5J39A

Crystal structure of the extended tudor domain from tdrd2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
196
Chain Sequence
GRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSKKLDIGLELVHKGYAIELPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Tudor and KH domain-containing protein
publication title Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 196
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j39A02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j39A01
3QKJA 5IGFA 4RKBA 3P75A 4Z02A 4TRDA 2RHXA 1F2YA 2OF1A 1JOQA 1A3VA 4PLLA 2M0OA 1F2MA 3PMIA 4R8NA 3NTIA 4ZUJA 2DIQA 3LX0A 1RI0A 4HCZA 2EY6A 1STYA 2X4XA 2EQJA 1A3UA 2CKKA 3S3NA 3NK9A 4EQOA 5IGEA 3EROA 3L2QA 4KJNA 4F8MA 2HQEA 5I9OA 4ZUIA 3PMFA 3MXPA 3OS1A 2F0UA 3LYIA 1SYGA 4K5XA 2LRQA 3C1FA 4ZQ3A 3TP8A 3LX7A 3DLMA 2F0SA 2BIVA 3OYAA 3OYHA 5KE2A 1KAAA 3MP8A 4BDZA 3OYFA 2VYTA 1STNA 1KDBA 5CGKA 3OYGA 5HGTA 2G3RA 5DEHA 2K3XA 2PQEA 4C5IA 4DU9A 4NDXA 1STAA 5I6WA 3MEUA 2O4XA 4EQNA 1KDAA 3NTHA 3DB3A 3O8VA 3FEOA 2OEOA 4I65A 1SNDA 4QQDA 5E1FA 3EAEA 3NXWA 1NSNS 3NHHA 4RG2A 2O4XB 3V2TA 2SOBA 2DIGA 4K8JA 5IIFA 3C4SA 1TT2A 2K3YA 5D6YA 5KIXA 1JORA 3OA6A 3L2VA 3U9OA 1NUCA 4BACA 1RKNA 3OB9A 3ERQA 5KYLA 4IUPA 4A4HA 5EKKA 4NS5A 2R5MA 2EYMA 5DAUA 3RUZA 4WORA 4DFAA 4H7BA 2SNMA 3SD4A 2IG0A 4C5EA 2EY1A 1SNQA 2F0DA 2F0WA 4FL6A 2JZ2A 4KY5A 2F0OA 4IZ8A 2RI3A 2R57A 3ASKA 4FU6A 4BE0A 3OS2A 1STGA 4KD3A 4BD3A 4BE2A 5D6XA 3META 3S3OA 3TMEA 2EYLA 1SNCA 3FC3A 5EGTA 3MEWA 2WACA 1IHZA 1SYBA 3D4WA 1EZ8A 2F0KA 3QOLA 5ISRA 2GFAA 2X35A 1KDCA 4Q5WA 4F7XA 3TP7A 4QMGA 3H6MA 3NTKA 3NUCA 2EY2A 3PMTA 4PLIA 2F0PA 2EQMA 2F0FA 2X4WA 2E6NA 3C1EA 4EVOA 3OWFA 4IUTA 3DB4A 4HMIA 3DHQA 3MEAA 3LH0A 3E9GA 2NLUA 3MEHA 3MO8A 2XK0A 5FRMA 3QIIA 1EY9A 1STBA 5CR3A 4II1A 5KEEA 1EY7A 4UC4A 4K14A 3TP6A 4KY7A 1TQOA 5FRNA 5KCOA 3OS0A 5JAVA 3OYJA 1OZ3A 3VA5A 1MHNA 1F2ZA 2BUDA 2F0QA 5CC4A 2OXPA 1A2TA 3P1HA 1EQVA 3BDCA 2F0EA 2PZWA 4IUVA 1SNMA 2X4YA 2EYFA 2LVMA 4HMJA 3MP6A 2LCCA 2RDFA 1WJQA 4KJOA 1KABA 1SYFA 3S9WA 4NKLA 1G5VA 4K5WA 2JTFA 5C4HA 5KYIA 4DGZA 2D9TA 1KHCA 3E5SA 4N4GA 4C5HA 4PMCA 3L42A 5CIUA 4N4HA 3QB3A 4MIUA 4K6DA 2M16A 3L2WA 4A4EA 3ITPA 2RBMA 3OYIA 2GFUA 4DF7A 3NQTA 2RHZA 3Q1JA 4S3SA 3HEJA 1A3TA 4NP5A 1EY6A 2RHUA 3R3OA 3CEYA 3MP1A 3S6WA 3OYCA 4QVZA 4RKLA 4QQGA 2PW5A 3M9QA 4ID6A 5C3XA 5CV4A 2RJDA 2EQUA 3UWNA 2BKDN 4IURA 1EY4A 4K2KA 4E6IA 2RI2A 1SSFA 4J1MA 5EKLA 4CRIA 3L2RA 5C5MA 5M9OA 2EYPA 4ZTFA 2KHSA 4EDUA 3L2UA 4YIJA 1TR5A 5C0MA 4ZTJA 2PYKA 3OYMA 5J1ZA 1EYDA 2F3VA 4X34A 5D6WA 3EJIA 2QQRA 5HURA 2L8DA 2FHDA 3D4DA 5CV9A 5KCHA 5J26A 4E7HA 2F5KA 3QJ6A 1XNIA 2NUCA 4QF4A 2F0MA 4KD4A 2EQKA 3TP5A 4IUQA 1OYXA 5IODA 4WRDA 1EYAA 2P0KA 1JOKA 5KE3A 2M1HA 2DAQA 4K5VA 3SHLA 3SK8A 3MEVA 2F0VA 3ME9A 2F0HA 3OYLA 4E7KA 4PL6A 1EY8A 4J6HA 3OYEA 3LGLA 4KHVA 2EY5A 4QW2A 4BE1A 2PZUA 3D6CA 3QBYA 2EXZA 5E3FA 4GY5A 2LKVA 3OMCA 2B8AA 2R5AA 3KUFA 4IUUA 5IOCA 4IKFA 4PNYA 5K5PA 4E7LA 2RHYA 3UT1A 2E5QA 4QB4A 4LD6A 3EVQA 3SR1A 5JOBA 4N9PA 3T13A 3OY9A 4KY6A 4A4FA 5KGUA 1EY5A 2PQWA 4K8IA 2RJFA 4IALA 1SYDA 1STHA 1WJRA 3LGFA 2R58A 5CV7A 2MWPA 4C5GA 2GF7A 3FDRA 3NP8A 4N4IA 2SNSA 2L89A 1EYCA 2PW7A 3HZXA 4KV6A 2RJCA 3F70A 2RHIA 4QQ6A 4BDYA 2F3WA 5NUCA 4B9XA 5I6YA 2F0GA 3GOXA 3S3MA 2LTOA 4A4GA 1OI1A 3OYDA 1OZ2A 4LAAA 4OVAA 5FROA 2EFIA 4PMBA 2PZTA 5KRUA 5IGGA 3PFSA 2MWOA 2M00A 1A2UA 4NMZA 5F2DA 1H3ZA 3OYBA 4ODGA 3OYKA 5CV5A 1WGSA 5IAYA 2EYHA 2LDMA 5IGBA 2RKSA 5C4ZA 3OQ5A 4E7IA 3MZ5A 2F0NA 5C6AA 1N27A 4L59A 2EYJA 2KQ3A 1WJSA 2QQSA 4B9WA 2XDPA 5KH6A 5CV6A 2ENBA 2RJEA 4OL7A 2HQXA 1U9RA 3T16A 4E7JA 1EZ6A 3DMUA 3PNWC 4N9TA 4HTHA 3SK5A 1SNPA 5IGCA 2F0LA 4ME5A 1II3A 1ENAA 4KTAA 5IN1A 5CV8A 3SXHA 2F0IA 5C3WA 2RI5A 3QOJA 3SK4A 1SYEA 2YRVA 3P8HA 3E9FA 3OMGA 1EY0A 3OYNA 2L3RA 4EQPA 3OSOA 3SK6A 1ENCA 2F0JA 3D8GA 3H8ZA 4K2LA 5J39A 4G57A 3BDLA 1JOOA 3FLGA 3LLRA 2EYOA 1SYCA 2F0TA 5C6SA 1SNOA 4IUNA 3H6ZA 5C5LA 2EKOA 2RO0A 5I9PA 3P8DA 2QDBA 1AEXA 3ZEHA 3MHBA 3MVVA 5IGDA 5J22A
chains in the Genus database with same CATH superfamily
1RCVD 1H641 1RTOA 5IGFA 3P75A 4Z02A 1R4QB 1GRIA 2RHXA 2B63G 2JS0A 5FO8B 1SMYD 1R77A 1Z47A 2B2WC 2OF1A 1Y1VH 3AU7A 1A3VA 3TCJA 1DYQA 1LJOA 4PLLA 1D1IA 1A8VA 2COWA 4FXDA 1N32L 1N32Q 1EQRA 4R8NA 3WVDB 3LWUA 4RFBA 4M77E 2MNAA 1T5EA 4DAMA 5I2XA 5FU6B 4KKTA 1LT5D 3LX0A 1K3RA 4EGVA 2VV5A 4BXXG 4M77B 2DY8A 2EY6A 2B2YA 2X4XA 1JJGA 4UY8C 3HRUA 3I56Q 4BY1H 3D7SB 3E0JA 2SRCA 3S3NA 1K83B 4DUYQ 1VIFA 5IT9E 2DZ9A 2H8HA 4F17A 1EEID 4GN3B 4CGYB 2HBWA 2DL4A 1LACA 5EJWA 3M4OH 2M0YA 5LJ5h 2FFKB 4RTVA 3C2PA 1EFID 3E3XA 5JEAH 1IW7D 3VS7A 3TQYA 5HY6A 3OS1A 3LYIA 1AOJA 4K5XA 2LRQA 3LX7A 1JB3A 1PYSB 2Q8TA 5I2SA 1AN8A 1OOTA 5BN3A 2QW7A 1YZ6A 2F0SA 1P8LA 2HIXA 3RZOH 3OYAA 1ABOA 1WXTA 1X2KA 3FJPA 2CP6A 3N5BB 4RTWA 4NW2A 1M4VA 4XTUA 4AFQC 1L1OA 1PM3A 1U1TA 3MP8A 4IFDG 1ZSZA 1R9TH 1K8AU 5D7UA 1KNAA 3HOXH 4A3FH 4EMHA 3EG0A 4K11A 4KN7C 3A8JE 3M55A 2JK8A 3GTMB 4KH1B 4KH0B 4C8QF 1PTOH 1NMGA 2PQEA 4DU9A 4RUGA 4DV4L 4TSSA 4DV4Q 1GHKA 4JBWA 1I4PA 2KVMA 2BZYA 5ELCA 2K7VA 3X26B 3KLSX 