5J39A

Crystal structure of the extended tudor domain from tdrd2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
196
Chain Sequence
GRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSKKLDIGLELVHKGYAIELPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Tudor and KH domain-containing protein
total genus 48
structure length 196
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j39A02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j39A01
1STAA 4IKFA 1STGA 1XNIA 3OYMA 4N9TA 4BDYA 5D6XA 2FHDA 2RHZA 1SNOA 4I65A 2F0PA 4WRDA 2EY6A 3OYKA 2O4XA 2VYTA 2F0UA 4NMZA 3MP8A 5K5PA 1A3TA 1SNCA 2F0WA 4RKLA 2L8DA 4E7LA 2F0KA 3D8GA 3OYLA 4KHVA 2EQMA 4A4HA 4N4IA 2F0GA 4A4GA 3E5SA 5CV7A 4IUUA 4PMCA 3MXPA 3NK9A 4E7KA 4NS5A 1ENCA 3BDLA 3OYJA 3ME9A 3U9OA 5CR3A 3PMIA 4IUNA 2F3VA 4ID6A 4K2KA 4CRIA 3OYBA 5KEEA 1WJRA 2F0IA 1EYAA 4K8JA 3L2UA 5E3FA 3VA5A 3TP8A 1EY6A 3MVVA 3MO8A 2BUDA 4KY5A 1H3ZA 3NP8A 4IURA 3BDCA 2XDPA 2ENBA 4QQ6A 2M00A 4DGZA 4QVZA 2PQWA 2RI3A 1EY7A 3EJIA 3P8DA 3L2RA 5E1FA 5CGKA 3D6CA 5C3XA 2JTFA 1WGSA 3TP6A 3LX0A 3OYEA 2F0LA 3ASKA 4QF4A 2X4YA 5IGCA 4KTAA 2NLUA 4BE1A 3OY9A 4RG2A 1TR5A 3C1FA 3OYFA 1SYFA 5KE3A 3NTIA 3OYNA 4IUVA 2MWPA 4EDUA 4ZTFA 1OZ3A 4QQDA 3SK4A 4DU9A 5CIUA 5HGTA 3NXWA 1OYXA 2HQXA 3S3OA 1SNMA 1KAAA 1STYA 5ISRA 5DEHA 2BIVA 3Q1JA 1EQVA 2F3WA 2EY2A 1NSNS 4K5VA 3OYGA 5CV9A 5M9OA 1SSFA 3C4SA 1NUCA 3H6MA 2RHXA 2G3RA 3S9WA 1WJQA 3LH0A 2EKOA 2BKDN 1MHNA 4K6DA 3MEVA 4N4HA 5KCOA 2F0DA 4K5XA 4EVOA 5C6AA 3NTKA 2M0OA 1EY5A 1EY8A 3LX7A 3LYIA 3P8HA 1SYEA 3OB9A 5F2DA 3UT1A 3QOLA 4GY5A 4ZUJA 1STNA 3KUFA 3PNWC 3OS2A 4KD4A 4K5WA 3TP7A 3MEWA 3SK8A 4BE2A 3DB4A 2F0QA 3L2VA 3OYDA 5C4HA 3EVQA 2MWOA 5IOCA 3OWFA 5J22A 2F0HA 3DHQA 4KV6A 4B9XA 1F2YA 5KE2A 2EYFA 2OXPA 3F70A 3FEOA 4PLLA 2PQEA 2DIGA 3L42A 2IG0A 2LVMA 2LDMA 2LTOA 5J39A 1EYDA 3HEJA 4S3SA 2WACA 2NUCA 5IAYA 2X4XA 1JOOA 4G57A 3RUZA 2RJFA 1RKNA 4KY6A 1JOKA 4FU6A 1KABA 2RO0A 2O4XB 1EYCA 4B9WA 1EY4A 2F0NA 2R5MA 1KDBA 3ZEHA 1A2UA 3DMUA 3OYAA 1II3A 1OI1A 3MEAA 2R57A 3QOJA 3PFSA 2XK0A 1SNPA 5KYIA 4LAAA 5KCHA 4PLIA 4R8NA 5IIFA 3E9GA 3T13A 4K8IA 2SNSA 4QW2A 5IN1A 5CV5A 1N27A 4YIJA 2EYJA 1AEXA 2CKKA 2GFUA 4A4EA 3ERQA 3SK5A 3E9FA 1TT2A 2LRQA 3SD4A 4HMJA 5C5LA 3HZXA 4FL6A 1JORA 1OZ2A 1SYBA 5C3WA 2DAQA 2RBMA 2EFIA 1SNQA 2P0KA 3PMFA 2K3XA 5IGDA 3QIIA 3OQ5A 3OA6A 2X4WA 2D9TA 5KIXA 2RHUA 4HTHA 5I9PA 4KJNA 2LCCA 4EQOA 2EYPA 2EY5A 1SYDA 5CV8A 1U9RA 2F5KA 1A2TA 2PZWA 1KDCA 3P1HA 2E6NA 4X34A 5C4ZA 4LD6A 2EYLA 2B8AA 5CV6A 4PL6A 4DFAA 4ZTJA 3DB3A 2F0JA 4BDZA 1EY0A 1KHCA 3CEYA 4EQNA 2F0TA 2E5QA 4UC4A 3ITPA 2F0OA 5CV4A 4IUTA 4E7IA 3EROA 4C5IA 2R5AA 4IUPA 3SHLA 4IUQA 1SYCA 1TQOA 3OS0A 1STBA 5IODA 3NQTA 1EZ6A 4TRDA 5I9OA 2X35A 4N9PA 3META 5C5MA 3MHBA 3C1EA 3EAEA 5EKKA 4EQPA 5EKLA 3L2QA 3H6ZA 3MEHA 1KDAA 1IHZA 3QJ6A 3QB3A 4ZUIA 3NHHA 2SNMA 3OSOA 4QB4A 2GFAA 4RKBA 2RHYA 4NDXA 5I6YA 2QQSA 5JAVA 2PZUA 2EYOA 2QDBA 3SR1A 4ZQ3A 4KD3A 2KQ3A 3LLRA 3MP6A 4HMIA 5FRNA 3S6WA 3QKJA 5J26A 2F0MA 4IZ8A 2RI5A 5IGBA 4II1A 5JOBA 5C0MA 1SYGA 3S3MA 3LGFA 4F7XA 4OVAA 4L59A 3MZ5A 4C5HA 2L3RA 5KGUA 2YRVA 1F2ZA 3D4DA 3T16A 1WJSA 3FDRA 5C6SA 3LGLA 2RHIA 2PZTA 1A3UA 2GF7A 3MP1A 4NKLA 4DF7A 1ENAA 4J6HA 3R3OA 3MEUA 2F0SA 3OMGA 2F0VA 4E7JA 4N4GA 4HCZA 1STHA 2OF1A 4BACA 2JZ2A 3H8ZA 5NUCA 4BD3A 4ME5A 5IGEA 3OMCA 3OYHA 4H7BA 3OYIA 4BE0A 4ODGA 4NP5A 4C5EA 5EGTA 3L2WA 3DLMA 3TP5A 5IGFA 4F8MA 2PW7A 2KHSA 5D6YA 1F2MA 2L89A 2HQEA 2M1HA 1A3VA 1JOQA 2QQRA 5D6WA 4MIUA 2RI2A 4K14A 3D4WA 2OEOA 3S3NA 2F0FA 4E6IA 2RKSA 2EXZA 2F0EA 2K3YA 4PNYA 2EQKA 4KY7A 2EQUA 3V2TA 4Q5WA 5FRMA 2LKVA 4K2LA 2PYKA 3O8VA 5DAUA 5KRUA 5IGGA 1SNDA 2SOBA 3TMEA 5HURA 4J1MA 2RJEA 3FC3A 3OYCA 1RI0A 5CC4A 3M9QA 4PMBA 3SK6A 2PW5A 2DIQA 5FROA 2EYHA 4Z02A 3FLGA 4C5GA 2M16A 4A4FA 1EY9A 4E7HA 5KH6A 3PMTA 3NTHA 2RDFA 5I6WA 5KYLA 2EQJA 3QBYA 4QMGA 4OL7A 5J1ZA 2RJCA 3NUCA 2R58A 4WORA 2RJDA 1G5VA 3P75A 3GOXA 3SXHA 4QQGA 2EYMA 4IALA 4KJOA 1EZ8A 3UWNA 3OS1A 2EY1A
chains in the Genus database with same CATH superfamily
3GTLB 1RTOA 3E0EA 1STGA 4C92C 1ZXTA 2K2MA 1K8GA 1M1GA 4MDXA 2O5IC 1ICWA 3QUIA 1XMOL 2FHDA 2LQ8A 3CD6Q 1SNOA 1TWAH 2C5CA 1G3TA 2CFMA 4XU0A 5CR2A 4JJBA 2Y4YA 3MXGA 3PF5A 2IIMA 3QO2A 3VR4A 3MXUA 4AYBB 5FJ8G 3V8JA 2YUOA 1YWPA 3TZUA 2IT1A 4QIWE 1VQ8Q 1PA6A 5ELCA 1VQ8A 2JN0A 3GO5A 2F52A 4RKLA 1QVPA 1Q8IA 2L8DA 4PFOA 3X28B 4DNTB 2BZ8A 4DV1L 4AQYQ 3CXCA 2RH2A 1TS3A 5LMUL 5CK9A 2ASBA 4KHVA 4JI5L 1WCMG 4ZK9B 3GTGB 3PF4A 4IIMA 2M9UA 3E5SA 3K7UC 2CZ1B 3K6OA 4X3KA 5CV7A 1UGPB 3MXPA 2LJ0A 2WKDA 1C1AA 3CQZB 3R2IA 5FLMH 1XTDA 1CA6A 3BDLA 1KQ2A 1JR0D 1RHPA 2KECA 5A2QL 1UNSA 5LJ5j 2MP1A 3X26B 3HRTA 1CSQA 1NR4A 4DR3Q 2EJFA 2HKQB 1GM5A 1D3BB 2UUCQ 1LYLA 3REAB 3K0XA 1TUGB 2LCLA 4BB7A 2XWBB 1IW7D 2CP3A 4ZN3A 1VQOA 3M4PA 4ID6A 2HHHQ 2FB7A 4K2KA 1PLFA 3OYBA 4YWLA 1WI7A 4LWCA 1VQOQ 1ML0D 2F0IA 5DLOA 3L2UA 1LVKA 1AEYA 4OO1H 4WTOB 1VCIA 1VQLQ 2PI2E 2OTJT 2UXBL 3TQ7P 2DNEA 1N36Q 1SN8A 3A54A 4DR2Q 1VQ9A 3TP8A 1EY6A 4A3IB 3MO8A 2WFWA 1X2QA 1Z7TA 4IO9A 2YRDA 2QEXT 7AT1B 1HFGA 3NP8A 3D7SB 3ER0A 3BDCA 3H41A 