2VC8A

Crystal structure of the lsm domain of human edc3 (enhancer of decapping 3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
b'TDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENHANCER OF MRNA-DECAPPING PROTEIN 3
molecule tags Protein binding
source organism Homo sapiens
publication title A Divergent Sm Fold in Edc3 Proteins Mediates Dcp1 Binding and P-Body Targeting.
pubmed doi rcsb
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vc8A00
2EWNA 5LJ3h 5GAOl 3JCMe 4M78D 2E64A 4C8QD 4C92C 5CAIA 5GAN6 4M75C 4XU2A 5GMKj 5GMKm 4PJOF 4PJOE 4J6WA 3RUXA 1KQ2A 2VXFA 1M8VA 3BFMA 3SWNA 4M77G 4EMGA 3JCMJ 4J5YA 3JCMg 1HK9A 3BY7A 2E1HA 2DVEA 4X9DA 4EMKC 1B34A 2DEQA 2DJZA 2HNIA 4MMKA 4JLIA 3JCMf 3JCMQ 1M5Q1 1WQWA 4M7AF 1BIBA 3RKXA 4M7DD 4C92G 3JCMV 5LJ5j 2EJFA 5GAMd 4PJOA 2DTIA 1TH7A 5GMKh 2YLCA 2DXTA 2EAYA 3HFOA 4F7UF 3JCMc 4QVCA 5GMKl 5GAMj 4M75D 4C92F 5GAN3 1I5LA 1I4K1 4M7DA 5GAMg 2EJGA 4M75B 2RB6A 5GAMh 1BIAA 4V2SA 4C92E 4C8QE 1D3BB 3INZA 4M75E 3V8KA 1LOJA 4XTZA 4F7UE 5GANe 4M7AG 2DKGA 4M7AC 5LJ5h 3L1AA 3HSBA 4HA8A 4F7UB 2I2LA 3VU3C 4XU3A 4OP0A 4M78G 1N9SA 4M77C 2RA2A 4M7AE 4XU0A 1Y96B 4A53A 4C8QG 3FB9A 2E65A 4J6YA 3V7SA 4M77D 4WF2A 4HT8A 1U1SA 2DXUA 4N0AA 1D3BA 4X9CA 4EMKB 3EFRA 5DY9A 1U1TA 2CGHA 5GAMf 3V8LA 5GAN8 1HXDA 3QHSA 3FJPA 4C92D 4M77E 2YHTA 4M7DB 4RCCA 1JBMA 4RCBA 4M77B 3JCMX 5GAN5 2ZGWA 4M78E 3M4GA 1YCYA 4MMLA 4XU1A 3RESA 3BDUA 1B34B 4NOYA 3V8JA 2QTXA 4JUVA 4PJOB 2RM4A 1WPYA 5LJ5g 4N0AC 5GAN2 4M78C 3JCMh 4PNOA 3RKWA 4XTWA 3HFNA 1WQ7A 5LJ3e 3JB9F 4M7DF 4M7AD 5LJ3f 4XTUA 3SWNB 5GMKi 3L2ZA 3QO3A 2Y90A 4J6XA 3V7RA 2DZ9A 5GAOq 3JB9I 2YLBA 2FYKA 4JRKA 1X01A 5GMKe 1WNLA 3JCMd 4M78F 2EJ9A 4JRIA 4C8QF 2DTHA 4M78A 3RERA 4PJOD 4XTVA 5GAN4 4F7UG 4M77A 4C92B 2E10A 5LJ5d 5GAOn 4QVDA 4PJOC 4XQ3A 4EMKA 2FB7A 5LJ5e 3JB9G 3SB2A 1I8FA 3PGGA 4C8QB 3JCMP 3JB9J 4XTYA 1LJOA 5GAMe 4M7DC 2VXEA 4M7DG 2E41A 4M77F 4XTXA 5GANh 5GAOr 3RIRA 5GANg 1JRIA 5LJ3g 3FIFA 3JCMW 3JB9D 4M7AB 4EMHA 1H641 5GAOm 3QSUA 2VC8A 4C8QC 2DZCA 3AHUA 1LNXA 5LJ5f 5GANf 4M7AA 1Y96A 5GANj 2K57A 3SWNC 3V7CA 4A54A 2JN0A 4HT9A 4M75G 2RD1A 5GANd 5GAN7 3GIBA 4Y91A 4F7UA 3JCMb 5GAOp 4M75A 3QUIA 3JB9H 4C8QA 1I81A 3EFSA 4C92A 4M75F 4DQ2A 5I21A 1N9RA 3BW1A 4M7DE 2DTOA 3RKYA 5LJ3j 1MGQA 4PJOG 4NL3A 4M78B 4NL2A 5LJ3d 1KQ1A
chains in the Genus database with same CATH superfamily
4IURA 2CDTA 2PVDB 4C8QD 4RTUA 1MNEA 1FMWA 2VXFA 1ABOA 4ZTFA 2YT6A 4C5HA 1NJIC 4JRQA 2MF2A 1N6AA 4J83A 3CCJA 2L3SA 4ESRA 2GFUA 2JTFA 3EAEA 5J39A 1OU9A 2K2MA 3HTRA 5FWBA 2X4WA 3DB3A 2KQWA 4M7AC 1LOJA 3CEYA 1SRMA 1PKTA 1OZ2A 3OYYA 2XHCA 4A53A 2AZSA 3VV0A 4BI8B 1U1SA 4HCBA 4LN2A 1YHQT 1IXDA 3VRYA 3NPFA 1YIJA 2K6DA 2GQVA 4WTOB 4M7DB 3UPUA 1VQMQ 3CC4Q 3VS3A 3N5BB 3MKDA 1D0XA 1YCYA 2GBQA 2JMAA 1VQNA 2RQVA 4MDXA 2RM4A 2DERA 4IIOA 2RHIA 2GTOA 4Y92A 1VQPQ 1BI2A 1X01A 3JCMd 3C4SA 4OGEA 2JTEA 4DBRA 1VQ9T 4AFQC 4JJDA 3QYHB 4QQDA 2HEQA 5LJ5d 2JXBA 3QDFA 2MK5A 3UDCA 2EQUA 3JCMP 3OYEA 4BE0A 2DFUA 2AIRB 4VUBA 1VYTA 3CXCA 2OTLT 4M7AA 4PKCC 1AWJA 4KGXB 4PJNA 1T3SA 2RD1A 1Y71A 5GANd 2LJ1A 3GOXA 1IO6A 3CCVQ 1VQNQ 4PJOG 2LNHB 1Z9QA 4PJOE 2P0QA 3MCAB 4LDWA 1NLPC 1D1AA 1G8XA 3NGPA 4J5YA 1RAGB 2KT1A 3P8DA 2KGTA 2OX7A 2EAYA 3HFOA 3JRZA 5CQYA 1FMKA 1QP2A 1AWOA 4C92F 2CT3A 2QA4Q 1X2KA 1RAHB 1GXIE 2HD0A 3D7SB 4MZPA 1YJ9A 3NHNA 3VU3C 4BUGA 1N9SA 5C0MA 2YUQA 3OMCA 1VQ4Q 2WSEE 1S1NA 1CKAA 2R58A 4WF2A 2E3HA 4LDYA 1QVPA 3EFRA 2EFIA 4R56A 4KUIA 3I55A 2F5KA 4PJLA 2JS2A 1VQKT 1N8RC 1M3BA 4D6WA 2L2PA 4O6JA 1X2QA 2DYBA 2EYYA 2P0KA 3C94A 4BI3A 2OAWA 2QTVA 5LJ5g 2C06A 4OMFB 4M7DF 3TSWA 3A8LB 2DL7A 2YWWA 3EGXB 4A4HA 5IHNA 5KYNA 2HBPA 4J9BA 1JJ2A 5LL6S 4R55A 2YSQA 2CKKA 4C92B 1CKBA 4PJMA 3CD6Q 1OQKA 4Y28E 2FB7A 4LXCA 2C0TA 2KXDA 4XTYA 1LJOA 5A0DA 1BI1A 3X26B 3SDZA 1W6XA 1BCMA 1Q82C 5DM7R 5GANj 2ZAEA 3QJYA 1R8OB 1ZSZA 4J9DA 5I21A 4M75F 5LJ3j 1TUCA 1X75C 2FZKB 1VQ7Q 2F69A 1NEBA 1KQ1A 1GFDA 4QT7A 1NYGA 5IAYA 1SHFA 1JO8A 2M51A 1B3QA 2O4XB 2DEQA 1M90U 2RQWA 5EC7A 4GLMA 1QLYA 5CR2A 2DRKA 4B9XA 2DX1A 2A37A 3CCLT 1RABB 2SRCA 4QW2A 3SD4A 2CT4A 2ESWA 2DD4A 2VYTA 5LJ5h 2QQ9A 3BE3A 3RMSA 4UC4A 2J6OA 2E5QA 1Q7YC 3OYJA 1ZSZC 3A5ZB 1ZA2B 1D0ZA 1AWXA 3EH2A 4XAXB 2DYIA 5GAMf 4E7IA 2LQWA 2JMCA 1WLPB 2L89A 2KRMA 2QYZA 1M1FA 3OSSC 2BE7D 4AFUC 2XKOC 1X6BA 1NZ9A 2XI9A 2O31A 2CP7A 1C0MA 4A63B 1B34B 4JUVA 4N0AC 1VQ5T 3G71T 4D8DA 1VQLA 1XJWB 4FYVB 4GLKA 1FX7A 1VQLT 5FU6C 2LCCA 1IRXA 1HD3A 1KSWA 3EHRA 1JJ2P 1ARKA 2RQRA 4DBFA 4C8QB 2VWFA 4E7JA 1N5ZA 5I2MA 2SEMA 2VXEA 1UJYA 1CSKA 3I56T 1H641 2LJ3A 5GAOm 4C8QC 3G6ET 4ZGEB 1GRIA 5KYUA 1VIFA 3RDVA 2MI6A 4GBQA 3LGLA 1K9MU 2ZZDA 1K9AA 1X6GA 3U23A 1VQKQ 4C5EA 3NTKA 2COZA 3X24B 5GAOl 5CAIA 2F2VA 3MEUA 4M75C 5GMKj 2QQRA 3VYGA 2LCSA 2CZ7B 1IGUA 1UEBA 2DVEA 1I0CA 1W1FA 4OMLA 2GTJA 2X3XD 5FRNA 2E4HA 3M4YA 2EW3A 1BIBA 1LVKA 2VGMA 3EHQA 5GJWB 5KYWA 4FT4A 2CZ6B 5GMKl 1I4K1 2DPPB 5GAMg 2X3WD 3QKJA 4OMQA 1IGQA 2JM8A 4YTLA 4M4ZA 1NM7A 2FL7A 3CPFA 3S3MA 4OP0A 1Q81R 3H0IA 1YJ9T 2KE9A 1KHCA 1W2BS 4II1A 2P4TA 3QWYA 6AT1B 1YIJQ 1D3BA 3TCJA 3PIOA 3CMAA 1XTDA 1Z9ZA 4E47A 4PFZA 2FRYA 1W70A 4ATOA 4ZTJA 3MO8A 4RTVA 3OW2A 3M0TA 4F14A 3E2UA 3LWIA 4DEXA 3GNFB 4FL6A 3HRSA 3KXTA 2RHUA 1M3CA 5CKDA 4JZ3A 4M78C 3CCEA 1SG5A 1NPPA 1WHGA 3JB9I 3TREA 3HP9A 5CO7A 1K8AU 3ZL7C 2PZ1A 3DB4A 4IUUA 1G5VA 1V76A 1AWWA 3M5AA 1LCKA 4RKUE 1Q81U 4F16A 3SB2A 2K2VA 1UUEA 4M7DG 1YCSB 2A3LA 5GAOr 5FU6B 4HKEA 3AHUA 2KVQG 1M9SA 3DLMA 4HVVA 4M75A 4L6V5 4DQ2A 3CD6T 1TUGB 3RKYA 3A1PA 4J9EA 1YJNT 2E3IA 3EGDB 1KD1C 3VS0A 3LH5A 2E64A 1IHWA 4DOVA 2FO0A 3J7AF 5KE3A 3P8BB 4M77G 1FYNA 4JRPA 2HNIA 3CCET 1RAFB 2V1RA 1VQ5Q 4M7AF 2LX7A 4A4KA 5GJVB 2R57A 2H3EB 1TG0A 3JSCA 5GAN3 1O9SA 5GAMh 3NTHA 1R0BG 4LD9K 2KRNA 4BE1A 4HCKA 3L1AA 4EDUA 4O5VA 1AZEA 3OS1A 2RA2A 4WCIA 2PNIA 1BK2A 2RHXA 3VS1A 2EQJA 1P92A 2KSSA 3CCSQ 2LDMA 1N8RU 4FT2A 2M0OA 4C92D 2O01E 2IG0A 4OB3B 4IUQA 4TVRA 1VQKA 4LD6A 2DBKA 1BB9A 3EG1A 1ZHIA 5GAN2 2DF6A 1M90C 2MIOA 2OTLQ 3L42A 3OYMA 1NJIR 1YITQ 2GF7A 2QXFA 2FYKA 2PUOB 4M78F 5J3BA 1JQQA 1U8RA 4LDUA 4XTVA 2KNBB 2EYZA 1VQNT 1AEYA 2K4YA 2CH4W 4PJOC 2KXCA 3L2QA 3A8GB 3M53A 2EQIA 4L59A 3NMZC 4Q5WA 1IREB 2FG0A 2LQKA 2ZPIB 3P8HA 1B07A 2C0IA 2J7IA 3HKSA 2XMFA 1NLOC 1UGSB 3DLLA 4Y91A 1K73U 4C0ZA 3RNJA 2HCKA 2YRVA 3EFSA 2XD0A 1R0CB 2LT4A 1K4US 3EG3A 4CC3A 4NL3A 1Q86C 4M78B 3RKWA 3E9FA 3CCLQ 2E6NA 1R77A 3H0HA 3SWNA 4A4GA 3CC2A 1HSQA 4OMNA 4X9DA 3THKA 1B7TA 2Z0WA 2P0PA 3R6OA 2EQKA 2D0QB 1RUWA 4FM4B 4PLLA 2ZPEB 2AKKA 3JCMc 1SEMA 3KBGA 1K0XA 1Y07A 1BIAA 1Q82R 2HAXA 2EGCA 1AHJB 1VQ6Q 2X4XA 2I2LA 1KJWA 1D1CA 1TUDA 1Q82U 4M78G 1G3TA 2J06A 4XU0A 1NYFA 1QQJA 4OF1A 3EG9B 2LRQA 1OV3A 4OMPA 2XK0A 1FWZA 1Q81C 1G3YA 