5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
1DJ7B 3VYHB 2DD5A 2PUOB 2PVOB 1PSEA 1UGPB 4RKUE 3A8HB 4XK8E 3X24B 4OB3B 4ZGDB 1GXIE 1PSFA 2ZCFB 3HHTB 4ZGEB 2AHJB 3X26B 2DPPB 2PVGB 2ZPFB 2ZPHB 3QYGB 3A8LB 2PU9B 2ZPBB 3WVDB 2D0QB 4OB0B 2PVDB 2ZPEB 2CZ0B 3X28B 1AHJB 4Y28E 4L6V5 2QDYB 3QZ5B 2CZ6B 4ZGJB 3QZ9B 4KT0E 4FM4B 2WSEE 1UGRB 1IREB 2PUKB 4OB1B 2DXCA 1JB0E 3X20B 2WSCE 3X25B 2CZ7B 2DD4A 2ZPGB 3A8OB 3QYHB 2DXBA 2ZZDA 2O01E 4OB2B 3WVEB 3A8GB 2ZPIB 2CYZB 2WSFE 3VYGA 1UGSB 3A8MB 3LW5E 1UGQB 3QXEB 5L8RE 2CZ1B 1QP3A 1QP2A 1V29B
chains in the Genus database with same CATH superfamily
3JCMf 1WA7A 5GJWB 2YRVA 4NL3A 2GNCA 2B8AA 3QO3A 3O8VA 4JZ4A 4RG2A 2RK2A 4RMOA 2MAMA 3EFSA 2IIMA 5IXBA 1X6GA 3BY7A 4OP0A 2QQ9A 4F7UB 2FPEA 4ZGDB 4B6MA 5CKBA 3R6NA 3EGDB 2ZCFB 2VGMA 1WNLA 3PMIA 1YITA 1AWJA 1RLPC 2ZPFB 1RAIB 3P8BB 4ZNXA 2AZVA 5GAN8 5A2QE 5GAMj 5GAOp 1HJDA 1UFFA 3Q1JA 2KXDA 1T0HA 3EG1A 3LH0A 4E7LA 2QEXQ 5I2MA 2DBMA 1Q82C 1NPRA 4OMMA 1KHIA 4JJCA 1IZ6A 3MO8A 1QCNA 8ATCB 1N8RU 3FJPA 1SPKA 3JCMg 2D6FA 3CCQT 1WPYA 5HK0A 1WHMA 2LDMA 1J3TA 1IO6A 4X9DA 3LGLA 4F7UE 5KH6A 2E3HA 1AD5A 4R0KA 4E2FB 5A0GA 3HRUA 4JLIA 4E47A 1N8RR 3TVTA 4F14A 1K4US 2D8JA 3M0RA 3S6WA 4FIBA 1N6AA 5CR2A 1MMDA 4J9EA 2HL5C 5IXFA 2HMAA 3H8ZA 2VYTA 2E6NA 3M4GA 1YHQA 1RAAB 1VUBA 2KXCA 1NG2A 2CYZB 4Y91A 1QLYA 2FPDA 1TH7A 2P4RA 1OYXA 2K5LA 1BKBA 3HFOA 3U23A 1UGQB 2JS2A 3BDLA 3J81E 3HFNA 1IGQA 1OQKA 5I22A 1K9MC 5KYYB 3QUIA 3VU3C 2HKQB 3RIRA 4PJOF 1QCOA 3UATA 1W70A 3OMGA 4LDWA 1MNEA 1PC0A 1X2QA 4BACA 2CKKA 3G71Q 3NMZC 2XG8D 3AT1B 4KH0B 5CK9A 1UGPB 2J6FA 4M7DF 4IURA 4C0GA 3FJ5A 4XQ3A 5GAN5 5LJ5j 4DA4A 4J6XA 1PSFA 5A0LA 3RUXA 4AFQC 4QVZA 3G71A 1NBEB 3RMSA 2F5KA 3MP6A 4OF1A 4DOWA 3G4SQ 2MK5A 2LCCA 2KSSA 3MEVA 2L5QA 2LQNA 1QW1A 5HCKA 3KXTA 1AT1B 3RKWA 1Z9ZA 1M8VA 2A3LA 3BFMA 4EDUA 4XU0A 4C5GA 4KGVB 3M0PA 2XICA 4N0AA 3VS7A 5HY6A 2JJ9A 4LDXA 2L8DA 5KYYA 2SRCA 2K7AA 2P4TA 1W1FA 2FHDA 2DXCA 4PJOD 1G83A 5GANj 1M2VB 3CC4T 4FW2A 2RMOA 2LQWA 4JUVA 4BI8B 1I5LA 1X6BA 3NPFA 4C0DB 2M1HA 2GQIA 5IHNA 4M7DD 2DRMA 1VQ9A 2DYIA 4JJNK 2XMFA 4ME7A 2Y4XA 2LNHB 1KG1A 3OYLA 2KNBB 3JCMV 1SKUB 2NUPB 2VC8A 3QXEB 2CZ1B 1YJNQ 1VQNQ 4X1VA 4XU3A 3UWNA 1YP5A 2FL7A 1C0MA 3L2ZA 5LJ3e 4JS5A 2RQWA 2CP3A 4RG8A 2DD5A 1YJWT 3M0SA 4NS5A 2JUFA 4ZTFA 2EGCA 3ZFJA 1M9SA 3X24B 4OB3B 1B34A 1RAGB 3OMCA 4UC4A 2ECZA 4A4KA 1OU8A 4FYWB 2ATCB 2BE7D 2EW3A 3FB9A 2NUZA 5FWBA 1RL2A 4RTVA 1NJIU 1M2VA 5FRMA 3JSCA 1E6HA 2RQUA 4D8DA 2NUTA 1I5OB 5GMKi 1NJIR 1WI7A 3QZ9B 3GLXA 2GQVA 3ASKA 4XTUA 1YI2T 4EMGA 2X51A 1PG5B 2AK5A 3V8JA 2E3IA 4OB1B 1NYFA 2X4XA 2XK0A 2J06A 5LJ3d 2DEQA 4MDWA 2YT6A 1VQ4T 1WJQA 3X25B 2R57A 3LLRA 3BDUA 1RAEB 1M30A 1VYVA 2HZYA 2EGEA 3URGA 5GMKh 1YJ9A 4ANJA 2KK4A 4DBHA 2DAQA 2MPXC 3I55T 4EMKA 2D1XA 2K5FA 1TOVA 2RF0A 3THKA 1S72Q 2ZPIB 3M57A 3GOXA 3CCMT 1LPLA 1M5Q1 4BB7A 4OMPA 1EX4A 1SSFA 1KSWA 1N9RA 1TG0A 3OBWA 2HQHA 3OQ5A 3VS5A 2OTLT 2EYYA 2A36A 6AT1B 1WXBA 3OS5A 4M7AC 4O5VA 1H3ZA 4M7AG 1UE9A 3G7ZA 4R55A 1VQMQ 3TQ7P 1D0ZA 1OPLA 3D7SB 2BZXA 3CCVQ 1K73C 1N27A 2BZYA 2DXUA 4FSSA 4FCYA 1U5SA 2AKLA 1GXIE 1XOVA 5GAMd 4M78C 1OX8A 4MDXA 3M9QA 4JDSA 4PJOB 1VQMA 2V8IA 1TUGB 4AFUC 1WXTA 3A1PA 3CD6Q 5GAN4 3CCVA 1AWXA 4RTXA 2EYZA 2ED0A 1ABQA 3MPUB 3OYJA 2DFUA 1UJ0A 5DLQE 4M7DB 3I35A 1VQ6T 3QPHA 4IUPA 3QDRB 1TUCA 2O31A 3OYAA 1NE8A 1ZSGA 1VQOT 2LMJA 5LJ5e 4L6V5 2DL5A 1EFNA 3L1AA 3I56A 3RDVA 3DLLA 3EG9A 2QA4Q 2COZA 2XDDA 1QCFA 5HKCA 1M1FA 4C8QE 1IREB 4M77C 1AWWA 3LWHA 2ESWA 2M0YA 2MI6A 3UT1A 1YIJQ 2GCXA 3OW2A 2EQUA 4PJOE 1TU0B 1CSKA 4C8QA 4DBRA 3PFSA 1VQ7A 1UGVA 3PVLA 1BI3A 3CCRQ 4KH1B 4F17A 1ZX6A 2HCKA 2KE9A 2LTOA 4DEXA 1R8OB 2VB6A 3VS6A 2MYSA 4M7DE 2HD0A 3QDFA 3VYGA 2XD0A 3GNGA 2EGAA 3DLMA 1FMKA 2AIRB 2D0NA 2HKNA 4QT7A 2EPDA 2DTOA 1Q86R 3CCEA 1U8RA 1RI9A 1LOJA 4A4GA 2XDPA 1QP2A 2OTJT 1O75A 4IIOA 3CBOA 1BYMA 4AFSC 4HKEA 4HVVA 2FO0A 4K11A 5LJ5d 2DJZA 4CI0C 3P8DA 3OYCA 2KRNA 2ZGWA 1VQKA 2FZKB 5IHKA 1W2BP 1PWTA 2R58A 4RKUE 2C0IA 4L59A 1ABOA 1M4ZA 2PNIA 1Q7YR 3I9QA 2DA9A 4J7IA 4XAXB 5CVIA 3MKDA 3BW1A 4C0FA 3M4YA 1KJWA 3M0QA 4N4GA 1H3HA 2PU9B 2ZPBB 3PGGA 4E7JA 1XQHA 2RK1A 1VQ5A 2EJ9A 2I0NA 1AVZC 1XTDA 3HP9A 2VVKA 3MHXA 5KCHA 3LWIA 1Y57A 1KQSP 3GF5A 4XTZA 3SD4A 2MIOA 2QTXA 5HK3A 1G3YA 5GANd 3VS3A 4WCIA 1ZSZB 3M59A 4R56A 1K9MR 4WF2A 3TEEA 4C92C 4KULA 1QMCA 4PFZA 4XTYA 2OAUA 4C92G 3VJPA 2YHTA 4RTYA 3MP1A 2OAWA 3JCMW 4HVUA 2CUBA 3NHNA 2DTIA 1G3SA 2X3XD 3EHRA 5KYUB 2ZZDA 4KRTA 1JXOA 1ARKA 2G6FX 3CC2T 2E10A 1KD1U 1YCSB 5FW9A 1PRMC 5M9OA 4ESRA 1M90U 4FSXA 4II1A 2KR3A 2LNVA 2Y4YA 2COYA 4QQDA 3QHSA 2JM9A 5KCOA 1QVGP 1I81A 2YUOA 1N9SA 1VQPQ 2Z0WA 4JRIA 2YUNA 4GLKA 3CCJT 1JU5C 3EFRA 3CCQA 1CKBA 1KD1R 4LNPA 1MMAA 3NTKA 5IHIA 1YFNA 1G5VA 1Z9QA 2JZ2A 5GAOq 2PUOB 4KUIA 3G6EQ 3CPWA 2GFAA 2DXTA 1Y71A 5J39A 2LQ8A 2X4YA 3CMET 4BE0A 3NTHA 5IN1A 3J80E 3V8LA 3OA6A 4M75C 3GBQA 1IHWA 3CPWS 1G8XA 3L2QA 4RUGA 3OSVA 5KYUA 3WVDB 1YITQ 2B86A 2E5QA 5EC7A 2A37A 2ZAEA 3EFOA 2ZPEB 1M1KU 2RI5A 3X28B 1NLOC 4MZTA 1T0JA 2LJ0A 2QDYB 3VS4A 3RESA 3ULRB 2K3BA 5DY9A 3VUZA 1QWEA 1Y96A 1WJRA 2VXFA 3M53A 4XTXA 1M1KR 1JB0E 1I07A 3X20B 2W10A 5CCAA 2DD4A 4M75A 2DM1A 1BU1A 2FVUA 4B9WA 2CP6A 3VUBA 4JRQA 1YNZA 2O01E 1M3BA 3E2UA 2RHUA 3F70A 4F7UG 1D09B 2HSEB 1X75C 1K76A 2R5AA 1YHQQ 2E70A 3LW5E 3EGUA 3CC4Q 2QQAA 3EG3A 1OULA 4C5HA 1D3BB 3LX7A 1C6VX 2KVQG 4IUQA 2EYXA 3VYHB 1JQQA 3QBYA 4M4ZA 4OMQA 4FL6A 2DILA 4CRIA 1LNXA 2J6OA 4M78F 1Q95G 3CMAT 1PSEA 3CC4A 1R0CB 4C8QF 3A8HB 1AOJA 3E9GA 1MNDA 1UTIA 4BE1A 4BE2A 1UG1A 5C0MA 5KYNA 4RTWA 4FT2A 2LRQA 3EHQA 1C1AA 2K79A 4XU2A 4O6JA 5GAOl 3REBB 4DOVA 3MEUA 4J9CA 1K9AA 2D0QB 3CXCA 3UF4A 4GLMA 3H0IA 2MOXA 2FZCB 4J8OA 1WQ7A 1X6OA 1QVFA 2DVEA 4M77F 2XHCA 4EPCA 4J9HA 4Z02A 3WXMB 2DKGA 2F5TX 1X69A 2L3PA 3CXCS 2DL3A 1UGRB 2PUKB 4VUBA 1D3BA 1K1ZA 4E7ZA 1QVFS 1TS9A 1BI2A 2CS7A 2EYQA 1NZ9A 4DBQA 4A63B 3OYGA 2RQVA 1K73R 1UB4A 2K4YA 2DERA 4M78D 1RUWA 4PKCC 3LYIA 2DZCA 2LJ1A 1IGUA 5LL6S 4C8QD 4YTLA 2CT4A 3H0FA 4RTUA 1NEGA 3OYNA 1B34B 4GBQA 1JJ2A 1KK7A 1I0CA 1UGSB 1Y07A 3V8KA 1VQ9Q 1VQ4Q 3PVQA 4LDYA 1BBZA 2KDSA 1RADB 3HTRA 2O4XB 4QW2A 2QEXT 1OV3A 3JCMe 2CH4A 4DBFA 1YI2A 2V8JA 3I55Q 3E9FA 3JB9G 1JJ2S 1DJ7B 2ED1A 1WHHA 2RJFA 2RHIA 1VQ4A 4MMKA 3SWNC 