5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
3A8MB 3QYHB 2DXCA 3X24B 2ZPHB 4OB1B 2DXBA 2DD5A 4OB2B 1GXIE 1JB0E 2ZPEB 4Y28E 2CZ0B 2CZ6B 3LW5E 3X28B 4OB0B 2ZPBB 1V29B 2PUOB 3X26B 2PVGB 2WSCE 2O01E 3VYGA 3QZ9B 2CZ7B 3WVEB 2CZ1B 1QP3A 2DD4A 3QYGB 2PU9B 2ZCFB 3WVDB 2ZZDA 4KT0E 2PVDB 1QP2A 2WSEE 3A8OB 3A8HB 3X20B 4RKUE 2ZPIB 1PSFA 3A8GB 4L6V5 5L8RE 2WSFE 1UGSB 2QDYB 1AHJB 4FM4B 2CYZB 4OB3B 2PVOB 2PUKB 2ZPFB 3HHTB 3A8LB 1UGQB 4ZGDB 2AHJB 1DJ7B 4XK8E 2DPPB 1UGRB 4ZGEB 1UGPB 3VYHB 3QZ5B 2ZPGB 2D0QB 4ZGJB 1IREB 3QXEB 1PSEA 3X25B
chains in the Genus database with same CATH superfamily
1WIEA 4IUVA 2EYXA 1NYFA 2GNCA 2PZ1A 3QSUA 3OS2A 2E3HA 6AT1B 2DXBA 2LCLA 3MEVA 3CCMA 2LQNA 5GANh 1BI0A 2HCKA 2DXTA 2MK5A 3VRYA 2F69A 1Q81C 2XDPA 3H8ZA 1PD1A 1U1SA 1WJRA 3X26B 1YITA 1KHCA 5FU6C 1I1JA 3BE3A 5GAMg 1B3QA 3JV3A 4MZTA 3CPWP 1PKSA 1NM7A 1WDXA 4AMCA 5FU7B 2DM1A 1KK7A 4C0FA 2ZZDA 4M77A 1U8RA 4C92C 1OX8A 3DLMA 2KNBB 3NHNA 3V8KA 2NUTA 4AG1C 1WHLA 3UA6A 1BBZA 3REBB 3L2ZA 5KYUB 4F04B 5KYWA 4M77B 2KROA 1VQ7T 1KC8R 2DL4A 1ZBJA 3HRTA 3PIPA 2ZAEA 2NUTB 4JLGA 1KSWA 1VQPT 2HSEB 2Y90A 4LDYA 2HL5C 2O31A 4D6WA 2ROTA 2Y4YA 1NPPA 1VQ5Q 3I55A 4OB3B 2B86A 4II1A 3M59A 5KYWB 3EFSA 1YJ9Q 2BZXA 3V7SA 2AZVA 3M57A 4ME7A 1YWPA 3OYGA 1JO8A 1VQ4T 4C0DB 1RAGB 3C12A 2CREA 2YDLA 4M7AB 2GGRA 1GBQA 3S3OA 1Q95G 1R77A 4EMKC 5FWCA 3CCST 2A0FB 5I2MA 3RESA 4F7UE 2D0QB 4ZGJB 2D0NA 1Q81R 4C92D 1ZSZC 2V1QA 4J9EA 3QJ6A 1ZLMA 2M1HA 1ARKA 4M7DF 1K8AR 1XNIA 3CBOA 3UDCA 4Z89A 2RI5A 1WI7A 2HBPA 5GAMe 2ZPEB 1S1NA 3CMAQ 1KD1C 3OS5A 5GAOr 1R0CB 5GANf 3LW5E 5GAOl 4OB0B 3D7SB 2EYQA 2K3BA 3TVTA 3FB9A 3RBBB 2KXCA 2E5QA 2G3RA 1K9MC 4PKCC 4ANJA 2DD4A 2JOYA 2DE0X 1K0SA 1I07A 1I4K1 3RDVA 4QW2A 2HDAA 3EG0A 2XU8A 4MMKA 1LPLA 2QQSA 3PVQA 4KULA 1QP2A 2FPDA 3EGXA 4C0ZA 5FRNA 2DIGA 1N9RA 5GAOq 3G4SQ 1YJWA 4M78C 1VQKA 1MMGA 4E7ZA 3M4YA 2HBWA 2QXFA 2X3WD 1WHGA 4AFUC 1H92A 5I2SA 4HA8A 1G8XA 3WXMB 5DLOA 4M77E 2LDMA 1K4US 1VQNT 2W10A 2IPOB 5L8RE 3EGXB 2P84A 2X4WA 3IQLA 1ZA2B 4PFOA 1KQSP 1Y71A 5I11A 2O88A 2VGNA 2PVOB 1U06A 4JS4A 2E70A 1YIJT 1RAFB 2BZYA 2RQWA 4NS5A 2VUBA 3V7RA 2KXDA 1VQ5T 4M7AE 2EVRA 2HZYA 1GFDA 2CT4A 4M77G 1YJ9T 2RMOA 5FU6B 2RB6A 5CR2A 1SF9A 2KDSA 1E6GA 4Z88A 3HFOA 1G3YA 2WACA 3MCAB 2JW4A 5GJVB 2EQJA 2R5AA 3G1JA 2H3EB 3I5RA 4BY6C 1UJYA 4C92B 4M78D 1W6XA 1K9MR 3VS0A 2RN8A 3BFMA 3M5AA 1MGQA 5GAN8 3SB2A 3F70A 1MNEA 4A54A 2QGGA 3VS3A 3H6ZA 3JCMW 1OZ2A 4IIMA 2E12A 3SWNC 2VWFA 2YT6A 2ZCFB 3URGA 2RHUA 3CMAT 1Q86U 1YP5A 2DZCA 5FLXE 2X4JA 4PL6A 3WVDB 3GNFB 2F2WA 5GAOp 2DLPA 2QDLA 3HP9A 4J6WA 2MYSA 1V76A 3PGGA 5LJ3h 3JRZA 3I35A 4ZNXA 1KG1A 2LCSA 3CC4Q 2HKNA 5CKHA 1ZSZA 3EFOA 2CH4W 1K73U 1R8OB 1WJSA 1C6VX 2DIQA 1G3SA 1SHFA 3AT1B 3LGLA 4ZN3A 2G6FX 4EMKB 3CCEQ 3G4ST 1M9SA 2V1RA 1JQQA 2X9HA 4FW1A 4A4HA 3JAME 1VQ9A 4X9DA 3CCJA 1M1FA 1ZSZB 2M51A 2JJ9A 2COWA 3EGUA 1M4ZA 4QVDA 1YJNQ 1UUEA 2D1XA 3NTHA 1NBEB 3Q1JA 3L2VA 5L23A 3PMIA 3HHTB 3FRNA 3ZBDA 2JZ2A 4J9HA 1VQ8A 3CCRA 5CQXA 3LX7A 4J5YA 2DRMA 4LXCA 3VS2A 3GBQA 1IREB 3PMTA 2DNUA 1D3BA 3CC2A 3FIFA 2JUFA 4M78A 1BI2A 2RQUA 4M7DC 2K3YA 3A8MB 4J9FA 4EPCA 3OMCA 3R6NA 2QQAA 3UF4A 4R56A 2QQBA 1FYNA 4XQ3A 4C8QF 2AKKA 2RO0A 5GANd 2D9TA 4C92E 4M75F 2EYYA 4AFQC 2H8HA 1M3BA 1UHCA 1N8RC 3PTAA 1BCOA 3CMET 2B8AA 4OVAA 3ZL7C 4M78B 2RI2A 2X35A 1GFCA 3L42A 1BIBA 2HQXA 4A4KA 2CP0A 3M0RA 4FSSA 4FCYA 2EBPA 2EIFA 5CIUA 1N5ZA 3V7CA 2YRVA 2EYZA 1PM3A 4OMFB 5I21A 4PFPA 1KJWA 3M56A 2CGHA 1NLOC 2WSEE 2DYBA 1VQ9Q 3JB9J 1RL2A 4FT2A 4NOYA 2E10A 1UGVA 5LJ5h 2K4YA 5CQYA 2EFIA 4JJBA 1UJ0A 4M7DD 4GLKA 4J9BA 1W70A 3G71T 1FWZA 3FJ5A 1M2VA 3CC4T 1PRMC 1UGSB 2VKNA 3M4GA 1XJWB 2DF6A 4FM4B 2MF2A 2AKLA 4Q5WA 4E7IA 4RG8A 4BY6B 2Y4XA 3SWNA 1E7OA 2M16A 4E7LA 3CCET 4XTXA 2YSQA 3REAB 2QA4Q 3OYJA 1VQ7A 3DB3A 4FU6A 1EIFA 1OZ3A 4OMLA 1QVGS 1YJNT 3KBGA 1VQPA 3PNWC 5FW9A 3C4SA 3V8JA 2NWMA 2KSSA 3QUIA 4OB1B 2JM9A 5DLQE 3PVLA 4K11A 4OB2B 3L1AA 1SKUB 2JMCA 1WHHA 3R6OA 5GAOn 3VS7A 1O75A 1VQ4A 2A37A 1QWFA 2GQVA 4DA4A 4KGZB 3UPUA 4C0GA 1MV3A 3CQTA 3OYIA 2CKKA 4M78E 1MUZA 3CCSA 2KT1A 2PNIA 2X4XA 1SSHA 1H8KA 1LCKA 1YI2Q 1JJ2S 1HSQA 2QTXA 4MDXA 4RCCA 4GY5A 3HSBA 5A0LA 1VIEA 1I8FA 4M7AC 1Q7YC 1NJIU 1QVPA 2KBTA 5C0MA 1KHIA 4BI3A 1QWEA 4XU0A 4DBRA 2MCNA 4KH1B 2K2VA 2VXFA 4A4EA 1HYOA 4BUGA 2KMTA 2M0OA 4KRTA 2QASA 3P8BB 4B9WA 1MMNA 3SD4A 1N27A 5J26A 3JB9H 5GAN5 3OYBA 2CP6A 5D6YA 3CXCS 5GMKm 1YHQQ 2ZGWA 3EG3A 1EFNA 2ESWA 3LWIA 1JEGA 4M7DB 3CCLT 3MEAA 2RJCA 2QG9B 4N0AC 2KRNA 1IZ6A 1D0ZA 1QCOA 4J9CA 2LT1A 3DKMA 2LQKA 1K73R 2XK0A 1W2BP 2DL8A 2YRCA 4XK8E 2K9GA 1VQ4Q 1UGRB 1VQNA 3NTKA 3HFNA 2EGEA 2DERA 3CC7Q 3VUBA 4E6RA 2D6FA 3S3MA 3OSVA 4R55A 5CKDA 3X25B 4MMLA 1KC8C 1QVGA 4C8QC 1OPKA 4XTYA 3RUXA 2QA4T 4M75C 1T0HA 1U5SA 1YIJA 2L3RA 1LNXA 2F5TX 3ASKA 4N4GA 4J83A 4PJOF 3X28B 1Y7XA 2DILA 5ECAA 3OB9A 4E7SA 1VQ5A 3QDRB 2HD0A 3TQ7P 5GANj 1YJ9A 1WHMA 3FJPA 1CKBA 4B6MA 2FRYA 3FEOA 3RR6A 2JS2A 2L89A 4OMNA 5CCAA 3RMQA 1JJ2A 2K5IA 1IHWA 2DZ9A 1B7TA 5LJ3d 2COYA 1VYUA 1D09B 1H641 2V8IA 3CCQQ 2CSQA 1W1FA 1BK2A 1YI2T 1V1CA 3ER0A 3RNJA 1K8AC 4OP0A 2O2OA 2K3XA 1T3SA 1PWTA 3JCMd 2FZCB 5EC7A 4JRKA 4F14A 5KH6A 4HCZA 4LDXA 5KYUA 3VS4A 2SEMA 3CMAA 3CCUT 4C8QD 5GMKh 1VQNQ 4M75D 2RD1A 5KCHA 1ZUYA 2L8DA 4C5GA 5J3BA 2ZPFB 4M7DE 5IHKA 4BE0A 1M90U 1WA7A 2JN0A 3CXCA 4QVZA 4C5HA 1D1BA 1XOVA 1UTIA 3A1PA 3GNGA 1YHQT 1GCQA 1YIJQ 2BE9B 4M7AA 4JDSA 2DVJA 2R5MA 2L2PA 2ZPGB 3QDFA 2O9SA 4KGXB 1I0CA 3G4SA 5GJWB 1BYMA 2IVWA 1ZQ1A 3NMZC 1M5Q1 4J7IA 5KE2A 4XTWA 4FW2A 2E3IA 2H3JA 1T3LA 2JS0A 5IAYA 2GBQA 4PLIA 1GXIE 1S72T 3CC7T 1TXQA 3NFCA 2W0ZA 1NZ9A 2C0OA 2XICA 1WXBA 2DTHA 5AT1B 5IXBA 1SG5A 1T0JA 2O01E 4P5NA 1AEYA 2PQWA 4E47A 3JCMV 4N0AA 2DL5A 2E6NA 4DBQA 2YLBA 1NPRA 1K1ZA 3C95A 1ABOA 1M1KR 3MP6A 1X01A 4QQGA 3CMEA 3X20B 1WXTA 3LH5A 2M0YA 3CPWS 2E65A 3M55A 3UATA 3OS1A 2YWWA 5LJ5d 4C8QA 2QI2A 1PSFA 4F7UG 4M75A 2KYBA 4ELZC 2LQWA 5IHIA 5HK3A 2RJEA 4RTWA 3JCMb 4IUTA 3CCQT 2LCCA 5M9OA 2BZ8A 3RKXA 4LDVA 4C8QB 2KK4A 1NE8A 2AT1B 4M75B 1HK9A 2L5QA 3GPLA 2OAWA 2LP5A 2QK0A 5HY6A 2FPEA 3CPFA 1NG2A 1N9SA 1R0BG 1RI0A 3G71A 2DBKA 1QMCA 3H0HA 4MZPA 3P8DA 3CC4A 2ED0A 3QBYA 3EAEA 4J6XA 1PSEA 4A4FA 1IGUA 4D8DA 1WGSA 4KUIA 3BY7A 4RTVA 4Z8AA 1G83A 1Y96A 2YXYA 3OY9A 