3TCJA

Ccdb dimer from v. fisheri in complex with one c-terminal domain of f-plasmid ccda
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcdB
publication title Energetic basis of uncoupling folding from binding for an intrinsically disordered protein.
pubmed doi rcsb
source organism Aliivibrio fischeri
molecule tags Toxin/antitoxin
total genus 31
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3tcjA00
5CCAA 3JRZA 3VUBA 5CKHA 5CKDA 1NE8A 5DLOA 4MZMA 3HPWA 1VUBA 5CO7A 5HK0A 5CR2A 4VUBA 5CKEA 5CQYA 4ELYC 2VUBA 2C06A 4MZPA 5HKCA 4OF1A 4MZTA 3G7ZA 4ME7A 1M1FA 3NFCA 5CK9A 5CQXA 3TCJA 1X75C 4ELZC 5HK3A 4HKEA 2KMTA 4MDXA 1UB4A 2MF2A 5CKBA 3JSCA 5CKFA
chains in the Genus database with same CATH superfamily
4RKUE 4C92E 3JRZA 2LX9A 3VUZA 4M75B 5D7UA 1PRMC 4M7AB 3FJ5A 4PFZA 3CXCP 4QKUA 3CCVQ 2RHZA 3M58A 3MCAB 4LUDA 3GOXA 1U8RA 4OB1B 3EAEA 1ABQA 4IUVA 3META 5GAMd 3CD6Q 5LL6S 1H8KA 5GAMf 4KT0E 2AZSA 1WQWA 5KYYB 1Y07A 2DERA 2DRKA 1MMGA 3G4SA 4A53A 4A4FA 1WGSA 4OMMA 1PNJA 1Q7YR 1I4K1 1YJNT 2VGMA 2QYZA 2ZZDA 5GMKj 2FZKB 1RAAB 5A0GA 3JCMd 2RQTA 3QWXX 1YHQQ 5FRNA 1RI9A 4Y28E 3M53A 2GCXA 4LDWA 2EJFA 2EQUA 2CUBA 2FHDA 2RHXA 2MAMA 1RLPC 2E10A 3SFMA 2GFAA 3M0QA 2CSIA 4EDUA 2A08A 3CCRT 5GAN7 3I5RA 3OQ5A 1BI1A 2JTMA 2KR3A 2YLBA 2KI7A 1Q86R 2H8HA 2EYQA 1Y71A 4HT8A 3ULRB 5DY9A 4B6MA 3EGDB 1VQLA 3OY9A 1M27C 2E5KA 3L1AA 2R58A 1RAHB 1NPRA 4QQ6A 1G83A 3NPFA 2GF7A 4C92B 2EGCA 3BW1A 3SEMA 4BD3A 4C92D 4OP0A 2LT4A 2EIFA 1YFNA 3JCMg 3CCQA 4M75G 5EC7A 1T3LA 4M7AG 2DNUA 3FEOA 1ZA1B 4GLKA 2AKKA 1UJYA 4Z8AA 3QKJA 1ACMB 2DLPA 1N8RR 1KK7A 3KUFA 4OGEA 3V7RA 3PIOA 3X26B 4KBMB 3M5AA 5KH6A 5KCOA 2M16A 1E6HA 4BI8B 4XAXB 2GGRA 1VQNT 1PG5B 2XDPA 4C8QA 4OMOA 3CCJA 2FO0A 1W70A 2KROA 2K6DA 2JN0A 5I2MA 4M7DA 1NM7A 2FEIA 2VWFA 4KRTA 1QVGA 1X75C 1Y96A 3QPHA 5GAOl 3MKDA 4M4ZA 1GFCA 3PMIA 3EGXB 8ATCB 1HD3A 2CP5A 1OQKA 3M4GA 3QDRB 4OMNA 3OYIA 2E6NA 1K4US 1A0NB 2A37A 2FVUA 3OYAA 3CPWA 2RM4A 1LCKA 4C8QF 2K2MA 1FWZA 1XNIA 4GY5A 3X28B 4M7DF 3GIBA 3QG1A 3M9QA 3MP8A 2IIMA 1YWOA 3OYKA 2YRDA 1JB0E 1MUZA 2KYMA 4C5IA 5GAN3 4JUVA 2JOYA 1YN8A 5IHIA 2DYIA 2HQHA 4C92G 5GJVB 1MNEA 4HKEA 4C0GA 5C0MA 1YJ9Q 2ROTA 5CCAA 3E9GA 3I55T 1QP2A 1W6XA 5DLOA 2KY9A 2V8JA 1QMCA 3H0HA 1VQOT 3R6OA 1LJOA 1WHLA 2KK4A 2F69A 3NHNA 1KC8C 4PL6A 2QTVA 1B34A 2JUFA 1IREB 1M30A 5KE3A 4DBFA 1B7TA 2RHIA 2A36A 4FL6A 5M9OA 1BYMA 1TOVA 1VQ7A 4R56A 3A8LB 4HA8A 4XTWA 3TU4K 3ZL7C 3QSUA 2I2LA 2EJ9A 3L2ZA 4E7IA 5GANf 5LJ3e 3M0PA 2VC8A 3REAB 1JJ2A 3EG9B 4E7ZA 2J06A 4RUGA 4RTVA 2NUTA 2ATCB 2CSQA 1R0BG 3PIPA 3QIIA 2QAZA 2DAQA 4FSSA 4OF1A 1WPYA 2EKOA 3LH0A 3BE3A 2PVDB 3CC2T 2CT4A 4OMFB 9ATCB 4FM4B 2A28A 3PFSA 2QEXA 4BE0A 1YIJA 3TQ7P 1JBMA 2EQMA 2RD1A 4N4GA 2OTJT 2Y90A 1Q82U 1KD1C 5LJ5f 3F70A 2DL3A 1UDLA 4C0DC 2YUOA 3EFRA 2AK5A 2KGTA 4LE9A 3I5SA 1VQ9A 3RBBB 4N4IA 3OYHA 1RAEB 2PVGB 2LZ6B 2RQRA 3GPLA 3J7AF 1S72A 4WCIA 2JS0A 5LJ3d 4AT1B 1VA7A 2CP0A 2QQBA 5GMKe 2M51A 1TH7A 5GJWB 3JB9D 8AT1B 1K73C 2LVMA 3JCMQ 1FMVA 1U5SA 2E5QA 2J6KA 4C8QC 5GAMj 3UATA 3QHSA 1UE9A 3R6NA 2M02A 2EKHA 4QW2A 4M7DC 4DOVA 2RJCA 1H3ZA 2R5MA 5GAOp 1K9MR 1AWXA 1W1FA 1K8AC 2BKDN 2KYBA 4MDXA 1M2VB 1HSQA 2KE9A 4QQGA 1Q7YU 3NTKA 1OPLA 1X27A 2FRYA 3GNGA 2DTOA 2HSPA 5CIUA 1ZHIA 3L2QA 2DXCA 1VQ4Q 2OTLA 3WVDB 4L59A 3L2UA 5LJ3g 1C1AA 4IIOA 1XJWB 2L3PA 2KVQG 4GLMA 2DJZA 1G3SA 2DPPB 1AEYA 3JAME 1T0HA 1ZA2B 4RMOA 1GBQA 1VQMA 5KYWB 2KNBB 2GNCA 2DE0X 1Q86U 1SHGA 2W10A 1VQPA 4C8QE 2EVRA 5GAOr 2K4YA 4M7DE 4CC7A 1AHJB 4Z88A 3I35A 2RN8A 3CCVA 2KSSA 3PMTA 1OU8A 3JCMJ 1U1TA 3N5BB 1E6GA 2RI2A 3VS3A 1TUGB 3CD6A 2DD5A 1UHFA 3H0FA 1N8RU 1M8MA 3S3NA 2HQXA 5CKBA 2JT4A 1CSKA 1X2QA 1Q95G 4HCCA 2BZXA 4J6XA 3G4ST 1M3CA 1NJIR 2F2XA 2EWNA 2LT1A 2WSEE 2X4JA 1YJWQ 1M5Q1 2Y4XA 4OMPA 1JXMA 2VXEA 4C0DB 2RQWA 3G6EQ 2D0QB 4J9GA 5FWCA 3CCSQ 1KIKA 4E7KA 4A4KA 3M4YA 2SEMA 3HL8A 1G3YA 1WHGA 5C6SA 3J81E 4PJOA 2CP7A 4JLIA 1LOJA 1G3TA 1C0MA 3CCLQ 3HRUA 2X9HA 5CR2A 4XQ3A 5FU6C 1YITQ 3LWIA 4A4GA 3CCMQ 2L3RA 4LN2A 2O01E 3P8BB 5FU7C 2CP3A 4C8QB 1VQLT 1PHTA 5GAOm 1TTHB 2M0YA 4C8QD 3VS7A 1BIAA 2PZ1A 4M7DB 1YWPA 4LD6A 1WXBA 5CAIA 4M7DD 2DL4A 2Y4YA 3G71Q 3P8HA 4XTYA 4PLLA 1W2BS 5D6WA 2OI3A 3CCQT 2QA4Q 4LXCA 2RI3A 2GTOA 1G5VA 2JNGA 1N6AA 3HP9A 4OVAA 3E19A 4YTLA 3OW2A 3M57A 5GMKh 4IKFA 2K3XA 4KGZB 3FJPA 3VS1A 1AD5A 2DX1A 3EG2A 3CCJT 2M1HA 2EJGA 1UG1A 3UT1A 1ZBJA 2HCKA 3MHXA 3VV0A 1G3WA 2EQIA 1EFNA 2HMAA 3OYMA 1D0ZA 4EMHA 5CKDA 3FDRA 1OX9A 2QQRA 4Z89A 4XTVA 4J9EA 5GANj 2JXBA 2VVKA 5IAYA 3OW2P 2ZPGB 2LNHB 1NLPC 1W2BP 1GCQA 2DXBA 4AG1C 5HCKA 3M0SA 4MMKA 4ZTJA 3M55A 1WHMA 1X6GA 1QCFA 4FU6A 4XU3A 5KCHA 4F16A 4BB7A 1N9SA 3MP6A 2P0PA 4K11A 3RUXA 2KT8A 4E7HA 1Q81C 1WHJA 4JRIA 4C8QG 1WYXA 5LJ5j 1N5ZA 5EG2A 1ZX6A 4M7DG 3JB9H 1YJ9A 2RMOA 4RTWA 3OYNA 1OULA 3A98A 4NL2A 1VQKQ 3AT1B 4L5GA 3CC7Q 3JB9F 1NEGA 4F14A 2COWA 2X4WA 2CREA 2V8KA 1QVFA 1HYOA 3ASKA 1I81A 2DETA 1IXDA 2QXFA 3UA6A 4RCBA 2NUTB 3VRYA 2OAWA 2YSQA 1HK9A 2P84A 3WVEB 1WNLA 1X69A 2ZPIB 5FU6B 4IUUA 3JCMV 2CZ7B 3FRNA 3CCEA 4QVZA 2KRNA 1VQ7T 1OYXA 3EHQA 3CBMA 2MIOA 5FU7B 1K9MU 1K0XA 2CP6A 1MV0B 1BCOA 1VYUA 2HBWA 3JCMf 3A8HB 4E7LA 1DJ7B 1G8XA 2MF2A 4JJDA 2NUPA 1LPLA 2BE9B 2DEQA 5GAN4 1VQ8A 1LNXA 3I9QA 3C4SA 2DXTA 3OSSC 3QXEB 3I56A 3S3OA 4EPCA 4BI4A 1RL2A 2J6OA 2VV5A 1BCMA 1AZEA 2QEXT 4AMCA 1YIJT 3V7SA 4RG2A 1AZGB 1B3QA 2A0FB 4AFSC 3BFMA 1KG1A 2LQ8A 2QDLA 2DTHA 3C12A 1VQ9T 1AVZC 1WZOA 2D0NA 2OAUA 3VYGA 5DM7R 1GRIA 2E1HA 1I5OB 1V76A 1RLQC 2JTFA 2L3SA 4XU2A 1IRXA 1S72T 1RUWA 1VQ6Q 2F2VA 3HFNA 3TREA 1EZZB 3L2VA 3IQLA 3T9NA 4ORZA 2F2WA 3M0UA 4PNOA 1YI2Q 4F17A 4PJOE 5FROA 2QQ9A 1QVGS 2QTXA 4EMKA 2QGGA 4PJJA 2L2PA 1UGSB 4CRIA 2BTTA 2RB6A 5IN1A 1M9SA 4ANJA 2CP2A 5CKFA 2LMJA 1NJIU 1ZSZA 2VYTA 1O9SA 3CBOA 1VQ4A 4PKCC 1OZ3A 3CPWS 1GCQC 1IGUA 1X43A 1TSFA 4LUEA 2OTLT 1SSHA 2VXFA 1PWTA 2IVWA 3EGUA 1M1FA 1WJRA 2QQAA 2LQWA 2KMTA 4PJMA 2PU9B 3M54A 1KQ1A 1Y0MA 2DBMA 2E4HA 1QVGP 1VQMT 4DEXA 2XIDA 4JLGA 4DBRA 4DQ2A 2C06A 3FLGA 3FC3A 2RHUA 1WDXA 1VQPT 2X3WD 4J9IA 3LGLA 1ZSGA 3P8DA 4LDYA 4AFUC 1M1KR 3HRSA 1E7OA 1AWOA 3DB3A 3UA7A 4PFPA 2P4TA 3MEAA 1UTIA 1WA7A 3CPWP 4ZTFA 1IHVA 4PK4A 4HCKA 1LVKA 2KT1A 3EH1A 1HXDA 3CCVT 3CQTA 4J9BA 1JQQA 3VS4A 