1YBYA

Conserved hypothetical protein cth-95 from clostridium thermocellum
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
185
structure length
176
Chain Sequence
MISAGDFKNGVTFELDGQIFQVIEFQHVKPGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation elongation factor P
publication title Conserved hypothetical protein Cth-95 from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Translation
total genus 29
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ybyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA02
4GNXA 4JI0L 3KFUA 3S24A 1S72T 4HJ8A 1UWVA 3CC7A 2LXKA 1KRTA 3A5ZB 1OXTA 3SGIA 2UUBQ 2K50A 5C0XJ 2MWOA 2E5LQ 1CKOA 2KCTA 1YVCA 3I56A 3ERSX 1QZHA 1B70B 4YWMA 1OTCA 5K36G 1VCIA 4A3MH 5AJ3Q 2GVAA 4LUZA 4DV4L 1CKMA 2EQSA 5M3MG 3CXCA 1M90U 1BKBA 3DM3A 3TS0A 4OX9L 2NVXH 4JI0Q 2AMCB 1QUQB 1XJVA 4R1JA 2IHFA 4A76A 2EIFA 1KD1C 4IPCA 1EIFA 1Q86C 1PA6A 1VQEA 5C44H 1PH4A 1SRUA 2HHHQ 1VQHA 4DV4Q 4JI8Q 3M7NA 4OX9Q 1L2FA 4X65L 1TWAH 1GO3E 1A8VA 4OXPA 4P74A 3G6EA 4B3RL 4HIKA 2N78A 2V1CC 1Z47A 4JBWA 2PMZE 3PGZA 1G51A 1P16A 4JI1Q 2BA1A 3ULJA 4C3HH 1PH3A 3RZDH 3W5OA 1BBWA 3GO5A 4X66Q 2NZHA 4GNXB 2HIVA 4LW1A 3ULPA 1UE6A 1NZ9A 4ALPA 1J6QA 2E2JH 2JQOA 2ALYB 4KI0A 5FLMG 4IO9A 1P8LA 4B3RQ 2MWPA 3RLOA 2YU9H 2ZJRA 2NZOA 3AFPA 3CC7T 5C4JH 1Q82U 5IYBH 1I50H 1UE7A 2F52A 5M5YH 4L5RC 1VQNT 1PH6A 5FLXc 1YI2T 1UEBA 1M90C 1KC8C 2WB1E 3S14H 1XMQL 3CAMA 2UUAL 1NPRA 3GTLH 4KHZA 3NELA 4YWKA 4C3IH 3PO3G 3PUXA 4JC0A 4A3JH 2OTJA 1TWGH 1XPUA 4A3EH 3I4NH 1R9TH 3CCLT 1VQBA 1K3RA 3JAME 3CC2A 2YTXA 1KRSA 2QA4T 2ZTCA 1GM5A 1MJCA 4R4CA 4CRIA 3PUYA 1VQLA 4EX5A 1Q7YU 1VQ5A 4YY3Q 3JAMc 2WP8J 2JJQA 3HFZB 4DV2L 3NEMA 5GAHC 5FJ8H 4HIOA 1YIJA 2IX1A 3CPWA 1C0AA 1WOCA 1X9NA 2B3GA 3HOWG 1Q82C 2H5XA 3JC66 1ASZA 1NPPA 3RNUA 3CCQA 2K5VA 4DV2Q 3CCRT 2E2IH 3CP0A 2IY5B 5FLMH 3S15H 5C0XG 1YZ6A 4JOIC 2NN6G 3OTOQ 5LMNL 3ICEA 3OW2S 3U58A 1YHQT 2MQHA 1JJCB 2Q2IA 3F2CA 3CC4A 3HKZE 3PF5A 3KDFA 4A3KH 4OO1G 2R7FA 4JI3L 3KF6B 5GAEC 1W2BA 4Y7NH 1PH9A 2AWOA 2G3RA 3E9HA 1UE5A 4O0AA 1Q1BA 1E3PA 1SLJA 1VQIA 1HJPA 2E8GA 3NENA 4MZ9A 5A2QE 5LMNQ 2D62A 2YTYA 1CSQA 2I5LX 2Z6KA 1VQOA 3CCVT 2CWPA 4ZN1A 4JI4L 4LF8Q 1YIJT 2C35B 2N3SA 4JI7L 3B6YA 3H3VH 1HNWL 3T1HL 3OYYA 3KF8B 3NBHB 1VQ6A 1H95A 4RG1A 5IE8A 1A63A 4HJAA 4NXML 4A3BG 4NPSA 1FGUA 4AQYQ 4JBKA 3EIVA 4BXXG 1O7IA 1I94L 2L3RA 4IFDI 4UP7A 4JI4Q 1VQ7T 3AEVA 3CCJA 3AFQA 4JI7Q 4DV7Q 1HNWQ 4JBMA 5GROA 2A8VA 3H3VI 3UDGA 3KDFB 5BR8L 4R4OA 1YJ9A 4NXMQ 3S2DH 3CC4T 2VY3A 4DV6L 1LM0A 1AE2A 1TWCH 3W1GA 1TXYA 1I3QH 1IYJB 3ZJYC 2F4VL 1VQGA 4GNXC 4AH6A 1WFQA 1Q86U 3S16H 3J81c 4DV3Q 4HJ5A 1M1KC 4RMFA 1HR0Q 1EQRA 2OTLT 3K7UC 1JE5A 3KYHC 1E1OA 1SFOH 4BBRG 4DV6Q 1V9PA 4AYBG 3GTPH 1Q46A 1W2BS 4PMWA 4LFCQ 4RG2A 1KAWA 1XNQL 3E9IA 1OXSC 2L15A 3I55A 2MNAA 2MO1A 4BA2I 4QIWE 4QL5A 4DK3C 1BBUA 2RCNA 5EAYA 1E22A 1YNXA 1K0RA 4BY1H 2PQAB 1XNQQ 3CCJT 3LH0A 4JV5L 3RN5A 2VZAA 1XPRA 1K9MC 4LFAQ 4B3MQ 3HOYG 4A3BH 4BXXH 1TWHH 2IT1A 4DR7Q 1QVFA 2GN5A 2HIXA 4JI8L 3HOXH 1KC8U 4DUZQ 1X55A 4X64L 2E2HH 3UDXA 1L1OA 4EQ5A 1IXRA 3HOUH 3LGJA 3TREA 1YJNA 1SE8A 2MO0A 3FHWA 3IRBA 4JI1L 1VQCA 3S1RH 2R7ZG 4JV5Q 4X66L 4WJ3M 2HT1A 2KVQG 1QVGS 2OQKA 2BH8A 3K7AH 4X64Q 1VQ9A 2LXJA 1PYBA 1DGSA 3G4SA 3PSIA 4GKJL 4A3FH 1EWIA 1C9OA 1N9WA 1K73C 3KJPA 4TVAB 1PH7A 4BBRH 4A3GG 4C2MH 4GLXA 1WI5A 3PUVA 2VQEL 2QEXA 5M5WH 3TQYA 1J5EL 3K8AA 1EFWA 3A0JA 2QGQA 3BU2A 5DLQE 3TRZA 3OW2A 5FLXE 4GKJQ 2MI6A 1PH5A 3MEFA 2DGYA 3I56T 2R93H 3Q8DA 4H02A 4OWTB 3L7ZC 1Q8KA 1K83H 2VQEQ 1L1OB 1PH8A 1N32L 5HY6A 2JEBI 1J5EQ 1PVOA 1X6OA 1SR3A 4JI5Q 3GTOH 3STBD 1MIUA 4YY3L 2OQ0A 1VQPA 2WFWA 1Y1WG 1AH9A 4JI2Q 3KLWA 4APVA 5M3MH 5GADC 1SMXA 2YTVA 4IJHA 1VQ4A 4POFA 1S40A 1QVFS 2VW9A 2UUCL 1N32Q 4JYAQ 5GAGC 2RHSB 3U4ZA 1Q12A 3G6ET 2R7ZH 2K14A 1CUKA 1NTGA 1PH2A 3UDIA 4HIDA 1YBYA 4JG2A 3UDFA 1Y1VG 2UXDL 4DV0Q 3HKZG 1PFSA 1V1QA 3CCEA 2F3IA 2JA6G 3JAMi 2JUFA 2UUCQ 1IBLL 3DB3A 1VQFA 4L5TA 3OTOL 2LVMA 2IG0A 4A3GH 4P71A 1B7YB 2OCEA 3EN2A 2XHCA 2ASBA 3G71A 2UXDQ 3L0OA 4A3DG 1RL2A 2HHHL 3PIOA 2Z6KC 1YITA 3FP9A 3E0EA 4QJFA 1D8LA 4LF7Q 1IBLQ 2HQLA 2Z0SA 4NXNL 1LUZA 4A3IG 2VUMG 4LF9L 1VQMA 1E24A 3CCUA 5H1SE 1JJ2A 1VQPT 1VQKA 2R7DA 3VDYA 4DR4L 2UXBL 2OTJT 3M3YH 3PV0A 4QY7A 3J80c 3J81j 2I0QA 4LF8L 4DNIA 1Z9FA 1HNZQ 4OONA 2AKWB 1L0WA 4DUYQ 2JA9A 3CC2T 4GOPA 3TS2A 4NXNQ 2VQFL 3PO3H 3BZKA 4LF9Q 5ELOA 1M1KU 1VQLT 1A0IA 1VQ5T 1NBWA 1C7YA 3RZOH 4DR4Q 4A3LG 4AQYL 2NVTH 2UXBQ 3H0GG 2D0OA 3M85A 1N33L 1LTLA 1K8GA 3F2DA 4A93G 1JT8A 4KLKA 4PZ8A 4BBSG 2KENA 4DV7L 2KDSA 1QVCA 4R4TA 2VQFQ 4DR6Q 1VQJA 4ZN3A 1Y1VH 4P75A 5IP9G 2R92G 4JBJA 5IP7G 1WYDA 4R4IA 2N8NA 4P72A 2JA6H 1VQDA 3CCQT 2JEAI 2WAQG 4DR3L 1N33Q 4QQDA 3GTJH 4X6AH 3K81C 4A3CG 2NVQH 2JE6I 4LNQA 3HOWH 1NMFA 3CD6A 2I5HA 4GS3A 3F1ZA 1GVPA 3FKIG 5J26A 1X54A 4DV3L 1K9MU 3I4MG 1VQ8A 1N8RC 1M1GA 1U0LA 1HR0L 2E6ZA 1ASYA 1YJWA 1QVGA 4KHPQ 1Y14B 4UP8A 4DR3Q 4AIMA 4GOPB 5C4XG 1CSPA 5HGQA 3J81E 4LFCL 4X62Q 4DR2L 4A3IH 2VUMH 1JB7A 5IT9c 4XTCS 4B3SQ 3CQZH 1N34L 4BY1G 1YHBA 3HKSA 2K52A 1JJ2S 3A5UA 1JJGA 3GTGH 1Q1EA 