1YBYA

Conserved hypothetical protein cth-95 from clostridium thermocellum
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
185
structure length
176
Chain Sequence
MISAGDFKNGVTFELDGQIFQVIEFQHVKPGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Cth-95 from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Translation
molecule keywords Translation elongation factor P
total genus 29
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ybyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA02
2BH2A 4LFBQ 2KCMA 2R93H 4DV0L 4TVAB 1KQSS 1Y1VG 3ULLA 2PI2E 4JBWA 5J3BA 5M5YH 2UXCQ 3LH0A 3I56T 4EX5A 2JA9A 4GLAC 4DV6Q 4LF8Q 4NXML 3AEVA 2ZJRA 1M90C 1NBWA 2E6ZA 3J81E 1VS0A 2ID0A 2JVVA 4GOPA 3HOYG 3HKZE 4LF8L 3CCEA 1OXUA 4EQ5A 1S40A 2RCNA 3GTJH 3RLFA 4L5QA 1HR0W 4DR6Q 2R6GA 1UE5A 1S72T 1VQBA 1PH8A 1X3GA 4Y7NH 3EBEA 4BBSH 1B70B 4LF9L 5JJKA 4DUYL 2CKKA 3HOVG 4X34A 1P16A 5LMNL 1XPOA 1JJ2A 3HOWH 4UP7A 4GLVB 1KRSA 3LGLA 1E24A 1HZCA 2N49A 1Z9FA 1VQKA 2QGQA 1SROA 3T1HQ 2CQOA 4DV1Q 1H95A 3M4QA 4B3TQ 3CC7T 3CC4T 2UUAL 1VQJA 3IRBA 4PZ7A 1N34Q 2JA6G 2JE6I 2AKWB 3U58A 4C3HH 1OTCA 2UUCL 4B3RL 4YWMA 3LGJA 4JI3L 2AHOB 4AH6A 5IYBG 5A2QE 1FGUA 3I4MH 3K80C 5GROA 4O2DA 3S17H 3DM3A 4A3DH 1K73U 3J7AF 2VW9A 4LW1A 1XPRA 3CCVT 1VQDA 4DR1Q 3MXNB 1NE3A 4H02A 4A3IH 4HIMA 3UDGA 4WJ3M 5C44H 2R7ZG 4DR2Q 4MTNA 3CD6A 2JQOA 4DR7Q 3JAMc 3H15A 3A0JA 4B3RQ 1VCIA 3JAMi 1SLJA 4A3JG 1VQ8A 1NMGA 4DK6C 5M3FG 3AFQA 4LF6L 4OX9L 3P8BB 1VQ5T 4QQDA 1CSPA 2NN6I 4MZ9A 4LF9Q 5BR8L 1E1OA 4OWXB 3RZOH 3CCSA 1UEBA 3D31A 4JOIC 2XHCA 1IBMQ 1O7IA 2D0OA 5GAEC 2YV5A 3G6EA 3KF8B 3PIOA 4IPHA 1YJNT 4OO1I 5IY0A 1I5FA 1N33L 1VQ4T 2MO1A 4LF7L 1PH7A 1BBUA 3OW2S 4AQYQ 2VZAA 1KIXA 3K8AA 4DK3C 4HJ5A 4LF4Q 1TWAH 1K9MC 1Q86C 3B6YA 2IX1A 4DV2Q 4DNIA 5IYDG 1NPRA 2KENA 4OWWB 2R92G 4P74A 2HIVA 4LFCL 3PF5A 3CCRA 2OTLT 5LMUQ 3RLNA 3S1MH 3I55A 2JA7H 4IPCA 5IYBH 3W1GA 2BA1A 1YZ6A 2WP8J 4YHHQ 4HJ8A 1K3RA 2QEXT 3CCJT 4AIMA 4DR2L 3K81C 1YJWA 4R1JA 1LUZA 4DR7L 1Y1WG 1MJEA 5FJ8H 2OQKA 3ZJYC 2IHFA 1OXTA 4JYAL 1E1TA 2R7ZH 1VQFA 2XTIA 1XMOL 4A3BH 2PQAB 3HOWG 3CC2T 2JOYA 1EUJA 3CW2C 3L7ZC 4A93G 4IFDJ 4YY3Q 3S16H 2YTYA 2UXBQ 1CKNA 3CCUT 2JJQA 4O0AA 2IHEA 5IP7H 4IO9A 1EIYB 5IYCG 1N33Q 4OWTB 2R92H 1VQ5A 5IYDH 5C0XG 4IPDA 3UDFA 5JEAG 3GD7A 1QUQB 3U50C 1PH1A 2YU9H 1TXYA 4POGA 1FJGL 2JA6H 2I5HA 1IBML 1KD1C 3J81c 2KBNA 1OXSC 2MQHA 4LF5L 1YJ9T 3F2BA 4B3MQ 4JI7Q 4A3MH 4RMFA 3CC4A 3CMAA 1FL0A 4KHPQ 3G4ST 1YHBA 2HIXA 1RIPA 4BY7G 2LCLA 1WYDA 2Y0SG 4A75A 3PO3G 1HZBA 3PSIA 5E7NA 4R4QA 3TQYA 5FLXE 2FXQA 4UY8C 3S1QH 1QVGA 4QL5A 2KHIA 2PI2A 4JI8Q 3J81j 1A62A 3G4SA 1Q12A 1MJCA 4GS3A 4A3JH 1ASZA 3CC7A 2E5LL 3GTLH 3CF5A 4TVRA 4DV5Q 2HHHQ 4HIDA 1J5EQ 2NVTH 3MEFA 3PO2G 1XPUA 2V1CC 1E22A 4J15A 2ZM6Q 3UDXA 4DAYB 2G3RA 1VQ9A 5IT9E 2I0QA 2VS1A 4LFAL 2Z6KA 3S15H 1LYLA 2Y0SE 3I4OA 4IJLA 1BKBA 1Q82U 1IBLQ 4BA1I 2BH8A 3CCVA 3G6ET 1GM5A 2NVXH 4LFCQ 4JV5Q 1JJGA 1VQAA 3CC2A 3S24A 1X55A 3KBGA 3KYHC 2MI6A 1VQ4A 3BJUA 5M3FH 1QVFA 3JC66 3J80c 5LMUL 1VQOT 1VQ9T 2EIFA 1FVIA 2Z6KC 1QUQA 2KHJA 3CAMA 3H0GG 3J80i 3L0OA 3KFUA 3D0FA 1YEZA 3CCQA 4JBMA 3CCST 4PMWA 4PG3A 3CCMA 1X3EA 3DB4A 4UPAA 1C9OA 4A4IA 1JT8A 3I4MG 4DR3L 3PIPA 3I55T 1Q46A 1CUKA 3LGFA 3CMET 5ELOA 3FP9A 3WWVA 5IE8A 1ASYA 4A3LH 3KOJA 3HOYH 2PNHA 4OONA 1VQ6T 4ZN1A 3TRZA 4R4CA 1V9PA 2UU9Q 4GN4B 4OO1G 1EIFA 4BY1G 1X9NA 4DV7Q 2E8GA 2JA7G 3GTKH 4IFDI 1KL9A 4P71A 3TEHB 1CKMA 1Q1EA 5FLMH 1I94L 4DR4L 1N8RU 3CCRT 2OTLA 4YCUA 4LFAQ 3E9HA 1IBKL 3S14H 1A0IA 4JI0Q 1HNZL 4YCWA 1VQGA 3GDEA 4BBSG 1PH6A 4QY7A 1VQPA 2OTJA 1K83H 2JEBI 3NEMA 4B3SL 3S2HH 3RN2A 4GOPB 1TWCH 3GTQH 2JK8A 2MWOA 2LXJA 1NPPA 1YITT 3A5UA 2F4VQ 3DLLA 1SR3A 3PV0A 3M4PA 1NJIU 4A3GH 2VL6A 1X56A 1Q81C 1M1KU 4L5TA 1Q81U 1M1KC 4JI8L 4X65L 3I2ZA 3K7UC 1XMQL 4GKKL 5M3MH 3OTOL 4Y52H 2UUBQ 3CCUA 1YBYA 1I6HH 2NZOA 4GN5A 4OXPA 4XTCS 3KLWA 1KC8C 4JC0A 1E7ZA 2D62A 1KRTA 5BR8Q 4MNOA 2MNAA 4LF6Q 1VQ7T 2F52A 3TS0A 4JI1L 3CXCS 3CD6T 1K0RA 2MWPA 1SN8A 1Q1BA 1K73C 2A8VA 4DR6L 1FJGQ 1Q7YC 3CMEA 3HFZB 3U4VA 5IWAQ 2UXBL 1S3OA 3G48A 2B63G 4WJ4A 4JBJA 3CCLA 2Q2IA 1KAWA 4NXNL 5C0XJ 5IP9G 4DV6L 1YNXA 4B3SQ 2OQ0A 1V1QA 4QQBX 4GNXA 1EQRA 1BVSA 4JCVE 1N34L 5DLQE 2IG0A 1L1OA 5C44G 1HH2P 1U0LA 4YTLA 2ZTCA 1IBKQ 4X66Q 1HNZQ 1YI2A 1C7YA 4AYBE 4KI0A 1PH9A 1SMXA 4JOIA 1PV4A 4IOAA 3F2DA 3BZCA 2K5VA 1JE5A 5M3MG 2KVQG 1K8AU 1JJ2S 5LMNQ 5HGQA 3CCQT 2YTXA 2C35B 1QVCA 4BXXH 3JAME 2BA0A 1WCMH 1YHQA 5C4JH 3CCET 2WFWA 4YCVA 3CPFA 1YJWT 4NB3A 3STBC 2ZTEA 3I4NG 2EQSA 5M5XH 1J5EL 2L3RA 1EQQA 4BY1H 4AQYL 4DAMA 2JA5H 4PZ8A 2R7DA 1HJPA 4P72A 5H1SE 1VQ6A 1N9WA 4DPGA 2JNGA 2JUFA 3HKSA 2HT1A 5K36G 1SE8A 3A5ZB 2VUMG 1X54A 1YIJA 1I3QH 1HZAA 2DGYA 4YWLA 4DV0Q 1JB7A 5DM7R 2KCTA 4A3KG 4KHPL 4FDBA 4PZ6A 4HJ9A 3NBHB 1WOCA 1VQNA 3AFPA 3F1ZA 2E70A 2ES2A 1N32Q 3PUZA 4ZN3A 4DUZQ 5FLXc 3M7NA 4A3GG 1X3FA 2RHSB 1NJIC 2N3SA 1M90U 3F8TA 5FLMG 4GKKQ 1XMQQ 4A3MG 1S72A 3H0GH 2UUBL 3CPWA 1KQSA 2GVBA 4DV4Q 2GN5A 2OWOA 1Y1WH 3OYYA 4JI4L 1NZ9A 1G6PA 3HOZH 4A3EH 4CRIA 3G71T 2YTVA 2Z0SA 1CKNB 1J6QA 2E2IH 1KD1U 4DV5L 