1YNZA

Sh3 domain of yeast pin3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'MEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pin3p
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ynzA00
2ROLA 1AWOA 1ZBJA 1E6HA 3JV3A 1I1JA 2J06A 2P4RA 2CUBA 1UDLA 5GJWB 2C0IA 1YNZA 4CC2A 3H0HA 1H8KA 3UF4A 2J6KA 1KIKA 1K9AA 2LQWA 1M3AA 1X43A 4Z88A 3PVQA 3VRYA 2A37A 1PKSA 1VYVA 3R6NA 3PVLA 1WLPB 2HBWA 2HCKA 1QWEA 2OJ2A 3VS3A 1SRMA 2SRCA 2HDAA 1ZUYA 2LJ1A 1UFFA 1QLYA 2GGRA 2LQNA 1AD5A 1U5SA 3QWXX 4GBQA 2FG0A 3M0RA 3THKA 1JQQA 3LH5A 4D8KA 2KGTA 4ESRA 2F2WA 2KE9A 2EGAA 2K2MA 4AFZC 1GL5A 1OV3A 2L0AA 4AFQC 2IIMA 1YWPA 4AG2C 3SEMA 3EHRA 2DF6A 1MUZA 3CQTA 5IHIA 1RLPC 2M0YA 1WIEA 3VS4A 1AZEA 2ABLA 4CC3A 2X3WD 1A0NB 2PNIA 1T3LA 4RTXA 2KT8A 4J9FA 2KXCA 3H41A 4D8DA 2DL8A 2JM9A 1XOVA 2M51A 2DLPA 2DE0X 4HCKA 5IHNA 1Y57A 2EVRA 1AWJA 4LNPA 2AZVA 1UHCA 1WYXA 3EG0A 4EIKA 4Z8AA 1KJWA 2EYWA 2FPEA 4RTZA 3H0FA 2O88A 3VS1A 4KRTA 1SRLA 3I5RA 3REAB 2K7AA 1FMKA 4IIMA 1LCKA 2YUPA 2RPNA 2GQIA 1CSKA 1YWOA 4LE9A 5I22A 2C0TA 1VYTA 2D8HA 1WFWA 3TSZA 2K9GA 2FRYA 1QKXA 4RUGA 1WXUA 4J9BA 4DEYA 2DBMA 1SSHA 1YCSB 2RQUA 3I35A 1GFDA 1YN8A 3O5ZA 5IHKA 2DRMA 2VVKA 2GNCA 1YP5A 2JMAA 2CT4A 4RTYA 1WX6A 2XMFA 2NWMA 2RNAA 4E6RA 2DA9A 2V1QA 1RI9A 4OMPA 1OPKA 1QKWA 1SHFA 5FWBA 1GBQA 2DX1A 4IIOA 2L3PA 1ZLMA 1K0XA 4HVWA 1W1FA 1X6BA 4HXJA 2YDLA 2A36A 1W70A 2EW3A 2NUZA 2OI3A 3NGPA 5FWCA 3EG3A 2ECZA 3IQLA 2CSIA 2PZ1A 1G2BA 2DMOA 1ABOA 2W10A 4JJDA 2BZXA 2L2PA 2PTKA 1WDXA 5FW9A 2JM8A 2GTOA 2O31A 2ESWA 1W6XA 1U3OA 1UE9A 4LUDA 1ABQA 1NLPC 2K3BA 3NHNA 4J9DA 1BB9A 2O9SA 2RMOA 1N5ZA 2RQWA 2CH4A 4M4ZA 2L3SA 2CREA 2EYZA 2JS2A 2QDLA 5ECAA 4A63B 2DL7A 2DL3A 2EPDA 1PRMC 1K0SA 1TG0A 2YT6A 2DL5A 5GJVB 1AWXA 4OMMA 3VS0A 4RTTA 4AFUC 3KFVA 1NG2A 1FYNA 1SPKA 2DM1A 1JU5C 1X27A 2JXBA 2RQVA 1Z9QA 3VRZA 2K6DA 1PKTA 2DRKA 2F2XA 2FEIA 2DJQA 3PE0A 3VS6A 2ENMA 1K76A 1NEBA 1WA7A 1ARKA 3M0QA 4JJCA 1NYFA 3C0CA 4RTUA 4R0KA 2YSQA 4HVUA 4DEXA 5IXBA 3I9QA 4JJBA 4LN2A 1J3TA 1EFNA 1UTIA 1CKBA 3ZL7C 3RBBB 1PNJA 1E7OA 3EGUA 1RLQC 1T3SA 2CT3A 2YUNA 1QCFA 1UJYA 2LZ6B 5I11A 2J7IA 1HJDA 1NYGA 4ZNXA 1QWFA 2KROA 1WI7A 2LP5A 4F16A 1KFZA 4OMNA 2D1XA 1BK2A 2K79A 2BZYA 2I0NA 2EKHA 2KEAA 2VKNA 1T0HA 1HD3A 3A98A 2F2VA 2EGEA 2FPFA 1OEBA 2VWFA 1K4US 1NLOC 2RQTA 4JPBW 1E6GA 4OMOA 1AWWA 1SEMA 2A28A 3NPFA 4Z89A 1ZUKA 4AFSC 4FSSA 1H3HA 1K1ZA 2J6FA 1BU1A 1M3BA 4Y92A 1TUCA 1G83A 4WCIA 2AKLA 5EC7A 2BTTA 2CDTA 2LNHB 2LMJA 3NMZC 1MV3A 2ED1A 1UECA 2EGCA 3EHQA 1VYUA 1AVZC 3TVTA 3M0SA 2FRWA 1HSQA 2JTEA 2KNBB 2ROTA 2HEQA 2KT1A 3UATA 2ED0A 2JMCA 2D8JA 2YUOA 5HCKA 3U23A 1M30A 1UG1A 3VS5A 2O2OA 3I5SA 1S1NA 3GBQA 2JS0A 1SHGA 5IH2A 2OAWA 2KRMA 4F14A 3UA6A 2HSPA 1B07A 3VS7A 3REBB 2GTJA 4F17A 1RUWA 2LX7A 2DNUA 2V1RA 1WXBA 2W0ZA 1X6GA 4RTVA 1Z9ZA 2DYBA 2RQRA 4CC4B 1H92A 1WXTA 3ULRB 1X2QA 2FO0A 2KXDA 3H0IA 2KYBA 1MV0B 2KRSA 4LUEA 2JW4A 4JZ3A 4AG1C 1TUDA 1X2KA 4CC7A 3EG2A 2B86A 1UGVA 2KRNA 1AOJA 4X1VA 1JXMA 1NEGA 1UHFA 2J05A 2DL4A 2C0OA 1PWTA 1GRIA 2L3QA 2D0NA 4J9HA 1PHTA 2E5KA 1PRLC 3M0TA 5L23A 1JEGA 2KBTA 2KYMA 1CKAA 4JZ4A 4HVVA 2JT4A 2CUDA 1X69A 1AEYA 2CSQA 2DILA 1JXOA 2AKKA 4J9EA 5IXFA 2GBQA 1BBZA 1IO6A 3SHWA 1KSWA 1GCPA 1M3CA 3M0PA 4QT7A 2EQIA 1Y0MA 2EYYA 2CH4W 4GLMA 1GFCA 3M0UA 1ZSGA 3TSWA 3EG1A 1I07A 1T0JA 1VA7A 1M8MA 2AZSA 1I0CA 2A08A 2BZ8A 1GBRA 2SEMA 3UA7A 4OMLA 1GCQA 2AK5A 4K11A 2MCNA 1AZGB 3FJ5A 2LJ3A 1UUEA 2MOXA 1JO8A 4J9GA 2RN8A 1U06A 1OOTA 1ZX6A 4J9CA 4ORZA 2O9VA 1NM7A 4J9IA 3RNJA 4OMQA 1M27C 2MIOA 1UJ0A 2DVJA 2H8HA 2YUQA 1OPLA 1B3QA 2EYXA 2DBKA 2G6FX 3VS2A 2X3XD 3QWYA 4RTWA 2LCSA 1ZUUA 2RF0A 2LJ0A 1V1CA 2J6OA 2EBPA 1GCQC 2FPDA 2KR3A
chains in the Genus database with same CATH superfamily
2V8IA 2M16A 5KYUB 1ZBJA 3JV3A 1M2VA 5A0GA 2KVQG 1UDLA 1QW1A 2DXUA 1YNZA 4M7DA 3OW2S 3CXCA 4HT9A 2DVEA 3HSBA 2LQWA 1QVGS 4E7KA 3EG9B 4MDXA 2A0FB 4M75E 3VRYA 2A37A 3MEVA 3JAME 3ASKA 1K8AU 2E70A 1BI3A 1WHJA 3TREA 2OJ2A 3CCQA 1H641 2SRCA 5GAOr 4X34A 1QLYA 1N9RA 2RK2A 3A8LB 3QWXX 1ZQ1A 4GBQA 3JB9G 4OVAA 4IUVA 3SWNA 1D3BA 2FG0A 5AYFA 1DJ7B 5CR2A 3LH5A 5DLOA 3L2WA 1LVKA 2EGAA 3ZFJA 3M55A 2F69A 1OV3A 3ER0A 4JUVA 4RKUE 2QQRA 4BUGA 2OTJQ 1MUZA 2M0YA 1Y7XA 3VS4A 1NPPA 3E2UA 4C0ZA 4KT0E 1PD0A 1A0NB 3QYGB 3H9NA 1Q95G 3NTHA 4JS5A 5FU6B 2RJFA 3LYIA 2DTHA 2DTOA 4D8DA 2DL8A 2R57A 3PIOA 2BKDN 2BIVA 2CKKA 4RCCA 4HCKA 3QJ6A 2DD4A 1VQOT 3OYJA 2AZVA 2HL3A 5KE3A 4A54A 1Y96A 5LJ3d 4KRTA 2RB6A 4N4IA 1SRLA 1ZSZA 1M2VB 4TVRA 3CEYA 2XU8A 1IGQA 1C1AA 5KYWA 4M7DB 4M78G 1LCKA 3NTIA 3FLGA 3OBYA 4ZGDB 3HPWA 2YUPA 4BI8B 3CCET 2FL7A 2FZKB 5KYYA 2XICA 5LJ3f 1PC0A 2C0TA 1VYTA 1WFWA 2X4WA 2P4TA 2EAYA 1QKXA 1KC8C 1Q82U 1WXUA 3CCLA 2CP7A 4N0AC 4Z02A 4LDVA 2GFAA 5LJ5d 4KGVB 1Q7YC 4VUBA 2QI2A 2OTLT 1YP5A 1D3BB 2JMAA 1K9MC 1S72Q 5GAN7 4IUTA 2DA9A 5AT1B 2FHDA 1GBQA 1Q7YR 1M90R 1I5LA 4B6MA 1QVFA 1ZLMA 3OA6A 2XDBA 4C92F 4HCBA 5LJ5f 3CCQQ 1W1FA 1KD1C 1Q86U 3L1AA 4HXJA 2DYIA 2YDLA 5D6YA 3CCMT 2NUZA 4EPCA 1RACB 3EG3A 5FWCA 3O8VA 2PZ1A 2DMOA 1NZ9A 5GAN5 1KD1R 1LNXA 2PTKA 1JJ2A 4FYVB 3JCMV 2JM8A 1W6XA 2YRVA 1O75A 1BCMA 4LUDA 3MKDA 5GANh 5HKCA 1R8OB 3OMGA 3NHNA 2X51A 4C8QG 2CH4A 3QBYA 2K3XA 1IXDA 1RADB 4EMKA 2DL3A 1PRMC 1Y96B 1PCXA 3MP1A 4M78A 1TUGB 2YT6A 1ZSZB 1WNLA 3CMAA 4PJOA 1AWXA 3HTRA 5KYWB 4HKEA 4FT4A 4RTTA 3CD6Q 2CP3A 4A4KA 3MP8A 1FYNA 2DM1A 2XDDA 3OB9A 3P8HA 5KYYB 4XTYA 3QZ5B 2XI9A 1X27A 2JXBA 1Z9QA 5I2MA 3PE0A 2FEIA 5A0DA 2E64A 3J7AF 4BE0A 3FRNA 4JJCA 3DLMA 4RTUA 7AT1B 2YSQA 4C0DB 5IXBA 4JJBA 1J3TA 3I55T 1CKBA 3ZL7C 3RBBB 1PNJA 1VQMA 3G6EA 2YUNA 4FYWB 4R55A 2PUKB 1BIBA 4ZNXA 5C6SA 5DM7R 3QIIA 4BY6B 4PL6A 2EYQA 2LP5A 1MHNA 2QA4T 2KK4A 3CCLQ 2I2LA 4EDUA 4C8QE 1K4US 4J6YA 1YI2T 1NLOC 2QTXA 2RQTA 1E6GA 3BDUA 4E47A 1AWWA 4LD9K 2A28A 1K1ZA 1WPYA 2J6FA 4DOWA 1G83A 2HMAA 4WCIA 2AKLA 2ZZDA 3CPWA 4OMFB 3CCSQ 2ED1A 2R58A 3CCUA 2ATCB 1PG5B 3TVTA 2E65A 2JTEA 2ROTA 1M1KU 4EMKB 3CBPA 1TWBA 2JMCA 4M78B 2MPXC 1PSFA 2E3HA 3BFMA 1OZ2A 1UG1A 3VS5A 1VQ9A 1OU8A 3E9GA 4PJOB 4BI4A 3ZBDA 3OYLA 2HL5C 4F17A 3LW5E 3VS7A 5J39A 4E7JA 2LX7A 1JBMA 4PNOA 1X6GA 1Z9ZA 