1QLYA

Nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'LKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE BTK
publication title Solution Structure of the Human Btk SH3 Domain Complexed with a Proline-Rich Peptide from P120Cbl
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tyrosine-protein kinase
total genus 10
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qlyA00
4F17A 3M0QA 1SPKA 2KE9A 2JM9A 1SEMA 1SRLA 2AZVA 2EGAA 2L3PA 2F2XA 2NWMA 1GRIA 2KYBA 1BB9A 3I35A 2MCNA 1NYFA 2D1XA 2K3BA 1OPKA 4CC7A 1GFDA 1GL5A 1AWJA 2ESWA 4LUEA 3A98A 2JS2A 1KFZA 4JJDA 1Z9ZA 2O88A 1I07A 2JW4A 2DMOA 4HVWA 1RLPC 1UUEA 2YSQA 1IO6A 5FWCA 4WCIA 1GBRA 1W1FA 3LH5A 2HEQA 2L3SA 2YUQA 2KRNA 3I9QA 1U5SA 3H0HA 4K11A 4OMMA 3NGPA 1M30A 2JXBA 1PHTA 2HSPA 2J6KA 1T0HA 1CKBA 1BU1A 2B86A 3VS4A 1NEBA 3VS3A 2OAWA 1ABOA 1M27C 2DJQA 2J6OA 2DF6A 1SSHA 2KXCA 2L0AA 1Y57A 2O31A 2RQRA 4QT7A 2YUPA 1AD5A 2GNCA 4JJCA 1UJYA 2LJ3A 1PKTA 3EHQA 2O9SA 2ROTA 1H8KA 3QWYA 1U3OA 1X69A 4AFSC 4HCKA 1WDXA 3M0UA 1H3HA 2W0ZA 1YWOA 1XOVA 5IXFA 3VS0A 1VYTA 1KIKA 2EYWA 2CSIA 1QLYA 2E5KA 1NYGA 5ECAA 1X27A 3UATA 3EG3A 3EGUA 4J9EA 2VVKA 2FRYA 2RMOA 1AWWA 2KEAA 3PVQA 3UA7A 2P4RA 2KR3A 2X3WD 1QCFA 2ABLA 4ESRA 2JM8A 1M3CA 2W10A 1GCPA 2DLPA 1TUDA 2JTEA 4J9FA 1S1NA 1FMKA 1AZEA 3NPFA 5FW9A 2IIMA 2EGEA 2LCSA 2GGRA 2JT4A 4LNPA 2K6DA 1YNZA 2FEIA 4AG1C 3VS1A 3VRYA 4J9GA 1NG2A 2YT6A 1PKSA 5IHIA 1SHGA 1T3SA 1PNJA 2VWFA 4IIMA 1AVZC 1ZX6A 3EG0A 3SEMA 2F2VA 2KBTA 2X3XD 4JJBA 4LE9A 2EYXA 2ROLA 1B07A 1OEBA 4RTWA 1FYNA 1T3LA 4D8DA 4AFQC 1NLPC 3I5RA 1X2QA 1BBZA 2DBKA 1T0JA 1W70A 2ED0A 2YUNA 2K79A 3TVTA 2GTJA 5I22A 4EIKA 3M0PA 2PZ1A 1V1CA 3EG2A 4ZNXA 1PRLC 4JPBW 1YCSB 2ECZA 2KYMA 1MUZA 1M3BA 1VYVA 3NHNA 1G83A 3TSZA 1JU5C 2EKHA 3O5ZA 2V1QA 3ULRB 2CDTA 2F2WA 3VS2A 2K7AA 2BZYA 2CT3A 2DRMA 2LP5A 2J05A 1UFFA 3KFVA 2CT4A 3CQTA 1GCQC 1GCQA 2LX7A 2KRSA 5FWBA 2EPDA 2DL3A 4LUDA 1UECA 1ZUUA 3REAB 4J9IA 1WYXA 1UGVA 1E6HA 1UDLA 3H0FA 2HBWA 3M0TA 2JMCA 4Y92A 2FPFA 2BZ8A 2FRWA 4GLMA 1QWFA 2CUDA 2EGCA 2DYBA 2DA9A 1UG1A 2G6FX 2J7IA 1B3QA 1ZBJA 3GBQA 1ZSGA 1PWTA 4R0KA 1K0SA 2A28A 3C0CA 1K76A 1U06A 1AWXA 4OMNA 1UHCA 2C0TA 2SEMA 4RTXA 1E6GA 2CSQA 3VS7A 4AFZC 3RBBB 2AK5A 4Z89A 5EC7A 4CC2A 1WFWA 4F14A 1AEYA 1JXOA 1X6GA 2DVJA 2HDAA 2OI3A 4IIOA 2BZXA 3M0SA 3M0RA 2FO0A 3H41A 3SHWA 2FG0A 1X6BA 2SRCA 1WXUA 2MIOA 4GBQA 1MV3A 1N5ZA 1AWOA 1QKXA 4J9DA 2CH4A 2O9VA 3H0IA 1G2BA 2JS0A 2I0NA 1JEGA 1HSQA 2RPNA 3FJ5A 3EHRA 4RTUA 2YUOA 4RTTA 2PNIA 2RNAA 1I1JA 1K9AA 2JMAA 1HD3A 1RI9A 1OOTA 1PRMC 4JZ4A 4D8KA 4OMPA 1KSWA 2EW3A 4F16A 1WLPB 2EBPA 1Y0MA 1NEGA 1WXBA 2M51A 2ED1A 2GBQA 4RTZA 1WXTA 2DNUA 2FPEA 2EYYA 3JV3A 1CSKA 2D8JA 4OMOA 2K9GA 4M4ZA 3TSWA 1E7OA 2DBMA 5IXBA 2DL5A 2LZ6B 1H92A 2DL8A 1QKWA 1VYUA 1X2KA 1KJWA 1K4US 2K2MA 2ENMA 1J3TA 1YP5A 3PE0A 4OMQA 1UJ0A 4DEYA 1NM7A 5IH2A 4CC4B 2XMFA 3UA6A 3NMZC 1NLOC 4AG2C 1JO8A 4X1VA 2RQWA 1BK2A 4RUGA 3VS6A 1ARKA 3REBB 1A0NB 2MOXA 4J9HA 4A63B 1WIEA 4AFUC 1AZGB 1JXMA 1UTIA 2CH4W 2DILA 1OPLA 2D0NA 1WI7A 2DL4A 2LJ1A 2H8HA 3RNJA 2RN8A 1M8MA 2KROA 2AKLA 2RQTA 4E6RA 2V1RA 3UF4A 1ZUKA 1M3AA 2RQVA 2A08A 1GBQA 2LQNA 2LNHB 1MV0B 1WA7A 4KRTA 3ZL7C 2A37A 5IHKA 4Z88A 2DE0X 2CUBA 2KGTA 3QWXX 4RTYA 5IHNA 1Z9QA 2LMJA 1LCKA 3VRZA 3THKA 4OMLA 4HVUA 2EYZA 5GJVB 1EFNA 2O2OA 2PTKA 1WX6A 1W6XA 2CREA 1JQQA 3I5SA 4Z8AA 1ABQA 1YN8A 4DEXA 2NUZA 1I0CA 1X43A 1QWEA 1YWPA 4J9BA 2DRKA 4HXJA 1HJDA 2FPDA 4HVVA 3PVLA 2D8HA 1AOJA 1GFCA 2AKKA 5L23A 1CKAA 2AZSA 2OJ2A 4FSSA 1OV3A 2RQUA 2LJ0A 1RLQC 2KNBB 2M0YA 1ZLMA 1VA7A 2C0OA 1TUCA 2C0IA 3U23A 2J06A 2EQIA 2GTOA 2KT1A 1K1ZA 2HCKA 1TG0A 5GJWB 1SHFA 2BTTA 3IQLA 1ZUYA 2KT8A 2L2PA 2YDLA 2GQIA 2A36A 1UHFA 1SRMA 4J9CA 2DM1A 2VKNA 3VS5A 2J6FA 1K0XA 3R6NA 2KRMA 2LQWA 2KXDA 2RF0A 4JZ3A 2QDLA 4CC3A 2L3QA 4RTVA 2DX1A 5HCKA 2EVRA 4LN2A 5I11A 4ORZA 1RUWA 1UE9A 2DL7A 3EG1A
chains in the Genus database with same CATH superfamily
2K3YA 3CCST 1RACB 2MWPA 1SRLA 4PJOB 2DVEA 5I2SA 2GFUA 2NWMA 4A53A 3HFOA 3I35A 2MCNA 2QDYB 2D1XA 2K3BA 1GFDA 2RI3A 2Y4XA 1VQOQ 3J80E 2M0OA 1VQLQ 2O88A 3FEOA 1I07A 2VGNA 1RADB 2V8KA 1UUEA 2QYZA 3OS5A 2K5IA 1SSFA 2I2LA 3S3NA 1YJNA 1W1FA 4OGEA 1GBRA 2KAFA 4ZN3A 3V8LA 3I9QA 1U5SA 4K11A 1BI2A 2QTVA 1M30A 4FU6A 4M78G 9ATCB 3VS3A 1D3BA 4KGZB 3G4SQ 1Q81R 2JZ2A 2DF6A 4A4GA 1G3TA 2AIRB 3UT1A 1YJWA 3TEEA 5GMKm 2O31A 2YUPA 1D3BB 1MMNA 4XU3A 3GLXA 3PT9A 4AFSC 1RAHB 4HCKA 3M0UA 2KMTA 1H3HA 5GMKh 2LNVA 1Q81C 1YWOA 2GCXA 5IXFA 3JB9D 2BIVA 1VYTA 3QJ6A 2LCCA 1QLYA 1NYGA 3A8MB 4GLKA 3V7RA 3UATA 3CC7A 3EGUA 3HPWA 2XICA 5GMKl 2VVKA 3MPUB 1FWZA 3CCMQ 1MGQA 5KE3A 3R6OA 2KEAA 3PVQA 3I56T 2HSEB 2YXYA 2A0FB 2XHCA 4Z02A 2ABLA 3OS2A 1TUDA 3JCMh 2JTEA 4J9FA 4C8QG 1S1NA 4BY6C 3CCLT 2MMPA 5FU7B 1VQ5Q 1AZEA 2EGEA 1GXIE 2JT4A 5KCOA 5GAN2 2FEIA 3JCMc 3OYCA 4MMKA 4A4EA 3GP8A 1NG2A 3OYLA 1OX8A 1M5Q1 3T9NA 4IIMA 1K73U 2WSEE 1VQ6A 2ROLA 1FYNA 2GQVA 4RMOA 4D8DA 5C0MA 2JN0A 4LDXA 1NLPC 2WACA 1D09B 1QQJA 3D7SB 2KVQG 3M59A 1W70A 1BIBA 4A4FA 3CCVA 3CC4T 5GAN5 1BI0A 3QXEB 4XU2A 4M7AA 2ZPGB 3EGDB 3CXCP 1VQNT 2PVOB 1JJ2P 3NHNA 3TSZA 2DK3A 4PJOG 3RKYA 1K8AR 1VQKA 3VS2A 2OX7A 1AT1B 2BZYA 1UFFA 3KFVA 2H3EB 3GF5A 1GCQC 2YRDA 2LX7A 1S72T 2OTJT 2DO3A 3TREA 1R77A 1RAFB 3A8GB 1UGVA 1X01A 3EGXA 2HBWA 3M0TA 2B8AA 2X4WA 3NTHA 2FRWA 5AT1B 1RI0A 1K8AC 1P92A 1X75C 4AT1B 3P8DA 1G3SA 2DYBA 1QVGA 4KUDK 1UG1A 2EKOA 2F69A 3EGXB 4PJLA 1PCXA 5A0LA 3QKJA 1ZBJA 4HCCA 1YHQA 2PVGB 4Y91A 3M53A 1M1KU 2CGHA 3CCQA 4QQDA 1UHCA 4M77C 2DERA 4DQ2A 3RIRA 5A0DA 2CSQA 2LX9A 4QKUA 1XNIA 4FIBA 5EC7A 5KYWA 1X6GA 4PLLA 3CCET 4M75B 3M0RA 3G7ZA 2FG0A 1WXUA 1IRXA 4PLIA 1TWBA 5C6SA 4X9CA 3QG1A 3MJXA 4C8QF 4M78D 3L42A 3JCMW 1RAIB 4J9DA 3H0IA 2E12A 2I0NA 1JEGA 3FJ5A 4C92A 3EHRA 2EJFA 3BDUA 1SKUB 1VQ4A 1LPLA 1I1JA 4IUVA 1K9AA 1ZA2B 1HD3A 2DXTA 4M78E 3CCLQ 2OTLA 3CBOA 3EG9B 4C92B 4J83A 4D8KA 2EJ9A 4II1A 1WGSA 2RHXA 3AT1B 4HKEA 4XU0A 1KSWA 2RH2A 3HFNA 3CCRT 1WXTA 1BKBA 2VASA 3CPWS 4XQ3A 4OMOA 4EMHA 2COZA 2DBMA 3HTRA 3ME9A 5CKHA 1BIAA 2HMAA 5GAOr 1VQLA 1KJWA 1K4US 3QHSA 4L6V5 1YP5A 4VUBA 1J3TA 1FXXA 4OMQA 3UA6A 3NMZC 3S3MA 1R0CB 