1YBYA

Conserved hypothetical protein cth-95 from clostridium thermocellum
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
185
structure length
176
Chain Sequence
b'MISAGDFKNGVTFELDGQIFQVIEFQHVKPGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation elongation factor P
publication title Conserved hypothetical protein Cth-95 from Clostridium thermocellum
rcsb
source organism Clostridium thermocellum
molecule tags Translation
total genus 29
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ybyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ybyA02
4RG2A 2KBNA 2UUAL 4GNXA 4B3SQ 4BA2I 5JJLA 1HZAA 5J26A 2VS1A 2VW9A 2LVMA 1V1QA 2Q2TA 3SGIA 3F2BA 1SROA 1MJEA 3I55A 2VY3A 4K0KL 1T9HA 2RCNA 4PMWA 1Q1BA 5C0XI 4X66L 4ME3A 3RLNA 1FJGL 1PH4A 4JI4L 2ZTCA 1VQKA 3D0FA 4HJ8A 1XMOQ 3AFPA 4IFDG 1QUQB 3G6EA 2Q2HA 3UDXA 1V9PA 1X3EA 1LYLA 3BZCA 2VQFQ 4B3MQ 3PF4A 4LFBL 3D31A 2F4VL 2AHOB 4JI8Q 2I5MX 3J81c 4B3SL 3M4QA 1KXLA 2CWAA 5E7NA 2QEXA 2CWPA 3F2DA 1JE5A 5C3EG 1HR0W 1NPPA 4JI1L 5IP7H 3RZOH 4A3BG 4HIMA 4GOPB 2XGTA 2KHIA 1A8VA 1CKNB 4BA1I 2UUBQ 2B3GA 2IHEA 3UDIA 1XNQL 4LFAQ 1RIPA 5IYCH 3BJUA 1XMOL 3PUWA 2VQFL 4DR1Q 3HOYG 3T1YQ 1N34L 1TWGH 1XTDA 1KRSA 3S24A 1G51A 4JI8L 3AFQA 1K73U 3CCQT 3CW2C 5M3FG 1KHIA 3CC7T 1OTCA 3AYHB 1HR0L 1XJVA 4YHHQ 4GOPA 1L2FA 4UPAA 1WJJA 4UP9A 1PH6A 3KYHC 3CPFA 1CKNA 4LF8L 3GTGH 4EX5A 1K8GA 2IG0A 1VQ7T 2CKZB 4LF6Q 1O7IA 1E7ZA 3CD6T 1VQHA 2GVBA 3U4VA 1VQMA 3CCJT 4TVAB 4HJ7A 4DK6C 2UUBL 1IXRA 3ER0A 4BY1H 2YTYA 3CCUA 4KI0A 4IFDJ 3GDEA 4DR4L 3GO5A 3I4MG 5IT9E 3S2HH 4GKJL 5IYBG 1CSPA 4DUYQ 4P74A 2JNGA 3ULLA 1N9WA 1IBKL 3S16H 4A3GG 3I4NG 1K9MC 2Z0SA 5IWAL 5FLMH 3HOZH 2VZAA 3G4SA 2I5LX 4YHHL 2OCEA 1Q86C 1EUJA 1VQ6A 3CMET 2NN6G 4LF7Q 1P16A 1UEBA 3CAMA 5M5XH 1X54A 4RG1A 2JA5H 4JBMA 1Q46A 4LF6L 2QA4A 1JJGA 1VQOT 4DV5L 2UXDL 2OTJA 1IBMQ 3TRZA 4A3DG 1X56A 5GAHC 2VUMH 2MWOA 4IFDI 2K5VA 2NZHA 1J6QA 2CFMA 3A74A 2UUCL 1B8AA 1AH9A 3KDFB 3STBC 4DV2L 1L1OC 3CCRA 2H5XA 3DM3A 4JI2Q 4DUYL 1K73C 1S40A 2D0PA 1TXYA 2XHCA 5IYDH 1ASZA 3L0OA 1CUKA 1EOVA 5C0XG 3HOWG 1H95A 3M4OH 4BXXG 1M90U 1CKMA 1X3GA 1QZGA 1FVIA 4JC0A 2WFWA 3OTOL 2PI2A 3NEMA 4X62Q 3AQQA 1NMGA 1AE2A 4A3CG 1AE3A 1KL9A 3W1GA 2PI2E 3ZJYC 1LUZA 4JI3Q 4IPGA 4JYAL 3I56T 1K8AC 1K83H 1Q12A 4QJFA 4DAMA 3VDYA 1IBML 3HOUH 4BY7G 3CC4A 1YZ6A 1S72A 2PMZE 2R6GA 3K7AH 3K80C 4LUZA 1L0WA 3JAMc 3PUXA 3KF6B 3J81j 4LF4Q 3KBGA 1SRUA 2WAQE 3GTPH 3HOVH 4DR7Q 2A1AA 4OONA 3BU2A 4YWMA 1MIUA 2HIXA 2WAQG 3EN2A 4R1JA 1A0IA 4ZN1A 1VQJA 3AEVA 1M1KC 5M3MG 3CF5A 2EXDA 2Q2IA 4R4OA 5LMUQ 1PH1A 3B6YA 1PH9A 2KCMA 1X9NA 1VQDA 1OXVA 4LNQA 3U4ZA 2HHHL 4DV6Q 2N8NA 2VQEL 1VQNT 4UP8A 2KCTA 3KF6A 3KOJA 2UUAQ 3FP9A 4WJ3M 5LL6S 2MO0A 4OXPA 3I4OA 2UU9L 1YJ9T 4TQUS 1Y1VG 4YCUA 4MZ9A 5LMNW 1PV4A 3A5ZB 4DR7L 2UXCQ 1I3QH 3FKIH 2IY5B 4YWLA 2YV5A 1SN8A 4GLVB 2I0QA 2JA7G 4OX9L 2ASBA 4C2MH 2JOYA 3K8AA 3L7ZC 2E8GA 3J7ZC 3U58A 4JI4Q 1UE1A 1FJGQ 4BBSG 2R93G 1OXTA 1I50H 3T1HL 5FJ8G 4A3LH 4A3IG 1YI2T 2K75A 4LFBQ 3CXCA 4JI0Q 1Q82C 4PZ8A 4L5RC 4R4TA 4HJAA 4JBWA 5FLXc 4Y7NH 5LMNL 3CMAA 1B70B 3ERSX 2UXBL 5K36G 3PUVA 3CPWA 3BZKA 1C0AA 1NTGA 1OXSC 2UXCL 1MKHA 4JI1Q 1G291 3J7AF 4DR6Q 4GKKL 2R92H 5AJ3Q 5BR8L 3I7FA 1NJIU 4HJ5A 1KD1C 4O2DA 2ZJQA 5C4XH 4JOIC 4A3FH 2Q2UA 1XNQQ 2MWPA 3CCQA 1OXXK 2CKKA 1QVGS 5DM7R 1PFSA 3CC7A 1CKOA 1GD7A 1WOCA 4L5TA 3RLFA 1N34Q 4O0AA 2JA6H 1D7QA 2KENA 5HY6A 4JI0L 4JI7Q 3S2DH 4L5QA 4R4QA 2K14A 3KF8B 1XMQQ 1TWFH 1DGSA 3L2PA 4A3JH 1K9MU 1HR0Q 3G71T 4TVRA 3CD6A 2ES2A 3K0XA 4X64Q 2YU9H 2JEAI 1QVFS 3J80c 1PHJA 2LSSA 3CCLT 4LF8Q 5JJKA 4DR6L 1Q86U 1IYJB 3UE1A 1J5EL 4L5SA 1EIFA 4XTCS 5AJ3L 4KLKA 2OTLT 3TS0A 1QUQA 1W2BA 3EIVA 1Q1EA 4JI5L 1SR3A 3OW2A 3CCST 1JJ2A 4GN3B 1N33Q 1WFQA 4DV4L 1SMXA 4DR4Q 3JAME 5IP7G 1HNZL 1KQSA 4PZ6A 2E2IH 1SSFA 1ASYA 3KFUA 3CC2T 4GKJQ 1IBKQ 1W3SA 4JI7L 1VQ8T 1XMQL 1A62A 3CCEA 3CMEA 1WI5A 1VQPA 2Z6KA 5IP9H 5IWAQ 2RHQB 4DR3Q 1PH3A 1VQ9T 1Q8KA 5IYCG 4X64L 4DV4Q 3CCVT 1L1OB 1VQOA 3JC66 4DK3C 2AWOA 3NELA 2LCLA 1X65A 1UE6A 3K7UC 4YCVA 4OWXB 3PIPA 4LWCA 1VQLT 1VQCA 1NJIC 4GN4B 1JB7A 3S1QH 3IRBA 5HGQA 4DV5Q 2UXDQ 3S14H 1K8AU 4A3EH 1YVCA 1IZ6A 4QIWE 3MXNB 1N33L 3I55T 3P8BB 1E22A 2UUCQ 4XIGS 2QGQA 4BBRH 4DV2Q 1XNRL 3J81i 1PVOA 2ID0A 2K4KA 2I5HA 1L1OA 1PA6A 4P75A 3LGJA 3M3YH 3PO3H 4POGA 4X6AH 4YY3Q 4DR3L 2ATWA 2N49A 4BY1G 4A3KH 5IAYA 2IHFA 1M1KU 3CCMT 4QL5A 2JQOA 1IBLL 2VNUD 1Z9FA 1YHQT 5C4JH 3LGLA 3PO2H 1NPRA 2B63H 3I4MH 1GVPA 1CSQA 3GTQH 1JMCA 5FLMG 1YNXA 3HOZG 4A3GH 4R4CA 2IX1A 4OO1I 1P8LA 4LW1A 4DV7Q 4PG3A 4P71A 2R7DA 4LF5L 4HIDA 4QGUA 3TEHB 4P72A 2JA5G 4B3RQ 1VQ4T 1TWAH 1RL2A 5J3BA 4YY3L 2HQLA 1HZCA 5IY0A 2VUMG 5GAEC 1VQNA 1HJPA 1VCIA 4LF9L 1WYDA 1BVSA 4MTNA 2IT1A 4DV1Q 2BA0A 2PQAB 1GO3E 1U0LA 3RR5A 2HHHQ 1Y1WH 2R7ZH 1YJWA 1Q82U 5H1SE 2VQEQ 5C44H 2K50A 3S15H 4GN5A 3KDFA 2LQ8A 1UE5A 2UU9Q 4GS3A 3E9IA 4A3MH 2HT1A 3J81E 1I94Q 4DV7L 1YHBA 3HOWH 4OWWB 2Y0SE 4DV3Q 4A93H 2FXQA 3J80E 2PNHA 5EAYA 4A4IA 3H0GH 2JE6I 3ULJA 2Y0SG 3CQZH 4B3RL 4OX9Q 3OYYA 3S1RH 1YI2A 3CCUT 1PYSB 1KD1U 2JK8A 2PQAA 1N36L 4B3TL 2R7FA 