5L8RE

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5l8rE00
3X26B 2PUOB 3A8OB 2DD4A 4OB2B 2PVGB 2CZ0B 3A8GB 3VYGA 4Y28E 3X24B 1PSEA 2WSCE 2ZPIB 1UGSB 3A8HB 3QYGB 3A8MB 4L6V5 2CZ6B 3WVEB 4ZGEB 1UGRB 1DJ7B 1UGQB 2CZ7B 1GXIE 5L8RE 1JB0E 2DPPB 3VYHB 2ZPEB 3QZ5B 3QXEB 3LW5E 4FM4B 3X28B 1UGPB 3X20B 1QP2A 3QZ9B 4OB0B 2ZPGB 2PUKB 4OB3B 3QYHB 2ZCFB 2WSEE 2D0QB 2ZZDA 2WSFE 2PU9B 4OB1B 2QDYB 1QP3A 1IREB 2DXCA 3X25B 2CYZB 4ZGJB 4ZGDB 2DXBA 2PVOB 4XK8E 2ZPBB 1AHJB 2DD5A 3WVDB 1V29B 2ZPHB 2PVDB 2AHJB 2CZ1B 3HHTB 2ZPFB 4KT0E 4RKUE 1PSFA 3A8LB 2O01E
chains in the Genus database with same CATH superfamily
3X26B 2QA4A 3EH1A 1KG1A 4HVUA 7AT1B 1NLOC 4A63B 3J7AF 5D6YA 3LWIA 1AEYA 1I81A 2XDPA 1OQKA 3NHNA 1Y96B 2QAZA 3JB9J 2DD4A 3SB2A 4JJBA 1H3ZA 2CZ0B 3C94A 4F7UE 3CC2T 2LDMA 4WF2A 3JCMP 2AZSA 4M7AD 3OYJA 1VQKA 1K0XA 2E5QA 4HCCA 4BUGA 2P4RA 1F1BB 1YP5A 2DL5A 2LCCA 5KCHA 3E9GA 5DLOA 4LDYA 1UGQB 2CP2A 2OI3A 1YIJA 5LJ5d 3RNJA 3C95A 1GRIA 3LH0A 1RAFB 1JJ2S 5HCKA 2XK0A 2FEIA 3G71Q 2SRCA 1YCYA 5GAN7 2C06A 1VQ6A 1FXXA 5LJ5f 4JJCA 2DERA 2X4YA 3CXCP 4J6YA 4OMLA 3EG0A 3CD6Q 4C5EA 5LJ3e 3OBYA 2M02A 1NE8A 2RNAA 5CKFA 3ULRB 1QVFP 1O75A 4RUGA 3RERA 2DIQA 1YJWT 1K1ZA 3S3NA 4KBMB 1I5OB 3EGDB 4J9GA 1M90C 2DBKA 4HKEA 1KHIA 4X9DA 3I55A 2RPNA 2ROLA 1G3WA 1WJRA 4E7LA 2K57A 2QQSA 3OW2P 2DO3A 3LGFA 3KUFA 1YFNA 4C8QC 1M2OA 1LNXA 4JLGA 3UA7A 2ED0A 2FHDA 1K9AA 4AG2C 3OYGA 2P0KA 2EQKA 2KMTA 4OGEA 4DBQA 3EGXB 1X27A 5KYWB 4NS5A 5GANh 3NMZC 4FT2A 3CCQT 5CK9A 1AOJA 2YHTA 1NEGA 3CBPA 1PCXA 2E1HA 2V1RA 5AYFA 3I56Q 1VYTA 2FYKA 2JOYA 2MCNA 5GAMe 2RJCA 2K6DA 1TUCA 1KQ1A 2DL3A 1WXBA 1OZ2A 3ASKA 3GBQA 1SEMA 2OTJQ 5FW9A 2LT1A 2J6KA 5GAOp 2OJ2A 4J6WA 1RACB 2O4XB 3PE0A 2KYMA 2EW3A 4MMLA 2KRNA 1UJYA 3LW5E 4PJOA 3JB9G 2Y90A 2E6ZA 3SWNA 1AVZC 3JCMh 4PFOA 1YITT 2J06A 1Q82R 3OYFA 2PUKB 4N4HA 5AT1B 2HQXA 1H8KA 2K5IA 3M5AA 4E6RA 2LCLA 2L0AA 4MZMA 1WA7A 1JXOA 3NFCA 1Q81R 2CT4A 2P0PA 4Z02A 4E47A 2EQIA 4HCZA 1PC0A 4XTVA 2VC8A 1H3HA 2DL8A 1VQPA 2JMAA 3FLGA 4M78E 3CCMT 2LP5A 1WIEA 2PVOB 5J39A 5FRNA 5I11A 2JMCA 2X3WD 3VV0A 5C6SA 2HBWA 2KE9A 1C0MA 1TS9A 4E2FB 1E6GA 4J83A 1P92A 2FZGB 2YLBA 5CCAA 1UHFA 2E70A 3CC7Q 1M8VA 1XTDA 1BCOA 4EMKB 2PNIA 1WYXA 3VS0A 3EG1A 2DA9A 2RD1A 1JEGA 1BI3A 2VUBA 1OULA 2HL5C 5GAOr 2YWWA 1K0SA 4PJOC 2AKLA 2QEXA 3JAME 3SWNC 1KSWA 5HK3A 4NL3A 4QQGA 1U3OA 1YHQA 2GCXA 3E9FA 1YJNT 2RJDA 2E10A 3CMET 4Y28E 4ESRA 1WJSA 4OMFB 4RTYA 1VQOT 4ANJA 3CPFA 3QWXX 3CC2Q 5IXFA 1IGUA 3PTAA 2K79A 3EG9A 2LNHB 2L3PA 3EG3A 3V8KA 3PMIA 5KH6A 4ZGEB 3BFMA 3M4GA 1IXDA 5DM7R 3QG1A 1W2BP 3OQ5A 2DPPB 2VKNA 3EHQA 1VQ5A 2XDBA 4OP0A 1Q82C 5L23A 1PRLC 4DOWA 3C4SA 1NG2A 2LRQA 2M0YA 4J8OA 4LN2A 1Y96A 2KXCA 1Q81C 1KQSA 3QYHB 1X6BA 2WSFE 3FEOA 2F2XA 1TSFA 1LOJA 1QVGA 2EKHA 2DL4A 4FYVB 1T3LA 3DLMA 1YJWQ 1M5Q1 5GAN4 1B34A 3NTIA 1VQ4Q 1TUGB 4C92E 5IT9E 2VYTA 4C0GA 1MGQA 2D8HA 5GAN6 2DETA 3PIOA 4ZTJA 1H92A 2AHJB 1RL2A 5LL6S 3RKWA 5FROA 5I22A 3CCST 3J81E 1Y71A 5DLQE 4R56A 4C5HA 2RF0A 2VGNA 2RJFA 4FSXA 4LNPA 1QKXA 2DRKA 2RHYA 1PRMC 2KR3A 1QCOA 2AKKA 4D8DA 2YSQA 1M8MA 3AHUA 4BDZA 4PLIA 4C8QB 3PFSA 4JJDA 2JZ2A 3JCMV 1PNJA 2VASA 3V7RA 2EGEA 3PMTA 3CCQQ 2DL7A 3EGDA 4EMHA 2CUDA 5GMKm 3M53A 1D1BA 4RTWA 1Q81U 4PFPA 4J9FA 1KD1C 1MMNA 1ACMB 1D1CA 3RIRA 4A4KA 3RMQA 3CBOA 4AMCA 3QJ6A 1SRLA 1H641 4V2SA 1ZUKA 4L6V5 1YNZA 4OVAA 5ECAA 2HKNA 4BY6C 2XIDA 4RG2A 2KBTA 4A4FA 1KC8R 2HQEA 1N8RU 1JB0E 4BB7A 5HK0A 1T3SA 4VUBA 5LJ3h 1W2BA 2D9TA 1WQWA 4ZTFA 1QWFA 3CCVT 2DRMA 3EGXA 5KYWA 1SRMA 3JB9D 2EVRA 1X01A 1TOVA 3OS1A 1YITQ 1VQ9A 3EHRA 4JJNK 1MNDA 4DA4A 3RKXA 3MEWA 4RCCA 1E6HA 2QDYB 3VJPA 5I2SA 1IHWA 2HMAA 1QP3A 3L42A 2KRMA 5EG2A 1FMWA 3G4ST 2JTEA 3OYKA 2DYIA 2DFUA 2K3BA 3CCMQ 4XU2A 1IB8A 1UG1A 2DNUA 2O4XA 4OMOA 5CO7A 3CC4A 1M27C 1K8AR 1SHFA 4C8QF 3A5ZB 1MNEA 1KD1U 2DZ9A 5GAMg 4LDUA 1NLPC 3FB9A 3SDZA 2JTMA 2A0FB 1NYGA 5GMKj 2C0OA 5EC7A 2CS7A 3OA6A 4LD9K 1X6GA 5FWCA 3CCUA 3H6ZA 3GF5A 4XTXA 5LJ5j 4XU1A 3M0SA 5GAMd 2KSSA 2VXEA 3U23A 1RUWA 4F14A 2KRSA 1NYFA 3CCET 5KYXA 1GFCA 3CMAA 4EMGA 1WHMA 1YJNQ 1M9SA 5I21A 4Z89A 1VQOQ 1KC8C 1RI9A 2K9GA 5IH2A 3HSBA 4PJOB 2H3EB 4FSSA 1ZA1B 1G8XA 5GAMf 3SWNB 3BDUA 1LCKA 2GTJA 3ME9A 1U8RA 1K76A 4XU3A 2RK2A 1UB4A 2DEQA 2BIVA 3BW1A 2EPDA 4EMKA 4FCYA 4PKCC 2QTVA 3FJPA 1RAAB 2ZPEB 4X34A 2YRCA 3QZ5B 2HEQA 2QQBA 2KYBA 2GQVA 1Z9ZA 2X4WA 1EZZB 2EFIA 4UC4A 4C0FA 2RJEA 2E4HA 3CCJA 2VXFA 4OB0B 2FO0A 4M7AE 2F5TX 3HTRA 3REAB 2EAYA 3OYNA 4OB3B 1AT1B 3QPHA 3JB9F 2HNIA 4A4EA 3LH5A 1VUBA 2BUDA 2GFAA 3CCRA 3OYBA 2J6FA 3QSUA 4JS5A 2DE0X 2J05A 1OPKA 2CT3A 2XMFA 4M7DA 1W6XA 2L2PA 3GNGA 3TREA 3L2UA 1GBRA 3S3MA 1ARKA 3D7SB 1K8AC 2DXBA 2M0OA 4DBHA 3CPWP 2BZYA 2YT6A 1AZGB 2OTLA 3GNFB 4BE0A 2BZXA 2X4JA 1NPPA 1PM3A 2FRWA 4N4IA 3QWYA 3QUIA 4RTXA 3TEEA 2KEAA 4DBRA 3CBMA 3TSWA 1VQPT 3CCSQ 3BDLA 1HK9A 4EMKC 2PUOB 3V7SA 4PJOF 3EG9B 3NGPA 1NPRA 1TWBA 2LT4A 4FU6A 2DILA 5CKBA 3THKA 3HFNA 3OYMA 1J3TA 2AIRB 3KFVA 4A53A 3X24B 4DOVA 3HRTA 3VS1A 4J9BA 2XICA 1VQ7A 2V1QA 3HKSA 4M7DC 4LXCA 3V8JA 1RAGB 1UGRB 2RHXA 1K8AU 2JTFA 2KT8A 5L8RE 1OEBA 2M16A 1K4US 3UPUA 5GMKh 1VQ8A 4CC7A 1NJIC 2CSQA 4XTUA 1QQJA 4XTYA 1BI1A 2QTXA 3CCVQ 4LUEA 4C8QA 4GBQA 2ZPGB 5LJ5h 4BY6B 2PTKA 3I9QA 1B34B 3G6ET 5GAOq 2ED1A 2FZKB 3QDRB 3JCMJ 1M3CA 2QDLA 4LE9A 4M78A 1CSKA 4OMMA 2ROTA 3VS2A 4F04B 2FVUA 2RN8A 1EX4A 4PFZA 2JT4A 1ZLMA 2MF2A 2X3XD 2GGRA 2EKOA 5IXBA 2HAXA 2RHIA 4A54A 1EIFA 3G4SQ 2DD5A 1WJQA 1Q7YU 4M77A 2H8HA 2XG8D 4QW2A 3CPWA 2FRYA 1VQLA 3JCMX 3UT1A 1XQHA 3HHTB 3E2UA 4E7SA 2FPEA 4ME7A 4EDUA 1XNIA 1OV3A 4HA8A 2HKQB 3LWHA 3VUBA 3A8GB 4C8QG 4PK4A 3L2QA 1HD3A 2ABLA 3ZFJA 1UDLA 3MJXA 3G7ZA 4O5VA 1X75C 1W70A 1ZHIA 3CD6A 1ZBJA 1NJIU 2DK3A 1KJWA 2M51A 3O8VA 2LX7A 1X2QA 2HQHA 3IQLA 3JV3A 3O5ZA 4PJNA 2ATCB 3MO8A 5KYUB 4LUDA 5KE2A 1RABB 2D6FA 3TQ7P 2K5LA 4QVDA 4B9XA 3CCLT 4M78C 3AT1B 2EJ9A 1WGSA 4MDWA 3CCEQ 2RQWA 3REBB 4PJMA 3VRYA 2CZ6B 3QHSA 2JW4A 4YTLA 2DIGA 1B07A 1JO8A 2E3HA 3M57A 2P84A 4M77C 3T9NA 1V76A 3VS3A 2K3XA 2DMOA 3ZBDA 1OU9A 1TXQA 2GNCA 2PQWA 1RADB 3VRZA 3JCMW 2V26A 2RB6A 1UHCA 4XQ3A 2DXTA 1M90U 3M54A 1UECA 3MPUB 3I56A 1JRIA 4PJLA 3Q1JA 2RI5A 3EFSA 1U1SA 4MZTA 4MMKA 2F5KA 2LNVA 5IHIA 2I0NA 3N5BB 1CKBA 5FRMA 1BB9A 2XI9A 4BDYA 3JCMg 4F7UB 3A1PA 