4BI8B

Crystal structure of the type vi effector-immunity complex ssp1-rap1a from serratia marcescens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords RAP1A
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi8B01
4BI3A 4BI8B 4BI4A
chains in the Genus database with same CATH superfamily
1ZA1B 1RAHB 2KQWA 3M5AA 2R5AA 1TOVA 2RQVA 4C0FA 1WI7A 4NL2A 3EG9B 4M7AC 4F7UE 5CVIA 3QHSA 4E7LA 1CSKA 1QVFP 4GLMA 2XDDA 1YITA 1MNDA 2X4XA 2CT4A 2VC8A 2F5KA 1RI9A 2RD1A 1IREB 2QK0A 5LJ5f 3CMAT 1VQ8Q 3A5ZB 1NJIU 1S72Q 4M77F 5GAMd 3CCRT 1SG5A 2KK4A 4LUEA 4L6V5 1RI0A 1RAEB 2K2VA 5GANj 4RKUE 3UA6A 1VQ5T 1EIFA 1TTHB 2CT3A 1VQNQ 3L2UA 3G71T 1VUBA 4DA4A 1FXXA 2GF7A 4RCCA 1UE9A 3QWXX 2NYSA 5GAN8 4RTWA 5LJ3h 4HCKA 4Y28E 4X9DA 3CC4T 3M0QA 1VQ7T 1PRLC 3CD6A 2CSQA 2RA2A 5KYWB 5CCAA 3VS0A 4PLLA 2PVGB 2DKGA 2R57A 3EGDA 1QVFS 3NHNA 1AVZC 1N6AA 3C94A 3HL8A 1FMVA 5FU6B 5CO7A 3VS3A 2MWOA 2QXFA 4M78A 4GLKA 2DYBA 3PNWC 3D7SB 2BZYA 5HK3A 2PTKA 2LT1A 3GP8A 3A8LB 3FB9A 1LVKA 5GAMf 3JB9G 3VYGA 2K5FA 4J83A 4FIBA 3OYMA 2GFUA 4F7UG 4C5GA 4KGXB 2MWPA 3OS1A 2VUBA 4JRIA 2QQAA 4OVAA 3JCMV 4FCYA 4OGCA 2F69A 3V8KA 2E12A 2ROLA 1VYUA 1UUEA 1M1KU 1ZBXA 2RF0A 2HCKA 1YITQ 4IIOA 5FU6C 2YHTA 4XU0A 2QG9B 3P8DA 1PSEA 4O5VA 4PJOF 2RN8A 1EFNA 1IGQA 2FG0A 3G6EA 2OTJT 1IXDA 1RLQC 1VQKA 2CUBA 4M7DA 1G3SA 4J7IA 2E41A 4ME7A 3HTRA 4HVVA 2BE9B 1KD1R 4C0GA 1OX8A 5LJ3d 4Z88A 4C92A 2MMPA 2NUTA 2HEQA 1JJ2P 3G4ST 3OYCA 1M3BA 1WA7A 4CC2A 2V1QA 3CCVT 1UGSB 1N8RU 2L3QA 3BY7A 3I55T 2CP5A 2OTLT 3PMTA 4BB7A 5D6XA 2BKDN 2KBTA 2QQ9A 3TU4K 1K73U 1VQ4Q 5KYYB 5DLQE 3CD6Q 3JB9J 4M78E 1R77A 1AT1B 4F17A 2H3EB 4OMQA 3N5BB 1K0XA 2EKHA 4X34A 4PLIA 4BE1A 5CKEA 3VS4A 2QAZA 3VS5A 3SEMA 2HQXA 1K8AR 3MJXA 4RMOA 4XK8E 3OYHA 1WQWA 2G6FX 1NM7A 3S3MA 1WJRA 2D8JA 2RHYA 4J6XA 1SHFA 1JB0E 3VV0A 1D09B 8AT1B 3QJYA 4ZNXA 1VQLT 4F14A 4O6JA 3JB9D 5LJ3f 1ZA2B 3EGXB 3REAB 2E10A 1M90C 1RUWA 2DO3A 2EW3A 4WCIA 2RHZA 2EGAA 2LC4A 3UDCA 5AYFA 4L5GA 4PFPA 1NEGA 3LW5E 2L5QA 2YWWA 3L2RA 1GRIA 1VYTA 1X01A 4HT8A 4C8QF 3THKA 1HYOA 3HFOA 1NJIR 1ABQA 3EGUA 2O9SA 3FEOA 3OSVA 4BI4A 3S3OA 2DE0X 2OAUA 1KG1A 3G6EQ 4YTLA 1PWTA 2FPFA 4C92E 4JPBW 3CCLT 1VQKQ 4ZGEB 5FRNA 4IUVA 4JJBA 2IG0A 1WHMA 3PMIA 4OMNA 2XICA 4OP0A 1PRMC 3CXCS 1GFDA 4M77C 2LMJA 5GMKj 1YJ9Q 1UJ0A 2XG8D 4Y91A 3M55A 4M78G 4J9CA 3SB2A 3GPLA 1Q81U 4EMKA 4HT9A 3LWIA 4J6WA 1X69A 4NL3A 2HKNA 1UGRB 3RMQA 3LWHA 1HJDA 5I11A 5HK0A 3OYJA 4PJLA 1UB4A 2RK2A 4M75E 3EFOB 3MKDA 2J05A 2V8JA 1K9AA 5FU7B 1W2BA 4Q5WA 4N0AA 4JZ3A 2OAWA 3TEEA 3MO8A 3META 1AWJA 2YRDA 3CMET 2X9HA 2A28A 1H641 5KCHA 2QGFB 3QWYA 4QKUA 4PJOB 2KAFA 4MZTA 3VS1A 1QVGA 4IKFA 3I5RA 1BIAA 3JCMQ 2LNVA 3VRYA 2DRMA 4L59A 2LRQA 2P0PA 5GAOq 1SHGA 1XNIA 1GFCA 4DOWA 3OYNA 4M7AF 1G3WA 3CPWA 1ZX6A 2C0TA 2DXUA 5KCOA 3T9NA 2LJ0A 1QP2A 2LX9A 3SHWA 2CGHA 3H0HA 3NTHA 4KT0E 1NYFA 4C92G 5CR2A 3M9QA 2K3BA 5CAIA 1WDXA 1BCMA 2CP7A 5FU7C 1Y96B 1GCQA 2DJQA 3BW1A 4LN2A 3E19A 1M8VA 1M4ZA 2MF2A 2ZPBB 1R0CB 3OYYA 4FYYB 1S1NA 2VKNA 3V8LA 5GANh 2A7YA 2DTIA 2DL5A 4PJOC 2CSIA 2DLPA 4XTVA 3CBMA 1N8RR 2F2VA 2VXEA 2F1LA 3I56A 3JCMc 3PVLA 1KHIA 1K73R 2EGCA 4QT7A 1OEBA 4KGZB 4FSXA 3RBBB 3GOXA 3AHUA 2ZPGB 4M78D 4E7KA 2VB6A 1ZHIA 4AT1B 2DTHA 2GTJA 4BE0A 4VUBA 5KYUB 2VVKA 1VYVA 4KH0B 4QQDA 1YNZA 5CKFA 2DBMA 3CCQA 1Q95G 4OMOA 1N9RA 5GAOp 3X28B 2DEUA 1SRMA 1E6HA 2EBPA 4F7UB 1Q7YR 4FW1A 2EYWA 2PUKB 4C8QB 1Q82U 4OMFB 3LX7A 2CP2A 4CRIA 2YLBA 4LDYA 5GAN3 2AK5A 3JCMh 1W6XA 1NE8A 1ZUYA 4WTOB 1MHNA 4FYVB 2DL7A 4XU1A 1FMWA 4XTXA 2YXYA 5EG2A 3FRNA 1QWFA 1TXQA 3SWNC 2EYQA 2LZ6B 2JM9A 2DTOA 2CZ6B 3MP8A 3RIRA 2M0YA 1OPLA 1UDLA 1K9MU 4ZN1A 1GBQA 3G1JA 3QBYA 4C5HA 2JS2A 2Z0WA 4M7DF 1G3YA 5GANd 1KC8C 3M54A 1KQSA 5KH6A 4C92D 3MPUB 2NUZA 4EMGA 2VYTA 3ER0A 4C8QC 1D3BA 2O2OA 3CCJA 3JSCA 1TH7A 3NFCA 2JMAA 1YJNA 4C5IA 5LJ5g 1YI2T 2NUPB 1M1FA 1IZ6A 2FEIA 1JEGA 2QQSA 3FDRA 4XAXB 2DFUA 3I56Q 4RTUA 3L2WA 1ZLMA 3JCMJ 2PUOB 2GQVA 5CQXA 1KQ2A 1UJYA 1Y57A 2DJZA 3CC2T 2QDLA 2E5QA 5HCKA 3EHQA 2HSPA 3M53A 3MEAA 1K4US 4M75D 3CCSA 2VGMA 2DNUA 4C0DC 2EKOA 2KT1A 1VQ6T 5I21A 2C0OA 1P92A 3RKXA 1Z9QA 3CCMA 1M1GA 1QCOA 3LYIA 5J3BA 4CC3A 5GANf 5J39A 3JCMd 4XU3A 5IHNA 1IGUA 2LQ8A 3X26B 3FLGA 3VJPA 1IRXA 4JZ4A 1BI3A 1SRLA 4A54A 1UGQB 1KFZA 1IHWA 5GJWB 1VQMT 2F2WA 1W2BP 2LDMA 3OMGA 1ZSZA 5GAMg 3BDLA 2E6NA 4MMLA 3VUBA 4PFOA 2HL3A 4ATOA 5KYNA 2E3IA 3L2ZA 4D8KA 2XK0A 5D7UA 1MMNA 2K3YA 3V8JA 1QVGP 2BZ8A 5GAOr 3I35A 3JV3A 5KYXA 1YIJA 3QG1A 1Q86U 1D0XA 2FZKB 4X1VA 3CPWP 4IURA 3EGDB 4LNPA 1M90U 1M27C 4BUGA 4KH1B 4DEYA 1CKAA 2O88A 2PU9B 2EQUA 3L2VA 2XKOC 3CCJQ 4M78B 3JRZA 2FPEA 1YJNQ 1X6OA 3JCMf 3OBYA 3QKJA 5GMKh 1NLOC 3EG2A 4OMLA 2AZSA 1YHQA 1X27A 3CCQT 1KQ1A 1H92A 1T0HA 2EAYA 4EDUA 2IPOB 3CCEA 2DMOA 3A98A 1M5Q1 2RNAA 2L0AA 3ZFJA 2D6FA 1E6GA 3QO3A 1N27A 3CCSQ 4PNOA 1BI1A 3MEUA 1VQ4A 3CCMQ 1SKUB 4HA8A 1VQPA 1WHJA 3G7ZA 3M0UA 3S3NA 2VASA 4E6RA 1AOJA 1AZGB 1RL2A 4KUDK 2F2XA 2HMAA 4V2SA 1QVPA 2EJ9A 2RHIA 4M7DB 2MYSA 2QTXA 4QQGA 2HKQB 2M1HA 2KYMA 1NG2A 5IHKA 5GAN7 3CBOA 4C92B 2NUTB 2O01E 1U8RA 2RK1A 1IO6A 2X35A 1QLYA 2AZVA 5L8RE 2X51A 2DF6A 2Y90A 3ME9A 1VQ8T 3J7AF 1ARKA 4BACA 1S72T 2KT8A 5LJ3g 2Y4YA 2JOYA 2K5LA 2EYYA 1YIJQ 3CEYA 2COZA 2DD4A 1PKSA 1D0ZA 3URGA 1VQNT 2EJGA 3M4GA 3H0FA 2VGNA 4M7DC 5LJ5e 4JLIA 1KQSP 3JB9I 3HFNA 4PL6A 1QW1A 2RHUA 2QEXA 1YHQQ 3TVTA 3KXTA 4ELYC 3ULRB 1NLPC 2QA4A 5DY9A 3OYBA 2AKLA 1HK9A 3FJPA 1WHLA 3CCEQ 2CKKA 2DD5A 4JS4A 4KGVB 2H8HA 4ZGDB 1YJ9A 2A36A 2JTEA 1JBMA 4LD6A 3QZ5B 2KY9A 4QVCA 1U06A 3UPUA 2EVRA 1KD1C 3MP6A 4FYXB 2LP5A 3HSBA 3KUFA 2DXTA 5IXBA 1RAFB 3JCMb 2DL8A 4B9XA 1VQPQ 1PD1A 4JRPA 3LGLA 2P0QA 2XHCA 3P8BB 5CKHA 2DZCA 2X4JA 3OS2A 3P8HA 1YFNA 1WLPB 2DEQA 3CC7A 2I0NA 2MPXC 5FROA 2CS7A 2PVOB 3BE3A 3M56A 1B3QA 4DBFA 3OA6A 4MDWA 3A8GB 1WFWA 4AFQC 3QPHA 4M75A 4NOYA 4MMKA 3KFVA 5IN1A 5GAMe 2E65A 2KYBA 2ZZDA 1YITT 2K79A 1BU1A 1Z9ZA 2OX7A 3X25B 3OW2A 2L89A 1YJWA 1D1BA 2DXCA 2RJDA 3R6NA 1GBRA 8ATCB 1Y07A 3VS7A 1JJ2S 1M9SA 1Q86R 1K8AC 3JB9F 4EMKB 1JO8A 1SSFA 1TWBA 2RQUA 2JW4A 1JRIA 3V7RA 4JS5A 1G5VA 5CKDA 3CCUA 4F7UF 2E6ZA 1RAIB 2EQMA 2V26A 2COWA 2PNIA 