4X34A 2B29A 3HOUG 1R9TH 3PGZA 1MJCA 4P73A 1VQIA 1E1TA 4DV1L 3T1HQ 3HOVG 5M5WH 4IO9A 2YTXA 1EWIA 2E2HH 4X65Q 2EQSA 4IPDA 5LMNQ 2MO1A 2MFIA 2NVTH 3GTMH 2UXBQ 3TREA 1E1OA 1X55A 2RHSB 1HZBA 4R4IA 2ZJRA 1I94L 3HKZE 2OWOA 3S1NH 2MQHA 2KVQG 3PSIA 4DV3L 1K0RA 3GTOH 2QA4T 3DB3A 3HKZG 3W5OA 3CP0A 4GKKQ 5BR8Q 3HFZB 1XPOA 2K5HA 3W1BA 1EIYB 2D0OA 2ZM6L 4QY7A 4A75A 1SFOH 4YTLA 3DLLA 1VS0A 4IPHA 1EYGA 1EFWA 4DR5Q 1Q81C 3OTOQ 1NBWA 3G71A 1Y1VH 2L15A 3FKIG 1HZ9A 4NPSA 4X65L 1HNWL 3Q8DA 1Q7YC 3CCLA 1WCMH 2A19A 3JAMi 3HOXH 3RN5A 2JA8H 1QZHA 3M85A 1VQEA 1XPUA 4RMFA 3KLWA 2OTLA 4QQDA 4HIKA 1B7YB 4HJ9A 2CQOA 2NZOA 1C9OA 1KAWA 4BBSH 1M1GA 4H02A 5M5YH 5IT9c 1J5EQ 4A3LG 3S17H 1X6OA 4A3IH 3UDGA 3FHWA 2WP8J 3MEFA 1XNIA 3UDFA 1S72T 1LTLA 3CC2A 1YITT 4JI5Q 2V1CC 1VQ8A 1BKBA 4OO1G 3G48A 4DR5L 2N78A 2EIFA 1YIJT 4FDBA 1PH8A 4AQYQ 1HNZQ 2WB1E 4GLXA 2GN5A 2R92G 2IX0A 3LH0A 3J7A5 2WB1G 5C4XG 1VQ7A 2ZTDA 1VQLA 4C3HH 2JUFA 1S3OA 2DGYA 5IE8A 1YJNT 4DV0L 4A3FG 2F3IA 3GTKH 4IOAA 3CCJA 1KRTA 2G3RA 1BBWA 2JA6G 2DO3A 2VL6A 3GD7A 1Z47A 4NXNL 4POFA 5JEAG 3NENA 4A3JG 1UWVA 4KHZA 1G6PA 1N8RC 4MNOA 2OQKA 4IPCA 2ZJPA 4NXMQ 4DNIA 1PH7A 4AQYL 4UP7A 3CXCS 4UY8C 1XNRQ 1VQ5T 5C3EH 3CCMA 4HIOA 1YHQA 2KHJA 4A3BH 1NY4A 4JCVE 5GADC 1Y14B 4GNXC 3H3VH 4IJHA 3M7NA 3CPWS 2HIVA 3M9BA 3RZDH 4IJLA 1LM0A 4J15A 4C3JH 1IBLQ 1JJCB 1TWCH 4AYBE 3HOYH 3CMAT 1N32Q 4ZN3A 3EBEA 1D8LA 4DUZQ 4AYBG 5IP9G 2AMCB 2OQ0A 1UE7A 4LUOA 5M3FH 1VQ4A 1JT8A 1TWHH 4C3IH 1VQAA 1EQQA 3HKSA 4NXML 4LF5Q 3LGFA 1HNXQ 2E2JH 4B3ML 1YHAA 4NB3A 3J80i 1VQKT 2RF4A 4A3EG 3F2CA 3G6ET 3E0EA 3H15A 4LF9Q 2ALYB 4APVA 2NVQH 3I56A 3KJPA 1OXUA 1SLJA 4BBRG 5JEAJ 2F4VQ 2K5NA 1N32L 4JV5Q 5GROA 5IYBH 1W2BS 3PV0A 4DUZL 1PYBA 3PO3G 4KHPQ 3OW2S 1NMFA 2QEXT 5FLXE 3WWVA 1JJ2S 4JG2A 2D62A 4OWTB 4A3KG 3I4NH 3S1MH 5JJIA 4LFAL 1KQSS 2BA1A 3PUYA 3RLOA 4DR1L 3PO2G 1HNXL 2JVVA 1KC8U 4DPGA 2B63G 3T1YL 2NVYH 2GVAA 2MNAA 2Z6KC 1N36Q 4B3TQ 5A2QE 1SE8A 4GOPC 4DAYB 4A3DH 1Q81U 1IL2A 2L3RA 1YJ9A 3F1ZA 3RN2A 3CCET 1KIXA 1VQPT 5IYDG 4LFCQ 2N3SA 3A5UA 4JV5L 1Q7YU 4KHPL 4IOCA 2E70A 2E6ZA 4A76A 1BBUA 3I2ZA 1U5KA 1X3FA 4BXXH 4QQBX 2NVXH 1EQRA 1Y1WG 1VQMT 2R7ZG 5C44G 2YTVA 4CRIA 4AH6A 4A3CH 2ZM6Q 1VQBA 4A3MG 1PH2A 3M4PA 3TS2A 3KJOA 3NBHB 4JBKA 2MI6A 4BY7H 4A93G 2DUDA 4WJ4A 2KDSA 2ZTEA 1C7YA 3H0GG 4LF7L 1HNWQ 5GQOA 4LFCL 3U50C 3TQYA 2YYZA 4JBJA 1NZ9A 3H3VI 5DLQE 3G4ST 3K81C 2LXKA 1VQGA 1GKHA 3PIOA 1VQ6T 5M3MH 4DR2Q 1A63A 1HH2P 1YITA 2C35B 1KC8C 5ELNA 1FGUA 3RNUA 2OTJT 1YBYA 1YIJA 4JI2L 1QVCA 3ULPA 2CCZA 2JEBI 4PZ7A 1I6HH 3E9HA 4JOIA 5GAGC 3CCRT 1N8RU 2LXJA 1YEZA 3F8TA 3UE0A 2BH2A 4YCWA 1YJNA 1QVGA 1E24A 4X62L 4JI6Q 4GLAC 4ALPA 3GTJH 2E5LQ 5ELOA 2JA7H 3A0JA 4JI3L 1E3PA 4DV0Q 1GM5A 4LUVA 4DR2L 3ICEA 2R93H 1YJWT 2AWNA 1I5FA 3CCSA 1QVFA 4DKAC 4LF4L 4NXNQ 4GNXB 2JJQA 5FJ8H 1WCMG 2F52A 4K0KQ 3PCOB 3PUZA 3HOXG 4EQ5A 1K3RA 2JA8G 3CC4T 1VQ5A 4AIMA 1PH5A 4Y52H 2XTIA 4X66Q 5C0XJ 1FL0A 1V43A 1M90C 3PF5A 1XPRA 2A8VA 4YWKA 3STBD 3GTLH 2AKWB 2JA9A 2K52A 5LMUL 2BH8A 1VQFA 4JYAQ 1VQ9A 3DB4A 2NN6I 4JI6L 3CCVA 2E5LL 4DV6L 1NE3A
chains in the Genus database with same CATH superfamily
2LT4A 3MP6A 4RG2A 3M57A 2DJQA 4GZYC 4J6XA 1HZAA 5JJLA 1MSGA 1SROA 4PJOF 1ESFA 2VY3A 4N0AA 2EY6A 3D4DA 4K0KL 3RZDB 1M2OA 1G83A 2JMCA 1PKSA 5EG2A 4KUIA 1J3TA 1FJGL 1TWCB 2EQKA 1VQKA 3D0FA 4HJ8A 2EKOA 3CCUQ 1QUQB 4JUVA 3G6EA 1GOZA 1WTXA 1X3EA 3PF4A 4ZLTF 5BN5A 2YRDA 2F0NA 3D31A 5M3FB 2AHOB 4H7BA 1TWHB 4C3IB 3OYAA 2R3ZA 2H4OA 4DFAA 4B3SL 4K8JA 4CDFC 4A3DB 2HQHA 1GUOA 3GV3A 2E2JB 3N52A 5ISRA 3F2DA 5EPJA 4A63B 1NPPA 3M58A 4KK7A 3MC0B 3H6ZA 3TSSA 1CKNB 3H0IA 2LP5A 2FRWA 5I6YA 2QQ9A 1QLYA 5C0MA 3UDIA 1WVLA 4M7AD 3A8IE 1RIPA 5IYCH 1PWTA 5IOCA 3PO3H 4TSSA 2NZ1D 1MV3A 2JXBA 2K7VA 3VYTA 2VQFL 4DR1Q 3HOYG 3AT1B 4NL3A 2GQVA 1XTDA 1G51A 4JI8L 3CCQT 3CW2C 1JWMD 1GCPA 3CC7T 2P84A 3SHLA 5C6SA 4GOPA 2A0FB 1L2FA 1PH6A 3VYGA 1U5SA 4EX5A 4EMKC 5GMKl 2D8HA 1SE3A 1WHMA 1FYNA 4LF6Q 4HCZA 1SYDA 2DBKA 1IXRA 2VUBA 3ER0A 3E6ZX 1B34A 2CT4A 3SK5A 2E3IA 4IFDJ 2EGAA 3HZXA 3RKXA 1YITQ 3I4MG 3L2UA 4GKJL 1BBZA 2ZZDA 5IYBG 1CSPA 4DUYQ 4ESRA 3S16H 2ZPFB 3CBOA 3NMZC 3JCMX 1G3WA 1NEGA 4PNOA 2A6HD 3HG9A 3OYFA 2X6LA 3RMQA 2X4JA 5JJZA 1EUJA 1D3BA 3X26B 3E3XA 3GQBA 3KUPA 1X54A 1Q46A 4OB2B 2F0VA 1JJGA 4BY7B 5DLOA 2UXDL 2OTJA 2GGRA 2NUCA 4FO2A 4A3DG 2Y4YA 3VS4A 3T9NA 5ELFA 3HPWA 1J6QA 3A74A 4DN4M 3V8KA 2XU8A 2F0HA 3BFMA 3MP8A 3CCRA 3PVQA 1SAPA 4JW0A 4JI2Q 3QHSA 3I90A 2D0PA 2NVTB 2XHCA 4ULLA 3I35A 1CUKA 1H95A 3I3CA 1LCKA 1M90U 1X3GA 2SEBD 1FVIA 2JZ2A 1E2VA 2B2VC 2WFWA 3D3RA 5D3DA 2ED0A 1F9SA 3NEMA 1MNEA 2CP6A 2HSPA 1KL9A 1RABB 2P0QA 3ZJYC 3VKIA 2K5DA 4IPGA 3I56T 1K83H 3HOUH 2PMZE 1S72A 2IY5B 1Z9ZA 3KF6B 4DR7Q 1C48A 2JA7B 1AHJB 1LTSD 3NBHA 2CP3A 2H8HA 3I55Q 1V8QA 4YWMA 4R1JA 1DJ7B 1A0IA 3V96A 4ELYC 3MEUA 4EMHA 4JRPA 1ZXTA 4R4OA 3VYRA 3CF5A 5LMUQ 1PH1A 3QDRB 1PH9A 2D8JA 1ML0D 3THKA 2ATCB 5GMKe 1EWHA 3H0FA 2HZYA 1NR2A 1OO9B 4DV6Q 2VQEL 4CC4B 6AT1B 4OMQA 3KOJA 2C5CA 5CYUA 2UUAQ 4WJ3M 5LL6S 2MO0A 1SYGA 4OXPA 1YJ9T 1RAFB 2E6NA 2KBTA 2MOXA 1R0CB 4ZTFA 2EYLA 2J6KA 