5J39A

Crystal structure of the extended tudor domain from tdrd2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
196
Chain Sequence
b'GRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSKKLDIGLELVHKGYAIELPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor and KH domain-containing protein
molecule tags Transcription
source organism Homo sapiens
publication title Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2.
pubmed doi rcsb
total genus 48
structure length 196
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j39A02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j39A01
2F0EA 3OYMA 3NHHA 4QQ6A 3OYDA 1ENCA 2BIVA 2PZWA 1RI0A 2F0GA 2X4XA 4FL6A 2NUCA 3OS0A 2EY1A 3MEWA 5IAYA 4KY7A 1A2UA 4A4HA 4ODGA 1SNDA 5ISRA 5EKKA 1EZ8A 1OZ3A 4PNYA 3SK5A 2SNSA 3D8GA 3CEYA 2EYLA 4PLIA 5IGGA 1EYCA 3DB3A 3OMGA 3TP6A 1OYXA 1SNOA 4L59A 2PQEA 3PMIA 2F0VA 4WORA 5I9PA 4EQNA 3TP7A 1A3TA 1OZ2A 5KE2A 4IUQA 2SNMA 3PFSA 4EQOA 1KDAA 3OA6A 3OYFA 4KJOA 1JORA 3OYLA 3P75A 2HQXA 4QW2A 3LX0A 2L8DA 5CV4A 2IG0A 2F0KA 3DB4A 2EQMA 2QQSA 3MZ5A 3O8VA 2X4YA 3C1FA 2EQJA 3S9WA 1WGSA 2BUDA 2RO0A 3M9QA 2MWPA 3OY9A 2RDFA 5CGKA 3OYCA 5KGUA 1KABA 2L89A 2PYKA 3UT1A 3FC3A 3TP5A 1WJRA 5D6WA 4N4HA 1F2MA 3SK4A 2DAQA 5IGFA 2YRVA 3QBYA 2F0DA 3P1HA 4HMJA 1SYFA 5F2DA 5I6WA 3RUZA 4C5IA 3E5SA 2LKVA 4N9PA 4I65A 2EYFA 2R5AA 2JTFA 5CV5A 3TMEA 2F0MA 3OYAA 2K3XA 4E7LA 2SOBA 4Z02A 3L42A 4CRIA 2D9TA 2M16A 2PW5A 4F7XA 3T13A 4QQGA 2F0HA 5C5MA 3E9GA 5IOCA 2DIQA 5M9OA 1SYDA 1TR5A 2KHSA 1H3ZA 4IURA 4A4FA 5FRMA 4G57A 1NUCA 1EY5A 2F3VA 4RKLA 5C4ZA 3QKJA 2MWOA 2PW7A 4PMCA 1SNCA 3ASKA 2EQKA 2RI3A 4KHVA 3QB3A 3UWNA 4YIJA 1STAA 2K3YA 3OYJA 3MXPA 2M1HA 3H6MA 4R8NA 1EYDA 3C1EA 5JAVA 3KUFA 4HCZA 3FLGA 4J1MA 2R58A 3SXHA 4QQDA 2QQRA 5NUCA 4KY6A 3EVQA 2GFAA 3L2WA 2EY6A 3SHLA 2GF7A 3NUCA 4K2KA 3HZXA 3P8HA 4PMBA 4K14A 2DIGA 2LDMA 1STNA 2X35A 1WJSA 3TP8A 2EY2A 2EYPA 2O4XA 3LH0A 2M00A 3S3OA 3S6WA 4B9XA 1KDBA 2F0WA 4K5WA 3HEJA 2B8AA 2HQEA 1II3A 2PQWA 4A4EA 4IUNA 4ZTFA 4QMGA 5IODA 3P8DA 5CC4A 2R5MA 1JOOA 5C3XA 5C6SA 3FDRA 4BE1A 4H7BA 5E1FA 5IGEA 2X4WA 4K6DA 1IHZA 3OYKA 1F2YA 3BDCA 4EQPA 4WRDA 5DEHA 2F0UA 2EY5A 3L2RA 3SK6A 3S3MA 4DGZA 2F0FA 4ZQ3A 4E7HA 3LGLA 3H8ZA 2L3RA 5KH6A 1N27A 3LLRA 5C5LA 2CKKA 4Q5WA 3ZEHA 5D6XA 5EGTA 2RHZA 5CV7A 5IGDA 5KYLA 2LRQA 4IUPA 4RG2A 5KIXA 4K8JA 1EYAA 1EY0A 2EQUA 4F8MA 5I9OA 3MP6A 4MIUA 4QB4A 3H6ZA 3OWFA 2RJEA 2RJCA 2M0OA 1F2ZA 5CIUA 4B9WA 2F0QA 4N9TA 5C4HA 4HTHA 1EZ6A 3FEOA 3L2VA 3NTIA 3L2UA 3SD4A 3NXWA 4BACA 3OS1A 3EJIA 4J6HA 5IGBA 4K8IA 4BE0A 3MEVA 4IUUA 2OXPA 2F5KA 3META 2OF1A 3GOXA 4QF4A 1XNIA 2RI2A 3D4DA 1EY8A 4ID6A 2JZ2A 4C5GA 4K5VA 3LX7A 1G5VA 1STGA 2EFIA 5J22A 4NKLA 1TQOA 2PZUA 5J26A 3DMUA 4NDXA 1U9RA 4PL6A 4GY5A 3DLMA 2RKSA 3EROA 5EKLA 4NS5A 2R57A 2KQ3A 2F0JA 3EAEA 2P0KA 5IN1A 2EYHA 5KRUA 4IUTA 2RHIA 2F3WA 4QVZA 2ENBA 5FROA 5J1ZA 4E6IA 4EVOA 4N4IA 1STHA 1JOQA 3S3NA 2BKDN 5D6YA 1EY9A 3SR1A 2F0NA 1WJQA 1SSFA 4FU6A 2XDPA 4KTAA 3DHQA 3NTKA 1SYBA 3MO8A 2EKOA 1AEXA 4ZUJA 3OYIA 4TRDA 5JOBA 2G3RA 4DU9A 1KDCA 2F0IA 5C3WA 5DAUA 3BDLA 3R3OA 4KY5A 3OQ5A 1KHCA 1OI1A 3OYNA 4BD3A 4N4GA 4KV6A 2F0PA 1EQVA 2RJFA 3D4WA 3OS2A 4E7KA 3U9OA 3QOLA 2FHDA 1STYA 3L2QA 5HGTA 3Q1JA 2E5QA 5C0MA 3E9FA 2RI5A 5HURA 2XK0A 2EYOA 4EDUA 3C4SA 5CR3A 4UC4A 2EYMA 3QIIA 2EXZA 1SYCA 3PNWC 4C5EA 3V2TA 3OYBA 2WACA 2LTOA 3PMFA 1SNPA 5KE3A 4KJNA 5CV6A 2O4XB 4K2LA 4KD4A 3OYEA 4BE2A 5IGCA 1EY6A 2RBMA 1SYEA 3ERQA 4DF7A 5IIFA 5K5PA 2F0LA 4ZTJA 3MP1A 2F0SA 3LYIA 1NSNS 4OVAA 4A4GA 3OMCA 2VYTA 5CV9A 2NLUA 5C6AA 4BDYA 4E7IA 1A3UA 5E3FA 4IZ8A 4S3SA 1SNQA 4K5XA 4IUVA 4E7JA 3VA5A 2OEOA 1KAAA 1STBA 4KD3A 4ZUIA 2QDBA 2RJDA 4HMIA 3QOJA 3D6CA 4II1A 3NK9A 4ME5A 5KCOA 3OYHA 2E6NA 2EYJA 3MEUA 1SNMA 3NQTA 3MHBA 3MVVA 1SYGA 1A2TA 2GFUA 1EY7A 2LVMA 3SK8A 4IKFA 4LD6A 5J39A 2RHYA 2F0OA 4X34A 3NP8A 5KCHA 4LAAA 3PMTA 5KEEA 4RKBA 2LCCA 3QJ6A 4IALA 1RKNA 3MP8A 3OB9A 2F0TA 3MEHA 3NTHA 4OL7A 4DFAA 3T16A 3F70A 4BDZA 1EY4A 3MEAA 3ME9A 5FRNA 5I6YA 1JOKA 1MHNA 4NMZA 3LGFA 3ITPA 5KYIA 4NP5A 1TT2A 4PLLA 4C5HA 1A3VA 2RHXA 2RHUA 2PZTA 1ENAA 5CV8A 3OSOA 3OYGA
chains in the Genus database with same CATH superfamily
3OYMA 1JWMD 3EFXD 3NHHA 2DFUA 3KFVA 4LNPA 1VQ6A 3O5ZA 4GN5A 2NVTB 3J81i 1RI0A 3WOFA 4KN7C 1BCOA 2EYYA 3JCMQ 4J6YA 1VYUA 1MGSA 1HR0Q 2B2WA 2ZPBB 3G4SA 1IXDA 3OS0A 1CKBA 2PUKB 3MEWA 2CP2A 2EY1A 2FMCA 5A2QL 1ILPA 4WCIA 2VVKA 2GVAA 4MHEA 3QXEB 2N49A 2V8JA 2A37A 1AEYA 2O2LD 2COYA 3MKDA 1OZ3A 4M77G 3SK5A 2SNSA 3PUXA 4LFAQ 4ZKBB 1PTOC 2IJ0A 2JVVA 2M2LA 1MMNA 3R6OA 2L5QA 4PLIA 1TY0A 4DNIA 5IGGA 4RUGA 1I3QH 3CW2C 3K57A 3DB3A 2OQ0A 1OYXA 3OW2A 4M7DC 1C0AA 1WI5A 4IJLA 3UE0A 2ECZA 3HHTB 5FOBB 4WJ3M 5I9PA 4HXJA 2Z0SA 3ONAB 2LQNA 3DEOA 2NUZA 4RHRA 3EH1A 1HD3A 5KE2A 2A6EC 2C5CA 2UUAL 1NE8A 1HZAA 1KDAA 1PYSB 1AP0A 1W2BA 1D3BB 1YITA 2A7YA 1YNND 2WAQE 1CHQD 1YJ9Q 3SDZA 2BE5D 1JORA 3LWHA 4QIWE 3WDNA 2E5LL 2DL3A 5CBAE 1YJ9T 4M78F 4NXNL 1YIJT 5CV4A 2BTTA 5FK9C 2VQEL 1PVOA 1H9JA 2EQMA 5M3MG 1K76A 1PFMA 1NG2A 2VB2X 3GQBA 4J9EA 2A19A 3I9QA 4XU2A 4L63B 3SGIA 5DLOA 3T53B 4DN4M 