5J39A

Crystal structure of the extended tudor domain from tdrd2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
196
Chain Sequence
GRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSKKLDIGLELVHKGYAIELPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor and KH domain-containing protein
publication title Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 196
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j39A02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j39A01
4N4GA 4B9WA 4BDZA 4L59A 4Z02A 2R58A 2EY2A 3PNWC 1SNDA 2BUDA 5EKKA 2PZUA 5CIUA 4WRDA 3MZ5A 3OMGA 1SNOA 2R57A 2PW7A 4N9TA 3MEVA 1SNPA 5M9OA 3QB3A 2NLUA 2RJFA 1STHA 5KYLA 4K14A 2JTFA 3DB4A 3QJ6A 3SHLA 3TP7A 3P8HA 1MHNA 2PQWA 2LDMA 3DLMA 2R5AA 3V2TA 4C5IA 4EDUA 3U9OA 3OYKA 2F0WA 3T16A 2HQXA 2XK0A 5KYIA 1KABA 1U9RA 3OSOA 1JORA 4DGZA 3MXPA 3L2UA 3H6ZA 2PW5A 3L2QA 4UC4A 3ASKA 3OYDA 5IGEA 4K5WA 3MEWA 5CV7A 2EYLA 5KRUA 1SNMA 3R3OA 2EXZA 5J22A 4N4IA 2EFIA 2GFAA 4KD4A 3OS0A 3DHQA 2JZ2A 1SYFA 5KE2A 2F0UA 1JOOA 2M1HA 4CRIA 2RJEA 1AEXA 3TP6A 3MVVA 5CR3A 1RI0A 2O4XB 4IUVA 3S9WA 2X4WA 3NTIA 4Q5WA 3SK5A 3SD4A 2SOBA 3OMCA 4KD3A 5KIXA 5EKLA 4GY5A 4ZTFA 3HZXA 3S3OA 4EQOA 3TP8A 3LLRA 3ITPA 4X34A 1JOKA 3PMIA 2QQSA 5CV4A 5NUCA 3S3MA 3NTHA 1A3VA 5D6YA 3PMFA 2BIVA 5IIFA 4KV6A 4BD3A 2XDPA 1EY0A 3HEJA 2QDBA 5IAYA 2O4XA 2F0HA 4OL7A 1NUCA 1EY4A 4QQDA 1KDAA 5JAVA 3NQTA 2M16A 4KHVA 5C3XA 5C6SA 4II1A 3MEAA 5FRNA 3OWFA 2F0SA 4BE1A 2RHZA 4N4HA 2MWPA 2K3XA 3FEOA 3UWNA 2NUCA 3SK4A 2YRVA 2EQJA 4K2LA 5FROA 3OA6A 1TR5A 2G3RA 4H7BA 1SYBA 3UT1A 5KGUA 4FU6A 4LD6A 3QKJA 4TRDA 3S6WA 3OYNA 3BDLA 4NP5A 3FC3A 4G57A 3P1HA 2RJDA 4KY6A 3O8VA 3MP8A 3BDCA 3DB3A 2WACA 5J1ZA 4EVOA 1EY6A 4PMCA 3PFSA 4ZUJA 2EY5A 2HQEA 1SNCA 2F0IA 1N27A 2EYJA 4C5EA 1II3A 5IODA 4RKBA 4PL6A 5C4HA 4IURA 1F2ZA 3NP8A 4R8NA 3OYIA 4IUTA 3NHHA 1TQOA 3E5SA 3QIIA 2R5MA 2EYMA 3NUCA 3C4SA 2SNSA 5C5MA 3RUZA 4ID6A 2D9TA 4DF7A 3TP5A 1STAA 5CGKA 5IGCA 2F3VA 4K6DA 4E7IA 4ZTJA 2ENBA 1KDBA 3Q1JA 4WORA 2F5KA 3OS2A 4HMJA 5J26A 4E7JA 5IGBA 4NDXA 3QBYA 4EQNA 1A3TA 5KCHA 1H3ZA 3PMTA 4NKLA 3OS1A 5FRMA 4J6HA 3LX7A 3MHBA 2F0OA 2DIQA 5DEHA 2RBMA 4IUNA 4J1MA 4E7LA 3H8ZA 2RI2A 4K2KA 4ZUIA 4EQPA 1SSFA 3OYGA 2FHDA 3SK6A 5EGTA 5I9PA 4K5VA 2RO0A 4BDYA 2EKOA 4IALA 2RI5A 1EY8A 3FDRA 1A3UA 4IKFA 1WJQA 1STBA 3LGFA 4ODGA 2K3YA 3T13A 4S3SA 3LX0A 5D6WA 2F0VA 3OYHA 3ME9A 2L8DA 5C5LA 3LGLA 1A2TA 3MEHA 3KUFA 1OZ2A 3CEYA 2CKKA 1WGSA 3META 2F0GA 4IZ8A 2EY1A 1SNQA 4IUUA 3SXHA 4I65A 3EVQA 4HMIA 3OB9A 1STNA 4LAAA 2RDFA 4A4GA 4KJNA 2GFUA 1EYAA 4QQ6A 3ERQA 4IUQA 2F0TA 4ME5A 3QOJA 2X4YA 1TT2A 5IGGA 4HTHA 3EROA 1EQVA 1EZ6A 3D8GA 4DFAA 1SYEA 2IG0A 2PZWA 1EZ8A 2RHUA 2EYOA 5IGDA 1OI1A 1SYGA 5D6XA 3H6MA 4YIJA 4KY5A 4K8JA 5I9OA 3DMUA 5KCOA 3OYFA 3D6CA 1EY5A 2DIGA 5F2DA 4FL6A 3MP1A 1OYXA 3L42A 2RJCA 1SYDA 4QMGA 2EYFA 4RKLA 5DAUA 4C5GA 2QQRA 1EYCA 2EQKA 5I6YA 3L2VA 3GOXA 2RHYA 3NTKA 1OZ3A 2E5QA 1NSNS 2F0MA 3P8DA 2EYPA 5C3WA 2OF1A 3NXWA 3OY9A 3LH0A 3VA5A 2F0JA 3SR1A 3E9GA 4BE2A 3D4DA 5KE3A 3C1EA 2MWOA 2EQMA 2LTOA 2L89A 1EYDA 2PQEA 3OYCA 3SK8A 5CV8A 4MIUA 3MEUA 5E1FA 4E7KA 4PNYA 4PMBA 2B8AA 4NMZA 1KDCA 3F70A 4E7HA 5C6AA 3NK9A 3OYLA 3MO8A 3P75A 4QW2A 1WJSA 2LKVA 2VYTA 5HGTA 3C1FA 2BKDN 5JOBA 1EY9A 3L2RA 4K8IA 3OYEA 1SYCA 2F0FA 5HURA 4PLIA 4PLLA 2EYHA 1ENCA 3TMEA 2KQ3A 2F0QA 4F8MA 2SNMA 1EY7A 2RKSA 5IGFA 4K5XA 2E6NA 3OYBA 4KTAA 2F0EA 2DAQA 4RG2A 4NS5A 2F3WA 5CV6A 4IUPA 4A4HA 3FLGA 3OYMA 2OEOA 5CV9A 1G5VA 2GF7A 2EQUA 2F0PA 3S3NA 1STYA 4QB4A 3D4WA 1KHCA 3EAEA 2KHSA 5CV5A 2PYKA 5ISRA 4DU9A 2P0KA 2F0NA 2OXPA 4KJOA 2M0OA 4QQGA 3LYIA 3EJIA 4N9PA 5IOCA 3OYAA 2LVMA 2X35A 5K5PA 1XNIA 4OVAA 3E9FA 4A4EA 5IN1A 5CC4A 3M9QA 5E3FA 2PZTA 3OQ5A 4BE0A 5I6WA 1F2MA 3MP6A 5C4ZA 1KAAA 2RI3A 1ENAA 2LRQA 3L2WA 4B9XA 2F0LA 2EY6A 4QVZA 1JOQA 4KY7A 2L3RA 1F2YA 5KH6A 2LCCA 4E6IA 2RHXA 1A2UA 1RKNA 3OYJA 5C0MA 2F0DA 1IHZA 2X4XA 2M00A 3ZEHA 4ZQ3A 4QF4A 4C5HA 4F7XA 4BACA 1WJRA 3QOLA 4A4FA 1STGA 2F0KA 5J39A 5KEEA 2RHIA 4HCZA
chains in the Genus database with same CATH superfamily
4NL3A 5C0XG 1LTTD 4EX5A 3M7NA 4B9WA 3CPFA 4BDZA 1JJ2S 1K9MU 4DOWA 3K80C 2QK0A 5EBDA 3STBD 3MXUA 1BI1A 3J7YW 4CKEA 3PNWC 1SNDA 4GLXA 4OB2B 5IT9E 2DNUA 3VUBA 2PZUA 2EVBA 2RF4A 5JPMC 2UXDL 1FGBD 4DPGA 4DEYA 3OMGA 1KQSA 4LF9Q 2JOYA 1PTOB 2PW7A 3RR6A 2V4DA 1H641 3BYYB 3MXGA 5JJLA 4N9TA 2HCCA 1G6ZA 2E6ZA 4KMUC 3MEVA 1SNPA 1NE8A 1TWBA 2CREA 1F1BB 4F14A 5KYLA 3DB4A 3QJ6A 1AP0A 5EPJA 5JJZA 4EIKA 3P8HA 4MHEA 2DEQA 1X56A 4BA1I 1SRUA 3RZOH 1MMNA 2JA5B 3DLMA 1RJTA 2GQVA 2A19A 1EIGA 4RHRA 1HTPA 1G2TA 4M4ZA 4PZ8A 2OTLT 2HQXA 2QDYB 1R4QB 1Y8PB 4DV5Q 4K6LA 3A8OB 1V9PA 1IXRA 1E1TA 3RMHA 1KABA 1U9RA 2JXBA 2IX0A 3FKIH 4XT1B 2DE0X 4NOYA 5IYCG 2WSCE 2JYOA 4J9EA 2F3IA 3S1NH 1PM3A 1PVOA 1K3BC 3L2QA 1PC0A 1RAHB 5AFWA 5HKCA 3BDOA 1BU1A 1W1FA 2LMJA 2WAQB 3ERSX 4RMOA 1JR0D 3R6OA 1P8LA 5CV7A 3OW2A 4GOPC 2YUNA 1ZUYA 4OMNA 3F2BA 1JB7A 5J22A 3REAB 1X55A 2FPDA 4J7FA 2QGGA 1W6KA 4KD4A 4P2CB 3OS0A 3DHQA 3VS3A 5KE2A 1I5OB 4AG2C 5JEAG 3NE5B 2UXCQ 1VYUA 2M1HA 2A08A 4LDXA 1G3TA 3GTJB 