1YBYA

Conserved hypothetical protein cth-95 from clostridium thermocellum
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
185
structure length
176
Chain Sequence
MISAGDFKNGVTFELDGQIFQVIEFQHVKPGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation elongation factor P
publication title Conserved hypothetical protein Cth-95 from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
total genus 29
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ybyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA02
2OQ0A 2NVXH 1U5KA 1YVCA 2H5XA 3A5UA 2CWPA 1FL0A 1CKOA 3PUYA 1LM0A 2R93G 2Z6KC 3AYHB 3W1GA 5M3MG 4A3BG 1XMOL 1S3OA 2E5LQ 1M1KU 3CC2A 4A3CH 2JEBI 3M7NA 1XNRQ 3J81c 1C9OA 5LMNQ 3NBHB 4BY7G 3CD6A 1N33Q 4HJ9A 1E1TA 1YHQT 5HY6A 1E3PA 2CFMA 2MFIA 3EIVA 3RLOA 4DAYB 4DR5Q 2UXCQ 2NZOA 1K9MC 2VUMH 3CCVA 4A3CG 3CCUT 1V43A 1L2FA 2YV5A 3RN5A 1M90U 3CMAT 1CKNA 1WFQA 1QZGA 1UE6A 1WYDA 2JE6I 4HIKA 1VQEA 4OX9Q 2NN6I 4IPCA 3UDXA 3H0GH 4ALPA 2EQSA 4BY1H 3E9HA 1YJNA 2HHHQ 1FVIA 4QL5A 3KDFB 3CCMT 1HNZQ 3I4MH 3CC4A 3I4OA 2I5HA 4LNQA 4A3JH 1KRSA 2UXDL 5IYCH 4K0KL 3CCQA 1NPPA 4ZN1A 3GD7A 3H0GG 2Z0SA 3NEMA 3J80i 3HOXH 2WB1G 4AYBE 4DV4L 2IX0A 2V1CC 1PH3A 4HIOA 1K8AU 3CMAA 2UXBL 3ICEA 4B3TQ 3T1HQ 2JA8H 4DV6L 4GKJQ 2G3RA 3H15A 4MNOA 5IYCG 2A19A 1NTGA 4B3MQ 3I4NG 2IT1A 3HOXG 1SSFA 1JB7A 2OTLT 3OTOL 1N8RC 1VQLT 1B70B 5IP7G 1XJVA 1K8GA 4GKKQ 4QQBX 2IHEA 1YJWT 3K7UC 2VL6A 2D62A 2JQOA 4A76A 4NXML 1XTDA 5BR8L 3F2DA 2KENA 2E8GA 4DV5Q 4X65Q 4JI6L 1BKBA 4A3BH 1YITA 2JA6H 5IYDH 2KHJA 4L5RC 1Q1BA 5JEAJ 1Q12A 4HJ7A 5GROA 4X64L 1H95A 4B3RL 4PG3A 2DO3A 4C3IH 4JI1Q 2VNUD 1SRUA 4YHHL 1VQOA 4DR3Q 5IYDG 1VQ8A 2R7FA 4OXPA 3CCET 2L15A 4IPDA 3VDYA 1HZ9A 4JBMA 5C4JH 1JMCA 2CKZB 1QVCA 4JI2Q 3TQYA 1U0LA 3M4QA 4TVAB 1QVFA 2ZTDA 1PH7A 1YIJA 2NVQH 1GVPA 3KYHC 4DR2Q 1N36Q 4OWWB 1PVOA 5IAYA 1TWHH 3J7ZC 4JOIA 4OO1G 1JE5A 1EIYB 2MO1A 1PHJA 3KF6A 2QEXT 1VQ4A 2CCZA 3OW2A 2QA4A 5E7NA 3STBC 5M3FG 3JAME 3CCEA 2HQLA 1O7IA 2Q2IA 2R7DA 3U4ZA 3PSIA 4BA1I 1YI2T 3D31A 3HOVH 1Q82C 1RIPA 1SMXA 4GN5A 2AWNA 1XNRL 5LMNL 2YTXA 5IP9H 3UE1A 3TS0A 4POGA 4GNXC 2E2HH 1QVGS 1N33L 3HOWH 1HR0W 3GTQH 4DV4Q 2OCEA 1X3FA 2UXCL 4DR5L 4LF8Q 5DM7R 4DV6Q 3MXNB 1PH8A 3HOVG 1VCIA 1VQ6A 2PQAA 3AQQA 3ULJA 5IP9G 5M5YH 2L3RA 4GOPA 3CCLT 1EUJA 1W3SA 1Q81U 2K5HA 3A74A 3BJUA 2WP8J 4JBJA 4PMWA 4IO9A 5C4XG 1D7QA 4OX9L 1MJCA 2BH2A 4KHPQ 4BBSH 2IY5B 2HHHL 1HNZL 4IFDG 4A3FH 1R9TH 5FJ8H 5HGQA 3HOYH 1HZCA 1OXXK 2RHQB 1TWFH 3ER0A 3H3VH 1PYBA 4JI6Q 1SR3A 2E5LL 2IG0A 2UUBQ 3CCVT 3M3YH 4AQYQ 3CCLA 1KQSS 2ZM6Q 3W1BA 5J3BA 3B6YA 3T1HL 4A3FG 3HOUG 4GKJL 1A0IA 1SN8A 4CRIA 1V1QA 2BA1A 2PI2A 3HOZH 1G291 1NE3A 4B3ML 3JC66 2OTJT 4LF6Q 4O2DA 1VQNT 1IZ6A 4JI0Q 2UUCL 4JYAQ 4JCVE 2ES2A 4RG1A 1ASYA 1TWGH 1NMGA 4R4CA 3CC2T 1WJJA 4LFBQ 1I6HH 5IWAL 4DR4Q 3PUVA 4LF4Q 3GTGH 1OXTA 3RZDH 1EFWA 3HOZG 1PH2A 3FP9A 4GNXB 2ID0A 2N3SA 3CPFA 4A3EH 2E70A 5GAHC 3D0FA 4DV5L 4DUYQ 4X65L 1W2BS 2VS1A 1L1OC 2OTJA 1Y14B 1VQNA 5ELOA 3U4VA 1B7YB 2VQEQ 4EX5A 2KVQG 4GLVB 2I5MX 4MTNA 4XIGS 5GQOA 4A3IG 4JI1L 3S1QH 1PH6A 4DR3L 2MWPA 1YJNT 4YCVA 3AFQA 1C7YA 2JA5H 4TQUS 2AWOA 3CPWA 2CWAA 2MI6A 3CC4T 4UPAA 1EQRA 5ELNA 4Y7NH 4HIDA 4ZN3A 4LF7Q 1K9MU 3HKSA 3CCQT 2K52A 4JI2L 4A93H 4WJ4A 1EIFA 1GO3E 5FLXE 3GTOH 4DR2L 3S1RH 1HZBA 4BBRH 1N36L 3TRZA 1SLJA 1JJCB 2Q2UA 1G6PA 1IYJB 1YJ9A 4A3KH 1K73U 4YWLA 1E24A 2B3GA 4LFCQ 4DK3C 2VUMG 3E9IA 2YTVA 3L2PA 5LMNW 3ULPA 3RR5A 1IBMQ 4P75A 2VY3A 4JI7Q 4AYBG 3J80c 3HFZB 4LUOA 2MNAA 4HJAA 1UE5A 1I50H 1SE8A 3G71T 3PIOA 2NN6G 1PFSA 3KOJA 3CCJT 4AH6A 4A3KG 3GO5A 4BY1G 4HJ8A 3G6EA 1X55A 2ZJQA 1HNWQ 1Y1WH 3UDFA 2XHCA 3SGIA 3K80C 4X6AH 4LF8L 3I4MG 2ZJPA 3CXCS 4A3JG 1YITT 4X66Q 2JVVA 4UP9A 3TEHB 3M4PA 3S14H 3HKZE 1L1OB 1M90C 2UUCQ 1I3QH 2QGQA 4DR7Q 1AE3A 1Q1EA 1V9PA 3PCOB 3PUXA 2JA7H 4KHPL 1PH4A 3A5ZB 3JAMi 1A62A 5IWAQ 1KAWA 1PA6A 1EYGA 1VQOT 2JA8G 3PO2H 3L0OA 4QIWE 1QVGA 3G71A 1VQ8T 1YHAA 2JA9A 2PI2E 3CCJA 2YTYA 4R4QA 1PYSB 1X56A 1VQMA 5JEAG 1YHBA 3J81E 2LVMA 4IPHA 3AFPA 2F52A 2PNHA 5M5XH 3CW2C 2JA7G 1VQJA 2RCNA 5C0XG 2FXQA 1YIJT 2UUBL 3PO2G 4AQYL 1JJ2A 1K8AC 2ZM6L 4DR1Q 1YEZA 1LUZA 4LF5L 3LGLA 1Y1VH 2WB1E 4JV5Q 2A8VA 1EWIA 4LF6L 2NVTH 3P8BB 2RF4A 1VQ4T 1X6OA 1VQCA 3LGJA 3KF6B 3EN2A 2QA4T 4GLXA 4JI0L 2XTIA 2B63H 2JA6G 4JYAL 3Q8DA 1X3GA 1ASZA 4LFBL 1N34Q 2MO0A 2NZHA 4DR4L 3RZOH 4LF4L 3CQZH 1XPUA 3CP0A 4P73A 4A75A 1KHIA 1NBWA 4NB3A 2B63G 1YNXA 1HZAA 2LQ8A 1VQGA 1VQ7A 4DUYL 4IPGA 3S2DH 1VQ6T 1QUQB 2ZJRA 1A63A 3S15H 2AHOB 1WOCA 2PQAB 4GOPB 2VQEL 1SROA 1TXYA 2LCLA 4JI8Q 4L5SA 4FDBA 1KRTA 4AIMA 1Q82U 3UDIA 1VQFA 3W5OA 5JJKA 5IT9c 3OYYA 1IBKQ 4DV2Q 2YYZA 4OO1I 3DB4A 1BVSA 4LF7L 2K4KA 3K0XA 4YWKA 3PF4A 4YCWA 1HR0Q 1VQHA 5LL6S 1NJIC 2KBNA 3CC7T 3BZKA 3PF5A 4EQ5A 2LSSA 3A0JA 5M5WH 3G4ST 4QGUA 1CKMA 2MWOA 2VZAA 4LFCL 3G48A 1IL2A 1HNXQ 1G51A 4QJFA 1KD1U 2JEAI 1I94Q 1IBML 4YTLA 2F3IA 2UU9Q 4JI7L 4UY8C 4JI4Q 2DGYA 1P8LA 3GTMH 5GADC 2VQFQ 3K7AH 2R7ZH 1I5FA 2BA0A 3EBEA 2Y0SG 4DR6Q 4JV5L 1OXVA 4HJ5A 4X34A 1X54A 4BBSG 2R92H 1HNWL 4P74A 2CQOA 3CC7A 1KC8C 4LF9Q 5FJ8G 