2I5MX 4K0KL 1Z47A 1IXRA 2ZJPA 4QIWE 2Q2UA 2RHQB 4IPGA 3FHWA 4K0KQ 4P75A 2PQAA 3U4ZA 1D7QA 1UE6A 5IT9c 4A3CG 3PUYA 3NELA 1YITA 3GTMH 1B8AA 3BZKA 4YWKA 1PH2A 2UUAQ 2JA8H 1W2BA 4A3BG 4JBKA 3CXCA 5AJ3Q 1XJVA 4L5RC 1XNRL 3ICEA 4IOCA 1OXXK 3STBD 2IX0A 4HIOA 5JEAJ 1UWVA 3I56A 1AE3A 4LUVA 1Q8KA 2A19A 3KDFB 4JI2L 3OTOQ 1EOVA 4LUZA 4DV2L 3PO3H 3KF6A 2LSSA 2K4KA 2RF4A 1XNQQ 1HNXQ 1VQMA 4DKAC 1PA6A 1E3PA 1MIUA 4UP8A 3W5OA 3E9IA 4DR3Q 1EYGA 1YHAA 4L5SA 1RL2A 2DO3A 2QA4T 4APVA 1QVGS 1A8VA 4TQUS 3NENA 2VQEQ 2WB1E 1YJNA 3CCJA 1G291 4ME3A 1XMOQ 4JYAQ 1XNIA 2CKZB 1GVPA 1EWIA 5C4XH 3CPWS 4LFBL 2VY3A 3KDFA 1GD7A 3PUVA 4OX9Q 1I50H 1TWGH 1D8LA 3L2PA 2MFIA 1YHQT 4C3JH 3GTOH 4JV5L 5AJ3L 2Q2TA 1AE2A 1GO3E 3HOZG 4A3LG 1CKOA 4A76A 3H3VH 1X6OA 5FJ8G 4X66L 3J81i 2A1AA 4LNQA 3J7A5 1VQEA 3K7AH 3T1YL 4A3IG 2JA8G 5LL6S 1L1OC 1VQHA 2AMCB 4DR5L 2CCZA 3FKIH 4UP9A 2E5LQ 4GNXC 1SRUA 2UUCQ 2OCEA 1LM0A 2HHHL 1PYBA 4BA2I 3TREA 4BY7H 1YJ9A 2IT1A 2NVYH 1HNXL 1XNQL 1Q86U 4JI6Q 3TS2A 1K9MU 3PGZA 1WJJA 5GADC 4LWCA 4GLXA 3DB3A 3S1NH 1VQ7A 1N36L 4A3EG 4JI5Q 1VQKT 1W3SA 4JI2Q 4ALPA 2B3GA 3VDYA 3T1HL 2Q2HA 4QJFA 4GKJL 4JI1Q 1NY4A 2LXKA 4R4OA 5IP7G 3RNUA 5C4XG 3J7ZC 3I4NH 2LQ8A 1PH5A 2GVAA 2H5XA 1JJCB 1IBLL 2E2JH 4A93H 1XNRQ 4BXXG 3UDIA 4BBRG 4IJHA 3PO2H 3PUWA 1QVFS 2CFMA 1A63A 3Q8DA 1V43A 3A74A 1G51A 4HJAA 4R4IA 4GNXB 4KLKA 1B7YB 2VUMH 3AQQA 4QGUA 2XGTA 2KDSA 5C0XI 2N8NA 3GO5A 4JI3Q 4NXMQ 2UXCL 3T1YQ 1N8RC 2NVQH 2VNUD 1M1GA 4DR5Q 2ATWA 2YYZA 4DV4L 4JI4Q 4A3CH 2R93G 1EFWA 1L2FA 2JEAI 4RG2A 2WAQE 5ELNA 2K5HA 2I5LX 1WCMG 2DUDA 2WB1G 3RLOA 4DUZL 2K5NA 4YHHL 1JMCA 3J80E 1C0AA 2VQFL 3HOXG 2UU9L 1U5KA 4X64L 1UE1A 1VQLT 4GN3B 4GKJQ 1DGSA 4NPSA 4DUYQ 4KHZA 5IAYA 5IYCH 3W1BA 3M9BA 1WFQA 4IFDG 1IYJB 1SSFA 4XIGS 3RR5A 1BBWA 2VQEL 1PH4A 4LF4L 1PYSB 1Y14B 4BBRH 1HNWQ 4NXNQ 1VQLA 4C3IH 4YY3L 2R7FA 3EIVA 1HNWL 1VQOA 3K0XA 4X6AH 4LF7Q 1TWHH 2CWAA 3SGIA 2AWOA 5IP9H 2ASBA 1R9TH 5EAYA 4AYBG 5C3EG 3GTGH 3CCLT 1Q7YU 2LVMA 3CCMT 2EXDA 2ZTDA 3HOUG 2QA4A 2PMZE 2VQFQ 1VQPT 1K8GA 3OW2A 1AH9A 4X64Q 1YIJT 5JJIA 3ERSX 1HZ9A 5M5WH 3M3YH 1X65A 1CSQA 2K75A 4HJ7A 3FKIG 3M85A 1YVCA 4X65Q 1YI2T 3HOVH 2CWPA 3UE0A 1QZGA 4GOPC 4DR1L 4A3KH 3HOUH 2ZM6L 1KHIA 3M4OH 2IY5B 4C2MH 1MKHA 1OXVA 3HKZG 5GAHC 3RN5A 1KXLA 1Q82C 1HR0Q 1Y1VH 2ALYB 3CQZH 2N78A 3G71A 2K14A 3ULJA 5C3EH 2OTJT 2K50A 5IWAL 5HY6A 4HIKA 4DV1L 1SFOH 3CP0A 1P8LA 1WI5A 3S2DH 2UXDL 3UE1A 4DR4Q 4POFA 4X62Q 4DV7L 3PUXA 2B63H 4LF5Q 2UXDQ 1T9HA 1K8AC 3AYHB 3I7FA 5GAGC 3PCOB 2D0PA 1W2BS 1VQMT 2F3IA 4R4TA 4X62L 4B3ML 3KJOA 1QZHA 4RG1A 1N36Q 2JA5G 4A3DG 4JI5L 5LMNW 3GTPH 3PF4A 1VQ8T 3EN2A 2AWNA 3CMAT 2E2HH 1PFSA 1VQNT 3KJPA 2ZJQA 4JI7L 1UE7A 3F2CA 5J26A 4JI6L 1IL2A 2MO0A 4A3FH 1HR0L 1XTDA 2F4VL 1L0WA 1NMFA 3H3VI 2HQLA 1PH3A 1PVOA 2WAQG 2NN6G 3ULPA 3S1RH 1LTLA 3E0EA 4A3FG 2K52A 3KF6B 4P73A 5JJLA 2NZHA 2QEXA 4LUOA 1L1OB 1VQCA 4DV3Q 1IZ6A 4B3TL 4JI0L 3BU2A 1KC8U 4JG2A 1TWFH 2B29A 5GQOA 1I94Q 2L15A 1PHJA 1N32L 3RZDH 3ER0A 4DV3L 3HOXH 1VQIA 1GKHA 1NTGA
chains in the Genus database with same CATH superfamily
4LFBQ 1K9AA 3CMAQ 3CRLC 2KT8A 2Y90A 1X6GA 2RI3A 4TVAB 3N52A 2RQRA 4J9HA 5D7UA 5GAN4 1VQPQ 2RI2A 2BE5C 1WHJA 2LDMA 3LH0A 3THKA 3I56T 2JA9A 1D0YA 1CA6A 4LF8Q 1H95A 4N4IA 5M3MB 4AMCA 3AEVA 4F7UG 1NBWA 2E6ZA 2ID0A 2A6EC 1U1TA 4XU0A 5M9OA 4C1NK 4OMMA 4JLGA 2ICIA 1NUCA 4LF8L 1DOMA 2DL3A 2A3LA 3CCEA 4EGVA 2RCNA 5KYYA 2RH2A 3OTOQ 5CCAA 2IPKD 1YHQQ 1S72T 2EQJA 1GBRA 1PRTB 4Y7NH 3QJYA 3M4YA 5IHIA 4QVCA 2B8FA 4F87A 4LF9L 3HOVG 2JW4A 4C3IB 4RH6A 5LMNL 2NWMA 1TU0B 1K8MA 3RMQA 1SNQA 4UP7A 2HMAA 3LGLA 1E24A 5D14A 1VQKA 2EKOA 4EMKA 1YNJD 4N8FA 4IURA 1HUMA 4KY5A 4B3TQ 3OYKA 2AKKA 1NAPA 3QOJA 1GCQC 3H09A 4UAIA 3NPPA 1OPLA 1QP2A 5ECAA 2XU8A 1F2LA 1BCPF 1EY4A 2JE6I 4PZ7A 3U58A 4A3BB 3HRTA 4NP5A 5FU6C 4HMJA 4AH6A 3M0UA 8AT1B 1FGUA 5GJVB 2PMZB 2CSIA 3GOXA 3CC4Q 1TQOA 4CDDC 3FDTA 4A4EA 3JCMe 3J7AF 3M9QA 2VW9A 4DR1Q 1I5LA 1NE3A 4LD9K 4A3IH 2VASA 8ATCB 4HIMA 4WJ3M 4P5NA 1V76A 1XJWB 3L9AX 1WHKA 1VCIA 5GANd 1SLJA 2F2XA 4A3JG 3LLRA 2BDOA 3QWXX 5M3FG 1HPCA 3P8BB 1FMWA 1A3TA 4J6WA 2NN6I 1I3QB 3REBB 4LF9Q 4C3JG 2KBTA 4AYBB 3MXPA 4JOIC 3VYTA 3BVGA 4DOVA 4OO1I 2XICA 1VIFA 1N33L 5KEEA 2A28A 1TWHB 5GAN3 4C92D 1BBUA 1VQ9Q 1JU5C 3PMTA 2PZTA 3GTOB 4A4FA 4HJ5A 3BS1A 1BBXC 2VWFA 1SG5A 1ZUKA 3OYHA 2MJ8A 3V7RA 1K9MC 5D3DA 3NUCA 1NPRA 3HS0C 1TSFA 1AWXA 4P74A 2PUOB 3EG9B 2HIVA 1IW7D 2QQSA 1AZEA 2QQAA 5ELEA 3RLNA 2DX1A 3W1GA 4FYWB 4I65A 3OSSC 1SEBD 1YZ6A 2PZWA 1V8QA 4NKLA 1YJWA 2X6LA 3ME9A 1Z9ZA 1RABB 2K2MA 4M7AG 4X3UA 1MJEA 5FJ8H 4NS5A 2TSSA 1E1TA 3JCMJ 1NR4A 1VQFA 1JEGA 1XMOL 4E7SA 1GBQA 2VB6A 3CC2T 1VQKQ 2JOYA 3L7ZC 4A93G 5GAOq 4X3KA 3I4NH 1GXDC 4YY3Q 3TVTA 2YTYA 1CKNA 5FU7C 5IP7H 4IO9A 2JA5B 3NGPA 5IYCG 4OWTB 1VQ5A 2DBKA 4KUIA 4K2LA 1B9MA 4DOWA 4RCCA 1BR9A 1M3BA 1TXYA 1IBML 1GUWA 4D8KA 3J81c 4G4KA 1OXSC 2MQHA 4E7LA 4HT9A 1LTSD 2EY5A 3M55A 4LF5L 1BUVT 4ZKCB 2ZXPA 4RMFA 3CC4A 4J6XA 3VS2A 3L2ZA 4JI7Q 2GFAA 3KXTA 1RD9D 1YHBA 1ZBXA 1D1IA 5HKCA 1WYDA 2F0NA 3EFRA 2Y0SG 1PHTA 1W4SA 1HZBA 3PSIA 3HOYB 3TQYA 