1VQOT 1A62A 1KQSS 1X3EA 2RHQB 5IYDG 4YCVA 2ZTDA 2DUDA 3AYHB 5C0XI 4DR2Q 1S72A 2IHEA 3L2PA 3AQQA 3RN2A 2NN6I 1AE3A 3F2BA 4B3TL 1X65A 1L1OC 4NB3A 2E70A 1VQ6T 1K73U 1X56A 1N34Q 2ID0A 1E1TA 2PI2A 4B3ML 4LFAL 4LFBQ 4A3LH 2PNHA 4DR7L 2KHJA 3KJOA 4DUZL 4UPAA 1SSFA 4OO1I 4BBSH 2ZTEA 4IFDJ 4B3TQ 5IP9H 1XNRQ 2R92H 3GDEA 1D7QA 1XMOQ 1QUQA 3ULLA 1VQ8T 2YV5A 3TEHB 1YJ9T 1HZ9A 2CFMA 4DAYB 3LGFA 2JA5G 3HOZG 1XPOA 5GQOA 1HNXQ 3CPFA 3KOJA 3STBC 5C4XH 2A1AA 3I4MH 4ME3A 2Q2HA 1SN8A 1WCMG 1IBMQ 4UY8C 3CMAA 3CCSA 2MFIA 4MNOA 4A75A 2GVBA 3T1YQ 3PF4A 2I5MX 2WB1G 1N36L 1NJIC 1Q81C 2LQ8A 4IOAA 2Y0SE 3RLNA 3G48A 5JEAG 1RIPA 4X34A 1KHIA 1X3GA 4L5QA 5M3FG 1KL9A 2DO3A 1HZBA 4DK6C 4POGA 4K0KL 4DV1Q 4JCVE 2JNGA 3ER0A 4PZ6A 2K5NA 3U50C 2A19A 5M5XH 3I55T 1VQNA 5IYDH 2B63G 2VNUD 1YI2A 3CCMA 1K8AC 1EOVA 4J15A 4AYBE 4A3EG 1N36Q 3I4NG 3HOZH 4GKKL 4LF4L 4JI5L 4O2DA 3H15A 2CWAA 1B8AA 4YWLA 4K0KQ 1E7ZA 5C3EG 4OWWB 4JI2L 2BA0A 2KBNA 3W1BA 4DR1L 1HH2P 1NE3A 2JA8G 1OXUA 1VQAA 3CCLA 2ES2A 1FJGL 4DR5L 1CKNA 4JYAL 2QA4A 3U4VA 5FJ8G 2FXQA 3K80C 4LF4Q 4GKKQ 1XTDA 3HOYH 3HOVG 4BY7G 1YJNT 4IJLA 4DKAC 4TVRA 5LMUL 4DV0L 4Y52H 4YHHL 3PUWA 4DR1Q 3CCST 3CMAT 2JA5H 3EBEA 1KXLA 2AWNA 3GD7A 4DR5Q 1FJGQ 4X65Q 3S1QH 1VQ9T 5IAYA 3PUZA 1EQQA 3G4ST 1NMGA 3BJUA 3S1NH 2CKKA 1WCMH 3J7AF 2JA7G 3UE1A 4YCWA 3RLFA 4FDBA 4YHHQ 5LMUQ 3CCRA 1W3SA 3I7FA 2R6GA 1JMCA 4LF7L 1VS0A 4LUVA 2QEXT 5J3BA 1G6PA 3CCMT 2PI2E 4A3KG 5M3FH 3WWVA 2IX0A 1PH1A 4L5SA 4GOPC 2RF4A 1YHQA 1IZ6A 5IY0A 2B63H 1CKNB 4IFDG 2ZM6L 3LGLA 2KHIA 1YHAA 3M4PA 3UE0A 3CW2C 4DUYL 3CXCS 1GD7A 1U5KA 1HNZL 3PO2G 1XNIA 2VS1A 4HJ9A 1OXVA 1XMQQ 3KF6A 5C3EH 2KCMA 2UUAQ 2BH2A 3GTQH 3J80E 5LMNW 1N8RU 2XGTA 4XIGS 1PV4A 4JI6L 2JA8H 1T9HA 3S1MH 1IBKL 2CCZA 1KQSA 2ZM6Q 3S17H 5JJKA 3CCVA 1VQ4T 1YEZA 4A4IA 4A3JG 3D0FA 1FVIA 1MKHA 2D0PA 4QQBX 1WJJA 3HOVH 3DB4A 4MTNA 1QZGA 4BY7H 3J80i 1Y1WH 4TQUS 4DR6L 5LL6S 4YCUA 3A74A 4JI6Q 5JEAJ 4IOCA 1IBKQ 1IL2A 1PYSB 3CCET 1NY4A 2LSSA 4YTLA 4LUOA 4R4QA 2JOYA 4UP9A 1VQ7A 2JK8A 4LF6L 3I2ZA 3S2HH 1I6HH 1I5FA 1UE1A 4PZ7A 3P8BB 2JVVA 5ELNA 2CQOA 2XTIA 2Q2UA 2JA7H 2CKZB 2UU9L 3CMEA 4HIMA 2K4KA 3G71T 2OWOA 4KHPL 5IYCG 1HZCA 1YITT 3J7ZC 4X62L 2LCLA 4LF6Q 3BZCA 4B3SL 2ATWA 4P73A 2UXCL 4LWCA 2ZJQA 3D31A 1VQMT 4LF5L 4A3DH 3CCUT 1Q7YC 1HR0W 3CF5A 2OTLA 2UU9Q 1VQKT 5IWAL 5IT9E 1PHJA 4GN5A 4GLAC 3PO2H 3GTMH 4JOIA 4JI3Q 2N49A 4IPDA 4GN3B 2UXCQ 1BVSA 1HZAA 4LF5Q 4LFBL 3MXNB 4GLVB 5IWAQ 2NVYH 2K5HA 5DM7R 2Q2TA 3RR5A 1NJIU 4OWXB 1Q81U 3J81i 4A3MG 4WJ4A 4IPGA 2EXDA 4C3JH 3CPWS 3HOXG 1XNRL 1G291 4PG3A 1FL0A 3F8TA 1GKHA 4DAMA 3T1HQ 3DLLA 1V43A 2PQAA 1KIXA 3HOUG 1XMOL 3H0GH 2VL6A 3KBGA 5JJLA 3CMET 1S3OA 2AHOB 3M4QA 3K0XA 1K8AU 5C44G 2ZJPA 4A93H 4BA1I 1I94Q 1HNXL 3GTKH 2Y0SG 4DV5L 3CD6T 4GN4B 5IP7H 5JJIA 1KD1U 1X3FA 1IBML 3I4OA 5IYCH 3M9BA 3PCOB 5BR8Q 3T1YL 4A3FG 1YJWT 4A3CH 5E7NA 1OXXK 2WAQE 2YYZA 1MJEA 1EIYB 3FKIH 4DV5Q 4DPGA 1SROA 3PIPA 1EUJA 1EYGA 2UUBL 2F4VQ 4QGUA 2E5LL 1TWFH 3M4OH 4DV1L 4IPHA 2K75A 5IYBG 4HJ7A 3J7A5 2B29A 1LYLA 5AJ3L 2R93G
chains in the Genus database with same CATH superfamily
4PJOG 4Q5VA 4WFN3 2XDBA 4LD9K 1YCSB 1S72T 2UUBQ 2LXKA 2RQRA 1LTGD 3SGIA 5CV9A 2E5LQ 3VYGA 1TR5A 1YNZA 1PHTA 2DL8A 1VCIA 4C3IG 2HHHL 5AJ3Q 2K33A 4DV4L 4HJAA 3DWAA 2K5FA 2BKDN 4OX9L 1RADB 2D5DA 3OS1A 1ZUUA 4FXGC 1NYFA 2EIFA 1EIFA 1PH4A 1GCQA 1PD1A 2H8HA 1VQHA 2ZPIB 1A8VA 2LKVA 4OXPA 1EY9A 4RGTA 2P4TA 4JJDA 2N55A 2N78A 4J9FA 4JBWA 1D1CA 1P16A 5KYLA 5GMKl 4C3HH 1S1NA 1LTAD 4HXJA 5C6SA 3W5OA 3EFXD 2F2XA 2CT4A 1S5DD 1H3HA 1NZ9A 5GJVB 2RBMA 4QCLA 3ND9A 2XG8D 2DF6A 2NVTB 2KQWA 3OYIA 2AQ2B 2ZJRA 1U4PA 3AFPA 3AMUA 4XTZA 5IYBH 2KSSA 4JJCA 5M5YH 2F52A 4EDUA 4CDCC 3R6OA 1PCXA 3PGGA 1WHGA 3GTOB 2JA6B 3PNWC 2MCNA 1D1AA 3RKXA 3E3XA 4OF1A 4ID6A 4KHZA 3EG2A 3NELA 1K28A 3PE0A 1ZKOA 4H13C 4A3JH 2OTJA 4FVMA 1WHLA 3QOJA 4RWSC 1X2QA 1RAIB 4PNOA 1PTOH 2YTXA 1QWFA 3MFYA 1GM5A 2F3WA 4CRIA 4M7DA 1MBYA 3PUYA 3PFSA 4YY3Q 3NUCA 2WP8J 4PJNA 3HFZB 4X9DA 1X32A 1MV0B 2DL7A 5EBCA 5GAMf 4OGQC 1Y96B 3WXMB 4B9XA 3HFNA 4F7UG 2RHIA 2HQHA 4R8IA 1JO8A 3NBHA 4N9PA 1NPPA 3A8JE 2I2LA 4DBRA 2K5VA 4DV2Q 1V76A 1LT4D 1WQ7A 1STBA 3CP0A 1QNKA 5I2XA 3MXGA 3FJ5A 5C0XG 5G3LD 4KUIA 2ROTA 4RAUC 3HPWA 2RA4A 3VS0A 2C9OA 3OTOQ 1JORA 1Y07A 3M59A 1N9RA 2P0PA 1AWOA 1JJCB 2Q2IA 2MPXC 3CC4A 3HKZE 1AD5A 1RLQC 2Y4YA 2IVWA 2RI5A 5CORA 4DA2A 3KF6B 4F8MA 2B2UA 2WAQB 2L2PA 4RCNA 5JPMC 4A76A 4MZ9A 1PYWD 5LMNQ 1HPCA 2ABLA 2YTYA 3I90A 4A54A 8ATCB 2OEOA 2DNUA 1LNXA 1YIJT 1DOMA 2C35B 2N3SA 1HNWL 5L8RE 3H94A 4M75F 3J7YW 4ZTJA 1VQ6A 4RGNA 5IE8A 3CRKC 1A63A 1VQMQ 1R4PB 1FGUA 3EIVA 1DCZA 1O7IA 3EVQA 2XN9C 4JI4Q 1ABOA 1GBRA 2A6ED 1OX8A 1BUVT 2ZXOA 4RGOS 1F77A 4JI7Q 1AN8A 3VUZA 1C1AA 1B34B 4CGYB 1B2TA 1QG7A 3KDFB 2LQWA 4NXMQ 1TU0B 2VGNA 3S2DH 3QDRB 5GANf 1AE2A 1QVGP 1A2TA 2SDFA 3F2UA 3W1GA 1I3QH 5LJ5h 1IYJB 4ZTFA 1VQGA 5HGTA 4FF1A 1Q86U 4C8QA 3HEJA 4C92D 4ZAIA 3J81c 4DV3Q 1M1KC 2G5DA 4RMFA 3S16H 2G6FX 2K2VA 3K7UC 3UDCA 3JCMV 1E1OA 1SFOH 4BBRG 4CHTB 4OO1H 4AYBG 4JRKA 3OY9A 1U8RA 1Q46A 4JJNK 1W2BS 4PMWA 1XYIA 1T0JA 4LFCQ 