV A;  1MHN A;  2RF0 A;  4AG1 C;  1YIT A;  2RK1 A;  1Y57 A;  2X4J A;  2DIQ A;  4WCI A;  4IKF A;  2KNB B;  3BE3 A;  2R5M A;  3PIO A;  2CH4 A;  3CXC A;  5GAO l;  2M16 A;  4OMP A;  4ANJ A;  2JUF A;  4C92 D;  1K0X A;  3TQ7 P;  4ZGD B;  4M4Z A;  4J9H A;  3G71 Q;  1WPY A;  1WFW A;  4KH0 B;  4Q5W A;  1VIE A;  3X26 B;  2ROT A;  2LQW A;  3X28 B;  5FWC A;  2QGG A;  2DL5 A;  5LJ5 d;  2M9U A;  2RHI A;  2RO0 A;  2JJ9 A;  4FYY B;  2KT8 A;  2DRK A;  2DX1 A;  1U1T A;  3REA B;  1WDX A;  5GAN d;  3MHX A;  1MMN A;  4M75 B;  3X24 B;  3ZL7 C;  2JT4 A;  4FL6 A;  4M75 A;  4LDU A;  4XTV A;  1LCK A;  3JB9 F;  1QP3 A;  4M7D G;  1YI2 A;  4CC4 B;  4BUG A;  4M78 G;  2BZ8 A;  4HKE A;  2EJF A;  5CCA A;  3NFC A;  2O4X B;  3CC7 T;  5GMK h;  3G6E T;  3FB9 A;  3BFM A;  1S72 A;  1QVP A;  4PFO A;  2O4X A;  5IHI A;  1Q82 U;  4OML A;  3SD4 A;  2LCC A;  1Q82 R;  2JTF A;  2JM9 A;  1VYV A;  3LGL A;  1LJO A;  3EH1 A;  3EGX B;  1GXI E;  1M8M A;  2QA4 T;  2LQK A;  2V1R A;  3EFO B;  3CC4 A;  2HCK A;  2D8H A;  4F7U E;  2ECZ A;  1Z9Z A;  2GTO A;  1YCS B;  3EFO A;  3HRT A;  2ED1 A;  1U8R A;  1BYM A;  3HRS A;  2IPO B;  2LTO A;  1RAD B;  9ATC B;  3G6E Q;  1ZHI A;  1J3T A;  1PCX A;  4A4H A;  3OS1 A;  2A37 A;  1Q95 G;  3AT1 B;  2O9S A;  1WNL A;  2KGT A;  4AFU C;  1G3W A;  1I07 A;  1W70 A;  2QA4 Q;  1JJ2 P;  1H3Z A;  3QZ5 B;  1VIF A;  4GLM A;  2C06 A;  3M54 A;  3CCV T;  3CCS A;  2Y90 A;  2OTL A;  1FX7 A;  1N6A A;  3VS6 A;  1OX8 A;  4BE0 A;  2J6F A;  2EWN A;  1VQ4 A;  2CUD A;  1EZZ B;  3QPH A;  1OZ3 A;  4PKC C;  3HHT B;  4RTV A;  5GAN g;  2EQI A;  1W1F A;  1TWB A;  2LX9 A;  4FM4 B;  3VYH B;  2C0O A;  4PLL A;  4Y92 A;  3PVQ A;  3M58 A;  1B07 A;  2JXB A;  2DYI A;  1WGS A;  1M27 C;  3URG A;  3MJX A;  3TCJ A;  1G5V A;  2X35 A;  4F7U F;  4E7Z A;  2CZ1 B;  3CCV Q;  2R58 A;  1GFC A;  2MCN A;  1Y07 A;  2ZPF B;  4NL2 A;  1N8R R;  2DET A;  1NLO C;  3ME9 A;  4BB7 A;  1NM7 A;  2YRC A;  4XTX A;  5KYX B;  1AVZ C;  2RJD A;  2LP5 A;  1G3S A;  2DTO A;  5KYX A;  4LNP A;  3OYM A;  2MOX A;  1HXD A;  4HCB A;  1UG1 A;  1VOM A;  3G71 A;  2DTH A;  1VQK A;  5A2Q E;  4J83 A;  1RLP C;  1I4K 1;  4C8Q C;  1SEM A;  3QG1 A;  1RAB B;  4AG2 C;  2RQW A;  3VJP A;  2RN8 A;  1MV3 A;  1YJ9 A;  1I81 A;  1C0M A;  1UFF A;  2NUP B;  4M7D B;  4F7U G;  2VB6 A;  3OYG A;  4M78 B;  2BE7 D;  2QQA A;  1QVF P;  3QO3 A;  4XU3 A;  4QT7 A;  3DB4 A;  1ABO A;  2PQW A; 