1XJWB 1H8KA 2ENBA 2K75A 2YXYA 4FP5D 1N33L 1EQRA 4LXCA 4DK6C 3VS1A 3CMEA 1X65A 3M3YH 1Z6HA 1L1OB 5JJZA 4M7AC 1J6QA 2DL3A 1WTPA 3EJIA 3P8DA 1RF2D 4JI2L 5E1FA 5GAOp 2PQAA 4DV3L 1KC8C 1YCYA 1HQMC 1H9SB 3JAME 2VB2X 3M4OH 4B3TL 2JTEA 1F77A 2NUPA 1B3QA 2IW3A 1WHGA 3EFOA 2PNRC 1WXBA 2OQ0A 1JE4A 1CKOA 1R0CB 2ZTDA 2X4YA 1E7ZA 2Z4HA 3I4MG 5C4XB 4R0KA 2JYOA 5D3IB 2RNAA 1KNEA 2NLUA 3G6JB 3CPWS 2MOXA 3EGDB 2K5VA 3OY9A 4RG2A 3LWIA 1ZSZC 3C1FA 5H1SE 1Y1WH 3OYFA 1LCKA 1XYIA 1MGQA 2GGRA 2SEBD 3I4LA 2BA0A 3NTIA 3OYNA 3X24B 2YTVA 2K52A 4IUVA 1SBBB 2MWPA 2G9DA 2EPBA 1EIYB 3PO3B 3UE0A 2KI7A 4M7DA 4QQDA 3PUWA 4WCIA 5GMKl 1CUKA 2WB1G 4L6V5 4M78E 3S3OA 1HXDA 1SR3A 2K14A 4FXDA 5M5WH 1JWSD 2VB6A 2BIVA 1MMNA 1CKAA 5DEHA 2CSQA 2DXUA 3CCSQ 1LV9A 2PNHA 4GOPC 1XNQQ 1I4XA 1HZ9A 4PJOB 3OSSC 2CREA 4NPSA 5DY9A 1OULA 2X6LA 3C4SA 4JBKA 1NJIR 3H6MA 1VQMQ 1JQYD 1Q1EA 1MMAA 2E2HH 3VRYA 3UE1A 2ZXRA 1FJGQ 2EKOA 4K6DA 1RLPC 2AIRB 1PTOB 3JAML 4EVOA 3JB9G 2ESWA 1UG1A 3LX7A 1ICFB 4ZLTF 4KHPQ 1QVCA 4ZGDB 1EUJA 1TSFA 3BG3A 5EPKA 3S1NH 1F9SA 1AN8A 3UT1A 3CCLT 2B2TC 1SEBD 2C0IA 4LFBL 2EJ9A 2VUMG 4DN4M 4XYQA 2E2JB 3PNWC 1EL0A 1M27C 1TWFB 3K57A 2LQWA 4KD4A 1O9SA 5EKIA 4DQ2A 1I4K1 2QA4A 3IQLA 2V1QA 2N78A 1SE3A 2RHQB 1AE2A 2DKGA 4JZ4A 3PTAA 2FMMA 2CZ7B 3PGGA 4J8OA 4OHJA 5C4XH 4DAYB 5FO7B 1M90R 3OYDA 1C4QA 2RPNA 3KJOA 4IPHA 3S2DH 5IOCA 3OWFA 5J22A 3A8LB 4UHVA 2C0OA 4GLVB 1BI3A 3RMSA 3MCAB 3B6YA 1BNZA 2MNAA 4LF9Q 2EYFA 4GNXA 3CC4Q 3RR6A 1PZKD 2AMCB 1I94L 1K73C 4BY1B 3M7NA 3C46A 3FEOA 4PLLA 3AU7A 2DRMA 4PJJA 4GKJL 3L42A 1T0HA 3M56A 4C0FA 4HIDA 2F03A 2LCSA 3DWQA 1DYQA 2LDMA 3HEJA 4JK1C 1I5LA 4A3IH 4F88A 4ATOA 2WACA 1WVLA 4GLXA 3G7LA 3CC7T 1I4QA 3RNUA 1GXDC 2VQEQ 4GKKL 3RUZA 1EYGA 4C0ZA 4C8QC 2P0QA 4CDEC 1JOKA 1Y1VH 4DAYA 3GTQH 4OB0B 2WAQE 2RQWA 4V0BA 4DR4Q 2LNHB 4LDUA 3E19A 2ZCFB 1S72A 4A3BH 2ID0A 2O2OA 2XHCA 2NVYB 1EY4A 4GOPA 4Y92A 2FEIA 2HD0A 2KSSA 3CU7A 3ZEHA 4OIJA 4FYVB 4EX5A 1WHHA 5HK0A 4UP8A 2LP5A 2H8HA 1LUZA 3HP9A 4TVAB 2I5MX 2QGQA 3HHTB 3QOJA 1I4RA 4Y7NB 3M58A 5KCHA 2CUBA 1X27A 5KYYA 3CPWA 1VQGA 3CKIB 3EFXD 3PT9A 3CCMA 2G9HD 3A8HB 4ZRZA 5IWAL 3S14H 1I81A 4PFPA 4XK8E 5GAN5 4A3EG 3A8OB 1VF5C 5LL6S 5LJ3h 2QGGA 4QY7A 2DVJA 3VDYA 5I11A 4PZ7A 3MAQA 4GLKA 5JEAJ 4TQUS 3PVQA 1EFWA 4BWGB 2E41A 2V26A 3M4YA 1WNLA 1BCPB 4R9WA 1R8OB 1RABB 1HZCA 3I3CA 1I94Q 4QVDA 5CQYA 5GAOr 1Q95G 4X65L 5ECAA 1AEXA 2CKKA 2AUJD 3JCMg 1VQ6A 3KF8A 5M5YB 3HL8A 3A74A 3KLRA 3E9FA 1TT2A 1VQ6Q 2LRQA 4HMJA 3JCMX 2RA4A 2DNUA 4M75E 1AW7A 1EWIA 3FRPB 3GNFB 4M75G 2RQXA 4L5GA 2E6ZA 4MHEA 3ULJA 1SE8A 2UUCL 2J05A 1PRTF 4M77E 2RBMA 2K50A 5FLMG 2P0KA 4JI5Q 2AZVA 5CKHA 3PMFA 1XTCD 2Y90A 2L4NA 3L0OA 4X3SA 4JI0Q 2HMAA 2R7ZB 1E6HA 3RLOA 2K3BA 1X9NA 4JI2Q 3VR5A 1D0XA 1GHJA 2CW0D 1X69A 2D9TA 5GANj 2R93H 4XQJA 4CC7A 4E7SA 5EC7A 1WHKA 3F2DA 2UUAL 4C92F 3HOZH 2DXBA 2CQOA 4EPCA 3S1MB 5IP9H 3FPUB 4XXEA 3SFMA 3BW1A 2ZXPA 3RZDH 2VWFA 2PZWA 2EGEA 1Y1VG 3DXJC 3EA6A 2R7ZH 3CBPA 3S2HH 2E70A 1YNJC 5FLXc 3H15A 3RKXA 1QE6A 2CDTA 3H0FA 4FYWB 1K76A 1MHWC 4A3BG 1LTBD 3PCOB 1PH8A 1N36L 3I56Q 3CCMT 3CAMA 1YHQT 2CWAA 1WHMA 3V7RA 5CV6A 1U5KA 4ZTJA 2IL8A 2XTIA 1NM7A 3GNGA 4LDVA 2UU9L 4L8JA 1IYUA 2LY7A 3KLWA 4HJ7A 4JI4Q 4EQNA 2F69A 4UC4A 3ITPA 2HZYA 2EJMA 3HG9A 3ICEA 2F0OA 2DBKA 5CV4A 5AJ3L 1MMGA 4E7IA 3EROA 4JBMA 3CCRA 3E2UA 1PSFA 1WTRA 2A7YA 3NGPA 2R5AA 1M90U 3CD6T 3A0JA 3SHLA 3FKIB 1QUQB 1HZAA 2Q8IB 4M78A 5LJ3f 1NJIC 1YCSB 1STBA 3S24A 1IBKL 3M3YB 4Z9CB 3ZBDA 2LX7A 4L5QA 3HOUG 4JV5L 1H95A 2W10A 4A3DH 3E9IA 2H1EA 4MZ9A 5C5MA 4JC0A 1QJOA 3MHBA 4JVZA 4C3JG 4PZ6A 2EVRA 1H92A 2XG8D 4GN4B 3H6ZA 3HOUH 2DL7A 1AWJA 4C92E 3KXTA 3CRKC 4OMLA 3QB3A 2C0TA 2R61A 4P75A 1WQ7A 2F1MA 2E5LL 2ROLA 2GN5A 1M30A 2CUDA 2LQKA 4QB4A 2B2YC 2GFAA 1O7LA 2E65A 2EDGA 1D0YA 2UXDQ 4JDSA 3HKZG 4F17A 1G2SA 2VL6A 4JI7Q 1HNWL 4A3IG 3SR1A 2BTTA 2EYOA 4EIKA 1MNDA 1X3EA 1Q81U 5GAHC 2CP7A 4M7AB 2L5TA 5JVG3 3HKZE 3GTLH 3D0FA 1Y96A 4Y28E 5I2MA 4KLKA 1VQMT 4L5RC 4GKJQ 1N32L 5IGBA 1LLRD 4WJ3M 2FJ2A 4FM4B 4II1A 4A93H 4J5YA 1NLPC 2O2LD 3M59A 4DV5Q 3V7SA 1CHPD 4JRQA 1I5OB 4OMMA 2E2IH 1UGRB 2B29A 3F8TA 2VGNA 1S3OA 3V05A 1D1KA 2EVBA 4JI3L 3VJPA 2Q2TA 5FLXL 1U3OA 2OAWA 1O80A 2EJGC 3EIVA 1WJSA 3MFGA 4MMKA 3LGLA 1XMQQ 3RMQA 4YHHQ 4X64Q 5GMKj 1OQKA 4FVMA 4KHZA 1NEGA 4DF7A 3SE0A 1WXTA 4HIOA 2A6EC 2F0SA 3UF4A 2PQAB 5JJIA 1PRMC 4N4GA 3E6ZX 1JBMA 4BACA 2B2WC 3BVGA 4NB3A 1CT1D 1ET9A 1TWAB 4F87A 1TVXA 3PGZA 2IX0A 2AT1B 4NOYA 1Q82U 1WD0A 2E74C 3OMCA 3OYHA 3OYIA 1WTQA 1NZ9A 1RAHB 4C92D 4IIOA 3HFNA 1WCMH 4C5EA 2ECZA 1G6ZA 2FPEA 2VVKA 5AT1B 1K9MC 1QB5D 1SMXA 1QKXA 4CC2A 3DLMA 4JBWA 2UXBQ 1VQ4A 4XYOA 3QDRB 1LT5D 4RCCA 1B7TA 1FYNA 2K4YA 3I55T 1SMYC 4J9DA 5I4DA 2NVTB 1OU9A 2ZPBB 3UA7A 2KEEA 1BQQT 3CHBD 1JOQA 1X2KA 3BU2A 1SG5A 2KVQG 2COZA 2DFUA 5D6WA 5FLXE 4A3FG 4A3KH 5GAOn 3D4WA 3E9HA 1QW1A 5J3BA 2OEOA 4DR5Q 1E2VA 2RKSA 2EXZA 1C7YA 1YJ9Q 4PNYA 1BBWA 4QQBX 3V2TA 1YJ9A 4Q5WA 5FRMA 5GMKe 1L1OC 4OEMB 4R56A 1JRIA 1AE3A 1IGUA 1TWCB 2LKVA 4DR7Q 5IWAQ 1DM0B 2K6AA 3DEPA 4LE9A 5DAUA 2B63H 3CCRT 1PWTA 1W2BP 1FGUA 2E2IB 2EIFA 2RJEA 4J1MA 