4KULA 2RK1A 2JTMA 4CC4B 1RABB 5CQYA 3HL8A 1FX7A 3ULRB 1YI2A 2O01E 1FMWA 2KYBA 1MNEA 2KRSA 3AHUA 3ME9A 4JZ3A 2VXFA 4ZGEB 1X2KA 2KRNA 1M1FA 3CC4T 3CC7T 3L2ZA 5FU7C 1UHFA 2MF2A 2C0OA 1GRIA 1KK7A 1PHTA 2AIRB 1PRLC 3M0TA 1JEGA 1VIEA 4M7AG 2KYMA 5LJ3h 1MNDA 2MMPA 2JT4A 2GCXA 3QZ9B 4E7SA 1BI2A 1X69A 2RHZA 4OB0B 1AEYA 2CSQA 4J9EA 2GBQA 5HK0A 1KSWA 1D0XA 3M0PA 2M9UA 2CZ1B 4GLMA 2CH4W 1VQMQ 3G6EQ 1ZSGA 5GMKm 1JB0E 2XD0A 1WJRA 2AZSA 5GAOn 3A8OB 2A08A 4C92D 2EJGA 2VB6A 2KI7A 2BE7D 4DBQA 2GFUA 4OMLA 3L2QA 1WHKA 2AK5A 4K11A 2DFUA 1AZGB 4ZTJA 2LJ3A 2RHYA 2X4XA 1VQPQ 2FVUA 1WQ7A 5LJ5h 1U06A 4Q5WA 3CC2T 2F5KA 4IURA 1NJIC 3OSSC 3FC3A 3FB9A 2O9VA 1NM7A 3RNJA 3CC4A 2A3LA 4OMQA 1UJ0A 2YUQA 1OPLA 3SFMA 1SSFA 3VS2A 3OS0A 3OYFA 2X3XD 5GANj 3CXCS 2L89A 3CCRA 2O4XA 1ZUUA 3CCUQ 1I4K1 1I81A 1GCQC 4M7AE 4B9XA 1AWOA 2PUOB 1OX8A 2J06A 2CUBA 1VQ9Q 1OU9A 5GJWB 2C0IA 2DETA 2RJCA 3OS1A 2J6KA 1B7TA 1M3AA 3A1PA 3CCVQ 3EH1A 3T9NA 5GAOq 4Z88A 3BDLA 5CQXA 1IGUA 1PKSA 4FL6A 1VYVA 2K57A 3PVLA 4PJMA 2HBWA 2HCKA 5FLXE 1VQKT 4DBRA 1RAEB 4DQ2A 1SRMA 4BE2A 5GANg 3HRUA 1XJWB 2DZCA 3E9FA 3PFSA 2GGRA 2LQNA 1AD5A 1U5SA 3TU4K 3CPFA 2MI6A 1GXIE 4D8KA 5D6WA 1BYMA 1GL5A 2KE9A 2QGGA 1VQ7T 1KQ1A 2JUFA 3HP9A 1OI1A 4AFQC 3PT9A 1YWPA 1LOJA 5CAIA 1X01A 4RG2A 4J7FA 5IHIA 1RLPC 2RI5A 8ATCB 2ABLA 3OYIA 4C92C 2X3WD 3VV0A 2QYZA 2PNIA 2VASA 4RTXA 3OYCA 1VQ8T 1TS9A 2BUDA 1KG1A 2RA2A 1VQLT 2LT1A 4F7UF 2DE0X 4O6JA 3X20B 3D7SB 2EYWA 1AT1B 2L3RA 2FPEA 3H0FA 3VS1A 3L42A 3REAB 3S6WA 3RKWA 1M9SA 1I5OB 2MWPA 2LCCA 1D09B 2B8AA 3PIPA 3OYMA 2V8KA 3CXCP 2YRCA 4IIMA 1G3WA 3CCRQ 1KC8U 5DY9A 1YWOA 1Q81C 3X28B 5I22A 4J83A 4WTOB 1QVFS 2RO0A 4F04B 1Q7YU 1M90U 2DBMA 1Q81R 2CGHA 4E7IA 1U8RA 1YCSB 4M7DE 1IHVA 3MEAA 2VGNA 2QEXA 3NTKA 2GQVA 2XMFA 4XAXB 4E6RA 2DJZA 2V1QA 4OMPA 9ATCB 1SHFA 5FWBA 1KD1U 5LJ3j 3LWHA 5GMKj 4FW1A 4IIOA 4OB3B 3OYEA 3FDRA 3G71A 1KQSA 3VUBA 4NL3A 1YJWQ 3TEEA 2VGMA 1VQ6T 2AHJB 2CSIA 1ABOA 2W10A 4MZMA 2VUBA 2O31A 1YIJA 1U3OA 1ABQA 3PGGA 1IHWA 1NLPC 2P84A 2K3BA 1KQ2A 3WVEB 3HFOA 1BB9A 2OX7A 5LJ5j 4EMHA 2EYZA 1LPLA 2CZ7B 1ZA2B 2DL7A 2EPDA 2D0QB 2LC4A 1TG0A 3EFOB 5LJ3g 2CP6A 4PFOA 4KBMB 1W2BA 3R6OA 3M9QA 5CKEA 3JCMd 4KGXB 4QQ6A 1SPKA 4CRIA 2QQAA 1JU5C 2K2VA 2EJFA 2RQVA 3CMEQ 2JVVA 3VRZA 3L2UA 3VS6A 2ENMA 3PNWC 4QQGA 1WA7A 4MMLA 5A2QE 3JCMf 2CP2A 2DO3A 3C12A 3MEWA 5GAMf 1VQ5T 1SKUB 4DEXA 4HA8A 4LN2A 4N4HA 1MMDA 2QK0A 1UTIA 3MO8A 1QP2A 4XTUA 1E7OA 3TCJA 3EGUA 1RLQC 5LJ5g 2CT3A 2LZ6B 5I11A 2J7IA 5GAOl 1HJDA 1B34A 1QVFP 4XTVA 4F16A 3OYHA 2ZPBB 4PJOG 4OMNA 2LTOA 2EKHA 2VKNA 2WSFE 1T0HA 4FYYB 2VWFA 1YJ9Q 4E7LA 3GF5A 1UGRB 1N27A 4OMOA 1O9SA 3UDCA 1LJOA 2QEXQ 5FU7B 4Z89A 1D1CA 3G1JA 1JJ2P 4Y92A 2BE9B 1N9SA 3KUFA 3JCMQ 1KC8R 1V29B 4PFPA 1PD1A 2LNHB 2LMJA 2AT1B 3NMZC 3GPLA 1MV3A 1VQOA 3EGXA 3EHQA 2H3EB 3ZEHA 3I56T 1D0YA 1K9MR 3G71Q 2KNBB 2JOYA 1ACMB 2ZPIB 1Y07A 4C5EA 1VOMA 5LJ3e 5GMKe 2YUOA 2D8JA 3S3OA 1MMNA 5HCKA 3N5BB 3U23A 1RL2A 1M30A 5CKDA 4BDZA 3UPUA 1S1NA 4FCYA 2EJ9A 4F14A 3QDFA 5GAN3 4AMCA 2RHXA 1YIJQ 3RUXA 3REBB 2GTJA 3CCEA 3RDVA 4RTVA 4M78E 2DYBA 4GLKA 1QCOA 1YCYA 4C92A 3S3NA 3JCMW 3H0IA 4PKCC 4PJOE 4M77D 5KCOA 1MV0B 4LUEA 2COWA 2JW4A 3UWNA 1TTHB 5LJ5e 2M02A 1UGSB 2JTFA 3OW2A 3RMSA 2OTLA 2B86A 1UGVA 1QVGA 3V7RA 3HHTB 1B34B 2L3QA 4XTXA 4FM4B 2DK3A 3I56A 4JS4A 2RM4A 2D9TA 2DTIA 4A4FA 5L8RE 3M5AA 4HVVA 2RI3A 2P0KA 5FROA 2CUDA 4FSXA 3JB9J 3VYGA 3CCMA 1BBZA 1IO6A 1GCPA 4QT7A 2EYYA 3EG1A 1PSEA 2CS7A 1T0JA 3CPWP 1M8MA 4M75D 3LWIA 4DBFA 3UA7A 2QXFA 3EGXB 1NJIU 2YLCA 3FJ5A 3QSUA 4ZN1A 4LXCA 4P5NA 4XQ3A 4J9CA 1VQNT 4L5GA 5FRNA 4C8QF 1VIFA 2HQXA 4J9IA 2MIOA 4PFZA 2E10A 2DBKA 2G6FX 3JCMb 3V8JA 2NYSA 4N4GA 4RTWA 2LCSA 1VQOQ 1H3ZA 4R56A 1VQ4T 1G8XA 4FIBA 2K5LA 1TSFA 4C92B 2VXEA 2QQSA 3M53A 3META 1MGQA 2DXCA 2P4RA 3PMTA 3I55A 1F1BB 1MMGA 2DIQA 3CCEQ 1I8FA 4ZGJB 2Y4XA 3OYAA 1TXQA 3PVQA 2P0QA 4M77C 2QA4A 4QVDA 3R6NA 1WLPB 3HKSA 4NS5A 3VS3A 5A0LA 3PTAA 5HY6A 1RAGB 1VQNA 1YHQT 1UFFA 3JCMh 4KUDK 4KGZB 4PLIA 2OTLQ 3GNGA 2QTVA 3CMAQ 3BY7A 3THKA 1JQQA 3LLRA 4MZPA 2KGTA 3RR6A 5M9OA 2LX9A 1YITT 2V8JA 3P8BB 4AG2C 2DF6A 2LNVA 3MHXA 5GMKh 4OB2B 3EFSA 3CCMQ 4CC3A 4JRKA 1G3TA 4M75C 4UC4A 1QP3A 1T3LA 2M0OA 3MP6A 1N8RC 1YJNT 3H41A 3SWNC 2KDSA 2JM9A 1XOVA 2M51A 2DLPA 1Y57A 2EVRA 3M4GA 2JZ2A 1N8RR 1K73C 3G4ST 3CBMA 1UHCA 3EG0A 4EIKA 4Z8AA 2XK0A 4N0AA 2E6NA 1KJWA 4O5VA 1YHQA 4RTZA 3CCJT 3A8MB 4OF1A 1K73R 2HNIA 1WZOA 2K7AA 4NOYA 1Q81U 2WSEE 3CC7A 2EIFA 4YTLA 1NJIR 2K9GA 2QG9B 2FRYA 4X9CA 4J9BA 4DEYA 1M4ZA 4L59A 2RQUA 2HQHA 3A5ZB 2R5MA 2VVKA 3I55Q 2GNCA 4PK4A 3UT1A 2CT4A 4RTYA 2GF7A 2NWMA 3OYYA 1BKBA 1OPKA 3G4SA 2DX1A 2RJDA 1IZ6A 3KXTA 3CCJA 3MEUA 3WXMB 2OTJT 1X6BA 5KE2A 5CVIA 5IAYA 1YI2Q 3CC2A 2FZCB 4F7UG 4ZTFA 2YWWA 1W70A 2OI3A 3M54A 3NGPA 3VYHB 5CKBA 2ECZA 3QPHA 3IQLA 1W2BS 4C0DC 4JJDA 3LGLA 2BZXA 2L2PA 3RKYA 3JCMX 1XQHA 2WSCE 1WDXA 2FYKA 5FW9A 3RMQA 3OYGA 1UE9A 4CI0C 2HKNA 2O9SA 2L5QA 2RMOA 3V7SA 2RQWA 4HT8A 4XU2A 3WVDB 2QDLA 2CREA 2JS2A 2JN0A 2LVMA 4OGEA 4C8QD 5ECAA 4A63B 3GOXA 1K0SA 2ZPGB 2IPOB 2DAQA 2NUTA 4DA4A 2RJEA 3S3MA 1RI0A 2EFIA 3VS0A 4A4GA 1Y71A 2VC8A 4L6V5 3M57A 5IN1A 1UGPB 2DD5A 2R5AA 2JNGA 1VQKA 2DJQA 4J6XA 1ARKA 3VU3C 4C5IA 3OBWA 1TOVA 2DEQA 3SDZA 4R0KA 2RHIA 4HVUA 4EMKC 2XIDA 3EFOA 4A4EA 4M78C 3I9QA 2M1HA 1EFNA 4FU6A 3CC7Q 3CC4Q 3JCMP 1T3SA 4M77F 2KY9A 1SG5A 1S72T 1QCFA 4GY5A 1NYGA 3JCMc 1QWFA 3VJPA 1VQ7A 2KROA 4F7UA 1KFZA 4E7HA 1KQSP 2D1XA 1BK2A 2DPPB 2K79A 2I0NA 4QW2A 4XTZA 3CCQT 2F2VA 2Y90A 4V2SA 1OEBA 5GAOp 3L2VA 3AT1B 3M4YA 1K9MU 3LGFA 1SEMA 4M7DF 3NPFA 1ZUKA 2G3RA 4AFSC 2V26A 1U1TA 1VQ8A 3M58A 4M77A 5EC7A 1WHMA 2Y4YA 1VQLA 2CDTA 1JJ2S 3DB4A 4ELZC 1BIAA 1YBYA 2EGCA 1VYUA 2FRWA 4M75F 2PVDB 2HEQA 2X4YA 3CC2Q 2ED0A 4ZN3A 1W2BP 2NUTB 2O2OA 3I5SA 3GBQA 1M5Q1 2E5QA 1SHGA 1S72A 2OAWA 4BD3A 3UA6A 3TQ7P 2HSPA 2DEUA 5GMKi 4II1A 3JCMg 3F70A 3CD6T 3RESA 5GAMg 3OS2A 1RUWA 3FJPA 4C8QC 2W0ZA 3M59A 1H92A 4C0FA 2LDMA 2ZCFB 4M75A 1QCNA 3OSVA 2LRQA 3EFRA 3RERA 2X9HA 4JLIA 2OAUA 4AG1C 1TUDA 2IG0A 1ZHIA 4IUQA 4J8OA 3EG2A 1AOJA 2QGFB 1JXMA 2J05A 2DL4A 5GAMd 2E4HA 4F7UB 