3EG3A 1SXTA 2R6GA 5M3MG 1HA6A 2KROA 5I4DA 5GQOA 4Z89A 2VB6A 3O8VA 3K7AH 4C92E 1VF5C 1QWYA 1FXXA 3EAEA 3NXWA 4C92B 3CCQQ 1SMYC 3H09A 1IB8A 4LF4L 4LF4Q 3MAQA 3ND9A 4RG2A 3QXEB 4MDXA 5EPJA 2HCCA 2KCNA 2HKQB 1O7ZA 4HJ7A 2DIGA 1VQHA 1N33L 4KBMB 1N33Q 3C4SA 3OW2P 2K1BA 1D3BB 1WTQA 2OWOA 1ML0D 2CP0A 3R6OA 3S15B 1JORA 2KE9A 2CS7A 2XDDA 3B6YA 2SEBD 3DM3A 5EC7A 4L5SA 2B63H 4DAVA 2DE0X 3L2VA 2PNHA 1IL8A 2MI6A 3HRZC 1S5DD 3U9OA 2ZPFB 1CT1D 1BI2A 2DD4A 3LWIA 1IW7C 4IPDA 2RCFA 5L23A 3M0TA 4J83A 2CYZB 3RUZA 5BR8Q 4WORA 2ROLA 2Q2IA 3S1RB 4RCOA 5CBAE 1AE3A 5FOBB 1WCMB 4DBRA 4OB3B 1VQGA 3DEPA 3PSIA 2YTYA 4BXXH 2DXTA 2QA4Q 4B3ML 1HK9A 4HVUA 3H91A 1CA5A 4B3MQ 4J5YA 4FL6A 2JZ2A 2A6ED 1JE4A 3ONAB 2D0QB 4OMQA 3N52A 5JEAJ 2KCMA 2DL8A 1Q8KA 1SN8A 3TEHB 2F0OA 1G2BA 4OWWB 2K32A 2AKWB 3ASKA 4M78A 1LTLA 3JCMc 1KHIA 4LFBL 2M51A 1NR2A 4L63B 1V1PB 3P8BB 3SHWA 3K0XA 3KF8A 1SFOH 3F2DA 1CKOA 4P5NA 2A1AA 2NVQB 5D3DA 1IHWA 4GOPB 3NMZC 3META 3QJYA 2Z1CA 4X3KA 3NWTA 4KGZB 1ACMB 4MZPA 5GAMf 3JCMJ 1CKNB 2TSSA 3TMEA 1QZGA 2NVXB 4GN5A 1B7YB 1Q82C 4P2CB 3PT9A 4J9DA 3VKIA 4HN7A 5DNFA 2RPNA 1TS5A 3WWVA 1IHZA 1ET6A 1TWAB 4GN4B 5GAMj 4GLAC 2HHHQ 2X35A 1TS3A 2OI3A 4IIMA 2I5MX 3MEFA 4LUZA 2J06A 1UE7A 3HFZB 2L5TA 3H6MA 2RA4A 4C92D 2B86A 1RLPC 3QYHB 1ZSGA 3CMET 2X4WA 2F0FA 1XWEA 2JJQA 5M3MH 3RERA 4LDVA 1GJXA 1XMQL 2E5LQ 1XMQQ 1AFPA 3PVQA 1A15A 2IPOB 4C0FA 3VUBA 3UE1A 4GKJQ 5FU6C 3LH0A 3E9GA 4F88A 1HSQA 3EBEA 3MEHA 4FNFA 2DD5A 4M77C 2MAMA 4DNIA 1H3HA 2FZKB 4II1A 4C0DB 3HTRA 4DR1Q 4WJ4A 3L1AA 2NUTB 1I3QH 2FO0A 1N8RC 1TQOA 2DNEA 5FRNA 4CBVA 1I6HH 5KCOA 3OPOA 1PH2A 2MK5A 4MHEA 4AYBG 1PRMC 2YU9H 4ZLTF 3OYJA 1OULA 3NGPA 3KK7A 3FP9A 1S5FD 2QKIC 3I8ZA 3VA5A 1MHNA 4EMKB 2BUDA 2NVTB 1W2BS 4ME3A 2A6EC 1KD1C 3S16B 3GV3A 1D0ZA 1CSKA 4XTVA 2KCTA 4JZ3A 1YNZA 2OXPA 3R2TA 1GCPA 4A3DB 5K36G 5KNCA 4A3EG 1OV3A 2AZSA 3H3VH 4XU3A 4BI8B 3BDCA 5JJKA 1IYUA 1K8OA 2ROTA 4JBMA 1B34A 1VCIA 2F03A 2JA7G 3U4VA 1SNMA 2X4YA 1KIKA 1H9SB 2EYFA 2R3ZA 3JAMi 1WYDA 3CCEA 5C0XI 1SBBB 1PH1A 3H0GG 1L2FA 4KJOA 3DEOA 1NE8A 3QZ5B 4J9CA 1HJPA 4AG1C 1SYFA 1WD0A 4APVA 4A3MG 1TG0A 3NBHB 3LW5E 2L2PA 2E2HH 2L1BA 1CKAA 1G5VA 4JI7L 4JI7Q 5ELFA 4JBKA 2DKGA 1BR9A 2CZ1B 2YRDA 5KYIA 3HG9A 4KGXB 2NBFA 4GKKL 4GKKQ 1VMPA 5T1IA 4F04B 4F7UE 5GAN7 1OX8A 1HZBA 2LQNA 3PF5A 4LFCL 3L42A 4LFCQ 4C92C 4UDUC 3MJXA 5CIUA 2CW0C 4JUVA 1WTVA 4MIUA 2VXFA 3S14B 4F7UB 2M16A 1GUNA 4DAYB 1QCBD 4IFDJ 3RNJA 1M8MA 2UUCQ 1YITQ 2HIVA 4M75D 2EDGA 4R9WA 2HCKA 3RR6A 2VVKA 5AYFA 1B3QA 3GTKB 4CC3A 1WTPA 3CCET 1E0BA 1CFMA 1AWWA 3OOCA 4M77F 2B39A 2SEMA 4XTCS 3Q1JA 4IOCA 3HEJA 3JCMW 2L12A 1VQKQ 1BNZA 4HT9A 1G3WA 3BY7A 4DBFA 4PJOE 2JOYA 1JCKB 1RTNA 1O75A 1J3TA 4YCWA 2KRSA 4D6WA 1VQJA 3M7NA 1QVCA 1FWZA 4PJOB 3FMCA 5H1SE 2YUQA 3OYCA 3M4YA 3MXUA 3IQLA 4RCBA 3TU4K 2CP7A 2MHVA 2PW5A 4ID6A 1DOKA 1KNEA 3JAML 4XU1A 3OS5A 4NL2A 2A69D 2HL3A 4HCBA 5CV4A 4A3CG 3UWNA 2ZTEA 1UDLA 2BKDN 2BTTA 2P84A 4UPAA 4IURA 1VQOA 1UJYA 2MYSA 2E5KA 3G71A 1DGSA 4K2KA 2RK1A 1DM0B 4XTZA 1SRUA 3C95A 4XTWA 2R92B 4MTKA 2V4DA 2NN6G 4CRIA 5C5MA 2UU9Q 5M9OA 2BZXA 2EYPA 4BA1I 1WI7A 4A3BB 2I07B 5GANg 1OXSC 2RVLA 1XXGA 4YIJA 3M0SA 3AFQA 4J7FA 2NN6I 3J81i 1TR5A 4ZTJA 4GOPC 4M7AE 1WTWA 2KT8A 1PKSA 5GAN6 4K0KQ 1SMXA 5K36H 1Y1WB 3M0PA 4A3EH 4HIMA 2F3VA 3GP8A 4M7AB 3RIRA 3EJIA 2DRKA 2QQRA 2L8DA 2F52A 1JMCA 2YT6A 1EL0A 5A0GA 2KXDA 1B7TA 2QEJC 3QJ6A 4HXJA 4X9DA 1YNNC 1XNIA 1B53A 1X75C 2PVOB 2E2IB 4QF4A 1CA6A 2CUBA 1ZEQX 1VQOT 3REAB 3G71T 2FRYA 2JNGA 4A3MH 2A3LA 1QVGA 1Q1BA 5EAYA 1I5OB 3H9NA 1X3FA 2K05A 4IN3A 1U1SA 2XSCA 5LMNW 3SE0A 1EYAA 1ZYRD 5C4XG 3BE3A 4BBRB 1FMVA 2GCXA 3VS5A 4B6MA 1WNLA 2QCPX 4HIOA 1VQBA 3UDGA 4HJAA 1Y69U 2FZCB 4J6YA 1BBWA 1EIHA 2F0VA 4Y28E 4R56A 2C06A 1D6EC 5ELDA 1A0NB 4C0DC 3MKDA 5I21A 3R6NA 2ICEC 5KNBA 2RA2A 3J80c 1DD2A 1WI5A 2QGQA 1J9OA 4DK3C 1OPKA 3OW2A 2AMCB 3T1HQ 1UGQB 5G3LF 1YJNQ 1QWEA 1VOMA 2EY5A 3CC4Q 1N9RA 1Y96A 2GQIA 3OSVA 4QW2A 1K8AC 1HXYD 2PZUA 3DWAA 4DUZL 2AK5A 3QBYA 3G7LA 2X51A 3KDFA 4EMKC 3OMCA 4CI0C 1S4ZA 4O1NA 4B3TL 4Y7NB 4B3TQ 2RB6A 2L0AA 4IKFA 2ZPBB 4PNYA 1K8GA 4DQ2A 1PFSA 1K1ZA 2ZM6L 2JA8B 4Y92A 2ZM6Q 3K5OA 1FYNA 2VXWA 2E5QA 3TS2A 1PA6A 1VQMQ 1NTGA 1K9MR 4CJ1B 1X2QA 1TWHH 4L6V5 1LTSD 2JQOA 3OY9A 5ELNA 2ZXRA 3OIPA 4OB2B 5EG2A 3U23A 3BZKA 4OIKA 1IL2A 2H4OA 4A3CH 4BUGA 4LF9L 4J9GA 2DMOA 3GTGH 1XNQL 3BDUA 2JTEA 1HNWQ 3PUZA 1HNWL 4X3UA 1YI2A 3VR2A 1WJRA 2YLCA 1GUTA 1KAWA 4J6WA 4DK1A 3GTOB 2R93B 4C5GA 1VQ7A 3MXNA 2KMTA 4VUBA 4N4IA 1KFZA 1W6JA 1LTID 2NN6H 4MDWA 4M7AD 3EG9A 1EYCA 3HZXA 1W1FA 3CXCS 3CQTA 2ZXOA 4IPCA 4KV6A 3LH5A 2EGEA 3F70A 4UHVA 2CGHA 3HOUG 6AT1B 1Q86U 2GGRA 3QWYA 3EGXB 5IP7G 1ZYRC 5GAN8 4P71A 1QCOA 1VQDA 5LJ5g 4JJNK 5A0DA 3UDIA 4LWCA 3K57A 4ZN3A 4NL3A 5I6YA 1I4QA 4OB0B 1QVFA 1HUNA 1FX7A 4FCYA 1ICFB 4RA8A 2LTOA 5GAN3 3I55Q 2GNCA 3BVGA 1IO6A 1EOTA 2A6HC 2L11A 1EFNA 4FW2A 1Z6HA 1U0LA 1PZJD 1M3CA 2MOXA 1I1JA 5IGGA 1PV4A 4L5RC 5KYUA 3PV0A 3X3MA 1V9PA 3E6ZX 3IFTA 1PSFA 1IREB 1VQ8Q 4PJOC 4ILWA 4LUVA 1I5FA 3J81j 2H3JA 5GMKe 3OYKA 1KJWA 2CP2A 1VQ7T 4ODGA 5CV5A 2ZPEB 5C4XH 5FWBA 1RLQC 