5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
2ZCFB 4ZGJB 2PVOB 3X25B 2DXCA 3X20B 4L6V5 1UGQB 2D0QB 1PSFA 4KT0E 2DD4A 2AHJB 3X24B 1UGPB 3VYGA 2O01E 4FM4B 3QYGB 3A8MB 4OB3B 3QXEB 4ZGDB 2PUKB 2ZPHB 2DD5A 4OB2B 2PU9B 2QDYB 1V29B 2DPPB 3X26B 2ZPEB 2CZ0B 3X28B 3QZ5B 3HHTB 1JB0E 3VYHB 1UGRB 3A8GB 1GXIE 2CZ6B 2ZPGB 2ZZDA 3QZ9B 4RKUE 4ZGEB 2DXBA 3WVDB 2PUOB 3A8OB 4XK8E 2WSCE 2WSEE 1IREB 2WSFE 3WVEB 5L8RE 2ZPBB 4Y28E 3A8HB 1AHJB 3QYHB 1UGSB 1QP3A 2CZ7B 4OB0B 1PSEA 2CZ1B 1QP2A 2ZPIB 1DJ7B 3A8LB 2ZPFB 2PVDB 4OB1B 2PVGB 3LW5E 2CYZB
chains in the Genus database with same CATH superfamily
3MCAB 4XTUA 2RH2A 3G1JA 2P4RA 2DK3A 4OMLA 2DX1A 1FX7A 5CKEA 2COZA 3FC3A 2E1HA 4PJNA 2YUPA 1SSHA 2PZ1A 1KC8U 1CKAA 3DLLA 1VQ6Q 2ECZA 1Q81C 4KBMB 2K79A 1S72T 2KYMA 5CVIA 4ZGDB 1X2QA 4VUBA 2XMFA 1OPLA 2CS7A 4EMKB 4A4GA 2V8JA 4C0DB 2VXEA 2DD5A 4M7AA 2E65A 3OS0A 2V1RA 2X4JA 1E7OA 4LD6A 2P4TA 4AG1C 4QQGA 2D8HA 4QQDA 2LCLA 1W2BA 1HYOA 1G3SA 1QCNA 1VQ5T 1D3BA 4JRQA 1OZ2A 2NUPA 3OW2A 5GAMg 3SHWA 1BCOA 4FT4A 1JXOA 2OX7A 4B9XA 3EG1A 1FMKA 3UF4A 1Z9ZA 3C0CA 1R77A 3ZEHA 1KD1R 1VQ7A 1RI9A 2F5KA 1N8RR 3JCMc 5L8RE 2IIMA 1NLPC 5LJ3d 2EIFA 3V7CA 3EGXB 4OB0B 4ZN3A 2KR3A 2GCXA 3RUXA 3L2RA 1SG5A 3EH1A 1BI1A 3LX7A 2PVDB 1YJWQ 1M1KC 2PTKA 4RUGA 4MZMA 1VQ7T 2JXBA 3JRZA 1XNIA 4M75D 1VQPQ 3L42A 4Z02A 2NUTA 3RKYA 1U1SA 5LJ5f 1HXDA 3V7SA 1Q81R 4DA4A 3VKIA 2HDAA 1ZSGA 2AHJB 5GMKe 1NZ9A 2G3RA 4OGCA 1VA7A 3QYGB 3TQ7P 2VASA 2CKKA 3EGDB 1PRLC 1YWOA 1JJ2S 3OYYA 3OB9A 2JNGA 2OTLQ 1QVGP 1BIBA 4C92D 3CC4A 4QT7A 4X1VA 4DBRA 1BK2A 1MNDA 5KYWB 1RAFB 2KMTA 3MO8A 2ED1A 2WACA 5J26A 2D1XA 1ZUUA 3BDLA 5KCHA 2C0IA 2L3PA 1IXDA 4M7DD 3JCMg 1QVFS 4KULA 2LQNA 2DL5A 2EQKA 4QQ6A 4OMOA 3OYKA 1KIKA 4KGZB 2EYYA 3EG2A 2RA2A 3A8OB 2WSCE 3CC7Q 2LCCA 2E12A 1UHFA 3GBQA 1N27A 3NPFA 2YWWA 3C4SA 2K6DA 1QKWA 4R55A 4PLIA 2YLCA 4PJOD 1NG2A 1RAGB 4C8QF 1X2KA 1M1KR 2AK5A 4C5GA 3QDRB 1ZBJA 1IB8A 3NTKA 2BKDN 4M78D 1LCKA 4J83A 4A4HA 1YHQA 1BKBA 1VUBA 4ZGJB 2ATCB 3FJ5A 3OYHA 4F16A 3CCVQ 2GF7A 4KUDK 3H9NA 2QA4A 1MMAA 3OMCA 1PSFA 1VYVA 4M7AB 4Z89A 4FW2A 1Q86R 3G71Q 1VQOA 3JB9J 4AFUC 3CCQQ 3HFNA 4GLMA 2LT4A 4KH1B 2P0QA 1AZEA 4OB3B 4XTZA 1D3BB 5FWCA 2SEMA 4N4GA 2NUPB 4EDUA 3DKMA 2R57A 2VGMA 3MJXA 3VUZA 3QPHA 4E7JA 3JCMb 3G4SA 3EAEA 2FO0A 4M75C 5FRMA 2ESWA 1IGQA 4EIKA 1G3YA 1WX6A 2ZAEA 1XTDA 3JV3A 5D6WA 2MPXC 1VQOT 4BE1A 3MP6A 1G3TA 4M75E 1UGRB 2HAXA 4ZN1A 1QLYA 2DBMA 3PGGA 4IUUA 3SEMA 2A0FB 1VQNQ 2LQ8A 3EG3A 3UT1A 2BE7D 2QK0A 3SB2A 3G4ST 5IHNA 5GANj 4XK8E 1LJOA 2G6FX 2OJ2A 2RQVA 4LDYA 2FPEA 3OA6A 1SF9A 4BDYA 4GY5A 2K5LA 1RAAB 1K8AU 2DF6A 3RNJA 3T9NA 4C92E 3OS2A 3EFOA 3OBYA 2JS0A 4LDVA 3ASKA 4AFQC 5GAN2 4BY6C 3M0SA 1PWTA 1ABQA 2GBQA 3CPWS 1AOJA 3JCMX 1W2BP 1KFZA 1QWFA 1AWJA 2LQWA 4JPBW 2MCNA 2K7AA 3LW5E 4DOVA 2ZCFB 1UHCA 2QTXA 4M7DE 3OW2P 2RK1A 2LDMA 1P92A 4QVZA 4L6V5 3UA7A 4DEXA 1UUEA 2RQRA 3KBGA 4MDWA 4DEYA 1ZSZA 4PJOC 3M0TA 1KC8C 3KUFA 1BB9A 5IN1A 1E6HA 3CCQT 3I55A 4C0FA 1SHGA 3CCSQ 5AT1B 3QJYA 2YUNA 2FRWA 1LNXA 4LXCA 3GPLA 1K0XA 5A0LA 4M78C 4X9CA 1JJ2A 2CP0A 2ZPHB 4E7ZA 3DLMA 4D6WA 4BI8B 4C92G 3LH5A 5DLQE 1KQ2A 1J3TA 4M78E 4BACA 2AKKA 2JTFA 2X51A 2BZXA 4J7FA 1UEBA 5D6XA 5GANe 3JB9G 1Y96B 1YIJQ 1FMVA 3FLGA 3I55T 5AYFA 4J5YA 2Y4YA 2DYBA 3A8GB 1NEGA 1OQKA 2RM4A 1PG5B 4PFPA 1QVFA 2CZ6B 1HK9A 5KYXA 4D8KA 4XU3A 3QZ9B 4FCYA 1YWPA 1WJQA 3VUBA 4AMCA 3TVTA 4F7UF 2RHXA 2HQXA 5I2SA 1ZHIA 2D9TA 5GAOr 2LTOA 2X3WD 3M9QA 1D1AA 4HCZA 2DL4A 4OMNA 2LNHB 1VYTA 1PRMC 3J7AF 1X69A 3R6NA 1RAIB 1UGSB 3PT9A 4JRIA 1SEMA 4CI0C 1S1NA 5CQXA 1X6GA 2QEXT 3LYIA 2CUBA 2DE0X 2OTJA 2J6FA 2BE9B 3CCEQ 1YNZA 4JJDA 2XK0A 5GAN8 1NBEB 1SHFA 2YSQA 2XD0A 3LH0A 3EH2A 2YRDA 1KC8R 4FU6A 1MV3A 4E7IA 1OZ3A 2RJEA 1WPYA 5GAN4 4KGXB 2EW3A 3A98A 3INZA 4ORZA 2XG8D 4HT8A 3CCJA 2OTJT 3SFMA 4C8QB 3NGPA 5IAYA 4JS5A 3RR6A 2F2WA 1PD1A 2M02A 4OMPA 3M5AA 4BI4A 2EQMA 1XQHA 4Z88A 5D6YA 3QXEB 2MF2A 2XI9A 5CQYA 1EFNA 5GAOn 3FJPA 1LPLA 4OVAA 1ZSZC 4M77G 5CKBA 2CGHA 4XTYA 4DBQA 3OYFA 1Q82U 3META 3EG9B 3OSVA 2Y90A 3CCJT 3I56Q 1YFNA 1K1ZA 3UPUA 1I81A 3VYHB 4FT2A 3OBWA 2LX7A 5GAMf 1H8KA 3UATA 3E9FA 2ZZDA 2KROA 4D8DA 2LJ3A 4HCCA 1VQ8A 3REBB 4BD3A 3G6EA 2L0AA 3C95A 4ME7A 1I5LA 1KSWA 1W6XA 3PE0A 1WXUA 4J9FA 2CT4A 3CCRA 1B34B 1M9SA 5GAOm 2WSFE 3CD6A 1I8FA 2KGTA 2XIDA 3QYHB 3SDZA 4LNPA 3VS0A 1RLQC 4DQ2A 3LWIA 2RJCA 2DNUA 1M2VB 1VQ8T 3G6ET 2K3YA 2JVVA 1M30A 2M16A 3VS3A 1VQ9T 3CPWA 3MHXA 4J9BA 5I2MA 3OQ5A 4ZGEB 2DVJA 3CC2A 3CCRT 4J9DA 2DILA 2RPNA 1VQMQ 3QSUA 1JEGA 3ME9A 4C0GA 3OY9A 1YITQ 1U5SA 5KYYA 2EYQA 3BW1A 5GAOq 4A4EA 2VWFA 2XDBA 4E7HA 2ZGWA 1R0BG 1IGUA 3OYIA 1BIAA 3SD4A 3CXCA 2M9UA 4F04B 4HXJA 2HBWA 3M53A 3L2WA 2K3XA 4KUIA 1RABB 3I5SA 3CC2T 4LDWA 2H8HA 3VU3C 3P8BB 2JS2A 2K2MA 3RERA 5IH2A 1OX8A 4PJJA 3QG1A 3E1SA 2CZ0B 5DM7R 2JTEA 1GCQC 4FYWB 2DEUA 3MKDA 1VQ5A 2K4YA 3H8ZA 3I56T 3VS4A 1G5VA 2J06A 1EZZB 2HQEA 2ZPGB 4IURA 3JCMf 3H41A 2FPDA 3CCMQ 2KT8A 2HKNA 1KQSS 1G8XA 2LVMA 3Q1JA 4RTUA 5LJ5h 3HSBA 2IVWA 4L5GA 4MMKA 1X6BA 3A8HB 1JBMA 4M75F 4XU0A 1KG1A 1ZQ1A 6AT1B 2HSEB 1RI0A 1OPKA 2EGAA 1WFWA 4KH0B 2DRKA 5FU7C 1N5ZA 1JJ2P 2QDLA 5LJ3j 2KY9A 1VYUA 2MMPA 2XICA 4A63B 3MEVA 5HY6A 2XDDA 2GFUA 1PC0A 4PFZA 1NE8A 4F7UB 4ZTJA 3BDUA 5A2QE 5FW9A 1YITT 2DXCA 2EPDA 2FG0A 2FRYA 5C6SA 1I1JA 3BE3A 1UGQB 3CC4Q 2D0QB 4J6YA 4EPCA 2E64A 1QVFP 4KRTA 1YI2Q 1M90U 2JT4A 2MYSA 4JUVA 1PD0A 2RI3A 2DL8A 1MUZA 2VVKA 4CRIA 3PMIA 3I9QA 1AWOA 3RESA 1GRIA 1ARKA 2B86A 3A5ZB 3CMAQ 1ABOA 2QYZA 2HD0A 2QDYB 5GANg 4E6RA 1GBQA 1Y0MA 2A28A 4M75A 1UTIA 2EBPA 3FIFA 5J3BA 2RHZA 5CCAA 1WJRA 1RUWA 2KT1A 2DLPA 1VQ6T 2W10A 2YT6A 3EHQA 1RADB 2O2OA 2HL3A 2RQUA 3L2UA 1Q86C 2A7YA 4PJOF 4J6XA 4XTXA 2V8IA 4XTWA 2DETA 4CC2A 3RKWA 2F2XA 1WHKA 5LJ3e 1QMCA 1FXXA 1K8AR 3M0RA 3M4GA 4C92A 3JB9D 1NM7A 4M78F 3CCLQ 1YHQQ 3TCJA 2BIVA 3JCMW 4MDXA 1GFDA 2RO0A 1K73U 1U3OA 1ZX6A 2DRMA 1OU8A 1SRMA 5KYYB 1Q7YU 1SKUB 3HFOA 2CZ7B 2LNVA 1KHCA 3S3OA 2CZ1B 1FWZA 2RI2A 4M7DA 2HEQA 4DBHA 2RF0A 3FDRA 3OSSC 1YJWA 4E7SA 1HD3A 2LZ6B 2K3BA 2PVOB 2NWMA 4M4ZA 3VJPA 3R6OA 2J6KA 4F14A 5IHKA 5L23A 5HK3A 4PJOA 1TG0A 2IG0A 4XQ3A 1M3AA 1UGPB 1WHGA 3LGLA 4M7AE 1YJWT 1FYNA 1NJIU 2PQWA 4IIOA 4O5VA 4PLLA 1VQPT 2PUKB 1C0MA 4M78A 2LCSA 2OTLA 1D0YA 5CKDA 1BU1A 2EQUA 