5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Lhca1
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
2DXCA 2PVDB 2DPPB 4OB3B 2CZ7B 2DXBA 2QDYB 2ZPBB 1IREB 4OB0B 2CZ0B 3HHTB 3QYGB 3X24B 4OB1B 3QXEB 2WSEE 3QZ9B 3A8HB 2O01E 4ZGJB 3LW5E 3X20B 3VYGA 3X25B 1UGPB 2D0QB 3A8OB 2PVOB 3VYHB 4ZGEB 2CZ6B 2PU9B 2CZ1B 3WVDB 1UGRB 3WVEB 1DJ7B 1QP2A 1UGSB 4XK8E 2ZPIB 1AHJB 2ZPHB 2PVGB 3A8MB 4OB2B 2WSFE 2CYZB 1V29B 4L6V5 4ZGDB 2PUOB 3X28B 2ZPGB 2DD4A 4Y28E 2ZCFB 1GXIE 2ZPFB 2ZZDA 2PUKB 1JB0E 2DD5A 2ZPEB 3QYHB 4FM4B 4KT0E 3A8GB 3QZ5B 3A8LB 1QP3A 2AHJB 1PSEA 4RKUE 3X26B 1UGQB 1PSFA 5L8RE 2WSCE
chains in the Genus database with same CATH superfamily
2DPPB 5IHNA 3PMTA 3HHTB 3RMSA 3QXEB 3JB9J 1IGQA 2RNAA 4MZPA 2LCSA 2QEXA 3V8LA 3CBOA 3OB9A 3VUBA 3KBGA 2AIRB 1X27A 2YUQA 1VQ8A 4LD6A 2OAWA 1K0SA 1VQ5A 3RNJA 1JB0E 2DNUA 1KD1R 1WXUA 1AOJA 3LH5A 1ZA2B 1OU8A 4OVAA 2D0NA 2FPEA 2K9GA 2O4XB 3GNFB 2EKOA 2Y4YA 2KEAA 4L6V5 3GNGA 2KT8A 5KYUB 2DA9A 1QVFP 4BACA 1VQOT 3RMQA 5EG2A 3HRUA 2M16A 3EH1A 2CP0A 2HDAA 3ASKA 5CO7A 1N5ZA 2R58A 4EPCA 2J05A 1AZGB 3REBB 4M78C 1TUCA 3H0IA 1RACB 3CC2T 1VQLA 3CCLT 2O9VA 1HXDA 1JU5C 4ZGDB 1M1KC 3CC7T 2P0KA 1GBQA 1BIAA 4QW2A 4RTWA 3PNWC 1VQKT 1WX6A 3I5SA 4QQDA 3SB2A 4KBMB 3QZ9B 5AYFA 4C92F 4M7DF 3FJPA 4PJJA 3C0CA 3I5RA 2LRQA 2EIFA 3LGLA 3N5BB 5DLOA 1BYMA 2RQUA 3VS3A 3MEAA 1NJIC 3UATA 2NUPB 3OYIA 4C8QB 1HD3A 1G8XA 3O5ZA 3HP9A 3SWNA 2COZA 1KK7A 2W10A 3X24B 1GFCA 4M77A 1XJWB 2SEMA 2KGTA 1WFWA 2DKGA 3OW2S 1KQSA 4V2SA 1NPRA 2DTOA 1VQ6A 4R56A 4OGEA 1D3BB 1I81A 1RAIB 1YCYA 1Q82C 5CKEA 1EX4A 1X43A 1QVFS 4PJOG 5GAMd 3QZ5B 2HEQA 2YUOA 2ZAEA 1U3OA 2OTJA 2QASA 3JCMW 1VQLQ 1WQ7A 3CCSA 2HNIA 5I2SA 4BDYA 2JTEA 1UGRB 2E12A 4C5IA 3M0QA 1BI1A 2LTOA 2HQEA 2PUOB 4QT7A 1ZHIA 1NBEB 1WXTA 5CQXA 1K9MC 1GXIE 1X6OA 4M7AC 2K4YA 1R77A 1UHFA 2YHTA 2X4JA 2MMPA 2MWPA 4ZTFA 1K73R 4M75B 1M1KU 3NHNA 3SWNB 4FW2A 4PFZA 3MKDA 1SRMA 2L2PA 1RAGB 4M77E 5IXFA 4HVWA 3NFCA 2RH2A 4Q5WA 2DAQA 4C0ZA 4M77D 3URGA 2RB6A 2CP6A 2EQMA 1SEMA 3VS1A 5FU7C 1D0ZA 3A98A 2PUKB 3OA6A 1TUDA 3M57A 4M7DC 4RTUA 5LJ5h 2DM1A 3CCEQ 1K1ZA 1MNDA 1U06A 4M75E 3JCMQ 3NMZC 3M55A 3M4YA 4F7UB 1MV0B 3HRSA 3X20B 2ROTA 4XU1A 3JCMh 1FX7A 5LJ3f 3R6NA 3OS0A 2DJZA 1VQ7A 3G6ET 4M7DB 3D7SB 2O4XA 1T3LA 1KJWA 2A28A 4AG2C 1I0CA 4YTLA 3I35A 3AT1B 2BZYA 1ABQA 1X69A 4DOVA 2QAZA 2QA4A 3MCAB 3WVDB 3I56Q 5CKHA 2FZGB 4M7AA 1ZLMA 1R0CB 4D6WA 5HY6A 5GAMh 1MMDA 4E47A 3SEMA 4JRPA 4HCBA 1K9MU 1FMVA 4M78F 2AKLA 2RQTA 1KC8R 2Y4XA 3I55T 1EZZB 1WYXA 2L0AA 1YHQT 4BDZA 1S72T 1B3QA 1Y57A 1KSWA 2LP5A 3OYLA 4O5VA 2XU8A 2DRKA 4FU6A 4BY6C 3PFSA 5IXBA 3OYNA 5C0MA 3CXCA 5DLQE 2DK3A 2IPOB 3CC4Q 4MDWA 1D1BA 3JB9F 2V8IA 1SSHA 1Q82U 2MAMA 1SKUB 2DXUA 4WTOB 1HYOA 1NE8A 2VC8A 5GAN8 3RKYA 5LJ3j 3FEOA 4ATOA 5J39A 2XI9A 5M9OA 3CXCS 3VS0A 4PJOA 2FYKA 2KMTA 2D9TA 3E9GA 4X1VA 2P4RA 1QMCA 2DJQA 4LUEA 3VYGA 1KHCA 3H0FA 2JJ9A 1PKTA 2DL5A 2VWFA 1BU1A 1RL2A 2X3WD 4F7UE 2V1QA 2LCLA 2F69A 3CCST 1W1FA 3CBMA 2MF2A 2YLBA 2ECZA 2ZCFB 2ZPFB 2QEXQ 5LJ3g 3I56T 2KRSA 3JCMg 5HCKA 4M78A 4F17A 2L8DA 1B34A 4C92C 4AMCA 2L5QA 3ZBDA 1SHFA 4RTVA 3UF4A 1KQSP 1WNLA 4M7AF 4DBRA 2PU9B 4BI4A 1OI1A 1Y7XA 4WCIA 3MHXA 1VQKA 1O75A 1QP3A 1TWBA 4XU2A 1AD5A 1YIJA 2WSEE 2ZGWA 1R0BG 1N6AA 2PVOB 3CPFA 1JQQA 1M8VA 3PVQA 1N8RC 1RAEB 2NLUA 4BI3A 5CR2A 4C92G 2XDBA 1WLPB 3H8ZA 3QYHB 2GBQA 3INZA 5GJWB 1JRIA 3EGDB 1RADB 1UUEA 2J06A 1B34B 4TVRA 1VYTA 1TS9A 2E3IA 3AHUA 1ZX6A 1Y96A 3CCSQ 1G3WA 1VQ4T 3VRYA 3EGUA 3P8BB 4ZNXA 3VS5A 4FM4B 3TU4K 3OYGA 4PJOC 3E19A 3PMIA 3R6OA 4C8QE 3JSCA 3E9FA 1VQLT 1SHGA 4MMLA 1IB8A 1WHJA 1OX9A 4LDYA 3ER0A 1MV3A 1VIEA 2EQJA 3PTAA 5HK0A 4M75F 2YXYA 3M4GA 1YJWT 2QYZA 2LMJA 2LX7A 3EFOB 2XHCA 2BE9B 2DYBA 4KRTA 3EG2A 2DZ9A 2V1RA 3G4ST 1QWFA 1R8OB 4HCCA 2LNHB 1YI2A 1HJDA 2DLPA 5FWCA 5I21A 2EW3A 1FMKA 1VQ5Q 1F1BB 2DEQA 2G6FX 5A0GA 1K9AA 5C6SA 4Z8AA 1W2BA 3EFRA 2J6KA 3IQLA 3PT9A 3OYEA 1D0XA 3S3MA 2RA2A 4HVUA 4D8KA 3CCLQ 1Q7YU 1AWOA 3CCMA 2LJ1A 1VQKQ 2GCXA 2EPDA 3PIPA 3V7RA 3M58A 1JXOA 2OJ2A 3KXTA 2DYIA 2J6FA 2OTLQ 3CCRT 2M0OA 3HFNA 4F04B 1UGVA 4JJBA 1PNJA 4Y28E 1M27C 4LE9A 3L42A 4F7UG 3CMEQ 1UB4A 3FIFA 2EGAA 1C1AA 2EQKA 2E65A 2GFAA 1EIFA 1YJ9Q 1RAHB 2JMCA 4J9BA 5GMKl 2EJGA 3TREA 3V7CA 3QG1A 1ZUKA 3QIIA 3H6ZA 1SSFA 4GBQA 4LDWA 4N4IA 5CQYA 3TQ7P 2V26A 2CT4A 2K5LA 3OSSC 1Q95G 1G3SA 3O8VA 3EG0A 1XNIA 1NJIU 4HKEA 2LT4A 4DBQA 1BIBA 4XK8E 3OMGA 5FWBA 2B8AA 2DTHA 3H9NA 3BDUA 1M3CA 3OYJA 1VUBA 5A0LA 1K9MR 1VQ8T 1B7TA 1NEGA 1M3BA 2QI2A 2F1LA 2EQIA 4HCKA 3MEUA 3DB4A 3NTHA 2Z0WA 2LZ6B 2A7YA 2EYXA 3G1JA 2K79A 2VV5A 3PIOA 1Q81R 2OTJQ 1PRMC 2K3BA 2I2LA 4M7AE 2JS0A 2JM8A 2RQWA 3LYIA 1AEYA 2DXCA 3QJ6A 3EHRA 2CSQA 3HKSA 2B86A 2J6OA 4C5EA 2HL5C 4C0DC 3LW5E 2CP7A 3OQ5A 1BB9A 3VYHB 4M77C 5KYWB 2QA4Q 4RMOA 1M1FA 1RAFB 4OMQA 4BE1A 4AT1B 1G5VA 3M0PA 1TH7A 5LJ5f 1OULA 1ZA1B 4C0DB 3UT1A 4R0KA 4XU0A 4JZ3A 1X75C 2GFUA 2K3YA 1H92A 2KI7A 4JLGA 5CAIA 4HCZA 1W70A 2NUZA 2D1XA 4M7AB 2EWNA 4OB2B 2MYSA 2DD4A 4M75C 1NM7A 4ZN1A 1OEBA 3RDVA 3BDLA 4LDUA 1KFZA 3EHQA 1UTIA 2LQWA 3BFMA 1AZEA 1E7OA 1M90R 4PLIA 1RABB 2DILA 4DBHA 3H0HA 2PNIA 3J7AF 2RJFA 3CCUQ 5GAMf 3DLLA 2OTJT 2JN0A 4M7DD 4N0AA 1MHNA 5CKBA 1QCOA 1KQSS 1A0NB 4JJNK 5KE2A 4RCBA 4D8DA 2KNBB 2VB6A 1QLYA 4J9CA 3CMAA 1X01A 3WXMB 1FMWA 3M9QA 2YUPA 4JRIA 4E7ZA 5KYWA 1YITT 3TCJA 1H8KA 2GTOA 2KYBA 3JCMJ 2JM9A 4FYXB 1I4K1 5LJ5j 1YJNQ 1XOVA 3QWYA 2JXBA 2PVDB 3META 4MDXA 2PZ1A 1AWJA 3CD6Q 2QK0A 1UJYA 1YJWQ 3G4SA 1WIEA 1QVGP 2KDSA 3GF5A 2DD5A 2CP5A 4XQ3A 3MO8A 1KHIA 4XTUA 1M9SA 3G6EA 2ED0A 5GMKi 2YDLA 5LJ3e 3CCLA 1SF9A 2OI3A 1KQ2A 4A4GA 5IT9E 2DIGA 3X25B 3OYCA 4DBFA 2RO0A 2MWOA 1LOJA 1WHHA 4OMMA 3OSVA 5LJ5e 1KC8C 3CCEA 2O2OA 1Y0MA 2LT1A 3CCRQ 2ROLA 2JT4A 3NTKA 2F2XA 4IUUA 3A8LB 3OW2P 4HVVA 2RN8A 5LL6S 2EYWA 2ZPBB 5LJ3d 1FYNA 1W2BP 4Y92A 4JPBW 2M02A 1RLQC 1ZSZC 3NGPA 4C92B 1GRIA 5GAN7 2CKKA 4C8QD 1VQPT 2ZPGB 1QVFA 1KD1U 2RJDA 1VQ5T 4KULA 5FU6B 1BK2A 1I5LA 1OU9A 5IHKA 1X6GA 4E7SA 1JEGA 1YJWA 2HQHA 1LVKA 4J9GA 4L59A 5GANf 3G4SQ 5HKCA 2BE7D 1IXDA 2K5FA 5DM7R 1NEBA 2E64A 3FDRA 3REAB 4M7DA 2ABLA 1KIKA 1VQ7Q 5FU6C 3LH0A 1S1NA 1FXXA 4AFQC 2C0OA 2LJ0A 3M0RA 4C92E 3NPFA 2KAFA 4PJOD 1GFDA 3OYDA 4C92A 2DTIA 4OMOA 5KYYB 2E70A 4FSSA 2JTMA 3F70A 1WPYA 2RHIA 