4BI8B

Crystal structure of the type vi effector-immunity complex ssp1-rap1a from serratia marcescens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1A
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi8B01
4BI3A 4BI4A 4BI8B
chains in the Genus database with same CATH superfamily
4LUDA 3EFOB 2LJ0A 1OV3A 3QDFA 3M0SA 4HXJA 1FYNA 1QMCA 1QVGA 3VUZA 2ZPFB 1TTHB 4QT7A 2DL5A 4KH0B 2YRVA 4E7JA 1LJOA 4M7AB 1QWEA 1WJSA 3TU4K 5KYXA 1RAEB 1AZEA 1VQMQ 1B34A 4F04B 1K8AU 1E6HA 4HA8A 4HCKA 1YI2Q 2GFAA 2O31A 3P8HA 4M75B 5FRMA 4DOWA 1M3BA 3OBYA 4XU2A 2ABLA 3I56T 2K6DA 1Z9ZA 4BI3A 1I07A 1ZUKA 1MUZA 3QHSA 1K8AC 2P4RA 2E41A 2H3JA 1M3AA 1K9MR 3MEWA 4PJOA 3CCQQ 1OI1A 3LWHA 3BDUA 4ZN1A 1H3HA 5LJ5g 1OX8A 5CQYA 4HKEA 1ZUUA 2RA2A 3OYHA 4C8QG 2COZA 3O8VA 2DEQA 3MEAA 1M90U 1JO8A 4JPBW 1SSHA 1YHQT 1AVZC 3REAB 4J9IA 3CC2T 2M0YA 3URGA 3ER0A 4E6RA 3CQTA 1ABOA 1PD0A 4RG2A 5FWBA 4XU3A 1A0NB 3JCMf 1IHVA 4D8KA 3ME9A 1NJIC 1M90C 1TWBA 5FROA 4V2SA 2LT4A 1Y07A 2X9HA 2RB6A 5GJVB 1BYMA 1PKSA 1HYOA 1PD1A 2RPNA 1SSFA 5LJ3h 4BE0A 2DJQA 2CH4W 1WXBA 3M53A 2YRCA 2A37A 5KH6A 2C0IA 1I8FA 4RTZA 3JCMX 1G83A 4JJDA 4CRIA 3M0QA 4FYVB 2QQAA 3JB9D 3UATA 4HVUA 4J9EA 1QKWA 1X2KA 1VQ6T 2MK5A 2HQXA 4M4ZA 4RTXA 2KROA 4M77E 3IQLA 5GAN7 1EZZB 5KYWB 5FU7B 4PJOC 4ELYC 4OGEA 3M55A 3U23A 2QEXA 3HFNA 2DXUA 2EYZA 3OW2A 3CCUT 3CCLT 2GTJA 5LL6S 1VQLQ 1U1SA 4P5NA 2PUOB 3LLRA 2DIQA 1MHNA 1U1TA 2OAUA 3TSWA 1IREB 4E7SA 3G6ET 5LJ5e 3G71A 5HK0A 1Q86R 1I1JA 1X2QA 2XU8A 2YT6A 2EJ9A 1VIEA 1YJNA 3RR6A 1VQ7A 1JJ2A 1K9AA 1S72T 2GFUA 3QBYA 2COWA 2W0ZA 4JRKA 2HBPA 4Z8AA 1ARKA 3S6WA 3NHNA 4FT4A 3QO3A 3CC7A 1UG1A 1NM7A 2HSPA 2R57A 4ME7A 1ZLMA 2E1HA 4A4GA 2BE7D 3OS2A 2D0QB 2ROTA 5GANf 2VXFA 3EFRA 1RL2A 3QJ6A 4DBHA 1VUBA 1M8MA 3QPHA 5FU6C 2CZ7B 2DTHA 1TS9A 2DNUA 3GNFB 4C0GA 4N4GA 1ZSZA 4XU0A 3OW2P 1N9SA 1N8RR 5FRNA 1MMDA 3L2VA 2LMJA 1PNJA 4PNOA 4F7UE 5A0LA 3OYYA 4M78G 1Q81R 1JJ2P 4BY6B 2XMFA 1I81A 4C5IA 4M77F 3EGUA 1JXMA 1ZBJA 5GANd 3E1SA 3S3MA 2LX9A 3BDLA 4VUBA 3LGLA 3JCMV 2MYSA 1WYXA 1VQNT 2SRCA 3JCMh 3JV3A 2D6FA 2DYBA 4ESRA 5J3BA 2XDPA 2FRYA 4Y92A 5GAOn 1WHLA 4Q5WA 2M02A 4FW1A 5HKCA 4MDWA 1IRXA 2LQ8A 3C12A 4RTVA 1Q7YU 2K5IA 5GJWB 5DY9A 3QXEB 1W2BA 3PVLA 2NUPA 3OY9A 4PLLA 1YNZA 3H0HA 4JJNK 1H3ZA 2DK3A 5CCAA 2FZCB 3CCST 2C06A 2A7YA 1SHFA 5D6YA 4OMOA 1PCXA 2RJDA 1Y0MA 3JCMQ 3V8LA 3LWIA 5I2MA 1Q7YC 3VS7A 1GXIE 1KD1R 2DKGA 2MF2A 3MJXA 3INZA 2DAQA 1YIJQ 5IHKA 2VB6A 2KEAA 2A36A 1BB9A 3CCRA 1YJWQ 4C8QD 2CUDA 4ZGJB 4OMFB 5FWCA 1U06A 3G7ZA 2XD0A 1TH7A 3EFOA 2K5FA 1K73U 1TU0B 4IUVA 2QQSA 1WHMA 3CCMA 5LJ3j 1LCKA 4FSXA 1W1FA 2DLPA 1VQMT 1O9SA 4A63B 6AT1B 4LDUA 4M7AA 1Z9QA 4KH1B 1CSKA 4PFZA 4C8QB 1TXQA 1YI2T 4O5VA 2FZGB 2LRQA 2NUZA 4F7UF 3JB9J 2FYKA 1P92A 2DZ9A 2R5MA 1W2BP 2DF6A 2HBWA 3A8GB 3NGPA 1GCPA 4HT9A 1G3WA 2DL8A 4AT1B 4M75A 2FVUA 3E19A 3FIFA 4ATOA 3MPUB 1D0YA 2K9GA 1RI9A 3CCQT 1M1GA 1KHIA 4JRQA 1VQOA 3CMEA 4JJBA 3OSVA 2P0QA 2SEMA 2ZPEB 4A4HA 3M0RA 1KQSS 4YTLA 2EQUA 2KYBA 4X34A 2RJEA 5GANh 2RQRA 2X4JA 2K2MA 4EIKA 4RTYA 3OYDA 1YJ9A 3JB9I 1VQ8A 5KYNA 1TUCA 4KBMB 5J39A 3G4SQ 4C5HA 3QJYA 3OYMA 1ACMB 2DL4A 2QTVA 2CZ1B 2EQIA 3RIRA 2DTOA 1KQ1A 4OB2B 1UDLA 5KYYB 5GAMf 3D7SB 3ZBDA 3MEVA 2LCSA 4J5YA 2YUNA 1D0ZA 3RKWA 3M9QA 2FPDA 2LCLA 4M7AC 1Q82U 4C92E 2CP6A 3R6NA 3VS4A 5J26A 2M51A 2EKOA 2YLCA 5L8RE 1M1KR 3OS5A 1SRMA 1FMVA 4AFQC 1RUWA 3JSCA 3HSBA 2BZYA 2LX7A 1M5Q1 2ED0A 2EGCA 4M75C 4A4EA 1Q82C 2EGEA 2IG0A 3A8MB 2G6FX 2QQ9A 5KYWA 2GGRA 1NLOC 3TQ7P 1VQLT 5GAMd 2KSSA 1VQKQ 2BZ8A 3I56A 3L1AA 1IGUA 4E2FB 2RJCA 4IURA 4BACA 1YCSB 3REBB 4M78D 1H8KA 1YFNA 2KAFA 4WCIA 1X27A 1RACB 1SKUB 4O6JA 3H0IA 3VS6A 2O9SA 4KULA 1K9MU 2HQHA 3EG1A 1C0MA 1YP5A 4J9DA 1MV3A 3JB9H 1CKBA 4M78B 1LOJA 2WSEE 2CT3A 4HT8A 3M58A 4CC3A 3CC2A 1MV0B 3G1JA 2KI7A 2P0KA 1WQWA 2J06A 1K9MC 2JXBA 5GAOl 2JM8A 3UWNA 2LC4A 1WPYA 2M9UA 2YXYA 3JRZA 3MP1A 5HK3A 1RADB 5CKEA 3J7AF 2X3WD 4C92F 1N9RA 2KRMA 3MKDA 4NOYA 4LN2A 3T9NA 5D7UA 3M54A 2C0OA 4R56A 3CMAQ 2MI6A 4E7KA 2FZKB 3UA6A 3V8KA 1YWPA 3OYIA 1MNEA 2J6OA 3X28B 3CCJA 5FU7C 3V7CA 2QXFA 1V29B 4JUVA 1VQ6A 4QVCA 2D8JA 2MWOA 3VUBA 3Q1JA 1AEYA 2X4XA 3PT9A 2ENMA 2LDMA 4PK4A 2Z0WA 4IUPA 4M7DE 1SF9A 4XTZA 4BDYA 4GY5A 2MAMA 4J9GA 3CCUA 4Z89A 2KDSA 4OF1A 1VQ9Q 5GAN8 3CD6Q 5GAMh 5GANj 1DJ7B 4X1VA 1BKBA 3G6EA 1TSFA 1IO6A 4K11A 3V8JA 2DILA 3KUFA 1C6VX 4RTTA 3THKA 2EQMA 1S72A 2YUOA 4BI8B 3OYBA 4D6WA 3CEYA 3OBWA 1OPKA 1Q86U 2KXCA 5GMKi 3QYHB 2OTLQ 5A0DA 2WACA 1VOMA 3OYKA 1YJWT 1JRIA 4B9WA 2CDTA 4JS5A 1Y57A 2RHZA 2FPEA 1W4SA 2XHCA 2QEXQ 2EKHA 1Q86C 3JCMg 3S3OA 1M1FA 4J9FA 3MO8A 2ECZA 2AKLA 3HP9A 1GL5A 1LNXA 2FPFA 2K5LA 3PTAA 3VS0A 3FEOA 1I5OB 2RM4A 4LD6A 1YJNQ 1VQ7Q 2HD0A 1AWWA 4C8QA 4BE2A 2DPPB 4MDXA 2DIGA 3E2UA 3P8BB 4BY6C 4AG1C 2JUFA 2L3RA 3L2RA 3CC7Q 1K0SA 2CP2A 1NJIU 4OMPA 1N8RU 3RNJA 3M0UA 3A98A 1VYVA 3L2UA 4M77G 4M7DF 4RTUA 1WXTA 1SHGA 2KT8A 2Y4YA 1VQNA 4PFPA 5CKBA 2CSIA 4E7HA 2F1LA 2K3BA 2PTKA 3NMZC 3PMTA 4IUUA 3PIOA 1N8RC 3RESA 3ULRB 1IXDA 2QGFB 1WXUA 2YSQA 3G4ST 1VQPT 3EH1A 1XJWB 3BW1A 1KQ2A 1Q81C 3OB9A 1QP3A 1KQSA 1NBEB 3CCSA 1PRMC 3HRTA 2ZPBB 2O2OA 3P8DA 2DFUA 1QCFA 2E65A 1V1CA 2NYSA 2K3XA 4JDSA 4PJOE 1YBYA 5KYYA 3JCMe 4R55A 2QI2A 3H41A 1BI2A 3RERA 4D8DA 2DXBA 4R0KA 4N0AC 5AYFA 1KD1U 4C8QC 8ATCB 2D8HA 2GQIA 3CBPA 1UTIA 2L3QA 1VQMA 3DLMA 3META 1M4ZA 3VYGA 4FYYB 1BCOA 5CR2A 4FIBA 1YI2A 5CVIA 2BIVA 5C6SA 1TUGB 1YITQ 1KD1C 2CGHA 2LVMA 4F7UG 2LZ6B 1VQKT 4LUEA 5LJ5d 2LJ1A 3H8ZA 2HKNA 3TREA 1KQSP 2VC8A 2QG9B 2EYYA 4XTXA 2EJGA 2MCNA 3FLGA 2RN8A 3CCQA 3DB4A 4J9BA 1K8AR 4XTVA 1TG0A 2RMOA 1BI3A 2K2VA 1RAFB 4LDVA 1UECA 1UGSB 5GAMj 3SDZA 4XTUA 4B9XA 2DMOA 2PU9B 1D1CA 4DBFA 4JZ4A 1QW1A 3UDCA 2BE9B 4DEXA 4OGCA 3OS1A 3CCVQ 3KBGA 1M2VB 1OX9A 2DYIA 4XAXB 1WJQA 1Q95G 2OTJA 4M78A 1IB8A 5GAN2 1UFFA 2FG0A 2L5QA 2RQWA 2HZYA 1UB4A 3SD4A 1JQQA 4J8OA 1VQOQ 3HFOA 3HTRA 4AFUC 4PJOF 3CMEQ 3JCMW 1G3TA 2ZPGB 1QCOA 2E3IA 3PGGA 3LW5E 2DX1A 4J6YA 2DETA 2GF7A 3RKYA 4GBQA 2F5KA 4E7IA 1SPKA 3CMAT 4KUDK 2Y90A 1VQ4A 1KSWA 2RQTA 1ZX6A 3LH5A 2P0PA 1MNDA 5GAN5 4OB3B 1UHCA 1YJ9Q 1XQHA 3I55Q 1I4K1 1VQ8Q 5EC7A 2HQEA 