1WHJA 3C12A 4FW1A 4IUVA 5HCKA 1Q82C 4B9WA 2A36A 3QJ6A 1CSKA 2RD1A 5CO7A 5LJ3h 2P84A 4RCBA 3X28B 3TSZA 2O9VA 1YCYA 4NS5A 2SRCA 1VQLQ 3CPWP 2DEQA 2DYIA 2QXFA 2YRCA 3HPWA 2VXFA 2K5IA 3JCMP 1PKSA 2OTLT 4M77D 3CMEQ 3GF5A 1KQSA 2Z0WA 2AIRB 2FZGB 3CCUQ 2ED0A 3FRNA 3CC7A 5GJVB 2EKHA 5FROA 4M7AG 4J9IA 2BUDA 5GAMd 2EGCA 2DAQA 2X35A 1YJNQ 4C8QD 4HA8A 2W0ZA 4C5IA 4O6JA 1H3ZA 1VQ4Q 3LLRA 2NYSA 5KCOA 2F1LA 2ZPFB 4C92C 1UFFA 2E41A 1QCOA 4E2FB 1TS9A 3CC7T 4OMFB 1YJ9Q 2M0OA 2AZSA 2BZ8A 3HP9A 1TWBA 2DMOA 3NTHA 4HVUA 2L2PA 1T0JA 3H0FA 1O9SA 1VIFA 2LJ1A 2NUTB 2RHIA 2DD4A 2KK4A 1D1BA 2CREA 5GJWB 4CC4B 1ZA1B 4M75B 2J05A 1JXMA 5GMKl 4M7DC 3G71A 3VV0A 3CCQA 3DB4A 4AG2C 1Y71A 1O75A 1Q82R 1CKBA 1Z9QA 4OGEA 4GLKA 3V8JA 3PMTA 3CCVT 1M27C 4LDXA 1WXTA 2ZPEB 2CP5A 2E3HA 2JM9A 3G71T 4FIBA 1TSFA 1RACB 3CXCS 2CDTA 7AT1B 2YUQA 1VQLT 1WXBA 2KE9A 5D7UA 4RTZA 3SWNC 4AFSC 5FU6C 3M0QA 1VQNA 3CBMA 1QW1A 4HT9A 1X75C 1QCFA 5IHIA 1JQQA 3HRTA 2FHDA 2M51A 2WSEE 2I0NA 1U1TA 3TSWA 2P0KA 4PJLA 4HCKA 4BY6B 1T0HA 1WI7A 1VOMA 4FL6A 1WQ7A 3WXMB 3JCMd 2MIOA 4LN2A 2QEXA 2JMCA 1VQNT 5GMKm 2GTOA 4DOWA 4PJOB 3CBPA 3V7RA 2GQVA 2QASA 4M77C 3VS2A 4AT1B 2DIQA 4PJMA 1AWXA 2CYZB 1PM3A 2K9GA 3RDVA 4FSSA 1JU5C 4C0ZA 2JUFA 3X20B 3CPFA 2EFIA 4M77E 4M78B 1QKXA 2E70A 4N4HA 5GAOp 5GAMh 2XDPA 1K0SA 2RI5A 2O4XA 1M8VA 2QQRA 2HQHA 2V26A 2KAFA 2ABLA 2E10A 3CCSA 1WLPB 4PK4A 3OYJA 2XKOC 4N0AC 4LUDA 2E6ZA 4LDUA 3EFSA 4C8QE 4RTTA 1N9SA 1UJYA 2DBKA 1VQKQ 2L5QA 4WTOB 2DL7A 2RJDA 1EIFA 5LJ5j 2RJFA 1RL2A 2C06A 1GCQA 4BI3A 2HSPA 3JCMV 3VS6A 2EKOA 1NYGA 3HRSA 1BYMA 1YIJA 2M1HA 1BI0A 2QQAA 2FEIA 3O5ZA 3CCST 2F2VA 2KQWA 5DLOA 3J81E 3CD6Q 2COWA 4WCIA 1B07A 2X4XA 3U23A 1GXIE 1M4ZA 3GOXA 2LT1A 1SPKA 2E5QA 4YTLA 1H3HA 4RKUE 3QO3A 4ELZC 1NYFA 2YUOA 4PKCC 4P5NA 3WVDB 2KEAA 3GLXA 4A4FA 4PFOA 4KGVB 1IREB 1WYXA 1IHWA 2I2LA 2BZYA 4II1A 3FEOA 1YIJT 1K73C 3E19A 3JCMQ 3GNFB 5HK0A 4JRPA 2CUDA 2EYZA 2DFUA 4C8QG 3P8DA 1W1FA 4IUPA 4RG2A 3EFOB 1UB4A 3OYMA 3OYAA 1R8OB 2ROLA 3PVQA 3RKXA 4V2SA 1VQ9A 3A8LB 1I4K1 2A3LA 1K9MU 2HKQB 3URGA 1S72Q 4FYXB 3QWXX 2DKGA 2V1QA 2NUZA 1M90R 1WHHA 2GGRA 2ROTA 1WGSA 1B7TA 2DXUA 4BE0A 1QWEA 2VKNA 2L3SA 1ZSZB 3JCMh 1KQSP 5LJ5e 1VQ5Q 1MMGA 2O01E 3CCET 3M0UA 2FB7A 1NJIC 2DZCA 3CEYA 2RB6A 1M3BA 2O31A 4ATOA 3D7SB 1I5OB 2BTTA 2HZYA 3PVLA 4QVDA 1VIEA 1MMNA 5GANf 2FZCB 1PNJA 2OI3A 4MZTA 5A0GA 3CBOA 2R5AA 3I56A 1AD5A 1H92A 2RHUA 2JW4A 4GBQA 4EMKC 2HMAA 4C0DC 3E2UA 2VV5A 1K4US 3ULRB 2QI2A 2V8KA 3THKA 4HKEA 5KYXB 4X34A 1K73R 4FYYB 1OU9A 5M9OA 2PUOB 2LX9A 3QDFA 3BY7A 2DVEA 1VQ7Q 1Y07A 1Q7YR 1AZGB 3MEUA 2AZVA 1TXQA 2HCKA 1YN8A 1V1CA 2AT1B 2F5TX 3HRUA 1LVKA 1UE9A 4JJNK 1PSEA 3QWYA 4E7LA 2VC8A 1T3LA 2O4XB 1M3CA 5HKCA 2CP6A 4JZ3A 2DM1A 4M7AD 4JLGA 2DXTA 1ZLMA 4JZ4A 1VQMA 3NTIA 1YITA 1K8AC 3X25B 4F7UE 5GMKj 1PKTA 5KYUA 4ZTFA 1C6VX 1IZ6A 2KRSA 1NJIR 1MMDA 3X24B 3KFVA 1UJ0A 3JCMJ 1YCSB 5CR2A 4BUGA 1H641 5C0MA 2EYXA 1GL5A 2E4HA 2DJQA 3EFRA 1N9RA 2DL3A 1NLOC 1GCPA 2COYA 1WZOA 1F1BB 1MV0B 3EHRA 4RTXA 4Z8AA 1VQMT 1M8MA 2A08A 1K9AA 1U8RA 2GQIA 2J7IA 2JJ9A 1FMWA 2VB6A 1D1CA 4J9CA 4C92F 2EJGA 3VS5A 2D0NA 3QZ5B 3RMQA 2LMJA 1VQ6A 1OV3A 5EG2A 2L3RA 1PHTA 4WF2A 3JB9F 2YLBA 2EJFA 5GAN7 4UC4A 1RAEB 1U06A 4M7DF 4XAXB 5I21A 3CCMA 1V76A 5FU7B 4DBFA 4F7UG 1GFCA 2JTMA 1ZA2B 3F70A 2L8DA 3VS7A 4IIMA 2HL5C 1ZBXA 4E47A 2O9SA 4TVRA 2VGNA 8AT1B 2A37A 3IQLA 2KDSA 2EWNA 4QW2A 2DERA 5KE2A 1A0NB 2RQTA 4A4KA 4J8OA 2CP7A 3JB9I 4RG8A 2C0OA 2E5KA 4OF1A 2DZ9A 3CCMT 4LD9K 1PCXA 3AT1B 4BDZA 2D6FA 1YBYA 1SSFA 2QQ9A 3OYLA 1OEBA 2MWPA 4RTYA 4R0KA 4NL3A 3P8HA 3ZL7C 2QA4Q 2GFAA 1QVPA 3QKJA 2RMOA 2JOYA 3S6WA 1KQ1A 1YI2A 3S3MA 4PL6A 1VQOQ 3M4YA 2RK2A 3VRYA 5I11A 5CIUA 5EC7A 2F69A 2Y4XA 1VQPA 4XU2A 3RIRA 1MGQA 3NFCA 1XOVA 3CMAA 4M7AC 3G4SQ 2J6OA 2QQSA 3GNGA 2QAZA 2DPPB 3CC4T 4M77F 3PTAA 3TU4K 3OYGA 5FWBA 1Y57A 4C5EA 1OOTA 3M56A 1I0CA 3N5BB 1YI2T 3OYNA 1Y96A 4F17A 5IT9E 4FYVB 3MEWA 1TTHB 4ESRA 1TU0B 2MI6A 3OS5A 3SWNA 4JJCA 4LUEA 4RTVA 4A54A 2DTIA 3CMAT 2EAYA 2LRQA 4IKFA 5GMKh 2X9HA 4NL2A 1MHNA 3RMSA 3V8KA 1E6GA 1GBRA 2X4WA 3CCLA 2CP2A 1NPRA 3H0HA 3GP8A 2X3XD 3GIBA 4Y28E 1QVGS 1UECA 2EJ9A 3DB3A 1AHJB 1KD1U 5GAMj 5J39A 5GAN5 1N8RU 3L2VA 3KXTA 5KYUB 2KYBA 1DJ7B 3HL8A 1W4SA 1K9MC 1AEYA 3EGUA 4M77A 1ZUYA 1Y7XA 3NHNA 2XU8A 4HVVA 2PVGB 1X01A 3M59A 3CCLT 5KH6A 3CXCP 1YHQT 2R5MA 4BB7A 2EQIA 1JRIA 2QQBA 5LJ5g 2CSQA 2QA4T 3V8LA 2NLUA 3QIIA 4C8QA 3LWHA 3TREA 2K5FA 4FM4B 1C1AA 3I55Q 1Q81U 4N0AA 2EGEA 3JAME 3OYDA 1WA7A 1HSQA 4JRKA 3QUIA 3JSCA 4FSXA 2ENMA 3CCVA 1ZUKA 2OAUA 4CC7A 3EG9A 3H6ZA 3OYBA 2KVQG 4J9GA 1TUDA 2D8JA 3JB9H 3PIOA 2CP3A 2LJ0A 1TH7A 3HHTB 1VQLA 4EMGA 3RBBB 1JB0E 2X4YA 3MP1A 2O88A 3O8VA 2R58A 1AWWA 4N4IA 5LJ3f 3TEEA 1I07A 4MZPA 4IUTA 2QEXQ 5ECAA 2RN8A 3CMEA 3CQTA 5GANd 2JM8A 1NEBA 5GAMe 4QVCA 2GNCA 3L2QA 2P0PA 2DXBA 3CCUA 5FLXE 3L2ZA 2QG9B 3M57A 1B34A 2MAMA 4MMLA 3G7ZA 3M54A 4C92B 1G3WA 3J80E 1G83A 5KYNA 4M75G 1Q95G 1YJNA 1D0XA 1K9MR 1QP3A 1M2VA 1VQ4A 5A0DA 3CMET 5FRNA 2OTJQ 4ZNXA 2L3QA 5GAN6 2QGGA 4M7DB 3LGFA 3MEAA 3CCUT 1QQJA 1M1KU 2HBPA 2CH4A 1WNLA 1M1FA 1YJ9A 4PJOE 4X9DA 1BI3A 1BCMA 4J6WA 3OMGA 3M0PA 4C5HA 3BFMA 1YJNT 4KT0E 1D09B 3M55A 4E7KA 1WQWA 2OAWA 1M1GA 1VQ4T 2KRMA 3S3NA 1UGVA 3CCJQ 3I35A 4BE2A 2CSIA 4CC3A 2C0TA 4L59A 1BI2A 3A8MB 4RCCA 2VUBA 2JZ2A 3UWNA 2H3JA 2LQKA 4Q5WA 1YJ9T 1Q86U 2LP5A 1SRLA 1OYXA 4J7IA 3SWNB 4M7DG 1T3SA 4OB2B 5FU6B 1IRXA 3ZBDA 1KHIA 2PU9B 1V29B 4R56A 3VS1A 3PIPA 1M5Q1 2RNAA 1WHMA 2QGFB 2VYTA 4XU1A 2GTJA 4C8QC 2YHTA 1M90C 3OYEA 1W2BS 1TUCA 4NOYA 2M0YA 1TOVA 1N6AA 3OW2S 2FL7A 2YDLA 4EMKA 4OMMA 1IO6A 4PJOG 4K11A 4JLIA 1WIEA 5CKFA 2FYKA 2LC4A 5LL6S 2H3EB 5KE3A 2EYWA 2DO3A 1RAHB 1G2BA 2PNIA 1VQ8Q 3G6EQ 1AVZC 3JCMe 1VQ9Q 2KI7A 1RLPC 2EVRA 4JDSA 1TUGB 2FZKB 4M78G 1OULA 4M77B 3CCRQ 4J9EA 3I5RA 5GAOl 3H0IA 2FPFA 1D0ZA 4RTWA 1QVGA 2CT3A 3MPUB 5LJ3g 3PFSA 3HTRA 2RQWA 1YP5A 1QP2A 1K76A 2IPOB 3HKSA 5GANh 4F7UA 3PNWC 1WJSA 2K57A 5IXBA 4OB1B 2JN0A 3CC2Q 2EQJA 1WDXA 4J9HA 3EGXA 5I22A 1BBZA 5LJ5d 4HCBA 5GAN3 2KXDA 1Q7YC 3NMZC 3QBYA 4XTVA 5CAIA 2QTVA 3MP8A 3VYGA 1AT1B 3L1AA 1UDLA 3CCEA 1XJWB 1X27A 4B6MA 2DIGA 2L89A 1B3QA 4A53A 1VQKA 2KXCA 2KRNA 5DY9A 3ZFJA 1KJWA 3REAB 3X26B 4JJBA 1R0CB 3UA6A 2DTHA 3UDCA 3EG0A 2KNBB 2E3IA 1W70A 2E6NA 3EGDA 3AHUA 3QHSA 2JMAA 3VRZA 1OI1A 3OS1A 2YXYA 1JO8A 2KSSA 4HVWA 2B8AA 5GMKi 2MOXA 2MK5A 1X43A 4AFZC 1VQKT 1M2OA 4ANJA 5KYWA 4EMHA 2MWOA 3OYCA 1ACMB 2YRVA 1X6OA 1MNEA 1UG1A 4OMQA 4OP0A 3ER0A 2RHYA 2XHCA 2CH4W 1IHVA 3FB9A 2K2VA 3WVEB 5IXFA 2DTOA 5CKHA 4M7AF 2DJZA 2ZPBB 1WHLA 3C94A 9ATCB 4RMOA 8ATCB 3CD6T 2HNIA 1OX9A 1KD1C 2FVUA 1EX4A 4Y91A 3M58A 2DA9A 5CK9A 1N8RC 3E9GA 3A1PA 2KBTA 2ZPIB 4QKUA 4IUQA 2AKLA 1LOJA 4LE9A 4PNOA 4Y92A 1HJDA 1KK7A 4JS4A 1S72A 1NPPA 4ELYC
