1YNZA

Sh3 domain of yeast pin3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
MEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Pin3p
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ynzA00
2V1RA 3EG3A 1K9AA 2ED0A 4JJDA 1AWXA 1A0NB 4Z8AA 2FO0A 2EYZA 5FWBA 3EHRA 3VS4A 3IQLA 4IIOA 2X3XD 5GJVB 2AK5A 2EYYA 1WLPB 2KROA 1W70A 1ABOA 2AZSA 2DILA 4AG2C 1KFZA 1UUEA 1WXBA 2GTOA 1I0CA 2VKNA 4ZNXA 1KJWA 2ROTA 3VS3A 5I22A 3M0QA 2MIOA 4JPBW 1M30A 4F17A 2HBWA 2LQNA 2JM8A 1NLPC 2EYWA 2GTJA 2G6FX 2ROLA 1MV3A 3I9QA 2HEQA 2EQIA 2NWMA 4F16A 2YT6A 2D8JA 2E5KA 2FPEA 1GFDA 1YN8A 1YWPA 2O31A 1BU1A 3I5SA 1GCQA 4QT7A 1V1CA 4AFQC 4OMPA 1JU5C 4JZ3A 1PKSA 3M0PA 2ESWA 4JJBA 1GRIA 3EG1A 5L23A 2CUBA 1WA7A 1FMKA 2YUNA 4DEXA 3UF4A 1ABQA 2DLPA 1E6GA 1ZX6A 1S1NA 1OPKA 3I5RA 4OMMA 3A98A 4D8DA 3M0SA 2LCSA 2JS0A 4K11A 1AWOA 3VRYA 1VYUA 3H0HA 1M3BA 1PKTA 1U06A 2RQVA 3EG2A 1K1ZA 2D0NA 1SSHA 2DRKA 2J06A 2BZ8A 2D8HA 2EKHA 2QDLA 2W10A 2MCNA 1KIKA 4ESRA 1M3AA 1K76A 2DYBA 1QWEA 4J9GA 1AZEA 1SHGA 4AFSC 1T0HA 4AG1C 3VS1A 3VS7A 2HSPA 1JXOA 2CREA 1SPKA 3PVQA 3H0IA 1WDXA 2DRMA 2JW4A 2LJ1A 4HCKA 4RTYA 2LJ3A 2SEMA 1GCPA 2KR3A 1HSQA 2PNIA 2C0IA 2FPFA 3ULRB 1B3QA 4JZ4A 2DL7A 2XMFA 2FPDA 3SEMA 4RTUA 2B86A 1CSKA 2CH4W 2EGEA 1OV3A 2JXBA 1E6HA 1MV0B 4Z89A 1U3OA 4J9BA 1BB9A 2IIMA 2BTTA 2D1XA 2OJ2A 1OPLA 1QKWA 1UTIA 4EIKA 1K0XA 2JTEA 4AFUC 4E6RA 1X6GA 1CKBA 4J9DA 4OMQA 3RBBB 5I11A 1ZUUA 3GBQA 1UG1A 2RN8A 1NM7A 3M0TA 2J6KA 2V1QA 1NYGA 2LMJA 1Y57A 2CT4A 1PHTA 2CSIA 1M8MA 1WYXA 1M3CA 1E7OA 1AWJA 1UE9A 2A36A 1IO6A 3UA6A 3O5ZA 1GCQC 2FRYA 2GGRA 4J9CA 1UDLA 3PE0A 1K0SA 4LUEA 2VVKA 4RTWA 2DE0X 2GBQA 3VS0A 2J6FA 2DL5A 2YUOA 5IHNA 2YSQA 4GLMA 1NEGA 3ZL7C 4R0KA 2K79A 2JT4A 1XOVA 2ED1A 4HVVA 1AWWA 1PWTA 1PNJA 2DM1A 3M0UA 1RLPC 2PTKA 3H0FA 3EHQA 2A37A 2I0NA 1NG2A 4M4ZA 2YUQA 2JS2A 3TVTA 4IIMA 1YNZA 2ENMA 2RQTA 2C0TA 2DVJA 4GBQA 2EVRA 2BZXA 1T0JA 2KRNA 1WI7A 1LCKA 2F2VA 2OAWA 2EYXA 3VS5A 4WCIA 1X2QA 2EGCA 2KT1A 2KT8A 5EC7A 1MUZA 4LN2A 4RTXA 5FW9A 2EW3A 1JQQA 2CT3A 3R6NA 5IXFA 2DX1A 1GBRA 3PVLA 1PRMC 2RQWA 2RF0A 1PRLC 4J9EA 4A63B 1HD3A 4OMLA 2KYBA 2OI3A 1X6BA 2KXCA 2O88A 2K2MA 1K4US 3NPFA 2SRCA 1JXMA 1YWOA 1JEGA 4RUGA 1I07A 1RLQC 1UFFA 1OOTA 1G83A 2K3BA 1BBZA 3VRZA 5IXBA 2KXDA 2AKKA 1AVZC 2KGTA 4FSSA 2CUDA 2JM9A 3EGUA 2RPNA 2W0ZA 2O2OA 3M0RA 1NYFA 4LUDA 1VA7A 1N5ZA 4ORZA 1TUCA 2L2PA 2EGAA 2K9GA 2GQIA 1X27A 3THKA 2PZ1A 1WX6A 4HVUA 1AZGB 5GJWB 2JMAA 2RQRA 3I35A 1AEYA 2EPDA 4Y92A 2DJQA 1QKXA 4JJCA 3H41A 1JO8A 3QWYA 1X43A 3KFVA 2KRMA 4J9FA 1WXUA 2O9SA 4RTVA 1W1FA 1Z9ZA 1OEBA 2BZYA 5HCKA 2DL4A 1AD5A 2CDTA 2H8HA 1X69A 4RTZA 2L3SA 2DNUA 2K6DA 1KSWA 3JV3A 4CC3A 5ECAA 5IHKA 1H92A 2EBPA 2P4RA 1ARKA 1RUWA 1H8KA 2A08A 2LJ0A 1U5SA 4RTTA 1TUDA 3U23A 2NUZA 2JMCA 1GFCA 2HCKA 2L3QA 4CC7A 2RNAA 3QWXX 4DEYA 3REBB 3VS2A 1FYNA 1UHFA 2FRWA 4OMNA 2DL8A 1SHFA 4LNPA 1J3TA 1TG0A 4X1VA 1I1JA 2K7AA 2LQWA 4F14A 1VYTA 1NEBA 2LP5A 2O9VA 1NLOC 2J7IA 1EFNA 2KBTA 3NHNA 2J05A 2L3PA 1WFWA 2J6OA 2F2WA 1QWFA 1ZSGA 4AFZC 5IHIA 2LNHB 1G2BA 4CC4B 3NMZC 3REAB 2ECZA 3LH5A 1ZLMA 1M27C 4LE9A 2VWFA 4HXJA 2M0YA 2AZVA 1VYVA 1UGVA 1X2KA 3TSZA 3RNJA 1ZBJA 1T3SA 2YUPA 5FWCA 2MOXA 2LX7A 1Z9QA 1Y0MA 2RMOA 2L0AA 3TSWA 2DMOA 3VS6A 1T3LA 3CQTA 1YP5A 3UA7A 4J9HA 2GNCA 3NGPA 1UJ0A 1ZUKA 1BK2A 1ZUYA 2X3WD 1AOJA 4OMOA 2DL3A 2DBMA 1YCSB 2KYMA 2CSQA 1GBQA 2DF6A 1SEMA 1WIEA 2M51A 4HVWA 2KNBB 1UHCA 2RQUA 2AKLA 2YDLA 1WXTA 2FG0A 1UECA 2KEAA 4D8KA 2KRSA 1CKAA 1HJDA 2A28A 2DA9A 2KE9A 1QCFA 5IH2A 1B07A 2DBKA 1H3HA 2ABLA 3C0CA 4Z88A 4KRTA 2F2XA 2LZ6B 4J9IA 1UJYA 3SHWA 1W6XA 1SRLA 2FEIA 2CH4A 2HDAA 3UATA 1QLYA 2C0OA 1SRMA 1RI9A 4CC2A 3FJ5A 3EG0A 1GL5A
chains in the Genus database with same CATH superfamily
1WHMA 3L2WA 1AWXA 4Z8AA 5FWBA 2KDSA 1NJIU 4HT9A 1K9MR 2ZZDA 2AK5A 4QQDA 3MEUA 2QEXQ 2F69A 1UGRB 1UUEA 5GMKi 1U8RA 3VS3A 4CRIA 2JZ2A 3FC3A 2YRVA 1M30A 2DXUA 4F17A 1Q86C 2GTJA 1O9SA 3R6OA 5FRMA 1YJ9Q 4AT1B 3OYKA 3SB2A 2A3LA 1YI2Q 3TU4K 2P0QA 4JRQA 4X34A 4AFQC 1F1BB 5KYNA 4NS5A 4OF1A 1M90C 2PUKB 4ZN1A 3F70A 3LWIA 3OYBA 3VKIA 3JCMW 5KE3A 5LJ5f 4M75C 4P5NA 1FMKA 2X4XA 1VIEA 4A54A 4XTVA 1ABQA 2QQSA 2DLPA 1ZX6A 2LT1A 1M1KR 1H3ZA 2M1HA 4MDXA 4BDYA 3META 3CXCP 2RK2A 4K11A 4KUDK 1NJIC 3NTHA 1PKTA 1U06A 3CCUQ 2D0NA 3GIBA 2CP3A 3DLLA 2D8HA 2MCNA 1MNEA 1ZBXA 2LRQA 4TVRA 1VQ9Q 4ZGDB 1MMGA 1SKUB 3CMAA 1KD1U 1WHGA 2RJEA 5CO7A 2LVMA 4OMFB 4HCBA 1EZZB 4F7UG 5CVIA 2V8IA 4FCYA 2HBPA 4E7LA 3FIFA 1C0MA 2FPFA 3ULRB 3MEWA 4LDXA 4D6WA 1QQJA 2JUFA 2QYZA 4J5YA 2O4XB 2DL7A 2XMFA 3LGLA 5I21A 4OB2B 3SEMA 3OY9A 2B86A 5L8RE 1BI3A 1BIBA 1OV3A 1IHVA 1NE8A 4BI8B 1U3OA 4FM4B 3OYIA 2F5KA 1OPLA 4EIKA 4E6RA 5A2QE 4OGEA 1CKBA 4J9DA 4OMQA 5I11A 1MNDA 1Q82R 1YBYA 3JCMg 3N5BB 1NM7A 4C0FA 3VUZA 2CT4A 1K73C 1Q86R 3OW2P 5DY9A 1E7OA 1M3CA 2RHUA 1AWJA 1UE9A 5KYYB 2A36A 4DBRA 2GGRA 4J9CA 1MGQA 4XK8E 1RAAB 4LUEA 4FIBA 1KG1A 3JCMb 1EX4A 5LL6S 3MEAA 2RB6A 1OZ3A 5GANd 1FMVA 3LW5E 4HVVA 3P8HA 1PWTA 1PNJA 2DM1A 1VQKA 1RLPC 4BACA 3CC4T 1PCXA 4J6XA 2YUQA 2OX7A 4Y91A 3CBPA 4QVZA 4M77D 2CS7A 1D3BA 4IIMA 1D3BB 1G3TA 4M77C 3EFOB 1WI7A 2OAWA 1X2QA 2EGCA 2KT8A 3L42A 4LN2A 4C0ZA 1K8AC 2EW3A 1JQQA 2CT3A 2DX1A 1GBRA 3PVLA 3RR6A 5CKBA 4R56A 1Q82C 1IXDA 4PK4A 4M78G 3QIIA 3CD6Q 2XDPA 3KBGA 2K2MA 3TCJA 1QVGA 3GP8A 2KVQG 1I07A 4RCCA 1YIJT 3MCAB 2LTOA 5GMKh 2BKDN 1PM3A 5I2MA 3M58A 1PG5B 2DTHA 2AT1B 1VQMQ 1AVZC 2HSEB 1MMNA 4C92B 2E3HA 1RAFB 2LNVA 3OS5A 4ELYC 4N4GA 2O2OA 4NOYA 3CEYA 1WGSA 2IVWA 1N5ZA 4ORZA 4M7DE 1TUCA 2EGAA 1X27A 2F5TX 4JRIA 4PJOB 5GJWB 3OMGA 4LD9K 4OGCA 2DJQA 3CCQT 4HKEA 3H41A 3KFVA 1WXUA 2O9SA 3QO3A 1Z9ZA 5HK0A 3CCRT 2BZYA 4PL6A 4DA4A 2M16A 4PJNA 4C5EA 3CCQQ 3A8HB 2CDTA 2FB7A 3KUFA 2P4TA 4PLLA 4XTZA 2VYTA 3JV3A 3E1SA 2QA4A 2EBPA 3PMIA 4XTWA 3CCLA 2WSCE 2X35A 3C95A 1FX7A 2EAYA 2A08A 3ER0A 2FVUA 1QVFP 3BE3A 1ZA2B 5GANh 4C0DC 4C92G 3EGXA 2NUZA 2MYSA 2HCKA 2L3QA 5KYYA 2CP7A 4JS5A 5CIUA 2VXEA 4JRPA 1VQKT 3REBB 1X01A 4J7IA 1I4K1 4EMGA 5GAOp 3I55T 1UHFA 2PVOB 4BB7A 1SHFA 4LNPA 1J3TA 2DO3A 1I1JA 2EKOA 2QG9B 4F14A 1K73R 3HKSA 3OYMA 4C0DB 2J7IA 2J05A 3HRUA 