3WVDB 3PTAA 3UWNA 2M02A 2EYXA 3OY9A 2FZCB 1NPPA 2JM8A 2V1RA 2QEXQ 3UF4A 1VQ4T 2YUPA 1KC8U 3CD6T 1NJIC 1U1SA 2QA4Q 3JCMW 2K9GA 3S6WA 1J3TA 3RERA 4PK4A 3OS0A 1C0MA 4LDUA 3RNJA 2DA9A 1EX4A 4EMKC 3HPWA 4RTVA 3RKWA 2VWFA 4IUTA 4IIMA 4UC4A 4E7IA 4JRQA 9ATCB 4OB0B 5CKBA 1ABOA 1OOTA 1XOVA 2JN0A 4E7SA 2JTMA 2E5KA 4BI8B 2CZ0B 1JU5C 1VQ9A 2JNGA 2W0ZA 1WXBA 1BCOA 4R0KA 2V8IA 3I5SA 4N0AC 3CC7Q 3DLMA 1LPLA 4KRTA 2YDLA 4M77A 5CIUA 2DERA 2FYKA 3MEVA 5FW9A 1SEMA 1C1AA 1T3LA 2KGTA 2CUDA 3E1SA 2JUFA 5I2MA 3PT9A 2KEAA 1A0NB 1SF9A 1QCFA 2RMOA 1YCSB 1YJWQ 3A8OB 5LJ3e 4GBQA 3OYKA 3G6ET 4OMMA 2BTTA 1VQKT 3EHRA 3L2QA 2L3PA 2K5IA 1M1KR 2XMFA 4Z8AA 5M9OA 3X24B 3CCUQ 1YBYA 2KI7A 1VQOQ 3VU3C 2HBWA 5I2SA 3VRZA 3OS5A 1WPYA 5J26A 4PJNA 1YJ9T 1VOMA 4FT4A 1VIEA 1HXDA 1H3HA 2DZ9A 4M7AD 1WQ7A 3PGGA 1ZBJA 4BD3A 2HBPA 1X43A 1AHJB 2MIOA 4QW2A 2CZ7B 4ZN3A 4QQ6A 4C0ZA 3PFSA 3HHTB 2KROA 5CK9A 4RG8A 3WXMB 1JQQA 2SEMA 2XDPA 3I9QA 4LE9A 4OMPA 2KDSA 3VS2A 1TUGB 1TSFA 1UGVA 3EH1A 4HCZA 4M75G 1N8RC 2D1XA 1MMGA 1VQ9Q 4ELZC 4M78F 1BK2A 4M77E 4EMHA 3RKYA 1K73C 1MMDA 2ESWA 4J9IA 1I0CA 3C95A 3NGPA 2KMTA 3A8HB 2KRSA 1GL5A 2F5TX 2EQKA 4KUIA 4HKEA 2L2PA 1D3BB 2FHDA 2DIQA 2DL3A 4R56A 1M3AA 5GANg 1B34A 4Y92A 3MEWA 1OQKA 3RESA 2X3XD 1YN8A 5GMKi 2P84A 2D8HA 2HQHA 2QI2A 3QSUA 3CCRA 1RACB 1K0SA 4OGEA 5D6WA 3OBWA 2RQTA 3RUXA 1ZQ1A 2MCNA 4AMCA 3PIPA 3DKMA 4Z89A 4BDYA 1Q7YC 2K2MA 4P5NA 4HVWA 1VQ5A 4XTUA 2WACA 2GCXA 4AFZC 2ZPIB 3G71A 3OW2P 1PM3A 4C5EA 1GXIE 1K1ZA 1TUCA 2MK5A 4QVDA 2OJ2A 2HL5C 3JCMP 3M0SA 4J9DA 4RUGA 3CC4A 3X20B 2Y4XA 3EH2A 2R58A 1T0JA 1M2VA 3ZL7C 4IUUA 2RO0A 3VS6A 4C92F 2JS0A 1UEBA 2MOXA 2YLCA 2EPDA 3SWNA 4F04B 1JXMA 2M51A 1G83A 3M58A 4ESRA 1E7OA 1BBZA 4II1A 3JCMg 1RADB 3FJ5A 2JXBA 2X4YA 2ZPHB 1TS9A 4X9CA 1M2OA 2O31A 4LDVA 1Q81R 1Y71A 4JLGA 3EFRA 1ZSZB 1GCPA 4M77G 2ROTA 1KJWA 2GNCA 5CQYA 1H3ZA 1MV3A 3GNFB 2B86A 2A37A 3LH5A 4PJOE 2LJ3A 3LGFA 4A4FA 4RTZA 2KVQG 1Q81C 3SD4A 1HSQA 5KYXB 1QMCA 2J06A 1FYNA 5IXFA 2LJ1A 2YUQA 5L23A 5IAYA 3OYAA 4ORZA 2BE7D 1WHHA 1KD1U 1O9SA 1OYXA 3REBB 1V29B 4AFUC 1YWOA 3U23A 2QQRA 4J9FA 3OB9A 3GNGA 3MCAB 2OTJA 3CMAQ 4DBQA 3MHXA 4XU2A 3GBQA 1K76A 1KK7A 1ZSZC 3CCRQ 2AT1B 2AKKA 2J6FA 2PZ1A 3OYFA 4EPCA 2FZGB 3J81E 2FVUA 1AEYA 4E2FB 1VQ5Q 4AG1C 3TQ7P 2EJFA 4JJNK 3CXCA 3G4SA 2ZCFB 1G8XA 3G71Q 2E1HA 3PVQA 4HVUA 4CC4B 3CCVA 2DIGA 2GGRA 4XQ3A 3I55A 1W70A 2XD0A 2OTLA 3GIBA 3QDRB 5IHIA 2O4XA 3CC4Q 4PJMA 3I56T 1VQ7Q 2J7IA 4JJCA 4LUDA 2DX1A 5GAN4 4RTTA 5HKCA 4B6MA 3QYGB 1WNLA 2KE9A 1MV0B 5D6YA 4FW2A 3J80E 3DB3A 2D9TA 3OSSC 3AT1B 5A2QE 1Y0MA 1C6VX 4A4GA 1VIFA 5IT9E 2HZYA 4J8OA 4PJOG 1NZ9A 4Z02A 1LOJA 2EFIA 2QASA 4PFZA 1NYGA 4C8QE 1W2BS 5FWCA 2JZ2A 3M0RA 4M7AA 1MGQA 1CKBA 1VQLA 4J9EA 4M77D 2RH2A 2FL7A 1WIEA 1Y7XA 1HD3A 1QVGS 1RLPC 5GAN6 1BI0A 1NEBA 2L8DA 3QXEB 1M8MA 1MMAA 3SFMA 4A4KA 1OZ3A 2JVVA 5GANe 1OU8A 3CPWS 1Q82R 4M78C 1OI1A 3EG0A 1TG0A 1NPRA 3TSZA 3E9FA 4AFSC 3CBPA 2BUDA 2OTJQ 3CCLA 2ATCB 1Q82C 4FU6A 2DYIA 3EG9A 1QCNA 2K4YA 2KRNA 4A4EA 2A0FB 1ACMB 5GAN2 2YRVA 2CYZB 1K9MR 3TREA 2DETA 1B07A 2PVDB 2JJ9A 3CCJT 3G4SQ 2CP6A 2QTVA 2X4WA 2DVJA 1YJNT 2LQWA 4DBRA 2E4HA 3CCVQ 2KXCA 1EZZB 3I55Q 1UG1A 2J6OA 1RABB 3H0IA 2P4TA 2OTLQ 4E47A 1K9MC 3E9GA 2HD0A 4OF1A 4IUQA 4BE2A 3O5ZA 2WSCE 2ZGWA 4BDZA 4N4HA 1FMKA 5EC7A 1WJQA 1OPKA 5LJ5j 4R55A 5I22A 2FRWA 2J6KA 2K6DA 3JCMe 4C8QG 4E7JA 4A53A 2RHXA 3CCST 1FWZA 4M75B 4M7AE 4C92C 3H41A 3QDFA 2GFAA 2GTOA 3CCMT 4FM4B 1D1AA 3KBGA 3NTIA 3CMEA 5KYWA 1AWWA 2FB7A 4PJOD 1BI2A 3OYGA 3EG1A 1BB9A 4OB2B 3QYHB 1VQLQ 1PC0A 4AG2C 1G3TA 4K11A 3SDZA 2NLUA 3NPFA 3R6OA 3LLRA 4KBMB 5HY6A 3OMCA 1PSFA 4E7ZA 2YT6A 4MDXA 2LX7A 2HQEA 2D0NA 2LQKA 3V7SA 4KULA 2FPDA 2KSSA 4RTYA 1ZUKA 3EG3A 5GAOn 5GAOl 2LNHB 4F16A 4M75C 2ED0A 6AT1B 2X3WD 3RR6A 1KQSS 2OI3A 2RJEA 4IUPA 3CCLQ 1YIJT 5GAMj 2YUNA 2VV5A 2DK3A 7AT1B 1LCKA 3EFSA 2XI9A 3TSWA 3VKIA 5GJVB 4LD9K 2CREA 2H3JA 1FX7A 1G2BA 2K7AA 3JAME 1NBEB 4JDSA 1YHQT 5LL6S 4RTXA 2DAQA 2EYZA 1M90R 2KR3A 2R5MA 4ZGJB 4CC7A 3M59A 2KNBB 1UHFA 2DVEA 3CXCP 2LCLA 1VQOA 4JRKA 1Q7YU 2QYZA 3CCET 2A08A 4ANJA 2ENMA 1PD0A 1Q86C 4M7AG 4B9WA 2G3RA 5AT1B 4M77B 1UTIA 2DRKA 1I8FA 2L3SA 2EGEA 1I4K1 2RB6A 1M30A 3IQLA 1U1TA 3OYEA 1WZOA 4FT2A 4PJJA 2COYA 3QIIA 5C6SA 2RJCA 2QGGA 3H6ZA 4N4IA 3EAEA 4C8QD 3M57A 2BIVA 3QZ9B 2M0OA 1VQPT 5KYYA 2DM1A 3OQ5A 3CMEQ 2SRCA 1SSHA 1UGPB 4FYWB 1OULA 4M7DE 2V8KA 1QKWA 1UECA 4M4ZA 3VUZA 3Q1JA 3OYDA 1X6GA 1I5OB 4OB1B 5ECAA 1QKXA 3JB9H 5FWBA 4WF2A 1R0BG 3M0TA 1I5LA 4HCBA 2MI6A 2P4RA 3C0CA 2HAXA 3E2UA 3BFMA 3QUIA 5GMKe 2P0KA 1I1JA 1YCYA 1KHCA 2E64A 3EGXA 5GAOm 2RI2A 3UT1A 1AZEA 1IHVA 5KE2A 4DQ2A 4J7FA 1U3OA 2QQBA 1AWOA 1YI2A 2CDTA 2GQIA 1BYMA 5DLOA 5LJ3j 3M0PA 1UFFA 2FRYA 1XQHA 2M9UA 1PHTA 2RI3A 2M16A 3FC3A 3WVEB 1BIBA 1TUDA 1H8KA 2QEXT 2QDYB 1R8OB 2JT4A 3UATA 4BI3A 3CC2A 3A8MB 4LDXA 2QA4T 2KRMA 1T3SA 2MAMA 2K3XA 1MNEA 1N9SA 1B7TA 2HDAA 1XJWB 4D6WA 1XTDA 2CP0A 2E70A 1GCQC 3JCMX 1WGSA 5DM7R 2YRCA 1WYXA 1ZSGA 1WHKA 1N5ZA 4GY5A 4XTYA 1VQ6A 1M1KC 3DB4A 3HKSA 1TU0B 2NWMA 4M7DG 1W4SA 1B34B 4D8DA 4RCBA 4EIKA 2PQWA 3DLLA 1QVFA 2LCSA 3NMZC 4LDWA 4JUVA 4NS5A 1F1BB 4HCCA 1UHCA 1X6BA 3O8VA 3CC7T 1YP5A 1VQMA 1V76A 1I81A 4MZMA 2EQIA 2D0QB 3EFOA 2HSEB 1ZUUA 1I07A 1QQJA 1BKBA 5FLXE 3BDUA 1X75C 2RQWA 1D1CA 1LJOA 2DPPB 4J9HA 3L42A 3UA7A 3HRSA 2YSQA 5KE3A 2RJFA 2ZAEA 2XU8A 4CI0C 1YJWT 2HNIA 2IVWA 1JXOA 1M2VB 4PJOA 1WX6A 4PKCC 2VXFA 1WXUA 2JTFA 1WXTA 3MP1A 3SWNB 4J6YA 5A0LA 1W1FA 3CCUT 4FL6A 5A0DA 1PNJA 1VQOT 1KSWA 1KIKA 5GMKl 4J9GA 3CMAA 1YI2Q 2L3RA 2GBQA 2EQJA 1D0YA 1PCXA 3PE0A 1YWPA 1AD5A 1Y96A 3C12A 1M3CA 4HXJA 3LH0A 3V7CA 1O75A 1RAAB 4TVRA 4DOVA 2LCCA 3RDVA 3A1PA 3HRUA 3CC2Q 5GAN5 4OB3B 4A63B 5IH2A 3GF5A 2IIMA 2RI5A 4DEXA 3NTKA 1OZ2A 2E3HA 4JJDA 5LJ5h 2C06A 5FRMA 1U5SA 3OYIA 2LQNA 3CPFA 5C0MA 1VQ7A 1VQ6Q 2EIFA 1WJSA 3ZBDA 3OYLA 2RM4A 1KC8R 1DJ7B 2XDBA 2BZXA 3TCJA 3H9NA 2B8AA 1AWXA 1QP3A 1VQ9T 3C4SA 1VA7A 4M7DD 4ZTFA 2C0IA 2K57A 2YUOA 2RPNA 3INZA 1LNXA 5KYUA 2O9VA 2CH4A 1VQMQ 2ED1A 4LXCA 3F70A 1WHGA 4C0DB 3CQTA 4J5YA 4BY6B 3GLXA 3PIOA 2ECZA 2LT4A 3QJ6A 4J9BA 1MUZA 2DL4A 2XIDA 4F7UA 2KXDA 3ASKA 3M4YA 3OW2S 1VQ8A 1S72A 1JJ2A 1IB8A 2W10A 4C8QA 5A0GA 3ZEHA 4DBHA 2O4XB 2LVMA 4RG2A 2WSEE 3L1AA 4M75F 3VYHB 2CP3A 4N4GA 3H8ZA 1X2QA 2CH4W 1VQNA 5GAMh 4E7HA 2LTOA 4XTZA 2EWNA 2A3LA 1OU9A 2DXBA 3FIFA 2RQRA 1V1CA 2ZPFB 4MZPA 4ZTJA 4BY6C 2CZ1B 5GMKm 3CCQQ 4QVZA 2DILA 2I2LA 1X2KA 1OV3A 5LJ5d 4M7AB 2ABLA 2AHJB 3HP9A 2AIRB 2WSFE 3RMSA 2DBKA 2FO0A 2ZPEB 2JMCA 4FSSA 2NUPA 1PG5B 1OX9A 1RAGB 1QWEA 4XTWA 3HRTA 1SPKA 1K8AU 4A4HA 1PKTA
