5J39A

Crystal structure of the extended tudor domain from tdrd2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
196
Chain Sequence
GRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSKKLDIGLELVHKGYAIELPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor and KH domain-containing protein
publication title Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 196
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j39A02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j39A01
5CIUA 3S3NA 4E7KA 4BDZA 5HURA 4WORA 1A3TA 4BE0A 1N27A 3ASKA 3NK9A 3NP8A 5CV4A 5EGTA 1SNDA 2F0DA 3EVQA 1H3ZA 5KIXA 4LAAA 1EYCA 5KCHA 2EY1A 3MZ5A 5CV7A 2F0LA 2ENBA 3MEUA 2R58A 4HMJA 1EY0A 1U9RA 2EYHA 4ZUIA 4K8JA 2WACA 3TP6A 3TP5A 3U9OA 5IGFA 3FDRA 4ID6A 4IURA 5ISRA 2RHUA 5IOCA 2E5QA 3LX0A 4G57A 4R8NA 5C6SA 4B9WA 3KUFA 3OYEA 3QB3A 2X35A 1ENAA 3OA6A 2RJDA 4QMGA 3MO8A 5JAVA 2LCCA 3P8DA 3DB3A 3PNWC 4ZQ3A 4DFAA 2RO0A 4X34A 1F2YA 5FROA 1EYDA 3L42A 1XNIA 2RJCA 3L2RA 2RHIA 3P75A 5IGGA 2PZUA 3R3OA 3PFSA 4IUTA 1WGSA 3NTIA 4QQGA 4K14A 3GOXA 2EQMA 2F0TA 4KY5A 4IUVA 2X4WA 5KCOA 1SNOA 4EVOA 4K5XA 4NMZA 5FRNA 2F0HA 5FRMA 2F0SA 3QBYA 5NUCA 4K5VA 4ZTFA 2GFUA 4RKLA 1SNCA 2PQWA 3SR1A 2EYMA 2RHZA 1G5VA 3NTKA 5M9OA 3MEVA 3DLMA 4F7XA 3MEAA 1TT2A 3EROA 5E3FA 3META 4PMBA 5C5LA 3HEJA 3H6MA 4II1A 5IGCA 3LGFA 2F3WA 3RUZA 2XK0A 2BUDA 3E5SA 3P1HA 2EFIA 4N9PA 2F0PA 2X4XA 2SNMA 4PLIA 2XDPA 5DEHA 2MWPA 4A4HA 4GY5A 3S6WA 4IUQA 2M00A 3MEHA 4IUPA 4PNYA 2F0MA 1KDAA 3OYJA 3UWNA 1RI0A 4L59A 3PMTA 4FU6A 3TMEA 4HMIA 2JTFA 2KQ3A 3OYNA 5IGDA 3MP6A 4K2KA 3V2TA 3D4WA 3FC3A 2PQEA 1JOQA 3C4SA 5EKKA 2F0UA 4HCZA 1EY8A 3OYDA 1OI1A 5DAUA 3LX7A 3SXHA 4I65A 4KJOA 5J26A 4OVAA 1SYFA 2BIVA 4WRDA 4IZ8A 5C4ZA 1JOOA 3CEYA 2QQRA 4IUUA 2EQUA 4N4IA 3MP1A 1EY7A 3MVVA 1STBA 1SYGA 3HZXA 4A4EA 1TR5A 1WJQA 4H7BA 2DIQA 2RHYA 3OS1A 2EYLA 1NUCA 4N9TA 4Q5WA 1IHZA 2E6NA 5E1FA 2DIGA 3BDLA 1EQVA 2F0NA 3OWFA 2PZWA 5KH6A 4E7IA 4KV6A 2L8DA 3Q1JA 4KTAA 3BDCA 3DHQA 1EZ8A 4YIJA 1SYDA 2RKSA 4KHVA 3EJIA 3LH0A 1ENCA 1SYCA 1F2MA 4C5GA 3H6ZA 4E6IA 2EYPA 1STNA 4A4FA 3OS0A 5IN1A 4OL7A 5KEEA 4DGZA 4BD3A 5HGTA 2YRVA 3D4DA 1KDBA 1STAA 2SNSA 4K6DA 4BDYA 1A2TA 4NP5A 2R5MA 5IAYA 2QQSA 4EQNA 2EYFA 4ODGA 2O4XB 5KE2A 3L2WA 3E9FA 3C1FA 5EKLA 3H8ZA 3OYHA 3OYMA 3NXWA 3SK5A 4NKLA 4CRIA 5C4HA 2PW7A 3OMCA 2L3RA 1II3A 1KABA 2EKOA 4RG2A 1A3UA 2PW5A 4K2LA 3F70A 5I6WA 1AEXA 1EY9A 3QOLA 2EQJA 2L89A 3M9QA 4K8IA 4BE2A 3S3MA 4N4HA 2EXZA 1F2ZA 1WJRA 3OS2A 4FL6A 5C3XA 3LLRA 1EY4A 4KJNA 5I9OA 2EQKA 4C5HA 2F0WA 2O4XA 1KHCA 4LD6A 2RJFA 3MEWA 3O8VA 4BACA 2F0VA 3MXPA 4RKBA 1STHA 4HTHA 2F0EA 1SNMA 3ZEHA 2M16A 2EY5A 2GFAA 3OYCA 2GF7A 4S3SA 3QIIA 2B8AA 4EDUA 1SSFA 4E7LA 3MHBA 4C5IA 3NUCA 2BKDN 2PYKA 2F0OA 2RJEA 3T16A 3SK6A 3SHLA 3QKJA 3MP8A 2MWOA 3OB9A 5C5MA 4N4GA 1STYA 2F0IA 3QOJA 2IG0A 5J39A 5KYIA 4E7JA 3OQ5A 2LRQA 1JORA 3QJ6A 5F2DA 4QW2A 2OF1A 2R57A 2FHDA 5CC4A 4KY6A 4IUNA 1A2UA 4EQPA 3ME9A 2RI2A 2RDFA 4F8MA 1STGA 3DB4A 2CKKA 5D6XA 3D8GA 3FEOA 2LVMA 4EQOA 1OZ3A 3PMIA 2M0OA 2LTOA 2EY6A 3PMFA 1SNPA 2F0GA 2R5AA 2OEOA 5K5PA 2G3RA 2P0KA 2KHSA 5J22A 5KE3A 5D6YA 2DAQA 3TP8A 2K3XA 2NUCA 5IGEA 4QF4A 3OYAA 4UC4A 2F0KA 4DU9A 4J6HA 4ZUJA 2F0FA 1KAAA 3SK4A 2PZTA 4QQDA 3LYIA 4QQ6A 1EZ6A 2SOBA 4TRDA 5CV6A 5CV8A 3S3OA 3OYIA 5KGUA 2RI5A 4KY7A 1OZ2A 5I6YA 3LGLA 2HQXA 1MHNA 3NQTA 3C1EA 2M1HA 3ITPA 3D6CA 3EAEA 3E9GA 3UT1A 5CV9A 2F0QA 2RBMA 5KRUA 3NTHA 4C5EA 3L2VA 4KD3A 5CR3A 4PL6A 2NLUA 3OMGA 1SYBA 3OYBA 3SK8A 5D6WA 5JOBA 1SNQA 3FLGA 1NSNS 2LKVA 4BE1A 3NHHA 3OYLA 3SD4A 3T13A 2QDBA 2RHXA 4IALA 2JZ2A 4Z02A 3TP7A 1WJSA 3VA5A 4KD4A 3DMUA 4PLLA 2HQEA 5IIFA 4IKFA 5I9PA 5KYLA 4J1MA 4ME5A 2EYJA 4B9XA 3L2QA 2EYOA 4ZTJA 1OYXA 2LDMA 3OSOA 3ERQA 5C0MA 4QB4A 3L2UA 5IGBA 2X4YA 2D9TA 4A4GA 3OYFA 1SYEA 2F5KA 3P8HA 4NS5A 5CV5A 4DF7A 1TQOA 4PMCA 5J1ZA 2K3YA 1EY6A 1A3VA 3OYGA 2VYTA 5C3WA 2F3VA 3S9WA 4QVZA 4E7HA 1RKNA 1KDCA 5IODA 2F0JA 2RI3A 4K5WA 1EY5A 3OY9A 1JOKA 4MIUA 4NDXA 2EY2A 1EYAA 2OXPA 5C6AA 5CGKA 3OYKA
chains in the Genus database with same CATH superfamily
2EPDA 5CIUA 1X69A 3REBB 4J5YA 4E7KA 3V8LA 2OTLQ 2KCTA 2Z4IA 1SKUB 5IT9L 3V7CA 1YJWA 4M75F 1FMKA 3GF5A 1HNWQ 1VQAA 1SMYD 2HNIA 1VQ9Q 1EWHA 2TSSA 4DN4M 3ASKA 4GNXC 4WJ4A 4HJ7A 2FFKB 1MD2D 5I2SA 4XQ3A 1HZCA 1S72A 1QCBD 5LMUQ 1VQKQ 4LFCL 2OWOA 2NZOA 3WVDB 2EYYA 5CR2A 3HOUB 1RL2A 4FF1A 3JB9G 2LJ3A 4LAAA 1RAHB 2KEAA 1GUGA 2F0LA 3S17B 3ULLA 1WHKA 1BIAA 2ENBA 3HG9A 2R58A 1OXVA 2ZPHB 2FPEA 2A74C 5C3EG 4HMJA 1ICWA 5EKIA 1U8RA 2EE1A 1UAPA 4DV2L 5CKEA 3MC0B 4BB7A 3CC2Q 4UP7A 3DWPA 2FZCB 5CQYA 2KUMA 5BN4A 1WHJA 3A5ZB 5IYCH 4XTWA 2RCFA 1VQLQ 3L0OA 3K7UC 4ATOA 1TS9A 1FJGL 1TSFA 2XSCA 2IHFA 1DOLA 4JI3L 2ZXRA 3CCMT 2WSFE 3J80E 1AP0A 1MV3A 2J6FA 2VGMA 4BS9A 1S40A 2QKIC 3H3VC 2NVQH 5FO7B 3EHQA 4G57A 2ATCB 3RNUA 5FO8B 3KUFA 3OYEA 2LXJA 3QG1A 4HIKA 3RKXA 1HNZL 1JE5A 1SE4A 1M27C 1I81A 1TS3A 2PPBC 1WXBA 1Q86R 3UPUA 2LZ6B 3EG3A 1YNJC 4OGCA 3KLWA 2ZT9C 2DM1A 3RLFA 5KYXB 4C0DC 2LXKA 2RO0A 1IL8A 2RQUA 1EYDA 1SJED 4PG3A 1OEBA 3JCMf 5GJWB 1G3WA 2RJCA 1M90C 4VUBA 1KG1A 1TH7A 