1YNZA

Sh3 domain of yeast pin3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
MEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Pin3p
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ynzA00
2ECZA 2O31A 1PRLC 1GRIA 1PRMC 4RTYA 2F2VA 2RMOA 1N5ZA 3EG0A 2MOXA 2RQUA 1OPKA 2OI3A 1M30A 2FPEA 2DRKA 1Y0MA 2L3PA 2B86A 1YWOA 1Z9QA 4GBQA 2JW4A 4F17A 1GFCA 1LCKA 1AOJA 2H8HA 2E5KA 2HBWA 4CC2A 1XOVA 4J9GA 1QWFA 2IIMA 2DL8A 3H0HA 2C0IA 2OJ2A 2RQTA 2EBPA 2LCSA 1K4US 4AFZC 4ORZA 5IH2A 2EGCA 1AWWA 1YWPA 1M8MA 2O88A 1AWOA 2FPFA 2JS0A 4JPBW 3QWXX 2RQWA 4AG1C 1X6BA 1G2BA 4J9BA 1Y57A 2NUZA 4LN2A 3NHNA 2CDTA 1AVZC 4HVWA 1H92A 2D8JA 1JXMA 2KXCA 2D8HA 1UE9A 4Y92A 3VS5A 1WXBA 1W6XA 3C0CA 3U23A 2CUDA 1H8KA 2ED0A 4F14A 2EYYA 2VKNA 1E6HA 4HVVA 1ABOA 3M0QA 2CH4W 1AZGB 1M3AA 2DVJA 4D8DA 2YSQA 5ECAA 1ZUKA 2DF6A 1WXUA 3M0UA 2LMJA 1SRLA 1Z9ZA 2O9SA 2DLPA 1G83A 1TUCA 2OAWA 3EHRA 1JQQA 2CT4A 4X1VA 1GCPA 3TSWA 2DMOA 1U3OA 2CT3A 3REBB 1ZSGA 1NYGA 1W1FA 2LX7A 3QWYA 1ZLMA 2DNUA 4M4ZA 2J6FA 3ULRB 1WDXA 2CSIA 2L3SA 1VYVA 1X43A 3M0PA 4AFSC 2CH4A 2K3BA 4K11A 2DL5A 4J9FA 2KRNA 1BB9A 1NLOC 1QWEA 2LP5A 1KSWA 2AZSA 2CUBA 3O5ZA 3REAB 4AFQC 1K1ZA 2J6KA 4D8KA 1UTIA 2YUNA 2EGAA 3EG3A 4ESRA 2C0TA 2SRCA 3VRYA 1WFWA 4KRTA 3PVQA 4J9EA 2EPDA 4LNPA 2VVKA 4OMQA 1NEBA 1MV3A 1IO6A 3UATA 4JJBA 1AZEA 2K6DA 1YNZA 1AWJA 2JMAA 2SEMA 2FEIA 2KXDA 4EIKA 2JM9A 2YUPA 1NEGA 4LUEA 1JXOA 2LJ0A 2L2PA 2DBKA 2LZ6B 3SHWA 1I07A 1W70A 2RQRA 1NLPC 3NMZC 1H3HA 5GJWB 1RLPC 3UA6A 3VS1A 1SSHA 1WXTA 2GTJA 1BK2A 3R6NA 2DX1A 1BU1A 3FJ5A 4FSSA 1T0JA 2X3WD 3EG1A 1B3QA 1AD5A 2JM8A 2M0YA 1U5SA 2JMCA 2KGTA 2L0AA 1U06A 1T3LA 1T3SA 2G6FX 2YDLA 4HCKA 3UF4A 1K9AA 3H0FA 2EGEA 2J7IA 1K0SA 4CC7A 4J9DA 4R0KA 3TSZA 2JT4A 2AKLA 3NPFA 2KEAA 3RNJA 2HEQA 3ZL7C 1ZBJA 1QKXA 2YT6A 1TG0A 2EQIA 2GGRA 2BZXA 1JU5C 1FYNA 4LUDA 1SRMA 2FO0A 3M0SA 2ED1A 2KT1A 4E6RA 4ZNXA 2PTKA 2ABLA 2DL7A 2EYXA 1UHCA 2DL3A 4RTXA 3VS3A 2DA9A 5L23A 1NG2A 1UUEA 2J05A 3UA7A 1RI9A 5I11A 2LJ3A 4OMMA 2KRSA 2YUOA 1YP5A 2HDAA 1ARKA 1OOTA 4J9HA 2DJQA 3VS6A 1GL5A 1OPLA 3SEMA 1TUDA 2KT8A 4HVUA 2RN8A 1UECA 2LNHB 5IHNA 2DE0X 1QKWA 2HSPA 2DYBA 2DL4A 1CKBA 1HD3A 3M0TA 2GQIA 4HXJA 1NM7A 1K0XA 2GBQA 2O9VA 3I5RA 5FWCA 3H41A 3EG2A 4Z89A 2YUQA 2MIOA 5HCKA 2O2OA 1I0CA 2NWMA 4RUGA 4OMNA 2FG0A 4QT7A 1X69A 1HJDA 2D0NA 1A0NB 1PKTA 2LQWA 1WX6A 1KFZA 2FRYA 2JXBA 3GBQA 5IXBA 1WYXA 2DILA 2KROA 2RF0A 2KBTA 2K79A 2J6OA 2PNIA 4JJDA 1V1CA 3VS0A 1MV0B 1UJYA 1ABQA 1KJWA 3VS4A 4OMLA 2CSQA 3PVLA 1PKSA 3RBBB 4AFUC 5IXFA 1GCQA 1VYTA 2LQNA 2ESWA 1UGVA 3IQLA 5FWBA 2BTTA 2QDLA 1VA7A 2A36A 2AK5A 4LE9A 4DEYA 2ROLA 1M3CA 1J3TA 5IHIA 1T0HA 1UHFA 2RPNA 1E6GA 1YCSB 4RTZA 5EC7A 2W10A 2L3QA 3I35A 1UJ0A 2W0ZA 1X27A 1CKAA 3JV3A 3I9QA 1UDLA 1NYFA 4RTUA 4GLMA 4JZ4A 2AZVA 2K9GA 1UG1A 1YN8A 2KYMA 1QCFA 3THKA 1GBQA 2JTEA 1X2QA 2LJ1A 1ZUUA 1RLQC 4OMPA 1JO8A 1UFFA 2DM1A 2HCKA 2A28A 2RQVA 4RTVA 1GCQC 1AEYA 2GNCA 1KIKA 1VYUA 2C0OA 4AG2C 3NGPA 2KR3A 1WLPB 1K76A 1I1JA 2BZYA 2EYWA 5GJVB 1M27C 2BZ8A 2RNAA 1OEBA 1ZX6A 3A98A 1CSKA 1SEMA 4RTWA 4DEXA 2JS2A 1B07A 1M3BA 2KRMA 4RTTA 1EFNA 1WI7A 3EGUA 1SHGA 1GBRA 4CC4B 2J06A 2EVRA 2PZ1A 2V1RA 1X2KA 2X3XD 1PNJA 2KYBA 1E7OA 2EKHA 4Z88A 1HSQA 3PE0A 2AKKA 3TVTA 5FW9A 2I0NA 4J9IA 4IIMA 5IHKA 1BBZA 2CREA 1PHTA 1S1NA 3VS2A 2KE9A 1GFDA 2XMFA 1ZUYA 2P4RA 2DRMA 1SHFA 3I5SA 2A08A 5I22A 2D1XA 3VS7A 2K7AA 1RUWA 2GTOA 2ROTA 4JZ3A 2A37A 2EYZA 4F16A 2ENMA 2MCNA 2F2WA 1SPKA 4OMOA 4WCIA 2VWFA 1AWXA 3EHQA 3LH5A 1WIEA 4JJCA 1JEGA 1WA7A 3H0IA 1OV3A 2F2XA 2K2MA 1QLYA 2DBMA 2KNBB 4CC3A 2FRWA 4J9CA 4IIOA 2EW3A 3VRZA 1FMKA 2FPDA 1X6GA 2V1QA 3M0RA 2M51A 4A63B 1PWTA 3CQTA 3KFVA 4Z8AA 1MUZA
chains in the Genus database with same CATH superfamily
4TVRA 1GRIA 4RTYA 5GAOm 2WSEE 3ER0A 4OB2B 1G3WA 1KHIA 1JBMA 2OI3A 3L1AA 2DRKA 2B86A 1YWOA 5FU7C 4ZN3A 1SSFA 4XTUA 2LNVA 2KMTA 2HBWA 4PLLA 4KUDK 3CC4T 3PT9A 4N0AC 2EBPA 2PVDB 5IH2A 1TS9A 2LX9A 3I56A 1QW1A 1YWPA 2K3XA 3M59A 4JPBW 4LD9K 2XDDA 4XU1A 4M7AF 4C8QE 3QZ9B 4J9BA 3L2VA 3NHNA 2F69A 5GANj 3EGXA 3I56Q 1M2VB 1YHQA 1GXIE 1JXMA 2KXCA 1N9RA 3KBGA 2RM4A 1H3ZA 3U23A 2E70A 2ED0A 5LJ5g 1E6HA 3CCUA 1ABOA 2QAZA 3V7SA 4D8DA 1VQLT 1YHQQ 2YSQA 3M53A 4C5EA 5ECAA 3RDVA 3M0UA 2LMJA 4O6JA 4EMKC 3CCMT 2DLPA 1JQQA 2CT4A 4C92E 2F5TX 5KH6A 2QGFB 1K8AU 1WDXA 1NJIU 1N27A 2DKGA 1VOMA 4PJOA 3CCRT 2DZ9A 4X34A 2DL5A 1KD1C 2ZPBB 2JJ9A 4IUPA 2LDMA 1KSWA 4AFQC 1UTIA 4M7DE 5KYYB 2VGMA 3GNFB 4ANJA 3MKDA 2EGAA 3EG3A 2C0TA 2SRCA 2RI5A 3M55A 5GAMe 1NBEB 2EYQA 3CCSQ 4J9EA 2Y4YA 5IAYA 1NE8A 2VVKA 2EIFA 4JJBA 3G6ET 2K6DA 2EJFA 5GAN8 3S6WA 1AWJA 5AYFA 2JMAA 3JB9D 2SEMA 4KT0E 1FMVA 5J3BA 4R56A 1NEGA 4LUEA 2G3RA 2DBKA 2L2PA 4M75B 2YHTA 1I07A 2RQRA 2RHXA 1NLPC 4L5GA 1RLPC 1WXTA 3TQ7P 3P8BB 2FVUA 2GTJA 1BK2A 3QPHA 4X9DA 3R6NA 1QVGA 4YTLA 3QDRB 4LDWA 5GAMh 3C95A 1O9SA 2R57A 4FSSA 1S72Q 2X4JA 1AD5A 4KGXB 2M0YA 2C06A 3OYJA 1K73U 1WQ7A 4BY6B 1RAEB 1VQMA 2JZ2A 2YDLA 4C92C 3H0FA 2QEXA 2EGEA 1K0SA 4CC7A 1OULA 3OMCA 4C5IA 3RNJA 4M7AB 4E7SA 3VYHB 1M90U 2HEQA 3V8LA 2EQIA 2EQJA 1VQMQ 1Q82R 1VQKA 1BKBA 4OB0B 1YIJA 1FYNA 1N9SA 3GNGA 1YJWA 1SRMA 4UC4A 2LRQA 3M0SA 1IGUA 4E6RA 4ZNXA 2ABLA 1UHCA 2DL3A 3VS3A 4M7DC 3I55Q 2DA9A 1X6OA 2XK0A 3UA7A 1KC8C 1XQHA 2LJ3A 2MPXC 5HY6A 4PJOF 2DAQA 3LX7A 4E7KA 2M02A 2DYIA 1OOTA 1VQ6T 5EG2A 4RCBA 1GL5A 2COWA 5KCHA 3H9NA 4BI4A 3JCMb 2LQKA 2OTLA 3OYHA 1U8RA 1BI2A 4FT4A 3EG9A 2DERA 2DIQA 1OI1A 1K0XA 3A8OB 5FWCA 3A8MB 5IT9E 4ZN1A 3H41A 3UWNA 1VQPA 3EG2A 5FLXE 1I0CA 2NWMA 2RK2A 4RUGA 4C8QG 2X51A 3OS1A 2LC4A 1OYXA 3V8KA 2CZ7B 4P5NA 2FRYA 5CKHA 1VQPQ 1LPLA 3GBQA 2O4XA 3PMIA 3CC2A 1WYXA 3A8LB 4BB7A 4V2SA 4AT1B 3PVLA 1D1CA 2E65A 4AFUC 5IXFA 1GCQA 3HTRA 1RL2A 5J26A 3FJPA 1UGVA 4XU0A 2QYZA 4NS5A 4J6XA 2CP2A 1YBYA 2XICA 4C92G 2PUOB 1MMDA 2PVGB 1M4ZA 4RTZA 4JJNK 2EQKA 1UJ0A 1QVPA 1ZSZA 2ZZDA 2W0ZA 3DKMA 3VJPA 4FYWB 9ATCB 3CCMQ 3DB3A 1NYFA 5GAN5 4EPCA 1KG1A 4JZ4A 2K9GA 1QCFA 1VUBA 1IRXA 1X2QA 2R58A 1WJQA 1BI3A 4M7DG 1JO8A 1UFFA 2DM1A 1VQNT 4QKUA 5GMKl 4AG2C 3V7RA 3CEYA 4HCBA 3CCJA 5GJVB 2X9HA 1SKUB 2BZ8A 1OEBA 1PM3A 4BACA 4MMLA 