5CORA 2EBPA 2KE9A 2ALYB 1VYVA 3M9QA 1J3TA 1UFFA 5A0DA 3DM3A 3G6ET 2J6KA 3H3VI 1BO0A 3X25B 3SK6A 2PW5A 5FROA 2HL5C 3NPFA 4Z02A 1E3PA 2PUKB 3UDCA 4QKUA 5I2XA 1QVFA 1Q81R 5LJ5d 2G6FX 4C5GA 3JAMi 1IB8A 4AMCA 2M16A 4RTUA 4A4FA 1HFNA 3KDFB 1WXUA 2K01A 4AYBG 4KKUA 1HA6A 3M0QA 3NTHA 1IKLA 2QTVA 2A74C 2EQJA 3QBYA 2X3WD 1QP3A 2DERA 1K9MU 4QMGA 2F4VL 2RJCA 3NUCA 3CC4A 1FNUA 3QDFA 3A5UA 2AQ2B 1E1OA 4WORA 3S1RB 1E24A 5KNDA 4B3SQ 3P75A 1K1ZA 3H0HA 1PVOA 4LMQD 3GOXA 4NXML 3GF5A 1NYGA 3D3RA 5JJKA 2EYYA 1DONA 3FIFA 1XQHA 1QCFA 1HA5A 4IALA 3EGXB 3HOYB 3DLLA 1VQAA 2YUQA 3UWNA 3V8LA 2G5DA 4LF5Q 4BBSB 3Q6SA 3OYKA 4ORZA 1F1BB 2P84A 3FVQA 3HOWG 2MYSA 2NN6G 4YCUA 5K36H 3M85A 3OS5A 3JCMW 2DTHA 4P71A 2HBWA 4A3LG 4BDYA 3JCMJ 1IXRA 2RHZA 3FEWX 5L37A 2L9HA 1VQFA 3CCJQ 2F0PA 4WRDA 1K0XA 2AKKA 1NAPA 3GTKB 1S5ED 4QIWB 3X3MA 3GTJB 2MK5A 5ELDA 5I21A 4PJOA 3KUPA 3CCVT 2VYTA 1JXMA 2QEXA 1RI9A 4BUGA 1KLGD 2DN8A 2F0UA 2DA9A 2HAXA 3MP8A 1TXYA 1E7OA 2SRCA 1CKNB 4HSVA 3H0IA 5K5PA 3BFMA 1N9SA 5DM63 1KIXA 2KYMA 3H0GB 4AH6A 4M7DC 1KQ1A 2MO0A 3E0JA 1O7IA 3D8GA 3OYLA 1H3HA 3VA7A 1O7YA 1HNXL 3I70A 1Y8OB 2EQMA 4A4GA 2JA5G 2V8JA 2I5HA 5CKBA 4IUUA 5I2SA 3JB9H 3GTMH 2XMFA 3NK9A 1PC0A 2KMTA 2RM4A 1NTGA 1VYUA 4NS5A 3PUYA 4JI8L 5GAMe 2HD3A 3S1RH 4C8QE 2OTLA 3OYJA 2YTYA 3ME9A 2Z6KC 3U9OA 1Y1WB 1X01A 1DD2A 4JI4L 2LX9A 2KT1A 1NNXA 2RCNA 2GBQA 3RKYA 3EN2A 2DRKA 3I90A 4FYDA 3PMIA 3CC4T 4IUNA 4YY3L 4N0AC 1WTOA 1UTIA 3V7CA 1EOTA 4LF8Q 1VMPA 2AKWB 2P0PA 4CRIA 2EYQA 1WJRA 4Y91A 1EYAA 1XNRL 4ANJA 2MO1A 3GP7A 2UUBL 4EMGA 1PCXA 2LNVA 4C8QD 4DEYA 4RGNA 2VXEA 3FPPA 2DK3A 5IP7G 1IYVA 2V4DA 2B2TA 1IRXA 1CKMA 3F2UA 4XT1B 1LNXA 1FNVA 3VYHB 1SHGA 2Z6KA 4X66Q 4XQ3A 5AYFA 4AFSC 1ESFA 2WV6D 2JM9A 1PYSB 1PZID 2HDLA 3IKJA 2BE7D 2NYZD 3J81j 2F2VA 2IJ0A 1GOZA 4QQ6A 5GADC 2XDBA 2DL4A 5EBDA 4A3CG 1TY0A 1EU3A 3HOWH 2RI3A 3I91A 1EY7A 3JCMP 1TWFH 1MJEA 3L2RA 2D0QB 3D6CA 2HCKA 4FSXA 1G2TA 4GN3B 2LS01 2JTFA 5LJ3j 2PU9B 4DOWA 1Q86R 1UUPA 2YYZA 3JB9F 1AVZC 1V9PA 2F2XA 3H91A 3R6NA 3IL8A 5TSSA 2NZOA 3MWYW 1Z9ZA 4DUYL 1VDZA 3I56T 4X66L 4HCBA 3O13A 1VQ5T 2K79A 3OHXC 4VUBA 1TR5A 2K7AA 4C8QF 5KE3A 4J6WA 2JJQA 3Q23A 1EIGA 1SE4A 1ZSZA 1MJCA 4HJ9A 2LC4A 3J80L 1YI2T 2B2VA 4KMUC 4J9BA 2CSIA 1AZGB 1SSOA 2JA5H 5LJ5g 1QWYA 1JU5C 2AHJB 2PI2A 3JB9J 1P8LA 5HGTA 5G3LD 3U4ZA 3CW2C 4U673 2LSSA 2RA2A 2QYZA 2E12A 4OX9Q 5ISRA 3GTPB 1KD1U 3T1YL 2A0FB 1HUMA 1VF7A 1NSNS 2EY2A 2KYBA 2P4TA 4K5VA 3OYGA 5CV9A 2DEUA 2QK0A 1VQMA 1Q7YC 2RDGA 2RHXA 3GTQB 2B8GA 4LJZC 2G3RA 2BH2A 3U23A 2FINB 1U1SA 3FJPA 2V1CC 1K28A 3TS2A 1MHNA 5C6AA 1W1FA 5KCOA 2F0DA 4CDCC 4DXFA 1L2FA 2BZXA 2RD1A 1EY8A 2C9OA 2A28A 3OIQA 3P8HA 1RAGB 4A3EB 3I4MH 2VGMA 2J7IA 5F2DA 4OWXB 3IAYA 2ZPFB 1FJGL 1K0RA 2HNIA 2E1HA 2NWGA 4RGTA 5CYUA 5M3FH 1I07A 3CCQA 4DV0Q 2MQHA 3GBQA 3JCMV 3OS2A 1VUBA 1OXUA 3KBGA 2QA4Q 4KHPL 3G4SQ 1IYJB 6AT1B 1RTNA 2RVLA 1YJNQ 1O7ZA 1P16A 1YNJD 4K5WA 3TP7A 3J81i 3VR2A 2ATWA 1BCOA 1FMWA 1B34A 1N8RC 4ZGEB 1A0IA 1ZYRC 2N3SA 2RF0A 3M9BA 3RDVA 5GAOl 2EOTA 2K5FA 2F0QA 3N6RA 3A7AB 3EG2A 2WAQB 4PJMA 3VUBA 5C4HA 2E10A 2QF7A 1TS5A 1X3FA 1UDLA 5FK9C 4KV6A 2KEAA 5GROA 4B9XA 3TSWA 1TH7A 2DILA 2DTOA 1F2YA 4PJOG 3TSSA 5KE2A 2MHVA 1X56A 2DM1A 2JEAI 1PH3A 1VQ7T 2LT4A 1SXTA 4RMFA 1TG0A 1YNNC 2YHTA 1B2TA 3CC2A 1OXXK 2PQEA 1W4SA 4NW2A 3ULLA 2ZZDA 3CC2Q 1PG5B 2XSCA 2X9HA 5CBAE 2IG0A 5IYDH 3PVLA 3A55A 3K0YA 3UDGA 1A8VA 2AKLA 1FNWA 1N9RA 1SPKA 4OMFB 5IXFA 2X4XA 1WIEA 3X20B 5KYWA 4JOIA 2HSPA 1RKNA 1XPOA 3RLFA 5GAOm 3VYTA 1YNZA 2CGHA 1YJ9T 1H9SA 1JJ2A 1WQWA 2RMOA 1JO8A 2O4XB 2RO0A 4J6XA 2Q8RE 3IRBA 2FPDA 3J80c 2OTJQ 3ZFJA 4UPAA 4B9WA 1OX9A 3HS0C 3OIPA 1S5CD 2M02A 1ZUUA 2KY9A 1DGSA 1S1NA 1RACB 4A3EH 2DMOA 3VS0A 3CCUT 4RUGA 2F0NA 2KHIA 4JUVA 3E3XA 1TWHH 4RG8A 3TBIB 3S15H 4EMKB 4OB3B 2AUKA 2NUZA 2SDFA 4CC3A 2ZPIB 2F4VQ 4A3MG 1GHKA 1YVCA 1NE8A 4KKSA 3HOVG 3M4OB 4CHTB 4LK1C 3PFSA 2XK0A 4JI8Q 4MTKA 4LAAA 3CMET 4TSSA 3H9NA 3HOZB 4UP9A 1V76A 5IYBG 3I56A 2P4RA 4NXNQ 4R8NA 3WWVA 2VS1A 4RTTA 2DD5A 3E9GA 4K8IA 4GN5A 3CXCP 1M3CA 2W0ZA 1UGQB 3A1PA 4JRIA 4NL2A 1LT3D 1JJGA 2SNSA 4CBVA 5C44G 2BE9B 3U9SA 1IBLL 3AB9A 2CYZB 3HOUB 5CVIA 2PMZB 3AFQA 1ZKOA 1C0MA 1KL9A 2TSSA 4CKEA 2FO0A 4YIJA 5BR8Q 2C35B 4FNFA 1B70B 1V1PA 2GFUA 4QVCA 4JI7L 3QXEB 2CP6A 1U4RA 1PM3A 4HR7B 4XAXB 1TUCA 4FT4A 1JT8A 4JI0L 1I0CA 3FKIH 3HZXA 1Y96B 5CBEE 1ZBJA 2R6GA 2L55A 3INZA 1YIJT 2BZYA 1UHCA 2X3XD 2DAQA 1KC8U 1X3PA 4M8AA 1HR0Q 4LF6Q 3M0UA 1SNQA 4M7DG 3AEVA 5CKFA 2K3XA 5HK3A 1B53A 1BBUA 2EGCA 1XMOQ 1D5MC 1SFOH 3QIIA 4J9GA 3QWXX 1I3QH 1YJNA 1NPRA 2B2WA 1TWCH 3VKIA 1TWBA 5FU6B 2XN9C 1U06A 5D14A 4KI0A 2L0AA 1GUSA 2COWA 1DOKA 1X3QA 4HTHA 4A3FB 1XOVA 2OQKA 4KJNA 4YCWA 2EY5A 1K9AA 3M4QA 3CMAQ 1D3BA 4LN2A 4C3HB 2MI6A 5CV8A 4CGYB 4A3GG 1QNKA 1U9RA 3A8IE 3HOXG 2QQ9A 4LUVA 4HCEA 1M3AA 4RGMA 5FOBB 2DX1A 1BYMA 1NYFA 1RJTA 3TZDA 4DAMA 1WFWA 1KDCA 3J81L 2E6NA 4J7FA 3FJ5A 5D7UA 4X34A 2RHSB 5C4ZA 2K1BA 5T1IA 4F16A 2HKNA 4DKAC 2MUYA 4A3DG 3C3LA 2E4HA 4D6WA 4F7UA 2B8AA 2JW4A 4GLMA 4ESRA 1KRTA 4PL6A 3MA2B 2ENMA 1KHIA 2RB6A 4FYXB 4DFAA 2F0JA 2JK8A 2MAMA 5M3FG 