1Z7TA 4XTYA 2UXCQ 4KGZB 1UGRB 3FKIH 5D6WA 3TSZA 4HCCA 4M7AC 1M8AA 5GANg 1I8FA 4NDXA 4YIJA 5E3FA 1D1AA 2I0QA 4OX9L 1OEBA 1PRTF 4F7UB 2EYWA 2E8GA 5D3IB 2D0NA 5LJ5j 1UE1A 1AD5A 1BQQT 4D8DA 5L8RE 5EJWA 1K8MA 2EYYA 2VXWA 5FJ8G 3MEWA 1MBYA 4LFBQ 2VB2X 1Q82C 3QZ9B 4N9TA 4DXGA 5FLXc 5LMNL 2DA9A 3CMAA 3ERSX 1ICFB 3CCEQ 3L2QA 3PUVA 3BZKA 1PMRA 1OXSC 4DR6Q 1G291 3J7AF 1BR9A 2FZKB 3C0CA 4JJCA 4F7UE 4ZKCB 1VQMQ 4M78A 2M9VA 4JOIC 5C4XH 1XNQQ 2D2CC 1EY5A 4EMKB 4WCIA 2MWPA 3V2TA 1OXXK 2CKKA 1QVGS 1BCPD 4L5TA 1WOCA 1GD7A 5GAN2 5D14A 3RLFA 4FF4A 1N34Q 2KENA 5HY6A 4JI7Q 3CEYA 4R4QA 4M78G 1KTKA 1TS5A 1TWFH 1WXBA 3UF4A 3L2PA 5I6WA 3CD6A 3P7JA 2F3VA 3PMIA 3K0XA 2YU9H 2JEAI 2E2IB 3OBYA 1LTID 5KEEA 4LF8Q 1TWGB 4C8QA 2AKKA 2XK0A 1EIFA 1VQ6Q 2K33A 4KLKA 5AJ3L 2DD5A 2OTLT 2B39A 2SOBA 2AZVA 4HA8A 1W2BA 2QKIC 3OW2A 2FINB 1LTGD 3CCST 4C8QG 2R61A 4RCOA 4C92D 5CV8A 2L3QA 4DV4L 1RJTA 1N33Q 1SMXA 2A37A 3JAME 3OA6A 4DR4Q 4A4FA 5CKBA 4K2LA 2DNCA 1W3SA 1VQ8T 2V1QA 1XMQL 4BY1B 1HJDA 1WI5A 4R0KA 2EVBA 2RHQB 2A68D 1PH3A 3M9QA 1Q8KA 4X64L 4ANJA 3CCVT 3S2HB 3PIP3 2LCLA 3K7UC 1UE6A 3TN2A 4N0AC 1S5ED 1EY7A 4DBFA 1NJIC 3HOZB 1JB7A 2D6FA 4DV5Q 4EQPA 2BUDA 1OX8A 3OYNA 1K8AU 4A3EH 4F7UF 3FJPA 3EGUA 2YT6A 5IGGA 2YLBA 1E22A 4XIGS 3FIFA 1EEID 1HUMA 1D1CA 3OYCA 3DM1A 4BBRH 2YXYA 1VIEA 2ID0A 3DLMA 2EQMA 1L1OA 1EY4A 2H1EA 1Y8NB 1WJRA 3LGJA 3JB9J 3LX0A 4KKSA 4DR3L 4POGA 2N49A 4C1NK 1V1OA 2K5WA 2ATWA 5IAYA 1HXDA 2IHFA 4QL5A 1MI2A 3E1SA 4XTZA 2RVLA 2PU9B 2EYXA 5C4JH 3T51B 2YUNA 1FNWA 2LKVA 1NPRA 1C0MA 5FK9C 1GVPA 2PZ1A 3IQLA 1M3CA 4M75F 2VUMH 5FLMG 1YNXA 4R4CA 2IX1A 1RAAB 3QO2A 2VASA 1ILPA 4HIDA 1N6AA 5D6XA 1FNVA 3TEHB 1CI3M 2ZGWA 3META 2JA5G 1E7OA 1JQQA 3K7AB 4YY3L 2DJFC 2HAXA 2VUMG 3M4GA 3NHHA 2RA2A 4J9CA 4M7AB 5JPNC 1F2ZA 2K6AA 2RHZA 1NNXA 3MEAA 3KDFA 5GAMd 1UE5A 4BACA 4XU1A 5TSSA 2P0PA 3N5BB 2LJ3A 2VB3X 1YHBA 3L1AA 4DV7L 4OWWB 2FG0A 2IJ0A 3SK4A 4A93H 3J80E 5EAYA 1TY2A 4A4IA 4M78D 3H0GH 2JE6I 2Y0SG 3CQZH 1ZLMA 3QJ6A 4IQZA 5KCHA 1PYSB 4ODGA 4FM4B 4B3TL 1NUCA 1VA7A 1ZA1B 2Z0WA 2FYKA 2JT4A 3REAB 1X32A 4Z9CB 4BS9A 1R9TH 3SWNC 9ATCB 4DV1L 3T1HQ 5M5WH 4IO9A 4GY5A 4IPDA 4DBHA 1MGSA 2VB6A 2MO1A 3A55A 2UXBQ 4AFQC 3A98A 1I50B 3LWHA 1U4MA 2DLPA 1O78A 1SRMA 1UECA 1I1JA 4R4IA 3ZYYX 3L2RA 2MQHA 2LC4A 4J6WA 2E74C 2LQWA 3LX7A 3PSIA 4DV3L 3OYJA 4C92C 1WHJA 4PJOG 5KNBA 1F1BB 2PO4A 2D0OA 4A75A 1SFOH 1XJWB 3VUZA 4YTLA 1TTHB 1VS0A 4IPHA 2FJ2A 3ND8A 3OTOQ 4F04B 1N5ZA 3TP7A 4IUNA 4XYOA 1NBWA 1Y1VH 2A68C 2Q8RE 1WXTA 2R92B 4Z89A 2MIOA 3Q8DA 3EFSA 1HPCA 5IN1A 2A19A 2JA8H 2RPNA 1NAPA 2QQRA 3JCMe 4MHEA 5KYWB 2NZOA 1KAWA 3P20A 1M1GA 4E7KA 2EOTA 2SNMA 5M5YH 5IT9c 4KJOA 4A3JB 2VC8A 2XDPA 3FHWA 3MEFA 3UDGA 2XRQD 4AFUC 5L23A 1QOHA 1LTLA 3IKJA 3NP8A 4JI5Q 1BKBA 4MN3A 4DR5L 1JQYD 2E2DC 3VRYA 4FYWB 1WHLA 4PJNA 1X69A 5FKAC 1PFMA 3NTHA 5D7UA 1NR4A 1EEFD 1UE9A 3LH0A 5ELEA 3J7A5 3MPUB 2WB1G 2KI7A 2B2UC 4A3FG 4XT3B 1UGPB 5CK9A 1WHHA 1YJNT 1AFPA 5G3LF 1KRTA 1NSNS 1HK9A 1FR3A 2DVJA 1Z47A 4IFDH 1X2KA 1GL5A 1GXIE 3BVMA 1IKMA 1M5Q1 1TU2B 1M4ZA 2FPDA 1PZJD 2FRYA 1SHGA 2M51A 3EGXA 4J6HA 4KKTA 1K8OA 4EVOA 4AQYL 2COWA 4JJBA 1XNRQ 1Q95G 3A8KE 4HIOA 4BWGB 3FMCA 2XICA 4AG2C 3KLRA 2KXCA 2A74C 4FXGC 1C6VX 3CPWS 3M4YA 2HIVA 3RZDH 1ILQA 2HCIA 4KY6A 1VQNQ 4UHVA 4LE9A 1EZ8A 5LJ3d 1TWCH 2ZPHB 2LTOA 3M3YB 1STAA 5I2XA 3EBEA 4A3KB 5I11A 2K4YA 2KQ3A 1U9RA 2AMCB 5KH6A 5C6AA 5M3FH 1VQ4A 1G2SA 5COYA 2X3WD 1TWHH 4C3IH 4MDWA 2V4DA 3I4MB 2B63B 2BDNA 4M77F 4E6IA 2K9GA 2RQTA 2E2JH 3GTQB 2DM1A 5GAMh 1D5ZC 3AHUA 4BI3A 4IUVA 1FD7D 2COZA 2A6EC 2QDBA 3VA5A 1VQKT 3L9AX 2RF4A 2JS2A 1HQRD 1B2TA 2L0AA 3G6ET 2F0TA 1N9SA 3I56A 2ECZA 1ACMB 1AZQA 1SLJA 2FO0A 1LTAD 1TWAB 2KUMA 2XG8D 1J9OA 2O2OA 3JCMf 2RI5A 1PYBA 1RDPD 3PV0A 4WJWA 2ENBA 4DUZL 3SWNB 5FLXE 3JCMb 1O7ZA 2D62A 2ZT9C 5CIUA 1MD2D 1EWCA 4LFAL 2BA1A 4GLKA 4LUDA 5C44B 2JVVA 3NWTA 4O42A 3BY7A 2EY2A 2NN6H 1I5OB 4RHSA 2GFUA 2RQXA 5EBCA 3VYUA 2W10A 4HXJA 1SE8A 4DAYB 2XSCA 1LT3D 4C92B 5GAN5 1Q81U 1QB5D 4J9FA 1YJ9A 3F1ZA 1BI3A 1Y96A 3VS5A 2N3SA 2WSFE 3A5UA 3TZUA 1Q7YU 5BN3A 5IGDA 3CCLQ 5KYUB 4HVWA 2RDHA 2E6ZA 2IW3A 3O5ZA 4IOCA 2RHXA 5CCAA 3I2ZA 5C0XH 4M8AA 2MHVA 4BXXH 2LZ6B 4FYDA 1KSWA 3GTMB 4H13C 2HUGA 4A3CH 4CRIA 1Q82R 3RUZA 1XXGA 3MFGA 2DZ9A 1LOJA 3G7LA 2J05A 4C92E 3M4PA 2PZWA 3NBHB 2NUTA 4BY7H 3HL8A 2EJ9A 1DM0B 3MHBA 1ZSZA 1RTNA 2B2WA 1VQ9Q 4LFCL 4JBJA 3H0HA 2K2VA 1I6HB 4ZYSA 3MFYA 4EQNA 2COYA 1VQLQ 3PIOA 2HL5C 1WTVA 2XN9C 1KQSP 1V76A 1EU4A 1WCMB 4TRDA 3OW7A 2RD1A 1RLPC 3HOXB 2OTJT 1YIJA 3D8GA 1QVCA 1B1ZA 1WPYA 4K2KA 2EW3A 3O8VA 4PFPA 2CUDA 3CCRT 4RTVA 3U23A 1N8RU 1TS2A 2LXJA 3F8TA 3K6OA 3UE0A 4Q0FA 3S17B 4Z88A 4XU3A 5GAOn 1AOJA 2MGSA 3CCMQ 2E5LQ 1JC7A 1C8CA 3G1JA 3HHTB 2O01E 1YHQQ 2JA7H 3QWYA 4DR2L 1ESRA 1I07A 4DKAC 1I5FA 3CCSA 1QVFA 4LF4L 2L55A 3E9GA 4ZUIA 4IKFA 3SK8A 4K0KQ 2PVOB 1RD9D 1DONA 4EMGA 4AIMA 1G91A 1SNDA 2XTIA 1JICA 4NW2A 5K36H 1LT4D 5LJ3h 3STBD 1UG1A 5KNCA 2AKWB 4FYYB 3QJYA 2O31A 4CJ0B 3K5OA 4LJZC 2EJFA 1HFNA 3CCVA 1EFID 1XQHA 1LV9A 3MXUA 2NWGA 4ZRZA 2EWNA 5EPLA 5EQ0A 4KHPL 3AU7A 1MNDA 1NJIR 1IW7D 3OB9A 