3FDRA 4PJOC 4BACA 2DA9A 1X6GA 1WYXA 1VQOT 1B07A 2XMFA 4C92A 3CCEA 3OW2A 3JB9G 4RUGA 3KXTA 2E4HA 5EG2A 1G2BA 2J6KA 1VIFA 3CMEQ 1YJNA 1JU5C 2X3XD 3O8VA 1TOVA 5GANe 1Y96B 2BE7D 4D8KA 1BI1A 3QYGB 2V8KA 3NPFA 1WX6A 1WPYA 3HTRA 2VV5A 2RPNA 2MMPA 1OEBA 2PVDB 1M8VA 2KYMA 2V8JA 4HCCA 3E2UA 3QHSA 4FSXA 4FYWB 3KFVA 3JCMQ 3T9NA 4M7AG 1WFWA 3QO3A 1X43A 3G7ZA 4CI0C 3A8GB 1PNJA 3CPWA 1SRLA 3GOXA 2VASA 2WSFE 2EWNA 1D0XA 2RK1A 4EMKA 3OYMA 2J6FA 4PJOD 4X1VA 3G71Q 1X75C 2ENMA 2AK5A 3RMSA 4C8QE 1WZOA 3JCMh 4E7JA 4M4ZA 4M75E 3BW1A 2EPDA 3A8LB 2DX1A 2EJ9A 3LWHA 4RTXA 1QVFS 1RAAB 2DPPB 2C06A 1UGPB 3A5ZB 3S3NA 1YN8A 2QAZA 1B34A 2CP7A 2JT4A 2K5FA 4DOWA 5GAN2 2J05A 3QWYA 3JCMc 3CCLA 2BUDA 4J8OA 1WJQA 1UG1A 3OSSC 2YUOA 1KIKA 4M75G 1VQMQ 1B34B 4NL3A 2MPXC 3TEEA 1WXUA 2FHDA 2PUOB 4O6JA 1IB8A 1ABQA 1ZHIA 2I0NA 1WHJA 4MZMA 2CZ1B 2XIDA 2LT4A 4FYYB 2NYSA 2EQMA 1Q82U 1VQ6Q 1OYXA 1U3OA 3VRZA 3MP1A 7AT1B 2QA4A 2P0KA 2IIMA 1VYVA 3EH1A 3LGFA 2LNHB 4DEXA 3VS5A 3UWNA 5GAN6 1PG5B 1FMWA 3ME9A 3INZA 2ZPIB 4Z02A 1U1TA 4BI8B 4OMOA 1M8MA 4PJOA 3NTIA 2EQIA 3TSZA 2QQ9A 3J7AF 4XU1A 3VV0A 2DTOA 2CS7A 4C92G 2QEXQ 4LD9K 5LJ3f 1OPLA 1MV0B 1KFZA 1YI2A 5IXFA 2IG0A 3E9GA 3CCLQ 4PJOB 5LL6S 2XG8D 4XU2A 4PJNA 3JCMf 3M0UA 1UB4A 4X9CA 1GBRA 5GMKi 1LOJA 2DL3A 2KAFA 4KGVB 3DLLA 2DL7A 2XKOC 4PK4A 1OULA 3CCUA 4QVCA 1AZEA 3M0PA 2D8JA 1TUGB 2QTVA 4LDUA 2JMAA 3QXEB 2OTLT 1J3TA 1QVFA 1KQSA 4IUPA 5KCOA 2CP5A 1JXOA 5FRMA 2BKDN 4V2SA 1YCSB 2RNAA 1YHQA 2ZPBB 4BDZA 1PD0A 4BI4A 4OMPA 5CVIA 2WSCE 4J9IA 1RI9A 3H0FA 3QZ9B 2RH2A 4IIOA 4JPBW 1QP3A 3OYKA 1PRLC 1K73C 1M3AA 1I5OB 4LNPA 2LJ0A 1VQMT 1Q81U 1PCXA 3LH0A 3QG1A 2DRKA 1QCFA 5KYYA 3A8OB 2J7IA 1AOJA 1IHVA 1S72A 2DO3A 3CC7A 2JVVA 4GBQA 5CKEA 4HVUA 2R57A 3MHXA 4J9DA 1OV3A 1VQ6T 2EQUA 4HT9A 5LJ3e 1K0XA 3M54A 3JCMX 5KYYB 3PIOA 1BIAA 4XTUA 2CSIA 3JB9I 2QDYB 1NEBA 3L2UA 2F2VA 1VUBA 1AHJB 4J6YA 1TS9A 3CCUQ 3V8LA 4R0KA 3H41A 2BTTA 4M7DA 4J7FA 1EX4A 1MMDA 3MJXA 4C5EA 4TVRA 4EMHA 2KE9A 5LJ5f 4M78G 4PJOE 1AWJA 1IRXA 3FLGA 4WCIA 3JCMJ 2CP2A 2X51A 1W4SA 1NLPC 3M9QA 2ABLA 3E19A 2LRQA 2QEXT 2C0IA 1Q86R 1OU8A 5GAMh 4BE1A 3L2QA 2K7AA 3AHUA 3PFSA 3G6EQ 3CCQA 3VUZA 3VYGA 2A3LA 2KI7A 5HCKA 3GF5A 2ZPHB 2JXBA 2ED1A 2FYKA 4HCBA 3RKWA 3OS0A 5FROA 4BB7A 3SFMA 1HD3A 3RERA 2F5KA 4ESRA 1X6OA 1S72Q 2KRMA 2EQKA 1JBMA 4RTTA 4FL6A 3VJPA 1VQ8T 3LLRA 4OF1A 3CCVT 2DJQA 4PJMA 1KD1U 2P4TA 2RJFA 5IT9E 5A0DA 1BB9A 3GIBA 1VQLQ 1TG0A 2YHTA 2LNVA 4QT7A 1VQOA 1D1AA 5GAN7 4FIBA 4DOVA 2VB6A 8ATCB 4LDWA 3EG2A 5GAN3 1Y07A 3CBPA 2MOXA 1WQ7A 1K9MU 1SEMA 4RTYA 2MWOA 4XTVA 1Q82R 3EGDA 5GAOm 5CKFA 2DFUA 5LJ5e 4J9GA 4HKEA 2C0TA 5FWBA 4EDUA 2F2XA 3LYIA 2XI9A 1SSFA 1VOMA 2JNGA 3OYYA 5GMKj 4ELYC 2NUZA 3TREA 1UGQB 3EGDB 3TSWA 4ZGDB 4RMOA 1M1KC 1AZGB 4HVVA 1UE9A 3SHWA 2HNIA 3S6WA 5IHNA 3CEYA 1O9SA 2D8HA 3L2RA 2K2MA 5I22A 1OOTA 1YNZA 2KEAA 4VUBA 3UT1A 4BDYA 4A53A 5GAMf 2RA2A 1ZUUA 1Z9QA 2LQ8A 2JTFA 1M2OA 2K5LA 2KY9A 2VYTA 3JSCA 2OTJQ 4QQ6A 4E2FB 1FXXA 2FEIA 2E41A 1JRIA 4Y91A 3I56Q 3QIIA 1W2BS 3CD6Q 3MO8A 4DBHA 2DJZA 1I5LA 2RHZA 1G3WA 4FYXB 5GMKl 3G6ET 2RJDA 1OI1A 3C0CA 2DAQA 1VQOQ 5DY9A 1NJIC 4JRQA 4LD6A 4HCKA 2PVGB 2COZA 2GF7A 2RI3A 3U23A 1TSFA 4OMQA 2GFUA 3THKA 1FX7A 3OW2S 2PU9B 3RIRA 1IXDA 2JM8A 1F1BB 5A2QE 4M7DG 2GQIA 3BDLA 1UEBA 3OYNA 2ECZA 4RTZA 1G3TA 4OMMA 2XD0A 4QQDA 2YLCA 1BU1A 3ZEHA 2GTOA 4RKUE 1OU9A 1H3ZA 2K57A 2I2LA 3PT9A 2RHXA 3CCMQ 1VQLT 4IUQA 4KUDK 3M0QA 4XU3A 4ZTFA 4L5GA 4AT1B 3OYFA 4OGCA 4CC4B 2MI6A 2LTOA 1AT1B 4DQ2A 2LX9A 2DYIA 5GANg 5GAN4 4MDWA 1HXDA 1TTHB 1YITQ 4JRPA 1ZA1B 1Y57A 5D6WA 1HJDA 4HXJA 2OAUA 4DBFA 1ZX6A 4WTOB 2E6ZA 2HKQB 1C1AA 2A08A 2LMJA 1EZZB 4JJDA 2NUPA 1XTDA 1IO6A 3QZ5B 4IURA 5D7UA 2FL7A 5HKCA 1IGQA 4UC4A 4CC2A 1MHNA 1MNDA 2RM4A 1RADB 1TUDA 2A36A 1NJIR 1NYGA 3OBWA 2X4YA 1KQ2A 4IKFA 2L0AA 1QW1A 2LC4A 1Z9ZA 4JUVA 4FYVB 2VGMA 2DK3A 2NUPB 1M1GA 2RQTA 2CUBA 4FT4A 2FPFA 1X69A 1AVZC 3DB4A 1SHGA 1W2BA 3I55Q 2CH4A 2OTJT 1MMAA 2F1LA 3J81E 5J39A 1XQHA 4KH0B 4F7UF 1WLPB 3I56T 2CUDA 3CD6T 1WHKA 4EIKA 2KRSA 4E7KA 2OTLA 3ULRB 4ZTJA 3QWXX 3OYHA 1N8RU 4KT0E 2RK2A 3OYCA 1QVFP 1KQ1A 4F17A 4X34A 2PTKA 3M53A 2ROLA 2KT8A 3QJYA 1ZUKA 1AWXA 3TU4K 1PHTA 4EMGA 1LVKA 2EYWA 4HT8A 1M90C 3VKIA 3HL8A 1WNLA 4O5VA 1PKTA 2FVUA 5D6XA 4JJCA 1GRIA 1VQMA 1KD1R 3O5ZA 3EFRA 2CYZB 2FG0A 2KR3A 3A98A 3OYLA 4BD3A 1TH7A 3CCMT 2OI3A 3OYAA 1G5VA 5GMKe 1VQ6A 3JB9F 2J6OA 3MKDA 1NEGA 2DTIA 1RACB 5LJ3j 1AD5A 1YBYA 4M77F 1YITT 2AIRB 2MWPA 3META 2MIOA 3VYHB 1YCYA 3SDZA 4PNOA 5GAMd 4LN2A 2M02A 1YJWQ 1VQKQ 4AG2C 1CKAA 1JXMA 3EG1A 3QYHB 2DXCA 1M30A 2YUNA 4N4IA 2OTLQ 2DVEA 4IUUA 1JB0E 2JTMA 1VYTA 2CZ0B 1X2QA 1KQSS 1TU0B 1OQKA 4M7AF 4AFZC 8AT1B 1P92A 2K79A 1ZBXA 2HMAA 2QEXA 2EKOA 2CZ7B 3WVEB 4E7HA 2RHIA 2FZGB 1FMKA 4JLIA 5KE3A 2LVMA 3MP8A 3J80E 1M90R 5A0GA 1YFNA 4C8QG 3I55T 2J06A 3BDUA 2DXUA 2HL3A 5CKBA 3EFOB 3EH2A 3A8HB 4PJJA 3E9FA 2LX7A 1UDLA 2M9UA 2KQWA 3E1SA 2AZSA 3H9NA 4RCBA 3OBYA 1QQJA 4A4GA 5CO7A 4PLLA 3CCVA 3MEUA 4C5IA 3MEWA 1Q7YU 4A63B 3HPWA 3L2WA 1QVGP 2YUQA 1QKXA 1D0YA 1E6HA 1QCNA 2DEUA 2OJ2A 3QPHA 3N5BB 4JJNK 4YTLA 4GLMA 4N4HA 1X27A 4ORZA 2A28A 4ZGEB 1D3BB 2KGTA 1RAHB 3OQ5A 9ATCB 5DM7R 5LJ5j 3EHRA 4AFSC 1QLYA 2LJ3A 4QKUA 1BCMA 5LJ3g 3X24B 2EJFA 2EKHA 4DEYA 1I81A 3I9QA 2DD5A 1JJ2P 2CDTA 4NL2A 4JZ3A 3JCMg 3I5SA 2L3PA 3EHQA 4ZN1A 3GLXA 1YJWT 1GCPA 1VQKT 1RUWA 1PC0A 1TUCA 1V29B 2SRCA 3CCJQ 5KYNA 1KC8U 3SEMA 1UFFA 3VS6A 2DETA 2GFAA 5KYXA 1WQWA 4OGEA 1VA7A 2O4XA 3FC3A 1TWBA 1VQ8Q 1CSKA 1Q86C 2V26A 4PFZA 3CCRQ 3CCVQ 4LUDA 4C92F 1M3CA 1H3HA 4KBMB 3CXCP 3H0IA 3CC2Q 3G6EA 3QKJA 5KYXB 2E1HA 2KVQG 2Z0WA 2DKGA 2O4XB 2HQEA 1ACMB 5FU7C 4XAXB 1M2VB 3HRUA 1K9AA 4ATOA 1RAEB 1C0MA 5CK9A 2O9VA 2K6DA 4LUEA 2GCXA 2A7YA 1N8RR 2QQRA 1YWOA 1K8AU 2PUKB 2XHCA 2MAMA 3P8HA 3VU3C 1RAIB 3SWNB 3HKSA 1BKBA 3UA7A 2NLUA 2XDBA 2E64A 1M1KU 2E5KA 4M77C 3HRSA 3OYDA 2HSPA 2ATCB 2P0PA 1GL5A 4JZ4A 1VQLA 2VXEA 3EG9A 3TCJA 2QYZA 1OX9A 2FZKB 3JCMe 2VVKA 2CP3A 1AWWA 2GTJA 2L3SA 1RABB 2FO0A 5CAIA 3M58A 2BIVA 2EJGA 3GP8A 2CT3A 1FMVA 1GCQC 1Q82C 5AYFA 2RHYA 1RLPC 4C0DC 5GAMj 1UECA 4HVWA 1Y0MA 4Y28E 5LJ5g 1UHFA 3EG9B 1RLQC 1M27C 4BE2A 2CZ6B 3OMGA 3VS1A 2HAXA 3RKYA 2P0QA 3OYEA 2LZ6B 2LJ1A 5IN1A 4F16A 4JS5A 2DEQA 3C94A 4WF2A 1AWOA 4RG2A 2VC8A 4JRIA 2EW3A 1VQ9T 3JCMP 3MPUB 3CCJT 1A0NB 1VQ7Q 3JB9D 3ZFJA 4CC3A 2FB7A 2R58A 1VQPQ 4M77D 4PJOG 1D1CA 1SRMA 2L3QA 2QGFB 2XDDA 2HQHA 4CRIA 2EAYA 1X6BA 2RF0A 4M78F 2OTJA 2EGAA 1QKWA 3CCRT 3I56A 1SPKA 4L59A 4L6V5 2RQVA 3CD6A 5C6SA 1N6AA 2HEQA 2JTEA 3KUFA 3CC2T 5HK0A 3NGPA 1BI3A 5IH2A 2DBMA 2RQRA 1ZSGA 4F7UA 4LE9A 4B9XA 4XTZA 3M0TA 1K76A 3CCSQ 2FRWA 4M7AD 2YRDA 2DMOA 2YUPA 3M0SA 4CC7A 3OW2P 3PE0A 4Y92A 1LJOA 2AHJB 2OX7A 2P4RA 1DJ7B 4F7UB 3CBMA 3OA6A 4PJLA 1X2KA 4RTUA 1Q7YR 2EGCA