3CMET 2RHIA 5LJ3e 1CSPA 5IGGA 2VY3A 3SDZA 5C4XB 2JXMB 2K1BA 1YJ9A 1H9KA 1TWHB 4RTZA 4FT4A 1N9WA 4M77B 3HOYB 1HD3A 2ZCFB 1HQRD 2P0QA 4YY3L 3T1HL 3K5NA 4V0BA 5HY6A 3STBC 3HFOA 4OO1I 3PVLA 1QG7A 4BY6B 2XRQD 1ZX6A 2C9OA 2L55A 3BE3A 1VQCA 2DY8A 3DEOA 3ND8A 2X4WA 7AT1B 1IBMQ 5KCOA 2JYOA 4IQZA 1IO6A 2K5DA 1LTSD 1PKSA 2LX9A 3QWNA 1NJIU 4BA2I 4YWMA 3H3VH 4K5XA 2K52A 4C1NK 2Y4XA 5FRNA 2F0HA 3JCMQ 1JB3A 2K6AA 2F0SA 3EFSA 1PCXA 2KSSA 4YWKA 2LC4A 4X62L 2IY5B 1DYQA 1HUMA 2QA4A 2VXEA 1LTTD 4BBRG 1EQQA 2PQWA 2EYMA 3PCOB 1G5VA 3NTKA 3QO3A 3T53B 4BBSB 4H13C 4HSVA 4A3IH 4RHRA 1EU4A 5E3FA 4A63B 1EQTA 3RNJA 2HAXA 3HEJA 4M1UB 3CCUA 5M5WH 3OIQA 1WIEA 5DNFA 2RA4A 3BYTB 3FKIH 4LFBL 1Q3LA 3VYHB 1D3BA 3CD6Q 1KSWA 2RA2A 1WJJA 1WD0A 3TN2A 4NL3A 1JXOA 2ZGWA 4KUIA 2DKGA 1YN8A 4G7OC 1Q7YR 2RD1A 1SF9A 1AZQA 4DR7Q 2XDPA 3JAME 1WHHA 1Z9QA 4TKOB 1AWXA 4GLXA 4DR6L 1K83B 1Y14B 3QSUA 3CC7Q 1K8AU 1JR0D 2KI7A 3M0UA 4IUQA 3S6WA 3MEHA 4IUPA 2F0MA 2JA7G 4M77D 3J7ZC 5EPJA 2Y0SE 1YITT 2HBWA 1RF2D 1KDAA 2IL8A 5M3FH 3OYJA 4ZGDB 1C8CA 1M1KR 4LWCA 5JEAG 3MCAB 2O5IC 2Q8IB 3CQZH 3W5OA 3HGBA 2JTFA 4AQYQ 4C8QF 2K01A 4AFUC 2QGQA 3X28B 3PGGA 4K11A 3VKIA 3I4OA 3R93A 3V8JA 3M54A 4HCSA 4X66L 5IGDA 2M51A 2YT6A 3A8MB 1YHQT 2PNIA 1JOQA 2PUOB 3EIVA 1E7ZA 1KRTA 2F0UA 2VASA 2IX0A 3ZJYC 3HRSA 3Q0AA 4I7AA 2XU8A 1WD1A 3X26B 1NMFA 2G6FX 3LX7A 3SXHA 2KECA 1E6HA 2WKDA 1SYFA 2XIWA 4XYOA 3TBIB 1PH2A 3M0PA 1UTIA 4IZ8A 3CPWS 2NVXH 4A93H 1JOOA 2DILA 5BR8Q 2VB2X 1VQFA 3HOXB 4BXXH 2A6EC 3EG9A 1UUEA 3CEYA 1YCSB 1NLPC 3BDOA 4J15A 2Z1CA 3PO2H 3MVVA 1STBA 1ABOA 3HFZB 4A4EA 5LMNL 4LE9A 3A56A 4JI8Q 1TR5A 1ZSZA 3PSIA 2XI9A 4C92A 2B2YC 2E2JH 1WYXA 1NUCA 1NPPA 5JPMC 3W1GA 1J5EQ 1HR0W 2MF2A 1AOJA 3HOUG 2JT4A 2E6NA 3D3RA 1KD1R 2OTLA 4JI7L 2D6FA 1TY0A 9ATCB 4HR7B 1E24A 2XWJB 5EPKA 2L8DA 1QVFS 3TZUA 3GTPH 3BJUA 4Y7NB 4QCLA 1PKTA 4Y52H 1VQ9A 1E3PA 1EZ8A 4OB0B 3MA2B 5K36G 1LOJA 1OO9B 2BE5C 1GUOA 3J80L 3HTRA 3AEVA 2AIRB 5ECAA 3FRNA 1VQPT 4PJOA 2OTJQ 4DEYA 3G71Q 4C5GA 1F2MA 1SE3A 4OWXB 1N9RA 4E6IA 2EYPA 5CKFA 2IT1A 4YHHQ 3OS0A 2D1XA 1EIGA 4C92C 3TSWA 2DD5A 4DGZA 3S16B 2CS7A 5KYUB 1N32L 2NVTB 3I72A 2E5LQ 3KLRA 4A3GB 1Y1WB 2SNSA 4D8DA 2HHHL 4OMLA 5C44B 4PMWA 4JRIA 4JI0Q 1H3HA 1D3BB 1SRLA 2R5MA 2DTOA 5IAYA 2ED1A 2EYFA 1Q82C 3JCMe 5M3MH 1MMAA 2VKNA 5C4JH 3L2WA 1V76A 2YU9H 1VQLA 1N8RR 1YNZA 4FYVB 4DK0A 1CQFA 1TS5A 3AB9A 3VR2A 3U50C 2YXYA 2M9VA 4A3CH 2GQIA 3G1JA 3OYHA 3SEMA 2PI2A 2WSCE 3DEPA 2E64A 4F16A 3CCQT 1JJGA 3L2ZA 3I4MH 3NXWA 2E5KA 4DAYB 1PHJA 4KGZB 1SDFA 1CKOA 1U06A 1II3A 4Q5VA 3J81i 1CK1A 2PW5A 1HPCA 3F70A 3K0XA 1KXLA 2RQRA 1EY9A 1CI3M 3QOLA 4GN5A 4EMKC 1GBRA 2AQ3B 3A8LB 2QDLA 1LNXA 3M9QA 3F2UA 3L3OC 3GTOB 2DXUA 2NB0A 1OX9A 1ET9A 4R4TA 1S1NA 5C4XG 2FL7A 4XTYA 1F2ZA 3CPWA 1BBXC 5D3DA 3TSZA 5C3XA 1X75C 3VJPA 1EY4A 3PF5A 1RAIB 4P75A 1XTDA 5DM7R 1X3FA 1LT5D 2B2WA 4C5HA 4CGYB 1GVPA 2JSOA 3VR5A 1UE5A 4X64L 2QQAA 4BY1B 1BCPB 2O4XA 3OW2P 1NE3A 3MXNB 4DQ2A 2UXDL 2DRMA 2JQOA 5KNCA 2EZVA 1PH9A 1TVXA 4JV5L 1SNMA 2XVSA 3EG9B 3PUXA 1GKHA 2M9UA 1Q1BA 5HK3A 4DBHA 4RGOS 1IXDA 5BN3A 1KC8C 1J5EL 1QVFA 3GIBA 1UGVA 2E3HA 4EDUA 2QCPX 1M1KU 1EWCA 1QB5D 1ZSZB 3JAML 1XMOL 1ZKOA 3S2HB 3I8ZA 3EHRA 2B2WC 4BI3A 4LDVA 4ANJA 3MHBA 3CCMQ 1SFOH 1DZ1A 2PYKA 3JCMc 2A37A 1R9TH 4L63B 4CDEC 4HCBA 1I0CA 1E2VA 4C8QA 3SK6A 2OCEA 2N3SA 4JPBW 4DUZQ 3MP8A 1UDLA 3HSBA 2FINB 1STYA 3K5LA 1MNDA 2IG0A 5J39A 5KYIA 1QUQB 2L3QA 4O5VA 3OQ5A 4A3KH 4PJOB 3HOVH 1LTBD 1JORA 2DXCA 1VQ5Q 5IWAL 1SBBB 2KAFA 1Y07A 1VYUA 1O75A 2SEMA 2SRCA 3VS3A 1M5Q1 2JA6B 4M78E 4R0KA 4M75D 4M7AG 3M56A 1DJRD 4EQPA 3V8KA 2C0IA 3M7NA 1LTGD 2CZ1B 1Y57A 2RDFA 3V7RA 4J7FA 1STGA 4AFZC 1QVGP 2K2MA 3M5AA 4GLVB 5DLOA 5GAN6 1WTHA 2IPOB 1U4LA 1IW7D 2AHOB 5LJ5d 4EMHA 4XQQA 5H1SE 4ZYSA 4DK1A 3CC7A 3PMIA 5GAOn 2F03A 3RZDB 3GTQB 1XWEA 1SNPA 3G4SQ 2DL4A 3QPHA 4GLMA 5K5PA 3NBHB 4M7DE 5AJ3Q 4JI6Q 1JT8A 5IE8A 1CSQA 1RTOA 4DR1L 1G6ZA 1MJCA 4F7UG 1JU5C 2DAQA 1DOKA 4X3KA 2QTVA 2D8JA 1BBZA 1N5ZA 2NUCA 4HCCA 4RGTA 1VQ8T 4QF4A 3OYAA 1YJNT 4NPSA 1ILPA 4DAPA 1LJOA 3FKIG 4J6HA 5ELEA 1FXXA 2OT2A 4E7ZA 3HS0C 5CVIA 2VUBA 1KAAA 4LFAL 2OI3A 2QXFA 4N8X1 4IO9A 2Y90A 4M78A 4C3HB 5GANd 4A54A 2BE9B 4QQ6A 2YWWA 2DYBA 3VS2A 4J9GA 1NEGA 1HTLD 2FXQA 1VQ7T 3P20A 4A3FB 2YSQA 1WXUA 2NTTA 1YWOA 3P8BB 3LGJA 4N0AC 3NENA 3EGDA 1VIFA 2KT1A 1VMCA 4JI3Q 4GKKL 1GOZA 5GAHC 1Q86C 1FD7D 3A98A 5KGUA 4HIMA 5L37A 1VQKT 2KHJA 4JC0A 5I6YA 2ZXPA 4PJOD 4PZ6A 3ITPA 2QILA 3PTAA 2RCNA 2NVYH 4ALPA 1QMCA 2X3WD 5CV9A 3UF4A 4XT1B 4NXNL 4M78C 4C5EA 2F4VQ 4A3LH 2DL8A 4HCKA 1FL0A 1VS0A 3RZOH 2K6DA 1BF4A 4NL2A 2DD4A 4PL6A 3OS5A 5KYYA 2ZTCA 2WAQG 3NWSA 3SFMA 2L9HA 4XTZA 1YITQ 3CC2T 2NLUA 3FPPA 1I5OB 4NXML 2ZZDA 2B86A 2O01E 1VQOT 3OYBA 1SYBA 4XU1A 2EJGC 3CCET 1IYJB 4AG1C 5JOBA 2LKVA 3HOWG 1A15A 3OYLA 3T13A 3FDTA 2QDBA 1ZXTA 2HMAA 4ZN3A 1KIKA 1U5KA 4A93G 3H0FA 1YHQQ 3G71A 1EYGA 2GTOA 4FW1A 1W2BS 3PO3H 5IXBA 3TP7A 4C8QB 4CI0C 1HQMC 4DKAC 4XT3B 1VQHA 3UDFA 4PLLA 1MI2A 5G3LF 2HQEA 1PTOC 2AKWB 1Q8IA 3IKJA 3S1NH 3PO2G 3W3AA 1K9MR 4IKFA 2A1AA 5KYLA 2AQ2B 4IFDI 4XU3A 1GHJA 2E2IB 4IIMA 1OXTA 