3TCJA

Ccdb dimer from v. fisheri in complex with one c-terminal domain of f-plasmid ccda
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/antitoxin
molecule keywords CcdB
publication title Energetic basis of uncoupling folding from binding for an intrinsically disordered protein.
pubmed doi rcsb
source organism Aliivibrio fischeri
total genus 31
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3tcjA00
1X75C 4ME7A 2MF2A 4HKEA 4MZPA 3JRZA 5CCAA 1M1FA 5CK9A 2VUBA 4MDXA 3JSCA 4MZTA 5CQYA 5CR2A 1UB4A 4MZMA 1VUBA 3TCJA 4OF1A 3NFCA 3G7ZA 5CKFA 5DLOA 5CKEA 5CO7A 3VUBA 4VUBA 1NE8A 4ELYC 4ELZC 3HPWA 5CKDA 5HK3A 5HKCA 2KMTA 5CKHA 2C06A 5CQXA 5HK0A 5CKBA
chains in the Genus database with same CATH superfamily
1TU0B 2V1QA 1ZLMA 1YJNQ 4LDVA 1Y0MA 3EFRA 1AZGB 1TWBA 4C92D 1YHQQ 2XDBA 2QYZA 1BI1A 2LMJA 4M75B 3CC7Q 2XICA 1JB0E 5GAMj 3CMET 3OB9A 2LJ1A 1I5LA 1MV3A 1N5ZA 2AIRB 2VGMA 3META 2O4XA 3JV3A 1MMNA 4PL6A 1PKTA 1OZ2A 3S3NA 1N9SA 2LC4A 1RAEB 1UB4A 3JCMP 2K2MA 2YSQA 2HL5C 1B3QA 2CUBA 5KYXA 1KFZA 3EG0A 1M5Q1 2IVWA 2GGRA 1YIJQ 1VQ8T 5D6XA 4ZGEB 2E64A 3QDRB 1QVGP 4PNOA 2HEQA 3X25B 3RESA 1NJIU 1VQ4T 1WYXA 4M75A 1UECA 5CKFA 4QVDA 3M0RA 4PLIA 1NPPA 5KE2A 1QVFP 3OYIA 1UG1A 5LJ5j 2RHUA 4C92F 3CMAT 4J7FA 1IHWA 7AT1B 3ZFJA 3CXCA 3JAME 1MNDA 2QQRA 4PJOF 2CZ1B 1JJ2P 2VXFA 2ABLA 2MYSA 1MUZA 5D6YA 1P92A 1U5SA 2AT1B 4BD3A 1T0HA 3DLLA 4R56A 4HCZA 4X9CA 5GMKi 3G71A 3G4SA 4K11A 1CKBA 1HYOA 1JXOA 4JZ4A 4J8OA 4DA4A 5I2SA 3EH2A 1Q82R 2RM4A 2XK0A 2EGCA 4OMPA 3MEVA 2G6FX 1M90U 2PU9B 2H3EB 4A4FA 3VV0A 3L42A 3EH1A 1RAHB 3RBBB 1WI7A 1GFDA 5CKBA 1RAAB 1ZSGA 1K9AA 2KXDA 1QCOA 2KBTA 1S72A 2E5QA 4FYWB 3MP6A 3G6EQ 2XIDA 3QO3A 2VVKA 3OW2S 4J9HA 4M77E 1PSFA 3A5ZB 3PFSA 2RJDA 2MWPA 4M77G 1BK2A 1M9SA 2FEIA 1RAGB 1SEMA 4KH0B 4ZTJA 4FT4A 3CBOA 4PJJA 1YCSB 5IN1A 1VQ6Q 3QJ6A 4FYVB 3CPWP 4PLLA 2HSEB 2A0FB 1OU9A 4Y28E 2DILA 3JB9I 1WDXA 1ZA1B 3MJXA 3QIIA 2K5FA 3CCRA 2QASA 1YITA 3CPFA 1K0XA 3RMSA 3CCSQ 4M7AE 4KGVB 2FRYA 1OU8A 1WX6A 4M7AG 6AT1B 1PKSA 3L2WA 1SHFA 1RI9A 4BE0A 2M02A 1D1CA 2EYWA 1GCQA 4A54A 4HA8A 3ZL7C 1W70A 2BZYA 2RI2A 2HMAA 1ZQ1A 3GBQA 3JCMh 5GAN4 1ACMB 1O9SA 2L3SA 2J6FA 3SFMA 1YJ9A 1Q81R 3PTAA 2PVDB 4M7AC 2EFIA 5CVIA 1M1KC 3G71T 3G4ST 3CMEQ 2KRNA 3M0TA 3VRZA 2YDLA 4EMGA 5HKCA 2ENMA 1PRMC 2J7IA 2PVGB 1X01A 2V1RA 3M55A 8ATCB 3VJPA 3RIRA 2EVRA 2IG0A 3CXCS 2KRSA 5GMKe 3M5AA 1OV3A 3UDCA 1IHVA 1W1FA 2LTOA 2CZ0B 3A8OB 4OF1A 5LJ3h 1K73U 4M7DE 2IIMA 2GQVA 4J9FA 4M78E 3JCMf 4M7DG 1A0NB 1S72T 1ZX6A 4M78G 3P8BB 4BE2A 2AZVA 4MMKA 1VQ8Q 3REBB 3TEEA 2K79A 3KUFA 1VQ4Q 4RMOA 1B07A 2K4YA 2SRCA 3OSVA 2QQSA 1U1TA 3OS0A 2DEQA 4ATOA 2COZA 2LDMA 1G3YA 2A37A 1OQKA 3HRTA 4F7UF 2K5LA 3VUZA 1QCFA 4JDSA 4FL6A 2HQEA 4CC4B 5LJ3f 1M1KR 5GJWB 5CR2A 3FRNA 3CCRT 3BDUA 4A53A 3M0QA 2DO3A 2KGTA 4RCBA 1YITT 1TH7A 4JLGA 1OOTA 1RL2A 5LJ3d 4C0DB 3OYFA 3I55A 4E7IA 4IIMA 4XTXA 4BI8B 4D8KA 2DYIA 4A4KA 4E7LA 3SWNC 1AWWA 3UWNA 2F1LA 3UF4A 2XDDA 2ZPBB 1M1GA 3MP1A 2E6ZA 4X9DA 2RK1A 3JCMW 4FYYB 5DM7R 4OB2B 1PHTA 4OGEA 3NHNA 1NM7A 1R0CB 4J9CA 3I56A 4E2FB 2GNCA 1YJ9T 4N4HA 1HSQA 3A98A 4RTVA 1LNXA 3U23A 4XAXB 1PWTA 4JLIA 1LVKA 2M0OA 2HBWA 5EG2A 2OTLA 3V8LA 1MV0B 4Z02A 3JCMb 2J06A 4M78D 1BI3A 3A8MB 3C4SA 3H8ZA 1KQSP 1R0BG 4M77B 1K0SA 3OMGA 4RG8A 3OYMA 3MEUA 3VYGA 1G2BA 2AK5A 2EJFA 1ABOA 1NYGA 4M75E 1VQOQ 4XTWA 3AT1B 1K9MC 3MEAA 1Y07A 1UHCA 2AKLA 4GBQA 5J3BA 1JJ2A 1RLPC 1UHFA 4KT0E 3JRZA 3CQTA 2V8KA 4HCCA 3JB9D 2VUBA 3BFMA 2VASA 4HCKA 5HCKA 3QZ9B 1JRIA 1K8AC 4EPCA 2VB6A 3H0HA 2KYMA 2KI7A 2K5IA 4DBHA 1PNJA 4M7AB 2RHZA 3SHWA 2DD5A 1YN8A 4RTZA 5KH6A 4J9IA 3S6WA 2F2VA 3RKYA 1GCPA 2YRCA 1QLYA 2FB7A 2GFAA 2K57A 3J81E 2FL7A 4DOWA 2LZ6B 5IT9E 2R58A 2ATCB 1NJIR 4EMHA 2BZ8A 4RCCA 4J9GA 4PJNA 5GAOn 2CKKA 1CSKA 1YFNA 5GAMf 2RI3A 1NEBA 4PFZA 2CSQA 2MF2A 2X4YA 1ZHIA 3EAEA 4MMLA 4FW1A 3I55T 4CC2A 4IKFA 4OGCA 3EG3A 4KUDK 4BACA 2NUPB 5I21A 2XMFA 3G71Q 3M0UA 1AT1B 1MMAA 3HPWA 4N0AC 5KYUB 2D0QB 4J9DA 1D0XA 2EKOA 2RN8A 5LJ5h 4M7AA 3JB9F 1ZSZB 1ZBJA 2RJFA 4R0KA 1JQQA 1D1BA 3VS5A 3I56T 4M75D 1O75A 1Q95G 4QQ6A 2LVMA 1Y7XA 1K4US 3OYHA 1RADB 3V7CA 2JTEA 1C0MA 3TU4K 2OTLT 3WVEB 1M90R 4AFUC 4YTLA 1E6GA 1X69A 5CKDA 2EJ9A 3M0PA 1S72Q 2PVOB 2O9SA 4HXJA 4FT2A 4MDWA 3OS2A 2CDTA 3DB3A 1N6AA 4N4IA 3L2QA 3SWNB 1WXBA 2E10A 2DNUA 2DTIA 4B9WA 1VUBA 1W6XA 3QSUA 5LJ5f 2NUPA 1NBEB 4ORZA 4KULA 1QVGS 4D6WA 1UGQB 4C8QF 5KYUA 1N9RA 4PJMA 2L89A 1VQNQ 2CSIA 5GMKl 1AEYA 5GAMe 4AG2C 2KK4A 4PJOG 3VS0A 1ZSZA 3TQ7P 4WCIA 3GLXA 1MNEA 3CCRQ 5KYWB 1AWXA 1WA7A 4P5NA 4UC4A 5AYFA 3X20B 4OMLA 3O5ZA 2KT8A 5FU7C 1I4K1 1WPYA 4Q5WA 2ZPFB 2OTJA 2D1XA 3V7RA 2I2LA 5FWBA 3HRUA 1JJ2S 1T0JA 5J39A 1X6OA 4WTOB 4C92C 1CKAA 1ZUKA 1K73C 2ESWA 3WXMB 2QK0A 1X6BA 3SWNA 4PJOC 2ROTA 4HT9A 2EW3A 1QMCA 2DJQA 3VUBA 3OYDA 2J05A 4X34A 3CC4A 4C0FA 1YJ9Q 5IHKA 1V29B 1WZOA 1C6VX 2RH2A 1WIEA 3T9NA 2C0TA 2L5QA 4D8DA 3ZEHA 2CP5A 1FMKA 2K7AA 4JS5A 1UTIA 4OMFB 4MZMA 2EQIA 1VQKA 1I07A 5KYWA 2G3RA 5LJ5e 1VQ9A 4BI4A 3OYLA 1SPKA 1NE8A 1QVPA 4NL3A 3PMTA 5GANh 2GFUA 2LQ8A 2F5KA 1BCMA 1BYMA 1B34B 1U06A 4KH1B 1EIFA 1SSFA 3M0SA 3KBGA 4Z8AA 1VQOA 3CD6A 3QJYA 1YP5A 2YT6A 4NS5A 1LOJA 2M1HA 5A0DA 4RG2A 1RAFB 1RABB 1K73R 4IURA 1JXMA 1UEBA 2E6NA 3CPWS 2XDPA 3LH5A 2X4WA 2E3HA 2DXBA 3M58A 3MPUB 4JRPA 4HVVA 3FC3A 2X3WD 3UPUA 4OMMA 1KK7A 2L3QA 4C5GA 4XU3A 1I5OB 2K2VA 2JZ2A 3DB4A 2LNHB 1QKXA 5L8RE 1KQ1A 1KSWA 2BTTA 1U8RA 1M3AA 4ZN1A 3RKXA 5CKHA 4J83A 1OULA 5GANd 2YRDA 4DEXA 1LJOA 4ZGDB 1B34A 4A4HA 2ED0A 2LX7A 2CT3A 2RQWA 1YWOA 3I55Q 5GAOr 5GMKm 2P4TA 3FB9A 3L1AA 3QG1A 2OTJT 2RQRA 2LT1A 1K9MU 3OMCA 3JCMg 1WHMA 2CH4W 2RI5A 2EYXA 1NEGA 4R55A 1IRXA 1G83A 3JCMJ 3M57A 3UA6A 2J6OA 2F2XA 2HBPA 3OYBA 4OB3B 4XK8E 3X26B 1K8AU 4N0AA 5D6WA 3I56Q 3CC4T 1QW1A 3E2UA 1KC8U 2D8HA 2M0YA 2JTMA 2A36A 4KGXB 2OTLQ 2FPFA 1LCKA 3H0IA 2K6DA 2WSFE 2I0NA 1G3WA 2KROA 3EGXB 1VQKT 2E1HA 3F70A 2EGEA 2JW4A 1VQ9T 5FU7B 1R8OB 3JB9H 4JUVA 5AT1B 3BE3A 4J6WA 2DRMA 2E5KA 3OBYA 1Y57A 2RQVA 2R5MA 3OYNA 2LRQA 2RF0A 3NPFA 3V8JA 3TVTA 1AVZC 3A1PA 1WHGA 2PQWA 2C06A 3EHRA 1VQOT 3M54A 3CD6T 4PJOB 1QQJA 4NOYA 1IXDA 2CP6A 1BU1A 3SDZA 4L5GA 1UJYA 2M16A 1VQNA 2QQBA 3EG2A 4KRTA 5IHNA 2CS7A 3JCMc 2D6FA 1MHNA 4J9EA 4OP0A 