chains in the Genus database with same CATH topology
2KSSA 4IUVA 3QUIA 3OBWA 4OB1B 3JCMc 2X4YA 2BUDA 3OS2A 3CCLA 3QSUA 2DXBA 2LCLA 3MEVA 5DLQE 3CCMA 4J8OA 1KQ2A 4IKFA 4OB2B 3L1AA 5GANh 1WJQA 1QW1A 1BI0A 2LC4A 4JUVA 2DXTA 3OSSC 3R6OA 5GAOn 2VGMA 2DK3A 2F69A 1O75A 1Q81C 1VQ4A 2XDPA 3H8ZA 1M1GA 1U1SA 4M75G 1B34B 2GQVA 4NL3A 4DA4A 3TEEA 4FT4A 3UPUA 3DB4A 4C0GA 1W2BA 2FHDA 3OYIA 1WJRA 2PUOB 3X26B 2CKKA 4O6JA 1KHCA 4M78E 1YITA 2OTJT 3J81E 5FU6C 5J39A 1XQHA 3CCSA 2X4XA 1ZHIA 4F7UF 3I56T 4MZMA 5GAMg 4MZTA 2CZ1B 2XIDA 3CD6T 2LT4A 1JJ2S 2EQMA 5FU7B 1Q82U 4C0FA 2QTXA 4E7KA 4RCCA 2OTLA 4MDXA 4GY5A 1OYXA 4ZTJA 2ZZDA 3HSBA 4M77A 1U8RA 3OYHA 5A0LA 1N8RU 4C92C 1VIEA 1I8FA 3MP1A 2QA4A 4KT0E 2P0KA 2RK2A 3DLMA 3V8KA 3OYCA 4M7AC 3LGFA 1Q7YC 1NJIU 1QVPA 1KQ1A 5C0MA 1KHIA 4BI3A 4X34A 4XU0A 3M53A 3UWNA 5GAN6 3QJYA 2K2VA 2VXFA 3L2ZA 3TU4K 4EMGA 3ME9A 4A4EA 4HT8A 3INZA 2ZPIB 4BUGA 4Z02A 1M90C 2KMTA 4M77B 2M0OA 3VKIA 1U1TA 1VQ7T 3HL8A 3P8BB 1WNLA 3HRTA 4B9WA 4BI8B 3PIPA 4PJOA 4JLGA 3SD4A 4O5VA 1VQPT 1N27A 3NTIA 2Y90A 2FVUA 5J26A 5D6XA 3JB9H 2QQ9A 5GAN5 4LDYA 5D6YA 3OYBA 3CXCS 5GMKm 4XU1A 1VQMA 2ZGWA 3J7AF 4D6WA 2Y4YA 1NPPA 3VV0A 3EFRA 3LWIA 2DTOA 2CYZB 3I55A 4M7DB 4OB3B 2CS7A 4C92G 3CCLT 4LD9K 4II1A 3MEAA 3M59A 3OYLA 3EFSA 1TH7A 5LJ3f 4BD3A 3CCMT 3V7SA 2RJCA 3M57A 4ME7A 3OYAA 4N0AC 1YI2A 2IG0A 1IZ6A 3E9GA 3OYGA 4PJOB 1G5VA 1VQ4T 5LL6S 2LT1A 2XG8D 4XU2A 4C0DB 5GMKe 1VQ6A 3JB9F 3JCMf 3C12A 3DKMA 2LQKA 1UB4A 2DTIA 4X9CA 4M7AB 5LJ3j 2XK0A 1YBYA 5GMKi 4M77F 3S3OA 4XK8E 1LOJA 1YITT 1UGRB 4EMKC 1VQNA 3NTKA 2MWPA 3HFNA 2KAFA 3META 1YCYA 3SDZA 3VYHB 3DLLA 5I2MA 3CCST 4PNOA 2XKOC 3RESA 5GAMd 4F7UE 2D0QB 3VUBA 4ZGJB 2D6FA 3CCUA 4QVCA 3S3MA 3OSVA 4C92D 4LDUA 3QXEB 4M78A 4R55A 5CKDA 2OTLT 3X25B 1QVFA 1KQSA 4IUPA 3QJ6A 5KCOA 4MMLA 1KC8C 3QYHB 2DXCA 4XTYA 4C8QC 2M1HA 1QVGA 3RUXA 2QA4T 4M7DF 1XNIA 4M75C 5FRMA 4N4IA 3CBOA 3UDCA 2BKDN 2HBPA 2RI5A 2DVEA 4IUUA 5GAMe 1JB0E 2JTMA 2ZPEB 1YIJA 4V2SA 1KD1C 2L3RA 1LNXA 2F5TX 3ASKA 3OS5A 4J83A 4N4GA 2CZ0B 5GAOr 5GANf 4PJOF 3LW5E 5GAOl 1KQSS 3X28B 4OB0B 1Y7XA 1YHQA 2ZPBB 4BDZA 4M7AF 2EYQA 3OB9A 1VQ5A 1P92A 3FB9A 1ZBXA 4BI4A 3QDRB 5CVIA 2QEXA 2WSCE 2EKOA 2HD0A 3QZ9B 2CZ7B 5GANj 1YJ9A 2E5QA 2RH2A 2G3RA 3WVEB 4E7HA 1K9MC 4PKCC 1QP3A 2DD4A 3FJPA 2JOYA 3OYKA 1K73C 2RHIA 3FEOA 1I4K1 4JLIA 5KE3A 4QW2A 2LVMA 1VQMT 1Q81U 4MMKA 2XU8A 3MP8A 3J80E 5A0GA 2QQSA 2L89A 3LH0A 3QG1A 4C8QG 4KULA 3I55T 5CCAA 1QP2A 3RMQA 3BDUA 2DXUA 3A8OB 4C0ZA 2K5IA 1JJ2A 5FRNA 2DIGA 2DZ9A 1N9RA 1S72A 5CKBA 2DO3A 5LJ3d 5GAOq 3CC7A 2JVVA 5CKEA 3A8HB 1YJWA 2R57A 1H641 3E9FA 2V8IA 3MHXA 4M78C 1YI2T 1VQKA 3M4YA 2QXFA 3ER0A 1K8AC 4OP0A 2M9UA 2KQWA 1VQ6T 2K3XA 5I2SA 3E1SA 4HA8A 3JCMd 4JRKA 4RCBA 3WXMB 5KH6A 5DLOA 4HCZA 3OBYA 2EQUA 4LDXA 4M77E 2LDMA 1VQNT 4HT9A 5LJ3e 4A4GA 3M54A 3JCMX 5L8RE 5CO7A 3CMAA 2X4WA 1BIAA 4PLLA 3PIOA 3MEUA 4C5IA 4XTUA 4C8QD 3CCUT 3CCVA 3MEWA 1Q7YU 3HPWA 5GMKh 3JB9I 2QDYB 4M75D 2RD1A 3L2UA 5KCHA 1Y71A 3L2WA 1VUBA 1AHJB 2L8DA 2VGNA 4J6YA 2PVOB 4C5GA 5J3BA 2ZPFB 3V8LA 4JS4A 4M7DE 4BE0A 1M90U 2JN0A 3CXCA 4M7DA 4J7FA 2E70A 1YIJT 4QVZA 4C5EA 4TVRA 4C5HA 4EMHA 4NS5A 1XOVA 3QPHA 5LJ5f 4M78G 3N5BB 4PJOE 4JJNK 2VUBA 3FLGA 3GNGA 4YTLA 3V7RA 3JCMJ 1YHQT 4N4HA 1VQ5T 4M7AE 1W4SA 3M9QA 3E19A 2LRQA 2QEXT 4ZGEB 4M7AA 1D3BB 4JDSA 4M77G 2R5MA 5GAMh 1YJ9T 4BE1A 3OQ5A 5DM7R 2ZPGB 3L2QA 3AHUA 3CC2A 5FU6B 5LJ5j 2RB6A 3PFSA 3G4SA 5CR2A 2KDSA 3CCQA 3HFOA 1G3YA 2IVWA 1BYMA 3VUZA 3VYGA 1ZQ1A 1M5Q1 2A3LA 4J7IA 5KE2A 2WACA 3GF5A 3MCAB 3X24B 2EJFA 4XTWA 5LJ3g 1I81A 2ZPHB 2H3JA 2EQJA 2R5AA 4BY6C 2FYKA 4HCBA 5IAYA 2DD5A 4C92B 4M78D 4NL2A 3RKWA 4PLIA 3OS0A 1GXIE 4J6XA 3JCMg 3BFMA 5FROA 1S72T 3M5AA 4BB7A 3CC7T 1MGQA 3NFCA 3GLXA 3SFMA 4ZN1A 5GAN8 1YJWT 1VQKT 3SB2A 3F70A 3RERA 2F5KA 1V29B 1NZ9A 1X6OA 2XICA 4A54A 2EQKA 2DTHA 1JBMA 4FL6A 1KC8U 2O01E 3VJPA 3H6ZA 4P5NA 3JCMW 2PQWA 4E47A 1VQ8T 1OZ2A 3LLRA 4OF1A 2GFAA 3JCMV 2E12A 3SWNC 3URGA 2ZCFB 3CMAT 2RHUA 1WQWA 4N0AA 4OGEA 2O4XA 3CCVT 3FC3A 1Q86U 2DZCA 5FLXE 2X4JA 4PL6A 3WVDB 1KD1U 3GNFB 2P4TA 2RJFA 5IT9E 2E6NA 1Q86C 5A0DA 2YLBA 1NPRA 5GAOp 3HP9A 3C95A 3GIBA 4J6WA 4C92F 3PGGA 2YHTA 5LJ3h 3JRZA 2LNVA 4KBMB 1VQOA 1KG1A 5GAN7 3MP6A 1X01A 4FIBA 4QQGA 4DOVA 3CMEA 5CKHA 4LDWA 3X20B 3G6EA 3QKJA 5GAN3 3CPWS 1Y07A 2E65A 3CBPA 1WQ7A 3M55A 3OS1A 1K9MU 2E1HA 2KVQG 2DKGA 2O4XB 1K73U 5LJ5d 1R8OB 1WJSA 4C8QA 2HQEA 2QI2A 1PSFA 2DIQA 1G3SA 4F7UG 4M75A 5FU7C 4XAXB 3LGLA 4ELZC 3HRUA 2MWOA 4ATOA 4ZN3A 5CK9A 4EMKB 4XTVA 2RJEA 5HK3A 3G4ST 3JCMb 1M9SA 4IUTA 3CCQT 2GCXA 5GAOm 4A4HA 5CKFA 3JAME 1VQ9A 2A7YA 2LCCA 5LJ5e 5M9OA 4X9DA 3CCJA 1M1FA 2QQRA 4HKEA 4EDUA 1K8AU 2PUKB 2XHCA 2MAMA 3P8HA 1M4ZA 3RKXA 4LDVA 3VU3C 3LYIA 4QVDA 4C8QB 3SWNB 2KK4A 1BKBA 1NE8A 2XI9A 3HKSA 1SSFA 3NTHA 3Q1JA 4M75B 2NLUA 3L2VA 2XDBA 3PMIA 3HHTB 2E64A 1HK9A 2JNGA 2L5QA 1M1KU 3OYYA 5GMKj 3FRNA 3ZBDA 4ELYC 4M77C 3GPLA 3HRSA 3TREA 2JZ2A 3OYDA 1UGQB 4RMOA 4ZGDB 1M1KC 1VQ8A 5HY6A 2P0PA 3CCRA 2HNIA 5CQXA 3S6WA 3CPFA 3LX7A 3CEYA 4J5YA 1VQLA 1O9SA 2VXEA 3TCJA 3L2RA 1N9SA 1RI0A 3G71A 4VUBA 3UT1A 3JCMe 4BDYA 1IREB 4MZPA 3P8DA 3CC4A 3PMTA 4A53A 1D3BA 5GAMf 3FIFA 2RA2A 2JUFA 1BI2A 1PSEA 2JTFA 2BIVA 2LQ8A 2K5LA 2K3YA 3EAEA 3M58A 4A4FA 4M7DC 1WGSA 2KY9A 2VYTA 3A8MB 3JSCA 4KUIA 4EPCA 4QQ6A 3OMCA 1FXXA 2EJGA 2QQAA 3BY7A 2E41A 1JRIA 4R56A 3GP8A 2QQBA 1Y96A 4Y91A 4XQ3A 4C8QF 3OY9A 3QIIA 3FDRA 1W2BS 5AYFA 2RHYA 1Q82C 4PJOC 4C0DC 2RO0A 5GAMj 2D9TA 4C92E 5GANd 3MO8A 4M75F 4Y28E 5LJ5g 4BACA 1VQOT 2DJZA 1I5LA 2RHZA 1N8RC 1G3WA 4C92A 3CCEA 2CZ6B 4BE2A 3PTAA 3CMET 3OW2A 5GMKl 3JB9G 3OMGA 3G6ET 3KXTA 2HAXA 2B8AA 2P0QA 3RKYA 2RJDA 4OVAA 5EG2A 3OYEA 1OI1A 4M78B 2DAQA 5DY9A 1NJIC 2RI2A 5IN1A 4JRQA 4LD6A 2PVGB 2X35A 1VIFA 2GF7A 