1JOQA 4B3SQ 4BA2I 2Z4IA 2VS1A 5C3EB 2LVMA 2P4TA 2RQVA 2Q2TA 2KSSA 4A3BB 3M59A 3F2BA 4QCLA 2SRCA 4OMFB 4XXEA 1T9HA 4FL6A 3QXEB 2FPEA 4C3JB 2RCNA 4C3HG 2WACA 4X66L 2E5QA 3JB9H 2LCCA 2KY9A 1PH4A 4KTAA 5CKEA 1LTTD 1NCVA 2IL8A 2G9HD 2VQFQ 4JYAL 3BE3A 3EFXD 3X3MA 5JVH3 4B3MQ 2EAYA 3NPFA 2F4VL 2EE1A 4JI8Q 3H9NA 3M0UA 1TG0A 5LJ5d 3VR5A 1KXLA 4M75A 3TEEA 1WJQA 1BIAA 2CWAA 1G3YA 2QEXA 2QEJC 1AWWA 2CWPA 1JE5A 1HR0W 5IP7H 4JI1L 1K28A 3OYKA 1M3AA 2F0EA 4Y92A 2KHIA 2XGTA 2DILA 3MO8A 4M75G 4BA1I 1AWJA 1I4RA 1BI2A 2B3GA 1WLPB 5KE2A 4RTXA 2IHEA 3J7YW 4CDEC 2KR3A 1XMOL 3PUWA 1CKBA 4JRQA 2R58A 1ARKA 1PXUA 3OSSC 3NXWA 1S5CD 3OSOA 3T1YQ 1TWGH 1KRSA 3I4NB 4N4HA 3S24A 3S1MB 1VF5C 1PG5B 2DPPB 2B8GA 1KHIA 1OTCA 3AYHB 1SKUB 1IB8A 3AMUA 1WTHA 2LMCB 4UP9A 4PL6A 3KYHC 1F77A 5KE3A 2NVYB 3GTGH 1NE8A 3HFOA 5GAOm 1O7IA 1E7ZA 2L3SA 3CD6T 1VQHA 1JCKB 2L0CA 3CCJT 4DK6C 1GUSA 4A4KA 2EY1A 4BY1H 4OMMA 1S72Q 3NHNA 2ZPIB 5IT9E 1GUGA 5D65A 2F4IA 4FF1A 4J8QA 3S2HH 2H3EB 2JNGA 1PZID 4P74A 3M0PA 1BYMA 4PKCC 4BDYA 3KLSX 2G6FX 4KN4C 3DEOA 4A3GG 2DAQA 5IWAL 3HOZH 2NVXB 2VZAA 3G4SA 3LWIA 4YHHL 1MHNA 2OCEA 2KROA 1Q86C 1G5VA 4LF7Q 1K3BC 1P16A 2KHSA 1A2UA 1DYQA 1XX8A 1LPLA 3A8MB 1WQ7A 2EQIA 4K5WA 5J1ZA 3VS3A 1L0XB 2L5TA 3EQLC 4HN7A 2CFMA 1VIFA 3KDFB 3STBC 2ZCFB 3DM3A 5IYDH 3VS1A 1TXYA 1ASZA 3L0OA 2DFUA 1H92A 1VQ5Q 3DWQA 4OMOA 3HOWG 4C0FA 1CKMA 4LXCA 1IW7C 3GIBA 3JCMJ 3H91A 4JC0A 1X6BA 4Q5VA 3MJXA 3AQQA 3Q0AA 4OB1B 1AE2A 4J9HA 2JTMA 5C4HA 2PI2E 1CQFA 5FO7B 3VDYA 3EVQA 3CC4A 1YZ6A 3K80C 3JAMc 1ZKOA 3K7AH 1L0WA 3K5NA 2QGGA 2B86A 2ABLA 3KBGA 2R5AA 1KIKA 3UI2A 2QGFB 1EZ6A 1FYCA 1W6KA 4OB0B 1MIUA 3Q22A 1KQ2A 2WAQG 3GBQA 4ZN1A 3F2UA 1G2TA 4RG8A 1M1KC 3SVMA 2AZSA 3MA2B 3EH1A 2KCMA 1X9NA 1K0SA 4LNQA 4UAIA 4Z8AA 4FW1A 2KCTA 3GTLB 2ZPBB 3VV0A 2DY8A 2L9HA 2DE0X 3FP9A 4RGMA 2K1BA 5CORA 2LT1A 5JOBA 2X6GA 4TQUS 4N8X1 4YCUA 4MZ9A 2KT1A 2HEQA 2ICEC 3VR3A 1DJRD 3C46A 1HA6A 2F0UA 5LJ5h 1UNSA 4GLVB 2LQNA 5GANe 5I9PA 3L7ZC 3J7ZC 3U58A 4JI4Q 2MPXC 4CKBA 4BBSG 2R93G 4M7DD 3R2IA 1I50H 1F2MA 1ZBXA 1BBXC 2FB7A 3CXCA 3URYA 1BU1A 1VMPA 3I91A 1GHJA 2RO0A 1C0AA 3A8HB 3VJPA 5KYYA 3NE5B 1JR0D 2R92H 5AJ3Q 5BR8L 2QASA 1JXMA 4M77A 1NJIU 1M3BA 1KD1C 1H641 2X69A 3BVGA 2ZJQA 1PC0A 3GNGA 2JW4A 1EYCA 2Q2UA 1ZUUA 3P75A 4DV4Q 1CKOA 4PFOA 1JWUD 2JP1A 4M77G 4CC2A 3SHWA 4RTTA 4PMCA 4J9EA 1WYXA 1F9PA 2BE9B 2E41A 4ZTJA 4L5QA 2K14A 4HCBA 4XQQA 1XMQQ 4XK8E 1UGQB 4A3JH 3OS5A 1K9MU 1GFDA 1HR0Q 4X64Q 3J80c 2HKNA 2LSSA 5JJKA 1IYJB 1J5EL 5KGUA 4XTCS 4RGTA 1YNJD 3CU7A 2QA4Q 5EBDA 4X1VA 1JJ2A 2YLCA 1RHPA 1RAEB 1WFQA 1ZUKA 2EJFC 1TS3A 1HNZL 2DZCA 2BE5C 1U4PA 3KFUA 1R4PB 2CH4W 4WRDA 3NQIA 2MCNA 1R77A 1EY6A 4JVZA 5BN4A 4ID6A 3CMEA 2Z6KA 4DR3Q 4FXKC 3NTKA 2F0JA 4N4IA 2IX3A 5IYCG 4ABNA 1VQOA 3JC66 4DK3C 4F87A 1X65A 1KK7A 5GAOq 3NPPA 4LWCA 4GN4B 3IRBA 4ZAIA 2NBFA 3SR1A 3LNNA 2RF0A 1YVCA 4QT7A 2HDMA 1GCQA 1WHGA 2M16A 2E4HA 3EG3A 3M53A 3I55T 1NBEB 1QVGP 4XQJA 2UUCQ 4DV2Q 1TUDA 5GANf 3FVQA 4KHVA 2LDMA 4P2CB 2K3XA 1E6HA 1FX7A 2ED1A 3PMTA 4DBQA 1Y69U 2EYMA 4YY3Q 3M3YH 3ZEHA 4A3KH 2YUQA 2QCPX 5FWCA 1IBLL 2VNUD 3UA7A 2PUOB 5IIFA 4QVCA 2HSEB 3I4MH 3MXNA 2B63H 4IURA 3S6WA 1CSQA 3GTQH 3M4OB 4QKUA 2MUYA 3J81L 1RADB 1P8LA 4LW1A 4DV7Q 1SRLA 1Y96B 4L8JA 4P71A 4DAPA 3I5RA 2OAUA 3OMGA 2OF1A 2YRVA 5EGTA 4M7DC 2ZXPA 1VQ4T 1ET9A 4JDSA 1TWAH 3MZ5A 1RL2A 2P0KA 4U68A 2L5QA 4DA4A 2OT2A 3OIQA 4LK1C 2RNAA 4BY6C 4QF4A 4F7XA 5GAEC 4LF9L 1SJED 4RGOS 1WYDA 3HOVB 4MTNA 4DV1Q 4KV6A 1JRIA 5HK0A 1BI1A 1EZZB 4L63B 4CHTB 2HHHQ 2F1LA 2DJGC 4I65A 5H1SE 2FEIA 2ROTA 5C4ZA 5C44H 2RK1A 2UU9Q 4I7ZC 1BOSA 2HT1A 2AHJB 1I94Q 4U673 1O80A 1G3TA 3BDOA 4DV3Q 2DERA 2CZ7B 2PNHA 1AP0A 1OYXA 2EYZA 2J06A 3LYIA 4C5GA 1T5XD 5GAN8 4B3RL 2QYZA 1WA7A 1YI2A 2PQAA 1N36L 3HOUG 5KCOA 2DXCA 2FVUA 1I3QB 4FIBA 3PGZA 4V190 1NM7A 3OY9A 2VGNA 2EPBA 3HP9A 3CCQQ 1I4HA 2QF7A 3I9QA 4AG1C 3CC7Q 4C2MB 1KFZA 2RQRA 2EQSA 2JM8A 2VXEA 3GTMH 1QCOA 3VYSA 4RCBA 1AVZC 3MHXA 1QWFA 1HZBA 2ZJRA 2F0MA 3NFCA 1OOTA 1D5XC 1WTOA 3HKZG 3W5OA 4GKKQ 2DRKA 3HFZB 2J0TD 2K5QA 2K5HA 2N88A 1EFWA 3G7ZA 1STEA 4LDYA 2WSEE 4DR5Q 2DJZA 2V1RA 5T1GA 3G71A 4KGVB 3FKIG 5C3XA 1KHCA 1OPKA 1NLOC 2I2LA 2M0OA 4ZGEB 5A0GA 1HZ9A 2AUKA 1AWXA 3RN5A 1WCMH 1HNWL 5KNDA 1HFGA 3JAMi 3HOXH 2HDAA 4NKLA 4RMFA 1VQPQ 3KLWA 1X3PA 4HJ9A 3QSUA 2CQOA 2JA6B 4LAAA 3X20B 3VS7A 4CKEA 2PYKA 2KYMA 1X75C 3S17H 3FRNA 2WP8J 1P92A 1RUWA 3CC2A 3X3NA 1HA5A 2V1CC 2QTXA 1HUNA 2N78A 2IWHA 4DU9A 2MP1A 2A6HC 4M1UB 1YIJT 3TZDA 1PH8A 3L2WA 4AQYQ 2AKLA 1DZ1A 1D0XA 3ITPA 4K6DA 4OMPA 1GXDC 3EA6A 2ZTDA 5C4XG 4XQNA 1SF9A 2FL7A 1LTBD 4KMUC 1HQMC 3CCJA 3KK7A 1WQWA 1LACA 2VL6A 3GD7A 2F2XA 2X3XD 4NXNL 1B3QA 5FROA 5HKCA 3EFOA 4J9DA 2B2TA 2RBMA 2DL3A 3UT1A 3BDCA 3VR2A 2BZYA 2OQKA 2ZJPA 1FWZA 1AT1B 3X24B 4UY8C 3S1QB 5C3EH 3SEBA 1Q86R 5EKIA 3S14B 2KHJA 4A3BH 1NY4A 2G9DA 5GADC 2E64A 4FF3A 3M7NA 2DY7A 3M9BA 4JLIA 4J15A 4C3JH 2DBMA 1OZ3A 2KJXA 1I4K1 4L59A 4M7DB 2L11A 1JJCB 2RMOA 3BG3A 4OIKA 4AFZC 5FO9B 1D8LA 4BY6B 1YJWQ 4DUZQ 1SDFA 3DWPA 4AYBG 5GANj 1QKWA 3RNJA 2I0NA 1IXDA 1UE7A 4RKLA 2KXDA 3KXTA 4NXML 