3S9WA 1SE4A 4NXNQ 4OMPA 4BBRG 2DM1A 5M5YH 3OY9A 1LTSD 3N6RA 4TKOB 5KGUA 2RSOA 2IWHA 6AT1B 3T1YQ 1KABA 2PVDB 5CKEA 2L89A 2WB1B 2OT2A 1G3TA 2FPEA 5GAN8 1TWFH 1B34B 3HOZG 4XTXA 2VY3A 3JCMX 3NMZC 3RLOA 2L4NA 4MZ9A 4FP5D 3MPUB 3CCST 2A6HD 3SK4A 2A1AA 2LMJA 3THKA 4DV4L 5IGFA 3CCSQ 1XPOA 3QBYA 3TDQA 3GTQB 1C7YA 3TSWA 5EQ0A 1RAIB 3GNGA 2RH2A 1M90U 2NZ1D 3P1HA 3J81L 4LFBL 4OELB 4AFZC 1UECA 1EFNA 1OX9A 2RD1A 1IBLL 1LNXA 5M3MH 5HKCA 3H3VH 1BU1A 3HOUB 4LN2A 3K5OA 2EYFA 2BZ8A 5LL6S 3VJPA 2RPNA 4LW1A 3HOWH 5IYCG 1CT1D 2KDSA 2F0MA 2ZGWA 1TIID 2B8FA 4UP7A 4A3JG 1WPYA 2SOBA 3CCSA 3L42A 3STBD 2K32A 1EWCA 5FJ8G 1VDZA 2PW5A 2NZHA 2K5IA 3EG3A 4FF2A 3Q6SA 2OTLT 5HY6A 4JI0L 4NB3A 1QVPA 5C5MA 2CWAA 4M77E 1ABQA 2K50A 1AWXA 3OTOQ 3QUIA 2KHSA 4A4FA 4RKLA 2BA0A 3PGZA 3QR8A 2VV5A 1B07A 2ZXRA 5C4ZA 2HIXA 5EBCA 4D6WA 4DAVA 1U3OA 4FYXB 3CD6T 1VQ4Q 4HSPA 1VQDA 1PG5B 1V8QA 3S1RH 2NYSA 2EQKA 4L6TB 4KHVA 1CTMA 4LD9K 2GA4B 1G91A 2A8VA 2K2MA 2C35B 4OGQC 1X69A 2K57A 5GAN2 1CUKA 1YJWA 2A69D 2NTTA 4BS9A 4JI4Q 3WVDB 2KCMA 2QXFA 2Z9HA 3ZFJA 5LMUQ 4A3JH 1Z9FA 1CKNB 2KNBB 1RAHB 2O2OA 5I2MA 1VQPT 4A3EG 3KF6B 2D8JA 2J7ZA 1VQ6T 2XGTA 4JI3Q 1NTGA 4UY8C 1ZUUA 1SE8A 2K5QA 3BDOA 3OWEB 2WINB 3H94A 1S72A 2B8GA 1GFCA 1J3TA 1J5EQ 3NFCA 1JRIA 1IBKQ 4KULA 4KGZB 2L3QA 3QYGB 2C06A 1UG1A 3CKIB 1WTRA 2GFAA 2KSSA 1KFZA 1Y1VH 2EY6A 4DR5Q 5HK3A 4Z89A 2EJGA 4ZRZA 4DA2A 3HPWA 5GAOp 2EJGC 2XU8A 2P4RA 1YJNA 2RCFA 2XN9C 3FIFA 3PIPA 1W2BP 4YTLA 1YVCA 5C0XI 3JCMJ 2GF7A 3CXCS 4HSVA 3NUCA 1KQ1A 3GV6A 2NWMA 2UXCQ 3V8LA 1O80A 5CQYA 2K14A 2SEMA 4DR5L 3A1PA 3Q24A 1KJWA 3FPUB 3GLXA 2X35A 5D7UA 4JPBW 2WKCA 5IP7G 2C0OA 4C0GA 1LTRD 4IIOA 4B3TL 5FLXE 2DXTA 2RQVA 1ZBJA 3LH0A 3CPFA 4MZTA 2JA9A 1G51A 4X3KA 4C2MH 3KJOA 3S6WA 3CCUA 4ILWA 1QJOA 1KTKA 5FLMG 3HEJA 1CA6A 2ICEC 1Y7XA 3NEMA 1CZWA 2FB7A 3S24A 2MF2A 2KCNA 3CC2A 2V26A 1Y96A 4M7DD 1LVKA 1FWZA 1OPKA 1ZA2B 1JJ2A 2DJGC 4IUNA 1RD9D 2Z4IA 3VS2A 5CC4A 1Q82U 2R5MA 1AT1B 1RACB 3JB9J 5C3XA 2OX7A 1W70A 1JB3A 1IW7D 2DL7A 1MKHA 1RAEB 4M75F 4ME7A 2A69C 1IHZA 2DO3A 4ULLA 5AT1B 3QYHB 4WRDA 5DEHA 2F0UA 2K33A 1BI1A 4JBWA 4A3GG 4GN3B 2FMMA 4DR3Q 5IP7H 4HCKA 4EPCA 4YY3L 1C8CA 3M56A 4CKBA 1VQLT 3LGLA 2RA4A 1VQGA 1N27A 3EQLC 1FNWA 2B2WC 4I7AA 2CUDA 4Q5WA 1N34L 1HQMC 2XWBB 5FLMH 3MA2B 2Q2TA 3HRZC 4AQYQ 1UEBA 5GMKi 1SBBB 4AFUC 5KYUA 2RHZA 1CKOA 1UGVA 4JC0A 4MTKA 1YJWQ 1NR4A 3K8AA 4I7ZC 9ATCB 8AT1B 4ZGDB 1HHVA 5KIXA 4K8JA 5A2QE 5CKDA 3BW1A 3MXUA 4Y91A 1U1SA 1EY0A 3K7AB 4OEMB 4RTUA 4GOPB 2WSFE 1K8MA 1JCKB 1M2VA 3JCMg 4C92D 4OMQA 4A3MG 3HOVH 3CC7T 4JCVE 2RJEA 2ZPIB 1RDPD 2ZTEA 4MDWA 4ABNA 3EGDA 2FL7A 3M4YA 1CKAA 3FEOA 2CP6A 3VKIA 3L2VA 1X56A 2E2IH 4LNQA 2VNUD 3SD4A 2JK8A 1VQLA 3NXWA 1N8RR 1PH9A 4C56C 1AOJA 1RAAB 3K5MA 2JM9A 5EPJA 2QASA 1QVFP 1D5MC 1PRTD 2KOLA 4XYQA 2E2JH 3CCRA 3TREA 2BOSA 2JA6G 4RAUC 1ZUKA 4ID6A 2C0IA 3K59A 4M78D 4RTWA 3G71A 1E1TA 1LTGD 1LT4D 1EL0A 4IIMA 5FU7C 1TG0A 3HP3A 2UUAQ 4F7UA 2JEBI 3A74A 2N8NA 4LF4L 4IOAA 2LJ0A 4FXDA 1CHPD 3HOVG 4V2SA 3CCMT 4X62L 1WTOA 1M1KR 1OU9A 4B3RL 1PH4A 3IAYA 5J26A 1E22A 3HKZE 1HZCA 3NWTA 4CKCA 1QZGA 2B63H 2LP5A 2DJZA 8ATCB 1JEGA 3VDYA 4PL6A 5EG2A 1R9TH 3C94A 2DETA 2WP8J 4LFCL 3GTOH 1DONA 2DMOA 2A6ED 4H44C 3CCVQ 4GY5A 4ZKCB 3RZOB 1C1AA 4NXMQ 1TTHB 2LQKA 1TWCH 1PH5A 2RKSA 1VQNQ 2ED0A 3A98A 5CR2A 2Y0SE 3RMHA 2R57A 2KQ3A 3CBPA 1H9MA 2UXCL 2KGTA 2DY7A 2B2UC 1WHJA 2P0KA 1LTID 1C48A 1OXSC 2XSCA 4HJ9A 4C3IG 4M7AE 1I4QA 4L5TA 4C1NI 1ZUYA 4OB2B 2LNVA 4IUTA 4LMQD 1ZQ1A 5GANh 2ENBA 4RHSA 5C3EB 1YBYA 4XQQA 1STHA 4LF8L 2BE7D 5KNBA 1X3EA 3S3NA 1EY9A 3JB9H 3AYHB 1N5ZA 1WHGA 1X2QA 1D1IA 4DUYL 1HR0L 2RHSB 4A4IA 1WJQA 1SSFA 3OBYA 4P74A 2R92H 1C4QA 1ZYRD 2RCNA 1SMXA 3FKIG 5KYUB 2WIIB 1K8AU 3TZUA 1JR0D 2QA4Q 4KTAA 2OAWA 3DHQA 1YHQT 2EJMA 3KLSX 1K8GA 1X3QA 5GAOl 3IRBA 1AEXA 1Q86C 1N8RC 1F1BB 3OYIA 3VS7A 2VASA 3MXGA 4TRDA 4BY1B 2C9OA 3NE5B 1OEBA 1IHVA 2H3JA 2KEEA 1D1KA 1AE3A 1GUTA 4DU9A 1KDCA 3S1NB 2F0IA 3BDLA 4BA1I 1B3QA 5GMKh 4M75D 4OB0B 2KRSA 2PNRC 2AIRB 1KQSA 1KHCA 4RTTA 2YLBA 3U58A 3OYNA 5CCAA 1VQ8Q 2F0PA 1NEGA 1EQVA 2RJFA 1PZID 3U9OA 5A0LA 2CZ0B 3QOLA 3BU2A 1STYA 4DXGA 1I4RA 2KYBA 1SSHA 4ZK9B 2RI5A 2R7FA 4AIMA 2NUTA 2YV5A 3FKIH 2KA7A 1E7ZA 1HNWL 2QW7A 2OTLQ 4DR2L 2I5LX 1D1CA 2N88A 1XOVA 4JW0A 2VXEA 2DD5A 4ZAIA 3PIO3 1VQBA 1XPUA 4JRQA 2EYMA 2BDNA 2OQKA 2DNCA 4POFA 4LF6L 3G6ET 2FJ2A 2ATCB 3CMEQ 1KLUD 1XYIA 2MGSA 1AWWA 2V4DA 2DN8A 1JJ2S 2NWGA 4DK0A 1C9OA 2AZSA 1WJJA 4B6MA 1E6GA 1NLPC 2VUMG 5K36H 5GAMh 3OYBA 2DGYA 3PMFA 3VV0A 1PZJD 1X3GA 4A93B 1WOCA 4RCNA 2OI3A 2MPXC 3RKXA 1T9HA 4K6LA 1IYVA 1NBEB 4KJNA 5CV6A 3HKZG 3T1YL 4K2LA 3OPOA 3I56T 1G8ZD 4DV6L 4J9DA 1G3YA 4ZCKA 3NBIA 1VQIA 5ELFA 1FL0A 2HDMA 4DV3Q 1PFSA 1XNRQ 2OAUA 4AG1C 3CC4A 2CFMA 1VQ8A 4R1JA 4JI1L 4DF7A 4ZTJA 1TWHH 3G7ZA 1VQPQ 2H1EA 5FU6B 3ERSX 4LXCA 2CSQA 3E0JA 4A4GA 4DK3C 3SEBA 3OMCA 3UE1A 1Y1WH 4PV1C 1YJ9A 4IZ8A 3IFTA 2D0NA 5CKFA 1VQPA 4DV1Q 1TWAH 4FW2A 4KI0A 3HOZH 3DWQA 1ENFA 2XRQD 1QZHA 1HA5A 2OEOA 4ZLTF 1EIGA 2B2YA 4KD3A 2VUMH 1M3CA 1XTDA 4J6WA 1EFWA 3C3LA 3LWUA 2QDBA 2RJDA 4E47A 3IFDA 1XMOQ 4A3JB 1HSQA 2DL8A 3H0GH 