4EIKA 3VS2A 2M51A 3EGXA 3RMQA 2MIOA 3PIOA 2B8AA 3OYCA 2P4RA 1KD1U 2RMOA 4LDYA 2L2PA 4DEYA 2DVEA 4LXCA 5IHIA 1GFCA 2FO0A 4M4ZA 2CUDA 2EIFA 1IGQA 2OAUA 3M56A 1W2BP 1TUCA 1FWZA 4JRQA 1BIBA 1YJWA 3R6OA 3M53A 4L6V5 2M9UA 2V26A 4ELZC 3OYGA 2HSPA 2DZCA 3OQ5A 3NMZC 4PJOA 2DERA 5GANj 1WGSA 5KYYB 2HCKA 2EBPA 1SRMA 3L2RA 3QUIA 4LNPA 2HQXA 4FSSA 1FXXA 4E7JA 3INZA 4RKUE 4E47A 1EZZB 4C5HA 2JM9A 1AWOA 2K3BA 2DPPB 4JPBW 3TSZA 4A4EA 3TSWA 2KY9A 1KQSS 1F1BB 2XD0A 2YUOA 2RB6A 5CCAA 5DY9A 1WQ7A 2A28A 4M77D 3LYIA 2DVJA 2ZZDA 5CIUA 1D3BB 2NUTB 4II1A 1KIKA 3I5RA 2L8DA 1QKWA 1I0CA 5GAMg 2BE7D 5KYYA 3CCUA 1QP2A 2ED1A 5EC7A 1HJDA 1DJ7B 1JEGA 4AG1C 1NLOC 4DQ2A 4J6YA 4EMKC 4M7AD 2LT4A 1T3LA 3ER0A 3VYHB 2KNBB 5HY6A 3M9QA 2KVQG 4BB7A 1VQNT 2P0QA 1Q86C 2LQWA 2XU8A 3OW2P 4LN2A 4JS4A 2E12A 2XKOC 1VYVA 4MZTA 5KYNA 3H9NA 2OTJQ 2PNIA 1SG5A 2LQKA 1D3BA 1OZ3A 2D8JA 2FHDA 2NUTA 4ELYC 1Q7YC 3HL8A 2KMTA 4LUDA 3MCAB 1TG0A 2LJ0A 4BE1A 2YUQA 2QAZA 3PNWC 4ZN3A 1IB8A 3LLRA 1YJWT 4M77F 2YUNA 2H8HA 2DF6A 3ZBDA 1M3CA 4FCYA 5LJ5g 3CC4Q 3PVQA 2C0IA 1UJ0A 2HL3A 4QQDA 4E7ZA 3CCVA 3NGPA 2EYZA 2CGHA 4E7SA 2FG0A 2QGFB 3VKIA 3JCMe 1QVGA 5GAN3 4JRKA 4AFZC 1VQKQ 2QXFA 1I81A 2WACA 1VQ9Q 1RI0A 1KG1A 1YCYA 2JNGA 4CC3A 4M7DD 4J9BA 1FX7A 2LNVA 4GY5A 5CQYA 4ZTFA 4M7AF 5FU6C 3G1JA 4BI3A 3QWXX 1QVFA 1WHHA 2BKDN 1S1NA 2HD0A 2QI2A 4DBFA 3CD6Q 2GQIA 3MEWA 2WSEE 1JBMA 2GBQA 2MK5A 5LJ3e 4RTUA 3CBMA 2L3RA 3URGA 2MOXA 2NWMA 3EG9B 2D9TA 1UUEA 2E4HA 3CCUT 1V1CA 1G3TA 1UFFA 4C8QC 1KC8C 2JS0A 2EQMA 2DKGA 2QEXA 1X43A 2D0NA 3PMIA 5FW9A 1E6HA 1PD1A 3GPLA 3OYYA 4C0GA 2AHJB 4TVRA 1MMDA 2DAQA 1H3ZA 2EQKA 2DEUA 4M7DF 1AOJA 4M78F 4FW2A 1FMVA 1BI2A 1H3HA 1ZBXA 2CP7A 4AFSC 1AZEA 2DL3A 3CEYA 2RQUA 2RO0A 3LGFA 3H0FA 3EG1A 1QP3A 5LL6S 4B9XA 1D09B 3EG9A 2X3XD 1K9MR 2GTJA 2X35A 3V8KA 2VGNA 3IQLA 4BDZA 2DFUA 1BKBA 2O2OA 4C5EA 4EMKB 3REAB 4B6MA 3CPWA 3CCVT 1NG2A 3D7SB 2K3XA 1K8AR 3BY7A 4LE9A 1KC8R 1KD1C 1V76A 4BDYA 2F2WA 3RUXA 4LD9K 2YWWA 1OEBA 4J5YA 1N27A 3UT1A 3E9GA 2FZGB 3A8GB 2O9VA 1XOVA 3RR6A 5I11A 3O8VA 3GNGA 2DM1A 4CRIA 1UDLA 2H3JA 1EFNA 4Z89A 2COYA 2GTOA 4RTWA 4C92E 3ULRB 1I8FA 2A08A 2W0ZA 4JJNK 4C92G 1WJSA 2QTVA 2KYBA 1UGSB 4EMKA 4PJOE 1VQMA 3EFOB 3LGLA 3BW1A 3QZ5B 1HD3A 2JMAA 3SEMA 1QVFS 5GAOp 3CCJA 2QGGA 3I35A 3UATA 2QEXT 4IUPA 2DA9A 1TOVA 2DD4A 1GBQA 2NLUA 2BUDA 2X9HA 4NL2A 3PT9A 2LJ3A 2A3LA 2ECZA 2RPNA 1N8RU 2BIVA 1YJWQ 4M75F 3OSSC 1VQ5A 3E1SA 3DLMA 1J3TA 4Y92A 1IGUA 3S3OA 3Q1JA 4MDXA 1KD1R 1PM3A 2KE9A 2ZPHB 4QKUA 1MGQA 4L59A 2CREA 4AMCA 1OPKA 2KR3A 1VQLA 4BY6C 2CYZB 1TUDA 4RUGA 1OI1A 2FPEA 2VC8A 4C8QB 2OAWA 3CCLQ 3EFOA 1JO8A 1WXUA 4CC7A 2OX7A 1D0YA 2Z0WA 1GCQC 1WLPB 3L2VA 4XTYA 2LCLA 3E19A 2KQWA 4IUUA 4OMOA 4AT1B 4FIBA 4XQ3A 1Q86U 2E3IA 2RQTA 1SRLA 5IXBA 2QQAA 2O88A 3A8HB 2AZSA 3V7SA 5CK9A 1AD5A 1Q7YU 1RAIB 2JOYA 1TSFA 3LH0A 5C6SA 3CCMA 3PIPA 3CC2A 4PJOD 3VS4A 2RHXA 3CCUQ 2HKNA 5IH2A 2JM8A 4JZ3A 2DL4A 1G8XA 4Y91A 2LCCA 1YI2A 3BDLA 5M9OA 4KGZB 3OS5A 1B7TA 4C8QA 1HXDA 4HVUA 1Q82C 1BI0A 5GANf 3E9FA 4ZGJB 5GJVB 2RJEA 3ME9A 2VWFA 4C0ZA 3HKSA 1VQMT 5CO7A 5KCHA 2YXYA 2CZ6B 1UGPB 2P0PA 2VV5A 4JJBA 2BE9B 1W2BS 3CCJT 1R77A 4MZPA 1KQSA 2RNAA 2DZ9A 1SF9A 1GBRA 2RD1A 4Z88A 1NLPC 2CH4A 5J26A 1X6GA 3JCMQ 3NFCA 1VQ5T 5GAN8 4QW2A 2DBKA 2QDLA 2CP0A 8AT1B 3JCMV 2O01E 3QHSA 1IZ6A 3HP9A 5CAIA 1X75C 1XQHA 2FZCB 3CCVQ 4PKCC 2RK2A 2HKQB 4JRIA 2FYKA 1VQLT 2XG8D 5GAN7 3RNJA 3LX7A 4GLMA 2F5TX 1VQPQ 2X51A 2CP2A 3QKJA 2DTOA 1OX8A 2EYQA 3NTKA 1VQ7A 1PSEA 1WFWA 5FLXE 1G3SA 2FPDA 2A7YA 3EFSA 3OA6A 5LJ3g 1WNLA 1Z9QA 1UGVA 2V8JA 2QTXA 1PCXA 1M30A 2JMCA 4C92B 2JN0A 4BUGA 1ZA2B 5GANe 5A0GA 3QBYA 2HNIA 4F7UE 5GMKh 3OYJA 1AWJA 1KHIA 4LUEA 4F7UG 3PGGA 3TREA 3M4YA 2YRVA 1GRIA 3CCMT 2DL7A 3GP8A 3CC2T 2V8IA 4BY6B 2KRMA 4O5VA 4PK4A 1FYNA 3QXEB 1PG5B 1RACB 4C0DC 1OX9A 2YLBA 3HTRA 1Q81C 1VA7A 2QEXQ 3CCEA 4CI0C 3I5SA 2AKKA 4E6RA 5CKEA 1YI2T 2O31A 3QDFA 2WSCE 2E65A 2PTKA 2EJGA 1IO6A 1K76A 3OYEA 4OVAA 1Y71A 1PRLC 4LDWA 3RKWA 2DETA 1ARKA 2QA4A 1WJRA 3LWHA 3FJ5A 4C92A 1RUWA 2JJ9A 4QQGA 1TTHB 1GXIE 1WJQA 2YLCA 4PFOA 4F16A 3FLGA 1U3OA 4M77C 5GAN5 1BB9A 4DBRA 4X1VA 3QYHB 2ZPIB 3MHXA 1UE9A 5C0MA 1LPLA 4O6JA 2DX1A 3C94A 3CCQA 3TCJA 2ZGWA 5IAYA 3M59A 2EQUA 4OB0B 1M2OA 3SB2A 2EAYA 3DKMA 3CCLA 1OYXA 1W4SA 1OPLA 4JJDA 2ROLA 3VRYA 4FYXB 4OMQA 3VS3A 2CZ7B 2X4XA 2JS2A 4IIOA 1VQ7T 4OB1B 4J6XA 1N8RC 2DRKA 2JVVA 3KXTA 1YJNA 1Y96B 1MMGA 3PVLA 2EQJA 1YHQA 2COWA 3A8LB 1PD0A 2NYSA 1BIAA 1WHLA 3GNFB 5FRNA 3CC7A 4IUQA 2XHCA 1KHCA 3THKA 2RHYA 2BZXA 4ME7A 5FRMA 2KEAA 4RTYA 2YUPA 2SEMA 3HFOA 3CBPA 1WXTA 2EKHA 2FRWA 1VQMQ 1YNZA 3N5BB 3J80E 3NTIA 2MCNA 3EGUA 1YBYA 3RDVA 1QCNA 3CCJQ 1RLQC 2X4JA 2DIQA 1X2QA 3CCET 3JCMd 5GAOl 3L2UA 2P0KA 2XI9A 1QWEA 3JSCA 1XNIA 1YIJA 2LP5A 2DTHA 9ATCB 1M8MA 3OY9A 3G7ZA 5A0LA 3MO8A 1VQ5Q 1ZSZC 4E7HA 1Y96A 1TXQA 2QA4T 5ECAA 3VS7A 3JB9G 2LQNA 1Z9ZA 2VYTA 4M7DC 3CMAQ 4M78C 1C1AA 4HT8A 4E7KA 2DJZA 2EWNA 1N8RR 3QYGB 4F17A 3VU3C 1VQLQ 3GIBA 2R5AA 1NYFA 1BBZA 4A63B 3X28B 4DOVA 2CT4A 5A2QE 2MMPA 3SD4A 2RHIA 3L2ZA 5GMKj 3LW5E 5CQXA 2DXUA 1Q82U 1H8KA 3CCQT 1VQPA 1D0ZA 2NUZA 3P8HA 1WQWA 1NPRA 1PC0A 2DYBA 1U1SA 3CCLT 4F7UB 3JB9J 4C8QE 2OI3A 2KSSA 2OJ2A 1XTDA 4C8QG 4IUVA 2DIGA 3NTHA 2ZPGB 2ZAEA 1Q86R 1NJIC 1UGRB 4XTZA 3X24B 4F14A 2J6KA 2Y4YA 2RJCA 4FM4B 2QDYB 5FWCA 1M2VB 3JCMX 3CCMQ 2VKNA 2B86A 1YJNT 3CC2Q 4ESRA 5IXFA 4XU0A 2DL8A 3RERA 2LX9A 1YHQT 2E41A 3H41A 3P8DA 1YWPA 4ANJA 1VIEA 1Q7YR 3CC7T 2FZKB 4N4GA 2KDSA 5DLOA 5D7UA 1YI2Q 3QPHA 3FIFA 4PJLA 2KT1A 3HHTB 3CXCP 1SKUB 1D1AA 4M75G 1ZUUA 3UA7A 3G6EA 3EHQA 3S3MA 1WHJA 1VIFA 1H641 5L23A 4V2SA 1G5VA 4HKEA 3R6NA 4IUTA 1HK9A 4HVWA 4XTVA 5GAMh 1GL5A 4F7UA 3QWYA 3OYAA 4KBMB 4WF2A 2C0OA 2P84A 4LDUA 1VQ6A 3AHUA 1XJWB 4QVCA 1M90C 3HSBA 1YIJT 2E70A 1WHKA 2DXCA 3HRSA 3OBWA 2MPXC 1M27C 3EGDB 3C95A 1M2VA 4M75C 4DBQA 4OMNA 2DMOA 1AHJB 2ZCFB 3CCSA 1K1ZA 1H92A 5GAOm 2DL5A 5KCOA 4M77A 2JUFA 1VYUA 2W10A 3FEOA 2K9GA 2MAMA 1VOMA 3M4GA 4C8QD 3MKDA 3FDRA 1I1JA 1M4ZA 1Q81U 3OS1A 1M8VA 4C5IA 1M1FA 2L3PA 5GANg 2K3YA 1VQ7Q 4LDXA 5GAN2 5GAMd 3G4SQ 2YHTA 1EX4A 5FROA 1VQPT 3PE0A 4PFPA 4LD6A 4HCBA 2JXBA 3ASKA 1TS9A 5LJ3j 2MI6A 1TUGB 4QVZA 3J7AF 1FMWA 4FU6A 3CMEA 1W2BA 3EGDA 5I22A 3MP8A 4M7DB 2KXCA 3VS1A 4JJCA 2F69A 4M78B 4J7IA 2GCXA 1JU5C 3KFVA 5HK0A 4RTTA 4GLKA 3CCEQ 1IREB 1T3SA 2GF7A 2QQ9A 4A4GA 4XTUA 2JTFA 3C0CA 2HAXA 2QG9B 3FJPA 2CP3A 1KQ2A 4XU1A 3G6ET 1VQ8A 2EPDA 4ZNXA 2LCSA 4RTXA 5GAOq 3GF5A 2DE0X 4VUBA 2DBMA 3OYKA 2Y4XA 5FU6B 2QA4Q 1QWFA 2PUKB 1VQ4A 2EYYA 5LJ5d 2PZ1A 5KE3A 1M1KU 4XU2A 2R57A 1NZ9A 2JT4A 2IPOB 1VQ6T 3I9QA 1YITQ 4M7DA 2PUOB 1E7OA 4M78A 3CMAA 2HZYA 4F04B 5GAN6 5DLQE 1X27A 2Y90A 4AFQC 3VS6A 2O4XB 1SHGA 3CCST 1X2KA 3LWIA 1BCOA 3CCQQ 2DK3A 2HDAA 3C12A 2KAFA 2RA2A 2HQHA 1ABQA 2ZPEB 2FVUA 2VXEA 4FSXA 3GOXA 4QT7A 1M3BA 5I2MA 2DXTA 5KYXB 1SSHA 2DLPA 3WVDB 4KUIA 2L0AA 5HK3A 3OW2A 1VYTA 3H6ZA 1ZUYA 1KJWA 3HFNA 2MWOA 2EGAA 4EDUA
