1QLYA

Nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
LKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE BTK
publication title Solution Structure of the Human Btk SH3 Domain Complexed with a Proline-Rich Peptide from P120Cbl
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tyrosine-protein kinase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qlyA00
2RQRA 1JU5C 4J9FA 2O9SA 2JTEA 4F17A 2ESWA 2D1XA 2EVRA 5ECAA 1BK2A 2RNAA 1CKAA 2B86A 1JEGA 3H0IA 2M0YA 2KE9A 2DILA 1AWJA 1ABQA 3M0QA 1CKBA 1UTIA 1AVZC 4KRTA 2DYBA 2KXDA 2YUOA 2X3WD 1KJWA 4DEYA 1FMKA 2DVJA 1AOJA 4AFUC 2CH4W 2VKNA 1S1NA 1UE9A 4J9GA 1JXOA 1X69A 3PE0A 1PKTA 2PNIA 2A08A 2LX7A 2LP5A 2YUQA 3VS6A 3ZL7C 1K76A 4E6RA 1E7OA 2M51A 1NLPC 2K2MA 1OOTA 3I9QA 1UG1A 1NYGA 1X6BA 2A28A 4FSSA 1H3HA 1GFCA 1FYNA 2L2PA 4JJDA 1B07A 3PVLA 2D8JA 2L3PA 1K4US 2J7IA 2F2WA 4J9IA 1GL5A 4CC2A 1YWPA 4OMQA 1TUDA 4Z89A 2AZSA 3THKA 2ABLA 3O5ZA 3I5RA 1VYTA 3M0UA 5HCKA 1ZLMA 3IQLA 1ZUUA 2L3SA 3EHQA 2BZ8A 2ROTA 1HJDA 2J05A 4X1VA 1TG0A 2O2OA 1ZUYA 2DA9A 2KEAA 4JJCA 2V1RA 4AG2C 4ORZA 2DM1A 1BU1A 2D0NA 1H8KA 2KR3A 3SHWA 3H41A 1AEYA 2HDAA 2W0ZA 2KT1A 1AD5A 2HEQA 1AZGB 1GBQA 1QWFA 2KT8A 2ED0A 1ZSGA 3A98A 2A37A 1YN8A 2GTOA 2HBWA 3VS2A 2RQVA 2DX1A 5I22A 1Z9QA 3EHRA 1KIKA 2DL8A 2EQIA 2K9GA 2YUNA 4QT7A 2EGEA 1PRMC 1KSWA 1RUWA 2CUBA 2FG0A 3H0HA 2KXCA 1ZBJA 2RQUA 2CT4A 1ZUKA 2AK5A 2EYZA 1X6GA 4HVWA 5EC7A 4F16A 1PNJA 3VS1A 1CSKA 4Y92A 4JZ4A 3R6NA 1BBZA 4RTWA 3RNJA 3EG3A 2L0AA 4IIMA 2ROLA 4AFZC 5IHKA 1M8MA 2YSQA 1PWTA 3CQTA 4CC7A 1Y0MA 2NUZA 4J9HA 1E6HA 2FO0A 1QLYA 4J9EA 2JXBA 3VS3A 4GLMA 3UATA 1WI7A 4IIOA 1WFWA 2J6OA 1UGVA 2RQWA 2E5KA 5GJWB 5FWBA 1JQQA 1QKWA 1SHGA 2MCNA 2EBPA 2X3XD 2LJ1A 4Z8AA 1W1FA 3EG2A 2DL5A 1GFDA 2KBTA 2FPEA 1GCQA 1WIEA 2JMCA 1B3QA 3ULRB 1M3BA 2GGRA 2A36A 4J9CA 1WLPB 1T3SA 2C0OA 2KNBB 1PRLC 1KFZA 2DLPA 1WDXA 3EG0A 1W70A 2J6FA 1QCFA 2FEIA 1WXUA 2V1QA 4D8DA 4LUEA 2KRNA 1H92A 1J3TA 4OMMA 1UJ0A 2EYXA 4RTUA 1NG2A 4ESRA 2OI3A 3FJ5A 1T0JA 2ENMA 3VS5A 2LZ6B 2FRWA 2W10A 1QWEA 1ARKA 2DL3A 2EGAA 4OMLA 1RI9A 2LQWA 4Z88A 1TUCA 5L23A 4A63B 3M0SA 2KGTA 3H0FA 2DL7A 1VYVA 2KYBA 5FW9A 4F14A 1I1JA 3U23A 1OV3A 3I35A 1OPLA 2C0IA 4JZ3A 4GBQA 1NEBA 2CT3A 3TSZA 2CH4A 4EIKA 3C0CA 2PTKA 1PHTA 1ABOA 2J6KA 5IH2A 1GCPA 2DRMA 2F2XA 2VVKA 2KRSA 1NM7A 2XMFA 1MV0B 2GNCA 2G6FX 4LNPA 1XOVA 2DRKA 4RUGA 1SSHA 1W6XA 4JJBA 1N5ZA 2YT6A 2EGCA 4AFSC 1K0XA 1GCQC 1X2KA 1G83A 4CC4B 4ZNXA 1AWOA 1X2QA 1UDLA 1Y57A 4LE9A 4RTZA 2AZVA 2J06A 1YNZA 2AKLA 2LNHB 2P4RA 5IXBA 1NEGA 1SRLA 1T0HA 2CUDA 1M27C 2QDLA 3QWYA 1HD3A 3VS7A 3VS4A 2D8HA 3VS0A 4HVVA 1X43A 3EGUA 3UA6A 1NYFA 1UJYA 2LMJA 1MUZA 2SRCA 4LUDA 4J9DA 4D8KA 4OMOA 5FWCA 4DEXA 3RBBB 1M3CA 4AFQC 2O88A 1RLQC 4OMPA 4AG1C 2KYMA 2GBQA 2NWMA 2DNUA 1UFFA 1UHCA 2DF6A 2F2VA 1NLOC 2C0TA 2OAWA 1GRIA 2VWFA 3M0TA 2JM9A 1OPKA 1VA7A 2MOXA 2ED1A 3NHNA 4J9BA 2BZXA 1VYUA 4K11A 2K6DA 2RMOA 2GQIA 1T3LA 2K7AA 2JM8A 5IHNA 3NPFA 2KROA 1UUEA 3NMZC 2FPDA 3KFVA 3M0RA 3PVQA 2DJQA 2EW3A 3LH5A 3REAB 2PZ1A 4JPBW 5IXFA 2EYYA 1PKSA 2EYWA 3EG1A 3I5SA 4WCIA 2LJ0A 1M3AA 2JS0A 3JV3A 2I0NA 1YWOA 1I07A 1BB9A 1Z9ZA 1AWXA 3UA7A 1X27A 2JT4A 3M0PA 1U5SA 3VRZA 1A0NB 1EFNA 1M30A 4RTXA 2LCSA 2AKKA 2ECZA 4RTYA 4OMNA 4HXJA 1YP5A 2FRYA 5I11A 2EKHA 2HCKA 2L3QA 1ZX6A 2DBMA 2JMAA 4R0KA 1U06A 1UECA 1MV3A 2O31A 1E6GA 2H8HA 2IIMA 2CDTA 2O9VA 1G2BA 2K79A 2KRMA 1U3OA 2BTTA 2BZYA 2RF0A 2SEMA 2LQNA 1AWWA 2JW4A 3QWXX 1WX6A 1WXBA 1YCSB 1GBRA 3TVTA 1LCKA 1HSQA 1OEBA 2YDLA 1SEMA 1RLPC 2RQTA 1V1CA 2JS2A 3NGPA 1AZEA 2CSIA 2DE0X 2MIOA 1K0SA 2OJ2A 1SPKA 2CSQA 1WYXA 2YUPA 1SHFA 3SEMA 3REBB 1JXMA 2FPFA 2LJ3A 1I0CA 2RN8A 2DBKA 2HSPA 3GBQA 1WXTA 3UF4A 2EPDA 5IHIA 2DMOA 5GJVB 1K1ZA 4HCKA 4M4ZA 4RTVA 2GTJA 4HVUA 4CC3A 1K9AA 1WA7A 2CREA 1IO6A 4RTTA 2RPNA 4LN2A 1UHFA 1QKXA 1SRMA 1JO8A 2K3BA 3VRYA 3TSWA 2DL4A
chains in the Genus database with same CATH superfamily
3CXCA 4B9WA 4TVRA 3RKXA 5CIUA 2JTEA 3EG9A 4F17A 2ESWA 2EVRA 2DD4A 2EWNA 1Q82U 4LDVA 2M0YA 1NBEB 2KE9A 1K73U 8ATCB 2KQWA 4M78C 1CKBA 1F1BB 2RO0A 4KRTA 4KUDK 2DYBA 2KXDA 2QG9B 2KSSA 1D3BB 4QQDA 1FMKA 1YFNA 1TUGB 5D6WA 1JXOA 3D7SB 4MMKA 4FYXB 4XTVA 2A08A 2QTVA 2LP5A 2YUQA 3VKIA 3OMCA 5FRMA 3I9QA 1X6BA 3HPWA 4E2FB 4M77B 3L2VA 1GFCA 2K5FA 1TWBA 1B07A 3PVLA 1WQWA 1OULA 5LJ3h 2OAUA 4DOVA 1B34A 2MPXC 4J9IA 4C0FA 1I5LA 5DY9A 4OMQA 1TUDA 3JSCA 2QA4Q 3EGXB 4V2SA 4VUBA 4B6MA 2F5TX 1ZLMA 5GAMh 1RACB 1HJDA 3OA6A 2J05A 4DBHA 2FZGB 2DXCA 1BI2A 4JRPA 3V7RA 2V8KA 2R5MA 5DM7R 2VUBA 2LQKA 2MAMA 3H41A 1AEYA 2HDAA 3UWNA 3M53A 2HEQA 1YIJQ 1GBQA 1QWFA 1ZSGA 3CCUA 1BIAA 2WSFE 8AT1B 4XTYA 3QHSA 3EHRA 3CC4T 2DXUA 3H6ZA 2GFAA 4M7DB 2EGEA 3TREA 1YJ9T 1RUWA 3CCRA 4FYYB 3H0HA 1I8FA 2KDSA 3LH0A 5GAOp 1JJ2S 3MCAB 1VQNQ 4ZTFA 2O01E 3A8MB 3TCJA 1KD1U 4F16A 2R5AA 2WSCE 4C92A 4OGCA 1QVGP 1YITT 4JZ4A 3R6NA 4QKUA 2KY9A 4JLIA 3G6EA 1VQPA 3EG3A 1ZSZB 2JZ2A 1EZZB 3JCMW 3CQTA 2CP3A 1N27A 2NUZA 4J9HA 3QO3A 3FB9A 1N8RU 1NJIU 3J80E 2DTHA 4PLLA 4IIOA 2Y4XA 1HXDA 5GJWB 1VQMQ 5GMKi 1WNLA 3JCMX 5GANj 4L59A 3JB9J 2EBPA 2LJ1A 2EJFA 1W1FA 3EG2A 2DL5A 3HFOA 4KULA 3V8JA 2YWWA 1GCQA 1WIEA 3QKJA 1VOMA 3MP8A 5LJ5f 1UGRB 3TU4K 3OYYA 2L3RA 4JS4A 4ELYC 4LD9K 1WLPB 1T3SA 2C0OA 2KNBB 1PRLC 1KFZA 1WDXA 4PJJA 5GAOn 4BDYA 1WXUA 2QGGA 5GMKm 3OYJA 4LUEA 2KRNA 1H92A 1YI2T 1RAHB 1VQ6T 4A4EA 1D0XA 5LJ3f 2ENMA 4EDUA 1ZHIA 1VQ5Q 1VQ9Q 5CO7A 1QWEA 3GOXA 5HKCA 2DL3A 4OMLA 2QQAA 3RDVA 2F69A 1JRIA 5GAMf 1RAGB 3ME9A 4Y91A 4F14A 2DZ9A 1VQOQ 1I1JA 3U23A 3OYDA 1OPLA 4M78E 3CC7A 1Q81U 2K57A 4M75D 3SD4A 2IG0A 3JCMd 1QVGA 3TSZA 3JCMP 4EIKA 5CVIA 3HRSA 2PTKA 2J6KA 3CCMA 4PJOD 2F2XA 3GNFB 3UT1A 1XJWB 2VVKA 3GPLA 1KC8U 2CZ0B 2GNCA 2X4WA 4LNPA 5GAOm 2DRKA 3QIIA 1Q82R 1KK7A 2PU9B 2HSEB 1K73R 2PVGB 2CP0A 4C92D 4CC4B 2RI5A 3FRNA 3OS5A 3OYIA 1X2QA 2CKKA 3V8LA 5LJ5e 4PJOG 2JOYA 2AKLA 2LNHB 4BDZA 4BE1A 5IXBA 2K4YA 2D0QB 5GANh 1KHIA 3CD6T 1M27C 1HD3A 1TTHB 2P4TA 3VS4A 4BUGA 2I2LA 2XHCA 4C92G 4HVVA 1X43A 3EGUA 3RKWA 2E41A 3X20B 3JB9F 3UA6A 1NYFA 4HCBA 2SRCA 3EFSA 2K3YA 3HL8A 4LUDA 2JTFA 5LJ3e 3LWHA 4D8KA 3P8HA 3M54A 3ZEHA 4C0GA 1TOVA 4EMKA 