1CZGA 2FXQA 2YLBA 1ZA2B 4JI8Q 1N8RR 3EH2A 4RMOA 4CJ1B 1A62A 3G4SA 3NP8A 1WX6A 1ASZA 4OELB 1SNMA 3CF5A 2B2WA 5G3LD 2NVTH 1SNDA 1J5EQ 3I4LA 1R0CB 3MEFA 1STHA 4IUTA 3PO2G 3A1PA 2V1CC 2ED0A 4J1MA 4J15A 3VS4A 3UDXA 5L37A 4RTZA 2G3RA 1LV9A 3EGDB 2HEQA 2J6KA 1VQ9A 4OB1B 2KUMA 3OWFA 2H3EB 3LH5A 3NQIA 4BA1I 2BH8A 3G6ET 1JJGA 4JV5Q 1VQAA 3IKJA 3QO3A 2B2YA 3C95A 1QVFA 3JC66 5LMUL 1ILPA 1WHLA 1VQ9T 4IN3A 5HURA 4IQZA 1I0CA 1Y8OB 1X69A 1JXMA 3KFUA 1SRMA 1L0YB 4L6TB 2ZAEA 3WXMB 2CT4A 3SR1A 3CCMA 2DY8A 4UPAA 1YI2Q 3I3CA 3TEEA 2EYYA 3NPFA 5A2QL 4Z8AA 4BE2A 4DR3L 3H41A 1RI0A 3EFOA 3PIPA 2RN8A 1CUKA 4DA2A 5IE8A 2PZUA 1I5OB 2PNHA 1M27C 2Z4IA 4OONA 4KK7A 1LACA 3G7LA 1VMPA 1UGRB 1V9PA 2GA4B 4OO1G 1B34A 1EIFA 5FROA 2M02A 3MEWA 4M7AC 1PFMA 2E8GA 1X9NA 4IFDI 4DR4L 1PD1A 4C5IA 1QQJA 2RJDA 3CCRT 2OTLA 1IYUA 2RQVA 4LFAQ 3E9HA 4JRPA 4C92F 3V2TA 2YLCA 4YCWA 1F2ZA 1VQGA 3PTAA 1EX4A 4QY7A 4BBSG 3S2HH 2LQWA 2JEBI 2R7ZB 3L3OC 4M7DB 4FYVB 4A4HA 4GOPB 3OBWA 4A3JB 5C4HA 1ET9A 2BE9B 1QOHA 1SR3A 2YDLA 2HDLA 5JPNC 2VL6A 4A3GH 3W2DA 1OOTA 4JW0A 4L5TA 2M0YA 2H3JA 1M1KC 2L89A 3I73A 2FZKB 3GV3A 4Y52H 1F1BB 1LJOA 5FWCA 1HRJA 1YBYA 2F0IA 1I6HH 4OXPA 2JTFA 3HP9A 2EFIA 4LF6Q 4DN4M 2DFUA 1MSGA 1SAPA 3RDVA 5CV8A 5GAMd 3CXCS 1K0RA 4DR6L 1B44D 1Q1BA 1SN8A 2WAQB 1FJGQ 4RTYA 2O2OA 1Q7YC 1CQVA 1Q3LA 2RBMA 5IWAQ 4M77G 2UXBL 3G48A 3HL8A 3SK5A 2B63G 4WJ4A 1UUEA 3RNJA 1S4ZA 2Z9HA 1K0SA 4JBJA 1UFFA 5GAOn 3RKWA 3MEAA 4DV6L 3UDCA 2DVJA 1Y1WB 3DWQA 4GNXA 1O7LA 1BVSA 4PFOA 1N34L 2A7YA 3GPLA 4RHSA 2ZPIB 2E3IA 3V05A 1YI2A 4Y92A 2BTTA 2EXZA 4XDXA 1PH9A 2QA4Q 1SMXA 4JOIA 1I07A 3G6JB 4IOAA 3F2DA 3E9FA 3L2UA 3BZCA 4HCKA 1K8AU 5M3MG 3FEWX 2A37A 4D8DA 1KDAA 3CCQT 3TP7A 2FPEA 4XQQA 5C44B 3NBIA 4F8MA 4C0DB 1C1AA 1YHQA 5D6YA 1EU4A 1WCMH 3SXHA 5C4JH 4C92G 1GXIE 2EQSA 4MZMA 2OTLQ 1SBBB 3QPHA 1UB4A 2JA5H 4PZ8A 1J3TA 1HJPA 1KK7A 4L8JA 2EGCA 2GGRA 1N9WA 2F0VA 4QT7A 1XTCD 4FF1A 3A8GB 2VUMG 2RK2A 1HZAA 3H91A 4DV0Q 2ZXRA 5CQYA 4JS5A 2GFUA 3L2VA 3ZEHA 3O5ZA 2YUPA 1KDCA 2HAXA 1KQ1A 4RCNA 4KHPL 2K28A 1VOMA 4A53A 4EMKC 3S1RB 2QTVA 5IGCA 1X3FA 4RGTA 1NJIC 3F8TA 3KLRA 5FLMG 1XMQQ 4CDFC 2DEUA 5GAMg 3BDOA 4E2FB 1YJ9Q 2GVBA 5GAMj 4C0GA 5KH6A 2Z0WA 2RVLA 3AMUA 2JZ2A 1J6QA 1VQ7Q 4ORZA 2K05A 4E7IA 4M7DC 1LTBD 2KEEA 4RWSC 3VYSA 2PO4A 3OYMA 1LTTD 1MV0B 1N27A 2HD0A 1YITA 3GTMH 3BZKA 1BI3A 1OXXK 5KE3A 2IX0A 5JEAJ 1UWVA 2DZ9A 2M16A 1H9KA 4K14A 5FW9A 3GIBA 2E12A 1Z7TA 5I22A 1STAA 3KDFB 1LT5D 1AW7A 2DJQA 2KEAA 4LDUA 3OSVA 4IUPA 4M78A 2M51A 1GUOA 1STEA 2NTTA 3IAYA 2CUDA 1PRTC 3A8JE 2IX3A 1VQMA 3NK9A 3K6OA 2JA7B 1PA6A 1E3PA 1T3LA 2K5FA 1YHAA 5LJ5d 2QDYB 3QWNA 4ZTJA 2B2VA 2EKHA 1YJWQ 4KRTA 1XXGA 5EKIA 2DO3A 2QA4T 2VQEQ 1QVGS 1VMCA 3NENA 3VS7A 4FSXA 3O8VA 3SFMA 4JYAQ 2DJZA 3INZA 4CKBA 2DMOA 3ZBDA 3NHHA 4HVUA 1Y7XA 3CPWS 1ML0D 1UE9A 1U4MA 4C5EA 2VY3A 1GD7A 3KDFA 3Q0AA 4OX9Q 5A35A 1I50H 5EQ0A 3LWHA 3L2PA 2MFIA 3GTOH 3TP6A 3BVZA 1GO3E 4A3LG 1E7OA 1AWJA 5FJ8G 4FO2A 4OMLA 2F0DA 3ZFJA 3UI2A 2CT3A 4CBVA 2F0QA 2F0OA 2JA8G 1L1OC 2AMCB 4Q5VA 1TWBA 3CBOA 2WSCE 2OCEA 3QR8A 2UUCQ 3TREA 3V7SA 1YJ9A 2D0QB 1HNXL 1KNEA 4JI6Q 2X9HA 1N5ZA 5GADC 3JB9F 1Y8PB 1VQ7A 2LZ6B 4A3IB 3K7AB 2XD0A 2EPDA 3VDYA 1W3SA 2B3GA 2VYTA 4LN2A 3Q23A 2D6FA 2F0GA 4MZTA 2HD3A 4R4OA 3OS0A 4L59A 3MCAB 1VUBA 4J9EA 1IBLL 4RTUA 2DNUA 1PDQA 5FKAC 1DYQA 2XK0A 3I72A 4X9DA 1U8RA 3MTSA 5C6AA 4IJHA 1XNRQ 1XX8A 2ATCB 3VR5A 1A63A 4HJAA 3A74A 1O7ZA 4R4IA 2OT2A 5EKLA 4IZ8A 4C0DC 4KTAA 3GNFB 3WOFA 5C0XI 2QGGA 4M7DD 2C06A 3ND9A 2UXCL 3OQ5A 2QDBA 1K1ZA 2VNUD 3JCMg 3SB2A 2QKIC 3H94A 2EYOA 2E4HA 4RG8A 5CKDA 1VQMQ 3S9WA 1EFWA 4JI4Q 4A3CH 2XRSD 1TVXA 2F0JA 2OXPA 3MC0B 3KF8A 2MK5A 4DUZL 2K5NA 3M0TA 1JMCA 2TMPA 2ZPEB 2F3VA 2VQFL 4OB0B 5KNCA 4II1A 4X64L 2IPOB 4MIUA 1DZ1A 4KHZA 1PRMC 4JRQA 4M78G 3OA6A 1RACB 1SSFA 4LF4L 3T4AC 5LJ5h 4BBRH 3L1AA 1MGQA 3OS5A 1WYXA 2E3HA 3GV6A 3Q1JA 3VYUA 3CCVQ 4F7UA 2DNCA 3ERQA 2O88A 3R93A 2ASBA 5IP9H 1G83A 2CVRA 1R9TH 3E9GA 5CV7A 2PNRC 2A08A 3CCLT 3HSBA 2LVMA 2XDPA 1E2VA 2EXDA 1CK1A 3HOUG 4K5WA 2PMZE 2VQFQ 1VQPT 2QEJC 1WNLA 1C4QA 2Q8IB 2K4YA 3SWNC 2DILA 1HZ9A 4PNYA 3M3YH 2K75A 3NTKA 1D3BA 1YVCA 4OMFB 1YI2T 3UE0A 1QZGA 5LJ3f 1PRTD 4GOPC 1X32A 3M57A 2IY5B 4C2MH 5GANg 1OXVA 1G8ZD 2BE5D 7AT1B 4HA8A 3C12A 2J7IA 2KQWA 1XYIA 3T51B 4G7OC 2K04A 4BI3A 3CQZH 3QB3A 2OTJT 1EFID 2BDNA 5EJWA 2YWWA 2CP5A 3CP0A 3IL8A 1WI5A 4IUNA 2M9UA 2PW5A 3S2DH 2FRWA 4POFA 1NEGA 4C8QE 4DR4Q 3FPPA 4K8JA 4M1UB 4PNOA 1H9SA 3N6RA 1K8AC 3AYHB 5GAGC 4JI7L 2F3IA 4B3RL 5EPKA 2Z1CA 5IOCA 3KJOA 4RG1A 1SMYC 2XWJB 4PJOF 3MXUA 3W3AA 1QZHA 1BK2A 4K2KA 3V8KA 2AWNA 3CMAT 1PFSA 2PTKA 3AT1B 1UE7A 2K01A 2RK1A 1C48A 1AOJA 3VA7A 5J26A 5KYXB 4OMNA 1QCBD 3CHBD 4OIKA 3BFMA 4M77F 2KXCA 5I2SA 2NB0A 3BZDB 1AT1B 2AQ1B 4KY6A 1EIHA 1PTOB 2GTOA 1SMYD 3T13A 4PJMA 2WAQG 3ULPA 1TUDA 4A3FG 2LJ1A 4E7HA 5FO7B 1LVKA 3S1MB 1UDLA 1VQ5Q 4A4GA 4JI0L 3JRZA 3BU2A 2NYZD 2EQMA 1EU3A 4E47A 2PU9B 2QILA 1X75C 3UPUA 1TR5A 2R93H 4DV0L 3FDRA 1EWCA 2B2UA 1Y1VG 4OGEA 4JBWA 5J3BA 4FW2A 4JI5Q 2BCOA 1U4RA 2KECA 1IO6A 3QYHB 2JVVA 3PO3B 2KYBA 5JEAH 1ZYRD 