4L5GA 1V8QA 4DR6L 4DUZQ 4L6V5 5L8RE 2O4XB 3M58A 3S9WA 2XDDA 3SK5A 5M5YH 2SOBA 1JJ2P 5LMUQ 2IPOB 1VIEA 1KTKA 1DOKA 4JI8Q 4A3CG 1IW7C 4GNXB 3HZXA 4ZTFA 3GTMH 4FM4B 3S3OA 1DOLA 4M7DB 1WHGA 4EQOA 3LLRA 4GKJQ 3AYHB 1JWMD 3M4PA 4RCOA 5KNBA 4AT1B 1HR0Q 3I8ZA 1JOKA 1SSHA 5FU6B 1EQTA 2WAQE 5GAOr 1B7TA 4O42A 5M3FB 4DR4L 1GJXA 4XAXB 5ELDA 5NUCA 3TSSA 1SFOB 3NTHA 1PKTA 1A3VA 1VF7A 4R4TA 1K8GA 3PMFA 4GOPA 2K32A 1YJNT 3G4SQ 3A8JE 4AYBB 5IIFA 3K5LA 2Z0SA 1W2BS 5DLOA 4A3KB 5FLXE 1JICA 2AZVA 3H3VC 3EG3A 1YITT 5GAOm 4KN7C 3TEEA 1SSOA 1HYOA 1C7YA 2YXYA 5GAN5 2Q8IB 4IFDJ 1EY4A 1ONLA 4M8AA 3QHSA 1VQIA 1KDAA 4KULA 5D3DA 4CJ1B 1H8KA 4R0KA 2M16A 3C94A 4JI7Q 5KYWA 3JB9G 1AHJB 3EHQA 3CW2C 4JJBA 2OQ0A 1U8RA 2HL3A 3TQ7P 4HJ5A 3J81i 1WD1A 2ATWA 3GLXA 4C8QB 3C46A 2VB3X 1OQKA 2RQVA 3G71T 1J8IA 4J9IA 1TS4A 4RGMA 2JSOA 1PH9A 2NWGA 5GAOp 3RERA 5FO7B 1ZBJA 1EFID 3I7FA 1WTVA 4FF2A 1N34L 2GVAA 1YFNA 3NHNA 3UWNA 3RLNA 1U0LA 3HOXG 2VS1A 3CCEQ 2RHQB 5EAYA 5E7NA 5I21A 4AYBE 1QUQA 1K9AA 4LFCQ 2ZPBB 3G48A 3GF5A 4G7OC 1UGPB 2RN8A 3HOVB 4B3SL 1VQPT 2E2HB 1D1CA 1PZID 4A3MB 3S6WA 2K52A 1WTHA 4P74A 5FU7C 2KR3A 3CCQQ 3FPUB 4NP5A 1C48A 4DN4M 4OB1B 2DTOA 4C8QE 4PJJA 3O8VA 1MJCA 3PSIA 4KHPL 2XICA 1PFBA 3HP3A 4LFBQ 2F4VQ 5H1SE 2I0NA 1HNZQ 3VKIA 3V7SA 1HSQA 2MP1A 2QGQA 4GZYC 1KNEA 3M4GA 1UNSA 1RLPC 1EY6A 1YNJC 4IJLA 3TRZA 3PO2G 1MMDA 3X20B 2HQEA 3QDFA 5GAMj 1K73R 2JJQA 3KDFA 4LF4L 1II3A 3CC4Q 1RADB 1Y8NB 1AWWA 3KK7A 5IODA 4A3DH 4M75G 2ROLA 3EFOA 4J6YA 1AWJA 4D8DA 4PJOC 1B53A 3T4AC 4ZYSA 3OYIA 4IUTA 1WXBA 3RNJA 2NYZD 2UUCQ 3J80i 2WKCA 4MZMA 2A74C 3E5SA 4CC3A 3QIIA 3TS2A 3RKWA 3NGPA 3NMZC 3K0XA 1Q1BA 4ZGJB 2B2WA 1W2BP 1VQMT 3HKZG 1NEBA 3C4SA 2SNSA 1WNLA 4X3UA 3TP5A 1WTQA 1HJPA 4IPGA 2CGHA 4QUFA 4POGA 3ND9A 1KG1A 1GUNA 2D0QB 1LYLA 3A7LA 5IGCA 1CM9A 4RG8A 4XTVA 1VOMA 3D0FA 4XIGS 3FIFA 1GXIE 3X28B 1Y1VB 1N9RA 4XQNA 3BG3A 3BYTB 1C4QA 5GANj 1E7ZA 1KDBA 4OWXB 3M3YH 3Q1JA 3PCOB 2A68C 3ZBDA 5GADC 2HSEB 4JBWA 5J26A 1S3OA 3A0JA 3UATA 5FW9A 1SKUB 4OMOA 5I2SA 1A3TA 2D62A 4X66Q 1Z6HA 2A6HC 3BW1A 4NKLA 3RNUA 2E64A 1C8CA 5FLXc 4OO1I 1U1TA 3MHBA 4IUNA 1JWUD 3KJPA 1YWPA 2Z6BA 4DV4L 1OX9A 4BI8B 3RZDH 1CA5A 2RB6A 5GAN4 2HKNA 5GAN3 3HRUA 1VQ6Q 1VMPA 1CKNB 3MFYA 3SEBA 5M5XH 1IBML 4XDXA 1IW7D 3CXCS 3K6OA 5I9PA 1I07A 4X3TA 4C3JH 1EOTA 4A3IG 5IP7H 1HXDA 3H0IA 2HAXA 2TSSA 1I50B 2GA4B 4JI5L 3OWEB 2EKOA 3OIPA 1Y07A 1ZUKA 1EY8A 4DK0A 4DV0Q 1XPOA 1HHVA 1A3UA 3S17H 4IKFA 1WJQA 3PGZA 3M57A 4OWTB 3RZOB 3MCAB 2EQIA 3KFUA 2D8JA 1H9RA 2K3YA 1BQQT 3URGA 2RQRA 2IL8A 5EPKA 2F0VA 1T0JA 3H9NA 2D1XA 5C5LA 2X9HA 3LGLA 2K4KA 1G2BA 5DM63 2VQEQ 4JLGA 3KUFA 2JA6H 3OTOQ 4EMKB 2E8GA 1AW7A 3FKIB 1VQKT 3EIVA 3E19A 2R7DA 1SNQA 4M7DG 3VRZA 3JB9D 4IUUA 5C44H 2ATCB 3HSBA 4OIJA 4DA2A 3EVQA 3G4SA 1QP3A 1EEFD 2FO0A 1WJJA 3BZDB 4LAAA 2UUAQ 1V29B 1S72Q 4X65L 4Z8AA 5IHNA 2Z8LA 1IL2A 3ULLA 3H0HA 2VUMB 2DJFC 1YHQT 5LJ3j 2F2WA 1A62A 2AUKA 1W3SA 4DV6L 1NLPC 3VYHB 1NJIR 2X4YA 1Y57A 3V7CA 5IGGA 4OX9L 1EQVA 3JV3A 4BI4A 1EZ6A 3KBGA 2N3SA 2LCSA 1U4MA 1RDPD 1LM0A 4BXXG 2WIIB 3HTRA 1M1GA 3H3VI 4JYAL 1WHHA 4JI0Q 5IYBH 2SEMA 4NL2A 4YTLA 3PT9A 1EL0A 1AE3A 3H6MA 2QTXA 1ZSGA 1FVIA 4K8JA 3J7ZC 5M5YB 4R56A 1B9MA 5I9OA 5KYXA 4C92G 4G7ZC 3CAMA 3CCEA 1GHJA 1U4PA 3GTMB 2NUZA 5IYDH 3BDUA 2L3PA 1R77A 3CCVQ 2A69C 5HK3A 3D6CA 4PZ6A 1TH7A 5GAEC 1EQQA 2C35B 4V0BA 4FL6A 4KLKA 1MD2D 1C0MA 5GAMg 1PRTC 1SYDA 4QMGA 1TVXA 4ELYC 1T0HA 3CXCP 4ANJA 2ED1A 5GROA 2O31A 4XYQA 2Q2UA 1SROA 1Q82U 1H9MA 3CCQA 1TKWB 4M75F 3KFVA 1OX8A 2I5HA 1TU0B 2QKIC 1YZ6A 2YTXA 4BS9A 4PJOD 3UF4A 2M2LA 3S1RB 3NTKA 1OZ3A 3HOZG 3AU7A 2QEXT 1PTOF 3AB9A 2IWHA 4AQYL 4A3EH 1CA6A 5ELBA 4C56C 4ZLTF 4K0KL 2LC4A 3AHUA 4DR5L 2OTJQ 4OO1H 2ICIA 2VGNA 1HNXQ 4FXKC 3VA5A 1VQ9A 2CWAA 2R7ZB 3PGGA 1JB3A 1BVSA 5GANg 2YUPA 1KJWA 1Q81U 1YBYA 3CC4A 3G6EQ 2DJQA 2FRWA 1K4US 1ESRA 1TY2A 4LFAL 4RMFA 5LMNW 1SR3A 2EQMA 2J7IA 4DR3L 4B3RQ 2N55A 4JOIC 3KXTA 3ONAB 3CRLC 5IWAQ 2FZKB 1MBYA 3OYCA 3JCMJ 1XMQL 1O7IA 5CV8A 1NYGA 1E22A 2ZXOA 3MEUA 1MHWC 1XWEA 5E1FA 1BCPC 4M7AB 2AUJD 2NBFA 2FJ2A 1I4PA 1F9RA 1KDCA 3F2UA 3F70A 3JAMi 1X27A 2FEIA 4QGUA 1G3YA 1JE5A 4PV1C 3M0QA 3EFSA 4XTUA 3N5BB 4F16A 1ARKA 3OW7A 3P75A 4UHVA 1I6HB 1NR2A 4F7UB 1TWFH 1BBXC 1BO0A 3CP0A 2EJFC 1IYUA 5JVG3 4IIMA 1LTAD 4M77B 1BBZA 3E2UA 2K6DA 2MCNA 1VQNQ 5I11A 1DJ7B 3OYEA 3ULPA 4DBQA 1YNNC 4IPDA 2BZXA 1ENCA 5M5WB 4FIBA 1AH9A 1GD7A 1WTOA 2DLPA 2DEUA 3DLLA 4A54A 1VQ6A 3KF8B 1VQ5T 2VV5A 4FCYA 3VS5A 4FYXB 4M7AE 2F52A 5LHY1 4A3DB 2R92B 3OYBA 2KCTA 1YN8A 3UDCA 4C0ZA 1E2WA 1L1OA 4RG2A 4A76A 2YYZA 5A2QL 1HUMA 1O7YA 3RKYA 2ENMA 4IUPA 4M7DF 1G3WA 1RL2A 2OEOA 4F7UE 3H3VH 2DY7A 3BZCA 3J81L 2EOTA 4A3GH 1EWHA 4J9GA 1PHTA 4MZPA 1G5VA 4M77E 1E6GA 1LUZA 2A0FB 2EJFA 4M78G 1PLFA 4BBRG 2KXDA 4HT9A 4QB4A 1ICFB 3D4WA 3K59A 1KHCA 3M3YB 2VGMA 2E76C 5CR2A 1Q46A 4PJNA 4RTYA 3TSZA 2RMOA 3JCMP 1RI9A 1VQLQ 4WTOB 4LF9L 4YY3Q 5C0XJ 2JVVA 2YSQA 3K8AA 4A75A 5HGQA 2B2VA 2DL8A 1S72A 3EJIA 4NXMQ 1B4OA 4IPCA 4LUVA 4O2DA 4DR7Q 3HOYH 1WI7A 5HY6A 1WOCA 2DBMA 4C8QF 2R6GA 3RZDB 3HOWG 1SRLA 4TSSA 1Q12A 5LL6S 2DN8A 2Z4IA 4C92D 