5GMKm 3PIOA 3J7A5 4JI3Q 5EPKA 1Q3LA 2L0CA 1JQQA 3QZ9B 1VYTA 3G6JB 5KYYB 2IY5B 2RN8A 2K5VA 1W2BP 2AHJB 1GXIE 5CBEE 4E7IA 4FF4A 2F0NA 1EWHA 4A75A 1N27A 1IXRA 3CCJA 2KDSA 4DR3L 4DR3Q 3OBWA 2IX3A 2EOTA 2KQ3A 3HKZE 4JOIC 2J6KA 5DM63 3HOWG 1WJSA 2PVDB 1X3PA 2JM9A 1HZCA 1HJDA 3HKZB 4XQ3A 2A7YA 2K52A 2A8VA 2DJGC 4FF2A 3JCMb 3G4SA 1EZ6A 5JJLA 3PNWC 1PD1A 3OYYA 4L5GA 1JXOA 3URGA 1AEYA 1SNPA 2L5QA 1II3A 1PLFA 4A53A 4JRKA 2F0IA 2KRMA 4KHPL 4KHPQ 1HRJA 2CWAA 4JK1C 3P8HA 1RJTA 4M7AC 2ZXPA 3OMGA 3OYNA 1PRTB 1RODA 3NHNA 2J7ZA 2KECA 4A3DH 3UA6A 1BUVT 1LO5D 2CQOA 2HSEB 4KHZA 1IBML 1GKHA 1IBMQ 3INZA 4F7UF 1YCSB 4M7DF 3TN2A 1Y7XA 1Q81U 2RF4A 5CAIA 1HQRD 3BDLA 3CMAA 1NEGA 4P74A 3CCJT 1Q90A 1PYWD 5EBCA 4HVWA 4C8QG 3LLRA 4X6AH 1HR0L 2CUDA 1Z7TA 2K5FA 3NENA 3GPLA 1ENFA 2G5DA 1ARKA 3BVZA 2EKOA 2RO0A 2KQWA 4XAXB 3G4ST 2DBMA 1QVGS 1PG5B 4KN4C 2QDBA 2VUBA 1Q82R 3H15A 1Y71A 4GBQA 1RD9D 3MHBA 4IFDI 2NZHA 2ID0A 5IP7H 1RAAB 2DL5A 1FL0A 3PIP3 2X3XD 1Y8PB 4PJOF 3KUPA 1U06A 4Y52H 2OTJA 1E1TA 4OIJA 4TRDA 2NYZD 2ECZA 2RDGA 3D6WA 4GLKA 5GJVB 3RD4A 2E2DC 1TH7A 1XJWB 2E70A 2RM4A 3A1PA 3HP9A 5CKFA 1VQLA 1FR3A 4DKAC 1WTRA 3CMAT 2OQKA 2F1MA 2LCLA 2DIQA 2LP5A 2CFMA 3P20A 1FYCA 2XHCA 2Z6KC 3D4RA 3AB9A 4D8KA 1JB0E 2EQJA 4L6TB 2K57A 1DOMA 3RZDB 4K6LA 1Q46A 1HPCA 4R1JA 3I4MH 4DA4A 1I81A 2EJMA 1UB4A 4JJBA 2KEEA 5AJ3Q 2P0QA 2A68D 2PNRC 2E4HA 1T3SA 1Y57A 1NCVA 1TU2B 5GROA 5T1GA 1UHFA 4KJNA 3V8LA 3OWEB 3PMFA 3OTOL 2E8GA 2QK0A 4O42A 2KEAA 2RMOA 5CVIA 5FK9C 1K9AA 3JB9H 3D0FA 2DBKA 1SYGA 2DL7A 1ILPA 3TP8A 2OTJT 1U5SA 1WX6A 4J9HA 1TY0A 3HOWH 1WQWA 3BDOA 3J7AF 5C4JB 3MC0B 2BIVA 3Q0AA 1MV3A 3J81c 1UEAB 5L37A 3OYHA 2CT4A 1N8RU 2WAQG 2IW3A 4QQBX 1R8OB 1M2OA 2RQRA 1I4HA 4ZK9B 4A3KB 1D8LA 1VQLT 2VWFA 4XYQA 1WA7A 1NR4A 4CDCC 2A73B 2L3QA 1SSHA 2VYTA 3JB9D 1GXDC 3W1GA 5I2YA 1U4PA 5CGKA 2D8JA 1FNWA 3G1JA 2G3RA 3GD7A 1AW7A 4C5IA 1KD1U 2B29A 1GFCA 3HOVG 4FW1A 1NEBA 4R8IA 3T53B 3CW2C 2O4XA 5JPNC 1L1OB 1G2TA 2OT2A 1RL2A 3GNFB 5LJ5d 3URYA 1K0SA 4C3IH 4EQNA 1ZSZB 2ZJQA 1H92A 2HUGA 4R4IA 4U68A 1GUWA 4DEXA 3CCUT 4PFZA 3FEOA 4LUOA 1SNDA 3IRBA 4R4OA 1QVFS 5GAOp 3GNGA 1Q8IA 3HHTB 1WVLA 4LUEA 4MMLA 3QDFA 1TWGH 1NSNS 3NHHA 4ZYSA 2VQFL 1G2SA 5GANh 3N6RA 4JYAQ 2QXFA 4XQJA 3JCMX 1WHGA 4DR7L 4DR7Q 3V8JA 2VGMA 4K8JA 2O88A 4C2MB 1GM5A 2NZ1D 2DK3A 2K5IA 1TT2A 5JJIA 2K3YA 3ZFJA 1UE6A 3EA6A 3CC2A 4A3GG 1UJ0A 1STEA 2MCNA 4ZGEB 1BCPC 5KIXA 2DM1A 1Y1VB 3HL8A 1OO9B 4PZ8A 4JI5L 2NWGA 3OA6A 4JI5Q 1OX9A 2E65A 3JCMQ 1U3OA 3GO5A 4O6JA 1QQJA 2K04A 3VYTA 2F2XA 1RKNA 3VUZA 3OB9A 2CH4A 1JT8A 3NE5B 3CQZH 2ZCFB 4IUPA 2EBPA 4NS5A 2LJ1A 5CYUA 3M3YB 2YUOA 1AE2A 4DFAA 1E2VA 4N0AC 2VUMG 1TY2A 2IG0A 2RNAA 1UTIA 4JS5A 3I4NG 3M4OB 3T51B 5LJ5e 3CC7Q 2QDLA 1PRTC 3A98A 3CRKC 1IYVA 4KY5A 4JVZA 1E6GA 3JB9J 4OEMB 1SPKA 2JS2A 3CXCP 1JICA 3UDFA 1B9MA 1BB9A 5IYBG 2RI3A 2R57A 3CC2T 2LS01 4FU6A 2MFIA 3RZOB 3T4AC 2DY7A 1E2WA 4KD3A 2LMJA 3DLLA 1LT3D 4JV5L 3I91A 1S1NA 1TIID 2MUYA 3HP3A 3ULPA 2EVRA 4BE2A 3S3OA 2WSFE 4NXML 1CZWA 3GTQH 1R9TB 4GNXC 2AQ3B 4DBHA 4KGVB 2EYLA 3EQLC 4A3FB 5GAN2 3HOXB 1FVIA 1SRLA 2NYSA 1VMCA 3MEWA 5EGTA 4M78B 5LJ3g 2DXUA 4E7SA 1I50H 2CQAA 3TRZA 2ZPIB 4C8QA 1NJIR 2K3BA 1VQEA 2EJGC 4H13C 1SAPA 2PU9B 1EZ8A 3D4WA 3QOLA 2JA5G 1VQPA 5ISRA 2V1QA 3H0HA 1YHBA 2M9VA 3M0QA 4P72A 5JVG3 1KSWA 2DUDA 3WXMB 2R7ZG 1UECA 5DM7R 1X3EA 5LL6X 3EIVA 4QMGA 1WD1A 1UE9A 1AVZC 1QCNA 5GMKj 2EE1A 3E9IA 5KNDA 1QKXA 3K7AB 3HOVH 3PMTA 5COYA 3VU3C 2EQMA 1YIJA 3CD6A 2D0NA 2AUJD 2PI2A 1F2LA 2EAYA 1EOVA 1FGBD 1T9HA 3OWFA 1VQIA 1WTXA 1QNUA 5LMNL 4PK4A 5LMNQ 2I5LX 1ZHIA 1HQMC 3DB4A 5DLOA 3MEAA 4M77G 2EGCA 2X4JA 2GQVA 1BCPF 2JA9A 4J9IA 2NLUA 4I7AA 1O9SA 3I4LA 3BZDB 2DVJA 3G6EA 2B2WA 5CR3A 3QIIA 1X6GA 5KEEA 3C0CA 1EY7A 3MFGA 3EGDB 4K14A 3TP6A 4HSVA 1W2BA 1N5ZA 3HOZG 4HEDA 3TZUA 4A3IH 3CCEQ 3QIAA 2VC8A 1ONLA 2WP8J 4MNOA 4YTLA 1Q86C 2L9HA 2DNUA 3W5OA 4XQNA 4A3GH 1VQPT 1F2ZA 1C1AA 4DXFA 5JPMC 2B2YC 2B63B 4BBSG 5CC4A 2A28A 1TWFH 3RESA 1PRTF 4RGOS 1CHQD 2EZVA 3A0JA 1X6BA 2A36A 2YLBA 2ZPGB 2XGTA 1IGUA 1YIJT 3CD6T 2AKKA 1EQVA 1PH6A 2UUAQ 1HTLD 2D1XA 1X43A 2UUAL 1RHPA 2F0EA 2QEXA 2PZWA 3TSSA 4CC7A 1X3GA 2LVMA 2Q8RE 2K9GA 2LCCA 1VQ5T 2JXMB 2O5IC 5CKEA 3G6ET 1PWTA 3FRNA 2ABLA 2FHTA 4AMCA 1O7IA 1IRXA 2X6LA 3I90A 1S3OA 4HSPA 3S9WA 4WJ3M 1GD7A 1LABA 1Y07A 1SJHD 4NKLA 4ME7A 3VYGA 5FLXc 3ER0A 3I4NH 3PO2H 1Y8OB 1O78A 1I4RA 3SDZA 3S1MH 1B34B 1TWBA 1ZSZC 2HDAA 1VQ6A 3CP0A 4MZMA 3NBIA 1SFOB 1BF4A 4LF5L 1IBLL 1QVGP 3ERSX 3UDCA 1KHCA 4ZN1A 3M7GA 1IBLQ 4N4GA 1D5ZC 3SEBA 1CZGA 4M78D 2KHIA 4PMCA 3SGIA 2CH4W 2Y4XA 1PTOD 4N4HA 1B4OA 1WJJA 2F5TX 5GMKl 2VXEA 2ICIA 1UWVA 4K6DA 4JI6Q 1LLRD 2KVQG 4JW0A 4BI3A 3HFOA 2RSNA 2RBMA 4RGNA 4DR5L 2YUPA 2QEXT 1MI2A 1W3SA 5M5WH 4OB1B 3J80i 1VQNA 2GA4B 4DF7A 2JA5H 5M5XH 1VQOQ 5L8RE 2GTJA 1C8CA 1X9NA 4S3SA 2JT4A 8ATCB 2R7ZH 1K73U 1U4RA 2JN4A 3ND8A 2RHUA 4F87A 1VQ6T 1M4ZA 4C3JB 1Q81C 2QASA 1B44D 2WKDA 2XRSD 4QUFA 4OX9L 4FO2A 4QQGA 1LYLA 2JXBA 1UNSA 2RSOA 3DXJC 1M2VB 5C44G 1I6HB 2QAZA 4OMNA 5C3XA 2RJDA 2EQUA 8AT1B 2DYBA 1QUQA 2LXJA 3BYYB 2NWMA 1HXDA 4KUIA 3O5ZA 3HOZH 4J1MA 