5GAN8 2X9HA 3CC4Q 2FZKB 4F7UF 3CCJT 3ASKA 1ARKA 3HRTA 1A0NB 2K3XA 1MNEA 3HRSA 5KYXA 2MOXA 4J9HA 3G4SA 3A1PA 3QJYA 4PFOA 1JXMA 2CH4W 4M7AG 3CEYA 4XTZA 2H8HA 3PMIA 1M4ZA 2L89A 4OB3B 1S72Q 3GIBA 1TXQA 3X28B 4AMCA 2HZYA 3S6WA 1IXDA 2NUPA 1BYMA 1NJIR 1R0BG 4C5IA 3PIOA 4PNOA 5LJ3f 1WHMA 4DBQA 1K9MR 2VXFA 4RKUE 2DE0X 4FW2A 2CUBA 2JTMA 2LVMA 4XU1A 2KQWA 2XIDA 4PJOD 2F1LA 2RM4A 1NJIC 2RHUA 1EFNA 2O2OA 3QZ9B 3L2WA 2PTKA 1O9SA 1W6XA 5AYFA 2YRCA 1YN8A 4M77F 2WSFE 1VQ5A 1KQSP 2IG0A 4HT8A 2QTXA 4PJOE 1QCNA 3OYMA 3PVLA 3CCEQ 4M7DA 2D8HA 4M75G 2EIFA 4YTLA 2R5AA 5DY9A 2CZ6B 3M4GA 1ZLMA 2EYQA 2QASA 2DIGA 1TUCA 2KT1A 1SHFA 2HAXA 3IQLA 2KT8A 2L2PA 1TSFA 2QQ9A 3RERA 1UHFA 2DXBA 3PGGA 1SRMA 2CYZB 5GMKe 2J6FA 3KBGA 1K8AU 2E1HA 2QDLA 3JB9J 1EZZB 2L3QA 1IREB 4RTVA 1RL2A 4BE0A 1PM3A 2EQJA 4C92G 4HT9A 4LN2A 1RUWA 3CCSA 1UE9A 1Q82R 4FYVB 3SD4A 4EMKA 3HKSA 1ZSZC 2JNGA 3CMAT 4F17A 1KHCA 3CCRQ 1NE8A 3M56A 4LDVA 1SPKA 2KE9A 2JM9A 2JVVA 2CP5A 1SEMA 3BY7A 3ZEHA 2EGAA 2L3PA 2M1HA 1VQPT 1QP2A 2F2XA 2K5FA 2X4YA 2RHIA 3EFSA 5FU6B 5GANf 2LQ8A 3MEUA 1OPKA 4CC7A 1GL5A 2R57A 4LUEA 3OSSC 2AHJB 1Q95G 4JJDA 4M7AF 2JW4A 4HVWA 1IO6A 3PMTA 5FWCA 3QDRB 3GNGA 2CZ1B 1TU0B 3LH5A 5GAMe 4J5YA 2QEXT 2KRNA 2L5QA 1VQMT 1WHJA 3GNFB 2HNIA 3NGPA 2QGGA 1PHTA 3RDVA 3VS4A 2OAWA 3DLMA 1IB8A 5D6XA 2HQEA 3C94A 2J6OA 1KC8R 1SSHA 3G71T 4QQ6A 3JSCA 1U1SA 4QT7A 1G8XA 4JS5A 2EAYA 1UJYA 2E10A 2ROTA 4E7JA 1YHQQ 2DJZA 4J6XA 4JRQA 1WDXA 3JB9H 2W0ZA 1XOVA 1KC8C 1VOMA 4JRPA 5ECAA 3EG3A 1I8FA 3I56A 1BCMA 4C8QB 5LJ3j 4J9EA 4J7FA 4P5NA 1IGQA 2RMOA 3VUBA 1O75A 4RG2A 1AWWA 3UA7A 4TVRA 2DAQA 3M4YA 2G3RA 3CCLA 4N0AC 4F04B 2MAMA 4NS5A 1JB0E 4ESRA 2JM8A 2X35A 3F70A 2DLPA 1LJOA 1YCYA 5DLQE 1JBMA 1G5VA 2FVUA 3NPFA 4MMLA 2QA4T 5GAN4 3CXCS 2DD4A 4LNPA 1JJ2S 4BUGA 3VS1A 2KK4A 3H6ZA 3VRYA 2M16A 3EFOB 4E7IA 1PKSA 1SG5A 5IHIA 2RI5A 2VV5A 4BD3A 1T3SA 1PNJA 3C4SA 2VWFA 1AVZC 4JJBA 4LE9A 2EYXA 4RTWA 5LJ5e 2O4XB 2NUTA 4A4KA 3I5RA 4OB0B 3JCMJ 3CC4A 1C1AA 4F7UA 3NFCA 1X2QA 2DBKA 4M75D 1LOJA 2MF2A 5GAOq 1TS9A 1VQNA 1I4K1 2YUNA 2K79A 3JCMV 3TVTA 5I22A 1ZHIA 3M0PA 2NUTB 4OP0A 1WHKA 4ZNXA 1EX4A 3CMAQ 4F7UB 3OQ5A 2ECZA 2KYMA 1G83A 2DXCA 4KGXB 1N8RR 1JU5C 1VQPQ 1S72A 2OTJA 1M90U 4ANJA 2CDTA 2F2WA 4M75E 2E70A 2CT3A 2DRMA 2LP5A 1Q86R 2E41A 3L2VA 1VQ7T 4M78C 2RJDA 3JB9F 1GCQA 2DL3A 1WJRA 3BDLA 2COWA 1QVGP 1UECA 1ZUUA 3LH0A 1WYXA 1E6HA 4L5GA 1W4SA 3H0FA 3JCMf 1N8RC 2JMCA 5IN1A 4GLMA 1QWFA 1Q86C 3RR6A 4KUIA 4OF1A 2DKGA 1Q7YR 3VUZA 3JAME 1N9RA 3LGFA 4OVAA 1QMCA 1K0SA 3CPWA 1W2BA 5KYNA 4C92E 4C0DC 2PQWA 2RJFA 2C0TA 4M77A 2SEMA 3MEWA 4GY5A 1Y96A 3VS7A 5GAMf 4EMGA 1KQ2A 2BE7D 3CCEA 4M77B 3HL8A 1WFWA 4F14A 1AEYA 1Y96B 4C0ZA 2DVJA 1OQKA 2BZXA 3BE3A 3J81E 1WQ7A 2JUFA 4BDYA 3SWNC 1HK9A 1QKXA 4BB7A 2O9VA 4C5EA 1HSQA 4BE2A 4M7DF 4KH1B 3O8VA 5HKCA 1V29B 5CKBA 4FW1A 1PRMC 4QW2A 2QAZA 2MYSA 5KE2A 3WXMB 3CCRA 4OMPA 3MEAA 4HCZA 4LDWA 4B9XA 2EW3A 2EBPA 5CVIA 5FLXE 2X4JA 4PKCC 2FPEA 1FX7A 1M1GA 3JV3A 2K9GA 1VQ9T 3TSWA 2JOYA 2YRVA 1YJ9T 4PJOC 2DL5A 3LWHA 2MK5A 2DL8A 1QKWA 3CCSQ 2K2MA 2ENMA 3M54A 3PE0A 1UJ0A 3CPFA 4PFZA 3CCJA 5LJ3e 3L2RA 1NZ9A 1NLOC 1JO8A 3OYAA 3OSVA 4M7AB 4X1VA 1BK2A 3OYJA 4F7UG 2P84A 4N4IA 3I55T 5LJ5f 2V8IA 5LJ3d 4NL3A 5EG2A 1YBYA 4BE1A 3AHUA 3OYBA 2DL4A 1VQ7Q 3JCMQ 3OA6A 1M8MA 1KG1A 2MPXC 3G6ET 5GMKj 4FCYA 3QDFA 4DBHA 1KQSS 5CK9A 2GFAA 4ELYC 1M3AA 2RQVA 2NYSA 1GBQA 2LQNA 1MV0B 1WA7A 2DETA 2KDSA 3ZL7C 5M9OA 2A37A 4QVZA 3A8OB 2KGTA 3QWXX 2LMJA 2Z0WA 2EYZA 5GAOl 2DD5A 3L2UA 2FZGB 1UGSB 4MZMA 1PD0A 3E9GA 1VIEA 1D0YA 2CREA 3I5SA 5KYWB 3WVEB 1ABQA 4ATOA 3CD6T 1QWEA 4PK4A 1YWPA 4M77G 1PC0A 2DRKA 4HXJA 2FPDA 2K57A 1AOJA 2FL7A 3LLRA 3CMET 3OMGA 1GFCA 2F5TX 1I5LA 4PJMA 1CKAA 2AZSA 3I56Q 1OV3A 5LJ3g 4IKFA 2PUOB 5FU7C 1VA7A 5KYYA 5GAMj 4E47A 2C0OA 4XTUA 3U23A 4IUTA 2BTTA 4HCBA 1ZUYA 4ZN1A 3N5BB 5GANe 2P4TA 4J9CA 2LRQA 1N8RU 2KRMA 2RF0A 4ZGDB 3OYFA 3A8HB 1V76A 3P8BB 1YFNA 3TCJA 3TU4K 3CMAA 2YLCA 3OB9A 2DL7A 2IVWA 3EG1A 2QQAA 1ZSZA 4R55A 1VQPA 3OW2A 1XQHA 4B9WA 4OB1B 4C8QD 2F5KA 1VQ9Q 1Q81U 1ZBXA 1OYXA 4FL6A 1Y07A 2DZCA 2KYBA 1BB9A 1NPPA 1VQNQ 1D0ZA 2DEUA 3A98A 2JS2A 1Z9ZA 1RABB 2O01E 4C8QE 2QEXA 2HQHA 1VQMA 2YSQA 5KYXB 2LCLA 2OTJQ 2HEQA 2L3SA 3MP6A 1QVFP 3I55Q 3HP9A 1YI2T 2QXFA 2HL5C 1M2VA 3DKMA 3MP1A 6AT1B 2LTOA 3OBYA 2JXBA 1YIJT 3QSUA 2HSPA 1D1CA 4OGCA 4BDZA 4N4HA 2J6KA 1T0HA 3G71A 5A2QE 5IT9E 5HK0A 3QPHA 1M27C 2ZGWA 3G6EQ 3LGLA 1R8OB 2NUPB 4OMFB 2DYIA 2KXCA 2L0AA 1Y57A 2RQRA 8ATCB 5LJ5j 2HKNA 2FB7A 8AT1B 1VUBA 2XG8D 4ZTJA 2GNCA 3E2UA 2LJ3A 3EHQA 2O9SA 2M9UA 4BI3A 1U3OA 1K9MC 1M9SA 4ZTFA 2LT4A 4M75C 2EYWA 2CSIA 2ATCB 4JUVA 1UGPB 3S3OA 3CC2T 2FRYA 1G3WA 4LXCA 5CQYA 1QVPA 3EFRA 4X9DA 1UEBA 2P4RA 3HRUA 4NL2A 5GAN6 2DEQA 5KH6A 4M7DB 4N0AA 1QCFA 4RCBA 1M3CA 5KYUA 1GCPA 2KSSA 2QA4A 4R56A 5FROA 3CMEQ 1FMKA 2A7YA 5CR2A 2IIMA 2LCSA 4C92C 3OYEA 2K6DA 2PU9B 2FHDA 4AG1C 3ER0A 1PG5B 3HHTB 3META 3PNWC 2YT6A 4EPCA 1SHGA 2C06A 5I2MA 1ZX6A 3EG0A 3HSBA 2KBTA 2X3XD 3RMQA 4JDSA 3A8LB 2E6ZA 4MZPA 1B07A 1OEBA 4ZGJB 1QVGS 1T3LA 4AFQC 3EH2A 1M2OA 3JCMe 1BBZA 4EMKB 2ED0A 3L2ZA 4RCCA 2E65A 2PZ1A 1Q82C 1V1CA 2X4XA 3H8ZA 3QBYA 4JPBW 4PL6A 1YCSB 2ZPEB 2Y90A 4QQGA 3JCMd 1M3BA 3OYIA 1VYVA 1VQ7A 2K2VA 1VQOT 3O5ZA 3X25B 3V7CA 2VC8A 2YLBA 4JJNK 1VQLT 3CCJQ 3OYKA 3TQ7P 2EJGA 3QYGB 2CT4A 4M78A 3UWNA 5FWBA 2DPPB 2EPDA 3CCUT 3JB9G 1K73R 2BUDA 3REAB 4E7HA 1M8VA 1WNLA 1TH7A 3QYHB 1OU9A 2BE9B 3DLLA 2FPFA 3E9FA 4PJNA 1W2BP 4J6YA 2P0QA 5GAMd 2K4YA 5CKDA 2CUDA 1YI2Q 3M58A 2XKOC 2DA9A 3KXTA 2J7IA 1C0MA 3JB9I 3GBQA 1YIJQ 1ZSGA 1PWTA 3C0CA 1K76A 1BCOA 1U06A 1AWXA 4OMNA 4A54A 1E6GA 2LDMA 2D9TA 2H3JA 2CZ7B 4BI4A 4LDYA 4AFZC 3OS0A 2WSCE 3MP8A 3RBBB 2E64A 4M7AD 1JXOA 1AHJB 1H641 2HDAA 2OI3A 2JJ9A 4IIOA 2FO0A 3CCMT 3H41A 3VU3C 4C5HA 1X6BA 2SRCA 2L8DA 4X34A 4GBQA 1UGRB 1MV3A 3SWNA 1YITT 3FB9A 1I81A 2E5QA 2CH4A 2HQXA 4M7AE 5GAN3 3FJPA 2JS0A 2EQKA 2RPNA 2COYA 4MDWA 1M1KR 3PFSA 2ZCFB 2DXUA 1OZ2A 2YUOA 4M7DG 4ELZC 2V8JA 2E3IA 2PNIA 2RNAA 1D0XA 4BY6B 5DLOA 2LC4A 5GAMg 2XU8A 4DBFA 4KGVB 1VQ8T 2QI2A 3SB2A 3VYHB 3LW5E 5GAOp 3X20B 3GOXA 2BKDN 1M1KC 1VQ9A 1Y0MA 1WXBA 2M51A 