2JS2A 1M3BA 2QK0A 3EGUA 1PSFA 2NYSA 2OAUA 5GAMj 2QI2A 3G71A 4MMKA 2E1HA 1RADB 3G6EQ 2KQWA 2EKHA 1X01A 1Q86R 3MHXA 1D1AA 1Q82C 2DD5A 1Q7YU 2JN0A 3PE0A 3OS5A 2AKKA 3QSUA 2E4HA 3UT1A 3HFOA 2D6FA 1LNXA 4XK8E 1HK9A 4NOYA 1PHTA 3VS2A 2KE9A 5GANe 3A8HB 2P4RA 5GMKi 5D7UA 1TH7A 2X35A 3I56T 3OYGA 2DD4A 3VS7A 1RUWA 2GTOA 2A37A 4F16A 2HQXA 2ZAEA 1ZBXA 5FU7B 4C0ZA 2DXCA 4J8OA 3QG1A 3VUBA 3OSSC 3C94A 2KDSA 3OYDA 3VV0A 1YCYA 2RI3A 1YHQT 2E6ZA 3EHQA 1WIEA 2MWPA 1QCOA 3J80E 1WA7A 3CXCP 2F2XA 3FRNA 2RI2A 1H641 2KNBB 4CC3A 3CCUT 4J9CA 4IIOA 1MHNA 2XDPA 4JRPA 4MDWA 5GANh 2FPDA 1I81A 2KY9A 2M51A 1I5OB 3SB2A 3SD4A 4BE2A 4Z8AA 1D3BA 1Y96B 1N8RR 2F2VA 2RMOA 1N5ZA 3EG0A 3KXTA 2RA2A 4X9CA 1TOVA 1OPKA 5GMKm 1M30A 2IVWA 2FPEA 2L3PA 3MEVA 1LCKA 1AOJA 2ATCB 3M4GA 3JB9H 4QVZA 1BI0A 4J9GA 2DL8A 4C0DC 2C0IA 2ZPHB 3SFMA 3JCMe 4OVAA 1VQ6Q 4C8QD 2BE7D 2LCSA 3QIIA 4AFZC 4ORZA 4PL6A 1AWOA 2OX7A 3X26B 3CCLA 2P0PA 1M8VA 4PJOE 2RQWA 1X6BA 1WJRA 5DM7R 2CDTA 1AVZC 4JLGA 3CCVQ 2E6NA 1KD1U 2CYZB 3X24B 2QTVA 2RO0A 2YRDA 4A4GA 3CPFA 3CCLQ 5KCOA 1KQ1A 4M78F 1M1GA 4M7AA 2CUDA 3M5AA 5CK9A 1PC0A 2EYYA 2VKNA 4JUVA 5KYWA 2CH4W 1AZGB 3JCMh 2DVJA 1ZUKA 2K5IA 3JB9G 2DF6A 1WJSA 2VGNA 3JAME 2GCXA 3EHRA 4HT8A 4X1VA 2K57A 4GLKA 1ZSGA 3PFSA 4IUUA 4M4ZA 1KHCA 1VQMT 3EFOB 1X43A 3M0PA 2JTMA 2JTFA 4K11A 2QEXT 3MO8A 8AT1B 4IKFA 2AHJB 2IG0A 2CGHA 1NLOC 2KI7A 1QVFP 1KQSP 2DXUA 3BDLA 1BI1A 1Q86C 2LP5A 2PU9B 3GF5A 3MPUB 2AZSA 3O5ZA 4B6MA 2QA4A 4OP0A 1VIEA 4XTYA 5GAN4 1YIJT 2QQ9A 4E7IA 1YJWT 1IREB 3CMEA 3OYKA 2DTIA 3QHSA 2EPDA 1TWBA 1NEBA 4C92B 1MV3A 1IO6A 1VQ7A 1VQNQ 3QKJA 3ZBDA 2CZ0B 3CMEQ 7AT1B 4RMOA 4E7JA 2NUTB 3H6ZA 1C0MA 4M75F 1JXOA 1TUGB 1RACB 3URGA 2Y4XA 1VQ7Q 2K3YA 1W70A 3M4YA 3SWNA 3NMZC 5GJWB 1SSHA 5C6SA 5DY9A 2M9UA 4LD6A 3CBPA 4M7DB 4F7UB 2OTLT 3HRTA 3FJ5A 1KC8U 1HXDA 5CIUA 2GQVA 3EG1A 4LDUA 3TU4K 1P92A 1U5SA 5GAN7 4PJNA 2MF2A 2Y90A 3QDFA 2KGTA 3QYGB 4RKUE 1JB0E 4EDUA 1YJ9A 1N8RC 3NTIA 4FW1A 1VQPT 2RHUA 4MZMA 2J7IA 2EJGA 2O01E 3TSZA 2JT4A 2RB6A 3DLMA 2GGRA 3LW5E 3E2UA 4A53A 3OMGA 2E5QA 1SG5A 1ZA1B 4M78B 5CQYA 3X20B 4LUDA 1D0XA 3GOXA 1QVFS 3X25B 2I2LA 1KQSS 3F70A 2DFUA 2GFAA 3CBOA 1R0BG 2DL7A 4ZGDB 4C0FA 1X75C 1LOJA 2NLUA 3JCMQ 1NG2A 2J05A 1RI9A 5I11A 4R55A 1OU8A 3OW2P 4M77F 2KRSA 3M58A 3CCUQ 5FU6B 4FIBA 1M1KU 2ZPEB 1YP5A 2HDAA 4J9HA 3OYEA 1RAHB 1OPLA 1WHGA 1TUDA 4NL2A 4E7LA 2RN8A 2DE0X 2DYBA 1TU0B 2ZPFB 1EZZB 3QYHB 2M1HA 3C12A 4L6V5 3X28B 2GBQA 1I8FA 4ZTJA 4J6WA 1VQ4A 2EFIA 2YUQA 2MIOA 2WSFE 3H8ZA 2O2OA 5HCKA 4PJOG 5LJ3g 3CCJT 1WGSA 5CKBA 2P4TA 2MK5A 3JCMc 1HJDA 4FW2A 1NJIR 4PNOA 3RKYA 1KFZA 2HBPA 3OYMA 4C8QC 5IXBA 2DILA 2K79A 3G71T 2KK4A 2ZCFB 1V1CA 3VS0A 4N0AA 3VS4A 4M7AD 2FHDA 2XU8A 2FYKA 4D6WA 5GMKj 3HFNA 2LQNA 2ESWA 4DA4A 2BTTA 2AK5A 4DEYA 3JCMX 3LWIA 4JRQA 1ZA2B 3L2WA 5KYUB 5IHIA 5CKEA 4KGZB 1Y96A 2HD0A 4JDSA 5EC7A 2W10A 5D6YA 3OW2S 1X27A 5A0DA 3I9QA 1YJNA 4HCCA 3P8HA 2YLCA 2AZVA 5FRMA 5LJ3h 1UB4A 1Q95G 3THKA 4MZTA 1R8OB 2A3LA 1ZUUA 2R5AA 4OMPA 1YJNQ 4XAXB 4ZGEB 2HCKA 3L42A 2A28A 3MP1A 2QDYB 4RTVA 2QEXQ 1GCQC 3AHUA 1WLPB 1TTHB 1QP2A 4HKEA 1M27C 1VQOA 2RNAA 1ZX6A 1AT1B 3BFMA 4OB1B 1SEMA 2CP5A 4RTWA 1K73R 4LDXA 1VQKQ 4RTTA 2AT1B 1EFNA 1YIJQ 1YJWQ 1ZSZC 2A7YA 5GAOr 1GBRA 2RJCA 2YRCA 4M77B 3LH0A 4CC4B 2VXEA 4PKCC 1R0CB 1YITA 2V1RA 1X2KA 1VQOQ 5GAN6 3MEWA 1WNLA 1PD0A 2P0KA 3L2QA 4OGCA 4RG8A 1K9MU 1NZ9A 3TVTA 5FW9A 2I0NA 1G3TA 3MEAA 3CXCA 5IHKA 1BIBA 1MGQA 1BBZA 2V8JA 2CREA 4WTOB 2E10A 2K4YA 1IGQA 1ZUYA 2VYTA 1M1FA 2A08A 5I22A 2D1XA 3CCVT 6AT1B 5I21A 3G7ZA 2RHIA 3CCLT 2OTLQ 2VB6A 4JS4A 4OMOA 2PVOB 4WCIA 4M75E 1QMCA 2IPOB 4C0DB 4PK4A 1XTDA 4IUQA 1OV3A 2RJDA 3L2RA 3S3NA 2FRWA 4RG2A 1FMKA 2NUPB 5GAMg 1X6GA 1U1SA 3CD6A 4A63B 1ZHIA 3ME9A 3QZ5B 4MZPA 5LJ5f 2L5QA 1MUZA 3CC2Q 2ECZA 2QASA 2O31A 1PRLC 2EQMA 4M7AE 2E3IA 1NJIC 2EWNA 3CD6Q 1Y0MA 3GLXA 2F5KA 2X4XA 2NUTA 3JB9I 1Z9QA 4GBQA 5IN1A 2JW4A 4F17A 3N5BB 3OB9A 5I2SA 1OX8A 2E5KA 2QXFA 3O8VA 2L3RA 5KYXB 2DVEA 2DJZA 1XOVA 3CCEA 1PSEA 4PJOD 1MMGA 2OJ2A 5FROA 2CP3A 5LJ5d 2QA4T 4F7UA 1M2OA 2EGCA 1AWWA 4DBQA 4N4GA 1M8MA 2O88A 3CMET 2E3HA 3A8GB 4ME7A 3CCEQ 3MCAB 2VV5A 2DPPB 3EAEA 2XG8D 1Y57A 2NUZA 4LN2A 1KQ2A 4HVWA 1VQ7T 2D8JA 2PUKB 2HQEA 5LJ3f 3Q1JA 3VS5A 1QQJA 2JOYA 3C0CA 4J83A 3CCJQ 1Q81U 5GAN3 4F14A 1M2VA 5KE2A 1G8XA 4HVVA 1QVFA 1M3AA 1KQSA 1C6VX 2QQRA 4IUVA 4M78A 4JRKA 4CRIA 2CZ1B 2CP7A 2GF7A 2XKOC 3OQ5A 1SRLA 1Z9ZA 2O9SA 2OAWA 1TUCA 3OSVA 4LDVA 3G71Q 3TSWA 2K5LA 2DMOA 2CT3A 3REBB 1K73C 3LGFA 1W1FA 5LJ3d 3QWYA 2QTXA 2CSIA 1YJ9T 3HRSA 4A4FA 2CH4A 1C1AA 2YXYA 1JJ2A 4J9FA 4M7AC 2KRNA 1BB9A 3VYGA 2JUFA 1Q7YR 4QW2A 2CUBA 3REAB 1K1ZA 5A0LA 2QG9B 3EH2A 2M16A 3TEEA 1WFWA 4KRTA 4B9WA 3OYBA 2FL7A 5CO7A 3PVQA 4C92F 5KYYA 4LNPA 3OS0A 4CI0C 4QQGA 3PIPA 1SF9A 3UATA 3CMAA 1AZEA 1YNZA 2FZCB 1G3YA 1VQ5A 2KXDA 4EIKA 3HPWA 3OYLA 3RKWA 2A0FB 1B7TA 2X4YA 2LJ0A 4J7FA 3CMAQ 3SHWA 3OYFA 4BD3A 4DBRA 1OZ2A 2RJFA 4M7DF 3UA6A 3ZFJA 4F7UF 1VQ5Q 4M75A 1WHKA 3EGDB 3E19A 1BU1A 4EMKB 2DETA 2WACA 5GAOn 1WHMA 1T0JA 3BDUA 1B3QA 3M9QA 3ASKA 3CC7A 2JMCA 3HRUA 2LQ8A 3OW2A 1U06A 1T3LA 2G6FX 4HCKA 1K9AA 2MYSA 4BI3A 4Q5WA 2AKLA 4M75G 3NPFA 4J5YA 1V29B 4IURA 1D09B 3CC7Q 4QQ6A 3ZL7C 1ZBJA 2YT6A 5GMKe 1TG0A 3SWNC 2BZXA 3CPWP 2XD0A 1EX4A 1F1BB 2LCCA 5GAOl 1D0YA 1JU5C 1OU9A 2DXTA 4HCZA 4KGVB 2B8AA 2FO0A 1JRIA 2KT1A 2PTKA 2EYXA 1RAGB 1IB8A 4F04B 3RKXA 4ELZC 2YLBA 3CXCS 5GAMf 3QJYA 2DZCA 1RAIB 3G4SA 4M7AG 1KD1R 3LLRA 4C8QB 1ARKA 2DJQA 4Y91A 3VS6A 1VQ9A 4M77A 5GMKh 4XTZA 3SEMA 3E1SA 5LJ5h 4B9XA 5CKDA 1YJNT 3S3MA 4C5HA 3G4SQ 2LNHB 5IHNA 2L8DA 3EFRA 1QKWA 1R77A 4KBMB 1VQ9Q 3META 2VUBA 4PFOA 1TSFA 1HD3A 1Y07A 3M0TA 4BE1A 5GANg 2GQIA 5CQXA 3RMSA 4HXJA 1NM7A 1VQKT 2VASA 3FEOA 3M57A 5GAMd 5KYNA 1PD1A 3I5RA 5HKCA 1IXDA 1ZQ1A 1VQ8A 1FXXA 4OMNA 1VQOT 2ZPIB 1B34B 2FG0A 4QT7A 3JRZA 1X69A 3CBMA 2QA4Q 2QQSA 2D0NA 2FZGB 2Z0WA 4OMFB 1A0NB 1PKTA 3LGLA 1I4K1 3J81E 4PJOC 1JJ2P 2JXBA 2F1LA 4Z02A 1YITT 1VIFA 2RF0A 2KBTA 2DXBA 2CP0A 2DEUA 1Q7YC 3UDCA 1MV0B 2D9TA 3INZA 1KJWA 1NPRA 3QXEB 4ATOA 4OMLA 3PGGA 4KUIA 1PKSA 2BUDA 3WVEB 3CPWS 3MJXA 1O75A 1VYTA 2NUPA 