2RI3A 3L42A 1BIBA 2HQXA 1YJNA 4A4KA 3O8VA 4JS5A 2DEQA 3C94A 5GANe 1Y96B 2GFUA 1FX7A 2EIFA 4WF2A 1BI1A 3QYGB 2V8KA 2PU9B 5CIUA 3OW2S 3RIRA 4RG2A 3V7CA 2YRVA 2VC8A 4JRIA 1WPYA 2VV5A 5A2QE 2MMPA 4M7DG 1VQ9T 3BDLA 4OMFB 1UEBA 5I21A 3OYNA 3M56A 3CCJT 3JCMP 3JB9D 2CGHA 2PVDB 2WSEE 1M8VA 3ZFJA 2V8JA 1G3TA 4HCCA 2FB7A 2XD0A 2R58A 4QQDA 4M77D 3JB9J 3QHSA 4PJOG 1RL2A 4FSXA 2YLCA 4FT2A 4NOYA 3JCMQ 2XDDA 3ZEHA 2E10A 4RKUE 3T9NA 4CRIA 4M7AG 2EAYA 1H3ZA 5LJ5h 2K4YA 4M78F 2K57A 3QO3A 2OTJA 2I2LA 5CQYA 3PT9A 2RHXA 3CCRT 3G7ZA 4CI0C 3I56A 2EFIA 3A8GB 4IUQA 1VQLT 4L59A 3QBYA 4L6V5 4KUDK 3CPWA 3CD6A 4GLKA 4XU3A 5C6SA 3GOXA 4ZTFA 4M7DD 1N6AA 4L5GA 3G71T 1FWZA 3OYFA 3KUFA 4OGCA 3CC4T 2WSFE 2MI6A 1UGSB 2LTOA 5HK0A 3CC2T 2EWNA 4DQ2A 1BI3A 2LX9A 2RK1A 3M4GA 5GANg 5GAN4 4EMKA 3OYMA 4MDWA 1HXDA 4PJOD 4FM4B 1X75C 4JRPA 4F7UA 4B9XA 4XTZA 3RMSA 2MF2A 5D6WA 4M7AD 4Q5WA 4C8QE 4E7IA 4RG8A 3JCMh 4BY6B 4E7JA 2Y4XA 4M75E 2OAUA 3SWNA 3BW1A 2M16A 4E7LA 3CCET 5CAIA 3A8LB 1LJOA 2EJ9A 4XTXA 3LWHA 2E6ZA 2AHJB 1QVFS 1DJ7B 3OYJA 1VQ7A 3DB3A 2DPPB 4FU6A 1EIFA 1OZ3A 1QVGS 2C06A 1UGPB 3A5ZB 1YJNT 4F7UB 3S3NA 3CBMA 3KBGA 1XTDA 3QZ5B 3PNWC 4IURA 1VQPA 3OA6A 2FL7A 5HKCA 1B34A 3C4SA 2K5FA 4UC4A 3V8JA 1MHNA 2RM4A 4DOWA 5GAN2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8M B;  3QYH B;  2DXC A;  3X24 B;  2ZPH B;  4OB1 B;  2DXB A;  2DD5 A;  4OB2 B;  1GXI E;  1JB0 E;  2ZPE B;  4Y28 E;  2CZ0 B;  2CZ6 B;  3LW5 E;  3X28 B;  4OB0 B;  2ZPB B;  1V29 B;  2PUO B;  3X26 B;  2PVG B;  2WSC E;  2O01 E;  3VYG A;  3QZ9 B;  2CZ7 B;  3WVE B;  2CZ1 B;  1QP3 A;  2DD4 A;  3QYG B;  2PU9 B;  2ZCF B;  3WVD B;  2ZZD A;  4KT0 E;  2PVD B;  1QP2 A;  2WSE E;  3A8O B;  3A8H B;  3X20 B;  4RKU E;  2ZPI B;  1PSF A;  3A8G B;  4L6V 5;  5L8R E;  2WSF E;  1UGS B;  2QDY B;  1AHJ B;  4FM4 B;  2CYZ B;  4OB3 B;  2PVO B;  2PUK B;  2ZPF B;  3HHT B;  3A8L B;  1UGQ B;  4ZGD B;  2AHJ B;  1DJ7 B;  4XK8 E;  2DPP B;  1UGR B;  4ZGE B;  1UGP B;  3VYH B;  3QZ5 B;  2ZPG B;  2D0Q B;  4ZGJ B;  1IRE B;  3QXE B;  1PSE A;  3X25 B; 
#chains in the Genus database with same CATH topology
 1WIE A;  4IUV A;  2EYX A;  1NYF A;  2GNC A;  2PZ1 A;  3QSU A;  3OS2 A;  2E3H A;  6AT1 B;  2DXB A;  2LCL A;  3MEV A;  3CCM A;  2LQN A;  5GAN h;  1BI0 A;  2HCK A;  2DXT A;  2MK5 A;  3VRY A;  2F69 A;  1Q81 C;  2XDP A;  3H8Z A;  1PD1 A;  1U1S A;  1WJR A;  3X26 B;  1YIT A;  1KHC A;  5FU6 C;  1I1J A;  3BE3 A;  5GAM g;  1B3Q A;  3JV3 A;  4MZT A;  3CPW P;  1PKS A;  1NM7 A;  1WDX A;  4AMC A;  5FU7 B;  2DM1 A;  1KK7 A;  4C0F A;  2ZZD A;  4M77 A;  1U8R A;  4C92 C;  1OX8 A;  3DLM A;  2KNB B;  3NHN A;  3V8K A;  2NUT A;  4AG1 C;  1WHL A;  3UA6 A;  1BBZ A;  3REB B;  3L2Z A;  5KYU B;  4F04 B;  5KYW A;  4M77 B;  2KRO A;  1VQ7 T;  1KC8 R;  2DL4 A;  1ZBJ A;  3HRT A;  3PIP A;  2ZAE A;  2NUT B;  4JLG A;  1KSW A;  1VQP T;  2HSE B;  2Y90 A;  4LDY A;  2HL5 C;  2O31 A;  4D6W A;  2ROT A;  2Y4Y A;  1NPP A;  1VQ5 Q;  3I55 A;  4OB3 B;  2B86 A;  4II1 A;  3M59 A;  5KYW B;  3EFS A;  1YJ9 Q;  2BZX A;  3V7S A;  2AZV A;  3M57 A;  4ME7 A;  1YWP A;  3OYG A;  1JO8 A;  1VQ4 T;  4C0D B;  1RAG B;  3C12 A;  2CRE A;  2YDL A;  4M7A B;  2GGR A;  1GBQ A;  3S3O A;  1Q95 G;  1R77 A;  4EMK C;  5FWC A;  3CCS T;  2A0F B;  5I2M A;  3RES A;  4F7U E;  2D0Q B;  4ZGJ B;  2D0N A;  1Q81 R;  4C92 D;  1ZSZ C;  2V1Q A;  4J9E A;  3QJ6 A;  1ZLM A;  2M1H A;  1ARK A;  4M7D F;  1K8A R;  1XNI A;  3CBO A;  3UDC A;  4Z89 A;  2RI5 A;  1WI7 A;  2HBP A;  5GAM e;  2ZPE B;  1S1N A;  3CMA Q;  1KD1 C;  3OS5 A;  5GAO r;  1R0C B;  5GAN f;  3LW5 E;  5GAO l;  4OB0 B;  3D7S B;  2EYQ A;  2K3B A;  3TVT A;  3FB9 A;  3RBB B;  2KXC A;  2E5Q A;  2G3R A;  1K9M C;  4PKC C;  4ANJ A;  2DD4 A;  2JOY A;  2DE0 X;  1K0S A;  1I07 A;  1I4K 1;  3RDV A;  4QW2 A;  2HDA A;  3EG0 A;  2XU8 A;  4MMK A;  1LPL A;  2QQS A;  3PVQ A;  4KUL A;  1QP2 A;  2FPD A;  3EGX A;  4C0Z A;  5FRN A;  2DIG A;  1N9R A;  5GAO q;  3G4S Q;  1YJW A;  4M78 C;  1VQK A;  1MMG A;  4E7Z A;  3M4Y A;  2HBW A;  2QXF A;  2X3W D;  1WHG A;  4AFU C;  1H92 A;  5I2S A;  4HA8 A;  1G8X A;  3WXM B;  5DLO A;  4M77 E;  2LDM A;  1K4U S;  1VQN T;  2W10 A;  2IPO B;  5L8R E;  3EGX B;  2P84 A;  2X4W A;  3IQL A;  1ZA2 B;  4PFO A;  1KQS P;  1Y71 A;  5I11 A;  2O88 A;  2VGN A;  2PVO B;  1U06 A;  4JS4 A;  2E70 A;  1YIJ T;  1RAF B;  2BZY A;  2RQW A;  4NS5 A;  2VUB A;  3V7R A;  2KXD A;  1VQ5 T;  4M7A E;  2EVR A;  2HZY A;  1GFD A;  2CT4 A;  4M77 G;  1YJ9 T;  2RMO A;  5FU6 B;  2RB6 A;  5CR2 A;  1SF9 A;  2KDS A;  1E6G A;  4Z88 A;  3HFO A;  1G3Y A;  2WAC A;  3MCA B;  2JW4 A;  5GJV B;  2EQJ A;  2R5A A;  3G1J A;  2H3E B;  3I5R A;  4BY6 C;  1UJY A;  4C92 B;  4M78 D;  1W6X A;  1K9M R;  3VS0 A;  2RN8 A;  3BFM A;  3M5A A;  1MGQ A;  5GAN 8;  3SB2 A;  3F70 A;  1MNE A;  4A54 A;  2QGG A;  3VS3 A;  3H6Z A;  3JCM W;  1OZ2 A;  4IIM A;  2E12 A;  3SWN C;  2VWF A;  2YT6 A;  2ZCF B;  3URG A;  2RHU A;  3CMA T;  1Q86 U;  1YP5 A;  2DZC A;  5FLX E;  2X4J A;  4PL6 A;  3WVD B;  3GNF B;  2F2W A;  5GAO p;  2DLP A;  2QDL A;  3HP9 A;  4J6W A;  2MYS A;  1V76 A;  3PGG A;  5LJ3 h;  3JRZ A;  3I35 A;  4ZNX A;  1KG1 A;  2LCS A;  3CC4 Q;  2HKN A;  5CKH A;  1ZSZ A;  3EFO A;  2CH4 W;  1K73 U;  1R8O B;  1WJS A;  1C6V X;  2DIQ A;  1G3S A;  1SHF A;  3AT1 B;  3LGL A;  4ZN3 A;  2G6F X;  4EMK B;  3CCE Q;  3G4S T;  1M9S A;  2V1R A;  1JQQ A;  2X9H A;  4FW1 A;  4A4H A;  3JAM E;  1VQ9 A;  4X9D A;  3CCJ A;  1M1F A;  1ZSZ B;  2M51 A;  2JJ9 A;  2COW A;  3EGU A;  1M4Z A;  4QVD A;  1YJN Q;  1UUE A;  2D1X A;  3NTH A;  1NBE B;  3Q1J A;  3L2V A;  5L23 A;  3PMI A;  3HHT B;  3FRN A;  3ZBD A;  2JZ2 A;  4J9H A;  1VQ8 A;  3CCR A;  5CQX A;  3LX7 A;  4J5Y A;  2DRM A;  4LXC A;  3VS2 A;  3GBQ A;  1IRE B;  3PMT A;  2DNU A;  1D3B A;  3CC2 A;  3FIF A;  2JUF A;  4M78 A;  1BI2 A;  2RQU A;  4M7D C;  2K3Y A;  3A8M B;  4J9F A;  4EPC A;  3OMC A;  3R6N A;  2QQA A;  3UF4 A;  4R56 A;  2QQB A;  1FYN A;  4XQ3 A;  4C8Q F;  2AKK A;  2RO0 A;  5GAN d;  2D9T A;  4C92 E;  4M75 F;  2EYY A;  4AFQ C;  2H8H A;  1M3B A;  1UHC A;  1N8R C;  3PTA A;  1BCO A;  3CME T;  2B8A A;  4OVA A;  3ZL7 C;  4M78 B;  2RI2 A;  2X35 A;  1GFC A;  3L42 A;  1BIB A;  2HQX A;  4A4K A;  2CP0 