1YNZA

Sh3 domain of yeast pin3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
MEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pin3p
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ynzA00
4AFQC 2KRNA 2GNCA 1H92A 4OMOA 1X27A 2D8JA 1QWEA 1WX6A 1M8MA 4RTTA 2EBPA 2GBQA 1RI9A 1NYGA 1SHGA 4JJBA 2RN8A 1WI7A 3I35A 5IHKA 3PE0A 2DL8A 1QWFA 1RLQC 4WCIA 5IH2A 1JU5C 4CC2A 1N5ZA 2CH4A 2ECZA 1WDXA 2EYZA 1PKSA 1X2KA 1CSKA 2V1RA 1UTIA 1FYNA 4J9GA 2JMAA 2LQNA 1OEBA 1FMKA 2CDTA 3EGUA 2RNAA 4J9BA 1AWWA 1JXOA 1M3AA 4LUEA 2BZYA 2LNHB 2DF6A 4ORZA 3SHWA 4D8DA 1UE9A 2KGTA 1IO6A 1X2QA 2KRMA 1SSHA 3VS2A 2AKKA 1PHTA 2KNBB 1VYTA 2HDAA 1K4US 2X3XD 1JO8A 1AOJA 3O5ZA 2M0YA 2P4RA 1QCFA 3CQTA 3QWYA 4D8KA 2NUZA 1SEMA 1GCPA 3I5RA 2KYBA 4AG2C 1Y57A 1GBRA 1W6XA 1RUWA 1ZLMA 2FPFA 5ECAA 3EG2A 1WXTA 2A37A 1ZX6A 4A63B 1X6GA 2DRMA 4CC4B 2DLPA 2EGAA 1T0HA 2PNIA 2DM1A 2BZXA 4HVWA 3NMZC 2DRKA 2B86A 2K7AA 1GBQA 2CUDA 2CSQA 1HD3A 1NYFA 2DA9A 2YSQA 2CH4W 1I0CA 2JMCA 4K11A 4J9DA 1M30A 2HBWA 1WXUA 3A98A 2GTOA 3M0QA 2YUNA 1LCKA 1NLPC 1KJWA 1OV3A 2J05A 4EIKA 1MV0B 2YUOA 3I5SA 4OMNA 4Z88A 3FJ5A 3THKA 1AZGB 1HSQA 3M0PA 2KT1A 1GCQA 1YWOA 2A28A 2L3SA 2O9VA 2EGEA 3VS1A 1UFFA 2O31A 1NEGA 3EG3A 1K9AA 2J06A 2L2PA 4J9IA 1J3TA 2K3BA 2DE0X 2KROA 2I0NA 5IXBA 3H41A 4RTYA 1ZBJA 5I22A 2JXBA 2LX7A 1I1JA 2CREA 1XOVA 2DYBA 4LE9A 1U5SA 1JQQA 1ZUUA 2AZVA 3TSZA 2J6KA 3M0SA 3RNJA 2IIMA 2JTEA 2KRSA 2DVJA 3VRYA 4OMPA 1OPKA 2KE9A 5IXFA 2DX1A 2RQUA 2RQTA 3GBQA 4ESRA 4JZ4A 3VS4A 1WLPB 1KFZA 2FEIA 2CUBA 2K6DA 1T3SA 3I9QA 2FRYA 2DBKA 2EYWA 2EPDA 1AD5A 1K1ZA 2VKNA 4J9CA 2RF0A 3EG1A 1PKTA 1GRIA 4DEYA 4J9FA 4JJCA 1I07A 1K0XA 3ZL7C 2DNUA 1E7OA 2AZSA 1A0NB 4AG1C 4OMQA 2FRWA 2JW4A 2A36A 3RBBB 2A08A 1QLYA 2DBMA 2KYMA 2JM9A 2W0ZA 1NEBA 1X69A 2O88A 1ZSGA 2KXCA 3NGPA 1KIKA 2GTJA 2C0IA 1RLPC 1ZUYA 2L3PA 4AFSC 1AEYA 5FWCA 4LN2A 1B07A 1UHCA 1PNJA 1H8KA 1Y0MA 1TUCA 2EYXA 4Z89A 1AVZC 4JPBW 2O2OA 1AWJA 3QWXX 1T0JA 2GQIA 4HXJA 3KFVA 4RUGA 2RPNA 2JS2A 2DMOA 2SRCA 4HCKA 3VRZA 1PRLC 2DL3A 3C0CA 2J7IA 3VS0A 1NLOC 1UGVA 1UHFA 1X6BA 3H0HA 3UATA 1QKXA 1WA7A 3IQLA 1BBZA 1K76A 1MUZA 1PRMC 3EG0A 4AFZC 4LUDA 4FSSA 1SRMA 1Z9QA 1ABQA 4RTXA 2AKLA 1WIEA 4DEXA 1YP5A 1SPKA 2HSPA 2FPEA 1UG1A 1BB9A 2AK5A 2LJ1A 1HJDA 2X3WD 3M0RA 2BTTA 2V1QA 2F2WA 2FPDA 2W10A 5EC7A 1K0SA 1AWOA 2F2VA 3M0TA 3H0FA 2RQVA 1SRLA 2M51A 1M3CA 1YNZA 2MOXA 1U3OA 5FW9A 4E6RA 2JM8A 3TSWA 1ZUKA 1X43A 1AWXA 4JJDA 2LQWA 2KR3A 3JV3A 4LNPA 1UECA 2C0TA 1YN8A 4Y92A 3VS5A 2BZ8A 2D0NA 2ESWA 4HVUA 1GCQC 1E6HA 2EKHA 1S1NA 2F2XA 2DL4A 4GLMA 1B3QA 4OMMA 3NHNA 3SEMA 3EHRA 1UJYA 1AZEA 4J9EA 1W1FA 3TVTA 4Z8AA 3UF4A 2PTKA 1VA7A 2GGRA 1G2BA 1YWPA 5IHIA 1JEGA 2EGCA 2JS0A 1GFCA 2DJQA 1T3LA 1UJ0A 1PWTA 4JZ3A 3VS6A 4RTZA 5L23A 1GL5A 1M27C 4CC3A 2YUPA 1WYXA 3PVLA 2L3QA 2EW3A 1OOTA 1U06A 2KT8A 2KXDA 1UUEA 2DILA 1H3HA 1OPLA 2O9SA 4HVVA 5I11A 4F14A 2ENMA 2ABLA 5IHNA 4OMLA 2K2MA 1ABOA 2C0OA 2CSIA 2KEAA 1MV3A 2RMOA 1E6GA 2RQWA 2QDLA 2OJ2A 4RTVA 4ZNXA 1QKWA 4F16A 4AFUC 2EQIA 3M0UA 5FWBA 1CKBA 1GFDA 1JXMA 1G83A 2XMFA 2FO0A 2SEMA 2DL5A 2ED1A 1SHFA 1TUDA 4KRTA 2J6FA 4RTWA 4J9HA 1V1CA 2VWFA 1BK2A 4X1VA 2YT6A 3U23A 4CC7A 3VS7A 3H0IA 1NG2A 2ROLA 1EFNA 2NWMA 4RTUA 2FG0A 1BU1A 1W70A 2YUQA 3LH5A 1VYVA 1TG0A 2D1XA 2CT3A 2G6FX 2LMJA 3VS3A 4IIMA 2LJ0A 3EHQA 2KBTA 1Z9ZA 2CT4A 1WFWA 1ARKA 1CKAA 2HEQA 2LJ3A 3NPFA 3PVQA 1WXBA 1M3BA 2HCKA 2K9GA 2LP5A 2ROTA 1KSWA 2K79A 2MIOA 3UA6A 2D8HA 3REAB 5HCKA 2JT4A 1VYUA 5GJWB 2ED0A 2DL7A 3R6NA 4M4ZA 3ULRB 2OAWA 2VVKA 2MCNA 2J6OA 4F17A 2LZ6B 2H8HA 2EVRA 2EYYA 1YCSB 2OI3A 2PZ1A 5GJVB 3UA7A 2YDLA 4IIOA 3REBB 1UDLA 1NM7A 4R0KA 4GBQA 2RQRA 2E5KA 2LCSA 4QT7A 2L0AA
chains in the Genus database with same CATH superfamily
1G3SA 4NS5A 2DXTA 1H92A 4OMOA 3VV0A 1U1SA 1X27A 3M9QA 1K8AU 3CMAQ 1M8MA 2EBPA 1RI9A 1VQ6Q 3FB9A 4M77C 3L2WA 2FZKB 2ZPEB 2DL8A 4A4KA 2ECZA 1PKSA 1X2KA 2LX9A 1LNXA 1TH7A 2V1RA 2L3RA 2JN0A 4C5GA 1NJIR 2JMAA 3FLGA 4JUVA 2A0FB 2RK2A 1OEBA 4M75C 2HNIA 2CDTA 2QA4Q 3RMSA 2GQVA 2OAUA 1M3AA 3CCLT 3G1JA 2DF6A 1QVFS 2FHDA 2KGTA 1X2QA 3GNGA 1VQNQ 3OS2A 1IGQA 2FVUA 5FU6B 5A0GA 3AT1B 1PHTA 2K57A 3EAEA 3G71Q 2DFUA 1AOJA 3EG9B 2H3JA 3OYMA 2DETA 4KBMB 4M7AB 2M0YA 3RIRA 2P4RA 1SEMA 4QKUA 3I5RA 3VYHB 3JSCA 1PM3A 4J6XA 1Y57A 3HTRA 1W6XA 1RUWA 4J83A 3X25B 4QVCA 3ZBDA 2PUKB 1WJRA 5ECAA 3CC7A 2DRMA 2GCXA 2DLPA 5KCOA 1M2VB 4HVWA 2HSEB 3OA6A 2K7AA 1Y07A 2LTOA 1NYFA 3MJXA 4C92C 2CH4W 1I0CA 3E19A 3PIOA 2E3IA 4PFZA 2GTOA 2E6NA 3G6ET 1QCOA 2HL5C 4MMLA 1KJWA 4O6JA 1FX7A 4EIKA 3FJ5A 3THKA 1AZGB 2A28A 5D7UA 3VS1A 3M54A 2O31A 3OW2A 2BKDN 1J3TA 3V8KA 2K3BA 2KROA 3I56A 1VUBA 2JXBA 1OX9A 4E7HA 1S72A 1XOVA 2DYBA 1JQQA 3NFCA 1YIJA 1JBMA 2OTJT 2J6KA 4PJOF 5I2SA 1VQLA 3HFOA 4KT0E 5CKDA 3CCJT 2DVJA 5IT9E 1SKUB 5HY6A 2OTLA 3EFRA 1Q82U 1KQ2A 2DX1A 1VQ9T 4ESRA 2RH2A 1G3TA 3VKIA 3OBWA 3F70A 2FRYA 2EYWA 1VQ7T 3MO8A 4KGZB 1PKTA 1RAGB 1GRIA 3V7CA 3CC7Q 4J7FA 4JJCA 4Q5WA 2MWPA 4AG1C 4OMQA 3CC4A 1D3BB 2A36A 9ATCB 1I81A 3M56A 4IUVA 2DBMA 2JM9A 5AYFA 1BI3A 4C0DC 2GTJA 2DJZA 1VQ5A 1RLPC 2L3PA 2DPPB 4ANJA 3CCQT 1B07A 1UHCA 2YHTA 4BY6C 2X51A 3CMAT 1H8KA 8AT1B 1AVZC 4C5EA 1N9SA 1VQ6T 2GQIA 4HXJA 2RPNA 3ME9A 1ZSZC 2LRQA 4M7AF 2DL3A 2KAFA 4PJJA 4XU2A 2J7IA 2X35A 5LJ3h 3VS0A 3I56Q 3PFSA 4C8QC 2P0PA 4LXCA 3H0HA 4BI8B 4HCBA 3L2QA 4M77F 3UATA 2WSCE 3OMCA 3RR6A 1S72Q 3JCMW 1YIJQ 1BBZA 1K76A 1TXQA 1PRMC 4AFZC 1VQLQ 1FWZA 5KH6A 2QA4T 1KHCA 4PJOA 1SRMA 4KUDK 2FL7A 4EMGA 3CCUT 2NUTA 3MP6A 3P8BB 2OTLQ 5M9OA 2KK4A 2AKLA 3L2VA 2FYKA 1YP5A 2LQ8A 3CBMA 1UG1A 1BB9A 4M78A 3CMEA 2X3WD 2YWWA 2F2WA 2FPDA 2VV5A 3G71T 2CP0A 5EC7A 1AWOA 3M0TA 2VYTA 3CC4Q 1IB8A 3H0FA 3OYBA 1OX8A 3OB9A 4FT2A 4E6RA 4PLIA 1YNZA 2WSEE 5FW9A 2QGGA 2NUPA 4LDVA 1ZUKA 5GAOm 2E41A 1X43A 4JJDA 1VQ5Q 4ATOA 4LNPA 2C0TA 4FM4B 1YN8A 1OU8A 2CGHA 4C0ZA 2VGNA 4N0AA 2K5IA 4JRQA 3OSSC 2RM4A 1BIBA 3J80E 3VU3C 1S1NA 1QVFP 1YFNA 1QVFA 3NHNA 3SEMA 4ZGDB 4M7AA 4HCCA 1AZEA 4E7IA 2L89A 3UF4A 2COYA 2BIVA 4M77A 1YWPA 4ZN3A 2JS0A 4M7DE 3CCSA 4QQ6A 3RUXA 2M0OA 1UJ0A 4C92F 1PWTA 4JZ3A 4XU3A 1KQSS 5LJ3d 2Y90A 1M27C 4F7UF 