2DL5A 3JCMb 3D6WA 3EH2A 1E0BA 2F0TA 4GS3A 3AYHB 1FMVA 4DPGA 4OP0A 2HHHL 3I72A 4IUTA 1G6PA 2KRSA 3HRSA 3CCJA 4C5IA 2J7ZA 4LUEA 3HTRA 1WJJA 2DL8A 1N6AA 4IFDI 1YNXA 3T4AC 3OW2A 1TQOA 2YRCA 1K8AR 4EMKA 3OTOQ 1IREB 3NQTA 1EZ6A 3QZ5B 5KYXB 3RERA 1U1TA 2NWMA 2X35A 1KG1A 1H9RA 5I9OA 2SEMA 2KRMA 2KGTA 5CCAA 4N9PA 3META 5IYDG 4DR7L 2JP1A 4OX9L 3EFSA 3C1EA 5EKKA 4PFZA 1VQLT 4C3IH 1KK7A 1U8RA 4EQPA 4WFN3 3URYA 1Z9QA 4JYAQ 4UAIA 3MEHA 1ZA1B 3GP8A 1JCKB 1IHZA 3M0RA 1PH4A 3QJ6A 4JV5Q 5C0XI 2N8NA 2I0NA 5GAMh 1J5EQ 1G8ZD 2X6GA 2A3LA 2FFKB 2I46A 2VUMH 3VR3A 1HK9A 4NDXA 5I6YA 1S5BD 1AP0A 4F04B 2QQSA 1I4HA 5LL6X 1SE2A 3PO3H 2J4XA 3M53A 4KH1B 1K8MA 3Q22A 1VQCA 4DBQA 2KQ3A 3PUVA 2MIOA 3LLRA 3MP6A 2DJFC 4JI1L 1PTOD 3S6WA 4DUZL 2WSCE 3PE0A 1Q86C 1TWGB 4A3JH 1V43A 4Z89A 3PO2H 2KCTA 4IZ8A 1YITT 1B9NA 4C3JH 1UGVA 1JB7A 2A73B 5CO7A 3J7A5 5C0MA 1GCPA 1SYGA 4A3MB 3LGFA 1G3YA 4OXPA 1YITQ 1NBWA 2HIXA 3K59A 4OVAA 4LF7Q 3EG1A 1A15A 1PFMA 5KGUA 2YRVA 3K7AB 4OWWB 3RNJA 4OF1A 5KYWB 1ZSGA 4F7UB 2M51A 3ONAB 3VRZA 4KGXB 1HQRD 1MSHA 1TIID 2JA9A 2VZAA 3J7ZC 1EFID 1H9JA 1N33Q 4XTUA 2E5KA 2F4IA 4MNOA 2DYBA 5E4WC 3A8MB 4X9DA 1KTKA 3R3OA 5GAN7 3MEUA 4P5NA 2QQAA 2NVQB 5M3FB 2JNGA 1W6XA 4E7JA 4C0DC 1STHA 1CM9A 2PPBC 1MKHA 2K5QA 4J9HA 5GAEC 1XMQL 3S1QB 4BD3A 1VQPA 1M1KC 4ME5A 1Y0MA 2IY5B 1VQIA 2JA7G 4HCSA 4C3HH 2D0PA 2KJXA 5JJLA 4H7BA 1IO6A 4BE0A 2HL3A 4ODGA 2J06A 2ZJRA 2JXMB 2QQBA 4NP5A 4LF7L 2L5QA 3DKMA 3L2WA 4NXNL 4A4IA 1LTRD 1EZZB 4XTYA 1LM0A 3M0SA 3NHNA 1TS2A 2ZGWA 4C92G 1GFDA 1STEA 1B34B 2YUPA 3CQTA 2PW7A 2N55A 2KHSA 2KAFA 1K4US 1S5FD 3OYYA 2XIWA 1Y8PB 3U4VA 2M1HA 1A3VA 1Q86U 1R4QB 4CJ2C 3RBBB 4N0AA 1UB4A 3HOXH 3AQQA 4K14A 4LW1A 1WCMB 2P5ZX 2LT1A 2F0FA 4E6IA 3S1NB 4DBHA 2K3YA 3NELA 5GQOA 1VIEA 2EQKA 2VC8A 2K7VA 3CCET 4KY7A 4ULLA 2WINB 3QWYA 2JVVA 2QEXQ 3WVDB 4M78D 1L0WA 1KD1C 2ICIA 4FF2A 1W6KA 1GO3E 1ABOA 5KRUA 1D1BA 4DR5L 4BI3A 5HURA 4F7UE 1UEBA 5GAN8 2YU9B 2QI2A 5CC4A 1IBLQ 4R1JA 3LWUA 2QDLA 2IPKD 4DUYQ 2QEJC 2TMPA 3M5AA 2FPFA 5CKEA 3P7JA 5EBCA 1EEFD 4A4KA 3VV0A 2E64A 2GCXA 1IHVA 2PVDB 5LJ3d 3JV3A 1UE6A 1Y7XA 5M5XH 5FWCA 2C06A 1EY9A 5KH6A 2AQ3B 2ES2A 4AFQC 1ILPA 3A8JE 2I5LX 1A63A 2LXKA 2A8VA 2Q8TA 1VQPT 3CCST 1UE9A 4LF6L 3L2ZA 1WZOA 2VNUD 2R93B 1WHLA 2NVXH 3U58A 4C8QA 1W3SA 2MJ8A 2EYXA 2DE0X 2CP0A 5FWBA 1CK1A 3PUZA 4DV6L 2JA5B 3J7AV 2DLPA 2MPMA 1EQQA 1PRLC 2QG9B 4E7ZA 3MFYA 5IY0A 4G7ZC 3G4ST 5LMUQ 2EZVA 4C3JB 3AT1B 4GBQA 1GUOA 3OS1A 5A2QE 1Y1VB 4L63B 3CF5A 3BZKA 4KH0B 1RADB 1EX4A 2EY1A 3C12A 1M8AA 3EG9B 4IKFA 3W3AA 1XNIA 4ZCKA 3OYMA 4X9CA 1YZ6A 2Z0SA 1PZJD 2KOLA 3I7FA 1QCNA 4C1NK 1DCZA 5D6XA 4BY6C 1ASYA 4EQ5A 1FR3A 2FRWA 3RKWA 1EOVA 3K7AH 4I65A 1RD9D 3PIP3 3MHXA 2EY6A 1PHJA 2AK5A 3TQYA 2AZSA 2LFNA 4ZKBB 1X6GA 1MV3A 5IXBA 4BY6B 5DM7R 2BE5D 2PMZE 1B44D 2QCPX 1Q90A 2H3EB 3P8BB 3H3VC 2F0WA 2F0KA 4OMPA 1YWOA 1FYCA 3QR8A 1ZX6A 3F2CA 4M7AA 4A3LH 3CCQQ 4M75A 1LTLA 5KYNA 2O31A 3JCMc 2DNCA 2F3IA 1YJNT 1RLQC 4AG1C 2F0GA 2HUGA 4X6AH 1HHVA 3NBHB 1O78A 3I55Q 2K33A 2DPPB 4HVUA 1UUEA 4E6RA 2DJGC 4PMCA 1G91A 4E7KA 2NVXB 1X43A 2XI9A 1ENCA 5M5XB 2COYA 2OAUA 1S72T 1IZ6A 1M8MA 5KYYB 2Z0WA 4QT7A 4OONA 3SEMA 4JRKA 1L1OA 2UUAQ 4RWSC 2OTLT 2ABLA 3G71T 2E76C 4ILWA 3UI2A 1GCQC 2PZ1A 3BYYB 1C8CA 2KBNA 4IFDG 3FB9A 2PVOB 2F3VA 3WOEA 1PD1A 2IX3A 1SF9A 4ZNXA 4DAVA 5HY6A 5M3MH 5KNCA 1LTTD 1QWFA 4JRPA 2FHTA 1QVGS 1AFPA 5C4JB 1M4ZA 4PQXA 1PH1A 3H94A 1FX7A 4A75A 4K0KQ 4N8X1 2L2PA 1M1FA 1VQNA 4KY5A 2EYZA 2A6HC 1H3ZA 3UPUA 4IURA 1GBRA 4DK0A 1HR0W 3T53B 1CZWA 2CCZA 2XDPA 1WPYA 4F14A 5IHKA 1PH5A 2M00A 4DGZA 3QHSA 1YIJA 3G71Q 3QYHB 2PQWA 1UGSB 1OPLA 1PTOC 3GTOB 2NZHA 2OTJA 2A6HD 2EKHA 3TN2A 5CMDA 3LNNA 3RZDB 2HQLA 4FF1A 4J9FA 1V1CA 3LGJA 4C3IB 3KBXA 3T1HL 1WGSA 3TP6A 1NMFA 1VQEA 3OYEA 1ARKA 5GMKi 3ASKA 4QF4A 3WXMB 1ET6A 2HBPA 1QCBD 3DEOA 4KBMB 2M0YA 2RN8A 3CCQT 4NXMQ 1HJDA 5IGCA 4KTAA 4DR2L 2EJGA 1Y57A 4KT0E 4JS4A 1VQ9T 3R93A 4M77B 3G6EQ 3SB2A 3KOJA 1E22A 1Y69U 2DVEA 2ZPGB 1HTPA 2DUDA 5C3EG 2ZJQA 4EDUA 4ZTFA 1OZ3A 1BF4A 5CKDA 2K5NA 4KKTA 4DU9A 5CIUA 3NXWA 4ALPA 1O75A 4PK4A 2HQXA 1SNMA 1LTSD 1K73U 1KAAA 1VIFA 2VASA 1D5XC 1STYA 1TWGH 5GAN6 4A3JB 2K5WA 5EPLA 1D1CA 2OI3A 4G7OC 2LZ6B 1K8OA 3UDFA 2F3WA 4B3TQ 1HNWQ 1CI3M 1NBEB 3QIAA 2ZPEB 2JXBA 2D1XA 3V8KA 2CZ0B 3VS7A 1LTID 4YWMA 5M9OA 4LDWA 1SSFA 1NUCA 3OWEB 2DJZA 5CQXA 4XU1A 4GKKQ 5C4JH 1WJQA 1R0BG 1CSPA 1H9MA 4C3IG 3MEVA 4N4HA 2X4JA 3NTKA 1EY5A 1BXTA 1X55A 1E2WA 5AFWA 3RMHA 1SJHD 2LXJA 3CCEQ 4O2DA 3NPPA 4HIMA 1QZHA 4N8FA 2BH8A 3QOLA 1JB3A 4ZUJA 1TKWB 2E75C 1VQ5Q 1BIBA 3M55A 3KUFA 1F9QA 2D6FA 4R4QA 4XTCS 2J6FA 3HKZB 3K58A 4JLIA 4MZTA 3RESA 4BBSG 2A36A 2EWNA 1JEGA 1ONLA 3D4RA 1FMKA 3M4GA 2H5XA 1MNEA 1ENFA 4OELB 3SK8A 4RCNA 4M78C 2M9VA 1VQJA 5IH2A 1SDFA 3L3OC 3L2VA 4DA4A 3OOCA 4A3JG 1BI2A 3T56B 4A93B 2E2DC 2HSEB 2WSEE 4M7DF 2F0HA 1JWMD 4R8IA 1D1AA 2VQFL 3JCMQ 5IYCH 4HXJA 1S5DD 1PV4A 1FGBD 1SSHA 5ELBA 2BA1A 4X64L 1OPKA 1UEAB 1A6XA 3QO3A 2A68D 2R92H 2HDAA 3IFDA 1RAEB 4V2SA 2PVGB 2JT4A 1KAWA 2AQ1B 4OGQC 4ABNA 4PJOD 4QJFA 4B3RL 1D2BA 3S1MH 2A69D 3A7LA 4IFDH 2JMCA 3GIBA 3OTOL 