4HIOA 4ZTJA 2MJ8A 1GXIE 3OWEB 3MXGA 5FWBA 3MFYA 4X3UA 5EAYA 2DFUA 2FG0A 3M9BA 5D3IB 3CU7A 3ERSX 4J9EA 2FPFA 3L2UA 1E1OA 3MHXA 2J7IA 4JI2Q 1N34L 4GKJQ 4UHVA 3TREA 3OYFA 4CC2A 1SYEA 4K0KL 2DXTA 1YCYA 2F5KA 3P8HA 4NS5A 4LF4Q 2PQAA 4PMCA 3V96A 4A3BH 4M8AA 4M75G 1EY6A 2UXBL 1Q7YC 3OYGA 5CKHA 2I0NA 2EQIA 5C3WA 2EBPA 1CUKA 2F3VA 1BUVT 2KA7A 2K33A 1UJ0A 5EPLA 3PUZA 1B8AA 4K6LA 4E7HA 2N88A 3X3MA 1R0BG 2RI3A 2F0JA 2XMFA 3J81c 5FO9B 1OU8A 4JI1Q 4C3IB 5GAN7 1V8QA 5GADC 3D31A 5I2MA 1O9SA 2N55A 2UXCQ 4MIUA 5C3EB 3VS0A 1M1KC 4EX5A 4MDWA 1VQPQ 1WI7A 4DR6Q 5C6AA 4CJ1B 4LF5Q 1UHFA 2D0OA 1K0SA 1TWAH 2CDTA 5M3MG 3S3NA 1TIID 2K4KA 2DY7A 1QZGA 1RLPC 4BDZA 1J6QA 4KN4C 3R2IA 2KT8A 1IBLL 5IHNA 4A3JB 1WQ7A 4C8QD 4A3CG 1P16A 4XTVA 1TXYA 3KF8A 5CV4A 3DWAA 3EGDB 4D8KA 3EFRA 1C1AA 4Y91A 4QKUA 4R55A 2WP8J 4DV4Q 3SVMA 3S15B 3EVQA 4X66Q 1SMYC 3I4MG 2VXFA 2LQKA 1DD2A 1GUNA 2DO3A 4P5NA 3MTSA 1TTHB 1F1BB 2LNHB 1EYCA 2KVMA 4UAIA 3U4VA 3OBYA 3A8HB 1Y71A 5CV7A 2HSEB 5C0XJ 5IXFA 2DJGC 4FIBA 2YUNA 3CD6T 5FU6C 2JP1A 4LMQD 5IYBH 1M8MA 1DXMA 1IBKL 1GUWA 3CXCA 5HCKA 2EYHA 4ZUIA 3CCMA 1UHCA 3E1SA 4TVRA 4LUDA 4GBQA 5KYYB 1RAFB 1W2BA 2KRMA 2N49A 4ESRA 1H641 1X43A 1JWUD 1R4PB 4CJ0B 5EBDA 1EOTA 5LMNQ 3KF6A 1ZQ1A 4IPGA 1N6AA 1KD1C 1ONLA 2K5NA 1G2TA 3FDRA 5LL6S 1K3RA 4FF2A 4IURA 3SWNA 1GFCA 5ISRA 1D5XC 1MGSA 4RKUE 1GFDA 2E5QA 5A2QL 1W6XA 5A0DA 1HFNA 3RR5A 4J9DA 1A0NB 5C6SA 2JXBA 3O5ZA 3J80i 4B9WA 3CMEA 4DV7Q 1M90U 1GUSA 1AEYA 2PO4A 1X01A 3QB3A 1M3AA 5ELOA 2JA5H 1ENAA 1X3PA 1ACMB 3OA6A 4ZGEB 3C3LA 4LXCA 2E70A 1AE2A 2VUMH 4RTXA 2L1BA 5T1GA 4I7ZC 3IL8A 3TRZA 4QMGA 4LF8L 4YCVA 4XQJA 3MO8A 1U1TA 4XU0A 2H8HA 5JAVA 2LCCA 3DM3A 3DB3A 1AFPA 3PNWC 4ZQ3A 4DFAA 1U4MA 1H9JA 2C0OA 2QDYB 1T0HA 2K2VA 2NYSA 3L42A 1R8OB 2L2PA 3S1MH 3ULPA 2FZKB 1N32Q 3P75A 5A0LA 1WXTA 1KNAA 3MEFA 2XNAC 2PZUA 2A69C 4OO1H 2LFNA 4X9DA 4LK1C 1H95A 1N8RC 3R3OA 4A3KG 1C48A 2C35B 3PUYA 3HOVG 3K5MA 3KDFA 2DJZA 4JUVA 1KLUD 2YTVA 4M77E 1WGSA 1YVCA 3FRPB 3NTIA 2CZ0B 4XTXA 4UP8A 2LJ1A 1G3TA 1BOSA 1RAAB 4MHEA 2XWBB 4DR3L 1NBWA 4MTNA 3A1PA 5CCAA 2JEAI 4FXDA 1YNXA 4IUVA 2R92G 2RHQB 2QGGA 1ZA2B 1AWWA 2B2VC 2NWMA 5IP9G 4AYBG 1Z6HA 1KQSS 2J0TD 1JJCB 4EVOA 2F1LA 1WYDA 3IQLA 3S2DB 5M5XH 5FRMA 2RK1A 1F9QA 4JZ3A 1IREB 3QBYA 2OTJT 5NUCA 4DNIA 3Q8DA 1WVLA 5KYXA 3I9QA 2GFUA 2UUCQ 3JB9I 3SR1A 1JO8A 1ICFB 3H15A 1VQBA 4PMBA 1J8IA 2YV5A 3FHWA 4QQBX 1ARKA 3H6MA 3TEEA 1HTPA 4KI0A 2EYXA 2I0QA 2XK0A 3EH2A 1YITA 2BUDA 2LT1A 4F17A 2HIVA 4O42A 3VV0A 1M4VA 1ZYRD 1QOHA 1M2VA 1XJWB 3CC4T 3QUIA 1Y7XA 1VQ8Q 2SNMA 5GROA 4DEXA 2ESWA 3BVMA 2PVOB 3J81j 4JV5Q 2CFMA 1YHQA 2MWPA 2X6LA 3TU4K 1B2TA 1HR0L 4CDFC 3S17H 1G3YA 2HD3A 2HCIA 3JAMi 2Z6KA 2CH4A 1ZUYA 4JJNK 4F14A 1PMRA 1PYWD 2JK8A 1Y69U 3UWNA 1VQ7Q 1SSOA 1V1OA 3I91A 4JI4L 4M77C 4RAUC 3SWNB 2KQ3A 3LWHA 3GTKB 5FOBB 3OYNA 1Y1VH 3Q22A 4XU2A 1K28A 3JCMW 1VCIA 4IN3A 4K2KA 3V2TA 2BOSA 2P5ZX 2IX1A 2PQEA 3JCMd 4PFPA 4BY6C 2N8NA 4B3MQ 2KXDA 1NM7A 3EH1A 3CCST 3I2ZA 4DR2L 4LD9K 1OX8A 1E2ZA 2F4VL 3BFMA 5E7NA 3A8OB 3AQQA 2KBNA 4DUYQ 2DTHA 1Q46A 1JB7A 2ZXOA 3M3YB 1PM3A 3OYDA 2HZYA 4C3IG 4KLKA 4R8IA 1UE7A 2Z6KC 1E6GA 1FNUA 4KJOA 2I07B 2Q8RE 5JJIA 4OVAA 3S14B 1G83A 1LPLA 3PVQA 2P0PA 3BYYB 4WRDA 4JI5L 3HFNA 2ES2A 2BZYA 2QTXA 4JJCA 5GAMg 1Q12A 2I5MX 2QQRA 4HVWA 3JCMb 2L12A 2ATWA 1DCZA 3K7AH 1QKXA 1VQOQ 3MP1A 1PLFA 3CCEQ 1EY7A 3CCRT 4M7AA 1SYGA 2KYBA 1LT6D 3U58A 4PJMA 4A3JG 4BY7H 4OIJA 3KDFB 1VQMQ 3M59A 2DIQA 4L5GA 1VQPA 1KQSA 3NFCA 2RHYA 1I4RA 4DV6Q 3C12A 4N9TA 3K59A 3NELA 4GLKA 4HXJA 1IHZA 2D8HA 5E1FA 1B34A 3CBPA 1VQ4Q 1PRMC 3OWFA 2O31A 4J6YA 5KH6A 5E4WC 4E7IA 5FLMG 3HOZH 1F9PA 3Q1JA 4DR1Q 3BDCA 3DHQA 2A6HD 3WOFA 1SYDA 2RKSA 4P74A 2CP6A 3EJIA 4F7UA 1MHWC 4V2SA 1QNUA 1SYCA 1VQEA 3UDXA 1CKBA 3H6ZA 1EX4A 2E65A 3PGZA 4LFAQ 3S1RH 4MTKA 1Q82U 1VUBA 1K73R 1HJDA 1VQ5T 1RIPA 1VQGA 3BG3A 2K50A 3H0GH 1T9HA 3SEBA 5KEEA 5M5YH 2ZM6Q 4G7ZC 2RB6A 2R61A 2O88A 3OIPA 1L0WA 1TY2A 2A08A 3OYYA 2YUQA 5ELDA 1G91A 3HKZG 1QWEA 4BD3A 4QGUA 1PG5B 1UUPA 1XMQL 5JPNC 1STAA 3CCQA 1M30A 2OQKA 4BDYA 1A2TA 1X2KA 5JVG3 4QVDA 1I4HA 3EGXA 1TWGH 2C5CA 2QQSA 1LT3D 3E9HA 4DBFA 2KRSA 1D0XA 3CF5A 4EPCA 5KE2A 4RCOA 4BBSH 3C1FA 4QUCA 1LUZA 1M2VB 3CPWP 3G7LA 3G4ST 4RGMA 2Y4YA 2AKKA 2YLCA 3CPFA 4ZNXA 3A0JA 5EKLA 3VR3A 3MKDA 1PV4A 1VF5C 1PVOA 2KXCA 1BBWA 1PH8A 2ED0A 2R7ZH 2CP3A 1D1BA 4DK3C 1PH7A 4OMNA 2DGYA 2NVQB 1X3QA 1KABA 3SGIA 3I7FA 1E2WA 2VL6A 4FM4B 3INZA 2SDFA 1RABB 3J80c 1X6GA 4DBQA 2L89A 5IYBG 2B63H 3OOCA 1UGSB 5KYUA 2CP0A 3I90A 1K8OA 1UJYA 2HL3A 3OS2A 1S4ZA 4D6WA 3LLRA 1QVFP 4OELB 2UU9Q 2JA9A 3QXEB 4KJNA 5G3LD 4WJ3M 4PV1C 4R9WA 1AZPA 2EQKA 1PRTB 1GUTA 2RHSB 2MMPA 3EGUA 1KC8U 2E2HH 3GP7A 4LD6A 3VYSA 3MEWA 3DKMA 2E74C 3JCMP 2F0VA 1UEAB 2HCKA 2P4RA 2X9HA 3GTGH 4PJNA 2CGHA 2M16A 2EY5A 2XG8D 1O80A 1HNXL 4S3SA 2DVEA 4ELZC 3QIIA 4M7AB 1FR3A 4DAYA 2VQEL 1N9SA 2B8AA 2KJXA 2JA5G 1TWFH 4FF3A 4KHPL 2MO1A 2JTMA 2DETA 3K58A 2J7ZA 1JQYD 1SE8A 4ILWA 2JJQA 1ESFA 3QIAA 1HK9A 2VUMG 1ZSGA 1JB0E 4MNOA 4DV5L 2VWFA 2HD0A 1BQQT 4C92E 3NUCA 1MGQA 1JJ2S 4B3TQ 3GD7A 1ASZA 1D2BA 2F0OA 2WB1G 1B34B 4M75A 