1PD0A 1WFWA 2DZ9A 4HCCA 2K5LA 2MF2A 3OW2S 1Q7YU 1VQ4Q 2CYZB 2LNHB 2ECZA 2VWFA 3JCMh 2AZVA 3CCST 4J7FA 1VQPA 4FYXB 1G5VA 4J6YA 3TSZA 2OTLQ 2OTJT 2LCCA 5FWCA 2DMOA 1MMDA 1T3LA 2YLBA 3SDZA 3OA6A 2BUDA 1ZUKA 1D1AA 1XJWB 4QVCA 3G4SQ 1ZUYA 1AOJA 2CSQA 1GBQA 1UGSB 1TU0B 2DFUA 2M51A 1D1BA 3RUXA 2RQUA 1ACMB 2AKLA 4Z02A 1YJNQ 1TUGB 3MP1A 1WXTA 1UECA 4HA8A 3HFOA 2HMAA 1BCOA 4XTUA 4E7JA 4NL2A 2KRSA 1CKAA 1R0BG 3BW1A 2DBKA 5LJ5g 2NUPB 4M78E 1UGPB 3C0CA 3OYHA 3CCJA 4Z88A 2F2XA 3DKMA 1UJYA 4BI3A 2FEIA 2NUTB 3OS1A 2D9TA 3JB9G 4M7AA 4CC2A 4GLKA 5KCHA 4JJDA 2NLUA 2FO0A 3G71T 2HD0A 4MZPA 4M77E 1QCOA 5GJVB 1WLPB 2XICA 1W70A 1B34A 4BE2A 2DILA 4AG2C 4NL3A 1WXBA 2XDDA 2X9HA 1N6AA 1I0CA 4ZNXA 4OB3B 4C92D 1KJWA 2ROTA 1UEBA 4E7ZA 4M7DF 5I22A 3M0QA 2Z0WA 2V26A 2HBWA 4LDVA 1NLPC 2EYWA 5KYWB 4C92C 2HEQA 3PT9A 2RHXA 2EQIA 5IT9E 2DIQA 3TREA 2OTLT 2E5KA 1GFDA 1YN8A 3PGGA 1GCQA 4Y28E 3JAME 1VQNT 4M7DA 4C5HA 4Q5WA 1LPLA 3X24B 5GAN8 4BD3A 4OVAA 3ASKA 3C94A 1VQ4T 1VQ9A 3HTRA 4B9XA 4C8QG 1X75C 3QSUA 2QTVA 3CCMT 4JLIA 3EGXB 2JN0A 2LX9A 4IUUA 2ESWA 5KCOA 2O01E 3V8JA 1RABB 2VGNA 1NPRA 1KQ1A 5CKHA 3JCMP 1OI1A 3C12A 3BDUA 3BDLA 3JCMf 2YUNA 2QASA 5C6SA 2E41A 3J80E 3I55Q 4M77B 1OQKA 3CC7A 1S1NA 2PU9B 4M78C 4ELZC 5GAN5 1QVPA 2OTJA 1PD1A 3FEOA 4OMMA 1G3WA 5LJ3j 3CPFA 1IRXA 1WPYA 2JS0A 2E6ZA 1IGUA 2MPXC 3V8KA 5FU6C 4E7HA 1ZSZC 3VRYA 2CP2A 1M3BA 2XU8A 3OSSC 2RQVA 2HQXA 1K1ZA 2KMTA 1SSHA 2DRKA 5HY6A 2J06A 1KIKA 1QP3A 2W10A 2QQ9A 4M75D 1QWEA 3V7CA 4FSXA 1AZEA 4AFSC 1T0HA 4C0GA 1JXOA 1YHQQ 1QVGS 2CREA 1SPKA 1YI2T 5GAMd 3PVQA 5IAYA 2E70A 3X26B 2MAMA 2K3YA 3BY7A 5J26A 1SG5A 1KQSP 2LJ1A 4HCKA 4RTYA 5J3BA 2LJ3A 4PKCC 2SEMA 2OTLA 1GCPA 2KR3A 4QW2A 2C0IA 4BI4A 3NTIA 1QCNA 2FPDA 1YJNT 1CSKA 2CH4W 3JCMJ 2JXBA 1MV0B 4Z89A 4M77G 2IIMA 3BFMA 2D1XA 1M8VA 3E9GA 1IZ6A 1UTIA 4M75B 4E7IA 3GF5A 1TSFA 1BIAA 3QHSA 3OYYA 1UG1A 2GFAA 1VQ6A 2J6KA 2V1QA 3GOXA 1NYGA 1Y57A 3CCEA 1PHTA 2CSIA 3M4YA 1M8MA 1WYXA 2VUBA 5LJ5d 3MKDA 5M9OA 3VV0A 3RKYA 4XAXB 2B8AA 3EGDA 3P8DA 3O5ZA 3CCSQ 2FRYA 3JB9H 3PE0A 1YITT 3HPWA 1K0SA 1B34B 2DE0X 2J6FA 2QI2A 5IHNA 4GLMA 1NEGA 3ZL7C 3UPUA 4M7AF 2ED1A 1AWWA 4ANJA 4BUGA 2E4HA 1OULA 3S6WA 2O4XA 2EJ9A 3H0FA 5GAMj 2YRDA 3MO8A 3CPWP 2QQAA 2DETA 3NTKA 5GMKe 1YNZA 3HSBA 2BZXA 3JCMX 4LXCA 1M90U 2KRNA 1Q82U 5KYXB 1S72T 2F2VA 3OYJA 3CPWA 2KT1A 4EDUA 1MUZA 5GAOm 3MP8A 1M90R 3CCSA 1M1KC 1Q7YR 1LOJA 2RQWA 1TS9A 1BYMA 4J9EA 4HCZA 1YJNA 4A63B 3AT1B 3GPLA 2DZCA 1X6BA 3LH0A 3RDVA 1YJWA 1WJQA 4KGZB 1V76A 1K4US 2SRCA 1RL2A 1VQMA 4JJNK 4M75G 1RLQC 1YIJA 2DXTA 1UFFA 4F7UE 2RHIA 3I56A 1OOTA 3OBWA 2K3BA 1BBZA 3RIRA 2YHTA 3KXTA 5IXBA 2NYSA 4HT8A 2DPPB 3MEVA 4C92E 5GAOq 2LT4A 2ZPGB 2W0ZA 4XTYA 3TEEA 3M57A 4FU6A 4N4IA 2KQWA 3M59A 2JMAA 2RQRA 3I35A 2D0QB 5GAN3 1QKXA 3GNGA 4JJCA 1JO8A 3QWYA 1X43A 2KRMA 4J9FA 2M02A 3OYCA 2RI2A 2RJCA 5I2SA 2LQKA 1OEBA 3OYDA 1PSFA 2DL4A 4BDZA 1AD5A 3CBOA 2H8HA 4RTZA 2L3SA 2K6DA 1VQ8Q 1KSWA 3CCVQ 3RMQA 5D6WA 2WSFE 1FMWA 1FXXA 1VQOA 5ECAA 3OSVA 5IHKA 3CXCA 1VQ9T 1TXQA 4C8QE 2P4RA 4F7UB 3RERA 3PTAA 3CMEA 2EJGA 1TUDA 1D0ZA 4IUTA 1KD1R 4YTLA 1VQNQ 2L89A 2XD0A 4KT0E 4PNOA 3QWXX 4M78A 2FZKB 4FYYB 4PJMA 2FRWA 1VUBA 2DL8A 2FZGB 2RK1A 1VYTA 1NEBA 3CCLT 2O9VA 2QAZA 3JB9D 4EMKB 2DD5A 2J6OA 3T9NA 3GLXA 5GAN4 3M5AA 2KY9A 1KC8C 2E5QA 4A4HA 2K5FA 1QWFA 4PJOD 2BE7D 4AFZC 2QQRA 1G2BA 4CC4B 3NMZC 3REAB 5EG2A 3G71Q 2H3JA 1ZLMA 1M27C 4LE9A 2V8KA 5CKEA 1VYVA 2I2LA 1X2KA 5HK3A 3RNJA 1MHNA 4FYWB 4BY6C 4EMKC 2YUPA 4LD6A 3G4SA 2L0AA 4II1A 1RI0A 1S72Q 1RAHB 2ZGWA 1UJ0A 1AT1B 1JB0E 5D6XA 2DL3A 2DBMA 8AT1B 4OP0A 2ZPEB 4HVWA 2KNBB 3CCJQ 4DOVA 3V7SA 1PSEA 2YLCA 2DJZA 3G4ST 2XI9A 2DXCA 2DA9A 2KE9A 3L2VA 4XQ3A 3SFMA 4ME7A 4JUVA 4QQ6A 4KRTA 3JCMV 1YJ9A 4J9IA 4C8QB 5CAIA 1VQPQ 1VQ8A 1Q81C 1W6XA 4GY5A 2OTJQ 1PC0A 2HDAA 1VQLA 5A0GA 2P0KA 3EH2A 2DAQA 4KBMB 3EG0A 3FDRA 1YITQ 3V8LA 2C06A 3RKWA 1XTDA 2V1RA 2QEXA 1RAGB 3QUIA 2EYZA 2JTFA 2RHYA 3EHRA 3VS4A 2EYYA 1ABOA 3EG9B 3EG9A 3CPWS 2L5QA 2KSSA 4N4HA 3ME9A 2FYKA 2VKNA 1M5Q1 4IURA 2MIOA 1JJ2P 2LQNA 1BI0A 3I9QA 2P0PA 2VC8A 4JRKA 2NWMA 2XDBA 4F16A 2LQ8A 2YT6A 2D8JA 3FB9A 1YWPA 1BU1A 4QT7A 1HXDA 2A7YA 4EPCA 2ZPIB 2DTIA 4MZTA 1TWBA 1PKSA 3G71A 5LJ5e 1ZQ1A 2XKOC 2K3XA 4O6JA 7AT1B 1YHQT 3ZBDA 3LLRA 5L23A 1DJ7B 4DBHA 1WA7A 1ZSZB 2RJFA 1ZSZA 2DXBA 3OS2A 4DEXA 1YJ9T 5LJ3f 4A4FA 1E6GA 3CCEQ 1OPKA 5CQXA 1WQWA 3JB9I 3I5RA 1EIFA 4BE1A 3A98A 1B7TA 4D8DA 3EH1A 1Q7YC 2RHZA 1WHKA 3M0SA 2E3IA 3EAEA 5KYUA 1VYUA 1RACB 3H0HA 5KYUB 4LDYA 3OYLA 3OYGA 4O5VA 3CCLQ 2Y90A 2Y4YA 3CMAQ 1WHLA 4FW2A 1TH7A 2QDLA 2ZAEA 3UT1A 1N9RA 3CCUA 1W2BA 1SHGA 4QKUA 4AG1C 2HSPA 3VU3C 3JB9J 3DLMA 3E9FA 3I56T 4MZMA 2QGGA 2QK0A 1WDXA 1VQMT 4C92F 3CCMQ 4DOWA 3G1JA 2DKGA 3CCUT 1YIJQ 1HSQA 2PNIA 1I81A 1OX9A 4L59A 1B3QA 4JZ4A 3UDCA 4F7UF 3CCVT 3EFRA 4RTUA 4KGVB 2DK3A 2EGEA 1VQ8T 1HYOA 1P92A 1QP2A 1KQSS 4F04B 3CMET 2BTTA 4ZTJA 4M7DG 3M53A 2OJ2A 2EQKA 1QMCA 2KI7A 1K0XA 2JTEA 3D7SB 3X20B 1X6GA 2F1LA 3RBBB 1ZUUA 3HHTB 5FRNA 5GMKm 2LMJA 3CC7Q 5D6YA 4XU2A 3QDRB 4X9CA 1YHQA 3H6ZA 3L2RA 1BCMA 4A53A 1IHWA 2JTMA 1IO6A 3QYHB 3SWNC 1X6OA 1N8RC 1GCQC 4MDWA 5C0MA 2RJDA 4M77A 5GMKl 3CC4Q 1I5LA 2COYA 2P84A 4KUIA 3E19A 2YSQA 2X51A 3FRNA 4R0KA 1RADB 2JT4A 3PNWC 2CP6A 1K9MC 4ZGEB 1H641 3HP9A 1R8OB 2A37A 2Y4XA 3GNFB 1LNXA 3G6ET 3M55A 2X4JA 3OW2A 4GBQA 2DVJA 3CCQA 4XU3A 1T0JA 2PQWA 2D6FA 3EFOA 1LVKA 4ATOA 4XTXA 2RI3A 1LCKA 2EYXA 4KH0B 3VS5A 4WCIA 5GAMe 4RTXA 1YJWQ 1VIFA 1Y71A 2DEQA 1PRLC 2XIDA 3RMSA 4OMLA 2CP0A 2OI3A 1U1TA 1WZOA 4RKUE 4XU1A 2ZPFB 3V7RA 6AT1B 3TQ7P 1K73U 2QQBA 2EJFA 3CD6T 1YCYA 1JEGA 2VV5A 2HKNA 3WVDB 4BE0A 2VGMA 4JLGA 4M7DC 1WJSA 3VRZA 2X4WA 1U1SA 5FU7C 2ZPHB 4E2FB 3M9QA 2HL3A 2L8DA 2KGTA 4FSSA 2JM9A 1KK7A 2RPNA 3CC2T 3S3MA 2GFUA 3M0RA 4M78B 1JJ2S 1NYFA 3DB3A 4LDWA 1VA7A 4A4GA 1Q86U 2FHDA 2GQIA 2PZ1A 1MMAA 1TOVA 1WX6A 3SD4A 3CD6A 4OB1B 5FU6B 1Y96B 2CP5A 1Q81R 3C4SA 1RAIB 4RTVA 1W1FA 3G6EA 2COWA 4PFPA 4M7AC 3CC2A 2HNIA 3CC4A 1IB8A 2EYQA 1X69A 2DNUA 2YXYA 1VQ6T 4M78F 1H92A 1VQ7A 5FLXE 2X4YA 1Y7XA 4PJOC 5KYXA 4PJOG 1ARKA 5KH6A 1Q95G 3OS0A 5CKFA 2IG0A 2RO0A 3SWNA 