3JB9I 1SRMA 2JVVA 1BK2A 2NUTB 1K0SA 4XU1A 2DVJA 3OS2A 2E1HA 1K8AU 1RACB 4LXCA 3ZEHA 4LDVA 3I55A 2L3SA 1Q81C 2D9TA 1SEMA 2DJQA 2DLPA 3M54A 5CO7A 5GMKl 3EH2A 3CCMA 1KC8U 3EGXA 5IH2A 5L23A 2JMCA 3RERA 2XKOC 1NM7A 1D0XA 1K8AR 2BIVA 5GAOn 2LX9A 4C0DC 3V7CA 1VQ8T 2OTLA 2YUQA 3KUFA 4C0ZA 3MJXA 1GBRA 4EMKB 2BUDA 4Z8AA 2RJCA 2GF7A 1KC8R 4J5YA 4D8KA 3JCMd 4J6WA 2O4XA 5GJVB 2EKHA 2RHYA 1NPPA 3RR6A 2RB6A 3G71T 2DZ9A 4OGCA 2QAZA 1CKAA 1ZA1B 2CP0A 4BI4A 4BDYA 3H6ZA 1LCKA 3PTAA 2QQSA 2GTOA 2P0QA 1YJ9Q 4OB2B 4JPBW 2FPFA 3LH5A 1VQ6A 1UJYA 1AEYA 1ACMB 3WVEB 2EBPA 3PE0A 3G4ST 2M02A 5GAMe 1D0YA 1VQOA 1N8RC 5KE2A 1U3OA 3RKYA 2HQXA 2QYZA 2VWFA 3VS2A 3AHUA 1GFCA 3ZBDA 2NWMA 1PHTA 3PIOA 1QP3A 2OJ2A 2R5MA 1SSHA 1V29B 1XJWB 1WFWA 2O9VA 3CBMA 2EIFA 4KGXB 4M75F 2XDBA 5LJ3h 1QWFA 3DB4A 2CT3A 1AZEA 4LN2A 1PKSA 3EG9B 2RO0A 5CKFA 4L5GA 2RQRA 2IPOB 1WHJA 1GRIA 1QQJA 3C95A 5CQXA 3M55A 1LJOA 2IG0A 4M78B 5CIUA 1D1BA 4BI3A 1AWOA 4C8QB 1Y0MA 3J7AF 2OI3A 3OSSC 1Y7XA 1IRXA 2CZ0B 1YJNT 1VQNT 2OTJA 4PJMA 1G2BA 4FW1A 5FROA 1ZQ1A 2F2WA 2CZ6B 3M0TA 2AZSA 2FRYA 2V26A 1RAHB 3I56Q 2V1QA 2F2VA 3L2RA 4OMNA 4HCZA 2YDLA 3C4SA 4M77B 5FU7C 4M7AA 4M75D 2HDAA 4HCBA 2XIDA 4M78E 5CAIA 1ZBXA 1VQ7Q 4HT9A 2P0KA 1QVPA 4PJOC 4JRKA 4PJOG 1B07A 2NLUA 3GPLA 2VGNA 2JTEA 2LCSA 3HRTA 2FEIA 5L8RE 3M58A 2F2XA 4M78A 4HVWA 2HEQA 4ATOA 1B7TA 2K2VA 4M7DC 2LQKA 4FT4A 1Q86U 4M7DG 3CCEQ 3HPWA 1PCXA 3QG1A 1WDXA 5CQYA 4BY6B 4X9CA 2YWWA 2JTFA 1LVKA 3C94A 3E19A 3JCMJ 1FYNA 1VQKQ 2XU8A 1K0XA 1UUEA 1MMGA 4KBMB 4M77E 2HBPA 5GANe 5IAYA 4B9XA 1JEGA 1ZUKA 4JLGA 3UPUA 3CC2A 5KYWB 2GTJA 3UA6A 1Q7YU 2RHZA 3HHTB 5KYXB 2CGHA 2LJ3A 2DPPB 3L42A 3VS0A 2VXEA 2DL8A 4M77A 4X34A 1Q82R 1BCOA 2MMPA 1S72T 5CKDA 1T3SA 4QVCA 3CCJA 3TREA 2IVWA 3FRNA 3RNJA 4FYYB 1VQ5Q 3MEWA 2NYSA 3PT9A 1F1BB 4HCCA 5CKEA 1I1JA 4Y28E 4A4HA 1QKXA 4QQGA 5J3BA 2EFIA 3JCMb 3RBBB 4J9BA 3CC7T 1SHFA 3SDZA 1VQMT 5LJ5h 3CCLT 1OPKA 5AT1B 2K2MA 1EZZB 1PRLC 1K9MU 2BTTA 3CCVT 1NJIC 3MCAB 1HK9A 4PJJA 5FU6B 2CSIA 1KQ2A 4Y92A 3SHWA 1WHKA 3I5RA 3QYHB 1I8FA 2DIGA 4E6RA 3TSWA 2JM8A 2COWA 3QWXX 1M2OA 3CD6T 3FIFA 3META 3OYFA 3VRYA 5KYWA 2RPNA 2WSFE 4AMCA 4CC3A 4BUGA 5KYXA 4JS4A 2HNIA 1JBMA 1M3CA 2SEMA 1HYOA 3TSZA 3TCJA 2KAFA 2CP7A 1BCMA 2K3XA 2DF6A 1RAFB 2AKKA 2DK3A 1G3TA 1TUDA 1D1CA 3EFOB 5D6WA 3CCQQ 2FB7A 2QA4T 2MCNA 1FMVA 3N5BB 2K57A 2X4WA 4DEYA 4OVAA 2J6KA 1ZSZC 4ORZA 1YIJT 2QXFA 3KFVA 5GAN6 2P0PA 3OW2P 1GCPA 3SFMA 4LD6A 2CP5A 4P5NA 1Y96B 1VIFA 3O5ZA 4V2SA 3JCMX 2YUPA 3X26B 3L2UA 3QYGB 4C92A 4IUTA 3CCRT 2EQKA 5FRNA 1M27C 3CMAQ 5GMKj 3C12A 4M75B 3OS1A 2BZ8A 4J9IA 1XNIA 2KYMA 1IB8A 2RNAA 2RM4A 3CMAA 4ZGJB 3E1SA 5GAN2 1FXXA 2LT1A 4E7SA 2G3RA 2EQMA 1HXDA 1VQLT 4J6YA 2DNUA 2ABLA 3M5AA 1FX7A 1E7OA 4A53A 2QQRA 1UECA 2EAYA 1KQ1A 3PIPA 2YRCA 3V7SA 2CH4W 2YLCA 2FG0A 1WZOA 4ZN3A 1U1TA 2L3RA 1Q81R 2CDTA 2QK0A 4M75E 3CCST 3NGPA 4E7KA 1KHCA 1W4SA 2JMAA 3OYYA 2HBWA 3EH1A 3REAB 8AT1B 1H92A 4LDUA 2QTVA 1T3LA 2EQIA 2EVRA 1NYGA 2A08A 2DX1A 3GP8A 4IIMA 2PZ1A 2E41A 3GIBA 2QDLA 4QKUA 4A4EA 2BE9B 1VOMA 2YXYA 5LJ3f 1Q86C 2E6ZA 2RD1A 2RQTA 3JB9H 2BKDN 3CCUT 4M7AF 5C6SA 2GFUA 2L0AA 2X4JA 1PD1A 3JCMQ 4JJBA 1BB9A 4JJDA 1WHLA 3CPFA 1Q7YC 1PM3A 2X9HA 4F16A 3L2WA 4AG1C 3DKMA 1B3QA 4HA8A 2QEXA 3S3OA 1IXDA 2PQWA 3FEOA 1OU9A 4J9GA 4OB0B 3VKIA 2PVDB 1MUZA 9ATCB 1VQPT 1UHCA 4C5EA 1ZA2B 7AT1B 1QKWA 2DTHA 4XTVA 4Q5WA 4PNOA 4F7UA 3ZL7C 1YJWQ 2WSEE 3CPWP 4E7IA 3G6ET 3EGDA 1VQ8Q 5LJ3g 2ROLA 1OEBA 2X35A 1OI1A 2YLBA 5GAMf 5DM7R 1M1GA 2F1LA 2KEAA 2H3JA 4Z89A 4ZTJA 1YJWA 4ELZC 1K73U 2VV5A 2V8KA 3NFCA 4PFPA 4M7AD 3OYIA 2JXBA 1VQ8A 1U1SA 1WHGA 4N0AC 3A8GB 3VRZA 3H0HA 2VKNA 1YITT 1BI1A 5GAOm 2QGGA 2KROA 2RI2A 2DRKA 3EGXB 2HSPA 1GL5A 3RMQA 2P84A 2VASA 3HRSA 1SRLA 2E5KA 2MF2A 4EMHA 3CEYA 3A98A 2L3QA 4QVDA 5FWCA 1BIBA 4E7HA 2QI2A 1YI2Q 1E6GA 3FLGA 1GCQC 2DE0X 4PLLA 2RI3A 2PVOB 5GAOr 2DL7A 2K3YA 1KD1C 2L2PA 1M90C 4J9FA 3SWNB 5GAMg 3OY9A 4CC7A 4ZGEB 1X01A 1VIEA 2AHJB 1JO8A 2H3EB 2H8HA 1HD3A 3G4SA 2EJGA 1U06A 4NL2A 4WTOB 3CCMQ 3FDRA 4OGEA 4M77D 1TTHB 2OX7A 2YSQA 1YHQT 1O9SA 2O2OA 2OTLQ 1AHJB 4N4HA 3M0UA 3ME9A 4C5IA 4J7FA 5LJ5f 1GCQA 1MV0B 4FM4B 1TXQA 2E4HA 4RCBA 3TU4K 5GMKe 2RJEA 2HAXA 5D7UA 3HSBA 1H641 4IKFA 3QJYA 4J83A 5D6XA 2RH2A 3QKJA 2QASA 3JCMP 1P92A 2DMOA 5GAN7 4FU6A 4C92F 3QJ6A 2DXBA 4Z88A 2JS0A 4AFZC 3VV0A 1X27A 1M1KC 1GFDA 1NEBA 2KQWA 3PMTA 5GMKm 4KGZB 1OX9A 5CKHA 3SWNA 2JW4A 1YJNA 1VQNA 2LC4A 4A54A 2KY9A 3A8MB 2V1RA 2LCLA 1VQ6Q 4LUDA 3CXCP 2K5IA 1PKTA 2RN8A 3H41A 2CREA 4LD9K 5FLXE 1VQOQ 3FC3A 1QVFP 2RA2A 4AT1B 3GNFB 5GANf 3OYBA 4ELYC 2GGRA 2I2LA 3EG0A 1S1NA 2JOYA 2EJFA 4EMKC 2O9SA 1M8MA 5LJ5g 3JCMh 2QG9B 5I11A 4PL6A 2DBKA 4OMLA 2DO3A 4XK8E 3A5ZB 1YWPA 1JRIA 2NUPA 3VS1A 2F69A 3JRZA 2J05A 2KI7A 3BE3A 3ER0A 1JJ2P 3QSUA 4C92D 4PFOA 1D1AA 1VQ9T 4M7AB 3CQTA 2A28A 4RCCA 3PNWC 1WJSA 2C0TA 2MWOA 3OYEA 4JZ3A 2JN0A 5EG2A 2OTJQ 2JNGA 3QZ5B 5GANg 4PJNA 2AT1B 2EYWA 5DLOA 2EQJA 1V76A 1WIEA 3MEAA 5AYFA 2E64A 1YWOA 1W2BA 2RHXA 2CP2A 1VYUA 4BD3A 2E65A 3HKSA 2CZ7B 1UEBA 2K6DA 2DIQA 3QIIA 1YCYA 1ZLMA 2M16A 1YBYA 1BI0A 4NOYA 1GBQA 3CC7Q 1S72A 4IUUA 3S3MA 1W2BS 2QQBA 2ROTA 3CCLQ 4GY5A 4LUEA 5FU7B 5D6YA 4M7AE 3OS0A 1SF9A 2KRSA 4PJLA 2E12A 2KYBA 1NLPC 4F7UF 3CC7A 1KQSA 1H8KA 4M78G 3UA7A 2LVMA 5GAMh 4C8QC 2YRDA 3CCLA 3OYHA 4C8QG 3OYMA 2DL4A 2KT1A 4TVRA 3SB2A 2DYBA 1SHGA 1KQSS 4MMLA 2M0OA 2MWPA 1V1CA 1KFZA 4CC2A 1MHNA 1UHFA 3CD6A 2KMTA 4ZN1A 3QWYA 2KBTA 3R6OA 4DQ2A 2M51A 1YJ9T 3CC2Q 4MZPA 1HSQA 1WXUA 3A8LB 2EWNA 3INZA 4M77G 5GAN3 5IT9E 4RTTA 1Q82U 3IQLA 1QVGA 1BIAA 1VYTA 2JTMA 3CCJQ 2WACA 2QA4A 3HL8A 2FRWA 1K8AC 4KT0E 2PTKA 5A0DA 1OZ2A 1ZBJA 1YIJA 4PJOA 1ZUYA 1EIFA 4N4IA 3OW2S 4IUVA 1QVGS 1KC8C 3CBPA 1N5ZA 3CMEQ 2FYKA 3EAEA 1FMWA 1TWBA 3KBGA 2QGFB 2A7YA 3A8OB 2CUDA 4BY6C 3CCRA 4M7DA 3M56A 3V7RA 4JRPA 4HXJA 1WGSA 1R77A 5I2SA 4LE9A 1YN8A 3CMEA 1VQLQ 1MGQA 1WQWA 1RLQC 2D8HA 2J7IA 3EG2A 4C92B 4PLIA 3P8HA 2VUBA 3I5SA 1ZUUA 1PNJA 1JXMA 1VA7A 3CCSQ 5I21A 1VQLA 2RJDA 3OYKA 5KE3A 1UDLA 4BDZA 1TSFA 3I56T 2C06A 3DB3A 3H9NA 1RABB 2HL3A 2W0ZA 4FYXB 3JB9F 1WYXA 2CSQA 2FZGB 3OYDA 4CC4B 3JAME 1I4K1 2KGTA 2KT8A 1FWZA 3CCSA 4HCKA 3S3NA 3JV3A 3L2VA 5FU6C 5GANh 2PVGB 2ZPHB 4J9DA 4QQ6A 3RKXA 4A4FA 1MMNA 1VQ7T 2KRMA 3T9NA 3CCUQ 1MV3A 4RTZA 4C92E 3OBYA 2LZ6B 2LP5A 1A0NB 4HT8A 4EIKA 4OMOA 3CCET 3CCUA 3LGFA 2DEUA 2X3WD 3SEMA 4KUDK 1KIKA 5ECAA 1RI0A 1PD0A 2WSCE 2XI9A 1OOTA 1VQKT 3MP8A 1OZ3A 2LX7A 1ZHIA 4AG2C 2M9UA 2ZPGB 5J26A 2A0FB 3JB9J 2C0OA 2Y90A 4OMFB 5LJ3j 1WX6A 1M90R 1IHVA 1W6XA 3JB9D 2O88A 1X43A 4D6WA 4XTWA 3JCMc 3G1JA 3C0CA 3UDCA 2LT4A 1Q81U 1ZSZA 1SG5A 4MZMA 2HQEA 1VQPA 4F04B 4FYVB 1G3WA 3OB9A 2GBQA 3NTIA 1VQ5T 2K9GA 4PK4A 1WLPB 2ENMA 4M75G 1X2KA 1AZGB 2JT4A 2L89A 1M3AA 3G6EA 1R0BG 2DETA 2EKOA