5GAOm 4MDXA 1AW7A 4A3DH 3SHLA 3QKJA 2JA8H 2NUZA 2DPPB 4IFDJ 4PFOA 4RTYA 1OQKA 3F2DA 2F0IA 4RFBA 2AHJB 4BUGA 3T1YL 1L0XB 2QAZA 4F7UB 4A3IB 4DV3L 2JMAA 1PYSB 5M5WB 3QJ6A 3MXNA 1Q90A 2E76C 4PJOE 1WCMH 4J9FA 3J7AV 1RJTA 3FKIB 2COWA 2LMJA 4AFQC 1XOVA 3G6EQ 2L3SA 5IP7H 1HCZA 4KY6A 1XX8A 4IUNA 1IBLQ 3NEMA 2ZJQA 3FB9A 1AHJB 4KKTA 2UUBQ 2L3PA 1PSEA 3PF4A 4UY8C 1VQ8A 1SEMA 1PRTD 2RSNA 3RMQA 3FEOA 1YJNA 5FJ8H 3D0FA 4C0GA 4ZRZA 4OEMB 4O0AA 1OZ3A 3EGXB 1PFBA 4P72A 1SRUA 4EQOA 5HURA 3GTMH 2EGAA 2LTOA 4DR5L 2EY6A 1CHPD 3PMFA 1G2BA 1IW7C 2E8GA 2NVTH 1BCPC 4B3SQ 5LJ3g 2G3RA 2BE7D 4RMFA 3I5SA 2RSOA 1VQ7A 1L1OB 5J22A 4HJAA 5KE3A 3RKWA 2CP5A 1GO3E 3CQZB 3TP8A 3TS2A 4A3MG 4HVUA 2ZJRA 4M7AD 2V4DA 3H41A 3GPLA 2PI2E 2D62A 4DR4L 4UC4A 1LTLA 1QUQA 4DU9A 5D14A 1Q86U 5C0XG 4HIDA 1VQKA 4ZUJA 2F0FA 4HEDA 2VQFQ 4N8FA 1SE2A 3SK4A 4GZYC 2PZTA 1QCNA 4L5RC 1TU2B 1YHAA 1ZSZC 1FYCA 3W1BA 1I3QH 4DA2A 2SOBA 4ME3A 4P73A 2K5QA 3HOWB 3I4NH 1CZWA 3PIPA 1YEZA 5GAN3 4RCNA 5CV6A 3S3OA 1EEFD 3ND9A 2Q2UA 2NVXB 4A93B 2QGFB 1ZEQX 3OYIA 3GNGA 1D6EC 1IHWA 1X65A 3CC2A 2QEXT 2OQ0A 2BDOA 5CORA 5AYFA 3THKA 1MHNA 1VQOA 4J8QA 4JS5A 2IX3A 3CCEA 4FVMA 3D6CA 4OGEA 3KXTA 2F52A 3PO2B 3CC4Q 4U68A 4ABNA 1BU1A 3BZDB 4PJOC 4F88A 2RQWA 3NBHA 4PZ7A 1Y1VG 2QEJC 2AKLA 1BDOA 3RBBB 3KBGA 2DEUA 4KD3A 2E2JB 1JJ2A 3F1ZA 1BI0A 4FYXB 2FMMA 1I94L 2RDGA 4LF7Q 1QW1A 3I56T 1RAEB 3ER0A 3JCMX 2I46A 2DVJA 4HAEA 2JUFA 4NW2A 2XICA 1TXQA 3GTPB 3FLGA 4E7SA 4BE1A 1Q95G 4M7DF 4XIGS 3RMSA 1H9SB 3GP8A 3S1QB 2Q8TA 1A8VA 1K0XA 4IALA 5FU7B 1PTOF 4Z02A 4M4ZA 4PNOA 4M75B 3AU7A 3S1QH 4JBKA 2WINB 4A3EH 3JCMV 3CCSQ 3B6YA 4IFDH 3BVGA 1LT4D 4DR3Q 4C8QE 1DJ7B 3TZDA 2CKZB 2HIXA 3HP3A 5IYCG 5GAOl 3S2HH 3M0QA 2A19A 3VUZA 2W0ZA 1LACA 2OAUA 1UECA 2EYOA 2MPMA 4BY7G 2YLBA 2MIOA 2F5TX 3PT9A 1LVKA 2GNCA 4Y92A 4ORZA 1SN8A 3OSOA 4AG2C 1Q7YU 2ZJPA 1Q81R 4LF6Q 2Z6BA 1A6XA 3BDUA 3NWTA 1VQJA 2BA0A 4XXEA 5C0MA 1WQWA 3QZ5B 3M0SA 2XGTA 2VB6A 3U23A 5GAGC 4FYWB 2O9SA 2RVLA 3CCRQ 5M3MB 2DNEA 5C4JB 2B2TA 2YU9B 2ZTDA 3E0JA 5KNBA 3ULJA 4OMFB 3QO2A 1M4ZA 1TQOA 3M57A 2EVBA 2CCZA 2K3YA 1VDZA 4H02A 2VW9A 2NWGA 5AT1B 3JRZA 2VYTA 4IPDA 1GM5A 3I4MB 2V8KA 3T4AC 2O5JC 4IOAA 2K3BA 3H0GG 1NCVA 4QVZA 2L5TA 1A62A 2AT1B 1KDCA 1O7YA 4ZK9B 1I6VC 2D2CC 2F69A 3BVZA 4C3JH 2R93H 4K5WA 3KJPA 1BKBA 2CSIA 2FMCA 2DEQA 4NDXA 2B2TC 5I11A 4EGVA 4DPGA 1QKWA 3NSWA 2CH4W 1CKNB 1OPLA 3M58A 2Q2TA 1HNWL 1PD0A 1G6PA 2VGNA 5DY9A 4L6V5 1JQQA 1OU9A 4OF1A 4QVCA 3CXCP 3CD6A 2NN6H 1K76A 4WORA 4OMPA 4EMGA 1N27A 1W2BP 3NK9A 5LMUL 1Z9ZA 5EGTA 4JYAL 1SNDA 3VS4A 4C8QC 1D7QA 1W70A 2EYWA 5KIXA 4LFCQ 2L15A 1ABQA 1UEBA 1CQVA 5KCHA 2EJMA 2H5XA 1QE6A 2WKCA 4MZTA 3MZ5A 3TDQA 5GAMh 2YTXA 1BNZA 4KKSA 1T5EA 2ABLA 1KD1U 1VIEA 3MEUA 3PUWA 5CK9A 1EY0A 2K5LA 1FVIA 2E2HB 1C0MA 3HRUA 4K8JA 1WDXA 4A3IG 1HA6A 1SFOB 3UDCA 5FLXE 5IYDH 1D1AA 1PFMA 4DV2Q 1LABA 2DXBA 2VB3X 1R9TB 2HDLA 1B44D 2HSPA 4JJDA 1AN8A 3E6ZX 4JBJA 3F2BA 1X55A 2H3JA 5GMKh 4IPCA 2RN8A 5I2XA 2RH2A 4H0LC 4HT9A 3M4PA 2YTYA 4LDWA 1TWCH 1VYVA 2KDSA 1QNKA 1EIHA 4KGVB 2BCOA 1FJGQ 1JICA 4A3KB 3HOVB 2RHUA 1BVSA 4B08A 5IOCA 1U4RA 1SHGA 2AUJD 1LO5D 5CYUA 1GD7A 3FVQA 5GAN5 3AHUA 1FWZA 2GCXA 5LJ5h 4R8NA 2MI6A 1Y0MA 1VQ6T 1K73C 2X3XD 2HQHA 2HUGA 5M3FG 1LCKA 2BZXA 1GCQA 1HNZQ 3O13A 5I2YA 2RJDA 3G7ZA 1BB9A 1N8RU 3AFPA 2R92B 4R56A 3KK7A 2DLPA 3CQTA 4RTWA 4AYBB 1TUCA 3P8DA 3VS7A 5HKCA 1EZZB 5GAMf 3L9AX 1WTRA 1T0JA 3M55A 4OWTB 4A3DG 2FPDA 1F2YA 1WNLA 5FROA 1YIJT 2JA8G 2WV6D 3D6WA 1WA7A 1XNIA 2E2IH 4JOIA 1RLQC 2PCFB 1I4K1 3L2RA 2K7VA 2H4OA 1V1QA 4J83A 1XMQQ 2Z0SA 2GN5A 1FMVA 5GANh 1C4QA 4R4QA 1C6VX 4MMKA 2AWNA 4GN4B 1NG2A 1X9NA 1EIYB 1VQMT 4YY3Q 2LQWA 3T1HQ 4JG2A 2OTJA 4BXXG 4F04B 5LMNW 2K9GA 3RLNA 3QWYA 2B29A 3A8KE 1OXXK 3GOXA 1VQIA 2G9DA 4KY5A 1VQ4T 1IBML 1V43A 4CKBA 3LWIA 1YBYA 3ICEA 1JE4A 1W4SA 2RMOA 5LJ5f 3JB9H 1PC0A 1QWFA 4WTOB 2CT3A 2K05A 1IYVA 1I4XA 1U0LA 3ULRB 4ZTFA 1SNCA 4X62Q 1I6HB 3HHTB 3CC4A 2RHZA 5GMKi 2J4XA 5M9OA 4F7XA 3DLMA 2NVYB 5E4XA 4OX9L 1TT2A 1N36L 1YNND 3EROA 3KFUA 4J7IA 2SEBD 1AZEA 1Z9FA 4F87A 3A8IE 1I50H 4AT1B 3EG1A 5IGCA 2A68D 3E3XA 3RZOB 4LFBQ 4A76A 4C2MB 1SXTA 2EW3A 3AT1B 3X24B 2EFIA 2EGCA 2NUTA 5GANf 1TS2A 2KCCA 3P1HA 4N9PA 5CR3A 2JOYA 4X3TA 2KROA 3DUZA 3QDFA 3UA7A 4DR7L 2X4XA 2WFWA 1EWIA 2VV5A 3HL8A 4PLIA 2MCNA 1B9MA 5DEHA 3C95A 2PUKB 4A4HA 1HNXQ 3CCSA 2JS2A 1YHBA 4M77F 1QWYA 4YWLA 5IY0A 1V1CA 1QVPA 4KHPQ 1B3QA 1RI0A 1PTOH 4MZPA 2PNRC 4L59A 4RH6A 4FU6A 3A7LA 4AQYL 1W3SA 1WTXA 1IRXA 4LUOA 3KOJA 2XHCA 3EFOA 2OJ2A 1WX6A 2MOXA 1MMGA 3MP6A 3PIO3 1CM9A 3D4WA 1PXUA 2QEXQ 3N6RA 2PNHA 3M7GA 5ELBA 1K8GA 3C4SA 1AWOA 1PD1A 3GTLH 4HCZA 2MFIA 4JW0A 3CCRA 4A75A 1EY8A 1OULA 2F2XA 2O2OA 1KQSP 2ALYB 2RDHA 1FGBD 4KH1B 4U673 2YHTA 1OI1A 1LTRD 4DV3Q 3UE1A 4E47A 3T56B 5BR8L 1UGQB 2BIVA 2BTTA 1G291 4A3BB 2HQLA 2Y0SG 1ZBJA 4IFDG 3I56Q 4OMOA 1PFSA 1KL9A 1F2LA 4N4IA 4GLAC 2XTIA 5GQOA 2KEDA 2HDMA 1N33L 2O2LD 3HZXA 5LJ3h 3KBXA 3CW2C 3HKZB 5FLXL 3VRYA 1J9OA 4KBMB 2X51A 5GJVB 1GL5A 4H7BA 1LM0A 2CHBD 2F1MA 2LQ8A 3OS1A 4R4CA 2EYLA 4FO2A 4OB3B 5ELNA 5GMKm 4M7DB 5M5YB 1MBYA 4Q5WA 