3ASKA 4JRKA 4RG2A 4XTYA 5KYXB 1OOTA 1U06A 2KT8A 4M75A 2KXDA 4LDXA 3CMEQ 1K9MU 1H641 4FW2A 1H3HA 1OPLA 2P84A 1IZ6A 3OQ5A 2ENMA 2ABLA 2VXFA 2F5TX 2K2MA 4LDUA 2C0OA 1M5Q1 2ZZDA 3Q1JA 2EQIA 2MYSA 1G83A 5GAOn 1RABB 2FO0A 4YTLA 2BE7D 2ED1A 2P0KA 5CKFA 4ZTFA 1TUDA 3CC7T 2J6FA 1VQMA 1BK2A 1OULA 4X1VA 2MF2A 3MEUA 1D1BA 1ZQ1A 1BU1A 5LJ5j 1R77A 3VYGA 5KCHA 1V29B 2LT4A 4PJOD 4FIBA 1IHWA 4R55A 5DY9A 3INZA 2QK0A 2G6FX 1XNIA 2HQEA 2LJ0A 2DKGA 3CCSQ 3EHQA 2GFUA 2KBTA 3PT9A 1KC8R 4M78D 4C92A 1PC0A 2HEQA 3JCMc 2E65A 3CCEQ 4F7UA 1PG5B 3I56T 1WXBA 1IREB 4PFOA 2VB6A 3HFNA 1S72T 2DXCA 1OZ2A 2MIOA 1EX4A 4OMFB 3UA6A 2D8HA 5D6XA 5HCKA 1VQLT 3PNWC 3QDRB 4XTZA 3R6NA 3DLLA 2DTHA 2OAWA 2QAZA 1QP2A 2F5KA 2D0QB 5A0DA 3TQ7P 5GAMg 4KH1B 5GJVB 3BY7A 5C6SA 4IIOA 3REBB 3DB4A 3JCMe 1NM7A 2G3RA 4M7AD 1VQMQ 1F1BB 3CC4T 5LJ5e 2RQRA 5HK0A 4V2SA 4M77D 2E10A 4AFQC 4JJNK 1AT1B 2V8JA 2D8JA 1YJ9A 1WX6A 4M7DG 1QP3A 1TTHB 1VQ5T 1NYGA 1SHGA 2E6ZA 1IRXA 2RN8A 5IHKA 5GMKi 3CXCA 4JRPA 1K8AR 2AT1B 1LOJA 4M75D 5FRMA 3JB9G 4DA4A 3X20B 4CC2A 1N5ZA 2CH4A 2EYZA 3I55A 5D6YA 2EIFA 1FYNA 3QJ6A 2LQNA 4QQGA 1Q7YU 5LJ3f 3CPFA 1O9SA 1AWWA 1ZSZA 3AHUA 2BZYA 1UE9A 2RK1A 3OYNA 2KRMA 1SSHA 4C8QA 3VUBA 2AKKA 3S3OA 1YCYA 2X4JA 2KNBB 4FL6A 1I4K1 3PGGA 3CMET 5GAN7 4IKFA 4LD6A 3G4SA 1VQKA 3M4GA 3JB9I 4FCYA 4HKEA 2EAYA 1D09B 4QVDA 1ZLMA 4CI0C 2FPFA 3L2RA 1YJ9Q 3H6ZA 4MDXA 3EG2A 1WXTA 1EZZB 3TCJA 1ZX6A 4A63B 4C92D 4WTOB 4NL3A 2CZ1B 1NPPA 4XTWA 1MMDA 2XG8D 2EGAA 1FXXA 2FB7A 4XTVA 5KYXA 2DM1A 2BZXA 1WGSA 2A7YA 3NMZC 1GBQA 4Y28E 2CUDA 2CSQA 5DM7R 1KQSP 4KGXB 1KQSA 1VIFA 3JCMX 3I55Q 2HBWA 1WXUA 5CO7A 1YHQT 4OP0A 4LDWA 4A4GA 2AHJB 4IUUA 1YJNA 4N4GA 1C6VX 2J05A 3DKMA 4JDSA 1MV0B 4OMNA 4E7JA 1BCMA 3A5ZB 2XDBA 2L3SA 3E9FA 1Q7YC 1UFFA 2L2PA 2J06A 3LWIA 2E5QA 4J5YA 2DE0X 2I0NA 5IXBA 2R57A 4RTYA 1NBEB 1ZBJA 3JCMP 4N4IA 2ZPBB 3CC2T 2CREA 8ATCB 3VJPA 2YLBA 5J26A 2AZVA 3TSZA 5J39A 5HKCA 3GOXA 2LDMA 3MHXA 4PJOB 2NUTB 3MEWA 1I8FA 1WHLA 5GANj 4NL2A 3OS0A 3G4SQ 1VQKQ 3VRYA 4OMPA 1OPKA 2MI6A 3FIFA 5IXFA 3GBQA 3LLRA 1OI1A 4JZ4A 3VS4A 5GMKh 2RJEA 1KC8C 2FEIA 2JTFA 3I9QA 3J81E 4M78B 2DBKA 4EMHA 2EPDA 1AD5A 2EKOA 1K1ZA 2VKNA 2RF0A 3A8LB 2LT1A 2XD0A 4J7IA 2QQ9A 1C0MA 1E7OA 1A0NB 5FRNA 2FRWA 2JW4A 3RBBB 4BACA 2A08A 2YRDA 2NUPB 1G3WA 3LYIA 1VQMT 2DEQA 2W0ZA 1X69A 2O88A 3M53A 1ZSGA 3NGPA 1KIKA 1ZUYA 2QASA 1QVGS 2A3LA 4AFSC 2M16A 1YJNQ 4E7SA 3KFVA 1M1KU 3JCMb 2DMOA 3QIIA 1BCOA 2Z0WA 3RMQA 4EMKC 3VRZA 5CCAA 3SD4A 3MEVA 4MZMA 3CCVA 4OVAA 3JCMQ 1KG1A 4M77B 1QKXA 3IQLA 5GANe 1YI2T 1K73U 1MUZA 3OYEA 4FSSA 2RHUA 4PK4A 1M1GA 2H3EB 2JUFA 1WHKA 5CIUA 1K8AC 5FU7C 5GAOq 3J7AF 1WJSA 4DEXA 1BI0A 4M75B 5HK3A 3PIPA 2IPOB 1AHJB 1BIAA 2R5AA 2LJ1A 3A8OB 2BTTA 3M0RA 3M5AA 5IN1A 3NTKA 3QJYA 2JZ2A 4ZN1A 4M7DC 1TOVA 2RQVA 1SRLA 2M51A 1M3CA 1B34A 2CP2A 2RI3A 3QHSA 4ZGJB 2KR3A 3JV3A 2RJFA 2BZ8A 1WHJA 3BE3A 3T9NA 1E6HA 2NYSA 1N6AA 2F2XA 2R5MA 1RACB 4GLMA 2D6FA 2QEXA 2HQXA 4A54A 4E7LA 3I55T 4UC4A 3CCVQ 3S3MA 1W1FA 3TVTA 3E1SA 4PJOE 4DBRA 2C06A 2PVOB 3ZEHA 2GGRA 4M78F 1W2BS 3BW1A 3G7ZA 2DJQA 3SB2A 2DZ9A 4C92B 2EQUA 1VQ8T 5GMKj 4DOWA 1WHGA 3C4SA 3KBGA 5CKHA 5A2QE 3RKYA 4F7UB 3OYIA 1JRIA 2YUPA 1WYXA 4PL6A 2GF7A 2E1HA 2L3QA 4FT4A 5GAMh 1WPYA 2EJ9A 2QQRA 4HVVA 1U1TA 5I11A 4F14A 5IHNA 4OMLA 1K9MR 1RL2A 2CP7A 3G4ST 1VQKT 1E6GA 1SSFA 4DBHA 3JB9H 2QDLA 4RTVA 2IVWA 2ZCFB 1Y96A 2M9UA 2VGMA 2XMFA 1MNEA 2SEMA 4GLKA 2DL5A 2CZ7B 2VC8A 4R56A 2VWFA 2VUBA 4M7AE 2PUOB 2YT6A 3U23A 3VS7A 1NG2A 4II1A 1RADB 5GAN6 3KUFA 2HQHA 4M77E 2QEXQ 2X4YA 3LW5E 2QXFA 3QO3A 4ELZC 2YUQA 1VYVA 2D1XA 3M58A 1RAHB 4M75F 1VQNT 4XK8E 1RI0A 3OYFA 4BE0A 2DZCA 1Q82C 3V8LA 3OYJA 2FZGB 4IUQA 3CCRA 4C0DB 5GAOl 4JLIA 1X01A 4J8OA 2KI7A 1CKAA 2ZGWA 1Q81U 4BY6B 2LJ3A 1TUGB 3OSVA 4MDWA 2KQWA 1M3BA 1M90U 3JAME 2K4YA 3H9NA 1ZBXA 2ROTA 2K79A 2LCCA 4PNOA 1ZSZB 4TVRA 1VQPA 3HKSA 2K3YA 5GJWB 2ED0A 2DL7A 1UGRB 2CKKA 4C8QB 1MMGA 3BFMA 4M4ZA 2EJGA 2QGFB 1SF9A 2J6OA 4QW2A 4F17A 5EG2A 3GNFB 4GY5A 2EVRA 2EYYA 2PVDB 1QVGP 1YCSB 4PKCC 5GAMd 1QVGA 3UA7A 4J6WA 4E7ZA 2DO3A 2AIRB 3KXTA 1IXDA 2EFIA 1M1FA 4R0KA 4LDYA 2E5KA 2LCSA 2PU9B 2L0AA 2JT4A 2P0QA 2GNCA 4OB3B 3SWNC 4D6WA 3X24B 1QWEA 2EJFA 4RTTA 2GBQA 5GAN5 1OYXA 4JJBA 3GP8A 3CCEA 3GLXA 4C92E 4BDZA 3I35A 3EGXA 3R6OA 4FW1A 4EPCA 3QYHB 3PE0A 1QWFA 4A53A 4F7UE 3CCRQ 1JU5C 4HA8A 3EGDA 3MCAB 2L5QA 1CSKA 1UTIA 3GF5A 4BI3A 3CCVT 2CS7A 3JCMJ 1Q81C 1FMKA 3EGUA 2HD0A 2JNGA 4J9BA 4ZTJA 4C5HA 4DQ2A 1VQPQ 1JXOA 1M90C 4EMKA 2LNHB 1Q86U 4ORZA 3MPUB 1Q7YR 2X4WA 3SHWA 4D8DA 1VQ4A 1IO6A 1HK9A 2ZPGB 2RHIA 5I21A 2F69A 2HZYA 5KYYA 2WACA 5LJ3j 1VYTA 2HDAA 2XKOC 4OB0B 1K4US 1JO8A 2PQWA 4M7AG 3ZFJA 1QCFA 3CQTA 1EIFA 2M02A 5AT1B 4D8KA 1GCPA 1BI1A 3M57A 2RB6A 2DVEA 2KYBA 4AG2C 4C5IA 2QQSA 4LD9K 3HSBA 2O4XA 3CCLA 3H8ZA 2QG9B 2A37A 3V8JA 3LWHA 2CP3A 2ZPHB 1W2BP 4CC4B 1W2BA 4M7DA 1T0HA 2PNIA 3LX7A 1BKBA 2DRKA 2Y4YA 4FSXA 2B86A 2RHZA 5CQXA 1YIJT 4BE1A 5C0MA 4X9CA 4ELYC 2QQAA 4K11A 1K9MC 1M30A 3CD6A 4C8QF 1HXDA 1LPLA 2COZA 3SFMA 3A98A 3M0QA 2YUNA 3HPWA 2OTLT 1OV3A 3O8VA 5CQYA 1N9RA 2YRCA 3HP9A 1Y7XA 1ZHIA 3I5SA 3OYDA 3EFOA 2DXUA 1HSQA 3M0PA 2RHYA 2KT1A 2O9VA 2EGEA 1NPRA 2RI5A 3EG3A 1K9AA 4J9IA 5LJ3e 1VQ4Q 3H41A 1Q86C 5I22A 2K5LA 2LX7A 1I1JA 1TSFA 1U5SA 4LE9A 1TS9A 1NZ9A 2QTVA 3RNJA 3A8MB 2JTEA 3M59A 5GAMf 4BB7A 1DJ7B 2RQTA 4PJLA 5CKEA 3L42A 2K6DA 4JS5A 1T3SA 3L1AA 3CCLQ 3EG1A 3CCMA 4NOYA 4DEYA 4J9FA 5CKBA 1I07A 3JCMg 4F7UG 3ZL7C 2DNUA 2MPXC 4RKUE 2AZSA 2YLCA 3NTIA 1UGSB 3WXMB 5LJ5g 4X9DA 4OB1B 3FC3A 3QZ9B 2KYMA 4RCBA 1B34B 2KXCA 2R58A 2HAXA 2C0IA 2HBPA 3CCJA 2DERA 2HMAA 3CD6Q 1AEYA 4LN2A 2KDSA 4QVZA 3D7SB 3V7SA 1Y0MA 1TUCA 1W4SA 4JPBW 3CBOA 1KD1U 3DB3A 1O75A 2O2OA 1AWJA 3QWXX 3MP1A 3JCMf 2MAMA 1YITA 4RUGA 1N27A 4DOVA 2JS2A 2SRCA 3CCRT 4HCKA 1PRLC 1QVPA 1D1AA 3C94A 2E4HA 1UGVA 2K3XA 1UHFA 4ZGEB 2DD4A 3HRUA 1HYOA 2PVGB 4XTXA 3L2UA 2JOYA 3EG0A 3URGA 2LQKA 3CCQA 1VQPT 1TWBA 4J6YA 3UT1A 5GMKm 1MHNA 1Z9QA 5KYWA 1UEBA 2DYIA 1K73R 2LVMA 3BDUA 2DEUA 1SPKA 2XK0A 2I2LA 2HSPA 5KYUA 1D0ZA 2AK5A 2V1QA 3CCMQ 2W10A 1K0SA 2F2VA 2CZ6B 1WJQA 1U3OA 2K2VA 2JM8A 3TSWA 