chains in the Genus database with same CATH topology
3CBOA 3JCMf 4QVDA 1BIBA 2YRVA 4E7HA 4HKEA 4NL3A 1BYMA 2QI2A 3CBMA 5LJ5d 2DJZA 4CI0C 3P8DA 2EIFA 3FLGA 2B8AA 3QO3A 3OYCA 2ZGWA 3O8VA 1VQKA 4PLLA 2RI3A 2PVOB 4RG2A 2RK2A 4M75F 4RMOA 5GAOr 2XDBA 2MAMA 2R58A 4RKUE 2K3YA 3EFSA 5LJ3h 4L59A 1M4ZA 3DB4A 1KD1C 3BY7A 4OP0A 2QQ9A 4F7UB 1M90C 4ZGDB 2RO0A 5CKBA 5CKFA 4L5GA 3SWNB 5GAMg 3OY9A 4J7IA 4XAXB 2ZCFB 2VGMA 5CVIA 4ZGEB 1X01A 1VIEA 3C95A 3BW1A 2AHJB 1WNLA 3PMIA 5CQXA 1YITA 4C0FA 3G4SA 3M55A 2EJGA 1LJOA 2ZPFB 3M4YA 2IG0A 4N4GA 3P8BB 4NL2A 4M78B 2PU9B 2ZPBB 3PGGA 4E7JA 5CIUA 1XQHA 5GAN8 5A2QE 4BI3A 5GAMj 2RK1A 3FDRA 1VQ5A 2EJ9A 4OGEA 4C8QB 5GAOp 4M77D 3J7AF 1YHQT 1XTDA 1O9SA 3OSSC 3HP9A 3Q1JA 4E7LA 1Y7XA 3LH0A 2CZ0B 3MHXA 1YJNT 1VQNT 2OTJA 5KCHA 3LWIA 5I2MA 1AHJB 3GF5A 4XTZA 1ZQ1A 4N4HA 3SD4A 5FROA 1Q82C 2QTXA 1NPRA 5HK3A 3ME9A 1G3YA 1KHIA 5GANd 2CZ6B 4C5IA 1IZ6A 3M59A 3MO8A 4J7FA 4R56A 1N8RU 3FJPA 5LJ5f 3JCMg 2D6FA 4FM4B 4WF2A 3TEEA 4C92C 4KULA 4RCBA 4XTYA 1WPYA 3CCQT 2OAUA 4C92G 5HK0A 5GMKe 2RJEA 3TU4K 2HAXA 3HSBA 3VJPA 1H641 2LDMA 3QJYA 4J83A 5D6XA 4IKFA 2YHTA 4X9DA 2RH2A 4M7DF 3LGLA 4F7UE 3MP1A 5KH6A 3QKJA 3JCMP 1P92A 3L2RA 5A0GA 3HRUA 4HCZA 3JCMW 5GAN7 4FU6A 3C4SA 4M77B 4C92F 3QJ6A 2DTIA 1G3SA 2DXBA 4JLIA 5FU7C 2ZZDA 4E47A 4M7AA 4M75D 3VV0A 3S6WA 4HCBA 4FIBA 1M1KC 1N6AA 2KQWA 5CR2A 2XIDA 4M78E 5CAIA 3CC2T 3PMTA 5GMKm 2E10A 3H8ZA 2VYTA 2E6NA 3M4GA 1YHQA 5M9OA 1ZBXA 5CKHA 3SWNA 1KD1U 1M90U 1VUBA 4HT9A 2P0KA 2CYZB 4Y91A 1YJNA 1VQNA 1QVPA 2LC4A 4A54A 2KY9A 4PJOC 3A8MB 4JRKA 1TH7A 2LCLA 4FSXA 1OYXA 4PJOG 2K5IA 2K5LA 4II1A 1BKBA 2NLUA 3HFOA 2LNVA 2VGNA 1UGQB 2Y4YA 3GPLA 5FLXE 4QQDA 3BDLA 3HRTA 5L8RE 3J81E 4LD9K 3HFNA 3M58A 3QHSA 5KCOA 1I81A 4M78A 1N9SA 1K9MC 4JRIA 3QUIA 3FC3A 3VU3C 4ATOA 2RA2A 4GLKA 3GNFB 3CCJT 5GANf 3OYBA 2K2VA 3EFRA 3CCQA 4ELYC 4M7DC 2LQKA 3RIRA 4PJOF 4FT4A 2I2LA 1Q86U 4M7DG 2JOYA 3NTKA 2EJFA 3OMGA 1G5VA 3HPWA 4EMKC 4LDWA 5LJ5g 2JZ2A 3QG1A 2PUOB 4KUIA 3JCMh 5GAOq 3CPWA 4BACA 2CKKA 2GFAA 2XG8D 5CQYA 4PL6A 4BY6B 5CK9A 4X9CA 1UGPB 2DXTA 2JTFA 1Y71A 5J39A 3C94A 2DO3A 2LQ8A 2X4YA 3E19A 4IURA 4XK8E 3CMET 4BE0A 4C0GA 2XU8A 3JCMJ 3NTHA 4KBMB 4M77E 2HBPA 5IN1A 5GANe 5IAYA 4B9XA 3J80E 3V8LA 3A5ZB 4XQ3A 5GAN5 5LJ5j 4JLGA 4J6XA 3UPUA 4DA4A 3CC2A 3OA6A 4M75C 1Q7YU 1PSFA 2RHZA 3HHTB 3RUXA 5A0LA 1JRIA 3OW2S 4QVZA 3CPWS 2F69A 2CGHA 3JRZA 2DPPB 3L42A 3G71A 3L2QA 3RMSA 2F5KA 2VXEA 3ER0A 3MP6A 3OSVA 4M77A 4X34A 4OF1A 2MMPA 3WVDB 4DOWA 1S72T 3QSUA 4C92D 5CKDA 2E5QA 2LCCA 1VQ9T 4M7AB 4QVCA 3CCJA 2KSSA 3PNWC 2IVWA 3FRNA 2L5QA 3MEVA 4RCCA 1WJSA 3TREA 2ZPEB 1QW1A 2MWOA 3OYEA 3MEWA 1M1KU 2RI5A 3X28B 3KXTA 3PT9A 3RKWA 4HCCA 5CKEA 1M8VA 4MZTA 4Y28E 2A3LA 4A4HA 2JN0A 5EG2A 3BFMA 2QDYB 4EDUA 4QQGA 5J3BA 2JNGA 2EFIA 3JCMb 3QZ5B 5GANg 3RESA 4XU0A 4C5GA 3CC7T 2XICA 3SDZA 4N0AA 5DY9A 5HY6A 3VUZA 5DLOA 2EQJA 1VQMT 4LDXA 1Y96A 2L8DA 1WJRA 2VXFA 3M53A 5LJ5h 3CCLT 2P4TA 3MEAA 5AYFA 2E64A 1W2BA 1K9MU 3CCVT 2RHXA 4XTXA 2FHDA 1NJIC 2DXCA 3MCAB 1JB0E 1HK9A 3X20B 4BD3A 2E65A 4PJOD 3HKSA 5FU6B 5GANj 2CZ7B 5CCAA 1UEBA 1KQ2A 2DD4A 2DIQA 4M75A 3QIIA 1YCYA 3CC4T 3QYHB 1I8FA 2DIGA 1YBYA 2FVUA 1BI0A 2M16A 4NOYA 3VUBA 4B9WA 4JRQA 4JUVA 4BI8B 1I5LA 2O01E 4C0DB 1S72A 4IUUA 2M1HA 3S3MA 1W2BS 4M7DD 2QQBA 3CD6T 1VQ9A 3FIFA 3META 3OYFA 2RHUA 3F70A 4F7UG 4JJNK 4ME7A 2Y4XA 4GY5A 5FU7B 5D6YA 4M7AE 1KG1A 2WSFE 3OYLA 3JCMV 2R5AA 1X75C 4BUGA 3OS0A 2E70A 2VC8A 3LW5E 3QXEB 4JS4A 2CZ1B 2HNIA 2E12A 1JBMA 4F7UF 4XU3A 3UWNA 2QQAA 3CC7A 1KQSA 2FL7A 4M78G 3TCJA 2KAFA 2LVMA 2K3XA 4C5HA 1D3BB 5GAMh 3LX7A 4C8QC 3CCLA 3L2ZA 2DK3A 4C8QG 5LJ3e 1G3TA 3OYMA 2KVQG 3OYHA 4IUQA 4RG8A 4JS5A 3VYHB 2DD5A 3QBYA 4TVRA 5D6WA 2FB7A 4FL6A 2QA4T 1YJWT 4CRIA 3N5BB 1LNXA 2K57A 4NS5A 3SB2A 2JUFA 4M78F 4ZTFA 2X4WA 3CMAT 1PSEA 4OVAA 3CC4A 3ZFJA 1KQSS 4MMLA 2M0OA 1M9SA 4C8QF 3A8HB 2MWPA 3X24B 4OB3B 1YIJT 1B34A 2QXFA 3OMCA 5GAN6 2P0PA 3E9GA 3SFMA 4LD6A 4UC4A 4BE1A 4A4KA 1MHNA 4BE2A 4P5NA 3CD6A 1Y96B 2KMTA 1VIFA 4ZN1A 4V2SA 5C0MA 3JCMX 3FB9A 3R6OA 4FT2A 2LRQA 1RL2A 4DQ2A 3X26B 1YJ9T 3L2UA 1NJIU 3QYGB 4MZPA 4C92A 4IUTA 5FRMA 3CCRT 2EQKA 3A8LB 5FRNA 2EWNA 5GMKj 4XU2A 3C12A 4M75B 3INZA 4M77G 4O6JA 5GAOl 3OS1A 4DOVA 3MEUA 2D0QB 5GAN3 5IT9E 3JSCA 3CXCA 1Q82U 4J8OA 1WQ7A 1QVGA 1BIAA 1XNIA 1X6OA 2JTMA 5GMKi 2DVEA 4M77F 1QVFA 2XHCA 4EPCA 2RM4A 2WACA 2QA4A 3HL8A 1K8AC 2OTLA 4Z02A 3CMAA 4ZGJB 3E1SA 3WXMB 3QZ9B 2DKGA 3GLXA 2GQVA 4KT0E 2F5TX 3ASKA 4XTUA 3CXCS 1YI2T 4EMGA 5GAN2 1FXXA 1UGRB 2LT1A 3V8JA 5A0DA 1OZ2A 1YIJA 4PJOA 2PUKB 1EIFA 4N4IA 4VUBA 1D3BA 2X4XA 2G3RA 2EQMA 2XK0A 1HXDA 4IUVA 4OB1B 2DEQA 5LJ3d 1QVGS 1KC8C 1VQLT 4MDWA 3CBPA 4J6YA 2FYKA 3EAEA 1QVFS 1VQ4T 1BI2A 1WJQA 2R57A 3X25B 3LLRA 2CS7A 2EYQA 3BDUA 3KBGA 3M5AA 1NZ9A 1FX7A 2A7YA 3URGA 4A53A 1YJ9A 5GMKh 3OYGA 3A8OB 1UB4A 2K4YA 2QQRA 4BY6C 2EAYA 2KK4A 3CCRA 4M7DA 3M56A 4M78D 1KQ1A 2DAQA 3V7RA 3PIPA 4PKCC 3V7SA 3LYIA 2DZCA 4JRPA 3I55T 2YLCA 5LL6S 4EMKA 4ZN3A 1WGSA 4C8QD 1U1TA 2L3RA 4YTLA 4M75E 2K5FA 5I2SA 3OYNA 3CCST 1B34B 1JJ2A 2ZPIB 3M57A 3GOXA 3CMEA 4E7KA 3CCMT 1KHCA 1MGQA 1UGSB 1Y07A 1W4SA 3OYYA 1WQWA 3V8KA 4LDYA 1M5Q1 4BB7A 4LDUA 2KDSA 1SSFA 4C92B 1N9RA 2O4XB 3OBWA 3OQ5A 4QW2A 3JCMe 2QEXT 2OTLT 4PLIA 3P8HA 3GP8A 2VUBA 1YI2A 2V8JA 3OS5A 4M7AC 3E9FA 4O5VA 3JB9G 1JJ2S 1H3ZA 4M7AG 2E41A 1DJ7B 3G7ZA 2RJFA 4R55A 5I21A 1VQLA 2RHIA 3GIBA 2RJDA 1VQ4A 3OYKA 4A4EA 5KE3A 4MMKA 3SWNC 5LJ3f 3JB9I 1Q86C 2E6ZA 2JVVA 2RD1A 3JB9H 4BDZA 1K73C 3I56T 2C06A 3DB3A 4XU1A 2BKDN 3CCUT 3JB9F 3OS2A 1N27A 4M7AF 3OYDA 2E1HA 1K8AU 2DXUA 3JAME 1I4K1 5C6SA 3ZEHA 4LDVA 2GFUA 3I55A 2X4JA 1GXIE 1XOVA 5GAMd 4M78C 1Q81C 2D9TA 4MDXA 3JCMQ 1FWZA 3M9QA 4JDSA 3CCSA 4PJOB 1VQMA 2V8IA 3S3NA 3M54A 5CO7A 5GMKl 