1AWOA

The solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
SLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Kinase
molecule keywords ABL TYROSINE KINASE
publication title The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awoA00
1OOTA 2F2XA 3VS2A 5IHKA 2FPFA 3VS3A 4R0KA 4D8DA 3ULRB 2A28A 2EYXA 3TSWA 1NYGA 1WX6A 2RQWA 1NM7A 2DX1A 2LP5A 4OMLA 1W70A 1AZGB 1KIKA 2K79A 2GQIA 4HVVA 5GJVB 1ABQA 2EBPA 4AFZC 1SRLA 2C0OA 2ENMA 2MCNA 1GCQC 2EYYA 3A98A 2JS0A 4HXJA 1CKBA 2RF0A 3H0HA 1NEGA 2HEQA 1M3CA 1X27A 1BBZA 1MV3A 5FWBA 3H0FA 2VVKA 4HVUA 2O88A 3KFVA 4GBQA 4CC3A 1T3LA 1GCPA 1U06A 4QT7A 1K0XA 1V1CA 2RMOA 1K9AA 1UG1A 1WLPB 2JMAA 1ARKA 1H8KA 1G83A 2GNCA 2LQNA 2O31A 1IO6A 1PRLC 2DJQA 2EGCA 1ZUKA 2YUOA 2RQUA 1ZBJA 1VA7A 4F16A 4RTUA 4LUEA 1MUZA 4A63B 1KJWA 1UHCA 3M0PA 1Z9ZA 2DMOA 1WXBA 4IIMA 2AKKA 2YUPA 3RNJA 3I5SA 1BK2A 5IHNA 1QLYA 2LMJA 1QWEA 2A37A 2GBQA 4JJCA 1GBQA 1KFZA 1JQQA 2JMCA 1UGVA 4K11A 3VS5A 1ZLMA 1SHFA 4OMOA 1NEBA 2LJ3A 2YUQA 4HVWA 2BTTA 5L23A 2JM9A 2DL4A 2CDTA 2EPDA 2DL7A 4J9FA 2XMFA 2ROTA 1UE9A 3I5RA 1AOJA 3NPFA 2PNIA 4LUDA 2L0AA 1M27C 1G2BA 4Z8AA 3U23A 5I11A 1RLPC 2FO0A 1WFWA 2AZVA 2F2WA 5FWCA 2KE9A 3R6NA 2CH4A 3M0SA 2DRKA 1K1ZA 5IXFA 1T0HA 1SRMA 2O9VA 1X2KA 4Y92A 1PKSA 2BZXA 1GFCA 3UF4A 2DA9A 4J9BA 1OV3A 2NWMA 4KRTA 5IXBA 1QWFA 1Z9QA 2KRSA 2KR3A 3EHRA 2BZYA 4CC7A 2LX7A 1UJYA 2CUBA 1PKTA 1AEYA 3EG3A 1YCSB 2DL8A 4M4ZA 4JZ3A 2CSQA 1CKAA 1OEBA 4RTVA 1UJ0A 1W6XA 2X3WD 1GL5A 1B3QA 1WYXA 3NHNA 3REAB 1FMKA 2KRMA 2VKNA 1A0NB 3VS7A 2W0ZA 2ED1A 2C0IA 2A36A 3EG0A 1ABOA 1HD3A 1U5SA 1WIEA 1MV0B 3UA7A 1UDLA 2V1QA 3NMZC 2G6FX 2VWFA 3THKA 1WDXA 2KXDA 5EC7A 2LZ6B 2RPNA 2RN8A 2RQVA 1UTIA 4X1VA 3REBB 2DE0X 2DILA 2RQTA 2YDLA 3SHWA 1E6GA 2PZ1A 4CC4B 1ZX6A 2EGEA 1LCKA 2HBWA 2DF6A 3FJ5A 2EYZA 2FEIA 2LJ0A 3NGPA 3M0RA 2BZ8A 2AKLA 2EW3A 1SHGA 2L3SA 1GCQA 2YUNA 1AWJA 2DRMA 2K6DA 1JXMA 1E6HA 2I0NA 2ECZA 2KYBA 1BU1A 4OMQA 2DL5A 3ZL7C 2EGAA 2EQIA 1YP5A 4J9IA 3C0CA 2J6OA 2X3XD 2J05A 1T0JA 1I1JA 3EG2A 3TVTA 1UECA 2K9GA 4AFSC 4FSSA 2ABLA 4GLMA 2K2MA 1UFFA 1WI7A 2JTEA 4AFUC 2JW4A 4RTZA 2KBTA 2ROLA 3I9QA 2HSPA 3I35A 3VS4A 4RUGA 2LJ1A 1J3TA 3EG1A 4J9DA 4Z88A 3PE0A 2GGRA 4J9CA 1Y57A 1OPLA 1HJDA 1RUWA 1NG2A 4AFQC 2LCSA 1JU5C 1JO8A 2NUZA 4RTWA 2P4RA 5IHIA 1PHTA 1RLQC 2EKHA 2O9SA 1BB9A 3VS0A 3RBBB 1AWOA 1I0CA 4DEYA 2MIOA 2K3BA 1T3SA 4OMPA 2HCKA 2MOXA 1AZEA 2KXCA 2DL3A 1HSQA 1UHFA 1VYVA 1H92A 2JM8A 1M3AA 1S1NA 2L2PA 2J6KA 2SEMA 4DEXA 1E7OA 2OAWA 2CSIA 1QKXA 3M0TA 1ZSGA 2W10A 3H0IA 2KRNA 1GBRA 3O5ZA 2CT4A 1TUCA 3LH5A 2JT4A 3PVQA 1WXTA 2KT8A 4AG1C 5FW9A 2V1RA 2OJ2A 1WXUA 2A08A 1PRMC 2L3PA 2D8JA 1N5ZA 1M3BA 2CT3A 2OI3A 4RTTA 4ORZA 1VYUA 2AK5A 3M0QA 2RQRA 5ECAA 3VS6A 4EIKA 4F14A 2KGTA 1CSKA 2CH4W 4WCIA 1X69A 1B07A 2M51A 2DLPA 1K0SA 2M0YA 4AG2C 2JS2A 2D1XA 4RTYA 1XOVA 3VRYA 1FYNA 1PWTA 2KT1A 5GJWB 2J06A 1GFDA 3M0UA 1K4US 1SPKA 2GTJA 4JJBA 1AD5A 2PTKA 2H8HA 2C0TA 1K76A 1YN8A 1AVZC 3IQLA 1KSWA 2EYWA 4JJDA 1NLOC 1NYFA 2KROA 3VS1A 2RNAA 1RI9A 5IH2A 1VYTA 2DM1A 2DBMA 1ZUYA 3EHQA 1W1FA 2J7IA 4HCKA 2CREA 2DBKA 2KYMA 1EFNA 1X6GA 2FRWA 1GRIA 3QWXX 2J6FA 2GTOA 2FG0A 2ESWA 2AZSA 3H41A 1JXOA 2QDLA 1SEMA 4ESRA 4Z89A 3SEMA 2FRYA 2DYBA 2KEAA 4ZNXA 2LQWA 2O2OA 1I07A 4J9EA 4JZ4A 1X2QA 4LN2A 4D8KA 1WA7A 1PNJA 2SRCA 1AWXA 2FPEA 1Y0MA 2LNHB 1SSHA 2JXBA 5HCKA 1U3OA 1UUEA 4JPBW 4RTXA 4IIOA 3GBQA 1JEGA 1M30A 1QKWA 1H3HA 1M8MA 3UATA 1AWWA 4LNPA 2YSQA 3EGUA 2D8HA 1X6BA 3VRZA 1QCFA 3JV3A 4LE9A 1TUDA 2IIMA 1X43A 4J9GA 4CC2A 2YT6A 3PVLA 1YWPA 4J9HA 2K7AA 2CUDA 2EVRA 1OPKA 1YWOA 2D0NA 2DVJA 1YNZA 4OMMA 3UA6A 2B86A 2FPDA 2KNBB 1NLPC 3CQTA 1TG0A 2E5KA 2F2VA 4E6RA 2L3QA 4F17A 4OMNA 2DNUA 1ZUUA 5I22A 2HDAA 2ED0A 3TSZA 3QWYA
chains in the Genus database with same CATH superfamily
1OOTA 3CCSQ 3NFCA 1YFNA 3UDCA 5GANf 2CP6A 2KMTA 1K8AR 3HL8A 1NYGA 2RQWA 1WQWA 1VQ4T 2XDDA 3UWNA 4GY5A 1N8RR 2JOYA 2K79A 4HVVA 2EBPA 1SRLA 2MAMA 1GCQC 4IUQA 2X4XA 2EYYA 1KQSA 1VQPA 3P8DA 4M75C 1CKBA 2V8KA 5KYWA 4FCYA 4EPCA 2FL7A 3HHTB 4LXCA 2HEQA 3M58A 3RUXA 4DA4A 1M3CA 5FWBA 1X6OA 2XDBA 4V2SA 1OZ3A 2QI2A 2DD4A 3H0FA 1SSFA 1X01A 1VQ6A 3RKXA 3VYGA 4DOVA 1T3LA 1GCPA 1U06A 2M9UA 2EQJA 4PFOA 3CC4T 2LDMA 1WLPB 1XJWB 2A0FB 3H8ZA 1ARKA 2LTOA 4RG8A 1O75A 8AT1B 3OW2A 3OYDA 3X28B 1ZBJA 3CMAA 5C0MA 5CKFA 3Q1JA 4F16A 1N27A 5KYUA 5KE3A 1KJWA 3N5BB 4HA8A 2RJDA 4FYYB 4IIMA 1RABB 3VUZA 2X35A 1RADB 4QVZA 5I2SA 2LT4A 1QWEA 2QDYB 4QVCA 2A37A 4J6WA 3I55Q 4HT8A 2HL5C 4K11A 3VS5A 1JBMA 1Q81C 1M90R 4WTOB 3OYLA 4C92G 4J7FA 1IRXA 1TU0B 4E7SA 5L23A 5FU7B 2CDTA 4LDXA 4IUPA 5KCHA 4PLLA 1ZBXA 