1VA7A 1QVPA 3CXCA 1K9MR 4E7JA 1JJ2P 3QO3A 4JUVA 3H0HA 1UUEA 1S72T 2FZCB 4FW1A 1QVFA 1VQPQ 4F16A 2NUTB 3L2VA 5KYXB 3RUXA 2JXBA 2HSEB 1VIFA 1VQNT 3JB9I 1N9SA 2MIOA 2EYXA 3OS2A 2NUPB 2F2VA 1YJ9A 1RLPC 2CP5A 4O6JA 3OW2A 4PJOG 2JS2A 1T0JA 4FL6A 1OZ3A 2QQ9A 3C0CA 5LJ3j 1M1KR 1QLYA 3M0QA 1XJWB 4CC2A 2EWNA 5KYYB 4Y91A 3C12A 2DX1A 4GY5A 3CC7A 3INZA 3SEMA 3H0IA 3FDRA 5GJWB 1DJ7B 5IN1A 1BIAA 3E19A 3GPLA 4FM4B 1YI2A 4R0KA 3OYHA 1KHCA 4OGCA 2VGMA 4CC4B 3M55A 4M7DB 1GL5A 4BE1A 3GOXA 4C0DC 1AWWA 4XAXB 1I4K1 1MMDA 1FMKA 4GLKA 4F7UF 2LQNA 3G6EQ 3G1JA 2ENMA 4A4GA 3CC2A 3MCAB 3TVTA 2BKDN 2A3LA 1IREB 2OAUA 4RTTA 1MMAA 3CCJT 4XU0A 1K9MC 4M75A 2EYZA 3CCRT 1R8OB 5GAMj 1Y7XA 2DLPA 1BKBA 4QKUA 2K2VA 2CZ1B 5CQYA 4E7IA 4AFZC 4TVRA 3MP1A 2RM4A 1I0CA 1TG0A 2QGFB 1GBQA 1K73R 4C8QD 1X6OA 2EQMA 3FJ5A 3FIFA 4RMOA 5HY6A 1C1AA 1VQMT 1WHKA 1YJWA 2LZ6B 1VQ4A 1UGSB 4QQDA 3OY9A 9ATCB 2GTOA 3A8HB 3RMSA 2LMJA 3LGLA 3CCLQ 4IUUA 4PJOE 4M7DF 1JU5C 2P4TA 3L2RA 1Q82U 3I5RA 3OYYA 2EBPA 2W0ZA 2JNGA 1WX6A 1GXIE 1S1NA 1EFNA 1N27A 1YCSB 3OSSC 3VYHB 4M75C 4M78B 4M7AA 1TU0B 3X28B 2YUNA 2QA4T 2XDDA 4E7ZA 4KULA 1QP2A 2F69A 4FYWB 3QZ9B 2K7AA 3S6WA 3OBWA 4BI3A 4IUTA 5KYUA 3CCQA 2WACA 3CEYA 4IUQA 4M77B 4KGZB 4BE2A 4J9EA 4D6WA 4JLIA 2DXCA 3PVQA 2KGTA 1VQKT 1KK7A 4GLMA 4ZGDB 1U1TA 3QJYA 4X1VA 3HRSA 3VS5A 3PGGA 1YIJT 1Q86R 2ESWA 3LLRA 4KUIA 4AFQC 1K73C 2ZPFB 3DB4A 4NOYA 1GCPA 2QASA 5GANe 1VQ6T 2DAQA 1YITA 2KAFA 2FPFA 1S72Q 4M7AC 2BE7D 1R0CB 1W4SA 2LQWA 3SHWA 4FYYB 1VQLT 3A98A 1D09B 2SEMA 1VQNQ 3SFMA 2AK5A 1ZSGA 3P8HA 2JJ9A 4OMPA 3PVLA 3GIBA 2NWMA 1MHNA 4M78F 2ZPIB 5A0GA 4PJOD 3CCMA 1TUDA 3I55T 4HCBA 2HSPA 2YXYA 1AWOA 4AG1C 4F7UA 5GAMh 4NL2A 3H8ZA 3NTHA 4MZPA 1R77A 2JM9A 4WTOB 1ZQ1A 2CZ7B 1SG5A 1LVKA 3VS4A 4M77F 3JCMe 1AWXA 2NUTA 4N4GA 1MMGA 1M1GA 4Q5WA 3CMEQ 1WZOA 3RKYA 4C92B 2JM8A 3P8BB 3I35A 2NUPA 2DVJA 2A7YA 2RQUA 3P8DA 2ZCFB 4J5YA 2I2LA 4ELZC 1ZX6A 1OU8A 2CGHA 4K11A 1N5ZA 2OAWA 2VVKA 1SKUB 2GFUA 1VQOA 3BE3A 3EFOB 2O88A 5KYYA 2ZGWA 4F7UG 4C0DB 1HXDA 1MUZA 2LQ8A 1R0BG 1Q86C 5DY9A 3CCJQ 2LX9A 1BIBA 2EYQA 4KGVB 1C6VX 2L3RA 2XHCA 2XU8A 3RESA 2DZCA 3CCRQ 3TSZA 4Y92A 4L59A 2B8AA 2R58A 4IUPA 2XKOC 3M4YA 5J26A 4AFUC 2RI2A 5D6WA 1G3TA 3MEVA 3CXCS 5KCOA 2CH4A 3EH2A 5A2QE 4E7KA 1BU1A 2KI7A 1KC8U 1VOMA 1QVFS 4HT8A 1VQMQ 2V8JA 1TH7A 2RO0A 1YWOA 2A08A 4R55A 3A8MB 4X9CA 1N9RA 1NZ9A 1QCNA 3WVEB 4CRIA 1YJ9T 2VV5A 3OW2S 4HVVA 2GF7A 1ZSZA 3H0FA 3CCSA 1FWZA 4M7DG 1WQ7A 4J7IA 1W1FA 2DVEA 1UGVA 4PL6A 2G3RA 4C0ZA 1VYUA 3FRNA 5IAYA 2QA4Q 2QEXT 1G83A 2RHZA 1V1CA 2MK5A 4IKFA 3DKMA 3E1SA 2YUPA 2FG0A 4JPBW 1YHQT 4M75B 4BD3A 1YI2T 4HT9A 3VU3C 2CP0A 4BACA 2E41A 3MHXA 1WHLA 2O9SA 3X25B 2E65A 2KDSA 3M9QA 4MDXA 3ER0A 3BY7A 2A36A 2K4YA 4P5NA 3WXMB 4J9DA 4N0AA 2MYSA 1JQQA 2MPXC 1QWEA 1VQKQ 3L1AA 3MEAA 1V29B 2A37A 2ZPHB 4JS4A 2PVDB 3JCMc 5LJ5g 4LDWA 3LX7A 2HD0A 1VQ5T 3EGUA 1SPKA 2K2MA 2E12A 1YIJQ 2BTTA 4RKUE 4RTZA 5CKEA 3CCVA 2CDTA 4ZN3A 2DJQA 1Y0MA 1ZSZC 2HCKA 1KQSS 2DTIA 3M59A 1HJDA 3NTKA 1VQ6Q 2EGAA 3ZL7C 5D7UA 4OB2B 4QQ6A 2R57A 1YN8A 3EFRA 1VQLQ 1UFFA 2XD0A 3META 1QVGS 1BYMA 1ZA2B 3UF4A 3G71A 3TCJA 3J80E 2LQKA 4HCKA 3G4SA 2B86A 4M7AB 1PKSA 3URGA 5CKHA 2RA2A 3I55Q 2Y4XA 1SSHA 1WHJA 1O9SA 1OX8A 2RQRA 4M78G 4FYXB 4N0AC 2VWFA 2DM1A 3M56A 2QK0A 4M75F 2ZAEA 4XTZA 1T0HA 2KROA 1NM7A 1VQ4T 1FMVA 1M3AA 2KXDA 2BZ8A 2GBQA 2YRDA 2EJFA 3M0PA 4M77G 4M7DE 1PWTA 5GAN3 2ZZDA 4DBFA 3UATA 4QVCA 5GANg 4ZN1A 2CUBA 2Z0WA 2E5KA 4QT7A 1PKTA 2DKGA 1SSFA 1B3QA 3OMGA 5IHNA 3CCEA 1HYOA 1G2BA 4KGXB 2HZYA 3JCMQ 5CVIA 2HDAA 4FW2A 4J9CA 1RAEB 2Y4YA 4OMNA 5GAN2 2EQJA 5FU6B 2NLUA 1W2BS 2QG9B 2G6FX 2W10A 4DEYA 5GANd 1I5LA 2L3SA 3OYIA 2V8IA 2CREA 2D1XA 4E7HA 1OX9A 5A0LA 2DF6A 1QCFA 1G3SA 4KT0E 4C92A 2BE9B 1PSFA 2O01E 4RTVA 3RBBB 2KY9A 2OTJA 1WXTA 1MV0B 3HFOA 4M7AF 2RQTA 5GANf 3DLLA 1VQ9T 3EAEA 1G5VA 3HPWA 5J3BA 2GQIA 4KH1B 2PVGB 1QMCA 1SHGA 4WCIA 5M9OA 1I8FA 1VIEA 3UDCA 3VYGA 3L2ZA 3MP6A 4B6MA 3EFOA 5FU7C 1AWJA 4ATOA 1RAHB 3F70A 1UJ0A 1KQSP 3ZEHA 1WFWA 2RK1A 1G3YA 1D3BB 3CC4T 1AD5A 2E64A 2DXUA 3JCMd 4CI0C 4C8QE 3DB3A 4LD6A 1QVGP 1YJ9Q 4C92G 4J9HA 3QXEB 1UE9A 3RDVA 2DTHA 4JRIA 3MEUA 1OYXA 1BI0A 1WLPB 3X20B 3JCMf 4M7DD 3L2WA 4LDVA 1N8RR 4EIKA 1U5SA 1OPLA 3H41A 4C92C 2CP6A 3CCUT 1D0ZA 2HBPA 5GAOn 1VYVA 2QEXQ 2FL7A 2P0QA 3TU4K 1Q95G 1M2VA 4IIOA 4RTUA 4M77E 2PZ1A 2X4XA 3OYCA 1YHQQ 3CMAT 1YI2Q 2MWOA 2O2OA 4XK8E 2MMPA 2COYA 2V8KA 3FC3A 1BK2A 3JCMb 1M30A 2H3JA 4J9IA 4QVZA 6AT1B 1M3BA 3HP9A 3JRZA 4M4ZA 3UWNA 4DQ2A 5CQXA 1ABQA 1IHVA 3S3OA 4RCBA 1WNLA 1VQ5Q 1I1JA 2M9UA 4FIBA 2EJGA 2L89A 2YUQA 3M0RA 1KD1R 1LPLA 4A4HA 1X2KA 2LJ3A 5D6XA 5GAN5 3G6EA 4JRKA 4KRTA 1WHGA 1ZUUA 3R6NA 5GJVB 4JRQA 1WI7A 5HKCA 4II1A 3JSCA 4OMQA 1ZSZB 1JJ2A 5GAOl 1BCMA 1E7OA 3M0UA 2RI3A 2OTLT 2F2WA 2YLCA 2HL3A 5CR2A 5GMKe 1RLQC 1KQ2A 1U06A 4FT4A 1LJOA 1PHTA 4M78D 1Z9QA 1M1KC 4B9WA 4EPCA 1IGQA 2YDLA 1N8RC 2JS0A 1XOVA 3M0TA 1UGPB 5LJ5e 4HVWA 1I07A 1ABOA 3QBYA 5A0DA 5CAIA 1B7TA 5GMKl 2LJ1A 4M75G 3GP8A 8AT1B 4Z88A 4M77D 2D0QB 2FPDA 2DTOA 2E6NA 5GAOm 2MOXA 4LDXA 1QW1A 1RAIB 2C0TA 1GCQA 3V7CA 3PT9A 3PNWC 3OYEA 1K9MU 3CCLA 4ZGJB 1IZ6A 1OOTA 2E3IA 4PNOA 1VQ7T 1UEBA 1A0NB 1D0XA 2YUOA 2DEUA 1IO6A 2JVVA 1YBYA 2KQWA 3KXTA 2X35A 4ELYC 3OYAA 5GAN8 3QKJA 3H9NA 3VS7A 1Y07A 5FLXE 4PJJA 1VQ8T 2KK4A 1JXMA 1NBEB 2O9VA 1FYNA 3OMCA 3A8LB 1JBMA 4RG8A 1AZEA 5LJ3g 3NPFA 3VUZA 3VS6A 2LJ0A 2L5QA 1M1KU 4JZ4A 5CIUA 2M1HA 2R5MA 3V8LA 3SD4A 4D8KA 1VQ9Q 4IIMA 5CKDA 4M7AG 1BI2A 2KT1A 3RR6A 4AT1B 2KNBB 3JB9H 2D0NA 4JDSA 5LJ3d 1GCQC 2AZVA 2L3QA 2MAMA 1WDXA 2J6OA 3CPWS 4JRPA 4Z8AA 5FWBA 2FB7A 2VB6A 1KFZA 2JN0A 4J6XA 3UA6A 3CC4Q 2LCSA 1D1AA 5FU7B 3G71T 5LJ3f 2DBMA 3OSVA 3LYIA 2LTOA 4C92D 8ATCB 1S72A 2A28A 3HRUA 1Y57A 3CD6T 1VQNA 2ECZA 3OS0A 3OYDA 2RQVA 2EYWA 1X43A 4IUVA 2WSEE 2OX7A 3CCUQ 2PU9B 4OB1B 4PLLA 4HXJA 4M75E 4XTWA 4BI4A 2CYZB 1CKAA 1OI1A 2KVQG 2QGGA 2LC4A 2X9HA 2QI2A 3CMAQ 1D3BA 4OF1A 1AHJB 1PG5B 3QIIA 3PIPA 2YRVA 3MKDA 1WHHA 1K73U 2CP7A 3I5SA 4JZ3A 1RI0A 2RHUA 2MWPA 2F1LA 1FX7A 2L8DA 4KH0B 2COZA 1YJNA 5FU6C 3CMEA 5GMKi 3QDFA 1GFDA 2EIFA 2RMOA 4DEXA 1Q7YR 2DYBA 2CP3A 1BBZA 2QQRA 5KYNA 1M4ZA 2IPOB 3A8OB 1NEBA 1HSQA 1IRXA 3VKIA 3I56T 1WXUA 4L5GA 1PD1A 2NUZA 3GLXA 2X51A 1SF9A 1PSEA 2WSCE 2J7IA 1NJIR 2OTJT 2JUFA 3QYGB 1ZUYA 1KIKA 1QKWA 2IG0A 4C5IA 4ORZA 1D0YA 2OTLQ 2C0IA 2QQAA 2K5FA 4IURA 2CH4W 1N6AA 1TTHB 4AFSC 3KBGA 5C0MA 1M2VB 1UTIA 1YWPA 2QXFA 1PD0A 2AT1B 3OYLA 4C92F 2MI6A 2EGCA 2CSIA 4J7FA 2K3YA 4M75D 5GANj 3CQTA 5KE3A 3HL8A 2RH2A 2LVMA 2R5AA 4C5GA 2IIMA 2COWA 4ZNXA 1VQMA 2EQUA 4BI8B 1Q86U 2EYYA 4KUDK 3R6OA 4CC3A 4F17A 2ZPBB 2IVWA 2DJZA 3EG2A 2D8JA 2QYZA 3WVDB 1M90R 2NYSA 5I2MA 1M1FA 1VQ7Q 3CC7T 2CKKA 3OB9A 1MV3A 3OS5A 1ZBXA 1X69A 5IHKA 3MP8A 1Q7YC 3M58A 2O31A 1VQ8Q 1WPYA