1OXUA 1PZJD 1SE3A 3GTJH 1A2TA 2OF1A 3RLFA 1AZQA 1UE5A 3NHNA 2XSCA 3QOLA 1VQBA 1PH8A 1X3GA 2F03A 4BBSH 4KV6A 1CTMA 1UG1A 2CKKA 1PXUA 1R8OB 4X34A 3UT1A 2F0UA 2RSNA 3A55A 2L5TA 4CDEC 4OO1H 1NG2A 3TP8A 2N49A 3PO2B 3T1HQ 3G1JA 3I4MB 1M1FA 3CC7T 2WKCA 1HFGA 5IODA 5IN1A 1ARKA 1N34Q 4J9BA 4FP5D 4C3IG 2JA6G 4BDZA 1HK9A 2AIRB 1OTCA 4YWMA 3LGJA 2AHOB 2V1RA 2KHSA 3I4MH 4IIOA 3K80C 2M0OA 3CCMQ 2J06A 1BIBA 1P92A 4EMGA 1J8IA 1S72Q 1XPRA 3CCVT 1VQDA 1GJXA 2VB2X 2KI7A 3EFSA 1D0ZA 1H9JA 1SHGA 2K32A 2NZ1D 9ATCB 5AFWA 5C44H 2R7ZG 2Q8TA 3JAMi 2SRCA 3OW7A 3ZL7C 4TRDA 4DBFA 4LF6L 1VQ5T 5M5YB 1QVFP 1CQFA 4ZK9B 4A54A 4OWXB 2F1LA 1F9SA 1D1AA 1QW1A 4WCIA 2YV5A 3VR3A 3VYRA 1SFOB 4J7IA 3NE5B 1G6ZA 5GMKe 5CBAE 5IY0A 1I5FA 1C8CA 1K8OA 1ZSGA 2QCPX 1CI3M 4RHRA 4LF7L 3G71Q 1PH7A 1JC7A 1RKNA 1LO5D 1CSKA 4AFZC 3MEVA 1W6KA 2F0LA 3K8AA 3J81L 1T0JA 4LF4Q 1FX7A 2HKNA 2EQIA 1UHCA 1TWAH 2KK4A 1Q86C 5IGBA 4BY7H 4DV2Q 3BDLA 5IYDG 1RAFB 4OWWB 2R92G 4R8NA 3TBIB 2XDBA 5LMUQ 1Y69U 1D09B 2EW3A 2EJMA 4TSSA 5IYBH 2DZCA 5FWBA 2YRCA 2E65A 3D4WA 1LT6D 4ZLTF 5GMKl 3VUBA 3GTLB 1WQ7A 5CYUA 3BYTB 4XU3A 1YJNQ 2IHFA 3DXJC 1OXTA 3Q24A 5EPJA 2XTIA 1CA5A 5KYNA 1W1FA 2L3PA 1B3QA 2RA2A 4BD3A 2EYHA 2PQAB 1B34B 2HSEB 4QVZA 3GNGA 5GAN8 2A69C 2Z6BA 1SXTA 3R3OA 2UXBQ 3CCUT 4MDXA 2JJQA 2IHEA 3ZYYX 1EIYB 2R92H 1B7TA 5IYDH 2COYA 4MZPA 1Q90A 1QUQB 2CREA 5C5MA 4POGA 3MHXA 2LY7A 2I5HA 1M1KR 2KBNA 3I4NB 4A93B 1M3AA 4Y7NB 1FL0A 5TSSA 1SEMA 1WDXA 2QXFA 3JCMQ 1CKAA 2A5HA 4G57A 3TDQA 2NUZA 3S1QB 4BY7G 5ELFA 5E7NA 1PG5B 4WJWA 1DOKA 3S1QH 1QVGA 1STGA 2PI2A 3J81j 1WD1A 2F0SA 1IW7C 1A0NB 1Q12A 3NWSA 1MJCA 3HG9A 4GS3A 3SVMA 1T3SA 4A3JH 3GTLH 5E1FA 4TVRA 1TKWB 1PKTA 1UGSB 4A3GB 3RZDB 5EC7A 1ACMB 2C0OA 1E22A 4ZGJB 4I7AA 4J7FA 3NFCA 2LRQA 1SHFA 4M78B 3VYHB 4R0KA 3U9SA 4LFAL 1JB3A 5E3FA 3S15H 1H92A 2BZYA 5LJ3h 1AEXA 4V2SA 1MSHA 3ULRB 1BKBA 1Q82U 1PTOF 3I4OA 4IJLA 3CCVA 1M8MA 5ISRA 1GM5A 2O31A 2P0KA 2LTOA 3V8LA 2SNSA 3S15B 2DA9A 3TSWA 3KBGA 4M77E 3V8JA 1VQ4A 1U4PA 3KYHC 3C2PA 3J80i 1HQMC 2Z6KC 1QUQA 4M78E 4BI4A 3CAMA 3L0OA 2IL8A 5F2DA 1IGQA 1M4VA 1SSHA 3D0FA 2B8AA 2MAMA 4FXDA 3O13A 4A4KA 3M4GA 2XVSA 1ZUUA 2K5DA 4PMWA 2RHYA 2NUPA 5DNFA 1C9OA 5ELDA 2RI5A 1B50A 3OWEB 3TSSA 4A4IA 3I4MG 2EYJA 1Q46A 4JDSA 4DNTB 4A3MB 3LGFA 4NOYA 5ELOA 4C8QF 3FP9A 4ZQ3A 3WWVA 1ASYA 1D5MC 1QB5D 4A3LH 5AT1B 3KOJA 5KE2A 3JCMX 3GP7A 5CR2A 1VQ6T 1ZXTA 3C46A 4R4CA 1VF7A 2UU9Q 4J9IA 2V8JA 1HYOA 3RERA 2XWBB 4BY1G 2JA7G 2VKNA 5GAMh 5L8RE 4P71A 4E7KA 1Q1EA 1YNJC 6AT1B 1IBKL 1JQQA 3S14H 3DWAA 3D4RA 3NQTA 2PYKA 5J1ZA 5C3EB 4V0BA 3GLXA 4GLMA 1PH6A 1VQPA 2OTJA 1ZEQX 3NEMA 5FO9B 4B3SL 1WTXA 1B53A 2JK8A 4Z88A 2LXJA 3HGBA 1HA5A 1QCFA 1NPPA 3M7GA 1EQVA 3DLLA 1NJIU 2MP1A 2RQXA 1Q81U 4N4GA 3R8BA 1XQHA 5G3LF 2I0NA 2X6GA 3I2ZA 1F9RA 1XMQL 5CMDA 1AVZC 2K5QA 2FB7A 2R93G 1OX8A 5EPLA 2CSQA 2D62A 2SEMA 1VQ7T 2FPDA 3X3MA 3CD6T 1F9PA 5LL6X 2EAYA 2JT4A 4FYXB 1GHJA 3E1SA 5BR8Q 3U4VA 4XU2A 3VRYA 3L42A 3NBHA 2JTEA 4NXNL 2JMAA 4FSSA 4C8QA 5IGDA 4LDVA 5I2MA 2OQ0A 2NUTB 3M5AA 2EQUA 4WF2A 3HOUB 3M4OB 4JCVE 2ABLA 1B2TA 5DLQE 2IG0A 5C44G 1U0LA 1EZ6A 3A98A 4X66Q 1C7YA 4IFDH 2O01E 3PVQA 4RAUC 2KJXA 1SYEA 1PCXA 4F7UB 3UF4A 1JJ2S 2L5QA 4DNRB 5HGQA 5LMNQ 2YTXA 2C35B 4CHTB 2YUNA 3LW5E 3T9NA 3S2DB 3ASKA 3T16A 2VB3X 2YUQA 3CCET 3CC7Q 2WFWA 3CPFA 3I4NG 1S5FD 2DJGC 3STBC 5DEHA 1AWOA 3Q6SA 2R7DA 4P72A 3CQZB 5H1SE 1GL5A 2RQTA 1TS4A 5K36G 3RKYA 3BDCA 2M2LA 3A5ZB 2KCCA 3PE0A 1K73R 1GFDA 2DGYA 3KFVA 5DM7R 4CGYB 2DYIA 4K11A 3CEYA 3JCMV 1QCOA 4HJ9A 3NBHB 3F1ZA 2JS0A 2RB6A 3CBMA 2ES2A 4ZN3A 4QF4A 4DUZQ 2RSOA 1B3AA 1GCPA 1M90U 4F04B 4PLIA 2EYMA 1S72A 1IL8A 3CPWA 4JI4L 1DJ7B 3OYYA 1PNJA 2RA4A 3HOZH 1HJDA 4A3KB 1AHJB 2Z0SA 1BO0A 2E2IH 2Y4YA 1S5CD 4DV5L 2R58A 1Z47A 3SE0A 5GMKh 2X3XD 1UHFA 4QIWE 3K58A 4PJOA 2ENMA 4P75A 4K0KQ 1DJRD 1E6HA 1D7QA 1UE6A 3FVQA 3EJIA 4A3CG 2OEOA 3PUYA 5KYIA 3NWTA 1NNXA 3S2HB 1B8AA 2UUAQ 2IWHA 1JQYD 4JBKA 2GBQA 1O75A 4BS9A 2C0TA 3RKXA 1ENAA 4O1NA 4HIOA 1I6HB 1YWPA 4M7AD 4IALA 2KROA 3I56A 3OOCA 5GANj 5I6WA 1AE3A 1WTWA 2PNIA 1NTGA 2D8JA 1RUWA 3CBPA 1Q8KA 3E0JA 5GAN5 5GAN6 4OB2B 2MUYA 4KH1B 2O4XB 2LSSA 1K0XA 1DXMA 4JJBA 2RF4A 5I2YA 1HNXQ 1XOVA 2J0TD 1I1JA 3MVVA 3I35A 1M8AA 4ABNA 2A74C 4L5SA 4M8AA 3DLMA 2KNBB 4CKCA 2HNIA 2YUOA 4JS4A 4L5RC 1YJNA 3CCJA 1XMOQ 2FPFA 5AYFA 3OS2A 1YNZA 2ZPFB 1M4ZA 1I4QA 3HOWB 3MJXA 1D8LA 3TZDA 4LUDA 1JWSD 5AJ3L 5KYWA 3DUZA 3JB9G 5T1IA 5C0XH 4A76A 2RHZA 1NLOC 4OVAA 3J7A5 4A3IG 3K7AH 1NM7A 4B08A 2D5DA 4HVVA 1IXDA 2HZYA 2NLUA 1IREB 1EIGA 1T5EA 4BA2I 1EFNA 4DEXA 3JCMb 2KRMA 2LMCB 2AZVA 2IT1A 4HJ8A 2K5LA 1Q86U 4DXFA 2O5JC 3EROA 1RCVD 4LWCA 4M4ZA 1QVGP 3S1NH 4M7DF 1WPYA 1N36L 4A3EG 1VQKT 1FMVA 3QBYA 4K6LA 3QWYA 1NY4A 4XQJA 2LXKA 5C4XG 1SSOA 1PLFA 1BCPD 2RNAA 2VGNA 4J9GA 1KD1R 1I4K1 3Q22A 3IQLA 3M58A 1QG7A 2AK5A 3PUWA 2CFMA 3KUPA 3EG9A 5IXBA 4C1NI 3PO2H 5IHNA 1JOOA 2ZPBB 1MBYA 2EYXA 3NTIA 3AQQA 2A69D 2XGTA 2KDSA 1OO9B 1WJRA 4NXMQ 1LTGD 2QF7A 1SNCA 2OI3A 4XT1B 3FRNA 1H3ZA 3URYA 2YRDA 1N8RC 1VYTA 1WTPA 2PQEA 2EY6A 4DR5Q 1PFBA 2ATWA 2YYZA 3H6MA 2JEAI 5EG2A 