1VQ8A 4AFQC 4AG1C 2EJ9A 3UDCA 5IN1A 3OY9A 1UHCA 5GAMe 4ZTJA 2EIFA 1M1KC 1VQKT 3M0TA 1VA7A 3NHNA 2ED1A 4J9BA 2BZXA 4M75C 3G4ST 2GQIA 3JB9I 2JM8A 1QW1A 3NPFA 4XU2A 4PJOC 5I21A 3KFVA 3QPHA 4LXCA 4OB2B 1YJNT 3A5ZB 4LDUA 2EYYA 1PKSA 3M56A 2RA2A 5L8RE 2MWOA 3CCVA 4QQ6A 2D9TA 4E7IA 2JVVA 2O4XA 3OW2S 1W2BP 2OTJT 3CCUQ 1AWXA 1LJOA 3UA7A 1X27A 2PUKB 1U5SA 2LCSA 2AKKA 1GXIE 1KD1R 3CCRQ 4OMNA 1YP5A 3X25B 2RD1A 4F7UF 3EFOB 1AT1B 5GAN5 2L3QA 2DERA 1BI0A 1UECA 4KUIA 4FYWB 2H8HA 2K79A 2KRMA 4BI3A 1U3OA 2BZYA 2YXYA 2RF0A 1PD1A 2JW4A 2RM4A 1N8RR 5A0LA 1NJIR 1WXBA 1YCSB 1VQPQ 3EAEA 5AYFA 7AT1B 2YDLA 1C1AA 2DIQA 1ZQ1A 1SEMA 2E4HA 4FT4A 5KH6A 4M77D 3M58A 1AZEA 4QVCA 3EFRA 3G71Q 1VUBA 3TQ7P 5KYNA 3RIRA 2YUPA 2V26A 3OYCA 1JXMA 4UC4A 2RN8A 3BE3A 3UF4A 3L2ZA 2EPDA 5FRNA 4M77G 1KQ2A 3QG1A 3CMEQ 2QYZA 4A53A 4RTVA 4HVUA 1WA7A 2E70A 1IO6A 2RHIA 2HZYA 2DETA 4OF1A 3MP1A 5EG2A 3CPWA 1MMGA 2OTLT 2NUTB 3TSWA 2DL4A 4Y28E 4J9FA 2O9SA 2DJZA 3VUBA 3CXCS 3GNGA 3SDZA 2D1XA 2IPOB 4XTWA 3FIFA 2ZPIB 1JEGA 1G5VA 1W2BA 1RABB 2K5LA 1ABQA 4JRQA 2XIDA 1D09B 1G3TA 4PL6A 1WHGA 4J7IA 1AVZC 5KYYA 4FT2A 2VASA 2H3JA 4DEYA 1Q81R 3FJPA 2DVJA 1AOJA 1UE9A 3PE0A 2DYIA 2XG8D 2LX7A 2HQEA 1OX8A 5LJ3g 2DXTA 1KC8R 1K76A 2BUDA 4E6RA 4ZGDB 3A8OB 1E7OA 4M77C 1NPPA 2K2MA 4NS5A 4OP0A 1NYGA 1VQLT 3CCST 3SFMA 4ME7A 1MMDA 1H3HA 2L2PA 4IUUA 3LYIA 5LJ5j 3OYBA 2D8JA 5GAMg 3T9NA 1K4US 2HQXA 2F2WA 2Y90A 3A8GB 2VXFA 1I81A 2DZCA 2EQMA 3QZ9B 4Z89A 1MNDA 2AZSA 3JCMf 3O5ZA 3I5RA 4C8QF 4M7DF 1PSEA 2HKQB 2E5QA 4OMFB 3CC4A 1YJ9A 2DA9A 4A4GA 2R57A 2XKOC 4AG2C 4M75E 5D7UA 2D0NA 3FLGA 3SHWA 4DBQA 2KT1A 5CCAA 1IREB 2ED0A 1YITA 3A98A 4PJOE 4M7DC 2A37A 1YN8A 1K8AC 2A3LA 1Z9QA 2F5KA 1KIKA 2YUNA 1PRMC 4EMHA 4A4FA 1MMNA 5IT9E 1VQ8Q 5CR2A 2F1LA 1X75C 2QGFB 2KXCA 2RQUA 2M1HA 3GP8A 3OSSC 2X4XA 2FZCB 1R77A 1IZ6A 1M1KU 3CBMA 5GAOq 4IUPA 5KE3A 1BBZA 1P92A 3INZA 2JN0A 3CCLT 2Z0WA 3ZBDA 2L0AA 4IIMA 2ROLA 1H641 1M2VA 4XTXA 2EQUA 3V7SA 1M5Q1 1E6HA 1UGPB 2BKDN 3L2RA 2QA4T 2JXBA 3VS3A 4GLMA 3UATA 3VJPA 3O8VA 3OBWA 1O75A 3LGLA 2ZPFB 3G7ZA 1JQQA 1QKWA 3JCMe 1SKUB 1SG5A 3OQ5A 4PLIA 2NUPB 4F7UE 1ZBXA 2X9HA 1YI2A 1VQ6A 2FPEA 5LJ5h 1MNEA 2RHXA 1M3BA 2LX9A 1K9MC 2XDBA 3QJ6A 3C12A 4J9CA 2K3XA 3I56T 1BI3A 3SWNB 1Y96A 2DLPA 2JTMA 2PVDB 3EG0A 1W70A 3A1PA 1KG1A 3AT1B 3MEWA 1J3TA 2VV5A 4OMMA 1UJ0A 2GQVA 3QYHB 3FJ5A 1ACMB 1OU9A 1VQ7Q 3EGDA 2LZ6B 2NYSA 4KBMB 1RI9A 2LQWA 2XI9A 2RJCA 5L23A 3OYLA 2RJDA 3M0SA 3H0FA 3HP9A 4J6XA 3MEAA 2DL7A 5KCHA 3URGA 3PIPA 3RUXA 2PVOB 4P5NA 4ZN1A 1RL2A 2WSEE 1R0BG 5FU6B 4GBQA 1NEBA 1VQMT 5J39A 5KYWB 4M75A 1ABOA 5IH2A 1NM7A 5GAN2 3ZFJA 4C8QB 4FU6A 4PJOA 2G6FX 5FU7B 3CD6A 3CC2Q 1SSHA 4JJBA 1N5ZA 5CQYA 4M77E 4AFSC 3FEOA 3BDLA 5GANg 1AWOA 3PNWC 2YRVA 1G3YA 2EFIA 4E7JA 4M7AB 4Z02A 3WXMB 4ANJA 1T0HA 3FDRA 3E2UA 1WHLA 4N0AC 1VQ9T 3QDFA 1M90C 1VQKA 2HMAA 1TXQA 2DTIA 4PJLA 3LWIA 2XK0A 1Q95G 4IUTA 1RAEB 3G4SA 3V8KA 2HKNA 3OYNA 4PJNA 1M3CA 3S6WA 1N9RA 1HYOA 2KYMA 1UFFA 1YJNA 4M7DE 5D6YA 2F2VA 1NLOC 5FLXE 4F7UA 1GRIA 3DB3A 5GAN6 4PKCC 2MOXA 1YHQT 2DD5A 4K11A 2OTJA 4E7HA 3CCQQ 3C94A 4M78B 2KROA 3CC4Q 1QVPA 2M0OA 3M57A 3CCJT 1YJ9Q 1M1GA 3M0RA 3PVQA 2DJQA 3SB2A 2PZ1A 4JPBW 5IXFA 2ZPHB 2JNGA 4WCIA 2LC4A 2LJ0A 2K2VA 1XTDA 3JV3A 2I0NA 3UPUA 1M2OA 2PQWA 4FIBA 3OYMA 1YITQ 3M0PA 5A2QE 3RMSA 3QUIA 4BY6B 1M30A 4X9DA 2ECZA 2E1HA 2ZAEA 3CPFA 1M1KR 3HSBA 4PFOA 2FZKB 4MMLA 3HKSA 3RR6A 3JB9D 2DTOA 4D6WA 4N4HA 2A7YA 1MV3A 3HTRA 1D3BA 4J6YA 2CDTA 4KH1B 1U1SA 5KE2A 1AWWA 3MO8A 3QWXX 1WX6A 1OEBA 2DXBA 2DVEA 5HK0A 3JB9G 4M75G 2RQTA 1V1CA 1FMVA 3NGPA 1TS9A 1BKBA 2DE0X 2MIOA 4M77A 2MWPA 4BE2A 1SPKA 2MMPA 2COZA 2XDPA 4R55A 2OTLA 2DBKA 4GLKA 3OYGA 3EGXA 1G3WA 1VQ6Q 2K5IA 3DLMA 4KGZB 1QVFS 5KYXB 4HT9A 3DLLA 4AMCA 4HCKA 2GTJA 4CC3A 2YHTA 4RTTA 4E7SA 1WPYA 1IRXA 1R0CB 2M02A 1QKXA 2QQSA 2K3BA 4XTZA 2RQRA 1JU5C 3GLXA 3RMQA 4FYVB 5ECAA 1BK2A 2RNAA 1CKAA 3QZ5B 4RCCA 4M7DA 1AWJA 1S72T 2NLUA 2X4YA 3EH1A 3VYGA 1VQLA 1UGSB 1UTIA 3CCSA 3OS2A 3GIBA 5AT1B 3JAME 2YUOA 3BW1A 4DOWA 3CPWP 3LX7A 4AFUC 2CH4W 4PFZA 4F7UG 3OYKA 1PKTA 4CRIA 5GAN8 2OX7A 4JJNK 5KYUB 1WJRA 1KQSS 3ZL7C 3G71T 2ZZDA 2M51A 1ZSZA 1NLPC 3CMAT 2G3RA 3QYGB 1OX9A 2BIVA 2GFUA 2DEUA 4HKEA 2A28A 4FSSA 2CP7A 4KT0E 1OI1A 1FYNA 4JJDA 1IGQA 2RB6A 2L3PA 2J7IA 3CMET 2ZPGB 4N4GA 3JCMh 1Q82C 4MZTA 2QAZA 1BI1A 1NZ9A 3THKA 1K73C 3L2UA 4X34A 2R58A 3OYHA 3OB9A 1WHHA 1ZUUA 3EHQA 2ROTA 3V7CA 2E3HA 4X1VA 5CK9A 1TG0A 3G6EQ 2EQJA 2L5QA 2DKGA 2KEAA 1YJWT 3MHXA 1RAIB 1M8VA 4ORZA 1MGQA 1BU1A 2DM1A 1M90U 1TU0B 3OS0A 4OGEA 3EG9B 4J83A 1AZGB 2KT8A 1VQKQ 2KAFA 4L5GA 4BB7A 3OW2P 4PK4A 2RK2A 2GTOA 2HBWA 3VS2A 2RQVA 5I2MA 3G4SQ 3CCLA 3RERA 1QCNA 4ZGEB 1KSWA 2FG0A 2QA4A 2CT4A 1ZUKA 4HVWA 5EC7A 2VGNA 3JCMJ 2C06A 4Y92A 4RTWA 3RKYA 2HL5C 2OTJQ 2CGHA 4AFZC 5IHKA 2QEXT 1M8MA 1M1FA 1WJSA 4CC7A 4KGVB 2FO0A 4E7LA 1KQ1A 2QQ9A 1QLYA 4J5YA 2FL7A 1Y71A 4J9EA 4JRIA 5GAN3 5CKDA 1DJ7B 1RAAB 4M7DD 4C8QD 1B34B 4DBFA 5LJ5g 3I56A 4XU3A 1UGVA 1LOJA 2E5KA 1D1AA 3CCET 2HL3A 2E10A 4LD6A 4XTUA 2MCNA 2X3XD 2M9UA 4Z8AA 4C5HA 1VQ4T 4RG2A 3PTAA 1UB4A 2RJEA 3ULRB 5DLQE 1B3QA 3E1SA 3VUZA 4M7DG 1KD1C 2LTOA 2GF7A 3G1JA 3MP6A 4JLGA 3CC7Q 4IUQA 2V8IA 2L8DA 3QDRB 3I55T 4IKFA 1HK9A 4XAXB 1QP3A 3A8HB 2J6FA 4OVAA 1QCFA 4MDWA 3CCMQ 4D8DA 4E47A 2YRCA 5KCOA 5KYXA 4RTUA 1NG2A 4ESRA 4N0AA 2EJGA 2CP5A 1N8RC 1T0JA 4FW1A 1NJIC 3VS5A 4RG8A 2FRWA 2W10A 3OS1A 1ARKA 1VQMA 3OW2A 2EGAA 2ZPBB 2H3EB 4A63B 2KGTA 1VIEA 4C92B 2KYBA 3NTKA 1D0ZA 3GF5A 3I35A 3J7AF 5C6SA 4ZGJB 2HNIA 4QW2A 4M7AF 4L6V5 1WJQA 1UGQB 2CH4A 3CEYA 1PHTA 4BI8B 4BI4A 1GCPA 2DRMA 4C8QC 2KRSA 1Q7YC 3LLRA 5FU7C 4RMOA 2E65A 2P0KA 4LDYA 3ER0A 1LNXA 1XOVA 4RUGA 4XK8E 1BCMA 1W6XA 1QQJA 5KYUA 2MYSA 1VQ9A 3F70A 2BE7D 1G83A 1RAFB 2DPPB 1JBMA 4ZNXA 1UDLA 1Y57A 4MZPA 4RTZA 2AZVA 2J06A 4X9CA 2LVMA 2FHDA 1ZSZC 3VU3C 2YRDA 2P4RA 2RJFA 4HT8A 1X6OA 1SRLA 1VQ7T 2PUOB 2CUDA 2VC8A 3P8DA 3EFOA 3Q1JA 3QWYA 3VS7A 5DLOA 2D8HA 2XICA 3M4GA 3QBYA 4M78F 5M9OA 1UJYA 2RHZA 3JCMQ 1YHQA 4QVZA 2LMJA 1MUZA 3CCVQ 3PMTA 1KC8C 4OB3B 3RBBB 5J3BA 4OMPA 3CCJA 5C0MA 2GBQA 2NWMA 3HRUA 3CBPA 3DKMA 1B7TA 2DNUA 5LL6S 2KI7A 2P0PA 