chains in the Genus database with same CATH topology
3X26B 2QA4A 2KY9A 2CS7A 1KG1A 2OTJA 3HFOA 4M7AF 3J7AF 4C8QD 1X6OA 5D6YA 5GANf 3OA6A 3LWIA 1I81A 2EQMA 3EAEA 3DLLA 2XDPA 1VQ9T 4LD9K 3CCUA 1G5VA 3H6ZA 1Y96B 3HPWA 3FIFA 3GF5A 5J3BA 3JB9J 2DD4A 3SB2A 4XTXA 4RMOA 5LJ5j 4XU1A 2PVGB 5HY6A 2CZ0B 1H3ZA 3C94A 4F7UE 5GAMd 5M9OA 1I8FA 1VIEA 2KSSA 3UDCA 3L2ZA 2LDMA 3VYGA 3MP6A 3CC2T 2VXEA 4WF2A 5FU7C 4ATOA 1VQMT 3JCMP 1YJWA 3CCET 3F70A 3CMAA 4EMGA 4M7AD 1VQ4A 1M9SA 1UGSB 5I21A 4QQDA 3OY9A 3OYJA 1VQKA 1KC8C 3ZEHA 3A8HB 3HSBA 3RMSA 4PJOB 3LGLA 2RK1A 4IUUA 5GAMf 2E5QA 4HCCA 3SWNB 4PJOE 4BUGA 3BDUA 4M7DF 1G3YA 3ME9A 1U8RA 1D3BB 3CC4T 2E64A 2DXUA 2P4TA 2LCCA 3L2RA 4XU3A 1Q82U 5KCHA 3JCMd 3OYYA 2RK2A 3E9GA 4CI0C 5DLOA 2JNGA 1UB4A 4LDYA 1UGQB 3DB3A 4LD6A 4C8QE 1YIJA 5LJ5d 2DEQA 2BIVA 3BW1A 1GXIE 4EMKA 1N27A 3C95A 4PKCC 3OSSC 4C92G 3FJPA 3LH0A 3VYHB 2ZPEB 4M75C 3QZ5B 3QXEB 4M78B 4X34A 2QQBA 1JJ2S 4M7AA 3X28B 2DTHA 2XK0A 2GQVA 4JRIA 3MEUA 1OYXA 2X4WA 2QA4T 1BI0A 3X20B 2EFIA 3JCMf 4M7DD 3L2WA 2XDDA 1YCYA 5GAN7 4KULA 4UC4A 1QP2A 2F69A 4LDVA 2C06A 1VQ6A 1FXXA 4C0FA 2RJEA 3QZ9B 5LJ5f 3CCJA 2VXFA 4OB0B 4M7AE 2F5TX 4C92C 2EAYA 3S6WA 4OB3B 2X4YA 3OBWA 2HBPA 4IUTA 4J6YA 4BI3A 3QPHA 5GAOn 3JB9F 2HNIA 4A4EA 4C5EA 3CCQA 1VUBA 2BUDA 2FL7A 2P0QA 2WACA 2GFAA 3CEYA 4IUQA 3CCRA 5LJ3e 3TU4K 3OBYA 4M77B 3OYBA 4BE2A 4M77E 1NE8A 4JS5A 5CKFA 3QSUA 1O75A 4D6WA 2X4XA 2DIQA 4JLIA 3OYCA 1YJWT 3RERA 2DXCA 3S3NA 4KBMB 3CMAT 4M7DA 3GNGA 1M90C 4HKEA 2MWOA 3TREA 3L2UA 3S3MA 1VQKT 4ZGDB 1K8AC 1KHIA 1U1TA 2DXBA 2MMPA 2M0OA 4X9DA 4XK8E 3I55A 2V8KA 3QJYA 3FC3A 3JCMb 2H3JA 3HRSA 1G3WA 1WJRA 2OTLA 4E7LA 2K57A 3GNFB 3PGGA 4BE0A 2QQSA 2X4JA 4QVZA 2DO3A 1NPPA 3LGFA 3KUFA 4C8QC 1YIJT 3HP9A 4N4IA 3LLRA 1LNXA 3JRZA 4JLGA 4KUIA 3UWNA 3QUIA 3TEEA 4DQ2A 5CQXA 2FHDA 3S3OA 1K73C 3CBMA 3OYGA 2ZPFB 2P0KA 4RCBA 1VQPT 1WNLA 3DB4A 2M9UA 3BDLA 2EQKA 4NOYA 2KMTA 4FIBA 2EJGA 4OGEA 2L89A 1HK9A 4EMKC 5GANe 2PUOB 1VQ6T 3V7SA 2DAQA 1YITA 2KAFA 4PJOF 4M7AC 1W4SA 4NS5A 4A4HA 5GANh 4FT2A 5D6XA 1NPRA 5GAN5 3G6EA 1VQLT 3CCQT 2LT4A 4FU6A 5CK9A 4JRKA 2YHTA 5CKBA 3SFMA 3CBPA 3HFNA 3P8HA 2E1HA 5AYFA 3OYMA 4JRQA 4A53A 3X24B 4DOVA 5HKCA 2FYKA 4II1A 3JSCA 3GIBA 1MHNA 4M78F 2JOYA 2ZPIB 3HRTA 5GAMe 5A0GA 2RJCA 4PJOD 3CCMA 1JJ2A 3I55T 4HCBA 4ZN1A 1KQ1A 2XICA 5GAOl 1OZ2A 3ASKA 1VQ7A 4F7UA 3HKSA 5GAMh 2RI3A 4NL2A 2OTLT 4M7DC 3V8JA 2YLCA 2LT1A 3H8ZA 3NTHA 4MZPA 5CR2A 5GMKe 5GAOp 4J6WA 2O4XB 1UGRB 2RHXA 1ZQ1A 1KQ2A 1K8AU 2CZ7B 2JTFA 5L8RE 2M16A 4FT4A 5GMKh 1LJOA 3UPUA 4M77F 4M78D 4MMLA 1VQ8A 1NJIC 1M1KC 3JCMe 3LW5E 4B9WA 4EPCA 4PJOA 1N8RC 3JB9G 1XOVA 2Y90A 1UGPB 4N4GA 4XTUA 1M1GA 2E6ZA 4XTYA 1BI1A 3SWNA 4Q5WA 5LJ5e 2QTXA 3RKYA 3JCMh 4C92B 1YITT 3QBYA 5A0DA 5CAIA 4C8QA 3P8BB 5GMKl 2ZPGB 5LJ5h 4BY6B 4M75G 3OYFA 2PUKB 3GP8A 4N4HA 1B34B 2HQXA 2A7YA 3G6ET 2K5IA 5GAOq 3P8DA 3QDRB 2ZCFB 4J5YA 2I2LA 3M5AA 4ELZC 2LCLA 3JCMJ 4M77D 2D0QB 4MZMA 2CGHA 2DTOA 2E6NA 3NFCA 4M78A 5GAOm 4LDXA 1QW1A 2FVUA 2P0PA 4Z02A 2GFUA 4E47A 3V7CA 4HCZA 2MF2A 1VQOA 4XTVA 3PT9A 2VC8A 3PNWC 3OYEA 1VQPA 1K9MU 2EKOA 3FLGA 4M78E 4ZGJB 3CCMT 3CCLA 1IZ6A 2RHIA 2PVOB 2ZGWA 4C0DB 1HXDA 4F7UG 5J39A 2HAXA 4A54A 4PNOA 5FRNA 2LQ8A 1EIFA 2DD5A 1VQ7T 1UEBA 1Q86C 1WJQA 5DY9A 3VV0A 5C6SA 1Q7YU 2LX9A 4M77A 1BIBA 2EYQA 2XG8D 4J83A 4QW2A 3CPWA 2JVVA 1P92A 1VQLA 3JCMX 1YBYA 2YLBA 2KQWA 5CCAA 2L3RA 3KXTA 2E70A 3UT1A 2X35A 2XHCA 2XU8A 3RESA 4ELYC 3OYAA 5GAN8 3QKJA 2DZCA 1VQ8T 1Y07A 5FLXE 1XQHA 2KK4A 3HHTB 1M8VA 1XTDA 4ME7A 4EDUA 1XNIA 4EMKB 4L59A 4HA8A 3OMCA 3LWHA 3VUBA 3A8GB 3A8LB 1JBMA 2B8AA 2R58A 4RG8A 4C8QG 3L2QA 2RD1A 3ZFJA 4IUPA 1BI3A 2XKOC 3G7ZA 3VUZA 2VUBA 4O5VA 5LJ3g 1X75C 5GAOr 3M4YA 5J26A 1ZHIA 3CD6A 2QEXA 4PJOC 2RI2A 5D6WA 1G3TA 2L5QA 2DK3A 3JAME 1NJIU 1M1KU 5CIUA 3MEVA 3SWNC 3O8VA 3CXCS 2M1HA 5KCOA 2R5MA 3V8LA 3SD4A 5HK3A 5A2QE 4NL3A 5CKDA 4E7KA 3MO8A 4QQGA 1YHQA 1KC8U 2GCXA 4M7AG 3E9FA 1YJNT 1BI2A 2RJDA 2E10A 5KE2A 4Y28E 3CMET 2D6FA 1QVFS 4HT8A 1WJSA 2K5LA 4OMFB 1VQOT 3CPFA 4QVDA 3JB9H 3PTAA 4B9XA 3CCLT 4M78C 2EJ9A 2V8JA 1TH7A 1WGSA 2RO0A 4MDWA 4JDSA 5LJ3d 2MAMA 4R55A 3A8MB 4X9CA 3CPWS 3V8KA 1N9RA 1NZ9A 3PMIA 5KH6A 2CZ6B 4JRPA 3WVEB 4CRIA 2FB7A 3QHSA 1YJ9T 4ZGEB 2VV5A 4YTLA 2JN0A 3BFMA 3M4GA 4J6XA 3OW2S 5DM7R 2DIGA 3QG1A 5FU7B 3M57A 3OQ5A 2DPPB 2GF7A 3G71T 5LJ3f 4M77C 3CCSA 1VQ5A 1FWZA 2XDBA 4M7DG 4OP0A 1WQ7A 3T9NA 1Q82C 3OSVA 3LYIA 4J7IA 4PL6A 2DVEA 2K3XA 2LTOA 4DOWA 4C92D 3C4SA 2G3RA 1S72A 3ZBDA 3HRUA 2LRQA 4C0ZA 2PQWA 3FRNA 4J8OA 5IAYA 1Y96A 3CD6T 2QEXT 3JCMW 1VQNA 1KQSA 1Q81C 3OS0A 2RB6A 2RHZA 3OYDA 3QYHB 4IKFA 4IUVA 2WSEE 4XQ3A 3DKMA 3E1SA 2DXTA 1M90U 3M54A 2WSFE 3I56A 1JRIA 2PU9B 4OB1B 3FEOA 4M75B 3Q1JA 2RI5A 3EFSA 4PLLA 4BD3A 1YHQT 1YI2T 1U1SA 4M75E 4HT9A 4XTWA 3VU3C 4MZTA 4BACA 4MMKA 1LOJA 2E41A 2F5KA 3MHXA 3X25B 2LNVA 2CYZB 2E65A 1OI1A 2KDSA 3M9QA 4BI4A 1QVGA 4MDXA 2KVQG 3ER0A 2LC4A 3BY7A 3DLMA 3N5BB 3WXMB 2K4YA 1M5Q1 2QI2A 4P5NA 1B34A 1D3BA 5GAN4 4OF1A 3NTIA 1AHJB 4N0AA 3QIIA 3L1AA 3MEAA 1V29B 3PIPA 2YRVA 2ZPHB 4C92E 5FRMA 5IT9E 2VYTA 2XI9A 4BDYA 3JCMg 4C0GA 4JS4A 1MGQA 2PVDB 4F7UB 1K73U 3JCMc 5GAN6 3PIOA 1RI0A 5LJ5g 4LDWA 1QVPA 2RHUA 4ZTJA 2AHJB 3CXCA 2MWPA 1FX7A 1RL2A 2L8DA 3LX7A 2HD0A 5LL6S 3RKWA 5FROA 3CCST 2E12A 3J81E 4E7JA 1VQ5T 1Y71A 3QO3A 5DLQE 4R56A 4JUVA 1YJNA 5FU6C 4C5HA 5GMKi 3CMEA 2VGNA 4FSXA 2RJFA 2EIFA 4RKUE 5CKEA 3CCVA 4ZN3A 1S72T 2RHYA 1QVFA 3L2VA 1KQSS 2DTIA 2QQRA 3RUXA 1M4ZA 3A8OB 3M59A 3NTKA 1VIFA 1VQNT 3AHUA 4BDZA 3JB9I 4PLIA 4C8QB 3PFSA 1N9SA 3OYNA 2JZ2A 4OB2B 4QQ6A 3JCMV 3VKIA 3OS2A 2R57A 1YJ9A 3EFRA 3I56T 3V7RA 3PMTA 4L5GA 2XD0A 4O6JA 3META 3OW2A 4EMHA 4PJOG 1QVGS 1BYMA 3GLXA 5GMKm 3M53A 3G71A 4FL6A 1OZ3A 1PSEA 2WSCE 3TCJA 1Q81U 