1VA7A 2A36A 4M78D 4FYVB 2ROLA 1ZSZB 1M3CA 1J3TA 4II1A 2E41A 2H3EB 2BKDN 2L3QA 3I35A 3FC3A 1CKAA 4FL6A 2V26A 2DK3A 3C4SA 3RUXA 4RTUA 3LYIA 2E12A 4GLMA 4XU2A 4J7IA 1OZ3A 2VC8A 1V76A 1GBQA 2JTEA 4JS5A 1XJWB 1G5VA 5KYXA 3G1JA 1YJ9Q 3S3OA 3JB9F 2LJ1A 3JCMg 1UGSB 2RQVA 1FWZA 3CC2T 1KC8R 2GNCA 5FRNA 1KIKA 2C0OA 3UPUA 3OY9A 3NGPA 2RH2A 2EKOA 1I1JA 2BZYA 2EYWA 3CD6T 3QO3A 1CSKA 1RAFB 5C0MA 1WI7A 4A4KA 2EVRA 2PZ1A 3HSBA 4KULA 2X3XD 3QUIA 1PNJA 2KYBA 3JCMV 4PFPA 2RJEA 1BCMA 4FYXB 2K2VA 1EIFA 1U1TA 4J9IA 4IIMA 1JJ2S 2LVMA 3CCET 1LJOA 5D6WA 4BDZA 4M75D 5CAIA 5CR2A 2DRMA 1SHFA 3I5SA 1UGQB 4FM4B 2BIVA 2K7AA 3AT1B 2ROTA 1LVKA 4JZ3A 2ENMA 1M1KR 5GAOq 2H3JA 1K8AR 1WPYA 2KVQG 1AHJB 1WQWA 4DBFA 3CCSA 1AWXA 2OTJA 4ZTFA 1W2BA 3HL8A 3LH5A 4JJCA 4F7UE 3H0IA 1XNIA 1VQ4Q 4XTXA 2K2MA 2WSCE 4L59A 1QLYA 3JSCA 1W4SA 4C0GA 2EW3A 1Y71A 4FSXA 1D3BB 1G3SA 2OTJQ 2V1QA 4JLIA 5CKFA 1PWTA 3CQTA 2HKQB 4C5GA 4PJMA 4QQDA 4FT2A 5DLQE 1MNEA 5LJ5j 3OYAA 1UGRB 1PRMC 4BI8B 3L2ZA 1MNDA 2MOXA 3BE3A 4J6YA 2RQUA 2MWOA 2RHZA 3GIBA 3MP6A 1S72A 4QVDA 1GFCA 4M78E 2H8HA 4E7HA 4CC2A 1Q82U 4M77D 4DOWA 1QWFA 2E64A 2IIMA 3H0HA 3JCMW 1YI2A 4OGEA 5HK3A 2RQTA 2D0QB 5DLOA 1K4US 5HK0A 1RI0A 3EGDA 2KAFA 4EMKA 3A1PA 2FPFA 3A5ZB 2JS0A 1OQKA 3QWXX 3SDZA 3BY7A 4AG1C 1YI2Q 5LL6S 3TCJA 1G2BA 5GANf 2FB7A 2EQUA 1UEBA 3MP8A 3CMAT 2PQWA 1H92A 2D8HA 1M5Q1 5KYWB 4MDXA 3I55A 3CCQA 1UE9A 4Y92A 1WXBA 1W6XA 4A4HA 5LJ3j 1VQ5T 3WVDB 1H8KA 1M90R 3VKIA 1UGPB 3M0QA 1YFNA 2HKNA 3NTKA 1OX9A 3CCQQ 5A0GA 1WXUA 2MAMA 1YITQ 2LTOA 1G83A 5GANd 1GCPA 1BCOA 2COYA 3V7CA 1U3OA 1NYGA 3T9NA 2LX7A 3CC7T 3ULRB 1ZLMA 2DNUA 2J6FA 2L3SA 1VYVA 2V8IA 3OYNA 2HL5C 3JCMP 3M54A 3NTHA 4AFSC 2K3BA 4C8QA 1I5LA 1BIAA 1QWEA 3EFOA 1K9MR 3CC4A 4E7ZA 1D0ZA 2J6KA 4D8KA 5CCAA 5M9OA 2DTOA 3P8DA 4M78C 2LCLA 2YUNA 4ESRA 3VRYA 4BE0A 3JB9J 2HZYA 3CC4Q 3ZEHA 4OMQA 3JCMf 4XU3A 3TREA 2XIDA 5FU6C 1M1KC 4PFZA 1K8AC 1B34A 4C92A 3SWNB 2LT4A 2FEIA 2JM9A 3OS2A 4HT9A 3G4ST 2YUPA 3L2UA 1Y7XA 5D6XA 2LZ6B 1W2BP 1VQ9T 3QBYA 1VQLA 1H3HA 2QGGA 2L89A 3VS1A 2M0OA 3CPWA 4DBHA 4BDYA 2DX1A 3CCMA 3JCMd 1PG5B 2X3WD 1VQLQ 4M7DA 1D1BA 3DB4A 2JM8A 3LWHA 2P84A 2YRVA 4M77E 2L0AA 3EGXB 2CP6A 1T3SA 3UF4A 3CCRA 4OF1A 1VQ8T 4J9DA 4R0KA 2KEAA 4LDYA 1QKXA 3OA6A 2ZGWA 3EH1A 1Q86U 3CCRQ 2DEQA 4F7UG 1QVGP 5GAOp 2CKKA 4M75C 2BE9B 2ED1A 4LXCA 4PJJA 4VUBA 4RTXA 4XTWA 3G6EA 2LT1A 5L23A 1UUEA 1IHWA 1ACMB 1WZOA 4OMMA 3OBYA 2HAXA 1WHLA 1IZ6A 3QJ6A 2XI9A 1FMWA 4KH1B 2ZPGB 4FYYB 4C8QF 2YUOA 4PJOB 1HYOA 2EAYA 2FZKB 4A54A 4BY6C 3GP8A 1QCNA 2DO3A 4IUTA 1Q81R 3RESA 5KE3A 4M78G 2KT8A 1M90C 4HVUA 4ELYC 2JVVA 1UECA 2V8KA 4BUGA 1N6AA 2HSPA 1QP3A 2DL4A 1RAAB 1W2BS 1CKBA 5CVIA 3EFSA 1WHJA 4GY5A 8ATCB 2O9VA 2DTHA 4RCCA 4Z89A 5GAN2 1N8RU 4JRIA 4DQ2A 3JCMJ 2LQWA 4M77C 1WX6A 4HA8A 4XTVA 3M56A 3FIFA 3DLLA 3OYCA 2KROA 2J6OA 2PNIA 1K9MC 4JJDA 4PJLA 1UJYA 3KUFA 1ABQA 3GPLA 2XHCA 4WF2A 3PTAA 2QQBA 3PNWC 3FLGA 3V8JA 2CSQA 2K5FA 1IHVA 3RBBB 2AIRB 5I2MA 1FX7A 3HHTB 1QVGS 2HSEB 3IQLA 5FWBA 2QDLA 4LE9A 4E2FB 1MMNA 3OYYA 1T0HA 2YWWA 1UHFA 2COZA 2RPNA 1E6GA 1YCSB 1VQ6A 4ZGJB 5KYUA 3JV3A 1VQ4T 1RABB 4EMHA 2QQAA 1UDLA 4OB3B 3CCST 4EMGA 4A4EA 1UG1A 4FU6A 1YN8A 2OTJT 2KYMA 2P0QA 2HMAA 3E9FA 5LJ5e 4FCYA 3R6OA 1RLQC 3CCVA 3RIRA 4E47A 1AEYA 3HKSA 3OBWA 4N4IA 2VXFA 1VYUA 2KR3A 2HQHA 1K76A 2R5MA 2EJ9A 3A98A 4DOVA 4DEXA 1B07A 4QVCA 1DJ7B 2KRMA 4AMCA 2MI6A 1TXQA 1SHGA 4PLIA 2JNGA 2CZ6B 3PMTA 2J06A 3OYIA 2RK1A 1PCXA 2RHYA 3PIOA 1MMAA 5L8RE 4C92D 1KK7A 1E7OA 3RR6A 4Z88A 1M9SA 1S72T 1HSQA 3EG9B 3D7SB 3WXMB 1YI2T 1S1NA 3FB9A 2X4WA 1GFDA 2XMFA 3FDRA 3NFCA 2RD1A 2XDBA 1NPPA 2MMPA 5LJ3e 4KH0B 2EYZA 3HP9A 4N4HA 4M77G 4M7DD 2HL3A 2F2WA 2MCNA 1SPKA 4XQ3A 1BYMA 2VWFA 2O4XB 5AT1B 3E9GA 2HNIA 2CS7A 3VU3C 1WHHA 1Q81C 3I55T 3MEUA 5J39A 3CCQT 3RERA 1JEGA 4NL3A 1VQNA 3VUZA 1VQ8Q 2DBMA 4O5VA 3RMQA 3VRZA 5A2QE 3M0RA 2GFUA 2KSSA 3J7AF 3KFVA 4Y28E 2DIGA 3BW1A
chains in the Genus database with same CATH topology
2ECZA 2O31A 1PRLC 1GRIA 1PRMC 4RTYA 2F2VA 2RMOA 1N5ZA 3EG0A 2MOXA 2RQUA 1OPKA 2OI3A 1M30A 2FPEA 2DRKA 1Y0MA 2L3PA 2B86A 1YWOA 1Z9QA 4GBQA 2JW4A 4F17A 1GFCA 1LCKA 1AOJA 2H8HA 2E5KA 2HBWA 4CC2A 1XOVA 4J9GA 1QWFA 2IIMA 2DL8A 3H0HA 2C0IA 2OJ2A 2RQTA 2EBPA 2LCSA 1K4US 4AFZC 4ORZA 5IH2A 2EGCA 1AWWA 1YWPA 1M8MA 2O88A 1AWOA 2FPFA 2JS0A 4JPBW 3QWXX 2RQWA 4AG1C 1X6BA 1G2BA 4J9BA 1Y57A 2NUZA 4LN2A 3NHNA 2CDTA 1AVZC 4HVWA 1H92A 2D8JA 1JXMA 2KXCA 2D8HA 1UE9A 4Y92A 3VS5A 1WXBA 1W6XA 3C0CA 3U23A 2CUDA 1H8KA 2ED0A 4F14A 2EYYA 2VKNA 1E6HA 4HVVA 1ABOA 3M0QA 2CH4W 1AZGB 1M3AA 2DVJA 4D8DA 2YSQA 5ECAA 1ZUKA 2DF6A 1WXUA 3M0UA 2LMJA 1SRLA 1Z9ZA 2O9SA 2DLPA 1G83A 1TUCA 2OAWA 3EHRA 1JQQA 2CT4A 4X1VA 1GCPA 3TSWA 2DMOA 1U3OA 2CT3A 3REBB 1ZSGA 1NYGA 1W1FA 2LX7A 3QWYA 1ZLMA 2DNUA 4M4ZA 2J6FA 3ULRB 1WDXA 2CSIA 2L3SA 1VYVA 1X43A 3M0PA 4AFSC 2CH4A 2K3BA 4K11A 2DL5A 4J9FA 2KRNA 1BB9A 1NLOC 1QWEA 2LP5A 1KSWA 2AZSA 2CUBA 3O5ZA 3REAB 4AFQC 1K1ZA 2J6KA 4D8KA 1UTIA 2YUNA 2EGAA 3EG3A 4ESRA 2C0TA 2SRCA 3VRYA 1WFWA 4KRTA 3PVQA 4J9EA 2EPDA 4LNPA 2VVKA 4OMQA 1NEBA 1MV3A 1IO6A 3UATA 4JJBA 1AZEA 2K6DA 1YNZA 1AWJA 2JMAA 2SEMA 2FEIA 2KXDA 4EIKA 2JM9A 2YUPA 1NEGA 4LUEA 1JXOA 2LJ0A 2L2PA 2DBKA 2LZ6B 3SHWA 1I07A 1W70A 2RQRA 1NLPC 3NMZC 1H3HA 5GJWB 1RLPC 3UA6A 3VS1A 1SSHA 1WXTA 2GTJA 1BK2A 3R6NA 2DX1A 1BU1A 3FJ5A 4FSSA 1T0JA 2X3WD 3EG1A 1B3QA 1AD5A 2JM8A 2M0YA 1U5SA 2JMCA 2KGTA 2L0AA 1U06A 1T3LA 1T3SA 2G6FX 2YDLA 4HCKA 3UF4A 1K9AA 3H0FA 2EGEA 2J7IA 1K0SA 4CC7A 4J9DA 4R0KA 3TSZA 2JT4A 2AKLA 3NPFA 2KEAA 3RNJA 2HEQA 3ZL7C 1ZBJA 1QKXA 2YT6A 1TG0A 2EQIA 2GGRA 2BZXA 1JU5C 1FYNA 4LUDA 1SRMA 2FO0A 3M0SA 2ED1A 2KT1A 4E6RA 4ZNXA 2PTKA 2ABLA 2DL7A 2EYXA 1UHCA 2DL3A 4RTXA 3VS3A 2DA9A 5L23A 1NG2A 1UUEA 2J05A 3UA7A 1RI9A 5I11A 2LJ3A 4OMMA 2KRSA 2YUOA 1YP5A 2HDAA 1ARKA 1OOTA 4J9HA 2DJQA 3VS6A 1GL5A 1OPLA 3SEMA 1TUDA 2KT8A 4HVUA 2RN8A 1UECA 2LNHB 5IHNA 2DE0X 1QKWA 2HSPA 2DYBA 2DL4A 1CKBA 1HD3A 3M0TA 2GQIA 4HXJA 1NM7A 1K0XA 2GBQA 2O9VA 3I5RA 5FWCA 3H41A 3EG2A 4Z89A 2YUQA 2MIOA 5HCKA 2O2OA 1I0CA 2NWMA 4RUGA 4OMNA 2FG0A 4QT7A 1X69A 1HJDA 2D0NA 1A0NB 