5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Lhca1
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
2ZPHB 4XK8E 2ZPBB 3WVEB 3X20B 2ZCFB 2DXBA 3A8HB 3X24B 2ZPFB 3A8LB 4Y28E 1PSEA 1UGQB 2PUOB 3QZ5B 2CYZB 1GXIE 2DD5A 2PVOB 1QP3A 2DD4A 2QDYB 2CZ0B 2WSCE 3VYHB 1QP2A 1UGPB 2CZ1B 3QZ9B 2AHJB 3X28B 2PUKB 4L6V5 3A8OB 4OB3B 4ZGDB 2O01E 2ZPIB 4OB0B 3A8MB 4ZGJB 3X26B 2WSFE 2ZPEB 2CZ6B 1V29B 3QXEB 2DXCA 2ZPGB 2DPPB 2CZ7B 3HHTB 3QYHB 3LW5E 4KT0E 4OB2B 3WVDB 1AHJB 1PSFA 3A8GB 5L8RE 2ZZDA 3X25B 1IREB 2PVGB 4FM4B 2WSEE 2PU9B 1UGSB 4OB1B 4RKUE 3VYGA 1JB0E 2D0QB 2PVDB 4ZGEB 3QYGB 1UGRB 1DJ7B
chains in the Genus database with same CATH superfamily
1QKWA 1K8AR 2OAWA 2E6ZA 1Y07A 1KD1U 1O9SA 1PG5B 4M7DG 2YRDA 3JB9D 1ZUKA 3JCMV 2RM4A 3JCMe 2DYIA 2RPNA 3VS6A 4F7UE 1N9SA 3NTKA 3OYHA 1VQNT 1JQQA 3UA6A 1TOVA 4QQDA 2O9VA 4KRTA 1G2BA 3H6ZA 3PVQA 2VWFA 2F1LA 3THKA 1UDLA 1Q81R 5IHIA 2CYZB 5LJ3g 2PVOB 4ZN3A 2OTLA 1VYUA 1XTDA 2WACA 2FEIA 3L2QA 3G71T 2JJ9A 4QT7A 3PMIA 2CKKA 2DKGA 2ZPEB 3NGPA 3EH1A 1Q86C 4X34A 1KQSS 2XHCA 1Q82U 3JB9F 2DZCA 4OB1B 3JCMQ 5GAOq 3L2UA 1TUCA 4NL3A 1YJNA 1NLPC 2GTJA 2LQKA 2NUPB 1VQPT 2K3XA 5GMKh 3EHRA 1LVKA 5IHNA 3DKMA 2YUQA 1WZOA 2XG8D 1S1NA 2JN0A 2QAZA 2EGAA 4C5IA 3PIOA 1NG2A 1TSFA 1VQ9A 5KE2A 4LXCA 3MEVA 3A8HB 3EG9B 4HKEA 3QWXX 3VS1A 1VYTA 3LWHA 1VQNQ 3JV3A 4M78D 3C4SA 1YN8A 3RMQA 2DBKA 3QSUA 3SHWA 2CT3A 2EW3A 2RHUA 1RACB 2A28A 3HFOA 5EC7A 4KGZB 1ACMB 2HKNA 3QDRB 2ZPFB 4KGXB 2H3EB 4DEYA 3ULRB 3LX7A 1WA7A 1SEMA 2SRCA 3CCSQ 2MWPA 4AT1B 2XI9A 2X51A 1VQNA 2RK1A 1GCQC 2DPPB 2E5QA 3META 1YI2T 1AEYA 3BY7A 3EGXA 3MPUB 4C8QA 2QA4T 3M54A 4AMCA 1YIJA 4PNOA 3CEYA 3QZ5B 1ZHIA 3OYIA 2COZA 1WI7A 5GANh 5L23A 4IUUA 5HK3A 1PKTA 1OYXA 3SFMA 5J26A 2X4JA 4OMPA 3CMET 2EQUA 4CI0C 4OP0A 3NTHA 3JB9J 5KE3A 2P84A 2ZZDA 4AFSC 1M90R 3HSBA 3I55Q 3M4YA 4L5GA 1WQ7A 5KYWB 4HCBA 5KYUA 1I1JA 3I5RA 1RAAB 4M75A 1WXTA 1I0CA 1RL2A 1VQ8T 2KEAA 3OA6A 1I5OB 3M57A 1QCNA 3MEWA 1WGSA 1NBEB 3OBYA 1X6OA 4QKUA 4FM4B 1TS9A 3G6ET 1UUEA 2FVUA 3QKJA 2NYSA 3M0PA 1R0BG 3CCQQ 3OYGA 3A1PA 2DD4A 3NFCA 1D09B 1HXDA 2YXYA 3RNJA 1VQ7Q 2E12A 3CPWA 2KVQG 3H9NA 1NPPA 4F7UA 2JT4A 4PK4A 1K73C 1VQMT 2D8JA 4XQ3A 2IIMA 1FYNA 3V8LA 1XNIA 1CKAA 1AVZC 2DL5A 1TUGB 2JTMA 3A8LB 3OB9A 1YITT 3MEUA 3FJ5A 1N9RA 4BI4A 3GP8A 2LT1A 2PZ1A 3QJYA 3S3MA 3EGUA 2L3PA 2DE0X 4J6WA 1X75C 3GIBA 2RI2A 1WHMA 1SF9A 3BDLA 2CZ6B 1IO6A 2DXCA 4KBMB 5FU6C 2NUZA 2WSEE 3RBBB 4ZNXA 4M7DD 2KBTA 2RO0A 3EH2A 7AT1B 4ORZA 4B6MA 2GQIA 2CP5A 4M7DC 1VQ8A 2MYSA 5GAOr 2GBQA 4J7FA 2LNVA 4C8QB 4M75E 5DLOA 4D6WA 4FSXA 5IT9E 1VQ6Q 1JXMA 1VQ4T 2K79A 3J7AF 2HL5C 4J9GA 4M75F 1MMDA 3J81E 2VKNA 1LNXA 3NMZC 2X3WD 1WHGA 3QIIA 3OYKA 2DD5A 4RTXA 2V1QA 2O88A 3TEEA 5IXBA 2CREA 1QQJA 1T3LA 2DERA 4II1A 1NEGA 5ECAA 4CC4B 2MI6A 4ANJA 1G3SA 5KYXB 5KYYB 4PJLA 1WHLA 2C06A 2O4XB 3L2ZA 4E7HA 1M2VB 4OMQA 2KRSA 2YRVA 1OX9A 4KULA 2X3XD 3MCAB 1Q7YC 2KYMA 4LDXA 2EGEA 2R5MA 5EG2A 2KY9A 2M0YA 5LJ5d 2J6FA 2GGRA 2JMAA 3HKSA 1U06A 1BCMA 2ROLA 4DBFA 3BFMA 4X9CA 4MMKA 1B34B 1U5SA 2M1HA 2HZYA 3V7SA 3CCJQ 1U8RA 2RI5A 2VXEA 1I07A 3OYYA 1JBMA 2CP0A 2A7YA 3H41A 3HRTA 2QQAA 1K8AC 4Z8AA 1WNLA 2VGNA 5CQXA 4E2FB 3E9GA 5CR2A 2P4TA 4J9DA 3SEMA 2AIRB 2JS2A 2QEXQ 1JEGA 2GTOA 4O6JA 4FW2A 1KC8C 1VQPA 2ZAEA 1V29B 4M7AF 1VQOA 2O2OA 4RMOA 3G7ZA 1AWJA 1YJNT 1U1SA 2LVMA 4JRKA 1TXQA 1VUBA 1SKUB 1QVGS 4N4HA 1WX6A 1S72T 1Y71A 4C92B 1ZSZB 1H641 4F7UG 1VOMA 3L2RA 2JMCA 3CC2T 4FT2A 4HXJA 4ESRA 2C0IA 2OTLT 1N8RC 4IUQA 4AG1C 5GMKj 1M27C 3CCRT 4EIKA 2DTHA 2MWOA 4M7AD 2VUBA 4DOVA 3TVTA 3H0IA 3UDCA 2DMOA 5KCHA 3CCMA 1QVGA 3EGDA 4M78B 1IRXA 4M78C 5KCOA 2P0KA 3M56A 4A4GA 4BDYA 5GJWB 4BY6B 3M55A 4FW1A 2LZ6B 2QTVA 1LOJA 3PMTA 3RDVA 4LDWA 1OPKA 4JLIA 3CCQT 3EG1A 4OB2B 4CC2A 4JS5A 2DYBA 1DJ7B 1YBYA 1K0SA 3M0RA 5GMKl 3CCMQ 3VV0A 3E1SA 2RHIA 4DEXA 1RI9A 2DM1A 1VQMQ 2DTIA 1UJYA 2LNHB 2YUOA 5FLXE 3ER0A 1ZX6A 5IHKA 1VQOT 1R8OB 4OGEA 4VUBA 1NEBA 8ATCB 3HRSA 2J06A 1K0XA 5GAOp 2XD0A 4IUTA 2GCXA 2Y4XA 1M8VA 4C8QE 2LJ0A 2AKKA 5CK9A 2LTOA 3JB9I 1YCYA 1W2BP 2QK0A 1X6GA 1G3WA 4M7AA 1P92A 1QMCA 4OB0B 4IUPA 3QWYA 3UATA 2J05A 4BACA 4Z88A 4RKUE 2ED0A 5GANf 3MEAA 3JCMX 3CCLA 5FU7B 2DAQA 4PJOA 1VIEA 4J7IA 5KH6A 1JJ2S 1PSEA 2MIOA 5LJ3f 2V1RA 1QVGP 2CZ0B 2OTJT 4M7DA 2RMOA 4K11A 3JCMh 4LDVA 4JZ3A 1M3AA 1M90C 3JCMf 4C0GA 1V1CA 2QG9B 3KBGA 1MV0B 4M7AC 3CCLQ 4RTVA 1TTHB 1M2VA 1UGQB 3FJPA 2RJFA 1QP3A 2BUDA 3LGFA 1GCQA 1M3BA 4M7DE 1G3YA 4PJJA 2LT4A 2RB6A 4KUIA 2KGTA 3TQ7P 2HQEA 3JCMc 3TSZA 4KUDK 3F70A 3A8GB 4JLGA 3CCVT 3O5ZA 2VV5A 4M7DF 4D8KA 1RI0A 4M4ZA 2VXFA 1VQLQ 2LCSA 4E7ZA 1X2QA 2EYZA 3RKXA 2XICA 2F5KA 3OYDA 4NS5A 4M77G 4JJNK 3CMAQ 2EYXA 1OU8A 1HJDA 2E1HA 3GBQA 4LE9A 2YUPA 3G4SA 2LX9A 1HD3A 1K73R 4RG8A 3X25B 1X69A 5GAN8 3QYGB 3C94A 2LCCA 2Y4YA 3X24B 3OMGA 1WXUA 3LH0A 4BY6C 4M78A 1GCPA 4QW2A 1Z9QA 3JCMJ 4B9XA 2JXBA 4DA4A 1JJ2P 3UWNA 2HDAA 1ABOA 3G4SQ 2M02A 1IZ6A 5KYYA 3J80E 3PT9A 3ZBDA 2RA2A 2ABLA 1YITA 4OGCA 2I2LA 1BK2A 4R0KA 1I5LA 4C5EA 1QVPA 1ZBXA 3MJXA 4A63B 3V7CA 4AFUC 2LQWA 5KYNA 3GLXA 4RCBA 4ELYC 1ZQ1A 2QTXA 3M58A 4C92C 4LDUA 4N4GA 1E6GA 1D0YA 1OPLA 5I22A 2JM8A 2F2XA 4PKCC 5CKHA 3OS2A 3JAME 4HVUA 3CC7T 4M77F 4C92D 2MCNA 4J9IA 2K3YA 1C1AA 3RUXA 3OYFA 1I8FA 3P8BB 5J39A 4JRQA 4PFZA 3G6EA 5GAOn 4C8QG 1F1BB 1SRMA 1LPLA 3CCUA 1VQLT 2B86A 1W2BS 2LJ3A 4LD9K 2W10A 1GFDA 2MMPA 4M7DB 4HVWA 1K9MC 1WJRA 4BE1A 2FRYA 4M75C 1KQSP 1OZ2A 2EGCA 4PJMA 3UPUA 2KI7A 3VJPA 4OMMA 4PJOG 1KC8R 3MP8A 2ECZA 3TREA 3CMEA 3CD6Q 1IB8A 2XU8A 4J9BA 2FPDA 1MMNA 3OBWA 4JPBW 1YHQQ 2XMFA 5AYFA 4MZPA 1H92A 4N0AA 3FB9A 2K5IA 2KE9A 2RHYA 1UG1A 2DXBA 1YIJT 2QQRA 2VASA 2CP7A 2QA4A 1PC0A 3URGA 2E3HA 4KGVB 1G83A 1QLYA 3L2VA 4J83A 1YI2A 5GAN6 2P0PA 3OYJA 1NJIU 2L3QA 5GAOm 3RKWA 5C0MA 1KQ1A 1C0MA 2IPOB 2YUNA 2E65A 3HTRA 2JNGA 4FYVB 2A08A 4GY5A 2DFUA 1E6HA 4IUVA 1JU5C 2DA9A 2WSCE 4LUEA 1KSWA 1WLPB 1SSHA 3ZEHA 2QDLA 4JJDA 5D6XA 2EQIA 2RJEA 1H8KA 2QEXA 1VQKQ 1BI0A 2A0FB 2QGGA 3WVEB 3CPWP 1VQ5Q 2E64A 4M77B 2R58A 4X1VA 4M75G 2AT1B 2F69A 3V8JA 1JRIA 1T3SA 2AK5A 5GAN5 5GANd 1N8RR 1VYVA 2EQJA 1RLPC 2DXTA 2E3IA 2K2MA 2EAYA 3FC3A 4PJNA 1KK7A 3LW5E 1K4US 1OV3A 5CQYA 1Q82C 3JCMd 1M8MA 3CCRQ 2JTEA 2VVKA 1EX4A 1AZEA 5DY9A 1WYXA 4BE2A 1HYOA 2XDPA 4M75D 1YJWA 