3EH2A 2X4YA 1JXOA 2CKKA 3GBQA 4MMLA 1D0XA 3LX7A 1VQ5T 2DO3A 4OMNA 4RUGA 4X9DA 2MWPA 2AT1B 1AT1B 2FEIA 3EAEA 4HCZA 4KUIA 1WFWA 4RTWA 3M59A 2ED1A 1JEGA 3FJPA 2KY9A 2GQVA 2KRSA 2VKNA 1J3TA 1VQ9T 2DD5A 2FB7A 2PVDB 1VYTA 2HEQA 2XIDA 3CD6T 3QG1A 2HNIA 2LP5A 1HJDA 1G3SA 2CH4A 1M1KC 1SEMA 3VRZA 4PKCC 2QDLA 4QW2A 1QKXA 2PNIA 3CCEQ 1CKAA 2L3SA 1T3SA 3C4SA 1M3CA 3X25B 1X75C 1WHHA 1GRIA 3HKSA 1PC0A 4M78C 3VV0A 2EJFA 2OTLT 5C0MA 2DVEA 5D6XA 1ZA1B 4M77D 4QVDA 2DBMA 2QA4A 2RF0A 3H9NA 2V8KA 3MEUA 5GAN4 3I5RA 1WHKA 4DBRA 5GMKj 2HKQB 4FM4B 4J83A 4QVZA 2DE0X 3ZFJA 1D1AA 4PLIA 5IHNA 5IHIA 3V7SA 4MMKA 1QVFS 3FJ5A 4FYXB 3I56Q 2VUBA 4M77B 3QZ9B 5FW9A 3EGXB 2VGNA 3OMGA 4FT2A 3OYEA 4PJLA 1SG5A 1YJNT 2RH2A 5I22A 1VQ7T 2EBPA 2VV5A 2A28A 1AWOA 5HY6A 4M7AG 3NFCA 2R58A 4C92G 2KNBB 2VASA 3CC7T 1K0XA 4BE1A 1KJWA 2X4WA 4A4KA 4M75G 3LH0A 5IXFA 2LNVA 3CPWP 2JTFA 1GFCA 2LJ3A 1QCNA 3CC2Q 4DA4A 1RAIB 2AZSA 4TVRA 5CKFA 2CZ6B 3CC4Q 3OA6A 2KT1A 2A08A 3H0FA 2ROLA 4BB7A 1IZ6A 2LNHB 4J6WA 2A0FB 1C1AA 2AKKA 1WJRA 3EG2A 4M7AE 1NYGA 3RBBB 1PRLC 4QQ6A 2E6ZA 4JZ3A 2F2VA 1BK2A 1BU1A 2JZ2A 4MZMA 4JRPA 2A3LA 2DEUA 3M4YA 1AOJA 1PKTA 3EG0A 1GBRA 3CCJQ 3OYGA 2JT4A 4M75E 2J6FA 4Z88A 4Y91A 4A54A 1WIEA 5IAYA 4F7UB 1Q7YR 3J80E 2BZXA 4JRIA 1YJWA 4LD9K 4GLMA 4MZPA 4A4FA 2ZPIB 3VKIA 3QYGB 4BD3A 4HVVA 4IIOA 2BUDA 4KRTA 1R0BG 2R5AA 1EIFA 1TOVA 2KRNA 1RLPC 4QQGA 1R0CB 2VYTA 2V26A 4NL2A 3TEEA 3RDVA 3TSZA 2RK1A 1NPRA 1YITT 3CPFA 5CKHA 2KXDA 5LJ3g 5GAOr 3RMSA 5DLOA 1K73R 4KGZB 3A8HB 2WSFE 1OULA 2FRWA 3TCJA 5FLXE 4FSSA 4ZGEB 1EFNA 1KC8R 3JCMP 1YHQA 2FHDA 4ZNXA 1FMKA 2DJZA 2E12A 1TUDA 4C0DB 2HAXA 1B7TA 2PUKB 1IGQA 4M7DG 2XICA 5LJ5j 1D09B 1QWFA 2JW4A 3CCVT 4ZGDB 2RI5A 4M7AF 1G2BA 4ZTFA 2E70A 1UE9A 4DBQA 2XK0A 3TVTA 1B07A 1NZ9A 4KGVB 3AHUA 1KK7A 3BFMA 1VQPA 1BIAA 3PVQA 2DTIA 1M2VA 4EDUA 2L3PA 1UJ0A 4RMOA 2CP7A 2O01E 2YRDA 1E6GA 4M75F 3L2ZA 3H6ZA 1VQOT 1WGSA 3CMET 3O5ZA 2AIRB 3MP8A 3QZ5B 2JVVA 1W6XA 1I5LA 3FDRA 3FB9A 1SRLA 3UPUA 4RKUE 1W70A 3CPWS 4LDWA 2O88A 2K57A 4F16A 3I55T 1Y7XA 1VQ8T 1UHFA 3CCLA 4QKUA 2ZGWA 1FX7A 5LJ3e 3CBOA 4DQ2A 5ECAA 2XDDA 2CYZB 2XDBA 1GFDA 4KGXB 2EYWA 3CXCS 3PMIA 3X26B 2F69A 1I0CA 1GCQA 4AFZC 1FWZA 4LNPA 1WX6A 4AG2C 2W10A 2YHTA 2LT1A 3WXMB 1PM3A 1MMGA 2V1RA 2YUQA 4M7AD 2LCCA 2VXEA 5KE2A 1YIJT 1JU5C 1QVPA 4C92D 3M57A 5A0GA 4DOVA 4ZTJA 3CCET 1AWJA 4OMMA 3OYNA 1OOTA 2K3YA 2MMPA 2RQVA 3LYIA 1NG2A 2CS7A 4EMKB 4M75D 2YLBA 2IVWA 3UA7A 3MCAB 1D3BB 1ZBXA 1G3YA 2O4XB 3AT1B 3QUIA 1U8RA 4C92B 3G71Q 1AWXA 4OMLA 1O75A 2AK5A 1OEBA 3EHQA 4N0AA 3GF5A 5AT1B 3QWXX 3FC3A 4N4IA 1UUEA 2KBTA 2RI2A 3M5AA 1Y96B 5KCOA 2PQWA 4BDZA 2KGTA 2EQJA 1VA7A 4JLIA 4ANJA 4C0ZA 2QAZA 8AT1B 4E7ZA 2H3EB 4CC7A 3EGDB 2M1HA 3JB9F 4M77A 1FMWA 3EGXA 4JJCA 1HD3A 5KYUB 4XK8E 3F70A 2CZ0B 4PJOG 2YUPA 5I11A 3ZL7C 1UGPB 3GNGA 1Q81U 5KCHA 4OMQA 3CMAA 2K7AA 2LQWA 2IIMA 1QVFA 2G3RA 2RHUA 3M56A 1FXXA 1GCQC 1QVGP 2RHYA 3OMCA 1AZGB 2GNCA 3SWNB 1ABQA 4RCCA 2DL7A 2OTJQ 2YWWA 3C95A 2CUBA 2F5TX 1VQ5A 3PE0A 3CC4T 2DM1A 4WTOB 5HCKA 2CREA 3QWYA 5CQXA 3PIPA 2QASA 5GAN3 5GMKh 2QTXA 1VQ9A 3CD6A 4XQ3A 2KQWA 4XTWA 2P4TA 5LJ5f 2QK0A 2MPXC 4OVAA 1VQ4Q 3CBMA 1XNIA 3FRNA 2RI3A 2E64A 1X6BA 4C8QE 2RO0A 2NLUA 3NTIA 2D9TA 3CCJT 2DA9A 2VVKA 1M27C 2KR3A 5GANg 2LQNA 2CT4A 1QLYA 4Y28E 1G8XA 2OTLA 2EYQA 5I21A 3JCMd 2JN0A 1QVFP 1RAGB 2HL5C 1OZ2A 1KG1A 4M7DD 4ORZA 1G5VA 3E9FA 4F7UA 4M77C 1GBQA 3SB2A 4F17A 4LXCA 3RUXA 1K76A 4II1A 4J7FA 3NTKA 3A8OB 4L6V5 2X51A 5DM7R 2KE9A 1YCYA 4UC4A 3OYFA 2M0OA 4AMCA 3QIIA 2ZPHB 4M7DB 3M0TA 3CCRQ 1PHTA 3QKJA 3HPWA 1UGRB 2NUTB 4PJNA 3HRSA 2JTEA 1S1NA 2PVGB 4EMGA 2D1XA 3CCMQ 4J6XA 2L89A 3C94A 2L0AA 1QP2A 3BE3A 2LQKA 2O9VA 1M8VA 1ZQ1A 2E10A 1WA7A 2QA4Q 1F1BB 4XU1A 3EG9B 3DKMA 1N6AA 5GAN6 1IHWA 4PFOA 4FU6A 2EVRA 3OYAA 1WLPB 1NEGA 4PJJA 2DXCA 1X69A 2F2WA 3GIBA 3I9QA 9ATCB 3VS5A 1XTDA 5IT9E 1PG5B 5EG2A 5IXBA 2MOXA 1NJIR 1M90R 2EGAA 3EHRA 4C8QF 2C0TA 3HHTB 4LDYA 5GANe 1NLPC 3R6OA 1RI0A 3ZEHA 4AFSC 2ESWA 1X6OA 1YWOA 3JCMb 2DBKA 1RLQC 2L8DA 3A5ZB 3GLXA 1T3LA 2AZVA 4FL6A 1KIKA 4JLGA 1KFZA 1UEBA 3MP6A 4B6MA 1HXDA 2DRMA 4BUGA 2HSEB 1M1KU 1QVGS 2GTOA 5DLQE 3DLLA 4ZN3A 3GPLA 2XG8D 3OYJA 4CC2A 3I5SA 1H641 4CC4B 4QQDA 1VQLA 3C0CA 2DVJA 1RABB 3JCMJ 1WQ7A 5LJ5h 2DD4A 1VYUA 1UGQB 4IUTA 1Y71A 1OZ3A 3I35A 2GCXA 2OX7A 1YITA 1OU9A 1RAAB 1HSQA 4M78E 3CPWA 3V7RA 5KYXB 2HL3A 1B34B 2L2PA 7AT1B 2AHJB 3OYCA 5GMKm 1OPLA 3MHXA 4OB0B 4PJOD 4HCBA 3N5BB 4WF2A 3VRYA 4LDXA 3OYLA 2FL7A 1NYFA 2EPDA 4C0DC 1BIBA 1VIFA 4MZTA 3EG3A 2FO0A 1RAHB 3CXCA 3DB3A 1ZSZC 2WSCE 1ZUYA 2RQUA 2QEXT 2ZZDA 2QYZA 4FCYA 2JMCA 4EMKA 4PJOB 2EW3A 1D3BA 3VU3C 2H8HA 1NPPA 2IPOB 5CO7A 3G71T 2Y4XA 3GP8A 1KC8U 2K79A 2PZ1A 3CCVA 1ZHIA 2RJFA 2O4XA 1QQJA 4NS5A 3M0PA 3SHWA 4X9CA 4C92A 1K73C 1MMAA 5GAMg 1U5SA 1AD5A 4OP0A 2QQRA 3PNWC 4IIMA 3RMQA 3OQ5A 1B3QA 1KC8C 1U3OA 2CP5A 1Y96A 1N27A 4PL6A 2QDYB 4E47A 3JCMc 4BI4A 1YHQQ 4GLKA 3OS0A 5A2QE 3EGDA 2PVOB 4RCBA 1LVKA 5CIUA 2EWNA 2QQBA 1JBMA 5KYUA 2DXTA 1OU8A 3PFSA 1X43A 4F14A 4C0FA 1NE8A 2B8AA 3CXCP 1N5ZA 3I55A 3VS3A 2EQKA 3KXTA 4DEYA 2RNAA 2E5QA 1ZA2B 5M9OA 1R8OB 2XI9A 3J81E 1BBZA 1H92A 2OTJT 2V8JA 1VQPQ 5FU6B 2I2LA 3HL8A 2I0NA 4RG8A 2P84A 4M78F 1D1BA 1WZOA 2D0NA 3SWNA 1T0JA 1T0HA 3ASKA 5GAOm 2DERA 2J7IA 3LGFA 3BY7A 3OW2S 2M16A 2JM9A 4HCCA 4XTYA 1WHJA 1MGQA 1WHGA 1X01A 2BKDN 3HRUA 5GMKl 2CP0A 2KYMA 2V8IA 3QDRB 4EMKC 1VQ6Q 1YIJA 3VYHB 1MMNA 1OQKA 2E4HA 1VQ4T 1JJ2S 1ZSGA 2OI3A 3A8LB 4Z02A 3CCEA 4IKFA 5GAOp 4C92C 4IUQA 2COYA 1WDXA 5I2SA 3CCUQ 1XOVA 3CCLQ 3KFVA 1R77A 2JS0A 2KVQG 3WVEB 1NEBA 5GAMe 1YN8A 4L5GA 4NL3A 1PWTA 3G6EQ 2BTTA 1PSFA 1AHJB 1V76A 2MIOA 2JOYA 4FW2A 4EMHA 1S72Q 2B86A 3L42A 1JB0E 2LTOA 3S3NA 2OAWA 3A1PA 1BI1A 3NTHA 2EAYA 1K4US 3VJPA 3UT1A 2KK4A 2KMTA 3CCRT 3X20B 3JB9G 3M4GA 2HMAA 4M7DA 3X24B 4JS4A 4J9CA 1M2OA 1K1ZA 3EFSA 5D6WA 2X3XD 3CCMT 1HK9A 2HCKA 2NUTA 2JMAA 2VGMA 1ZSZB 3SWNC 2QA4T 2JJ9A 2YDLA 2RD1A 2NWMA 4C5EA 5CK9A 2VWFA 2E5KA 4KT0E 3RKXA 5IH2A 3G4SA 4C5GA 3EG9A 3L2QA 3WVDB 2JTMA 1M9SA 1X6GA 4OB1B 2ZAEA 3CC4A 2RHXA 1E7OA 4E7LA 3GOXA 2JNGA 2RHIA 2GBQA 5CKDA 5CAIA 1BCMA 4N4HA 1EX4A 2CP3A 1W2BS 5L23A 2E6NA 2QGGA 5LJ3f 3E9GA 2ATCB 2DRKA 3SFMA 4ELZC 2EFIA 4PJMA 3UF4A 1M30A 2RK2A 2E3HA 2ZCFB 2J05A 5GAOq 1VQNQ 2K4YA 2DL3A 1LPLA 4CI0C 4EPCA 1UJYA 1YJ9T 1KHCA 2EIFA 2XKOC 1PSEA 2OJ2A 2NUPB 4FYWB 2X35A 4J9HA 4A53A 3VS1A 2J6KA 2HDAA 1VQ5Q 1WI7A 3QSUA 4J7IA 1OYXA 2EYXA 3CCSQ 1UGVA 1WNLA 2JS2A 1BI0A 5GMKe 3JAME 1Q82R 2CSQA 3NPFA 4M7DC 4LE9A 4HVWA 5LJ3d 5KE3A 5IN1A 1VQKA 4L59A 2V1QA 2DZCA 3L2WA 3SEMA 3OSSC 3VS2A 2F2XA