2LJ0A 2R57A 3QJYA 4RMOA 1R0CB 3U23A 2DTOA 1QW1A 2KAFA 4JDSA 4CC7A 2RNAA 4M7AG 4L5GA 4FW1A 5A0LA 2CKKA 4PJJA 3QDFA 3WVEB 3QPHA 5DLQE 2EFIA 3QYGB 2YWWA 3E2UA 4C8QC 4X1VA 2LQWA 1GXIE 1V29B 1S72A 3NFCA 2DYIA 4KGXB 2LP5A 3L2UA 3JCMe 2QEXT 3H9NA 3MPUB 5GANf 2QA4Q 2R5MA 5IHIA 1KQ2A 3J81E 2QGFB 4J8OA 3CCRA 1WNLA 2K4YA 1N9SA 4M77F 4EMHA 5LJ3h 1UGVA 4C5GA 3OQ5A 3Q1JA 1VQ5Q 3M54A 3S3NA 4E7SA 1T3SA 2MOXA 2LX7A 4PFZA 4J83A 1FWZA 3PIPA 3TSWA 4R55A 4N0AA 1KD1C 5HKCA 3CQTA 1YP5A 2KK4A 2LCLA 5GAOn 3NGPA 2K57A 5D7UA 1BKBA 1IGQA 2X3WD 1KQSA 4OMOA 2RH2A 1YCSB 5CR2A 1M2VA 2DF6A 1M2VB 1SEMA 3A8MB 1UHCA 1YFNA 1Y07A 2KEAA 1HJDA 1QCFA 3A5ZB 4UC4A 1VQNA 4C8QF 1B07A 1OZ2A 4B6MA 4EMKA 2ABLA 4AMCA 2LZ6B 4XU0A 4C92A 3SHWA 5LJ3g 3JCMQ 1NJIR 1QLYA 2C0OA 4M7AB 1RI9A 1G3SA 2VXFA 3EG3A 1K9AA 2ED0A 4M78D 3UWNA 1A0NB 2MWOA 4QQGA 3JB9F 1G8XA 3IQLA 1VQ4A 4IIOA 2X3XD 5GANg 2KROA 1D0XA 2E10A 1D0YA 2DD4A 2AZSA 2L3RA 3OYAA 1KFZA 2GTOA 1WHHA 1QVGP 2CGHA 3I55A 2GF7A 4KULA 3RKXA 4JPBW 3VUBA 3OYNA 5KYWA 2JM8A 2G6FX 2ROLA 1MV3A 1IREB 3I56Q 1VQ5T 3QXEB 3RESA 2FPEA 2O31A 2JVVA 1AHJB 1K8AU 3I5SA 2VASA 1V1CA 4OMPA 3SWNB 1JU5C 3A8OB 4JZ3A 3CMAT 1YITA 2QA4T 1XQHA 2GCXA 3M0PA 2QXFA 3OB9A 1UGQB 3INZA 4JJBA 2JNGA 1GRIA 2IPOB 3EG1A 2E65A 2CUBA 4N0AC 3PIOA 2RM4A 3M4GA 1G3YA 3UF4A 1M1GA 5LJ5j 4FT2A 2HQEA 1KC8U 3A8LB 4E47A 5GAN7 2LCSA 4C8QA 2MMPA 5LJ3e 1I8FA 1AWOA 3QBYA 2JJ9A 3EG2A 3PMTA 4OB0B 2XHCA 3HFNA 1VQLT 2CZ7B 2BZ8A 4MMLA 2EKHA 2HL5C 3HL8A 4DBQA 4ESRA 1M3AA 1K76A 3A1PA 2DYBA 4ZN3A 3QKJA 4J9GA 1VQKQ 4M7AE 3VS1A 3VS7A 1VQ6Q 3DB4A 4IUPA 4RCBA 3H0IA 4IUVA 4CI0C 4IUQA 4B9WA 2DRMA 4DQ2A 2JW4A 4JS4A 3PFSA 2ZPBB 4M75E 2DVEA 1VQ5A 1M9SA 2EIFA 9ATCB 1WJRA 4VUBA 2K5IA 1M4ZA 1VQOQ 3JRZA 3OMCA 4ZGJB 1SF9A 3ZEHA 3M56A 1KHIA 1E6HA 1TTHB 3MHXA 2MK5A 3O8VA 4J9BA 2MWPA 1BB9A 1M1KU 2ATCB 1QKWA 4M75A 3VJPA 3CCRQ 5A0DA 2QDYB 5J39A 4AFUC 1Q81U 2V8JA 4F7UA 3GBQA 2E12A 2RN8A 3M0TA 5DLOA 2R5AA 1WQ7A 2RD1A 1JRIA 8ATCB 3J7AF 1W2BS 5CQYA 4PJOF 3EGDB 2DERA 3UA6A 5LJ3d 4A4EA 3AHUA 1UDLA 2M0OA 3CCJT 1BI2A 2CZ6B 4X9DA 3P8BB 2VVKA 4RTWA 2AIRB 2GBQA 1ZHIA 4WTOB 3VS0A 4RG8A 1W4SA 2DL5A 2YUOA 5CK9A 1VQ7T 2K79A 3QZ9B 5DM7R 1XOVA 1Y96A 2MI6A 2BIVA 3QG1A 1VQ7Q 4LDUA 3M0UA 3LX7A 4PLIA 3URGA 2LDMA 3A8GB 3L2QA 1R77A 1QVFA 2PTKA 4KH1B 3EHQA 5KE2A 2I0NA 1NG2A 4M4ZA 4V2SA 4FYVB 4A4KA 4M7DD 2JS2A 1RAEB 3TVTA 1N27A 5GAMf 1OYXA 1K9MU 2ENMA 2OAUA 2C0TA 2RQTA 3ZFJA 3G6EQ 2EVRA 4PJOA 2BE9B 1VOMA 3WXMB 2HAXA 5EC7A 5FW9A 1XNIA 1OU9A 4FT4A 3R6NA 5IXFA 1M2OA 2JOYA 1PRMC 5GAN2 2VB6A 2RF0A 4J6WA 1N8RR 1OX8A 1HD3A 3X28B 2KYBA 2G3RA 2KXCA 2FL7A 2O88A 3NPFA 3LYIA 1JXMA 1YWOA 1JJ2A 4RUGA 3G7ZA 1G83A 2E6NA 3LGFA 2KXDA 2AKKA 4M75F 4C5IA 1HK9A 2CUDA 3EGUA 1C6VX 3MP6A 2YRCA 5AYFA 4LUDA 1NBEB 3CMEQ 2DIGA 2L2PA 1C1AA 2K9GA 2A0FB 1OU8A 3THKA 1BI1A 4HVUA 1AZGB 2XK0A 1AEYA 2EPDA 4Y92A 5GAMg 2EQMA 4FL6A 1W2BP 2PVDB 5HCKA 4BY6B 4C8QD 3CCVA 1I5OB 3HRSA 2H3EB 4PFOA 2PVGB 2EWNA 2HQHA 5GANj 1WHJA 3VYHB 3VYGA 3L1AA 4E7KA 4ZTFA 4CC3A 3FJPA 1SSFA 1O75A 3H8ZA 2CZ0B 1RUWA 2RA2A 1H8KA 3HRTA 1U5SA 2RI5A 4PJOE 4RTTA 2AHJB 3FLGA 2PUOB 2JMCA 3L2ZA 1GFCA 4MMKA 3JCMc 2WACA 4DEYA 2XG8D 3OYEA 3CCET 1D1CA 3VS2A 2COZA 1FYNA 4OMNA 1D09B 4M7AD 1TG0A 5GAMh 2E1HA 2K7AA 3LWHA 3JSCA 5GAOr 1VQOT 1NLOC 3NHNA 1EFNA 2KBTA 2NUPA 3EFSA 2L3PA 5GMKj 1KC8R 3QZ5B 4RG2A 1N8RU 2F2WA 1ZSGA 2NUTA 1JBMA 3LH5A 1NPPA 4HXJA 2M0YA 1QVFS 5GAN6 3CCMA 2LC4A 5GAOl 2M9UA 4DBFA 1ZBJA 4L6V5 4M7DB 4WF2A 3CC2Q 3CC7T 1VQLQ 1Z9QA 1Y0MA 2RMOA 1YI2A 3OBYA 3VS6A 4IKFA 3OYFA 1LJOA 2FZCB 3UA7A 3X25B 4J9HA 1UB4A 2GNCA 2EQUA 5CCAA 1K8AR 2GQVA 1BK2A 2EQJA 1NZ9A 3QJ6A 2KYMA 2ZCFB 5GANe 1WIEA 5AT1B 2QTXA 5LJ5h 1KHCA 3MJXA 2WSEE 2YDLA 2FG0A 3JCMd 4QVDA 2DEUA 3CXCS 4D8KA 2HKQB 5IN1A 2A28A 2K2VA 2E64A 5IH2A 5FROA 5CKDA 1H3HA 2HZYA 1ZA1B 1VQPT 1M1FA 1YJWT 2CZ1B 1SRLA 5FU7B 2R58A 2CH4A 3UATA 1SRMA 3CBMA 3FJ5A 4PJLA 1GL5A 3S3OA
chains in the Genus database with same CATH topology
2V1RA 3EG3A 1K9AA 2ED0A 4JJDA 1AWXA 1A0NB 4Z8AA 2FO0A 2EYZA 5FWBA 3EHRA 3VS4A 3IQLA 4IIOA 2X3XD 5GJVB 2AK5A 2EYYA 1WLPB 2KROA 1W70A 1ABOA 2AZSA 2DILA 4AG2C 1KFZA 1UUEA 1WXBA 2GTOA 1I0CA 2VKNA 4ZNXA 1KJWA 2ROTA 3VS3A 5I22A 3M0QA 2MIOA 4JPBW 1M30A 4F17A 2HBWA 2LQNA 2JM8A 1NLPC 2EYWA 2GTJA 2G6FX 2ROLA 1MV3A 3I9QA 2HEQA 2EQIA 2NWMA 4F16A 2YT6A 2D8JA 2E5KA 2FPEA 1GFDA 1YN8A 1YWPA 2O31A 1BU1A 3I5SA 1GCQA 4QT7A 1V1CA 4AFQC 4OMPA 1JU5C 4JZ3A 1PKSA 3M0PA 2ESWA 4JJBA 1GRIA 3EG1A 5L23A 2CUBA 1WA7A 1FMKA 2YUNA 4DEXA 3UF4A 1ABQA 2DLPA 1E6GA 1ZX6A 1S1NA 1OPKA 3I5RA 4OMMA 3A98A 4D8DA 3M0SA 2LCSA 2JS0A 4K11A 1AWOA 3VRYA 1VYUA 3H0HA 1M3BA 1PKTA 1U06A 2RQVA 3EG2A 1K1ZA 2D0NA 1SSHA 2DRKA 2J06A 2BZ8A 2D8HA 2EKHA 2QDLA 2W10A 2MCNA 1KIKA 4ESRA 1M3AA 1K76A 2DYBA 1QWEA 4J9GA 1AZEA 1SHGA 4AFSC 1T0HA 4AG1C 3VS1A 3VS7A 2HSPA 1JXOA 2CREA 1SPKA 3PVQA 3H0IA 1WDXA 2DRMA 2JW4A 2LJ1A 4HCKA 4RTYA 2LJ3A 2SEMA 1GCPA 2KR3A 1HSQA 2PNIA 2C0IA 2FPFA 3ULRB 1B3QA 4JZ4A 2DL7A 2XMFA 2FPDA 3SEMA 4RTUA 2B86A 1CSKA 2CH4W 2EGEA 1OV3A 2JXBA 1E6HA 1MV0B 4Z89A 1U3OA 4J9BA 1BB9A 2IIMA 2BTTA 2D1XA 2OJ2A 1OPLA 1QKWA 1UTIA 4EIKA 1K0XA 2JTEA 4AFUC 4E6RA 1X6GA 1CKBA 4J9DA 4OMQA 3RBBB 5I11A 1ZUUA 3GBQA 1UG1A 2RN8A 1NM7A 3M0TA 2J6KA 2V1QA 1NYGA 2LMJA 1Y57A 2CT4A 1PHTA 2CSIA 1M8MA 1WYXA 1M3CA 1E7OA 1AWJA 1UE9A 2A36A 1IO6A 3UA6A 3O5ZA 1GCQC 2FRYA 2GGRA 4J9CA 1UDLA 3PE0A 1K0SA 4LUEA 2VVKA 4RTWA 2DE0X 2GBQA 3VS0A 2J6FA 2DL5A 2YUOA 5IHNA 2YSQA 4GLMA 1NEGA 3ZL7C 4R0KA 2K79A 2JT4A 1XOVA 2ED1A 4HVVA 1AWWA 1PWTA 1PNJA 2DM1A 3M0UA 1RLPC 2PTKA 3H0FA 3EHQA 2A37A 2I0NA 1NG2A 4M4ZA 2YUQA 2JS2A 3TVTA 4IIMA 1YNZA 2ENMA 2RQTA 2C0TA 2DVJA 4GBQA 2EVRA 2BZXA 1T0JA 2KRNA 1WI7A 1LCKA 2F2VA 2OAWA 2EYXA 3VS5A 4WCIA 1X2QA 2EGCA 2KT1A 2KT8A 5EC7A 1MUZA 4LN2A 4RTXA 5FW9A 2EW3A 1JQQA 2CT3A 3R6NA 5IXFA 2DX1A 1GBRA 3PVLA 1PRMC 2RQWA 2RF0A 1PRLC 4J9EA 4A63B 1HD3A 4OMLA 2KYBA 2OI3A 1X6BA 2KXCA 2O88A 2K2MA 1K4US 3NPFA 2SRCA 1JXMA 1YWOA 1JEGA 4RUGA 1I07A 1RLQC 1UFFA 1OOTA 1G83A 2K3BA 1BBZA 3VRZA 5IXBA 2KXDA 2AKKA 1AVZC 2KGTA 4FSSA 2CUDA 2JM9A 3EGUA 2RPNA 2W0ZA 2O2OA 3M0RA 1NYFA 