chains in the Genus database with same CATH topology
4C8QB 1Q82U 4PJOD 1BI2A 4OMFB 3OYGA 2KQWA 4OB2B 3LX7A 3M5AA 2R5AA 3QYHB 4CRIA 2YLBA 4LDYA 2V8IA 5GAN3 3JCMh 4N0AC 1G3TA 1NE8A 3DLMA 1MHNA 4C0FA 4XU1A 4NL2A 3SDZA 4XTXA 5EG2A 4M77A 2NLUA 3FRNA 4M7AC 3SWNC 5CIUA 4F7UE 5CVIA 2EYQA 3R6OA 2FYKA 3MEVA 3QHSA 4E7LA 3LLRA 4KBMB 5HY6A 3OMCA 1PSFA 2DTOA 2CZ6B 3MP8A 2XDDA 1YITA 4MDXA 2HQEA 3RIRA 2LQKA 2X4XA 2VC8A 1K9MU 4ZN1A 2F5KA 3E1SA 3V7SA 2JUFA 4KULA 3PT9A 2KSSA 2RD1A 5I2MA 3QBYA 1IREB 5LJ5f 4C5HA 5GAOn 3CMAT 3A5ZB 5GAOl 1NJIU 3A8OB 4M77F 1G3YA 5GANd 5GAMd 4M75C 4M7DF 3CCRT 5LJ3e 1KC8C 2KK4A 3OYKA 3M54A 3G6ET 1KQSA 5KH6A 1KQSS 4L6V5 4C92D 1VQKT 1RI0A 2RJEA 4IUPA 1YIJT 2K2VA 3L2QA 2K5IA 5GAMj 5GANj 4EMGA 2VYTA 4RKUE 5M9OA 2VV5A 3ER0A 3X24B 4C8QC 1EIFA 1VQ5T 2DK3A 1D3BA 1YBYA 3CCJA 3JSCA 3VU3C 1TH7A 2XI9A 3EFSA 3L2UA 3G71T 1VUBA 3NFCA 4DA4A 3VKIA 5I2SA 4LD9K 1YJNA 2H3JA 3OS5A 4C5IA 1FX7A 5LJ5g 1YI2T 1WPYA 1M1FA 5J26A 1FXXA 2GF7A 4RCCA 1YJ9T 1IZ6A 4FT4A 5GAN8 5LJ3h 1VIEA 2QQSA 3JAME 4JDSA 4Y28E 1HXDA 4X9DA 3FDRA 4XAXB 2DZ9A 3CC4T 1VQ7T 3L2WA 1YHQT 1WQ7A 3PGGA 5LL6S 4BD3A 4M7AD 3JCMJ 2HBPA 2DAQA 2PUOB 1AHJB 3CD6A 2R5MA 2GQVA 4ZGJB 2RA2A 3M59A 4QW2A 5CQXA 5CCAA 2CZ7B 2DVEA 1KQ2A 4PLLA 2DJZA 4ZN3A 2PVGB 2DKGA 2R57A 3CC2T 2LCLA 1VQOA 4QQ6A 4JRKA 1QVFS 1Q7YU 3CCET 4C0ZA 2E5QA 3PFSA 1Q86C 4M7AG 1N6AA 3C94A 4B9WA 2G3RA 3HL8A 5FU6B 3M53A 5CO7A 2MWOA 2QXFA 3HHTB 3MEAA 4GLKA 4M75D 4M77B 2VGMA 4M78A 3CCSA 3PNWC 5CK9A 4RG8A 3WXMB 4C0DC 1VQ8A 1I8FA 2EKOA 2XDPA 1I4K1 2RB6A 1VQ6T 5I21A 3RKXA 1P92A 3CCMA 1U1TA 1M1GA 3OYEA 2KDSA 4FT2A 5HK3A 3LYIA 2LT1A 3GP8A 5J3BA 3A8LB 3FB9A 3QIIA 5GANf 5GAMf 2RJCA 3H6ZA 4N4IA 4C8QD 3EAEA 4XU3A 3M57A 5C6SA 5J39A 4HCZA 2BIVA 3QZ9B 4M7DA 2M0OA 4M75G 1VQPT 1N8RC 3VYGA 3OQ5A 2K5FA 4J83A 1UGPB 2LQ8A 4FIBA 3X26B 4ELZC 3FLGA 4M78F 4M77E 3OYMA 4M7DE 2V8KA 2GFUA 3VJPA 4C5GA 4EMHA 4F7UG 2MWPA 3OS1A 2VUBA 4JRIA 2QQAA 3RKYA 1BI3A 4A54A 1K73C 1UGQB 3VUZA 4OVAA 3JCMV 3Q1JA 3C95A 4OGCA 1VQMT 2F69A 2KMTA 3A8HB 3OYDA 2F5TX 2EQKA 2LDMA 4KUIA 4HKEA 4OB1B 3V8KA 1D3BB 2E12A 2FHDA 3OMGA 2DIQA 4R56A 3JB9H 5GANg 4WF2A 5GAMg 1M1KU 3BDLA 1ZBXA 2E6NA 4MMLA 3VUBA 1I5LA 4HCBA 1B34A 3MEWA 4ATOA 2MI6A 5FU6C 2YHTA 4XU0A 3P8DA 3RESA 1PSEA 3L2ZA 2HAXA 5GMKi 4O5VA 2QI2A 2XK0A 3BFMA 3QSUA 4PJOF 3CCRA 2K3YA 4OGEA 3OBWA 5D6WA 3V8JA 2OTJT 3G6EA 3QUIA 3RUXA 1ZQ1A 5GAOr 5GMKe 2P0KA 1VQKA 1YIJA 1YCYA 1KHCA 2E64A 3PIPA 3DKMA 3QG1A 1G3SA 4J7IA 4BDYA 2E41A 4ME7A 5GAOm 1Q7YC 1Q86U 4P5NA 2RI2A 3UT1A 4IURA 1VQ5A 4XTUA 2WACA 4C0GA 1M90U 4BUGA 2GCXA 5KE2A 2ZPIB 5LJ3d 4DQ2A 3G71A 4C92A 2MMPA 2EQUA 2PU9B 4J7FA 4C5EA 2XKOC 3L2VA 1GXIE 2QQBA 3OYNA 1YI2A 3G4ST 4M78B 3JRZA 4QVDA 3OYCA 5DLOA 1BYMA 5LJ3j 1X6OA 3JCMf 3OBYA 3CCVT 3JCMP 1UGSB 3QKJA 1N8RU 1XQHA 3BY7A 5GMKh 3I55T 3CC4A 3X20B 2M9UA 2Y4XA 1YHQA 2RI3A 2R58A 2M16A 3CCQT 3FC3A 3PMTA 2OTLT 4BB7A 1KQ1A 1BIBA 5D6XA 3WVEB 2BKDN 2QEXT 4IUUA 2RO0A 2QQ9A 2QDYB 1R8OB 4C92F 4BI3A 2EAYA 3TU4K 4EDUA 5DLQE 3A8MB 1K73U 3CC2A 3JB9J 4LDXA 2QA4T 2MAMA 1UEBA 2K3XA 2YLCA 4M78E 3CCEA 3SWNA 1N9SA 3N5BB 4D6WA 1XTDA 2E70A 4X34A 3JCMX 1WGSA 1M5Q1 3M58A 4PLIA 5DM7R 4BE1A 4II1A 3JCMg 2X4YA 3ZFJA 5CKEA 2ZPHB 2D6FA 4GY5A 4X9CA 4XTYA 3QO3A 1N27A 4LDVA 4PNOA 1M1KC 1BI1A 1VQ6A 1Y71A 4JLGA 3EFRA 3DB4A 3HKSA 3MEUA 2HQXA 1VQ4A 4M77G 4M7DG 1W4SA 1B34B 4RCBA 5CQYA 4RMOA 4HA8A 4XK8E 1VQPA 1H3ZA 3OYHA 1WQWA 2PQWA 3DLLA 3G7ZA 3GNFB 3S3NA 3S3MA 1WJRA 2RHYA 1QVFA 4LDWA 4J6XA 1JB0E 4JUVA 3VV0A 4NS5A 4PJOE 3LGFA 4A4FA 4HCCA 2KVQG 1Q81C 3QJYA 1RL2A 1VQLT 3SD4A 4O6JA 3O8VA 3JB9D 4KUDK 5LJ3f 4V2SA 3CC7T 1QVPA 2EJ9A 1VQMA 2RHIA 4M7DB 2E10A 2QTXA 4QQGA 2M1HA 1M90C 1I81A 4MZMA 2D0QB 2DO3A 1BKBA 2RHZA 5FLXE 5IAYA 3BDUA 3OYAA 2LC4A 5GAN7 3CBOA 1X75C 3UDCA 5AYFA 4C92B 1LJOA 4L5GA 2DPPB 3LW5E 2L5QA 2O01E 3L2RA 1U8RA 2RK1A 1KD1U 1O9SA 3L42A 1X01A 2X35A 4HT8A 1OYXA 4C8QF 3HRSA 1V29B 5KE3A 3HFOA 2RJFA 2QQRA 5L8RE 3OB9A 3GNGA 2XU8A 3FEOA 2Y90A 3ME9A 3MCAB 3OSVA 4CI0C 2OTJA 1VQ8T 1YJWT 3J7AF 3MHXA 4XU2A 4BI4A 2HNIA 4BACA 2OAUA 3S3OA 2IVWA 5LJ3g 1S72T 2Y4YA 1KG1A 2JOYA 2K5LA 4YTLA 4PJOA 4C92E 3CCLT 4PKCC 3CEYA 4ZGEB 3OYFA 4EPCA 2VXFA 5FRNA 2JTFA 4IUVA 2DD4A 2IG0A 3MP1A 3SWNB 2FVUA 3PMIA 4J6YA 3J81E 5A0LA 3URGA 2XICA 3CCUT 2EJFA 4FL6A 4JJNK 5A0DA 1VQNT 1VQOT 4OP0A 3CXCA 3G4SA 2ZCFB 2E1HA 2EJGA 3CXCS 3M4GA 5GMKl 2VGNA 4M77C 3CMAA 4M7DC 5LJ5e 3CCVA 4JLIA 2DIGA 5GMKj 2L3RA 4XQ3A 3I55A 2XG8D 2EQJA 3HFNA 3JB9I 4PL6A 2XD0A 2OTLA 4Y91A 1QW1A 3GIBA 2RHUA 3M55A 3QDRB 4M78G 2O4XA 2QEXA 3SB2A 3I56T 3GPLA 1Y96A 3C12A 1Q81U 5GAN4 4EMKA 4HT9A 5HKCA 3KXTA 3LH0A 3V7CA 4ELYC 1O75A 4J6WA 3LWIA 2QA4A 4TVRA 5DY9A 4DOVA 2LCCA 3OYBA 3HRUA 4NL3A 5GAN5 4OB3B 3QYGB 1UGRB 1WNLA 1HK9A 3FJPA 3GF5A 5D6YA 2RI5A 3RMQA 3LWHA 3J80E 3NTKA 2CKKA 2D9TA 2DD5A 3DB3A 3OSSC 5HK0A 3OYJA 4JS4A 1OZ2A 1UB4A 4ZGDB 1YJ9A 5LJ5h 2RK2A 5A2QE 4LD6A 1JBMA 4M75E 2C06A 5FRMA 3QZ5B 2KY9A 4A4GA 4QVCA 3OYIA 1VIFA 3CPFA 3UPUA 3JCMd 2FB7A 5C0MA 5IT9E 1KD1C 1VQ7A 3MP6A 2EIFA 1WJSA 4J8OA 3ZBDA 3OYLA 2V8JA 5FU7B 2RM4A 4PJOG 3HSBA 3KUFA 1NZ9A 4Z02A 1W2BA 2DXTA 1DJ7B 1LOJA 2EFIA 4N0AA 4Q5WA 3TCJA 2XDBA 4C8QE 1W2BS 3TEEA 3MO8A 3JCMb 3META 2B8AA 2JZ2A 4B9XA 4JRPA 3CMET 1MGQA 4M7AA 3LGLA 2P0QA 2XHCA 1QP3A 3P8BB 5CKHA 1VQ9T 3C4SA 2DZCA 2X4JA 3OS2A 1VQLA 3P8HA 4M77D 2RH2A 4M7DD 4ZTFA 2FL7A 2DEQA 1H641 3CC7A 5KCHA 5FROA 2CS7A 2PVOB 2K57A 4PJOB 1Y7XA 2KAFA 4MZTA 3INZA 3M56A 1LNXA 1QVGA 4IKFA 3OA6A 4MDWA 1QVGS 3A8GB 5GAN6 1BIAA 1BI0A 3JCMQ 2LNVA 3F70A 4C0DB 2L8DA 3QXEB 4L59A 4J5YA 4BY6B 2LRQA 2P0PA 3GLXA 5GAOq 3PIOA 3QPHA 1XNIA 4DOWA 4M75A 4NOYA 2LT4A 1G3WA 4MMKA 3SFMA 1OZ3A 4A4KA 