2QDYB 4B9XA 2V1RA 3CMEQ 1D3BB 4UC4A 2O31A 3CD6T 2DK3A 4PJOD 1BU1A 1IB8A 4ME7A 1VQ5Q 3TCJA 2NYSA 3X20B 5GAN5 5J3BA 1OI1A 2EQKA 3TSZA 1YJWA 3D7SB 3LWHA 1YHQT 3G6EA 1M90C 1JJ2S 3CCEQ 3ER0A 3CCSA 3RERA 4Q5WA 2DTIA 4J7FA 5FLXE 1WLPB 2CYZB 1WXTA 4PJLA 1PCXA 4RCCA 2RNAA 4LDUA 3CCLA 5KYXB 3SWNA 5DLQE 1I8FA 3CCUQ 1YITA 1X6BA 2J05A 2LNVA 3CCMA 2HZYA 1UECA 1ZLMA 4OGCA 3JV3A 4PJNA 1VQ8Q 1TU0B 2DIGA 5IHNA 2ZAEA 4MMLA 1U1SA 2EYYA 4M75A 2RHYA 2DZ9A 4BACA 4M7AA 5IHKA 3I56Q 3OS2A 2OJ2A 3G71A 5D6XA 2JM8A 3EFOB 1D1AA 4FW1A 2K5LA 4R0KA 2DXUA 1AWWA 5HK0A 1JJ2P 4QT7A 1T3SA 3E9FA 2QA4A 2NUZA 2CH4A 3NMZC 2RK2A 2RH2A 5KYYA 5A2QE 3ZBDA 2FG0A 4C0FA 5CQXA 2CZ1B 2DKGA 2O4XA 4IIMA 3JCMW 2E70A 4LDVA 2COYA 1JXOA 2SRCA 2ED1A 5LJ3f 4PJOG 2LJ3A 1Q82C 1K73U 2ZCFB 1N27A 1NE8A 4FT4A 3OYBA 4EMKC 3HPWA 4ZN3A 5AT1B 1BBZA 2E64A 3GP8A 2ED0A 4KH0B 2L3QA 3QJ6A 2EYXA 4JDSA 4EMGA 4KGXB 1QKWA 4E2FB 2CS7A 2PVOB 3HHTB 2HDAA 2CGHA 3C94A 3EGDA 4L6V5 3SDZA 3CMAQ 1UEBA 4J9HA 2X4YA 4KULA 2XKOC 2LC4A 2VGNA 4DA4A 5GAN2 4FCYA 4BE2A 1M2OA 3QO3A 4Z02A 4ZGDB 1Q7YC 2XICA 5L23A 3M0RA 2ZPHB 1KFZA 1JU5C 2BZ8A 4D6WA 2YXYA 1VQKA 4JRKA 2BIVA 2LQKA 3CC7A 1NYFA 1YJ9T 2AT1B 1UB4A 3RKXA 2RK1A 5CKHA 3LH5A 3TEEA 4J9CA 3EHRA 1AT1B 1PD0A 2MK5A 2DILA 4X9DA 1SG5A 2NUPB 1Q86C 3EGXA 5A0DA 3JB9G 3ZEHA 1JRIA 1SRMA 3OYGA 4IUPA 2DL5A 1WXUA 4E6RA 5GANh 3J80E 1O75A 2F5KA 2HL5C 5J39A 2XDDA 2RA2A 3CCET 3INZA 1KQSA 2C0TA 3PVQA 1SPKA 4RTZA 2B8AA 3CBPA 2FPEA 2DA9A 2IPOB 2RJEA 4J6WA 3LGFA 2DRMA 2A7YA 2KRSA 3LYIA 4XTZA 4ELZC 1N8RC 1YCYA 4OMQA 1I1JA 3SWNC 1NEBA 3O5ZA 4KH1B 2G3RA 2M0OA 5LJ5h 2DVJA 3DLLA 1SF9A 1MMDA 3OS1A 3KXTA 5I22A 1KJWA 2KQWA 1SSFA 4CC2A 2H3JA 1KQSP 1M3BA 3G7ZA 1RAGB 4CC4B 1IHWA 3RNJA 1YJNQ 4FYYB 4EMKB 3UWNA 2QG9B 4ZN1A 2RJDA 4BI3A 4PFOA 2NWMA 3OYDA 4A4EA 2D8HA 1D09B 1Y96B 1M1GA 1ZQ1A 2CH4W 5CKEA 4PJOF 1OU9A 1M1KU 3RKWA 3CCRQ 1VQ6A 3OW2S 2XMFA 1RACB 4F7UA 4RTXA 2MCNA 5GAOq 1YI2A 1KQ2A 4JRQA 2P4RA 3S6WA 4C0ZA 4A4HA 4FT2A 3H41A 2XG8D 3FB9A 2FL7A 3CEYA 2RJFA 4NS5A 2DM1A 4HCBA 2KEAA 3HSBA 1PC0A 2V26A 3L42A 3EG9A 2CZ6B 5FWBA 4E7JA 2IG0A 3UPUA 2P0KA 4M75E 2W0ZA 2D6FA 4CC3A 4F7UF 4M7AE 2DL7A 1YCSB 1K76A 1VQ4T 2Z0WA 1WX6A 1AOJA 2RF0A 1GFDA 3QZ9B 2JJ9A 4X1VA 1VQNQ 4FSXA 2HBPA 3HRTA 2G6FX 5GAOn 1YNZA 2E12A 1YBYA 2FPFA 2K79A 3MPUB 4MDWA 1N9RA 1ZUKA 1ZBXA 1KD1R 2MYSA 1V1CA 2ENMA 5I11A 2KXCA 1B34B 2BUDA 4VUBA 4D8KA 1BB9A 1RI0A 1XOVA 4Y91A 3SHWA 1SEMA 1GXIE 1GBRA 4BY6C 3NTHA 1NYGA 3M56A 1QVFS 2E3HA 5GAMe 5A0LA 1UHCA 3CXCA 1K1ZA 1MGQA 3GBQA 2AZVA 3ME9A 2QASA 1VUBA 2L8DA 3CMEA 1KHCA 5LJ3j 2LDMA 1D1CA 1K73R 3VKIA 2C0IA 1VQ5A 4V2SA 1TUCA 5HKCA 2J6FA 1M2VA 2YWWA 4WF2A 3SWNB 2QQSA 1NBEB 2DL8A 3GLXA 4FYWB 4X9CA 4JPBW 2JS2A 4J7IA 3HFOA 1K8AR 2LCLA 3M0TA 2DJQA 2YUQA 3SD4A 5GAN6 3OYEA 1NLOC 4M75D 2C0OA 2K9GA 3MO8A 4FW2A 1EX4A 1YJWT 1UUEA 1UFFA 4XU0A 4M7AD 3I55Q 6AT1B 4C5EA 2DF6A 1UGQB 3G6ET 3EG0A 3CCST 1VQOQ 3PTAA 1QVFP 3NFCA 2HNIA 5KYWA 2VKNA 2R57A 2XHCA 2MI6A 3CCUA 3S3MA 3UF4A 4PJOC 1H92A 2RQUA 2DD4A 5KYUA 3CCLT 2LJ1A 3VS0A 1G2BA 3QYHB 1YITT 1TWBA 1RAIB 3CCMT 1QWEA 2O4XB 3CC4A 1PSFA 4KUIA 2PTKA 3V8KA 2X4XA 1U06A 1WQ7A 2PUOB 1K9MC 2OX7A 3RR6A 3MEUA 2GQIA 4M77A 2DO3A 1XTDA 2AHJB 1VIFA 1GL5A 3G71T 4J9DA 3OYJA 3JCMX 2QA4T 2MOXA 1I5LA 4RG8A 3X24B 2EGAA 4MZTA 2F1LA 2PNIA 2L89A 2D9TA 5GAMg 4NOYA 3UDCA 4OB0B 3HTRA 4M78A 3CC2Q 4O6JA 2EGEA 2FB7A 1QCNA 1PKSA 1FX7A 1M3AA 2OTJQ 5I21A 5L8RE 3VYHB 2RI5A 2KRMA 2VB6A 2YT6A 4M77F 2YDLA 1QVPA 4JJNK 1Y57A 2FPDA 4OMLA 4QQDA 5HY6A 1Z9QA 4JZ3A 4IUTA 1XQHA 3QJYA 2CZ0B 1X2KA 3V7CA 2BZYA 2YUNA 1QKXA 2HSEB 2HEQA 4M78F 3CMAA 4BY6B 2K5IA 4DBHA 5CO7A 2E41A 3JCMP 2WSCE 2VUBA 1OZ2A 4FIBA 2K7AA 1M8VA 1BKBA 3LLRA 2EYZA 3BDLA 1ZUUA 2LCSA 4F7UE 4C5HA 4IUQA 4JJBA 3QUIA 1NJIC 4CI0C 3OYLA 3A8GB 1PKTA 2JZ2A 3OSVA 1VQKT 1Z9ZA 3QZ5B 4XU1A 2EFIA 4BUGA 3QYGB 3CC7T 4R55A 3OBYA 1QLYA 1UJ0A 2XDBA 2NLUA 3URGA 5GAMh 2EYWA 4JJCA 2EBPA 1BI2A 2GFUA 1TXQA 5GMKl 1IGQA 2D8JA 3GF5A 1EIFA 4HCZA 3E2UA 2K5FA 3DKMA 4EIKA 4PJOB 2ZPBB 1KC8U 2COZA 2CUDA 1SKUB 1J3TA 3MEWA 2E6ZA 5FW9A 5GANe 2K57A 3JCMh 1PRLC 3E1SA 1V29B 2XD0A 3C0CA 2JMCA 3H8ZA 1Y7XA 3OMCA 4ESRA 2O9SA 2JMAA 2HQEA 4BDYA 1H641 1M90U 1K0SA 2MWPA 1MV3A 5FRMA 4LDXA 2XI9A 3NTIA 3RKYA 4AFZC 4A54A 3JCMb 1BI0A 2D1XA 2LRQA 5LJ5e 1H3HA 4TVRA 2DYBA 1R77A 4RTYA 4ZGJB 2LJ0A 4F7UB 1QP3A 2JVVA 1I07A 1VYTA 3H9NA 5IXBA 2DEUA 4HT9A 4ZNXA 1YJNA 2FZGB 2X51A 3PE0A 3LW5E 3V8JA 1Q81R 2LTOA 2HL3A 3G4SQ 1UGVA 3CC4Q 2R5AA 1JEGA 5GANd 1BI3A 2F5TX 4M77C 4II1A 1KD1U 2KXDA 3MJXA 1KHIA 3JB9J 1BK2A 1MMNA 2RO0A 1OPKA 3VUBA 4D8DA 4ATOA 2JM9A 2ESWA 3CCRA 2WSFE 2WACA 2LQNA 1TG0A 3O8VA 2HAXA 3A1PA 3DLMA 3AHUA 2RPNA 4J83A 3VJPA 2ZPFB 1VQ6T 4M78C 2E65A 1AWJA 1NG2A 2DIQA 3A8OB 4NL3A 2O2OA 1ARKA 1YI2T 2KBTA 3OYYA 5LJ5d 4XTUA 3M59A 4IURA 4A63B 4AG2C 3OB9A 4M75F 1FYNA 2ROLA 1VQLQ 4M7AF 2CDTA 3Q1JA 1SRLA 4AFQC 1K9AA 4FYXB 2HKNA 4MZPA 2O9VA 2I0NA 5GANg 2HKQB 1MNDA 1K8AU 1PD1A 2FYKA 3CCQQ 5CQYA 1R8OB 4N4HA 4ELYC 5KYNA 1ZSZC 2EQJA 4O5VA 3RMQA 1QWFA 2XK0A 2BE7D 3EFSA 4M77E 2LX7A 4JZ4A 4PLIA 2HD0A 1C6VX 1VQNA 5D6YA 1R0CB 4E47A 2JW4A 4BE1A 4F7UG 2YHTA 1KSWA 4HVUA 3CPFA 3CCJQ 1OOTA 5LJ5g 1TS9A 4C92A 1IZ6A 4M78E 2J7IA 3VRZA 2VASA 4JS4A 4C5GA 4N0AA 2KDSA 1TUDA 3C95A 2O88A 1JO8A 1WIEA 3VS2A 1PM3A 4RTTA 2CT3A 1RADB 2AIRB 1D1BA 1X6OA 1M4ZA 4HVVA 2GQVA 2K3YA 4LNPA 3EH2A 2V1QA 1T0JA 2PUKB 1FXXA 2A3LA 5GMKi 4C92F 3SB2A 1YP5A 3EG1A 4KUDK 3CMET 1D0XA 5I2SA 2LP5A 3WXMB 3BDUA 5KYUB 1VQ5T 4RTUA 5IT9E 1CKAA 1KQSS 3REBB 1HJDA 1VIEA 2ABLA 3QDFA 3OYCA 2GTJA 1I0CA 1ABOA 5AYFA 2YRCA 3I55A 3G1JA 1UGRB 1VQOA 2ZGWA 4HXJA 1UGPB 2L5QA 4M77B 5IXFA 4JRPA 3MP1A 3NGPA 4M77D 1U3OA 1VYVA 5CK9A 5HK3A 3RMSA 3L2WA 2FZCB 3CCUT 1WJQA 2P0QA 3A8MB 4X34A 1OV3A 1VQ8T 3KBGA 4MZMA 4M78B 3U23A 2B86A 1YHQA 3CC4T 4M78D 3OS0A 2ZPEB 3H6ZA 4DOWA 1FMKA 1VQ7Q 3THKA 4M75C 3VS5A 4J8OA 4QVDA 3I56T 1OEBA 3ZFJA 4M7AC 1WHKA 2L0AA 4XTXA 1OX8A 1QW1A 1PSEA 2DBKA 4J9FA 5LJ3h 2ECZA 1D3BA 2GBQA 4BDZA 1WFWA 4E7SA 1MMAA 3HKSA 2KAFA 1RABB 5J26A 2K3BA 1QQJA 3MEVA 2V8IA 3CC2A 2M9UA 1ZSZB 3VU3C 3OA6A 2EAYA 2YLCA 2X3XD 4OB3B 2K2VA 1B07A 2OTJA 1VOMA 1KC8R 2DVEA 1IO6A 3DB4A 2QEXQ 4KGVB 3X25B 1YIJQ 1W4SA 4F04B 3KFVA 2LCCA 1BIBA 3PT9A 1CKBA 2DMOA 4B9WA 5KYXA 1MHNA 2QK0A 1M1KC 1VQ9Q 2DZCA 4OB2B 4GBQA 2RQVA 1M90R 2MPXC 3LX7A 3BY7A 1NZ9A 3RIRA 1F1BB 4WTOB 5GAN8 1WJSA 4M77G 1S72Q 1W2BA 1D0YA 2QGFB 3OBWA 3CMAT 3QWYA 3V8LA 5GMKm 3PGGA 3H0IA 4QVCA 1FMWA 2H3EB 2MMPA 4DBQA 7AT1B 4JS5A 3EFOA 4ZGEB 4C92C 3VS6A 4M78G 3OYFA 3GNFB 3PNWC 1SHFA 2X35A 1GCPA 3RESA 3JSCA 2E3IA 2FRWA 4N0AC 3JB9I 2JTEA 3L2RA 1NPPA 1WI7A 3JCMc 1S1NA 1Q81U 3PVLA 4J5YA 4XK8E 5ECAA 2AKLA 4FYVB 3OS5A 2MWOA 2EPDA 3CXCS 3OMGA 1P92A 3TSWA 2EW3A 2OTLQ 2DFUA 5IH2A 1X01A 3RDVA 1WHHA 1RAFB 4HVWA 3TVTA 2YRVA 2PQWA 1Q82R 3QBYA 3A5ZB 3FIFA 4LD9K 2CKKA 1VQMQ 4Y92A 4DEYA 3EG3A 2XU8A 3JCMe 4P5NA 4J6YA 5KE2A 5CVIA 1ZUYA 1VQPQ 2YUPA 2QI2A 1QCOA