5J39A 3I4OA 1RIPA 4S3SA 3WOFA 1OEBA 1OV3A 3EG9A 1L0YB 1XWEA 4RHSA 1YN8A 2V8KA 3M57A 1M90C 5IAYA 4LUOA 3VYRA 2Y0SG 3GPLA 4KY6A 4AYBE 5HKCA 1RUWA 1QWEA 3GDEA 4FU6A 1NJIU 3EFRA 5A0LA 1EWCA 2JA7B 1ESRA 1Q3LA 4JJNK 3O5ZA 1EYCA 1LO5D 1U4LA 4RTZA 5K36G 3BYTB 1KSWA 1CKNA 2ZM6L 2WB1B 4A3FH 4A3KG 2ZAEA 5GAMf 4DV2L 2R5MA 5E4XA 1WDXA 3ZJYC 4A93G 1OXSC 1B07A 2DBMA 1NMGA 4BXXH 1I3QB 1BB9A 3OYAA 4DR1L 3FRNA 1SAPA 1VQOT 4FF4A 3RR5A 4QGUA 3SVMA 3U50C 1M3BA 2D5DA 3HGBA 2R57A 4BBRB 1HNZQ 1CHQD 1WLPB 5GANg 2CS7A 2K2VA 3R2TA 1R9TH 4FF3A 3EHRA 2A19A 4MN3A 4O1NA 3T13A 4DR3L 2BE5C 3R6OA 1XX8A 2R92B 5LJ5h 4OGEA 1NCVA 1X54A 1NLOC 4QW2A 1PTOH 3A56A 4JCVE 3HRZC 2BDOA 5CV5A 3CCUQ 1A0NB 1N27A 1KD1R 2BOSA 2N49A 3HOYH 4BBRH 2XD0A 2DO3A 1I4GA 2EYJA 1ASZA 5GMKm 4A4EA 1ZYRD 3UATA 3ERQA 3SGIA 1DZ1A 3SK5A 2DZCA 4A3GH 1ACMB 4PJNA 4PJLA 4FL6A 3JC66 1JORA 4L5SA 5BN5A 2VUBA 3RZOH 1SYBA 3JCMf 1VQNQ 4DV1Q 3TRZA 5GJWB 1KQSA 2GVAA 3F2BA 2EFIA 4BI4A 1KLUD 3J81c 4HJ5A 3HPWA 1SHFA 2CT4A 4JJDA 4A76A 1PKTA 3CC2T 3DUZA 2DXCA 4RFBA 2L3QA 5I2YA 4BY1G 3W1BA 3SDZA 3OA6A 1EU4A 3H0GH 3G7ZA 1IBML 3E1SA 2KT8A 5CAIA 1G83A 3C94A 2Q2UA 2NZ1D 4MDWA 4H02A 5FKAC 5I9PA 2JA6H 5GANd 2LCCA 3DWAA 3GTGH 4EQOA 2LQNA 1AH9A 2CQAA 5BN4A 1J9OA 1SYDA 1EIHA 3ND8A 3EHQA 2KROA 4DR6Q 4FXGC 1A2TA 3EGDA 2O88A 1WA7A 3KF8B 3BDOA 1S40A 4AFUC 4F7UG 4G7HC 1VOMA 1M9SA 2XWJB 2NVQH 4RCBA 5GANh 1I50B 4DK1A 4M75C 2HCIA 4DNIA 5DM73 5IHIA 1I6VC 3NE5B 1X6OA 2CP2A 3V96A 2DD4A 4CC4B 4K0KL 4CKBA 3DB3A 1EFNA 2K03A 3K5NA 4HVWA 2ZXOA 4M77G 4X65Q 3CEYA 1W2BS 3N5BB 1PRTC 4LF5L 2E5QA 4AT1B 4OB2B 4RAUC 2QASA 4CI0C 4QUFA 2K57A 2VXWA 1YNND 3DM1A 5LMNW 1EEID 4MZMA 3PIPA 1A62A 4ZYSA 1XNRQ 4A3MH 2A08A 4IPDA 3I8ZA 1QVGA 1PMRA 2HDMA 1G8XA 5M5WB 2R92G 1PKSA 3M54A 2YWWA 1V8QA 4JI6Q 2HT1A 1VQDA 3RZOB 4JYAL 1N34Q 2MF2A 1C48A 3GTMB 4DBRA 4MMLA 5ELNA 5GJVB 3PIO3 3EH1A 1MSGA 2K5DA 2E2HB 3JCMd 3TEEA 1QMCA 2K6DA 3K5OA 3RN5A 5GAOq 5EKLA 2XU8A 3L2QA 1MUZA 2K32A 4U68A 1IBMQ 2KCNA 1WI5A 3OW2P 2YDLA 4J9EA 1JB0E 2OTLQ 1LABA 1Y8NB 2KHJA 4CJ0B 3JB9I 4FO2A 2L3SA 2B63B 1F9PA 3RN2A 4OO1I 2L11A 1G3WA 2EW3A 4A3CH 4RG1A 5DNFA 3NSWA 4QL5A 1QLYA 3GV6A 4RKBA 4XU2A 2ED0A 2RHYA 1GCQA 1W70A 4PG3A 5BR8L 1FWZA 4J83A 4RGOS 3A5ZB 4HJAA 1M1KR 1B7YB 2PO4A 1F9RA 2XRSD 1SKUB 2WIIB 4KULA 4KN7C 4ZQ3A 4KD3A 4R55A 3KFVA 5IT9L 4GNXB 1WHJA 2XIDA 4HMIA 3LW5E 4LFBQ 4LF4Q 2PCFB 4P73A 3QKJA 4B3RQ 1NY4A 3SEBA 3FMCA 2RI5A 1I1JA 2WAQG 1VQ8T 3QPHA 5GAMg 1BUVT 4DV6Q 1YITA 4FSSA 1QCOA 3S3MA 3HOXB 4UY8C 1VQKQ 4L59A 1HJPA 1GRIA 4JLGA 1YIJQ 1E2ZA 2L3RA 1SRLA 4BBRG 4C2MH 3PSIA 1F2ZA 1SEMA 2VB3X 3T16A 1KFZA 3BZDB 5GANf 1LTGD 3FDRA 2MGSA 2PZTA 3KYHC 4IPCA 3T9NA 2A68C 4BY7G 1PH6A 4OIKA 2GF7A 3KLSA 1RAAB 1HD3A 3EGUA 4BBSH 2L15A 2I0QA 2FRYA 1T9HA 4DV2Q 3ULPA 4C8QG 1BCPC 3CMAA 3NWTA 3OMGA 2YV5A 2ATCB 2EQIA 1BBXC 2JA6B 1CTMA 3EG0A 4HCZA 2OF1A 1KXLA 3VU3C 2XVSA 1B1ZA 3HOWB 1JJ2P 3GLXA 1YHQQ 2DY8A 3NFCA 1D0ZA 1PYWD 2A6ED 1K8AC 3QSUA 3GTJH 2E5LQ 1IW7C 3A8GB 1D1IA 3PO2G 1GJXA 3S2DB 2CWPA 4M75B 3CC7A 2B2VC 3KK7A 1BIAA 1Q46A 4RTYA 2A1AA 1HCZA 3CP0A 2WP8J 1ZSZB 1RAFB 1DXMA 4M1UB 3TDQA 4GZYC 2KXDA 3CCMQ 1HTLD 3STBD 2L89A 2HQEA 2R7ZG 4M78F 5EG2A 4LF4L 2FG0A 5JEAH 2QQRA 3I2ZA 5M3MB 5IYBH 2KENA 1T0JA 3ULRB 2KXCA 2KK4A 3T1YQ 2CVRA 4KUIA 2RI2A 1GXIE 2KBTA 4BY7B 1DOLA 2O9VA 3I4MB 1BBZA 3CCSA 4MTNA 1M5Q1 2F0EA 4X62L 1HNZL 2KCCA 2ROTA 1AZPA 3TS0A 3A8KE 2ZM6Q 2MCNA 4ME7A 4JZ3A 2D62A 5GAN4 3O8VA 2NN6I 5LJ5f 5E7NA 2ZT9C 2VXFA 2JQOA 4DK3C 1SNDA 2GTOA 4DBFA 3TMEA 5IGGA 3IFTA 4DR1Q 1WYDA 2HIVA 2JA7H 3OYCA 4M78G 1RI0A 3VS5A 4H0LC 5G3LF 3JAMc 3I5RA 2LJ1A 1FL0A 2AWOA 3BE3A 1Q12A 4ZKCB 1CSKA 2NUTA 4R4TA 1H641 3J7AF 1PH7A 2EYHA 4KGVB 4DV4Q 4DV0L 3FLGA 1YHBA 2KCMA 5ELOA 5KNBA 4L6TB 3L7ZC 1YJWA 2D0NA 4RA8A 2CP5A 4AFZC 3ZYYX 3CBMA 4E7HA 5FW9A 1ZEQX 2RCFA 1WTVA 1BKBA 2IHEA 1LOJA 1VQ6T 3JCMh 2B8FA 4E47A 2PNIA 4PJOE 1Y71A 5I6WA 4OL7A 2EPDA 1I5FA 4M7DE 3G6EA 4X3UA 2A37A 1IXDA 1PHTA 5IE8A 1WOCA 1B9MA 2R3ZA 3FP9A 1IL8A 2K5HA 1ILQA 5I22A 1K3BC 2B3GA 2JE6I 4QQGA 4HCKA 1CZGA 4LUDA 2EXDA 3TREA 1KRSA 1B50A 2Y0SB 1BOSA 4FW2A 4YWKA 1VYTA 3RLNA 2AWNA 3HRUA 1RDPD 2UUBQ 1WD1A 1ZBXA 1STAA 1KNAA 8AT1B 1QOHA 1OTCA 2BCOA 2K28A 1VQKA 2YTXA 3MXNA 3WVEB 4EMKC 4N9TA 4HA8A 1BU1A 5IT9c 5C3EH 1HSQA 3G71A 4RTXA 1BR9A 1IHWA 1TWHB 4IOCA 2QA4T 1VQ7A 2XNAC 2O4XA 1SJED 4J8QA 4LNQA 3HOVB 4UDUC 4NMZA 2IX1A 4X1VA 4CKCA 2E3IA 3VUZA 2KDSA 3HFOA 1A3TA 3JRZA 1SNCA 3K81C 4RHRA 1VQPQ 3HOZG 4OO1G 4E7LA 2UXCL 2MPXC 2ZJPA 1YHQA 1HR0L 3L1AA 3N52A 2E3HA 1Z9FA 3VYSA 3CPFA 3CXCS 1OO9B 3REBB 4A4HA 3J81E 4N4IA 1U4MA 2IHFA 3EBEA 1Q82C 2K5LA 1I6HB 2JOYA 1AZQA 2K04A 1WX6A 4DAPA 4POFA 2F5TX 1K8AU 2GQVA 3W1GA 3GQBA 3CRLC 2KNBB 2I2LA 4DV7L 3CCUA 3OBWA 1GBQA 4A63B 4B08A 4FIBA 3BS1A 3A98A 3M0TA 3OSVA 1H9KA 4CDFC 5CR3A 2JM8A 2WKCA 2RK1A 4RMOA 1NR2A 1IKMA 3MKDA 4C92A 3VS3A 3KJPA 4HCCA 5KEEA 4K8JA 3VYUA 5E3FA 2UXCQ 3QG1A 2Q2HA 1GUGA 2VUMB 2K9GA 2XRQD 3VA5A 1WFQA 2LMCB 4JI6L 5A0GA 2D8JA 4O0AA 4JOIC 4DOVA 3MVVA 3PO3G 4K6LA 3WDNA 4M77A 2N88A 4XTZA 2BUDA 2GVBA 1X3GA 1BI0A 3JB9D 1GD7A 2JMAA 1PFNA 2K4KA 