5CV4A 4ZNXA 1Y71A 2I5LX 4M78C 3RLOA 2DRMA 2WV6D 3I55Q 3P20A 2FJ2A 2HL5C 3J80E 1K83B 1YP5A 1D0XA 3DHQA 1VYVA 3NTHA 5DM63 1NEBA 4GN3B 4CJ2C 5CR3A 3D8GA 4GKJQ 5GAMe 1SYGA 2ZPGB 1HA6A 5IYCH 5KYXA 3S3OA 1W6JA 3W1BA 1HUNA 4OP0A 3RR5A 3X3NA 4OMQA 1BBWA 2F1MA 1HNWQ 2B2TC 3WVEB 4KH0B 5JVG3 1DCZA 1G5VA 4EMHA 1TTHB 2KVMA 2R7FA 4KN4C 2RKSA 4LF7Q 3P8DA 3SGIA 4EQPA 4FF4A 4M7DA 4HSPA 4QB4A 3OS1A 5EAYA 1ZKOA 4OMPA 2OTJQ 5C3XA 1J9OA 2ZTDA 2ROTA 2QA4A 5M5WB 4CC4B 1OULA 4OF1A 1K8GA 1AH9A 1EEID 4R55A 3ERSX 5M5WH 2VXWA 1CSQA 2L3QA 3HFOA 1A3VA 2NVTB 3WOEA 1NLPC 1PD0A 2DTHA 1AEYA 1B07A 4DXGA 1KHIA 3TN2A 3PGGA 2ECZA 1MKHA 5GAHC 1WXBA 2YXYA 4F16A 2A73B 3VJPA 1Q82C 1KXLA 1I4RA 4KGZB 5AJ3Q 2EJ9A 3FKIB 4H7BA 2N78A 3G71A 3RD4A 1MV3A 4AFQC 1SDFA 4RGMA 5C3EH 1QMCA 4JLIA 4HTHA 4BE0A 1LCKA 1Q86R 4LDWA 2R5AA 4QKUA 3HKZB 4FU6A 4M77B 1JR0D 3P75A 2UXDL 3QKJA 4KGXB 2VUBA 2B63H 1ILQA 2UXDQ 1H9MA 2D0PA 2FL7A 4R4TA 2RMOA 4PQXA 4A3DG 4J9FA 2H1EA 1GUSA 1HQRD 4X1VA 1VQ8T 2JXMB 2R61A 1HSQA 2PCFB 3ONAB 3OSOA 5J39A 4A3EB 3RZOH 2R57A 1AFPA 1MUZA 2HQEA 4A3FH 4RCBA 4B9XA 1HFNA 1DOLA 3HHTB 3D6WA 3JB9D 5EKKA 1L0WA 1NMFA 3CD6Q 1QNKA 3META 2QTXA 1PH3A 2PZ1A 5GAOr 1VQ8Q 3OYEA 4KN7C 2K52A 4P73A 4LUOA 1VQCA 2BUDA 1HCZA 2DXBA 1UGQB 1Y1VB 2EJGA 3DEOA 2QQRA 2V8IA 1KC8U 4FT2A 5CV6A 1ABOA 2K6DA 5GQOA 1Y96B 4E6IA 2L15A 1PHJA 1BNZA 2OJ2A 1MMNA 5CV5A 4JJCA 1VQIA 1N6AA 3E19A 1GKHA 1ICWA 4FVMA 4LFCQ 1UGVA 4ELYC 1YNND 2KCMA 3DM1A 1Z6HA 2FZCB 5GMKj 2RCFA 4Z9CB 1KQSS 3OYBA 2PPBC 2EYZA 2OX7A 4EX5A 4NXML 1WCMB 4GLAC 1SYBA 1KC8R 2ZJRA 1RJTA 1O9SA 1GOZA 3J81E 4OIJA 5KNDA 4M75F 4GOPA 4XYOA 2LS01 2AUJD 3G7ZA 1STYA 3SEBA 4EQ5A 3FPUB 4L5QA 2MOXA 3C94A 2C9OA 2R6GA 2DL5A 1KLUD 4BY6C 4XTYA 2PQWA 4J6YA 3EGXB 3EBEA 1B70B 3SK8A 1FYCA 5T1GA 1LPLA 4KULA 4DUYL 3J7AV 1P16A 1XPOA 3HOWH 3C4SA 1WQWA 2HDAA 2QDLA 1KRSA 1K4US 2QGQA 1Z9FA 2ED1A 1X27A 1D5ZC 2CQOA 2VC8A 3A8HB 3T53B 2CUBA 3V7CA 1V1PA 4KUDK 3PMFA 2QQ9A 3IRBA 4I7ZC 2UUAL 1VQ4Q 2L4NA 1BI2A 1S1NA 4NL2A 1JJ2P 2DXTA 4C3HH 1G2BA 1Y96A 2XIWA 3I56Q 3EG2A 4MDWA 5A2QE 3K0YA 3OYCA 2MCNA 1YFNA 4ZAIA 5JVH3 2K2VA 4XTWA 1Z9QA 5GROA 1U9RA 5C4JB 2KRSA 3DM3A 4ULLA 3K5NA 3WVDB 1K73U 1RAEB 2L3SA 1JWMD 1O7YA 2ZXOA 3BYYB 4LNPA 2DF6A 4BDYA 4LW1A 4G7HC 5GAOl 5DLOA 4N0AC 4MTNA 3CD6A 2Q8RE 2K9GA 1X2KA 3E5SA 5C5LA 4F7UE 5JJZA 3JAMc 3H15A 1VQ8A 4JRKA 4PLLA 1NMGA 3AFQA 3A8MB 3OW2P 1BYMA 2QAZA 3CCSA 2E74C 3TMEA 4PJOE 2XHCA 1O7IA 5GAEC 5IT9L 1D1KA 2K7VA 5DM73 3PIOA 1YJNT 4IKFA 3OYFA 1EYAA 2W0ZA 2MO1A 2IJ0A 4EVOA 2M9VA 1KIXA 2X4XA 2VZAA 4C92A 4DK3C 1PFNA 3HOZB 3L2QA 2DAQA 2IX1A 3CC2Q 1FNUA 1A15A 4LFCL 3CCRA 2OTLT 2B2UC 2JA7H 4M75D 2NUTA 4IPCA 4QUCA 4PMBA 4C3HG 4YHHQ 1WTOA 1SE4A 2ENBA 5LJ3g 2QEXT 3CCJT 2D8HA 1GFCA 4AIMA 3K81C 4R1JA 4DR2L 1LUZA 3OYLA 2NVYB 4DR7L 2F0HA 5CO7A 1YWOA 2HKQB 4PJJA 1JORA 1WHHA 3MO8A 1BCPB 2PVGB 2OQKA 4IUQA 5IGGA 4C56C 1A2UA 3EQLC 3OIPA 2R93B 2J6FA 4QVDA 4KKSA 2BE7D 1EUJA 1A3UA 3CW2C 1OQKA 2JXBA 2FMCA 1TT2A 4IFDJ 4N4HA 3FLGA 2C0IA 3QXEB 2EZVA 2JM9A 3JB9H 3F70A 4IPDA 5C0XG 3GD7A 3FEOA 3A54A 4FNFA 2Y4XA 4HR7B 3KK7A 2EQKA 5E4WC 3U50C 2JA6H 4FXKC 1GUNA 3S6WA 1I4GA 3OB9A 4B3MQ 1WHGA 3GF5A 4A3MH 2DERA 2HQHA 1V1CA 3G4ST 1R77A 1TY0A 3QDRB 2HIXA 2MPMA 1IRXA 1RIPA 2LCLA 5NUCA 3PO3G 4O6JA 4LK1C 2CYZB 2HCCA 5FLXE 2L8DA 5L23A 3VR4A 1NCVA 5C3WA 2EJFC 2KHIA 1PZKD 4PJLA 1DM0B 5FRNA 3A8IE 2YT6A 3CC7A 2E5LL 4FF2A 4DV5Q 2DE0X 2JMCA 5CKEA 4HIDA 5CIUA 4FF3A 2HCKA 1JB0E 3JSCA 4FIBA 1WGSA 5DY9A 4FYYB 2CP3A 2ZM6Q 3PMIA 2XKOC 2CQAA 3SWNB 2L1BA 2DK3A 5IT9E 2LQKA 2VS1A 1WIEA 2B39A 1LYLA 2Y0SE 2QW7A 2KT1A 1KFZA 2DTOA 3S24A 3CC2A 3I90A 2KY9A 3CCLQ 2EGEA 1EY0A 5M3FH 4C5GA 3BJUA 4XTXA 1V1PB 3J80c 2BH2A 2K7AA 1FVIA 3H0GG 4ILWA 3GTJB 2KHJA 3NXWA 1DD2A 5I4DA 1JT8A 2H8HA 4BY6B 5C4ZA 5COYA 1X3PA 3OYNA 1YEZA 3CCQA 1HXDA 3CCST 4PG3A 3BY7A 4B6MA 3H0HA 1Q82R 3DB4A 1R4QB 1RAAB 1X3EA 3C1FA 3J7YW 2ESWA 1BXTA 3CQTA 5LHY1 5D65A 3UWNA 4K5VA 2GNCA 4MN3A 2ROLA 1EZZB 1UTIA 2BKDN 3C3LA 2EJFA 3HOYH 3GTPB 3FB9A 3R6NA 4GN4B 3SK6A 2B8GA 4DV7Q 1TWFB 4JPBW 2FO0A 4N8X1 1UGPB 3TEHB 1NBEB 4ZGDB 3SD4A 2DPPB 1CKMA 1EEFD 4YCUA 1XWEA 1PWTA 4AFUC 2XG8D 1A0IA 4JI0Q 1R0BG 2GQVA 2R5MA 1NYGA 1KNAA 3A8LB 3K5LA 5KYWB 3PFSA 1TWCH 3MZ5A 3GTQH 4WRDA 3S3MA 3TP5A 1LTID 2B63B 2A0FB 2DKGA 3M4PA 1RF2D 2FINB 2CZ7B 1RHPA 1M1KU 1VQNQ 1X56A 2WINB 2A6ED 1FNVA 1OU8A 5A0LA 4R9WA 4X65L 1UJ0A 4DBRA 5M3MH 5CC4A 4KJNA 3GTQB 1O78A 2RJFA 1FNWA 4L63B 1ZSZC 2NZOA 4S3SA 4XTCS 3KLWA 5GMKm 1KC8C 1E7ZA 1STBA 1E0BA 4JC0A 2MNAA 4LXCA 1R9TB 2HSPA 1TS9A 1H3HA 1ICFB 2ICEC 4JI1L 4JJDA 2K79A 3EHQA 2MIOA 1ABQA 2MWPA 5GAN7 4ODGA 4RGOS 3QZ9B 3CMEA 1KQ2A 4M7AF 3HFZB 4KMUC 5KNBA 1S3OA 1VIEA 3CCLA 1PYWD 2Q2IA 2D2CC 2P0PA 3VR6A 2B86A 5IGEA 5C0XJ 5IP9G 4C8QB 4B3SQ 4QQBX 1V1QA 4JUVA 1BCPC 1LABA 1VYUA 1EQRA 3OYIA 3CCQQ 2O4XA 3MEUA 1L1OA 1WTVA 2QGFB 1IBKQ 2ZTCA 3I91A 2E5KA 2A36A 3VUZA 1HNZQ 1AZPA 4KI0A 1PV4A 2XIDA 3E2UA 1TY2A 4QUFA 3OYGA 3MP6A 1MGSA 2J6OA 1JE5A 1NR2A 2KVQG 2DD5A 2K5VA 2W10A 1QE6A 1S5ED 1QVCA 4BXXH 3JAME 4ZKBB 1SYDA 4N0AA 2BA0A 2KXDA 2F0TA 1K3BC 2LFNA 4C8QC 