chains in the Genus database with same CATH topology
5GAMf 2RI3A 3CCMT 2XU8A 1Q86C 3GP8A 3CC2T 2V8IA 4LDVA 4BY6B 4O5VA 2MF2A 4JS4A 2X4YA 1ZHIA 3EAEA 3EFRA 4MMLA 2E12A 2XKOC 4C92D 3I55T 4MZTA 2XDBA 4IKFA 3QXEB 4C0DC 4OGCA 1BI1A 4BACA 4KUDK 2YLBA 4M75B 2XICA 1JB0E 5GAMj 1Q81C 5I21A 3CCEA 2LQKA 3OB9A 4CI0C 3CMET 1I5LA 5CKEA 1D3BA 1OZ3A 2FHDA 1YI2T 4ELYC 1Q7YC 1VQNT 3HPWA 3HL8A 4N0AC 2KMTA 2D0QB 2WSCE 2E65A 3MCAB 2VGMA 4BE1A 3META 2O4XA 2EKOA 5LJ5h 4M7AA 3PNWC 4ZN3A 2EJGA 4PL6A 3JB9F 3OYEA 3LLRA 4OVAA 1YJWT 1OZ2A 1Y71A 4M77F 2RJFA 4LDWA 3RKWA 3S3NA 3ZBDA 1N9SA 2LC4A 3I56T 2QA4A 1WJRA 4M75D 5LJ5g 1UB4A 3JCMP 1O75A 4QQ6A 3LWHA 2LVMA 1Y7XA 3OYHA 1YITT 3V7CA 3CCVA 4QQDA 4C92A 3TU4K 2OTLT 3WVEB 4YTLA 1M5Q1 2CGHA 5CKDA 4QQGA 2IVWA 2EJ9A 3VKIA 1GXIE 3JCMe 1WJQA 2PVOB 2YLCA 5GAN3 4JRKA 1QVGA 1VQ8T 1VQNA 4FT2A 2QXFA 3FLGA 5D6XA 4MDWA 1I81A 2WACA 4ZGEB 4M77C 5GAN5 3OS2A 1RI0A 2E64A 1YCYA 2JNGA 3DB3A 3QDRB 1KG1A 1N6AA 4M7DD 3QYHB 4N4IA 4PNOA 3L2QA 3X25B 1FX7A 2LNVA 3RESA 2ZPIB 3MHXA 4GY5A 5CQYA 2E10A 3SWNB 4ZTFA 2DTIA 4M7AF 5C0MA 4O6JA 5FU6C 4B9WA 1NJIU 1VUBA 4BI3A 1VQ4T 3QSUA 5LJ5f 3C94A 1QVFA 3CCQA 3TCJA 2BKDN 4M75A 2ZGWA 2HD0A 3M59A 2EQUA 2QI2A 5CKFA 5IAYA 4OB0B 4QVDA 4KULA 3SB2A 1QVGS 2EAYA 3DKMA 4D6WA 3CCLA 1UGQB 4PLIA 1NPPA 4C8QF 1OYXA 5KE2A 1N9RA 1W4SA 3OYIA 2L89A 3MEWA 5LJ5j 2RHUA 2WSEE 4C92F 5GMKl 5GAMe 3CMAT 4J7FA 1JBMA 2KK4A 4PJOG 2CZ7B 3ZFJA 5LJ3e 2X4XA 3GLXA 1VQ7T 3CXCA 4OB1B 3CBMA 3JAME 2QQRA 4J6XA 4PJOF 3CC7A 2L3RA 3URGA 2CZ1B 1N8RC 2VXFA 2JVVA 3KXTA 1YJNA 2D9TA 4P5NA 1Y96B 4UC4A 3CCUT 5AYFA 2EQJA 3X20B 5FU7C 1G3TA 3A8LB 1YHQA 5D6YA 1P92A 1I4K1 4BD3A 1BIAA 1WPYA 4C8QC 4Q5WA 4R56A 3DLLA 1KC8C 4HCZA 2ZPFB 3GNFB 5FRNA 3V7RA 2I2LA 4IUQA 3HRUA 4X9CA 2EQMA 2XHCA 2DKGA 5J39A 1KHCA 1X6OA 5GMKi 4C92C 2RHYA 3G4SA 3G71A 2QEXA 1K73C 4ME7A 3WXMB 5FRMA 4J8OA 4DA4A 5I2SA 3PMIA 2RM4A 2XK0A 3MEVA 3HFOA 3CBPA 3SWNA 4PJOC 1M90U 2PU9B 3GPLA 4A4FA 3OYYA 4C0GA 4HT9A 3VV0A 3L42A 3VUBA 3OYDA 2AHJB 4TVRA 4X34A 3CC4A 4C0FA 3N5BB 2DAQA 3NTIA 3J80E 1H3ZA 2EQKA 1V29B 5CKBA 1YBYA 4M7DF 2X4JA 4M78F 2RH2A 2DIQA 3T9NA 1BI2A 2L5QA 3CCET 3ZEHA 1ZBXA 3JCMd 5GAOl 3L2UA 2P0KA 3CEYA 2XI9A 2RO0A 4JS5A 3JSCA 3LGFA 4OMFB 1S72A 1XNIA 2E5QA 1YIJA 4MZMA 1VQKA 3MP6A 2DTHA 2XIDA 1QP3A 5LL6S 2G3RA 5LJ5e 3QO3A 1VQ9A 4BI4A 3OY9A 3G7ZA 4B9XA 3MO8A 5A0LA 3OYLA 1NE8A 3OW2S 1QVPA 4E7HA 1Y96A 2X35A 4M77E 1PSFA 3V8KA 2VGNA 3A5ZB 3PFSA 4NL3A 2RJDA 3PMTA 2MWPA 5GANh 2QA4T 2GFUA 2VYTA 4BDZA 3JB9G 2LQ8A 4M77G 1BKBA 2F5KA 4C5EA 4EMKB 4M7DC 1BYMA 1B34B 1EIFA 3CPWA 3CCVT 4M78C 1M9SA 4HT8A 4E7KA 2DJZA 1SSFA 3KBGA 2EWNA 2OTJA 4ZTJA 3QYGB 3CBOA 4FT4A 3VU3C 1VQOA 3CD6A 3QJYA 3GIBA 2K3XA 5IN1A 3QJ6A 2R5AA 4NS5A 3BY7A 4PLLA 1LOJA 2M1HA 4Y28E 1KD1C 3X28B 4DOVA 5A2QE 2MMPA 5A0DA 4BDYA 3SD4A 2RHIA 3QIIA 4RG2A 3JB9I 3L2ZA 3RUXA 5GMKj 2K5FA 4LD9K 4IURA 1N27A 4J5YA 3E9GA 3LW5E 3UT1A 3CCRA 1UEBA 5CQXA 2E6NA 3CPWS 2XDPA 1YITA 3CPFA 3A8GB 3RMSA 2DXUA 2X4WA 1Q82U 1XOVA 3CCQT 1VQPA 4M7AE 2DXBA 1WQWA 3P8HA 1NPRA 3M58A 4JRPA 4M7AG 3FC3A 3UPUA 1U1SA 3CCLT 3O8VA 3GNGA 4CRIA 4F7UB 4C5GA 3JB9J 2H3JA 4XU3A 4C8QE 2K2VA 2JZ2A 2KSSA 3DB4A 5L8RE 1KQ1A 1XTDA 4C8QG 4IUVA 3L2WA 4ZN1A 2DIGA 4C92E 1U8RA 3NTHA 1I8FA 2ZPGB 3RKXA 5CKHA 1NJIC 4JJNK 1UGRB 4J83A 4BE0A 4C92G 1WJSA 4XTZA 3X24B 5GANd 4A54A 2Y4YA 2RJCA 4FM4B 2QDYB 1LJOA 4HA8A 4ZGDB 3JCMX 1UGSB 4EMKA 2RI2A 1YJNT 4PJOE 1B34A 4A4HA 1ZQ1A 1VQMA 3JCMh 3LGLA 4XU0A 3RERA 5GAN4 2LX9A 1O9SA 3BW1A 3QZ5B 1YHQT 3SFMA 5GAOr 2E41A 5GMKm 1YJ9A 3P8DA 2P4TA 3FB9A 3L1AA 3PTAA 3QG1A 1QVFS 2PVDB 5GAOp 3CCJA 4M7AC 2EFIA 1VIEA 5CVIA 3CC7T 1M1KC 2LT1A 2OTJT 4N4GA 1K9MU 3OMCA 3G4ST 2KDSA 3G71T 4IUPA 3JCMg 2QEXT 5DLOA 2DD4A 3QPHA 3FIFA 2NLUA 3HHTB 2BUDA 4EMGA 5HKCA 2RI5A 4R55A 4NL2A 3PT9A 4M75G 2PVGB 1X01A 3G6EA 3M57A 3JCMJ 2A3LA 3S3MA 1VIFA 3M55A 1H641 3VJPA 3RIRA 2BIVA 1N8RU 4V2SA 4M75F 3OSSC 1VQ5A 3E1SA 2HBPA 1G5VA 4HKEA 3OYBA 4OB3B 3DLMA 4XK8E 2IG0A 3X26B 4N0AA 5D6WA 1K8AU 3CXCS 3Q1JA 3S3OA 4IUTA 1HK9A 5GMKe 4MDXA 3M5AA 3CC4T 4XTVA 1QW1A 3UDCA 5GAMh 2ZPHB 1KC8U 1MGQA 4L59A 4F7UA 2LTOA 2CZ0B 2JTMA 3A8OB 4OF1A 5LJ3h 3OYAA 1K73U 4M7DE 4KBMB 2GQVA 4WF2A 4M78E 1VQLA 3JCMf 4BY6C 4LDUA 4M7DG 1VQ6A 3AHUA 2CYZB 4QVCA 1S72T 1M90C 3HSBA 4M78G 2E70A 2WSFE 1YIJT 2DXCA 1G3WA 3P8BB 1VQKT 4BE2A 4MMKA 2E1HA 3F70A 3HRSA 1OI1A 3OBWA 3C95A 1VQ9T 4M75C 3TEEA 5FU7B 1R8OB 5IT9E 3JB9H 4JUVA 3KUFA 2VC8A 4C8QB 1AHJB 2ZCFB 4J6WA 3OYNA 3OBYA 2R5MA 2LRQA 3L2VA 4XTYA 2LCLA 4RMOA 3E19A 3CCSA 2K4YA 2KQWA 4IUUA 3V8JA 5GAOm 3OSVA 2QQSA 4M77A 5KCOA 1U1TA 4FIBA 4XQ3A 3OS0A 2DEQA 1Q86U 4ATOA 2PQWA 2JUFA 2LDMA 2C06A 1G3YA 3FEOA 1VQOT 3M54A 3CD6T 2MAMA 4PJOB 2QQAA 3HRTA 4F7UF 3M4GA 2K5LA 3VUZA 4NOYA 4C8QD 4JDSA 3A8HB 3V7SA 3FDRA 4FL6A 1M4ZA 2HQEA 1Q81U 3OS1A 1M8VA 4C5IA 5LJ3f 1M1FA 5CK9A 3SDZA 1Q7YU 4L5GA 5GANg 2M16A 2K3YA 5CR2A 3FRNA 3CCRT 4LDXA 3BDUA 2JOYA 4A53A 2DO3A 5GAN2 2QQBA 4RCBA 5GAMd 1TH7A 3LH0A 5C6SA 3CCMA 3PIPA 4JLGA 2CS7A 2YHTA 3JCMc 3CC2A 5FROA 1VQPT 1RL2A 4PJOD 2RHXA 4LD6A 2D6FA 1MHNA 5LJ3d 4HCBA 3ASKA 5LJ3j 2MI6A 4C0DB 3OYFA 4OP0A 4QVZA 3I55A 4E7IA 3J7AF 4BI8B 4XTXA 4FU6A 4E7LA 4A4KA 3SWNC 3UWNA 2XDDA 2ZPBB 1M1GA 3MP1A 4Y91A 3RMQA 3CMEA 3PIOA 3OYCA 2B8AA 1W2BA 2E6ZA 1KD1U 2LCCA 1YI2A 4LDYA 3BDLA 4X9DA 2RK1A 3JCMW 5DM7R 2DVEA 5M9OA 3OS5A 4C8QA 3MP8A 4OB2B 4M7DB 1HXDA 2EIFA 2OAUA 3M56A 2F69A 4M78B 1Q82C 1BI0A 1JJ2S 1FWZA 5GANf 4JRQA 3E9FA 1BIBA 4ZGJB 1YJWA 4OGEA 3R6OA 3M53A 2RJEA 4J7IA 2GCXA 3ME9A 4L6V5 2M9UA 