4M4ZA 3RUXA 3PV0A 5D65A 4CDDC 3PO2B 4Q5VA 4XTXA 2R93G 3BZCA 2LJ3A 2ED1A 4L5TA 4M77F 3I9QA 1Q7YR 4APVA 4QVZA 1TUDA 1LPLA 2NB0A 4A3GB 4QCLA 1NEBA 1BCPF 3MJXA 3MPUB 1T5EA 4HKEA 5FU7B 4KUDK 1VQ4T 2HCCA 5C3XA 5CGKA 3K5LA 1TY2A 1W6JA 1V1PB 2JJ9A 2QGFB 4P72A 4LFCQ 4JW0A 3LX0A 4O6JA 1YBYA 2F0LA 2UXDL 1Q8KA 4RKUE 1XPRA 1NG2A 3LWHA 4EGVA 1UE1A 3ERSX 4BE1A 2RQTA 2BDNA 4DV3Q 3I4NH 4JI3Q 1SYFA 4HAEA 2ICEC 2FZCB 3I35A 4RTWA 3X3NA 1R9TB 4XQQA 4FCYA 1K3RA 2D2CC 1N8RR 4ELZC 1PFBA 1LTAD 3CQZH 4HN7A 1D7QA 2QTXA 1V1QA 1D6EC 3MC0B 4H44C 1BCPD 3SK4A 2IWHA 1J5EL 1JWUD 1OYXA 4LF8L 5KYUA 1RAIB 4B3ML 1VQ4Q 3KF6A 4XTVA 3VS6A 2Z9HA 4PMWA 1OU8A 3Q1JA 1EQVA 2KEDA 4D8KA 3CCVQ 4TKOB 5LHY1 3TVTA 2XGTA 4HEDA 4JJCA 4YTLA 1I50H 3MTSA 3HKSA 3P20A 3S16B 3CD6A 1Q1BA 3R8BA 2YLCA 2DZ9A 5DLQE 3BDUA 1JC7A 1GUTA 2NUPB 4Y52H 3S9WA 3LH0A 3M7GA 4XIGS 3EFOB 5GMKh 1K9MR 1Y07A 2BKDN 3CCEA 3CCRQ 4HT9A 1D5ZC 1TU2B 1OOTA 4K5XA 4LFAL 2M0OA 1LACA 4F7UF 1SMYD 3LYIA 4J15A 1SYEA 5KYXA 3OB9A 5C44B 1Q82R 3UDXA 1PSEA 1QQJA 1IGQA 3HFZB 2B63G 4GY5A 2LMJA 2CH4A 1YI2A 5A35A 3KFUA 2E8GA 4Z88A 1BVSA 2J0TD 5JPNC 3TEHB 1STNA 1WTXA 2I07B 5IT9E 3I55A 2EAYA 1HZBA 3CCJT 2PUOB 3J80E 3H09A 4X62Q 1GUNA 3MEWA 1Z47A 4DXGA 2NYSA 1CA5A 3I4NB 4B6MA 5HCKA 3S1QH 2NN6H 1PFSA 4BE2A 5ELEA 4M7AG 4ZGJB 1K83H 1KJWA 3DB4A 2MFIA 4JPBW 3FDTA 3NQIA 3C95A 1SRUA 3EVQA 2MWOA 4WJ4A 1XPUA 3K8AA 3DHQA 1OX8A 1QKWA 4M7AD 5ELFA 4HVVA 2NBFA 3MEFA 4IJLA 1MMDA 3M0PA 3C2PA 2NVTH 2M2LA 2GNCA 2NTSA 2OXPA 1NPPA 1MD2D 3D31A 1BI1A 3F70A 3PQIA 4DV4L 2DXTA 3PIOA 2VY3A 4BXXG 1HRJA 2DIGA 2OJ2A 4JBJA 3GTKH 2KVMA 2CW0C 3HP3A 3W2DA 3S16H 2H3JA 3LH5A 5GANe 2D0OA 2Z1CA 2LVMA 1D8LA 4CJ1B 1VQ9Q 5C4XG 2KR3A 2LTOA 2XICA 5L8RE 1EYDA 2L1BA 5EPJA 4BY7H 3SWNA 4XT3B 1TOVA 3GV3A 1HPCA 2NUCA 3GD7A 1JOOA 1ZLMA 4G57A 1BDOA 2RJFA 3HOYG 3J7YW 2JS2A 1ZUYA 1I4PA 1OXVA 4LFAQ 4FW1A 1KABA 1EQTA 1Y1WG 4A54A 1AHJB 1T3SA 2O9SA 1AD5A 4M77D 2QILA 3SHWA 1DOMA 3CPWP 1VQBA 1K0SA 3AMUA 1K73R 1KDBA 2KRNA 1A2UA 2B2UA 5GAN2 1IL2A 4RTVA 3DMUA 3ND9A 1CFMA 1GL5A 4C92B 4FT2A 1GVPA 4OMNA 1QILA 9ATCB 1YI2Q 2R7FA 3NBHA 1IBKQ 1II3A 3CC7Q 1GKHA 1OI1A 5C0XJ 3MEAA 1UJYA 2DY7A 4HJ8A 5HGQA 1SNPA 2L3PA 5KYIA 3NENA 4RCOA 3NBIA 4LUZA 4IFDJ 3H0GG 4PLIA 4DA2A 1TS4A 2FYKA 5IIFA 3SWNB 1N32Q 4DV7Q 1K83B 2ZTCA 3F1ZA 4KK7A 1XNQL 2JN4A 4M7AE 1X32A 1M8VA 2JSOA 4M7DD 1ZA2B 3S17H 5IN1A 3CCVA 2KQWA 1YHAA 4HIKA 4FXKC 2JA6G 4IN3A 2FXQA 2JA8H 4J7IA 2OT2A 1RCVD 5FU6C 8ATCB 3I4NG 4BY1H 3TCJA 1S4ZA 2R7DA 5IP9G 3SD4A 5C5LA 2AHOB 4G4KA 1WTHA 1OZ2A 1Q7YU 1JE5A 2GQIA 1BK2A 5C3WA 2EGAA 3W5OA 5C0XH 1U4PA 3BVMA 4XU3A 2YLBA 2NVYH 3T51B 1HNXQ 5JVH3 4MZPA 5IGDA 1M2VB 2DYIA 3OQ5A 1MBYA 2B2UC 2OCEA 2Y4XA 4C3HG 3S2HB 2NUTB 4D8DA 5GAMd 4LDXA 3CMEQ 2X4WA 2H4OA 3PUXA 1UJ0A 4IJHA 2E2JH 1AWWA 5KIXA 2RHUA 2V8IA 2RQRA 5KYUB 1E1TA 5IGFA 5GAN3 1C9OA 1V1OA 2O5JC 4NL3A 4A53A 3KLSX 2EYPA 4IOAA 4YHHL 2VQFQ 2IVWA 2YU9H 2O01E 1QZGA 3GTOH 2XDDA 4ME3A 1N8RU 1JQQA 2F5KA 5FJ8H 3S14B 4PJOF 3TU4K 4OMQA 3STBC 1VS0A 3GTPH 2YT6A 1G2BA 1YP5A 3P1HA 3RIRA 3SWNC 1KQSS 2F2WA 2UU9Q 2QAZA 4LD6A 4KRTA 3AHUA 4HSPA 2CH4W 2JTMA 1QG7A 2DF6A 4OGCA 2FL7A 2EYLA 2Y0SE 5EJWA 1JXOA 4M7AF 4BS9A 5IP7H 1R77A 1YEZA 2Z4IA 3KF6B 2DJQA 3BVZA 3G48A 4LFCL 2QXFA 4BDZA 3S17B 1YFNA 1EY0A 1KHCA 3VS2A 1R4PB 3S15B 5T1GA 4DR4L 1G51A 3NMZC 4LF9L 4POGA 1RODA 4C0DB 2JA8B 2L12A 1T3LA 2EJFC 4JG2A 4O42A 2VQEL 4PJOC 2CZ6B 2A69C 4GOPB 2QW7A 4IUPA 1C6VX 1VQ7Q 3UDIA 3I5SA 3VR6A 1M2OA 1G3SA 4IUQA 4PNOA 1SYCA 3OS0A 1LJOA 1DJRD 1TS9A 4C0GA 1JICA 3CCLA 5IODA 2KA7A 2MMPA 2VW9A 5D3DA 2ZPHB 2Z6BA 1FXXA 3G1JA 1PRTB 2EE1A 3CCLQ 2EYWA 3L9AX 4TRDA 3HSBA 4R4CA 4WJWA 1PD0A 3Q0AA 1MGSA 2NTTA 4C56C 4B3MQ 5JPMC 1DJ7B 1CQVA 2OWOA 1OXTA 2K5IA 3EAEA 3QYGB 4AQYL 4GLAC 1FD7D 2V1RA 4XTWA 1J8IA 5M3MG 2QDYB 1HXYD 1QVGP 1KDAA 2K05A 1MV0B 2CKZB 1E6GA 1UE7A 5EAYA 1M1KU 1M4VA 5LJ5e 4ZUIA 1HYOA 2DETA 1TTHB 4DNRB 4P74A 4R4OA 3Q24A 2OX7A 1I8FA 4GNXC 3NHHA 2SNMA 3OSOA 1ABQA 4TVRA 1BCMA 2JUFA 1XXGA 3KDFA 5JAVA 1SROA 2WB1E 3THKA 2PZUA 2QDBA 2CHBD 4LNPA 5FU7C 2X51A 3JCMe 4M78B 1Y14B 1QVFS 2RQVA 4DV5L 2QKIC 1QUQA 5FRNA 1GFCA 5J26A 1QP2A 4ZAIA 3H3VH 5L23A 1UE5A 2YUNA 2F0MA 1SRMA 3NWSA 1SFOB 5EQ0A 3T1HQ 1EIFA 4B3SL 2RSOA 5JOBA 1HH2P 5M5YH 1JMCA 1VQLA 2JEBI 2RF4A 3OBYA 1FVIA 4LD9K 1Q81C 4F7XA 2GA4B 3MZ5A 4C5HA 4ELYC 3BJUA 1AWXA 2JS0A 1RL2A 4E2FB 4I7AA 4KGZB 3AFPA 3D4DA 1L0XB 2EQSA 1B3AA 5COYA 1PTOF 5C6SA 2RHIA 5FO8B 3QWNA 1A3UA 3JSCA 4LDYA 2PTKA 1MI2A 3MP1A 3HOVH 4NKLA 4Z8AA 2J6OA 1CQFA 1ENAA 4J6HA 5C44H 1S72Q 5LMNQ 1U0LA 2RQUA 5C0XG 3FHWA 1JJ2S 1PRTD 2B39A 2F0VA 4YCVA 2DGYA 4DUZQ 2D9UA 4OB1B 3I73A 5C3EB 2JZ2A 3CMAT 1VQNT 3H8ZA 5NUCA 4C2MB 5IGEA 2B2YA 2KUMA 3OPOA 4AIMA 2FZGB 4YY3Q 1B4OA 1PH2A 4IQZA 4A3KB 3VS4A 5LJ3g 3Q8DA 5EGTA 1AOJA 5FO9B 2RK2A 1SLJA 1F2LA 3MXNB 2DEQA 4M77C 3RD4A 3TP5A 4F8MA 1C0AA 3ZL7C 4M7DB 2A5HA 4R4IA 5D6YA 4RH6A 4K11A 1F2MA 3CBOA 5AJ3Q 4DR6L 1HUNA 3QZ9B 4JI1Q 2F1LA 5LMNL 3NEMA 1W2BA 3EG3A 2ZTEA 2DTIA 2GTJA 1PH9A 1TXQA 1I6HH 2D8HA 1ZHIA 4MIUA 3L2PA 4M75D 3UA6A 3S3NA 4V190 4WF2A 1MIUA 1N9WA 2EQUA 3URGA 4DEXA 4J9CA 1KIKA 