3NPFA 4FW2A 1FXXA 4LUDA 1NZ9A 1VQKA 3U23A 2FO0A 5GAN5 2NLUA 4M7DG 2DRKA 2D6FA 2O9VA 3OYHA 1O9SA 3X26B 2CKKA 1PKSA 2BZXA 1GFCA 3UF4A 3S3MA 2OTLQ 5GANj 3ASKA 3CBOA 5LJ3f 5IXBA 4JS4A 1Z9QA 2JTMA 2KRSA 2XU8A 2KR3A 1VQOT 3EHRA 4PFPA 1D0XA 3CC7A 4QQDA 3RERA 4RKUE 3GIBA 3EG3A 4M77D 4FU6A 3CC2Q 1RAGB 1VQMA 3JB9I 1GL5A 2EQKA 4KULA 2VGNA 4BDZA 2OTJA 2VKNA 1D3BA 3OYJA 4M7DC 2C0IA 2FZCB 4BUGA 3UT1A 1HD3A 4C8QD 1Q7YU 2DKGA 1OX9A 4EMKB 1RAAB 3DB4A 3NMZC 3ME9A 4E2FB 2G6FX 1D1AA 1LVKA 1KD1C 3LW5E 1N9RA 2COWA 3REBB 2DE0X 1VQNQ 4BB7A 1WHJA 4QQGA 1ZSZA 4J83A 3CCQA 2PZ1A 5LL6S 4E7ZA 2HBWA 2RB6A 1WGSA 2LJ0A 3NGPA 3CCVQ 1UGPB 3HRUA 2E1HA 3CCUT 2K6DA 3SD4A 1JXMA 2I0NA 3TQ7P 4N0AA 2ECZA 2D9TA 2YHTA 3OS2A 2EQIA 3M55A 1YP5A 4ZN3A 1S72A 1NJIR 2LQKA 3V8JA 4E7IA 4F7UA 4PJLA 5IT9E 4GLMA 2P0PA 4E47A 4ZGEB 3QDFA 4RMOA 1UFFA 1WI7A 4PNOA 5GAN6 5KYYA 1VQPQ 4RTZA 5KCOA 2DAQA 3X20B 2HSPA 3I35A 4C5GA 3EG1A 3PE0A 2GGRA 2RJFA 4J9CA 4M75F 1KC8C 1Y57A 3QJ6A 4AFQC 5D6XA 1JU5C 2EAYA 2WSCE 2H3EB 4RTWA 3EFSA 1VQ6Q 1PHTA 2RA2A 1BB9A 2BIVA 5FU6B 1Q95G 6AT1B 4FYVB 2K3BA 3QIIA 1VQ7T 2HCKA 5KH6A 1YJNT 4A53A 1HSQA 2E65A 3UPUA 1VYVA 1H92A 3JSCA 1G3YA 3CMAQ 2SEMA 4DEXA 4R55A 2CSIA 2GCXA 3URGA 4J6XA 2R5MA 5LJ3j 3GLXA 3A8LB 3H0IA 1BIBA 4KUIA 1M9SA 1TUCA 4DQ2A 3G71T 4N4HA 3SDZA 1PM3A 1WJQA 1IGUA 3CXCP 1MGQA 2DXUA 2HQXA 2KT8A 3JCMh 1I5OB 5KYXA 4J8OA 2LCCA 1OI1A 3DB3A 1WXUA 2A08A 2RHZA 2D8JA 1M3BA 2AT1B 4ORZA 4WF2A 1BCOA 2RQRA 4BACA 3CPWS 1Y96B 2CH4W 3S6WA 1B07A 2M51A 4C8QF 1KQ1A 2M0YA 1W4SA 3FLGA 1VQKQ 2J06A 1X75C 4E7JA 1SPKA 3LWHA 2XIDA 3GF5A 7AT1B 4BY6C 3NTHA 4JJBA 2C0TA 2R58A 3IQLA 3HSBA 1KQSP 1LOJA 5LJ5g 4JJDA 1NLOC 2CP3A 1NYFA 3VS1A 2RNAA 1KD1U 2DXCA 3CC7Q 5IH2A 1VYTA 3OY9A 3CPWA 3EGDB 1YHQT 2QEXT 5GAMh 1EFNA 1M2VA 4C5EA 1GRIA 3QWXX 1UGQB 2P84A 1VQMQ 2FRYA 2KEAA 1MNDA 4IURA 2DO3A 2K3YA 2CS7A 4M7AA 1WNLA 2OTJQ 4JZ4A 1X2QA 2GFUA 5GAN2 1PNJA 3MP6A 3OW2P 2LCLA 1U3OA 3CCRT 4M7DF 1F1BB 1NPRA 3M54A 2RO0A 4IUUA 5AT1B 3QO3A 3CD6A 2CYZB 2KK4A 2HL3A 4BE1A 2K5FA 4OB0B 1Y07A 1AWWA 4Z02A 4PL6A 1VQ5A 1QCFA 1KC8U 4ME7A 4CC2A 2OAUA 3PVLA 3OSVA 3E1SA 1YIJA 2QGGA 4FT2A 1Q81R 5DY9A 2DVJA 2V8IA 3GPLA 2XKOC 1M2OA 1NLPC 1Q82C 1S72Q 2EQUA 4E6RA 5I22A 5GANh 1FMWA 3JCMJ 1BI2A 3FC3A 3LX7A 3D7SB 3VS2A 4XTZA 4R0KA 4PJOG 4D8DA 2A28A 2EYXA 3WVDB 2MYSA 2LVMA 2ZCFB 2LP5A 2GF7A 4JRQA 4M78A 5CR2A 3BY7A 2RI5A 3LYIA 3CCUA 3EFOB 5GAN3 2ENMA 4J5YA 2MCNA 3A5ZB 3HFNA 3L42A 1U8RA 4FT4A 4C5HA 1HYOA 5IAYA 1HK9A 3PTAA 1V29B 4M7AE 3MEAA 4M75E 1AT1B 4JRPA 4KGZB 1MV3A 3BDUA 2FHDA 1C6VX 3OYNA 1B34B 2VVKA 2O88A 3KFVA 4GBQA 3ZFJA 2JUFA 4PJOC 4CC3A 4O6JA 5HKCA 2O4XB 2YLBA 1K0XA 4CRIA 2RMOA 1VQLT 1UG1A 1H8KA 2GNCA 2O31A 3CPFA 1PRLC 1UGRB 4RG2A 1YCYA 4M75B 2Y4XA 2RQUA 4C0GA 3H9NA 2DEUA 1WHGA 1YJ9T 4LUEA 1PSFA 2WSEE 1KD1R 2FVUA 3E19A 3E9FA 1YJNA 3P8HA 1R77A 2YUPA 2QA4A 2CZ1B 3FB9A 1MHNA 5IHNA 2KVQG 2RJEA 1QLYA 2H3JA 2X4YA 3O8VA 2F5KA 2E5QA 2EJ9A 4JJCA 1UEBA 3G71A 1H641 4MMKA 1UGVA 4DBHA 1QP3A 5LJ5e 3VKIA 3JB9D 1YITA 5L8RE 5GAOq 3BE3A 4C0DC 1NEBA 2YUQA 4HVWA 2X4WA 3HP9A 4AT1B 2ROTA 1UE9A 4M78E 2KAFA 2PNIA 2AIRB 1M27C 4Z8AA 1M8VA 1KC8R 2AZVA 3PMTA 4II1A 2QYZA 1UGSB 1YI2T 2L5QA 4B6MA 1M5Q1 1EX4A 5LJ3h 4DBQA 4JS5A 2QK0A 4C0ZA 1QWFA 2BZYA 4OGCA 2LX7A 4C92E 4KBMB 1Q7YC 5GMKi 1Q82U 3OW2S 4M4ZA 3CD6Q 1LPLA 5GMKj 4LDVA 2F5TX 2CZ7B 1B3QA 2VC8A 2QEXA 1VQ5Q 2RD1A 2A36A 4C92B 4NL2A 1U1SA 2DZ9A 3FDRA 3CCET 2KQWA 1MV0B 3MKDA 1UDLA 1WHHA 3FIFA 3OYYA 2QGFB 3OYAA 3MHXA 1YIJQ 4M77G 3CCMA 1MMAA 2FZGB 1JJ2A 2RN8A 4A4EA 2KY9A 3CCJA 4X1VA 1PCXA 4EMKA 2RQTA 2YDLA 3A8OB 2HAXA 4ZN1A 1E6GA 3G6ET 4M7DB 1BI1A 4CC4B 1IREB 1ZX6A 2EGEA 5GAMj 4NOYA 4C8QG 4J6YA 1R0BG 1K73C 2LNVA 4KGVB 1BU1A 4OMQA 2DL5A 3ZL7C 4J9IA 2X3XD 3EG2A 2OX7A 4M77C 3V7SA 4E7HA 3SFMA 3CCUQ 2E10A 3WXMB 5J39A 2K2MA 2JTEA 5D7UA 4AFUC 3CPWP 2JW4A 3I9QA 1QQJA 3VS4A 2LJ1A 4J9DA 4Z88A 1KHCA 1OPLA 4C8QC 1HJDA 2BKDN 4EMHA 4HCBA 2L3RA 2MI6A 3BFMA 3JB9J 4MMLA 2ZZDA 2PQWA 2CP5A 3RBBB 4F7UF 3A8GB 3WVEB 4DEYA 4JLIA 4M7AD 4A4KA 4PJOF 1XNIA 4LD6A 2E4HA 1YJWT 4OMPA 1AZEA 2M0OA 3QSUA 4FSXA 2A3LA 5CKBA 2J6KA 3CBPA 3X25B 3VYHB 1E7OA 1IB8A 3EG9B 5HY6A 2RM4A 1PD1A 3VV0A 1YJNQ 4IUVA 1LJOA 4BI8B 1VQ9A 2AHJB 1FX7A 4XU2A 4Q5WA 2QA4Q 1TH7A 4AG1C 1D0ZA 5FW9A 2P0KA 2DVEA 1YBYA 1PRMC 1Y7XA 2L3PA 3G71Q 1N5ZA 1AHJB 1V76A 1VYUA 1Q82R 3JCMQ 1YITQ 3TREA 1LNXA 3VS6A 2KGTA 1CSKA 4XK8E 5CO7A 1YJ9A 3FEOA 3C95A 1X69A 3CCLA 5M9OA 3I56A 1K0SA 1TWBA 2D1XA 3VRYA 2PVGB 5GJWB 1Y96A 4MZMA 5CKHA 2GTJA 1PG5B 2XICA 1QVGA 4M78D 1K76A 1VQ8A 1YN8A 1AVZC 2QASA 2R57A 4QKUA 2CP0A 2EYWA 2QQAA 4EMGA 3RESA 