3HKSA 4C0ZA 1VQMT 5CO7A 5KCHA 4ELZC 3OYGA 3I56A 2CZ6B 1UGPB 2P0PA 2VV5A 2DZCA 3OQ5A 4N4HA 1YJ9T 5HK0A 4PJOA 1W2BS 3CCJT 1LNXA 5GANj 4XAXB 1WGSA 2M0OA 4JLIA 5EG2A 4GLKA 2OTLA 1IREB 2GF7A 2QQ9A 4A4GA 3L2RA 4MZPA 2JTFA 4XTUA 3V8LA 3QUIA 4Z02A 3JCMb 2HQXA 1KQSA 4M78D 1BI3A 2DZ9A 2HAXA 1FXXA 3A8MB 3FJPA 1KQ2A 4E7JA 3INZA 4XU1A 3G6ET 1VQ8A 2RD1A 3C4SA 5J26A 3H8ZA 4M77B 4RKUE 3JCMQ 3OMGA 4RG8A 4E47A 5GAOq 3NFCA 4C5HA 3OYMA 1VQ5T 3MEUA 3GF5A 4VUBA 3VYGA 5GAN8 2EJFA 3OYKA 4M75E 2Y4XA 4QW2A 5FU6B 2DPPB 4XTWA 2PUKB 1VQ4A 3JCMV 2O01E 3QHSA 5LJ5d 4A4EA 1IZ6A 1K9MC 3MEAA 1Y07A 3HP9A 5CAIA 2KY9A 1KQSS 1X75C 1XQHA 5J3BA 5KE3A 1M1KU 1JJ2A 2XD0A 4XU2A 4PKCC 2RK2A 2R57A 4KT0E 2RB6A 3JRZA 5CCAA 1NZ9A 5DY9A 1WQ7A 2V8KA 4JRIA 2FYKA 3JB9D 2VUBA 2XG8D 3BFMA 5GAN7 1VQLT 4HCCA 1VQ6T 4M77D 3LYIA 4M7DA 2PUOB 3LX7A 3QZ9B 2ZZDA 4M78A 1JRIA 2F5TX 5CIUA 1D3BB 5GAN6 5DLQE 3CMAA 1K8AC 4II1A 4EPCA 2L8DA 2K5IA 2Y90A 3QKJA 2DTOA 2O4XB 2EYQA 4M7AB 3NTKA 1VQ7A 1PSEA 5GAMg 2RHZA 2DD5A 5FLXE 1G3SA 2A7YA 3CCST 3EFSA 3OA6A 3LWIA 5KH6A 5LJ3g 1WNLA 2DK3A 3S6WA 3CCUA 3C12A 2KAFA 2RA2A 3RKYA 1QP2A 2ZPEB 2V8JA 2QTXA 2FVUA 2VXEA 2FB7A 4FSXA 2GFAA 2K57A 1DJ7B 3J81E 2FL7A 3GOXA 5I2MA 4DOWA 2DXTA 4C92B 2JN0A 4BUGA 5GANe 3WVDB 5A0GA 2R58A 3QBYA 4KUIA 2HNIA 4EMKC 4DQ2A 4J6YA 4EMHA 4F7UE 5GMKh 3OYJA 4M7AD 1KHIA 2LT4A 4RCCA 4F7UG 3ER0A 3VYHB 3PGGA 5HK3A 3OW2A 5HY6A 3TREA 3M9QA 3H6ZA 2KVQG 3M4YA 4BB7A 5GAOn 2YRVA 2CKKA 3HFNA 2MWOA 4EDUA 2P0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X75 C;  4ME7 A;  2MF2 A;  4HKE A;  4MZP A;  3JRZ A;  5CCA A;  1M1F A;  5CK9 A;  2VUB A;  4MDX A;  3JSC A;  4MZT A;  5CQY A;  5CR2 A;  1UB4 A;  4MZM A;  1VUB A;  3TCJ A;  4OF1 A;  3NFC A;  3G7Z A;  5CKF A;  5DLO A;  5CKE A;  5CO7 A;  3VUB A;  4VUB A;  1NE8 A;  4ELY C;  4ELZ C;  3HPW A;  5CKD A;  5HK3 A;  5HKC A;  2KMT A;  5CKH A;  2C06 A;  5CQX A;  5HK0 A;  5CKB A; 
#chains in the Genus database with same CATH topology
 1TU0 B;  2V1Q A;  1ZLM A;  1YJN Q;  4LDV A;  1Y0M A;  3EFR A;  1AZG B;  1TWB A;  4C92 D;  1YHQ Q;  2XDB A;  2QYZ A;  1BI1 A;  2LMJ A;  4M75 B;  3CC7 Q;  2XIC A;  1JB0 E;  5GAM j;  3CME T;  3OB9 A;  2LJ1 A;  1I5L A;  1MV3 A;  1N5Z A;  2AIR B;  2VGM A;  3MET A;  2O4X A;  3JV3 A;  1MMN A;  4PL6 A;  1PKT A;  1OZ2 A;  3S3N A;  1N9S A;  2LC4 A;  1RAE B;  1UB4 A;  3JCM P;  2K2M A;  2YSQ A;  2HL5 C;  1B3Q A;  2CUB A;  5KYX A;  1KFZ A;  3EG0 A;  1M5Q 1;  2IVW A;  2GGR A;  1YIJ Q;  1VQ8 T;  5D6X A;  4ZGE B;  2E64 A;  3QDR B;  1QVG P;  4PNO A;  2HEQ A;  3X25 B;  3RES A;  1NJI U;  1VQ4 T;  1WYX A;  4M75 A;  1UEC A;  5CKF A;  4QVD A;  3M0R A;  4PLI A;  1NPP A;  5KE2 A;  1QVF P;  3OYI A;  1UG1 A;  5LJ5 j;  2RHU A;  4C92 F;  3CMA T;  4J7F A;  1IHW A;  7AT1 B;  3ZFJ A;  3CXC A;  3JAM E;  1MND A;  2QQR A;  4PJO F;  2CZ1 B;  1JJ2 P;  2VXF A;  2ABL A;  2MYS A;  1MUZ A;  5D6Y A;  1P92 A;  1U5S A;  2AT1 B;  4BD3 A;  1T0H A;  3DLL A;  4R56 A;  4HCZ A;  4X9C A;  5GMK i;  3G71 A;  3G4S A;  4K11 A;  1CKB A;  1HYO A;  1JXO A;  4JZ4 A;  4J8O A;  4DA4 A;  5I2S A;  3EH2 A;  1Q82 R;  2RM4 A;  2XK0 A;  2EGC A;  4OMP A;  3MEV A;  2G6F X;  1M90 U;  2PU9 B;  2H3E B;  4A4F A;  3VV0 A;  3L42 A;  3EH1 A;  1RAH B;  3RBB B;  1WI7 A;  1GFD A;  5CKB A;  1RAA B;  1ZSG A;  1K9A A;  2KXD A;  1QCO A;  2KBT A;  1S72 A;  2E5Q A;  4FYW B;  3MP6 A;  3G6E Q;  2XID A;  3QO3 A;  2VVK A;  3OW2 S;  4J9H A;  4M77 E;  1PSF A;  3A5Z B;  3PFS A;  2RJD A;  2MWP A;  4M77 G;  1BK2 A;  1M9S A;  2FEI A;  1RAG B;  1SEM A;  4KH0 B;  4ZTJ A;  4FT4 A;  3CBO A;  4PJJ A;  1YCS B;  5IN1 A;  1VQ6 Q;  3QJ6 A;  4FYV B;  3CPW P;  4PLL A;  2HSE B;  2A0F B;  1OU9 A;  4Y28 E;  2DIL A;  3JB9 I;  1WDX A;  1ZA1 B;  3MJX A;  3QII A;  2K5F A;  3CCR A;  2QAS A;  1YIT A;  3CPF A;  1K0X A;  3RMS A;  3CCS Q;  4M7A E;  4KGV B;  2FRY A;  1OU8 A;  1WX6 A;  4M7A G;  6AT1 B;  1PKS A;  3L2W A;  1SHF A;  1RI9 A;  4BE0 A;  2M02 A;  1D1C A;  2EYW A;  1GCQ A;  4A54 A;  4HA8 A;  3ZL7 C;  1W70 A;  2BZY A;  2RI2 A;  2HMA A;  1ZQ1 A;  3GBQ A;  3JCM h;  5GAN 4;  1ACM B;  1O9S A;  2L3S A;  2J6F A;  3SFM A;  1YJ9 A;  1Q81 R;  3PTA A;  2PVD B;  4M7A C;  2EFI A;  5CVI A;  1M1K C;  3G71 T;  3G4S T;  3CME Q;  2KRN A;  3M0T A;  3VRZ A;  2YDL A;  4EMG A;  5HKC A;  2ENM A;  1PRM C;  2J7I A;  2PVG B;  1X01 A;  2V1R A;  3M55 A;  8ATC B;  3VJP A;  3RIR A;  2EVR A;  2IG0 A;  3CXC S;  2KRS A;  5GMK e;  3M5A A;  1OV3 A;  3UDC A;  1IHV A;  1W1F A;  2LTO A;  2CZ0 B;  3A8O B;  4OF1 A;  5LJ3 h;  1K73 U;  4M7D E;  2IIM A;  2GQV A;  4J9F A;  4M78 E;  3JCM f;  4M7D G;  1A0N B;  1S72 T;  1ZX6 A;  4M78 G;  3P8B B;  4BE2 A;  2AZV A;  4MMK A;  1VQ8 Q;  3REB B;  3TEE A;  2K79 A;  3KUF A;  1VQ4 Q;  4RMO A;  1B07 A;  2K4Y A;  2SRC A;  3OSV A;  2QQS A;  1U1T A;  3OS0 A;  2DEQ A;  4ATO A;  2COZ A;  2LDM A;  1G3Y A;  2A37 A;  1OQK A;  3HRT A;  4F7U F;  2K5L A;  3VUZ A;  1QCF A;  4JDS A;  4FL6 A;  2HQE A;  4CC4 B;  5LJ3 f;  1M1K R;  5GJW B;  5CR2 A;  3FRN A;  3CCR T;  3BDU A;  4A53 A;  3M0Q A;  2DO3 A;  2KGT A;  4RCB A;  1YIT T;  1TH7 A;  4JLG A;  1OOT A;  1RL2 A;  5LJ3 d;  4C0D B;  3OYF A;  3I55 A;  4E7I A;  4IIM A;  4XTX A;  4BI8 B;  4D8K A;  2DYI A;  4A4K A;  4E7L A;  3SWN C;  1AWW A;  3UWN A;  2F1L A;  3UF4 A;  2XDD A;  2ZPB B;  1M1G A;  3MP1 A;  2E6Z A;  4X9D A;  2RK1 A;  3JCM W;  4FYY B;  5DM7 R;  4OB2 B;  1PHT A;  4OGE A;  3NHN A;  1NM7 A;  1R0C B;  4J9C A;  3I56 A;  4E2F B;  2GNC A;  1YJ9 T;  4N4H A;  1HSQ A;  3A98 A;  4RTV A;  1LNX A;  3U23 A;  4XAX B;  1PWT A;  4JLI A;  1LVK A;  2M0O A;  2HBW A;  5EG2 A;  2OTL A;  3V8L A;  1MV0 B;  4Z02 A;  3JCM b;  2J06 A;  4M78 D;  1BI3 A;  3A8M B;  3C4S A;  3H8Z A;  1KQS P;  1R0B G;  4M77 B;  1K0S A;  3OMG A;  4RG8 A;  3OYM A;  3MEU A;  3VYG A;  1G2B A;  2AK5 A;  2EJF A;  1ABO A;  1NYG A;  4M75 E;  1VQO Q;  4XTW A;  3AT1 B;  1K9M C;  3MEA A;  1Y07 A;  1UHC A;  2AKL A;  4GBQ A;  5J3B A;  1JJ2 A;  1RLP C;  1UHF A;  4KT0 E;  3JRZ A;  3CQT A;  2V8K A;  4HCC A;  3JB9 D;  2VUB A;  3BFM A;  2VAS A;  4HCK A;  5HCK A;  3QZ9 B;  1JRI A;  1K8A C;  4EPC A;  2VB6 A;  3H0H A;  2KYM A;  2KI7 A;  2K5I A;  4DBH A;  1PNJ A;  4M7A B;  