4BI8B 2ED1A 4RTZA 2DNUA 4MDXA 1YJ9A 1F1BB 4DOVA 1EIFA 3UPUA 1E7OA 5LJ5d 4PJOA 2LZ6B 1G3YA 3JCMb 1H92A 1NJIU 5FU6C 1K9MU 5IH2A 4DEYA 4WF2A 4CC4B 2PUKB 3URGA 3INZA 1RAEB 2EWNA 3P8HA 3I55A 1XTDA 1D1AA 4E7KA 3VKIA 2DTHA 4Y28E 4IUQA 4RUGA 5CQXA 1Y7XA 4A63B 4C92D 1WIEA 1AZGB 4FYWB 1UTIA 2DILA 2GF7A 1OPLA 3G6EA 1IZ6A 2QEXQ 3CCUQ 5GANj 1VQMQ 2RI2A 4JRIA 2RQTA 3UF4A 2EQMA 2ZPBB 1HYOA 1QCOA 1C6VX 2ZPHB 2XDPA 3M57A 4KRTA 2CP2A 4Z88A 5A0GA 3RKXA 3G71Q 1KHIA 1NBEB 2VUBA 5GAOn 2XDBA 4KT0E 1LNXA 1Z9QA 1Q7YC 4CI0C 3THKA 3G1JA 4RG8A 4HVUA 5LJ5g 4V2SA 1ZA1B 3FRNA 3CD6A 2HBPA 1WX6A 3OMCA 4C8QC 1JQQA 4Z8AA 4DEXA 3E19A 2NUZA 1X43A 3CMEA 2A3LA 4J9BA 1Q82U 4FYXB 1N27A 3CBMA 2CP3A 4E7SA 4EDUA 1OZ3A 4O6JA 2OJ2A 4FSSA 1RLQC 2KNBB 4XTXA 5DM7R 1XJWB 3BW1A 3V7SA 2C0IA 2EQIA 2GTOA 1YITQ 3L1AA 4KBMB 1TG0A 1VIFA 1HXDA 1MMGA 1ZQ1A 2NLUA 3X26B 2QQRA 2QA4Q 2A36A 1I5OB 1KD1R 4XTYA 5D7UA 1K0XA 3R6NA 4JZ3A 4J8OA 2E6NA 4QVDA 3OW2P 4CC3A 5CKFA 1QW1A 1VQ8Q 1WJQA 2HKQB 2VB6A 5I11A 4ORZA 4DOWA 1QVFS 1KD1C 1N9SA 5GAMh 3X24B 3M0QA 2KY9A 3RESA 3JRZA 3MKDA 3EGDA 3L2QA 4JS4A 1IHVA 2AZVA 5FRNA 4E2FB 1KC8U 1GRIA 1B7TA 4XTWA 4XK8E 2IPOB 4B6MA 1NYFA 4M7DD 1WHLA 1PSFA 2DFUA 5HK3A 1AWJA 2ESWA 2EFIA 1KFZA 4FT4A 2DMOA 1YI2A 1MMAA 1RLPC 1SF9A 2V26A 4WCIA 1WPYA 2YUQA 1YIJA 5GAOm 4M7DE 3H0HA 4OMMA 4M78F 1YJNT 1CKBA 1BU1A 2B86A 2CKKA 4KH0B 1NEBA 1ABOA 4OB2B 4IUPA 2DJQA 5CAIA 1RAGB 5GMKi 2D0QB 2RJCA 2D6FA 3VYGA 1AD5A 4FT2A 2QK0A 4IURA 4JJCA 4ZGEB 1OX9A 1PKTA 1UGQB 4FSXA 4C0GA 1YJWT 4A4HA 4LD9K 2M02A 1H8KA 2RHZA 3QWYA 1X69A 5CCAA 1PD1A 5HY6A 3VS0A 3DB3A 4M75A 3ZFJA 1KIKA 3CC2A 3WVDB 5CKEA 2E5KA 1X27A 3OS1A 2CP6A 1N6AA 4Q5WA 5J26A 3MHXA 3M9QA 3CC7T 2JTFA 4J7IA 5KCHA 2KR3A 2X3WD 5LJ5h 2W10A 4KULA 3SFMA 3PTAA 4NOYA 2VYTA 5KYYB 2YWWA 5FW9A 3OYGA 2GGRA 3EG9A 1WHGA 1YNZA 5J3BA 4J9GA 1Q86U 2HL3A 4N4GA 5D6WA 5GANd 3SEMA 2F2VA 3OYNA 3C95A 2YHTA 1MNDA 4UC4A 4FM4B 1DJ7B 1VQ6T 1TOVA 1D1BA 3RUXA 1W2BS 1T0JA 4E7ZA 3JCMP 1ZSZB 1YJ9Q 1Q7YU 1KQ1A 2GTJA 4EIKA 3SDZA 4IUUA 3EG2A 2OAUA 1VQOA 1PRLC 2ZAEA 4M7AC 3C12A 3CCVT 1MUZA 2LT1A 4PJOF 7AT1B 2EKHA 2ZZDA 3V8KA 2V1QA 3ULRB 1OULA 3CCUA 2K7AA 3NTIA 2J05A 4C5GA 3DB4A 3CQTA 3EH1A 2KRSA 3CXCA 1VQKT 2ZPFB 4XTVA 4LUDA 1JJ2A 2Y4YA 5L8RE 4J9IA 3J7AF 1UDLA 2DZ9A 3RMSA 4Y92A 2BZ8A 3QZ5B 3RKWA 2HD0A 2RA2A 1M2VB 2RJEA 2EGCA 1RAAB 3KUFA 2G6FX 3FIFA 4PJJA 1BI1A 3EAEA 1B3QA 5GANg 1YJNQ 5IAYA 4R0KA 2A28A 3FC3A 2RD1A 4RTXA 1YHQT 5LL6S 1JRIA 1M90R 3CCQT 1WJSA 3MEVA 3Q1JA 3UDCA 2AK5A 4Z89A 4CC2A 5FRMA 1YJWQ 1KD1U 3CCMA 3E1SA 5I21A 4FYYB 1LVKA 3M0SA 1ACMB 4F7UE 2QGFB 1OU8A 1YITA 1H3ZA 3SHWA 3CD6Q 4BACA 1U8RA 1M90C 3LYIA 1PSEA 2MIOA 4CRIA 1N5ZA 4XAXB 3OYYA 1AWOA 2P0PA 2EQUA 3V8JA 2DTOA 1G2BA 3CC7Q 1TTHB 3ZBDA 4RTUA 5KYUB 4JLGA 1VQ8A 4RTTA 2MI6A 1MMDA 5CIUA 2JMAA 1Y71A 1RI9A 4WTOB 1OOTA 2FYKA 5LJ3h 4JZ4A 1QP3A 2DTIA 2X51A 1VQ4T 2MWOA 1X6OA 3OYDA 3FDRA 2ZPIB 2OTLT 4F16A 1WLPB 1NEGA 4M77D 4QVCA 2GBQA 4LDUA 4E7LA 2E3HA 2EYYA 1CSKA 2CP0A 2D8JA 1WHHA 4M4ZA 3QO3A 5IXBA 4JLIA 3A5ZB 1OI1A 2RO0A 4C0FA 1VYUA 1X2KA 1VQ6Q 3OYHA 4M77E 1NM7A 5D6YA 2XMFA 2VXEA 2CS7A 4AG2C 1NPRA 1WZOA 2XDDA 1M1FA 2RQWA 2R58A 3LX7A 3QUIA 3VS6A 3REBB 4L59A 3CCVQ 1UB4A 2R5MA 4AFUC 3CPWP 4M78B 1B34A 2D0NA 1TUGB 1WI7A 2LJ1A 3G4ST 3RNJA 2RN8A 1VQKQ 2KROA 2AKLA 4LD6A 4E6RA 2V1RA 3M5AA 1K73C 1ZUKA 1B34B 5J39A 2A08A 2CZ0B 1U1TA 2LNHB 4JRKA 2XD0A 5IHKA 2XK0A 4ME7A 1QVFA 4PFPA 4RTYA 3MO8A 4D6WA 5IHNA 4C0DB 1LCKA 3MCAB 3VRZA 4OMLA 2E4HA 5GAN7 5GJVB 3CBPA 3QIIA 1IGUA 2KI7A 3JCMg 2L3RA 3VV0A 2RK1A 5GANh 3CCQQ 4C8QA 4J6WA 2QG9B 1FMVA 3PIPA 2PVDB 3OW2S 2XI9A 1I0CA 2RK2A 4M75F 3CC2Q 2K5LA 1HJDA 4M7DC 4HVVA 2VGMA 2AKKA 1MHNA 5L23A 1VQ5T 5CO7A 3LWIA 2DIQA 2RQUA 2LJ0A 2CP7A 3SWNB 2M0YA 3M55A 1KQSA 2RHYA 2J06A 1K1ZA 2HCKA 4HA8A 5GJWB 2LQKA 2P0KA 4DA4A 2YDLA 1BI3A 3GPLA 2GQIA 1IHWA 3EFOA 1FMWA 3BFMA 3OBWA 2DM1A 1KK7A 2VKNA 2QQSA 3VS5A 2LQWA 3H9NA 2KXDA 4O5VA 3VJPA 2RB6A 3JCMX 4C92F 2O4XA 2QQBA 2DX1A 5HCKA 1WQWA 1VQ4Q 2EVRA 3NTKA 4DBRA 3OY9A 4MZTA 2AT1B 4EMKC 3FLGA 2OTLQ 2FZCB
chains in the Genus database with same CATH topology
4F17A 3M0QA 1SPKA 2KE9A 2JM9A 1SEMA 1SRLA 2AZVA 2EGAA 2L3PA 2F2XA 2NWMA 1GRIA 2KYBA 1BB9A 3I35A 2MCNA 1NYFA 2D1XA 2K3BA 1OPKA 4CC7A 1GFDA 1GL5A 1AWJA 2ESWA 4LUEA 3A98A 2JS2A 1KFZA 4JJDA 1Z9ZA 2O88A 1I07A 2JW4A 2DMOA 4HVWA 1RLPC 1UUEA 2YSQA 1IO6A 5FWCA 4WCIA 1GBRA 1W1FA 3LH5A 2HEQA 2L3SA 2YUQA 2KRNA 3I9QA 1U5SA 3H0HA 4K11A 4OMMA 3NGPA 1M30A 2JXBA 1PHTA 2HSPA 2J6KA 1T0HA 1CKBA 1BU1A 2B86A 3VS4A 1NEBA 3VS3A 2OAWA 1ABOA 1M27C 2DJQA 2J6OA 2DF6A 1SSHA 2KXCA 2L0AA 1Y57A 2O31A 2RQRA 4QT7A 2YUPA 1AD5A 2GNCA 4JJCA 1UJYA 2LJ3A 1PKTA 3EHQA 2O9SA 2ROTA 1H8KA 3QWYA 1U3OA 1X69A 4AFSC 4HCKA 1WDXA 3M0UA 1H3HA 2W0ZA 1YWOA 1XOVA 5IXFA 3VS0A 1VYTA 1KIKA 2EYWA 2CSIA 1QLYA 2E5KA 1NYGA 5ECAA 1X27A 3UATA 3EG3A 3EGUA 4J9EA 2VVKA 2FRYA 2RMOA 1AWWA 2KEAA 3PVQA 3UA7A 2P4RA 2KR3A 2X3WD 1QCFA 2ABLA 4ESRA 2JM8A 1M3CA 2W10A 1GCPA 2DLPA 1TUDA 2JTEA 4J9FA 1S1NA 1FMKA 1AZEA 3NPFA 5FW9A 2IIMA 2EGEA 2LCSA 2GGRA 2JT4A 4LNPA 2K6DA 1YNZA 2FEIA 4AG1C 3VS1A 3VRYA 4J9GA 1NG2A 2YT6A 1PKSA 5IHIA 1SHGA 1T3SA 1PNJA 2VWFA 4IIMA 1AVZC 1ZX6A 3EG0A 3SEMA 2F2VA 2KBTA 2X3XD 4JJBA 4LE9A 2EYXA 2ROLA 1B07A 1OEBA 4RTWA 1FYNA 1T3LA 4D8DA 4AFQC 1NLPC 3I5RA 1X2QA 1BBZA 2DBKA 1T0JA 1W70A 2ED0A 2YUNA 2K79A 3TVTA 2GTJA 5I22A 4EIKA 3M0PA 2PZ1A 1V1CA 3EG2A 4ZNXA 1PRLC 4JPBW 1YCSB 2ECZA 2KYMA 1MUZA 1M3BA 1VYVA 3NHNA 1G83A 3TSZA 1JU5C 2EKHA 3O5ZA 2V1QA 3ULRB 2CDTA 2F2WA 3VS2A 2K7AA 2BZYA 2CT3A 2DRMA 2LP5A 2J05A 1UFFA 3KFVA 2CT4A 3CQTA 1GCQC 1GCQA 2LX7A 2KRSA 5FWBA 2EPDA 2DL3A 4LUDA 1UECA 1ZUUA 3REAB 4J9IA 1WYXA 1UGVA 1E6HA 1UDLA 3H0FA 2HBWA 3M0TA 2JMCA 4Y92A 2FPFA 2BZ8A 2FRWA 4GLMA 1QWFA 2CUDA 2EGCA 2DYBA 2DA9A 1UG1A 2G6FX 2J7IA 1B3QA 1ZBJA 3GBQA 1ZSGA 1PWTA 4R0KA 1K0SA 2A28A 3C0CA 1K76A 1U06A 1AWXA 4OMNA 1UHCA 2C0TA 2SEMA 4RTXA 1E6GA 2CSQA 3VS7A 4AFZC 3RBBB 2AK5A 4Z89A 5EC7A 4CC2A 1WFWA 4F14A 1AEYA 1JXOA 1X6GA 2DVJA 2HDAA 2OI3A 4IIOA 2BZXA 3M0SA 3M0RA 2FO0A 3H41A 3SHWA 2FG0A 1X6BA 2SRCA 1WXUA 2MIOA 4GBQA 1MV3A 1N5ZA 1AWOA 1QKXA 4J9DA 2CH4A 