chains in the Genus database with same CATH topology
2MWPA 2M0OA 3MCAB 3HP9A 4XTUA 3NTHA 2XD0A 2RH2A 3LH0A 2DK3A 4NL3A 3P8HA 1FX7A 4FU6A 4E7IA 1O9SA 2GFAA 1VIFA 1QVPA 5CKEA 1OZ3A 3QKJA 3FC3A 2E1HA 1WPYA 2RJEA 5GAN4 2JOYA 2RHIA 2DD4A 2KK4A 3S6WA 1KQ1A 3INZA 1YI2A 4M75B 3S3MA 5GMKl 4M7DC 2XG8D 4PL6A 3G71A 3VV0A 3CCJA 4HT8A 1KC8U 2OTJT 3M4YA 3SFMA 3DLLA 3CCQA 4C8QB 3DB4A 2RK2A 1Y71A 5IAYA 4JS5A 1O75A 1Q81C 4KBMB 3M5AA 5CIUA 1S72T 5CVIA 4BI4A 2EQMA 1XQHA 5D6YA 2F69A 3QXEB 2MF2A 2XI9A 2Y4XA 4ZGDB 4XU2A 4VUBA 5CQYA 1VQPA 4OGEA 5GAOn 3RIRA 1MGQA 4EMKB 2CS7A 3NFCA 1XOVA 4GLKA 4A4GA 2V8JA 3PMTA 3FJPA 3V8JA 2VXEA 4C0DB 2DD5A 3CMAA 3CCVT 4M7AA 4M7AC 2E65A 2QQSA 3OS0A 3GNGA 2X4JA 4OVAA 2DPPB 4LDXA 3CC4T 4LD6A 4M77G 2ZPEB 4M77F 2CGHA 4XTYA 5CKBA 3OYFA 1Q82U 3META 3PTAA 3TU4K 3OYGA 4C5EA 2P4TA 4V2SA 4QQGA 3M56A 3OSVA 4QQDA 2LCLA 2Y90A 3N5BB 1YI2T 3OYNA 1W2BA 1Y96A 3G71T 5IT9E 4FIBA 3CCJT 1G3SA 3MEWA 3CXCS 1VQ5T 1D3BA 4JRQA 1OZ2A 3OW2A 1VQLT 3UPUA 1I81A 3VYHB 5GAMg 2MI6A 4FT2A 3OS5A 3SWNC 3SWNA 4FT4A 5FU6C 3OBWA 5GAMf 3E9FA 1VQNA 3CBMA 4A54A 4B9XA 2ZZDA 1QW1A 2DTIA 3CMAT 2EAYA 4HT9A 2LRQA 1X75C 4HCCA 1VQ8A 4IKFA 3G6EA 4BD3A 5GMKh 3C95A 1MHNA 4ME7A 3HRTA 4NL2A 1I5LA 3RMSA 2FHDA 3V8KA 2WSEE 3ZEHA 1U1TA 2X4WA 2P0KA 1VQ7A 4BY6B 3CCLA 1NPRA 3CCRA 2F5KA 1M9SA 1B34B 5GAOm 2WSFE 3GP8A 3JCMc 5L8RE 3CD6A 3GIBA 4Y28E 4FL6A 1QVGS 1WQ7A 2EJ9A 1I8FA 3DB3A 1AHJB 2XIDA 3QYHB 2EIFA 3SDZA 5LJ3d 3V7CA 3WXMB 3JCMd 5GAMj 1KD1U 2QEXA 4OB0B 5GMKm 5J39A 5GAN5 4ZN3A 1N8RU 3L2VA 1VQNT 4DQ2A 3KXTA 3LWIA 2GCXA 3RUXA 2RJCA 4DOWA 1DJ7B 3L2RA 3HL8A 1W4SA 4PJOB 3CBPA 1VQ8T 3G6ET 3V7RA 1BI1A 2JVVA 2K3YA 1K9MC 2M16A 2GQVA 3LX7A 4M77C 1VQ9T 2PVDB 1M1KC 4M77A 3CPWA 1Y7XA 2DIQA 3MHXA 2XU8A 4MZMA 5I2MA 3OQ5A 1VQ7T 2PVGB 4ZGEB 1X01A 2CYZB 3JRZA 1XNIA 3M59A 3CCLT 3CC2A 3CCRT 4M75D 5KH6A 1YHQT 2R5MA 3L42A 4Z02A 3ME9A 4BB7A 4C0GA 3OY9A 4C0ZA 2JUFA 3RKYA 3QSUA 1JRIA 2QQBA 3CPFA 2EFIA 3X20B 5LJ5g 4M77E 1U1SA 2EYQA 4M78B 2QA4T 2E70A 4N4HA 3BW1A 5GAOq 5LJ5f 1HXDA 3V7SA 2NLUA 3V8LA 2XDPA 4A4EA 5GAMh 3QIIA 5GAOp 3VKIA 4DA4A 2XDBA 2RI5A 4E7HA 2ZGWA 2AHJB 4C8QA 5GMKe 2O4XA 1M8VA 3LWHA 2QQRA 1NZ9A 2G3RA 4OGCA 3TREA 3OYIA 2KAFA 2K5FA 1BIAA 4FM4B 3SD4A 2E10A 3CXCA 3QYGB 3CCSA 2M9UA 1Q81U 3OYJA 2XKOC 4N0AC 2CKKA 2E6ZA 4N0AA 4LDUA 3M53A 3EFSA 3L2WA 3JAME 4C8QE 2K3XA 4JRKA 4KUIA 3OYDA 1N9SA 3QUIA 1JJ2S 3JSCA 3OYYA 4FSXA 4LDWA 3CC2T 3VU3C 3CCVA 3OB9A 2JNGA 3P8BB 1BIBA 2L5QA 4C92D 3CC4A 2OAUA 3RERA 2RJDA 3H6ZA 3OYBA 2KVQG 1EIFA 3QG1A 5LJ5j 2RJFA 3E1SA 2CZ0B 2KMTA 5DM7R 1RL2A 2C06A 3JB9H 3MO8A 4BI3A 3PIOA 1TH7A 3JCMV 3HHTB 1VQ5A 2EKOA 2K4YA 2WACA 5J26A 3HRSA 1BYMA 1VQLA 3H8ZA 4EMGA 1JB0E 2X4YA 3BDLA 3MP1A 2M1HA 3I56T 1BI0A 2QQAA 3CCST 2KQWA 5DLOA 3J81E 1G5VA 3O8VA 5KCHA 2X4XA 1GXIE 2R58A 1M4ZA 2HQEA 4N4IA 4M7DD 3JCMg 3GOXA 2LT1A 1QVFS 4KULA 2ZPGB 4IURA 5LJ3f 3TEEA 2E5QA 3JCMf 4MZPA 4IUTA 2EQKA 4QQ6A 4RKUE 4YTLA 3QO3A 3CMEA 4ELZC 5GANd 1KQSS 3OYKA 5GAMe 4QVCA 3L2QA 2P0PA 2DXBA 4PKCC 4P5NA 3WVDB 2RA2A 5FLXE 2LVMA 3A8OB 3L2ZA 3GLXA 2WSCE 2IVWA 3Q1JA 4A4FA 5LJ5h 3HSBA 2LCCA 1B34A 2MAMA 2E12A 3M57A 4L5GA 1IREB 4MMLA 1N27A 4MMKA 3C4SA 3G7ZA 3M54A 4C92B 1G3WA 2I2LA 3J80E 4II1A 3FEOA 1YIJT 4R55A 4PLIA 1K73C 3E19A 2YLCA 3A8HB 4M75G 1JBMA 4M75F 4XU0A 3JCMQ 1YJNA 3GNFB 1ZQ1A 5HK0A 4JRPA 4PJOD 1KG1A 1RI0A 4C8QG 4C8QF 5FU7C 3P8DA 1QP3A 4IUPA 2KY9A 4RG2A 5LJ3j 1VQ4A 5A0DA 1UB4A 3OYMA 3OYAA 2MMPA 3CMET 2XICA 4C5GA 5FRNA 1R8OB 3QDRB 3MEVA 3RKXA 3NTKA 5HY6A 5GAN6 2BKDN 3A8LB 1I4K1 2XDDA 2A3LA 3JB9G 1VQ9A 4M7DB 1K9MU 3LGFA 3MEAA 2GFUA 3URGA 3CCUT 4M78D 4J83A 1M1KU 2HBPA 2DKGA 4A4HA 1WNLA 1M1FA 1NE8A 4F7UB 1YJ9A 4ZTJA 1BKBA 1YHQA 4PJOE 1VUBA 3BDUA 5A2QE 4X9DA 1BI3A 4ZGJB 3OYHA 4J6WA 2GF7A 2DXCA 3OMGA 2QA4A 1YITT 4KUDK 5C6SA 4C5HA 3BFMA 3OMCA 1YJNT 1WGSA 1UGQB 2D0QB 2DXUA 4J6YA 4EPCA 4BE0A 1PSFA 4KT0E 2E64A 4M7AB 3M55A 4E7KA 1WQWA 1M1GA 1VQ4T 3JCMh 3S3NA 1M90U 1VQOA 4BE2A 3JB9J 5LJ5e 3HFNA 2O01E 4L59A 3JB9F 2LT4A 1BI2A 2P0QA 3A8MB 4RCCA 2VUBA 4JUVA 3CCET 4OB3B 4XTZA 2FB7A 2JZ2A 2RI3A 1D3BB 3UWNA 2H3JA 1NJIC 4N4GA 2DZCA 4EDUA 3CEYA 2RB6A 2LQKA 4CRIA 4Q5WA 1YJ9T 3DKMA 3PMIA 1Q86U 2R57A 3RESA 2VGMA 1OYXA 4J7IA 3A5ZB 3SWNB 3QPHA 3VUZA 4ATOA 4M7DG 4E7JA 5FU6B 4OB2B 3JCMb 3G4SA 3EAEA 3ZBDA 1KHIA 2PU9B 4QVDA 2HD0A 2QDYB 4M75C 1V29B 5GANg 5FRMA 4M75A 1VIEA 4R56A 3PIPA 1M5Q1 4XU1A 2VYTA 5GANf 4C8QC 1G3YA 2YHTA 3FIFA 5J3BA 3OYEA 1XTDA 2RHZA 1W2BS 1M90C 5CCAA 5D6WA 4NOYA 1WJRA 4MZTA 5A0GA 3CBOA 1VQOT 2R5AA 3I56A 1VQ6T 1N6AA 4BE1A 3MP6A 1G3TA 2RHUA 4M75E 3OW2S 2FL7A 1UGRB 4EMKC 3L2UA 4EMKA 4C0DC 1Q86C 2HAXA 2A7YA 4PJOG 4ZN1A 2VV5A 4PJOF 4JLIA 3PGGA 4IUUA 5CKFA 2FYKA 2LC4A 4J6XA 5LL6S 2LQ8A 2QI2A 4XTXA 2V8IA 3UT1A 5KE3A 2V8KA 4XTWA 2DO3A 4HKEA 3SB2A 3G4ST 3RKWA 4X34A 5M9OA 5LJ3e 1YIJA 3JCMe 2PUOB 4XK8E 5GANj 1FXXA 2LX9A 1LJOA 3BY7A 3M4GA 2DVEA 4C92A 4JDSA 3JB9D 1Y07A 4M78G 4M78F 4M77B 4LDYA 3MEUA 3OA6A 3TCJA 2BIVA 4BDYA 4GY5A 5GAOl 3JCMW 2K5LA 4MDXA 2RO0A 1K73U 1QVGA 1K8AU 3T9NA 5LJ3g 3PFSA 4C92E 3OS2A 3OBYA 2F5TX 3HRUA 1Q7YU 3HFOA 2CZ7B 4LDVA 3ASKA 2LNVA 4JJNK 1KHCA 3S3OA 1PSEA 2CZ1B 1FWZA 1QP2A 2RI2A 4M7DA 4E7LA 2VC8A 5GAN2 4BY6C 2O4XB 5HKCA 3FDRA 3OSSC 1YJWA 3HKSA 3CPWS 5GANh 4F7UA 3PNWC 1WJSA 2K57A 3JCMX 4M7AD 4OB1B 2JN0A 3LW5E 2DXTA 4JLGA 4DOVA 2ZCFB 2QTXA 4M7DE 2EQJA 1VQMA 3NTIA 2PVOB 1YITA 2RK1A 2LDMA 1P92A 3VJPA 1K8AC 3X25B 4QVZA 3R6OA 5LJ5d 4L6V5 4HCBA 4F7UE 5GAN3 5GMKj 3KBGA 4MDWA 1Q7YC 4ZTFA 1IZ6A 5HK3A 4PJOC 3QBYA 4PJOA 3X24B 2IG0A 4XTVA 5CAIA 4XQ3A 3JCMJ 1KC8C 3MP8A 3KUFA 5IN1A 1UGPB 3LGLA 3VYGA 3L1AA 5CR2A 3CCQT 3I55A 3CCEA 4M7AE 4BUGA 4C0FA 1H641 5C0MA 1YJWT 2DIGA 3QJYA 3EFRA 1NJIU 1N9RA 2L89A 2PQWA 1LNXA 4O5VA 4A53A 4PLLA 