1QLYA

Nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
LKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tyrosine-protein kinase
molecule keywords TYROSINE-PROTEIN KINASE BTK
publication title Solution Structure of the Human Btk SH3 Domain Complexed with a Proline-Rich Peptide from P120Cbl
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qlyA00
2KROA 2JT4A 1GCQC 4RTTA 1NLPC 2EW3A 1K9AA 1M8MA 4AFSC 1PKSA 3THKA 2RQUA 3PVQA 3QWXX 2LQNA 3VS5A 3SEMA 2DVJA 2HEQA 1X69A 1SEMA 2E5KA 3EG3A 2VWFA 2O9VA 2D8HA 4AFZC 2CUDA 2GNCA 3REAB 2NUZA 5IHIA 1JU5C 2M51A 1N5ZA 3I5SA 2EVRA 2BZ8A 4A63B 1UGVA 2DL5A 1XOVA 5GJVB 5IHKA 2ED1A 1KJWA 4FSSA 2ROTA 2CT4A 1UE9A 1RLPC 4KRTA 4HCKA 1JXOA 3NMZC 1HSQA 2RF0A 2K79A 3M0TA 4J9FA 2FPDA 4CC3A 1AWXA 1ABOA 2PZ1A 1SHGA 1M3CA 1B07A 1RLQC 2H8HA 4CC4B 2EKHA 1BU1A 2A37A 2C0IA 1K76A 5IH2A 4OMQA 1WFWA 2XMFA 2DA9A 2K6DA 3QWYA 1BBZA 1OV3A 1UJYA 4HVUA 2BZXA 1YCSB 3EHQA 1NYGA 2RQVA 1FMKA 1WLPB 1UJ0A 1K1ZA 1UHFA 4ZNXA 1X6BA 4JPBW 1ARKA 4Y92A 2O88A 1QLYA 1VYUA 1U5SA 5EC7A 1CKAA 2O2OA 1LCKA 1MV0B 2KT8A 2AKKA 1OPLA 1UFFA 1AWOA 1S1NA 2AZSA 4Z8AA 4DEYA 1QWEA 2LP5A 3NGPA 2FG0A 2FRYA 4JJCA 4HVWA 4AFUC 1E6HA 2EGAA 3H0FA 3VS4A 2A36A 2DL8A 1TUDA 3EG2A 1WX6A 2J7IA 2KRMA 4GLMA 3VS6A 3ZL7C 2F2VA 2RQWA 2M0YA 1OEBA 2W0ZA 2KBTA 1SPKA 1CSKA 3JV3A 1VA7A 2CSIA 1AVZC 5I11A 1T0JA 2YDLA 2CUBA 3UA7A 2AKLA 2D1XA 1RI9A 3H41A 3SHWA 2GGRA 1W6XA 2HBWA 1T3SA 1ZUYA 1NEGA 2DLPA 1X2KA 5L23A 3A98A 2J05A 3EGUA 1H8KA 2DNUA 1EFNA 1J3TA 4J9BA 2KRSA 1WYXA 1UHCA 2OJ2A 2C0TA 2YT6A 2B86A 2L3SA 1PKTA 4CC7A 2A28A 2YSQA 1PNJA 1U3OA 1GRIA 4AG2C 4Z89A 1KIKA 4GBQA 2KYMA 1YWOA 4LUEA 1UG1A 2GTOA 3CQTA 3VRZA 2ABLA 1GCPA 4RTWA 1V1CA 4RTYA 4LNPA 1WIEA 4J9EA 1ZUUA 3H0IA 2LZ6B 5FWBA 1T0HA 2KXDA 1IO6A 1X2QA 2O31A 4AG1C 2EYYA 2OAWA 1VYTA 1G83A 2K3BA 2DM1A 2RPNA 2DRKA 1H3HA 2A08A 2HSPA 2BTTA 1PRLC 3NPFA 5ECAA 1ZLMA 2JM9A 1H92A 1I07A 1NEBA 4IIOA 4JJBA 1YN8A 4X1VA 1Y0MA 2KXCA 1X43A 5IHNA 2JS0A 1ZUKA 1GFCA 3REBB 4K11A 2L3PA 2DYBA 3I9QA 2L2PA 3VS7A 1BK2A 5HCKA 2DJQA 2JW4A 2KYBA 2MIOA 2L3QA 4RTVA 4F14A 2KEAA 2BZYA 4Z88A 1JO8A 2KNBB 3UF4A 1RUWA 1SRMA 4J9IA 1UDLA 2JM8A 3EHRA 1M27C 1WXTA 1NG2A 1ZSGA 3M0PA 3GBQA 4HXJA 2LCSA 2DL3A 2OI3A 4AFQC 1WXBA 2EYZA 1JXMA 1SHFA 2G6FX 2X3XD 3KFVA 1YP5A 1AWWA 1NM7A 3O5ZA 4LE9A 5FWCA 3TVTA 2K2MA 5IXFA 4RTZA 1YWPA 1I0CA 2LJ3A 3U23A 2DF6A 2ECZA 1HD3A 1SRLA 2CH4A 3LH5A 4DEXA 3R6NA 1OOTA 2EYWA 2I0NA 2QDLA 1QKWA 1BB9A 3EG0A 1PRMC 2ED0A 4J9DA 1M3AA 2EPDA 4LUDA 3VS2A 2D8JA 3M0UA 5FW9A 3C0CA 2P4RA 2VVKA 4IIMA 3VS0A 2DL4A 1AZGB 2CREA 2DRMA 5I22A 2ROLA 1K4US 4RUGA 2J6OA 2DMOA 2LJ1A 4OMMA 2VKNA 2D0NA 2F2WA 2DE0X 2PTKA 4OMLA 1MUZA 1CKBA 2CT3A 3M0SA 1WI7A 1W70A 2CSQA 4JZ4A 4LN2A 3RNJA 2DILA 2J06A 2K7AA 1U06A 4D8KA 1GBRA 3M0RA 2DX1A 1HJDA 1UECA 2KE9A 1AD5A 2YUNA 2CH4W 2YUQA 1JQQA 2AZVA 1AZEA 2O9SA 3ULRB 2YUPA 1GL5A 1Z9QA 1ZBJA 2V1RA 1OPKA 2LQWA 2LMJA 1X27A 4ORZA 2EYXA 4QT7A 4ESRA 4RTUA 2DBMA 1I1JA 1MV3A 2V1QA 2SEMA 2FRWA 1K0SA 2EGCA 2X3WD 3FJ5A 4OMOA 3VRYA 4D8DA 2KT1A 2FPFA 4E6RA 2GBQA 2HDAA 3H0HA 2C0OA 3VS3A 4JZ3A 1VYVA 2ENMA 2KR3A 1TG0A 1QWFA 4F17A 3I5RA 1JEGA 2L0AA 1GCQA 2RNAA 2FEIA 1UUEA 1Z9ZA 1KFZA 1KSWA 2YUOA 4JJDA 2LX7A 2SRCA 2DL7A 2F2XA 2FPEA 2K9GA 2MOXA 4J9HA 2EBPA 1YNZA 2NWMA 1NLOC 2J6KA 3PE0A 1WA7A 2RN8A 2LNHB 1AEYA 2HCKA 1AWJA 2RMOA 2GTJA 1ZX6A 4OMPA 3M0QA 1AOJA 1M30A 1PWTA 2PNIA 1A0NB 4F16A 1TUCA 4CC2A 1FYNA 1NYFA 1QCFA 3TSZA 1W1FA 1WXUA 2DBKA 3RBBB 2JXBA 5GJWB 4M4ZA 2J6FA 3VS1A 2IIMA 1Y57A 3I35A 3IQLA 1GFDA 1UTIA 2EQIA 1K0XA 1X6GA 4J9CA 2LJ0A 2RQRA 4EIKA 3EG1A 4J9GA 2FO0A 2JMCA 4R0KA 1GBQA 2GQIA 1ABQA 2EGEA 2JS2A 1E7OA 1PHTA 4WCIA 3UATA 4HVVA 3TSWA 2KRNA 1G2BA 3NHNA 5IXBA 2AK5A 2JMAA 1T3LA 1E6GA 1SSHA 1M3BA 2CDTA 4RTXA 3PVLA 2JTEA 2W10A 2KGTA 4OMNA 1B3QA 3UA6A 1WDXA 1QKXA 2MCNA 2ESWA 2RQTA
chains in the Genus database with same CATH superfamily
3FIFA 4MDXA 3NTIA 2JT4A 3H8ZA 1WHGA 2XDDA 2DK3A 4EMKB 2HKNA 1Y96B 1NLPC 1KQSS 4IUVA 1HK9A 4KUDK 1K9AA 3QDFA 4XQ3A 5CKHA 3OW2P 1PKSA 3THKA 2KK4A 4FW2A 3CCRA 3PVQA 3QWXX 4A4EA 4F7UB 1VQPA 1VOMA 3HFOA 4FYXB 1X69A 1BCOA 2DD5A 4C8QE 3REAB 2NUZA 2M51A 4PNOA 1N5ZA 3A5ZB 3QBYA 2DL5A 1XOVA 3JCMf 3CCRQ 3X25B 5KH6A 4N0AC 1VQPQ 1TH7A 1W2BA 1IZ6A 2RH2A 1V76A 2QAZA 4V2SA 1VQOA 1LPLA 3QUIA 5C6SA 1NE8A 4F7UA 2RF0A 2K79A 3M0TA 2FPDA 4ZTFA 2YRCA 1ABOA 2VXEA 4M7AD 2A37A 3RKXA 2C0IA 3TREA 4P5NA 5IH2A 4OMQA 2HMAA 2DXTA 3DLLA 1UGRB 2XMFA 1VQ4T 1VQOQ 3RERA 1BI1A 3QWYA 3WXMB 2P0QA 1VQ8T 1YBYA 4M75D 3CPWS 1UJYA 2ZGWA 3EHQA 3P8BB 3CC4T 1W2BP 4LD9K 3G7ZA 1TOVA 1QVGS 3RDVA 1I4K1 1IGQA 2GFAA 1X6BA 4EMGA 5CIUA 1X01A 2ZPEB 1TS9A 1Y7XA 2E12A 1CKAA 3MPUB 1Q82R 1MV0B 3OYGA 4F7UG 2VV5A 2AZSA 1R8OB 2ZZDA 4C92A 4BI4A 2FG0A 1N8RC 2EQMA 3NTKA 2C06A 1YJNT 1TUDA 1WX6A 2J7IA 2X4JA 3META 2KRMA 4GLMA 3VS6A 3JCMX 3CC2A 4IURA 2M0YA 4PFZA 1OEBA 3EFRA 1YIJT 1CSKA 4ANJA 3CXCP 1T0JA 1RAFB 2CUBA 5GAOm 1NJIC 2D1XA 3H41A 1PC0A 4WTOB 2KSSA 1W6XA 2HBWA 2L89A 2DLPA 3C12A 1K73R 1QVPA 2E6ZA 3CCUT 4PJOF 3CC2Q 4C0FA 4CRIA 1J3TA 3HHTB 1WYXA 3QHSA 5GAN4 5CO7A 4FL6A 3LWHA 4M7DD 3OS2A 1U3OA 4C92G 3M57A 2XDBA 1GRIA 3C94A 2KY9A 5KE3A 1YWOA 1UG1A 1R0CB 1JBMA 2E3HA 4RTYA 3EH2A 4PK4A 2GCXA 4J9EA 2PVDB 1ZUUA 4QKUA 3EGXB 1WHKA 4HCCA 4XU1A 4M7AC 1T0HA 3CCVT 1G83A 5GAOr 1K8AR 2E64A 1EX4A 5ECAA 1PRLC 3KXTA 1VQLT 4M75C 4IIOA 2FB7A 4X1VA 3QKJA 3AT1B 2HQXA 3MEWA 2JS0A 3REBB 4JJNK 4K11A 3PT9A 1QW1A 5HCKA 2DZCA 5C0MA 2MAMA 2KYBA 2L3QA 2GF7A 2IPOB 3EGXA 4M78E 2KEAA 2BZYA 3OYDA 1I5LA 1RUWA 3OS5A 2H3EB 2JM8A 3EHRA 5LJ5e 1WXTA 3GBQA 2O01E 3MCAB 1SHFA 2G6FX 3NTHA 4JUVA 5FWCA 4Z02A 5IXFA 4X34A 3OS0A 4A54A 1RI0A 2LJ3A 3U23A 1PSFA 4Y28E 5HK0A 2JNGA 1UEBA 2IG0A 2DF6A 2ECZA 1HD3A 1SRLA 3LH5A 1VQ4A 3JCMP 4EMKC 3WVDB 1VQ8A 1BKBA 1D3BB 2QDLA 3EG0A 3EFOB 1M90U 3V8LA 5CQXA 2DPPB 1M3AA 3CC4A 5GMKi 5FW9A 2F1LA 2VVKA 3VS0A 1O75A 3I56T 2DRMA 1K4US 4RUGA 1UGSB 3D7SB 2LJ1A 1VQ4Q 2VKNA 1WHMA 3JCMJ 1VQ8Q 4M7DC 2OTJT 2PTKA 1MUZA 4PJLA 1R0BG 5GMKj 1WI7A 5GANe 1PM3A 4BUGA 4LN2A 3OYBA 1TUGB 3T9NA 4E7JA 2DILA 3CC4Q 2V8IA 1U06A 4D8KA 4PFPA 3M0RA 2RHZA 1M1FA 2DX1A 