4LUDA 1VA7A 1N5ZA 4ORZA 1TUCA 2L2PA 2EGAA 2K9GA 2GQIA 1X27A 3THKA 2PZ1A 1WX6A 4HVUA 1AZGB 5GJWB 2JMAA 2RQRA 3I35A 1AEYA 2EPDA 4Y92A 2DJQA 1QKXA 4JJCA 3H41A 1JO8A 3QWYA 1X43A 3KFVA 2KRMA 4J9FA 1WXUA 2O9SA 4RTVA 1W1FA 1Z9ZA 1OEBA 2BZYA 5HCKA 2DL4A 1AD5A 2CDTA 2H8HA 1X69A 4RTZA 2L3SA 2DNUA 2K6DA 1KSWA 3JV3A 4CC3A 5ECAA 5IHKA 1H92A 2EBPA 2P4RA 1ARKA 1RUWA 1H8KA 2A08A 2LJ0A 1U5SA 4RTTA 1TUDA 3U23A 2NUZA 2JMCA 1GFCA 2HCKA 2L3QA 4CC7A 2RNAA 3QWXX 4DEYA 3REBB 3VS2A 1FYNA 1UHFA 2FRWA 4OMNA 2DL8A 1SHFA 4LNPA 1J3TA 1TG0A 4X1VA 1I1JA 2K7AA 2LQWA 4F14A 1VYTA 1NEBA 2LP5A 2O9VA 1NLOC 2J7IA 1EFNA 2KBTA 3NHNA 2J05A 2L3PA 1WFWA 2J6OA 2F2WA 1QWFA 1ZSGA 4AFZC 5IHIA 2LNHB 1G2BA 4CC4B 3NMZC 3REAB 2ECZA 3LH5A 1ZLMA 1M27C 4LE9A 2VWFA 4HXJA 2M0YA 2AZVA 1VYVA 1UGVA 1X2KA 3TSZA 3RNJA 1ZBJA 1T3SA 2YUPA 5FWCA 2MOXA 2LX7A 1Z9QA 1Y0MA 2RMOA 2L0AA 3TSWA 2DMOA 3VS6A 1T3LA 3CQTA 1YP5A 3UA7A 4J9HA 2GNCA 3NGPA 1UJ0A 1ZUKA 1BK2A 1ZUYA 2X3WD 1AOJA 4OMOA 2DL3A 2DBMA 1YCSB 2KYMA 2CSQA 1GBQA 2DF6A 1SEMA 1WIEA 2M51A 4HVWA 2KNBB 1UHCA 2RQUA 2AKLA 2YDLA 1WXTA 2FG0A 1UECA 2KEAA 4D8KA 2KRSA 1CKAA 1HJDA 2A28A 2DA9A 2KE9A 1QCFA 5IH2A 1B07A 2DBKA 1H3HA 2ABLA 3C0CA 4Z88A 4KRTA 2F2XA 2LZ6B 4J9IA 1UJYA 3SHWA 1W6XA 1SRLA 2FEIA 2CH4A 2HDAA 3UATA 1QLYA 2C0OA 1SRMA 1RI9A 4CC2A 3FJ5A 3EG0A 1GL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1R A;  3EG3 A;  1K9A A;  2ED0 A;  4JJD A;  1AWX A;  1A0N B;  4Z8A A;  2FO0 A;  2EYZ A;  5FWB A;  3EHR A;  3VS4 A;  3IQL A;  4IIO A;  2X3X D;  5GJV B;  2AK5 A;  2EYY A;  1WLP B;  2KRO A;  1W70 A;  1ABO A;  2AZS A;  2DIL A;  4AG2 C;  1KFZ A;  1UUE A;  1WXB A;  2GTO A;  1I0C A;  2VKN A;  4ZNX A;  1KJW A;  2ROT A;  3VS3 A;  5I22 A;  3M0Q A;  2MIO A;  4JPB W;  1M30 A;  4F17 A;  2HBW A;  2LQN A;  2JM8 A;  1NLP C;  2EYW A;  2GTJ A;  2G6F X;  2ROL A;  1MV3 A;  3I9Q A;  2HEQ A;  2EQI A;  2NWM A;  4F16 A;  2YT6 A;  2D8J A;  2E5K A;  2FPE A;  1GFD A;  1YN8 A;  1YWP A;  2O31 A;  1BU1 A;  3I5S A;  1GCQ A;  4QT7 A;  1V1C A;  4AFQ C;  4OMP A;  1JU5 C;  4JZ3 A;  1PKS A;  3M0P A;  2ESW A;  4JJB A;  1GRI A;  3EG1 A;  5L23 A;  2CUB A;  1WA7 A;  1FMK A;  2YUN A;  4DEX A;  3UF4 A;  1ABQ A;  2DLP A;  1E6G A;  1ZX6 A;  1S1N A;  1OPK A;  3I5R A;  4OMM A;  3A98 A;  4D8D A;  3M0S A;  2LCS A;  2JS0 A;  4K11 A;  1AWO A;  3VRY A;  1VYU A;  3H0H A;  1M3B A;  1PKT A;  1U06 A;  2RQV A;  3EG2 A;  1K1Z A;  2D0N A;  1SSH A;  2DRK A;  2J06 A;  2BZ8 A;  2D8H A;  2EKH A;  2QDL A;  2W10 A;  2MCN A;  1KIK A;  4ESR A;  1M3A A;  1K76 A;  2DYB A;  1QWE A;  4J9G A;  1AZE A;  1SHG A;  4AFS C;  1T0H A;  4AG1 C;  3VS1 A;  3VS7 A;  2HSP A;  1JXO A;  2CRE A;  1SPK A;  3PVQ A;  3H0I A;  1WDX A;  2DRM A;  2JW4 A;  2LJ1 A;  4HCK A;  4RTY A;  2LJ3 A;  2SEM A;  1GCP A;  2KR3 A;  1HSQ A;  2PNI A;  2C0I A;  2FPF A;  3ULR B;  1B3Q A;  4JZ4 A;  2DL7 A;  2XMF A;  2FPD A;  3SEM A;  4RTU A;  2B86 A;  1CSK A;  2CH4 W;  2EGE A;  1OV3 A;  2JXB A;  1E6H A;  1MV0 B;  4Z89 A;  1U3O A;  4J9B A;  1BB9 A;  2IIM A;  2BTT A;  2D1X A;  2OJ2 A;  1OPL A;  1QKW A;  1UTI A;  4EIK A;  1K0X A;  2JTE A;  4AFU C;  4E6R A;  1X6G A;  1CKB A;  4J9D A;  4OMQ A;  3RBB B;  5I11 A;  1ZUU A;  3GBQ A;  1UG1 A;  2RN8 A;  1NM7 A;  3M0T A;  2J6K A;  2V1Q A;  1NYG A;  2LMJ A;  1Y57 A;  2CT4 A;  1PHT A;  2CSI A;  1M8M A;  1WYX A;  1M3C A;  1E7O A;  1AWJ A;  1UE9 A;  2A36 A;  1IO6 A;  3UA6 A;  3O5Z A;  1GCQ C;  2FRY A;  2GGR A;  4J9C A;  1UDL A;  3PE0 A;  1K0S A;  4LUE A;  2VVK A;  4RTW A;  2DE0 X;  2GBQ A;  3VS0 A;  2J6F A;  2DL5 A;  2YUO A;  5IHN A;  2YSQ A;  4GLM A;  1NEG A;  3ZL7 C;  4R0K A;  2K79 A;  2JT4 A;  1XOV A;  2ED1 A;  4HVV A;  1AWW A;  1PWT A;  1PNJ A;  2DM1 A;  3M0U A;  1RLP C;  2PTK A;  3H0F A;  3EHQ A;  2A37 A;  2I0N A;  1NG2 A;  4M4Z A;  2YUQ A;  2JS2 A;  3TVT A;  4IIM A;  1YNZ A;  2ENM A;  2RQT A;  2C0T A;  2DVJ A;  4GBQ A;  2EVR A;  2BZX A;  1T0J A;  2KRN A;  1WI7 A;  1LCK A;  2F2V A;  2OAW A;  2EYX A;  3VS5 A;  4WCI A;  1X2Q A;  2EGC A;  2KT1 A;  2KT8 A;  5EC7 A;  1MUZ A;  4LN2 A;  4RTX A;  5FW9 A;  2EW3 A;  1JQQ A;  2CT3 A;  3R6N A;  5IXF A;  2DX1 A;  1GBR A;  3PVL A;  1PRM C;  2RQW A;  2RF0 A;  1PRL C;  4J9E A;  4A63 B;  1HD3 A;  4OML A;  2KYB A;  2OI3 A;  1X6B A;  2KXC A;  2O88 A;  2K2M A;  1K4U S;  3NPF A;  2SRC A;  1JXM A;  1YWO A;  1JEG A;  4RUG A;  1I07 A;  1RLQ C;  1UFF A;  1OOT A;  1G83 A;  2K3B A;  1BBZ A;  3VRZ A;  5IXB A;  2KXD A;  2AKK A;  1AVZ C;  2KGT A;  4FSS A;  2CUD A;  2JM9 A;  3EGU A;  2RPN A;  2W0Z A;  2O2O A;  3M0R A;  1NYF A;  4LUD A;  1VA7 A;  1N5Z A;  4ORZ A;  1TUC A;  2L2P A;  2EGA A;  2K9G A;  2GQI A;  1X27 A;  3THK A;  2PZ1 A;  1WX6 A;  4HVU A;  1AZG B;  5GJW B;  2JMA A;  2RQR A;  3I35 A;  1AEY A;  2EPD A;  4Y92 A;  2DJQ A;  1QKX A;  4JJC A;  3H41 A;  1JO8 A;  3QWY A;  1X43 A;  3KFV A;  2KRM A;  4J9F A;  1WXU A;  2O9S A;  4RTV A;  1W1F A;  1Z9Z A;  1OEB A;  2BZY A;  5HCK A;  2DL4 A;  1AD5 A;  2CDT A;  2H8H A;  1X69 A;  4RTZ A;  2L3S A;  2DNU A;  2K6D A;  1KSW A;  3JV3 A;  4CC3 A;  5ECA A;  5IHK A;  1H92 A;  2EBP A;  2P4R A;  1ARK A;  1RUW A;  1H8K A;  2A08 A;  2LJ0 A;  1U5S A;  4RTT A;  1TUD A;  3U23 A;  2NUZ A;  2JMC A;  1GFC A;  2HCK A;  2L3Q A;  4CC7 A;  2RNA A;  3QWX X;  4DEY A;  3REB B;  3VS2 A;  1FYN A;  1UHF A;  2FRW A;  4OMN A;  2DL8 A;  1SHF A;  4LNP A;  1J3T A;  1TG0 A;  4X1V A;  1I1J A;  2K7A A;  2LQW A;  4F14 A;  1VYT A;  1NEB A;  2LP5 A;  2O9V A;  1NLO C;  2J7I A;  1EFN A;  2KBT A;  3NHN A;  2J05 A;  2L3P A;  1WFW A;  2J6O A;  2F2W A;  1QWF A;  1ZSG A;  4AFZ C;  5IHI A;  2LNH B;  1G2B A;  4CC4 B;  3NMZ C;  3REA B;  2ECZ A;  3LH5 A;  1ZLM A;  1M27 C;  4LE9 A;  2VWF A;  4HXJ A;  2M0Y A;  2AZV A;  1VYV A;  1UGV A;  1X2K A;  3TSZ A;  3RNJ A;  1ZBJ A;  1T3S A;  2YUP A;  5FWC A;  2MOX A;  2LX7 A;  1Z9Q A;  1Y0M A;  2RMO A;  2L0A A;  3TSW A;  2DMO A;  3VS6 A;  1T3L A;  3CQT A;  1YP5 A;  3UA7 A;  4J9H A;  2GNC A;  3NGP A;  1UJ0 A;  1ZUK A;  1BK2 A;  1ZUY A;  2X3W D;  1AOJ A;  4OMO A;  2DL3 A;  2DBM A;  1YCS B;  2KYM A;  2CSQ A;  1GBQ A;  2DF6 A;  1SEM A;  1WIE A;  2M51 A;  4HVW A;  2KNB B;  1UHC A;  2RQU A;  2AKL A;  2YDL A;  1WXT A;  2FG0 A;  1UEC A;  2KEA A;  4D8K A;  2KRS A;  1CKA A;  1HJD A;  2A28 A;  2DA9 A;  2KE9 A;  1QCF A;  5IH2 A;  1B07 A;  2DBK A;  1H3H A;  2ABL A;  3C0C A;  4Z88 A;  4KRT A;  2F2X A;  2LZ6 B;  4J9I A;  1UJY A;  3SHW A;  1W6X A;  1SRL A;  2FEI A;  2CH4 A;  2HDA A;  3UAT A;  1QLY A;  2C0O A;  1SRM A;  1RI9 A;  4CC2 A;  3FJ5 A;  3EG0 A;  1GL5 A; 