3GPLA 5A0LA 1VQKA 4M78C 4X9CA 1VQPT 2PUKB 5DY9A 4M78A 1JJ2A 2OTLA 1VQMT 5CKDA 2ZPHB 3ZFJA 2EQUA 3C12A 1U8RA 4IUVA 3DLMA 4D6WA 4BI8B 3X26B 1Q82C 4C92G 4C92F 5DLQE 2EJGA 2DTHA 4B9WA 3UDCA 3QJ6A 2RD1A 5CO7A 5LJ3h 1KQ2A 4RCBA 4M78E 3QZ5B 3RMQA 3X28B 4BACA 2JTFA 1VQ6A 5EG2A 2L3RA 1YCYA 4J7FA 1UEBA 4NS5A 2E6NA 4WF2A 5D6XA 1Y96B 3QHSA 5GANe 2YLBA 3FLGA 3I55T 2EJFA 3AHUA 5GAN7 5AYFA 1OI1A 4J5YA 2DEQA 3OS1A 2Y4YA 3A8GB 4UC4A 2KSSA 2QXFA 2RM4A 2B8AA 5GMKi 3HPWA 2VXFA 1QVFA 2CZ6B 2K5IA 1HK9A 3JCMP 1VQKT 4XAXB 4M7DF 5I21A 4XU3A 2OTLT 3CCMA 4M77D 3QZ9B 5FU7B 3GF5A 1WJQA 3VUBA 4EMHA 1KQSA 2MWOA 2JTMA 4F7UF 4F7UG 3F70A 3OYCA 2L8DA 2RHXA 2HQXA 5I2SA 2YRVA 1X6OA 1ZBXA 4OP0A 3FRNA 3CC7A 3ER0A 1ZHIA 2RHYA 2XHCA 4E47A 2D9TA 4TVRA 2VGNA 5GAOr 2LTOA 3FB9A 3M9QA 3CCUA 2K2VA 5FROA 4HCZA 3WVEB 4M7AG 2DTOA 5CKHA 4M7AF 2DJZA 2ZPBB 2BUDA 5GAMd 3J7AF 3C94A 2KDSA 2EWNA 4RMOA 2DAQA 2X35A 3CD6T 4C8QD 4HA8A 4QW2A 2HNIA 1KD1C 5KE2A 2FVUA 1UGSB 3PT9A 4Y91A 4JRIA 3M58A 4C5IA 4O6JA 4CI0C 4A4KA 4J8OA 5CQXA 5CK9A 3E9GA 1N8RC 1H3ZA 3JB9I 3LLRA 4RG8A 3LYIA 2QEXT 4OF1A 4LD9K 3CCMT 2DZ9A 2OTJA 2ZPIB 4IUQA 5KCOA 1LOJA 4PNOA 2ZPFB 4BDZA 4C92C 2D6FA 2E41A 4JS4A 1S72A 3CC7T 1YBYA 1SSFA 2XK0A 5GAN8 1NPPA 2QQ9A 4OMFB 3OYLA 4ELYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  4ZGJ B;  2PVO B;  3X25 B;  2DXC A;  3X20 B;  4L6V 5;  1UGQ B;  2D0Q B;  1PSF A;  4KT0 E;  2DD4 A;  2AHJ B;  3X24 B;  1UGP B;  3VYG A;  2O01 E;  4FM4 B;  3QYG B;  3A8M B;  4OB3 B;  3QXE B;  4ZGD B;  2PUK B;  2ZPH B;  2DD5 A;  4OB2 B;  2PU9 B;  2QDY B;  1V29 B;  2DPP B;  3X26 B;  2ZPE B;  2CZ0 B;  3X28 B;  3QZ5 B;  3HHT B;  1JB0 E;  3VYH B;  1UGR B;  3A8G B;  1GXI E;  2CZ6 B;  2ZPG B;  2ZZD A;  3QZ9 B;  4RKU E;  4ZGE B;  2DXB A;  3WVD B;  2PUO B;  3A8O B;  4XK8 E;  2WSC E;  2WSE E;  1IRE B;  2WSF E;  3WVE B;  5L8R E;  2ZPB B;  4Y28 E;  3A8H B;  1AHJ B;  3QYH B;  1UGS B;  1QP3 A;  2CZ7 B;  4OB0 B;  1PSE A;  2CZ1 B;  1QP2 A;  2ZPI B;  1DJ7 B;  3A8L B;  2ZPF B;  2PVD B;  4OB1 B;  2PVG B;  3LW5 E;  2CYZ B; 
#chains in the Genus database with same CATH topology
 3MCA B;  4XTU A;  2RH2 A;  3G1J A;  2P4R A;  2DK3 A;  4OML A;  2DX1 A;  1FX7 A;  5CKE A;  2COZ A;  3FC3 A;  2E1H A;  4PJN A;  2YUP A;  1SSH A;  2PZ1 A;  1KC8 U;  1CKA A;  3DLL A;  1VQ6 Q;  2ECZ A;  1Q81 C;  4KBM B;  2K79 A;  1S72 T;  2KYM A;  5CVI A;  4ZGD B;  1X2Q A;  4VUB A;  2XMF A;  1OPL A;  2CS7 A;  4EMK B;  4A4G A;  2V8J A;  4C0D B;  2VXE A;  2DD5 A;  4M7A A;  2E65 A;  3OS0 A;  2V1R A;  2X4J A;  1E7O A;  4LD6 A;  2P4T A;  4AG1 C;  4QQG A;  2D8H A;  4QQD A;  2LCL A;  1W2B A;  1HYO A;  1G3S A;  1QCN A;  1VQ5 T;  1D3B A;  4JRQ A;  1OZ2 A;  2NUP A;  3OW2 A;  5GAM g;  3SHW A;  1BCO A;  4FT4 A;  1JXO A;  2OX7 A;  4B9X A;  3EG1 A;  1FMK A;  3UF4 A;  1Z9Z A;  3C0C A;  1R77 A;  3ZEH A;  1KD1 R;  1VQ7 A;  1RI9 A;  2F5K A;  1N8R R;  3JCM c;  5L8R E;  2IIM A;  1NLP C;  5LJ3 d;  2EIF A;  3V7C A;  3EGX B;  4OB0 B;  4ZN3 A;  2KR3 A;  2GCX A;  3RUX A;  3L2R A;  1SG5 A;  3EH1 A;  1BI1 A;  3LX7 A;  2PVD B;  1YJW Q;  1M1K C;  2PTK A;  4RUG A;  4MZM A;  1VQ7 T;  2JXB A;  3JRZ A;  1XNI A;  4M75 D;  1VQP Q;  3L42 A;  4Z02 A;  2NUT A;  3RKY A;  1U1S A;  5LJ5 f;  1HXD A;  3V7S A;  1Q81 R;  4DA4 A;  3VKI A;  2HDA A;  1ZSG A;  2AHJ B;  5GMK e;  1NZ9 A;  2G3R A;  4OGC A;  1VA7 A;  3QYG B;  3TQ7 P;  2VAS A;  2CKK A;  3EGD B;  1PRL C;  1YWO A;  1JJ2 S;  3OYY A;  3OB9 A;  2JNG A;  2OTL Q;  1QVG P;  1BIB A;  4C92 D;  3CC4 A;  4QT7 A;  4X1V A;  4DBR A;  1BK2 A;  1MND A;  5KYW B;  1RAF B;  2KMT A;  3MO8 A;  2ED1 A;  2WAC A;  5J26 A;  2D1X A;  1ZUU A;  3BDL A;  5KCH A;  2C0I A;  2L3P A;  1IXD A;  4M7D D;  3JCM g;  1QVF S;  4KUL A;  2LQN A;  2DL5 A;  2EQK A;  4QQ6 A;  4OMO A;  3OYK A;  1KIK A;  4KGZ B;  2EYY A;  3EG2 A;  2RA2 A;  3A8O B;  2WSC E;  3CC7 Q;  2LCC A;  2E12 A;  1UHF A;  3GBQ A;  1N27 A;  3NPF A;  2YWW A;  3C4S A;  2K6D A;  1QKW A;  4R55 A;  4PLI A;  2YLC A;  4PJO D;  1NG2 A;  1RAG B;  4C8Q F;  1X2K A;  1M1K R;  2AK5 A;  4C5G A;  3QDR B;  1ZBJ A;  1IB8 A;  3NTK A;  2BKD N;  4M78 D;  1LCK A;  4J83 A;  4A4H A;  1YHQ A;  1BKB A;  1VUB A;  4ZGJ B;  2ATC B;  3FJ5 A;  3OYH A;  4F16 A;  3CCV Q;  2GF7 A;  4KUD K;  3H9N A;  2QA4 A;  1MMA A;  3OMC A;  1PSF A;  1VYV A;  4M7A B;  4Z89 A;  4FW2 A;  1Q86 R;  3G71 Q;  1VQO A;  3JB9 J;  4AFU C;  3CCQ Q;  3HFN A;  4GLM A;  2LT4 A;  4KH1 B;  2P0Q A;  1AZE A;  4OB3 B;  4XTZ A;  1D3B B;  5FWC A;  2SEM A;  4N4G A;  2NUP B;  4EDU A;  3DKM A;  2R57 A;  2VGM A;  3MJX A;  3VUZ A;  3QPH A;  4E7J A;  3JCM b;  3G4S A;  3EAE A;  2FO0 A;  4M75 C;  5FRM A;  2ESW A;  1IGQ A;  4EIK A;  1G3Y A;  1WX6 A;  2ZAE A;  1XTD A;  3JV3 A;  5D6W A;  2MPX C;  1VQO T;  4BE1 A;  3MP6 A;  1G3T A;  4M75 E;  1UGR B;  2HAX A;  4ZN1 A;  1QLY A;  2DBM A;  3PGG A;  4IUU A;  3SEM A;  2A0F B;  1VQN Q;  2LQ8 A;  3EG3 A;  3UT1 A;  2BE7 D;  2QK0 A;  3SB2 A;  3G4S T;  5IHN A;  5GAN j;  4XK8 E;  1LJO A;  2G6F X;  2OJ2 A;  2RQV A;  4LDY A;  2FPE A;  3OA6 A;  1SF9 A;  4BDY A;  4GY5 A;  2K5L A;  1RAA B;  1K8A U;  2DF6 A;  3RNJ A;  3T9N A;  4C92 E;  3OS2 A;  3EFO A;  3OBY A;  2JS0 A;  4LDV A;  3ASK A;  4AFQ C;  5GAN 2;  4BY6 C;  3M0S A;  1PWT A;  1ABQ A;  2GBQ A;  3CPW S;  1AOJ A;  3JCM X;  1W2B P;  1KFZ A;  1QWF A;  1AWJ A;  2LQW A;  4JPB W;  2MCN A;  2K7A A;  3LW5 E;  4DOV A;  2ZCF B;  1UHC A;  2QTX A;  4M7D E;  3OW2 P;  2RK1 A;  2LDM A;  1P92 A;  4QVZ A;  4L6V 5;  3UA7 A;  4DEX A;  1UUE A;  2RQR A;  3KBG A;  4MDW A;  4DEY A;  1ZSZ A;  4PJO C;  3M0T A;  1KC8 C;  3KUF A;  1BB9 A;  5IN1 A;  1E6H A;  3CCQ T;  3I55 A;  4C0F A;  1SHG A;  3CCS Q;  5AT1 B;  3QJY A;  2YUN A;  2FRW A;  1LNX A;  4LXC A;  3GPL A;  1K0X A;  5A0L A;  4M78 C;  4X9C A;  1JJ2 A;  2CP0 A;  2ZPH B;  4E7Z A;  3DLM A;  4D6W A;  4BI8 B;  4C92 G;  3LH5 A;  5DLQ E;  1KQ2 A;  1J3T A;  4M78 E;  4BAC A;  2AKK A;  2JTF A;  2X51 A;  2BZX A;  4J7F A;  1UEB A;  5D6X A;  5GAN e;  3JB9 G;  1Y96 B;  1YIJ Q;  1FMV A;  3FLG A;  3I55 T;  5AYF A;  4J5Y A;  2Y4Y A;  2DYB A;  3A8G B;  1NEG A;  1OQK A;  2RM4 A;  1PG5 B;  4PFP A;  1QVF A;  2CZ6 B;  1HK9 A;  5KYX A;  4D8K A;  4XU3 A;  3QZ9 B;  4FCY A;  1YWP