1W1FA 2AKLA 1SYEA 3KFVA 1WDXA 2NLUA 5AYFA 1X3PA 2QW7A 2MNAA 4BA2I 3S1NB 1J8IA 2PZWA 2RCNA 5EAYA 1E22A 4C92B 1GCQC 4OIJA 4E6RA 1AZGB 3CCJT 2XMFA 4E7HA 1IHZA 3LH0A 3M0PA 3LH5A 5GMKm 1NYGA 1SMYC 2E3HA 2ZXPA 4M77F 3RN5A 1TKWB 3KXTA 1QILA 5D3DA 5M3FB 1QVFA 2GN5A 1CTMA 1M5Q1 4X64L 4DNRB 4DFAA 1JQQA 1RACB 1L1OA 1PNJA 4JPBW 2RPNA 3TREA 1SE8A 3FHWA 1UNSA 4JI1L 5FWBA 3S1RH 4K5XA 4M78G 1SYBA 3GBQA 2KVQG 1TWBA 1LTBD 4O6JA 3K7AH 3S1MB 1CKAA 1MMGA 1EU4A 3VUBA 4A3FH 1EWIA 3INZA 1K73C 2KMTA 1FMVA 4KV6A 4BY7B 2J7IA 3M0SA 1Y1WB 2IW3A 1J5EL 2A37A 3L2VA 1EIHA 1D1IA 3A0JA 5DLQE 3WVEB 3OW2A 3N5BB 3V05A 3RR6A 2OT2A 1I6HB 2HKNA 1M4ZA 4LD6A 2DXCA 4RTWA 4M7DC 5K5PA 1X43A 3JV3A 1Q8KA 1K83H 5C5LA 2DD5A 5HY6A 3CMAQ 3CCSQ 2L9HA 2FRWA 1E0BA 2FPFA 4ZK9B 3STBD 3K5LA 3BY7A 2XVSA 5KYIA 1OZ3A 3ASKA 1CQVA 1X01A 3QXEB 3KLWA 1PRMC 5M3MH 1SMXA 2YTVA 5GADC 1S40A 5LJ5e 1TIID 2X4WA 4FU6A 4A3DB 1HSQA 2F0HA 4JYAQ 1FYNA 5GAGC 2D9UA 4E6IA 1JXMA 2LMJA 3CCMQ 4OB3B 1TH7A 1WA7A 2KCCA 3T13A 3PO2B 3UDIA 5GAN8 1CM9A 4DV0Q 5GAOq 2QDYB 4J6YA 2JA6G 1NE8A 3T53B 2PCFB 4XT3B 4L5TA 2B2UC 2DMOA 2F69A 2IG0A 1K8MA 3BDUA 3X26B 2OCEA 4LJZC 3G71A 2V8KA 3U23A 2RSOA 2UXDQ 3PIOA 1UECA 3OA6A 3BE3A 2PVGB 3VS6A 2M9UA 1SRMA 4PKCC 1VQMA 1RABB 1PRTD 1VF7A 1LT6D 3NXWA 1VQKA 1GL5A 1H92A 2UXBL 2OTJT 3M3YH 2LJ0A 4F04B 2I0QA 2DD4A 3GNGA 3J80c 4J9GA 4LF8L 4BWGB 3TSZA 3O13A 3CCEQ 4OONA 3NTHA 4M7DB 2JA9A 4JW0A 4XU1A 4C3JG 3MKDA 3PO3H 1NBWA 1PC0A 4JZ3A 1O78A 3RZOH 4DR4Q 4DAVA 2L8DA 3QPHA 4KRTA 3M85A 2C0TA 1PRTB 3F2DA 1ZA2B 2X4XA 4KLKA 2K04A 2KENA 4DV7L 5C4XB 3K6OA 2L5QA 1K0SA 5IP9G 4JBJA 5IP7G 1WYDA 2KJXA 2XSCA 5C0MA 4C8QC 3SD4A 4XU0A 4LUDA 5EKLA 5GAMh 2CYZB 3JCMc 2QILA 2WAQG 4NMZA 3GTJH 3K81C 3HOWH 1AEYA 3S3OA 3CD6A 4N0AA 1B44D 2GA4B 4GS3A 1KNAA 5J26A 1SE2A 1ZUKA 2DFUA 4LDUA 4F7UE 1K9MU 5D6XA 1G3SA 4PJOA 1HR0L 1QKXA 1FYCA 3AT1B 4QF4A 1D09B 4AIMA 3J81E 3HG9A 4A3IH 4FO2A 5IT9c 4M7AC 4B3SQ 1C48A 3M57A 4C0ZA 3VJPA 2L11A 1TWAB 3G7ZA 3A5UA 2FPEA 4OVAA 3IL8A 2Y90A 2HCKA 2E12A 2RJFA 1Q3LA 5CKFA 1Q1EA 1X3EA 1TOVA 1D5XC 3GV3A 1TY2A 1RKNA 4DA4A 3RZDB 4XDXA 3AQQA 2XU8A 2IWHA 1L1OC 2E70A 1X6GA 2ECZA 4D8KA 1VQ6T 2ID0A 4LFBQ 4MZTA 4A3LH 4HA8A 2PNHA 4DR7L 4GLKA 2P84A 1WTHA 2DL4A 2FINB 1UB4A 4OO1I 1CFMA 5T1IA 4IFDJ 1LABA 3GDEA 1D7QA 4M75E 3M54A 5GAOp 1I07A 1HFNA 3VYSA 1VYTA 1JQYD 3LGFA 3QIIA 2DN8A 5GQOA 2HSEB 4OMQA 1U3OA 3CPFA 2DERA 1FNUA 2E5KA 2K5QA 3H3VC 3I4MH 1R9TB 2DM1A 1RAHB 3A8IE 1IBMQ 4KKUA 5GANh 1O75A 4C92G 3CMAA 3CCSA 2GVBA 5FU6B 1WPYA 1JWSD 2GF7A 2B2YA 1NJIC 5EQ0A 1N36L 1U9RA 2Y0SE 2KXCA 3RLNA 1I4K1 2KNBB 5JEAG 2Z1CA 1UHFA 1KHIA 4X34A 1OO9B 1X3GA 1DYQA 2DO3A 1HZBA 2A5HA 4C1NK 5KNBA 4JCVE 3ER0A 2QAZA 3QB3A 1BQQT 5JVH3 2DVJA 2LQNA 4M7AB 1VQNA 1ESRA 2A19A 1RHPA 1HJDA 3N6RA 1YI2A 3CCMA 1EOVA 2KVMA 1M27C 4AYBE 3CXCP 2LJ1A 4PLIA 1Q81R 2BOSA 4JI5L 4TKOB 5E1FA 3NFCA 1RTNA 4K6DA 3DXJC 1N6AA 4NP5A 5GAMe 2KBNA 2P0QA 3HS0C 2A3LA 1H9KA 1HH2P 1GUOA 1OXUA 2DIQA 2NUCA 4OGEA 1CKNA 1L0YB 4XYOA 2VGMA 4MIUA 4Z89A 2A74C 2FXQA 3FDTA 5E4WC 4CI0C 5IGDA 3UT1A 4RKBA 4BY7G 2CH4A 2JXBA 2Q8IB 4IJLA 5LJ3g 4Y7NB 4ZCKA 4HCEA 1O7YA 3TMEA 4DR1Q 3V8LA 2GGRA 3I56Q 2QASA 4C0DC 4E7LA 3W2DA 4DR5Q 2EY1A 3JCMQ 3EJIA 4OMFB 1EQQA 2JT4A 2EQUA 3H41A 1WCMH 2EYWA 2D8JA 1WXTA 2JYOA 5C4HA 5LMUQ 2A69C 3RLFA 5CV4A 5CVIA 3CCRA 1T5XD 1HRJA 1WHHA 3M0TA 1JMCA 5GAN2 1VS0A 1QCNA 3V7RA 4A3KG 2SEMA 5FK9C 5CGKA 3WOEA 3QKJA 3N52A 2RF4A 3C1EA 2BE9B 2K3XA 3GOXA 2IL8A 3MZ5A 1YHAA 3CW2C 3PO2G 2DZ9A 2LNVA 1M90R 5D65A 4DU9A 1KC8R 3PT9A 1TTHB 2K03A 1XMQQ 2R5MA 1TWCB 3J80E 5LMNW 1N27A 3DEPA 1N5ZA 3OBWA 2JA8H 3Q1JA 1D6EC 4B6MA 1IBKL 1ZBXA 4FF4A 4ZGDB 3CCVA 1SF9A 1FVIA 3QYHB 2D0PA 4KD3A 3UI2A 1TXQA 4C1NI 1QZGA 2PZUA 1CI3M 5GANe 4N0AC 1BCPF 1UJ0A 2HCIA 1NAPA 2O2OA 4PJOC 1IL2A 3MFGA 5LJ5g 2FMCA 5BN3A 4C5HA 4UP9A 3OYLA 3I9QA 4PZ7A 2JVVA 2X6GA 4GLMA 2Q2UA 2O9SA 2CKZB 4QVDA 2UU9L 1TS9A 2K4KA 3AU7A 3G71T 1SRLA 2BE5D 1VQLQ 4KUDK 3JCMf 4M7DG 1MNDA 1OOTA 1HZCA 2O31A 4Q5WA 4LF6Q 4J9BA 1I81A 3SWNA 3BZCA 3VYTA 4EGVA 1YIJQ 1SE4A 2KI7A 2DJQA 4P73A 4P5NA 2ZJQA 1W70A 1VQMT 1WI7A 4LF5L 3QDFA 1R77A 1VUBA 3U9OA 4EMKA 4IFDH 1VQKT 3MEHA 5IT9E 1PHJA 4GN5A 4GLAC 4D8DA 2O88A 2F0MA 2M02A 1U06A 4FM4B 2N49A 4HSVA 1HUMA 1BVSA 4J8QA 4CJ0B 2RQWA 2EYPA 1DD2A 1WIEA 2A6HD 2JTMA 2COWA 2NVYH 1I0CA 2K5DA 3J81i 2ZPHB 1Q81U 4HCZA 2F0IA 2PVOB 4IPGA 4M78A 2RM4A 1RI0A 1XNRL 1G291 1I6VC 4PG3A 4DK0A 4DEXA 1HXDA 1KJWA 3DLLA 1SNDA 3T1HQ 2RJDA 3H0GH 3VA5A 2QI2A 4AFUC 2AHOB 3M4QA 4A93H 5T1GA 2EQJA 5BN5A 1K4US 1STNA 3CD6T 2C0OA 2RK2A 2M2LA 3P8HA 2NTTA 2MUYA 3MWYW 4G7OC 4M4ZA 1EIGA 3M9BA 3TQ7P 1I4QA 4A3CH 2DETA 1M9SA 4F17A 2WAQE 3M7GA 5HKCA 4FSSA 4KY6A 3FKIH 4DV5Q 2UUBL 1SROA 1GBQA 4Z02A 1B9NA 2D2CC 4QGUA 2E5LL 1TWFH 2DBMA 3CCJQ 5KCOA 1LPLA 4D6WA 4XQNA 1CK1A 4HJ7A 2B29A 5KYXA 4LWCA 5AJ3L 3J7A5 4BY6C 2MP1A 2R93G 3LNNA 1SHGA 3KFUA 1EY7A 3S24A 2XDDA 4HJ8A 1UWVA 4BY1H 2A7YA 2E5QA 1YNND 2K50A 5C0XJ 3ERSX 4RTYA 3I56A 1YVCA 1QZHA 1B70B 1JICA 5GAN7 5CR3A 1OTCA 5GMKi 4C8QF 5FRNA 4LUZA 4A3GB 3O8VA 1F2MA 3DM3A 1M90U 5CIUA 3QO3A 1WFWA 4JI0Q 1R0CB 