chains in the Genus database with same CATH topology
1KG1A 1Q82C 4M7DD 4PKCC 4QW2A 4HCBA 1G5VA 3E9FA 4F7UA 4M77C 2IG0A 3A8MB 1QVGA 3SB2A 3VUZA 2QQ9A 2ZPFB 3C4SA 3RUXA 4II1A 4J7FA 3NTKA 3A8OB 3X25B 1VQLT 1X75C 2YRVA 4L6V5 3HKSA 5GAMd 2KSSA 4M78C 3VV0A 4E7JA 1LJOA 4M7AB 5DM7R 2EJFA 3I56A 2OTLT 1WJSA 5C0MA 1YCYA 2DVEA 4UC4A 5D6XA 3L1AA 3TU4K 4M77D 3OYFA 2M0OA 1B34A 4QVDA 3QIIA 2RJCA 1K8AU 2QA4A 4HA8A 4IURA 2V8KA 2ZPHB 4M7DB 4BACA 3MEUA 5GAN4 4M78D 5GMKi 5GMKj 3QKJA 2GFAA 2KAFA 1UGRB 3HPWA 4FM4B 3P8HA 4M75B 4J83A 5FRMA 4QVZA 3HRSA 4O6JA 3ZFJA 4DOWA 3OBYA 4PLIA 4XU2A 2PVGB 3V7SA 4MMKA 4EMGA 3I56T 1QVFS 4BI3A 4KULA 1K9MU 4J6XA 2L89A 2VUBA 3C94A 4M77B 3QZ9B 1QP2A 2LQKA 3QHSA 1M8VA 1K8AC 1ZQ1A 2E10A 2E41A 2VGNA 3OMGA 2H3JA 4FT2A 3OYEA 4XU1A 3MEWA 4PJOA 3JB9H 1OI1A 1YJNT 2RH2A 1VQ7T 3LWHA 3BDUA 4M78B 1LOJA 3DKMA 1N6AA 2VV5A 2WSEE 4ZN1A 5HY6A 5GAN6 4HT8A 3M58A 4M7AG 3CC2A 3NFCA 5LJ5g 4FU6A 5CQYA 2R58A 4C92G 3OYAA 4HKEA 2P0KA 1WQWA 1K9MC 2DXCA 2RA2A 3OYHA 4C8QG 3CC7T 3GIBA 4BE1A 5GAOl 3O8VA 2DEQA 3UWNA 3MEAA 2X4WA 2LC4A 1XTDA 4A4KA 1M90U 4M75G 1WPYA 3LH0A 5IT9E 2M9UA 5EG2A 2LNVA 3JRZA 2JTFA 3MP1A 1YHQT 5HK3A 5CKEA 3CC2T 3J7AF 4C92F 3URGA 1N9RA 3ER0A 4NOYA 4C8QF 4RG2A 4DA4A 3HHTB 3T9NA 4XU3A 4LDYA 3M54A 5GANe 3JCMf 4R56A 3R6OA 4TVRA 2MI6A 2CZ6B 5CKFA 1RI0A 3ME9A 4E7KA 3ZEHA 3OA6A 1NJIC 1X6OA 3V8KA 3JCMb 1M90C 5FROA 3OYIA 2L8DA 3A5ZB 4BB7A 3X28B 2LT4A 3GLXA 1Y07A 3CCJA 4V2SA 1IZ6A 5FU7C 3V7CA 2QXFA 2RB6A 1V29B 1BYMA 4FL6A 4J6WA 4JUVA 4JLGA 1VQ6A 1UEBA 1SSFA 5LJ3h 4BE0A 3MP6A 4QVCA 1WJRA 4M7AE 1HXDA 4QQ6A 2MWOA 2E6ZA 3VUBA 3Q1JA 4BUGA 2X4XA 3M53A 1M1KU 3PT9A 1QVGS 2LDMA 2JZ2A 5DLQE 3DLLA 4IUPA 4MZMA 4ZN3A 2A3LA 5KH6A 3GPLA 2XG8D 4JRPA 3M4YA 4XTZA 3OYJA 4M7DE 1I8FA 4BDYA 3JCMX 4GY5A 2MAMA 1H641 4CRIA 3OYGA 3CCUA 2QQAA 4QQDA 1VQLA 4M75E 2KDSA 3JB9D 4Y91A 4A54A 4OF1A 1VQ6T 5GAN8 5IAYA 5GAMh 5GANj 1DJ7B 2HQXA 1BKBA 4F7UB 3G6EA 3JCMJ 1WQ7A 5LJ5h 2DD4A 4M77E 5GAN7 3J80E 4JRIA 1YJWA 4LD9K 3V8JA 5FU7B 4MZPA 4PJOC 3KUFA 1UGQB 4IUTA 4ELYC 4OGEA 1Y71A 3M55A 1OZ3A 2EQMA 4A4FA 2ZPIB 1S72A 2GCXA 1YITA 4BI8B 4M78E 3HFNA 3QYGB 3VKIA 2DXUA 4BD3A 3OYBA 3V7RA 2QEXA 3CPWA 3OW2A 4D6WA 3CCUT 3CEYA 3OBWA 1B34B 3CCLT 2AHJB 5LL6S 5GMKm 3OYCA 2BUDA 1Q86U 3MHXA 4OB0B 1U1SA 4P5NA 2PUOB 2R5AA 1EIFA 3LLRA 2DIQA 1MHNA 1U1TA 2OAUA 3N5BB 3QYHB 4WF2A 1IREB 2WACA 2FL7A 5A0DA 3OYLA 4QQGA 3G6ET 4LDXA 4C0DC 1BIBA 5HK0A 5LJ5e 3G71A 2XU8A 3OYKA 1YJWT 2VYTA 1VIFA 1JRIA 4MZTA 2EJ9A 1VIEA 4B9WA 4NL2A 1YJNA 3TEEA 1VQ7A 3CXCA 4PJOD 1JJ2A 2RK1A 3DB3A 1NPRA 1S72T 1YITT 3CPFA 2WSCE 2GFUA 4JS5A 5CKHA 2RHZA 2QEXT 5LJ3g 2ZZDA 1W4SA 3QBYA 2XHCA 4JRKA 5GAOr 3RMSA 2HBPA 1Q86C 3JCMg 5DLOA 1M1FA 3S6WA 3S3OA 4FT4A 3QO3A 4EMKA 3MO8A 4PJOB 3A8HB 2WSFE 3CC7A 1D3BA 3HP9A 3VU3C 3TCJA 1NPPA 3G71T 5CO7A 5FLXE 1LNXA 2Y4XA 3GP8A 1KC8U 2K5LA 2R57A 4ME7A 4ZGEB 3CCVA 1ZHIA 2RJFA 2O4XA 3PTAA 3FEOA 4NS5A 2RM4A 2E1HA 4LD6A 3JCMP 4X9CA 4A4GA 1YHQA 2FHDA 4C92A 2HD0A 3OS2A 1K73C 4C8QA 5GAMg 4BE2A 2DPPB 2D0QB 2DJZA 2E12A 4MDXA 2DIGA 3P8BB 4BY6C 4C0DB 4OP0A 2QQRA 2HAXA 3PNWC 5GANf 2VXFA 3EFRA 2PUKB 2JUFA 1RL2A 4M7DG 3QJ6A 2L3RA 2XICA 3RMQA 5LJ5j 1VUBA 3OQ5A 3L2RA 1KC8C 3QPHA 5FU6C 2CZ7B 2DTHA 1NJIU 1Y96A 1N27A 4PL6A 4ZGDB 3CCVT 1N8RU 2QDYB 2RI5A 3GNFB 4E47A 4M7AF 3JCMc 4C0GA 4N4GA 4XU0A 4ZTFA 4BI4A 2E70A 1N9SA 2XK0A 4GLKA 3OS0A 5FRNA 5A2QE 2PVOB 1NZ9A 4RCBA 3AHUA 3L2UA 3L2VA 3BFMA 4M77G 1BIAA 5CIUA 2DTIA 2EWNA 1VQPA 4M7DF 2QQBA 1JBMA 2DXTA 2Y4YA 4EDUA 4RMOA 1VQNA 5CKBA 4PNOA 2O01E 3PFSA 4F7UE 4C0FA 1NE8A 4E7HA 5A0LA 3OYYA 4M75F 3L2ZA 4M78G 2B8AA 3PMTA 3H6ZA 4IUUA 3PIOA 1VQOT 1N8RC 3RESA 4BY6B 1WGSA 3I55A 3CMET 1I81A 2EQKA 3KXTA 4C5IA 4M77F 3MP8A 3QZ5B 2JVVA 2E5QA 5M9OA 3G4ST 1R8OB 2XI9A 3J81E 1VQPT 5GANd 3E1SA 3S3MA 2LX9A 2V8JA 3BDLA 3BW1A 4VUBA 5FU6B 2I2LA 3HL8A 3LGLA 3JCMV 1KQ2A 1I5LA 1Q81C 3FDRA 4RG8A 4M78F 3OB9A 1VQNT 1QP3A 3FB9A 1KQSA 3UPUA 3SWNA 4RKUE 3JCMh 1KD1C 3ASKA 5GAOm 3CCSA 3LGFA 3BY7A 4LDWA 3CPWS 2D6FA 2K57A 2ZPBB 3HRTA 2XDPA 2M16A 5J3BA 3I55T 1Y7XA 4XTYA 3OW2S 1MGQA 4HCCA 5GAOn 1X01A 2BKDN 3P8DA 4Q5WA 1VQ8T 3HRUA 5GMKl 3CCLA 5HKCA 4MDWA 2E65A 2LQ8A 3C12A 1Q7YU 2K5IA 2ZGWA 2V8IA 3QDRB 3QXEB 5DY9A 1FX7A 4EMKC 5LJ3e 1W2BA 2K3XA 3OY9A 3VYHB 3CBOA 1YIJA 4JDSA 4PLLA 4DQ2A 4PJOE 2XDDA 2CYZB 1YBYA 4JJNK 1VQ4T 2XDBA 1H3ZA 3CXCS 3JCMe 2DK3A 3PMIA 4R55A 3X26B 3A8LB 1JJ2S 2F69A 4Z02A 5CCAA 3CCEA 3CCST 2QI2A 4IKFA 2C06A 1BI2A 3RERA 2A7YA 5GAOp 2DXBA 1FWZA 5D6YA 4N0AC 4C92C 5AYFA 2YHTA 2LT1A 2RJDA 3WXMB 4IUQA 1KD1U 3JCMQ 4C8QC 5I2SA 3V8LA 1XOVA 3LWIA 5I2MA 1Q7YC 3CBPA 4M7AD 1GXIE 2VXEA 2LCCA 2DKGA 2MF2A 2KVQG 3WVEB 5KE2A 3INZA 1YIJT 2DAQA 3DLMA 3META 5GAMe 1VQMA 4L5GA 1QVPA 4NL3A 1M4ZA 4C92D 3M57A 1PSFA 3VYGA 5A0GA 1AHJB 3CCRA 4DOVA 4ZTJA 3CCET 4C8QD 4ZGJB 5CR2A 2JOYA 4OMFB 4FIBA 3G7ZA 2XD0A 3OYNA 1YI2A 5CVIA 2MMPA 2K3YA 2BIVA 1TH7A 3L42A 3LYIA 2CS7A 2K5FA 4EMHA 4M75D 2YLBA 4EMKB 2IVWA 5C6SA 2CGHA 1K73U 3MCAB 1D3BB 2LVMA 4IUVA 4F7UG 1JB0E 2LTOA 2QQSA 1VQKT 3CCMA 3S3NA 5LJ3j 5LJ5d 3H8ZA 1ZBXA 4FSXA 3TREA 1VQMT 1G3YA 2O4XB 1O9SA 3QUIA 2VC8A 1BI1A 3NTHA 2EAYA 4XTXA 1U8RA 3VJPA 3UT1A 4C92B 2EJGA 2KK4A 4LDUA 4M7AA 2KMTA 3FLGA 1O75A 3CCQA 3CCRT 3DB4A 4C8QB 3X20B 1YI2T 4O5VA 3JB9G 2LRQA 3M4GA 4XTVA 4N0AA 3GF5A 4F7UF 3FC3A 3JB9J 1BI3A 2K2VA 4N4IA 2FYKA 4M7DA 3X24B 4JS4A 1P92A 4LDVA 2DZ9A 2R5MA 3EFSA 5D6WA 3CCMT 3A8GB 4HT9A 1HK9A 2RI2A 1G3WA 3M5AA 1UGSB 1Y96B 5KCOA 3SDZA 5GAMj 4M75A 2VGMA 2PQWA 2FVUA 3E19A 3FIFA 4XTUA 2EQJA 4B9XA 2PU9B 4BDZA 4ATOA 2OTJT 4JLIA 3SWNC 4C0ZA 1QW1A 2QA4T 3CCQT 3UDCA 1M1GA 1KHIA 2M1HA 2RD1A 4JRQA 4OGCA 1VQOA 3JB9F 3OS1A 4M77A 3KBGA 