1RI9A 1Y71A 3EHQA 3G4ST 2CREA 2KYMA 1X6GA 2FRWA 3RDVA 2GTOA 4PKCC 3H41A 2ESWA 2AZSA 5D6YA 4D6WA 2QDLA 1PD0A 4OB1B 5I2MA 3OS0A 4ESRA 1BKBA 4BY6B 2DYBA 3HTRA 2A7YA 2EWNA 4ZNXA 3EGDA 1K73U 1RACB 3OYMA 2YWWA 1K9MC 4C92D 2QEXQ 3OA6A 3M57A 1OU9A 2SRCA 1AWXA 5FU7C 2YRCA 4OB3B 4BD3A 2HQEA 3JCMg 1WPYA 4CI0C 1BCMA 3LGLA 4E7LA 1M30A 1QKWA 3CCMQ 3V8KA 2YSQA 3EH2A 1EZZB 1QW1A 3CCJQ 2D8HA 4E7KA 1VQ4A 3JV3A 4LE9A 2IIMA 3OYFA 2DIQA 1JB0E 2YT6A 1YWPA 2K7AA 2CUDA 3OMCA 4J7IA 3JCMP 3S3OA 3E2UA 4OMMA 2ZPHB 2OTLT 2RK2A 1KK7A 1K8AC 4OMNA 1ZUUA 2L8DA 4M77F 3RIRA 3CC4A 2DYIA 2F2XA 1QMCA 2DZCA 3ULRB 3TSWA 1ZA2B 1WX6A 4JJNK 2DX1A 4JLGA 5GAMg 1C0MA 1AZGB 2HD0A 5I21A 5CK9A 1KIKA 1ACMB 2EIFA 2GQIA 2XDPA 5GMKh 5GJVB 4AFZC 3EFRA 2HMAA 4X9CA 3GNGA 5CKDA 1Q7YR 3BDLA 4OVAA 2QG9B 4KH0B 2KSSA 3EFOA 3JCMb 5DLQE 1VQNT 2VB6A 4EDUA 2PUKB 2CZ0B 3R6OA 2XHCA 3RMQA 3CCVT 1B7TA 1VQ9Q 1K9AA 3RKWA 4VUBA 4KH1B 2LQNA 1G3TA 1IO6A 9ATCB 1B34A 1ZUKA 2YUOA 3LH0A 4GLKA 2VUBA 4RTUA 2O4XA 1UHCA 1JJ2P 4BI4A 5KE2A 1Z9ZA 2LX9A 4KGXB 4M75A 4PJOB 3RKYA 3RNJA 2VXFA 1M1KC 1VQPT 3I5SA 1YJ9Q 5D6WA 1M4ZA 1BK2A 3CCLQ 3HPWA 3I56Q 1K73R 2LMJA 5J26A 1KFZA 1GBQA 5GANg 1VQOA 1IHVA 1VQ6T 3F70A 2DERA 2IVWA 1K9MU 2D0QB 1SHFA 3G7ZA 1KG1A 2ZPBB 3M59A 1SF9A 5C6SA 5GMKl 2BTTA 2RK1A 1VQ8Q 3H6ZA 3LLRA 2M16A 5LJ5d 3I5RA 3CMAT 1AOJA 2L0AA 1G2BA 1Q86C 2Y90A 5FWCA 1OYXA 2ZAEA 3A8HB 1QP2A 3R6NA 1IZ6A 4C0DB 4ZGDB 2DJZA 1K1ZA 5IXFA 1WQ7A 1T0HA 1SRMA 3JCMe 2M1HA 2CP7A 4LD9K 1WHLA 4F7UG 2NWMA 3M4GA 1YI2Q 4P5NA 2DFUA 2K2VA 1UJYA 3SWNB 1PKTA 1MNEA 1OZ2A 2BE7D 4L5GA 1IGQA 1ZSZC 1ZA1B 1K8AU 1NE8A 1YCSB 2ZGWA 4XAXB 5GANd 2MWPA 1OX8A 4JZ3A 1OEBA 1N8RU 1W6XA 3TEEA 1WYXA 1M1GA 3CEYA 2DD5A 1A0NB 2M02A 3VS7A 2W0ZA 1VQ4Q 4N0AC 2PVOB 3G4SA 1WJSA 1VQKT 3JB9H 5CQYA 3EG0A 1ABOA 1U5SA 2FYKA 2MK5A 1WIEA 3UA7A 2JNGA 2V1QA 3E9GA 4HKEA 2MPXC 3OYEA 2VWFA 1H3ZA 4ATOA 3THKA 5EG2A 1D1BA 5EC7A 4C92A 2RPNA 3MCAB 1TUGB 2RQVA 3GP8A 2DILA 3PFSA 3ZBDA 3SHWA 1VIFA 1RAIB 2DF6A 5A0LA 2FEIA 5GAMe 3M0RA 5AYFA 1SHGA 2L3SA 3CC4Q 2YUNA 3NTKA 2YRDA 1AWJA 2DRMA 1VQ7A 3CMET 2E70A 2KYBA 4M7DA 1BYMA 1QVGP 2EGAA 3DKMA 3L2ZA 2V26A 3OBYA 2OTJT 4DBRA 3L2QA 2J05A 1VIEA 3JCMc 8ATCB 2NUPB 1I1JA 1WZOA 5LJ3g 4FSSA 3JCMX 1QVPA 3PNWC 2CZ6B 2Y4YA 2K5IA 2ROLA 2HKQB 2XI9A 1MMNA 5A0DA 1M1KU 2B8AA 1RUWA 1NG2A 4BDYA 2IG0A 4FL6A 3CCQT 2EYQA 4C8QE 4BE2A 1RLQC 2O9SA 4M77B 2BUDA 1AWOA 2EJGA 2MIOA 1VUBA 2ZPEB 5LJ5f 2LT1A 2KXCA 3EGXB 2DL3A 1UHFA 1QVFA 1DJ7B 1S1NA 1S72T 4C8QB 4Y28E 1RAFB 2OAWA 3A8MB 1QKXA 1ZSGA 3O5ZA 2QTVA 1JJ2S 5GANe 2JT4A 3JCMW 4KUDK 3PVQA 4M7AG 1Q86U 1WJRA 2RHYA 4N4IA 3EG9A 5LJ3d 2HSEB 2E41A 1N9SA 3QJYA 3PGGA 3M53A 2QAZA 4OP0A 1VQOQ 2CT3A 2OI3A 4RTTA 1RAHB 2XD0A 1W2BA 1YHQA 2PU9B 2K4YA 4EIKA 4C5IA 4M7DE 4IUTA 1RI0A 4XTVA 1QCNA 2QXFA 4AG2C 2JS2A 3OYCA 1FYNA 1PWTA 2NYSA 2KT1A 4M7AC 3J80E 1K4US 3CCRA 2QTXA 1AD5A 2H8HA 3M5AA 2Z0WA 1KSWA 1OULA 3JCMV 3QKJA 2EKOA 3FJPA 2DBMA 1ZUYA 1M1FA 1W1FA 2J7IA 4HCKA 4JDSA 2DTOA 2DBKA 3PIPA 2FG0A 1NJIU 5CCAA 4Z89A 5GAN4 2DETA 1I4K1 4M78G 2G3RA 2LQWA 4ANJA 2O2OA 1I07A 3PIOA 4J9EA 4XTWA 5FROA 2XG8D 3G4SQ 2FPEA 3GOXA 1D09B 3ER0A 4N4GA 5HCKA 2JZ2A 4JPBW 3JB9F 3OS1A 2BE9B 1P92A 3V7RA 3QDRB 2E6ZA 2I2LA 3RR6A 4PLIA 3PT9A 3OSSC 3OS5A 1H3HA 5LJ5j 3UATA 1D1CA 3MEVA 1M1KR 4M75D 3BW1A 3VRZA 5GAOm 3OYGA 2VV5A 1TUDA 2XK0A 2HNIA 3QHSA 4M78C 1X43A 3QPHA 3VUBA 4XTYA 3NTIA 3MEWA 2KI7A 1VQ7Q 1PSEA 5LJ3e 2NUTB 2D0NA 2FPDA 3CCST 2KNBB 2MMPA 2E5KA 2DTIA 1RAEB 2DPPB 2E64A 2F2VA 5GAN7 4ZTFA 2L3QA 1QVGS 3G1JA 3MPUB 2C06A 5A0GA 2HDAA 3CD6T 4KT0E 1VQLA 4O5VA 4C92C 1Q86R 5IHKA 2FPFA 3VS3A 1FWZA 2EJFA 2YRVA 3QUIA 4L59A 1NM7A 3OYKA 4OMLA 2E6NA 1W70A 1VQ5T 5KYWB 2R5AA 1ABQA 4MZPA 3V8LA 2C0OA 3CMEA 3DLMA 3QYGB 5CAIA 2F1LA 4ZGJB 3A98A 1UB4A 2JS0A 1YIJT 4HXJA 3JRZA 4NL3A 2PVDB 2O01E 2L89A 2RF0A 3H0HA 1NEGA 1X27A 4XU3A 5CQXA 1BBZA 5CIUA 3RMSA 2QQSA 2E12A 2VASA 2VXEA 4HVUA 1ZHIA 3OQ5A 2QQ9A 5KYUB 4HT9A 3AHUA 4QT7A 1TXQA 1V1CA 2JMAA 3KBGA 3C4SA 1G83A 1TOVA 2E3HA 2DJQA 2EGCA 4B9XA 1BI3A 1VA7A 4QW2A 3OYIA 1MUZA 4A63B 4B9WA 5J3BA 1NBEB 3HFOA 3M0PA 2DMOA 3I55T 1WXBA 1YHQQ 3INZA 2AKKA 1YI2A 3C94A 2LQ8A 4PJOA 2GBQA 1JQQA 2JMCA 2LRQA 5HK3A 3L1AA 2DTHA 3CCRQ 2ZPFB 3META 4OGEA 1KHIA 1ZLMA 4PK4A 3DLLA 4M7DD 4M7AF 1WHMA 4OMOA 2RI2A 5GAOp 2LJ3A 4R56A 4LDUA 1VOMA 2QQBA 2JM9A 2RJCA 2DL4A 1QCOA 2EPDA 4UC4A 1I81A 2DL7A 4J9FA 2XMFA 3M9QA 3V7CA 1MMDA 3AT1B 1MMGA 1SKUB 3GNFB 1BIAA 5I11A 1RLPC 1WFWA 1Q81U 3CCEA 2F2WA 3VJPA 4ZTJA 2KE9A 2K3XA 2CH4A 3M0SA 2HZYA 2E3IA 2JTFA 1N8RC 2QA4T 2MWOA 4Y92A 1X2KA 5IN1A 2DA9A 4J9BA 1OV3A 3QXEB 2RHIA 3CC2T 