4BI8B

Crystal structure of the type vi effector-immunity complex ssp1-rap1a from serratia marcescens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
b'MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTCAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1A
molecule tags Toxin
source organism Serratia marcescens
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi8B01
4BI4A 4BI3A 4BI8B
chains in the Genus database with same CATH superfamily
4J7FA 5CKBA 2XK0A 4CC7A 1KD1U 2L3RA 2HEQA 1D1BA 4OVAA 3VRZA 4M7AC 4P5NA 4M77G 4X9DA 2A3LA 1GCPA 4FT2A 4QQDA 2FYKA 1ZLMA 2BZYA 1VUBA 2QAZA 2WACA 4Z88A 1QCOA 1ZQ1A 2VB6A 2W0ZA 4BI8B 1NEBA 3EFOB 1Q7YU 1KQ2A 2ZCFB 2F2VA 2MF2A 1G3TA 3UA7A 1AVZC 1MHNA 4ZTJA 1AWJA 3CCMQ 3SHWA 5IH2A 3I56Q 3U23A 2E3HA 4BDZA 1M3AA 2KXDA 4RCCA 4C8QE 2K6DA 1Y71A 1FMWA 1VQ7Q 2MOXA 2D0NA 3CCRQ 1FX7A 2DL7A 3X24B 2GFUA 2J06A 2D0QB 2KT1A 3VS7A 4J9CA 4ANJA 5FU7C 3GNFB 4R56A 4X9CA 1QCNA 2M0OA 1PD0A 2XD0A 2VV5A 2ZPGB 3OYLA 2JJ9A 2K5FA 2OAWA 1UDLA 2HL3A 1Y96A 1VQ6T 5I22A 2DL8A 1ABOA 1WYXA 4EMKC 4AG2C 2BZ8A 3OYJA 3V8JA 4MZPA 3DB4A 1SKUB 4R55A 4M7AA 1MNEA 4C92G 4KT0E 1M2VB 2HKNA 2WSCE 1Q82U 1OOTA 5GAMg 3OBYA 1I07A 4XU0A 1VQ6Q 1M90R 1T3SA 1G3WA 2RQRA 1MV3A 3A8OB 4C0GA 2X9HA 5DM7R 3PGGA 2MK5A 3JCMc 4E47A 2RD1A 2J6FA 3BE3A 5GMKe 2BZXA 2DZCA 2MWOA 2VXFA 4AFZC 2ZPHB 1VQ5T 1JXOA 1SPKA 4FYXB 1WNLA 2JTFA 1JO8A 3OYYA 1BI2A 1QP2A 4J6YA 4FYWB 4M7DC 1NLOC 2L89A 3QJYA 1G2BA 2GF7A 2FRYA 1AT1B 3GLXA 2VC8A 2QEXQ 5A2QE 5LJ5e 3RIRA 3C0CA 1YI2Q 3OYGA 1VQNT 1I0CA 2HBPA 2EJFA 1I4K1 5GMKh 1YIJA 1Y57A 3EG2A 2OI3A 3VUZA 3JCMJ 2A36A 4OP0A 1KC8U 1VIFA 3CBPA 2E41A 5CAIA 5IXFA 1JQQA 4HXJA 4BI3A 3QDRB 4N4GA 1R0BG 4M7AE 1N27A 1UG1A 3GF5A 5GMKi 1KJWA 2DMOA 2DJZA 4AG1C 2OAUA 2YHTA 3A1PA 1WHHA 4AT1B 1G8XA 5D6WA 5LJ5f 1JJ2P 2LCLA 2DL5A 1QCFA 2DD5A 1HYOA 4X34A 4RTVA 1ABQA 3CQTA 2CZ6B 2AIRB 1ARKA 2K2VA 3JV3A 2KRMA 1AZGB 2X3WD 4FU6A 4MDWA 4M75A 4M7DF 2F69A 3JCMP 1OZ2A 3E2UA 2QA4A 3QDFA 3HRTA 2DPPB 1YP5A 2DYBA 2RK2A 1VQ8A 4BB7A 5CKEA 3OW2P 2J7IA 2KMTA 4C92C 1IXDA 2YT6A 4M75E 2RI3A 3LYIA 1QKWA 2FPEA 1Q81R 3JCMQ 4QVDA 1RLPC 1K9MR 1RACB 3QYHB 4IIOA 3RKXA 1PHTA 2F1LA 3OYIA 2RJDA 4ZGDB 1H3ZA 5LJ5j 1TUCA 2DIGA 1XNIA 2DBKA 3X26B 3NMZC 2A28A 3MJXA 3GIBA 2HL5C 1K1ZA 1YJNT 1D0ZA 1VQ4A 3LWHA 4DEXA 1AEYA 4OMPA 3X28B 1E7OA 2EIFA 1XQHA 2O2OA 2XI9A 3KFVA 2QEXA 1AWXA 3QBYA 3I9QA 2BE9B 1WX6A 4GLMA 2LX9A 1RAHB 1TSFA 1ACMB 2OTLQ 1D0XA 2D6FA 4XAXB 2P0KA 4Q5WA 2I0NA 4Z8AA 3M55A 1WQ7A 5GJWB 1Q81U 1BCMA 2VKNA 3TU4K 2LC4A 4J5YA 2RQVA 2DILA 3M0PA 3RUXA 1PRMC 4R0KA 3CC7T 1Q86U 1VQ9T 1B07A 3CCLT 3RKWA 2DL3A 2FPDA 5GAMe 1NBEB 2CP0A 3JCMf 3VV0A 5GAOn 2EAYA 2ED1A 2DF6A 2K57A 3FRNA 2JUFA 5FROA 1MUZA 1NJIU 3ULRB 5KCOA 4YTLA 4M75F 1QQJA 2EGCA 2KRNA 2DRMA 1D1CA 3QWYA 1VQ4Q 2YSQA 1D1AA 2K3YA 2XIDA 5HK3A 4IUPA 2JMCA 3UA6A 1VQ5Q 4C5HA 5ECAA 2JTMA 4DBRA 4PJOF 4PLLA 3CMAT 2DETA 4DQ2A 2DIQA 1Q86R 1UECA 2FHDA 2ATCB 2JNGA 2R57A 1YHQT 2EGEA 4EMHA 3G4SA 1KQSP 2DX1A 2YUNA 2RHIA 3EH2A 2A37A 3RERA 3ME9A 1JXMA 5GAMh 3QZ9B 4CC3A 2C0OA 3R6NA 2F5KA 3SDZA 3S6WA 2KBTA 5HKCA 4JUVA 2DM1A 3CCEQ 4DEYA 1JEGA 4JRQA 2R5MA 3SWNB 3VS3A 5FRNA 4PLIA 2NLUA 2FZGB 2M02A 5DLOA 1ZUKA 3HP9A 4M75D 1QLYA 5CIUA 1Y96B 4JZ4A 2QGGA 2KGTA 1VQ9Q 1ZSZB 1TOVA 3CCUT 2YDLA 3VKIA 1R8OB 3ZFJA 1U5SA 2QQSA 3OMGA 1YI2T 1YN8A 3X25B 4JS5A 3OYMA 2WSEE 3HFNA 1U06A 2K3BA 4Z89A 3RMSA 1NYFA 5DLQE 3I5SA 1GBRA 2E4HA 3N5BB 4M7DA 3OYDA 2CKKA 2AKKA 3I56T 2Y4XA 4HVVA 5D7UA 2QTVA 1QVPA 2SRCA 1UB4A 3PE0A 5IHNA 4BACA 1FMKA 1R0CB 2A08A 2V1RA 3V7CA 2D8HA 3RESA 3GP8A 1GL5A 4XU3A 2KE9A 3I5RA 5I2SA 1UTIA 5CQYA 3OY9A 3H8ZA 4EPCA 1EZZB 2PVDB 1YHQQ 1MMNA 2RMOA 3WVEB 3OMCA 4DBQA 2YRCA 3C4SA 2BTTA 2PNIA 2DK3A 2GTJA 3CXCA 1NLPC 3M0SA 3CPFA 4PK4A 2L5QA 1PRLC 2GQIA 5FU6B 3SWNA 1FMVA 5GANh 3MEUA 4XTYA 4UC4A 1TXQA 3CEYA 2EJ9A 4C5IA 2PUKB 2GNCA 4J9BA 1YJWQ 3VS5A 3UF4A 1RABB 3MP6A 3CCMT 1X6GA 3HRSA 1ZA2B 2CSIA 2G3RA 1VIEA 1C6VX 1Q7YR 5LJ5g 3ZBDA 1QKXA 5KYXB 4OGEA 1UHCA 2FZKB 5KYWA 3EAEA 4F7UF 1B34B 2CZ7B 2COYA 1G5VA 4XU2A 3F70A 4M7DG 1SSFA 3HL8A 4PFPA 3OQ5A 1RI9A 5FU7B 1YITT 2MYSA 2I2LA 2JVVA 5CKDA 1X6OA 2LTOA 1W1FA 3CCQA 3CBOA 3QKJA 3PTAA 3CC4Q 4QVZA 3VUBA 1GCQA 1MV0B 3C95A 1U8RA 2KYBA 2DA9A 4JZ3A 1IGQA 3CXCS 4M77B 3PMTA 1OPKA 3I55A 1LOJA 2D9TA 1ZSZC 3E9GA 2NWMA 2XG8D 4ELZC 4M78F 3VYHB 4M7AB 4A4KA 4N0AA 4XQ3A 1PNJA 4OB1B 3CC4T 3CCSQ 4FL6A 1I8FA 5CKFA 2K2MA 1KC8R 2LJ0A 1WQWA 4FW2A 1HD3A 2K5LA 2BUDA 2RHUA 1IZ6A 3G7ZA 1WHKA 4LD9K 2QGFB 3L2UA 4IIMA 4OMFB 1YI2A 3REBB 3TVTA 2P0QA 3E9FA 2FRWA 2DLPA 3EG0A 3TSZA 4KH1B 3RDVA 1K9AA 1UFFA 1KQ1A 3H9NA 3OS5A 3S3NA 5IHKA 1B3QA 1BB9A 2OTLT 1VQKT 3RR6A 1MMDA 3JCMg 3A8MB 2MWPA 3WVDB 2DXCA 3CPWA 1YWPA 2RH2A 1YJ9T 5DY9A 5HCKA 1UJ0A 5GAOp 1Z9ZA 3HFOA 2DXBA 1HXDA 3FJPA 2CP5A 2FVUA 5D6XA 4B9WA 1IGUA 2LJ3A 2PQWA 2RB6A 2YXYA 2EGAA 4OMNA 1ZSZA 4QW2A 1MNDA 3PMIA 4MMKA 2VUBA 4BE1A 5GAOl 4NS5A 1VQLQ 5A0GA 1OI1A 4ELYC 3AT1B 3I35A 4JRPA 4IURA 5J26A 5L8RE 3EGUA 2IG0A 3MP1A 1M30A 1YIJT 3C12A 4FCYA 1VQ8T 2M51A 3L2WA 1YFNA 2X51A 2NUTB 4IUTA 5GJVB 5GAMj 2O88A 3EG9A 3EG1A 1E6HA 3PVLA 4RTWA 3M0UA 2FL7A 1N8RU 4M7DD 3CCSA 1X6BA 3QUIA 1IRXA 1YIJQ 2RHZA 4ESRA 2LP5A 1J3TA 3FEOA 3G6EA 2DFUA 2LQKA 5LJ3f 4LE9A 3FJ5A 2PVOB 2RJCA 4C8QG 3CCLA 2DERA 1Y7XA 3OBWA 4J9GA 4ZGEB 1GFCA 1TS9A 3MEWA 4FSSA 3NGPA 2JS0A 3RNJA 2ZAEA 4J7IA 3A5ZB 2E65A 4WF2A 2LVMA 4KGZB 3L2ZA 1IREB 2QTXA 4L59A 2CH4A 5LJ3h 3PT9A 3LX7A 1KQSS 4AFUC 1HK9A 2EQJA 1S72A 2KVQG 4RTZA 3SEMA 3NTHA 3H0HA 1YJNQ 1VA7A 5LJ3d 1PD1A 3EFOA 4EMKB 1Z9QA 2EYYA 2LQNA 4DOVA 3WXMB 3META 1SHFA 5IAYA 2E5KA 3BFMA 2GCXA 4B6MA 2QDYB 4JJBA 1C1AA 3P8DA 1PSFA 3QWXX 2LMJA 4NL3A 1VQOA 1TU0B 1GRIA 1BI3A 2H3EB 3OYFA 1VQOT 2K79A 3NHNA 2E70A 1X75C 4F7UG 3OYHA 1W2BP 1Y07A 4C0ZA 1VQMQ 1M1KR 2Y4YA 2XDDA 4CC4B 1UGSB 2P0PA 3CMAQ 4OGCA 2KI7A 2XICA 1RAAB 1NYGA 4E7ZA 4CRIA 1P92A 1AZEA 2R58A 4L5GA 3MCAB 1BKBA 2CREA 2AHJB 1TTHB 5GAN2 5KYNA 5LJ3j 2EWNA 5C6SA 4ZGJB 3H6ZA 4PFOA 5LJ3g 2CUBA 1PC0A 5IXBA 1NG2A 1EIFA 2HQHA 5FWCA 1RADB 1WHJA 4D8KA 1B34A 1O75A 5GAOr 2HDAA 3CCRA 3OYBA 1YITA 4JJNK 1RAGB 1T0HA 3CXCP 5GMKj 1D0YA 2KSSA 