4C5EA 5CK9A 3CMEA 3OSVA 2P0QA 4XK8E 2ZPEB 3F70A 4KT0E 4XAXB 2CZ0B 3RKXA 1WJQA 4PJOG 4A4HA 3G4SA 4C5GA 2OTJA 1UGPB 4M78A 3L2QA 1KQSS 4YTLA 2EQUA 3WVDB 2JTMA 3GNGA 4X34A 1M9SA 1Q81U 2RJEA 5KCHA 5GANh 5GAN2 3CMAA 4OB1B 2X4JA 3CC4A 2RHXA 2L5QA 4E7LA 1QVFA 2G3RA 2RHUA 3GOXA 3M56A 1UB4A 2JNGA 3SD4A 1FXXA 4J8OA 3OYDA 3HFOA 1YJ9A 3JB9I 4PJOF 2RHYA 2RHIA 1VQ8A 5CKDA 5CAIA 3JCMW 3OMCA 1G3TA 2ZPGB 3PGGA 4J6YA 4N4HA 3LW5E 1W2BS 4KBMB 2E6NA 2GF7A 5LJ3f 3E9GA 3RKYA 3SWNB 4C5HA 5J39A 2F5KA 3SFMA 4RCCA 4ELZC 3QJYA 4E7IA 3C95A 2EFIA 2F5TX 2RK2A 1VQ5A 3CMAT 2Y90A 2ZCFB 5GAOq 3OYMA 1VQ4A 2K4YA 3CC4T 4KUDK 4CI0C 4EPCA 2CZ1B 5CQXA 2P0PA 3PIPA 5GAN5 1YJ9T 4OB3B 1KHCA 5GAN3 5GMKh 2EIFA 3RIRA 2XKOC 1XQHA 1PSEA 1I4K1 2QTXA 2DTOA 1KQ1A 2HQEA 4OB2B 1VQ9A 2X4YA 2X35A 5GAMf 3CD6A 4XQ3A 2CKKA 2KQWA 3ZBDA 4XTWA 4MMLA 2P4TA 3MEVA 4A53A 5LJ5f 4J5YA 3LX7A 1VQ5T 2DO3A 3RKWA 3M9QA 4OVAA 3QSUA 4X9DA 4J7IA 2LCLA 2MWPA 1XNIA 3CBMA 4M7AC 1Q82U 1OYXA 3FRNA 4C92E 2RI3A 1WNLA 5J26A 2E64A 2YLCA 2EKOA 5L8RE 4C8QE 3EAEA 2RO0A 1BI0A 2NLUA 3NTIA 3OS5A 2D9TA 4HCZA 4KUIA 5GMKe 3JAME 3CCJT 3M59A 3FJPA 4M7DC 2KY9A 2GQVA 5LJ3d 5KE3A 5GANg 3JSCA 3HSBA 1VQ9T 2DD5A 2PVDB 2FB7A 5IN1A 4Y28E 1VQKA 4L59A 1M5Q1 2XIDA 3CD6T 3QG1A 2HNIA 2EYQA 5I21A 2DZCA 2OTLA 3JCMd 4M75C 2JN0A 3L2WA 1G3SA 3OSSC 4A4EA 1OZ2A 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI3 A;  4BI4 A;  4BI8 B; 
#chains in the Genus database with same CATH topology
 4LUD A;  3EFO B;  2LJ0 A;  1OV3 A;  3QDF A;  3M0S A;  4HXJ A;  1FYN A;  1QMC A;  1QVG A;  3VUZ A;  2ZPF B;  1TTH B;  4QT7 A;  2DL5 A;  4KH0 B;  2YRV A;  4E7J A;  1LJO A;  4M7A B;  1QWE A;  1WJS A;  3TU4 K;  5KYX A;  1RAE B;  1AZE A;  1VQM Q;  1B34 A;  4F04 B;  1K8A U;  1E6H A;  4HA8 A;  4HCK A;  1YI2 Q;  2GFA A;  2O31 A;  3P8H A;  4M75 B;  5FRM A;  4DOW A;  1M3B A;  3OBY A;  4XU2 A;  2ABL A;  3I56 T;  2K6D A;  1Z9Z A;  4BI3 A;  1I07 A;  1ZUK A;  1MUZ A;  3QHS A;  1K8A C;  2P4R A;  2E41 A;  2H3J A;  1M3A A;  1K9M R;  3MEW A;  4PJO A;  3CCQ Q;  1OI1 A;  3LWH A;  3BDU A;  4ZN1 A;  1H3H A;  5LJ5 g;  1OX8 A;  5CQY A;  4HKE A;  1ZUU A;  2RA2 A;  3OYH A;  4C8Q G;  2COZ A;  3O8V A;  2DEQ A;  3MEA A;  1M90 U;  1JO8 A;  4JPB W;  1SSH A;  1YHQ T;  1AVZ C;  3REA B;  4J9I A;  3CC2 T;  2M0Y A;  3URG A;  3ER0 A;  4E6R A;  3CQT A;  1ABO A;  1PD0 A;  4RG2 A;  5FWB A;  4XU3 A;  1A0N B;  3JCM f;  1IHV A;  4D8K A;  3ME9 A;  1NJI C;  1M90 C;  1TWB A;  5FRO A;  4V2S A;  2LT4 A;  1Y07 A;  2X9H A;  2RB6 A;  5GJV B;  1BYM A;  1PKS A;  1HYO A;  1PD1 A;  2RPN A;  1SSF A;  5LJ3 h;  4BE0 A;  2DJQ A;  2CH4 W;  1WXB A;  3M53 A;  2YRC A;  2A37 A;  5KH6 A;  2C0I A;  1I8F A;  4RTZ A;  3JCM X;  1G83 A;  4JJD A;  4CRI A;  3M0Q A;  4FYV B;  2QQA A;  3JB9 D;  3UAT A;  4HVU A;  4J9E A;  1QKW A;  1X2K A;  1VQ6 T;  2MK5 A;  2HQX A;  4M4Z A;  4RTX A;  2KRO A;  4M77 E;  3IQL A;  5GAN 7;  1EZZ B;  5KYW B;  5FU7 B;  4PJO C;  4ELY C;  4OGE A;  3M55 A;  3U23 A;  2QEX A;  3HFN A;  2DXU A;  2EYZ A;  3OW2 A;  3CCU T;  3CCL T;  2GTJ A;  5LL6 S;  1VQL Q;  1U1S A;  4P5N A;  2PUO B;  3LLR A;  2DIQ A;  1MHN A;  1U1T A;  2OAU A;  3TSW A;  1IRE B;  4E7S A;  3G6E T;  5LJ5 e;  3G71 A;  5HK0 A;  1Q86 R;  1I1J A;  1X2Q A;  2XU8 A;  2YT6 A;  2EJ9 A;  1VIE A;  1YJN A;  3RR6 A;  1VQ7 A;  1JJ2 A;  1K9A A;  1S72 T;  2GFU A;  3QBY A;  2COW A;  2W0Z A;  4JRK A;  2HBP A;  4Z8A A;  1ARK A;  3S6W A;  3NHN A;  4FT4 A;  3QO3 A;  3CC7 A;  1UG1 A;  1NM7 A;  2HSP A;  2R57 A;  4ME7 A;  1ZLM A;  2E1H A;  4A4G A;  2BE7 D;  3OS2 A;  2D0Q B;  2ROT A;  5GAN f;  2VXF A;  3EFR A;  1RL2 A;  3QJ6 A;  4DBH A;  1VUB A;  1M8M A;  3QPH A;  5FU6 C;  2CZ7 B;  2DTH A;  1TS9 A;  2DNU A;  3GNF B;  4C0G A;  4N4G A;  1ZSZ A;  4XU0 A;  3OW2 P;  1N9S A;  1N8R R;  5FRN A;  1MMD A;  3L2V A;  2LMJ A;  1PNJ A;  4PNO A;  4F7U E;  5A0L A;  3OYY A;  4M78 G;  1Q81 R;  1JJ2 P;  4BY6 B;  2XMF A;  1I81 A;  4C5I A;  4M77 F;  3EGU A;  1JXM A;  1ZBJ A;  5GAN d;  3E1S A;  3S3M A;  2LX9 A;  3BDL A;  4VUB A;  3LGL A;  3JCM V;  2MYS A;  1WYX A;  1VQN T;  2SRC A;  3JCM h;  3JV3 A;  2D6F A;  2DYB A;  4ESR A;  5J3B A;  2XDP A;  2FRY A;  4Y92 A;  5GAO n;  1WHL A;  4Q5W A;  2M02 A;  4FW1 A;  5HKC A;  4MDW A;  1IRX A;  2LQ8 A;  3C12 A;  4RTV A;  1Q7Y U;  2K5I A;  5GJW B;  5DY9 A;  3QXE B;  1W2B A;  3PVL A;  2NUP A;  3OY9 A;  4PLL A;  1YNZ A;  3H0H A;  4JJN K;  1H3Z A;  2DK3 A;  5CCA A;  2FZC B;  3CCS T;  2C06 A;  2A7Y A;  1SHF A;  5D6Y A;  4OMO A;  1PCX A;  2RJD A;  1Y0M A;  3JCM Q;  3V8L A;  3LWI A;  5I2M A;  1Q7Y C;  3VS7 A;  1GXI E;  1KD1 R;  2DKG A;  2MF2 A;  3MJX A;  3INZ A;  2DAQ A;  1YIJ Q;  5IHK A;  2VB6 A;  2KEA A;  2A36 A;  1BB9 A;  3CCR A;  1YJW Q;  4C8Q D;  2CUD A;  4ZGJ B;  4OMF B;  5FWC A;  1U06 A;  3G7Z A;  2XD0 A;  1TH7 A;  3EFO A;  2K5F A;  1K73 U;  1TU0 B;  4IUV A;  2QQS A;  1WHM A;  3CCM A;  5LJ3 j;  1LCK A;  4FSX A;  1W1F A;  2DLP A;  1VQM T;  1O9S A;  4A63 B;  6AT1 B;  4LDU A;  4M7A A;  1Z9Q A;  4KH1 B;  1CSK A;  4PFZ A;  4C8Q B;  1TXQ A;  1YI2 T;  4O5V A;  2FZG B;  2LRQ A;  2NUZ A;  4F7U F;  3JB9 J;  2FYK A;  1P92 A;  2DZ9 A;  2R5M A;  1W2B P;  2DF6 A;  2HBW A;  3A8G B;  3NGP A;  1GCP A;  4HT9 A;  1G3W A;  2DL8 A;  4AT1 B;  4M75 A;  2FVU A;  3E19 A;  3FIF A;  4ATO A;  3MPU B;  1D0Y A;  2K9G A;  1RI9 A;  3CCQ T;  1M1G A;  1KHI A;  4JRQ A;  1VQO A;  3CME A;  4JJB A;  3OSV A;  2P0Q A;  2SEM A;  2ZPE B;  4A4H A;  3M0R A;  1KQS S;  4YTL A;  2EQU A;  2KYB A;  4X34 A;  2RJE A;  5GAN h;  2RQR A;  2X4J A;  2K2M A;  4EIK A;  4RTY A;  3OYD A;  1YJ9 A;  3JB9 I;  1VQ8 A;  5KYN A;  1TUC A;  4KBM B;  5J39 A;  3G4S Q;  4C5H A;  3QJY A;  3OYM A;  1ACM B;  2DL4 A;  2QTV A;  2CZ1 B;  2EQI A;  3RIR A;  2DTO A;  1KQ1 A;  4OB2 B;  1UDL A;  5KYY B;  5GAM f;  3D7S B;  3ZBD A;  3MEV A;  2LCS A;  4J5Y A;  2YUN A;  1D0Z A;  3RKW A;  3M9Q A;  2FPD A;  2LCL A;  4M7A C;  1Q82 U;  4C92 E;  2CP6 A;  3R6N A;  3VS4 A;  5J26 A;  2M51 A;  2EKO A;  2YLC A;  5L8R E;  1M1K R;  3OS5 A;  1SRM A;  1FMV A;  4AFQ C;  1RUW A;  3JSC A;  3HSB A;  2BZY