1YNZA

Sh3 domain of yeast pin3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'MEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pin3p
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ynzA00
4FSSA 4RTTA 1BU1A 1UECA 2ROLA 1QWEA 4X1VA 1KIKA 2A08A 2BZXA 1K4US 1ZX6A 4LNPA 1U3OA 4J9CA 2IIMA 1RI9A 1SPKA 1H92A 1H3HA 1OOTA 4OMQA 1UG1A 3M0SA 1MV0B 5IXFA 1G83A 1GFDA 2EYXA 1YNZA 2GTJA 1NM7A 1BB9A 2AZSA 2G6FX 2YDLA 1PNJA 4ZNXA 1WXUA 2YUOA 1U5SA 4J9GA 1RLQC 2RPNA 3JV3A 1JEGA 3THKA 1M3AA 4CC4B 1ABQA 1VA7A 2DF6A 2LP5A 3M0PA 2KBTA 1GBQA 2KXCA 1ZBJA 1VYVA 1PHTA 1HSQA 1HJDA 2MIOA 1JO8A 1SEMA 2K9GA 1NEBA 2LMJA 4LE9A 5GJWB 2V1QA 4AG1C 1NLOC 2EGCA 1NYGA 2XMFA 1WFWA 2BTTA 2W10A 1XOVA 2LCSA 1NEGA 2K2MA 2VWFA 3VS4A 2EKHA 3EG1A 2D1XA 1Z9QA 2K6DA 1X6GA 2DL3A 1SRLA 1NG2A 1TG0A 1K76A 3PVLA 1AZEA 2A36A 3UA7A 1G2BA 2BZ8A 1E6GA 1M8MA 3KFVA 2PNIA 4R0KA 1T3SA 1X2QA 2AKKA 1AWJA 4OMOA 1WI7A 2RF0A 1V1CA 2H8HA 4RTWA 2KYBA 3CQTA 4M4ZA 3SHWA 4AFQC 2C0IA 2K7AA 1GCQC 2DL5A 3VS1A 2RQWA 2YUPA 3H0IA 2DYBA 3M0QA 1SHGA 3VRYA 1UUEA 2L3SA 4LN2A 1X69A 1ABOA 3PVQA 1NLPC 4F16A 1VYUA 1JXOA 2KYMA 4ESRA 2DNUA 4RTXA 2O88A 3H0FA 1QKWA 1WXBA 2LNHB 1AWOA 1W1FA 1GCQA 1JQQA 2O31A 2B86A 1H8KA 2EYWA 3EHRA 1AWWA 1U06A 2L3PA 3ZL7C 3A98A 1QCFA 4Y92A 1OPLA 1B07A 2JM8A 1IO6A 2GQIA 2KXDA 1KJWA 1K0SA 4IIMA 2DVJA 4J9BA 3REBB 2GTOA 4Z88A 1TUDA 5EC7A 3VS6A 2LJ3A 1I0CA 4AFSC 1OV3A 4F17A 5HCKA 2FRYA 4GLMA 2JMAA 2LJ0A 2J06A 5IHNA 1B3QA 4JJDA 2LQNA 2OI3A 2A37A 2KT1A 1RUWA 4JPBW 2M51A 3NPFA 1CSKA 2EBPA 4J9DA 1K9AA 5FW9A 2FPFA 1UDLA 1UGVA 1ARKA 2KRNA 3EG2A 4EIKA 4OMMA 1AOJA 4J9IA 3EGUA 2FEIA 5IHKA 1UFFA 1W70A 3NMZC 1EFNA 2DL8A 1NYFA 4AFZC 2O2OA 1MUZA 2F2XA 1UE9A 2EYYA 2D0NA 1BBZA 5GJVB 4OMPA 4IIOA 2C0TA 5I22A 1CKBA 3RNJA 1W6XA 1YWPA 2CREA 2DBKA 4J9HA 4Z89A 2KE9A 4JJBA 1YCSB 2ED1A 3H0HA 2YUNA 1OPKA 1I1JA 2HCKA 1FYNA 2JTEA 1E6HA 2ABLA 1AWXA 4LUEA 2HBWA 3IQLA 2SEMA 2RQUA 4QT7A 2EW3A 2KNBB 2NUZA 1M3BA 1PKTA 4E6RA 1WDXA 1ZLMA 4ORZA 2JXBA 2CUDA 2EGEA 3H41A 2L2PA 4JZ4A 4RTUA 4OMNA 1UJ0A 5IH2A 2EQIA 2D8JA 4CC3A 1SHFA 3EG0A 2J6FA 1ZUUA 1TUCA 1HD3A 3M0UA 2DM1A 1WIEA 2DL7A 2FG0A 2LQWA 2ROTA 3UA6A 3U23A 3NHNA 2DRKA 2JW4A 1MV3A 1QLYA 1S1NA 2X3XD 1KSWA 1UTIA 2FRWA 2J7IA 2DRMA 2F2VA 2MOXA 1T0JA 4AG2C 3VS0A 4HVVA 4JZ3A 3RBBB 2CH4A 3PE0A 2CT3A 1KFZA 2FPDA 2FPEA 2J05A 5I11A 2YSQA 1PRMC 1E7OA 5ECAA 2LZ6B 2KRSA 2CUBA 2AKLA 1WXTA 4OMLA 2ECZA 2RQVA 3QWYA 4RTZA 2OAWA 1T3LA 1LCKA 1RLPC 4HCKA 3I9QA 1PWTA 2EVRA 3NGPA 2KGTA 1FMKA 1JU5C 3M0RA 3ULRB 2DILA 2L0AA 1SRMA 3EHQA 3M0TA 4D8KA 2KEAA 3VS5A 2LX7A 3LH5A 2DL4A 1PRLC 1QWFA 2KR3A 2CSQA 3C0CA 4GBQA 2QDLA 2RN8A 2JMCA 1I07A 4JJCA 2A28A 4K11A 2F2WA 1GBRA 2DMOA 1WYXA 1CKAA 1AVZC 1A0NB 1GFCA 1YWOA 1JXMA 2ED0A 4HVWA 2DX1A 2FO0A 4D8DA 2PTKA 2M0YA 1X27A 4Z8AA 1X6BA 2VKNA 2SRCA 1PKSA 3VS2A 3TSZA 2CT4A 1Y0MA 2JT4A 1BK2A 3FJ5A 2HSPA 2MCNA 2K79A 2RNAA 3I5SA 1VYTA 2J6OA 4DEXA 2GGRA 1J3TA 4KRTA 5L23A 2YT6A 5IXBA 4DEYA 1GRIA 1K1ZA 1OEBA 1AD5A 3TSWA 3QWXX 2CDTA 3SEMA 2DE0X 3GBQA 1WX6A 4RTYA 1UHCA 1SSHA 1M3CA 1Y57A 4F14A 1UHFA 1T0HA 2GNCA 4AFUC 1Z9ZA 4HVUA 2KT8A 2RMOA 5IHIA 2LJ1A 5FWBA 3I35A 2O9VA 4RUGA 1AZGB 2X3WD 4CC7A 2D8HA 2CH4W 3O5ZA 2EYZA 1QKXA 1YN8A 2KROA 4HXJA 2DBMA 2JS2A 2DA9A 2K3BA 2EPDA 2YUQA 2AK5A 1ZSGA 2O9SA 2J6KA 1GCPA 2V1RA 2VVKA 1K0XA 4J9FA 4LUDA 2C0OA 4WCIA 1ZUKA 2P4RA 2E5KA 4RTVA 4J9EA 2NWMA 4CC2A 3REAB 1GL5A 2AZVA 1X2KA 2W0ZA 3VRZA 5FWCA 2RQRA 3VS3A 2L3QA 3R6NA 2BZYA 1UJYA 2ESWA 1ZUYA 2DLPA 2JS0A 1YP5A 2DJQA 2OJ2A 1WLPB 2HEQA 2KRMA 1WA7A 2ENMA 2HDAA 3EG3A 1X43A 1M30A 3I5RA 2GBQA 1N5ZA 3TVTA 3VS7A 2CSIA 1M27C 2RQTA 4A63B 2EGAA 2I0NA 3UF4A 1AEYA 2JM9A 3UATA 2PZ1A
chains in the Genus database with same CATH superfamily
1D1BA 1BU1A 3H8ZA 2A08A 2BZXA 2CKKA 2BKDN 4E2FB 1VQ6Q 3DB3A 1RI9A 1OOTA 2QEXT 4OMQA 3HSBA 5IXFA 3GF5A 2AZSA 3V7SA 3CCMT 2P84A 2YDLA 2DETA 2YUOA 4KBMB 4E7ZA 4LDWA 1ABQA 2E41A 2KBTA 5KYYB 1MNDA 3CCST 2R58A 3JB9F 1OULA 2CP5A 2MIOA 1LPLA 1YI2A 3SWNA 3X28B 3OYIA 1G3WA 5GJWB 2GFAA 2V1QA 1QVGA 1B7TA 2YRVA 3CC7Q 4D6WA 1NYGA 3OW2S 2BTTA 2CP6A 2QEXA 2LCSA 3JCMb 3VS4A 2D1XA 4OMFB 4EMKC 1K73C 4A4HA 2RI2A 2C06A 1SRLA 1TG0A 2JZ2A 1PD0A 4Y28E 5GMKj 1K76A 1AZEA 3CCMA 2K4YA 3UA7A 4OB0B 2BZ8A 3OSVA 3VKIA 2ZZDA 1FX7A 4R0KA 1KQSP 2L5QA 1KK7A 1WI7A 2RF0A 1KC8C 3NTIA 2LRQA 4C92E 2CP0A 4C8QE 3VV0A 2E10A 2R5AA 2NYSA 2RK2A 3EGXB 3JCMc 1QCNA 2DYBA 1MGQA 2DIQA 5GAOl 3VRYA 1UUEA 2EJFA 3LWIA 2B8AA 1NBEB 2ZPIB 4JDSA 2VYTA 4BDYA 5GAMh 3C94A 1AWOA 1W1FA 1GCQA 2EJGA 3EHRA 4M7AA 2E3IA 1DJ7B 2EQKA 1VQMT 2EFIA 3A98A 1B07A 2OTLT 1Y96B 1W2BP 3MPUB 2LQKA 3GNGA 4IIMA 1I5OB 4MMKA 4A4FA 3L1AA 3VS6A 2AIRB 3JCMd 5HCKA 1ZBXA 5GAN7 5DLOA 5IHNA 3HP9A 1B3QA 4JJDA 2LQNA 2PU9B 1RUWA 2M51A 2FB7A 2ATCB 2KI7A 2EBPA 1U1TA 1Y07A 2FPFA 3OW2P 4WTOB 8ATCB 4M7DE 1KQ2A 1ARKA 2QGFB 1VQMA 2E4HA 4IKFA 4J9IA 1QVFS 4HA8A 4C0DB 3RDVA 3OYCA 1BI2A 2F2XA 3CC4A 3LW5E 4Z02A 3OSSC 1RAHB 4OMPA 4KGZB 2KVQG 2PVGB 3C95A 1CKBA 2YWWA 5FROA 3FDRA 1YWPA 1WGSA 4MMLA 1QVPA 4BB7A 3RKWA 2O4XB 4Z89A 4FU6A 4EDUA 2PVOB 1YJ9T 3QDFA 1NJIR 1I1JA 4FW2A 5GAMe 9ATCB 5GAMg 2ABLA 4JS5A 2R5MA 2RM4A 2SEMA 2PVDB 4ZN1A 2EW3A 1M1KR 2Y4YA 4J6WA 1PG5B 3CCLQ 3OYKA 1ZLMA 2JXBA 2CUDA 2NLUA 3H41A 2QI2A 2RK1A 2KY9A 4JZ4A 2DD5A 1EZZB 4FYWB 1QCOA 2JTMA 5FLXE 3F70A 1YCYA 1OU8A 3CCQT 3WVDB 4C0FA 2KQWA 4BUGA 3ZBDA 3EGDB 3M0UA 4EMKA 1WIEA 2ROTA 1YJ9A 3OW2A 3U23A 5DM7R 3NHNA 4X9DA 3P8BB 1PD1A 2HKQB 1S72T 2X3XD 1KSWA 3QSUA 1UTIA 4M77E 5KYWA 4ZTJA 3OQ5A 2MOXA 4PL6A 1T0JA 4XU2A 2KK4A 4ME7A 3MEUA 2LDMA 4PJOG 5I11A 3OB9A 4BACA 1E7OA 1IGQA 2LZ6B 2KRSA 2CUBA 4B6MA 4BY6C 4QQDA 4RTZA 3CCQA 3M59A 4TVRA 3LWHA 1BKBA 2COWA 2FL7A 2OAWA 1T3LA 1LCKA 2LTOA 2DAQA 3I9QA 5GAMf 4F04B 2WSCE 1Q82U 4XTXA 3NGPA 2KGTA 1FMKA 3ULRB 2DILA 1SRMA 2E12A 3CXCP 4ZN3A 4PFPA 5C6SA 1WHJA 3CCMQ 2LX7A 3UPUA 2KR3A 4GY5A 1WHGA 2GFUA 5D7UA 4C92G 2QYZA 4FYYB 2XG8D 4JJCA 3CCSQ 4XAXB 4N4HA 1ZSZC 1AVZC 2E64A 1Q81R 1RADB 4RG8A 2HNIA 4QQ6A 4J83A 4X9CA 2FO0A 4D8DA 2PTKA 1SF9A 5FU6C 3RR6A 5CO7A 3EFSA 2XI9A 4BI4A 1PM3A 3OMGA 4O6JA 3TSZA 4LDYA 3VYHB 