1PM3A 1CKAA 4QVCA 4DOVA 1VQKQ 4JZ4A 1V76A 2YRDA 4M7AD 2E6ZA 1WHLA 3CCLT 1VQ6A 1WHHA 5IXFA 1BI0A 3OY9A 1M2OA 3SHWA 3KBGA 2DXTA 1KHCA 1M3CA 4C0GA 4FT2A 3EGDA 2CZ0B 4JLGA 4BI3A 4J6WA 1Y0MA 1GFCA 3CD6A 3M0UA 1KHIA 2P0PA 3H6ZA 4C92G 4M77B 1I07A 3JCMJ 1I0CA 4C5HA 1VQ7Q 1G3SA 2BZ8A 3CCST 1UEBA 3JB9F 3CPWS 1GCQA 5D6XA 1RAHB 4FYXB 4ME7A 2D6FA 2XHCA 4J9GA 2QDYB 2RN8A 4KH0B 3FIFA 4RMOA 1X6OA 4QKUA 3BE3A 3RIRA 1ZX6A 4ORZA 2EQUA 2CZ6B 2ZPFB 2A7YA 2MYSA 1M27C 3JCMe 1VQ8Q 2H8HA 5I2SA 5GAMe 3VKIA 2CP5A 1VQLQ 4OB1B 3QWYA 1WQWA 2LJ0A 5C0MA 1V1CA 2J6OA 2EBPA 1ZA1B 5GAN4 1QMCA 4KUIA 4MZTA 1FMVA 2HD0A 4M75B 2FPDA 2K4YA 2KR3A 3RKXA 2ROLA 1YFNA 1VQ5A 1P92A 2ZAEA 4OGCA 1RAAB 1E6HA 2QQBA 1M90C 1I1JA 3OW2P 3SWNB 3CMAT 4CC2A 4E7ZA 4PJNA 1QVGP 3H0HA 1H8KA 4Y91A 3UF4A 2PU9B 1R77A 3CCSA 1KIKA 1K9AA 2CP0A 1X43A 3HRTA 5GAOm 4C92E 2KQWA 3MCAB 3JRZA 4PJJA 4XTWA 1QWEA 4M78F 2RH2A 1IB8A 2E3IA 2HDAA 1ZUYA 2LJ1A 2RHUA 4ATOA 4LDUA 2XKOC 3QJYA 4PJOF 4A4HA 1RAIB 1K8AC 3EGDB 3QO3A 1U1SA 2COZA 1VQMT 3G6ET 3M0RA 4IUPA 2HZYA 3HRSA 3VUZA 5CKHA 4M7AC 1IREB 2XDPA 4ESRA 2F2WA 4AFZC 1K8AR 2K2MA 3MJXA 3LH0A 5KYXA 2L0AA 2IIMA 3QG1A 3SEMA 3EHRA 4AT1B 3OYBA 1NPRA 3CQTA 2NUPA 5LL6S 1VQPT 1N8RU 1WIEA 1VQ6Q 4M7DD 1AZEA 2L8DA 1M8VA 4OP0A 4C5GA 4WF2A 2KT8A 3QUIA 1ZBXA 1K73U 2X4JA 4J9FA 2KXCA 1OZ3A 1EZZB 2HKQB 1IRXA 5IHNA 1D1AA 1AWJA 3CCUT 4LNPA 3EH2A 1OULA 1WYXA 2K5FA 5HK3A 3A8HB 3GP8A 3GLXA 3X25B 1NBEB 2O88A 3A8GB 3QDRB 4MDWA 2DERA 3I5RA 5J26A 3C4SA 4LD6A 2F5TX 1FMKA 2DZ9A 1HXDA 1VQ9T 3DKMA 1N6AA 4HCZA 4XK8E 3JB9H 2LQ8A 2HBPA 2RPNA 2GQIA 1CSKA 3CCVT 3BW1A 4J5YA 4LE9A 2XG8D 4XU3A 1HYOA 2D8HA 3TSZA 1VQPA 1C0MA 2PQWA 4A53A 1HK9A 4RUGA 2FB7A 1SSHA 2VYTA 5D7UA 1VQ5Q 2HAXA 2WACA 3OS5A 3I35A 1GFDA 3DB3A 1YN8A 2QAZA 3O5ZA 4RG8A 5IHKA 2DRMA 3H8ZA 1AHJB 4C8QA 5GAN2 3J81E 1Q82C 1WJSA 1WX6A 2RNAA 3QYHB 1RI9A 4ELYC 5FU6C 1QKWA 5KYXB 3URGA 3INZA 1Q82R 2L3PA 4D6WA 2H3JA 5FRMA 5GAN8 2EQKA 3DLLA 1K0XA 3C94A 4HVWA 2NUPB 3M56A 1EX4A 4JRQA 2A36A 2EW3A 3E1SA 4MMKA 1G2BA 5GAMh 5GMKl 1Q86C 2RD1A 4IUUA 3QKJA 3JB9D 2GTOA 3CCVA 4BACA 2ESWA 4PLLA 2EWNA 4M7DC 2DXBA 5DLQE 4J9DA 2HQEA 2YLBA 4FW2A 3I56Q 1Q86R 1N5ZA 1VQ4A 3NFCA 4M4ZA 3OYNA 2L3SA 2RI2A 2PVOB 2DL5A 5GJVB 4IKFA 4OMMA 1R0BG 4B9WA 4AFUC 2MK5A 3KFVA 2DIGA 3J80E 1NG2A 2QQ9A 4Y28E 2PVGB 4JJNK 1OYXA 4E2FB 3CCRT 6AT1B 3FEOA 2K6DA 1PKTA 1OX9A 2DRKA 2F2XA 1K76A 1NEBA 1XTDA 3V8LA 2E41A 3M0QA 4BDYA 1VUBA 1NYFA 3C0CA 4RCBA 2YXYA 1G5VA 2JJ9A 1XNIA 3MPUB 2KAFA 2LQKA 3OYKA 1FXXA 4C8QB 1BI1A 2COYA 1UJYA 4DBHA 2ZPHB 2ZGWA 2EQMA 1MMAA 1WI7A 4M78D 1YITA 1OQKA 4KH1B 3X24B 5KCHA 5GAN6 2ZPEB 2BZYA 2KEAA 1M1GA 1HD3A 4PJOD 1YJWT 3A98A 2EGEA 2FPFA 5CKFA 1G3YA 3OMCA 1KQSS 4JPBW 5KYNA 2FZGB 4M7AF 2C06A 5CIUA 4FSSA 1H3HA 2KSSA 1YJNA 3Q1JA 1BU1A 1M3BA 1ZSZC 1TUCA 5CK9A 2CYZB 2BTTA 2LCLA 3P8DA 2DKGA 1UECA 2IVWA 3PMIA 1AVZC 8AT1B 2QA4Q 3M0SA 4J7IA 1HSQA 3LX7A 2KT1A 2EKOA 3UATA 2E1HA 2E12A 3SD4A 4HCCA 3V8KA 1VQNQ 2YHTA 2NLUA 1NE8A 4XU0A 4M7AA 4PJLA 1SF9A 2JS0A 5IH2A 1M1KC 2KRMA 4LDYA 2F1LA 4QVZA 1B07A 2MAMA 1D1BA 2DNUA 2V1RA 1WXBA 3G7ZA 1JRIA 1M1KR 1BCOA 3QXEB 3QHSA 1VQ4Q 2RQRA 1WGSA 1WXTA 1QVPA 3CMET 1YJWA 4BY6C 1UGQB 1WJQA 4M77G 1X2QA 2FO0A 1TH7A 2KXDA 5KYUA 1RAFB 5CCAA 2K3YA 3CBOA 3OQ5A 4BE1A 4EMGA 1D0ZA 1C6VX 4CC7A 3GNFB 4X1VA 4NL2A 1NEGA 1R0CB 1PWTA 3X26B 2D0NA 3EG9A 4J9HA 2E5KA 3OYDA 3GIBA 5L23A 2KBTA 4X9DA 1EIFA 4M7DG 5GANd 2OTJA 4JRPA 1YHQQ 2DILA 1JXOA 2AKKA 1YJ9T 4BB7A 4JDSA 2HSEB 2QEXT 2LT4A 2EQIA 3JSCA 3TSWA 4F7UE 4M75G 5IT9E 4QQDA 1VA7A 2O4XB 5GANf 4PJOC 3V7CA 2KMTA 1WHGA 1GBRA 1YITQ 2SEMA 3JB9I 3L2RA 3C95A 3CMEA 5KH6A 2Z0WA 3EAEA 2MCNA 2K5IA 3G71T 2QASA 1UUEA 4ANJA 2MOXA 1JO8A 1OOTA 4LDXA 2VV5A 4XU1A 5GAMj 4M77E 1TU0B 3SB2A 2X35A 5I21A 4M7AB 1YJNQ 2DVJA 1FWZA 1B3QA 2EYXA 4JRIA 5EG2A 1W4SA 2MWOA 5J3BA 1YIJT 1UB4A 2RF0A 3HFNA 1X75C 5CO7A 3G4SQ 2EQJA 5GANe 1QQJA 3E19A 3CCJQ 4LDWA 1YJ9A
chains in the Genus database with same CATH topology
2ROLA 1AWOA 1ZBJA 1E6HA 3JV3A 1I1JA 2J06A 2P4RA 2CUBA 1UDLA 5GJWB 2C0IA 1YNZA 4CC2A 3H0HA 1H8KA 3UF4A 2J6KA 1KIKA 1K9AA 2LQWA 1M3AA 1X43A 4Z88A 3PVQA 3VRYA 2A37A 1PKSA 1VYVA 3R6NA 3PVLA 1WLPB 2HBWA 2HCKA 1QWEA 2OJ2A 3VS3A 1SRMA 2SRCA 2HDAA 1ZUYA 2LJ1A 1UFFA 1QLYA 2GGRA 2LQNA 1AD5A 1U5SA 3QWXX 4GBQA 2FG0A 3M0RA 3THKA 1JQQA 3LH5A 4D8KA 2KGTA 4ESRA 2F2WA 2KE9A 2EGAA 2K2MA 4AFZC 1GL5A 1OV3A 2L0AA 4AFQC 2IIMA 1YWPA 4AG2C 3SEMA 3EHRA 2DF6A 1MUZA 3CQTA 5IHIA 1RLPC 2M0YA 1WIEA 3VS4A 1AZEA 2ABLA 4CC3A 2X3WD 1A0NB 2PNIA 1T3LA 4RTXA 2KT8A 4J9FA 2KXCA 3H41A 4D8DA 2DL8A 2JM9A 1XOVA 2M51A 2DLPA 2DE0X 4HCKA 5IHNA 1Y57A 2EVRA 1AWJA 4LNPA 2AZVA 1UHCA 1WYXA 3EG0A 4EIKA 4Z8AA 1KJWA 2EYWA 2FPEA 4RTZA 3H0FA 2O88A 3VS1A 4KRTA 1SRLA 3I5RA 3REAB 2K7AA 1FMKA 4IIMA 1LCKA 2YUPA 2RPNA 2GQIA 1CSKA 1YWOA 4LE9A 5I22A 2C0TA 1VYTA 2D8HA 1WFWA 3TSZA 2K9GA 2FRYA 1QKXA 4RUGA 1WXUA 4J9BA 4DEYA 2DBMA 1SSHA 1YCSB 2RQUA 3I35A 1GFDA 1YN8A 3O5ZA 5IHKA 2DRMA 2VVKA 2GNCA 1YP5A 2JMAA 2CT4A 4RTYA 1WX6A 2XMFA 2NWMA 2RNAA 4E6RA 2DA9A 2V1QA 1RI9A 4OMPA 1OPKA 1QKWA 1SHFA 5FWBA 1GBQA 2DX1A 4IIOA 2L3PA 1ZLMA 1K0XA 4HVWA 1W1FA 1X6BA 4HXJA 2YDLA 2A36A 1W70A 2EW3A 2NUZA 2OI3A 3NGPA 5FWCA 3EG3A 2ECZA 3IQLA 2CSIA 2PZ1A 1G2BA 2DMOA 1ABOA 2W10A 4JJDA 2BZXA 2L2PA 2PTKA 1WDXA 5FW9A 2JM8A 2GTOA 2O31A 2ESWA 1W6XA 1U3OA 1UE9A 4LUDA 1ABQA 1NLPC 2K3BA 3NHNA 4J9DA 1BB9A 2O9SA 2RMOA 1N5ZA 2RQWA 2CH4A 4M4ZA 2L3SA 2CREA 2EYZA 2JS2A 2QDLA 5ECAA 4A63B 2DL7A 2DL3A 2EPDA 1PRMC 1K0SA 1TG0A 2YT6A 2DL5A 5GJVB 1AWXA 4OMMA 3VS0A 4RTTA 4AFUC 3KFVA 1NG2A 1FYNA 1SPKA 2DM1A 1JU5C 1X27A 2JXBA 2RQVA 1Z9QA 3VRZA 2K6DA 1PKTA 2DRKA 2F2XA 2FEIA 2DJQA 3PE0A 3VS6A 2ENMA 1K76A 1NEBA 1WA7A 1ARKA 3M0QA 4JJCA 1NYFA 3C0CA 4RTUA 4R0KA 2YSQA 4HVUA 4DEXA 5IXBA 3I9QA 4JJBA 4LN2A 1J3TA 1EFNA 1UTIA 1CKBA 3ZL7C 3RBBB 1PNJA 1E7OA 3EGUA 1RLQC 1T3SA 2CT3A 2YUNA 1QCFA 1UJYA 2LZ6B 5I11A 2J7IA 1HJDA 1NYGA 4ZNXA 1QWFA 2KROA 1WI7A 2LP5A 4F16A 1KFZA 4OMNA 2D1XA 1BK2A 2K79A 2BZYA 2I0NA 2EKHA 2KEAA 2VKNA 1T0HA 1HD3A 3A98A 2F2VA 2EGEA 2FPFA 1OEBA 2VWFA 1K4US 1NLOC 2RQTA 4JPBW 1E6GA 4OMOA 1AWWA 