3J80E 2LQKA 1KD1C 3G4SA 2QQ9A 3RIRA 4A4KA 4M7AB 5LJ3j 3RMQA 2OTJT 2JUFA 3CBOA 3URGA 5CKHA 3QJ6A 2EWNA 3QYGB 2RA2A 1H641 4Y91A 4V2SA 2Y4XA 2IG0A 4L6V5 4C5IA 3C12A 4OVAA 1O9SA 3CCUT 4BY6C 2XIDA 4GY5A 4RG2A 4A4FA 4M78G 2HQEA 3CC7A 1N8RU 3INZA 3FDRA 1DJ7B 5IN1A 4N0AC 2QQAA 1BIAA 1JB0E 4BB7A 2K5FA 3M56A 4IURA 5HK0A 3E19A 4M75F 3GPLA 4VUBA 5LJ3h 1N6AA 4FM4B 1YI2A 1W2BA 2D9TA 3KBGA 4XTZA 5C0MA 3OYHA 1WQWA 4ZTFA 1VQ4T 3CCVT 1KHCA 4OGCA 2QXFA 2VGMA 3M55A 3JB9D 4M7DB 4BE1A 1X01A 2EJFA 3GOXA 4M77G 4C0DC 3OYLA 4M7DE 4C92F 2MI6A 3OS1A 1VQ9A 4XAXB 1I4K1 4JJNK 5GAN3 4DA4A 4GLKA 4J7FA 2K3YA 2ZZDA 4M75D 3RKXA 4F7UF 5GANj 4QVCA 3MEWA 4RCCA 5KE3A 2QDYB 5GANg 3CC2A 3HL8A 3VJPA 2RH2A 4A4GA 3MP1A 2LVMA 2R5AA 3MCAB 4C5GA 2BKDN 5I2SA 2A3LA 1VQMA 1Q86U 1QP3A 1IREB 2EQUA 2OAUA 3L42A 5EG2A 2DKGA 4BI8B 1SSFA 3OMGA 3CCEA 4KUDK 3R6OA 3G4ST 3OYKA 3CCJT 2ZPBB 2IVWA 2DJZA 3JCMQ 4XU2A 4XU0A 5CVIA 3WVDB 2O4XA 5CO7A 1K9MC 5I2MA 3CC4A 1M1FA 4M75A 3CC7T 2CKKA 2Y4YA 1R8OB 3OB9A 5GAMj 4C8QF 3A5ZB 1Y7XA 3CCRT 3OS5A 1KD1U 1ZBXA 1BKBA 2DZ9A 5GAMg 2K2VA 4LDUA 2EQJA 2CZ1B 2NLUA 3MP8A 5CQYA 5FU6B 5GAN2 1W2BS 1Q7YC 3FB9A 5GANd 3SDZA 1I5LA 4E7IA 2JTMA 2V8IA 3OYIA 4E7HA 3M58A 5A0LA 4TVRA 1G3SA 4KT0E 4C92A 5GMKj 1WPYA 2RM4A 1PSFA 2O01E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X26 B;  2PUO B;  3A8O B;  2DD4 A;  4OB2 B;  2PVG B;  2CZ0 B;  3A8G B;  3VYG A;  4Y28 E;  3X24 B;  1PSE A;  2WSC E;  2ZPI B;  1UGS B;  3A8H B;  3QYG B;  3A8M B;  4L6V 5;  2CZ6 B;  3WVE B;  4ZGE B;  1UGR B;  1DJ7 B;  1UGQ B;  2CZ7 B;  1GXI E;  5L8R E;  1JB0 E;  2DPP B;  3VYH B;  2ZPE B;  3QZ5 B;  3QXE B;  3LW5 E;  4FM4 B;  3X28 B;  1UGP B;  3X20 B;  1QP2 A;  3QZ9 B;  4OB0 B;  2ZPG B;  2PUK B;  4OB3 B;  3QYH B;  2ZCF B;  2WSE E;  2D0Q B;  2ZZD A;  2WSF E;  2PU9 B;  4OB1 B;  2QDY B;  1QP3 A;  1IRE B;  2DXC A;  3X25 B;  2CYZ B;  4ZGJ B;  4ZGD B;  2DXB A;  2PVO B;  4XK8 E;  2ZPB B;  1AHJ B;  2DD5 A;  3WVD B;  1V29 B;  2ZPH B;  2PVD B;  2AHJ B;  2CZ1 B;  3HHT B;  2ZPF B;  4KT0 E;  4RKU E;  1PSF A;  3A8L B;  2O01 E; 
#chains in the Genus database with same CATH topology
 3X26 B;  2QA4 A;  3EH1 A;  1KG1 A;  4HVU A;  7AT1 B;  1NLO C;  4A63 B;  3J7A F;  5D6Y A;  3LWI A;  1AEY A;  1I81 A;  2XDP A;  1OQK A;  3NHN A;  1Y96 B;  2QAZ A;  3JB9 J;  2DD4 A;  3SB2 A;  4JJB A;  1H3Z A;  2CZ0 B;  3C94 A;  4F7U E;  3CC2 T;  2LDM A;  4WF2 A;  3JCM P;  2AZS A;  4M7A D;  3OYJ A;  1VQK A;  1K0X A;  2E5Q A;  4HCC A;  4BUG A;  2P4R A;  1F1B B;  1YP5 A;  2DL5 A;  2LCC A;  5KCH A;  3E9G A;  5DLO A;  4LDY A;  1UGQ B;  2CP2 A;  2OI3 A;  1YIJ A;  5LJ5 d;  3RNJ A;  3C95 A;  1GRI A;  3LH0 A;  1RAF B;  1JJ2 S;  5HCK A;  2XK0 A;  2FEI A;  3G71 Q;  2SRC A;  1YCY A;  5GAN 7;  2C06 A;  1VQ6 A;  1FXX A;  5LJ5 f;  4JJC A;  2DER A;  2X4Y A;  3CXC P;  4J6Y A;  4OML A;  3EG0 A;  3CD6 Q;  4C5E A;  5LJ3 e;  3OBY A;  2M02 A;  1NE8 A;  2RNA A;  5CKF A;  3ULR B;  1QVF P;  1O75 A;  4RUG A;  3RER A;  2DIQ A;  1YJW T;  1K1Z A;  3S3N A;  4KBM B;  1I5O B;  3EGD B;  4J9G A;  1M90 C;  2DBK A;  4HKE A;  1KHI A;  4X9D A;  3I55 A;  2RPN A;  2ROL A;  1G3W A;  1WJR A;  4E7L A;  2K57 A;  2QQS A;  3OW2 P;  2DO3 A;  3LGF A;  3KUF A;  1YFN A;  4C8Q C;  1M2O A;  1LNX A;  4JLG A;  3UA7 A;  2ED0 A;  2FHD A;  1K9A A;  4AG2 C;  3OYG A;  2P0K A;  2EQK A;  2KMT A;  4OGE A;  4DBQ A;  3EGX B;  1X27 A;  5KYW B;  4NS5 A;  5GAN h;  3NMZ C;  4FT2 A;  3CCQ T;  5CK9 A;  1AOJ A;  2YHT A;  1NEG A;  3CBP A;  1PCX A;  2E1H A;  2V1R A;  5AYF A;  3I56 Q;  1VYT A;  2FYK A;  2JOY A;  2MCN A;  5GAM e;  2RJC A;  2K6D A;  1TUC A;  1KQ1 A;  2DL3 A;  1WXB A;  1OZ2 A;  3ASK A;  3GBQ A;  1SEM A;  2OTJ Q;  5FW9 A;  2LT1 A;  2J6K A;  5GAO p;  2OJ2 A;  4J6W A;  1RAC B;  2O4X B;  3PE0 A;  2KYM A;  2EW3 A;  4MML A;  2KRN A;  1UJY A;  3LW5 E;  4PJO A;  3JB9 G;  2Y90 A;  2E6Z A;  3SWN A;  1AVZ C;  3JCM h;  4PFO A;  1YIT T;  2J06 A;  1Q82 R;  3OYF A;  2PUK B;  4N4H A;  5AT1 B;  2HQX A;  1H8K A;  2K5I A;  3M5A A;  4E6R A;  2LCL A;  2L0A A;  4MZM A;  1WA7 A;  1JXO A;  3NFC A;  1Q81 R;  2CT4 A;  2P0P A;  4Z02 A;  4E47 A;  2EQI A;  4HCZ A;  1PC0 A;  4XTV A;  2VC8 A;  1H3H A;  2DL8 A;  1VQP A;  2JMA A;  3FLG A;  4M78 E;  3CCM T;  2LP5 A;  1WIE A;  2PVO B;  5J39 A;  5FRN A;  5I11 A;  2JMC A;  2X3W D;  3VV0 A;  5C6S A;  2HBW A;  2KE9 A;  1C0M A;  1TS9 A;  4E2F B;  1E6G A;  4J83 A;  1P92 A;  2FZG B;  2YLB A;  5CCA A;  1UHF A;  2E70 A;  3CC7 Q;  1M8V A;  1XTD A;  1BCO A;  4EMK B;  2PNI A;  1WYX A;  3VS0 A;  3EG1 A;  2DA9 A;  2RD1 A;  1JEG A;  1BI3 A;  2VUB A;  1OUL A;  2HL5 C;  5GAO r;  2YWW A;  1K0S A;  4PJO C;  2AKL A;  2QEX A;  3JAM E;  3SWN C;  1KSW A;  5HK3 A;  4NL3 A;  4QQG A;  1U3O A;  1YHQ A;  2GCX A;  3E9F A;  1YJN T;  2RJD A;  2E10 A;  3CME T;  4Y28 E;  4ESR A;  1WJS A;  4OMF B;  4RTY A;  1VQO T;  4ANJ A;  3CPF A;  3QWX X;  3CC2 Q;  5IXF A;  1IGU A;  3PTA A;  2K79 A;  3EG9 A;  2LNH B;  2L3P A;  3EG3 A;  3V8K A;  3PMI A;  5KH6 A;  4ZGE B;  3BFM A;  3M4G A;  1IXD A;  5DM7 R;  3QG1 A;  1W2B P;  3OQ5 A;  2DPP B;  2VKN A;  3EHQ A;  1VQ5 A;  2XDB A;  4OP0 A;  1Q82 C;  5L23 A;  1PRL C;  4DOW A;  3C4S A;  1NG2 A;  2LRQ A;  2M0Y A;  4J8O A;  4LN2 A;  1Y96 A;  2KXC A;  1Q81 C;  1KQS A;  3QYH B;  1X6B A;  2WSF E;  3FEO A;  2F2X A;  1TSF A;  1LOJ A;  1QVG A;  2EKH A;  2DL4 A;  4FYV B;  1T3L A;  3DLM A;  1YJW Q;  1M5Q 1;  5GAN 4;  1B34 A;  3NTI A;  1VQ4 Q;  1TUG B;  4C92 E;  5IT9 E;  2VYT A;  4C0G A;  1MGQ A;  2D8H A;  5GAN 6;  2DET A;  3PIO A;  4ZTJ A;  1H92 A;  2AHJ B;  1RL2 A;  5LL6 S;  3RKW A;  5FRO A;  5I22 A;  3CCS T;  3J81 E;  1Y71 A;  5DLQ E;  4R56 A;  4C5H A;  2RF0 A;  2VGN A;  2RJF A;  4FSX A;  4LNP A;  1QKX A;  2DRK A;  2RHY A;  1PRM C;  2KR3 A;  1QCO A;  2AKK A;  4D8D A;  2YSQ A;  1M8M A;  3AHU A;  4BDZ A;  4PLI A;  4C8Q B;  3PFS A;  4JJD A;  2JZ2 A;  3JCM V;  1PNJ A;  2VAS A;  3V7R A;  2EGE A;  3PMT A;  3CCQ Q;  2DL7 A;  3EGD A;  4EMH A;  2CUD A;  5GMK m;  3M53 A;  1D1B A;  4RTW A;  1Q81 U;  4PFP A;  4J9F A;  1KD1 C;  1MMN A;  1ACM B;  1D1C A;  3RIR A;  4A4K A;  3RMQ A;  3CBO A;  4AMC A;  3QJ6 A;  1SRL A;  1H64 1;  4V2S A;  1ZUK A;  4L6V 5;  1YNZ A;  4OVA A;  5ECA A;  2HKN