2JVVA 2DBKA 4JLIA 4C8QA 3OYMA 2GQVA 2MIOA 4M75D 1P92A 3SDZA 3FC3A 2BKDN 4N0AC 2EYZA 2GGRA 1M90U 4DOWA 3OBYA 3KFVA 5GAN3 3VU3C 2X4YA 4JJCA 3S3NA 2JTFA 4B9WA 4OMNA 1WHGA 3QSUA 1WXBA 3LX7A 4Z88A 4OB0B 2ENMA 4E7LA 2JUFA 4J9FA 1BCOA 4PKCC 2HL3A 3NTIA 2EAYA 5GAN5 4CC2A 3G71A 1YIJT 4PJOB 2X35A 3JCMV 4F16A 4GLKA 3EG9A 3FLGA 1OPLA 2QTVA 4J6XA 4RKUE 4IUQA 1YHQQ 1I5OB 3CCMQ 4AG1C 1PCXA 3I55Q 1IHVA 3PVLA 2DE0X 1WA7A 2RI2A 2CT3A 3Q1JA 4F7UF 2O88A 2A08A 1K73C 1BI3A 3C12A 2C06A 2QEXT 2FVUA 2KT1A 4C8QG 2CYZB 2RMOA 3C4SA 4XU3A 2HD0A 4MMKA 3TEEA 2YRVA 4LXCA 4XTVA 4JRQA 2LQ8A 3I56A 1WI7A 4OF1A 2CZ7B 1ZQ1A 2VGNA 1YITA 1IZ6A 3A8HB 2CDTA 1UHCA 3UPUA 3UDCA 4ZGEB 2RD1A 5IN1A 4EMKB 2RK2A 2M9UA 1RI9A 4KH0B 4ESRA 3LWIA 4M78B 4J7IA 2DZCA 2COWA 3RR6A 5FRMA 4IURA 1U8RA 2EFIA 2JOYA 4FYYB 3VS7A 1OQKA 4JRKA 2WSCE 1I07A 1NZ9A 2M1HA 8AT1B 3CCET 3A1PA 1M8MA 1YIJQ 5KYXA 2K5IA 2DERA 4M4ZA 4X9CA 1Z9ZA 2K2MA 5J3BA 1G3TA 1Z9QA 3EH2A 3CC4T 1C6VX 1MNEA 4E2FB 1QVGA 3RESA 2XKOC 4XTWA 3CPWA 1CKBA 4OB3B 3JCMX 2V8KA 1D09B 1OX8A 1PRLC 5LJ5d 1N27A 4WF2A 3QHSA 3CCQA 4DEYA 5KYUA 5CKFA 1GCQA 1S72A 2QXFA 1MGQA 1RUWA 1ARKA 3JB9D 4ELZC 4OMPA 4P5NA 4HXJA 3L2ZA 1J3TA 1UGQB 3SFMA 1M30A 1M3AA 1LNXA 2KVQG 1CKAA 1IREB 1ZBXA 3L2QA 1QVPA 1JBMA 2MI6A 3GP8A 4KGZB 5GAOn 2IVWA 3QBYA 3CCJT 4J83A 5J26A 2BZ8A 1WDXA 3BW1A 4EMGA 1G3YA 2KY9A 2PVGB 3S6WA 2H3JA 2QQRA 4GLMA 5LJ3h 2HKQB 4M75G 3CEYA 2P0QA 2XD0A 1V1CA 4LD9K 3QYGB 2DF6A 2BZXA 1VQ7T 1RLPC 4IUPA 1VYUA 5KYXB 3SWNC 4HT8A 3EFOA 1N9RA 2A37A 4FW1A 2EGCA 1UFFA 5GAMg 3QKJA 2KRMA 4RTYA 2VUBA 3JRZA 2MK5A 2R5AA 3X26B 5FU7B 4PJOF 2VKNA 1TUGB 2QDYB 2AZVA 3P8HA 4KGVB 2JW4A 2K3XA 5KYYA 1UGPB 3CCUA 3CC7Q 1SG5A 2DL7A 2JMAA 2JZ2A 2Y90A 1OZ2A 1SRLA 3G71Q 4PLLA 1JJ2P 1IGUA 3QDRB 2MOXA 2L3RA 4B9XA 1Y07A 1KD1C 3GIBA 2OX7A 1VOMA 3QO3A 2DVJA 2E6ZA 2XMFA 5GAN4 2KR3A 1JO8A 2CS7A 1PHTA 1X2KA 1VQMT 2AZSA 4O6JA 2RHYA 5FW9A 2R57A 5L23A 1UGSB 3RIRA 1Q7YR 4JDSA 1H641 1YN8A 2OTLA 2M0YA 1YI2Q 4E7KA 2E41A 1M2VB 1Q81C 2RF0A 4IUTA 4QQ6A 3TSZA 1YNZA 4ORZA 1W4SA 2VVKA 1VQNT 2EJ9A 2RQVA 3I9QA 3CD6A 2HAXA 3L2UA 4IKFA 4CI0C 3CD6T 4RG2A 3VKIA 3H41A 4J6WA 2WSFE 1H3HA 3OYBA 1KQ1A 3X28B 1Y71A 4MZMA 5IH2A 4BY6B 2HBPA 4A63B 1BBZA 2FRYA 4RCCA 4ANJA 2EJFA 4C0GA 3CC7A 4OMLA 3RKXA 3OBWA 5EC7A 5CCAA 4ELYC 4A4KA 2F2WA 2RI3A 4LDXA 1VA7A 2KBTA 4J6YA 3UA6A 3M56A 4PJLA 3EGXB 3U23A 2RJCA 2M51A 4A4FA 1NJIR 3KUFA 2ZPHB 2HSPA 1YJ9T 1VQNA 1PD1A 4FCYA 3HL8A 2RPNA 2CREA 4PK4A 2RK1A 4HT9A 3PE0A 1G2BA 3JCMf 3CPWS 2D6FA 3DKMA 3RBBB 2KXDA 2OTLT 3CC4A 3MJXA 3JCMe 2XICA 5GMKh 1BCMA 3JCMb 2FL7A 3CCUT 1N8RU 5HK3A 3EG9B 2CZ1B 2ESWA 3M0TA 2NUTB 4OGCA 2LNVA 4LN2A 1MUZA 4QVCA 3L2RA 3S3OA 3GBQA 4M7DE 2KSSA 2KRNA 2YUNA 1K4US 1HK9A 2KQWA 1M2VA 2DMOA 1WHLA 3JCMd 4RG8A 2E5QA 1U1SA 2L89A 2EYQA 5GANh 1Q81U 3EG3A 3L2VA 4II1A 5GAMe 2OAUA 3OS2A 1V76A 3LWHA 4JUVA 1K8AC 5I2MA 1WGSA 2G3RA 2FRWA 2BUDA 1VQOA 1TOVA 3M0UA 1AWWA 1NYGA 3HSBA 4DEXA 1VQNQ 4RTTA 3EGDA 4PL6A 2KK4A 2F2VA 2QA4T 1WHKA 2O31A 2W0ZA 4OP0A 2CH4A 3WVEB 4DA4A 1YI2T 2GTJA 3MEWA 2QGFB 1GCPA 2FPFA 2DL4A 1WJQA 2WACA 2EVRA 2FZKB 1IHWA 2L3PA 2VYTA 2QQBA 2DEUA 4MZTA 2LX9A 2EKHA 1VQ8Q 4RTZA 3G71T 1WZOA 2ATCB 4FL6A 1VIFA 3HRTA 4A54A 3A8OB 2E10A 1M1GA 4BD3A 4PFPA 5GAN2 3CCVA 1GCQC 5GMKe 1AHJB 2PTKA 5CVIA 2XK0A 2KE9A 1YBYA 3ZEHA 2C0IA 2RI5A 1PKSA 3GPLA 1WHMA 5GAOm 3CBPA 4ZGJB 1N8RR 1VQ4A 4NL3A 2D0QB 5IHIA 2VGMA 4QKUA 3OMCA 2L3SA 1D1AA 2E6NA 1JJ2S 2P0PA 2AT1B 3PGGA 1I1JA 4RTXA 2GF7A 2X3XD 2NUPA 1AVZC 2RHUA 1T0JA 5GANd 3THKA 2LQNA 4N4GA 2DIQA 2K2VA 1VQ9T 2LC4A 4IIOA 4PJNA 1BKBA 4VUBA 3FJ5A 3JV3A 5IAYA 2YWWA 2COYA 2E1HA 1LCKA 2FG0A 3CMET 2HZYA 2RJEA 2CZ6B 3JB9I 1KG1A 1QCFA 1M1KR 2MCNA 1X6BA 2XG8D 2CSIA 1KC8U 4XTYA 2NYSA 3CXCP 2DXTA 3CQTA 6AT1B 1CSKA 4PJOE 5GAOr 1MMNA 1ZSGA 2RHXA 5DY9A 3CCVQ 1UJ0A 4KH1B 2KXCA 3VV0A 1QVGS 5CKDA 4M75A 1RAAB 2DBMA 1SPKA 3V8KA 4KGXB 3CCJA 1OPKA 1QP2A 4X34A 3TVTA 4Z89A 3VJPA 4IIMA 2D8HA 3CCQQ 3JCMc 2QDLA 2ZPEB 2NUTA 5FLXE 2IG0A 3C94A 2X4XA 3VUZA 3FRNA 4E7HA 2QQ9A 2MPXC 1D1CA 2CP3A 3QUIA 3J80E 4BB7A 4CC3A 4Y91A 4A53A 4A4EA 8ATCB 3FB9A 4JS4A 1U5SA 2J7IA 2NWMA 2K7AA 1ZBJA 3VS6A 2DL8A 4LUDA 4AFZC 4IUVA 1QKWA 2P4TA 4KUDK 2EGEA 2JNGA 3OYYA 4AFUC 1WJSA 4J9EA 1YJ9A 4EMKC 3M54A 1S72Q 4J5YA 4BE2A 2BTTA 1NPPA 2ED1A 2FZCB 5I22A 4PNOA 1C0MA 2I0NA 2E3HA 1UDLA 1VQMQ 4PJMA 3QJYA 1M4ZA 2FO0A 3E2UA 1AWXA 2FHDA 3VS2A 5GAOl 3OYKA 1QW1A 1W6XA 2AKKA 1Q82R 3EAEA 4C8QC 4ME7A 4FSXA 2O01E 1VQ6T 1PC0A 3L2WA 3HPWA 1VQ4Q 4GY5A 2A3LA 5GJVB 5ECAA 1UECA 3CCMT 1NG2A 5D6YA 1V29B 4M7AD 1PWTA 4JJDA 1TTHB 2YRCA 2QGGA 2GNCA 2A36A 2YRDA 2FEIA 5LJ5g 1PSFA 2K6DA 2VXEA 3G6EQ 3DB3A 1TSFA 2YT6A 1E6GA 2QQAA 5I11A 1Y96B 1TG0A 3ULRB 2CGHA 2VASA 3ZFJA 1ZUYA 1PD0A 3QWXX 3CMAT 2F5KA 1NLPC 3DLMA 2X51A 3VRZA 1LJOA 3P8DA 4M7DG 1QWEA 4BI8B 5KE3A 4F14A 4CC4B 2EQUA 1VQPA 1UE9A 4J9IA 1VYVA 2BIVA 3M53A 1YP5A 5AT1B 1JJ2A 5GAMj 2GQIA 3CCJQ 3TSWA 3HTRA 2H3EB 1ZSZA 1JXMA 3JCMP 5A0DA 1LPLA 5CK9A 1Q7YC 3GOXA 3EG1A 1UG1A 3UWNA 2R5MA 2DXBA 1W2BS 2CZ0B 4M77B 5GAOp 2HKNA 1WQWA 4FIBA 4K11A 3HFOA 1GL5A 4QVZA 1M2OA 4DQ2A 3V7SA 2DX1A 3LLRA 1UEBA 3L1AA 1K73U 1RI0A 1EFNA 1WJRA 1YFNA 7AT1B 3M0SA 3M59A 4M78D 4FYWB 4E7JA 3JAME 4EMKA 4KUIA 3CC2A 3ME9A 2O9SA 2XIDA 3QPHA 1QQJA 4RUGA 4EIKA 5A2QE 3V8JA 3A8MB 3E1SA 3C95A 1XTDA 1Q86U 5GMKm 2ZZDA 3CMAQ 1PM3A 1BI2A 1M5Q1 2PQWA 4FT2A 3SD4A 3OYFA 4OMFB 2KYMA 1Q86C 2CP2A 1ABOA 5KYNA 5CIUA 3CCQT 9ATCB 1K8AU 5FRNA 3EFSA 4EDUA 1X2QA 5KH6A 2P84A 1MMAA 3QDFA 1YWOA 1VQPQ 2LQKA 3VS4A 4NL2A 2XDDA 1VQ6Q 4L5GA 2SRCA 3T9NA 4A4HA 2DO3A 1YWPA 2E5KA 3BY7A 2DVEA 1IO6A 1NLOC 5GAN6 1VQMA 1OOTA 2EBPA 5D7UA 2IIMA 3JB9G 1VQOQ 2X9HA 4X9DA 4B6MA 2V8JA 5L8RE 2DL3A 4QVDA 4C8QF 4JS5A 1VQ9Q 2RHZA 2F5TX 1TU0B 2D8JA 3CMEA 4ZN3A 1MMGA 4J7FA 4CC7A 2AK5A 1G83A 2HMAA 4XAXB 1T3SA 4FT4A 1YJNT 4EMHA 2LJ3A 2AHJB 4J9DA 3MEVA 3ZL7C 3M5AA 4LNPA 5KCHA 1YITQ 3CCRA 2K57A 3OY9A 2E4HA 1D0YA 5D6XA 3MPUB 3BE3A 3CPWP 1K76A 2LCCA 1AT1B 2KROA 3I55A 1D3BA 3EGXA 1TXQA 1ZUUA 1BI0A 4KT0E 3MP1A 4ZTJA 2CUBA 4JZ4A 1PSEA 1N9SA 3A5ZB 1FWZA 4M7AG 5D6WA 1ACMB 1ZSZB 4CRIA 3GLXA 5FROA 3J81E 2X4WA 4XTZA 2YSQA 2FPDA 1NYFA 2LDMA 3CCVT 4R55A 2DETA 1YCSB 4M77F 2QQSA 2A0FB 4F7UA 5GANe 4HA8A 3G7ZA 3JB9H 3A8GB 4PFOA 1M90C 1YJNA 2HBWA 4OB1B 1K8AR 2CH4W 5GMKj 1H3ZA 1U1TA 1I8FA 4UC4A 4XTXA 4NOYA 1OV3A 4M78E 4Z02A 1VQ9A 2FB7A 1XQHA 4E6RA 1Q86R 2HCKA 4N4HA 3OYAA 1OYXA 2HQXA 4E7IA 2QG9B 3MP8A 4AFSC 1O9SA 4J9HA 5GANg 5GANj 2VXFA 4M77G 3SHWA 1E6HA 1QKXA 2DRMA 2ZPIB 2L3QA 2JS2A 3CC2Q 2EYYA 3OS5A 4FYVB 1QCNA 4LDVA 2LVMA 5GAOq 1B07A 1GBRA 2RM4A 3RERA 2DFUA 1IRXA 5KCOA 2RQRA 1PG5B 3OYHA 4QQGA 4NS5A 4C0FA 4BE0A 2HSEB 1OZ3A 4M78G 1T0HA 3OW2A 3MP6A 4C5HA 2QTXA 2CUDA 3UA7A 1DJ7B 4BUGA 2XDPA 3OS1A 3LGFA 4J8OA 1YHQA 3RUXA 1K0XA 4C92D 2C0TA 4C5GA 2H8HA 2YLCA 1HSQA 3RKWA