4LF5Q 2DUDA 3HOYG 3G4SA 4JI3Q 2Q2HA 4RG2A 2WAQG 4X66L 4IFDI 4BXXH 4LW1A 3K8AA 3KFUA 3BZCA 1L0WA 3I56T 2XGTA 4JBKA 4DR7L 1IBLQ 5FLMH 1Q8KA 4A3MH 1B8AA 2R92G 3PO3H 4A3GH 1Q86C 4WJ3M 1UE1A 3KBGA 3CAMA 1A8VA 2F4VQ 3CF5A 1FGUA 1M1GA 2N78A 4B3SQ 1KXLA 1OXUA 3KJPA 2HIXA 4BA2I 4DV1Q 4DV3Q 4A3MG 2EIFA 1Q7YU 1VQPT 3LH0A 4IJLA 1C0AA 1XNQQ 1QVFS 3RLNA 1E7ZA 5IY0A 2ZTEA 4APVA 1PH1A 2C35B 4DR1L 3I56A 4IOAA 1WCMH 4DPGA 1YJ9T 3LGFA 1CKNB 2MQHA 4A3EG 4Y52H 4TVRA 3GTPH 1XNIA 4MZ9A 4C3JH 2OWOA 3CMEA 3MEFA 4JI5L 1SFOH 2KDSA 4X62Q 3OW2S 1E22A 1GKHA 2ZTCA 5K36G 1N34L 1WCMG 4KHZA 4LFAQ 2YU9H 3J81i 1VQPA 2R93H 5M3MH 4DV7Q 3G6ET 3UDGA 4YWMA 4HIMA 2JA5G 2UUAQ 3PUZA 3K81C 4JOIC 3CCST 1Z47A 1YBYA 4A93G 4IJHA 4GN4B 1X9NA 3GTJH 4JI8L 3J7A5 2B29A 4BBRG 3DB3A 1M1KC 5AJ3Q 5IE8A 4YY3Q 4GNXA 5C3EH 2KCTA 1IBKL 3M4OH 4DV2L 1HH2P 1VQMT 1GM5A 1VQKA 4L5QA 4A3DH 3L7ZC 3I55T 3HKZG 3FKIH 1VS0A 2JOYA 1XMQQ 1K0RA 2D0PA 2JNGA 4DUZQ 1HR0L 3CCSA 1BBWA 2EXDA 1VQAA 4DK6C 5C3EG 4KI0A 4GOPC 5A2QE 1YZ6A 1MKHA 1OTCA 2E2IH 3PO3G 1N8RU 4J15A 4A3DG 1Y1WG 3UE0A 1K73C 3FKIG 3DLLA 1HNXL 3T1YQ 4R4OA 2GVAA 1I94L 2UU9L 2VW9A 2RHSB 1CUKA 1YHQA 4JI4L 4LUZA 3ULLA 2JUFA 3I55A 2OQKA 2VQFL 2K14A 4NXNQ 3I4NH 4DR6L 1N32L 4XTCS 5LMUQ 4IOCA 1DGSA 2JK8A 3CCUA 3S1NH 3U58A 1XPOA 4H02A 5JJLA 5IP7H 4LF9L 3AEVA 1VQ7T 1RL2A 3GDEA 3HOWG 4ME3A 4JI3L 4P71A 3JAMc 3NELA 3CCRT 4OWXB 1VQ5T 4DAMA 3KDFA 1IXRA 2I0QA 1K3RA 4JI5Q 3U50C 4YCUA 2I5LX 3CCMA 1UE7A 4JBWA 4PZ6A 5H1SE 1IBLL 5C0XI 1BBUA 1WI5A 4JC0A 2JJQA 2F4VL 1Y1VG 2BH8A 1T9HA 4P72A 4B3SL 1S72T 3CPWS 4PZ8A 3FHWA 4A4IA 4DV0Q 1FJGQ 1KQSA 4DV1L 3GTLH 1Q46A 1CSQA 4GS3A 4DV3L 2CKKA 4RMFA 3F2BA 4C3HH 1KIXA 1L1OA 1XNQL 1JJGA 4OWTB 3CCRA 3KJOA 1VQ5A 2Z6KA 1X3EA 4LWCA 3STBD 4C2MH 4OONA 3KLWA 1VQDA 2OTLA 3BU2A 4UP8A 1XMOQ 4A3LH 2E2JH 1VQLA 1E1OA 1JT8A 5C0XJ 2GVBA 2KCMA 1PV4A 1YJWA 4X62L 4PZ7A 2Q2TA 1S72A 1NMFA 2HT1A 1NY4A 4LFAL 1EOVA 3J80E 2N8NA 4A3LG 1W2BA 3J81j 1CSPA 4O0AA 4LUVA 4R4IA 5J26A 5M3FH 1NJIU 1Z9FA 4DV7L 1AH9A 2R6GA 3NENA 2UUAL 2IX1A 4R4TA 3E0EA 4DNIA 5C44H 1J5EL 2ATWA 1LYLA 1TWCH 4DKAC 4QY7A 3PV0A 1VQ9T 3J7AF 4POFA 3WWVA 2UXDQ 1XPRA 1TWAH 1VQBA 2N49A 3ZJYC 4YY3L 5C44G 4UP7A 5AJ3L 4JG2A 5DLQE 4L5TA 4K0KQ 1N32Q 1AE2A 1OXSC 3F8TA 1S40A 3KF8B 2AMCB 5GAGC 5C4XH 3RNUA 2LXKA 4GLAC 1KC8U 2UXBQ 4KLKA 3PUWA 1QUQA 2GN5A 1XMQL 1QZHA 4GN3B 4DUZL 1EQQA 2LXJA 2R7ZG 3M9BA 3F2CA 2QEXA 2NVYH 2WFWA 3RN2A 1JJ2S 1Q81C 2K5NA 3OTOQ 3GTKH 3S16H 3S24A 1VQ9A 2K50A 2KHIA 1Q86U 2PMZE 4QQDA 1UEBA 1YI2A 2D0OA 3PGZA 1MJEA 1NPRA 3CMET 1GD7A 3T1YL 1KD1C 4BXXG 4NXMQ 3I2ZA 3HOUH 5FLXc 1VQIA 5IT9E 1N9WA 2AKWB 5BR8Q 3S1MH 2K5VA 5FLMG 3H3VI 3IRBA 4NXNL 3TS2A 4A3GG 3CXCA 5LMUL 1J6QA 1P16A 1K83H 5IYBH 3S2HH 2IHFA 1X65A 3M85A 2A1AA 1MIUA 2K75A 1PH5A 4IFDJ 4B3TL 2Y0SE 2ALYB 3DM3A 4X64Q 3S17H 4B3RQ 5JJIA 3F1ZA 4R1JA 2E6ZA 4YHHQ 3PIPA 5IYBG 1LTLA 5EAYA 2WAQE 4GKKL 2HIVA 4NPSA 2ASBA 3CD6T 1HJPA 1KL9A 1PH9A 1NZ9A 3ERSX 3TREA 1D8LA 1VQKT 1UWVA 5GAEC 4DV0L 3RLFA 1FJGL 4A3IH 1J5EQ 1Q7YC 3I7FA 4BY7H
chains in the Genus database with same CATH superfamily
2CW0C 1RAEB 5E4XA 1YVCA 2K7VA 2DYIA 3A5UA 1EIGA 1VYTA 4F7UE 3CHBD 3AYHB 1UGSB 2BKDN 3LNNA 3MFGA 1PRLC 3UATA 2JEBI 1M90R 1XNRQ 3NMZC 4Y28E 2DY8A 5M3FB 1UGVA 2DE0X 1SBBB 3NBHB 1N33Q 4ORZA 1QJOA 1CA5A 5CKHA 1ZUYA 2DZCA 2K2MA 1JWMD 1NSNS 4MIUA 2IPOB 3M56A 3CCUT 2BCOA 3RN5A 5FU7C 1WFQA 4GY5A 1TWAB 1NLOC 3OYIA 1QNUA 3UDXA 4LD6A 2E2HB 3V2TA 1OYXA 1Y69U 4K6DA 4WF2A 1K8AR 3E9HA 4C92F 2E4HA 2YLCA 3CC4A 2UXDL 2I5HA 5G3LF 4A3JH 1BIAA 2QI2A 3I4LA 3HOXH 2E5LQ 3GTKB 1WHMA 1I07A 3OYLA 1M3BA 2NTTA 4XU3A 4HIOA 5CKEA 2AUKA 4J9IA 3JCMP 4DV6L 4HTHA 4A3FB 1LLRD 2VVKA 4J7FA 4A4GA 4MZPA 5KYXB 2PZTA 1R9TB 1WXTA 4XQQA 3OTOL 2EQJA 2VYTA 1JB7A 4C92C 1DD2A 2H3EB 1BBZA 1KIKA 1D1CA 1D1AA 1K8GA 1IO6A 3FDRA 1CTMA 5KIXA 3K7UC 2D62A 4U673 4DN4M 5BR8L 1OPLA 1B9MA 2Z0WA 2KENA 2E8GA 4PNOA 2KVMA 2F0IA 4DV5Q 2DM1A 1YITA 2G9DA 2D9UA 2K9GA 4FM4B 2FRWA 2XD0A 3H91A 4B3RL 4XQNA 1NJIR 2K79A 3VUBA 2YDLA 6AT1B 5IGCA 1AZGB 5IYDG 5EC7A 1G5VA 1VQ8A 1UEAB 1SJED 4OXPA 1ZX6A 4XTZA 2L15A 4DA2A 5D14A 3VDYA 4A3IB 1EWHA 2O4XB 4KGZB 4PFOA 1QVCA 5KRUA 1WD0A 2KJXA 3TQYA 2RJEA 1U0LA 4FO2A 3TP5A 4G7OC 2ZTDA 1PH7A 5FRNA 1GVPA 4DR2Q 4OWWB 3LWHA 1QQJA 1UAPA 1QWEA 2MIOA 2JMCA 3HRUA 1ESFA 4XU0A 3A55A 1KC8R 3KF6A 2QAZA 5GAN6 1U9RA 5ELCA 4J9DA 1A0NB 3EA6A 2HQLA 2ZCFB 3PIO3 1YI2T 2AIRB 3BVGA 3HOVH 4GN5A 1J8IA 1C1AA 3TS0A 1M30A 1PC0A 2LRQA 3CMAQ 2CZ7B 2QGFB 2K5QA 1PD0A 5GAOm 2B2YC 3I4NH 2AK5A 2JZ2A 3H9NA 1LT4D 1PFNA 3RD4A 2K5IA 4DV6Q 4BY1B 5LHY1 1VQ6A 2R5AA 3PTAA 3ULJA 4GOPA 3J7AV 3CCMQ 3HOWG 2F3VA 3I4MB 4K8IA 3SDZA 3CKIB 3BDOA 3CPWP 3H94A 2C0IA 4BBSH 3ASKA 4LE9A 2KQ3A 1NG2A 4IFDG 4LD9K 2DK3A 1HZCA 3HOYH 1GUWA 1TWFH 4Z02A 2F0HA 5HCKA 2NYSA 2RH2A 3VR5A 1D09B 3OY9A 2KRNA 4IUNA 2JA7B 4XTYA 1QWFA 1T3LA 2I0NA 3W1BA 3HOUG 2F3WA 1HJDA 2PI2A 3OSVA 1G291 2DAQA 2RKSA 4O2DA 1K8OA 4JCVE 1UG1A 4EMKC 3QZ9B 2OF1A 3CC2T 1WJJA 5IWAL 1M27C 4WRDA 2E10A 5LJ3g 4C1NK 5NUCA 1MNEA 1TSFA 3FP9A 3CPFA 2KBTA 4F7UG 1EL0A 4A4HA 2FL7A 2QCPX 1MHNA 1I8FA 