1SEMA 2A28A 3NPFA 4Z89A 1ZUKA 4AFSC 4FSSA 1H3HA 1K1ZA 2J6FA 1BU1A 1M3BA 4Y92A 1TUCA 1G83A 4WCIA 2AKLA 5EC7A 2BTTA 2CDTA 2LNHB 2LMJA 3NMZC 1MV3A 2ED1A 1UECA 2EGCA 3EHQA 1VYUA 1AVZC 3TVTA 3M0SA 2FRWA 1HSQA 2JTEA 2KNBB 2ROTA 2HEQA 2KT1A 3UATA 2ED0A 2JMCA 2D8JA 2YUOA 5HCKA 3U23A 1M30A 1UG1A 3VS5A 2O2OA 3I5SA 1S1NA 3GBQA 2JS0A 1SHGA 5IH2A 2OAWA 2KRMA 4F14A 3UA6A 2HSPA 1B07A 3VS7A 3REBB 2GTJA 4F17A 1RUWA 2LX7A 2DNUA 2V1RA 1WXBA 2W0ZA 1X6GA 4RTVA 1Z9ZA 2DYBA 2RQRA 4CC4B 1H92A 1WXTA 3ULRB 1X2QA 2FO0A 2KXDA 3H0IA 2KYBA 1MV0B 2KRSA 4LUEA 2JW4A 4JZ3A 4AG1C 1TUDA 1X2KA 4CC7A 3EG2A 2B86A 1UGVA 2KRNA 1AOJA 4X1VA 1JXMA 1NEGA 1UHFA 2J05A 2DL4A 2C0OA 1PWTA 1GRIA 2L3QA 2D0NA 4J9HA 1PHTA 2E5KA 1PRLC 3M0TA 5L23A 1JEGA 2KBTA 2KYMA 1CKAA 4JZ4A 4HVVA 2JT4A 2CUDA 1X69A 1AEYA 2CSQA 2DILA 1JXOA 2AKKA 4J9EA 5IXFA 2GBQA 1BBZA 1IO6A 3SHWA 1KSWA 1GCPA 1M3CA 3M0PA 4QT7A 2EQIA 1Y0MA 2EYYA 2CH4W 4GLMA 1GFCA 3M0UA 1ZSGA 3TSWA 3EG1A 1I07A 1T0JA 1VA7A 1M8MA 2AZSA 1I0CA 2A08A 2BZ8A 1GBRA 2SEMA 3UA7A 4OMLA 1GCQA 2AK5A 4K11A 2MCNA 1AZGB 3FJ5A 2LJ3A 1UUEA 2MOXA 1JO8A 4J9GA 2RN8A 1U06A 1OOTA 1ZX6A 4J9CA 4ORZA 2O9VA 1NM7A 4J9IA 3RNJA 4OMQA 1M27C 2MIOA 1UJ0A 2DVJA 2H8HA 2YUQA 1OPLA 1B3QA 2EYXA 2DBKA 2G6FX 3VS2A 2X3XD 3QWYA 4RTWA 2LCSA 1ZUUA 2RF0A 2LJ0A 1V1CA 2J6OA 2EBPA 1GCQC 2FPDA 2KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROL A;  1AWO A;  1ZBJ A;  1E6H A;  3JV3 A;  1I1J A;  2J06 A;  2P4R A;  2CUB A;  1UDL A;  5GJW B;  2C0I A;  1YNZ A;  4CC2 A;  3H0H A;  1H8K A;  3UF4 A;  2J6K A;  1KIK A;  1K9A A;  2LQW A;  1M3A A;  1X43 A;  4Z88 A;  3PVQ A;  3VRY A;  2A37 A;  1PKS A;  1VYV A;  3R6N A;  3PVL A;  1WLP B;  2HBW A;  2HCK A;  1QWE A;  2OJ2 A;  3VS3 A;  1SRM A;  2SRC A;  2HDA A;  1ZUY A;  2LJ1 A;  1UFF A;  1QLY A;  2GGR A;  2LQN A;  1AD5 A;  1U5S A;  3QWX X;  4GBQ A;  2FG0 A;  3M0R A;  3THK A;  1JQQ A;  3LH5 A;  4D8K A;  2KGT A;  4ESR A;  2F2W A;  2KE9 A;  2EGA A;  2K2M A;  4AFZ C;  1GL5 A;  1OV3 A;  2L0A A;  4AFQ C;  2IIM A;  1YWP A;  4AG2 C;  3SEM A;  3EHR A;  2DF6 A;  1MUZ A;  3CQT A;  5IHI A;  1RLP C;  2M0Y A;  1WIE A;  3VS4 A;  1AZE A;  2ABL A;  4CC3 A;  2X3W D;  1A0N B;  2PNI A;  1T3L A;  4RTX A;  2KT8 A;  4J9F A;  2KXC A;  3H41 A;  4D8D A;  2DL8 A;  2JM9 A;  1XOV A;  2M51 A;  2DLP A;  2DE0 X;  4HCK A;  5IHN A;  1Y57 A;  2EVR A;  1AWJ A;  4LNP A;  2AZV A;  1UHC A;  1WYX A;  3EG0 A;  4EIK A;  4Z8A A;  1KJW A;  2EYW A;  2FPE A;  4RTZ A;  3H0F A;  2O88 A;  3VS1 A;  4KRT A;  1SRL A;  3I5R A;  3REA B;  2K7A A;  1FMK A;  4IIM A;  1LCK A;  2YUP A;  2RPN A;  2GQI A;  1CSK A;  1YWO A;  4LE9 A;  5I22 A;  2C0T A;  1VYT A;  2D8H A;  1WFW A;  3TSZ A;  2K9G A;  2FRY A;  1QKX A;  4RUG A;  1WXU A;  4J9B A;  4DEY A;  2DBM A;  1SSH A;  1YCS B;  2RQU A;  3I35 A;  1GFD A;  1YN8 A;  3O5Z A;  5IHK A;  2DRM A;  2VVK A;  2GNC A;  1YP5 A;  2JMA A;  2CT4 A;  4RTY A;  1WX6 A;  2XMF A;  2NWM A;  2RNA A;  4E6R A;  2DA9 A;  2V1Q A;  1RI9 A;  4OMP A;  1OPK A;  1QKW A;  1SHF A;  5FWB A;  1GBQ A;  2DX1 A;  4IIO A;  2L3P A;  1ZLM A;  1K0X A;  4HVW A;  1W1F A;  1X6B A;  4HXJ A;  2YDL A;  2A36 A;  1W70 A;  2EW3 A;  2NUZ A;  2OI3 A;  3NGP A;  5FWC A;  3EG3 A;  2ECZ A;  3IQL A;  2CSI A;  2PZ1 A;  1G2B A;  2DMO A;  1ABO A;  2W10 A;  4JJD A;  2BZX A;  2L2P A;  2PTK A;  1WDX A;  5FW9 A;  2JM8 A;  2GTO A;  2O31 A;  2ESW A;  1W6X A;  1U3O A;  1UE9 A;  4LUD A;  1ABQ A;  1NLP C;  2K3B A;  3NHN A;  4J9D A;  1BB9 A;  2O9S A;  2RMO A;  1N5Z A;  2RQW A;  2CH4 A;  4M4Z A;  2L3S A;  2CRE A;  2EYZ A;  2JS2 A;  2QDL A;  5ECA A;  4A63 B;  2DL7 A;  2DL3 A;  2EPD A;  1PRM C;  1K0S A;  1TG0 A;  2YT6 A;  2DL5 A;  5GJV B;  1AWX A;  4OMM A;  3VS0 A;  4RTT A;  4AFU C;  3KFV A;  1NG2 A;  1FYN A;  1SPK A;  2DM1 A;  1JU5 C;  1X27 A;  2JXB A;  2RQV A;  1Z9Q A;  3VRZ A;  2K6D A;  1PKT A;  2DRK A;  2F2X A;  2FEI A;  2DJQ A;  3PE0 A;  3VS6 A;  2ENM A;  1K76 A;  1NEB A;  1WA7 A;  1ARK A;  3M0Q A;  4JJC A;  1NYF A;  3C0C A;  4RTU A;  4R0K A;  2YSQ A;  4HVU A;  4DEX A;  5IXB A;  3I9Q A;  4JJB A;  4LN2 A;  1J3T A;  1EFN A;  1UTI A;  1CKB A;  3ZL7 C;  3RBB B;  1PNJ A;  1E7O A;  3EGU A;  1RLQ C;  1T3S A;  2CT3 A;  2YUN A;  1QCF A;  1UJY A;  2LZ6 B;  5I11 A;  2J7I A;  1HJD A;  1NYG A;  4ZNX A;  1QWF A;  2KRO A;  1WI7 A;  2LP5 A;  4F16 A;  1KFZ A;  4OMN A;  2D1X A;  1BK2 A;  2K79 A;  2BZY A;  2I0N A;  2EKH A;  2KEA A;  2VKN A;  1T0H A;  1HD3 A;  3A98 A;  2F2V A;  2EGE A;  2FPF A;  1OEB A;  2VWF A;  1K4U S;  1NLO C;  2RQT A;  4JPB W;  1E6G A;  4OMO A;  1AWW A;  1SEM A;  2A28 A;  3NPF A;  4Z89 A;  1ZUK A;  4AFS C;  4FSS A;  1H3H A;  1K1Z A;  2J6F A;  1BU1 A;  1M3B A;  4Y92 A;  1TUC A;  1G83 A;  4WCI A;  2AKL A;  5EC7 A;  2BTT A;  2CDT A;  2LNH B;  2LMJ A;  3NMZ C;  1MV3 A;  2ED1 A;  1UEC A;  2EGC A;  3EHQ A;  1VYU A;  1AVZ C;  3TVT A;  3M0S A;  2FRW A;  1HSQ A;  2JTE A;  2KNB B;  2ROT A;  2HEQ A;  2KT1 A;  3UAT A;  2ED0 A;  2JMC A;  2D8J A;  2YUO A;  5HCK A;  3U23 A;  1M30 A;  1UG1 A;  3VS5 A;  2O2O A;  3I5S A;  1S1N A;  3GBQ A;  2JS0 A;  1SHG A;  5IH2 A;  2OAW A;  2KRM A;  4F14 A;  3UA6 A;  2HSP A;  1B07 A;  3VS7 A;  3REB B;  2GTJ A;  4F17 A;  1RUW A;  2LX7 A;  2DNU A;  2V1R A;  1WXB A;  2W0Z A;  1X6G A;  4RTV A;  1Z9Z A;  2DYB A;  2RQR A;  4CC4 B;  1H92 A;  1WXT A;  3ULR B;  1X2Q A;  2FO0 A;  2KXD A;  3H0I A;  2KYB A;  1MV0 B;  2KRS A;  4LUE A;  2JW4 A;  4JZ3 A;  4AG1 C;  1TUD A;  1X2K A;  4CC7 A;  3EG2 A;  2B86 A;  1UGV A;  2KRN A;  1AOJ A;  4X1V A;  1JXM A;  1NEG A;  1UHF A;  2J05 A;  2DL4 A;  2C0O A;  1PWT A;  1GRI A;  2L3Q A;  2D0N A;  4J9H A;  1PHT A;  2E5K A;  1PRL C;  3M0T A;  5L23 A;  1JEG A;  2KBT A;  2KYM A;  1CKA A;  4JZ4 A;  4HVV A;  2JT4 A;  2CUD A;  1X69 A;  1AEY A;  2CSQ A;  2DIL A;  1JXO A;  2AKK A;  4J9E A;  5IXF A;  2GBQ A;  1BBZ A;  1IO6 A;  3SHW A;  1KSW A;  1GCP A;  1M3C A;  3M0P A;  4QT7 A;  2EQI A;  1Y0M A;  2EYY A;  2CH4 W;  4GLM A;  1GFC A;  3M0U A;  1ZSG A;  3TSW A;  3EG1 A;  1I07 A;  1T0J A;  1VA7 A;  1M8M A;  2AZS A;  1I0C A;  2A08 A;  2BZ8 A;  1GBR A;  2SEM A;  3UA7 A;  4OML A;  1GCQ A;  2AK5 A;  4K11 A;  2MCN A;  1AZG B;  3FJ5 A;  2LJ3 A;  1UUE A;  2MOX A;  1JO8 A;  4J9G A;  2RN8 A;  1U06 A;  1OOT A;  1ZX6 A;  4J9C A;  4ORZ A;  2O9V A;  1NM7 A;  4J9I A;  3RNJ A;  4OMQ A;  1M27 C;  2MIO A;  1UJ0 A;  2DVJ A;  2H8H A;  2YUQ A;  1OPL A;  1B3Q A;  2EYX A;  2DBK A;  2G6F X;  3VS2 A;  2X3X D;  3QWY A;  4RTW A;  2LCS A;  1ZUU A;  2RF0 A;  2LJ0 A;  1V1C A;  2J6O A;  2EBP A;  1GCQ C;  2FPD A;  2KR3 A; 