3H6ZA 1TY0A 2YRDA 3DEOA 1XJVA 3MP6A 1PA6A 3C1FA 1Q86C 2XWJB 4JRIA 1I8FA 4DBQA 5C44H 2EGEA 3FRNA 2DTHA 2KEDA 4RTXA 4IURA 4GBQA 1W6XA 2GTJA 8AT1B 1L2FA 3CHBD 1BB9A 5FKAC 3PVQA 4X65L 2A0FB 4HIKA 5GAN5 2A68D 4M7AG 1I5LA 1G51A 2DNCA 2O2LD 4QB4A 1PH3A 3TP5A 2QF7A 1UHCA 3R6NA 1BBWA 1ET6A 4FYWB 1KDAA 3ULPA 1AWXA 4ULLA 3C94A 1UE6A 2WV6D 5KYUB 1G3YA 4E7IA 2ALYB 2JQOA 5FLMG 4IO9A 4B3RQ 2K28A 3RLOA 2EYLA 3CC7T 1A0NB 2V8JA 2NWGA 2RVLA 3LWIA 1H9SB 1I50H 1UE7A 1BBZA 4L5RC 3R93A 1NM7A 1TT2A 2CH4W 1VQNT 3CRLC 1PH6A 1Y1VB 1DZ1A 1BOSA 1YI2T 1QJOA 4K14A 2F0VA 5GMKh 3S14H 1BU1A 3EROA 4DN4M 2UUAL 4BY6B 1W6KA 3GTLH 4N4HA 4H44C 5CBAE 4C3IH 5K36H 1WXUA 3G4SQ 1DJRD 4JC0A 1KFZA 4A3EH 3I4NH 3C12A 4NL2A 2LY7A 3DM1A 2V26A 3JAME 1CHQD 2ZTCA 5L23A 2QEXQ 1MJCA 2E74C 4R4CA 4PFZA 3OW7A 3JB9D 1VQLA 1VQ5A 1JOKA 2PW5A 4FXKC 2VUMB 1YNJC 1WXBA 4DV2L 3NTIA 1VMCA 3CQZB 3HFOA 3NEMA 1UEAB 1YIJA 1LV9A 3RUXA 3H6MA 2PNIA 4X3KA 2Z9HA 3CPWA 1TSFA 4MMLA 1WOCA 2Q8TA 2O5IC 3SWNC 2ZT9C 5KH6A 1Q82C 1B07A 3JC66 4DAPA 3CCRT 4EMKC 2OTJQ 3K59A 3S15H 5IGFA 1YZ6A 2CZ6B 4RFBA 2QTXA 4ESRA 1MV3A 3V7CA 3ICEA 5LMNL 3OW2S 1MMNA 4GY5A 2AZVA 2R92B 3X24B 2B8AA 3PF5A 1V1PB 3KDFA 4JI3L 5GAEC 4CKCA 4JRQA 1JB3A 2LMCB 2F0QA 3NPPA 4M78C 4CC4B 1KNEA 5A2QE 2LZ6B 2D62A 1M2OA 2F0FA 2Z6KA 2X6LA 1PM3A 3HRTA 1VDZA 3CCVT 5FO8B 5IODA 4JI4L 3NENA 2COZA 3FEOA 2X35A 4UC4A 1HQRD 4XK8E 4JI7L 2DXUA 3MHBA 2ZZDA 1B1ZA 3KF8B 4OHJA 4JJBA 1H95A 4E2FB 4J6HA 2Z4HA 4NXML 1ACMB 3D6WA 2H3EB 4FW2A 1A15A 4NOYA 4IUNA 3RMQA 4AQYQ 1I94L 4IFDI 2LP5A 3W3AA 4UP7A 1EWCA 3GNFB 4FYXB 3CCJA 3AFQA 5M5XB 4C92A 3O5ZA 2F4IA 2A8VA 3H3VI 3H0IA 4M1UB 3TP8A 1YJ9A 5GMKe 2VY3A 3SWNB 1LM0A 3I8ZA 5C0XH 2K5WA 4QKUA 2L0AA 4DXFA 2F4VL 2X3XD 4MDWA 4EMKB 1WFQA 4HTHA 1EQVA 3JCMh 3HTRA 3JCMJ 2PMZB 1EQRA 1DONA 1N8RR 4DV6Q 2DVEA 1X69A 4M7DE 3GTPH 1ONLA 2VXWA 2AHJB 1KAWA 2WKCA 3LX7A 2JA5B 1WTWA 3OSSC 1E6HA 1OXSC 1EY5A 2EOTA 2ICEC 3EH2A 4M77D 3S1QB 2YUNA 4PJOF 3EGDA 4F88A 1PTOD 2HDLA 1LOJA 1K0RA 5M5YB 1I5OB 2WB1B 4XYQA 3T56B 1GUWA 4KTAA 2I0NA 3GP7A 1K9MC 4LFAQ 4B3MQ 3HOYG 3CKIB 3HRZC 1TWHH 2IT1A 4RH6A 3FLGA 1SNMA 1R8OB 2D6FA 4Z9CB 4JI8L 3HOXH 3K57A 4DUZQ 3ME9A 1X55A 2E2HH 2B63B 1PLFA 5K36G 3S3MA 3HOUH 1SYDA 1YJNA 2R7ZG 4JV5Q 1H9MA 1ZYRD 5LHY1 4O42A 3A8GB 4X66L 5C4ZA 3SHWA 2HT1A 1LLRD 5CV7A 3JCMW 2JM8A 3RKYA 4HCBA 1SJHD 1ZXTA 3G4SA 4LDXA 1OPKA 3FRPB 2YWWA 5KYXB 2JN4A 1C9OA 1N9WA 4A3GG 1XTCD 1GUSA 4BBRH 1VYVA 4C2MH 3NQIA 2MOXA 2QEXA 3JCMP 3V8KA 5M5WH 1AOJA 3META 2CT3A 2MYSA 2L55A 2SRCA 2LS01 3S2HB 3MEFA 1UDLA 1JBMA 1E7OA 3I56T 1KAAA 3Q8DA 3G1JA 4H02A 3L7ZC 5I9PA 1WNLA 2JA7B 2VQEQ 1X27A 1PH8A 3RUZA 2JEBI 2JSOA 1PVOA 4EMHA 2CP5A 4JK1C 1MIUA 4J6XA 2M9VA 2X9HA 4JI2Q 2EJMA 2GQIA 3FB9A 4IJHA 2IX3A 1CZGA 1NCVA 2KECA 2B2VA 4C8QE 4I65A 4JZ4A 2RHSB 3U4ZA 3I4LA 1K9AA 1CUKA 3JCMe 1NTGA 3GTMB 2GBQA 4HIDA 3VS1A 3L2WA 2RQXA 1Y1VG 3UDFA 2VASA 2UXDL 2FEIA 3PMIA 1V1QA 2F3IA 3J81L 3JAMi 2JUFA 2RI2A 4RMOA 2UUCQ 3H8ZA 1IKMA 3CCLQ 2ATCB 3CBPA 4F7UF 1JB0E 2X3WD 3RBBB 5C5MA 4KJNA 3ULRB 1TS2A 4KGVB 4M7AE 4C3JB 2O9VA 1XX8A 4IUVA 1TUCA 5LJ3h 2AUKA 2Z6KC 4ZLTF 3E0EA 1D8LA 2VB2X 2A6EC 2FO0A 1ZUYA 2HQLA 5KRUA 5JAVA 1LUZA 3F70A 2VUMG 1ILQA 2G9DA 3GTKB 3CCUA 2EYZA 2K57A 1SNPA 1JJ2A 1VQPT 2J0TD 2R7DA 4I7ZC 3ITPA 3VDYA 3FMCA 1STHA 4DR4L 2SEBD 2M16A 4IUPA 5GAOr 3HGBA 1Z9FA 5IN1A 1L0WA 2FYKA 3TS2A 2E64A 3EG0A 3CPWP 1NG2A 4C56C 4NXNQ 4FYVB 1AVZC 3TDQA 4C92C 1VQLT 1A0IA 3H0HA 1VQ5T 2DIGA 1C7YA 3I73A 3JB9G 3TN2A 2NVTH 1PFMA 4JS5A 2NYZD 2D0OA 3G71Q 1LTLA 3MXNA 3MVVA 1K8GA 1JT8A 3NK9A 2KDSA 4R4TA 4E7SA 4CC3A 1FD7D 1VQJA 4P75A 3GTOH 2B2TA 2R92G 2M00A 4P72A 1B3QA 3SXHA 2JA6H 1VQDA 2EYXA 2EY2A 4NS5A 4QQDA 1VQKQ 2SNMA 1OULA 1HCZA 4CDFC 4IUQA 3R8BA 4A3MB 3OYCA 1D0ZA 5FWCA 1U0LA 2NVXB 2CUBA 1ASYA 3OIPA 1UGRB 3VA7A 4KHPQ 1Y14B 1KSWA 4DR3Q 1WJSA 4CC7A 5KYNA 4KJOA 5HGQA 2XWBB 4X62Q 3DKMA 3L2QA 3UA7A 1WX6A 1IW7D 1GHJA 5E3FA 3V2TA 2SNSA 4RG8A 1KLUD 1M4VA 3I5RA 5IYDG 2DRMA 3MO8A 2FB7A 2DUDA 3AYHB 3S9WA 3MC0B 5C0XI 3A54A 3L2PA 3EGXA 4DR2Q 3PVLA 1UGSB 1AE3A 4CC2A 1X65A 3PIP3 2PO4A 3CD6Q 1JEGA 3CU7A 4N4GA 1S4ZA 2PI2A 4NB3A 5IGEA 2E2JB 1K8OA 2YU9B 1ZSZA 3PMTA 5C4JB 3AB9A 4UPAA 4M7AA 2C5CA 1E2WA 4BI3A 2K32A 5IP9H 4A4HA 1EU3A 5DY9A 4ZGEB 1WHKA 5LJ3e 3ULLA 1VQ8T 3Q0AA 1ILPA 1FMKA 4C3HG 1YJ9T 4IKFA 1HZ9A 4TSSA 2F0TA 2LDMA 2JA5G 1XPOA 3M0RA 1SNOA 1HNXQ 1TWGB 3KOJA 3STBC 4OB1B 4M78F 1PXUA 2AT1B 2Q2HA 3OYKA 4UY8C 3GLXA 2BE7D 4WF2A 2PZTA 3T1YQ 1M2VB 4LXCA 2EKOA 4ILWA 2SOBA 3PF4A 2WB1G 2E65A 1Q81C 1BNZA 2AQ1B 3J80L 3X28B 3SB2A 5IGBA 3REBB 4DK6C 3UA6A 4POGA 1AT1B 3EGDB 2F0PA 4DV1Q 2Z0WA 2B2WA 2F5TX 1HQMC 3I3CA 1C6VX 1QCFA 2B63G 3QUIA 3M0UA 2VNUD 4II1A 4KKSA 5AFWA 2J05A 2K5LA 2QEJC 1A6XA 2B2VC 3R2IA 5EJWA 2E2IB 2CWAA 4K0KQ 1CA5A 4OWWB 1KQ2A 3GQBA 4DR1L 1VQAA 3CCLA 4ZGJB 5GAN3 4DR5L 4PJOE 2QA4A 4GKKQ 4LF4Q 1X2KA 4IIMA 4XTXA 4A3KB 2CZ1B 3SK6A 1YJNT 1PRTC 2FPDA 1I1JA 3C95A 3OYMA 3CC7Q 5LMUL 3D6CA 4FYYB 4EPCA 2DXTA 1CKBA 3GD7A 3OPOA 1FJGQ 1VQNQ 1YWOA 1YI2Q 3PUZA 5EBDA 3G4ST 3S1NH 1O7LA 4BS9A 5IT9L 1U1TA 2JA7G 3TP6A 4YCWA 4FDBA 