5EKIA 3D6CA 3G6EA 2E76C 5GANg 4DQ2A 5KCOA 1B7TA 2CKZB 1EEID 4X65L 1AFPA 1WTVA 1FJGQ 3MEUA 2ZJPA 2DEQA 1SYGA 2JA6B 4O0AA 1ZA1B 2MK5A 1B9NA 4UPAA 4DV6Q 2GFUA 4DEYA 1NJIR 3KJPA 1T0JA 4IKFA 4LD6A 2F0OA 1JBMA 5FJ8H 4DV3L 5KCHA 5KEEA 2QA4T 1U4PA 1A6XA 1NLOC 2WB1E 3MP8A 3U4ZA 1B34A 1R0CB 2VL6A 2NVXB 2DJQA 4TQUS 2X3XD 1XNQL 1B50A 3I56Q 4JI5L 3NTHA 1QG7A 2X69A 1V1PA 4HJ7A 1PNJA 1VQ7Q 4XXEA 3H3VC 3EGXA 4N8FA 1Y14B 2EPDA 1H8KA 5I6YA 1LTTD 1WHHA 2I07B 4A3EB 1XNQQ 4NMZA 3QWYA 4RCBA 3VYRA 1PHTA 2DNUA 4FYVB 1M1FA 2L0CA 5KYIA 5LMNL 4KKUA 4NP5A 1H92A 2RHXA 3KYHC 1PCXA 5EC7A 2RHUA 1LLRD 2PZTA 1XQHA 1R77A 3MWYW 2E5LQ 2JA8H 1IKMA 1O7LA 2Q2UA 1NMFA 4A3EH 3L0OA 3MTSA 3N5BB 1QCBD 3OYHA 1VQKA 2ZXPA 2GVBA 4PJOG 1TWFB 1WTQA 3OYDA 4QJFA 2DILA 2A08A 1PDQA 4JUVA 2PZWA 3ULPA 4HT9A 2X4XA 1G8XA 3I35A 1YIJQ 3VYGA 1M8AA 2BCOA 4RGOS 2R93G 1CZGA 4FT4A 1VQ5A 4GNXB 1YEZA 1HR0W 3C0CA 3EFOA 1BYMA 2VXFA 4DR4L 5AFWA 2VZAA 2CZ7B 2HIVA 3TCJA 3SWNA 1IGQA 1SPKA 4ODGA 4JLIA 1WFQA 1SNDA 4IOCA 5EKKA 2UXBQ 1EZ8A 2QEXA 1QVCA 3OBWA 3EGXB 1MI2A 1OQKA 1ET6A 4GNXC 2RVLA 1HH2P 5GAOn 2RQUA 5COYA 1EYCA 3OW7A 3OMGA 5IXBA 2FEIA 4M7AC 1PRTC 1I4K1 2DBMA 4L59A 3BZCA 3KK7A 5ELCA 4RH6A 5IHKA 1B44D 2JJQA 3D6WA 4DK6C 3GTQH 1WA7A 1BKBA 1WQWA 4GLXA 1CSKA 3E2UA 3TS2A 4XU0A 1A3TA 4A3FB 3CC2T 1QVFA 1JJCB 1WYDA 1K4US 4FF4A 2VUMB 2SNMA 3K0XA 2GN5A 1BBWA 2P84A 4JJDA 1YN8A 4PJOF 3CCEQ 3BJUA 2JNGA 5LJ5j 3FJ5A 3OYFA 3CC4Q 1SROA 1PMRA 2PVGB 1RJTA 1PH3A 3P75A 3PO2B 4QW2A 2L8DA 2QF7A 3A55A 5ELOA 3DB4A 2QDYB 4JBKA 3DUZA 4O1NA 2QQSA 3UDGA 3MZ5A 2JA7B 3AT1B 1TWHB 3O8VA 2EPBA 4BBSB 1N8RU 3E19A 4AQYL 5LJ5e 3C1FA 2EQJA 4X66L 1CQFA 1CQVA 1WGSA 1RLQC 2BUDA 2RO0A 3M9QA 1BXTA 1AZQA 4OMMA 5J3BA 5E7NA 2CUBA 4JVZA 2ICIA 4X64Q 3UT1A 3A8LB 3T4AC 4DR4Q 2KE9A 1TS3A 1G2BA 4JI4L 4NW2A 2NUPB 1E24A 2FPDA 3H0IA 4N4HA 3X3MA 1YNNC 1QW1A 4UHVA 4LF9L 4FCYA 4DBRA 4AH6A 2X51A 2K5HA 2DAQA 1GKHA 1S3OA 4XQJA 1YZ6A 4BXXG 2YUQA 2XDDA 2D5DA 2F0DA 1SN8A 2QQAA 1S4ZA 4PZ6A 4Q0FA 3GDEA 4AYBG 1QWFA 3H0HA 1B4OA 1SYFA 2PI2E 5DM73 2EWNA 2DX1A 4M78A 3E5SA 5DM7R 4G7ZC 4XTUA 3S2DH 3W2DA 2HBWA 4N9PA 1TU2B 4OONA 1TXYA 5L37A 3MHXA 3ZJYC 4B08A 1I6HB 3TMEA 2DRKA 3EIVA 1VA7A 5C0XH 2K6AA 1SRUA 1T5XD 2VQEQ 1YCSB 4E7LA 4FXKC 4XTCS 2K5WA 3UA7A 4ZN3A 1RIPA 3S1RB 3CC7Q 2KYMA 4M7AA 1LV9A 1VQ7A 4DEXA 1PH1A 4TVRA 1CSQA 4QQGA 2I5HA 3GTMB 2O9VA 2X6GA 3AQQA 1BNZA 5GAOr 4QIWB 2IY5B 3CCQT 1XMQL 4R8IA 1TR5A 3A56A 2NUTB 1H3ZA 1V1PB 3OIQA 2K7VA 5A0GA 2OTJQ 5I22A 3M54A 2FFKB 1W3SA 3L2PA 4BB7A 4N0AA 5FKAC 4DR1L 2I2LA 4M75E 1U8RA 3LWEA 2NVQH 4B3RQ 3A8MB 4PJOB 4HN7A 1HNWQ 2EJFC 1B9MA 3VR4A 5JEAJ 2ZZDA 2OTJA 4IN3A 4M7DE 3TBIB 2JA6H 4BXXH 4JI2L 1U4RA 2L3SA 2IHFA 5G3LD 2JE6I 3RLFA 2UU9L 2RI3A 1CI3M 1VQ7T 3QB3A 3UWNA 1K9MR 1K0XA 5HK0A 1RHPA 1STAA 4RA8A 4YIJA 2PCFB 3I4MH 3W5OA 4A75A 3PO2H 2E70A 5C44G 3OYJA 3MXPA 1YNJD 2JN4A 3H6MA 4R8NA 1FXXA 4BY7H 1RADB 2RF0A 4JS5A 3M3YB 3C1EA 3KUFA 1DYQA 1GUNA 2JA5H 3TVTA 4KMUC 1YJNT 5JEAH 3UPUA 1X6OA 2F4VL 2EQSA 1E6HA 5IYBH 1Q86R 3PUWA 3RKYA 2HMAA 1I6VC 4CHTB 2AHJB 3N52A 5IP9H 3SXHA 5CKBA 1UGRB 4A3GB 4M7DG 4HJ8A 3AEVA 1KD1R 2J4XA 5ECAA 1I4HA 4DPGA 3L2WA 1EU3A 4DAPA 4XTVA 5LJ5g 4C3IH 3PIP3 2ROTA 2B63B 3V8KA 4OGCA 1FMKA 2AKLA 1WTXA 4K2KA 2Y4XA 5GAMd 4DAYB 2DL4A 1D0YA 3P8HA 2MMPA 4K14A 3UATA 1EQRA 3D31A 4IPHA 2K6DA 5C44H 4FDBA 2R92G 4HJAA 2XHCA 4BY7G 1M90C 5DY9A 5IWAL 4MDXA 3Q8DA 3M0SA 4FYDA 3GTJH 1QNKA 1GXDC 3TP8A 1GUOA 3R93A 2AZVA 3Q22A 2EYPA 4A3CH 1E0BA 1BK2A 3S3OA 1PYWD 2A0FB 3A8HB 3OYYA 3C2PA 3HP9A 4B9XA 3BY7A 2CVRA 4DUYQ 1P16A 1R8OB 4B3SQ 3ULRB 4A3FH 3E6ZX 2F4VQ 4ELYC 4MMLA 3RERA 1IYJB 1XXGA 3TSZA 1K83H 4MZPA 4KRTA 4OIKA 3X25B 1KHIA 4PFPA 2E74C 4UP9A 2VKNA 4QMGA 1M90R 1X54A 2A74C 4XU3A 4C8QF 2KUMA 4BE1A 5E1FA 5IGEA 2HD0A 3FJPA 4JS4A 4H7BA 2X4WA 1A62A 1KIXA 2LX7A 3TS0A 1J5EL 1G2TA 4E7ZA 4LFBQ 4A3LH 2KECA 1JT8A 3JCMc 4R9WA 3L2RA 4PMWA 4CDEC 5IT9c 1VQMA 3S3MA 2D62A 4DGZA 3S15B 4J9IA 2DZ9A 4A3CG 5KH6A 3I4LA 3LLRA 1G3SA 4LF4Q 1PYBA 1H9KA 2V1QA 4OMLA 3RZDB 1VQ5T 4BY1G 4A3FG 4QCLA 5EGTA 2PNIA 3A5ZB 1D5ZC 1JO8A 5KYYB 1KLGD 1NE3A 1K9MU 4YY3Q 1OU8A 5CV7A 1NJIC 3H15A 3RESA 2ZT9C 2JA5G 1VQ5Q 1GFDA 5KYLA 1EZZB 2L1BA 3REBB 3W1BA 4DV0L 2FVUA 3OTOL 1YWOA 3RIRA 3VS0A 1DZ1A 4CC4B 4M7AD 2CZ1B 5CORA 2NVYB 2QCPX 5GAGC 3RR6A 2FZKB 3VS5A 1U4LA 1SEMA 2KAFA 1EYAA 1FX7A 3HOWG 2EQUA 2IIMA 2RNAA 4C92C 3E0EA 1Q86U 3KLWA 3TQYA 2R6GA 3VYTA 5BR8L 3Q23A 4QB4A 3CBOA 2LCSA 1IKLA 2HQLA 1PWTA 2TMPA 2K4KA 4C3JB 4PJLA 2RJCA 5FWBA 1ZEQX 5CIUA 1P92A 4B9WA 5IHIA 4HIDA 2OTLA 1WCMG 4HTHA 2DTOA 1EZ6A 3EGUA 3L2UA 3K58A 4R4CA 2Z1CA 1YITT 5FW9A 1WHLA 3OS1A 1UEAB 5CAIA 3FHWA 1UDLA 3CCMA 2JOYA 1OX8A 4WF2A 1WCMB 4K8IA 5IGBA 1Y1WB 4LDUA 4IUUA 4C92E 1IREB 1PSEA 2F5KA 1LYLA 2OXPA 3META 3M4QA 3GTKB 1BI0A 2OCEA 1Y69U 1F9SA 2D0PA 3VRYA 1I4GA 2RI2A 3M3YH 3M0TA 3D4DA 1N34Q 2JXBA 1QQJA 4RGTA 2K04A 3GTJB 3WWVA 2DTHA 5KYWB 4C5GA 2RQXA 1VQNT 3NGPA 1Y96B 4A3BH 2COZA 4AFQC 4M78C 5C44B 4M77D 1G5VA 3CCVT 2YRDA 2QYZA 2QI2A 5E4WC 1SJED 4JLGA 4C1NK 4P72A 3K5LA 1E2WA 3F1ZA 1VQOT 5J22A 4GLAC 4NKLA 1S1NA 2CT3A 1RABB 4HIKA 1QVFS 4BI4A 4IPCA 