1VQ5A 4ZN1A 1TWAB 4KULA 1EQVA 2V1QA 2YUPA 2F0NA 4L5QA 4BBRH 2PZWA 2L0CA 2RF4A 4BWGB 5IT9c 4JI7Q 1MMDA 2FB7A 4KTAA 4YIJA 1Z7TA 2RF0A 4KHVA 1KK7A 4IPHA 3RUXA 3VYTA 1SMXA 1VQNT 3LH0A 5HGQA 1UE9A 3RLOA 4A4FA 3CCVT 1SLJA 1STNA 5IN1A 4OL7A 2JM8A 1EFID 4C3JG 4DXFA 1HRJA 1D0YA 2V26A 3LW5E 3SWNC 5HK0A 3G4SA 3G6ET 2BA1A 3MWYW 2E5LL 1G8ZD 2B2UA 1ZLMA 2QG9B 1HA5A 3J7A5 3F8TA 1HSQA 2DNUA 4YCUA 5LL6X 3CCJT 4K6DA 3M85A 1YI2T 4WF2A 2N78A 3QWXX 4NP5A 4EIKA 1PZID 2HHHQ 4IJLA 4BA1I 2JA7H 3ZL7C 2DX1A 2JN0A 5D7UA 1MJEA 4ODGA 1RACB 2NN6G 5JEAH 2NUTB 1WFWA 5LJ3f 1UG1A 3H94A 2FEIA 3H8ZA 4R1JA 4RG1A 4PJJA 1PSFA 2AWOA 2I5HA 1K9MU 4JRPA 1XNQL 2CW0D 1NYGA 2HEQA 2ICEC 2DK3A 4DBRA 1M3CA 2BH2A 2B2UC 1NTGA 4CRIA 4NKLA 4FSXA 3OMCA 2PW7A 4RUGA 2L3RA 2F3IA 1CA6A 3PV0A 2EKOA 1A3UA 3EN2A 4K2LA 4CDDC 1AEXA 1KRSA 1AE3A 4LNPA 1W6JA 2CYZB 4M7DD 2VS1A 5JVH3 1XPOA 1P8LA 4LUZA 1EFNA 1FGUA 3GTJB 1RI9A 4PQXA 4LUEA 1UNSA 2JA5B 1AWJA 2VUMB 3EFOB 2EXZA 4JRQA 2E12A 1WJRA 3IRBA 1T3SA 1UGPB 1R0CB 4POGA 4FYDA 4GOPA 4FL6A 3E0EA 1RADB 1V1PB 2MPXC 3M53A 1Z47A 2WB1B 4O1NA 1M2OA 2EWNA 4PJLA 1Q81C 2EAYA 4TQUS 4QIWB 4JK1C 3GDEA 3S1MB 5D65A 5FU6B 4X64Q 1KHCA 3H0HA 2DUDA 2OAWA 3O8VA 4DOWA 1NJIR 1PH5A 3MXPA 4RKBA 1STHA 2KEEA 1RD9D 8ATCB 2P4TA 3QJYA 1V9PA 3HOUH 1IZ6A 4E6RA 3ZEHA 1F9SA 2EIFA 4HKEA 2GFAA 2IWHA 3AYHB 3K6OA 2DA9A 2BZ8A 2DZ9A 4OB2B 4P71A 2CUBA 4NB3A 3NGPA 2B39A 4M7AE 1JEGA 5K36H 3S14H 1SSFA 4E7LA 4OB1B 4RWSC 1XMOQ 2ROTA 4J9CA 1MUZA 4C5IA 1ILQA 2Z9HA 2MAMA 2JEBI 4KMUC 2BKDN 4GNXA 3RN5A 3TCJA 1RUWA 1R77A 4FF4A 4A3LG 2RJEA 3AFQA 4DUZL 5M5XB 3IFTA 1VQ6Q 1F77A 4MN3A 4B3RL 2MWOA 3KLSX 3OB9A 5C5MA 1OTCA 3NMZC 1H9RA 1Y8NB 4JVZA 1ENFA 4G7HC 4GS3A 1D1IA 4E7JA 5FK9C 1K8AR 1HFGA 2LRQA 1V29B 4A3MB 4J6XA 1NY4A 1G8XA 3D7SB 4F7UE 4X1VA 2CQAA 2LY7A 3FMCA 4JCVE 3UI2A 1EIFA 2PVGB 5F2DA 4TVAB 2OF1A 1YIJQ 1HXDA 5IWAQ 3PO3G 1QILA 2FHDA 3T51B 2HT1A 1QCOA 5I21A 1AD5A 1A2UA 1IKMA 1OV3A 3LH5A 2XIDA 5GAN8 2RI2A 1HZAA 3CCLT 3X20B 3DB4A 4KGXB 4JYAQ 2RNAA 3D8GA 2DZCA 1DM0B 1EQRA 2A5HA 1BCPF 1BO0A 1C9OA 2LVMA 2BDNA 3M4OB 3FEWX 1EOVA 3NE5B 1GCPA 2MO0A 1WTQA 1XPRA 1S5BD 2IW3A 1M3BA 1PRTC 2K14A 2K5HA 4WJWA 1S3OA 3U9SA 5AJ3L 4FDBA 4JI6L 2F0GA 1BK2A 2R5AA 1QVCA 4QT7A 1RCVD 2OEOA 3PUVA 3JCMh 4OHJA 4QY7A 2MP1A 1KAWA 3FP9A 5C4XH 3OTOL 3REAB 2D0PA 2LP5A 1TWHH 3RD4A 2RK2A 1NMGA 3HOYH 1KHIA 1Y1VB 4M78G 3EA6A 1VMPA 2F0KA 5L8RE 2KE9A 4A3BG 1ZA1B 2EJFA 4C92F 5LJ5g 2QEXA 4M7AC 4FCYA 3BS1A 3Q23A 3UDIA 2WSEE 1EZ6A 2LJ0A 1JJ2P 3KLSA 4CKEA 4G4KA 2A28A 4TRDA 2JW4A 1HYOA 1MNEA 3VS1A 1Q1EA 3BU2A 3OSSC 1R4QB 2NYZD 3DLLA 4GOPB 1A63A 1E22A 2MK5A 4GKKQ 2E4HA 2A7YA 2RI5A 4LDUA 3I56A 4RTVA 1OZ2A 2E6ZA 4M7DG 3LGLA 4PJOF 3GLXA 4RMOA 4KY7A 2JS0A 3J7AF 3WWVA 3K7AB 4DNRB 2M1HA 1NEBA 2VXWA 1ZUKA 2C0TA 4H44C 3SHWA 1G51A 3EAEA 2EJFC 3E9GA 4OGQC 5GANg 1XYIA 2F0QA 2RBMA 1FMWA 4IIOA 5GAOq 1HXYD 1OXUA 1X56A 1L1OA 5KRUA 2V1RA 3NTHA 4BY7B 3L2VA 3CMAT 5DM63 4NXNQ 3NPFA 4JJBA 1D5MC 2K5FA 3WXMB 2A69D 4ZGJB 5GAOp 1H8KA 1NBEB 2GVBA 1OPKA 4TSSA 2MQHA 2GA4B 1SHFA 5JJZA 1GJXA 3VS5A 2DNCA 1NR4A 1HZ9A 3A55A 2CUDA 3VU3C 3SK8A 4XTUA 1DOMA 2MUYA 3I3CA 3R6NA 1SNQA 5TSSA 4NXMQ 3HOZB 2KRNA 1JBMA 5KYNA 1IB8A 1XJVA 4GNXB 4OXPA 1IHVA 1K83H 1K9MC 2E75C 1DGSA 3VA5A 4M75E 3DMUA 4KD4A 3S1RB 3H0GB 2EOTA 1ZUUA 1L1OC 5JJLA 1IGUA 2X4JA 5IIFA 3GNFB 4ME5A 1NLOC 3EFXD 3ZYYX 5DM73 4FP5D 3K0YA 2CWAA 1WTWA 2L11A 2R6GA 3CBMA 3J7YW 4MZ9A 2YUOA 1OYXA 2LDMA 4JLIA 2JTEA 4HCEA 2D0QB 5AFWA 2DERA 1TWGB 5CBEE 1Y96A 1YP5A 4JI2L 1CKMA 4J9BA 3H09A 4ZLTF 4GKJL 4OONA 4QB4A 2COZA 2X4YA 1WZOA 4LF9L 2WAQB 2EVRA 3ZBDA 4LF4L 1N34Q 1XNRL 3I55T 4OX9Q 5CV5A 2UUAL 1WHMA 1LV9A 4DF7A 1QP3A 3HP9A 4K0KQ 2Z4HA 1CKAA 4RTTA 2DN8A 2J6OA 2KOLA 3P7JA 1A3VA 4J9IA 3RERA 1H9SA 3LNNA 3HOXH 1I4GA 2UXBQ 1VQDA 4JRKA 2R7ZB 5GAMj 4X6AH 1IKLA 4JI1L 2X69A 5C0XI 1NAPA 4MZMA 1I1JA 3U4ZA 1BXTA 2UXCL 4CBVA 1EY5A 3OY9A 5EC7A 1JOKA 3X25B 2B63B 2PMZB 4OO1G 2LCSA 4LF5L 2ENMA 1VQNQ 1G3SA 1IYUA 2KBTA 2IHEA 2OXPA 1F9RA 5CMDA 2KK4A 3CCVQ 5CGKA 3OYKA 1KLGD 1KQ1A 4C0FA 3VR6A 5GMKj 1TU0B 1NPRA 4C0DB 1M9SA 3URGA 1PHTA 2RQTA 1IXRA 2K5VA 1D5ZC 2FO0A 4PZ8A 2GGRA 1A3TA 4Y7NH 2F2WA 2YYZA 3HRZC 4BE0A 4DV4L 4DA4A 5FU7C 3NP8A 3CCJQ 4HVVA 2D0NA 1YI2Q 4FNFA 5IHKA 4M75C 2F0DA 1H3ZA 1UE6A 2F4IA 3GTGB 2XN9C 5LJ5j 3H91A 4X65L 2E3IA 1ET6A 3GQBA 1X6BA 2YRDA 3CP0A 1FNWA 1LTID 4OMMA 2B2YA 5LHY1 2J06A 2A36A 1TOVA 2EY1A 4DAVA 3RDVA 2K4YA 1WLPB 2QI2A 3HOWH 1NNXA 3S16H 2HCCA 2QW7A 1IL2A 1YJWT 2QF7A 5KNDA 3IFDA 4HJ8A 1I5FA 1TWFB 1MSGA 3CAMA 5M3FB 2G9HD 3OSVA 2J05A 3JAMc 1Y1WH 4A3GH 3WOEA 2HBPA 1U9RA 4AIMA 4J8OA 4DV1L 3JC66 1S72T 2L4NA 5C44H 2GTJA 1IBKQ 2JJ9A 1EU3A 1TS4A 2YDLA 4CC7A 2DL7A 2WACA 3RMHA 1STEA 2QQ9A 3TP6A 3MJXA 2Q2IA 3URYA 1VQ6A 4A3DB 3TP5A 2JA8B 3JV3A 1VF7A 3KFVA 3U9OA 3WDNA 5IGFA 1CKNA 1N33Q 1K73U 3QYHB 3RKYA 1K9AA 4HA8A 5GANj 3JB9F 1B7YB 2BH8A 1AH9A 4ID6A 4OMQA 1PRLC 2ROLA 1N36Q 3QYGB 4LJZC 1X54A 2PZ1A 4ZKCB 4CC3A 4UDUC 4C56C 2GQVA 3M0RA 1S5DD 1WCMB 1YIJA 1GXDC 4ULLA 1SJHD 1NR2A 1JWMD 3LX0A 4A4IA 4DV7L 5EJWA 2ZAEA 1VOMA 2NUPA 2R7DA 2JNGA 2X35A 3BZCA 5GAN2 1YNJD 