3MJXA 4E7JA 3PIOA 5C0MA 1BK2A 2MCNA 3R6OA 1M90U 1QVFA 2RJDA 4KUDK 1V76A 2RH2A 4EPCA 4JRPA 1VYTA 3FEOA 3EH2A 4KRTA 1RABB 7AT1B 2YT6A 5CKBA 1Q86R 1AD5A 4FIBA 3QWXX 4XTZA 2DE0X 4M78D 4LD6A 2XD0A 2PUKB 4PNOA 4PFOA 4L6V5 1UHFA 3QG1A 2HQEA 5LJ3h 4C92F 2KT8A 4PJMA 4C8QF 2LJ1A 3I35A 4MDWA 1YJNT 4M7DG 3HL8A 2CH4W 4HXJA 1VQMQ 2QK0A 4ZGEB 1TXQA 2RJCA 1EX4A 2OTLQ 2EPDA 1D3BA 2AK5A 5CKHA 2O9SA 4EMHA 4NOYA 4M7AD 2E5KA 4C92B 1OI1A 2X35A 4C8QB 2AZVA 2RQRA 4FW1A 1UJYA 3L2UA 2JS0A 1YP5A 2PQWA 2OJ2A 5LJ5d 4F7UE 5CK9A 4QKUA 1X75C 2Y90A 3BFMA 2COYA 3VS7A 3ME9A 2COZA 4A63B 1K73U 1AEYA 1RAGB 1WHKA 4E7HA 1KHCA 4FSSA 1UECA 2ROLA 1QWEA 5CVIA 1VQKA 3JCMV 5GAMj 1K9MR 4C0ZA 4M7DF 4J9CA 2IIMA 1QVGS 2QA4T 1TSFA 5LJ3e 1YFNA 5LJ3g 1YJWT 1JBMA 1MV0B 4OVAA 3SWNC 2EYXA 2QAZA 2GTJA 2PUOB 4BD3A 1NM7A 3JB9J 1BB9A 5KYXA 5KYNA 2ZCFB 1PNJA 3CCUA 4RCCA 1NPRA 4J9GA 1VIFA 3JV3A 2ZGWA 3THKA 4OP0A 4M7DB 4RG2A 4CC4B 3OY9A 1VA7A 2LP5A 3M0PA 1NZ9A 1ZBJA 1VYVA 2X4XA 1PHTA 3EFRA 3ZEHA 5I21A 1D0XA 3CCQQ 1R0BG 4M75A 4KUIA 3A8MB 4M78C 1RACB 6AT1B 3G6EQ 2QA4A 1XOVA 2QDYB 3LYIA 2EKHA 4MZTA 3EG1A 3KUFA 1YJWA 1Z9QA 4LD9K 1S72Q 5KE3A 2HL5C 1MMGA 3QYGB 3MHXA 3GPLA 3KFVA 1VQLT 1RAIB 3V7CA 4QQGA 1QP3A 1VQ4Q 1AWJA 4OMOA 1V1CA 2H8HA 4JS4A 4E7IA 4N4IA 3SHWA 3PMIA 4AFQC 2C0IA 2K7AA 1GCQC 4M7AC 1VQ7T 4FYVB 3BDUA 2RQWA 1TH7A 3A8GB 3JCMP 1RAEB 3H0IA 5LJ3f 3JCMX 1SHGA 3CPWS 1VOMA 4PJJA 1WQ7A 1BIBA 4JLIA 1JXOA 3OS5A 2DNUA 2HQHA 3D7SB 1M90C 4RTXA 3EFOA 3H0FA 1QKWA 1QVGP 2H3JA 1JQQA 2O31A 1AWWA 4M77B 5LJ5h 1OPLA 1M4ZA 3QZ9B 2JM8A 2Y4XA 2E5QA 4IUQA 1WHLA 3S6WA 2GQIA 4AMCA 1KJWA 1K0SA 2K3YA 2DVJA 4J9BA 1VQ7A 2FHDA 4E7LA 2GTOA 4J5YA 3HRSA 1OV3A 1K9MC 4GLMA 1BIAA 4XK8E 4PLIA 1YI2T 2J06A 1ZA2B 2DO3A 4JPBW 5LL6S 4JRIA 4MDXA 3OYEA 1UDLA 1UGVA 2EQMA 4EIKA 1D09B 4C5GA 3FIFA 2XDDA 1KHIA 3M9QA 4PJOE 2D0NA 1BBZA 1PCXA 5GJVB 1YIJT 3E19A 2QGGA 1MMNA 4IIOA 3MO8A 3RNJA 2XDBA 2NUPB 1OU9A 3QXEB 3G71T 3EG9A 4JJBA 1D0YA 3H0HA 1OPKA 2DZ9A 2JTEA 2QTVA 4F7UG 1AWXA 3CPWP 3CCJT 5LJ5e 1M2VA 5LJ5g 1YJNQ 1VQ9T 3HRUA 1Y71A 3FB9A 4PFZA 1IZ6A 1M8VA 5IH2A 2EQIA 4M78A 1YIJA 5GMKm 3EG0A 2J6FA 1ZUUA 1TUCA 4ZGDB 2RHYA 4BDZA 3VJPA 1QW1A 3RKXA 3G71A 3OYYA 2VXFA 2ZPBB 1K8AR 2FG0A 5KYUA 1OZ3A 5GAN4 2F1LA 3QJYA 5GANd 3LX7A 2FRWA 3CCJA 3OS0A 1OYXA 3MP6A 3VS0A 1VQ9A 4HVVA 2HBPA 1G3TA 3OYLA 2CT3A 2DTHA 1KFZA 2NUTA 2FPEA 4Y91A 3OMCA 4KGVB 2J05A 2YSQA 1QQJA 2QTXA 1NJIU 5CQYA 2AKLA 1AHJB 2RQVA 5LJ3j 4F7UF 3CC4T 4A53A 1M1KU 2XU8A 5A0DA 1RLPC 3OBWA 3FC3A 2EJ9A 3CMEA 3TU4K 3CPWA 3E1SA 2QA4Q 5GAOq 1C1AA 2M0OA 4L59A 2CZ6B 2L0AA 2QQ9A 1YJWQ 3G4ST 2BIVA 4A4EA 4D8KA 3CMAT 1UGRB 2VC8A 3INZA 2KEAA 2HAXA 4F7UB 1OX9A 4HT9A 1QWFA 2XK0A 4M7AE 1N8RR 1NE8A 2CZ7B 2BE7D 2ZPHB 5D6XA 3TCJA 1Q7YU 3FLGA 4K11A 4QW2A 4RKUE 2GQVA 1GBRA 1LOJA 2OAUA 5CCAA 2DMOA 5CR2A 1WYXA 1CKAA 2QQRA 1YWOA 2JVVA 1BI3A 3WVEB 2ED0A 2M0YA 1X27A 3G4SA 1VQ5A 3CMAA 2DVEA 2VKNA 3OYFA 3I56T 4M75D 1PKSA 1IREB 2K5LA 3CEYA 2LX9A 2JT4A 2DXUA 4DQ2A 1VQLQ 4R55A 2E6ZA 3I55T 3I5SA 3JRZA 3E9GA 4BY6B 4DEXA 3BW1A 4R56A 1VQOT 1B34A 1VQ7Q 1GXIE 5IXBA 4DEYA 1K1ZA 3KBGA 4FM4B 5GAN3 3TSWA 2CDTA 4BE0A 1PSFA 3GBQA 4HKEA 1HXDA 1JRIA 1Y57A 4JLGA 1T0HA 2GNCA 3JSCA 4NS5A 1Z9ZA 4HVUA 5GMKl 5IHIA 3I56A 1SG5A 1ACMB 3DKMA 2G3RA 2YRDA 1Q7YR 4CC7A 3ASKA 2I2LA 1YN8A 5KE2A 2A3LA 5GANh 1Q81U 1I5LA 3I55A 2RJFA 2K3BA 1QP2A 3PFSA 1RI0A 3JCMQ 4LUDA 3V8KA 5KCOA 1VQOA 3L2VA 1N27A 2WSEE 4RTVA 3CC2T 1VQPT 4J9EA 1X6OA 1QVFP 2DXBA 2QXFA 2W0ZA 1ZSZB 2QQSA 4B9XA 2L3QA 2BZYA 2ESWA 1FMWA 1YI2Q 3M56A 4HCZA 5FU6B 2DJQA 3OS1A 3A8OB 2HEQA 1WA7A 3EG3A 5KYYA 2QEXQ 3JCMh 2DYIA 3S3MA 1VQ8T 1Q86U 3DB4A 2RHIA 2VGMA 2CSIA 1KD1R 1M27C 4ATOA 2JM9A 2DTOA 2CP7A 3META 4MZMA 1YHQT 3UATA 3CC2A 1VQPA 4RTTA 1YIJQ 2K57A 2CP2A 1KIKA 1NPPA 1D0ZA 1XNIA 1ZX6A 2QQAA 5CAIA 1G8XA 4CRIA 4LNPA 3QBYA 1M2OA 1U3OA 5LJ5j 3MEVA 1H92A 2FZKB 1TTHB 1TUGB 3L2ZA 5CKEA 3OYHA 1R8OB 1YITT 3RUXA 2IVWA 1PSEA 2DPPB 3QO3A 4M75C 1YNZA 4PJOF 1VQ8A 3CCJQ 3CBOA 3L2RA 5GANe 1NJIC 5GANg 4ZNXA 4YTLA 1M5Q1 4MZPA 1VQ9Q 1U5SA 1HYOA 1RLQC 2RPNA 3A8HB 3HHTB 4PLLA 5GMKh 1JEGA 1M3AA 5HY6A 1M1KC 1GBQA 4C92D 1YHQA 3M4GA 4C8QD 4M78G 5IAYA 2YXYA 1ZHIA 2E3HA 1JO8A 4PJOB 1SEMA 2K9GA 1OZ2A 1XTDA 4LE9A 4AG1C 2XHCA 3KXTA 3BE3A 2EGCA 3MCAB 5KCHA 4N0AA 1NEGA 2K2MA 2VWFA 1IB8A 1Y96A 1YITA 3JCMe 3JCMg 3QKJA 1NG2A 3LGLA 5FU7B 1RAAB 2M16A 4KT0E 3T9NA 2KMTA 1K9MU 2A36A 1TOVA 1LVKA 1G2BA 2P0KA 3BY7A 2PNIA 3H6ZA 1Q7YC 5DY9A 1T3SA 2MK5A 2AKKA 4M7AG 4JJNK 1TU0B 4RTWA 3ER0A 3CQTA 4M4ZA 4E7SA 5IN1A 3OYGA 3FRNA 2D9TA 3VS1A 4CI0C 2RJEA 2V8IA 2YUPA 4EMGA 4L5GA 4OB1B 3CC4Q 2K2VA 1LNXA 1TWBA 2D0QB 3M0QA 3OYMA 3QJ6A 2DD4A 3SDZA 1VQKT 1G5VA 5A2QE 1YBYA 4IURA 2L3SA 4LN2A 1VYUA 4OB3B 4JUVA 4ESRA 3SWNB 3G4SQ 3CMAQ 3CCVT 4M78F 3HTRA 3X24B 2XDPA 2B86A 1H8KA 2EYWA 2O01E 3TREA 1U06A 3ZL7C 3OYDA 4Y92A 3GNFB 3PMTA 1P92A 1IO6A 3GP8A 2HD0A 2KXDA 1KD1C 3CCUT 3AT1B 1EIFA 2O4XA 5GMKi 1WJSA 3CBPA 5EG2A 1MMDA 4Z88A 2LC4A 5EC7A 1UB4A 3OYAA 5L8RE 4F17A 2FRYA 3JCMf 1WZOA 2LJ0A 1VQNT 4M7AF 3NPFA 2WACA 1H3ZA 3GOXA 1Q81C 3HFOA 4A4KA 3CCVA 5FW9A 1YJ9Q 3I56Q 4BE1A 1VIEA 4A4GA 2HL3A 3JCMW 5IHKA 3EGDA 4WF2A 1JJ2S 1UFFA 1EFNA 1NYFA 2O2OA 3I55Q 2P4TA 1UE9A 4C5HA 2EYYA 4C8QC 4M7AB 3URGA 2F5KA 1VQOQ 1W6XA 1I81A 3M55A 2CREA 3OYBA 2HKNA 2DBKA 4J9HA 2K5IA 2X4YA 1VQNA 3VUZA 2KE9A 1X01A 1Q86C 1YCSB 4VUBA 1E6HA 3RMSA 2HBWA 2E6NA 4M77D 4QT7A 2KNBB 4RCBA 3CCET 2IPOB 4OMNA 1MHNA 1UJ0A 4B9WA 2FVUA 1R0CB 2D8JA 2LQ8A 1SHFA 4ELYC 1HD3A 3VUBA 2DL7A 4HT8A 4M75E 3UA6A 2E70A 2L3RA 3A1PA 2JW4A 5GAOn 4J8OA 2H3EB 5GAOm 2DRMA 2F2VA 2HMAA 4A54A 5AT1B 2CGHA 1KC8R 1VQ8Q 4AG2C 2DFUA 4JZ3A 3RBBB 2CH4A 3J80E 2FPDA 2EQJA 3CCEA 3WXMB 2FZGB 3RERA 3RKYA 1FWZA 3BDLA 1G3SA 1PRMC 4BI8B 5ECAA 4OMLA 3QWYA 2E65A 1RAFB 4HCCA 4RMOA 1YHQQ 3J7AF 2GF7A 4FYXB 4OF1A 3QZ5B 2MI6A 3M57A 1FMVA 5GAMd 4HCKA 4BE2A 3X25B 4QVDA 5GANj 1KQSS 1Q95G 3EH1A 3EHQA 2VASA 4N4GA 1N9SA 2OX7A 4C5EA 3OYNA 2ZPEB 3UWNA 4EMKB 3VS5A 2VUBA 3JB9D 5D6WA 2F5TX 2JUFA 4XTVA 2DZCA 1K8AU 2M02A 1PC0A 4ELZC 2X4WA 2V26A 4GBQA 2QDLA 2FZCB 5KYWB 1I07A 2A28A 2LCLA 2F2WA 5GAN2 