2RHZ A;  3SHW A;  2DD5 A;  1YN8 A;  4RTZ A;  5KH6 A;  4J9I A;  3S6W A;  2F2V A;  3RKY A;  1GCP A;  2YRC A;  1QLY A;  2FB7 A;  2GFA A;  2K57 A;  3J81 E;  2FL7 A;  4DOW A;  2LZ6 B;  5IT9 E;  2R58 A;  2ATC B;  1NJI R;  4EMH A;  2BZ8 A;  4RCC A;  4J9G A;  4PJN A;  5GAO n;  2CKK A;  1CSK A;  1YFN A;  5GAM f;  2RI3 A;  1NEB A;  4PFZ A;  2CSQ A;  2MF2 A;  2X4Y A;  1ZHI A;  3EAE A;  4MML A;  4FW1 A;  3I55 T;  4CC2 A;  4IKF A;  4OGC A;  3EG3 A;  4KUD K;  4BAC A;  2NUP B;  5I21 A;  2XMF A;  3G71 Q;  3M0U A;  1AT1 B;  1MMA A;  3HPW A;  4N0A C;  5KYU B;  2D0Q B;  4J9D A;  1D0X A;  2EKO A;  2RN8 A;  5LJ5 h;  4M7A A;  3JB9 F;  1ZSZ B;  1ZBJ A;  2RJF A;  4R0K A;  1JQQ A;  1D1B A;  3VS5 A;  3I56 T;  4M75 D;  1O75 A;  1Q95 G;  4QQ6 A;  2LVM A;  1Y7X A;  1K4U S;  3OYH A;  1RAD B;  3V7C A;  2JTE A;  1C0M A;  3TU4 K;  2OTL T;  3WVE B;  1M90 R;  4AFU C;  4YTL A;  1E6G A;  1X69 A;  5CKD A;  2EJ9 A;  3M0P A;  1S72 Q;  2PVO B;  2O9S A;  4HXJ A;  4FT2 A;  4MDW A;  3OS2 A;  2CDT A;  3DB3 A;  1N6A A;  4N4I A;  3L2Q A;  3SWN B;  1WXB A;  2E10 A;  2DNU A;  2DTI A;  4B9W A;  1VUB A;  1W6X A;  3QSU A;  5LJ5 f;  2NUP A;  1NBE B;  4ORZ A;  4KUL A;  1QVG S;  4D6W A;  1UGQ B;  4C8Q F;  5KYU A;  1N9R A;  4PJM A;  2L89 A;  1VQN Q;  2CSI A;  5GMK l;  1AEY A;  5GAM e;  4AG2 C;  2KK4 A;  4PJO G;  3VS0 A;  1ZSZ A;  3TQ7 P;  4WCI A;  3GLX A;  1MNE A;  3CCR Q;  5KYW B;  1AWX A;  1WA7 A;  4P5N A;  4UC4 A;  5AYF A;  3X20 B;  4OML A;  3O5Z A;  2KT8 A;  5FU7 C;  1I4K 1;  1WPY A;  4Q5W A;  2ZPF B;  2OTJ A;  2D1X A;  3V7R A;  2I2L A;  5FWB A;  3HRU A;  1JJ2 S;  1T0J A;  5J39 A;  1X6O A;  4WTO B;  4C92 C;  1CKA A;  1ZUK A;  1K73 C;  2ESW A;  3WXM B;  2QK0 A;  1X6B A;  3SWN A;  4PJO C;  2ROT A;  4HT9 A;  2EW3 A;  1QMC A;  2DJQ A;  3VUB A;  3OYD A;  2J05 A;  4X34 A;  3CC4 A;  4C0F A;  1YJ9 Q;  5IHK A;  1V29 B;  1WZO A;  1C6V X;  2RH2 A;  1WIE A;  3T9N A;  2C0T A;  2L5Q A;  4D8D A;  3ZEH A;  2CP5 A;  1FMK A;  2K7A A;  4JS5 A;  1UTI A;  4OMF B;  4MZM A;  2EQI A;  1VQK A;  1I07 A;  5KYW A;  2G3R A;  5LJ5 e;  1VQ9 A;  4BI4 A;  3OYL A;  1SPK A;  1NE8 A;  1QVP A;  4NL3 A;  3PMT A;  5GAN h;  2GFU A;  2LQ8 A;  2F5K A;  1BCM A;  1BYM A;  1B34 B;  1U06 A;  4KH1 B;  1EIF A;  1SSF A;  3M0S A;  3KBG A;  4Z8A A;  1VQO A;  3CD6 A;  3QJY A;  1YP5 A;  2YT6 A;  4NS5 A;  1LOJ A;  2M1H A;  5A0D A;  4RG2 A;  1RAF B;  1RAB B;  1K73 R;  4IUR A;  1JXM A;  1UEB A;  2E6N A;  3CPW S;  2XDP A;  3LH5 A;  2X4W A;  2E3H A;  2DXB A;  3M58 A;  3MPU B;  4JRP A;  4HVV A;  3FC3 A;  2X3W D;  3UPU A;  4OMM A;  1KK7 A;  2L3Q A;  4C5G A;  4XU3 A;  1I5O B;  2K2V A;  2JZ2 A;  3DB4 A;  2LNH B;  1QKX A;  5L8R E;  1KQ1 A;  1KSW A;  2BTT A;  1U8R A;  1M3A A;  4ZN1 A;  3RKX A;  5CKH A;  4J83 A;  1OUL A;  5GAN d;  2YRD A;  4DEX A;  1LJO A;  4ZGD B;  1B34 A;  4A4H A;  2ED0 A;  2LX7 A;  2CT3 A;  2RQW A;  1YWO A;  3I55 Q;  5GAO r;  5GMK m;  2P4T A;  3FB9 A;  3L1A A;  3QG1 A;  2OTJ T;  2RQR A;  2LT1 A;  1K9M U;  3OMC A;  3JCM g;  1WHM A;  2CH4 W;  2RI5 A;  2EYX A;  1NEG A;  4R55 A;  1IRX A;  1G83 A;  3JCM J;  3M57 A;  3UA6 A;  2J6O A;  2F2X A;  2HBP A;  3OYB A;  4OB3 B;  4XK8 E;  3X26 B;  1K8A U;  4N0A A;  5D6W A;  3I56 Q;  3CC4 T;  1QW1 A;  3E2U A;  1KC8 U;  2D8H A;  2M0Y A;  2JTM A;  2A36 A;  4KGX B;  2OTL Q;  2FPF A;  1LCK A;  3H0I A;  2K6D A;  2WSF E;  2I0N A;  1G3W A;  2KRO A;  3EGX B;  1VQK T;  2E1H A;  3F70 A;  2EGE A;  2JW4 A;  1VQ9 T;  5FU7 B;  1R8O B;  3JB9 H;  4JUV A;  5AT1 B;  3BE3 A;  4J6W A;  2DRM A;  2E5K A;  3OBY A;  1Y57 A;  2RQV A;  2R5M A;  3OYN A;  2LRQ A;  2RF0 A;  3NPF A;  3V8J A;  3TVT A;  1AVZ C;  3A1P A;  1WHG A;  2PQW A;  2C06 A;  3EHR A;  1VQO T;  3M54 A;  3CD6 T;  4PJO B;  1QQJ A;  4NOY A;  1IXD A;  2CP6 A;  1BU1 A;  3SDZ A;  4L5G A;  1UJY A;  2M16 A;  1VQN A;  2QQB A;  3EG2 A;  4KRT A;  5IHN A;  2CS7 A;  3JCM c;  2D6F A;  1MHN A;  4J9E A;  4OP0 A;  4EIK A;  3VS2 A;  2M51 A;  3EGX A;  3RMQ A;  2MIO A;  3PIO A;  2B8A A;  3OYC A;  2P4R A;  1KD1 U;  2RMO A;  4LDY A;  2L2P A;  4DEY A;  2DVE A;  4LXC A;  5IHI A;  1GFC A;  2FO0 A;  4M4Z A;  2CUD A;  2EIF A;  1IGQ A;  2OAU A;  3M56 A;  1W2B P;  1TUC A;  1FWZ A;  4JRQ A;  1BIB A;  1YJW A;  3R6O A;  3M53 A;  4L6V 5;  2M9U A;  2V26 A;  4ELZ C;  3OYG A;  2HSP A;  2DZC A;  3OQ5 A;  3NMZ C;  4PJO A;  2DER A;  5GAN j;  1WGS A;  5KYY B;  2HCK A;  2EBP A;  1SRM A;  3L2R A;  3QUI A;  4LNP A;  2HQX A;  4FSS A;  1FXX A;  4E7J A;  3INZ A;  4RKU E;  4E47 A;  1EZZ B;  4C5H A;  2JM9 A;  1AWO A;  2K3B A;  2DPP B;  4JPB W;  3TSZ A;  4A4E A;  3TSW A;  2KY9 A;  1KQS S;  1F1B B;  2XD0 A;  2YUO A;  2RB6 A;  5CCA A;  5DY9 A;  1WQ7 A;  2A28 A;  4M77 D;  3LYI A;  2DVJ A;  2ZZD A;  5CIU A;  1D3B B;  2NUT B;  4II1 A;  1KIK A;  3I5R A;  2L8D A;  1QKW A;  1I0C A;  5GAM g;  2BE7 D;  5KYY A;  3CCU A;  1QP2 A;  2ED1 A;  5EC7 A;  1HJD A;  1DJ7 B;  1JEG A;  4AG1 C;  1NLO C;  4DQ2 A;  4J6Y A;  4EMK C;  4M7A D;  2LT4 A;  1T3L A;  3ER0 A;  3VYH B;  2KNB B;  5HY6 A;  3M9Q A;  2KVQ G;  4BB7 A;  1VQN T;  2P0Q A;  1Q86 C;  2LQW A;  2XU8 A;  3OW2 P;  4LN2 A;  4JS4 A;  2E12 A;  2XKO C;  1VYV A;  4MZT A;  5KYN A;  3H9N A;  2OTJ Q;  2PNI A;  1SG5 A;  2LQK A;  1D3B A;  1OZ3 A;  2D8J A;  2FHD A;  2NUT A;  4ELY C;  1Q7Y C;  3HL8 A;  2KMT A;  4LUD A;  3MCA B;  1TG0 A;  2LJ0 A;  4BE1 A;  2YUQ A;  2QAZ A;  3PNW C;  4ZN3 A;  1IB8 A;  3LLR A;  1YJW T;  4M77 F;  2YUN A;  2H8H A;  2DF6 A;  3ZBD A;  1M3C A;  4FCY A;  5LJ5 g;  3CC4 Q;  3PVQ A;  2C0I A;  1UJ0 A;  2HL3 A;  4QQD A;  4E7Z A;  3CCV A;  3NGP A;  2EYZ A;  2CGH A;  4E7S A;  2FG0 A;  2QGF B;  3VKI A;  3JCM e;  1QVG A;  5GAN 3;  4JRK A;  4AFZ C;  1VQK Q;  2QXF A;  1I81 A;  2WAC A;  1VQ9 Q;  1RI0 A;  1KG1 A;  1YCY A;  2JNG A;  4CC3 A;  4M7D D;  4J9B A;  1FX7 A;  2LNV A;  4GY5 A;  5CQY A;  4ZTF A;  4M7A F;  5FU6 C;  3G1J A;  4BI3 A;  3QWX X;  1QVF A;  1WHH A;  2BKD N;  1S1N A;  2HD0 A;  2QI2 A;  4DBF A;  3CD6 Q;  2GQI A;  3MEW A;  2WSE E;  1JBM A;  2GBQ A;  2MK5 A;  5LJ3 e;  4RTU A;  3CBM A;  2L3R A;  3URG A;  2MOX A;  2NWM A;  3EG9 B;  2D9T A;  1UUE A;  2E4H A;  3CCU T;  1V1C A;  1G3T A;  1UFF A;  4C8Q C;  