5M5XB 5JJIA 3GTQB 2K57A 3H0GB 2AT1B 5IHIA 2A69D 4EMKA 4C3JB 1R9TB 4OMMA 1QNKA 5CC4A 3M9QA 4IIOA 4H44C 5CKBA 5IXFA 5E3FA 3UI2A 4B3TQ 2UXBQ 1FNUA 1LNXA 4GN5A 2IJ0A 1HFNA 4DV5L 2LMCB 2R93B 1PTOH 3INZA 3F1ZA 1E1OA 3KBXA 3TEHB 5E4WC 1KAAA 3CPWA 1RODA 2CP2A 4LF7L 4HIOA 3CCVA 1QCNA 2F0LA 1SMYC 5EQ0A 2G9DA 1JOQA 1RCVD 2JA6B 2X69A 1GVPA 4F04B 1MSHA 2JA5H 2X3XD 4FNFA 3PV0A 2JMAA 1F2YA 2RDGA 1N8RC 4JW0A 1M1KU 4VUBA 2WKDA 1CK1A 1Y69U 4RGTA 2O9SA 2EVRA 2RHXA 1TS2A 4X3KA 2E5LQ 3C0CA 2F2VA 1DONA 3OYJA 2ABLA 4LUDA 1UHFA 4ZQ3A 2X4XA 1FWZA 4C5HA 1G291 1K73C 1VQDA 2ZXRA 3HOUB 3WDNA 1PRMC 4JI6Q 4A93G 2UXCL 3RBBB 2OTJA 5GAOq 4DUZL 4C0DB 2KRNA 2HDLA 1TG0A 1W6XA 1DM0B 4HJ9A 1BCPD 4RHSA 3I91A 5LMUL 1YJ9T 4JI8L 2AZSA 3G6EA 4L59A 2AKLA 4HIMA 5JEAJ 1PKSA 1IYJB 4GKJL 1RF2D 3OPOA 3CCSA 4CDCC 2IVWA 1HR0L 2OTLQ 1I4RA 3VYRA 3GIBA 4WRDA 3BVGA 3CCJA 2A5HA 2K14A 3PUXA 1QVFS 4BY7H 1I5LA 1MJEA 4B3MQ 2KNBB 1SNOA 2R57A 1M4ZA 4BBSB 1KC8C 1BUVT 1PYWD 2MJ8A 3MWYW 2JA8G 2DX1A 4R4IA 2N49A 4A4IA 3EGDA 3GTJH 1YNND 3QB3A 3TVTA 2MOXA 3M53A 2BDOA 3RMQA 3I3CA 4ZKBB 3JCMg 4IFDI 1RACB 1G8XA 2VB6A 3SHLA 1BDOA 2RHSB 3SVMA 1M8MA 4OMFB 3ER0A 2MHVA 2EGCA 4A3BH 4KHZA 2MFIA 2LDMA 3G7ZA 2R5AA 1QLYA 3V2TA 3CCLT 1TXQA 2JTMA 3I70A 3RMSA 1CKOA 1VQNA 1ZSZA 3OYKA 2XU8A 2F0WA 3PO3B 1B7YB 4A3EB 4A3JH 1Y1WB 2UXDQ 3DEOA 5C44B 1SFOH 2A37A 2DL5A 2DETA 1JORA 3FDTA 2DNEA 3H15A 1VF5C 1K0XA 3NBHA 3CBMA 2B39A 4A3KH 2FB7A 4M78F 3JB9J 2CS7A 4ZN1A 4E7ZA 5EC7A 1AZEA 4M78D 4FXGC 1IBLQ 4UC4A 2KI7A 3S2HH 3JRZA 5IGEA 1U3OA 1EUJA 4LFCL 1JO8A 1ZYRC 3G7LA 4M77A 3MHXA 2C06A 1UE1A 2EYLA 2DZCA 3EFXD 4PG3A 3VDYA 2K9GA 4KN4C 4N4IA 4O1NA 3RLOA 1BXTA 1G6PA 2GFAA 1H9JA 3PIPA 3TZDA 4GLVB 4XTWA 1C9OA 2F0UA 3L2PA 4IOCA 2DTHA 3FJ5A 4LD9K 4U68A 3EG9B 4GOPB 1CKBA 2E75C 2O5JC 5K36G 3J7AF 1DD2A 4LFBL 1YITQ 2F4VL 2PVGB 1HNZL 1GUOA 3A56A 3LWUA 1RI0A 2K28A 2E12A 2EPBA 1PA6A 2NN6I 3R2TA 1B70B 4ATOA 1QWYA 3OMCA 4KD3A 2BCOA 4YWMA 3IFDA 5EKLA 2KRMA 2LQWA 4PQXA 1OXXK 3FJPA 3TP8A 2K79A 4XTYA 2XSCA 5KYWB 3ITPA 3HOVH 4HCSA 1GUTA 3ICEA 1NJIC 4YWLA 3UDXA 2ZPGB 1M9SA 1QVFP 4A3MH 2K4YA 1UEAB 2ZM6Q 4P73A 2UUCL 4TKOB 5CK9A 2JTEA 3S3MA 4ELZC 5D6YA 2CZ1B 3OBWA 2Z0WA 4IJHA 4BY1B 3VS1A 2BIVA 2DXTA 1QZHA 1B34B 5GJWB 4KV6A 1XTDA 4HIKA 2K5WA 2K01A 2D0NA 1EY0A 1SMYD 5CVIA 1IHVA 2MGSA 5LJ5d 1E2ZA 1NUCA 2VB2X 3MFGA 1VQ4T 1KRTA 2HCKA 1PHJA 1QUQB 2L12A 1VQLT 1M1FA 3M56A 1LTGD 3QO2A 1DOMA 1S5BD 2K5NA 2RNAA 4CBVA 1TUCA 3DWAA 4KHVA 2D8HA 4O0AA 2UU9Q 1S1NA 4ZGDB 1VQPQ 2B3GA 2X6GA 1KRSA 2BE9B 3AQQA 4X66L 2L3SA 5C3XA 3K7AB 4LJZC 2EW3A 4L63B 3U9SA 3TS0A 2CWPA 3OWFA 1VQJA 4C3IG 4HJ7A 2F5TX 3PUZA 4RAUC 4BE1A 4DXGA 1K8AU 4OONA 4J83A 3Q0AA 3PIOA 2V1RA 2JEAI 1NEGA 2V1QA 4N4HA 2YRCA 2MWPA 3GO5A 1FNVA 1SDFA 4IPHA 4UDUC 2RD1A 2VWFA 1DZ1A 3A8GB 2LQ8A 1Z9QA 4J6XA 4UY8C 2K05A 1MNDA 1Y1VH 4DAMA 4RCCA 2Y0SE 1A8VA 2ZAEA 3OA6A 3KDFB 2KSSA 2JW4A 4H7BA 3K5OA 4RCBA 3EFOB 5C44G 2LJ3A 4TRDA 3QKJA 5A2QE 1KD1R 1EIYB 2E5KA 1Z7TA 4DV0L 2JXMB 1VCIA 1PZJD 3OS5A 4L6TB 1VQMQ 4LF6Q 3QYGB 3J81E 1D0XA 2XRQD 2OAWA 3P1HA 4KY6A 3MP8A 1KL9A 2DNCA 3S24A 1JU5C 3DB3A 5FU7B 5J1ZA 4EVOA 2PU9B 3FB9A 1VS0A 2QGFB 4M7AF 4J5YA 4PK4A 2OTLA 2CSIA 1T3SA 4RGOS 2VQEL 4JBKA 1K8OA 1D3BA 2NYSA 3ND8A 4GKKQ 5T1IA 3OTOL 2E2DC 4ULLA 2XG8D 5EJWA 4ZUJA 1PH6A 1EEID 4X64Q 3SFMA 1MGQA 4LMQD 4ZRZA 4XQQA 2CZ0B 2RCNA 4IURA 1F2ZA 4R8NA 1I50H 2UUAL 1ESFA 1NZ9A 2QA4T 2RQUA 2RDHA 5C4XH 2E41A 1PH3A 3E9IA 3ZYYX 2R5MA 1AZPA 1D7QA 2Y4YA 1Q86R 1Q7YR 4DKAC 5IYDG 4JRQA 1D5MC 1ASZA 4PJMA 3RKXA 4HR7B 5CGKA 1SG5A 2NWMA 1TUDA 5FWCA 1D0YA 1B50A 2LNHB 2VC8A 1ZYRD 1T5XD 1NG2A 3CCRT 3EFRA 3GTLB 4JI0L 5GMKl 1TS5A 4UPAA 4WORA 2KCCA 2F5KA 3J7AV 3HRSA 3VYGA 4EPCA 5ELOA 3VR4A 4BBSH 1WPYA 2KROA 5DY9A 5HK0A 4E7JA 2K1BA 3M7GA 3SEMA 4C1NK 4EQNA 4D8KA 4DQ2A 4G4KA 2KEEA 3OS1A 1ABOA 4J6HA 2W0ZA 3LX7A 2VNUD 1Q3LA 2XMFA 4ME7A 4DBRA 4JRIA 2RBMA 3OIQA 2VUMH 4RTVA 3RN2A 3J80E 1N6AA 3A5UA 2RQWA 4DAPA 3T53B 4KKTA 2ICEC 4YCUA 5GMKj 4PNOA 1N9WA 2L3QA 3OYGA 4PJOE 2P5ZX 4BY7B 1MNEA 3TU4K 1PG5B 1AE2A 1YI2Q 3I9QA 1PXUA 3PUWA 3SWNC 1VQKQ 3SK6A 4F87A 5EGTA 4LNQA 2E2IB 4RG1A 3VS4A 1YJNA 5GAOn 3CMAT 3JC66 1BYMA 2RA2A 5I4DA 1SBBB 2HBWA 2QILA 2DK3A 1YITA 4QVCA 2NVTB 4JLIA 3FDRA 4AFSC 3CMET 3LWHA 1VQBA 1BF4A 1I94Q 1YHQQ 3WVEB 2JT4A 5A0GA 4A3BB 3PQIA 1STBA 3VS0A 4JCVE 2AQ3B 4AH6A 1M8AA 1HNXL 3HHTB 1FNWA 2FZCB 1EX4A 2PO4A 5D6WA 3U23A 2Q2TA 4LUOA 1M90C 3S2DH 3MEHA 4B3RL 1EIHA 4JI2L 2IIMA 4A3JB 1PNJA 1OZ2A 3CEYA 4WCIA 2E4HA 1V1CA 3G71A 5IWAL 3META 1Y8OB 1UEBA 2EKHA 2FL7A 3EG9A 1FGUA 1SF9A 2EY1A 3ZJYC 2K50A 4I65A 1I0CA 1STNA 3S1RH 4KRTA 3J81c 4L5SA 1XNQQ 1G51A 1SEMA 3SWNA 1YIJT 4A4GA 3FMCA 5KYXB 4KJNA 3T51B 1EYAA 3SE0A 1OOTA 1DXMA 1UHCA 3ERQA 1KIKA 1L0WA 1ZX6A 2EAYA 4OXPA 5IT9c 4LK1C 1UAPA 1FMVA 5CYUA 1IBKQ 2R7ZH 4ME5A 3QOJA 1TT2A 2KQWA 1VQPA 4HTHA 1I81A 2MF2A 2FXQA 1XPRA 1LT6D 1SAPA 1G8ZD 3P20A 4XU1A 1XQHA 5E4XA 1M3BA 2A6EC 2PZWA 3EHRA 1ZXTA 2X6LA 1EZ8A 4HSPA 1PSEA 5I2YA 1VMCA 1A0NB 3TBIB 5IGDA 1OI1A 1B34A 4JZ4A 4TVRA 1C1AA 2QEXQ 1LT5D 5C3EH 4A3GG 1QE6A 2CUDA 2PNHA 1HPCA 4KY5A 4A3FB 1LPLA 2QG9B 