2E12A 3CCRT 1PRLC 2HZYA 2MAMA 4JJBA 5HK0A 2D1XA 2V8IA 5KCHA 2DAQA 3L2VA 3OW2S 9ATCB 3LH0A 2QTXA 3X20B 1PRMC 1RADB 3LX7A 1QKXA 4EIKA 4ZN3A 1QVFS 1WHHA 2HBWA 4IKFA 1NE8A 2EJ9A 2LC4A 1MV3A 3CXCP 2CH4A 1WJRA 1ZSZB 5ECAA 4HVUA 1JXOA 4XTXA 3RIRA 3PVQA 2ENMA 3VUBA 1C6VX 2RK2A 2AKLA 3CC7A 1DJ7B 4L5GA 1M3AA 1TU0B 4M75G 3GIBA 2ZPGB 1UGPB 3QUIA 1I81A 4C92A 8AT1B 3QIIA 2LCLA 4AFSC 2WSFE 4RTZA 1C1AA 1KQSS 3KUFA 1E6HA 1I07A 5KYWB 1KQSP 2CP0A 2FVUA 2DIQA 1M8VA 4J7FA 3BFMA 5IXBA 3FC3A 3JCMJ 5IN1A 2K3BA 3A8MB 1SF9A 2COWA 2FEIA 2E70A 2QI2A 2EPDA 4LDXA 2KRSA 2D6FA 2A0FB 1WIEA 3OYDA 1W2BP 1PHTA 3HRTA 2LMJA 2EQMA 4XU3A 2VVKA 1VQ9A 4CI0C 2RN8A 3FEOA 4X9CA 2V8JA 2MMPA 3CCMA 5FW9A 1WXTA 4RUGA 1QW1A 3CBPA 3QHSA 3PNWC 4M77E 1K73R 3OW2P 4ZGDB 2KYBA 3M4GA 1YJWA 1SHGA 1M1KR 1FXXA 2FZGB 3JB9F 5I11A 1QVGP 4XTUA 3OB9A 3QO3A 3VS6A 3CC2T 3OYFA 3LWHA 4PLIA 1KC8U 4BI4A 4MDWA 2KYMA 2M1HA 3HL8A 4B6MA 2QGGA 4B9WA 1SPKA 4M77A 2DLPA 4J9FA 3MEVA 4QVDA 1G2BA 1ABQA 4FYYB 2BE9B 1VQPT 2KEAA 5GANh 1TXQA 4F04B 4M7AB 3M0SA 1VQ4T 1LNXA 2Y4YA 1VQPA 1Y96A 3V7CA 3H6ZA 4F17A 2LNVA 4C8QA 1JXMA 3BW1A 2VKNA 4JS4A 2DRMA 2RHZA 2DM1A 1UB4A 1SSFA 1E7OA 1VQMA 3ZEHA 2J6KA 4KULA 2LQNA 3PFSA 3G6EA 2X4JA 4J9IA 3TU4K 2L0AA 3JCMQ 1T0JA 1M5Q1 1RAEB 1H8KA 4ZN1A 3SHWA 4C0GA 1UTIA 1KHIA 3L2RA 2QEXA 1TWBA 1QMCA 4C92E 4XTZA 4M7AG 2DKGA 1EFNA 1D1BA 3PT9A 3PIPA 2O2OA 1PSEA 3CMEQ 4M77C 4M7AE 4PFPA 4JJNK 2XDBA 4GY5A 1K76A 2O9SA 1WX6A 2H8HA 3ER0A 2AT1B 1U1TA 2HKQB 3L2WA 3CCMQ 3UT1A 1JBMA 4RG8A 1VQ9Q 1QP3A 5AT1B 4MMLA 1X43A 2MOXA 1VA7A 2X9HA 5IHKA 5CVIA 4PNOA 3M57A 3UF4A 3HFNA 5KE2A 1YI2A 2GFAA 1MHNA 2DL3A 5FLXE 2DZ9A 3H8ZA 2CYZB 3GPLA 3RERA 3VKIA 1GL5A 1BBZA 2E10A 3RR6A 4KT0E 4XQ3A 4JZ4A 3CCUQ 8ATCB 3SFMA 1KFZA 2E41A 2MCNA 5GANg 2LTOA 1VYVA 2H3JA 2JJ9A 5FROA 3MP6A 5GANf 3OY9A 1OYXA 3FDRA 4ME7A 3QXEB 1AVZC 2CUDA 3C12A 2DL8A 4Z89A 4DOWA 1H3ZA 3CC7Q 1OX9A 3HPWA 3JCMe 3H41A 1PSFA 5GAN6 3RUXA 2O4XA 3MP8A 3M0UA 3PE0A 1S72Q 1VOMA 2E1HA 1W2BA 4C0FA 3JCMf 4JLIA 3TQ7P 4M7DD 3TSZA 3GLXA 4M75D 1WZOA 1I5LA 1KC8R 4RMOA 4IUPA 3VS5A 1UGQB 1MNDA 3HSBA 1RAIB 4OB1B 2HQXA 3VYHB 3OS2A 1YP5A 2OJ2A 3QJ6A 1WDXA 1MUZA 3I56Q 3A8OB 3URGA 3C0CA 1O75A 3SEMA 2KY9A 1KIKA 3V8LA 2BZXA 4HCZA 2PTKA 4RTXA 1K8AR 1VUBA 3CCQA 1KC8C 4DA4A 4M77B 4MZTA 1RL2A 1G3WA 2BUDA 1ZUUA 2XU8A 1RLQC 3EGXA 4OVAA 3S3NA 1U5SA 1WHJA 1VQ6A 3GF5A 5IHIA 3SWNB 3CMET 3V7RA 5I2SA 1M1KU 1VQ8T 1NEGA 1KD1R 2KBTA 3PTAA 1VQ6T 1M4ZA 4M78A 4A4FA 5CKBA 2VUBA 5GAN4 2NUPA 2M9UA 3ASKA 4IUVA 1SRLA 1RACB 2KMTA 1ZX6A 3CCRQ 1V1CA 2DJQA 4M7DC 3CC2Q 1XOVA 3G7ZA 3JCMW 5EG2A 2EKHA 3UATA 2BTTA 3CCLA 2JS0A 2LJ0A 2MWPA 3KFVA 1Q86U 3UA7A 4NL2A 3RBBB 1YI2T 3CCQQ 4M78D 1YFNA 2A08A 1V29B 3UWNA 1QVGS 1Y57A 1PD1A 2A36A 1B34A 4MMKA 3BDLA 1WXUA 2DTIA 2XG8D 4PL6A 1Q7YR 1YJNQ 5GAMj 2YLCA 4QVCA 2BIVA 4M7DA 4V2SA 5KYUB 1YITA 4MZMA 5GANe 2YUOA 2DNUA 4PK4A 2CREA 3CQTA 2A7YA 2EYQA 1YN8A 4M77D 3LLRA 1OU8A 4KH0B 2HMAA 2QQSA 5CIUA 1UGVA 2RI3A 2IVWA 1ZBXA 3ZFJA 4RCBA 1UG1A 4JLGA 5KYYA 4NOYA 3A8HB 5HCKA 1U3OA 4BDZA 3JCMh 1WQ7A 4M7AD 1BCOA 1H3HA 2QDLA 5CKFA 1GFCA 1E6GA 1TOVA 1AZGB 3CC4T 3VRZA 3OYCA 1WHLA 3AT1B 3X25B 1BYMA 1SSHA 3OYHA 3OYLA 1VQ5A 4AMCA 2YRCA 1K9MR 3JB9J 5GAMe 2GNCA 2DE0X 1YITT 3G4SQ 4NS5A 1VQ8Q 2X51A 5CCAA 2K5FA 2RJEA 3CPWS 2D0NA 2VC8A 4DBQA 4A54A 1PKSA 2CSIA 2ZCFB 1WJSA 4QQ6A 1YI2Q 4ZNXA 1MMAA 1ZQ1A 5CKHA 2QK0A 1VQOA 2CP5A 2D8JA 1AOJA 4BB7A 4PFOA 3NTIA 2EKOA 3G4SA 3H0FA 4EMGA 2V26A 1K0SA 1HK9A 3BY7A 2CS7A 2GGRA 4EMKC 2DJZA 1JEGA 2XDDA 5GAMd 1EX4A 2JZ2A 3CMEA 2DXTA 1MV0B 3M59A 4C5IA 1OZ3A 3R6NA 1M30A 3I55T 4A4EA 1K1ZA 4E2FB 2JM9A 1YWPA 3CCEQ 1GCPA 3OSVA 4C8QG 3V7SA 3OYNA 3ME9A 4AT1B 3LYIA 1UDLA 2CP6A 5DY9A 2C0OA 1I1JA 1TSFA 2F2WA 3M0QA 3CMAQ 1W4SA 3HHTB 3FJPA 2YHTA 2M0YA 1D09B 2VASA 3QZ9B 3JCMX 2RQUA 2K3XA 2RJCA 2JNGA 3EG0A 1MMGA 4FU6A 4BE2A 2V8KA 3QDRB 3RESA 1NJIU 5LJ3e 2L3PA 2HKNA 1JU5C 4C0DB 3VS4A 4JRIA 4PJOD 4C0DC 1T0HA 1YJWT 5GAOn 1D0YA 2RJDA 3CMAT 2BKDN 4EMKA 2QEXT 1G3SA 5FU7B 5HKCA 4J9CA 2K5IA 5LJ3g 4OB2B 2K9GA 1U06A 1ZUYA 1Q7YU 1M2OA 5J26A 5CKEA 1N27A 2ED0A 4E6RA 3CCJT 2OTJQ 1RAAB 1XNIA 1A0NB 1HYOA 4XK8E 1YJWQ 4C5GA 1ZA1B 3FRNA 1K8AC 1UHFA 4XU2A 4PJOF 1HJDA 1WI7A 3Q1JA 3WVEB 2F5TX 5KH6A 4KBMB 2F2XA 3I5RA 1WQWA 4C92G 3JCMV 5LJ5j 5IT9E 2DBMA 1RI9A 3HRUA 2J05A 2CSQA 4N4GA 2GQIA 2EYWA 1NBEB 2EJGA 2PUKB 2RB6A 2DMOA 2CZ1B 4CC7A 4HVWA 4KGZB 4AG2C 1VQLQ 1M2VA 1FMVA 5C6SA 2EYXA 2OI3A 2KT8A 3OYKA 3F70A 3GP8A 2E65A 1LPLA 3G71A 2QG9B 2DILA 1QWEA 2P4RA 3H9NA 3EH1A 5L8RE 2VGNA 2O9VA 3O5ZA 4ORZA 2HQEA 3CCST 3ULRB 2LX9A 1MMNA 2CUBA 1VIEA 4XU1A 1WXBA 1F1BB 4PJOB 3ZBDA 1Q95G 3X28B 4XTWA 2NUTB 4FYWB 4E7SA 2QAZA 2Y90A 2QASA 3G4ST 1OULA 1SKUB 2HDAA 5GMKe 1Y7XA 2YUNA 5KYYB 3JAME 4C8QF 5DLOA 1IB8A 3VS7A 3OYGA 2AZVA 1KG1A 1QCNA 3PVLA 5LJ5e 3PGGA 1QCFA 1S72A 3L2UA 4FW2A 3REAB 2DZCA 5LJ5f 2K57A 1VQ7A 4FSSA 2PVGB 4F7UA 2K3YA 4J9HA 2M02A 4IIMA 1UJ0A 2KDSA 2PQWA 1GCQC 5IH2A 4J6WA 3JCMg 5HK3A 3G71Q 3I35A 3G1JA 2NUTA 3RKXA 1X27A 3EFOB 5DLQE 4PJOA 3CCUT 1BI0A 3EGDA 3VUZA 1VQMT 5A0LA 2ATCB 1QWFA 4M75B 1J3TA 4M75E 2JOYA 4F7UE 5A0GA 2ZPHB 1TS9A 3EG9A 3VS2A 4X34A 4EPCA 3LW5E 1ACMB 4N0AA 4DBHA 2CGHA 1PM3A 4LE9A 3I55Q 2ECZA 3CBOA 4CC2A 2FPFA 3EGUA 2J6FA 4JS5A 2ROTA 2ROLA 2OTJT 1K9MC 2RO0A 2YXYA 2ZGWA 4M78E 2EGEA 2LZ6B 4DEYA 1VQ4A 3V8JA 1QVFA 1Y0MA 4LUEA 1OOTA 2OTJA 1YJ9Q 4KUDK 2ZPBB 4J6XA 5GAOq 1GBRA 2P84A 1I5OB 1EZZB 3O8VA 2QA4A 1WGSA 3OYIA 2QEXQ 2L5QA 2DO3A 2DL4A 3MEAA 3QWXX 4ELYC 5FU7C 4RG2A 3T9NA 2LVMA 5I22A 2FPEA 4N4IA 3WVDB 3REBB 2WSCE 1JB0E 4D8KA 2X35A 2JW4A 3G6EQ 2CP2A 2GCXA 2JT4A 1PCXA 3FJ5A 1RLPC 2AK5A 4LDVA 3MPUB 1X69A 3MEWA 1GCQA 5CQXA 1JJ2S 1YWOA 2RI5A 3CCVA 1KQSA 3CBMA 4CC4B 2FZCB 2OAUA 1MGQA 2I0NA 1M1GA 5LJ3d 2MYSA 4C92C 2K5LA 3OS0A 4R0KA 2RHYA 3NFCA 3CPWP 4ANJA 2XIDA 3CCSA 1NPRA 2DIGA 3M54A 2RK1A 3OYBA 2LQ8A 1UE9A 2QQAA 4OMMA 1UGRB 5GMKh 2YUPA 2WACA 2EVRA 2V1QA 4X1VA 2QA4T 1M27C 2M16A 3WXMB 2KAFA 3M0RA 1Q86R 3E1SA 4HA8A 4F7UB 4BY6C 3LGFA 1YNZA 1M90R 4AG1C 5AYFA 2IIMA 3CC4A 1QCOA 1WYXA 2FRWA 1WHMA 2MWOA 1BI3A 4BDYA 2F1LA 2NUPB 1GBQA 2ABLA 2BZYA 5D6WA 4PJJA 4RCCA 4IUTA 5FRMA 4RTWA 1VQOQ 2NLUA 2L3QA 3OBYA 3BDUA 1WPYA 4OGCA 1OI1A 4Z02A 5GMKi 2HL3A 4J8OA 2E5KA 2YLBA 3OBWA 2LT1A 1QVFP 2L3RA 2DTHA 1VQ8A 2K79A 3OMGA 4F7UG 3MHXA 5HY6A 3UA6A 4ZGJB 3I5SA 3CCJQ 4J9GA 1M1KC 1WJQA 2PU9B 1G83A 2X4YA 3JV3A 3QSUA 1KK7A 3E9GA 1S72T 1ZBJA 4KGVB 1PNJA 2RMOA 2JN0A 2RF0A 3J80E 4OMOA 5KYXB 1PD0A 1VQ7T 4JPBW 4HCCA 3VJPA 3M58A 2PVOB 4BD3A 1YHQQ 2VV5A 2EWNA 5LJ3h 1N8RR 2DEUA 1KQ2A 2HSEB 1VYUA 4JDSA 4FYXB 2Y4XA 5L23A 4FSXA 2KROA 1VQOT 2EJFA 5KCOA 2DA9A 4CRIA 3FLGA 2YRDA 4C8QE 1D3BB 2KR3A 3V8KA 3J81E 4FW1A 1YBYA 1WHKA 4Z8AA 1BU1A 1YJNA 5CK9A 2KK4A 