3URGA 4RTUA 1XTDA 4C8QA 1M1KU 2RQUA 1LNXA 1LJOA 4J9EA 2DL4A 4C0FA 5KH6A 4PJOG 2V8KA 2F2XA 2PUOB 1XJWB 1C0MA 3LH5A 4V2SA 5KYWB 4LN2A 1NZ9A 1YCSB 3CBMA 3OA6A 2HKQB 4HVWA 2YUQA 3H41A 2FB7A 3JCMd 5FW9A 3CCRT 1UHFA 3NTIA 2BKDN 2A7YA 2X35A 4QVCA 3GOXA 2ROTA 1NJIC 1XOVA 4E7KA 4RTXA 2MCNA 2CUDA 1GFDA 2AK5A 5I21A 5L23A 2NUPB 4HCBA 4M78G 1KFZA 3A98A 3GPLA 3QXEB 2DXUA 3CC4A 2M9UA 5GAOm 4A54A 2VASA 2DTHA 3PVQA 4J6WA 2ZPIB 1EX4A 1N9RA 4F04B 1RAEB 5GAN8 1VQNA 5KCHA 1YWOA 2HBWA 4HT9A 2EJGA 1KK7A 6AT1B 3CCJA 3FC3A 3JCMh 1H641 4VUBA 3A8LB 2X4YA 1LPLA 2JW4A 4A63B 4E7JA 1M1FA 1NPPA 2EBPA 2EYXA 1UGQB 3G71A 3THKA 1KSWA 2P84A 5GAN6 2GQVA 1B7TA 1G83A 2DYIA 4C8QB 3JB9D 3NPFA 1MGQA 1AWWA 3CC2A 5M9OA 3DKMA 2DAQA 2VGMA 4RG2A 5CQXA 3UATA 2QQBA 2RI5A 2EQMA 3SFMA 4FT4A 3X20B 1WZOA 1KD1R 2JT4A 5LL6S 1D09B 4OB0B 4LDWA 3CCQQ 4HT8A 3V8LA 1QMCA 1JJ2A 3M5AA 4Y28E 4M7AF 1T3LA 1CSKA 1QWEA 1M90U 4KRTA 2O9SA 4DBFA 4M75G 2L3SA 4KULA 3TREA 3EGDA 5GANe 1WA7A 4OB2B 4F7UA 4PJOB 3LWIA 3CCJQ 4AMCA 1M1KC 2B86A 1M2OA 5FU6C 1JB0E 3PFSA 4HKEA 1PKSA 4BE0A 3P8HA 1TWBA 1PM3A 3G4SQ 2E12A 1QWFA 2ED0A 2XDBA 1WHGA 4FYYB 3EFRA 2ZZDA 5GAOq 2K9GA 2C06A 2NUZA 3M0TA 2ZPEB 4C8QD 3BDLA 1V76A 2RF0A 1S1NA 3ER0A 4MMLA 2ZPFB 4IUUA 1X2QA 4J83A 2DO3A 1WXBA 4F17A 1NEGA 3EG3A 1OX9A 4PJLA 4A4EA 2K4YA 4AFQC 1VQPT 2PU9B 2NUTA 1WJSA 4M78B 1E6GA 1M8MA 3P8BB 1SSHA 2DVEA 2GBQA 5GMKm 3OS2A 1VQ4T 1I5OB 2V26A 2XHCA 3M59A 1Q95G 1RAIB 2KXCA 2SEMA 2E6ZA 2OTLA 1VQ9A 2M16A 1N6AA 2EVRA 4ZN1A 2X4XA 2CS7A 3CCUA 3UPUA 3O5ZA 3M9QA 2DRKA 1OU9A 1RL2A 2HSPA 4M77C 1BIAA 1IB8A 1ZUUA 2RJEA 4M4ZA 1FXXA 4A4FA 1JJ2S 1X2KA 1OPLA 2RPNA 4GBQA 1UUEA 4RMOA 1TUDA 3LLRA 5HK0A 1V29B 3M4YA 2E6NA 2KAFA 1UGPB 3RKYA 1BBZA 1OU8A 2JMAA 4J8OA 2QA4Q 2QEXT 4N4HA 2L2PA 1WHLA 2LNVA 1K0XA 3JB9J 4J9IA 1KHIA 4QKUA 4C92A 1X27A 2DKGA 2OTJQ 4LUDA 4EDUA 3RBBB 2YLCA 1W2BA 3CMEQ 3M53A 2EQUA 1SRLA 1YJWA 3HRUA 1S72T 1WJQA 1VQ8Q 3QSUA 1WXUA 2CYZB 4F16A 4NL2A 1U3OA 3QG1A 4HCZA 3G6EQ 1N8RC 1KD1C 3HPWA 2HMAA 3A8HB 5AT1B 4ORZA 4M75B 1TG0A 2EYQA 2RN8A 8ATCB 2X4JA 4M7AD 1HJDA 2YRVA 5FLXE 1TUGB 3OS1A 2KDSA 2RHXA 3MO8A 5CVIA 3DLMA 1V1CA 1YNZA 2LJ1A 3OW2S 2KEAA 4RKUE 2VYTA 9ATCB 5GAN3 1K8AU 3GBQA 3VS1A 2LRQA 1WJRA 4CC2A 4FM4B 3JB9F 1SEMA 2CP2A 1KHCA 1GCQC 4OB3B 1OZ3A 1QVFP 3CC7Q 3TCJA 4M77F 2W10A 1JRIA 4FIBA 1G3SA 4LDYA 4O6JA 1A0NB 2E3IA 1EFNA 2CT4A 3MEAA 2C0TA 5GAN5 1MMAA 1WI7A 4E2FB 1UJYA 1W70A 5KYXA 2FO0A 1GBQA 3CC2T 4PNOA 1Q86C 5LJ3e 2CZ0B 3NFCA 4M77A 3TEEA 1BCOA 5CR2A 1ZX6A 3S3MA 2V1QA 1N8RR 3G71T 2JN0A 4JPBW 4KUDK 1VQ7T 4RG8A 2ZPBB 4XTZA 2RNAA 2LCCA 4M78A 3JB9I 2F5TX 3L2VA 3JB9H 3H0IA 1VOMA 2QQ9A 4M77E 1U1TA 2QQRA 1UE9A 2JOYA 3FIFA 3CCVA 1F1BB 1M27C 4LNPA 4ZN3A 2KYMA 1HSQA 3CCJT 1VQKA 4JRKA 2GGRA 4ATOA 1WDXA 2HD0A 4C92E 1QVGP 2F2WA 2YLBA 1QVFS 2CSQA 3BDUA 2KY9A 4GY5A 4OF1A 4XTVA 1K73U 4CI0C 3EGXB 3JB9G 4E7LA 4JJCA 2RQWA 3CCLQ 2PZ1A 4C92D 4L6V5 2RA2A 1OV3A 1ZHIA 4M7AG 2C0IA 1Q82C 1K76A 3DLLA 2EPDA 2HZYA 1D3BA 2HQEA 3QPHA 5KYUA 5GAN4 1WIEA 3FLGA 4PL6A 5IT9E 2G6FX 3IQLA 3E19A 3VU3C 4PJOA 1M4ZA 2LZ6B 3KBGA 3L2RA 3LGFA 4PJNA 4WTOB 1H8KA 1BI1A 3JCMb 2DBMA 1LCKA 4PKCC 1YJNA 2HAXA 2ROLA 5D6YA 2KNBB 1Q81C 4B9XA 1M90C 2DJQA 2OTJA 4RCBA 1K73R 1SRMA 4LDUA 1YBYA 2BE7D 4E7HA 3OYEA 3OW2A 1NJIR 4TVRA 3Q1JA 2QASA 4C8QF 1ZBJA 2JTEA 3C94A 5CCAA 2J6OA 4MZTA 4BE2A 4DBHA 3MEVA 3ZEHA 4RUGA 4EMKA 5LJ5d 1X69A 4JJDA 1G3YA 3QJ6A 2VVKA 4JLIA 1RAFB 1K73C 1X01A 5A0LA 3JRZA 2DZ9A 3LW5E 3CCVQ 1W6XA 4ZTFA 2QI2A 4BD3A 3CCMA 4KGVB 3CCET 1RUWA 2O31A 4C5GA 1QW1A 1VQKQ 3BY7A 1WLPB 2FG0A 4HCKA 1IO6A 1ZBXA 4AFSC 2CGHA 4ZNXA 3MKDA 2B8AA 3L2QA 3A8GB 1JBMA 4KGXB 2EQKA 2E1HA 3CPWS 4E7SA 3O8VA 4XTWA 2L0AA 1K9MC 3RMQA 3OYCA 3JCMV 1TH7A 2E5QA 2ECZA 4N4IA 2MAMA 5LJ5h 2H8HA 3ZL7C 4KBMB 2XDPA 3UDCA 3UT1A 1BI0A 1OULA 3M58A 3OB9A 3QHSA 2L3PA 4QQGA 2H3JA 2DTOA 2D1XA 4JLGA 1OYXA 3OYAA 2KRSA 2DEQA 1QVGA 1KG1A 2X4WA 3L42A 4BY6C 4QT7A 4M7DB 4PJOC 2LNHB 5J3BA 4XK8E 5CKHA 1VQ5A 3VRYA 1M9SA 2YWWA 4F14A 2X3XD 3I56A 3LGLA 1AD5A 4PJOD 3JSCA 2LX7A 2K7AA 1Q82R 1VQLT 5C0MA 1VQ6A 3EGXA 2DE0X 2XU8A 3EFSA 2XMFA 3VS0A 3HHTB 3GNGA 2KK4A 4M78E 2CH4W 4C92F 1QVGS 2Y90A 3G6ET 3JCMW 3M0RA 2LQ8A 3NTKA 3V7RA 1YJ9A 5EC7A 1YJ9Q 4HVUA 1VQLA 3HSBA 4C8QC 2HQXA 4FW1A 2EQIA 1AOJA 1PKTA 5FRMA 1IHWA 5IN1A 2OTJT 2FPFA 3HKSA 5KE3A 1NM7A 4XTUA 5J39A 4Y91A 2WSFE 1LVKA 3EG9B 3MP8A 1CKAA 3R6OA 3CCVT 4M78D 5GAMd 2L3QA 1Y0MA 1K8AC 2YUOA 3SB2A 5FWBA 2LCSA 4FSXA 2CP7A 2EFIA 4C0DB 1CKBA 4RTYA 4PJOE 2O9VA 2Z0WA 2QQAA 4D8DA 3E1SA 3OS0A 2RI2A 4IUQA 1BU1A 4N0AC 3G4ST 2COWA 2DXTA 4JDSA 5AYFA 1X43A 2EYWA 1NE8A 4C5EA 3REAB 3D7SB 1UEBA 1KIKA 1ZSGA 2OX7A 1N9SA 2AZSA 1QVFA 3OYKA 2KR3A 4F7UB 4BDYA 2RHYA 3I55T 4HCCA 2VXEA 2GFAA 3HTRA 2O4XA 1WXTA 3M0QA 3CD6T 3M57A 2ZGWA 3UWNA 1UGRB 4II1A 2IVWA 4D6WA 1VQ7A 2RQTA 1PG5B 2AKLA 2LQWA 3J80E 2IPOB 3G71Q 4JRIA 2ENMA 3JCMe 2COZA 1D3BB 1VQOQ 2EKHA 2MI6A 3CC2Q 2PTKA 2A0FB 3SD4A 2O01E 4OMQA 3J81E 2DTIA 3OSVA 4J9HA 2CP6A 3G1JA 3VJPA 4OMMA 2VGNA 4MDXA 2DD4A 1M3CA 1SG5A 3CMET 3MPUB 4GLKA 2NUPA 4PJJA 4IKFA 3ASKA 1QP3A 1K4US 1M1GA 2OJ2A 1M8VA 2AT1B 4PFZA 2QK0A 2HSEB 2K5IA 3KXTA 2MMPA 4BUGA 3QO3A 3FB9A 2RM4A 1PWTA 3TQ7P 3CPWP 3PIOA 1VYVA 2JZ2A 1T0JA 3VYGA 2QG9B 1N5ZA 3J7AF 8AT1B 1I5LA 3PNWC 4OMLA 2J05A 1O9SA 1M3BA 5HY6A 3TSWA 4HA8A 5I11A 4LD6A 3QYGB 3KUFA 5GAMf 1RLQC 2CDTA 1H3HA 1JU5C 2FZCB 1OEBA 4IUVA 3JCMX 4LXCA 2HCKA 1S72Q 3EH1A 3EGDB 2L8DA 3M56A 3VS2A 1I81A 1WPYA 4O5VA 4M78C 2O4XB 2E10A 4EMGA 1YJWT 1VQPQ 4XU1A 4A4HA 2IIMA 4EIKA 1W2BS 2R5AA 2QA4T 1M2VA 2J6KA 3VS4A 4RTTA 3CMEA 4Y92A 4OMOA 1K0SA 4M75C 3L1AA 4FYVB 1I1JA 2HNIA 3V8KA 1VQMT 1ZA1B 2CT3A 1BYMA 2RO0A 4A4GA 4J9DA 5GMKl 3OYNA 1AHJB 1WHMA 4KH0B 5GANd 1IHVA 4J9FA 3CCUQ 2KT8A 2GTOA 1VQMA 5IHIA 3OSSC 3FDRA 1YITQ 5GANf 3CCST 5CO7A 1AWOA 1K9MU 3MHXA 4XTXA 3PIPA 5A0DA 1K8AR 4M77D 2E64A 5GANj 4PJMA 2M1HA 1YCYA 3QIIA 4JS4A 4F7UE 4WCIA 1PCXA 1FYNA 1KQSA 1ZUYA 2YUPA 2DNUA 4Z02A 1BIBA 1VQPA 4QQ6A 3EHQA 2LT4A 3DB3A 1KC8C 2V8JA 2PVGB 4LDVA 1MMGA 2QDLA 2FEIA 4LDXA 2KROA 5I2MA 1OX8A 3INZA 3H0FA 2QXFA 5KYUB 3M54A 4DA4A 2DEUA 3BW1A 4E7IA 2DVJA 3CMAA 2JXBA 1GXIE 2V8IA 1U1SA 5CK9A 2BIVA 2MPXC 5GAN7 4C92B 1SHGA 2XKOC 2LDMA 2ABLA 2KQWA 2QYZA 2JS2A 2EKOA 2RK1A 4ME7A 2P4TA 2RJFA 1DJ7B 2K3XA 1PSEA 1R77A 1BK2A 5GANg 3CCQT 2MIOA 1RI0A 5KE2A 2JM8A 1NPRA 4LUEA 3EHRA 3QZ5B 4E6RA 3CC7A 4BI4A 2EW3A 7AT1B 3JAME 5KYYB 1WFWA 5KYYA 4M7DE 2AZVA 1YHQA 3M4GA 4DOWA 4K11A 2JM9A 1SF9A 2VWFA 2YRDA 2D8JA 5EG2A 1OQKA 2P4RA 1WGSA 1W4SA 3S3OA 3CD6Q 3CD6A 1UGVA 3VS6A 3T9NA 2CZ1B 2M0YA 3AHUA 1VQNQ 4C0DC 3I55Q 4X1VA 4KUIA 2EYZA 4J6XA 3SWNC 2CP3A 2LT1A 3CCEA 4A53A 1Q7YC 2ESWA 4NOYA 3V7SA 1FWZA 1M5Q1 1VYUA 1VYTA 4BY6B 1H92A 4MZMA 2NYSA 3LH0A