A;  3M0R A;  4FSS A;  4FCY A;  2EBP A;  2EIF A;  5CIU A;  1N5Z A;  3V7C A;  2YRV A;  2EYZ A;  1PM3 A;  4OMF B;  5I21 A;  4PFP A;  1KJW A;  3M56 A;  2CGH A;  1NLO C;  2WSE E;  2DYB A;  1VQ9 Q;  3JB9 J;  1RL2 A;  4FT2 A;  4NOY A;  2E10 A;  1UGV A;  5LJ5 h;  2K4Y A;  5CQY A;  2EFI A;  4JJB A;  1UJ0 A;  4M7D D;  4GLK A;  4J9B A;  1W70 A;  3G71 T;  1FWZ A;  3FJ5 A;  1M2V A;  3CC4 T;  1PRM C;  1UGS B;  2VKN A;  3M4G A;  1XJW B;  2DF6 A;  4FM4 B;  2MF2 A;  2AKL A;  4Q5W A;  4E7I A;  4RG8 A;  4BY6 B;  2Y4X A;  3SWN A;  1E7O A;  2M16 A;  4E7L A;  3CCE T;  4XTX A;  2YSQ A;  3REA B;  2QA4 Q;  3OYJ A;  1VQ7 A;  3DB3 A;  4FU6 A;  1EIF A;  1OZ3 A;  4OML A;  1QVG S;  1YJN T;  3KBG A;  1VQP A;  3PNW C;  5FW9 A;  3C4S A;  3V8J A;  2NWM A;  2KSS A;  3QUI A;  4OB1 B;  2JM9 A;  5DLQ E;  3PVL A;  4K11 A;  4OB2 B;  3L1A A;  1SKU B;  2JMC A;  1WHH A;  3R6O A;  5GAO n;  3VS7 A;  1O75 A;  1VQ4 A;  2A37 A;  1QWF A;  2GQV A;  4DA4 A;  4KGZ B;  3UPU A;  4C0G A;  1MV3 A;  3CQT A;  3OYI A;  2CKK A;  4M78 E;  1MUZ A;  3CCS A;  2KT1 A;  2PNI A;  2X4X A;  1SSH A;  1H8K A;  1LCK A;  1YI2 Q;  1JJ2 S;  1HSQ A;  2QTX A;  4MDX A;  4RCC A;  4GY5 A;  3HSB A;  5A0L A;  1VIE A;  1I8F A;  4M7A C;  1Q7Y C;  1NJI U;  1QVP A;  2KBT A;  5C0M A;  1KHI A;  4BI3 A;  1QWE A;  4XU0 A;  4DBR A;  2MCN A;  4KH1 B;  2K2V A;  2VXF A;  4A4E A;  1HYO A;  4BUG A;  2KMT A;  2M0O A;  4KRT A;  2QAS A;  3P8B B;  4B9W A;  1MMN A;  3SD4 A;  1N27 A;  5J26 A;  3JB9 H;  5GAN 5;  3OYB A;  2CP6 A;  5D6Y A;  3CXC S;  5GMK m;  1YHQ Q;  2ZGW A;  3EG3 A;  1EFN A;  2ESW A;  3LWI A;  1JEG A;  4M7D B;  3CCL T;  3MEA A;  2RJC A;  2QG9 B;  4N0A C;  2KRN A;  1IZ6 A;  1D0Z A;  1QCO A;  4J9C A;  2LT1 A;  3DKM A;  2LQK A;  1K73 R;  2XK0 A;  1W2B P;  2DL8 A;  2YRC A;  4XK8 E;  2K9G A;  1VQ4 Q;  1UGR B;  1VQN A;  3NTK A;  3HFN A;  2EGE A;  2DER A;  3CC7 Q;  3VUB A;  4E6R A;  2D6F A;  3S3M A;  3OSV A;  4R55 A;  5CKD A;  3X25 B;  4MML A;  1KC8 C;  1QVG A;  4C8Q C;  1OPK A;  4XTY A;  3RUX A;  2QA4 T;  4M75 C;  1T0H A;  1U5S A;  1YIJ A;  2L3R A;  1LNX A;  2F5T X;  3ASK A;  4N4G A;  4J83 A;  4PJO F;  3X28 B;  1Y7X A;  2DIL A;  5ECA A;  3OB9 A;  4E7S A;  1VQ5 A;  3QDR B;  2HD0 A;  3TQ7 P;  5GAN j;  1YJ9 A;  1WHM A;  3FJP A;  1CKB A;  4B6M A;  2FRY A;  3FEO A;  3RR6 A;  2JS2 A;  2L89 A;  4OMN A;  5CCA A;  3RMQ A;  1JJ2 A;  2K5I A;  1IHW A;  2DZ9 A;  1B7T A;  5LJ3 d;  2COY A;  1VYU A;  1D09 B;  1H64 1;  2V8I A;  3CCQ Q;  2CSQ A;  1W1F A;  1BK2 A;  1YI2 T;  1V1C A;  3ER0 A;  3RNJ A;  1K8A C;  4OP0 A;  2O2O A;  2K3X A;  1T3S A;  1PWT A;  3JCM d;  2FZC B;  5EC7 A;  4JRK A;  4F14 A;  5KH6 A;  4HCZ A;  4LDX A;  5KYU A;  3VS4 A;  2SEM A;  3CMA A;  3CCU T;  4C8Q D;  5GMK h;  1VQN Q;  4M75 D;  2RD1 A;  5KCH A;  1ZUY A;  2L8D A;  4C5G A;  5J3B A;  2ZPF B;  4M7D E;  5IHK A;  4BE0 A;  1M90 U;  1WA7 A;  2JN0 A;  3CXC A;  4QVZ A;  4C5H A;  1D1B A;  1XOV A;  1UTI A;  3A1P A;  3GNG A;  1YHQ T;  1GCQ A;  1YIJ Q;  2BE9 B;  4M7A A;  4JDS A;  2DVJ A;  2R5M A;  2L2P A;  2ZPG B;  3QDF A;  2O9S A;  4KGX B;  1I0C A;  3G4S A;  5GJW B;  1BYM A;  2IVW A;  1ZQ1 A;  3NMZ C;  1M5Q 1;  4J7I A;  5KE2 A;  4XTW A;  4FW2 A;  2E3I A;  2H3J A;  1T3L A;  2JS0 A;  5IAY A;  2GBQ A;  4PLI A;  1GXI E;  1S72 T;  3CC7 T;  1TXQ A;  3NFC A;  2W0Z A;  1NZ9 A;  2C0O A;  2XIC A;  1WXB A;  2DTH A;  5AT1 B;  5IXB A;  1SG5 A;  1T0J A;  2O01 E;  4P5N A;  1AEY A;  2PQW A;  4E47 A;  3JCM V;  4N0A A;  2DL5 A;  2E6N A;  4DBQ A;  2YLB A;  1NPR A;  1K1Z A;  3C95 A;  1ABO A;  1M1K R;  3MP6 A;  1X01 A;  4QQG A;  3CME A;  3X20 B;  1WXT A;  3LH5 A;  2M0Y A;  3CPW S;  2E65 A;  3M55 A;  3UAT A;  3OS1 A;  2YWW A;  5LJ5 d;  4C8Q A;  2QI2 A;  1PSF A;  4F7U G;  4M75 A;  2KYB A;  4ELZ C;  2LQW A;  5IHI A;  5HK3 A;  2RJE A;  4RTW A;  3JCM b;  4IUT A;  3CCQ T;  2LCC A;  5M9O A;  2BZ8 A;  3RKX A;  4LDV A;  4C8Q B;  2KK4 A;  1NE8 A;  2AT1 B;  4M75 B;  1HK9 A;  2L5Q A;  3GPL A;  2OAW A;  2LP5 A;  2QK0 A;  5HY6 A;  2FPE A;  3CPF A;  1NG2 A;  1N9S A;  1R0B G;  1RI0 A;  3G71 A;  2DBK A;  1QMC A;  3H0H A;  4MZP A;  3P8D A;  3CC4 A;  2ED0 A;  3QBY A;  3EAE A;  4J6X A;  1PSE A;  4A4F A;  1IGU A;  4D8D A;  1WGS A;  4KUI A;  3BY7 A;  4RTV A;  4Z8A A;  1G83 A;  1Y96 A;  2YXY A;  3OY9 A;  3FDR A;  4PJO C;  4BAC A;  2DA9 A;  1X6G A;  1WYX A;  1VQO T;  1B07 A;  2XMF A;  4C92 A;  3CCE A;  3OW2 A;  3JB9 G;  4RUG A;  3KXT A;  2E4H A;  5EG2 A;  1G2B A;  2J6K A;  1VIF A;  3CME Q;  1YJN A;  1JU5 C;  2X3X D;  3O8V A;  1TOV A;  5GAN e;  1Y96 B;  2BE7 D;  4D8K A;  1BI1 A;  3QYG B;  2V8K A;  3NPF A;  1WX6 A;  1WPY A;  3HTR A;  2VV5 A;  2RPN A;  2MMP A;  1OEB A;  2PVD B;  1M8V A;  2KYM A;  2V8J A;  4HCC A;  3E2U A;  3QHS A;  4FSX A;  4FYW B;  3KFV A;  3JCM Q;  3T9N A;  4M7A G;  1WFW A;  3QO3 A;  1X43 A;  3G7Z A;  4CI0 C;  3A8G B;  1PNJ A;  3CPW A;  1SRL A;  3GOX A;  2VAS A;  2WSF E;  2EWN A;  1D0X A;  2RK1 A;  4EMK A;  3OYM A;  2J6F A;  4PJO D;  4X1V A;  3G71 Q;  1X75 C;  2ENM A;  2AK5 A;  3RMS A;  4C8Q E;  1WZO A;  3JCM h;  4E7J A;  4M4Z A;  4M75 E;  3BW1 A;  2EPD A;  3A8L B;  2DX1 A;  2EJ9 A;  3LWH A;  4RTX A;  1QVF S;  1RAA B;  2DPP B;  2C06 A;  1UGP B;  3A5Z B;  3S3N A;  1YN8 A;  2QAZ A;  1B34 A;  2CP7 A;  2JT4 A;  2K5F A;  4DOW A;  5GAN 2;  2J05 A;  3QWY A;  3JCM c;  3CCL A;  2BUD A;  4J8O A;  1WJQ A;  1UG1 A;  3OSS C;  2YUO A;  1KIK A;  4M75 G;  1VQM Q;  1B34 B;  4NL3 A;  2MPX C;  3TEE A;  1WXU A;  2FHD A;  2PUO B;  4O6J A;  1IB8 A;  1ABQ A;  1ZHI A;  2I0N A;  1WHJ A;  4MZM A;  2CZ1 B;  2XID A;  2LT4 A;  4FYY B;  2NYS A;  2EQM A;  1Q82 U;  1VQ6 Q;  1OYX A;  1U3O A;  3VRZ A;  3MP1 A;  7AT1 B;  2QA4 A;  2P0K A;  2IIM A;  1VYV A;  3EH1 A;  3LGF A;  2LNH B;  4DEX A;  3VS5 A;  3UWN A;  5GAN 6;  1PG5 B;  1FMW A;  3ME9 A;  3INZ A;  2ZPI B;  4Z02 A;  1U1T A;  4BI8 B;  4OMO A;  1M8M A;  4PJO A;  3NTI A;  2EQI A;  3TSZ A;  2QQ9 A;  3J7A F;  4XU1 A;  3VV0 A;  2DTO A;  2CS7 A;  4C92 G;  2QEX Q;  4LD9 K;  5LJ3 f;  1OPL A;  1MV0 B;  1KFZ A;  1YI2 A;  5IXF A;  2IG0 A;  3E9G A;  3CCL Q;  4PJO B;  5LL6 S;  2XG8 D;  4XU2 A;  4PJN A;  3JCM f;  3M0U A;  1UB4 A;  4X9C A;  1GBR A;  5GMK i;  1LOJ A;  2DL3 