#chains in the Genus database with same CATH topology
 1WHM A;  3L2W A;  1AWX A;  4Z8A A;  5FWB A;  2KDS A;  1NJI U;  4HT9 A;  1K9M R;  2ZZD A;  2AK5 A;  4QQD A;  3MEU A;  2QEX Q;  2F69 A;  1UGR B;  1UUE A;  5GMK i;  1U8R A;  3VS3 A;  4CRI A;  2JZ2 A;  3FC3 A;  2YRV A;  1M30 A;  2DXU A;  4F17 A;  1Q86 C;  2GTJ A;  1O9S A;  3R6O A;  5FRM A;  1YJ9 Q;  4AT1 B;  3OYK A;  3SB2 A;  2A3L A;  1YI2 Q;  3TU4 K;  2P0Q A;  4JRQ A;  4X34 A;  4AFQ C;  1F1B B;  5KYN A;  4NS5 A;  4OF1 A;  1M90 C;  2PUK B;  4ZN1 A;  3F70 A;  3LWI A;  3OYB A;  3VKI A;  3JCM W;  5KE3 A;  5LJ5 f;  4M75 C;  4P5N A;  1FMK A;  2X4X A;  1VIE A;  4A54 A;  4XTV A;  1ABQ A;  2QQS A;  2DLP A;  1ZX6 A;  2LT1 A;  1M1K R;  1H3Z A;  2M1H A;  4MDX A;  4BDY A;  3MET A;  3CXC P;  2RK2 A;  4K11 A;  4KUD K;  1NJI C;  3NTH A;  1PKT A;  1U06 A;  3CCU Q;  2D0N A;  3GIB A;  2CP3 A;  3DLL A;  2D8H A;  2MCN A;  1MNE A;  1ZBX A;  2LRQ A;  4TVR A;  1VQ9 Q;  4ZGD B;  1MMG A;  1SKU B;  3CMA A;  1KD1 U;  1WHG A;  2RJE A;  5CO7 A;  2LVM A;  4OMF B;  4HCB A;  1EZZ B;  4F7U G;  5CVI A;  2V8I A;  4FCY A;  2HBP A;  4E7L A;  3FIF A;  1C0M A;  2FPF A;  3ULR B;  3MEW A;  4LDX A;  4D6W A;  1QQJ A;  2JUF A;  2QYZ A;  4J5Y A;  2O4X B;  2DL7 A;  2XMF A;  3LGL A;  5I21 A;  4OB2 B;  3SEM A;  3OY9 A;  2B86 A;  5L8R E;  1BI3 A;  1BIB A;  1OV3 A;  1IHV A;  1NE8 A;  4BI8 B;  1U3O A;  4FM4 B;  3OYI A;  2F5K A;  1OPL A;  4EIK A;  4E6R A;  5A2Q E;  4OGE A;  1CKB A;  4J9D A;  4OMQ A;  5I11 A;  1MND A;  1Q82 R;  1YBY A;  3JCM g;  3N5B B;  1NM7 A;  4C0F A;  3VUZ A;  2CT4 A;  1K73 C;  1Q86 R;  3OW2 P;  5DY9 A;  1E7O A;  1M3C A;  2RHU A;  1AWJ A;  1UE9 A;  5KYY B;  2A36 A;  4DBR A;  2GGR A;  4J9C A;  1MGQ A;  4XK8 E;  1RAA B;  4LUE A;  4FIB A;  1KG1 A;  3JCM b;  1EX4 A;  5LL6 S;  3MEA A;  2RB6 A;  1OZ3 A;  5GAN d;  1FMV A;  3LW5 E;  4HVV A;  3P8H A;  1PWT A;  1PNJ A;  2DM1 A;  1VQK A;  1RLP C;  4BAC A;  3CC4 T;  1PCX A;  4J6X A;  2YUQ A;  2OX7 A;  4Y91 A;  3CBP A;  4QVZ A;  4M77 D;  2CS7 A;  1D3B A;  4IIM A;  1D3B B;  1G3T A;  4M77 C;  3EFO B;  1WI7 A;  2OAW A;  1X2Q A;  2EGC A;  2KT8 A;  3L42 A;  4LN2 A;  4C0Z A;  1K8A C;  2EW3 A;  1JQQ A;  2CT3 A;  2DX1 A;  1GBR A;  3PVL A;  3RR6 A;  5CKB A;  4R56 A;  1Q82 C;  1IXD A;  4PK4 A;  4M78 G;  3QII A;  3CD6 Q;  2XDP A;  3KBG A;  2K2M A;  3TCJ A;  1QVG A;  3GP8 A;  2KVQ G;  1I07 A;  4RCC A;  1YIJ T;  3MCA B;  2LTO A;  5GMK h;  2BKD N;  1PM3 A;  5I2M A;  3M58 A;  1PG5 B;  2DTH A;  2AT1 B;  1VQM Q;  1AVZ C;  2HSE B;  1MMN A;  4C92 B;  2E3H A;  1RAF B;  2LNV A;  3OS5 A;  4ELY C;  4N4G A;  2O2O A;  4NOY A;  3CEY A;  1WGS A;  2IVW A;  1N5Z A;  4ORZ A;  4M7D E;  1TUC A;  2EGA A;  1X27 A;  2F5T X;  4JRI A;  4PJO B;  5GJW B;  3OMG A;  4LD9 K;  4OGC A;  2DJQ A;  3CCQ T;  4HKE A;  3H41 A;  3KFV A;  1WXU A;  2O9S A;  3QO3 A;  1Z9Z A;  5HK0 A;  3CCR T;  2BZY A;  4PL6 A;  4DA4 A;  2M16 A;  4PJN A;  4C5E A;  3CCQ Q;  3A8H B;  2CDT A;  2FB7 A;  3KUF A;  2P4T A;  4PLL A;  4XTZ A;  2VYT A;  3JV3 A;  3E1S A;  2QA4 A;  2EBP A;  3PMI A;  4XTW A;  3CCL A;  2WSC E;  2X35 A;  3C95 A;  1FX7 A;  2EAY A;  2A08 A;  3ER0 A;  2FVU A;  1QVF P;  3BE3 A;  1ZA2 B;  5GAN h;  4C0D C;  4C92 G;  3EGX A;  2NUZ A;  2MYS A;  2HCK A;  2L3Q A;  5KYY A;  2CP7 A;  4JS5 A;  5CIU A;  2VXE A;  4JRP A;  1VQK T;  3REB B;  1X01 A;  4J7I A;  1I4K 1;  4EMG A;  5GAO p;  3I55 T;  1UHF A;  2PVO B;  4BB7 A;  1SHF A;  4LNP A;  1J3T A;  2DO3 A;  1I1J A;  2EKO A;  2QG9 B;  4F14 A;  1K73 R;  3HKS A;  3OYM A;  4C0D B;  2J7I A;  2J05 A;  3HRU A;  1PD0 A;  1WFW A;  2DZ9 A;  4HCC A;  2K5L A;  2MF2 A;  3OW2 S;  1Q7Y U;  1VQ4 Q;  2CYZ B;  2LNH B;  2ECZ A;  2VWF A;  3JCM h;  2AZV A;  3CCS T;  4J7F A;  1VQP A;  4FYX B;  1G5V A;  4J6Y A;  3TSZ A;  2OTL Q;  2OTJ T;  2LCC A;  5FWC A;  2DMO A;  1MMD A;  1T3L A;  2YLB A;  3SDZ A;  3OA6 A;  2BUD A;  1ZUK A;  1D1A A;  1XJW B;  4QVC A;  3G4S Q;  1ZUY A;  1AOJ A;  2CSQ A;  1GBQ A;  1UGS B;  1TU0 B;  2DFU A;  2M51 A;  1D1B A;  3RUX A;  2RQU A;  1ACM B;  2AKL A;  4Z02 A;  1YJN Q;  1TUG B;  3MP1 A;  1WXT A;  1UEC A;  4HA8 A;  3HFO A;  2HMA A;  1BCO A;  4XTU A;  4E7J A;  4NL2 A;  2KRS A;  1CKA A;  1R0B G;  3BW1 A;  2DBK A;  5LJ5 g;  2NUP B;  4M78 E;  1UGP B;  3C0C A;  3OYH A;  3CCJ A;  4Z88 A;  2F2X A;  3DKM A;  1UJY A;  4BI3 A;  2FEI A;  2NUT B;  3OS1 A;  2D9T A;  3JB9 G;  4M7A A;  4CC2 A;  4GLK A;  5KCH A;  4JJD A;  2NLU A;  2FO0 A;  3G71 T;  2HD0 A;  4MZP A;  4M77 E;  1QCO A;  5GJV B;  1WLP B;  2XIC A;  1W70 A;  1B34 A;  4BE2 A;  2DIL A;  4AG2 C;  4NL3 A;  1WXB A;  2XDD A;  2X9H A;  1N6A A;  1I0C A;  4ZNX A;  4OB3 B;  4C92 D;  1KJW A;  2ROT A;  1UEB A;  4E7Z A;  4M7D F;  5I22 A;  3M0Q A;  2Z0W A;  2V26 A;  2HBW A;  4LDV A;  1NLP C;  2EYW A;  5KYW B;  4C92 C;  2HEQ A;  3PT9 A;  2RHX A;  2EQI A;  5IT9 E;  2DIQ A;  3TRE A;  2OTL T;  2E5K A;  1GFD A;  1YN8 A;  3PGG A;  1GCQ A;  4Y28 E;  3JAM E;  1VQN T;  4M7D A;  4C5H A;  4Q5W A;  1LPL A;  3X24 B;  5GAN 8;  4BD3 A;  4OVA A;  3ASK A;  3C94 A;  1VQ4 T;  1VQ9 A;  3HTR A;  4B9X A;  4C8Q G;  1X75 C;  3QSU A;  2QTV A;  3CCM T;  4JLI A;  3EGX B;  2JN0 A;  2LX9 A;  4IUU A;  2ESW A;  5KCO A;  2O01 E;  3V8J A;  1RAB B;  2VGN A;  1NPR A;  1KQ1 A;  5CKH A;  3JCM P;  1OI1 A;  3C12 A;  3BDU A;  3BDL A;  3JCM f;  2YUN A;  2QAS A;  5C6S A;  2E41 A;  3J80 E;  3I55 Q;  4M77 B;  1OQK A;  3CC7 A;  1S1N A;  2PU9 B;  4M78 C;  4ELZ C;  5GAN 5;  1QVP A;  2OTJ A;  1PD1 A;  3FEO A;  4OMM A;  1G3W A;  5LJ3 j;  3CPF A;  1IRX A;  1WPY A;  2JS0 A;  2E6Z A;  1IGU A;  2MPX C;  