1KC8 C;  2JS0 A;  2EQM A;  2DKG A;  2QEX A;  1X43 A;  2D0N A;  3PMI A;  5FW9 A;  1E6H A;  1PD1 A;  3GPL A;  3OYY A;  4C0G A;  2AHJ B;  4TVR A;  1MMD A;  2DAQ A;  1H3Z A;  2EQK A;  2DEU A;  4M7D F;  1AOJ A;  4M78 F;  4FW2 A;  1FMV A;  1BI2 A;  1H3H A;  1ZBX A;  2CP7 A;  4AFS C;  1AZE A;  2DL3 A;  3CEY A;  2RQU A;  2RO0 A;  3LGF A;  3H0F A;  3EG1 A;  1QP3 A;  5LL6 S;  4B9X A;  1D09 B;  3EG9 A;  2X3X D;  1K9M R;  2GTJ A;  2X35 A;  3V8K A;  2VGN A;  3IQL A;  4BDZ A;  2DFU A;  1BKB A;  2O2O A;  4C5E A;  4EMK B;  3REA B;  4B6M A;  3CPW A;  3CCV T;  1NG2 A;  3D7S B;  2K3X A;  1K8A R;  3BY7 A;  4LE9 A;  1KC8 R;  1KD1 C;  1V76 A;  4BDY A;  2F2W A;  3RUX A;  4LD9 K;  2YWW A;  1OEB A;  4J5Y A;  1N27 A;  3UT1 A;  3E9G A;  2FZG B;  3A8G B;  2O9V A;  1XOV A;  3RR6 A;  5I11 A;  3O8V A;  3GNG A;  2DM1 A;  4CRI A;  1UDL A;  2H3J A;  1EFN A;  4Z89 A;  2COY A;  2GTO A;  4RTW A;  4C92 E;  3ULR B;  1I8F A;  2A08 A;  2W0Z A;  4JJN K;  4C92 G;  1WJS A;  2QTV A;  2KYB A;  1UGS B;  4EMK A;  4PJO E;  1VQM A;  3EFO B;  3LGL A;  3BW1 A;  3QZ5 B;  1HD3 A;  2JMA A;  3SEM A;  1QVF S;  5GAO p;  3CCJ A;  2QGG A;  3I35 A;  3UAT A;  2QEX T;  4IUP A;  2DA9 A;  1TOV A;  2DD4 A;  1GBQ A;  2NLU A;  2BUD A;  2X9H A;  4NL2 A;  3PT9 A;  2LJ3 A;  2A3L A;  2ECZ A;  2RPN A;  1N8R U;  2BIV A;  1YJW Q;  4M75 F;  3OSS C;  1VQ5 A;  3E1S A;  3DLM A;  1J3T A;  4Y92 A;  1IGU A;  3S3O A;  3Q1J A;  4MDX A;  1KD1 R;  1PM3 A;  2KE9 A;  2ZPH B;  4QKU A;  1MGQ A;  4L59 A;  2CRE A;  4AMC A;  1OPK A;  2KR3 A;  1VQL A;  4BY6 C;  2CYZ B;  1TUD A;  4RUG A;  1OI1 A;  2FPE A;  2VC8 A;  4C8Q B;  2OAW A;  3CCL Q;  3EFO A;  1JO8 A;  1WXU A;  4CC7 A;  2OX7 A;  1D0Y A;  2Z0W A;  1GCQ C;  1WLP B;  3L2V A;  4XTY A;  2LCL A;  3E19 A;  2KQW A;  4IUU A;  4OMO A;  4AT1 B;  4FIB A;  4XQ3 A;  1Q86 U;  2E3I A;  2RQT A;  1SRL A;  5IXB A;  2QQA A;  2O88 A;  3A8H B;  2AZS A;  3V7S A;  5CK9 A;  1AD5 A;  1Q7Y U;  1RAI B;  2JOY A;  1TSF A;  3LH0 A;  5C6S A;  3CCM A;  3PIP A;  3CC2 A;  4PJO D;  3VS4 A;  2RHX A;  3CCU Q;  2HKN A;  5IH2 A;  2JM8 A;  4JZ3 A;  2DL4 A;  1G8X A;  4Y91 A;  2LCC A;  1YI2 A;  3BDL A;  5M9O A;  4KGZ B;  3OS5 A;  1B7T A;  4C8Q A;  1HXD A;  4HVU A;  1Q82 C;  1BI0 A;  5GAN f;  3E9F A;  4ZGJ B;  5GJV B;  2RJE A;  3ME9 A;  2VWF A;  4C0Z A;  3HKS A;  1VQM T;  5CO7 A;  5KCH A;  2YXY A;  2CZ6 B;  1UGP B;  2P0P A;  2VV5 A;  4JJB A;  2BE9 B;  1W2B S;  3CCJ T;  1R77 A;  4MZP A;  1KQS A;  2RNA A;  2DZ9 A;  1SF9 A;  1GBR A;  2RD1 A;  4Z88 A;  1NLP C;  2CH4 A;  5J26 A;  1X6G A;  3JCM Q;  3NFC A;  1VQ5 T;  5GAN 8;  4QW2 A;  2DBK A;  2QDL A;  2CP0 A;  8AT1 B;  3JCM V;  2O01 E;  3QHS A;  1IZ6 A;  3HP9 A;  5CAI A;  1X75 C;  1XQH A;  2FZC B;  3CCV Q;  4PKC C;  2RK2 A;  2HKQ B;  4JRI A;  2FYK A;  1VQL T;  2XG8 D;  5GAN 7;  3RNJ A;  3LX7 A;  4GLM A;  2F5T X;  1VQP Q;  2X51 A;  2CP2 A;  3QKJ A;  2DTO A;  1OX8 A;  2EYQ A;  3NTK A;  1VQ7 A;  1PSE A;  1WFW A;  5FLX E;  1G3S A;  2FPD A;  2A7Y A;  3EFS A;  3OA6 A;  5LJ3 g;  1WNL A;  1Z9Q A;  1UGV A;  2V8J A;  2QTX A;  1PCX A;  1M30 A;  2JMC A;  4C92 B;  2JN0 A;  4BUG A;  1ZA2 B;  5GAN e;  5A0G A;  3QBY A;  2HNI A;  4F7U E;  5GMK h;  3OYJ A;  1AWJ A;  1KHI A;  4LUE A;  4F7U G;  3PGG A;  3TRE A;  3M4Y A;  2YRV A;  1GRI A;  3CCM T;  2DL7 A;  3GP8 A;  3CC2 T;  2V8I A;  4BY6 B;  2KRM A;  4O5V A;  4PK4 A;  1FYN A;  3QXE B;  1PG5 B;  1RAC B;  4C0D C;  1OX9 A;  2YLB A;  3HTR A;  1Q81 C;  1VA7 A;  2QEX Q;  3CCE A;  4CI0 C;  3I5S A;  2AKK A;  4E6R A;  5CKE A;  1YI2 T;  2O31 A;  3QDF A;  2WSC E;  2E65 A;  2PTK A;  2EJG A;  1IO6 A;  1K76 A;  3OYE A;  4OVA A;  1Y71 A;  1PRL C;  4LDW A;  3RKW A;  2DET A;  1ARK A;  2QA4 A;  1WJR A;  3LWH A;  3FJ5 A;  4C92 A;  1RUW A;  2JJ9 A;  4QQG A;  1TTH B;  1GXI E;  1WJQ A;  2YLC A;  4PFO A;  4F16 A;  3FLG A;  1U3O A;  4M77 C;  5GAN 5;  1BB9 A;  4DBR A;  4X1V A;  3QYH B;  2ZPI B;  3MHX A;  1UE9 A;  5C0M A;  1LPL A;  4O6J A;  2DX1 A;  3C94 A;  3CCQ A;  3TCJ A;  2ZGW A;  5IAY A;  3M59 A;  2EQU A;  4OB0 B;  1M2O A;  3SB2 A;  2EAY A;  3DKM A;  3CCL A;  1OYX A;  1W4S A;  1OPL A;  4JJD A;  2ROL A;  3VRY A;  4FYX B;  4OMQ A;  3VS3 A;  2CZ7 B;  2X4X A;  2JS2 A;  4IIO A;  1VQ7 T;  4OB1 B;  4J6X A;  1N8R C;  2DRK A;  2JVV A;  3KXT A;  1YJN A;  1Y96 B;  1MMG A;  3PVL A;  2EQJ A;  1YHQ A;  2COW A;  3A8L B;  1PD0 A;  2NYS A;  1BIA A;  1WHL A;  3GNF B;  5FRN A;  3CC7 A;  4IUQ A;  2XHC A;  1KHC A;  3THK A;  2RHY A;  2BZX A;  4ME7 A;  5FRM A;  2KEA A;  4RTY A;  2YUP A;  2SEM A;  3HFO A;  3CBP A;  1WXT A;  2EKH A;  2FRW A;  1VQM Q;  1YNZ A;  3N5B B;  3J80 E;  3NTI A;  2MCN A;  3EGU A;  1YBY A;  3RDV A;  1QCN A;  3CCJ Q;  1RLQ C;  2X4J A;  2DIQ A;  1X2Q A;  3CCE T;  3JCM d;  5GAO l;  3L2U A;  2P0K A;  2XI9 A;  1QWE A;  3JSC A;  1XNI A;  1YIJ A;  2LP5 A;  2DTH A;  9ATC B;  1M8M A;  3OY9 A;  3G7Z A;  5A0L A;  3MO8 A;  1VQ5 Q;  1ZSZ C;  4E7H A;  1Y96 A;  1TXQ A;  2QA4 T;  5ECA A;  3VS7 A;  3JB9 G;  2LQN A;  1Z9Z A;  2VYT A;  4M7D C;  3CMA Q;  4M78 C;  1C1A A;  4HT8 A;  4E7K A;  2DJZ A;  2EWN A;  1N8R R;  3QYG B;  4F17 A;  3VU3 C;  1VQL Q;  3GIB A;  2R5A A;  1NYF A;  1BBZ A;  4A63 B;  3X28 B;  4DOV A;  2CT4 A;  5A2Q E;  2MMP A;  3SD4 A;  2RHI A;  3L2Z A;  5GMK j;  3LW5 E;  5CQX A;  2DXU A;  1Q82 U;  1H8K A;  3CCQ T;  1VQP A;  1D0Z A;  2NUZ A;  3P8H A;  1WQW A;  1NPR A;  1PC0 A;  2DYB A;  1U1S A;  3CCL T;  4F7U B;  3JB9 J;  4C8Q E;  2OI3 A;  2KSS A;  2OJ2 A;  1XTD A;  4C8Q G;  4IUV A;  2DIG A;  3NTH A;  2ZPG B;  2ZAE A;  1Q86 R;  1NJI C;  1UGR B;  4XTZ A;  3X24 B;  4F14 A;  2J6K A;  2Y4Y A;  2RJC A;  4FM4 B;  2QDY B;  5FWC A;  1M2V B;  3JCM X;  3CCM Q;  2VKN A;  2B86 A;  1YJN T;  3CC2 Q;  4ESR A;  5IXF A;  4XU0 A;  2DL8 A;  3RER A;  2LX9 A;  1YHQ T;  2E41 A;  3H41 A;  3P8D A;  1YWP A;  4ANJ A;  1VIE A;  1Q7Y R;  3CC7 T;  2FZK B;  4N4G A;  2KDS A;  5DLO A;  5D7U A;  1YI2 Q;  3QPH A;  3FIF A;  4PJL A;  2KT1 A;  3HHT B;  3CXC P;  1SKU B;  1D1A A;  4M75 G;  1ZUU A;  3UA7 A;  3G6E A;  3EHQ A;  3S3M A;  1WHJ A;  1VIF A;  1H64 1;  5L23 A;  4V2S A;  1G5V A;  4HKE A;  3R6N A;  4IUT A;  1HK9 A;  4HVW A;  4XTV A;  5GAM h;  