2KE9A 1AD5A 2P0PA 1PD0A 2YUQA 1RABB 1D3BA 2D9TA 1YJNA 3FEOA 3EFOA 2O9SA 4QVDA 2X4XA 1QMCA 1KHCA 2CZ1B 3OB9A 4ESRA 4NL3A 4RTUA 1MV3A 2FRWA 2EGCA 3FJ5A 3HPWA 1AHJB 1LVKA 4D8DA 3S3MA 2KT1A 1YJNQ 3OYNA 4E6RA 2GBQA 1WQ7A 4PL6A 5GANg 3CCUA 1IREB 2DTIA 2C0OA 1I8FA 2YRVA 2COZA 2ENMA 1X75C 6AT1B 3M55A 1VQMT 4FYYB 4XTUA 3L1AA 2YUOA 5KYYB 1BI3A 1EZZB 2K9GA 2SRCA 3SWNC 5I21A 3CCUQ 2EBPA 3VJPA 3M4YA 3JSCA 4ZN3A 3QYGB 2LNHB 4QW2A 1M2OA 4OMPA 1PWTA 3BDLA 2PNIA 3MJXA 3QJYA 4FYVB 4PJOE 5LJ3f 1TUCA 3CCVA 1OZ2A 1WXUA 5LJ5h 2DBKA 3RBBB 2JXBA 5GANf 4M4ZA 2IIMA 5CKDA 1WQWA 4N0AA 4C92F 1X6GA 2L3RA 1VQLA 2LJ0A 1BI0A 5KYYA 3V8KA 3LGFA 2F5KA 1K9MU 2LCLA 1VQ5T 3CCVQ 4J9GA 2FO0A 2XU8A 1JB0E 1GBQA 2V26A 5I2MA 3CBOA 2EGEA 2A0FB 1D09B 2YRDA 1FWZA 4HVVA 3RKWA 4HA8A 5IXBA 4JS4A 1VQLQ 1IGUA 5A2QE 1E6GA 1SSHA 4J5YA 5CCAA 3OA6A 4ME7A 3PVLA 2JTEA 4OMNA 1KQ2A 4DOVA 3DLMA 2LRQA 2LQ8A 3CCEA 2KROA 3URGA 4LDVA 4X9CA 2E10A 5GANh 2EW3A 5GAMe 2K2VA 1JRIA 1ACMB 1M90C 3G4ST 1XQHA 3QO3A 2DYIA 2P0KA 2LQNA 4OB1B 3VS5A 2ZPBB 3AHUA 3SEMA 4MZTA 2MYSA 4LDXA 2WSEE 3OY9A 2COWA 3EG3A 2VWFA 2XKOC 3RKYA 3CCEQ 2PVOB 1YJWA 1KQ1A 2CUDA 1HXDA 7AT1B 2EVRA 2BZ8A 2RM4A 2AIRB 3I56A 2ZPFB 2ED1A 3M58A 5FLXE 4FSSA 2ROTA 2HBPA 1RLPC 2M0OA 5GAMg 1VQ7Q 1IRXA 1YJWQ 1KQSA 2DKGA 3A8MB 2H3JA 3PMIA 1AWXA 2PZ1A 1SHGA 1M3CA 2H8HA 2KDSA 4CC4B 3OYHA 3I56Q 4A53A 3WVEB 1C6VX 4M7AB 4KT0E 4KH0B 1M1KR 1ZSZC 1OZ3A 2DA9A 1QVFS 2K6DA 1BBZA 2BIVA 4BACA 1N8RU 4HVUA 4MMLA 4M75B 4HCBA 2ATCB 2CKKA 4BY6C 2HD0A 2HKQB 3JCMe 1FMKA 1UJ0A 2R57A 1UHFA 1JJ2P 3OSVA 3JCMb 5J3BA 3CCMT 2O88A 1QLYA 1VYUA 4KUIA 4M7AA 1WZOA 2DO3A 4EMHA 2JOYA 1OPLA 1UFFA 1VQMA 1AWOA 4Z8AA 2E6NA 2LP5A 2KVQG 1N6AA 2FRYA 2FVUA 4HVWA 4AFUC 5FU6B 2O4XB 3M53A 2EGAA 4EDUA 3H0FA 3VS4A 2LT1A 2DL8A 4M75A 2B8AA 2HAXA 3JCMW 4F7UE 4E7HA 3CPWA 2RQWA 2CGHA 1D1CA 1X6OA 1U8RA 3S6WA 3JCMg 1LOJA 4PJOD 2CSIA 1AVZC 3UA7A 3DKMA 2AKLA 8ATCB 1RI9A 4N4IA 1QVGA 1K9MC 1T3SA 1X2KA 1HYOA 1FX7A 2DZ9A 3P8HA 1Q86R 2O4XA 1G3WA 2CZ7B 4IUPA 5GAMh 2R5AA 3MO8A 3OYLA 4M7AG 2R58A 1VQ5A 3VKIA 1IHWA 5AT1B 1SKUB 3N5BB 3VUBA 3M59A 2A28A 4PJNA 3MEUA 3DB4A 4M7DB 1OYXA 4Z89A 4AMCA 4GBQA 2KYMA 4M75G 5CKFA 2GTOA 3L2RA 4OP0A 4XTXA 3PIOA 2MI6A 1D0XA 4EMKA 1V29B 1VQ5Q 1Y96A 1WIEA 2RHYA 1KD1R 4C92E 4J8OA 4KGZB 2NUTB 5IT9E 2LZ6B 2XHCA 2KXDA 4FW1A 1D1BA 1IO6A 2EYYA 2OAWA 2XD0A 3KBGA 2Y4YA 5J26A 4QQGA 4IUUA 4LDUA 1RACB 3RR6A 2JM9A 3G4SA 3PMTA 2DEQA 4JJBA 4M7DA 4ZGEB 1KC8R 1MGQA 2KXCA 1ZUKA 2HL3A 2L3PA 2L8DA 3OW2S 3GNGA 2JW4A 4FSXA 2NUTA 3MP8A 3J80E 3G4SQ 1YCYA 5D6WA 3JCMh 1SRMA 5J39A 1VQ9T 1M27C 5GMKm 1M1KC 3SWNB 2RK1A 1Q82U 2LCSA 2OTLT 3CCST 1WXBA 2EYZA 2X51A 2X3XD 4HCZA 1YP5A 3CCJT 1NM7A 3CC7T 4LE9A 1MMAA 3V7RA 2EJGA 1NBEB 2DVEA 2L5QA 3UT1A 2K3YA 2MPXC 4KGXB 2QTXA 2ZCFB 2CP7A 4A4KA 2YLCA 4M7DG 2QEXT 3CCQT 2CH4A 4DEXA 2WSCE 1WJQA 2HQEA 4YTLA 5CVIA 5KE2A 4L59A 2ED0A 4J9DA 3SWNA 1K73U 3M0UA 1AZGB 2CREA 3EH1A 1WGSA 5HKCA 2D6FA 5GAN8 3BE3A 2D0NA 3CCMA 2ZPHB 3QIIA 4OMLA 2CT3A 1W2BS 1W70A 2CSQA 4JZ4A 5HK3A 3KUFA 4JRIA 4DBRA 1GBRA 2ZAEA 4J6YA 3HP9A 1YJ9T 2PU9B 3LGLA 1JQQA 2AZVA 2DXCA 3LX7A 2YUPA 4M77D 1FMWA 4DBQA 3CCMQ 1G5VA 1Z9QA 1VIFA 5CKEA 2LNVA 1X27A 1VUBA 2CS7A 3OYJA 4BB7A 2X3WD 1K0SA 4E7SA 1K8AU 3MP1A 3VRYA 2FYKA 1UGPB 1M2VB 2K5IA 2RJCA 3CXCS 3H0HA 2CZ0B 4XU2A 3VS3A 2WSFE 3FJPA 3M56A 1VYVA 3CBMA 2HNIA 3LLRA 3OYFA 2OAUA 4DBFA 2JTFA 2MK5A 3L2ZA 3UWNA 1QWFA 2QA4T 2XG8D 1JEGA 1TSFA 4C8QD 3TEEA 1VQ6T 2JVVA 2DXUA 2DL7A 2MOXA 3CMAT 4IUTA 4PLLA 3JB9G 2LT4A 2J6KA 1WA7A 2RN8A 4C92D 3S3NA 1KG1A 3FDRA 5FU6C 2EQKA 4CC2A 4M7AF 4FYWB 2E3IA 1QCFA 2K3XA 1W1FA 1ZSZB 3GNFB 3TSZA 2LQKA 2M9UA 3V8JA 5GJWB 2J6FA 4QQ6A 4ELYC 1Y57A 1UTIA 3CMET 4BY6B 3X24B 4M75F 2CP2A 3PTAA 3P8DA 3FC3A 4R56A 4EIKA 3SD4A 4OF1A 4RKUE 3EG1A 2JMCA 2GQIA 1IB8A 1Q82C 1M5Q1 5GAN5 5FROA 2KRNA 3C4SA 4DQ2A 1ZSZA 2JMAA 1T3LA 3JCMc 1AT1B 5LJ3e 1VQ9A 3TQ7P 4PLIA 2FZCB 4VUBA 2MWOA 2DAQA 2KGTA 5LJ5d 3UA6A 2QQBA 4PJMA 1Q95G 3CCSA 2OTLA 4NL2A 2ESWA 2BUDA 2RQTA 3CCJA 4M77C 4BDZA 5FU7C 1GCQC 3MKDA 1EIFA 2A7YA 1H3ZA 3GF5A 1M8MA 1NPRA 2RQUA 2JN0A 3GPLA 3JRZA 1VQ9Q 1K73C 3QG1A 2QEXA 5D7UA 2DVJA 3CCQA 2HEQA 4UC4A 1YIJA 4C5IA 2OTLQ 3CCSQ 4C0GA 2YHTA 1OI1A 1SEMA 3ME9A 3CCJQ 4RCBA 4AFZC 2GNCA 5LJ3g 5IHIA 1JU5C 4F7UF 3MEVA 4XU0A 2DTHA 2QQ9A 1RAGB 5GJVB 1PG5B 2E41A 2RD1A 2QEXQ 1KJWA 4KH1B 3CCQQ 1YIJQ 1NPPA 1RAHB 4GLKA 1KK7A 4C8QC 2EFIA 1UE9A 2VXFA 4KRTA 4M7DF 4LDWA 3G71T 4E7IA 1IXDA 3NMZC 5CAIA 4XTVA 1VQKT 2XI9A 1YJ9A 4BE1A 2LVMA 1B07A 1RLQC 2VGMA 1K8AC 2R5MA 1K76A 1WFWA 3A1PA 1YI2T 2RA2A 2FHDA 1OV3A 3ZFJA 2E70A 2F5TX 1YCSB 1YJ9Q 1NYGA 2E1HA 1RADB 4R55A 1WLPB 4J83A 2BE9B 4FT4A 3OYCA 4C5GA 1Q7YR 2X4WA 4B6MA 1Q81R 2JUFA 1U5SA 1LCKA 2QA4A 2DXBA 1Y71A 1VQ6A 1QWEA 4M78D 4JJCA 5DLOA 1N9SA 2EIFA 3CMAA 2PUKB 5A0DA 2A36A 2XIDA 1QVFA 3EG2A 4A4FA 3ZL7C 2F2VA 2W0ZA 3JV3A 2DD4A 3CCLT 4XTZA 2QA4Q 4PJOB 2YDLA 5I2SA 3SHWA 1VQ6Q 5LJ3h 3ER0A 4E7LA 1ZUYA 3CMAQ 2QASA 1NEGA 4BI3A 4C5HA 3A98A 2J05A 3L42A 1H8KA 3CMEA 3JB9F 2VC8A 3QJ6A 5KYUB 3HTRA 2KRSA 3S3OA 3EGDB 2OJ2A 1OX8A 3QSUA 2C0TA 2YT6A 4FIBA 3A8GB 4JDSA 3L2UA 4CC7A 1QCOA 1U1SA 2YSQA 3TU4K 1I5OB 1PNJA 2DTOA 2LCCA 4AG2C 4JS5A 1KIKA 5LJ5j 2QYZA 4LUEA 4M7AE 3CMEQ 1B7TA 3CQTA 1B34B 4RTWA 1GCPA 4Y91A 1V1CA 1BYMA 3HFNA 2OTJA 3H0IA 5FWBA 1PD1A 4M75E 2O31A 1G3TA 2EKOA 4AG1C 1S72T 2KMTA 5KYUA 3Q1JA 2M02A 2DM1A 2RPNA 3EGDA 4ZN1A 1KHIA 4MZMA 3CD6T 5IAYA 1M1KU 5GAMd 1WHHA 4B9XA 1Y07A 1NEBA 2X4YA 3C95A 4OB3B 5CKBA 1G3YA 4J6WA 2OTJQ 1Y0MA 4HKEA 1G8XA 4XU3A 5IHNA 1GFCA 4MMKA 3F70A 1B34A 2XDPA 3I9QA 3VS7A 2DJQA 2QI2A 2MIOA 3GIBA 2OX7A 4ZGDB 1YHQT 2DERA 2COYA 3A8HB 4XAXB 5GANj 2KNBB 4J9IA 1KQSP 2ZPIB 1NG2A 5FRMA 3BDUA 4HXJA 4M78C 2DL3A 3G71A 2OI3A 4AFQC 1VQKA 3KFVA 3QPHA 4L6V5 3O5ZA 5CQYA 2K2MA 2EAYA 4PFOA 3OYYA 4FM4B 1YWPA 2D0QB 1R77A 1MMGA 1QP3A 3LW5E 5A0LA 4O5VA 3HSBA 1YI2A 1I81A 3OW2A 1NJIR 5D6YA 1Q81C 3G71Q 2E5QA 3J7AF 1OOTA 2EYWA 1VQMQ 3RMSA 2FZKB 2V8KA 4JLGA 3VV0A 4LUDA 3VS2A 4M7DE 2D8JA 4RMOA 3JCMd 3E9FA 2KAFA 3C0CA 4DBHA 1C0MA 3ZBDA 2QG9B 1Q86U 9ATCB 4N4HA 2ROLA 3QXEB 1YI2Q 2VB6A 2J6OA 2DMOA 4OMMA 2F2WA 4ELZC 