chains in the Genus database with same CATH topology
4J7FA 3CPWS 2CKKA 5CKBA 2XK0A 4A54A 2DTHA 3I56T 2Y4XA 3O8VA 4XTWA 1KD1U 2L3RA 1QVPA 2ZPIB 1N9RA 1UB4A 4J6WA 1K9MC 3RMQA 3OYCA 4BACA 3JCMV 1TH7A 2E5QA 4OVAA 5GAN8 1VQNA 4M7AC 4P5NA 4N4IA 2MAMA 4M77G 4X9DA 5KCHA 3V7CA 5LJ5h 4HT9A 4KBMB 2EJGA 2XDPA 3RESA 2A3LA 3GP8A 3UDCA 3CCJA 3FC3A 3JCMh 3UT1A 4FT2A 1BI0A 4XU3A 4QQDA 3M58A 1H641 3OB9A 2FYKA 3QHSA 4VUBA 1VUBA 3A8LB 2WACA 2X4YA 4QQGA 2H3JA 2DTOA 4JLGA 1ZQ1A 5I2SA 1OYXA 4E7JA 1M1FA 5CQYA 4BI8B 3OYAA 1NPPA 3OY9A 1Q7YU 3H8ZA 4EPCA 2DEQA 1UGQB 2ZCFB 3G71A 1QVGA 2X4WA 1KQ2A 1KG1A 2PVDB 3WVEB 2MF2A 3OMCA 3L42A 5GAN6 1G3TA 4BY6C 2GQVA 3C4SA 3JB9D 4M7DB 4C8QB 4PJOC 1MHNA 5J3BA 1MGQA 4XK8E 4ZTJA 5CKHA 1VQ5A 3CC2A 5M9OA 2DK3A 3DKMA 2DAQA 3CXCA 1M9SA 2VGMA 4RG2A 5CQXA 3I56A 2QQBA 2RI5A 2EQMA 3CPFA 3LGLA 3SFMA 4BDZA 4FT4A 4PJOD 3JSCA 3X20B 2L5QA 4RCCA 4C8QE 5FU6B 1VQLT 1Y71A 5C0MA 3SWNA 1VQ6A 2XU8A 5LL6S 5GANh 1FX7A 3X24B 3MEUA 2GFUA 3EFSA 2D0QB 3HHTB 3GNGA 2KK4A 4OB0B 4LDWA 4HT8A 5FU7C 3GNFB 4XTYA 4UC4A 3V8LA 4M78E 3CEYA 2EJ9A 4R56A 4C5IA 2PUKB 4X9CA 4C92F 1JJ2A 1QVGS 3M5AA 2M0OA 4Y28E 2Y90A 2XD0A 2VV5A 2ZPGB 3MP6A 3G6ET 4M7AF 3JCMW 3OYLA 3CCMT 1M90U 2LQ8A 3HRSA 2G3RA 3NTKA 2K5FA 4KULA 1VIEA 4M75G 3TREA 3V7RA 1YJ9A 1Y96A 5LJ5g 1VQ6T 5GANe 3ZBDA 1VQLA 4OB2B 4F7UA 3HSBA 4C8QC 3LWIA 2HQXA 4PJOB 4OGEA 5FRMA 1M1KC 3EAEA 4EMKC 5IN1A 4F7UF 2OTJT 5FU6C 1B34B 2CZ7B 3HKSA 5KE3A 1JB0E 3PFSA 4HKEA 3OYJA 4BE0A 1G5VA 4XU2A 3F70A 4XTUA 5J39A 3V8JA 4MZPA 4M7DG 4Y91A 1SSFA 2WSFE 3HL8A 3DB4A 3OQ5A 5FU7B 4R55A 3P8HA 1YITT 2I2LA 4M7AA 2JVVA 4C92G 2E12A 4KT0E 5CKDA 1X6OA 2LTOA 2WSCE 3MP8A 3R6OA 3CCVT 3CCQA 4M78D 5GAMg 5GAMd 1Q82U 3CBOA 2XDBA 1K8AC 3QKJA 3PTAA 3EFRA 2ZZDA 3SB2A 4QVZA 3VUBA 5GAOq 4FSXA 3OBYA 2C06A 3C95A 2EFIA 4C0DB 2ZPEB 1U8RA 4C8QD 4PJOE 3BDLA 2QQAA 3CXCS 4M77B 3PMTA 3ER0A 4MMLA 2ZPFB 1LOJA 4XU0A 2D9TA 4IUUA 4J83A 3I55A 2DO3A 3E9GA 3E1SA 3OS0A 2RI2A 2XG8D 1G3WA 4IUQA 4M78F 4ELZC 3VYHB 3A8OB 4N0AC 3G4ST 4C0GA 4M7AB 5DM7R 3PGGA 3JCMc 4A4KA 2DXTA 2K4YA 4A4EA 4E47A 4JDSA 1VQPT 2PU9B 5AYFA 2RD1A 4N0AA 1WJSA 4M78B 4XQ3A 3CC4T 4OB1B 1NE8A 5GMKe 4FL6A 1I8FA 4C5EA 5CKFA 3P8BB 2DVEA 2DZCA 1UEBA 2MWOA 5GMKm 1WQWA 3OS2A 2VXFA 1N9SA 1VQ4T 2K5LA 2BUDA 2RHUA 1QVFA 1IZ6A 3G7ZA 4LD9K 2ZPHB 3OYKA 1VQ5T 4F7UB 2XHCA 3M59A 4BDYA 2RHYA 3I55T 1WNLA 3L2UA 4OMFB 1YI2A 2JTFA 4HCCA 2E6ZA 2VXEA 3OYYA 1BI2A 2OTLA 2GFAA 1VQ9A 2M16A 1N6AA 1QP2A 2O4XA 2X4XA 4J6YA 4ZN1A 4M7DC 2CS7A 2L89A 2P0QA 3E9FA 3QJYA 3M57A 3CCUA 3CD6T 3UPUA 2ZGWA 3M9QA 2GF7A 3UWNA 1UGRB 4II1A 3GLXA 3L2VA 2IVWA 4D6WA 2VC8A 1VQ7A 1RL2A 4M77C 3J80E 5A2QE 5LJ5e 1BIAA 4JRIA 2RJEA 1KQ1A 1FXXA 4A4FA 3OS5A 3RIRA 3S3NA 1JJ2S 3JCMe 1D3BB 2OTLT 2MI6A 3OYGA 1VQNT 4RMOA 3LLRA 5HK0A 1V29B 2HBPA 2O01E 3SD4A 3M4YA 1VQKT 2EJFA 1I4K1 2E6NA 5GMKh 3J81E 1YIJA 2DTIA 2KAFA 1UGPB 3OSVA 3RKYA 3A8MB 3JCMg 4J8OA 3VJPA 2MWPA 3VUZA 2QEXT 3JCMJ 3WVDB 2DXCA 4N4HA 4OP0A 2VGNA 2LNVA 3CPWA 1KC8U 3JB9J 4MDXA 2RH2A 1VIFA 2DD4A 3CBPA 1KHIA 5DY9A 1YJ9T 3CMET 4GLKA 2E41A 4C92A 5CAIA 2DKGA 4IKFA 5GAOp 3ASKA 1QP3A 3HFOA 2DXBA 4BI3A 1M1GA 1HXDA 1M8VA 3FJPA 3QDRB 4N4GA 4EDUA 1W2BA 2YLCA 2FVUA 4M7AE 1N27A 5D6XA 3GF5A 2K5IA 5GMKi 3M53A 2EQUA 3KXTA 1YJWA 3HRUA 2DJZA 4B9WA 1S72T 2MMPA 2OAUA 2PQWA 4BUGA 2YHTA 2RB6A 3QO3A 1WJQA 3FB9A 3QSUA 2RM4A 2CYZB 4NL2A 5D6WA 3QG1A 5LJ5f 4QW2A 3PIOA 4HCZA 2LCLA 2DD5A 3PMIA 4MMKA 4X34A 2VUBA 2JZ2A 4BE1A 5GAOl 1N8RC 2CZ6B 4NS5A 3VYGA 1KD1C 3HPWA 5A0GA 1OI1A 3J7AF 3A8HB 2K2VA 4ELYC 1I5LA 3PNWC 4IURA 5J26A 4FU6A 5L8RE 4JRPA 2IG0A 4M75B 4M75A 3MP1A 4MDWA 4M7DF 2F69A 3JCMP 1OZ2A 2EYQA 1YIJT 3C12A 2X4JA 2QA4A 4M7AD 1O9SA 1VQ8T 3HRTA 2DPPB 5HY6A 2YRVA 3L2WA 4HA8A 2RK2A 1VQ8A 4LD6A 4BB7A 5FLXE 3QYGB 4IUTA 5CKEA 2KMTA 3KUFA 4C92C 5GAMf 5GAMj 2KDSA 3OS1A 2RHXA 4M75E 2RI3A 3LYIA 3MO8A 2FL7A 4IUVA 5CVIA 1N8RU 4M7DD 3DLMA 3CCSA 3JCMX 3QUIA 3OW2S 3JCMQ 4RKUE 2L8DA 4QVDA 2VYTA 3M56A 2RHZA 1I81A 5GAN3 1WPYA 1K8AU 4O5VA 2LRQA 1WJRA 4M78C 3FEOA 3QYHB 2O4XB 3RKXA 2E10A 3G6EA 4EMGA 3OYIA 2LQKA 2RJDA 4ZGDB 1YJWT 1H3ZA 4FM4B 5LJ5j 4XU1A 2DIGA 1XNIA 5LJ3f 3X26B 4A4HA 3JB9F 2PVOB 1KHCA 1W2BS 2R5AA 2RJCA 4OB3B 1OZ3A 4C8QG 2QA4T 3CCLA 1YJNT 3GIBA 3TCJA 1VQ4A 4M77F 3LWHA 1Y7XA 3CMEA 1JRIA 3OBWA 4ZGEB 4M75C 4FIBA 1G3SA 4LDYA 3X28B 3MEWA 2EIFA 4O6JA 1XQHA 2XI9A 3L1AA 3LH0A 2QEXA 3QBYA 3MEAA 4J7IA 3A5ZB 2E65A 2HNIA 2LVMA 4WF2A 3V8KA 1VQMT 1BYMA 5GAN5 2LX9A 2RO0A 3L2ZA 4A4GA 1IREB 2QTXA 4L59A 5GMKl 3OYNA 5LJ3h 3CC2T 3PT9A 4PNOA 1Q86C 3LX7A 1AHJB 1KQSS 1HK9A 2EQJA 5LJ3e 2CZ0B 1S72A 3NFCA 2KVQG 4M77A 5GANd 2D6FA 3NTHA 3TEEA 4XAXB 2P0KA 5CR2A 4Q5WA 3M55A 3S3MA 3G71T 1WQ7A 1VQMA 2JN0A 3OSSC 3FDRA 5LJ3d 1Q81U 3TU4K 1VQ7T 4RG8A 2ZPBB 5GANf 4XTZA 4EMKB 3CCST 2LCCA 4M78A 5CO7A 2LC4A 4J5YA 1K9MU 3MHXA 4XTXA 2F5TX 5A0DA 4DOVA 3JB9I 3WXMB 4M77D 3PIPA 3META 3RUXA 5IAYA 3JB9H 2QQ9A 2E64A 3BFMA 4M77E 1U1TA 2QQRA 3FIFA 2JOYA 3CCVA 2GCXA 2QDYB 4ZN3A 3CC7T 5GANj 1Q86U 3P8DA 1VQ9T 1PSFA 4NL3A 1VQOA 3CCLT 2M1HA 1YCYA 3CCJT 1BI3A 3RKWA 1VQKA 5GAMe 4JRKA 4ATOA 3OYFA 2HD0A 3QIIA 4JS4A 3JCMf 4C92E 3VV0A 1VQOT 5GAOn 2YLBA 4F7UE 1QVFS 2E70A 1X75C 3BDUA 2KY9A 4F7UG 1Y07A 3OYHA 2EAYA 4C0ZA 4GY5A 1KQSA 4OF1A 4XTVA 2K57A 2Y4YA 1K73U 4CI0C 3FRNA 2JUFA 4Z02A 2XDDA 3JB9G 1BIBA 1UGSB 2P0PA 5FROA 1VQPA 1NJIU 4QQ6A 5KCOA 4E7LA 4YTLA 4M75F 2LT4A 4OGCA 3DB3A 4C92D 2XICA 4L6V5 2RA2A 1ZHIA 1KC8C 2V8JA 4M7AG 2K3YA 1Q82C 2PVGB 4LDVA 2XIDA 1P92A 4IUPA 4CRIA 2R58A 4L5GA 5HK3A 5I2MA 4LDXA 3MCAB 1BKBA 3DLLA 2AHJB 5GAN2 1D3BA 