5IN1A 2JVVA 3QJ6A 5GANe 5GAMe 2DXUA 2E65A 3CPWA 3CPWS 5KCOA 2ZZDA 2XIDA 3T9NA 4M78C 1YITT 4F7UA 3JB9G 3X25B 1OI1A 3OW2A 1QP2A 3ASKA 2LX9A 1NPRA 2CGHA 2L89A 3M4YA 3NTHA 4KT0E 4C92G 3OW2S 5CR2A 2DXCA 1YJWA 2RJDA 3M9QA 1S72A 3E9FA 4C8QA 3CBPA 1JJ2A 2BUDA 1Y07A 5A0GA 5CAIA 3ZEHA 1JJ2S 2O4XB 2LVMA 5FU7C 1M9SA 1Y96B 4RG2A 1K8AC 3JB9F 1M8VA 3BW1A 4EMKB 2WSEE 3E19A 3L1AA 3CCLA 4M75F 1M4ZA 2MF2A 3VYHB 1SSFA 1Q82C 4N4GA 3V7RA 1JRIA 3H8ZA 4FU6A 4JS5A 1G5VA 2ZPBB 5CKDA 3CCUA 4F7UF 2E6ZA 2K4YA 3OYYA 5GAN2 3V8LA 4A4EA 5GAMh 5GANh 2LTOA 2CYZB 2A7YA 2YRVA 3TREA 4E7HA 1VQNA 2DTIA 4XTZA 2PVDB 2EQMA 2A3LA 2EWNA 4M7AF 2DXBA 3CCJT 3FIFA 4PJOC 4XTVA 3CBMA 3WVDB 2ZPFB 3UWNA 3PTAA 2X4WA 4MZPA 1YJNT 2VXEA 4ZTJA 3OY9A 4BY6C 3I56A 2CZ1B 5GMKm 3JCMc 2P4TA 4QVZA 1KHIA 1NPPA 2I2LA 3E9GA 4E47A 1K9MC 2HD0A 4OF1A 5LJ5d 1VQ4T 4IUQA 4FSXA 1KC8U 3CD6T 4M7AB 4BE2A 3GOXA 2WSCE 1NJIC 3AHUA 1U1SA 2ZPGB 3JCMW 2ZGWA 3S6WA 4M78D 4BDZA 4N4HA 4E7KA 2AHJB 1ZHIA 1WJQA 3HP9A 2WSFE 3RERA 5LJ5j 2DTHA 3RMSA 3OS0A 4LDUA 2ZPEB 4BE0A 4R55A 4VUBA 4EMKC 3HPWA 3RKWA 3JCMe 4C8QG 4E7JA 4QQDA 4A53A 4IUTA 2RHXA 5CKFA 3CCST 3CCQA 4UC4A 4E7IA 1FWZA 4M75B 4JRQA 4M7AE 4XTWA 3HRTA 4C92C 1N9RA 4OB0B 5CKBA 5GAOp 2GFAA 3X28B 3CCMT 4FM4B 1XOVA 2JN0A 4F7UB 2JTMA 3KBGA 3NTIA 3CMEA 1K8AU 4BI8B 2CZ0B 1VQ9A 4A4HA 2PUKB 2JNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI3 A;  4BI8 B;  4BI4 A; 
#chains in the Genus database with same CATH topology
 1ZA1 B;  1RAH B;  2KQW A;  3M5A A;  2R5A A;  1TOV A;  2RQV A;  4C0F A;  1WI7 A;  4NL2 A;  3EG9 B;  4M7A C;  4F7U E;  5CVI A;  3QHS A;  4E7L A;  1CSK A;  1QVF P;  4GLM A;  2XDD A;  1YIT A;  1MND A;  2X4X A;  2CT4 A;  2VC8 A;  2F5K A;  1RI9 A;  2RD1 A;  1IRE B;  2QK0 A;  5LJ5 f;  3CMA T;  1VQ8 Q;  3A5Z B;  1NJI U;  1S72 Q;  4M77 F;  5GAM d;  3CCR T;  1SG5 A;  2KK4 A;  4LUE A;  4L6V 5;  1RI0 A;  1RAE B;  2K2V A;  5GAN j;  4RKU E;  3UA6 A;  1VQ5 T;  1EIF A;  1TTH B;  2CT3 A;  1VQN Q;  3L2U A;  3G71 T;  1VUB A;  4DA4 A;  1FXX A;  2GF7 A;  4RCC A;  1UE9 A;  3QWX X;  2NYS A;  5GAN 8;  4RTW A;  5LJ3 h;  4HCK A;  4Y28 E;  4X9D A;  3CC4 T;  3M0Q A;  1VQ7 T;  1PRL C;  3CD6 A;  2CSQ A;  2RA2 A;  5KYW B;  5CCA A;  3VS0 A;  4PLL A;  2PVG B;  2DKG A;  2R57 A;  3EGD A;  1QVF S;  3NHN A;  1AVZ C;  1N6A A;  3C94 A;  3HL8 A;  1FMV A;  5FU6 B;  5CO7 A;  3VS3 A;  2MWO A;  2QXF A;  4M78 A;  4GLK A;  2DYB A;  3PNW C;  3D7S B;  2BZY A;  5HK3 A;  2PTK A;  2LT1 A;  3GP8 A;  3A8L B;  3FB9 A;  1LVK A;  5GAM f;  3JB9 G;  3VYG A;  2K5F A;  4J83 A;  4FIB A;  3OYM A;  2GFU A;  4F7U G;  4C5G A;  4KGX B;  2MWP A;  3OS1 A;  2VUB A;  4JRI A;  2QQA A;  4OVA A;  3JCM V;  4FCY A;  4OGC A;  2F69 A;  3V8K A;  2E12 A;  2ROL A;  1VYU A;  1UUE A;  1M1K U;  1ZBX A;  2RF0 A;  2HCK A;  1YIT Q;  4IIO A;  5FU6 C;  2YHT A;  4XU0 A;  2QG9 B;  3P8D A;  1PSE A;  4O5V A;  4PJO F;  2RN8 A;  1EFN A;  1IGQ A;  2FG0 A;  3G6E A;  2OTJ T;  1IXD A;  1RLQ C;  1VQK A;  2CUB A;  4M7D A;  1G3S A;  4J7I A;  2E41 A;  4ME7 A;  3HTR A;  4HVV A;  2BE9 B;  1KD1 R;  4C0G A;  1OX8 A;  5LJ3 d;  4Z88 A;  4C92 A;  2MMP A;  2NUT A;  2HEQ A;  1JJ2 P;  3G4S T;  3OYC A;  1M3B A;  1WA7 A;  4CC2 A;  2V1Q A;  3CCV T;  1UGS B;  1N8R U;  2L3Q A;  3BY7 A;  3I55 T;  2CP5 A;  2OTL T;  3PMT A;  4BB7 A;  5D6X A;  2BKD N;  2KBT A;  2QQ9 A;  3TU4 K;  1K73 U;  1VQ4 Q;  5KYY B;  5DLQ E;  3CD6 Q;  3JB9 J;  4M78 E;  1R77 A;  1AT1 B;  4F17 A;  2H3E B;  4OMQ A;  3N5B B;  1K0X A;  2EKH A;  4X34 A;  4PLI A;  4BE1 A;  5CKE A;  3VS4 A;  2QAZ A;  3VS5 A;  3SEM A;  2HQX A;  1K8A R;  3MJX A;  4RMO A;  4XK8 E;  3OYH A;  1WQW A;  2G6F X;  1NM7 A;  3S3M A;  1WJR A;  2D8J A;  2RHY A;  4J6X A;  1SHF A;  1JB0 E;  3VV0 A;  1D09 B;  8AT1 B;  3QJY A;  4ZNX A;  1VQL T;  4F14 A;  4O6J A;  3JB9 D;  5LJ3 f;  1ZA2 B;  3EGX B;  3REA B;  2E10 A;  1M90 C;  1RUW A;  2DO3 A;  2EW3 A;  4WCI A;  2RHZ A;  2EGA A;  2LC4 A;  3UDC A;  5AYF A;  4L5G A;  4PFP A;  1NEG A;  3LW5 E;  2L5Q A;  2YWW A;  3L2R A;  1GRI A;  1VYT A;  1X01 A;  4HT8 A;  4C8Q F;  3THK A;  1HYO A;  3HFO A;  1NJI R;  1ABQ A;  3EGU A;  2O9S A;  3FEO A;  3OSV A;  4BI4 A;  3S3O A;  2DE0 X;  2OAU A;  1KG1 A;  3G6E Q;  4YTL A;  1PWT A;  2FPF A;  4C92 E;  4JPB W;  3CCL T;  1VQK Q;  4ZGE B;  5FRN A;  4IUV A;  4JJB A;  2IG0 A;  1WHM A;  3PMI A;  4OMN A;  2XIC A;  4OP0 A;  1PRM C;  3CXC S;  1GFD A;  4M77 C;  2LMJ A;  5GMK j;  1YJ9 Q;  1UJ0 A;  2XG8 D;  4Y91 A;  3M55 A;  4M78 G;  4J9C A;  3SB2 A;  3GPL A;  1Q81 U;  4EMK A;  4HT9 A;  3LWI A;  4J6W A;  1X69 A;  4NL3 A;  2HKN A;  1UGR B;  3RMQ A;  3LWH A;  1HJD A;  5I11 A;  5HK0 A;  3OYJ A;  4PJL A;  1UB4 A;  2RK2 A;  4M75 E;  3EFO B;  3MKD A;  2J05 A;  2V8J A;  1K9A A;  5FU7 B;  1W2B A;  4Q5W A;  4N0A A;  4JZ3 A;  2OAW A;  3TEE A;  3MO8 A;  3MET A;  1AWJ A;  2YRD A;  3CME T;  2X9H A;  2A28 A;  1H64 1;  5KCH A;  2QGF B;  3QWY A;  4QKU A;  4PJO B;  2KAF A;  4MZT A;  3VS1 A;  1QVG A;  4IKF A;  3I5R A;  1BIA A;  3JCM Q;  2LNV A;  3VRY A;  2DRM A;  4L59 A;  2LRQ A;  2P0P A;  5GAO q;  1SHG A;  1XNI A;  1GFC A;  4DOW A;  3OYN A;  4M7A F;  1G3W A;  3CPW A;  1ZX6 A;  2C0T A;  2DXU A;  5KCO A;  3T9N A;  2LJ0 A;  1QP2 A;  2LX9 A;  3SHW A;  2CGH A;  3H0H A;  3NTH A;  4KT0 E;  1NYF A;  4C92 G;  5CR2 A;  3M9Q A;  2K3B A;  5CAI A;  1WDX A;  1BCM A;  2CP7 A;  5FU7 C;  1Y96 B;  1GCQ A;  2DJQ A;  3BW1 A;  4LN2 A;  3E19 A;  1M8V A;  1M4Z A;  2MF2 A;  2ZPB B;  1R0C B;  3OYY A;  4FYY B;  1S1N A;  2VKN A;  3V8L A;  5GAN h;  2A7Y A;  2DTI A;  2DL5 A;  4PJO C;  2CSI A;  2DLP A;  4XTV A;  3CBM A;  1N8R R;  2F2V A;  2VXE A;  2F1L A;  3I56 A;  3JCM c;  3PVL A;  1KHI A;  1K73 R;  2EGC A;  4QT7 A;  1OEB A;  4KGZ B;  4FSX A;  3RBB B;  3GOX A;  3AHU A;  2ZPG B;  4M78 D;  4E7K A;  2VB6 A;  1ZHI A;  4AT1 B;  2DTH A;  2GTJ A;  4BE0 A;  4VUB A;  5KYU B;  2VVK A;  1VYV A;  4KH0 B;  4QQD A;  1YNZ A;  5CKF A;  2DBM A;  3CCQ A;  1Q95 G;  4OMO A;  1N9R A;  5GAO p;  3X28 B;  2DEU A;  1SRM A;  1E6H A;  2EBP A;  4F7U B;  1Q7Y R;  4FW1 A;  2EYW A;  2PUK B;  4C8Q B;  1Q82 U;  4OMF B;  3LX7 A;  2CP2 A;  4CRI A;  2YLB A;  4LDY A;  5GAN 3;  2AK5 A;  3JCM h;  1W6X A;  1NE8 A;  1ZUY A;  4WTO B;  1MHN A;  4FYV B;  2DL7 A;  4XU1 A;  1FMW A;  4XTX A;  2YXY A;  5EG2 A;  3FRN A;  1QWF A;  1TXQ A;  3SWN C;  2EYQ A;  2LZ6 B;  2JM9 A;  2DTO A;  2CZ6 B;  3MP8 A;  3RIR A;  2M0Y A;  1OPL A;  1UDL A;  1K9M U;  4ZN1 A;  1GBQ A;  3G1J A;  3QBY A;  4C5H A;  2JS2 A;  2Z0W A;  4M7D F;  1G3Y A;  5GAN d;  1KC8 C;  3M54 A;  1KQS A;  5KH6 A;  4C92 D;  3MPU B;  2NUZ A;  4EMG A;  2VYT A;  3ER0 A;  4C8Q C;  1D3B A;  2O2O A;  3CCJ A;  3JSC A;  1TH7 A;  3NFC A;  2JMA A;  1YJN A;  4C5I A;  5LJ5 g;  1YI2 T;  2NUP B;  1M1F A;  1IZ6 A;  2FEI A;  1JEG A;  2QQS A;  3FDR A;  4XAX B;  2DFU A;  3I56 Q;  4RTU A;  3L2W A;  1ZLM A;  3JCM J;  2PUO B;  2GQV A;  5CQX A;  1KQ2 A;  1UJY A;  1Y57 A;  2DJZ A;  3CC2 T;  2QDL A;  2E5Q A;  5HCK A;  3EHQ A;  2HSP A;  3M53 A;  3MEA A;  1K4U S;  4M75 D;  3CCS A;  2VGM A;  2DNU A;  4C0D C;  2EKO A;  2KT1 A;  1VQ6 T;  5I21 A;  2C0O A;  1P92 A;  3RKX A;  1Z9Q A;  3CCM A;  1M1G A;  1QCO A;  3LYI A;  5J3B A;  4CC3 A;  5GAN f;  5J39 A;  3JCM d;  4XU3 A;  5IHN A;  1IGU A;  2LQ8 A;  3X26 B;  3FLG A;  3VJP A;  1IRX A;  4JZ4 A;  1BI3 A;  1SRL A;  4A54 A;  1UGQ B;  1KFZ A;  1IHW A;  5GJW B;  1VQM T;  2F2W A;  1W2B P;  2LDM A;  3OMG A;  1ZSZ A;  5GAM g;  3BDL A;  2E6N A;  4MML A;  3VUB A;  4PFO A;  2HL3 A;  4ATO A;  5KYN A;  2E3I A;  3L2Z A;  4D8K A;  2XK0 A;  5D7U A;  1MMN A;  2K3Y A;  3V8J A;  1QVG P;  2BZ8 A;  5GAO r;  3I35 A;  3JV3 A;  5KYX A;  1YIJ A;  3QG1 A;  1Q86 U;  1D0X A;  2FZK B;  4X1V A;  3CPW P;  4IUR A;  3EGD B;  4LNP A;  1M90 U;  1M27 C;  4BUG A;  4KH1 B;  4DEY A;  1CKA A;  2O88 A;  2PU9 B;  2EQU A;  3L2V A;  2XKO C;  3CCJ Q;  4M78 B;  3JRZ A;  2FPE A;  1YJN Q;  1X6O A;  3JCM f;  3OBY A;  3QKJ A;  5GMK h;  1NLO C;  3EG2 A;  4OML A;  2AZS A;  1YHQ A;  1X27 A;  3CCQ T;  1KQ1 A;  1H92 A;  1T0H A;  2EAY A;  4EDU A;  2IPO B;  3CCE A;  2DMO A;  3A98 A;  1M5Q 1;  2RNA A;  2L0A A;  3ZFJ A;  2D6F A;  1E6G A;  3QO3 A;  1N27 A;  3CCS Q;  4PNO A;  1BI1 A;  3MEU A;  1VQ4 A;  3CCM Q;  1SKU B;  4HA8 A;  1VQP A;  1WHJ A;  3G7Z A;  3M0U A;  3S3N A;  2VAS A;  4E6R A;  1AOJ A;  1AZG B;  1RL2 A;  4KUD K;  2F2X A;  2HMA A;  4V2S A;  1QVP A;  2EJ9 A;  2RHI A;  4M7D B;  2MYS A;  2QTX A;  4QQG A;  2HKQ B;  2M1H A;  2KYM A;  1NG2 A;  5IHK A;  5GAN 7;  3CBO A;  4C92 B;  2NUT B;  2O01 E;  1U8R A;  2RK1 A;  1IO6 A;  2X35 A;  1QLY A;  2AZV A;  5L8R E;  2X51 A;  2DF6 A;  2Y90 A;  3ME9 A;  1VQ8 T;  3J7A F;  1ARK A;  4BAC A;  1S72 T;  2KT8 A;  5LJ3 g;  2Y4Y A;  2JOY A;  2K5L A;  2EYY A;  1YIJ Q;  3CEY A;  2COZ A;  2DD4 A;  1PKS A;  1D0Z A;  3URG A;  1VQN T;  2EJG A;  3M4G A;  3H0F A;  2VGN A;  4M7D C;  5LJ5 e;  4JLI A;  1KQS P;  3JB9 I;  3HFN A;  4PL6 A;  1QW1 A;  2RHU A;  2QEX A;  1YHQ Q;  3TVT A;  3KXT A;  4ELY C;  3ULR B;  1NLP C;  2QA4 A;  5DY9 A;  3OYB A;  2AKL A;  1HK9 A;  3FJP A;  1WHL A;  3CCE Q;  2CKK A;  2DD5 A;  4JS4 A;  4KGV B;  2H8H A;  4ZGD B;  1YJ9 A;  2A36 A;  2JTE A;  1JBM A;  4LD6 A;  3QZ5 B;  2KY9 A;  4QVC A;  1U06 A;  3UPU A;  2EVR A;  1KD1 C;  3MP6 A;  4FYX B;  2LP5 A;  3HSB A;  3KUF A;  2DXT A;  5IXB A;  1RAF B;  3JCM b;  2DL8 A;  4B9X A;  1VQP Q;  1PD1 A;  4JRP A;  3LGL A;  2P0Q A;  2XHC A;  3P8B B;  5CKH A;  2DZC A;  2X4J A;  3OS2 A;  3P8H A;  1YFN A;  1WLP B;  2DEQ A;  3CC7 A;  2I0N A;  2MPX C;  5FRO A;  2CS7 A;  2PVO B;  3BE3 A;  3M56 A;  1B3Q A;  4DBF A;  3OA6 A;  4MDW A;  3A8G B;  1WFW A;  4AFQ C;  3QPH A;  4M75 A;  4NOY A;  4MMK A;  3KFV A;  5IN1 A;  5GAM e;  2E65 A;  2KYB A;  2ZZD A;  1YIT T;  2K79 A;  1BU1 A;  1Z9Z A;  2OX7 A;  3X25 B;  3OW2 A;  2L89 A;  1YJW A;  1D1B A;  2DXC A;  2RJD A;  3R6N A;  1GBR A;  8ATC B;  1Y07 A;  3VS7 A;  1JJ2 S;  1M9S A;  1Q86 R;  1K8A C;  3JB9 F;  4EMK B;  1JO8 A;  1SSF A;  1TWB A;  2RQU A;  2JW4 A;  1JRI A;  3V7R A;  4JS5 A;  1G5V A;  5CKD A;  3CCU A;  4F7U F;  2E6Z A;  1RAI B;  2EQM A;  2V26 A;  2COW A;  2PNI A;  3WVD B;  3PTA A;  3UWN A;  2M02 A;  2EYX A;  3OY9 A;  2FZC B;  1NPP A;  2JM8 A;  2V1R A;  2QEX Q;  3UF4 A;  1VQ4 T;  2YUP A;  1KC8 U;  3CD6 T;  1NJI C;  1U1S A;  2QA4 Q;  3JCM W;  2K9G A;  3S6W A;  1J3T A;  3RER A;  4PK4 A;  3OS0 A;  1C0M A;  4LDU A;  3RNJ A;  2DA9 A;  1EX4 A;  4EMK C;  3HPW A;  4RTV A;  3RKW A;  2VWF A;  4IUT A;  4IIM A;  4UC4 A;  4E7I A;  4JRQ A;  9ATC B;  4OB0 B;  5CKB A;  1ABO A;  1OOT A;  1XOV A;  2JN0 A;  4E7S A;  2JTM A;  2E5K A;  4BI8 B;  2CZ0 B;  1JU5 C;  1VQ9 A;  2JNG A;  2W0Z A;  1WXB A;  1BCO A;  4R0K A;  2V8I A;  3I5S A;  4N0A C;  3CC7 Q;  3DLM A;  1LPL A;  4KRT A;  2YDL A;  4M77 A;  5CIU A;  2DER A;  2FYK A;  3MEV A;  5FW9 A;  1SEM A;  1C1A A;  1T3L A;  2KGT A;  2CUD A;  3E1S A;  2JUF A;  5I2M A;  3PT9 A;  2KEA A;  1A0N B;  1SF9 A;  1QCF A;  2RMO A;  1YCS B;  1YJW Q;  3A8O B;  5LJ3 e;  4GBQ A;  3OYK A;  3G6E T;  4OMM A;  2BTT A;  1VQK T;  3EHR A;  3L2Q A;  2L3P A;  2K5I A;  1M1K R;  2XMF A;  4Z8A A;  5M9O A;  3X24 B;  3CCU Q;  1YBY A;  2KI7 A;  1VQO Q;  3VU3 C;  2HBW A;  5I2S A;  3VRZ A;  3OS5 A;  1WPY A;  5J26 A;  4PJN A;  1YJ9 T;  1VOM A;  4FT4 A;  1VIE A;  1HXD A;  1H3H A;  2DZ9 A;  4M7A D;  1WQ7 A;  3PGG A;  1ZBJ A;  4BD3 A;  2HBP A;  1X43 A;  1AHJ B;  2MIO A;  4QW2 A;  2CZ7 B;  4ZN3 A;  4QQ6 A;  4C0Z A;  3PFS A;  3HHT B;  2KRO A;  5CK9 A;  4RG8 A;  3WXM B;  1JQQ A;  2SEM A;  2XDP A;  3I9Q A;  4LE9 A;  4OMP A;  2KDS A;  3VS2 A;  1TUG B;  1TSF A;  1UGV A;  3EH1 A;  4HCZ A;  4M75 G;  1N8R C;  2D1X A;  1MMG A;  1VQ9 Q;  4ELZ C;  4M78 F;  1BK2 A;  4M77 E;  4EMH A;  3RKY A;  1K73 C;  1MMD A;  2ESW A;  4J9I A;  1I0C A;  3C95 A;  3NGP A;  2KMT A;  3A8H B;  2KRS A;  1GL5 A;  2F5T X;  2EQK A;  4KUI A;  4HKE A;  2L2P A;  1D3B B;  2FHD A;  2DIQ A;  2DL3 A;  4R56 A;  1M3A A;  5GAN g;  1B34 A;  4Y92 A;  3MEW A;  1OQK A;  3RES A;  2X3X D;  1YN8 A;  5GMK i;  2P84 A;  2D8H A;  2HQH A;  2QI2 A;  3QSU A;  3CCR A;  1RAC B;  1K0S A;  4OGE A;  5D6W A;  3OBW A;  2RQT A;  3RUX A;  1ZQ1 A;  2MCN