1UGSB 1G3YA 2QG9B 3UDCA 2ZPGB 4DBHA 4HVWA 1IRXA 2DX1A 3MEWA 1W2BS 2LNVA 2MWOA 3S3OA 5CQXA 4Z8AA 3QDRB 3RESA 4BI3A 4M77C 2SRCA 4JRKA 2OTJT 1IHWA 2CT4A 4C92A 4FCYA 2FYKA 4C8QA 1Y7XA 2HSPA 4XTWA 2K79A 3TQ7P 2RNAA 1JJ2A 3A8LB 4QVZA 2MYSA 3MP1A 2WSFE 2J6OA 3MKDA 2GGRA 2F69A 1GRIA 3OS2A 1M9SA 4DBRA 3SEMA 3C4SA 2ZAEA 1VUBA 3RMQA 1SSHA 2YLCA 1VQKQ 1N8RU 2DXTA 4LDXA 1M3CA 4F14A 3CMET 3CCRT 3M53A 4AFUC 2LT1A 5GAN8 3V8JA 3ZFJA 4E47A 2OTJA 4DOVA 2O9VA 4PKCC 3CCVQ 2X3WD 3O5ZA 2EYZA 2RO0A 3H9NA 3VYGA 1WJRA 3M58A 2DA9A 2RI5A 3CCSA 3OBYA 2YUQA 1ZSGA 3LH0A 1GCPA 3CCUQ 4J9FA 3LGFA 4WCIA 2P4RA 2JOYA 2NWMA 4CC2A 2L89A 3REAB 4M78E 2XKOC 1X2KA 3VRZA 5FWCA 3VS3A 4XU0A 2JN0A 3CCRA 1VQNQ 1TS9A 1BCOA 3L2WA 4M7DA 1WLPB 3NTHA 1R77A 2ENMA 2HDAA 1RL2A 1X43A 5LJ5f 1M30A 4XU1A 1UGPB 4C0GA 2GBQA 1VQ5T 3PTAA 1N5ZA 1WHMA 3MP8A 3TVTA 2K5FA 2MMPA 2CZ1B 2RQTA 5FRNA 3UF4A 1D1CA 5FRMA 2BE9B 2RHXA 2XICA 4X1VA 1K4US 5I2SA 2KAFA 4NL2A 3SD4A 4C5IA 4DOWA 2D6FA 2M1HA 1D3BB 1SPKA 1H3HA 1UG1A 4M75G 1UGQB 3M0SA 1KQSA 2LVMA 3RIRA 1G83A 1GFDA 2V8JA 4LDVA 3DLMA 2OTLA 1V29B 2G6FX 1MMAA 2AHJB 4N0AC 1WXUA 2VGNA 1OQKA 5AYFA 2HZYA 3CCEQ 2DF6A 5CIUA 2KXCA 4V2SA 3A5ZB 1H641 1HSQA 3CXCS 1HJDA 3SFMA 3JCMJ 1KG1A 1NEBA 2LMJA 1NLOC 3EAEA 2XMFA 1WFWA 1C0MA 3SB2A 2W10A 4IUVA 4M77A 1KD1U 2Z0WA 1JB0E 1BYMA 4X34A 2K6DA 1F1BB 3PGGA 8AT1B 2VXEA 1X6GA 4AT1B 1W2BA 2DL3A 2BUDA 1K8AC 3PVLA 5IT9E 1C6VX 1E6GA 1ZA1B 1M8MA 2CS7A 5KH6A 4XU3A 4C0DC 1X2QA 2YRCA 3QUIA 3M54A 2KYBA 4KULA 4M75F 2RHZA 2CZ0B 2DL5A 5KYXB 3G6ET 3S3NA 1FXXA 2E1HA 5LJ3d 5HK3A 3P8DA 1HK9A 2YHTA 4UC4A 2QQBA 4KH1B 3GIBA 5HK0A 1SSFA 1IHVA 2LCCA 1X69A 1ABOA 3PVQA 1NLPC 4F16A 2KYMA 3X26B 3MEAA 1O9SA 4E7KA 2O88A 4M75B 3G1JA 1WXBA 2LNHB 3CPFA 1VQ4T 4J7FA 1WNLA 2L3PA 3E9FA 1QCFA 4O5VA 4FT4A 2NUPA 1BCMA 1WQWA 4IUUA 5CKDA 3CD6T 5CKFA 2VB6A 1M1FA 3G6EA 3REBB 4PJOD 2MF2A 1W4SA 2JJ9A 1N8RC 1TUDA 2LJ3A 1I0CA 4AFSC 1S72A 2JMAA 3L42A 4J6XA 4XTYA 2OI3A 2A37A 2KT1A 5M9OA 5GAOp 3G71Q 1CSKA 4J9DA 4XQ3A 3L2QA 2CYZB 1K9AA 2X51A 1VQ4A 2DERA 2KRNA 2OTJQ 1WJQA 1IXDA 3EG2A 2DEUA 4OMMA 1AOJA 3C12A 3P8HA 2JTFA 3EGUA 2FEIA 4IUPA 1W70A 3NMZC 2V8KA 2A0FB 2DL8A 4C8QG 3EGXA 4AFZC 5J26A 3CD6A 2RA2A 2RD1A 1MUZA 2RHUA 2X4JA 3EFOB 4P5NA 2AT1B 3JAME 2C0TA 3X20B 2CP3A 3NFCA 5I22A 5DLQE 1VQ6T 4KH0B 4FSXA 2ED1A 2YUNA 3CMEQ 3CCRQ 2HCKA 1FYNA 4LUEA 3IQLA 4DBQA 2RQUA 1BI0A 1BI1A 1U1SA 2NUZA 1M3BA 1PKTA 1QMCA 1WDXA 4E6RA 4ORZA 1KQ1A 2EGEA 5J3BA 1Q82R 2L2PA 4RTUA 4CC3A 2KSSA 4QVCA 3CXCA 1I8FA 2EAYA 2M9UA 2DTIA 4HCBA 2ZPFB 3CC7T 1VQ6A 2DM1A 3TEEA 4F7UA 3HRTA 2LQWA 2X9HA 3GLXA 2DRKA 3UT1A 1MV3A 1QLYA 3JB9I 1S1NA 2QASA 2EYQA 2J7IA 3JB9H 5GANf 2HSEB 4FT2A 2IG0A 3PE0A 1VQ5Q 3EG9B 2EQUA 1UEBA 2MAMA 4XTUA 2XIDA 5GMKe 4M7DD 3HFNA 3J81E 1SKUB 1WXTA 2EIFA 2ECZA 2RI3A 4PJOC 1M2VB 1N9RA 2MPXC 4JRQA 3CC7A 3HPWA 1WPYA 1PWTA 1M90R 2EVRA 4M78B 5FU7C 1JU5C 3M0RA 3Q1JA 2P0QA 1YJNA 1O75A 3M0TA 3HKSA 1M1GA 1LJOA 2MWPA 1XQHA 3LLRA 5D6YA 3LH5A 2DL4A 1N6AA 4LXCA 1PRLC 5KYUB 4IUTA 2CSQA 3C0CA 1I4K1 2P0PA 2JMCA 2RN8A 4LDUA 2DJZA 2R57A 3PNWC 4C92C 5J39A 1KC8U 2NUTB 1OX8A 1A0NB 1GFCA 2EKOA 4DBFA 1JXMA 4NL3A 4M77G 4FL6A 1AT1B 3AHUA 4OB2B 1XJWB 1MNEA 1X6BA 2DK3A 3PT9A 3VS2A 4GLKA 1Y0MA 3FJ5A 1WHHA 1ZSZA 3DLLA 1Q82C 3QPHA 2DXCA 2GCXA 3M4YA 4ZGJB 2YLBA 1J3TA 2DKGA 5L23A 3FJPA 4PK4A 1OEBA 2A7YA 2VV5A 3PIPA 2HQXA 5GAN5 3M5AA 3CC2Q 4J7IA 5GAOr 1VQPQ 1WX6A 4KGXB 4RTYA 1UHCA 5HKCA 1K73R 1U8RA 3QIIA 2LT4A 4J6YA 5A0LA 3CBMA 4PJLA 2RMOA 3QYHB 4DA4A 5FWBA 4RUGA 3CCLT 1AZGB 4ANJA 2D8HA 1QKXA 2KROA 2DIGA 3VU3C 3OA6A 2DBMA 3V8LA 2JS2A 4ZTFA 4M7DC 1IGUA 5GAN6 4II1A 2EWNA 2J6KA 3CD6Q 2V1RA 2VVKA 4M77F 2L8DA 1K0XA 2C0OA 4PJNA 1ZUKA 3NTKA 5A0GA 4OGEA 1GL5A 4OGCA 5I2MA 3V7RA 1JJ2P 3R6NA 1ZUYA 2DLPA 2DEQA 3E2UA 3OYJA 1D1AA 3JB9G 1B34B 3O8VA 3G7ZA 3QHSA 2KRMA 2KDSA 2RB6A 1VQLA 3CCLA 1YITQ 3I5RA 4PJOA 4Q5WA 2EGAA 2I0NA 2K3XA 1ZQ1A 2JNGA 3N5BB 2PZ1A
chains in the Genus database with same CATH topology
4FSSA 4RTTA 1BU1A 1UECA 2ROLA 1QWEA 4X1VA 1KIKA 2A08A 2BZXA 1K4US 1ZX6A 4LNPA 1U3OA 4J9CA 2IIMA 1RI9A 1SPKA 1H92A 1H3HA 1OOTA 4OMQA 1UG1A 3M0SA 1MV0B 5IXFA 1G83A 1GFDA 2EYXA 1YNZA 2GTJA 1NM7A 1BB9A 2AZSA 2G6FX 2YDLA 1PNJA 4ZNXA 1WXUA 2YUOA 1U5SA 4J9GA 1RLQC 2RPNA 3JV3A 1JEGA 3THKA 1M3AA 4CC4B 1ABQA 1VA7A 2DF6A 2LP5A 3M0PA 2KBTA 1GBQA 2KXCA 1ZBJA 1VYVA 1PHTA 1HSQA 1HJDA 2MIOA 1JO8A 1SEMA 2K9GA 1NEBA 2LMJA 4LE9A 5GJWB 2V1QA 4AG1C 1NLOC 2EGCA 1NYGA 2XMFA 1WFWA 2BTTA 2W10A 1XOVA 2LCSA 1NEGA 2K2MA 2VWFA 3VS4A 2EKHA 3EG1A 2D1XA 1Z9QA 2K6DA 1X6GA 2DL3A 1SRLA 1NG2A 1TG0A 1K76A 3PVLA 1AZEA 2A36A 3UA7A 1G2BA 2BZ8A 1E6GA 1M8MA 3KFVA 2PNIA 4R0KA 1T3SA 1X2QA 2AKKA 1AWJA 4OMOA 1WI7A 2RF0A 1V1CA 2H8HA 4RTWA 2KYBA 3CQTA 4M4ZA 3SHWA 4AFQC 2C0IA 2K7AA 1GCQC 2DL5A 3VS1A 2RQWA 2YUPA 3H0IA 2DYBA 3M0QA 1SHGA 3VRYA 1UUEA 2L3SA 4LN2A 1X69A 1ABOA 3PVQA 1NLPC 4F16A 1VYUA 1JXOA 2KYMA 4ESRA 2DNUA 4RTXA 2O88A 3H0FA 1QKWA 1WXBA 2LNHB 1AWOA 1W1FA 1GCQA 1JQQA 2O31A 2B86A 1H8KA 2EYWA 3EHRA 1AWWA 1U06A 2L3PA 3ZL7C 3A98A 1QCFA 4Y92A 1OPLA 1B07A 2JM8A 1IO6A 2GQIA 2KXDA 1KJWA 1K0SA 4IIMA 2DVJA 4J9BA 3REBB 2GTOA 4Z88A 1TUDA 5EC7A 3VS6A 2LJ3A 1I0CA 4AFSC 1OV3A 4F17A 5HCKA 2FRYA 4GLMA 2JMAA 2LJ0A 2J06A 5IHNA 1B3QA 4JJDA 2LQNA 2OI3A 2A37A 2KT1A 1RUWA 4JPBW 2M51A 3NPFA 1CSKA 2EBPA 4J9DA 1K9AA 5FW9A 2FPFA 1UDLA 1UGVA 1ARKA 2KRNA 3EG2A 4EIKA 4OMMA 1AOJA 4J9IA 3EGUA 2FEIA 5IHKA 1UFFA 1W70A 3NMZC 1EFNA 2DL8A 1NYFA 4AFZC 2O2OA 1MUZA 2F2XA 1UE9A 2EYYA 2D0NA 1BBZA 5GJVB 4OMPA 4IIOA 2C0TA 5I22A 1CKBA 3RNJA 1W6XA 1YWPA 2CREA 2DBKA 4J9HA 4Z89A 2KE9A 4JJBA 1YCSB 2ED1A 3H0HA 2YUNA 1OPKA 1I1JA 2HCKA 1FYNA 2JTEA 1E6HA 2ABLA 1AWXA 4LUEA 2HBWA 3IQLA 2SEMA 2RQUA 4QT7A 2EW3A 2KNBB 2NUZA 1M3BA 1PKTA 4E6RA 1WDXA 1ZLMA 4ORZA 2JXBA 2CUDA 2EGEA 3H41A 2L2PA 4JZ4A 4RTUA 4OMNA 1UJ0A 5IH2A 2EQIA 2D8JA 4CC3A 1SHFA 3EG0A 2J6FA 1ZUUA 1TUCA 1HD3A 3M0UA 2DM1A 1WIEA 2DL7A 2FG0A 2LQWA 2ROTA 3UA6A 3U23A 3NHNA 2DRKA 2JW4A 1MV3A 1QLYA 1S1NA 2X3XD 1KSWA 1UTIA 2FRWA 2J7IA 2DRMA 2F2VA 2MOXA 1T0JA 4AG2C 3VS0A 4HVVA 4JZ3A 3RBBB 2CH4A 3PE0A 2CT3A 1KFZA 2FPDA 