1GL5 A;  4F7U A;  3QWY A;  3OYA A;  4KBM B;  4WF2 A;  2C0O A;  2P84 A;  4LDU A;  1VQ6 A;  3AHU A;  1XJW B;  4QVC A;  1M90 C;  3HSB A;  1YIJ T;  2E70 A;  1WHK A;  2DXC A;  3HRS A;  3OBW A;  2MPX C;  1M27 C;  3EGD B;  3C95 A;  1M2V A;  4M75 C;  4DBQ A;  4OMN A;  2DMO A;  1AHJ B;  2ZCF B;  3CCS A;  1K1Z A;  1H92 A;  5GAO m;  2DL5 A;  5KCO A;  4M77 A;  2JUF A;  1VYU A;  2W10 A;  3FEO A;  2K9G A;  2MAM A;  1VOM A;  3M4G A;  4C8Q D;  3MKD A;  3FDR A;  1I1J A;  1M4Z A;  1Q81 U;  3OS1 A;  1M8V A;  4C5I A;  1M1F A;  2L3P A;  5GAN g;  2K3Y A;  1VQ7 Q;  4LDX A;  5GAN 2;  5GAM d;  3G4S Q;  2YHT A;  1EX4 A;  5FRO A;  1VQP T;  3PE0 A;  4PFP A;  4LD6 A;  4HCB A;  2JXB A;  3ASK A;  1TS9 A;  5LJ3 j;  2MI6 A;  1TUG B;  4QVZ A;  3J7A F;  1FMW A;  4FU6 A;  3CME A;  1W2B A;  3EGD A;  5I22 A;  3MP8 A;  4M7D B;  2KXC A;  3VS1 A;  4JJC A;  2F69 A;  4M78 B;  4J7I A;  2GCX A;  1JU5 C;  3KFV A;  5HK0 A;  4RTT A;  4GLK A;  3CCE Q;  1IRE B;  1T3S A;  2GF7 A;  2QQ9 A;  4A4G A;  4XTU A;  2JTF A;  3C0C A;  2HAX A;  2QG9 B;  3FJP A;  2CP3 A;  1KQ2 A;  4XU1 A;  3G6E T;  1VQ8 A;  2EPD A;  4ZNX A;  2LCS A;  4RTX A;  5GAO q;  3GF5 A;  2DE0 X;  4VUB A;  2DBM A;  3OYK A;  2Y4X A;  5FU6 B;  2QA4 Q;  1QWF A;  2PUK B;  1VQ4 A;  2EYY A;  5LJ5 d;  2PZ1 A;  5KE3 A;  1M1K U;  4XU2 A;  2R57 A;  1NZ9 A;  2JT4 A;  2IPO B;  1VQ6 T;  3I9Q A;  1YIT Q;  4M7D A;  2PUO B;  1E7O A;  4M78 A;  3CMA A;  2HZY A;  4F04 B;  5GAN 6;  5DLQ E;  1X27 A;  2Y90 A;  4AFQ C;  3VS6 A;  2O4X B;  1SHG A;  3CCS T;  1X2K A;  3LWI A;  1BCO A;  3CCQ Q;  2DK3 A;  2HDA A;  3C12 A;  2KAF A;  2RA2 A;  2HQH A;  1ABQ A;  2ZPE B;  2FVU A;  2VXE A;  4FSX A;  3GOX A;  4QT7 A;  1M3B A;  5I2M A;  2DXT A;  5KYX B;  1SSH A;  2DLP A;  3WVD B;  4KUI A;  2L0A A;  5HK3 A;  3OW2 A;  1VYT A;  3H6Z A;  1ZUY A;  1KJW A;  3HFN A;  2MWO A;  2EGA A;  4EDU A; 
#chains in the Genus database with same CATH homology
 5GAM f;  2RI3 A;  3CCM T;  2XU8 A;  1Q86 C;  3GP8 A;  3CC2 T;  2V8I A;  4LDV A;  4BY6 B;  4O5V A;  2MF2 A;  4JS4 A;  2X4Y A;  1ZHI A;  3EAE A;  3EFR A;  4MML A;  2E12 A;  2XKO C;  4C92 D;  3I55 T;  4MZT A;  2XDB A;  4IKF A;  3QXE B;  4C0D C;  4OGC A;  1BI1 A;  4BAC A;  4KUD K;  2YLB A;  4M75 B;  2XIC A;  1JB0 E;  5GAM j;  1Q81 C;  5I21 A;  3CCE A;  2LQK A;  3OB9 A;  4CI0 C;  3CME T;  1I5L A;  5CKE A;  1D3B A;  1OZ3 A;  2FHD A;  1YI2 T;  4ELY C;  1Q7Y C;  1VQN T;  3HPW A;  3HL8 A;  4N0A C;  2KMT A;  2D0Q B;  2WSC E;  2E65 A;  3MCA B;  2VGM A;  4BE1 A;  3MET A;  2O4X A;  2EKO A;  5LJ5 h;  4M7A A;  3PNW C;  4ZN3 A;  2EJG A;  4PL6 A;  3JB9 F;  3OYE A;  3LLR A;  4OVA A;  1YJW T;  1OZ2 A;  1Y71 A;  4M77 F;  2RJF A;  4LDW A;  3RKW A;  3S3N A;  3ZBD A;  1N9S A;  2LC4 A;  3I56 T;  2QA4 A;  1WJR A;  4M75 D;  5LJ5 g;  1UB4 A;  3JCM P;  1O75 A;  4QQ6 A;  3LWH A;  2LVM A;  1Y7X A;  3OYH A;  1YIT T;  3V7C A;  3CCV A;  4QQD A;  4C92 A;  3TU4 K;  2OTL T;  3WVE B;  4YTL A;  1M5Q 1;  2CGH A;  5CKD A;  4QQG A;  2IVW A;  2EJ9 A;  3VKI A;  1GXI E;  3JCM e;  1WJQ A;  2PVO B;  2YLC A;  5GAN 3;  4JRK A;  1QVG A;  1VQ8 T;  1VQN A;  4FT2 A;  2QXF A;  3FLG A;  5D6X A;  4MDW A;  1I81 A;  2WAC A;  4ZGE B;  4M77 C;  5GAN 5;  3OS2 A;  1RI0 A;  2E64 A;  1YCY A;  2JNG A;  3DB3 A;  3QDR B;  1KG1 A;  1N6A A;  4M7D D;  3QYH B;  4N4I A;  4PNO A;  3L2Q A;  3X25 B;  1FX7 A;  2LNV A;  3RES A;  2ZPI B;  3MHX A;  4GY5 A;  5CQY A;  2E10 A;  3SWN B;  4ZTF A;  2DTI A;  4M7A F;  5C0M A;  4O6J A;  5FU6 C;  4B9W A;  1NJI U;  1VUB A;  4BI3 A;  1VQ4 T;  3QSU A;  5LJ5 f;  3C94 A;  1QVF A;  3CCQ A;  3TCJ A;  2BKD N;  4M75 A;  2ZGW A;  2HD0 A;  3M59 A;  2EQU A;  2QI2 A;  5CKF A;  5IAY A;  4OB0 B;  4QVD A;  4KUL A;  3SB2 A;  1QVG S;  2EAY A;  3DKM A;  4D6W A;  3CCL A;  1UGQ B;  4PLI A;  1NPP A;  4C8Q F;  1OYX A;  5KE2 A;  1N9R A;  1W4S A;  3OYI A;  2L89 A;  3MEW A;  5LJ5 j;  2RHU A;  2WSE E;  4C92 F;  5GMK l;  5GAM e;  3CMA T;  4J7F A;  1JBM A;  2KK4 A;  4PJO G;  2CZ7 B;  3ZFJ A;  5LJ3 e;  2X4X A;  3GLX A;  1VQ7 T;  3CXC A;  4OB1 B;  3CBM A;  3JAM E;  2QQR A;  4J6X A;  4PJO F;  3CC7 A;  2L3R A;  3URG A;  2CZ1 B;  1N8R C;  2VXF A;  2JVV A;  3KXT A;  1YJN A;  2D9T A;  4P5N A;  1Y96 B;  4UC4 A;  3CCU T;  5AYF A;  2EQJ A;  3X20 B;  5FU7 C;  1G3T A;  3A8L B;  1YHQ A;  5D6Y A;  1P92 A;  1I4K 1;  4BD3 A;  1BIA A;  1WPY A;  4C8Q C;  4Q5W A;  4R56 A;  3DLL A;  1KC8 C;  4HCZ A;  2ZPF B;  3GNF B;  5FRN A;  3V7R A;  2I2L A;  4IUQ A;  3HRU A;  4X9C A;  2EQM A;  2XHC A;  2DKG A;  5J39 A;  1KHC A;  1X6O A;  5GMK i;  4C92 C;  2RHY A;  3G4S A;  3G71 A;  2QEX A;  1K73 C;  4ME7 A;  3WXM B;  5FRM A;  4J8O A;  4DA4 A;  5I2S A;  3PMI A;  2RM4 A;  2XK0 A;  3MEV A;  3HFO A;  3CBP A;  3SWN A;  4PJO C;  1M90 U;  2PU9 B;  3GPL A;  4A4F A;  3OYY A;  4C0G A;  4HT9 A;  3VV0 A;  3L42 A;  3VUB A;  3OYD A;  2AHJ B;  4TVR A;  4X34 A;  3CC4 A;  4C0F A;  3N5B B;  2DAQ A;  3NTI A;  3J80 E;  1H3Z A;  2EQK A;  1V29 B;  5CKB A;  1YBY A;  4M7D F;  2X4J A;  4M78 F;  2RH2 A;  2DIQ A;  3T9N A;  1BI2 A;  2L5Q A;  3CCE T;  3ZEH A;  1ZBX A;  3JCM d;  5GAO l;  3L2U A;  2P0K A;  3CEY A;  2XI9 A;  2RO0 A;  4JS5 A;  3JSC A;  3LGF A;  4OMF B;  1S72 A;  1XNI A;  2E5Q A;  1YIJ A;  4MZM A;  1VQK A;  3MP6 A;  2DTH A;  2XID A;  1QP3 A;  5LL6 S;  2G3R A;  5LJ5 e;  3QO3 A;  1VQ9 A;  4BI4 A;  3OY9 A;  3G7Z A;  4B9X A;  3MO8 A;  5A0L A;  3OYL A;  1NE8 A;  3OW2 S;  1QVP A;  4E7H A;  1Y96 A;  2X35 A;  4M77 E;  1PSF A;  3V8K A;  2VGN A;  3A5Z B;  3PFS A;  4NL3 A;  2RJD A;  3PMT A;  2MWP A;  5GAN h;  2QA4 T;  2GFU A;  2VYT A;  4BDZ A;  3JB9 G;  2LQ8 A;  4M77 G;  1BKB A;  2F5K A;  4C5E A;  4EMK B;  4M7D C;  1BYM A;  1B34 B;  1EIF A;  3CPW A;  3CCV T;  4M78 C;  1M9S A;  4HT8 A;  4E7K A;  2DJZ A;  1SSF A;  3KBG A;  2EWN A;  2OTJ A;  4ZTJ A;  3QYG B;  3CBO A;  4FT4 A;  3VU3 C;  1VQO A;  3CD6 A;  3QJY A;  3GIB A;  2K3X A;  5IN1 A;  3QJ6 A;  2R5A A;  4NS5 A;  3BY7 A;  4PLL A;  1LOJ A;  2M1H A;  4Y28 E;  1KD1 C;  3X28 B;  4DOV A;  5A2Q E;  2MMP A;  5A0D A;  4BDY A;  3SD4 A;  2RHI A;  3QII A;  4RG2 A;  3JB9 I;  3L2Z A;  3RUX A;  5GMK j;  2K5F A;  4LD9 K;  4IUR A;  1N27 A;  4J5Y A;  3E9G