4OGEA 1Y96B 1BI2A 1IGUA 5DLQE 3CCST 2LQWA 3CCUA 3CCJQ 4QQDA 2KY9A 3HL8A 3QXEB 4E2FB 1PD0A 4Y92A 5LL6S 2HL3A 3UDCA 2D0NA 3CCET 2ESWA 5FROA 2LNVA 4HVUA 2CP6A 1YITQ 1GCQC 1B3QA 3QDFA 3QBYA 4EDUA 4OMMA 3SWNA 2BUDA 3EHRA 5CK9A 1UJYA 1RAEB 3X28B 5FU6C 4OB2B 1VA7A 4BD3A 3A8GB 1G2BA 4PJNA 5IHIA 1JEGA 1OU9A 3SDZA 1V76A 1WZOA 3S3NA 1Q82R 4XU1A 2RD1A 5L8RE 3VS6A 4RTZA 4BDYA 3CCQQ 1I5OB 1GL5A 4M7AC 4CC3A 3RKWA 1VQ4T 3PVLA 4MZTA 3OBYA 2EW3A 3QZ5B 2E3HA 4O5VA 5I2MA 2DILA 3N5BB 3A1PA 3RESA 3MKDA 4C8QD 2CSIA 1MV3A 1QCNA 1JB0E 2RQWA 2CP5A 3DLMA 4ZNXA 3UPUA 4IUPA 3M0UA 3CCUQ 1CKBA 3QSUA 3QG1A 1SHFA 1VIEA 5GAOr 2F1LA 2ROLA 2COWA 1EFNA 2DK3A 4RTUA 3FRNA 1W70A 3FDRA 2EWNA 3LH5A 3CD6T 2D9TA 3EGXB 1UGPB 5FLXE 3OY9A 3VS3A 3LGFA 1D1CA 3JCMV 3A8HB 4XTUA 3EGDB 2HKNA 1QMCA 4P5NA 4B6MA 4BUGA 2CT4A 1WFWA 1PSEA 1N8RU 1ACMB 1PSFA 3NPFA 3PVQA 4KULA 4E7KA 2K9GA 5GANg 2DIGA 5KE3A 1Q81R 1KQ1A 4EMKB 2Y4XA 1QQJA 2DTOA 1VYUA 1YJ9T 5D6WA 1M90R 1ZA2B 3ULRB 2VVKA 3M55A 5KYYB 3OYAA 2LZ6B 5GAN3 1G5VA 2LC4A 2PZ1A 1LJOA 1M1KC 1WHHA 3OW2P 1WQ7A 3OYYA 3CCMT 5GANf 3LH0A 5FU7B 2RHXA 1TU0B 4QT7A 3OS5A 2KSSA 2KRNA 2O4XB 1RAFB 2V26A 1K73C 5GAN2 1KK7A 4DBFA 4M78E 3JB9J 3C12A 3GPLA 1X75C 4X34A 4M7DB 1JJ2S 2X9HA 4FYVB 1WI7A 2QDYB 1RLQC 4WCIA 4AMCA 5IH2A 1NJIU 1YITT 4XQ3A 1Y71A 1WDXA 1MNDA 2MWOA 2OX7A 2XDPA 3TEEA 4RG8A 1RAIB 1BYMA 4J9GA 1N8RC 3EFOB 3LGLA 4FYXB 2RNAA 4JS4A 1WHMA 4JRIA 4LUEA 4FYYB 4KGVB 1G3YA 2ZPIB 3BDLA 3WVDB 2K5FA 4N4HA 3VS2A 4E47A 4AT1B 2ZPFB 1Q86R 2X3XD 2YRVA 2DTIA 2ATCB 4MZPA 3O5ZA 3S6WA 3MP8A 3JCMh 2X4XA 2XICA 2DD5A 3QWYA 3HHTB 2NUZA 5GMKe 1P92A 2E64A 1YJNT 1WNLA 5LJ5h 4A4FA 1GBRA 2DXBA 3CXCS 1G8XA 4M75E 1M9SA 1D0YA 1X6GA 4A4EA 2JTMA 3ER0A 1HD3A 3M4YA 2DA9A 2YSQA 2JMCA 4J9DA 2LCLA 3HRTA 1NJIC 4HT9A 3UWNA 3VUZA 1MMNA 1ZA1B 5GAN8 1YJWA 1LCKA 2EQJA 1NLPC 1MGQA 4Z88A 2YUOA 4FYWB 1GCQA 2E70A 1YWOA 4Y91A 1NEGA 3CEYA 3CPWS 4XAXB 5CAIA 3HRSA 1M2OA 2RI2A 6AT1B 1VQOA 5KE2A 4PJOG 1ZUUA 3E9GA 2CYZB 2VASA 3M0SA 3EG9A 4OGCA 4WF2A 3TU4K 1YHQA 2IIMA 2KRSA 5KYNA 5KYWB 4M7DF 2KE9A 2RQUA 4M78G 1GXIE 3EFSA 1WLPB 5KYUB 4C0GA 5GAOp 1KFZA 2CUBA 2DIQA 2V8IA 2BE9B 3C95A 4J9CA 1UGQB 5GAN4 3JB9F 1WQWA 4BE2A 1K0XA 3JCMd 3OYGA 5GAMj 1SG5A 2B8AA 3CC2A 1QLYA 5LJ5d 2MMPA 3EH1A 1M2VA 2XIDA 1NEBA 4KUIA 2IG0A 2VXEA 2EQKA 3V7RA 2WSFE 5FWCA 2KVQG 2M1HA 1YJWQ 1PNJA 2EYXA 4Z89A 4RMOA 1T0JA 4A4HA 3NTHA 5A0LA 4L6V5 2DAQA 3SWNB 3CBPA 4XU0A 1KD1R 3C0CA 1NLOC 4M77G 4RCCA 1X6BA 1M8VA 4C0FA 2L8DA 1WA7A 3E2UA 1VQOQ 4FU6A 1QW1A 1H3ZA 4LUDA 4VUBA 1YHQQ 2CZ0B 2QQBA 7AT1B 5IAYA 1ABQA 1FMWA 1MMAA 4M75G 4RTXA 3OYKA 2V8KA 1WIEA 2P4TA 4PJMA 2FPEA 4ME7A 3QUIA 3QKJA 4IUTA 1U8RA 5GAMe 3JRZA 1HJDA 4JLGA 4L59A 2QEXT 1JJ2P 1JJ2A 4B9WA 3CC2Q 1D3BA 2MOXA 2YXYA 1D0XA 1YI2A 3RDVA 4C8QE 5CR2A 4OF1A 3PMIA 3P8HA 1AWXA 3MEAA 3RERA 1OQKA 1PCXA 1UECA 1I5LA 3VS5A 4MMKA 2XI9A 3WVEB 2QI2A 2QTXA 3PMTA 2EKHA 2XDDA 2DL4A 3OMGA 3G6EA 2QYZA 4J9EA 3OYLA 4Z8AA 2PTKA 5DLOA 1RAAB 2EGCA 4C92G 1GFCA 2JJ9A 5GANh 1T3LA 5L23A 3OS1A 4HT8A 5LJ3g 2KMTA 2RA2A 4DBQA 2EQMA 3CXCP 2EYQA 1OZ3A 1LVKA 1XQHA 2OTJA 1UUEA 1M4ZA 4F04B 2O9SA 4BI4A 1YBYA 3OW2S 1VQ9A 3X26B 1ABOA 3EH2A 2KEAA 4KH0B 2RMOA 1YI2Q 2RJCA 5CVIA 2OJ2A 1VQ7A 1QKWA 4F16A 1VQ8A 4AFUC 1NE8A 1PD1A 5FWBA 1GFDA 1JXMA 5LJ5f 2GFAA 3OYHA 1M1KR 4KRTA 4RTWA 4J9HA 1V1CA 5GMKl 1UB4A 4CC7A 2E12A 3H0IA 2NWMA 3CPWP 3FEOA 2FG0A 3CPWA 2FZCB 3G6EQ 3CMAA 2XU8A 1IHVA 2O01E 1TG0A 1KC8U 1R0BG 2XHCA 1VQ6A 2CT3A 1YJWT 4M7DD 2LMJA 4IIMA 3OYCA 1Q95G 1C1AA 2NLUA 3FJPA 3P8DA 4PJOC 1Z9ZA 5J3BA 1ARKA 3QPHA 1R0CB 3TREA 3JB9D 4L5GA 4B9XA 1XTDA 2HCKA 2LP5A 4HCZA 2OTJQ 5GANd 4M78C 1N8RR 1KSWA 2QA4A 1VQOT 1X6OA 2JVVA 3L2ZA 3PTAA 2MK5A 3REAB 4C8QG 4PLLA 4Z02A 1VQ9Q 3QYGB 4CRIA 4PFPA 1VQNA 1R8OB 2MCNA 1XJWB 1KHIA 2RO0A 1VQ7Q 2H8HA 1KD1C 1VQ8Q 3G71A 2RJDA 2OI3A 1FMVA 1VOMA 4IURA 3META 2YDLA 1UDLA 4N0AC 3GIBA 4GBQA 2HKQB 1B7TA 2ZAEA 3RKXA
chains in the Genus database with same CATH topology
4AFQC 2KRNA 2GNCA 1H92A 4OMOA 1X27A 2D8JA 1QWEA 1WX6A 1M8MA 4RTTA 2EBPA 2GBQA 1RI9A 1NYGA 1SHGA 4JJBA 2RN8A 1WI7A 3I35A 5IHKA 3PE0A 2DL8A 1QWFA 1RLQC 4WCIA 5IH2A 1JU5C 4CC2A 1N5ZA 2CH4A 2ECZA 1WDXA 2EYZA 1PKSA 1X2KA 1CSKA 2V1RA 1UTIA 1FYNA 4J9GA 2JMAA 2LQNA 1OEBA 1FMKA 2CDTA 3EGUA 2RNAA 4J9BA 1AWWA 1JXOA 1M3AA 4LUEA 2BZYA 2LNHB 2DF6A 4ORZA 3SHWA 4D8DA 1UE9A 2KGTA 1IO6A 1X2QA 2KRMA 1SSHA 3VS2A 2AKKA 1PHTA 2KNBB 1VYTA 2HDAA 1K4US 2X3XD 1JO8A 1AOJA 3O5ZA 2M0YA 2P4RA 1QCFA 3CQTA 3QWYA 4D8KA 2NUZA 1SEMA 1GCPA 3I5RA 2KYBA 4AG2C 1Y57A 1GBRA 1W6XA 1RUWA 1ZLMA 2FPFA 5ECAA 3EG2A 1WXTA 2A37A 1ZX6A 4A63B 1X6GA 2DRMA 4CC4B 2DLPA 2EGAA 1T0HA 2PNIA 2DM1A 2BZXA 4HVWA 3NMZC 2DRKA 2B86A 2K7AA 1GBQA 2CUDA 2CSQA 1HD3A 1NYFA 2DA9A 2YSQA 2CH4W 1I0CA 2JMCA 4K11A 4J9DA 1M30A 2HBWA 1WXUA 3A98A 2GTOA 3M0QA 2YUNA 1LCKA 1NLPC 1KJWA 1OV3A 2J05A 4EIKA 1MV0B 2YUOA 3I5SA 4OMNA 4Z88A 3FJ5A 3THKA 1AZGB 1HSQA 3M0PA 2KT1A 1GCQA 1YWOA 2A28A 2L3SA 2O9VA 2EGEA 3VS1A 1UFFA 2O31A 1NEGA 3EG3A 1K9AA 2J06A 2L2PA 4J9IA 1J3TA 2K3BA 2DE0X 2KROA 2I0NA 5IXBA 3H41A 4RTYA 1ZBJA 5I22A 2JXBA 2LX7A 1I1JA 2CREA 1XOVA 2DYBA 4LE9A 1U5SA 1JQQA 1ZUUA 2AZVA 3TSZA 2J6KA 3M0SA 3RNJA 2IIMA 2JTEA 2KRSA 2DVJA 3VRYA 4OMPA 1OPKA 2KE9A 5IXFA 2DX1A 2RQUA 2RQTA 3GBQA 4ESRA 4JZ4A 3VS4A 1WLPB 1KFZA 2FEIA 2CUBA 2K6DA 1T3SA 3I9QA 2FRYA 2DBKA 2EYWA 2EPDA 1AD5A 1K1ZA 2VKNA 4J9CA 2RF0A 3EG1A 1PKTA 1GRIA 4DEYA 4J9FA 4JJCA 1I07A 1K0XA 3ZL7C 2DNUA 1E7OA 2AZSA 1A0NB 4AG1C 4OMQA 2FRWA 2JW4A 2A36A 3RBBB 2A08A 1QLYA 2DBMA 2KYMA 2JM9A 2W0ZA 1NEBA 1X69A 2O88A 1ZSGA 2KXCA 3NGPA 1KIKA 2GTJA 2C0IA 1RLPC 1ZUYA 2L3PA 4AFSC 1AEYA 5FWCA 4LN2A 1B07A 1UHCA 1PNJA 1H8KA 1Y0MA 1TUCA 2EYXA 4Z89A 1AVZC 4JPBW 2O2OA 1AWJA 3QWXX 1T0JA 2GQIA 4HXJA 3KFVA 4RUGA 2RPNA 2JS2A 2DMOA 2SRCA 4HCKA 3VRZA 1PRLC 2DL3A 3C0CA 2J7IA 3VS0A 1NLOC 1UGVA 1UHFA 1X6BA 3H0HA 3UATA 1QKXA 1WA7A 3IQLA 1BBZA 1K76A 1MUZA 1PRMC 3EG0A 4AFZC 4LUDA 4FSSA 1SRMA 1Z9QA 1ABQA 4RTXA 2AKLA 1WIEA 4DEXA 1YP5A 1SPKA 2HSPA 2FPEA 1UG1A 1BB9A 2AK5A 2LJ1A 1HJDA 2X3WD 3M0RA 2BTTA 2V1QA 2F2WA 2FPDA 2W10A 5EC7A 1K0SA 1AWOA 2F2VA 3M0TA 