2FPEA 2J05A 5I11A 2YSQA 1PRMC 1E7OA 5ECAA 2LZ6B 2KRSA 2CUBA 2AKLA 1WXTA 4OMLA 2ECZA 2RQVA 3QWYA 4RTZA 2OAWA 1T3LA 1LCKA 1RLPC 4HCKA 3I9QA 1PWTA 2EVRA 3NGPA 2KGTA 1FMKA 1JU5C 3M0RA 3ULRB 2DILA 2L0AA 1SRMA 3EHQA 3M0TA 4D8KA 2KEAA 3VS5A 2LX7A 3LH5A 2DL4A 1PRLC 1QWFA 2KR3A 2CSQA 3C0CA 4GBQA 2QDLA 2RN8A 2JMCA 1I07A 4JJCA 2A28A 4K11A 2F2WA 1GBRA 2DMOA 1WYXA 1CKAA 1AVZC 1A0NB 1GFCA 1YWOA 1JXMA 2ED0A 4HVWA 2DX1A 2FO0A 4D8DA 2PTKA 2M0YA 1X27A 4Z8AA 1X6BA 2VKNA 2SRCA 1PKSA 3VS2A 3TSZA 2CT4A 1Y0MA 2JT4A 1BK2A 3FJ5A 2HSPA 2MCNA 2K79A 2RNAA 3I5SA 1VYTA 2J6OA 4DEXA 2GGRA 1J3TA 4KRTA 5L23A 2YT6A 5IXBA 4DEYA 1GRIA 1K1ZA 1OEBA 1AD5A 3TSWA 3QWXX 2CDTA 3SEMA 2DE0X 3GBQA 1WX6A 4RTYA 1UHCA 1SSHA 1M3CA 1Y57A 4F14A 1UHFA 1T0HA 2GNCA 4AFUC 1Z9ZA 4HVUA 2KT8A 2RMOA 5IHIA 2LJ1A 5FWBA 3I35A 2O9VA 4RUGA 1AZGB 2X3WD 4CC7A 2D8HA 2CH4W 3O5ZA 2EYZA 1QKXA 1YN8A 2KROA 4HXJA 2DBMA 2JS2A 2DA9A 2K3BA 2EPDA 2YUQA 2AK5A 1ZSGA 2O9SA 2J6KA 1GCPA 2V1RA 2VVKA 1K0XA 4J9FA 4LUDA 2C0OA 4WCIA 1ZUKA 2P4RA 2E5KA 4RTVA 4J9EA 2NWMA 4CC2A 3REAB 1GL5A 2AZVA 1X2KA 2W0ZA 3VRZA 5FWCA 2RQRA 3VS3A 2L3QA 3R6NA 2BZYA 1UJYA 2ESWA 1ZUYA 2DLPA 2JS0A 1YP5A 2DJQA 2OJ2A 1WLPB 2HEQA 2KRMA 1WA7A 2ENMA 2HDAA 3EG3A 1X43A 1M30A 3I5RA 2GBQA 1N5ZA 3TVTA 3VS7A 2CSIA 1M27C 2RQTA 4A63B 2EGAA 2I0NA 3UF4A 1AEYA 2JM9A 3UATA 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSS A;  4RTT A;  1BU1 A;  1UEC A;  2ROL A;  1QWE A;  4X1V A;  1KIK A;  2A08 A;  2BZX A;  1K4U S;  1ZX6 A;  4LNP A;  1U3O A;  4J9C A;  2IIM A;  1RI9 A;  1SPK A;  1H92 A;  1H3H A;  1OOT A;  4OMQ A;  1UG1 A;  3M0S A;  1MV0 B;  5IXF A;  1G83 A;  1GFD A;  2EYX A;  1YNZ A;  2GTJ A;  1NM7 A;  1BB9 A;  2AZS A;  2G6F X;  2YDL A;  1PNJ A;  4ZNX A;  1WXU A;  2YUO A;  1U5S A;  4J9G A;  1RLQ C;  2RPN A;  3JV3 A;  1JEG A;  3THK A;  1M3A A;  4CC4 B;  1ABQ A;  1VA7 A;  2DF6 A;  2LP5 A;  3M0P A;  2KBT A;  1GBQ A;  2KXC A;  1ZBJ A;  1VYV A;  1PHT A;  1HSQ A;  1HJD A;  2MIO A;  1JO8 A;  1SEM A;  2K9G A;  1NEB A;  2LMJ A;  4LE9 A;  5GJW B;  2V1Q A;  4AG1 C;  1NLO C;  2EGC A;  1NYG A;  2XMF A;  1WFW A;  2BTT A;  2W10 A;  1XOV A;  2LCS A;  1NEG A;  2K2M A;  2VWF A;  3VS4 A;  2EKH A;  3EG1 A;  2D1X A;  1Z9Q A;  2K6D A;  1X6G A;  2DL3 A;  1SRL A;  1NG2 A;  1TG0 A;  1K76 A;  3PVL A;  1AZE A;  2A36 A;  3UA7 A;  1G2B A;  2BZ8 A;  1E6G A;  1M8M A;  3KFV A;  2PNI A;  4R0K A;  1T3S A;  1X2Q A;  2AKK A;  1AWJ A;  4OMO A;  1WI7 A;  2RF0 A;  1V1C A;  2H8H A;  4RTW A;  2KYB A;  3CQT A;  4M4Z A;  3SHW A;  4AFQ C;  2C0I A;  2K7A A;  1GCQ C;  2DL5 A;  3VS1 A;  2RQW A;  2YUP A;  3H0I A;  2DYB A;  3M0Q A;  1SHG A;  3VRY A;  1UUE A;  2L3S A;  4LN2 A;  1X69 A;  1ABO A;  3PVQ A;  1NLP C;  4F16 A;  1VYU A;  1JXO A;  2KYM A;  4ESR A;  2DNU A;  4RTX A;  2O88 A;  3H0F A;  1QKW A;  1WXB A;  2LNH B;  1AWO A;  1W1F A;  1GCQ A;  1JQQ A;  2O31 A;  2B86 A;  1H8K A;  2EYW A;  3EHR A;  1AWW A;  1U06 A;  2L3P A;  3ZL7 C;  3A98 A;  1QCF A;  4Y92 A;  1OPL A;  1B07 A;  2JM8 A;  1IO6 A;  2GQI A;  2KXD A;  1KJW A;  1K0S A;  4IIM A;  2DVJ A;  4J9B A;  3REB B;  2GTO A;  4Z88 A;  1TUD A;  5EC7 A;  3VS6 A;  2LJ3 A;  1I0C A;  4AFS C;  1OV3 A;  4F17 A;  5HCK A;  2FRY A;  4GLM A;  2JMA A;  2LJ0 A;  2J06 A;  5IHN A;  1B3Q A;  4JJD A;  2LQN A;  2OI3 A;  2A37 A;  2KT1 A;  1RUW A;  4JPB W;  2M51 A;  3NPF A;  1CSK A;  2EBP A;  4J9D A;  1K9A A;  5FW9 A;  2FPF A;  1UDL A;  1UGV A;  1ARK A;  2KRN A;  3EG2 A;  4EIK A;  4OMM A;  1AOJ A;  4J9I A;  3EGU A;  2FEI A;  5IHK A;  1UFF A;  1W70 A;  3NMZ C;  1EFN A;  2DL8 A;  1NYF A;  4AFZ C;  2O2O A;  1MUZ A;  2F2X A;  1UE9 A;  2EYY A;  2D0N A;  1BBZ A;  5GJV B;  4OMP A;  4IIO A;  2C0T A;  5I22 A;  1CKB A;  3RNJ A;  1W6X A;  1YWP A;  2CRE A;  2DBK A;  4J9H A;  4Z89 A;  2KE9 A;  4JJB A;  1YCS B;  2ED1 A;  3H0H A;  2YUN A;  1OPK A;  1I1J A;  2HCK A;  1FYN A;  2JTE A;  1E6H A;  2ABL A;  1AWX A;  4LUE A;  2HBW A;  3IQL A;  2SEM A;  2RQU A;  4QT7 A;  2EW3 A;  2KNB B;  2NUZ A;  1M3B A;  1PKT A;  4E6R A;  1WDX A;  1ZLM A;  4ORZ A;  2JXB A;  2CUD A;  2EGE A;  3H41 A;  2L2P A;  4JZ4 A;  4RTU A;  4OMN A;  1UJ0 A;  5IH2 A;  2EQI A;  2D8J A;  4CC3 A;  1SHF A;  3EG0 A;  2J6F A;  1ZUU A;  1TUC A;  1HD3 A;  3M0U A;  2DM1 A;  1WIE A;  2DL7 A;  2FG0 A;  2LQW A;  2ROT A;  3UA6 A;  3U23 A;  3NHN A;  2DRK A;  2JW4 A;  1MV3 A;  1QLY A;  1S1N A;  2X3X D;  1KSW A;  1UTI A;  2FRW A;  2J7I A;  2DRM A;  2F2V A;  2MOX A;  1T0J A;  4AG2 C;  3VS0 A;  4HVV A;  4JZ3 A;  3RBB B;  2CH4 A;  3PE0 A;  2CT3 A;  1KFZ A;  2FPD A;  2FPE A;  2J05 A;  5I11 A;  2YSQ A;  1PRM C;  1E7O A;  5ECA A;  2LZ6 B;  2KRS A;  2CUB A;  2AKL A;  1WXT A;  4OML A;  2ECZ A;  2RQV A;  3QWY A;  4RTZ A;  2OAW A;  1T3L A;  1LCK A;  1RLP C;  4HCK A;  3I9Q A;  1PWT A;  2EVR A;  3NGP A;  2KGT A;  1FMK A;  1JU5 C;  3M0R A;  3ULR B;  2DIL A;  2L0A A;  1SRM A;  3EHQ A;  3M0T A;  4D8K A;  2KEA A;  3VS5 A;  2LX7 A;  3LH5 A;  2DL4 A;  1PRL C;  1QWF A;  2KR3 A;  2CSQ A;  3C0C A;  4GBQ A;  2QDL A;  2RN8 A;  2JMC A;  1I07 A;  4JJC A;  2A28 A;  4K11 A;  2F2W A;  1GBR A;  2DMO A;  1WYX A;  1CKA A;  1AVZ C;  1A0N B;  1GFC A;  1YWO A;  1JXM A;  2ED0 A;  4HVW A;  2DX1 A;  2FO0 A;  4D8D A;  2PTK A;  2M0Y A;  1X27 A;  4Z8A A;  1X6B A;  2VKN A;  2SRC A;  1PKS A;  3VS2 A;  3TSZ A;  2CT4 A;  1Y0M A;  2JT4 A;  1BK2 A;  3FJ5 A;  2HSP A;  2MCN A;  2K79 A;  2RNA A;  3I5S A;  1VYT A;  2J6O A;  4DEX A;  2GGR A;  1J3T A;  4KRT A;  5L23 A;  2YT6 A;  5IXB A;  4DEY A;  1GRI A;  1K1Z A;  1OEB A;  1AD5 A;  3TSW A;  3QWX X;  2CDT A;  3SEM A;  2DE0 X;  3GBQ A;  1WX6 A;  4RTY A;  1UHC A;  1SSH A;  1M3C A;  1Y57 A;  4F14 A;  1UHF A;  1T0H A;  2GNC A;  4AFU C;  1Z9Z A;  4HVU A;  2KT8 A;  2RMO A;  5IHI A;  2LJ1 A;  5FWB A;  3I35 A;  2O9V A;  4RUG A;  1AZG B;  2X3W D;  4CC7 A;  2D8H A;  2CH4 W;  3O5Z A;  2EYZ A;  1QKX A;  1YN8 A;  2KRO A;  4HXJ A;  2DBM A;  2JS2 A;  2DA9 A;  2K3B A;  2EPD A;  2YUQ A;  2AK5 A;  1ZSG A;  2O9S A;  2J6K A;  1GCP A;  2V1R A;  2VVK A;  1K0X A;  4J9F A;  4LUD A;  2C0O A;  4WCI A;  