A;  4BY6 C;  2XID A;  4RG2 A;  2KBT A;  4A4F A;  1KC8 R;  2HQE A;  1N8R U;  1JB0 E;  4BB7 A;  5HK0 A;  1T3S A;  4VUB A;  5LJ3 h;  1W2B A;  2D9T A;  1WQW A;  4ZTF A;  1QWF A;  3CCV T;  2DRM A;  3EGX A;  5KYW A;  1SRM A;  3JB9 D;  2EVR A;  1X01 A;  1TOV A;  3OS1 A;  1YIT Q;  1VQ9 A;  3EHR A;  4JJN K;  1MND A;  4DA4 A;  3RKX A;  3MEW A;  4RCC A;  1E6H A;  2QDY B;  3VJP A;  5I2S A;  1IHW A;  2HMA A;  1QP3 A;  3L42 A;  2KRM A;  5EG2 A;  1FMW A;  3G4S T;  2JTE A;  3OYK A;  2DYI A;  2DFU A;  2K3B A;  3CCM Q;  4XU2 A;  1IB8 A;  1UG1 A;  2DNU A;  2O4X A;  4OMO A;  5CO7 A;  3CC4 A;  1M27 C;  1K8A R;  1SHF A;  4C8Q F;  3A5Z B;  1MNE A;  1KD1 U;  2DZ9 A;  5GAM g;  4LDU A;  1NLP C;  3FB9 A;  3SDZ A;  2JTM A;  2A0F B;  1NYG A;  5GMK j;  2C0O A;  5EC7 A;  2CS7 A;  3OA6 A;  4LD9 K;  1X6G A;  5FWC A;  3CCU A;  3H6Z A;  3GF5 A;  4XTX A;  5LJ5 j;  4XU1 A;  3M0S A;  5GAM d;  2KSS A;  2VXE A;  3U23 A;  1RUW A;  4F14 A;  2KRS A;  1NYF A;  3CCE T;  5KYX A;  1GFC A;  3CMA A;  4EMG A;  1WHM A;  1YJN Q;  1M9S A;  5I21 A;  4Z89 A;  1VQO Q;  1KC8 C;  1RI9 A;  2K9G A;  5IH2 A;  3HSB A;  4PJO B;  2H3E B;  4FSS A;  1ZA1 B;  1G8X A;  5GAM f;  3SWN B;  3BDU A;  1LCK A;  2GTJ A;  3ME9 A;  1U8R A;  1K76 A;  4XU3 A;  2RK2 A;  1UB4 A;  2DEQ A;  2BIV A;  3BW1 A;  2EPD A;  4EMK A;  4FCY A;  4PKC C;  2QTV A;  3FJP A;  1RAA B;  2ZPE B;  4X34 A;  2YRC A;  3QZ5 B;  2HEQ A;  2QQB A;  2KYB A;  2GQV A;  1Z9Z A;  2X4W A;  1EZZ B;  2EFI A;  4UC4 A;  4C0F A;  2RJE A;  2E4H A;  3CCJ A;  2VXF A;  4OB0 B;  2FO0 A;  4M7A E;  2F5T X;  3HTR A;  3REA B;  2EAY A;  3OYN A;  4OB3 B;  1AT1 B;  3QPH A;  3JB9 F;  2HNI A;  4A4E A;  3LH5 A;  1VUB A;  2BUD A;  2GFA A;  3CCR A;  3OYB A;  2J6F A;  3QSU A;  4JS5 A;  2DE0 X;  2J05 A;  1OPK A;  2CT3 A;  2XMF A;  4M7D A;  1W6X A;  2L2P A;  3GNG A;  3TRE A;  3L2U A;  1GBR A;  3S3M A;  1ARK A;  3D7S B;  1K8A C;  2DXB A;  2M0O A;  4DBH A;  3CPW P;  2BZY A;  2YT6 A;  1AZG B;  2OTL A;  3GNF B;  4BE0 A;  2BZX A;  2X4J A;  1NPP A;  1PM3 A;  2FRW A;  4N4I A;  3QWY A;  3QUI A;  4RTX A;  3TEE A;  2KEA A;  4DBR A;  3CBM A;  3TSW A;  1VQP T;  3CCS Q;  3BDL A;  1HK9 A;  4EMK C;  2PUO B;  3V7S A;  4PJO F;  3EG9 B;  3NGP A;  1NPR A;  1TWB A;  2LT4 A;  4FU6 A;  2DIL A;  5CKB A;  3THK A;  3HFN A;  3OYM A;  1J3T A;  2AIR B;  3KFV A;  4A53 A;  3X24 B;  4DOV A;  3HRT A;  3VS1 A;  4J9B A;  2XIC A;  1VQ7 A;  2V1Q A;  3HKS A;  4M7D C;  4LXC A;  3V8J A;  1RAG B;  1UGR B;  2RHX A;  1K8A U;  2JTF A;  2KT8 A;  5L8R E;  1OEB A;  2M16 A;  1K4U S;  3UPU A;  5GMK h;  1VQ8 A;  4CC7 A;  1NJI C;  2CSQ A;  4XTU A;  1QQJ A;  4XTY A;  1BI1 A;  2QTX A;  3CCV Q;  4LUE A;  4C8Q A;  4GBQ A;  2ZPG B;  5LJ5 h;  4BY6 B;  2PTK A;  3I9Q A;  1B34 B;  3G6E T;  5GAO q;  2ED1 A;  2FZK B;  3QDR B;  3JCM J;  1M3C A;  2QDL A;  4LE9 A;  4M78 A;  1CSK A;  4OMM A;  2ROT A;  3VS2 A;  4F04 B;  2FVU A;  2RN8 A;  1EX4 A;  4PFZ A;  2JT4 A;  1ZLM A;  2MF2 A;  2X3X D;  2GGR A;  2EKO A;  5IXB A;  2HAX A;  2RHI A;  4A54 A;  1EIF A;  3G4S Q;  2DD5 A;  1WJQ A;  1Q7Y U;  4M77 A;  2H8H A;  2XG8 D;  4QW2 A;  3CPW A;  2FRY A;  1VQL A;  3JCM X;  3UT1 A;  1XQH A;  3HHT B;  3E2U A;  4E7S A;  2FPE A;  4ME7 A;  4EDU A;  1XNI A;  1OV3 A;  4HA8 A;  2HKQ B;  3LWH A;  3VUB A;  3A8G B;  4C8Q G;  4PK4 A;  3L2Q A;  1HD3 A;  2ABL A;  3ZFJ A;  1UDL A;  3MJX A;  3G7Z A;  4O5V A;  1X75 C;  1W70 A;  1ZHI A;  3CD6 A;  1ZBJ A;  1NJI U;  2DK3 A;  1KJW A;  2M51 A;  3O8V A;  2LX7 A;  1X2Q A;  2HQH A;  3IQL A;  3JV3 A;  3O5Z A;  4PJN A;  2ATC B;  3MO8 A;  5KYU B;  4LUD A;  5KE2 A;  1RAB B;  2D6F A;  3TQ7 P;  2K5L A;  4QVD A;  4B9X A;  3CCL T;  4M78 C;  3AT1 B;  2EJ9 A;  1WGS A;  4MDW A;  3CCE Q;  2RQW A;  3REB B;  4PJM A;  3VRY A;  2CZ6 B;  3QHS A;  2JW4 A;  4YTL A;  2DIG A;  1B07 A;  1JO8 A;  2E3H A;  3M57 A;  2P84 A;  4M77 C;  3T9N A;  1V76 A;  3VS3 A;  2K3X A;  2DMO A;  3ZBD A;  1OU9 A;  1TXQ A;  2GNC A;  2PQW A;  1RAD B;  3VRZ A;  3JCM W;  2V26 A;  2RB6 A;  1UHC A;  4XQ3 A;  2DXT A;  1M90 U;  3M54 A;  1UEC A;  3MPU B;  3I56 A;  1JRI A;  4PJL A;  3Q1J A;  2RI5 A;  3EFS A;  1U1S A;  4MZT A;  4MMK A;  2F5K A;  2LNV A;  5IHI A;  2I0N A;  3N5B B;  1CKB A;  5FRM A;  1BB9 A;  2XI9 A;  4BDY A;  3JCM g;  4F7U B;  3A1P A;  1VA7 A;  1QVP A;  3CXC A;  1K9M R;  4E7J A;  1JJ2 P;  3QO3 A;  4JUV A;  3H0H A;  1UUE A;  1S72 T;  2FZC B;  4FW1 A;  1QVF A;  1VQP Q;  4F16 A;  2NUT B;  3L2V A;  5KYX B;  3RUX A;  2JXB A;  2HSE B;  1VIF A;  1VQN T;  3JB9 I;  1N9S A;  2MIO A;  2EYX A;  3OS2 A;  2NUP B;  2F2V A;  1YJ9 A;  1RLP C;  2CP5 A;  4O6J A;  3OW2 A;  4PJO G;  2JS2 A;  1T0J A;  4FL6 A;  1OZ3 A;  2QQ9 A;  3C0C A;  5LJ3 j;  1M1K R;  1QLY A;  3M0Q A;  1XJW B;  4CC2 A;  2EWN A;  5KYY B;  4Y91 A;  3C12 A;  2DX1 A;  4GY5 A;  3CC7 A;  3INZ A;  3SEM A;  3H0I A;  3FDR A;  5GJW B;  1DJ7 B;  5IN1 A;  1BIA A;  3E19 A;  3GPL A;  4FM4 B;  1YI2 A;  4R0K A;  3OYH A;  1KHC A;  4OGC A;  2VGM A;  4CC4 B;  3M55 A;  4M7D B;  1GL5 A;  4BE1 A;  3GOX A;  4C0D C;  1AWW A;  4XAX B;  1I4K 1;  1MMD A;  1FMK A;  4GLK A;  4F7U F;  2LQN A;  3G6E Q;  3G1J A;  2ENM A;  4A4G A;  3CC2 A;  3MCA B;  3TVT A;  2BKD N;  2A3L A;  1IRE B;  2OAU A;  4RTT A;  1MMA A;  3CCJ T;  4XU0 A;  1K9M C;  4M75 A;  2EYZ A;  3CCR T;  1R8O B;  5GAM j;  1Y7X A;  2DLP A;  1BKB A;  4QKU A;  2K2V A;  2CZ1 B;  5CQY A;  4E7I A;  4AFZ C;  4TVR A;  3MP1 A;  2RM4 A;  1I0C A;  1TG0 A;  2QGF B;  1GBQ A;  1K73 R;  4C8Q D;  1X6O A;  2EQM A;  3FJ5 A;  3FIF A;  4RMO A;  5HY6 A;  1C1A A;  1VQM T;  1WHK A;  1YJW A;  2LZ6 B;  1VQ4 A;  1UGS B;  4QQD A;  3OY9 A;  9ATC B;  2GTO A;  3A8H B;  3RMS A;  2LMJ A;  3LGL A;  3CCL Q;  4IUU A;  4PJO E;  4M7D F;  1JU5 C;  2P4T A;  3L2R A;  1Q82 U;  3I5R A;  3OYY A;  2EBP A;  2W0Z A;  2JNG A;  1WX6 A;  1GXI E;  1S1N A;  1EFN A;  1N27 A;  1YCS B;  3OSS C;  3VYH B;  4M75 C;  4M78 B;  4M7A A;  1TU0 B;  3X28 B;  2YUN A;  2QA4 T;  2XDD A;  4E7Z A;  4KUL A;  1QP2 A;  2F69 A;  4FYW B;  3QZ9 B;  2K7A A;  3S6W A;  3OBW A;  4BI3 A;  4IUT A;  5KYU A;  3CCQ A;  2WAC A;  3CEY A;  4IUQ A;  4M77 B;  4KGZ B;  4BE2 A;  4J9E A;  4D6W A;  4JLI A;  2DXC A;  3PVQ A;  2KGT A;  1VQK T;  1KK7 A;  