#chains in the Genus database with same CATH topology
 2V8I A;  2M16 A;  5KYU B;  1ZBJ A;  3JV3 A;  1M2V A;  5A0G A;  2KVQ G;  1UDL A;  1QW1 A;  2DXU A;  1YNZ A;  4M7D A;  3OW2 S;  3CXC A;  4HT9 A;  2DVE A;  3HSB A;  2LQW A;  1QVG S;  4E7K A;  3EG9 B;  4MDX A;  2A0F B;  4M75 E;  3VRY A;  2A37 A;  3MEV A;  3JAM E;  3ASK A;  1K8A U;  2E70 A;  1BI3 A;  1WHJ A;  3TRE A;  2OJ2 A;  3CCQ A;  1H64 1;  2SRC A;  5GAO r;  4X34 A;  1QLY A;  1N9R A;  2RK2 A;  3A8L B;  3QWX X;  1ZQ1 A;  4GBQ A;  3JB9 G;  4OVA A;  4IUV A;  3SWN A;  1D3B A;  2FG0 A;  5AYF A;  1DJ7 B;  5CR2 A;  3LH5 A;  5DLO A;  3L2W A;  1LVK A;  2EGA A;  3ZFJ A;  3M55 A;  2F69 A;  1OV3 A;  3ER0 A;  4JUV A;  4RKU E;  2QQR A;  4BUG A;  2OTJ Q;  1MUZ A;  2M0Y A;  1Y7X A;  3VS4 A;  1NPP A;  3E2U A;  4C0Z A;  4KT0 E;  1PD0 A;  1A0N B;  3QYG B;  3H9N A;  1Q95 G;  3NTH A;  4JS5 A;  5FU6 B;  2RJF A;  3LYI A;  2DTH A;  2DTO A;  4D8D A;  2DL8 A;  2R57 A;  3PIO A;  2BKD N;  2BIV A;  2CKK A;  4RCC A;  4HCK A;  3QJ6 A;  2DD4 A;  1VQO T;  3OYJ A;  2AZV A;  2HL3 A;  5KE3 A;  4A54 A;  1Y96 A;  5LJ3 d;  4KRT A;  2RB6 A;  4N4I A;  1SRL A;  1ZSZ A;  1M2V B;  4TVR A;  3CEY A;  2XU8 A;  1IGQ A;  1C1A A;  5KYW A;  4M7D B;  4M78 G;  1LCK A;  3NTI A;  3FLG A;  3OBY A;  4ZGD B;  3HPW A;  2YUP A;  4BI8 B;  3CCE T;  2FL7 A;  2FZK B;  5KYY A;  2XIC A;  5LJ3 f;  1PC0 A;  2C0T A;  1VYT A;  1WFW A;  2X4W A;  2P4T A;  2EAY A;  1QKX A;  1KC8 C;  1Q82 U;  1WXU A;  3CCL A;  2CP7 A;  4N0A C;  4Z02 A;  4LDV A;  2GFA A;  5LJ5 d;  4KGV B;  1Q7Y C;  4VUB A;  2QI2 A;  2OTL T;  1YP5 A;  1D3B B;  2JMA A;  1K9M C;  1S72 Q;  5GAN 7;  4IUT A;  2DA9 A;  5AT1 B;  2FHD A;  1GBQ A;  1Q7Y R;  1M90 R;  1I5L A;  4B6M A;  1QVF A;  1ZLM A;  3OA6 A;  2XDB A;  4C92 F;  4HCB A;  5LJ5 f;  3CCQ Q;  1W1F A;  1KD1 C;  1Q86 U;  3L1A A;  4HXJ A;  2DYI A;  2YDL A;  5D6Y A;  3CCM T;  2NUZ A;  4EPC A;  1RAC B;  3EG3 A;  5FWC A;  3O8V A;  2PZ1 A;  2DMO A;  1NZ9 A;  5GAN 5;  1KD1 R;  1LNX A;  2PTK A;  1JJ2 A;  4FYV B;  3JCM V;  2JM8 A;  1W6X A;  2YRV A;  1O75 A;  1BCM A;  4LUD A;  3MKD A;  5GAN h;  5HKC A;  1R8O B;  3OMG A;  3NHN A;  2X51 A;  4C8Q G;  2CH4 A;  3QBY A;  2K3X A;  1IXD A;  1RAD B;  4EMK A;  2DL3 A;  1PRM C;  1Y96 B;  1PCX A;  3MP1 A;  4M78 A;  1TUG B;  2YT6 A;  1ZSZ B;  1WNL A;  3CMA A;  4PJO A;  1AWX A;  3HTR A;  5KYW B;  4HKE A;  4FT4 A;  4RTT A;  3CD6 Q;  2CP3 A;  4A4K A;  3MP8 A;  1FYN A;  2DM1 A;  2XDD A;  3OB9 A;  3P8H A;  5KYY B;  4XTY A;  3QZ5 B;  2XI9 A;  1X27 A;  2JXB A;  1Z9Q A;  5I2M A;  3PE0 A;  2FEI A;  5A0D A;  2E64 A;  3J7A F;  4BE0 A;  3FRN A;  4JJC A;  3DLM A;  4RTU A;  7AT1 B;  2YSQ A;  4C0D B;  5IXB A;  4JJB A;  1J3T A;  3I55 T;  1CKB A;  3ZL7 C;  3RBB B;  1PNJ A;  1VQM A;  3G6E A;  2YUN A;  4FYW B;  4R55 A;  2PUK B;  1BIB A;  4ZNX A;  5C6S A;  5DM7 R;  3QII A;  4BY6 B;  4PL6 A;  2EYQ A;  2LP5 A;  1MHN A;  2QA4 T;  2KK4 A;  3CCL Q;  2I2L A;  4EDU A;  4C8Q E;  1K4U S;  4J6Y A;  1YI2 T;  1NLO C;  2QTX A;  2RQT A;  1E6G A;  3BDU A;  4E47 A;  1AWW A;  4LD9 K;  2A28 A;  1K1Z A;  1WPY A;  2J6F A;  4DOW A;  1G83 A;  2HMA A;  4WCI A;  2AKL A;  2ZZD A;  3CPW A;  4OMF B;  3CCS Q;  2ED1 A;  2R58 A;  3CCU A;  2ATC B;  1PG5 B;  3TVT A;  2E65 A;  2JTE A;  2ROT A;  1M1K U;  4EMK B;  3CBP A;  1TWB A;  2JMC A;  4M78 B;  2MPX C;  1PSF A;  2E3H A;  3BFM A;  1OZ2 A;  1UG1 A;  3VS5 A;  1VQ9 A;  1OU8 A;  3E9G A;  4PJO B;  4BI4 A;  3ZBD A;  3OYL A;  2HL5 C;  4F17 A;  3LW5 E;  3VS7 A;  5J39 A;  4E7J A;  2LX7 A;  1JBM A;  4PNO A;  1X6G A;  1Z9Z A;  4KUL A;  2RK1 A;  2JTM A;  4CC4 B;  1RAB B;  5CQY A;  3HL8 A;  1FX7 A;  3ULR B;  1YI2 A;  2O01 E;  1FMW A;  2KYB A;  1MNE A;  2KRS A;  3AHU A;  3ME9 A;  4JZ3 A;  2VXF A;  4ZGE B;  1X2K A;  2KRN A;  1M1F A;  3CC4 T;  3CC7 T;  3L2Z A;  5FU7 C;  1UHF A;  2MF2 A;  2C0O A;  1GRI A;  1KK7 A;  1PHT A;  2AIR B;  1PRL C;  3M0T A;  1JEG A;  1VIE A;  4M7A G;  2KYM A;  5LJ3 h;  1MND A;  2MMP A;  2JT4 A;  2GCX A;  3QZ9 B;  4E7S A;  1BI2 A;  1X69 A;  2RHZ A;  4OB0 B;  1AEY A;  2CSQ A;  4J9E A;  2GBQ A;  5HK0 A;  1KSW A;  1D0X A;  3M0P A;  2M9U A;  2CZ1 B;  4GLM A;  2CH4 W;  1VQM Q;  3G6E Q;  1ZSG A;  5GMK m;  1JB0 E;  2XD0 A;  1WJR A;  2AZS A;  5GAO n;  3A8O B;  2A08 A;  4C92 D;  2EJG A;  2VB6 A;  2KI7 A;  2BE7 D;  4DBQ A;  2GFU A;  4OML A;  3L2Q A;  1WHK A;  2AK5 A;  4K11 A;  2DFU A;  1AZG B;  4ZTJ A;  2LJ3 A;  2RHY A;  2X4X A;  1VQP Q;  2FVU A;  1WQ7 A;  5LJ5 h;  1U06 A;  4Q5W A;  3CC2 T;  2F5K A;  4IUR A;  1NJI C;  3OSS C;  3FC3 A;  3FB9 A;  2O9V A;  1NM7 A;  3RNJ A;  3CC4 A;  2A3L A;  4OMQ A;  1UJ0 A;  2YUQ A;  1OPL A;  3SFM A;  1SSF A;  3VS2 A;  3OS0 A;  3OYF A;  2X3X D;  5GAN j;  3CXC S;  2L89 A;  3CCR A;  2O4X A;  1ZUU A;  3CCU Q;  1I4K 1;  1I81 A;  1GCQ C;  4M7A E;  4B9X A;  1AWO A;  2PUO B;  1OX8 A;  2J06 A;  2CUB A;  1VQ9 Q;  1OU9 A;  5GJW B;  2C0I A;  2DET A;  2RJC A;  3OS1 A;  2J6K A;  1B7T A;  1M3A A;  3A1P A;  3CCV Q;  3EH1 A;  3T9N A;  5GAO q;  4Z88 A;  3BDL A;  5CQX A;  1IGU A;  1PKS A;  4FL6 A;  1VYV A;  2K57 A;  3PVL A;  4PJM A;  2HBW A;  2HCK A;  5FLX E;  1VQK T;  4DBR A;  1RAE B;  4DQ2 A;  1SRM A;  4BE2 A;  5GAN g;  3HRU A;  1XJW B;  2DZC A;  3E9F A;  3PFS A;  2GGR A;  2LQN A;  1AD5 A;  1U5S A;  3TU4 K;  3CPF A;  2MI6 A;  1GXI E;  4D8K A;  5D6W A;  1BYM A;  1GL5 A;  2KE9 A;  2QGG A;  1VQ7 T;  1KQ1 A;  2JUF A;  3HP9 A;  1OI1 A;  4AFQ C;  3PT9 A;  1YWP A;  1LOJ A;  5CAI A;  1X01 A;  4RG2 A;  4J7F A;  5IHI A;  1RLP C;  2RI5 A;  8ATC B;  2ABL A;  3OYI A;  4C92 C;  2X3W D;  