3HTRA 1K1ZA 3TEEA 2J6KA 2AK5A 3AHUA 1ZX6A 5IH2A 4YCVA 1L0WA 1MSHA 4DV0Q 3VR2A 2IX1A 1RTNA 4DNTB 3GTKH 4IPGA 4L8JA 4KT0E 2KBTA 2JS2A 4HCBA 5CVIA 5JVG3 2GTOA 1M3AA 4V190 1YCYA 1Y1VG 2HDLA 3ULLA 3PIOA 2CP3A 4BI3A 1I5OB 2B2UA 2EYHA 5FLXL 2LJ1A 5DNFA 5KRUA 1L1OA 5J1ZA 2XD0A 2JP1A 2L2PA 2BH2A 4N4IA 2RF4A 2E3HA 4A3MB 4A3BG 4LDWA 2BKDN 3JB9F 1LT6D 2EDGA 4TSSA 5KNCA 3SR1A 1TUGB 1PLFA 3PO3H 1Q81R 2RB6A 2JUFA 1X2KA 2DYIA 1KK7A 4O6JA 2ZPFB 2J0TD 3D3RA 1RTOA 2DJFC 5CQXA 3RMQA 1MIUA 1TS4A 2F5TX 3NTKA 2F4IA 2OJ2A 1WNLA 1UE5A 2LXKA 1HNXL 4KLKA 3H9NA 4ZUJA 3TSSA 3I55A 3GIBA 1K8AR 2AQ1B 3UDIA 1XNRL 1PHJA 1VYVA 1IBLQ 2K5FA 2E12A 2EYQA 1B2TA 1U06A 5BN4A 4J9FA 2IT1A 1A15A 3I7FA 4OXPA 2QQ9A 4HA8A 1R4PB 2WAQG 4JI7L 1HTPA 1U4MA 1WZOA 1EQQA 1Q1EA 1ACMB 2QEXT 2B2VC 3HOYB 2O5JC 3M59A 3I55Q 4G7HC 1VQMQ 1OI1A 1LTLA 4BD3A 1Q3LA 4KV6A 1ZSZB 2AKKA 3NQIA 3D4WA 1M4VA 2GQIA 3OS2A 4DR7L 2YLCA 2FHDA 4KHZA 4HEDA 1ZYRC 2O31A 5TSSA 3CRLC 1KNEA 3I4OA 1WI7A 5ELDA 3MFGA 2QAZA 5M3MB 3HOUH 2H4OA 1HA6A 4IJHA 3BVMA 2XK0A 5LJ5h 2EYWA 1J8IA 3M4GA 3VS4A 4GN4B 4FM4B 5CR3A 2QTXA 4XK8E 3D4RA 4FVMA 2E3IA 2JS0A 3MCAB 3M53A 1TWGB 2CW0D 1HZBA 3X3NA 1UGSB 2EXZA 1S5ED 2HUGA 2RDHA 4CJ2C 1NZ9A 3GTOB 2QA4A 2L11A 3DM3A 1N36L 4KKSA 3JCMW 4PJOE 1KXLA 2M9VA 2D9UA 3J81j 5C4XB 1LCKA 1E7OA 1EEFD 4WJWA 2LFNA 2V8KA 2CHBD 1L0YB 1PD0A 1ET9A 3EH2A 1SE3A 1EWHA 2LZ6B 3GTPB 4JZ4A 2J6OA 1I0CA 1JQQA 1SRMA 3ICEA 1B53A 1ESFA 2J6FA 3OYEA 2NB0A 4BE2A 4J8QA 3CCJT 2X3WD 2R92B 2D8HA 1VCIA 2Z6KA 2NN6H 1NYFA 1EY6A 3AFQA 3FVQA 2BA1A 1AWJA 2M0YA 4EIKA 1YNJC 5IIFA 3MAQA 2F0LA 1Y07A 5M3FH 1EYGA 2F0SA 1BCPF 1M3BA 1NSNS 1EQTA 2V8IA 1Y1VB 4J9BA 1PTOH 2QGFB 2ZXOA 4CJ0B 1NY4A 4B3MQ 4Y52H 1NPPA 5LJ5f 4E7IA 5DM63 1A3UA 3EG1A 1FMVA 1MV3A 1PM3A 1I4PA 4DKAC 4DAMA 1D1AA 4K5XA 2RMOA 1J9OA 2M9UA 1MMGA 3QDFA 2AMCB 2UUCL 3A8JE 4GOPA 1YJWT 5IXFA 3G7LA 3WXMB 3PUZA 1PFNA 1ONLA 3RKWA 2E6ZA 1VQNA 4DNRB 1VS0A 4ME5A 3CC2Q 1VQMT 1MV0B 2KT1A 3K7AH 2FXQA 4IPDA 3HOXB 3CCJA 1D6EC 4OHJA 2E6NA 2KRMA 2VUBA 3L2ZA 2EYJA 1OOTA 2XKOC 3F8TA 1PC0A 2EYZA 1RAFB 3MJXA 3V8JA 3S1QB 4OGEA 2K9GA 3L1AA 3JCMP 4EX5A 3CCUQ 4PJOA 3M85A 4L5SA 3K5NA 2E8GA 3V7SA 3NPFA 4O5VA 2HDAA 4M75A 1EY7A 1D5XC 1Y0MA 2JN0A 1GD7A 3SK8A 1VQ6Q 4BWGB 2RHYA 1LOJA 2ZJRA 4X34A 4V0BA 3NP8A 1CA5A 4LAAA 1FJGL 3PMTA 3JCMb 1E2ZA 4IALA 5FLXc 1RKNA 1XWEA 3E1SA 4JYAL 1I94Q 1PRLC 3OB9A 2YU9B 3MEHA 4PFOA 3T16A 1ESRA 3EG0A 3U4VA 3MEAA 2F69A 3ME9A 4NPSA 1IXRA 3S1MB 1VF7A 4H02A 4DV1L 1M1KC 4GLKA 1JOKA 4UDUC 1MHNA 4A3DG 4ANJA 1YHQA 1UE9A 4U673 3BVZA 2HCCA 4LUEA 1QVGP 3ZBDA 1QVGS 1NCVA 3HRUA 3ITPA 3GTGH 2FG0A 1V43A 3DKMA 1KD1C 3PCOB 4XIGS 1OTCA 1A3VA 2KI7A 3JAMi 1VQ9A 3HRTA 1K83B 1TUDA 3J7A5 1ENAA 1VOMA 1JQYD 5JEAG 1YFNA 1UE1A 5LMNQ 3JCMV 3KLRA 5IYBG 4C2MB 4CKEA 4M8AA 1ENCA 4CDCC 2PO4A 2MPMA 1V1OA 1VQCA 2L5TA 3R8BA 3S16H 4FL6A 1HYOA 5HCKA 4YWMA 2NUCA 2CT4A 3CC4T 2QEXQ 5GANj 1M30A 5L8RE 2K7AA 3CCET 2KCTA 4RGNA 1FGUA 3U9SA 2L0AA 5E4XA 5IAYA 4J5YA 3LWIA 2R7ZH 3INZA 1YIJA 4A4HA 1A2UA 1NMGA 2CZ6B 4PNYA 4FSSA 1AZGB 1CSPA 3K6OA 4DBHA 3NELA 3A7LA 4EMGA 1BR9A 1ZHIA 1QILA 2R7ZB 1WTHA 2KT8A 1OULA 1Q95G 2DZCA 3CEYA 4M77F 4Z9CB 4EMKA 2DY8A 1EWIA 1WIEA 3SHWA 4EMKC 5GMKj 3P8BB 2I46A 2MO0A 3TP6A 1PFBA 5AJ3L 2FRWA 2JQOA 2ZPEB 2DXUA 3JC66 2PQEA 3PMIA 1Q7YC 3S16B 4WORA 4XAXB 5HGQA 1GBQA 1I1JA 4OB1B 4ELZC 1J6QA 2AHOB 4LUZA 1K0SA 1W6KA 1OZ2A 2PI2A 1HNZL 4IUQA 1BCMA 1RL2A 5GMKe 2N55A 4F17A 1HTLD 2ZTDA 3PFSA 4DK1A 5AJ3Q 4BY6C 5K36G 1HJDA 3OA6A 5EPKA 3TRZA 4GKKL 4FF3A 4BY7B 3TU4K 3QSUA 1WYXA 1BBZA 3FKIB 4X62Q 4KJOA 2DVEA 3M0PA 3OYLA 3URGA 3LX0A 1GCQA 2E65A 2RQWA 1GL5A 1JE4A 1L2FA 1BB9A 2F0KA 3A8IE 3ND8A 4GBQA 2ZJQA 3JCMe 1LACA 2XVSA 2PVOB 1XMOL 1VIEA 1PH2A 4JBMA 4M7AB 2DYBA 4PJMA 1E1OA 2L55A 1QB5D 4X9CA 3EA6A 3EFOB 2BZXA 2X4YA 1MMDA 1MNEA 3J80E 4M7AG 2ID0A 4H0LC 3PUYA 5GAN5 2ZM6L 1HRJA 1X55A 3UDCA 2MWPA 2DKGA 2DUDA 4CDDC 1ZSZA 4DBQA 2Y0SG 5GAHC 3M4OH 2R93B 3M5AA 1UUPA 1D3BA 1ZBXA 1OXUA 3TP5A 1WJRA 1QKXA 2Q2IA 3JAML 4RGMA 2CP7A 1S5BD 4K0KL 4PNOA 1B8AA 4JRPA 1BDOA 2WV6D 3I4NH 1LTAD 4ESRA 4PJJA 5KYXB 2RQTA 1MSGA 1S40A 4L5RC 1PKSA 3STBC 2F2WA 4R55A 1IYUA 4O2DA 5F2DA 1DJRD 1YITQ 2E2HB 1R0BG 3FB9A 3G6EQ 3RUZA 1NM7A 4PJOC 4XDXA 3HOXH 2PUOB 5GAN6 1UGPB 4QL5A 4DR3L 2JTFA 3KXTA 5CV5A 1SE2A 3V96A 5ELBA 4DV7L 5I2XA 4JV5L 2PTKA 5CMDA 3A5UA 3OYAA 2K3XA 4M77B 2MP1A 2XNAC 2F1LA 1WVLA 1GO3E 4QQBX 4BBRH 1IO6A 4Z02A 3SFMA 4CRIA 2PNHA 5IE8A 3ER0A 2D9TA 1UNSA 2M16A 1YP5A 2GQVA 1D8LA 4LWCA 3OOCA 2PPBC 3VYHB 1TY2A 2F0HA 3KDFA 1FMWA 2I0NA 3VU3C 5GAMf 3E9GA 5IOCA 2P0PA 3LH5A 2D1XA 1Q82C 2GTJA 3R2TA 3S1NH 2EAYA 3I90A 4IURA 5DLQE 1K8AC 5FRMA 1LTBD 1EY5A 3R6NA 4G57A 2GBQA 4QKUA 3EGDB 3K7UC 4HIMA 1AWOA 4C3JG 4P5NA 2PW7A 4B3TQ 1HJPA 3PTAA 1S72T 1UTIA 3R2IA 1MHWC 5BN3A 1BOSA 1I5LA 1VQ4A 3L3OC 4M75B 3HOXG 1S5CD 2FYKA 3GTPH 2M1HA 2EXDA 3VUZA 2B39A 5LJ3f 4GS3A 4KH1B 3VR3A 4HCZA 2AWNA 5C3EH 5KYWA 1O75A 2R58A 1PD1A 2IPKD 3J7AV 3RD4A 2CW0C 1DD2A 3I70A 3A8KE 1I81A 2CQAA 4DV7Q 1JWUD 2G9DA 2CREA 2CQOA 1WTPA 2TSSA 3HG9A 2G9HD 1IL2A 1QLYA 2NVXH 1UE6A 4QQDA 2XDBA 2YTVA 1V29B 2QQRA 5NUCA 2YU9H 