1ZUK A;  2P4R A;  2E5K A;  4RTV A;  4J9E A;  2NWM A;  4CC2 A;  3REA B;  1GL5 A;  2AZV A;  1X2K A;  2W0Z A;  3VRZ A;  5FWC A;  2RQR A;  3VS3 A;  2L3Q A;  3R6N A;  2BZY A;  1UJY A;  2ESW A;  1ZUY A;  2DLP A;  2JS0 A;  1YP5 A;  2DJQ A;  2OJ2 A;  1WLP B;  2HEQ A;  2KRM A;  1WA7 A;  2ENM A;  2HDA A;  3EG3 A;  1X43 A;  1M30 A;  3I5R A;  2GBQ A;  1N5Z A;  3TVT A;  3VS7 A;  2CSI A;  1M27 C;  2RQT A;  4A63 B;  2EGA A;  2I0N A;  3UF4 A;  1AEY A;  2JM9 A;  3UAT A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 1D1B A;  1BU1 A;  3H8Z A;  2A08 A;  2BZX A;  2CKK A;  2BKD N;  4E2F B;  1VQ6 Q;  3DB3 A;  1RI9 A;  1OOT A;  2QEX T;  4OMQ A;  3HSB A;  5IXF A;  3GF5 A;  2AZS A;  3V7S A;  3CCM T;  2P84 A;  2YDL A;  2DET A;  2YUO A;  4KBM B;  4E7Z A;  4LDW A;  1ABQ A;  2E41 A;  2KBT A;  5KYY B;  1MND A;  3CCS T;  2R58 A;  3JB9 F;  1OUL A;  2CP5 A;  2MIO A;  1LPL A;  1YI2 A;  3SWN A;  3X28 B;  3OYI A;  1G3W A;  5GJW B;  2GFA A;  2V1Q A;  1QVG A;  1B7T A;  2YRV A;  3CC7 Q;  4D6W A;  1NYG A;  3OW2 S;  2BTT A;  2CP6 A;  2QEX A;  2LCS A;  3JCM b;  3VS4 A;  2D1X A;  4OMF B;  4EMK C;  1K73 C;  4A4H A;  2RI2 A;  2C06 A;  1SRL A;  1TG0 A;  2JZ2 A;  1PD0 A;  4Y28 E;  5GMK j;  1K76 A;  1AZE A;  3CCM A;  2K4Y A;  3UA7 A;  4OB0 B;  2BZ8 A;  3OSV A;  3VKI A;  2ZZD A;  1FX7 A;  4R0K A;  1KQS P;  2L5Q A;  1KK7 A;  1WI7 A;  2RF0 A;  1KC8 C;  3NTI A;  2LRQ A;  4C92 E;  2CP0 A;  4C8Q E;  3VV0 A;  2E10 A;  2R5A A;  2NYS A;  2RK2 A;  3EGX B;  3JCM c;  1QCN A;  2DYB A;  1MGQ A;  2DIQ A;  5GAO l;  3VRY A;  1UUE A;  2EJF A;  3LWI A;  2B8A A;  1NBE B;  2ZPI B;  4JDS A;  2VYT A;  4BDY A;  5GAM h;  3C94 A;  1AWO A;  1W1F A;  1GCQ A;  2EJG A;  3EHR A;  4M7A A;  2E3I A;  1DJ7 B;  2EQK A;  1VQM T;  2EFI A;  3A98 A;  1B07 A;  2OTL T;  1Y96 B;  1W2B P;  3MPU B;  2LQK A;  3GNG A;  4IIM A;  1I5O B;  4MMK A;  4A4F A;  3L1A A;  3VS6 A;  2AIR B;  3JCM d;  5HCK A;  1ZBX A;  5GAN 7;  5DLO A;  5IHN A;  3HP9 A;  1B3Q A;  4JJD A;  2LQN A;  2PU9 B;  1RUW A;  2M51 A;  2FB7 A;  2ATC B;  2KI7 A;  2EBP A;  1U1T A;  1Y07 A;  2FPF A;  3OW2 P;  4WTO B;  8ATC B;  4M7D E;  1KQ2 A;  1ARK A;  2QGF B;  1VQM A;  2E4H A;  4IKF A;  4J9I A;  1QVF S;  4HA8 A;  4C0D B;  3RDV A;  3OYC A;  1BI2 A;  2F2X A;  3CC4 A;  3LW5 E;  4Z02 A;  3OSS C;  1RAH B;  4OMP A;  4KGZ B;  2KVQ G;  2PVG B;  3C95 A;  1CKB A;  2YWW A;  5FRO A;  3FDR A;  1YWP A;  1WGS A;  4MML A;  1QVP A;  4BB7 A;  3RKW A;  2O4X B;  4Z89 A;  4FU6 A;  4EDU A;  2PVO B;  1YJ9 T;  3QDF A;  1NJI R;  1I1J A;  4FW2 A;  5GAM e;  9ATC B;  5GAM g;  2ABL A;  4JS5 A;  2R5M A;  2RM4 A;  2SEM A;  2PVD B;  4ZN1 A;  2EW3 A;  1M1K R;  2Y4Y A;  4J6W A;  1PG5 B;  3CCL Q;  3OYK A;  1ZLM A;  2JXB A;  2CUD A;  2NLU A;  3H41 A;  2QI2 A;  2RK1 A;  2KY9 A;  4JZ4 A;  2DD5 A;  1EZZ B;  4FYW B;  1QCO A;  2JTM A;  5FLX E;  3F70 A;  1YCY A;  1OU8 A;  3CCQ T;  3WVD B;  4C0F A;  2KQW A;  4BUG A;  3ZBD A;  3EGD B;  3M0U A;  4EMK A;  1WIE A;  2ROT A;  1YJ9 A;  3OW2 A;  3U23 A;  5DM7 R;  3NHN A;  4X9D A;  3P8B B;  1PD1 A;  2HKQ B;  1S72 T;  2X3X D;  1KSW A;  3QSU A;  1UTI A;  4M77 E;  5KYW A;  4ZTJ A;  3OQ5 A;  2MOX A;  4PL6 A;  1T0J A;  4XU2 A;  2KK4 A;  4ME7 A;  3MEU A;  2LDM A;  4PJO G;  5I11 A;  3OB9 A;  4BAC A;  1E7O A;  1IGQ A;  2LZ6 B;  2KRS A;  2CUB A;  4B6M A;  4BY6 C;  4QQD A;  4RTZ A;  3CCQ A;  3M59 A;  4TVR A;  3LWH A;  1BKB A;  2COW A;  2FL7 A;  2OAW A;  1T3L A;  1LCK A;  2LTO A;  2DAQ A;  3I9Q A;  5GAM f;  4F04 B;  2WSC E;  1Q82 U;  4XTX A;  3NGP A;  2KGT A;  1FMK A;  3ULR B;  2DIL A;  1SRM A;  2E12 A;  3CXC P;  4ZN3 A;  4PFP A;  5C6S A;  1WHJ A;  3CCM Q;  2LX7 A;  3UPU A;  2KR3 A;  4GY5 A;  1WHG A;  2GFU A;  5D7U A;  4C92 G;  2QYZ A;  4FYY B;  2XG8 D;  4JJC A;  3CCS Q;  4XAX B;  4N4H A;  1ZSZ C;  1AVZ C;  2E64 A;  1Q81 R;  1RAD B;  4RG8 A;  2HNI A;  4QQ6 A;  4J83 A;  4X9C A;  2FO0 A;  4D8D A;  2PTK A;  1SF9 A;  5FU6 C;  3RR6 A;  5CO7 A;  3EFS A;  2XI9 A;  4BI4 A;  1PM3 A;  3OMG A;  4O6J A;  3TSZ A;  4LDY A;  3VYH B;  3MJX A;  4E7J A;  3PIO A;  5C0M A;  1BK2 A;  2MCN A;  3R6O A;  1M90 U;  1QVF A;  2RJD A;  4KUD K;  1V76 A;  2RH2 A;  4EPC A;  4JRP A;  1VYT A;  3FEO A;  3EH2 A;  4KRT A;  1RAB B;  7AT1 B;  2YT6 A;  5CKB A;  1Q86 R;  1AD5 A;  4FIB A;  3QWX X;  4XTZ A;  2DE0 X;  4M78 D;  4LD6 A;  2XD0 A;  2PUK B;  4PNO A;  4PFO A;  4L6V 5;  1UHF A;  3QG1 A;  2HQE A;  5LJ3 h;  4C92 F;  2KT8 A;  4PJM A;  4C8Q F;  2LJ1 A;  3I35 A;  4MDW A;  1YJN T;  4M7D G;  3HL8 A;  2CH4 W;  4HXJ A;  1VQM Q;  2QK0 A;  4ZGE B;  1TXQ A;  2RJC A;  1EX4 A;  2OTL Q;  2EPD A;  1D3B A;  2AK5 A;  5CKH A;  2O9S A;  4EMH A;  4NOY A;  4M7A D;  2E5K A;  4C92 B;  1OI1 A;  2X35 A;  4C8Q B;  2AZV A;  2RQR A;  4FW1 A;  1UJY A;  3L2U A;  2JS0 A;  1YP5 A;  2PQW A;  2OJ2 A;  5LJ5 d;  4F7U E;  5CK9 A;  4QKU A;  1X75 C;  2Y90 A;  3BFM A;  2COY A;  3VS7 A;  3ME9 A;  2COZ A;  4A63 B;  1K73 U;  1AEY A;  1RAG B;  1WHK A;  4E7H A;  1KHC A;  4FSS A;  1UEC A;  2ROL A;  1QWE A;  5CVI A;  1VQK A;  3JCM V;  5GAM j;  1K9M R;  4C0Z A;  4M7D F;  4J9C A;  2IIM A;  1QVG S;  2QA4 T;  1TSF A;  5LJ3 e;  1YFN A;  5LJ3 g;  1YJW T;  1JBM A;  1MV0 B;  4OVA A;  3SWN C;  2EYX A;  2QAZ A;  2GTJ A;  2PUO B;  4BD3 A;  1NM7 A;  3JB9 J;  1BB9 A;  5KYX A;  5KYN A;  2ZCF B;  1PNJ A;  3CCU A;  4RCC A;  1NPR A;  4J9G A;  1VIF A;  3JV3 A;  2ZGW A;  3THK A;  4OP0 A;  4M7D B;  4RG2 A;  4CC4 B;  3OY9 A;  1VA7 A;  2LP5 A;  3M0P A;  1NZ9 A;  1ZBJ A;  1VYV A;  2X4X A;  1PHT A;  3EFR A;  3ZEH A;  5I21 A;  1D0X A;  3CCQ Q;  1R0B G;  4M75 A;  4KUI A;  3A8M B;  4M78 C;  1RAC B;  6AT1 B;  3G6E Q;  2QA4 A;  1XOV A;  2QDY B;  3LYI A;  2EKH A;  4MZT A;  3EG1 A;  3KUF A;  1YJW A;  1Z9Q A;  4LD9 K;  1S72 Q;  5KE3 A;  2HL5 C;  1MMG A;  3QYG B;  3MHX A;  3GPL A;  3KFV A;  1VQL T;  1RAI B;  3V7C A;  4QQG A;  1QP3 A;  1VQ4 Q;  1AWJ A;  4OMO A;  1V1C A;  2H8H A;  4JS4 A;  4E7I A;  4N4I A;  3SHW A;  3PMI A;  4AFQ C;  2C0I A;  2K7A A;  1GCQ C;  4M7A C;  1VQ7 T;  4FYV B;  3BDU A;  2RQW A;  1TH7 A;  3A8G