1V1OA 2J05A 3DMUA 3FHWA 5BN5A 2LSSA 2PQAA 2B63H 2CH4W 2E3IA 1CT1D 1EY5A 3HFOA 4JI4Q 3IRBA 5LJ3d 1VQ7T 1GUSA 3MP1A 1OYXA 4HVVA 2MAMA 2RJCA 5LJ5h 1I6HH 4OGEA 1GRIA 2QQAA 2J0TD 4HJAA 5DAUA 2KVMA 4OMPA 2QQRA 2K5FA 2KA7A 1EYCA 1B1ZA 4DR2Q 3J7A5 1O9SA 1MUZA 5IXBA 1TWGH 1JB0E 1X3EA 1VQMA 1PRTB 4HA8A 1N8RR 3QSUA 2RHYA 2RCFA 1XNRQ 3HOYG 3HS0C 4GLAC 4J15A 4JG2A 1NTGA 1NSNS 1J3TA 5M5WH 2F0MA 2B29A 2YT6A 1F9QA 3SHWA 3JSCA 3OY9A 1HNWL 3SR1A 2R92H 4NXNQ 3A54A 1I4GA 4BE2A 4M75C 2F1LA 5C0XI 3NPFA 1N32Q 4YY3L 5JPNC 2KT8A 3WWVA 3FPPA 1YNZA 1CQVA 2EJGC 1O80A 2A1AA 5CMDA 3GD7A 2ASBA 2L89A 1K1ZA 4J8QA 4NXML 1EYDA 2QYZA 4DR7L 3M59A 3T9NA 5M3MB 4XU3A 3X24B 4C3HH 2WFWA 5JJKA 2OAUA 2I5MX 2B8FA 4KH1B 1VQ5Q 2I5LX 2NTSA 1L0YB 1KC8R 1X6OA 3U4VA 3PF5A 3GBQA 5J3BA 1UJYA 1TU2B 3TZUA 4IO9A 3NK9A 2JA5G 1S5ED 4B3TL 5I2MA 4FF3A 2UXBL 4KK7A 3VS2A 1IHWA 1YEZA 2DA9A 1L1OB 1JT8A 4RFBA 3CPWS 2LKVA 2VYTA 3HP9A 3C1FA 3TCJA 2BKDN 1ZEQX 4XTCS 5D3IB 1KXLA 3AMUA 3S1MB 1X65A 4PJOA 2MO0A 2F0FA 5FJ8H 1RLQC 4PLIA 4PLLA 3I4MH 2QDLA 5CORA 2NZ1D 3TMEA 4RWSC 2F0QA 3GTQH 3H0GH 2E70A 1XJVA 1QILA 2JUFA 2ZPEB 4DK1A 3BZKA 2RKSA 1WVLA 5CBAE 2GQIA 1R9TH 1VQKA 2WAQG 2ZXPA 5LJ5e 5AJ3Q 1CSQA 4BA2I 4KGXB 3BVZA 4BI3A 3JAME 3A7AB 2E5LL 1NY4A 4LWCA 2R93H 5C4XB 3JCMW 4A4HA 3PF4A 4P71A 1D6EC 4JI6L 1OXSC 3OYMA 1YHQA 2GNCA 2COYA 4RH6A 3V8LA 5CV9A 5GAN6 3R6NA 5D7UA 3CCUT 2VXEA 2DYBA 3T1HQ 2DFUA 2SRCA 1UGVA 2F0PA 3EGXA 3S3NA 2K5QA 3VYUA 3PVQA 1V1PA 1YI2T 4A3BG 3JCMd 4GNXC 5CV5A 4FF1A 4RTUA 2ID0A 3D3RA 4M7DC 2HQLA 5ELCA 3MAQA 2DPPB 4DU9A 5GMKi 4QVDA 4HCEA 4KJOA 5FU6C 1I3QB 4POFA 1K76A 4B3ML 1GHKA 5M3FG 4ZNXA 2A6ED 4LDVA 3LYIA 1NMGA 2JN4A 3HOUH 1B44D 3M85A 1PSFA 1HQMC 1JJ2A 2FMMA 2J6OA 2H1EA 4AYBG 2P4TA 1ZKOA 4A3KG 4JV5L 2BOSA 2LVMA 4CC7A 5L23A 3JCMX 1XNIA 2XI9A 5DM7R 1QZGA 2W10A 4A4EA 1NCVA 3I2ZA 3EG2A 4MZ9A 3MKDA 3FVQA 2PZTA 2HCIA 4DNIA 3OQ5A 5CKEA 2NVQB 3H94A 1WQ7A 1K3RA 4U673 3CPWP 3DUZA 1N36Q 2QEXA 3QZ9B 2RA4A 1WCMB 4ILWA 3NPPA 4C8QG 2E10A 4C92C 1EZZB 2A73B 3K7UC 5DNFA 4JI1Q 1NYFA 3MP6A 5CBEE 1WTRA 2EBPA 3AT1B 4FYWB 4LXCA 2ED0A 4RTXA 3JB9I 2LJ1A 5C4ZA 1QKWA 1QVPA 4FSXA 1PCXA 5CKDA 1ENAA 1VQ8T 1IBLL 4HXJA 4JS5A 1Z9ZA 4CHTB 1YJ9Q 3M54A 3PVLA 1KD1C 3EA6A 2DXUA 2Z6KC 5LMNL 2EZVA 3S2DB 4KY7A 4CI0C 5D65A 2DY8A 4PZ7A 4ABNA 4DK3C 4LF5Q 2H5XA 5KH6A 2HL5C 1QVGS 1S4ZA 4M75D 1KHIA 2Y90A 3HOVG 4DXFA 1YP5A 1FX7A 3PO3H 3K58A 4FT4A 4A3MG 2X3WD 3URYA 1B07A 1Y1WH 2A36A 3M0SA 5C0MA 1D8LA 1PTOD 1GXDC 3ZEHA 2M00A 1NBEB 1Q8KA 2GBQA 4F7XA 4LF8Q 1WZOA 1GM5A 3EGDB 4RUGA 1F77A 1STGA 2F0KA 3L9AX 2XGTA 2XIWA 2DTIA 4C92A 4N8X1 4N4GA 1I8FA 1UGSB 2PNRC 4DV3Q 2KAFA 1LLRD 1ACMB 5LJ3h 3CCLQ 1YJWT 1Q7YC 1Q86C 1K0RA 2BE5C 3VRYA 4NW2A 4JI3Q 5T1GA 3KOJA 5EKKA 1QW1A 2Z6KA 1ZSZB 4RTTA 5C3EB 4R4OA 2LZ6B 1LT3D 2ZM6L 3MZ5A 4HSVA 2AKKA 1HZBA 1N33Q 1YHAA 2B8GA 5C4JB 3I4NH 5LJ5f 1OO9B 2B63B 9ATCB 4L5QA 1VQ5A 5FO8B 4O5VA 2CQAA 1H95A 5M9OA 3UA7A 1WTXA 3NBHB 1SXTA 1UGQB 1VIFA 3H0FA 2ESWA 2RJFA 4AG1C 3C12A 4R55A 4ZK9B 3BS1A 3S16B 3D31A 3TP7A 2JTFA 3IL8A 4Y7NB 1X9NA 4X9DA 2UUBQ 2XN9C 2RF0A 1RD9D 1MHNA 1CHPD 4DV1Q 1Y1VG 1QG7A 2UU9L 1BCMA 2J6FA 1TWGB 2EYQA 1VDZA 2L4NA 1QQJA 4C5IA 4CKBA 4DUYQ 4EDUA 1P16A 4DBHA 2PPBC 3GTKB 3T16A 2V8JA 1W2BA 2XK0A 1LTRD 4JOIA 4A3CH 4JS4A 1O78A 1QWEA 3QPHA 3V8JA 3OSOA 4L5TA 3DM3A 3VA7A 4BY1H 3A8IE 3PIP3 3VJPA 1UE6A 4Y91A 2AK5A 3L2UA 2DXCA 3I5SA 2PW5A 2CSQA 3MPUB 2RK1A 3F8TA 1LACA 1HA6A 2M9VA 3PUVA 1Y7XA 2M02A 4K5WA 1QCBD 2G5DA 2MQHA 1SRMA 5COYA 4FDBA 3MEWA 2DXBA 1QVGP 3AEVA 4M7DD 1KNAA 1K28A 4J9DA 1IGUA 1SNMA 2EXZA 1SEBD 4C3HB 2X51A 2EFIA 3CCMQ 1IL8A 3K7AH 4M78C 4BWGB 2JZ2A 1AT1B 4YCVA 4LF6L 4R1JA 1JOOA 2YHTA 2G6FX 2LXJA 3U58A 2IX1A 3F2DA 4CRIA 2CP0A 1KQSS 4B3SQ 1KK7A 4A63B 3CHBD 1VQFA 3RD4A 2VL6A 2VASA 3MVVA 1VQ4Q 2X4WA 2FVUA 3NTIA 5CO7A 1DGSA 3E6ZX 4QY7A 2CCZA 1F9SA 4GKKL 1ET6A 3I4OA 5LJ3e 2K5HA 3IQLA 4GY5A 4XXEA 1JJCB 2EIFA 1EU4A 1QJOA 4AFUC 1OTCA 4OGCA 3FKIG 4DOVA 1JXMA 1CSPA 3HOXH 3VR2A 4CKCA 1T5EA 3PMIA 3I4MB 1BBWA 1LJOA 1K0SA 5CAIA 3ZFJA 3QXEB 1F9PA 1XTCD 2LY7A 1M90R 4R4CA 2WB1B 4C8QD 2D5DA 4GN3B 4YHHQ 3GNFB 2O01E 2VUMG 2DMOA 3GTGH 3SDZA 5CKHA 3S1QH 3P7JA 2M9UA 1FYCA 1AWOA 1EFNA 2XDPA 3E1SA 4M78A 1UJ0A 1PWTA 5IAYA 1W70A 2ZCFB 1LTSD 2LNVA 1I5FA 2ZPFB 3JCMQ 1M4VA 5EBCA 2JA7B 1HD3A 1BIAA 3NQTA 3JCMh 4QUCA 2EYXA 3FRNA 4ME3A 3T56B 3R8BA 4LNPA 2KUMA 3J80L 2YUQA 4DR1Q 2E3HA 2DVEA 4II1A 1ABQA 4DEXA 1EFWA 1HQRD 3CQTA 3OW2S 2QXFA 1YJ9A 2KENA 2F0SA 1D0ZA 1ZBXA 4RTWA 1TOVA 2B2UC 1KLGD 1PRTF 4PMWA 2WB1E 2RHZA 4OGQC 1WHKA 3Q22A 2LT1A 1X6GA 4XTZA 2NUCA 1D3BB 2KK4A 2CFMA 3GTPH 4K2LA 2BE5D 3GV3A 4E7SA 1TR5A 2Q2HA 2Z4HA 1GUGA 4DAYA 1RIPA 5GMKm 1EYGA 3GTLH 4DV4Q 3UA6A 3UT1A 2H8HA 1X54A 4KT0E 1SLJA 2QA4Q 2HD0A 1PH5A 2XDBA 2L5TA 3BDLA 1RHPA 1PH8A 3E0JA 1I94L 1PYSB 1U5KA 4X9CA 5BR8Q 4G57A 2RJDA 3QWXX 1KQSP 3IAYA 1BKBA 3CXCA 1JQQA 3BDCA 5A0LA 2R7ZG 3CCLA 2EXDA 4JI5Q 1WX6A 2MO1A 2K5VA 3QJYA 3CCRQ 3GP8A 1S5CD 4PMCA 3PFSA 2O88A 4UAIA 3D6WA 3M4OB 4XTXA 2EY5A 2F0IA 2F03A 1N27A 2E2IH 4C5EA 1VQGA 2CH4A 3VV0A 1FR3A 4Y92A 2Q8RE 2XRSD 3NP8A 1XNQL 4N0AC 