1PKTA 2LQWA 1WX6A 1KFZA 2FRYA 2JXBA 3GBQA 5IXBA 1WYXA 2DILA 2KROA 2RF0A 2KBTA 2K79A 2J6OA 2PNIA 4JJDA 1V1CA 3VS0A 1MV0B 1UJYA 1ABQA 1KJWA 3VS4A 4OMLA 2CSQA 3PVLA 1PKSA 3RBBB 4AFUC 5IXFA 1GCQA 1VYTA 2LQNA 2ESWA 1UGVA 3IQLA 5FWBA 2BTTA 2QDLA 1VA7A 2A36A 2AK5A 4LE9A 4DEYA 2ROLA 1M3CA 1J3TA 5IHIA 1T0HA 1UHFA 2RPNA 1E6GA 1YCSB 4RTZA 5EC7A 2W10A 2L3QA 3I35A 1UJ0A 2W0ZA 1X27A 1CKAA 3JV3A 3I9QA 1UDLA 1NYFA 4RTUA 4GLMA 4JZ4A 2AZVA 2K9GA 1UG1A 1YN8A 2KYMA 1QCFA 3THKA 1GBQA 2JTEA 1X2QA 2LJ1A 1ZUUA 1RLQC 4OMPA 1JO8A 1UFFA 2DM1A 2HCKA 2A28A 2RQVA 4RTVA 1GCQC 1AEYA 2GNCA 1KIKA 1VYUA 2C0OA 4AG2C 3NGPA 2KR3A 1WLPB 1K76A 1I1JA 2BZYA 2EYWA 5GJVB 1M27C 2BZ8A 2RNAA 1OEBA 1ZX6A 3A98A 1CSKA 1SEMA 4RTWA 4DEXA 2JS2A 1B07A 1M3BA 2KRMA 4RTTA 1EFNA 1WI7A 3EGUA 1SHGA 1GBRA 4CC4B 2J06A 2EVRA 2PZ1A 2V1RA 1X2KA 2X3XD 1PNJA 2KYBA 1E7OA 2EKHA 4Z88A 1HSQA 3PE0A 2AKKA 3TVTA 5FW9A 2I0NA 4J9IA 4IIMA 5IHKA 1BBZA 2CREA 1PHTA 1S1NA 3VS2A 2KE9A 1GFDA 2XMFA 1ZUYA 2P4RA 2DRMA 1SHFA 3I5SA 2A08A 5I22A 2D1XA 3VS7A 2K7AA 1RUWA 2GTOA 2ROTA 4JZ3A 2A37A 2EYZA 4F16A 2ENMA 2MCNA 2F2WA 1SPKA 4OMOA 4WCIA 2VWFA 1AWXA 3EHQA 3LH5A 1WIEA 4JJCA 1JEGA 1WA7A 3H0IA 1OV3A 2F2XA 2K2MA 1QLYA 2DBMA 2KNBB 4CC3A 2FRWA 4J9CA 4IIOA 2EW3A 3VRZA 1FMKA 2FPDA 1X6GA 2V1QA 3M0RA 2M51A 4A63B 1PWTA 3CQTA 3KFVA 4Z8AA 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECZ A;  2O31 A;  1PRL C;  1GRI A;  1PRM C;  4RTY A;  2F2V A;  2RMO A;  1N5Z A;  3EG0 A;  2MOX A;  2RQU A;  1OPK A;  2OI3 A;  1M30 A;  2FPE A;  2DRK A;  1Y0M A;  2L3P A;  2B86 A;  1YWO A;  1Z9Q A;  4GBQ A;  2JW4 A;  4F17 A;  1GFC A;  1LCK A;  1AOJ A;  2H8H A;  2E5K A;  2HBW A;  4CC2 A;  1XOV A;  4J9G A;  1QWF A;  2IIM A;  2DL8 A;  3H0H A;  2C0I A;  2OJ2 A;  2RQT A;  2EBP A;  2LCS A;  1K4U S;  4AFZ C;  4ORZ A;  5IH2 A;  2EGC A;  1AWW A;  1YWP A;  1M8M A;  2O88 A;  1AWO A;  2FPF A;  2JS0 A;  4JPB W;  3QWX X;  2RQW A;  4AG1 C;  1X6B A;  1G2B A;  4J9B A;  1Y57 A;  2NUZ A;  4LN2 A;  3NHN A;  2CDT A;  1AVZ C;  4HVW A;  1H92 A;  2D8J A;  1JXM A;  2KXC A;  2D8H A;  1UE9 A;  4Y92 A;  3VS5 A;  1WXB A;  1W6X A;  3C0C A;  3U23 A;  2CUD A;  1H8K A;  2ED0 A;  4F14 A;  2EYY A;  2VKN A;  1E6H A;  4HVV A;  1ABO A;  3M0Q A;  2CH4 W;  1AZG B;  1M3A A;  2DVJ A;  4D8D A;  2YSQ A;  5ECA A;  1ZUK A;  2DF6 A;  1WXU A;  3M0U A;  2LMJ A;  1SRL A;  1Z9Z A;  2O9S A;  2DLP A;  1G83 A;  1TUC A;  2OAW A;  3EHR A;  1JQQ A;  2CT4 A;  4X1V A;  1GCP A;  3TSW A;  2DMO A;  1U3O A;  2CT3 A;  3REB B;  1ZSG A;  1NYG A;  1W1F A;  2LX7 A;  3QWY A;  1ZLM A;  2DNU A;  4M4Z A;  2J6F A;  3ULR B;  1WDX A;  2CSI A;  2L3S A;  1VYV A;  1X43 A;  3M0P A;  4AFS C;  2CH4 A;  2K3B A;  4K11 A;  2DL5 A;  4J9F A;  2KRN A;  1BB9 A;  1NLO C;  1QWE A;  2LP5 A;  1KSW A;  2AZS A;  2CUB A;  3O5Z A;  3REA B;  4AFQ C;  1K1Z A;  2J6K A;  4D8K A;  1UTI A;  2YUN A;  2EGA A;  3EG3 A;  4ESR A;  2C0T A;  2SRC A;  3VRY A;  1WFW A;  4KRT A;  3PVQ A;  4J9E A;  2EPD A;  4LNP A;  2VVK A;  4OMQ A;  1NEB A;  1MV3 A;  1IO6 A;  3UAT A;  4JJB A;  1AZE A;  2K6D A;  1YNZ A;  1AWJ A;  2JMA A;  2SEM A;  2FEI A;  2KXD A;  4EIK A;  2JM9 A;  2YUP A;  1NEG A;  4LUE A;  1JXO A;  2LJ0 A;  2L2P A;  2DBK A;  2LZ6 B;  3SHW A;  1I07 A;  1W70 A;  2RQR A;  1NLP C;  3NMZ C;  1H3H A;  5GJW B;  1RLP C;  3UA6 A;  3VS1 A;  1SSH A;  1WXT A;  2GTJ A;  1BK2 A;  3R6N A;  2DX1 A;  1BU1 A;  3FJ5 A;  4FSS A;  1T0J A;  2X3W D;  3EG1 A;  1B3Q A;  1AD5 A;  2JM8 A;  2M0Y A;  1U5S A;  2JMC A;  2KGT A;  2L0A A;  1U06 A;  1T3L A;  1T3S A;  2G6F X;  2YDL A;  4HCK A;  3UF4 A;  1K9A A;  3H0F A;  2EGE A;  2J7I A;  1K0S A;  4CC7 A;  4J9D A;  4R0K A;  3TSZ A;  2JT4 A;  2AKL A;  3NPF A;  2KEA A;  3RNJ A;  2HEQ A;  3ZL7 C;  1ZBJ A;  1QKX A;  2YT6 A;  1TG0 A;  2EQI A;  2GGR A;  2BZX A;  1JU5 C;  1FYN A;  4LUD A;  1SRM A;  2FO0 A;  3M0S A;  2ED1 A;  2KT1 A;  4E6R A;  4ZNX A;  2PTK A;  2ABL A;  2DL7 A;  2EYX A;  1UHC A;  2DL3 A;  4RTX A;  3VS3 A;  2DA9 A;  5L23 A;  1NG2 A;  1UUE A;  2J05 A;  3UA7 A;  1RI9 A;  5I11 A;  2LJ3 A;  4OMM A;  2KRS A;  2YUO A;  1YP5 A;  2HDA A;  1ARK A;  1OOT A;  4J9H A;  2DJQ A;  3VS6 A;  1GL5 A;  1OPL A;  3SEM A;  1TUD A;  2KT8 A;  4HVU A;  2RN8 A;  1UEC A;  2LNH B;  5IHN A;  2DE0 X;  1QKW A;  2HSP A;  2DYB A;  2DL4 A;  1CKB A;  1HD3 A;  3M0T A;  2GQI A;  4HXJ A;  1NM7 A;  1K0X A;  2GBQ A;  2O9V A;  3I5R A;  5FWC A;  3H41 A;  3EG2 A;  4Z89 A;  2YUQ A;  2MIO A;  5HCK A;  2O2O A;  1I0C A;  2NWM A;  4RUG A;  4OMN A;  2FG0 A;  4QT7 A;  1X69 A;  1HJD A;  2D0N A;  1A0N B;  1PKT A;  2LQW A;  1WX6 A;  1KFZ A;  2FRY A;  2JXB A;  3GBQ A;  5IXB A;  1WYX A;  2DIL A;  2KRO A;  2RF0 A;  2KBT A;  2K79 A;  2J6O A;  2PNI A;  4JJD A;  1V1C A;  3VS0 A;  1MV0 B;  1UJY A;  1ABQ A;  1KJW A;  3VS4 A;  4OML A;  2CSQ A;  3PVL A;  1PKS A;  3RBB B;  4AFU C;  5IXF A;  1GCQ A;  1VYT A;  2LQN A;  2ESW A;  1UGV A;  3IQL A;  5FWB A;  2BTT A;  2QDL A;  1VA7 A;  2A36 A;  2AK5 A;  4LE9 A;  4DEY A;  2ROL A;  1M3C A;  1J3T A;  5IHI A;  1T0H A;  1UHF A;  2RPN A;  1E6G A;  1YCS B;  4RTZ A;  5EC7 A;  2W10 A;  2L3Q A;  3I35 A;  1UJ0 A;  2W0Z A;  1X27 A;  1CKA A;  3JV3 A;  3I9Q A;  1UDL A;  1NYF A;  4RTU A;  4GLM A;  4JZ4 A;  2AZV A;  2K9G A;  1UG1 A;  1YN8 A;  2KYM A;  1QCF A;  3THK A;  1GBQ A;  2JTE A;  1X2Q A;  2LJ1 A;  1ZUU A;  1RLQ C;  4OMP A;  1JO8 A;  1UFF A;  2DM1 A;  2HCK A;  2A28 A;  2RQV A;  4RTV A;  1GCQ C;  1AEY A;  2GNC A;  1KIK A;  1VYU A;  2C0O A;  4AG2 C;  3NGP A;  2KR3 A;  1WLP B;  1K76 A;  1I1J A;  2BZY A;  2EYW A;  5GJV B;  1M27 C;  2BZ8 A;  2RNA A;  1OEB A;  1ZX6 A;  3A98 A;  1CSK A;  1SEM A;  4RTW A;  4DEX A;  2JS2 A;  1B07 A;  1M3B A;  2KRM A;  4RTT A;  1EFN A;  1WI7 A;  3EGU A;  1SHG A;  1GBR A;  4CC4 B;  2J06 A;  2EVR A;  2PZ1 A;  2V1R A;  1X2K A;  2X3X D;  1PNJ A;  2KYB A;  1E7O A;  2EKH A;  4Z88 A;  1HSQ A;  3PE0 A;  2AKK A;  3TVT A;  5FW9 A;  2I0N A;  4J9I A;  4IIM A;  5IHK A;  1BBZ A;  2CRE A;  1PHT A;  1S1N A;  3VS2 A;  2KE9 A;  1GFD A;  2XMF A;  1ZUY A;  2P4R A;  2DRM A;  1SHF A;  3I5S A;  2A08 A;  5I22 A;  2D1X A;  3VS7 A;  2K7A A;  1RUW A;  2GTO A;  2ROT A;  4JZ3 A;  2A37 A;  2EYZ A;  4F16 A;  2ENM A;  2MCN A;  2F2W A;  1SPK A;  4OMO A;  4WCI A;  2VWF A;  1AWX A;  3EHQ A;  3LH5 A;  1WIE A;  4JJC A;  1JEG A;  1WA7 A;  3H0I A;  1OV3 A;  2F2X A;  2K2M A;  1QLY A;  2DBM A;  2KNB B;  4CC3 A;  2FRW A;  4J9C A;  4IIO A;  2EW3 A;  3VRZ A;  1FMK A;  2FPD A;  1X6G A;  2V1Q A;  3M0R A;  2M51 A;  4A63 B;  1PWT A;  3CQT A;  3KFV A;  4Z8A A;  1MUZ A; 