chains in the Genus database with same CATH topology
4RKUE 3J81E 4C92E 1Q82C 1K73U 3JRZA 2ZCFB 2LX9A 4JLIA 4C5HA 4PJOA 4IUQA 3VUZA 3QUIA 1NJIC 1LOJA 1N27A 1NE8A 4FT4A 4M75B 4CI0C 3OYBA 4EMKC 1G3TA 3HPWA 4ZN3A 3OYLA 3A8GB 4M7AB 3HRUA 2JZ2A 5CR2A 4XQ3A 3OSVA 5FU6C 3LWIA 2E64A 4A4GA 3GP8A 2L3RA 2RHZA 3M58A 3MCAB 3QZ5B 1VQKT 4XU1A 2EFIA 4BUGA 3QYGB 3GOXA 1U8RA 4OB1B 3QJ6A 3CC7T 4JDSA 3EAEA 4R55A 3OBYA 4EMGA 4IUVA 2O01E 3P8BB 5FU7C 3META 5GAMd 4C8QB 5LL6S 1VQLT 5GAOm 2XDBA 2CS7A 2NLUA 5GAMf 4KT0E 3URGA 4C8QD 2PVOB 1WQWA 3HHTB 1BIAA 5GAMh 1Y07A 4M7DB 4LD6A 2CGHA 1BI2A 2GFUA 5CAIA 5GMKl 4M7DD 3C94A 3G4SA 4A53A 4A4FA 1WGSA 2Y4YA 3GF5A 4L6V5 3SDZA 1EIFA 1I4K1 1YJNT 4HCZA 2K5FA 2VGMA 1UEBA 2ZZDA 3DKMA 3P8HA 5GMKj 4XTYA 2X4YA 4PLLA 4PJOB 2ZPBB 2XKOC 2LC4A 4KULA 5D6WA 5A0GA 3JCMd 1W2BS 1KC8U 3CCQT 2RI3A 5FRNA 2VGNA 3MEWA 4DA4A 2E6ZA 2JNGA 4Y28E 1N6AA 2GCXA 3M53A 4LDWA 5GANe 2K57A 3JCMh 2EJFA 3HP9A 4OVAA 5GAN2 2EQUA 3E19A 4YTLA 2FHDA 2RHXA 3E1SA 2MAMA 3SFMA 2E10A 3OW2A 2GFAA 1V29B 4BE2A 2XD0A 3M57A 3QO3A 4Z02A 4ZGDB 3H8ZA 4EDUA 5GMKh 1Q7YC 2XICA 1Y7XA 3OMCA 4IKFA 2K3XA 2HQEA 3CCRT 1H641 4BDYA 1M90U 4M7DF 2ZPHB 2MWPA 5GAN7 3FJPA 3OQ5A 3CCJT 5FRMA 2M1HA 2EJGA 1BI1A 2JTMA 3UT1A 4D6WA 2YLBA 1VQKA 4LDXA 2XI9A 4JRKA 3NTIA 2BIVA 2LQKA 3RKYA 3CC7A 2EYQA 1Y71A 1YJ9T 3MHXA 4HT8A 3VV0A 1G3WA 4A54A 5DY9A 3JCMb 1VQLA 1BI0A 1UB4A 3OY9A 2LRQA 3L1AA 2R58A 3RKXA 1NPRA 2RK1A 4TVRA 4QQ6A 5LJ5e 3OYMA 4ZGJB 4EMHA 5CKHA 5CKDA 4F7UB 1QP3A 3FDRA 3TEEA 2JVVA 2QQRA 2GF7A 4XTVA 5GANj 4C92B 4X9DA 3BW1A 4HT9A 5IAYA 4BD3A 4C92D 2LT4A 2ZPGB 4OP0A 1YJNA 1Q86C 3LW5E 3V8JA 2LTOA 2EIFA 3JCMg 5A0DA 3JB9G 3ZEHA 1JRIA 2DXBA 3CCQA 4M75G 2R5AA 5GANd 3OYGA 4IUPA 1BI3A 4MMKA 2F5TX 4ZTJA 4M7AG 3M55A 4M77C 3FEOA 4II1A 1KD1U 4GLKA 4FU6A 5GANh 4XU3A 1KHIA 5KCHA 3JB9J 3QKJA 3J80E 1O75A 2F5KA 2RO0A 3KUFA 5J39A 2XDDA 3VUBA 2RA2A 4OGEA 3V7RA 3PIOA 3CCET 3INZA 3X26B 4KBMB 3M5AA 4BB7A 1KQSA 4ATOA 1N9SA 3MP6A 2P0PA 3RUXA 5KCOA 5KH6A 2M16A 2WSFE 3CCRA 4BI8B 4XAXB 2B8AA 4JRIA 4E7HA 2WACA 3CBPA 4C8QG 1Q81C 1VQNT 2XDPA 3O8VA 5LJ5j 4C8QA 2HAXA 3CCJA 5EG2A 3DLMA 2RJEA 4J6WA 3AHUA 4J83A 3VJPA 2JN0A 2ZPFB 1VQ6T 4M7DG 5I2MA 3JB9H 4M78C 2E65A 3LGFA 1YJ9A 4M7DA 2DIQA 4NL3A 3A8OB 2A7YA 1QVGA 3OYNA 3LYIA 4XTZA 1X75C 1Y96A 3QPHA 4ELZC 4NL2A 1N8RC 1YI2T 5LJ5d 3OYYA 1YCYA 4L5GA 4XTUA 5GAOl 3M59A 3SWNC 3PMIA 4IURA 3JB9F 3OB9A 4M75F 2G3RA 2M0OA 5LJ5h 2X4WA 3DLLA 4M7AF 2V8KA 1QVFA 3Q1JA 3M4GA 1G5VA 3OS1A 3KXTA 3ASKA 3QDRB 1I81A 2KQWA 3OYIA 2E6NA 1SSFA 2QXFA 4MZPA 4RCBA 2H3JA 3G7ZA 2FVUA 5GANg 3OYAA 3CPWA 2RM4A 1K8AU 4C8QF 4EMKB 1FWZA 1XNIA 2FYKA 3WVEB 1WNLA 3UWNA 5CQYA 1R8OB 4GY5A 4N4HA 3X28B 4ELYC 4ZN1A 2ZPIB 2RJDA 2EQJA 4IUUA 2CZ7B 5FU6B 3JCMV 4O5VA 3FRNA 3RMQA 4BI3A 3QG1A 3GIBA 3CCEA 2XK0A 3M9QA 4QVZA 3EFSA 3MP8A 4M77E 3OYDA 1OYXA 4A4EA 4PLIA 2HD0A 3OYKA 3CBMA 1VQ7T 1Y96B 1JB0E 1M1GA 1ZQ1A 1VQNA 5D6YA 5CKEA 4C5IA 5GAN3 4PJOF 5FU7B 1M1KU 4JUVA 2JOYA 4E47A 4BE1A 1K9MU 3RKWA 4F7UG 1VQ6A 2YHTA 3OW2S 4F7UA 3CPFA 3JCMf 3A8HB 4C92G 4E7LA 5GAOq 5LJ5g 4HKEA 4C92A 1DJ7B 1YI2A 1KQ2A 4C0GA 2MF2A 1IZ6A 3S6WA 5C0MA 4JRQA 4C0ZA 4M78E 5CCAA 2DEQA 4A4HA 5GAN4 1VQ8A 3E9GA 1LNXA 4FT2A 4JS4A 4C5GA 3I55T 4N0AA 1QP2A 2KDSA 3C95A 2XG8D 3FB9A 5DLOA 2FL7A 2KY9A 3CEYA 2RJFA 2V8JA 4NS5A 1VQOT 3R6OA 3C4SA 2DXTA 4HCBA 3HSBA 3L42A 1LJOA 2CZ6B 2KK4A 3OSSC 4E7JA 2IG0A 2F69A 3QXEB 3I56A 3UPUA 1X6OA 3S3OA 1M4ZA 4EPCA 4BI4A 2GQVA 2K3YA 1KC8C 1RL2A 4PL6A 2VV5A 2P0KA 2QEXT 1YIJT 1B34A 3V7SA 2JUFA 2PUKB 4M75E 4RG2A 1IREB 1FXXA 5KE3A 2D6FA 4F7UF 2RHIA 4M7AE 3BFMA 4FL6A 5M9OA 1KG1A 2A3LA 5GMKi 4C92F 2LQ8A 3SB2A 1BYMA 1VQ4T 1VQ7A 4KUDK 2DTHA 4R56A 3A8LB 3CMET 3C12A 4HA8A 5I2SA 1VQ9T 3WXMB 3BDUA 4XTWA 3VYGA 2OAUA 5C6SA 5DM7R 3QZ9B 3TU4K 1VQ5T 2E1HA 3QSUA 2I2LA 2JTFA 2EJ9A 5IT9E 4XU2A 4FSXA 1S72T 1KQSS 1VIEA 2HBPA 3HRTA 3L2ZA 3OYCA 4E7IA 5GANf 5GAOn 5LJ3e 1JJ2A 2VC8A 3HFNA 2E12A 3TREA 1YBYA 3L2VA 3T9NA 4MDWA 1N9RA 4PNOA 5AYFA 1ZBXA 3I55A 1UGRB 4PJOE 5FROA 2QQ9A 1VQOA 1QVGS 3PIPA 2QTXA 1B34B 2ZGWA 3QIIA 2BUDA 4EMKA 4VUBA 1RI0A 1UGSB 2L5QA 1UGPB 1XOVA 2DAQA 4M77B 4OF1A 1WPYA 2EKOA 3LH0A 4Y91A 4CRIA 3MP1A 2PVDB 4JRPA 3CC2T 1GXIE 4M77D 4BY6C 2RB6A 4OMFB 3NTHA 4FM4B 5CK9A 5IN1A 3PFSA 2QEXA 3M56A 4BE0A 5HK3A 3RMSA 3L2WA 1YIJA 1JBMA 1M9SA 2EQMA 3CCUT 1QVFS 1WJQA 2RD1A 4N4GA 5GAMe 2OTJT 2Y90A 5A0LA 1Q82U 5CKFA 2P0QA 3A8MB 1KD1C 3CXCA 5LJ5f 1NJIU 1MGQA 4X34A 3F70A 2VYTA 4C0DC 1O9SA 1VQ8T 3ME9A 3CBOA 1VQ4A 4PKCC 3KBGA 3EFRA 4MZMA 1VUBA 4M78B 2L8DA 3CMEA 1OZ3A 3HL8A 3CPWS 1KHCA 1YHQA 1VQ9A 3CC4T 4N4IA 5LJ3j 3OYHA 2LDMA 4M78D 3OS0A 2ZPEB 3H6ZA 3VKIA 2PVGB 4DOWA 5HKCA 1VQ5A 2OTLT 4V2SA 4WF2A 3SWNB 4M75C 2VXFA 3GPLA 4J8OA 2IVWA 4QVDA 3I56T 2QQSA 1M1FA 1WJRA 2QQAA 3ZFJA 1S72A 3J7AF 4M7AC 3GLXA 5LJ3d 4X9CA 4XTXA 2KMTA 1QW1A 1PSEA 2PU9B 3M54A 4J7IA 2QQBA 5GMKe 3HFOA 1KQ1A 1TH7A 5LJ3h 2LCLA 1D3BA 4BDZA 3SD4A 5GAN6 3HKSA 3OYEA 3JB9D 1K73C 1VQMT 2LVMA 2KAFA 2XIDA 2E5QA 4JLGA 3JCMQ 4M75D 4C8QC 3MO8A 5J26A 1YJWT 5GAMj 4XU0A 4DQ2A 3QHSA 4M7AD 4C5EA 2C06A 1UGQB 3FLGA 3FC3A 2RHUA 3G6ET 3MEVA 3CCST 2V8IA 4QW2A 1VQPT 3CC2A 2M9UA 4M7DC 3LGLA 4DOVA 2RJCA 3VU3C 3OA6A 3PTAA 3P8DA 2EAYA 2HNIA 2YLCA 3NFCA 2R5MA 4LDYA 3HRSA 1H3ZA 5GAOp 2R57A 2XHCA 4OB3B 3DB3A 1K8AC 2K2VA 2MI6A 3CCUA 2BKDN 3S3MA 4MDXA 2OTJA 4PJOC 2DVEA 2DD4A 2P4TA 3DB4A 3CCLT 3MEAA 3X25B 4QQGA 1Q7YU 3QYHB 3NTKA 1YITT 1W4SA 4ZTFA 3CCMT 2O4XB 3GNGA 1HXDA 3CCVT 2LCCA 3CC4A 2DTOA 1PSFA 4KUIA 1BIBA 5CIUA 1ZHIA 3V8KA 3L2QA 