#chains in the Genus database with same CATH homology
 1Q81 U;  3QHS A;  4M7A B;  1VQ8 T;  3FJP A;  5CQX A;  5CQY A;  4C0D B;  4NS5 A;  5GMK l;  1HK9 A;  3OMG A;  1O75 A;  4HCZ A;  5EG2 A;  1V29 B;  4RCB A;  3SFM A;  4C8Q E;  3L2Q A;  3CCS T;  4BDY A;  2JVV A;  3L2R A;  2V8J A;  4BI3 A;  4DQ2 A;  2DEQ A;  2RJE A;  5GAN 6;  4J8O A;  1FXX A;  1BIA A;  1BI0 A;  1VQ4 T;  4E47 A;  4M75 D;  1K9M U;  5GAN 8;  5FRO A;  4R55 A;  4LD9 K;  4OVA A;  1QVG S;  2KK4 A;  3BDU A;  4KBM B;  3OYI A;  2RB6 A;  1XNI A;  3JB9 G;  5GAM j;  1KQS S;  1N8R C;  3M57 A;  2A3L A;  4JRQ A;  4QQ6 A;  4MDW A;  2EQK A;  3Q1J A;  3CMA A;  5LJ5 e;  4II1 A;  3JB9 J;  5I2S A;  3WVD B;  4A4G A;  4XU0 A;  3FIF A;  2K5L A;  3P8B B;  3ER0 A;  1Q86 C;  3H6Z A;  2CS7 A;  4HCC A;  4DOW A;  4PLI A;  2ZPB B;  1N9R A;  1YJN T;  4PNO A;  5FU7 C;  1JRI A;  5GMK m;  1QVF S;  3QXE B;  4E7H A;  5FU7 B;  4LDX A;  4N4H A;  2RHZ A;  5FLX E;  2BUD A;  3LX7 A;  4J6X A;  4Y28 E;  2DZ9 A;  5CKF A;  5GAN e;  4QVD A;  3VUB A;  4C92 C;  2E12 A;  4UC4 A;  1W2B S;  1VQL A;  1Y96 B;  4C92 B;  3CC7 A;  3G6E A;  1M1G A;  3KUF A;  2FYK A;  5D6W A;  1UGQ B;  5LJ5 g;  3HSB A;  1G3T A;  1FWZ A;  2FVU A;  4X9C A;  3ZBD A;  1BKB A;  2DO3 A;  5C0M A;  1KG1 A;  4OGC A;  5IT9 E;  2EAY A;  3OW2 S;  2M0O A;  3M56 A;  2LNV A;  4V2S A;  5I21 A;  4XTU A;  1M1K C;  5GAN 5;  2Y4Y A;  3V8K A;  2GQV A;  4LDW A;  1VQ9 A;  4ATO A;  3HFO A;  4Y91 A;  4BI8 B;  3CCJ A;  1QW1 A;  1YHQ A;  3JCM c;  3JCM e;  3VU3 C;  5IAY A;  1PSE A;  2DD5 A;  1EIF A;  2HNI A;  4J6Y A;  1R8O B;  1VQK T;  2EJ9 A;  4A54 A;  3CCM A;  1VQ6 A;  5LJ3 j;  3VV0 A;  2L5Q A;  3A8O B;  4JS5 A;  1XOV A;  3WXM B;  2WSE E;  4JS4 A;  4E7K A;  3BY7 A;  3SDZ A;  5FU6 C;  1NPP A;  1UGS B;  5KCO A;  3RKW A;  2E41 A;  1YJW A;  3QKJ A;  3OSV A;  5FU6 B;  1BI3 A;  1VQP A;  1M90 C;  4YTL