4GLM A;  4ZGD B;  1U1T A;  3QJY A;  4X1V A;  3HRS A;  3VS5 A;  3PGG A;  1YIJ T;  1Q86 R;  2ESW A;  3LLR A;  4KUI A;  4AFQ C;  1K73 C;  2ZPF B;  3DB4 A;  4NOY A;  1GCP A;  2QAS A;  5GAN e;  1VQ6 T;  2DAQ A;  1YIT A;  2KAF A;  2FPF A;  1S72 Q;  4M7A C;  2BE7 D;  1R0C B;  1W4S A;  2LQW A;  3SHW A;  4FYY B;  1VQL T;  3A98 A;  1D09 B;  2SEM A;  1VQN Q;  3SFM A;  2AK5 A;  1ZSG A;  3P8H A;  2JJ9 A;  4OMP A;  3PVL A;  3GIB A;  2NWM A;  1MHN A;  4M78 F;  2ZPI B;  5A0G A;  4PJO D;  3CCM A;  1TUD A;  3I55 T;  4HCB A;  2HSP A;  2YXY A;  1AWO A;  4AG1 C;  4F7U A;  5GAM h;  4NL2 A;  3H8Z A;  3NTH A;  4MZP A;  1R77 A;  2JM9 A;  4WTO B;  1ZQ1 A;  2CZ7 B;  1SG5 A;  1LVK A;  3VS4 A;  4M77 F;  3JCM e;  1AWX A;  2NUT A;  4N4G A;  1MMG A;  1M1G A;  4Q5W A;  3CME Q;  1WZO A;  3RKY A;  4C92 B;  2JM8 A;  3P8B B;  3I35 A;  2NUP A;  2DVJ A;  2A7Y A;  2RQU A;  3P8D A;  2ZCF B;  4J5Y A;  2I2L A;  4ELZ C;  1ZX6 A;  1OU8 A;  2CGH A;  4K11 A;  1N5Z A;  2OAW A;  2VVK A;  1SKU B;  2GFU A;  1VQO A;  3BE3 A;  3EFO B;  2O88 A;  5KYY A;  2ZGW A;  4F7U G;  4C0D B;  1HXD A;  1MUZ A;  2LQ8 A;  1R0B G;  1Q86 C;  5DY9 A;  3CCJ Q;  2LX9 A;  1BIB A;  2EYQ A;  4KGV B;  1C6V X;  2L3R A;  2XHC A;  2XU8 A;  3RES A;  2DZC A;  3CCR Q;  3TSZ A;  4Y92 A;  4L59 A;  2B8A A;  2R58 A;  4IUP A;  2XKO C;  3M4Y A;  5J26 A;  4AFU C;  2RI2 A;  5D6W A;  1G3T A;  3MEV A;  3CXC S;  5KCO A;  2CH4 A;  3EH2 A;  5A2Q E;  4E7K A;  1BU1 A;  2KI7 A;  1KC8 U;  1VOM A;  1QVF S;  4HT8 A;  1VQM Q;  2V8J A;  1TH7 A;  2RO0 A;  1YWO A;  2A08 A;  4R55 A;  3A8M B;  4X9C A;  1N9R A;  1NZ9 A;  1QCN A;  3WVE B;  4CRI A;  1YJ9 T;  2VV5 A;  3OW2 S;  4HVV A;  2GF7 A;  1ZSZ A;  3H0F A;  3CCS A;  1FWZ A;  4M7D G;  1WQ7 A;  4J7I A;  1W1F A;  2DVE A;  1UGV A;  4PL6 A;  2G3R A;  4C0Z A;  1VYU A;  3FRN A;  5IAY A;  2QA4 Q;  2QEX T;  1G83 A;  2RHZ A;  1V1C A;  2MK5 A;  4IKF A;  3DKM A;  3E1S A;  2YUP A;  2FG0 A;  4JPB W;  1YHQ T;  4M75 B;  4BD3 A;  1YI2 T;  4HT9 A;  3VU3 C;  2CP0 A;  4BAC A;  2E41 A;  3MHX A;  1WHL A;  2O9S A;  3X25 B;  2E65 A;  2KDS A;  3M9Q A;  4MDX A;  3ER0 A;  3BY7 A;  2A36 A;  2K4Y A;  4P5N A;  3WXM B;  4J9D A;  4N0A A;  2MYS A;  1JQQ A;  2MPX C;  1QWE A;  1VQK Q;  3L1A A;  3MEA A;  1V29 B;  2A37 A;  2ZPH B;  4JS4 A;  2PVD B;  3JCM c;  5LJ5 g;  4LDW A;  3LX7 A;  2HD0 A;  1VQ5 T;  3EGU A;  1SPK A;  2K2M A;  2E12 A;  1YIJ Q;  2BTT A;  4RKU E;  4RTZ A;  5CKE A;  3CCV A;  2CDT A;  4ZN3 A;  2DJQ A;  1Y0M A;  1ZSZ C;  2HCK A;  1KQS S;  2DTI A;  3M59 A;  1HJD A;  3NTK A;  1VQ6 Q;  2EGA A;  3ZL7 C;  5D7U A;  4OB2 B;  4QQ6 A;  2R57 A;  1YN8 A;  3EFR A;  1VQL Q;  1UFF A;  2XD0 A;  3MET A;  1QVG S;  1BYM A;  1ZA2 B;  3UF4 A;  3G71 A;  3TCJ A;  3J80 E;  2LQK A;  4HCK A;  3G4S A;  2B86 A;  4M7A B;  1PKS A;  3URG A;  5CKH A;  2RA2 A;  3I55 Q;  2Y4X A;  1SSH A;  1WHJ A;  1O9S A;  1OX8 A;  2RQR A;  4M78 G;  4FYX B;  4N0A C;  2VWF A;  2DM1 A;  3M56 A;  2QK0 A;  4M75 F;  2ZAE A;  4XTZ A;  1T0H A;  2KRO A;  1NM7 A;  1VQ4 T;  1FMV A;  1M3A A;  2KXD A;  2BZ8 A;  2GBQ A;  2YRD A;  2EJF A;  3M0P A;  4M77 G;  4M7D E;  1PWT A;  5GAN 3;  2ZZD A;  4DBF A;  3UAT A;  4QVC A;  5GAN g;  4ZN1 A;  2CUB A;  2Z0W A;  2E5K A;  4QT7 A;  1PKT A;  2DKG A;  1SSF A;  1B3Q A;  3OMG A;  5IHN A;  3CCE A;  1HYO A;  1G2B A;  4KGX B;  2HZY A;  3JCM Q;  5CVI A;  2HDA A;  4FW2 A;  4J9C A;  1RAE B;  2Y4Y A;  4OMN A;  5GAN 2;  2EQJ A;  5FU6 B;  2NLU A;  1W2B S;  2QG9 B;  2G6F X;  2W10 A;  4DEY A;  5GAN d;  1I5L A;  2L3S A;  3OYI A;  2V8I A;  2CRE A;  2D1X A;  4E7H A;  1OX9 A;  5A0L A;  2DF6 A;  1QCF A;  1G3S A;  4KT0 E;  4C92 A;  2BE9 B;  1PSF A;  2O01 E;  4RTV A;  3RBB B;  2KY9 A;  2OTJ A;  1WXT A;  1MV0 B;  3HFO A;  4M7A F;  2RQT A;  5GAN f;  3DLL A;  1VQ9 T;  3EAE A;  1G5V A;  3HPW A;  5J3B A;  2GQI A;  4KH1 B;  2PVG B;  1QMC A;  1SHG A;  4WCI A;  5M9O A;  1I8F A;  1VIE A;  3UDC A;  3VYG A;  3L2Z A;  3MP6 A;  4B6M A;  3EFO A;  5FU7 C;  1AWJ A;  4ATO A;  1RAH B;  3F70 A;  1UJ0 A;  1KQS P;  3ZEH A;  1WFW A;  2RK1 A;  1G3Y A;  1D3B B;  3CC4 T;  1AD5 A;  2E64 A;  2DXU A;  3JCM d;  4CI0 C;  4C8Q E;  3DB3 A;  4LD6 A;  1QVG P;  1YJ9 Q;  4C92 G;  4J9H A;  3QXE B;  1UE9 A;  3RDV A;  2DTH A;  4JRI A;  3MEU A;  1OYX A;  1BI0 A;  1WLP B;  3X20 B;  3JCM f;  4M7D D;  3L2W A;  4LDV A;  1N8R R;  4EIK A;  1U5S A;  1OPL A;  3H41 A;  4C92 C;  2CP6 A;  3CCU T;  1D0Z A;  2HBP A;  5GAO n;  1VYV A;  2QEX Q;  2FL7 A;  2P0Q A;  3TU4 K;  1Q95 G;  1M2V A;  4IIO A;  4RTU A;  4M77 E;  2PZ1 A;  2X4X A;  3OYC A;  1YHQ Q;  3CMA T;  1YI2 Q;  2MWO A;  2O2O A;  4XK8 E;  2MMP A;  2COY A;  2V8K A;  3FC3 A;  1BK2 A;  3JCM b;  1M30 A;  2H3J A;  4J9I A;  4QVZ A;  6AT1 B;  1M3B A;  3HP9 A;  3JRZ A;  4M4Z A;  3UWN A;  4DQ2 A;  5CQX A;  1ABQ A;  1IHV A;  3S3O A;  4RCB A;  1WNL A;  1VQ5 Q;  1I1J A;  2M9U A;  4FIB A;  2EJG A;  2L89 A;  2YUQ A;  3M0R A;  1KD1 R;  1LPL A;  4A4H A;  1X2K A;  2LJ3 A;  5D6X A;  5GAN 5;  3G6E A;  4JRK A;  4KRT A;  1WHG A;  1ZUU A;  3R6N A;  5GJV B;  4JRQ A;  1WI7 A;  5HKC A;  4II1 A;  3JSC A;  4OMQ A;  1ZSZ B;  1JJ2 A;  5GAO l;  1BCM A;  1E7O A;  3M0U A;  2RI3 A;  2OTL T;  2F2W A;  2YLC A;  2HL3 A;  5CR2 A;  5GMK e;  1RLQ C;  1KQ2 A;  1U06 A;  4FT4 A;  1LJO A;  1PHT A;  4M78 D;  1Z9Q A;  1M1K C;  4B9W A;  4EPC A;  1IGQ A;  2YDL A;  1N8R C;  2JS0 A;  1XOV A;  3M0T A;  1UGP B;  5LJ5 e;  4HVW A;  1I07 A;  1ABO A;  3QBY A;  5A0D A;  5CAI A;  1B7T A;  5GMK l;  2LJ1 A;  4M75 G;  3GP8 A;  8AT1 B;  4Z88 A;  4M77 D;  2D0Q B;  2FPD A;  2DTO A;  2E6N A;  5GAO m;  2MOX A;  4LDX A;  1QW1 A;  1RAI B;  2C0T A;  1GCQ A;  3V7C A;  3PT9 A;  3PNW C;  3OYE A;  1K9M U;  3CCL A;  4ZGJ B;  1IZ6 A;  1OOT A;  2E3I A;  4PNO A;  1VQ7 T;  1UEB A;  1A0N B;  1D0X A;  2YUO A;  2DEU A;  1IO6 A;  2JVV A;  1YBY A;  2KQW A;  3KXT A;  2X35 A;  4ELY C;  3OYA A;  5GAN 8;  3QKJ A;  3H9N A;  3VS7 A;  1Y07 A;  5FLX E;  4PJJ A;  1VQ8 T;  2KK4 A;  1JXM A;  1NBE B;  2O9V A;  1FYN A;  3OMC A;  3A8L B;  1JBM A;  4RG8 A;  1AZE A;  5LJ3 g;  3NPF A;  3VUZ A;  3VS6 A;  2LJ0 A;  2L5Q A;  1M1K U;  4JZ4 A;  5CIU A;  2M1H A;  2R5M A;  3V8L A;  3SD4 A;  4D8K A;  1VQ9 Q;  4IIM A;  5CKD A;  4M7A