2HQHA 1Y96B 3META 4J7IA 3FB9A 4RTYA 1PC0A 4HT8A 3I9QA 2DXUA 3GNGA 1OPKA 2G6FX 1ZLMA 2DD5A 5D6YA 4JJCA 1HXDA 5A2QE 3CCVT 5FWCA 4E7ZA 5GAN5 3MJXA 2DETA 2LP5A 3A98A 3TEEA 1OPLA 2NWMA 2K7AA 3OYAA 1K73C 3CPWA 1ZUKA 2VB6A 4HXJA 2DVJA 2YDLA 2JTMA 3M55A 4KRTA 1BKBA 2E6ZA 1XQHA 2KI7A 5D6XA 4E7HA 4FCYA 3CC7T 3QPHA 3PMIA 3E19A 2G3RA 3CCRA 2EGAA 2D9TA 3MP1A 4KH1B 2W0ZA 2MPXC 1ZSGA 3M56A 4BACA 3CXCS 2NYSA 3QYGB 1JRIA 2CZ0B 2HSPA 2IPOB 2RQTA 4P5NA 3M9QA 2R5AA 1X6OA 3EG2A 2AHJB 5D7UA 3IQLA 3SWNC 2DXCA 1RI0A 3QG1A 3JCMb 5GAOp 4RTTA 2XDPA 4LUDA 2RH2A 4M7DE 2HL5C 2FPDA 1M8MA 1NG2A 3C95A 5GMKm 1YIJT 1OEBA 2BZ8A 2DXBA 1MMDA 1H92A 5IXFA 2ZPFB 2RJFA 2CP3A 1QKWA 4E7KA 3I56A 2D8HA 1PG5B 2RNAA 2JUFA 2B86A 1TH7A 3CCQT 4F7UF 2RPNA 4QQGA 1AT1B 3OA6A 4E7LA 3INZA 2JVVA 4N4HA 2OTLA 4OB0B 4QKUA 5M9OA 4ELZC 2L8DA 2QQBA 2W10A 2XICA 4QVZA 1T3LA 4FIBA 3QBYA 2A28A 3M0PA 3PMTA 2DL5A 4J6YA 1OX8A 3S3OA 3OQ5A 4EMKB 2FHDA 2ED1A 5GAN8 1KD1U 2B8AA 2NUZA 1UFFA 3TVTA 3EFOA 1PWTA 2COYA 4K11A 5LJ3f 1UHCA 3L2ZA 7AT1B 4LNPA 3S6WA 4JRKA 2R5MA 1WNLA 1IZ6A 1TTHB 2EBPA 1AD5A 1EIFA 3CCUA 3GBQA 3CCMT 4AFZC 5KYXA 3CD6A 3JB9G 3QZ5B 1I8FA 1WFWA 1IHVA 3RMQA 4Z88A 1UECA 4M77F 2EIFA 3FIFA 3JB9D 4EMHA 2DK3A 3DKMA 1YHQA 3OS5A 2QDYB 4HT9A 5GAN7 1M2VB 1WA7A 2O88A 3JB9H 2RI2A 1N9RA 2DTOA 2QGFB 1QVGA 4BY6B
chains in the Genus database with same CATH topology
3HPWA 3JCMe 1KD1C 4IURA 2PVDB 2E64A 4C8QD 1PSFA 4DOVA 5GAN6 4J6WA 3RUXA 2O4XA 2VXFA 3MP8A 3J7AF 5KE3A 3P8BB 4M77G 4ZTFA 3JCMg 4C5HA 4JRPA 2E1HA 1NJIC 4JRQA 5HK3A 1W2BA 2MF2A 4C0FA 2HNIA 1N6AA 4J83A 4JLIA 3JCMf 3CCET 3CCJA 4M7AF 3RKXA 4M7DD 5DLQE 2GFUA 4PJOA 3CCUT 1BI0A 2JTFA 3EAEA 4A4KA 3GLXA 5J39A 2R57A 3VUZA 4M75D 3JSCA 2X4WA 5A0LA 5GAN3 1O9SA 3DB3A 1VQMT 2KQWA 1I5LA 4RMOA 4IUPA 4M75B 5GAMh 3NTHA 4M75E 4M7AC 1LOJA 2JOYA 3CEYA 4F7UE 4LD9K 4BE1A 5A0GA 1UGQB 2ZPHB 3L1AA 4EDUA 4O5VA 3HSBA 4OB1B 1OZ2A 2HQXA 2RA2A 3OYYA 3VYHB 2XHCA 4X34A 3OS1A 4A53A 4EPCA 3OS2A 3QJ6A 3VV0A 3LW5E 3A8OB 2RHXA 1U1SA 4BI8B 2EQJA 1P92A 2KSSA 4N0AA 3URGA 4HCBA 1O75A 2LDMA 2KY9A 2CGHA 1YHQT 3V8LA 4HCZA 1N8RU 4FT2A 2M0OA 3CBOA 4C92D 1YIJA 2GQVA 1VUBA 2O01E 3CCQA 4JS5A 3UPUA 1KC8C 4DA4A 2RO0A 2IG0A 4M77B 1RL2A 4MZTA 4OB3B 1K9MC 2ZGWA 4M78E 4IUQA 3N5BB 1G3WA 4TVRA 1VQKA 4LD6A 2BUDA 1YCYA 1ZHIA 1VQNA 1VQ4A 2XU8A 3V8JA 4MDXA 4OVAA 1QVFA 2RM4A 5GAN2 3S3NA 2OTJA 1M90C 1VQ6A 4KUDK 3GF5A 2ZPBB 2RHIA 3L42A 3SWNB 3OYMA 3CMET 3V7RA 4J6XA 2GF7A 5I2SA 5GAOq 1M1KU 1VQ8T 2QXFA 1BI2A 2FYKA 3O8VA 1X01A 2QA4A 1WGSA 2PUOB 4M78F 3C4SA 5J3BA 1M4ZA 3JCMd 4OGEA 3OYIA 4M78A 4A4FA 4LDUA 5CKBA 2VUBA 2L5QA 2DO3A 4XTVA 3MEAA 5GAN4 1VQ9T 4ELYC 5FU7C 2M9UA 4RG2A 3QYHB 2K4YA 2LVMA 4QQDA 3ASKA 3T9NA 4IUVA 5LJ5d 1VQNT 4PJOC 4N4IA 3WVDB 3L2QA 2WSCE 1JB0E 3A8GB 2KMTA 3M53A 3UDCA 4L59A 4Q5WA 2EQUA 2X35A 3JCMP 3OYEA 4BE0A 1IREB 4M7DC 1XOVA 4VUBA 3G7ZA 2OTJT 2GCXA 3JCMW 2LQKA 3CXCA 5EG2A 2ZPIB 3P8HA 2OTLT 4M7AA 4LDVA 3HKSA 3MEWA 3CCLA 4PKCC 5CQXA 1JJ2S 1UGSB 3DLLA 2RD1A 1Y71A 5GANd 4Y91A 2RI5A 3CCVA 1K73U 4C0ZA 1U8RA 1KQSA 3GOXA 3CBMA 2YRVA 3EFSA 2MWPA 2XD0A 2LT4A 2OAUA 1Q86U 1MGQA 4PJOG 4NL3A 1Q86C 4M78B 4NL2A 3E9FA 1M1GA 3RKWA 5LJ3d 1YI2T 2E6NA 4M78D 4C92C 2K5LA 3OS0A 4PJOE 2P0QA 1V29B 3MCAB 4LDWA 3UWNA 1QVGS 2RHYA 3SWNA 4A4GA 3NFCA 3CC2A 1YJNT 2XIDA 3CCSA 1NPRA 2DIGA 3M54A 4J5YA 4X9DA 2RK1A 1B34A 4MMKA 3P8DA 3BDLA 3OYBA 2LQ8A 2QQAA 1UGRB 2P0PA 3R6OA 2EQKA 2D0QB 2DTIA 2XG8D 4PL6A 4FM4B 5GMKh 5GAMj 2YLCA 2EAYA 2ZPEB 3HFOA 3JRZA 1QP2A 4PLLA 5CQYA 2WACA 3JCMc 4C92F 4QVCA 2QA4T 3KBGA 2BIVA 4M7DA 1Y07A 1BIAA 4V2SA 2HAXA 2M16A 1YITA 3WXMB 4MZMA 5GANe 1GXIE 2HD0A 2KAFA 4MZPA 1YJ9A 1AHJB 3E1SA 4HA8A 4F7UB 2X4XA 2I2LA 4BY6C 3LGFA 3VU3C 1Q82U 4BUGA 4M78G 1G3TA 1N9SA 5C0MA 3OMCA 4XU0A 2WSEE 2A7YA 2EYQA 4OF1A 5AYFA 2LRQA 2R58A 4M77D 3LLRA 4WF2A 2XK0A 3CC4A 4LDYA 1FWZA 1Q81C 1QVPA 1G3YA 4M7DB 2E12A 3EFRA 2EFIA 2QQSA 2MWOA 1BI3A 4KUIA 5CIUA 4R56A 2F5KA 3I55A 2MAMA 1VQKT 4BDYA 5HK0A 2RI3A 2IVWA 5D6WA 1N8RC 4D6WA 1ZBXA 2V8IA 4RCCA 4O6JA 3ZFJA 4RCBA 5KCHA 4IUTA 2P0KA 3C94A 2DAQA 4BI3A 5FRMA 3L2VA 2NLUA 3OW2S 3OBYA 4JLGA 3BDUA 4NOYA 3LH0A 2QTXA 3A8HB 1WPYA 4OGCA 3X20B 5LJ5g 4BDZA 3JCMh 2C06A 1WQ7A 1OI1A 4OMFB 4M7DF 4M7AD 3LX7A 4Z02A 3A8LB 5GMKi 4ZN3A 1QVFS 4A4HA 4J8OA 2HBPA 2YLBA 3OBWA 2LT1A 5CKFA 1JJ2A 5LL6S 4IKFA 1NE8A 4R55A 2EJ9A 2L3RA 2DTHA 2LC4A 3CC4T 1VQ8A 3OYCA 3OMGA 3X25B 2CKKA 4F7UG 1BYMA 3MHXA 4C92B 3OYHA 3OYLA 5HY6A 4ZGJB 1VQ5A 1WJRA 4Y28E 2FB7A 3JB9J 1M1KC 1WJQA 2PU9B 4XTYA 1LJOA 5GAMe 1YITT 2X4YA 4NS5A 5CCAA 4XTXA 2K5FA 5A0DA 2RJEA 3RIRA 3CPWS 1BI1A 3X26B 3QSUA 3E9GA 3SDZA 2VC8A 1S72T 1Q82C 3VUBA 2RK2A 5DM7R 3CC7A 1DJ7B 5GANj 4L5GA 3QJYA 4A54A 2JN0A 4M75G 3GIBA 1R8OB 2ZCFB 1WJSA 4QQ6A 3J80E 2ZPGB 1UGPB 1ZQ1A 3QUIA 1I81A 4C92A 5I21A 4M75F 1VQ7T 5CKHA 4HCCA 5LJ3j 1X75C 2LCLA 3QIIA 3M58A 2WSFE 2F69A 3VJPA 2PVOB 1VQOA 4BD3A 1KQSS 3KUFA 2VV5A 1KQ1A 2EWNA 5LJ3h 4BB7A 2FVUA 2DIQA 3PTAA 3NTIA 1KQ2A 1M8VA 4J7FA 3BFMA 2EKOA 5IAYA 3FC3A 3G4SA 4EMGA 3JCMJ 5IN1A 3A8MB 1HK9A 3BY7A 4JDSA 2CS7A 4EMKC 2O4XB 2DEQA 2Y4XA 2DJZA 4FSXA 1M90U 2XDDA 1VQOT 2E70A 2EJFA 2QI2A 5KCOA 5CR2A 5GAMd 2JZ2A 4LDXA 4B9XA 2D6FA 3CCLT 3CMEA 2DXTA 4CRIA 4QW2A 3SD4A 3M59A 3FLGA 4C5IA 3OYDA 1OZ3A 3HRTA 4C8QE 1D3BB 3V8KA 2DD4A 3J81E 3I55T 4A4EA 2VYTA 5LJ5h 2QQ9A 3RMSA 2EQMA 4UC4A 1YBYA 4XU3A 2E5QA 1Q7YC 1YJNA 3OYJA 5CK9A 2KK4A 1Y96B 3A5ZB 3OSVA 3META 4J7IA 4C8QG 3FB9A 1VQ9A 3V7SA 3OYNA 3ME9A 4CI0C 4HT8A 3LYIA 2DXUA 3FEOA 4X9CA 3GNGA 2V8JA 2MMPA 4XAXB 3CCMA 5DY9A 2DD5A 5GAMf 5D6YA 4E7IA 1QW1A 3CBPA 1HXDA 1W4SA 2L89A 3HHTB 3FJPA 3QHSA 3PNWC 4M77E 5A2QE 2YHTA 3CCVT 3QZ9B 3JCMX 5GAN5 1M1FA 2K3XA 2RJCA 3OSSC 2JNGA 2XKOC 4FU6A 3TEEA 1NZ9A 2XI9A 3M4GA 4ZGDB 4BE2A 2V8KA 1YJWA 3QDRB 3RESA 3OYAA 1B34B 1K73C 4JUVA 1FXXA 1NJIU 4N0AC 1VQ5T 3G71T 3CPWA 5LJ3e 3JB9F 1VQLA 4XTUA 3OB9A 3QO3A 4C0DB 4GLKA 2JTMA 3M55A 1BKBA 2E6ZA 3CC2T 3OYFA 3LWHA 1FX7A 4PLIA 1KC8U 1VQLT 1XQHA 4BI4A 4MDWA 4JRIA 5FU6C 4PJOD 2LCCA 3HL8A 2M1HA 5D6XA 4C0DC 4E7HA 4B9WA 3QPHA 3CC7T 3PMIA 4M77A 1YJWT 3E19A 2G3RA 5GAOn 3CCRA 2D9TA 3MEVA 4QVDA 2RJDA 3CMAT 3MP1A 2BKDN 4EMKA 2QEXT 4C8QB 4E7JA 3CCRT 1G3SA 5I2MA 5FU7B 5HKCA 1VQPT 3M56A 4BACA 2VXEA 3CXCS 5GANh 3QYGB 2K5IA 1JRIA 2CZ0B 5LJ3g 4OB2B 3I56T 4M7AB 1H641 5GAOm 4C8QC 4P5NA 1Q7YU 3M9QA 1LNXA 2R5AA 2Y4YA 1X6OA 1Y96A 5J26A 1VQ4T 1VQPA 2AHJB 3SWNC 3V7CA 3G6ET 4ZGEB 2DXCA 3H6ZA 1RI0A 1N27A 3QG1A 5CKEA 1VIFA 3JCMb 5GAOp 3CCJT 2LNVA 2MI6A 4C8QA 1XNIA 3LGLA 1K9MU 2XDPA 2RH2A 3BW1A 4XK8E 4M7DE 2ZZDA 4JS4A 4C5EA 2RHZA 3NTKA 4C5GA 1UB4A 1SSFA 3X24B 3FRNA 5GAOl 1VQMA 1K8AC 5CAIA 3C95A 3MEUA 4M75C 4XU2A 3ZEHA 4PJOF 5GMKj 4KULA 5GMKm 1YIJT 2QQRA 1VQ6T 3Q1JA 3PFSA 3VYGA 