4BE0A 4PFPA 3FJPA 4B6MA 5M9OA 5HK3A 1L1OC 2M1HA 1WJSA 2AQ2B 4NMZA 1Y14B 5A35A 5EBCA 4ODGA 4K5VA 4F7XA 1PRMC 3CEYA 2DERA 4FW1A 1VIEA 1L0XB 2I5MX 4XIGS 5GQOA 3SR1A 1CFMA 2EQMA 1YJNT 4YCVA 3JCMg 2JA5H 2AWOA 4KUIA 1VMCA 1MV3A 1MUZA 4RKBA 2B2TA 4HIDA 5GAMf 5IXFA 2K52A 1GO3E 3OBWA 5FLXE 1IXDA 2DIQA 1N36L 1HZBA 1D1IA 4BBRH 2V4DA 1IYJB 1YJ9A 3AB9A 4RFBA 4A3KH 1E24A 2ZPEB 3GTQB 3E9IA 4ZRZA 3L2PA 2QASA 1RAFB 4C0GA 4P75A 3OYBA 2VY3A 2Y90A 1B07A 3QB3A 4HJAA 4K14A 1NUCA 1LTTD 1SE8A 2NN6G 2A36A 3JB9J 3PO3H 4JV5Q 2RJCA 3GO5A 1FMKA 2ZJQA 2Y0SB 3K80C 4PK4A 3EG3A 2ZJPA 4A3JG 5IT9L 2EQKA 5FWCA 3QJ6A 4J8QA 2PVGB 1M90C 4L6TB 1DCZA 4C8QD 4UAIA 4DR7Q 5ISRA 4IUVA 3GQBA 4KHPL 5FWBA 1A62A 5IWAQ 1SNMA 4QVCA 1EYGA 3PO2H 3ZYYX 4QUFA 2QGGA 3LYIA 1RHPA 1PCXA 3G6JB 1ZEQX 4RGOS 4R4QA 1PYSB 1WI7A 1X56A 3J81E 2LVMA 4IPHA 4C8QE 4R8NA 2CH4W 1FYNA 5CQYA 1KDCA 1G2SA 1VQJA 1VQNQ 2L5QA 4AMCA 2RCNA 2M0OA 3REBB 1ZSZB 5C6SA 1K8AC 1PKTA 4M7AB 1N9RA 1LUZA 1KG1A 1Y1VH 1JICA 3SEBA 5KNCA 4LF6L 2NVTH 4A3EB 3CBOA 2QA4T 4C0FA 4PQXA 5ECAA 4DXGA 1EY5A 2J7ZA 5LL6X 4LFBL 2RNAA 4DR4L 2NZHA 5I2MA 1E2ZA 1ENFA 1B2TA 3RZOH 2L0AA 1BNZA 3OMCA 3CQZH 2LX9A 1XPUA 1BB9A 4NB3A 4M75A 2B63G 5I6WA 5I4DA 2L11A 5LJ5e 1MSHA 1VQGA 4C3JB 3TEEA 4HSVA 2ZJRA 2AKLA 3SWNB 1X3QA 2D9TA 1FMWA 2BE5C 3VS6A 1SROA 3L2WA 4L5SA 1GCQC 3GNFB 3W5OA 2IX3A 1CQFA 4XQ3A 2PUKB 4K2LA 1EU3A 1JO8A 2DX1A 1K4US 4WORA 3K5OA 4OO1I 5GAN2 1CKAA 1ICFB 2JXMB 3K5MA 3C12A 2K4KA 2QILA 3K0XA 3HFOA 2K4YA 2M9VA 5CV4A 3SD4A 5LL6S 1NJIC 1BU1A 3JSCA 4X3UA 3CC7T 1NR2A 3BZKA 3PF5A 2F0EA 3A0JA 1V1PA 3CQTA 4IKFA 2EZVA 4LFCL 4QIWB 1F2YA 2FMMA 1UGPB 4II1A 4ZKBB 5E3FA 3T16A 4JVZA 1IBML 2UU9Q 4PJOF 1U06A 2DFUA 4JI4Q 2VXEA 5GADC 2VQFQ 3K7AH 5GANd 2A5HA 3EBEA 4OGCA 2BOSA 4HJ5A 5D7UA 2DBMA 2K5FA 1X54A 4BBSG 1HNWL 3I5SA 3CC7A 1I1JA 2LTOA 1KC8C 3UI2A 2E6NA 2FPDA 1TS3A 3HOYG 2O2OA 3EROA 4BXXH 4KY7A 2B8GA 1A3VA 2VC8A 4A3MH 2KNBB 1ENCA 4RTUA 4PJOC 3UA6A 3X26B 1UE1A 3KBGA 4IQZA 3K5NA 3CAMA 5DM63 1OEBA 1W6JA 1XXGA 2N78A 1OXUA 1KXLA 1NEBA 3NPPA 1GHKA 4BE2A 1TWBA 2EIFA 3VS4A 1VQPT 2DVJA 1C0AA 5GAOl 4M7AF 3GP7A 4APVA 5IY0A 1NEGA 3CCEQ 2AZVA 2Q8RE 4DPGA 1CKNB 2EVBA 2CH4A 4TVRA 2VASA 1NBEB 4JI5L 3MEAA 1GKHA 1SMYC 2F0PA 2ZTCA 3FEWX 2J6OA 4ANJA 5A0LA 3OYEA 3PVLA 1SEMA 3KLRA 1VQPA 3J81i 3G6ET 3UDGA 4YWMA 2ED0A 4M7AC 2JA5G 2SRCA 2E2JB 4M75C 2M0YA 3CBMA 3JCMV 4Z88A 4FT2A 2L1BA 2DTIA 4M7DA 2XRQD 3GF5A 1Z47A 4GN4B 1X9NA 4F88A 1LVKA 2FHTA 2BZ8A 5I9PA 2B29A 3MXPA 4BBRG 1ZKOA 2RSNA 4H7BA 5AJ3Q 4YY3Q 1H9KA 2LP5A 3F2UA 3Q1JA 2KCTA 1IBKL 3M4OH 1F9QA 2B2WA 2DNCA 1GUGA 1GM5A 5C44B 4ZGDB 4L5QA 2RDHA 1WYXA 1VS0A 2PNRC 2KYBA 1XMQQ 2JNGA 3K57A 1HR0L 4J9FA 2LFNA 5C3EG 3PO3G 1YZ6A 2YXYA 1OTCA 3IKJA 1UNSA 5C4HA 2R7ZB 4A3DG 3RMSA 3DLLA 1HNXL 1KNAA 3E3XA 1EOTA 5CBAE 4UDUC 2PZWA 1I94L 4R55A 1N32L 4ZAIA 1LCKA 5GAOq 1AW7A 5LMUQ 4IOCA 2EY1A 2D5DA 1M2VB 4LJZC 3U58A 1XPOA 5IP7H 4M77B 3AEVA 3GDEA 4BWGB 3QR8A 4ME3A 2A73B 2P0PA 3VS2A 4DAMA 4ZTJA 1TOVA 1TIID 3INZA 4CC7A 4JI5Q 1RTOA 4YCUA 2CGHA 2EVRA 1UE7A 3KXTA 1LTAD 4JBWA 1GUSA 2EPBA 5C0XI 4RCBA 2AQ1B 1QKWA 1Y1VG 2F4VL 4NW2A 4J83A 1PKSA 2NB0A 3FHWA 3S17B 1I5OB 3DWQA 4FF3A 4Y92A 4DV1L 4DV3L 1AD5A 3TSZA 4C3HH 3RUZA 2VB3X 1SFOB 1XNQL 3META 2MJ8A 1X3EA 2Z6KA 4C2MH 4OONA 1LPLA 3KLWA 2OTLA 3BU2A 4UP8A 2EY5A 5FLXL 2PQWA 2K04A 1VQLA 3H8ZA 5CKBA 2M00A 4M78A 3A56A 3VJPA 1GBRA 1X27A 2PVOB 4OMQA 3JCMb 1YJWA 3L2UA 3BZDB 1WTVA 2J6KA 1LV9A 4OO1H 1BUVT 2SNSA 3I70A 3QWXX 4E7HA 3J80E 4AG2C 2HSPA 4F7UA 1W2BA 1F9SA 3OSOA 4LFAL 4LUVA 4DV7L 4JS5A 1NJIU 1Z9FA 4M1UB 4DA4A 3NENA 4R4TA 3HTRA 2ATWA 1LYLA 1TWCH 1PNJA 4DKAC 3QIIA 3R93A 2WSEE 1VQMQ 3J7AF 4GBQA 2JSOA 2OXPA 2A6HC 4CJ1B 2EW3A 3ZJYC 1JB0E 2A08A 2D1XA 2N49A 3HS0C 1N32Q 5DLQE 1ILPA 3F8TA 2PPBC 4CKBA 4PFZA 4ELZC 2L4NA 4LUDA 5GAGC 5C4XH 1YN8A 1KC8U 2UXBQ 2M51A 4OMOA 2WB1B 3I5RA 4GN3B 1SNCA 1EQQA 5EGTA 1R4QB 3ONAB 3F2CA 2QEXA 2K5NA 4ATOA 3EAEA 3C1EA 2NUPA 2K50A 5KYNA 3HOXB 4J9HA 4QQDA 2PMZE 2RPNA 5BN3A 1MJEA 1NPRA 2K6DA 1UJYA 2QQAA 3CMET 1WJQA 1GD7A 4BXXG 5DLOA 3I2ZA 3MP8A 2O9SA 2DXUA 3MXNA 3S1MH 3H3VI 3DKMA 2YSQA 2EQUA 1ACMB 3REAB 3CXCA 1VQ5Q 5D65A 1OOTA 2KA7A 3L2RA 2XWBB 1X65A 4UHVA 2YT6A 3HRTA 1Q95G 4AFZC 1D6EC 1PH5A 1ZBXA 4ZTFA 4B3TL 2CUDA 2KI7A 3EGXA 2NWGA 2QW7A 2Y0SE 4X64Q 5JJIA 3F1ZA 2COYA 4R1JA 1PFBA 1EYCA 2HQEA 4BACA 1FWZA 4N0AC 4KD4A 2KYMA 4L59A 4DEYA 4E47A 2PO4A 4DK0A 4OMPA 4C5HA 2HIVA 1CM9A 3CD6T 1HJPA 1PH9A 1NZ9A 1V29B 3ERSX 3CBPA 1UWVA 9ATCB 5GAEC 1H3HA 4JYAQ 2K5WA 2COWA 3R6OA 5KCOA 3CCVT 5F2DA 3VA7A 3QHSA 1A3TA 2EFIA 2VB6A 1TU0B 4KKUA 1TS9A 1U5KA 2EYJA 2H5XA 2CWPA 3D4DA 3EVQA 2VGMA 2G5DA 2Z6KC 2V1QA 1B34B 2B8AA 2QQ9A 2FB7A 2IWHA 3A7AB 3E6ZX 1XMOL 3LWIA 3M7NA 1C9OA 4BY7G 1ZSGA 1N6AA 3C4SA 1EX4A 3CD6A 1E1TA 3OYHA 1S4ZA 5LJ5g 4C0DC 4RTYA 4XTVA 1YHQT 1E3PA 1PTOD 3EIVA 4DAYB 3RLOA 1Y96A 4DR5Q 2UXCQ 1QP3A 1HRJA 3CCVA 1Y8NB 3D4WA 4I7ZC 2F0GA 2FEIA 4A3CG 2ROTA 2K7AA 1V43A 2YHTA 1L2FA 5I6YA 2L8DA 1VYVA 3JB9D 2RCFA 3HOVB 2EWNA 3HSBA 1VQEA 2EJMA 3DUZA 4OX9Q 5GANe 2NN6I 4IPCA 1ILQA 2LDMA 4RGMA 1EY4A 2EQSA 1NCVA 