#chains in the Genus database with same CATH topology
 4TVR A;  1GRI A;  4RTY A;  5GAO m;  2WSE E;  3ER0 A;  4OB2 B;  1G3W A;  1KHI A;  1JBM A;  2OI3 A;  3L1A A;  2DRK A;  2B86 A;  1YWO A;  5FU7 C;  4ZN3 A;  1SSF A;  4XTU A;  2LNV A;  2KMT A;  2HBW A;  4PLL A;  4KUD K;  3CC4 T;  3PT9 A;  4N0A C;  2EBP A;  2PVD B;  5IH2 A;  1TS9 A;  2LX9 A;  3I56 A;  1QW1 A;  1YWP A;  2K3X A;  3M59 A;  4JPB W;  4LD9 K;  2XDD A;  4XU1 A;  4M7A F;  4C8Q E;  3QZ9 B;  4J9B A;  3L2V A;  3NHN A;  2F69 A;  5GAN j;  3EGX A;  3I56 Q;  1M2V B;  1YHQ A;  1GXI E;  1JXM A;  2KXC A;  1N9R A;  3KBG A;  2RM4 A;  1H3Z A;  3U23 A;  2E70 A;  2ED0 A;  5LJ5 g;  1E6H A;  3CCU A;  1ABO A;  2QAZ A;  3V7S A;  4D8D A;  1VQL T;  1YHQ Q;  2YSQ A;  3M53 A;  4C5E A;  5ECA A;  3RDV A;  3M0U A;  2LMJ A;  4O6J A;  4EMK C;  3CCM T;  2DLP A;  1JQQ A;  2CT4 A;  4C92 E;  2F5T X;  5KH6 A;  2QGF B;  1K8A U;  1WDX A;  1NJI U;  1N27 A;  2DKG A;  1VOM A;  4PJO A;  3CCR T;  2DZ9 A;  4X34 A;  2DL5 A;  1KD1 C;  2ZPB B;  2JJ9 A;  4IUP A;  2LDM A;  1KSW A;  4AFQ C;  1UTI A;  4M7D E;  5KYY B;  2VGM A;  3GNF B;  4ANJ A;  3MKD A;  2EGA A;  3EG3 A;  2C0T A;  2SRC A;  2RI5 A;  3M55 A;  5GAM e;  1NBE B;  2EYQ A;  3CCS Q;  4J9E A;  2Y4Y A;  5IAY A;  1NE8 A;  2VVK A;  2EIF A;  4JJB A;  3G6E T;  2K6D A;  2EJF A;  5GAN 8;  3S6W A;  1AWJ A;  5AYF A;  2JMA A;  3JB9 D;  2SEM A;  4KT0 E;  1FMV A;  5J3B A;  4R56 A;  1NEG A;  4LUE A;  2G3R A;  2DBK A;  2L2P A;  4M75 B;  2YHT A;  1I07 A;  2RQR A;  2RHX A;  1NLP C;  4L5G A;  1RLP C;  1WXT A;  3TQ7 P;  3P8B B;  2FVU A;  2GTJ A;  1BK2 A;  3QPH A;  4X9D A;  3R6N A;  1QVG A;  4YTL A;  3QDR B;  4LDW A;  5GAM h;  3C95 A;  1O9S A;  2R57 A;  4FSS A;  1S72 Q;  2X4J A;  1AD5 A;  4KGX B;  2M0Y A;  2C06 A;  3OYJ A;  1K73 U;  1WQ7 A;  4BY6 B;  1RAE B;  1VQM A;  2JZ2 A;  2YDL A;  4C92 C;  3H0F A;  2QEX A;  2EGE A;  1K0S A;  4CC7 A;  1OUL A;  3OMC A;  4C5I A;  3RNJ A;  4M7A B;  4E7S A;  3VYH B;  1M90 U;  2HEQ A;  3V8L A;  2EQI A;  2EQJ A;  1VQM Q;  1Q82 R;  1VQK A;  1BKB A;  4OB0 B;  1YIJ A;  1FYN A;  1N9S A;  3GNG A;  1YJW A;  1SRM A;  4UC4 A;  2LRQ A;  3M0S A;  1IGU A;  4E6R A;  4ZNX A;  2ABL A;  1UHC A;  2DL3 A;  3VS3 A;  4M7D C;  3I55 Q;  2DA9 A;  1X6O A;  2XK0 A;  3UA7 A;  1KC8 C;  1XQH A;  2LJ3 A;  2MPX C;  5HY6 A;  4PJO F;  2DAQ A;  3LX7 A;  4E7K A;  2M02 A;  2DYI A;  1OOT A;  1VQ6 T;  5EG2 A;  4RCB A;  1GL5 A;  2COW A;  5KCH A;  3H9N A;  4BI4 A;  3JCM b;  2LQK A;  2OTL A;  3OYH A;  1U8R A;  1BI2 A;  4FT4 A;  3EG9 A;  2DER A;  2DIQ A;  1OI1 A;  1K0X A;  3A8O B;  5FWC A;  3A8M B;  5IT9 E;  4ZN1 A;  3H41 A;  3UWN A;  1VQP A;  3EG2 A;  5FLX E;  1I0C A;  2NWM A;  2RK2 A;  4RUG A;  4C8Q G;  2X51 A;  3OS1 A;  2LC4 A;  1OYX A;  3V8K A;  2CZ7 B;  4P5N A;  2FRY A;  5CKH A;  1VQP Q;  1LPL A;  3GBQ A;  2O4X A;  3PMI A;  3CC2 A;  1WYX A;  3A8L B;  4BB7 A;  4V2S A;  4AT1 B;  3PVL A;  1D1C A;  2E65 A;  4AFU C;  5IXF A;  1GCQ A;  3HTR A;  1RL2 A;  5J26 A;  3FJP A;  1UGV A;  4XU0 A;  2QYZ A;  4NS5 A;  4J6X A;  2CP2 A;  1YBY A;  2XIC A;  4C92 G;  2PUO B;  1MMD A;  2PVG B;  1M4Z A;  4RTZ A;  4JJN K;  2EQK A;  1UJ0 A;  1QVP A;  1ZSZ A;  2ZZD A;  2W0Z A;  3DKM A;  3VJP A;  4FYW B;  9ATC B;  3CCM Q;  3DB3 A;  1NYF A;  5GAN 5;  4EPC A;  1KG1 A;  4JZ4 A;  2K9G A;  1QCF A;  1VUB A;  1IRX A;  1X2Q A;  2R58 A;  1WJQ A;  1BI3 A;  4M7D G;  1JO8 A;  1UFF A;  2DM1 A;  1VQN T;  4QKU A;  5GMK l;  4AG2 C;  3V7R A;  3CEY A;  4HCB A;  3CCJ A;  5GJV B;  2X9H A;  1SKU B;  2BZ8 A;  1OEB A;  1PM3 A;  4BAC A;  4MML A;  2JS2 A;  1M3B A;  2QK0 A;  3EGU A;  1PSF A;  2NYS A;  2OAU A;  5GAM j;  2QI2 A;  3G71 A;  4MMK A;  2E1H A;  1RAD B;  3G6E Q;  2KQW A;  2EKH A;  1X01 A;  1Q86 R;  3MHX A;  1D1A A;  1Q82 C;  2DD5 A;  1Q7Y U;  2JN0 A;  3PE0 A;  3OS5 A;  2AKK A;  3QSU A;  2E4H A;  3UT1 A;  3HFO A;  2D6F A;  1LNX A;  4XK8 E;  1HK9 A;  4NOY A;  1PHT A;  3VS2 A;  2KE9 A;  5GAN e;  3A8H B;  2P4R A;  5GMK i;  5D7U A;  1TH7 A;  2X35 A;  3I56 T;  3OYG A;  2DD4 A;  3VS7 A;  1RUW A;  2GTO A;  2A37 A;  4F16 A;  2HQX A;  2ZAE A;  1ZBX A;  5FU7 B;  4C0Z A;  2DXC A;  4J8O A;  3QG1 A;  3VUB A;  3OSS C;  3C94 A;  2KDS A;  3OYD A;  3VV0 A;  1YCY A;  2RI3 A;  1YHQ T;  2E6Z A;  3EHQ A;  1WIE A;  2MWP A;  1QCO A;  3J80 E;  1WA7 A;  3CXC P;  2F2X A;  3FRN A;  2RI2 A;  1H64 1;  2KNB B;  4CC3 A;  3CCU T;  4J9C A;  4IIO A;  1MHN A;  2XDP A;  4JRP A;  4MDW A;  5GAN h;  2FPD A;  1I81 A;  2KY9 A;  2M51 A;  1I5O B;  3SB2 A;  3SD4 A;  4BE2 A;  4Z8A A;  1D3B A;  1Y96 B;  1N8R R;  2F2V A;  2RMO A;  1N5Z A;  3EG0 A;  3KXT A;  2RA2 A;  4X9C A;  1TOV A;  1OPK A;  5GMK m;  1M30 A;  2IVW A;  2FPE A;  2L3P A;  3MEV A;  1LCK A;  1AOJ A;  2ATC B;  3M4G A;  3JB9 H;  4QVZ A;  1BI0 A;  4J9G A;  2DL8 A;  4C0D C;  2C0I A;  2ZPH B;  3SFM A;  3JCM e;  4OVA A;  1VQ6 Q;  4C8Q D;  2BE7 D;  2LCS A;  3QII A;  4AFZ C;  4ORZ A;  4PL6 A;  1AWO A;  2OX7 A;  3X26 B;  3CCL A;  2P0P A;  1M8V A;  4PJO E;  2RQW A;  1X6B A;  1WJR A;  5DM7 R;  2CDT A;  1AVZ C;  4JLG A;  3CCV Q;  2E6N A;  1KD1 U;  2CYZ B;  3X24 B;  2QTV A;  2RO0 A;  2YRD A;  4A4G A;  3CPF A;  3CCL Q;  5KCO A;  1KQ1 A;  4M78 F;  1M1G A;  4M7A A;  2CUD A;  3M5A A;  5CK9 A;  1PC0 A;  2EYY A;  2VKN A;  4JUV A;  5KYW A;  2CH4 W;  1AZG B;  3JCM h;  2DVJ A;  1ZUK A;  2K5I A;  3JB9 G;  2DF6 A;  1WJS A;  2VGN A;  3JAM E;  2GCX A;  3EHR A;  4HT8 A;  4X1V A;  2K57 A;  4GLK A;  1ZSG A;  3PFS A;  4IUU A;  4M4Z A;  1KHC A;  1VQM T;  3EFO B;  1X43 A;  3M0P A;  2JTM A;  2JTF A;  4K11 A;  2QEX T;  3MO8 A;  8AT1 B;  