A;  3HL8 A;  1N8R U;  1YI2 T;  2JTM A;  4C8Q F;  2VGN A;  2KSS A;  2HD0 A;  3S6W A;  4D6W A;  2QQS A;  5CAI A;  2QEX A;  2K3Y A;  4HA8 A;  1YJ9 T;  4CI0 C;  2RHX A;  3TU4 K;  5GAN 4;  5GAM f;  1S72 T;  2QQ9 A;  2RK2 A;  2V8I A;  3MEA A;  3MP8 A;  3FDR A;  1Q86 U;  2YLC A;  4FSX A;  4N4I A;  2V8K A;  2XDP A;  4KUI A;  4A53 A;  2K57 A;  2CGH A;  2MWP A;  2QTX A;  5DM7 R;  2KQW A;  2L89 A;  2XIC A;  5GAM h;  2R5A A;  4J6W A;  2D6F A;  1U1S A;  2DJZ A;  4M78 F;  1I5L A;  4QQD A;  4HT9 A;  4M7D F;  4PJO B;  4ZN1 A;  4NOY A;  2DXB A;  4JUV A;  3LYI A;  4OF1 A;  3CBO A;  3UWN A;  3VYG A;  3G4S T;  2CYZ B;  2RI2 A;  4QQG A;  2E10 A;  3OYA A;  3JCM P;  4MDX A;  3CCQ A;  1NJI C;  3NTI A;  1M4Z A;  2K5F A;  3C95 A;  4XU1 A;  5A0L A;  2OAU A;  3LW5 E;  5LJ5 j;  3OYF A;  1M8V A;  2PVG B;  2DAQ A;  2E65 A;  2PU9 B;  5CVI A;  1K73 C;  1M9S A;  4OB2 B;  4ZTF A;  1M1K U;  4RCC A;  1BI1 A;  4M7A F;  2EJG A;  4JRI A;  3PIP A;  3L2V A;  5KH6 A;  3OYC A;  2XDD A;  2X4Y A;  3UPU A;  1ZBX A;  3MEV A;  2PUO B;  4B9W A;  3GF5 A;  5HKC A;  5GAN j;  5GAN h;  4O5V A;  4OB1 B;  3I56 A;  3V8L A;  1WJQ A;  4OMF B;  3JSC A;  3OBY A;  3KXT A;  2RM4 A;  2A7Y A;  3A8G B;  5LL6 S;  3SWN C;  4C0G A;  2F5T X;  2F69 A;  2GCX A;  2LQ8 A;  1KC8 C;  5IN1 A;  3SWN B;  3L2Z A;  3S3N A;  2X4X A;  4C8Q G;  3S3M A;  3CMA T;  3S3O A;  3M9Q A;  2Y4X A;  3PFS A;  2FL7 A;  4M7D A;  3GLX A;  4N0A A;  4BAC A;  1M90 U;  4A4E A;  4M78 A;  1OI1 A;  4IUU A;  1QP2 A;  2RJC A;  1PSF A;  3P8H A;  3OB9 A;  2P0K A;  3CCL T;  2KDS A;  3CCE A;  5LJ3 h;  1D3B A;  2O01 E;  5FRM A;  3HFN A;  1K8A C;  3UDC A;  1O9S A;  2CZ6 B;  1W4S A;  4EMH A;  4JRP A;  4C5G A;  2PUK B;  2I2L A;  1VQL T;  2EQU A;  3JRZ A;  2RD1 A;  5I2M A;  3OYB A;  4X34 A;  4M7A A;  4BD3 A;  4OB0 B;  3UT1 A;  2YRV A;  5L8R E;  3WVE B;  1KD1 C;  2OTL T;  3JB9 H;  5A0G A;  2KVQ G;  4C92 F;  3QSU A;  4EDU A;  3V7S A;  3CD6 A;  3JCM W;  3RER A;  2VC8 A;  4IUQ A;  1VQ7 A;  1NJI U;  4LDV A;  2XDB A;  3SB2 A;  2BKD N;  3M55 A;  3X25 B;  3CEY A;  3CCJ T;  1Q7Y C;  4DOV A;  4M7D E;  3GP8 A;  1VQO A;  3OS5 A;  1YHQ T;  