3INZA 5LJ3j 4C5HA 2QXFA 2JTMA 2EWNA 2HQEA 3QPHA 4PJOF 5C6SA 3M54A 3FLGA 5GAN4 4DA4A 4ZGJB 3BW1A 3H6ZA 4PL6A 4PLLA 4E7IA 5LJ3g 5IT9E 3E19A 3VU3C 4PJOA 3CMAT 1M4ZA 4KUDK 3KBGA 4DQ2A 3L2RA 3LGFA 1EIFA 3CMAA 1GXIE 2DIQA 2V8IA 2FHDA 1U1SA 1B34A 2JNGA 2R57A 1O75A 2BIVA 1BI1A 5CK9A 3JCMb 5GAOr 1YHQT 4PKCC 3CCRA 1YJNA 2HAXA 5GAN7 5D6YA 4EMHA 3OYBA 3G4SA 1YITA 4JJNK 4C92B 5GMKj 1Q81C 2XKOC 2LDMA 2KQWA 4B9XA 1M90C 2KSSA 3URGA 2RHIA 1XTDA 4C8QA 2OTJA 1M1KU 2EKOA 3RERA 4RCBA 2RK1A 4ME7A 3ME9A 4LDUA 1LNXA 3QZ9B 5GAMh 1LJOA 1YBYA 4E7HA 3OYEA 3OW2A 2F5KA 4TVRA 3Q1JA 3SDZA 2P4TA 2RJFA 4C0FA 5KH6A 4PJOG 2V8KA 1DJ7B 2K3XA 2PUOB 4C8QF 1PSEA 3S6WA 5CCAA 3C94A 5HKCA 4JUVA 5GANg 3CCQT 4V2SA 1RI0A 4MZTA 5KE2A 4BE2A 4JRQA 2R5MA 1NPRA 3SWNB 1NZ9A 3MEVA 3ZEHA 3CBMA 3OA6A 3QZ5B 4PLIA 5FRNA 2NLUA 4EMKA 5LJ5d 3CC7A 1G3YA 3QJ6A 4BI4A 2FB7A 4JLIA 3JAME 5DLOA 3JCMd 4M7DE 3CCRT 1K73C 1YHQA 1X01A 3M4GA 3NTIA 3HP9A 4DOWA 2BKDN 4M75D 5A0LA 2A7YA 3JRZA 2DZ9A 5GAOm 5CIUA 1Y96B 2X35A 5EG2A 4QVCA 3GOXA 1WGSA 1W4SA 3LW5E 3S3OA 4ZTFA 2QI2A 1NJIC 4BD3A 3CCMA 3CCET 3CCUT 1XOVA 3CD6A 4E7KA 3VKIA 1QW1A 3T9NA 1R8OB 3ZFJA 4C5GA 2CZ1B 3AHUA 2QQSA 3BY7A 3OMGA 1YI2T 4C0DC 3X25B 4KUIA 1ZBXA 4JS5A 3OYMA 2WSEE 4J6XA 3SWNC 2CGHA 2LT1A 4A53A 3HFNA 5I21A 3CCEA 1Q7YC 4HCBA 3RMSA 4M78G 2B8AA 4NOYA 5DLQE 3L2QA 3V7SA 1FWZA 1JBMA 3A8GB 1M5Q1 3GPLA 3QXEB 2DXUA 4BY6B 3N5BB 3CC4A 4MZMA 2M9UA 4M7DA 2EQKA 2E1HA 3OYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI4 A;  4BI3 A;  4BI8 B; 
#chains in the Genus database with same CATH topology
 4J7F A;  5CKB A;  2XK0 A;  4CC7 A;  1KD1 U;  2L3R A;  2HEQ A;  1D1B A;  4OVA A;  3VRZ A;  4M7A C;  4P5N A;  4M77 G;  4X9D A;  2A3L A;  1GCP A;  4FT2 A;  4QQD A;  2FYK A;  1ZLM A;  2BZY A;  1VUB A;  2QAZ A;  2WAC A;  4Z88 A;  1QCO A;  1ZQ1 A;  2VB6 A;  2W0Z A;  4BI8 B;  1NEB A;  3EFO B;  1Q7Y U;  1KQ2 A;  2ZCF B;  2F2V A;  2MF2 A;  1G3T A;  3UA7 A;  1AVZ C;  1MHN A;  4ZTJ A;  1AWJ A;  3CCM Q;  3SHW A;  5IH2 A;  3I56 Q;  3U23 A;  2E3H A;  4BDZ A;  1M3A A;  2KXD A;  4RCC A;  4C8Q E;  2K6D A;  1Y71 A;  1FMW A;  1VQ7 Q;  2MOX A;  2D0N A;  3CCR Q;  1FX7 A;  2DL7 A;  3X24 B;  2GFU A;  2J06 A;  2D0Q B;  2KT1 A;  3VS7 A;  4J9C A;  4ANJ A;  5FU7 C;  3GNF B;  4R56 A;  4X9C A;  1QCN A;  2M0O A;  1PD0 A;  2XD0 A;  2VV5 A;  2ZPG B;  3OYL A;  2JJ9 A;  2K5F A;  2OAW A;  1UDL A;  2HL3 A;  1Y96 A;  1VQ6 T;  5I22 A;  2DL8 A;  1ABO A;  1WYX A;  4EMK C;  4AG2 C;  2BZ8 A;  3OYJ A;  3V8J A;  4MZP A;  3DB4 A;  1SKU B;  4R55 A;  4M7A A;  1MNE A;  4C92 G;  4KT0 E;  1M2V B;  2HKN A;  2WSC E;  1Q82 U;  1OOT A;  5GAM g;  3OBY A;  1I07 A;  4XU0 A;  1VQ6 Q;  1M90 R;  1T3S A;  1G3W A;  2RQR A;  1MV3 A;  3A8O B;  4C0G A;  2X9H A;  5DM7 R;  3PGG A;  2MK5 A;  3JCM c;  4E47 A;  2RD1 A;  2J6F A;  3BE3 A;  5GMK e;  2BZX A;  2DZC A;  2MWO A;  2VXF A;  4AFZ C;  2ZPH B;  1VQ5 T;  1JXO A;  1SPK A;  4FYX B;  1WNL A;  2JTF A;  1JO8 A;  3OYY A;  1BI2 A;  1QP2 A;  4J6Y A;  4FYW B;  4M7D C;  1NLO C;  2L89 A;  3QJY A;  1G2B A;  2GF7 A;  2FRY A;  1AT1 B;  3GLX A;  2VC8 A;  2QEX Q;  5A2Q E;  5LJ5 e;  3RIR A;  3C0C A;  1YI2 Q;  3OYG A;  1VQN T;  1I0C A;  2HBP A;  2EJF A;  1I4K 1;  5GMK h;  1YIJ A;  1Y57 A;  3EG2 A;  2OI3 A;  3VUZ A;  3JCM J;  2A36 A;  4OP0 A;  1KC8 U;  1VIF A;  3CBP A;  2E41 A;  5CAI A;  5IXF A;  1JQQ A;  4HXJ A;  4BI3 A;  3QDR B;  4N4G A;  1R0B G;  4M7A E;  1N27 A;  1UG1 A;  3GF5 A;  5GMK i;  1KJW A;  2DMO A;  2DJZ A;  4AG1 C;  2OAU A;  2YHT A;  3A1P A;  1WHH A;  4AT1 B;  1G8X A;  5D6W A;  5LJ5 f;  1JJ2 P;  2LCL A;  2DL5 A;  1QCF A;  2DD5 A;  1HYO A;  4X34 A;  4RTV A;  1ABQ A;  3CQT A;  2CZ6 B;  2AIR B;  1ARK A;  2K2V A;  3JV3 A;  2KRM A;  1AZG B;  2X3W D;  4FU6 A;  4MDW A;  4M75 A;  4M7D F;  2F69 A;  3JCM P;  1OZ2 A;  3E2U A;  2QA4 A;  3QDF A;  3HRT A;  2DPP B;  1YP5 A;  2DYB A;  2RK2 A;  1VQ8 A;  4BB7 A;  5CKE A;  3OW2 P;  2J7I A;  2KMT A;  4C92 C;  1IXD A;  2YT6 A;  4M75 E;  2RI3 A;  3LYI A;  1QKW A;  2FPE A;  1Q81 R;  3JCM Q;  4QVD A;  1RLP C;  1K9M R;  1RAC B;  3QYH B;  4IIO A;  3RKX A;  1PHT A;  2F1L A;  3OYI A;  2RJD A;  4ZGD B;  1H3Z A;  5LJ5 j;  1TUC A;  2DIG A;  1XNI A;  2DBK A;  3X26 B;  3NMZ C;  2A28 A;  3MJX A;  3GIB A;  2HL5 C;  1K1Z A;  1YJN T;  1D0Z A;  1VQ4 A;  3LWH A;  4DEX A;  1AEY A;  4OMP A;  3X28 B;  1E7O A;  2EIF A;  1XQH A;  2O2O A;  2XI9 A;  3KFV A;  2QEX A;  1AWX A;  3QBY A;  3I9Q A;  2BE9 B;  1WX6 A;  4GLM A;  2LX9 A;  1RAH B;  1TSF A;  1ACM B;  2OTL Q;  1D0X A;  2D6F A;  4XAX B;  2P0K A;  4Q5W A;  2I0N A;  4Z8A A;  3M55 A;  1WQ7 A;  5GJW B;  1Q81 U;  1BCM A;  2VKN A;  3TU4 K;  2LC4 A;  4J5Y A;  2RQV A;  2DIL A;  3M0P A;  3RUX A;  1PRM C;  4R0K A;  3CC7 T;  1Q86 U;  1VQ9 T;  1B07 A;  3CCL T;  3RKW A;  2DL3 A;  2FPD A;  5GAM e;  1NBE B;  2CP0 A;  3JCM f;  3VV0 A;  5GAO n;  2EAY A;  2ED1 A;  2DF6 A;  2K57 A;  3FRN A;  2JUF A;  5FRO A;  1MUZ A;  1NJI U;  3ULR B;  5KCO A;  4YTL A;  4M75 F;  1QQJ A;  2EGC A;  2KRN A;  2DRM A;  1D1C A;  3QWY A;  1VQ4 Q;  2YSQ A;  1D1A A;  2K3Y A;  2XID A;  5HK3 A;  4IUP A;  2JMC A;  3UA6 A;  1VQ5 Q;  4C5H A;  5ECA A;  2JTM A;  4DBR A;  4PJO F;  4PLL A;  3CMA T;  2DET A;  4DQ2 A;  2DIQ A;  1Q86 R;  1UEC A;  2FHD A;  2ATC B;  2JNG A;  2R57 A;  1YHQ T;  2EGE A;  4EMH A;  3G4S A;  1KQS P;  2DX1 A;  2YUN A;  2RHI A;  3EH2 A;  2A37 A;  3RER A;  3ME9 A;  1JXM A;  5GAM h;  3QZ9 B;  4CC3 A;  2C0O A;  3R6N A;  2F5K A;  3SDZ A;  3S6W A;  2KBT A;  5HKC A;  4JUV A;  2DM1 A;  3CCE Q;  4DEY A;  1JEG A;  4JRQ A;  2R5M A;  3SWN B;  3VS3 A;  5FRN A;  4PLI A;  2NLU A;  2FZG B;  2M02 A;  5DLO A;  1ZUK A;  3HP9 A;  4M75 D;  1QLY A;  5CIU A;  1Y96 B;  4JZ4 A;  2QGG A;  2KGT A;  1VQ9 Q;  1ZSZ B;  1TOV A;  3CCU T;  2YDL A;  3VKI A;  1R8O B;  3ZFJ A;  1U5S A;  2QQS A;  3OMG A;  1YI2 T;  1YN8 A;  3X25 B;  4JS5 A;  3OYM A;  2WSE E;  3HFN A;  1U06 A;  2K3B A;  4Z89 A;  3RMS A;  1NYF A;  5DLQ E;  3I5S A;  1GBR A;  2E4H A;  3N5B B;  4M7D A;  3OYD A;  2CKK A;  2AKK A;  3I56 T;  2Y4X A;  4HVV A;  5D7U A;  2QTV A;  1QVP A;  2SRC A;  1UB4 