4BD3A 4OF1A 2YLCA 4C92A 1SSFA 1BI3A 4DBQA 1JB0E 2YT6A 2LX7A 1M30A 4JZ4A 1NYFA 2LJ1A 4DOWA 4ZTJA 3KXTA 2PUOB 4OMLA 1K9AA 1I4K1 5DLQE 4D8DA 2EIFA 3O8VA 3PNWC 5I21A 3M0TA 1C6VX 2YWWA 3CPWS 2DK3A 4RTTA 1S72Q 1KC8U 1T0HA 3CCUQ 3H0HA 3EG9A 1EFNA 1MMAA 5CIUA 5L8RE 2AZSA 3CCST 2C0OA 4FIBA 4PLIA 2Y90A 2J6KA 4J9CA 2X35A 2D8HA 2KDSA 1Z9ZA 3M53A 2CH4A 3I56T 2HEQA 5A0GA 2RQVA 3CCVQ 1M9SA 4RUGA 4OB3B 1M1FA 1VQKT 1NPRA 4EMKC 4LNPA 3SB2A 1B34A 3OYBA 4PL6A 2AKLA 3EFSA 3VRZA 2QGFB 2RQWA 5LJ5g 2NUPA 1YHQA 3VYGA 3AT1B 3CBOA 3UA7A 3JCMW 1RAHB 4RTYA 5GAMg 1WPYA 2LQNA 4XU2A 2K5LA 1K1ZA 2K9GA 1T0JA 2YHTA 2O9SA 5D6YA 1Q7YU 3VS7A 2DETA 3V8KA 2QQ9A 2MF2A 1TH7A 1K76A 5GANg 3R6NA 5I2SA 2CT4A 1D0ZA 2EQKA 3CC7A 3G1JA 1M5Q1 3TU4K 1Q81U 2XDDA 1VQOQ 3CMEQ 3CD6A 4RTUA 1M1KC 3CXCS 2ATCB 4QVZA 2F5TX 2MK5A 3EG0A 2FZGB 2VB6A 1Y0MA 4GBQA 4XAXB 4JRPA 3P8DA 4KH0B 2KT8A 1MNEA 3ME9A 1OULA 4ATOA 2QI2A 2BZYA 4O5VA 2DL7A 5GANe 1D1AA 1FMVA 5GJVB 2L5QA 3IQLA 3M0QA 4E7KA 1KG1A 1GBRA 3FRNA 3CXCA 2FO0A 1W1FA 3NHNA 5GAN2 4HCZA 2O4XA 3RESA 2DL3A 4C5GA 4M7AE 2DILA 2JTFA 3H0FA 4E7JA 1PSFA 4QVCA 2CSQA 2CS7A 5KYXA 2DEQA 1ZUUA 3OS1A 1ABQA 3FIFA 1VQ6T 4QVDA 2KXDA 1LJOA 2DL4A 2DF6A 2I0NA 4JDSA 1HK9A 1U1TA 4J6YA 2X9HA 4RG2A 2MPXC 3RR6A 1M3CA 2DRKA 2O01E 4ELZC 3PE0A 2HKQB 2HCKA 2CZ7B 1CKBA 5LJ5h 1VQ7A 4F14A 1BBZA 2JUFA 2D0QB 4C5HA 2ZPHB 2ROTA 1K9MR 4RTZA 3CCVA 5FWBA 3C95A 4EMHA 1W2BA 4F7UF 2VYTA 1MV3A 1N6AA 1JJ2A 2XIDA 4L6V5 1YFNA 5GAMd 3X26B 1KQSA 3SD4A 4BI3A 2EYWA 3JCMb 2OJ2A 5LJ3j 1R77A 3BW1A 1UGVA 3VRYA 4E7LA 3TCJA 1X27A 1AWOA 2RD1A 2H8HA 2RHZA 1PD0A 1E7OA 2OI3A 1QCFA 5KYWA 2GQVA 3QJ6A 2SEMA 3QPHA 2PQWA 4HVVA 2OTJA 1VA7A 5J3BA 5KYUB 5LJ3e 2IG0A 1HSQA 1YWOA 1J3TA 4IIMA 1NZ9A 3QYHB 2E4HA 3I55A 3E9FA 3CC2Q 2RJDA 3CXCP 1W70A 4A54A 3L2WA 1WXBA 2J7IA 2L3SA 1KQ2A 4F7UB 2FHDA 3S6WA 1X01A 2JZ2A 3EGDB 2KROA 1QWEA 1Q95G 2CZ1B 2NLUA 1PHTA 4ZGJB 3PTAA 3MO8A 4HA8A 2K7AA 2HAXA 2YSQA 1MNDA 3HPWA 4Z02A 3FLGA 4GLMA 2VGMA 3DLMA 5IH2A 2EJ9A 2IVWA 1KD1C 4XTXA 1QVFP 3INZA 3RMSA 3PIPA 1GXIE 3OW2P 3JRZA 5A0DA 3OYEA 2PUKB 5GMKe 2EKOA 3E19A 3TSWA 4CC7A 3M59A 1BI1A 3WVDB 2DXUA 1X43A 4OMNA 3ASKA 2FB7A 2GNCA 4Y28E 2K6DA 4QQGA 3I56A 3CCQA 1X2KA 2KRMA 3P8HA 2Z0WA 3OSVA 1BIBA 1TWBA 4N0AC 1VQ9Q 4FSSA 2HL3A 2JOYA 4IKFA 3CCEA 1IXDA 2A37A 5GMKi 1YJ9A 3CCET 9ATCB 2DTOA 3G71Q 2G3RA 2LMJA 1XQHA 2X4YA 2EWNA 2LRQA 2OAUA 3JB9H 2F2WA 4J5YA 3GNGA 1U3OA 5CAIA 3QUIA 3HRUA 1W4SA 2CP6A 5GAN4 5CVIA 1VQ5A 3QXEB 5FW9A 1VQPQ 1N27A 2L8DA 3MHXA 3GOXA 2YRCA 1ZSGA 4LUDA 5I11A 4JS4A 2NWMA 2RQUA 3BE3A 1PWTA 3LWIA 1VIFA 2A36A 4MZTA 2HQXA 1VQ4Q 2BE7D 2QDYB 1UEBA 4LDYA 4RTWA 3QZ9B 2RK2A 2L2PA 1QVFA 1D1BA 2DVJA 2R5AA 1WHJA 3M0UA 4EMKA 4BI8B 1Q86R 2W0ZA 4P5NA 1ZA2B 1UGSB 4NL2A 3X20B 5FRNA 2LQ8A 4A4HA 5A2QE 1NJIC 1YP5A 4UC4A 2RI3A 4M78G 4MMLA 1CSKA 4Y91A 1QWFA 2DEUA 1NM7A 3VS2A 4ZTFA 2EPDA 4M78E 4QQ6A 3EG2A 1RAEB 4BUGA 1NYGA 3CC4A 8AT1B 3V7RA 1OEBA 1RAGB 3HL8A 2HD0A 1G8XA 3VU3C 2KRNA 3SDZA 3OY9A 2X4XA 4DQ2A 4KT0E 5LJ5e 3LYIA 3L42A 1GBQA 3CCJT 1Q82R 4TVRA 2K4YA 1KFZA 5HK0A 2BZXA 2DX1A 1UE9A 3VS3A 3GNFB 3CPFA 1M2OA 1WJQA 5D7UA 1WHHA 1YWPA 2DZ9A 4X9DA 1IGQA 1M90U 2JS0A 3REAB 5LJ3d 1VQ7T 2DRMA 5FROA 2JM9A 5GAMj 4PJOE 1M1KR 1BIAA 1AD5A 1UB4A 3VS0A 5FRMA 4XTUA 3EAEA 1G5VA 1D0XA 4A53A 4IIOA 4C8QF 3CC7Q 4WF2A 1NLOC 3L1AA 2CP3A 1Y96B 2RHXA 1VQLA 1YJ9Q 3CBMA 2ZPBB 4M75B 1UHFA 3Q1JA 1WDXA 2LC4A 4R55A 2QQBA 3CMAA 4F17A 1TUDA 2AHJB 2HQHA 1PRLC 5M9OA 1EZZB 2RN8A 4XU1A 3S3NA 3C12A 2CH4W 1FWZA 1KHIA 2BZ8A 2CGHA 4J6XA 3FDRA 3RIRA 1PRMC 2GF7A 3LLRA 3QO3A 5LL6S 4F04B 4C92G 2FPFA 4JRIA 3NPFA 4RCCA 2H3JA 3SWNA 3MP1A 3HFNA 4J9FA 4MZMA 1B7TA 4PFPA 2BKDN 1FX7A 2EJGA 2FZKB 4IURA 2HBPA 2HMAA 3MKDA 4A4FA 5HKCA 3CMAT 1O75A 1X6BA 2RNAA 2CUDA 1I81A 5C6SA 1G3TA 1IGUA 1Y7XA 1AOJA 1B3QA 1QP2A 4WCIA 3OW2A 2KMTA 1OZ3A 3GF5A 2EVRA 4M77D 1SHGA 2ED1A 4A4EA 4M78F 4NOYA 2PTKA 1FXXA 5DM7R 4EMGA 3PVLA 2XKOC 4MDWA 3SWNC 1GFCA 2E6NA 1BI2A 4JJBA 3ZFJA 1SG5A 3DLLA 2D0NA 1WJSA 3AHUA 2FPEA 2DJZA 1K73U 4DBRA 3VS4A 2KQWA 2DIGA 2K3BA 2F2VA 4EPCA 3CCSA 2BE9B 2L89A 2KXCA 5CKDA 1JO8A 3EFOA 5CKBA 2OTJQ 1UHCA 3VKIA 1N8RU 3CCJA 4FYWB 3LH5A 2PNIA 5CKFA 2CUBA 2JVVA 4C0DB 2AZVA 2ESWA 1OOTA 1K8AU 3JCMP 2BIVA 2EFIA 1M4ZA 4OMFB 3OYAA 1YJWT 2QXFA 1XOVA 4V2SA 2HSEB 2M16A 4PJOC 4HCCA 2QASA 3ZL7C 4FYYB 2D6FA 3VYHB 4M77A 3CCLT 3CC4T 4N4IA 4AFZC 1BKBA 4C8QD 3UT1A 1R0CB 4B9WA 4FT4A 2BTTA 2OTLQ 2PU9B 2ENMA 2KAFA 2M51A 1ZSZC 2KYBA 6AT1B 4C0DC 4BDZA 1RADB 1VQ9T 1JXOA 2EQMA 5GAOl 1RUWA 2HSPA 2FZCB 1YJNQ 3BDUA 3OYCA 5GAMf 3X28B 1PNJA 2GFAA 5A0LA 5GAMh 4PJOB 2EYQA 2NUTA 1AHJB 2QQSA 3H8ZA 4JUVA 4DBHA 2QEXT 1KJWA 2KT1A 2J6OA 5IXFA 4F16A 2G6FX 1N5ZA 3D7SB 4M77C 2R57A 1FMKA 2L3RA 2FG0A 3CCEQ 2CSIA 4CRIA 3HP9A 1UJ0A 4C92E 1QCOA 3G71A 2CP2A 2K5FA 1VQ5T 1OI1A 2V26A 2PVGB 3EGXB 3OW2S 4PFOA 2DNUA 4ME7A 4XK8E 1PD1A 1TG0A 1YNZA 1KD1R 1YCSB 2NUTB 1Q81C 4LD6A 2LCLA 1V76A 3I35A 1B07A 2E41A 1YJ9T 1RABB 1BB9A 4J8OA 4EDUA 5D6WA 3LGLA 2C0TA 1QVFS 3CCMT 4XU3A 3M0SA 1ARKA 2E5KA 4OMOA 3T9NA 1SPKA 2A3LA 1QKXA 1VQ8Q 5AT1B 3OYMA 2K2VA 3MP6A 3M4GA 4A4KA 2FL7A 1UTIA 3CCRA 3VS5A 3CC4Q 3C0CA 4HCKA 4E7SA 3GPLA 3VUZA 4KH1B 3CC2A 2DBMA 3CBPA 3G6EQ 1MUZA 1WHKA 3OS5A 1IHVA 1KIKA 2RJCA 2V8KA 1UECA 1FMWA 1S72A 1Q86U 2P0QA 4WTOB 4HT8A 2COYA 4PJOD 1RLQC 1IREB 4GLKA 2HNIA 4JJCA 1MGQA 1D3BA 2PVDB 3QHSA 1UGRB 3KUFA 4XTZA 1RAFB 4C8QC 1K9MU 2LP5A 3CCUT 2EBPA 2EJFA 1YI2Q 2DVEA 4C92F 1AZGB 1W6XA 3UF4A 3EHQA 3OYLA 2ZPIB 1BCOA 1IHWA 3JCMg 2V8JA 2DO3A 5LJ5j 1YIJQ 3S3OA 4PJOF 1ZSZA 3N5BB 1BU1A 2M0OA 5FU6B 5I2MA 4ZGEB 2DLPA 2FRWA 4ZN1A 3OS0A 2JW4A 4XTYA 3QBYA 4FL6A 2YLBA 3M9QA 2D1XA 4MDXA 4AG2C 5GANj 1BYMA 5FU7C 2KNBB 1H3ZA 3I55T 2RQRA 1SHFA 3A8MB 2E10A 2KR3A 4E47A 2LDMA 4HT9A 2ZPGB 3HHTB 5LJ3h 1ZA1B 1H3HA 1A0NB 1ZLMA 3I56Q 1GL5A 4E7IA 2X4WA 3OQ5A 2QYZA 1NJIR 5CKEA 4YTLA 5GAN3 5GAMe 3DB3A 5HCKA 1M1KU 2QA4Q 1AWXA 3KFVA 3A8OB 3U23A 2COWA 3EFOB 5LJ5f 4XTWA 2DIQA 2L0AA 2B8AA 4AFQC 3G4ST 1EIFA 3QDFA 3SWNB 2DL8A 1UGPB 1PM3A 2OX7A 1PCXA 3A98A 1Q7YR 2DJQA 2MOXA 1ZUYA 1VQ4A 3NTIA 3OSSC 5GMKm 2XDBA 5CCAA 3JB9G 4FCYA 4FYXB 2ZGWA 2ZCFB 3I5SA 1VQ6A 5FWCA 2K57A 2KSSA 1NE8A 2RF0A 3FEOA 5HY6A 2V8IA 4M7AG 3JSCA 3OYNA 3I9QA 1Y96A 4CC3A 4J9HA 1LCKA 4C0ZA 3CQTA 1MHNA 1SRLA 1OX8A 4J9EA 3QG1A 4FU6A 4M7AB 2E70A 2P4RA 2VC8A 1M1GA 2M9UA 4C0FA 1WIEA 1YITQ 1PKSA 1VQMA 1YJWQ 1AWWA 1OU9A 2FYKA 3REBB 4BB7A 5CO7A 2RH2A 1OQKA 3EG3A 2XK0A 3RKYA 3CD6T 4Q5WA 4PLLA 1WFWA 5IAYA 4Z89A 3M5AA 1RAIB 2CDTA 1ZBJA 1D1CA 4XTVA 1MMGA 3VUBA 2KK4A 3DB4A 2MAMA 5IN1A 4EMKB 1UFFA 3EFRA 3OMCA 2EKHA 2YDLA 2O31A 4BE0A 1D3BB 4Y92A 3A5ZB 1AT1B 2RQTA 3E2UA 3PGGA 1Y57A 1KHCA 2EYYA 5GAN7 3PFSA 1TU0B 2GFUA 4LN2A 4L59A 1GRIA 2D9TA 4OVAA 1QW1A 1YHQT 4R56A 4ZGDB 4E6RA 4M77E 2WSFE 3RERA 1XJWB 3WXMB 1VQKA 2HBWA 3R6OA 1WQWA 4XU0A