chains in the Genus database with same CATH topology
2DPPB 2DZ9A 2RHXA 3G4ST 3PMTA 1R8OB 5DY9A 4HCCA 3HHTB 3RMSA 3QXEB 1YI2A 3JB9J 2RI2A 3Q1JA 4MZPA 3VV0A 4F7UF 2QEXA 5CKDA 1QVGS 3V8LA 5I21A 3CBOA 1BI3A 3OB9A 4M75A 3C12A 3VUBA 1K73C 3V8KA 2C06A 3KBGA 2DEQA 3CCJA 1QP2A 5A0GA 2FVUA 2QEXT 5C6SA 4X34A 2CYZB 3C4SA 3VJPA 4XU3A 2HD0A 4C8QG 1W2BA 3EFRA 4MMKA 1VQ8A 4LD6A 3TEEA 3JCMc 3PT9A 1VQ5A 2YRVA 1JB0E 2ZPEB 5FLXE 4XTVA 3OYEA 4JRQA 2IG0A 3C94A 2LQ8A 2X4XA 3I56A 3VUZA 3FRNA 4E7HA 2QQ9A 3S3MA 4OF1A 2RA2A 1Q7YU 2CZ7B 3QUIA 1ZQ1A 2VGNA 3J80E 4BB7A 1YITA 3CCMA 4Y91A 4A53A 4A4EA 1IZ6A 2GCXA 3A8HB 3UPUA 4OVAA 3PIPA 3UDCA 3V7RA 3M58A 2O4XB 4ZGEB 3FB9A 3GNFB 2EKOA 2RD1A 2Y4YA 5IN1A 4EMKB 3KXTA 4JS4A 2RK2A 2M9UA 3CCRT 2M0OA 3HFNA 3LWIA 4L6V5 4M78B 3GNGA 4Y28E 4J7IA 2DZCA 3L42A 4F7UG 1UB4A 3FIFA 5FRMA 4IURA 4BACA 1VQOT 1U8RA 4IUVA 2EFIA 2JOYA 3RMQA 2P4TA 4KUDK 5EG2A 4JRKA 3HRUA 2EQKA 2GFAA 2E65A 2M16A 2WSCE 1EIFA 1NZ9A 3ASKA 2JNGA 2M1HA 5CO7A 2R58A 3CCET 3OYYA 4EPCA 1WJSA 1YJ9A 4EMKC 5GMKl 3M54A 2K5IA 2EJGA 4X9CA 4J5YA 4BE2A 4M78C 3TREA 1NPPA 3V7CA 3CC2T 4PNOA 5J3BA 1G3TA 3CCLT 3QG1A 1VQLA 1HXDA 3QIIA 3H6ZA 1SSFA 3CC4T 4ZGDB 3QJYA 1M4ZA 1M1KC 4LDWA 2FHDA 3CC7T 2P0KA 1QVGA 5GAOl 4N4IA 5CQYA 3RESA 2XKOC 4XTWA 1BIAA 3OYKA 3CPWA 4QW2A 1QW1A 2K5LA 3OSSC 4OB3B 3EAEA 3JCMX 3PNWC 1VQKT 4QQDA 4C8QC 2V8KA 4ME7A 1G3SA 3O8VA 5LJ5d 3SB2A 4KBMB 3QZ9B 4FSXA 2O01E 5AYFA 1VQ6T 1N27A 4WF2A 4C92F 3QHSA 1XNIA 3CCQA 1NJIU 3L2WA 3FJPA 3HPWA 4M7DF 4GY5A 5CKFA 2A3LA 4HKEA 2LT4A 1S72A 1BIBA 2QXFA 4XK8E 1MGQA 3OMGA 3CCMT 5D6YA 1V29B 2LRQA 2B8AA 2EIFA 2DTHA 3LGLA 3N5BB 5DLOA 4M7AD 1BYMA 3JB9D 3MEAA 4ELZC 4P5NA 1NJIC 3BDUA 3OYIA 4C8QB 3L2ZA 5LJ5g 1UGQB 1PSFA 3SFMA 2VXEA 3OYJA 1VUBA 3HP9A 3DB3A 1LNXA 2KVQG 3SWNA 5A0LA 1VQ8T 1IREB 1ZBXA 3X24B 3L2QA 1QVPA 1JBMA 2MI6A 4M77A 3GP8A 2QQAA 2QI2A 5GAOn 2IVWA 3QBYA 3CCJT 1Y96B 4J83A 2DKGA 3OW2S 5J26A 1KQSA 2CGHA 3DB4A 3BW1A 3MEUA 3NTHA 4V2SA 3ZFJA 1NPRA 4EMGA 1G3YA 2A7YA 2KY9A 2DTOA 1VQ6A 4R56A 2PVGB 4OGEA 3CMAT 3S6WA 2VV5A 3PIOA 1D3BB 1I81A 2F5KA 2H3JA 1YCYA 2QQRA 3DLMA 5CKEA 1Q82C 1QVFS 1LJOA 2I2LA 4M7AE 4PJOG 5GAMd 5LJ3h 3P8DA 3QZ5B 4M7DG 3LYIA 4BI8B 4M75G 3CEYA 2DXCA 2OTJA 2P0QA 3QJ6A 5KE3A 2XD0A 3HKSA 4LD9K 3JCMW 3QYGB 4C5EA 2EQUA 1VQ7T 4C0DC 1VQPA 3LW5E 1WQ7A 4IUPA 2BIVA 3M53A 3CCSA 2HNIA 3OQ5A 3SWNC 5I2SA 4HT8A 3VYHB 4M77C 4BDYA 1UGRB 1N9RA 2E12A 4C5IA 4RMOA 5GAMj 1JJ2A 1M1FA 5GAMg 1BI1A 2LTOA 3QKJA 2HQEA 2PUOB 1ZHIA 4BE1A 5CQXA 1K9MC 1GXIE 2VUBA 3JRZA 3JCMP 1X6OA 1G5VA 4M7AC 2K4YA 5A0DA 5CK9A 1TH7A 2R5AA 5LJ5f 1Q7YC 3GOXA 3X26B 2YHTA 2X4JA 5FU7B 4PJOF 3UWNA 4C0DB 2R5MA 2MMPA 2MWPA 4ZTFA 4M75B 3UT1A 2DXBA 2QDYB 1W2BS 1M1KU 3P8HA 3SWNB 2CZ0B 4M77B 4XU0A 1X75C 5GAOp 2GFUA 2K3XA 2K3YA 3CCUA 1UGPB 2JZ2A 4JLGA 4M77E 2Y90A 1OZ2A 3NFCA 4HCZA 5CAIA 1WQWA 2RH2A 4Q5WA 4PLLA 4FIBA 2DAQA 4M7AB 2EWNA 3HFOA 4OB2B 4M77D 3URGA 2RB6A 3QDRB 4QVZA 2EQMA 2L3RA 3V7SA 5FU7C 4DQ2A 2DD4A 4B9XA 1Y07A 3LLRA 2PUKB 4M75C 4ZN1A 1UEBA 3OA6A 3L1AA 1K73U 1KD1C 3M57A 3GIBA 4M7DC 1RI0A 3QO3A 2E6ZA 5LJ5h 3BDLA 4LDUA 1WJRA 4M75E 3JCMQ 5GAN4 3M59A 4M78D 3M55A 4E7JA 3JAME 3BFMA 2CS7A 4EMKA 3M4YA 4KUIA 4F7UB 3CC2A 3HRSA 3X20B 3ME9A 1VQMT 4O6JA 4PLIA 4XU1A 2XIDA 3QPHA 1FX7A 3JCMh 2RHYA 2R57A 5LJ3f 5A2QE 3J7AF 2RJFA 1UGSB 3V8JA 3A8MB 3OS0A 2DJZA 3RIRA 3E1SA 4JDSA 5GAMf 3G6ET 3DLLA 1VQ7A 1H641 4M7DB 3C95A 2OTLA 2OTJT 2JN0A 2O4XA 4M7DD 1XTDA 1MHNA 4N0AA 1Q86U 5GMKm 2ZZDA 4E7KA 2E41A 1BI2A 5CKBA 1M5Q1 2PQWA 1Q81C 1KQSS 4FT2A 4YTLA 3SD4A 5KE2A 4JJNK 4IUTA 4QQ6A 3OYFA 4RCBA 1W4SA 3CMAA 1VQNT 2EJ9A 4OMFB 1X01A 1Q86C 3CD6A 2HAXA 3WXMB 4DOVA 3L2UA 4IKFA 4CI0C 5CIUA 2QA4A 3M9QA 3MCAB 4JRIA 3CCQT 3CD6T 3WVDB 1K8AU 4RG2A 5CKHA 1YITT 3TCJA 4M7AA 3VKIA 5FRNA 4J6WA 4D6WA 2WSFE 3EFSA 4EDUA 5HY6A 5GAMh 3JCMJ 3OYBA 1KQ1A 4E47A 3X28B 1I4K1 1Y71A 4MZMA 5KH6A 4JRPA 4BY6B 2HBPA 1K9MU 4HCBA 5LJ5j 1XOVA 2LQKA 4M78F 4RCCA 2EJFA 4C0GA 2Y4XA 4NL2A 2PVDB 3RKXA 3I55T 3CC7A 2XDDA 3OBWA 5CCAA 4ELYC 3META 4A4KA 4L5GA 1YHQT 2RI3A 3T9NA 4LDXA 4BDZA 4J6YA 4MDXA 1S72T 4A4HA 2DO3A 3M56A 3BY7A 3OYLA 4O5VA 2XU8A 2DVEA 2RJCA 4FU6A 4BY6C 5GAN6 1VQMA 4A4FA 3PFSA 3KUFA 2ZPHB 1YJ9T 1VQNA 3OYNA 3OYDA 3G4SA 5C0MA 3HL8A 3CXCA 5DLQE 3JB9G 2DK3A 2KDSA 4MDWA 3GF5A 3JB9F 2DD5A 2RK1A 2V8IA 1Q82U 4HT9A 4X9DA 4XQ3A 3JCMf 3MO8A 2V8JA 1KHIA 3DKMA 5L8RE 3CPWS 2D6FA 4QVDA 4XTUA 2MAMA 2OTLT 1M9SA 3CC4A 2DXUA 4C8QF 5GMKi 3G6EA 4JS5A 2RHZA 5LJ3e 3CCLA 2F5TX 3JCMe 2XICA 5GMKh 1KQ2A 1NE8A 3JCMb 4A4GA 5IT9E 2DIGA 3CMEA 2FL7A 2VC8A 3X25B 3RKYA 5LJ3j 5GAN8 4ZN3A 5HK3A 3CCUT 1N8RU 3OYCA 2CZ1B 2RO0A 3FEOA 4ATOA 4OGCA 5J39A 2MWOA 1LOJA 2LNVA 2XI9A 4J7FA 5M9OA 3OSVA 5LJ5e 4QVCA 3L2RA 1KC8C 3CCEA 3CXCS 4XAXB 3S3OA 2FYKA 4PJOA 2LT1A 2KMTA 4FT4A 1YJNT 4EMHA 2KSSA 4M7DE 3NTKA 2D9TA 3E9GA 4IUUA 1HK9A 3A8LB 2AHJB 2KQWA 3MEVA 3VYGA 3M5AA 5LL6S 1KHCA 5KCHA 2ZPBB 5LJ3d 3CCRA 3JCMd 2E5QA 1U1SA 4RG8A 2L89A 1RL2A 2EYQA 5GANh 2K57A 3OY9A 3L2VA 4II1A 1Q81U 5GAMe 4C92B 5D6XA 2OAUA 4F7UE 5GAN7 3OS2A 2LCLA 2CKKA 2F69A 4C8QD 3LWHA 4JUVA 3CCST 1VQPT 3CBMA 2LCCA 2MF2A 1K8AC 5I2MA 1WGSA 2G3RA 3I55A 2YLBA 2ZPGB 1D3BA 2ZCFB 1QVFA 1KD1U 2ZPFB 1BI0A 2BUDA 4KT0E 3MP1A 5LJ3g 2RJDA 4ZTJA 3I56T 1VQOA 3JCMg 1PSEA 1N9SA 3A5ZB 1FWZA 4KULA 4M78A 5D6WA 5FU6B 1VQ5T 4M7AG 3HSBA 2L8DA 4CRIA 1B34A 3GLXA 5FROA 4C92C 3J81E 2X4WA 4XTZA 1I5LA 2L5QA 3ZBDA 2LDMA 1YJWA 3CCVT 4PL6A 2KK4A 4L59A 5GANf 1WNLA 4M7AF 2QA4T 4OP0A 5HKCA 4R55A 2K5FA 2PU9B 2E64A 4M77F 3WVEB 5DM7R 2QQSA 3FDRA 4BI4A 4DA4A 1OI1A 1Y7XA 4F7UA 3MHXA 4HA8A 5GANe 4M7DA 1YI2T 3G7ZA 3MEWA 1VQKA 1O75A 5FU6C 3LH0A 1WJQA 2WACA 3JB9H 1FXXA 3A8GB 1QP3A 2VYTA 2QQBA 1M90C 4MZTA 4XU2A 2LX9A 