5KEEA 2HHHQ 1SSHA 1QP2A 2VKNA 1FVIA 1SNPA 3KDFB 1AHJB 1HNZQ 1HFGA 4RA8A 5CVIA 3I4OA 1SHGA 1KRSA 1TUDA 1IL8A 1SYDA 4RUGA 2XDPA 3CCQA 1NPPA 3GD7A 1WTRA 3J80i 4DV4L 2V1CC 1WTQA 2MGSA 5HURA 4QQGA 5I9OA 2KEDA 4B3TQ 1STBA 3T1HQ 3ICEA 2G3RA 4LDXA 4MNOA 2A19A 1NTGA 4B3MQ 1W1FA 3X24B 2IT1A 1D3BB 3A98A 2DL8A 1T0HA 3FEOA 1B70B 5IP7G 3S2HB 4QVZA 5C0XH 3H41A 2DXTA 4R56A 4NXML 2EJFA 4QCLA 2ECZA 2FG0A 4CC3A 2QDBA 4KKSA 4X65Q 1L0YB 1BKBA 4A3BH 2YRVA 4OB3B 2JA6H 5IYDH 4Q5WA 3VKIA 1CHQD 4NDXA 3VS7A 5JEAJ 5COYA 2GFAA 5FU7B 3L1AA 5CK9A 1LTSD 2J7IA 1VF5C 2OEOA 3URYA 2Z9HA 3QYHB 2GTOA 2DL7A 4C3IH 4JI1Q 1VQOA 2P0KA 1PD1A 1H9MA 3NK9A 1VQKQ 1FR3A 3D6CA 4JDSA 2FZCB 3CXCP 4IPDA 4CDDC 2D8HA 1HZ9A 4XDXA 2NVXB 4JI2Q 1QVFA 3EFRA 4X3KA 1YIJA 2NVQH 1ESRA 1LABA 1D0YA 3EG0A 1T5XD 3MC0B 1G3SA 4OB2B 1DJRD 1JE5A 4OO1G 3UA7A 4ZCKA 2MO1A 4A54A 1VQ4A 2A6EC 1Y57A 4R9WA 1AVZC 3OW2A 3STBC 3SK4A 3JAME 3I55Q 2E64A 1JC7A 1O7IA 2R7DA 4C92B 3PSIA 5IGEA 1NR4A 3D31A 2VUMB 1RIPA 1SMXA 2F0NA 2Z1CA 1XNRL 2YTXA 3CCUQ 3UE1A 1N33L 4GNXC 4AYBB 1QVGS 4ZK9B 3HOWH 4DV4Q 2VWFA 2OCEA 2X6LA 4J9CA 1X3FA 4OEMB 3OYNA 4A3KB 1WA7A 1KHCA 4E7SA 5J1ZA 1PH8A 2DRKA 4Z89A 1GL5A 1QLYA 2LT1A 1E2WA 1VCIA 2A68C 8ATCB 5IP9G 5M5YH 3CCLT 3BJUA 5LJ3h 4PNYA 1UGRB 4PMWA 5C4XG 1D7QA 2CZ0B 1HTLD 1PRTD 2XU8A 1SRLA 1TVXA 2KMTA 5DNFA 1U4RA 2JMAA 4K2KA 4QKUA 2JA8B 4HMIA 5FJ8H 1C48A 5HGQA 2IIMA 2JM9A 1ZXTA 2M2LA 3H3VH 1PYBA 3S14B 3CCRQ 2E5LL 2UUBQ 2DXCA 2MOXA 1T0JA 3M3YH 2O5JC 4AQYQ 3CCLA 2ZM6Q 4OHJA 3JCMh 4Z8AA 3PO2B 4WCIA 5CR2A 1PHTA 3ND8A 1D5MC 1YCYA 1NE3A 1ZHIA 3JC66 2YRCA 5KYIA 3HPWA 2ES2A 4C8QA 4CKCA 1TWGH 1NMGA 4OIJA 1EQTA 3NUCA 1UGQB 4XAXB 2J0TD 3PUVA 1ZYRC 1JQQA 4LF4Q 3GTGH 2DY7A 5DY9A 3RZDH 1CZWA 3HOZG 2YUPA 5JPNC 4M77D 4M78E 1X3PA 4CHTB 5GAHC 3CRKC 2EJFC 1IHWA 4DV5L 1EEID 2V8KA 1W2BS 3L2QA 2EYOA 4PJLA 2DKGA 1TH7A 3QDRB 4Q0FA 3V05A 5K36H 3J80L 5GAN4 5EPKA 1RI9A 1B7YB 5C4JB 1A15A 4LDVA 2BIVA 2KVQG 2A3LA 2JT4A 2RHZA 5KYUA 2F1MA 4XK8E 3OWEB 3QWNA 4EVOA 3RZOB 1RAAB 2MAMA 3AFQA 4FF2A 3CPWA 1K73R 3CC4T 2MHVA 4BB7A 5ELNA 8AT1B 1WLPB 4LF7Q 2CP6A 4A93H 2ABLA 2EY2A 3A8JE 3M0TA 4HT9A 3GTOH 4DR2L 3BW1A 2D0QB 1YI2Q 1F2LA 2NN6H 1CK1A 1XWEA 2YTVA 3ULPA 3C46A 3SK5A 3ZFJA 1JOOA 4RAUC 1QVFP 4EMKB 4KMUC 1K76A 2XIDA 4LUOA 2HL3A 3M0UA 4E6RA 1UE5A 3G71T 1WXBA 3CCJT 1FMVA 4TKOB 4JK1C 4BS9A 3P8HA 3L42A 1WDXA 2XN9C 4N8X1 1Y1WH 2XHCA 4RG8A 2CDTA 1KABA 3SGIA 3VU3C 3CXCS 3OW2P 1YITT 4X66Q 1TTHB 2JVVA 3X28B 4BDYA 1S5ED 2B2UC 2ENBA 3QJYA 1L1OB 2KECA 3HKZE 3M4PA 5EPLA 4J8OA 3E19A 3UF4A 4A63B 1I3QH 2RVLA 2KHSA 2WAQB 3L3OC 3K7AB 1M3AA 4E7LA 3PCOB 3NBHA 1F2MA 2H3JA 3A5ZB 3JAMi 1KAWA 1FNVA 3KLSA 2A69C 3G71A 1VQ8T 2JA9A 4BD3A 3CCJA 2EYFA 2L55A 1IB8A 1QG7A 1EYDA 1GFDA 5M5XH 3HFNA 3MCAB 3CW2C 2PVDB 3V8JA 2DETA 5C0XG 2FXQA 5GMKh 4A3MB 2CYZB 2F0TA 1R8OB 3CC2Q 1I6HB 2ZPHB 2RJDA 4M7DG 3LGLA 1V8QA 3PMFA 4LF5L 2F5KA 2WB1E 4AFSC 4BY6C 1BO0A 1EWIA 2IVWA 3FPUB 3ME9A 4A3BG 1VQCA 3KF6B 2B63H 1M5Q1 2JA6G 2XTIA 1B44D 1LTRD 1X3GA 1ASZA 4L6V5 3H09A 1HCZA 2L0CA 5GJVB 4C3IG 2XG8D 5KGUA 3MEWA 4RGTA 4P73A 4L8JA 1WHLA 1QMCA 1YNXA 3G7LA 1HZAA 4G4KA 1GBQA 2A0FB 1VQ7A 5KYXA 1YJNQ 1VQ6T 3NWTA 1QUQB 4NKLA 2AHOB 5CV9A 2K1BA 4J9GA 4GOPB 4BE1A 4JI8Q 4Y7NB 1A2UA 3LWEA 3UDIA 1VQFA 2DJQA 1Q81R 5GAMd 2DD5A 2R61A 3S1RB 1RABB 3RIRA 3BVZA 4DV2Q 4FF1A 1WTHA 5EPJA 5LJ5f 2E2DC 3NTIA 1U8RA 1VOMA 4DFAA 4YWKA 3PF4A 1VQHA 4OB0B 1KNEA 2B2VA 1M3CA 2RO0A 2RQVA 1YNNC 1M1FA 4NL3A 2XSCA 3M4OB 2VZAA 4IUPA 2L3PA 1KTKA 4QJFA 1KD1U 4PJNA 5JOBA 1AT1B 4YTLA 5C3WA 1P8LA 3GTMH 1VYUA 1RKNA 3RR6A 1KDBA 2BA0A 3K58A 4JV5L 4DNRB 1G8XA 4F14A 1O80A 2X51A 1WTWA 4P74A 5GANg 2CQOA 3JCMX 1ZBJA 1SYBA 4LF9Q 5FJ8G 4LF5Q 1LTGD 4HVVA 1JB3A 3KUPA 3A54A 1JOKA 3M0SA 4JRKA 3K8AA 2X9HA 1A6XA 4DOVA 2XGTA 1Q7YR 2CP3A 1EEFD 4JW0A 4DR7L 2R92G 5BN5A 1B8AA 4RHSA 5T1IA 5IGGA 4M78G 4WJ3M 3JCMc 2HAXA 1A8VA 3QKJA 4GLMA 5GJWB 4A53A 1M1GA 1SYEA 2UUCL 4HSPA 3KJPA 1Z7TA 4EMGA 4C0ZA 2CW0D 3PNWC 3LH0A 1STHA 1LT3D 1STNA 3TDQA 2C0OA 1QVFS 2AT1B 2RI2A 2QA4Q 2C35B 1NM7A 1K9MR 1YJ9T 3LGFA 2MQHA 1QCBD 1Q8IA 1JCKB 3GTPH 4MZTA 1XNIA 4MZ9A 5D6XA 2KDSA 3OQ5A 3OW2S 4X62Q 3OSSC 5K36G 2DEQA 4C3HB 4Y91A 3THKA 3S2DB 2LJ3A 1AZEA 1WCMG 2YU9H 3JAML 4C2MB 3S15B 2R93H 1RLPC 5M3MH 1AOJA 1K9AA 4DBQA 3V7CA 1QCOA 3OA6A 4HIMA 5IHIA 2SNMA 2UUAQ 1W70A 2EJGA 3PUZA 1YP5A 3CCST 4PMCA 2GBQA 3FRPB 2GGRA 4A93G 4D6WA 4IJHA 3SB2A 2Z6BA 3M53A 3WVEB 2F0JA 1V1OA 4CJ0B 1GUNA 4PJOB 2KEAA 2D2CC 5C3EH 1H8KA 1N8RR 1KLUD 2DD4A 4BUGA 2AQ3B 4KV6A 3A8OB 3CC7Q 1IKMA 3DEOA 5M5WB 4A3DH 1TWCB 3HKZG 1STYA 2GFUA 4DUZQ 3CCSA 1VQAA 2F0KA 2B39A 1EZ6A 2DF6A 4GOPC 4C92D 1IKLA 2YLBA 2E2IH 1Y1WG 5G3LD 2OX7A 2YWWA 5A0GA 1K73C 2EPDA 3DEPA 4FYWB 3S3MA 3FKIG 1C8CA 3TU4K 5CKDA 1RAHB 1JWSD 4E7ZA 1MSGA 2RQUA 1O78A 2UU9L 4JI4L 4BDZA 2PCFB 4LUZA 3ULLA 4C92E 3FC3A 2VQFL 1O9SA 2H8HA 2ZAEA 3M0QA 1GXDC 1QWYA 1PSFA 1BCPB 2BDNA 2K14A 4LDUA 4XTCS 2E5QA 1DGSA 3S1NH 4A3GB 3MAQA 1G2TA 3FLGA 2E3IA 4M75B 4EMHA 1HTPA 3MTSA 2GTJA 4KHVA 1SNDA 4OWXB 1MMDA 1XYIA 1K3RA 2VQEQ 3U50C 3VYSA 3CCMA 4C1NI 4HCBA 4X3SA 2CUBA 