chains in the Genus database with same CATH topology
2EQKA 2E6ZA 5GMKl 3CC7A 3VV0A 1M5Q1 1O75A 3E1SA 3TU4K 1Y07A 2RHIA 1Q81U 1KD1U 1O9SA 1I81A 5C6SA 2XDDA 3CD6A 4M7DG 1G3TA 1M1KC 2DTIA 1Y7XA 3CXCS 5FLXE 4QVZA 2F5TX 3JB9D 1QP2A 3ER0A 3JCMV 3OW2A 2RM4A 4XAXB 3JCMe 1R8OB 4JRPA 3P8DA 1VQOT 4OGEA 2KMTA 4VUBA 1OZ3A 3GF5A 3ME9A 4M77D 3HRSA 4F7UE 1N9SA 3NTKA 4ATOA 5GAOp 2XD0A 3OYHA 4IUTA 1VQNT 4A4EA 4QQDA 2GCXA 4M78F 2Y4XA 2QI2A 4NOYA 1M8VA 4C8QE 3H6ZA 1FXXA 5DM7R 4O5VA 4EMGA 5GANe 2XKOC 5CK9A 2L5QA 2LTOA 4MDWA 3JB9I 1YCYA 3SWNC 2CYZB 2E6NA 5LJ3g 4E7KA 1G3WA 1KG1A 4M7AA 1BI2A 2PVOB 4ZN3A 1P92A 3ZFJA 2OTLA 3FRNA 3CXCA 1XTDA 3G71T 2WACA 3L2QA 3DLLA 3PMIA 2CKKA 4OB0B 1WJSA 2DKGA 4IUPA 5GAN2 3AHUA 2ZPEB 4HCZA 2O4XA 3RESA 1Q86C 4C5GA 2DJZA 4X34A 2JTFA 4BACA 1K73U 1KQSS 4M7AE 2KQWA 4E7JA 2XHCA 1PSFA 1Q82U 3JB9F 2DZCA 2DIGA 4OB1B 4EPCA 3JCMQ 4RKUE 4QVCA 5GAOq 3L2UA 5GANf 2CS7A 3CCSA 2DEQA 2L89A 3MEAA 4NL3A 1YJNA 3JCMX 5CKDA 3CCLA 5FU7B 3OS1A 2DAQA 5CKBA 4PJOA 3FIFA 1VQ6T 1VIEA 2LQKA 4J7IA 4QVDA 5KH6A 1JJ2S 1VQPT 1LJOA 1PSEA 2K3XA 3VKIA 4JDSA 5LJ3f 1HK9A 1U1TA 4J6YA 5GMKh 1N8RU 4RG2A 3CCJA 3DKMA 2CZ0B 5CKFA 2OTJT 2O01E 4M7DA 2JVVA 4ELZC 4C0DB 2XG8D 3JCMh 2CZ7B 2JN0A 5LJ5h 1VQ7A 4LDVA 2JUFA 4C5IA 1K8AU 1M90C 3PIOA 3JCMP 1VQ9A 3JCMf 2BIVA 2D0QB 4C5HA 4C0GA 5KE2A 2EFIA 1M4ZA 3KBGA 2ZPHB 4OMFB 4M7AC 3MEVA 3A8HB 3OYAA 1YJWT 2QXFA 1XOVA 4V2SA 1UGQB 3FJPA 3CCVA 4HKEA 2M16A 3C95A 4EMHA 4PJOC 2RJFA 1W2BA 4F7UF 4HCCA 1QP3A 2D6FA 2BUDA 3VYHB 2VYTA 4M77A 1N6AA 3LGFA 3LWHA 1JJ2A 2XIDA 4M7DE 4L6V5 1G3YA 3CCLT 3CC4T 5GAMd 4N4IA 2LT4A 2RB6A 4KUIA 3X26B 4M78D 3C4SA 1KQSA 3RMQA 3SD4A 2HQEA 3JCMc 1BKBA 4BI3A 4C8QD 3JCMb 4KUDK 3QSUA 3UT1A 4B9WA 5LJ3j 3BW1A 3F70A 4FT4A 3A8GB 4JLGA 2RHUA 3CCVT 4E7LA 3TCJA 2PU9B 2KAFA 2VV5A 3HFOA 4M7DF 1RI0A 4C0DC 4BDZA 2VXFA 2RD1A 3QDRB 1VQ9T 2ZPFB 3RKXA 2EQMA 2RHZA 2XICA 2F5KA 3OYDA 5GAOl 4NS5A 4M77G 4JJNK 3LX7A 2GQVA 3BDUA 2E1HA 3QJ6A 3OYCA 2MWPA 3QPHA 5GAMf 3X28B 2PQWA 2OTJA 5J3BA 2GFAA 5LJ3e 2IG0A 2XI9A 5A0LA 3G4SA 1VQNA 5GAMh 2RK1A 2LX9A 4PJOB 2DPPB 1NZ9A 2EYQA 3QYHB 2E5QA 1AHJB 3META 2QQSA 3E9FA 4RG8A 3X25B 3I55A 1YI2T 2RJDA 3H8ZA 4JUVA 5GAN8 2QEXT 3BY7A 3QYGB 4A54A 4C8QA 2QA4T 3M54A 3L2WA 3C94A 2LCCA 1YIJA 4PNOA 2Y4YA 3X24B 3OMGA 3CEYA 4M77C 2R57A 1ZHIA 3LH0A 2L3RA 3QZ5B 4BY6C 4F7UB 2FHDA 4M78A 3S6WA 1KQ2A 1X01A 2JZ2A 5GANh 4IUUA 4CRIA 4QW2A 3HP9A 2CZ1B 5HK3A 4C92E 1OYXA 3SFMA 4B9XA 2NLUA 3JCMJ 3G71A 4ZGJB 5J26A 2X4JA 2K5FA 3CMET 2EQUA 4CI0C 3PTAA 4DA4A 1OI1A 3MO8A 3NTHA 4OP0A 4HA8A 3UWNA 5KE3A 3JB9J 2HAXA 3HPWA 4Z02A 2ZZDA 3FLGA 1IZ6A 2PVGB 2VGMA 3DLMA 3J80E 3HSBA 2EJ9A 3OW2S 4ME7A 2IVWA 4XK8E 1KD1C 3PT9A 3M4YA 3ZBDA 2RA2A 1YITA 4L5GA 1WQ7A 4XTXA 4OGCA 2I2LA 1Q81C 4HCBA 3INZA 4LD6A 2LCLA 3RMSA 3PIPA 1I5LA 4M75A 4C5EA 1QVPA 1ZBXA 1GXIE 2E41A 1YJ9T 1RL2A 3JRZA 5A0DA 3OYEA 3V7CA 3OYIA 1VQ8T 4J8OA 2PUKB 3OA6A 3GLXA 5GMKe 4RCBA 4EDUA 4ELYC 2EKOA 5D6WA 1ZQ1A 2QTXA 3E19A 3LGLA 3M57A 3M58A 3M59A 4C92C 4LDUA 4XU3A 3MEWA 3CCMT 1QVFS 4N4GA 1BI1A 1WGSA 3T9NA 3OBYA 3WVDB 2A3LA 4PKCC 1X6OA 4FM4B 5CKHA 2DXUA 3OS2A 3OYMA 3JAME 2K2VA 3G6ET 3MP6A 3M4GA 4A4KA 2FL7A 4M77F 3CC7T 3ASKA 3CCRA 4C92D 2FVUA 3QKJA 2FB7A 2K3YA 4Y28E 3GPLA 3RUXA 3OYFA 3VUZA 1I8FA 3P8BB 4QQGA 3CC2A 5J39A 3I56A 3CBPA 3OYGA 3CCQA 4JRQA 3G6EA 5GAOn 4C8QG 2DD4A 3NFCA 3OS5A 3P8HA 3OSVA 1HXDA 2RJCA 2V8KA 1BIBA 1S72A 3CCUA 1VQLT 1Q86U 2E12A 3CPWA 2KVQG 1NPPA 2P0QA 4F7UA 1W2BS 4N0AC 4HT8A 4PJOD 2JOYA 1K73C 4GLKA 1IREB 1VQMT 4IKFA 2HNIA 3CCEA 4XQ3A 4LD9K 1MGQA 1D3BA 2PVDB 3QHSA 5GMKi 1UGRB 3V8LA 3KUFA 2MMPA 4XTZA 1YJ9A 3CCET 4M7DB 1K9MC 2DTOA 1XNIA 1WJRA 2G3RA 4BE1A 4C8QC 1K9MU 4M75C 2JTMA 3A8LB 3OB9A 3CCUT 1YITT 1XQHA 1OZ2A 2X4YA 2EWNA 3MEUA 2LRQA 2EJFA 1N9RA 2OAUA 3UPUA 3JB9H 3VJPA 4BI4A 2LT1A 3GNGA 3QJYA 4J5YA 5CAIA 3GP8A 3QUIA 2DVEA 3S3MA 3HRUA 4C92F 1W4SA 4PJOG 4J6WA 5GAN4 3OYLA 1X75C 3GIBA 2RI2A 2ZPIB 5CVIA 3BDLA 3MP8A 2CZ6B 1VQ5A 3QXEB 3TREA 3JCMg 2DXCA 2V8JA 2DO3A 4KBMB 5LJ5j 3CMEA 3S3OA 4PJOF 1N27A 2XU8A 3N5BB 5FU6C 2L8DA 3MHXA 3OBWA 2M0OA 2WSEE 3GOXA 4M7DD 5FU6B 5I2MA 4ZGEB 5AYFA 4MZPA 4N0AA 3FB9A 4JS4A 4ZN1A 2K5IA 3OS0A 2RO0A 2RHYA 4XTYA 3QBYA 4FL6A 2YLBA 3M9QA 2DXBA 3LWIA 1YIJT 1VIFA 4MDXA 5GANj 1BYMA 2QQRA 2QA4A 4MZTA 3URGA 2HQXA 4M7DC 1VQ8A 2QDYB 1UEBA 4LDYA 5GAOr 5FU7C 3QZ9B 3L2VA 4J83A 2RK2A 4J7FA 3I55T 2LNVA 4C8QB 5GAN6 4M75E 1YI2A 1QVFA 1H3ZA 3A8MB 2E10A 2R5AA 5DLOA 4D6WA 4FSXA 2LDMA 4E47A 2P0PA 4EMKA 5IT9E 2ZPGB 3HHTB 5LJ3h 4BI8B 1VQ4T 4HT9A 3OYJA 4P5NA 1UGSB 3J7AF 4NL2A 3X20B 1NJIU 5GAOm 3RKWA 4M75F 5C0MA 2X4WA 3OQ5A 4E7IA 2LQ8A 1KQ1A 4A4HA 5A2QE 1NJIC 5FRNA 5CKEA 4UC4A 2RI3A 4YTLA 2E65A 5GAN3 2JNGA 4M78G 4MMLA 5GAMe 3J81E 3DB3A 4Y91A 1LNXA 4GY5A 3QIIA 3OYKA 2DD5A 4IUVA 1M1KU 2WSCE 3TEEA 4ZTFA 3A8OB 4M78E 4QQ6A 3ZEHA 4BUGA 3CC4A 5D6XA 3V7RA 2RJEA 4II1A 2QEXA 5LJ5f 3HL8A 1BI0A 2HD0A 4XTWA 3VU3C 2MI6A 3WVEB 2DIQA 1G3SA 2E64A 2B8AA 2R58A 4M77B 3G4ST 4M75G 2F69A 3V8JA 2C06A 1EIFA 3SDZA 1JRIA 2O4XB 3L2ZA 4E7HA 3SWNB 5GAN5 5GANd 3OY9A 3CMAT 2X4XA 2EQJA 1UGPB 4DQ2A 2DXTA 2YRVA 4KULA 2EAYA 3FC3A 3MCAB 1Q7YC 4KT0E 5LJ5e 3LW5E 4LDXA 2R5MA 3LYIA 3L42A 1VQ4A 5EG2A 2KY9A 4XU0A 5LJ5d 3NTIA 3OSSC 5CQYA 5GMKm 3JCMd 1Q82C 2XDBA 5CCAA 3CCJT 3HKSA 3JB9G 2ZGWA 2ZCFB 3BFMA 4X9CA 4MMKA 4TVRA 1B34B 2K4YA 1VQ6A 5DY9A 2K57A 2M1HA 2KSSA 1NE8A 4BE2A 5HK0A 3V7SA 3FEOA 5HY6A 3GNFB 1U8RA 2V8IA 3CPFA 4M7AG 1WJQA 2RI5A 3JSCA 2XDPA 3OYNA 2VXEA 4M75D 1YJWA 4BD3A 1Y96A 2DZ9A 2YLCA 4OF1A 3OYYA 1JBMA 4C92A 1SSFA 1BI3A 2A7YA 4X9DA 3HRTA 2QQAA 1JB0E 4C0ZA 1MHNA 1K8AC 1M90U 5LJ3d 1WNLA 1VQ7T 2VGNA 3QG1A 5CQXA 4FU6A 5FROA 4DOWA 3E9GA 5CR2A 4ZTJA 5GAMj 2P4TA 4M7AB 