3TS0A 3GTOH 1KIXA 4QUFA 4M78F 1TKWB 3VYUA 3QZ9B 2K79A 3V7SA 3TEHB 4MMLA 1PZJD 2KNBB 2RQVA 2XDDA 1VQMA 4B6MA 2KYMA 2IJ0A 4LF8Q 1SG5A 2QK0A 3GTMB 4YCWA 1J3TA 1Y96B 2L0AA 4X34A 2V1CC 4AYBE 3QR8A 3GV3A 3N5BB 4O2DA 5GAEC 1H9MA 2I2LA 1VQ4A 4DOVA 4BY1H 2KCNA 2DYIA 4CJ2C 1EUJA 3T9NA 3STBD 3PFSA 1U3OA 4IUTA 3RR6A 4EMKA 1E0BA 1PDQA 3K8AA 1B07A 1S5FD 2KENA 1WFQA 1I8FA 1HHVA 4UP9A 2ZTEA 4LNQA 4QQGA 4K14A 2JMCA 2ICIA 1BI3A 1SRMA 2EQMA 2F0TA 1PYBA 1I3QB 1KQ2A 3C46A 2KHIA 3CRKC 6AT1B 1XNQQ 1YJ9T 5A35A 3I4NB 1SNOA 1SROA 3L7ZC 1B4OA 1BR9A 2LS01 4GN3B 4NMZA 3M4YA 3D4RA 2UUCL 2RPNA 3JCMJ 1B7TA 3C2PA 2M2LA 4K5VA 1WHLA 5GAOr 4RKLA 1D1CA 3CCLQ 3H3VI 1GRIA 2HKQB 3MEVA 3VYGA 4J9HA 3CHBD 3HOZG 1BCMA 3MEAA 1TWBA 4M77G 3HOYG 3META 5C5LA 2QYZA 2TMPA 3VRZA 2KY9A 3K5OA 3V05A 2DMOA 2AUKA 3BZKA 1LTAD 4II1A 1NJIC 2A3LA 3LGFA 2F3WA 3RUZA 2JE6I 1CFMA 4HJ5A 2JA6H 1RODA 1YNNC 2Z0WA 3SB2A 3N52A 2IPKD 1JC7A 2GBQA 4LDYA 2A68C 3E5SA 4R4OA 2QA4T 1GBQA 4NOYA 2K04A 2NZHA 4ME7A 3UDGA 1XXGA 2AZVA 1TUGB 2F0PA 3KJOA 3C0CA 3HRTA 2K03A 1QZHA 4V190 4BI8B 1I4PA 4BI4A 3WVEB 1JCKB 4GY5A 3CCUT 4DV0L 2IVWA 1U4PA 2B8GA 1BI2A 3RZDH 3GTQH 4A3EB 1MIUA 2M00A 2Y0SB 4KRTA 4PNYA 2R7FA 2AK5A 5CAIA 3EQLC 1HR0Q 3PIOA 1VA7A 1K4US 3JB9J 1JMCA 5LJ3j 4BBSG 4C92B 1I5LA 2E10A 3PMTA 3TMEA 3RIRA 5KYWA 1D1KA 1RAGB 2EKHA 4HMIA 1EFWA 2JM9A 5EQ0A 1SEBD 4JI4Q 5GAMd 1PH6A 2CZ7B 1MMNA 4Z89A 5COYA 5I4DA 2LNVA 3FC3A 5T1IA 4KH0B 2PVDB 1K8AC 4B3ML 1P92A 2FRYA 2R7ZG 1Q8KA 2NUPB 3TSSA 2FJ2A 5EKKA 4DUYL 4IOCA 4C3HH 4DAMA 2DRKA 2FHTA 2LX7A 3PE0A 4B3RQ 4DR2Q 3CRLC 4A3FH 3I5RA 1JXMA 5EBCA 1U5SA 1E1TA 2A0FB 5DAUA 3W2DA 2A6ED 4I65A 2B63G 1EL0A 3CMAQ 5J26A 2RM4A 1O7ZA 2E41A 3X3NA 3ONAB 4J6WA 5C4ZA 4JI5Q 3MPUB 1WTVA 3CMEQ 4IUUA 2ZPEB 2EQUA 2E1HA 3JCMg 3VUBA 2NZ1D 2R92H 2MYSA 1PNJA 4C3JB 2R93B 4L5SA 2YRCA 5GAN4 1CHQD 5IP9H 4XYQA 4EMKB 4APVA 3NHNA 2L5QA 4HT8A 1BCPD 2EPBA 4DV6L 1WJQA 1VQNA 1YZ6A 1X27A 1BYMA 1MSHA 3HKZE 3KYHC 1QCFA 2PTKA 4N0AA 4RHSA 3CCVA 3DM1A 4AMCA 1W6KA 1A0IA 1LYLA 3SE0A 2DIGA 3BDLA 5J3BA 2DE0X 1FNVA 2BE5D 3OHXC 3G6EA 1SR3A 2OX7A 2NTSA 4KV6A 3OTOQ 2Q2HA 2FYKA 1WPYA 4RCBA 3RESA 3CCJA 1YI2A 1SSHA 1CTMA 2KVQG 3FJPA 3HOXG 5JJKA 1ENCA 4KKUA 4C92D 3R6OA 2LT4A 5A2QE 3OW2S 1AT1B 4HJ9A 1B9NA 2ZM6L 2QASA 2EJ9A 2OTLT 2UXDQ 2XKOC 3NQIA 3EG0A 3I55Q 2JVVA 1BIBA 2H1EA 1VQ9T 1MV0B 5HGTA 2EJGA 2YRVA 3D4DA 1KDBA 1SAPA 3MXUA 2COYA 3VYRA 1FX7A 1K0RA 4CDCC 1D0ZA 2IIMA 3K57A 4YTLA 1AVZC 2AZSA 2K28A 4KHZA 1M90R 4EQNA 3E2UA 1WCMG 1I6HH 4RA8A 3S24A 3PIP3 2O4XB 2DBMA 1B3AA 1XPUA 1GCQC 2PU9B 4M7DA 3A8JE 5IP7G 1UWVA 3E9FA 5FLXc 3QHSA 1ESRA 3MFGA 1X6OA 3CBOA 1TWCB 4DXGA 2V8IA 2K57A 3OYMA 3J81E 2E2DC 1BBUA 4X3SA 5FJ8G 1XTCD 1M1GA 4C2MH 3SK5A 2EYQA 4JOIC 4DNTB 5C4HA 1M8VA 3K80C 4HSPA 2CW0C 4Z88A 4PK4A 4RG2A 3A8GB 1Q81U 2ID0A 5I6WA 2EYZA 4C3IH 2WIIB 1VQLT 5KYWB 1C7YA 1YFNA 2EQJA 4A3GG 1B50A 1Y1WG 3CXCS 2DL3A 4K8IA 2A73B 4BE2A 3S3MA 4Q0FA 4QL5A 5C3EH 4N4HA 5C44G 4M7DC 3L2PA 2UU9L 3M4QA 4JLGA 4CC4B 4X9CA 2CQOA 4JBWA 1KJWA 2CREA 1QVGS 1K8MA 2K32A 3L1AA 4A4KA 8AT1B 5I9OA 1O78A 3AMUA 1IGQA 5IH2A 1YJWQ 2WB1E 3A74A 2K5WA 4PFZA 3VDYA 4A3JH 2F0WA 4QIWE 3M4GA 4FYYB 2RJFA 4BACA 4XK8E 2B8FA 3K81C 1QLYA 2QQBA 3OBWA 1S72Q 3S15H 2O9VA 4HTHA 5JEAJ 3I4NG 1X32A 2F0EA 1ZYRC 3G6JB 4CKCA 2MNAA 2EDGA 1D8LA 2K7AA 1EEID 3LWUA 4AH6A 4OWWB 1UE1A 3OYCA 2GF7A 1PFNA 4POFA 5FLMH 4HN7A 3R2TA 2EQSA 3E9IA 3FPUB 3PO3B 2XD0A 2HDAA 4LF9Q 4ELYC 1XNRQ 2VQEQ 2XDBA 2D5DA 2UUAQ 3S1NB 4A53A 5BN5A 4RCCA 4JZ4A 2KQWA 1TUDA 4B3TL 3UE0A 2H3EB 4EQ5A 1LLRD 3KUPA 1U1SA 3OW2A 4DV5Q 1DONA 1RHPA 1C0AA 1T3LA 4PKCC 3E19A 3M0TA 3T16A 1CT1D 1ZBXA 1V1PA 2DF6A 5FKAC 2VVKA 4BY1G 2KMTA 1X2QA 1NE8A 3HKSA 4P2CB 3HPWA 3CCLA 4N4GA 2FRWA 5IT9E 2XRSD 3QOJA 3TVTA 1HUNA 4L5TA 3T1YQ 1G2SA 3BY7A 3FIFA 1S5CD 4AFSC 1I50B 4M78B 1JRIA 1PZKD 2G5DA 1I4QA 4QW2A 5LJ3d 3H0IA 5FW9A 2R57A 4A3EG 3PQIA 1QP2A 4ZCKA 4C1NI 5CC4A 2V8JA 2VNUD 1SPKA 2UUBL 3ME9A 1W1FA 4JI8L 4F8MA 1AZGB 2NN6I 4C92G 1RDPD 2CKKA 1PRTF 1MKHA 5D6XA 3EG2A 3A7AB 4RTUA 3H9NA 2M02A 1JWSD 1O7LA 4X65Q 1XQHA 1ZHIA 2FVUA 3FJ5A 2C06A 2M0OA 2GVAA 4B3SL 1S5ED 2MHVA 3EBEA 4DR5Q 4FW2A 1B53A 1I07A 1UGRB 1QJOA 2P0KA 1WOCA 2KHSA 1BI1A 2R3ZA 1PTOB 3CCQQ 2NBFA 5D6YA 1NYFA 2KCMA 1YJ9Q 3F2CA 1TG0A 2K3XA 4PJOG 4M7AF 1HJPA 2ECZA 4DV1Q 5IGEA 2JN4A 4KK7A 1PA6A 2VQFL 1WHGA 4OIKA 1M1FA 2JA6G 4DR4Q 1QVGA 4LW1A 1E7OA 2ZPGB 3CC7T 4YHHL 2A6HC 4Y28E 4R4IA 4WFN3 4QQDA 4KUDK 1WTPA 3GTLB 2CP7A 3C94A 4O6JA 4OP0A 3JB9D 3LYIA 2A8VA 2R93G 3GBQA 4RGNA 2FZGB 4ZAIA 2KR3A 1OXSC 1X3EA 1CA5A 3CMAA 4QJFA 3BW1A 2AMCB 5CV8A 2HKNA 3S2DH 4JI0L 3UA6A 2K5IA 5IHIA 4F7UF 5GAMe 1OOTA 2CT4A 3Q24A 1KTKA 2HQXA 3GTJH 3UATA 1WI5A 3MAQA 3NQTA 2CP2A 2HL5C 2QA4Q 3C1EA 4XTCS 4M78D 2K75A 5CBAE 1CZGA 1PH1A 5FWCA 2VC8A 3UT1A 3DXJC 1CSKA 1NZ9A 3JSCA 2X6GA 2DL5A 4L8JA 1Q82R 1B1ZA 1BCOA 3CCUQ 4LF7L 2RQXA 2ZPBB 2MGSA 2ZPFB 3LWEA 2B2VA 2CWPA 5L23A 5GMKe 2LMCB 4C3HG 3RN2A 5CQXA 4FXGC 1I94Q 3OMGA 4BBRB 1D09B 1RTNA 1WTOA 3ZFJA 2LSSA 2PQAB 1K1ZA 1ML0D 3TQYA 5D6WA 3NPPA 4A3FG 3IAYA 1NSNS 4WCIA 5CO7A 1KFZA 3NHHA 3J81L 1ASYA 3SD4A 3VR4A 