3L2VA 5FU6C 3CCMA 1KC8U 5GANh 3CPFA 2PVGB 2ZPHB 5GAN4 3CCVA 1Q7YC 4QQ6A 3RKXA 4A4FA 3RERA 1VQ7T 2XKOC 3L2WA 3OYJA 3T9NA 3DKMA 4M7DB 2BIVA 4HA8A 5DLQE 2LX9A 5GAOn 4C0DC 2PQWA 3FEOA 3V7CA 3QPHA 4IUPA 3S3OA 3KUFA 1VQ8T 4C0ZA 1VQ6T 4OB0B 3VKIA 2PVDB 4C92E 3QDRB 3OBYA 4EMKB 2BUDA 2RJCA 3OYAA 1NE8A 1VQOT 5LJ5e 2GF7A 1VQPT 4L6V5 4HT8A 4C5EA 4J5YA 2DTHA 3L1AA 4XTVA 4Q5WA 4PNOA 4F7UA 3I56A 3CCET 3JCMd 4J6WA 3DLLA 3CCUA 2WSEE 2XDDA 3LGFA 2O4XA 5HKCA 4E7IA 2RHYA 1M1FA 1IREB 1NPPA 4C8QE 4M77C 3G6ET 2QEXA 2RB6A 3G71T 4KUDK 2DZ9A 3LWHA 5LJ3g 4OGCA 1RI0A 2X35A 2MI6A 4BI4A 2WSCE 1OI1A 2XI9A 2GCXA 2YLBA 3UT1A 4BDYA 3H6ZA 3MP8A 1OZ3A 1VQKT 1ZHIA 5GAMf 1M1GA 5DM7R 3OW2A 2M9UA 2ZPGB 5J26A 2EQUA 4PJOE 2H3JA 3JB9J 3PTAA 2QQSA 4C8QA 4ZTJA 2Y90A 2P0QA 1YJWA 3PFSA 1VQ7A 4ELZC 4OMFB 5LJ3j 4OB2B 1K73U 2VV5A 2V8KA 3NFCA 3JB9D 4M7AD 1BI3A 3OYIA 1VQ6A 1VQ8A 1U1SA 4N0AC 4D6WA 4XTWA 3WVEB 2LTOA 3JCMc 1R8OB 3A8GB 4M7DE 1YITT 3UDCA 2LT4A 2HD0A 3G4ST 3VYGA 2XD0A 1Q81U 5GAMe 1VQOA 1N8RC 1BI1A 5GAOm 5KE2A 3GNGA 2HQEA 3DLMA 4MZMA 1VQPA 1G3WA 3RKYA 2HQXA 2RI2A 3AHUA 3OB9A 3ZBDA 3NTIA 1VQ5T 3RMQA 2DTOA 3CCEA 3PIOA 1QP3A 3HRSA 2R5MA 2L89A 4M75G 1U8RA 1LOJA 4A4GA 2MF2A 1QP2A 2XDPA 3CEYA 4EMHA 1V29B 3G6EA 1O75A 2OTJT 2EKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJ7 B;  3VYH B;  2DD5 A;  2PUO B;  2PVO B;  1PSE A;  1UGP B;  4RKU E;  3A8H B;  4XK8 E;  3X24 B;  4OB3 B;  4ZGD B;  1GXI E;  1PSF A;  2ZCF B;  3HHT B;  4ZGE B;  2AHJ B;  3X26 B;  2DPP B;  2PVG B;  2ZPF B;  2ZPH B;  3QYG B;  3A8L B;  2PU9 B;  2ZPB B;  3WVD B;  2D0Q B;  4OB0 B;  2PVD B;  2ZPE B;  2CZ0 B;  3X28 B;  1AHJ B;  4Y28 E;  4L6V 5;  2QDY B;  3QZ5 B;  2CZ6 B;  4ZGJ B;  3QZ9 B;  4KT0 E;  4FM4 B;  2WSE E;  1UGR B;  1IRE B;  2PUK B;  4OB1 B;  2DXC A;  1JB0 E;  3X20 B;  2WSC E;  3X25 B;  2CZ7 B;  2DD4 A;  2ZPG B;  3A8O B;  3QYH B;  2DXB A;  2ZZD A;  2O01 E;  4OB2 B;  3WVE B;  3A8G B;  2ZPI B;  2CYZ B;  2WSF E;  3VYG A;  1UGS B;  3A8M B;  3LW5 E;  1UGQ B;  3QXE B;  5L8R E;  2CZ1 B;  1QP3 A;  1QP2 A;  1V29 B; 
#chains in the Genus database with same CATH topology
 3JCM f;  1WA7 A;  5GJW B;  2YRV A;  4NL3 A;  2GNC A;  2B8A A;  3QO3 A;  3O8V A;  4JZ4 A;  4RG2 A;  2RK2 A;  4RMO A;  2MAM A;  3EFS A;  2IIM A;  5IXB A;  1X6G A;  3BY7 A;  4OP0 A;  2QQ9 A;  4F7U B;  2FPE A;  4ZGD B;  4B6M A;  5CKB A;  3R6N A;  3EGD B;  2ZCF B;  2VGM A;  1WNL A;  3PMI A;  1YIT A;  1AWJ A;  1RLP C;  2ZPF B;  1RAI B;  3P8B B;  4ZNX A;  2AZV A;  5GAN 8;  5A2Q E;  5GAM j;  5GAO p;  1HJD A;  1UFF A;  3Q1J A;  2KXD A;  1T0H A;  3EG1 A;  3LH0 A;  4E7L A;  2QEX Q;  5I2M A;  2DBM A;  1Q82 C;  1NPR A;  4OMM A;  1KHI A;  4JJC A;  1IZ6 A;  3MO8 A;  1QCN A;  8ATC B;  1N8R U;  3FJP A;  1SPK A;  3JCM g;  2D6F A;  3CCQ T;  1WPY A;  5HK0 A;  1WHM A;  2LDM A;  1J3T A;  1IO6 A;  4X9D A;  3LGL A;  4F7U E;  5KH6 A;  2E3H A;  1AD5 A;  4R0K A;  4E2F B;  5A0G A;  3HRU A;  4JLI A;  4E47 A;  1N8R R;  3TVT A;  4F14 A;  1K4U S;  2D8J A;  3M0R A;  3S6W A;  4FIB A;  1N6A A;  5CR2 A;  1MMD A;  4J9E A;  2HL5 C;  5IXF A;  2HMA A;  3H8Z A;  2VYT A;  2E6N A;  3M4G A;  1YHQ A;  1RAA B;  1VUB A;  2KXC A;  1NG2 A;  2CYZ B;  4Y91 A;  1QLY A;  2FPD A;  1TH7 A;  2P4R A;  1OYX A;  2K5L A;  1BKB A;  3HFO A;  3U23 A;  1UGQ B;  2JS2 A;  3BDL A;  3J81 E;  3HFN A;  1IGQ A;  1OQK A;  5I22 A;  1K9M C;  5KYY B;  3QUI A;  3VU3 C;  2HKQ B;  3RIR A;  4PJO F;  1QCO A;  3UAT A;  1W70 A;  3OMG A;  4LDW A;  1MNE A;  1PC0 A;  1X2Q A;  4BAC A;  2CKK A;  3G71 Q;  3NMZ C;  2XG8 D;  3AT1 B;  4KH0 B;  5CK9 A;  1UGP B;  2J6F A;  4M7D F;  4IUR A;  4C0G A;  3FJ5 A;  4XQ3 A;  5GAN 5;  5LJ5 j;  4DA4 A;  4J6X A;  1PSF A;  5A0L A;  3RUX A;  4AFQ C;  4QVZ A;  3G71 A;  1NBE B;  3RMS A;  2F5K A;  3MP6 A;  4OF1 A;  4DOW A;  3G4S Q;  2MK5 A;  2LCC A;  2KSS A;  3MEV A;  2L5Q A;  2LQN A;  1QW1 A;  5HCK A;  3KXT A;  1AT1 B;  3RKW A;  1Z9Z A;  1M8V A;  2A3L A;  3BFM A;  4EDU A;  4XU0 A;  4C5G A;  4KGV B;  3M0P A;  2XIC A;  4N0A A;  3VS7 A;  5HY6 A;  2JJ9 A;  4LDX A;  2L8D A;  5KYY A;  2SRC A;  2K7A A;  2P4T A;  1W1F A;  2FHD A;  2DXC A;  4PJO D;  1G83 A;  5GAN j;  1M2V B;  3CC4 T;  4FW2 A;  2RMO A;  2LQW A;  4JUV A;  4BI8 B;  1I5L A;  1X6B A;  3NPF A;  4C0D B;  2M1H A;  2GQI A;  5IHN A;  4M7D D;  2DRM A;  1VQ9 A;  2DYI A;  4JJN K;  2XMF A;  4ME7 A;  2Y4X A;  2LNH B;  1KG1 A;  3OYL A;  2KNB B;  3JCM V;  1SKU B;  2NUP B;  2VC8 A;  3QXE B;  2CZ1 B;  1YJN Q;  1VQN Q;  4X1V A;  4XU3 A;  3UWN A;  1YP5 A;  2FL7 A;  1C0M A;  3L2Z A;  5LJ3 e;  4JS5 A;  2RQW A;  2CP3 A;  4RG8 A;  2DD5 A;  1YJW T;  3M0S A;  4NS5 A;  2JUF A;  4ZTF A;  2EGC A;  3ZFJ A;  1M9S A;  3X24 B;  4OB3 B;  1B34 A;  1RAG B;  3OMC A;  4UC4 A;  2ECZ A;  4A4K A;  1OU8 A;  4FYW B;  2ATC B;  2BE7 D;  2EW3 A;  3FB9 A;  2NUZ A;  5FWB A;  1RL2 A;  4RTV A;  1NJI U;  1M2V A;  5FRM A;  3JSC A;  1E6H A;  2RQU A;  4D8D A;  2NUT A;  1I5O B;  5GMK i;  1NJI R;  1WI7 A;  3QZ9 B;  3GLX A;  2GQV A;  3ASK A;  4XTU A;  1YI2 T;  4EMG A;  2X51 A;  1PG5 B;  2AK5 A;  3V8J A;  2E3I A;  4OB1 B;  1NYF A;  2X4X A;  2XK0 A;  2J06 A;  5LJ3 d;  2DEQ A;  4MDW A;  2YT6 A;  1VQ4 T;  1WJQ A;  3X25 B;  2R57 A;  3LLR A;  3BDU A;  1RAE B;  1M30 A;  1VYV A;  2HZY A;  2EGE A;  3URG A;  5GMK h;  1YJ9 A;  4ANJ A;  2KK4 A;  4DBH A;  2DAQ A;  2MPX C;  3I55 T;  4EMK A;  2D1X A;  2K5F A;  1TOV A;  2RF0 A;  3THK A;  1S72 Q;  2ZPI B;  3M57 A;  3GOX A;  3CCM T;  1LPL A;  1M5Q 1;  4BB7 A;  4OMP A;  1EX4 A;  1SSF A;  1KSW A;  1N9R A;  1TG0 A;  3OBW A;  2HQH A;  3OQ5 A;  3VS5 A;  2OTL T;  2EYY A;  2A36 A;  6AT1 B;  1WXB A;  3OS5 A;  4M7A C;  4O5V A;  1H3Z A;  4M7A G;  1UE9 A;  3G7Z A;  4R55 A;  1VQM Q;  3TQ7 P;  1D0Z A;  1OPL A;  3D7S B;  2BZX A;  3CCV Q;  1K73 C;  1N27 A;  2BZY A;  2DXU A;  4FSS A;  4FCY A;  1U5S A;  2AKL A;  1GXI E;  1XOV A;  5GAM d;  4M78 C;  1OX8 A;  4MDX A;  3M9Q A;  4JDS A;  4PJO B;  1VQM A;  2V8I A;  1TUG B;  4AFU C;  1WXT A;  3A1P A;  3CD6 Q;  5GAN 4;  3CCV A;  1AWX A;  4RTX A;  2EYZ A;  2ED0 A;  1ABQ A;  3MPU B;  3OYJ A;  2DFU A;  1UJ0 A;  5DLQ E;  4M7D B;  3I35 A;  1VQ6 T;  3QPH A;  4IUP A;  3QDR B;  1TUC A;  2O31 A;  3OYA A;  1NE8 A;  1ZSG A;  1VQO