1PMRA 3CMEA 1D1CA 1VQNT 3RR5A 5HKCA 5LMUL 5LMUQ 1LM0A 1X32A 2UXDL 1IKMA 4LFBQ 4IPGA 1YHQA 1HR0W 4B3RL 2ATWA 4B3RQ 1QMCA 4BBSH 3E2UA 4OP0A 3HRTA 2MJ8A 1FD7D 5BN4A 1G8ZD 2VQEL 2VQEQ 1KLGD 2D2CC 2EJFC 1CKMA 1EYDA 1KTKA 4UAIA 4OMMA 4RMFA 3I73A 4DN4M 2V26A 2FEIA 4M78C 5D6WA 3HOYG 4IIOA 3RKWA 2FHDA 1AZEA 2J6FA 3CPWA 3J80L 1EU3A 3FPPA 4EQ5A 5KCHA 1T0HA 5J26A 1OPLA 2F5KA 4Z8AA 1CQVA 2BA1A 1I4GA 2VB2X 2E2HB 2NUCA 4M75E 1QVFP 5I22A 4FYVB 3M5AA 2XVSA 3KFVA 5GAN5 1MKHA 2EQKA 2AKLA 4M75B 1IHVA 1WFQA 3S1QH 3LWEA 5IODA 2F4VQ 2F4VL 3M0RA 2BOSA 1YHAA 2C0IA 2P0KA 2RQTA 1JOKA 1JJCB 4PG3A 1WIEA 5TSSA 1EWIA 3NELA 1NG2A 3KYHC 1YHQT 2K03A 4YWMA 1EIGA 2V8IA 1S5ED 1C9OA 4E7KA 4QVDA 1BQQT 2LT1A 1BBZA 1UGPB 3DWPA 4KHVA 4LE9A 1GCQC 2YYZA 1QB5D 4A3JG 4M77A 4BE1A 1MIUA 5LJ5f 3S15H 4FYXB 1M8AA 2Y0SE 2B8AA 3V7SA 1WHHA 5IOCA 4IUUA 1WHLA 1EFWA 5C3EB 3ZL7C 1M30A 4OMOA 1YI2Q 1M1KC 2FPEA 4E7LA 2A5HA 2RHYA 3UT1A 2Y0SB 1BI1A 2JMCA 1G51A 1PFMA 1V1OA 5IT9c 5C0XG 3TQ7P 1TWCH 1G291 5HK3A 5JOBA 3KDFB 4FXKC 4X1VA 4N9PA 4POGA 4WCIA 4RGTA 3OIQA 3VRYA 4AYBE 5C44H 1VF7A 4PV1C 1EY5A 4BWGB 1BXTA 2XI9A 3K7UC 1YJ9A 1AP0A 4AYBB 3CXCA 2CREA 2I46A 4IALA 1VYUA 1SSOA 1I8FA 1EIFA 1STHA 3VJPA 5AFWA 3LGFA 1Q1EA 5CV7A 5D3IB 1PNJA 2MWPA 3I2ZA 3RDVA 2LMCB 5ELOA 2SNSA 3MPUB 2V8JA 3HFNA 2CWPA 4F7UG 2DEUA 3I56A 3GIBA 4M7DG 4RGMA 1MBYA 1TS9A 2MIOA 2ZPHB 3JCMg 2EPDA 1C4QA 2X6GA 2EWNA 2PCFB 1ET9A 4BDYA 1Q7YR 2R61A 4LW1A 1KLUD 4E7ZA 3BFMA 2ZGWA 5KYNA 4CKBA 3VDYA 2NVXH 3ICEA 2D5DA 3BVMA 2F3WA 4B9XA 3STBD 2K28A 3J7AV 3HOYH 3GOXA 1PFNA 2LJ0A 4G7HC 4JRPA 4A3MB 2E6ZA 4AIMA 1OZ2A 1X69A 2EFIA 3A5ZB 1UE1A 5FO9B 1YJ9T 3I3CA 2OAUA 2PQAA 4C56C 3PCOB 3PFSA 4PJOG 2KJXA 4UP9A 2BE7D 2F1LA 1G8XA 2HZYA 2D62A 3A7AB 2AIRB 1M5Q1 3REBB 1BI3A 4LDXA 5F2DA 3BS1A 3OYBA 3G4SQ 5GAOl 2ES2A 2YDLA 2UUBL 2UUBQ 1WGSA 4AFSC 2EYHA 3QR8A 1AHJB 3EFOA 2F2WA 3I56T 1G3TA 3A8MB 4QKUA 1AZPA 3Q23A 3VS4A 3ZYYX 2I2LA 2CP3A 3BJUA 1AZGB 5KYUB 1MGSA 1MMNA 3RKXA 2J4XA 5HK0A 5LJ3h 4L59A 2EYJA 2DO3A 4JCVE 4DR4L 4A3JH 4DR4Q 5JVH3 1JRIA 1SHGA 3C46A 4A3BG 4DV6L 4L8JA 4DV6Q 1PH3A 2J0TD 2C35B 3CCRA 3CCQA 2O2LD 3T16A 3VV0A 3ULJA 2OQ0A 5IYDG 2HT1A 4XK8E 2IT1A 3HKSA 3V05A 4HTHA 3SK5A 3VYHB 1Y1WG 1CM9A 2M02A 1QWFA 4ME5A 1M8VA 1ENAA 4H02A 5IN1A 1KC8U 1TVXA 3SXHA 5C3WA 1A6XA 1TWHB 3VYRA 1KQSA 3QUIA 1E7OA 5C0XH 1EY0A 3GTGB 2JA7H 2L3RA 3JAME 4EQPA 2Q2HA 2D6FA 1PZID 3SK6A 3OSSC 3RNUA 3M53A 4M4ZA 3LGJA 3D8GA 4JPBW 3CBMA 2I0NA 4C92F 3H0GH 5IE8A 3A5UA 1LTAD 4K2LA 2EYQA 2B2VA 1HFGA 4G57A 2HMAA 4JJDA 4AQYL 5M3FG 4AQYQ 2OTJQ 1F9QA 4M75C 2D0OA 3STBC 3PF4A 5J3BA 4FT4A 3CPWS 1UUPA 1VIEA 3JV3A 2EYOA 4DV3L 3TSWA 1W6XA 1TS2A 4DV3Q 1BIBA 2F0TA 2P4RA 4IUNA 3H6ZA 3CCQT 3CCRT 1YFNA 2DERA 5EPLA 3U4ZA 4CDFC 3K5NA 5C5LA 1XPOA 1XNRL 1XNRQ 4QUCA 1M90R 2EVBA 5IHIA 1IXDA 3GF5A 3MTSA 4RG1A 4B3SL 1WXBA 4B3SQ 2LCSA 2X69A 3PO3G 2HKNA 4LUDA 2O31A 2YTVA 3KJPA 1G83A 2DYIA 4RKBA 2P4TA 1F77A 2A69C 4DUZQ 3CCMA 2WIIB 2NUTA 1F2YA 2Z8LA 1JOQA 2JTMA 4HJ5A 1QOHA 1F2MA 2KBNA 3GP7A 1MJCA 3QSUA 1K0XA 5D65A 1S5CD 3VRZA 4MTNA 3J81L 3GV6A 5C4XB 4H44C 4CJ2C 1EZZB 4EMKA 2KXCA 2K4KA 1A62A 1STYA 2Y4YA 2E1HA 1ZUKA 3QG1A 2CKKA 3CPFA 3M4GA 2EW3A 4XYOA 2DILA 4L5QA 4BS9A 2QA4T 1IYJB 3NK9A 4EQOA 1NYGA 5IGEA 3L2QA 4JS4A 1TS4A 2E76C 2WB1E 4ZUIA 2KRNA 4LF9Q 4D8DA 1LCKA 2IL8A 2EYYA 2K01A 1XNQQ 3GTLH 2OX7A 3MHXA 1H9SA 3KBXA 4QIWE 2R93G 2KY9A 2F0UA 5GAMg 2WB1B 2LNHB 4ZQ3A 1LT6D 2IPKD 3S2HH 3PUVA 4QIWB 3DLMA 3CCLQ 4RG8A 1BK2A 3CCMT 1PYBA 3NBHA 3UATA 1G6ZA 1QG7A 1V1CA 3PTAA 1FNUA 3W3AA 3Q22A 5IYDH 2ZAEA 3E1SA 1KQ1A 2CVRA 4YHHL 5C0XJ 4YHHQ 2FPFA 3J81E 4YCVA 2NTTA 4M75F 1K73C 1O7YA 1C6VX 3OYFA 4WFN3 1STNA 1KDBA 1DXMA 3QPHA 2KT1A 1JJ2A 1UAPA 3U50C 4FIBA 5DEHA 3U9SA 1YP5A 4C3HB 2MQHA 3OBYA 2WKCA 5HGQA 4NDXA 1WHKA 2WINB 1STAA 4F7UA 3BW1A 4M7DA 3WOEA 2VB3X 3VA7A 3GLXA 4DAYA 3BU2A 5I6WA 4LXCA 1FJGL 1FJGQ 3CC2Q 1K9MU 5HCKA 2K5HA 4DXGA 2MO0A 4I65A 1HFNA 1BU1A 2DXBA 2XDBA 1BOSA 2LNVA 1K28A 4ANJA 4KMUC 2HDMA 5E1FA 5M3FH 1XTDA 1LPLA 4MZTA 5FJ8G 3GTPH 1OXXK 1XQHA 1AD5A 1VQ4A 2N88A 2N49A 1T0JA 2O4XB 3NQIA 3V2TA 3SWNA 1HZAA 4C1NK 1S72Q 4EPCA 4PJOA 1JWUD 2BZ8A 5D6YA 2FZGB 4DNTB 3PO3H 5A35A 5GAN4 1KQ2A 1OU8A 1YVCA 3GTJH 2DF6A 1ZUYA 1N9WA 4CDDC 1N36L 1GO3E 1ZA1B 1QCFA 4ULLA 1E7ZA 3I35A 4BACA 1NUCA 3TEEA 3ERQA 1GHJA 4JOIA 5EKKA 4A4HA 5DAUA 3EH1A 4H7BA 3I4MB 4A4IA 1O7LA 2VS1A 2NUPA 2YRCA 5GANd 1ABQA 3DUZA 1VQ4T 1DZ1A 2EY1A 1SNQA 1HD3A 2F0DA 1OQKA 4N8X1 2F0WA 2ED1A 1VQKA 1NAPA 4CC2A 4C1NI 3X28B 1PXUA 4JLIA 5I2MA 2ZTDA 1KQSS 4HVVA 4IZ8A 2COYA 5FU7B 1IKLA 3HOWB 1STGA 1VUBA 4DK6C 4PNOA 2R93H 1BO0A 3A8LB 3A54A 4V0BA 3V96A 2H3EB 2XICA 3CD6Q 1CSPA 4FVMA 4BD3A 1HR0Q 5D6XA 2VY3A 2DETA 2CT3A 1BIAA 4PZ6A 4LJZC 3NPFA 1SNCA 3HOUH 4BY7G 1VDZA 4QT7A 2B2UC 4G7ZC 3VS2A 1SE3A 3G6EQ 2WACA 4H0LC 2NVYH 2F0KA 3RN5A 2K5LA 4HCEA 3L7ZC 3VYUA 3FKIG 2X3WD 4Q5WA 4C3IB 3TP7A 3KJOA 1G3SA 4XT3B 2Z9HA 3NUCA 3EGUA 1JWSD 1HA5A 1TTHB 1VQKT 4PLIA 2EY2A 5M5YH 5KYXB 3BYTB 2JA6G 2E6NA 2CZ0B 3EG2A 1T3LA 4EVOA 4J6XA 3K58A 1LT4D 2CP5A 4FF1A 4Z88A 2GTOA 1TWGB 4ORZA 1BBUA 3DHQA 4LF6L 4PMWA 4LF6Q 