4YCVA 1WZOA 1NSNS 1YJWT 2ZTEA 5M5XH 4WTOB 2DL7A 1SRLA 1EQQA 1EY5A 2HQXA 4DAMA 2P84A 2WKDA 3CXCP 4AQYL 4BY1H 2COZA 1ZLMA 2A6HD 3OIQA 2PVOB 3X20B 3DKMA 2N55A 4DPGA 2JNGA 3HKSA 1Y0MA 4ZTFA 2H4OA 1SF9A 2WSEE 3OBYA 4B9WA 1SE8A 3ITPA 4ZGEB 4HCSA 1X54A 1YIJA 4LAAA 4YWLA 1JB7A 2KCTA 2CHBD 5KYUA 4F88A 1ZUYA 4PZ6A 4M7AA 4RTTA 1WOCA 2X4JA 1VQNA 2JYOA 1PRTF 3AFPA 3CU7A 1GRIA 1ZBJA 1SPKA 3H8ZA 3PUZA 1N32Q 3M7NA 4HCZA 1WVLA 2N3SA 3P7JA 2E5QA 3HRZC 4GKKQ 2QASA 1MMGA 4KGVB 3H0GH 4RUGA 3S17B 1RAIB 2GN5A 4DV4Q 2OWOA 4A63B 2EGAA 4A3EH 2O2LD 4CRIA 3G71T 4KD3A 2AZSA 1CKNB 1EWHA 2DNEA 3RUZA 2I5MX 4HMIA 4O5VA 4DK1A 2ZJPA 4LE9A 5GMKi 3L2WA 4IPGA 1YCSB 2BIVA 1CKBA 4RFBA 4LMQD 3MAQA 4C3JB 1OX9A 3QUIA 4BUGA 3NELA 1X3QA 5BN5A 4OB3B 3DMUA 2JA8H 2B2YC 5D3IB 1PH2A 3GP8A 1W2BA 2JA6B 2LCCA 4PFZA 1WXUA 2DEQA 3CXCA 1NJIR 1XJVA 1XNRL 4F7UF 3STBD 2CS7A 3K57A 1HXYD 2NTSA 1JCKB 5EBCA 2P4RA 2HL3A 4CJ0B 4UC4A 2EBPA 5JPMC 3J80L 2A19A 2PUKB 1S5BD 4M77D 3JCMc 2EJGC 4LUZA 5FK9C 4DV2L 3PO3H 2CW0D 3D3RA 5LJ3j 3VA5A 5CKFA 4ANJA 2B2WC 1KABA 3VS0A 4DKAC 1ONLA 3M0RA 1EZ8A 1MIUA 3W5OA 4DR3Q 2FHDA 1TUCA 2RDGA 1T5XD 1CFMA 2F0KA 3M56A 5LJ5g 2K5IA 1PZID 4APVA 1A8VA 5KIXA 4HAEA 4CC3A 2WB1E 3SHLA 3S14B 5HCKA 5IH2A 1YNNC 3MP8A 3QZ5B 4OMOA 3G6EQ 2A68C 3SEMA 5GAOp 4BWGB 2OAUA 2EPBA 3PUVA 3RUXA 5LJ3d 1H9SB 2HBPA 1JOKA 4JV5L 2L0CA 4C3JH 1KLGD 2J05A 2O9VA 2Q2TA 1U5SA 2RM4A 1KDBA 2KEDA 3H3VH 4C92E 4FXGC 3SDZA 2E76C 4C2MB 2RHXA 3J81i 1BOSA 2A1AA 4LNQA 4DA4A 3A7LA 3EHRA 4C8QD 4ATOA 3ND8A 4AFSC 5E4XA 1HD3A 1BU1A 3F2UA 1YCYA 4GNXC 4LDYA 1HHVA 2NVYH 4MHEA 3R2IA 1XNQL 3TS2A 3PGZA 1RAGB 2L9HA 3DB3A 1HTPA 5K36H 2NYSA 4HN7A 3EAEA 3T1HL 3EH1A 2WSFE 4JI1Q 4PKCC 3L2RA 5IP7G 2QG9B 3BVMA 2QI2A 2H5XA 1G3TA 4X3SA 4A93H 3FC3A 3EG3A 4BXXG 3UDIA 4BBRG 4XYQA 1QVFS 3R2TA 3CRKC 3Q8DA 2KAFA 1V43A 1EL0A 2FZGB 4DAPA 1B7YB 2VUMH 4QGUA 5C4XB 3BE3A 2F0FA 4JI3Q 2E2JB 1UUPA 3X25B 2NVQH 2EE1A 1M1GA 4XT3B 1MD2D 1QJOA 1L2FA 3CPWP 1C0MA 2WAQE 5ELNA 5KCOA 2K5HA 3TQ7P 3OYDA 2D0NA 3GBQA 2DUDA 2WB1G 2FVUA 1B4OA 4MTKA 2O9SA 5HK0A 2LKVA 3QDFA 3X24B 2UU9L 1UE1A 4XK8E 1ZHIA 2LX7A 2VXFA 4M77A 1VQLT 3VKIA 4NPSA 2E41A 1IHVA 3QIAA 4P2CB 3I8ZA 4IFDG 1IYJB 4XIGS 2VQEL 3V96A 2X3WD 1PYSB 2E6NA 1E6GA 2RDHA 1CZWA 1W2BP 4JK1C 4C3IH 1M2OA 2X69A 4IUVA 3EIVA 1KSWA 1VA7A 3K0XA 2CWAA 2G5DA 2KGTA 3S16B 1IKLA 1R4PB 1C6VX 1QVPA 1Q7YR 2AQ3B 3PIO3 3GTGH 1OI1A 3MWYW 4ESRA 1Q7YU 3LWIA 2RHIA 4L5GA 4PFPA 1UAPA 1NYFA 2E2IB 1WA7A 3OW2A 4X64Q 5JJIA 2KSSA 2F0MA 3HRSA 4HJ7A 5IXFA 1F2MA 2HDMA 3FKIG 3PIP3 4X65Q 2LNVA 3GTGB 3HOVH 3VYGA 2CWPA 3MHBA 4DR1L 4A3KH 3CCSQ 2OAWA 2EY1A 2ZM6L 1BF4A 4M75C 4OL7A 1AP0A 2E64A 1BDOA 2XNAC 3RN5A 3EVQA 3G4SQ 5M3FB 1Y1VH 1MNDA 1U3OA 2J7ZA 3P1HA 4GZYC 1QCNA 4KBMB 1NE8A 3FJ5A 2K14A 5CORA 1RADB 3ULJA 2DETA 3VS1A 3A8KE 5FO8B 2FYKA 5LJ5f 3AU7A 5IWAL 5HY6A 1M9SA 4DV1L 1O80A 2X4YA 3HEJA 3T56B 1SFOH 1P8LA 2K5WA 3MEHA 3UE1A 1EQTA 4X62Q 4DV7L 1RLQC 5CKBA 1T9HA 3I7FA 1IYVA 3PCOB 4X62L 1W2BS 4E7JA 1VQMT 4B3ML 2K03A 4DFAA 1TXQA 1X6BA 2LJ0A 4CC7A 5LMNW 3GTPH 3NMZC 2I2LA 4A3FB 2ZJQA 3PF4A 5ELCA 1VQNT 4XTVA 2EVBA 4EDUA 1MMAA 4PK4A 2HUGA 4JI6L 2MO0A 1SNPA 3K59A 3QJ6A 4RCOA 1EYDA 4VUBA 4Z02A 3D4DA 1UNSA 2HQLA 2Z4HA 3D6CA 4H0LC 4H44C 2WIIB 3RIRA 1I8FA 1JRIA 5FRMA 4BY7B 1PTOD 1LTLA 3E0EA 3UA7A 3KF6B 1SJHD 4XQNA 5JJLA 1PSFA 1Y07A 2MHVA 2JA8B 2IVWA 2LJ3A 2DN8A 4DV3Q 1I6VC 2RJEA 4JG2A 1TWFH 3M59A 2B29A 3EGUA 1BIAA 4KJOA 1N32L 4HKEA 5KYLA 4DV3L 2RJCA 4M7DE 3HOXH 1WD0A 3LX0A 4IUUA 3E3XA 1MNEA 3HRUA 1H641 3SHWA 3ULLA 2PI2E 3I5RA 1B1ZA 5M5YH 2UXCQ 2LC4A 4DV6Q 1M8VA 3HFNA 1M90C 1VS0A 2BZ8A 4RTXA 1QP3A 4HCCA 4AT1B 1ZYRC 2Y0SB 3HOYG 3HKZE 3CCJQ 4J5YA 1S40A 2RO0A 4F17A 1HR0W 4DR6Q 2KA7A 4LDXA 3JCMf 4C92B 4XXEA 2RF0A 1BI1A 2DY7A 3DEPA 4XTZA 1PM3A 1JICA 2F3WA 3OY9A 1JJ2A 4GLVB 1HZCA 2JM8A 3JCMd 1ESRA 1FMKA 1EY6A 2F5KA 1SROA 1QLYA 3RMHA 3M4QA 4EQOA 4DV1Q 3REAB 3D7SB 3GTKB 3FIFA 2CZ1B 3CC4T 3QIIA 1VQJA 2SEBD 3MXGA 4M7AE 4AG1C 4RKBA 5C6SA 2DL8A 2AKWB 1G91A 1PSEA 4RKLA 2UUCL 4Q5WA 4JI3L 5IYBG 4M75G 1PTOH 1GHKA 1LT4D 2J4XA 1RTOA 4O2DA 3H0GB 2O5IC 3S17H 4A3DH 3MPUB 4K6DA 4KKUA 3MXNB 3EG1A 4H02A 3UDGA 1WFWA 3EG0A 3LYIA 4DR2Q 1GCQA 1AN8A 4M7DG 2JQOA 4DR7Q 3M54A 3A0JA 3KLSA 1PMRA 4B3RQ 2AQ2B 4DK6C 4OX9L 1BI0A 3BW1A 2F4IA 1CSPA 1N9RA 3C0CA 4QQDA 5I11A 2SDFA 4KY7A 1E1OA 4MZ9A 4TKOB 5BR8L 1UEBA 2LNHB 1I81A 5GANf 3D31A 5EGTA 1MI2A 1IBMQ 2D0OA 5CKHA 1ENCA 4XAXB 3G6EA 1E2WA 2L55A 3FMCA 3KF8B 4IPHA 2DD4A 1MHNA 3N5BB 3WDNA 1VQ4T 1K8AR 4BY1B 2DL4A 1BB9A 3OW2S 1UJYA 4AQYQ 1G3YA 2D9TA 2ZPHB 4D6WA 1MHWC 4X3TA 3JB9I 2SNMA 3VR2A 1AZGB 2CZ6B 2F0EA 3B6YA 4DNIA 2KENA 1W70A 1OPKA 2L2PA 2I07B 4WORA 2JJ9A 3PF5A 2V8KA 3S1MH 4RGNA 1U1SA 1TOVA 2DXCA 4JZ3A 3I55A 4NW2A 2BA1A 4PJNA 2WP8J 3BDUA 1OYXA 1K3RA 3EFXD 1Y1WG 3VS3A 2VXEA 3ZJYC 4QQ6A 1GUGA 4JYAL 4C0FA 1KAAA 2R7ZH 4DAYA 3MA2B 1L0XB 4A3BH 4EMKB 1TS2A 1OU9A 1TUGB 2VV5A 3HOWG 3RMSA 1D6EC 4ZCKA 2JSOA 4ZYSA 1D1CA 4C92C 4J8OA 5M5XB 4WFN3 3S16H 1IHZA 4O0AA 2XN9C 1N33Q 4J9CA 1BQQT 1EY7A 1F2YA 3UDFA 4BBRB 5JEAG 5LJ5e 5CVIA 1PH1A 2YU9H 1FJGL 1KD1C 1DONA 