1ZUUA 3LWEA 2EDGA 5GAHC 1OPLA 3NHHA 2J4XA 3CC2T 2PI2A 2NVTH 2FFKB 4M7AG 3KLRA 2IHEA 2KOLA 1XOVA 1Y14B 2EYMA 1HZCA 4PFOA 3NUCA 3S2HB 3TN2A 2KVQG 4PKCC 5C5MA 2D9TA 3RUZA 1TIID 4DF7A 2CUBA 1IBKL 1STAA 4JI7L 1WLPB 4IN3A 1K8AC 2JM8A 4J8OA 3NQIA 4K6DA 1SPKA 4GLKA 4X65Q 1W4SA 4F7UG 3JCMe 2ENBA 3NEMA 4HN7A 2FPFA 2P0PA 5CQXA 4E6RA 3CMAQ 3I90A 4RA8A 3QWNA 4PJLA 4M77G 4N8FA 2CT3A 4KKUA 1D1IA 4HMJA 3KF6A 2HDAA 5IGBA 2XWBB 3CMEQ 1PD0A 3M0UA 5LJ3f 3OW2P 1QOHA 1H3ZA 3PMTA 2DZ9A 1HZAA 5FRMA 2JJ9A 2DIQA 5CCAA 1PMRA 1U4LA 3QUIA 5AT1B 4JI4L 1PV4A 3H8ZA 1WTPA 1Q82R 3M0TA 1K9MC 2Q2IA 3M55A 4K2KA 1QB5D 4ZUIA 2R92G 5A35A 2A3LA 4JRPA 2FMCA 4EQPA 1SSFA 4CDDC 2IX3A 1X3GA 2HHHQ 3GDEA 4ZGEB 1K8MA 3C3LA 4DR2L 1WXUA 4WFN3 1VQAA 3I4NB 1CTMA 2DGYA 1YHBA 1T9HA 3FP9A 2KEDA 4K5VA 3DEPA 4OEMB 2RK2A 3KLWA 1XNRL 2K2MA 2RO0A 1YIJQ 2NUTA 2K04A 1T3LA 2N88A 3Q8DA 3SWNB 2RI5A 2B2TC 4IALA 3TSWA 5FLMH 2BZ8A 4A3FH 2KE9A 3L2ZA 1VQ4A 3UE0A 3BJUA 1VQLA 5FWBA 4FW2A 1L0XB 3E9HA 2PNIA 4P75A 1VYVA 4ODGA 1D2BA 2MK5A 2LP5A 1X32A 4KKSA 3DM1A 4CGYB 4OB3B 2F69A 1MI2A 1N32L 2L8DA 3L7ZC 4AQYQ 2Z1CA 2HT1A 2IY5B 3S15H 1UE5A 3LGJA 3CCMT 1KIXA 2CKKA 1N8RU 2AWOA 2D6FA 1WGSA 4DR5Q 2PUOB 4IZ8A 4G7HC 4MN3A 2O9VA 1ENFA 4OELB 4LUEA 4HMIA 5FJ8G 4DAVA 1G2SA 3J81j 2Y0SB 1K73U 4QQBX 2LFNA 2GFUA 4BUGA 4QQ6A 3MTSA 5FKAC 4QIWB 3HFZB 2JK8A 4LDYA 2PQAB 3H0GG 2KGTA 2L11A 1P92A 2WP8J 2KYBA 4IUQA 2F0TA 1VQ7Q 1HA5A 2MPXC 4C3JG 2PVDB 5I22A 4FYDA 4KUIA 5IP7G 2B2TA 1ZQ1A 3A5ZB 2CQOA 1U06A 3OSVA 2KCNA 3D8GA 4J9CA 1LCKA 1SYEA 2R93G 3QWYA 2K7AA 3G6JB 2DF6A 2L5QA 4QL5A 2RHUA 4IOAA 2EYOA 1U1SA 1CKMA 1M30A 1Y71A 2RSNA 4KUDK 5M3MH 5D6XA 3GPLA 4YIJA 4C1NI 4IFDH 3I55T 1D1AA 1E7OA 4WJ4A 1DCZA 4YWKA 3JAML 7AT1B 1IREB 2JA6G 2QCPX 4R9WA 3EG1A 3CC7T 2DIGA 5F2DA 2JE6I 1GCPA 1DYQA 4QIWE 5TSSA 3HOXB 1VQOT 1YCSB 1R4PB 4MZTA 3N52A 2FINB 3A8KE 3K5MA 3GTOB 1SJED 2F2XA 2C5CA 2QA4A 4C5GA 2YTYA 3HGBA 1XJWB 1TWHB 2PCFB 3HOUG 2CYZB 1EOVA 2CW0C 4Q0FA 3GTGB 3S1MH 4JPBW 3S1QB 2EQSA 3GOXA 3JCMf 3T1HL 4M7AD 1A0IA 5C3WA 1TXYA 1MKHA 2KCMA 4XQ3A 5KYYA 2K33A 1RAEB 2OF1A 3RR5A 3V96A 3CCRA 4DV7Q 1OXUA 3A8LB 2E2JH 1NNXA 5EG2A 2A28A 2KEAA 5IYBG 3D4DA 4EMHA 3CD6T 4F7UF 1OXTA 3EGUA 3C1EA 1WXTA 2MWOA 2QTVA 1Q1EA 2I46A 1MV3A 4H0LC 3VR6A 3PO2B 2LTOA 4M77F 1FYNA 2YTVA 3U50C 2AQ2B 4BBSG 1E6HA 4M77D 3VYTA 2PQEA 3F2CA 4M75B 1GFDA 4PJOB 1GL5A 1PFSA 1WFQA 1YWOA 1MGSA 1KQ1A 2KT1A 1JWSD 4PNYA 4PMBA 2NN6H 2B8AA 2QI2A 1QKXA 2P84A 1PYBA 2BA1A 2NB0A 4NMZA 3X25B 3GTPB 2OQKA 3HKZB 5DLQE 2QASA 2DVJA 5GAMd 4E7HA 5C6AA 3CMAA 3DKMA 1IXDA 1CQFA 3OYLA 1HTLD 4TVAB 1C0AA 3OSSC 2DBKA 4BBRH 1OU9A 1N36L 1WJSA 1X2KA 4OF1A 2PZ1A 1JEGA 1I3QH 3PO3G 4A3EG 3CMEA 2JEBI 4JI1L 1Y1WG 1FJGL 5L37A 1UGRB 3C95A 1NJIU 4B08A 1KSWA 1ILQA 4OO1G 1M2VB 1V43A 4AMCA 3CCUQ 1CKAA 4KH0B 4MMLA 1PFNA 1ZHIA 1AD5A 4X1VA 4BY6C 2ZTCA 1E2VA 4CC4B 4M75E 2KQ3A 1M1KR 3EGXB 3A74A 4R4QA 4ZCKA 4RTZA 2KRSA 2SNMA 2XD0A 1V1PB 3NFCA 2I0QA 1HRJA 4LE9A 1J6QA 1K83B 4LF5L 2BH2A 1ZA2B 5GANd 2P4RA 1GKHA 1CI3M 4APVA 4LF7Q 2E6NA 3O13A 3HOWH 4KTAA 3HKZE 2NVQH 1PDQA 2F0EA 2DAQA 4NS5A 1YIJA 1WCMH 3L3OC 2EGAA 1O75A 5CV6A 4AIMA 4A3IB 4LF8L 3FLGA 1I6VC 3OHXC 2K5IA 3I4NG 2OCEA 8ATCB 1M8VA 4XU0A 2HIVA 1CSKA 3OBYA 1J5EQ 2FG0A 5KYUA 2R61A 3BFMA 3B6YA 2GF7A 5JVH3 4X6AH 3P8BB 4AFZC 4OHJA 4DV3L 2WINB 2NUPB 2LX9A 3EAEA 3MA2B 3R2IA 4JI3L 4WF2A 2J7ZA 2PYKA 5ISRA 2ZGWA 1TY0A 5LJ5j 3QO3A 2P0KA 2F0NA 2HMAA 4JUVA 1N33L 3UPUA 3I73A 3MC0B 1WHMA 1RUWA 5IP9H 5GQOA 2CDTA 3RIRA 2HKQB 1EWCA 2AMCB 4BY1G 1VQ8Q 4JRKA 3OYAA 2AWNA 1VQ7A 3SGIA 3V7RA 4KGVB 2Y0SG 2UUBL 2X35A 3HRTA 1XMOQ 2QF7A 4A93H 4OVAA 3N6RA 4DV1L 4LDWA 3E9FA 1M3CA 1X2QA 1ZA1B 1QVFA 1H9SA 1M5Q1 4WJWA 1IZ6A 3EH2A 2Y4XA 2B86A 4DUYL 1VQHA 1QCFA 1CHQD 1X43A 1NLOC 2COZA 5GMKh 1LV9A 2NVYB 4BE0A 3RN5A 1OPKA 2CHBD 3THKA 4CDEC 3ULJA 5C4JH 3H41A 1Q90A 4L5RC 4QCLA 4IQZA 2LX7A 3O5ZA 2K03A 1AFPA 2CW0D 2KECA 2RI3A 4MDWA 4MMKA 2EE1A 4B9XA 3E3XA 1VQEA 1RAAB 2RQTA 4HCBA 1BI2A 4M7DE 4D6WA 2HDMA 4JBJA 3S16H 3M5AA 1AVZC 4JDSA 4C92B 2CKZB 3BVMA 4Y7NH 3C2PA 4DBFA 2JA8H 3S15B 1TWAB 4A3DG 1YJWQ 2NVXH 2VQFQ 2L3RA 2BA0A 3MXNA 3G1JA 3ULRB 4CJ0B 1S5FD 3CRKC 1A2UA 1V76A 2VUBA 4B6MA 1S40A 3GTKH 1RKNA 3J80c 1D1KA 1RAIB 4LDUA 1O7ZA 1IHZA 4DNTB 4OMLA 4CC2A 1LTBD 4EGVA 2YWWA 2JS0A 4QT7A 4BACA 3VU3C 2DUDA 2B2WC 2ZJQA 1WJRA 1HXYD 3QOLA 1TWCB 5EPLA 1GCQC 5KEEA 1BIBA 3HOZB 2JMCA 3D4RA 2DJZA 2B2YC 4HCZA 1M2OA 4PFPA 1Y96A 2F4IA 1LT4D 5IY0A 1CUKA 4X62Q 2GTJA 4OWWB 2D0PA 1XPUA 1PTOC 1WFWA 2DKGA 4Z02A 2R58A 4C92E 2EY2A 3CBPA 2EJMA 4V2SA 2ZJRA 4FO2A 2BUDA 5GAGC 5FOBB 5CIUA 4J9FA 1B3AA 4HVUA 2CP3A 2QEJC 2LQNA 4JVZA 4YHHL 1UUEA 1VQ9Q 3E0EA 4ESRA 1D5XC 4GS3A 2O2LD 1MV0B 1UDLA 4PJOG 3TREA 2VY3A 2NLUA 1STHA 4JJNK 3UDIA 1BCPB 3KLSA 4K14A 1IYVA 1ZLMA 2CVRA 1UWVA 5K36H 2V1CC 2DILA 2DO3A 4DK6C 2PQWA 3JCMV 1BK2A 1HH2P 1WD0A 2RSOA 1GCQA 1M90U 1TS3A 4M75A 5GMKe 1Q82C 2B2YA 3U9OA 4DR1L 5GAN2 5CKFA 1K8AR 4HKEA 4RGNA 3CCUA 2EJGA 1BR9A 5KNCA 3MJXA 1E3PA 1QVCA 5KYIA 2KYMA 1UECA 2RPNA 2L9HA 3AFQA 3L0OA 2VKNA 2ZZDA 1Y0MA 5IH2A 1M27C 1KFZA 2N8NA 1YI2A 4DGZA 3H09A 2D9UA 