5GANe 2ALYB 2Z4IA 3GDEA 1KRTA 2E3IA 3S2DH 2EKHA 2Y90A 2XK0A 3MO8A 5FRMA 1STBA 1SKUB 3F8TA 5FKAC 2HD3A 3W2DA 2O01E 4HA8A 1NLPC 5IY0A 1PKTA 2WSCE 1MMAA 2LQKA 2QEXQ 2W0ZA 1YJWA 3JC66 4KY7A 2CZ7B 1N8RR 3JCMh 4HCSA 2HDLA 3K81C 3U58A 1H8KA 1V43A 1E2ZA 3ZJYC 3A56A 5JAVA 2BE9B 2XIWA 1V1QA 3CCUA 1OZ3A 3OTOQ 5GMKi 2JEAI 4CC4B 2A74C 3Q8DA 3FIFA 4FYYB 4M7AF 4JG2A 3FHWA 4DA2A 1KD1R 1HNZL 2QG9B 1HNZQ 3NFCA 5BN5A 3CQZB 3P1HA 4A3KG 3EHRA 1PVOA 2Q8IB 1FMWA 4A3LG 4YWLA 2XU8A 2KENA 1CQFA 3M4PA 2IX1A 4HAEA 3RMSA 1E22A 4JRQA 3D3RA 4A93G 1JB7A 1YBYA 2HQHA 3R93A 4JI8L 4JI8Q 3CBPA 4FYDA 1YJNA 4HMJA 2J05A 1UFFA 1RUWA 5CR2A 3CC4A 1WJQA 4BI4A 3L2PA 4GZYC 2LJ3A 1QP2A 2R7DA 4EMGA 2QILA 4PJMA 3CPWP 3E9HA 2E2JH 3S1NH 1M1KU 1YJWT 2M2LA 2AUKA 2K50A 4RTYA 1OXUA 2JTFA 3OHXC 2TMPA 5C4HA 1E6HA 3I72A 4DV1L 4DV1Q 1JJ2S 2D9TA 3E5SA 1WLPB 2WAQE 1X54A 3GTQB 2E74C 3FRPB 4OHJA 3EFSA 1GFDA 1DOLA 4DNRB 2PPBC 2IIMA 1WHMA 4HCCA 1XTCD 2JM8A 4C0GA 2AWNA 2SDFA 2WAQB 1AWXA 5LHY1 4KUDK 3MXGA 2EGAA 1I50B 2VQFQ 4A4EA 1G6PA 2ESWA 2EYXA 2PZ1A 2E10A 2GVAA 3PUYA 2UXCL 2UXCQ 3OYIA 4DV0L 4DV0Q 2LX9A 4BY7H 1SJED 5D14A 2MO1A 1KC8C 1PZKD 3NQTA 1YJNT 2W10A 1MUZA 3SEMA 3CC4T 4FDBA 1SROA 4ESRA 4JI2L 3AEVA 4C8QD 1Y8NB 2VZAA 2RHSB 3HOVB 2DVEA 1JEGA 4E6RA 2PMZE 2GN5A 2A68C 1NNXA 3FKIH 4QJFA 3CMEQ 1A3TA 2AWOA 3NPPA 4NP5A 2M9UA 1EY6A 4P73A 1UEBA 2PMZB 3L3OC 1LVKA 4DV5L 3FJ5A 1KL9A 1X3QA 2B2TA 3H94A 2JA6H 1PFBA 4QVCA 3UI2A 3CEYA 4N8FA 3MP1A 3QWNA 4Q5VA 2NTSA 5GAOq 1EQQA 5IHKA 3M9QA 3KLRA 4BY1B 2RQWA 2IWHA 3RZDH 3CU7A 4R4QA 3M85A 1LTRD 4A3IB 1XMOL 1XMOQ 5JEAG 4X62L 4X62Q 1W70A 4O2DA 4E6IA 2RI2A 1HUMA 1XX8A 2N3SA 1QNKA 4LF7L 4A3GB 4N0AA 3VS6A 3KOJA 4RCNA 4RTUA 2DJFC 4LDUA 2ZTCA 1JO8A 1BDOA 5FU7C 2D8HA 3X24B 3DWQA 2KHSA 2LZ6B 2K2VA 5IH2A 1GVPA 2GBQA 2BA0A 3A8KE 2K75A 1QUQB 1D2BA 4HR7B 3E0EA 2JJ9A 3PUXA 4JV5Q 1LNXA 5C0MA 4A3FG 5J1ZA 3OYMA 4M78E 4AH6A 4A3LH 4I7ZC 3PQIA 1XJVA 1TXQA 4PKCC 2RH2A 4A93H 2IX0A 4LF8L 3PIO3 4LF8Q 5FW9A 1B8AA 1K8MA 3D4DA 5CV9A 3QWXX 1PTOB 4R4TA 3KF8B 3I4NB 3TVTA 4GLMA 4WF2A 4E7HA 2RK2A 4M8AA 4GNXA 2P0PA 2CSIA 3PO2B 2EYZA 4X64L 4X64Q 3SB2A 1D1BA 4DOVA 1IZ6A 2R7FA 3TP5A 3G48A 2CCZA 4WRDA 5I11A 1OEBA 2YSQA 3F2CA 5KE3A 1J5EQ 2BDOA 1J6QA 2M1HA 4XXEA 4HKEA 5GAMh 1D0YA 4K5VA 3SHLA 5IT9L 1VQ5A 2LSSA 1EX4A 1R0CB 1CI3M 2OAWA 1PHTA 2V1RA 1RABB 3OYLA 2AQ1B 2F0HA 2MGSA 3ULLA 5M5WB 2XWJB 2DEQA 3R8BA 1LTTD 1N6AA 3I4OA 1VQAA 4C2MH 4LNQA 1BKBA 3H0IA 4C0ZA 1I6VC 4ZRZA 5M5XB 2JA5B 1X01A 4FP5D 4DK0A 1PCXA 1JWMD 3K59A 3S17H 1K8AR 2VW9A 2LY7A 2EXZA 2R7ZB 4GY5A 1YJ9Q 2JSOA 2R5AA 1PH8A 4OELB 3I9QA 3C12A 2XIDA 2QQBA 2EXDA 1R0BG 3NSWA 4J8OA 1BYMA 2KOLA 1NJIU 3VR6A 4ZKCB 4TKOB 3FB9A 4LD6A 3A8GB 1K9MC 5IP9G 4A63B 4R55A 3JB9F 4ZGDB 3M3YH 1XYIA 1JQYD 2A19A 4DUYL 1S5BD 4RCCA 1NLOC 1IGQA 3T13A 1KQSP 2HSPA 3VS3A 1GOZA 2G6FX 4JI4L 1GBQA 3CBOA 2L3PA 4JI4Q 4V190 3HOZB 2VUMH 2C5CA 1BI0A 2EJ9A 5IHNA 5CK9A 2KAFA 2LX7A 4RHRA 2NUZA 1VS0A 4ABNA 1RI9A 1MD2D 1L1OC 1MNEA 2R58A 4OGQC 2FB7A 2Z6BA 4BBSB 3R2IA 3NP8A 1Y14B 2Q2UA 1P16A 2DL3A 1K3BC 2FMMA 5IYBH 4C92G 1RAFB 1WXUA 2XN9C 2RJCA 1D1KA 1MSHA 4JI1L 1WQ7A 2QTVA 4ZGJB 4JI1Q 2BH2A 2RHIA 1C0MA 3H0FA 1Q12A 1K73R 2Q2TA 5GANf 1NYFA 1I94L 1I94Q 5KYWA 4MMKA 1I4K1 3WOFA 1VQ9A 1H9RA 1D09B 2Z0SA 3K0YA 5NUCA 5GAGC 2LT4A 4DR5Q 2F0GA 1QILA 2QYZA 2RQUA 4XQQA 4LMQD 4RWSC 3X3NA 5GANj 4A76A 4A4GA 4XTXA 1HCZA 4FXGC 3G71Q 4LAAA 4OVAA 3M4QA 3S1QB 4HJ8A 2PZTA 1M1FA 5M3MB 1PH7A 4IO9A 4PJJA 1I07A 1VQFA 2M00A 1SLJA 4OONA 4C3JG 2E41A 4MZ9A 3CCRQ 2WFWA 4NMZA 1MMDA 4ALPA 2CKZB 1AT1B 1QVPA 4LF5Q 1ASYA 1C0AA 1M9SA 2OTLA 4FYWB 4CJ0B 3KF6A 1WCMG 4OX9Q 1RACB 2HCIA 3HGBA 2LDMA 1I3QB 3E19A 2VL6A 5C4ZA 3OQ5A 1WZOA 1K83H 2PQAB 1AWJA 1RF2D 3MZ5A 2YU9B 2DRMA 3CCVA 4MN3A 2KK4A 4R0KA 1B9NA 4PFOA 3C94A 1L0XB 1VQ9T 1D5XC 4X66L 4X66Q 1RAGB 1MHWC 2AT1B 3KLWA 4JRIA 4M77D 3EFOB 2K33A 1KIXA 2VASA 1JBMA 2HQXA 1U9RA 1W6KA 3M57A 2UXDQ 1GBRA 3DMUA 3CCSA 4N9TA 2JE6I 1D0XA 2F2VA 4KRTA 2JP1A 4YCUA 1U4LA 4DPGA 5IGCA 5BR8L 1TWCB 2F0LA 2KR3A 5FLMG 3H3VI 2D0PA 4NXMQ 1M1GA 4DOWA 4DAPA 1AZQA 1O80A 3QOJA 3SK4A 1SYEA 1RAIB 5IP9H 1U4MA 1RIPA 2FMCA 2LFNA 5C44B 2N8NA 2OTLT 1OTCA 1NY4A 1PTOC 3GTMH 1JJ2P 2EJFA 3O13A 1N9SA 3X25B 2F0JA 3J7YW 4FSSA 4Z9CB 4M75G 3T1YL 3T1YQ 1IBKL 1MNDA 2LQWA 1IBKQ 5LJ3d 1NPRA 4GS3A 3CCVT 2EQIA 4OGCA 1ICWA 2KEDA 3CCMQ 1SNOA 1VA7A 4XU0A 3RMQA 1EUJA 2YTXA 1ZLMA 3CCST 5I9PA 5IWAL 5IWAQ 4J9BA 1W4SA 2PUKB 4A54A 5IYCG 2HHHL 3HOYB 3EH2A 1NMFA 2F69A 1SRMA 3T56B 2ENMA 3QKJA 3X20B 1R4PB 3J80E 3L9AX 1KRSA 3EGDA 2CW0D 1Z9ZA 5C3EG 2FYKA 2Y0SG 3CRLC 4KKSA 2IHEA 1SR3A 1I4XA 2K5NA 2M0OA 4LDYA 2E5LL 2K79A 3PMIA 4POFA 1GCQA 5FWCA 1QW1A 1CK1A 1EU4A 3NTIA 4GKJL 3GBQA 1MGQA 4ZUJA 5LJ5j 1H9KA 4C3JH 1VQ7Q 2AZVA 1S40A 1RI0A 2RF0A 4HCZA 4OXPA 3AT1B 5GAOr 1Y96B 4M1UB 1DJRD 4DR1L 2K14A 1A3UA 1X65A 3S1RH 2N78A 1LTBD 2I0QA 3CC7A 1RAHB 1WCMH 2J7IA 2EIFA 5LJ3e 4ELYC 2XD0A 3EROA 3RLNA 4XIGS 1DONA 4F8MA 2HQEA 1WOCA 2QF7A 5I9OA 4DR2L 4A3JB 2EQSA 1ZXTA 3MXPA 4DR2Q 5G3LD 2QQ9A 4E2FB 1MV0B 4R4CA 2B8GA 3C1FA 4M78F 2L15A 1PTOF 2NZOA 2KSSA 4GLXA 1FGUA 2XMFA 2KYMA 