3V8K A;  5FU6 C;  4E7H A;  1ZSZ C;  3VRY A;  2CP2 A;  1M3B A;  2XU8 A;  3OSS C;  2RQV A;  2HQX A;  1K1Z A;  2KMT A;  1SSH A;  2DRK A;  5HY6 A;  2J06 A;  1KIK A;  1QP3 A;  2W10 A;  2QQ9 A;  4M75 D;  1QWE A;  3V7C A;  4FSX A;  1AZE A;  4AFS C;  1T0H A;  4C0G A;  1JXO A;  1YHQ Q;  1QVG S;  2CRE A;  1SPK A;  1YI2 T;  5GAM d;  3PVQ A;  5IAY A;  2E70 A;  3X26 B;  2MAM A;  2K3Y A;  3BY7 A;  5J26 A;  1SG5 A;  1KQS P;  2LJ1 A;  4HCK A;  4RTY A;  5J3B A;  2LJ3 A;  4PKC C;  2SEM A;  2OTL A;  1GCP A;  2KR3 A;  4QW2 A;  2C0I A;  4BI4 A;  3NTI A;  1QCN A;  2FPD A;  1YJN T;  1CSK A;  2CH4 W;  3JCM J;  2JXB A;  1MV0 B;  4Z89 A;  4M77 G;  2IIM A;  3BFM A;  2D1X A;  1M8V A;  3E9G A;  1IZ6 A;  1UTI A;  4M75 B;  4E7I A;  3GF5 A;  1TSF A;  1BIA A;  3QHS A;  3OYY A;  1UG1 A;  2GFA A;  1VQ6 A;  2J6K A;  2V1Q A;  3GOX A;  1NYG A;  1Y57 A;  3CCE A;  1PHT A;  2CSI A;  3M4Y A;  1M8M A;  1WYX A;  2VUB A;  5LJ5 d;  3MKD A;  5M9O A;  3VV0 A;  3RKY A;  4XAX B;  2B8A A;  3EGD A;  3P8D A;  3O5Z A;  3CCS Q;  2FRY A;  3JB9 H;  3PE0 A;  1YIT T;  3HPW A;  1K0S A;  1B34 B;  2DE0 X;  2J6F A;  2QI2 A;  5IHN A;  4GLM A;  1NEG A;  3ZL7 C;  3UPU A;  4M7A F;  2ED1 A;  1AWW A;  4ANJ A;  4BUG A;  2E4H A;  1OUL A;  3S6W A;  2O4X A;  2EJ9 A;  3H0F A;  5GAM j;  2YRD A;  3MO8 A;  3CPW P;  2QQA A;  2DET A;  3NTK A;  5GMK e;  1YNZ A;  3HSB A;  2BZX A;  3JCM X;  4LXC A;  1M90 U;  2KRN A;  1Q82 U;  5KYX B;  1S72 T;  2F2V A;  3OYJ A;  3CPW A;  2KT1 A;  4EDU A;  1MUZ A;  5GAO m;  3MP8 A;  1M90 R;  3CCS A;  1M1K C;  1Q7Y R;  1LOJ A;  2RQW A;  1TS9 A;  1BYM A;  4J9E A;  4HCZ A;  1YJN A;  4A63 B;  3AT1 B;  3GPL A;  2DZC A;  1X6B A;  3LH0 A;  3RDV A;  1YJW A;  1WJQ A;  4KGZ B;  1V76 A;  1K4U S;  2SRC A;  1RL2 A;  1VQM A;  4JJN K;  4M75 G;  1RLQ C;  1YIJ A;  2DXT A;  1UFF A;  4F7U E;  2RHI A;  3I56 A;  1OOT A;  3OBW A;  2K3B A;  1BBZ A;  3RIR A;  2YHT A;  3KXT A;  5IXB A;  2NYS A;  4HT8 A;  2DPP B;  3MEV A;  4C92 E;  5GAO q;  2LT4 A;  2ZPG B;  2W0Z A;  4XTY A;  3TEE A;  3M57 A;  4FU6 A;  4N4I A;  2KQW A;  3M59 A;  2JMA A;  2RQR A;  3I35 A;  2D0Q B;  5GAN 3;  1QKX A;  3GNG A;  4JJC A;  1JO8 A;  3QWY A;  1X43 A;  2KRM A;  4J9F A;  2M02 A;  3OYC A;  2RI2 A;  2RJC A;  5I2S A;  2LQK A;  1OEB A;  3OYD A;  1PSF A;  2DL4 A;  4BDZ A;  1AD5 A;  3CBO A;  2H8H A;  4RTZ A;  2L3S A;  2K6D A;  1VQ8 Q;  1KSW A;  3CCV Q;  3RMQ A;  5D6W A;  2WSF E;  1FMW A;  1FXX A;  1VQO A;  5ECA A;  3OSV A;  5IHK A;  3CXC A;  1VQ9 T;  1TXQ A;  4C8Q E;  2P4R A;  4F7U B;  3RER A;  3PTA A;  3CME A;  2EJG A;  1TUD A;  1D0Z A;  4IUT A;  1KD1 R;  4YTL A;  1VQN Q;  2L89 A;  2XD0 A;  4KT0 E;  4PNO A;  3QWX X;  4M78 A;  2FZK B;  4FYY B;  4PJM A;  2FRW A;  1VUB A;  2DL8 A;  2FZG B;  2RK1 A;  1VYT A;  1NEB A;  3CCL T;  2O9V A;  2QAZ A;  3JB9 D;  4EMK B;  2DD5 A;  2J6O A;  3T9N A;  3GLX A;  5GAN 4;  3M5A A;  2KY9 A;  1KC8 C;  2E5Q A;  4A4H A;  2K5F A;  1QWF A;  4PJO D;  2BE7 D;  4AFZ C;  2QQR A;  1G2B A;  4CC4 B;  3NMZ C;  3REA B;  5EG2 A;  3G71 Q;  2H3J A;  1ZLM A;  1M27 C;  4LE9 A;  2V8K A;  5CKE A;  1VYV A;  2I2L A;  1X2K A;  5HK3 A;  3RNJ A;  1MHN A;  4FYW B;  4BY6 C;  4EMK C;  2YUP A;  4LD6 A;  3G4S A;  2L0A A;  4II1 A;  1RI0 A;  1S72 Q;  1RAH B;  2ZGW A;  1UJ0 A;  1AT1 B;  1JB0 E;  5D6X A;  2DL3 A;  2DBM A;  8AT1 B;  4OP0 A;  2ZPE B;  4HVW A;  2KNB B;  3CCJ Q;  4DOV A;  3V7S A;  1PSE A;  2YLC A;  2DJZ A;  3G4S T;  2XI9 A;  2DXC A;  2DA9 A;  2KE9 A;  3L2V A;  4XQ3 A;  3SFM A;  4ME7 A;  4JUV A;  4QQ6 A;  4KRT A;  3JCM V;  1YJ9 A;  4J9I A;  4C8Q B;  5CAI A;  1VQP Q;  1VQ8 A;  1Q81 C;  1W6X A;  4GY5 A;  2OTJ Q;  1PC0 A;  2HDA A;  1VQL A;  5A0G A;  2P0K A;  3EH2 A;  2DAQ A;  4KBM B;  3EG0 A;  3FDR A;  1YIT Q;  3V8L A;  2C06 A;  3RKW A;  1XTD A;  2V1R A;  2QEX A;  1RAG B;  3QUI A;  2EYZ A;  2JTF A;  2RHY A;  3EHR A;  3VS4 A;  2EYY A;  1ABO A;  3EG9 B;  3EG9 A;  3CPW S;  2L5Q A;  2KSS A;  4N4H A;  3ME9 A;  2FYK A;  2VKN A;  1M5Q 1;  4IUR A;  2MIO A;  1JJ2 P;  2LQN A;  1BI0 A;  3I9Q A;  2P0P A;  2VC8 A;  4JRK A;  2NWM A;  2XDB A;  4F16 A;  2LQ8 A;  2YT6 A;  2D8J A;  3FB9 A;  1YWP A;  1BU1 A;  4QT7 A;  1HXD A;  2A7Y A;  4EPC A;  2ZPI B;  2DTI A;  4MZT A;  1TWB A;  1PKS A;  3G71 A;  5LJ5 e;  1ZQ1 A;  2XKO C;  2K3X A;  4O6J A;  7AT1 B;  1YHQ T;  3ZBD A;  3LLR A;  5L23 A;  1DJ7 B;  4DBH A;  1WA7 A;  1ZSZ B;  2RJF A;  1ZSZ A;  2DXB A;  3OS2 A;  4DEX A;  1YJ9 T;  5LJ3 f;  4A4F A;  1E6G A;  3CCE Q;  1OPK A;  5CQX A;  1WQW A;  3JB9 I;  3I5R A;  1EIF A;  4BE1 A;  3A98 A;  1B7T A;  4D8D A;  3EH1 A;  1Q7Y C;  2RHZ A;  1WHK A;  3M0S A;  2E3I A;  3EAE A;  5KYU A;  1VYU A;  1RAC B;  3H0H A;  5KYU B;  4LDY A;  3OYL A;  3OYG A;  4O5V A;  3CCL Q;  2Y90 A;  2Y4Y A;  3CMA Q;  1WHL A;  4FW2 A;  1TH7 A;  2QDL A;  2ZAE A;  3UT1 A;  1N9R A;  3CCU A;  1W2B A;  1SHG A;  4QKU A;  4AG1 C;  2HSP A;  3VU3 C;  3JB9 J;  3DLM A;  3E9F A;  3I56 T;  4MZM A;  2QGG A;  2QK0 A;  1WDX A;  1VQM T;  4C92 F;  3CCM Q;  4DOW A;  3G1J A;  2DKG A;  3CCU T;  1YIJ Q;  1HSQ A;  2PNI A;  1I81 A;  1OX9 A;  4L59 A;  1B3Q A;  4JZ4 A;  3UDC A;  4F7U F;  3CCV T;  3EFR A;  4RTU A;  4KGV B;  2DK3 A;  2EGE A;  1VQ8 T;  1HYO A;  1P92 A;  1QP2 A;  1KQS S;  4F04 B;  3CME T;  2BTT A;  4ZTJ A;  4M7D G;  3M53 A;  2OJ2 A;  2EQK A;  1QMC A;  2KI7 A;  1K0X A;  2JTE A;  3D7S B;  3X20 B;  1X6G A;  2F1L A;  3RBB B;  1ZUU A;  3HHT B;  5FRN A;  5GMK m;  2LMJ A;  3CC7 Q;  5D6Y A;  4XU2 A;  3QDR B;  4X9C A;  1YHQ A;  3H6Z A;  3L2R A;  1BCM A;  4A53 A;  1IHW A;  2JTM A;  1IO6 A;  3QYH B;  3SWN C;  1X6O A;  1N8R C;  1GCQ C;  4MDW A;  5C0M A;  2RJD A;  4M77 A;  5GMK l;  3CC4 Q;  1I5L A;  2COY A;  2P84 A;  4KUI A;  3E19 A;  2YSQ A;  2X51 A;  3FRN A;  4R0K A;  1RAD B;  2JT4 A;  3PNW C;  2CP6 A;  1K9M C;  4ZGE B;  1H64 1;  3HP9 A;  1R8O B;  2A37 A;  2Y4X A;  3GNF B;  1LNX A;  3G6E T;  3M55 A;  2X4J A;  3OW2 A;  4GBQ A;  2DVJ A;  3CCQ A;  4XU3 A;  1T0J A;  2PQW A;  2D6F A;  3EFO A;  1LVK A;  4ATO A;  4XTX A;  2RI3 A;  1LCK A;  2EYX A;  4KH0 B;  3VS5 A;  