A;  4AMC A;  3PIP A;  3DKM A;  4Z89 A;  4BDY A;  1Q7Y C;  2K2M A;  4P5N A;  4HVW A;  1VQ5 A;  4XTU A;  2WAC A;  2GCX A;  4AFZ C;  2ZPI B;  3G71 A;  3OW2 P;  1PM3 A;  4C5E A;  1GXI E;  1K1Z A;  1TUC A;  2MK5 A;  4QVD A;  2OJ2 A;  2HL5 C;  3JCM P;  3M0S A;  4J9D A;  4RUG A;  3CC4 A;  3X20 B;  2Y4X A;  3EH2 A;  2R58 A;  1T0J A;  1M2V A;  3ZL7 C;  4IUU A;  2RO0 A;  3VS6 A;  4C92 F;  2JS0 A;  1UEB A;  2MOX A;  2YLC A;  2EPD A;  3SWN A;  4F04 B;  1JXM A;  2M51 A;  1G83 A;  3M58 A;  4ESR A;  1E7O A;  1BBZ A;  4II1 A;  3JCM g;  1RAD B;  3FJ5 A;  2JXB A;  2X4Y A;  2ZPH B;  1TS9 A;  4X9C A;  1M2O A;  2O31 A;  4LDV A;  1Q81 R;  1Y71 A;  4JLG A;  3EFR A;  1ZSZ B;  1GCP A;  4M77 G;  2ROT A;  1KJW A;  2GNC A;  5CQY A;  1H3Z A;  1MV3 A;  3GNF B;  2B86 A;  2A37 A;  3LH5 A;  4PJO E;  2LJ3 A;  3LGF A;  4A4F A;  4RTZ A;  2KVQ G;  1Q81 C;  3SD4 A;  1HSQ A;  5KYX B;  1QMC A;  2J06 A;  1FYN A;  5IXF A;  2LJ1 A;  2YUQ A;  5L23 A;  5IAY A;  3OYA A;  4ORZ A;  2BE7 D;  1WHH A;  1KD1 U;  1O9S A;  1OYX A;  3REB B;  1V29 B;  4AFU C;  1YWO A;  3U23 A;  2QQR A;  4J9F A;  3OB9 A;  3GNG A;  3MCA B;  2OTJ A;  3CMA Q;  4DBQ A;  3MHX A;  4XU2 A;  3GBQ A;  1K76 A;  1KK7 A;  1ZSZ C;  3CCR Q;  2AT1 B;  2AKK A;  2J6F A;  2PZ1 A;  3OYF A;  4EPC A;  2FZG B;  3J81 E;  2FVU A;  1AEY A;  4E2F B;  1VQ5 Q;  4AG1 C;  3TQ7 P;  2EJF A;  4JJN K;  3CXC A;  3G4S A;  2ZCF B;  1G8X A;  3G71 Q;  2E1H A;  3PVQ A;  4HVU A;  4CC4 B;  3CCV A;  2DIG A;  2GGR A;  4XQ3 A;  3I55 A;  1W70 A;  2XD0 A;  2OTL A;  3GIB A;  3QDR B;  5IHI A;  2O4X A;  3CC4 Q;  4PJM A;  3I56 T;  1VQ7 Q;  2J7I A;  4JJC A;  4LUD A;  2DX1 A;  5GAN 4;  4RTT A;  5HKC A;  4B6M A;  3QYG B;  1WNL A;  2KE9 A;  1MV0 B;  5D6Y A;  4FW2 A;  3J80 E;  3DB3 A;  2D9T A;  3OSS C;  3AT1 B;  5A2Q E;  1Y0M A;  1C6V X;  4A4G A;  1VIF A;  5IT9 E;  2HZY A;  4J8O A;  4PJO G;  1NZ9 A;  4Z02 A;  1LOJ A;  2EFI A;  2QAS A;  4PFZ A;  1NYG A;  4C8Q E;  1W2B S;  5FWC A;  2JZ2 A;  3M0R A;  4M7A A;  1MGQ A;  1CKB A;  1VQL A;  4J9E A;  4M77 D;  2RH2 A;  2FL7 A;  1WIE A;  1Y7X A;  1HD3 A;  1QVG S;  1RLP C;  5GAN 6;  1BI0 A;  1NEB A;  2L8D A;  3QXE B;  1M8M A;  1MMA A;  3SFM A;  4A4K A;  1OZ3 A;  2JVV A;  5GAN e;  1OU8 A;  3CPW S;  1Q82 R;  4M78 C;  1OI1 A;  3EG0 A;  1TG0 A;  1NPR A;  3TSZ A;  3E9F A;  4AFS C;  3CBP A;  2BUD A;  2OTJ Q;  3CCL A;  2ATC B;  1Q82 C;  4FU6 A;  2DYI A;  3EG9 A;  1QCN A;  2K4Y A;  2KRN A;  4A4E A;  2A0F B;  1ACM B;  5GAN 2;  2YRV A;  2CYZ B;  1K9M R;  3TRE A;  2DET A;  1B07 A;  2PVD B;  2JJ9 A;  3CCJ T;  3G4S Q;  2CP6 A;  2QTV A;  2X4W A;  2DVJ A;  1YJN T;  2LQW A;  4DBR A;  2E4H A;  3CCV Q;  2KXC A;  1EZZ B;  3I55 Q;  1UG1 A;  2J6O A;  1RAB B;  3H0I A;  2P4T A;  2OTL Q;  4E47 A;  1K9M C;  3E9G A;  2HD0 A;  4OF1 A;  4IUQ A;  4BE2 A;  3O5Z A;  2WSC E;  2ZGW A;  4BDZ A;  4N4H A;  1FMK A;  5EC7 A;  1WJQ A;  1OPK A;  5LJ5 j;  4R55 A;  5I22 A;  2FRW A;  2J6K A;  2K6D A;  3JCM e;  4C8Q G;  4E7J A;  4A53 A;  2RHX A;  3CCS T;  1FWZ A;  4M75 B;  4M7A E;  4C92 C;  3H41 A;  3QDF A;  2GFA A;  2GTO A;  3CCM T;  4FM4 B;  1D1A A;  3KBG A;  3NTI A;  3CME A;  5KYW A;  1AWW A;  2FB7 A;  4PJO D;  1BI2 A;  3OYG A;  3EG1 A;  1BB9 A;  4OB2 B;  3QYH B;  1VQL Q;  1PC0 A;  4AG2 C;  1G3T A;  4K11 A;  3SDZ A;  2NLU A;  3NPF A;  3R6O A;  3LLR A;  4KBM B;  5HY6 A;  3OMC A;  1PSF A;  4E7Z A;  2YT6 A;  4MDX A;  2LX7 A;  2HQE A;  2D0N A;  2LQK A;  3V7S A;  4KUL A;  2FPD A;  2KSS A;  4RTY A;  1ZUK A;  3EG3 A;  5GAO n;  5GAO l;  2LNH B;  4F16 A;  4M75 C;  2ED0 A;  6AT1 B;  2X3W D;  3RR6 A;  1KQS S;  2OI3 A;  2RJE A;  4IUP A;  3CCL Q;  1YIJ T;  5GAM j;  2YUN A;  2VV5 A;  2DK3 A;  7AT1 B;  1LCK A;  3EFS A;  2XI9 A;  3TSW A;  3VKI A;  5GJV B;  4LD9 K;  2CRE A;  2H3J A;  1FX7 A;  1G2B A;  2K7A A;  3JAM E;  1NBE B;  4JDS A;  1YHQ T;  5LL6 S;  4RTX A;  2DAQ A;  2EYZ A;  1M90 R;  2KR3 A;  2R5M A;  4ZGJ B;  4CC7 A;  3M59 A;  2KNB B;  1UHF A;  2DVE A;  3CXC P;  2LCL A;  1VQO A;  4JRK A;  1Q7Y U;  2QYZ A;  3CCE T;  2A08 A;  4ANJ A;  2ENM A;  1PD0 A;  1Q86 C;  4M7A G;  4B9W A;  2G3R A;  5AT1 B;  4M77 B;  1UTI A;  2DRK A;  1I8F A;  2L3S A;  2EGE A;  1I4K 1;  2RB6 A;  1M30 A;  3IQL A;  1U1T A;  3OYE A;  1WZO A;  4FT2 A;  4PJJ A;  2COY A;  3QII A;  5C6S A;  2RJC A;  2QGG A;  3H6Z A;  4N4I A;  3EAE A;  4C8Q D;  3M57 A;  2BIV A;  3QZ9 B;  2M0O A;  1VQP T;  5KYY A;  2DM1 A;  3OQ5 A;  3CME Q;  2SRC A;  1SSH A;  1UGP B;  4FYW B;  1OUL A;  4M7D E;  2V8K A;  1QKW A;  1UEC A;  4M4Z A;  3VUZ A;  3Q1J A;  3OYD A;  1X6G A;  1I5O B;  4OB1 B;  5ECA A;  1QKX A;  3JB9 H;  5FWB A;  4WF2 A;  1R0B G;  3M0T A;  1I5L A;  4HCB A;  2MI6 A;  2P4R A;  3C0C A;  2HAX A;  3E2U A;  3BFM A;  3QUI A;  5GMK e;  2P0K A;  1I1J A;  1YCY A;  1KHC A;  2E64 A;  3EGX A;  5GAO m;  2RI2 A;  3UT1 A;  1AZE A;  1IHV A;  5KE2 A;  4DQ2 A;  4J7F A;  1U3O A;  2QQB A;  1AWO A;  1YI2 A;  2CDT A;  2GQI A;  1BYM A;  5DLO A;  5LJ3 j;  3M0P A;  1UFF A;  2FRY A;  1XQH A;  2M9U A;  1PHT A;  2RI3 A;  2M16 A;  3FC3 A;  3WVE B;  1BIB A;  1TUD A;  1H8K A;  2QEX T;  2QDY B;  1R8O B;  2JT4 A;  3UAT A;  4BI3 A;  3CC2 A;  3A8M B;  4LDX A;  2QA4 T;  2KRM A;  1T3S A;  2MAM A;  2K3X A;  1MNE A;  1N9S A;  1B7T A;  2HDA A;  1XJW B;  4D6W A;  1XTD A;  2CP0 A;  2E70 A;  1GCQ C;  3JCM X;  1WGS A;  5DM7 R;  2YRC A;  1WYX A;  1ZSG A;  1WHK A;  1N5Z A;  4GY5 A;  4XTY A;  1VQ6 A;  1M1K C;  3DB4 A;  3HKS A;  1TU0 B;  2NWM A;  4M7D G;  1W4S A;  1B34 B;  4D8D A;  4RCB A;  4EIK A;  2PQW A;  3DLL A;  1QVF A;  2LCS A;  3NMZ C;  4LDW A;  4JUV A;  4NS5 A;  1F1B B;  4HCC A;  1UHC A;  1X6B A;  3O8V A;  3CC7 T;  1YP5 A;  1VQM A;  1V76 A;  1I81 A;  4MZM A;  2EQI A;  2D0Q B;  3EFO A;  2HSE B;  1ZUU A;  1I07 A;  1QQJ A;  1BKB A;  5FLX E;  3BDU A;  1X75 C;  2RQW A;  1D1C A;  1LJO A;  2DPP B;  4J9H A;  3L42 A;  3UA7 A;  3HRS A;  2YSQ A;  5KE3 A;  2RJF A;  2ZAE A;  2XU8 A;  4CI0 C;  1YJW T;  2HNI A;  2IVW A;  1JXO A;  1M2V B;  4PJO A;  1WX6 A;  4PKC C;  2VXF A;  1WXU A;  2JTF A;  1WXT A;  3MP1 A;  3SWN B;  4J6Y A;  