1YJNA 4C92E 3G71T 2KAFA 4PJOD 1YIJA 4FL6A 4OB1B 2WSEE 2ZGWA 5GMKj 1VIFA 3HRTA 4A54A 1H3ZA 1N6AA 3A8OB 2E10A 2DTIA 1U1TA 1M1GA 2PVOB 3CPFA 4C92A 1I8FA 4BD3A 1M8VA 5GAN2 3CCVA 2E70A 1N8RC 4UC4A 5GMKe 1AHJB 2NLUA 4XTXA 4BI3A 2JTMA 4NOYA 3F70A 5CR2A 4C92G 5CVIA 2XK0A 4M78E 2XDBA 3H8ZA 1WPYA 2RHIA 4Z02A 2FB7A 1VQ9A 3QYHB 1YBYA 2JVVA 3INZA 1XQHA 4JLIA 3ZEHA 4C8QA 3OYMA 2GQVA 1JRIA 2RI5A 4M75D 4N4HA 3GPLA 3OYAA 1P92A 3SDZA 1B34B 1OYXA 2HQXA 2BKDN 4TVRA 4N0AC 3FC3A 5GAOm 4E7IA 3MP8A 3CBPA 1O9SA 5GANg 5GANj 4ZGJB 2VXFA 1VQ4A 1M90U 3AHUA 4M77G 4DOWA 4NL3A 1Y96A 2D0QB 2VGMA 3OBYA 3OMCA 5GAN3 3VU3C 1G3WA 2E6NA 1VQ4T 2X4YA 3S3NA 2ZPIB 2JTFA 1JJ2S 2P0PA 4B9WA 3PGGA 3P8BB 3OS5A 4LDVA 4FM4B 2GF7A 3TU4K 3QSUA 2LVMA 3OYGA 4PJOC 5GAOq 2RHUA 4C0ZA 3E19A 5GANd 3PMIA 2DIQA 2K2VA 2RM4A 3R6OA 4N4GA 2LC4A 4C8QE 1VQ9T 3LX7A 3JSCA 3RERA 4OB0B 5KCOA 3E9FA 1BKBA 1VQLT 4VUBA 4MMLA 4E7LA 5IAYA 3OYHA 2JUFA 4QQGA 4NS5A 2E1HA 4C0FA 4LDYA 4BE0A 1OZ3A 4M78G 4PKCC 3CMET 3OW2A 3MP6A 4C5HA 2RJEA 3ER0A 2CZ6B 3JB9I 2QTXA 1VIEA 2EAYA 3NTIA 2EQJA 1DJ7B 4BUGA 2XDPA 3PTAA 5GAN5 1KG1A 3OS1A 5HK0A 4M75F 3LGFA 3M4GA 4J8OA 3G71A 1YJWT 1YHQA 2XG8D 3RUXA 1YIJT 1KC8U 2X35A 4XTYA 3JCMV 4PJOB 4GLKA 4C92D 2DXTA 2XHCA 3FLGA 4C5GA 2YLCA 4J6XA 4RKUE 4PJOE 4IUQA 5GAOr 3RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC A;  2PVD B;  2DPP B;  4OB3 B;  2CZ7 B;  2DXB A;  2QDY B;  2ZPB B;  1IRE B;  4OB0 B;  2CZ0 B;  3HHT B;  3QYG B;  3X24 B;  4OB1 B;  3QXE B;  2WSE E;  3QZ9 B;  3A8H B;  2O01 E;  4ZGJ B;  3LW5 E;  3X20 B;  3VYG A;  3X25 B;  1UGP B;  2D0Q B;  3A8O B;  2PVO B;  3VYH B;  4ZGE B;  2CZ6 B;  2PU9 B;  2CZ1 B;  3WVD B;  1UGR B;  3WVE B;  1DJ7 B;  1QP2 A;  1UGS B;  4XK8 E;  2ZPI B;  1AHJ B;  2ZPH B;  2PVG B;  3A8M B;  4OB2 B;  2WSF E;  2CYZ B;  1V29 B;  4L6V 5;  4ZGD B;  2PUO B;  3X28 B;  2ZPG B;  2DD4 A;  4Y28 E;  2ZCF B;  1GXI E;  2ZPF B;  2ZZD A;  2PUK B;  1JB0 E;  2DD5 A;  2ZPE B;  3QYH B;  4FM4 B;  4KT0 E;  3A8G B;  3QZ5 B;  3A8L B;  1QP3 A;  2AHJ B;  1PSE A;  4RKU E;  3X26 B;  1UGQ B;  1PSF A;  5L8R E;  2WSC E; 
#chains in the Genus database with same CATH topology
 2DPP B;  5IHN A;  3PMT A;  3HHT B;  3RMS A;  3QXE B;  3JB9 J;  1IGQ A;  2RNA A;  4MZP A;  2LCS A;  2QEX A;  3V8L A;  3CBO A;  3OB9 A;  3VUB A;  3KBG A;  2AIR B;  1X27 A;  2YUQ A;  1VQ8 A;  4LD6 A;  2OAW A;  1K0S A;  1VQ5 A;  3RNJ A;  1JB0 E;  2DNU A;  1KD1 R;  1WXU A;  1AOJ A;  3LH5 A;  1ZA2 B;  1OU8 A;  4OVA A;  2D0N A;  2FPE A;  2K9G A;  2O4X B;  3GNF B;  2EKO A;  2Y4Y A;  2KEA A;  4L6V 5;  3GNG A;  2KT8 A;  5KYU B;  2DA9 A;  1QVF P;  4BAC A;  1VQO T;  3RMQ A;  5EG2 A;  3HRU A;  2M16 A;  3EH1 A;  2CP0 A;  2HDA A;  3ASK A;  5CO7 A;  1N5Z A;  2R58 A;  4EPC A;  2J05 A;  1AZG B;  3REB B;  4M78 C;  1TUC A;  3H0I A;  1RAC B;  3CC2 T;  1VQL A;  3CCL T;  2O9V A;  1HXD A;  1JU5 C;  4ZGD B;  1M1K C;  3CC7 T;  2P0K A;  1GBQ A;  1BIA A;  4QW2 A;  4RTW A;  3PNW C;  1VQK T;  1WX6 A;  3I5S A;  4QQD A;  3SB2 A;  4KBM B;  3QZ9 B;  5AYF A;  4C92 F;  4M7D F;  3FJP A;  4PJJ A;  3C0C A;  3I5R A;  2LRQ A;  2EIF A;  3LGL A;  3N5B B;  5DLO A;  1BYM A;  2RQU A;  3VS3 A;  3MEA A;  1NJI C;  3UAT A;  2NUP B;  3OYI A;  4C8Q B;  1HD3 A;  1G8X A;  3O5Z A;  3HP9 A;  3SWN A;  2COZ A;  1KK7 A;  2W10 A;  3X24 B;  1GFC A;  4M77 A;  1XJW B;  2SEM A;  2KGT A;  1WFW A;  2DKG A;  3OW2 S;  1KQS A;  4V2S A;  1NPR A;  2DTO A;  1VQ6 A;  4R56 A;  4OGE A;  1D3B B;  1I81 A;  1RAI B;  1YCY A;  1Q82 C;  5CKE A;  1EX4 A;  1X43 A;  1QVF S;  4PJO G;  5GAM d;  3QZ5 B;  2HEQ A;  2YUO A;  2ZAE A;  1U3O A;  2OTJ A;  2QAS A;  3JCM W;  1VQL Q;  1WQ7 A;  3CCS A;  2HNI A;  5I2S A;  4BDY A;  2JTE A;  1UGR B;  2E12 A;  4C5I A;  3M0Q A;  1BI1 A;  2LTO A;  2HQE A;  2PUO B;  4QT7 A;  1ZHI A;  1NBE B;  1WXT A;  5CQX A;  1K9M C;  1GXI E;  1X6O A;  4M7A C;  2K4Y A;  1R77 A;  1UHF A;  2YHT A;  2X4J A;  2MMP A;  2MWP A;  4ZTF A;  1K73 R;  4M75 B;  1M1K U;  3NHN A;  3SWN B;  4FW2 A;  4PFZ A;  3MKD A;  1SRM A;  2L2P A;  1RAG B;  4M77 E;  5IXF A;  4HVW A;  3NFC A;  2RH2 A;  4Q5W A;  2DAQ A;  4C0Z A;  4M77 D;  3URG A;  2RB6 A;  2CP6 A;  2EQM A;  1SEM A;  3VS1 A;  5FU7 C;  1D0Z A;  3A98 A;  2PUK B;  3OA6 A;  1TUD A;  3M57 A;  4M7D C;  4RTU A;  5LJ5 h;  2DM1 A;  3CCE Q;  1K1Z A;  1MND A;  1U06 A;  4M75 E;  3JCM Q;  3NMZ C;  3M55 A;  3M4Y A;  4F7U B;  1MV0 B;  3HRS A;  3X20 B;  2ROT A;  4XU1 A;  3JCM h;  1FX7 A;  5LJ3 f;  3R6N A;  3OS0 A;  2DJZ A;  1VQ7 A;  3G6E T;  4M7D B;  3D7S B;  2O4X A;  1T3L A;  1KJW A;  2A28 A;  4AG2 C;  1I0C A;  4YTL A;  3I35 A;  3AT1 B;  2BZY A;  1ABQ A;  1X69 A;  4DOV A;  2QAZ A;  2QA4 A;  3MCA B;  3WVD B;  3I56 Q;  5CKH A;  2FZG B;  4M7A A;  1ZLM A;  1R0C B;  4D6W A;  5HY6 A;  5GAM h;  1MMD A;  4E47 A;  3SEM A;  4JRP A;  4HCB A;  1K9M U;  1FMV A;  4M78 F;  2AKL A;  2RQT A;  1KC8 R;  2Y4X A;  3I55 T;  1EZZ B;  1WYX A;  2L0A A;  1YHQ T;  4BDZ A;  1S72 T;  1B3Q A;  1Y57 A;  1KSW A;  2LP5 A;  3OYL A;  4O5V A;  2XU8 A;  2DRK A;  4FU6 A;  4BY6 C;  3PFS A;  5IXB A;  3OYN A;  5C0M A;  3CXC A;  5DLQ E;  2DK3 A;  2IPO B;  3CC4 Q;  4MDW A;  1D1B A;  3JB9 F;  2V8I A;  1SSH A;  1Q82 U;  2MAM A;  1SKU B;  2DXU A;  4WTO B;  1HYO A;  1NE8 A;  2VC8 A;  5GAN 8;  3RKY A;  5LJ3 j;  3FEO A;  4ATO A;  5J39 A;  2XI9 A;  5M9O A;  3CXC S;  3VS0 A;  4PJO A;  2FYK A;  2KMT A;  2D9T A;  3E9G A;  4X1V A;  2P4R A;  1QMC A;  2DJQ A;  4LUE A;  3VYG A;  1KHC A;  3H0F A;  2JJ9 A;  1PKT A;  2DL5 A;  2VWF A;  1BU1 A;  1RL2 A;  2X3W D;  4F7U E;  2V1Q A;  2LCL A;  2F69 A;  3CCS T;  1W1F A;  3CBM A;  2MF2 A;  2YLB A;  2ECZ A;  2ZCF B;  2ZPF B;  2QEX Q;  5LJ3 g;  3I56 T;  2KRS A;  3JCM g;  5HCK A;  4M78 A;  4F17 A;  2L8D A;  1B34 A;  4C92 C;  4AMC A;  2L5Q A;  3ZBD A;  1SHF A;  4RTV A;  3UF4 A;  1KQS P;  1WNL A;  4M7A F;  4DBR A;  2PU9 B;  4BI4 A;  1OI1 A;  1Y7X A;  4WCI A;  3MHX A;  1VQK A;  1O75 A;  1QP3 A;  1TWB A;  4XU2 A;  1AD5 A;  1YIJ A;  2WSE E;  2ZGW A;  1R0B G;  1N6A A;  2PVO B;  3CPF A;  1JQQ A;  1M8V A;  3PVQ A;  1N8R C;  1RAE B;  2NLU A;  4BI3 A;  5CR2 A;  4C92 G;  2XDB A;  1WLP B;  3H8Z A;  3QYH B;  2GBQ A;  3INZ A;  5GJW B;  1JRI A;  3EGD B;  1RAD B;  1UUE A;  