3KXTA 2PUOB 4PJOE 1I4K1 1BIAA 2E70A 5DLQE 1UB4A 2VC8A 1M1GA 2EIFA 4O6JA 2M9UA 3O8VA 3PNWC 5I21A 4C0FA 5FRMA 4XTUA 1KC8C 3EAEA 3CPWS 2DK3A 1G5VA 4A53A 4C8QF 1KC8U 4WF2A 1VQPA 1V29B 4M7AF 1VQOA 3L1AA 4RMOA 1VQMA 3G7ZA 5CIUA 5L8RE 1YJNT 2FYKA 4BB7A 3CCST 1U1SA 2LVMA 2RH2A 4JRKA 1VUBA 1Y96B 5CO7A 1QVGS 4FIBA 2RHXA 1VQLA 2Y90A 4N4HA 4PLIA 3CBMA 1S72T 2ZPBB 2X35A 1Y71A 4C92B 1VQ5T 4M75B 1H641 2XK0A 4F7UG 3RKYA 3CD6T 4Q5WA 4PLLA 2KDSA 3L2RA 3M53A 5IAYA 3I56T 3CC2T 3Q1JA 4FT2A 2LC4A 3M5AA 4R55A 5A0GA 2QQBA 3CMAA 2OTLT 1N8RC 4IUQA 4XTVA 5GMKj 1M9SA 2AHJB 3VUBA 1M1FA 2KK4A 3DB4A 4OB3B 5M9OA 1NPRA 4EMKC 3CCRT 1VQKT 2DTHA 2MWOA 4XU1A 3SB2A 3S3NA 2MAMA 4M7AD 1B34A 5IN1A 4EMKB 4PL6A 3C12A 3OYBA 2VUBA 3EFSA 4DOVA 3EFRA 3OMCA 1FWZA 1KHIA 4BE0A 5LJ5g 3UDCA 1YHQA 3VYGA 1D3BB 5KCHA 3CCMA 3CBOA 3A5ZB 1QVGA 2CGHA 4J6XA 3PGGA 3FDRA 4M78B 3JCMW 1KHCA 3RIRA 5GAN7 2GF7A 3LLRA 3PFSA 3QO3A 5GAMg 1WPYA 5LL6S 2GFUA 4XU2A 4M78C 4C92G 2P0KA 5KCOA 3M56A 2K5LA 4JRIA 4L59A 4A4GA 2D9TA 4OVAA 4BDYA 4BY6B 1QW1A 2YHTA 3M55A 4RCCA 1YHQT 2H3JA 3SWNA 3MP1A 3HFNA 4MZMA 4R56A 1LOJA 3PMTA 4ZGDB 5D6YA 4M77E 1Q7YU 2WSFE 3RERA 4LDWA 2BKDN 3V8KA 4JLIA 3CCQT 1FX7A 2QQ9A 2MF2A 4OB2B 2EJGA 3WXMB 1VQKA 1TH7A 4IURA 3R6OA 5GANg 2HBPA 4JS5A 4A4FA 5HKCA 1WQWA 5I2SA 1DJ7B 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  4XK8 E;  2ZPB B;  3WVE B;  3X20 B;  2ZCF B;  2DXB A;  3A8H B;  3X24 B;  2ZPF B;  3A8L B;  4Y28 E;  1PSE A;  1UGQ B;  2PUO B;  3QZ5 B;  2CYZ B;  1GXI E;  2DD5 A;  2PVO B;  1QP3 A;  2DD4 A;  2QDY B;  2CZ0 B;  2WSC E;  3VYH B;  1QP2 A;  1UGP B;  2CZ1 B;  3QZ9 B;  2AHJ B;  3X28 B;  2PUK B;  4L6V 5;  3A8O B;  4OB3 B;  4ZGD B;  2O01 E;  2ZPI B;  4OB0 B;  3A8M B;  4ZGJ B;  3X26 B;  2WSF E;  2ZPE B;  2CZ6 B;  1V29 B;  3QXE B;  2DXC A;  2ZPG B;  2DPP B;  2CZ7 B;  3HHT B;  3QYH B;  3LW5 E;  4KT0 E;  4OB2 B;  3WVD B;  1AHJ B;  1PSF A;  3A8G B;  5L8R E;  2ZZD A;  3X25 B;  1IRE B;  2PVG B;  4FM4 B;  2WSE E;  2PU9 B;  1UGS B;  4OB1 B;  4RKU E;  3VYG A;  1JB0 E;  2D0Q B;  2PVD B;  4ZGE B;  3QYG B;  1UGR B;  1DJ7 B; 
#chains in the Genus database with same CATH topology
 1QKW A;  1K8A R;  2OAW A;  2E6Z A;  1Y07 A;  1KD1 U;  1O9S A;  1PG5 B;  4M7D G;  2YRD A;  3JB9 D;  1ZUK A;  3JCM V;  2RM4 A;  3JCM e;  2DYI A;  2RPN A;  3VS6 A;  4F7U E;  1N9S A;  3NTK A;  3OYH A;  1VQN T;  1JQQ A;  3UA6 A;  1TOV A;  4QQD A;  2O9V A;  4KRT A;  1G2B A;  3H6Z A;  3PVQ A;  2VWF A;  2F1L A;  3THK A;  1UDL A;  1Q81 R;  5IHI A;  2CYZ B;  5LJ3 g;  2PVO B;  4ZN3 A;  2OTL A;  1VYU A;  1XTD A;  2WAC A;  2FEI A;  3L2Q A;  3G71 T;  2JJ9 A;  4QT7 A;  3PMI A;  2CKK A;  2DKG A;  2ZPE B;  3NGP A;  3EH1 A;  1Q86 C;  4X34 A;  1KQS S;  2XHC A;  1Q82 U;  3JB9 F;  2DZC A;  4OB1 B;  3JCM Q;  5GAO q;  3L2U A;  1TUC A;  4NL3 A;  1YJN A;  1NLP C;  2GTJ A;  2LQK A;  2NUP B;  1VQP T;  2K3X A;  5GMK h;  3EHR A;  1LVK A;  5IHN A;  3DKM A;  2YUQ A;  1WZO A;  2XG8 D;  1S1N A;  2JN0 A;  2QAZ A;  2EGA A;  4C5I A;  3PIO A;  1NG2 A;  1TSF A;  1VQ9 A;  5KE2 A;  4LXC A;  3MEV A;  3A8H B;  3EG9 B;  4HKE A;  3QWX X;  3VS1 A;  1VYT A;  3LWH A;  1VQN Q;  3JV3 A;  4M78 D;  3C4S A;  1YN8 A;  3RMQ A;  2DBK A;  3QSU A;  3SHW A;  2CT3 A;  2EW3 A;  2RHU A;  1RAC B;  2A28 A;  3HFO A;  5EC7 A;  4KGZ B;  1ACM B;  2HKN A;  3QDR B;  2ZPF B;  4KGX B;  2H3E B;  4DEY A;  3ULR B;  3LX7 A;  1WA7 A;  1SEM A;  2SRC A;  3CCS Q;  2MWP A;  4AT1 B;  2XI9 A;  2X51 A;  1VQN A;  2RK1 A;  1GCQ C;  2DPP B;  2E5Q A;  3MET A;  1YI2 T;  1AEY A;  3BY7 A;  3EGX A;  3MPU B;  4C8Q A;  2QA4 T;  3M54 A;  4AMC A;  1YIJ A;  4PNO A;  3CEY A;  3QZ5 B;  1ZHI A;  3OYI A;  2COZ A;  1WI7 A;  5GAN h;  5L23 A;  4IUU A;  5HK3 A;  1PKT A;  1OYX A;  3SFM A;  5J26 A;  2X4J A;  4OMP A;  3CME T;  2EQU A;  4CI0 C;  4OP0 A;  3NTH A;  3JB9 J;  5KE3 A;  2P84 A;  2ZZD A;  4AFS C;  1M90 R;  3HSB A;  3I55 Q;  3M4Y A;  4L5G A;  1WQ7 A;  5KYW B;  4HCB A;  5KYU A;  1I1J A;  3I5R A;  1RAA B;  4M75 A;  1WXT A;  1I0C A;  1RL2 A;  1VQ8 T;  2KEA A;  3OA6 A;  1I5O B;  3M57 A;  1QCN A;  3MEW A;  1WGS A;  1NBE B;  3OBY A;  1X6O A;  4QKU A;  4FM4 B;  1TS9 A;  3G6E T;  1UUE A;  2FVU A;  3QKJ A;  2NYS A;  3M0P A;  1R0B G;  3CCQ Q;  3OYG A;  3A1P A;  2DD4 A;  3NFC A;  1D09 B;  1HXD A;  2YXY A;  3RNJ A;  1VQ7 Q;  2E12 A;  3CPW A;  2KVQ G;  3H9N A;  1NPP A;  4F7U A;  2JT4 A;  4PK4 A;  1K73 C;  1VQM T;  2D8J A;  4XQ3 A;  2IIM A;  1FYN A;  3V8L A;  1XNI A;  1CKA A;  1AVZ C;  2DL5 A;  1TUG B;  2JTM A;  3A8L B;  3OB9 A;  1YIT T;  3MEU A;  3FJ5 A;  1N9R A;  4BI4 A;  3GP8 A;  2LT1 A;  2PZ1 A;  3QJY A;  3S3M A;  3EGU A;  2L3P A;  2DE0 X;  4J6W A;  1X75 C;  3GIB A;  2RI2 A;  1WHM A;  1SF9 A;  3BDL A;  2CZ6 B;  1IO6 A;  2DXC A;  4KBM B;  5FU6 C;  2NUZ A;  2WSE E;  3RBB B;  4ZNX A;  4M7D D;  2KBT A;  2RO0 A;  3EH2 A;  7AT1 B;  4ORZ A;  4B6M A;  2GQI A;  2CP5 A;  4M7D C;  1VQ8 A;  2MYS A;  5GAO r;  2GBQ A;  4J7F A;  2LNV A;  4C8Q B;  4M75 E;  5DLO A;  4D6W A;  4FSX A;  5IT9 E;  1VQ6 Q;  1JXM A;  1VQ4 T;  2K79 A;  3J7A F;  2HL5 C;  4J9G A;  4M75 F;  1MMD A;  3J81 E;  2VKN A;  1LNX A;  3NMZ C;  2X3W D;  1WHG A;  3QII A;  3OYK A;  2DD5 A;  4RTX A;  2V1Q A;  2O88 A;  3TEE A;  5IXB A;  2CRE A;  1QQJ A;  1T3L A;  2DER A;  4II1 A;  1NEG A;  5ECA A;  4CC4 B;  2MI6 A;  4ANJ A;  1G3S A;  5KYX B;  5KYY B;  4PJL A;  1WHL A;  2C06 A;  2O4X B;  3L2Z A;  4E7H A;  1M2V B;  4OMQ A;  2KRS A;  2YRV A;  1OX9 A;  4KUL A;  2X3X D;  3MCA B;  1Q7Y C;  2KYM A;  4LDX A;  2EGE A;  2R5M A;  5EG2 A;  2KY9 A;  2M0Y A;  5LJ5 d;  2J6F A;  2GGR A;  2JMA A;  3HKS A;  1U06 A;  1BCM A;  2ROL A;  4DBF A;  3BFM A;  4X9C A;  4MMK A;  1B34 B;  1U5S A;  2M1H A;  2HZY A;  3V7S A;  3CCJ Q;  1U8R A;  2RI5 A;  2VXE A;  1I07 A;  3OYY A;  1JBM A;  2CP0 A;  2A7Y A;  3H41 A;  3HRT A;  2QQA A;  1K8A C;  4Z8A A;  1WNL A;  2VGN A;  5CQX A;  4E2F B;  3E9G A;  5CR2 A;  2P4T A;  4J9D A;  3SEM A;  2AIR B;  2JS2 A;  2QEX Q;  1JEG A;  2GTO A;  4O6J A;  4FW2 A;  1KC8 C;  1VQP A;  2ZAE A;  1V29 B;  4M7A F;  1VQO A;  2O2O A;  4RMO A;  3G7Z A;  1AWJ A;  1YJN T;  1U1S A;  2LVM A;  4JRK A;  1TXQ A;  1VUB A;  1SKU B;  1QVG S;  4N4H A;  1WX6 A;  1S72 T;  1Y71 A;  4C92 