2DE0X 1CKBA 5KYWB 3RNJA 1IHVA 2J06A 1ZQ1A 5DLQE 2CP5A 4C0DB 1JJ2S 2YUNA 1W4SA 1TU0B 1TTHB 3CPWP 4KULA 1AZEA 2XK0A 4BE2A 1GL5A 5KCOA 2BKDN 4M77B 3H9NA 1KD1U 1ZBJA 5FU7B 3BW1A 2V1RA 3OBYA 4A4HA 1OPKA 2LQWA 2LMJA 3CCLA 4QT7A 1QVGP 3H6ZA 2V1QA 2HQHA 3CBPA 3UPUA 4F04B 1U1TA 2FPFA 2F69A 2FL7A 5KYWA 1RAEB 2LC4A 4IUQA 3OMGA 2MF2A 2HDAA 4A4GA 1YITT 2CP3A 2I2LA 1KC8U 5GAN2 5GAN7 4JZ3A 3CCLQ 2EQUA 3E2UA 2KR3A 2DIGA 2LTOA 4XK8E 1TG0A 4ATOA 3SFMA 3OBWA 3PGGA 2RI3A 4M77A 2CZ6B 2RJEA 2QK0A 1GCQA 2L0AA 2RNAA 1WHLA 2WACA 4WF2A 4XTWA 1Z9ZA 4C8QB 1KSWA 5GMKe 4JJDA 2FPEA 2F2XA 2HZYA 3OSSC 1WJRA 1NLOC 3TCJA 2X9HA 3PE0A 1RL2A 1QQJA 5A0GA 1AEYA 3M4GA 1O9SA 1AWJA 2RMOA 5FRNA 1XNIA 1ZX6A 2DIQA 4C92B 1AOJA 1M30A 1WHJA 1SF9A 1A0NB 5GAMj 3SB2A 1FYNA 1NYFA 3CXCA 1S72A 3O8VA 5GAN3 2QTVA 3CPFA 2CP0A 3I55T 3I35A 3CD6A 4OGEA 1UB4A 3IQLA 1GFDA 4PJOC 1LJOA 4J9CA 4X9DA 4C8QA 3EG9B 3OYIA 2P4TA 4II1A 2VUBA 1S72Q 4EPCA 4M77G 1XJWB 5GMKl 1FXXA 1PHTA 3A8OB 3CD6Q 3RMQA 3NHNA 1YHQA 2MMPA 5GAOp 1M3BA 2CDTA 3E1SA 3QDRB 4LXCA 1MMDA 1MMNA 3EG9A 2MCNA 3OYKA 1OX9A 4E47A 1M1GA 1UGQB 3NFCA 4RTTA 3L2QA 1YHQQ 3X28B 2EYQA 5GAOl 3J81E 4AFSC 1P92A 4C8QG 1WPYA 4E7KA 1TWBA 5GAN6 3SDZA 1Q86C 3HKSA 2E5KA 2QGGA 3FRNA 2O9VA 2D8HA 2GQVA 2K57A 4ZTJA 2P84A 3G1JA 3I5SA 4PJJA 1ZBXA 4BDYA 4A63B 1UGVA 2EWNA 2YWWA 1LNXA 5IHKA 3BFMA 3OQ5A 4DA4A 3R6OA 2LX9A 1WNLA 2CT4A 2Y4XA 4LDYA 3LYIA 4HCKA 2G3RA 1JXOA 2YLBA 2HSEB 1OU9A 1KD1C 1HSQA 4KBMB 3INZA 4J9FA 4CC3A 1FMVA 5KYNA 5DY9A 2X35A 2EKHA 2LDMA 1BU1A 1M9SA 3L2WA 3EFSA 1M4ZA 3M54A 5GMKh 4OVAA 1M2VA 1NZ9A 1KC8C 4GY5A 2BZXA 3JB9J 2K4YA 2QGFB 3OYMA 4MZPA 4JRKA 2RQVA 3A8LB 3DB3A 3OYAA 1K1ZA 1YITA 2VYTA 4ZNXA 3MEAA 1VQNT 4JPBW 2RI5A 1ARKA 1PSEA 4Y92A 1ZHIA 1WJSA 5EC7A 2O2OA 2RHIA 2DJZA 2KT8A 2AKKA 3JCMQ 3QZ9B 1S1NA 3JB9I 3CCET 4DEYA 3L2VA 3NGPA 3RIRA 4QVZA 1E6HA 4M78B 1YITQ 5LL6S 2VASA 5IN1A 2EJ9A 4MDWA 3HRUA 4C0ZA 2CYZB 2KBTA 1SPKA 4C0DC 1VA7A 5I11A 3JB9D 3GOXA 2FZGB 5KYXB 4Q5WA 1VQ7T 1YJWT 2GGRA 4LD6A 5HY6A 2QQRA 2HL5C 3RESA 5LJ5g 3CC7A 1M90R 3I55A 5CK9A 2E4HA 1ZA2B 2IVWA 3PFSA 5L23A 1OU8A 4RCCA 5CR2A 3EGUA 2RB6A 2DNUA 1EFNA 1D0YA 3JAME 3M5AA 4M78A 4J9BA 1UHCA 2PUOB 4TVRA 1GXIE 2B86A 2L3SA 1PKTA 5DM7R 3GLXA 3HL8A 3CC7Q 3I55Q 4JRPA 1OQKA 3G6ET 2GFUA 1RAIB 5KYXA 4HT9A 2QXFA 3VRZA 3JB9H 2ABLA 3FLGA 3VYHB 4LNPA 5LJ3d 1C1AA 3E19A 2DETA 4PKCC 5LJ5f 4BD3A 5GANd 3FB9A 1X2QA 3M9QA 4OMFB 1VYTA 2K3BA 4M77F 4IKFA 4OB2B 2DRKA 2JTMA 2XICA 3MP6A 2A08A 4C92C 1H3HA 2HSPA 2BTTA 3NPFA 1ZLMA 4N4GA 1QCNA 1H92A 4J6XA 1I07A 1YN8A 1DJ7B 4M78G 1X43A 2EJFA 1TXQA 3PNWC 2BE7D 2DYBA 2RO0A 2L2PA 3LH0A 5AYFA 1BK2A 2RJFA 1MNDA 3PIPA 2M1HA 4RTVA 4F14A 3UDCA 1BIAA 1H641 1Q7YU 4Z88A 1Q81U 2QQAA 1JO8A 3UF4A 1UDLA 3QYHB 4C8QF 1ZSGA 3M0PA 1N27A 1YFNA 4HT8A 1JXMA 5GAOn 2CP6A 1AWWA 3TVTA 2YXYA 4RTZA 1ZA1B 1I0CA 2QDYB 5D6XA 2EQJA 1QP2A 3CCRT 1M8VA 2VGNA 1RAAB 2Y90A 4FCYA 1VQPT 4DOWA 3VU3C 3HRTA 3R6NA 8AT1B 1K9MR 2I0NA 1VIEA 1QKWA 2M16A 1BB9A 2K5FA 1PRMC 2NLUA 2DFUA 2EPDA 2P4RA 5KCHA 4IIMA 3X20B 1XTDA 2DL4A 4JLIA 5I22A 1VQNA 1SG5A 2PVGB 3VUZA 4OB0B 3M0SA 1VQOT 2K7AA 2ZPGB 3OS1A 1QVFP 1HJDA 1UECA 2CH4W 4D6WA 4PJOA 4QQDA 3V7CA 3ASKA 4O6JA 2NUPB 1VQNQ 3ULRB 4CI0C 4ORZA 2EYXA 1F1BB 2KI7A 2DBMA 1I1JA 4QVCA 2SEMA 2QQSA 1VQ7A 4OMOA 5L8RE 4BE0A 2RK2A 3CEYA 4J7FA 3VYGA 4RG8A 5GAOq 3ZEHA 1JJ2A 2NUPA 2AT1B 3E9GA 5EG2A 1OULA 4F17A 3I5RA 2DEUA 1SSFA 4BI8B 4NOYA 2FEIA 1UUEA 1KFZA 2K5LA 3QZ5B 4L5GA 1G3SA 1BIBA 5LJ3j 2LX7A 3G6EA 4PJOG 4J9HA 4NS5A 4E7ZA 1YNZA 2NWMA 2JJ9A 4ZGJB 2Z0WA 2PQWA 2HCKA 3CC2T 2GTJA 5M9OA 3M0QA 1D0ZA 3MHXA 4F16A 3RUXA 3OYEA 1N8RR 3X26B 1N9RA 3G6EQ 2RJDA 3GP8A 3VS1A 2RHUA 2EQIA 1K0XA 4B9WA 2MWPA 2RQRA 4AT1B 1NJIU 4RG2A 5GAMf 1PCXA 4JRQA 4FT2A 3LWIA 1Q7YC 3BY7A 3EAEA 1D1AA 4OGCA 1VQKQ 4R0KA 2KQWA 2A3LA 4E2FB 1ABQA 2JS2A 1E7OA 4C5EA 2AHJB 4WCIA 4XTYA 3UATA 3TSWA 2RI2A 1G2BA 2V8JA 2E65A 3V7SA 2AK5A 4M77E 4RTXA 4J7IA 4FU6A 1MHNA 2W10A 3HRSA 3JCMV 1BI2A 1MNEA 1B3QA 3OMCA 4KGVB 4M78F 1WDXA 2RHXA 1QKXA 1BCMA 2NYSA 2JZ2A
chains in the Genus database with same CATH topology
2KROA 2JT4A 1GCQC 4RTTA 1NLPC 2EW3A 1K9AA 1M8MA 4AFSC 1PKSA 3THKA 2RQUA 3PVQA 3QWXX 2LQNA 3VS5A 3SEMA 2DVJA 2HEQA 1X69A 1SEMA 2E5KA 3EG3A 2VWFA 2O9VA 2D8HA 4AFZC 2CUDA 2GNCA 3REAB 2NUZA 5IHIA 1JU5C 2M51A 1N5ZA 3I5SA 2EVRA 2BZ8A 4A63B 1UGVA 2DL5A 1XOVA 5GJVB 5IHKA 2ED1A 1KJWA 4FSSA 2ROTA 2CT4A 1UE9A 1RLPC 4KRTA 4HCKA 1JXOA 3NMZC 1HSQA 2RF0A 2K79A 3M0TA 4J9FA 2FPDA 4CC3A 1AWXA 1ABOA 2PZ1A 1SHGA 1M3CA 1B07A 1RLQC 2H8HA 4CC4B 2EKHA 1BU1A 2A37A 2C0IA 1K76A 5IH2A 4OMQA 1WFWA 2XMFA 2DA9A 2K6DA 3QWYA 1BBZA 1OV3A 1UJYA 4HVUA 2BZXA 1YCSB 3EHQA 1NYGA 2RQVA 1FMKA 1WLPB 1UJ0A 1K1ZA 1UHFA 4ZNXA 1X6BA 4JPBW 1ARKA 4Y92A 2O88A 1QLYA 1VYUA 1U5SA 5EC7A 1CKAA 2O2OA 1LCKA 1MV0B 2KT8A 2AKKA 1OPLA 1UFFA 1AWOA 1S1NA 2AZSA 4Z8AA 4DEYA 1QWEA 2LP5A 3NGPA 2FG0A 2FRYA 4JJCA 4HVWA 4AFUC 1E6HA 2EGAA 3H0FA 3VS4A 2A36A 2DL8A 1TUDA 3EG2A 1WX6A 2J7IA 2KRMA 4GLMA 3VS6A 3ZL7C 2F2VA 2RQWA 2M0YA 1OEBA 2W0ZA 2KBTA 1SPKA 1CSKA 3JV3A 1VA7A 2CSIA 1AVZC 5I11A 1T0JA 2YDLA 2CUBA 3UA7A 2AKLA 2D1XA 1RI9A 3H41A 3SHWA 2GGRA 1W6XA 2HBWA 1T3SA 1ZUYA 1NEGA 2DLPA 1X2KA 5L23A 3A98A 2J05A 3EGUA 1H8KA 2DNUA 1EFNA 1J3TA 4J9BA 2KRSA 1WYXA 1UHCA 2OJ2A 2C0TA 2YT6A 2B86A 2L3SA 1PKTA 4CC7A 2A28A 2YSQA 1PNJA 1U3OA 1GRIA 4AG2C 4Z89A 1KIKA 4GBQA 2KYMA 1YWOA 4LUEA 1UG1A 2GTOA 3CQTA 3VRZA 2ABLA 1GCPA 4RTWA 1V1CA 4RTYA 4LNPA 1WIEA 4J9EA 1ZUUA 3H0IA 2LZ6B 5FWBA 1T0HA 2KXDA 1IO6A 1X2QA 2O31A 4AG1C 2EYYA 2OAWA 1VYTA 1G83A 2K3BA 2DM1A 2RPNA 2DRKA 1H3HA 2A08A 2HSPA 2BTTA 1PRLC 3NPFA 5ECAA 1ZLMA 2JM9A 1H92A 1I07A 1NEBA 4IIOA 4JJBA 1YN8A 4X1VA 1Y0MA 2KXCA 1X43A 5IHNA 2JS0A 1ZUKA 1GFCA 3REBB 4K11A 2L3PA 2DYBA 3I9QA 2L2PA 3VS7A 1BK2A 5HCKA 2DJQA 2JW4A 2KYBA 2MIOA 2L3QA 4RTVA 4F14A 2KEAA 2BZYA 4Z88A 1JO8A 2KNBB 3UF4A 1RUWA 1SRMA 4J9IA 1UDLA 2JM8A 3EHRA 1M27C 1WXTA 1NG2A 1ZSGA 3M0PA 3GBQA 4HXJA 2LCSA 2DL3A 2OI3A 4AFQC 1WXBA 2EYZA 1JXMA 1SHFA 2G6FX 2X3XD 3KFVA 1YP5A 1AWWA 1NM7A 3O5ZA 4LE9A 5FWCA 3TVTA 2K2MA 5IXFA 4RTZA 1YWPA 1I0CA 2LJ3A 3U23A 2DF6A 2ECZA 1HD3A 1SRLA 