2O9VA 3H0IA 1G2BA 2JS0A 2I0NA 1JEGA 1HSQA 2RPNA 3FJ5A 3EHRA 4RTUA 2YUOA 4RTTA 2PNIA 2RNAA 1I1JA 1K9AA 2JMAA 1HD3A 1RI9A 1OOTA 1PRMC 4JZ4A 4D8KA 4OMPA 1KSWA 2EW3A 4F16A 1WLPB 2EBPA 1Y0MA 1NEGA 1WXBA 2M51A 2ED1A 2GBQA 4RTZA 1WXTA 2DNUA 2FPEA 2EYYA 3JV3A 1CSKA 2D8JA 4OMOA 2K9GA 4M4ZA 3TSWA 1E7OA 2DBMA 5IXBA 2DL5A 2LZ6B 1H92A 2DL8A 1QKWA 1VYUA 1X2KA 1KJWA 1K4US 2K2MA 2ENMA 1J3TA 1YP5A 3PE0A 4OMQA 1UJ0A 4DEYA 1NM7A 5IH2A 4CC4B 2XMFA 3UA6A 3NMZC 1NLOC 4AG2C 1JO8A 4X1VA 2RQWA 1BK2A 4RUGA 3VS6A 1ARKA 3REBB 1A0NB 2MOXA 4J9HA 4A63B 1WIEA 4AFUC 1AZGB 1JXMA 1UTIA 2CH4W 2DILA 1OPLA 2D0NA 1WI7A 2DL4A 2LJ1A 2H8HA 3RNJA 2RN8A 1M8MA 2KROA 2AKLA 2RQTA 4E6RA 2V1RA 3UF4A 1ZUKA 1M3AA 2RQVA 2A08A 1GBQA 2LQNA 2LNHB 1MV0B 1WA7A 4KRTA 3ZL7C 2A37A 5IHKA 4Z88A 2DE0X 2CUBA 2KGTA 3QWXX 4RTYA 5IHNA 1Z9QA 2LMJA 1LCKA 3VRZA 3THKA 4OMLA 4HVUA 2EYZA 5GJVB 1EFNA 2O2OA 2PTKA 1WX6A 1W6XA 2CREA 1JQQA 3I5SA 4Z8AA 1ABQA 1YN8A 4DEXA 2NUZA 1I0CA 1X43A 1QWEA 1YWPA 4J9BA 2DRKA 4HXJA 1HJDA 2FPDA 4HVVA 3PVLA 2D8HA 1AOJA 1GFCA 2AKKA 5L23A 1CKAA 2AZSA 2OJ2A 4FSSA 1OV3A 2RQUA 2LJ0A 1RLQC 2KNBB 2M0YA 1ZLMA 1VA7A 2C0OA 1TUCA 2C0IA 3U23A 2J06A 2EQIA 2GTOA 2KT1A 1K1ZA 2HCKA 1TG0A 5GJWB 1SHFA 2BTTA 3IQLA 1ZUYA 2KT8A 2L2PA 2YDLA 2GQIA 2A36A 1UHFA 1SRMA 4J9CA 2DM1A 2VKNA 3VS5A 2J6FA 1K0XA 3R6NA 2KRMA 2LQWA 2KXDA 2RF0A 4JZ3A 2QDLA 4CC3A 2L3QA 4RTVA 2DX1A 5HCKA 2EVRA 4LN2A 5I11A 4ORZA 1RUWA 1UE9A 2DL7A 3EG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F17 A;  3M0Q A;  1SPK A;  2KE9 A;  2JM9 A;  1SEM A;  1SRL A;  2AZV A;  2EGA A;  2L3P A;  2F2X A;  2NWM A;  1GRI A;  2KYB A;  1BB9 A;  3I35 A;  2MCN A;  1NYF A;  2D1X A;  2K3B A;  1OPK A;  4CC7 A;  1GFD A;  1GL5 A;  1AWJ A;  2ESW A;  4LUE A;  3A98 A;  2JS2 A;  1KFZ A;  4JJD A;  1Z9Z A;  2O88 A;  1I07 A;  2JW4 A;  2DMO A;  4HVW A;  1RLP C;  1UUE A;  2YSQ A;  1IO6 A;  5FWC A;  4WCI A;  1GBR A;  1W1F A;  3LH5 A;  2HEQ A;  2L3S A;  2YUQ A;  2KRN A;  3I9Q A;  1U5S A;  3H0H A;  4K11 A;  4OMM A;  3NGP A;  1M30 A;  2JXB A;  1PHT A;  2HSP A;  2J6K A;  1T0H A;  1CKB A;  1BU1 A;  2B86 A;  3VS4 A;  1NEB A;  3VS3 A;  2OAW A;  1ABO A;  1M27 C;  2DJQ A;  2J6O A;  2DF6 A;  1SSH A;  2KXC A;  2L0A A;  1Y57 A;  2O31 A;  2RQR A;  4QT7 A;  2YUP A;  1AD5 A;  2GNC A;  4JJC A;  1UJY A;  2LJ3 A;  1PKT A;  3EHQ A;  2O9S A;  2ROT A;  1H8K A;  3QWY A;  1U3O A;  1X69 A;  4AFS C;  4HCK A;  1WDX A;  3M0U A;  1H3H A;  2W0Z A;  1YWO A;  1XOV A;  5IXF A;  3VS0 A;  1VYT A;  1KIK A;  2EYW A;  2CSI A;  1QLY A;  2E5K A;  1NYG A;  5ECA A;  1X27 A;  3UAT A;  3EG3 A;  3EGU A;  4J9E A;  2VVK A;  2FRY A;  2RMO A;  1AWW A;  2KEA A;  3PVQ A;  3UA7 A;  2P4R A;  2KR3 A;  2X3W D;  1QCF A;  2ABL A;  4ESR A;  2JM8 A;  1M3C A;  2W10 A;  1GCP A;  2DLP A;  1TUD A;  2JTE A;  4J9F A;  1S1N A;  1FMK A;  1AZE A;  3NPF A;  5FW9 A;  2IIM A;  2EGE A;  2LCS A;  2GGR A;  2JT4 A;  4LNP A;  2K6D A;  1YNZ A;  2FEI A;  4AG1 C;  3VS1 A;  3VRY A;  4J9G A;  1NG2 A;  2YT6 A;  1PKS A;  5IHI A;  1SHG A;  1T3S A;  1PNJ A;  2VWF A;  4IIM A;  1AVZ C;  1ZX6 A;  3EG0 A;  3SEM A;  2F2V A;  2KBT A;  2X3X D;  4JJB A;  4LE9 A;  2EYX A;  2ROL A;  1B07 A;  1OEB A;  4RTW A;  1FYN A;  1T3L A;  4D8D A;  4AFQ C;  1NLP C;  3I5R A;  1X2Q A;  1BBZ A;  2DBK A;  1T0J A;  1W70 A;  2ED0 A;  2YUN A;  2K79 A;  3TVT A;  2GTJ A;  5I22 A;  4EIK A;  3M0P A;  2PZ1 A;  1V1C A;  3EG2 A;  4ZNX A;  1PRL C;  4JPB W;  1YCS B;  2ECZ A;  2KYM A;  1MUZ A;  1M3B A;  1VYV A;  3NHN A;  1G83 A;  3TSZ A;  1JU5 C;  2EKH A;  3O5Z A;  2V1Q A;  3ULR B;  2CDT A;  2F2W A;  3VS2 A;  2K7A A;  2BZY A;  2CT3 A;  2DRM A;  2LP5 A;  2J05 A;  1UFF A;  3KFV A;  2CT4 A;  3CQT A;  1GCQ C;  1GCQ A;  2LX7 A;  2KRS A;  5FWB A;  2EPD A;  2DL3 A;  4LUD A;  1UEC A;  1ZUU A;  3REA B;  4J9I A;  1WYX A;  1UGV A;  1E6H A;  1UDL A;  3H0F A;  2HBW A;  3M0T A;  2JMC A;  4Y92 A;  2FPF A;  2BZ8 A;  2FRW A;  4GLM A;  1QWF A;  2CUD A;  2EGC A;  2DYB A;  2DA9 A;  1UG1 A;  2G6F X;  2J7I A;  1B3Q A;  1ZBJ A;  3GBQ A;  1ZSG A;  1PWT A;  4R0K A;  1K0S A;  2A28 A;  3C0C A;  1K76 A;  1U06 A;  1AWX A;  4OMN A;  1UHC A;  2C0T A;  2SEM A;  4RTX A;  1E6G A;  2CSQ A;  3VS7 A;  4AFZ C;  3RBB B;  2AK5 A;  4Z89 A;  5EC7 A;  4CC2 A;  1WFW A;  4F14 A;  1AEY A;  1JXO A;  1X6G A;  2DVJ A;  2HDA A;  2OI3 A;  4IIO A;  2BZX A;  3M0S A;  3M0R A;  2FO0 A;  3H41 A;  3SHW A;  2FG0 A;  1X6B A;  2SRC A;  1WXU A;  2MIO A;  4GBQ A;  1MV3 A;  1N5Z A;  1AWO A;  1QKX A;  4J9D A;  2CH4 A;  2O9V A;  3H0I A;  1G2B A;  2JS0 A;  2I0N A;  1JEG A;  1HSQ A;  2RPN A;  3FJ5 A;  3EHR A;  4RTU A;  2YUO A;  4RTT A;  2PNI A;  2RNA A;  1I1J A;  1K9A A;  2JMA A;  1HD3 A;  1RI9 A;  1OOT A;  1PRM C;  4JZ4 A;  4D8K A;  4OMP A;  1KSW A;  2EW3 A;  4F16 A;  1WLP B;  2EBP A;  1Y0M A;  1NEG A;  1WXB A;  2M51 A;  2ED1 A;  2GBQ A;  4RTZ A;  1WXT A;  2DNU A;  2FPE A;  2EYY A;  3JV3 A;  1CSK A;  2D8J A;  4OMO A;  2K9G A;  4M4Z A;  3TSW A;  1E7O A;  2DBM A;  5IXB A;  2DL5 A;  2LZ6 B;  1H92 A;  2DL8 A;  1QKW A;  1VYU A;  1X2K A;  1KJW A;  1K4U S;  2K2M A;  2ENM A;  1J3T A;  1YP5 A;  3PE0 A;  4OMQ A;  1UJ0 A;  4DEY A;  1NM7 A;  5IH2 A;  4CC4 B;  2XMF A;  3UA6 A;  3NMZ C;  1NLO C;  4AG2 C;  1JO8 A;  4X1V A;  2RQW A;  1BK2 A;  4RUG A;  3VS6 A;  1ARK A;  3REB B;  1A0N B;  2MOX A;  4J9H A;  4A63 B;  1WIE A;  4AFU C;  1AZG B;  1JXM A;  1UTI A;  2CH4 W;  2DIL A;  1OPL A;  2D0N A;  1WI7 A;  2DL4 A;  2LJ1 A;  2H8H A;  3RNJ A;  2RN8 A;  1M8M A;  2KRO A;  2AKL A;  2RQT A;  4E6R A;  2V1R A;  3UF4 A;  1ZUK A;  1M3A A;  2RQV A;  2A08 A;  1GBQ A;  2LQN A;  2LNH B;  1MV0 B;  1WA7 A;  4KRT A;  3ZL7 C;  2A37 A;  5IHK A;  4Z88 A;  2DE0 X;  2CUB A;  2KGT A;  3QWX X;  4RTY A;  5IHN A;  1Z9Q A;  2LMJ A;  1LCK A;  3VRZ A;  3THK A;  4OML A;  4HVU A;  2EYZ A;  5GJV B;  1EFN A;  2O2O A;  2PTK A;  1WX6 A;  1W6X A;  2CRE A;  1JQQ A;  3I5S A;  4Z8A A;  1ABQ A;  1YN8 A;  4DEX A;  2NUZ A;  1I0C A;  1X43 A;  1QWE A;  1YWP A;  4J9B A;  2DRK A;  4HXJ A;  1HJD A;  2FPD A;  4HVV A;  3PVL A;  2D8H A;  1AOJ A;  1GFC A;  2AKK A;  5L23 A;  1CKA A;  2AZS A;  2OJ2 A;  4FSS A;  1OV3 A;  2RQU A;  2LJ0 A;  1RLQ C;  2KNB B;  2M0Y A;  1ZLM A;  1VA7 A;  2C0O A;  1TUC A;  2C0I A;  3U23 A;  2J06 A;  2EQI A;  2GTO A;  2KT1 A;  1K1Z A;  2HCK A;  1TG0 A;  5GJW B;  1SHF A;  2BTT A;  3IQL A;  1ZUY A;  2KT8 A;  2L2P A;  2YDL A;  2GQI A;  2A36 A;  1UHF A;  1SRM A;  4J9C A;  2DM1 A;  2VKN A;  3VS5 A;  2J6F A;  1K0X A;  3R6N A;  2KRM A;  2LQW A;  2KXD A;  2RF0 A;  4JZ3 A;  2QDL A;  4CC3 A;  2L3Q A;  4RTV A;  2DX1 A;  5HCK A;  2EVR A;  4LN2 A;  5I11 A;  4ORZ A;  1RUW A;  1UE9 A;  2DL7 A;  3EG1 A; 