2J06 A;  1B34 B;  4TVR A;  1VYT A;  1TS9 A;  2E3I A;  3AHU A;  1ZX6 A;  1Y96 A;  3CCS Q;  1G3W A;  1VQ4 T;  3VRY A;  3EGU A;  3P8B B;  4ZNX A;  3VS5 A;  4FM4 B;  3TU4 K;  3OYG A;  4PJO C;  3E19 A;  3PMI A;  3R6O A;  4C8Q E;  3JSC A;  3E9F A;  1VQL T;  1SHG A;  4MML A;  1IB8 A;  1WHJ A;  1OX9 A;  4LDY A;  3ER0 A;  1MV3 A;  1VIE A;  2EQJ A;  3PTA A;  5HK0 A;  4M75 F;  2YXY A;  3M4G A;  1YJW T;  2QYZ A;  2LMJ A;  2LX7 A;  3EFO B;  2XHC A;  2BE9 B;  2DYB A;  4KRT A;  3EG2 A;  2DZ9 A;  2V1R A;  3G4S T;  1QWF A;  1R8O B;  4HCC A;  2LNH B;  1YI2 A;  1HJD A;  2DLP A;  5FWC A;  5I21 A;  2EW3 A;  1FMK A;  1VQ5 Q;  1F1B B;  2DEQ A;  2G6F X;  5A0G A;  1K9A A;  5C6S A;  4Z8A A;  1W2B A;  3EFR A;  2J6K A;  3IQL A;  3PT9 A;  3OYE A;  1D0X A;  3S3M A;  2RA2 A;  4HVU A;  4D8K A;  3CCL Q;  1Q7Y U;  1AWO A;  3CCM A;  2LJ1 A;  1VQK Q;  2GCX A;  2EPD A;  3PIP A;  3V7R A;  3M58 A;  1JXO A;  2OJ2 A;  3KXT A;  2DYI A;  2J6F A;  2OTL Q;  3CCR T;  2M0O A;  3HFN A;  4F04 B;  1UGV A;  4JJB A;  1PNJ A;  4Y28 E;  1M27 C;  4LE9 A;  3L42 A;  4F7U G;  3CME Q;  1UB4 A;  3FIF A;  2EGA A;  1C1A A;  2EQK A;  2E65 A;  2GFA A;  1EIF A;  1YJ9 Q;  1RAH B;  2JMC A;  4J9B A;  5GMK l;  2EJG A;  3TRE A;  3V7C A;  3QG1 A;  1ZUK A;  3QII A;  3H6Z A;  1SSF A;  4GBQ A;  4LDW A;  4N4I A;  5CQY A;  3TQ7 P;  2V26 A;  2CT4 A;  2K5L A;  3OSS C;  1Q95 G;  1G3S A;  3O8V A;  3EG0 A;  1XNI A;  1NJI U;  4HKE A;  2LT4 A;  4DBQ A;  1BIB A;  4XK8 E;  3OMG A;  5FWB A;  2B8A A;  2DTH A;  3H9N A;  3BDU A;  1M3C A;  3OYJ A;  1VUB A;  5A0L A;  1K9M R;  1VQ8 T;  1B7T A;  1NEG A;  1M3B A;  2QI2 A;  2F1L A;  2EQI A;  4HCK A;  3MEU A;  3DB4 A;  3NTH A;  2Z0W A;  2LZ6 B;  2A7Y A;  2EYX A;  3G1J A;  2K79 A;  2VV5 A;  3PIO A;  1Q81 R;  2OTJ Q;  1PRM C;  2K3B A;  2I2L A;  4M7A E;  2JS0 A;  2JM8 A;  2RQW A;  3LYI A;  1AEY A;  2DXC A;  3QJ6 A;  3EHR A;  2CSQ A;  3HKS A;  2B86 A;  2J6O A;  4C5E A;  2HL5 C;  4C0D C;  3LW5 E;  2CP7 A;  3OQ5 A;  1BB9 A;  3VYH B;  4M77 C;  5KYW B;  2QA4 Q;  4RMO A;  1M1F A;  1RAF B;  4OMQ A;  4BE1 A;  4AT1 B;  1G5V A;  3M0P A;  1TH7 A;  5LJ5 f;  1OUL A;  1ZA1 B;  4C0D B;  3UT1 A;  4R0K A;  4XU0 A;  4JZ3 A;  1X75 C;  2GFU A;  2K3Y A;  1H92 A;  2KI7 A;  4JLG A;  5CAI A;  4HCZ A;  1W70 A;  2NUZ A;  2D1X A;  4M7A B;  2EWN A;  4OB2 B;  2MYS A;  2DD4 A;  4M75 C;  1NM7 A;  4ZN1 A;  1OEB A;  3RDV A;  3BDL A;  4LDU A;  1KFZ A;  3EHQ A;  1UTI A;  2LQW A;  3BFM A;  1AZE A;  1E7O A;  1M90 R;  4PLI A;  1RAB B;  2DIL A;  4DBH A;  3H0H A;  2PNI A;  3J7A F;  2RJF A;  3CCU Q;  5GAM f;  3DLL A;  2OTJ T;  2JN0 A;  4M7D D;  4N0A A;  1MHN A;  5CKB A;  1QCO A;  1KQS S;  1A0N B;  4JJN K;  5KE2 A;  4RCB A;  4D8D A;  2KNB B;  2VB6 A;  1QLY A;  4J9C A;  3CMA A;  1X01 A;  3WXM B;  1FMW A;  3M9Q A;  2YUP A;  4JRI A;  4E7Z A;  5KYW A;  1YIT T;  3TCJ A;  1H8K A;  2GTO A;  2KYB A;  3JCM J;  2JM9 A;  4FYX B;  1I4K 1;  5LJ5 j;  1YJN Q;  1XOV A;  3QWY A;  2JXB A;  2PVD B;  3MET A;  4MDX A;  2PZ1 A;  1AWJ A;  3CD6 Q;  2QK0 A;  1UJY A;  1YJW Q;  3G4S A;  1WIE A;  1QVG P;  2KDS A;  3GF5 A;  2DD5 A;  2CP5 A;  4XQ3 A;  3MO8 A;  1KHI A;  4XTU A;  1M9S A;  3G6E A;  2ED0 A;  5GMK i;  2YDL A;  5LJ3 e;  3CCL A;  1SF9 A;  2OI3 A;  1KQ2 A;  4A4G A;  5IT9 E;  2DIG A;  3X25 B;  3OYC A;  4DBF A;  2RO0 A;  2MWO A;  1LOJ A;  1WHH A;  4OMM A;  3OSV A;  5LJ5 e;  1KC8 C;  3CCE A;  2O2O A;  1Y0M A;  2LT1 A;  3CCR Q;  2ROL A;  2JT4 A;  3NTK A;  2F2X A;  4IUU A;  3A8L B;  3OW2 P;  4HVV A;  2RN8 A;  5LL6 S;  2EYW A;  2ZPB B;  5LJ3 d;  1FYN A;  1W2B P;  4Y92 A;  4JPB W;  2M02 A;  1RLQ C;  1ZSZ C;  3NGP A;  4C92 B;  1GRI A;  5GAN 7;  2CKK A;  4C8Q D;  1VQP T;  2ZPG B;  1QVF A;  1KD1 U;  2RJD A;  1VQ5 T;  4KUL A;  5FU6 B;  1BK2 A;  1I5L A;  1OU9 A;  5IHK A;  1X6G A;  4E7S A;  1JEG A;  1YJW A;  2HQH A;  1LVK A;  4J9G A;  4L59 A;  5GAN f;  3G4S Q;  5HKC A;  2BE7 D;  1IXD A;  2K5F A;  5DM7 R;  1NEB A;  2E64 A;  3FDR A;  3REA B;  4M7D A;  2ABL A;  1KIK A;  1VQ7 Q;  5FU6 C;  3LH0 A;  1S1N A;  1FXX A;  4AFQ C;  2C0O A;  2LJ0 A;  3M0R A;  4C92 E;  3NPF A;  2KAF A;  4PJO D;  1GFD A;  3OYD A;  4C92 A;  2DTI A;  4OMO A;  5KYY B;  2E70 A;  4FSS A;  2JTM A;  3F70 A;  1WPY A;  2RHI A;  2JVV A;  2DBK A;  4JLI A;  4C8Q A;  3OYM A;  2GQV A;  2MIO A;  4M75 D;  1P92 A;  3SDZ A;  3FC3 A;  2BKD N;  4N0A C;  2EYZ A;  2GGR A;  1M90 U;  4DOW A;  3OBY A;  3KFV A;  5GAN 3;  3VU3 C;  2X4Y A;  4JJC A;  3S3N A;  2JTF A;  4B9W A;  4OMN A;  1WHG A;  3QSU A;  1WXB A;  3LX7 A;  4Z88 A;  4OB0 B;  2ENM A;  4E7L A;  2JUF A;  4J9F A;  1BCO A;  4PKC C;  2HL3 A;  3NTI A;  2EAY A;  5GAN 5;  4CC2 A;  3G71 A;  1YIJ T;  4PJO B;  2X35 A;  3JCM V;  4F16 A;  4GLK A;  3EG9 A;  3FLG A;  1OPL A;  2QTV A;  4J6X A;  4RKU E;  4IUQ A;  1YHQ Q;  1I5O B;  3CCM Q;  4AG1 C;  1PCX A;  3I55 Q;  1IHV A;  3PVL A;  2DE0 X;  1WA7 A;  2RI2 A;  2CT3 A;  3Q1J A;  4F7U F;  2O88 A;  2A08 A;  1K73 C;  1BI3 A;  3C12 A;  2C06 A;  2QEX T;  2FVU A;  2KT1 A;  4C8Q G;  2CYZ B;  2RMO A;  3C4S A;  4XU3 A;  2HD0 A;  4MMK A;  3TEE A;  2YRV A;  4LXC A;  4XTV A;  4JRQ A;  2LQ8 A;  3I56 A;  1WI7 A;  4OF1 A;  2CZ7 B;  1ZQ1 A;  2VGN A;  1YIT A;  1IZ6 A;  3A8H B;  2CDT A;  1UHC A;  3UPU A;  3UDC A;  4ZGE B;  2RD1 A;  5IN1 A;  4EMK B;  2RK2 A;  2M9U A;  1RI9 A;  4KH0 B;  4ESR A;  3LWI A;  4M78 B;  4J7I A;  2DZC A;  2COW A;  3RR6 A;  5FRM A;  4IUR A;  1U8R A;  2EFI A;  2JOY A;  4FYY B;  3VS7 A;  1OQK A;  4JRK A;  2WSC E;  1I07 A;  1NZ9 A;  2M1H A;  8AT1 B;  3CCE T;  3A1P A;  1M8M A;  1YIJ Q;  5KYX A;  2K5I A;  2DER A;  4M4Z A;  4X9C A;  1Z9Z A;  2K2M A;  5J3B A;  1G3T A;  1Z9Q A;  3EH2 A;  3CC4 T;  1C6V X;  1MNE A;  4E2F B;  1QVG A;  3RES A;  2XKO C;  4XTW A;  3CPW A;  1CKB A;  4OB3 B;  3JCM X;  2V8K A;  1D09 B;  1OX8 A;  1PRL C;  5LJ5 d;  1N27 A;  4WF2 A;  3QHS A;  3CCQ A;  4DEY A;  5KYU A;  5CKF A;  1GCQ A;  1S72 A;  2QXF A;  1MGQ A;  1RUW A;  1ARK A;  3JB9 D;  4ELZ C;  4OMP A;  4P5N A;  4HXJ A;  3L2Z A;  1J3T A;  1UGQ B;  3SFM A;  1M30 A;  1M3A A;  1LNX A;  2KVQ G;  1CKA A;  1IRE B;  1ZBX A;  3L2Q A;  1QVP A;  1JBM A;  2MI6 A;  3GP8 A;  4KGZ B;  5GAO n;  2IVW A;  3QBY A;  3CCJ T;  4J83 A;  5J26 A;  