3VV0 A;  2QYZ A;  2PNI A;  2VAS A;  4RTX A;  3OYC A;  1VQ8 T;  1TS9 A;  2BUD A;  1KG1 A;  2RA2 A;  1VQL T;  2LT1 A;  4F7U F;  2DE0 X;  4O6J A;  3X20 B;  3D7S B;  2EYW A;  1AT1 B;  2L3R A;  2FPE A;  3H0F A;  3VS1 A;  3L42 A;  3REA B;  3S6W A;  3RKW A;  1M9S A;  1I5O B;  2MWP A;  2LCC A;  1D09 B;  2B8A A;  3PIP A;  3OYM A;  2V8K A;  3CXC P;  2YRC A;  4IIM A;  1G3W A;  3CCR Q;  1KC8 U;  5DY9 A;  1YWO A;  1Q81 C;  3X28 B;  5I22 A;  4J83 A;  4WTO B;  1QVF S;  2RO0 A;  4F04 B;  1Q7Y U;  1M90 U;  2DBM A;  1Q81 R;  2CGH A;  4E7I A;  1U8R A;  1YCS B;  4M7D E;  1IHV A;  3MEA A;  2VGN A;  2QEX A;  3NTK A;  2GQV A;  2XMF A;  4XAX B;  4E6R A;  2DJZ A;  2V1Q A;  4OMP A;  9ATC B;  1SHF A;  5FWB A;  1KD1 U;  5LJ3 j;  3LWH A;  5GMK j;  4FW1 A;  4IIO A;  4OB3 B;  3OYE A;  3FDR A;  3G71 A;  1KQS A;  3VUB A;  4NL3 A;  1YJW Q;  3TEE A;  2VGM A;  1VQ6 T;  2AHJ B;  2CSI A;  1ABO A;  2W10 A;  4MZM A;  2VUB A;  2O31 A;  1YIJ A;  1U3O A;  1ABQ A;  3PGG A;  1IHW A;  1NLP C;  2P84 A;  2K3B A;  1KQ2 A;  3WVE B;  3HFO A;  1BB9 A;  2OX7 A;  5LJ5 j;  4EMH A;  2EYZ A;  1LPL A;  2CZ7 B;  1ZA2 B;  2DL7 A;  2EPD A;  2D0Q B;  2LC4 A;  1TG0 A;  3EFO B;  5LJ3 g;  2CP6 A;  4PFO A;  4KBM B;  1W2B A;  3R6O A;  3M9Q A;  5CKE A;  3JCM d;  4KGX B;  4QQ6 A;  1SPK A;  4CRI A;  2QQA A;  1JU5 C;  2K2V A;  2EJF A;  2RQV A;  3CME Q;  2JVV A;  3VRZ A;  3L2U A;  3VS6 A;  2ENM A;  3PNW C;  4QQG A;  1WA7 A;  4MML A;  5A2Q E;  3JCM f;  2CP2 A;  2DO3 A;  3C12 A;  3MEW A;  5GAM f;  1VQ5 T;  1SKU B;  4DEX A;  4HA8 A;  4LN2 A;  4N4H A;  1MMD A;  2QK0 A;  1UTI A;  3MO8 A;  1QP2 A;  4XTU A;  1E7O A;  3TCJ A;  3EGU A;  1RLQ C;  5LJ5 g;  2CT3 A;  2LZ6 B;  5I11 A;  2J7I A;  5GAO l;  1HJD A;  1B34 A;  1QVF P;  4XTV A;  4F16 A;  3OYH A;  2ZPB B;  4PJO G;  4OMN A;  2LTO A;  2EKH A;  2VKN A;  2WSF E;  1T0H A;  4FYY B;  2VWF A;  1YJ9 Q;  4E7L A;  3GF5 A;  1UGR B;  1N27 A;  4OMO A;  1O9S A;  3UDC A;  1LJO A;  2QEX Q;  5FU7 B;  4Z89 A;  1D1C A;  3G1J A;  1JJ2 P;  4Y92 A;  2BE9 B;  1N9S A;  3KUF A;  3JCM Q;  1KC8 R;  1V29 B;  4PFP A;  1PD1 A;  2LNH B;  2LMJ A;  2AT1 B;  3NMZ C;  3GPL A;  1MV3 A;  1VQO A;  3EGX A;  3EHQ A;  2H3E B;  3ZEH A;  3I56 T;  1D0Y A;  1K9M R;  3G71 Q;  2KNB B;  2JOY A;  1ACM B;  2ZPI B;  1Y07 A;  4C5E A;  1VOM A;  5LJ3 e;  5GMK e;  2YUO A;  2D8J A;  3S3O A;  1MMN A;  5HCK A;  3N5B B;  3U23 A;  1RL2 A;  1M30 A;  5CKD A;  4BDZ A;  3UPU A;  1S1N A;  4FCY A;  2EJ9 A;  4F14 A;  3QDF A;  5GAN 3;  4AMC A;  2RHX A;  1YIJ Q;  3RUX A;  3REB B;  2GTJ A;  3CCE A;  3RDV A;  4RTV A;  4M78 E;  2DYB A;  4GLK A;  1QCO A;  1YCY A;  4C92 A;  3S3N A;  3JCM W;  3H0I A;  4PKC C;  4PJO E;  4M77 D;  5KCO A;  1MV0 B;  4LUE A;  2COW A;  2JW4 A;  3UWN A;  1TTH B;  5LJ5 e;  2M02 A;  1UGS B;  2JTF A;  3OW2 A;  3RMS A;  2OTL A;  2B86 A;  1UGV A;  1QVG A;  3V7R A;  3HHT B;  1B34 B;  2L3Q A;  4XTX A;  4FM4 B;  2DK3 A;  3I56 A;  4JS4 A;  2RM4 A;  2D9T A;  2DTI A;  4A4F A;  5L8R E;  3M5A A;  4HVV A;  2RI3 A;  2P0K A;  5FRO A;  2CUD A;  4FSX A;  3JB9 J;  3VYG A;  3CCM A;  1BBZ A;  1IO6 A;  1GCP A;  4QT7 A;  2EYY A;  3EG1 A;  1PSE A;  2CS7 A;  1T0J A;  3CPW P;  1M8M A;  4M75 D;  3LWI A;  4DBF A;  3UA7 A;  2QXF A;  3EGX B;  1NJI U;  2YLC A;  3FJ5 A;  3QSU A;  4ZN1 A;  4LXC A;  4P5N A;  4XQ3 A;  4J9C A;  1VQN T;  4L5G A;  5FRN A;  4C8Q F;  1VIF A;  2HQX A;  4J9I A;  2MIO A;  4PFZ A;  2E10 A;  2DBK A;  2G6F X;  3JCM b;  3V8J A;  2NYS A;  4N4G A;  4RTW A;  2LCS A;  1VQO Q;  1H3Z A;  4R56 A;  1VQ4 T;  1G8X A;  4FIB A;  2K5L A;  1TSF A;  4C92 B;  2VXE A;  2QQS A;  3M53 A;  3MET A;  1MGQ A;  2DXC A;  2P4R A;  3PMT A;  3I55 A;  1F1B B;  1MMG A;  2DIQ A;  3CCE Q;  1I8F A;  4ZGJ B;  2Y4X A;  3OYA A;  1TXQ A;  3PVQ A;  2P0Q A;  4M77 C;  2QA4 A;  4QVD A;  3R6N A;  1WLP B;  3HKS A;  4NS5 A;  3VS3 A;  5A0L A;  3PTA A;  5HY6 A;  1RAG B;  1VQN A;  1YHQ T;  1UFF A;  3JCM h;  4KUD K;  4KGZ B;  4PLI A;  2OTL Q;  3GNG A;  2QTV A;  3CMA Q;  3BY7 A;  3THK A;  1JQQ A;  3LLR A;  4MZP A;  2KGT A;  3RR6 A;  5M9O A;  2LX9 A;  1YIT T;  2V8J A;  3P8B B;  4AG2 C;  2DF6 A;  2LNV A;  3MHX A;  5GMK h;  4OB2 B;  3EFS A;  3CCM Q;  4CC3 A;  4JRK A;  1G3T A;  4M75 C;  4UC4 A;  1QP3 A;  1T3L A;  2M0O A;  3MP6 A;  1N8R C;  1YJN T;  3H41 A;  3SWN C;  2KDS A;  2JM9 A;  1XOV A;  2M51 A;  2DLP A;  1Y57 A;  2EVR A;  3M4G A;  2JZ2 A;  1N8R R;  1K73 C;  3G4S T;  3CBM A;  1UHC A;  3EG0 A;  4EIK A;  4Z8A A;  2XK0 A;  4N0A A;  2E6N A;  1KJW A;  4O5V A;  1YHQ A;  4RTZ A;  3CCJ T;  3A8M B;  4OF1 A;  1K73 R;  2HNI A;  1WZO A;  2K7A A;  4NOY A;  1Q81 U;  2WSE E;  3CC7 A;  2EIF A;  4YTL A;  1NJI R;  2K9G A;  2QG9 B;  2FRY A;  4X9C A;  4J9B A;  4DEY A;  1M4Z A;  4L59 A;  2RQU A;  2HQH A;  3A5Z B;  2R5M A;  2VVK A;  3I55 Q;  2GNC A;  4PK4 A;  3UT1 A;  2CT4 A;  4RTY A;  2GF7 A;  2NWM A;  3OYY A;  1BKB A;  1OPK A;  3G4S A;  2DX1 A;  2RJD A;  1IZ6 A;  3KXT A;  3CCJ A;  3MEU A;  3WXM B;  2OTJ T;  1X6B A;  5KE2 A;  5CVI A;  5IAY A;  1YI2 Q;  3CC2 A;  2FZC B;  4F7U G;  4ZTF A;  2YWW A;  1W70 A;  2OI3 A;  3M54 A;  3NGP A;  3VYH B;  5CKB A;  2ECZ A;  3QPH A;  3IQL A;  1W2B S;  4C0D C;  4JJD A;  3LGL A;  2BZX A;  2L2P A;  3RKY A;  3JCM X;  1XQH A;  2WSC E;  1WDX A;  2FYK A;  5FW9 A;  3RMQ A;  3OYG A;  1UE9 A;  4CI0 C;  2HKN A;  2O9S A;  2L5Q A;  2RMO A;  3V7S A;  2RQW A;  4HT8 A;  4XU2 A;  3WVD B;  2QDL A;  2CRE A;  2JS2 A;  2JN0 A;  2LVM A;  4OGE A;  4C8Q D;  5ECA A;  4A63 B;  3GOX A;  1K0S A;  2ZPG B;  2IPO B;  2DAQ A;  2NUT A;  4DA4 A;  2RJE A;  3S3M A;  1RI0 A;  2EFI A;  3VS0 A;  4A4G A;  1Y71 A;  2VC8 A;  4L6V 5;  3M57 A;  5IN1 A;  1UGP B;  2DD5 A;  2R5A A;  2JNG A;  1VQK A;  2DJQ A;  4J6X A;  1ARK A;  3VU3 C;  4C5I A;  3OBW A;  1TOV A;  2DEQ A;  3SDZ A;  4R0K A;  2RHI A;  4HVU A;  4EMK C;  2XID A;  3EFO A;  4A4E A;  4M78 C;  3I9Q A;  2M1H A;  1EFN A;  4FU6 A;  3CC7 Q;  3CC4 Q;  3JCM P;  1T3S A;  4M77 F;  2KY9 A;  1SG5 A;  1S72 T;  1QCF A;  4GY5 A;  1NYG A;  3JCM c;  1QWF A;  3VJP A;  1VQ7 A;  2KRO A;  4F7U A;  