2DXBA 3WVEB 2F5TX 2X4JA 4KBMB 5KH6A 3G6EA 2CZ7B 1UEBA 2DVEA 2ZPFB 3TU4K 2RJFA 4E7KA 3JCMQ 5FRNA 1M5Q1 1WQWA 3M4YA 1BIBA 3I56A 4C92G 3JCMV 4ZN1A 2VGMA 5LJ5j 2JUFA 5IT9E 4C0GA 1TH7A 3HRUA 4F7UF 3CCQT 1KHIA 4FT4A 2CZ6B 4QQGA 5GMKl 3L2RA 2QEXA 4N4GA 1I4K1 2DPPB 2EJGA 5GAMg 2PUKB 2RB6A 3OA6A 4C92E 4E7LA 3QKJA 2CZ1B 3INZA 2JVVA 4XTZA 4N4HA 4M7AG 4YTLA 2DKGA 2OTLA 4OB0B 5M9OA 3PT9A 3PIPA 2FL7A 4ELZC 3CPFA 1PSEA 2L8DA 2QQBA 2XICA 4OP0A 5C6SA 4M77C 3S3MA 4M7AE 4QVZA 1YJ9T 4JJNK 2XDBA 4FIBA 3QBYA 1KHCA 4GY5A 3OYKA 3F70A 3GP8A 2E65A 3PMTA 1W2BS 4J6YA 4II1A 3S3OA 3G71A 2P4TA 3OQ5A 1D3BA 3TCJA 2FHDA 3ER0A 4EMKB 3PIOA 3CMAA 1XTDA 1U1TA 3L2WA 4E47A 5GAN8 1KD1U 5L8RE 2VGNA 3UT1A 2B8AA 4ATOA 4ZTJA 2HQEA 1JBMA 3MO8A 4RG8A 3CCST 3OW2A 3LWIA 2LX9A 3GNFB 1VIEA 1QP3A 4FL6A 4MMLA 4XU1A 3HRSA 3KXTA 2RHUA 4PJOB 5CKDA 3ZBDA 5CVIA 4M78C 3X28B 4PNOA 3M57A 4XTWA 3HFNA 5KE2A 3CCEA 1NPPA 2GFAA 1YI2A 5LJ3f 1MHNA 3L2ZA 2Y90A 5FLXE 2DZ9A 3H8ZA 3JB9I 3G4ST 3S6WA 2CYZB 3HP9A 2R5MA 4JRKA 1WNLA 5CO7A 1IZ6A 1Y7XA 3TREA 5GMKe 3JAME 1K8AU 3GPLA 4C8QF 3RERA 5DLOA 1EIFA 3VKIA 3OYGA 3CCUA 3DB4A 4IUUA 3CCMT 1G5VA 2E10A 1KG1A 3M5AA 4KT0E 4XQ3A 4RKUE 5LJ5e 1Q81U 3CD6A 3JB9G 3QZ5B 1I8FA 3PGGA 3SB2A 2K2VA 3RMQA 3SFMA 1S72A 4M7DG 2E41A 2A3LA 4M77F 2EIFA 5GAOr 3L2UA 5GANg 3FIFA 2LTOA 3JB9D 4EMHA 5FU6B 2DK3A 2H3JA 5FROA 2DZCA 3MP6A 4HKEA 2KVQG 1M9SA 3DKMA 5LJ5f 5GANf 3AHUA 1YHQA 3OS5A 2K57A 3DLMA 2QDYB 3OY9A 4HT9A 1VQ7A 5GAN7 1OYXA 2PVGB 4F7UA 3FDRA 4M75A 4ME7A 2K3YA 3QXEB 4L6V5 4DQ2A 3CD6T 3JB9H 2RI2A 1N9RA 3C12A 2DTOA 2KDSA 3RKYA 2PQWA 4DOWA 1H3ZA 1QVGA 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  5LJ3 h;  5GAO l;  3JCM e;  4M78 D;  2E64 A;  4C8Q D;  4C92 C;  5CAI A;  5GAN 6;  4M75 C;  4XU2 A;  5GMK j;  5GMK m;  4PJO F;  4PJO E;  4J6W A;  3RUX A;  1KQ2 A;  2VXF A;  1M8V A;  3BFM A;  3SWN A;  4M77 G;  4EMG A;  3JCM J;  4J5Y A;  3JCM g;  1HK9 A;  3BY7 A;  2E1H A;  2DVE A;  4X9D A;  4EMK C;  1B34 A;  2DEQ A;  2DJZ A;  2HNI A;  4MMK A;  4JLI A;  3JCM f;  3JCM Q;  1M5Q 1;  1WQW A;  4M7A F;  1BIB A;  3RKX A;  4M7D D;  4C92 G;  3JCM V;  5LJ5 j;  2EJF A;  5GAM d;  4PJO A;  2DTI A;  1TH7 A;  5GMK h;  2YLC A;  2DXT A;  2EAY A;  3HFO A;  4F7U F;  3JCM c;  4QVC A;  5GMK l;  5GAM j;  4M75 D;  4C92 F;  5GAN 3;  1I5L A;  1I4K 1;  4M7D A;  5GAM g;  2EJG A;  4M75 B;  2RB6 A;  5GAM h;  1BIA A;  4V2S A;  4C92 E;  4C8Q E;  1D3B B;  3INZ A;  4M75 E;  3V8K A;  1LOJ A;  4XTZ A;  4F7U E;  5GAN e;  4M7A G;  2DKG A;  4M7A C;  5LJ5 h;  3L1A A;  3HSB A;  4HA8 A;  4F7U B;  2I2L A;  3VU3 C;  4XU3 A;  4OP0 A;  4M78 G;  1N9S A;  4M77 C;  2RA2 A;  4M7A E;  4XU0 A;  1Y96 B;  4A53 A;  4C8Q G;  3FB9 A;  2E65 A;  4J6Y A;  3V7S A;  4M77 D;  4WF2 A;  4HT8 A;  1U1S A;  2DXU A;  4N0A A;  1D3B A;  4X9C A;  4EMK B;  3EFR A;  5DY9 A;  1U1T A;  2CGH A;  5GAM f;  3V8L A;  5GAN 8;  1HXD A;  3QHS A;  3FJP A;  4C92 D;  4M77 E;  2YHT A;  4M7D B;  4RCC A;  1JBM A;  4RCB A;  4M77 B;  3JCM X;  5GAN 5;  2ZGW A;  4M78 E;  3M4G A;  1YCY A;  4MML A;  4XU1 A;  3RES A;  3BDU A;  1B34 B;  4NOY A;  3V8J A;  2QTX A;  4JUV A;  4PJO B;  2RM4 A;  1WPY A;  5LJ5 g;  4N0A C;  5GAN 2;  4M78 C;  3JCM h;  4PNO A;  3RKW A;  4XTW A;  3HFN A;  1WQ7 A;  5LJ3 e;  3JB9 F;  4M7D F;  4M7A D;  5LJ3 f;  4XTU A;  3SWN B;  5GMK i;  3L2Z A;  3QO3 A;  2Y90 A;  4J6X A;  3V7R A;  2DZ9 A;  5GAO q;  3JB9 I;  2YLB A;  2FYK A;  4JRK A;  1X01 A;  5GMK e;  1WNL A;  3JCM d;  4M78 F;  2EJ9 A;  4JRI A;  4C8Q F;  2DTH A;  4M78 A;  3RER A;  4PJO D;  4XTV A;  5GAN 4;  4F7U G;  4M77 A;  4C92 B;  2E10 A;  5LJ5 d;  5GAO n;  4QVD A;  4PJO C;  4XQ3 A;  4EMK A;  2FB7 A;  5LJ5 e;  3JB9 G;  3SB2 A;  1I8F A;  3PGG A;  4C8Q B;  3JCM P;  3JB9 J;  4XTY A;  1LJO A;  5GAM e;  4M7D C;  2VXE A;  4M7D G;  2E41 A;  4M77 F;  4XTX A;  5GAN h;  5GAO r;  3RIR A;  5GAN g;  1JRI A;  5LJ3 g;  3FIF A;  3JCM W;  3JB9 D;  4M7A B;  4EMH A;  1H64 1;  5GAO m;  3QSU A;  2VC8 A;  4C8Q C;  2DZC A;  3AHU A;  1LNX A;  5LJ5 f;  5GAN f;  4M7A A;  1Y96 A;  5GAN j;  2K57 A;  3SWN C;  3V7C A;  4A54 A;  2JN0 A;  4HT9 A;  4M75 G;  2RD1 A;  5GAN d;  5GAN 7;  3GIB A;  4Y91 A;  4F7U A;  3JCM b;  5GAO p;  4M75 A;  3QUI A;  3JB9 H;  4C8Q A;  1I81 A;  3EFS A;  4C92 A;  4M75 F;  4DQ2 A;  5I21 A;  1N9R A;  3BW1 A;  4M7D E;  2DTO A;  3RKY A;  5LJ3 j;  1MGQ A;  4PJO G;  4NL3 A;  4M78 B;  4NL2 A;  5LJ3 d;  1KQ1 A; 
#chains in the Genus database with same CATH topology
 4IUR A;  2CDT A;  2PVD B;  4C8Q D;  4RTU A;  1MNE A;  1FMW A;  2VXF A;  1ABO A;  4ZTF A;  2YT6 A;  4C5H A;  1NJI C;  4JRQ A;  2MF2 A;  1N6A A;  4J83 A;  3CCJ A;  2L3S A;  4ESR A;  2GFU A;  2JTF A;  3EAE A;  5J39 A;  1OU9 A;  2K2M A;  3HTR A;  5FWB A;  2X4W A;  3DB3 A;  2KQW A;  4M7A C;  1LOJ A;  3CEY A;  1SRM A;  1PKT A;  1OZ2 A;  3OYY A;  2XHC A;  4A53 A;  2AZS A;  3VV0 A;  4BI8 B;  1U1S A;  4HCB A;  4LN2 A;  1YHQ T;  1IXD A;  3VRY A;  3NPF A;  1YIJ A;  2K6D A;  2GQV A;  4WTO B;  4M7D B;  3UPU A;  1VQM Q;  3CC4 Q;  3VS3 A;  3N5B B;  3MKD A;  1D0X A;  1YCY A;  2GBQ A;  2JMA A;  1VQN A;  2RQV A;  4MDX A;  2RM4 A;  2DER A;  4IIO A;  2RHI A;  2GTO A;  4Y92 A;  1VQP Q;  1BI2 A;  1X01 A;  3JCM d;  3C4S A;  4OGE A;  2JTE A;  4DBR A;  1VQ9 T;  4AFQ C;  4JJD A;  3QYH B;  4QQD A;  2HEQ A;  5LJ5 d;  2JXB A;  3QDF A;  2MK5 A;  3UDC A;  2EQU A;  3JCM P;  3OYE A;  4BE0 A;  2DFU A;  2AIR B;  4VUB A;  1VYT A;  3CXC A;  2OTL T;  4M7A A;  4PKC C;  1AWJ A;  4KGX B;  4PJN A;  1T3S A;  2RD1 A;  1Y71 A;  5GAN d;  2LJ1 A;  3GOX A;  1IO6 A;  3CCV Q;  1VQN Q;  4PJO G;  2LNH B;  1Z9Q A;  4PJO E;  2P0Q A;  3MCA B;  4LDW A;  1NLP C;  1D1A A;  1G8X A;  3NGP A;  4J5Y A;  1RAG B;  2KT1 A;  3P8D A;  2KGT A;  2OX7 A;  2EAY A;  3HFO A;  3JRZ A;  5CQY A;  1FMK A;  1QP2 A;  1AWO A;  4C92 F;  2CT3 A;  2QA4 Q;  1X2K A;  1RAH B;  1GXI E;  2HD0 A;  3D7S B;  4MZP A;  1YJ9 A;  3NHN A;  3VU3 C;  4BUG A;  1N9S A;  5C0M A;  2YUQ A;  3OMC A;  1VQ4 Q;  2WSE E;  1S1N A;  1CKA A;  2R58 A;  4WF2 A;  2E3H A;  4LDY A;  1QVP A;  3EFR A;  2EFI A;  4R56 A;  4KUI A;  3I55 A;  2F5K A;  4PJL A;  2JS2 A;  1VQK T;  1N8R C;  1M3B A;  4D6W A;  2L2P A;  4O6J A;  1X2Q A;  2DYB A;  2EYY A;  2P0K A;  3C94 A;  4BI3 A;  2OAW A;  2QTV A;  5LJ5 g;  2C06 A;  4OMF B;  4M7D F;  3TSW A;  3A8L B;  2DL7 A;  2YWW A;  3EGX B;  4A4H A;  5IHN A;  5KYN A;  2HBP A;  4J9B A;  1JJ2 A;  5LL6 S;  4R55 A;  2YSQ A;  2CKK A;  4C92 B;  1CKB A;  4PJM A;  3CD6 Q;  1OQK A;  4Y28 E;  2FB7 A;  4LXC A;  2C0T A;  2KXD A;  4XTY A;  1LJO A;  5A0D A;  1BI1 A;  3X26 B;  3SDZ A;  1W6X A;  1BCM A;  1Q82 C;  5DM7 R;  5GAN j;  2ZAE A;  3QJY A;  1R8O B;  1ZSZ A;  4J9D