2BZ8 A;  1WDX A;  3BW1 A;  4EMG A;  1G3Y A;  2KY9 A;  2PVG B;  3S6W A;  2H3J A;  2QQR A;  4GLM A;  5LJ3 h;  2HKQ B;  4M75 G;  3CEY A;  2P0Q A;  2XD0 A;  1V1C A;  4LD9 K;  3QYG B;  2DF6 A;  2BZX A;  1VQ7 T;  1RLP C;  4IUP A;  1VYU A;  5KYX B;  3SWN C;  4HT8 A;  3EFO A;  1N9R A;  2A37 A;  4FW1 A;  2EGC A;  1UFF A;  5GAM g;  3QKJ A;  2KRM A;  4RTY A;  2VUB A;  3JRZ A;  2MK5 A;  2R5A A;  3X26 B;  5FU7 B;  4PJO F;  2VKN A;  1TUG B;  2QDY B;  2AZV A;  3P8H A;  4KGV B;  2JW4 A;  2K3X A;  5KYY A;  1UGP B;  3CCU A;  3CC7 Q;  1SG5 A;  2DL7 A;  2JMA A;  2JZ2 A;  2Y90 A;  1OZ2 A;  1SRL A;  3G71 Q;  4PLL A;  1JJ2 P;  1IGU A;  3QDR B;  2MOX A;  2L3R A;  4B9X A;  1Y07 A;  1KD1 C;  3GIB A;  2OX7 A;  1VOM A;  3QO3 A;  2DVJ A;  2E6Z A;  2XMF A;  5GAN 4;  2KR3 A;  1JO8 A;  2CS7 A;  1PHT A;  1X2K A;  1VQM T;  2AZS A;  4O6J A;  2RHY A;  5FW9 A;  2R57 A;  5L23 A;  1UGS B;  3RIR A;  1Q7Y R;  4JDS A;  1H64 1;  1YN8 A;  2OTL A;  2M0Y A;  1YI2 Q;  4E7K A;  2E41 A;  1M2V B;  1Q81 C;  2RF0 A;  4IUT A;  4QQ6 A;  3TSZ A;  1YNZ A;  4ORZ A;  1W4S A;  2VVK A;  1VQN T;  2EJ9 A;  2RQV A;  3I9Q A;  3CD6 A;  2HAX A;  3L2U A;  4IKF A;  4CI0 C;  3CD6 T;  4RG2 A;  3VKI A;  3H41 A;  4J6W A;  2WSF E;  1H3H A;  3OYB A;  1KQ1 A;  3X28 B;  1Y71 A;  4MZM A;  5IH2 A;  4BY6 B;  2HBP A;  4A63 B;  1BBZ A;  2FRY A;  4RCC A;  4ANJ A;  2EJF A;  4C0G A;  3CC7 A;  4OML A;  3RKX A;  3OBW A;  5EC7 A;  5CCA A;  4ELY C;  4A4K A;  2F2W A;  2RI3 A;  4LDX A;  1VA7 A;  2KBT A;  4J6Y A;  3UA6 A;  3M56 A;  4PJL A;  3EGX B;  3U23 A;  2RJC A;  2M51 A;  4A4F A;  1NJI R;  3KUF A;  2ZPH B;  2HSP A;  1YJ9 T;  1VQN A;  1PD1 A;  4FCY A;  3HL8 A;  2RPN A;  2CRE A;  4PK4 A;  2RK1 A;  4HT9 A;  3PE0 A;  1G2B A;  3JCM f;  3CPW S;  2D6F A;  3DKM A;  3RBB B;  2KXD A;  2OTL T;  3CC4 A;  3MJX A;  3JCM e;  2XIC A;  5GMK h;  1BCM A;  3JCM b;  2FL7 A;  3CCU T;  1N8R U;  5HK3 A;  3EG9 B;  2CZ1 B;  2ESW A;  3M0T A;  2NUT B;  4OGC A;  2LNV A;  4LN2 A;  1MUZ A;  4QVC A;  3L2R A;  3S3O A;  3GBQ A;  4M7D E;  2KSS A;  2KRN A;  2YUN A;  1K4U S;  1HK9 A;  2KQW A;  1M2V A;  2DMO A;  1WHL A;  3JCM d;  4RG8 A;  2E5Q A;  1U1S A;  2L89 A;  2EYQ A;  5GAN h;  1Q81 U;  3EG3 A;  3L2V A;  4II1 A;  5GAM e;  2OAU A;  3OS2 A;  1V76 A;  3LWH A;  4JUV A;  1K8A C;  5I2M A;  1WGS A;  2G3R A;  2FRW A;  2BUD A;  1VQO A;  1TOV A;  3M0U A;  1AWW A;  1NYG A;  3HSB A;  4DEX A;  1VQN Q;  4RTT A;  3EGD A;  4PL6 A;  2KK4 A;  2F2V A;  2QA4 T;  1WHK A;  2O31 A;  2W0Z A;  4OP0 A;  2CH4 A;  3WVE B;  4DA4 A;  1YI2 T;  2GTJ A;  3MEW A;  2QGF B;  1GCP A;  2FPF A;  2DL4 A;  1WJQ A;  2WAC A;  2EVR A;  2FZK B;  1IHW A;  2L3P A;  2VYT A;  2QQB A;  2DEU A;  4MZT A;  2LX9 A;  2EKH A;  1VQ8 Q;  4RTZ A;  3G71 T;  1WZO A;  2ATC B;  4FL6 A;  1VIF A;  3HRT A;  4A54 A;  3A8O B;  2E10 A;  1M1G A;  4BD3 A;  4PFP A;  5GAN 2;  3CCV A;  1GCQ C;  5GMK e;  1AHJ B;  2PTK A;  5CVI A;  2XK0 A;  2KE9 A;  1YBY A;  3ZEH A;  2C0I A;  2RI5 A;  1PKS A;  3GPL A;  1WHM A;  5GAO m;  3CBP A;  4ZGJ B;  1N8R R;  1VQ4 A;  4NL3 A;  2D0Q B;  5IHI A;  2VGM A;  4QKU A;  3OMC A;  2L3S A;  1D1A A;  2E6N A;  1JJ2 S;  2P0P A;  2AT1 B;  3PGG A;  1I1J A;  4RTX A;  2GF7 A;  2X3X D;  2NUP A;  1AVZ C;  2RHU A;  1T0J A;  5GAN d;  3THK A;  2LQN A;  4N4G A;  2DIQ A;  2K2V A;  1VQ9 T;  2LC4 A;  4IIO A;  4PJN A;  1BKB A;  4VUB A;  3FJ5 A;  3JV3 A;  5IAY A;  2YWW A;  2COY A;  2E1H A;  1LCK A;  2FG0 A;  3CME T;  2HZY A;  2RJE A;  2CZ6 B;  3JB9 I;  1KG1 A;  1QCF A;  1M1K R;  2MCN A;  1X6B A;  2XG8 D;  2CSI A;  1KC8 U;  4XTY A;  2NYS A;  3CXC P;  2DXT A;  3CQT A;  6AT1 B;  1CSK A;  4PJO E;  5GAO r;  1MMN A;  1ZSG A;  2RHX A;  5DY9 A;  3CCV Q;  1UJ0 A;  4KH1 B;  2KXC A;  3VV0 A;  1QVG S;  5CKD A;  4M75 A;  1RAA B;  2DBM A;  1SPK A;  3V8K A;  4KGX B;  3CCJ A;  1OPK A;  1QP2 A;  4X34 A;  3TVT A;  4Z89 A;  3VJP A;  4IIM A;  2D8H A;  3CCQ Q;  3JCM c;  2QDL A;  2ZPE B;  2NUT A;  5FLX E;  2IG0 A;  3C94 A;  2X4X A;  3VUZ A;  3FRN A;  4E7H A;  2QQ9 A;  2MPX C;  1D1C A;  2CP3 A;  3QUI A;  3J80 E;  4BB7 A;  4CC3 A;  4Y91 A;  4A53 A;  4A4E A;  8ATC B;  3FB9 A;  4JS4 A;  1U5S A;  2J7I A;  2NWM A;  2K7A A;  1ZBJ A;  3VS6 A;  2DL8 A;  4LUD A;  4AFZ C;  4IUV A;  1QKW A;  2P4T A;  4KUD K;  2EGE A;  2JNG A;  3OYY A;  4AFU C;  1WJS A;  4J9E A;  1YJ9 A;  4EMK C;  3M54 A;  1S72 Q;  4J5Y A;  4BE2 A;  2BTT A;  1NPP A;  2ED1 A;  2FZC B;  5I22 A;  4PNO A;  1C0M A;  2I0N A;  2E3H A;  1UDL A;  1VQM Q;  4PJM A;  3QJY A;  1M4Z A;  2FO0 A;  3E2U A;  1AWX A;  2FHD A;  3VS2 A;  5GAO l;  3OYK A;  1QW1 A;  1W6X A;  2AKK A;  1Q82 R;  3EAE A;  4C8Q C;  4ME7 A;  4FSX A;  2O01 E;  1VQ6 T;  1PC0 A;  3L2W A;  3HPW A;  1VQ4 Q;  4GY5 A;  2A3L A;  5GJV B;  5ECA A;  1UEC A;  3CCM T;  1NG2 A;  5D6Y A;  1V29 B;  4M7A D;  1PWT A;  4JJD A;  1TTH B;  2YRC A;  2QGG A;  2GNC A;  2A36 A;  2YRD A;  2FEI A;  5LJ5 g;  1PSF A;  2K6D A;  2VXE A;  3G6E Q;  3DB3 A;  1TSF A;  2YT6 A;  1E6G A;  2QQA A;  5I11 A;  1Y96 B;  1TG0 A;  3ULR B;  2CGH A;  2VAS A;  3ZFJ A;  1ZUY A;  1PD0 A;  3QWX X;  3CMA T;  2F5K A;  1NLP C;  3DLM A;  2X51 A;  3VRZ A;  1LJO A;  3P8D A;  4M7D G;  1QWE A;  4BI8 B;  5KE3 A;  4F14 A;  4CC4 B;  2EQU A;  1VQP A;  1UE9 A;  4J9I A;  1VYV A;  2BIV A;  3M53 A;  1YP5 A;  5AT1 B;  1JJ2 A;  5GAM j;  2GQI A;  3CCJ Q;  3TSW A;  3HTR A;  2H3E B;  1ZSZ A;  1JXM A;  3JCM P;  5A0D A;  1LPL A;  5CK9 A;  1Q7Y C;  3GOX A;  3EG1 A;  1UG1 A;  3UWN A;  2R5M A;  2DXB A;  1W2B S;  2CZ0 B;  4M77 B;  5GAO p;  2HKN A;  1WQW A;  4FIB A;  4K11 A;  3HFO A;  1GL5 A;  4QVZ A;  1M2O A;  4DQ2 A;  3V7S A;  2DX1 A;  3LLR A;  1UEB A;  3L1A A;  1K73 U;  1RI0 A;  1EFN A;  1WJR A;  1YFN A;  7AT1 B;  3M0S A;  3M59 A;  4M78 D;  4FYW B;  4E7J A;  3JAM E;  4EMK A;  4KUI A;  3CC2 A;  3ME9 A;  2O9S A;  2XID A;  3QPH A;  1QQJ A;  4RUG A;  4EIK A;  5A2Q E;  3V8J A;  3A8M B;  3E1S A;  3C95 A;  1XTD A;  1Q86 U;  5GMK m;  2ZZD A;  3CMA Q;  1PM3 A;  1BI2 A;  1M5Q 1;  2PQW A;  4FT2 A;  3SD4 A;  3OYF A;  4OMF B;  2KYM A;  1Q86 C;  2CP2 A;  1ABO A;  5KYN A;  5CIU A;  3CCQ T;  9ATC B;  1K8A U;  5FRN A;  3EFS A;  4EDU A;  1X2Q A;  5KH6 A;  2P84 A;  1MMA A;  3QDF A;  1YWO A;  1VQP Q;  