3PO2B 1EQQA 4A54A 2EDGA 4X3KA 4B08A 1M8MA 4LF5Q 1HXYD 3LGFA 3C94A 4NMZA 4CJ1B 1CA5A 3PTAA 4A3GB 1YHAA 2VV5A 3A54A 4NB3A 3J80i 3JB9F 1JO8A 4A3EG 3H3VC 4DAVA 4KULA 2A28A 4M7DE 1A3TA 3TQ7P 3KJPA 3C3LA 1EFNA 4BBRG 5JEAJ 2J6FA 1Y0MA 2HD3A 4J83A 2LJ0A 1N32L 5GROA 4IUTA 1W2BS 3PO3G 4KHPQ 5KYXA 3OW2S 1DOMA 2QEXT 4J7IA 3S1MH 3I4NH 1UHFA 2DEUA 1ZSGA 3UWNA 1M1KR 1KDBA 3PUYA 1EY9A 3RLOA 1QNUA 1Y1WB 4DR1L 2R7ZB 1HNXL 3S15B 1H9SA 5FU7C 1JBMA 4J7FA 3TU4K 2NVYH 2EYJA 2GVAA 4A3MB 2MNAA 2CP0A 2EYHA 2Z6KC 3HOWB 3CPWP 2LCSA 1PTOD 3A7LA 4GOPC 1WTRA 2L3RA 1O7LA 1VMCA 1UB4A 2RQWA 3S1RB 2X51A 3HFNA 4LDXA 1GUTA 1KIXA 4LFCQ 4PJLA 1JOKA 4RWSC 2R57A 4JV5L 3QO3A 1LLRD 1V1PB 4DA2A 3JCMd 1D09B 4A76A 3RKYA 4O1NA 1F9RA 1LABA 1UTIA 2F2VA 1SBBB 1X3FA 4IZ8A 2OTLQ 1EQTA 2NVXH 1EQRA 1X6GA 4EPCA 2PZTA 2LX9A 5CMDA 1IYVA 1IBKL 1M2VB 1BCPC 4K8IA 3QUIA 5T1IA 2ZM6Q 4LDUA 2Z6BA 5CBEE 4J9GA 4M7AE 5CKHA 1LT5D 1PH2A 3TS2A 1VQ8Q 1I4XA 2MI6A 2EYFA 4A93G 2DUDA 4QW2A 1QQJA 1B7TA 2CP2A 2KDSA 2ZTEA 3H0GG 1C7YA 1K4US 3DUZA 1WD1A 3U50C 4G7ZC 2ICIA 3CCVQ 2CZ0B 2J4XA 3RR6A 3G4ST 4PJOA 4C8QD 2LXKA 1VQ7Q 1I0CA 1TIID 4F88A 1B9NA 5M3MH 4DR2Q 1MSHA 4Z02A 1HH2P 1YITA 5CR3A 1A63A 1QKXA 2D0QB 4KH0B 1PSEA 1PM3A 2F5KA 3VRZA 2EQJA 1FGUA 1HTPA 1YBYA 1PDQA 4JI2L 4XU2A 2O5JC 2CCZA 2JEBI 5L37A 1X01A 4BBSB 2OJ2A 2F0KA 3E9HA 5C5LA 3OSVA 2LJ1A 2YUOA 1S5FD 3K59A 4GLAC 4VUBA 4M4ZA 4ELZC 4BI4A 2F0GA 2MPMA 5ELOA 3T56B 1TT2A 3A0JA 1VUBA 1BB9A 3R6OA 4DV0Q 3NQTA 1YNZA 2K28A 3ASKA 2JJQA 4BE0A 2F52A 4HTHA 3PCOB 4EQ5A 1CSKA 2JA8G 3CC4T 1TUGB 1WHKA 3QB3A 4Y52H 3I73A 2EVRA 1V43A 4X66Q 1M90C 3GTLH 3AB9A 1QG7A 2JA9A 2JMAA 5FWBA 1FMVA 2BH8A 2K52A 5LMUL 4FU6A 3FEWX 1A0NB 3DB4A 4M7AF 2NN6I 4JI6L 4JYAQ 1IHWA 1QILA 1RAHB 2CP5A 3DMUA 1PZKD 4DV6L 4II1A 1NE3A 2F4VQ 1QP2A 3ONAB 1II3A 2YWWA 4GNXA 2C0OA 2UUAL 1A3UA 4ZGDB 3EG9A 4C0GA 3FPUB 4OMNA 3SGIA 1MJEA 3I55A 3RMHA 3ULRB 4PMWA 1ZBJA 1Q1BA 2XI9A 1TR5A 5C0XI 3NUCA 2BCOA 5KIXA 3CRKC 1W6XA 3HOYB 2AT1B 1XWEA 3MP1A 1PTOC 5GMKj 3AFPA 5IGFA 4MMKA 1XMOQ 4IFDG 1V9PA 3BZCA 1LYLA 4KUDK 4LFBL 3EG2A 3FPPA 3E0JA 4LN2A 3T13A 4XDXA 1D6EC 3HTRA 4ME7A 3WXMB 4RKUE 1ICWA 1KAAA 2MF2A 5FU7B 3OS1A 4J9BA 3IL8A 2BZXA 1TWBA 3M5AA 1D1IA 4BB7A 1A8VA 1ONLA 1Q3LA 4GOPB 2WSCE 4M78C 2NVQB 4C56C 3EFRA 2FMCA 4ZCKA 1XNQL 1F2LA 1SYBA 4DXFA 3BJUA 2AQ2B 1I5LA 2Z8LA 3JCMh 4EQOA 1N34L 1OU8A 2EXZA 3T53B 3MAQA 1B34B 5M3FG 1EYAA 3A1PA 3C12A 3NSWA 4C3IG 2L4NA 4YHHQ 3R3OA 1TS9A 1STHA 3PE0A 4C8QC 1BCPB 4PJOD 1CKNA 1TVXA 1YFNA 4LF8L 4FT2A 3IFTA 2B2YA 3LWEA 1RAGB 4ZK9B 2NTSA 2XIWA 1VQMA 2B2TC 4TVAB 4HJ7A 1U4RA 4E2FB 3OYDA 1D3BB 2DVEA 3K5LA 2UUBL 4N9PA 4KI0A 2A3LA 4D6WA 4DR4L 2QQBA 3RBBB 4QQGA 4F16A 1SE2A 2SEMA 3ULLA 1N9WA 1W70A 2PUKB 2BKDN 2BTTA 1Q8IA 4PMBA 3QYHB 2K5IA 1HSQA 2XKOC 2I5LX 3OYEA 4E7LA 1D1BA 4IIOA 2VYTA 2BIVA 3PT9A 4AT1B 1VQ6A 3CMET 2NN6G 1YJNQ 1UEBA 1HTLD 1E2WA 3CAMA 2PNIA 1UJYA 3D6CA 4RG1A 4JBMA 1Y8PB 1SMYD 1VQOT 4DV5L 5CC4A 3CQTA 4JJDA 2CH4A 2Y90A 1X56A 3RD4A 3C4SA 1JORA 4B6MA 1GFCA 1AH9A 2Z9HA 1L1OC 1FMKA 1K73C 1S40A 4IUUA 2WKDA 2JJ9A 1WTWA 5C0XG 1EOVA 4HCSA 3M4OH 4X9DA 1U06A 4BXXG 2PW7A 1R8OB 1QZGA 2C0TA 2W0ZA 4LDWA 2RSOA 4X62Q 3R2TA 1NMGA 1RI9A 1GJXA 4A3CG 1AE3A 4PV1C 3A8OB 5JAVA 2ZPEB 5LJ3e 3Q24A 2HD0A 4JI3Q 4FW2A 4RCNA 1K8AC 4MIUA 1Q12A 3RDVA 1IBML 1TXQA 4XQ3A 4BY7G 4LUZA 1OI1A 3J81j 3GTJB 4J1MA 4HVUA 4RAUC 3HOVH 4R8IA 2A1AA 3V7RA 4PJMA 2OX7A 2D1XA 2IVWA 4ATOA 1DOKA 3OPOA 1T5EA 1STGA 2MYSA 3EN2A 4E7HA 1ZYRD 2FHDA 3ND9A 3VS0A 2Q2IA 3A8LB 3B6YA 1SYFA 1VQKQ 5DY9A 1VQDA 1EIHA 2GA4B 3G6EQ 4HSVA 3P1HA 2N8NA 1BNZA 1SNPA 3KF6A 2K5LA 1PTOB 1CHQD 1H3HA 3I4OA 3QZ5B 5IGCA 2KRNA 5GJWB 5LMNW 2VWFA 3A5ZB 2OEOA 3BW1A 1I3QH 4K5VA 3V7SA 1HD3A 1SN8A 3EJIA 2JA7G 1I4GA 4C2MH 4WF2A 2E75C 2JOYA 3K8AA 3FLGA 3MEHA 1FJGQ 4TKOB 1C4QA 2B8AA 2LX7A 1U4LA 3T1HL 4C92F 4A3LH 4A3IG 1YI2T 4M78B 2LMJA 4L5RC 4PZ8A 3U9SA 4PJOC 4QUFA 2QW7A 1PLFA 4R4TA 4ZGJB 5IHNA 4GBQA 1B70B 5GAMg 2UXBL 5K36G 4OO1H 5AYFA 4F7UA 2KA7A 3DHQA 1PRMC 4LD9K 7AT1B 3HSBA 4B9XA 3I7FA 2NUZA 4HJ5A 2DX1A 4C8QB 4O2DA 2XNAC 2K05A 2CGHA 4F7UG 1PNJA 1A2TA 4XAXB 1W1FA 4K5XA 5LJ3j 1RF2D 3OTOL 1I94L 4M78E 3RZOB 3OYBA 3I70A 2JA6H 2K2MA 1H3ZA 5JEAH 1KJWA 4JI0L 1T0JA 1T3SA 5LHY1 4QVDA 4C0ZA 1ENCA 3SB2A 3G71T 1HCZA 4TVRA 2A73B 2F0IA 2XRSD 5FO8B 2ES2A 1QVFS 2MMPA 5GAOl 1STNA 1VYTA 2D5DA 4C0DC 1PRTD 1A6XA 1M4VA 2DRMA 4C8QE 1M8VA 2K03A 2K32A 1K1ZA 3FDTA 1SPKA 4ZKBB 1Q1EA 4JI5L 2RCFA 2CW0D 3DWAA 2OTJQ 2NTTA 5IP7G 1UUEA 1KQSA 2E2IH 4GKJQ 1RACB 1SSFA 1VYVA 2O9VA 3QWXX 3CC2T 1GHKA 1B9MA 3CCRQ 1A62A 4JJNK 3I5SA 3QYGB 1EQVA 3RERA 4F8MA 1BXTA 5IP9H 3M54A 2HCCA 2BH2A 4ORZA 1L1OB 2AWOA 2CUBA 4OWXB 3JV3A 3PIPA 1VQCA 3S1QH 3ZBDA 1W4SA 3C2PA 2YSQA 4PFZA 3C95A 4R55A 1EYDA 3S14H 2UXDQ 2GTJA 2RQUA 1TY0A 2QI2A 5JVG3 2M0YA 3QKJA 4JZ3A 5I2MA 5LL6X 1WZOA 1C1AA 1OV3A 2HKQB 3P8BB 1ZYRC 3BZDB 3D4WA 5C4JB 5KYXB 4QUCA 5M5XB 2QGQA 1XNRL 3TP8A 1PVOA 2IIMA 2RA4A 5GAN6 4KRTA 3X28B 2K4KA 1PFBA 2DNEA 2I5HA 2EZVA 5J22A 1PA6A 2VUMB 4X6AH 2F0WA 3O13A 3FJ5A 4BY1G 1FGBD 4HMIA 1UHCA 1SJHD 1S1NA 2MAMA 4GLMA 2QQAA 4CC3A 1J8IA 