1OQKA 3L2UA 4KRTA 3M4YA 1G5VA 1QVFP 2F69A 3G6EA 4CC7A 1TTHB 3JCMd 2CUBA 4EMKC 1D3BB 1AEYA 1YITT 1EIFA 2DL8A 1XTDA 2CSQA 1CKAA 1R0CB 4RTVA 1UJ0A 2V8JA 2X3WD 4FM4B 3NHNA 3SWNA 3REAB 1FMKA 2DK3A 2KRMA 4OF1A 2ED1A 3X24B 4PJNA 4RCCA 3KXTA 4PFZA 4IKFA 4X34A 1ZSZB 5FRMA 3QBYA 2DEQA 4M78F 5GAN8 1W2BP 1WDXA 4F7UE 2KXDA 2LZ6B 1OU8A 4PJOE 1UTIA 4HCCA 5CKEA 2X4JA 1LCKA 3FJ5A 2EYZA 4L6V5 4XTXA 2BZ8A 2AKLA 2EW3A 1GCQA 3T9NA 4F7UB 1WHKA 2DXBA 1VQLQ 1G3WA 1YJWA 3QZ9B 2DIGA 1E6HA 1U1TA 4FW1A 4HCZA 4JUVA 3OMGA 3OBWA 2VGMA 5CVIA 1M90C 4C92F 5GAMd 5KYYB 3C0CA 2J6OA 4XU1A 2GFAA 2ZPIB 1T0JA 3TVTA 4BI3A 1UECA 5FU6C 2K9GA 4AFSC 4FYXB 2ABLA 3CMEQ 4BE0A 2LC4A 4QVDA 3CCSA 2KBTA 3C12A 3MP8A 1C1AA 2NUPA 3CCMT 4RUGA 1J3TA 2COZA 4JRKA 3EAEA 3CCJT 2P0QA 2LCSA 3S3NA 1JO8A 2KDSA 2NUZA 2VYTA 2P4RA 5IHIA 2EKHA 5LJ5h 3VS0A 4FIBA 1I0CA 3HRSA 4A4HA 4YTLA 2MF2A 1T3SA 4DBFA 2IPOB 2GQVA 5A2QE 2MOXA 2HKNA 2YLCA 4PJJA 2ATCB 4TVRA 1BI0A 3CCQQ 5HK0A 2JM8A 1M3AA 4M77A 2ZPGB 2L2PA 3JB9G 4A54A 3M0TA 2K5LA 3P8BB 5KYXB 2W10A 2KRNA 1GBRA 3EGXA 2CT4A 3LH5A 3FRNA 1WXTA 3L2VA 4C8QA 5DM7R 2V1RA 4XQ3A 4LDWA 4XTUA 4FYWB 2EQMA 2OJ2A 3CBMA 3LWIA 3JCMf 1TS9A 2RI3A 3A1PA 4XU0A 2YXYA 5GMKe 3MO8A 3SB2A 3M0QA 2AK5A 3QG1A 5ECAA 4F14A 2JN0A 5DLOA 3TCJA 3L2RA 4WCIA 5FLXE 2DLPA 1PC0A 2WACA 3L2WA 3I55A 2JJ9A 4RTYA 1XOVA 1GFDA 3M0UA 2K57A 3CCEQ 3PMIA 4AMCA 3HKSA 3M56A 1D0YA 1R8OB 1VQ9T 1I5LA 3CC7T 4QQ6A 1NJIC 4JRIA 2PTKA 4A4GA 4DOWA 2JVVA 4MDWA 4NS5A 1M2VB 1IHWA 1N6AA 4MDXA 3LGFA 3OB9A 1VQMT 2KROA 2PUOB 3MJXA 3JAME 3VU3C 2FZKB 1HXDA 2COYA 3G6EQ 5GAOr 2DM1A 4M7AB 1IXDA 1ZQ1A 2CGHA 3MP1A 1QVFS 5GAOn 3CXCS 2J6FA 1JXOA 2FB7A 1NPPA 1SEMA 3SEMA 2WSFE 3CCLT 5GAMf 4MZTA 4M77E 2OTLA 2DXTA 2RH2A 1I8FA 3I56T 3OYBA 3J81E 4LN2A 4D8KA 1WA7A 4Y91A 1Y0MA 1RL2A 2LNHB 2RHXA 1SSHA 2JXBA 1UUEA 1M90U 2RHUA 1XQHA 4OMFB 5GMKm 1TSFA 4RTXA 4IIOA 3GBQA 3QYHB 3CC2A 1JEGA 1VQ8T 1K9MR 1M8MA 5KYNA 4LNPA 3EGUA 4X9DA 1W2BS 4RCBA 5FRNA 2X9HA 2HBPA 1FMVA 2X51A 4F04B 1X6BA 1G8XA 4ELZC 3CXCA 3MEUA 4J9GA 4C0FA 4LDYA 4A4FA 4J9HA 2HQHA 2P4TA 1JRIA 3EH1A 2EVRA 4PJOD 1YJWQ 1OPKA 1YWOA 4PJMA 3KUFA 3QZ5B 1YNZA 1KQSS 3UA6A 2B86A 3SWNC 2QQRA 5GAOl 2CP2A 4OB2B 1G3SA 3CQTA 1TG0A 3HRTA 1VQNA 1GXIE 4M75G 2EFIA 3J7AF 4F17A 3ZEHA 2DNUA 4ELYC 3TU4K 2NUTA 1KQ2A 4M78B 3CCVA 2ED0A 3TSZA 3QWYA 1SG5A
chains in the Genus database with same CATH topology
1OOTA 2F2XA 3VS2A 5IHKA 2FPFA 3VS3A 4R0KA 4D8DA 3ULRB 2A28A 2EYXA 3TSWA 1NYGA 1WX6A 2RQWA 1NM7A 2DX1A 2LP5A 4OMLA 1W70A 1AZGB 1KIKA 2K79A 2GQIA 4HVVA 5GJVB 1ABQA 2EBPA 4AFZC 1SRLA 2C0OA 2ENMA 2MCNA 1GCQC 2EYYA 3A98A 2JS0A 4HXJA 1CKBA 2RF0A 3H0HA 1NEGA 2HEQA 1M3CA 1X27A 1BBZA 1MV3A 5FWBA 3H0FA 2VVKA 4HVUA 2O88A 3KFVA 4GBQA 4CC3A 1T3LA 1GCPA 1U06A 4QT7A 1K0XA 1V1CA 2RMOA 1K9AA 1UG1A 1WLPB 2JMAA 1ARKA 1H8KA 1G83A 2GNCA 2LQNA 2O31A 1IO6A 1PRLC 2DJQA 2EGCA 1ZUKA 2YUOA 2RQUA 1ZBJA 1VA7A 4F16A 4RTUA 4LUEA 1MUZA 4A63B 1KJWA 1UHCA 3M0PA 1Z9ZA 2DMOA 1WXBA 4IIMA 2AKKA 2YUPA 3RNJA 3I5SA 1BK2A 5IHNA 1QLYA 2LMJA 1QWEA 2A37A 2GBQA 4JJCA 1GBQA 1KFZA 1JQQA 2JMCA 1UGVA 4K11A 3VS5A 1ZLMA 1SHFA 4OMOA 1NEBA 2LJ3A 2YUQA 4HVWA 2BTTA 5L23A 2JM9A 2DL4A 2CDTA 2EPDA 2DL7A 4J9FA 2XMFA 2ROTA 1UE9A 3I5RA 1AOJA 3NPFA 2PNIA 4LUDA 2L0AA 1M27C 1G2BA 4Z8AA 3U23A 5I11A 1RLPC 2FO0A 1WFWA 2AZVA 2F2WA 5FWCA 2KE9A 3R6NA 2CH4A 3M0SA 2DRKA 1K1ZA 5IXFA 1T0HA 1SRMA 2O9VA 1X2KA 4Y92A 1PKSA 2BZXA 1GFCA 3UF4A 2DA9A 4J9BA 1OV3A 2NWMA 4KRTA 5IXBA 1QWFA 1Z9QA 2KRSA 2KR3A 3EHRA 2BZYA 4CC7A 2LX7A 1UJYA 2CUBA 1PKTA 1AEYA 3EG3A 1YCSB 2DL8A 4M4ZA 4JZ3A 2CSQA 1CKAA 1OEBA 4RTVA 1UJ0A 1W6XA 2X3WD 1GL5A 1B3QA 1WYXA 3NHNA 3REAB 1FMKA 2KRMA 2VKNA 1A0NB 3VS7A 2W0ZA 2ED1A 2C0IA 2A36A 3EG0A 1ABOA 1HD3A 1U5SA 1WIEA 1MV0B 3UA7A 1UDLA 2V1QA 3NMZC 2G6FX 2VWFA 3THKA 1WDXA 2KXDA 5EC7A 2LZ6B 2RPNA 2RN8A 2RQVA 1UTIA 4X1VA 3REBB 2DE0X 2DILA 2RQTA 2YDLA 3SHWA 1E6GA 2PZ1A 4CC4B 1ZX6A 2EGEA 1LCKA 2HBWA 2DF6A 3FJ5A 2EYZA 2FEIA 2LJ0A 3NGPA 3M0RA 2BZ8A 2AKLA 2EW3A 1SHGA 2L3SA 1GCQA 2YUNA 1AWJA 2DRMA 2K6DA 1JXMA 1E6HA 2I0NA 2ECZA 2KYBA 1BU1A 4OMQA 2DL5A 3ZL7C 2EGAA 2EQIA 1YP5A 4J9IA 3C0CA 2J6OA 2X3XD 2J05A 1T0JA 1I1JA 3EG2A 3TVTA 1UECA 2K9GA 4AFSC 4FSSA 2ABLA 4GLMA 2K2MA 1UFFA 1WI7A 2JTEA 4AFUC 2JW4A 4RTZA 2KBTA 2ROLA 3I9QA 2HSPA 3I35A 3VS4A 4RUGA 2LJ1A 1J3TA 3EG1A 4J9DA 4Z88A 3PE0A 2GGRA 4J9CA 1Y57A 1OPLA 1HJDA 1RUWA 1NG2A 4AFQC 2LCSA 1JU5C 1JO8A 2NUZA 4RTWA 2P4RA 5IHIA 1PHTA 1RLQC 2EKHA 2O9SA 1BB9A 3VS0A 3RBBB 1AWOA 1I0CA 4DEYA 2MIOA 2K3BA 1T3SA 4OMPA 2HCKA 2MOXA 1AZEA 2KXCA 2DL3A 1HSQA 1UHFA 1VYVA 1H92A 2JM8A 1M3AA 1S1NA 2L2PA 2J6KA 