A;  2LX7 A;  1M5Q 1;  2ED0 A;  2EGC A;  4M75 C;  4A4E A;  1Q82 C;  2EGE A;  2IG0 A;  3A8M B;  2G6F X;  2QQ9 A;  5KYW A;  2GGR A;  1NLO C;  3TQ7 P;  1VQL T;  5GAM d;  2KSS A;  1VQK Q;  2BZ8 A;  3I56 A;  3L1A A;  1IGU A;  4E2F B;  2RJC A;  4IUR A;  4BAC A;  1YCS B;  3REB B;  4M78 D;  1H8K A;  1YFN A;  2KAF A;  4WCI A;  1X27 A;  1RAC B;  1SKU B;  4O6J A;  3H0I A;  3VS6 A;  2O9S A;  4KUL A;  1K9M U;  2HQH A;  3EG1 A;  1C0M A;  1YP5 A;  4J9D A;  1MV3 A;  3JB9 H;  1CKB A;  4M78 B;  1LOJ A;  2WSE E;  2CT3 A;  4HT8 A;  3M58 A;  4CC3 A;  3CC2 A;  1MV0 B;  3G1J A;  2KI7 A;  2P0K A;  1WQW A;  2J06 A;  1K9M C;  2JXB A;  5GAO l;  2JM8 A;  3UWN A;  2LC4 A;  1WPY A;  2M9U A;  2YXY A;  3JRZ A;  3MP1 A;  5HK3 A;  1RAD B;  5CKE A;  3J7A F;  2X3W D;  4C92 F;  1N9R A;  2KRM A;  3MKD A;  4NOY A;  4LN2 A;  3T9N A;  5D7U A;  3M54 A;  2C0O A;  4R56 A;  3CMA Q;  2MI6 A;  4E7K A;  2FZK B;  3UA6 A;  3V8K A;  1YWP A;  3OYI A;  1MNE A;  2J6O A;  3X28 B;  3CCJ A;  5FU7 C;  3V7C A;  2QXF A;  1V29 B;  4JUV A;  1VQ6 A;  4QVC A;  2D8J A;  2MWO A;  3VUB A;  3Q1J A;  1AEY A;  2X4X A;  3PT9 A;  2ENM A;  2LDM A;  4PK4 A;  2Z0W A;  4IUP A;  4M7D E;  1SF9 A;  4XTZ A;  4BDY A;  4GY5 A;  2MAM A;  4J9G A;  3CCU A;  4Z89 A;  2KDS A;  4OF1 A;  1VQ9 Q;  5GAN 8;  3CD6 Q;  5GAM h;  5GAN j;  1DJ7 B;  4X1V A;  1BKB A;  3G6E A;  1TSF A;  1IO6 A;  4K11 A;  3V8J A;  2DIL A;  3KUF A;  1C6V X;  4RTT A;  3THK A;  2EQM A;  1S72 A;  2YUO A;  4BI8 B;  3OYB A;  4D6W A;  3CEY A;  3OBW A;  1OPK A;  1Q86 U;  2KXC A;  5GMK i;  3QYH B;  2OTL Q;  5A0D A;  2WAC A;  1VOM A;  3OYK A;  1YJW T;  1JRI A;  4B9W A;  2CDT A;  4JS5 A;  1Y57 A;  2RHZ A;  2FPE A;  1W4S A;  2XHC A;  2QEX Q;  2EKH A;  1Q86 C;  3JCM g;  3S3O A;  1M1F A;  4J9F A;  3MO8 A;  2ECZ A;  2AKL A;  3HP9 A;  1GL5 A;  1LNX A;  2FPF A;  2K5L A;  3PTA A;  3VS0 A;  3FEO A;  1I5O B;  2RM4 A;  4LD6 A;  1YJN Q;  1VQ7 Q;  2HD0 A;  1AWW A;  4C8Q A;  4BE2 A;  2DPP B;  4MDX A;  2DIG A;  3E2U A;  3P8B B;  4BY6 C;  4AG1 C;  2JUF A;  2L3R A;  3L2R A;  3CC7 Q;  1K0S A;  2CP2 A;  1NJI U;  4OMP A;  1N8R U;  3RNJ A;  3M0U A;  3A98 A;  1VYV A;  3L2U A;  4M77 G;  4M7D F;  4RTU A;  1WXT A;  1SHG A;  2KT8 A;  2Y4Y A;  1VQN A;  4PFP A;  5CKB A;  2CSI A;  4E7H A;  2F1L A;  2K3B A;  2PTK A;  3NMZ C;  3PMT A;  4IUU A;  3PIO A;  1N8R C;  3RES A;  3ULR B;  1IXD A;  2QGF B;  1WXU A;  2YSQ A;  3G4S T;  1VQP T;  3EH1 A;  1XJW B;  3BW1 A;  1KQ2 A;  1Q81 C;  3OB9 A;  1QP3 A;  1KQS A;  1NBE B;  3CCS A;  1PRM C;  3HRT A;  2ZPB B;  2O2O A;  3P8D A;  2DFU A;  1QCF A;  2E65 A;  1V1C A;  2NYS A;  2K3X A;  4JDS A;  4PJO E;  1YBY A;  5KYY A;  3JCM e;  4R55 A;  2QI2 A;  3H41 A;  1BI2 A;  3RER A;  4D8D A;  2DXB A;  4R0K A;  4N0A C;  5AYF A;  1KD1 U;  4C8Q C;  8ATC B;  2D8H A;  2GQI A;  3CBP A;  1UTI A;  2L3Q A;  1VQM A;  3DLM A;  3MET A;  1M4Z A;  3VYG A;  4FYY B;  1BCO A;  5CR2 A;  4FIB A;  1YI2 A;  5CVI A;  2BIV A;  5C6S A;  1TUG B;  1YIT Q;  1KD1 C;  2CGH A;  2LVM A;  4F7U G;  2LZ6 B;  1VQK T;  4LUE A;  5LJ5 d;  2LJ1 A;  3H8Z A;  2HKN A;  3TRE A;  1KQS P;  2VC8 A;  2QG9 B;  2EYY A;  4XTX A;  2EJG A;  2MCN A;  3FLG A;  2RN8 A;  3CCQ A;  3DB4 A;  4J9B A;  1K8A R;  4XTV A;  1TG0 A;  2RMO A;  1BI3 A;  2K2V A;  1RAF B;  4LDV A;  1UEC A;  1UGS B;  5GAM j;  3SDZ A;  4XTU A;  4B9X A;  2DMO A;  2PU9 B;  1D1C A;  4DBF A;  4JZ4 A;  1QW1 A;  3UDC A;  2BE9 B;  4DEX A;  4OGC A;  3OS1 A;  3CCV Q;  3KBG A;  1M2V B;  1OX9 A;  2DYI A;  4XAX B;  1WJQ A;  1Q95 G;  2OTJ A;  4M78 A;  1IB8 A;  5GAN 2;  1UFF A;  2FG0 A;  2L5Q A;  2RQW A;  2HZY A;  1UB4 A;  3SD4 A;  1JQQ A;  4J8O A;  1VQO Q;  3HFO A;  3HTR A;  4AFU C;  4PJO F;  3CME Q;  3JCM W;  1G3T A;  2ZPG B;  1QCO A;  2E3I A;  3PGG A;  3LW5 E;  2DX1 A;  4J6Y A;  2DET A;  2GF7 A;  3RKY A;  4GBQ A;  2F5K A;  4E7I A;  1SPK A;  3CMA T;  4KUD K;  2Y90 A;  1VQ4 A;  1KSW A;  2RQT A;  1ZX6 A;  3LH5 A;  2P0P A;  1MND A;  5GAN 5;  4OB3 B;  1UHC A;  1YJ9 Q;  1XQH A;  3I55 Q;  1I4K 1;  1VQ8 Q;  5EC7 A;  2HQE A;  3EH2 A;  2X4Y A;  1JXO A;  2CKK A;  3GBQ A;  4MML A;  1D0X A;  3LX7 A;  1VQ5 T;  2DO3 A;  4OMN A;  4RUG A;  4X9D A;  2MWP A;  2AT1 B;  1AT1 B;  2FEI A;  3EAE A;  4HCZ A;  4KUI A;  1WFW A;  4RTW A;  3M59 A;  2ED1 A;  1JEG A;  3FJP A;  2KY9 A;  2GQV A;  2KRS A;  2VKN A;  1J3T A;  1VQ9 T;  2DD5 A;  2FB7 A;  2PVD B;  1VYT A;  2HEQ A;  2XID A;  3CD6 T;  3QG1 A;  2HNI A;  2LP5 A;  1HJD A;  1G3S A;  2CH4 A;  1M1K C;  1SEM A;  3VRZ A;  4PKC C;  2QDL A;  4QW2 A;  1QKX A;  2PNI A;  3CCE Q;  1CKA A;  2L3S A;  1T3S A;  3C4S A;  1M3C A;  3X25 B;  1X75 C;  1WHH A;  1GRI A;  3HKS A;  1PC0 A;  4M78 C;  3VV0 A;  2EJF A;  2OTL T;  5C0M A;  2DVE A;  5D6X A;  1ZA1 B;  4M77 D;  4QVD A;  2DBM A;  2QA4 A;  2RF0 A;  3H9N A;  2V8K A;  3MEU A;  5GAN 4;  3I5R A;  1WHK A;  4DBR A;  5GMK j;  2HKQ B;  4FM4 B;  4J83 A;  4QVZ A;  2DE0 X;  3ZFJ A;  1D1A A;  4PLI A;  5IHN A;  5IHI A;  3V7S A;  4MMK A;  1QVF S;  3FJ5 A;  4FYX B;  3I56 Q;  2VUB A;  4M77 B;  3QZ9 B;  5FW9 A;  3EGX B;  2VGN A;  3OMG A;  4FT2 A;  3OYE A;  4PJL A;  1SG5 A;  1YJN T;  2RH2 A;  5I22 A;  1VQ7 T;  2EBP A;  2VV5 A;  2A28 A;  1AWO A;  5HY6 A;  4M7A G;  3NFC A;  2R58 A;  4C92 G;  2KNB B;  2VAS A;  3CC7 T;  1K0X A;  4BE1 A;  1KJW A;  2X4W A;  4A4K A;  4M75 G;  3LH0 A;  5IXF A;  2LNV A;  3CPW P;  2JTF A;  1GFC A;  2LJ3 A;  1QCN A;  3CC2 Q;  4DA4 A;  1RAI B;  2AZS A;  4TVR A;  5CKF A;  2CZ6 B;  3CC4 Q;  3OA6 A;  2KT1 A;  2A08 A;  3H0F A;  2ROL A;  4BB7 A;  1IZ6 A;  2LNH B;  4J6W A;  2A0F B;  1C1A A;  2AKK A;  1WJR A;  3EG2 A;  4M7A E;  1NYG A;  3RBB B;  1PRL C;  4QQ6 A;  2E6Z A;  4JZ3 A;  2F2V A;  1BK2 A;  1BU1 A;  2JZ2 A;  4MZM A;  4JRP A;  2A3L A;  2DEU A;  3M4Y A;  1AOJ A;  1PKT A;  3EG0 A;  1GBR A;  3CCJ Q;  3OYG A;  2JT4 A;  4M75 E;  2J6F A;  4Z88 A;  4Y91 A;  4A54 A;  1WIE A;  5IAY A;  4F7U B;  1Q7Y R;  3J80 E;  2BZX A;  4JRI A;  1YJW A;  4LD9 K;  4GLM A;  4MZP A;  4A4F A;  2ZPI B;  3VKI A;  3QYG B;  4BD3 A;  4HVV A;  4IIO A;  2BUD A;  4KRT A;  1R0B G;  2R5A