4X3UA 4LF7L 2RF0A 2PUKB 2QEXT 3VS5A 3A7AB 5EGTA 1ZHIA 5M3FH 3AHUA 1PH1A 3BZDB 4DF7A 4OIKA 4EVOA 2RQTA 5BN4A 1Y57A 2EYYA 1DOKA 2IJ0A 4QQGA 1UUPA 4K8IA 3QJYA 3EFRA 2K9GA 4LNPA 4BD3A 3G6JB 2FL7A 1HNZL 3M4PA 4DUYL 1E2VA 3I72A 1GFCA 2K6AA 2VKNA 3S3NA 3E9GA 3JSCA 2VS1A 4N8X1 4HJ9A 1WQWA 3BYYB 1UGVA 3OYJA 1BCPD 4ORZA 2RB6A 4XIGS 3S1MH 2ICIA 2X69A 1ZEQX 2B2TC 2CP0A 1Q95G 1JR0D 1RJTA 2ZM6Q 1YEZA 1KHCA 1JCKB 4A4IA 5C3WA 2E75C 3D0FA 3CCRQ 5LJ3d 3A7LA 1MHNA 4XQ3A 1Z6HA 2ZXRA 2P4RA 3DB4A 2WACA 4MTNA 4BY7H 2NUPB 1Y1WH 4DR6L 1JC7A 1BR9A 3NSWA 4JI6Q 3VYHB 4XT1B 4LMQD 2YDLA 4FT4A 2EAYA 1ET9A 2RHYA 4YTLA 3LWUA 4R4QA 3SK4A 1VQ7A 2JK8A 5D14A 3I2ZA 4LF6L 1I6HH 2VYTA 1I4PA 2M0YA 3JCMg 5ISRA 1M3AA 2IPKD 4OB2B 2DEUA 5IYCG 3J7ZC 3VR4A 4A3BB 2LCLA 1SNCA 3CCVQ 5G3LF 4K6LA 3C2PA 1D1KA 3BVZA 2L0CA 5FU6C 4OEMB 2PTKA 1C0MA 3A55A 1ZA1B 5FOBB 2RK1A 4A3DH 3CCUT 3SK5A 1I4HA 2OTLA 5ECAA 3CF5A 4FXDA 1BBXC 1IYUA 1IHWA 3PO2H 4JOIA 1ZSZC 1WHMA 1EZZB 2MJ8A 3CCQQ 3RIRA 4ZYSA 1AZQA 2DJFC 4IPDA 4KN7C 4AFZC 2UXCQ 1Q7YR 3MXNB 2EFIA 3TZUA 2K5HA 2EYOA 3RR5A 4A3MG 4HMIA 2HQEA 3WOFA 2EXDA 3CPWS 2BDOA 5D6YA 1K76A 1FL0A 1GKHA 2RDGA 1IKLA 5LJ5d 1KDBA 1V43A 2PQAA 1KIXA 3RMHA 1XMOL 4A4FA 2VL6A 3CMET 1Y0MA 4JDSA 3A8HB 3CBMA 4NKLA 1TVXA 2VB6A 4FF3A 2R93B 2ESWA 5COYA 4R55A 4DV5L 2RDFA 2QQAA 4GN4B 2LTOA 3THKA 3I4OA 3NHNA 5CYUA 3WDNA 1B50A 3PCOB 4A3FG 2KYBA 1R0BG 3IFTA 1AHJB 3EG3A 2B2WC 5E7NA 5ELDA 1EL0A 1ZX6A 3URGA 1G3TA 5FROA 1OXXK 2NBFA 1EIYB 5KIXA 4DPGA 4QUFA 1EUJA 5CV8A 2F0JA 2NYSA 4C92F 3ZFJA 1B9MA 4OMPA 3RDVA 3JAML 5C4XH 3QOLA 1VMPA 3BFMA 3EGXB 4XU3A 4C0GA 3SEMA 4JI0L 1GJXA 3CC7A 5KYUA 1OXTA 3BG3A 1ZSZB 1CKOA 2KCTA 1T5EA 3FPPA 1AWWA 1H9SA 2RKSA 2NUTB 4O1NA 2ED1A 2EQSA 1U1SA 5M3MG 3Q24A 1QVFP 1JXOA 1MGSA 2K01A 5IGCA 4RKUE 2AMCB 1M8VA 2VC8A 1F9PA 2IHFA 2EY6A 2CP6A 1KD1C 1D3BB 5CKEA 4A4GA 1A3UA 3KUPA 1K0XA 4IPCA 1G2BA 1NLOC 1PG5B 4C5EA 4QVZA 3I55Q 2RQUA 2F1LA 1GO3E 1TWAH 2K05A 4RA8A 4A53A 3G6EA 4B3RL 2V1CC 1XXGA 1FNWA 2PMZE 2D0NA 4RHSA 1O7ZA 4JI1Q 5KYYA 3RZDH 1VIEA 2AIRB 3GO5A 2KYMA 2F3VA 2NZHA 3L9AX 4GNXB 1HHVA 3FIFA 4LW1A 3EFSA 4ALPA 4KH0B 1J6QA 5DAUA 1P8LA 5A2QL 1G8XA 2PU9B 5I21A 3LX0A 2NZOA 1E6GA 2RDHA 3OW2P 4KBMB 3DLMA 4M78E 2ZJPA 1EY4A 5I9OA 2F03A 5FLXc 2O4XA 3ND8A 1UEBA 2QQ9A 3HKZB 2WB1E 4ZUJA 1M1FA 3CAMA 5I4DA 2OF1A 2DTOA 2NVQB 1GHKA 4QW2A 3PO3G 5I2MA 1O80A 2BE5C 2Z4IA 2K3BA 1XPUA 1DJ7B 2EVBA 3CCLT 5KGUA 1R9TH 1K3RA 3QIAA 4K5WA 1V1PA 3NTKA 2QA4T 1KRSA 4K8JA 4PJJA 2L1BA 3JAMc 1Q7YU 3OSOA 3L1AA 1STEA 2JJQA 4ZKBB 5IHNA 5FJ8H 4HIOA 2X51A 2EQMA 5CQYA 4L6TB 1WTVA 1C0AA 3I35A 3GTGB 2DLPA 2B3GA 1JRIA 2A28A 4HVUA 4JVZA 3HOWG 1Y8OB 3KF8A 1WTQA 2A6HC 1A3VA 5IOCA 3CCQA 3RNUA 3MP8A 5J1ZA 1VQPQ 2IY5B 3NPFA 2YT6A 1T0HA 5FLMH 1UE9A 2RO0A 4JOIC 2NN6G 2A08A 1RAGB 2V1RA 1XQHA 3D8GA 4BBSB 4F16A 3M5AA 3U58A 1D5MC 1NSNS 4M7DF 3F2CA 1YN8A 5JVG3 1VQ5Q 2RMOA 1KQ1A 2R7FA 4Y7NH 1NEGA 1W2BA 1PH9A 2AWOA 1FR3A 3E9HA 1UE5A 4O0AA 4PFPA 1Q1BA 1SLJA 3OS0A 1HJPA 1SYCA 1G3WA 2K6DA 3EHQA 4J9IA 1PRTF 1VQIA 1CSQA 2I5LX 1TS4A 3LYIA 2DKGA 1VQOA 2RJCA 1SHFA 4OELB 2CWPA 4ZN1A 4LF8Q 3R3OA 5GAMd 2COYA 3H3VH 4JRPA 2AUJD 2W10A 3OYYA 1ZBJA 4BACA 3KBXA 5FO7B 3MAQA 1PWTA 3HP9A 2C06A 4HAEA 4A3BG 3QZ9B 3VR5A 2Z6BA 2EGAA 2XIWA 4BXXG 2L3RA 3KLSX 1VQ7T 5C3XA 2EJGA 4DQ2A 4DV7Q 1YNNC 2EGCA 3HOZB 5FO9B 4UAIA 4KD4A 5BR8L 2GNCA 4R4OA 2QG9B 1KTKA 4KN4C 4DV6L 5EG2A 1TWCH 1VIFA 1TXYA 1D0XA 4JLGA 2VV5A 3ZJYC 2EQIA 1QW1A 1RAFB 4M77A 1PSEA 4HJ5A 1HR0Q 2OTLT 3KYHC 1F9SA 4U673 1QB5D 3HOYB 3GIBA 2F5KA 2RN8A 1V9PA 3E5SA 3FPUB 1T3LA 3BW1A 1G2TA 3J7AV 3D3RA 3E9IA 1SJED 2RJEA 2A68C 1BXTA 4XU2A 1WTRA 2L3SA 3I55A 2F1MA 3RD4A 2PZ1A 2J4XA 2MO1A 1VQ8Q 4DK3C 4DK1A 3X20B 2JTEA 2HBWA 6AT1B 1YJ9Q 2PQWA 2PQAB 4BI4A 1U4MA 4J9CA 1XNQQ 3OMGA 2ZAEA 4PMBA 4JV5L 1XPRA 2VZAA 5J22A 4DR7Q 2HIXA 3MXPA 5CKDA 5GANd 1KC8U 1Y8NB 3FDRA 3UDXA 4EQ5A 1IXRA 2ZCFB 2P0KA 3LGJA 2E10A 2MO0A 1VQCA 5HCKA 1QOHA 1WVLA 3D4RA 3GTQB 5C3EB 2KAFA 2LQKA 4N8FA 5EKIA 4CKBA 3K5MA 1R4QB 3JB9J 3LWHA 1PYBA 1TG0A 3SHLA 3S17B 5EC7A 4FIBA 4M7AF 4KK7A 3Q22A 1B53A 4DEYA 1OI1A 4FW1A 3KJPA 1PH7A 3BS1A 3KLSA 1V1OA 3HOVB 2XRSD 3PUVA 2VQEL 4J7IA 3TQYA 1QCBD 2DPPB 2CP7A 3MEVA 4L5GA 5CK9A 1NJIR 4GKJQ 5FLXE 3V7SA 2MI6A 2E2DC 3OYGA 1LT5D 2OX7A 3FVQA 1MSHA 1YJNQ 4WORA 3HHTB 2QK0A 4OWTB 4MHEA 4C92E 2XDPA 1B4OA 2EJFA 4PFOA 1S5ED 1ABQA 3T51B 3GF5A 1X6OA 2CS7A 1UJYA 3MTSA 4JI5Q 1YP5A 1D0YA 1NUCA 4YY3L 4PLLA 4KULA 1VQPA 3BVMA 2E4HA 4APVA 5CMDA 1LTSD 1EY8A 2K1BA 4J6WA 1SBBB 1QVFS 1BI2A 2DYIA 1IGUA 2UUCL 1N32Q 2XK0A 4C5GA 5KYYB 3G6ET 2KUMA 1XOVA 1SKUB 3VR3A 2R7ZH 1PH2A 3PMFA 5I22A 1YBYA 2BTTA 2JXMB 2R5AA 3HKZG 2R57A 1PFSA 2Q8RE 2YRVA 1UG1A 2H3JA 2NZ1D 1OEBA 1VQFA 2EY5A 4AT1B 5KYWA 3OTOL 2LVMA 3VS3A 1EYCA 2A73B 4P71A 1GRIA 4A3GH 3EN2A 1WJRA 4DBFA 3FJPA 4J9HA 4BE2A 1EOTA 2O4XB 1RL2A 1HTLD 1GCPA 1YITA 2AQ3B 2QCPX 3FP9A 2KEEA 4AG2C 1IBLQ 2Z0SA 4NXNL 4JUVA 4XAXB 2CVRA 1E24A 5GAOm 3C0CA 3PV0A 4DNIA 3DUZA 5EPJA 3H0FA 1B7TA 2AKWB 4HT8A 4M75D 3GPLA 2QDLA 4PV1C 5I6YA 1SSHA 2EJGC 3BZKA 2PPBC 4LF9Q 3GTPB 1RLPC 2D9TA 2DL5A 4WJWA 