4E7KA 4O5VA 2OAWA 4MDXA 3J81E 1YIJT 2JM9A 1PM3A 1ZA2B 5A0GA 2RMOA 2DIGA 1OQKA 2CP6A 4ELZC 3CC2T 1OU8A 2L89A 1UUEA 3PGGA 1M90R 3OSVA 5FROA 2HBPA 3LH5A 1VQNT 2DAQA 4A4KA 2RHYA 3OMGA 4YTLA 2COYA 3I5SA 1Q86C 1M3AA 2X4JA 2JS0A 1I07A 1V29B 2NUTA 2E6NA 1Z9ZA 4BY6C 2JT4A 4GY5A 1EIFA 3CCLQ 1A0NB 1EFNA 4RTXA 3H9NA 3PT9A 4HXJA 2HD0A 3L2WA 3A8LB 4LDWA 2HCKA 4BD3A 1QVGS 4NL2A 4KH0B 1E6GA 3R6OA 2IIMA 2COWA 1ZA1B 2BTTA 2SEMA 2LQNA 3BFMA 5CAIA 1GBRA 3S3OA 1IGUA 5HY6A 4EMKB 1YCYA 3KUFA 1RLPC 2CYZB 2CP2A 2JS2A 1IXDA 2CSIA 3MEUA 1K0SA 3CCQT 3I56Q 1PC0A 1WYXA 2RK1A 4C0DB 1RI0A 3VV0A 4B9XA 1SHFA 3SEMA 3REBB 1D0YA 2DK3A 2FPFA 2LJ3A 4DQ2A 5GMKj 1I0CA 4C5EA 2HSPA 4IURA 1VQ5T 3C4SA 1SF9A 1WXTA 5IHIA 3E19A 3KBGA 4BACA 2DMOA 1K1ZA 4M4ZA 3WVEB 2LQ8A 3JB9H 4DBRA 1S72A 1VQOT 1JO8A 2O4XB 4FM4B 1X01A 2JUFA 5GANd 1TH7A 3FC3A 4AT1B 3CBOA 2CZ1B 1JJ2P 2KVQG 2X51A 4EMGA 2YLCA 4C8QE 2Y4YA 2B86A 2QK0A 1FX7A 3G71A 3H0IA 2DILA 3M0QA 3CMAA 1PSFA 2E64A 3QSUA 2KMTA 1Y7XA 4II1A 2X3WD 1KJWA 4WTOB 2AIRB 4M7AE 3HFNA 2FB7A 2VKNA 2LRQA 1S1NA 4J9GA 3CMEA 1KHCA 1X69A 2QI2A 2PNIA 1M4ZA 1WQ7A 1WZOA 5GAOr 2HAXA 2DEQA 3VS6A 3JCMb 5A0DA 1H3ZA 1OOTA 1C6VX 3JCMg 1NE8A 1UG1A 1K8AU 1Q7YU 4XQ3A 3EH2A 1O9SA 1D1BA 1YJWA 4XU1A 1GL5A 4CC2A 2QXFA 1YWPA 3S3MA 3MPUB 2LT1A 4J6WA 2ABLA 1VYTA 3M0UA 2XD0A 5I2SA 5HCKA 5J26A 1V76A 3P8BB 3IQLA 2L3SA 2FVUA 2NUPA 2BZ8A 4C5IA 4NL3A 2O2OA 1ZUYA 2ZPEB 1QCOA 4JJCA 4ATOA 2V1RA 3X26B 4PJMA 5GMKh 3WVDB 5IAYA 3SWNA 1H8KA 2KR3A 2WACA 1D1CA 2W0ZA 1AD5A 1WHKA 1SSFA 3META 2QQRA 3TEEA 1YHQQ 2VYTA 4Q5WA 2DX1A 3MEVA 2DL8A 2EQIA 2K9GA 2QEXA 4QT7A 1OZ3A 2KK4A 2CUBA 1JJ2A 5KYYB 3CCJQ 2VB6A 1ZBJA 4JDSA 1YI2Q 1FWZA 2AK5A 4IUVA 2EYZA 1X6GA 3L2QA 1QMCA 1K9MU 2LCCA 1PNJA 3VS1A 1CSKA 3CCUT 2CZ7B 2LDMA 3CCEA 3RNJA 2XU8A 2YSQA 1PWTA 1VQ4A 2IVWA 3CPWS 3JCMc 3CCRT 1IHVA 1Y0MA 2LCLA 9ATCB 2DO3A 2QTXA 5KYWA 1XQHA 4M75F 1Q86U 1WI7A 1WFWA 2J6OA 5CKBA 2RQWA 3OYEA 3I55A 4C8QA 1W2BS 1N6AA 5FWBA 3G6ET 4PJOF 5GMKl 1AHJB 1SHGA 1VQPT 3DB4A 2B8AA 2XDDA 1GFDA 2KBTA 1UEBA 4PFPA 3OYAA 1PG5B 2JMCA 2RI2A 1QVFP 3HRTA 2GGRA 2A36A 1Y07A 3LW5E 4M7AA 2QQBA 4C92F 2EKOA 5CQXA 1G8XA 2VGMA 4CI0C 2FEIA 1LVKA 2V1QA 2QASA 2MF2A 4PNOA 2EYXA 6AT1B 2OI3A 4N4IA 4E7ZA 3CD6Q 1IB8A 3M59A 1BYMA 2M16A 1WHMA 1FMWA 4QQGA 1U1TA 4BE0A 1C0MA 2ZCFB 4F04B 4OB0B 2E6ZA 4Z88A 4C92C 1TUCA 3NTIA 1VYVA 3MKDA 4RCBA 5FW9A 5GAOl 4FL6A 4JS5A 5CKHA 3VYHB 1OV3A 3QXEB 4A4HA 2C0IA 2CS7A 2RH2A 1M2VB 4JZ3A 2LT4A 2CT3A 1KQSP 1MHNA 4J8OA 3RESA 1W4SA 4C5GA 3C0CA 3HHTB 4M78A 4NOYA 4DA4A 4XU0A 1NPRA 1WHJA 3N5BB 4ZN3A 1S72Q 2XMFA 1MV0B 1VQ7A 2VXEA 2YT6A 2EGCA 1G3SA 4HA8A 1GCQC 1K0XA 1X2KA 3CC7T 3L1AA 1YJNQ 1QP2A 4LE9A 1YNZA 2EQKA 3CCMT 1M9SA 3KXTA 3M55A 3CMAQ 1Y96B 3AHUA 1NEGA 2CZ6B 1PD0A 2AHJB 4FSXA 3NFCA 2E12A 5GANf 1QVFA 2QDLA 4WF2A 3C95A 3M5AA 4C0ZA 3VS0A 3JCMV 2MK5A 4O6JA 1YIJA 1K8AR 1Q7YR 2MI6A 3EGDB 4J9DA 4OMOA 3JRZA 4JRKA 5FWCA 1BIBA 1RADB 2DFUA 4DEXA 3OYFA 1R8OB 3CC2A 2O88A 1RLQC 2EAYA 1XNIA 3OBYA 4M7AD 5D6XA 2DF6A 1YJWQ 1VQNA 2C0TA 4C8QG 4M77F 3SWNC 2VWFA 1OPKA 3LGFA 1BCOA 1VYUA 5GMKe 1OYXA 2K6DA 1T3LA 2K7AA 5IHNA 1IHWA 4M75B 4HCCA 4EPCA 3X24B 1VQ8T 3NMZC 2FPDA 4LDXA 2LNVA 1OZ2A 2ZGWA 4M7AG 2EW3A 1U8RA 3L42A 3CXCP 4PJOB 2X35A 3REAB 5LJ5d 1KQSA 2EYWA 2RHUA 3EG1A 4J7FA 2JJ9A 1WGSA 1YWOA 3E9GA 1BB9A 4FW2A 4JUVA 4RKUE 3PMIA 2ATCB 5CKFA 5GAN7 3H8ZA 3M9QA 3VRZA 2QEXQ 1K9MR 2OTLQ 4RTYA 5FU6C 5LJ3d 2FRYA 5I11A 2QDYB 4A54A 2EKHA 3PFSA 4M78D 1YBYA 3CCVT 5GANe 2E3IA 3BY7A 1ZX6A 2DBMA 2JMAA 4R0KA 1U06A 3CCQA 3BDUA 1N9SA 2O31A 4MZMA 1EX4A 2O9VA 1G2BA 1I4K1 5GAMd 2V8JA 3CCEQ 5LJ3j 4EMKC 2BE9B 3TVTA 1LCKA 3ASKA 3S3NA 2A0FB 1VQ4Q 1Q86R 3MJXA 1HSQA 1VQ5A 3X28B 1LPLA 4M78G 4R56A 5CKEA 1VIFA 4M7AC 5HK3A 5GAMj 4C0DC 2OJ2A 4F7UB 2FYKA 1FXXA 1MMAA 3I55Q 2YLBA 2CSQA 1VQOA 2D6FA 2AT1B 1VQLQ 3CCSQ 4FCYA 2HQHA 3E9FA 4QVDA 3PIOA 3GBQA 4C92E 1PCXA 3NTHA 1Q81C 2P0QA 1I5OB 4OB1B 4HCZA 2EYQA 5GJVB 2P84A 3QJYA 1JB0E 1K9AA 5GAN4 2CREA 2RI3A 2RPNA 4KGXB 4LN2A 1UHFA 2GCXA 3M4YA 1SRMA 1TSFA 3VRYA 5I22A
chains in the Genus database with same CATH topology
2RQRA 1JU5C 4J9FA 2O9SA 2JTEA 4F17A 2ESWA 2D1XA 2EVRA 5ECAA 1BK2A 2RNAA 1CKAA 2B86A 1JEGA 3H0IA 2M0YA 2KE9A 2DILA 1AWJA 1ABQA 3M0QA 1CKBA 1UTIA 1AVZC 4KRTA 2DYBA 2KXDA 2YUOA 2X3WD 1KJWA 4DEYA 1FMKA 2DVJA 1AOJA 4AFUC 2CH4W 2VKNA 1S1NA 1UE9A 4J9GA 1JXOA 1X69A 3PE0A 1PKTA 2PNIA 2A08A 2LX7A 2LP5A 2YUQA 3VS6A 3ZL7C 1K76A 4E6RA 1E7OA 2M51A 1NLPC 2K2MA 1OOTA 3I9QA 1UG1A 1NYGA 1X6BA 2A28A 4FSSA 1H3HA 1GFCA 1FYNA 2L2PA 4JJDA 1B07A 3PVLA 2D8JA 2L3PA 1K4US 2J7IA 2F2WA 4J9IA 1GL5A 4CC2A 1YWPA 4OMQA 1TUDA 4Z89A 2AZSA 3THKA 2ABLA 3O5ZA 3I5RA 1VYTA 3M0UA 5HCKA 1ZLMA 3IQLA 1ZUUA 2L3SA 3EHQA 2BZ8A 2ROTA 1HJDA 2J05A 4X1VA 1TG0A 2O2OA 1ZUYA 2DA9A 2KEAA 4JJCA 2V1RA 4AG2C 4ORZA 2DM1A 1BU1A 2D0NA 1H8KA 2KR3A 3SHWA 3H41A 1AEYA 2HDAA 2W0ZA 2KT1A 1AD5A 2HEQA 1AZGB 1GBQA 1QWFA 2KT8A 2ED0A 1ZSGA 3A98A 2A37A 1YN8A 2GTOA 2HBWA 3VS2A 2RQVA 2DX1A 5I22A 1Z9QA 3EHRA 1KIKA 2DL8A 2EQIA 2K9GA 2YUNA 4QT7A 2EGEA 1PRMC 1KSWA 1RUWA 2CUBA 2FG0A 3H0HA 2KXCA 1ZBJA 2RQUA 2CT4A 1ZUKA 2AK5A 2EYZA 1X6GA 4HVWA 5EC7A 4F16A 1PNJA 3VS1A 1CSKA 4Y92A 4JZ4A 3R6NA 1BBZA 4RTWA 3RNJA 3EG3A 2L0AA 4IIMA 2ROLA 4AFZC 5IHKA 1M8MA 2YSQA 1PWTA 3CQTA 4CC7A 1Y0MA 2NUZA 4J9HA 1E6HA 2FO0A 1QLYA 4J9EA 2JXBA 3VS3A 4GLMA 3UATA 1WI7A 4IIOA 1WFWA 2J6OA 1UGVA 2RQWA 2E5KA 5GJWB 5FWBA 1JQQA 1QKWA 1SHGA 2MCNA 2EBPA 2X3XD 2LJ1A 4Z8AA 1W1FA 3EG2A 2DL5A 1GFDA 2KBTA 2FPEA 1GCQA 1WIEA 2JMCA 1B3QA 3ULRB 1M3BA 2GGRA 2A36A 4J9CA 1WLPB 1T3SA 2C0OA 2KNBB 1PRLC 1KFZA 2DLPA 1WDXA 3EG0A 1W70A 2J6FA 1QCFA 2FEIA 1WXUA 2V1QA 4D8DA 4LUEA 2KRNA 1H92A 1J3TA 4OMMA 1UJ0A 2EYXA 4RTUA 1NG2A 4ESRA 2OI3A 3FJ5A 1T0JA 2ENMA 3VS5A 2LZ6B 2FRWA 2W10A 1QWEA 1ARKA 2DL3A 2EGAA 4OMLA 1RI9A 2LQWA 4Z88A 1TUCA 5L23A 4A63B 3M0SA 2KGTA 3H0FA 2DL7A 1VYVA 2KYBA 5FW9A 4F14A 1I1JA 3U23A 1OV3A 3I35A 1OPLA 2C0IA 4JZ3A 4GBQA 1NEBA 2CT3A 3TSZA 2CH4A 4EIKA 3C0CA 2PTKA 1PHTA 1ABOA 2J6KA 5IH2A 1GCPA 2DRMA 2F2XA 2VVKA 2KRSA 1NM7A 2XMFA 1MV0B 2GNCA 2G6FX 4LNPA 1XOVA 2DRKA 4RUGA 1SSHA 1W6XA 4JJBA 1N5ZA 2YT6A 