A;  1WJQ A;  3VUB A;  4AMC A;  3TVT A;  4F7U F;  2RHX A;  2HQX A;  5I2S A;  1ZHI A;  2D9T A;  5GAO r;  2LTO A;  2X3W D;  3M9Q A;  1D1A A;  4HCZ A;  2DL4 A;  4OMN A;  2LNH B;  1VYT A;  1PRM C;  3J7A F;  1X69 A;  3R6N A;  1RAI B;  1UGS B;  3PT9 A;  4JRI A;  1SEM A;  4CI0 C;  1S1N A;  5CQX A;  1X6G A;  2QEX T;  3LYI A;  2CUB A;  2DE0 X;  2OTJ A;  2J6F A;  2BE9 B;  3CCE Q;  1YNZ A;  4JJD A;  2XK0 A;  5GAN 8;  1NBE B;  1SHF A;  2YSQ A;  2XD0 A;  3LH0 A;  3EH2 A;  2YRD A;  1KC8 R;  4FU6 A;  1MV3 A;  4E7I A;  1OZ3 A;  2RJE A;  1WPY A;  5GAN 4;  4KGX B;  2EW3 A;  3A98 A;  3INZ A;  4ORZ A;  2XG8 D;  4HT8 A;  3CCJ A;  2OTJ T;  3SFM A;  4C8Q B;  3NGP A;  5IAY A;  4JS5 A;  3RR6 A;  2F2W A;  1PD1 A;  2M02 A;  4OMP A;  3M5A A;  4BI4 A;  2EQM A;  1XQH A;  4Z88 A;  5D6Y A;  3QXE B;  2MF2 A;  2XI9 A;  5CQY A;  1EFN A;  5GAO n;  3FJP A;  1LPL A;  4OVA A;  1ZSZ C;  4M77 G;  5CKB A;  2CGH A;  4XTY A;  4DBQ A;  3OYF A;  1Q82 U;  3MET A;  3EG9 B;  3OSV A;  2Y90 A;  3CCJ T;  3I56 Q;  1YFN A;  1K1Z A;  3UPU A;  1I81 A;  3VYH B;  4FT2 A;  3OBW A;  2LX7 A;  5GAM f;  1H8K A;  3UAT A;  3E9F A;  2ZZD A;  2KRO A;  4D8D A;  2LJ3 A;  4HCC A;  1VQ8 A;  3REB B;  4BD3 A;  3G6E A;  2L0A A;  3C95 A;  4ME7 A;  1I5L A;  1KSW A;  1W6X A;  3PE0 A;  1WXU A;  4J9F A;  2CT4 A;  3CCR A;  1B34 B;  1M9S A;  5GAO m;  2WSF E;  3CD6 A;  1I8F A;  2KGT A;  2XID A;  3QYH B;  3SDZ A;  4LNP A;  3VS0 A;  1RLQ C;  4DQ2 A;  3LWI A;  2RJC A;  2DNU A;  1M2V B;  1VQ8 T;  3G6E T;  2K3Y A;  2JVV A;  1M30 A;  2M16 A;  3VS3 A;  1VQ9 T;  3CPW A;  3MHX A;  4J9B A;  5I2M A;  3OQ5 A;  4ZGE B;  2DVJ A;  3CC2 A;  3CCR T;  4J9D A;  2DIL A;  2RPN A;  1VQM Q;  3QSU A;  1JEG A;  3ME9 A;  4C0G A;  3OY9 A;  1YIT Q;  1U5S A;  5KYY A;  2EYQ A;  3BW1 A;  5GAO q;  4A4E A;  2VWF A;  2XDB A;  4E7H A;  2ZGW A;  1R0B G;  1IGU A;  3OYI A;  1BIA A;  3SD4 A;  3CXC A;  2M9U A;  4F04 B;  4HXJ A;  2HBW A;  3M53 A;  3L2W A;  2K3X A;  4KUI A;  1RAB B;  3I5S A;  3CC2 T;  4LDW A;  2H8H A;  3VU3 C;  3P8B B;  2JS2 A;  2K2M A;  3RER A;  5IH2 A;  1OX8 A;  4PJJ A;  3QG1 A;  3E1S A;  2CZ0 B;  5DM7 R;  2JTE A;  1GCQ C;  4FYW B;  2DEU A;  3MKD A;  1VQ5 A;  2K4Y A;  3H8Z A;  3I56 T;  3VS4 A;  1G5V A;  2J06 A;  1EZZ B;  2HQE A;  2ZPG B;  4IUR A;  3JCM f;  3H41 A;  2FPD A;  3CCM Q;  2KT8 A;  2HKN A;  1KQS S;  1G8X A;  2LVM A;  3Q1J A;  4RTU A;  5LJ5 h;  3HSB A;  2IVW A;  4L5G A;  4MMK A;  1X6B A;  3A8H B;  1JBM A;  4M75 F;  4XU0 A;  1KG1 A;  1ZQ1 A;  6AT1 B;  2HSE B;  1RI0 A;  1OPK A;  2EGA A;  1WFW A;  4KH0 B;  2DRK A;  5FU7 C;  1N5Z A;  1JJ2 P;  2QDL A;  5LJ3 j;  2KY9 A;  1VYU A;  2MMP A;  2XIC A;  4A63 B;  3MEV A;  5HY6 A;  2XDD A;  2GFU A;  1PC0 A;  4PFZ A;  1NE8 A;  4F7U B;  4ZTJ A;  3BDU A;  5A2Q E;  5FW9 A;  1YIT T;  2DXC A;  2EPD A;  2FG0 A;  2FRY A;  5C6S A;  1I1J A;  3BE3 A;  1UGQ B;  3CC4 Q;  2D0Q B;  4J6Y A;  4EPC A;  2E64 A;  1QVF P;  4KRT A;  1YI2 Q;  1M90 U;  2JT4 A;  2MYS A;  4JUV A;  1PD0 A;  2RI3 A;  2DL8 A;  1MUZ A;  2VVK A;  4CRI A;  3PMI A;  3I9Q A;  1AWO A;  3RES A;  1GRI A;  1ARK A;  2B86 A;  3A5Z B;  3CMA Q;  1ABO A;  2QYZ A;  2HD0 A;  2QDY B;  5GAN g;  4E6R A;  1GBQ A;  1Y0M A;  2A28 A;  4M75 A;  1UTI A;  2EBP A;  3FIF A;  5J3B A;  2RHZ A;  5CCA A;  1WJR A;  1RUW A;  2KT1 A;  2DLP A;  1VQ6 T;  2W10 A;  2YT6 A;  3EHQ A;  1RAD B;  2O2O A;  2HL3 A;  2RQU A;  3L2U A;  1Q86 C;  2A7Y A;  4PJO F;  4J6X A;  4XTX A;  2V8I A;  4XTW A;  2DET A;  4CC2 A;  3RKW A;  2F2X A;  1WHK A;  5LJ3 e;  1QMC A;  1FXX A;  1K8A R;  3M0R A;  3M4G A;  4C92 A;  3JB9 D;  1NM7 A;  4M78 F;  3CCL Q;  1YHQ Q;  3TCJ A;  2BIV A;  3JCM W;  4MDX A;  1GFD A;  2RO0 A;  1K73 U;  1U3O A;  1ZX6 A;  2DRM A;  1OU8 A;  1SRM A;  5KYY B;  1Q7Y U;  1SKU B;  3HFO A;  2CZ7 B;  2LNV A;  1KHC A;  3S3O A;  2CZ1 B;  1FWZ A;  2RI2 A;  4M7D A;  2HEQ A;  4DBH A;  2RF0 A;  3FDR A;  3OSS C;  1YJW A;  4E7S A;  1HD3 A;  2LZ6 B;  2K3B A;  2PVO B;  2NWM A;  4M4Z A;  3VJP A;  3R6O A;  2J6K A;  4F14 A;  5IHK A;  5L23 A;  5HK3 A;  4PJO A;  1TG0 A;  2IG0 A;  4XQ3 A;  1M3A A;  1UGP B;  1WHG A;  3LGL A;  4M7A E;  1YJW T;  1FYN A;  1NJI U;  2PQW A;  4IIO A;  4O5V A;  4PLL A;  1VQP T;  2PUK B;  1C0M A;  4M78 A;  2LCS A;  2OTL A;  1D0Y A;  5CKD A;  1BU1 A;  2EQU A;  1WHJ A;  3C12 A;  4FW1 A;  4IUV A;  5HCK A;  1Q82 C;  4B9W A;  2A36 A;  3QJ6 A;  1CSK A;  2RD1 A;  5CO7 A;  5LJ3 h;  2P84 A;  4RCB A;  3X28 B;  3TSZ A;  2O9V A;  1YCY A;  4NS5 A;  2SRC A;  1VQL Q;  3CPW P;  2DEQ A;  2DYI A;  2QXF A;  2YRC A;  3HPW A;  2VXF A;  2K5I A;  3JCM P;  1PKS A;  2OTL T;  4M77 D;  3CME Q;  3GF5 A;  1KQS A;  2Z0W A;  2AIR B;  2FZG B;  3CCU Q;  2ED0 A;  3FRN A;  3CC7 A;  5GJV B;  2EKH A;  5FRO A;  4M7A G;  4J9I A;  2BUD A;  5GAM d;  2EGC A;  2DAQ A;  2X35 A;  1YJN Q;  4C8Q D;  4HA8 A;  2W0Z A;  4C5I A;  4O6J A;  1H3Z A;  1VQ4 Q;  3LLR A;  2NYS A;  5KCO A;  2F1L A;  2ZPF B;  4C92 C;  1UFF A;  2E41 A;  1QCO A;  4E2F B;  1TS9 A;  3CC7 T;  4OMF B;  1YJ9 Q;  2M0O A;  2AZS A;  2BZ8 A;  3HP9 A;  1TWB A;  2DMO A;  3NTH A;  4HVU A;  2L2P A;  1T0J A;  3H0F A;  1O9S A;  1VIF A;  2LJ1 A;  2NUT B;  2RHI A;  2DD4 A;  2KK4 A;  1D1B A;  2CRE A;  5GJW B;  4CC4 B;  1ZA1 B;  4M75 B;  2J05 A;  1JXM A;  5GMK l;  4M7D C;  3G71 A;  3VV0 A;  3CCQ A;  3DB4 A;  4AG2 C;  1Y71 A;  1O75 A;  1Q82 R;  1CKB A;  1Z9Q A;  4OGE A;  4GLK A;  3V8J A;  3PMT A;  3CCV T;  1M27 C;  4LDX A;  1WXT A;  2ZPE B;  2CP5 A;  2E3H A;  2JM9 A;  3G71 T;  4FIB A;  1TSF A;  1RAC B;  3CXC S;  2CDT A;  7AT1 B;  2YUQ A;  1VQL T;  1WXB A;  2KE9 A;  5D7U A;  4RTZ A;  3SWN C;  4AFS C;  5FU6 C;  3M0Q A;  1VQN A;  3CBM A;  1QW1 A;  4HT9 A;  1X75 C;  1QCF A;  5IHI A;  1JQQ A;  3HRT A;  2FHD A;  2M51 A;  2WSE E;  2I0N A;  1U1T A;  3TSW A;  2P0K A;  4PJL A;  4HCK A;  4BY6 B;  1T0H A;  1WI7 A;  1VOM A;  4FL6 A;  1WQ7 A;  3WXM B;  3JCM d;  2MIO A;  4LN2 A;  2QEX A;  2JMC A;  1VQN T;  5GMK m;  2GTO A;  4DOW A;  4PJO B;  3CBP A;  3V7R A;  2GQV A;  2QAS A;  4M77 C;  3VS2 A;  4AT1 B;  2DIQ A;  4PJM A;  1AWX A;  2CYZ B;  1PM3 A;  2K9G A;  3RDV A;  4FSS A;  1JU5 C;  4C0Z A;  2JUF A;  3X20 B;  3CPF A;  2EFI A;  4M77 E;  4M78 B;  1QKX A;  2E70 