#chains in the Genus database with same CATH topology
 2K3Y A;  3CCS T;  1RAC B;  2MWP A;  1SRL A;  4PJO B;  2DVE A;  5I2S A;  2GFU A;  2NWM A;  4A53 A;  3HFO A;  3I35 A;  2MCN A;  2QDY B;  2D1X A;  2K3B A;  1GFD A;  2RI3 A;  2Y4X A;  1VQO Q;  3J80 E;  2M0O A;  1VQL Q;  2O88 A;  3FEO A;  1I07 A;  2VGN A;  1RAD B;  2V8K A;  1UUE A;  2QYZ A;  3OS5 A;  2K5I A;  1SSF A;  2I2L A;  3S3N A;  1YJN A;  1W1F A;  4OGE A;  1GBR A;  2KAF A;  4ZN3 A;  3V8L A;  3I9Q A;  1U5S A;  4K11 A;  1BI2 A;  2QTV A;  1M30 A;  4FU6 A;  4M78 G;  9ATC B;  3VS3 A;  1D3B A;  4KGZ B;  3G4S Q;  1Q81 R;  2JZ2 A;  2DF6 A;  4A4G A;  1G3T A;  2AIR B;  3UT1 A;  1YJW A;  3TEE A;  5GMK m;  2O31 A;  2YUP A;  1D3B B;  1MMN A;  4XU3 A;  3GLX A;  3PT9 A;  4AFS C;  1RAH B;  4HCK A;  3M0U A;  2KMT A;  1H3H A;  5GMK h;  2LNV A;  1Q81 C;  1YWO A;  2GCX A;  5IXF A;  3JB9 D;  2BIV A;  1VYT A;  3QJ6 A;  2LCC A;  1QLY A;  1NYG A;  3A8M B;  4GLK A;  3V7R A;  3UAT A;  3CC7 A;  3EGU A;  3HPW A;  2XIC A;  5GMK l;  2VVK A;  3MPU B;  1FWZ A;  3CCM Q;  1MGQ A;  5KE3 A;  3R6O A;  2KEA A;  3PVQ A;  3I56 T;  2HSE B;  2YXY A;  2A0F B;  2XHC A;  4Z02 A;  2ABL A;  3OS2 A;  1TUD A;  3JCM h;  2JTE A;  4J9F A;  4C8Q G;  1S1N A;  4BY6 C;  3CCL T;  2MMP A;  5FU7 B;  1VQ5 Q;  1AZE A;  2EGE A;  1GXI E;  2JT4 A;  5KCO A;  5GAN 2;  2FEI A;  3JCM c;  3OYC A;  4MMK A;  4A4E A;  3GP8 A;  1NG2 A;  3OYL A;  1OX8 A;  1M5Q 1;  3T9N A;  4IIM A;  1K73 U;  2WSE E;  1VQ6 A;  2ROL A;  1FYN A;  2GQV A;  4RMO A;  4D8D A;  5C0M A;  2JN0 A;  4LDX A;  1NLP C;  2WAC A;  1D09 B;  1QQJ A;  3D7S B;  2KVQ G;  3M59 A;  1W70 A;  1BIB A;  4A4F A;  3CCV A;  3CC4 T;  5GAN 5;  1BI0 A;  3QXE B;  4XU2 A;  4M7A A;  2ZPG B;  3EGD B;  3CXC P;  1VQN T;  2PVO B;  1JJ2 P;  3NHN A;  3TSZ A;  2DK3 A;  4PJO G;  3RKY A;  1K8A R;  1VQK A;  3VS2 A;  2OX7 A;  1AT1 B;  2BZY A;  1UFF A;  3KFV A;  2H3E B;  3GF5 A;  1GCQ C;  2YRD A;  2LX7 A;  1S72 T;  2OTJ T;  2DO3 A;  3TRE A;  1R77 A;  1RAF B;  3A8G B;  1UGV A;  1X01 A;  3EGX A;  2HBW A;  3M0T A;  2B8A A;  2X4W A;  3NTH A;  2FRW A;  5AT1 B;  1RI0 A;  1K8A C;  1P92 A;  1X75 C;  4AT1 B;  3P8D A;  1G3S A;  2DYB A;  1QVG A;  4KUD K;  1UG1 A;  2EKO A;  2F69 A;  3EGX B;  4PJL A;  1PCX A;  5A0L A;  3QKJ A;  1ZBJ A;  4HCC A;  1YHQ A;  2PVG B;  4Y91 A;  3M53 A;  1M1K U;  2CGH A;  3CCQ A;  4QQD A;  1UHC A;  4M77 C;  2DER A;  4DQ2 A;  3RIR A;  5A0D A;  2CSQ A;  2LX9 A;  4QKU A;  1XNI A;  4FIB A;  5EC7 A;  5KYW A;  1X6G A;  4PLL A;  3CCE T;  4M75 B;  3M0R A;  3G7Z A;  2FG0 A;  1WXU A;  1IRX A;  4PLI A;  1TWB A;  5C6S A;  4X9C A;  3QG1 A;  3MJX A;  4C8Q F;  4M78 D;  3L42 A;  3JCM W;  1RAI B;  4J9D A;  3H0I A;  2E12 A;  2I0N A;  1JEG A;  3FJ5 A;  4C92 A;  3EHR A;  2EJF A;  3BDU A;  1SKU B;  1VQ4 A;  1LPL A;  1I1J A;  4IUV A;  1K9A A;  1ZA2 B;  1HD3 A;  2DXT A;  4M78 E;  3CCL Q;  2OTL A;  3CBO A;  3EG9 B;  4C92 B;  4J83 A;  4D8K A;  2EJ9 A;  4II1 A;  1WGS A;  2RHX A;  3AT1 B;  4HKE A;  4XU0 A;  1KSW A;  2RH2 A;  3HFN A;  3CCR T;  1WXT A;  1BKB A;  2VAS A;  3CPW S;  4XQ3 A;  4OMO A;  4EMH A;  2COZ A;  2DBM A;  3HTR A;  3ME9 A;  5CKH A;  1BIA A;  2HMA A;  5GAO r;  1VQL A;  1KJW A;  1K4U S;  3QHS A;  4L6V 5;  1YP5 A;  4VUB A;  1J3T A;  1FXX A;  4OMQ A;  3UA6 A;  3NMZ C;  3S3M A;  1R0C B;  5GAN 8;  2X9H A;  3CC4 Q;  2FZK B;  4F7U F;  3CCJ T;  3ASK A;  1ARK A;  3HRT A;  1A0N B;  2K3X A;  1MNE A;  3HRS A;  5KYX A;  2MOX A;  4J9H A;  3G4S A;  3A1P A;  3QJY A;  4PFO A;  1JXM A;  2CH4 W;  4M7A G;  3CEY A;  4XTZ A;  2H8H A;  3PMI A;  1M4Z A;  2L89 A;  4OB3 B;  1S72 Q;  3GIB A;  1TXQ A;  3X28 B;  4AMC A;  2HZY A;  3S6W A;  1IXD A;  2NUP A;  1BYM A;  1NJI R;  1R0B G;  4C5I A;  3PIO A;  4PNO A;  5LJ3 f;  1WHM A;  4DBQ A;  1K9M R;  2VXF A;  4RKU E;  2DE0 X;  4FW2 A;  2CUB A;  2JTM A;  2LVM A;  4XU1 A;  2KQW A;  2XID A;  4PJO D;  2F1L A;  2RM4 A;  1NJI C;  2RHU A;  1EFN A;  2O2O A;  3QZ9 B;  3L2W A;  2PTK A;  1O9S A;  1W6X A;  5AYF A;  2YRC A;  1YN8 A;  4M77 F;  2WSF E;  1VQ5 A;  1KQS P;  2IG0 A;  4HT8 A;  2QTX A;  4PJO E;  1QCN A;  3OYM A;  3PVL A;  3CCE Q;  4M7D A;  2D8H A;  4M75 G;  2EIF A;  4YTL A;  2R5A A;  5DY9 A;  2CZ6 B;  3M4G A;  1ZLM A;  2EYQ A;  2QAS A;  2DIG A;  1TUC A;  2KT1 A;  1SHF A;  2HAX A;  3IQL A;  2KT8 A;  2L2P A;  1TSF A;  2QQ9 A;  3RER A;  1UHF A;  2DXB A;  3PGG A;  1SRM A;  2CYZ B;  5GMK e;  2J6F A;  3KBG A;  1K8A U;  2E1H A;  2QDL A;  3JB9 J;  1EZZ B;  2L3Q A;  1IRE B;  4RTV A;  1RL2 A;  4BE0 A;  1PM3 A;  2EQJ A;  4C92 G;  4HT9 A;  4LN2 A;  1RUW A;  3CCS A;  1UE9 A;  1Q82 R;  4FYV B;  3SD4 A;  4EMK A;  3HKS A;  1ZSZ C;  2JNG A;  3CMA T;  4F17 A;  1KHC A;  3CCR Q;  1NE8 A;  3M56 A;  4LDV A;  1SPK A;  2KE9 A;  2JM9 A;  2JVV A;  2CP5 A;  1SEM A;  3BY7 A;  3ZEH A;  2EGA A;  2L3P A;  2M1H A;  1VQP T;  1QP2 A;  2F2X A;  2K5F A;  2X4Y A;  2RHI A;  3EFS A;  5FU6 B;  5GAN f;  2LQ8 A;  3MEU A;  1OPK A;  4CC7 A;  1GL5 A;  2R57 A;  4LUE A;  3OSS C;  2AHJ B;  1Q95 G;  4JJD A;  4M7A F;  2JW4 A;  4HVW A;  1IO6 A;  3PMT A;  5FWC A;  3QDR B;  3GNG A;  2CZ1 B;  1TU0 B;  3LH5 A;  5GAM e;  4J5Y A;  2QEX T;  2KRN A;  2L5Q A;  1VQM T;  1WHJ A;  3GNF B;  2HNI A;  3NGP A;  2QGG A;  1PHT A;  3RDV A;  3VS4 A;  2OAW A;  3DLM A;  1IB8 A;  5D6X A;  2HQE A;  3C94 A;  2J6O A;  1KC8 R;  1SSH A;  3G71 T;  4QQ6 A;  3JSC A;  1U1S A;  4QT7 A;  1G8X A;  4JS5 A;  2EAY A;  1UJY A;  2E10 A;  2ROT A;  4E7J A;  1YHQ Q;  2DJZ A;  4J6X A;  4JRQ A;  1WDX A;  3JB9 H;  2W0Z