2EGCA 4AFSC 1K0XA 1GCQC 1X2KA 1G83A 4CC4B 4ZNXA 1AWOA 1X2QA 1UDLA 1Y57A 4LE9A 4RTZA 2AZVA 2J06A 1YNZA 2AKLA 2LNHB 2P4RA 5IXBA 1NEGA 1SRLA 1T0HA 2CUDA 1M27C 2QDLA 3QWYA 1HD3A 3VS7A 3VS4A 2D8HA 3VS0A 4HVVA 1X43A 3EGUA 3UA6A 1NYFA 1UJYA 2LMJA 1MUZA 2SRCA 4LUDA 4J9DA 4D8KA 4OMOA 5FWCA 4DEXA 3RBBB 1M3CA 4AFQC 2O88A 1RLQC 4OMPA 4AG1C 2KYMA 2GBQA 2NWMA 2DNUA 1UFFA 1UHCA 2DF6A 2F2VA 1NLOC 2C0TA 2OAWA 1GRIA 2VWFA 3M0TA 2JM9A 1OPKA 1VA7A 2MOXA 2ED1A 3NHNA 4J9BA 2BZXA 1VYUA 4K11A 2K6DA 2RMOA 2GQIA 1T3LA 2K7AA 2JM8A 5IHNA 3NPFA 2KROA 1UUEA 3NMZC 2FPDA 3KFVA 3M0RA 3PVQA 2DJQA 2EW3A 3LH5A 3REAB 2PZ1A 4JPBW 5IXFA 2EYYA 1PKSA 2EYWA 3EG1A 3I5SA 4WCIA 2LJ0A 1M3AA 2JS0A 3JV3A 2I0NA 1YWOA 1I07A 1BB9A 1Z9ZA 1AWXA 3UA7A 1X27A 2JT4A 3M0PA 1U5SA 3VRZA 1A0NB 1EFNA 1M30A 4RTXA 2LCSA 2AKKA 2ECZA 4RTYA 4OMNA 4HXJA 1YP5A 2FRYA 5I11A 2EKHA 2HCKA 2L3QA 1ZX6A 2DBMA 2JMAA 4R0KA 1U06A 1UECA 1MV3A 2O31A 1E6GA 2H8HA 2IIMA 2CDTA 2O9VA 1G2BA 2K79A 2KRMA 1U3OA 2BTTA 2BZYA 2RF0A 2SEMA 2LQNA 1AWWA 2JW4A 3QWXX 1WX6A 1WXBA 1YCSB 1GBRA 3TVTA 1LCKA 1HSQA 1OEBA 2YDLA 1SEMA 1RLPC 2RQTA 1V1CA 2JS2A 3NGPA 1AZEA 2CSIA 2DE0X 2MIOA 1K0SA 2OJ2A 1SPKA 2CSQA 1WYXA 2YUPA 1SHFA 3SEMA 3REBB 1JXMA 2FPFA 2LJ3A 1I0CA 2RN8A 2DBKA 2HSPA 3GBQA 1WXTA 3UF4A 2EPDA 5IHIA 2DMOA 5GJVB 1K1ZA 4HCKA 4M4ZA 4RTVA 2GTJA 4HVUA 4CC3A 1K9AA 1WA7A 2CREA 1IO6A 4RTTA 2RPNA 4LN2A 1UHFA 1QKXA 1SRMA 1JO8A 2K3BA 3VRYA 3TSWA 2DL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQR A;  1JU5 C;  4J9F A;  2O9S A;  2JTE A;  4F17 A;  2ESW A;  2D1X A;  2EVR A;  5ECA A;  1BK2 A;  2RNA A;  1CKA A;  2B86 A;  1JEG A;  3H0I A;  2M0Y A;  2KE9 A;  2DIL A;  1AWJ A;  1ABQ A;  3M0Q A;  1CKB A;  1UTI A;  1AVZ C;  4KRT A;  2DYB A;  2KXD A;  2YUO A;  2X3W D;  1KJW A;  4DEY A;  1FMK A;  2DVJ A;  1AOJ A;  4AFU C;  2CH4 W;  2VKN A;  1S1N A;  1UE9 A;  4J9G A;  1JXO A;  1X69 A;  3PE0 A;  1PKT A;  2PNI A;  2A08 A;  2LX7 A;  2LP5 A;  2YUQ A;  3VS6 A;  3ZL7 C;  1K76 A;  4E6R A;  1E7O A;  2M51 A;  1NLP C;  2K2M A;  1OOT A;  3I9Q A;  1UG1 A;  1NYG A;  1X6B A;  2A28 A;  4FSS A;  1H3H A;  1GFC A;  1FYN A;  2L2P A;  4JJD A;  1B07 A;  3PVL A;  2D8J A;  2L3P A;  1K4U S;  2J7I A;  2F2W A;  4J9I A;  1GL5 A;  4CC2 A;  1YWP A;  4OMQ A;  1TUD A;  4Z89 A;  2AZS A;  3THK A;  2ABL A;  3O5Z A;  3I5R A;  1VYT A;  3M0U A;  5HCK A;  1ZLM A;  3IQL A;  1ZUU A;  2L3S A;  3EHQ A;  2BZ8 A;  2ROT A;  1HJD A;  2J05 A;  4X1V A;  1TG0 A;  2O2O A;  1ZUY A;  2DA9 A;  2KEA A;  4JJC A;  2V1R A;  4AG2 C;  4ORZ A;  2DM1 A;  1BU1 A;  2D0N A;  1H8K A;  2KR3 A;  3SHW A;  3H41 A;  1AEY A;  2HDA A;  2W0Z A;  2KT1 A;  1AD5 A;  2HEQ A;  1AZG B;  1GBQ A;  1QWF A;  2KT8 A;  2ED0 A;  1ZSG A;  3A98 A;  2A37 A;  1YN8 A;  2GTO A;  2HBW A;  3VS2 A;  2RQV A;  2DX1 A;  5I22 A;  1Z9Q A;  3EHR A;  1KIK A;  2DL8 A;  2EQI A;  2K9G A;  2YUN A;  4QT7 A;  2EGE A;  1PRM C;  1KSW A;  1RUW A;  2CUB A;  2FG0 A;  3H0H A;  2KXC A;  1ZBJ A;  2RQU A;  2CT4 A;  1ZUK A;  2AK5 A;  2EYZ A;  1X6G A;  4HVW A;  5EC7 A;  4F16 A;  1PNJ A;  3VS1 A;  1CSK A;  4Y92 A;  4JZ4 A;  3R6N A;  1BBZ A;  4RTW A;  3RNJ A;  3EG3 A;  2L0A A;  4IIM A;  2ROL A;  4AFZ C;  5IHK A;  1M8M A;  2YSQ A;  1PWT A;  3CQT A;  4CC7 A;  1Y0M A;  2NUZ A;  4J9H A;  1E6H A;  2FO0 A;  1QLY A;  4J9E A;  2JXB A;  3VS3 A;  4GLM A;  3UAT A;  1WI7 A;  4IIO A;  1WFW A;  2J6O A;  1UGV A;  2RQW A;  2E5K A;  5GJW B;  5FWB A;  1JQQ A;  1QKW A;  1SHG A;  2MCN A;  2EBP A;  2X3X D;  2LJ1 A;  4Z8A A;  1W1F A;  3EG2 A;  2DL5 A;  1GFD A;  2KBT A;  2FPE A;  1GCQ A;  1WIE A;  2JMC A;  1B3Q A;  3ULR B;  1M3B A;  2GGR A;  2A36 A;  4J9C A;  1WLP B;  1T3S A;  2C0O A;  2KNB B;  1PRL C;  1KFZ A;  2DLP A;  1WDX A;  3EG0 A;  1W70 A;  2J6F A;  1QCF A;  2FEI A;  1WXU A;  2V1Q A;  4D8D A;  4LUE A;  2KRN A;  1H92 A;  1J3T A;  4OMM A;  1UJ0 A;  2EYX A;  4RTU A;  1NG2 A;  4ESR A;  2OI3 A;  3FJ5 A;  1T0J A;  2ENM A;  3VS5 A;  2LZ6 B;  2FRW A;  2W10 A;  1QWE A;  1ARK A;  2DL3 A;  2EGA A;  4OML A;  1RI9 A;  2LQW A;  4Z88 A;  1TUC A;  5L23 A;  4A63 B;  3M0S A;  2KGT A;  3H0F A;  2DL7 A;  1VYV A;  2KYB A;  5FW9 A;  4F14 A;  1I1J A;  3U23 A;  1OV3 A;  3I35 A;  1OPL A;  2C0I A;  4JZ3 A;  4GBQ A;  1NEB A;  2CT3 A;  3TSZ A;  2CH4 A;  4EIK A;  3C0C A;  2PTK A;  1PHT A;  1ABO A;  2J6K A;  5IH2 A;  1GCP A;  2DRM A;  2F2X A;  2VVK A;  2KRS A;  1NM7 A;  2XMF A;  1MV0 B;  2GNC A;  2G6F X;  4LNP A;  1XOV A;  2DRK A;  4RUG A;  1SSH A;  1W6X A;  4JJB A;  1N5Z A;  2YT6 A;  2EGC A;  4AFS C;  1K0X A;  1GCQ C;  1X2K A;  1G83 A;  4CC4 B;  4ZNX A;  1AWO A;  1X2Q A;  1UDL A;  1Y57 A;  4LE9 A;  4RTZ A;  2AZV A;  2J06 A;  1YNZ A;  2AKL A;  2LNH B;  2P4R A;  5IXB A;  1NEG A;  1SRL A;  1T0H A;  2CUD A;  1M27 C;  2QDL A;  3QWY A;  1HD3 A;  3VS7 A;  3VS4 A;  2D8H A;  3VS0 A;  4HVV A;  1X43 A;  3EGU A;  3UA6 A;  1NYF A;  1UJY A;  2LMJ A;  1MUZ A;  2SRC A;  4LUD A;  4J9D A;  4D8K A;  4OMO A;  5FWC A;  4DEX A;  3RBB B;  1M3C A;  4AFQ C;  2O88 A;  1RLQ C;  4OMP A;  4AG1 C;  2KYM A;  2GBQ A;  2NWM A;  2DNU A;  1UFF A;  1UHC A;  2DF6 A;  2F2V A;  1NLO C;  2C0T A;  2OAW A;  1GRI A;  2VWF A;  3M0T A;  2JM9 A;  1OPK A;  1VA7 A;  2MOX A;  2ED1 A;  3NHN A;  4J9B A;  2BZX A;  1VYU A;  4K11 A;  2K6D A;  2RMO A;  2GQI A;  1T3L A;  2K7A A;  2JM8 A;  5IHN A;  3NPF A;  2KRO A;  1UUE A;  3NMZ C;  2FPD A;  3KFV A;  3M0R A;  3PVQ A;  2DJQ A;  2EW3 A;  3LH5 A;  3REA B;  2PZ1 A;  4JPB W;  5IXF A;  2EYY A;  1PKS A;  2EYW A;  3EG1 A;  3I5S A;  4WCI A;  2LJ0 A;  1M3A A;  2JS0 A;  3JV3 A;  2I0N A;  1YWO A;  1I07 A;  1BB9 A;  1Z9Z A;  1AWX A;  3UA7 A;  1X27 A;  2JT4 A;  3M0P A;  1U5S A;  3VRZ A;  1A0N B;  1EFN A;  1M30 A;  4RTX A;  2LCS A;  2AKK A;  2ECZ A;  4RTY A;  4OMN A;  4HXJ A;  1YP5 A;  2FRY A;  5I11 A;  2EKH A;  2HCK A;  2L3Q A;  1ZX6 A;  2DBM A;  2JMA A;  4R0K A;  1U06 A;  1UEC A;  1MV3 A;  2O31 A;  1E6G A;  2H8H A;  2IIM A;  2CDT A;  2O9V A;  1G2B A;  2K79 A;  2KRM A;  1U3O A;  2BTT A;  2BZY A;  2RF0 A;  2SEM A;  2LQN A;  1AWW A;  2JW4 A;  3QWX X;  1WX6 A;  1WXB A;  1YCS B;  1GBR A;  3TVT A;  1LCK A;  1HSQ A;  1OEB A;  2YDL A;  1SEM A;  1RLP C;  2RQT A;  1V1C A;  2JS2 A;  3NGP A;  1AZE A;  2CSI A;  2DE0 X;  2MIO A;  1K0S A;  2OJ2 A;  1SPK A;  2CSQ A;  1WYX A;  2YUP A;  1SHF A;  3SEM A;  3REB B;  1JXM A;  2FPF A;  2LJ3 A;  1I0C A;  2RN8 A;  2DBK A;  2HSP A;  3GBQ A;  1WXT A;  3UF4 A;  2EPD A;  5IHI A;  2DMO A;  5GJV B;  1K1Z A;  4HCK A;  4M4Z A;  4RTV A;  2GTJ A;  4HVU A;  4CC3 A;  1K9A A;  1WA7 A;  2CRE A;  1IO6 A;  4RTT A;  2RPN A;  4LN2 A;  1UHF A;  1QKX A;  1SRM A;  1JO8 A;  2K3B A;  3VRY A;  3TSW A;  2DL4 A; 