3M58A 4R8IA 1VQPQ 1H9SB 3AHUA 1WJRA 5FROA 4P72A 1VIFA 3CPWS 2FZGB 4OGQC 2DZ9A 4A4IA 1Q82R 1FJGQ 3VYHB 4RTTA 1OQKA 1M8MA 3GTLH 2P4TA 3GPLA 4GS3A 3VRZA 2CKKA 4RMFA 3F2BA 1TUGB 2GNCA 1JJGA 4OWTB 3S9WA 2ZPGB 3KJOA 4LWCA 3FPPA 3KLSX 5L8RE 2LY7A 2ZXOA 1MMAA 4EDUA 3HRZC 1DOKA 1E1OA 1K8MA 1WGSA 1JT8A 3QWYA 3MPUB 2JP1A 2GVBA 4WFN3 5C0XJ 3G6EQ 2N88A 3ERQA 2QTVA 1LO5D 1GHJA 1S5CD 2N8NA 2B2TC 1ZSZA 1CSPA 4R4IA 4XU2A 3ZBDA 1QE6A 5M3FH 1G3YA 4UC4A 2HCIA 3GTJB 2E5KA 1RJTA 3TBIB 4JJCA 2DEUA 2R6GA 2F0WA 3E0EA 4DNIA 3VR6A 4I65A 2DL3A 3DLMA 4DNTB 1SJHD 3QOLA 3VYGA 2ENMA 4DAVA 3PV0A 1VQ9T 5CIUA 1NNXA 1UUEA 1TWAH 1VQBA 4FVMA 4YY3L 3MXGA 2EGAA 5AJ3L 4K0KQ 2CP2A 3URGA 1OXSC 1UHCA 3SK6A 1SPKA 2Y4XA 4K5WA 1FXXA 3RNUA 1X01A 1X6BA 4NOYA 1I4HA 2HUGA 2LXKA 4GLAC 4RH6A 4XTWA 1XMQL 4NL2A 1VF7A 1LNXA 2RDFA 1HXDA 3Q6SA 2NVYH 2WFWA 3GTKH 2EGEA 1Q81C 1SE2A 2LMJA 3S24A 1VQ9A 1JE4A 1STEA 1NYFA 2HBPA 2R5MA 5CV7A 4B08A 3VR2A 3MVVA 2DL4A 2H4OA 4MZMA 1BI2A 1OX9A 1WNLA 5L37A 1VQIA 1OU8A 1BCPF 2XDDA 4XT1B 3J7YW 2XI9A 4ABNA 5C3XA 2X69A 1J6QA 1P16A 5LMUL 3S14H 4PLIA 5KE2A 5GAMj 2HDLA 4OMFB 4M75F 1MIUA 2QQSA 2A1AA 1FYCA 2K75A 3M85A 4IFDJ 4IUUA 3GP8A 1Y8OB 1N5ZA 5LJ5h 3V7SA 2YRDA 3A8MB 4M7DB 2E74C 4YHHQ 1LTLA 4YIJA 1QOHA 1X75C 2WAQE 4CGYB 4EQPA 5JVG3 1MNDA 4KBMB 3SHWA 2VV5A 3HEJA 4GKKL 1QILA 1BCPC 4QB4A 4FT4A 2PYKA 1STAA 2F2VA 4PJJA 3MEUA 4J9BA 4A3IH 2LJ1A 4C5GA 1Q7YC 2EYYA 1OZ3A 5GAMe 2BUDA 1LT6D 2K2VA 4BY7H 1BF4A 3GIBA 4RG1A 5L23A 3PUYA 1ASYA 1T3SA 1CKOA 2LT4A 2XRSD 1EY8A 2R93G 3W1GA 5M3MG 3O5ZA 2HZYA 4A3CH 3U23A 4LAAA 4M8AA 4QF4A 5LMNQ 2LQKA 1TY2A 4HJ9A 2Z8LA 1I6VC 4OB1B 2CFMA 2MFIA 2W10A 5GMKm 2NZOA 3JB9I 4C5EA 1K9MC 4IALA 1H9JA 4ZQ3A 2F0SA 1W4SA 1IW7C 1M90U 1CKNA 3PE0A 4KKTA 3VYUA 1UE6A 1WYDA 1SYFA 2G9HD 2JE6I 5FK9C 4HIKA 1SNQA 2HNIA 4RGNA 3HOWB 1MI2A 4BY1H 4C8QG 4BI8B 1A3UA 2ZXPA 5KYYB 2K5LA 4QL5A 3I4MH 5FKAC 1B3AA 2K57A 1U3OA 4EIKA 1I4GA 1CI3M 3H0GG 2Z0SA 3NEMA 3TP7A 3UWNA 1PH3A 3NPFA 2IX0A 2BZYA 1II3A 4ZUIA 1K8AU 2UXBL 1BR9A 2F69A 4GKJQ 1H9RA 1Z9ZA 2DLPA 3CMEQ 4RWSC 5IYCG 3I4NG 3P75A 5J22A 2M9UA 3HOUB 2HKNA 3NHHA 2OTLT 3UDCA 1N8RC 2K05A 1WTOA 3V96A 3KUFA 1VQLT 3W3AA 4K6LA 1RCVD 1K83B 1YNJC 4ZYSA 1XJVA 4GKKQ 1OU9A 3M54A 1EU4A 1YJWT 5LJ3f 3WOFA 2O88A 2JQOA 4FSSA 4RTVA 1XTDA 2M16A 4C0DB 3F2DA 1QKXA 1U1TA 4N9PA 3BDUA 2BE5D 4F7UB 3I91A 3C0CA 1TWGB 4L5RC 1Q1BA 4J5YA 3N5BB 5IHNA 4RTXA 4X64L 1H95A 3OS5A 4PG3A 4M7DF 3WXMB 3RBBB 3OS1A 3CD6Q 4G57A 1B1ZA 1SRUA 3VR4A 4DR3Q 2VNUD 1WQ7A 4L5GA 2DJZA 2KGTA 3CCET 3JCMf 4JZ4A 1YNZA 3FVQA 1G83A 3CCVQ 1JMCA 2QG9B 2RHXA 4E2FB 1HPCA 3D7SB 2VUBA 1HXYD 1DOLA 4M77A 4DEXA 2G6FX 2MF2A 3QPHA 5IAYA 1Q90A 1TWHH 3KYHC 3J7ZC 3SE0A 4JOIA 3FRNA 2Q8TA 2DA9A 3TP6A 1EIYB 4OMLA 3WVDB 2QEXT 4M7DC 1BCOA 3ITPA 1YHQQ 4J1MA 5M3FG 1T5EA 3CCEA 2P84A 1I81A 2Q2IA 1H641 3NQIA 4BA1I 3HP9A 2NUPB 4MMLA 1Y0MA 1Q82C 3SFMA 2AWNA 3GTOB 2FVUA 4J6HA 2DTOA 1IHZA 5IP9H 4POGA 1KQ1A 1HR0W 1Q86R 3A8LB 1O7LA 2WKDA 3GTQH 3D6WA 2B2WC 2UXCL 4DR5L 1XQHA 3V8KA 4LF8Q 5DM7R 3MXNB 2JYOA 1SRMA 2X35A 2PQAA 5D6YA 2BE9B 1W3SA 1Q81U 4JBJA 3E9FA 4LK1C 4A3JB 4IO9A 3TCJA 2X6GA 1WTXA 4PJOD 5I2XA 4OX9L 3RUXA 1MJCA 3P20A 1IGQA 1SE4A 2BH2A 3EGUA 2EJ9A 1FNWA 3UT1A 2F0VA 4IIMA 2HHHL 1HNZL 2IY5B 2SEMA 2XKOC 4Z9CB 3T56B 1AZQA 2RHQB 2ZPIB 2I2LA 4PJOE 1SR3A 2IG0A 4KT0E 4A3FG 1G8ZD 3ZL7C 3OS2A 3B6YA 3T1HL 1A0IA 1SN8A 5IODA 3PQIA 2GQVA 3QYGB 4B3ML 3HOZH 4CC4B 2KK4A 3FB9A 2OTJT 1IZ6A 1A2TA 2ICEC 4JI0Q 4AFQC 4E7JA 1SMYD 4OL7A 3QXEB 4PL6A 1BI0A 1ZA2B 2BE7D 2WKCA 3N6RA 2X4JA 3RMQA 4R4CA 4KGVB 3OOCA 3R6NA 4M78F 5E1FA 1EFID 4E7IA 1OXTA 2NLUA 1EFWA 1PH2A 4M7AD 4GNXB 1M1KR 3QDFA 2N3SA 4M75D 2XWJB 5FO7B 2E70A 1KDAA 2O01E 4A3EH 4O5VA 2QQBA 4F7UF 3M5AA 4X65L 4DUYQ 3JCMQ 2VS1A 3NTKA 3QIAA 2B63B 1WXUA 4A4KA 2OTJA 5ELOA 2KAFA 3H3VC 4M7AE 4GLVB 4HCCA 2R3ZA 4JLGA 4A4FA 3DMUA 1V76A 4RKUE 4BI3A 3SVMA 4JI1L 4A3IG 1PTOH 1PH6A 3S1QH 3H6ZA 1AWWA 4M78C 2AKKA 5HKCA 2QTXA 3A7LA 2MYSA 2CWAA 2VB2X 2MI6A 1DOMA 4QMGA 4UPAA 2HCKA 4ZN3A 2O2LD 1K9MU 3HKSA 3CCQT 3JCMJ 3JB9H 2F5TX 1EWCA 4JI2L 3IL8A 4HA8A 4QT7A 2SDFA 4FXDA 2TMPA 2MCNA 3VS5A 1JJCB 2Q2UA 2KRMA 1VUBA 5GAOp 1IYVA 3EFXD 5BN4A 1LTID 1BIBA 1E6HA 1GRIA 4JI7Q 2HQHA 3EH2A 1YWOA 1WIEA 1JR0D 3P8DA 3NBIA 1S5FD 3C95A 3HRSA 2MNAA 5JJKA 1SKUB 1I50H 3KOJA 3PIOA 3MEHA 1PFSA 3CCLQ 4AH6A 4JLIA 3TSWA 4OP0A 5GAN7 5GAN5 1X55A 1YWPA 4BY1G 1B4OA 1JU5C 3PVQA 5GAOr 3OYGA 3I4MG 5IHKA 3PMIA 4HVUA 3OS0A 2ICIA 4BBSB 2YUNA 3M4YA 1B34A 4PLLA 3TEHB 2N55A 3HGBA 3HOYB 2UUCQ 4X9CA 5C6AA 1TWFB 2NWMA 1AE3A 1Q1EA 2PZUA 1PH4A 3BS1A 1VQOT 4XT3B 4O1NA 4QIWE 4RTWA 3EFOA 1YHAA 1GUTA 2YTYA 1AWXA 1I0CA 1VQMA 1X32A 1YHBA 4F17A 3AFPA 2F52A 2PNHA 4WTOB 2JA7G 4RCOA 4ZKCB 1G6ZA 1U4LA 3IQLA 1YIJT 2UUBL 4FL6A 5FU6C 5GMKl 4NS5A 4AQYL 1ET6A 2RA2A 1JJ2A 2CT4A 2ZM6L 2CT3A 4DR1Q 2A8VA 3AT1B 2NUCA 3BVMA 1VQ4T 4HXJA 2E65A 7AT1B 3LGJA 4FSXA 3EN2A 3K0YA 3A1PA 3S1MB 3M7GA 1WZOA 2RQXA 1N34Q 2MO0A 3G1JA 4XTUA 4LF4L 2HSEB 4OVAA 1XOVA 5C0MA 2ATCB 1KHIA 5FOBB 1PWTA 5EBDA 1GCPA 4HAEA 2HD3A 2JA5B 1TG0A 3VYTA 2CSIA 2KSSA 1WOCA 2A6HD 3CC4Q 2VQEL 