G;  1BI2 A;  2KT1 A;  3RR6 A;  4AT1 B;  2KNB B;  3JB9 H;  2D0N A;  4JDS A;  5LJ3 d;  1GCQ C;  2AZV A;  2L3Q A;  2MAM A;  1WDX A;  2J6O A;  3CPW S;  4JRP A;  4Z8A A;  5FWB A;  2FB7 A;  2VB6 A;  1KFZ A;  2JN0 A;  4J6X A;  3UA6 A;  3CC4 Q;  2LCS A;  1D1A A;  5FU7 B;  3G71 T;  5LJ3 f;  2DBM A;  3OSV A;  3LYI A;  2LTO A;  4C92 D;  8ATC B;  1S72 A;  2A28 A;  3HRU A;  1Y57 A;  3CD6 T;  1VQN A;  2ECZ A;  3OS0 A;  3OYD A;  2RQV A;  2EYW A;  1X43 A;  4IUV A;  2WSE E;  2OX7 A;  3CCU Q;  2PU9 B;  4OB1 B;  4PLL A;  4HXJ A;  4M75 E;  4XTW A;  4BI4 A;  2CYZ B;  1CKA A;  1OI1 A;  2KVQ G;  2QGG A;  2LC4 A;  2X9H A;  2QI2 A;  3CMA Q;  1D3B A;  4OF1 A;  1AHJ B;  1PG5 B;  3QII A;  3PIP A;  2YRV A;  3MKD A;  1WHH A;  1K73 U;  2CP7 A;  3I5S A;  4JZ3 A;  1RI0 A;  2RHU A;  2MWP A;  2F1L A;  1FX7 A;  2L8D A;  4KH0 B;  2COZ A;  1YJN A;  5FU6 C;  3CME A;  5GMK i;  3QDF A;  1GFD A;  2EIF A;  2RMO A;  4DEX A;  1Q7Y R;  2DYB A;  2CP3 A;  1BBZ A;  2QQR A;  5KYN A;  1M4Z A;  2IPO B;  3A8O B;  1NEB A;  1HSQ A;  1IRX A;  3VKI A;  3I56 T;  1WXU A;  4L5G A;  1PD1 A;  2NUZ A;  3GLX A;  2X51 A;  1SF9 A;  1PSE A;  2WSC E;  2J7I A;  1NJI R;  2OTJ T;  2JUF A;  3QYG B;  1ZUY A;  1KIK A;  1QKW A;  2IG0 A;  4C5I A;  4ORZ A;  1D0Y A;  2OTL Q;  2C0I A;  2QQA A;  2K5F A;  4IUR A;  2CH4 W;  1N6A A;  1TTH B;  4AFS C;  3KBG A;  5C0M A;  1M2V B;  1UTI A;  1YWP A;  2QXF A;  1PD0 A;  2AT1 B;  3OYL A;  4C92 F;  2MI6 A;  2EGC A;  2CSI A;  4J7F A;  2K3Y A;  4M75 D;  5GAN j;  3CQT A;  5KE3 A;  3HL8 A;  2RH2 A;  2LVM A;  2R5A A;  4C5G A;  2IIM A;  2COW A;  4ZNX A;  1VQM A;  2EQU A;  4BI8 B;  1Q86 U;  2EYY A;  4KUD K;  3R6O A;  4CC3 A;  4F17 A;  2ZPB B;  2IVW A;  2DJZ A;  3EG2 A;  2D8J A;  2QYZ A;  3WVD B;  1M90 R;  2NYS A;  5I2M A;  1M1F A;  1VQ7 Q;  3CC7 T;  2CKK A;  3OB9 A;  1MV3 A;  3OS5 A;  1ZBX A;  1X69 A;  5IHK A;  3MP8 A;  1Q7Y C;  3M58 A;  2O31 A;  1VQ8 Q;  1WPY A; 
#chains in the Genus database with same CATH homology
 3X26 B;  2QA4 A;  2KY9 A;  2CS7 A;  1KG1 A;  2OTJ A;  3HFO A;  4M7A F;  3J7A F;  4C8Q D;  1X6O A;  5D6Y A;  5GAN f;  3OA6 A;  3LWI A;  1I81 A;  2EQM A;  3EAE A;  3DLL A;  2XDP A;  1VQ9 T;  4LD9 K;  3CCU A;  1G5V A;  3H6Z A;  1Y96 B;  3HPW A;  3FIF A;  3GF5 A;  5J3B A;  3JB9 J;  2DD4 A;  3SB2 A;  4XTX A;  4RMO A;  5LJ5 j;  4XU1 A;  2PVG B;  5HY6 A;  2CZ0 B;  1H3Z A;  3C94 A;  4F7U E;  5GAM d;  5M9O A;  1I8F A;  1VIE A;  2KSS A;  3UDC A;  3L2Z A;  2LDM A;  3VYG A;  3MP6 A;  3CC2 T;  2VXE A;  4WF2 A;  5FU7 C;  4ATO A;  1VQM T;  3JCM P;  1YJW A;  3CCE T;  3F70 A;  3CMA A;  4EMG A;  4M7A D;  1VQ4 A;  1M9S A;  1UGS B;  5I21 A;  4QQD A;  3OY9 A;  3OYJ A;  1VQK A;  1KC8 C;  3ZEH A;  3A8H B;  3HSB A;  3RMS A;  4PJO B;  3LGL A;  2RK1 A;  4IUU A;  5GAM f;  2E5Q A;  4HCC A;  3SWN B;  4PJO E;  4BUG A;  3BDU A;  4M7D F;  1G3Y A;  3ME9 A;  1U8R A;  1D3B B;  3CC4 T;  2E64 A;  2DXU A;  2P4T A;  2LCC A;  3L2R A;  4XU3 A;  1Q82 U;  5KCH A;  3JCM d;  3OYY A;  2RK2 A;  3E9G A;  4CI0 C;  5DLO A;  2JNG A;  1UB4 A;  4LDY A;  1UGQ B;  3DB3 A;  4LD6 A;  4C8Q E;  1YIJ A;  5LJ5 d;  2DEQ A;  2BIV A;  3BW1 A;  1GXI E;  4EMK A;  1N27 A;  3C95 A;  4PKC C;  3OSS C;  4C92 G;  3FJP A;  3LH0 A;  3VYH B;  2ZPE B;  4M75 C;  3QZ5 B;  3QXE B;  4M78 B;  4X34 A;  2QQB A;  1JJ2 S;  4M7A A;  3X28 B;  2DTH A;  2XK0 A;  2GQV A;  4JRI A;  3MEU A;  1OYX A;  2X4W A;  2QA4 T;  1BI0 A;  3X20 B;  2EFI A;  3JCM f;  4M7D D;  3L2W A;  2XDD A;  1YCY A;  5GAN 7;  4KUL A;  4UC4 A;  1QP2 A;  2F69 A;  4LDV A;  2C06 A;  1VQ6 A;  1FXX A;  4C0F A;  2RJE A;  3QZ9 B;  5LJ5 f;  3CCJ A;  2VXF A;  4OB0 B;  4M7A E;  2F5T X;  4C92 C;  2EAY A;  3S6W A;  4OB3 B;  2X4Y A;  3OBW A;  2HBP A;  4IUT A;  4J6Y A;  4BI3 A;  3QPH A;  5GAO n;  3JB9 F;  2HNI A;  4A4E A;  4C5E A;  3CCQ A;  1VUB A;  2BUD A;  2FL7 A;  2P0Q A;  2WAC A;  2GFA A;  3CEY A;  4IUQ A;  3CCR A;  5LJ3 e;  3TU4 K;  3OBY A;  4M77 B;  3OYB A;  4BE2 A;  4M77 E;  1NE8 A;  4JS5 A;  5CKF A;  3QSU A;  1O75 A;  4D6W A;  2X4X A;  2DIQ A;  4JLI A;  3OYC A;  1YJW T;  3RER A;  2DXC A;  3S3N A;  4KBM B;  3CMA T;  4M7D A;  3GNG A;  1M90 C;  4HKE A;  2MWO A;  3TRE A;  3L2U A;  3S3M A;  1VQK T;  4ZGD B;  1K8A C;  1KHI A;  1U1T A;  2DXB A;  2MMP A;  2M0O A;  4X9D A;  4XK8 E;  3I55 A;  2V8K A;  3QJY A;  3FC3 A;  3JCM b;  2H3J A;  3HRS A;  1G3W A;  1WJR A;  2OTL A;  4E7L A;  2K57 A;  3GNF B;  3PGG A;  4BE0 A;  2QQS A;  2X4J A;  4QVZ A;  2DO3 A;  1NPP A;  3LGF A;  3KUF A;  4C8Q C;  1YIJ T;  3HP9 A;  4N4I A;  3LLR A;  1LNX A;  3JRZ A;  4JLG A;  4KUI A;  3UWN A;  3QUI A;  3TEE A;  4DQ2 A;  5CQX A;  2FHD A;  3S3O A;  1K73 C;  3CBM A;  3OYG A;  2ZPF B;  2P0K A;  4RCB A;  1VQP T;  1WNL A;  3DB4 A;  2M9U A;  3BDL A;  2EQK A;  4NOY A;  2KMT A;  4FIB A;  2EJG A;  4OGE A;  2L89 A;  1HK9 A;  4EMK C;  5GAN e;  2PUO B;  1VQ6 T;  3V7S A;  2DAQ A;  1YIT A;  2KAF A;  4PJO F;  4M7A C;  1W4S A;  4NS5 A;  4A4H A;  5GAN h;  4FT2 A;  5D6X A;  1NPR A;  5GAN 5;  3G6E A;  1VQL T;  3CCQ T;  2LT4 A;  4FU6 A;  5CK9 A;  4JRK A;  2YHT A;  5CKB A;  3SFM A;  3CBP A;  3HFN A;  3P8H A;  2E1H A;  5AYF A;  3OYM A;  4JRQ A;  4A53 A;  3X24 B;  4DOV A;  5HKC A;  2FYK A;  4II1 A;  3JSC A;  3GIB A;  1MHN A;  4M78 F;  2JOY A;  2ZPI B;  3HRT A;  5GAM e;  5A0G A;  2RJC A;  4PJO D;  3CCM A;  1JJ2 A;  3I55 T;  4HCB A;  4ZN1 A;  1KQ1 A;  2XIC A;  5GAO l;  1OZ2 A;  3ASK A;  1VQ7 A;  4F7U A;  3HKS A;  5GAM h;  2RI3 A;  4NL2 A;  2OTL T;  4M7D C;  3V8J A;  2YLC A;  2LT1 A;  3H8Z A;  3NTH A;  4MZP A;  5CR2 A;  5GMK e;  5GAO p;  4J6W A;  2O4X B;  1UGR B;  2RHX A;  1ZQ1 A;  1KQ2 A;  1K8A U;  2CZ7 B;  2JTF A;  5L8R E;  2M16 A;  4FT4 A;  5GMK h;  1LJO A;  3UPU A;  4M77 F;  4M78 D;  4MML A;  1VQ8 A;  1NJI C;  1M1K C;  3JCM e;  3LW5 E;  4B9W A;  4EPC A;  4PJO A;  1N8R C;  3JB9 G;  1XOV A;  2Y90 A;  1UGP B;  4N4G A;  4XTU A;  1M1G A;  2E6Z A;  4XTY A;  1BI1 A;  3SWN A;  4Q5W A;  5LJ5 e;  2QTX A;  3RKY A;  3JCM h;  4C92 B;  1YIT T;  3QBY A;  5A0D A;  5CAI A;  4C8Q A;  3P8B B;  5GMK l;  2ZPG B;  5LJ5 h;  4BY6 B;  4M75 G;  3OYF A;  2PUK B;  3GP8 A;  4N4H A;  1B34 B;  2HQX A;  2A7Y A;  3G6E T;  2K5I A;  5GAO q;  3P8D A;  3QDR