A;  1EIF A;  1TOV A;  2KRN A;  1RLP C;  4QQG A;  1R0C B;  2VYT A;  2V26 A;  4NL2 A;  3TEE A;  3RDV A;  3TSZ A;  2RK1 A;  1NPR A;  1YIT T;  3CPF A;  5CKH A;  2KXD A;  5LJ3 g;  5GAO r;  3RMS A;  5DLO A;  1K73 R;  4KGZ B;  3A8H B;  2WSF E;  1OUL A;  2FRW A;  3TCJ A;  5FLX E;  4FSS A;  4ZGE B;  1EFN A;  1KC8 R;  3JCM P;  1YHQ A;  2FHD A;  4ZNX A;  1FMK A;  2DJZ A;  2E12 A;  1TUD A;  4C0D B;  2HAX A;  1B7T A;  2PUK B;  1IGQ A;  4M7D G;  2XIC A;  5LJ5 j;  1D09 B;  1QWF A;  2JW4 A;  3CCV T;  4ZGD B;  2RI5 A;  4M7A F;  1G2B A;  4ZTF A;  2E70 A;  1UE9 A;  4DBQ A;  2XK0 A;  3TVT A;  1B07 A;  1NZ9 A;  4KGV B;  3AHU A;  1KK7 A;  3BFM A;  1VQP A;  1BIA A;  3PVQ A;  2DTI A;  1M2V A;  4EDU A;  2L3P A;  1UJ0 A;  4RMO A;  2CP7 A;  2O01 E;  2YRD A;  1E6G A;  4M75 F;  3L2Z A;  3H6Z A;  1VQO T;  1WGS A;  3CME T;  3O5Z A;  2AIR B;  3MP8 A;  3QZ5 B;  2JVV A;  1W6X A;  1I5L A;  3FDR A;  3FB9 A;  1SRL A;  3UPU A;  4RKU E;  1W70 A;  3CPW S;  4LDW A;  2O88 A;  2K57 A;  4F16 A;  3I55 T;  1Y7X A;  1VQ8 T;  1UHF A;  3CCL A;  4QKU A;  2ZGW A;  1FX7 A;  5LJ3 e;  3CBO A;  4DQ2 A;  5ECA A;  2XDD A;  2CYZ B;  2XDB A;  1GFD A;  4KGX B;  2EYW A;  3CXC S;  3PMI A;  3X26 B;  2F69 A;  1I0C A;  1GCQ A;  4AFZ C;  1FWZ A;  4LNP A;  1WX6 A;  4AG2 C;  2W10 A;  2YHT A;  2LT1 A;  3WXM B;  1PM3 A;  1MMG A;  2V1R A;  2YUQ A;  4M7A D;  2LCC A;  2VXE A;  5KE2 A;  1YIJ T;  1JU5 C;  1QVP A;  4C92 D;  3M57 A;  5A0G A;  4DOV A;  4ZTJ A;  3CCE T;  1AWJ A;  4OMM A;  3OYN A;  1OOT A;  2K3Y A;  2MMP A;  2RQV A;  3LYI A;  1NG2 A;  2CS7 A;  4EMK B;  4M75 D;  2YLB A;  2IVW A;  3UA7 A;  3MCA B;  1D3B B;  1ZBX A;  1G3Y A;  2O4X B;  3AT1 B;  3QUI A;  1U8R A;  4C92 B;  3G71 Q;  1AWX A;  4OML A;  1O75 A;  2AK5 A;  1OEB A;  3EHQ A;  4N0A A;  3GF5 A;  5AT1 B;  3QWX X;  3FC3 A;  4N4I A;  1UUE A;  2KBT A;  2RI2 A;  3M5A A;  1Y96 B;  5KCO A;  2PQW A;  4BDZ A;  2KGT A;  2EQJ A;  1VA7 A;  4JLI A;  4ANJ A;  4C0Z A;  2QAZ A;  8AT1 B;  4E7Z A;  2H3E B;  4CC7 A;  3EGD B;  2M1H A;  3JB9 F;  4M77 A;  1FMW A;  3EGX A;  4JJC A;  1HD3 A;  5KYU B;  4XK8 E;  3F70 A;  2CZ0 B;  4PJO G;  2YUP A;  5I11 A;  3ZL7 C;  1UGP B;  3GNG A;  1Q81 U;  5KCH A;  4OMQ A;  3CMA A;  2K7A A;  2LQW A;  2IIM A;  1QVF A;  2G3R A;  2RHU A;  3M56 A;  1FXX A;  1GCQ C;  1QVG P;  2RHY A;  3OMC A;  1AZG B;  2GNC A;  3SWN B;  1ABQ A;  4RCC A;  2DL7 A;  2OTJ Q;  2YWW A;  3C95 A;  2CUB A;  2F5T X;  1VQ5 A;  3PE0 A;  3CC4 T;  2DM1 A;  4WTO B;  5HCK A;  2CRE A;  3QWY A;  5CQX A;  3PIP A;  2QAS A;  5GAN 3;  5GMK h;  2QTX A;  1VQ9 A;  3CD6 A;  4XQ3 A;  2KQW A;  4XTW A;  2P4T A;  5LJ5 f;  2QK0 A;  2MPX C;  4OVA A;  1VQ4 Q;  3CBM A;  1XNI A;  3FRN A;  2RI3 A;  2E64 A;  1X6B A;  4C8Q E;  2RO0 A;  2NLU A;  3NTI A;  2D9T A;  3CCJ T;  2DA9 A;  2VVK A;  1M27 C;  2KR3 A;  5GAN g;  2LQN A;  2CT4 A;  1QLY A;  4Y28 E;  1G8X A;  2OTL A;  2EYQ A;  5I21 A;  3JCM d;  2JN0 A;  1QVF P;  1RAG B;  2HL5 C;  1OZ2 A;  1KG1 A;  4M7D D;  4ORZ A;  1G5V A;  3E9F A;  4F7U A;  4M77 C;  1GBQ A;  3SB2 A;  4F17 A;  4LXC A;  3RUX A;  1K76 A;  4II1 A;  4J7F A;  3NTK A;  3A8O B;  4L6V 5;  2X51 A;  5DM7 R;  2KE9 A;  1YCY A;  4UC4 A;  3OYF A;  2M0O A;  4AMC A;  3QII A;  2ZPH B;  4M7D B;  3M0T A;  3CCR Q;  1PHT A;  3QKJ A;  3HPW A;  1UGR B;  2NUT B;  4PJN A;  3HRS A;  2JTE A;  1S1N A;  2PVG B;  4EMG A;  2D1X A;  3CCM Q;  4J6X A;  2L89 A;  3C94 A;  2L0A A;  1QP2 A;  3BE3 A;  2LQK A;  2O9V A;  1M8V A;  1ZQ1 A;  2E10 A;  1WA7 A;  2QA4 Q;  1F1B B;  4XU1 A;  3EG9 B;  3DKM A;  1N6A A;  5GAN 6;  1IHW A;  4PFO A;  4FU6 A;  2EVR A;  3OYA A;  1WLP B;  1NEG A;  4PJJ A;  2DXC A;  1X69 A;  2F2W A;  3GIB A;  3I9Q A;  9ATC B;  3VS5 A;  1XTD A;  5IT9 E;  1PG5 B;  5EG2 A;  5IXB A;  2MOX A;  1NJI R;  1M90 R;  2EGA A;  3EHR A;  4C8Q F;  2C0T A;  3HHT B;  4LDY A;  5GAN e;  1NLP C;  3R6O A;  1RI0 A;  3ZEH A;  4AFS C;  2ESW A;  1X6O A;  1YWO A;  3JCM b;  2DBK A;  1RLQ C;  2L8D A;  3A5Z B;  3GLX A;  1T3L A;  2AZV A;  4FL6 A;  1KIK A;  4JLG A;  1KFZ A;  1UEB A;  3MP6 A;  4B6M A;  1HXD A;  2DRM A;  4BUG A;  2HSE B;  1M1K U;  1QVG S;  2GTO A;  5DLQ E;  3DLL A;  4ZN3 A;  3GPL A;  2XG8 D;  3OYJ A;  4CC2 A;  3I5S A;  1H64 1;  4CC4 B;  4QQD A;  1VQL A;  3C0C A;  2DVJ A;  1RAB B;  3JCM J;  1WQ7 A;  5LJ5 h;  2DD4 A;  1VYU A;  1UGQ B;  4IUT A;  1Y71 A;  1OZ3 A;  3I35 A;  2GCX A;  2OX7 A;  1YIT A;  1OU9 A;  1RAA B;  1HSQ A;  4M78 E;  3CPW A;  3V7R A;  5KYX B;  2HL3 A;  1B34 B;  2L2P A;  7AT1 B;  2AHJ B;  3OYC A;  5GMK m;  1OPL A;  3MHX A;  4OB0 B;  4PJO D;  4HCB A;  3N5B B;  4WF2 A;  3VRY A;  4LDX A;  3OYL A;  2FL7 A;  1NYF A;  2EPD A;  4C0D C;  1BIB A;  1VIF A;  4MZT A;  3EG3 A;  2FO0 A;  1RAH B;  3CXC A;  3DB3 A;  1ZSZ C;  2WSC E;  1ZUY A;  2RQU A;  2QEX T;  2ZZD A;  2QYZ A;  4FCY A;  2JMC A;  4EMK A;  4PJO B;  2EW3 A;  1D3B A;  3VU3 C;  2H8H A;  1NPP A;  2IPO B;  5CO7 A;  3G71 T;  2Y4X A;  3GP8 A;  1KC8 U;  2K79 A;  2PZ1 A;  3CCV A;  1ZHI A;  2RJF A;  2O4X A;  1QQJ A;  4NS5 A;  3M0P A;  3SHW A;  4X9C A;  4C92 A;  1K73 C;  1MMA A;  5GAM g;  1U5S A;  1AD5 A;  4OP0 A;  2QQR A;  3PNW C;  4IIM A;  3RMQ A;  3OQ5 A;  1B3Q A;  1KC8 C;  1U3O A;  2CP5 A;  1Y96 A;  1N27 A;  4PL6 A;  2QDY B;  4E47 A;  3JCM c;  4BI4 A;  1YHQ Q;  4GLK A;  3OS0 A;  5A2Q E;  3EGD A;  2PVO B;  4RCB A;  1LVK A;  5CIU A;  2EWN A;  2QQB A;  1JBM A;  5KYU A;  2DXT A;  1OU8 A;  3PFS A;  1X43 A;  4F14 A;  4C0F A;  1NE8 A;  2B8A A;  3CXC P;  1N5Z A;  3I55 A;  3VS3 A;  2EQK A;  3KXT A;  4DEY A;  2RNA A;  2E5Q A;  1ZA2 B;  5M9O A;  1R8O B;  2XI9 A;  3J81 E;  1BBZ A;  1H92 A;  2OTJ T;  2V8J A;  1VQP Q;  5FU6 B;  2I2L A;  3HL8 A;  2I0N A;  4RG8 A;  2P84 A;  4M78 F;  1D1B A;  1WZO A;  2D0N A;  3SWN A;  1T0J A;  1T0H A;  3ASK A;  5GAO m;  2DER A;  2J7I A;  3LGF A;  3BY7 A;  3OW2 S;  2M16 A;  2JM9 A;  4HCC A;  4XTY A;  1WHJ A;  1MGQ A;  1WHG A;  1X01 A;  2BKD N;  3HRU A;  5GMK l;  2CP0 A;  2KYM A;  2V8I A;  3QDR B;  4EMK C;  1VQ6 Q;  1YIJ A;  3VYH B;  1MMN A;  1OQK A;  2E4H A;  1VQ4 T;  1JJ2 S;  1ZSG A;  2OI3 A;  