B;  3JCM P;  1RAE B;  3H0I A;  5LJ3 f;  3JCM X;  1SHG A;  3CPW S;  1VOM A;  4PJJ A;  1WQ7 A;  1BIB A;  4JLI A;  1JXO A;  3OS5 A;  2DNU A;  2HQH A;  3D7S B;  1M90 C;  4RTX A;  3EFO A;  3H0F A;  1QKW A;  1QVG P;  2H3J A;  1JQQ A;  2O31 A;  1AWW A;  4M77 B;  5LJ5 h;  1OPL A;  1M4Z A;  3QZ9 B;  2JM8 A;  2Y4X A;  2E5Q A;  4IUQ A;  1WHL A;  3S6W A;  2GQI A;  4AMC A;  1KJW A;  1K0S A;  2K3Y A;  2DVJ A;  4J9B A;  1VQ7 A;  2FHD A;  4E7L A;  2GTO A;  4J5Y A;  3HRS A;  1OV3 A;  1K9M C;  4GLM A;  1BIA A;  4XK8 E;  4PLI A;  1YI2 T;  2J06 A;  1ZA2 B;  2DO3 A;  4JPB W;  5LL6 S;  4JRI A;  4MDX A;  3OYE A;  1UDL A;  1UGV A;  2EQM A;  4EIK A;  1D09 B;  4C5G A;  3FIF A;  2XDD A;  1KHI A;  3M9Q A;  4PJO E;  2D0N A;  1BBZ A;  1PCX A;  5GJV B;  1YIJ T;  3E19 A;  2QGG A;  1MMN A;  4IIO A;  3MO8 A;  3RNJ A;  2XDB A;  2NUP B;  1OU9 A;  3QXE B;  3G71 T;  3EG9 A;  4JJB A;  1D0Y A;  3H0H A;  1OPK A;  2DZ9 A;  2JTE A;  2QTV A;  4F7U G;  1AWX A;  3CPW P;  3CCJ T;  5LJ5 e;  1M2V A;  5LJ5 g;  1YJN Q;  1VQ9 T;  3HRU A;  1Y71 A;  3FB9 A;  4PFZ A;  1IZ6 A;  1M8V A;  5IH2 A;  2EQI A;  4M78 A;  1YIJ A;  5GMK m;  3EG0 A;  2J6F A;  1ZUU A;  1TUC A;  4ZGD B;  2RHY A;  4BDZ A;  3VJP A;  1QW1 A;  3RKX A;  3G71 A;  3OYY A;  2VXF A;  2ZPB B;  1K8A R;  2FG0 A;  5KYU A;  1OZ3 A;  5GAN 4;  2F1L A;  3QJY A;  5GAN d;  3LX7 A;  2FRW A;  3CCJ A;  3OS0 A;  1OYX A;  3MP6 A;  3VS0 A;  1VQ9 A;  4HVV A;  2HBP A;  1G3T A;  3OYL A;  2CT3 A;  2DTH A;  1KFZ A;  2NUT A;  2FPE A;  4Y91 A;  3OMC A;  4KGV B;  2J05 A;  2YSQ A;  1QQJ A;  2QTX A;  1NJI U;  5CQY A;  2AKL A;  1AHJ B;  2RQV A;  5LJ3 j;  4F7U F;  3CC4 T;  4A53 A;  1M1K U;  2XU8 A;  5A0D A;  1RLP C;  3OBW A;  3FC3 A;  2EJ9 A;  3CME A;  3TU4 K;  3CPW A;  3E1S A;  2QA4 Q;  5GAO q;  1C1A A;  2M0O A;  4L59 A;  2CZ6 B;  2L0A A;  2QQ9 A;  1YJW Q;  3G4S T;  2BIV A;  4A4E A;  4D8K A;  3CMA T;  1UGR B;  2VC8 A;  3INZ A;  2KEA A;  2HAX A;  4F7U B;  1OX9 A;  4HT9 A;  1QWF A;  2XK0 A;  4M7A E;  1N8R R;  1NE8 A;  2CZ7 B;  2BE7 D;  2ZPH B;  5D6X A;  3TCJ A;  1Q7Y U;  3FLG A;  4K11 A;  4QW2 A;  4RKU E;  2GQV A;  1GBR A;  1LOJ A;  2OAU A;  5CCA A;  2DMO A;  5CR2 A;  1WYX A;  1CKA A;  2QQR A;  1YWO A;  2JVV A;  1BI3 A;  3WVE B;  2ED0 A;  2M0Y A;  1X27 A;  3G4S A;  1VQ5 A;  3CMA A;  2DVE A;  2VKN A;  3OYF A;  3I56 T;  4M75 D;  1PKS A;  1IRE B;  2K5L A;  3CEY A;  2LX9 A;  2JT4 A;  2DXU A;  4DQ2 A;  1VQL Q;  4R55 A;  2E6Z A;  3I55 T;  3I5S A;  3JRZ A;  3E9G A;  4BY6 B;  4DEX A;  3BW1 A;  4R56 A;  1VQO T;  1B34 A;  1VQ7 Q;  1GXI E;  5IXB A;  4DEY A;  1K1Z A;  3KBG A;  4FM4 B;  5GAN 3;  3TSW A;  2CDT A;  4BE0 A;  1PSF A;  3GBQ A;  4HKE A;  1HXD A;  1JRI A;  1Y57 A;  4JLG A;  1T0H A;  2GNC A;  3JSC A;  4NS5 A;  1Z9Z A;  4HVU A;  5GMK l;  5IHI A;  3I56 A;  1SG5 A;  1ACM B;  3DKM A;  2G3R A;  2YRD A;  1Q7Y R;  4CC7 A;  3ASK A;  2I2L A;  1YN8 A;  5KE2 A;  2A3L A;  5GAN h;  1Q81 U;  1I5L A;  3I55 A;  2RJF A;  2K3B A;  1QP2 A;  3PFS A;  1RI0 A;  3JCM Q;  4LUD A;  3V8K A;  5KCO A;  1VQO A;  3L2V A;  1N27 A;  2WSE E;  4RTV A;  3CC2 T;  1VQP T;  4J9E A;  1X6O A;  1QVF P;  2DXB A;  2QXF A;  2W0Z A;  1ZSZ B;  2QQS A;  4B9X A;  2L3Q A;  2BZY A;  2ESW A;  1FMW A;  1YI2 Q;  3M56 A;  4HCZ A;  5FU6 B;  2DJQ A;  3OS1 A;  3A8O B;  2HEQ A;  1WA7 A;  3EG3 A;  5KYY A;  2QEX Q;  3JCM h;  2DYI A;  3S3M A;  1VQ8 T;  1Q86 U;  3DB4 A;  2RHI A;  2VGM A;  2CSI A;  1KD1 R;  1M27 C;  4ATO A;  2JM9 A;  2DTO A;  2CP7 A;  3MET A;  4MZM A;  1YHQ T;  3UAT A;  3CC2 A;  1VQP A;  4RTT A;  1YIJ Q;  2K57 A;  2CP2 A;  1KIK A;  1NPP A;  1D0Z A;  1XNI A;  1ZX6 A;  2QQA A;  5CAI A;  1G8X A;  4CRI A;  4LNP A;  3QBY A;  1M2O A;  1U3O A;  5LJ5 j;  3MEV A;  1H92 A;  2FZK B;  1TTH B;  1TUG B;  3L2Z A;  5CKE A;  3OYH A;  1R8O B;  1YIT T;  3RUX A;  2IVW A;  1PSE A;  2DPP B;  3QO3 A;  4M75 C;  1YNZ A;  4PJO F;  1VQ8 A;  3CCJ Q;  3CBO A;  3L2R A;  5GAN e;  1NJI C;  5GAN g;  4ZNX A;  4YTL A;  1M5Q 1;  4MZP A;  1VQ9 Q;  1U5S A;  1HYO A;  1RLQ C;  2RPN A;  3A8H B;  3HHT B;  4PLL A;  5GMK h;  1JEG A;  1M3A A;  5HY6 A;  1M1K C;  1GBQ A;  4C92 D;  1YHQ A;  3M4G A;  4C8Q D;  4M78 G;  5IAY A;  2YXY A;  1ZHI A;  2E3H A;  1JO8 A;  4PJO B;  1SEM A;  2K9G A;  1OZ2 A;  1XTD A;  4LE9 A;  4AG1 C;  2XHC A;  3KXT A;  3BE3 A;  2EGC A;  3MCA B;  5KCH A;  4N0A A;  1NEG A;  2K2M A;  2VWF A;  1IB8 A;  1Y96 A;  1YIT A;  3JCM e;  3JCM g;  3QKJ A;  1NG2 A;  3LGL A;  5FU7 B;  1RAA B;  2M16 A;  4KT0 E;  3T9N A;  2KMT A;  1K9M U;  2A36 A;  1TOV A;  1LVK A;  1G2B A;  2P0K A;  3BY7 A;  2PNI A;  3H6Z A;  1Q7Y C;  5DY9 A;  1T3S A;  2MK5 A;  2AKK A;  4M7A G;  4JJN K;  1TU0 B;  4RTW A;  3ER0 A;  3CQT A;  4M4Z A;  4E7S A;  5IN1 A;  3OYG A;  3FRN A;  2D9T A;  3VS1 A;  4CI0 C;  2RJE A;  2V8I A;  2YUP A;  4EMG A;  4L5G A;  4OB1 B;  3CC4 Q;  2K2V A;  1LNX A;  1TWB A;  2D0Q B;  3M0Q A;  3OYM A;  3QJ6 A;  2DD4 A;  3SDZ A;  1VQK T;  1G5V A;  5A2Q E;  1YBY A;  4IUR A;  2L3S A;  4LN2 A;  1VYU A;  4OB3 B;  4JUV A;  4ESR A;  3SWN B;  3G4S Q;  3CMA Q;  3CCV T;  4M78 F;  3HTR A;  3X24 B;  2XDP A;  2B86 A;  1H8K A;  2EYW A;  2O01 E;  3TRE A;  1U06 A;  3ZL7 C;  3OYD A;  4Y92 A;  3GNF B;  3PMT A;  1P92 A;  1IO6 A;  3GP8 A;  2HD0 A;  2KXD A;  1KD1 C;  3CCU T;  3AT1 B;  1EIF A;  2O4X A;  5GMK i;  1WJS A;  3CBP A;  5EG2 A;  1MMD A;  4Z88 A;  2LC4 A;  5EC7 A;  1UB4 A;  3OYA A;  5L8R E;  4F17 A;  2FRY A;  3JCM f;  1WZO A;  2LJ0 A;  1VQN T;  4M7A F;  3NPF A;  2WAC A;  1H3Z A;  3GOX A;  1Q81 C;  3HFO A;  4A4K A;  3CCV A;  5FW9 A;  1YJ9 Q;  3I56 Q;  4BE1 A;  1VIE A;  4A4G A;  2HL3 A;  3JCM W;  5IHK A;  3EGD A;  4WF2 A;  1JJ2 S;  1UFF A;  1EFN A;  1NYF A;  2O2O A;  3I55 Q;  2P4T A;  1UE9 A;  4C5H A;  2EYY A;  4C8Q C;  4M7A B;  3URG A;  2F5K A;  1VQO Q;  1W6X A;  1I81 A;  3M55 A;  2CRE A;  3OYB A;  2HKN A;  2DBK A;  4J9H A;  2K5I A;  2X4Y A;  1VQN A;  3VUZ A;  2KE9 A;  1X01 A;  1Q86 C;  1YCS B;  4VUB A;  1E6H A;  3RMS A;  2HBW A;  2E6N A;  4M77 D;  4QT7 A;  2KNB B;  4RCB A;  3CCE T;  2IPO B;  4OMN A;  