2B2VA 3PO2H 3FEOA 3QBYA 3SD4A 5EKLA 1PSFA 1TQOA 2BE7D 1D0ZA 3OYMA 3HOZG 4A3GH 1RI0A 2RHIA 3PQIA 3T16A 1IL8A 2VXFA 2K57A 4PG3A 3BS1A 2R7DA 3OS2A 1QJOA 2KEEA 2Y0SB 4QGUA 4C5EA 2ENMA 1D0YA 5GANd 4B3RQ 4OEMB 2O2LD 1SHFA 2GF7A 2NB0A 4AFSC 4BUGA 1AEYA 2KAFA 3DEPA 2HQLA 1CFMA 3K0YA 1HZCA 2EQUA 1OX9A 2CSQA 1VQNA 1VCIA 3H8ZA 4ILWA 1BVSA 3GTPB 2PTKA 5LJ3g 3FC3A 4PK4A 1GO3E 1Y1WH 4OP0A 2R7ZH 1Q82U 2VQEQ 1ZA2B 1RTOA 3S15H 2LQ8A 1NLPC 4GS3A 3CMAQ 4QB4A 4A3MH 3OYGA 4CDDC 1UFFA 3HOWH 2DKGA 3SEMA 1M90R 2Y0SE 4PJOB 2KEDA 5D6YA 3WVEB 2ZXRA 4LMQD 3IAYA 3HRZC 3M56A 3S1RH 4OX9Q 5HGTA 1JT8A 3CCUT 1MUZA 2HQXA 2QQSA 3Q23A 3CBMA 4P73A 1VQIA 4JPBW 1E1TA 2PVGB 2RHYA 3JCMV 4M75D 3X25B 5LMNQ 4WTOB 3I72A 2LNHB 2MFIA 4BE1A 3TREA 2DL4A 1O75A 1E1OA 1PRTC 3H6MA 2OWOA 3CD6Q 1TS4A 2XVSA 3T4AC 2QDLA 2KVQG 2OXPA 1IYUA 1K0RA 2CW0C 3L2ZA 2LNVA 2V8KA 1M1FA 3DB3A 3JRZA 2QA4T 3CP0A 2JN0A 4Y7NB 3QG1A 1HRJA 5DNFA 1D1KA 3W1BA 5CV6A 1EIYB 2YUPA 4QY7A 1EYGA 3DLLA 5FRMA 4OIJA 1Q81C 2X4WA 4C0DB 1ZSZC 2B2WC 2L15A 4NPSA 2WB1B 4OGCA 3REBB 4X65L 3TCJA 3JCMQ 4XTXA 1Q7YC 3CCLA 2D9UA 4A3FB 1QZHA 3M85A 4UC4A 1XPUA 4QQDA 1EY0A 2DTIA 3H94A 3S2DB 1C9OA 1SYCA 5E4XA 3K5MA 4H02A 3OYHA 1D5MC 1O9SA 4BBSH 1QW1A 1BCOA 1EY8A 3QIAA 1A3VA 2X4XA 1UJ0A 4MZTA 1YITT 1X27A 3MXGA 2BZ8A 3UA6A 4DGZA 3OWFA 3G48A 4FVMA 5EC7A 1LT6D 2EIFA 5JPMC 1XOVA 4FDBA 5KYIA 2WB1E 2CZ1B 4BDZA 3OQ5A 4GLXA 4J5YA 2R92G 4KD4A 3S3NA 3NK9A 2IX0A 2JTEA 4IUPA 3GPLA 4NP5A 3EGXB 4JLGA 4DK0A 5IE8A 1VQLA 1OULA 2JUFA 4FT4A 1S3OA 2DGYA 4IOAA 2KCNA 3BYTB 2XDBA 2QG9B 4POFA 1PCXA 3NENA 1FMWA 4H0LC 4A3JG 1UWVA 4FYXB 1IGUA 4K11A 1G6PA 1QP3A 1N8RC 3KF8A 4MNOA 4NXMQ 4IPCA 5GAOp 1PD0A 3CXCS 3CCMA 3KLSA 3R8BA 5I9OA 1YHQA 3A7AB 2L1BA 1RLQC 2PZUA 4JCVE 3H3VH 3H09A 1YWOA 4KH1B 1DXMA 4MDXA 1LM0A 2A7YA 1UGVA 3VUBA 5M9OA 5GANh 1ENFA 3HOYH 1SXTA 4CDCC 1H9KA 1N32Q 1V29B 2K3BA 1MHWC 5FLXL 2E65A 2KECA 1R0BG 1T3LA 2D9TA 2QDYB 3SFMA 1K73R 1Y8OB 2LY7A 2OQ0A 2WV6D 2LS01 4H44C 1WDXA 3TMEA 1XYIA 3WDNA 4F17A 5CQYA 3HKSA 3BDLA 2K01A 5FW9A 5KRUA 4UDUC 1HNXQ 5IODA 4B3ML 4PQXA 2HBPA 5GAN4 1KABA 5G3LD 4M75C 2KVMA 3F2CA 3E0EA 4APVA 1K8AR 4IIMA 1EU3A 4MMLA 2NVQH 3OS0A 2F1MA 1OXUA 1CHPD 2K5NA 1PFNA 4JV5Q 5IYBH 2A08A 1JWSD 4JRIA 1X2QA 2EBPA 3S3MA 1JJ2S 4R56A 5A35A 4E7ZA 4A3KG 1ZQ1A 3S9WA 3N6RA 4X9CA 2RSNA 3QDFA 1SEMA 2O4XA 2B63G 3T1YL 2MK5A 2KQWA 3QPHA 1TH7A 4Y28E 1KDAA 1PRTB 3OHXC 4N4GA 4RTZA 4F14A 4B3TQ 1PYWD 5LJ5g 1WTQA 1LJOA 4A3DH 1IL2A 2DEQA 5FOBB 2XWJB 3SWNA 4WFN3 3EG1A 3CCET 3VS6A 5CV5A 1VQPT 2NUTB 5GMKm 4PLIA 1ZSZB 1BBUA 3HGBA 3L42A 4M77D 2F0OA 2KOLA 4QQBX 4AMCA 2E2HB 1FNUA 2PMZB 4FYVB 2AIRB 1VQMT 4X3TA 4EIKA 1GUNA 1VOMA 2CDTA 3L2VA 1G2BA 4DAYA 4O5VA 2KNBB 4C92A 4AH6A 2DIGA 5I2YA 5C44G 2FMMA 1VQBA 2X35A 2WINB 4KY5A 3S1NB 3GTOB 3KJOA 4WJ4A 5KYUA 2KCCA 4CBVA 4C92G 4LF7L 5A0DA 2YDLA 1U1TA 3A8GB 1W2BP 5GQOA 4J9IA 2YYZA 3ZFJA 5DLQE 3OW2P 3PIO3 5A0LA 4OB3B 2WKCA 3K81C 1CA6A 1VQGA 2RB6A 1GKHA 1YNJC 1VQ6T 2DMOA 2RKSA 4OGQC 1DD2A 3JCMP 1KC8C 2C35B 1JU5C 4E7SA 2MJ8A 1PD1A 3HP3A 3RNUA 2DYIA 1UAPA 2M02A 4PZ7A 4LD6A 1PHTA 1LVKA 1I6HH 3G6JB 2A36A 1S5BD 4A3IB 4JI6Q 1E24A 1QVGA 4FNFA 3KUFA 3GTJH 4HVVA 4FSSA 4OF1A 4LDVA 2ZPGB 1E3PA 1GM5A 1QCBD 4DOVA 2B2UA 3PVLA 4E47A 3ICEA 4OGEA 3V05A 1MV0B 1YJWT 5C3WA 2L3PA 2CYZB 4A4GA 5FJ8H 1WCMG 2FZGB 3PUZA 4C3HB 3HOXG 1K3RA 4KJNA 5CBAE 3GTKB 1VQ5A 1LTRD 3KFVA 5C0XJ 4HAEA 3F70A 1VQ4Q 2I07B 3E2UA 2DL5A 4HR7B 1PTOH 4RCCA 1S4ZA 4RKBA 1UUPA 3MKDA 2KBNA 3I4LA 3MVVA 2RJEA 5J26A 2RN8A 2VW9A 1V1QA 2C0IA 8AT1B 1LO5D 5KYLA 3I56Q 5CAIA 4HT9A 2GTOA 4M75B 3HEJA 1IGQA 4KGXB 5GMKh 2KT8A 3OIPA 2QAZA 4C5HA 4ME3A 3RLNA 1WTPA 1BF4A 4RTWA 4JI4L 1QE6A 5E4WC 2ZTCA 2Q2HA 3UDXA 1KG1A 2JM9A 2FHTA 3LWUA 1M9SA 2BDOA 2CS7A 2I5MX 3J81c 2VKNA 2F0DA 5DM73 5GAN3 3UPUA 3M4QA 1CZGA 3GP8A 1SNMA 5E7NA 3INZA 2SDFA 3NBIA 4KKUA 5C3EG 1CKAA 2J6OA 5J39A 1H9MA 4M75E 1WX6A 1YJ9Q 1N27A 4M77C 3RZOH 4DOWA 1CT1D 4HIMA 4A3BG 3J7AV 1FXXA 2UUBQ 4C3JG 2F03A 2IPKD 4LFAQ 5IT9L 3W3AA 3QOLA 1R4QB 3FDRA 2KK4A 2CT3A 4G7OC 5A2QL 3GF5A 4PLLA 3U9OA 3AFQA 1K73U 1RODA 1HR0L 1QVPA 1XJVA 2F3WA 2PCFB 3HRUA 1OQKA 1NEBA 2EYQA 2M9UA 1WJJA 4UPAA 3CPFA 2E10A 2JN4A 2N55A 1K8GA 2IG0A 2P5ZX 1VQ7T 4E7JA 2CKZB 1WGSA 2CHBD 2GVBA 3EROA 1SNQA 3U4VA 5I4DA 4DNTB 2NUPA 1UEAB 1ABQA 3M0TA 2KRMA 1O7YA 2YTYA 2DTOA 3CCUA 4X3SA 1BDOA 5ELCA 1EX4A 3R93A 3RUXA 2RDFA 3GDEA 5K5PA 3GO5A 3IFDA 2CSIA 3C1FA 1NG2A 2PQWA 1YIJQ 5IGBA 2F5TX 3I4NG 1K9MC 2Z0SA 5FLMH 1X3QA 2F2WA 1F9QA 3M0SA 4A53A 5CKDA 1CQVA 2HDLA 5M5XH 2JA5H 4CI0C 1YP5A 1VDZA 2QA4A 4LF6L 1E0BA 3MEVA 4RH6A 1IBMQ 2VVKA 1GCQC 1AWOA 3TRZA 3LH5A 5GAHC 2M00A 3OWEB 2Y4XA 2MWOA 4XTVA 2K5VA 2NZHA 1WD0A 1YCSB 2UUCL 1Q81R 4IFDI 1B8AA 1IHZA 3CCSQ 4DV2L 2H5XA 2WAQB 1I6VC 1B4OA 4DUYL 2A5HA 1N9RA 3GNFB 1IKLA 4HEDA 2K3YA 1Q7YR 1IRXA 2PQEA 4ME5A 1MMNA 2IPOB 1IHVA 3L3OC 5CVIA 2PI2A 1Y07A 4CKCA 4M7DF 4J6YA 3D4RA 4E6RA 3W1GA 2DL7A 1LUZA 1VYUA 4QJFA 4DAMA 1KD1R 5GAN7 2A69D 4HMJA 4R8NA 1ZUYA 5EPKA 2R6GA 3PUXA 2B8FA 2CVRA 1SRUA 2WAQE 4LF4Q 3GTPH 1IO6A 1OPLA 1TOVA 3PFSA 4OONA 1LNXA 3BU2A 1EOTA 3JCMc 