B;  1ZSZ B;  1H64 1;  4F7U G;  1VOM A;  3L2R A;  2JMC A;  3CC2 T;  4FT2 A;  4HXJ A;  4ESR A;  2C0I A;  2OTL T;  1N8R C;  4IUQ A;  4AG1 C;  5GMK j;  1M27 C;  3CCR T;  4EIK A;  2DTH A;  2MWO A;  4M7A D;  2VUB A;  4DOV A;  3TVT A;  3H0I A;  3UDC A;  2DMO A;  5KCH A;  3CCM A;  1QVG A;  3EGD A;  4M78 B;  1IRX A;  4M78 C;  5KCO A;  2P0K A;  3M56 A;  4A4G A;  4BDY A;  5GJW B;  4BY6 B;  3M55 A;  4FW1 A;  2LZ6 B;  2QTV A;  1LOJ A;  3PMT A;  3RDV A;  4LDW A;  1OPK A;  4JLI A;  3CCQ T;  3EG1 A;  4OB2 B;  4CC2 A;  4JS5 A;  2DYB A;  1DJ7 B;  1YBY A;  1K0S A;  3M0R A;  5GMK l;  3CCM Q;  3VV0 A;  3E1S A;  2RHI A;  4DEX A;  1RI9 A;  2DM1 A;  1VQM Q;  2DTI A;  1UJY A;  2LNH B;  2YUO A;  5FLX E;  3ER0 A;  1ZX6 A;  5IHK A;  1VQO T;  1R8O B;  4OGE A;  4VUB A;  1NEB A;  8ATC B;  3HRS A;  2J06 A;  1K0X A;  5GAO p;  2XD0 A;  4IUT A;  2GCX A;  2Y4X A;  1M8V A;  4C8Q E;  2LJ0 A;  2AKK A;  5CK9 A;  2LTO A;  3JB9 I;  1YCY A;  1W2B P;  2QK0 A;  1X6G A;  1G3W A;  4M7A A;  1P92 A;  1QMC A;  4OB0 B;  4IUP A;  3QWY A;  3UAT A;  2J05 A;  4BAC A;  4Z88 A;  4RKU E;  2ED0 A;  5GAN f;  3MEA A;  3JCM X;  3CCL A;  5FU7 B;  2DAQ A;  4PJO A;  1VIE A;  4J7I A;  5KH6 A;  1JJ2 S;  1PSE A;  2MIO A;  5LJ3 f;  2V1R A;  1QVG P;  2CZ0 B;  2OTJ T;  4M7D A;  2RMO A;  4K11 A;  3JCM h;  4LDV A;  4JZ3 A;  1M3A A;  1M90 C;  3JCM f;  4C0G A;  1V1C A;  2QG9 B;  3KBG A;  1MV0 B;  4M7A C;  3CCL Q;  4RTV A;  1TTH B;  1M2V A;  1UGQ B;  3FJP A;  2RJF A;  1QP3 A;  2BUD A;  3LGF A;  1GCQ A;  1M3B A;  4M7D E;  1G3Y A;  4PJJ A;  2LT4 A;  2RB6 A;  4KUI A;  2KGT A;  3TQ7 P;  2HQE A;  3JCM c;  3TSZ A;  4KUD K;  3F70 A;  3A8G B;  4JLG A;  3CCV T;  3O5Z A;  2VV5 A;  4M7D F;  4D8K A;  1RI0 A;  4M4Z A;  2VXF A;  1VQL Q;  2LCS A;  4E7Z A;  1X2Q A;  2EYZ A;  3RKX A;  2XIC A;  2F5K A;  3OYD A;  4NS5 A;  4M77 G;  4JJN K;  3CMA Q;  2EYX A;  1OU8 A;  1HJD A;  2E1H A;  3GBQ A;  4LE9 A;  2YUP A;  3G4S A;  2LX9 A;  1HD3 A;  1K73 R;  4RG8 A;  3X25 B;  1X69 A;  5GAN 8;  3QYG B;  3C94 A;  2LCC A;  2Y4Y A;  3X24 B;  3OMG A;  1WXU A;  3LH0 A;  4BY6 C;  4M78 A;  1GCP A;  4QW2 A;  1Z9Q A;  3JCM J;  4B9X A;  2JXB A;  4DA4 A;  1JJ2 P;  3UWN A;  2HDA A;  1ABO A;  3G4S Q;  2M02 A;  1IZ6 A;  5KYY A;  3J80 E;  3PT9 A;  3ZBD A;  2RA2 A;  2ABL A;  1YIT A;  4OGC A;  2I2L A;  1BK2 A;  4R0K A;  1I5L A;  4C5E A;  1QVP A;  1ZBX A;  3MJX A;  4A63 B;  3V7C A;  4AFU C;  2LQW A;  5KYN A;  3GLX A;  4RCB A;  4ELY C;  1ZQ1 A;  2QTX A;  3M58 A;  4C92 C;  4LDU A;  4N4G A;  1E6G A;  1D0Y A;  1OPL A;  5I22 A;  2JM8 A;  2F2X A;  4PKC C;  5CKH A;  3OS2 A;  3JAM E;  4HVU A;  3CC7 T;  4M77 F;  4C92 D;  2MCN A;  4J9I A;  2K3Y A;  1C1A A;  3RUX A;  3OYF A;  1I8F A;  3P8B B;  5J39 A;  4JRQ A;  4PFZ A;  3G6E A;  5GAO n;  4C8Q G;  1F1B B;  1SRM A;  1LPL A;  3CCU A;  1VQL T;  2B86 A;  1W2B S;  2LJ3 A;  4LD9 K;  2W10 A;  1GFD A;  2MMP A;  4M7D B;  4HVW A;  1K9M C;  1WJR A;  4BE1 A;  2FRY A;  4M75 C;  1KQS P;  1OZ2 A;  2EGC A;  4PJM A;  3UPU A;  2KI7 A;  3VJP A;  4OMM A;  4PJO G;  1KC8 R;  3MP8 A;  2ECZ A;  3TRE A;  3CME A;  3CD6 Q;  1IB8 A;  2XU8 A;  4J9B A;  2FPD A;  1MMN A;  3OBW A;  4JPB W;  1YHQ Q;  2XMF A;  5AYF A;  4MZP A;  1H92 A;  4N0A A;  3FB9 A;  2K5I A;  2KE9 A;  2RHY A;  1UG1 A;  2DXB A;  1YIJ T;  2QQR A;  2VAS A;  2CP7 A;  2QA4 A;  1PC0 A;  3URG A;  2E3H A;  4KGV B;  1G83 A;  1QLY A;  3L2V A;  4J83 A;  1YI2 A;  5GAN 6;  2P0P A;  3OYJ A;  1NJI U;  2L3Q A;  5GAO m;  3RKW A;  5C0M A;  1KQ1 A;  1C0M A;  2IPO B;  2YUN A;  2E65 A;  3HTR A;  2JNG A;  4FYV B;  2A08 A;  4GY5 A;  2DFU A;  1E6H A;  4IUV A;  1JU5 C;  2DA9 A;  2WSC E;  4LUE A;  1KSW A;  1WLP B;  1SSH A;  3ZEH A;  2QDL A;  4JJD A;  5D6X A;  2EQI A;  2RJE A;  1H8K A;  2QEX A;  1VQK Q;  1BI0 A;  2A0F B;  2QGG A;  3WVE B;  3CPW P;  1VQ5 Q;  2E64 A;  4M77 B;  2R58 A;  4X1V A;  4M75 G;  2AT1 B;  2F69 A;  3V8J A;  1JRI A;  1T3S A;  2AK5 A;  5GAN 5;  5GAN d;  1N8R R;  1VYV A;  2EQJ A;  1RLP C;  2DXT A;  2E3I A;  2K2M A;  2EAY A;  3FC3 A;  4PJN A;  1KK7 A;  3LW5 E;  1K4U S;  1OV3 A;  5CQY A;  1Q82 C;  3JCM d;  1M8M A;  3CCR Q;  2JTE A;  2VVK A;  1EX4 A;  1AZE A;  5DY9 A;  1WYX A;  4BE2 A;  1HYO A;  2XDP A;  4M75 D;  1YJW A;  4BD3 A;  4OF1 A;  2YLC A;  4C92 A;  1SSF A;  1BI3 A;  4DBQ A;  1JB0 E;  2YT6 A;  2LX7 A;  1M30 A;  4JZ4 A;  1NYF A;  2LJ1 A;  4DOW A;  4ZTJ A;  3KXT A;  2PUO B;  4OML A;  1K9A A;  1I4K 1;  5DLQ E;  4D8D A;  2EIF A;  3O8V A;  3PNW C;  5I21 A;  3M0T A;  1C6V X;  2YWW A;  3CPW S;  2DK3 A;  4RTT A;  1S72 Q;  1KC8 U;  1T0H A;  3CCU Q;  3H0H A;  3EG9 A;  1EFN A;  1MMA A;  5CIU A;  5L8R E;  2AZS A;  3CCS T;  2C0O A;  4FIB A;  4PLI A;  2Y90 A;  2J6K A;  4J9C A;  2X35 A;  2D8H A;  2KDS A;  1Z9Z A;  3M53 A;  2CH4 A;  3I56 T;  2HEQ A;  5A0G A;  2RQV A;  3CCV Q;  1M9S A;  4RUG A;  4OB3 B;  1M1F A;  1VQK T;  1NPR A;  4EMK C;  4LNP A;  3SB2 A;  1B34 A;  3OYB A;  4PL6 A;  2AKL A;  3EFS A;  3VRZ A;  2QGF B;  2RQW A;  5LJ5 g;  2NUP A;  1YHQ A;  3VYG A;  3AT1 B;  3CBO A;  3UA7 A;  3JCM W;  1RAH B;  4RTY A;  5GAM g;  1WPY A;  2LQN A;  4XU2 A;  2K5L A;  1K1Z A;  2K9G A;  1T0J A;  2YHT A;  2O9S A;  5D6Y A;  1Q7Y U;  3VS7 A;  2DET A;  3V8K A;  2QQ9 A;  2MF2 A;  1TH7 A;  1K76 A;  5GAN g;  3R6N A;  5I2S A;  2CT4 A;  1D0Z A;  2EQK A;  3CC7 A;  3G1J A;  1M5Q 1;  3TU4 K;  1Q81 U;  2XDD A;  1VQO Q;  3CME Q;  3CD6 A;  4RTU A;  1M1K C;  3CXC S;  2ATC B;  4QVZ A;  2F5T X;  2MK5 A;  3EG0 A;  2FZG B;  2VB6 A;  1Y0M A;  4GBQ A;  4XAX B;  4JRP A;  3P8D A;  4KH0 B;  2KT8 A;  1MNE A;  3ME9 A;  1OUL A;  4ATO A;  2QI2 A;  2BZY A;  4O5V A;  2DL7 A;  5GAN e;  1D1A A;  1FMV A;  5GJV B;  2L5Q A;  3IQL A;  3M0Q A;  4E7K A;  1KG1 A;  1GBR A;  3FRN A;  3CXC A;  2FO0 A;  1W1F A;  3NHN A;  5GAN 2;  4HCZ A;  2O4X A;  3RES A;  2DL3 A;  4C5G A;  4M7A E;  2DIL A;  2JTF A;  3H0F A;  4E7J A;  1PSF A;  4QVC A;  2CSQ A;  2CS7 A;  5KYX A;  2DEQ A;  1ZUU A;  3OS1 A;  1ABQ A;  3FIF A;  1VQ6 T;  4QVD A;  2KXD A;  1LJO A;  2DL4 A;  2DF6 A;  2I0N A;  4JDS A;  1HK9 A;  1U1T A;  4J6Y A;  2X9H A;  4RG2 A;  2MPX C;  3RR6 A;  1M3C A;  2DRK A;  2O01 E;  4ELZ C;  3PE0 A;  2HKQ B;  2HCK A;  2CZ7 B;  1CKB A;  5LJ5 h;  