A;  4N4H A;  5GAO p;  5GAM h;  2XDP A;  1K0S A;  2RI5 A;  2O4X A;  1M8V A;  2QQR A;  2HQH A;  2V26 A;  2KAF A;  2ABL A;  2E10 A;  3CCS A;  1WLP B;  4PK4 A;  3OYJ A;  2XKO C;  4N0A C;  4LUD A;  2E6Z A;  4LDU A;  3EFS A;  4C8Q E;  4RTT A;  1N9S A;  1UJY A;  2DBK A;  1VQK Q;  2L5Q A;  4WTO B;  2DL7 A;  2RJD A;  1EIF A;  5LJ5 j;  2RJF A;  1RL2 A;  2C06 A;  1GCQ A;  4BI3 A;  2HSP A;  3JCM V;  3VS6 A;  2EKO A;  1NYG A;  3HRS A;  1BYM A;  1YIJ A;  2M1H A;  1BI0 A;  2QQA A;  2FEI A;  3O5Z A;  3CCS T;  2F2V A;  2KQW A;  5DLO A;  3J81 E;  3CD6 Q;  2COW A;  4WCI A;  1B07 A;  2X4X A;  3U23 A;  1GXI E;  1M4Z A;  3GOX A;  2LT1 A;  1SPK A;  2E5Q A;  4YTL A;  1H3H A;  4RKU E;  3QO3 A;  4ELZ C;  1NYF A;  2YUO A;  4PKC C;  4P5N A;  3WVD B;  2KEA A;  3GLX A;  4A4F A;  4PFO A;  4KGV B;  1IRE B;  1WYX A;  1IHW A;  2I2L A;  2BZY A;  4II1 A;  3FEO A;  1YIJ T;  1K73 C;  3E19 A;  3JCM Q;  3GNF B;  5HK0 A;  4JRP A;  2CUD A;  2EYZ A;  2DFU A;  4C8Q G;  3P8D A;  1W1F A;  4IUP A;  4RG2 A;  3EFO B;  1UB4 A;  3OYM A;  3OYA A;  1R8O B;  2ROL A;  3PVQ A;  3RKX A;  4V2S A;  1VQ9 A;  3A8L B;  1I4K 1;  2A3L A;  1K9M U;  2HKQ B;  3URG A;  1S72 Q;  4FYX B;  3QWX X;  2DKG A;  2V1Q A;  2NUZ A;  1M90 R;  1WHH A;  2GGR A;  2ROT A;  1WGS A;  1B7T A;  2DXU A;  4BE0 A;  1QWE A;  2VKN A;  2L3S A;  1ZSZ B;  3JCM h;  1KQS P;  5LJ5 e;  1VQ5 Q;  1MMG A;  2O01 E;  3CCE T;  3M0U A;  2FB7 A;  1NJI C;  2DZC A;  3CEY A;  2RB6 A;  1M3B A;  2O31 A;  4ATO A;  3D7S B;  1I5O B;  2BTT A;  2HZY A;  3PVL A;  4QVD A;  1VIE A;  1MMN A;  5GAN f;  2FZC B;  1PNJ A;  2OI3 A;  4MZT A;  5A0G A;  3CBO A;  2R5A A;  3I56 A;  1AD5 A;  1H92 A;  2RHU A;  2JW4 A;  4GBQ A;  4EMK C;  2HMA A;  4C0D C;  3E2U A;  2VV5 A;  1K4U S;  3ULR B;  2QI2 A;  2V8K A;  3THK A;  4HKE A;  5KYX B;  4X34 A;  1K73 R;  4FYY B;  1OU9 A;  5M9O A;  2PUO B;  2LX9 A;  3QDF A;  3BY7 A;  2DVE A;  1VQ7 Q;  1Y07 A;  1Q7Y R;  1AZG B;  3MEU A;  2AZV A;  1TXQ A;  2HCK A;  1YN8 A;  1V1C A;  2AT1 B;  2F5T X;  3HRU A;  1LVK A;  1UE9 A;  4JJN K;  1PSE A;  3QWY A;  4E7L A;  2VC8 A;  1T3L A;  2O4X B;  1M3C A;  5HKC A;  2CP6 A;  4JZ3 A;  2DM1 A;  4M7A D;  4JLG A;  2DXT A;  1ZLM A;  4JZ4 A;  1VQM A;  3NTI A;  1YIT A;  1K8A C;  3X25 B;  4F7U E;  5GMK j;  1PKT A;  5KYU A;  4ZTF A;  1C6V X;  1IZ6 A;  2KRS A;  1NJI R;  1MMD A;  3X24 B;  3KFV A;  1UJ0 A;  3JCM J;  1YCS B;  5CR2 A;  4BUG A;  1H64 1;  5C0M A;  2EYX A;  1GL5 A;  2E4H A;  2DJQ A;  3EFR A;  1N9R A;  2DL3 A;  1NLO C;  1GCP A;  2COY A;  1WZO A;  1F1B B;  1MV0 B;  3EHR A;  4RTX A;  4Z8A A;  1VQM T;  1M8M A;  2A08 A;  1K9A A;  1U8R A;  2GQI A;  2J7I A;  2JJ9 A;  1FMW A;  2VB6 A;  1D1C A;  4J9C A;  4C92 F;  2EJG A;  3VS5 A;  2D0N A;  3QZ5 B;  3RMQ A;  2LMJ A;  1VQ6 A;  1OV3 A;  5EG2 A;  2L3R A;  1PHT A;  4WF2 A;  3JB9 F;  2YLB A;  2EJF A;  5GAN 7;  4UC4 A;  1RAE B;  1U06 A;  4M7D F;  4XAX B;  5I21 A;  3CCM A;  1V76 A;  5FU7 B;  4DBF A;  4F7U G;  1GFC A;  2JTM A;  1ZA2 B;  3F70 A;  2L8D A;  3VS7 A;  4IIM A;  2HL5 C;  1ZBX A;  4E47 A;  2O9S A;  4TVR A;  2VGN A;  8AT1 B;  2A37 A;  3IQL A;  2KDS A;  2EWN A;  4QW2 A;  2DER A;  5KE2 A;  1A0N B;  2RQT A;  4A4K A;  4J8O A;  2CP7 A;  3JB9 I;  4RG8 A;  2C0O A;  2E5K A;  4OF1 A;  2DZ9 A;  3CCM T;  4LD9 K;  1PCX A;  3AT1 B;  4BDZ A;  2D6F A;  1YBY A;  1SSF A;  2QQ9 A;  3OYL A;  1OEB A;  2MWP A;  4RTY A;  4R0K A;  4NL3 A;  3P8H A;  3ZL7 C;  2QA4 Q;  2GFA A;  1QVP A;  3QKJ A;  2RMO A;  2JOY A;  3S6W A;  1KQ1 A;  1YI2 A;  3S3M A;  4PL6 A;  1VQO Q;  3M4Y A;  2RK2 A;  3VRY A;  5I11 A;  5CIU A;  5EC7 A;  2F69 A;  2Y4X A;  1VQP A;  4XU2 A;  3RIR A;  1MGQ A;  3NFC A;  1XOV A;  3CMA A;  4M7A C;  3G4S Q;  2J6O A;  2QQS A;  3GNG A;  2QAZ A;  2DPP B;  3CC4 T;  4M77 F;  3PTA A;  3TU4 K;  3OYG A;  5FWB A;  1Y57 A;  4C5E A;  1OOT A;  3M56 A;  1I0C A;  3N5B B;  1YI2 T;  3OYN A;  1Y96 A;  4F17 A;  5IT9 E;  4FYV B;  3MEW A;  1TTH B;  4ESR A;  1TU0 B;  2MI6 A;  3OS5 A;  3SWN A;  4JJC A;  4LUE A;  4RTV A;  4A54 A;  2DTI A;  3CMA T;  2EAY A;  2LRQ A;  4IKF A;  5GMK h;  2X9H A;  4NL2 A;  1MHN A;  3RMS A;  3V8K A;  1E6G A;  1GBR A;  2X4W A;  3CCL A;  2CP2 A;  1NPR A;  3H0H A;  3GP8 A;  2X3X D;  3GIB A;  4Y28 E;  1QVG S;  1UEC A;  2EJ9 A;  3DB3 A;  1AHJ B;  1KD1 U;  5GAM j;  5J39 A;  5GAN 5;  1N8R U;  3L2V A;  3KXT A;  5KYU B;  2KYB A;  1DJ7 B;  3HL8 A;  1W4S A;  1K9M C;  1AEY A;  3EGU A;  4M77 A;  1ZUY A;  1Y7X A;  3NHN A;  2XU8 A;  4HVV A;  2PVG B;  1X01 A;  3M59 A;  3CCL T;  5KH6 A;  3CXC P;  1YHQ T;  2R5M A;  4BB7 A;  2EQI A;  1JRI A;  2QQB A;  5LJ5 g;  2CSQ A;  2QA4 T;  3V8L A;  2NLU A;  3QII A;  4C8Q A;  3LWH A;  3TRE A;  2K5F A;  4FM4 B;  1C1A A;  3I55 Q;  1Q81 U;  4N0A A;  2EGE A;  3JAM E;  3OYD A;  1WA7 A;  1HSQ A;  4JRK A;  3QUI A;  3JSC A;  4FSX A;  2ENM A;  3CCV A;  1ZUK A;  2OAU A;  4CC7 A;  3EG9 A;  3H6Z A;  3OYB A;  2KVQ G;  4J9G A;  1TUD A;  2D8J A;  3JB9 H;  3PIO A;  2CP3 A;  2LJ0 A;  1TH7 A;  3HHT B;  1VQL A;  4EMG A;  3RBB B;  1JB0 E;  2X4Y A;  3MP1 A;  2O88 A;  3O8V A;  2R58 A;  1AWW A;  4N4I A;  5LJ3 f;  3TEE A;  1I07 A;  4MZP A;  4IUT A;  2QEX Q;  5ECA A;  2RN8 A;  3CME A;  3CQT A;  5GAN d;  2JM8 A;  1NEB A;  5GAM e;  4QVC A;  2GNC A;  3L2Q A;  2P0P A;  2DXB A;  3CCU A;  5FLX E;  3L2Z A;  2QG9 B;  3M57 A;  1B34 A;  2MAM A;  4MML A;  3G7Z A;  3M54 A;  4C92 B;  1G3W A;  3J80 E;  1G83 A;  5KYN A;  4M75 G;  1Q95 G;  1YJN A;  1D0X A;  1K9M R;  1QP3 A;  1M2V A;  1VQ4 A;  5A0D A;  3CME T;  5FRN A;  2OTJ Q;  4ZNX A;  2L3Q A;  5GAN 6;  2QGG A;  4M7D B;  3LGF A;  3MEA A;  3CCU T;  1QQJ A;  1M1K U;  2HBP A;  2CH4 A;  1WNL A;  1M1F A;  1YJ9 A;  4PJO E;  4X9D A;  1BI3 A;  1BCM A;  4J6W A;  3OMG A;  3M0P A;  4C5H A;  3BFM A;  1YJN T;  4KT0 E;  1D09 B;  3M55 A;  4E7K A;  1WQW A;  2OAW A;  1M1G A;  1VQ4 T;  2KRM A;  3S3N A;  1UGV A;  3CCJ Q;  3I35 A;  4BE2 A;  2CSI A;  4CC3 A;  2C0T A;  4L59 A;  1BI2 A;  3A8M B;  4RCC A;  2VUB A;  2JZ2 A;  3UWN A;  2H3J A;  2LQK A;  4Q5W A;  1YJ9 T;  1Q86 U;  2LP5 A;  1SRL A;  1OYX A;  4J7I A;  3SWN B;  4M7D G;  1T3S A;  4OB2 B;  5FU6 B;  1IRX A;  3ZBD A;  1KHI A;  2PU9 B;  1V29 B;  4R56 A;  3VS1 A;  3PIP A;  1M5Q 