2DXCA 3PT9A 2X4XA 4B9WA 3WVDB 2OTLA 2QDYB 4B9XA 1WQ7A 4L59A 2PUOB 1MHNA 1M1KC 1D3BB 4UC4A 2DZCA 4OB2B 3L2UA 1K9MC 3CD6T 2DK3A 4PJOD 3LX7A 4ME7A 3BY7A 5LJ3g 1NZ9A 3RIRA 3TCJA 3MEUA 2KVQG 5GAN8 1WJSA 1G3SA 2DJZA 2DPPB 4M77G 3JAME 4M77A 2DO3A 3X20B 1W2BA 1XTDA 2AHJB 5J3BA 5GAN5 1VIFA 4RMOA 3G71T 1OI1A 2EQKA 3OBWA 1VQMA 3CMAT 3V8LA 5GMKm 3OYJA 1YJWA 1Q86U 3PGGA 3JCMX 3LWHA 1YHQT 2QA4T 4QVCA 3G6EA 1M90C 1I5LA 1JJ2S 3ER0A 4RG8A 3CCSA 2MMPA 1VQPA 3X24B 3RERA 4MZTA 4Q5WA 4JS5A 2L89A 4C8QE 2D9TA 2DTIA 4J7FA 4C92C 4ZGEB 4M78G 5FLXE 5GAMg 3OYFA 4NOYA 3GNFB 3PNWC 3UDCA 4OB0B 4M78A 2CYZB 2X35A 4O6JA 5GAOr 4RCCA 2K4YA 4M7DE 4LDUA 1AHJB 3RESA 3JSCA 2FB7A 4N0AC 3CCLA 3JB9I 3SWNA 5DLQE 1I8FA 3L2RA 1FX7A 1NPPA 1YITA 5I21A 5L8RE 3JCMc 2LNVA 3CCMA 1Q81U 3VYHB 2RI5A 4J5YA 3CCVA 2KSSA 4OGCA 3PMTA 4XK8E 4M77F 3JCMJ 1QVPA 1U1TA 4JJNK 3N5BB 2DIGA 2RI2A 4QQDA 5HY6A 4MMLA 3OS5A 1U1SA 2MWOA 3CXCS 3CD6A 2DD5A 4M75A 3OMGA 1P92A 4IUTA 2RHYA 1N8RU 2DZ9A 4BACA 5LJ3f 4M7AA 3S3NA 1X01A 1XQHA 3QJYA 2HQXA 5CKBA 3OS2A 2CZ0B 3V7CA 2YRVA 2PQWA 3G71A 4M78F 5D6XA 3CMAA 2K5LA 2K5IA 3QBYA 4BY6B 5CO7A 4HCCA 2DXUA 3A5ZB 4J6XA 3G4ST 5HK0A 2E41A 3E9FA 2QA4A 3JCMP 2WSCE 3FIFA 2VUBA 1OZ2A 2CKKA 4LD9K 2EWNA 2RK2A 2LT1A 2RH2A 2WSEE 2X4JA 4FIBA 5A2QE 2XU8A 1M5Q1 2Y4XA 1M8VA 1BKBA 3ZBDA 3JCMe 3LLRA 2VXEA 4C0FA 4P5NA 5CQXA 4C0DB 4J6YA 2CZ1B 2D0QB 2DKGA 5CVIA 3BDLA 2O4XA 5KE2A 3JCMW 2E70A 2QI2A 4LDVA 4F7UE 4E7KA 4A4KA 3M4YA 1HK9A 4PJOG 1G3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  3JRZ A;  3VUB A;  5CKH A;  5CKD A;  1NE8 A;  5DLO A;  4MZM A;  3HPW A;  1VUB A;  5CO7 A;  5HK0 A;  5CR2 A;  4VUB A;  5CKE A;  5CQY A;  4ELY C;  2VUB A;  2C06 A;  4MZP A;  5HKC A;  4OF1 A;  4MZT A;  3G7Z A;  4ME7 A;  1M1F A;  3NFC A;  5CK9 A;  5CQX A;  3TCJ A;  1X75 C;  4ELZ C;  5HK3 A;  4HKE A;  2KMT A;  4MDX A;  1UB4 A;  2MF2 A;  5CKB A;  3JSC A;  5CKF A; 
#chains in the Genus database with same CATH topology
 4RKU E;  4C92 E;  3JRZ A;  2LX9 A;  3VUZ A;  4M75 B;  5D7U A;  1PRM C;  4M7A B;  3FJ5 A;  4PFZ A;  3CXC P;  4QKU A;  3CCV Q;  2RHZ A;  3M58 A;  3MCA B;  4LUD A;  3GOX A;  1U8R A;  4OB1 B;  3EAE A;  1ABQ A;  4IUV A;  3MET A;  5GAM d;  3CD6 Q;  5LL6 S;  1H8K A;  5GAM f;  4KT0 E;  2AZS A;  1WQW A;  5KYY B;  1Y07 A;  2DER A;  2DRK A;  1MMG A;  3G4S A;  4A53 A;  4A4F A;  1WGS A;  4OMM A;  1PNJ A;  1Q7Y R;  1I4K 1;  1YJN T;  2VGM A;  2QYZ A;  2ZZD A;  5GMK j;  2FZK B;  1RAA B;  5A0G A;  3JCM d;  2RQT A;  3QWX X;  1YHQ Q;  5FRN A;  1RI9 A;  4Y28 E;  3M53 A;  2GCX A;  4LDW A;  2EJF A;  2EQU A;  2CUB A;  2FHD A;  2RHX A;  2MAM A;  1RLP C;  2E10 A;  3SFM A;  2GFA A;  3M0Q A;  2CSI A;  4EDU A;  2A08 A;  3CCR T;  5GAN 7;  3I5R A;  3OQ5 A;  1BI1 A;  2JTM A;  2KR3 A;  2YLB A;  2KI7 A;  1Q86 R;  2H8H A;  2EYQ A;  1Y71 A;  4HT8 A;  3ULR B;  5DY9 A;  4B6M A;  3EGD B;  1VQL A;  3OY9 A;  1M27 C;  2E5K A;  3L1A A;  2R58 A;  1RAH B;  1NPR A;  4QQ6 A;  1G83 A;  3NPF A;  2GF7 A;  4C92 B;  2EGC A;  3BW1 A;  3SEM A;  4BD3 A;  4C92 D;  4OP0 A;  2LT4 A;  2EIF A;  1YFN A;  3JCM g;  3CCQ A;  4M75 G;  5EC7 A;  1T3L A;  4M7A G;  2DNU A;  3FEO A;  1ZA1 B;  4GLK A;  2AKK A;  1UJY A;  4Z8A A;  3QKJ A;  1ACM B;  2DLP A;  1N8R R;  1KK7 A;  3KUF A;  4OGE A;  3V7R A;  3PIO A;  3X26 B;  4KBM B;  3M5A A;  5KH6 A;  5KCO A;  2M16 A;  1E6H A;  4BI8 B;  4XAX B;  2GGR A;  1VQN T;  1PG5 B;  2XDP A;  4C8Q A;  4OMO A;  3CCJ A;  2FO0 A;  1W70 A;  2KRO A;  2K6D A;  2JN0 A;  5I2M A;  4M7D A;  1NM7 A;  2FEI A;  2VWF A;  4KRT A;  1QVG A;  1X75 C;  1Y96 A;  3QPH A;  5GAO l;  3MKD A;  4M4Z A;  1GFC A;  3PMI A;  3EGX B;  8ATC B;  1HD3 A;  2CP5 A;  1OQK A;  3M4G A;  3QDR B;  4OMN A;  3OYI A;  2E6N A;  1K4U S;  1A0N B;  2A37 A;  2FVU A;  3OYA A;  3CPW A;  2RM4 A;  1LCK A;  4C8Q F;  2K2M A;  1FWZ A;  1XNI A;  4GY5 A;  3X28 B;  4M7D F;  3GIB A;  3QG1 A;  3M9Q A;  3MP8 A;  2IIM A;  1YWO A;  3OYK A;  2YRD A;  1JB0 E;  1MUZ A;  2KYM A;  4C5I A;  5GAN 3;  4JUV A;  2JOY A;  1YN8 A;  5IHI A;  2DYI A;  2HQH A;  4C92 G;  5GJV B;  1MNE A;  4HKE A;  4C0G A;  5C0M A;  1YJ9 Q;  2ROT A;  5CCA A;  3E9G A;  3I55 T;  1QP2 A;  1W6X A;  5DLO A;  2KY9 A;  2V8J A;  1QMC A;  3H0H A;  1VQO T;  3R6O A;  1LJO A;  1WHL A;  2KK4 A;  2F69 A;  3NHN A;  1KC8 C;  4PL6 A;  2QTV A;  1B34 A;  2JUF A;  1IRE B;  1M30 A;  5KE3 A;  4DBF A;  1B7T A;  2RHI A;  2A36 A;  4FL6 A;  5M9O A;  1BYM A;  1TOV A;  1VQ7 A;  4R56 A;  3A8L B;  4HA8 A;  4XTW A;  3TU4 K;  3ZL7 C;  3QSU A;  2I2L A;  2EJ9 A;  3L2Z A;  4E7I A;  5GAN f;  5LJ3 e;  3M0P A;  2VC8 A;  3REA B;  1JJ2 A;  3EG9 B;  4E7Z A;  2J06 A;  4RUG A;  4RTV A;  2NUT A;  2ATC B;  2CSQ A;  1R0B G;  3PIP A;  3QII A;  2QAZ A;  2DAQ A;  4FSS A;  4OF1 A;  1WPY A;  2EKO A;  3LH0 A;  3BE3 A;  2PVD B;  3CC2 T;  2CT4 A;  4OMF B;  9ATC B;  4FM4 B;  2A28 A;  3PFS A;  2QEX A;  4BE0 A;  1YIJ A;  3TQ7 P;  1JBM A;  2EQM A;  2RD1 A;  4N4G A;  2OTJ T;  2Y90 A;  1Q82 U;  1KD1 C;  5LJ5 f;  3F70 A;  2DL3 A;  1UDL A;  4C0D C;  2YUO A;  3EFR A;  2AK5 A;  2KGT A;  4LE9 A;  3I5S A;  1VQ9 A;  3RBB B;  4N4I A;  3OYH A;  1RAE B;  2PVG B;  2LZ6 B;  2RQR A;  3GPL A;  3J7A F;  1S72 A;  4WCI A;  2JS0 A;  5LJ3 d;  4AT1 B;  1VA7 A;  2CP0 A;  2QQB A;  5GMK e;  2M51 A;  1TH7 A;  5GJW B;  3JB9 D;  8AT1 B;  1K73 C;  2LVM A;  3JCM Q;  1FMV A;  1U5S A;  2E5Q A;  2J6K A;  4C8Q C;  5GAM j;  3UAT A;  3QHS A;  1UE9 A;  3R6N A;  2M02 A;  2EKH A;  4QW2 A;  4M7D C;  4DOV A;  2RJC A;  1H3Z A;  2R5M A;  5GAO p;  1K9M R;  1AWX A;  1W1F A;  1K8A C;  2BKD N;  2KYB A;  4MDX A;  1M2V B;  1HSQ A;  2KE9 A;  4QQG A;  1Q7Y U;  3NTK A;  1OPL A;  1X27 A;  2FRY A;  3GNG A;  2DTO A;  2HSP A;  5CIU A;  1ZHI A;  3L2Q A;  2DXC A;  1VQ4 Q;  2OTL A;  3WVD B;  4L59 A;  3L2U A;  5LJ3 g;  1C1A A;  4IIO A;  1XJW B;  2L3P A;  2KVQ G;  4GLM A;  2DJZ A;  1G3S A;  2DPP B;  1AEY A;  3JAM E;  1T0H A;  1ZA2 B;  4RMO A;  1GBQ A;  1VQM A;  5KYW B;  2KNB B;  2GNC A;  2DE0 X;  1Q86 U;  1SHG A;  2W10 A;  1VQP A;  4C8Q E;  2EVR A;  5GAO r;  2K4Y A;  4M7D E;  4CC7 A;  1AHJ B;  4Z88 A;  3I35 A;  2RN8 A;  3CCV A;  2KSS A;  3PMT A;  1OU8 A;  3JCM J;  1U1T A;  3N5B B;  