A;  5I21 A;  4M75 F;  5LJ3 j;  1TUC A;  1X75 C;  2FZK B;  1VQ7 Q;  2F69 A;  1NEB A;  1KQ1 A;  1GFD A;  4QT7 A;  1NYG A;  5IAY A;  1SHF A;  1JO8 A;  2M51 A;  1B3Q A;  2O4X B;  2DEQ A;  1M90 U;  2RQW A;  5EC7 A;  4GLM A;  1QLY A;  5CR2 A;  2DRK A;  4B9X A;  2DX1 A;  2A37 A;  3CCL T;  1RAB B;  2SRC A;  4QW2 A;  3SD4 A;  2CT4 A;  2ESW A;  2DD4 A;  2VYT A;  5LJ5 h;  2QQ9 A;  3BE3 A;  3RMS A;  4UC4 A;  2J6O A;  2E5Q A;  1Q7Y C;  3OYJ A;  1ZSZ C;  3A5Z B;  1ZA2 B;  1D0Z A;  1AWX A;  3EH2 A;  4XAX B;  2DYI A;  5GAM f;  4E7I A;  2LQW A;  2JMC A;  1WLP B;  2L89 A;  2KRM A;  2QYZ A;  1M1F A;  3OSS C;  2BE7 D;  4AFU C;  2XKO C;  1X6B A;  1NZ9 A;  2XI9 A;  2O31 A;  2CP7 A;  1C0M A;  4A63 B;  1B34 B;  4JUV A;  4N0A C;  1VQ5 T;  3G71 T;  4D8D A;  1VQL A;  1XJW B;  4FYV B;  4GLK A;  1FX7 A;  1VQL T;  5FU6 C;  2LCC A;  1IRX A;  1HD3 A;  1KSW A;  3EHR A;  1JJ2 P;  1ARK A;  2RQR A;  4DBF A;  4C8Q B;  2VWF A;  4E7J A;  1N5Z A;  5I2M A;  2SEM A;  2VXE A;  1UJY A;  1CSK A;  3I56 T;  1H64 1;  2LJ3 A;  5GAO m;  4C8Q C;  3G6E T;  4ZGE B;  1GRI A;  5KYU A;  1VIF A;  3RDV A;  2MI6 A;  4GBQ A;  3LGL A;  1K9M U;  2ZZD A;  1K9A A;  1X6G A;  3U23 A;  1VQK Q;  4C5E A;  3NTK A;  2COZ A;  3X24 B;  5GAO l;  5CAI A;  2F2V A;  3MEU A;  4M75 C;  5GMK j;  2QQR A;  3VYG A;  2LCS A;  2CZ7 B;  1IGU A;  1UEB A;  2DVE A;  1I0C A;  1W1F A;  4OML A;  2GTJ A;  2X3X D;  5FRN A;  2E4H A;  3M4Y A;  2EW3 A;  1BIB A;  1LVK A;  2VGM A;  3EHQ A;  5GJW B;  5KYW A;  4FT4 A;  2CZ6 B;  5GMK l;  1I4K 1;  2DPP B;  5GAM g;  2X3W D;  3QKJ A;  4OMQ A;  1IGQ A;  2JM8 A;  4YTL A;  4M4Z A;  1NM7 A;  2FL7 A;  3CPF A;  3S3M A;  4OP0 A;  1Q81 R;  3H0I A;  1YJ9 T;  2KE9 A;  1KHC A;  1W2B S;  4II1 A;  2P4T A;  3QWY A;  6AT1 B;  1YIJ Q;  1D3B A;  3TCJ A;  3PIO A;  3CMA A;  1XTD A;  1Z9Z A;  4E47 A;  4PFZ A;  2FRY A;  1W70 A;  4ATO A;  4ZTJ A;  3MO8 A;  4RTV A;  3OW2 A;  3M0T A;  4F14 A;  3E2U A;  3LWI A;  4DEX A;  3GNF B;  4FL6 A;  3HRS A;  3KXT A;  2RHU A;  1M3C A;  5CKD A;  4JZ3 A;  4M78 C;  3CCE A;  1SG5 A;  1NPP A;  1WHG A;  3JB9 I;  3TRE A;  3HP9 A;  5CO7 A;  1K8A U;  3ZL7 C;  2PZ1 A;  3DB4 A;  4IUU A;  1G5V A;  1V76 A;  1AWW A;  3M5A A;  1LCK A;  4RKU E;  1Q81 U;  4F16 A;  3SB2 A;  2K2V A;  1UUE A;  4M7D G;  1YCS B;  2A3L A;  5GAO r;  5FU6 B;  4HKE A;  3AHU A;  2KVQ G;  1M9S A;  3DLM A;  4HVV A;  4M75 A;  4L6V 5;  4DQ2 A;  3CD6 T;  1TUG B;  3RKY A;  3A1P A;  4J9E A;  1YJN T;  2E3I A;  3EGD B;  1KD1 C;  3VS0 A;  3LH5 A;  2E64 A;  1IHW A;  4DOV A;  2FO0 A;  3J7A F;  5KE3 A;  3P8B B;  4M77 G;  1FYN A;  4JRP A;  2HNI A;  3CCE T;  1RAF B;  2V1R A;  1VQ5 Q;  4M7A F;  2LX7 A;  4A4K A;  5GJV B;  2R57 A;  2H3E B;  1TG0 A;  3JSC A;  5GAN 3;  1O9S A;  5GAM h;  3NTH A;  1R0B G;  4LD9 K;  2KRN A;  4BE1 A;  4HCK A;  3L1A A;  4EDU A;  4O5V A;  1AZE A;  3OS1 A;  2RA2 A;  4WCI A;  2PNI A;  1BK2 A;  2RHX A;  3VS1 A;  2EQJ A;  1P92 A;  2KSS A;  3CCS Q;  2LDM A;  1N8R U;  4FT2 A;  2M0O A;  4C92 D;  2O01 E;  2IG0 A;  4OB3 B;  4IUQ A;  4TVR A;  1VQK A;  4LD6 A;  2DBK A;  1BB9 A;  3EG1 A;  1ZHI A;  5GAN 2;  2DF6 A;  1M90 C;  2MIO A;  2OTL Q;  3L42 A;  3OYM A;  1NJI R;  1YIT Q;  2GF7 A;  2QXF A;  2FYK A;  2PUO B;  4M78 F;  5J3B A;  1JQQ A;  1U8R A;  4LDU A;  4XTV A;  2KNB B;  2EYZ A;  1VQN T;  1AEY A;  2K4Y A;  2CH4 W;  4PJO C;  2KXC A;  3L2Q A;  3A8G B;  3M53 A;  2EQI A;  4L59 A;  3NMZ C;  4Q5W A;  1IRE B;  2FG0 A;  2LQK A;  2ZPI B;  3P8H A;  1B07 A;  2C0I A;  2J7I A;  3HKS A;  2XMF A;  1NLO C;  1UGS B;  3DLL A;  4Y91 A;  1K73 U;  4C0Z A;  3RNJ A;  2HCK A;  2YRV A;  3EFS A;  2XD0 A;  1R0C B;  2LT4 A;  1K4U S;  3EG3 A;  4CC3 A;  4NL3 A;  1Q86 C;  4M78 B;  3RKW A;  3E9F A;  3CCL Q;  2E6N A;  1R77 A;  3H0H A;  3SWN A;  4A4G A;  3CC2 A;  1HSQ A;  4OMN A;  4X9D A;  3THK A;  1B7T A;  2Z0W A;  2P0P A;  3R6O A;  2EQK A;  2D0Q B;  1RUW A;  4FM4 B;  4PLL A;  2ZPE B;  2AKK A;  3JCM c;  1SEM A;  3KBG A;  1K0X A;  1Y07 A;  1BIA A;  1Q82 R;  2HAX A;  2EGC A;  1AHJ B;  1VQ6 Q;  2X4X A;  2I2L A;  1KJW A;  1D1C A;  1TUD A;  1Q82 U;  4M78 G;  1G3T A;  2J06 A;  4XU0 A;  1NYF A;  1QQJ A;  4OF1 A;  3EG9 B;  2LRQ A;  1OV3 A;  4OMP A;  2XK0 A;  1FWZ A;  1Q81 C;  1G3Y A;  2E12 A;  3CCR T;  1PRL C;  2HZY A;  2MAM A;  4JJB A;  5HK0 A;  2D1X A;  2V8I A;  5KCH A;  2DAQ A;  3L2V A;  3OW2 S;  9ATC B;  3LH0 A;  2QTX A;  3X20 B;  1PRM C;  1RAD B;  3LX7 A;  1QKX A;  4EIK A;  4ZN3 A;  1QVF S;  1WHH A;  2HBW A;  4IKF A;  1NE8 A;  2EJ9 A;  2LC4 A;  1MV3 A;  3CXC P;  2CH4 A;  1WJR A;  1ZSZ B;  5ECA A;  4HVU A;  1JXO A;  4XTX A;  3RIR A;  3PVQ A;  2ENM A;  3VUB A;  1C6V X;  2RK2 A;  2AKL A;  3CC7 A;  1DJ7 B;  4L5G A;  1M3A A;  1TU0 B;  4M75 G;  3GIB A;  2ZPG B;  1UGP B;  3QUI A;  1I81 A;  4C92 A;  8AT1 B;  3QII A;  2LCL A;  4AFS C;  2WSF E;  4RTZ A;  1C1A A;  1KQS S;  3KUF A;  1E6H A;  1I07 A;  5KYW B;  1KQS P;  2CP0 A;  2FVU A;  2DIQ A;  1M8V A;  4J7F A;  3BFM A;  5IXB A;  3FC3 A;  3JCM J;  5IN1 A;  2K3B A;  3A8M B;  1SF9 A;  2COW A;  2FEI A;  2E70 A;  2QI2 A;  2EPD A;  4LDX A;  2KRS A;  2D6F A;  2A0F B;  1WIE A;  3OYD A;  1W2B P;  1PHT A;  3HRT A;  2LMJ A;  2EQM A;  4XU3 A;  2VVK A;  1VQ9 A;  4CI0 C;  2RN8 A;  3FEO A;  4X9C A;  2V8J A;  2MMP A;  3CCM A;  5FW9 A;  1WXT A;  4RUG A;  1QW1 A;  3CBP A;  3QHS A;  3PNW C;  4M77 E;  1K73 R;  3OW2 P;  4ZGD B;  2KYB A;  3M4G A;  1YJW A;  1SHG A;  1M1K R;  1FXX A;  2FZG B;  3JB9 F;  5I11 A;  1QVG P;  4XTU A;  3OB9 A;  3QO3 A;  3VS6 A;  3CC2 T;  3OYF A;  3LWH A;  4PLI A;  1KC8 U;  4BI4 A;  4MDW A;  2KYM A;  2M1H A;  3HL8 A;  4B6M A;  2QGG A;  4B9W A;  1SPK A;  4M77 A;  2DLP A;  4J9F A;  3MEV A;  4QVD A;  1G2B A;  1ABQ A;  4FYY B;  2BE9 B;  1VQP T;  2KEA A;  5GAN h;  1TXQ A;  4F04 B;  4M7A B;  3M0S A;  1VQ4 T;  1LNX A;  2Y4Y A;  1VQP A;  1Y96 A;  3V7C A;  3H6Z A;  4F17 A;  2LNV A;  4C8Q A;  1JXM A;  3BW1 A;  2VKN A;  4JS4 A;  2DRM A;  2RHZ A;  2DM1 A;  1UB4 A;  1SSF A;  1E7O A;  1VQM A;  3ZEH A;  2J6K A;  4KUL A;  2LQN A;  3PFS A;  3G6E A;  2X4J A;  4J9I A;  3TU4 K;  2L0A A;  3JCM Q;  1T0J A;  1M5Q 1;  1RAE B;  1H8K A;  4ZN1 A;  3SHW A;  4C0G A;  1UTI A;  1KHI A;  3L2R A;  2QEX A;  1TWB A;  1QMC A;  4C92 E;  4XTZ A;  4M7A G;  2DKG A;  1EFN A;  1D1B A;  3PT9 A;  3PIP A;  2O2O A;  1PSE A;  3CME Q;  4M77 C;  4M7A E;  4PFP A;  4JJN K;  2XDB A;  4GY5 A;  1K76 A;  2O9S A;  1WX6 A;  2H8H A;  3ER0 A;  2AT1 B;  1U1T A;  2HKQ B;  3L2W A;  3CCM Q;  3UT1 A;  1JBM A;  4RG8 A;  1VQ9 Q;  1QP3 A;  5AT1 B;  4MML A;  1X43 A;  2MOX A;  1VA7 A;  2X9H A;  5IHK A;  5CVI A;  4PNO A;  3M57 A;  3UF4 A;  3HFN A;  5KE2 A;  1YI2 A;  2GFA A;  1MHN A;  