4IKF A;  2AHJ B;  2IG0 A;  2CGH A;  1NLO C;  2KI7 A;  1QVF P;  1KQS P;  2DXU A;  3BDL A;  1BI1 A;  1Q86 C;  2LP5 A;  2PU9 B;  3GF5 A;  3MPU B;  2AZS A;  3O5Z A;  4B6M A;  2QA4 A;  4OP0 A;  1VIE A;  4XTY A;  5GAN 4;  1YIJ T;  2QQ9 A;  4E7I A;  1YJW T;  1IRE B;  3CME A;  3OYK A;  2DTI A;  3QHS A;  2EPD A;  1TWB A;  1NEB A;  4C92 B;  1MV3 A;  1IO6 A;  1VQ7 A;  1VQN Q;  3QKJ A;  3ZBD A;  2CZ0 B;  3CME Q;  7AT1 B;  4RMO A;  4E7J A;  2NUT B;  3H6Z A;  1C0M A;  4M75 F;  1JXO A;  1TUG B;  1RAC B;  3URG A;  2Y4X A;  1VQ7 Q;  2K3Y A;  1W70 A;  3M4Y A;  3SWN A;  3NMZ C;  5GJW B;  1SSH A;  5C6S A;  5DY9 A;  2M9U A;  4LD6 A;  3CBP A;  4M7D B;  4F7U B;  2OTL T;  3HRT A;  3FJ5 A;  1KC8 U;  1HXD A;  5CIU A;  2GQV A;  3EG1 A;  4LDU A;  3TU4 K;  1P92 A;  1U5S A;  5GAN 7;  4PJN A;  2MF2 A;  2Y90 A;  3QDF A;  2KGT A;  3QYG B;  4RKU E;  1JB0 E;  4EDU A;  1YJ9 A;  1N8R C;  3NTI A;  4FW1 A;  1VQP T;  2RHU A;  4MZM A;  2J7I A;  2EJG A;  2O01 E;  3TSZ A;  2JT4 A;  2RB6 A;  3DLM A;  2GGR A;  3LW5 E;  3E2U A;  4A53 A;  3OMG A;  2E5Q A;  1SG5 A;  1ZA1 B;  4M78 B;  5CQY A;  3X20 B;  4LUD A;  1D0X A;  3GOX A;  1QVF S;  3X25 B;  2I2L A;  1KQS S;  3F70 A;  2DFU A;  2GFA A;  3CBO A;  1R0B G;  2DL7 A;  4ZGD B;  4C0F A;  1X75 C;  1LOJ A;  2NLU A;  3JCM Q;  1NG2 A;  2J05 A;  1RI9 A;  5I11 A;  4R55 A;  1OU8 A;  3OW2 P;  4M77 F;  2KRS A;  3M58 A;  3CCU Q;  5FU6 B;  4FIB A;  1M1K U;  2ZPE B;  1YP5 A;  2HDA A;  4J9H A;  3OYE A;  1RAH B;  1OPL A;  1WHG A;  1TUD A;  4NL2 A;  4E7L A;  2RN8 A;  2DE0 X;  2DYB A;  1TU0 B;  2ZPF B;  1EZZ B;  3QYH B;  2M1H A;  3C12 A;  4L6V 5;  3X28 B;  2GBQ A;  1I8F A;  4ZTJ A;  4J6W A;  1VQ4 A;  2EFI A;  2YUQ A;  2MIO A;  2WSF E;  3H8Z A;  2O2O A;  5HCK A;  4PJO G;  5LJ3 g;  3CCJ T;  1WGS A;  5CKB A;  2P4T A;  2MK5 A;  3JCM c;  1HJD A;  4FW2 A;  1NJI R;  4PNO A;  3RKY A;  1KFZ A;  2HBP A;  3OYM A;  4C8Q C;  5IXB A;  2DIL A;  2K79 A;  3G71 T;  2KK4 A;  2ZCF B;  1V1C A;  3VS0 A;  4N0A A;  3VS4 A;  4M7A D;  2FHD A;  2XU8 A;  2FYK A;  4D6W A;  5GMK j;  3HFN A;  2LQN A;  2ESW A;  4DA4 A;  2BTT A;  2AK5 A;  4DEY A;  3JCM X;  3LWI A;  4JRQ A;  1ZA2 B;  3L2W A;  5KYU B;  5IHI A;  5CKE A;  4KGZ B;  1Y96 A;  2HD0 A;  4JDS A;  5EC7 A;  2W10 A;  5D6Y A;  3OW2 S;  1X27 A;  5A0D A;  3I9Q A;  1YJN A;  4HCC A;  3P8H A;  2YLC A;  2AZV A;  5FRM A;  5LJ3 h;  1UB4 A;  1Q95 G;  3THK A;  4MZT A;  1R8O B;  2A3L A;  1ZUU A;  2R5A A;  4OMP A;  1YJN Q;  4XAX B;  4ZGE B;  2HCK A;  3L42 A;  2A28 A;  3MP1 A;  2QDY B;  4RTV A;  2QEX Q;  1GCQ C;  3AHU A;  1WLP B;  1TTH B;  1QP2 A;  4HKE A;  1M27 C;  1VQO A;  2RNA A;  1ZX6 A;  1AT1 B;  3BFM A;  4OB1 B;  1SEM A;  2CP5 A;  4RTW A;  1K73 R;  4LDX A;  1VQK Q;  4RTT A;  2AT1 B;  1EFN A;  1YIJ Q;  1YJW Q;  1ZSZ C;  2A7Y A;  5GAO r;  1GBR A;  2RJC A;  2YRC A;  4M77 B;  3LH0 A;  4CC4 B;  2VXE A;  4PKC C;  1R0C B;  1YIT A;  2V1R A;  1X2K A;  1VQO Q;  5GAN 6;  3MEW A;  1WNL A;  1PD0 A;  2P0K A;  3L2Q A;  4OGC A;  4RG8 A;  1K9M U;  1NZ9 A;  3TVT A;  5FW9 A;  2I0N A;  1G3T A;  3MEA A;  3CXC A;  5IHK A;  1BIB A;  1MGQ A;  1BBZ A;  2V8J A;  2CRE A;  4WTO B;  2E10 A;  2K4Y A;  1IGQ A;  1ZUY A;  2VYT A;  1M1F A;  2A08 A;  5I22 A;  2D1X A;  3CCV T;  6AT1 B;  5I21 A;  3G7Z A;  2RHI A;  3CCL T;  2OTL Q;  2VB6 A;  4JS4 A;  4OMO A;  2PVO B;  4WCI A;  4M75 E;  1QMC A;  2IPO B;  4C0D B;  4PK4 A;  1XTD A;  4IUQ A;  1OV3 A;  2RJD A;  3L2R A;  3S3N A;  2FRW A;  4RG2 A;  1FMK A;  2NUP B;  5GAM g;  1X6G A;  1U1S A;  3CD6 A;  4A63 B;  1ZHI A;  3ME9 A;  3QZ5 B;  4MZP A;  5LJ5 f;  2L5Q A;  1MUZ A;  3CC2 Q;  2ECZ A;  2QAS A;  2O31 A;  1PRL C;  2EQM A;  4M7A E;  2E3I A;  1NJI C;  2EWN A;  3CD6 Q;  1Y0M A;  3GLX A;  2F5K A;  2X4X A;  2NUT A;  3JB9 I;  1Z9Q A;  4GBQ A;  5IN1 A;  2JW4 A;  4F17 A;  3N5B B;  3OB9 A;  5I2S A;  1OX8 A;  2E5K A;  2QXF A;  3O8V A;  2L3R A;  5KYX B;  2DVE A;  2DJZ A;  1XOV A;  3CCE A;  1PSE A;  4PJO D;  1MMG A;  2OJ2 A;  5FRO A;  2CP3 A;  5LJ5 d;  2QA4 T;  4F7U A;  1M2O A;  2EGC A;  1AWW A;  4DBQ A;  4N4G A;  1M8M A;  2O88 A;  3CME T;  2E3H A;  3A8G B;  4ME7 A;  3CCE Q;  3MCA B;  2VV5 A;  2DPP B;  3EAE A;  2XG8 D;  1Y57 A;  2NUZ A;  4LN2 A;  1KQ2 A;  4HVW A;  1VQ7 T;  2D8J A;  2PUK B;  2HQE A;  5LJ3 f;  3Q1J A;  3VS5 A;  1QQJ A;  2JOY A;  3C0C A;  4J83 A;  3CCJ Q;  1Q81 U;  5GAN 3;  4F14 A;  1M2V A;  5KE2 A;  1G8X A;  4HVV A;  1QVF A;  1M3A A;  1KQS A;  1C6V X;  2QQR A;  4IUV A;  4M78 A;  4JRK A;  4CRI A;  2CZ1 B;  2CP7 A;  2GF7 A;  2XKO C;  3OQ5 A;  1SRL A;  1Z9Z A;  2O9S A;  2OAW A;  1TUC A;  3OSV A;  4LDV A;  3G71 Q;  3TSW A;  2K5L A;  2DMO A;  2CT3 A;  3REB B;  1K73 C;  3LGF A;  1W1F A;  5LJ3 d;  3QWY A;  2QTX A;  2CSI A;  1YJ9 T;  3HRS A;  4A4F A;  2CH4 A;  1C1A A;  2YXY A;  1JJ2 A;  4J9F A;  4M7A C;  2KRN A;  1BB9 A;  3VYG A;  2JUF A;  1Q7Y R;  4QW2 A;  2CUB A;  3REA B;  1K1Z A;  5A0L A;  2QG9 B;  3EH2 A;  2M16 A;  3TEE A;  1WFW A;  4KRT A;  4B9W A;  3OYB A;  2FL7 A;  5CO7 A;  3PVQ A;  4C92 F;  5KYY A;  4LNP A;  3OS0 A;  4CI0 C;  4QQG A;  3PIP A;  1SF9 A;  3UAT A;  3CMA A;  1AZE A;  1YNZ A;  2FZC B;  1G3Y A;  1VQ5 A;  2KXD A;  4EIK A;  3HPW A;  3OYL A;  3RKW A;  2A0F B;  1B7T A;  2X4Y A;  2LJ0 A;  4J7F A;  3CMA Q;  3SHW A;  3OYF A;  4BD3 A;  4DBR A;  1OZ2 A;  2RJF A;  4M7D F;  3UA6 A;  3ZFJ A;  4F7U F;  1VQ5 Q;  4M75 A;  1WHK A;  3EGD B;  3E19 A;  1BU1 A;  4EMK B;  2DET A;  2WAC A;  5GAO n;  1WHM A;  1T0J A;  3BDU A;  1B3Q A;  3M9Q A;  3ASK A;  3CC7 A;  2JMC A;  3HRU A;  2LQ8 A;  3OW2 A;  1U06 A;  1T3L A;  2G6F X;  4HCK A;  1K9A A;  2MYS A;  4BI3 A;  4Q5W A;  2AKL A;  4M75 G;  3NPF A;  4J5Y A;  1V29 B;  4IUR A;  1D09 B;  3CC7 Q;  4QQ6 A;  3ZL7 C;  1ZBJ A;  2YT6 A;  5GMK e;  1TG0 A;  3SWN C;  2BZX A;  3CPW P;  2XD0 A;  1EX4 A;  1F1B B;  2LCC A;  5GAO l;  1D0Y A;  1JU5 C;  1OU9 A;  2DXT A;  4HCZ A;  4KGV B;  2B8A A;  2FO0 A;  1JRI A;  2KT1 A;  2PTK A;  2EYX A;  1RAG B;  1IB8 A;  4F04 B;  3RKX A;  4ELZ C;  2YLB A;  3CXC S;  5GAM f;  3QJY A;  2DZC A;  1RAI B;  3G4S