1;  2RNA A;  1WHM A;  2QGF B;  2VYT A;  4XU1 A;  2GTJ A;  4C8Q C;  2YHT A;  1M90 C;  3OYE A;  1W2B S;  1TUC A;  4NOY A;  2M0Y A;  1TOV A;  1N6A A;  3OW2 S;  2FL7 A;  2YDL A;  4EMK A;  4OMM A;  1IO6 A;  4PJO G;  4K11 A;  4JLI A;  1WIE A;  5CKF A;  2FYK A;  2LC4 A;  5LL6 S;  2H3E B;  5KE3 A;  2EYW A;  2DO3 A;  1RAH B;  1G2B A;  2PNI A;  1VQ8 Q;  3G6E Q;  1AVZ C;  3JCM e;  1VQ9 Q;  2KI7 A;  1RLP C;  2EVR A;  4JDS A;  1TUG B;  2FZK B;  4M78 G;  1OUL A;  4M77 B;  3CCR Q;  4J9E A;  3I5R A;  5GAO l;  3H0I A;  2FPF A;  1D0Z A;  4RTW A;  1QVG A;  2CT3 A;  3MPU B;  5LJ3 g;  3PFS A;  3HTR A;  2RQW A;  1YP5 A;  1QP2 A;  1K76 A;  2IPO B;  3HKS A;  5GAN h;  4F7U A;  3PNW C;  1WJS A;  2K57 A;  5IXB A;  4OB1 B;  2JN0 A;  3CC2 Q;  2EQJ A;  1WDX A;  4J9H A;  3EGX A;  5I22 A;  1BBZ A;  5LJ5 d;  4HCB A;  5GAN 3;  2KXD A;  1Q7Y C;  3NMZ C;  3QBY A;  4XTV A;  5CAI A;  2QTV A;  3MP8 A;  3VYG A;  1AT1 B;  3L1A A;  1UDL A;  3CCE A;  1XJW B;  1X27 A;  4B6M A;  2DIG A;  2L89 A;  1B3Q A;  4A53 A;  1VQK A;  2KXC A;  2KRN A;  5DY9 A;  3ZFJ A;  1KJW A;  3REA B;  3X26 B;  4JJB A;  1R0C B;  3UA6 A;  2DTH A;  3UDC A;  3EG0 A;  2KNB B;  2E3I A;  1W70 A;  2E6N A;  3EGD A;  3AHU A;  3QHS A;  2JMA A;  3VRZ A;  1OI1 A;  3OS1 A;  2YXY A;  1JO8 A;  2KSS A;  4HVW A;  2B8A A;  5GMK i;  2MOX A;  2MK5 A;  1X43 A;  4AFZ C;  1VQK T;  1M2O A;  4ANJ A;  5KYW A;  4EMH A;  2MWO A;  3OYC A;  1ACM B;  2YRV A;  1X6O A;  1MNE A;  1UG1 A;  4OMQ A;  4OP0 A;  3ER0 A;  2RHY A;  2XHC A;  2CH4 W;  1IHV A;  3FB9 A;  2K2V A;  3WVE B;  5IXF A;  2DTO A;  5CKH A;  4M7A F;  2DJZ A;  2ZPB B;  1WHL A;  3C94 A;  9ATC B;  4RMO A;  8ATC B;  3CD6 T;  2HNI A;  1OX9 A;  1KD1 C;  2FVU A;  1EX4 A;  4Y91 A;  3M58 A;  2DA9 A;  5CK9 A;  1N8R C;  3E9G A;  3A1P A;  2KBT A;  2ZPI B;  4QKU A;  4IUQ A;  2AKL A;  1LOJ A;  4LE9 A;  4PNO A;  4Y92 A;  1HJD A;  1KK7 A;  4JS4 A;  1S72 A;  1NPP A;  4ELY C; 
#chains in the Genus database with same CATH homology
 2MWP A;  2M0O A;  3MCA B;  3HP9 A;  4XTU A;  3NTH A;  2XD0 A;  2RH2 A;  3LH0 A;  2DK3 A;  4NL3 A;  3P8H A;  1FX7 A;  4FU6 A;  4E7I A;  1O9S A;  2GFA A;  1VIF A;  1QVP A;  5CKE A;  1OZ3 A;  3QKJ A;  3FC3 A;  2E1H A;  1WPY A;  2RJE A;  5GAN 4;  2JOY A;  2RHI A;  2DD4 A;  2KK4 A;  3S6W A;  1KQ1 A;  3INZ A;  1YI2 A;  4M75 B;  3S3M A;  5GMK l;  4M7D C;  2XG8 D;  4PL6 A;  3G71 A;  3VV0 A;  3CCJ A;  4HT8 A;  1KC8 U;  2OTJ T;  3M4Y A;  3SFM A;  3DLL A;  3CCQ A;  4C8Q B;  3DB4 A;  2RK2 A;  1Y71 A;  5IAY A;  4JS5 A;  1O75 A;  1Q81 C;  4KBM B;  3M5A A;  5CIU A;  1S72 T;  5CVI A;  4BI4 A;  2EQM A;  1XQH A;  5D6Y A;  2F69 A;  3QXE B;  2MF2 A;  2XI9 A;  2Y4X A;  4ZGD B;  4XU2 A;  4VUB A;  5CQY A;  1VQP A;  4OGE A;  5GAO n;  3RIR A;  1MGQ A;  4EMK B;  2CS7 A;  3NFC A;  1XOV A;  4GLK A;  4A4G A;  2V8J A;  3PMT A;  3FJP A;  3V8J A;  2VXE A;  4C0D B;  2DD5 A;  3CMA A;  3CCV T;  4M7A A;  4M7A C;  2E65 A;  2QQS A;  3OS0 A;  3GNG A;  2X4J A;  4OVA A;  2DPP B;  4LDX A;  3CC4 T;  4LD6 A;  4M77 G;  2ZPE B;  4M77 F;  2CGH A;  4XTY A;  5CKB A;  3OYF A;  1Q82 U;  3MET A;  3PTA A;  3TU4 K;  3OYG A;  4C5E A;  2P4T A;  4V2S A;  4QQG A;  3M56 A;  3OSV A;  4QQD A;  2LCL A;  2Y90 A;  3N5B B;  1YI2 T;  3OYN A;  1W2B A;  1Y96 A;  3G71 T;  5IT9 E;  4FIB A;  3CCJ T;  1G3S A;  3MEW A;  3CXC S;  1VQ5 T;  1D3B A;  4JRQ A;  1OZ2 A;  3OW2 A;  1VQL T;  3UPU A;  1I81 A;  3VYH B;  5GAM g;  2MI6 A;  4FT2 A;  3OS5 A;  3SWN C;  3SWN A;  4FT4 A;  5FU6 C;  3OBW A;  5GAM f;  3E9F A;  1VQN A;  3CBM A;  4A54 A;  4B9X A;  2ZZD A;  1QW1 A;  2DTI A;  3CMA T;  2EAY A;  4HT9 A;  2LRQ A;  1X75 C;  4HCC A;  1VQ8 A;  4IKF A;  3G6E A;  4BD3 A;  5GMK h;  3C95 A;  1MHN A;  4ME7 A;  3HRT A;  4NL2 A;  1I5L A;  3RMS A;  2FHD A;  3V8K A;  2WSE E;  3ZEH A;  1U1T A;  2X4W A;  2P0K A;  1VQ7 A;  4BY6 B;  3CCL A;  1NPR A;  3CCR A;  2F5K A;  1M9S A;  1B34 B;  5GAO m;  2WSF E;  3GP8 A;  3JCM c;  5L8R E;  3CD6 A;  3GIB A;  4Y28 E;  4FL6 A;  1QVG S;  1WQ7 A;  2EJ9 A;  1I8F A;  3DB3 A;  1AHJ B;  2XID A;  3QYH B;  2EIF A;  3SDZ A;  5LJ3 d;  3V7C A;  3WXM B;  3JCM d;  5GAM j;  1KD1 U;  2QEX A;  4OB0 B;  5GMK m;  5J39 A;  5GAN 5;  4ZN3 A;  1N8R U;  3L2V A;  1VQN T;  4DQ2 A;  3KXT A;  3LWI A;  2GCX A;  3RUX A;  2RJC A;  4DOW A;  1DJ7 B;  3L2R A;  3HL8 A;  1W4S A;  4PJO B;  3CBP A;  1VQ8 T;  3G6E T;  3V7R A;  1BI1 A;  2JVV A;  2K3Y A;  1K9M C;  2M16 A;  2GQV A;  3LX7 A;  4M77 C;  1VQ9 T;  2PVD B;  1M1K C;  4M77 A;  3CPW A;  1Y7X A;  2DIQ A;  3MHX A;  2XU8 A;  4MZM A;  5I2M A;  3OQ5 A;  1VQ7 T;  2PVG B;  4ZGE B;  1X01 A;  2CYZ B;  3JRZ A;  1XNI A;  3M59 A;  3CCL T;  3CC2 A;  3CCR T;  4M75 D;  5KH6 A;  1YHQ T;  2R5M A;  3L42 A;  4Z02 A;  3ME9 A;  4BB7 A;  4C0G A;  3OY9 A;  4C0Z A;  2JUF A;  3RKY A;  3QSU A;  1JRI A;  2QQB A;  3CPF A;  2EFI A;  3X20 B;  5LJ5 g;  4M77 E;  1U1S A;  2EYQ A;  4M78 B;  2QA4 T;  2E70 A;  4N4H A;  3BW1 A;  5GAO q;  5LJ5 f;  1HXD A;  3V7S A;  2NLU A;  3V8L A;  2XDP A;  4A4E A;  5GAM h;  3QII A;  5GAO p;  3VKI A;  4DA4 A;  2XDB A;  2RI5 A;  4E7H A;  2ZGW A;  2AHJ B;  4C8Q A;  5GMK e;  2O4X A;  1M8V A;  3LWH A;  2QQR A;  1NZ9 A;  2G3R A;  4OGC A;  3TRE A;  3OYI A;  2KAF A;  2K5F A;  1BIA A;  4FM4 B;  3SD4 A;  2E10 A;  3CXC A;  3QYG B;  3CCS A;  2M9U A;  1Q81 U;  3OYJ A;  2XKO C;  4N0A C;  2CKK A;  2E6Z A;  4N0A A;  4LDU A;  3M53 A;  3EFS A;  3L2W A;  3JAM E;  4C8Q E;  2K3X A;  4JRK A;  4KUI A;  3OYD A;  1N9S A;  3QUI A;  1JJ2 S;  3JSC A;  3OYY A;  4FSX A;  4LDW A;  3CC2 T;  3VU3 C;  3CCV A;  3OB9 A;  2JNG A;  3P8B B;  1BIB A;  2L5Q A;  4C92 D;  3CC4 A;  2OAU A;  3RER A;  2RJD A;  3H6Z A;  3OYB A;  2KVQ G;  1EIF A;  3QG1 A;  5LJ5 j;  2RJF A;  3E1S A;  2CZ0 B;  2KMT A;  5DM7 R;  1RL2 A;  2C06 A;  3JB9 H;  3MO8 A;  4BI3 A;  3PIO A;  1TH7 A;  3JCM V;  3HHT B;  1VQ5 A;  2EKO A;  2K4Y A;  2WAC A;  5J26 A;  3HRS A;  1BYM A;  1VQL A;  3H8Z A;  4EMG A;  1JB0 E;  2X4Y A;  3BDL A;  3MP1 A;  2M1H A;  3I56 T;  1BI0 A;  2QQA A;  3CCS T;  2KQW A;  5DLO A;  3J81 E;  1G5V A;  3O8V A;  5KCH A;  2X4X A;  1GXI E;  2R58 A;  1M4Z A;  2HQE A;  4N4I A;  4M7D D;  3JCM g;  3GOX A;  2LT1 A;  1QVF S;  4KUL A;  2ZPG B;  4IUR