#chains in the Genus database with same CATH topology
 3CXC A;  4B9W A;  4TVR A;  3RKX A;  5CIU A;  2JTE A;  3EG9 A;  4F17 A;  2ESW A;  2EVR A;  2DD4 A;  2EWN A;  1Q82 U;  4LDV A;  2M0Y A;  1NBE B;  2KE9 A;  1K73 U;  8ATC B;  2KQW A;  4M78 C;  1CKB A;  1F1B B;  2RO0 A;  4KRT A;  4KUD K;  2DYB A;  2KXD A;  2QG9 B;  2KSS A;  1D3B B;  4QQD A;  1FMK A;  1YFN A;  1TUG B;  5D6W A;  1JXO A;  3D7S B;  4MMK A;  4FYX B;  4XTV A;  2A08 A;  2QTV A;  2LP5 A;  2YUQ A;  3VKI A;  3OMC A;  5FRM A;  3I9Q A;  1X6B A;  3HPW A;  4E2F B;  4M77 B;  3L2V A;  1GFC A;  2K5F A;  1TWB A;  1B07 A;  3PVL A;  1WQW A;  1OUL A;  5LJ3 h;  2OAU A;  4DOV A;  1B34 A;  2MPX C;  4J9I A;  4C0F A;  1I5L A;  5DY9 A;  4OMQ A;  1TUD A;  3JSC A;  2QA4 Q;  3EGX B;  4V2S A;  4VUB A;  4B6M A;  2F5T X;  1ZLM A;  5GAM h;  1RAC B;  1HJD A;  3OA6 A;  2J05 A;  4DBH A;  2FZG B;  2DXC A;  1BI2 A;  4JRP A;  3V7R A;  2V8K A;  2R5M A;  5DM7 R;  2VUB A;  2LQK A;  2MAM A;  3H41 A;  1AEY A;  2HDA A;  3UWN A;  3M53 A;  2HEQ A;  1YIJ Q;  1GBQ A;  1QWF A;  1ZSG A;  3CCU A;  1BIA A;  2WSF E;  8AT1 B;  4XTY A;  3QHS A;  3EHR A;  3CC4 T;  2DXU A;  3H6Z A;  2GFA A;  4M7D B;  2EGE A;  3TRE A;  1YJ9 T;  1RUW A;  3CCR A;  4FYY B;  3H0H A;  1I8F A;  2KDS A;  3LH0 A;  5GAO p;  1JJ2 S;  3MCA B;  1VQN Q;  4ZTF A;  2O01 E;  3A8M B;  3TCJ A;  1KD1 U;  4F16 A;  2R5A A;  2WSC E;  4C92 A;  4OGC A;  1QVG P;  1YIT T;  4JZ4 A;  3R6N A;  4QKU A;  2KY9 A;  4JLI A;  3G6E A;  1VQP A;  3EG3 A;  1ZSZ B;  2JZ2 A;  1EZZ B;  3JCM W;  3CQT A;  2CP3 A;  1N27 A;  2NUZ A;  4J9H A;  3QO3 A;  3FB9 A;  1N8R U;  1NJI U;  3J80 E;  2DTH A;  4PLL A;  4IIO A;  2Y4X A;  1HXD A;  5GJW B;  1VQM Q;  5GMK i;  1WNL A;  3JCM X;  5GAN j;  4L59 A;  3JB9 J;  2EBP A;  2LJ1 A;  2EJF A;  1W1F A;  3EG2 A;  2DL5 A;  3HFO A;  4KUL A;  3V8J A;  2YWW A;  1GCQ A;  1WIE A;  3QKJ A;  1VOM A;  3MP8 A;  5LJ5 f;  1UGR B;  3TU4 K;  3OYY A;  2L3R A;  4JS4 A;  4ELY C;  4LD9 K;  1WLP B;  1T3S A;  2C0O A;  2KNB B;  1PRL C;  1KFZ A;  1WDX A;  4PJJ A;  5GAO n;  4BDY A;  1WXU A;  2QGG A;  5GMK m;  3OYJ A;  4LUE A;  2KRN A;  1H92 A;  1YI2 T;  1RAH B;  1VQ6 T;  4A4E A;  1D0X A;  5LJ3 f;  2ENM A;  4EDU A;  1ZHI A;  1VQ5 Q;  1VQ9 Q;  5CO7 A;  1QWE A;  3GOX A;  5HKC A;  2DL3 A;  4OML A;  2QQA A;  3RDV A;  2F69 A;  1JRI A;  5GAM f;  1RAG B;  3ME9 A;  4Y91 A;  4F14 A;  2DZ9 A;  1VQO Q;  1I1J A;  3U23 A;  3OYD A;  1OPL A;  4M78 E;  3CC7 A;  1Q81 U;  2K57 A;  4M75 D;  3SD4 A;  2IG0 A;  3JCM d;  1QVG A;  3TSZ A;  3JCM P;  4EIK A;  5CVI A;  3HRS A;  2PTK A;  2J6K A;  3CCM A;  4PJO D;  2F2X A;  3GNF B;  3UT1 A;  1XJW B;  2VVK A;  3GPL A;  1KC8 U;  2CZ0 B;  2GNC A;  2X4W A;  4LNP A;  5GAO m;  2DRK A;  3QII A;  1Q82 R;  1KK7 A;  2PU9 B;  2HSE B;  1K73 R;  2PVG B;  2CP0 A;  4C92 D;  4CC4 B;  2RI5 A;  3FRN A;  3OS5 A;  3OYI A;  1X2Q A;  2CKK A;  3V8L A;  5LJ5 e;  4PJO G;  2JOY A;  2AKL A;  2LNH B;  4BDZ A;  4BE1 A;  5IXB A;  2K4Y A;  2D0Q B;  5GAN h;  1KHI A;  3CD6 T;  1M27 C;  1HD3 A;  1TTH B;  2P4T A;  3VS4 A;  4BUG A;  2I2L A;  2XHC A;  4C92 G;  4HVV A;  1X43 A;  3EGU A;  3RKW A;  2E41 A;  3X20 B;  3JB9 F;  3UA6 A;  1NYF A;  4HCB A;  2SRC A;  3EFS A;  2K3Y A;  3HL8 A;  4LUD A;  2JTF A;  5LJ3 e;  3LWH A;  4D8K A;  3P8H A;  3M54 A;  3ZEH A;  4C0G A;  1TOV A;  4EMK A;  1VQ8 A;  4AFQ C;  4AG1 C;  2EJ9 A;  3UDC A;  5IN1 A;  3OY9 A;  1UHC A;  5GAM e;  4ZTJ A;  2EIF A;  1M1K C;  1VQK T;  3M0T A;  1VA7 A;  3NHN A;  2ED1 A;  4J9B A;  2BZX A;  4M75 C;  3G4S T;  2GQI A;  3JB9 I;  2JM8 A;  1QW1 A;  3NPF A;  4XU2 A;  4PJO C;  5I21 A;  3KFV A;  3QPH A;  4LXC A;  4OB2 B;  1YJN T;  3A5Z B;  4LDU A;  2EYY A;  1PKS A;  3M56 A;  2RA2 A;  5L8R E;  2MWO A;  3CCV A;  4QQ6 A;  2D9T A;  4E7I A;  2JVV A;  2O4X A;  3OW2 S;  1W2B P;  2OTJ T;  3CCU Q;  1AWX A;  1LJO A;  3UA7 A;  1X27 A;  2PUK B;  1U5S A;  2LCS A;  2AKK A;  1GXI E;  1KD1 R;  3CCR Q;  4OMN A;  1YP5 A;  3X25 B;  2RD1 A;  4F7U F;  3EFO B;  1AT1 B;  5GAN 5;  2L3Q A;  2DER A;  1BI0 A;  1UEC A;  4KUI A;  4FYW B;  2H8H A;  2K79 A;  2KRM A;  4BI3 A;  1U3O A;  2BZY A;  2YXY A;  2RF0 A;  1PD1 A;  2JW4 A;  2RM4 A;  1N8R R;  5A0L A;  1NJI R;  1WXB A;  1YCS B;  1VQP Q;  3EAE A;  5AYF A;  7AT1 B;  2YDL A;  1C1A A;  2DIQ A;  1ZQ1 A;  1SEM A;  2E4H A;  4FT4 A;  5KH6 A;  4M77 D;  3M58 A;  1AZE A;  4QVC A;  3EFR A;  3G71 Q;  1VUB A;  3TQ7 P;  5KYN A;  3RIR A;  2YUP A;  2V26 A;  3OYC A;  1JXM A;  4UC4 A;  2RN8 A;  3BE3 A;  3UF4 A;  3L2Z A;  2EPD A;  5FRN A;  4M77 G;  1KQ2 A;  3QG1 A;  3CME Q;  2QYZ A;  4A53 A;  4RTV A;  4HVU A;  1WA7 A;  2E70 A;  1IO6 A;  2RHI A;  2HZY A;  2DET A;  4OF1 A;  3MP1 A;  5EG2 A;  3CPW A;  1MMG A;  2OTL T;  2NUT B;  3TSW A;  2DL4 A;  4Y28 E;  4J9F A;  2O9S A;  2DJZ A;  3VUB A;  3CXC S;  3GNG A;  3SDZ A;  2D1X A;  2IPO B;  4XTW A;  3FIF A;  2ZPI B;  1JEG A;  1G5V A;  1W2B A;  1RAB B;  2K5L A;  1ABQ A;  4JRQ A;  2XID A;  1D09 B;  1G3T A;  4PL6 A;  1WHG A;  4J7I A;  1AVZ C;  5KYY A;  4FT2 A;  2VAS A;  2H3J A;  4DEY A;  1Q81 R;  3FJP A;  2DVJ A;  1AOJ A;  1UE9 A;  3PE0 A;  2DYI A;  2XG8 D;  2LX7 A;  2HQE A;  1OX8 A;  5LJ3 g;  2DXT A;  1KC8 R;  1K76 A;  2BUD A;  4E6R A;  4ZGD B;  3A8O B;  1E7O A;  4M77 C;  1NPP A;  2K2M A;  4NS5 A;  4OP0 A;  1NYG A;  1VQL T;  3CCS T;  3SFM A;  4ME7 A;  1MMD A;  1H3H A;  2L2P A;  4IUU A;  3LYI A;  5LJ5 j;  3OYB A;  2D8J A;  5GAM g;  3T9N A;  1K4U S;  2HQX A;  2F2W A;  2Y90 A;  3A8G B;  2VXF A;  1I81 A;  2DZC A;  2EQM A;  3QZ9 B;  