1E6G A;  2RI2 A;  3VS3 A;  1TUG B;  3CD6 A;  2DD5 A;  1UHF A;  3H0F A;  1N8R U;  1M8M A;  3S3N A;  2HQX A;  5CKB A;  2JT4 A;  1CSK A;  1X2Q A;  1Q95 G;  4HCC A;  2BZX A;  4J6X A;  3G4S T;  1M3C A;  1NJI R;  2F2X A;  2EWN A;  2LT1 A;  2WSE E;  2X4J A;  1YJW Q;  1M5Q 1;  2Y4X A;  4OMP A;  1JXM A;  2VXE A;  4C0D B;  2RQW A;  3G6E Q;  2D0Q B;  4J9G A;  5FWC A;  3CCS Q;  1KIK A;  4E7K A;  4A4K A;  3M4Y A;  2SEM A;  3HL8 A;  1G3Y A;  1WHG A;  5C6S A;  3J81 E;  4PJO A;  2CP7 A;  4JLI A;  1LOJ A;  1G3T A;  1C0M A;  3CCL Q;  3HRU A;  2X9H A;  5CR2 A;  4XQ3 A;  5FU6 C;  1YIT Q;  3LWI A;  4A4G A;  3CCM Q;  2L3R A;  4LN2 A;  2O01 E;  3P8B B;  5FU7 C;  2CP3 A;  4C8Q B;  1VQL T;  1PHT A;  5GAO m;  1TTH B;  2M0Y A;  4C8Q D;  3VS7 A;  1BIA A;  2PZ1 A;  4M7D B;  1YWP A;  4LD6 A;  1WXB A;  5CAI A;  4M7D D;  2DL4 A;  2Y4Y A;  3G71 Q;  3P8H A;  4XTY A;  4PLL A;  1W2B S;  5D6W A;  2OI3 A;  3CCQ T;  2QA4 Q;  4LXC A;  2RI3 A;  2GTO A;  1G5V A;  2JNG A;  1N6A A;  3HP9 A;  4OVA A;  3E19 A;  4YTL A;  3OW2 A;  3M57 A;  5GMK h;  4IKF A;  2K3X A;  4KGZ B;  3FJP A;  3VS1 A;  1AD5 A;  2DX1 A;  3EG2 A;  3CCJ T;  2M1H A;  2EJG A;  1UG1 A;  3UT1 A;  1ZBJ A;  2HCK A;  3MHX A;  3VV0 A;  1G3W A;  2EQI A;  1EFN A;  2HMA A;  3OYM A;  1D0Z A;  4EMH A;  5CKD A;  3FDR A;  1OX9 A;  2QQR A;  4Z89 A;  4XTV A;  4J9E A;  5GAN j;  2JXB A;  2VVK A;  5IAY A;  3OW2 P;  2ZPG B;  2LNH B;  1NLP C;  1W2B P;  1GCQ A;  2DXB A;  4AG1 C;  5HCK A;  3M0S A;  4MMK A;  4ZTJ A;  3M55 A;  1WHM A;  1X6G A;  1QCF A;  4FU6 A;  4XU3 A;  5KCH A;  4F16 A;  4BB7 A;  1N9S A;  3MP6 A;  2P0P A;  4K11 A;  3RUX A;  2KT8 A;  4E7H A;  1Q81 C;  1WHJ A;  4JRI A;  4C8Q G;  1WYX A;  5LJ5 j;  1N5Z A;  5EG2 A;  1ZX6 A;  4M7D G;  3JB9 H;  1YJ9 A;  2RMO A;  4RTW A;  3OYN A;  1OUL A;  3A98 A;  4NL2 A;  1VQK Q;  3AT1 B;  4L5G A;  3CC7 Q;  3JB9 F;  1NEG A;  4F14 A;  2COW A;  2X4W A;  2CRE A;  2V8K A;  1QVF A;  1HYO A;  3ASK A;  1I81 A;  2DET A;  1IXD A;  2QXF A;  3UA6 A;  4RCB A;  2NUT B;  3VRY A;  2OAW A;  2YSQ A;  1HK9 A;  2P84 A;  3WVE B;  1WNL A;  1X69 A;  2ZPI B;  5FU6 B;  4IUU A;  3JCM V;  2CZ7 B;  3FRN A;  3CCE A;  4QVZ A;  2KRN A;  1VQ7 T;  1OYX A;  3EHQ A;  3CBM A;  2MIO A;  5FU7 B;  1K9M U;  1K0X A;  2CP6 A;  1MV0 B;  1BCO A;  1VYU A;  2HBW A;  3JCM f;  3A8H B;  4E7L A;  1DJ7 B;  1G8X A;  2MF2 A;  4JJD A;  2NUP A;  1LPL A;  2BE9 B;  2DEQ A;  5GAN 4;  1VQ8 A;  1LNX A;  3I9Q A;  3C4S A;  2DXT A;  3OSS C;  3QXE B;  3I56 A;  3S3O A;  4EPC A;  4BI4 A;  1RL2 A;  2J6O A;  2VV5 A;  1BCM A;  1AZE A;  2QEX T;  4AMC A;  1YIJ T;  3V7S A;  4RG2 A;  1AZG B;  1B3Q A;  2A0F B;  4AFS C;  3BFM A;  1KG1 A;  2LQ8 A;  2QDL A;  2DTH A;  3C12 A;  1VQ9 T;  1AVZ C;  1WZO A;  2D0N A;  2OAU A;  3VYG A;  5DM7 R;  1GRI A;  2E1H A;  1I5O B;  1V76 A;  1RLQ C;  2JTF A;  2L3S A;  4XU2 A;  1IRX A;  1S72 T;  1RUW A;  1VQ6 Q;  2F2V A;  3HFN A;  3TRE A;  1EZZ B;  3L2V A;  3IQL A;  3T9N A;  4ORZ A;  2F2W A;  3M0U A;  4PNO A;  1YI2 Q;  4F17 A;  4PJO E;  5FRO A;  2QQ9 A;  1QVG S;  2QTX A;  4EMK A;  2QGG A;  4PJJ A;  2L2P A;  1UGS B;  4CRI A;  2BTT A;  2RB6 A;  5IN1 A;  1M9S A;  4ANJ A;  2CP2 A;  5CKF A;  2LMJ A;  1NJI U;  1ZSZ A;  2VYT A;  1O9S A;  3CBO A;  1VQ4 A;  4PKC C;  1OZ3 A;  3CPW S;  1GCQ C;  1IGU A;  1X43 A;  1TSF A;  4LUE A;  2OTL T;  1SSH A;  2VXF A;  1PWT A;  2IVW A;  3EGU A;  1M1F A;  1WJR A;  2QQA A;  2LQW A;  2KMT A;  4PJM A;  2PU9 B;  3M54 A;  1KQ1 A;  1Y0M A;  2DBM A;  2E4H A;  1QVG P;  1VQM T;  4DEX A;  2XID A;  4JLG A;  4DBR A;  4DQ2 A;  2C06 A;  3FLG A;  3FC3 A;  2RHU A;  1WDX A;  1VQP T;  2X3W D;  4J9I A;  3LGL A;  1ZSG A;  3P8D A;  4LDY A;  4AFU C;  1M1K R;  3HRS A;  1E7O A;  1AWO A;  3DB3 A;  3UA7 A;  4PFP A;  2P4T A;  3MEA A;  1UTI A;  1WA7 A;  3CPW P;  4ZTF A;  1IHV A;  4PK4 A;  4HCK A;  1LVK A;  2KT1 A;  3EH1 A;  1HXD A;  3CCV T;  3CQT A;  4J9B A;  1JQQ A;  3VS4 A;  2QDY B;  4B9X A;  2V1R A;  3CME Q;  1D3B B;  4UC4 A;  2O31 A;  3CD6 T;  2DK3 A;  4PJO D;  1BU1 A;  1IB8 A;  4ME7 A;  1VQ5 Q;  3TCJ A;  2NYS A;  3X20 B;  5GAN 5;  5J3B A;  1OI1 A;  2EQK A;  3TSZ A;  1YJW A;  3D7S B;  3LWH A;  1YHQ T;  3G6E A;  1M90 C;  1JJ2 S;  3CCE Q;  3ER0 A;  3CCS A;  3RER A;  4Q5W A;  2DTI A;  4J7F A;  5FLX E;  1WLP B;  2CYZ B;  1WXT A;  4PJL A;  1PCX A;  4RCC A;  2RNA A;  4LDU A;  3CCL A;  5KYX B;  3SWN A;  5DLQ E;  1I8F A;  3CCU Q;  1YIT A;  1X6B A;  2J05 A;  2LNV A;  3CCM A;  2HZY A;  1UEC A;  1ZLM A;  4OGC A;  3JV3 A;  4PJN A;  1VQ8 Q;  1TU0 B;  2DIG A;  5IHN A;  2ZAE A;  4MML A;  1U1S A;  2EYY A;  4M75 A;  2RHY A;  2DZ9 A;  4BAC A;  4M7A A;  5IHK A;  3I56 Q;  3OS2 A;  2OJ2 A;  3G71 A;  5D6X A;  2JM8 A;  3EFO B;  1D1A A;  4FW1 A;  2K5L A;  4R0K A;  2DXU A;  1AWW A;  5HK0 A;  1JJ2 P;  4QT7 A;  1T3S A;  3E9F A;  2QA4 A;  2NUZ A;  2CH4 A;  3NMZ C;  2RK2 A;  2RH2 A;  5KYY A;  5A2Q E;  3ZBD A;  2FG0 A;  4C0F A;  5CQX A;  2CZ1 B;  2DKG A;  2O4X A;  4IIM A;  3JCM W;  2E70 A;  4LDV A;  2COY A;  1JXO A;  2SRC A;  2ED1 A;  5LJ3 f;  4PJO G;  2LJ3 A;  1Q82 C;  1K73 U;  2ZCF B;  1N27 A;  1NE8 A;  4FT4 A;  3OYB A;  4EMK C;  3HPW A;  4ZN3 A;  5AT1 B;  1BBZ A;  2E64 A;  3GP8 A;  2ED0 A;  4KH0 B;  2L3Q A;  3QJ6 A;  2EYX A;  4JDS A;  4EMG A;  4KGX B;  1QKW A;  4E2F B;  2CS7 A;  2PVO B;  3HHT B;  2HDA A;  2CGH A;  3C94 A;  3EGD A;  4L6V 5;  3SDZ A;  3CMA Q;  1UEB A;  4J9H A;  2X4Y A;  4KUL A;  2XKO C;  2LC4 A;  2VGN A;  4DA4 A;  5GAN 2;  4FCY A;  4BE2 A;  1M2O A;  3QO3 A;  4Z02 A;  4ZGD B;  1Q7Y C;  2XIC A;  5L23 A;  3M0R A;  2ZPH B;  1KFZ A;  1JU5 C;  2BZ8 A;  4D6W A;  2YXY A;  1VQK A;  4JRK A;  2BIV A;  2LQK A;  3CC7 A;  1NYF A;  1YJ9 T;  2AT1 B;  1UB4 A;  3RKX A;  2RK1 A;  5CKH A;  3LH5 A;  3TEE A;  4J9C A;  3EHR A;  1AT1 B;  1PD0 A;  2MK5 A;  2DIL A;  4X9D A;  1SG5 A;  2NUP B;  1Q86 C;  3EGX A;  5A0D A;  3JB9 G;  3ZEH A;  1JRI A;  1SRM A;  3OYG A;  4IUP A;  2DL5 A;  1WXU A;  4E6R A;  5GAN h;  3J80 E;  1O75 A;  2F5K A;  2HL5 C;  5J39 A;  2XDD A;  2RA2 A;  3CCE T;  3INZ A;  1KQS A;  2C0T A;  3PVQ A;  1SPK A;  4RTZ A;  2B8A A;  3CBP A;  2FPE A;  2DA9 A;  2IPO B;  2RJE A;  4J6W A;  3LGF A;  2DRM A;  