3H0FA 2RQVA 1SRLA 2M51A 1M3CA 1YNZA 2MOXA 1U3OA 5FW9A 4E6RA 2JM8A 3TSWA 1ZUKA 1X43A 1AWXA 4JJDA 2LQWA 2KR3A 3JV3A 4LNPA 1UECA 2C0TA 1YN8A 4Y92A 3VS5A 2BZ8A 2D0NA 2ESWA 4HVUA 1GCQC 1E6HA 2EKHA 1S1NA 2F2XA 2DL4A 4GLMA 1B3QA 4OMMA 3NHNA 3SEMA 3EHRA 1UJYA 1AZEA 4J9EA 1W1FA 3TVTA 4Z8AA 3UF4A 2PTKA 1VA7A 2GGRA 1G2BA 1YWPA 5IHIA 1JEGA 2EGCA 2JS0A 1GFCA 2DJQA 1T3LA 1UJ0A 1PWTA 4JZ3A 3VS6A 4RTZA 5L23A 1GL5A 1M27C 4CC3A 2YUPA 1WYXA 3PVLA 2L3QA 2EW3A 1OOTA 1U06A 2KT8A 2KXDA 1UUEA 2DILA 1H3HA 1OPLA 2O9SA 4HVVA 5I11A 4F14A 2ENMA 2ABLA 5IHNA 4OMLA 2K2MA 1ABOA 2C0OA 2CSIA 2KEAA 1MV3A 2RMOA 1E6GA 2RQWA 2QDLA 2OJ2A 4RTVA 4ZNXA 1QKWA 4F16A 4AFUC 2EQIA 3M0UA 5FWBA 1CKBA 1GFDA 1JXMA 1G83A 2XMFA 2FO0A 2SEMA 2DL5A 2ED1A 1SHFA 1TUDA 4KRTA 2J6FA 4RTWA 4J9HA 1V1CA 2VWFA 1BK2A 4X1VA 2YT6A 3U23A 4CC7A 3VS7A 3H0IA 1NG2A 2ROLA 1EFNA 2NWMA 4RTUA 2FG0A 1BU1A 1W70A 2YUQA 3LH5A 1VYVA 1TG0A 2D1XA 2CT3A 2G6FX 2LMJA 3VS3A 4IIMA 2LJ0A 3EHQA 2KBTA 1Z9ZA 2CT4A 1WFWA 1ARKA 1CKAA 2HEQA 2LJ3A 3NPFA 3PVQA 1WXBA 1M3BA 2HCKA 2K9GA 2LP5A 2ROTA 1KSWA 2K79A 2MIOA 3UA6A 2D8HA 3REAB 5HCKA 2JT4A 1VYUA 5GJWB 2ED0A 2DL7A 3R6NA 4M4ZA 3ULRB 2OAWA 2VVKA 2MCNA 2J6OA 4F17A 2LZ6B 2H8HA 2EVRA 2EYYA 1YCSB 2OI3A 2PZ1A 5GJVB 3UA7A 2YDLA 4IIOA 3REBB 1UDLA 1NM7A 4R0KA 4GBQA 2RQRA 2E5KA 2LCSA 4QT7A 2L0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFQ C;  2KRN A;  2GNC A;  1H92 A;  4OMO A;  1X27 A;  2D8J A;  1QWE A;  1WX6 A;  1M8M A;  4RTT A;  2EBP A;  2GBQ A;  1RI9 A;  1NYG A;  1SHG A;  4JJB A;  2RN8 A;  1WI7 A;  3I35 A;  5IHK A;  3PE0 A;  2DL8 A;  1QWF A;  1RLQ C;  4WCI A;  5IH2 A;  1JU5 C;  4CC2 A;  1N5Z A;  2CH4 A;  2ECZ A;  1WDX A;  2EYZ A;  1PKS A;  1X2K A;  1CSK A;  2V1R A;  1UTI A;  1FYN A;  4J9G A;  2JMA A;  2LQN A;  1OEB A;  1FMK A;  2CDT A;  3EGU A;  2RNA A;  4J9B A;  1AWW A;  1JXO A;  1M3A A;  4LUE A;  2BZY A;  2LNH B;  2DF6 A;  4ORZ A;  3SHW A;  4D8D A;  1UE9 A;  2KGT A;  1IO6 A;  1X2Q A;  2KRM A;  1SSH A;  3VS2 A;  2AKK A;  1PHT A;  2KNB B;  1VYT A;  2HDA A;  1K4U S;  2X3X D;  1JO8 A;  1AOJ A;  3O5Z A;  2M0Y A;  2P4R A;  1QCF A;  3CQT A;  3QWY A;  4D8K A;  2NUZ A;  1SEM A;  1GCP A;  3I5R A;  2KYB A;  4AG2 C;  1Y57 A;  1GBR A;  1W6X A;  1RUW A;  1ZLM A;  2FPF A;  5ECA A;  3EG2 A;  1WXT A;  2A37 A;  1ZX6 A;  4A63 B;  1X6G A;  2DRM A;  4CC4 B;  2DLP A;  2EGA A;  1T0H A;  2PNI A;  2DM1 A;  2BZX A;  4HVW A;  3NMZ C;  2DRK A;  2B86 A;  2K7A A;  1GBQ A;  2CUD A;  2CSQ A;  1HD3 A;  1NYF A;  2DA9 A;  2YSQ A;  2CH4 W;  1I0C A;  2JMC A;  4K11 A;  4J9D A;  1M30 A;  2HBW A;  1WXU A;  3A98 A;  2GTO A;  3M0Q A;  2YUN A;  1LCK A;  1NLP C;  1KJW A;  1OV3 A;  2J05 A;  4EIK A;  1MV0 B;  2YUO A;  3I5S A;  4OMN A;  4Z88 A;  3FJ5 A;  3THK A;  1AZG B;  1HSQ A;  3M0P A;  2KT1 A;  1GCQ A;  1YWO A;  2A28 A;  2L3S A;  2O9V A;  2EGE A;  3VS1 A;  1UFF A;  2O31 A;  1NEG A;  3EG3 A;  1K9A A;  2J06 A;  2L2P A;  4J9I A;  1J3T A;  2K3B A;  2DE0 X;  2KRO A;  2I0N A;  5IXB A;  3H41 A;  4RTY A;  1ZBJ A;  5I22 A;  2JXB A;  2LX7 A;  1I1J A;  2CRE A;  1XOV A;  2DYB A;  4LE9 A;  1U5S A;  1JQQ A;  1ZUU A;  2AZV A;  3TSZ A;  2J6K A;  3M0S A;  3RNJ A;  2IIM A;  2JTE A;  2KRS A;  2DVJ A;  3VRY A;  4OMP A;  1OPK A;  2KE9 A;  5IXF A;  2DX1 A;  2RQU A;  2RQT A;  3GBQ A;  4ESR A;  4JZ4 A;  3VS4 A;  1WLP B;  1KFZ A;  2FEI A;  2CUB A;  2K6D A;  1T3S A;  3I9Q A;  2FRY A;  2DBK A;  2EYW A;  2EPD A;  1AD5 A;  1K1Z A;  2VKN A;  4J9C A;  2RF0 A;  3EG1 A;  1PKT A;  1GRI A;  4DEY A;  4J9F A;  4JJC A;  1I07 A;  1K0X A;  3ZL7 C;  2DNU A;  1E7O A;  2AZS A;  1A0N B;  4AG1 C;  4OMQ A;  2FRW A;  2JW4 A;  2A36 A;  3RBB B;  2A08 A;  1QLY A;  2DBM A;  2KYM A;  2JM9 A;  2W0Z A;  1NEB A;  1X69 A;  2O88 A;  1ZSG A;  2KXC A;  3NGP A;  1KIK A;  2GTJ A;  2C0I A;  1RLP C;  1ZUY A;  2L3P A;  4AFS C;  1AEY A;  5FWC A;  4LN2 A;  1B07 A;  1UHC A;  1PNJ A;  1H8K A;  1Y0M A;  1TUC A;  2EYX A;  4Z89 A;  1AVZ C;  4JPB W;  2O2O A;  1AWJ A;  3QWX X;  1T0J A;  2GQI A;  4HXJ A;  3KFV A;  4RUG A;  2RPN A;  2JS2 A;  2DMO A;  2SRC A;  4HCK A;  3VRZ A;  1PRL C;  2DL3 A;  3C0C A;  2J7I A;  3VS0 A;  1NLO C;  1UGV A;  1UHF A;  1X6B A;  3H0H A;  3UAT A;  1QKX A;  1WA7 A;  3IQL A;  1BBZ A;  1K76 A;  1MUZ A;  1PRM C;  3EG0 A;  4AFZ C;  4LUD A;  4FSS A;  1SRM A;  1Z9Q A;  1ABQ A;  4RTX A;  2AKL A;  1WIE A;  4DEX A;  1YP5 A;  1SPK A;  2HSP A;  2FPE A;  1UG1 A;  1BB9 A;  2AK5 A;  2LJ1 A;  1HJD A;  2X3W D;  3M0R A;  2BTT A;  2V1Q A;  2F2W A;  2FPD A;  2W10 A;  5EC7 A;  1K0S A;  1AWO A;  2F2V A;  3M0T A;  3H0F A;  2RQV A;  1SRL A;  2M51 A;  1M3C A;  1YNZ A;  2MOX A;  1U3O A;  5FW9 A;  4E6R A;  2JM8 A;  3TSW A;  1ZUK A;  1X43 A;  1AWX A;  4JJD A;  2LQW A;  2KR3 A;  3JV3 A;  4LNP A;  1UEC A;  2C0T A;  1YN8 A;  4Y92 A;  3VS5 A;  2BZ8 A;  2D0N A;  2ESW A;  4HVU A;  1GCQ C;  1E6H A;  2EKH A;  1S1N A;  2F2X A;  2DL4 A;  4GLM A;  1B3Q A;  4OMM A;  3NHN A;  3SEM A;  3EHR A;  1UJY A;  1AZE A;  4J9E A;  1W1F A;  3TVT A;  4Z8A A;  3UF4 A;  2PTK A;  1VA7 A;  2GGR A;  1G2B A;  1YWP A;  5IHI A;  1JEG A;  2EGC A;  2JS0 A;  1GFC A;  2DJQ A;  1T3L A;  1UJ0 A;  1PWT A;  4JZ3 A;  3VS6 A;  4RTZ A;  5L23 A;  1GL5 A;  1M27 C;  4CC3 A;  2YUP A;  1WYX A;  3PVL A;  2L3Q A;  2EW3 A;  1OOT A;  1U06 A;  2KT8 A;  2KXD A;  1UUE A;  2DIL A;  1H3H A;  1OPL A;  2O9S A;  4HVV A;  5I11 A;  4F14 A;  2ENM A;  2ABL A;  5IHN A;  4OML A;  2K2M A;  1ABO A;  2C0O A;  2CSI A;  2KEA A;  1MV3 A;  2RMO A;  1E6G A;  2RQW A;  2QDL A;  2OJ2 A;  4RTV A;  4ZNX A;  1QKW A;  4F16 A;  4AFU C;  2EQI A;  3M0U A;  5FWB A;  1CKB A;  1GFD A;  1JXM A;  1G83 A;  2XMF A;  2FO0 A;  2SEM A;  2DL5 A;  2ED1 A;  1SHF A;  1TUD A;  4KRT A;  2J6F A;  4RTW A;  4J9H A;  1V1C A;  2VWF A;  1BK2 A;  4X1V A;  2YT6 A;  3U23 A;  4CC7 A;  3VS7 A;  3H0I A;  1NG2 A;  2ROL A;  1EFN A;  2NWM A;  4RTU A;  2FG0 A;  1BU1 A;  1W70 A;  2YUQ A;  3LH5 A;  1VYV A;  1TG0 A;  2D1X A;  2CT3 A;  2G6F X;  2LMJ A;  3VS3 A;  4IIM A;  2LJ0 A;  3EHQ A;  2KBT A;  1Z9Z A;  2CT4 A;  1WFW A;  1ARK A;  1CKA A;  2HEQ A;  2LJ3 A;  3NPF A;  3PVQ A;  1WXB A;  1M3B A;  2HCK A;  2K9G A;  2LP5 A;  2ROT A;  1KSW A;  2K79 A;  2MIO A;  3UA6 A;  2D8H A;  3REA B;  5HCK A;  2JT4 A;  1VYU A;  5GJW B;  2ED0 A;  2DL7 A;  3R6N A;  4M4Z A;  3ULR B;  2OAW A;  2VVK A;  2MCN A;  2J6O A;  4F17 A;  2LZ6 B;  2H8H A;  2EVR A;  2EYY A;  1YCS B;  2OI3 A;  2PZ1 A;  5GJV B;  3UA7 A;  2YDL A;  4IIO A;  3REB B;  1UDL A;  1NM7 A;  4R0K A;  4GBQ A;  2RQR A;  2E5K A;  2LCS A;  4QT7 A;  2L0A A; 