2HIXA 4RA8A 2GCXA 1VQJA 2SNSA 4FF2A 4A4EA 3AEVA 2R93B 5M3MG 5IXFA 2EXDA 4S3SA 1QWYA 2M1HA 3EGDA 4BE2A 4FXDA 1CZWA 2A6ED 2GFAA 1OXVA 1SEBD 2KMTA 4I7AA 3U4ZA 2HHHL 2I46A 3W2DA 5GMKi 2DXBA 2J7IA 1VQNT 4UP8A 2ROLA 1QCFA 3QOJA 3QR8A 2UU9L 1STBA 2FPFA 2G5DA 4L6TB 2V26A 3CKIB 2KEAA 2X4YA 1JOOA 2VGMA 1Y1VG 4DF7A 3KBXA 5FU6C 1PV4A 1WIEA 1N8RR 2O88A 2QEXQ 4DR7L 2L89A 1MMDA 4YWLA 2PW5A 2YV5A 4HSPA 4DNRB 3LW5E 1VF7A 2O5IC 2ASBA 5KYYB 2EFIA 4K6LA 4B9WA 4M77B 1E6GA 1OXTA 1Q90A 1B50A 3OOCA 5GAOr 1S5DD 2K75A 3SE0A 3TP6A 4JI0Q 1ABOA 4V2SA 4JBWA 5CV7A 4Y7NH 2XIDA 2YRCA 2AQ1B 4R9WA 4HJAA 1GUWA 3M0QA 1SNOA 3CBPA 3CPWA 1I4QA 5NUCA 3BDUA 2DD4A 2V8JA 1Y57A 5GAMe 1NTGA 1ZEQX 4P5NA 2UXCL 1MKHA 4JI1Q 3H41A 4RTUA 4GKKL 3OBWA 4JRKA 3UATA 1B44D 2M2LA 2V8IA 4A3FH 4M77E 4HT8A 3MWYW 3CCQA 2RJDA 1PFSA 5DM7R 3CC7A 2DXTA 4LNPA 3OYLA 2RI3A 3EHQA 1D7QA 4O0AA 3URGA 3S2DH 3KF8B 3OYIA 1BK2A 1KNAA 1YN8A 1YNND 1DGSA 3NTIA 3FB9A 5DEHA 2HQEA 2F0LA 3G4SQ 3TP5A 2JS0A 4D8KA 1Y71A 3CCLT 1PHJA 4DR6L 1Q86U 5ECAA 3UE1A 4RGNA 4EGVA 4L5SA 2EJGA 2OI3A 1U3OA 4J8OA 4OVAA 1WJSA 3NGPA 4C1NI 1QUQA 3TS0A 1DOLA 4A4HA 3EIVA 1HHVA 1SR3A 3DXJC 2ZAEA 2NYZD 4GN3B 4MZPA 2HBWA 3QWNA 4QIWB 2L8DA 5DM63 3RKWA 4OMLA 4PZ6A 2LFNA 1ASYA 3EAEA 1IBKQ 4JI7L 1ZHIA 2LRQA 3Q1JA 3VS2A 3CCEA 1PRLC 1VQPA 5IWAQ 1SSHA 2R5MA 4KT0E 1KLUD 4DEXA 1VQ9T 4WORA 3EHRA 2DIQA 2RDGA 3S16B 2A69C 3NELA 4YCVA 2NLUA 1VQLT 2K7AA 4FP5D 4FCYA 5HGQA 4DK1A 5HCKA 3Q6SA 4ZQ3A 1IZ6A 4QIWE 3MXNB 5CV4A 1N33L 3CC4Q 3OMCA 2QTVA 3SK6A 1CTMA 2KYBA 2EY5A 3HS0C 2FZCB 3J81i 1H9JA 4P75A 1TSFA 4RFBA 4HCEA 1WFWA 2LQKA 3WOEA 2O4XB 4NS5A 4RMOA 1M1KU 3CCMT 1QVFP 2JQOA 1Z9FA 1YHQT 1U8RA 5I22A 4ZUJA 1WNLA 3LGLA 1KC8R 2NWMA 1SG5A 2X9HA 1G8ZD 4HKEA 4Y91A 5GAMf 2RK2A 1SSOA 1Y7XA 1JMCA 4OO1I 3MTSA 2AUJD 4LF5L 4IALA 3M7GA 2GNCA 4FSXA 2EJMA 4P72A 1K83B 3PMFA 2Q8IB 3HOUB 3JB9I 5J3BA 3TSWA 5FU6B 5IY0A 1HJPA 5IXBA 1AZGB 4L6V5 3UDCA 2IT1A 5HURA 2BA0A 2PQAB 3C1EA 1U0LA 3RR5A 1UGSB 2Q8TA 1WXUA 1YJWA 3HRSA 4OL7A 5ELDA 2K50A 4GN5A 1BIBA 4V0BA 3E9IA 4RTYA 3J81E 3HKZB 3E19A 4XT1B 3RESA 2FXQA 4G7HC 1RCVD 1JB3A 2CZ6B 2E12A 2TMPA 4JZ4A 2AQ3B 3ULJA 2L2PA 3OYYA 1UDLA 3CHBD 1CM9A 1ZX6A 2RJCA 1KD1U 2JK8A 2R7FA 4X34A 2B29A 2Z1CA 2DL8A 3FKIB 2RJFA 1MJCA 1YNNC 2HNIA 3TVTA 2CREA 3HOVG 5CKFA 5DAUA 2EGEA 1BCPF 3GP7A 4X3UA 2YTXA 1EWIA 2E2HH 4X65Q 1K76A 4JS5A 2DXUA 2NVTH 1X55A 3P8DA 2RHSB 1GRIA 3HKZE 4PNYA 5CV9A 1G3SA 3S1NH 4NOYA 1YWPA 5IH2A 3GTOH 2JXMB 1A15A 2HMAA 2ESWA 5BR8Q 2PPBC 2RHUA 1XPOA 1AZPA 5I2SA 1M27C 2GBQA 2ZM6L 2PNRC 2DTHA 3RIRA 1I4PA 3JSCA 1YCYA 2ZXOA 4QMGA 5CGKA 2E76C 1K9AA 2JTFA 1Z9QA 1AW7A 4QVZA 1IREB 3E5SA 1B3AA 5C4XB 1JXOA 1STYA 3JCMg 3CMEQ 1VQEA 2F0PA 3JCMW 2OTLA 4HIKA 1B7YB 1AEXA 4A3LG 1VQOQ 1TU0B 1J5EQ 3A56A 1TWFB 1X6OA 5FRNA 2EYPA 1JE4A 4A3IH 4IUQA 1XNIA 3QIIA 1ENAA 1F2YA 1S72T 3UDFA 2YU9B 3VR6A 2F69A 1VQ8A 3JAML 4OO1G 4KN7C 1H9RA 1HNZQ 3EFOB 2GN5A 1KNEA 1GBRA 3JB9G 1VQ7A 2O9SA 4C3HH 3GTKH 1MMGA 1GBQA 4DV0L 5CR2A 1BI0A 2F3IA 4N8FA 1SMYC 4OELB 2K5FA 4BD3A 4BI8B 5LJ3f 2G3RA 4CC7A 1BBWA 2JA6G 2DO3A 2HCKA 4XU0A 5JEAG 4EMKA 4AYBB 2QK0A 1BCMA 4KHZA 1BO0A 1K9MR 5C5MA 2JSOA 3ME9A 4DNIA 5KYNA 5AT1B 1PH7A 4UP7A 1EIGA 1VQ5T 1OZ2A 5E1FA 4XTUA 2RM4A 4ZNXA 4A3EB 4O6JA 1Y14B 2DN8A 4IJHA 4GNXC 1EL0A 2H3JA 1B07A 1JEGA 1V1CA 4IJLA 3PGGA 3TDQA 1IBLQ 4QQ6A 3LLRA 1WI7A 1PTOF 3V8LA 1XTCD 2XWBB 3FRPB 3NWSA 4BBRB 2K6DA 2PVDB 4AYBE 1T0HA 3WOFA 3PO3B 3CMAT 1TUCA 4ZN3A 5IP9G 4G4KA 4KD3A 4LUOA 4Q5WA 1X43A 4JK1C 4XTWA 5GJVB 1SYEA 1VQAA 4K14A 4DQ2A 5CO7A 2DETA 2K04A 3EH2A 2C06A 2BOSA 2NUPB 2KGTA 1AN8A 4M78F 2DNUA 5ELBA 4CJ2C 4M7DA 3ERQA 4RHRA 5EKKA 1YI2Q 4LF9Q 1H9SB 3M0RA 2ALYB 3H15A 5GAMj 4CGYB 4RUGA 2EPDA 2WIIB 3BYYB 2GQIA 2EJGC 4M7DG 4MTKA 3M55A 4PJJA 1NMFA 1TKWB 3WWVA 1KLGD 4JG2A 4OWTB 4KBMB 3GV6A 5JJIA 4C8QF 3I8ZA 2F0SA 3SDZA 3J80L 1D2BA 5IGEA 1KQSS 3CXCP 3PO2G 1KC8U 4DPGA 4DEYA 3D6WA 5AFWA 3VR4A 5F2DA 5IHKA 1RAIB 3VA7A 1N36Q 5A2QE 2P4RA 2KRSA 3DKMA 2EYOA 3MXPA 3K57A 4A93B 2DYBA 2QXFA 4E7IA 2JA5B 5LJ5e 4NL2A 2QILA 3H0GB 2B2YC 3CQZB 3G71Q 2AK5A 4OHJA 3D7SB 2F0FA 3RN2A 3WVDB 1MGQA 5IYDG 2XDDA 3V7CA 1R9TB 2E5KA 2E70A 2EGCA 1HYOA 1H8KA 1JB0E 1B53A 1QCNA 3VYHB 1U5KA 3TBIB 5M5WB 1I81A 3EG0A 2Z4HA 3GTGB 1Y1WG 2R7ZG 4HCKA 1QMCA 1RKNA 5I21A 3JB9D 4M7AA 2TSSA 3P8HA 2HL3A 2YTVA 3GLXA 5M3MB 3PNWC 4A3MG 3S3OA 3CC2Q 3HRTA 8ATCB 2L12A 4JBKA 2BE5D 4KY7A 1V1PA 2XD0A 1ET6A 1MMAA 1AZEA 4M7AG 4JS4A 1HNWQ 1SFOB 3H3VI 3TQYA 1NZ9A 2CQAA 3RMSA 3EGDB 2E1HA 1JJ2P 2F0QA 2NYSA 1M2VA 1Y1VB 4PJOE 2J7ZA 1W6JA 2XMFA 5HK3A 2E3HA 3CCJQ 1OU9A 5ELNA 3K58A 1SNCA 2JA8B 4DBRA 1Z6HA 2EKHA 3ULPA 1E2ZA 1KQ1A 4LUEA 5CQXA 1L0YB 2RH2A 3CRLC 5M5YB 1CK1A 4JOIA 5GAGC 1YEZA 3V8JA 4C5IA 1G6ZA 4YCWA 1YJNA 4X62L 4L5GA 2CP7A 4ALPA 1K0XA 3SXHA 3A8JE 4XYQA 1BUVT 4JI3L 5IHIA 1NYGA 1PKTA 1DCZA 3E9FA 2DF6A 4LUVA 2R93H 2JYOA 2AWNA 2OAWA 4NXNQ 1QWEA 3VU3C 4GNXB 2C9OA 3ZL7C 3EG9B 3BVZA 4MZMA 4EDUA 1KDCA 1PH5A 2RI2A 3R6NA 2DK3A 3MCAB 1FL0A 3PF5A 1XPRA 2A8VA 1U1SA 4YWKA 2K79A 1QNKA 1NYFA 2YHTA 1VQFA 3GOXA 1VQ9A 1SE4A 1G8XA 1M30A 4G57A 4IN3A 2KE9A 5KYWA 2E5LL 2FFKB 5LJ5f