A;  2KAF A;  4KGV B;  3DLL A;  2DL7 A;  2XKO C;  4PK4 A;  1OUL A;  3CCU A;  4QVC A;  1AZE A;  3M0P A;  2D8J A;  1TUG B;  2QTV A;  4LDU A;  2JMA A;  3QXE B;  2OTL T;  1J3T A;  1QVF A;  1KQS A;  4IUP A;  5KCO A;  2CP5 A;  1JXO A;  5FRM A;  2BKD N;  4V2S A;  1YCS B;  2RNA A;  1YHQ A;  2ZPB B;  4BDZ A;  1PD0 A;  4BI4 A;  4OMP A;  5CVI A;  2WSC E;  4J9I A;  1RI9 A;  3H0F A;  3QZ9 B;  2RH2 A;  4IIO A;  4JPB W;  1QP3 A;  3OYK A;  1PRL C;  1K73 C;  1M3A A;  1I5O B;  4LNP A;  2LJ0 A;  1VQM T;  1Q81 U;  1PCX A;  3LH0 A;  3QG1 A;  2DRK A;  1QCF A;  5KYY A;  3A8O B;  2J7I A;  1AOJ A;  1IHV A;  1S72 A;  2DO3 A;  3CC7 A;  2JVV A;  4GBQ A;  5CKE A;  4HVU A;  2R57 A;  3MHX A;  4J9D A;  1OV3 A;  1VQ6 T;  2EQU A;  4HT9 A;  5LJ3 e;  1K0X A;  3M54 A;  3JCM X;  5KYY B;  3PIO A;  1BIA A;  4XTU A;  2CSI A;  3JB9 I;  2QDY B;  1NEB A;  3L2U A;  2F2V A;  1VUB A;  1AHJ B;  4J6Y A;  1TS9 A;  3CCU Q;  3V8L A;  4R0K A;  3H41 A;  2BTT A;  4M7D A;  4J7F A;  1EX4 A;  1MMD A;  3MJX A;  4C5E A;  4TVR A;  4EMH A;  2KE9 A;  5LJ5 f;  4M78 G;  4PJO E;  1AWJ A;  1IRX A;  3FLG A;  4WCI A;  3JCM J;  2CP2 A;  2X51 A;  1W4S A;  1NLP C;  3M9Q A;  2ABL A;  3E19 A;  2LRQ A;  2QEX T;  2C0I A;  1Q86 R;  1OU8 A;  5GAM h;  4BE1 A;  3L2Q A;  2K7A A;  3AHU A;  3PFS A;  3G6E Q;  3CCQ A;  3VUZ A;  3VYG A;  2A3L A;  2KI7 A;  5HCK A;  3GF5 A;  2ZPH B;  2JXB A;  2ED1 A;  2FYK A;  4HCB A;  3RKW A;  3OS0 A;  5FRO A;  4BB7 A;  3SFM A;  1HD3 A;  3RER A;  2F5K A;  4ESR A;  1X6O A;  1S72 Q;  2KRM A;  2EQK A;  1JBM A;  4RTT A;  4FL6 A;  3VJP A;  1VQ8 T;  3LLR A;  4OF1 A;  3CCV T;  2DJQ A;  4PJM A;  1KD1 U;  2P4T A;  2RJF A;  5IT9 E;  5A0D A;  1BB9 A;  3GIB A;  1VQL Q;  1TG0 A;  2YHT A;  2LNV A;  4QT7 A;  1VQO A;  1D1A A;  5GAN 7;  4FIB A;  4DOV A;  2VB6 A;  8ATC B;  4LDW A;  3EG2 A;  5GAN 3;  1Y07 A;  3CBP A;  2MOX A;  1WQ7 A;  1K9M U;  1SEM A;  4RTY A;  2MWO A;  4XTV A;  1Q82 R;  3EGD A;  5GAO m;  5CKF A;  2DFU A;  5LJ5 e;  4J9G A;  4HKE A;  2C0T A;  5FWB A;  4EDU A;  2F2X A;  3LYI A;  2XI9 A;  1SSF A;  1VOM A;  2JNG A;  3OYY A;  5GMK j;  4ELY C;  2NUZ A;  3TRE A;  1UGQ B;  3EGD B;  3TSW A;  4ZGD B;  4RMO A;  1M1K C;  1AZG B;  4HVV A;  1UE9 A;  3SHW A;  2HNI A;  3S6W A;  5IHN A;  3CEY A;  1O9S A;  2D8H A;  3L2R A;  2K2M A;  5I22 A;  1OOT A;  1YNZ A;  2KEA A;  4VUB A;  3UT1 A;  4BDY A;  4A53 A;  5GAM f;  2RA2 A;  1ZUU A;  1Z9Q A;  2LQ8 A;  2JTF A;  1M2O A;  2K5L A;  2KY9 A;  2VYT A;  3JSC A;  2OTJ Q;  4QQ6 A;  4E2F B;  1FXX A;  2FEI A;  2E41 A;  1JRI A;  4Y91 A;  3I56 Q;  3QII A;  1W2B S;  3CD6 Q;  3MO8 A;  4DBH A;  2DJZ A;  1I5L A;  2RHZ A;  1G3W A;  4FYX B;  5GMK l;  3G6E T;  2RJD A;  1OI1 A;  3C0C A;  2DAQ A;  1VQO Q;  5DY9 A;  1NJI C;  4JRQ A;  4LD6 A;  4HCK A;  2PVG B;  2COZ A;  2GF7 A;  2RI3 A;  3U23 A;  1TSF A;  4OMQ A;  2GFU A;  3THK A;  1FX7 A;  3OW2 S;  2PU9 B;  3RIR A;  1IXD A;  2JM8 A;  1F1B B;  5A2Q E;  4M7D G;  2GQI A;  3BDL A;  1UEB A;  3OYN A;  2ECZ A;  4RTZ A;  1G3T A;  4OMM A;  2XD0 A;  4QQD A;  2YLC A;  1BU1 A;  3ZEH A;  2GTO A;  4RKU E;  1OU9 A;  1H3Z A;  2K57 A;  2I2L A;  3PT9 A;  2RHX A;  3CCM Q;  1VQL T;  4IUQ A;  4KUD K;  3M0Q A;  4XU3 A;  4ZTF A;  4L5G A;  4AT1 B;  3OYF A;  4OGC A;  4CC4 B;  2MI6 A;  2LTO A;  1AT1 B;  4DQ2 A;  2LX9 A;  2DYI A;  5GAN g;  5GAN 4;  4MDW A;  1HXD A;  1TTH B;  1YIT Q;  4JRP A;  1ZA1 B;  1Y57 A;  5D6W A;  1HJD A;  4HXJ A;  2OAU A;  4DBF A;  1ZX6 A;  4WTO B;  2E6Z A;  2HKQ B;  1C1A A;  2A08 A;  2LMJ A;  1EZZ B;  4JJD A;  2NUP A;  1XTD A;  1IO6 A;  3QZ5 B;  4IUR A;  5D7U A;  2FL7 A;  5HKC A;  1IGQ A;  4UC4 A;  4CC2 A;  1MHN A;  1MND A;  2RM4 A;  1RAD B;  1TUD A;  2A36 A;  1NJI R;  1NYG A;  3OBW A;  2X4Y A;  1KQ2 A;  4IKF A;  2L0A A;  1QW1 A;  2LC4 A;  1Z9Z A;  4JUV A;  4FYV B;  2VGM A;  2DK3 A;  2NUP B;  1M1G A;  2RQT A;  2CUB A;  4FT4 A;  2FPF A;  1X69 A;  1AVZ C;  3DB4 A;  1SHG A;  1W2B A;  3I55 Q;  2CH4 A;  2OTJ T;  1MMA A;  2F1L A;  3J81 E;  5J39 A;  1XQH A;  4KH0 B;  4F7U F;  1WLP B;  3I56 T;  2CUD A;  3CD6 T;  1WHK A;  4EIK A;  2KRS A;  4E7K A;  2OTL A;  3ULR B;  4ZTJ A;  3QWX X;  3OYH A;  1N8R U;  4KT0 E;  2RK2 A;  3OYC A;  1QVF P;  1KQ1 A;  4F17 A;  4X34 A;  2PTK A;  3M53 A;  2ROL A;  2KT8 A;  3QJY A;  1ZUK A;  1AWX A;  3TU4 K;  1PHT A;  4EMG A;  1LVK A;  2EYW A;  4HT8 A;  1M90 C;  3VKI A;  3HL8 A;  1WNL A;  4O5V A;  1PKT A;  2FVU A;  5D6X A;  4JJC A;  1GRI A;  1VQM A;  1KD1 R;  3O5Z A;  3EFR A;  2CYZ B;  2FG0 A;  2KR3 A;  3A98 A;  3OYL A;  4BD3 A;  1TH7 A;  3CCM T;  2OI3 A;  3OYA A;  1G5V A;  5GMK e;  1VQ6 A;  3JB9 F;  2J6O A;  3MKD A;  1NEG A;  2DTI A;  1RAC B;  5LJ3 j;  1AD5 A;  1YBY A;  4M77 F;  1YIT T;  2AIR B;  2MWP A;  3MET A;  2MIO A;  3VYH B;  1YCY A;  3SDZ A;  4PNO A;  5GAM d;  4LN2 A;  2M02 A;  1YJW Q;  1VQK Q;  4AG2 C;  1CKA A;  1JXM A;  3EG1 A;  3QYH B;  2DXC A;  1M30 A;  2YUN A;  4N4I A;  2OTL Q;  2DVE A;  4IUU A;  1JB0 E;  2JTM A;  1VYT A;  2CZ0 B;  1X2Q A;  1KQS S;  1TU0 B;  1OQK A;  4M7A F;  4AFZ C;  8AT1 B;  1P92 A;  2K79 A;  1ZBX A;  2HMA A;  2QEX A;  2EKO A;  2CZ7 B;  3WVE B;  4E7H A;  2RHI A;  2FZG B;  1FMK A;  4JLI A;  5KE3 A;  2LVM A;  3MP8 A;  3J80 E;  1M90 R;  5A0G A;  1YFN A;  4C8Q G;  3I55 T;  2J06 A;  3BDU A;  2DXU A;  2HL3 A;  5CKB A;  3EFO B;  3EH2 A;  3A8H B;  4PJJ A;  3E9F A;  2LX7 A;  1UDL A;  2M9U A;  2KQW A;  3E1S A;  2AZS A;  3H9N A;  4RCB A;  3OBY A;  1QQJ A;  4A4G A;  5CO7 A;  4PLL A;  3CCV A;  3MEU A;  4C5I A;  3MEW A;  1Q7Y U;  4A63 B;  3HPW A;  3L2W A;  1QVG P;  2YUQ A;  1QKX A;  1D0Y A;  1E6H A;  1QCN A;  2DEU A;  2OJ2 A;  3QPH A;  3N5B B;  4JJN K;  4YTL A;  4GLM A;  4N4H A;  1X27 A;  4ORZ A;  2A28 A;  4ZGE B;  1D3B B;  2KGT A;  1RAH B;  3OQ5 A;  9ATC B;  5DM7 R;  5LJ5 j;  3EHR A;  4AFS C;  1QLY A;  2LJ3 A;  4QKU A;  1BCM A;  5LJ3 g;  3X24 B;  2EJF A;  2EKH A;  4DEY A;  1I81 A;  3I9Q A;  2DD5 A;  1JJ2 P;  2CDT A;  4NL2 A;  4JZ3 A;  3JCM g;  3I5S A;  2L3P A;  3EHQ A;  4ZN1 A;  3GLX A;  1YJW T;  1GCP A;  1VQK T;  1RUW A;  1PC0 A;  1TUC A;  1V29 B;  2SRC A;  3CCJ Q;  5KYN A;  1KC8 U;  3SEM A;  1UFF A;  3VS6 A;  2DET A;  2GFA A;  5KYX A;  1WQW A;  4OGE A;  1VA7 A;  2O4X