4WCI A;  5GAM e;  4RTX A;  1YJW Q;  1VIF A;  1Y71 A;  2DEQ A;  1PRL C;  2XID A;  3RMS A;  4OML A;  2CP0 A;  2OI3 A;  1U1T A;  1WZO A;  4RKU E;  4XU1 A;  2ZPF B;  3V7R A;  6AT1 B;  3TQ7 P;  1K73 U;  2QQB A;  2EJF A;  3CD6 T;  1YCY A;  1JEG A;  2VV5 A;  2HKN A;  3WVD B;  4BE0 A;  2VGM A;  4JLG A;  4M7D C;  1WJS A;  3VRZ A;  2X4W A;  1U1S A;  5FU7 C;  2ZPH B;  4E2F B;  3M9Q A;  2HL3 A;  2L8D A;  2KGT A;  4FSS A;  2JM9 A;  1KK7 A;  2RPN A;  3CC2 T;  3S3M A;  2GFU A;  3M0R A;  4M78 B;  1JJ2 S;  1NYF A;  3DB3 A;  4LDW A;  1VA7 A;  4A4G A;  1Q86 U;  2FHD A;  2GQI A;  2PZ1 A;  1MMA A;  1TOV A;  1WX6 A;  3SD4 A;  3CD6 A;  4OB1 B;  5FU6 B;  1Y96 B;  2CP5 A;  1Q81 R;  3C4S A;  1RAI B;  4RTV A;  1W1F A;  3G6E A;  2COW A;  4PFP A;  4M7A C;  3CC2 A;  2HNI A;  3CC4 A;  1IB8 A;  2EYQ A;  1X69 A;  2DNU A;  2YXY A;  1VQ6 T;  4M78 F;  1H92 A;  1VQ7 A;  5FLX E;  2X4Y A;  1Y7X A;  4PJO C;  5KYX A;  4PJO G;  1ARK A;  5KH6 A;  1Q95 G;  3OS0 A;  5CKF A;  2IG0 A;  2RO0 A;  3SWN A;  2LJ0 A;  2R57 A;  3QJY A;  4RMO A;  1R0C B;  3U23 A;  2DTO A;  1QW1 A;  2KAF A;  4JDS A;  4CC7 A;  2RNA A;  4M7A G;  4L5G A;  4FW1 A;  5A0L A;  2CKK A;  4PJJ A;  3QDF A;  3WVE B;  3QPH A;  5DLQ E;  2EFI A;  3QYG B;  2YWW A;  3E2U A;  4C8Q C;  4X1V A;  2LQW A;  1GXI E;  1V29 B;  1S72 A;  3NFC A;  2DYI A;  4KGX B;  2LP5 A;  3L2U A;  3JCM e;  2QEX T;  3H9N A;  3MPU B;  5GAN f;  2QA4 Q;  2R5M A;  5IHI A;  1KQ2 A;  3J81 E;  2QGF B;  4J8O A;  3CCR A;  1WNL A;  2K4Y A;  1N9S A;  4M77 F;  4EMH A;  5LJ3 h;  1UGV A;  4C5G A;  3OQ5 A;  3Q1J A;  1VQ5 Q;  3M54 A;  3S3N A;  4E7S A;  1T3S A;  2MOX A;  2LX7 A;  4PFZ A;  4J83 A;  1FWZ A;  3PIP A;  3TSW A;  4R55 A;  4N0A A;  1KD1 C;  5HKC A;  3CQT A;  1YP5 A;  2KK4 A;  2LCL A;  5GAO n;  3NGP A;  2K57 A;  5D7U A;  1BKB A;  1IGQ A;  2X3W D;  1KQS A;  4OMO A;  2RH2 A;  1YCS B;  5CR2 A;  1M2V A;  2DF6 A;  1M2V B;  1SEM A;  3A8M B;  1UHC A;  1YFN A;  1Y07 A;  2KEA A;  1HJD A;  1QCF A;  3A5Z B;  4UC4 A;  1VQN A;  4C8Q F;  1B07 A;  1OZ2 A;  4B6M A;  4EMK A;  2ABL A;  4AMC A;  2LZ6 B;  4XU0 A;  4C92 A;  3SHW A;  5LJ3 g;  3JCM Q;  1NJI R;  1QLY A;  2C0O A;  4M7A B;  1RI9 A;  1G3S A;  2VXF A;  3EG3 A;  1K9A A;  2ED0 A;  4M78 D;  3UWN A;  1A0N B;  2MWO A;  4QQG A;  3JB9 F;  1G8X A;  3IQL A;  1VQ4 A;  4IIO A;  2X3X D;  5GAN g;  2KRO A;  1D0X A;  2E10 A;  1D0Y A;  2DD4 A;  2AZS A;  2L3R A;  3OYA A;  1KFZ A;  2GTO A;  1WHH A;  1QVG P;  2CGH A;  3I55 A;  2GF7 A;  4KUL A;  3RKX A;  4JPB W;  3VUB A;  3OYN A;  5KYW A;  2JM8 A;  2G6F X;  2ROL A;  1MV3 A;  1IRE B;  3I56 Q;  1VQ5 T;  3QXE B;  3RES A;  2FPE A;  2O31 A;  2JVV A;  1AHJ B;  1K8A U;  3I5S A;  2VAS A;  1V1C A;  4OMP A;  3SWN B;  1JU5 C;  3A8O B;  4JZ3 A;  3CMA T;  1YIT A;  2QA4 T;  1XQH A;  2GCX A;  3M0P A;  2QXF A;  3OB9 A;  1UGQ B;  3INZ A;  4JJB A;  2JNG A;  1GRI A;  2IPO B;  3EG1 A;  2E65 A;  2CUB A;  4N0A C;  3PIO A;  2RM4 A;  3M4G A;  1G3Y A;  3UF4 A;  1M1G A;  5LJ5 j;  4FT2 A;  2HQE A;  1KC8 U;  3A8L B;  4E47 A;  5GAN 7;  2LCS A;  4C8Q A;  2MMP A;  5LJ3 e;  1I8F A;  1AWO A;  3QBY A;  2JJ9 A;  3EG2 A;  3PMT A;  4OB0 B;  2XHC A;  3HFN A;  1VQL T;  2CZ7 B;  2BZ8 A;  4MML A;  2EKH A;  2HL5 C;  3HL8 A;  4DBQ A;  4ESR A;  1M3A A;  1K76 A;  3A1P A;  2DYB A;  4ZN3 A;  3QKJ A;  4J9G A;  1VQK Q;  4M7A E;  3VS1 A;  3VS7 A;  1VQ6 Q;  3DB4 A;  4IUP A;  4RCB A;  3H0I A;  4IUV A;  4CI0 C;  4IUQ A;  4B9W A;  2DRM A;  4DQ2 A;  2JW4 A;  4JS4 A;  3PFS A;  2ZPB B;  4M75 E;  2DVE A;  1VQ5 A;  1M9S A;  2EIF A;  9ATC B;  1WJR A;  4VUB A;  2K5I A;  1M4Z A;  1VQO Q;  3JRZ A;  3OMC A;  4ZGJ B;  1SF9 A;  3ZEH A;  3M56 A;  1KHI A;  1E6H A;  1TTH B;  3MHX A;  2MK5 A;  3O8V A;  4J9B A;  2MWP A;  1BB9 A;  1M1K U;  2ATC B;  1QKW A;  4M75 A;  3VJP A;  3CCR Q;  5A0D A;  2QDY B;  5J39 A;  4AFU C;  1Q81 U;  2V8J A;  4F7U A;  3GBQ A;  2E12 A;  2RN8 A;  3M0T A;  5DLO A;  2R5A A;  1WQ7 A;  2RD1 A;  1JRI A;  8ATC B;  3J7A F;  1W2B S;  5CQY A;  4PJO F;  3EGD B;  2DER A;  3UA6 A;  5LJ3 d;  4A4E A;  3AHU A;  1UDL A;  2M0O A;  3CCJ T;  1BI2 A;  2CZ6 B;  4X9D A;  3P8B B;  2VVK A;  4RTW A;  2AIR B;  2GBQ A;  1ZHI A;  4WTO B;  3VS0 A;  4RG8 A;  1W4S A;  2DL5 A;  2YUO A;  5CK9 A;  1VQ7 T;  2K79 A;  3QZ9 B;  5DM7 R;  1XOV A;  1Y96 A;  2MI6 A;  2BIV A;  3QG1 A;  1VQ7 Q;  4LDU A;  3M0U A;  3LX7 A;  4PLI A;  3URG A;  2LDM A;  3A8G B;  3L2Q A;  1R77 A;  1QVF A;  2PTK A;  4KH1 B;  3EHQ A;  5KE2 A;  2I0N A;  1NG2 A;  4M4Z A;  4V2S A;  4FYV B;  4A4K A;  4M7D D;  2JS2 A;  1RAE B;  3TVT A;  1N27 A;  5GAM f;  1OYX A;  1K9M U;  2ENM A;  2OAU A;  2C0T A;  2RQT A;  3ZFJ A;  3G6E Q;  2EVR A;  4PJO A;  2BE9 B;  1VOM A;  3WXM B;  2HAX A;  5EC7 A;  5FW9 A;  1XNI A;  1OU9 A;  4FT4 A;  3R6N A;  5IXF A;  1M2O A;  2JOY A;  1PRM C;  5GAN 2;  2VB6 A;  2RF0 A;  4J6W A;  1N8R R;  1OX8 A;  1HD3 A;  3X28 B;  2KYB A;  2G3R A;  2KXC A;  2FL7 A;  2O88 A;  3NPF A;  3LYI A;  1JXM A;  1YWO A;  1JJ2 A;  4RUG A;  3G7Z A;  1G83 A;  2E6N A;  3LGF A;  2KXD A;  2AKK A;  4M75 F;  4C5I A;  1HK9 A;  2CUD A;  3EGU A;  1C6V X;  3MP6 A;  2YRC A;  5AYF A;  4LUD A;  1NBE B;  3CME Q;  2DIG A;  2L2P A;  1C1A A;  2K9G A;  2A0F B;  1OU8 A;  3THK A;  1BI1 A;  4HVU A;  1AZG B;  2XK0 A;  1AEY A;  2EPD A;  4Y92 A;  5GAM g;  2EQM A;  4FL6 A;  1W2B P;  2PVD B;  5HCK A;  4BY6 B;  4C8Q D;  3CCV A;  1I5O B;  3HRS A;  2H3E B;  4PFO A;  2PVG B;  2EWN A;  2HQH A;  5GAN j;  1WHJ A;  3VYH B;  3VYG A;  3L1A A;  4E7K A;  4ZTF A;  4CC3 A;  3FJP A;  1SSF A;  1O75 A;  3H8Z A;  2CZ0 B;  1RUW A;  2RA2 A;  1H8K A;  3HRT A;  1U5S A;  2RI5 A;  4PJO E;  4RTT A;  2AHJ B;  3FLG A;  2PUO B;  2JMC A;  3L2Z A;  1GFC A;  4MMK A;  3JCM c;  2WAC A;  4DEY A;  2XG8 D;  3OYE A;  3CCE T;  1D1C A;  3VS2 A;  2COZ A;  1FYN A;  4OMN A;  1D09 B;  4M7A D;  1TG0 A;  5GAM h;  2E1H A;  2K7A A;  3LWH A;  3JSC A;  5GAO r;  1VQO T;  1NLO C;  3NHN A;  1EFN A;  2KBT A;  2NUP A;  3EFS A;  2L3P A;  5GMK j;  1KC8 R;  3QZ5 B;  4RG2 A;  1N8R U;  2F2W A;  1ZSG A;  2NUT A;  1JBM A;  3LH5 A;  1NPP A;  4HXJ A;  2M0Y A;  1QVF S;  5GAN 6;  3CCM A;  2LC4 A;  5GAO l;  2M9U A;  4DBF A;  1ZBJ A;  4L6V 5;  4M7D B;  4WF2 A;  3CC2 Q;  3CC7 T;  1VQL Q;  1Z9Q A;  1Y0M A;  2RMO A;  1YI2 A;  3OBY A;  3VS6 A;  4IKF A;  3OYF A;  1LJO A;  2FZC B;  3UA7 A;  3X25 B;  4J9H A;  1UB4 A;  2GNC A;  2EQU A;  5CCA A;  1K8A R;  2GQV A;  1BK2 A;  2EQJ A;  1NZ9 A;  3QJ6 A;  2KYM A;  2ZCF B;  5GAN e;  1WIE A;  5AT1 B;  2QTX A;  5LJ5 h;  1KHC A;  3MJX A;  2WSE E;  2YDL A;  2FG0 A;  3JCM d;  4QVD A;  2DEU A;  3CXC S;  4D8K A;  2HKQ B;  5IN1 A;  2A28 A;  2K2V A;  2E64 A;  5IH2 A;  5FRO A;  5CKD A;  1H3H A;  2HZY A;  1ZA1 B;  1VQP T;  1M1F A;  1YJW T;  2CZ1 B;  1SRL A;  5FU7 B;  2R58 A;  2CH4 A;  3UAT A;  1SRM A;  3CBM A;  3FJ5 A;  4PJL A;  1GL5 A;  3S3O A; 