2SEMA 4DEXA 1E7OA 2OAWA 2CSIA 1QKXA 3M0TA 1ZSGA 2W10A 3H0IA 2KRNA 1GBRA 3O5ZA 2CT4A 1TUCA 3LH5A 2JT4A 3PVQA 1WXTA 2KT8A 4AG1C 5FW9A 2V1RA 2OJ2A 1WXUA 2A08A 1PRMC 2L3PA 2D8JA 1N5ZA 1M3BA 2CT3A 2OI3A 4RTTA 4ORZA 1VYUA 2AK5A 3M0QA 2RQRA 5ECAA 3VS6A 4EIKA 4F14A 2KGTA 1CSKA 2CH4W 4WCIA 1X69A 1B07A 2M51A 2DLPA 1K0SA 2M0YA 4AG2C 2JS2A 2D1XA 4RTYA 1XOVA 3VRYA 1FYNA 1PWTA 2KT1A 5GJWB 2J06A 1GFDA 3M0UA 1K4US 1SPKA 2GTJA 4JJBA 1AD5A 2PTKA 2H8HA 2C0TA 1K76A 1YN8A 1AVZC 3IQLA 1KSWA 2EYWA 4JJDA 1NLOC 1NYFA 2KROA 3VS1A 2RNAA 1RI9A 5IH2A 1VYTA 2DM1A 2DBMA 1ZUYA 3EHQA 1W1FA 2J7IA 4HCKA 2CREA 2DBKA 2KYMA 1EFNA 1X6GA 2FRWA 1GRIA 3QWXX 2J6FA 2GTOA 2FG0A 2ESWA 2AZSA 3H41A 1JXOA 2QDLA 1SEMA 4ESRA 4Z89A 3SEMA 2FRYA 2DYBA 2KEAA 4ZNXA 2LQWA 2O2OA 1I07A 4J9EA 4JZ4A 1X2QA 4LN2A 4D8KA 1WA7A 1PNJA 2SRCA 1AWXA 2FPEA 1Y0MA 2LNHB 1SSHA 2JXBA 5HCKA 1U3OA 1UUEA 4JPBW 4RTXA 4IIOA 3GBQA 1JEGA 1M30A 1QKWA 1H3HA 1M8MA 3UATA 1AWWA 4LNPA 2YSQA 3EGUA 2D8HA 1X6BA 3VRZA 1QCFA 3JV3A 4LE9A 1TUDA 2IIMA 1X43A 4J9GA 4CC2A 2YT6A 3PVLA 1YWPA 4J9HA 2K7AA 2CUDA 2EVRA 1OPKA 1YWOA 2D0NA 2DVJA 1YNZA 4OMMA 3UA6A 2B86A 2FPDA 2KNBB 1NLPC 3CQTA 1TG0A 2E5KA 2F2VA 4E6RA 2L3QA 4F17A 4OMNA 2DNUA 1ZUUA 5I22A 2HDAA 2ED0A 3TSZA 3QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOT A;  2F2X A;  3VS2 A;  5IHK A;  2FPF A;  3VS3 A;  4R0K A;  4D8D A;  3ULR B;  2A28 A;  2EYX A;  3TSW A;  1NYG A;  1WX6 A;  2RQW A;  1NM7 A;  2DX1 A;  2LP5 A;  4OML A;  1W70 A;  1AZG B;  1KIK A;  2K79 A;  2GQI A;  4HVV A;  5GJV B;  1ABQ A;  2EBP A;  4AFZ C;  1SRL A;  2C0O A;  2ENM A;  2MCN A;  1GCQ C;  2EYY A;  3A98 A;  2JS0 A;  4HXJ A;  1CKB A;  2RF0 A;  3H0H A;  1NEG A;  2HEQ A;  1M3C A;  1X27 A;  1BBZ A;  1MV3 A;  5FWB A;  3H0F A;  2VVK A;  4HVU A;  2O88 A;  3KFV A;  4GBQ A;  4CC3 A;  1T3L A;  1GCP A;  1U06 A;  4QT7 A;  1K0X A;  1V1C A;  2RMO A;  1K9A A;  1UG1 A;  1WLP B;  2JMA A;  1ARK A;  1H8K A;  1G83 A;  2GNC A;  2LQN A;  2O31 A;  1IO6 A;  1PRL C;  2DJQ A;  2EGC A;  1ZUK A;  2YUO A;  2RQU A;  1ZBJ A;  1VA7 A;  4F16 A;  4RTU A;  4LUE A;  1MUZ A;  4A63 B;  1KJW A;  1UHC A;  3M0P A;  1Z9Z A;  2DMO A;  1WXB A;  4IIM A;  2AKK A;  2YUP A;  3RNJ A;  3I5S A;  1BK2 A;  5IHN A;  1QLY A;  2LMJ A;  1QWE A;  2A37 A;  2GBQ A;  4JJC A;  1GBQ A;  1KFZ A;  1JQQ A;  2JMC A;  1UGV A;  4K11 A;  3VS5 A;  1ZLM A;  1SHF A;  4OMO A;  1NEB A;  2LJ3 A;  2YUQ A;  4HVW A;  2BTT A;  5L23 A;  2JM9 A;  2DL4 A;  2CDT A;  2EPD A;  2DL7 A;  4J9F A;  2XMF A;  2ROT A;  1UE9 A;  3I5R A;  1AOJ A;  3NPF A;  2PNI A;  4LUD A;  2L0A A;  1M27 C;  1G2B A;  4Z8A A;  3U23 A;  5I11 A;  1RLP C;  2FO0 A;  1WFW A;  2AZV A;  2F2W A;  5FWC A;  2KE9 A;  3R6N A;  2CH4 A;  3M0S A;  2DRK A;  1K1Z A;  5IXF A;  1T0H A;  1SRM A;  2O9V A;  1X2K A;  4Y92 A;  1PKS A;  2BZX A;  1GFC A;  3UF4 A;  2DA9 A;  4J9B A;  1OV3 A;  2NWM A;  4KRT A;  5IXB A;  1QWF A;  1Z9Q A;  2KRS A;  2KR3 A;  3EHR A;  2BZY A;  4CC7 A;  2LX7 A;  1UJY A;  2CUB A;  1PKT A;  1AEY A;  3EG3 A;  1YCS B;  2DL8 A;  4M4Z A;  4JZ3 A;  2CSQ A;  1CKA A;  1OEB A;  4RTV A;  1UJ0 A;  1W6X A;  2X3W D;  1GL5 A;  1B3Q A;  1WYX A;  3NHN A;  3REA B;  1FMK A;  2KRM A;  2VKN A;  1A0N B;  3VS7 A;  2W0Z A;  2ED1 A;  2C0I A;  2A36 A;  3EG0 A;  1ABO A;  1HD3 A;  1U5S A;  1WIE A;  1MV0 B;  3UA7 A;  1UDL A;  2V1Q A;  3NMZ C;  2G6F X;  2VWF A;  3THK A;  1WDX A;  2KXD A;  5EC7 A;  2LZ6 B;  2RPN A;  2RN8 A;  2RQV A;  1UTI A;  4X1V A;  3REB B;  2DE0 X;  2DIL A;  2RQT A;  2YDL A;  3SHW A;  1E6G A;  2PZ1 A;  4CC4 B;  1ZX6 A;  2EGE A;  1LCK A;  2HBW A;  2DF6 A;  3FJ5 A;  2EYZ A;  2FEI A;  2LJ0 A;  3NGP A;  3M0R A;  2BZ8 A;  2AKL A;  2EW3 A;  1SHG A;  2L3S A;  1GCQ A;  2YUN A;  1AWJ A;  2DRM A;  2K6D A;  1JXM A;  1E6H A;  2I0N A;  2ECZ A;  2KYB A;  1BU1 A;  4OMQ A;  2DL5 A;  3ZL7 C;  2EGA A;  2EQI A;  1YP5 A;  4J9I A;  3C0C A;  2J6O A;  2X3X D;  2J05 A;  1T0J A;  1I1J A;  3EG2 A;  3TVT A;  1UEC A;  2K9G A;  4AFS C;  4FSS A;  2ABL A;  4GLM A;  2K2M A;  1UFF A;  1WI7 A;  2JTE A;  4AFU C;  2JW4 A;  4RTZ A;  2KBT A;  2ROL A;  3I9Q A;  2HSP A;  3I35 A;  3VS4 A;  4RUG A;  2LJ1 A;  1J3T A;  3EG1 A;  4J9D A;  4Z88 A;  3PE0 A;  2GGR A;  4J9C A;  1Y57 A;  1OPL A;  1HJD A;  1RUW A;  1NG2 A;  4AFQ C;  2LCS A;  1JU5 C;  1JO8 A;  2NUZ A;  4RTW A;  2P4R A;  5IHI A;  1PHT A;  1RLQ C;  2EKH A;  2O9S A;  1BB9 A;  3VS0 A;  3RBB B;  1AWO A;  1I0C A;  4DEY A;  2MIO A;  2K3B A;  1T3S A;  4OMP A;  2HCK A;  2MOX A;  1AZE A;  2KXC A;  2DL3 A;  1HSQ A;  1UHF A;  1VYV A;  1H92 A;  2JM8 A;  1M3A A;  1S1N A;  