2DL3 A;  5FLX E;  2DZ9 A;  3H8Z A;  2CYZ B;  3GPL A;  3RER A;  3VKI A;  1GL5 A;  1BBZ A;  2E10 A;  3RR6 A;  4KT0 E;  4XQ3 A;  4JZ4 A;  3CCU Q;  8ATC B;  3SFM A;  1KFZ A;  2E41 A;  2MCN A;  5GAN g;  2LTO A;  1VYV A;  2H3J A;  2JJ9 A;  5FRO A;  3MP6 A;  5GAN f;  3OY9 A;  1OYX A;  3FDR A;  4ME7 A;  3QXE B;  1AVZ C;  2CUD A;  3C12 A;  2DL8 A;  4Z89 A;  4DOW A;  1H3Z A;  3CC7 Q;  1OX9 A;  3HPW A;  3JCM e;  3H41 A;  1PSF A;  5GAN 6;  3RUX A;  2O4X A;  3MP8 A;  3M0U A;  3PE0 A;  1S72 Q;  1VOM A;  2E1H A;  1W2B A;  4C0F A;  3JCM f;  4JLI A;  3TQ7 P;  4M7D D;  3TSZ A;  3GLX A;  4M75 D;  1WZO A;  1I5L A;  1KC8 R;  4RMO A;  4IUP A;  3VS5 A;  1UGQ B;  1MND A;  3HSB A;  1RAI B;  4OB1 B;  2HQX A;  3VYH B;  3OS2 A;  1YP5 A;  2OJ2 A;  3QJ6 A;  1WDX A;  1MUZ A;  3I56 Q;  3A8O B;  3URG A;  3C0C A;  1O75 A;  3SEM A;  2KY9 A;  1KIK A;  3V8L A;  2BZX A;  4HCZ A;  2PTK A;  4RTX A;  1K8A R;  1VUB A;  3CCQ A;  1KC8 C;  4DA4 A;  4M77 B;  4MZT A;  1RL2 A;  1G3W A;  2BUD A;  1ZUU A;  2XU8 A;  1RLQ C;  3EGX A;  4OVA A;  3S3N A;  1U5S A;  1WHJ A;  1VQ6 A;  3GF5 A;  5IHI A;  3SWN B;  3CME T;  3V7R A;  5I2S A;  1M1K U;  1VQ8 T;  1NEG A;  1KD1 R;  2KBT A;  3PTA A;  1VQ6 T;  1M4Z A;  4M78 A;  4A4F A;  5CKB A;  2VUB A;  5GAN 4;  2NUP A;  2M9U A;  3ASK A;  4IUV A;  1SRL A;  1RAC B;  2KMT A;  1ZX6 A;  3CCR Q;  1V1C A;  2DJQ A;  4M7D C;  3CC2 Q;  1XOV A;  3G7Z A;  3JCM W;  5EG2 A;  2EKH A;  3UAT A;  2BTT A;  3CCL A;  2JS0 A;  2LJ0 A;  2MWP A;  3KFV A;  1Q86 U;  3UA7 A;  4NL2 A;  3RBB B;  1YI2 T;  3CCQ Q;  4M78 D;  1YFN A;  2A08 A;  1V29 B;  3UWN A;  1QVG S;  1Y57 A;  1PD1 A;  2A36 A;  1B34 A;  4MMK A;  3BDL A;  1WXU A;  2DTI A;  2XG8 D;  4PL6 A;  1Q7Y R;  1YJN Q;  5GAM j;  2YLC A;  4QVC A;  2BIV A;  4M7D A;  4V2S A;  5KYU B;  1YIT A;  4MZM A;  5GAN e;  2YUO A;  2DNU A;  4PK4 A;  2CRE A;  3CQT A;  2A7Y A;  2EYQ A;  1YN8 A;  4M77 D;  3LLR A;  1OU8 A;  4KH0 B;  2HMA A;  2QQS A;  5CIU A;  1UGV A;  2RI3 A;  2IVW A;  1ZBX A;  3ZFJ A;  4RCB A;  1UG1 A;  4JLG A;  5KYY A;  4NOY A;  3A8H B;  5HCK A;  1U3O A;  4BDZ A;  3JCM h;  1WQ7 A;  4M7A D;  1BCO A;  1H3H A;  2QDL A;  5CKF A;  1GFC A;  1E6G A;  1TOV A;  1AZG B;  3CC4 T;  3VRZ A;  3OYC A;  1WHL A;  3AT1 B;  3X25 B;  1BYM A;  1SSH A;  3OYH A;  3OYL A;  1VQ5 A;  4AMC A;  2YRC A;  1K9M R;  3JB9 J;  5GAM e;  2GNC A;  2DE0 X;  1YIT T;  3G4S Q;  4NS5 A;  1VQ8 Q;  2X51 A;  5CCA A;  2K5F A;  2RJE A;  3CPW S;  2D0N A;  2VC8 A;  4DBQ A;  4A54 A;  1PKS A;  2CSI A;  2ZCF B;  1WJS A;  4QQ6 A;  1YI2 Q;  4ZNX A;  1MMA A;  1ZQ1 A;  5CKH A;  2QK0 A;  1VQO A;  2CP5 A;  2D8J A;  1AOJ A;  4BB7 A;  4PFO A;  3NTI A;  2EKO A;  3G4S A;  3H0F A;  4EMG A;  2V26 A;  1K0S A;  1HK9 A;  3BY7 A;  2CS7 A;  2GGR A;  4EMK C;  2DJZ A;  1JEG A;  2XDD A;  5GAM d;  1EX4 A;  2JZ2 A;  3CME A;  2DXT A;  1MV0 B;  3M59 A;  4C5I A;  1OZ3 A;  3R6N A;  1M30 A;  3I55 T;  4A4E A;  1K1Z A;  4E2F B;  2JM9 A;  1YWP A;  3CCE Q;  1GCP A;  3OSV A;  4C8Q G;  3V7S A;  3OYN A;  3ME9 A;  4AT1 B;  3LYI A;  1UDL A;  2CP6 A;  5DY9 A;  2C0O A;  1I1J A;  1TSF A;  2F2W A;  3M0Q A;  3CMA Q;  1W4S A;  3HHT B;  3FJP A;  2YHT A;  2M0Y A;  1D09 B;  2VAS A;  3QZ9 B;  3JCM X;  2RQU A;  2K3X A;  2RJC A;  2JNG A;  3EG0 A;  1MMG A;  4FU6 A;  4BE2 A;  2V8K A;  3QDR B;  3RES A;  1NJI U;  5LJ3 e;  2L3P A;  2HKN A;  1JU5 C;  4C0D B;  3VS4 A;  4JRI A;  4PJO D;  4C0D C;  1T0H A;  1YJW T;  5GAO n;  1D0Y A;  2RJD A;  3CMA T;  2BKD N;  4EMK A;  2QEX T;  1G3S A;  5FU7 B;  5HKC A;  4J9C A;  2K5I A;  5LJ3 g;  4OB2 B;  2K9G A;  1U06 A;  1ZUY A;  1Q7Y U;  1M2O A;  5J26 A;  5CKE A;  1N27 A;  2ED0 A;  4E6R A;  3CCJ T;  2OTJ Q;  1RAA B;  1XNI A;  1A0N B;  1HYO A;  4XK8 E;  1YJW Q;  4C5G A;  1ZA1 B;  3FRN A;  1K8A C;  1UHF A;  4XU2 A;  4PJO F;  1HJD A;  1WI7 A;  3Q1J A;  3WVE B;  2F5T X;  5KH6 A;  4KBM B;  2F2X A;  3I5R A;  1WQW A;  4C92 G;  3JCM V;  5LJ5 j;  5IT9 E;  2DBM A;  1RI9 A;  3HRU A;  2J05 A;  2CSQ A;  4N4G A;  2GQI A;  2EYW A;  1NBE B;  2EJG A;  2PUK B;  2RB6 A;  2DMO A;  2CZ1 B;  4CC7 A;  4HVW A;  4KGZ B;  4AG2 C;  1VQL Q;  1M2V A;  1FMV A;  5C6S A;  2EYX A;  2OI3 A;  2KT8 A;  3OYK A;  3F70 A;  3GP8 A;  2E65 A;  1LPL A;  3G71 A;  2QG9 B;  2DIL A;  1QWE A;  2P4R A;  3H9N A;  3EH1 A;  5L8R E;  2VGN A;  2O9V A;  3O5Z A;  4ORZ A;  2HQE A;  3CCS T;  3ULR B;  2LX9 A;  1MMN A;  2CUB A;  1VIE A;  4XU1 A;  1WXB A;  1F1B B;  4PJO B;  3ZBD A;  1Q95 G;  3X28 B;  4XTW A;  2NUT B;  4FYW B;  4E7S A;  2QAZ A;  2Y90 A;  2QAS A;  3G4S T;  1OUL A;  1SKU B;  2HDA A;  5GMK e;  1Y7X A;  2YUN A;  5KYY B;  3JAM E;  4C8Q F;  5DLO A;  1IB8 A;  3VS7 A;  3OYG A;  2AZV A;  1KG1 A;  1QCN A;  3PVL A;  5LJ5 e;  3PGG A;  1QCF A;  1S72 A;  3L2U A;  4FW2 A;  3REA B;  2DZC A;  5LJ5 f;  2K57 A;  1VQ7 A;  4FSS A;  2PVG B;  4F7U A;  2K3Y A;  4J9H A;  2M02 A;  4IIM A;  1UJ0 A;  2KDS A;  2PQW A;  1GCQ C;  5IH2 A;  4J6W A;  3JCM g;  5HK3 A;  3G71 Q;  3I35 A;  3G1J A;  2NUT A;  3RKX A;  1X27 A;  3EFO B;  5DLQ E;  4PJO A;  3CCU T;  1BI0 A;  3EGD A;  3VUZ A;  1VQM T;  5A0L A;  2ATC B;  1QWF A;  4M75 B;  1J3T A;  4M75 E;  2JOY A;  4F7U E;  5A0G A;  2ZPH B;  1TS9 A;  3EG9 A;  3VS2 A;  4X34 A;  4EPC A;  3LW5 E;  1ACM B;  4N0A A;  4DBH A;  2CGH A;  1PM3 A;  4LE9 A;  3I55 Q;  2ECZ A;  3CBO A;  4CC2 A;  2FPF A;  3EGU A;  2J6F A;  4JS5 A;  2ROT A;  2ROL A;  2OTJ T;  1K9M C;  2RO0 A;  2YXY A;  2ZGW A;  4M78 E;  2EGE A;  2LZ6 B;  4DEY A;  1VQ4 A;  3V8J A;  1QVF A;  1Y0M A;  4LUE A;  1OOT A;  2OTJ A;  1YJ9 Q;  4KUD K;  2ZPB B;  4J6X A;  5GAO q;  1GBR A;  2P84 A;  1I5O B;  1EZZ B;  3O8V A;  2QA4 A;  1WGS A;  3OYI A;  2QEX Q;  2L5Q A;  2DO3 A;  2DL4 A;  3MEA A;  3QWX X;  4ELY C;  5FU7 C;  4RG2 A;  3T9N A;  2LVM A;  5I22 A;  2FPE A;  4N4I A;  3WVD B;  3REB B;  2WSC E;  1JB0 E;  4D8K A;  2X35 A;  2JW4 A;  3G6E Q;  2CP2 A;  2GCX A;  2JT4 A;  1PCX A;  3FJ5 A;  1RLP C;  2AK5 A;  4LDV A;  3MPU B;  1X69 A;  3MEW A;  1GCQ A;  5CQX A;  1JJ2 S;  1YWO A;  2RI5 A;  3CCV A;  1KQS A;  3CBM A;  4CC4 B;  2FZC B;  2OAU A;  1MGQ A;  2I0N A;  1M1G A;  5LJ3 d;  2MYS A;  4C92 C;  2K5L A;  3OS0 A;  4R0K A;  2RHY A;  3NFC A;  3CPW P;  4ANJ A;  2XID A;  3CCS A;  1NPR A;  2DIG A;  3M54 A;  2RK1 A;  3OYB A;  2LQ8 A;  1UE9 A;  2QQA A;  4OMM A;  1UGR B;  5GMK h;  2YUP A;  2WAC A;  2EVR A;  2V1Q A;  4X1V A;  2QA4 T;  1M27 C;  2M16 A;  3WXM B;  2KAF A;  3M0R A;  1Q86 R;  3E1S A;  4HA8 A;  4F7U B;  4BY6 C;  3LGF A;  1YNZ A;  1M90 R;  4AG1 C;  5AYF A;  2IIM A;  3CC4 A;  1QCO A;  1WYX A;  2FRW A;  1WHM A;  2MWO A;  1BI3 A;  4BDY A;  2F1L A;  2NUP B;  1GBQ A;  2ABL A;  2BZY A;  5D6W A;  4PJJ A;  4RCC