2LCLA 3FDTA 3VRYA 4LDYA 4BI4A 3I9QA 4AIMA 1Q82U 3I3CA 3M9QA 4FW2A 5GANh 3EG9A 5IT9c 3OYCA 3OYYA 4F16A 3X3NA 4BBRB 3ULRB 2YYZA 4H13C 3DB4A 2XMFA 1CQVA 2EBPA 4B9WA 5CCAA 5GAMg 4A4EA 4LF7L 2RHUA 2GCXA 2EYPA 3QOJA 4YCWA 2F0LA 5KNBA 1KFZA 4LNPA 1UUPA 2KBNA 4VUBA 4EQ5A 2LSSA 4E7KA 3NQTA 3G4ST 4QGUA 5C3EB 2WSCE 2OT2A 3K5LA 3PO3B 3G71Q 4BY6B 3G48A 1IL2A 3CCJQ 1MBYA 1G51A 4A3DB 3VS1A 4ESRA 2F3IA 5CGKA 1ENAA 1JEGA 2LKVA 5IGBA 1YITQ 2R7ZH 1RLQC 1I5FA 4DR6Q 2Y0SG 1OXVA 2DMOA 1KLGD 4JJDA 4ID6A 1OZ2A 2R92H 2ZXRA 4MN3A 2NZ1D 5C4ZA 2DUDA 4QVDA 3G4SA 4JI3Q 4RG2A 4X66L 5EJWA 2NUTA 1OX8A 4LW1A 5JVH3 1C0MA 1VQ8Q 3BYYB 2GQIA 4KJNA 2VUMG 3KFUA 5D6WA 3I56T 4C92A 1IBLQ 1RUWA 1M2OA 3EGDA 1Q86C 5KYUB 2JXBA 4TSSA 4DF7A 3S1NB 3KF8A 1JQYD 4V190 4B3SQ 1HK9A 3R3OA 4FIBA 2HIXA 5GMKj 1Y1VB 5CMDA 4KUDK 2GA4B 2NVTB 1TS4A 4IJLA 5KYWA 4M7AG 4MTKA 3TZUA 2EKOA 3RDVA 1PH1A 3OYFA 2ZTEA 1EFNA 1O7ZA 5FRMA 4CDFC 3I56A 2AUJD 1BI1A 4D8DA 1WCMH 3SHLA 4A3EG 4M77E 1WVLA 4Y52H 3CQZB 2VGNA 2EYZA 2DNUA 3MEFA 3ND9A 1M4VA 1SFOH 4XTXA 2R58A 3A8GB 2QDLA 2FHDA 4N4HA 2CP5A 4KHZA 4IZ8A 5CORA 2GF7A 3OYJA 1VQ6Q 3RNJA 1JJ2P 4ELYC 2NYZD 4C3JG 2COZA 4X1VA 4RCCA 3EG2A 1BOSA 4IUQA 1ABQA 1MHWC 2R57A 2IL8A 4FXKC 3JB9G 2IPKD 2E1HA 4JI8L 2J06A 3E9GA 1RACB 3DB3A 1M1KC 4V2SA 5LJ5d 1HUMA 1S5BD 2FZKB 3MJXA 3R2IA 2KY9A 4JJNK 3Q24A 5I2SA 2VXFA 2B2YA 4DV2L 1HH2P 1PZID 1VQKA 2EE1A 2QDYB 3I55T 2BDOA 2F0DA 3FKIH 5ELFA 1MMNA 2QXFA 1LJOA 3H0FA 4JZ3A 3OYKA 1K0RA 2D0PA 3TZDA 2ZPFB 4DK6C 1JORA 1J9OA 2NUZA 4V0BA 4KI0A 3BG3A 3R8BA 3X3MA 1MKHA 3KBXA 5IIFA 1WHGA 3I90A 3UE0A 1TS5A 1PXUA 2D8JA 3GV3A 2P5ZX 2WV6D 3T1YQ 4C8QF 2VW9A 2RHSB 1CUKA 2KXCA 1EYAA 2IJ0A 1K0XA 2JUFA 3I55A 1NAPA 2OQKA 4NXNQ 5KYLA 2HDAA 3M0PA 1SAPA 2PW7A 1BXTA 2NVYB 1SEBD 3HHTB 2XIWA 3NXWA 3U9OA 2DIGA 1I4XA 1HQMC 3CCUA 2HDMA 3EQLC 4AFUC 1AP0A 4ULLA 3RERA 2CP0A 1TQOA 5JJLA 4LF9L 1CA6A 4ZGJB 1VQ7T 1PZJD 1LACA 3I72A 2RBMA 2KQWA 3BFMA 1MGSA 3NELA 3CCRT 2C5CA 1F1BB 1IREB 4B9XA 5D3IB 1D1BA 1QCFA 4J9EA 4EMKA 4PZ6A 1CSKA 2LQWA 2JS2A 1BCMA 4HVWA 4C8QC 1B53A 5FO8B 1BBUA 3MP6A 1T9HA 1S72T 3OIQA 4PZ8A 3DM1A 5DAUA 1HD3A 2LNVA 1Z6HA 4DV0Q 1YJ9Q 1KQSA 3X20B 1Q46A 1CSQA 4HEDA 1KIXA 1L1OA 1PFMA 2A6ED 1TY0A 4KRTA 3CCRA 3STBD 5C5MA 3QUIA 2D6FA 1FX7A 1B9NA 1LTBD 3TQ7P 1JBMA 2RF0A 2EDGA 1G2BA 3L2ZA 1Y8PB 3QBYA 2KCMA 3QZ5B 4H44C 2QEJC 4X62L 1JXMA 4PZ7A 1UDLA 2EQIA 4HKEA 1S72A 1NMFA 2HT1A 4BY7B 2HQXA 3ZEHA 4CI0C 3CCSQ 1EOVA 4XQJA 5CQXA 2C06A 1TU2B 2VXWA 2A68D 4A3LG 1F77A 3NE5B 1SHFA 1X6GA 5J26A 4R0KA 3NFCA 2P0QA 4WJWA 1J5EL 2UUAL 1PLFA 2IX1A 3D3RA 4HN7A 4LXCA 3G7ZA 3KFVA 2RA4A 1O7YA 4RMOA 1H3ZA 4MMKA 3NTHA 4HCKA 2X4WA 1D5ZC 2O4XA 1FNUA 2F0UA 4POFA 2UXDQ 1GJXA 2KEEA 5A2QL 3PGGA 5C44G 2JJ9A 4IURA 2K6AA 4JG2A 1N27A 4L5TA 4UP7A 3UPUA 5IGFA 2RI5A 1S40A 2PUOB 1D5XC 2AMCB 2CVRA 4G7ZC 2PW5A 5ELDA 3MWYW 3PUWA 1K1ZA 1AWJA 3EHRA 1QUQA 2GN5A 1QZHA 4DUZL 3PMTA 2LXJA 2R7ZG 3M9BA 2V26A 3SEMA 2E3HA 4N8FA 2EYQA 1JJ2S 3OTOQ 3S16H 1D0XA 4JRIA 5DM73 1Q86U 1Y07A 1ZYRD 1YI2A 1IYUA 2D0OA 2J6FA 5GAN3 3H0HA 2DXBA 2RMOA 1KAAA 2DPPB 1HSQA 5FLXc 5BR8Q 1N9WA 2AKWB 3TMEA 3TS2A 2K5VA 2J4XA 4GZYC 3IRBA 1I6HH 3VV0A 2BZXA 3AU7A 5IGDA 5AT1B 2ZT9C 3S2HH 4M77G 3N52A 3LX0A 2IHFA 4DBFA 5FO9B 1UJ0A 2DILA 1E2VA 4DQ2A 2L12A 4O42A 3WDNA 2ESWA 1B3QA 4B3RQ 4EQNA 1DYQA 4N4GA 1QVPA 5KNDA 1F2ZA 3PIPA 5IYBG 4HCSA 1I4QA 2ASBA 3BDCA 1AEXA 3GOXA 3X25B 5ELEA 1FJGL 1ET9A 4ZGEB 3RLFA 2RN8A 1WX6A 1J5EQ 1LT5D 2MP1A 3I7FA 3OIPA 2OQ0A 2NVXH 5CBEE 1KK7A 1FL0A 1XX8A 1LM0A 3MHBA 3M57A 1GCQA 3CU7A 1S3OA 2KXDA 1M1KU 3CC2A 3J81c 2CZ6B 1KQSP 5EKKA 1E0BA 1TWHB 3NHNA 1J3TA 1S1NA 1I4RA 5IOCA 5HY6A 3GLXA 4JRPA 2EOTA 3HG9A 2VUMH 1WTPA 5CV6A 1SDFA 4RTZA 2WACA 1K0SA 1OULA 2YV5A 1VQ9Q 1G91A 3CMAT 3EH1A 2B2VC 2F1LA 1R77A 2FJ2A 1AEYA 4J6YA 1QZGA 2PMZB 1UE9A 3H0GH 4ALPA 2A69D 2HMAA 1IHVA 1E7OA 1YJNA 5C4XB 2PTKA 2FINB 3CCMT 3E0JA 4KGXB 4LNQA 1ONLA 5IYCH 3C94A 4K0KL 4ZN1A 3DXJC 4H0LC 2WB1G 4AYBE 1NLPC 5KE3A 2K03A 3CMAA 2JA8H 1PZKD 3RKXA 1NYGA 3MFYA 3SXHA 4OMMA 1H92A 3H15A 5JEAH 2J05A 3HOXG 1SSFA 4MDXA 4EQOA 1BBXC 4XYQA 1WHKA 3EFSA 2BTTA 3FIFA 3A8KE 4PJOA 3HP3A 1KJWA 2CQAA 2WINB 3FMCA 2IHEA 3OHXC 4QQBX 2YUOA 2VL6A 4O6JA 4FYYB 1K3BC 4A76A 2LMCB 4PKCC 3S3NA 3HOZB 3M59A 4M4ZA 4JI6L 1Q3LA 5LJ5j 3NP8A 1G3WA 5CV8A 4MDWA 2KHJA 3O8VA 2FRYA 4GLKA 1Q12A 1TKWB 1M9SA 4HJ7A 3T13A 5GROA 3NGPA 4X3TA 2DO3A 4DOWA 1X69A 1ZQ1A 3PFSA 1V1PB 1XTCD 1OV3A 4KTAA 4YHHL 3MHXA 3I73A 2R7FA 3GV6A 2EXZA 2B86A 4L63B 4JBMA 5C4JH 2ROLA 4PV1C 2CKZB 1UB4A 1JRIA 5JJZA 3M4QA 4TVAB 2LCCA 3E1SA 1GXIE 4M7AA 1D0ZA 2Z4HA 4HR7B 4G7HC 1N36Q 1HA5A 1PVOA 1YNND 3V7RA 3TSSA 1PM3A 2M02A 1OI1A 2SEBD 1PTOB 1IGUA 5K5PA 3S1QB 1Z9QA 2EJGC 2OAUA 5IH2A 3OWFA 3Q23A 1R0BG 3MXUA 2CCZA 2QA4A 2RQRA 1H9SA 1I4PA 5E7NA 1VMPA 4NP5A 3U4ZA 3DWPA 2OAWA 2V8IA 5LMNL 1DJ7B 2E2HH 4F04B 2B8FA 1JWUD 1F9RA 2KROA 4RKLA 4TRDA 4UP9A 3SWNA 2X3XD 3MEVA 5EKIA 1VDZA 3HOVG 1OO9B 3AQQA 2P4RA 4QQ6A 2L3RA 3OPOA 2ZPBB 1EUJA 2F0QA 2K5HA 3A74A 5E4WC 2WP8J 5FW9A 1I50B 4KHPQ 1X43A 4EGVA 2AHJB 1K28A 3DWAA 4A3FH 4FNFA 1R9TH 5I22A 1HFNA 