T;  2LMJ A;  5LJ5 e;  4L6V 5;  2DL5 A;  1EFN A;  3L1A A;  3I56 A;  3RDV A;  3DLL A;  3EG9 A;  2QA4 Q;  2COZ A;  2XDD A;  1QCF A;  5HKC A;  1M1F A;  4C8Q E;  1IRE B;  4M77 C;  1AWW A;  3LWH A;  2ESW A;  2M0Y A;  2MI6 A;  3UT1 A;  1YIJ Q;  2GCX A;  3OW2 A;  2EQU A;  4PJO E;  1TU0 B;  1CSK A;  4C8Q A;  4DBR A;  3PFS A;  1VQ7 A;  1UGV A;  3PVL A;  1BI3 A;  3CCR Q;  4KH1 B;  4F17 A;  1ZX6 A;  2HCK A;  2KE9 A;  2LTO A;  4DEX A;  1R8O B;  2VB6 A;  3VS6 A;  2MYS A;  4M7D E;  2HD0 A;  3QDF A;  3VYG A;  2XD0 A;  3GNG A;  2EGA A;  3DLM A;  1FMK A;  2AIR B;  2D0N A;  2HKN A;  4QT7 A;  2EPD A;  2DTO A;  1Q86 R;  3CCE A;  1U8R A;  1RI9 A;  1LOJ A;  4A4G A;  2XDP A;  1QP2 A;  2OTJ T;  1O75 A;  4IIO A;  3CBO A;  1BYM A;  4AFS C;  4HKE A;  4HVV A;  2FO0 A;  4K11 A;  5LJ5 d;  2DJZ A;  4CI0 C;  3P8D A;  3OYC A;  2KRN A;  2ZGW A;  1VQK A;  2FZK B;  5IHK A;  1W2B P;  1PWT A;  2R58 A;  4RKU E;  2C0I A;  4L59 A;  1ABO A;  1M4Z A;  2PNI A;  1Q7Y R;  3I9Q A;  2DA9 A;  4J7I A;  4XAX B;  5CVI A;  3MKD A;  3BW1 A;  4C0F A;  3M4Y A;  1KJW A;  3M0Q A;  4N4G A;  1H3H A;  2PU9 B;  2ZPB B;  3PGG A;  4E7J A;  1XQH A;  2RK1 A;  1VQ5 A;  2EJ9 A;  2I0N A;  1AVZ C;  1XTD A;  3HP9 A;  2VVK A;  3MHX A;  5KCH A;  3LWI A;  1Y57 A;  1KQS P;  3GF5 A;  4XTZ A;  3SD4 A;  2MIO A;  2QTX A;  5HK3 A;  1G3Y A;  5GAN d;  3VS3 A;  4WCI A;  1ZSZ B;  3M59 A;  4R56 A;  1K9M R;  4WF2 A;  3TEE A;  4C92 C;  4KUL A;  1QMC A;  4PFZ A;  4XTY A;  2OAU A;  4C92 G;  3VJP A;  2YHT A;  4RTY A;  3MP1 A;  2OAW A;  3JCM W;  4HVU A;  2CUB A;  3NHN A;  2DTI A;  1G3S A;  2X3X D;  3EHR A;  5KYU B;  2ZZD A;  4KRT A;  1JXO A;  1ARK A;  2G6F X;  3CC2 T;  2E10 A;  1KD1 U;  1YCS B;  5FW9 A;  1PRM C;  5M9O A;  4ESR A;  1M90 U;  4FSX A;  4II1 A;  2KR3 A;  2LNV A;  2Y4Y A;  2COY A;  4QQD A;  3QHS A;  2JM9 A;  5KCO A;  1QVG P;  1I81 A;  2YUO A;  1N9S A;  1VQP Q;  2Z0W A;  4JRI A;  2YUN A;  4GLK A;  3CCJ T;  1JU5 C;  3EFR A;  3CCQ A;  1CKB A;  1KD1 R;  4LNP A;  1MMA A;  3NTK A;  5IHI A;  1YFN A;  1G5V A;  1Z9Q A;  2JZ2 A;  5GAO q;  2PUO B;  4KUI A;  3G6E Q;  3CPW A;  2GFA A;  2DXT A;  1Y71 A;  5J39 A;  2LQ8 A;  2X4Y A;  3CME T;  4BE0 A;  3NTH A;  5IN1 A;  3J80 E;  3V8L A;  3OA6 A;  4M75 C;  3GBQ A;  1IHW A;  3CPW S;  1G8X A;  3L2Q A;  4RUG A;  3OSV A;  5KYU A;  3WVD B;  1YIT Q;  2B86 A;  2E5Q A;  5EC7 A;  2A37 A;  2ZAE A;  3EFO A;  2ZPE B;  1M1K U;  2RI5 A;  3X28 B;  1NLO C;  4MZT A;  1T0J A;  2LJ0 A;  2QDY B;  3VS4 A;  3RES A;  3ULR B;  2K3B A;  5DY9 A;  3VUZ A;  1QWE A;  1Y96 A;  1WJR A;  2VXF A;  3M53 A;  4XTX A;  1M1K R;  1JB0 E;  1I07 A;  3X20 B;  2W10 A;  5CCA A;  2DD4 A;  4M75 A;  2DM1 A;  1BU1 A;  2FVU A;  4B9W A;  2CP6 A;  3VUB A;  4JRQ A;  1YNZ A;  2O01 E;  1M3B A;  3E2U A;  2RHU A;  3F70 A;  4F7U G;  1D09 B;  2HSE B;  1X75 C;  1K76 A;  2R5A A;  1YHQ Q;  2E70 A;  3LW5 E;  3EGU A;  3CC4 Q;  2QQA A;  3EG3 A;  1OUL A;  4C5H A;  1D3B B;  3LX7 A;  1C6V X;  2KVQ G;  4IUQ A;  2EYX A;  3VYH B;  1JQQ A;  3QBY A;  4M4Z A;  4OMQ A;  4FL6 A;  2DIL A;  4CRI A;  1LNX A;  2J6O A;  4M78 F;  1Q95 G;  3CMA T;  1PSE A;  3CC4 A;  1R0C B;  4C8Q F;  3A8H B;  1AOJ A;  3E9G A;  1MND A;  1UTI A;  4BE1 A;  4BE2 A;  1UG1 A;  5C0M A;  5KYN A;  4RTW A;  4FT2 A;  2LRQ A;  3EHQ A;  1C1A A;  2K79 A;  4XU2 A;  4O6J A;  5GAO l;  3REB B;  4DOV A;  3MEU A;  4J9C A;  1K9A A;  2D0Q B;  3CXC A;  3UF4 A;  4GLM A;  3H0I A;  2MOX A;  2FZC B;  4J8O A;  1WQ7 A;  1X6O A;  1QVF A;  2DVE A;  4M77 F;  2XHC A;  4EPC A;  4J9H A;  4Z02 A;  3WXM B;  2DKG A;  2F5T X;  1X69 A;  2L3P A;  3CXC S;  2DL3 A;  1UGR B;  2PUK B;  4VUB A;  1D3B A;  1K1Z A;  4E7Z A;  1QVF S;  1TS9 A;  1BI2 A;  2CS7 A;  2EYQ A;  1NZ9 A;  4DBQ A;  4A63 B;  3OYG A;  2RQV A;  1K73 R;  1UB4 A;  2K4Y A;  2DER A;  4M78 D;  1RUW A;  4PKC C;  3LYI A;  2DZC A;  2LJ1 A;  1IGU A;  5LL6 S;  4C8Q D;  4YTL A;  2CT4 A;  3H0F A;  4RTU A;  1NEG A;  3OYN A;  1B34 B;  4GBQ A;  1JJ2 A;  1KK7 A;  1I0C A;  1UGS B;  1Y07 A;  3V8K A;  1VQ9 Q;  1VQ4 Q;  3PVQ A;  4LDY A;  1BBZ A;  2KDS A;  1RAD B;  3HTR A;  2O4X B;  4QW2 A;  2QEX T;  1OV3 A;  3JCM e;  2CH4 A;  4DBF A;  1YI2 A;  2V8J A;  3I55 Q;  3E9F A;  3JB9 G;  1JJ2 S;  1DJ7 B;  2ED1 A;  1WHH A;  2RJF A;  2RHI A;  1VQ4 A;  4MMK A;  3SWN C;  3JB9 I;  1SRM A;  2JVV A;  1BK2 A;  2NUT B;  1K0S A;  4XU1 A;  2DVJ A;  3OS2 A;  2E1H A;  1K8A U;  1RAC B;  4LXC A;  3ZEH A;  4LDV A;  3I55 A;  2L3S A;  1Q81 C;  2D9T A;  1SEM A;  2DJQ A;  2DLP A;  3M54 A;  5CO7 A;  5GMK l;  3EH2 A;  3CCM A;  1KC8 U;  3EGX A;  5IH2 A;  5L23 A;  2JMC A;  3RER A;  2XKO C;  1NM7 A;  1D0X A;  1K8A R;  2BIV A;  5GAO n;  2LX9 A;  4C0D C;  3V7C A;  1VQ8 T;  2OTL A;  2YUQ A;  3KUF A;  4C0Z A;  3MJX A;  1GBR A;  4EMK B;  2BUD A;  4Z8A A;  2RJC A;  2GF7 A;  1KC8 R;  4J5Y A;  4D8K A;  3JCM d;  4J6W A;  2O4X A;  5GJV B;  2EKH A;  2RHY A;  1NPP A;  3RR6 A;  2RB6 A;  3G71 T;  2DZ9 A;  4OGC A;  2QAZ A;  1CKA A;  1ZA1 B;  2CP0 A;  4BI4 A;  4BDY A;  3H6Z A;  1LCK A;  3PTA A;  2QQS A;  2GTO A;  2P0Q A;  1YJ9 Q;  4OB2 B;  4JPB W;  2FPF A;  3LH5 A;  1VQ6 A;  1UJY A;  1AEY A;  1ACM B;  3WVE B;  2EBP A;  3PE0 A;  3G4S T;  2M02 A;  5GAM e;  1D0Y A;  1VQO A;  1N8R C;  5KE2 A;  1U3O A;  3RKY A;  2HQX A;  2QYZ A;  2VWF A;  3VS2 A;  3AHU A;  1GFC A;  3ZBD A;  2NWM A;  1PHT A;  3PIO A;  1QP3 A;  2OJ2 A;  2R5M A;  1SSH A;  1V29 B;  1XJW B;  1WFW A;  2O9V A;  3CBM A;  2EIF A;  4KGX B;  4M75 F;  2XDB A;  5LJ3 h;  1QWF A;  3DB4 A;  2CT3 A;  1AZE A;  4LN2 A;  1PKS A;  3EG9 B;  2RO0 A;  5CKF A;  4L5G A;  2RQR A;  2IPO B;  1WHJ A;  1GRI A;  1QQJ A;  3C95 A;  5CQX A;  3M55 A;  1LJO A;  2IG0 A;  4M78 B;  5CIU A;  1D1B A;  4BI3 A;  1AWO A;  4C8Q B;  1Y0M A;  3J7A F;  2OI3 A;  3OSS C;  1Y7X A;  1IRX A;  2CZ0 B;  1YJN T;  1VQN T;  2OTJ A;  4PJM A;  1G2B A;  4FW1 A;  5FRO A;  1ZQ1 A;  2F2W A;  2CZ6 B;  3M0T A;  2AZS A;  2FRY A;  2V26 A;  1RAH B;  3I56 Q;  2V1Q A;  2F2V A;  3L2R A;  4OMN A;  4HCZ A;  2YDL A;  3C4S A;  4M77 B;  5FU7 C;  4M7A A;  4M75 D;  2HDA A;  4HCB A;  2XID A;  4M78 E;  5CAI A;  1ZBX A;  1VQ7 Q;  4HT9 A;  2P0K A;  1QVP A;  4PJO C;  4JRK A;  4PJO G;  1B07 A;  2NLU A;  3GPL A;  2VGN