3QDRB 1M8AA 2RHXA 4DK6C 3A5UA 2CZ6B 1KNEA 1YWPA 2JZ2A 1PTOD 2EGEA 2F2VA 5LJ5e 1L2FA 3CKIB 4FSSA 1WJSA 4FXKC 5IYDG 1T5XD 2KGTA 2CSQA 4KT0E 3OW7A 4UPAA 4LN2A 2EXDA 1HZBA 3I55A 3I70A 4J1MA 3DWQA 5ELCA 5I9PA 2EYJA 2LCLA 4B9XA 3L2QA 2AQ1B 3VS6A 3GTKH 4LDXA 1L0YB 5DLQE 4RG8A 1PH4A 3OPOA 5A0GA 4LF6L 2DJFC 3I4LA 4FT2A 3VA7A 2LQNA 2ZPIB 3ERQA 2Z8LA 5EG2A 1QQJA 2M0YA 3G71T 2JA7B 1HH2P 2VZAA 1K3BC 4XAXB 3KF8B 4JDSA 3A54A 5IGBA 2D9TA 4A4GA 3M3YH 1X3GA 5GANe 4ZKBB 4A3MH 2B3GA 1VYTA 4IJHA 2D9UA 2WAQE 3GV6A 4GOPC 2DBKA 2P84A 2I5LX 4KN7C 5ELFA 1Y8OB 5J1ZA 5C0XH 5I22A 1UB4A 2W10A 4M77A 4Z8AA 3GO5A 4C0ZA 4C8QG 1B70B 4JS4A 1Y8PB 2DJQA 1KC8R 3G48A 2CVRA 2DTIA 3S9WA 4E2FB 2ASBA 4Z9CB 1RKNA 5IODA 1FYNA 4XDXA 3TQ7P 5GMKl 1UFFA 3I35A 4L6TB 3R8BA 1YJNQ 1GHKA 5CKDA 3M4OH 4CHTB 3I73A 4XQNA 1H92A 5CKBA 2EY2A 1EYAA 2PMZE 2J6KA 1PH3A 4DV0Q 1O7IA 3Q6SA 4JBMA 4LUVA 1PWTA 3KF6B 3NBIA
chains in the Genus database with same CATH topology
5CIUA 2Z4IA 4J5YA 4E7KA 3V8LA 5IT9L 3V7CA 1YJWA 4M75F 3GF5A 1SMYD 2HNIA 4DN4M 1EWHA 2TSSA 3ASKA 2FFKB 1MD2D 5I2SA 4XQ3A 1S72A 1QCBD 3WVDB 5CR2A 3HOUB 1RL2A 4FF1A 3JB9G 4LAAA 1GUGA 2F0LA 3S17B 1BIAA 2ENBA 3HG9A 2R58A 1OXVA 2ZPHB 2A74C 4HMJA 1ICWA 5EKIA 1U8RA 2EE1A 1UAPA 5CKEA 3MC0B 4BB7A 3DWPA 5CQYA 2KUMA 5BN4A 3A5ZB 4XTWA 4ATOA 2XSCA 1DOLA 2ZXRA 3CCMT 2WSFE 3J80E 1AP0A 2VGMA 4BS9A 2QKIC 3H3VC 5FO7B 4G57A 5FO8B 3KUFA 3OYEA 3QG1A 3RKXA 1SE4A 2PPBC 1I81A 1TS3A 3UPUA 1YNJC 4OGCA 2ZT9C 3RLFA 4C0DC 2RO0A 1IL8A 1EYDA 1SJED 3JCMf 2RJCA 1G3WA 1M90C 4VUBA 1KG1A 1TH7A 3CMET 2RHIA 5LJ3e 5IGGA 3SDZA 5C4XB 2JXMB 2K1BA 1YJ9A 1H9KA 1TWHB 4FT4A 3HOYB 4M77B 2ZCFB 1HQRD 2P0QA 3K5NA 4V0BA 5HY6A 3HFOA 4OO1I 1QG7A 4BY6B 2XRQD 2C9OA 2L55A 3DEOA 5M5YB 2DY8A 3ND8A 2X4WA 5KCOA 2JYOA 4IQZA 2K5DA 1LTSD 2LX9A 3QWNA 1NJIU 4BA2I 4K5XA 4C1NK 2Y4XA 5FRNA 2F0HA 3JCMQ 1JB3A 2K6AA 2F0SA 3EFSA 2KSSA 2LC4A 1DYQA 1HUMA 2QA4A 2VXEA 1LTTD 2PQWA 2EYMA 1G5VA 3NTKA 3QO3A 3T53B 4BBSB 4H13C 4HSVA 4RHRA 1EU4A 5E3FA 1EQTA 3HEJA 2HAXA 4M1UB 3CCUA 3OIQA 5DNFA 2RA4A 3BYTB 1Q3LA 3VYHB 1D3BA 2RA2A 1WD0A 3TN2A 4NL3A 2ZGWA 4KUIA 2DKGA 4G7OC 2RD1A 1AZQA 2XDPA 3JAME 4TKOB 1K83B 3QSUA 1K8AU 1JR0D 3S6WA 4IUQA 3MEHA 4IUPA 2F0MA 4M77D 5EPJA 1YITT 2IL8A 1RF2D 1KDAA 3OYJA 4ZGDB 1C8CA 5JEAG 3MCAB 2O5IC 2Q8IB 3HGBA 2JTFA 4C8QF 2K01A 3X28B 3PGGA 3VKIA 3R93A 5IGDA 3V8JA 3M54A 4HCSA 3A8MB 1YHQT 1JOQA 2PUOB 2F0UA 2IX0A 3HRSA 3Q0AA 2XU8A 1WD1A 3X26B 3LX7A 3SXHA 2KECA 2XIWA 2WKDA 1SYFA 4XYOA 3TBIB 4IZ8A 3CPWS 1JOOA 2VB2X 3HOXB 2A6EC 3CEYA 3BDOA 2Z1CA 3MVVA 1STBA 4A4EA 3A56A 1TR5A 2XI9A 4C92A 2B2YC 1NUCA 1NPPA 5JPMC 2MF2A 2E6NA 3D3RA 2OTLA 2D6FA 1TY0A 4HR7B 2XWJB 3TZUA 5EPKA 2L8DA 1QVFS 4QCLA 4Y7NB 1VQ9A 1EZ8A 4OB0B 3MA2B 5K36G 1LOJA 1OO9B 2BE5C 1GUOA 3J80L 3FRNA 1VQPT 4PJOA 1SE3A 1F2MA 4C5GA 1N9RA 4E6IA 2EYPA 5CKFA 2IT1A 3OS0A 1EIGA 4C92C 4DGZA 2DD5A 3S16B 2CS7A 2NVTB 3I72A 3KLRA 4A3GB 1Y1WB 2SNSA 5C44B 4PMWA 4JRIA 1D3BB 2R5MA 2DTOA 5IAYA 2EYFA 1Q82C 3JCMe 3L2WA 1VQLA 4DK0A 1CQFA 1TS5A 3AB9A 3VR2A 2M9VA 3OYHA 2WSCE 3DEPA 2E64A 3CCQT 3L2ZA 3NXWA 1SDFA 4Q5VA 1II3A 1CK1A 2PW5A 1HPCA 3F70A 1EY9A 1CI3M 3QOLA 4EMKC 2AQ3B 3A8LB 3GTOB 1LNXA 3M9QA 3F2UA 3L3OC 2DXUA 2NB0A 1ET9A 2FL7A 4XTYA 1F2ZA 3CPWA 1BBXC 5D3DA 5C3XA 1X75C 3VJPA 1EY4A 1XTDA 5DM7R 2B2WA 1LT5D 4CGYB 4C5HA 2JSOA 3VR5A 2QQAA 4BY1B 1BCPB 2O4XA 4DQ2A 5KNCA 2EZVA 1TVXA 1SNMA 2XVSA 3PUXA 2M9UA 1Q1BA 5HK3A 4RGOS 5BN3A 1KC8C 1QVFA 3GIBA 4EDUA 2QCPX 1M1KU 1EWCA 1QB5D 3JAML 1ZKOA 3S2HB 3I8ZA 2B2WC 4BI3A 4LDVA 3MHBA 1DZ1A 2PYKA 3JCMc 4L63B 4HCBA 1E2VA 4C8QA 3SK6A 3MP8A 3HSBA 2FINB 1STYA 3K5LA 2IG0A 5J39A 5KYIA 4O5VA 3OQ5A 4PJOB 1LTBD 1JORA 2DXCA 1SBBB 2KAFA 1Y07A 1O75A 1M5Q1 2JA6B 4M78E 4M75D 4M7AG 3M56A 1DJRD 4EQPA 3V8KA 3M7NA 1LTGD 2CZ1B 2RDFA 3V7RA 4J7FA 1STGA 3M5AA 5DLOA 5GAN6 1U4LA 1IW7D 4XQQA 5LJ5d 4EMHA 4ZYSA 4DK1A 3CC7A 3PMIA 5GAOn 2F03A 3RZDB 3GTQB 1XWEA 1SNPA 3QPHA 5K5PA 4M7DE 1RTOA 1G6ZA 4F7UG 2DAQA 1DOKA 4X3KA 2NUCA 4HCCA 4RGTA 1VQ8T 4QF4A 3OYAA 1YJNT 1ILPA 4DAPA 1LJOA 4J6HA 5ELEA 1FXXA 2OT2A 3HS0C 5CVIA 2VUBA 1KAAA 2QXFA 2Y90A 4M78A 4C3HB 5GANd 4A54A 4QQ6A 3P20A 4A3FB 1HTLD 1VQ7T 2NTTA 3P8BB 4N0AC 1VIFA 1VMCA 1GOZA 1Q86C 1FD7D 5KGUA 1VQKT 5I6YA 2ZXPA 4PJOD 3ITPA 2QILA 3PTAA 5CV9A 4XT1B 4M78C 4C5EA 1BF4A 4NL2A 2DD4A 4PL6A 3OS5A 3NWSA 3SFMA 2L9HA 4XTZA 3CC2T 2NLUA 3FPPA 2ZZDA 2O01E 1VQOT 3OYBA 1SYBA 4XU1A 2EJGC 3CCET 5JOBA 2LKVA 1A15A 3OYLA 3T13A 3FDTA 2QDBA 1ZXTA 4ZN3A 3G71A 1W2BS 3TP7A 4C8QB 4CI0C 1HQMC 4XT3B 4PLLA 1MI2A 5G3LF 2HQEA 1PTOC 3IKJA 1Q8IA 3W3AA 4IKFA 5KYLA 2AQ2B 4IFDI 4XU3A 1GHJA 2E2IB 1OXTA 4ZTJA 2MJ8A 1GXIE 3OWEB 3MXGA 3MFYA 4X3UA 5D3IB 3CU7A 3L2UA 3MHXA 3TREA 3OYFA 1SYEA 2DXTA 1YCYA 2F5KA 3P8HA 4NS5A 4PMCA 3V96A 4M8AA 4M75G 1EY6A 1Q7YC 3OYGA 5CKHA 5C3WA 2F3VA 1BUVT 2KA7A 2K33A 5EPLA 3X3MA 3PUZA 4K6LA 4E7HA 2N88A 2F0JA 2RI3A 5FO9B 4C3IB 5GAN7 1V8QA 3D31A 5I2MA 1O9SA 2N55A 4MIUA 5C3EB 1M1KC 4MDWA 5C6AA 4CJ1B 3S3NA 1TIID 2DY7A 4BDZA 4KN4C 3R2IA 4A3JB 1WQ7A 4C8QD 4XTVA 3KF8A 5CV4A 3DWAA 2WP8J 3EFRA 4Y91A 4R55A 3SVMA 3S15B 3EVQA 1SMYC 2VXFA 