1VQ7 A;  4F14 A;  1BBZ A;  2JUF A;  2D0Q B;  4C5H A;  2ZPH B;  2ROT A;  1K9M R;  4RTZ A;  3CCV A;  5FWB A;  3C95 A;  4EMH A;  1W2B A;  4F7U F;  2VYT A;  1MV3 A;  1N6A A;  1JJ2 A;  2XID A;  4L6V 5;  1YFN A;  5GAM d;  3X26 B;  1KQS A;  3SD4 A;  4BI3 A;  2EYW A;  3JCM b;  2OJ2 A;  5LJ3 j;  1R77 A;  3BW1 A;  1UGV A;  3VRY A;  4E7L A;  3TCJ A;  1X27 A;  1AWO A;  2RD1 A;  2H8H A;  2RHZ A;  1PD0 A;  1E7O A;  2OI3 A;  1QCF A;  5KYW A;  2GQV A;  3QJ6 A;  2SEM A;  3QPH A;  2PQW A;  4HVV A;  2OTJ A;  1VA7 A;  5J3B A;  5KYU B;  5LJ3 e;  2IG0 A;  1HSQ A;  1YWO A;  1J3T A;  4IIM A;  1NZ9 A;  3QYH B;  2E4H A;  3I55 A;  3E9F A;  3CC2 Q;  2RJD A;  3CXC P;  1W70 A;  4A54 A;  3L2W A;  1WXB A;  2J7I A;  2L3S A;  1KQ2 A;  4F7U B;  2FHD A;  3S6W A;  1X01 A;  2JZ2 A;  3EGD B;  2KRO A;  1QWE A;  1Q95 G;  2CZ1 B;  2NLU A;  1PHT A;  4ZGJ B;  3PTA A;  3MO8 A;  4HA8 A;  2K7A A;  2HAX A;  2YSQ A;  1MND A;  3HPW A;  4Z02 A;  3FLG A;  4GLM A;  2VGM A;  3DLM A;  5IH2 A;  2EJ9 A;  2IVW A;  1KD1 C;  4XTX A;  1QVF P;  3INZ A;  3RMS A;  3PIP A;  1GXI E;  3OW2 P;  3JRZ A;  5A0D A;  3OYE A;  2PUK B;  5GMK e;  2EKO A;  3E19 A;  3TSW A;  4CC7 A;  3M59 A;  1BI1 A;  3WVD B;  2DXU A;  1X43 A;  4OMN A;  3ASK A;  2FB7 A;  2GNC A;  4Y28 E;  2K6D A;  4QQG A;  3I56 A;  3CCQ A;  1X2K A;  2KRM A;  3P8H A;  2Z0W A;  3OSV A;  1BIB A;  1TWB A;  4N0A C;  1VQ9 Q;  4FSS A;  2HL3 A;  2JOY A;  4IKF A;  3CCE A;  1IXD A;  2A37 A;  5GMK i;  1YJ9 A;  3CCE T;  9ATC B;  2DTO A;  3G71 Q;  2G3R A;  2LMJ A;  1XQH A;  2X4Y A;  2EWN A;  2LRQ A;  2OAU A;  3JB9 H;  2F2W A;  4J5Y A;  3GNG A;  1U3O A;  5CAI A;  3QUI A;  3HRU A;  1W4S A;  2CP6 A;  5GAN 4;  5CVI A;  1VQ5 A;  3QXE B;  5FW9 A;  1VQP Q;  1N27 A;  2L8D A;  3MHX A;  3GOX A;  2YRC A;  1ZSG A;  4LUD A;  5I11 A;  4JS4 A;  2NWM A;  2RQU A;  3BE3 A;  1PWT A;  3LWI A;  1VIF A;  2A36 A;  4MZT A;  2HQX A;  1VQ4 Q;  2BE7 D;  2QDY B;  1UEB A;  4LDY A;  4RTW A;  3QZ9 B;  2RK2 A;  2L2P A;  1QVF A;  1D1B A;  2DVJ A;  2R5A A;  1WHJ A;  3M0U A;  4EMK A;  4BI8 B;  1Q86 R;  2W0Z A;  4P5N A;  1ZA2 B;  1UGS B;  4NL2 A;  3X20 B;  5FRN A;  2LQ8 A;  4A4H A;  5A2Q E;  1NJI C;  1YP5 A;  4UC4 A;  2RI3 A;  4M78 G;  4MML A;  1CSK A;  4Y91 A;  1QWF A;  2DEU A;  1NM7 A;  3VS2 A;  4ZTF A;  2EPD A;  4M78 E;  4QQ6 A;  3EG2 A;  1RAE B;  4BUG A;  1NYG A;  3CC4 A;  8AT1 B;  3V7R A;  1OEB A;  1RAG B;  3HL8 A;  2HD0 A;  1G8X A;  3VU3 C;  2KRN A;  3SDZ A;  3OY9 A;  2X4X A;  4DQ2 A;  4KT0 E;  5LJ5 e;  3LYI A;  3L42 A;  1GBQ A;  3CCJ T;  1Q82 R;  4TVR A;  2K4Y A;  1KFZ A;  5HK0 A;  2BZX A;  2DX1 A;  1UE9 A;  3VS3 A;  3GNF B;  3CPF A;  1M2O A;  1WJQ A;  5D7U A;  1WHH A;  1YWP A;  2DZ9 A;  4X9D A;  1IGQ A;  1M90 U;  2JS0 A;  3REA B;  5LJ3 d;  1VQ7 T;  2DRM A;  5FRO A;  2JM9 A;  5GAM j;  4PJO E;  1M1K R;  1BIA A;  1AD5 A;  1UB4 A;  3VS0 A;  5FRM A;  4XTU A;  3EAE A;  1G5V A;  1D0X A;  4A53 A;  4IIO A;  4C8Q F;  3CC7 Q;  4WF2 A;  1NLO C;  3L1A A;  2CP3 A;  1Y96 B;  2RHX A;  1VQL A;  1YJ9 Q;  3CBM A;  2ZPB B;  4M75 B;  1UHF A;  3Q1J A;  1WDX A;  2LC4 A;  4R55 A;  2QQB A;  3CMA A;  4F17 A;  1TUD A;  2AHJ B;  2HQH A;  1PRL C;  5M9O A;  1EZZ B;  2RN8 A;  4XU1 A;  3S3N A;  3C12 A;  2CH4 W;  1FWZ A;  1KHI A;  2BZ8 A;  2CGH A;  4J6X A;  3FDR A;  3RIR A;  1PRM C;  2GF7 A;  3LLR A;  3QO3 A;  5LL6 S;  4F04 B;  4C92 G;  2FPF A;  4JRI A;  3NPF A;  4RCC A;  2H3J A;  3SWN A;  3MP1 A;  3HFN A;  4J9F A;  4MZM A;  1B7T A;  4PFP A;  2BKD N;  1FX7 A;  2EJG A;  2FZK B;  4IUR A;  2HBP A;  2HMA A;  3MKD A;  4A4F A;  5HKC A;  3CMA T;  1O75 A;  1X6B A;  2RNA A;  2CUD A;  1I81 A;  5C6S A;  1G3T A;  1IGU A;  1Y7X A;  1AOJ A;  1B3Q A;  1QP2 A;  4WCI A;  3OW2 A;  2KMT A;  1OZ3 A;  3GF5 A;  2EVR A;  4M77 D;  1SHG A;  2ED1 A;  4A4E A;  4M78 F;  4NOY A;  2PTK A;  1FXX A;  5DM7 R;  4EMG A;  3PVL A;  2XKO C;  4MDW A;  3SWN C;  1GFC A;  2E6N A;  1BI2 A;  4JJB A;  3ZFJ A;  1SG5 A;  3DLL A;  2D0N A;  1WJS A;  3AHU A;  2FPE A;  2DJZ A;  1K73 U;  4DBR A;  3VS4 A;  2KQW A;  2DIG A;  2K3B A;  2F2V A;  4EPC A;  3CCS A;  2BE9 B;  2L89 A;  2KXC A;  5CKD A;  1JO8 A;  3EFO A;  5CKB A;  2OTJ Q;  1UHC A;  3VKI A;  1N8R U;  3CCJ A;  4FYW B;  3LH5 A;  2PNI A;  5CKF A;  2CUB A;  2JVV A;  4C0D B;  2AZV A;  2ESW A;  1OOT A;  1K8A U;  3JCM P;  2BIV A;  2EFI A;  1M4Z A;  4OMF B;  3OYA A;  1YJW T;  2QXF A;  1XOV A;  4V2S A;  2HSE B;  2M16 A;  4PJO C;  4HCC A;  2QAS A;  3ZL7 C;  4FYY B;  2D6F A;  3VYH B;  4M77 A;  3CCL T;  3CC4 T;  4N4I A;  4AFZ C;  1BKB A;  4C8Q D;  3UT1 A;  1R0C B;  4B9W A;  4FT4 A;  2BTT A;  2OTL Q;  2PU9 B;  2ENM A;  2KAF A;  2M51 A;  1ZSZ C;  2KYB A;  6AT1 B;  4C0D C;  4BDZ A;  1RAD B;  1VQ9 T;  1JXO A;  2EQM A;  5GAO l;  1RUW A;  2HSP A;  2FZC B;  1YJN Q;  3BDU A;  3OYC A;  5GAM f;  3X28 B;  1PNJ A;  2GFA A;  5A0L A;  5GAM h;  4PJO B;  2EYQ A;  2NUT A;  1AHJ B;  2QQS A;  3H8Z A;  4JUV A;  4DBH A;  2QEX T;  1KJW A;  2KT1 A;  2J6O A;  5IXF A;  4F16 A;  2G6F X;  1N5Z A;  3D7S B;  4M77 C;  2R57 A;  1FMK A;  2L3R A;  2FG0 A;  3CCE Q;  2CSI A;  4CRI A;  3HP9 A;  1UJ0 A;  4C92 E;  1QCO A;  3G71 A;  2CP2 A;  2K5F A;  1VQ5 T;  1OI1 A;  2V26 A;  2PVG B;  3EGX B;  3OW2 S;  4PFO A;  2DNU A;  4ME7 A;  4XK8 E;  1PD1 A;  1TG0 A;  1YNZ A;  1KD1 R;  1YCS B;  2NUT B;  1Q81 C;  4LD6 A;  2LCL A;  1V76 A;  3I35 A;  1B07 A;  2E41 A;  1YJ9 T;  1RAB B;  1BB9 A;  4J8O A;  4EDU A;  5D6W A;  3LGL A;  2C0T A;  1QVF S;  3CCM T;  4XU3 A;  3M0S A;  1ARK A;  2E5K A;  4OMO A;  3T9N A;  1SPK A;  2A3L A;  1QKX A;  1VQ8 Q;  5AT1 B;  3OYM A;  2K2V A;  3MP6 A;  3M4G A;  4A4K A;  2FL7 A;  1UTI A;  3CCR A;  3VS5 A;  3CC4 Q;  3C0C A;  4HCK A;  4E7S A;  3GPL A;  3VUZ A;  4KH1 B;  3CC2 A;  2DBM A;  3CBP A;  3G6E Q;  1MUZ A;  1WHK A;  3OS5 A;  1IHV A;  1KIK A;  2RJC A;  2V8K A;  1UEC A;  1FMW A;  1S72 A;  1Q86 U;  2P0Q A;  4WTO B;  4HT8 A;  2COY A;  4PJO D;  1RLQ C;  1IRE B;  4GLK A;  2HNI A;  4JJC A;  1MGQ A;  1D3B A;  2PVD B;  3QHS A;  1UGR B;  3KUF A;  4XTZ A;  1RAF B;  4C8Q C;  1K9M U;  2LP5 A;  3CCU T;  2EBP A;  2EJF A;  1YI2 Q;  2DVE A;  4C92 F;  1AZG B;  1W6X A;  3UF4 A;  3EHQ A;  3OYL A;  2ZPI B;  1BCO A;  1IHW A;  3JCM g;  2V8J