A;  3FC3 A;  1TWB A;  1VQ8 Q;  1CSK A;  1Q86 C;  2V26 A;  4PFZ A;  3CCR Q;  3CCV Q;  4LUD A;  4C92 F;  1M3C A;  1H3H A;  4KBM B;  3CXC P;  3H0I A;  3CC2 Q;  3G6E A;  3QKJ A;  5KYX B;  2E1H A;  2KVQ G;  2Z0W A;  2DKG A;  2O4X B;  2HQE A;  1ACM B;  5FU7 C;  4XAX B;  1M2V B;  3HRU A;  1K9A A;  4ATO A;  1RAE B;  1C0M A;  5CK9 A;  2O9V A;  2K6D A;  4LUE A;  2GCX A;  2A7Y A;  1N8R R;  2QQR A;  1YWO A;  1K8A U;  2PUK B;  2XHC A;  2MAM A;  3P8H A;  3VU3 C;  1RAI B;  3SWN B;  3HKS A;  1BKB A;  3UA7 A;  2NLU A;  2XDB A;  2E64 A;  1M1K U;  2E5K A;  4M77 C;  3HRS A;  3OYD A;  2HSP A;  2ATC B;  2P0P A;  1GL5 A;  4JZ4 A;  1VQL A;  2VXE A;  3EG9 A;  3TCJ A;  2QYZ A;  1OX9 A;  2FZK B;  3JCM e;  2VVK A;  2CP3 A;  1AWW A;  2GTJ A;  2L3S A;  1RAB B;  2FO0 A;  5CAI A;  3M58 A;  2BIV A;  2EJG A;  3GP8 A;  2CT3 A;  1FMV A;  1GCQ C;  1Q82 C;  5AYF A;  2RHY A;  1RLP C;  4C0D C;  5GAM j;  1UEC A;  4HVW A;  1Y0M A;  4Y28 E;  5LJ5 g;  1UHF A;  3EG9 B;  1RLQ C;  1M27 C;  4BE2 A;  2CZ6 B;  3OMG A;  3VS1 A;  2HAX A;  3RKY A;  2P0Q A;  3OYE A;  2LZ6 B;  2LJ1 A;  5IN1 A;  4F16 A;  4JS5 A;  2DEQ A;  3C94 A;  4WF2 A;  1AWO A;  4RG2 A;  2VC8 A;  4JRI A;  2EW3 A;  1VQ9 T;  3JCM P;  3MPU B;  3CCJ T;  1A0N B;  1VQ7 Q;  3JB9 D;  3ZFJ A;  4CC3 A;  2FB7 A;  2R58 A;  1VQP Q;  4M77 D;  4PJO G;  1D1C A;  1SRM A;  2L3Q A;  2QGF B;  2XDD A;  2HQH A;  4CRI A;  2EAY A;  1X6B A;  2RF0 A;  4M78 F;  2OTJ A;  2EGA A;  1QKW A;  3CCR T;  3I56 A;  1SPK A;  4L59 A;  4L6V 5;  2RQV A;  3CD6 A;  5C6S A;  1N6A A;  2HEQ A;  2JTE A;  3KUF A;  3CC2 T;  5HK0 A;  3NGP A;  1BI3 A;  5IH2 A;  2DBM A;  2RQR A;  1ZSG A;  4F7U A;  4LE9 A;  4B9X A;  4XTZ A;  3M0T A;  1K76 A;  3CCS Q;  2FRW A;  4M7A D;  2YRD A;  2DMO A;  2YUP A;  3M0S A;  4CC7 A;  3OW2 P;  3PE0 A;  4Y92 A;  1LJO A;  2AHJ B;  2OX7 A;  2P4R A;  1DJ7 B;  4F7U B;  3CBM A;  3OA6 A;  4PJL A;  1X2K A;  4RTU A;  1Q7Y R;  2EGC A; 
#chains in the Genus database with same CATH homology
 2KSS A;  4IUV A;  3QUI A;  3OBW A;  4OB1 B;  3JCM c;  2X4Y A;  2BUD A;  3OS2 A;  3CCL A;  3QSU A;  2DXB A;  2LCL A;  3MEV A;  5DLQ E;  3CCM A;  4J8O A;  1KQ2 A;  4IKF A;  4OB2 B;  3L1A A;  5GAN h;  1WJQ A;  1QW1 A;  1BI0 A;  2LC4 A;  4JUV A;  2DXT A;  3OSS C;  3R6O A;  5GAO n;  2VGM A;  2DK3 A;  2F69 A;  1O75 A;  1Q81 C;  1VQ4 A;  2XDP A;  3H8Z A;  1M1G A;  1U1S A;  4M75 G;  1B34 B;  2GQV A;  4NL3 A;  4DA4 A;  3TEE A;  4FT4 A;  3UPU A;  3DB4 A;  4C0G A;  1W2B A;  2FHD A;  3OYI A;  1WJR A;  2PUO B;  3X26 B;  2CKK A;  4O6J A;  1KHC A;  4M78 E;  1YIT A;  2OTJ T;  3J81 E;  5FU6 C;  5J39 A;  1XQH A;  3CCS A;  2X4X A;  1ZHI A;  4F7U F;  3I56 T;  4MZM A;  5GAM g;  4MZT A;  2CZ1 B;  2XID A;  3CD6 T;  2LT4 A;  1JJ2 S;  2EQM A;  5FU7 B;  1Q82 U;  4C0F A;  2QTX A;  4E7K A;  4RCC A;  2OTL A;  4MDX A;  4GY5 A;  1OYX A;  4ZTJ A;  2ZZD A;  3HSB A;  4M77 A;  1U8R A;  3OYH A;  5A0L A;  1N8R U;  4C92 C;  1VIE A;  1I8F A;  3MP1 A;  2QA4 A;  4KT0 E;  2P0K A;  2RK2 A;  3DLM A;  3V8K A;  3OYC A;  4M7A C;  3LGF A;  1Q7Y C;  1NJI U;  1QVP A;  1KQ1 A;  5C0M A;  1KHI A;  4BI3 A;  4X34 A;  4XU0 A;  3M53 A;  3UWN A;  5GAN 6;  3QJY A;  2K2V A;  2VXF A;  3L2Z A;  3TU4 K;  4EMG A;  3ME9 A;  4A4E A;  4HT8 A;  3INZ A;  2ZPI B;  4BUG A;  4Z02 A;  1M90 C;  2KMT A;  4M77 B;  2M0O A;  3VKI A;  1U1T A;  1VQ7 T;  3HL8 A;  3P8B B;  1WNL A;  3HRT A;  4B9W A;  4BI8 B;  3PIP A;  4PJO A;  4JLG A;  3SD4 A;  4O5V A;  1VQP T;  1N27 A;  3NTI A;  2Y90 A;  2FVU A;  5J26 A;  5D6X A;  3JB9 H;  2QQ9 A;  5GAN 5;  4LDY A;  5D6Y A;  3OYB A;  3CXC S;  5GMK m;  4XU1 A;  1VQM A;  2ZGW A;  3J7A F;  4D6W A;  2Y4Y A;  1NPP A;  3VV0 A;  3EFR A;  3LWI A;  2DTO A;  2CYZ B;  3I55 A;  4M7D B;  4OB3 B;  2CS7 A;  4C92 G;  3CCL T;  4LD9 K;  4II1 A;  3MEA A;  3M59 A;  3OYL A;  3EFS A;  1TH7 A;  5LJ3 f;  4BD3 A;  3CCM T;  3V7S A;  2RJC A;  3M57 A;  4ME7 A;  3OYA A;  4N0A C;  1YI2 A;  2IG0 A;  1IZ6 A;  3E9G A;  3OYG A;  4PJO B;  1G5V A;  1VQ4 T;  5LL6 S;  2LT1 A;  2XG8 D;  4XU2 A;  4C0D B;  5GMK e;  1VQ6 A;  3JB9 F;  3JCM f;  3C12 A;  3DKM A;  2LQK A;  1UB4 A;  2DTI A;  4X9C A;  4M7A B;  5LJ3 j;  2XK0 A;  1YBY A;  5GMK i;  4M77 F;  3S3O A;  4XK8 E;  1LOJ A;  1YIT T;  1UGR B;  4EMK C;  1VQN A;  3NTK A;  2MWP A;  3HFN A;  2KAF A;  3MET A;  1YCY A;  3SDZ A;  3VYH B;  3DLL A;  5I2M A;  3CCS T;  4PNO A;  2XKO C;  3RES A;  5GAM d;  4F7U E;  2D0Q B;  3VUB A;  4ZGJ B;  2D6F A;  3CCU A;  4QVC A;  3S3M A;  3OSV A;  4C92 D;  4LDU A;  3QXE B;  4M78 A;  4R55 A;  5CKD A;  2OTL T;  3X25 B;  1QVF A;  1KQS A;  4IUP A;  3QJ6 A;  5KCO A;  4MML A;  1KC8 C;  3QYH B;  2DXC A;  4XTY A;  4C8Q C;  2M1H A;  1QVG A;  3RUX A;  2QA4 T;  4M7D F;  1XNI A;  4M75 C;  5FRM A;  4N4I A;  3CBO A;  3UDC A;  2BKD N;  2HBP A;  2RI5 A;  2DVE A;  4IUU A;  5GAM e;  1JB0 E;  2JTM A;  2ZPE B;  1YIJ A;  4V2S A;  1KD1 C;  2L3R A;  1LNX A;  2F5T X;  3ASK A;  3OS5 A;  4J83 A;  4N4G A;  2CZ0 B;  5GAO r;  5GAN f;  4PJO F;  3LW5 E;  5GAO l;  1KQS S;  3X28 B;  4OB0 B;  1Y7X A;  1YHQ A;  2ZPB B;  4BDZ A;  4M7A F;  2EYQ A;  3OB9 A;  1VQ5 A;  1P92 A;  3FB9 A;  1ZBX A;  4BI4 A;  3QDR B;  5CVI A;  2QEX A;  2WSC E;  2EKO A;  2HD0 A;  3QZ9 B;  2CZ7 B;  5GAN j;  1YJ9 A;  2E5Q A;  2RH2 A;  2G3R A;  3WVE B;  4E7H A;  1K9M C;  4PKC C;  1QP3 A;  2DD4 A;  3FJP A;  2JOY A;  3OYK A;  1K73 C;  2RHI A;  3FEO A;  1I4K 1;  4JLI A;  5KE3 A;  4QW2 A;  2LVM A;  1VQM T;  1Q81 U;  4MMK A;  2XU8 A;  3MP8 A;  3J80 E;  5A0G A;  2QQS A;  2L89 A;  3LH0 A;  3QG1 A;  4C8Q G;  4KUL A;  3I55 T;  5CCA A;  1QP2 A;  3RMQ A;  3BDU A;  2DXU A;  3A8O B;  4C0Z A;  2K5I A;  1JJ2 A;  5FRN A;  2DIG A;  2DZ9 A;  1N9R A;  1S72 A;  5CKB A;  2DO3 A;  5LJ3 d;  5GAO q;  3CC7 A;  2JVV A;  5CKE A;  3A8H B;  1YJW A;  2R57 A;  1H64 1;  3E9F A;  2V8I A;  3MHX A;  4M78 C;  1YI2 T;  1VQK A;  3M4Y A;  2QXF A;  3ER0 A;  1K8A C;  4OP0 A;  2M9U A;  2KQW A;  1VQ6 T;  2K3X A;  5I2S A;  3E1S A;  4HA8 A;  3JCM d;  4JRK A;  4RCB A;  3WXM B;  5KH6 A;  5DLO A;  4HCZ A;  3OBY A;  2EQU A;  4LDX A;  4M77 E;  2LDM A;  1VQN T;  4HT9 A;  5LJ3 e;  4A4G A;  3M54 A;  3JCM X;  5L8R E;  5CO7 A;  3CMA A;  2X4W A;  1BIA A;  4PLL A;  3PIO