1KFZ A;  4E7H A;  1KQS P;  2D1X A;  1BK2 A;  2DPP B;  2K79 A;  2I0N A;  4QW2 A;  4XTZ A;  3CCQ T;  2F2V A;  2Y90 A;  4V2S A;  1OEB A;  5GAO p;  3L2V A;  3AT1 B;  3M4Y A;  1K9M U;  3LGF A;  1SEM A;  4M7D F;  3NPF A;  1ZUK A;  2G3R A;  4AFS C;  2V26 A;  1U1T A;  1VQ8 A;  3M58 A;  4M77 A;  5EC7 A;  1WHM A;  2Y4Y A;  1VQL A;  2CDT A;  1JJ2 S;  3DB4 A;  4ELZ C;  1BIA A;  1YBY A;  2EGC A;  1VYU A;  2FRW A;  4M75 F;  2PVD B;  2HEQ A;  2X4Y A;  3CC2 Q;  2ED0 A;  4ZN3 A;  1W2B P;  2NUT B;  2O2O A;  3I5S A;  3GBQ A;  1M5Q 1;  2E5Q A;  1SHG A;  1S72 A;  2OAW A;  4BD3 A;  3UA6 A;  3TQ7 P;  2HSP A;  2DEU A;  5GMK i;  4II1 A;  3JCM g;  3F70 A;  3CD6 T;  3RES A;  5GAM g;  3OS2 A;  1RUW A;  3FJP A;  4C8Q C;  2W0Z A;  3M59 A;  1H92 A;  4C0F A;  2LDM A;  2ZCF B;  4M75 A;  1QCN A;  3OSV A;  2LRQ A;  3EFR A;  3RER A;  2X9H A;  4JLI A;  2OAU A;  4AG1 C;  1TUD A;  2IG0 A;  1ZHI A;  4IUQ A;  4J8O A;  3EG2 A;  1AOJ A;  2QGF B;  1JXM A;  2J05 A;  2DL4 A;  5GAM d;  2E4H A;  4F7U B;  1PM3 A;  1CKA A;  4QVC A;  4DOV A;  1VQK Q;  4JZ4 A;  1V76 A;  2YRD A;  4M7A D;  2E6Z A;  1WHL A;  3CCL T;  1VQ6 A;  1WHH A;  5IXF A;  1BI0 A;  3OY9 A;  1M2O A;  3SHW A;  3KBG A;  2DXT A;  1KHC A;  1M3C A;  4C0G A;  4FT2 A;  3EGD A;  2CZ0 B;  4JLG A;  4BI3 A;  4J6W A;  1Y0M A;  1GFC A;  3CD6 A;  3M0U A;  1KHI A;  2P0P A;  3H6Z A;  4C92 G;  4M77 B;  1I07 A;  3JCM J;  1I0C A;  4C5H A;  1VQ7 Q;  1G3S A;  2BZ8 A;  3CCS T;  1UEB A;  3JB9 F;  3CPW S;  1GCQ A;  5D6X A;  1RAH B;  4FYX B;  4ME7 A;  2D6F A;  2XHC A;  4J9G A;  2QDY B;  2RN8 A;  4KH0 B;  3FIF A;  4RMO A;  1X6O A;  4QKU A;  3BE3 A;  3RIR A;  1ZX6 A;  4ORZ A;  2EQU A;  2CZ6 B;  2ZPF B;  2A7Y A;  2MYS A;  1M27 C;  3JCM e;  1VQ8 Q;  2H8H A;  5I2S A;  5GAM e;  3VKI A;  2CP5 A;  1VQL Q;  4OB1 B;  3QWY A;  1WQW A;  2LJ0 A;  5C0M A;  1V1C A;  2J6O A;  2EBP A;  1ZA1 B;  5GAN 4;  1QMC A;  4KUI A;  4MZT A;  1FMV A;  2HD0 A;  4M75 B;  2FPD A;  2K4Y A;  2KR3 A;  3RKX A;  2ROL A;  1YFN A;  1VQ5 A;  1P92 A;  2ZAE A;  4OGC A;  1RAA B;  1E6H A;  2QQB A;  1M90 C;  1I1J A;  3OW2 P;  3SWN B;  3CMA T;  4CC2 A;  4E7Z A;  4PJN A;  1QVG P;  3H0H A;  1H8K A;  4Y91 A;  3UF4 A;  2PU9 B;  1R77 A;  3CCS A;  1KIK A;  1K9A A;  2CP0 A;  1X43 A;  3HRT A;  5GAO m;  4C92 E;  2KQW A;  3MCA B;  3JRZ A;  4PJJ A;  4XTW A;  1QWE A;  4M78 F;  2RH2 A;  1IB8 A;  2E3I A;  2HDA A;  1ZUY A;  2LJ1 A;  2RHU A;  4ATO A;  4LDU A;  2XKO C;  3QJY A;  4PJO F;  4A4H A;  1RAI B;  1K8A C;  3EGD B;  3QO3 A;  1U1S A;  2COZ A;  1VQM T;  3G6E T;  3M0R A;  4IUP A;  2HZY A;  3HRS A;  3VUZ A;  5CKH A;  4M7A C;  1IRE B;  2XDP A;  4ESR A;  2F2W A;  4AFZ C;  1K8A R;  2K2M A;  3MJX A;  3LH0 A;  5KYX A;  2L0A A;  2IIM A;  3QG1 A;  3SEM A;  3EHR A;  4AT1 B;  3OYB A;  1NPR A;  3CQT A;  2NUP A;  5LL6 S;  1VQP T;  1N8R U;  1WIE A;  1VQ6 Q;  4M7D D;  1AZE A;  2L8D A;  1M8V A;  4OP0 A;  4C5G A;  4WF2 A;  2KT8 A;  3QUI A;  1ZBX A;  1K73 U;  2X4J A;  4J9F A;  2KXC A;  1OZ3 A;  1EZZ B;  2HKQ B;  1IRX A;  5IHN A;  1D1A A;  1AWJ A;  3CCU T;  4LNP A;  3EH2 A;  1OUL A;  1WYX A;  2K5F A;  5HK3 A;  3A8H B;  3GP8 A;  3GLX A;  3X25 B;  1NBE B;  2O88 A;  3A8G B;  3QDR B;  4MDW A;  2DER A;  3I5R A;  5J26 A;  3C4S A;  4LD6 A;  2F5T X;  1FMK A;  2DZ9 A;  1HXD A;  1VQ9 T;  3DKM A;  1N6A A;  4HCZ A;  4XK8 E;  3JB9 H;  2LQ8 A;  2HBP A;  2RPN A;  2GQI A;  1CSK A;  3CCV T;  3BW1 A;  4J5Y A;  4LE9 A;  2XG8 D;  4XU3 A;  1HYO A;  2D8H A;  3TSZ A;  1VQP A;  1C0M A;  2PQW A;  4A53 A;  1HK9 A;  4RUG A;  2FB7 A;  1SSH A;  2VYT A;  5D7U A;  1VQ5 Q;  2HAX A;  2WAC A;  3OS5 A;  3I35 A;  1GFD A;  3DB3 A;  1YN8 A;  2QAZ A;  3O5Z A;  4RG8 A;  5IHK A;  2DRM A;  3H8Z A;  1AHJ B;  4C8Q A;  5GAN 2;  3J81 E;  1Q82 C;  1WJS A;  1WX6 A;  2RNA A;  3QYH B;  1RI9 A;  4ELY C;  5FU6 C;  1QKW A;  5KYX B;  3URG A;  3INZ A;  1Q82 R;  2L3P A;  4D6W A;  2H3J A;  5FRM A;  5GAN 8;  2EQK A;  3DLL A;  1K0X A;  3C94 A;  4HVW A;  2NUP B;  3M56 A;  1EX4 A;  4JRQ A;  2A36 A;  2EW3 A;  3E1S A;  4MMK A;  1G2B A;  5GAM h;  5GMK l;  1Q86 C;  2RD1 A;  4IUU A;  3QKJ A;  3JB9 D;  2GTO A;  3CCV A;  4BAC A;  2ESW A;  4PLL A;  2EWN A;  4M7D C;  2DXB A;  5DLQ E;  4J9D A;  2HQE A;  2YLB A;  4FW2 A;  3I56 Q;  1Q86 R;  1N5Z A;  1VQ4 A;  3NFC A;  4M4Z A;  3OYN A;  2L3S A;  2RI2 A;  2PVO B;  2DL5 A;  5GJV B;  4IKF A;  4OMM A;  1R0B G;  4B9W A;  4AFU C;  2MK5 A;  3KFV A;  2DIG A;  3J80 E;  1NG2 A;  2QQ9 A;  4Y28 E;  2PVG B;  4JJN K;  1OYX A;  4E2F B;  3CCR T;  6AT1 B;  3FEO A;  2K6D A;  1PKT A;  1OX9 A;  2DRK A;  2F2X A;  1K76 A;  1NEB A;  1XTD A;  3V8L A;  2E41 A;  3M0Q A;  4BDY A;  1VUB A;  1NYF A;  3C0C A;  4RCB A;  2YXY A;  1G5V A;  2JJ9 A;  1XNI A;  3MPU B;  2KAF A;  2LQK A;  3OYK A;  1FXX A;  4C8Q B;  1BI1 A;  2COY A;  1UJY A;  4DBH A;  2ZPH B;  2ZGW A;  2EQM A;  1MMA A;  1WI7 A;  4M78 D;  1YIT A;  1OQK A;  4KH1 B;  3X24 B;  5KCH A;  5GAN 6;  2ZPE B;  2BZY A;  2KEA A;  1M1G A;  1HD3 A;  4PJO D;  1YJW T;  3A98 A;  2EGE A;  2FPF A;  5CKF A;  1G3Y A;  3OMC A;  1KQS S;  4JPB W;  5KYN A;  2FZG B;  4M7A F;  2C06 A;  5CIU A;  4FSS A;  1H3H A;  2KSS A;  1YJN A;  3Q1J A;  1BU1 A;  1M3B A;  1ZSZ C;  1TUC A;  5CK9 A;  2CYZ B;  2BTT A;  2LCL A;  3P8D A;  2DKG A;  1UEC A;  2IVW A;  3PMI A;  1AVZ C;  8AT1 B;  2QA4 Q;  3M0S A;  4J7I A;  1HSQ A;  3LX7 A;  2KT1 A;  2EKO A;  3UAT A;  2E1H A;  2E12 A;  3SD4 A;  4HCC A;  3V8K A;  1VQN Q;  2YHT A;  2NLU A;  1NE8 A;  4XU0 A;  4M7A A;  4PJL A;  1SF9 A;  2JS0 A;  5IH2 A;  1M1K C;  2KRM A;  4LDY A;  2F1L A;  4QVZ A;  1B07 A;  2MAM A;  1D1B A;  2DNU A;  2V1R A;  1WXB A;  3G7Z A;  1JRI A;  1M1K R;  1BCO A;  3QXE B;  3QHS A;  1VQ4 Q;  2RQR A;  1WGS A;  1WXT A;  1QVP A;  3CME T;  1YJW A;  4BY6 C;  1UGQ B;  1WJQ A;  4M77 G;  1X2Q A;  2FO0 A;  1TH7 A;  2KXD A;  5KYU A;  1RAF B;  5CCA A;  2K3Y A;  3CBO A;  3OQ5 A;  4BE1 A;  4EMG A;  1D0Z A;  1C6V X;  4CC7 A;  3GNF B;  4X1V A;  4NL2 A;  1NEG A;  1R0C B;  1PWT A;  3X26 B;  2D0N A;  3EG9 A;  4J9H A;  2E5K A;  3OYD A;  3GIB A;  5L23 