A;  3PE0 A;  5IHN A;  4BAC A;  1FMK A;  1R0C B;  2A08 A;  2V1R A;  3V7C A;  2D8H A;  3RES A;  3GP8 A;  1GL5 A;  4XU3 A;  2KE9 A;  3I5R A;  5I2S A;  1UTI A;  5CQY A;  3OY9 A;  3H8Z A;  4EPC A;  1EZZ B;  2PVD B;  1YHQ Q;  1MMN A;  2RMO A;  3WVE B;  3OMC A;  4DBQ A;  2YRC A;  3C4S A;  2BTT A;  2PNI A;  2DK3 A;  2GTJ A;  3CXC A;  1NLP C;  3M0S A;  3CPF A;  4PK4 A;  2L5Q A;  1PRL C;  2GQI A;  5FU6 B;  3SWN A;  1FMV A;  5GAN h;  3MEU A;  4XTY A;  4UC4 A;  1TXQ A;  3CEY A;  2EJ9 A;  4C5I A;  2PUK B;  2GNC A;  4J9B A;  1YJW Q;  3VS5 A;  3UF4 A;  1RAB B;  3MP6 A;  3CCM T;  1X6G A;  3HRS A;  1ZA2 B;  2CSI A;  2G3R A;  1VIE A;  1C6V X;  1Q7Y R;  5LJ5 g;  3ZBD A;  1QKX A;  5KYX B;  4OGE A;  1UHC A;  2FZK B;  5KYW A;  3EAE A;  4F7U F;  1B34 B;  2CZ7 B;  2COY A;  1G5V A;  4XU2 A;  3F70 A;  4M7D G;  1SSF A;  3HL8 A;  4PFP A;  3OQ5 A;  1RI9 A;  5FU7 B;  1YIT T;  2MYS A;  2I2L A;  2JVV A;  5CKD A;  1X6O A;  2LTO A;  1W1F A;  3CCQ A;  3CBO A;  3QKJ A;  3PTA A;  3CC4 Q;  4QVZ A;  3VUB A;  1GCQ A;  1MV0 B;  3C95 A;  1U8R A;  2KYB A;  2DA9 A;  4JZ3 A;  1IGQ A;  3CXC S;  4M77 B;  3PMT A;  1OPK A;  3I55 A;  1LOJ A;  2D9T A;  1ZSZ C;  3E9G A;  2NWM A;  2XG8 D;  4ELZ C;  4M78 F;  3VYH B;  4M7A B;  4A4K A;  4N0A A;  4XQ3 A;  1PNJ A;  4OB1 B;  3CC4 T;  3CCS Q;  4FL6 A;  1I8F A;  5CKF A;  2K2M A;  1KC8 R;  2LJ0 A;  1WQW A;  4FW2 A;  1HD3 A;  2K5L A;  2BUD A;  2RHU A;  1IZ6 A;  3G7Z A;  1WHK A;  4LD9 K;  2QGF B;  3L2U A;  4IIM A;  4OMF B;  1YI2 A;  3REB B;  3TVT A;  2P0Q A;  3E9F A;  2FRW A;  2DLP A;  3EG0 A;  3TSZ A;  4KH1 B;  3RDV A;  1K9A A;  1UFF A;  1KQ1 A;  3H9N A;  3OS5 A;  3S3N A;  5IHK A;  1B3Q A;  1BB9 A;  2OTL T;  1VQK T;  3RR6 A;  1MMD A;  3JCM g;  3A8M B;  2MWP A;  3WVD B;  2DXC A;  3CPW A;  1YWP A;  2RH2 A;  1YJ9 T;  5DY9 A;  5HCK A;  1UJ0 A;  5GAO p;  1Z9Z A;  3HFO A;  2DXB A;  1HXD A;  3FJP A;  2CP5 A;  2FVU A;  5D6X A;  4B9W A;  1IGU A;  2LJ3 A;  2PQW A;  2RB6 A;  2YXY A;  2EGA A;  4OMN A;  1ZSZ A;  4QW2 A;  1MND A;  3PMI A;  4MMK A;  2VUB A;  4BE1 A;  5GAO l;  4NS5 A;  1VQL Q;  5A0G A;  1OI1 A;  4ELY C;  3AT1 B;  3I35 A;  4JRP A;  4IUR A;  5J26 A;  5L8R E;  3EGU A;  2IG0 A;  3MP1 A;  1M30 A;  1YIJ T;  3C12 A;  4FCY A;  1VQ8 T;  2M51 A;  3L2W A;  1YFN A;  2X51 A;  2NUT B;  4IUT A;  5GJV B;  5GAM j;  2O88 A;  3EG9 A;  3EG1 A;  1E6H A;  3PVL A;  4RTW A;  3M0U A;  2FL7 A;  1N8R U;  4M7D D;  3CCS A;  1X6B A;  3QUI A;  1IRX A;  1YIJ Q;  2RHZ A;  4ESR A;  2LP5 A;  1J3T A;  3FEO A;  3G6E A;  2DFU A;  2LQK A;  5LJ3 f;  4LE9 A;  3FJ5 A;  2PVO B;  2RJC A;  4C8Q G;  3CCL A;  2DER A;  1Y7X A;  3OBW A;  4J9G A;  4ZGE B;  1GFC A;  1TS9 A;  3MEW A;  4FSS A;  3NGP A;  2JS0 A;  3RNJ A;  2ZAE A;  4J7I A;  3A5Z B;  2E65 A;  4WF2 A;  2LVM A;  4KGZ B;  3L2Z A;  1IRE B;  2QTX A;  4L59 A;  2CH4 A;  5LJ3 h;  3PT9 A;  3LX7 A;  1KQS S;  4AFU C;  1HK9 A;  2EQJ A;  1S72 A;  2KVQ G;  4RTZ A;  3SEM A;  3NTH A;  3H0H A;  1YJN Q;  1VA7 A;  5LJ3 d;  1PD1 A;  3EFO A;  4EMK B;  1Z9Q A;  2EYY A;  2LQN A;  4DOV A;  3WXM B;  3MET A;  1SHF A;  5IAY A;  2E5K A;  3BFM A;  2GCX A;  4B6M A;  2QDY B;  4JJB A;  1C1A A;  3P8D A;  1PSF A;  3QWX X;  2LMJ A;  4NL3 A;  1VQO A;  1TU0 B;  1GRI A;  1BI3 A;  2H3E B;  3OYF A;  1VQO T;  2K79 A;  3NHN A;  2E70 A;  1X75 C;  4F7U G;  3OYH A;  1W2B P;  1Y07 A;  4C0Z A;  1VQM Q;  1M1K R;  2Y4Y A;  2XDD A;  4CC4 B;  1UGS B;  2P0P A;  3CMA Q;  4OGC A;  2KI7 A;  2XIC A;  1RAA B;  1NYG A;  4E7Z A;  4CRI A;  1P92 A;  1AZE A;  2R58 A;  4L5G A;  3MCA B;  1BKB A;  2CRE A;  2AHJ B;  1TTH B;  5GAN 2;  5KYN A;  5LJ3 j;  2EWN A;  5C6S A;  4ZGJ B;  3H6Z A;  4PFO A;  5LJ3 g;  2CUB A;  1PC0 A;  5IXB A;  1NG2 A;  1EIF A;  2HQH A;  5FWC A;  1RAD B;  1WHJ A;  4D8K A;  1B34 A;  1O75 A;  5GAO r;  2HDA A;  3CCR A;  3OYB A;  1YIT A;  4JJN K;  1RAG B;  1T0H A;  3CXC P;  5GMK j;  1D0Y A;  2KSS A;  3URG A;  4RTU A;  1XTD A;  4C8Q A;  1M1K U;  2RQU A;  1LNX A;  1LJO A;  4J9E A;  2DL4 A;  4C0F A;  5KH6 A;  4PJO G;  2V8K A;  2F2X A;  2PUO B;  1XJW B;  1C0M A;  3LH5 A;  4V2S A;  5KYW B;  4LN2 A;  1NZ9 A;  1YCS B;  3CBM A;  3OA6 A;  2HKQ B;  4HVW A;  2YUQ A;  3H41 A;  2FB7 A;  3JCM d;  5FW9 A;  3CCR T;  1UHF A;  3NTI A;  2BKD N;  2A7Y A;  2X35 A;  4QVC A;  3GOX A;  2ROT A;  1NJI C;  1XOV A;  4E7K A;  4RTX A;  2MCN A;  2CUD A;  1GFD A;  2AK5 A;  5I21 A;  5L23 A;  2NUP B;  4HCB A;  4M78 G;  1KFZ A;  3A98 A;  3GPL A;  3QXE B;  2DXU A;  3CC4 A;  2M9U A;  5GAO m;  4A54 A;  2VAS A;  2DTH A;  3PVQ A;  4J6W A;  2ZPI B;  1EX4 A;  1N9R A;  4F04 B;  1RAE B;  5GAN 8;  1VQN A;  5KCH A;  1YWO A;  2HBW A;  4HT9 A;  2EJG A;  1KK7 A;  6AT1 B;  3CCJ A;  3FC3 A;  3JCM h;  1H64 1;  4VUB A;  3A8L B;  2X4Y A;  1LPL A;  2JW4 A;  4A63 B;  4E7J A;  1M1F A;  1NPP A;  2EBP A;  2EYX A;  1UGQ B;  3G71 A;  3THK A;  1KSW A;  2P84 A;  5GAN 6;  2GQV A;  1B7T A;  1G83 A;  2DYI A;  4C8Q B;  3JB9 D;  3NPF A;  1MGQ A;  1AWW A;  3CC2 A;  5M9O A;  3DKM A;  2DAQ A;  2VGM A;  4RG2 A;  5CQX A;  3UAT A;  2QQB A;  2RI5 A;  2EQM A;  3SFM A;  4FT4 A;  3X20 B;  1WZO A;  1KD1 R;  2JT4 A;  5LL6 S;  1D09 B;  4OB0 B;  4LDW A;  3CCQ Q;  4HT8 A;  3V8L A;  1QMC A;  1JJ2 A;  3M5A A;  4Y28 E;  4M7A F;  1T3L A;  1CSK A;  1QWE A;  1M90 U;  4KRT A;  2O9S A;  4DBF A;  4M75 G;  2L3S A;  4KUL A;  3TRE A;  3EGD A;  5GAN e;  1WA7 A;  4OB2 B;  4F7U A;  4PJO B;  3LWI A;  3CCJ Q;  4AMC A;  1M1K C;  2B86 A;  1M2O A;  5FU6 C;  1JB0 E;  3PFS A;  4HKE A;  1PKS A;  4BE0 A;  3P8H A;  1TWB A;  1PM3 A;  3G4S Q;  2E12 A;  1QWF A;  2ED0 A;  2XDB A;  1WHG A;  4FYY B;  3EFR A;  2ZZD A;  5GAO q;  2K9G A;  2C06 A;  2NUZ A;  3M0T A;  2ZPE B;  4C8Q D;  3BDL A;  1V76 A;  2RF0 A;  1S1N A;  3ER0 A;  4MML A;  2ZPF B;  4IUU A;  1X2Q A;  4J83 A;  2DO3 A;  1WXB A;  4F17 A;  1NEG A;  3EG3 A;  1OX9 A;  4PJL A;  4A4E A;  2K4Y A;  4AFQ C;  1VQP T;  2PU9 B;  2NUT A;  1WJS A;  4M78 B;  1E6G A;  1M8M A;  3P8B B;  1SSH A;  2DVE A;  2GBQ A;  5GMK m;  3OS2 A;  1VQ4 T;  1I5O B;  2V26 A;  2XHC A;  3M59 A;  1Q95 G;  1RAI B;  2KXC A;  2SEM A;  2E6Z A;  