#chains in the Genus database with same CATH topology
 1G3S A;  4NS5 A;  2DXT A;  1H92 A;  4OMO A;  3VV0 A;  1U1S A;  1X27 A;  3M9Q A;  1K8A U;  3CMA Q;  1M8M A;  2EBP A;  1RI9 A;  1VQ6 Q;  3FB9 A;  4M77 C;  3L2W A;  2FZK B;  2ZPE B;  2DL8 A;  4A4K A;  2ECZ A;  1PKS A;  1X2K A;  2LX9 A;  1LNX A;  1TH7 A;  2V1R A;  2L3R A;  2JN0 A;  4C5G A;  1NJI R;  2JMA A;  3FLG A;  4JUV A;  2A0F B;  2RK2 A;  1OEB A;  4M75 C;  2HNI A;  2CDT A;  2QA4 Q;  3RMS A;  2GQV A;  2OAU A;  1M3A A;  3CCL T;  3G1J A;  2DF6 A;  1QVF S;  2FHD A;  2KGT A;  1X2Q A;  3GNG A;  1VQN Q;  3OS2 A;  1IGQ A;  2FVU A;  5FU6 B;  5A0G A;  3AT1 B;  1PHT A;  2K57 A;  3EAE A;  3G71 Q;  2DFU A;  1AOJ A;  3EG9 B;  2H3J A;  3OYM A;  2DET A;  4KBM B;  4M7A B;  2M0Y A;  3RIR A;  2P4R A;  1SEM A;  4QKU A;  3I5R A;  3VYH B;  3JSC A;  1PM3 A;  4J6X A;  1Y57 A;  3HTR A;  1W6X A;  1RUW A;  4J83 A;  3X25 B;  4QVC A;  3ZBD A;  2PUK B;  1WJR A;  5ECA A;  3CC7 A;  2DRM A;  2GCX A;  2DLP A;  5KCO A;  1M2V B;  4HVW A;  2HSE B;  3OA6 A;  2K7A A;  1Y07 A;  2LTO A;  1NYF A;  3MJX A;  4C92 C;  2CH4 W;  1I0C A;  3E19 A;  3PIO A;  2E3I A;  4PFZ A;  2GTO A;  2E6N A;  3G6E T;  1QCO A;  2HL5 C;  4MML A;  1KJW A;  4O6J A;  1FX7 A;  4EIK A;  3FJ5 A;  3THK A;  1AZG B;  2A28 A;  5D7U A;  3VS1 A;  3M54 A;  2O31 A;  3OW2 A;  2BKD N;  1J3T A;  3V8K A;  2K3B A;  2KRO A;  3I56 A;  1VUB A;  2JXB A;  1OX9 A;  4E7H A;  1S72 A;  1XOV A;  2DYB A;  1JQQ A;  3NFC A;  1YIJ A;  1JBM A;  2OTJ T;  2J6K A;  4PJO F;  5I2S A;  1VQL A;  3HFO A;  4KT0 E;  5CKD A;  3CCJ T;  2DVJ A;  5IT9 E;  1SKU B;  5HY6 A;  2OTL A;  3EFR A;  1Q82 U;  1KQ2 A;  2DX1 A;  1VQ9 T;  4ESR A;  2RH2 A;  1G3T A;  3VKI A;  3OBW A;  3F70 A;  2FRY A;  2EYW A;  1VQ7 T;  3MO8 A;  4KGZ B;  1PKT A;  1RAG B;  1GRI A;  3V7C A;  3CC7 Q;  4J7F A;  4JJC A;  4Q5W A;  2MWP A;  4AG1 C;  4OMQ A;  3CC4 A;  1D3B B;  2A36 A;  9ATC B;  1I81 A;  3M56 A;  4IUV A;  2DBM A;  2JM9 A;  5AYF A;  1BI3 A;  4C0D C;  2GTJ A;  2DJZ A;  1VQ5 A;  1RLP C;  2L3P A;  2DPP B;  4ANJ A;  3CCQ T;  1B07 A;  1UHC A;  2YHT A;  4BY6 C;  2X51 A;  3CMA T;  1H8K A;  8AT1 B;  1AVZ C;  4C5E A;  1N9S A;  1VQ6 T;  2GQI A;  4HXJ A;  2RPN A;  3ME9 A;  1ZSZ C;  2LRQ A;  4M7A F;  2DL3 A;  2KAF A;  4PJJ A;  4XU2 A;  2J7I A;  2X35 A;  5LJ3 h;  3VS0 A;  3I56 Q;  3PFS A;  4C8Q C;  2P0P A;  4LXC A;  3H0H A;  4BI8 B;  4HCB A;  3L2Q A;  4M77 F;  3UAT A;  2WSC E;  3OMC A;  3RR6 A;  1S72 Q;  3JCM W;  1YIJ Q;  1BBZ A;  1K76 A;  1TXQ A;  1PRM C;  4AFZ C;  1VQL Q;  1FWZ A;  5KH6 A;  2QA4 T;  1KHC A;  4PJO A;  1SRM A;  4KUD K;  2FL7 A;  4EMG A;  3CCU T;  2NUT A;  3MP6 A;  3P8B B;  2OTL Q;  5M9O A;  2KK4 A;  2AKL A;  3L2V A;  2FYK A;  1YP5 A;  2LQ8 A;  3CBM A;  1UG1 A;  1BB9 A;  4M78 A;  3CME A;  2X3W D;  2YWW A;  2F2W A;  2FPD A;  2VV5 A;  3G71 T;  2CP0 A;  5EC7 A;  1AWO A;  3M0T A;  2VYT A;  3CC4 Q;  1IB8 A;  3H0F A;  3OYB A;  1OX8 A;  3OB9 A;  4FT2 A;  4E6R A;  4PLI A;  1YNZ A;  2WSE E;  5FW9 A;  2QGG A;  2NUP A;  4LDV A;  1ZUK A;  5GAO m;  2E41 A;  1X43 A;  4JJD A;  1VQ5 Q;  4ATO A;  4LNP A;  2C0T A;  4FM4 B;  1YN8 A;  1OU8 A;  2CGH A;  4C0Z A;  2VGN A;  4N0A A;  2K5I A;  4JRQ A;  3OSS C;  2RM4 A;  1BIB A;  3J80 E;  3VU3 C;  1S1N A;  1QVF P;  1YFN A;  1QVF A;  3NHN A;  3SEM A;  4ZGD B;  4M7A A;  4HCC A;  1AZE A;  4E7I A;  2L89 A;  3UF4 A;  2COY A;  2BIV A;  4M77 A;  1YWP A;  4ZN3 A;  2JS0 A;  4M7D E;  3CCS A;  4QQ6 A;  3RUX A;  2M0O A;  1UJ0 A;  4C92 F;  1PWT A;  4JZ3 A;  4XU3 A;  1KQS S;  5LJ3 d;  2Y90 A;  1M27 C;  4F7U F;  3ASK A;  4JRK A;  4RG2 A;  4XTY A;  5KYX B;  1OOT A;  1U06 A;  2KT8 A;  4M75 A;  2KXD A;  4LDX A;  3CME Q;  1K9M U;  1H64 1;  4FW2 A;  1H3H A;  1OPL A;  2P84 A;  1IZ6 A;  3OQ5 A;  2ENM A;  2ABL A;  2VXF A;  2F5T X;  2K2M A;  4LDU A;  2C0O A;  1M5Q 1;  2ZZD A;  3Q1J A;  2EQI A;  2MYS A;  1G83 A;  5GAO n;  1RAB B;  2FO0 A;  4YTL A;  2BE7 D;  2ED1 A;  2P0K A;  5CKF A;  4ZTF A;  1TUD A;  3CC7 T;  2J6F A;  1VQM A;  1BK2 A;  1OUL A;  4X1V A;  2MF2 A;  3MEU A;  1D1B A;  1ZQ1 A;  1BU1 A;  5LJ5 j;  1R77 A;  3VYG A;  5KCH A;  1V29 B;  2LT4 A;  4PJO D;  4FIB A;  1IHW A;  4R55 A;  5DY9 A;  3INZ A;  2QK0 A;  2G6F X;  1XNI A;  2HQE A;  2LJ0 A;  2DKG A;  3CCS Q;  3EHQ A;  2GFU A;  2KBT A;  3PT9 A;  1KC8 R;  4M78 D;  4C92 A;  1PC0 A;  2HEQ A;  3JCM c;  2E65 A;  3CCE Q;  4F7U A;  1PG5 B;  3I56 T;  1WXB A;  1IRE B;  4PFO A;  2VB6 A;  3HFN A;  1S72 T;  2DXC A;  1OZ2 A;  2MIO A;  1EX4 A;  4OMF B;  3UA6 A;  2D8H A;  5D6X A;  5HCK A;  1VQL T;  3PNW C;  3QDR B;  4XTZ A;  3R6N A;  3DLL A;  2DTH A;  2OAW A;  2QAZ A;  1QP2 A;  2F5K A;  2D0Q B;  5A0D A;  3TQ7 P;  5GAM g;  4KH1 B;  5GJV B;  3BY7 A;  5C6S A;  4IIO A;  3REB B;  3DB4 A;  3JCM e;  1NM7 A;  2G3R A;  4M7A D;  1VQM Q;  1F1B B;  3CC4 T;  5LJ5 e;  2RQR A;  5HK0 A;  4V2S A;  4M77 D;  2E10 A;  4AFQ C;  4JJN K;  1AT1 B;  2V8J A;  2D8J A;  1YJ9 A;  1WX6 A;  4M7D G;  1QP3 A;  1TTH B;  1VQ5 T;  1NYG A;  1SHG A;  2E6Z A;  1IRX A;  2RN8 A;  5IHK A;  5GMK i;  3CXC A;  4JRP A;  1K8A R;  2AT1 B;  1LOJ A;  4M75 D;  5FRM A;  3JB9 G;  4DA4 A;  3X20 B;  4CC2 A;  1N5Z A;  2CH4 A;  2EYZ A;  3I55 A;  5D6Y A;  2EIF A;  1FYN A;  3QJ6 A;  2LQN A;  4QQG A;  1Q7Y U;  5LJ3 f;  3CPF A;  1O9S A;  1AWW A;  1ZSZ A;  3AHU A;  2BZY A;  1UE9 A;  2RK1 A;  3OYN A;  2KRM A;  1SSH A;  4C8Q A;  3VUB A;  2AKK A;  3S3O A;  1YCY A;  2X4J A;  2KNB B;  4FL6 A;  1I4K 1;  3PGG A;  3CME T;  5GAN 7;  4IKF A;  4LD6 A;  3G4S A;  1VQK A;  3M4G A;  3JB9 I;  4FCY A;  4HKE A;  2EAY A;  1D09 B;  4QVD A;  