A;  4M7A G;  1KD1 R;  3LLR A;  4C8Q B;  1ARK A;  2DJQ A;  4Y91 A;  3VS6 A;  1VQ9 A;  4M77 A;  5GMK h;  4XTZ A;  3SEM A;  3E1S A;  5LJ5 h;  4B9X A;  5CKD A;  1YJN T;  3S3M A;  4C5H A;  3G4S Q;  2LNH B;  5IHN A;  2L8D A;  3EFR A;  1QKW A;  1R77 A;  4KBM B;  1VQ9 Q;  3MET A;  2VUB A;  4PFO A;  1TSF A;  1HD3 A;  1Y07 A;  3M0T A;  4BE1 A;  5GAN g;  2GQI A;  5CQX A;  3RMS A;  4HXJ A;  1NM7 A;  1VQK T;  2VAS A;  3FEO A;  3M57 A;  5GAM d;  5KYN A;  1PD1 A;  3I5R A;  5HKC A;  1IXD A;  1ZQ1 A;  1VQ8 A;  1FXX A;  4OMN A;  1VQO T;  2ZPI B;  1B34 B;  2FG0 A;  4QT7 A;  3JRZ A;  1X69 A;  3CBM A;  2QA4 Q;  2QQS A;  2D0N A;  2FZG B;  2Z0W A;  4OMF B;  1A0N B;  1PKT A;  3LGL A;  1I4K 1;  3J81 E;  4PJO C;  1JJ2 P;  2JXB A;  2F1L A;  4Z02 A;  1YIT T;  1VIF A;  2RF0 A;  2KBT A;  2DXB A;  2CP0 A;  2DEU A;  1Q7Y C;  3UDC A;  1MV0 B;  2D9T A;  3INZ A;  1KJW A;  1NPR A;  3QXE B;  4ATO A;  4OML A;  3PGG A;  4KUI A;  1PKS A;  2BUD A;  3WVE B;  3CPW S;  3MJX A;  1O75 A;  1VYT A;  2NUP A;  1VA7 A;  2A36 A;  4M78 D;  4FYV B;  2ROL A;  1ZSZ B;  1M3C A;  1J3T A;  4II1 A;  2E41 A;  2H3E B;  2BKD N;  2L3Q A;  3I35 A;  3FC3 A;  1CKA A;  4FL6 A;  2V26 A;  2DK3 A;  3C4S A;  3RUX A;  4RTU A;  3LYI A;  2E12 A;  4GLM A;  4XU2 A;  4J7I A;  1OZ3 A;  2VC8 A;  1V76 A;  1GBQ A;  2JTE A;  4JS5 A;  1XJW B;  1G5V A;  5KYX A;  3G1J A;  1YJ9 Q;  3S3O A;  3JB9 F;  2LJ1 A;  3JCM g;  1UGS B;  2RQV A;  1FWZ A;  3CC2 T;  1KC8 R;  2GNC A;  5FRN A;  1KIK A;  2C0O A;  3UPU A;  3OY9 A;  3NGP A;  2RH2 A;  2EKO A;  1I1J A;  2BZY A;  2EYW A;  3CD6 T;  3QO3 A;  1CSK A;  1RAF B;  5C0M A;  1WI7 A;  4A4K A;  2EVR A;  2PZ1 A;  3HSB A;  4KUL A;  2X3X D;  3QUI A;  1PNJ A;  2KYB A;  3JCM V;  4PFP A;  2RJE A;  1BCM A;  4FYX B;  2K2V A;  1EIF A;  1U1T A;  4J9I A;  4IIM A;  1JJ2 S;  2LVM A;  3CCE T;  1LJO A;  5D6W A;  4BDZ A;  4M75 D;  5CAI A;  5CR2 A;  2DRM A;  1SHF A;  3I5S A;  1UGQ B;  4FM4 B;  2BIV A;  2K7A A;  3AT1 B;  2ROT A;  1LVK A;  4JZ3 A;  2ENM A;  1M1K R;  5GAO q;  2H3J A;  1K8A R;  1WPY A;  2KVQ G;  1AHJ B;  1WQW A;  4DBF A;  3CCS A;  1AWX A;  2OTJ A;  4ZTF A;  1W2B A;  3HL8 A;  3LH5 A;  4JJC A;  4F7U E;  3H0I A;  1XNI A;  1VQ4 Q;  4XTX A;  2K2M A;  2WSC E;  4L59 A;  1QLY A;  3JSC A;  1W4S A;  4C0G A;  2EW3 A;  1Y71 A;  4FSX A;  1D3B B;  1G3S A;  2OTJ Q;  2V1Q A;  4JLI A;  5CKF A;  1PWT A;  3CQT A;  2HKQ B;  4C5G A;  4PJM A;  4QQD A;  4FT2 A;  5DLQ E;  1MNE A;  5LJ5 j;  3OYA A;  1UGR B;  1PRM C;  4BI8 B;  3L2Z A;  1MND A;  2MOX A;  3BE3 A;  4J6Y A;  2RQU A;  2MWO A;  2RHZ A;  3GIB A;  3MP6 A;  1S72 A;  4QVD A;  1GFC A;  4M78 E;  2H8H A;  4E7H A;  4CC2 A;  1Q82 U;  4M77 D;  4DOW A;  1QWF A;  2E64 A;  2IIM A;  3H0H A;  3JCM W;  1YI2 A;  4OGE A;  5HK3 A;  2RQT A;  2D0Q B;  5DLO A;  1K4U S;  5HK0 A;  1RI0 A;  3EGD A;  2KAF A;  4EMK A;  3A1P A;  2FPF A;  3A5Z B;  2JS0 A;  1OQK A;  3QWX X;  3SDZ A;  3BY7 A;  4AG1 C;  1YI2 Q;  5LL6 S;  3TCJ A;  1G2B A;  5GAN f;  2FB7 A;  2EQU A;  1UEB A;  3MP8 A;  3CMA T;  2PQW A;  1H92 A;  2D8H A;  1M5Q 1;  5KYW B;  4MDX A;  3I55 A;  3CCQ A;  1UE9 A;  4Y92 A;  1WXB A;  1W6X A;  4A4H A;  5LJ3 j;  1VQ5 T;  3WVD B;  1H8K A;  1M90 R;  3VKI A;  1UGP B;  3M0Q A;  1YFN A;  2HKN A;  3NTK A;  1OX9 A;  3CCQ Q;  5A0G A;  1WXU A;  2MAM A;  1YIT Q;  2LTO A;  1G83 A;  5GAN d;  1GCP A;  1BCO A;  2COY A;  3V7C A;  1U3O A;  1NYG A;  3T9N A;  2LX7 A;  3CC7 T;  3ULR B;  1ZLM A;  2DNU A;  2J6F A;  2L3S A;  1VYV A;  2V8I A;  3OYN A;  2HL5 C;  3JCM P;  3M54 A;  3NTH A;  4AFS C;  2K3B A;  4C8Q A;  1I5L A;  1BIA A;  1QWE A;  3EFO A;  1K9M R;  3CC4 A;  4E7Z A;  1D0Z A;  2J6K A;  4D8K A;  5CCA A;  5M9O A;  2DTO A;  3P8D A;  4M78 C;  2LCL A;  2YUN A;  4ESR A;  3VRY A;  4BE0 A;  3JB9 J;  2HZY A;  3CC4 Q;  3ZEH A;  4OMQ A;  3JCM f;  4XU3 A;  3TRE A;  2XID A;  5FU6 C;  1M1K C;  4PFZ A;  1K8A C;  1B34 A;  4C92 A;  3SWN B;  2LT4 A;  2FEI A;  2JM9 A;  3OS2 A;  4HT9 A;  3G4S T;  2YUP A;  3L2U A;  1Y7X A;  5D6X A;  2LZ6 B;  1W2B P;  1VQ9 T;  3QBY A;  1VQL A;  1H3H A;  2QGG A;  2L89 A;  3VS1 A;  2M0O A;  3CPW A;  4DBH A;  4BDY A;  2DX1 A;  3CCM A;  3JCM d;  1PG5 B;  2X3W D;  1VQL Q;  4M7D A;  1D1B A;  3DB4 A;  2JM8 A;  3LWH A;  2P84 A;  2YRV A;  4M77 E;  2L0A A;  3EGX B;  2CP6 A;  1T3S A;  3UF4 A;  3CCR A;  4OF1 A;  1VQ8 T;  4J9D A;  4R0K A;  2KEA A;  4LDY A;  1QKX A;  3OA6 A;  2ZGW A;  3EH1 A;  1Q86 U;  3CCR Q;  2DEQ A;  4F7U G;  1QVG P;  5GAO p;  2CKK A;  4M75 C;  2BE9 B;  2ED1 A;  4LXC A;  4PJJ A;  4VUB A;  4RTX A;  4XTW A;  3G6E A;  2LT1 A;  5L23 A;  1UUE A;  1IHW A;  1ACM B;  1WZO A;  4OMM A;  3OBY A;  2HAX A;  1WHL A;  1IZ6 A;  3QJ6 A;  2XI9 A;  1FMW A;  4KH1 B;  2ZPG B;  4FYY B;  4C8Q F;  2YUO A;  4PJO B;  1HYO A;  2EAY A;  2FZK B;  4A54 A;  4BY6 C;  3GP8 A;  1QCN A;  2DO3 A;  4IUT A;  1Q81 R;  3RES A;  5KE3 A;  4M78 G;  2KT8 A;  1M90 C;  4HVU A;  4ELY C;  2JVV A;  1UEC A;  2V8K A;  4BUG A;  1N6A A;  2HSP A;  1QP3 A;  2DL4 A;  1RAA B;  1W2B S;  1CKB A;  5CVI A;  3EFS A;  1WHJ A;  4GY5 A;  8ATC B;  2O9V A;  2DTH A;  4RCC A;  4Z89 A;  5GAN 2;  1N8R U;  4JRI A;  4DQ2 A;  3JCM J;  2LQW A;  4M77 C;  1WX6 A;  4HA8 A;  4XTV A;  3M56 A;  3FIF A;  3DLL A;  3OYC A;  2KRO A;  2J6O A;  2PNI A;  1K9M C;  4JJD A;  4PJL A;  1UJY A;  3KUF A;  1ABQ A;  3GPL A;  2XHC A;  4WF2 A;  3PTA A;  2QQB A;  3PNW C;  3FLG A;  3V8J A;  2CSQ A;  2K5F A;  1IHV A;  3RBB B;  2AIR B;  5I2M A;  1FX7 A;  3HHT B;  1QVG S;  2HSE B;  3IQL A;  5FWB A;  2QDL A;  4LE9 A;  4E2F B;  1MMN A;  3OYY A;  1T0H A;  2YWW A;  1UHF A;  2COZ A;  2RPN A;  1E6G A;  1YCS B;  1VQ6 A;  4ZGJ B;  5KYU A;  3JV3 A;  1VQ4 T;  1RAB B;  4EMH A;  2QQA A;  1UDL A;  4OB3 B;  3CCS T;  4EMG A;  4A4E A;  1UG1 A;  4FU6 A;  1YN8 A;  2OTJ T;  2KYM A;  2P0Q A;  2HMA A;  3E9F A;  5LJ5 e;  4FCY A;  3R6O A;  1RLQ C;  3CCV A;  3RIR A;  4E47 A;  1AEY A;  3HKS A;  3OBW A;  4N4I A;  2VXF A;  1VYU A;  2KR3 A;  2HQH A;  1K76 A;  2R5M A;  2EJ9 A;  3A98 A;  4DOV A;  4DEX A;  1B07 A;  4QVC A;  1DJ7 B;  2KRM A;  4AMC A;  2MI6 A;  1TXQ A;  1SHG A;  4PLI A;  2JNG A;  2CZ6 B;  3PMT A;  2J06 A;  3OYI A;  2RK1 A;  1PCX A;  2RHY A;  3PIO A;  1MMA A;  5L8R E;  4C92 D;  1KK7 A;  1E7O A;  3RR6 A;  4Z88 A;  1M9S A;  1S72 T;  1HSQ A;  3EG9 B;  3D7S B;  3WXM B;  1YI2 T;  1S1N A;  3FB9 A;  2X4W A;  1GFD A;  2XMF A;  3FDR A;  3NFC A;  2RD1 A;  2XDB A;  1NPP A;  2MMP A;  5LJ3 e;  4KH0 B;  2EYZ A;  3HP9 A;  4N4H A;  4M77 G;  4M7D D;  2HL3 A;  2F2W A;  2MCN A;  1SPK A;  4XQ3 A;  1BYM A;  2VWF A;  2O4X B;  5AT1 B;  3E9G A;  2HNI A;  2CS7 A;  3VU3 C;  1WHH A;  1Q81 C;  3I55 T;  3MEU A;  5J39 A;  3CCQ T;  3RER A;  1JEG A;  4NL3 A;  1VQN A;  3VUZ A;  1VQ8 Q;  2DBM A;  4O5V A;  3RMQ A;  3VRZ A;  5A2Q E;  3M0R A;  2GFU A;  2KSS A;  3J7A F;  3KFV A;  4Y28 E;  2DIG A;  3BW1 A; 