2LQK A;  3VS4 A;  4NL2 A;  2XDD A;  1VQ6 Q;  4L5G A;  2SRC A;  3T9N A;  4A4H A;  2DO3 A;  1YWP A;  2E5K A;  3BY7 A;  2DVE A;  1IO6 A;  1NLO C;  5GAN 6;  1VQM A;  1OOT A;  2EBP A;  5D7U A;  2IIM A;  3JB9 G;  1VQO Q;  2X9H A;  4X9D A;  4B6M A;  2V8J A;  5L8R E;  2DL3 A;  4QVD A;  4C8Q F;  4JS5 A;  1VQ9 Q;  2RHZ A;  2F5T X;  1TU0 B;  2D8J A;  3CME A;  4ZN3 A;  1MMG A;  4J7F A;  4CC7 A;  2AK5 A;  1G83 A;  2HMA A;  4XAX B;  1T3S A;  4FT4 A;  1YJN T;  4EMH A;  2LJ3 A;  2AHJ B;  4J9D A;  3MEV A;  3ZL7 C;  3M5A A;  4LNP A;  5KCH A;  1YIT Q;  3CCR A;  2K57 A;  3OY9 A;  2E4H A;  1D0Y A;  5D6X A;  3MPU B;  3BE3 A;  3CPW P;  1K76 A;  2LCC A;  1AT1 B;  2KRO A;  3I55 A;  1D3B A;  3EGX A;  1TXQ A;  1ZUU A;  1BI0 A;  4KT0 E;  3MP1 A;  4ZTJ A;  2CUB A;  4JZ4 A;  1PSE A;  1N9S A;  3A5Z B;  1FWZ A;  4M7A G;  5D6W A;  1ACM B;  1ZSZ B;  4CRI A;  3GLX A;  5FRO A;  3J81 E;  2X4W A;  4XTZ A;  2YSQ A;  2FPD A;  1NYF A;  2LDM A;  3CCV T;  4R55 A;  2DET A;  1YCS B;  4M77 F;  2QQS A;  2A0F B;  4F7U A;  5GAN e;  4HA8 A;  3G7Z A;  3JB9 H;  3A8G B;  4PFO A;  1M90 C;  1YJN A;  2HBW A;  4OB1 B;  1K8A R;  2CH4 W;  5GMK j;  1H3Z A;  1U1T A;  1I8F A;  4UC4 A;  4XTX A;  4NOY A;  1OV3 A;  4M78 E;  4Z02 A;  1VQ9 A;  2FB7 A;  1XQH A;  4E6R A;  1Q86 R;  2HCK A;  4N4H A;  3OYA A;  1OYX A;  2HQX A;  4E7I A;  2QG9 B;  3MP8 A;  4AFS C;  1O9S A;  4J9H A;  5GAN g;  5GAN j;  2VXF A;  4M77 G;  3SHW A;  1E6H A;  1QKX A;  2DRM A;  2ZPI B;  2L3Q A;  2JS2 A;  3CC2 Q;  2EYY A;  3OS5 A;  4FYV B;  1QCN A;  4LDV A;  2LVM A;  5GAO q;  1B07 A;  1GBR A;  2RM4 A;  3RER A;  2DFU A;  1IRX A;  5KCO A;  2RQR A;  1PG5 B;  3OYH A;  4QQG A;  4NS5 A;  4C0F A;  4BE0 A;  2HSE B;  1OZ3 A;  4M78 G;  1T0H A;  3OW2 A;  3MP6 A;  4C5H A;  2QTX A;  2CUD A;  3UA7 A;  1DJ7 B;  4BUG A;  2XDP A;  3OS1 A;  3LGF A;  4J8O A;  1YHQ A;  3RUX A;  1K0X A;  4C92 D;  2C0T A;  4C5G A;  2H8H A;  2YLC A;  1HSQ A;  3RKW A; 
#chains in the Genus database with same CATH homology
 2DPP B;  2DZ9 A;  2RHX A;  3G4S T;  3PMT A;  1R8O B;  5DY9 A;  4HCC A;  3HHT B;  3RMS A;  3QXE B;  1YI2 A;  3JB9 J;  2RI2 A;  3Q1J A;  4MZP A;  3VV0 A;  4F7U F;  2QEX A;  5CKD A;  1QVG S;  3V8L A;  5I21 A;  3CBO A;  1BI3 A;  3OB9 A;  4M75 A;  3C12 A;  3VUB A;  1K73 C;  3V8K A;  2C06 A;  3KBG A;  2DEQ A;  3CCJ A;  1QP2 A;  5A0G A;  2FVU A;  2QEX T;  5C6S A;  4X34 A;  2CYZ B;  3C4S A;  3VJP A;  4XU3 A;  2HD0 A;  4C8Q G;  1W2B A;  3EFR A;  4MMK A;  1VQ8 A;  4LD6 A;  3TEE A;  3JCM c;  3PT9 A;  1VQ5 A;  2YRV A;  1JB0 E;  2ZPE B;  5FLX E;  4XTV A;  3OYE A;  4JRQ A;  2IG0 A;  3C94 A;  2LQ8 A;  2X4X A;  3I56 A;  3VUZ A;  3FRN A;  4E7H A;  2QQ9 A;  3S3M A;  4OF1 A;  2RA2 A;  1Q7Y U;  2CZ7 B;  3QUI A;  1ZQ1 A;  2VGN A;  3J80 E;  4BB7 A;  1YIT A;  3CCM A;  4Y91 A;  4A53 A;  4A4E A;  1IZ6 A;  2GCX A;  3A8H B;  3UPU A;  4OVA A;  3PIP A;  3UDC A;  3V7R A;  3M58 A;  2O4X B;  4ZGE B;  3FB9 A;  3GNF B;  2EKO A;  2RD1 A;  2Y4Y A;  5IN1 A;  4EMK B;  3KXT A;  4JS4 A;  2RK2 A;  2M9U A;  3CCR T;  2M0O A;  3HFN A;  3LWI A;  4L6V 5;  4M78 B;  3GNG A;  4Y28 E;  4J7I A;  2DZC A;  3L42 A;  4F7U G;  1UB4 A;  3FIF A;  5FRM A;  4IUR A;  4BAC A;  1VQO T;  1U8R A;  4IUV A;  2EFI A;  2JOY A;  3RMQ A;  2P4T A;  4KUD K;  5EG2 A;  4JRK A;  3HRU A;  2EQK A;  2GFA A;  2E65 A;  2M16 A;  2WSC E;  1EIF A;  1NZ9 A;  3ASK A;  2JNG A;  2M1H A;  5CO7 A;  2R58 A;  3CCE T;  3OYY A;  4EPC A;  1WJS A;  1YJ9 A;  4EMK C;  5GMK l;  3M54 A;  2K5I A;  2EJG A;  4X9C A;  4J5Y A;  4BE2 A;  4M78 C;  3TRE A;  1NPP A;  3V7C A;  3CC2 T;  4PNO A;  5J3B A;  1G3T A;  3CCL T;  3QG1 A;  1VQL A;  1HXD A;  3QII A;  3H6Z A;  1SSF A;  3CC4 T;  4ZGD B;  3QJY A;  1M4Z A;  1M1K C;  4LDW A;  2FHD A;  3CC7 T;  2P0K A;  1QVG A;  5GAO l;  4N4I A;  5CQY A;  3RES A;  2XKO C;  4XTW A;  1BIA A;  3OYK A;  3CPW A;  4QW2 A;  1QW1 A;  2K5L A;  3OSS C;  4OB3 B;  3EAE A;  3JCM X;  3PNW C;  1VQK T;  4QQD A;  4C8Q C;  2V8K A;  4ME7 A;  1G3S A;  3O8V A;  5LJ5 d;  3SB2 A;  4KBM B;  3QZ9 B;  4FSX A;  2O01 E;  5AYF A;  1VQ6 T;  1N27 A;  4WF2 A;  4C92 F;  3QHS A;  1XNI A;  3CCQ A;  1NJI U;  3L2W A;  3FJP A;  3HPW A;  4M7D F;  4GY5 A;  5CKF A;  2A3L A;  4HKE A;  2LT4 A;  1S72 A;  1BIB A;  2QXF A;  4XK8 E;  1MGQ A;  3OMG A;  3CCM T;  5D6Y A;  1V29 B;  2LRQ A;  2B8A A;  2EIF A;  2DTH A;  3LGL A;  3N5B B;  5DLO A;  4M7A D;  1BYM A;  3JB9 D;  3MEA A;  4ELZ C;  4P5N A;  1NJI C;  3BDU A;  3OYI A;  4C8Q B;  3L2Z A;  5LJ5 g;  1UGQ B;  1PSF A;  3SFM A;  2VXE A;  3OYJ A;  1VUB A;  3HP9 A;  3DB3 A;  1LNX A;  2KVQ G;  3SWN A;  5A0L A;  1VQ8 T;  1IRE B;  1ZBX A;  3X24 B;  3L2Q A;  1QVP A;  1JBM A;  2MI6 A;  4M77 A;  3GP8 A;  2QQA A;  2QI2 A;  5GAO n;  2IVW A;  3QBY A;  3CCJ T;  1Y96 B;  4J83 A;  2DKG A;  3OW2 S;  5J26 A;  1KQS A;  2CGH A;  3DB4 A;  3BW1 A;  3MEU A;  3NTH A;  4V2S A;  3ZFJ A;  1NPR A;  4EMG A;  1G3Y A;  2A7Y A;  2KY9 A;  2DTO A;  1VQ6 A;  4R56 A;  2PVG B;  4OGE A;  3CMA T;  3S6W A;  2VV5 A;  3PIO A;  1D3B B;  1I81 A;  2F5K A;  2H3J A;  1YCY A;  2QQR A;  3DLM A;  5CKE A;  1Q82 C;  1QVF S;  1LJO A;  2I2L A;  4M7A E;  4PJO G;  5GAM d;  5LJ3 h;  3P8D A;  3QZ5 B;  4M7D G;  3LYI A;  4BI8 B;  4M75 G;  3CEY A;  2DXC A;  2OTJ A;  2P0Q A;  3QJ6 A;  5KE3 A;  2XD0 A;  3HKS A;  4LD9 K;  3JCM W;  3QYG B;  4C5E A;  2EQU A;  1VQ7 T;  4C0D C;  1VQP A;  3LW5 E;  1WQ7 A;  4IUP A;  2BIV A;  3M53 A;  3CCS A;  2HNI A;  3OQ5 A;  3SWN C;  5I2S A;  4HT8 A;  3VYH B;  4M77 C;  4BDY A;  1UGR B;  1N9R A;  2E12 A;  4C5I A;  4RMO A;  5GAM j;  1JJ2 A;  1M1F A;  5GAM g;  1BI1 A;  2LTO A;  3QKJ A;  2HQE A;  2PUO B;  1ZHI A;  4BE1 A;  5CQX A;  1K9M C;  1GXI E;  2VUB A;  3JRZ A;  3JCM P;  1X6O A;  1G5V A;  4M7A C;  2K4Y A;  5A0D A;  5CK9 A;  1TH7 A;  2R5A A;  5LJ5 f;  1Q7Y C;  3GOX A;  3X26 B;  2YHT A;  2X4J A;  5FU7 B;  4PJO F;  3UWN A;  4C0D B;  2R5M A;  2MMP A;  2MWP A;  4ZTF A;  4M75 B;  3UT1 A;  2DXB A;  2QDY B;  1W2B S;  1M1K U;  3P8H A;  3SWN B;  2CZ0 B;  4M77 B;  4XU0 A;  1X75 C;  5GAO p;  2GFU A;  2K3X A;  2K3Y A;  3CCU A;  1UGP B;  2JZ2 A;  4JLG A;  4M77 E;  2Y90 A;  1OZ2 A;  3NFC A;  4HCZ A;  5CAI A;  1WQW A;  2RH2 A;  4Q5W A;  4PLL A;  4FIB