A;  3LW5 E;  3UT1 A;  3CCR A;  1UEB A;  5CQX A;  2E6N A;  3CPW S;  2XDP A;  1YIT A;  3CPF A;  3A8G B;  3RMS A;  2DXU A;  2X4W A;  1Q82 U;  1XOV A;  3CCQ T;  1VQP A;  4M7A E;  2DXB A;  1WQW A;  3P8H A;  1NPR A;  3M58 A;  4JRP A;  4M7A G;  3FC3 A;  3UPU A;  1U1S A;  3CCL T;  3O8V A;  3GNG A;  4CRI A;  4F7U B;  4C5G A;  3JB9 J;  2H3J A;  4XU3 A;  4C8Q E;  2K2V A;  2JZ2 A;  2KSS A;  3DB4 A;  5L8R E;  1KQ1 A;  1XTD A;  4C8Q G;  4IUV A;  3L2W A;  4ZN1 A;  2DIG A;  4C92 E;  1U8R A;  3NTH A;  1I8F A;  2ZPG B;  3RKX A;  5CKH A;  1NJI C;  4JJN K;  1UGR B;  4J83 A;  4BE0 A;  4C92 G;  1WJS A;  4XTZ A;  3X24 B;  5GAN d;  4A54 A;  2Y4Y A;  2RJC A;  4FM4 B;  2QDY B;  1LJO A;  4HA8 A;  4ZGD B;  3JCM X;  1UGS B;  4EMK A;  2RI2 A;  1YJN T;  4PJO E;  1B34 A;  4A4H A;  1ZQ1 A;  1VQM A;  3JCM h;  3LGL A;  4XU0 A;  3RER A;  5GAN 4;  2LX9 A;  1O9S A;  3BW1 A;  3QZ5 B;  1YHQ T;  3SFM A;  5GAO r;  2E41 A;  5GMK m;  1YJ9 A;  3P8D A;  2P4T A;  3FB9 A;  3L1A A;  3PTA A;  3QG1 A;  1QVF S;  2PVD B;  5GAO p;  3CCJ A;  4M7A C;  2EFI A;  1VIE A;  5CVI A;  3CC7 T;  1M1K C;  2LT1 A;  2OTJ T;  4N4G A;  1K9M U;  3OMC A;  3G4S T;  2KDS A;  3G71 T;  4IUP A;  3JCM g;  2QEX T;  5DLO A;  2DD4 A;  3QPH A;  3FIF A;  2NLU A;  3HHT B;  2BUD A;  4EMG A;  5HKC A;  2RI5 A;  4R55 A;  4NL2 A;  3PT9 A;  4M75 G;  2PVG B;  1X01 A;  3G6E A;  3M57 A;  3JCM J;  2A3L A;  3S3M A;  1VIF A;  3M55 A;  1H64 1;  3VJP A;  3RIR A;  2BIV A;  1N8R U;  4V2S A;  4M75 F;  3OSS C;  1VQ5 A;  3E1S A;  2HBP A;  1G5V A;  4HKE A;  3OYB A;  4OB3 B;  3DLM A;  4XK8 E;  2IG0 A;  3X26 B;  4N0A A;  5D6W A;  1K8A U;  3CXC S;  3Q1J A;  3S3O A;  4IUT A;  1HK9 A;  5GMK e;  4MDX A;  3M5A A;  3CC4 T;  4XTV A;  1QW1 A;  3UDC A;  5GAM h;  2ZPH B;  1KC8 U;  1MGQ A;  4L59 A;  4F7U A;  2LTO A;  2CZ0 B;  2JTM A;  3A8O B;  4OF1 A;  5LJ3 h;  3OYA A;  1K73 U;  4M7D E;  4KBM B;  2GQV A;  4WF2 A;  4M78 E;  1VQL A;  3JCM f;  4BY6 C;  4LDU A;  4M7D G;  1VQ6 A;  3AHU A;  2CYZ B;  4QVC A;  1S72 T;  1M90 C;  3HSB A;  4M78 G;  2E70 A;  2WSF E;  1YIJ T;  2DXC A;  1G3W A;  3P8B B;  1VQK T;  4BE2 A;  4MMK A;  2E1H A;  3F70 A;  3HRS A;  1OI1 A;  3OBW A;  3C95 A;  1VQ9 T;  4M75 C;  3TEE A;  5FU7 B;  1R8O B;  5IT9 E;  3JB9 H;  4JUV A;  3KUF A;  2VC8 A;  4C8Q B;  1AHJ B;  2ZCF B;  4J6W A;  3OYN A;  3OBY A;  2R5M A;  2LRQ A;  3L2V A;  4XTY A;  2LCL A;  4RMO A;  3E19 A;  3CCS A;  2K4Y A;  2KQW A;  4IUU A;  3V8J A;  5GAO m;  3OSV A;  2QQS A;  4M77 A;  5KCO A;  1U1T A;  4FIB A;  4XQ3 A;  3OS0 A;  2DEQ A;  1Q86 U;  4ATO A;  2PQW A;  2JUF A;  2LDM A;  2C06 A;  1G3Y A;  3FEO A;  1VQO T;  3M54 A;  3CD6 T;  2MAM A;  4PJO B;  2QQA A;  3HRT A;  4F7U F;  3M4G A;  2K5L A;  3VUZ A;  4NOY A;  4C8Q D;  4JDS A;  3A8H B;  3V7S A;  3FDR A;  4FL6 A;  1M4Z A;  2HQE A;  1Q81 U;  3OS1 A;  1M8V A;  4C5I A;  5LJ3 f;  1M1F A;  5CK9 A;  3SDZ A;  1Q7Y U;  4L5G A;  5GAN g;  2M16 A;  2K3Y A;  5CR2 A;  3FRN A;  3CCR T;  4LDX A;  3BDU A;  2JOY A;  4A53 A;  2DO3 A;  5GAN 2;  2QQB A;  4RCB A;  5GAM d;  1TH7 A;  3LH0 A;  5C6S A;  3CCM A;  3PIP A;  4JLG A;  2CS7 A;  2YHT A;  3JCM c;  3CC2 A;  5FRO A;  1VQP T;  1RL2 A;  4PJO D;  2RHX A;  4LD6 A;  2D6F A;  1MHN A;  5LJ3 d;  4HCB A;  3ASK A;  5LJ3 j;  2MI6 A;  4C0D B;  3OYF A;  4OP0 A;  4QVZ A;  3I55 A;  4E7I A;  3J7A F;  4BI8 B;  4XTX A;  4FU6 A;  4E7L A;  4A4K A;  3SWN C;  3UWN A;  2XDD A;  2ZPB B;  1M1G A;  3MP1 A;  4Y91 A;  3RMQ A;  3CME A;  3PIO A;  3OYC A;  2B8A A;  1W2B A;  2E6Z A;  1KD1 U;  2LCC A;  1YI2 A;  4LDY A;  3BDL A;  4X9D A;  2RK1 A;  3JCM W;  5DM7 R;  2DVE A;  5M9O A;  3OS5 A;  4C8Q A;  3MP8 A;  4OB2 B;  4M7D B;  1HXD A;  2EIF A;  2OAU A;  3M56 A;  2F69 A;  4M78 B;  1Q82 C;  1BI0 A;  1JJ2 S;  1FWZ A;  5GAN f;  4JRQ A;  3E9F A;  1BIB A;  4ZGJ B;  1YJW A;  4OGE A;  3R6O A;  3M53 A;  2RJE A;  4J7I A;  2GCX A;  3ME9 A;  4L6V 5;  2M9U A;  3HKS A;  4C0Z A;  1VQM T;  5CO7 A;  5KCH A;  4ELZ C;  3OYG A;  3I56 A;  2CZ6 B;  1UGP B;  2P0P A;  2VV5 A;  2DZC A;  3OQ5 A;  4N4H A;  1YJ9 T;  5HK0 A;  4PJO A;  1W2B S;  3CCJ T;  1LNX A;  5GAN j;  4XAX B;  1WGS A;  2M0O A;  4JLI A;  5EG2 A;  4GLK A;  2OTL A;  1IRE B;  2GF7 A;  2QQ9 A;  4A4G A;  3L2R A;  4MZP A;  2JTF A;  4XTU A;  3V8L A;  3QUI A;  4Z02 A;  3JCM b;  2HQX A;  1KQS A;  4M78 D;  1BI3 A;  2DZ9 A;  2HAX A;  1FXX A;  3A8M B;  3FJP A;  1KQ2 A;  4E7J A;  3INZ A;  4XU1 A;  3G6E T;  1VQ8 A;  2RD1 A;  3C4S A;  5J26 A;  3H8Z A;  4M77 B;  4RKU E;  3JCM Q;  3OMG A;  4RG8 A;  4E47 A;  5GAO q;  3NFC A;  4C5H A;  3OYM A;  1VQ5 T;  3MEU A;  3GF5 A;  4VUB A;  3VYG A;  5GAN 8;  2EJF A;  3OYK A;  4M75 E;  2Y4X A;  4QW2 A;  5FU6 B;  2DPP B;  4XTW A;  2PUK B;  1VQ4 A;  3JCM V;  2O01 E;  3QHS A;  5LJ5 d;  4A4E A;  1IZ6 A;  1K9M C;  3MEA A;  1Y07 A;  3HP9 A;  5CAI A;  2KY9 A;  1KQS S;  1X75 C;  1XQH A;  5J3B A;  5KE3 A;  1M1K U;  1JJ2 A;  2XD0 A;  4XU2 A;  4PKC C;  2RK2 A;  2R57 A;  4KT0 E;  2RB6 A;  3JRZ A;  5CCA A;  1NZ9 A;  5DY9 A;  1WQ7 A;  2V8K A;  4JRI A;  2FYK A;  3JB9 D;  2VUB A;  2XG8 D;  3BFM A;  5GAN 7;  1VQL T;  4HCC A;  1VQ6 T;  4M77 D;  3LYI A;  4M7D A;  2PUO B;  3LX7 A;  3QZ9 B;  2ZZD A;  4M78 A;  1JRI A;  2F5T X;  5CIU A;  1D3B B;  5GAN 6;  5DLQ E;  3CMA A;  1K8A C;  4II1 A;  4EPC A;  2L8D A;  2K5I A;  2Y90 A;  3QKJ A;  2DTO A;  2O4X B;  2EYQ A;  4M7A B;  3NTK A;  1VQ7 A;  1PSE A;  5GAM g;  2RHZ A;  2DD5 A;  5FLX E;  1G3S A;  2A7Y A;  3CCS T;  3EFS A;  3OA6 A;  3LWI A;  5KH6 A;  5LJ3 g;  1WNL A;  2DK3 A;  3S6W A;  3CCU A;  3C12 A;  2KAF A;  2RA2 A;  3RKY A;  1QP2 A;  2ZPE B;  2V8J A;  2QTX A;  2FVU A;  2VXE A;  2FB7 A;  4FSX A;  2GFA A;  2K57 A;  1DJ7 B;  3J81 E;  2FL7 A;  3GOX A;  5I2M A;  4DOW A;  2DXT A;  4C92 B;  2JN0 A;  4BUG A;  5GAN e;  3WVD B;  5A0G A;  2R58 A;  3QBY A;  4KUI A;  2HNI A;  4EMK C;  4DQ2 A;  4J6Y A;  4EMH A;  4F7U E;  5GMK h;  3OYJ A;  4M7A D;  1KHI A;  2LT4 A;  4RCC A;  4F7U G;  3ER0 A;  3VYH B;  3PGG A;  5HK3 A;  3OW2 A;  5HY6 A;  3TRE A;  3M9Q A;  3H6Z A;  2KVQ G;  3M4Y A;  4BB7 A;  5GAO n;  2YRV A;  2CKK A;  3HFN A;  2MWO A;  4EDU A;  2P0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...