2A7Y A;  2KRS A;  3LYI A;  4XTZ A;  4ELZ C;  1N8R C;  1YCY A;  4OMQ A;  1I1J A;  3SWN C;  1NEB A;  3O5Z A;  4KH1 B;  2G3R A;  2M0O A;  5LJ5 h;  2DVJ A;  3DLL A;  1SF9 A;  1MMD A;  3OS1 A;  3KXT A;  5I22 A;  1KJW A;  2KQW A;  1SSF A;  4CC2 A;  2H3J A;  1KQS P;  1M3B A;  3G7Z A;  1RAG B;  4CC4 B;  1IHW A;  3RNJ A;  1YJN Q;  4FYY B;  4EMK B;  3UWN A;  2QG9 B;  4ZN1 A;  2RJD A;  4BI3 A;  4PFO A;  2NWM A;  3OYD A;  4A4E A;  2D8H A;  1D09 B;  1Y96 B;  1M1G A;  1ZQ1 A;  2CH4 W;  5CKE A;  4PJO F;  1OU9 A;  1M1K U;  3RKW A;  3CCR Q;  1VQ6 A;  3OW2 S;  2XMF A;  1RAC B;  4F7U A;  4RTX A;  2MCN A;  5GAO q;  1YI2 A;  1KQ2 A;  4JRQ A;  2P4R A;  3S6W A;  4C0Z A;  4A4H A;  4FT2 A;  3H41 A;  2XG8 D;  3FB9 A;  2FL7 A;  3CEY A;  2RJF A;  4NS5 A;  2DM1 A;  4HCB A;  2KEA A;  3HSB A;  1PC0 A;  2V26 A;  3L42 A;  3EG9 A;  2CZ6 B;  5FWB A;  4E7J A;  2IG0 A;  3UPU A;  2P0K A;  4M75 E;  2W0Z A;  2D6F A;  4CC3 A;  4F7U F;  4M7A E;  2DL7 A;  1YCS B;  1K76 A;  1VQ4 T;  2Z0W A;  1WX6 A;  1AOJ A;  2RF0 A;  1GFD A;  3QZ9 B;  2JJ9 A;  4X1V A;  1VQN Q;  4FSX A;  2HBP A;  3HRT A;  2G6F X;  5GAO n;  1YNZ A;  2E12 A;  1YBY A;  2FPF A;  2K79 A;  3MPU B;  4MDW A;  1N9R A;  1ZUK A;  1ZBX A;  1KD1 R;  2MYS A;  1V1C A;  2ENM A;  5I11 A;  2KXC A;  1B34 B;  2BUD A;  4VUB A;  4D8K A;  1BB9 A;  1RI0 A;  1XOV A;  4Y91 A;  3SHW A;  1SEM A;  1GXI E;  1GBR A;  4BY6 C;  3NTH A;  1NYG A;  3M56 A;  1QVF S;  2E3H A;  5GAM e;  5A0L A;  1UHC A;  3CXC A;  1K1Z A;  1MGQ A;  3GBQ A;  2AZV A;  3ME9 A;  2QAS A;  1VUB A;  2L8D A;  3CME A;  1KHC A;  5LJ3 j;  2LDM A;  1D1C A;  1K73 R;  3VKI A;  2C0I A;  1VQ5 A;  4V2S A;  1TUC A;  5HKC A;  2J6F A;  1M2V A;  2YWW A;  4WF2 A;  3SWN B;  2QQS A;  1NBE B;  2DL8 A;  3GLX A;  4FYW B;  4X9C A;  4JPB W;  2JS2 A;  4J7I A;  3HFO A;  1K8A R;  2LCL A;  3M0T A;  2DJQ A;  2YUQ A;  3SD4 A;  5GAN 6;  3OYE A;  1NLO C;  4M75 D;  2C0O A;  2K9G A;  3MO8 A;  4FW2 A;  1EX4 A;  1YJW T;  1UUE A;  1UFF A;  4XU0 A;  4M7A D;  3I55 Q;  6AT1 B;  4C5E A;  2DF6 A;  1UGQ B;  3G6E T;  3EG0 A;  3CCS T;  1VQO Q;  3PTA A;  1QVF P;  3NFC A;  2HNI A;  5KYW A;  2VKN A;  2R57 A;  2XHC A;  2MI6 A;  3CCU A;  3S3M A;  3UF4 A;  4PJO C;  1H92 A;  2RQU A;  2DD4 A;  5KYU A;  3CCL T;  2LJ1 A;  3VS0 A;  1G2B A;  3QYH B;  1YIT T;  1TWB A;  1RAI B;  3CCM T;  1QWE A;  2O4X B;  3CC4 A;  1PSF A;  4KUI A;  2PTK A;  3V8K A;  2X4X A;  1U06 A;  1WQ7 A;  2PUO B;  1K9M C;  2OX7 A;  3RR6 A;  3MEU A;  2GQI A;  4M77 A;  2DO3 A;  1XTD A;  2AHJ B;  1VIF A;  1GL5 A;  3G71 T;  4J9D A;  3OYJ A;  3JCM X;  2QA4 T;  2MOX A;  1I5L A;  4RG8 A;  3X24 B;  2EGA A;  4MZT A;  2F1L A;  2PNI A;  2L89 A;  2D9T A;  5GAM g;  4NOY A;  3UDC A;  4OB0 B;  3HTR A;  4M78 A;  3CC2 Q;  4O6J A;  2EGE A;  2FB7 A;  1QCN A;  1PKS A;  1FX7 A;  1M3A A;  2OTJ Q;  5I21 A;  5L8R E;  3VYH B;  2RI5 A;  2KRM A;  2VB6 A;  2YT6 A;  4M77 F;  2YDL A;  1QVP A;  4JJN K;  1Y57 A;  2FPD A;  4OML A;  4QQD A;  5HY6 A;  1Z9Q A;  4JZ3 A;  4IUT A;  1XQH A;  3QJY A;  2CZ0 B;  1X2K A;  3V7C A;  2BZY A;  2YUN A;  1QKX A;  2HSE B;  2HEQ A;  4M78 F;  3CMA A;  4BY6 B;  2K5I A;  4DBH A;  5CO7 A;  2E41 A;  3JCM P;  2WSC E;  2VUB A;  1OZ2 A;  4FIB A;  2K7A A;  1M8V A;  1BKB A;  3LLR A;  2EYZ A;  3BDL A;  1ZUU A;  2LCS A;  4F7U E;  4C5H A;  4IUQ A;  4JJB A;  3QUI A;  1NJI C;  4CI0 C;  3OYL A;  3A8G B;  1PKT A;  2JZ2 A;  3OSV A;  1VQK T;  1Z9Z A;  3QZ5 B;  4XU1 A;  2EFI A;  4BUG A;  3QYG B;  3CC7 T;  4R55 A;  3OBY A;  1QLY A;  1UJ0 A;  2XDB A;  2NLU A;  3URG A;  5GAM h;  2EYW A;  4JJC A;  2EBP A;  1BI2 A;  2GFU A;  1TXQ A;  5GMK l;  1IGQ A;  2D8J A;  3GF5 A;  1EIF A;  4HCZ A;  3E2U A;  2K5F A;  3DKM A;  4EIK A;  4PJO B;  2ZPB B;  1KC8 U;  2COZ A;  2CUD A;  1SKU B;  1J3T A;  3MEW A;  2E6Z A;  5FW9 A;  5GAN e;  2K57 A;  3JCM h;  1PRL C;  3E1S A;  1V29 B;  2XD0 A;  3C0C A;  2JMC A;  3H8Z A;  1Y7X A;  3OMC A;  4ESR A;  2O9S A;  2JMA A;  2HQE A;  4BDY A;  1H64 1;  1M90 U;  1K0S A;  2MWP A;  1MV3 A;  5FRM A;  4LDX A;  2XI9 A;  3NTI A;  3RKY A;  4AFZ C;  4A54 A;  3JCM b;  1BI0 A;  2D1X A;  2LRQ A;  5LJ5 e;  1H3H A;  4TVR A;  2DYB A;  1R77 A;  4RTY A;  4ZGJ B;  2LJ0 A;  4F7U B;  1QP3 A;  2JVV A;  1I07 A;  1VYT A;  3H9N A;  5IXB A;  2DEU A;  4HT9 A;  4ZNX A;  1YJN A;  2FZG B;  2X51 A;  3PE0 A;  3LW5 E;  3V8J A;  1Q81 R;  2LTO A;  2HL3 A;  3G4S Q;  1UGV A;  3CC4 Q;  2R5A A;  1JEG A;  5GAN d;  1BI3 A;  2F5T X;  4M77 C;  4II1 A;  1KD1 U;  2KXD A;  3MJX A;  1KHI A;  3JB9 J;  1BK2 A;  1MMN A;  2RO0 A;  1OPK A;  3VUB A;  4D8D A;  4ATO A;  2JM9 A;  2ESW A;  3CCR A;  2WSF E;  2WAC A;  2LQN A;  1TG0 A;  3O8V A;  2HAX A;  3A1P A;  3DLM A;  3AHU A;  2RPN A;  4J83 A;  3VJP A;  2ZPF B;  1VQ6 T;  4M78 C;  2E65 A;  1AWJ A;  1NG2 A;  2DIQ A;  3A8O B;  4NL3 A;  2O2O A;  1ARK A;  1YI2 T;  2KBT A;  3OYY A;  5LJ5 d;  4XTU A;  3M59 A;  4IUR A;  4A63 B;  4AG2 C;  3OB9 A;  4M75 F;  1FYN A;  2ROL A;  1VQL Q;  4M7A F;  2CDT A;  3Q1J A;  1SRL A;  4AFQ C;  1K9A A;  4FYX B;  2HKN A;  4MZP A;  2O9V A;  2I0N A;  5GAN g;  2HKQ B;  1MND A;  1K8A U;  1PD1 A;  2FYK A;  3CCQ Q;  5CQY A;  1R8O B;  4N4H A;  4ELY C;  5KYN A;  1ZSZ C;  2EQJ A;  4O5V A;  3RMQ A;  1QWF A;  2XK0 A;  2BE7 D;  3EFS A;  4M77 E;  2LX7 A;  4JZ4 A;  4PLI A;  2HD0 A;  1C6V X;  1VQN A;  5D6Y A;  1R0C B;  4E47 A;  2JW4 A;  4BE1 A;  4F7U G;  2YHT A;  1KSW A;  4HVU A;  3CPF A;  3CCJ Q;  1OOT A;  5LJ5 g;  1TS9 A;  4C92 A;  1IZ6 A;  4M78 E;  2J7I A;  3VRZ A;  2VAS A;  4JS4 A;  4C5G A;  4N0A A;  2KDS A;  1TUD A;  3C95 A;  2O88 A;  1JO8 A;  1WIE A;  3VS2 A;  1PM3 A;  4RTT A;  2CT3 A;  1RAD B;  2AIR B;  1D1B A;  1X6O A;  1M4Z A;  4HVV A;  2GQV A;  2K3Y A;  4LNP A;  3EH2 A;  2V1Q A;  1T0J A;  2PUK B;  1FXX A;  2A3L A;  5GMK i;  4C92 F;  3SB2 A;  1YP5 A;  3EG1 A;  4KUD K;  3CME T;  1D0X A;  5I2S A;  2LP5 A;  3WXM B;  3BDU A;  5KYU B;  1VQ5 T;  4RTU A;  5IT9 E;  1CKA A;  1KQS S;  3REB B;  1HJD A;  1VIE A;  2ABL A;  3QDF A;  3OYC A;  2GTJ A;  1I0C A;  1ABO A;  5AYF A;  2YRC A;  3I55 A;  3G1J A;  1UGR B;  1VQO A;  2ZGW A;  4HXJ A;  1UGP B;  2L5Q A;  4M77 B;  5IXF A;  4JRP A;  3MP1 A;  3NGP A;  4M77 D;  