#chains in the Genus database with same CATH homology
 2V1R A;  3EG3 A;  1K9A A;  2ED0 A;  4JJD A;  1AWX A;  1A0N B;  4Z8A A;  2FO0 A;  2EYZ A;  5FWB A;  3EHR A;  3VS4 A;  3IQL A;  4IIO A;  2X3X D;  5GJV B;  2AK5 A;  2EYY A;  1WLP B;  2KRO A;  1W70 A;  1ABO A;  2AZS A;  2DIL A;  4AG2 C;  1KFZ A;  1UUE A;  1WXB A;  2GTO A;  1I0C A;  2VKN A;  4ZNX A;  1KJW A;  2ROT A;  3VS3 A;  5I22 A;  3M0Q A;  2MIO A;  4JPB W;  1M30 A;  4F17 A;  2HBW A;  2LQN A;  2JM8 A;  1NLP C;  2EYW A;  2GTJ A;  2G6F X;  2ROL A;  1MV3 A;  3I9Q A;  2HEQ A;  2EQI A;  2NWM A;  4F16 A;  2YT6 A;  2D8J A;  2E5K A;  2FPE A;  1GFD A;  1YN8 A;  1YWP A;  2O31 A;  1BU1 A;  3I5S A;  1GCQ A;  4QT7 A;  1V1C A;  4AFQ C;  4OMP A;  1JU5 C;  4JZ3 A;  1PKS A;  3M0P A;  2ESW A;  4JJB A;  1GRI A;  3EG1 A;  5L23 A;  2CUB A;  1WA7 A;  1FMK A;  2YUN A;  4DEX A;  3UF4 A;  1ABQ A;  2DLP A;  1E6G A;  1ZX6 A;  1S1N A;  1OPK A;  3I5R A;  4OMM A;  3A98 A;  4D8D A;  3M0S A;  2LCS A;  2JS0 A;  4K11 A;  1AWO A;  3VRY A;  1VYU A;  3H0H A;  1M3B A;  1PKT A;  1U06 A;  2RQV A;  3EG2 A;  1K1Z A;  2D0N A;  1SSH A;  2DRK A;  2J06 A;  2BZ8 A;  2D8H A;  2EKH A;  2QDL A;  2W10 A;  2MCN A;  1KIK A;  4ESR A;  1M3A A;  1K76 A;  2DYB A;  1QWE A;  4J9G A;  1AZE A;  1SHG A;  4AFS C;  1T0H A;  4AG1 C;  3VS1 A;  3VS7 A;  2HSP A;  1JXO A;  2CRE A;  1SPK A;  3PVQ A;  3H0I A;  1WDX A;  2DRM A;  2JW4 A;  2LJ1 A;  4HCK A;  4RTY A;  2LJ3 A;  2SEM A;  1GCP A;  2KR3 A;  1HSQ A;  2PNI A;  2C0I A;  2FPF A;  3ULR B;  1B3Q A;  4JZ4 A;  2DL7 A;  2XMF A;  2FPD A;  3SEM A;  4RTU A;  2B86 A;  1CSK A;  2CH4 W;  2EGE A;  1OV3 A;  2JXB A;  1E6H A;  1MV0 B;  4Z89 A;  1U3O A;  4J9B A;  1BB9 A;  2IIM A;  2BTT A;  2D1X A;  2OJ2 A;  1OPL A;  1QKW A;  1UTI A;  4EIK A;  1K0X A;  2JTE A;  4AFU C;  4E6R A;  1X6G A;  1CKB A;  4J9D A;  4OMQ A;  3RBB B;  5I11 A;  1ZUU A;  3GBQ A;  1UG1 A;  2RN8 A;  1NM7 A;  3M0T A;  2J6K A;  2V1Q A;  1NYG A;  2LMJ A;  1Y57 A;  2CT4 A;  1PHT A;  2CSI A;  1M8M A;  1WYX A;  1M3C A;  1E7O A;  1AWJ A;  1UE9 A;  2A36 A;  1IO6 A;  3UA6 A;  3O5Z A;  1GCQ C;  2FRY A;  2GGR A;  4J9C A;  1UDL A;  3PE0 A;  1K0S A;  4LUE A;  2VVK A;  4RTW A;  2DE0 X;  2GBQ A;  3VS0 A;  2J6F A;  2DL5 A;  2YUO A;  5IHN A;  2YSQ A;  4GLM A;  1NEG A;  3ZL7 C;  4R0K A;  2K79 A;  2JT4 A;  1XOV A;  2ED1 A;  4HVV A;  1AWW A;  1PWT A;  1PNJ A;  2DM1 A;  3M0U A;  1RLP C;  2PTK A;  3H0F A;  3EHQ A;  2A37 A;  2I0N A;  1NG2 A;  4M4Z A;  2YUQ A;  2JS2 A;  3TVT A;  4IIM A;  1YNZ A;  2ENM A;  2RQT A;  2C0T A;  2DVJ A;  4GBQ A;  2EVR A;  2BZX A;  1T0J A;  2KRN A;  1WI7 A;  1LCK A;  2F2V A;  2OAW A;  2EYX A;  3VS5 A;  4WCI A;  1X2Q A;  2EGC A;  2KT1 A;  2KT8 A;  5EC7 A;  1MUZ A;  4LN2 A;  4RTX A;  5FW9 A;  2EW3 A;  1JQQ A;  2CT3 A;  3R6N A;  5IXF A;  2DX1 A;  1GBR A;  3PVL A;  1PRM C;  2RQW A;  2RF0 A;  1PRL C;  4J9E A;  4A63 B;  1HD3 A;  4OML A;  2KYB A;  2OI3 A;  1X6B A;  2KXC A;  2O88 A;  2K2M A;  1K4U S;  3NPF A;  2SRC A;  1JXM A;  1YWO A;  1JEG A;  4RUG A;  1I07 A;  1RLQ C;  1UFF A;  1OOT A;  1G83 A;  2K3B A;  1BBZ A;  3VRZ A;  5IXB A;  2KXD A;  2AKK A;  1AVZ C;  2KGT A;  4FSS A;  2CUD A;  2JM9 A;  3EGU A;  2RPN A;  2W0Z A;  2O2O A;  3M0R A;  1NYF A;  4LUD A;  1VA7 A;  1N5Z A;  4ORZ A;  1TUC A;  2L2P A;  2EGA A;  2K9G A;  2GQI A;  1X27 A;  3THK A;  2PZ1 A;  1WX6 A;  4HVU A;  1AZG B;  5GJW B;  2JMA A;  2RQR A;  3I35 A;  1AEY A;  2EPD A;  4Y92 A;  2DJQ A;  1QKX A;  4JJC A;  3H41 A;  1JO8 A;  3QWY A;  1X43 A;  3KFV A;  2KRM A;  4J9F A;  1WXU A;  2O9S A;  4RTV A;  1W1F A;  1Z9Z A;  1OEB A;  2BZY A;  5HCK A;  2DL4 A;  1AD5 A;  2CDT A;  2H8H A;  1X69 A;  4RTZ A;  2L3S A;  2DNU A;  2K6D A;  1KSW A;  3JV3 A;  4CC3 A;  5ECA A;  5IHK A;  1H92 A;  2EBP A;  2P4R A;  1ARK A;  1RUW A;  1H8K A;  2A08 A;  2LJ0 A;  1U5S A;  4RTT A;  1TUD A;  3U23 A;  2NUZ A;  2JMC A;  1GFC A;  2HCK A;  2L3Q A;  4CC7 A;  2RNA A;  3QWX X;  4DEY A;  3REB B;  3VS2 A;  1FYN A;  1UHF A;  2FRW A;  4OMN A;  2DL8 A;  1SHF A;  4LNP A;  1J3T A;  1TG0 A;  4X1V A;  1I1J A;  2K7A A;  2LQW A;  4F14 A;  1VYT A;  1NEB A;  2LP5 A;  2O9V A;  1NLO C;  2J7I A;  1EFN A;  2KBT A;  3NHN A;  2J05 A;  2L3P A;  1WFW A;  2J6O A;  2F2W A;  1QWF A;  1ZSG A;  4AFZ C;  5IHI A;  2LNH B;  1G2B A;  4CC4 B;  3NMZ C;  3REA B;  2ECZ A;  3LH5 A;  1ZLM A;  1M27 C;  4LE9 A;  2VWF A;  4HXJ A;  2M0Y A;  2AZV A;  1VYV A;  1UGV A;  1X2K A;  3TSZ A;  3RNJ A;  1ZBJ A;  1T3S A;  2YUP A;  5FWC A;  2MOX A;  2LX7 A;  1Z9Q A;  1Y0M A;  2RMO A;  2L0A A;  3TSW A;  2DMO A;  3VS6 A;  1T3L A;  3CQT A;  1YP5 A;  3UA7 A;  4J9H A;  2GNC A;  3NGP A;  1UJ0 A;  1ZUK A;  1BK2 A;  1ZUY A;  2X3W D;  1AOJ A;  4OMO A;  2DL3 A;  2DBM A;  1YCS B;  2KYM A;  2CSQ A;  1GBQ A;  2DF6 A;  1SEM A;  1WIE A;  2M51 A;  4HVW A;  2KNB B;  1UHC A;  2RQU A;  2AKL A;  2YDL A;  1WXT A;  2FG0 A;  1UEC A;  2KEA A;  4D8K A;  2KRS A;  1CKA A;  1HJD A;  2A28 A;  2DA9 A;  2KE9 A;  1QCF A;  5IH2 A;  1B07 A;  2DBK A;  1H3H A;  2ABL A;  3C0C A;  4Z88 A;  4KRT A;  2F2X A;  2LZ6 B;  4J9I A;  1UJY A;  3SHW A;  1W6X A;  1SRL A;  2FEI A;  2CH4 A;  2HDA A;  3UAT A;  1QLY A;  2C0O A;  1SRM A;  1RI9 A;  4CC2 A;  3FJ5 A;  3EG0 A;  1GL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...