1MHN A;  1UJ0 A;  4B9W A;  2FVU A;  1R0C B;  2D8J A;  2LQ8 A;  1SHF A;  4ELY C;  1HD3 A;  3VUB A;  2DL7 A;  4HT8 A;  4M75 E;  3UA6 A;  2E70 A;  2L3R A;  3A1P A;  2JW4 A;  5GAO n;  4J8O A;  2H3E B;  5GAO m;  2DRM A;  2F2V A;  2HMA A;  4A54 A;  5AT1 B;  2CGH A;  1KC8 R;  1VQ8 Q;  4AG2 C;  2DFU A;  4JZ3 A;  3RBB B;  2CH4 A;  3J80 E;  2FPD A;  2EQJ A;  3CCE A;  3WXM B;  2FZG B;  3RER A;  3RKY A;  1FWZ A;  3BDL A;  1G3S A;  1PRM C;  4BI8 B;  5ECA A;  4OML A;  3QWY A;  2E65 A;  1RAF B;  4HCC A;  4RMO A;  1YHQ Q;  3J7A F;  2GF7 A;  4FYX B;  4OF1 A;  3QZ5 B;  2MI6 A;  3M57 A;  1FMV A;  5GAM d;  4HCK A;  4BE2 A;  3X25 B;  4QVD A;  5GAN j;  1KQS S;  1Q95 G;  3EH1 A;  3EHQ A;  2VAS A;  4N4G A;  1N9S A;  2OX7 A;  4C5E A;  3OYN A;  2ZPE B;  3UWN A;  4EMK B;  3VS5 A;  2VUB A;  3JB9 D;  5D6W A;  2F5T X;  2JUF A;  4XTV A;  2DZC A;  1K8A U;  2M02 A;  1PC0 A;  4ELZ C;  2X4W A;  2V26 A;  4GBQ A;  2QDL A;  2FZC B;  5KYW B;  1I07 A;  2A28 A;  2LCL A;  2F2W A;  5GAN 2;  1UGS B;  1G3Y A;  2QG9 B;  3UDC A;  2ZPG B;  4DBH A;  4HVW A;  1IRX A;  2DX1 A;  3MEW A;  1W2B S;  2LNV A;  2MWO A;  3S3O A;  5CQX A;  4Z8A A;  3QDR B;  3RES A;  4BI3 A;  4M77 C;  2SRC A;  4JRK A;  2OTJ T;  1IHW A;  2CT4 A;  4C92 A;  4FCY A;  2FYK A;  4C8Q A;  1Y7X A;  2HSP A;  4XTW A;  2K79 A;  3TQ7 P;  2RNA A;  1JJ2 A;  3A8L B;  4QVZ A;  2MYS A;  3MP1 A;  2WSF E;  2J6O A;  3MKD A;  2GGR A;  2F69 A;  1GRI A;  3OS2 A;  1M9S A;  4DBR A;  3SEM A;  3C4S A;  2ZAE A;  1VUB A;  3RMQ A;  1SSH A;  2YLC A;  1VQK Q;  1N8R U;  2DXT A;  4LDX A;  1M3C A;  4F14 A;  3CME T;  3CCR T;  3M53 A;  4AFU C;  2LT1 A;  5GAN 8;  3V8J A;  3ZFJ A;  4E47 A;  2OTJ A;  4DOV A;  2O9V A;  4PKC C;  3CCV Q;  2X3W D;  3O5Z A;  2EYZ A;  2RO0 A;  3H9N A;  3VYG A;  1WJR A;  3M58 A;  2DA9 A;  2RI5 A;  3CCS A;  3OBY A;  2YUQ A;  1ZSG A;  3LH0 A;  1GCP A;  3CCU Q;  4J9F A;  3LGF A;  4WCI A;  2P4R A;  2JOY A;  2NWM A;  4CC2 A;  2L89 A;  3REA B;  4M78 E;  2XKO C;  1X2K A;  3VRZ A;  5FWC A;  3VS3 A;  4XU0 A;  2JN0 A;  3CCR A;  1VQN Q;  1TS9 A;  1BCO A;  3L2W A;  4M7D A;  1WLP B;  3NTH A;  1R77 A;  2ENM A;  2HDA A;  1RL2 A;  1X43 A;  5LJ5 f;  1M30 A;  4XU1 A;  1UGP B;  4C0G A;  2GBQ A;  1VQ5 T;  3PTA A;  1N5Z A;  1WHM A;  3MP8 A;  3TVT A;  2K5F A;  2MMP A;  2CZ1 B;  2RQT A;  5FRN A;  3UF4 A;  1D1C A;  5FRM A;  2BE9 B;  2RHX A;  2XIC A;  4X1V A;  1K4U S;  5I2S A;  2KAF A;  4NL2 A;  3SD4 A;  4C5I A;  4DOW A;  2D6F A;  2M1H A;  1D3B B;  1SPK A;  1H3H A;  1UG1 A;  4M75 G;  1UGQ B;  3M0S A;  1KQS A;  2LVM A;  3RIR A;  1G83 A;  1GFD A;  2V8J A;  4LDV A;  3DLM A;  2OTL A;  1V29 B;  2G6F X;  1MMA A;  2AHJ B;  4N0A C;  1WXU A;  2VGN A;  1OQK A;  5AYF A;  2HZY A;  3CCE Q;  2DF6 A;  5CIU A;  2KXC A;  4V2S A;  3A5Z B;  1H64 1;  1HSQ A;  3CXC S;  1HJD A;  3SFM A;  3JCM J;  1KG1 A;  1NEB A;  2LMJ A;  1NLO C;  3EAE A;  2XMF A;  1WFW A;  1C0M A;  3SB2 A;  2W10 A;  4IUV A;  4M77 A;  1KD1 U;  2Z0W A;  1JB0 E;  1BYM A;  4X34 A;  2K6D A;  1F1B B;  3PGG A;  8AT1 B;  2VXE A;  1X6G A;  4AT1 B;  1W2B A;  2DL3 A;  2BUD A;  1K8A C;  3PVL A;  5IT9 E;  1C6V X;  1E6G A;  1ZA1 B;  1M8M A;  2CS7 A;  5KH6 A;  4XU3 A;  4C0D C;  1X2Q A;  2YRC A;  3QUI A;  3M54 A;  2KYB A;  4KUL A;  4M75 F;  2RHZ A;  2CZ0 B;  2DL5 A;  5KYX B;  3G6E T;  3S3N A;  1FXX A;  2E1H A;  5LJ3 d;  5HK3 A;  3P8D A;  1HK9 A;  2YHT A;  4UC4 A;  2QQB A;  4KH1 B;  3GIB A;  5HK0 A;  1SSF A;  1IHV A;  2LCC A;  1X69 A;  1ABO A;  3PVQ A;  1NLP C;  4F16 A;  2KYM A;  3X26 B;  3MEA A;  1O9S A;  4E7K A;  2O88 A;  4M75 B;  3G1J A;  1WXB A;  2LNH B;  3CPF A;  1VQ4 T;  4J7F A;  1WNL A;  2L3P A;  3E9F A;  1QCF A;  4O5V A;  4FT4 A;  2NUP A;  1BCM A;  1WQW A;  4IUU A;  5CKD A;  3CD6 T;  5CKF A;  2VB6 A;  1M1F A;  3G6E A;  3REB B;  4PJO D;  2MF2 A;  1W4S A;  2JJ9 A;  1N8R C;  1TUD A;  2LJ3 A;  1I0C A;  4AFS C;  1S72 A;  2JMA A;  3L42 A;  4J6X A;  4XTY A;  2OI3 A;  2A37 A;  2KT1 A;  5M9O A;  5GAO p;  3G71 Q;  1CSK A;  4J9D A;  4XQ3 A;  3L2Q A;  2CYZ B;  1K9A A;  2X51 A;  1VQ4 A;  2DER A;  2KRN A;  2OTJ Q;  1WJQ A;  1IXD A;  3EG2 A;  2DEU A;  4OMM A;  1AOJ A;  3C12 A;  3P8H A;  2JTF A;  3EGU A;  2FEI A;  4IUP A;  1W70 A;  3NMZ C;  2V8K A;  2A0F B;  2DL8 A;  4C8Q G;  3EGX A;  4AFZ C;  5J26 A;  3CD6 A;  2RA2 A;  2RD1 A;  1MUZ A;  2RHU A;  2X4J A;  3EFO B;  4P5N A;  2AT1 B;  3JAM E;  2C0T A;  3X20 B;  2CP3 A;  3NFC A;  5I22 A;  5DLQ E;  1VQ6 T;  4KH0 B;  4FSX A;  2ED1 A;  2YUN A;  3CME Q;  3CCR Q;  2HCK A;  1FYN A;  4LUE A;  3IQL A;  4DBQ A;  2RQU A;  1BI0 A;  1BI1 A;  1U1S A;  2NUZ A;  1M3B A;  1PKT A;  1QMC A;  1WDX A;  4E6R A;  4ORZ A;  1KQ1 A;  2EGE A;  5J3B A;  1Q82 R;  2L2P A;  4RTU A;  4CC3 A;  2KSS A;  4QVC A;  3CXC A;  1I8F A;  2EAY A;  2M9U A;  2DTI A;  4HCB A;  2ZPF B;  3CC7 T;  1VQ6 A;  2DM1 A;  3TEE A;  4F7U A;  3HRT A;  2LQW A;  2X9H A;  3GLX A;  2DRK A;  3UT1 A;  1MV3 A;  1QLY A;  3JB9 I;  1S1N A;  2QAS A;  2EYQ A;  2J7I A;  3JB9 H;  5GAN f;  2HSE B;  4FT2 A;  2IG0 A;  3PE0 A;  1VQ5 Q;  3EG9 B;  2EQU A;  1UEB A;  2MAM A;  4XTU A;  2XID A;  5GMK e;  4M7D D;  3HFN A;  3J81 E;  1SKU B;  1WXT A;  2EIF A;  2ECZ A;  2RI3 A;  4PJO C;  1M2V B;  1N9R A;  2MPX C;  4JRQ A;  3CC7 A;  3HPW A;  1WPY A;  1PWT A;  1M90 R;  2EVR A;  4M78 B;  5FU7 C;  1JU5 C;  3M0R A;  3Q1J A;  2P0Q A;  1YJN A;  1O75 A;  3M0T A;  3HKS A;  1M1G A;  1LJO A;  2MWP A;  1XQH A;  3LLR A;  5D6Y A;  3LH5 A;  2DL4 A;  1N6A A;  4LXC A;  1PRL C;  5KYU B;  4IUT A;  2CSQ A;  3C0C A;  1I4K 1;  2P0P A;  2JMC A;  2RN8 A;  4LDU A;  2DJZ A;  2R57 A;  3PNW C;  4C92 C;  5J39 A;  1KC8 U;  2NUT B;  1OX8 A;  1A0N B;  1GFC A;  2EKO A;  4DBF A;  1JXM A;  4NL3 A;  4M77 G;  4FL6 A;  1AT1 B;  3AHU A;  4OB2 B;  1XJW B;  1MNE A;  1X6B A;  2DK3 A;  3PT9 A;  3VS2 A;  4GLK A;  1Y0M A;  3FJ5 A;  1WHH A;  1ZSZ A;  3DLL A;  1Q82 C;  3QPH A;  2DXC A;  2GCX A;  3M4Y A;  4ZGJ B;  2YLB A;  1J3T A;  2DKG A;  5L23 A;  3FJP A;  4PK4 A;  1OEB A;  2A7Y A;  2VV5 A;  3PIP A;  2HQX A;  5GAN 5;  3M5A A;  3CC2 Q;  4J7I