2CH4A 3LH5A 4DEXA 3R6NA 1OOTA 2EYWA 2I0NA 2QDLA 1QKWA 1BB9A 3EG0A 1PRMC 2ED0A 4J9DA 1M3AA 2EPDA 4LUDA 3VS2A 2D8JA 3M0UA 5FW9A 3C0CA 2P4RA 2VVKA 4IIMA 3VS0A 2DL4A 1AZGB 2CREA 2DRMA 5I22A 2ROLA 1K4US 4RUGA 2J6OA 2DMOA 2LJ1A 4OMMA 2VKNA 2D0NA 2F2WA 2DE0X 2PTKA 4OMLA 1MUZA 1CKBA 2CT3A 3M0SA 1WI7A 1W70A 2CSQA 4JZ4A 4LN2A 3RNJA 2DILA 2J06A 2K7AA 1U06A 4D8KA 1GBRA 3M0RA 2DX1A 1HJDA 1UECA 2KE9A 1AD5A 2YUNA 2CH4W 2YUQA 1JQQA 2AZVA 1AZEA 2O9SA 3ULRB 2YUPA 1GL5A 1Z9QA 1ZBJA 2V1RA 1OPKA 2LQWA 2LMJA 1X27A 4ORZA 2EYXA 4QT7A 4ESRA 4RTUA 2DBMA 1I1JA 1MV3A 2V1QA 2SEMA 2FRWA 1K0SA 2EGCA 2X3WD 3FJ5A 4OMOA 3VRYA 4D8DA 2KT1A 2FPFA 4E6RA 2GBQA 2HDAA 3H0HA 2C0OA 3VS3A 4JZ3A 1VYVA 2ENMA 2KR3A 1TG0A 1QWFA 4F17A 3I5RA 1JEGA 2L0AA 1GCQA 2RNAA 2FEIA 1UUEA 1Z9ZA 1KFZA 1KSWA 2YUOA 4JJDA 2LX7A 2SRCA 2DL7A 2F2XA 2FPEA 2K9GA 2MOXA 4J9HA 2EBPA 1YNZA 2NWMA 1NLOC 2J6KA 3PE0A 1WA7A 2RN8A 2LNHB 1AEYA 2HCKA 1AWJA 2RMOA 2GTJA 1ZX6A 4OMPA 3M0QA 1AOJA 1M30A 1PWTA 2PNIA 1A0NB 4F16A 1TUCA 4CC2A 1FYNA 1NYFA 1QCFA 3TSZA 1W1FA 1WXUA 2DBKA 3RBBB 2JXBA 5GJWB 4M4ZA 2J6FA 3VS1A 2IIMA 1Y57A 3I35A 3IQLA 1GFDA 1UTIA 2EQIA 1K0XA 1X6GA 4J9CA 2LJ0A 2RQRA 4EIKA 3EG1A 4J9GA 2FO0A 2JMCA 4R0KA 1GBQA 2GQIA 1ABQA 2EGEA 2JS2A 1E7OA 1PHTA 4WCIA 3UATA 4HVVA 3TSWA 2KRNA 1G2BA 3NHNA 5IXBA 2AK5A 2JMAA 1T3LA 1E6GA 1SSHA 1M3BA 2CDTA 4RTXA 3PVLA 2JTEA 2W10A 2KGTA 4OMNA 1B3QA 3UA6A 1WDXA 1QKXA 2MCNA 2ESWA 2RQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRO A;  2JT4 A;  1GCQ C;  4RTT A;  1NLP C;  2EW3 A;  1K9A A;  1M8M A;  4AFS C;  1PKS A;  3THK A;  2RQU A;  3PVQ A;  3QWX X;  2LQN A;  3VS5 A;  3SEM A;  2DVJ A;  2HEQ A;  1X69 A;  1SEM A;  2E5K A;  3EG3 A;  2VWF A;  2O9V A;  2D8H A;  4AFZ C;  2CUD A;  2GNC A;  3REA B;  2NUZ A;  5IHI A;  1JU5 C;  2M51 A;  1N5Z A;  3I5S A;  2EVR A;  2BZ8 A;  4A63 B;  1UGV A;  2DL5 A;  1XOV A;  5GJV B;  5IHK A;  2ED1 A;  1KJW A;  4FSS A;  2ROT A;  2CT4 A;  1UE9 A;  1RLP C;  4KRT A;  4HCK A;  1JXO A;  3NMZ C;  1HSQ A;  2RF0 A;  2K79 A;  3M0T A;  4J9F A;  2FPD A;  4CC3 A;  1AWX A;  1ABO A;  2PZ1 A;  1SHG A;  1M3C A;  1B07 A;  1RLQ C;  2H8H A;  4CC4 B;  2EKH A;  1BU1 A;  2A37 A;  2C0I A;  1K76 A;  5IH2 A;  4OMQ A;  1WFW A;  2XMF A;  2DA9 A;  2K6D A;  3QWY A;  1BBZ A;  1OV3 A;  1UJY A;  4HVU A;  2BZX A;  1YCS B;  3EHQ A;  1NYG A;  2RQV A;  1FMK A;  1WLP B;  1UJ0 A;  1K1Z A;  1UHF A;  4ZNX A;  1X6B A;  4JPB W;  1ARK A;  4Y92 A;  2O88 A;  1QLY A;  1VYU A;  1U5S A;  5EC7 A;  1CKA A;  2O2O A;  1LCK A;  1MV0 B;  2KT8 A;  2AKK A;  1OPL A;  1UFF A;  1AWO A;  1S1N A;  2AZS A;  4Z8A A;  4DEY A;  1QWE A;  2LP5 A;  3NGP A;  2FG0 A;  2FRY A;  4JJC A;  4HVW A;  4AFU C;  1E6H A;  2EGA A;  3H0F A;  3VS4 A;  2A36 A;  2DL8 A;  1TUD A;  3EG2 A;  1WX6 A;  2J7I A;  2KRM A;  4GLM A;  3VS6 A;  3ZL7 C;  2F2V A;  2RQW A;  2M0Y A;  1OEB A;  2W0Z A;  2KBT A;  1SPK A;  1CSK A;  3JV3 A;  1VA7 A;  2CSI A;  1AVZ C;  5I11 A;  1T0J A;  2YDL A;  2CUB A;  3UA7 A;  2AKL A;  2D1X A;  1RI9 A;  3H41 A;  3SHW A;  2GGR A;  1W6X A;  2HBW A;  1T3S A;  1ZUY A;  1NEG A;  2DLP A;  1X2K A;  5L23 A;  3A98 A;  2J05 A;  3EGU A;  1H8K A;  2DNU A;  1EFN A;  1J3T A;  4J9B A;  2KRS A;  1WYX A;  1UHC A;  2OJ2 A;  2C0T A;  2YT6 A;  2B86 A;  2L3S A;  1PKT A;  4CC7 A;  2A28 A;  2YSQ A;  1PNJ A;  1U3O A;  1GRI A;  4AG2 C;  4Z89 A;  1KIK A;  4GBQ A;  2KYM A;  1YWO A;  4LUE A;  1UG1 A;  2GTO A;  3CQT A;  3VRZ A;  2ABL A;  1GCP A;  4RTW A;  1V1C A;  4RTY A;  4LNP A;  1WIE A;  4J9E A;  1ZUU A;  3H0I A;  2LZ6 B;  5FWB A;  1T0H A;  2KXD A;  1IO6 A;  1X2Q A;  2O31 A;  4AG1 C;  2EYY A;  2OAW A;  1VYT A;  1G83 A;  2K3B A;  2DM1 A;  2RPN A;  2DRK A;  1H3H A;  2A08 A;  2HSP A;  2BTT A;  1PRL C;  3NPF A;  5ECA A;  1ZLM A;  2JM9 A;  1H92 A;  1I07 A;  1NEB A;  4IIO A;  4JJB A;  1YN8 A;  4X1V A;  1Y0M A;  2KXC A;  1X43 A;  5IHN A;  2JS0 A;  1ZUK A;  1GFC A;  3REB B;  4K11 A;  2L3P A;  2DYB A;  3I9Q A;  2L2P A;  3VS7 A;  1BK2 A;  5HCK A;  2DJQ A;  2JW4 A;  2KYB A;  2MIO A;  2L3Q A;  4RTV A;  4F14 A;  2KEA A;  2BZY A;  4Z88 A;  1JO8 A;  2KNB B;  3UF4 A;  1RUW A;  1SRM A;  4J9I A;  1UDL A;  2JM8 A;  3EHR A;  1M27 C;  1WXT A;  1NG2 A;  1ZSG A;  3M0P A;  3GBQ A;  4HXJ A;  2LCS A;  2DL3 A;  2OI3 A;  4AFQ C;  1WXB A;  2EYZ A;  1JXM A;  1SHF A;  2G6F X;  2X3X D;  3KFV A;  1YP5 A;  1AWW A;  1NM7 A;  3O5Z A;  4LE9 A;  5FWC A;  3TVT A;  2K2M A;  5IXF A;  4RTZ A;  1YWP A;  1I0C A;  2LJ3 A;  3U23 A;  2DF6 A;  2ECZ A;  1HD3 A;  1SRL A;  2CH4 A;  3LH5 A;  4DEX A;  3R6N A;  1OOT A;  2EYW A;  2I0N A;  2QDL A;  1QKW A;  1BB9 A;  3EG0 A;  1PRM C;  2ED0 A;  4J9D A;  1M3A A;  2EPD A;  4LUD A;  3VS2 A;  2D8J A;  3M0U A;  5FW9 A;  3C0C A;  2P4R A;  2VVK A;  4IIM A;  3VS0 A;  2DL4 A;  1AZG B;  2CRE A;  2DRM A;  5I22 A;  2ROL A;  1K4U S;  4RUG A;  2J6O A;  2DMO A;  2LJ1 A;  4OMM A;  2VKN A;  2D0N A;  2F2W A;  2DE0 X;  2PTK A;  4OML A;  1MUZ A;  1CKB A;  2CT3 A;  3M0S A;  1WI7 A;  1W70 A;  2CSQ A;  4JZ4 A;  4LN2 A;  3RNJ A;  2DIL A;  2J06 A;  2K7A A;  1U06 A;  4D8K A;  1GBR A;  3M0R A;  2DX1 A;  1HJD A;  1UEC A;  2KE9 A;  1AD5 A;  2YUN A;  2CH4 W;  2YUQ A;  1JQQ A;  2AZV A;  1AZE A;  2O9S A;  3ULR B;  2YUP A;  1GL5 A;  1Z9Q A;  1ZBJ A;  2V1R A;  1OPK A;  2LQW A;  2LMJ A;  1X27 A;  4ORZ A;  2EYX A;  4QT7 A;  4ESR A;  4RTU A;  2DBM A;  1I1J A;  1MV3 A;  2V1Q A;  2SEM A;  2FRW A;  1K0S A;  2EGC A;  2X3W D;  3FJ5 A;  4OMO A;  3VRY A;  4D8D A;  2KT1 A;  2FPF A;  4E6R A;  2GBQ A;  2HDA A;  3H0H A;  2C0O A;  3VS3 A;  4JZ3 A;  1VYV A;  2ENM A;  2KR3 A;  1TG0 A;  1QWF A;  4F17 A;  3I5R A;  1JEG A;  2L0A A;  1GCQ A;  2RNA A;  2FEI A;  1UUE A;  1Z9Z A;  1KFZ A;  1KSW A;  2YUO A;  4JJD A;  2LX7 A;  2SRC A;  2DL7 A;  2F2X A;  2FPE A;  2K9G A;  2MOX A;  4J9H A;  2EBP A;  1YNZ A;  2NWM A;  1NLO C;  2J6K A;  3PE0 A;  1WA7 A;  2RN8 A;  2LNH B;  1AEY A;  2HCK A;  1AWJ A;  2RMO A;  2GTJ A;  1ZX6 A;  4OMP A;  3M0Q A;  1AOJ A;  1M30 A;  1PWT A;  2PNI A;  1A0N B;  4F16 A;  1TUC A;  4CC2 A;  1FYN A;  1NYF A;  1QCF A;  3TSZ A;  1W1F A;  1WXU A;  2DBK A;  3RBB B;  2JXB A;  5GJW B;  4M4Z A;  2J6F A;  3VS1 A;  2IIM A;  1Y57 A;  3I35 A;  3IQL A;  1GFD A;  1UTI A;  2EQI A;  1K0X A;  1X6G A;  4J9C A;  2LJ0 A;  2RQR A;  4EIK A;  3EG1 A;  4J9G A;  2FO0 A;  2JMC A;  4R0K A;  1GBQ A;  2GQI A;  1ABQ A;  2EGE A;  2JS2 A;  1E7O A;  1PHT A;  4WCI A;  3UAT A;  4HVV A;  3TSW A;  2KRN A;  1G2B A;  3NHN A;  5IXB A;  2AK5 A;  2JMA A;  1T3L A;  1E6G A;  1SSH A;  1M3B A;  2CDT A;  4RTX A;  3PVL A;  2JTE A;  2W10 A;  2KGT A;  4OMN A;  1B3Q A;  3UA6 A;  1WDX A;  1QKX A;  2MCN A;  2ESW A;  2RQT A; 