3A8L B;  4Z02 A;  3CCE A;  4IKF A;  5GAO p;  4C92 C;  4IUQ A;  2COY A;  1WDX A;  5I2S A;  3CCU Q;  1XOV A;  3CCL Q;  3KFV A;  1R77 A;  2JS0 A;  2KVQ G;  3WVE B;  1NEB A;  5GAM e;  1YN8 A;  4L5G A;  4NL3 A;  1PWT A;  3G6E Q;  2BTT A;  1PSF A;  1AHJ B;  1V76 A;  2MIO A;  2JOY A;  4FW2 A;  4EMH A;  1S72 Q;  2B86 A;  3L42 A;  1JB0 E;  2LTO A;  3S3N A;  2OAW A;  3A1P A;  1BI1 A;  3NTH A;  2EAY A;  1K4U S;  3VJP A;  3UT1 A;  2KK4 A;  2KMT A;  3CCR T;  3X20 B;  3JB9 G;  3M4G A;  2HMA A;  4M7D A;  3X24 B;  4JS4 A;  4J9C A;  1M2O A;  1K1Z A;  3EFS A;  5D6W A;  2X3X D;  3CCM T;  1HK9 A;  2HCK A;  2NUT A;  2JMA A;  2VGM A;  1ZSZ B;  3SWN C;  2QA4 T;  2JJ9 A;  2YDL A;  2RD1 A;  2NWM A;  4C5E A;  5CK9 A;  2VWF A;  2E5K A;  4KT0 E;  3RKX A;  5IH2 A;  3G4S A;  4C5G A;  3EG9 A;  3L2Q A;  3WVD B;  2JTM A;  1M9S A;  1X6G A;  4OB1 B;  2ZAE A;  3CC4 A;  2RHX A;  1E7O A;  4E7L A;  3GOX A;  2JNG A;  2RHI A;  2GBQ A;  5CKD A;  5CAI A;  1BCM A;  4N4H A;  1EX4 A;  2CP3 A;  1W2B S;  5L23 A;  2E6N A;  2QGG A;  5LJ3 f;  3E9G A;  2ATC B;  2DRK A;  3SFM A;  4ELZ C;  2EFI A;  4PJM A;  3UF4 A;  1M30 A;  2RK2 A;  2E3H A;  2ZCF B;  2J05 A;  5GAO q;  1VQN Q;  2K4Y A;  2DL3 A;  1LPL A;  4CI0 C;  4EPC A;  1UJY A;  1YJ9 T;  1KHC A;  2EIF A;  2XKO C;  1PSE A;  2OJ2 A;  2NUP B;  4FYW B;  2X35 A;  4J9H A;  4A53 A;  3VS1 A;  2J6K A;  2HDA A;  1VQ5 Q;  1WI7 A;  3QSU A;  4J7I A;  1OYX A;  2EYX A;  3CCS Q;  1UGV A;  1WNL A;  2JS2 A;  1BI0 A;  5GMK e;  3JAM E;  1Q82 R;  2CSQ A;  3NPF A;  4M7D C;  4LE9 A;  4HVW A;  5LJ3 d;  5KE3 A;  5IN1 A;  1VQK A;  4L59 A;  2V1Q A;  2DZC A;  3L2W A;  3SEM A;  3OSS C;  3VS2 A;  2F2X A; 
#chains in the Genus database with same CATH homology
 1KG1 A;  1Q82 C;  4M7D D;  4PKC C;  4QW2 A;  4HCB A;  1G5V A;  3E9F A;  4F7U A;  4M77 C;  2IG0 A;  3A8M B;  1QVG A;  3SB2 A;  3VUZ A;  2QQ9 A;  2ZPF B;  3C4S A;  3RUX A;  4II1 A;  4J7F A;  3NTK A;  3A8O B;  3X25 B;  1VQL T;  1X75 C;  2YRV A;  4L6V 5;  3HKS A;  5GAM d;  2KSS A;  4M78 C;  3VV0 A;  4E7J A;  1LJO A;  4M7A B;  5DM7 R;  2EJF A;  3I56 A;  2OTL T;  1WJS A;  5C0M A;  1YCY A;  2DVE A;  4UC4 A;  5D6X A;  3L1A A;  3TU4 K;  4M77 D;  3OYF A;  2M0O A;  1B34 A;  4QVD A;  3QII A;  2RJC A;  1K8A U;  2QA4 A;  4HA8 A;  4IUR A;  2V8K A;  2ZPH B;  4M7D B;  4BAC A;  3MEU A;  5GAN 4;  4M78 D;  5GMK i;  5GMK j;  3QKJ A;  2GFA A;  2KAF A;  1UGR B;  3HPW A;  4FM4 B;  3P8H A;  4M75 B;  4J83 A;  5FRM A;  4QVZ A;  3HRS A;  4O6J A;  3ZFJ A;  4DOW A;  3OBY A;  4PLI A;  4XU2 A;  2PVG B;  3V7S A;  4MMK A;  4EMG A;  3I56 T;  1QVF S;  4BI3 A;  4KUL A;  1K9M U;  4J6X A;  2L89 A;  2VUB A;  3C94 A;  4M77 B;  3QZ9 B;  1QP2 A;  2LQK A;  3QHS A;  1M8V A;  1K8A C;  1ZQ1 A;  2E10 A;  2E41 A;  2VGN A;  3OMG A;  2H3J A;  4FT2 A;  3OYE A;  4XU1 A;  3MEW A;  4PJO A;  3JB9 H;  1OI1 A;  1YJN T;  2RH2 A;  1VQ7 T;  3LWH A;  3BDU A;  4M78 B;  1LOJ A;  3DKM A;  1N6A A;  2VV5 A;  2WSE E;  4ZN1 A;  5HY6 A;  5GAN 6;  4HT8 A;  3M58 A;  4M7A G;  3CC2 A;  3NFC A;  5LJ5 g;  4FU6 A;  5CQY A;  2R58 A;  4C92 G;  3OYA A;  4HKE A;  2P0K A;  1WQW A;  1K9M C;  2DXC A;  2RA2 A;  3OYH A;  4C8Q G;  3CC7 T;  3GIB A;  4BE1 A;  5GAO l;  3O8V A;  2DEQ A;  3UWN A;  3MEA A;  2X4W A;  2LC4 A;  1XTD A;  4A4K A;  1M90 U;  4M75 G;  1WPY A;  3LH0 A;  5IT9 E;  2M9U A;  5EG2 A;  2LNV A;  3JRZ A;  2JTF A;  3MP1 A;  1YHQ T;  5HK3 A;  5CKE A;  3CC2 T;  3J7A F;  4C92 F;  3URG A;  1N9R A;  3ER0 A;  4NOY A;  4C8Q F;  4RG2 A;  4DA4 A;  3HHT B;  3T9N A;  4XU3 A;  4LDY A;  3M54 A;  5GAN e;  3JCM f;  4R56 A;  3R6O A;  4TVR A;  2MI6 A;  2CZ6 B;  5CKF A;  1RI0 A;  3ME9 A;  4E7K A;  3ZEH A;  3OA6 A;  1NJI C;  1X6O A;  3V8K A;  3JCM b;  1M90 C;  5FRO A;  3OYI A;  2L8D A;  3A5Z B;  4BB7 A;  3X28 B;  2LT4 A;  3GLX A;  1Y07 A;  3CCJ A;  4V2S A;  1IZ6 A;  5FU7 C;  3V7C A;  2QXF A;  2RB6 A;  1V29 B;  1BYM A;  4FL6 A;  4J6W A;  4JUV A;  4JLG A;  1VQ6 A;  1UEB A;  1SSF A;  5LJ3 h;  4BE0 A;  3MP6 A;  4QVC A;  1WJR A;  4M7A E;  1HXD A;  4QQ6 A;  2MWO A;  2E6Z A;  3VUB A;  3Q1J A;  4BUG A;  2X4X A;  3M53 A;  1M1K U;  3PT9 A;  1QVG S;  2LDM A;  2JZ2 A;  5DLQ E;  3DLL A;  4IUP A;  4MZM A;  4ZN3 A;  2A3L A;  5KH6 A;  3GPL A;  2XG8 D;  4JRP A;  3M4Y A;  4XTZ A;  3OYJ A;  4M7D E;  1I8F A;  4BDY A;  3JCM X;  4GY5 A;  2MAM A;  1H64 1;  4CRI A;  3OYG A;  3CCU A;  2QQA A;  4QQD A;  1VQL A;  4M75 E;  2KDS A;  3JB9 D;  4Y91 A;  4A54 A;  4OF1 A;  1VQ6 T;  5GAN 8;  5IAY A;  5GAM h;  5GAN j;  1DJ7 B;  2HQX A;  1BKB A;  4F7U B;  3G6E A;  3JCM J;  1WQ7 A;  5LJ5 h;  2DD4 A;  4M77 E;  5GAN 7;  3J80 E;  4JRI A;  1YJW A;  4LD9 K;  3V8J A;  5FU7 B;  4MZP A;  4PJO C;  3KUF A;  1UGQ B;  4IUT A;  4ELY C;  4OGE A;  1Y71 A;  3M55 A;  1OZ3 A;  2EQM A;  4A4F A;  2ZPI B;  1S72 A;  2GCX A;  1YIT A;  4BI8 B;  4M78 E;  3HFN A;  3QYG B;  3VKI A;  2DXU A;  4BD3 A;  3OYB A;  3V7R A;  2QEX A;  3CPW A;  3OW2 A;  4D6W A;  3CCU T;  3CEY A;  3OBW A;  1B34 B;  3CCL T;  2AHJ B;  5LL6 S;  5GMK m;  3OYC A;  2BUD A;  1Q86 U;  3MHX A;  4OB0 B;  1U1S A;  4P5N A;  2PUO B;  2R5A A;  1EIF A;  3LLR A;  2DIQ A;  1MHN A;  1U1T A;  2OAU A;  3N5B B;  3QYH B;  4WF2 A;  1IRE B;  2WAC A;  2FL7 A;  5A0D A;  3OYL A;  4QQG A;  3G6E T;  4LDX A;  4C0D C;  1BIB A;  5HK0 A;  5LJ5 e;  3G71 A;  2XU8 A;  3OYK A;  1YJW T;  2VYT A;  1VIF A;  1JRI A;  4MZT A;  2EJ9 A;  1VIE A;  4B9W A;  4NL2 A;  1YJN A;  3TEE A;  1VQ7 A;  3CXC A;  4PJO D;  1JJ2 A;  2RK1 A;  3DB3 A;  1NPR A;  1S72 T;  1YIT T;  3CPF A;  2WSC E;  2GFU A;  4JS5 A;  5CKH A;  2RHZ A;  2QEX T;  5LJ3 g;  2ZZD A;  1W4S A;  3QBY A;  2XHC A;  4JRK A;  5GAO r;  3RMS A;  2HBP A;  1Q86 C;  3JCM g;  5DLO A;  1M1F A;  3S6W A;  3S3O A;  4FT4 A;  3QO3 A;  4EMK A;  3MO8 A;  4PJO B;  3A8H B;  2WSF E;  3CC7 A;  1D3B A;  3HP9 A;  3VU3 C;  3TCJ A;  1NPP A;  3G71 T;  5CO7 A;  5FLX E;  1LNX A;  2Y4X A;  3GP8 A;  1KC8 U;  2K5L A;  2R57 A;  4ME7 A;  4ZGE B;  3CCV A;  1ZHI A;  2RJF A;  2O4X A;  3PTA A;  3FEO A;  4NS5 A;  2RM4 A;  2E1H A;  4LD6 A;  3JCM P;  4X9C A;  4A4G A;  