A;  2JTE A;  2LCS A;  3HRT A;  2FEI A;  5L8R E;  3M58 A;  2F2X A;  4M78 A;  4HVW A;  2HEQ A;  4ATO A;  1B7T A;  2K2V A;  4M7D C;  2LQK A;  4FT4 A;  1Q86 U;  4M7D G;  3CCE Q;  3HPW A;  1PCX A;  3QG1 A;  1WDX A;  5CQY A;  4BY6 B;  4X9C A;  2YWW A;  2JTF A;  1LVK A;  3C94 A;  3E19 A;  3JCM J;  1FYN A;  1VQK Q;  2XU8 A;  1K0X A;  1UUE A;  1MMG A;  4KBM B;  4M77 E;  2HBP A;  5GAN e;  5IAY A;  4B9X A;  1JEG A;  1ZUK A;  4JLG A;  3UPU A;  3CC2 A;  5KYW B;  2GTJ A;  3UA6 A;  1Q7Y U;  2RHZ A;  3HHT B;  5KYX B;  2CGH A;  2LJ3 A;  2DPP B;  3L42 A;  3VS0 A;  2VXE A;  2DL8 A;  4M77 A;  4X34 A;  1Q82 R;  1BCO A;  2MMP A;  1S72 T;  5CKD A;  1T3S A;  4QVC A;  3CCJ A;  3TRE A;  2IVW A;  3FRN A;  3RNJ A;  4FYY B;  1VQ5 Q;  3MEW A;  2NYS A;  3PT9 A;  1F1B B;  4HCC A;  5CKE A;  1I1J A;  4Y28 E;  4A4H A;  1QKX A;  4QQG A;  5J3B A;  2EFI A;  3JCM b;  3RBB B;  4J9B A;  3CC7 T;  1SHF A;  3SDZ A;  1VQM T;  5LJ5 h;  3CCL T;  1OPK A;  5AT1 B;  2K2M A;  1EZZ B;  1PRL C;  1K9M U;  2BTT A;  3CCV T;  1NJI C;  3MCA B;  1HK9 A;  4PJJ A;  5FU6 B;  2CSI A;  1KQ2 A;  4Y92 A;  3SHW A;  1WHK A;  3I5R A;  3QYH B;  1I8F A;  2DIG A;  4E6R A;  3TSW A;  2JM8 A;  2COW A;  3QWX X;  1M2O A;  3CD6 T;  3FIF A;  3MET A;  3OYF A;  3VRY A;  5KYW A;  2RPN A;  2WSF E;  4AMC A;  4CC3 A;  4BUG A;  5KYX A;  4JS4 A;  2HNI A;  1JBM A;  1M3C A;  2SEM A;  1HYO A;  3TSZ A;  3TCJ A;  2KAF A;  2CP7 A;  1BCM A;  2K3X A;  2DF6 A;  1RAF B;  2AKK A;  2DK3 A;  1G3T A;  1TUD A;  1D1C A;  3EFO B;  5D6W A;  3CCQ Q;  2FB7 A;  2QA4 T;  2MCN A;  1FMV A;  3N5B B;  2K57 A;  2X4W A;  4DEY A;  4OVA A;  2J6K A;  1ZSZ C;  4ORZ A;  1YIJ T;  2QXF A;  3KFV A;  5GAN 6;  2P0P A;  3OW2 P;  1GCP A;  3SFM A;  4LD6 A;  2CP5 A;  4P5N A;  1Y96 B;  1VIF A;  3O5Z A;  4V2S A;  3JCM X;  2YUP A;  3X26 B;  3L2U A;  3QYG B;  4C92 A;  4IUT A;  3CCR T;  2EQK A;  5FRN A;  1M27 C;  3CMA Q;  5GMK j;  3C12 A;  4M75 B;  3OS1 A;  2BZ8 A;  4J9I A;  1XNI A;  2KYM A;  1IB8 A;  2RNA A;  2RM4 A;  3CMA A;  4ZGJ B;  3E1S A;  5GAN 2;  1FXX A;  2LT1 A;  4E7S A;  2G3R A;  2EQM A;  1HXD A;  1VQL T;  4J6Y A;  2DNU A;  2ABL A;  3M5A A;  1FX7 A;  1E7O A;  4A53 A;  2QQR A;  1UEC A;  2EAY A;  1KQ1 A;  3PIP A;  2YRC A;  3V7S A;  2CH4 W;  2YLC A;  2FG0 A;  1WZO A;  4ZN3 A;  1U1T A;  2L3R A;  1Q81 R;  2CDT A;  2QK0 A;  4M75 E;  3CCS T;  3NGP A;  4E7K A;  1KHC A;  1W4S A;  2JMA A;  3OYY A;  2HBW A;  3EH1 A;  3REA B;  8AT1 B;  1H92 A;  4LDU A;  2QTV A;  1T3L A;  2EQI A;  2EVR A;  1NYG A;  2A08 A;  2DX1 A;  3GP8 A;  4IIM A;  2PZ1 A;  2E41 A;  3GIB A;  2QDL A;  4QKU A;  4A4E A;  2BE9 B;  1VOM A;  2YXY A;  5LJ3 f;  1Q86 C;  2E6Z A;  2RD1 A;  2RQT A;  3JB9 H;  2BKD N;  3CCU T;  4M7A F;  5C6S A;  2GFU A;  2L0A A;  2X4J A;  1PD1 A;  3JCM Q;  4JJB A;  1BB9 A;  4JJD A;  1WHL A;  3CPF A;  1Q7Y C;  1PM3 A;  2X9H A;  4F16 A;  3L2W A;  4AG1 C;  3DKM A;  1B3Q A;  4HA8 A;  2QEX A;  3S3O A;  1IXD A;  2PQW A;  3FEO A;  1OU9 A;  4J9G A;  4OB0 B;  3VKI A;  2PVD B;  1MUZ A;  9ATC B;  1VQP T;  1UHC A;  4C5E A;  1ZA2 B;  7AT1 B;  1QKW A;  2DTH A;  4XTV A;  4Q5W A;  4PNO A;  4F7U A;  3ZL7 C;  1YJW Q;  2WSE E;  3CPW P;  4E7I A;  3G6E T;  3EGD A;  1VQ8 Q;  5LJ3 g;  2ROL A;  1OEB A;  2X35 A;  1OI1 A;  2YLB A;  5GAM f;  5DM7 R;  1M1G A;  2F1L A;  2KEA A;  2H3J A;  4Z89 A;  4ZTJ A;  1YJW A;  4ELZ C;  1K73 U;  2VV5 A;  2V8K A;  3NFC A;  4PFP A;  4M7A D;  3OYI A;  2JXB A;  1VQ8 A;  1U1S A;  1WHG A;  4N0A C;  3A8G B;  3VRZ A;  3H0H A;  2VKN A;  1YIT T;  1BI1 A;  5GAO m;  2QGG A;  2KRO A;  2RI2 A;  2DRK A;  3EGX B;  2HSP A;  1GL5 A;  3RMQ A;  2P84 A;  2VAS A;  3HRS A;  1SRL A;  2E5K A;  2MF2 A;  4EMH A;  3CEY A;  3A98 A;  2L3Q A;  4QVD A;  5FWC A;  1BIB A;  4E7H A;  2QI2 A;  1YI2 Q;  1E6G A;  3FLG A;  1GCQ C;  2DE0 X;  4PLL A;  2RI3 A;  2PVO B;  5GAO r;  2DL7 A;  2K3Y A;  1KD1 C;  2L2P A;  1M90 C;  4J9F A;  3SWN B;  5GAM g;  3OY9 A;  4CC7 A;  4ZGE B;  1X01 A;  1VIE A;  2AHJ B;  1JO8 A;  2H3E B;  2H8H A;  1HD3 A;  3G4S A;  2EJG A;  1U06 A;  4NL2 A;  4WTO B;  3CCM Q;  3FDR A;  4OGE A;  4M77 D;  1TTH B;  2OX7 A;  2YSQ A;  1YHQ T;  1O9S A;  2O2O A;  2OTL Q;  1AHJ B;  4N4H A;  3M0U A;  3ME9 A;  4C5I A;  4J7F A;  5LJ5 f;  1GCQ A;  1MV0 B;  4FM4 B;  1TXQ A;  2E4H A;  4RCB A;  3TU4 K;  5GMK e;  2RJE A;  2HAX A;  5D7U A;  3HSB A;  1H64 1;  4IKF A;  3QJY A;  4J83 A;  5D6X A;  2RH2 A;  3QKJ A;  2QAS A;  3JCM P;  1P92 A;  2DMO A;  5GAN 7;  4FU6 A;  4C92 F;  3QJ6 A;  2DXB A;  4Z88 A;  2JS0 A;  4AFZ C;  3VV0 A;  1X27 A;  1M1K C;  1GFD A;  1NEB A;  2KQW A;  3PMT A;  5GMK m;  4KGZ B;  1OX9 A;  5CKH A;  3SWN A;  2JW4 A;  1YJN A;  1VQN A;  2LC4 A;  4A54 A;  2KY9 A;  3A8M B;  2V1R A;  2LCL A;  1VQ6 Q;  4LUD A;  3CXC P;  2K5I A;  1PKT A;  2RN8 A;  3H41 A;  2CRE A;  4LD9 K;  5FLX E;  1VQO Q;  3FC3 A;  1QVF P;  2RA2 A;  4AT1 B;  3GNF B;  5GAN f;  3OYB A;  4ELY C;  2GGR A;  2I2L A;  3EG0 A;  1S1N A;  2JOY A;  2EJF A;  4EMK C;  2O9S A;  1M8M A;  5LJ5 g;  3JCM h;  2QG9 B;  5I11 A;  4PL6 A;  2DBK A;  4OML A;  2DO3 A;  4XK8 E;  3A5Z B;  1YWP A;  1JRI A;  2NUP A;  3VS1 A;  2F69 A;  3JRZ A;  2J05 A;  2KI7 A;  3BE3 A;  3ER0 A;  1JJ2 P;  3QSU A;  4C92 D;  4PFO A;  1D1A A;  1VQ9 T;  4M7A B;  3CQT A;  2A28 A;  4RCC A;  3PNW C;  1WJS A;  2C0T A;  2MWO A;  3OYE A;  4JZ3 A;  2JN0 A;  5EG2 A;  2OTJ Q;  2JNG A;  3QZ5 B;  5GAN g;  4PJN A;  2AT1 B;  2EYW A;  5DLO A;  2EQJ A;  1V76 A;  1WIE A;  3MEA A;  5AYF A;  2E64 A;  1YWO A;  1W2B A;  2RHX A;  2CP2 A;  1VYU A;  4BD3 A;  2E65 A;  3HKS A;  2CZ7 B;  1UEB A;  2K6D A;  2DIQ A;  3QII A;  1YCY A;  1ZLM A;  2M16 A;  1YBY A;  1BI0 A;  4NOY A;  1GBQ A;  3CC7 Q;  1S72 A;  4IUU A;  3S3M A;  1W2B S;  2QQB A;  2ROT A;  3CCL Q;  4GY5 A;  4LUE A;  5FU7 B;  5D6Y A;  4M7A E;  3OS0 A;  1SF9 A;  2KRS A;  4PJL A;  2E12 A;  2KYB A;  1NLP C;  4F7U F;  3CC7 A;  1KQS A;  1H8K A;  4M78 G;  3UA7 A;  2LVM A;  5GAM h;  4C8Q C;  2YRD A;  3CCL A;  3OYH A;  4C8Q G;  3OYM A;  2DL4 A;  2KT1 A;  4TVR A;  3SB2 A;  2DYB A;  1SHG A;  1KQS S;  4MML A;  2M0O A;  2MWP A;  1V1C A;  1KFZ A;  4CC2 A;  1MHN A;  1UHF A;  3CD6 A;  2KMT A;  4ZN1 A;  3QWY A;  2KBT A;  3R6O A;  4DQ2 A;  2M51 