#chains in the Genus database with same CATH topology
 3FIF A;  4MDX A;  3NTI A;  2JT4 A;  3H8Z A;  1WHG A;  2XDD A;  2DK3 A;  4EMK B;  2HKN A;  1Y96 B;  1NLP C;  1KQS S;  4IUV A;  1HK9 A;  4KUD K;  1K9A A;  3QDF A;  4XQ3 A;  5CKH A;  3OW2 P;  1PKS A;  3THK A;  2KK4 A;  4FW2 A;  3CCR A;  3PVQ A;  3QWX X;  4A4E A;  4F7U B;  1VQP A;  1VOM A;  3HFO A;  4FYX B;  1X69 A;  1BCO A;  2DD5 A;  4C8Q E;  3REA B;  2NUZ A;  2M51 A;  4PNO A;  1N5Z A;  3A5Z B;  3QBY A;  2DL5 A;  1XOV A;  3JCM f;  3CCR Q;  3X25 B;  5KH6 A;  4N0A C;  1VQP Q;  1TH7 A;  1W2B A;  1IZ6 A;  2RH2 A;  1V76 A;  2QAZ A;  4V2S A;  1VQO A;  1LPL A;  3QUI A;  5C6S A;  1NE8 A;  4F7U A;  2RF0 A;  2K79 A;  3M0T A;  2FPD A;  4ZTF A;  2YRC A;  1ABO A;  2VXE A;  4M7A D;  2A37 A;  3RKX A;  2C0I A;  3TRE A;  4P5N A;  5IH2 A;  4OMQ A;  2HMA A;  2DXT A;  3DLL A;  1UGR B;  2XMF A;  1VQ4 T;  1VQO Q;  3RER A;  1BI1 A;  3QWY A;  3WXM B;  2P0Q A;  1VQ8 T;  1YBY A;  4M75 D;  3CPW S;  1UJY A;  2ZGW A;  3EHQ A;  3P8B B;  3CC4 T;  1W2B P;  4LD9 K;  3G7Z A;  1TOV A;  1QVG S;  3RDV A;  1I4K 1;  1IGQ A;  2GFA A;  1X6B A;  4EMG A;  5CIU A;  1X01 A;  2ZPE B;  1TS9 A;  1Y7X A;  2E12 A;  1CKA A;  3MPU B;  1Q82 R;  1MV0 B;  3OYG A;  4F7U G;  2VV5 A;  2AZS A;  1R8O B;  2ZZD A;  4C92 A;  4BI4 A;  2FG0 A;  1N8R C;  2EQM A;  3NTK A;  2C06 A;  1YJN T;  1TUD A;  1WX6 A;  2J7I A;  2X4J A;  3MET A;  2KRM A;  4GLM A;  3VS6 A;  3JCM X;  3CC2 A;  4IUR A;  2M0Y A;  4PFZ A;  1OEB A;  3EFR A;  1YIJ T;  1CSK A;  4ANJ A;  3CXC P;  1T0J A;  1RAF B;  2CUB A;  5GAO m;  1NJI C;  2D1X A;  3H41 A;  1PC0 A;  4WTO B;  2KSS A;  1W6X A;  2HBW A;  2L89 A;  2DLP A;  3C12 A;  1K73 R;  1QVP A;  2E6Z A;  3CCU T;  4PJO F;  3CC2 Q;  4C0F A;  4CRI A;  1J3T A;  3HHT B;  1WYX A;  3QHS A;  5GAN 4;  5CO7 A;  4FL6 A;  3LWH A;  4M7D D;  3OS2 A;  1U3O A;  4C92 G;  3M57 A;  2XDB A;  1GRI A;  3C94 A;  2KY9 A;  5KE3 A;  1YWO A;  1UG1 A;  1R0C B;  1JBM A;  2E3H A;  4RTY A;  3EH2 A;  4PK4 A;  2GCX A;  4J9E A;  2PVD B;  1ZUU A;  4QKU A;  3EGX B;  1WHK A;  4HCC A;  4XU1 A;  4M7A C;  1T0H A;  3CCV T;  1G83 A;  5GAO r;  1K8A R;  2E64 A;  1EX4 A;  5ECA A;  1PRL C;  3KXT A;  1VQL T;  4M75 C;  4IIO A;  2FB7 A;  4X1V A;  3QKJ A;  3AT1 B;  2HQX A;  3MEW A;  2JS0 A;  3REB B;  4JJN K;  4K11 A;  3PT9 A;  1QW1 A;  5HCK A;  2DZC A;  5C0M A;  2MAM A;  2KYB A;  2L3Q A;  2GF7 A;  2IPO B;  3EGX A;  4M78 E;  2KEA A;  2BZY A;  3OYD A;  1I5L A;  1RUW A;  3OS5 A;  2H3E B;  2JM8 A;  3EHR A;  5LJ5 e;  1WXT A;  3GBQ A;  2O01 E;  3MCA B;  1SHF A;  2G6F X;  3NTH A;  4JUV A;  5FWC A;  4Z02 A;  5IXF A;  4X34 A;  3OS0 A;  4A54 A;  1RI0 A;  2LJ3 A;  3U23 A;  1PSF A;  4Y28 E;  5HK0 A;  2JNG A;  1UEB A;  2IG0 A;  2DF6 A;  2ECZ A;  1HD3 A;  1SRL A;  3LH5 A;  1VQ4 A;  3JCM P;  4EMK C;  3WVD B;  1VQ8 A;  1BKB A;  1D3B B;  2QDL A;  3EG0 A;  3EFO B;  1M90 U;  3V8L A;  5CQX A;  2DPP B;  1M3A A;  3CC4 A;  5GMK i;  5FW9 A;  2F1L A;  2VVK A;  3VS0 A;  1O75 A;  3I56 T;  2DRM A;  1K4U S;  4RUG A;  1UGS B;  3D7S B;  2LJ1 A;  1VQ4 Q;  2VKN A;  1WHM A;  3JCM J;  1VQ8 Q;  4M7D C;  2OTJ T;  2PTK A;  1MUZ A;  4PJL A;  1R0B G;  5GMK j;  1WI7 A;  5GAN e;  1PM3 A;  4BUG A;  4LN2 A;  3OYB A;  1TUG B;  3T9N A;  4E7J A;  2DIL A;  3CC4 Q;  2V8I A;  1U06 A;  4D8K A;  4PFP A;  3M0R A;  2RHZ A;  1M1F A;  2DX1 A;  2KE9 A;  1AD5 A;  2P0P A;  1PD0 A;  2YUQ A;  1RAB B;  1D3B A;  2D9T A;  1YJN A;  3FEO A;  3EFO A;  2O9S A;  4QVD A;  2X4X A;  1QMC A;  1KHC A;  2CZ1 B;  3OB9 A;  4ESR A;  4NL3 A;  4RTU A;  1MV3 A;  2FRW A;  2EGC A;  3FJ5 A;  3HPW A;  1AHJ B;  1LVK A;  4D8D A;  3S3M A;  2KT1 A;  1YJN Q;  3OYN A;  4E6R A;  2GBQ A;  1WQ7 A;  4PL6 A;  5GAN g;  3CCU A;  1IRE B;  2DTI A;  2C0O A;  1I8F A;  2YRV A;  2COZ A;  2ENM A;  1X75 C;  6AT1 B;  3M55 A;  1VQM T;  4FYY B;  4XTU A;  3L1A A;  2YUO A;  5KYY B;  1BI3 A;  1EZZ B;  2K9G A;  2SRC A;  3SWN C;  5I21 A;  3CCU Q;  2EBP A;  3VJP A;  3M4Y A;  3JSC A;  4ZN3 A;  3QYG B;  2LNH B;  4QW2 A;  1M2O A;  4OMP A;  1PWT A;  3BDL A;  2PNI A;  3MJX A;  3QJY A;  4FYV B;  4PJO E;  5LJ3 f;  1TUC A;  3CCV A;  1OZ2 A;  1WXU A;  5LJ5 h;  2DBK A;  3RBB B;  2JXB A;  5GAN f;  4M4Z A;  2IIM A;  5CKD A;  1WQW A;  4N0A A;  4C92 F;  1X6G A;  2L3R A;  1VQL A;  2LJ0 A;  1BI0 A;  5KYY A;  3V8K A;  3LGF A;  2F5K A;  1K9M U;  2LCL A;  1VQ5 T;  3CCV Q;  4J9G A;  2FO0 A;  2XU8 A;  1JB0 E;  1GBQ A;  2V26 A;  5I2M A;  3CBO A;  2EGE A;  2A0F B;  1D09 B;  2YRD A;  1FWZ A;  4HVV A;  3RKW A;  4HA8 A;  5IXB A;  4JS4 A;  1VQL Q;  1IGU A;  5A2Q E;  1E6G A;  1SSH A;  4J5Y A;  5CCA A;  3OA6 A;  4ME7 A;  3PVL A;  2JTE A;  4OMN A;  1KQ2 A;  4DOV A;  3DLM A;  2LRQ A;  2LQ8 A;  3CCE A;  2KRO A;  3URG A;  4LDV A;  4X9C A;  2E10 A;  5GAN h;  2EW3 A;  5GAM e;  2K2V A;  1JRI A;  1ACM B;  1M90 C;  3G4S T;  1XQH A;  3QO3 A;  2DYI A;  2P0K A;  2LQN A;  4OB1 B;  3VS5 A;  2ZPB B;  3AHU A;  3SEM A;  4MZT A;  2MYS A;  4LDX A;  2WSE E;  3OY9 A;  2COW A;  3EG3 A;  2VWF A;  2XKO C;  3RKY A;  3CCE Q;  2PVO B;  1YJW A;  1KQ1 A;  2CUD A;  1HXD A;  7AT1 B;  2EVR A;  2BZ8 A;  2RM4 A;  2AIR B;  3I56 A;  2ZPF B;  2ED1 A;  3M58 A;  5FLX E;  4FSS A;  2ROT A;  2HBP A;  1RLP C;  2M0O A;  5GAM g;  1VQ7 Q;  1IRX A;  1YJW Q;  1KQS A;  2DKG A;  3A8M B;  2H3J A;  3PMI A;  1AWX A;  2PZ1 A;  1SHG A;  1M3C A;  2H8H A;  2KDS A;  4CC4 B;  3OYH A;  3I56 Q;  4A53 A;  3WVE B;  1C6V X;  4M7A B;  4KT0 E;  4KH0 B;  1M1K R;  1ZSZ C;  1OZ3 A;  2DA9 A;  1QVF S;  2K6D A;  1BBZ A;  2BIV A;  4BAC A;  1N8R U;  4HVU A;  4MML A;  4M75 B;  4HCB A;  2ATC B;  2CKK A;  4BY6 C;  2HD0 A;  2HKQ B;  3JCM e;  1FMK A;  1UJ0 A;  2R57 A;  1UHF A;  1JJ2 P;  3OSV A;  3JCM b;  5J3B A;  3CCM T;  2O88 A;  1QLY A;  1VYU A;  4KUI A;  4M7A A;  1WZO A;  2DO3 A;  4EMH A;  2JOY A;  1OPL A;  1UFF A;  1VQM A;  1AWO A;  4Z8A A;  2E6N A;  2LP5 A;  2KVQ G;  1N6A A;  2FRY A;  2FVU A;  4HVW A;  4AFU C;  5FU6 B;  2O4X B;  3M53 A;  2EGA A;  4EDU A;  3H0F A;  3VS4 A;  2LT1 A;  2DL8 A;  4M75 A;  2B8A A;  2HAX A;  3JCM W;  4F7U E;  4E7H A;  3CPW A;  2RQW A;  2CGH A;  1D1C A;  1X6O A;  1U8R A;  3S6W A;  3JCM g;  1LOJ A;  4PJO D;  2CSI A;  1AVZ C;  3UA7 A;  3DKM A;  2AKL A;  8ATC B;  1RI9 A;  4N4I A;  1QVG A;  1K9M C;  1T3S A;  1X2K A;  1HYO A;  1FX7 A;  2DZ9 A;  3P8H A;  1Q86 R;  2O4X A;  1G3W A;  2CZ7 B;  4IUP A;  5GAM h;  2R5A A;  3MO8 A;  3OYL A;  4M7A G;  2R58 A;  1VQ5 A;  3VKI A;  1IHW A;  5AT1 B;  1SKU B;  3N5B B;  3VUB A;  3M59 A;  2A28 A;  4PJN A;  3MEU A;  3DB4 A;  4M7D B;  1OYX A;  4Z89 A;  4AMC A;  4GBQ A;  2KYM A;  4M75 G;  5CKF A;  2GTO A;  3L2R A;  4OP0 A;  4XTX A;  3PIO A;  2MI6 A;  1D0X A;  4EMK A;  1V29 B;  1VQ5 Q;  1Y96 A;  1WIE A;  2RHY A;  1KD1 R;  4C92 E;  4J8O A;  4KGZ B;  2NUT B;  5IT9 E;  2LZ6 B;  2XHC A;  2KXD A;  4FW1 A;  1D1B A;  1IO6 A;  2EYY A;  2OAW A;  2XD0 A;  3KBG A;  2Y4Y A;  5J26 A;  4QQG A;  4IUU A;  4LDU A;  1RAC B;  3RR6 A;  2JM9 A;  3G4S A;  3PMT A;  2DEQ A;  4JJB A;  4M7D A;  4ZGE B;  1KC8 R;  1MGQ A;  2KXC A;  1ZUK A;  2HL3 A;  2L3P A;  2L8D A;  3OW2 S;  3GNG A;  2JW4 A;  4FSX A;  2NUT A;  3MP8 A;  3J80 E;  3G4S Q;  1YCY A;  5D6W A;  3JCM h;  1SRM A;  5J39 A;  1VQ9 T;  1M27 C;  5GMK m;  1M1K C;  3SWN B;  2RK1 A;  1Q82 U;  2LCS A;  2OTL T;  3CCS T;  1WXB A;  2EYZ A;  2X51 A;  2X3X D;  4HCZ A;  1YP5 A;  3CCJ T;  1NM7 A;  3CC7 T;  4LE9 A;  1MMA A;  3V7R A;  2EJG A;  1NBE B;  2DVE A;  2L5Q A;  3UT1 A;  2K3Y A;  2MPX C;  4KGX B;  2QTX A;  2ZCF B;  2CP7 A;  4A4K A;  2YLC A;  4M7D G;  2QEX T;  3CCQ T;  2CH4 A;  4DEX A;  2WSC E;  1WJQ A;  2HQE A;  4YTL A;  5CVI A;  5KE2 A;  4L59 A;  2ED0 A;  4J9D A;  3SWN A;  1K73 U;  3M0U A;  1AZG B;  2CRE A;  3EH1 A;  1WGS A;  5HKC A;  2D6F A;  5GAN 8;  3BE3 A;  2D0N A;  3CCM A;  2ZPH B;  3QII A;  4OML A;  2CT3 A;  1W2B S;  1W70 A;  2CSQ A;  4JZ4 A;  5HK3 A;  3KUF A;  4JRI A;  4DBR A;  1GBR A;  2ZAE A;  4J6Y A;  3HP9 A;  1YJ9 T;  2PU9 B;  3LGL A;  1JQQ A;  2AZV A;  2DXC A;  3LX7 A;  2YUP A;  4M77 D;  1FMW A;  4DBQ A;  3CCM Q;  1G5V A;  1Z9Q A;  1VIF A;  5CKE A;  2LNV A;  1X27 A;  1VUB A;  2CS7 A;  3OYJ A;  4BB7 A;  2X3W D;  1K0S A;  4E7S A;  1K8A U;  3MP1 A;  3VRY A;  2FYK A;  1UGP B;  1M2V B;  2K5I A;  2RJC A;  3CXC S;  3H0H A;  2CZ0 B;  4XU2 A;  3VS3 A;  2WSF E;  3FJP A;  3M56 A;  1VYV A;  3CBM A;  2HNI A;  3LLR A;  3OYF A;  2OAU A;  4DBF A;  2JTF A;  2MK5 A;  3L2Z A;  3UWN A;  1QWF A;  2QA4 T;  2XG8 D;  1JEG A;  1TSF A;  4C8Q D;  3TEE A;  1VQ6 T;  2JVV A;  2DXU A;  2DL7 A;  2MOX A;  3CMA T;  4IUT A;  4PLL A;  3JB9 G;  2LT4 A;  2J6K A;  1WA7 A;  2RN8 A;  4C92 D;  3S3N A;  1KG1 A;  3FDR A;  5FU6 C;  2EQK A;  4CC2 A;  4M7A F;  4FYW B;  2E3I A;  1QCF A;  2K3X A;  1W1F A;  1ZSZ B;  3GNF B;  3TSZ A;  2LQK A;  2M9U A;  3V8J A;  5GJW B;  2J6F A;  4QQ6 A;  4ELY C;  1Y57 A;  1UTI A;  3CME T;  4BY6 B;  3X24 B;  4M75 F;  2CP2 A;  3PTA A;  3P8D A;  3FC3 A;  4R56 A;  4EIK A;  3SD4 A;  4OF1 A;  4RKU E;  3EG1 A;  2JMC A;  2GQI A;  1IB8 A;  1Q82 C;  1M5Q 1;  5GAN 5;  5FRO A;  2KRN A;  3C4S A;  4DQ2 A;  1ZSZ A;  2JMA A;  1T3L A;  3JCM c;  1AT1 B;  5LJ3 e;  1VQ9 A;  3TQ7 P;  4PLI A;  2FZC B;  4VUB A;  2MWO A;  2DAQ A;  2KGT A;  5LJ5 d;  3UA6 A;  2QQB A;  4PJM A;  1Q95 G;  3CCS A;  2OTL A;  4NL2 A;  2ESW A;  2BUD A;  2RQT A;  3CCJ A;  4M77 C;  4BDZ A;  5FU7 C;  1GCQ C;  3MKD A;  1EIF A;  2A7Y A;  1H3Z A;  3GF5 A;  1M8M A;  1NPR A;  2RQU A;  2JN0 A;  3GPL A;  3JRZ A;  1VQ9 Q;  1K73 C;  3QG1 A;  2QEX A;  5D7U A;  2DVJ A;  3CCQ A;  2HEQ A;  4UC4 A;  1YIJ A;  4C5I A;  2OTL Q;  3CCS Q;  4C0G A;  2YHT A;  1OI1 A;  1SEM A;  3ME9 A;  3CCJ Q;  4RCB A;  4AFZ C;  2GNC A;  5LJ3 g;  5IHI A;  1JU5 C;  4F7U F;  3MEV A;  4XU0 A;  2DTH A;  2QQ9 A;  1RAG B;  5GJV B;  1PG5 B;  2E41 A;  2RD1 A;  2QEX Q;  1KJW A;  4KH1 B;  3CCQ Q;  1YIJ Q;  1NPP A;  1RAH B;  4GLK A;  1KK7 A;  4C8Q C;  2EFI A;  1UE9 A;  2VXF A;  4KRT A;  4M7D F;  4LDW A;  3G71 T;  4E7I A;  1IXD A;  3NMZ C;  5CAI A;  4XTV A;  1VQK T;  2XI9 A;  1YJ9 A;  4BE1 A;  2LVM A;  1B07 A;  1RLQ C;  2VGM A;  1K8A C;  2R5M A;  1K76 A;  1WFW A;  3A1P A;  1YI2 T;  2RA2 A;  2FHD A;  1OV3 A;  3ZFJ A;  2E70 A;  2F5T X;  1YCS B;  1YJ9 Q;  1NYG A;  2E1H A;  1RAD B;  4R55 A;  1WLP B;  4J83 A;  2BE9 B;  4FT4 A;  3OYC A;  4C5G A;  1Q7Y R;  2X4W A;  4B6M A;  1Q81 R;  2JUF A;  1U5S A;  1LCK A;  2QA4 A;  2DXB A;  1Y71 A;  1VQ6 A;  1QWE A;  4M78 D;  4JJC A;  5DLO A;  1N9S A;  2EIF A;  3CMA A;  2PUK B;  5A0D A;  2A36 A;  2XID A;  1QVF A;  3EG2 A;  4A4F A;  3ZL7 C;  2F2V A;  2W0Z A;  3JV3 A;  2DD4 A;  3CCL T;  4XTZ A;  2QA4 Q;  4PJO B;  2YDL A;  5I2S A;  3SHW A;  1VQ6 Q;  5LJ3 h;  3ER0 A;  4E7L A;  1ZUY A;  3CMA Q;  2QAS A;  1NEG A;  4BI3 A;  4C5H A;  3A98 A;  2J05 A;  3L42 A;  1H8K A;  3CME A;  3JB9 F;  2VC8 A;  3QJ6 A;  5KYU B;  3HTR A;  2KRS A;  3S3O A;  3EGD B;  2OJ2 A;  1OX8 A;  3QSU A;  2C0T A;  2YT6 A;  4FIB A;  3A8G B;  4JDS A;  3L2U A;  4CC7 A;  1QCO A;  1U1S A;  2YSQ A;  3TU4 K;  1I5O B;  1PNJ A;  2DTO A;  2LCC A;  4AG2 C;  4JS5 A;  1KIK A;  5LJ5 j;  2QYZ A;  4LUE A;  4M7A E;  3CME Q;  1B7T A;  3CQT A;  1B34 B;  4RTW A;  1GCP A;  4Y91 A;  1V1C A;  1BYM A;  3HFN A;  2OTJ A;  3H0I A;  5FWB A;  1PD1 A;  4M75 E;  2O31 A;  1G3T A;  2EKO A;  4AG1 C;  1S72 T;  2KMT A;  5KYU A;  3Q1J A;  2M02 A;  2DM1 A;  2RPN A;  3EGD A;  4ZN1 A;  1KHI A;  4MZM A;  3CD6 T;  5IAY A;  1M1K U;  5GAM d;  1WHH A;  4B9X A;  1Y07 A;  1NEB A;  2X4Y A;  3C95 A;  4OB3 B;  5CKB A;  1G3Y A;  4J6W A;  2OTJ Q;  1Y0M A;  4HKE A;  1G8X A;  4XU3 A;  5IHN A;  1GFC