1P8LA 1TWAB 4KHPQ 3EVQA 2MO1A 3QWNA 2JEAI 1K28A 2NTSA 1B1ZA 3J81c 4JV5Q 4C3JH 3PQIA 5CYUA 3WVEB 4CBVA 4F7UE 3OS5A 1PTOB 5IT9E 1SHFA 4JG2A 3PSIA 1W2BS 3LGJA 2UUBL 1M9SA 2NVYH 4KN4C 3HZXA 2V1CC 3JCMd 3J80i 3S17H 4C3HG 2DIGA 1I4XA 2MCNA 2J06A 1LM0A 1STNA 3HOYH 2KROA 3NENA 5GANf 2EVBA 1A63A 2ASBA 3EHRA 2YWWA 1WJSA 2E41A 3P7JA 2EY2A 3I5SA 1XX8A 1V9PA 3CPWP 2PZ1A 4Y28E 2YDLA 1AZEA 1KDBA 2H5XA 2Z6BA 4K5WA 1X32A 1I07A 1K3RA 2B8AA 2HQEA 4GLMA 2MFIA 2JA8B 4F7UF 1VQ9T 4XQ3A 4DUZL 2WB1G 3CMAT 3S2HH 1KAWA 1XTCD 1I3QB 4LF9Q 3M7GA 1VQKQ 4JYAQ 3FDRA 1Y8PB 3JB9I 4CGYB 2DL5A 4JI6L 1FYNA 2HSPA 5GJVB 4K6DA 4QY7A 3URYA 3CD6A 1ASZA 3HSBA 4XTWA 3OYKA 1F2YA 4KK7A 3JAMc 4C3HH 4EQPA 4GKKQ 2UXDQ 3CBMA 1W4SA 3M0RA 1M4ZA 4OP0A 4PK4A 1S5DD 2EY5A 3W1GA 1I50B 2F0FA 4GLVB 1ICWA 3FP9A 4ZQ3A 4LF7L 2XG8D 3H8ZA 2HBPA 2L3RA 2K5DA 2KBNA 3AU7A 3M0QA 5C5LA 2HD3A 2WAQB 2HHHQ 2CKKA 4D8DA 3ZEHA 1TU0B 5CKHA 1W1FA 4HKEA 4C0DC 4DA4A 2VB3X 1UFFA 4APVA 3T9NA 1QMCA 3GV3A 4OIJA 4C8QB 4LF5L 5GAOm 2LRQA 4IUPA 4RG2A 3I55T 4LK1C 5JPMC 5GAN4 4B3SL 5T1IA 2K3BA 4EMKB 4A3BB 5CO7A 2DA9A 2JT4A 3SB2A 1ILQA 1GRIA 3I56A 2NN6G 2E4HA 4P2CB 5KYYA 3MP6A 2MQHA 5I9OA 5C0XG 4MIUA 1Z47A 3H6ZA 1M1KU 3LNNA 2M0OA 3UA6A 1F2ZA 3NSWA 4FSXA 1A0IA 1X43A 1VQLQ 4ZGEB 2EVRA 1VQEA 5C4HA 2K79A 2KHIA 3FEWX 4JI6Q 3GD7A 4QGUA 4DBFA 2DD4A 4JI8Q 1ZSZC 2H3EB 4M78E 5EAYA 2JYOA 4BACA 1BVSA 1Z9QA 3EJIA 2EOTA 2K5NA 1TS9A 3MEVA 1HPCA 2B2TC 2PU9B 4QUCA 3J80c 3CU7A 2JA5B 1SG5A 3VUBA 1KIKA 1XNIA 1RF2D 4UAIA 5I2YA 2EGEA 3ZYYX 2XTIA 1X75C 2J05A 2JZ2A 4MZMA 1KQ2A 3HS0C 2BZYA 4K5VA 4PFZA 1EFID 3LX7A 3PO3B 4ZGJB 1QVGA 1EOVA 2DNEA 4OX9Q 3GTLH 2D0QB 5JJLA 1STGA 2QG9B 1H9SB 3DXJC 4A3MH 2EFIA 1B70B 3VYSA 4EGVA 1KC8C 4CC7A 2PZUA 1UWVA 1YI2T 2A6HC 3BYTB 4M7DA 2JSOA 3H41A 4DR7Q 1VQOQ 4J83A 2ZTCA 5LMNW 5T1GA 1RLPC 1JJ2P 3PV0A 3PE0A 1QCOA 1G291 5IP9G 1TXQA 1PRTB 4AFSC 1O7ZA 2KJXA 1YWPA 4XTZA 2XI9A 3EROA 2FINB 5I2SA 4L6V5 1MBYA 3EAEA 5IN1A 2F0JA 4MNOA 1SFOB 5BR8Q 5GMKl 1Q90A 3DEPA 1RODA 4QUFA 1ARKA 2F3WA 4EVOA 5FROA 3HGBA 4M1UB 2JA7G 3HOWB 2YT6A 1SXTA 2LT1A 3K80C 3BFMA 3C95A 1DCZA 2K75A 4ZN1A 4X3UA 1K9MC 4DR6Q 1HCZA 3TN2A 4GNXA 3S2HB 4CC3A 1Q8KA 3IL8A 3CF5A 1IGUA 4FU6A 4KGXB 2N78A 3A7AB 2XDPA 2K03A 4OO1H 1VQHA 3NBHA 1W6JA 2EIFA 1SYBA 3MO8A 1LPLA 3FMCA 4OX9L 2EKOA 2ATWA 4F7UG 2EGCA 2HKQB 4M7DF 2LSSA 2MAMA 1VQKT 3K81C 1DXMA 4KBMB 2KVQG 1I50H 2O5IC 2JM8A 3PVLA 5C3WA 5DAUA 4HVWA 1SR3A 5LHY1 4KY5A 1H95A 4A3KH 4XYOA 5GANd 5AYFA 3VA7A 4N4GA 5L23A 1VQ4T 2PMZB 2R7ZG 2DTIA 2E1HA 1KRTA 5LJ3e 2JA7H 3CCLQ 4E7KA 3CMAA 2YUPA 3EFRA 1IB8A 3L2QA 1NYGA 4L5QA 5BN5A 5HGTA 5GAOq 3JB9G 2K4YA 3JCMh 2CWPA 5GADC 3AMUA 3H3VI 1H9SA 5HURA 2YTXA 3Q0AA 3G1JA 2EYOA 4EDUA 1TWCB 2MJ8A 3DM1A 3JCMf 1X65A 4N8X1 1N32Q 3QHSA 1PA6A 1OO9B 2G6FX 2KXDA 2RK2A 4UC4A 5D65A 2CH4W 1Q12A 1UAPA 2QTVA 4H13C 3PNWC 2UU9Q 5C4JB 1BUVT 1QWEA 3G4SQ 4LF8Q 4RWSC 3V2TA 3BYYB 4F88A 2PQAA 2DE0X 3KF6A 3F2UA 2WACA 2LTOA 3H0GG 3M7NA 4IFDI 4GOPC 4LUOA 3KFUA 3BE3A 4M78B 2O4XB 3J7AF 1M8VA 4RCOA 4RMFA 5G3LF 4A3KG 3S17B 2EYXA 2HCKA 4KD4A 5GJWB 3I5RA 5EPLA 1CKMA 2DF6A 4QVDA 1AW7A 1WHKA 1HQRD 4PJOD 3CQTA 2RBMA 4J6XA 1IBKL 4K0KQ 3CXCP 5LJ3g 3G4ST 1O78A 1HNXQ 5K5PA 4XU1A 4RMOA 2D0OA 2LC4A 2ROLA 4M4ZA 4R56A 3MP1A 3BZDB 3M4PA 3W3AA 4JBJA 3RN5A 2E2JB 1HUNA 4OVAA 1EU4A 4JI7Q 3F2DA 5I11A 2DXBA 2VYTA 4LF5Q 5CV9A 2NLUA 1PRTF 1QOHA 1SFOH 2LT4A 5E3FA 5GROA 2WSCE 2YSQA 2IL8A 3F2BA 4OWTB 4S3SA 1G6PA 4M7DB 4HAEA 1KSWA 1U5SA 4IUVA 4C8QE 1SEBD 4E7JA 3CCEA 1EX4A 1DOMA 1EIHA 2VW9A 2LJ3A 1S72Q 3G71Q 1KAAA 1RCVD 1STBA 1LUZA 3CD6Q 3IQLA 2F3IA 1N9RA 2Z4HA 3CCLT 4KKTA 4HMIA 4DV2L 3QOJA 4L5GA 2WKDA 1VQ8T 3G71T 1KG1A 1N36Q 3BG3A 3QPHA 1PRMC 4X66Q 4A3DB 1UHCA 5JJZA 1R4QB 1IBML 4DOWA 2ESWA 4POGA 1SNMA 2K5LA 2YTYA 3NQTA 4DAYA 1KQSP 1WTWA 3MHBA 4HT8A 1M2OA 1HFNA 1ZXTA 1SDFA 2LVMA 1EOTA 2DRMA 1JB0E 2COWA 5J39A 2CH4A 1Y1WG 4IFDG 1K73C 2QDLA 4RKBA 1Z9ZA 1O7IA 2A5HA 3D7SB 2IHEA 3J80L 3H91A 4JZ3A 2F0TA 3BVGA 5EJWA 4FNFA 2OWOA 3M0UA 2R93H 3GBQA 1FR3A 3KF8B 1H9RA 4DFAA 1BI3A 1JC7A 4QT7A 1EY4A 2NVTH 4ORZA 1AE2A 2X4JA 5FRNA 1N9WA 1WQ7A 3GTMH 5GAEC 4J9HA 3AFPA 3LGFA 1OXVA 2ALYB 3MEFA 2HCIA 3CMET 1T5EA 4PQXA 2V1RA 1GHKA 4J9GA 3RDVA 2B86A 3NHNA 3X26B 5LJ3d 2MUYA 4XTYA 3PO3G 1TT2A 4PLLA 2K05A 2KRNA 4C8QG 2VB6A 3H0GB 4C92F 1E2VA 2RSNA 3PGGA 3I4NB 4A93G 3RZDH 1GJXA 3M55A 1QCFA 1C0MA 2RDGA 3H0FA 1UHFA 3OYGA 2IVWA 4JOIC 5D3DA 2YYZA 2FPFA 2KEDA 4DR1Q 2F0EA 3PF5A 4IFDH 4QQ6A 2NVQB 4Y7NB 2BIVA 1D0ZA 4X65Q 3PT9A 3HFZB 2F0GA 5LL6X 4XT1B 2K52A 3CPWA 1YHAA 2KENA 2ZM6Q 2NUPA 3D0FA 3BDUA 2CCZA 3HFNA 1Q7YR 2O9SA 3OSVA 3MXNA 4P71A 4KY7A 2G5DA 1TH7A 4A3IB 1ZLMA 5ISRA 4XQNA 4J7IA 1UUEA 3E9IA 2ES2A 4A3IG 1WXTA 2AUJD 1G3WA 2L9HA 1YHQQ 2EGAA 3D8GA 4FO2A 3X24B 1SLJA 4BBSH 2EYLA 2HZYA 1I6HH 1GCPA 3HOUG 1OXXK 2BDOA 3V05A 2E5KA 1D0XA 3I91A 4M75C 4C0ZA 4AYBE 3HOYG 2JA8G 3CCUT 1SNOA 3TEHB 4CI0C 1RAGB 4A93H 4F14A 4X9DA 1Y8OB 2E2DC 2F0VA 3VR5A 2AWOA 1QNUA 1X9NA 4A76A 1BIBA 4EQNA 1BI2A 3TP7A 5LJ3j 1MJEA 3CP0A 1K73R 3QO3A 3A8OB 4MN3A 1X01A 4PZ7A 4RTZA 2LNHB 4JRIA 4ATOA 2Q2HA 4P75A 2PQAB 1TKWB 4EQOA 2K01A 1Y57A 