A;  1XOV A;  1KC8 C;  1VOM A;  4JRP A;  5ECA A;  3EG3 A;  1I8F A;  3I56 A;  1BCM A;  4C8Q B;  5LJ3 j;  4J9E A;  4J7F A;  4P5N A;  1IGQ A;  2RMO A;  3VUB A;  1O75 A;  4RG2 A;  1AWW A;  3UA7 A;  4TVR A;  2DAQ A;  3M4Y A;  2G3R A;  3CCL A;  4N0A C;  4F04 B;  2MAM A;  4NS5 A;  1JB0 E;  4ESR A;  2JM8 A;  2X35 A;  3F70 A;  2DLP A;  1LJO A;  1YCY A;  5DLQ E;  1JBM A;  1G5V A;  2FVU A;  3NPF A;  4MML A;  2QA4 T;  5GAN 4;  3CXC S;  2DD4 A;  4LNP A;  1JJ2 S;  4BUG A;  3VS1 A;  2KK4 A;  3H6Z A;  3VRY A;  2M16 A;  3EFO B;  4E7I A;  1PKS A;  1SG5 A;  5IHI A;  2RI5 A;  2VV5 A;  4BD3 A;  1T3S A;  1PNJ A;  3C4S A;  2VWF A;  1AVZ C;  4JJB A;  4LE9 A;  2EYX A;  4RTW A;  5LJ5 e;  2O4X B;  2NUT A;  4A4K A;  3I5R A;  4OB0 B;  3JCM J;  3CC4 A;  1C1A A;  4F7U A;  3NFC A;  1X2Q A;  2DBK A;  4M75 D;  1LOJ A;  2MF2 A;  5GAO q;  1TS9 A;  1VQN A;  1I4K 1;  2YUN A;  2K79 A;  3JCM V;  3TVT A;  5I22 A;  1ZHI A;  3M0P A;  2NUT B;  4OP0 A;  1WHK A;  4ZNX A;  1EX4 A;  3CMA Q;  4F7U B;  3OQ5 A;  2ECZ A;  2KYM A;  1G83 A;  2DXC A;  4KGX B;  1N8R R;  1JU5 C;  1VQP Q;  1S72 A;  2OTJ A;  1M90 U;  4ANJ A;  2CDT A;  2F2W A;  4M75 E;  2E70 A;  2CT3 A;  2DRM A;  2LP5 A;  1Q86 R;  2E41 A;  3L2V A;  1VQ7 T;  4M78 C;  2RJD A;  3JB9 F;  1GCQ A;  2DL3 A;  1WJR A;  3BDL A;  2COW A;  1QVG P;  1UEC A;  1ZUU A;  3LH0 A;  1WYX A;  1E6H A;  4L5G A;  1W4S A;  3H0F A;  3JCM f;  1N8R C;  2JMC A;  5IN1 A;  4GLM A;  1QWF A;  1Q86 C;  3RR6 A;  4KUI A;  4OF1 A;  2DKG A;  1Q7Y R;  3VUZ A;  3JAM E;  1N9R A;  3LGF A;  4OVA A;  1QMC A;  1K0S A;  3CPW A;  1W2B A;  5KYN A;  4C92 E;  4C0D C;  2PQW A;  2RJF A;  2C0T A;  4M77 A;  2SEM A;  3MEW A;  4GY5 A;  1Y96 A;  3VS7 A;  5GAM f;  4EMG A;  1KQ2 A;  2BE7 D;  3CCE A;  4M77 B;  3HL8 A;  1WFW A;  4F14 A;  1AEY A;  1Y96 B;  4C0Z A;  2DVJ A;  1OQK A;  2BZX A;  3BE3 A;  3J81 E;  1WQ7 A;  2JUF A;  4BDY A;  3SWN C;  1HK9 A;  1QKX A;  4BB7 A;  2O9V A;  4C5E A;  1HSQ A;  4BE2 A;  4M7D F;  4KH1 B;  3O8V A;  5HKC A;  1V29 B;  5CKB A;  4FW1 A;  1PRM C;  4QW2 A;  2QAZ A;  2MYS A;  5KE2 A;  3WXM B;  3CCR A;  4OMP A;  3MEA A;  4HCZ A;  4LDW A;  4B9X A;  2EW3 A;  2EBP A;  5CVI A;  5FLX E;  2X4J A;  4PKC C;  2FPE A;  1FX7 A;  1M1G A;  3JV3 A;  2K9G A;  1VQ9 T;  3TSW A;  2JOY A;  2YRV A;  1YJ9 T;  4PJO C;  2DL5 A;  3LWH A;  2MK5 A;  2DL8 A;  1QKW A;  3CCS Q;  2K2M A;  2ENM A;  3M54 A;  3PE0 A;  1UJ0 A;  3CPF A;  4PFZ A;  3CCJ A;  5LJ3 e;  3L2R A;  1NZ9 A;  1NLO C;  1JO8 A;  3OYA A;  3OSV A;  4M7A B;  4X1V A;  1BK2 A;  3OYJ A;  4F7U G;  2P84 A;  4N4I A;  3I55 T;  5LJ5 f;  2V8I A;  5LJ3 d;  4NL3 A;  5EG2 A;  1YBY A;  4BE1 A;  3AHU A;  3OYB A;  2DL4 A;  1VQ7 Q;  3JCM Q;  3OA6 A;  1M8M A;  1KG1 A;  2MPX C;  3G6E T;  5GMK j;  4FCY A;  3QDF A;  4DBH A;  1KQS S;  5CK9 A;  2GFA A;  4ELY C;  1M3A A;  2RQV A;  2NYS A;  1GBQ A;  2LQN A;  1MV0 B;  1WA7 A;  2DET A;  2KDS A;  3ZL7 C;  5M9O A;  2A37 A;  4QVZ A;  3A8O B;  2KGT A;  3QWX X;  2LMJ A;  2Z0W A;  2EYZ A;  5GAO l;  2DD5 A;  3L2U A;  2FZG B;  1UGS B;  4MZM A;  1PD0 A;  3E9G A;  1VIE A;  1D0Y A;  2CRE A;  3I5S A;  5KYW B;  3WVE B;  1ABQ A;  4ATO A;  3CD6 T;  1QWE A;  4PK4 A;  1YWP A;  4M77 G;  1PC0 A;  2DRK A;  4HXJ A;  2FPD A;  2K57 A;  1AOJ A;  2FL7 A;  3LLR A;  3CME T;  3OMG A;  1GFC A;  2F5T X;  1I5L A;  4PJM A;  1CKA A;  2AZS A;  3I56 Q;  1OV3 A;  5LJ3 g;  4IKF A;  2PUO B;  5FU7 C;  1VA7 A;  5KYY A;  5GAM j;  4E47 A;  2C0O A;  4XTU A;  3U23 A;  4IUT A;  2BTT A;  4HCB A;  1ZUY A;  4ZN1 A;  3N5B B;  5GAN e;  2P4T A;  4J9C A;  2LRQ A;  1N8R U;  2KRM A;  2RF0 A;  4ZGD B;  3OYF A;  3A8H B;  1V76 A;  3P8B B;  1YFN A;  3TCJ A;  3TU4 K;  3CMA A;  2YLC A;  3OB9 A;  2DL7 A;  2IVW A;  3EG1 A;  2QQA A;  1ZSZ A;  4R55 A;  1VQP A;  3OW2 A;  1XQH A;  4B9W A;  4OB1 B;  4C8Q D;  2F5K A;  1VQ9 Q;  1Q81 U;  1ZBX A;  1OYX A;  4FL6 A;  1Y07 A;  2DZC A;  2KYB A;  1BB9 A;  1NPP A;  1VQN Q;  1D0Z A;  2DEU A;  3A98 A;  2JS2 A;  1Z9Z A;  1RAB B;  2O01 E;  4C8Q E;  2QEX A;  2HQH A;  1VQM A;  2YSQ A;  5KYX B;  2LCL A;  2OTJ Q;  2HEQ A;  2L3S A;  3MP6 A;  1QVF P;  3I55 Q;  3HP9 A;  1YI2 T;  2QXF A;  2HL5 C;  1M2V A;  3DKM A;  3MP1 A;  6AT1 B;  2LTO A;  3OBY A;  2JXB A;  1YIJ T;  3QSU A;  2HSP A;  1D1C A;  4OGC A;  4BDZ A;  4N4H A;  2J6K A;  1T0H A;  3G71 A;  5A2Q E;  5IT9 E;  5HK0 A;  3QPH A;  1M27 C;  2ZGW A;  3G6E Q;  3LGL A;  1R8O B;  2NUP B;  4OMF B;  2DYI A;  2KXC A;  2L0A A;  1Y57 A;  2RQR A;  8ATC B;  5LJ5 j;  2HKN A;  2FB7 A;  8AT1 B;  1VUB A;  2XG8 D;  4ZTJ A;  2GNC A;  3E2U A;  2LJ3 A;  3EHQ A;  2O9S A;  2M9U A;  4BI3 A;  1U3O A;  1K9M C;  1M9S A;  4ZTF A;  2LT4 A;  4M75 C;  2EYW A;  2CSI A;  2ATC B;  4JUV A;  1UGP B;  3S3O A;  3CC2 T;  2FRY A;  1G3W A;  4LXC A;  5CQY A;  1QVP A;  3EFR A;  4X9D A;  1UEB A;  2P4R A;  3HRU A;  4NL2 A;  5GAN 6;  2DEQ A;  5KH6 A;  4M7D B;  4N0A A;  1QCF A;  4RCB A;  1M3C A;  5KYU A;  1GCP A;  2KSS A;  2QA4 A;  4R56 A;  5FRO A;  3CME Q;  1FMK A;  2A7Y A;  5CR2 A;  2IIM A;  2LCS A;  4C92 C;  3OYE A;  2K6D A;  2PU9 B;  2FHD A;  4AG1 C;  3ER0 A;  1PG5 B;  3HHT B;  3MET A;  3PNW C;  2YT6 A;  4EPC A;  1SHG A;  2C06 A;  5I2M A;  1ZX6 A;  3EG0 A;  3HSB A;  2KBT A;  2X3X D;  3RMQ A;  4JDS A;  3A8L B;  2E6Z A;  4MZP A;  1B07 A;  1OEB A;  4ZGJ B;  1QVG S;  1T3L A;  4AFQ C;  3EH2 A;  1M2O A;  3JCM e;  1BBZ A;  4EMK B;  2ED0 A;  3L2Z A;  4RCC A;  2E65 A;  2PZ1 A;  1Q82 C;  1V1C A;  2X4X A;  3H8Z A;  3QBY A;  4JPB W;  4PL6 A;  1YCS B;  2ZPE B;  2Y90 A;  4QQG A;  3JCM d;  1M3B A;  3OYI A;  1VYV A;  1VQ7 A;  2K2V A;  1VQO T;  3O5Z A;  3X25 B;  3V7C A;  2VC8 A;  2YLB A;  4JJN K;  1VQL T;  3CCJ Q;  3OYK A;  3TQ7 P;  2EJG A;  3QYG B;  2CT4 A;  4M78 A;  3UWN A;  5FWB A;  2DPP B;  2EPD A;  3CCU T;  3JB9 G;  1K73 R;  2BUD A;  3REA B;  4E7H A;  1M8V A;  1WNL A;  1TH7 A;  3QYH B;  1OU9 A;  2BE9 B;  3DLL A;  2FPF A;  3E9F A;  4PJN A;  1W2B P;  4J6Y A;  2P0Q A;  5GAM d;  2K4Y A;  5CKD A;  2CUD A;  1YI2 Q;  3M58 A;  2XKO C;  2DA9 A;  3KXT A;  2J7I A;  1C0M A;  3JB9 I;  3GBQ A;  1YIJ Q;  1ZSG A;  