A;  4MMK A;  3F70 A;  1B34 A;  2XDP A;  3I9Q A;  3VS7 A;  2DJQ A;  2QI2 A;  2MIO A;  3GIB A;  2OX7 A;  4ZGD B;  1YHQ T;  2DER A;  2COY A;  3A8H B;  4XAX B;  5GAN j;  2KNB B;  4J9I A;  1KQS P;  2ZPI B;  1NG2 A;  5FRM A;  3BDU A;  4HXJ A;  4M78 C;  2DL3 A;  3G71 A;  2OI3 A;  4AFQ C;  1VQK A;  3KFV A;  3QPH A;  4L6V 5;  3O5Z A;  5CQY A;  2K2M A;  2EAY A;  4PFO A;  3OYY A;  4FM4 B;  1YWP A;  2D0Q B;  1R77 A;  1MMG A;  1QP3 A;  3LW5 E;  5A0L A;  4O5V A;  3HSB A;  1YI2 A;  1I81 A;  3OW2 A;  1NJI R;  5D6Y A;  1Q81 C;  3G71 Q;  2E5Q A;  3J7A F;  1OOT A;  2EYW A;  1VQM Q;  3RMS A;  2FZK B;  2V8K A;  4JLG A;  3VV0 A;  4LUD A;  3VS2 A;  4M7D E;  2D8J A;  4RMO A;  3JCM d;  3E9F A;  2KAF A;  3C0C A;  4DBH A;  1C0M A;  3ZBD A;  2QG9 B;  1Q86 U;  9ATC B;  4N4H A;  2ROL A;  3QXE B;  1YI2 Q;  2VB6 A;  2J6O A;  2DMO A;  4OMM A;  2F2W A;  4ELZ C;  2DE0 X;  1CKB A;  5KYW B;  3RNJ A;  1IHV A;  2J06 A;  1ZQ1 A;  5DLQ E;  2CP5 A;  4C0D B;  1JJ2 S;  2YUN A;  1W4S A;  1TU0 B;  1TTH B;  3CPW P;  4KUL A;  1AZE A;  2XK0 A;  4BE2 A;  1GL5 A;  5KCO A;  2BKD N;  4M77 B;  3H9N A;  1KD1 U;  1ZBJ A;  5FU7 B;  3BW1 A;  2V1R A;  3OBY A;  4A4H A;  1OPK A;  2LQW A;  2LMJ A;  3CCL A;  4QT7 A;  1QVG P;  3H6Z A;  2V1Q A;  2HQH A;  3CBP A;  3UPU A;  4F04 B;  1U1T A;  2FPF A;  2F69 A;  2FL7 A;  5KYW A;  1RAE B;  2LC4 A;  4IUQ A;  3OMG A;  2MF2 A;  2HDA A;  4A4G A;  1YIT T;  2CP3 A;  2I2L A;  1KC8 U;  5GAN 2;  5GAN 7;  4JZ3 A;  3CCL Q;  2EQU A;  3E2U A;  2KR3 A;  2DIG A;  2LTO A;  4XK8 E;  1TG0 A;  4ATO A;  3SFM A;  3OBW A;  3PGG A;  2RI3 A;  4M77 A;  2CZ6 B;  2RJE A;  2QK0 A;  1GCQ A;  2L0A A;  2RNA A;  1WHL A;  2WAC A;  4WF2 A;  4XTW A;  1Z9Z A;  4C8Q B;  1KSW A;  5GMK e;  4JJD A;  2FPE A;  2F2X A;  2HZY A;  3OSS C;  1WJR A;  1NLO C;  3TCJ A;  2X9H A;  3PE0 A;  1RL2 A;  1QQJ A;  5A0G A;  1AEY A;  3M4G A;  1O9S A;  1AWJ A;  2RMO A;  5FRN A;  1XNI A;  1ZX6 A;  2DIQ A;  4C92 B;  1AOJ A;  1M30 A;  1WHJ A;  1SF9 A;  1A0N B;  5GAM j;  3SB2 A;  1FYN A;  1NYF A;  3CXC A;  1S72 A;  3O8V A;  5GAN 3;  2QTV A;  3CPF A;  2CP0 A;  3I55 T;  3I35 A;  3CD6 A;  4OGE A;  1UB4 A;  3IQL A;  1GFD A;  4PJO C;  1LJO A;  4J9C A;  4X9D A;  4C8Q A;  3EG9 B;  3OYI A;  2P4T A;  4II1 A;  2VUB A;  1S72 Q;  4EPC A;  4M77 G;  1XJW B;  5GMK l;  1FXX A;  1PHT A;  3A8O B;  3CD6 Q;  3RMQ A;  3NHN A;  1YHQ A;  2MMP A;  5GAO p;  1M3B A;  2CDT A;  3E1S A;  3QDR B;  4LXC A;  1MMD A;  1MMN A;  3EG9 A;  2MCN A;  3OYK A;  1OX9 A;  4E47 A;  1M1G A;  1UGQ B;  3NFC A;  4RTT A;  3L2Q A;  1YHQ Q;  3X28 B;  2EYQ A;  5GAO l;  3J81 E;  4AFS C;  1P92 A;  4C8Q G;  1WPY A;  4E7K A;  1TWB A;  5GAN 6;  3SDZ A;  1Q86 C;  3HKS A;  2E5K A;  2QGG A;  3FRN A;  2O9V A;  2D8H A;  2GQV A;  2K57 A;  4ZTJ A;  2P84 A;  3G1J A;  3I5S A;  4PJJ A;  1ZBX A;  4BDY A;  4A63 B;  1UGV A;  2EWN A;  2YWW A;  1LNX A;  5IHK A;  3BFM A;  3OQ5 A;  4DA4 A;  3R6O A;  2LX9 A;  1WNL A;  2CT4 A;  2Y4X A;  4LDY A;  3LYI A;  4HCK A;  2G3R A;  1JXO A;  2YLB A;  2HSE B;  1OU9 A;  1KD1 C;  1HSQ A;  4KBM B;  3INZ A;  4J9F A;  4CC3 A;  1FMV A;  5KYN A;  5DY9 A;  2X35 A;  2EKH A;  2LDM A;  1BU1 A;  1M9S A;  3L2W A;  3EFS A;  1M4Z A;  3M54 A;  5GMK h;  4OVA A;  1M2V A;  1NZ9 A;  1KC8 C;  4GY5 A;  2BZX A;  3JB9 J;  2K4Y A;  2QGF B;  3OYM A;  4MZP A;  4JRK A;  2RQV A;  3A8L B;  3DB3 A;  3OYA A;  1K1Z A;  1YIT A;  2VYT A;  4ZNX A;  3MEA A;  1VQN T;  4JPB W;  2RI5 A;  1ARK A;  1PSE A;  4Y92 A;  1ZHI A;  1WJS A;  5EC7 A;  2O2O A;  2RHI A;  2DJZ A;  2KT8 A;  2AKK A;  3JCM Q;  3QZ9 B;  1S1N A;  3JB9 I;  3CCE T;  4DEY A;  3L2V A;  3NGP A;  3RIR A;  4QVZ A;  1E6H A;  4M78 B;  1YIT Q;  5LL6 S;  2VAS A;  5IN1 A;  2EJ9 A;  4MDW A;  3HRU A;  4C0Z A;  2CYZ B;  2KBT A;  1SPK A;  4C0D C;  1VA7 A;  5I11 A;  3JB9 D;  3GOX A;  2FZG B;  5KYX B;  4Q5W A;  1VQ7 T;  1YJW T;  2GGR A;  4LD6 A;  5HY6 A;  2QQR A;  2HL5 C;  3RES A;  5LJ5 g;  3CC7 A;  1M90 R;  3I55 A;  5CK9 A;  2E4H A;  1ZA2 B;  2IVW A;  3PFS A;  5L23 A;  1OU8 A;  4RCC A;  5CR2 A;  3EGU A;  2RB6 A;  2DNU A;  1EFN A;  1D0Y A;  3JAM E;  3M5A A;  4M78 A;  4J9B A;  1UHC A;  2PUO B;  4TVR A;  1GXI E;  2B86 A;  2L3S A;  1PKT A;  5DM7 R;  3GLX A;  3HL8 A;  3CC7 Q;  3I55 Q;  4JRP A;  1OQK A;  3G6E T;  2GFU A;  1RAI B;  5KYX A;  4HT9 A;  2QXF A;  3VRZ A;  3JB9 H;  2ABL A;  3FLG A;  3VYH B;  4LNP A;  5LJ3 d;  1C1A A;  3E19 A;  2DET A;  4PKC C;  5LJ5 f;  4BD3 A;  5GAN d;  3FB9 A;  1X2Q A;  3M9Q A;  4OMF B;  1VYT A;  2K3B A;  4M77 F;  4IKF A;  4OB2 B;  2DRK A;  2JTM A;  2XIC A;  3MP6 A;  2A08 A;  4C92 C;  1H3H A;  2HSP A;  2BTT A;  3NPF A;  1ZLM A;  4N4G A;  1QCN A;  1H92 A;  4J6X A;  1I07 A;  1YN8 A;  1DJ7 B;  4M78 G;  1X43 A;  2EJF A;  1TXQ A;  3PNW C;  2BE7 D;  2DYB A;  2RO0 A;  2L2P A;  3LH0 A;  5AYF A;  1BK2 A;  2RJF A;  1MND A;  3PIP A;  2M1H A;  4RTV A;  4F14 A;  3UDC A;  1BIA A;  1H64 1;  1Q7Y U;  4Z88 A;  1Q81 U;  2QQA A;  1JO8 A;  3UF4 A;  1UDL A;  3QYH B;  4C8Q F;  1ZSG A;  3M0P A;  1N27 A;  1YFN A;  4HT8 A;  1JXM A;  5GAO n;  2CP6 A;  1AWW A;  3TVT A;  2YXY A;  4RTZ A;  1ZA1 B;  1I0C A;  2QDY B;  5D6X A;  2EQJ A;  1QP2 A;  3CCR T;  1M8V A;  2VGN A;  1RAA B;  2Y90 A;  4FCY A;  1VQP T;  4DOW A;  3VU3 C;  3HRT A;  3R6N A;  8AT1 B;  1K9M R;  2I0N A;  1VIE A;  1QKW A;  2M16 A;  1BB9 A;  2K5F A;  1PRM C;  2NLU A;  2DFU A;  2EPD A;  2P4R A;  5KCH A;  4IIM A;  3X20 B;  1XTD A;  2DL4 A;  4JLI A;  5I22 A;  1VQN A;  1SG5 A;  2PVG B;  3VUZ A;  4OB0 B;  3M0S A;  1VQO T;  2K7A A;  2ZPG B;  3OS1 A;  1QVF P;  1HJD A;  1UEC A;  2CH4 W;  4D6W A;  4PJO A;  4QQD A;  3V7C A;  3ASK A;  4O6J A;  2NUP B;  1VQN Q;  3ULR B;  4CI0 C;  4ORZ A;  2EYX A;  1F1B B;  2KI7 A;  2DBM A;  1I1J A;  4QVC A;  2SEM A;  2QQS A;  1VQ7 A;  4OMO A;  5L8R E;  4BE0 A;  2RK2 A;  3CEY A;  4J7F A;  3VYG A;  4RG8 A;  5GAO q;  3ZEH A;  1JJ2 A;  2NUP A;  2AT1 B;  3E9G A;  5EG2 A;  1OUL A;  4F17 A;  3I5R A;  2DEU A;  1SSF A;  4BI8 B;  4NOY A;  2FEI A;  1UUE A;  1KFZ A;  2K5L A;  3QZ5 B;  4L5G A;  1G3S A;  1BIB A;  5LJ3 j;  2LX7 A;  3G6E