4M78 E;  4MZP A;  1K73 U;  4C8Q D;  2LT1 A;  2E5Q A;  5J3B A;  2DKG A;  2WAC A;  3HPW A;  1NPR A;  3M4Y A;  3OS2 A;  3MCA B;  5GAM d;  3CCM T;  4ZGE B;  3FC3 A;  2DXT A;  5GAO r;  2JZ2 A;  3KBG A;  2K5I A;  5D6X A;  4M7D D;  3L42 A;  1YJW T;  4M7A E;  4M78 D;  5CKH A;  2XU8 A;  1TH7 A;  1VQP T;  1KC8 U;  1LNX A;  2CZ7 B;  3QYG B;  4R56 A;  2FHD A;  3T9N A;  1SSF A;  3CPW A;  1JB0 E;  3L2U A;  2LVM A;  4ELZ C;  2QEX T;  4C5H A;  2VYT A;  3CC2 A;  1NE8 A;  3HKS A;  3DLL A;  1Y96 A;  3DLM A;  1WJS A;  2DXC A;  2HQX A;  2ZPH B;  3O8V A;  4L6V 5;  4LDY A;  5AYF A;  2CKK A;  4C92 A;  5J39 A;  4XQ3 A;  1IRE B;  2ZZD A;  4MZT A;  4M7A D;  2RJF A;  2X4W A;  1VQ6 T;  2JOY A;  3CPF A;  3GNG A;  3CCU T;  1K8A U;  2DPP B;  2E6Z A;  2E64 A;  3RMQ A;  3JCM Q;  3NTH A;  5GAO p;  4J7I A;  1B34 B;  3C12 A;  4C5I A;  2L3R A;  3BW1 A;  4PJO F;  3CCQ T;  3RMS A;  1I8F A;  2XI9 A;  3QDR B;  3I55 A;  3G71 T;  1KQ2 A;  1AHJ B;  3MO8 A;  2QA4 A;  4IUT A;  5GAN 3;  2YLB A;  3ASK A;  1LOJ A;  1KD1 U;  3JCM h;  5CO7 A;  1RL2 A;  4QVC A;  4C5E A;  3RES A;  4JJN K;  4J5Y A;  2MI6 A;  1WQ7 A;  3NTK A;  1MHN A;  3CME A;  3QUI A;  1YIT A;  1Q7Y U;  4Z02 A;  2RK1 A;  5LJ3 d;  5GMK j;  1N27 A;  3OQ5 A;  2HAX A;  2LC4 A;  2LRQ A;  3EAE A;  4C92 E;  5HK0 A;  3DKM A;  3JCM J;  2P0P A;  2P4T A;  2X4J A;  2DIQ A;  4IKF A;  4IUR A;  2ZPG B;  3INZ A;  4JLG A;  3OYD A;  3VUZ A;  2R5M A;  1JBM A;  3PIO A;  1N9S A;  1XTD A;  2ZPI B;  4A4K A;  4A4F A;  3A5Z B;  4FT4 A;  4ME7 A;  3CXC A;  5DLQ E;  3CCR A;  5GAO l;  4FT2 A;  2M16 A;  4XTW A;  4C92 D;  2JUF A;  2GFA A;  1Q82 C;  4ZGD B;  2KY9 A;  4L59 A;  1WPY A;  4XTY A;  3CCE T;  4PJO A;  4C0Z A;  3OYN A;  4Q5W A;  2L8D A;  1VIE A;  2JNG A;  3E19 A;  5A0D A;  3E1S A;  3X26 B;  3C94 A;  4BDZ A;  2MF2 A;  4ZTJ A;  3X28 B;  2CZ0 B;  3MEU A;  3R6O A;  3CCV A;  2GF7 A;  4FIB A;  5GAM e;  1UGP B;  3CBM A;  2EQJ A;  4WF2 A;  4RMO A;  3V7R A;  1OYX A;  4C0D C;  2M9U A;  2RHI A;  4EMK C;  2RO0 A;  5LJ5 d;  1VQM A;  3LWH A;  3QJ6 A;  3AHU A;  5GAN 2;  1BI2 A;  4EMK B;  2KMT A;  3OY9 A;  3JCM V;  3CD6 T;  2VV5 A;  4XU2 