2F4IA 4L5TA 2VGNA 2A08A 3M0UA 1GUOA 5KE2A 1KAAA 1ZKOA 2NVQH 5JJZA 4A3EB 3IFDA 2VNUD 3CHBD 3VYSA 4E47A 5FLMH 4RH6A 4BDZA 1V76A 5CCAA 1NBWA 2QGFB 3QDRB 2DTIA 3ZBDA 1VQ4Q 3M54A 2JA7B 2QI2A 1LV9A 2RD1A 3FVQA 3OYGA 1D1AA 1E1OA 2K3XA 3MXNB 3H0GB 4C92A 1TWAH 4LNPA 2PTKA 1WFWA 3CC7T 3EG9B 1XOVA 3VS1A 3MEUA 3NWSA 5ELEA 1X6OA 1BBXC 3TZDA 1KDAA 3NTHA 3HRSA 3WVEB 3RKYA 3DB3A 3CCJQ 4NB3A 2ASBA 1KK7A 1UG1A 2OEOA 1U8RA 4QQDA 4M7DE 2BH8A 2QTXA 1B70B 1D3BA 4A4KA 5DY9A 1LTGD 4LFAL 4LFAQ 1P92A 1UGSB 4M7DB 4CHTB 1YNND 2UUCL 2IVWA 1MSGA 4QL5A 4DR6L 2A0FB 2A37A 1RDPD 2SOBA 4DR6Q 4RTZA 2FL7A 5IIFA 5GJWB 2RCNA 3UPUA 1KC8R 2YXYA 3V7RA 2YV5A 3EFXD 3ULRB 5IYCH 1PH4A 2IHFA 4F16A 2R92G 2YHTA 1M2VA 1EWCA 4JC0A 1VYVA 1XPRA 3SWNB 1Q7YU 2NVTH 5C3EH 1BVSA 1U5KA 4RTTA 2K5QA 3S16H 1MJEA 1M27C 3CMAQ 3I5SA 3H3VC 4FM4B 5KYLA 3KLSA 3MWYW 2R5MA 2HNIA 2EYMA 4JI3L 4EX5A 1PHJA 1UHCA 3D31A 4M7AG 2AHOB 2SNMA 4WJWA 3UF4A 3SD4A 1JU5C 3HSBA 3PIPA 1V1PA 3BZCA 2CHBD 1NM7A 4C5EA 4J15A 4PQXA 4TVAB 5FO7B 5GAHC 1G91A 1H95A 3W1BA 3GTLB 4GOPA 3HPWA 2CDTA 1CKNA 2HBPA 2VKNA 2XKOC 2FG0A 5CKDA 1SEBD 7AT1B 2UU9L 2RHQB 1K76A 1WDXA 3S2HB 1YCYA 3A8OB 1PSEA 4DV2L 4BE0A 3OS2A 1ILQA 4DV2Q 4X3TA 2E64A 2NUPB 4BBRG 4RHSA 3NEMA 3VR4A 3AQQA 1PDQA 1V8QA 4K0KL 1ESFA 1BCMA 2XG8D 4NXNL 1Y0MA 4IJHA 4NXNQ 1VQLQ 1CTMA 4M75A 4J8QA 3FC3A 2QA4A 3S14H 2B2VC 1CHPD 3CKIB 4HJ9A 1NJIC 4HIKA 1SYBA 5CQXA 1WTOA 4X3SA 2E12A 1ESRA 1M3BA 2GFAA 1YJWQ 1JC7A 1WTHA 1KDCA 2UXBL 4F7XA 1LOJA 2DTOA 3GTKH 2UXBQ 3NTKA 3Q24A 2F0PA 4G7OC 4M7DD 3CCUQ 3C1EA 1ZX6A 1YN8A 5M3FB 2XTIA 3IL8A 1SHFA 2C0TA 1B3AA 3UDXA 4U673 1I0CA 2JA8G 3GTPB 4IUTA 1PH5A 3V7CA 1B50A 2B3GA 4HMIA 2L3SA 3LWHA 3K5LA 5E4XA 2LXKA 1CSQA 1H9JA 2BDNA 3RN2A 2KI7A 3I70A 5EKIA 1EY9A 1HNXL 1SE4A 1HNXQ 3VS0A 2Z4HA 2DFUA 1MMGA 1J8IA 3DKMA 1QP3A 4UC4A 2A6HD 1PD0A 5IXBA 4OWXB 2DXCA 3T1HL 2XRQD 3OS0A 1GUSA 2V1CC 1WYXA 3V8KA 3Q6SA 2PVGB 3PO3B 1Q86R 2HAXA 2WB1G 4HIDA 1K0RA 1X27A 1TXYA 3F1ZA 1DCZA 4NPSA 3GTJB 4PJOD 2MP1A 1H9MA 2R92H 2F0QA 3MA2B 1M90U 2FRWA 2HD0A 1WHJA 3CAMA 2DLPA 5A0LA 1A2TA 4JZ4A 4A3BH 3T9NA 3JSCA 1B2TA 1NE3A 2DGYA 2D9UA 2BCOA 3FEWX 1ASZA 4IUVA 4XT1B 1Y1WH 4A3DG 4KI0A 3MP6A 4C3HG 2FJ2A 2RDFA 1KABA 3KFUA 1OXVA 2L55A 5LL6S 2N55A 5ELBA 4YWKA 5CMDA 3H41A 3JCMd 2MMPA 1JXMA 2E2IH 2KYBA 4K5WA 2CSQA 2HEQA 2KHJA 2HL5C 4KK7A 3QO3A 4DGZA 2DTHA 2K7AA 4IPHA 4C5HA 4HT8A 1VQCA 2JEBI 4BBRH 3M59A 1NPPA 1AWOA 3QB3A 4M7DC 1GL5A 4IJLA 3HOUB 4J9EA 4PJLA 3L2WA 4QGUA 1A0IA 4RMOA 2NVYB 3ITPA 2PUOB 2Z0WA 3F2BA 2HQLA 2YWWA 2K2MA 2GFUA 3M56A 1L0WA 1ZBXA 1K4US 2G9HD 4DEYA 3A8HB 1Z9QA 2RHZA 1HH2P 4UP7A 5LJ3f 5M5YB 2QGGA 3HKZG 2FXQA 2J6OA 3SWNC 4RTXA 3UA7A 4FSXA 1YI2T 1N36Q 4Y7NH 4Q0FA 4IFDH 3R3OA 1V29B 2OJ2A 3L2ZA 3PVLA 5LJ3j 1F9PA 3S2DB 2C9OA 5HGTA 2JA8H 3I4MG 3S6WA 1SEMA 1Q81R 2E75C 2G9DA 2PO4A 4OMFB 1YITA 4QY7A 4QVZA 2DNCA 4RKLA 2KNBB 3EG1A 1YWOA 2ATCB 3EFRA 3JCMe 1QKWA 1ZUUA 3F2UA 5CKHA 2K6DA 2KUMA 4OO1G 1EY4A 3RUXA 4EIKA 1D5MC 3DM1A 1C7YA 1BCPB 1B07A 1SSFA 3JB9G 2JN0A 4ZCKA 4OO1I 2MPMA 4AT1B 3LNNA 5CORA 1A63A 5DLQE 4XTYA 1VQPQ 4M7AA 1QJOA 5EKLA 1EIYB 3L2RA 5CKBA 3JB9I 4PJNA 4ZTFA 1SE8A 4X9CA 4EDUA 1J5EL 3GTOH 3L2UA 2XWBB 4HCKA 3EHQA 1YIJQ 3AYHB 2PYKA 5AT1B 4AFUC 4V2SA 3G7ZA 2RDHA 4TQUS 3JAMc 4OMLA 1UUEA 5CQYA 1N34L 4JI0L 1N34Q 4JI0Q 1UGVA 3M58A 2LC4A 1RADB 4X34A 1SDFA 4LK1C 5HURA 1VQ5Q 3J7ZC 1Z9FA 1NZ9A 1YITT 3S1NB 3TDQA 4IOAA 2E2JB 4FT2A 4C3IG 4C3HH 2DX1A 2I5HA 4TVRA 4BB7A 3K80C 2F0MA 3SFMA 4KD4A 3KBGA 2B2UA 2ED0A 1TOVA 3RMHA 3QHSA 4ZNXA 4IUQA 1OYXA 1QLYA 4C8QE 3SVMA 2RQVA 2NB0A 4BY6B 3I5RA 4C8QB 2JW4A 2DAQA 4GNXB 2YUNA 4CKCA 2KA7A 3SK8A 3UE0A 3MEVA 3ME9A 1FMKA 5ECAA 2ZJPA 4LD9K 5EQ0A 2PI2E 4CDEC 5GMKh 3THKA 1HZ9A 5FJ8H 1AH9A 2DZCA 4PL6A 1E3PA 1RAEB 1EY8A 1DJ7B 5IXFA 3OYEA 4J6HA 4BY7B 1D7QA 3TBIB 3S24A 2DPPB 3FPUB 3LGLA 2O9VA 4JJCA 1YNJD 3A55A 3QYGB 3P7JA 1PH9A 1WPYA 3PE0A 1EEFD 2Z6KA 1L0YB 3D6CA 1CKBA 5GAOn 3MFYA 5FLXL 3FKIB 3A8IE 5E3FA 3A7LA 2LKVA 4DV7L 3AMUA 4DV7Q 3KUFA 1X56A 2X9HA 3OW2S 2JUFA 5K5PA 4YY3L 1M1KR 4YY3Q 2JA6B 1Q82U 1JE5A 1VQ6Q 2DA9A 4QB4A 1BCOA 3TREA 4WTOB 3EVQA 1F1BB 2EYWA 2ZZDA 5GAMd 1UGRB 1T5XD 1BCPD 3SR1A 5DM73 2XNAC 5AJ3L 2CZ6B 2AQ2B 2KCCA 3TS0A 2ZT9C 4KY6A 1ZQ1A 3RLOA 1C48A 4A4FA 4ELZC 5KGUA 1ZBJA 2PQWA 4K8IA 2RJFA 4ZAIA 2C0OA 2JVVA 3K8AA 1TUGB 1VQ9Q 3CF5A 4FF3A 4OO1H 1SG5A 2L4NA 2FVUA 2WSEE 3EGXA 2MF2A 1SYDA 3JCMP 1YNXA 1VQNQ 2ZJRA 2BE5D 2K6AA 1CUKA 5FLXE 4RAUC 2GF7A 3FDRA 1M3AA 1VQMA 1F9RA 2EPBA 3AHUA 4KT0E 2L89A 2PW7A 1PRLC 3JRZA 1SF9A 1PRTD 5A2QL 2WV6D 2O5JC 4JDSA 1HTPA 3WDNA 1XPUA 4KULA 1Q7YC 4OMPA 4QQ6A 4A93B 4AFZC 3JCMV 1TSFA 2DN8A 3EN2A 4P75A 2OTLQ 1EQTA 2COZA 4OGEA 9ATCB 3GQBA 1OXTA 3PGZA 3A74A 3PGGA 2JMAA 4F14A 2DJZA 3BG3A 2KGTA 4O0AA 5E4WC 5GAEC 3S3MA 4GLVB 1B1ZA 1Y1VG 2H5XA 4X65L 1OI1A 4JI2Q 4X65Q 3OYDA 3CCLA 4J9FA 3CCVQ 5FROA 3I7FA 4PMBA 3C3LA 4RKUE 4DBQA 1YNJC 2RQXA 5KYYA 5KRUA 5GAMe 1ZA2B 2K4YA 2MWOA 5KYWB 3RBBB 2V8KA 1A2UA 2FPDA 4Y91A 3TSZA 4DV5Q 1H3ZA 1JR0D 1HHVA 4XDXA 4JI6L 1GUGA 4BY1G 1YHQQ 1YWPA 3CCSQ 1VQMT 2GVBA 2K5DA 1I5LA 4JYAL 3K5MA 5A2QE 5IAYA 1Q95G 