chains in the Genus database with same CATH topology
2LT4A 3MP6A 4RG2A 3M57A 4J6XA 1HZAA 5JJLA 1SROA 4PJOF 2VY3A 4K0KL 4N0AA 5EG2A 4KUIA 1FJGL 2EQKA 1VQKA 3D0FA 4HJ8A 2EKOA 1QUQB 4JUVA 3G6EA 3PF4A 1X3EA 3D31A 2AHOB 3OYAA 4B3SL 3F2DA 1NPPA 3M58A 3H6ZA 1CKNB 2QQ9A 5C0MA 3UDIA 4M7AD 1RIPA 5IYCH 4DR1Q 2VQFL 3HOYG 4NL3A 2GQVA 1XTDA 1G51A 4JI8L 3CCQT 3CW2C 3CC7T 5C6SA 4GOPA 1L2FA 1PH6A 3VYGA 4EX5A 4EMKC 5GMKl 4LF6Q 4HCZA 1IXRA 2VUBA 3ER0A 1B34A 4IFDJ 3RKXA 3I4MG 3L2UA 4GKJL 2ZZDA 5IYBG 1CSPA 4DUYQ 3S16H 2ZPFB 3CBOA 3JCMX 1G3WA 4PNOA 3OYFA 3RMQA 2X4JA 1EUJA 1D3BA 3X26B 1X54A 1Q46A 4OB2B 1JJGA 5DLOA 2UXDL 2OTJA 4A3DG 2Y4YA 3T9NA 3HPWA 1J6QA 3A74A 3V8KA 2XU8A 3BFMA 3MP8A 3CCRA 4JI2Q 3QHSA 2D0PA 2XHCA 1CUKA 1H95A 1M90U 1X3GA 1FVIA 2JZ2A 2WFWA 3NEMA 1KL9A 2P0QA 3ZJYC 3VKIA 4IPGA 3I56T 1K83H 3HOUH 2PMZE 1S72A 2IY5B 4DR7Q 3KF6B 1AHJB 4YWMA 4R1JA 1DJ7B 1A0IA 4ELYC 3MEUA 4EMHA 4JRPA 3CF5A 4R4OA 1PH1A 1PH9A 5LMUQ 3QDRB 5GMKe 4DV6Q 2VQEL 3KOJA 2UUAQ 4WJ3M 5LL6S 2MO0A 4OXPA 1YJ9T 2E6NA 4ZTFA 2UXCQ 4XTYA 3FKIH 1UGRB 5D6WA 4HCCA 4M7AC 5GANg 1I8FA 2I0QA 4OX9L 4F7UB 2E8GA 5LJ5j 1UE1A 5L8RE 5FJ8G 3MEWA 4LFBQ 1Q82C 3QZ9B 5FLXc 5LMNL 3CMAA 3ERSX 3L2QA 3PUVA 3BZKA 1OXSC 4DR6Q 1G291 3J7AF 4F7UE 5C4XH 4M78A 4JOIC 1XNQQ 4EMKB 2MWPA 1OXXK 2CKKA 1QVGS 4L5TA 3RLFA 1WOCA 1GD7A 5GAN2 1N34Q 2KENA 5HY6A 4JI7Q 3CEYA 4R4QA 4M78G 1TWFH 3L2PA 3CD6A 3K0XA 3PMIA 2YU9H 2JEAI 3OBYA 4LF8Q 4C8QA 2XK0A 1EIFA 5AJ3L 4KLKA 2DD5A 2OTLT 1W2BA 4HA8A 3OW2A 3CCST 4C8QG 4C92D 1N33Q 4DV4L 1SMXA 4DR4Q 3JAME 3OA6A 4A4FA 5CKBA 1W3SA 1VQ8T 1XMQL 1WI5A 2RHQB 1PH3A 3M9QA 1Q8KA 4X64L 3CCVT 2LCLA 3K7UC 1UE6A 4N0AC 1NJIC 1JB7A 2D6FA 4DV5Q 2BUDA 3OYNA 1K8AU 4A3EH 4F7UF 3FJPA 2YLBA 1E22A 4XIGS 3FIFA 3OYCA 4BBRH 1VIEA 2ID0A 3DLMA 2EQMA 1L1OA 3LGJA 1WJRA 3PO3H 3JB9J 4POGA 4DR3L 2ATWA 2N49A 5IAYA 1HXDA 2IHFA 4QL5A 3E1SA 4XTZA 2PU9B 5C4JH 1NPRA 1GVPA 4M75F 5FLMG 1YNXA 4R4CA 2IX1A 4HIDA 1N6AA 5D6XA 3TEHB 2JA5G 2ZGWA 3META 4YY3L 2HAXA 2VUMG 3M4GA 2RA2A 4M7AB 2RHZA 3MEAA 3KDFA 5GAMd 1UE5A 4BACA 4XU1A 2P0PA 3N5BB 4DV7L 1YHBA 3L1AA 4OWWB 4A93H 3J80E 5EAYA 4A4IA 4M78D 3H0GH 2JE6I 2Y0SG 3CQZH 3QJ6A 5KCHA 1PYSB 4B3TL 4FM4B 2FYKA 1R9TH 3SWNC 4DV1L 3T1HQ 5M5WH 4IO9A 4GY5A 4IPDA 2MO1A 2UXBQ 4R4IA 3LWHA 1I94L 3L2RA 2MQHA 2LC4A 4J6WA 3PSIA 3LX7A 4DV3L 3OYJA 4C92C 4PJOG 2D0OA 4A75A 1SFOH 3VUZA 4YTLA 1VS0A 4IPHA 3OTOQ 1NBWA 1Y1VH 3Q8DA 3EFSA 5IN1A 2A19A 2JA8H 2QQRA 3JCMe 2NZOA 1KAWA 1M1GA 4E7KA 5M5YH 5IT9c 2VC8A 2XDPA 3FHWA 3MEFA 3UDGA 1LTLA 4JI5Q 1BKBA 4DR5L 3NTHA 3LH0A 3J7A5 2WB1G 4A3FG 1UGPB 5CK9A 1YJNT 1KRTA 1HK9A 1Z47A 1GXIE 1M5Q1 1M4ZA 4AQYL 1XNRQ 4HIOA 2XICA 3CPWS 3M4YA 2HIVA 3RZDH 5LJ3d 1TWCH 2ZPHB 2LTOA 3EBEA 2K4YA 2AMCB 5KH6A 5M3FH 1VQ4A 1TWHH 4C3IH 4MDWA 4M77F 2E2JH 5GAMh 3AHUA 4BI3A 4IUVA 1VQKT 2RF4A 3G6ET 1N9SA 3I56A 1SLJA 2XG8D 3JCMf 2RI5A 1PYBA 3PV0A 4DUZL 3SWNB 5FLXE 3JCMb 2D62A 5CIUA 4LFAL 2BA1A 4GLKA 2JVVA 3BY7A 2GFUA 1SE8A 4DAYB 4C92B 5GAN5 1Q81U 1YJ9A 3F1ZA 1BI3A 1Y96A 2N3SA 2WSFE 3A5UA 1Q7YU 4KHPL 4IOCA 2E6ZA 2RHXA 5CCAA 3I2ZA 4BXXH 4A3CH 4CRIA 2DZ9A 1LOJA 4C92E 3M4PA 3NBHB 4BY7H 3HL8A 2EJ9A 4LFCL 4JBJA 2K2VA 3PIOA 2RD1A 2OTJT 1YIJA 1QVCA 1WPYA 3O8VA 3CCRT 1N8RU 2LXJA 3F8TA 3UE0A 4XU3A 5GAOn 2E5LQ 3HHTB 2O01E 2JA7H 4DR2L 4DKAC 1I5FA 3CCSA 1QVFA 4LF4L 3E9GA 4K0KQ 4IKFA 2PVOB 4EMGA 4AIMA 2XTIA 5LJ3h 3STBD 2AKWB 3QJYA 2EJFA 3CCVA 1XQHA 2EWNA 3OB9A 4B3SQ 4BA2I 2VS1A 2LVMA 2P4TA 2Q2TA 2KSSA 3M59A 3F2BA 4OMFB 1T9HA 4FL6A 3QXEB 2RCNA 2WACA 4X66L 2E5QA 3JB9H 2LCCA 2KY9A 1PH4A 5CKEA 2VQFQ 4JYAL 4B3MQ 2EAYA 2F4VL 4JI8Q 5LJ5d 1KXLA 4M75A 3TEEA 1WJQA 1BIAA 2CWAA 1G3YA 2QEXA 2CWPA 1JE5A 1HR0W 5IP7H 4JI1L 3OYKA 2XGTA 2KHIA 3MO8A 4M75G 4BA1I 1BI2A 2B3GA 5KE2A 2IHEA 1XMOL 3PUWA 4JRQA 2R58A 3T1YQ 3OSSC 1TWGH 1KRSA 4N4HA 3S24A 2DPPB 1KHIA 1OTCA 3AYHB 4UP9A 4PL6A 3KYHC 5KE3A 3GTGH 1NE8A 3HFOA 5GAOm 1O7IA 1E7ZA 3CD6T 1VQHA 3CCJT 4DK6C 4A4KA 4BY1H 2ZPIB 5IT9E 3S2HH 4P74A 2JNGA 1IBKL 1BYMA 4PKCC 4BDYA 4A3GG 2DAQA 5IWAL 3HOZH 2VZAA 3G4SA 3LWIA 4YHHL 1MHNA 2OCEA 1Q86C 1G5VA 4LF7Q 1P16A 3A8MB 1WQ7A 2CFMA 1VIFA 3KDFB 3STBC 2ZCFB 3DM3A 5IYDH 1TXYA 1ASZA 3L0OA 3HOWG 4C0FA 1CKMA 3GIBA 3JCMJ 4JC0A 3AQQA 4OB1B 1AE2A 2JTMA 2PI2E 3VDYA 3CC4A 1YZ6A 3K80C 3JAMc 3K7AH 1L0WA 3KBGA 2R5AA 4OB0B 1MIUA 1KQ2A 2WAQG 4ZN1A 4RG8A 1M1KC 2KCMA 1X9NA 4LNQA 2KCTA 2ZPBB 3VV0A 3FP9A 2LT1A 4TQUS 4YCUA 4MZ9A 5LJ5h 4GLVB 5GANe 3L7ZC 3J7ZC 3U58A 4JI4Q 4BBSG 2R93G 4M7DD 1I50H 1ZBXA 2FB7A 3CXCA 2RO0A 1C0AA 3A8HB 3VJPA 2R92H 5AJ3Q 5BR8L 4M77A 1NJIU 1KD1C 1H641 2ZJQA 3GNGA 2Q2UA 4DV4Q 1CKOA 4M77G 2E41A 4ZTJA 4L5QA 1XMQQ 2K14A 4HCBA 4XK8E 1UGQB 4A3JH 3OS5A 1K9MU 1HR0Q 4X64Q 3J80c 2LSSA 5JJKA 1IYJB 1J5EL 4XTCS 1JJ2A 2YLCA 1WFQA 1HNZL 2DZCA 3KFUA 3CMEA 2Z6KA 4DR3Q 3NTKA 4N4IA 5IYCG 1VQOA 3JC66 4DK3C 1X65A 5GAOq 4LWCA 4GN4B 3IRBA 1YVCA 2M16A 3I55T 2UUCQ 3M53A 4DV2Q 5GANf 2LDMA 2K3XA 3M3YH 1FX7A 3PMTA 4YY3Q 3ZEHA 4A3KH 1IBLL 2VNUD 2PUOB 4QVCA 3I4MH 2B63H 4IURA 3S6WA 1CSQA 3GTQH 1P8LA 4LW1A 4DV7Q 1Y96B 4P71A 2OAUA 3OMGA 2YRVA 4M7DC 1VQ4T