B;  2ZCF B;  4J5Y A;  2I2L A;  3M5A A;  4ELZ C;  2LCL A;  3JCM J;  4M77 D;  2D0Q B;  4MZM A;  2CGH A;  2DTO A;  2E6N A;  3NFC A;  4M78 A;  5GAO m;  4LDX A;  1QW1 A;  2FVU A;  2P0P A;  4Z02 A;  2GFU A;  4E47 A;  3V7C A;  4HCZ A;  2MF2 A;  1VQO A;  4XTV A;  3PT9 A;  2VC8 A;  3PNW C;  3OYE A;  1VQP A;  1K9M U;  2EKO A;  3FLG A;  4M78 E;  4ZGJ B;  3CCM T;  3CCL A;  1IZ6 A;  2RHI A;  2PVO B;  2ZGW A;  4C0D B;  1HXD A;  4F7U G;  5J39 A;  2HAX A;  4A54 A;  4PNO A;  5FRN A;  2LQ8 A;  1EIF A;  2DD5 A;  1VQ7 T;  1UEB A;  1Q86 C;  1WJQ A;  5DY9 A;  3VV0 A;  5C6S A;  1Q7Y U;  2LX9 A;  4M77 A;  1BIB A;  2EYQ A;  2XG8 D;  4J83 A;  4QW2 A;  3CPW A;  2JVV A;  1P92 A;  1VQL A;  3JCM X;  1YBY A;  2YLB A;  2KQW A;  5CCA A;  2L3R A;  3KXT A;  2E70 A;  3UT1 A;  2X35 A;  2XHC A;  2XU8 A;  3RES A;  4ELY C;  3OYA A;  5GAN 8;  3QKJ A;  2DZC A;  1VQ8 T;  1Y07 A;  5FLX E;  1XQH A;  2KK4 A;  3HHT B;  1M8V A;  1XTD A;  4ME7 A;  4EDU A;  1XNI A;  4EMK B;  4L59 A;  4HA8 A;  3OMC A;  3LWH A;  3VUB A;  3A8G B;  3A8L B;  1JBM A;  2B8A A;  2R58 A;  4RG8 A;  4C8Q G;  3L2Q A;  2RD1 A;  3ZFJ A;  4IUP A;  1BI3 A;  2XKO C;  3G7Z A;  3VUZ A;  2VUB A;  4O5V A;  5LJ3 g;  1X75 C;  5GAO r;  3M4Y A;  5J26 A;  1ZHI A;  3CD6 A;  2QEX A;  4PJO C;  2RI2 A;  5D6W A;  1G3T A;  2L5Q A;  2DK3 A;  3JAM E;  1NJI U;  1M1K U;  5CIU A;  3MEV A;  3SWN C;  3O8V A;  3CXC S;  2M1H A;  5KCO A;  2R5M A;  3V8L A;  3SD4 A;  5HK3 A;  5A2Q E;  4NL3 A;  5CKD A;  4E7K A;  3MO8 A;  4QQG A;  1YHQ A;  1KC8 U;  2GCX A;  4M7A G;  3E9F A;  1YJN T;  1BI2 A;  2RJD A;  2E10 A;  5KE2 A;  4Y28 E;  3CME T;  2D6F A;  1QVF S;  4HT8 A;  1WJS A;  2K5L A;  4OMF B;  1VQO T;  3CPF A;  4QVD A;  3JB9 H;  3PTA A;  4B9X A;  3CCL T;  4M78 C;  2EJ9 A;  2V8J A;  1TH7 A;  1WGS A;  2RO0 A;  4MDW A;  4JDS A;  5LJ3 d;  2MAM A;  4R55 A;  3A8M B;  4X9C A;  3CPW S;  3V8K A;  1N9R A;  1NZ9 A;  3PMI A;  5KH6 A;  2CZ6 B;  4JRP A;  3WVE B;  4CRI A;  2FB7 A;  3QHS A;  1YJ9 T;  4ZGE B;  2VV5 A;  4YTL A;  2JN0 A;  3BFM A;  3M4G A;  4J6X A;  3OW2 S;  5DM7 R;  2DIG A;  3QG1 A;  5FU7 B;  3M57 A;  3OQ5 A;  2DPP B;  2GF7 A;  3G71 T;  5LJ3 f;  4M77 C;  3CCS A;  1VQ5 A;  1FWZ A;  2XDB A;  4M7D G;  4OP0 A;  1WQ7 A;  3T9N A;  1Q82 C;  3OSV A;  3LYI A;  4J7I A;  4PL6 A;  2DVE A;  2K3X A;  2LTO A;  4DOW A;  4C92 D;  3C4S A;  2G3R A;  1S72 A;  3ZBD A;  3HRU A;  2LRQ A;  4C0Z A;  2PQW A;  3FRN A;  4J8O A;  5IAY A;  1Y96 A;  3CD6 T;  2QEX T;  3JCM W;  1VQN A;  1KQS A;  1Q81 C;  3OS0 A;  2RB6 A;  2RHZ A;  3OYD A;  3QYH B;  4IKF A;  4IUV A;  2WSE E;  4XQ3 A;  3DKM A;  3E1S A;  2DXT A;  1M90 U;  3M54 A;  2WSF E;  3I56 A;  1JRI A;  2PU9 B;  4OB1 B;  3FEO A;  4M75 B;  3Q1J A;  2RI5 A;  3EFS A;  4PLL A;  4BD3 A;  1YHQ T;  1YI2 T;  1U1S A;  4M75 E;  4HT9 A;  4XTW A;  3VU3 C;  4MZT A;  4BAC A;  4MMK A;  1LOJ A;  2E41 A;  2F5K A;  3MHX A;  3X25 B;  2LNV A;  2CYZ B;  2E65 A;  1OI1 A;  2KDS A;  3M9Q A;  4BI4 A;  1QVG A;  4MDX A;  2KVQ G;  3ER0 A;  2LC4 A;  3BY7 A;  3DLM A;  3N5B B;  3WXM B;  2K4Y A;  1M5Q 1;  2QI2 A;  4P5N A;  1B34 A;  1D3B A;  5GAN 4;  4OF1 A;  3NTI A;  1AHJ B;  4N0A A;  3QII A;  3L1A A;  3MEA A;  1V29 B;  3PIP A;  2YRV A;  2ZPH B;  4C92 E;  5FRM A;  5IT9 E;  2VYT A;  2XI9 A;  4BDY A;  3JCM g;  4C0G A;  4JS4 A;  1MGQ A;  2PVD B;  4F7U B;  1K73 U;  3JCM c;  5GAN 6;  3PIO A;  1RI0 A;  5LJ5 g;  4LDW A;  1QVP A;  2RHU A;  4ZTJ A;  2AHJ B;  3CXC A;  2MWP A;  1FX7 A;  1RL2 A;  2L8D A;  3LX7 A;  2HD0 A;  5LL6 S;  3RKW A;  5FRO A;  3CCS T;  2E12 A;  3J81 E;  4E7J A;  1VQ5 T;  1Y71 A;  3QO3 A;  5DLQ E;  4R56 A;  4JUV A;  1YJN A;  5FU6 C;  4C5H A;  5GMK i;  3CME A;  2VGN A;  4FSX A;  2RJF A;  2EIF A;  4RKU E;  5CKE A;  3CCV A;  4ZN3 A;  1S72 T;  2RHY A;  1QVF A;  3L2V A;  1KQS S;  2DTI A;  2QQR A;  3RUX A;  1M4Z A;  3A8O B;  3M59 A;  3NTK A;  1VIF A;  1VQN T;  3AHU A;  4BDZ A;  3JB9 I;  4PLI A;  4C8Q B;  3PFS A;  1N9S A;  3OYN A;  2JZ2 A;  4OB2 B;  4QQ6 A;  3JCM V;  3VKI A;  3OS2 A;  2R57 A;  1YJ9 A;  3EFR A;  3I56 T;  3V7R A;  3PMT A;  4L5G A;  2XD0 A;  4O6J A;  3MET A;  3OW2 A;  4EMH A;  4PJO G;  1QVG S;  1BYM A;  3GLX A;  5GMK m;  3M53 A;  3G71 A;  4FL6 A;  1OZ3 A;  1PSE A;  2WSC E;  3TCJ A;  1Q81 U;  3J80 E;  2LQK A;  1KD1 C;  3G4S A;  2QQ9 A;  3RIR A;  4A4K A;  4M7A B;  5LJ3 j;  3RMQ A;  2OTJ T;  2JUF A;  3CBO A;  3URG A;  5CKH A;  3QJ6 A;  2EWN A;  3QYG B;  2RA2 A;  1H64 1;  4Y91 A;  4V2S A;  2Y4X A;  2IG0 A;  4L6V 5;  4C5I A;  3C12 A;  4OVA A;  1O9S A;  3CCU T;  4BY6 C;  2XID A;  4GY5 A;  4RG2 A;  4A4F A;  4M78 G;  2HQE A;  3CC7 A;  1N8R U;  3INZ A;  3FDR A;  1DJ7 B;  5IN1 A;  4N0A C;  2QQA A;  1BIA A;  1JB0 E;  4BB7 A;  2K5F A;  3M56 A;  4IUR A;  5HK0 A;  3E19 A;  4M75 F;  3GPL A;  4VUB A;  5LJ3 h;  1N6A A;  4FM4 B;  1YI2 A;  1W2B A;  2D9T A;  3KBG A;  4XTZ A;  5C0M A;  3OYH A;  1WQW A;  4ZTF A;  1VQ4 T;  3CCV T;  1KHC A;  4OGC A;  2QXF A;  2VGM A;  3M55 A;  3JB9 D;  4M7D B;  4BE1 A;  1X01 A;  2EJF A;  3GOX A;  4M77 G;  4C0D C;  3OYL A;  4M7D E;  4C92 F;  2MI6 A;  3OS1 A;  1VQ9 A;  4XAX B;  1I4K 1;  4JJN K;  5GAN 3;  4DA4 A;  4GLK A;  4J7F A;  2K3Y A;  2ZZD A;  4M75 D;  3RKX A;  4F7U F;  5GAN j;  4QVC A;  3MEW A;  4RCC A;  5KE3 A;  2QDY B;  5GAN g;  3CC2 A;  3HL8 A;  3VJP A;  2RH2 A;  4A4G A;  3MP1 A;  2LVM A;  2R5A A;  3MCA B;  4C5G A;  2BKD N;  5I2S A;  2A3L A;  1VQM A;  1Q86 U;  1QP3 A;  1IRE B;  2EQU A;  2OAU A;  3L42 A;  5EG2 A;  2DKG A;  4BI8 B;  1SSF A;  3OMG A;  3CCE A;  4KUD K;  3R6O A;  3G4S T;  3OYK A;  3CCJ T;  2ZPB B;  2IVW A;  2DJZ A;  3JCM Q;  4XU2 A;  4XU0 A;  5CVI A;  3WVD B;  2O4X A;  5CO7 A;  1K9M C;  5I2M A;  3CC4 A;  1M1F A;  4M75 A;  3CC7 T;  2CKK A;  2Y4Y A;  1R8O B;  3OB9 A;  5GAM j;  4C8Q F;  3A5Z B;  1Y7X A;  3CCR T;  3OS5 A;  1KD1 U;  1ZBX A;  1BKB A;  2DZ9 A;  5GAM g;  2K2V A;  4LDU A;  2EQJ A;  2CZ1 B;  2NLU A;  3MP8 A;  5CQY A;  5FU6 B;  5GAN 2;  1W2B S;  1Q7Y C;  3FB9 A;  5GAN d;  3SDZ A;  1I5L A;  4E7I A;  2JTM A;  2V8I A;  3OYI A;  4E7H A;  3M58 A;  5A0L A;  4TVR A;  1G3S A;  4KT0 E;  4C92 A;  5GMK j;  1WPY A;  2RM4 A;  1PSF A;  2O01 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...