A;  4PJO G;  4J9H A;  4NS5 A;  4E7Z A;  1YNZ A;  2NWM A;  2JJ9 A;  4ZGJ B;  2Z0W A;  2PQW A;  2HCK A;  3CC2 T;  2GTJ A;  5M9O A;  3M0Q A;  1D0Z A;  3MHX A;  4F16 A;  3RUX A;  3OYE A;  1N8R R;  3X26 B;  1N9R A;  3G6E Q;  2RJD A;  3GP8 A;  3VS1 A;  2RHU A;  2EQI A;  1K0X A;  4B9W A;  2MWP A;  2RQR A;  4AT1 B;  1NJI U;  4RG2 A;  5GAM f;  1PCX A;  4JRQ A;  4FT2 A;  3LWI A;  1Q7Y C;  3BY7 A;  3EAE A;  1D1A A;  4OGC A;  1VQK Q;  4R0K A;  2KQW A;  2A3L A;  4E2F B;  1ABQ A;  2JS2 A;  1E7O A;  4C5E A;  2AHJ B;  4WCI A;  4XTY A;  3UAT A;  3TSW A;  2RI2 A;  1G2B A;  2V8J A;  2E65 A;  3V7S A;  2AK5 A;  4M77 E;  4RTX A;  4J7I A;  4FU6 A;  1MHN A;  2W10 A;  3HRS A;  3JCM V;  1BI2 A;  1MNE A;  1B3Q A;  3OMC A;  4KGV B;  4M78 F;  1WDX A;  2RHX A;  1QKX A;  1BCM A;  2NYS A;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 2KRO A;  2JT4 A;  1GCQ C;  4RTT A;  1NLP C;  2EW3 A;  1K9A A;  1M8M A;  4AFS C;  1PKS A;  3THK A;  2RQU A;  3PVQ A;  3QWX X;  2LQN A;  3VS5 A;  3SEM A;  2DVJ A;  2HEQ A;  1X69 A;  1SEM A;  2E5K A;  3EG3 A;  2VWF A;  2O9V A;  2D8H A;  4AFZ C;  2CUD A;  2GNC A;  3REA B;  2NUZ A;  5IHI A;  1JU5 C;  2M51 A;  1N5Z A;  3I5S A;  2EVR A;  2BZ8 A;  4A63 B;  1UGV A;  2DL5 A;  1XOV A;  5GJV B;  5IHK A;  2ED1 A;  1KJW A;  4FSS A;  2ROT A;  2CT4 A;  1UE9 A;  1RLP C;  4KRT A;  4HCK A;  1JXO A;  3NMZ C;  1HSQ A;  2RF0 A;  2K79 A;  3M0T A;  4J9F A;  2FPD A;  4CC3 A;  1AWX A;  1ABO A;  2PZ1 A;  1SHG A;  1M3C A;  1B07 A;  1RLQ C;  2H8H A;  4CC4 B;  2EKH A;  1BU1 A;  2A37 A;  2C0I A;  1K76 A;  5IH2 A;  4OMQ A;  1WFW A;  2XMF A;  2DA9 A;  2K6D A;  3QWY A;  1BBZ A;  1OV3 A;  1UJY A;  4HVU A;  2BZX A;  1YCS B;  3EHQ A;  1NYG A;  2RQV A;  1FMK A;  1WLP B;  1UJ0 A;  1K1Z A;  1UHF A;  4ZNX A;  1X6B A;  4JPB W;  1ARK A;  4Y92 A;  2O88 A;  1QLY A;  1VYU A;  1U5S A;  5EC7 A;  1CKA A;  2O2O A;  1LCK A;  1MV0 B;  2KT8 A;  2AKK A;  1OPL A;  1UFF A;  1AWO A;  1S1N A;  2AZS A;  4Z8A A;  4DEY A;  1QWE A;  2LP5 A;  3NGP A;  2FG0 A;  2FRY A;  4JJC A;  4HVW A;  4AFU C;  1E6H A;  2EGA A;  3H0F A;  3VS4 A;  2A36 A;  2DL8 A;  1TUD A;  3EG2 A;  1WX6 A;  2J7I A;  2KRM A;  4GLM A;  3VS6 A;  3ZL7 C;  2F2V A;  2RQW A;  2M0Y A;  1OEB A;  2W0Z A;  2KBT A;  1SPK A;  1CSK A;  3JV3 A;  1VA7 A;  2CSI A;  1AVZ C;  5I11 A;  1T0J A;  2YDL A;  2CUB A;  3UA7 A;  2AKL A;  2D1X A;  1RI9 A;  3H41 A;  3SHW A;  2GGR A;  1W6X A;  2HBW A;  1T3S A;  1ZUY A;  1NEG A;  2DLP A;  1X2K A;  5L23 A;  3A98 A;  2J05 A;  3EGU A;  1H8K A;  2DNU A;  1EFN A;  1J3T A;  4J9B A;  2KRS A;  1WYX A;  1UHC A;  2OJ2 A;  2C0T A;  2YT6 A;  2B86 A;  2L3S A;  1PKT A;  4CC7 A;  2A28 A;  2YSQ A;  1PNJ A;  1U3O A;  1GRI A;  4AG2 C;  4Z89 A;  1KIK A;  4GBQ A;  2KYM A;  1YWO A;  4LUE A;  1UG1 A;  2GTO A;  3CQT A;  3VRZ A;  2ABL A;  1GCP A;  4RTW A;  1V1C A;  4RTY A;  4LNP A;  1WIE A;  4J9E A;  1ZUU A;  3H0I A;  2LZ6 B;  5FWB A;  1T0H A;  2KXD A;  1IO6 A;  1X2Q A;  2O31 A;  4AG1 C;  2EYY A;  2OAW A;  1VYT A;  1G83 A;  2K3B A;  2DM1 A;  2RPN A;  2DRK A;  1H3H A;  2A08 A;  2HSP A;  2BTT A;  1PRL C;  3NPF A;  5ECA A;  1ZLM A;  2JM9 A;  1H92 A;  1I07 A;  1NEB A;  4IIO A;  4JJB A;  1YN8 A;  4X1V A;  1Y0M A;  2KXC A;  1X43 A;  5IHN A;  2JS0 A;  1ZUK A;  1GFC A;  3REB B;  4K11 A;  2L3P A;  2DYB A;  3I9Q A;  2L2P A;  3VS7 A;  1BK2 A;  5HCK A;  2DJQ A;  2JW4 A;  2KYB A;  2MIO A;  2L3Q A;  4RTV A;  4F14 A;  2KEA A;  2BZY A;  4Z88 A;  1JO8 A;  2KNB B;  3UF4 A;  1RUW A;  1SRM A;  4J9I A;  1UDL A;  2JM8 A;  3EHR A;  1M27 C;  1WXT A;  1NG2 A;  1ZSG A;  3M0P A;  3GBQ A;  4HXJ A;  2LCS A;  2DL3 A;  2OI3 A;  4AFQ C;  1WXB A;  2EYZ A;  1JXM A;  1SHF A;  2G6F X;  2X3X D;  3KFV A;  1YP5 A;  1AWW A;  1NM7 A;  3O5Z A;  4LE9 A;  5FWC A;  3TVT A;  2K2M A;  5IXF A;  4RTZ A;  1YWP A;  1I0C A;  2LJ3 A;  3U23 A;  2DF6 A;  2ECZ A;  1HD3 A;  1SRL A;  2CH4 A;  3LH5 A;  4DEX A;  3R6N A;  1OOT A;  2EYW A;  2I0N A;  2QDL A;  1QKW A;  1BB9 A;  3EG0 A;  1PRM C;  2ED0 A;  4J9D A;  1M3A A;  2EPD A;  4LUD A;  3VS2 A;  2D8J A;  3M0U A;  5FW9 A;  3C0C A;  2P4R A;  2VVK A;  4IIM A;  3VS0 A;  2DL4 A;  1AZG B;  2CRE A;  2DRM A;  5I22 A;  2ROL A;  1K4U S;  4RUG A;  2J6O A;  2DMO A;  2LJ1 A;  4OMM A;  2VKN A;  2D0N A;  2F2W A;  2DE0 X;  2PTK A;  4OML A;  1MUZ A;  1CKB A;  2CT3 A;  3M0S A;  1WI7 A;  1W70 A;  2CSQ A;  4JZ4 A;  4LN2 A;  3RNJ A;  2DIL A;  2J06 A;  2K7A A;  1U06 A;  4D8K A;  1GBR A;  3M0R A;  2DX1 A;  1HJD A;  1UEC A;  2KE9 A;  1AD5 A;  2YUN A;  2CH4 W;  2YUQ A;  1JQQ A;  2AZV A;  1AZE A;  2O9S A;  3ULR B;  2YUP A;  1GL5 A;  1Z9Q A;  1ZBJ A;  2V1R A;  1OPK A;  2LQW A;  2LMJ A;  1X27 A;  4ORZ A;  2EYX A;  4QT7 A;  4ESR A;  4RTU A;  2DBM A;  1I1J A;  1MV3 A;  2V1Q A;  2SEM A;  2FRW A;  1K0S A;  2EGC A;  2X3W D;  3FJ5 A;  4OMO A;  3VRY A;  4D8D A;  2KT1 A;  2FPF A;  4E6R A;  2GBQ A;  2HDA A;  3H0H A;  2C0O A;  3VS3 A;  4JZ3 A;  1VYV A;  2ENM A;  2KR3 A;  1TG0 A;  1QWF A;  4F17 A;  3I5R A;  1JEG A;  2L0A A;  1GCQ A;  2RNA A;  2FEI A;  1UUE A;  1Z9Z A;  1KFZ A;  1KSW A;  2YUO A;  4JJD A;  2LX7 A;  2SRC A;  2DL7 A;  2F2X A;  2FPE A;  2K9G A;  2MOX A;  4J9H A;  2EBP A;  1YNZ A;  2NWM A;  1NLO C;  2J6K A;  3PE0 A;  1WA7 A;  2RN8 A;  2LNH B;  1AEY A;  2HCK A;  1AWJ A;  2RMO A;  2GTJ A;  1ZX6 A;  4OMP A;  3M0Q A;  1AOJ A;  1M30 A;  1PWT A;  2PNI A;  1A0N B;  4F16 A;  1TUC A;  4CC2 A;  1FYN A;  1NYF A;  1QCF A;  3TSZ A;  1W1F A;  1WXU A;  2DBK A;  3RBB B;  2JXB A;  5GJW B;  4M4Z A;  2J6F A;  3VS1 A;  2IIM A;  1Y57 A;  3I35 A;  3IQL A;  1GFD A;  1UTI A;  2EQI A;  1K0X A;  1X6G A;  4J9C A;  2LJ0 A;  2RQR A;  4EIK A;  3EG1 A;  4J9G A;  2FO0 A;  2JMC A;  4R0K A;  1GBQ A;  2GQI A;  1ABQ A;  2EGE A;  2JS2 A;  1E7O A;  1PHT A;  4WCI A;  3UAT A;  4HVV A;  3TSW A;  2KRN A;  1G2B A;  3NHN A;  5IXB A;  2AK5 A;  2JMA A;  1T3L A;  1E6G A;  1SSH A;  1M3B A;  2CDT A;  4RTX A;  3PVL A;  2JTE A;  2W10 A;  2KGT A;  4OMN A;  1B3Q A;  3UA6 A;  1WDX A;  1QKX A;  2MCN A;  2ESW A;  2RQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...