3OW7A 3QO2A 4ZKBB 4A3IG 5IGBA 2LQ8A 2RKSA 4XU2A 1G3YA 3I55A 3RLFA 3S17B 4BA2I 1TUDA 2QQAA 1UE5A 2B2TC 3M9BA 5C6AA 5GADC 3AFPA 2O9SA 1TU0B 4O5VA 2JYOA 4UP8A 4G4KA 2F3IA 4LF7Q 2QQSA 3K6OA 4B9WA 2XDPA 5KH6A 2PNIA 1YEZA 3KF6B 1TKWB 2ENBA 2RJEA 5CV6A 1TWFB 4OL7A 4B08A 1EYGA 1VQ8A 4E7JA 1FNVA 3CCLT 4PFPA 4IQZA 1QZHA 1SE2A 3VR3A 5C4JH 2BE5C 5CV8A 1HYOA 1S72A 4KTAA 4CKEA 3HOXG 5GAOm 2KBTA 4A3KH 2RI5A 4M78G 3PUWA 2YRVA 1E24A 1PC0A 4OWTB 5CO7A 4LN2A 2K5WA 2OCEA 3E9FA 3PO2G 2VUMB 1KXLA 3OSOA 5EBDA 2DJQA 2QDYB 1ENCA 4KKUA 1NBEB 1OU9A 1F9SA 3VR5A 3H8ZA 2E3HA 2MPXC 4J7IA 3I55T 3MCAB 3S1MB 5J39A 3FDTA 1LUZA 3HS0C 4QCLA 1JOOA 1TUCA 3FLGA 2EJGA 5E7NA 4JLGA 1SYCA 3IAYA 4BY6C 2B8FA 4C8QC 5C6SA 3IKJA 1VQ8T 2FINB 1KG1A 4JBJA 1M90C 3KXTA 4LDWA 5KYXA 3L0OA 3P8DA 1AEXA 4ATOA 3ZEHA 4OF1A 2O2OA 1S72T 1X55A 2P5ZX 4NOYA 2H1EA 2IJ0A 3MVVA 4PZ7A 5IGDA 4KLKA 1QE6A 5J22A 4AG2C 3JCMf
chains in the Genus database with same CATH topology
1RCVD 1H641 1RTOA 5IGFA 3P75A 4Z02A 1R4QB 2RHXA 5FO8B 1SMYD 1Z47A 2B2WC 2OF1A 3AU7A 3NSWA 1A3VA 3TCJA 1DYQA 1LJOA 4PLLA 1D1IA 4FXDA 4R8NA 3WVDB 3LWUA 4RFBA 4M77E 1T5EA 5I2XA 5FU6B 4KKTA 1LT5D 3LX0A 4EGVA 2VV5A 4M77B 2DY8A 2EY6A 2B2YA 2X4XA 3HRUA 3E0JA 3S3NA 1K83B 1VIFA 5IT9E 2DZ9A 1EEID 4CGYB 1LACA 5EJWA 5LJ5h 2FFKB 3C2PA 1EFID 5JEAH 1IW7D 5HY6A 3OS1A 3LYIA 4K5XA 2LRQA 3LX7A 1JB3A 2Q8TA 5I2SA 1AN8A 5BN3A 2F0SA 3OYAA 3FJPA 3N5BB 4NW2A 1M4VA 4XTUA 1U1TA 3MP8A 4IFDG 1K8AU 1KNAA 4EMHA 4KN7C 3A8JE 3M55A 3GTMB 4C8QF 1PTOH 2PQEA 4DU9A 4TSSA 1GHKA 4JBWA 1I4PA 2KVMA 5ELCA 2K7VA 3X26B 3KLSX 1SXTA 2R6GA 1HA6A 5I4DA 3O8VA 4C92E 1VF5C 1QWYA 1FXXA 3EAEA 3NXWA 4C92B 1SMYC 3H09A 3MAQA 3ND9A 4RG2A 3QXEB 4MDXA 5EPJA 2HCCA 2KCNA 1O7ZA 2DIGA 4KBMB 3C4SA 2K1BA 1D3BB 1WTQA 1ML0D 3R6OA 3S15B 1JORA 2CS7A 2XDDA 2SEBD 4DAVA 3L2VA 3HRZC 3U9OA 1IL8A 2MI6A 1S5DD 2ZPFB 1CT1D 1BI2A 2DD4A 3LWIA 1IW7C 4J83A 2CYZB 3RUZA 4WORA 3S1RB 4RCOA 5CBAE 5FOBB 1WCMB 4OB3B 3DEPA 2DXTA 1HK9A 3H91A 1CA5A 4J5YA 4FL6A 2JZ2A 2A6ED 1JE4A 3ONAB 2D0QB 5JEAJ 3N52A 2F0OA 2K32A 3ASKA 4M78A 3JCMc 1KHIA 1NR2A 4L63B 1V1PB 3P8BB 3KF8A 4P5NA 2NVQB 5D3DA 3META 3QJYA 2Z1CA 4X3KA 3NWTA 4X3SA 4MZPA 5GAMf 3JCMJ 2TSSA 3TMEA 2NVXB 1Q82C 4P2CB 3PT9A 5DNFA 3VKIA 4HN7A 4IFDH 1TS5A 1IHZA 1ET6A 1TWAB 5GAMj 2X35A 1TS3A 2L5TA 3H6MA 2RA4A 4C92D 3QYHB 3CMET 2F0FA 2X4WA 1XWEA 3RERA 4LDVA 1GJXA 1AFPA 1A15A 4C0FA 3VUBA 5FU6C 3LH0A 3E9GA 4F88A 3MEHA 4FNFA 2DD5A 4M77C 2MAMA 4II1A 4C0DB 3L1AA 1TQOA 2DNEA 1N8RC 4CBVA 5FRNA 5KCOA 3OPOA 4MHEA 4ZLTF 3OYJA 3KK7A 1S5FD 2QKIC 3I8ZA 3VA5A 1MHNA 4EMKB 2BUDA 2NVTB 1W2BS 2A6EC 1KD1C 3S16B 3GV3A 4XTVA 2OXPA 3R2TA 5K36G 5KNCA 4XU3A 4BI8B 3BDCA 1IYUA 1K8OA 1B34A 1VCIA 2F03A 1SNMA 2X4YA 2EYFA 1H9SB 2R3ZA 3CCEA 5C0XI 1SBBB 4KJOA 3DEOA 1NE8A 3QZ5B 1WD0A 1SYFA 3LW5E 2L1BA 1G5VA 5ELFA 2DKGA 1BR9A 2CZ1B 5KYIA 3HG9A 2NBFA 1VMPA 5T1IA 4F7UE 5GAN7 3L42A 4C92C 4UDUC 5CIUA 1WTVA 2CW0C 4JUVA 4MIUA 2VXFA 3S14B 4F7UB 2M16A 1GUNA 1QCBD 4IFDJ 4M75D 2EDGA 4R9WA 5AYFA 3GTKB 1WTPA 3CCET 1E0BA 1CFMA 3OOCA 4M77F 2B39A 4XTCS 3Q1JA 3HEJA 3JCMW 2L12A 1BNZA 4HT9A 1G3WA 3BY7A 4PJOE 2JOYA 1JCKB 1RTNA 1O75A 4D6WA 3M7NA 3FMCA 1FWZA 4PJOB 3OYCA 3M4YA 3MXUA 4RCBA 3TU4K 3JAML 2MHVA 2PW5A 4ID6A 1DOKA 1KNEA 4XU1A 3OS5A 4NL2A 2A69D 5CV4A 4HCBA 3UWNA 2BKDN 4IURA 1VQOA 3G71A 4K2KA 2RK1A 1DM0B 4XTZA 3C95A 4XTWA 2R92B 2V4DA 2NN6G 4CRIA 5C5MA 5M9OA 2EYPA 4BA1I 4A3BB 2I07B 5GANg 1OXSC 2RVLA 1XXGA 4YIJA 4J7FA 2NN6I 1TR5A 4ZTJA 4M7AE 1WTWA 5GAN6 5K36H 1Y1WB 2F3VA 3GP8A 4M7AB 3RIRA 3EJIA 2QQRA 2L8DA 1EL0A 5A0GA 2QEJC 3QJ6A 4X9DA 1YNNC 1XNIA 1B53A 1X75C 2PVOB 2E2IB 4QF4A 1CA6A 1ZEQX 1VQOT 3G71T 2JNGA 2A3LA 1QVGA 1Q1BA 2K05A 4IN3A 1U1SA 2XSCA 3SE0A 1EYAA 1ZYRD 4BBRB 2GCXA 2QCPX 1WNLA 1Y69U 4J6YA 1EIHA 2F0VA 4Y28E 4R56A 2C06A 1D6EC 5ELDA 4C0DC 5I21A 2ICEC 5KNBA 2RA2A 1DD2A 1J9OA 3OW2A 1UGQB 5G3LF 2EY5A 4ILWA 1N9RA 1Y96A 3OSVA 4QW2A 1K8AC 1HXYD 2PZUA 3DWAA 3G7LA 3QBYA 4EMKC 3OMCA 4CI0C 1S4ZA 4O1NA 4Y7NB 2RB6A 4IKFA 2ZPBB 4PNYA 4DQ2A 2JA8B 3K5OA 2VXWA 2E5QA 4CJ1B 4L6V5 1LTSD 3OY9A 2ZXRA 3OIPA 4OB2B 5EG2A 4OIKA 2H4OA 4BUGA 3BDUA 3PUZA 4X3UA 1YI2A 3VR2A 1WJRA 2YLCA 1GUTA 4J6WA 4DK1A 3GTOB 2R93B 4C5GA 1VQ7A 3MXNA 2KMTA 4VUBA 4N4IA 1W6JA 2NN6H 1LTID 4MDWA 4M7AD 4KV6A 1EYCA 3HZXA 3CXCS 2ZXOA 3F70A 2CGHA 1Q86U 1ZYRC 5GAN8 5LJ5g 4JJNK 5A0DA 3K57A 4ZN3A 4NL3A 5I6YA 1I4QA 4OB0B 1QVFA 1HUNA 1FX7A 4RA8A 2LTOA 5GAN3 3BVGA 1EOTA 2A6HC 2L11A 1Z6HA 1PZJD 5IGGA 3PV0A 3E6ZX 3IFTA 1PSFA 1IREB 4PJOC 2H3JA 5GMKe 3OYKA 1VQ7T 4ODGA 5CV5A 2ZPEB 5GMKm 3PIOA 5EPKA 1Q3LA 2L0CA 3QZ9B 3G6JB 2AHJB 1GXIE 5CBEE 4E7IA 4FF4A 2F0NA 1EWHA 1N27A 3CCJA 2KDSA 3OBWA 2IX3A 2EOTA 2KQ3A 5DM63 1WJSA 2PVDB 1X3PA 3HKZB 4XQ3A 2A7YA 4FF2A 3JCMb 3G4SA 1EZ6A 3PNWC 3OYYA 4L5GA 3URGA 1SNPA 2L5QA 1II3A 1PLFA 4A53A 4JRKA 2F0IA 1HRJA 4JK1C 3P8HA 1RJTA 4M7AC 2ZXPA 3OMGA 3OYNA 1PRTB 1RODA 2J7ZA 2KECA 1BUVT 1LO5D 4KHZA 3INZA 4F7UF 4M7DF 3TN2A 1Y7XA 1Q81U 5CAIA 1HQRD 3BDLA 3CMAA 3CCJT 1Q90A 1PYWD 5EBCA 4C8QG 3LLRA 1Z7TA 2K5FA 3GPLA 1ENFA 3BVZA 2EKOA 2RO0A 2KQWA 4XAXB 3G4ST 1QVGS 4KN4C 2QDBA 