2L2P A;  2J6K A;  2SEM A;  4DEX A;  1E7O A;  2OAW A;  2CSI A;  1QKX A;  3M0T A;  1ZSG A;  2W10 A;  3H0I A;  2KRN A;  1GBR A;  3O5Z A;  2CT4 A;  1TUC A;  3LH5 A;  2JT4 A;  3PVQ A;  1WXT A;  2KT8 A;  4AG1 C;  5FW9 A;  2V1R A;  2OJ2 A;  1WXU A;  2A08 A;  1PRM C;  2L3P A;  2D8J A;  1N5Z A;  1M3B A;  2CT3 A;  2OI3 A;  4RTT A;  4ORZ A;  1VYU A;  2AK5 A;  3M0Q A;  2RQR A;  5ECA A;  3VS6 A;  4EIK A;  4F14 A;  2KGT A;  1CSK A;  2CH4 W;  4WCI A;  1X69 A;  1B07 A;  2M51 A;  2DLP A;  1K0S A;  2M0Y A;  4AG2 C;  2JS2 A;  2D1X A;  4RTY A;  1XOV A;  3VRY A;  1FYN A;  1PWT A;  2KT1 A;  5GJW B;  2J06 A;  1GFD A;  3M0U A;  1K4U S;  1SPK A;  2GTJ A;  4JJB A;  1AD5 A;  2PTK A;  2H8H A;  2C0T A;  1K76 A;  1YN8 A;  1AVZ C;  3IQL A;  1KSW A;  2EYW A;  4JJD A;  1NLO C;  1NYF A;  2KRO A;  3VS1 A;  2RNA A;  1RI9 A;  5IH2 A;  1VYT A;  2DM1 A;  2DBM A;  1ZUY A;  3EHQ A;  1W1F A;  2J7I A;  4HCK A;  2CRE A;  2DBK A;  2KYM A;  1EFN A;  1X6G A;  2FRW A;  1GRI A;  3QWX X;  2J6F A;  2GTO A;  2FG0 A;  2ESW A;  2AZS A;  3H41 A;  1JXO A;  2QDL A;  1SEM A;  4ESR A;  4Z89 A;  3SEM A;  2FRY A;  2DYB A;  2KEA A;  4ZNX A;  2LQW A;  2O2O A;  1I07 A;  4J9E A;  4JZ4 A;  1X2Q A;  4LN2 A;  4D8K A;  1WA7 A;  1PNJ A;  2SRC A;  1AWX A;  2FPE A;  1Y0M A;  2LNH B;  1SSH A;  2JXB A;  5HCK A;  1U3O A;  1UUE A;  4JPB W;  4RTX A;  4IIO A;  3GBQ A;  1JEG A;  1M30 A;  1QKW A;  1H3H A;  1M8M A;  3UAT A;  1AWW A;  4LNP A;  2YSQ A;  3EGU A;  2D8H A;  1X6B A;  3VRZ A;  1QCF A;  3JV3 A;  4LE9 A;  1TUD A;  2IIM A;  1X43 A;  4J9G A;  4CC2 A;  2YT6 A;  3PVL A;  1YWP A;  4J9H A;  2K7A A;  2CUD A;  2EVR A;  1OPK A;  1YWO A;  2D0N A;  2DVJ A;  1YNZ A;  4OMM A;  3UA6 A;  2B86 A;  2FPD A;  2KNB B;  1NLP C;  3CQT A;  1TG0 A;  2E5K A;  2F2V A;  4E6R A;  2L3Q A;  4F17 A;  4OMN A;  2DNU A;  1ZUU A;  5I22 A;  2HDA A;  2ED0 A;  3TSZ A;  3QWY A; 
#chains in the Genus database with same CATH topology
 1OOT A;  3CCS Q;  3NFC A;  1YFN A;  3UDC A;  5GAN f;  2CP6 A;  2KMT A;  1K8A R;  3HL8 A;  1NYG A;  2RQW A;  1WQW A;  1VQ4 T;  2XDD A;  3UWN A;  4GY5 A;  1N8R R;  2JOY A;  2K79 A;  4HVV A;  2EBP A;  1SRL A;  2MAM A;  1GCQ C;  4IUQ A;  2X4X A;  2EYY A;  1KQS A;  1VQP A;  3P8D A;  4M75 C;  1CKB A;  2V8K A;  5KYW A;  4FCY A;  4EPC A;  2FL7 A;  3HHT B;  4LXC A;  2HEQ A;  3M58 A;  3RUX A;  4DA4 A;  1M3C A;  5FWB A;  1X6O A;  2XDB A;  4V2S A;  1OZ3 A;  2QI2 A;  2DD4 A;  3H0F A;  1SSF A;  1X01 A;  1VQ6 A;  3RKX A;  3VYG A;  4DOV A;  1T3L A;  1GCP A;  1U06 A;  2M9U A;  2EQJ A;  4PFO A;  3CC4 T;  2LDM A;  1WLP B;  1XJW B;  2A0F B;  3H8Z A;  1ARK A;  2LTO A;  4RG8 A;  1O75 A;  8AT1 B;  3OW2 A;  3OYD A;  3X28 B;  1ZBJ A;  3CMA A;  5C0M A;  5CKF A;  3Q1J A;  4F16 A;  1N27 A;  5KYU A;  5KE3 A;  1KJW A;  3N5B B;  4HA8 A;  2RJD A;  4FYY B;  4IIM A;  1RAB B;  3VUZ A;  2X35 A;  1RAD B;  4QVZ A;  5I2S A;  2LT4 A;  1QWE A;  2QDY B;  4QVC A;  2A37 A;  4J6W A;  3I55 Q;  4HT8 A;  2HL5 C;  4K11 A;  3VS5 A;  1JBM A;  1Q81 C;  1M90 R;  4WTO B;  3OYL A;  4C92 G;  4J7F A;  1IRX A;  1TU0 B;  4E7S A;  5L23 A;  5FU7 B;  2CDT A;  4LDX A;  4IUP A;  5KCH A;  4PLL A;  1ZBX A;  3NPF A;  4FW2 A;  1FXX A;  4LUD A;  1NZ9 A;  1VQK A;  3U23 A;  2FO0 A;  5GAN 5;  2NLU A;  4M7D G;  2DRK A;  2D6F A;  2O9V A;  3OYH A;  1O9S A;  3X26 B;  2CKK A;  1PKS A;  2BZX A;  1GFC A;  3UF4 A;  3S3M A;  2OTL Q;  5GAN j;  3ASK A;  3CBO A;  5LJ3 f;  5IXB A;  4JS4 A;  1Z9Q A;  2JTM A;  2KRS A;  2XU8 A;  2KR3 A;  1VQO T;  3EHR A;  4PFP A;  1D0X A;  3CC7 A;  4QQD A;  3RER A;  4RKU E;  3GIB A;  3EG3 A;  4M77 D;  4FU6 A;  3CC2 Q;  1RAG B;  1VQM A;  3JB9 I;  1GL5 A;  2EQK A;  4KUL A;  2VGN A;  4BDZ A;  2OTJ A;  2VKN A;  1D3B A;  3OYJ A;  4M7D C;  2C0I A;  2FZC B;  4BUG A;  3UT1 A;  1HD3 A;  4C8Q D;  1Q7Y U;  2DKG A;  1OX9 A;  4EMK B;  1RAA B;  3DB4 A;  3NMZ C;  3ME9 A;  4E2F B;  2G6F X;  1D1A A;  1LVK A;  1KD1 C;  3LW5 E;  1N9R A;  2COW A;  3REB B;  2DE0 X;  1VQN Q;  4BB7 A;  1WHJ A;  4QQG A;  1ZSZ A;  4J83 A;  3CCQ A;  2PZ1 A;  5LL6 S;  4E7Z A;  2HBW A;  2RB6 A;  1WGS A;  2LJ0 A;  3NGP A;  3CCV Q;  1UGP B;  3HRU A;  2E1H A;  3CCU T;  2K6D A;  3SD4 A;  1JXM A;  2I0N A;  3TQ7 P;  4N0A A;  2ECZ A;  2D9T A;  2YHT A;  3OS2 A;  2EQI A;  3M55 A;  1YP5 A;  4ZN3 A;  1S72 A;  1NJI R;  2LQK A;  3V8J A;  4E7I A;  4F7U A;  4PJL A;  5IT9 E;  4GLM A;  2P0P A;  4E47 A;  4ZGE B;  3QDF A;  4RMO A;  1UFF A;  1WI7 A;  4PNO A;  5GAN 6;  5KYY A;  1VQP Q;  4RTZ A;  5KCO A;  2DAQ A;  3X20 B;  2HSP A;  3I35 A;  4C5G A;  3EG1 A;  3PE0 A;  2GGR A;  2RJF