1PWT A;  3C0C A;  1K76 A;  1BCO A;  1U06 A;  1AWX A;  4OMN A;  4A54 A;  1E6G A;  2LDM A;  2D9T A;  2H3J A;  2CZ7 B;  4BI4 A;  4LDY A;  4AFZ C;  3OS0 A;  2WSC E;  3MP8 A;  3RBB B;  2E64 A;  4M7A D;  1JXO A;  1AHJ B;  1H64 1;  2HDA A;  2OI3 A;  2JJ9 A;  4IIO A;  2FO0 A;  3CCM T;  3H41 A;  3VU3 C;  4C5H A;  1X6B A;  2SRC A;  2L8D A;  4X34 A;  4GBQ A;  1UGR B;  1MV3 A;  3SWN A;  1YIT T;  3FB9 A;  1I81 A;  2E5Q A;  2CH4 A;  2HQX A;  4M7A E;  5GAN 3;  3FJP A;  2JS0 A;  2EQK A;  2RPN A;  2COY A;  4MDW A;  1M1K R;  3PFS A;  2ZCF B;  2DXU A;  1OZ2 A;  2YUO A;  4M7D G;  4ELZ C;  2V8J A;  2E3I A;  2PNI A;  2RNA A;  1D0X A;  4BY6 B;  5DLO A;  2LC4 A;  5GAM g;  2XU8 A;  4DBF A;  4KGV B;  1VQ8 T;  2QI2 A;  3SB2 A;  3VYH B;  3LW5 E;  5GAO p;  3X20 B;  3GOX A;  2BKD N;  1M1K C;  1VQ9 A;  1Y0M A;  1WXB A;  2M51 A;  4BI8 B;  2ED1 A;  4RTZ A;  2DNU A;  4MDX A;  1YJ9 A;  1F1B B;  4DOV A;  1EIF A;  3UPU A;  1E7O A;  5LJ5 d;  4PJO A;  2LZ6 B;  1G3Y A;  3JCM b;  1H92 A;  1NJI U;  5FU6 C;  1K9M U;  5IH2 A;  4DEY A;  4WF2 A;  4CC4 B;  2PUK B;  3URG A;  3INZ A;  1RAE B;  2EWN A;  3P8H A;  3I55 A;  1XTD A;  1D1A A;  4E7K A;  3VKI A;  2DTH A;  4Y28 E;  4IUQ A;  4RUG A;  5CQX A;  1Y7X A;  4A63 B;  4C92 D;  1WIE A;  1AZG B;  4FYW B;  1UTI A;  2DIL A;  2GF7 A;  1OPL A;  3G6E A;  1IZ6 A;  2QEX Q;  3CCU Q;  5GAN j;  1VQM Q;  2RI2 A;  4JRI A;  2RQT A;  3UF4 A;  2EQM A;  2ZPB B;  1HYO A;  1QCO A;  1C6V X;  2ZPH B;  2XDP A;  3M57 A;  4KRT A;  2CP2 A;  4Z88 A;  5A0G A;  3RKX A;  3G71 Q;  1KHI A;  1NBE B;  2VUB A;  5GAO n;  2XDB A;  4KT0 E;  1LNX A;  1Z9Q A;  1Q7Y C;  4CI0 C;  3THK A;  3G1J A;  4RG8 A;  4HVU A;  5LJ5 g;  4V2S A;  1ZA1 B;  3FRN A;  3CD6 A;  2HBP A;  1WX6 A;  3OMC A;  4C8Q C;  1JQQ A;  4Z8A A;  4DEX A;  3E19 A;  2NUZ A;  1X43 A;  3CME A;  2A3L A;  4J9B A;  1Q82 U;  4FYX B;  1N27 A;  3CBM A;  2CP3 A;  4E7S A;  4EDU A;  1OZ3 A;  4O6J A;  2OJ2 A;  4FSS A;  1RLQ C;  2KNB B;  4XTX A;  5DM7 R;  1XJW B;  3BW1 A;  3V7S A;  2C0I A;  2EQI A;  2GTO A;  1YIT Q;  3L1A A;  4KBM B;  1TG0 A;  1VIF A;  1HXD A;  1MMG A;  1ZQ1 A;  2NLU A;  3X26 B;  2QQR A;  2QA4 Q;  2A36 A;  1I5O B;  1KD1 R;  4XTY A;  5D7U A;  1K0X A;  3R6N A;  4JZ3 A;  4J8O A;  2E6N A;  4QVD A;  3OW2 P;  4CC3 A;  5CKF A;  1QW1 A;  1VQ8 Q;  1WJQ A;  2HKQ B;  2VB6 A;  5I11 A;  4ORZ A;  4DOW A;  1QVF S;  1KD1 C;  1N9S A;  5GAM h;  3X24 B;  3M0Q A;  2KY9 A;  3RES A;  3JRZ A;  3MKD A;  3EGD A;  3L2Q A;  4JS4 A;  1IHV A;  2AZV A;  5FRN A;  4E2F B;  1KC8 U;  1GRI A;  1B7T A;  4XTW A;  4XK8 E;  2IPO B;  4B6M A;  1NYF A;  4M7D D;  1WHL A;  1PSF A;  2DFU A;  5HK3 A;  1AWJ A;  2ESW A;  2EFI A;  1KFZ A;  4FT4 A;  2DMO A;  1YI2 A;  1MMA A;  1RLP C;  1SF9 A;  2V26 A;  4WCI A;  1WPY A;  2YUQ A;  1YIJ A;  5GAO m;  4M7D E;  3H0H A;  4OMM A;  4M78 F;  1YJN T;  1CKB A;  1BU1 A;  2B86 A;  2CKK A;  4KH0 B;  1NEB A;  1ABO A;  4OB2 B;  4IUP A;  2DJQ A;  5CAI A;  1RAG B;  5GMK i;  2D0Q B;  2RJC A;  2D6F A;  3VYG A;  1AD5 A;  4FT2 A;  2QK0 A;  4IUR A;  4JJC A;  4ZGE B;  1OX9 A;  1PKT A;  1UGQ B;  4FSX A;  4C0G A;  1YJW T;  4A4H A;  4LD9 K;  2M02 A;  1H8K A;  2RHZ A;  3QWY A;  1X69 A;  5CCA A;  1PD1 A;  5HY6 A;  3VS0 A;  3DB3 A;  4M75 A;  3ZFJ A;  1KIK A;  3CC2 A;  3WVD B;  5CKE A;  2E5K A;  1X27 A;  3OS1 A;  2CP6 A;  1N6A A;  4Q5W A;  5J26 A;  3MHX A;  3M9Q A;  3CC7 T;  2JTF A;  4J7I A;  5KCH A;  2KR3 A;  2X3W D;  5LJ5 h;  2W10 A;  4KUL A;  3SFM A;  3PTA A;  4NOY A;  2VYT A;  5KYY B;  2YWW A;  5FW9 A;  3OYG A;  2GGR A;  3EG9 A;  1WHG A;  1YNZ A;  5J3B A;  4J9G A;  1Q86 U;  2HL3 A;  4N4G A;  5D6W A;  5GAN d;  3SEM A;  2F2V A;  3OYN A;  3C95 A;  2YHT A;  1MND A;  4UC4 A;  4FM4 B;  1DJ7 B;  1VQ6 T;  1TOV A;  1D1B A;  3RUX A;  1W2B S;  1T0J A;  4E7Z A;  3JCM P;  1ZSZ B;  1YJ9 Q;  1Q7Y U;  1KQ1 A;  2GTJ A;  4EIK A;  3SDZ A;  4IUU A;  3EG2 A;  2OAU A;  1VQO A;  1PRL C;  2ZAE A;  4M7A C;  3C12 A;  3CCV T;  1MUZ A;  2LT1 A;  4PJO F;  7AT1 B;  2EKH A;  2ZZD A;  3V8K A;  2V1Q A;  3ULR B;  1OUL A;  3CCU A;  2K7A A;  3NTI A;  2J05 A;  4C5G A;  3DB4 A;  3CQT A;  3EH1 A;  2KRS A;  3CXC A;  1VQK T;  2ZPF B;  4XTV A;  4LUD A;  1JJ2 A;  2Y4Y A;  5L8R E;  4J9I A;  3J7A F;  1UDL A;  2DZ9 A;  3RMS A;  4Y92 A;  2BZ8 A;  3QZ5 B;  3RKW A;  2HD0 A;  2RA2 A;  1M2V B;  2RJE A;  2EGC A;  1RAA B;  3KUF A;  2G6F X;  3FIF A;  4PJJ A;  1BI1 A;  3EAE A;  1B3Q A;  5GAN g;  1YJN Q;  5IAY A;  4R0K A;  2A28 A;  3FC3 A;  2RD1 A;  4RTX A;  1YHQ T;  5LL6 S;  1JRI A;  1M90 R;  3CCQ T;  1WJS A;  3MEV A;  3Q1J A;  3UDC A;  2AK5 A;  4Z89 A;  4CC2 A;  5FRM A;  1YJW Q;  1KD1 U;  3CCM A;  3E1S A;  5I21 A;  4FYY B;  1LVK A;  3M0S A;  1ACM B;  4F7U E;  2QGF B;  1OU8 A;  1YIT A;  1H3Z A;  3SHW A;  3CD6 Q;  4BAC A;  1U8R A;  1M90 C;  3LYI A;  1PSE A;  2MIO A;  4CRI A;  1N5Z A;  4XAX B;  3OYY A;  1AWO A;  2P0P A;  2EQU A;  3V8J A;  2DTO A;  1G2B A;  3CC7 Q;  1TTH B;  3ZBD A;  4RTU A;  5KYU B;  4JLG A;  1VQ8 A;  4RTT A;  2MI6 A;  1MMD A;  5CIU A;  2JMA A;  1Y71 A;  1RI9 A;  4WTO B;  1OOT A;  2FYK A;  5LJ3 h;  4JZ4 A;  1QP3 A;  2DTI A;  2X51 A;  1VQ4 T;  2MWO A;  1X6O A;  3OYD A;  3FDR A;  2ZPI B;  2OTL T;  4F16 A;  1WLP B;  1NEG A;  4M77 D;  4QVC A;  2GBQ A;  4LDU A;  4E7L A;  2E3H A;  2EYY A;  1CSK A;  2CP0 A;  2D8J A;  1WHH A;  4M4Z A;  3QO3 A;  5IXB A;  4JLI A;  3A5Z B;  1OI1 A;  2RO0 A;  4C0F A;  1VYU A;  1X2K A;  1VQ6 Q;  3OYH A;  4M77 E;  1NM7 A;  5D6Y A;  2XMF A;  2VXE A;  2CS7 A;  4AG2 C;  1NPR A;  1WZO A;  2XDD A;  1M1F A;  2RQW A;  2R58 A;  3LX7 A;  3QUI A;  3VS6 A;  3REB B;  4L59 A;  3CCV Q;  1UB4 A;  2R5M A;  4AFU C;  3CPW P;  4M78 B;  1B34 A;  2D0N A;  1TUG B;  1WI7 A;  2LJ1 A;  3G4S T;  3RNJ A;  2RN8 A;  1VQK Q;  2KRO A;  2AKL A;  4LD6 A;  4E6R A;  2V1R A;  3M5A A;  1K73 C;  1ZUK A;  1B34 B;  5J39 A;  2A08 A;  2CZ0 B;  1U1T A;  2LNH B;  4JRK A;  2XD0 A;  5IHK A;  2XK0 A;  4ME7 A;  1QVF A;  4PFP A;  4RTY A;  3MO8 A;  4D6W A;  5IHN A;  4C0D B;  1LCK A;  3MCA B;  3VRZ A;  4OML A;  2E4H A;  5GAN 7;  5GJV B;  3CBP A;  3QII A;  1IGU A;  2KI7 A;  3JCM g;  2L3R A;  3VV0 A;  2RK1 A;  5GAN h;  3CCQ Q;  4C8Q A;  4J6W A;  2QG9 B;  1FMV A;  3PIP A;  2PVD B;  3OW2 S;  2XI9 A;  1I0C A;  2RK2 A;  4M75 F;  3CC2 Q;  2K5L A;  1HJD A;  4M7D C;  4HVV A;  2VGM A;  2AKK A;  1MHN A;  5L23 A;  1VQ5 T;  5CO7 A;  3LWI A;  2DIQ A;  2RQU A;  2LJ0 A;  2CP7 A;  3SWN B;  2M0Y A;  3M55 A;  1KQS A;  2RHY A;  2J06 A;  1K1Z A;  2HCK A;  4HA8 A;  5GJW B;  2LQK A;  2P0K A;  4DA4 A;  2YDL A;  1BI3 A;  3GPL A;  2GQI A;  1IHW A;  3EFO A;  1FMW A;  3BFM A;  3OBW A;  2DM1 A;  1KK7 A;  2VKN A;  2QQS A;  3VS5 A;  2LQW A;  3H9N A;  2KXD A;  4O5V A;  3VJP A;  2RB6 A;  3JCM X;  4C92 F;  2O4X A;  2QQB A;  2DX1 A;  5HCK A;  1WQW A;  1VQ4 Q;  2EVR A;  3NTK A;  4DBR A;  3OY9 A;  4MZT A;  2AT1 B;  4EMK C;  3FLG A;  2OTL Q;  2FZC B; 