2VUBA 1Y71A 1RD9D 3MHBA 2ID0A 3PIP3 1Y8PB 4PJOF 3KUPA 2OTJA 4OIJA 4TRDA 2NYZD 2RDGA 3D6WA 4GLKA 3RD4A 2E2DC 1TH7A 2RM4A 2E70A 3HP9A 5CKFA 1VQLA 1FR3A 1WTRA 3CMAT 2F1MA 2LCLA 2DIQA 3P20A 1FYCA 2XHCA 3D4RA 3AB9A 1JB0E 2EQJA 4L6TB 2K57A 1DOMA 3RZDB 4K6LA 1HPCA 4DA4A 1I81A 2EJMA 1UB4A 2KEEA 2P0QA 2A68D 2PNRC 1NCVA 1TU2B 5T1GA 4KJNA 3V8LA 3OWEB 3PMFA 4O42A 5FK9C 5CVIA 3JB9H 1SYGA 1ILPA 3TP8A 2OTJT 1TY0A 1WQWA 3BDOA 3J7AF 5C4JB 3MC0B 2BIVA 3Q0AA 1UEAB 3OYHA 1N8RU 2IW3A 1R8OB 1I4HA 4A3KB 4ZK9B 1VQLT 4XYQA 1NR4A 2A73B 2VYTA 3JB9D 1GXDC 5I2YA 1U4PA 5CGKA 1FNWA 2G3RA 3GD7A 1AW7A 4C5IA 1KD1U 4R8IA 3T53B 2O4XA 5JPNC 1G2TA 2OT2A 1RL2A 3GNFB 5LJ5d 3URYA 4EQNA 1GUWA 2HUGA 4U68A 3CCUT 3FEOA 1SNDA 1QVFS 5GAOp 3GNGA 1Q8IA 3HHTB 1WVLA 4MMLA 1NSNS 3NHHA 4ZYSA 1G2SA 5GANh 3N6RA 2QXFA 4XQJA 3JCMX 3V8JA 2VGMA 4K8JA 4C2MB 2NZ1D 2DK3A 2K5IA 1TT2A 2K3YA 3ZFJA 3EA6A 3CC2A 1STEA 4ZGEB 1BCPC 5KIXA 1Y1VB 3HL8A 1OO9B 2NWGA 3OA6A 2E65A 3JCMQ 3GO5A 4O6JA 2K04A 3VYTA 1RKNA 3VUZA 3OB9A 3NE5B 2ZCFB 4IUPA 4NS5A 5CYUA 3M3YB 4DFAA 1E2VA 4N0AC 1TY2A 2IG0A 4JS5A 3M4OB 3T51B 5LJ5e 1PRTC 3CRKC 1IYVA 4KY5A 3JB9J 1JICA 1B9MA 2RI3A 2R57A 3CC2T 2LS01 4FU6A 3RZOB 3T4AC 2DY7A 1E2WA 4KD3A 3DLLA 1LT3D 3I91A 1TIID 3HP3A 2MUYA 4BE2A 3S3OA 2WSFE 1CZWA 1R9TB 2AQ3B 3HOXB 2EYLA 3EQLC 4A3FB 5GAN2 1VMCA 5EGTA 3MEWA 4M78B 5LJ3g 2DXUA 2CQAA 2ZPIB 4C8QA 4H13C 2EJGC 1SAPA 2PU9B 1EZ8A 3D4WA 3QOLA 1VQPA 5ISRA 2M9VA 5JVG3 3WXMB 5DM7R 5LL6X 4QMGA 1WD1A 5GMKj 2EE1A 5KNDA 3K7AB 3PMTA 5COYA 3VU3C 2EQMA 1YIJA 3CD6A 2AUJD 1F2LA 2EAYA 1FGBD 3OWFA 1WTXA 1QNUA 1ZHIA 1HQMC 3DB4A 5DLOA 3MEAA 4M77G 1BCPF 2X4JA 2GQVA 2NLUA 1O9SA 3I4LA 3BZDB 3G6EA 2B2WA 5CR3A 5KEEA 3QIIA 1EY7A 3MFGA 4K14A 3TP6A 4HSVA 1W2BA 4HEDA 3TZUA 3QIAA 2VC8A 1ONLA 2WP8J 4YTLA 1Q86C 2L9HA 4XQNA 1VQPT 1F2ZA 5JPMC 4DXFA 2B63B 2B2YC 5CC4A 3RESA 1PRTF 4RGOS 1CHQD 2EZVA 2YLBA 2ZPGB 1EQVA 1YIJT 3CD6T 1HTLD 1RHPA 2F0EA 2QEXA 2PZWA 3TSSA 2LVMA 2Q8RE 2JXMB 2LCCA 1VQ5T 2O5IC 5CKEA 3G6ET 3FRNA 2FHTA 3I90A 2X6LA 3X3MA 4HSPA 3S9WA 1SJHD 1LABA 1Y07A 4NKLA 4ME7A 3VYGA 3ER0A 1Y8OB 1O78A 1I4RA 3SDZA 1B34B 1VQ6A 3NBIA 4MZMA 1SFOB 1BF4A 3UDCA 1KHCA 4ZN1A 3M7GA 4N4GA 1D5ZC 3SEBA 1CZGA 4M78D 4PMCA 2Y4XA 1PTOD 4N4HA 1B4OA 4K6DA 2F5TX 5GMKl 2VXEA 2ICIA 1LLRD 2KVQG 4BI3A 3HFOA 2RSNA 2RBMA 4RGNA 2QEXT 1MI2A 4OB1B 1VQNA 2GA4B 4DF7A 5L8RE 1C8CA 4S3SA 1K73U 1U4RA 3ND8A 2RHUA 4F87A 1VQ6T 1M4ZA 4C3JB 1Q81C 1B44D 2WKDA 2XRSD 4QUFA 4FO2A 4QQGA 2RSOA 1UNSA 3DXJC 1I6HB 5C3XA 2RJDA 2EQUA 3BYYB 4KUIA 1HXDA 4J1MA 1PMRA 3CMEA 1VQNT 5HKCA 1X32A 1IKMA 1YHQA 4OP0A 5BN4A 3HRTA 2MJ8A 1FD7D 1G8ZD 1KLGD 2D2CC 2EJFC 1EYDA 1KTKA 4UAIA 4DN4M 3I73A 4M78C 5D6WA 3RKWA 2FHDA 3J80L 3CPWA 1EU3A 3FPPA 5KCHA 5J26A 2VB2X 2F5KA 1CQVA 2BA1A 2E2HB 1I4GA 2NUCA 4M75E 3M5AA 2XVSA 5GAN5 2EQKA 4M75B 3LWEA 5IODA 2BOSA 2P0KA 1JOKA 5TSSA 1YHQT 2K03A 1EIGA 2V8IA 1S5ED 4E7KA 4QVDA 1BQQT 2LT1A 1UGPB 3DWPA 4KHVA 2YYZA 1QB5D 4M77A 4BE1A 5LJ5f 1M8AA 2B8AA 3V7SA 5IOCA 4IUUA 5C3EB 2A5HA 1M1KC 4E7LA 2Y0SB 2RHYA 3UT1A 1BI1A 1PFMA 1V1OA 5C0XG 1G291 5HK3A 5JOBA 4FXKC 4N9PA 4RGTA 3OIQA 1VF7A 4PV1C 1EY5A 4BWGB 1BXTA 2XI9A 1YJ9A 1AP0A 4AYBB 3CXCA 2I46A 4IALA 1SSOA 1I8FA 1EIFA 1STHA 3VJPA 5AFWA 3LGFA 1Q1EA 5CV7A 5D3IB 2MWPA 2LMCB 2SNSA 2V8JA 3HFNA 4RGMA 4F7UG 3GIBA 3I56A 4M7DG 1MBYA 2ZPHB 3JCMg 1C4QA 2X6GA 2EWNA 2PCFB 1ET9A 4BDYA 2R61A 1KLUD 3BFMA 2ZGWA 4CKBA 2D5DA 3BVMA 2F3WA 4B9XA 2K28A 3J7AV 3GOXA 1PFNA 4G7HC 4JRPA 4A3MB 2E6ZA 1OZ2A 2EFIA 3A5ZB 5FO9B 1YJ9T 3I3CA 2OAUA 4C56C 3PFSA 4PJOG 2KJXA 3A7AB 2D62A 1M5Q1 4LDXA 1BI3A 5F2DA 3BS1A 3OYBA 5GAOl 1WGSA 2EYHA 1AHJB 3I56T 1G3TA 3A8MB 1AZPA 3Q23A 3ZYYX 2I2LA 1MGSA 3RKXA 2J4XA 5HK0A 5LJ3h 4L59A 2EYJA 2DO3A 5JVH3 1JRIA 3C46A 4L8JA 2J0TD 3CCRA 3CCQA 2O2LD 3T16A 3VV0A 4XK8E 2IT1A 3HKSA 3V05A 4HTHA 3SK5A 3VYHB 1CM9A 4ME5A 1M8VA 1ENAA 5IN1A 1KC8U 1TVXA 3SXHA 5C3WA 1A6XA 1TWHB 3VYRA 1KQSA 3QUIA 5C0XH 1EY0A 3GTGB 2L3RA 3JAME 4EQPA 2D6FA 1PZID 3SK6A 3OSSC 3M53A 3D8GA 3CBMA 4C92F 1LTAD 4K2LA 2EYQA 2B2VA 1HFGA 4G57A 1F9QA 4M75C 5J3BA 4FT4A 3CPWS 1UUPA 1VIEA 2EYOA 1TS2A 1BIBA 2F0TA 4IUNA 3H6ZA 3CCQT 3CCRT 3K5NA 5EPLA 5C5LA 4QUCA 2EVBA 3GF5A 3MTSA 2X69A 4RKBA 2P4TA 1F77A 2A69C 3CCMA 2WIIB 1F2YA 2Z8LA 1JOQA 2JTMA 1QOHA 1F2MA 3GP7A 3QSUA 5D65A 1S5CD 5C4XB 3J81L 3GV6A 4H44C 4CJ2C 4EMKA 1STYA 2Y4YA 2E1HA 3QG1A 2CKKA 3CPFA 3M4GA 4XYOA 4BS9A 2QA4T 3NK9A 4EQOA 5IGEA 3L2QA 4JS4A 1TS4A 2E76C 4ZUIA 2IL8A 2K01A 3MHXA 1H9SA 3KBXA 2KY9A 2F0UA 5GAMg 2WB1B 4ZQ3A 1LT6D 2IPKD 3PUVA 4QIWB 3DLMA 4RG8A 3CCMT 3NBHA 1G6ZA 1QG7A 3PTAA 1FNUA 3W3AA 3Q22A 3E1SA 1KQ1A 2CVRA 5C0XJ 3J81E 2NTTA 4M75F 1K73C 1O7YA 3OYFA 4WFN3 1STNA 1KDBA 1DXMA 3QPHA 1JJ2A 1UAPA 3U9SA 5HGTA 4FIBA 5DEHA 4A3DB 4C3HB 2WKCA 3OBYA 4NDXA 2WINB 1STAA 4F7UA 3BW1A 4M7DA 3WOEA 2VB3X 3VA7A 3GLXA 4DAYA 5I6WA 1K9MU 4DXGA 4I65A 1HFNA 2DXBA 2XDBA 1BOSA 2LNVA 4KMUC 2HDMA 5E1FA 1XTDA 4MZTA 1OXXK 1XQHA 1VQ4A 2N88A 2O4XB 3NQIA 3V2TA 3SWNA 4C1NK 4EPCA 4PJOA 1JWUD 5D6YA 4DNTB 5A35A 5GAN4 1KQ2A 4ULLA 1NUCA 4BACA 3TEEA 3ERQA 1GHJA 5EKKA 4A4HA 5DAUA 4H7BA 3I4MB 1O7LA