1ZLM A;  4CI0 C;  2FPF A;  3L2R A;  1YJ9 Q;  3H6Z A;  4MDX A;  3EG2 A;  1WXT A;  1EZZ B;  3TCJ A;  1ZX6 A;  4A63 B;  4C92 D;  4WTO B;  4NL3 A;  2CZ1 B;  1NPP A;  4XTW A;  1MMD A;  2XG8 D;  2EGA A;  1FXX A;  2FB7 A;  4XTV A;  5KYX A;  2DM1 A;  2BZX A;  1WGS A;  2A7Y A;  3NMZ C;  1GBQ A;  4Y28 E;  2CUD A;  2CSQ A;  5DM7 R;  1KQS P;  4KGX B;  1KQS A;  1VIF A;  3JCM X;  3I55 Q;  2HBW A;  1WXU A;  5CO7 A;  1YHQ T;  4OP0 A;  4LDW A;  4A4G A;  2AHJ B;  4IUU A;  1YJN A;  4N4G A;  1C6V X;  2J05 A;  3DKM A;  4JDS A;  1MV0 B;  4OMN A;  4E7J A;  1BCM A;  3A5Z B;  2XDB A;  2L3S A;  3E9F A;  1Q7Y C;  1UFF A;  2L2P A;  2J06 A;  3LWI A;  2E5Q A;  4J5Y A;  2DE0 X;  2I0N A;  5IXB A;  2R57 A;  4RTY A;  1NBE B;  1ZBJ A;  3JCM P;  4N4I A;  2ZPB B;  3CC2 T;  2CRE A;  8ATC B;  3VJP A;  2YLB A;  5J26 A;  2AZV A;  3TSZ A;  5J39 A;  5HKC A;  3GOX A;  2LDM A;  3MHX A;  4PJO B;  2NUT B;  3MEW A;  1I8F A;  1WHL A;  5GAN j;  4NL2 A;  3OS0 A;  3G4S Q;  1VQK Q;  3VRY A;  4OMP A;  1OPK A;  2MI6 A;  3FIF A;  5IXF A;  3GBQ A;  3LLR A;  1OI1 A;  4JZ4 A;  3VS4 A;  5GMK h;  2RJE A;  1KC8 C;  2FEI A;  2JTF A;  3I9Q A;  3J81 E;  4M78 B;  2DBK A;  4EMH A;  2EPD A;  1AD5 A;  2EKO A;  1K1Z A;  2VKN A;  2RF0 A;  3A8L B;  2LT1 A;  2XD0 A;  4J7I A;  2QQ9 A;  1C0M A;  1E7O A;  1A0N B;  5FRN A;  2FRW A;  2JW4 A;  3RBB B;  4BAC A;  2A08 A;  2YRD A;  2NUP B;  1G3W A;  3LYI A;  1VQM T;  2DEQ A;  2W0Z A;  1X69 A;  2O88 A;  3M53 A;  1ZSG A;  3NGP A;  1KIK A;  1ZUY A;  2QAS A;  1QVG S;  2A3L A;  4AFS C;  2M16 A;  1YJN Q;  4E7S A;  3KFV A;  1M1K U;  3JCM b;  2DMO A;  3QII A;  1BCO A;  2Z0W A;  3RMQ A;  4EMK C;  3VRZ A;  5CCA A;  3SD4 A;  3MEV A;  4MZM A;  3CCV A;  4OVA A;  3JCM Q;  1KG1 A;  4M77 B;  1QKX A;  3IQL A;  5GAN e;  1YI2 T;  1K73 U;  1MUZ A;  3OYE A;  4FSS A;  2RHU A;  4PK4 A;  1M1G A;  2H3E B;  2JUF A;  1WHK A;  5CIU A;  1K8A C;  5FU7 C;  5GAO q;  3J7A F;  1WJS A;  4DEX A;  1BI0 A;  4M75 B;  5HK3 A;  3PIP A;  2IPO B;  1AHJ B;  1BIA A;  2R5A A;  2LJ1 A;  3A8O B;  2BTT A;  3M0R A;  3M5A A;  5IN1 A;  3NTK A;  3QJY A;  2JZ2 A;  4ZN1 A;  4M7D C;  1TOV A;  2RQV A;  1SRL A;  2M51 A;  1M3C A;  1B34 A;  2CP2 A;  2RI3 A;  3QHS A;  4ZGJ B;  2KR3 A;  3JV3 A;  2RJF A;  2BZ8 A;  1WHJ A;  3BE3 A;  3T9N A;  1E6H A;  2NYS A;  1N6A A;  2F2X A;  2R5M A;  1RAC B;  4GLM A;  2D6F A;  2QEX A;  2HQX A;  4A54 A;  4E7L A;  3I55 T;  4UC4 A;  3CCV Q;  3S3M A;  1W1F A;  3TVT A;  3E1S A;  4PJO E;  4DBR A;  2C06 A;  2PVO B;  3ZEH A;  2GGR A;  4M78 F;  1W2B S;  3BW1 A;  3G7Z A;  2DJQ A;  3SB2 A;  2DZ9 A;  4C92 B;  2EQU A;  1VQ8 T;  5GMK j;  4DOW A;  1WHG A;  3C4S A;  3KBG A;  5CKH A;  5A2Q E;  3RKY A;  4F7U B;  3OYI A;  1JRI A;  2YUP A;  1WYX A;  4PL6 A;  2GF7 A;  2E1H A;  2L3Q A;  4FT4 A;  5GAM h;  1WPY A;  2EJ9 A;  2QQR A;  4HVV A;  1U1T A;  5I11 A;  4F14 A;  5IHN A;  4OML A;  1K9M R;  1RL2 A;  2CP7 A;  3G4S T;  1VQK T;  1E6G A;  1SSF A;  4DBH A;  3JB9 H;  2QDL A;  4RTV A;  2IVW A;  2ZCF B;  1Y96 A;  2M9U A;  2VGM A;  2XMF A;  1MNE A;  2SEM A;  4GLK A;  2DL5 A;  2CZ7 B;  2VC8 A;  4R56 A;  2VWF A;  2VUB A;  4M7A E;  2PUO B;  2YT6 A;  3U23 A;  3VS7 A;  1NG2 A;  4II1 A;  1RAD B;  5GAN 6;  3KUF A;  2HQH A;  4M77 E;  2QEX Q;  2X4Y A;  3LW5 E;  2QXF A;  3QO3 A;  4ELZ C;  2YUQ A;  1VYV A;  2D1X A;  3M58 A;  1RAH B;  4M75 F;  1VQN T;  4XK8 E;  1RI0 A;  3OYF A;  4BE0 A;  2DZC A;  1Q82 C;  3V8L A;  3OYJ A;  2FZG B;  4IUQ A;  3CCR A;  4C0D B;  5GAO l;  4JLI A;  1X01 A;  4J8O A;  2KI7 A;  1CKA A;  2ZGW A;  1Q81 U;  4BY6 B;  2LJ3 A;  1TUG B;  3OSV A;  4MDW A;  2KQW A;  1M3B A;  1M90 U;  3JAM E;  2K4Y A;  3H9N A;  1ZBX A;  2ROT A;  2K79 A;  2LCC A;  4PNO A;  1ZSZ B;  4TVR A;  1VQP A;  3HKS A;  2K3Y A;  5GJW B;  2ED0 A;  2DL7 A;  1UGR B;  2CKK A;  4C8Q B;  1MMG A;  3BFM A;  4M4Z A;  2EJG A;  2QGF B;  1SF9 A;  2J6O A;  4QW2 A;  4F17 A;  5EG2 A;  3GNF B;  4GY5 A;  2EVR A;  2EYY A;  2PVD B;  1QVG P;  1YCS B;  4PKC C;  5GAM d;  1QVG A;  3UA7 A;  4J6W A;  4E7Z A;  2DO3 A;  2AIR B;  3KXT A;  1IXD A;  2EFI A;  1M1F A;  4R0K A;  4LDY A;  2E5K A;  2LCS A;  2PU9 B;  2L0A A;  2JT4 A;  2P0Q A;  2GNC A;  4OB3 B;  3SWN C;  4D6W A;  3X24 B;  1QWE A;  2EJF A;  4RTT A;  2GBQ A;  5GAN 5;  1OYX A;  4JJB A;  3GP8 A;  3CCE A;  3GLX A;  4C92 E;  4BDZ A;  3I35 A;  3EGX A;  3R6O A;  4FW1 A;  4EPC A;  3QYH B;  3PE0 A;  1QWF A;  4A53 A;  4F7U E;  3CCR Q;  1JU5 C;  4HA8 A;  3EGD A;  3MCA B;  2L5Q A;  1CSK A;  1UTI A;  3GF5 A;  4BI3 A;  3CCV T;  2CS7 A;  3JCM J;  1Q81 C;  1FMK A;  3EGU A;  2HD0 A;  2JNG A;  4J9B A;  4ZTJ A;  4C5H A;  4DQ2 A;  1VQP Q;  1JXO A;  1M90 C;  4EMK A;  2LNH B;  1Q86 U;  4ORZ A;  3MPU B;  1Q7Y R;  2X4W A;  3SHW A;  4D8D A;  1VQ4 A;  1IO6 A;  1HK9 A;  2ZPG B;  2RHI A;  5I21 A;  2F69 A;  2HZY A;  5KYY A;  2WAC A;  5LJ3 j;  1VYT A;  2HDA A;  2XKO C;  4OB0 B;  1K4U S;  1JO8 A;  2PQW A;  4M7A G;  3ZFJ A;  1QCF A;  3CQT A;  1EIF A;  2M02 A;  5AT1 B;  4D8K A;  1GCP A;  1BI1 A;  3M57 A;  2RB6 A;  2DVE A;  2KYB A;  4AG2 C;  4C5I A;  2QQS A;  4LD9 K;  3HSB A;  2O4X A;  3CCL A;  3H8Z A;  2QG9 B;  2A37 A;  3V8J A;  3LWH A;  2CP3 A;  2ZPH B;  1W2B P;  4CC4 B;  1W2B A;  4M7D A;  1T0H A;  2PNI A;  3LX7 A;  1BKB A;  2DRK A;  2Y4Y A;  4FSX A;  2B86 A;  2RHZ A;  5CQX A;  1YIJ T;  4BE1 A;  5C0M A;  4X9C A;  4ELY C;  2QQA A;  4K11 A;  1K9M C;  1M30 A;  3CD6 A;  4C8Q F;  1HXD A;  1LPL A;  2COZ A;  3SFM A;  3A98 A;  3M0Q A;  2YUN A;  3HPW A;  2OTL T;  1OV3 A;  3O8V A;  5CQY A;  1N9R A;  2YRC A;  3HP9 A;  1Y7X A;  1ZHI A;  3I5S A;  3OYD A;  3EFO A;  2DXU A;  1HSQ A;  3M0P A;  2RHY A;  2KT1 A;  2O9V A;  2EGE A;  1NPR A;  2RI5 A;  3EG3 A;  1K9A A;  4J9I A;  5LJ3 e;  1VQ4 Q;  3H41 A;  1Q86 C;  5I22 A;  2K5L A;  2LX7 A;  1I1J A;  1TSF A;  1U5S A;  4LE9 A;  1TS9 A;  1NZ9 A;  2QTV A;  3RNJ A;  3A8M B;  2JTE A;  3M59 A;  5GAM f;  4BB7 A;  1DJ7 B;  2RQT A;  4PJL A;  5CKE A;  3L42 A;  2K6D A;  4JS5 A;  1T3S A;  3L1A A;  3CCL Q;  3EG1 A;  3CCM A;  4NOY A;  4DEY A;  4J9F A;  5CKB A;  1I07 A;  