#chains in the Genus database with same CATH homology
 4F17 A;  3M0Q A;  1SPK A;  2KE9 A;  2JM9 A;  1SEM A;  1SRL A;  2AZV A;  2EGA A;  2L3P A;  2F2X A;  2NWM A;  1GRI A;  2KYB A;  1BB9 A;  3I35 A;  2MCN A;  1NYF A;  2D1X A;  2K3B A;  1OPK A;  4CC7 A;  1GFD A;  1GL5 A;  1AWJ A;  2ESW A;  4LUE A;  3A98 A;  2JS2 A;  1KFZ A;  4JJD A;  1Z9Z A;  2O88 A;  1I07 A;  2JW4 A;  2DMO A;  4HVW A;  1RLP C;  1UUE A;  2YSQ A;  1IO6 A;  5FWC A;  4WCI A;  1GBR A;  1W1F A;  3LH5 A;  2HEQ A;  2L3S A;  2YUQ A;  2KRN A;  3I9Q A;  1U5S A;  3H0H A;  4K11 A;  4OMM A;  3NGP A;  1M30 A;  2JXB A;  1PHT A;  2HSP A;  2J6K A;  1T0H A;  1CKB A;  1BU1 A;  2B86 A;  3VS4 A;  1NEB A;  3VS3 A;  2OAW A;  1ABO A;  1M27 C;  2DJQ A;  2J6O A;  2DF6 A;  1SSH A;  2KXC A;  2L0A A;  1Y57 A;  2O31 A;  2RQR A;  4QT7 A;  2YUP A;  1AD5 A;  2GNC A;  4JJC A;  1UJY A;  2LJ3 A;  1PKT A;  3EHQ A;  2O9S A;  2ROT A;  1H8K A;  3QWY A;  1U3O A;  1X69 A;  4AFS C;  4HCK A;  1WDX A;  3M0U A;  1H3H A;  2W0Z A;  1YWO A;  1XOV A;  5IXF A;  3VS0 A;  1VYT A;  1KIK A;  2EYW A;  2CSI A;  1QLY A;  2E5K A;  1NYG A;  5ECA A;  1X27 A;  3UAT A;  3EG3 A;  3EGU A;  4J9E A;  2VVK A;  2FRY A;  2RMO A;  1AWW A;  2KEA A;  3PVQ A;  3UA7 A;  2P4R A;  2KR3 A;  2X3W D;  1QCF A;  2ABL A;  4ESR A;  2JM8 A;  1M3C A;  2W10 A;  1GCP A;  2DLP A;  1TUD A;  2JTE A;  4J9F A;  1S1N A;  1FMK A;  1AZE A;  3NPF A;  5FW9 A;  2IIM A;  2EGE A;  2LCS A;  2GGR A;  2JT4 A;  4LNP A;  2K6D A;  1YNZ A;  2FEI A;  4AG1 C;  3VS1 A;  3VRY A;  4J9G A;  1NG2 A;  2YT6 A;  1PKS A;  5IHI A;  1SHG A;  1T3S A;  1PNJ A;  2VWF A;  4IIM A;  1AVZ C;  1ZX6 A;  3EG0 A;  3SEM A;  2F2V A;  2KBT A;  2X3X D;  4JJB A;  4LE9 A;  2EYX A;  2ROL A;  1B07 A;  1OEB A;  4RTW A;  1FYN A;  1T3L A;  4D8D A;  4AFQ C;  1NLP C;  3I5R A;  1X2Q A;  1BBZ A;  2DBK A;  1T0J A;  1W70 A;  2ED0 A;  2YUN A;  2K79 A;  3TVT A;  2GTJ A;  5I22 A;  4EIK A;  3M0P A;  2PZ1 A;  1V1C A;  3EG2 A;  4ZNX A;  1PRL C;  4JPB W;  1YCS B;  2ECZ A;  2KYM A;  1MUZ A;  1M3B A;  1VYV A;  3NHN A;  1G83 A;  3TSZ A;  1JU5 C;  2EKH A;  3O5Z A;  2V1Q A;  3ULR B;  2CDT A;  2F2W A;  3VS2 A;  2K7A A;  2BZY A;  2CT3 A;  2DRM A;  2LP5 A;  2J05 A;  1UFF A;  3KFV A;  2CT4 A;  3CQT A;  1GCQ C;  1GCQ A;  2LX7 A;  2KRS A;  5FWB A;  2EPD A;  2DL3 A;  4LUD A;  1UEC A;  1ZUU A;  3REA B;  4J9I A;  1WYX A;  1UGV A;  1E6H A;  1UDL A;  3H0F A;  2HBW A;  3M0T A;  2JMC A;  4Y92 A;  2FPF A;  2BZ8 A;  2FRW A;  4GLM A;  1QWF A;  2CUD A;  2EGC A;  2DYB A;  2DA9 A;  1UG1 A;  2G6F X;  2J7I A;  1B3Q A;  1ZBJ A;  3GBQ A;  1ZSG A;  1PWT A;  4R0K A;  1K0S A;  2A28 A;  3C0C A;  1K76 A;  1U06 A;  1AWX A;  4OMN A;  1UHC A;  2C0T A;  2SEM A;  4RTX A;  1E6G A;  2CSQ A;  3VS7 A;  4AFZ C;  3RBB B;  2AK5 A;  4Z89 A;  5EC7 A;  4CC2 A;  1WFW A;  4F14 A;  1AEY A;  1JXO A;  1X6G A;  2DVJ A;  2HDA A;  2OI3 A;  4IIO A;  2BZX A;  3M0S A;  3M0R A;  2FO0 A;  3H41 A;  3SHW A;  2FG0 A;  1X6B A;  2SRC A;  1WXU A;  2MIO A;  4GBQ A;  1MV3 A;  1N5Z A;  1AWO A;  1QKX A;  4J9D A;  2CH4 A;  2O9V A;  3H0I A;  1G2B A;  2JS0 A;  2I0N A;  1JEG A;  1HSQ A;  2RPN A;  3FJ5 A;  3EHR A;  4RTU A;  2YUO A;  4RTT A;  2PNI A;  2RNA A;  1I1J A;  1K9A A;  2JMA A;  1HD3 A;  1RI9 A;  1OOT A;  1PRM C;  4JZ4 A;  4D8K A;  4OMP A;  1KSW A;  2EW3 A;  4F16 A;  1WLP B;  2EBP A;  1Y0M A;  1NEG A;  1WXB A;  2M51 A;  2ED1 A;  2GBQ A;  4RTZ A;  1WXT A;  2DNU A;  2FPE A;  2EYY A;  3JV3 A;  1CSK A;  2D8J A;  4OMO A;  2K9G A;  4M4Z A;  3TSW A;  1E7O A;  2DBM A;  5IXB A;  2DL5 A;  2LZ6 B;  1H92 A;  2DL8 A;  1QKW A;  1VYU A;  1X2K A;  1KJW A;  1K4U S;  2K2M A;  2ENM A;  1J3T A;  1YP5 A;  3PE0 A;  4OMQ A;  1UJ0 A;  4DEY A;  1NM7 A;  5IH2 A;  4CC4 B;  2XMF A;  3UA6 A;  3NMZ C;  1NLO C;  4AG2 C;  1JO8 A;  4X1V A;  2RQW A;  1BK2 A;  4RUG A;  3VS6 A;  1ARK A;  3REB B;  1A0N B;  2MOX A;  4J9H A;  4A63 B;  1WIE A;  4AFU C;  1AZG B;  1JXM A;  1UTI A;  2CH4 W;  2DIL A;  1OPL A;  2D0N A;  1WI7 A;  2DL4 A;  2LJ1 A;  2H8H A;  3RNJ A;  2RN8 A;  1M8M A;  2KRO A;  2AKL A;  2RQT A;  4E6R A;  2V1R A;  3UF4 A;  1ZUK A;  1M3A A;  2RQV A;  2A08 A;  1GBQ A;  2LQN A;  2LNH B;  1MV0 B;  1WA7 A;  4KRT A;  3ZL7 C;  2A37 A;  5IHK A;  4Z88 A;  2DE0 X;  2CUB A;  2KGT A;  3QWX X;  4RTY A;  5IHN A;  1Z9Q A;  2LMJ A;  1LCK A;  3VRZ A;  3THK A;  4OML A;  4HVU A;  2EYZ A;  5GJV B;  1EFN A;  2O2O A;  2PTK A;  1WX6 A;  1W6X A;  2CRE A;  1JQQ A;  3I5S A;  4Z8A A;  1ABQ A;  1YN8 A;  4DEX A;  2NUZ A;  1I0C A;  1X43 A;  1QWE A;  1YWP A;  4J9B A;  2DRK A;  4HXJ A;  1HJD A;  2FPD A;  4HVV A;  3PVL A;  2D8H A;  1AOJ A;  1GFC A;  2AKK A;  5L23 A;  1CKA A;  2AZS A;  2OJ2 A;  4FSS A;  1OV3 A;  2RQU A;  2LJ0 A;  1RLQ C;  2KNB B;  2M0Y A;  1ZLM A;  1VA7 A;  2C0O A;  1TUC A;  2C0I A;  3U23 A;  2J06 A;  2EQI A;  2GTO A;  2KT1 A;  1K1Z A;  2HCK A;  1TG0 A;  5GJW B;  1SHF A;  2BTT A;  3IQL A;  1ZUY A;  2KT8 A;  2L2P A;  2YDL A;  2GQI A;  2A36 A;  1UHF A;  1SRM A;  4J9C A;  2DM1 A;  2VKN A;  3VS5 A;  2J6F A;  1K0X A;  3R6N A;  2KRM A;  2LQW A;  2KXD A;  2RF0 A;  4JZ3 A;  2QDL A;  4CC3 A;  2L3Q A;  4RTV A;  2DX1 A;  5HCK A;  2EVR A;  4LN2 A;  5I11 A;  4ORZ A;  1RUW A;  1UE9 A;  2DL7 A;  3EG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...