2OTL A;  1VQ9 A;  2M16 A;  1N6A A;  2EVR A;  4ZN1 A;  2X4X A;  2CS7 A;  3CCU A;  3UPU A;  3O5Z A;  3M9Q A;  2DRK A;  1OU9 A;  1RL2 A;  2HSP A;  4M77 C;  1BIA A;  1IB8 A;  1ZUU A;  2RJE A;  4M4Z A;  1FXX A;  4A4F A;  1JJ2 S;  1X2K A;  1OPL A;  2RPN A;  4GBQ A;  1UUE A;  4RMO A;  1TUD A;  3LLR A;  5HK0 A;  1V29 B;  3M4Y A;  2E6N A;  2KAF A;  1UGP B;  3RKY A;  1BBZ A;  1OU8 A;  2JMA A;  4J8O A;  2QA4 Q;  2QEX T;  4N4H A;  2L2P A;  1WHL A;  2LNV A;  1K0X A;  3JB9 J;  4J9I A;  1KHI A;  4QKU A;  4C92 A;  1X27 A;  2DKG A;  2OTJ Q;  4LUD A;  4EDU A;  3RBB B;  2YLC A;  1W2B A;  3CME Q;  3M53 A;  2EQU A;  1SRL A;  1YJW A;  3HRU A;  1S72 T;  1WJQ A;  1VQ8 Q;  3QSU A;  1WXU A;  2CYZ B;  4F16 A;  4NL2 A;  1U3O A;  3QG1 A;  4HCZ A;  3G6E Q;  1N8R C;  1KD1 C;  3HPW A;  2HMA A;  3A8H B;  5AT1 B;  4ORZ A;  4M75 B;  1TG0 A;  2EYQ A;  2RN8 A;  8ATC B;  2X4J A;  4M7A D;  1HJD A;  2YRV A;  5FLX E;  1TUG B;  3OS1 A;  2KDS A;  2RHX A;  3MO8 A;  5CVI A;  3DLM A;  1V1C A;  1YNZ A;  2LJ1 A;  3OW2 S;  2KEA A;  4RKU E;  2VYT A;  9ATC B;  5GAN 3;  1K8A U;  3GBQ A;  3VS1 A;  2LRQ A;  1WJR A;  4CC2 A;  4FM4 B;  3JB9 F;  1SEM A;  2CP2 A;  1KHC A;  1GCQ C;  4OB3 B;  1OZ3 A;  1QVF P;  3CC7 Q;  3TCJ A;  4M77 F;  2W10 A;  1JRI A;  4FIB A;  1G3S A;  4LDY A;  4O6J A;  1A0N B;  2E3I A;  1EFN A;  2CT4 A;  3MEA A;  2C0T A;  5GAN 5;  1MMA A;  1WI7 A;  4E2F B;  1UJY A;  1W70 A;  5KYX A;  2FO0 A;  1GBQ A;  3CC2 T;  4PNO A;  1Q86 C;  5LJ3 e;  2CZ0 B;  3NFC A;  4M77 A;  3TEE A;  1BCO A;  5CR2 A;  1ZX6 A;  3S3M A;  2V1Q A;  1N8R R;  3G71 T;  2JN0 A;  4JPB W;  4KUD K;  1VQ7 T;  4RG8 A;  2ZPB B;  4XTZ A;  2RNA A;  2LCC A;  4M78 A;  3JB9 I;  2F5T X;  3L2V A;  3JB9 H;  3H0I A;  1VOM A;  2QQ9 A;  4M77 E;  1U1T A;  2QQR A;  1UE9 A;  2JOY A;  3FIF A;  3CCV A;  1F1B B;  1M27 C;  4LNP A;  4ZN3 A;  2KYM A;  1HSQ A;  3CCJ T;  1VQK A;  4JRK A;  2GGR A;  4ATO A;  1WDX A;  2HD0 A;  4C92 E;  1QVG P;  2F2W A;  2YLB A;  1QVF S;  2CSQ A;  3BDU A;  2KY9 A;  4GY5 A;  4OF1 A;  4XTV A;  1K73 U;  4CI0 C;  3EGX B;  3JB9 G;  4E7L A;  4JJC A;  2RQW A;  3CCL Q;  2PZ1 A;  4C92 D;  4L6V 5;  2RA2 A;  1OV3 A;  1ZHI A;  4M7A G;  2C0I A;  1Q82 C;  1K76 A;  3DLL A;  2EPD A;  2HZY A;  1D3B A;  2HQE A;  3QPH A;  5KYU A;  5GAN 4;  1WIE A;  3FLG A;  4PL6 A;  5IT9 E;  2G6F X;  3IQL A;  3E19 A;  3VU3 C;  4PJO A;  1M4Z A;  2LZ6 B;  3KBG A;  3L2R A;  3LGF A;  4PJN A;  4WTO B;  1H8K A;  1BI1 A;  3JCM b;  2DBM A;  1LCK A;  4PKC C;  1YJN A;  2HAX A;  2ROL A;  5D6Y A;  2KNB B;  1Q81 C;  4B9X A;  1M90 C;  2DJQ A;  2OTJ A;  4RCB A;  1K73 R;  1SRM A;  4LDU A;  1YBY A;  2BE7 D;  4E7H A;  3OYE A;  3OW2 A;  1NJI R;  4TVR A;  3Q1J A;  2QAS A;  4C8Q F;  1ZBJ A;  2JTE A;  3C94 A;  5CCA A;  2J6O A;  4MZT A;  4BE2 A;  4DBH A;  3MEV A;  3ZEH A;  4RUG A;  4EMK A;  5LJ5 d;  1X69 A;  4JJD A;  1G3Y A;  3QJ6 A;  2VVK A;  4JLI A;  1RAF B;  1K73 C;  1X01 A;  5A0L A;  3JRZ A;  2DZ9 A;  3LW5 E;  3CCV Q;  1W6X A;  4ZTF A;  2QI2 A;  4BD3 A;  3CCM A;  4KGV B;  3CCE T;  1RUW A;  2O31 A;  4C5G A;  1QW1 A;  1VQK Q;  3BY7 A;  1WLP B;  2FG0 A;  4HCK A;  1IO6 A;  1ZBX A;  4AFS C;  2CGH A;  4ZNX A;  3MKD A;  2B8A A;  3L2Q A;  3A8G B;  1JBM A;  4KGX B;  2EQK A;  2E1H A;  3CPW S;  4E7S A;  3O8V A;  4XTW A;  2L0A A;  1K9M C;  3RMQ A;  3OYC A;  3JCM V;  1TH7 A;  2E5Q A;  2ECZ A;  4N4I A;  2MAM A;  5LJ5 h;  2H8H A;  3ZL7 C;  4KBM B;  2XDP A;  3UDC A;  3UT1 A;  1BI0 A;  1OUL A;  3M58 A;  3OB9 A;  3QHS A;  2L3P A;  4QQG A;  2H3J A;  2DTO A;  2D1X A;  4JLG A;  1OYX A;  3OYA A;  2KRS A;  2DEQ A;  1QVG A;  1KG1 A;  2X4W A;  3L42 A;  4BY6 C;  4QT7 A;  4M7D B;  4PJO C;  2LNH B;  5J3B A;  4XK8 E;  5CKH A;  1VQ5 A;  3VRY A;  1M9S A;  2YWW A;  4F14 A;  2X3X D;  3I56 A;  3LGL A;  1AD5 A;  4PJO D;  3JSC A;  2LX7 A;  2K7A A;  1Q82 R;  1VQL T;  5C0M A;  1VQ6 A;  3EGX A;  2DE0 X;  2XU8 A;  3EFS A;  2XMF A;  3VS0 A;  3HHT B;  3GNG A;  2KK4 A;  4M78 E;  2CH4 W;  4C92 F;  1QVG S;  2Y90 A;  3G6E T;  3JCM W;  3M0R A;  2LQ8 A;  3NTK A;  3V7R A;  1YJ9 A;  5EC7 A;  1YJ9 Q;  4HVU A;  1VQL A;  3HSB A;  4C8Q C;  2HQX A;  4FW1 A;  2EQI A;  1AOJ A;  1PKT A;  5FRM A;  1IHW A;  5IN1 A;  2OTJ T;  2FPF A;  3HKS A;  5KE3 A;  1NM7 A;  4XTU A;  5J39 A;  4Y91 A;  2WSF E;  1LVK A;  3EG9 B;  3MP8 A;  1CKA A;  3R6O A;  3CCV T;  4M78 D;  5GAM d;  2L3Q A;  1Y0M A;  1K8A C;  2YUO A;  3SB2 A;  5FWB A;  2LCS A;  4FSX A;  2CP7 A;  2EFI A;  4C0D B;  1CKB A;  4RTY A;  4PJO E;  2O9V A;  2Z0W A;  2QQA A;  4D8D A;  3E1S A;  3OS0 A;  2RI2 A;  4IUQ A;  1BU1 A;  4N0A C;  3G4S T;  2COW A;  2DXT A;  4JDS A;  5AYF A;  1X43 A;  2EYW A;  1NE8 A;  4C5E A;  3REA B;  3D7S B;  1UEB A;  1KIK A;  1ZSG A;  2OX7 A;  1N9S A;  2AZS A;  1QVF A;  3OYK A;  2KR3 A;  4F7U B;  4BDY A;  2RHY A;  3I55 T;  4HCC A;  2VXE A;  2GFA A;  3HTR A;  2O4X A;  1WXT A;  3M0Q A;  3CD6 T;  3M57 A;  2ZGW A;  3UWN A;  1UGR B;  4II1 A;  2IVW A;  4D6W A;  1VQ7 A;  2RQT A;  1PG5 B;  2AKL A;  2LQW A;  3J80 E;  2IPO B;  3G71 Q;  4JRI A;  2ENM A;  3JCM e;  2COZ A;  1D3B B;  1VQO Q;  2EKH A;  2MI6 A;  3CC2 Q;  2PTK A;  2A0F B;  3SD4 A;  2O01 E;  4OMQ A;  3J81 E;  2DTI A;  3OSV A;  4J9H A;  2CP6 A;  3G1J A;  3VJP A;  4OMM A;  2VGN A;  4MDX A;  2DD4 A;  1M3C A;  1SG5 A;  3CME T;  3MPU B;  4GLK A;  2NUP A;  4PJJ A;  4IKF A;  3ASK A;  1QP3 A;  1K4U S;  1M1G A;  2OJ2 A;  1M8V A;  2AT1 B;  4PFZ A;  2QK0 A;  2HSE B;  2K5I A;  3KXT A;  2MMP A;  4BUG A;  3QO3 A;  3FB9 A;  2RM4 A;  1PWT A;  3TQ7 P;  3CPW P;  3PIO A;  1VYV A;  2JZ2 A;  1T0J A;  3VYG A;  2QG9 B;  1N5Z A;  3J7A F;  8AT1 B;  1I5L A;  3PNW C;  4OML A;  2J05 A;  1O9S A;  1M3B A;  5HY6 A;  3TSW A;  4HA8 A;  5I11 A;  4LD6 A;  3QYG B;  3KUF A;  5GAM f;  1RLQ C;  2CDT A;  1H3H A;  1JU5 C;  2FZC B;  1OEB A;  4IUV A;  3JCM X;  4LXC A;  2HCK A;  1S72 Q;  3EH1 A;  3EGD B;  2L8D A;  3M56 A;  3VS2 A;  1I81 A;  1WPY A;  4O5V A;  4M78 C;  2O4X B;  2E10 A;  4EMG A;  1YJW T;  1VQP Q;  4XU1 A;  4A4H A;  2IIM A;  4EIK A;  1W2B S;  2R5A A;  2QA4 T;  1M2V A;  2J6K A;  3VS4 A;  4RTT A;  3CME