4Z89 A;  1MND A;  2AZS A;  3JCM f;  3O5Z A;  3I5R A;  4C8Q F;  4M7D F;  1PSE A;  2HKQ B;  2E5Q A;  4OMF B;  3CC4 A;  1YJ9 A;  2DA9 A;  4A4G A;  2R57 A;  2XKO C;  4AG2 C;  4M75 E;  5D7U A;  2D0N A;  3FLG A;  3SHW A;  4DBQ A;  2KT1 A;  5CCA A;  1IRE B;  2ED0 A;  1YIT A;  3A98 A;  4PJO E;  4M7D C;  2A37 A;  1YN8 A;  1K8A C;  2A3L A;  1Z9Q A;  2F5K A;  1KIK A;  2YUN A;  1PRM C;  4EMH A;  4A4F A;  1MMN A;  5IT9 E;  1VQ8 Q;  5CR2 A;  2F1L A;  1X75 C;  2QGF B;  2KXC A;  2RQU A;  2M1H A;  3GP8 A;  3OSS C;  2X4X A;  2FZC B;  1R77 A;  1IZ6 A;  1M1K U;  3CBM A;  5GAO q;  4IUP A;  5KE3 A;  1BBZ A;  1P92 A;  3INZ A;  2JN0 A;  3CCL T;  2Z0W A;  3ZBD A;  2L0A A;  4IIM A;  2ROL A;  1H64 1;  1M2V A;  4XTX A;  2EQU A;  3V7S A;  1M5Q 1;  1E6H A;  1UGP B;  2BKD N;  3L2R A;  2QA4 T;  2JXB A;  3VS3 A;  4GLM A;  3UAT A;  3VJP A;  3O8V A;  3OBW A;  1O75 A;  3LGL A;  2ZPF B;  3G7Z A;  1JQQ A;  1QKW A;  3JCM e;  1SKU B;  1SG5 A;  3OQ5 A;  4PLI A;  2NUP B;  4F7U E;  1ZBX A;  2X9H A;  1YI2 A;  1VQ6 A;  2FPE A;  5LJ5 h;  1MNE A;  2RHX A;  1M3B A;  2LX9 A;  1K9M C;  2XDB A;  3QJ6 A;  3C12 A;  4J9C A;  2K3X A;  3I56 T;  1BI3 A;  3SWN B;  1Y96 A;  2DLP A;  2JTM A;  2PVD B;  3EG0 A;  1W70 A;  3A1P A;  1KG1 A;  3AT1 B;  3MEW A;  1J3T A;  2VV5 A;  4OMM A;  1UJ0 A;  2GQV A;  3QYH B;  3FJ5 A;  1ACM B;  1OU9 A;  1VQ7 Q;  3EGD A;  2LZ6 B;  2NYS A;  4KBM B;  1RI9 A;  2LQW A;  2XI9 A;  2RJC A;  5L23 A;  3OYL A;  2RJD A;  3M0S A;  3H0F A;  3HP9 A;  4J6X A;  3MEA A;  2DL7 A;  5KCH A;  3URG A;  3PIP A;  3RUX A;  2PVO B;  4P5N A;  4ZN1 A;  1RL2 A;  2WSE E;  1R0B G;  5FU6 B;  4GBQ A;  1NEB A;  1VQM T;  5J39 A;  5KYW B;  4M75 A;  1ABO A;  5IH2 A;  1NM7 A;  5GAN 2;  3ZFJ A;  4C8Q B;  4FU6 A;  4PJO A;  2G6F X;  5FU7 B;  3CD6 A;  3CC2 Q;  1SSH A;  4JJB A;  1N5Z A;  5CQY A;  4M77 E;  4AFS C;  3FEO A;  3BDL A;  5GAN g;  1AWO A;  3PNW C;  2YRV A;  1G3Y A;  2EFI A;  4E7J A;  4M7A B;  4Z02 A;  3WXM B;  4ANJ A;  1T0H A;  3FDR A;  3E2U A;  1WHL A;  4N0A C;  1VQ9 T;  3QDF A;  1M90 C;  1VQK A;  2HMA A;  1TXQ A;  2DTI A;  4PJL A;  3LWI A;  2XK0 A;  1Q95 G;  4IUT A;  1RAE B;  3G4S A;  3V8K A;  2HKN A;  3OYN A;  4PJN A;  1M3C A;  3S6W A;  1N9R A;  1HYO A;  2KYM A;  1UFF A;  1YJN A;  4M7D E;  5D6Y A;  2F2V A;  1NLO C;  5FLX E;  4F7U A;  1GRI A;  3DB3 A;  5GAN 6;  4PKC C;  2MOX A;  1YHQ T;  2DD5 A;  4K11 A;  2OTJ A;  4E7H A;  3CCQ Q;  3C94 A;  4M78 B;  2KRO A;  3CC4 Q;  1QVP A;  2M0O A;  3M57 A;  3CCJ T;  1YJ9 Q;  1M1G A;  3M0R A;  3PVQ A;  2DJQ A;  3SB2 A;  2PZ1 A;  4JPB W;  5IXF A;  2ZPH B;  2JNG A;  4WCI A;  2LC4 A;  2LJ0 A;  2K2V A;  1XTD A;  3JV3 A;  2I0N A;  3UPU A;  1M2O A;  2PQW A;  4FIB A;  3OYM A;  1YIT Q;  3M0P A;  5A2Q E;  3RMS A;  3QUI A;  4BY6 B;  1M30 A;  4X9D A;  2ECZ A;  2E1H A;  2ZAE A;  3CPF A;  1M1K R;  3HSB A;  4PFO A;  2FZK B;  4MML A;  3HKS A;  3RR6 A;  3JB9 D;  2DTO A;  4D6W A;  4N4H A;  2A7Y A;  1MV3 A;  3HTR A;  1D3B A;  4J6Y A;  2CDT A;  4KH1 B;  1U1S A;  5KE2 A;  1AWW A;  3MO8 A;  3QWX X;  1WX6 A;  1OEB A;  2DXB A;  2DVE A;  5HK0 A;  3JB9 G;  4M75 G;  2RQT A;  1V1C A;  1FMV A;  3NGP A;  1TS9 A;  1BKB A;  2DE0 X;  2MIO A;  4M77 A;  2MWP A;  4BE2 A;  1SPK A;  2MMP A;  2COZ A;  2XDP A;  4R55 A;  2OTL A;  2DBK A;  4GLK A;  3OYG A;  3EGX A;  1G3W A;  1VQ6 Q;  2K5I A;  3DLM A;  4KGZ B;  1QVF S;  5KYX B;  4HT9 A;  3DLL A;  4AMC A;  4HCK A;  2GTJ A;  4CC3 A;  2YHT A;  4RTT A;  4E7S A;  1WPY A;  1IRX A;  1R0C B;  2M02 A;  1QKX A;  2QQS A;  2K3B A;  4XTZ A;  2RQR A;  1JU5 C;  3GLX A;  3RMQ A;  4FYV B;  5ECA A;  1BK2 A;  2RNA A;  1CKA A;  3QZ5 B;  4RCC A;  4M7D A;  1AWJ A;  1S72 T;  2NLU A;  2X4Y A;  3EH1 A;  3VYG A;  1VQL A;  1UGS B;  1UTI A;  3CCS A;  3OS2 A;  3GIB A;  5AT1 B;  3JAM E;  2YUO A;  3BW1 A;  4DOW A;  3CPW P;  3LX7 A;  4AFU C;  2CH4 W;  4PFZ A;  4F7U G;  3OYK A;  1PKT A;  4CRI A;  5GAN 8;  2OX7 A;  4JJN K;  5KYU B;  1WJR A;  1KQS S;  3ZL7 C;  3G71 T;  2ZZD A;  2M51 A;  1ZSZ A;  1NLP C;  3CMA T;  2G3R A;  3QYG B;  1OX9 A;  2BIV A;  2GFU A;  2DEU A;  4HKE A;  2A28 A;  4FSS A;  2CP7 A;  4KT0 E;  1OI1 A;  1FYN A;  4JJD A;  1IGQ A;  2RB6 A;  2L3P A;  2J7I A;  3CME T;  2ZPG B;  4N4G A;  3JCM h;  1Q82 C;  4MZT A;  2QAZ A;  1BI1 A;  1NZ9 A;  3THK A;  1K73 C;  3L2U A;  4X34 A;  2R58 A;  3OYH A;  3OB9 A;  1WHH A;  1ZUU A;  3EHQ A;  2ROT A;  3V7C A;  2E3H A;  4X1V A;  5CK9 A;  1TG0 A;  3G6E Q;  2EQJ A;  2L5Q A;  2DKG A;  2KEA A;  1YJW T;  3MHX A;  1RAI B;  1M8V A;  4ORZ A;  1MGQ A;  1BU1 A;  2DM1 A;  1M90 U;  1TU0 B;  3OS0 A;  4OGE A;  3EG9 B;  4J83 A;  1AZG B;  2KT8 A;  1VQK Q;  2KAF A;  4L5G A;  4BB7 A;  3OW2 P;  4PK4 A;  2RK2 A;  2GTO A;  2HBW A;  3VS2 A;  2RQV A;  5I2M A;  3G4S Q;  3CCL A;  3RER A;  1QCN A;  4ZGE B;  1KSW A;  2FG0 A;  2QA4 A;  2CT4 A;  1ZUK A;  4HVW A;  5EC7 A;  2VGN A;  3JCM J;  2C06 A;  4Y92 A;  4RTW A;  3RKY A;  2HL5 C;  2OTJ Q;  2CGH A;  4AFZ C;  5IHK A;  2QEX T;  1M8M A;  1M1F A;  1WJS A;  4CC7 A;  4KGV B;  2FO0 A;  4E7L A;  1KQ1 A;  2QQ9 A;  1QLY A;  4J5Y A;  2FL7 A;  1Y71 A;  4J9E A;  4JRI A;  5GAN 3;  5CKD A;  1DJ7 B;  1RAA B;  4M7D D;  4C8Q D;  1B34 B;  4DBF A;  5LJ5 g;  3I56 A;  4XU3 A;  1UGV A;  1LOJ A;  2E5K A;  1D1A A;  3CCE T;  2HL3 A;  2E10 A;  4LD6 A;  4XTU A;  2MCN A;  2X3X D;  2M9U A;  4Z8A A;  4C5H A;  1VQ4 T;  4RG2 A;  3PTA A;  1UB4 A;  2RJE A;  3ULR B;  5DLQ E;  1B3Q A;  3E1S A;  3VUZ A;  4M7D G;  1KD1 C;  2LTO A;  2GF7 A;  3G1J A;  3MP6 A;  4JLG A;  3CC7 Q;  4IUQ A;  2V8I A;  2L8D A;  3QDR B;  3I55 T;  4IKF A;  1HK9 A;  4XAX B;  1QP3 A;  3A8H B;  2J6F A;  4OVA A;  1QCF A;  4MDW A;  3CCM Q;  4D8D A;  4E47 A;  2YRC A;  5KCO A;  5KYX A;  4RTU A;  1NG2 A;  4ESR A;  4N0A A;  2EJG A;  2CP5 A;  1N8R C;  1T0J A;  4FW1 A;  1NJI C;  3VS5 A;  4RG8 A;  2FRW A;  2W10 A;  3OS1 A;  1ARK A;  1VQM A;  3OW2 A;  2EGA A;  2ZPB B;  2H3E B;  4A63 B;  2KGT A;  1VIE A;  4C92 B;  2KYB A;  3NTK A;  1D0Z A;  3GF5 A;  3I35 A;  3J7A F;  5C6S A;  4ZGJ B;  2HNI A;  4QW2 A;  4M7A F;  4L6V 5;  1WJQ A;  1UGQ B;  2CH4 A;  