4DGZA 2QYZA 1WHMA 1YJ9T 1M30A 2L11A 3EA6A 4N9TA 3F2BA 4R8IA 3CMAA 1PRLC 3FRPB 3LWUA 4KHPQ 1WJQA 5A0DA 1FYNA 2YSQA 5KYUB 4A75A 1U06A 5FOBB 2K3BA 3U23A 3S1NB 1WJSA 4R4QA 4UY8C 1IHWA 1Q95G 4LD6A 2X51A 4LUEA 4QL5A 1QWEA 2JN0A 4OHJA 2DRKA 1TWCB 2EYLA 3CCEQ 2HHHQ 4M75A 1QNUA 4OEMB 1TWAB 4XQ3A 4KD4A 1XPUA 4OGCA 4DAYB 3URGA 3TSZA 1FGBD 5DAUA 5BN4A 2I0QA 1AWWA 1X2QA 2F2WA 2Z6KA 1YIJQ 2LQNA 4ME7A 1STNA 1TWGB 1IBLQ 2A6HC 3IFTA 5IGFA 2NVXH 4FYDA 4FT4A 2RPNA 4Y28E 1CHPD 1RI9A 1X55A 3VS6A 1M3CA 1D5XC 2MI6A 5I2XA 1WTQA 2DIGA 1G2TA 5KCHA 1VQOT 2EIFA 3VU3C 4CC2A 1G8XA 1X43A 4RTWA 4Y91A 1TU2B 1Y8NB 1IKMA 2EVRA 2B2VC 2ZT9C 1RDPD 4JBMA 1OEBA 1SE2A 4KHVA 2EYPA 2F5TX 4M75E 1EYCA 1JO8A 3I55T 4HT8A 2JA5G 3CMET 2F0WA 2RQWA 2EDGA 1MMDA 4JRIA 4M77C 4XU1A 2LCSA 4BB7A 2P4TA 3MXNA 5CK9A 2CP6A 4GLKA 4ZN1A 1JBMA 2AUKA 3TRZA 1EOTA 1VQLQ 3GTKH 4M75B 1KL9A 4YIJA 5FLMH 1I94L 4FM4B 1VQOQ 4JJNK 1N8RU 2K57A 4QCLA 4ZUIA 4DK0A 5KYYB 2GQIA 2IW3A 3I70A 3K5OA 1CM9A 1HNZL 3A56A 3GDEA 3GTMB 2ZCFB 1K83H 2PW7A 1SYFA 4U673 3RN2A 3MFGA 3C1EA 3JV3A 2A68D 4DU9A 4E7ZA 5I9OA 1KTKA 2MWOA 1SKUB 3M53A 5D6XA 1YITT 3A5UA 2F4VQ 3PV0A 3SK4A 1ZQ1A 1SNOA 1Q81C 3VV0A 4M78F 3RZOB 2DXUA 2KRNA 2IIMA 4M7AB 4JI8L 5C0MA 1ET6A 3K7UC 2AT1B 4F14A 3LNNA 1FWZA 1TS5A 1ESFA 3OTOL 5IHKA 4GKKL 3HP3A 2UUBQ 3CCUA 5CBEE 3JAML 1D3BB 5GAOm 4GN5A 5KGUA 1LLRD 2K33A 5GJWB 1KRTA 3M0SA 3TCJA 4MNOA 1WTRA 2F52A 3TS0A 5BN3A 2DVEA 1S5DD 1UEAB 4BE1A 3UATA 1K73C 2A8VA 2G9HD 3KUFA 2V4DA 3EFOB 5CV9A 1KAWA 2V1QA 2E10A 1W6XA 2SOBA 1YNXA 1Q8IA 4H13C 3M0PA 3OMGA 2F69A 1WLPB 2E75C 1ENFA 1HH2P 2P5ZX 4YTLA 3AB9A 4JZ4A 4V190 1FXXA 2FRYA 1I4HA 4AYBE 3KLSX 2CP7A 4C8QG 2RHUA 2I46A 5CGKA 2FFKB 2PVDB 3EGXA 1QWFA 1KJWA 2WACA 1CHQD 5LJ3e 2DJFC 4NB3A 2D9UA 1J5EL 2L3RA 2MPXC 5D6WA 2E1HA 4RTVA 2KOLA 2CP0A 2JS2A 3HOXB 1VQ6A 2EOTA 2HT1A 2JUFA 2P0QA 5CAIA 5JAVA 2K6AA 2B2TA 1ZX6A 3VS5A 1I3QH 2JP1A 2M1HA 3CCRQ 1KHCA 4HCEA 1N9SA 2LX9A 3MP1A 4A3KG 4FDBA 4K5XA 4X9CA 3OMCA 2FEIA 2E70A 3QSUA 4A3GG 5FLXc 1WTHA 2RHSB 2DTIA 3M3YB 2HBWA 3HTRA 1VF5C 1KQSP 4A3MG 2NN6H 4J83A 2UUBL 1KQSA 3CCUQ 1G2SA 1G6PA 1Y1WH 1NZ9A 3QYGB 3U9OA 2G9DA 3VRZA 4C5HA 5GAMf 2WB1B 4IIMA 2YTVA 3HOVB 1V1OA 4QW2A 2KR3A 1LNXA 1KD1U 3X28B 1A6XA 5HGTA 4K0KL 1QILA 2G6FX 4PJOD 3PQIA 2NUPB 1IXRA 2Q2UA 2RHQB 3FHWA 4HCBA 1KG1A 3JCMP 2PQAA 3U4ZA 5IT9c 2RQUA 1LT3D 4YWKA 4A3BG 4HSVA 1LOJA 2V26A 5CQXA 2L12A 3A8OB 4UDUC 3M0QA 4ZUJA 4RA8A 1OZ2A 2FHTA 3P8HA 4DBHA 4IOCA 3ICEA 1EY8A 2K3YA 4U68A 1D1BA 4LUVA 1H9RA 4ME5A 4RKUE 4DBQA 4L6V5 1EOVA 4JI2L 1T0HA 3KF6A 4PV1C 3EGDA 2QK0A 2K4KA 2E2HB 4M78D 4AG2C 1XNQQ 2GTJA 4UP8A 1EYGA 3E9IA 1G3WA 5K5PA 3FJPA 1M2VB 3R6OA 1RL2A 2MYSA 2DIQA 2XMFA 3OHXC 3I9QA 3GQBA 4LJZC 1EY9A 4TQUS 2NVQB 4ME3A 1G291 3OYJA 1XNIA 2CKZB 1GVPA 1JOQA 1EWIA 4OGQC 5C4XH 3LX7A 1TG0A 4KKTA 4LFBL 4HEDA 1TWGH 1QKXA 2LP5A 1F77A 1YHQT 1GUTA 1RODA 4ZRZA 2CP2A 1AE2A 3HOZG 1CKOA 2K1BA 4FL6A 1X6OA 2R92B 4X66L 1I4XA 1PTOC 2XRQD 5KRUA 4HVWA 5ELBA 1VQEA 1UECA 4FW1A 3T1YL 3PVLA 5LL6S 1VQHA 4CKEA 4DR5L 2CCZA 2M00A 3FKIH 4UP9A 2E5LQ 1SRUA 4MMLA 5GAN2 4NL3A 1LM0A 1PYBA 2HHHL 1JE4A 5JJKA 2YRVA 4A3DB 1LTAD 1K9MU 1X01A 1WJJA 2KQ3A 4J9DA 3KBXA 3PT9A 5I6YA 4GLXA 3UA6A 1D2BA 4KT0E 2NBFA 1JWUD 2RDFA 3E6ZX 2MMPA 2CW0C 4R56A 4JI2Q 5IIFA 4ALPA 2Q2HA 4QJFA 3QHSA 4QQGA 4GKJL 1ZSZA 3HPWA 5A0GA 3RNUA 2KMTA 2MF2A 3S3NA 3J7ZC 2LQ8A 5I21A 1PH5A 2GVAA 4J6HA 3SWNA 1JJCB 1FR3A 2E2JH 2YU9B 3LWEA 4EIKA 2VUMB 4ELZC 1G51A 1WXTA 1I50B 5GANe 1TIID 4GNXB 1SYCA 2YHTA 4KLKA 2D1XA 1FD7D 2BZXA 1M90R 3OPOA 2X4WA 4MMKA 1WI7A 1U4LA 4PJOC 2N8NA 1Y57A 3GO5A 1JXOA 4DEYA 1QWYA 1H8KA 3X26B 2Z8LA 4J8QA 4EQNA 3AHUA 3RR6A 3T1YQ 2EYFA 4O42A 4DV4L 1K28A 4RG2A 5FLXL 3HZXA 4GBQA 1WCMG 3QG1A 2KE9A 4BI8B 3JCMW 4Z89A 4YHHL 2RD1A 1C0AA 1SJED 4BACA 2ZZDA 2GCXA 3HOXG 1PKSA 1YN8A 2XDDA 4E6RA 1RTNA 1U5KA 1TH7A 2CH4W 4GY5A 1G3SA 2XI9A 2KYMA 1DGSA 1F9QA 3OYAA 1KIKA 4DUYQ 1K76A 5IAYA 5GANh 2BOSA 2DYBA 5J22A 2LMJA 4EPCA 3CMEQ 1AD5A 1BCOA 1WFQA 2VGMA 2EY2A 2L0AA 3M9BA 1PH4A 4Q0FA 1Y14B 2QQBA 1ZSZB 2QEXQ 1HTLD 4NXNQ 1VQLA 1M5Q1 2FG0A 4YY3L 1HNWL 3IFDA 1VQOA 4CI0C 2EWNA 2JN4A 4X6AH 4FCYA 1YITQ 1TWHH 1ZA1B 2AWOA 2COWA 2C5CA 1B9NA 3TZUA 1CT1D 2DM1A 4AYBG 5FU7B 5C3EG 1BBZA 3JCMh 2DBMA 2LT4A 2DLPA 5HK3A 4G7ZC 3CCMT 4BBSB 5LJ5j 3QO2A 4PL6A 2CDTA 2CGHA 2LT1A 1YIJT 5I9PA 3H3VC 1LTRD 1RAHB 1X65A 3DWPA 2FMMA 3M85A 3I5SA 5JOBA 1VDZA 3H0FA 4UHVA 3RESA 3MFYA 3HOUH 2X35A 3M4OH 1IGUA 2NVXB 3H0IA 4XTUA 3HKZG 3RBBB 4JVZA 4NMZA 1M2VA 4QIWB 4N9PA 4NDXA 1HR0Q 2ALYB 1V29B 2AHJB 2CZ0B 2CH4A 2K50A 2VVKA 4HIKA 1K9MR 1QKWA 2KCNA 1Q81R 3JB9J 4DAVA 3MKDA 3H6ZA 3PUXA 4QMGA 4LF5Q 4F7XA 1PC0A 2K3XA 3PNWC 3K5MA 1RLPC 1N36Q 2JTMA 3BG3A 4JI5L 2EYWA 2EYQA 3EN2A 2E2HH 3KJPA 3H9NA 2N88A 2HCIA 4PJOG 3F2CA 2AKLA 2ZGWA 1I4PA 2R3ZA 1IL2A 1OZ3A 3A7AB 4PMCA 4CDCC 2E2DC 4C3HB 1XTDA 4HXJA 1HR0L 2F4VL 4C0ZA 5EBDA 3CKIB 3H3VI 4K8IA 1PVOA 1BCMA 2NN6G 4DF7A 3S1RH 2NZHA 2QEXA 1L1OB 4PJOB 3TU4K 1IZ6A 4B3TL 5FU6B 1OV3A 2NWGA 4DQ2A 2GF7A 1II3A 1I94Q 3NSWA 2F0PA 2MGSA 1TS3A 1VQ6Q 2F2VA 1E2ZA 3RZDH 3ER0A 4ID6A 2NUCA 1IB8A