A;  4IUT A;  5FRM A;  4RTW A;  1VQO Q;  2NLU A;  2L3Q A;  3OBY A;  3BDU A;  1WPY A;  4OGC A;  1OI1 A;  4Z02 A;  5GMK i;  2HL3 A;  4J8O A;  2E5K A;  2YLB A;  3OBW A;  2LT1 A;  1QVF P;  2L3R A;  2DTH A;  1VQ8 A;  2K79 A;  3OMG A;  4F7U G;  3MHX A;  5HY6 A;  3UA6 A;  4ZGJ B;  3I5S A;  3CCJ Q;  4J9G A;  1M1K C;  1WJQ A;  2PU9 B;  1G83 A;  2X4Y A;  3JV3 A;  3QSU A;  1KK7 A;  3E9G A;  1S72 T;  1ZBJ A;  4KGV B;  1PNJ A;  2RMO A;  2JN0 A;  2RF0 A;  3J80 E;  4OMO A;  5KYX B;  1PD0 A;  1VQ7 T;  4JPB W;  4HCC A;  3VJP A;  3M58 A;  2PVO B;  4BD3 A;  1YHQ Q;  2VV5 A;  2EWN A;  5LJ3 h;  1N8R R;  2DEU A;  1KQ2 A;  2HSE B;  1VYU A;  4JDS A;  4FYX B;  2Y4X A;  5L23 A;  4FSX A;  2KRO A;  1VQO T;  2EJF A;  5KCO A;  2DA9 A;  4CRI A;  3FLG A;  2YRD A;  4C8Q E;  1D3B B;  2KR3 A;  3V8K A;  3J81 E;  4FW1 A;  1YBY A;  1WHK A;  4Z8A A;  1BU1 A;  1YJN A;  5CK9 A;  2KK4 A;  2HQH A;  1Y96 B;  3MET A;  4J7I A;  3FB9 A;  4RTY A;  1PC0 A;  4HT8 A;  3I9Q A;  2DXU A;  3GNG A;  1OPK A;  2G6F X;  1ZLM A;  2DD5 A;  5D6Y A;  4JJC A;  1HXD A;  5A2Q E;  3CCV T;  5FWC A;  4E7Z A;  5GAN 5;  3MJX A;  2DET A;  2LP5 A;  3A98 A;  3TEE A;  1OPL A;  2NWM A;  2K7A A;  3OYA A;  1K73 C;  3CPW A;  1ZUK A;  2VB6 A;  4HXJ A;  2DVJ A;  2YDL A;  2JTM A;  3M55 A;  4KRT A;  1BKB A;  2E6Z A;  1XQH A;  2KI7 A;  5D6X A;  4E7H A;  4FCY A;  3CC7 T;  3QPH A;  3PMI A;  3E19 A;  2G3R A;  3CCR A;  2EGA A;  2D9T A;  3MP1 A;  4KH1 B;  2W0Z A;  2MPX C;  1ZSG A;  3M56 A;  4BAC A;  3CXC S;  2NYS A;  3QYG B;  1JRI A;  2CZ0 B;  2HSP A;  2IPO B;  2RQT A;  4P5N A;  3M9Q A;  2R5A A;  1X6O A;  3EG2 A;  2AHJ B;  5D7U A;  3IQL A;  3SWN C;  2DXC A;  1RI0 A;  3QG1 A;  3JCM b;  5GAO p;  4RTT A;  2XDP A;  4LUD A;  2RH2 A;  4M7D E;  2HL5 C;  2FPD A;  1M8M A;  1NG2 A;  3C95 A;  5GMK m;  1YIJ T;  1OEB A;  2BZ8 A;  2DXB A;  1MMD A;  1H92 A;  5IXF A;  2ZPF B;  2RJF A;  2CP3 A;  1QKW A;  4E7K A;  3I56 A;  2D8H A;  1PG5 B;  2RNA A;  2JUF A;  2B86 A;  1TH7 A;  3CCQ T;  4F7U F;  2RPN A;  4QQG A;  1AT1 B;  3OA6 A;  4E7L A;  3INZ A;  2JVV A;  4N4H A;  2OTL A;  4OB0 B;  4QKU A;  5M9O A;  4ELZ C;  2L8D A;  2QQB A;  2W10 A;  2XIC A;  4QVZ A;  1T3L A;  4FIB A;  3QBY A;  2A28 A;  3M0P A;  3PMT A;  2DL5 A;  4J6Y A;  1OX8 A;  3S3O A;  3OQ5 A;  4EMK B;  2FHD A;  2ED1 A;  5GAN 8;  1KD1 U;  2B8A A;  2NUZ A;  1UFF A;  3TVT A;  3EFO A;  1PWT A;  2COY A;  4K11 A;  5LJ3 f;  1UHC A;  3L2Z A;  7AT1 B;  4LNP A;  3S6W A;  4JRK A;  2R5M A;  1WNL A;  1IZ6 A;  1TTH B;  2EBP A;  1AD5 A;  1EIF A;  3CCU A;  3GBQ A;  3CCM T;  4AFZ C;  5KYX A;  3CD6 A;  3JB9 G;  3QZ5 B;  1I8F A;  1WFW A;  1IHV A;  3RMQ A;  4Z88 A;  1UEC A;  4M77 F;  2EIF A;  3FIF A;  3JB9 D;  4EMH A;  2DK3 A;  3DKM A;  1YHQ A;  3OS5 A;  2QDY B;  4HT9 A;  5GAN 7;  1M2V B;  1WA7 A;  2O88 A;  3JB9 H;  2RI2 A;  1N9R A;  2DTO A;  2QGF B;  1QVG A;  4BY6 B; 
#chains in the Genus database with same CATH homology
 3HPW A;  3JCM e;  1KD1 C;  4IUR A;  2PVD B;  2E64 A;  4C8Q D;  1PSF A;  4DOV A;  5GAN 6;  4J6W A;  3RUX A;  2O4X A;  2VXF A;  3MP8 A;  3J7A F;  5KE3 A;  3P8B B;  4M77 G;  4ZTF A;  3JCM g;  4C5H A;  4JRP A;  2E1H A;  1NJI C;  4JRQ A;  5HK3 A;  1W2B A;  2MF2 A;  4C0F A;  2HNI A;  1N6A A;  4J83 A;  4JLI A;  3JCM f;  3CCE T;  3CCJ A;  4M7A F;  3RKX A;  4M7D D;  5DLQ E;  2GFU A;  4PJO A;  3CCU T;  1BI0 A;  2JTF A;  3EAE A;  4A4K A;  3GLX A;  5J39 A;  2R57 A;  3VUZ A;  4M75 D;  3JSC A;  2X4W A;  5A0L A;  5GAN 3;  1O9S A;  3DB3 A;  1VQM T;  2KQW A;  1I5L A;  4RMO A;  4IUP A;  4M75 B;  5GAM h;  3NTH A;  4M75 E;  4M7A C;  1LOJ A;  2JOY A;  3CEY A;  4F7U E;  4LD9 K;  4BE1 A;  5A0G A;  1UGQ B;  2ZPH B;  3L1A A;  4EDU A;  4O5V A;  3HSB A;  4OB1 B;  1OZ2 A;  2HQX A;  2RA2 A;  3OYY A;  3VYH B;  2XHC A;  4X34 A;  3OS1 A;  4A53 A;  4EPC A;  3OS2 A;  3QJ6 A;  3VV0 A;  3LW5 E;  3A8O B;  2RHX A;  1U1S A;  4BI8 B;  2EQJ A;  1P92 A;  2KSS A;  4N0A A;  3URG A;  4HCB A;  1O75 A;  2LDM A;  2KY9 A;  2CGH A;  1YHQ T;  3V8L A;  4HCZ A;  1N8R U;  4FT2 A;  2M0O A;  3CBO A;  4C92 D;  1YIJ A;  2GQV A;  1VUB A;  2O01 E;  3CCQ A;  4JS5 A;  3UPU A;  1KC8 C;  4DA4 A;  2RO0 A;  2IG0 A;  4M77 B;  1RL2 A;  4MZT A;  4OB3 B;  1K9M C;  2ZGW A;  4M78 E;  4IUQ A;  3N5B B;  1G3W A;  4TVR A;  1VQK A;  4LD6 A;  2BUD A;  1YCY A;  1ZHI A;  1VQN A;  1VQ4 A;  2XU8 A;  3V8J A;  4MDX A;  4OVA A;  1QVF A;  2RM4 A;  5GAN 2;  3S3N A;  2OTJ A;  1M90 C;  1VQ6 A;  4KUD K;  3GF5 A;  2ZPB B;  2RHI A;  3L42 A;  3SWN B;  3OYM A;  3CME T;  3V7R A;  4J6X A;  2GF7 A;  5I2S A;  5GAO q;  1M1K U;  1VQ8 T;  2QXF A;  1BI2 A;  2FYK A;  3O8V A;  1X01 A;  2QA4 A;  1WGS A;  2PUO B;  4M78 F;  3C4S A;  5J3B A;  1M4Z A;  3JCM d;  4OGE A;  3OYI A;  4M78 A;  4A4F A;  4LDU A;  5CKB A;  2VUB A;  2L5Q A;  2DO3 A;  4XTV A;  3MEA A;  5GAN 4;  1VQ9 T;  4ELY C;  5FU7 C;  2M9U A;  4RG2 A;  3QYH B;  2K4Y A;  2LVM A;  4QQD A;  3ASK A;  3T9N A;  4IUV A;  5LJ5 d;  1VQN T;  4PJO C;  4N4I A;  3WVD B;  3L2Q A;  2WSC E;  1JB0 E;  3A8G B;  2KMT A;  3M53 A;  3UDC A;  4L59 A;  4Q5W A;  2EQU A;  2X35 A;  3JCM P;  3OYE A;  4BE0 A;  1IRE B;  4M7D C;  1XOV A;  4VUB A;  3G7Z A;  2OTJ T;  2GCX A;  3JCM W;  2LQK A;  3CXC A;  5EG2 A;  2ZPI B;  3P8H A;  2OTL T;  4M7A A;  4LDV A;  3HKS A;  3MEW A;  3CCL A;  4PKC C;  5CQX A;  1JJ2 S;  1UGS B;  3DLL A;  2RD1 A;  1Y71 A;  5GAN d;  4Y91 A;  2RI5 A;  3CCV A;  1K73 U;  4C0Z A;  1U8R A;  1KQS A;  3GOX A;  3CBM A;  2YRV A;  3EFS A;  2MWP A;  2XD0 A;  2LT4 A;  2OAU A;  1Q86 U;  1MGQ A;  4PJO G;  4NL3 A;  1Q86 C;  4M78 B;  4NL2 A;  3E9F A;  1M1G A;  3RKW A;  5LJ3 d;  1YI2 T;  2E6N A;  4M78 D;  4C92 C;  2K5L A;  3OS0 A;  4PJO E;  2P0Q A;  1V29 B;  3MCA B;  4LDW A;  3UWN A;  1QVG S;  2RHY A;  3SWN A;  4A4G A;  3NFC A;  3CC2 A;  1YJN T;  2XID A;  3CCS A;  1NPR A;  2DIG A;  3M54 A;  4J5Y A;  4X9D A;  2RK1 A;  1B34 A;  4MMK A;  3P8D A;  3BDL A;  3OYB A;  2LQ8 A;  2QQA A;  1UGR B;  2P0P A;  3R6O A;  2EQK A;  2D0Q B;  2DTI A;  2XG8 D;  4PL6 A;  4FM4 B;  5GMK h;  5GAM j;  2YLC A;  2EAY A;  2ZPE B;  3HFO A;  3JRZ A;  1QP2 A;  4PLL A;  5CQY A;  2WAC A;  3JCM c;  4C92 F;  4QVC A;  2QA4 T;  3KBG A;  2BIV A;  4M7D A;  1Y07 A;  1BIA A;  4V2S A;  2HAX A;  2M16 A;  1YIT A;  3WXM B;  4MZM A;  5GAN e;  1GXI E;  2HD0 A;  2KAF A;  4MZP A;  1YJ9 A;  1AHJ B;  3E1S A;  4HA8 A;  4F7U B;  2X4X A;  2I2L A;  4BY6 C;  3LGF A;  3VU3 C;  1Q82 U;  4BUG A;  4M78 G;  1G3T A;  1N9S A;  5C0M A;  3OMC A;  4XU0 A;  2WSE E;  2A7Y A;  2EYQ A;  4OF1 A;  5AYF A;  2LRQ A;  2R58 A;  4M77 D;  3LLR A;  4WF2 A;  2XK0 A;  3CC4 A;  4LDY A;  1FWZ A;  1Q81 C;  1QVP A;  1G3Y A;  4M7D B;  2E12 A;  3EFR A;  2EFI