3CEY A;  1PHT A;  4BI8 B;  4BI4 A;  1GCP A;  2DRM A;  4C8Q C;  2KRS A;  1Q7Y C;  3LLR A;  5FU7 C;  4RMO A;  2E65 A;  2P0K A;  4LDY A;  3ER0 A;  1LNX A;  1XOV A;  4RUG A;  4XK8 E;  1BCM A;  1W6X A;  1QQJ A;  5KYU A;  2MYS A;  1VQ9 A;  3F70 A;  2BE7 D;  1G83 A;  1RAF B;  2DPP B;  1JBM A;  4ZNX A;  1UDL A;  1Y57 A;  4MZP A;  4RTZ A;  2AZV A;  2J06 A;  4X9C A;  2LVM A;  2FHD A;  1ZSZ C;  3VU3 C;  2YRD A;  2P4R A;  2RJF A;  4HT8 A;  1X6O A;  1SRL A;  1VQ7 T;  2PUO B;  2CUD A;  2VC8 A;  3P8D A;  3EFO A;  3Q1J A;  3QWY A;  3VS7 A;  5DLO A;  2D8H A;  2XIC A;  3M4G A;  3QBY A;  4M78 F;  5M9O A;  1UJY A;  2RHZ A;  3JCM Q;  1YHQ A;  4QVZ A;  2LMJ A;  1MUZ A;  3CCV Q;  3PMT A;  1KC8 C;  4OB3 B;  3RBB B;  5J3B A;  4OMP A;  3CCJ A;  5C0M A;  2GBQ A;  2NWM A;  3HRU A;  3CBP A;  3DKM A;  1B7T A;  2DNU A;  5LL6 S;  2KI7 A;  2P0P A;  4E7K A;  4O5V A;  2OAW A;  4MDX A;  3J81 E;  1YIJ T;  2JM9 A;  1PM3 A;  1ZA2 B;  5A0G A;  2RMO A;  2DIG A;  1OQK A;  2CP6 A;  4ELZ C;  3CC2 T;  1OU8 A;  2L89 A;  1UUE A;  3PGG A;  1M90 R;  3OSV A;  5FRO A;  2HBP A;  3LH5 A;  1VQN T;  2DAQ A;  4A4K A;  2RHY A;  3OMG A;  4YTL A;  2COY A;  3I5S A;  1Q86 C;  1M3A A;  2X4J A;  2JS0 A;  1I07 A;  1V29 B;  2NUT A;  2E6N A;  1Z9Z A;  4BY6 C;  2JT4 A;  4GY5 A;  1EIF A;  3CCL Q;  1A0N B;  1EFN A;  4RTX A;  3H9N A;  3PT9 A;  4HXJ A;  2HD0 A;  3L2W A;  3A8L B;  4LDW A;  2HCK A;  4BD3 A;  1QVG S;  4NL2 A;  4KH0 B;  1E6G A;  3R6O A;  2IIM A;  2COW A;  1ZA1 B;  2BTT A;  2SEM A;  2LQN A;  3BFM A;  5CAI A;  1GBR A;  3S3O A;  1IGU A;  5HY6 A;  4EMK B;  1YCY A;  3KUF A;  1RLP C;  2CYZ B;  2CP2 A;  2JS2 A;  1IXD A;  2CSI A;  3MEU A;  1K0S A;  3CCQ T;  3I56 Q;  1PC0 A;  1WYX A;  2RK1 A;  4C0D B;  1RI0 A;  3VV0 A;  4B9X A;  1SHF A;  3SEM A;  3REB B;  1D0Y A;  2DK3 A;  2FPF A;  2LJ3 A;  4DQ2 A;  5GMK j;  1I0C A;  4C5E A;  2HSP A;  4IUR A;  1VQ5 T;  3C4S A;  1SF9 A;  1WXT A;  5IHI A;  3E19 A;  3KBG A;  4BAC A;  2DMO A;  1K1Z A;  4M4Z A;  3WVE B;  2LQ8 A;  3JB9 H;  4DBR A;  1S72 A;  1VQO T;  1JO8 A;  2O4X B;  4FM4 B;  1X01 A;  2JUF A;  5GAN d;  1TH7 A;  3FC3 A;  4AT1 B;  3CBO A;  2CZ1 B;  1JJ2 P;  2KVQ G;  2X51 A;  4EMG A;  2YLC A;  4C8Q E;  2Y4Y A;  2B86 A;  2QK0 A;  1FX7 A;  3G71 A;  3H0I A;  2DIL A;  3M0Q A;  3CMA A;  1PSF A;  2E64 A;  3QSU A;  2KMT A;  1Y7X A;  4II1 A;  2X3W D;  1KJW A;  4WTO B;  2AIR B;  4M7A E;  3HFN A;  2FB7 A;  2VKN A;  2LRQ A;  1S1N A;  4J9G A;  3CME A;  1KHC A;  1X69 A;  2QI2 A;  2PNI A;  1M4Z A;  1WQ7 A;  1WZO A;  5GAO r;  2HAX A;  2DEQ A;  3VS6 A;  3JCM b;  5A0D A;  1H3Z A;  1OOT A;  1C6V X;  3JCM g;  1NE8 A;  1UG1 A;  1K8A U;  1Q7Y U;  4XQ3 A;  3EH2 A;  1O9S A;  1D1B A;  1YJW A;  4XU1 A;  1GL5 A;  4CC2 A;  2QXF A;  1YWP A;  3S3M A;  3MPU B;  2LT1 A;  4J6W A;  2ABL A;  1VYT A;  3M0U A;  2XD0 A;  5I2S A;  5HCK A;  5J26 A;  1V76 A;  3P8B B;  3IQL A;  2L3S A;  2FVU A;  2NUP A;  2BZ8 A;  4C5I A;  4NL3 A;  2O2O A;  1ZUY A;  2ZPE B;  1QCO A;  4JJC A;  4ATO A;  2V1R A;  3X26 B;  4PJM A;  5GMK h;  3WVD B;  5IAY A;  3SWN A;  1H8K A;  2KR3 A;  2WAC A;  1D1C A;  2W0Z A;  1AD5 A;  1WHK A;  1SSF A;  3MET A;  2QQR A;  3TEE A;  1YHQ Q;  2VYT A;  4Q5W A;  2DX1 A;  3MEV A;  2DL8 A;  2EQI A;  2K9G A;  2QEX A;  4QT7 A;  1OZ3 A;  2KK4 A;  2CUB A;  1JJ2 A;  5KYY B;  3CCJ Q;  2VB6 A;  1ZBJ A;  4JDS A;  1YI2 Q;  1FWZ A;  2AK5 A;  4IUV A;  2EYZ A;  1X6G A;  3L2Q A;  1QMC A;  1K9M U;  2LCC A;  1PNJ A;  3VS1 A;  1CSK A;  3CCU T;  2CZ7 B;  2LDM A;  3CCE A;  3RNJ A;  2XU8 A;  2YSQ A;  1PWT A;  1VQ4 A;  2IVW A;  3CPW S;  3JCM c;  3CCR T;  1IHV A;  1Y0M A;  2LCL A;  9ATC B;  2DO3 A;  2QTX A;  5KYW A;  1XQH A;  4M75 F;  1Q86 U;  1WI7 A;  1WFW A;  2J6O A;  5CKB A;  2RQW A;  3OYE A;  3I55 A;  4C8Q A;  1W2B S;  1N6A A;  5FWB A;  3G6E T;  4PJO F;  5GMK l;  1AHJ B;  1SHG A;  1VQP T;  3DB4 A;  2B8A A;  2XDD A;  1GFD A;  2KBT A;  1UEB A;  4PFP A;  3OYA A;  1PG5 B;  2JMC A;  2RI2 A;  1QVF P;  3HRT A;  2GGR A;  2A36 A;  1Y07 A;  3LW5 E;  4M7A A;  2QQB A;  4C92 F;  2EKO A;  5CQX A;  1G8X A;  2VGM A;  4CI0 C;  2FEI A;  1LVK A;  2V1Q A;  2QAS A;  2MF2 A;  4PNO A;  2EYX A;  6AT1 B;  2OI3 A;  4N4I A;  4E7Z A;  3CD6 Q;  1IB8 A;  3M59 A;  1BYM A;  2M16 A;  1WHM A;  1FMW A;  4QQG A;  1U1T A;  4BE0 A;  1C0M A;  2ZCF B;  4F04 B;  4OB0 B;  2E6Z A;  4Z88 A;  4C92 C;  1TUC A;  3NTI A;  1VYV A;  3MKD A;  4RCB A;  5FW9 A;  5GAO l;  4FL6 A;  4JS5 A;  5CKH A;  3VYH B;  1OV3 A;  3QXE B;  4A4H A;  2C0I A;  2CS7 A;  2RH2 A;  1M2V B;  4JZ3 A;  2LT4 A;  2CT3 A;  1KQS P;  1MHN A;  4J8O A;  3RES A;  1W4S A;  4C5G A;  3C0C A;  3HHT B;  4M78 A;  4NOY A;  4DA4 A;  4XU0 A;  1NPR A;  1WHJ A;  3N5B B;  4ZN3 A;  1S72 Q;  2XMF A;  1MV0 B;  1VQ7 A;  2VXE A;  2YT6 A;  2EGC A;  1G3S A;  4HA8 A;  1GCQ C;  1K0X A;  1X2K A;  3CC7 T;  3L1A A;  1YJN Q;  1QP2 A;  4LE9 A;  1YNZ A;  2EQK A;  3CCM T;  1M9S A;  3KXT A;  3M55 A;  3CMA Q;  1Y96 B;  3AHU A;  1NEG A;  2CZ6 B;  1PD0 A;  2AHJ B;  4FSX A;  3NFC A;  2E12 A;  5GAN f;  1QVF A;  2QDL A;  4WF2 A;  3C95 A;  3M5A A;  4C0Z A;  3VS0 A;  3JCM V;  2MK5 A;  4O6J A;  1YIJ A;  1K8A R;  1Q7Y R;  2MI6 A;  3EGD B;  4J9D A;  4OMO A;  3JRZ A;  4JRK A;  5FWC A;  1BIB A;  1RAD B;  2DFU A;  4DEX A;  3OYF A;  1R8O B;  3CC2 A;  2O88 A;  1RLQ C;  2EAY A;  1XNI A;  3OBY A;  4M7A D;  5D6X A;  2DF6 A;  1YJW Q;  1VQN A;  2C0T A;  4C8Q G;  4M77 F;  3SWN C;  2VWF A;  1OPK A;  3LGF A;  1BCO A;  1VYU A;  5GMK e;  1OYX A;  2K6D A;  1T3L A;  2K7A A;  5IHN A;  1IHW A;  4M75 B;  4HCC A;  4EPC A;  3X24 B;  1VQ8 T;  3NMZ C;  2FPD A;  4LDX A;  2LNV A;  1OZ2 A;  2ZGW A;  4M7A G;  2EW3 A;  1U8R A;  3L42 A;  3CXC P;  4PJO B;  2X35 A;  3REA B;  5LJ5 d;  1KQS A;  2EYW A;  2RHU A;  3EG1 A;  4J7F A;  2JJ9 A;  1WGS A;  1YWO A;  3E9G A;  1BB9 A;  4FW2 A;  4JUV A;  4RKU E;  3PMI A;  2ATC B;  5CKF A;  5GAN 7;  3H8Z A;  3M9Q A;  3VRZ A;  2QEX Q;  1K9M R;  2OTL Q;  4RTY A;  5FU6 C;  5LJ3 d;  2FRY A;  5I11 A;  2QDY B;  4A54 A;  2EKH A;  3PFS A;  4M78 D;  1YBY A;  3CCV T;  5GAN e;  2E3I A;  3BY7 A;  1ZX6 A;  2DBM A;  2JMA A;  4R0K A;  1U06 A;  3CCQ A;  3BDU A;  1N9S A;  2O31 A;  4MZM A;  1EX4 A;  2O9V A;  1G2B A;  1I4K 1;  5GAM d;  2V8J A;  3CCE Q;  5LJ3 j;  4EMK C;  2BE9 B;  3TVT A;  1LCK A;  3ASK A;  3S3N A;  2A0F B;  1VQ4 Q;  1Q86 R;  3MJX A;  1HSQ A;  1VQ5 A;  3X28 B;  1LPL A;  4M78 G;  4R56 A;  5CKE A;  1VIF A;  4M7A C;  5HK3 A;  5GAM j;  4C0D C;  2OJ2 A;  4F7U B;  2FYK A;  1FXX A;  1MMA A;  3I55 Q;  2YLB A;  2CSQ A;  1VQO A;  2D6F A;  2AT1 B;  1VQL Q;  3CCS Q;  4FCY A;  2HQH A;  3E9F A;  4QVD A;  3PIO A;  3GBQ A;  4C92 E;  1PCX A;  3NTH A;  1Q81 C;  2P0Q A;  1I5O B;  4OB1 B;  4HCZ A;  2EYQ A;  5GJV B;  2P84 A;  3QJY A;  1JB0 E;  1K9A A;  5GAN 4;  2CRE A;  2RI3 A;  2RPN A;  4KGX B;  4LN2 A;  1UHF A;  2GCX A;  3M4Y A;  1SRM A;  1TSF A;  3VRY A;  5I22 A; 