1U3O A;  1VYV A;  5CK9 A;  5HK3 A;  3RMS A;  3L2W A;  2FZC B;  3CCU T;  1WJQ A;  2P0Q A;  3A8M B;  4X34 A;  1OV3 A;  1VQ8 T;  3KBG A;  4MZM A;  4M78 B;  3U23 A;  2B86 A;  1YHQ A;  3CC4 T;  4M78 D;  3OS0 A;  2ZPE B;  3H6Z A;  4DOW A;  1FMK A;  1VQ7 Q;  3THK A;  4M75 C;  3VS5 A;  4J8O A;  4QVD A;  3I56 T;  1OEB A;  3ZFJ A;  4M7A C;  1WHK A;  2L0A A;  4XTX A;  1OX8 A;  1QW1 A;  1PSE A;  2DBK A;  4J9F A;  5LJ3 h;  2ECZ A;  1D3B A;  2GBQ A;  4BDZ A;  1WFW A;  4E7S A;  1MMA A;  3HKS A;  2KAF A;  1RAB B;  5J26 A;  2K3B A;  1QQJ A;  3MEV A;  2V8I A;  3CC2 A;  2M9U A;  1ZSZ B;  3VU3 C;  3OA6 A;  2EAY A;  2YLC A;  2X3X D;  4OB3 B;  2K2V A;  1B07 A;  2OTJ A;  1VOM A;  1KC8 R;  2DVE A;  1IO6 A;  3DB4 A;  2QEX Q;  4KGV B;  3X25 B;  1YIJ Q;  1W4S A;  4F04 B;  3KFV A;  2LCC A;  1BIB A;  3PT9 A;  1CKB A;  2DMO A;  4B9W A;  5KYX A;  1MHN A;  2QK0 A;  1M1K C;  1VQ9 Q;  2DZC A;  4OB2 B;  4GBQ A;  2RQV A;  1M90 R;  2MPX C;  3LX7 A;  3BY7 A;  1NZ9 A;  3RIR A;  1F1B B;  4WTO B;  5GAN 8;  1WJS A;  4M77 G;  1S72 Q;  1W2B A;  1D0Y A;  2QGF B;  3OBW A;  3CMA T;  3QWY A;  3V8L A;  5GMK m;  3PGG A;  3H0I A;  4QVC A;  1FMW A;  2H3E B;  2MMP A;  4DBQ A;  7AT1 B;  4JS5 A;  3EFO A;  4ZGE B;  4C92 C;  3VS6 A;  4M78 G;  3OYF A;  3GNF B;  3PNW C;  1SHF A;  2X35 A;  1GCP A;  3RES A;  3JSC A;  2E3I A;  2FRW A;  4N0A C;  3JB9 I;  2JTE A;  3L2R A;  1NPP A;  1WI7 A;  3JCM c;  1S1N A;  1Q81 U;  3PVL A;  4J5Y A;  4XK8 E;  5ECA A;  2AKL A;  4FYV B;  3OS5 A;  2MWO A;  2EPD A;  3CXC S;  3OMG A;  1P92 A;  3TSW A;  2EW3 A;  2OTL Q;  2DFU A;  5IH2 A;  1X01 A;  3RDV A;  1WHH A;  1RAF B;  4HVW A;  3TVT A;  2YRV A;  2PQW A;  1Q82 R;  3QBY A;  3A5Z B;  3FIF A;  4LD9 K;  2CKK A;  1VQM Q;  4Y92 A;  4DEY A;  3EG3 A;  2XU8 A;  3JCM e;  4P5N A;  4J6Y A;  5KE2 A;  5CVI A;  1ZUY A;  1VQP Q;  2YUP A;  2QI2 A;  1QCO A; 
#chains in the Genus database with same CATH homology
 4RKU E;  3J81 E;  4C92 E;  1Q82 C;  1K73 U;  3JRZ A;  2ZCF B;  2LX9 A;  4JLI A;  4C5H A;  4PJO A;  4IUQ A;  3VUZ A;  3QUI A;  1NJI C;  1LOJ A;  1N27 A;  1NE8 A;  4FT4 A;  4M75 B;  4CI0 C;  3OYB A;  4EMK C;  1G3T A;  3HPW A;  4ZN3 A;  3OYL A;  3A8G B;  4M7A B;  3HRU A;  2JZ2 A;  5CR2 A;  4XQ3 A;  3OSV A;  5FU6 C;  3LWI A;  2E64 A;  4A4G A;  3GP8 A;  2L3R A;  2RHZ A;  3M58 A;  3MCA B;  3QZ5 B;  1VQK T;  4XU1 A;  2EFI A;  4BUG A;  3QYG B;  3GOX A;  1U8R A;  4OB1 B;  3QJ6 A;  3CC7 T;  4JDS A;  3EAE A;  4R55 A;  3OBY A;  4EMG A;  4IUV A;  2O01 E;  3P8B B;  5FU7 C;  3MET A;  5GAM d;  4C8Q B;  5LL6 S;  1VQL T;  5GAO m;  2XDB A;  2CS7 A;  2NLU A;  5GAM f;  4KT0 E;  3URG A;  4C8Q D;  2PVO B;  1WQW A;  3HHT B;  1BIA A;  5GAM h;  1Y07 A;  4M7D B;  4LD6 A;  2CGH A;  1BI2 A;  2GFU A;  5CAI A;  5GMK l;  4M7D D;  3C94 A;  3G4S A;  4A53 A;  4A4F A;  1WGS A;  2Y4Y A;  3GF5 A;  4L6V 5;  3SDZ A;  1EIF A;  1I4K 1;  1YJN T;  4HCZ A;  2K5F A;  2VGM A;  1UEB A;  2ZZD A;  3DKM A;  3P8H A;  5GMK j;  4XTY A;  2X4Y A;  4PLL A;  4PJO B;  2ZPB B;  2XKO C;  2LC4 A;  4KUL A;  5D6W A;  5A0G A;  3JCM d;  1W2B S;  1KC8 U;  3CCQ T;  2RI3 A;  5FRN A;  2VGN A;  3MEW A;  4DA4 A;  2E6Z A;  2JNG A;  4Y28 E;  1N6A A;  2GCX A;  3M53 A;  4LDW A;  5GAN e;  2K57 A;  3JCM h;  2EJF A;  3HP9 A;  4OVA A;  5GAN 2;  2EQU A;  3E19 A;  4YTL A;  2FHD A;  2RHX A;  3E1S A;  2MAM A;  3SFM A;  2E10 A;  3OW2 A;  2GFA A;  1V29 B;  4BE2 A;  2XD0 A;  3M57 A;  3QO3 A;  4Z02 A;  4ZGD B;  3H8Z A;  4EDU A;  5GMK h;  1Q7Y C;  2XIC A;  1Y7X A;  3OMC A;  4IKF A;  2K3X A;  2HQE A;  3CCR T;  1H64 1;  4BDY A;  1M90 U;  4M7D F;  2ZPH B;  2MWP A;  5GAN 7;  3FJP A;  3OQ5 A;  3CCJ T;  5FRM A;  2M1H A;  2EJG A;  1BI1 A;  2JTM A;  3UT1 A;  4D6W A;  2YLB A;  1VQK A;  4LDX A;  2XI9 A;  4JRK A;  3NTI A;  2BIV A;  2LQK A;  3RKY A;  3CC7 A;  2EYQ A;  1Y71 A;  1YJ9 T;  3MHX A;  4HT8 A;  3VV0 A;  1G3W A;  4A54 A;  5DY9 A;  3JCM b;  1VQL A;  1BI0 A;  1UB4 A;  3OY9 A;  2LRQ A;  3L1A A;  2R58 A;  3RKX A;  1NPR A;  2RK1 A;  4TVR A;  4QQ6 A;  5LJ5 e;  3OYM A;  4ZGJ B;  4EMH A;  5CKH A;  5CKD A;  4F7U B;  1QP3 A;  3FDR A;  3TEE A;  2JVV A;  2QQR A;  2GF7 A;  4XTV A;  5GAN j;  4C92 B;  4X9D A;  3BW1 A;  4HT9 A;  5IAY A;  4BD3 A;  4C92 D;  2LT4 A;  2ZPG B;  4OP0 A;  1YJN A;  1Q86 C;  3LW5 E;  3V8J A;  2LTO A;  2EIF A;  3JCM g;  5A0D A;  3JB9 G;  3ZEH A;  1JRI A;  2DXB A;  3CCQ A;  4M75 G;  2R5A A;  5GAN d;  3OYG A;  4IUP A;  1BI3 A;  4MMK A;  2F5T X;  4ZTJ A;  4M7A G;  3M55 A;  4M77 C;  3FEO A;  4II1 A;  1KD1 U;  4GLK A;  4FU6 A;  5GAN h;  4XU3 A;  1KHI A;  5KCH A;  3JB9 J;  3QKJ A;  3J80 E;  1O75 A;  2F5K A;  2RO0 A;  3KUF A;  5J39 A;  2XDD A;  3VUB A;  2RA2 A;  4OGE A;  3V7R A;  3PIO A;  3CCE T;  3INZ A;  3X26 B;  4KBM B;  3M5A A;  4BB7 A;  1KQS A;  4ATO A;  1N9S A;  3MP6 A;  2P0P A;  3RUX A;  5KCO A;  5KH6 A;  2M16 A;  2WSF E;  3CCR A;  4BI8 B;  4XAX B;  2B8A A;  4JRI A;  4E7H A;  2WAC A;  3CBP A;  4C8Q G;  1Q81 C;  1VQN T;  2XDP A;  3O8V A;  5LJ5 j;  4C8Q A;  2HAX A;  3CCJ A;  5EG2 A;  3DLM A;  2RJE A;  4J6W A;  3AHU A;  4J83 A;  3VJP A;  2JN0 A;  2ZPF B;  1VQ6 T;  4M7D G;  5I2M A;  3JB9 H;  4M78 C;  2E65 A;  3LGF A;  1YJ9 A;  4M7D A;  2DIQ A;  4NL3 A;  3A8O B;  2A7Y A;  1QVG A;  3OYN A;  3LYI A;  4XTZ A;  1X75 C;  1Y96 A;  3QPH A;  4ELZ C;  4NL2 A;  1N8R C;  1YI2 T;  5LJ5 d;  3OYY A;  1YCY A;  4L5G A;  4XTU A;  5GAO l;  3M59 A;  3SWN C;  3PMI A;  4IUR A;  3JB9 F;  3OB9 A;  4M75 F;  2G3R A;  2M0O A;  5LJ5 h;  2X4W A;  3DLL A;  4M7A F;  2V8K A;  1QVF A;  3Q1J A;  3M4G A;  1G5V A;  3OS1 A;  3KXT A;  3ASK A;  3QDR B;  1I81 A;  2KQW A;  3OYI A;  2E6N A;  1SSF A;  2QXF A;  4MZP A;  4RCB A;  2H3J A;  3G7Z A;  2FVU A;  5GAN g;  3OYA A;  3CPW A;  2RM4 A;  1K8A U;  4C8Q F;  4EMK B;  1FWZ A;  1XNI A;  2FYK A;  3WVE B;  1WNL A;  3UWN A;  5CQY A;  1R8O B;  4GY5 A;  4N4H A;  3X28 B;  4ELY C;  4ZN1 A;  2ZPI B;  2RJD A;  2EQJ A;  4IUU A;  2CZ7 B;  5FU6 B;  3JCM V;  4O5V A;  3FRN A;  3RMQ A;  4BI3 A;  3QG1 A;  3GIB A;  3CCE A;  2XK0 A;  3M9Q A;  4QVZ A;  3EFS A;  3MP8 A;  4M77 E;  3OYD A;  1OYX A;  4A4E A;  4PLI A;  2HD0 A;  3OYK A;  3CBM A;  1VQ7 T;  1Y96 B;  1JB0 