1T0HA 4X6AH 4OO1I 2JTMA 4LDVA 3QZ5B 1BF4A 3OSSC 2UUCQ 2HQXA 1GCQC 2ZPHB 2IG0A 1MJCA 1XMQQ 1JB7A 4LFCQ 2IX3A 2FZCB 4ZNXA 2HHHL 1IL8A 1PTOD 4JRKA 4A3IH 2W10A 5M3FG 4BBSG 4M77A 1YI2Q 3F2CA 1Z7TA 4DUZQ 3S1MH 4FYYB 3QO2A 5FU6C 1TWBA 4LUDA 3CCQQ 1F9PA 4LJZC 2RDFA 5CGKA 4PKCC 3OYCA 1HZ9A 1JICA 3KUPA 1NPRA 2NYZD 2PYKA 3QWXX 2KHJA 2LX9A 2B3GA 4LDXA 1YI2A 4OMFB 7AT1B 3FC3A 4Y7NH 5D6WA 3CCLA 2MYSA 1NAPA 2UXBL 2FHTA 1CKNA 1F2MA 1KC8U 5ELNA 1PH7A 2A3LA 2Q8TA 1D1BA 2YRVA 3J7YW 5GAN7 4DOVA 5LJ5d 1SHGA 1U5KA 4WFN3 3BS1A 2YUOA 3T1HQ 3CMAQ 3SEMA 5FO7B 2QEJC 4HMJA 2LS01 4RTXA 4C5IA 4FYWB 1GBRA 2LKVA 3NBHB 2ABLA 2MOXA 1QP2A 4J8OA 3JV3A 4I65A 1BCPC 4C92B 2J7IA 2R5AA 1DOKA 4IQZA 2NN6I 2HT1A 2N3SA 3T1HL 1PH6A 1GUWA 1HNZQ 3VS6A 2HKNA 3VS1A 4DV2Q 2Y4YA 2JMCA 3EFSA 5FWCA 3CCRQ 1X6GA 4F7XA 3T13A 2YRCA 3A0JA 3UI2A 2MHVA 1JJGA 1SAPA 1JMCA 2VC8A 4QVCA 2VXWA 4OB3B 2DIQA 5M9OA 1SYDA 1R9TB 1LJOA 5JPNC 1NUCA 2F3VA 3RR5A 5JVH3 2CGHA 1VIFA 1UJYA 1AZPA 3DWAA 3QKJA 1GM5A 2B2YC 4IFDJ 3FRPB 4DR2Q 2MWOA 1G6ZA 2LXJA 2BE9B 1Z6HA 2JJ9A 4PMCA 3FPPA 4BI8B 3ZL7C 2A68D 1SNCA 1NBWA 3ASKA 1F9QA 3S1QH 4HIOA 3NPPA 2CP5A 4HVVA 4C8QC 5H1SE 5GANe 1V1QA 1X3FA 4JI3L 2K3YA 3O13A 4EQ5A 2ENMA 5IY0A 4C0DB 3GF5A 4BA2I 1EYDA 5D3IB 2E2HH 2L3PA 2IPOB 1M8MA 1WHMA 4F87A 5JAVA 2A68C 3FLGA 5C4XH 4J1MA 5M5WB 4GKJQ 1UGQB 1NJIU 5D14A 3NWSA 2Y90A 4CDFC 1N6AA 1OPLA 2KK4A 2HQHA 3EHQA 3KF8A 4RTYA 1ZKOA 4FXGC 4CJ1B 4RTVA 1FD7D 2DVJA 2E2IB 1Q81C 2E10A 1MGQA 1QWYA 4KY6A 4ALPA 4A3DH 1WX6A 5CK9A 3I73A 2W0ZA 1I5FA 1AHJB 4LF7Q 2VGNA 3M4OB 1EIFA 1WD1A 3PVQA 2X6LA 4N0AC 4HCCA 4MTNA 3RMSA 3T56B 1XPRA 1X6BA 4Z88A 1HK9A 3SHLA 1MD2D 1K73U 4A63B 2FO0A 1GUGA 2MIOA 1K0RA 1PZKD 4C92A 2QKIC 1TUCA 5M5XH 5LJ3h 3RUXA 2I0QA 3I4MG 3GTLB 1BCPD 4PMBA 2GGRA 4PZ8A 2LDMA 3JSCA 4J9CA 1EUJA 2HAXA 3CHBD 4OO1G 3DWPA 1BBXC 1D2BA 4UP8A 2UUBQ 3JB9D 4FIBA 2O4XA 4JJBA 1GHJA 2M00A 2EW3A 5GAMj 4JI2Q 1N33Q 4XT3B 1B7YB 1HUMA 1AH9A 1ICFB 1DJ7B 2F0WA 3FDTA 4DV5Q 4GZYC 3HOZB 2RA2A 3QDRB 1PTOF 1Q82R 1Q1BA 5IYDG 1M1GA 1KD1U 1II3A 2QILA 1QE6A 5GQOA 3CCVA 1IRXA 2PQWA 4A4EA 5GAMe 4ZTFA 1SJHD 1YNXA 2AT1B 4HR7B 5IODA 3S14B 1SSOA 1NEBA 3P8DA 3U23A 2F52A 4Q5VA 1JOOA 2RN8A 1NR2A 1W6XA 4E6RA 4M77C 5C6SA 2A28A 1KQSS 2I5MX 4JK1C 4ME3A 2CYZB 5M3FB 2YHTA 4HVUA 3AB9A 1IW7C 2F03A 4OMOA 2VWFA 1KC8R 3VYUA 3BDCA 5I6WA 3KBGA 1SMYD 1STEA 2MNAA 2BH8A 4YHHL 1Q8IA 1WXBA 5A0DA 2HEQA 2O88A 4P73A 4YWLA 3SK6A 3UF4A 1Y8NB 4E7HA 1TVXA 1HXDA 4C0FA 5EBDA 4CC2A 4D8KA 4F7UB 2F2XA 1SMYC 3QIAA 1M2VB 2LQ8A 3I4NG 5IYDH 2H8HA 2JMAA 3M57A 5IGDA 1N33L 1N32L 1TWGH 2VQFQ 1VUBA 1OV3A 1CK1A 2RM4A 3UDFA 2AQ2B 2K5VA 1PSFA 3FRNA 4A53A 1EIYB 2M02A 4BUGA 1Q7YU 1O7YA 2R3ZA 2R61A 5M5XB 4E7SA 1AD5A 1L1OB 3P20A 4C3HB 2HL5C 5KYXA 2GNCA 4F8MA 4F04B 2QQBA 1PKTA 5GAMg 1TS2A 1IZ6A 5IYCH 1LT5D 4DXFA 1KRSA 3OWFA 2KXCA 5I21A 5FO8B 2R7DA 2AUKA 4A3LG 2F0QA 4N9TA 2AQ3B 3EG9A 2P0QA 2KY9A 5FU7B 1GOZA 1KNAA 3A54A 4R4QA 1GXIE 1X3PA 4NXML 2VS1A 1JXMA 1MNDA 1UJ0A 1QUQB 3NTIA 3L7ZC 3U50C 4DR6L 1BBUA 4TVAB 1K3BC 4RFBA 3CAMA 2HSEB 3VRZA 2EKHA 4J6HA 1QUQA 4F16A 1K9AA 1WXUA 4BE0A 2D6FA 2FZGB 3E3XA 2EJ9A 2OF1A 4KUIA 3GOXA 1VQAA 3GO5A 4QF4A 4BY1H 3C46A 1RI9A 1M5Q1 3HOVB 1T3SA 4JI1Q 1V76A 2XRSD 1EY8A 2MI6A 2CS7A 2E64A 3E9HA 3DLLA 4JJCA 1SF9A 3RN2A 1PXUA 1C6VX 2PMZE 4KHPL 4YCUA 4Y92A 4KUDK 1S5FD 4RKUE 4X3SA 2VGMA 1PV4A 4G7OC 2ZCFB 2IW3A 1TSFA 4YCWA 3A8GB 2B29A 4VUBA 3CQZB 5JJIA 5KNDA 1BO0A 2KR3A 3EBEA 5C3EG 3I72A 1TQOA 2EZVA 3K0YA 2RK1A 2Q8IB 3DMUA 4NDXA 1U9RA 1CFMA 1WCMH 4AT1B 1F9RA 1VYTA 3QJYA 5C4JH 2VQFL 5IWAQ 2NBFA 3V7RA 3EG9B 3RZOH 5JJKA 2Y0SB 1WLPB 4EMHA 3OIPA 1N9SA 3DLMA 1JWSD 5EKLA 4NS5A 1ML0D 4KH0B 4JDSA 2WFWA 4YWKA 2F1MA 3SWNC 4GKJL 4X64L 1U0LA 4A4KA 1SRLA 2ZAEA 2RHIA 2XIWA 4QVZA 1LO5D 4E6IA 2DEUA 1QP3A 1JOQA 1QCNA 3I2ZA 1SKUB 1VQFA 1WFWA 5D6YA 4JI8L 3QG1A 2F0NA 2AKWB 4M78G 4A3KB 1F77A 3KBXA 4OMNA 2BE5C 4DV4Q 4PJNA 1O9SA 3BZKA 2IX0A 1ABOA 3X20B 4K11A 2K28A 2F2VA 5A35A 2SDFA 3RLNA 3I8ZA 4R4IA 1M27C 3JRZA 4KGVB 1YJNQ 1NNXA 2YUNA 2L15A 2P5ZX 2SEBD 3GNFB 4IO9A 2A36A 1X27A 5KYNA 2LMCB 4LFAL 2XMFA 5JOBA 1H641 2G3RA 2C0TA 2HNIA 1Q46A 5CBEE 3C12A 2KVMA 3R3OA 2ED1A 4B3ML 2B2VA 1T3LA 3OQ5A 2A73B 3V7CA 2XWJB 1FYCA 1AN8A 4NL3A 4J15A 4O42A 1DGSA 1VF5C 2YXYA 3KOJA 1D09B 1QKWA 2KEAA 3OW2S 4BBRB 3PF4A 2NZOA 2OTJT 1KL9A 3CCRT 1U1TA 1UB4A 1A0NB 4OF1A 4DV5L 3Q1JA 2E5QA 3E9FA 5C0MA 3VR6A 1IHWA 3MXNB 3CCMQ 4E2FB 1Q81U 2O01E 4NL2A 4HJ5A 1XJVA 3S14H 3J81E 4A3GH 3C4SA 1VMPA 3G48A 2CP0A 1OXTA 3QIIA 3SVMA 1SYCA 4FW1A 5FO9B 1JXOA 4MMKA 1AVZC 1V1CA 1JE5A 4C5EA 2DBKA 2X9HA 2KQWA 2E75C 4RG1A 4OWWB 2ZPGB 1G2SA 3GP8A 3HKSA 1VMCA 4BY6B 1F2LA 3WOEA 2QK0A 5GAN3 3CC7A 1WD0A 3CCJQ 3J7ZC 1SNPA 2RQRA 4FT2A 5KE3A 3CXCA 4JJNK 3CMEA 3CQZH 2K2VA 1I8FA 3S15H 2EJFA 3GP7A 2FRYA 2QGGA 1ZSGA 1MMAA 1I94L 4M75G 3I4MB 1WDXA 5IGCA 4NOYA 5I4DA 3OW2P 4HCEA 2EBPA 3MC0B 2LCLA 3EG2A 1SYEA 3ERQA 4ZYSA 4C3IB 5IHNA 3LYIA 3RNJA 4X3TA 3CRKC 2LY7A 2DK3A 3X28B 3IKJA 3RNUA 3KDFB 2JW4A 2KMTA 2DPPB 1HFGA 5C6AA 4R4TA 4BDYA 4Z8AA 2CSIA 3REAB 3I3CA 4WJ4A 3T51B 1SNQA 2B2TA 4PG3A 3HFOA 4R0KA 1BQQT 2L12A 4OWXB 