3JCM g;  4F7U G;  3ZL7 C;  2DNU A;  2MPX C;  4RKU E;  2AZS A;  2YLC A;  3NTI A;  1UGS B;  3WXM B;  5LJ5 g;  4X9D A;  4OB1 B;  3FC3 A;  3QZ9 B;  2KYM A;  4RCB A;  1B34 B;  2KXC A;  2R58 A;  2HAX A;  2C0I A;  2HBP A;  3CCJ A;  2DER A;  2HMA A;  3CD6 Q;  1AEY A;  4LN2 A;  2KDS A;  4QVZ A;  3D7S B;  3V7S A;  1Y0M A;  1TUC A;  1W4S A;  4JPB W;  3CBO A;  1KD1 U;  3DB3 A;  1O75 A;  2O2O A;  1AWJ A;  3QWX X;  3MP1 A;  3JCM f;  2MAM A;  1YIT A;  4RUG A;  1N27 A;  4DOV A;  2JS2 A;  2SRC A;  3CCR T;  4HCK A;  1PRL C;  1QVP A;  1D1A A;  3C94 A;  2E4H A;  1UGV A;  2K3X A;  1UHF A;  4ZGE B;  2DD4 A;  3HRU A;  1HYO A;  2PVG B;  4XTX A;  3L2U A;  2JOY A;  3EG0 A;  3URG A;  2LQK A;  3CCQ A;  1VQP T;  1TWB A;  4J6Y A;  3UT1 A;  5GMK m;  1MHN A;  1Z9Q A;  5KYW A;  1UEB A;  2DYI A;  1K73 R;  2LVM A;  3BDU A;  2DEU A;  1SPK A;  2XK0 A;  2I2L A;  2HSP A;  5KYU A;  1D0Z A;  2AK5 A;  2V1Q A;  3CCM Q;  2W10 A;  1K0S A;  2F2V A;  2CZ6 B;  1WJQ A;  1U3O A;  2K2V A;  2JM8 A;  3TSW A;  4OGE A;  1Y96 B;  1BI2 A;  1IGU A;  5DLQ E;  3CCS T;  2LQW A;  3CCU A;  3CCJ Q;  4QQD A;  2KY9 A;  3HL8 A;  3QXE B;  4E2F B;  1PD0 A;  4Y92 A;  5LL6 S;  2HL3 A;  3UDC A;  2D0N A;  3CCE T;  2ESW A;  5FRO A;  2LNV A;  4HVU A;  2CP6 A;  1YIT Q;  1GCQ C;  1B3Q A;  3QDF A;  3QBY A;  4EDU A;  4OMM A;  3SWN A;  2BUD A;  3EHR A;  5CK9 A;  1UJY A;  1RAE B;  3X28 B;  5FU6 C;  4OB2 B;  1VA7 A;  4BD3 A;  3A8G B;  1G2B A;  4PJN A;  5IHI A;  1JEG A;  1OU9 A;  3SDZ A;  1V76 A;  1WZO A;  3S3N A;  1Q82 R;  4XU1 A;  2RD1 A;  5L8R E;  3VS6 A;  4RTZ A;  4BDY A;  3CCQ Q;  1I5O B;  1GL5 A;  4M7A C;  4CC3 A;  3RKW A;  1VQ4 T;  3PVL A;  4MZT A;  3OBY A;  2EW3 A;  3QZ5 B;  2E3H A;  4O5V A;  5I2M A;  2DIL A;  3N5B B;  3A1P A;  3RES A;  3MKD A;  4C8Q D;  2CSI A;  1MV3 A;  1QCN A;  1JB0 E;  2RQW A;  2CP5 A;  3DLM A;  4ZNX A;  3UPU A;  4IUP A;  3M0U A;  3CCU Q;  1CKB A;  3QSU A;  3QG1 A;  1SHF A;  1VIE A;  5GAO r;  2F1L A;  2ROL A;  2COW A;  1EFN A;  2DK3 A;  4RTU A;  3FRN A;  1W70 A;  3FDR A;  2EWN A;  3LH5 A;  3CD6 T;  2D9T A;  3EGX B;  1UGP B;  5FLX E;  3OY9 A;  3VS3 A;  3LGF A;  1D1C A;  3JCM V;  3A8H B;  4XTU A;  3EGD B;  2HKN A;  1QMC A;  4P5N A;  4B6M A;  4BUG A;  2CT4 A;  1WFW A;  1PSE A;  1N8R U;  1ACM B;  1PSF A;  3NPF A;  3PVQ A;  4KUL A;  4E7K A;  2K9G A;  5GAN g;  2DIG A;  5KE3 A;  1Q81 R;  1KQ1 A;  4EMK B;  2Y4X A;  1QQJ A;  2DTO A;  1VYU A;  1YJ9 T;  5D6W A;  1M90 R;  1ZA2 B;  3ULR B;  2VVK A;  3M55 A;  5KYY B;  3OYA A;  2LZ6 B;  5GAN 3;  1G5V A;  2LC4 A;  2PZ1 A;  1LJO A;  1M1K C;  1WHH A;  3OW2 P;  1WQ7 A;  3OYY A;  3CCM T;  5GAN f;  3LH0 A;  5FU7 B;  2RHX A;  1TU0 B;  4QT7 A;  3OS5 A;  2KSS A;  2KRN A;  2O4X B;  1RAF B;  2V26 A;  1K73 C;  5GAN 2;  1KK7 A;  4DBF A;  4M78 E;  3JB9 J;  3C12 A;  3GPL A;  1X75 C;  4X34 A;  4M7D B;  1JJ2 S;  2X9H A;  4FYV B;  1WI7 A;  2QDY B;  1RLQ C;  4WCI A;  4AMC A;  5IH2 A;  1NJI U;  1YIT T;  4XQ3 A;  1Y71 A;  1WDX A;  1MND A;  2MWO A;  2OX7 A;  2XDP A;  3TEE A;  4RG8 A;  1RAI B;  1BYM A;  4J9G A;  1N8R C;  3EFO B;  3LGL A;  4FYX B;  2RNA A;  4JS4 A;  1WHM A;  4JRI A;  4LUE A;  4FYY B;  4KGV B;  1G3Y A;  2ZPI B;  3BDL A;  3WVD B;  2K5F A;  4N4H A;  3VS2 A;  4E47 A;  4AT1 B;  2ZPF B;  1Q86 R;  2X3X D;  2YRV A;  2DTI A;  2ATC B;  4MZP A;  3O5Z A;  3S6W A;  3MP8 A;  3JCM h;  2X4X A;  2XIC A;  2DD5 A;  3QWY A;  3HHT B;  2NUZ A;  5GMK e;  1P92 A;  2E64 A;  1YJN T;  1WNL A;  5LJ5 h;  4A4F A;  1GBR A;  2DXB A;  3CXC S;  1G8X A;  4M75 E;  1M9S A;  1D0Y A;  1X6G A;  4A4E A;  2JTM A;  3ER0 A;  1HD3 A;  3M4Y A;  2DA9 A;  2YSQ A;  2JMC A;  4J9D A;  2LCL A;  3HRT A;  1NJI C;  4HT9 A;  3UWN A;  3VUZ A;  1MMN A;  1ZA1 B;  5GAN 8;  1YJW A;  1LCK A;  2EQJ A;  1NLP C;  1MGQ A;  4Z88 A;  2YUO A;  4FYW B;  1GCQ A;  2E70 A;  1YWO A;  4Y91 A;  1NEG A;  3CEY A;  3CPW S;  4XAX B;  5CAI A;  3HRS A;  1M2O A;  2RI2 A;  6AT1 B;  1VQO A;  5KE2 A;  4PJO G;  1ZUU A;  3E9G A;  2CYZ B;  2VAS A;  3M0S A;  3EG9 A;  4OGC A;  4WF2 A;  3TU4 K;  1YHQ A;  2IIM A;  2KRS A;  5KYN A;  5KYW B;  4M7D F;  2KE9 A;  2RQU A;  4M78 G;  1GXI E;  3EFS A;  1WLP B;  5KYU B;  4C0G A;  5GAO p;  1KFZ A;  2CUB A;  2DIQ A;  2V8I A;  2BE9 B;  3C95 A;  4J9C A;  1UGQ B;  5GAN 4;  3JB9 F;  1WQW A;  4BE2 A;  1K0X A;  3JCM d;  3OYG A;  5GAM j;  1SG5 A;  2B8A A;  3CC2 A;  1QLY A;  5LJ5 d;  2MMP A;  3EH1 A;  1M2V A;  2XID A;  1NEB A;  4KUI A;  2IG0 A;  2VXE A;  2EQK A;  3V7R A;  2WSF E;  5FWC A;  2KVQ G;  2M1H A;  1YJW Q;  1PNJ A;  2EYX A;  4Z89 A;  4RMO A;  1T0J A;  4A4H A;  3NTH A;  5A0L A;  4L6V 5;  2DAQ A;  3SWN B;  3CBP A;  4XU0 A;  1KD1 R;  3C0C A;  1NLO C;  4M77 G;  4RCC A;  1X6B A;  1M8V A;  4C0F A;  2L8D A;  1WA7 A;  3E2U A;  1VQO Q;  4FU6 A;  1QW1 A;  1H3Z A;  4LUD A;  4VUB A;  1YHQ Q;  2CZ0 B;  2QQB A;  7AT1 B;  5IAY A;  1ABQ A;  1FMW A;  1MMA A;  4M75 G;  4RTX A;  3OYK A;  2V8K A;  1WIE A;  2P4T A;  4PJM A;  2FPE A;  4ME7 A;  3QUI A;  3QKJ A;  4IUT A;  1U8R A;  5GAM e;  3JRZ A;  1HJD A;  4JLG A;  4L59 A;  2QEX T;  1JJ2 P;  1JJ2 A;  4B9W A;  3CC2 Q;  1D3B A;  2MOX A;  2YXY A;  1D0X A;  1YI2 A;  3RDV A;  4C8Q E;  5CR2 A;  4OF1 A;  3PMI A;  3P8H A;  1AWX A;  3MEA A;  3RER A;  1OQK A;  1PCX A;  1UEC A;  1I5L A;  3VS5 A;  4MMK A;  2XI9 A;  3WVE B;  2QI2 A;  2QTX A;  3PMT A;  2EKH A;  2XDD A;  2DL4 A;  3OMG A;  3G6E A;  2QYZ A;  4J9E A;  3OYL A;  4Z8A A;  2PTK A;  5DLO A;  1RAA B;  2EGC A;  4C92 G;  1GFC A;  2JJ9 A;  5GAN h;  1T3L A;  5L23 A;  3OS1 A;  4HT8 A;  5LJ3 g;  2KMT A;  2RA2 A;  4DBQ A;  2EQM A;  3CXC P;  2EYQ A;  1OZ3 A;  1LVK A;  1XQH A;  2OTJ A;  1UUE A;  1M4Z A;  4F04 B;  2O9S A;  4BI4 A;  1YBY A;  3OW2 S;  1VQ9 A;  3X26 B;  1ABO A;  3EH2 A;  2KEA A;  4KH0 B;  2RMO A;  1YI2 Q;  2RJC A;  5CVI A;  2OJ2 A;  1VQ7 A;  1QKW A;  4F16 A;  1VQ8 A;  4AFU C;  1NE8 A;  1PD1 A;  5FWB A;  1GFD A;  1JXM A;  5LJ5 f;  2GFA A;  3OYH A;  1M1K R;  4KRT A;  4RTW A;  4J9H A;  1V1C A;  5GMK l;  1UB4 A;  4CC7 A;  2E12 A;  3H0I A;  2NWM A;  3CPW P;  3FEO A;  2FG0 A;  3CPW A;  2FZC B;  3G6E Q;  3CMA A;  2XU8 A;  1IHV A;  2O01 E;  1TG0 A;  1KC8 U;  1R0B G;  2XHC A;  1VQ6 A;  2CT3 A;  1YJW T;  4M7D D;  2LMJ A;  4IIM A;  3OYC A;  1Q95 G;  1C1A A;  2NLU A;  3FJP A;  3P8D A;  4PJO C;  1Z9Z A;  5J3B A;  1ARK A;  3QPH A;  1R0C B;  3TRE A;  3JB9 D;  4L5G A;  4B9X A;  1XTD A;  2HCK A;  2LP5 A;  4HCZ A;  2OTJ Q;  5GAN d;  4M78 C;  1N8R R;  1KSW A;  2QA4 A;  1VQO T;  1X6O A;  2JVV A;  3L2Z A;  3PTA A;  2MK5 A;  3REA B;  4C8Q G;  4PLL A;  4Z02 A;  1VQ9 Q;  3QYG B;  4CRI A;  4PFP A;  1VQN A;  1R8O B;  2MCN A;  1XJW B;  1KHI A;  2RO0 A;  1VQ7 Q;  2H8H A;  1KD1 C;  1VQ8 Q;  3G71 A;  2RJD A;  2OI3 A;  1FMV A;  1VOM A;  4IUR A;  3MET A;  2YDL A;  1UDL A;  4N0A C;  3GIB A;  4GBQ A;  2HKQ B;  1B7T A;  2ZAE A;  3RKX A; 