A;  4J9C A;  4M75 F;  1KC8 C;  1Y57 A;  3QJ6 A;  4AFQ C;  5D6X A;  1JU5 C;  2EAY A;  2WSC E;  2H3E B;  4RTW A;  3EFS A;  1VQ6 Q;  1PHT A;  2RA2 A;  1BB9 A;  2BIV A;  5FU6 B;  1Q95 G;  6AT1 B;  4FYV B;  2K3B A;  3QII A;  1VQ7 T;  2HCK A;  5KH6 A;  1YJN T;  4A53 A;  1HSQ A;  2E65 A;  3UPU A;  1VYV A;  1H92 A;  3JSC A;  1G3Y A;  3CMA Q;  2SEM A;  4DEX A;  4R55 A;  2CSI A;  2GCX A;  3URG A;  4J6X A;  2R5M A;  5LJ3 j;  3GLX A;  3A8L B;  3H0I A;  1BIB A;  4KUI A;  1M9S A;  1TUC A;  4DQ2 A;  3G71 T;  4N4H A;  3SDZ A;  1PM3 A;  1WJQ A;  1IGU A;  3CXC P;  1MGQ A;  2DXU A;  2HQX A;  2KT8 A;  3JCM h;  1I5O B;  5KYX A;  4J8O A;  2LCC A;  1OI1 A;  3DB3 A;  1WXU A;  2A08 A;  2RHZ A;  2D8J A;  1M3B A;  2AT1 B;  4ORZ A;  4WF2 A;  1BCO A;  2RQR A;  4BAC A;  3CPW S;  1Y96 B;  2CH4 W;  3S6W A;  1B07 A;  2M51 A;  4C8Q F;  1KQ1 A;  2M0Y A;  1W4S A;  3FLG A;  1VQK Q;  2J06 A;  1X75 C;  4E7J A;  1SPK A;  3LWH A;  2XID A;  3GF5 A;  7AT1 B;  4BY6 C;  3NTH A;  4JJB A;  2C0T A;  2R58 A;  3IQL A;  3HSB A;  1KQS P;  1LOJ A;  5LJ5 g;  4JJD A;  1NLO C;  2CP3 A;  1NYF A;  3VS1 A;  2RNA A;  1KD1 U;  2DXC A;  3CC7 Q;  5IH2 A;  1VYT A;  3OY9 A;  3CPW A;  3EGD B;  1YHQ T;  2QEX T;  5GAM h;  1EFN A;  1M2V A;  4C5E A;  1GRI A;  3QWX X;  1UGQ B;  2P84 A;  1VQM Q;  2FRY A;  2KEA A;  1MND A;  4IUR A;  2DO3 A;  2K3Y A;  2CS7 A;  4M7A A;  1WNL A;  2OTJ Q;  4JZ4 A;  1X2Q A;  2GFU A;  5GAN 2;  1PNJ A;  3MP6 A;  3OW2 P;  2LCL A;  1U3O A;  3CCR T;  4M7D F;  1F1B B;  1NPR A;  3M54 A;  2RO0 A;  4IUU A;  5AT1 B;  3QO3 A;  3CD6 A;  2CYZ B;  2KK4 A;  2HL3 A;  4BE1 A;  2K5F A;  4OB0 B;  1Y07 A;  1AWW A;  4Z02 A;  4PL6 A;  1VQ5 A;  1QCF A;  1KC8 U;  4ME7 A;  4CC2 A;  2OAU A;  3PVL A;  3OSV A;  3E1S A;  1YIJ A;  2QGG A;  4FT2 A;  1Q81 R;  5DY9 A;  2DVJ A;  2V8I A;  3GPL A;  2XKO C;  1M2O A;  1NLP C;  1Q82 C;  1S72 Q;  2EQU A;  4E6R A;  5I22 A;  5GAN h;  1FMW A;  3JCM J;  1BI2 A;  3FC3 A;  3LX7 A;  3D7S B;  3VS2 A;  4XTZ A;  4R0K A;  4PJO G;  4D8D A;  2A28 A;  2EYX A;  3WVD B;  2MYS A;  2LVM A;  2ZCF B;  2LP5 A;  2GF7 A;  4JRQ A;  4M78 A;  5CR2 A;  3BY7 A;  2RI5 A;  3LYI A;  3CCU A;  3EFO B;  5GAN 3;  2ENM A;  4J5Y A;  2MCN A;  3A5Z B;  3HFN A;  3L42 A;  1U8R A;  4FT4 A;  4C5H A;  1HYO A;  5IAY A;  1HK9 A;  3PTA A;  1V29 B;  4M7A E;  3MEA A;  4M75 E;  1AT1 B;  4JRP A;  4KGZ B;  1MV3 A;  3BDU A;  2FHD A;  1C6V X;  3OYN A;  1B34 B;  2VVK A;  2O88 A;  3KFV A;  4GBQ A;  3ZFJ A;  2JUF A;  4PJO C;  4CC3 A;  4O6J A;  5HKC A;  2O4X B;  2YLB A;  1K0X A;  4CRI A;  2RMO A;  1VQL T;  1UG1 A;  1H8K A;  2GNC A;  2O31 A;  3CPF A;  1PRL C;  1UGR B;  4RG2 A;  1YCY A;  4M75 B;  2Y4X A;  2RQU A;  4C0G A;  3H9N A;  2DEU A;  1WHG A;  1YJ9 T;  4LUE A;  1PSF A;  2WSE E;  1KD1 R;  2FVU A;  3E19 A;  3E9F A;  1YJN A;  3P8H A;  1R77 A;  2YUP A;  2QA4 A;  2CZ1 B;  3FB9 A;  1MHN A;  5IHN A;  2KVQ G;  2RJE A;  1QLY A;  2H3J A;  2X4Y A;  3O8V A;  2F5K A;  2E5Q A;  2EJ9 A;  4JJC A;  1UEB A;  3G71 A;  1H64 1;  4MMK A;  1UGV A;  4DBH A;  1QP3 A;  5LJ5 e;  3VKI A;  3JB9 D;  1YIT A;  5L8R E;  5GAO q;  3BE3 A;  4C0D C;  1NEB A;  2YUQ A;  4HVW A;  2X4W A;  3HP9 A;  4AT1 B;  2ROT A;  1UE9 A;  4M78 E;  2KAF A;  2PNI A;  2AIR B;  1M27 C;  4Z8A A;  1M8V A;  1KC8 R;  2AZV A;  3PMT A;  4II1 A;  2QYZ A;  1UGS B;  1YI2 T;  2L5Q A;  4B6M A;  1M5Q 1;  1EX4 A;  5LJ3 h;  4DBQ A;  4JS5 A;  2QK0 A;  4C0Z A;  1QWF A;  2BZY A;  4OGC A;  2LX7 A;  4C92 E;  4KBM B;  1Q7Y C;  5GMK i;  1Q82 U;  3OW2 S;  4M4Z A;  3CD6 Q;  1LPL A;  5GMK j;  4LDV A;  2F5T X;  2CZ7 B;  1B3Q A;  2VC8 A;  2QEX A;  1VQ5 Q;  2RD1 A;  2A36 A;  4C92 B;  4NL2 A;  1U1S A;  2DZ9 A;  3FDR A;  3CCE T;  2KQW A;  1MV0 B;  3MKD A;  1UDL A;  1WHH A;  3FIF A;  3OYY A;  2QGF B;  3OYA A;  3MHX A;  1YIJ Q;  4M77 G;  3CCM A;  1MMA A;  2FZG B;  1JJ2 A;  2RN8 A;  4A4E A;  2KY9 A;  3CCJ A;  4X1V A;  1PCX A;  4EMK A;  2RQT A;  2YDL A;  3A8O B;  2HAX A;  4ZN1 A;  1E6G A;  3G6E T;  4M7D B;  1BI1 A;  4CC4 B;  1IRE B;  1ZX6 A;  2EGE A;  5GAM j;  4NOY A;  4C8Q G;  4J6Y A;  1R0B G;  1K73 C;  2LNV A;  4KGV B;  1BU1 A;  4OMQ A;  2DL5 A;  3ZL7 C;  4J9I A;  2X3X D;  3EG2 A;  2OX7 A;  4M77 C;  3V7S A;  4E7H A;  3SFM A;  3CCU Q;  2E10 A;  3WXM B;  5J39 A;  2K2M A;  2JTE A;  5D7U A;  4AFU C;  3CPW P;  2JW4 A;  3I9Q A;  1QQJ A;  3VS4 A;  2LJ1 A;  4J9D A;  4Z88 A;  1KHC A;  1OPL A;  4C8Q C;  1HJD A;  2BKD N;  4EMH A;  4HCB A;  2L3R A;  2MI6 A;  3BFM A;  3JB9 J;  4MML A;  2ZZD A;  2PQW A;  2CP5 A;  3RBB B;  4F7U F;  3A8G B;  3WVE B;  4DEY A;  4JLI A;  