E;  1M1G A;  1ZQ1 A;  1VQN A;  5D6Y A;  5CKE A;  4C5I A;  5GAN 3;  4PJO F;  5FU7 B;  1M1K U;  4JUV A;  2JOY A;  4E47 A;  4BE1 A;  1K9M U;  3RKW A;  4F7U G;  1VQ6 A;  2YHT A;  3OW2 S;  4F7U A;  3CPF A;  3JCM f;  3A8H B;  4C92 G;  4E7L A;  5GAO q;  5LJ5 g;  4HKE A;  4C92 A;  1DJ7 B;  1YI2 A;  1KQ2 A;  4C0G A;  2MF2 A;  1IZ6 A;  3S6W A;  5C0M A;  4JRQ A;  4C0Z A;  4M78 E;  5CCA A;  2DEQ A;  4A4H A;  5GAN 4;  1VQ8 A;  3E9G A;  1LNX A;  4FT2 A;  4JS4 A;  4C5G A;  3I55 T;  4N0A A;  1QP2 A;  2KDS A;  3C95 A;  2XG8 D;  3FB9 A;  5DLO A;  2FL7 A;  2KY9 A;  3CEY A;  2RJF A;  2V8J A;  4NS5 A;  1VQO T;  3R6O A;  3C4S A;  2DXT A;  4HCB A;  3HSB A;  3L42 A;  1LJO A;  2CZ6 B;  2KK4 A;  3OSS C;  4E7J A;  2IG0 A;  2F69 A;  3QXE B;  3I56 A;  3UPU A;  1X6O A;  3S3O A;  1M4Z A;  4EPC A;  4BI4 A;  2GQV A;  2K3Y A;  1KC8 C;  1RL2 A;  4PL6 A;  2VV5 A;  2P0K A;  2QEX T;  1YIJ T;  1B34 A;  3V7S A;  2JUF A;  2PUK B;  4M75 E;  4RG2 A;  1IRE B;  1FXX A;  5KE3 A;  2D6F A;  4F7U F;  2RHI A;  4M7A E;  3BFM A;  4FL6 A;  5M9O A;  1KG1 A;  2A3L A;  5GMK i;  4C92 F;  2LQ8 A;  3SB2 A;  1BYM A;  1VQ4 T;  1VQ7 A;  4KUD K;  2DTH A;  4R56 A;  3A8L B;  3CME T;  3C12 A;  4HA8 A;  5I2S A;  1VQ9 T;  3WXM B;  3BDU A;  4XTW A;  3VYG A;  2OAU A;  5C6S A;  5DM7 R;  3QZ9 B;  3TU4 K;  1VQ5 T;  2E1H A;  3QSU A;  2I2L A;  2JTF A;  2EJ9 A;  5IT9 E;  4XU2 A;  4FSX A;  1S72 T;  1KQS S;  1VIE A;  2HBP A;  3HRT A;  3L2Z A;  3OYC A;  4E7I A;  5GAN f;  5GAO n;  5LJ3 e;  1JJ2 A;  2VC8 A;  3HFN A;  2E12 A;  3TRE A;  1YBY A;  3L2V A;  3T9N A;  4MDW A;  1N9R A;  4PNO A;  5AYF A;  1ZBX A;  3I55 A;  1UGR B;  4PJO E;  5FRO A;  2QQ9 A;  1VQO A;  1QVG S;  3PIP A;  2QTX A;  1B34 B;  2ZGW A;  3QII A;  2BUD A;  4EMK A;  4VUB A;  1RI0 A;  1UGS B;  2L5Q A;  1UGP B;  1XOV A;  2DAQ A;  4M77 B;  4OF1 A;  1WPY A;  2EKO A;  3LH0 A;  4Y91 A;  4CRI A;  3MP1 A;  2PVD B;  4JRP A;  3CC2 T;  1GXI E;  4M77 D;  4BY6 C;  2RB6 A;  4OMF B;  3NTH A;  4FM4 B;  5CK9 A;  5IN1 A;  3PFS A;  2QEX A;  3M56 A;  4BE0 A;  5HK3 A;  3RMS A;  3L2W A;  1YIJ A;  1JBM A;  1M9S A;  2EQM A;  3CCU T;  1QVF S;  1WJQ A;  2RD1 A;  4N4G A;  5GAM e;  2OTJ T;  2Y90 A;  5A0L A;  1Q82 U;  5CKF A;  2P0Q A;  3A8M B;  1KD1 C;  3CXC A;  5LJ5 f;  1NJI U;  1MGQ A;  4X34 A;  3F70 A;  2VYT A;  4C0D C;  1O9S A;  1VQ8 T;  3ME9 A;  3CBO A;  1VQ4 A;  4PKC C;  3KBG A;  3EFR A;  4MZM A;  1VUB A;  4M78 B;  2L8D A;  3CME A;  1OZ3 A;  3HL8 A;  3CPW S;  1KHC A;  1YHQ A;  1VQ9 A;  3CC4 T;  4N4I A;  5LJ3 j;  3OYH A;  2LDM A;  4M78 D;  3OS0 A;  2ZPE B;  3H6Z A;  3VKI A;  2PVG B;  4DOW A;  5HKC A;  1VQ5 A;  2OTL T;  4V2S A;  4WF2 A;  3SWN B;  4M75 C;  2VXF A;  3GPL A;  4J8O A;  2IVW A;  4QVD A;  3I56 T;  2QQS A;  1M1F A;  1WJR A;  2QQA A;  3ZFJ A;  1S72 A;  3J7A F;  4M7A C;  3GLX A;  5LJ3 d;  4X9C A;  4XTX A;  2KMT A;  1QW1 A;  1PSE A;  2PU9 B;  3M54 A;  4J7I A;  2QQB A;  5GMK e;  3HFO A;  1KQ1 A;  1TH7 A;  5LJ3 h;  2LCL A;  1D3B A;  4BDZ A;  3SD4 A;  5GAN 6;  3HKS A;  3OYE A;  3JB9 D;  1K73 C;  1VQM T;  2LVM A;  2KAF A;  2XID A;  2E5Q A;  4JLG A;  3JCM Q;  4M75 D;  4C8Q C;  3MO8 A;  5J26 A;  1YJW T;  5GAM j;  4XU0 A;  4DQ2 A;  3QHS A;  4M7A D;  4C5E A;  2C06 A;  1UGQ B;  3FLG A;  3FC3 A;  2RHU A;  3G6E T;  3MEV A;  3CCS T;  2V8I A;  4QW2 A;  1VQP T;  3CC2 A;  2M9U A;  4M7D C;  3LGL A;  4DOV A;  2RJC A;  3VU3 C;  3OA6 A;  3PTA A;  3P8D A;  2EAY A;  2HNI A;  2YLC A;  3NFC A;  2R5M A;  4LDY A;  3HRS A;  1H3Z A;  5GAO p;  2R57 A;  2XHC A;  4OB3 B;  3DB3 A;  1K8A C;  2K2V A;  2MI6 A;  3CCU A;  2BKD N;  3S3M A;  4MDX A;  2OTJ A;  4PJO C;  2DVE A;  2DD4 A;  2P4T A;  3DB4 A;  3CCL T;  3MEA A;  3X25 B;  4QQG A;  1Q7Y U;  3QYH B;  3NTK A;  1YIT T;  1W4S A;  4ZTF A;  3CCM T;  2O4X B;  3GNG A;  1HXD A;  3CCV T;  2LCC A;  3CC4 A;  2DTO A;  1PSF A;  4KUI A;  1BIB A;  5CIU A;  1ZHI A;  3V8K A;  3L2Q A;  2DXC A;  3PT9 A;  2X4X A;  4B9W A;  3WVD B;  2OTL A;  2QDY B;  4B9X A;  1WQ7 A;  4L59 A;  2PUO B;  1MHN A;  1M1K C;  1D3B B;  4UC4 A;  2DZC A;  4OB2 B;  3L2U A;  1K9M C;  3CD6 T;  2DK3 A;  4PJO D;  3LX7 A;  4ME7 A;  3BY7 A;  5LJ3 g;  1NZ9 A;  3RIR A;  3TCJ A;  3MEU A;  2KVQ G;  5GAN 8;  1WJS A;  1G3S A;  2DJZ A;  2DPP B;  4M77 G;  3JAM E;  4M77 A;  2DO3 A;  3X20 B;  1W2B A;  1XTD A;  2AHJ B;  5J3B A;  5GAN 5;  1VIF A;  4RMO A;  3G71 T;  1OI1 A;  2EQK A;  3OBW A;  1VQM A;  3CMA T;  3V8L A;  5GMK m;  3OYJ A;  1YJW A;  1Q86 U;  3PGG A;  3JCM X;  3LWH A;  1YHQ T;  2QA4 T;  4QVC A;  3G6E A;  1M90 C;  1I5L A;  1JJ2 S;  3ER0 A;  4RG8 A;  3CCS A;  2MMP A;  1VQP A;  3X24 B;  3RER A;  4MZT A;  4Q5W A;  4JS5 A;  2L89 A;  4C8Q E;  2D9T A;  2DTI A;  4J7F A;  4C92 C;  4ZGE B;  4M78 G;  5FLX E;  5GAM g;  3OYF A;  4NOY A;  3GNF B;  3PNW C;  3UDC A;  4OB0 B;  4M78 A;  2CYZ B;  2X35 A;  4O6J A;  5GAO r;  4RCC A;  2K4Y A;  4M7D E;  4LDU A;  1AHJ B;  3RES A;  3JSC A;  2FB7 A;  4N0A C;  3CCL A;  3JB9 I;  3SWN A;  5DLQ E;  1I8F A;  3L2R A;  1FX7 A;  1NPP A;  1YIT A;  5I21 A;  5L8R E;  3JCM c;  2LNV A;  3CCM A;  1Q81 U;  3VYH B;  2RI5 A;  4J5Y A;  3CCV A;  2KSS A;  4OGC A;  3PMT A;  4XK8 E;  4M77 F;  3JCM J;  1QVP A;  1U1T A;  4JJN K;  3N5B B;  2DIG A;  2RI2 A;  4QQD A;  5HY6 A;  4MML A;  3OS5 A;  1U1S A;  2MWO A;  3CXC S;  3CD6 A;  2DD5 A;  4M75 A;  3OMG A;  1P92 A;  4IUT A;  2RHY A;  1N8R U;  2DZ9 A;  4BAC A;  5LJ3 f;  4M7A A;  3S3N A;  1X01 A;  1XQH A;  3QJY A;  2HQX A;  5CKB A;  3OS2 A;  2CZ0 B;  3V7C A;  2YRV A;  2PQW A;  3G71 A;  4M78 F;  5D6X A;  3CMA A;  2K5L A;  2K5I A;  3QBY A;  4BY6 B;  5CO7 A;  4HCC A;  2DXU A;  3A5Z B;  4J6X A;  3G4S T;  5HK0 A;  2E41 A;  3E9F A;  2QA4 A;  3JCM P;  2WSC E;  3FIF A;  2VUB A;  1OZ2 A;  2CKK A;  4LD9 K;  2EWN A;  2RK2 A;  2LT1 A;  2RH2 A;  2WSE E;  2X4J A;  4FIB A;  5A2Q E;  2XU8 A;  1M5Q 1;  2Y4X A;  1M8V A;  1BKB A;  3ZBD A;  3JCM e;  3LLR A;  2VXE A;  4C0F A;  4P5N A;  5CQX A;  4C0D B;  4J6Y A;  2CZ1 B;  2D0Q B;  2DKG A;  5CVI A;  3BDL A;  2O4X A;  5KE2 A;  3JCM W;  2E70 A;  2QI2 A;  4LDV A;  4F7U E;  4E7K A;  4A4K A;  3M4Y A;  1HK9 A;  4PJO G;  1G3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...