2LCSA 1OXXK 5CO7A 3ER0A 2L2PA 1EY9A 2MK5A 4JI6Q 1DZ1A 3RKWA 2FO0A 2CSQA 4FF4A 1C4QA 2OTLQ 2JTFA 4FP5D 3LLRA 2JN4A 2JS0A 3F70A 1KQSS 1AWOA 5J3BA 3VUZA 4GKJL 2E41A 3M4GA 1VQLQ 1M8AA 2LS01 1V1QA 4CRIA 2BA1A 3D4RA 2DL5A 3RMHA 4KD3A 4LF6Q 1YJWQ 1VQNT 2RK2A 5LJ3d 5AYFA 4N9TA 4LFBQ 1RAGB 4DR4Q 4A3BB 2JA6B 2LJ0A 3H0IA 4FYVB 2KCNA 4F8MA 3OBYA 1V1CA 2KT8A 5AFWA 2ID0A 4CC2A 4ZUJA 3D0FA 5TSSA 4C3IB 2RQTA 3LWUA 3L2VA 5I11A 5A0DA 4QUCA 1WHJA 1EY7A 2CP7A 1VQNA 3U4VA 4FYXB 2FYKA 4EX5A 4K5XA 4MTNA 3JCMd 3IFTA 5EG2A 2NVQB 4DR3L 2MWPA 3OYMA 4J6WA 1EY6A 1SSOA 2O31A 1C7YA 4TQUS 2Q8IB 5HK0A 3M0RA 1EQRA 1F9PA 3DHQA 1ICWA 4Y7NH 2CS7A 3V8LA 4OIKA 3Q0AA 4N4IA 4WJ4A 2QEXQ 1EIFA 1YCSB 1ZSZC 1ARKA 1SNOA 3S1RH 1PTOF 2K32A 3TRZA 1MMGA 1SLJA 3I8ZA 1XJWB 4XYOA 1G6PA 5HGTA 1K73U 4YWLA 2B3GA 2PNIA 3BY7A 3QO3A 4C92G 4DK3C 4LFCQ 5LMNW 1QW1A 4LDWA 3JB9F 5GAOn 3RR5A 3J7A5 1IBMQ 4ZLTF 4AYBG 4U68A 2QK0A 2JN0A 4KJOA 4DXFA 2X3WD 1DM0B 1FGBD 1PRTB 3CRLC 3HFZB 4CKEA 4A3KG 5M5YB 2F2WA 2ZZDA 4HJ8A 1X2QA 2A7YA 3G6EA 2IW3A 4RCNA 1HNWQ 1OPKA 3LH5A 4HMJA 2F0MA 3UDFA 1PTOC 5GANf 4X6AH 4LF8L 3OYAA 4CDCC 3SWNC 4QW2A 3K6OA 4S3SA 3IFDA 2F2XA 2QGQA 4OMNA 5KCHA 3NWSA 1V9PA 3PUXA 2JA7H 4EPCA 4XXEA 4HT8A 3T9NA 1ZA1B 1YFNA 4PJMA 5DEHA 1PA6A 2JA8G 3M3YB 3L0OA 2R92B 2O9VA 2MPXC 2KT1A 1QVGA 4M78B 2PI2E 5JEAG 3J80c 5GMKi 1ABOA 5ELBA 5JPMC 2OTJQ 1QB5D 1TUCA 2AZSA 2KR3A 3PO2G 1U1SA 1O75A 4LUEA 5KH6A 1YEZA 4FXGC 2NTSA 1SXTA 2CZ1B 3GTGB 3PIP3 2ZGWA 2DVEA 2WSFE 4FU6A 3RZDB 5KYYA 3P8BB 5GAMh 2RF4A 4N0AA 4JUVA 1X6OA 4GLXA 4JI0L 2K3XA 4JYAL 2KE9A 2L9HA 3GBQA 3Q8DA 3OYDA 5T1GA 2DJFC 3MKDA 2C9OA 4DGZA 1M2VA 2RD1A 1E6GA 3CP0A 4F87A 1WCMB 4A75A 1NBWA 4JPBW 2LQ8A 1AZPA 1MGQA 1WPYA 1EZ8A 4DUYL 4IPGA 3S2DH 2SOBA 2LC4A 1CKBA 1A63A 2DNEA 3S15H 2KOLA 2PQAB 1TXYA 1EIHA 4KY6A 3BDLA 4A93B 4FDBA 1KRTA 3CCQQ 3TP8A 1G3TA 3LW5E 2K28A 2DBKA 1IBKQ 3T51B 3D8GA 2XICA 3LX7A 2OI3A 4KH1B 3R2TA 1BVSA 2EYWA 3QSUA 3C2PA 1KD1R 1CT1D 2XK0A 2FFKB 1HR0Q 2E12A 4X9DA 3HKZB 1U4MA 1EZZB 5FU6B 1STGA 4KK7A 2DJGC 4DBHA 2HD0A 5M5WH 3GNGA 1CKMA 3T4AC 2MWOA 3EGXB 3RKYA 3KK7A 1I4K1 2FPEA 2EYLA 1HNXQ 2JEAI 1SYGA 1Y1WB 2L3SA 1I94Q 4UY8C 3FKIB 4JI7L 1PRTF 2DGYA 2CHBD 4KN7C 1HHVA 3VA5A 1RODA 2RHIA 4X34A 1I3QB 3U9SA 3EJIA 2E75C 2HKQB 1BYMA 3OW7A 2XVSA 1WHHA 1I5LA 2XDBA 2PU9B 1ML0D 2RI3A 2W0ZA 1PYWD 1PMRA 1VQOQ 2Q2HA 2WAQG 3J81L 2PQEA 2JW4A 1WD1A 1WFWA 4IFDI 3BZCA 2JM8A 1L0WA 4JBKA 3HL8A 1Q8KA 1R4PB 4ZNXA 5FLMH 5M5XB 4A3GH 1BCPD 3S6WA 1PRTC 3MA2B 1S5DD 2F4VQ 1YIJQ 1X2KA 2TSSA 3CF5A 5C5LA 1FGUA 2C0TA 4BA2I 1JOQA 2MUYA 4DV1Q 4DV3Q 4A3MG 1RADB 1Y7XA 1Q7YU 2HL5C 1SYCA 1Y96B 1VQ4Q 1PDQA 4IN3A 1AN8A 3BE3A 1E7ZA 3RLNA 1XNQQ 2RSOA 4M77F 3C1FA 3JRZA 4DR1L 3T53B 2QQRA 1BQQT 5I2YA 4IOAA 2RB6A 1QVGP 2RJFA 4M75E 3WOEA 1RD9D 4C3JH 2OWOA 3CMEA 1TR5A 5J39A 5CV5A 2EAYA 1E22A 1B50A 2D0NA 2QF7A 2EYMA 3QG1A 1FD7D 1KQ2A 2L5TA 4LFAQ 2HEQA 1N34L 2KCCA 5CYUA 2FPFA 2RHYA 3JCMW 1IW7D 2PZ1A 1KSWA 2HCCA 4DV7Q 2EGCA 1BI3A 2DYBA 4KN4C 2RK1A 5CKFA 4M77C 4I7AA 4LN2A 3S3OA 3K81C 4JOIC 1TS2A 5D3DA 4C56C 1CZGA 5GANj 1YBYA 3GTJH 1TT2A 2X4XA 3I35A 1PG5B 1U5SA 5IE8A 4OGEA 3K59A 3L9AX 4GNXA 1WQWA 3W2DA 4ILWA 1GFCA 1VQMT 3EFOB 2E76C 2F0OA 3G4SQ 3L7ZC 5LJ3j 2JOYA 1EQVA 1BBWA 2EXDA 3HZXA 4FYDA 1GUOA 4DAPA 2LQNA 5A2QE 1N9SA 4FCYA 1U4PA 3GTMB 1N8RU 2I07B 4J15A 3IAYA 1YNJD 3NSWA 1HUNA 3H6MA 3QO2A 4ME7A 4R4OA 2GVAA 5EQ0A 4DAYA 1W2BP 1YHQA 4JJBA 4CBVA 4KY5A 1IRXA 2EYXA 4J6XA 2LX7A 4DR6L 3TVTA 4JRQA 3BYTB 3P7JA 3S16B 3I56Q 2JK8A 2QKIC 5LJ3e 1D2BA 4H02A 1MD2D 1RI0A 5CAIA 5EKLA 1M8VA 4CDEC 1RL2A 1ZLMA 2LNHB 1M4ZA 4HCZA 2EYHA 4P71A 4JI3L 3JAMc 2NBFA 2DTHA 1VQ5T 3KDFA 1IXRA 2I0QA 1B7TA 3Q22A 1IBLL 2JTEA 1DXMA 2I5LX 3VYRA 5H1SE 3JV3A 4E6IA 4IIOA 2A74C 3P1HA 2A28A 1WI5A 4JC0A 2JJQA 3SK8A 2CREA 2BH8A 4PMBA 3EG9B 4B3SL 1DONA 2EKHA 1D1KA 2A37A 4RHRA 3JCMe 3O13A 3FJ5A 5GAN8 2QYZA 3GTPB 1HA6A 1QCNA 4M7DD 1D3BA 3RESA 2EY6A 1VQ5A 1BK2A 2HBWA 5I21A 1VQDA 5IXBA 1XMOQ 1ZUKA 1TXQA 1UTIA 3EG1A 4K11A 2YU9B 2E2JH 4A3LH 2L89A 2R93B 5M3MB 2V1RA 4IUTA 3VS0A 3E5SA 4C3HG 1RF2D 5JAVA 1PV4A 2O5IC 1W6KA 4M7DE 1RTNA 2Q2TA 2JTMA 1GOZA 1NY4A 1RDPD 2H1EA 3E2UA 2MPMA 3AMUA 4Q5VA 1JXOA 2FMCA 3J81j 3MO8A 4O0AA 1AH9A 2DN8A 2K3YA 2KRSA 4HCEA 2KUMA 5IN1A 5C44H 4LMQD 1UFFA 1PSEA 5CC4A 4QY7A 3C3LA 1UECA 2NUTB 4OELB 4PJOG 3EHQA 1ZUUA 3WWVA 4DU9A 1XPRA 4C8QB 1AFPA 2V8JA 3EGDB 1BDOA 1AE2A 2RQWA 2E2IB 3KF8B 3VS3A 2DRMA 4K8JA 4KLKA 3H0GB 1P92A 2MMPA 3PT9A 2B2UA 4IFDH 1C6VX 4P5NA 5KYWB 3A8HB 3M55A 1VA7A 3RN2A 4KULA 4XU1A 1HQRD 2KHIA 3I4NB 1NE8A 4AT1B 1UHFA 2K33A 1UEBA 1LOJA 3PGZA 1SE3A 1SG5A 2ED1A 4P2CB 3OB9A 1KD1C 3MP1A 3T1YL 1Y71A 4DBRA 2F0FA 1PHJA 2RM4A 4NXMQ 3HOUH 3TN2A 5IT9E 1VQ7Q 1CHPD 1QNKA 5FLMG 4J7IA 4NXNL 4A3GG 2XNAC 1K83H 2K3BA 4M75G 4C5IA 4D8KA 2F4IA 5CR3A 4AG1C 3VR3A 5IYBH 2F03A 2LZ6B 2OJ2A 2ALYB 3DM3A 2WIIB 3S17H 4OF1A 4M78D 2E6ZA 1S72Q 2I46A 1EY0A 2X4YA 4ME5A 5EAYA 3GTLB 1R0CB 2K5DA 4CJ2C 4NPSA 4DK1A 4MHEA 1SF9A 2K01A 2Y4YA 5GMKe 4JS4A 1KL9A 4KH0B 3TREA 1D8LA 1VQKT 2Z4IA 3MZ5A 4DV0L 1W6XA 3A8IE 1RAIB 3OMGA 1HYOA 2RDGA 1MV0B 2L3QA 2YUQA