3MXPA 2E2JB 2C0IA 3H6ZA 3LW5E 1GBQA 3ASKA 3HKSA 3OYDA 2N78A 3HG9A 3M4QA 4M1UB 5KNDA 4BY7G 4DV2Q 2JA7H 1JQYD 1PH2A 1Q81C 5LJ5g 1JXOA 1GFCA 5GAMh 3M0RA 2L55A 5KRUA 1M2VA 2AQ1B 1UG1A 3R3OA 2K75A 1K9MR 2XVSA 4EQ5A 2DD5A 3T1YQ 2FHTA 2WSFE 2XWJB 1SYFA 2IPKD 2HNIA 2LXKA 1C6VX 2V26A 1AEYA 5BR8L 4ALPA 8AT1B 3GV6A 1AZGB 4HIDA 1TSFA 2RJEA 2DRKA 4UP7A 2DL4A 1AEXA 4M78B 1F2LA 5CR3A 3TP6A 2CP5A 5I2XA 4IUVA 4BBRB 3VS6A 4Q5WA 1IKMA 1LO5D 3SD4A 1LABA 2K3BA 4C3IH 5KYNA 1HZ9A 5KIXA 4A3JG 2ZT9C 2EPDA 5GANh 2I07B 1B3QA 3RUXA 4YCWA 4X34A 1G91A 2K5LA 2M0YA 4A3LH 2EYZA 2GCXA 2JS2A 3QDRB 1VQ8A 1UE7A 3CKIB 2QQSA 3K0YA 1WQWA 4F17A 2J6KA 5CV4A 4H02A 3I72A 2ZPHB 3Q6SA 1VYTA 4Z88A 1EQRA 2XIDA 3JB9F 5ELEA 2NUPA 2HSPA 1EWIA 2AKWB 1OU8A 1Z47A 2KJXA 3CQZH 3S1NB 1RTOA 4BD3A 3HOWB 1OXVA 2QDBA 3HEJA 2RH2A 3WOEA 1BNZA 2O4XA 2CP7A 2F0HA 2NZHA 4OL7A 1H9KA 3QG1A 4J6WA 5C0XH 3W1GA 1KQ2A 5JAVA 2QW7A 4M78E 4QQDA 4C8QC 4GNXA 3M4OH 4DAYB 3W1BA 1WI5A 3JCMb 4M7DA 1ET9A 3BE3A 2PMZB 1TS9A 1CFMA 3QR8A 2WSEE 4JC0A 4X3SA 1KLUD 2HZYA 1X6BA 2IHFA 5C6SA 3TDQA 3IFTA 1Q95G 1QWFA 3MEAA 5FLMG 3UDGA 4A3FG 5FRNA 1X01A 2EGEA 2AIRB 2LCLA 1YJWA 2GVBA 2J06A 2QAZA 2PTKA 3G4ST 2A7YA 5ELFA 2K3XA 1EU3A 4O6JA 2DERA 1AN8A 3FEOA 1QCOA 4J9BA 2HHHL 3SK4A 1D09B 5ECAA 2YRVA 1PFMA 2EQJA 5FROA 5GAMe 1WHJA 4JZ3A 2G3RA 1XXGA 1UE9A 2MUYA 3I4LA 4FF4A 1SYBA 3R93A 5KGUA 4FU6A 3CC2Q 2K5DA 4LD6A 4XU2A 3OYNA 4HAEA 4FSSA 1YNJD 1X75C 1LOJA 2EWNA 4C8QA 2D0OA 2PMZE 1I1JA 1OEBA 4A93B 3FC3A 1D1BA 3U4ZA 4ORZA 5IYCH 1GO3E 3I35A 2CZ6B 4PJOF 4OB0B 4XK8E 1NR4A 3W5OA 2KHJA 5IE8A 1EIFA 1SJHD 4JK1C 4LUZA 3JAMc 4DR6Q 1V1QA 4P5NA 1RAGB 2WACA 5GAOl 4MDXA 2KXCA 1CZGA 2AHOB 3CBOA 3LWIA 1STEA 5FO9B 4UP9A 2DM1A 3CCET 5GANe 1NAPA 3RESA 1SNCA 4FVMA 3UE1A 2EYJA 1JE4A 3VUZA 3EQLC 1E0BA 4RKBA 2MNAA 4PL6A 5C4HA 3S14H 2P0QA 1VA7A 2JN0A 3OYYA 1MSGA 1JC7A 2VXWA 3KF6B 4I7ZC 5M3MG 4KGZB 4OMQA 2IT1A 4P72A 2C0OA 2YDLA 1TQOA 2DJGC 4DR4Q 4JI2Q 3X26B 1W6JA 3DXJC 2OI3A 2DRMA 4IFDG 2FRYA 3CCQT 3PE0A 3CCSQ 1H92A 4JJCA 5JEAH 2JA8B 3BU2A 1RABB 2A68D 2NVXB 2R7FA 2MIOA 2K2VA 2PI2E 4BB7A 2LQKA 3CCJQ 4ID6A 4HCCA 3WOFA 1I4QA 2A6HD 2F3VA 4E7IA 4ZTJA 2VW9A 5LL6X 1U5SA 1M1KC 1L1OC 2L0CA 2EJ9A 2HQHA 2ECZA 2R3ZA 5BN3A 3DWQA 4KBMB 2M51A 2E1HA 5GAN7 1VQ9T 1ML0D 2EYYA 3OOCA 3PTAA 1OV3A 4J7IA 2G9HD 3OS2A 3CC4T 1A15A 2YRDA 5GAN8 2NUTB 2D2CC 3QBYA 4NDXA 5KCHA 2ALYB 3FEWX 1HUNA 4QKUA 2XNAC 2LT4A 1ASYA 4OP0A 2F0OA 2YU9H 5DEHA 4HEDA 4R8IA 4J1MA 4E7LA 1QNUA 3DWPA 3VS7A 1N34Q 3GNGA 2RI2A 4C0GA 4H13C 2SEBD 3LNNA 3H91A 2YLCA 2L1BA 2FHDA 1BI3A 5C4XG 2DL3A 3CF5A 4K11A 1B2TA 2B2VC 1A63A 3JB9H 3CU7A 1H3HA 4E47A 1FD7D 2Z9HA 3VR5A 1WDXA 2CP6A 4BDYA 2IW3A 5IHKA 2KMTA 1AOJA 3A1PA 1NMFA 4C2MH 2NN6G 4DV7L 4NPSA 2NZOA 3LGFA 4X64L 2FZGB 2H3JA 1KD1U 4QJFA 3T13A 4EMKC 1B8AA 4S3SA 4KHPQ 3LX0A 2RM4A 1IO6A 3ME9A 2PVOB 5LJ3g 3OYHA 1UUPA 3A98A 4ZAIA 4F88A 2XTIA 2H3EB 1A2TA 5IT9L 1CKNA 3GTOH 1VQ6T 4LW1A 3A8HB 2F0GA 1PH7A 1TWHH 4LF4Q 3I56Q 2O5IC 1HNWQ 4PFZA 2V8IA 3M9BA 4MNOA 3SXHA 4XT3B 1JMCA 3I55Q 3OB9A 1N9SA 1SN8A 5GAMf 3WVDB 4RCNA 3NSWA 2XHCA 1YVCA 2RDFA 1O7LA 3PIO3 1OULA 3AFPA 2KHIA 3CC7Q 1FXXA 2EYWA 3KUPA 4CJ2C 3W2DA 5DM73 1L2FA 1XYIA 1VQOQ 2F1MA 2VVKA 1R0BG 1ILPA 3LH5A 5GJVB 4C92F 4Q5VA 5CQYA 3EROA 1QP2A 1Q86U 3PO2H 1Q7YU 4DFAA 2IG0A 1WCMG 2ES2A 2A8VA 2I2LA 2JQOA 1AZQA 2BZYA 1SE2A 5BN4A 2HD3A 1CZWA 1GOZA 1FMKA 1PRTD 2L2PA 4LN2A 1SYGA 3NWSA 2KY9A 5GANf 3M4YA 5KCOA 3A8MB 2TMPA 1HJDA 4C3IB 3S17B 1S72T 4HCKA 1GBRA 5KYYB 1X3QA 3OYFA 1MIUA 3VR3A 3D7SB 3CD6Q 3TQYA 3L42A 6AT1B 1MMGA 2ZJPA 1JCKB 3SB2A 2EYFA 2L15A 4RKLA 2HBPA 3MEFA 2COWA 2YUOA 3CC2A 1IBMQ 2QQBA 2FYKA 4A53A 5IP9G 4A4KA 2E74C 4J9HA 3EN2A 1VQCA 2EQKA 4DA4A 4ZKCB 5I6YA 1FMWA 3L2VA 2BDNA 1NPRA 1SMXA 3CQZB 1SE3A 4NB3A 1J5EL 1SHFA 2E5QA 2K7VA 2SDFA 4HVWA 4GLMA 3P8DA 2EYPA 2B2UA 2FPEA 3NXWA 2ZTEA 1K83H 4V190 3LH0A 2F0JA 3CCVT 3E9GA 1BCPF 1J9OA 2V8KA 3EBEA 5ELNA 5C3EG 5KE3A 3GQBA 3Q23A 1ZSZC 1BOSA 4HJ8A 5HCKA 2MPMA 1N5ZA 2JNGA 1WYDA 4M7AC 5FK9C 4A3IH 1M3AA 1SE4A 2QQ9A 2BH8A 3KLSX 3SK8A 2B63G 1A6XA 4KI0A 5G3LF 1PH4A 2JM9A 2DL7A 3HRZC 1SHGA 1NM7A 2C9OA 1I4HA 4MIUA 5G3LD 3HPWA 5FLXL 2RQXA 3PUYA 4FXDA 1XMOL 4E7KA 1LTLA 4E2FB 3L1AA 2WV6D 1BB9A 2DYIA 4EMGA 4OIKA 2CT4A 3QYHB 1IRXA 2OTJT 3STBC 1PD1A 1YNXA 4M77C 3IKJA 4DV6Q 4JV5Q 4JJDA 3BY7A 3MO8A 3QZ5B 4QW2A 4OX9Q 2K6AA 1X3FA 2C0TA 3G6ET 1NPPA 2MMPA 5HGTA 2OJ2A 4Z9CB 2HUGA 4TQUS 1EY9A 3L2RA 5JOBA 3CCST 2H4OA 4K8IA 4JYAQ 5AYFA 1SYCA 1WA7A 5HURA 4ZN3A 4N0AA 4I7AA 4AFQC 1HR0W 3V8KA 3CCJT 2EYHA 1WIEA 2BE7D 5KYUB 1NBWA 5D14A 5M3FH 2OWOA 4FP5D 1TUGB 4M7AA 2MYSA 2KDSA 3NELA 4F8MA 3CCMA 3W3AA 3JCMc 1EY7A 2VQFL 2GN5A 2ROTA 1U4RA 5IGFA 3KJOA 1QMCA 4K5XA 2RVLA 3FRPB 4BY6B 1RTNA 3UDFA 2HEQA 3S14B 1KAWA 1JJGA 2NVYH 4C0FA 4FYVB 3K57A 4C3HG 4FW1A 5LMNQ 1R8OB 4F7UA 2F3WA 1HCZA 1UFFA 2VZAA 4BXXH 2CZ7B 1WHLA 1Q81R 2X4JA 2KBTA 4FT2A 4WJ3M 2O2OA 1X69A 4NXNL 1VQNT 1YCYA 2YLBA 3I5RA 1R0CB 4K0KQ 4X62L 1QVGA 4GN4B 2EQUA 1I4XA 1IGQA 2VXFA 3X3MA 1STYA 1YJNQ 1TWAH 4Z89A 2Q8TA 1H9SB 3KF8A 2LJ0A 2JA9A 2HIXA 2KHSA 3Q24A 1SE8A 5A0DA 1IKLA 1MMAA 