A;  2KBT A;  4X9D A;  1EIF A;  4M7D G;  5GAN d;  2OTJ A;  4JRP A;  1YHQ Q;  2DIL A;  1JXO A;  2AKK A;  1YJ9 T;  4BB7 A;  4JDS A;  2HSE B;  2QEX T;  2LT4 A;  2EQI A;  3JSC A;  3TSW A;  4F7U E;  4M75 G;  5IT9 E;  4QQD A;  1VA7 A;  2O4X B;  5GAN f;  4PJO C;  3V7C A;  2KMT A;  1WHG A;  1GBR A;  1YIT Q;  2SEM A;  3JB9 I;  3L2R A;  3C95 A;  3CME A;  5KH6 A;  2Z0W A;  3EAE A;  2MCN A;  2K5I A;  3G71 T;  2QAS A;  1UUE A;  4ANJ A;  2MOX A;  1JO8 A;  1OOT A;  4LDX A;  2VV5 A;  4XU1 A;  5GAM j;  4M77 E;  1TU0 B;  3SB2 A;  2X35 A;  5I21 A;  4M7A B;  1YJN Q;  2DVJ A;  1FWZ A;  1B3Q A;  2EYX A;  4JRI A;  5EG2 A;  1W4S A;  2MWO A;  5J3B A;  1YIJ T;  1UB4 A;  2RF0 A;  3HFN A;  1X75 C;  5CO7 A;  3G4S Q;  2EQJ A;  5GAN e;  1QQJ A;  3E19 A;  3CCJ Q;  4LDW A;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 2ROL A;  1AWO A;  1ZBJ A;  1E6H A;  3JV3 A;  1I1J A;  2J06 A;  2P4R A;  2CUB A;  1UDL A;  5GJW B;  2C0I A;  1YNZ A;  4CC2 A;  3H0H A;  1H8K A;  3UF4 A;  2J6K A;  1KIK A;  1K9A A;  2LQW A;  1M3A A;  1X43 A;  4Z88 A;  3PVQ A;  3VRY A;  2A37 A;  1PKS A;  1VYV A;  3R6N A;  3PVL A;  1WLP B;  2HBW A;  2HCK A;  1QWE A;  2OJ2 A;  3VS3 A;  1SRM A;  2SRC A;  2HDA A;  1ZUY A;  2LJ1 A;  1UFF A;  1QLY A;  2GGR A;  2LQN A;  1AD5 A;  1U5S A;  3QWX X;  4GBQ A;  2FG0 A;  3M0R A;  3THK A;  1JQQ A;  3LH5 A;  4D8K A;  2KGT A;  4ESR A;  2F2W A;  2KE9 A;  2EGA A;  2K2M A;  4AFZ C;  1GL5 A;  1OV3 A;  2L0A A;  4AFQ C;  2IIM A;  1YWP A;  4AG2 C;  3SEM A;  3EHR A;  2DF6 A;  1MUZ A;  3CQT A;  5IHI A;  1RLP C;  2M0Y A;  1WIE A;  3VS4 A;  1AZE A;  2ABL A;  4CC3 A;  2X3W D;  1A0N B;  2PNI A;  1T3L A;  4RTX A;  2KT8 A;  4J9F A;  2KXC A;  3H41 A;  4D8D A;  2DL8 A;  2JM9 A;  1XOV A;  2M51 A;  2DLP A;  2DE0 X;  4HCK A;  5IHN A;  1Y57 A;  2EVR A;  1AWJ A;  4LNP A;  2AZV A;  1UHC A;  1WYX A;  3EG0 A;  4EIK A;  4Z8A A;  1KJW A;  2EYW A;  2FPE A;  4RTZ A;  3H0F A;  2O88 A;  3VS1 A;  4KRT A;  1SRL A;  3I5R A;  3REA B;  2K7A A;  1FMK A;  4IIM A;  1LCK A;  2YUP A;  2RPN A;  2GQI A;  1CSK A;  1YWO A;  4LE9 A;  5I22 A;  2C0T A;  1VYT A;  2D8H A;  1WFW A;  3TSZ A;  2K9G A;  2FRY A;  1QKX A;  4RUG A;  1WXU A;  4J9B A;  4DEY A;  2DBM A;  1SSH A;  1YCS B;  2RQU A;  3I35 A;  1GFD A;  1YN8 A;  3O5Z A;  5IHK A;  2DRM A;  2VVK A;  2GNC A;  1YP5 A;  2JMA A;  2CT4 A;  4RTY A;  1WX6 A;  2XMF A;  2NWM A;  2RNA A;  4E6R A;  2DA9 A;  2V1Q A;  1RI9 A;  4OMP A;  1OPK A;  1QKW A;  1SHF A;  5FWB A;  1GBQ A;  2DX1 A;  4IIO A;  2L3P A;  1ZLM A;  1K0X A;  4HVW A;  1W1F A;  1X6B A;  4HXJ A;  2YDL A;  2A36 A;  1W70 A;  2EW3 A;  2NUZ A;  2OI3 A;  3NGP A;  5FWC A;  3EG3 A;  2ECZ A;  3IQL A;  2CSI A;  2PZ1 A;  1G2B A;  2DMO A;  1ABO A;  2W10 A;  4JJD A;  2BZX A;  2L2P A;  2PTK A;  1WDX A;  5FW9 A;  2JM8 A;  2GTO A;  2O31 A;  2ESW A;  1W6X A;  1U3O A;  1UE9 A;  4LUD A;  1ABQ A;  1NLP C;  2K3B A;  3NHN A;  4J9D A;  1BB9 A;  2O9S A;  2RMO A;  1N5Z A;  2RQW A;  2CH4 A;  4M4Z A;  2L3S A;  2CRE A;  2EYZ A;  2JS2 A;  2QDL A;  5ECA A;  4A63 B;  2DL7 A;  2DL3 A;  2EPD A;  1PRM C;  1K0S A;  1TG0 A;  2YT6 A;  2DL5 A;  5GJV B;  1AWX A;  4OMM A;  3VS0 A;  4RTT A;  4AFU C;  3KFV A;  1NG2 A;  1FYN A;  1SPK A;  2DM1 A;  1JU5 C;  1X27 A;  2JXB A;  2RQV A;  1Z9Q A;  3VRZ A;  2K6D A;  1PKT A;  2DRK A;  2F2X A;  2FEI A;  2DJQ A;  3PE0 A;  3VS6 A;  2ENM A;  1K76 A;  1NEB A;  1WA7 A;  1ARK A;  3M0Q A;  4JJC A;  1NYF A;  3C0C A;  4RTU A;  4R0K A;  2YSQ A;  4HVU A;  4DEX A;  5IXB A;  3I9Q A;  4JJB A;  4LN2 A;  1J3T A;  1EFN A;  1UTI A;  1CKB A;  3ZL7 C;  3RBB B;  1PNJ A;  1E7O A;  3EGU A;  1RLQ C;  1T3S A;  2CT3 A;  2YUN A;  1QCF A;  1UJY A;  2LZ6 B;  5I11 A;  2J7I A;  1HJD A;  1NYG A;  4ZNX A;  1QWF A;  2KRO A;  1WI7 A;  2LP5 A;  4F16 A;  1KFZ A;  4OMN A;  2D1X A;  1BK2 A;  2K79 A;  2BZY A;  2I0N A;  2EKH A;  2KEA A;  2VKN A;  1T0H A;  1HD3 A;  3A98 A;  2F2V A;  2EGE A;  2FPF A;  1OEB A;  2VWF A;  1K4U S;  1NLO C;  2RQT A;  4JPB W;  1E6G A;  4OMO A;  1AWW A;  1SEM A;  2A28 A;  3NPF A;  4Z89 A;  1ZUK A;  4AFS C;  4FSS A;  1H3H A;  1K1Z A;  2J6F A;  1BU1 A;  1M3B A;  4Y92 A;  1TUC A;  1G83 A;  4WCI A;  2AKL A;  5EC7 A;  2BTT A;  2CDT A;  2LNH B;  2LMJ A;  3NMZ C;  1MV3 A;  2ED1 A;  1UEC A;  2EGC A;  3EHQ A;  1VYU A;  1AVZ C;  3TVT A;  3M0S A;  2FRW A;  1HSQ A;  2JTE A;  2KNB B;  2ROT A;  2HEQ A;  2KT1 A;  3UAT A;  2ED0 A;  2JMC A;  2D8J A;  2YUO A;  5HCK A;  3U23 A;  1M30 A;  1UG1 A;  3VS5 A;  2O2O A;  3I5S A;  1S1N A;  3GBQ A;  2JS0 A;  1SHG A;  5IH2 A;  2OAW A;  2KRM A;  4F14 A;  3UA6 A;  2HSP A;  1B07 A;  3VS7 A;  3REB B;  2GTJ A;  4F17 A;  1RUW A;  2LX7 A;  2DNU A;  2V1R A;  1WXB A;  2W0Z A;  1X6G A;  4RTV A;  1Z9Z A;  2DYB A;  2RQR A;  4CC4 B;  1H92 A;  1WXT A;  3ULR B;  1X2Q A;  2FO0 A;  2KXD A;  3H0I A;  2KYB A;  1MV0 B;  2KRS A;  4LUE A;  2JW4 A;  4JZ3 A;  4AG1 C;  1TUD A;  1X2K A;  4CC7 A;  3EG2 A;  2B86 A;  1UGV A;  2KRN A;  1AOJ A;  4X1V A;  1JXM A;  1NEG A;  1UHF A;  2J05 A;  2DL4 A;  2C0O A;  1PWT A;  1GRI A;  2L3Q A;  2D0N A;  4J9H A;  1PHT A;  2E5K A;  1PRL C;  3M0T A;  5L23 A;  1JEG A;  2KBT A;  2KYM A;  1CKA A;  4JZ4 A;  4HVV A;  2JT4 A;  2CUD A;  1X69 A;  1AEY A;  2CSQ A;  2DIL A;  1JXO A;  2AKK A;  4J9E A;  5IXF A;  2GBQ A;  1BBZ A;  1IO6 A;  3SHW A;  1KSW A;  1GCP A;  1M3C A;  3M0P A;  4QT7 A;  2EQI A;  1Y0M A;  2EYY A;  2CH4 W;  4GLM A;  1GFC A;  3M0U A;  1ZSG A;  3TSW A;  3EG1 A;  1I07 A;  1T0J A;  1VA7 A;  1M8M A;  2AZS A;  1I0C A;  2A08 A;  2BZ8 A;  1GBR A;  2SEM A;  3UA7 A;  4OML A;  1GCQ A;  2AK5 A;  4K11 A;  2MCN A;  1AZG B;  3FJ5 A;  2LJ3 A;  1UUE A;  2MOX A;  1JO8 A;  4J9G A;  2RN8 A;  1U06 A;  1OOT A;  1ZX6 A;  4J9C A;  4ORZ A;  2O9V A;  1NM7 A;  4J9I A;  3RNJ A;  4OMQ A;  1M27 C;  2MIO A;  1UJ0 A;  2DVJ A;  2H8H A;  2YUQ A;  1OPL A;  1B3Q A;  2EYX A;  2DBK A;  2G6F X;  3VS2 A;  2X3X D;  3QWY A;  4RTW A;  2LCS A;  1ZUU A;  2RF0 A;  2LJ0 A;  1V1C A;  2J6O A;  2EBP A;  1GCQ C;  2FPD A;  2KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...