A;  4Y92 A;  4OMO A;  1K0S A;  4M75 C;  3L1A A;  4FYV B;  1I1J A;  2HNI A;  3V8K A;  1VQM T;  1ZA1 B;  2CT3 A;  1BYM A;  2RO0 A;  4A4G A;  4J9D A;  5GMK l;  3OYN A;  1AHJ B;  1WHM A;  4KH0 B;  5GAN d;  1IHV A;  4J9F A;  3CCU Q;  2KT8 A;  2GTO A;  1VQM A;  5IHI A;  3OSS C;  3FDR A;  1YIT Q;  5GAN f;  3CCS T;  5CO7 A;  1AWO A;  1K9M U;  3MHX A;  4XTX A;  3PIP A;  5A0D A;  1K8A R;  4M77 D;  2E64 A;  5GAN j;  4PJM A;  2M1H A;  1YCY A;  3QII A;  4JS4 A;  4F7U E;  4WCI A;  1PCX A;  1FYN A;  1KQS A;  1ZUY A;  2YUP A;  2DNU A;  4Z02 A;  1BIB A;  1VQP A;  4QQ6 A;  3EHQ A;  2LT4 A;  3DB3 A;  1KC8 C;  2V8J A;  2PVG B;  4LDV A;  1MMG A;  2QDL A;  2FEI A;  4LDX A;  2KRO A;  5I2M A;  1OX8 A;  3INZ A;  3H0F A;  2QXF A;  5KYU B;  3M54 A;  4DA4 A;  2DEU A;  3BW1 A;  4E7I A;  2DVJ A;  3CMA A;  2JXB A;  1GXI E;  2V8I A;  1U1S A;  5CK9 A;  2BIV A;  2MPX C;  5GAN 7;  4C92 B;  1SHG A;  2XKO C;  2LDM A;  2ABL A;  2KQW A;  2QYZ A;  2JS2 A;  2EKO A;  2RK1 A;  4ME7 A;  2P4T A;  2RJF A;  1DJ7 B;  2K3X A;  1PSE A;  1R77 A;  1BK2 A;  5GAN g;  3CCQ T;  2MIO A;  1RI0 A;  5KE2 A;  2JM8 A;  1NPR A;  4LUE A;  3EHR A;  3QZ5 B;  4E6R A;  3CC7 A;  4BI4 A;  2EW3 A;  7AT1 B;  3JAM E;  5KYY B;  1WFW A;  5KYY A;  4M7D E;  2AZV A;  1YHQ A;  3M4G A;  4DOW A;  4K11 A;  2JM9 A;  1SF9 A;  2VWF A;  2YRD A;  2D8J A;  5EG2 A;  1OQK A;  2P4R A;  1WGS A;  1W4S A;  3S3O A;  3CD6 Q;  3CD6 A;  1UGV A;  3VS6 A;  3T9N A;  2CZ1 B;  2M0Y A;  3AHU A;  1VQN Q;  4C0D C;  3I55 Q;  4X1V A;  4KUI A;  2EYZ A;  4J6X A;  3SWN C;  2CP3 A;  2LT1 A;  3CCE A;  4A53 A;  1Q7Y C;  2ESW A;  4NOY A;  3V7S A;  1FWZ A;  1M5Q 1;  1VYU A;  1VYT A;  4BY6 B;  1H92 A;  4MZM A;  2NYS A;  3LH0 A; 
#chains in the Genus database with same CATH homology
 4J7F A;  3CPW S;  2CKK A;  5CKB A;  2XK0 A;  4A54 A;  2DTH A;  3I56 T;  2Y4X A;  3O8V A;  4XTW A;  1KD1 U;  2L3R A;  1QVP A;  2ZPI B;  1N9R A;  1UB4 A;  4J6W A;  1K9M C;  3RMQ A;  3OYC A;  4BAC A;  3JCM V;  1TH7 A;  2E5Q A;  4OVA A;  5GAN 8;  1VQN A;  4M7A C;  4P5N A;  4N4I A;  2MAM A;  4M77 G;  4X9D A;  5KCH A;  3V7C A;  5LJ5 h;  4HT9 A;  4KBM B;  2EJG A;  2XDP A;  3RES A;  2A3L A;  3GP8 A;  3UDC A;  3CCJ A;  3FC3 A;  3JCM h;  3UT1 A;  4FT2 A;  1BI0 A;  4XU3 A;  4QQD A;  3M58 A;  1H64 1;  3OB9 A;  2FYK A;  3QHS A;  4VUB A;  1VUB A;  3A8L B;  2WAC A;  2X4Y A;  4QQG A;  2H3J A;  2DTO A;  4JLG A;  1ZQ1 A;  5I2S A;  1OYX A;  4E7J A;  1M1F A;  5CQY A;  4BI8 B;  3OYA A;  1NPP A;  3OY9 A;  1Q7Y U;  3H8Z A;  4EPC A;  2DEQ A;  1UGQ B;  2ZCF B;  3G71 A;  1QVG A;  2X4W A;  1KQ2 A;  1KG1 A;  2PVD B;  3WVE B;  2MF2 A;  3OMC A;  3L42 A;  5GAN 6;  1G3T A;  4BY6 C;  2GQV A;  3C4S A;  3JB9 D;  4M7D B;  4C8Q B;  4PJO C;  1MHN A;  5J3B A;  1MGQ A;  4XK8 E;  4ZTJ A;  5CKH A;  1VQ5 A;  3CC2 A;  5M9O A;  2DK3 A;  3DKM A;  2DAQ A;  3CXC A;  1M9S A;  2VGM A;  4RG2 A;  5CQX A;  3I56 A;  2QQB A;  2RI5 A;  2EQM A;  3CPF A;  3LGL A;  3SFM A;  4BDZ A;  4FT4 A;  4PJO D;  3JSC A;  3X20 B;  2L5Q A;  4RCC A;  4C8Q E;  5FU6 B;  1VQL T;  1Y71 A;  5C0M A;  3SWN A;  1VQ6 A;  2XU8 A;  5LL6 S;  5GAN h;  1FX7 A;  3X24 B;  3MEU A;  2GFU A;  3EFS A;  2D0Q B;  3HHT B;  3GNG A;  2KK4 A;  4OB0 B;  4LDW A;  4HT8 A;  5FU7 C;  3GNF B;  4XTY A;  4UC4 A;  3V8L A;  4M78 E;  3CEY A;  2EJ9 A;  4R56 A;  4C5I A;  2PUK B;  4X9C A;  4C92 F;  1JJ2 A;  1QVG S;  3M5A A;  2M0O A;  4Y28 E;  2Y90 A;  2XD0 A;  2VV5 A;  2ZPG B;  3MP6 A;  3G6E T;  4M7A F;  3JCM W;  3OYL A;  3CCM T;  1M90 U;  2LQ8 A;  3HRS A;  2G3R A;  3NTK A;  2K5F A;  4KUL A;  1VIE A;  4M75 G;  3TRE A;  3V7R A;  1YJ9 A;  1Y96 A;  5LJ5 g;  1VQ6 T;  5GAN e;  3ZBD A;  1VQL A;  4OB2 B;  4F7U A;  3HSB A;  4C8Q C;  3LWI A;  2HQX A;  4PJO B;  4OGE A;  5FRM A;  1M1K C;  3EAE A;  4EMK C;  5IN1 A;  4F7U F;  2OTJ T;  5FU6 C;  1B34 B;  2CZ7 B;  3HKS A;  5KE3 A;  1JB0 E;  3PFS A;  4HKE A;  3OYJ A;  4BE0 A;  1G5V A;  4XU2 A;  3F70 A;  4XTU A;  5J39 A;  3V8J A;  4MZP A;  4M7D G;  4Y91 A;  1SSF A;  2WSF E;  3HL8 A;  3DB4 A;  3OQ5 A;  5FU7 B;  4R55 A;  3P8H A;  1YIT T;  2I2L A;  4M7A A;  2JVV A;  4C92 G;  2E12 A;  4KT0 E;  5CKD A;  1X6O A;  2LTO A;  2WSC E;  3MP8 A;  3R6O A;  3CCV T;  3CCQ A;  4M78 D;  5GAM g;  5GAM d;  1Q82 U;  3CBO A;  2XDB A;  1K8A C;  3QKJ A;  3PTA A;  3EFR A;  2ZZD A;  3SB2 A;  4QVZ A;  3VUB A;  5GAO q;  4FSX A;  3OBY A;  2C06 A;  3C95 A;  2EFI A;  4C0D B;  2ZPE B;  1U8R A;  4C8Q D;  4PJO E;  3BDL A;  2QQA A;  3CXC S;  4M77 B;  3PMT A;  3ER0 A;  4MML A;  2ZPF B;  1LOJ A;  4XU0 A;  2D9T A;  4IUU A;  4J83 A;  3I55 A;  2DO3 A;  3E9G A;  3E1S A;  3OS0 A;  2RI2 A;  2XG8 D;  1G3W A;  4IUQ A;  4M78 F;  4ELZ C;  3VYH B;  3A8O B;  4N0A C;  3G4S T;  4C0G A;  4M7A B;  5DM7 R;  3PGG A;  3JCM c;  4A4K A;  2DXT A;  2K4Y A;  4A4E A;  4E47 A;  4JDS A;  1VQP T;  2PU9 B;  5AYF A;  2RD1 A;  4N0A A;  1WJS A;  4M78 B;  4XQ3 A;  3CC4 T;  4OB1 B;  1NE8 A;  5GMK e;  4FL6 A;  1I8F A;  4C5E A;  5CKF A;  3P8B B;  2DVE A;  2DZC A;  1UEB A;  2MWO A;  5GMK m;  1WQW A;  3OS2 A;  2VXF A;  1N9S A;  1VQ4 T;  2K5L A;  2BUD A;  2RHU A;  1QVF A;  1IZ6 A;  3G7Z A;  4LD9 K;  2ZPH B;  3OYK A;  1VQ5 T;  4F7U B;  2XHC A;  3M59 A;  4BDY A;  2RHY A;  3I55 T;  1WNL A;  3L2U A;  4OMF B;  1YI2 A;  2JTF A;  4HCC A;  2E6Z A;  2VXE A;  3OYY A;  1BI2 A;  2OTL A;  2GFA A;  1VQ9 A;  2M16 A;  1N6A A;  1QP2 A;  2O4X A;  2X4X A;  4J6Y A;  4ZN1 A;  4M7D C;  2CS7 A;  2L89 A;  2P0Q A;  3E9F A;  3QJY A;  3M57 A;  3CCU A;  3CD6 T;  3UPU A;  2ZGW A;  3M9Q A;  2GF7 A;  3UWN A;  1UGR B;  4II1 A;  3GLX A;  3L2V A;  2IVW A;  4D6W A;  2VC8 A;  1VQ7 A;  1RL2 A;  4M77 C;  3J80 E;  5A2Q E;  5LJ5 e;  1BIA A;  4JRI A;  2RJE A;  1KQ1 A;  1FXX A;  4A4F A;  3OS5 A;  3RIR A;  3S3N A;  1JJ2 S;  3JCM e;  1D3B B;  2OTL T;  2MI6 A;  3OYG A;  1VQN T;  4RMO A;  3LLR A;  5HK0 A;  1V29 B;  2HBP A;  2O01 E;  3SD4 A;  3M4Y A;  1VQK T;  2EJF A;  1I4K 1;  2E6N A;  5GMK h;  3J81 E;  1YIJ A;  2DTI A;  2KAF A;  1UGP B;  3OSV A;  3RKY A;  3A8M B;  3JCM g;  4J8O A;  3VJP A;  2MWP A;  3VUZ A;  2QEX T;  3JCM J;  3WVD B;  