A;  5LJ3 f;  3TEE A;  2E5Q A;  3JCM f;  4MZP A;  4IUT A;  2EQK A;  4QQ6 A;  4RKU E;  4YTL A;  3QO3 A;  3CME A;  4ELZ C;  5GAN d;  1KQS S;  3OYK A;  5GAM e;  4QVC A;  3L2Q A;  2P0P A;  2DXB A;  4PKC C;  4P5N A;  3WVD B;  2RA2 A;  5FLX E;  2LVM A;  3A8O B;  3L2Z A;  3GLX A;  2WSC E;  2IVW A;  3Q1J A;  4A4F A;  5LJ5 h;  3HSB A;  2LCC A;  1B34 A;  2MAM A;  2E12 A;  3M57 A;  4L5G A;  1IRE B;  4MML A;  1N27 A;  4MMK A;  3C4S A;  3G7Z A;  3M54 A;  4C92 B;  1G3W A;  2I2L A;  3J80 E;  4II1 A;  3FEO A;  1YIJ T;  4R55 A;  4PLI A;  1K73 C;  3E19 A;  2YLC A;  3A8H B;  4M75 G;  1JBM A;  4M75 F;  4XU0 A;  3JCM Q;  1YJN A;  3GNF B;  1ZQ1 A;  5HK0 A;  4JRP A;  4PJO D;  1KG1 A;  1RI0 A;  4C8Q G;  4C8Q F;  5FU7 C;  3P8D A;  1QP3 A;  4IUP A;  2KY9 A;  4RG2 A;  5LJ3 j;  1VQ4 A;  5A0D A;  1UB4 A;  3OYM A;  3OYA A;  2MMP A;  3CME T;  2XIC A;  4C5G A;  5FRN A;  1R8O B;  3QDR B;  3MEV A;  3RKX A;  3NTK A;  5HY6 A;  5GAN 6;  2BKD N;  3A8L B;  1I4K 1;  2XDD A;  2A3L A;  3JB9 G;  1VQ9 A;  4M7D B;  1K9M U;  3LGF A;  3MEA A;  2GFU A;  3URG A;  3CCU T;  4M78 D;  4J83 A;  1M1K U;  2HBP A;  2DKG A;  4A4H A;  1WNL A;  1M1F A;  1NE8 A;  4F7U B;  1YJ9 A;  4ZTJ A;  1BKB A;  1YHQ A;  4PJO E;  1VUB A;  3BDU A;  5A2Q E;  4X9D A;  1BI3 A;  4ZGJ B;  3OYH A;  4J6W A;  2GF7 A;  2DXC A;  3OMG A;  2QA4 A;  1YIT T;  4KUD K;  5C6S A;  4C5H A;  3BFM A;  3OMC A;  1YJN T;  1WGS A;  1UGQ B;  2D0Q B;  2DXU A;  4J6Y A;  4EPC A;  4BE0 A;  1PSF A;  4KT0 E;  2E64 A;  4M7A B;  3M55 A;  4E7K A;  1WQW A;  1M1G A;  1VQ4 T;  3JCM h;  3S3N A;  1M90 U;  1VQO A;  4BE2 A;  3JB9 J;  5LJ5 e;  3HFN A;  2O01 E;  4L59 A;  3JB9 F;  2LT4 A;  1BI2 A;  2P0Q A;  3A8M B;  4RCC A;  2VUB A;  4JUV A;  3CCE T;  4OB3 B;  4XTZ A;  2FB7 A;  2JZ2 A;  2RI3 A;  1D3B B;  3UWN A;  2H3J A;  1NJI C;  4N4G A;  2DZC A;  4EDU A;  3CEY A;  2RB6 A;  2LQK A;  4CRI A;  4Q5W A;  1YJ9 T;  3DKM A;  3PMI A;  1Q86 U;  2R57 A;  3RES A;  2VGM A;  1OYX A;  4J7I A;  3A5Z B;  3SWN B;  3QPH A;  3VUZ A;  4ATO A;  4M7D G;  4E7J A;  5FU6 B;  4OB2 B;  3JCM b;  3G4S A;  3EAE A;  3ZBD A;  1KHI A;  2PU9 B;  4QVD A;  2HD0 A;  2QDY B;  4M75 C;  1V29 B;  5GAN g;  5FRM A;  4M75 A;  1VIE A;  4R56 A;  3PIP A;  1M5Q 1;  4XU1 A;  2VYT A;  5GAN f;  4C8Q C;  1G3Y A;  2YHT A;  3FIF A;  5J3B A;  3OYE A;  1XTD A;  2RHZ A;  1W2B S;  1M90 C;  5CCA A;  5D6W A;  4NOY A;  1WJR A;  4MZT A;  5A0G A;  3CBO A;  1VQO T;  2R5A A;  3I56 A;  1VQ6 T;  1N6A A;  4BE1 A;  3MP6 A;  1G3T A;  2RHU A;  4M75 E;  3OW2 S;  2FL7 A;  1UGR B;  4EMK C;  3L2U A;  4EMK A;  4C0D C;  1Q86 C;  2HAX A;  2A7Y A;  4PJO G;  4ZN1 A;  2VV5 A;  4PJO F;  4JLI A;  3PGG A;  4IUU A;  5CKF A;  2FYK A;  2LC4 A;  4J6X A;  5LL6 S;  2LQ8 A;  2QI2 A;  4XTX A;  2V8I A;  3UT1 A;  5KE3 A;  2V8K A;  4XTW A;  2DO3 A;  4HKE A;  3SB2 A;  3G4S T;  3RKW A;  4X34 A;  5M9O A;  5LJ3 e;  1YIJ A;  3JCM e;  2PUO B;  4XK8 E;  5GAN j;  1FXX A;  2LX9 A;  1LJO A;  3BY7 A;  3M4G A;  2DVE A;  4C92 A;  4JDS A;  3JB9 D;  1Y07 A;  4M78 G;  4M78 F;  4M77 B;  4LDY A;  3MEU A;  3OA6 A;  3TCJ A;  2BIV A;  4BDY A;  4GY5 A;  5GAO l;  3JCM W;  2K5L A;  4MDX A;  2RO0 A;  1K73 U;  1QVG A;  1K8A U;  3T9N A;  5LJ3 g;  3PFS A;  4C92 E;  3OS2 A;  3OBY A;  2F5T X;  3HRU A;  1Q7Y U;  3HFO A;  2CZ7 B;  4LDV A;  3ASK A;  2LNV A;  4JJN K;  1KHC A;  3S3O A;  1PSE A;  2CZ1 B;  1FWZ A;  1QP2 A;  2RI2 A;  4M7D A;  4E7L A;  2VC8 A;  5GAN 2;  4BY6 C;  2O4X B;  5HKC A;  3FDR A;  3OSS C;  1YJW A;  3HKS A;  3CPW S;  5GAN h;  4F7U A;  3PNW C;  1WJS A;  2K57 A;  3JCM X;  4M7A D;  4OB1 B;  2JN0 A;  3LW5 E;  2DXT A;  4JLG A;  4DOV A;  2ZCF B;  2QTX A;  4M7D E;  2EQJ A;  1VQM A;  3NTI A;  2PVO B;  1YIT A;  2RK1 A;  2LDM A;  1P92 A;  3VJP A;  1K8A C;  3X25 B;  4QVZ A;  3R6O A;  5LJ5 d;  4L6V 5;  4HCB A;  4F7U E;  5GAN 3;  5GMK j;  3KBG A;  4MDW A;  1Q7Y C;  4ZTF A;  1IZ6 A;  5HK3 A;  4PJO C;  3QBY A;  4PJO A;  3X24 B;  2IG0 A;  4XTV A;  5CAI A;  4XQ3 A;  3JCM J;  1KC8 C;  3MP8 A;  3KUF A;  5IN1 A;  1UGP B;  3LGL A;  3VYG A;  3L1A A;  5CR2 A;  3CCQ T;  3I55 A;  3CCE A;  4M7A E;  4BUG A;  4C0F A;  1H64 1;  5C0M A;  1YJW T;  2DIG A;  3QJY A;  3EFR A;  1NJI U;  1N9R A;  2L89 A;  2PQW A;  1LNX A;  4O5V A;  4A53 A;  4PLL A;  3GPL A;  5A0L A;  1VQK A;  4M78 C;  4X9C A;  1VQP T;  2PUK B;  5DY9 A;  4M78 A;  1JJ2 A;  2OTL A;  1VQM T;  5CKD A;  2ZPH B;  3ZFJ A;  2EQU A;  3C12 A;  1U8R A;  4IUV A;  3DLM A;  4D6W A;  4BI8 B;  3X26 B;  1Q82 C;  4C92 G;  4C92 F;  5DLQ E;  2EJG A;  2DTH A;  4B9W A;  3UDC A;  3QJ6 A;  2RD1 A;  5CO7 A;  5LJ3 h;  1KQ2 A;  4RCB A;  4M78 E;  3QZ5 B;  3RMQ A;  3X28 B;  4BAC A;  2JTF A;  1VQ6 A;  5EG2 A;  2L3R A;  1YCY A;  4J7F A;  1UEB A;  4NS5 A;  2E6N A;  4WF2 A;  5D6X A;  1Y96 B;  3QHS A;  5GAN e;  2YLB A;  3FLG A;  3I55 T;  2EJF A;  3AHU A;  5GAN 7;  5AYF A;  1OI1 A;  4J5Y A;  2DEQ A;  3OS1 A;  2Y4Y A;  3A8G B;  4UC4 A;  2KSS A;  2QXF A;  2RM4 A;  2B8A A;  5GMK i;  3HPW A;  2VXF A;  1QVF A;  2CZ6 B;  2K5I A;  1HK9 A;  3JCM P;  1VQK T;  4XAX B;  4M7D F;  5I21 A;  4XU3 A;  2OTL T;  3CCM A;  4M77 D;  3QZ9 B;  5FU7 B;  3GF5 A;  1WJQ A;  3VUB A;  4EMH A;  1KQS A;  2MWO A;  2JTM A;  4F7U F;  4F7U G;  3F70 A;  3OYC A;  2L8D A;  2RHX A;  2HQX A;  5I2S A;  2YRV A;  1X6O A;  1ZBX A;  4OP0 A;  3FRN A;  3CC7 A;  3ER0 A;  1ZHI A;  2RHY A;  2XHC A;  4E47 A;  2D9T A;  4TVR A;  2VGN A;  5GAO r;  2LTO A;  3FB9 A;  3M9Q A;  3CCU A;  2K2V A;  5FRO A;  4HCZ A;  3WVE B;  4M7A G;  2DTO A;  5CKH A;  4M7A F;  2DJZ A;  2ZPB B;  2BUD A;  5GAM d;  3J7A F;  3C94 A;  2KDS A;  2EWN A;  4RMO A;  2DAQ A;  2X35 A;  3CD6 T;  4C8Q D;  4HA8 A;  4QW2 A;  2HNI A;  1KD1 C;  5KE2 A;  2FVU A;  1UGS B;  3PT9 A;  4Y91 A;  4JRI A;  3M58 A;  4C5I A;  4O6J A;  4CI0 C;  4A4K A;  4J8O A;  5CQX A;  5CK9 A;  3E9G A;  1N8R C;  1H3Z A;  3JB9 I;  3LLR A;  4RG8 A;  3LYI A;  2QEX T;  4OF1 A;  4LD9 K;  3CCM T;  2DZ9 A;  2OTJ A;  2ZPI B;  4IUQ A;  5KCO A;  1LOJ A;  4PNO A;  2ZPF B;  4BDZ A;  4C92 C;  2D6F A;  2E41 A;  4JS4 A;  1S72 A;  3CC7 T;  1YBY A;  1SSF A;  2XK0 A;  5GAN 8;  1NPP A;  2QQ9 A;  4OMF B;  3OYL A;  4ELY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...