2WINB 3H0GG 3M4OB 2FHTA 3SE0A 2IPOB 4Z8AA 4QIWB 4A93G 1J3TA 4PZ8A 4BBSG 2PNRC 3RESA 3L2RA 1QVCA 4DGZA 3L2ZA 3VRYA 3VR2A 2WSEE 2VQFQ 1Y1VH 4M77C 3OQ5A 4R4IA 2LT1A 4C0FA 1CZWA 1HTPA 2HUGA 1TS5A 4M75B 3CCUQ 1JE4A 1QLYA 3CCQT 1M3CA 4DR3L 1N33Q 1BF4A 1PTOC 4A3CG 1RAAB 1ZSGA 1EZ6A 2E6NA 5GAOn 1HD3A 3F1ZA 1GVPA 1OYXA 3FKIG 4DV3L 1H8KA 1VQ8A 1M1GA 2E6ZA 1Y8PB 1YJWA 1QVGA 4UP8A 4GOPB 1HA5A 4CDDC 4LFCL 4QQ6A 3EH1A 3ZL7C 5ELFA 4B08A 2KCNA 4DR2L 2VUMH 1OQKA 2AZSA 3M4GA 1Q90A 3IAYA 1AW7A 1RAEB 1FNVA 3VRZA 3CQZH 4BY1G 2Q2TA 1ZYRC 4FP5D 1YHBA 4YIJA 2K4YA 3HKSA 2B86A 3ZBDA 2K52A 4F87A 1WTXA 1VQOT 5DLOA 3A8MB 3CMEQ 4FCYA 2EXZA 4H0LC 1M2VA 4YCVA 1RD9D 2PQEA 4C3HB 3NE5B 2ZPFB 2EPBA 4G4KA 2GFUA 4UDUC 3D4DA 4KMUC 4X3SA 3HOZG 4KGXB 1WHJA 1N34Q 1BO0A 3JB9H 1PZJD 1X56A 2BDNA 2PW7A 3A8KE 3M53A 3KJOA 3RMSA 3HL8A 1ML0D 2F0NA 2ZTEA 3EA6A 5EPLA 4B3TQ 1IXDA 4MZMA 1XNRQ 2R92H 3IFDA 1EFNA 1QUQA 2YV5A 2EPDA 3KUFA 4IUTA 2CFMA 3TEHB 4DAYB 2EJ9A 3A1PA 4M77B 2K79A 4OP0A 1AP0A 4A3JB 2F0OA 2A1AA 2L5TA 2RCFA 2GQVA 1PTOB 1RDPD 4ZRZA 2MFIA 4MNOA 4A75A 1OPLA 2QQSA 4AMCA 4CDEC 2EJFC 3A98A 2J7ZA 3VS4A 1RIPA 2CW0D 4L5QA 2EYFA 4K0KL 1KL9A 3SK8A 4HEDA 2PYKA 1PFBA 2XRQD 2JNGA 1Y69U 3U50C 1CQFA 5M5XH 3I55T 2DZCA 3ZEHA 3Q6SA 5IYDH 1QKWA 2LX9A 3I91A 4J15A 4NDXA 4A3EG 3I4NG 3R2TA 4GKKL 4LF4L 3ONAB 4O2DA 2O01E 2RHUA 4YWLA 3QWYA 1HA6A 5C3EG 5IH2A 3VU3C 2BA0A 2ZPEB 3DMUA 2KROA 2CHBD 5D7UA 3OIQA 5CQXA 1PRLC 3W1BA 3OS2A 1FJGL 1OX9A 1I4GA 2R61A 4BB7A 2DBKA 2JZ2A 1K8AR 5CV6A 1HK9A 4JYAL 2HQXA 4HKEA 4XTUA 2WKDA 1X75C 3NQTA 3OYNA 2KA7A 3HOVG 4CJ1B 1STGA 4DKAC 4Y52H 1QWEA 4DV0L 1SXTA 1Q86R 1UGQB 4KH1B 3DHQA 1PSFA 2JA5H 4LK1C 1OU8A 4X65Q 3S1QH 4AFSC 5ELBA 1H3ZA 5IAYA 2XIDA 2F0LA 1AZPA 3URYA 3Q23A 2NUPA 1CA6A 2KRSA 1KLGD 5LJ5j 4YHHQ 2MF2A 1V8QA 1NEBA 2R6GA 2B39A 4LUVA 1G6PA 5J3BA 1KABA 1NR4A 2P5ZX 2PI2E 3WWVA 4L5SA 4ODGA 3LLRA 2QA4Q 2KHSA 2LCSA 1YHQA 1H641 5IY0A 4IQZA 5TSSA 4MTKA 2B63H 4N9TA 3LGLA 2X4YA 2ROLA 2ZM6L 2KHIA 3UE0A 1LTID 1U5KA 4E47A 5GAN6 4HMJA 3TU4K 3E1SA 3S2DB 3EG1A 5DEHA 2BH2A 2UUAQ 1M30A 3A56A 1N8RU 2XGTA 1I3QB 2RNAA 5D3IB 4JI6L 1AZEA 4BUGA 2CCZA 4R0KA 1KQSA 2JP1A 4A3JG 2ED0A 3S16B 2XICA 4Q0FA 4LN2A 4J9EA 3ERQA 1SFOB 5CKHA 3JB9F 2KY9A 1HXYD 1IW7C 2GFAA 3RNJA 1D5ZC 3A74A 4XQQA 5JEAJ 3X3NA 4IOCA 1PYSB 1NY4A 5NUCA 2YSQA 1Z9QA 5KYWB 3S2HH 1MD2D 4HVWA 2R58A 1I5FA 1JOOA 3CC2Q 2CQOA 2XTIA 2WIIB 2F2VA 3PQIA 2JA7H 2ZPGB 3CMEA 1Q82R 2OWOA 2J6OA 3VKIA 1EEFD 1MNEA 2DYBA 2KT1A 2KXDA 2LJ3A 4J8OA 1YITT 4MDXA 1G8ZD 4ZKCB 1SYGA 2RD1A 3LWEA 4QUCA 4B3SL 3BYTB 1G91A 2KQ3A 2V4DA 2OI3A 2UXCL 3D31A 3QWNA 3EG9B 1BIBA 1QE6A 1Q7YC 2EDGA 2KGTA 3HRSA 3TVTA 3TBIB 1EQTA 1HR0W 2DX1A 3P8DA 1MI2A 5AT1B 4MZPA 3S1RB 3GTMH 4JI3Q 4PJMA 2MPMA 1VQ7Q 1HFGA 1WJQA 4M75G 4LFBL 3K7AB 1SNQA 4IALA 2BCOA 4E7ZA 4CKEA 3CEYA 3NMZC 3L3OC 4GLVB 5LL6X 5IWAQ 1V29B 2HBPA 5IHIA 5DM7R 5GAN4 2AK5A 1UFFA 2D0QB 1PDQA 1RTOA 4OWXB 4A3FB 3MXUA 4C3JH 5CV5A 3HOXG 1ESFA 3QHSA 4WTOB 4DAMA 4ZQ3A 2OAWA 1DM0B 3HOUG 1VF5C 3KBGA 4MN3A 1S3OA 3HP3A 2K3YA 5JJLA 3EHRA 1K8AU 3JCMd 4RTVA 2OTLQ 3HSBA 3QJ6A 4BA1I 2NUTA 1CHPD 3H91A 1I94Q 3GTKH 2Y0SG 2VWFA 1J9OA 1ENAA 1GUTA 1QWYA 1K83B 4KHVA 2ZPBB 2H4OA 5IP7H 1IBML 2DEQA 4MMKA 2HD0A 1EYAA 5IYCH 3JB9I 1D3BA 1YJWT 3OYHA 5I2YA 4ATOA 1MJEA 3V8JA 5M3MB 2F4VQ 2FZCB 5A0LA 2FFKB 3PIPA 4KKTA 1EYGA 1Y7XA 4L63B 2MK5A 1LACA 3BDCA 4IPHA 2K75A 4S3SA 5IYBG 4DOWA 1LYLA 1UGPB 1STAA 1IL8A 2EQKA 3UF4A 2HAXA 2EVRA 4GNXA 2R7ZB 2QGFB 4VUBA 1QCOA 3OBYA 1SEBD 1KRTA 3A5ZB 1U4LA 1EY6A 2MWOA 2RH2A 4FT2A 1ICFB 4J9DA 1NR2A 2DE0X 4YWMA 4M77G 1PD0A 4WRDA 4V2SA 1CSKA 2GVAA 1CKMA 3ZYYX 2QQRA 3CXCA 1A3TA 1BKBA 2ENMA 2ZGWA 1LTRD 1PTOF 1TQOA 2NVXH 2OXPA 3MJXA 1EWHA 1QUQB 2JJ9A 4OMNA 4R1JA 1NLPC 1VQEA 3SVMA 1K9MR 2FVUA 1SRUA 2CUDA 1SG5A 4DV4Q 4JI8Q 2HHHQ 4OX9Q 3M7NA 4FL6A 4K11A 4G7ZC 4P74A 2MIOA 1BCOA 4Z88A 3VYUA 3M3YB 4FF2A 5D6WA 1W4SA 2GTOA 1Z47A 5HK0A 5GAMj 1FMWA 1B3AA 3PGZA 1BCPC 4LDVA 2BA1A 1LO5D 4Y28E 3ULJA 5C6AA 3X3MA 4X66Q 1JWUD 1FXXA 3OYAA 3PO3B 2HIVA 1G83A 3NHHA 2E2JH 2DAQA 3RZOB 2HZYA 4KI0A 1Q8IA 5CBEE 2MWPA 2YU9H 2KEAA 1F9QA 5C4JH 1SMYD 1TS3A 1Q82U 3TSSA 4B9WA 3TS0A 2EYMA 4RKLA 2HDAA 3OYFA 1NNXA 1M90C 1KC8C 5JEAH 1XMQL 4HN7A 4R8NA 1NPRA 3GTJB 4ANJA 3G6EQ 1VQ9Q 2TSSA 4YWKA 3HOWB 3PUXA 1F1BB 2FZGB 3QYGB 1TWGH 3QG1A 3PIO3 5FRMA 5IXFA 5F2DA 4GZYC 1VQBA 2FG0A 3CC2A 2VVKA 2DY7A 4IN3A 4CBVA 4RHRA 2ENBA 4EX5A 4A3IB 4OB0B 1FGBD 1IRXA 5GAHC 1G2SA 3EAEA 2IX1A 2DNEA 1AWJA 3OB9A 1F2LA 2LC4A 2QTVA 2KBTA 1X9NA 2E3IA 2JTFA 2EKHA 3A8OB 2H5XA 1IO6A 3P7JA 4M7DD 2D1XA 5E4XA 2EWNA 3TSWA 1ASZA 2E2IH 1MGQA 2KRNA 1BCPB 3MPUB 4O5VA 2DJGC 4KY5A 1IB8A 1VQ4Q 2K7AA 2EE1A 5GANj 2DL3A 2L12A 3P75A 2RI3A 1YHQT 1MMDA 2MQHA 3VYRA 1JJ2P 3QBYA 2J6FA 4A3KH 4OO1G 1KQSP 2RA2A 1BCMA 3TCJA 2G3RA 4UHVA 3OWFA 1E3PA 2E8GA 2E1HA 5ELEA 3MEWA 2RHXA 1AFPA 2BIVA 3I4MB 2LT4A 2VB3X 3EFOA 5IGGA 3M56A 3B6YA 2D8HA 1SEMA 4EIKA 3T1HL 1AEXA 3NBHB 1KK7A 1XJWB 4E7JA 4U68A 1GXDC 3OYEA 4E7KA 1G5VA 4KGZB 3OWEB 4RG1A 5KNCA 3K5NA 4NPSA 5M3FG 4JBKA 3LW5E 3P1HA 5A35A 1STYA 5DM63 3AEVA 1HNWQ 