2LQKA 1DD2A 1GUNA 2DO3A 4P5NA 3MTSA 1EYCA 2KVMA 4UAIA 3OBYA 3A8HB 1Y71A 5CV7A 5C0XJ 4FIBA 3CD6T 5FU6C 2JP1A 4LMQD 1DXMA 1GUWA 3CXCA 2EYHA 4ZUIA 3CCMA 3E1SA 4TVRA 1W2BA 1H641 1JWUD 1R4PB 4CJ0B 5EBDA 1EOTA 1ZQ1A 1N6AA 1KD1C 1ONLA 1G2TA 3FDRA 5LL6S 4FF2A 4IURA 3SWNA 5ISRA 1D5XC 1MGSA 4RKUE 2E5QA 5A2QL 1HFNA 5A0DA 5C6SA 4B9WA 3CMEA 1M90U 1GUSA 2PO4A 3QB3A 1X01A 1ENAA 1X3PA 3OA6A 4ZGEB 3C3LA 2E70A 2L1BA 5T1GA 4I7ZC 3IL8A 4QMGA 4XQJA 3MO8A 1U1TA 4XU0A 5JAVA 2LCCA 1AFPA 3DB3A 3PNWC 4ZQ3A 4DFAA 1U4MA 1H9JA 2QDYB 2K2VA 3L42A 1R8OB 3P75A 5A0LA 1KNAA 2XNAC 2PZUA 2A69C 4OO1H 2LFNA 4X9DA 4LK1C 1N8RC 3R3OA 1C48A 3PUYA 3K5MA 2DJZA 4JUVA 1KLUD 4M77E 1WGSA 3FRPB 3NTIA 2CZ0B 4XTXA 1G3TA 1BOSA 4MHEA 2XWBB 5CCAA 2JEAI 4FXDA 4IUVA 2B2VC 1Z6HA 1KQSS 2J0TD 4EVOA 3S2DB 5FRMA 2RK1A 1F9QA 1IREB 3QBYA 2OTJT 5NUCA 1WVLA 2GFUA 3JB9I 3SR1A 4PMBA 1J8IA 3H6MA 3TEEA 1HTPA 4KI0A 2XK0A 1YITA 2BUDA 2LT1A 4O42A 3VV0A 1M4VA 1ZYRD 1QOHA 3CC4T 3QUIA 1Y7XA 2SNMA 3BVMA 2PVOB 1YHQA 2MWPA 2X6LA 3TU4K 1B2TA 1G3YA 2HCIA 1PMRA 4JJNK 1PYWD 1Y69U 3UWNA 1SSOA 1V1OA 3I91A 4M77C 4RAUC 3SWNB 2KQ3A 3LWHA 3GTKB 5FOBB 3OYNA 3Q22A 4XU2A 3JCMW 1VCIA 4IN3A 4K2KA 3V2TA 2BOSA 2IX1A 2PQEA 3JCMd 4BY6C 3CCST 4LD9K 1E2ZA 3BFMA 3A8OB 2DTHA 2ZXOA 3M3YB 3OYDA 4C3IG 4R8IA 1FNUA 4KJOA 2I07B 2Q8RE 4OVAA 3S14B 2P0PA 3BYYB 4WRDA 3HFNA 2QTXA 5GAMg 1Q12A 2QQRA 3JCMb 2L12A 1DCZA 3MP1A 1PLFA 1EY7A 3CCRT 4M7AA 1SYGA 1LT6D 4OIJA 3M59A 2DIQA 4L5GA 1VQPA 1KQSA 3NFCA 2RHYA 1I4RA 3C12A 4N9TA 3K59A 4GLKA 1IHZA 5E1FA 1B34A 3CBPA 3OWFA 4J6YA 5KH6A 5E4WC 4E7IA 1F9PA 3Q1JA 3BDCA 3DHQA 2A6HD 3WOFA 1SYDA 2RKSA 3EJIA 4F7UA 4V2SA 1QNUA 1SYCA 3H6ZA 2E65A 1Q82U 1VUBA 3BG3A 1VQ5T 3SEBA 5KEEA 4G7ZC 2RB6A 2R61A 3OIPA 1TY2A 3OYYA 5ELDA 1G91A 4BD3A 1UUPA 5JPNC 1STAA 3CCQA 4BDYA 1A2TA 5JVG3 4QVDA 1I4HA 2C5CA 2QQSA 1LT3D 4EPCA 5KE2A 4RCOA 3C1FA 4QUCA 3G7LA 4RGMA 5EKLA 3G4ST 2Y4YA 2YLCA 3CPFA 3VR3A 1VF5C 2NVQB 1X3QA 1KABA 1E2WA 4FM4B 3INZA 2SDFA 2L89A 3OOCA 1UGSB 3I90A 1K8OA 3OS2A 1S4ZA 4D6WA 3LLRA 3QXEB 4KJNA 5G3LD 4PV1C 4R9WA 1AZPA 2EQKA 1PRTB 1GUTA 2MMPA 1KC8U 3GP7A 4LD6A 3VYSA 3MEWA 3DKMA 2E74C 3JCMP 2F0VA 1UEAB 2CGHA 2M16A 2EY5A 2XG8D 1O80A 4S3SA 2DVEA 4ELZC 3QIIA 4M7AB 1FR3A 4DAYA 4FF3A 1N9SA 2B8AA 2KJXA 2JTMA 3K58A 2J7ZA 1JQYD 4ILWA 1ESFA 3QIAA 1HK9A 1JB0E 2HD0A 1BQQT 4C92E 3NUCA 1MGQA 1JJ2S 3GD7A 1D2BA 2F0OA 1B34B 4M75A 5GAOm 4MDXA 1AW7A 3SHLA 3QKJA 2DPPB 4IFDJ 2F0IA 4RFBA 2AHJB 4BUGA 1L0XB 4F7UB 4A3IB 5M5WB 3QJ6A 3MXNA 1Q90A 2E76C 4PJOE 3J7AV 1RJTA 3FKIB 1XOVA 1HCZA 4KY6A 1XX8A 4IUNA 3FB9A 1AHJB 4KKTA 1PSEA 1VQ8A 1PRTD 2RSNA 3RMQA 3FEOA 1YJNA 4C0GA 4ZRZA 4EQOA 1OZ3A 1PFBA 2LTOA 2EY6A 1CHPD 3PMFA 1IW7C 1BCPC 5LJ3g 2G3RA 2RSOA 1VQ7A 5J22A 5KE3A 3RKWA 3CQZB 3TP8A 4M7AD 2V4DA 3GPLA 2D62A 4UC4A 4DU9A 5D14A 1Q86U 5C0XG 1VQKA 4ZUJA 2F0FA 4HEDA 4GZYC 1SE2A 3SK4A 2PZTA 1TU2B 1FYCA 4DA2A 2SOBA 2K5QA 3HOWB 1CZWA 3PIPA 5GAN3 4RCNA 5CV6A 3S3OA 1EEFD 3ND9A 2NVXB 4A93B 1ZEQX 3OYIA 3GNGA 1D6EC 3CC2A 2QEXT 2BDOA 5CORA 5AYFA 1VQOA 1MHNA 4J8QA 2IX3A 4JS5A 3CCEA 4FVMA 3D6CA 4OGEA 3KXTA 3PO2B 4U68A 4ABNA 3BZDB 4PJOC 4F88A 3NBHA 2QEJC 1BDOA 3KBGA 4KD3A 2E2JB 1JJ2A 1BI0A 2FMMA 2RDGA 1QW1A 3I56T 3ER0A 2I46A 3JCMX 4HAEA 4NW2A 2JUFA 2XICA 3GTPB 3FLGA 4BE1A 4M7DF 4XIGS 3RMSA 1H9SB 3GP8A 2Q8TA 4IALA 5FU7B 1PTOF 4Z02A 4PNOA 4M75B 3AU7A 2WINB 3JCMV 4IFDH 3BVGA 1LT4D 4C8QE 1DJ7B 3TZDA 3HP3A 5GAOl 3VUZA 1LACA 2OAUA 2EYOA 2MPMA 2YLBA 2F5TX 3PT9A 3OSOA 1Q7YU 1A6XA 3BDUA 3NWTA 2BA0A 4XXEA 5C0MA 1WQWA 3QZ5B 5M3MB 2RVLA 5C4JB 2DNEA 2B2TA 2YU9B 3E0JA 5KNBA 4OMFB 3QO2A 1M4ZA 1TQOA 3M57A 2EVBA 2K3YA 1VDZA 2NWGA 3JRZA 2VYTA 3I4MB 2O5JC 2V8KA 3T4AC 1NCVA 4QVZA 2L5TA 4ZK9B 1KDCA 1O7YA 1I6VC 2D2CC 2F69A 3BVZA 4K5WA 1BKBA 2FMCA 2DEQA 4NDXA 2B2TC 4EGVA 3NSWA 3M58A 2VGNA 5DY9A 4L6V5 4OF1A 4QVCA 2NN6H 3CD6A 4WORA 5HURA 4EMGA 1N27A 3NK9A 5EGTA 1SNDA 4C8QC 5KIXA 1UEBA 1CQVA 5KCHA 2EJMA 2WKCA 1QE6A 3TDQA 4MZTA 3MZ5A 5GAMh 1BNZA 4KKSA 1T5EA 1KD1U 1VIEA 3MEUA 3PUWA 5CK9A 1EY0A 2K5LA 2E2HB 3HRUA 1HA6A 4K8JA 1SFOB 3UDCA 5FLXE 1PFMA 1LABA 2DXBA 2VB3X 1R9TB 2HDLA 1B44D 3E6ZX 1AN8A 2H3JA 5GMKh 5I2XA 2RH2A 4H0LC 4HT9A 4LDWA 2KDSA 1QNKA 1EIHA 2BCOA 1JICA 4A3KB 3HOVB 2RHUA 4B08A 5IOCA 1U4RA 2AUJD 1LO5D 5CYUA 3FVQA 5GAN5 3AHUA 1FWZA 2GCXA 5LJ5h 4R8NA 2MI6A 1VQ6T 1K73C 2HUGA 3O13A 5I2YA 2RJDA 3G7ZA 1N8RU 2R92B 4R56A 3KK7A 4AYBB 3P8DA 5HKCA 5GAMf 1WTRA 3L9AX 3M55A 1F2YA 1WNLA 5FROA 1YIJT 2WV6D 3D6WA 1XNIA 2PCFB 1I4K1 3L2RA 2K7VA 2H4OA 4J83A 5GANh 1C4QA 4MMKA 2AWNA 1VQMT 2OTJA 3A8KE 1OXXK 3GOXA 2G9DA 4KY5A 1VQ4T 1V43A 4CKBA 3LWIA 1YBYA 1JE4A 1W4SA 5LJ5f 3JB9H 2K05A 1IYVA 1I4XA 4ZTFA 1SNCA 1I6HB 3HHTB 3CC4A 2RHZA 5GMKi 2J4XA 5M9OA 4F7XA 3DLMA 2NVYB 5E4XA 1TT2A 1YNND 3EROA 4J7IA 2SEBD 4F87A 3A8IE 5IGCA 2A68D 3RZOB 4C2MB 1SXTA 3X24B 5GANf 2EFIA 2KCCA 1TS2A 3P1HA 4N9PA 2JOYA 4X3TA 3DUZA 2X4XA 2VV5A 3HL8A 4PLIA 1B9MA 5DEHA 3C95A 2PUKB 4A4HA 3CCSA 4M77F 1QWYA 1QVPA 1RI0A 1PTOH 2PNRC 4MZPA 4RH6A 4L59A 1WTXA 4FU6A 3A7LA 2XHCA 3MP6A 3PIO3 1CM9A 3D4WA 1PXUA 5ELBA 3N6RA 3M7GA 3C4SA 4HCZA 3CCRA 1EY8A 2RDHA