A;  2EYQ A;  1VQ7 T;  2VXE A;  5D6Y A;  4EMK A;  2XID A;  4P5N A;  1U1T A;  4GY5 A;  2OTJ A;  2MAM A;  4JLI A;  3G7Z A;  2EFI A;  4PL6 A;  1KHI A;  1WQW A;  4JRK A;  5GAO m;  5GAN d;  4IUP A;  3MHX A;  4MML A;  4M75 C;  2DD4 A;  1DJ7 B;  4BI4 A;  4EPC A;  2RHY A;  5GAM g;  3CPW S;  2D9T A;  4M75 B;  3X24 B;  4KUL A;  3SWN A;  4PJO E;  3QZ9 B;  3FEO A;  4FL6 A;  4E7J A;  4M75 A;  1G3Y A;  4QVZ A;  4LDU A;  5LJ3 f;  3TEE A;  1OZ2 A;  1KQ1 A;  4E7L A;  3ZEH A;  4XTV A;  2LDM A;  4F7U B;  5KE2 A;  4CRI A;  2XD0 A;  3JB9 F;  2AHJ B;  3HP9 A;  1QP3 A;  3HRU A;  4F7U A;  1YI2 A;  5FRN A;  4M7D G;  4BUG A;  4M78 G;  1NZ9 A;  4M77 C;  1VQ5 A;  4HKE A;  2RH2 A;  3JCM d;  2EJF A;  3A8M B;  5CCA A;  3NFC A;  4M77 B;  4PJO D;  2O4X B;  4FU6 A;  3OYJ A;  3QJY A;  3RUX A;  3CC2 T;  5GMK h;  3V7C A;  3G6E T;  3CC7 T;  3A8H B;  3BFM A;  3FB9 A;  1QVP A;  3RIR A;  1S72 A;  4M77 A;  3J7A F;  2O4X A;  5J26 A;  1Q82 U;  4ZGJ B;  2M1H A;  2P0Q A;  3GNF B;  1IZ6 A;  2LCC A;  3SD4 A;  4RG2 A;  1VQ9 T;  4M7A G;  2JTF A;  1YBY A;  1ZQ1 A;  2EQM A;  2MMP A;  2QI2 A;  3M53 A;  3LGL A;  2E70 A;  4O6J A;  1VQN A;  1LJO A;  4M75 E;  3ZFJ A;  2QQR A;  1YIJ A;  1GXI E;  4OGE A;  1UEB A;  3I55 T;  1X6O A;  2QA4 T;  2DVE A;  2E1H A;  2LQK A;  2XHC A;  1JJ2 A;  5LJ5 f;  3CC4 A;  3FRN A;  1MGQ A;  4F7U E;  4KT0 E;  2FB7 A;  3MP6 A;  3HRT A;  5LJ3 g;  5LJ5 h;  3CXC S;  3OSS C;  3CME T;  1U8R A;  1YIT T;  1BYM A;  3MEW A;  3HRS A;  2LTO A;  5GMK i;  4M77 E;  4NL3 A;  4OP0 A;  3OYH A;  2BIV A;  5GAN f;  2E6N A;  3QBY A;  2F5K A;  5CKB A;  1KHC A;  1ZHI A;  3QYH B;  4A4H A;  3OS1 A;  3LLR A;  4OB3 B;  2IVW A;  2PVD B;  3CBP A;  1WNL A;  3OYE A;  3CCR T;  2WSF E;  2VXF A;  2QDY B;  1G3W A;  3M4G A;  4IUV A;  4LD6 A;  4M77 D;  1QVG A;  3MET A;  5M9O A;  4QW2 A;  2RA2 A;  5C6S A;  3GOX A;  4J7F A;  3QII A;  1UB4 A;  1VUB A;  4C92 G;  2LCL A;  3CCL A;  3JCM f;  2DXU A;  3X20 B;  2KAF A;  1B34 A;  5CIU A;  3TRE A;  3QZ5 B;  2K2V A;  2JN0 A;  1VIF A;  1VQ8 A;  1H64 1;  2C06 A;  1H3Z A;  3M54 A;  5DY9 A;  4XK8 E;  3CCV T;  3CCS A;  2Y90 A;  4BY6 C;  1X01 