chains in the Genus database with same CATH topology
1YVCA 3A5UA 4F7UE 3AYHB 1UGSB 2BKDN 2JEBI 1XNRQ 4Y28E 3NBHB 1N33Q 5CKHA 2DZCA 3M56A 3CCUT 3RN5A 5FU7C 1WFQA 4GY5A 3OYIA 3UDXA 4LD6A 1OYXA 4WF2A 3E9HA 4C92F 2YLCA 3CC4A 2UXDL 2I5HA 4A3JH 1BIAA 2QI2A 3HOXH 2E5LQ 3OYLA 4XU3A 4HIOA 5CKEA 3JCMP 4DV6L 4A4GA 4J7FA 4MZPA 1JB7A 3OTOL 2EQJA 2VYTA 4C92C 1K8GA 3FDRA 3K7UC 2D62A 5BR8L 2KENA 2E8GA 4PNOA 4DV5Q 1YITA 4FM4B 2XD0A 4B3RL 3VUBA 5IYDG 1G5VA 1VQ8A 4OXPA 4XTZA 2L15A 3VDYA 2O4XB 1QVCA 3TQYA 2RJEA 1U0LA 2ZTDA 1PH7A 5FRNA 1GVPA 4DR2Q 4OWWB 3LWHA 1PHJA 3HRUA 3KF6A 4XU0A 5GAN6 2HQLA 2ZCFB 1YI2T 3HOVH 4GN5A 3TS0A 2LRQA 2CZ7B 5GAOm 2JZ2A 4DV6Q 2K5IA 1VQ6A 2R5AA 3PTAA 3ULJA 4GOPA 3HOWG 3SDZA 4BBSH 3ASKA 4IFDG 4LD9K 2DK3A 1HZCA 3HOYH 1TWFH 4Z02A 2RH2A 3OY9A 4XTYA 3W1BA 3HOUG 2PI2A 3OSVA 1G291 2DAQA 4O2DA 4JCVE 4EMKC 3QZ9B 3CC2T 1WJJA 5IWAL 2E10A 5LJ3g 3FP9A 3CPFA 4F7UG 4A4HA 2FL7A 1MHNA 1I8FA 4BE0A 5HK3A 3FJPA 5M9OA 1L1OC 2M1HA 1WJSA 1Y14B 3CEYA 2I5MX 4XIGS 1VIEA 5GQOA 2EQMA 1YJNT 4YCVA 3JCMg 2JA5H 2AWOA 4KUIA 4HIDA 5GAMf 2K52A 1GO3E 3OBWA 5FLXE 2DIQA 1N36L 1HZBA 4BBRH 1IYJB 1YJ9A 4A3KH 1E24A 2ZPEB 3E9IA 3L2PA 4C0GA 4P75A 3OYBA 2VY3A 2Y90A 4HJAA 4JV5Q 1SE8A 2NN6G 3JB9J 3PO3H 2RJCA 3GO5A 2ZJQA 3K80C 2ZJPA 4A3JG 2EQKA 3S14H 3QJ6A 2PVGB 1M90C 4C8QD 4DR7Q 4KHPL 4IUVA 1A62A 5IWAQ 1EYGA 4QVCA 3PO2H 3LYIA 4R4QA 1PYSB 1X56A 3J81E 2LVMA 4IPHA 4C8QE 5CQYA 1VQJA 2RCNA 2L5QA 2M0OA 5C6SA 1K8AC 4M7AB 1N9RA 1LUZA 1KG1A 1Y1VH 4LF6L 2NVTH 3CBOA 2QA4T 4C0FA 4LFBL 4DR4L 2NZHA 5I2MA 3RZOH 3OMCA 3CQZH 2LX9A 1XPUA 4NB3A 4M75A 2B63G 5LJ5e 1VQGA 3TEEA 2ZJRA 3SWNB 2D9TA 1SROA 3L2WA 4L5SA 3GNFB 3W5OA 4XQ3A 2PUKB 4OO1I 5GAN2 3C12A 2K4KA 3K0XA 3HFOA 2K4YA 3SD4A 5LL6S 1NJIC 3JSCA 3CC7T 3BZKA 3PF5A 3A0JA 4IKFA 4LFCL 1UGPB 4II1A 1IBML 2UU9Q 4PJOF 4JI4Q 2VXEA 5GADC 2VQFQ 3K7AH 5GANd 3EBEA 4OGCA 4HJ5A 2K5FA 1X54A 4BBSG 1HNWL 3CC7A 2LTOA 1KC8C 3HOYG 2E6NA 4BXXH 2VC8A 4A3MH 4PJOC 3X26B 1UE1A 3KBGA 3CAMA 2N78A 1KXLA 1OXUA 4BE2A 2EIFA 1VQPT 1C0AA 5GAOl 4M7AF 5IY0A 4APVA 4DPGA 1CKNB 4TVRA 4JI5L 3MEAA 1GKHA 2ZTCA 5A0LA 3OYEA 3J81i 1VQPA 3G6ET 3UDGA 4YWMA 4M7AC 2JA5G 4M75C 3CBMA 3JCMV 4FT2A 2DTIA 4M7DA 3GF5A 1Z47A 4GN4B 1X9NA 3J7A5 2B29A 4BBRG 5AJ3Q 4YY3Q 3Q1JA 2KCTA 1IBKL 3M4OH 1GM5A 4ZGDB 4L5QA 1VS0A 1XMQQ 2JNGA 1HR0L 5C3EG 3PO3G 1YZ6A 1OTCA 4A3DG 3RMSA 3DLLA 1HNXL 1I94L 4R55A 1N32L 5GAOq 5LMUQ 4IOCA 3U58A 1XPOA 5IP7H 4M77B 3AEVA 3GDEA 4ME3A 2P0PA 4DAMA 4ZTJA 3INZA 4JI5Q 4YCUA 2CGHA 1UE7A 4JBWA 3KXTA 5C0XI 4RCBA 2F4VL 1Y1VG 4J83A 3FHWA 4DV1L 4DV3L 4C3HH 1XNQL 3META 2Z6KA 1X3EA 4C2MH 4OONA 3KLWA 2OTLA 3BU2A 4UP8A 2PQWA 1VQLA 3H8ZA 5CKBA 4M78A 3VJPA 2PVOB 1YJWA 3JCMb 3L2UA 4E7HA 4LFAL 3J80E 4F7UA 1W2BA 4LUVA 4DV7L 4JS5A 1NJIU 1Z9FA 4DA4A 3NENA 4R4TA 2ATWA 1LYLA 1TWCH 4DKAC 3QIIA 2WSEE 3J7AF 3ZJYC 1JB0E 2N49A 1N32Q 5DLQE 3F8TA 4ELZC 5GAGC 5C4XH 2UXBQ 1KC8U 4GN3B 1EQQA 3F2CA 2QEXA 2K5NA 4ATOA 3EAEA 2K50A 2PMZE 4QQDA 1MJEA 1NPRA 2QQAA 3CMET 1GD7A 1WJQA 4BXXG 5DLOA 3I2ZA 3MP8A 2DXUA 3S1MH 3H3VI 3DKMA 3CXCA 2EQUA 3L2RA 1X65A 3HRTA 1PH5A 1ZBXA 4ZTFA 4B3TL 2Y0SE 4X64Q 5JJIA 3F1ZA 4R1JA 2HQEA 4BACA 1FWZA 4N0AC 4L59A 4E47A 4C5HA 2HIVA 3CD6T 1HJPA 1PH9A 1NZ9A 1V29B 3ERSX 3CBPA 1UWVA 5GAEC 3R6OA 5KCOA 3CCVT 3QHSA 2EFIA 1U5KA 2H5XA 2CWPA 2VGMA 2Z6KC 1B34B 2B8AA 2QQ9A 2FB7A 1XMOL 3LWIA 3M7NA 1C9OA 4BY7G 1N6AA 3C4SA 3CD6A 1E1TA 3OYHA 5LJ5g 4C0DC 1YHQT 4XTVA 1E3PA 3EIVA 4DAYB 2UXCQ 3RLOA 1Y96A 4DR5Q 1QP3A 3CCVA 4A3CG 1V43A 2YHTA 1L2FA 2L8DA 3JB9D 2EWNA 3HSBA 1VQEA 4OX9Q 5GANe 2NN6I 4IPCA 2LDMA 2EQSA 2HHHQ 1QP2A 1FVIA 1HNZQ 3KDFB 1AHJB 5CVIA 3I4OA 1KRSA 2XDPA 3CCQA 1NPPA 3GD7A 3J80i 4DV4L 2V1CC 4QQGA 3ICEA 4B3TQ 3T1HQ 2G3RA 4LDXA 4MNOA 2A19A 1NTGA 4B3MQ 3X24B 2IT1A 1D3BB 3FEOA 1B70B 5IP7G 4QVZA 2DXTA 4R56A 4NXML 2EJFA 4X65Q 1BKBA 4A3BH 2YRVA 4OB3B 2JA6H 5IYDH 4Q5WA 3VKIA 5JEAJ 2GFAA 5FU7B 3L1AA 5CK9A 3QYHB 4C3IH 4JI1Q 1VQOA 2P0KA 4JDSA 4IPDA 1HZ9A 4JI2Q 1QVFA 3EFRA 1YIJA 2NVQH 4OO1G 1G3SA 4OB2B 1JE5A 2MO1A 4A54A 1VQ4A 3OW2A 3STBC 3JAME 2E64A 1O7IA 2R7DA 4C92B 3PSIA 3D31A 1RIPA 1SMXA 1XNRL 2YTXA 3UE1A 1N33L 4GNXC 3HOWH 1QVGS 4DV4Q 2OCEA 1X3FA 3OYNA 1KHCA 1PH8A 1VCIA 2LT1A 5IP9G 5M5YH 3CCLT 3BJUA 5LJ3h 1UGRB 4PMWA 5C4XG 1D7QA 2CZ0B 2XU8A 2KMTA 5FJ8H 5HGQA 3H3VH 1PYBA 2E5LL 2UUBQ 2DXCA 3M3YH 4AQYQ 3CCLA 2ZM6Q 3JCMh 5CR2A 1YCYA 1NE3A 1ZHIA 3JC66 3HPWA 2ES2A 4C8QA 1TWGH 1NMGA 1UGQB 4XAXB 3PUVA 4LF4Q 3GTGH 3RZDH 5DY9A 3HOZG 4M77D 4M78E 5GAHC 4DV5L 2V8KA 1W2BS 3L2QA 2DKGA 1TH7A 3QDRB 5GAN4 1B7YB 2VQEQ 2BIVA 4LDVA 2KVQG 2A3LA 2RHZA 4XK8E 2MAMA 3AFQA 3CPWA 3CC4T 4BB7A 5ELNA 4LF7Q 4A93H 4HT9A 3GTOH 4DR2L 3BW1A 2D0QB 2YTVA 3ULPA 3ZFJA 4EMKB 2XIDA 4LUOA 1UE5A 3G71T 3CCJT 3P8HA 3L42A 1Y1WH 2XHCA 4RG8A 3SGIA 3VU3C 3CXCS 1YITT 4X66Q 2JVVA 3X28B 4BDYA 4UP9A 3M4PA 3QJYA 1L1OB 3HKZE 4J8OA 3E19A 1I3QH 4E7LA 3PCOB 2H3JA 3A5ZB 3JAMi 1KAWA 3G71A 1VQ8T 2JA9A 4BD3A 3CCJA 5M5XH 3HFNA 3MCAB 3CW2C 2PVDB 3V8JA 5C0XG 2FXQA 5GMKh 2CYZB 1R8OB 2ZPHB 2RJDA 4M7DG 3LGLA 4LF5L 2F5KA 2WB1E 4BY6C 1EWIA 2IVWA 3ME9A