3VA5A 4ZUIA 3JAME 2JXMB 4LUVA 1DOLA 2EE1A 1XJWB 2M51A 3GPLA 1ASYA 3M58A 1TS5A 1FVIA 4II1A 1YNZA 3HRSA 3NK9A 4U68A 1HXYD 3M9BA 2DXCA 5M5WH 4C92G 3CPWS 1JU5C 2Z8LA 1D7QA 4C8QA 3QZ9B 3UDXA 3TZDA 3SE0A 4LF6Q 2KCCA 4C8QD 2LQWA 3PUVA 1VQOA 3VS3A 2P4TA 1VQJA 3G6JB 3MVVA 1B3AA 2SRCA 1L0XB 3LW5E 1A2TA 2Z6KC 2WSEE 2HL3A 4J7FA 2XIDA 2GCXA 4AG2C 4JI5Q 1LABA 3CCQA 1PH8A 1IBMQ 3TQ7P 4LDYA 1CM9A 2B63G 4R4OA 1LT3D 5GMKm 2LCCA 3QJ6A 4A54A 5IT9L 3ULJA 3RBBB 1K8OA 4WTOB 4HCSA 3SWNB 3B6YA 3HL8A 1Y71A 1FNUA 1UE7A 4OL7A 3F70A 4RCCA 4AMCA 4BDZA 1VQ9Q 5LMUL 5M5YB 1L1OC 1GUSA 5C0XJ 2UXDL 4YHHQ 3L9AX 3MFYA 2DLPA 2Z0WA 3EN2A 4JI0Q 2EQIA 4G4KA 2DERA 2D2CC 1MUZA 1TOVA 2RHQB 5ELEA 3S2DB 4M7AF 1E3PA 2CDTA 4LE9A 2QGQA 3H09A 1GVPA 2XICA 3KLSA 1A8VA 4AYBB 2K1BA 3PO2G 4C5HA 3HKZB 2JTEA 1DM0B 3GTGB 1RUWA 1G83A 1BIAA 3ND9A 4X1VA 1BCPB 1H3HA 1FNVA 5CV8A 4RG8A 4FF1A 3OSOA 5C4XG 4JOIA 1FGBD 5D6XA 1YHBA 2Q8RE 3OHXC
chains in the Genus database with same CATH topology
3OYMA 1JWMD 3EFXD 3NHHA 1VQ6A 2NVTB 1RI0A 3WOFA 4KN7C 3JCMQ 4J6YA 1MGSA 2B2WA 2ZPBB 3G4SA 3OS0A 2PUKB 2EY1A 3MEWA 2FMCA 5A2QL 1ILPA 4MHEA 3QXEB 2V8JA 2O2LD 4M77G 1OZ3A 3SK5A 2SNSA 3PUXA 4ZKBB 1PTOC 2IJ0A 2JVVA 2M2LA 1TY0A 3R6OA 2L5QA 4PLIA 5IGGA 3K57A 3DB3A 1OYXA 3OW2A 4M7DC 5FOBB 3HHTB 5I9PA 3ONAB 3DEOA 4RHRA 5KE2A 2A6EC 2C5CA 1NE8A 1KDAA 1AP0A 1W2BA 1D3BB 1YITA 2A7YA 1YNND 1CHQD 3SDZA 2BE5D 1JORA 3LWHA 3WDNA 5CBAE 1YJ9T 4M78F 1YIJT 5CV4A 5FK9C 1H9JA 2EQMA 1PFMA 2VB2X 3GQBA 4XU2A 4L63B 5DLOA 3T53B 4DN4M 3S9WA 1SE4A 3OY9A 1LTSD 3N6RA 4TKOB 5KGUA 2RSOA 2IWHA 1KABA 2PVDB 5CKEA 2L89A 2WB1B 2OT2A 1G3TA 5GAN8 1B34B 4XTXA 3JCMX 2L4NA 4FP5D 3CCST 2A6HD 3SK4A 5IGFA 3QBYA 3TDQA 3GTQB 5EQ0A 3GNGA 2RH2A 1M90U 2NZ1D 3P1HA 3J81L 2RD1A 1LNXA 3HOUB 5HKCA 3K5OA 2EYFA 3VJPA 5LL6S 1CT1D 2KDSA 2F0MA 2ZGWA 1TIID 2B8FA 1WPYA 2SOBA 3CCSA 3L42A 2K32A 1EWCA 1VDZA 2PW5A 2K5IA 4FF2A 3Q6SA 2OTLT 5HY6A 1QVPA 5C5MA 4M77E 3QUIA 2KHSA 4A4FA 4RKLA 2BA0A 2VV5A 5C4ZA 2ZXRA 5EBCA 4D6WA 4DAVA 3CD6T 4HSPA 1V8QA 2EQKA 4L6TB 4KHVA 1CTMA 4LD9K 2GA4B 1G91A 4OGQC 2K57A 5GAN2 2A69D 1YJWA 2NTTA 4BS9A 3WVDB 2QXFA 3ZFJA 5I2MA 1VQPT 2J7ZA 1VQ6T 2K5QA 3BDOA 3OWEB 2WINB 3H94A 1S72A 2B8GA 3NFCA 1JRIA 4KULA 2C06A 3QYGB 3CKIB 1WTRA 2GFAA 2KSSA 2EY6A 5HK3A 2EJGA 4ZRZA 4DA2A 3HPWA 5GAOp 2EJGC 2XU8A 1YJNA 2XN9C 3FIFA 3PIPA 4YTLA 5C0XI 3JCMJ 2GF7A 3CXCS 4HSVA 3NUCA 1KQ1A 3GV6A 3V8LA 1O80A 5CQYA 3Q24A 3FPUB 3GLXA 2X35A 2WKCA 4C0GA 1LTRD 5FLXE 2DXTA 3LH0A 3CPFA 4MZTA 4X3KA 3S6WA 3CCUA 4ILWA 1QJOA 1KTKA 3HEJA 1CA6A 2ICEC 1Y7XA 1CZWA 2FB7A 2MF2A 2KCNA 3CC2A 1Y96A 4M7DD 4IUNA 1FWZA 1JJ2A 1RD9D 2Z4IA 5CC4A 1Q82U 2R5MA 5C3XA 3JB9J 1IW7D 1JB3A 4M75F 4ME7A 2A69C 1IHZA 2DO3A 4ULLA 3QYHB 4WRDA 5DEHA 2F0UA 2K33A 1BI1A 4JBWA 2FMMA 1C8CA 4EPCA 3M56A 4CKBA 1VQLT 3LGLA 2RA4A 1N27A 3EQLC 1FNWA 2B2WC 4Q5WA 1HQMC 2XWBB 3MA2B 3HRZC 1UEBA 5GMKi 1SBBB 2RHZA 1NR4A 4I7ZC 4ZGDB 1HHVA 5KIXA 4K8JA 5A2QE 5CKDA 3BW1A 3MXUA 4Y91A 1U1SA 1EY0A 3K7AB 2WSFE 1K8MA 1JCKB 3JCMg 4C92D 3CC7T 2RJEA 2ZPIB 1RDPD 4MDWA 4ABNA 2FL7A 3M4YA 3FEOA 3VKIA 3L2VA 2VNUD 3SD4A 1VQLA 3NXWA 4C56C 3K5MA 5EPJA 1D5MC 1PRTD 2KOLA 4XYQA 3CCRA 3TREA 2BOSA 4RAUC 4ID6A 3K59A 4M78D 3G71A 1LTGD 1LT4D 1EL0A 5FU7C 3HP3A 4F7UA 2JEBI 4FXDA 1CHPD 4V2SA 3CCMT 1WTOA 3IAYA 5J26A 4CKCA 3NWTA 2DJZA 1GUWA 4PL6A 5EG2A 3C94A 2WP8J 1DONA 2A6ED 4H44C 4GY5A 4ZKCB 3RZOB 2LQKA 2RKSA 3RMHA 5CR2A 2R57A 2KQ3A 3CBPA 1H9MA 2DY7A 2B2UC 2P0KA 1OXSC 1LTID 1C48A 2XSCA 4C3IG 4M7AE 1I4QA 4C1NI 4OB2B 2LNVA 4IUTA 4LMQD 1ZQ1A 5GANh 2ENBA 4RHSA 5C3EB 1YBYA 4XQQA 1STHA 5KNBA 3S3NA 1EY9A 3JB9H 1D1IA 1WJQA 1SSFA 3OBYA 1C4QA 1ZYRD 3TZUA 2WIIB 1K8AU 1JR0D 4KTAA 3DHQA 1YHQT 2EJMA 3KLSX 1X3QA 5GAOl 1AEXA 1Q86C 1N8RC 3OYIA 3MXGA 4TRDA 4BY1B 2C9OA 3NE5B 2H3JA 2KEEA 1D1KA 1GUTA 4DU9A 1KDCA 3S1NB 2F0IA 3BDLA 4BA1I 5GMKh 4M75D 4OB0B 2PNRC 1KQSA 1KHCA 2YLBA 3OYNA 5CCAA 2F0PA 1EQVA 2RJFA 1PZID 3U9OA 5A0LA 2CZ0B 3QOLA 1STYA 4DXGA 1I4RA 4ZK9B 2RI5A 2KA7A 3PIO3 2N88A 1XOVA 2VXEA 2DD5A 4ZAIA 4JRQA 2EYMA 2BDNA 2DNCA 3G6ET 2FJ2A 1XYIA 1KLUD 2MGSA 2V4DA 2DN8A 1JJ2S 2NWGA 4DK0A 5K36H 5GAMh 3OYBA 4A93B 3PMFA 3VV0A 1PZJD 4RCNA 3RKXA 4K6LA 1IYVA 4KJNA 5CV6A 4K2LA 3OPOA 3I56T 1G8ZD 1G3YA 3NBIA 5ELFA 2HDMA 2OAUA 3CC4A 4DF7A 1VQ8A 4ZTJA 3G7ZA 2H1EA 5FU6B 3E0JA 4A4GA 3SEBA 3OMCA 4PV1C 1YJ9A 4IZ8A 3IFTA 5CKFA 1VQPA 4KI0A 3DWQA 1ENFA 2XRQD 1HA5A 2OEOA 4ZLTF 1EIGA 2B2YA 4KD3A 1XTDA 4J6WA 3C3LA 3LWUA 2QDBA 2RJDA 4E47A 3IFDA 4A3JB 5EKIA 3D6CA 3G6EA 2E76C 5GANg 4DQ2A 5KCOA 1EEID 1AFPA 1WTVA 3MEUA 2DEQA 1SYGA 2JA6B 1B9NA 2GFUA 4IKFA 4LD6A 2F0OA 1JBMA 5KCHA 5KEEA 2QA4T 1U4PA 1A6XA 3MP8A 1B34A 2NVXB 4TQUS 1B50A 3NTHA 1QG7A 2X69A 1V1PA 4XXEA 3H3VC 5I6YA 1LTTD 2I07B 4A3EB 4NMZA 4RCBA 3VYRA 1M1FA 2L0CA 5KYIA 4KKUA 4NP5A 2RHXA 2RHUA 1LLRD 2PZTA 1XQHA 3MWYW 1IKMA 1O7LA 3MTSA 3N5BB 1QCBD 3OYHA 1VQKA 2ZXPA 4PJOG 1TWFB 1WTQA 3OYDA 1PDQA 4JUVA 2PZWA 4HT9A 2X4XA 1M8AA 2BCOA 3VYGA 4RGOS 1CZGA 4FT4A 1VQ5A 1BYMA 2VXFA 5AFWA 2CZ7B 3TCJA 3SWNA 4ODGA 4JLIA 1SNDA 5EKKA 1EZ8A 2QEXA 3OBWA 1MI2A 1ET6A 2RVLA 5GAOn 5COYA 1EYCA 3OW7A 3OMGA 