A;  2DAQ A;  4M7A B;  2EWN A;  3HFO A;  4OB2 B;  4M77 D;  3URG A;  2RB6 A;  3QDR B;  4QVZ A;  2EQM A;  2L3R A;  3V7S A;  5FU7 C;  4DQ2 A;  2DD4 A;  4B9X A;  1Y07 A;  3LLR A;  2PUK B;  4M75 C;  4ZN1 A;  1UEB A;  3OA6 A;  3L1A A;  1K73 U;  1KD1 C;  3M57 A;  3GIB A;  4M7D C;  1RI0 A;  3QO3 A;  2E6Z A;  5LJ5 h;  3BDL A;  4LDU A;  1WJR A;  4M75 E;  3JCM Q;  5GAN 4;  3M59 A;  4M78 D;  3M55 A;  4E7J A;  3JAM E;  3BFM A;  2CS7 A;  4EMK A;  3M4Y A;  4KUI A;  4F7U B;  3CC2 A;  3HRS A;  3X20 B;  3ME9 A;  1VQM T;  4O6J A;  4PLI A;  4XU1 A;  2XID A;  3QPH A;  1FX7 A;  3JCM h;  2RHY A;  2R57 A;  5LJ3 f;  5A2Q E;  3J7A F;  2RJF A;  1UGS B;  3V8J A;  3A8M B;  3OS0 A;  2DJZ A;  3RIR A;  3E1S A;  4JDS A;  5GAM f;  3G6E T;  3DLL A;  1VQ7 A;  1H64 1;  4M7D B;  3C95 A;  2OTL A;  2OTJ T;  2JN0 A;  2O4X A;  4M7D D;  1XTD A;  1MHN A;  4N0A A;  1Q86 U;  5GMK m;  2ZZD A;  4E7K A;  2E41 A;  1BI2 A;  5CKB A;  1M5Q 1;  2PQW A;  1Q81 C;  1KQS S;  4FT2 A;  4YTL A;  3SD4 A;  5KE2 A;  4JJN K;  4IUT A;  4QQ6 A;  3OYF A;  4RCB A;  1W4S A;  3CMA A;  1VQN T;  2EJ9 A;  4OMF B;  1X01 A;  1Q86 C;  3CD6 A;  2HAX A;  3WXM B;  4DOV A;  3L2U A;  4IKF A;  4CI0 C;  5CIU A;  2QA4 A;  3M9Q A;  3MCA B;  4JRI A;  3CCQ T;  3CD6 T;  3WVD B;  1K8A U;  4RG2 A;  5CKH A;  1YIT T;  3TCJ A;  4M7A A;  3VKI A;  5FRN A;  4J6W A;  4D6W A;  2WSF E;  3EFS A;  4EDU A;  5HY6 A;  5GAM h;  3JCM J;  3OYB A;  1KQ1 A;  4E47 A;  3X28 B;  1I4K 1;  1Y71 A;  4MZM A;  5KH6 A;  4JRP A;  4BY6 B;  2HBP A;  1K9M U;  4HCB A;  5LJ5 j;  1XOV A;  2LQK A;  4M78 F;  4RCC A;  2EJF A;  4C0G A;  2Y4X A;  4NL2 A;  2PVD B;  3RKX A;  3I55 T;  3CC7 A;  2XDD A;  3OBW A;  5CCA A;  4ELY C;  3MET A;  4A4K A;  4L5G A;  1YHQ T;  2RI3 A;  3T9N A;  4LDX A;  4BDZ A;  4J6Y A;  4MDX A;  1S72 T;  4A4H A;  2DO3 A;  3M56 A;  3BY7 A;  3OYL A;  4O5V A;  2XU8 A;  2DVE A;  2RJC A;  4FU6 A;  4BY6 C;  5GAN 6;  1VQM A;  4A4F A;  3PFS A;  3KUF A;  2ZPH B;  1YJ9 T;  1VQN A;  3OYN A;  3OYD A;  3G4S A;  5C0M A;  3HL8 A;  3CXC A;  5DLQ E;  3JB9 G;  2DK3 A;  2KDS A;  4MDW A;  3GF5 A;  3JB9 F;  2DD5 A;  2RK1 A;  2V8I A;  1Q82 U;  4HT9 A;  4X9D A;  4XQ3 A;  3JCM f;  3MO8 A;  2V8J A;  1KHI A;  3DKM A;  5L8R E;  3CPW S;  2D6F A;  4QVD A;  4XTU A;  2MAM A;  2OTL T;  1M9S A;  3CC4 A;  2DXU A;  4C8Q F;  5GMK i;  3G6E A;  4JS5 A;  2RHZ A;  5LJ3 e;  3CCL A;  2F5T X;  3JCM e;  2XIC A;  5GMK h;  1KQ2 A;  1NE8 A;  3JCM b;  4A4G A;  5IT9 E;  2DIG A;  3CME A;  2FL7 A;  2VC8 A;  3X25 B;  3RKY A;  5LJ3 j;  5GAN 8;  4ZN3 A;  5HK3 A;  3CCU T;  1N8R U;  3OYC A;  2CZ1 B;  2RO0 A;  3FEO A;  4ATO A;  4OGC A;  5J39 A;  2MWO A;  1LOJ A;  2LNV A;  2XI9 A;  4J7F A;  5M9O A;  3OSV A;  5LJ5 e;  4QVC A;  3L2R A;  1KC8 C;  3CCE A;  3CXC S;  4XAX B;  3S3O A;  2FYK A;  4PJO A;  2LT1 A;  2KMT A;  4FT4 A;  1YJN T;  4EMH A;  2KSS A;  4M7D E;  3NTK A;  2D9T A;  3E9G A;  4IUU A;  1HK9 A;  3A8L B;  2AHJ B;  2KQW A;  3MEV A;  3VYG A;  3M5A A;  5LL6 S;  1KHC A;  5KCH A;  2ZPB B;  5LJ3 d;  3CCR A;  3JCM d;  2E5Q A;  1U1S A;  4RG8 A;  2L89 A;  1RL2 A;  2EYQ A;  5GAN h;  2K57 A;  3OY9 A;  3L2V A;  4II1 A;  1Q81 U;  5GAM e;  4C92 B;  5D6X A;  2OAU A;  4F7U E;  5GAN 7;  3OS2 A;  2LCL A;  2CKK A;  2F69 A;  4C8Q D;  3LWH A;  4JUV A;  3CCS T;  1VQP T;  3CBM A;  2LCC A;  2MF2 A;  1K8A C;  5I2M A;  1WGS A;  2G3R A;  3I55 A;  2YLB A;  2ZPG B;  1D3B A;  2ZCF B;  1QVF A;  1KD1 U;  2ZPF B;  1BI0 A;  2BUD A;  4KT0 E;  3MP1 A;  5LJ3 g;  2RJD A;  4ZTJ A;  3I56 T;  1VQO A;  3JCM g;  1PSE A;  1N9S A;  3A5Z B;  1FWZ A;  4KUL A;  4M78 A;  5D6W A;  5FU6 B;  1VQ5 T;  4M7A G;  3HSB A;  2L8D A;  4CRI A;  1B34 A;  3GLX A;  5FRO A;  4C92 C;  3J81 E;  2X4W A;  4XTZ A;  1I5L A;  2L5Q A;  3ZBD A;  2LDM A;  1YJW A;  3CCV T;  4PL6 A;  2KK4 A;  4L59 A;  5GAN f;  1WNL A;  4M7A F;  2QA4 T;  4OP0 A;  5HKC A;  4R55 A;  2K5F A;  2PU9 B;  2E64 A;  4M77 F;  3WVE B;  5DM7 R;  2QQS A;  3FDR A;  4BI4 A;  4DA4 A;  1OI1 A;  1Y7X A;  4F7U A;  3MHX A;  4HA8 A;  5GAN e;  4M7D A;  1YI2 T;  3G7Z A;  3MEW A;  1VQK A;  1O75 A;  5FU6 C;  3LH0 A;  1WJQ A;  2WAC A;  3JB9 H;  1FXX A;  3A8G B;  1QP3 A;  2VYT A;  2QQB A;  1M90 C;  4MZT A;  4XU2 A;  2LX9 A;  1YJN A;  4C92 E;  3G71 T;  2KAF A;  4PJO D;  1YIJ A;  4FL6 A;  4OB1 B;  2WSE E;  2ZGW A;  5GMK j;  1VIF A;  3HRT A;  4A54 A;  1H3Z A;  1N6A A;  3A8O B;  2E10 A;  2DTI A;  1U1T A;  1M1G A;  2PVO B;  3CPF A;  4C92 A;  1I8F A;  4BD3 A;  1M8V A;  5GAN 2;  3CCV A;  2E70 A;  1N8R C;  4UC4 A;  5GMK e;  1AHJ B;  2NLU A;  4XTX A;  4BI3 A;  2JTM A;  4NOY A;  3F70 A;  5CR2 A;  4C92 G;  5CVI A;  2XK0 A;  4M78 E;  2XDB A;  3H8Z A;  1WPY A;  2RHI A;  4Z02 A;  2FB7 A;  1VQ9 A;  3QYH B;  1YBY A;  2JVV A;  3INZ A;  1XQH A;  4JLI A;  3ZEH A;  4C8Q A;  3OYM A;  2GQV A;  1JRI A;  2RI5 A;  4M75 D;  4N4H A;  3GPL A;  3OYA A;  1P92 A;  3SDZ A;  1B34 B;  1OYX A;  2HQX A;  2BKD N;  4TVR A;  4N0A C;  3FC3 A;  5GAO m;  4E7I A;  3MP8 A;  3CBP A;  1O9S A;  5GAN g;  5GAN j;  4ZGJ B;  2VXF A;  1VQ4 A;  1M90 U;  3AHU A;  4M77 G;  4DOW A;  4NL3 A;  1Y96 A;  2D0Q B;  2VGM A;  3OBY A;  3OMC A;  5GAN 3;  3VU3 C;  1G3W A;  2E6N A;  1VQ4 T;  2X4Y A;  3S3N A;  2ZPI B;  2JTF A;  1JJ2 S;  2P0P A;  4B9W A;  3PGG A;  3P8B B;  3OS5 A;  4LDV A;  4FM4 B;  2GF7 A;  3TU4 K;  3QSU A;  2LVM A;  3OYG A;  4PJO C;  5GAO q;  2RHU A;  4C0Z A;  3E19 A;  5GAN d;  3PMI A;  2DIQ A;  2K2V A;  2RM4 A;  3R6O A;  4N4G A;  2LC4 A;  4C8Q E;  1VQ9 T;  3LX7 A;  3JSC A;  3RER A;  4OB0 B;  5KCO A;  3E9F A;  1BKB A;  1VQL T;  4VUB A;  4MML A;  4E7L A;  5IAY A;  3OYH A;  2JUF A;  4QQG A;  4NS5 A;  2E1H A;  4C0F A;  4LDY A;  4BE0 A;  1OZ3 A;  4M78 G;  4PKC C;  3CME T;  3OW2 A;  3MP6 A;  4C5H A;  2RJE A;  3ER0 A;  2CZ6 B;  3JB9 I;  2QTX A;  1VIE A;  2EAY A;  3NTI A;  2EQJ A;  1DJ7 B;  4BUG A;  2XDP A;  3PTA A;  5GAN 5;  1KG1 A;  3OS1 A;  5HK0 A;  4M75 F;  3LGF A;  3M4G A;  4J8O A;  3G71 A;  1YJW T;  1YHQ A;  2XG8 D;  3RUX A;  1YIJ T;  1KC8 U;  2X35 A;  4XTY A;  3JCM V;  4PJO B;  4GLK A;  4C92 D;  2DXT A;  2XHC A;  3FLG A;  4C5G A;  2YLC A;  4J6X A;  4RKU E;  4PJO E;  4IUQ A;  5GAO r;  3RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...