A;  2DO3 A;  5LJ5 j;  1YIJ Q;  3S3O A;  4PJO F;  1ZSZ A;  3N5B B;  1BU1 A;  2M0O A;  5FU6 B;  5I2M A;  4ZGE B;  2DLP A;  2FRW A;  4ZN1 A;  3OS0 A;  2JW4 A;  4XTY A;  3QBY A;  4FL6 A;  2YLB A;  3M9Q A;  2D1X A;  4MDX A;  4AG2 C;  5GAN j;  1BYM A;  5FU7 C;  2KNB B;  1H3Z A;  3I55 T;  2RQR A;  1SHF A;  3A8M B;  2E10 A;  2KR3 A;  4E47 A;  2LDM A;  4HT9 A;  2ZPG B;  3HHT B;  5LJ3 h;  1ZA1 B;  1H3H A;  1A0N B;  1ZLM A;  3I56 Q;  1GL5 A;  4E7I A;  2X4W A;  3OQ5 A;  2QYZ A;  1NJI R;  5CKE A;  4YTL A;  5GAN 3;  5GAM e;  3DB3 A;  5HCK A;  1M1K U;  2QA4 Q;  1AWX A;  3KFV A;  3A8O B;  3U23 A;  2COW A;  3EFO B;  5LJ5 f;  4XTW A;  2DIQ A;  2L0A A;  2B8A A;  4AFQ C;  3G4S T;  1EIF A;  3QDF A;  3SWN B;  2DL8 A;  1UGP B;  1PM3 A;  2OX7 A;  1PCX A;  3A98 A;  1Q7Y R;  2DJQ A;  2MOX A;  1ZUY A;  1VQ4 A;  3NTI A;  3OSS C;  5GMK m;  2XDB A;  5CCA A;  3JB9 G;  4FCY A;  4FYX B;  2ZGW A;  2ZCF B;  3I5S A;  1VQ6 A;  5FWC A;  2K57 A;  2KSS A;  1NE8 A;  2RF0 A;  3FEO A;  5HY6 A;  2V8I A;  4M7A G;  3JSC A;  3OYN A;  3I9Q A;  1Y96 A;  4CC3 A;  4J9H A;  1LCK A;  4C0Z A;  3CQT A;  1MHN A;  1SRL A;  1OX8 A;  4J9E A;  3QG1 A;  4FU6 A;  4M7A B;  2E70 A;  2P4R A;  2VC8 A;  1M1G A;  2M9U A;  4C0F A;  1WIE A;  1YIT Q;  1PKS A;  1VQM A;  1YJW Q;  1AWW A;  1OU9 A;  2FYK A;  3REB B;  4BB7 A;  5CO7 A;  2RH2 A;  1OQK A;  3EG3 A;  2XK0 A;  3RKY A;  3CD6 T;  4Q5W A;  4PLL A;  1WFW A;  5IAY A;  4Z89 A;  3M5A A;  1RAI B;  2CDT A;  1ZBJ A;  1D1C A;  4XTV A;  1MMG A;  3VUB A;  2KK4 A;  3DB4 A;  2MAM A;  5IN1 A;  4EMK B;  1UFF A;  3EFR A;  3OMC A;  2EKH A;  2YDL A;  2O31 A;  4BE0 A;  1D3B B;  4Y92 A;  3A5Z B;  1AT1 B;  2RQT A;  3E2U A;  3PGG A;  1Y57 A;  1KHC A;  2EYY A;  5GAN 7;  3PFS A;  1TU0 B;  2GFU A;  4LN2 A;  4L59 A;  1GRI A;  2D9T A;  4OVA A;  1QW1 A;  1YHQ T;  4R56 A;  4ZGD B;  4E6R A;  4M77 E;  2WSF E;  3RER A;  1XJW B;  3WXM B;  1VQK A;  2HBW A;  3R6O A;  1WQW A;  4XU0 A; 
#chains in the Genus database with same CATH homology
 2EQK A;  2E6Z A;  5GMK l;  3CC7 A;  3VV0 A;  1M5Q 1;  1O75 A;  3E1S A;  3TU4 K;  1Y07 A;  2RHI A;  1Q81 U;  1KD1 U;  1O9S A;  1I81 A;  5C6S A;  2XDD A;  3CD6 A;  4M7D G;  1G3T A;  1M1K C;  2DTI A;  1Y7X A;  3CXC S;  5FLX E;  4QVZ A;  2F5T X;  3JB9 D;  1QP2 A;  3ER0 A;  3JCM V;  3OW2 A;  2RM4 A;  4XAX B;  3JCM e;  1R8O B;  4JRP A;  3P8D A;  1VQO T;  4OGE A;  2KMT A;  4VUB A;  1OZ3 A;  3GF5 A;  3ME9 A;  4M77 D;  3HRS A;  4F7U E;  1N9S A;  3NTK A;  4ATO A;  5GAO p;  2XD0 A;  3OYH A;  4IUT A;  1VQN T;  4A4E A;  4QQD A;  2GCX A;  4M78 F;  2Y4X A;  2QI2 A;  4NOY A;  1M8V A;  4C8Q E;  3H6Z A;  1FXX A;  5DM7 R;  4O5V A;  4EMG A;  5GAN e;  2XKO C;  5CK9 A;  2L5Q A;  2LTO A;  4MDW A;  3JB9 I;  1YCY A;  3SWN C;  2CYZ B;  2E6N A;  5LJ3 g;  4E7K A;  1G3W A;  1KG1 A;  4M7A A;  1BI2 A;  2PVO B;  4ZN3 A;  1P92 A;  3ZFJ A;  2OTL A;  3FRN A;  3CXC A;  1XTD A;  3G71 T;  2WAC A;  3L2Q A;  3DLL A;  3PMI A;  2CKK A;  4OB0 B;  1WJS A;  2DKG A;  4IUP A;  5GAN 2;  3AHU A;  2ZPE B;  4HCZ A;  2O4X A;  3RES A;  1Q86 C;  4C5G A;  2DJZ A;  4X34 A;  2JTF A;  4BAC A;  1K73 U;  1KQS S;  4M7A E;  2KQW A;  4E7J A;  2XHC A;  1PSF A;  1Q82 U;  3JB9 F;  2DZC A;  2DIG A;  4OB1 B;  4EPC A;  3JCM Q;  4RKU E;  4QVC A;  5GAO q;  3L2U A;  5GAN f;  2CS7 A;  3CCS A;  2DEQ A;  2L89 A;  3MEA A;  4NL3 A;  1YJN A;  3JCM X;  5CKD A;  3CCL A;  5FU7 B;  3OS1 A;  2DAQ A;  5CKB A;  4PJO A;  3FIF A;  1VQ6 T;  1VIE A;  2LQK A;  4J7I A;  4QVD A;  5KH6 A;  1JJ2 S;  1VQP T;  1LJO A;  1PSE A;  2K3X A;  3VKI A;  4JDS A;  5LJ3 f;  1HK9 A;  1U1T A;  4J6Y A;  5GMK h;  1N8R U;  4RG2 A;  3CCJ A;  3DKM A;  2CZ0 B;  5CKF A;  2OTJ T;  2O01 E;  4M7D A;  2JVV A;  4ELZ C;  4C0D B;  2XG8 D;  3JCM h;  2CZ7 B;  2JN0 A;  5LJ5 h;  1VQ7 A;  4LDV A;  2JUF A;  4C5I A;  1K8A U;  1M90 C;  3PIO A;  3JCM P;  1VQ9 A;  3JCM f;  2BIV A;  2D0Q B;  4C5H A;  4C0G A;  5KE2 A;  2EFI A;  1M4Z A;  3KBG A;  2ZPH B;  4OMF B;  4M7A C;  3MEV A;  3A8H B;  3OYA A;  1YJW T;  2QXF A;  1XOV A;  4V2S A;  1UGQ B;  3FJP A;  3CCV A;  4HKE A;  2M16 A;  3C95 A;  4EMH A;  4PJO C;  2RJF A;  1W2B A;  4F7U F;  4HCC A;  1QP3 A;  2D6F A;  2BUD A;  3VYH B;  2VYT A;  4M77 A;  1N6A A;  3LGF A;  3LWH A;  1JJ2 A;  2XID A;  4M7D E;  4L6V 5;  1G3Y A;  3CCL T;  3CC4 T;  5GAM d;  4N4I A;  2LT4 A;  2RB6 A;  4KUI A;  3X26 B;  4M78 D;  3C4S A;  1KQS A;  3RMQ A;  3SD4 A;  2HQE A;  3JCM c;  1BKB A;  4BI3 A;  4C8Q D;  3JCM b;  4KUD K;  3QSU A;  3UT1 A;  4B9W A;  5LJ3 j;  3BW1 A;  3F70 A;  4FT4 A;  3A8G B;  4JLG A;  2RHU A;  3CCV T;  4E7L A;  3TCJ A;  2PU9 B;  2KAF A;  2VV5 A;  3HFO A;  4M7D F;  1RI0 A;  4C0D C;  4BDZ A;  2VXF A;  2RD1 A;  3QDR B;  1VQ9 T;  2ZPF B;  3RKX A;  2EQM A;  2RHZ A;  2XIC A;  2F5K A;  3OYD A;  5GAO l;  4NS5 A;  4M77 G;  4JJN K;  3LX7 A;  2GQV A;  3BDU A;  2E1H A;  3QJ6 A;  3OYC A;  2MWP A;  3QPH A;  5GAM f;  3X28 B;  2PQW A;  2OTJ A;  5J3B A;  2GFA A;  5LJ3 e;  2IG0 A;  2XI9 A;  5A0L A;  3G4S A;  1VQN A;  5GAM h;  2RK1 A;  2LX9 A;  4PJO B;  2DPP B;  1NZ9 A;  2EYQ A;  3QYH B;  2E5Q A;  1AHJ B;  3MET A;  2QQS A;  3E9F A;  4RG8 A;  3X25 B;  3I55 A;  1YI2 T;  2RJD A;  3H8Z A;  4JUV A;  5GAN 8;  2QEX T;  3BY7 A;  3QYG B;  4A54 A;  4C8Q A;  2QA4 T;  3M54 A;  3L2W A;  3C94 A;  2LCC A;  1YIJ A;  4PNO A;  2Y4Y A;  3X24 B;  3OMG A;  3CEY A;  4M77 C;  2R57 A;  1ZHI A;  3LH0 A;  2L3R A;  3QZ5 B;  4BY6 C;  4F7U B;  2FHD A;  4M78 A;  3S6W A;  1KQ2 A;  1X01 A;  2JZ2 A;  5GAN h;  4IUU A;  4CRI A;  4QW2 A;  3HP9 A;  2CZ1 B;  5HK3 A;  4C92 E;  1OYX A;  3SFM A;  4B9X A;  2NLU A;  3JCM J;  3G71 A;  4ZGJ B;  5J26 A;  2X4J A;  2K5F A;  3CME T;  2EQU A;  4CI0 C;  3PTA A;  4DA4 A;  1OI1 A;  3MO8 A;  3NTH A;  4OP0 A;  4HA8 A;  3UWN A;  5KE3 A;  3JB9 J;  2HAX A;  3HPW A;  4Z02 A;  2ZZD A;  3FLG A;  1IZ6 A;  2PVG B;  2VGM A;  3DLM A;  3J80 E;  3HSB A;  2EJ9 A;  3OW2 S;  4ME7 A;  2IVW A;  4XK8 E;  1KD1 C;  3PT9 A;  3M4Y A;  3ZBD A;  2RA2 A;  1YIT A;  4L5G A;  1WQ7 A;  4XTX A;  4OGC A;  2I2L A;  1Q81 C;  4HCB A;  3INZ A;  4LD6 A;  2LCL A;  3RMS A;  3PIP A;  1I5L A;  4M75 A;  4C5E A;  1QVP A;  1ZBX A;  1GXI E;  2E41 A;  1YJ9 T;  1RL2 A;  3JRZ A;  5A0D A;  3OYE