#chains in the Genus database with same CATH homology
 2ECZ A;  2O31 A;  1PRL C;  1GRI A;  1PRM C;  4RTY A;  2F2V A;  2RMO A;  1N5Z A;  3EG0 A;  2MOX A;  2RQU A;  1OPK A;  2OI3 A;  1M30 A;  2FPE A;  2DRK A;  1Y0M A;  2L3P A;  2B86 A;  1YWO A;  1Z9Q A;  4GBQ A;  2JW4 A;  4F17 A;  1GFC A;  1LCK A;  1AOJ A;  2H8H A;  2E5K A;  2HBW A;  4CC2 A;  1XOV A;  4J9G A;  1QWF A;  2IIM A;  2DL8 A;  3H0H A;  2C0I A;  2OJ2 A;  2RQT A;  2EBP A;  2LCS A;  1K4U S;  4AFZ C;  4ORZ A;  5IH2 A;  2EGC A;  1AWW A;  1YWP A;  1M8M A;  2O88 A;  1AWO A;  2FPF A;  2JS0 A;  4JPB W;  3QWX X;  2RQW A;  4AG1 C;  1X6B A;  1G2B A;  4J9B A;  1Y57 A;  2NUZ A;  4LN2 A;  3NHN A;  2CDT A;  1AVZ C;  4HVW A;  1H92 A;  2D8J A;  1JXM A;  2KXC A;  2D8H A;  1UE9 A;  4Y92 A;  3VS5 A;  1WXB A;  1W6X A;  3C0C A;  3U23 A;  2CUD A;  1H8K A;  2ED0 A;  4F14 A;  2EYY A;  2VKN A;  1E6H A;  4HVV A;  1ABO A;  3M0Q A;  2CH4 W;  1AZG B;  1M3A A;  2DVJ A;  4D8D A;  2YSQ A;  5ECA A;  1ZUK A;  2DF6 A;  1WXU A;  3M0U A;  2LMJ A;  1SRL A;  1Z9Z A;  2O9S A;  2DLP A;  1G83 A;  1TUC A;  2OAW A;  3EHR A;  1JQQ A;  2CT4 A;  4X1V A;  1GCP A;  3TSW A;  2DMO A;  1U3O A;  2CT3 A;  3REB B;  1ZSG A;  1NYG A;  1W1F A;  2LX7 A;  3QWY A;  1ZLM A;  2DNU A;  4M4Z A;  2J6F A;  3ULR B;  1WDX A;  2CSI A;  2L3S A;  1VYV A;  1X43 A;  3M0P A;  4AFS C;  2CH4 A;  2K3B A;  4K11 A;  2DL5 A;  4J9F A;  2KRN A;  1BB9 A;  1NLO C;  1QWE A;  2LP5 A;  1KSW A;  2AZS A;  2CUB A;  3O5Z A;  3REA B;  4AFQ C;  1K1Z A;  2J6K A;  4D8K A;  1UTI A;  2YUN A;  2EGA A;  3EG3 A;  4ESR A;  2C0T A;  2SRC A;  3VRY A;  1WFW A;  4KRT A;  3PVQ A;  4J9E A;  2EPD A;  4LNP A;  2VVK A;  4OMQ A;  1NEB A;  1MV3 A;  1IO6 A;  3UAT A;  4JJB A;  1AZE A;  2K6D A;  1YNZ A;  1AWJ A;  2JMA A;  2SEM A;  2FEI A;  2KXD A;  4EIK A;  2JM9 A;  2YUP A;  1NEG A;  4LUE A;  1JXO A;  2LJ0 A;  2L2P A;  2DBK A;  2LZ6 B;  3SHW A;  1I07 A;  1W70 A;  2RQR A;  1NLP C;  3NMZ C;  1H3H A;  5GJW B;  1RLP C;  3UA6 A;  3VS1 A;  1SSH A;  1WXT A;  2GTJ A;  1BK2 A;  3R6N A;  2DX1 A;  1BU1 A;  3FJ5 A;  4FSS A;  1T0J A;  2X3W D;  3EG1 A;  1B3Q A;  1AD5 A;  2JM8 A;  2M0Y A;  1U5S A;  2JMC A;  2KGT A;  2L0A A;  1U06 A;  1T3L A;  1T3S A;  2G6F X;  2YDL A;  4HCK A;  3UF4 A;  1K9A A;  3H0F A;  2EGE A;  2J7I A;  1K0S A;  4CC7 A;  4J9D A;  4R0K A;  3TSZ A;  2JT4 A;  2AKL A;  3NPF A;  2KEA A;  3RNJ A;  2HEQ A;  3ZL7 C;  1ZBJ A;  1QKX A;  2YT6 A;  1TG0 A;  2EQI A;  2GGR A;  2BZX A;  1JU5 C;  1FYN A;  4LUD A;  1SRM A;  2FO0 A;  3M0S A;  2ED1 A;  2KT1 A;  4E6R A;  4ZNX A;  2PTK A;  2ABL A;  2DL7 A;  2EYX A;  1UHC A;  2DL3 A;  4RTX A;  3VS3 A;  2DA9 A;  5L23 A;  1NG2 A;  1UUE A;  2J05 A;  3UA7 A;  1RI9 A;  5I11 A;  2LJ3 A;  4OMM A;  2KRS A;  2YUO A;  1YP5 A;  2HDA A;  1ARK A;  1OOT A;  4J9H A;  2DJQ A;  3VS6 A;  1GL5 A;  1OPL A;  3SEM A;  1TUD A;  2KT8 A;  4HVU A;  2RN8 A;  1UEC A;  2LNH B;  5IHN A;  2DE0 X;  1QKW A;  2HSP A;  2DYB A;  2DL4 A;  1CKB A;  1HD3 A;  3M0T A;  2GQI A;  4HXJ A;  1NM7 A;  1K0X A;  2GBQ A;  2O9V A;  3I5R A;  5FWC A;  3H41 A;  3EG2 A;  4Z89 A;  2YUQ A;  2MIO A;  5HCK A;  2O2O A;  1I0C A;  2NWM A;  4RUG A;  4OMN A;  2FG0 A;  4QT7 A;  1X69 A;  1HJD A;  2D0N A;  1A0N B;  1PKT A;  2LQW A;  1WX6 A;  1KFZ A;  2FRY A;  2JXB A;  3GBQ A;  5IXB A;  1WYX A;  2DIL A;  2KRO A;  2RF0 A;  2KBT A;  2K79 A;  2J6O A;  2PNI A;  4JJD A;  1V1C A;  3VS0 A;  1MV0 B;  1UJY A;  1ABQ A;  1KJW A;  3VS4 A;  4OML A;  2CSQ A;  3PVL A;  1PKS A;  3RBB B;  4AFU C;  5IXF A;  1GCQ A;  1VYT A;  2LQN A;  2ESW A;  1UGV A;  3IQL A;  5FWB A;  2BTT A;  2QDL A;  1VA7 A;  2A36 A;  2AK5 A;  4LE9 A;  4DEY A;  2ROL A;  1M3C A;  1J3T A;  5IHI A;  1T0H A;  1UHF A;  2RPN A;  1E6G A;  1YCS B;  4RTZ A;  5EC7 A;  2W10 A;  2L3Q A;  3I35 A;  1UJ0 A;  2W0Z A;  1X27 A;  1CKA A;  3JV3 A;  3I9Q A;  1UDL A;  1NYF A;  4RTU A;  4GLM A;  4JZ4 A;  2AZV A;  2K9G A;  1UG1 A;  1YN8 A;  2KYM A;  1QCF A;  3THK A;  1GBQ A;  2JTE A;  1X2Q A;  2LJ1 A;  1ZUU A;  1RLQ C;  4OMP A;  1JO8 A;  1UFF A;  2DM1 A;  2HCK A;  2A28 A;  2RQV A;  4RTV A;  1GCQ C;  1AEY A;  2GNC A;  1KIK A;  1VYU A;  2C0O A;  4AG2 C;  3NGP A;  2KR3 A;  1WLP B;  1K76 A;  1I1J A;  2BZY A;  2EYW A;  5GJV B;  1M27 C;  2BZ8 A;  2RNA A;  1OEB A;  1ZX6 A;  3A98 A;  1CSK A;  1SEM A;  4RTW A;  4DEX A;  2JS2 A;  1B07 A;  1M3B A;  2KRM A;  4RTT A;  1EFN A;  1WI7 A;  3EGU A;  1SHG A;  1GBR A;  4CC4 B;  2J06 A;  2EVR A;  2PZ1 A;  2V1R A;  1X2K A;  2X3X D;  1PNJ A;  2KYB A;  1E7O A;  2EKH A;  4Z88 A;  1HSQ A;  3PE0 A;  2AKK A;  3TVT A;  5FW9 A;  2I0N A;  4J9I A;  4IIM A;  5IHK A;  1BBZ A;  2CRE A;  1PHT A;  1S1N A;  3VS2 A;  2KE9 A;  1GFD A;  2XMF A;  1ZUY A;  2P4R A;  2DRM A;  1SHF A;  3I5S A;  2A08 A;  5I22 A;  2D1X A;  3VS7 A;  2K7A A;  1RUW A;  2GTO A;  2ROT A;  4JZ3 A;  2A37 A;  2EYZ A;  4F16 A;  2ENM A;  2MCN A;  2F2W A;  1SPK A;  4OMO A;  4WCI A;  2VWF A;  1AWX A;  3EHQ A;  3LH5 A;  1WIE A;  4JJC A;  1JEG A;  1WA7 A;  3H0I A;  1OV3 A;  2F2X A;  2K2M A;  1QLY A;  2DBM A;  2KNB B;  4CC3 A;  2FRW A;  4J9C A;  4IIO A;  2EW3 A;  3VRZ A;  1FMK A;  2FPD A;  1X6G A;  2V1Q A;  3M0R A;  2M51 A;  4A63 B;  1PWT A;  3CQT A;  3KFV A;  4Z8A A;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...