A;  2OTL A;  1FX7 A;  1N6A A;  1VQM T;  4BE0 A;  4XTZ A;  3V8J A;  2ZGW A;  4BY6 B;  4TVR A;  2EWN A;  1VQ4 A;  3M5A A;  3E9G A;  1OZ3 A;  3QPH A;  2XG8 D;  4PKC C;  2HQE A;  4XAX B;  2OTJ T;  3I56 T;  3JB9 D;  3N5B B;  3C4S A;  1M5Q 1;  5KCH A;  2XK0 A;  4JDS A;  1UGR B;  3HHT B;  5GAN g;  2B8A A;  2HBP A;  2QXF A;  3L2W A;  3PNW C;  4BE1 A;  4X9D A;  2LX9 A;  5GAO q;  4FM4 B;  5CKE A;  3VYH B;  5GAN 7;  4PLL A;  3OYY A;  3M58 A;  3RKX A;  4M75 F;  1XQH A;  2YHT A;  1WGS A;  2EKO A;  2QQB A;  2H3J A;  3URG A;  3JCM b;  2ZCF B;  3TCJ A;  4N4G A;  5DLO A;  1YJN A;  2GFU A;  1Y7X A;  4GLK A;  2DZC A;  2RI3 A;  1KQS A;  1G5V A;  2X35 A;  3JCM g;  3PMT A;  3VKI A;  4F7U F;  2CZ1 B;  3OYK A;  1VQ5 T;  2R58 A;  5GAO n;  3MP1 A;  2VUB A;  4ZN3 A;  1P92 A;  1Y07 A;  2PVO B;  2ZPF B;  4NL2 A;  5CKD A;  3OA6 A;  3ME9 A;  4PJO G;  2NLU A;  3J81 E;  2ZPE B;  4RKU E;  4BB7 A;  2IG0 A;  3PGG A;  4M77 F;  1Q81 C;  1JJ2 S;  4XTX A;  2RJD A;  2MWO A;  2RHU A;  3JCM X;  1QVF A;  1G3S A;  3CCU A;  4DA4 A;  2DTO A;  3OYM A;  3PT9 A;  1HXD A;  1W2B A;  1VQO T;  1BIB A;  4HCB A;  4E7I A;  2DK3 A;  2DTI A;  3PTA A;  2RI5 A;  2K4Y A;  1K9M C;  1VQN T;  3G71 A;  1WJR A;  2DTH A;  2G3R A;  1YIJ T;  1VQK A;  3P8D A;  3M59 A;  3EFR A;  3H8Z A;  5A2Q E;  4J83 A;  2XKO C;  3FLG A;  3LH0 A;  4RG8 A;  4B9X A;  5KE3 A;  2D0Q B;  4MMK A;  3CC4 T;  1I4K 1;  3GIB A;  3E9F A;  3OW2 A;  2R57 A;  5CR2 A;  4C8Q C;  3LWI A;  3DB3 A;  3A8L B;  4C8Q B;  3BDL A;  3QG1 A;  3JB9 I;  1RI0 A;  4C8Q A;  3LGF A;  3VJP A;  2EIF A;  4MZM A;  4M75 G;  4EMG A;  3EFS A;  3J80 E;  1I81 A;  1YJ9 A;  1Y71 A;  1YCY A;  3OYL A;  4KUD K;  4M7D C;  4N0A C;  4PJO C;  3OMC A;  4M78 C;  1M1F A;  4VUB A;  5HY6 A;  4HT8 A;  2VGM A;  4M7D B;  4F7U G;  4ELY C;  3OYG A;  4M78 B;  5HK3 A;  5CK9 A;  3RKY A;  2DIG A;  1X75 C;  2WSC E;  2QQA A;  3OS0 A;  3OBW A;  5LJ3 e;  3QO3 A;  3GPL A;  2LT4 A;  2K3X A;  1D3B B;  4M77 G;  4C0F A;  3G4S A;  4BE2 A;  3PMI A;  4XU3 A;  3L1A A;  5GMK e;  3JAM E;  3DB4 A;  3F70 A;  4M7A C;  4L5G A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...