A;  3V7C A;  3OYI A;  1VQ8 T;  4J8O A;  2PUK B;  3OA6 A;  3GLX A;  5GMK e;  4RCB A;  4EDU A;  4ELY C;  2EKO A;  5D6W A;  1ZQ1 A;  2QTX A;  3E19 A;  3LGL A;  3M57 A;  3M58 A;  3M59 A;  4C92 C;  4LDU A;  4XU3 A;  3MEW A;  3CCM T;  1QVF S;  4N4G A;  1BI1 A;  1WGS A;  3T9N A;  3OBY A;  3WVD B;  2A3L A;  4PKC C;  1X6O A;  4FM4 B;  5CKH A;  2DXU A;  3OS2 A;  3OYM A;  3JAM E;  2K2V A;  3G6E T;  3MP6 A;  3M4G A;  4A4K A;  2FL7 A;  4M77 F;  3CC7 T;  3ASK A;  3CCR A;  4C92 D;  2FVU A;  3QKJ A;  2FB7 A;  2K3Y A;  4Y28 E;  3GPL A;  3RUX A;  3OYF A;  3VUZ A;  1I8F A;  3P8B B;  4QQG A;  3CC2 A;  5J39 A;  3I56 A;  3CBP A;  3OYG A;  3CCQ A;  4JRQ A;  3G6E A;  5GAO n;  4C8Q G;  2DD4 A;  3NFC A;  3OS5 A;  3P8H A;  3OSV A;  1HXD A;  2RJC A;  2V8K A;  1BIB A;  1S72 A;  3CCU A;  1VQL T;  1Q86 U;  2E12 A;  3CPW A;  2KVQ G;  1NPP A;  2P0Q A;  4F7U A;  1W2B S;  4N0A C;  4HT8 A;  4PJO D;  2JOY A;  1K73 C;  4GLK A;  1IRE B;  1VQM T;  4IKF A;  2HNI A;  3CCE A;  4XQ3 A;  4LD9 K;  1MGQ A;  1D3B A;  2PVD B;  3QHS A;  5GMK i;  1UGR B;  3V8L A;  3KUF A;  2MMP A;  4XTZ A;  1YJ9 A;  3CCE T;  4M7D B;  1K9M C;  2DTO A;  1XNI A;  1WJR A;  2G3R A;  4BE1 A;  4C8Q C;  1K9M U;  4M75 C;  2JTM A;  3A8L B;  3OB9 A;  3CCU T;  1YIT T;  1XQH A;  1OZ2 A;  2X4Y A;  2EWN A;  3MEU A;  2LRQ A;  2EJF A;  1N9R A;  2OAU A;  3UPU A;  3JB9 H;  3VJP A;  4BI4 A;  2LT1 A;  3GNG A;  3QJY A;  4J5Y A;  5CAI A;  3GP8 A;  3QUI A;  2DVE A;  3S3M A;  3HRU A;  4C92 F;  1W4S A;  4PJO G;  4J6W A;  5GAN 4;  3OYL A;  1X75 C;  3GIB A;  2RI2 A;  2ZPI B;  5CVI A;  3BDL A;  3MP8 A;  2CZ6 B;  1VQ5 A;  3QXE B;  3TRE A;  3JCM g;  2DXC A;  2V8J A;  2DO3 A;  4KBM B;  5LJ5 j;  3CME A;  3S3O A;  4PJO F;  1N27 A;  2XU8 A;  3N5B B;  5FU6 C;  2L8D A;  3MHX A;  3OBW A;  2M0O A;  2WSE E;  3GOX A;  4M7D D;  5FU6 B;  5I2M A;  4ZGE B;  5AYF A;  4MZP A;  4N0A A;  3FB9 A;  4JS4 A;  4ZN1 A;  2K5I A;  3OS0 A;  2RO0 A;  2RHY A;  4XTY A;  3QBY A;  4FL6 A;  2YLB A;  3M9Q A;  2DXB A;  3LWI A;  1YIJ T;  1VIF A;  4MDX A;  5GAN j;  1BYM A;  2QQR A;  2QA4 A;  4MZT A;  3URG A;  2HQX A;  4M7D C;  1VQ8 A;  2QDY B;  1UEB A;  4LDY A;  5GAO r;  5FU7 C;  3QZ9 B;  3L2V A;  4J83 A;  2RK2 A;  4J7F A;  3I55 T;  2LNV A;  4C8Q B;  5GAN 6;  4M75 E;  1YI2 A;  1QVF A;  1H3Z A;  3A8M B;  2E10 A;  2R5A A;  5DLO A;  4D6W A;  4FSX A;  2LDM A;  4E47 A;  2P0P A;  4EMK A;  5IT9 E;  2ZPG B;  3HHT B;  5LJ3 h;  4BI8 B;  1VQ4 T;  4HT9 A;  3OYJ A;  4P5N A;  1UGS B;  3J7A F;  4NL2 A;  3X20 B;  1NJI U;  5GAO m;  3RKW A;  4M75 F;  5C0M A;  2X4W A;  3OQ5 A;  4E7I A;  2LQ8 A;  1KQ1 A;  4A4H A;  5A2Q E;  1NJI C;  5FRN A;  5CKE A;  4UC4 A;  2RI3 A;  4YTL A;  2E65 A;  5GAN 3;  2JNG A;  4M78 G;  4MML A;  5GAM e;  3J81 E;  3DB3 A;  4Y91 A;  1LNX A;  4GY5 A;  3QII A;  3OYK A;  2DD5 A;  4IUV A;  1M1K U;  2WSC E;  3TEE A;  4ZTF A;  3A8O B;  4M78 E;  4QQ6 A;  3ZEH A;  4BUG A;  3CC4 A;  5D6X A;  3V7R A;  2RJE A;  4II1 A;  2QEX A;  5LJ5 f;  3HL8 A;  1BI0 A;  2HD0 A;  4XTW A;  3VU3 C;  2MI6 A;  3WVE B;  2DIQ A;  1G3S A;  2E64 A;  2B8A A;  2R58 A;  4M77 B;  3G4S T;  4M75 G;  2F69 A;  3V8J A;  2C06 A;  1EIF A;  3SDZ A;  1JRI A;  2O4X B;  3L2Z A;  4E7H A;  3SWN B;  5GAN 5;  5GAN d;  3OY9 A;  3CMA T;  2X4X A;  2EQJ A;  1UGP B;  4DQ2 A;  2DXT A;  2YRV A;  4KUL A;  2EAY A;  3FC3 A;  3MCA B;  1Q7Y C;  4KT0 E;  5LJ5 e;  3LW5 E;  4LDX A;  2R5M A;  3LYI A;  3L42 A;  1VQ4 A;  5EG2 A;  2KY9 A;  4XU0 A;  5LJ5 d;  3NTI A;  3OSS C;  5CQY A;  5GMK m;  3JCM d;  1Q82 C;  2XDB A;  5CCA A;  3CCJ T;  3HKS A;  3JB9 G;  2ZGW A;  2ZCF B;  3BFM A;  4X9C A;  4MMK A;  4TVR A;  1B34 B;  2K4Y A;  1VQ6 A;  5DY9 A;  2K57 A;  2M1H A;  2KSS A;  1NE8 A;  4BE2 A;  5HK0 A;  3V7S A;  3FEO A;  5HY6 A;  3GNF B;  1U8R A;  2V8I A;  3CPF A;  4M7A G;  1WJQ A;  2RI5 A;  3JSC A;  2XDP A;  3OYN A;  2VXE A;  4M75 D;  1YJW A;  4BD3 A;  1Y96 A;  2DZ9 A;  2YLC A;  4OF1 A;  3OYY A;  1JBM A;  4C92 A;  1SSF A;  1BI3 A;  2A7Y A;  4X9D A;  3HRT A;  2QQA A;  1JB0 E;  4C0Z A;  1MHN A;  1K8A C;  1M90 U;  5LJ3 d;  1WNL A;  1VQ7 T;  2VGN A;  3QG1 A;  5CQX A;  4FU6 A;  5FRO A;  4DOW A;  3E9G A;  5CR2 A;  4ZTJ A;  5GAM j;  2P4T A;  4M7A B;  3KXT A;  2PUO B;  4PJO E;  1I4K 1;  1BIA A;  2E70 A;  5DLQ E;  1UB4 A;  2VC8 A;  1M1G A;  2EIF A;  4O6J A;  2M9U A;  3O8V A;  3PNW C;  5I21 A;  4C0F A;  5FRM A;  4XTU A;  1KC8 C;  3EAE A;  3CPW S;  2DK3 A;  1G5V A;  4A53 A;  4C8Q F;  1KC8 U;  4WF2 A;  1VQP A;  1V29 B;  4M7A F;  1VQO A;  3L1A A;  4RMO A;  1VQM A;  3G7Z A;  5CIU A;  5L8R E;  1YJN T;  2FYK A;  4BB7 A;  3CCS T;  1U1S A;  2LVM A;  2RH2 A;  4JRK A;  1VUB A;  1Y96 B;  5CO7 A;  1QVG S;  4FIB A;  2RHX A;  1VQL A;  2Y90 A;  4N4H A;  4PLI A;  3CBM A;  1S72 T;  2ZPB B;  2X35 A;  1Y71 A;  4C92 B;  1VQ5 T;  4M75 B;  1H64 1;  2XK0 A;  4F7U G;  3RKY A;  3CD6 T;  4Q5W A;  4PLL A;  2KDS A;  3L2R A;  3M53 A;  5IAY A;  3I56 T;  3CC2 T;  3Q1J A;  4FT2 A;  2LC4 A;  3M5A A;  4R55 A;  5A0G A;  2QQB A;  3CMA A;  2OTL T;  1N8R C;  4IUQ A;  4XTV A;  5GMK j;  1M9S A;  2AHJ B;  3VUB A;  1M1F A;  2KK4 A;  3DB4 A;  4OB3 B;  5M9O A;  1NPR A;  4EMK C;  3CCR T;  1VQK T;  2DTH A;  2MWO A;  4XU1 A;  3SB2 A;  3S3N A;  2MAM A;  4M7A D;  1B34 A;  5IN1 A;  4EMK B;  4PL6 A;  3C12 A;  3OYB A;  2VUB A;  3EFS A;  4DOV A;  3EFR A;  3OMC A;  1FWZ A;  1KHI A;  4BE0 A;  5LJ5 g;  3UDC A;  1YHQ A;  3VYG A;  1D3B B;  5KCH A;  3CCM A;  3CBO A;  3A5Z B;  1QVG A;  2CGH A;  4J6X A;  3PGG A;  3FDR A;  4M78 B;  3JCM W;  1KHC A;  3RIR A;  5GAN 7;  2GF7 A;  3LLR A;  3PFS A;  3QO3 A;  5GAM g;  1WPY A;  5LL6 S;  2GFU A;  4XU2 A;  4M78 C;  4C92 G;  2P0K A;  5KCO A;  3M56 A;  2K5L A;  4JRI A;  4L59 A;  4A4G A;  2D9T A;  4OVA A;  4BDY A;  4BY6 B;  1QW1 A;  2YHT A;  3M55 A;  4RCC A;  1YHQ T;  2H3J A;  3SWN A;  3MP1 A;  3HFN A;  4MZM A;  4R56 A;  1LOJ A;  3PMT A;  4ZGD B;  5D6Y A;  4M77 E;  1Q7Y U;  2WSF E;  3RER A;  4LDW A;  2BKD N;  3V8K A;  4JLI A;  3CCQ T;  1FX7 A;  2QQ9 A;  2MF2 A;  4OB2 B;  2EJG A;  3WXM B;  1VQK A;  1TH7 A;  4IUR A;  3R6O A;  5GAN g;  2HBP A;  4JS5 A;  4A4F A;  5HKC A;  1WQW A;  5I2S A;  1DJ7 B;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...