5A0L A;  1W1F A;  3CCU T;  4FL6 A;  5A0D A;  1PNJ A;  1VQO T;  1KSW A;  1KIK A;  5GMK l;  4J9G A;  3CMA A;  1YI2 Q;  2L3R A;  2GBQ A;  2EQJ A;  1D0Y A;  1PCX A;  3PE0 A;  1YWP A;  1AD5 A;  1Y96 A;  3C12 A;  1M3C A;  4HXJ A;  3LH0 A;  3V7C A;  1O75 A;  1RAA B;  4TVR A;  4DOV A;  2LCC A;  3RDV A;  3A1P A;  3HRU A;  3CC2 Q;  5GAN 5;  4OB3 B;  4A63 B;  5IH2 A;  3GF5 A;  2IIM A;  2RI5 A;  4DEX A;  3NTK A;  1OZ2 A;  2E3H A;  4JJD A;  5LJ5 h;  2C06 A;  5FRM A;  1U5S A;  3OYI A;  2LQN A;  3CPF A;  5C0M A;  1VQ7 A;  1VQ6 Q;  2EIF A;  1WJS A;  3ZBD A;  3OYL A;  2RM4 A;  1KC8 R;  1DJ7 B;  2XDB A;  2BZX A;  3TCJ A;  3H9N A;  2B8A A;  1AWX A;  1QP3 A;  1VQ9 T;  3C4S A;  1VA7 A;  4M7D D;  4ZTF A;  2C0I A;  2K57 A;  2YUO A;  2RPN A;  3INZ A;  1LNX A;  5KYU A;  2O9V A;  2CH4 A;  1VQM Q;  2ED1 A;  4LXC A;  3F70 A;  1WHG A;  4C0D B;  3CQT A;  4J5Y A;  4BY6 B;  3GLX A;  3PIO A;  2ECZ A;  2LT4 A;  3QJ6 A;  4J9B A;  1MUZ A;  2DL4 A;  2XID A;  4F7U A;  2KXD A;  3ASK A;  3M4Y A;  3OW2 S;  1VQ8 A;  1S72 A;  1JJ2 A;  1IB8 A;  2W10 A;  4C8Q A;  5A0G A;  3ZEH A;  4DBH A;  2O4X B;  2LVM A;  4RG2 A;  2WSE E;  3L1A A;  4M75 F;  3VYH B;  2CP3 A;  4N4G A;  3H8Z A;  1X2Q A;  2CH4 W;  1VQN A;  5GAM h;  4E7H A;  2LTO A;  4XTZ A;  2EWN A;  2A3L A;  1OU9 A;  2DXB A;  3FIF A;  2RQR A;  1V1C A;  2ZPF B;  4MZP A;  4ZTJ A;  4BY6 C;  2CZ1 B;  5GMK m;  3CCQ Q;  4QVZ A;  2DIL A;  2I2L A;  1X2K A;  1OV3 A;  5LJ5 d;  4M7A B;  2ABL A;  2AHJ B;  3HP9 A;  2AIR B;  2WSF E;  3RMS A;  2DBK A;  2FO0 A;  2ZPE B;  2JMC A;  4FSS A;  2NUP A;  1PG5 B;  1OX9 A;  1RAG B;  1QWE A;  4XTW A;  3HRT A;  1SPK A;  1K8A U;  4A4H A;  1PKT A; 
#chains in the Genus database with same CATH homology
 4C8Q B;  1Q82 U;  4PJO D;  1BI2 A;  4OMF B;  3OYG A;  2KQW A;  4OB2 B;  3LX7 A;  3M5A A;  2R5A A;  3QYH B;  4CRI A;  2YLB A;  4LDY A;  2V8I A;  5GAN 3;  3JCM h;  4N0A C;  1G3T A;  1NE8 A;  3DLM A;  1MHN A;  4C0F A;  4XU1 A;  4NL2 A;  3SDZ A;  4XTX A;  5EG2 A;  4M77 A;  2NLU A;  3FRN A;  4M7A C;  3SWN C;  5CIU A;  4F7U E;  5CVI A;  2EYQ A;  3R6O A;  2FYK A;  3MEV A;  3QHS A;  4E7L A;  3LLR A;  4KBM B;  5HY6 A;  3OMC A;  1PSF A;  2DTO A;  2CZ6 B;  3MP8 A;  2XDD A;  1YIT A;  4MDX A;  2HQE A;  3RIR A;  2LQK A;  2X4X A;  2VC8 A;  1K9M U;  4ZN1 A;  2F5K A;  3E1S A;  3V7S A;  2JUF A;  4KUL A;  3PT9 A;  2KSS A;  2RD1 A;  5I2M A;  3QBY A;  1IRE B;  5LJ5 f;  4C5H A;  5GAO n;  3CMA T;  3A5Z B;  5GAO l;  1NJI U;  3A8O B;  4M77 F;  1G3Y A;  5GAN d;  5GAM d;  4M75 C;  4M7D F;  3CCR T;  5LJ3 e;  1KC8 C;  2KK4 A;  3OYK A;  3M54 A;  3G6E T;  1KQS A;  5KH6 A;  1KQS S;  4L6V 5;  4C92 D;  1VQK T;  1RI0 A;  2RJE A;  4IUP A;  1YIJ T;  2K2V A;  3L2Q A;  2K5I A;  5GAM j;  5GAN j;  4EMG A;  2VYT A;  4RKU E;  5M9O A;  2VV5 A;  3ER0 A;  3X24 B;  4C8Q C;  1EIF A;  1VQ5 T;  2DK3 A;  1D3B A;  1YBY A;  3CCJ A;  3JSC A;  3VU3 C;  1TH7 A;  2XI9 A;  3EFS A;  3L2U A;  3G71 T;  1VUB A;  3NFC A;  4DA4 A;  3VKI A;  5I2S A;  4LD9 K;  1YJN A;  2H3J A;  3OS5 A;  4C5I A;  1FX7 A;  5LJ5 g;  1YI2 T;  1WPY A;  1M1F A;  5J26 A;  1FXX A;  2GF7 A;  4RCC A;  1YJ9 T;  1IZ6 A;  4FT4 A;  5GAN 8;  5LJ3 h;  1VIE A;  2QQS A;  3JAM E;  4JDS A;  4Y28 E;  1HXD A;  4X9D A;  3FDR A;  4XAX B;  2DZ9 A;  3CC4 T;  1VQ7 T;  3L2W A;  1YHQ T;  1WQ7 A;  3PGG A;  5LL6 S;  4BD3 A;  4M7A D;  3JCM J;  2HBP A;  2DAQ A;  2PUO B;  1AHJ B;  3CD6 A;  2R5M A;  2GQV A;  4ZGJ B;  2RA2 A;  3M59 A;  4QW2 A;  5CQX A;  5CCA A;  2CZ7 B;  2DVE A;  1KQ2 A;  4PLL A;  2DJZ A;  4ZN3 A;  2PVG B;  2DKG A;  2R57 A;  3CC2 T;  2LCL A;  1VQO A;  4QQ6 A;  4JRK A;  1QVF S;  1Q7Y U;  3CCE T;  4C0Z A;  2E5Q A;  3PFS A;  1Q86 C;  4M7A G;  1N6A A;  3C94 A;  4B9W A;  2G3R A;  3HL8 A;  5FU6 B;  3M53 A;  5CO7 A;  2MWO A;  2QXF A;  3HHT B;  3MEA A;  4GLK A;  4M75 D;  4M77 B;  2VGM A;  4M78 A;  3CCS A;  3PNW C;  5CK9 A;  4RG8 A;  3WXM B;  4C0D C;  1VQ8 A;  1I8F A;  2EKO A;  2XDP A;  1I4K 1;  2RB6 A;  1VQ6 T;  5I21 A;  3RKX A;  1P92 A;  3CCM A;  1U1T A;  1M1G A;  3OYE A;  2KDS A;  4FT2 A;  5HK3 A;  3LYI A;  2LT1 A;  3GP8 A;  5J3B A;  3A8L B;  3FB9 A;  3QII A;  5GAN f;  5GAM f;  2RJC A;  3H6Z A;  4N4I A;  4C8Q D;  3EAE A;  4XU3 A;  3M57 A;  5C6S A;  5J39 A;  4HCZ A;  2BIV A;  3QZ9 B;  4M7D A;  2M0O A;  4M75 G;  1VQP T;  1N8R C;  3VYG A;  3OQ5 A;  2K5F A;  4J83 A;  1UGP B;  2LQ8 A;  4FIB A;  3X26 B;  4ELZ C;  3FLG A;  4M78 F;  4M77 E;  3OYM A;  4M7D E;  2V8K A;  2GFU A;  3VJP A;  4C5G A;  4EMH A;  4F7U G;  2MWP A;  3OS1 A;  2VUB A;  4JRI A;  2QQA A;  3RKY A;  1BI3 A;  4A54 A;  1K73 C;  1UGQ B;  3VUZ A;  4OVA A;  3JCM V;  3Q1J A;  3C95 A;  4OGC A;  1VQM T;  2F69 A;  2KMT A;  3A8H B;  3OYD A;  2F5T X;  2EQK A;  2LDM A;  4KUI A;  4HKE A;  4OB1 B;  3V8K A;  1D3B B;  2E12 A;  2FHD A;  3OMG A;  2DIQ A;  4R56 A;  3JB9 H;  5GAN g;  4WF2 A;  5GAM g;  1M1K U;  3BDL A;  1ZBX A;  2E6N A;  4MML A;  3VUB A;  1I5L A;  4HCB A;  1B34 A;  3MEW A;  4ATO A;  2MI6 A;  5FU6 C;  2YHT A;  4XU0 A;  3P8D A;  3RES A;  1PSE A;  3L2Z A;  2HAX A;  5GMK i;  4O5V A;  2QI2 A;  2XK0 A;  3BFM A;  3QSU A;  4PJO F;  3CCR A;  2K3Y A;  4OGE A;  3OBW A;  5D6W A;  3V8J A;  2OTJ T;  3G6E A;  3QUI A;  3RUX A;  1ZQ1 A;  5GAO r;  5GMK e;  2P0K A;  1VQK A;  1YIJ A;  1YCY A;  1KHC A;  2E64 A;  3PIP A;  3DKM A;  3QG1 A;  1G3S A;  4J7I A;  4BDY A;  2E41 A;  4ME7 A;  5GAO m;  1Q7Y C;  1Q86 U;  4P5N A;  2RI2 A;  3UT1 A;  4IUR A;  1VQ5 A;  4XTU A;  2WAC A;  4C0G A;  1M90 U;  4BUG A;  2GCX A;  5KE2 A;  2ZPI B;  5LJ3 d;  4DQ2 A;  3G71 A;  4C92 A;  2MMP A;  2EQU A;  2PU9 B;  4J7F A;  4C5E A;  2XKO C;  3L2V A;  1GXI E;  2QQB A;  3OYN A;  1YI2 A;  3G4S T;  4M78 B;  3JRZ A;  4QVD A;  3OYC A;  5DLO A;  1BYM A;  5LJ3 j;  1X6O A;  3JCM f;  3OBY A;  3CCV T;  3JCM P;  1UGS B;  3QKJ A;  1N8R U;  1XQH A;  3BY7 A;  5GMK h;  3I55 T;  3CC4 A;  3X20 B;  2M9U A;  2Y4X A;  1YHQ A;  2RI3 A;  2R58 A;  2M16 A;  3CCQ T;  3FC3 A;  3PMT A;  2OTL T;  4BB7 A;  1KQ1 A;  1BIB A;  5D6X A;  3WVE B;  2BKD N;  2QEX T;  4IUU A;  2RO0 A;  2QQ9 A;  