4EQPA 2FRYA 4XQJA 4J83A 4JBMA 5GROA 2YUOA 2MMPA 4L6V5 2LNHB 1GOZA 2Y4XA 3UDGA 1IYVA 1P92A 1BDOA 3CC4T 3C3LA 4V0BA 2NN6H 1VQOQ 3U9SA 4BI8B 5IXBA 5KCHA 2DA9A 2Z8LA 5HURA 5FLXL 4GNXC 2NUZA 3MA2B 4AH6A 3EGUA 2RSNA 3E19A 2HD3A 1FWZA 4A4KA 1JE5A 1SDFA 2TMPA 2PUOB 3SFMA 5HK3A 4RG2A 4HCCA 2YUQA 1XNQL 2L15A 4DNTB 2VXEA 2I46A 1U5SA 5KEEA 4AFQC 1SE3A 1LT3D 3VS2A 4C8QD 1M1KR 3FEWX 2XD0A 4G7HC 4QIWE 4QL5A 1WCMB 1BBUA 1EX4A 2JN0A 1YNXA 5M9OA 3JRZA 3QZ5B 2FMMA 4X9CA 4H7BA 1IGQA 3REAB 1VOMA 4A3BH 2CP3A 4RTUA 4BXXH 5I6WA 3I70A 1D2BA 1ENCA 4CJ2C 4C8QB 1KIKA 4M7AD 4PJLA 2A36A 2HKQB 4XTVA 3IRBA 1N9SA 1S72Q 1WTOA 4WJ3M 2M0OA 3I5SA 4RTZA 1A2UA 1X3QA 2HDMA 4DBHA 4HCSA 1QVGS 5ELCA 2OQKA 2BH8A 4X64Q 2JA8B 2QGGA 1VQ9A 2LXJA 4RTTA 2OAUA 2VXFA 1DGSA 3PSIA 4K2KA 4GKJL 4K5VA 4Y91A 2O5JC 4TVAB 1M8MA 4GLXA 1WI5A 3OOCA 3M55A 4QT7A 1EYDA 1DOLA 1TU2B 4DOVA 1EFWA 5KE3A 3K8AA 3T16A 4Y92A 4NW2A 5KNDA 2WSFE 2QGQA 3BU2A 3TRZA 1QP2A 3RKWA 1GUGA 2F0UA 1PH5A 1QNUA 1WD1A 2DGYA 3BVGA 3E9FA 2R93H 3PTAA 1K73R 1XWEA 4IUUA 1QMCA 1L1OB 4F7UA 1EFID 2CZ0B 2MAMA 4IZ8A 1J5EQ 1PKTA 1N32L 1SR3A 3QO2A 3MP1A 2JMCA 3DWQA 2QKIC 1FX7A 2NTSA 3OYDA 2OQ0A 2CSQA 1RUWA 2CSIA 2YXYA 2WFWA 5IIFA 2MHVA 1Y1WG 2F0WA 1AH9A 3P20A 4M77E 1VQ4A 4POFA 2VW9A 2JW4A 1IHVA 3OS5A 1Q12A 3M0QA 1SYFA 2K14A 3FC3A 3D7SB 1LJOA 1VYUA 4JG2A 2DK3A 2EYQA 1TUGB 2WSCE 4BE1A 1ENFA 2DXBA 4TRDA 3CCEA 1Z9ZA 3WVDB 2OJ2A 4BDYA 3VR6A 2YHTA 3DB3A 1IBLL 2NVYB 4X1VA 4L8JA 1B7YB 4OMLA 2XHCA 2ASBA 5CR2A 2L3QA 3L0OA 2L4NA 2QYZA 4A3DG 2X4JA 3DWPA 4PQXA 1M3BA 1DXMA 4M75A 4QJFA 3H0GB 4XXEA 4LF7Q 1K3BC 4N4IA 4A3IG 4A93B 4LF9L 4HT9A 5H1SE 2F0SA 3OSVA 5CKBA 1BK2A 2QXFA 4P2CB 4QY7A 3J81j 1HNZQ 4DUYQ 2CDTA 4GOPA 3CC2T 1SSOA 4I7AA 4XTWA 4F7XA 1PFNA 2VQFL 3RERA 5ELOA 1M1KU 1RF2D 3S6WA 2FZKB 2A69D 3FKIB 4AQYL 4A3LG 3NP8A 2UXBQ 1N33L 1TWFB 4RCBA 2LFNA 4BE0A 1YITQ 3KLRA 3TZDA 4ELZC 5L37A 4DR6Q 1WGSA 4ZN3A 4ZUIA 4C0DB 2JMAA 2N8NA 1TUDA 3UWNA 1I4XA 4BY1B 2K5IA 5GAOl 1MMAA 2JEAI 2BZXA 4X6AH 1BI3A 4ME7A 2NVQH 2JE6I 1LVKA 2GCXA 2W0ZA 3X25B 1NMFA 2M51A 3JCMX 3K0YA 2I5HA 4LNQA 1WLPB 1X54A 3I4MG 5DM73 1N8RC 5KE2A 1IREB 1PMRA 1ARKA 1U4RA 1JOQA 2KOLA 5C4XG 4HVVA 1CSPA 4DAYA 5C44B 4PL6A 3C4SA 3VS7A 1JB7A 4XTCS 4R56A 1N34L 2HL5C 1S5BD 2BUDA 1YCYA 5GMKj 1JJ2S 2J06A 4ME5A 3EFOB 4PJOD 4OL7A 3GTGH 1JJGA 1KQSS 1YFNA 2RHQB 1RI9A 2DRKA 2ZTDA 2V8IA 2HL3A 3NGPA 1S72A 1I4RA 2IHEA 1QP3A 3RN2A 2NN6I 3F2BA 4B3TL 1K73U 4LFAL 4B3ML 1E1TA 1QQJA 1ZLMA 3M4YA 4J7FA 1OV3A 3NWTA 4J1MA 3T9NA 2JM9A 2KHJA 2DY8A 2HSPA 3GP8A 2F0DA 2HCCA 3G7LA 4DUZL 1SSFA 1BIAA 3BDLA 1YJWQ 1I50B 2H1EA 4BBSH 9ATCB 1SAPA 1G6ZA 5GJWB 4PJOB 2B2YC 1JU5C 5EKKA 1C4QA 3K5OA 1YWPA 3IQLA 2CZ7B 2F0KA 1XMOQ 3S14B 1L0XB 2F2WA 5CO7A 2YRCA 3GTLB 1OZ2A 1BYMA 1KG1A 4ZNXA 1F9RA 4C3IB 4QVCA 2RHZA 2I07B 4PK4A 4V190 4A3EB 3I4NB 1UAPA 4ME3A 1PZID 2HMAA 2L3PA 3UATA 1SN8A 1WCMG 1LCKA 2KT8A 2KRMA 4NL3A 4IIOA 5CAIA 3MHXA 2J6KA 2I5MX 2KK4A 2LQ8A 4IOAA 3G48A 1BI0A 1H9RA 2F0GA 2EYHA 3HRUA 1WZOA 2FJ2A 5A0DA 4PZ6A 2K5NA 4A3MH 3NBIA 3OYBA 2QDBA 2HNIA 2BZYA 4C8QG 4OMMA 3SDZA 1K8AC 3HOZH 1N36Q 4FYDA 4FSXA 4A4EA 3H15A 1B8AA 2EYJA 3E6ZX 4G57A 1E7ZA 1KDCA 2AKKA 3IKJA 1PZKD 4R9WA 3T4AC 4JI2L 3S15B 1NE3A 2JA8G 2ES2A 3UPUA 4PMCA 4RCCA 2V1QA 2YUPA 3U4VA 5FJ8G 1VA7A 3CQTA 3K80C 1EEID 1XTDA 3HOYH 3MCAB 3SEBA 4HR7B 4TVRA 1EZ8A 2G9HD 1KD1R 4EQNA 3PUWA 4YHHL 1RCVD 4LUEA 3CCST 3CMAT 1LTTD 3EBEA 1PKSA 1KXLA 2AWNA 5LJ3f 1MSGA 1VQ9T 1NBEB 4M75C 1Z7TA 2LRQA 3CBOA 1NMGA 3BJUA 1Y96A 2CKKA 2XNAC 3J7AF 2R3ZA 3UE1A 1D1BA 5J39A 1UUEA 2BZ8A 1ICWA 1W3SA 2E41A 3I7FA 1M8AA 1E2ZA 3V96A 3CCMT 1HUNA 2EW3A 2LCCA 1GFDA 1II3A 5IHKA 2IX0A 3HZXA 4GOPC 1ZQ1A 3K58A 5CC4A 1IZ6A 5JJZA 2YLBA 4F7UB 1WYXA 1CKNB 4A63B 4KT0E 4K2LA 4IFDG 2CQAA 4FNFA 5I2SA 3TEEA 3MEUA 3CXCS 4L59A 2JS0A 2KR3A 1XNIA 1BI1A 1GD7A 2N88A 3GTQH 1OXVA 1W6JA 2PVDB 3KF6A 2KCMA 5C3EH 1MUZA 1QVPA 1X6BA 3L2UA 3D4WA 4JLIA 1PV4A 5GAMg 1T9HA 3EG9A 3S17H 4HSPA 1CT1D 5JJKA 2QQBA 4OGCA 1VQ4T 2K7VA 2B8GA 2F0EA 3BDOA 1MKHA 2L89A 4QQBX 1WJJA 3HOVH 3J80i 1H9JA 2CP2A 4C5IA 4TQUS 5LL6S 4YCUA 3E2UA 4M8AA 2XKOC 1IBKQ 1YHQQ 5CCAA 3CCET 2LSSA 4LUOA 2JOYA 1S5FD 2RQVA 3E0JA 4OMOA 1UE1A 3NWSA 3P8BB 5LJ5f 5ELNA 2HEQA 3H09A 4HIMA 3VV0A 2B8FA 1B34A 4KY7A 3TP7A 4KHPL 4F14A 1GXIE 5FW9A 5DNFA 4X62L 4HCKA 4QMGA 3C46A 4ABNA 5FU7C 2FHDA 1W2BP 1TWHB 2ATWA 3EQLC 1RODA 2KE9A 3GV6A 3QWXX 3HOXB 2E2HB 2UU9Q 4RUGA 1MHWC 3HOUB 1YNJD 5IWAL 4BDZA 1S5CD 2CREA 1JWMD 2C0IA 2EZVA 2NB0A 4AG1C 2DILA 4GN3B 1F2YA 2Y0SB 1K1ZA 4LF5Q 1HZAA 2XI9A 3QSUA 4DXGA 2DJZA 3L42A 1OU9A 2M1HA 1WTPA 1NJIU 4WCIA 4WJ4A 3CC4Q 1SPKA 2K2MA 1HYOA 4BBRB 4C2MB 4AYBB 3F8TA 2CW0C 2E76C 5M5WB 2DTIA 5GANg 1GUNA 3MEAA 1WD0A 4LAAA 3KK7A 5EPKA 2NWMA 4XTYA 3OMCA 3K0XA 5JOBA 5C44G 4JS4A 1T3SA 2VUBA 3OHXC 5I11A 1HNXL 1EY0A 1V1CA 4M78D 5JJIA 3JCMb 5JPNC 1KD1U 2JS2A 1X3FA 3H9NA 4EMGA 4RGMA 3T1YL 2CGHA 1VQ6Q 5BR8Q 4LE9A 4RCOA 3M9QA 2YYZA 3QR8A 3SR1A 4EQOA 1Y71A 7AT1B 2IIMA 4X3TA 1C8CA 3A8LB 3M4OH 5LJ3j 1UTIA 2YLCA 4ELYC 2EBPA 2MGSA 5A0GA 4PNYA 4DV1L 2LX7A 4LDWA 5FU7B 1F2ZA 4LDYA 4J5YA 1A62A 3M58A 1O9SA 4M78B