#chains in the Genus database with same CATH homology
 2RQR A;  1JU5 C;  4J9F A;  2O9S A;  2JTE A;  4F17 A;  2ESW A;  2D1X A;  2EVR A;  5ECA A;  1BK2 A;  2RNA A;  1CKA A;  2B86 A;  1JEG A;  3H0I A;  2M0Y A;  2KE9 A;  2DIL A;  1AWJ A;  1ABQ A;  3M0Q A;  1CKB A;  1UTI A;  1AVZ C;  4KRT A;  2DYB A;  2KXD A;  2YUO A;  2X3W D;  1KJW A;  4DEY A;  1FMK A;  2DVJ A;  1AOJ A;  4AFU C;  2CH4 W;  2VKN A;  1S1N A;  1UE9 A;  4J9G A;  1JXO A;  1X69 A;  3PE0 A;  1PKT A;  2PNI A;  2A08 A;  2LX7 A;  2LP5 A;  2YUQ A;  3VS6 A;  3ZL7 C;  1K76 A;  4E6R A;  1E7O A;  2M51 A;  1NLP C;  2K2M A;  1OOT A;  3I9Q A;  1UG1 A;  1NYG A;  1X6B A;  2A28 A;  4FSS A;  1H3H A;  1GFC A;  1FYN A;  2L2P A;  4JJD A;  1B07 A;  3PVL A;  2D8J A;  2L3P A;  1K4U S;  2J7I A;  2F2W A;  4J9I A;  1GL5 A;  4CC2 A;  1YWP A;  4OMQ A;  1TUD A;  4Z89 A;  2AZS A;  3THK A;  2ABL A;  3O5Z A;  3I5R A;  1VYT A;  3M0U A;  5HCK A;  1ZLM A;  3IQL A;  1ZUU A;  2L3S A;  3EHQ A;  2BZ8 A;  2ROT A;  1HJD A;  2J05 A;  4X1V A;  1TG0 A;  2O2O A;  1ZUY A;  2DA9 A;  2KEA A;  4JJC A;  2V1R A;  4AG2 C;  4ORZ A;  2DM1 A;  1BU1 A;  2D0N A;  1H8K A;  2KR3 A;  3SHW A;  3H41 A;  1AEY A;  2HDA A;  2W0Z A;  2KT1 A;  1AD5 A;  2HEQ A;  1AZG B;  1GBQ A;  1QWF A;  2KT8 A;  2ED0 A;  1ZSG A;  3A98 A;  2A37 A;  1YN8 A;  2GTO A;  2HBW A;  3VS2 A;  2RQV A;  2DX1 A;  5I22 A;  1Z9Q A;  3EHR A;  1KIK A;  2DL8 A;  2EQI A;  2K9G A;  2YUN A;  4QT7 A;  2EGE A;  1PRM C;  1KSW A;  1RUW A;  2CUB A;  2FG0 A;  3H0H A;  2KXC A;  1ZBJ A;  2RQU A;  2CT4 A;  1ZUK A;  2AK5 A;  2EYZ A;  1X6G A;  4HVW A;  5EC7 A;  4F16 A;  1PNJ A;  3VS1 A;  1CSK A;  4Y92 A;  4JZ4 A;  3R6N A;  1BBZ A;  4RTW A;  3RNJ A;  3EG3 A;  2L0A A;  4IIM A;  2ROL A;  4AFZ C;  5IHK A;  1M8M A;  2YSQ A;  1PWT A;  3CQT A;  4CC7 A;  1Y0M A;  2NUZ A;  4J9H A;  1E6H A;  2FO0 A;  1QLY A;  4J9E A;  2JXB A;  3VS3 A;  4GLM A;  3UAT A;  1WI7 A;  4IIO A;  1WFW A;  2J6O A;  1UGV A;  2RQW A;  2E5K A;  5GJW B;  5FWB A;  1JQQ A;  1QKW A;  1SHG A;  2MCN A;  2EBP A;  2X3X D;  2LJ1 A;  4Z8A A;  1W1F A;  3EG2 A;  2DL5 A;  1GFD A;  2KBT A;  2FPE A;  1GCQ A;  1WIE A;  2JMC A;  1B3Q A;  3ULR B;  1M3B A;  2GGR A;  2A36 A;  4J9C A;  1WLP B;  1T3S A;  2C0O A;  2KNB B;  1PRL C;  1KFZ A;  2DLP A;  1WDX A;  3EG0 A;  1W70 A;  2J6F A;  1QCF A;  2FEI A;  1WXU A;  2V1Q A;  4D8D A;  4LUE A;  2KRN A;  1H92 A;  1J3T A;  4OMM A;  1UJ0 A;  2EYX A;  4RTU A;  1NG2 A;  4ESR A;  2OI3 A;  3FJ5 A;  1T0J A;  2ENM A;  3VS5 A;  2LZ6 B;  2FRW A;  2W10 A;  1QWE A;  1ARK A;  2DL3 A;  2EGA A;  4OML A;  1RI9 A;  2LQW A;  4Z88 A;  1TUC A;  5L23 A;  4A63 B;  3M0S A;  2KGT A;  3H0F A;  2DL7 A;  1VYV A;  2KYB A;  5FW9 A;  4F14 A;  1I1J A;  3U23 A;  1OV3 A;  3I35 A;  1OPL A;  2C0I A;  4JZ3 A;  4GBQ A;  1NEB A;  2CT3 A;  3TSZ A;  2CH4 A;  4EIK A;  3C0C A;  2PTK A;  1PHT A;  1ABO A;  2J6K A;  5IH2 A;  1GCP A;  2DRM A;  2F2X A;  2VVK A;  2KRS A;  1NM7 A;  2XMF A;  1MV0 B;  2GNC A;  2G6F X;  4LNP A;  1XOV A;  2DRK A;  4RUG A;  1SSH A;  1W6X A;  4JJB A;  1N5Z A;  2YT6 A;  2EGC A;  4AFS C;  1K0X A;  1GCQ C;  1X2K A;  1G83 A;  4CC4 B;  4ZNX A;  1AWO A;  1X2Q A;  1UDL A;  1Y57 A;  4LE9 A;  4RTZ A;  2AZV A;  2J06 A;  1YNZ A;  2AKL A;  2LNH B;  2P4R A;  5IXB A;  1NEG A;  1SRL A;  1T0H A;  2CUD A;  1M27 C;  2QDL A;  3QWY A;  1HD3 A;  3VS7 A;  3VS4 A;  2D8H A;  3VS0 A;  4HVV A;  1X43 A;  3EGU A;  3UA6 A;  1NYF A;  1UJY A;  2LMJ A;  1MUZ A;  2SRC A;  4LUD A;  4J9D A;  4D8K A;  4OMO A;  5FWC A;  4DEX A;  3RBB B;  1M3C A;  4AFQ C;  2O88 A;  1RLQ C;  4OMP A;  4AG1 C;  2KYM A;  2GBQ A;  2NWM A;  2DNU A;  1UFF A;  1UHC A;  2DF6 A;  2F2V A;  1NLO C;  2C0T A;  2OAW A;  1GRI A;  2VWF A;  3M0T A;  2JM9 A;  1OPK A;  1VA7 A;  2MOX A;  2ED1 A;  3NHN A;  4J9B A;  2BZX A;  1VYU A;  4K11 A;  2K6D A;  2RMO A;  2GQI A;  1T3L A;  2K7A A;  2JM8 A;  5IHN A;  3NPF A;  2KRO A;  1UUE A;  3NMZ C;  2FPD A;  3KFV A;  3M0R A;  3PVQ A;  2DJQ A;  2EW3 A;  3LH5 A;  3REA B;  2PZ1 A;  4JPB W;  5IXF A;  2EYY A;  1PKS A;  2EYW A;  3EG1 A;  3I5S A;  4WCI A;  2LJ0 A;  1M3A A;  2JS0 A;  3JV3 A;  2I0N A;  1YWO A;  1I07 A;  1BB9 A;  1Z9Z A;  1AWX A;  3UA7 A;  1X27 A;  2JT4 A;  3M0P A;  1U5S A;  3VRZ A;  1A0N B;  1EFN A;  1M30 A;  4RTX A;  2LCS A;  2AKK A;  2ECZ A;  4RTY A;  4OMN A;  4HXJ A;  1YP5 A;  2FRY A;  5I11 A;  2EKH A;  2HCK A;  2L3Q A;  1ZX6 A;  2DBM A;  2JMA A;  4R0K A;  1U06 A;  1UEC A;  1MV3 A;  2O31 A;  1E6G A;  2H8H A;  2IIM A;  2CDT A;  2O9V A;  1G2B A;  2K79 A;  2KRM A;  1U3O A;  2BTT A;  2BZY A;  2RF0 A;  2SEM A;  2LQN A;  1AWW A;  2JW4 A;  3QWX X;  1WX6 A;  1WXB A;  1YCS B;  1GBR A;  3TVT A;  1LCK A;  1HSQ A;  1OEB A;  2YDL A;  1SEM A;  1RLP C;  2RQT A;  1V1C A;  2JS2 A;  3NGP A;  1AZE A;  2CSI A;  2DE0 X;  2MIO A;  1K0S A;  2OJ2 A;  1SPK A;  2CSQ A;  1WYX A;  2YUP A;  1SHF A;  3SEM A;  3REB B;  1JXM A;  2FPF A;  2LJ3 A;  1I0C A;  2RN8 A;  2DBK A;  2HSP A;  3GBQ A;  1WXT A;  3UF4 A;  2EPD A;  5IHI A;  2DMO A;  5GJV B;  1K1Z A;  4HCK A;  4M4Z A;  4RTV A;  2GTJ A;  4HVU A;  4CC3 A;  1K9A A;  1WA7 A;  2CRE A;  1IO6 A;  4RTT A;  2RPN A;  4LN2 A;  1UHF A;  1QKX A;  1SRM A;  1JO8 A;  2K3B A;  3VRY A;  3TSW A;  2DL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...