2QDY B;  1R8O B;  4C92 F;  4BI3 A;  2EAY A;  3TU4 K;  4EDU A;  5DLQ E;  3A8M B;  1K73 U;  3CC2 A;  3JB9 J;  4LDX A;  2QA4 T;  2MAM A;  1UEB A;  2K3X A;  2YLC A;  4M78 E;  3CCE A;  3SWN A;  1N9S A;  3N5B B;  4D6W A;  1XTD A;  2E70 A;  4X34 A;  3JCM X;  1WGS A;  1M5Q 1;  3M58 A;  4PLI A;  5DM7 R;  4BE1 A;  4II1 A;  3JCM g;  2X4Y A;  3ZFJ A;  5CKE A;  2ZPH B;  2D6F A;  4GY5 A;  4X9C A;  4XTY A;  3QO3 A;  1N27 A;  4LDV A;  4PNO A;  1M1K C;  1BI1 A;  1VQ6 A;  1Y71 A;  4JLG A;  3EFR A;  3DB4 A;  3HKS A;  3MEU A;  2HQX A;  1VQ4 A;  4M77 G;  4M7D G;  1W4S A;  1B34 B;  4RCB A;  5CQY A;  4RMO A;  4HA8 A;  4XK8 E;  1VQP A;  1H3Z A;  3OYH A;  1WQW A;  2PQW A;  3DLL A;  3G7Z A;  3GNF B;  3S3N A;  3S3M A;  1WJR A;  2RHY A;  1QVF A;  4LDW A;  4J6X A;  1JB0 E;  4JUV A;  3VV0 A;  4NS5 A;  4PJO E;  3LGF A;  4A4F A;  4HCC A;  2KVQ G;  1Q81 C;  3QJY A;  1RL2 A;  1VQL T;  3SD4 A;  4O6J A;  3O8V A;  3JB9 D;  4KUD K;  5LJ3 f;  4V2S A;  3CC7 T;  1QVP A;  2EJ9 A;  1VQM A;  2RHI A;  4M7D B;  2E10 A;  2QTX A;  4QQG A;  2M1H A;  1M90 C;  1I81 A;  4MZM A;  2D0Q B;  2DO3 A;  1BKB A;  2RHZ A;  5FLX E;  5IAY A;  3BDU A;  3OYA A;  2LC4 A;  5GAN 7;  3CBO A;  1X75 C;  3UDC A;  5AYF A;  4C92 B;  1LJO A;  4L5G A;  2DPP B;  3LW5 E;  2L5Q A;  2O01 E;  3L2R A;  1U8R A;  2RK1 A;  1KD1 U;  1O9S A;  3L42 A;  1X01 A;  2X35 A;  4HT8 A;  1OYX A;  4C8Q F;  3HRS A;  1V29 B;  5KE3 A;  3HFO A;  2RJF A;  2QQR A;  5L8R E;  3OB9 A;  3GNG A;  2XU8 A;  3FEO A;  2Y90 A;  3ME9 A;  3MCA B;  3OSV A;  4CI0 C;  2OTJ A;  1VQ8 T;  1YJW T;  3J7A F;  3MHX A;  4XU2 A;  4BI4 A;  2HNI A;  4BAC A;  2OAU A;  3S3O A;  2IVW A;  5LJ3 g;  1S72 T;  2Y4Y A;  1KG1 A;  2JOY A;  2K5L A;  4YTL A;  4PJO A;  4C92 E;  3CCL T;  4PKC C;  3CEY A;  4ZGE B;  3OYF A;  4EPC A;  2VXF A;  5FRN A;  2JTF A;  4IUV A;  2DD4 A;  2IG0 A;  3MP1 A;  3SWN B;  2FVU A;  3PMI A;  4J6Y A;  3J81 E;  5A0L A;  3URG A;  2XIC A;  3CCU T;  2EJF A;  4FL6 A;  4JJN K;  5A0D A;  1VQN T;  1VQO T;  4OP0 A;  3CXC A;  3G4S A;  2ZCF B;  2E1H A;  2EJG A;  3CXC S;  3M4G A;  5GMK l;  2VGN A;  4M77 C;  3CMA A;  4M7D C;  5LJ5 e;  3CCV A;  4JLI A;  2DIG A;  5GMK j;  2L3R A;  4XQ3 A;  3I55 A;  2XG8 D;  2EQJ A;  3HFN A;  3JB9 I;  4PL6 A;  2XD0 A;  2OTL A;  4Y91 A;  1QW1 A;  3GIB A;  2RHU A;  3M55 A;  3QDR B;  4M78 G;  2O4X A;  2QEX A;  3SB2 A;  3I56 T;  3GPL A;  1Y96 A;  3C12 A;  1Q81 U;  5GAN 4;  4EMK A;  4HT9 A;  5HKC A;  3KXT A;  3LH0 A;  3V7C A;  4ELY C;  1O75 A;  4J6W A;  3LWI A;  2QA4 A;  4TVR A;  5DY9 A;  4DOV A;  2LCC A;  3OYB A;  3HRU A;  4NL3 A;  5GAN 5;  4OB3 B;  3QYG B;  1UGR B;  1WNL A;  1HK9 A;  3FJP A;  3GF5 A;  5D6Y A;  2RI5 A;  3RMQ A;  3LWH A;  3J80 E;  3NTK A;  2CKK A;  2D9T A;  2DD5 A;  3DB3 A;  3OSS C;  5HK0 A;  3OYJ A;  4JS4 A;  1OZ2 A;  1UB4 A;  4ZGD B;  1YJ9 A;  5LJ5 h;  2RK2 A;  5A2Q E;  4LD6 A;  1JBM A;  4M75 E;  2C06 A;  5FRM A;  3QZ5 B;  2KY9 A;  4A4G A;  4QVC A;  3OYI A;  1VIF A;  3CPF A;  3UPU A;  3JCM d;  2FB7 A;  5C0M A;  5IT9 E;  1KD1 C;  1VQ7 A;  3MP6 A;  2EIF A;  1WJS A;  4J8O A;  3ZBD A;  3OYL A;  2V8J A;  5FU7 B;  2RM4 A;  4PJO G;  3HSB A;  3KUF A;  1NZ9 A;  4Z02 A;  1W2B A;  2DXT A;  1DJ7 B;  1LOJ A;  2EFI A;  4N0A A;  4Q5W A;  3TCJ A;  2XDB A;  4C8Q E;  1W2B S;  3TEE A;  3MO8 A;  3JCM b;  3MET A;  2B8A A;  2JZ2 A;  4B9X A;  4JRP A;  3CME T;  1MGQ A;  4M7A A;  3LGL A;  2P0Q A;  2XHC A;  1QP3 A;  3P8B B;  5CKH A;  1VQ9 T;  3C4S A;  2DZC A;  2X4J A;  3OS2 A;  1VQL A;  3P8H A;  4M77 D;  2RH2 A;  4M7D D;  4ZTF A;  2FL7 A;  2DEQ A;  1H64 1;  3CC7 A;  5KCH A;  5FRO A;  2CS7 A;  2PVO B;  2K57 A;  4PJO B;  1Y7X A;  2KAF A;  4MZT A;  3INZ A;  3M56 A;  1LNX A;  1QVG A;  4IKF A;  3OA6 A;  4MDW A;  1QVG S;  3A8G B;  5GAN 6;  1BIA A;  1BI0 A;  3JCM Q;  2LNV A;  3F70 A;  4C0D B;  2L8D A;  3QXE B;  4L59 A;  4J5Y A;  4BY6 B;  2LRQ A;  2P0P A;  3GLX A;  5GAO q;  3PIO A;  3QPH A;  1XNI A;  4DOW A;  4M75 A;  4NOY A;  2LT4 A;  1G3W A;  4MMK A;  3SFM A;  1OZ3 A;  4A4K A;  5IN1 A;  2JVV A;  3QJ6 A;  5GAN e;  5GAM e;  2DXU A;  2E65 A;  3CPW A;  3CPW S;  5KCO A;  2ZZD A;  2XID A;  3T9N A;  4M78 C;  1YIT T;  4F7U A;  3JB9 G;  3X25 B;  1OI1 A;  3OW2 A;  1QP2 A;  3ASK A;  2LX9 A;  1NPR A;  2CGH A;  2L89 A;  3M4Y A;  3NTH A;  4KT0 E;  4C92 G;  3OW2 S;  5CR2 A;  2DXC A;  1YJW A;  2RJD A;  3M9Q A;  1S72 A;  3E9F A;  4C8Q A;  3CBP A;  1JJ2 A;  2BUD A;  1Y07 A;  5A0G A;  5CAI A;  3ZEH A;  1JJ2 S;  2O4X B;  2LVM A;  5FU7 C;  1M9S A;  1Y96 B;  4RG2 A;  1K8A C;  3JB9 F;  1M8V A;  3BW1 A;  4EMK B;  2WSE E;  3E19 A;  3L1A A;  3CCL A;  4M75 F;  1M4Z A;  2MF2 A;  3VYH B;  1SSF A;  1Q82 C;  4N4G A;  3V7R A;  1JRI A;  3H8Z A;  4FU6 A;  4JS5 A;  1G5V A;  2ZPB B;  5CKD A;  3CCU A;  4F7U F;  2E6Z A;  2K4Y A;  3OYY A;  5GAN 2;  3V8L A;  4A4E A;  5GAM h;  5GAN h;  2LTO A;  2CYZ B;  2A7Y A;  2YRV A;  3TRE A;  4E7H A;  1VQN A;  2DTI A;  4XTZ A;  2PVD B;  2EQM A;  2A3L A;  2EWN A;  4M7A F;  2DXB A;  3CCJ T;  3FIF A;  4PJO C;  4XTV A;  3CBM A;  3WVD B;  2ZPF B;  3UWN A;  3PTA A;  2X4W A;  4MZP A;  1YJN T;  2VXE A;  4ZTJ A;  3OY9 A;  4BY6 C;  3I56 A;  2CZ1 B;  5GMK m;  3JCM c;  2P4T A;  4QVZ A;  1KHI A;  1NPP A;  2I2L A;  3E9G A;  4E47 A;  1K9M C;  2HD0 A;  4OF1 A;  5LJ5 d;  1VQ4 T;  4IUQ A;  4FSX A;  1KC8 U;  3CD6 T;  4M7A B;  4BE2 A;  3GOX A;  2WSC E;  1NJI C;  3AHU A;  1U1S A;  2ZPG B;  3JCM W;  2ZGW A;  3S6W A;  4M78 D;  4BDZ A;  4N4H A;  4E7K A;  2AHJ B;  1ZHI A;  1WJQ A;  3HP9 A;  2WSF E;  3RER A;  5LJ5 j;  2DTH A;  3RMS A;  3OS0 A;  4LDU A;  2ZPE B;  4BE0 A;  4R55 A;  4VUB A;  4EMK C;  3HPW A;  3RKW A;  3JCM e;  4C8Q G;  4E7J A;  4QQD A;  4A53 A;  4IUT A;  2RHX A;  5CKF A;  3CCS T;  3CCQ A;  4UC4 A;  4E7I A;  1FWZ A;  4M75 B;  4JRQ A;  4M7A E;  4XTW A;  3HRT A;  4C92 C;  1N9R A;  4OB0 B;  5CKB A;  5GAO p;  2GFA A;  3X28 B;  3CCM T;  4FM4 B;  1XOV A;  2JN0 A;  4F7U B;  2JTM A;  3KBG A;  3NTI A;  3CME A;  1K8A U;  4BI8 B;  2CZ0 B;  1VQ9 A;  4A4H A;  2PUK B;  2JNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...