A;  2QQS A;  2MWO A;  1BI3 A;  4KUI A;  5CIU A;  4R56 A;  2F5K A;  3I55 A;  2MAM A;  1VQK T;  4BDY A;  5HK0 A;  2RI3 A;  2IVW A;  5D6W A;  1N8R C;  4D6W A;  1ZBX A;  2V8I A;  4RCC A;  4O6J A;  3ZFJ A;  4RCB A;  5KCH A;  4IUT A;  2P0K A;  3C94 A;  2DAQ A;  4BI3 A;  5FRM A;  3L2V A;  2NLU A;  3OW2 S;  3OBY A;  4JLG A;  3BDU A;  4NOY A;  3LH0 A;  2QTX A;  3A8H B;  1WPY A;  4OGC A;  3X20 B;  5LJ5 g;  4BDZ A;  3JCM h;  2C06 A;  1WQ7 A;  1OI1 A;  4OMF B;  4M7D F;  4M7A D;  3LX7 A;  4Z02 A;  3A8L B;  5GMK i;  4ZN3 A;  1QVF S;  4A4H A;  4J8O A;  2HBP A;  2YLB A;  3OBW A;  2LT1 A;  5CKF A;  1JJ2 A;  5LL6 S;  4IKF A;  1NE8 A;  4R55 A;  2EJ9 A;  2L3R A;  2DTH A;  2LC4 A;  3CC4 T;  1VQ8 A;  3OYC A;  3OMG A;  3X25 B;  2CKK A;  4F7U G;  1BYM A;  3MHX A;  4C92 B;  3OYH A;  3OYL A;  5HY6 A;  4ZGJ B;  1VQ5 A;  1WJR A;  4Y28 E;  2FB7 A;  3JB9 J;  1M1K C;  1WJQ A;  2PU9 B;  4XTY A;  1LJO A;  5GAM e;  1YIT T;  2X4Y A;  4NS5 A;  5CCA A;  4XTX A;  2K5F A;  5A0D A;  2RJE A;  3RIR A;  3CPW S;  1BI1 A;  3X26 B;  3QSU A;  3E9G A;  3SDZ A;  2VC8 A;  1S72 T;  1Q82 C;  3VUB A;  2RK2 A;  5DM7 R;  3CC7 A;  1DJ7 B;  5GAN j;  4L5G A;  3QJY A;  4A54 A;  2JN0 A;  4M75 G;  3GIB A;  1R8O B;  2ZCF B;  1WJS A;  4QQ6 A;  3J80 E;  2ZPG B;  1UGP B;  1ZQ1 A;  3QUI A;  1I81 A;  4C92 A;  5I21 A;  4M75 F;  1VQ7 T;  5CKH A;  4HCC A;  5LJ3 j;  1X75 C;  2LCL A;  3QII A;  3M58 A;  2WSF E;  2F69 A;  3VJP A;  2PVO B;  1VQO A;  4BD3 A;  1KQS S;  3KUF A;  2VV5 A;  1KQ1 A;  2EWN A;  5LJ3 h;  4BB7 A;  2FVU A;  2DIQ A;  3PTA A;  3NTI A;  1KQ2 A;  1M8V A;  4J7F A;  3BFM A;  2EKO A;  5IAY A;  3FC3 A;  3G4S A;  4EMG A;  3JCM J;  5IN1 A;  3A8M B;  1HK9 A;  3BY7 A;  4JDS A;  2CS7 A;  4EMK C;  2O4X B;  2DEQ A;  2Y4X A;  2DJZ A;  4FSX A;  1M90 U;  2XDD A;  1VQO T;  2E70 A;  2EJF A;  2QI2 A;  5KCO A;  5CR2 A;  5GAM d;  2JZ2 A;  4LDX A;  4B9X A;  2D6F A;  3CCL T;  3CME A;  2DXT A;  4CRI A;  4QW2 A;  3SD4 A;  3M59 A;  3FLG A;  4C5I A;  3OYD A;  1OZ3 A;  3HRT A;  4C8Q E;  1D3B B;  3V8K A;  2DD4 A;  3J81 E;  3I55 T;  4A4E A;  2VYT A;  5LJ5 h;  2QQ9 A;  3RMS A;  2EQM A;  4UC4 A;  1YBY A;  4XU3 A;  2E5Q A;  1Q7Y C;  1YJN A;  3OYJ A;  5CK9 A;  2KK4 A;  1Y96 B;  3A5Z B;  3OSV A;  3MET A;  4J7I A;  4C8Q G;  3FB9 A;  1VQ9 A;  3V7S A;  3OYN A;  3ME9 A;  4CI0 C;  4HT8 A;  3LYI A;  2DXU A;  3FEO A;  4X9C A;  3GNG A;  2V8J A;  2MMP A;  4XAX B;  3CCM A;  5DY9 A;  2DD5 A;  5GAM f;  5D6Y A;  4E7I A;  1QW1 A;  3CBP A;  1HXD A;  1W4S A;  2L89 A;  3HHT B;  3FJP A;  3QHS A;  3PNW C;  4M77 E;  5A2Q E;  2YHT A;  3CCV T;  3QZ9 B;  3JCM X;  5GAN 5;  1M1F A;  2K3X A;  2RJC A;  3OSS C;  2JNG A;  2XKO C;  4FU6 A;  3TEE A;  1NZ9 A;  2XI9 A;  3M4G A;  4ZGD B;  4BE2 A;  2V8K A;  1YJW A;  3QDR B;  3RES A;  3OYA A;  1B34 B;  1K73 C;  4JUV A;  1FXX A;  1NJI U;  4N0A C;  1VQ5 T;  3G71 T;  3CPW A;  5LJ3 e;  3JB9 F;  1VQL A;  4XTU A;  3OB9 A;  3QO3 A;  4C0D B;  4GLK A;  2JTM A;  3M55 A;  1BKB A;  2E6Z A;  3CC2 T;  3OYF A;  3LWH A;  1FX7 A;  4PLI A;  1KC8 U;  1VQL T;  1XQH A;  4BI4 A;  4MDW A;  4JRI A;  5FU6 C;  4PJO D;  2LCC A;  3HL8 A;  2M1H A;  5D6X A;  4C0D C;  4E7H A;  4B9W A;  3QPH A;  3CC7 T;  3PMI A;  4M77 A;  1YJW T;  3E19 A;  2G3R A;  5GAO n;  3CCR A;  2D9T A;  3MEV A;  4QVD A;  2RJD A;  3CMA T;  3MP1 A;  2BKD N;  4EMK A;  2QEX T;  4C8Q B;  4E7J A;  3CCR T;  1G3S A;  5I2M A;  5FU7 B;  5HKC A;  1VQP T;  3M56 A;  4BAC A;  2VXE A;  3CXC S;  5GAN h;  3QYG B;  2K5I A;  1JRI A;  2CZ0 B;  5LJ3 g;  4OB2 B;  3I56 T;  4M7A B;  1H64 1;  5GAO m;  4C8Q C;  4P5N A;  1Q7Y U;  3M9Q A;  1LNX A;  2R5A A;  2Y4Y A;  1X6O A;  1Y96 A;  5J26 A;  1VQ4 T;  1VQP A;  2AHJ B;  3SWN C;  3V7C A;  3G6E T;  4ZGE B;  2DXC A;  3H6Z A;  1RI0 A;  1N27 A;  3QG1 A;  5CKE A;  1VIF A;  3JCM b;  5GAO p;  3CCJ T;  2LNV A;  2MI6 A;  4C8Q A;  1XNI A;  3LGL A;  1K9M U;  2XDP A;  2RH2 A;  3BW1 A;  4XK8 E;  4M7D E;  2ZZD A;  4JS4 A;  4C5E A;  2RHZ A;  3NTK A;  4C5G A;  1UB4 A;  1SSF A;  3X24 B;  3FRN A;  5GAO l;  1VQM A;  1K8A C;  5CAI A;  3C95 A;  3MEU A;  4M75 C;  4XU2 A;  3ZEH A;  4PJO F;  5GMK j;  4KUL A;  5GMK m;  1YIJ T;  2QQR A;  1VQ6 T;  3Q1J A;  3PFS A;  3VYG A;  2DXB A;  3WVE B;  2F5T X;  2X4J A;  4KBM B;  5KH6 A;  3G6E A;  2CZ7 B;  1UEB A;  2DVE A;  2ZPF B;  3TU4 K;  2RJF A;  4E7K A;  3JCM Q;  5FRN A;  1M5Q 1;  1WQW A;  3M4Y A;  1BIB A;  3I56 A;  4C92 G;  3JCM V;  4ZN1 A;  2VGM A;  5LJ5 j;  2JUF A;  5IT9 E;  4C0G A;  1TH7 A;  3HRU A;  4F7U F;  3CCQ T;  1KHI A;  4FT4 A;  2CZ6 B;  4QQG A;  5GMK l;  3L2R A;  2QEX A;  4N4G A;  1I4K 1;  2DPP B;  2EJG A;  5GAM g;  2PUK B;  2RB6 A;  3OA6 A;  4C92 E;  4E7L A;  3QKJ A;  2CZ1 B;  3INZ A;  2JVV A;  4XTZ A;  4N4H A;  4M7A G;  4YTL A;  2DKG A;  2OTL A;  4OB0 B;  5M9O A;  3PT9 A;  3PIP A;  2FL7 A;  4ELZ C;  3CPF A;  1PSE A;  2L8D A;  2QQB A;  2XIC A;  4OP0 A;  5C6S A;  4M77 C;  3S3M A;  4M7A E;  4QVZ A;  1YJ9 T;  4JJN K;  2XDB A;  4FIB A;  3QBY A;  1KHC A;  4GY5 A;  3OYK A;  3F70 A;  3GP8 A;  2E65 A;  3PMT A;  1W2B S;  4J6Y A;  4II1 A;  3S3O A;  3G71 A;  2P4T A;  3OQ5 A;  1D3B A;  3TCJ A;  2FHD A;  3ER0 A;  4EMK B;  3PIO A;  3CMA A;  1XTD A;  1U1T A;  3L2W A;  4E47 A;  5GAN 8;  1KD1 U;  5L8R E;  2VGN A;  3UT1 A;  2B8A A;  4ATO A;  4ZTJ A;  2HQE A;  1JBM A;  3MO8 A;  4RG8 A;  3CCS T;  3OW2 A;  3LWI A;  2LX9 A;  3GNF B;  1VIE A;  1QP3 A;  4FL6 A;  4MML A;  4XU1 A;  3HRS A;  3KXT A;  2RHU A;  4PJO B;  5CKD A;  3ZBD A;  5CVI A;  4M78 C;  3X28 B;  4PNO A;  3M57 A;  4XTW A;  3HFN A;  5KE2 A;  3CCE A;  1NPP A;  2GFA A;  1YI2 A;  5LJ3 f;  1MHN A;  3L2Z A;  2Y90 A;  5FLX E;  2DZ9 A;  3H8Z A;  3JB9 I;  3G4S T;  3S6W A;  2CYZ B;  3HP9 A;  2R5M A;  4JRK A;  1WNL A;  5CO7 A;  1IZ6 A;  1Y7X A;  3TRE A;  5GMK e;  3JAM E;  1K8A U;  3GPL A;  4C8Q F;  3RER A;  5DLO A;  1EIF A;  3VKI A;  3OYG A;  3CCU A;  3DB4 A;  4IUU A;  3CCM T;  1G5V A;  2E10 A;  1KG1 A;  3M5A A;  4KT0 E;  4XQ3 A;  4RKU E;  5LJ5 e;  1Q81 U;  3CD6 A;  3JB9 G;  3QZ5 B;  1I8F A;  3PGG A;  3SB2 A;  2K2V A;  3RMQ A;  3SFM A;  1S72 A;  4M7D G;  2E41 A;  2A3L A;  4M77 F;  2EIF A;  5GAO r;  3L2U A;  5GAN g;  3FIF A;  2LTO A;  3JB9 D;  4EMH A;  5FU6 B;  2DK3 A;  2H3J A;  5FRO A;  2DZC A;  3MP6 A;  4HKE A;  2KVQ G;  1M9S A;  3DKM A;  5LJ5 f;  5GAN f;  3AHU A;  1YHQ A;  3OS5 A;  2K57 A;  3DLM A;  2QDY B;  3OY9 A;  4HT9 A;  1VQ7 A;  5GAN 7;  1OYX A;  2PVG B;  4F7U A;  3FDR A;  4M75 A;  4ME7 A;  2K3Y A;  3QXE B;  4L6V 5;  4DQ2 A;  3CD6 T;  3JB9 H;  2RI2 A;  1N9R A;  3C12 A;  2DTO A;  2KDS A;  3RKY A;  2PQW A;  4DOW A;  1H3Z A;  1QVG A;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...