1X75C 4FYYB 4C8QB 4IPGA 1LT6D 4M75F 4XQNA 1QVFP 1ZUKA 1XJVA 1VQHA 4J6YA 4K2LA 2PYKA 2IPOB 1VQKT 3EQLC 4BA2I 2SOBA 2FZKB 3EGXA 3FC3A 1VQ5A 1TU0B 4A3BB 1ZQ1A 4I7ZC 1VMCA 4A3DB 1P92A 5IYCG 2VKNA 1M2VA 2CT3A 4PMBA 3K5MA 5BN3A 1WTWA 3K80C 1WYXA 1UAPA 2DIQA 4X3TA 2Q2IA 1PNJA 3C0CA 5IHNA 1YJWQ 2RSNA 3OW2S 1UWVA 4BA1I 4OMOA 1JJCB 1NE3A 4XDXA 5GAGC 5JEAG 1AWOA 3QJYA 1KQSP 1N34L 1GUWA 3G4SA 4KN4C 1X6BA 1V29B 4EMHA 4Y7NH 2FVUA 3PMTA 1YJWT 1EWHA 2JA8G 1B8AA 1UECA 2XKOC 2RDFA 4OWTB 2VV5A 5GAMj 4PV1C 5KYLA 2HEQA 1UHFA 1KC8R 2HQHA 1AT1B 4FDBA 5J1ZA 4QUCA 4JS5A 4J9IA 1VA7A 3LWEA 2R58A 4PZ8A 4ZN1A 2RJDA 2WSFE 4PKCC 4HT8A 1G5VA 3FKIG 4BI8B 2X69A 2L0CA 2Z8LA 1LT4D 1PXUA 2FMCA 3SXHA 2B86A 1PYBA 2RDHA 4C1NI 1N5ZA 1AZEA 3DWPA 1QNUA 4P2CB 2EYMA 1CKBA 1G291 1D09B 4AG2C 4O5VA 4H13C 4KJOA 3J80i 1PDQA 3OW7A 1EZ8A 2YSQA 3BY7A 3TSZA 4Q0FA 1U5SA 3VYGA 4UP7A 1T5XD 5LJ3e
chains in the Genus database with same CATH topology
3GTLB 1RTOA 1STGA 4C92C 1ZXTA 1M1GA 4MDXA 2O5IC 1ICWA 3QUIA 2FHDA 2LQ8A 1SNOA 2C5CA 1G3TA 4XU0A 5CR2A 3MXGA 2Y4YA 3QO2A 3VR4A 3MXUA 4AYBB 3V8JA 3TZUA 2IT1A 5ELCA 1VQ8A 2JN0A 3GO5A 4DNTB 4RKLA 1QVPA 1Q8IA 2L8DA 3X28B 3CXCA 2RH2A 1TS3A 5CK9A 4KHVA 4ZK9B 3GTGB 2M9UA 3E5SA 2CZ1B 3K6OA 4X3KA 5CV7A 1UGPB 3MXPA 2WKDA 3CQZB 1XTDA 1CA6A 3BDLA 1KQ2A 1JR0D 1RHPA 2KECA 5A2QL 1UNSA 5LJ5j 2MP1A 3X26B 3HRTA 1NR4A 2EJFA 1D3BB 2LCLA 4BB7A 2XWBB 1IW7D 4ZN3A 1VQOA 4ID6A 2FB7A 4K2KA 1PLFA 3OYBA 1ML0D 2F0IA 5DLOA 3L2UA 4OO1H 1VCIA 2OTJT 2DNEA 3A54A 1VQ9A 3TP8A 1EY6A 4A3IB 3MO8A 1Z7TA 2QEXT 1HFGA 3NP8A 3ER0A 3BDCA 2ENBA 4FP5D 3CMEA 1Z6HA 5JJZA 4M7AC 1WTPA 3EJIA 3P8DA 1RF2D 5E1FA 5GAOp 1KC8C 1YCYA 1HQMC 1H9SB 3JAME 2VB2X 1F77A 2IW3A 2PNRC 1JE4A 5C4XB 2X4YA 2Z4HA 2JYOA 5D3IB 1KNEA 2NLUA 3G6JB 3CPWS 3OY9A 4RG2A 3LWIA 3C1FA 3OYFA 1XYIA 1MGQA 2SEBD 3I4LA 2BA0A 3NTIA 3OYNA 3X24B 4IUVA 1SBBB 2MWPA 2G9DA 2EPBA 3PO3B 4M7DA 3PUWA 4QQDA 5GMKl 4L6V5 4M78E 3S3OA 1HXDA 4FXDA 1JWSD 5DEHA 2BIVA 2DXUA 1LV9A 1I4XA 4PJOB 3OSSC 5DY9A 2X6LA 3C4SA 3H6MA 1JQYD 1Q1EA 2ZXRA 2EKOA 4K6DA 1PTOB 3JAML 4EVOA 3JB9G 3LX7A 4ZLTF 3BG3A 4ZGDB 5EPKA 1F9SA 1AN8A 3UT1A 3CCLT 2B2TC 1SEBD 2EJ9A 4DN4M 4XYQA 2E2JB 3PNWC 1EL0A 1TWFB 3K57A 4KD4A 1O9SA 5EKIA 4DQ2A 1I4K1 2QA4A 1SE3A 2DKGA 3PTAA 2FMMA 4OHJA 2CZ7B 3PGGA 4J8OA 5FO7B 3OYDA 1C4QA 5IOCA 3OWFA 5J22A 3A8LB 1BI3A 3RMSA 3MCAB 1BNZA 2EYFA 1PZKD 1K73C 4BY1B 3M7NA 3C46A 3FEOA 4PLLA 3AU7A 3L42A 3M56A 4C0FA 2F03A 3DWQA 1DYQA 2LDMA 3HEJA 4JK1C 1I5LA 4F88A 4ATOA 2WACA 1WVLA 3G7LA 3CC7T 1I4QA 1GXDC 3RUZA 4C0ZA 4C8QC 2P0QA 1JOKA 4DAYA 4OB0B 4V0BA 4LDUA 3E19A 2ZCFB 1S72A 2ID0A 2NVYB 2XHCA 1EY4A 2HD0A 2KSSA 3CU7A 3ZEHA 4OIJA 5HK0A 3HP9A 3HHTB 3QOJA 1I4RA 4Y7NB 3M58A 5KCHA 3CPWA 3CKIB 3EFXD 4ZRZA 3PT9A 3CCMA 2G9HD 3A8HB 1I81A 4XK8E 5GAN5 3A8OB 1VF5C 5LL6S 5LJ3h 3MAQA 4GLKA 5JEAJ 4TQUS 4BWGB 2E41A 3M4YA 1WNLA 1BCPB 4R9WA 1R8OB 3I3CA 4QVDA 5CQYA 5GAOr 1AEXA 2CKKA 2AUJD 3JCMg 1VQ6A 3KF8A 5M5YB 3HL8A 3KLRA 3E9FA 1TT2A 2LRQA 4HMJA 3JCMX 2RA4A 4M75E 1AW7A 3FRPB 3GNFB 4M75G 2RQXA 4L5GA 2E6ZA 4MHEA 1PRTF 4M77E 2RBMA 2P0KA 5CKHA 3PMFA 1XTCD 2Y90A 2L4NA 4X3SA 2R7ZB 3VR5A 2CW0D 1GHJA 2D9TA 5GANj 4XQJA 4C92F 2DXBA 4EPCA 3S1MB 3FPUB 4XXEA 3SFMA 3BW1A 2ZXPA 2PZWA 3DXJC 3EA6A 3CBPA 2E70A 1YNJC 3RKXA 1QE6A 1LTBD 3CCMT 1YHQT 3V7RA 5CV6A 4ZTJA 2IL8A 3GNGA 4LDVA 4L8JA 1IYUA 2LY7A 4EQNA 2F69A 4UC4A 3ITPA 2EJMA 3HG9A 2F0OA 5CV4A 4E7IA 3EROA 3CCRA 1PSFA 1WTRA 2A7YA 1M90U 2R5AA 3CD6T 3SHLA 3FKIB 2Q8IB 4M78A 5LJ3f 1NJIC 1STBA 3M3YB 4Z9CB 3ZBDA 2H1EA 5C5MA 1QJOA 3MHBA 4C3JG 2XG8D 3H6ZA 4C92E 3KXTA 3CRKC 3QB3A 2R61A 1WQ7A 2F1MA 2LQKA 4QB4A 2B2YC 2GFAA 1O7LA 2E65A 2EDGA 4JDSA 1G2SA 3SR1A 2EYOA 1Q81U 4M7AB 2L5TA 5JVG3 1Y96A 4Y28E 5I2MA 1VQMT 5IGBA 1LLRD 2FJ2A 4FM4B 4II1A 4J5YA 2O2LD 3M59A 3V7SA 1CHPD 4JRQA 1UGRB 2VGNA 3V05A 1D1KA 2EVBA 3VJPA 5FLXL 1O80A 2EJGC 1WJSA 3MFGA 4MMKA 3LGLA 3RMQA 5GMKj 4FVMA 4KHZA 4DF7A 3SE0A 2A6EC 2F0SA 4N4GA 3E6ZX 1JBMA 4BACA 2B2WC 3BVGA 1CT1D 1ET9A 1TWAB 4F87A 1TVXA 1WD0A 2IX0A 1Q82U 4NOYA 2E74C 3OMCA 3OYHA 3OYIA 1WTQA 1NZ9A 4C92D 3HFNA 4C5EA 1G6ZA 1K9MC 1QB5D 3DLMA 4JBWA 1VQ4A 4XYOA 3QDRB 1LT5D 4RCCA 2K4YA 3I55T 1SMYC 5I4DA 2NVTB 2ZPBB 2KEEA 1BQQT 3CHBD 1JOQA 2KVQG 5D6WA 5FLXE 5GAOn 3D4WA 1QW1A 5J3BA 2OEOA 1E2VA 2RKSA 2EXZA 4PNYA 3V2TA 1YJ9A 4Q5WA 5FRMA 5GMKe 4R56A 1JRIA 1TWCB 2LKVA 1DM0B 2K6AA 3DEPA 5DAUA 3CCRT 2E2IB 2EIFA 2RJEA 4J1MA 5CORA 3M9QA 5A0DA 3G6ET 1BO0A 3X25B 3SK6A 2PW5A 5FROA 4Z02A 2PUKB 3UDCA 5I2XA 1QVFA 5LJ5d 4C5GA 2M16A 4A4FA 1HFNA 2K01A 1HA6A 4KKUA 3NTHA 1IKLA 2A74C 2EQJA 3QBYA 1QP3A 1K9MU 4QMGA 2RJCA 3NUCA 3CC4A 1FNUA 2AQ2B 4WORA 3S1RB 5KNDA 3P75A 4LMQD 3GOXA 3GF5A 3D3RA 1DONA 3FIFA 1XQHA 1HA5A 4IALA 3HOYB 3DLLA 3UWNA 3V8LA 4BBSB 3Q6SA 3OYKA 3FVQA 2NN6G 5K36H 3M85A 3OS5A 3JCMW 2DTHA 4BDYA 3JCMJ 2RHZA 3FEWX 2L9HA 2F0PA 4WRDA 1NAPA 3GTKB 1S5ED 4QIWB 3X3MA 3GTJB 5ELDA 5I21A 4PJOA 3KUPA 3CCVT 2VYTA 2QEXA 1KLGD 2DN8A 4BUGA 2F0UA 3R2IA 2HAXA 3MP8A 4HSVA 5K5PA 5DM63 3BFMA 1N9SA 3H0GB 4M7DC 1KQ1A 3E0JA 3D8GA 3OYLA 3VA7A 1O7YA 3I70A 1Y8OB 2EQMA 4A4GA 2V8JA 