chains in the Genus database with same CATH topology
4LFBQ 2Y90A 2RI3A 4TVAB 5GAN4 2RI2A 2LDMA 3LH0A 3I56T 4LF8Q 2JA9A 4N4IA 3AEVA 4F7UG 1NBWA 2E6ZA 2ID0A 1U1TA 4XU0A 5M9OA 4JLGA 4LF8L 3CCEA 2A3LA 2RCNA 2RH2A 5CCAA 1S72T 2EQJA 5JJKA 4Y7NH 3QJYA 3M4YA 4LF9L 4QVCA 3HOVG 5LMNL 3RMQA 4UP7A 3LGLA 1E24A 1VQKA 2EKOA 4EMKA 4IURA 4B3TQ 3OYKA 1QP2A 2XU8A 4PZ7A 2JE6I 3U58A 3HRTA 5FU6C 4AH6A 1FGUA 3GOXA 4A4EA 3JCMe 3J7AF 3M9QA 2VW9A 4DR1Q 1I5LA 1NE3A 4LD9K 4A3IH 4HIMA 4WJ3M 4P5NA 1VCIA 5GANd 1SLJA 4A3JG 3LLRA 5M3FG 3P8BB 4LF9Q 4J6WA 2NN6I 4JOIC 4DOVA 4OO1I 2XICA 1VIFA 1N33L 5GAN3 4C92D 1BBUA 3PMTA 4A4FA 4HJ5A 3OYHA 3V7RA 1K9MC 1NPRA 4P74A 2PUOB 2HIVA 2QQSA 2QQAA 3RLNA 3W1GA 3OSSC 1YZ6A 1YJWA 3ME9A 4M7AG 1MJEA 5FJ8H 4NS5A 1E1TA 3JCMJ 1VQFA 1XMOL 3CC2T 2JOYA 3L7ZC 4A93G 5GAOq 4YY3Q 2YTYA 1CKNA 5FU7C 5IP7H 4IO9A 5IYCG 4OWTB 1VQ5A 4KUIA 4DOWA 4RCCA 1TXYA 1IBML 3J81c 1OXSC 2MQHA 4E7LA 4HT9A 4LF5L 3M55A 4JI7Q 4RMFA 3CC4A 4J6XA 3L2ZA 2GFAA 3KXTA 1YHBA 1ZBXA 5HKCA 1WYDA 2Y0SG 3EFRA 1W4SA 1HZBA 3PSIA 3TQYA 2FXQA 2YLBA 4JI8Q 4RMOA 1A62A 3G4SA 1ASZA 3CF5A 2NVTH 1J5EQ 3MEFA 4IUTA 3PO2G 2V1CC 4J15A 3UDXA 2G3RA 1VQ9A 4OB1B 4BA1I 2BH8A 3G6ET 1JJGA 4JV5Q 1VQAA 3QO3A 3C95A 1QVFA 3JC66 5LMUL 1VQ9T 3KFUA 3WXMB 3CCMA 4UPAA 3TEEA 1JT8A 4BE2A 4DR3L 1RI0A 3PIPA 1CUKA 5IE8A 2PNHA 4OONA 1UGRB 1V9PA 4OO1G 1B34A 1EIFA 5FROA 3MEWA 4M7AC 2E8GA 1X9NA 4IFDI 4DR4L 4C5IA 3CCRT 2RJDA 2OTLA 4LFAQ 3E9HA 4JRPA 4C92F 2YLCA 4YCWA 1VQGA 3PTAA 4BBSG 4QY7A 3S2HH 2JEBI 4M7DB 4A4HA 4GOPB 3OBWA 1SR3A 4A3GH 2VL6A 4L5TA 2H3JA 1M1KC 2L89A 4Y52H 1LJOA 1YBYA 1I6HH 4OXPA 2JTFA 3HP9A 2EFIA 4LF6Q 5GAMd 3CXCS 1K0RA 4DR6L 1SN8A 1Q1BA 1FJGQ 1Q7YC 5IWAQ 4M77G 2UXBL 3G48A 3HL8A 2B63G 4WJ4A 4JBJA 5GAOn 3RKWA 3MEAA 4DV6L 3UDCA 4GNXA 1BVSA 1N34L 2A7YA 3GPLA 2ZPIB 1YI2A 1PH9A 1SMXA 4JOIA 4IOAA 3F2DA 3E9FA 3L2UA 3BZCA 5M3MG 1K8AU 3CCQT 4C0DB 1WCMH 1YHQA 5D6YA 5C4JH 4C92G 1GXIE 2EQSA 4MZMA 2JA5H 3QPHA 1UB4A 4PZ8A 1HJPA 1N9WA 3A8GB 2VUMG 2RK2A 1HZAA 4DV0Q 5CQYA 4JS5A 2GFUA 3L2VA 3ZEHA 4KHPL 2HAXA 1KQ1A 4A53A 4EMKC 1X3FA 1NJIC 3F8TA 5FLMG 1XMQQ 5GAMg 2GVBA 5GAMj 4C0GA 5KH6A 2JZ2A 1J6QA 4E7IA 4M7DC 3OYMA 1N27A 2HD0A 1YITA 3GTMH 3BZKA 1BI3A 1OXXK 5KE3A 2IX0A 5JEAJ 1UWVA 2DZ9A 2M16A 3GIBA 2E12A 3KDFB 3OTOQ 4LDUA 4M78A 3OSVA 4IUPA 1VQMA 1PA6A 1E3PA 2K5FA 1YHAA 5LJ5d 2QDYB 4ZTJA 2DO3A 2QA4T 2VQEQ 1QVGS 3NENA 4FSXA 3O8VA 3SFMA 4JYAQ 2DJZA 3INZA 3ZBDA 1Y7XA 3CPWS 4C5EA 2VY3A 1GD7A 3KDFA 4OX9Q 1I50H 3L2PA 3LWHA 2MFIA 3GTOH 1GO3E 4A3LG 5FJ8G 3ZFJA 2JA8G 1L1OC 2AMCB 3CBOA 2WSCE 2OCEA 2UUCQ 3TREA 3V7SA 1YJ9A 2D0QB 1HNXL 4JI6Q 5GADC 3JB9F 1VQ7A 2XD0A 3VDYA 1W3SA 2B3GA 2VYTA 2D6FA 4MZTA 4R4OA 3OS0A 4L59A 3MCAB 1VUBA 1IBLL 2XK0A 4X9DA 1U8RA 1XNRQ 4IJHA 1A63A 4HJAA 3A74A 4R4IA 4C0DC 3GNFB 5C0XI 4M7DD 2C06A 2UXCL 3OQ5A 2VNUD 3JCMg 3SB2A 4RG8A 4JI4Q 5CKDA 4A3CH 1EFWA 4DUZL 2K5NA 1JMCA 2ZPEB 2VQFL 4OB0B 4II1A 4X64L 4KHZA 4JRQA 4M78G 3OA6A 1SSFA 4LF4L 5LJ5h 4BBRH 3L1AA 1MGQA 3OS5A 3Q1JA 4F7UA 2ASBA 5IP9H 1R9TH 3E9GA 3CCLT 3HSBA 2LVMA 2XDPA 2EXDA 2PMZE 2VQFQ 1VQPT 1WNLA 2K4YA 3SWNC 1HZ9A 3M3YH 2K75A 3NTKA 1D3BA 1YVCA 4OMFB 1YI2T 3UE0A 1QZGA 5LJ3f 4GOPC 3M57A 2IY5B 4C2MH 5GANg 1OXVA 4HA8A 3C12A 2KQWA 3CQZH 4BI3A 2OTJT 3CP0A 1WI5A 2M9UA 3S2DH 4DR4Q 4POFA 4C8QE 4PNOA 1K8AC 3AYHB 5GAGC 4JI7L 2F3IA 4B3RL 3KJOA 1QZHA 4RG1A 2JA5G 4PJOF 3V8KA 2AWNA 3CMAT 1PFSA 1UE7A 2RK1A 5J26A 3BFMA 4M77F 5I2SA 2WAQG 3ULPA 4A3FG 4E7HA 4A4GA 4JI0L 3JRZA 3BU2A 2EQMA 4E47A 2PU9B 1X75C 3UPUA 2R93H 4DV0L 3FDRA 1Y1VG 4OGEA 4JBWA 5J3BA 3QYHB 2JVVA 1OXUA 3GTJH 3RLFA 1UE5A 1VQBA 1PH8A 1X3GA 4BBSH 2CKKA 1R8OB 4X34A 3UT1A 2N49A 3T1HQ 1M1FA 3CC7T 5IN1A 1N34Q 2JA6G 4BDZA 1HK9A 1OTCA 4YWMA 3LGJA 2AHOB 3I4MH 3K80C 2M0OA 1BIBA 1P92A 4EMGA 1XPRA 3CCVT 1VQDA 3EFSA 5C44H 2R7ZG 3JAMi 4LF6L 1VQ5T 4A54A 4OWXB 1QW1A 2YV5A 4J7IA 5GMKe 5IY0A 1I5FA 4LF7L 1PH7A 3MEVA 3K8AA 4LF4Q 1FX7A 1TWAH 2KK4A 1Q86C 4BY7H 4DV2Q 3BDLA 5IYDG 4OWWB 2R92G 2XDBA 5LMUQ 5IYBH 2DZCA 2E65A 5GMKl 3VUBA 1WQ7A 4XU3A 2IHFA 1OXTA 2XTIA 4BD3A 2RA2A 2PQAB 1B34B 4QVZA 3GNGA 5GAN8 2UXBQ 3CCUT 4MDXA 2JJQA 2IHEA 1EIYB 2R92H 5IYDH 4MZPA 1QUQB 4POGA 3MHXA 2I5HA 2KBNA 1FL0A 2QXFA 3JCMQ 4BY7G 5E7NA 3S1QH 1QVGA 2PI2A 3J81j 1Q12A 4GS3A 1MJCA 4A3JH 3GTLH 4TVRA 1UGSB 1E22A 4ZGJB 4J7FA 3NFCA 2LRQA 4M78B 3VYHB 4LFAL 3S15H 5LJ3h 4V2SA 3I4OA 4IJLA 1BKBA 1Q82U 3CCVA 1GM5A 2P0KA 2LTOA 3V8LA 3KBGA 4M77E 3V8JA 1VQ4A 3KYHC 3J80i 2Z6KC 1QUQA 4M78E 4BI4A 3CAMA 3L0OA 3D0FA 2B8AA 2MAMA 4A4KA 3M4GA 4PMWA 2RHYA 1C9OA 2RI5A 4A4IA 3I4MG 1Q46A 4JDSA 3LGFA 4NOYA 5ELOA 4C8QF 3FP9A 3WWVA 1ASYA 4A3LH 3KOJA 5KE2A 3JCMX 5CR2A 1VQ6T 4R4CA 2UU9Q 3RERA 2V8JA 4BY1G 2JA7G 5GAMh 5L8RE 4P71A 4E7KA 1Q1EA 1IBKL 3S14H 3GLXA 1PH6A 1VQPA 2OTJA 3NEMA 4B3SL 2JK8A 2LXJA 1NPPA 3DLLA 1NJIU 1Q81U 4N4GA 1XQHA 3I2ZA 1XMQL 2FB7A 2R93G 2D62A 1VQ7T 3CD6T 2EAYA 3E1SA 3U4VA 4XU2A 3L42A 4NXNL 4C8QA 4LDVA 5I2MA 2OQ0A 3M5AA 2EQUA 4WF2A 4JCVE 5DLQE 2IG0A 5C44G 1U0LA 4X66Q 1C7YA 2O01E 4F7UB 1JJ2S 5HGQA 2L5QA 5LMNQ 2YTXA 2C35B 3LW5E 3T9NA 3ASKA 3CCET