4M7AC 1PRTC 1I4K1 4L59A 3KK7A 5ELCA 4RH6A 1B44D 3D6WA 1BKBA 1WQWA 4XU0A 1A3TA 4A3FB 3CC2T 1QVFA 4FF4A 2VUMB 2SNMA 4PJOF 2JNGA 5LJ5j 3OYFA 1PMRA 2PVGB 1RJTA 3P75A 3PO2B 4QW2A 2L8DA 2QF7A 3A55A 3DB4A 2QDYB 3DUZA 4O1NA 2QQSA 3MZ5A 2JA7B 1TWHB 4BBSB 3O8VA 2EPBA 1N8RU 3E19A 5LJ5e 3C1FA 2EQJA 1CQFA 1CQVA 1WGSA 2BUDA 2RO0A 3M9QA 1BXTA 1AZQA 5J3BA 2ICIA 3UT1A 3A8LB 3T4AC 1TS3A 4NW2A 4N4HA 3X3MA 1YNNC 1QW1A 2DAQA 4XQJA 2XDDA 2D5DA 2F0DA 2QQAA 1S4ZA 3RZDB 4Q0FA 1SYFA 1B4OA 5DM73 2EWNA 4M78A 3E5SA 5DM7R 4G7ZC 4XTUA 3W2DA 4N9PA 1TU2B 3MHXA 4B08A 1I6HB 3TMEA 5C0XH 2K6AA 1T5XD 4E7LA 4FXKC 4XTCS 2K5WA 3S1RB 4ZN3A 4M7AA 1LV9A 1VQ7A 4TVRA 3GTMB 4QQGA 2X6GA 1BNZA 5GAOr 4QIWB 3CCQT 4R8IA 1TR5A 3A56A 1H3ZA 1V1PB 3OIQA 2K7VA 5A0GA 3M54A 2FFKB 4BB7A 4N0AA 5FKAC 2I2LA 4M75E 1U8RA 3LWEA 3A8MB 4PJOB 4HN7A 2EJFC 1B9MA 3VR4A 5JEAJ 2ZZDA 2OTJA 4IN3A 4M7DE 3TBIB 1U4RA 5G3LD 2JE6I 3RLFA 2RI3A 1CI3M 1VQ7T 3QB3A 3UWNA 4YIJA 5HK0A 1RHPA 1STAA 4RA8A 2PCFB 2E70A 3OYJA 3MXPA 1YNJD 3H6MA 4R8NA 1FXXA 3M3YB 4JS5A 3C1EA 3KUFA 1DYQA 1GUNA 5JEAH 4KMUC 1YJNT 3UPUA 1X6OA 3PUWA 3RKYA 1I6VC 4CHTB 2AHJB 3N52A 3SXHA 5CKBA 1UGRB 4A3GB 4M7DG 2J4XA 1I4HA 3L2WA 1EU3A 4DAPA 4XTVA 5LJ5g 3PIP3 2B63B 3V8KA 4OGCA 1WTXA 4K2KA 2Y4XA 5GAMd 3P8HA 2MMPA 4K14A 3D31A 2XHCA 1M90C 5DY9A 4FYDA 4MDXA 1QNKA 1GXDC 3TP8A 1GUOA 3R93A 3Q22A 2EYPA 1E0BA 3S3OA 1PYWD 3A8HB 3OYYA 3C2PA 3HP9A 4B9XA 3BY7A 2CVRA 1R8OB 3E6ZX 4ELYC 4MMLA 3RERA 1XXGA 4MZPA 4OIKA 3X25B 1KHIA 2E74C 4QMGA 2A74C 4XU3A 4C8QF 2KUMA 4BE1A 5E1FA 5IGEA 2HD0A 3FJPA 4JS4A 4H7BA 2X4WA 1G2TA 2KECA 3JCMc 4R9WA 3L2RA 4PMWA 1VQMA 3S3MA 2D62A 4DGZA 3S15B 2DZ9A 5KH6A 3I4LA 3LLRA 1G3SA 1H9KA 1VQ5T 4QCLA 5EGTA 1D5ZC 3A5ZB 1KLGD 1K9MU 5CV7A 1NJIC 3RESA 2ZT9C 5KYLA 2L1BA 2FVUA 3RIRA 1DZ1A 4M7AD 2CZ1B 5CORA 2NVYB 2QCPX 1U4LA 2KAFA 1EYAA 1FX7A 2EQUA 4C92C 1Q86U 2R6GA 3VYTA 3Q23A 4QB4A 3CBOA 1IKLA 2TMPA 4C3JB 2RJCA 1ZEQX 5CIUA 1P92A 4B9WA 2OTLA 4HTHA 2DTOA 1EZ6A 3L2UA 3K58A 2Z1CA 1YITT 3OS1A 1UEAB 5CAIA 3CCMA 2JOYA 4WF2A 1WCMB 4K8IA 5IGBA 1Y1WB 4LDUA 4IUUA 4C92E 1IREB 1PSEA 2F5KA 2OXPA 3VYUA 3META 3GTKB 1BI0A 1Y69U 1F9SA 1I4GA 2RI2A 3D4DA 4RGTA 2K04A 3GTJB 2DTHA 2RQXA 4C5GA 1VQNT 1Y96B 4M78C 5C44B 4M77D 1G5VA 3CCVT 2QI2A 5E4WC 1SJED 4JLGA 4C1NK 3K5LA 1E2WA 1VQOT 5J22A 4NKLA 1QVFS 4BI4A 3TEEA 3AHUA 2IX1A 1MSHA 3VR2A 1RTNA 4DNTB 4L8JA 4KT0E 4HCBA 5CVIA 5JVG3 4V190 1YCYA 2HDLA 3PIOA 4BI3A 2B2UA 5FLXL 2EYHA 5DNFA 5KRUA 5J1ZA 2XD0A 2JP1A 4N4IA 4A3MB 4LDWA 2BKDN 3JB9F 1LT6D 2EDGA 4TSSA 5KNCA 3SR1A 1PLFA 2RB6A 2JUFA 2J0TD 4O6JA 2ZPFB 3D3RA 1RTOA 5CQXA 3RMQA 1TS4A 2F5TX 3NTKA 2F4IA 1WNLA 4ZUJA 3TSSA 3I55A 3GIBA 2AQ1B 2K5FA 2E12A 2EYQA 1B2TA 5BN4A 2IT1A 1A15A 2QQ9A 4HA8A 1R4PB 1HTPA 1U4MA 1Q1EA 2B2VC 2QEXT 3HOYB 2O5JC 3M59A 4G7HC 1OI1A 4BD3A 1Q3LA 4KV6A 3NQIA 3D4WA 1M4VA 3OS2A 2YLCA 2FHDA 4KHZA 4HEDA 1ZYRC 5TSSA 3CRLC 1KNEA 5ELDA 3MFGA 5M3MB 2H4OA 1HA6A 3BVMA 2XK0A 5LJ5h 1J8IA 3M4GA 4FM4B 5CR3A 2QTXA 4XK8E 3D4RA 4FVMA 3MCAB 3M53A 1TWGB 2CW0D 3X3NA 1UGSB 2EXZA 1S5ED 2HUGA 2RDHA 4CJ2C 1NZ9A 3GTOB 2QA4A 2L11A 4KKSA 3JCMW 4PJOE 2M9VA 2D9UA 5C4XB 1EEFD 4WJWA 2LFNA 2V8KA 2CHBD 1L0YB 1ET9A 1SE3A 1EWHA 3GTPB 1B53A 1ESFA 3OYEA 2NB0A 4BE2A 4J8QA 3CCJT 2R92B 1VCIA 2NN6H 1EY6A 3FVQA 2BA1A 1YNJC 5IIFA 3MAQA 2F0LA 1Y07A 2F0SA 1BCPF 1NSNS 1EQTA 2V8IA 1Y1VB 1PTOH 2ZXOA 4CJ0B 1NPPA 5LJ5f 4E7IA 5DM63 1A3UA 1I4PA 4K5XA 1J9OA 2M9UA 3A8JE 1YJWT 3G7LA 3PUZA 3WXMB 1PFNA 1ONLA 3RKWA 2E6ZA 1VQNA 4DNRB 4ME5A 1VQMT 3HOXB 3CCJA 1D6EC 4OHJA 2E6NA 2VUBA 2EYJA 3L2ZA 2XKOC 3V8JA 3S1QB 4OGEA 3L1AA 3JCMP 4PJOA 3M85A 3K5NA 3V7SA 4O5VA 4M75A 1EY7A 1D5XC 2JN0A 3SK8A 4BWGB 2RHYA 1LOJA 4X34A 4V0BA 3NP8A 1CA5A 4LAAA 3PMTA 3JCMb 1E2ZA 4IALA 1RKNA 1XWEA 3E1SA 3OB9A 2YU9B 3MEHA 3T16A 1ESRA 3MEAA 2F69A 3ME9A 3S1MB 1VF7A 1M1KC 4GLKA 1JOKA 4UDUC 1MHNA 1YHQA 4U673 3BVZA 2HCCA 1QVGS 3ZBDA 1NCVA 3HRUA 3ITPA 1V43A 3DKMA 1KD1C 4XIGS 1A3VA 1VQ9A 3HRTA 1K83B 1ENAA 1JQYD 5JEAG 3JCMV 3KLRA 4C2MB 4CKEA 4M8AA 1ENCA 2PO4A 2MPMA 1V1OA 2L5TA 3R8BA 4FL6A 2NUCA 3CC4T 5GANj 5L8RE 3CCET 4RGNA 3U9SA 5E4XA 5IAYA 4J5YA 3LWIA 3INZA 1YIJA 4A4HA 1A2UA 2CZ6B 4PNYA 3K6OA 3A7LA 4EMGA 1BR9A 1ZHIA 1QILA 2R7ZB 4Z9CB 2DZCA 3CEYA 4M77F 4EMKA 2DY8A 4EMKC 5GMKj 3P8BB 2I46A 3TP6A 1PFBA 2ZPEB 2DXUA 2PQEA 3PMIA 1Q7YC 3S16B 4WORA 4XAXB 4OB1B 4ELZC 1W6KA 1OZ2A 4IUQA 1RL2A 5GMKe 2N55A 1HTLD 5K36G 3PFSA 4DK1A 4BY6C 3OA6A 5EPKA 4FF3A 4BY7B 3TU4K 3QSUA 3FKIB 4KJOA 2DVEA 3OYLA 3URGA 3LX0A 2E65A 1JE4A 2F0KA 3A8IE 3ND8A 3JCMe 1LACA 2XVSA 2PVOB 1VIEA 4M7AB 2L55A 1QB5D 4X9CA 3EA6A 2X4YA 4H0LC 3J80E 4M7AG 2ID0A 3PUYA 5GAN5 1HRJA 3UDCA 2MWPA 2DKGA 2R93B 3M5AA 1UUPA 1D3BA 1ZBXA 1OXUA 3TP5A 1WJRA 3JAML 4RGMA 1S5BD 4PNOA 4JRPA 1BDOA 2WV6D 1LTAD 1MSGA 1IYUA 4R55A 5F2DA 1DJRD 2E2HB 3FB9A 3RUZA 4PJOC 4XDXA 2PUOB 5GAN6 1UGPB 2JTFA 3KXTA 5CV5A 1SE2A 3V96A 5ELBA 5I2XA 5CMDA 3OYAA 2K3XA 4M77B 2MP1A 2XNAC 1WVLA 4Z02A 4CRIA 3SFMA 3ER0A 2D9TA 1UNSA 2M16A 2GQVA 3OOCA 2PPBC 3VYHB 1TY2A 2F0HA 3VU3C 5GAMf 3E9GA 5IOCA 2P0PA 3R2TA 1Q82C 2EAYA 3I90A 4IURA 5DLQE 1K8AC 5FRMA 1LTBD 1EY5A 4G57A 4C3JG <