5CKBA 4IUUA 5I2SA 3JB9H 3NK9A 2KMTA 2RM4A 3PUYA 4NS5A 5GAMe 4C8QE 2OTLA 3OYJA 3ME9A 3U9OA 1Y1WB 1X01A 1DD2A 2LX9A 4FYDA 3RKYA 3I90A 3PMIA 3CC4T 4IUNA 1WTOA 4N0AC 3V7CA 1EOTA 1VMPA 2P0PA 4CRIA 2EYQA 1WJRA 4Y91A 1EYAA 3GP7A 4EMGA 4C8QD 2LNVA 4RGNA 2VXEA 3FPPA 2DK3A 1IYVA 2V4DA 2B2TA 3F2UA 4XT1B 1LNXA 1FNVA 3VYHB 4XQ3A 5AYFA 2WV6D 1ESFA 2HDLA 1PZID 3IKJA 2NYZD 2IJ0A 1GOZA 4QQ6A 2XDBA 5EBDA 1TY0A 1EU3A 2RI3A 3I91A 1EY7A 3JCMP 3L2RA 2D0QB 3D6CA 4FSXA 1G2TA 2LS01 2JTFA 5LJ3j 2PU9B 4DOWA 2YYZA 1UUPA 3JB9F 3H91A 3IL8A 5TSSA 3MWYW 1VDZA 3I56T 4HCBA 3O13A 1VQ5T 3OHXC 4VUBA 1TR5A 4C8QF 5KE3A 4J6WA 3Q23A 1EIGA 1SE4A 2LC4A 3J80L 1YI2T 2B2VA 4KMUC 1SSOA 1QWYA 5LJ5g 2AHJB 3JB9J 5HGTA 5G3LD 4U673 2RA2A 2E12A 5ISRA 3GTPB 1KD1U 1HUMA 1VF7A 1NSNS 2EY2A 2P4TA 4K5VA 3OYGA 5CV9A 1VQMA 1Q7YC 2RDGA 2RHXA 3GTQB 2B8GA 4LJZC 2G3RA 2FINB 1U1SA 3FJPA 1MHNA 5C6AA 2F0DA 5KCOA 4DXFA 2RD1A 1EY8A 2C9OA 3OIQA 3P8HA 4A3EB 2VGMA 5F2DA 3IAYA 2ZPFB 5CYUA 2HNIA 2E1HA 2NWGA 4RGTA 3CCQA 3JCMV 3OS2A 1VUBA 1OXUA 3KBGA 2JEAI 1RTNA 2RVLA 4K5WA 1O7ZA 1YNJD 3TP7A 3VR2A 1B34A 1N8RC 4ZGEB 1ZYRC 5GAOl 2EOTA 2F0QA 2K5FA 3N6RA 3A7AB 5C4HA 2WAQB 3VUBA 2E10A 2QF7A 1TS5A 5FK9C 4KV6A 4B9XA 1F2YA 1TH7A 2DTOA 4PJOG 3TSSA 5KE2A 2MHVA 1VQ7T 2LT4A 1SXTA 1YNNC 2YHTA 1B2TA 3CC2A 1OXXK 2PQEA 1W4SA 4NW2A 2ZZDA 2XSCA 5CBAE 2IG0A 3A55A 3K0YA 1FNWA 1N9RA 4OMFB 2X4XA 3X20B 1RKNA 3RLFA 5GAOm 3VYTA 1YJ9T 2CGHA 1H9SA 1JJ2A 1WQWA 2RO0A 4J6XA 2O4XB 2Q8RE 3ZFJA 4B9WA 3HS0C 3OIPA 1S5CD 2KY9A 3CCUT 2F0NA 4JUVA 4RG8A 3TBIB 4EMKB 4OB3B 2AUKA 2SDFA 2ZPIB 1GHKA 1NE8A 4KKSA 4CHTB 4LK1C 3PFSA 2XK0A 4LAAA 3CMET 4TSSA 3HOZB 3I56A 4R8NA 2DD5A 3E9GA 4K8IA 1UGQB 4JRIA 4NL2A 1LT3D 2SNSA 4CBVA 3U9SA 3AB9A 2CYZB 3HOUB 5CVIA 2PMZB 1ZKOA 2TSSA 4CKEA 4YIJA 4FNFA 1V1PA 2GFUA 4QVCA 3QXEB 1U4RA 4HR7B 4XAXB 4FT4A 3HZXA 1Y96B 5CBEE 2R6GA 2L55A 3INZA 1YIJT 2DAQA 1KC8U 1X3PA 4M8AA 1SNQA 4M7DG 5CKFA 2K3XA 5HK3A 1B53A 1D5MC 3QIIA 1YJNA 1NPRA 2B2WA 3VKIA 5FU6B 2XN9C 5D14A 4KI0A 1X3QA 1GUSA 1DOKA 4HTHA 4A3FB 1XOVA 4KJNA 2EY5A 1D3BA 4C3HB 2MI6A 5CV8A 4CGYB 1QNKA 1U9RA 3A8IE 2QQ9A 4HCEA 4RGMA 5FOBB 1BYMA 1RJTA 3TZDA 3J81L 1KDCA 2E6NA 4J7FA 4X34A 5C4ZA 2K1BA 5T1IA 2MUYA 3C3LA 4D6WA 4F7UA 2B8AA 4PL6A 3MA2B 2RB6A 1KHIA 4DFAA 2F0JA 2MAMA 3JCMb 3D6WA 1E0BA 2F0TA 4OP0A 3I72A 4IUTA 3HRSA 3CCJA 4C5IA 2J7ZA 1N6AA 4IFDI 3T4AC 3OW2A 1TQOA 4EMKA 1IREB 3NQTA 1EZ6A 3QZ5B 1KG1A 3RERA 1U1TA 5I9OA 2X35A 1H9RA 5CCAA 4N9PA 3META 2JP1A 3EFSA 3C1EA 5EKKA 1VQLT 4EQPA 1U8RA 4WFN3 3URYA 4UAIA 3MEHA 3GP8A 1JCKB 1IHZA 3QJ6A 5C0XI 5GAMh 1G8ZD 2X6GA 2A3LA 2FFKB 2I46A 3VR3A 1HK9A 4NDXA 5I6YA 1S5BD 1AP0A 2QQSA 1I4HA 5LL6X 1SE2A 2J4XA 3M53A 3Q22A 1K8MA 3PUVA 2KQ3A 3LLRA 3MP6A 1PTOD 3S6WA 2WSCE 1Q86C 1TWGB 1V43A 4IZ8A 1YITT 1B9NA 2A73B 5CO7A 5C0MA 1SYGA 4A3MB 3LGFA 1G3YA 3K59A 4OVAA 1A15A 1PFMA 5KGUA 2YRVA 3K7AB 4OF1A 4F7UB 3ONAB 1HQRD 1MSHA 1TIID 1EFID 1H9JA 4XTUA 2F4IA 5E4WC 3A8MB 4X9DA 1KTKA 3R3OA 5GAN7 3MEUA 4P5NA 2QQAA 2NVQB 5M3FB 2JNGA 4E7JA 4C0DC 1STHA 1CM9A 2PPBC 2K5QA 3S1QB 4BD3A 1VQPA 1M1KC 4ME5A 4HCSA 2KJXA 4H7BA 4BE0A 4ODGA 2JXMB 2QQBA 4NP5A 2L5QA 3DKMA 3L2WA 1LTRD 4XTYA 1TS2A 2ZGWA 4C92G 1STEA 1B34B 2PW7A 2N55A 2KHSA 2KAFA 1S5FD 3OYYA 2XIWA 1Y8PB 2M1HA 1A3VA 1Q86U 1R4QB 4CJ2C 1UB4A 4N0AA 4K14A 1WCMB 2LT1A 2F0FA 4E6IA 3S1NB 2K3YA 1VIEA 2EQKA 2VC8A 2K7VA 3CCET 4KY7A 4ULLA 2WINB 2JVVA 3WVDB 4M78D 1KD1C 2ICIA 4FF2A 1W6KA 5KRUA 4BI3A 5HURA 4F7UE 1UEBA 5GAN8 2YU9B 2QI2A 5CC4A 3LWUA 2IPKD 2QEJC 2TMPA 3M5AA 5CKEA 3P7JA 5EBCA 1EEFD 4A4KA 3VV0A 2E64A 2GCXA 2PVDB 5LJ3d 1Y7XA 2C06A 1EY9A 5KH6A 2AQ3B 1ILPA 3A8JE 2Q8TA 1VQPT 3CCST 3L2ZA 2VNUD 2R93B 4C8QA 2MJ8A 1CK1A 3PUZA 2JA5B 3J7AV 2MPMA 3MFYA 4G7ZC 2EZVA 3G4ST 4C3JB 1GUOA 1Y1VB 3OS1A 5A2QE 4L63B 2EY1A 3C12A 1M8AA 3W3AA 4IKFA 1XNIA 3OYMA 4X9CA 1PZJD 2KOLA 4C1NK 1DCZA 5D6XA 4BY6C 1FR3A 3RKWA 4I65A 1RD9D 3PIP3 3MHXA 2EY6A 4ZKBB 2LFNA 4BY6B 5DM7R 2BE5D 1B44D 2QCPX 1Q90A 3P8BB 3H3VC 2F0WA 2F0KA 1FYCA 4M7AA 4M75A 4G7OC 3JCMc 2DNCA 2HUGA 1YJNT 2F0GA 1HHVA 1O78A 2K33A 2DPPB 4PMCA 1G91A 4E7KA 2NVXB 2XI9A 1ENCA 5M5XB 2OAUA 1S72T 1IZ6A 4JRKA 4RWSC 2OTLT 4ILWA 3G71T 2E76C 3UI2A 3BYYB 1C8CA 4IFDG 3FB9A 2PVOB 2F3VA 3WOEA 2IX3A 4DAVA 5HY6A 5KNCA 1LTTD 4JRPA 2FHTA 1QVGS 1AFPA 5C4JB 1M4ZA 4PQXA 3H94A 1FX7A 1M1FA 1VQNA 4KY5A 2A6HC 1H3ZA 3UPUA 4IURA 4DK0A 3T53B 1CZWA 2XDPA 1WPYA 2M00A 4DGZA 3QHSA 1YIJA 3QYHB 2PQWA 1UGSB 1PTOC 3GTOB 2OTJA 2A6HD 3TN2A 5CMDA 3LNNA 3RZDB 4FF1A 4C3IB 3KBXA 1WGSA 3TP6A 3OYEA 5GMKi 3ASKA 4QF4A 3WXMB 1ET6A 2HBPA 1QCBD 3DEOA 4KBMB 3CCQT 5IGCA 4KTAA 2EJGA 4KT0E 4JS4A 1VQ9T 3R93A 4M77B 3SB2A 1Y69U 2DVEA 2ZPGB 1HTPA 4EDUA 4ZTFA 1OZ3A 1BF4A 5CKDA 4KKTA 4DU9A 5CIUA 3NXWA 1O75A 2HQXA 1SNMA 1LTSD 1KAAA 1K73U 1VIFA 1D5XC 1STYA 4A3JB 5GAN6 2K5WA 5EPLA 1K8OA 2F3WA 1CI3M 3QIAA 2ZPEB 3V8KA 1LTID 2CZ0B 5M9OA 4LDWA 1SSFA 1NUCA 3OWEB 2DJZA 5CQXA 4XU1A 1WJQA 1H9MA 4C3IG 3MEVA 4N4HA 2X4JA 3NTKA 1EY5A 1BXTA 1E2WA 5AFWA 3RMHA 1SJHD 3NPPA 3QOLA 1JB3A 4ZUJA 1TKWB 2E75C 1BIBA 3M55A 3KUFA 1F9QA 2D6FA 4XTCS 3HKZB 3K58A 4JLIA 4MZTA 3RESA