A;  1YJ9 T;  3CC2 Q;  4MZP A;  1HSQ A;  1WXU A;  3A8L B;  2EWN A;  3INZ A;  4M77 G;  5GAN 3;  5IT9 E;  4RTT A;  1Q82 U;  3IQL A;  1QVG A;  1BIA A;  1VYT A;  2JTM A;  3CCJ Q;  2WAC A;  2QA4 A;  3HL8 A;  2FRW A;  1K8A C;  4KT0 E;  2PTK A;  5A0D A;  1OZ2 A;  1ZBJ A;  1YIJ A;  4PJO A;  1ZUY A;  1EIF A;  4N4I A;  3OW2 S;  4IUV A;  1QVG S;  1KC8 C;  3CBP A;  1N5Z A;  3CME Q;  2FYK A;  3EAE A;  1FMW A;  1TWB A;  3KBG A;  2QGF B;  2A7Y A;  3A8O B;  2CUD A;  4BY6 C;  3CCR A;  4M7D A;  3M56 A;  3V7R A;  4JRP A;  4HXJ A;  1WGS A;  1R77 A;  5I2S A;  4LE9 A;  1YN8 A;  3CME A;  1VQL Q;  1MGQ A;  1WQW A;  1RLQ C;  2D8H A;  2J7I A;  3EG2 A;  4C92 B;  4PLI A;  3P8H A;  2VUB A;  3I5S A;  1ZUU A;  1PNJ A;  1JXM A;  1VA7 A;  3CCS Q;  5I21 A;  1VQL A;  2RJD A;  3OYK A;  5KE3 A;  1UDL A;  4BDZ A;  1TSF A;  3I56 T;  2C06 A;  3DB3 A;  3H9N A;  1RAB B;  2HL3 A;  2W0Z A;  4FYX B;  3JB9 F;  1WYX A;  2CSQ A;  2FZG B;  3OYD A;  4CC4 B;  3JAM E;  1I4K 1;  2KGT A;  2KT8 A;  1FWZ A;  3CCS A;  4HCK A;  3S3N A;  3JV3 A;  3L2V A;  5FU6 C;  5GAN h;  2PVG B;  2ZPH B;  4J9D A;  4QQ6 A;  3RKX A;  4A4F A;  1MMN A;  1VQ7 T;  2KRM A;  3T9N A;  3CCU Q;  1MV3 A;  4RTZ A;  4C92 E;  3OBY A;  2LZ6 B;  2LP5 A;  1A0N B;  4HT8 A;  4EIK A;  4OMO A;  3CCE T;  3CCU A;  3LGF A;  2DEU A;  2X3W D;  3SEM A;  4KUD K;  1KIK A;  5ECA A;  1RI0 A;  1PD0 A;  2WSC E;  2XI9 A;  1OOT A;  1VQK T;  3MP8 A;  1OZ3 A;  2LX7 A;  1ZHI A;  4AG2 C;  2M9U A;  2ZPG B;  5J26 A;  2A0F B;  3JB9 J;  2C0O A;  2Y90 A;  4OMF B;  5LJ3 j;  1WX6 A;  1M90 R;  1IHV A;  1W6X A;  3JB9 D;  2O88 A;  1X43 A;  4D6W A;  4XTW A;  3JCM c;  3G1J A;  3C0C A;  3UDC A;  2LT4 A;  1Q81 U;  1ZSZ A;  1SG5 A;  4MZM A;  2HQE A;  1VQP A;  4F04 B;  4FYV B;  1G3W A;  3OB9 A;  2GBQ A;  3NTI A;  1VQ5 T;  2K9G A;  4PK4 A;  1WLP B;  2ENM A;  4M75 G;  1X2K A;  1AZG B;  2JT4 A;  2L89 A;  1M3A A;  3G6E A;  1R0B G;  2DET A;  2EKO A; 
#chains in the Genus database with same CATH homology
 3CBO A;  3JCM f;  4QVD A;  1BIB A;  2YRV A;  4E7H A;  4HKE A;  4NL3 A;  1BYM A;  2QI2 A;  3CBM A;  5LJ5 d;  2DJZ A;  4CI0 C;  3P8D A;  2EIF A;  3FLG A;  2B8A A;  3QO3 A;  3OYC A;  2ZGW A;  3O8V A;  1VQK A;  4PLL A;  2RI3 A;  2PVO B;  4RG2 A;  2RK2 A;  4M75 F;  4RMO A;  5GAO r;  2XDB A;  2MAM A;  2R58 A;  4RKU E;  2K3Y A;  3EFS A;  5LJ3 h;  4L59 A;  1M4Z A;  3DB4 A;  1KD1 C;  3BY7 A;  4OP0 A;  2QQ9 A;  4F7U B;  1M90 C;  4ZGD B;  2RO0 A;  5CKB A;  5CKF A;  4L5G A;  3SWN B;  5GAM g;  3OY9 A;  4J7I A;  4XAX B;  2ZCF B;  2VGM A;  5CVI A;  4ZGE B;  1X01 A;  1VIE A;  3C95 A;  3BW1 A;  2AHJ B;  1WNL A;  3PMI A;  5CQX A;  1YIT A;  4C0F A;  3G4S A;  3M55 A;  2EJG A;  1LJO A;  2ZPF B;  3M4Y A;  2IG0 A;  4N4G A;  3P8B B;  4NL2 A;  4M78 B;  2PU9 B;  2ZPB B;  3PGG A;  4E7J A;  5CIU A;  1XQH A;  5GAN 8;  5A2Q E;  4BI3 A;  5GAM j;  2RK1 A;  3FDR A;  1VQ5 A;  2EJ9 A;  4OGE A;  4C8Q B;  5GAO p;  4M77 D;  3J7A F;  1YHQ T;  1XTD A;  1O9S A;  3OSS C;  3HP9 A;  3Q1J A;  4E7L A;  1Y7X A;  3LH0 A;  2CZ0 B;  3MHX A;  1YJN T;  1VQN T;  2OTJ A;  5KCH A;  3LWI A;  5I2M A;  1AHJ B;  3GF5 A;  4XTZ A;  1ZQ1 A;  4N4H A;  3SD4 A;  5FRO A;  1Q82 C;  2QTX A;  1NPR A;  5HK3 A;  3ME9 A;  1G3Y A;  1KHI A;  5GAN d;  2CZ6 B;  4C5I A;  1IZ6 A;  3M59 A;  3MO8 A;  4J7F A;  4R56 A;  1N8R U;  3FJP A;  5LJ5 f;  3JCM g;  2D6F A;  4FM4 B;  4WF2 A;  3TEE A;  4C92 C;  4KUL A;  4RCB A;  4XTY A;  1WPY A;  3CCQ T;  2OAU A;  4C92 G;  5HK0 A;  5GMK e;  2RJE A;  3TU4 K;  2HAX A;  3HSB A;  3VJP A;  1H64 1;  2LDM A;  3QJY A;  4J83 A;  5D6X A;  4IKF A;  2YHT A;  4X9D A;  2RH2 A;  4M7D F;  3LGL A;  4F7U E;  3MP1 A;  5KH6 A;  3QKJ A;  3JCM P;  1P92 A;  3L2R A;  5A0G A;  3HRU A;  4HCZ A;  3JCM W;  5GAN 7;  4FU6 A;  3C4S A;  4M77 B;  4C92 F;  3QJ6 A;  2DTI A;  1G3S A;  2DXB A;  4JLI A;  5FU7 C;  2ZZD A;  4E47 A;  4M7A A;  4M75 D;  3VV0 A;  3S6W A;  4HCB A;  4FIB A;  1M1K C;  1N6A A;  2KQW A;  5CR2 A;  2XID A;  4M78 E;  5CAI A;  3CC2 T;  3PMT A;  5GMK m;  2E10 A;  3H8Z A;  2VYT A;  2E6N A;  3M4G A;  1YHQ A;  5M9O A;  1ZBX A;  5CKH A;  3SWN A;  1KD1 U;  1M90 U;  1VUB A;  4HT9 A;  2P0K A;  2CYZ B;  4Y91 A;  1YJN A;  1VQN A;  1QVP A;  2LC4 A;  4A54 A;  2KY9 A;  4PJO C;  3A8M B;  4JRK A;  1TH7 A;  2LCL A;  4FSX A;  1OYX A;  4PJO G;  2K5I A;  2K5L A;  4II1 A;  1BKB A;  2NLU A;  3HFO A;  2LNV A;  2VGN A;  1UGQ B;  2Y4Y A;  3GPL A;  5FLX E;  4QQD A;  3BDL A;  3HRT A;  5L8R E;  3J81 E;  4LD9 K;  3HFN A;  3M58 A;  3QHS A;  5KCO A;  1I81 A;  4M78 A;  1N9S A;  1K9M C;  4JRI A;  3QUI A;  3FC3 A;  3VU3 C;  4ATO A;  2RA2 A;  4GLK A;  3GNF B;  3CCJ T;  5GAN f;  3OYB A;  2K2V A;  3EFR A;  3CCQ A;  4ELY C;  4M7D C;  2LQK A;  3RIR A;  4PJO F;  4FT4 A;  2I2L A;  1Q86 U;  4M7D G;  2JOY A;  3NTK A;  2EJF A;  3OMG A;  1G5V A;  3HPW A;  4EMK C;  4LDW A;  5LJ5 g;  2JZ2 A;  3QG1 A;  2PUO B;  4KUI A;  3JCM h;  5GAO q;  3CPW A;  4BAC A;  2CKK A;  2GFA A;  2XG8 D;  5CQY A;  4PL6 A;  4BY6 B;  5CK9 A;  4X9C A;  1UGP B;  2DXT A;  2JTF A;  1Y71 A;  5J39 A;  3C94 A;  2DO3 A;  2LQ8 A;  2X4Y A;  3E19 A;  4IUR A;  4XK8 E;  3CME T;  4BE0 A;  4C0G A;  2XU8 A;  3JCM J;  3NTH A;  4KBM B;  4M77 E;  2HBP A;  5IN1 A;  5GAN e;  5IAY A;  4B9X A;  3J80 E;  3V8L A;  3A5Z B;  4XQ3 A;  5GAN 5;  5LJ5 j;  4JLG A;  4J6X A;  3UPU A;  4DA4 A;  3CC2 A;  3OA6 A;  4M75 C;  1Q7Y U;  1PSF A;  2RHZ A;  3HHT B;  3RUX A;  5A0L A;  1JRI A;  3OW2 S;  4QVZ A;  3CPW S;  2F69 A;  2CGH A;  3JRZ A;  2DPP B;  3L42 A;  3G71 A;  3L2Q A;  3RMS A;  2F5K A;  2VXE A;  3ER0 A;  3MP6 A;  3OSV A;  4M77 A;  4X34 A;  4OF1 A;  2MMP A;  3WVD B;  4DOW A;  1S72 T;  3QSU A;  4C92 D;  5CKD A;  2E5Q A;  2LCC A;  1VQ9 T;  4M7A B;  4QVC A;  3CCJ A;  2KSS A;  3PNW C;  2IVW A;  3FRN A;  2L5Q A;  3MEV A;  4RCC A;  1WJS A;  3TRE A;  2ZPE B;  1QW1 A;  2MWO A;  3OYE A;  3MEW A;  1M1K U;  2RI5 A;  3X28 B;  3KXT A;  3PT9 A;  3RKW A;  4HCC A;  5CKE A;  1M8V A;  4MZT A;  4Y28 E;  2A3L A;  4A4H A;  2JN0 A;  5EG2 A;  3BFM A;  2QDY B;  4EDU A;  4QQG A;  5J3B A;  2JNG A;  2EFI A;  3JCM b;  3QZ5 B;  5GAN g;  3RES A;  4XU0 A;  4C5G A;  3CC7 T;  2XIC A;  3SDZ A;  4N0A A;  5DY9 A;  5HY6 A;  3VUZ A;  5DLO