1YHQ A;  2FHD A;  4C92 A;  2HD0 A;  3OS2 A;  1K73 C;  4C8Q A;  5GAM g;  4BE2 A;  2DPP B;  2D0Q B;  2DJZ A;  2E12 A;  4MDX A;  2DIG A;  3P8B B;  4BY6 C;  4C0D B;  4OP0 A;  2QQR A;  2HAX A;  3PNW C;  5GAN f;  2VXF A;  3EFR A;  2PUK B;  2JUF A;  1RL2 A;  4M7D G;  3QJ6 A;  2L3R A;  2XIC A;  3RMQ A;  5LJ5 j;  1VUB A;  3OQ5 A;  3L2R A;  1KC8 C;  3QPH A;  5FU6 C;  2CZ7 B;  2DTH A;  1NJI U;  1Y96 A;  1N27 A;  4PL6 A;  4ZGD B;  3CCV T;  1N8R U;  2QDY B;  2RI5 A;  3GNF B;  4E47 A;  4M7A F;  3JCM c;  4C0G A;  4N4G A;  4XU0 A;  4ZTF A;  4BI4 A;  2E70 A;  1N9S A;  2XK0 A;  4GLK A;  3OS0 A;  5FRN A;  5A2Q E;  2PVO B;  1NZ9 A;  4RCB A;  3AHU A;  3L2U A;  3L2V A;  3BFM A;  4M77 G;  1BIA A;  5CIU A;  2DTI A;  2EWN A;  1VQP A;  4M7D F;  2QQB A;  1JBM A;  2DXT A;  2Y4Y A;  4EDU A;  4RMO A;  1VQN A;  5CKB A;  4PNO A;  2O01 E;  3PFS A;  4F7U E;  4C0F A;  1NE8 A;  4E7H A;  5A0L A;  3OYY A;  4M75 F;  3L2Z A;  4M78 G;  2B8A A;  3PMT A;  3H6Z A;  4IUU A;  3PIO A;  1VQO T;  1N8R C;  3RES A;  4BY6 B;  1WGS A;  3I55 A;  3CME T;  1I81 A;  2EQK A;  3KXT A;  4C5I A;  4M77 F;  3MP8 A;  3QZ5 B;  2JVV A;  2E5Q A;  5M9O A;  3G4S T;  1R8O B;  2XI9 A;  3J81 E;  1VQP T;  5GAN d;  3E1S A;  3S3M A;  2LX9 A;  2V8J A;  3BDL A;  3BW1 A;  4VUB A;  5FU6 B;  2I2L A;  3HL8 A;  3LGL A;  3JCM V;  1KQ2 A;  1I5L A;  1Q81 C;  3FDR A;  4RG8 A;  4M78 F;  3OB9 A;  1VQN T;  1QP3 A;  3FB9 A;  1KQS A;  3UPU A;  3SWN A;  4RKU E;  3JCM h;  1KD1 C;  3ASK A;  5GAO m;  3CCS A;  3LGF A;  3BY7 A;  4LDW A;  3CPW S;  2D6F A;  2K57 A;  2ZPB B;  3HRT A;  2XDP A;  2M16 A;  5J3B A;  3I55 T;  1Y7X A;  4XTY A;  3OW2 S;  1MGQ A;  4HCC A;  5GAO n;  1X01 A;  2BKD N;  3P8D A;  4Q5W A;  1VQ8 T;  3HRU A;  5GMK l;  3CCL A;  5HKC A;  4MDW A;  2E65 A;  2LQ8 A;  3C12 A;  1Q7Y U;  2K5I A;  2ZGW A;  2V8I A;  3QDR B;  3QXE B;  5DY9 A;  1FX7 A;  4EMK C;  5LJ3 e;  1W2B A;  2K3X A;  3OY9 A;  3VYH B;  3CBO A;  1YIJ A;  4JDS A;  4PLL A;  4DQ2 A;  4PJO E;  2XDD A;  2CYZ B;  1YBY A;  4JJN K;  1VQ4 T;  2XDB A;  1H3Z A;  3CXC S;  3JCM e;  2DK3 A;  3PMI A;  4R55 A;  3X26 B;  3A8L B;  1JJ2 S;  2F69 A;  4Z02 A;  5CCA A;  3CCE A;  3CCS T;  2QI2 A;  4IKF A;  2C06 A;  1BI2 A;  3RER A;  2A7Y A;  5GAO p;  2DXB A;  1FWZ A;  5D6Y A;  4N0A C;  4C92 C;  5AYF A;  2YHT A;  2LT1 A;  2RJD A;  3WXM B;  4IUQ A;  1KD1 U;  3JCM Q;  4C8Q C;  5I2S A;  3V8L A;  1XOV A;  3LWI A;  5I2M A;  1Q7Y C;  3CBP A;  4M7A D;  1GXI E;  2VXE A;  2LCC A;  2DKG A;  2MF2 A;  2KVQ G;  3WVE B;  5KE2 A;  3INZ A;  1YIJ T;  2DAQ A;  3DLM A;  3MET A;  5GAM e;  1VQM A;  4L5G A;  1QVP A;  4NL3 A;  1M4Z A;  4C92 D;  3M57 A;  1PSF A;  3VYG A;  5A0G A;  1AHJ B;  3CCR A;  4DOV A;  4ZTJ A;  3CCE T;  4C8Q D;  4ZGJ B;  5CR2 A;  2JOY A;  4OMF B;  4FIB A;  3G7Z A;  2XD0 A;  3OYN A;  1YI2 A;  5CVI A;  2MMP A;  2K3Y A;  2BIV A;  1TH7 A;  3L42 A;  3LYI A;  2CS7 A;  2K5F A;  4EMH A;  4M75 D;  2YLB A;  4EMK B;  2IVW A;  5C6S A;  2CGH A;  1K73 U;  3MCA B;  1D3B B;  2LVM A;  4IUV A;  4F7U G;  1JB0 E;  2LTO A;  2QQS A;  1VQK T;  3CCM A;  3S3N A;  5LJ3 j;  5LJ5 d;  3H8Z A;  1ZBX A;  4FSX A;  3TRE A;  1VQM T;  1G3Y A;  2O4X B;  1O9S A;  3QUI A;  2VC8 A;  1BI1 A;  3NTH A;  2EAY A;  4XTX A;  1U8R A;  3VJP A;  3UT1 A;  4C92 B;  2EJG A;  2KK4 A;  4LDU A;  4M7A A;  2KMT A;  3FLG A;  1O75 A;  3CCQ A;  3CCR T;  3DB4 A;  4C8Q B;  3X20 B;  1YI2 T;  4O5V A;  3JB9 G;  2LRQ A;  3M4G A;  4XTV A;  4N0A A;  3GF5 A;  4F7U F;  3FC3 A;  3JB9 J;  1BI3 A;  2K2V A;  4N4I A;  2FYK A;  4M7D A;  3X24 B;  4JS4 A;  1P92 A;  4LDV A;  2DZ9 A;  2R5M A;  3EFS A;  5D6W A;  3CCM T;  3A8G B;  4HT9 A;  1HK9 A;  2RI2 A;  1G3W A;  3M5A A;  1UGS B;  1Y96 B;  5KCO A;  3SDZ A;  5GAM j;  4M75 A;  2VGM A;  2PQW A;  2FVU A;  3E19 A;  3FIF A;  4XTU A;  2EQJ A;  4B9X A;  2PU9 B;  4BDZ A;  4ATO A;  2OTJ T;  4JLI A;  3SWN C;  4C0Z A;  1QW1 A;  2QA4 T;  3CCQ T;  3UDC A;  1M1G A;  1KHI A;  2M1H A;  2RD1 A;  4JRQ A;  4OGC A;  1VQO A;  3JB9 F;  3OS1 A;  4M77 A;  3KBG A;  4C5E A;  5CK9 A;  3CME A;  3OSV A;  2P0Q A;  4XK8 E;  2ZPE B;  3F70 A;  4KT0 E;  4XAX B;  2CZ0 B;  3RKX A;  1WJQ A;  4PJO G;  4A4H A;  3G4S A;  4C5G A;  2OTJ A;  1UGP B;  4M78 A;  3L2Q A;  1KQS S;  4YTL A;  2EQU A;  3WVD B;  2JTM A;  3GNG A;  4X34 A;  1M9S A;  1Q81 U;  2RJE A;  5KCH A;  5GAN h;  5GAN 2;  3CMA A;  4OB1 B;  2X4J A;  3CC4 A;  2RHX A;  2L5Q A;  4E7L A;  1QVF A;  2G3R A;  2RHU A;  3GOX A;  3M56 A;  1UB4 A;  2JNG A;  3SD4 A;  1FXX A;  4J8O A;  3OYD A;  3HFO A;  1YJ9 A;  3JB9 I;  4PJO F;  2RHY A;  2RHI A;  1VQ8 A;  5CKD A;  5CAI A;  3JCM W;  3OMC A;  1G3T A;  2ZPG B;  3PGG A;  4J6Y A;  4N4H A;  3LW5 E;  1W2B S;  4KBM B;  2E6N A;  2GF7 A;  5LJ3 f;  3E9G A;  3RKY A;  3SWN B;  4C5H A;  5J39 A;  2F5K A;  3SFM A;  4RCC A;  4ELZ C;  3QJY A;  4E7I A;  3C95 A;  2EFI A;  2F5T X;  2RK2 A;  1VQ5 A;  3CMA T;  2Y90 A;  2ZCF B;  5GAO q;  3OYM A;  1VQ4 A;  2K4Y A;  3CC4 T;  4KUD K;  4CI0 C;  4EPC A;  2CZ1 B;  5CQX A;  2P0P A;  3PIP A;  5GAN 5;  1YJ9 T;  4OB3 B;  1KHC A;  5GAN 3;  5GMK h;  2EIF A;  3RIR A;  2XKO C;  1XQH A;  1PSE A;  1I4K 1;  2QTX A;  2DTO A;  1KQ1 A;  2HQE A;  4OB2 B;  1VQ9 A;  2X4Y A;  2X35 A;  5GAM f;  3CD6 A;  4XQ3 A;  2CKK A;  2KQW A;  3ZBD A;  4XTW A;  4MML A;  2P4T A;  3MEV A;  4A53 A;  5LJ5 f;  4J5Y A;  3LX7 A;  1VQ5 T;  2DO3 A;  3RKW A;  3M9Q A;  4OVA A;  3QSU A;  4X9D A;  4J7I A;  2LCL A;  2MWP A;  1XNI A;  3CBM A;  4M7A C;  1Q82 U;  1OYX A;  3FRN A;  4C92 E;  2RI3 A;  1WNL A;  5J26 A;  2E64 A;  2YLC A;  2EKO A;  5L8R E;  4C8Q E;  3EAE A;  2RO0 A;  1BI0 A;  2NLU A;  3NTI A;  3OS5 A;  2D9T A;  4HCZ A;  4KUI A;  5GMK e;  3JAM E;  3CCJ T;  3M59 A;  3FJP A;  4M7D C;  2KY9 A;  2GQV A;  5LJ3 d;  5KE3 A;  5GAN g;  3JSC A;  3HSB A;  1VQ9 T;  2DD5 A;  2PVD B;  2FB7 A;  5IN1 A;  4Y28 E;  1VQK A;  4L59 A;  1M5Q 1;  2XID A;  3CD6 T;  3QG1 A;  2HNI A;  2EYQ A;  5I21 A;  2DZC A;  2OTL A;  3JCM d;  4M75 C;  2JN0 A;  3L2W A;  1G3S A;  3OSS C;  4A4E A;  1OZ2 A;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...