4FYYB 3HFNA 1UTIA 3I56A 2E65A 1XX8A 1JBMA 3I4MG 2OXPA 2M0OA 2LS01 1TWFB 4MTNA 4QQGA 3I55A 4LFAQ 3X3NA 2WB1G 3M0PA 4DR3Q 1BI0A 2YU9B 4MTKA 4N9PA 3NBIA 4Y52H 3CC7A 1LTID 5IOCA 1XMQQ 1TWCH 4XQJA 2E2HH 3RDVA 3HOZH 1WYXA 3HL8A 3G71Q 1UB4A 1VQOA 4XYOA 5K5PA 3NENA 2PUKB 2GGRA 2JA7G 4CDFC 3NWTA 5IN1A 3K81C 4DNRB 3MXNB 1G83A 2KBNA 1FL0A 1PH1A 4RKUE 3I56T 2OT2A 1WTWA 3A55A 1KC8U 5I6WA 1PZKD 1FJGQ 1ICWA 3GP7A 3REBB 1F2MA 4C2MB 2OX7A 3RLFA 1PRLC 1Q8IA 1BCOA 1GUWA 2L0AA 1X3PA 2LRQA 3L2WA 2NTTA 4A3GB 2GTOA 3EH1A 1HK9A 1NE3A 3VYSA 5AJ3L 4JBMA 1TTHB 2XKOC 2EY6A 4QVZA 3CD6A 2AHJB 1Y96B 3KYHC 4DV2L 2MI6A 4HT8A 1G3SA 3V05A 3K5NA 2ZTDA 1Z9FA 1HFGA 1I4K1 1LVKA 2LCCA 3QIAA 4E6IA 4L8JA 4UP8A 3EG0A 3T1YL 4A3LG 4C0DC 4Y28E 3ZL7C 5EKIA 1E24A 2F0DA 2YV5A 2BTTA 2ZPIB 4QF4A 1RAFB 1D5ZC 1DJRD 2DD4A 1IB8A 4GBQA 1BBUA 1JRIA 3WXMB 1AWXA 1S5DD 3HOYB 4A4FA 5J39A 2RHIA 2JP1A 1B9NA 1VUBA
chains in the Genus database with same CATH topology
4NL3A 5C0XG 1LTTD 3M7NA 4B9WA 3CPFA 4BDZA 1JJ2S 1K9MU 4DOWA 5EBDA 3MXUA 1BI1A 3J7YW 4CKEA 3PNWC 1SNDA 4OB2B 5IT9E 3VUBA 2PZUA 5JPMC 2EVBA 1FGBD 3OMGA 1KQSA 2JOYA 1PTOB 2PW7A 3BYYB 2V4DA 1H641 3MXGA 1G6ZA 4N9TA 2HCCA 2E6ZA 4KMUC 3MEVA 1SNPA 1NE8A 5KYLA 3DB4A 3QJ6A 1AP0A 5EPJA 5JJZA 3P8HA 4MHEA 2DEQA 4BA1I 2JA5B 3DLMA 1RJTA 2GQVA 1EIGA 4RHRA 1HTPA 2OTLT 2HQXA 2QDYB 1R4QB 1Y8PB 4K6LA 3A8OB 3RMHA 1KABA 1U9RA 2IX0A 4XT1B 4NOYA 2WSCE 2JYOA 3L2QA 5AFWA 5HKCA 3BDOA 2WAQB 4RMOA 1JR0D 3R6OA 5CV7A 3OW2A 5J22A 4P2CB 4J7FA 1W6KA 4KD4A 3OS0A 3DHQA 5KE2A 5JEAG 3NE5B 2M1HA 3GTJB 4LDXA 1G3TA 4L5GA 1V8QA 4L6V5 5L8RE 2O4XB 3M58A 3S9WA 2XDDA 3SK5A 2SOBA 1VIEA 1KTKA 1DOKA 1IW7C 3HZXA 4ZTFA 4FM4B 3S3OA 1DOLA 4M7DB 4EQOA 3LLRA 4RCOA 1JWMD 5KNBA 3I8ZA 1JOKA 5FU6B 1EQTA 5GAOr 4O42A 5M3FB 1GJXA 4XAXB 5ELDA 5NUCA 3TSSA 1SFOB 3NTHA 1A3VA 1VF7A 3PMFA 2K32A 1YJNT 3A8JE 4AYBB 5IIFA 3K5LA 1W2BS 5DLOA 4A3KB 5FLXE 1JICA 3H3VC 1YITT 5GAOm 4KN7C 3TEEA 1SSOA 5GAN5 2Q8IB 4IFDJ 1EY4A 1ONLA 4M8AA 3QHSA 1KDAA 4KULA 5D3DA 4CJ1B 2M16A 3C94A 3JB9G 1AHJB 1U8RA 1WD1A 3GLXA 4C8QB 3C46A 2VB3X 1J8IA 3G71T 1TS4A 4RGMA 2JSOA 2NWGA 5GAOp 3RERA 5FO7B 1EFID 1WTVA 4FF2A 3UWNA 5I21A 2ZPBB 3GF5A 4G7OC 1UGPB 3HOVB 1VQPT 2E2HB 1PZID 4A3MB 3S6WA 5FU7C 3FPUB 4NP5A 1C48A 4DN4M 4OB1B 2DTOA 4C8QE 3O8VA 2XICA 1PFBA 3HP3A 3VKIA 3V7SA 4GZYC 2MP1A 1KNEA 3M4GA 1UNSA 1EY6A 1YNJC 3X20B 2HQEA 5GAMj 1II3A 1Y8NB 3KK7A 5IODA 4M75G 4J6YA 4PJOC 4ZYSA 1B53A 3T4AC 3OYIA 4IUTA 2NYZD 2WKCA 4MZMA 2A74C 3E5SA 3QIIA 3RKWA 1Q1BA 4ZGJB 2B2WA 1VQMT 3C4SA 2SNSA 1WNLA 4X3UA 3TP5A 1WTQA 4QUFA 2CGHA 3ND9A 1KG1A 1GUNA 2D0QB 3A7LA 5IGCA 1CM9A 4RG8A 4XTVA 4XIGS 3FIFA 1GXIE 3X28B 1Y1VB 1N9RA 4XQNA 3BG3A 3BYTB 1C4QA 5GANj 1KDBA 3Q1JA 2A68C 3ZBDA 4JBWA 5J26A 1A3TA 5I2SA 2D62A 1Z6HA 2A6HC 3BW1A 4NKLA 2E64A 1C8CA 4OO1I 1U1TA 3MHBA 4IUNA 1JWUD 4BI8B 1CA5A 2RB6A 5GAN4 5GAN3 3HRUA 1VMPA 3SEBA 3MFYA 4XDXA 1IW7D 3CXCS 3K6OA 5I9PA 4X3TA 1EOTA 1HXDA 2HAXA 2TSSA 1I50B 2GA4B 3OWEB 2EKOA 3OIPA 1Y07A 1EY8A 4DK0A 1HHVA 1A3UA 4IKFA 1WJQA 3M57A 3RZOB 3MCAB 1H9RA 2K3YA 1BQQT 3URGA 2IL8A 5EPKA 2F0VA 5C5LA 3LGLA 5DM63 4JLGA 3KUFA 4EMKB 1AW7A 3FKIB 1VQKT 3E19A 1SNQA 4M7DG 3JB9D 4IUUA 3HSBA 4OIJA 4DA2A 3EVQA 3G4SA 1QP3A 1EEFD 3BZDB 4LAAA 1V29B 2Z8LA 2VUMB 1YHQT 5LJ3j 2AUKA 3VYHB 2X4YA 3V7CA 5IGGA 1EQVA 4BI4A 1EZ6A 3KBGA 1U4MA 1RDPD 2WIIB 1M1GA 4YTLA 4NL2A 3PT9A 1EL0A 3H6MA 2QTXA 4K8JA 5M5YB 4R56A 1B9MA 5I9OA 4C92G 4G7ZC 3CCEA 1GHJA 1U4PA 3GTMB 3BDUA 3D6CA 2A69C 5HK3A 1TH7A 4V0BA 4FL6A 1MD2D 5GAMg 1PRTC 1SYDA 4QMGA 1TVXA 4ELYC 4XYQA 1Q82U 1H9MA 3CCQA 1TKWB 4M75F 2QKIC 4BS9A 4PJOD 2M2LA 3S1RB 3NTKA 1OZ3A 3AU7A 2QEXT 1PTOF 3AB9A 2IWHA 1CA6A 5ELBA 4C56C 4ZLTF 2LC4A 3AHUA 4OO1H 2ICIA 2VGNA 4FXKC 3VA5A 1VQ9A 2R7ZB 3PGGA 1JB3A 2BDOA 5GANg 1Q81U 3CC4A 1TY2A 1YBYA 1ESRA 2EQMA 2N55A 3KXTA 3ONAB 3CRLC 1MBYA 3OYCA 3JCMJ 5CV8A 2ZXOA 3MEUA 1XWEA 5E1FA 1BCPC 4M7AB 2AUJD 2NBFA 2FJ2A 1I4PA 1F9RA 1KDCA 3F2UA 3F70A 1G3YA 4PV1C 4XTUA 3EFSA 3OW7A 3N5BB 1G2TA 3P75A 1I6HB 1NR2A 4F7UB 1BBXC 1BO0A 2EJFC 1IYUA 5JVG3 1LTAD 4M77B 1DJ7B 3OYEA 1YNNC 1ENCA 5M5WB 4FIBA 1WTOA 3DLLA 4A54A 1VQ6A 1VQ5T 2VV5A 4M7AE 5LHY1 4A3DB 2R92B 3OYBA 3UDCA 4C0ZA 1E2WA 4RG2A 2YYZA 5A2QL 1HUMA 1O7YA 3RKYA 4IUPA 4M7DF 1G3WA 1RL2A 2OEOA 4F7UE 2DY7A 3J81L 2EOTA 1EWHA 4MZPA 1G5VA 4M77E 2EJFA 4M78G 1PLFA 4HT9A 4QB4A 3K59A 3D4WA 1KHCA 3M3YB 2VGMA 2E76C 5CR2A 3JCMP 5C0XJ 2JVVA 2B2VA 1S72A 3EJIA 1B4OA 5HY6A 4C8QF 2R6GA 3RZDB 4TSSA 1Q12A 5LL6S 2DN8A 2Z4IA 4C92D 5M5XB 3GTQB 2K57A 3H0GB 2A69D 4EMKA 4C3JB 1R9TB 1QNKA 5CC4A 3M9QA 4H44C 5E3FA 5CKBA 3UI2A 1FNUA 1LNXA 2IJ0A 1HFNA 2LMCB 2R93B 1PTOH 3INZA 3KBXA 5E4WC 1KAAA 3CPWA 1RODA 3CCVA 2F0LA 1SMYC 5EQ0A 2G9DA 1JOQA 1RCVD 2JA6B 2X69A 1MSHA 4FNFA 3PV0A 2RDGA 1F2YA 1N8RC 1Y69U 1M1KU 4VUBA 2WKDA 1CK1A 4RGTA 2RHXA 1TS2A 4X3KA 1DONA 3OYJA 4ZQ3A 2X4XA 1FWZA 4C5HA 1G291 1K73C 2ZXRA 3HOUB 3WDNA 2OTJA 5GAOq 4C0DB 2HDLA 1DM0B 1BCPD 4RHSA 3I91A 1YJ9T 3G6EA 4L59A 5JEAJ 1RF2D 3OPOA 3CCSA 2IVWA 1I4RA 3VYRA 3GIBA 4WRDA 3BVGA 3CCJA 2A5HA 3PUXA 1QVFS 1I5LA 1SNOA 2R57A 1M4ZA 4BBSB 1KC8C 