#chains in the Genus database with same CATH homology
 4AFQ C;  2KRN A;  2GNC A;  1H92 A;  4OMO A;  1X27 A;  2D8J A;  1QWE A;  1WX6 A;  1M8M A;  4RTT A;  2EBP A;  2GBQ A;  1RI9 A;  1NYG A;  1SHG A;  4JJB A;  2RN8 A;  1WI7 A;  3I35 A;  5IHK A;  3PE0 A;  2DL8 A;  1QWF A;  1RLQ C;  4WCI A;  5IH2 A;  1JU5 C;  4CC2 A;  1N5Z A;  2CH4 A;  2ECZ A;  1WDX A;  2EYZ A;  1PKS A;  1X2K A;  1CSK A;  2V1R A;  1UTI A;  1FYN A;  4J9G A;  2JMA A;  2LQN A;  1OEB A;  1FMK A;  2CDT A;  3EGU A;  2RNA A;  4J9B A;  1AWW A;  1JXO A;  1M3A A;  4LUE A;  2BZY A;  2LNH B;  2DF6 A;  4ORZ A;  3SHW A;  4D8D A;  1UE9 A;  2KGT A;  1IO6 A;  1X2Q A;  2KRM A;  1SSH A;  3VS2 A;  2AKK A;  1PHT A;  2KNB B;  1VYT A;  2HDA A;  1K4U S;  2X3X D;  1JO8 A;  1AOJ A;  3O5Z A;  2M0Y A;  2P4R A;  1QCF A;  3CQT A;  3QWY A;  4D8K A;  2NUZ A;  1SEM A;  1GCP A;  3I5R A;  2KYB A;  4AG2 C;  1Y57 A;  1GBR A;  1W6X A;  1RUW A;  1ZLM A;  2FPF A;  5ECA A;  3EG2 A;  1WXT A;  2A37 A;  1ZX6 A;  4A63 B;  1X6G A;  2DRM A;  4CC4 B;  2DLP A;  2EGA A;  1T0H A;  2PNI A;  2DM1 A;  2BZX A;  4HVW A;  3NMZ C;  2DRK A;  2B86 A;  2K7A A;  1GBQ A;  2CUD A;  2CSQ A;  1HD3 A;  1NYF A;  2DA9 A;  2YSQ A;  2CH4 W;  1I0C A;  2JMC A;  4K11 A;  4J9D A;  1M30 A;  2HBW A;  1WXU A;  3A98 A;  2GTO A;  3M0Q A;  2YUN A;  1LCK A;  1NLP C;  1KJW A;  1OV3 A;  2J05 A;  4EIK A;  1MV0 B;  2YUO A;  3I5S A;  4OMN A;  4Z88 A;  3FJ5 A;  3THK A;  1AZG B;  1HSQ A;  3M0P A;  2KT1 A;  1GCQ A;  1YWO A;  2A28 A;  2L3S A;  2O9V A;  2EGE A;  3VS1 A;  1UFF A;  2O31 A;  1NEG A;  3EG3 A;  1K9A A;  2J06 A;  2L2P A;  4J9I A;  1J3T A;  2K3B A;  2DE0 X;  2KRO A;  2I0N A;  5IXB A;  3H41 A;  4RTY A;  1ZBJ A;  5I22 A;  2JXB A;  2LX7 A;  1I1J A;  2CRE A;  1XOV A;  2DYB A;  4LE9 A;  1U5S A;  1JQQ A;  1ZUU A;  2AZV A;  3TSZ A;  2J6K A;  3M0S A;  3RNJ A;  2IIM A;  2JTE A;  2KRS A;  2DVJ A;  3VRY A;  4OMP A;  1OPK A;  2KE9 A;  5IXF A;  2DX1 A;  2RQU A;  2RQT A;  3GBQ A;  4ESR A;  4JZ4 A;  3VS4 A;  1WLP B;  1KFZ A;  2FEI A;  2CUB A;  2K6D A;  1T3S A;  3I9Q A;  2FRY A;  2DBK A;  2EYW A;  2EPD A;  1AD5 A;  1K1Z A;  2VKN A;  4J9C A;  2RF0 A;  3EG1 A;  1PKT A;  1GRI A;  4DEY A;  4J9F A;  4JJC A;  1I07 A;  1K0X A;  3ZL7 C;  2DNU A;  1E7O A;  2AZS A;  1A0N B;  4AG1 C;  4OMQ A;  2FRW A;  2JW4 A;  2A36 A;  3RBB B;  2A08 A;  1QLY A;  2DBM A;  2KYM A;  2JM9 A;  2W0Z A;  1NEB A;  1X69 A;  2O88 A;  1ZSG A;  2KXC A;  3NGP A;  1KIK A;  2GTJ A;  2C0I A;  1RLP C;  1ZUY A;  2L3P A;  4AFS C;  1AEY A;  5FWC A;  4LN2 A;  1B07 A;  1UHC A;  1PNJ A;  1H8K A;  1Y0M A;  1TUC A;  2EYX A;  4Z89 A;  1AVZ C;  4JPB W;  2O2O A;  1AWJ A;  3QWX X;  1T0J A;  2GQI A;  4HXJ A;  3KFV A;  4RUG A;  2RPN A;  2JS2 A;  2DMO A;  2SRC A;  4HCK A;  3VRZ A;  1PRL C;  2DL3 A;  3C0C A;  2J7I A;  3VS0 A;  1NLO C;  1UGV A;  1UHF A;  1X6B A;  3H0H A;  3UAT A;  1QKX A;  1WA7 A;  3IQL A;  1BBZ A;  1K76 A;  1MUZ A;  1PRM C;  3EG0 A;  4AFZ C;  4LUD A;  4FSS A;  1SRM A;  1Z9Q A;  1ABQ A;  4RTX A;  2AKL A;  1WIE A;  4DEX A;  1YP5 A;  1SPK A;  2HSP A;  2FPE A;  1UG1 A;  1BB9 A;  2AK5 A;  2LJ1 A;  1HJD A;  2X3W D;  3M0R A;  2BTT A;  2V1Q A;  2F2W A;  2FPD A;  2W10 A;  5EC7 A;  1K0S A;  1AWO A;  2F2V A;  3M0T A;  3H0F A;  2RQV A;  1SRL A;  2M51 A;  1M3C A;  1YNZ A;  2MOX A;  1U3O A;  5FW9 A;  4E6R A;  2JM8 A;  3TSW A;  1ZUK A;  1X43 A;  1AWX A;  4JJD A;  2LQW A;  2KR3 A;  3JV3 A;  4LNP A;  1UEC A;  2C0T A;  1YN8 A;  4Y92 A;  3VS5 A;  2BZ8 A;  2D0N A;  2ESW A;  4HVU A;  1GCQ C;  1E6H A;  2EKH A;  1S1N A;  2F2X A;  2DL4 A;  4GLM A;  1B3Q A;  4OMM A;  3NHN A;  3SEM A;  3EHR A;  1UJY A;  1AZE A;  4J9E A;  1W1F A;  3TVT A;  4Z8A A;  3UF4 A;  2PTK A;  1VA7 A;  2GGR A;  1G2B A;  1YWP A;  5IHI A;  1JEG A;  2EGC A;  2JS0 A;  1GFC A;  2DJQ A;  1T3L A;  1UJ0 A;  1PWT A;  4JZ3 A;  3VS6 A;  4RTZ A;  5L23 A;  1GL5 A;  1M27 C;  4CC3 A;  2YUP A;  1WYX A;  3PVL A;  2L3Q A;  2EW3 A;  1OOT A;  1U06 A;  2KT8 A;  2KXD A;  1UUE A;  2DIL A;  1H3H A;  1OPL A;  2O9S A;  4HVV A;  5I11 A;  4F14 A;  2ENM A;  2ABL A;  5IHN A;  4OML A;  2K2M A;  1ABO A;  2C0O A;  2CSI A;  2KEA A;  1MV3 A;  2RMO A;  1E6G A;  2RQW A;  2QDL A;  2OJ2 A;  4RTV A;  4ZNX A;  1QKW A;  4F16 A;  4AFU C;  2EQI A;  3M0U A;  5FWB A;  1CKB A;  1GFD A;  1JXM A;  1G83 A;  2XMF A;  2FO0 A;  2SEM A;  2DL5 A;  2ED1 A;  1SHF A;  1TUD A;  4KRT A;  2J6F A;  4RTW A;  4J9H A;  1V1C A;  2VWF A;  1BK2 A;  4X1V A;  2YT6 A;  3U23 A;  4CC7 A;  3VS7 A;  3H0I A;  1NG2 A;  2ROL A;  1EFN A;  2NWM A;  4RTU A;  2FG0 A;  1BU1 A;  1W70 A;  2YUQ A;  3LH5 A;  1VYV A;  1TG0 A;  2D1X A;  2CT3 A;  2G6F X;  2LMJ A;  3VS3 A;  4IIM A;  2LJ0 A;  3EHQ A;  2KBT A;  1Z9Z A;  2CT4 A;  1WFW A;  1ARK A;  1CKA A;  2HEQ A;  2LJ3 A;  3NPF A;  3PVQ A;  1WXB A;  1M3B A;  2HCK A;  2K9G A;  2LP5 A;  2ROT A;  1KSW A;  2K79 A;  2MIO A;  3UA6 A;  2D8H A;  3REA B;  5HCK A;  2JT4 A;  1VYU A;  5GJW B;  2ED0 A;  2DL7 A;  3R6N A;  4M4Z A;  3ULR B;  2OAW A;  2VVK A;  2MCN A;  2J6O A;  4F17 A;  2LZ6 B;  2H8H A;  2EVR A;  2EYY A;  1YCS B;  2OI3 A;  2PZ1 A;  5GJV B;  3UA7 A;  2YDL A;  4IIO A;  3REB B;  1UDL A;  1NM7 A;  4R0K A;  4GBQ A;  2RQR A;  2E5K A;  2LCS A;  4QT7 A;  2L0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...