chains in the Genus database with same CATH topology
4PJOG 2XDBA 4LD9K 1S72T 2UUBQ 2LXKA 3SGIA 2E5LQ 3VYGA 5K36G 1VCIA 2HHHL 5AJ3Q 4HJAA 4DV4L 2K5FA 2BKDN 4OX9L 3OS1A 2EIFA 1EIFA 1PH4A 1VQHA 2ZPIB 1A8VA 4OXPA 2P4TA 2N78A 4JBWA 1P16A 5GMKl 4C3HH 5C6SA 3W5OA 1NZ9A 2XG8D 2KQWA 3OYIA 2ZJRA 3AFPA 4XTZA 5IYBH 2KSSA 5M5YH 2F52A 4EDUA 3R6OA 3PGGA 3PNWC 3RKXA 4OF1A 4KHZA 3NELA 4A3JH 2OTJA 4PNOA 2YTXA 1GM5A 4CRIA 4M7DA 3PUYA 4YY3Q 3PFSA 2WP8J 3HFZB 4X9DA 5GAMf 1Y96B 3WXMB 4B9XA 3HFNA 4F7UG 2RHIA 1NPPA 2I2LA 2K5VA 4DV2Q 1WQ7A 3CP0A 5C0XG 4KUIA 3HPWA 3OTOQ 1Y07A 3M59A 1N9RA 2P0PA 1JJCB 2Q2IA 3CC4A 3HKZE 2Y4YA 2IVWA 2RI5A 3KF6B 4A76A 4MZ9A 5LMNQ 2YTYA 4A54A 1YIJT 1LNXA 2C35B 2N3SA 1HNWL 5L8RE 4M75F 4ZTJA 1VQ6A 5IE8A 1A63A 1FGUA 3EIVA 1O7IA 4JI4Q 4JI7Q 3VUZA 1B34B 3KDFB 4NXMQ 2VGNA 3S2DH 3QDRB 5GANf 1AE2A 3W1GA 1I3QH 5LJ5h 1IYJB 4ZTFA 1VQGA 1Q86U 4C8QA 3S16H 4C92D 3J81c 4DV3Q 1M1KC 4RMFA 2K2VA 3K7UC 1SFOH 3UDCA 3JCMV 1E1OA 4BBRG 4AYBG 4JRKA 3OY9A 1U8RA 1Q46A 4JJNK 1W2BS 4PMWA 4LFCQ 2NLUA 5AYFA 2MNAA 4BA2I 2RCNA 5EAYA 1E22A 4C92B 3CCJT 4E7HA 3LH0A 5GMKm 3RN5A 4M77F 3KXTA 1QVFA 2GN5A 1M5Q1 4X64L 1L1OA 3TREA 1SE8A 3FHWA 4JI1L 3S1RH 4M78G 2KVQG 4O6JA 3K7AH 3VUBA 4A3FH 1EWIA 3INZA 1K73C 2KMTA 1J5EL 3L2VA 3A0JA 5DLQE 3WVEB 3OW2A 3N5BB 1M4ZA 4LD6A 2DXCA 4M7DC 1Q8KA 1K83H 2DD5A 5HY6A 3STBD 3BY7A 1OZ3A 3ASKA 3KLWA 1X01A 3QXEB 5M3MH 5GADC 1SMXA 2YTVA 1S40A 5LJ5e 2X4WA 4FU6A 4JYAQ 5GAGC 4OB3B 1TH7A 3UDIA 5GAN8 4DV0Q 5GAOq 2QDYB 4J6YA 2JA6G 1NE8A 4L5TA 2F69A 2IG0A 3BDUA 3X26B 2OCEA 3G71A 2V8KA 2UXDQ 3PIOA 3OA6A 2PVGB 2M9UA 4PKCC 1VQMA 1VQKA 2UXBL 2OTJT 3M3YH 2I0QA 2DD4A 3GNGA 3J80c 4LF8L 4OONA 3NTHA 4M7DB 2JA9A 4XU1A 3PO3H 1NBWA 3RZOH 4DR4Q 2L8DA 3QPHA 3M85A 3F2DA 2X4XA 4KLKA 2KENA 4DV7L 2L5QA 5IP9G 4JBJA 5IP7G 1WYDA 5C0MA 4C8QC 3SD4A 4XU0A 5GAMh 2CYZB 3JCMc 2WAQG 3GTJH 3K81C 3HOWH 3S3OA 3CD6A 4N0AA 4GS3A 5J26A 1K9MU 4PJOA 4LDUA 4F7UE 1HR0L 5D6XA 1G3SA 4AIMA 3J81E 4A3IH 5IT9c 4M7AC 4B3SQ 3M57A 4C0ZA 3VJPA 3G7ZA 3A5UA 4OVAA 2Y90A 2RJFA 2E12A 1Q1EA 5CKFA 1X3EA 4DA4A 3AQQA 2XU8A 1L1OC 2E70A 1VQ6T 4A3LH 2ID0A 4LFBQ 4MZTA 4HA8A 2PNHA 4DR7L 4GLKA 1UB4A 4OO1I 4IFDJ 3GDEA 1D7QA 4M75E 3M54A 5GAOp 3LGFA 3QIIA 5GQOA 3CPFA 3I4MH 1IBMQ 5GANh 1O75A 4C92G 3CMAA 3CCSA 2GVBA 5FU6B 1WPYA 2GF7A 1N36L 1NJIC 2Y0SE 3RLNA 1I4K1 5JEAG 4X34A 1KHIA 1X3GA 5M3FG 2DO3A 1HZBA 4JCVE 3ER0A 2A19A 4M7AB 1VQNA 1YI2A 3CCMA 1EOVA 4AYBE 4PLIA 4JI5L 3NFCA 1N6AA 5GAMe 2KBNA 2P0QA 2A3LA 1HH2P 1OXUA 2DIQA 4OGEA 1CKNA 2VGMA 2FXQA 4CI0C 3UT1A 4BY7G 4IJLA 5LJ3g 4DR1Q 3V8LA 4C0DC 4E7LA 4DR5Q 3JCMQ 4OMFB 1EQQA 2EQUA 1WCMH 5LMUQ 3RLFA 5CVIA 3CCRA 1JMCA 5GAN2 1VS0A 3V7RA 4A3KG 3QKJA 2RF4A 2K3XA 3GOXA 1YHAA 3CW2C 3PO2G 2DZ9A 2LNVA 3PT9A 1XMQQ 2R5MA 3J80E 5LMNW 1N27A 3OBWA 2JA8H 3Q1JA 1IBKL 1ZBXA 4ZGDB 3CCVA 1FVIA 3QYHB 2D0PA 1QZGA 5GANe 4N0AC 4PJOC 1IL2A 5LJ5g 4C5HA 4UP9A 3OYLA 4PZ7A 2JVVA 2Q2UA 2CKZB 4QVDA 2UU9L 2K4KA 3G71T 4KUDK 3JCMf 4M7DG 1HZCA 4Q5WA 4LF6Q 3BZCA 1I81A 3SWNA 4P73A 4P5NA 2ZJQA 4LF5L 1VQMT 1VUBA 4EMKA 1VQKT 5IT9E 1PHJA 4GN5A 4GLAC 4FM4B 2N49A 1BVSA 2JTMA 2NVYH 3J81i 2ZPHB 1Q81U 4HCZA 2PVOB 4IPGA 4M78A 2RM4A 1RI0A 1XNRL 1G291 4PG3A 3T1HQ 1HXDA 3DLLA 2RJDA 3H0GH 2QI2A 2AHOB 3M4QA 4A93H 2EQJA 3CD6T 2RK2A 3P8HA 3M9BA 4A3CH 1M9SA 2WAQE 5HKCA 3FKIH 4DV5Q 2UUBL 1SROA 4Z02A 4QGUA 2E5LL 1TWFH 5KCOA 4D6WA 4HJ7A 3J7A5 2B29A 4LWCA 5AJ3L 2R93G 4BY6C 3KFUA 3S24A 2XDDA 4HJ8A 1UWVA 4BY1H 2A7YA 2E5QA 2K50A 5C0XJ 3ERSX 1YVCA 3I56A 1QZHA 1B70B 5GAN7 1OTCA 5GMKi 4C8QF 5FRNA 4LUZA 3O8VA 3DM3A 1M90U 5CIUA 3QO3A 4JI0Q 3H6ZA 1XJVA 3MP6A 1PA6A 1Q86C 4JRIA 1I8FA 5C44H 3FRNA 2DTHA 4IURA 1L2FA 4X65L 4HIKA 5GAN5 4M7AG 1I5LA 1G51A 1PH3A 1BBWA 3ULPA 3C94A 1UE6A 1G3YA 4E7IA 2ALYB 2JQOA 5FLMG 4IO9A 4B3RQ 3RLOA 3CC7T 2V8JA 3LWIA 1I50H 1UE7A 4L5RC 1VQNT 1PH6A 1YI2T 5GMKh 3S14H 2UUAL 4BY6B 3GTLH 4N4HA 4C3IH 4JC0A 4A3EH 3I4NH 3C12A 4NL2A 3JAME 2ZTCA 1MJCA 4R4CA 3JB9D 1VQLA 1VQ5A 4DV2L 3NTIA 3NEMA 3HFOA 1YIJA 3RUXA 3CPWA 1WOCA 4MMLA 3SWNC 5KH6A 1Q82C 3JC66 3CCRT 4EMKC 3S15H 1YZ6A 2CZ6B 2QTXA 3V7CA 3ICEA 5LMNL 3OW2S 4GY5A 3X24B 2B8AA 3PF5A 3KDFA 4JI3L 5GAEC 4JRQA 4M78C 5A2QE 2D62A 2Z6KA 3HRTA 3CCVT 4JI4L 3FEOA 2X35A 4UC4A 4JI7L 4XK8E 2DXUA 2ZZDA 3KF8B 1H95A 4NXML 4AQYQ 4IFDI 4NOYA 3RMQA 1I94L 4UP7A 3GNFB 3CCJA 3AFQA 4C92A 2A8VA 3H3VI 1YJ9A 5GMKe 2VY3A 3SWNB 1LM0A 2F4VL 4MDWA 4EMKB 1WFQA 3JCMh 3JCMJ 1EQRA 4DV6Q 2DVEA 4M7DE 3GTPH 2AHJB 1KAWA 3LX7A 3OSSC 1OXSC 4M77D 4PJOF 1LOJA 1K0RA 1K9MC 4LFAQ 4B3MQ 3HOYG 1TWHH 2IT1A 3FLGA 4JI8L 1R8OB 2D6FA 3HOXH 4DUZQ 3ME9A 1X55A 2E2HH 3S3MA 3HOUH 1YJNA 2R7ZG 4JV5Q 3A8GB 4X66L 2HT1A 3JCMW 3RKYA 4HCBA 3G4SA 4LDXA 1C9OA 1N9WA 4A3GG 4BBRH 4C2MH 2QEXA 3JCMP 3V8KA 5M5WH 3META 3MEFA 1JBMA 3I56T 3Q8DA 4H02A 3L7ZC 1WNLA 2VQEQ 1PH8A 2JEBI 1PVOA 4EMHA 1MIUA 4J6XA 4JI2Q 3FB9A 4IJHA 4C8QE 2RHSB 3U4ZA 1CUKA 3JCMe 1NTGA 4HIDA 3L2WA 3UDFA 1Y1VG 2UXDL 3PMIA 1V1QA 2F3IA 3JAMi 2JUFA 2RI2A 4RMOA 2UUCQ 3H8ZA 3CBPA 4F7UF 1JB0E 4M7AE 4IUVA 5LJ3h 2Z6KC 3E0EA 1D8LA 2HQLA 1LUZA 3F70A 2VUMG 3CCUA