A;  2EQJ A;  1VQM T;  4LDX A;  1Y96 A;  2L8D A;  1WJR A;  2VXF A;  3M53 A;  5LJ5 h;  3CCL T;  2P4T A;  3MEA A;  5AYF A;  2E64 A;  1W2B A;  1K9M U;  3CCV T;  2RHX A;  4XTX A;  2FHD A;  1NJI C;  2DXC A;  3MCA B;  1JB0 E;  1HK9 A;  3X20 B;  4BD3 A;  2E65 A;  4PJO D;  3HKS A;  5FU6 B;  5GAN j;  2CZ7 B;  5CCA A;  1UEB A;  1KQ2 A;  2DD4 A;  2DIQ A;  4M75 A;  3QII A;  1YCY A;  3CC4 T;  3QYH B;  1I8F A;  2DIG A;  1YBY A;  2FVU A;  1BI0 A;  2M16 A;  4NOY A;  3VUB A;  4B9W A;  4JRQ A;  4JUV A;  4BI8 B;  1I5L A;  2O01 E;  4C0D B;  1S72 A;  4IUU A;  2M1H A;  3S3M A;  1W2B S;  4M7D D;  2QQB A;  3CD6 T;  1VQ9 A;  3FIF A;  3MET A;  3OYF A;  2RHU A;  3F70 A;  4F7U G;  4JJN K;  4ME7 A;  2Y4X A;  4GY5 A;  5FU7 B;  5D6Y A;  4M7A E;  1KG1 A;  2WSF E;  3OYL A;  3JCM V;  2R5A A;  1X75 C;  4BUG A;  3OS0 A;  2E70 A;  2VC8 A;  3LW5 E;  3QXE B;  4JS4 A;  2CZ1 B;  2HNI A;  2E12 A;  1JBM A;  4F7U F;  4XU3 A;  3UWN A;  2QQA A;  3CC7 A;  1KQS A;  2FL7 A;  4M78 G;  3TCJ A;  2KAF A;  2LVM A;  2K3X A;  4C5H A;  1D3B B;  5GAM h;  3LX7 A;  4C8Q C;  3CCL A;  3L2Z A;  2DK3 A;  4C8Q G;  5LJ3 e;  1G3T A;  3OYM A;  2KVQ G;  3OYH A;  4IUQ A;  4RG8 A;  4JS5 A;  3VYH B;  2DD5 A;  3QBY A;  4TVR A;  5D6W A;  2FB7 A;  4FL6 A;  2QA4 T;  1YJW T;  4CRI A;  3N5B B;  1LNX A;  2K57 A;  4NS5 A;  3SB2 A;  2JUF A;  4M78 F;  4ZTF A;  2X4W A;  3CMA T;  1PSE A;  4OVA A;  3CC4 A;  3ZFJ A;  1KQS S;  4MML A;  2M0O A;  1M9S A;  4C8Q F;  3A8H B;  2MWP A;  3X24 B;  4OB3 B;  1YIJ T;  1B34 A;  2QXF A;  3OMC A;  5GAN 6;  2P0P A;  3E9G A;  3SFM A;  4LD6 A;  4UC4 A;  4BE1 A;  4A4K A;  1MHN A;  4BE2 A;  4P5N A;  3CD6 A;  1Y96 B;  2KMT A;  1VIF A;  4ZN1 A;  4V2S A;  5C0M A;  3JCM X;  3FB9 A;  3R6O A;  4FT2 A;  2LRQ A;  1RL2 A;  4DQ2 A;  3X26 B;  1YJ9 T;  3L2U A;  1NJI U;  3QYG B;  4MZP A;  4C92 A;  4IUT A;  5FRM A;  3CCR T;  2EQK A;  3A8L B;  5FRN A;  2EWN A;  5GMK j;  4XU2 A;  3C12 A;  4M75 B;  3INZ A;  4M77 G;  4O6J A;  5GAO l;  3OS1 A;  4DOV A;  3MEU A;  2D0Q B;  5GAN 3;  5IT9 E;  3JSC A;  3CXC A;  1Q82 U;  4J8O A;  1WQ7 A;  1QVG A;  1BIA A;  1XNI A;  1X6O A;  2JTM A;  5GMK i;  2DVE A;  4M77 F;  1QVF A;  2XHC A;  4EPC A;  2RM4 A;  2WAC A;  2QA4 A;  3HL8 A;  1K8A C;  2OTL A;  4Z02 A;  3CMA A;  4ZGJ B;  3E1S A;  3WXM B;  3QZ9 B;  2DKG A;  3GLX A;  2GQV A;  4KT0 E;  2F5T X;  3ASK A;  4XTU A;  3CXC S;  1YI2 T;  4EMG A;  5GAN 2;  1FXX A;  1UGR B;  2LT1 A;  3V8J A;  5A0D A;  1OZ2 A;  1YIJ A;  4PJO A;  2PUK B;  1EIF A;  4N4I A;  4VUB A;  1D3B A;  2X4X A;  2G3R A;  2EQM A;  2XK0 A;  1HXD A;  4IUV A;  4OB1 B;  2DEQ A;  5LJ3 d;  1QVG S;  1KC8 C;  1VQL T;  4MDW A;  3CBP A;  4J6Y A;  2FYK A;  3EAE A;  1QVF S;  1VQ4 T;  1BI2 A;  1WJQ A;  2R57 A;  3X25 B;  3LLR A;  2CS7 A;  2EYQ A;  3BDU A;  3KBG A;  3M5A A;  1NZ9 A;  1FX7 A;  2A7Y A;  3URG A;  4A53 A;  1YJ9 A;  5GMK h;  3OYG A;  3A8O B;  1UB4 A;  2K4Y A;  2QQR A;  4BY6 C;  2EAY A;  2KK4 A;  3CCR A;  4M7D A;  3M56 A;  4M78 D;  1KQ1 A;  2DAQ A;  3V7R A;  3PIP A;  4PKC C;  3V7S A;  3LYI A;  2DZC A;  4JRP A;  3I55 T;  2YLC A;  5LL6 S;  4EMK A;  4ZN3 A;  1WGS A;  4C8Q D;  1U1T A;  2L3R A;  4YTL A;  4M75 E;  2K5F A;  5I2S A;  3OYN A;  3CCS T;  1B34 B;  1JJ2 A;  2ZPI B;  3M57 A;  3GOX A;  3CME A;  4E7K A;  3CCM T;  1KHC A;  1MGQ A;  1UGS B;  1Y07 A;  1W4S A;  3OYY A;  1WQW A;  3V8K A;  4LDY A;  1M5Q 1;  4BB7 A;  4LDU A;  2KDS A;  1SSF A;  4C92 B;  1N9R A;  2O4X B;  3OBW A;  3OQ5 A;  4QW2 A;  3JCM e;  2QEX T;  2OTL T;  4PLI A;  3P8H A;  3GP8 A;  2VUB A;  1YI2 A;  2V8J A;  3OS5 A;  4M7A C;  3E9F A;  4O5V A;  3JB9 G;  1JJ2 S;  1H3Z A;  4M7A G;  2E41 A;  1DJ7 B;  3G7Z A;  2RJF A;  4R55 A;  5I21 A;  1VQL A;  2RHI A;  3GIB A;  2RJD A;  1VQ4 A;  3OYK A;  4A4E A;  5KE3 A;  4MMK A;  3SWN C;  5LJ3 f;  3JB9 I;  1Q86 C;  2E6Z A;  2JVV A;  2RD1 A;  3JB9 H;  4BDZ A;  1K73 C;  3I56 T;  2C06 A;  3DB3 A;  4XU1 A;  2BKD N;  3CCU T;  3JB9 F;  3OS2 A;  1N27 A;  4M7A F;  3OYD A;  2E1H A;  1K8A U;  2DXU A;  3JAM E;  1I4K 1;  5C6S A;  3ZEH A;  4LDV A;  2GFU A;  3I55 A;  2X4J A;  1GXI E;  1XOV A;  5GAM d;  4M78 C;  1Q81 C;  2D9T A;  4MDX A;  3JCM Q;  1FWZ A;  3M9Q A;  4JDS A;  3CCS A;  4PJO B;  1VQM A;  2V8I A;  3S3N A;  3M54 A;  5CO7 A;  5GMK l;  3L2V A;  5FU6 C;  3CCM A;  1KC8 U;  5GAN h;  3CPF A;  2PVG B;  2ZPH B;  5GAN 4;  3CCV A;  1Q7Y C;  4QQ6 A;  3RKX A;  4A4F A;  3RER A;  1VQ7 T;  2XKO C;  3L2W A;  3OYJ A;  3T9N A;  3DKM A;  4M7D B;  2BIV A;  4HA8 A;  5DLQ E;  2LX9 A;  5GAO n;  4C0D C;  2PQW A;  3FEO A;  3V7C A;  3QPH A;  4IUP A;  3S3O A;  3KUF A;  1VQ8 T;  4C0Z A;  1VQ6 T;  4OB0 B;  3VKI A;  2PVD B;  4C92 E;  3QDR B;  3OBY A;  4EMK B;  2BUD A;  2RJC A;  3OYA A;  1NE8 A;  1VQO T;  5LJ5 e;  2GF7 A;  1VQP T;  4L6V 5;  4HT8 A;  4C5E A;  4J5Y A;  2DTH A;  3L1A A;  4XTV A;  4Q5W A;  4PNO A;  4F7U A;  3I56 A;  3CCE T;  3JCM d;  4J6W A;  3DLL A;  3CCU A;  2WSE E;  2XDD A;  3LGF A;  2O4X A;  5HKC A;  4E7I A;  2RHY A;  1M1F A;  1IRE B;  1NPP A;  4C8Q E;  4M77 C;  3G6E T;  2QEX A;  2RB6 A;  3G71 T;  4KUD K;  2DZ9 A;  3LWH A;  5LJ3 g;  4OGC A;  1RI0 A;  2X35 A;  2MI6 A;  4BI4 A;  2WSC E;  1OI1 A;  2XI9 A;  2GCX A;  2YLB A;  3UT1 A;  4BDY A;  3H6Z A;  3MP8 A;  1OZ3 A;  1VQK T;  1ZHI A;  5GAM f;  1M1G A;  5DM7 R;  3OW2 A;  2M9U A;  2ZPG B;  5J26 A;  2EQU A;  4PJO E;  2H3J A;  3JB9 J;  3PTA A;  2QQS A;  4C8Q A;  4ZTJ A;  2Y90 A;  2P0Q A;  1YJW A;  3PFS A;  1VQ7 A;  4ELZ C;  4OMF B;  5LJ3 j;  4OB2 B;  1K73 U;  2VV5 A;  2V8K A;  3NFC A;  3JB9 D;  4M7A D;  1BI3 A;  3OYI A;  1VQ6 A;  1VQ8 A;  1U1S A;  4N0A C;  4D6W A;  4XTW A;  3WVE B;  2LTO A;  3JCM c;  1R8O B;  3A8G B;  4M7D E;  1YIT T;  3UDC A;  2LT4 A;  2HD0 A;  3G4S T;  3VYG A;  2XD0 A;  1Q81 U;  5GAM e;  1VQO A;  1N8R C;  1BI1 A;  5GAO m;  5KE2 A;  3GNG A;  2HQE A;  3DLM A;  4MZM A;  1VQP A;  1G3W A;  3RKY A;  2HQX A;  2RI2 A;  3AHU A;  3OB9 A;  3ZBD A;  3NTI A;  1VQ5 T;  3RMQ A;  2DTO A;  3CCE A;  3PIO A;  1QP3 A;  3HRS A;  2R5M A;  2L89 A;  4M75 G;  1U8R A;  1LOJ A;  4A4G A;  2MF2 A;  1QP2 A;  2XDP A;  3CEY A;  4EMH A;  1V29 B;  3G6E A;  1O75 A;  2OTJ T;  2EKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...