2DXC A;  4N4H A;  4OP0 A;  2VGN A;  2LNV A;  3CPW A;  1KC8 U;  3JB9 J;  4MDX A;  2RH2 A;  1VIF A;  2DD4 A;  3CBP A;  1KHI A;  5DY9 A;  1YJ9 T;  3CME T;  4GLK A;  2E41 A;  4C92 A;  5CAI A;  2DKG A;  4IKF A;  5GAO p;  3ASK A;  1QP3 A;  3HFO A;  2DXB A;  4BI3 A;  1M1G A;  1HXD A;  1M8V A;  3FJP A;  3QDR B;  4N4G A;  4EDU A;  1W2B A;  2YLC A;  2FVU A;  4M7A E;  1N27 A;  5D6X A;  3GF5 A;  2K5I A;  5GMK i;  3M53 A;  2EQU A;  3KXT A;  1YJW A;  3HRU A;  2DJZ A;  4B9W A;  1S72 T;  2MMP A;  2OAU A;  2PQW A;  4BUG A;  2YHT A;  2RB6 A;  3QO3 A;  1WJQ A;  3FB9 A;  3QSU A;  2RM4 A;  2CYZ B;  4NL2 A;  5D6W A;  3QG1 A;  5LJ5 f;  4QW2 A;  3PIO A;  4HCZ A;  2LCL A;  2DD5 A;  3PMI A;  4MMK A;  4X34 A;  2VUB A;  2JZ2 A;  4BE1 A;  5GAO l;  1N8R C;  2CZ6 B;  4NS5 A;  3VYG A;  1KD1 C;  3HPW A;  5A0G A;  1OI1 A;  3J7A F;  3A8H B;  2K2V A;  4ELY C;  1I5L A;  3PNW C;  4IUR A;  5J26 A;  4FU6 A;  5L8R E;  4JRP A;  2IG0 A;  4M75 B;  4M75 A;  3MP1 A;  4MDW A;  4M7D F;  2F69 A;  3JCM P;  1OZ2 A;  2EYQ A;  1YIJ T;  3C12 A;  2X4J A;  2QA4 A;  4M7A D;  1O9S A;  1VQ8 T;  3HRT A;  2DPP B;  5HY6 A;  2YRV A;  3L2W A;  4HA8 A;  2RK2 A;  1VQ8 A;  4LD6 A;  4BB7 A;  5FLX E;  3QYG B;  4IUT A;  5CKE A;  2KMT A;  3KUF A;  4C92 C;  5GAM f;  5GAM j;  2KDS A;  3OS1 A;  2RHX A;  4M75 E;  2RI3 A;  3LYI A;  3MO8 A;  2FL7 A;  4IUV A;  5CVI A;  1N8R U;  4M7D D;  3DLM A;  3CCS A;  3JCM X;  3QUI A;  3OW2 S;  3JCM Q;  4RKU E;  2L8D A;  4QVD A;  2VYT A;  3M56 A;  2RHZ A;  1I81 A;  5GAN 3;  1WPY A;  1K8A U;  4O5V A;  2LRQ A;  1WJR A;  4M78 C;  3FEO A;  3QYH B;  2O4X B;  3RKX A;  2E10 A;  3G6E A;  4EMG A;  3OYI A;  2LQK A;  2RJD A;  4ZGD B;  1YJW T;  1H3Z A;  4FM4 B;  5LJ5 j;  4XU1 A;  2DIG A;  1XNI A;  5LJ3 f;  3X26 B;  4A4H A;  3JB9 F;  2PVO B;  1KHC A;  1W2B S;  2R5A A;  2RJC A;  4OB3 B;  1OZ3 A;  4C8Q G;  2QA4 T;  3CCL A;  1YJN T;  3GIB A;  3TCJ A;  1VQ4 A;  4M77 F;  3LWH A;  1Y7X A;  3CME A;  1JRI A;  3OBW A;  4ZGE B;  4M75 C;  4FIB A;  1G3S A;  4LDY A;  3X28 B;  3MEW A;  2EIF A;  4O6J A;  1XQH A;  2XI9 A;  3L1A A;  3LH0 A;  2QEX A;  3QBY A;  3MEA A;  4J7I A;  3A5Z B;  2E65 A;  2HNI A;  2LVM A;  4WF2 A;  3V8K A;  1VQM T;  1BYM A;  5GAN 5;  2LX9 A;  2RO0 A;  3L2Z A;  4A4G A;  1IRE B;  2QTX A;  4L59 A;  5GMK l;  3OYN A;  5LJ3 h;  3CC2 T;  3PT9 A;  4PNO A;  1Q86 C;  3LX7 A;  1AHJ B;  1KQS S;  1HK9 A;  2EQJ A;  5LJ3 e;  2CZ0 B;  1S72 A;  3NFC A;  2KVQ G;  4M77 A;  5GAN d;  2D6F A;  3NTH A;  3TEE A;  4XAX B;  2P0K A;  5CR2 A;  4Q5W A;  3M55 A;  3S3M A;  3G71 T;  1WQ7 A;  1VQM A;  2JN0 A;  3OSS C;  3FDR A;  5LJ3 d;  1Q81 U;  3TU4 K;  1VQ7 T;  4RG8 A;  2ZPB B;  5GAN f;  4XTZ A;  4EMK B;  3CCS T;  2LCC A;  4M78 A;  5CO7 A;  2LC4 A;  4J5Y A;  1K9M U;  3MHX A;  4XTX A;  2F5T X;  5A0D A;  4DOV A;  3JB9 I;  3WXM B;  4M77 D;  3PIP A;  3MET A;  3RUX A;  5IAY A;  3JB9 H;  2QQ9 A;  2E64 A;  3BFM A;  4M77 E;  1U1T A;  2QQR A;  3FIF A;  2JOY A;  3CCV A;  2GCX A;  2QDY B;  4ZN3 A;  3CC7 T;  5GAN j;  1Q86 U;  3P8D A;  1VQ9 T;  1PSF A;  4NL3 A;  1VQO A;  3CCL T;  2M1H A;  1YCY A;  3CCJ T;  1BI3 A;  3RKW A;  1VQK A;  5GAM e;  4JRK A;  4ATO A;  3OYF A;  2HD0 A;  3QII A;  4JS4 A;  3JCM f;  4C92 E;  3VV0 A;  1VQO T;  5GAO n;  2YLB A;  4F7U E;  1QVF S;  2E70 A;  1X75 C;  3BDU A;  2KY9 A;  4F7U G;  1Y07 A;  3OYH A;  2EAY A;  4C0Z A;  4GY5 A;  1KQS A;  4OF1 A;  4XTV A;  2K57 A;  2Y4Y A;  1K73 U;  4CI0 C;  3FRN A;  2JUF A;  4Z02 A;  2XDD A;  3JB9 G;  1BIB A;  1UGS B;  2P0P A;  5FRO A;  1VQP A;  1NJI U;  4QQ6 A;  5KCO A;  4E7L A;  4YTL A;  4M75 F;  2LT4 A;  4OGC A;  3DB3 A;  4C92 D;  2XIC A;  4L6V 5;  2RA2 A;  1ZHI A;  1KC8 C;  2V8J A;  4M7A G;  2K3Y A;  1Q82 C;  2PVG B;  4LDV A;  2XID A;  1P92 A;  4IUP A;  4CRI A;  2R58 A;  4L5G A;  5HK3 A;  5I2M A;  4LDX A;  3MCA B;  1BKB A;  3DLL A;  2AHJ B;  5GAN 2;  1D3B A;  3INZ A;  5LJ3 j;  4C5H A;  2QXF A;  2JTM A;  2EWN A;  2HQE A;  3QPH A;  4PJO F;  5C6S A;  3M54 A;  3FLG A;  5GAN 4;  4DA4 A;  4ZGJ B;  3BW1 A;  3H6Z A;  4PL6 A;  4PLL A;  4E7I A;  5LJ3 g;  5IT9 E;  3E19 A;  3VU3 C;  4PJO A;  3CMA T;  1M4Z A;  4KUD K;  3KBG A;  4DQ2 A;  3L2R A;  3LGF A;  1EIF A;  3CMA A;  1GXI E;  2DIQ A;  2V8I A;  2FHD A;  1U1S A;  1B34 A;  2JNG A;  2R57 A;  1O75 A;  2BIV A;  1BI1 A;  5CK9 A;  3JCM b;  5GAO r;  1YHQ T;  4PKC C;  3CCR A;  1YJN A;  2HAX A;  5GAN 7;  5D6Y A;  4EMH A;  3OYB A;  3G4S A;  1YIT A;  4JJN K;  4C92 B;  5GMK j;  1Q81 C;  2XKO C;  2LDM A;  2KQW A;  4B9X A;  1M90 C;  2KSS A;  3URG A;  2RHI A;  1XTD A;  4C8Q A;  2OTJ A;  1M1K U;  2EKO A;  3RER A;  4RCB A;  2RK1 A;  4ME7 A;  3ME9 A;  4LDU A;  1LNX A;  3QZ9 B;  5GAM h;  1LJO A;  1YBY A;  4E7H A;  3OYE A;  3OW2 A;  2F5K A;  4TVR A;  3Q1J A;  3SDZ A;  2P4T A;  2RJF A;  4C0F A;  5KH6 A;  4PJO G;  2V8K A;  1DJ7 B;  2K3X A;  2PUO B;  4C8Q F;  1PSE A;  3S6W A;  5CCA A;  3C94 A;  5HKC A;  4JUV A;  5GAN g;  3CCQ T;  4V2S A;  1RI0 A;  4MZT A;  5KE2 A;  4BE2 A;  4JRQ A;  2R5M A;  1NPR A;  3SWN B;  1NZ9 A;  3MEV A;  3ZEH A;  3CBM A;  3OA6 A;  3QZ5 B;  4PLI A;  5FRN A;  2NLU A;  4EMK A;  5LJ5 d;  3CC7 A;  1G3Y A;  3QJ6 A;  4BI4 A;  2FB7 A;  4JLI A;  3JAM E;  5DLO A;  3JCM d;  4M7D E;  3CCR T;  1K73 C;  1YHQ A;  1X01 A;  3M4G A;  3NTI A;  3HP9 A;  4DOW A;  2BKD N;  4M75 D;  5A0L A;  2A7Y A;  3JRZ A;  2DZ9 A;  5GAO m;  5CIU A;  1Y96 B;  2X35 A;  5EG2 A;  4QVC A;  3GOX A;  1WGS A;  1W4S A;  3LW5 E;  3S3O A;  4ZTF A;  2QI2 A;  1NJI C;  4BD3 A;  3CCM A;  3CCE T;  3CCU T;  1XOV A;  3CD6 A;  4E7K A;  3VKI A;  1QW1 A;  3T9N A;  1R8O B;  3ZFJ A;  4C5G A;  2CZ1 B;  3AHU A;  2QQS A;  3BY7 A;  3OMG A;  1YI2 T;  4C0D C;  3X25 B;  4KUI A;  1ZBX A;  4JS5 A;  3OYM A;  2WSE E;  4J6X A;  3SWN C;  2CGH A;  2LT1 A;  4A53 A;  3HFN A;  5I21 A;  3CCE A;  1Q7Y C;  4HCB A;  3RMS A;  4M78 G;  2B8A A;  4NOY A;  5DLQ E;  3L2Q A;  3V7S A;  1FWZ A;  1JBM A;  3A8G B;  1M5Q 1;  3GPL A;  3QXE B;  2DXU A;  4BY6 B;  3N5B B;  3CC4 A;  4MZM A;  2M9U A;  4M7D A;  2EQK A;  2E1H A;  3OYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...