A;  3MEU A;  4C5I A;  4XTU A;  4C8Q D;  3CCU T;  3CCV A;  3MEW A;  1Q7Y U;  3HPW A;  5GMK h;  3JB9 I;  2QDY B;  4M75 D;  2RD1 A;  3L2U A;  5KCH A;  1Y71 A;  3L2W A;  1VUB A;  1AHJ B;  2L8D A;  2VGN A;  4J6Y A;  2PVO B;  4C5G A;  5J3B A;  2ZPF B;  3V8L A;  4JS4 A;  4M7D E;  4BE0 A;  1M90 U;  2JN0 A;  3CXC A;  4M7D A;  4J7F A;  2E70 A;  1YIJ T;  4QVZ A;  4C5E A;  4TVR A;  4C5H A;  4EMH A;  4NS5 A;  1XOV A;  3QPH A;  5LJ5 f;  4M78 G;  3N5B B;  4PJO E;  4JJN K;  2VUB A;  3FLG A;  3GNG A;  4YTL A;  3V7R A;  3JCM J;  1YHQ T;  4N4H A;  1VQ5 T;  4M7A E;  1W4S A;  3M9Q A;  3E19 A;  2LRQ A;  2QEX T;  4ZGE B;  4M7A A;  1D3B B;  4JDS A;  4M77 G;  2R5M A;  5GAM h;  1YJ9 T;  4BE1 A;  3OQ5 A;  5DM7 R;  2ZPG B;  3L2Q A;  3AHU A;  3CC2 A;  5FU6 B;  5LJ5 j;  2RB6 A;  3PFS A;  3G4S A;  5CR2 A;  2KDS A;  3CCQ A;  3HFO A;  1G3Y A;  2IVW A;  1BYM A;  3VUZ A;  3VYG A;  1ZQ1 A;  1M5Q 1;  2A3L A;  4J7I A;  5KE2 A;  2WAC A;  3GF5 A;  3MCA B;  3X24 B;  2EJF A;  4XTW A;  5LJ3 g;  1I81 A;  2ZPH B;  2H3J A;  2EQJ A;  2R5A A;  4BY6 C;  2FYK A;  4HCB A;  5IAY A;  2DD5 A;  4C92 B;  4M78 D;  4NL2 A;  3RKW A;  4PLI A;  3OS0 A;  1GXI E;  4J6X A;  3JCM g;  3BFM A;  5FRO A;  1S72 T;  3M5A A;  4BB7 A;  3CC7 T;  1MGQ A;  3NFC A;  3GLX A;  3SFM A;  4ZN1 A;  5GAN 8;  1YJW T;  1VQK T;  3SB2 A;  3F70 A;  3RER A;  2F5K A;  1V29 B;  1NZ9 A;  1X6O A;  2XIC A;  4A54 A;  2EQK A;  2DTH A;  1JBM A;  4FL6 A;  1KC8 U;  2O01 E;  3VJP A;  3H6Z A;  4P5N A;  3JCM W;  2PQW A;  4E47 A;  1VQ8 T;  1OZ2 A;  3LLR A;  4OF1 A;  2GFA A;  3JCM V;  2E12 A;  3SWN C;  3URG A;  2ZCF B;  3CMA T;  2RHU A;  1WQW A;  4N0A A;  4OGE A;  2O4X A;  3CCV T;  3FC3 A;  1Q86 U;  2DZC A;  5FLX E;  2X4J A;  4PL6 A;  3WVD B;  1KD1 U;  3GNF B;  2P4T A;  2RJF A;  5IT9 E;  2E6N A;  1Q86 C;  5A0D A;  2YLB A;  1NPR A;  5GAO p;  3HP9 A;  3C95 A;  3GIB A;  4J6W A;  4C92 F;  3PGG A;  2YHT A;  5LJ3 h;  3JRZ A;  2LNV A;  4KBM B;  1VQO A;  1KG1 A;  5GAN 7;  3MP6 A;  1X01 A;  4FIB A;  4QQG A;  4DOV A;  3CME A;  5CKH A;  4LDW A;  3X20 B;  3G6E A;  3QKJ A;  5GAN 3;  3CPW S;  1Y07 A;  2E65 A;  3CBP A;  1WQ7 A;  3M55 A;  3OS1 A;  1K9M U;  2E1H A;  2KVQ G;  2DKG A;  2O4X B;  1K73 U;  5LJ5 d;  1R8O B;  1WJS A;  4C8Q A;  2HQE A;  2QI2 A;  1PSF A;  2DIQ A;  1G3S A;  4F7U G;  4M75 A;  5FU7 C;  4XAX B;  3LGL A;  4ELZ C;  3HRU A;  2MWO A;  4ATO A;  4ZN3 A;  5CK9 A;  4EMK B;  4XTV A;  2RJE A;  5HK3 A;  3G4S T;  3JCM b;  1M9S A;  4IUT A;  3CCQ T;  2GCX A;  5GAO m;  4A4H A;  5CKF A;  3JAM E;  1VQ9 A;  2A7Y A;  2LCC A;  5LJ5 e;  5M9O A;  4X9D A;  3CCJ A;  1M1F A;  2QQR A;  4HKE A;  4EDU A;  1K8A U;  2PUK B;  2XHC A;  2MAM A;  3P8H A;  1M4Z A;  3RKX A;  4LDV A;  3VU3 C;  3LYI A;  4QVD A;  4C8Q B;  3SWN B;  2KK4 A;  1BKB A;  1NE8 A;  2XI9 A;  3HKS A;  1SSF A;  3NTH A;  3Q1J A;  4M75 B;  2NLU A;  3L2V A;  2XDB A;  3PMI A;  3HHT B;  2E64 A;  1HK9 A;  2JNG A;  2L5Q A;  1M1K U;  3OYY A;  5GMK j;  3FRN A;  3ZBD A;  4ELY C;  4M77 C;  3GPL A;  3HRS A;  3TRE A;  2JZ2 A;  3OYD A;  1UGQ B;  4RMO A;  4ZGD B;  1M1K C;  1VQ8 A;  5HY6 A;  2P0P A;  3CCR A;  2HNI A;  5CQX A;  3S6W A;  3CPF A;  3LX7 A;  3CEY A;  4J5Y A;  1VQL A;  1O9S A;  2VXE A;  3TCJ A;  3L2R A;  1N9S A;  1RI0 A;  3G71 A;  4VUB A;  3UT1 A;  3JCM e;  4BDY A;  1IRE B;  4MZP A;  3P8D A;  3CC4 A;  3PMT A;  4A53 A;  1D3B A;  5GAM f;  3FIF A;  2RA2 A;  2JUF A;  1BI2 A;  1PSE A;  2JTF A;  2BIV A;  2LQ8 A;  2K5L A;  2K3Y A;  3EAE A;  3M58 A;  4A4F A;  4M7D C;  1WGS A;  2KY9 A;  2VYT A;  3A8M B;  3JSC A;  4KUI A;  4EPC A;  4QQ6 A;  3OMC A;  1FXX A;  2EJG A;  2QQA A;  3BY7 A;  2E41 A;  1JRI A;  4R56 A;  3GP8 A;  2QQB A;  1Y96 A;  4Y91 A;  4XQ3 A;  4C8Q F;  3OY9 A;  3QII A;  3FDR A;  1W2B S;  5AYF A;  2RHY A;  1Q82 C;  4PJO C;  4C0D C;  2RO0 A;  5GAM j;  2D9T A;  4C92 E;  5GAN d;  3MO8 A;  4M75 F;  4Y28 E;  5LJ5 g;  4BAC A;  1VQO T;  2DJZ A;  1I5L A;  2RHZ A;  1N8R C;  1G3W A;  4C92 A;  3CCE A;  2CZ6 B;  4BE2 A;  3PTA A;  3CME T;  3OW2 A;  5GMK l;  3JB9 G;  3OMG A;  3G6E T;  3KXT A;  2HAX A;  2B8A A;  2P0Q A;  3RKY A;  2RJD A;  4OVA A;  5EG2 A;  3OYE A;  1OI1 A;  4M78 B;  2DAQ A;  5DY9 A;  1NJI C;  2RI2 A;  5IN1 A;  4JRQ A;  4LD6 A;  2PVG B;  2X35 A;  1VIF A;  2GF7 A;  2RI3 A;  3L42 A;  1BIB A;  2HQX A;  1YJN A;  4A4K A;  3O8V A;  4JS5 A;  2DEQ A;  3C94 A;  5GAN e;  1Y96 B;  2GFU A;  1FX7 A;  2EIF A;  4WF2 A;  1BI1 A;  3QYG B;  2V8K A;  2PU9 B;  5CIU A;  3OW2 S;  3RIR A;  4RG2 A;  3V7C A;  2YRV A;  2VC8 A;  4JRI A;  1WPY A;  2VV5 A;  5A2Q E;  2MMP A;  4M7D G;  1VQ9 T;  3BDL A;  4OMF B;  1UEB A;  5I21 A;  3OYN A;  3M56 A;  3CCJ T;  3JCM P;  3JB9 D;  2CGH A;  2PVD B;  2WSE E;  1M8V A;  3ZFJ A;  2V8J A;  1G3T A;  4HCC A;  2FB7 A;  2XD0 A;  2R58 A;  4QQD A;  4M77 D;  3JB9 J;  3QHS A;  4PJO G;  1RL2 A;  4FSX A;  2YLC A;  4FT2 A;  4NOY A;  3JCM Q;  2XDD A;  3ZEH A;  2E10 A;  4RKU E;  3T9N A;  4CRI A;  4M7A G;  2EAY A;  1H3Z A;  5LJ5 h;  2K4Y A;  4M78 F;  2K57 A;  3QO3 A;  2OTJ A;  2I2L A;  5CQY A;  3PT9 A;  2RHX A;  3CCR T;  3G7Z A;  4CI0 C;  3I56 A;  2EFI A;  3A8G B;  4IUQ A;  1VQL T;  4L59 A;  3QBY A;  4L6V 5;  4KUD K;  3CPW A;  3CD6 A;  4GLK A;  4XU3 A;  5C6S A;  3GOX A;  4ZTF A;  4M7D D;  1N6A A;  4L5G A;  3G71 T;  1FWZ A;  3OYF A;  3KUF A;  4OGC A;  3CC4 T;  2WSF E;  2MI6 A;  1UGS B;  2LTO A;  5HK0 A;  3CC2 T;  2EWN A;  4DQ2 A;  1BI3 A;  2LX9 A;  2RK1 A;  3M4G A;  5GAN g;  5GAN 4;  4EMK A;  3OYM A;  4MDW A;  1HXD A;  4PJO D;  4FM4 B;  1X75 C;  4JRP A;  4F7U A;  4B9X A;  4XTZ A;  3RMS A;  2MF2 A;  5D6W A;  4M7A D;  4Q5W A;  4C8Q E;  4E7I A;  4RG8 A;  3JCM h;  4BY6 B;  4E7J A;  2Y4X A;  4M75 E;  2OAU A;  3SWN A;  3BW1 A;  2M16 A;  4E7L A;  3CCE T;  5CAI A;  3A8L B;  1LJO A;  2EJ9 A;  4XTX A;  3LWH A;  2E6Z A;  2AHJ B;  1QVF S;  1DJ7 B;  3OYJ A;  1VQ7 A;  3DB3 A;  2DPP B;  4FU6 A;  1EIF A;  1OZ3 A;  1QVG S;  2C06 A;  1UGP B;  3A5Z B;  1YJN T;  4F7U B;  3S3N A;  3CBM A;  3KBG A;  1XTD A;  3QZ5 B;  3PNW C;  4IUR A;  1VQP A;  3OA6 A;  2FL7 A;  5HKC A;  1B34 A;  3C4S A;  2K5F A;  4UC4 A;  3V8J A;  1MHN A;  2RM4 A;  4DOW A;  5GAN 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...