1BUVT 1PYWD 2MJ8A 3MWYW 1YNND 3QB3A 3M53A 4IFDI 3RMQA 3I3CA 4ZKBB 3JCMg 3SHLA 1BDOA 3SVMA 4OMFB 3ER0A 2MHVA 4KHZA 2LDMA 3G7ZA 2R5AA 3V2TA 3CCLT 3I70A 2JTMA 3RMSA 1VQNA 3OYKA 2XU8A 2F0WA 3PO3B 4A3EB 1Y1WB 3DEOA 1JORA 3FDTA 2DNEA 1VF5C 3NBHA 3CBMA 2B39A 2FB7A 4M78F 3JB9J 2CS7A 4ZN1A 4M78D 4FXGC 4UC4A 3JRZA 5IGEA 1ZYRC 3G7LA 4M77A 3MHXA 2C06A 2EYLA 2DZCA 3EFXD 4KN4C 4N4IA 4O1NA 1BXTA 2GFAA 1H9JA 3PIPA 3TZDA 4XTWA 2F0UA 2DTHA 4LD9K 4U68A 5K36G 2E75C 2O5JC 3J7AF 1DD2A 2PVGB 1GUOA 3A56A 3LWUA 1RI0A 2K28A 2E12A 2EPBA 2NN6I 3R2TA 1QWYA 4ATOA 3OMCA 4KD3A 2BCOA 3IFDA 5EKLA 4PQXA 1OXXK 3FJPA 3TP8A 4XTYA 2XSCA 3ITPA 4HCSA 1GUTA 1NJIC 2ZPGB 1M9SA 2K4YA 1UEAB 4TKOB 5CK9A 3S3MA 4ELZC 5D6YA 2CZ1B 3OBWA 4BY1B 2BIVA 2DXTA 1B34B 4KV6A 1XTDA 2K5WA 2K01A 1SMYD 1EY0A 5CVIA 2MGSA 5LJ5d 1E2ZA 1NUCA 2VB2X 3MFGA 1VQ4T 2L12A 1VQLT 1M1FA 3M56A 1LTGD 3QO2A 1DOMA 1S5BD 5JAVA 4CBVA 3DWAA 4KHVA 4ZGDB 2X6GA 5C3XA 3K7AB 4LJZC 4L63B 3U9SA 3OWFA 4C3IG 2F5TX 3PUZA 4RAUC 4BE1A 4DXGA 1K8AU 4J83A 3Q0AA 3PIOA 2JEAI 4N4HA 2MWPA 3GO5A 1FNVA 1SDFA 4UDUC 2RD1A 1DZ1A 3A8GB 2LQ8A 4J6XA 2K05A 4RCCA 3OA6A 2KSSA 4H7BA 3K5OA 4RCBA 4TRDA 3QKJA 5A2QE 1Z7TA 2JXMB 1VCIA 1PZJD 3OS5A 4L6TB 3QYGB 3J81E 2XRQD 3P1HA 4KY6A 3MP8A 2DNCA 3DB3A 5FU7B 5J1ZA 4EVOA 2PU9B 3FB9A 4M7AF 4J5YA 2OTLA 4RGOS 1K8OA 1D3BA 3ND8A 5T1IA 2E2DC 4ULLA 2XG8D 5EJWA 4ZUJA 1EEID 3SFMA 1MGQA 4LMQD 4ZRZA 4XQQA 2CZ0B 4IURA 1F2ZA 4R8NA 1ESFA 1NZ9A 2QA4T 2RDHA 2E41A 3ZYYX 2R5MA 1AZPA 2Y4YA 4JRQA 1D5MC 3RKXA 4HR7B 5CGKA 1B50A 2VC8A 1ZYRD 1T5XD 3CCRT 3EFRA 3GTLB 5GMKl 1TS5A 4WORA 2KCCA 2F5KA 3J7AV 3HRSA 3VYGA 4EPCA 3VR4A 1WPYA 5DY9A 4E7JA 5HK0A 2K1BA 3M7GA 4C1NK 4EQNA 4DQ2A 4G4KA 2KEEA 3OS1A 4J6HA 3LX7A 2VNUD 1Q3LA 4ME7A 3OIQA 4JRIA 2RBMA 3J80E 1N6AA 4DAPA 3T53B 4KKTA 2ICEC 5GMKj 4PNOA 3OYGA 4BY7B 4PJOE 3TU4K 1PXUA 3PUWA 3SWNC 3SK6A 4F87A 5EGTA 2E2IB 1YJNA 5GAOn 3CMAT 1BYMA 2RA2A 5I4DA 1SBBB 2QILA 2DK3A 1YITA 4QVCA 2NVTB 4JLIA 3FDRA 3CMET 3LWHA 1BF4A 3WVEB 5A0GA 4A3BB 1STBA 2AQ3B 1M8AA 3HHTB 1FNWA 2PO4A 5D6WA 1M90C 3MEHA 1EIHA 4A3JB 1OZ2A 3CEYA 3G71A 3META 1Y8OB 1UEBA 2FL7A 2EY1A 4I65A 1STNA 3SWNA 1YIJT 4A4GA 3FMCA 3T51B 4KJNA 3S2HB 1EYAA 3SE0A 1DXMA 3ERQA 2EAYA 4LK1C 1UAPA 5CYUA 4ME5A 3QOJA 1TT2A 2KQWA 1VQPA 4HTHA 1I81A 2MF2A 1LT6D 1SAPA 1G8ZD 3P20A 4XU1A 1XQHA 5E4XA 2A6EC 2PZWA 2X6LA 1ZXTA 4HSPA 1EZ8A 1PSEA 5I2YA 1VMCA 3TBIB 5IGDA 1OI1A 1B34A 4TVRA 1LT5D 1QE6A 1HPCA 4KY5A 4A3FB 1V1OA 3DMUA 5BN5A 1CT1D 1EY5A 3HFOA 5LJ3d 1VQ7T 1GUSA 3MP1A 1OYXA 2MAMA 2RJCA 5LJ5h 4OGEA 2J0TD 2QQAA 5DAUA 2KVMA 2QQRA 2K5FA 2KA7A 1EYCA 1B1ZA 1O9SA 1JB0E 1VQMA 1PRTB 4HA8A 3QSUA 2RHYA 3HS0C 1NSNS 2F0MA 1F9QA 3JSCA 3OY9A 3SR1A 3A54A 1I4GA 4BE2A 4M75C 5C0XI 5JPNC 3FPPA 1CQVA 2EJGC 1O80A 5CMDA 3GD7A 2L89A 4J8QA 1EYDA 3M59A 3T9NA 5M3MB 4XU3A 3X24B 2OAUA 2B8FA 2NTSA 1L0YB 1X6OA 5J3BA 1TU2B 3TZUA 4FF3A 3NK9A 1S5ED 5I2MA 4KK7A 4RFBA 3CPWS 2LKVA 2VYTA 3HP9A 3C1FA 3TCJA 2BKDN 1ZEQX 4XTCS 5D3IB 3AMUA 3S1MB 4PJOA 2F0FA 4PLIA 4PLLA 5CORA 2NZ1D 3TMEA 4RWSC 2F0QA 2E70A 1QILA 2JUFA 2ZPEB 4DK1A 2RKSA 1WVLA 5CBAE 1VQKA 2ZXPA 5LJ5e 4BA2I 3BVZA 4BI3A 3JAME 3A7AB 5C4XB 3JCMW 4A4HA 1D6EC 1OXSC 3OYMA 1YHQA 4RH6A 3V8LA 5CV9A 5GAN6 3CCUT 2VXEA 2F0PA 2K5QA 3S3NA 3VYUA 1V1PA 1YI2T 3JCMd 4FF1A 5CV5A 2ID0A 3D3RA 4M7DC 5ELCA 3MAQA 2DPPB 4DU9A 5GMKi 4QVDA 4HCEA 4KJOA 5FU6C 1I3QB 1GHKA 2A6ED 4LDVA 3LYIA 1B44D 3M85A 1PSFA 1HQMC 1JJ2A 2FMMA 2H1EA 2P4TA 1ZKOA 2BOSA 2LVMA 3JCMX 1XNIA 2XI9A 5DM7R 1NCVA 4A4EA 3FVQA 2PZTA 2HCIA 3OQ5A 5CKEA 2NVQB 3H94A 1WQ7A 4U673 3DUZA 2QEXA 3QZ9B 2RA4A 1WCMB 4ILWA 3NPPA 4C8QG 2E10A 4C92C 2A73B 5DNFA 5CBEE 1WTRA 3MP6A 3JB9I 5C4ZA 1QVPA 4FSXA 5CKDA 1ENAA 1VQ8T 4JS5A 4CHTB 1KD1C 3M54A 2EZVA 3S2DB 3EA6A 2DXUA 4KY7A 4CI0C 5D65A 2DY8A 4ABNA 5KH6A 1QVGS 1S4ZA 4M75D 1KHIA 2Y90A 4DXFA 1FX7A 3K58A 4FT4A 3URYA 5C0MA 1PTOD 2M00A 1GXDC 3ZEHA 4F7XA 1F77A 1STGA 2F0KA 3L9AX 2XIWA 2DTIA 4C92A 4N4GA 1I8FA 1UGSB 2PNRC 2KAFA 1LLRD 5LJ3h 1YJWT 1Q7YC 1Q86C 2BE5C 4NW2A 5T1GA 5EKKA 1QW1A 5C3EB 1LT3D 3MZ5A 4HSVA 2B8GA 5C4JB 5LJ5f 1OO9B 2B63B 1VQ5A 5FO8B 4O5VA 2CQAA 5M9OA 1WTXA 1SXTA 1UGQB 1VIFA 2RJFA 4ZK9B 3C12A 4R55A 3BS1A 3S16B 3D31A 3TP7A 2JTFA 3IL8A 4Y7NB 4X9DA 2XN9C 1RD9D 1MHNA 1CHPD 1QG7A 1TWGB 2EYQA 1VDZA 2L4NA 4C5IA 4CKBA 4EDUA 2PPBC 3GTKB 3T16A 2V8JA 1W2BA 2XK0A 1LTRD 4JS4A 1O78A 3QPHA 3V8JA 3OSOA 3VA7A 3A8IE 3PIP3 3VJPA 4Y91A 3L2UA 2DXCA 2PW5A 2RK1A 1LACA 1HA6A 2M9VA 3PUVA 1Y7XA 4K5WA 1QCBD 5COYA 3MEWA 2DXBA 4M7DD 1KNAA 1SNMA 2EXZA 1SEBD 4C3HB 2EFIA 1IL8A 4M78C 4BWGB 2JZ2A 1JOOA 2YHTA 2IX1A 4CRIA 1KQSS 3CHBD 3RD4A 3MVVA 2X4WA 2FVUA 3NTIA 5CO7A 3E6ZX 1F9SA 1ET6A 5LJ3e 4GY5A 4XXEA 2EIFA 1EU4A 1QJOA 4OGCA 4DOVA 3VR2A 4CKCA 1T5EA 3PMIA 3I4MB 1LJOA 5CAIA 3ZFJA 3QXEB 1F9PA 1XTCD 2LY7A 2WB1B 4C8QD 2D5DA 3GNFB 2O01E 3SDZA 5CKHA 3P7JA 2M9UA 1FYCA 2XDPA 3E1SA 4M78A 5IAYA 2ZCFB 1LTSD 2LNVA 2ZPFB 3JCMQ 1M4VA 5EBCA 2JA7B 1BIAA 3NQTA 3JCMh 4QUCA 3FRNA 3T56B 3R8BA 2KUMA 3J80L 2DVEA 4II1A 1HQRD 3OW2S 2QXFA 1YJ9A 2F0SA 1ZBXA 2B2UC 1KLGD 1PRTF 4PMWA 2RHZA 4OGQC 3Q22A 2LT1A 4XTZA 2NUCA 1D3BB