A;  5GAO r;  1VQP Q;  1WX6 A;  4KGX B;  4RTY A;  1UHC A;  5HKC A;  1K73 R;  1U8R A;  3QII A;  2LT4 A;  4J6Y A;  5A0L A;  3CBM A;  4PJL A;  2RMO A;  3QYH B;  4DA4 A;  5FWB A;  4RUG A;  3CCL T;  1AZG B;  4ANJ A;  2D8H A;  1QKX A;  2KRO A;  2DIG A;  3VU3 C;  3OA6 A;  2DBM A;  3V8L A;  2JS2 A;  4ZTF A;  4M7D C;  1IGU A;  5GAN 6;  4II1 A;  2EWN A;  2J6K A;  3CD6 Q;  2V1R A;  2VVK A;  4M77 F;  2L8D A;  1K0X A;  2C0O A;  4PJN A;  1ZUK A;  3NTK A;  5A0G A;  4OGE A;  1GL5 A;  4OGC A;  5I2M A;  3V7R A;  1JJ2 P;  3R6N A;  1ZUY A;  2DLP A;  2DEQ A;  3E2U A;  3OYJ A;  1D1A A;  3JB9 G;  1B34 B;  3O8V A;  3G7Z A;  3QHS A;  2KRM A;  2KDS A;  2RB6 A;  1VQL A;  3CCL A;  1YIT Q;  3I5R A;  4PJO A;  4Q5W A;  2EGA A;  2I0N A;  2K3X A;  1ZQ1 A;  2JNG A;  3N5B B;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 4FSS A;  4RTT A;  1BU1 A;  1UEC A;  2ROL A;  1QWE A;  4X1V A;  1KIK A;  2A08 A;  2BZX A;  1K4U S;  1ZX6 A;  4LNP A;  1U3O A;  4J9C A;  2IIM A;  1RI9 A;  1SPK A;  1H92 A;  1H3H A;  1OOT A;  4OMQ A;  1UG1 A;  3M0S A;  1MV0 B;  5IXF A;  1G83 A;  1GFD A;  2EYX A;  1YNZ A;  2GTJ A;  1NM7 A;  1BB9 A;  2AZS A;  2G6F X;  2YDL A;  1PNJ A;  4ZNX A;  1WXU A;  2YUO A;  1U5S A;  4J9G A;  1RLQ C;  2RPN A;  3JV3 A;  1JEG A;  3THK A;  1M3A A;  4CC4 B;  1ABQ A;  1VA7 A;  2DF6 A;  2LP5 A;  3M0P A;  2KBT A;  1GBQ A;  2KXC A;  1ZBJ A;  1VYV A;  1PHT A;  1HSQ A;  1HJD A;  2MIO A;  1JO8 A;  1SEM A;  2K9G A;  1NEB A;  2LMJ A;  4LE9 A;  5GJW B;  2V1Q A;  4AG1 C;  1NLO C;  2EGC A;  1NYG A;  2XMF A;  1WFW A;  2BTT A;  2W10 A;  1XOV A;  2LCS A;  1NEG A;  2K2M A;  2VWF A;  3VS4 A;  2EKH A;  3EG1 A;  2D1X A;  1Z9Q A;  2K6D A;  1X6G A;  2DL3 A;  1SRL A;  1NG2 A;  1TG0 A;  1K76 A;  3PVL A;  1AZE A;  2A36 A;  3UA7 A;  1G2B A;  2BZ8 A;  1E6G A;  1M8M A;  3KFV A;  2PNI A;  4R0K A;  1T3S A;  1X2Q A;  2AKK A;  1AWJ A;  4OMO A;  1WI7 A;  2RF0 A;  1V1C A;  2H8H A;  4RTW A;  2KYB A;  3CQT A;  4M4Z A;  3SHW A;  4AFQ C;  2C0I A;  2K7A A;  1GCQ C;  2DL5 A;  3VS1 A;  2RQW A;  2YUP A;  3H0I A;  2DYB A;  3M0Q A;  1SHG A;  3VRY A;  1UUE A;  2L3S A;  4LN2 A;  1X69 A;  1ABO A;  3PVQ A;  1NLP C;  4F16 A;  1VYU A;  1JXO A;  2KYM A;  4ESR A;  2DNU A;  4RTX A;  2O88 A;  3H0F A;  1QKW A;  1WXB A;  2LNH B;  1AWO A;  1W1F A;  1GCQ A;  1JQQ A;  2O31 A;  2B86 A;  1H8K A;  2EYW A;  3EHR A;  1AWW A;  1U06 A;  2L3P A;  3ZL7 C;  3A98 A;  1QCF A;  4Y92 A;  1OPL A;  1B07 A;  2JM8 A;  1IO6 A;  2GQI A;  2KXD A;  1KJW A;  1K0S A;  4IIM A;  2DVJ A;  4J9B A;  3REB B;  2GTO A;  4Z88 A;  1TUD A;  5EC7 A;  3VS6 A;  2LJ3 A;  1I0C A;  4AFS C;  1OV3 A;  4F17 A;  5HCK A;  2FRY A;  4GLM A;  2JMA A;  2LJ0 A;  2J06 A;  5IHN A;  1B3Q A;  4JJD A;  2LQN A;  2OI3 A;  2A37 A;  2KT1 A;  1RUW A;  4JPB W;  2M51 A;  3NPF A;  1CSK A;  2EBP A;  4J9D A;  1K9A A;  5FW9 A;  2FPF A;  1UDL A;  1UGV A;  1ARK A;  2KRN A;  3EG2 A;  4EIK A;  4OMM A;  1AOJ A;  4J9I A;  3EGU A;  2FEI A;  5IHK A;  1UFF A;  1W70 A;  3NMZ C;  1EFN A;  2DL8 A;  1NYF A;  4AFZ C;  2O2O A;  1MUZ A;  2F2X A;  1UE9 A;  2EYY A;  2D0N A;  1BBZ A;  5GJV B;  4OMP A;  4IIO A;  2C0T A;  5I22 A;  1CKB A;  3RNJ A;  1W6X A;  1YWP A;  2CRE A;  2DBK A;  4J9H A;  4Z89 A;  2KE9 A;  4JJB A;  1YCS B;  2ED1 A;  3H0H A;  2YUN A;  1OPK A;  1I1J A;  2HCK A;  1FYN A;  2JTE A;  1E6H A;  2ABL A;  1AWX A;  4LUE A;  2HBW A;  3IQL A;  2SEM A;  2RQU A;  4QT7 A;  2EW3 A;  2KNB B;  2NUZ A;  1M3B A;  1PKT A;  4E6R A;  1WDX A;  1ZLM A;  4ORZ A;  2JXB A;  2CUD A;  2EGE A;  3H41 A;  2L2P A;  4JZ4 A;  4RTU A;  4OMN A;  1UJ0 A;  5IH2 A;  2EQI A;  2D8J A;  4CC3 A;  1SHF A;  3EG0 A;  2J6F A;  1ZUU A;  1TUC A;  1HD3 A;  3M0U A;  2DM1 A;  1WIE A;  2DL7 A;  2FG0 A;  2LQW A;  2ROT A;  3UA6 A;  3U23 A;  3NHN A;  2DRK A;  2JW4 A;  1MV3 A;  1QLY A;  1S1N A;  2X3X D;  1KSW A;  1UTI A;  2FRW A;  2J7I A;  2DRM A;  2F2V A;  2MOX A;  1T0J A;  4AG2 C;  3VS0 A;  4HVV A;  4JZ3 A;  3RBB B;  2CH4 A;  3PE0 A;  2CT3 A;  1KFZ A;  2FPD A;  2FPE A;  2J05 A;  5I11 A;  2YSQ A;  1PRM C;  1E7O A;  5ECA A;  2LZ6 B;  2KRS A;  2CUB A;  2AKL A;  1WXT A;  4OML A;  2ECZ A;  2RQV A;  3QWY A;  4RTZ A;  2OAW A;  1T3L A;  1LCK A;  1RLP C;  4HCK A;  3I9Q A;  1PWT A;  2EVR A;  3NGP A;  2KGT A;  1FMK A;  1JU5 C;  3M0R A;  3ULR B;  2DIL A;  2L0A A;  1SRM A;  3EHQ A;  3M0T A;  4D8K A;  2KEA A;  3VS5 A;  2LX7 A;  3LH5 A;  2DL4 A;  1PRL C;  1QWF A;  2KR3 A;  2CSQ A;  3C0C A;  4GBQ A;  2QDL A;  2RN8 A;  2JMC A;  1I07 A;  4JJC A;  2A28 A;  4K11 A;  2F2W A;  1GBR A;  2DMO A;  1WYX A;  1CKA A;  1AVZ C;  1A0N B;  1GFC A;  1YWO A;  1JXM A;  2ED0 A;  4HVW A;  2DX1 A;  2FO0 A;  4D8D A;  2PTK A;  2M0Y A;  1X27 A;  4Z8A A;  1X6B A;  2VKN A;  2SRC A;  1PKS A;  3VS2 A;  3TSZ A;  2CT4 A;  1Y0M A;  2JT4 A;  1BK2 A;  3FJ5 A;  2HSP A;  2MCN A;  2K79 A;  2RNA A;  3I5S A;  1VYT A;  2J6O A;  4DEX A;  2GGR A;  1J3T A;  4KRT A;  5L23 A;  2YT6 A;  5IXB A;  4DEY A;  1GRI A;  1K1Z A;  1OEB A;  1AD5 A;  3TSW A;  3QWX X;  2CDT A;  3SEM A;  2DE0 X;  3GBQ A;  1WX6 A;  4RTY A;  1UHC A;  1SSH A;  1M3C A;  1Y57 A;  4F14 A;  1UHF A;  1T0H A;  2GNC A;  4AFU C;  1Z9Z A;  4HVU A;  2KT8 A;  2RMO A;  5IHI A;  2LJ1 A;  5FWB A;  3I35 A;  2O9V A;  4RUG A;  1AZG B;  2X3W D;  4CC7 A;  2D8H A;  2CH4 W;  3O5Z A;  2EYZ A;  1QKX A;  1YN8 A;  2KRO A;  4HXJ A;  2DBM A;  2JS2 A;  2DA9 A;  2K3B A;  2EPD A;  2YUQ A;  2AK5 A;  1ZSG A;  2O9S A;  2J6K A;  1GCP A;  2V1R A;  2VVK A;  1K0X A;  4J9F A;  4LUD A;  2C0O A;  4WCI A;  1ZUK A;  2P4R A;  2E5K A;  4RTV A;  4J9E A;  2NWM A;  4CC2 A;  3REA B;  1GL5 A;  2AZV A;  1X2K A;  2W0Z A;  3VRZ A;  5FWC A;  2RQR A;  3VS3 A;  2L3Q A;  3R6N A;  2BZY A;  1UJY A;  2ESW A;  1ZUY A;  2DLP A;  2JS0 A;  1YP5 A;  2DJQ A;  2OJ2 A;  1WLP B;  2HEQ A;  2KRM A;  1WA7 A;  2ENM A;  2HDA A;  3EG3 A;  1X43 A;  1M30 A;  3I5R A;  2GBQ A;  1N5Z A;  3TVT A;  3VS7 A;  2CSI A;  1M27 C;  2RQT A;  4A63 B;  2EGA A;  2I0N A;  3UF4 A;  1AEY A;  2JM9 A;  3UAT A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...