4M7A D;  4A4K A;  4PJO F;  1XNI A;  4LD6 A;  2E4H A;  1YJW T;  4OMP A;  1AZE A;  2M0O A;  3QSU A;  4FSX A;  2A3L A;  5CKB A;  2J6K A;  3CBP A;  3X25 B;  3VYH B;  1E7O A;  1IB8 A;  3EG9 B;  5HY6 A;  2RM4 A;  1PD1 A;  3VV0 A;  1YJN Q;  4IUV A;  1LJO A;  4BI8 B;  1VQ9 A;  2AHJ B;  1FX7 A;  4XU2 A;  4Q5W A;  2QA4 Q;  1TH7 A;  4AG1 C;  1D0Z A;  5FW9 A;  2P0K A;  2DVE A;  1YBY A;  1PRM C;  1Y7X A;  2L3P A;  3G71 Q;  1N5Z A;  1AHJ B;  1V76 A;  1VYU A;  1Q82 R;  3JCM Q;  1YIT Q;  3TRE A;  1LNX A;  3VS6 A;  2KGT A;  1CSK A;  4XK8 E;  5CO7 A;  1YJ9 A;  3FEO A;  3C95 A;  1X69 A;  3CCL A;  5M9O A;  3I56 A;  1K0S A;  1TWB A;  2D1X A;  3VRY A;  2PVG B;  5GJW B;  1Y96 A;  4MZM A;  5CKH A;  2GTJ A;  1PG5 B;  2XIC A;  1QVG A;  4M78 D;  1K76 A;  1VQ8 A;  1YN8 A;  1AVZ C;  2QAS A;  2R57 A;  4QKU A;  2CP0 A;  2EYW A;  2QQA A;  4EMG A;  3RES A;  1RI9 A;  1Y71 A;  3EHQ A;  3G4S T;  2CRE A;  2KYM A;  1X6G A;  2FRW A;  3RDV A;  2GTO A;  4PKC C;  3H41 A;  2ESW A;  2AZS A;  5D6Y A;  4D6W A;  2QDL A;  1PD0 A;  4OB1 B;  5I2M A;  3OS0 A;  4ESR A;  1BKB A;  4BY6 B;  2DYB A;  3HTR A;  2A7Y A;  2EWN A;  4ZNX A;  3EGD A;  1K73 U;  1RAC B;  3OYM A;  2YWW A;  1K9M C;  4C92 D;  2QEX Q;  3OA6 A;  3M57 A;  1OU9 A;  2SRC A;  1AWX A;  5FU7 C;  2YRC A;  4OB3 B;  4BD3 A;  2HQE A;  3JCM g;  1WPY A;  4CI0 C;  1BCM A;  3LGL A;  4E7L A;  1M30 A;  1QKW A;  3CCM Q;  3V8K A;  2YSQ A;  3EH2 A;  1EZZ B;  1QW1 A;  3CCJ Q;  2D8H A;  4E7K A;  1VQ4 A;  3JV3 A;  4LE9 A;  2IIM A;  3OYF A;  2DIQ A;  1JB0 E;  2YT6 A;  1YWP A;  2K7A A;  2CUD A;  3OMC A;  4J7I A;  3JCM P;  3S3O A;  3E2U A;  4OMM A;  2ZPH B;  2OTL T;  2RK2 A;  1KK7 A;  1K8A C;  4OMN A;  1ZUU A;  2L8D A;  4M77 F;  3RIR A;  3CC4 A;  2DYI A;  2F2X A;  1QMC A;  2DZC A;  3ULR B;  3TSW A;  1ZA2 B;  1WX6 A;  4JJN K;  2DX1 A;  4JLG A;  5GAM g;  1C0M A;  1AZG B;  2HD0 A;  5I21 A;  5CK9 A;  1KIK A;  1ACM B;  2EIF A;  2GQI A;  2XDP A;  5GMK h;  5GJV B;  4AFZ C;  3EFR A;  2HMA A;  4X9C A;  3GNG A;  5CKD A;  1Q7Y R;  3BDL A;  4OVA A;  2QG9 B;  4KH0 B;  2KSS A;  3EFO A;  3JCM b;  5DLQ E;  1VQN T;  2VB6 A;  4EDU A;  2PUK B;  2CZ0 B;  3R6O A;  2XHC A;  3RMQ A;  3CCV T;  1B7T A;  1VQ9 Q;  1K9A A;  3RKW A;  4VUB A;  4KH1 B;  2LQN A;  1G3T A;  1IO6 A;  9ATC B;  1B34 A;  1ZUK A;  2YUO A;  3LH0 A;  4GLK A;  2VUB A;  4RTU A;  2O4X A;  1UHC A;  1JJ2 P;  4BI4 A;  5KE2 A;  1Z9Z A;  2LX9 A;  4KGX B;  4M75 A;  4PJO B;  3RKY A;  3RNJ A;  2VXF A;  1M1K C;  1VQP T;  3I5S A;  1YJ9 Q;  5D6W A;  1M4Z A;  1BK2 A;  3CCL Q;  3HPW A;  3I56 Q;  1K73 R;  2LMJ A;  5J26 A;  1KFZ A;  1GBQ A;  5GAN g;  1VQO A;  1IHV A;  1VQ6 T;  3F70 A;  2DER A;  2IVW A;  1K9M U;  2D0Q B;  1SHF A;  3G7Z A;  1KG1 A;  2ZPB B;  3M59 A;  1SF9 A;  5C6S A;  5GMK l;  2BTT A;  2RK1 A;  1VQ8 Q;  3H6Z A;  3LLR A;  2M16 A;  5LJ5 d;  3I5R A;  3CMA T;  1AOJ A;  2L0A A;  1G2B A;  1Q86 C;  2Y90 A;  5FWC A;  1OYX A;  2ZAE A;  3A8H B;  1QP2 A;  3R6N A;  1IZ6 A;  4C0D B;  4ZGD B;  2DJZ A;  1K1Z A;  5IXF A;  1WQ7 A;  1T0H A;  1SRM A;  3JCM e;  2M1H A;  2CP7 A;  4LD9 K;  1WHL A;  4F7U G;  2NWM A;  3M4G A;  1YI2 Q;  4P5N A;  2DFU A;  2K2V A;  1UJY A;  3SWN B;  1PKT A;  1MNE A;  1OZ2 A;  2BE7 D;  4L5G A;  1IGQ A;  1ZSZ C;  1ZA1 B;  1K8A U;  1NE8 A;  1YCS B;  2ZGW A;  4XAX B;  5GAN d;  2MWP A;  1OX8 A;  4JZ3 A;  1OEB A;  1N8R U;  1W6X A;  3TEE A;  1WYX A;  1M1G A;  3CEY A;  2DD5 A;  1A0N B;  2M02 A;  3VS7 A;  2W0Z A;  1VQ4 Q;  4N0A C;  2PVO B;  3G4S A;  1WJS A;  1VQK T;  3JB9 H;  5CQY A;  3EG0 A;  1ABO A;  1U5S A;  2FYK A;  2MK5 A;  1WIE A;  3UA7 A;  2JNG A;  2V1Q A;  3E9G A;  4HKE A;  2MPX C;  3OYE A;  2VWF A;  1H3Z A;  4ATO A;  3THK A;  5EG2 A;  1D1B A;  5EC7 A;  4C92 A;  2RPN A;  3MCA B;  1TUG B;  2RQV A;  3GP8 A;  2DIL A;  3PFS A;  3ZBD A;  3SHW A;  1VIF A;  1RAI B;  2DF6 A;  5A0L A;  2FEI A;  5GAM e;  3M0R A;  5AYF A;  1SHG A;  2L3S A;  3CC4 Q;  2YUN A;  3NTK A;  2YRD A;  1AWJ A;  2DRM A;  1VQ7 A;  3CME T;  2E70 A;  2KYB A;  4M7D A;  1BYM A;  1QVG P;  2EGA A;  3DKM A;  3L2Z A;  2V26 A;  3OBY A;  2OTJ T;  4DBR A;  3L2Q A;  2J05 A;  1VIE A;  3JCM c;  8ATC B;  2NUP B;  1I1J A;  1WZO A;  5LJ3 g;  4FSS A;  3JCM X;  1QVP A;  3PNW C;  2CZ6 B;  2Y4Y A;  2K5I A;  2ROL A;  2HKQ B;  2XI9 A;  1MMN A;  5A0D A;  1M1K U;  2B8A A;  1RUW A;  1NG2 A;  4BDY A;  2IG0 A;  4FL6 A;  3CCQ T;  2EYQ A;  4C8Q E;  4BE2 A;  1RLQ C;  2O9S A;  4M77 B;  2BUD A;  1AWO A;  2EJG A;  2MIO A;  1VUB A;  2ZPE B;  5LJ5 f;  2LT1 A;  2KXC A;  3EGX B;  2DL3 A;  1UHF A;  1QVF A;  1DJ7 B;  1S1N A;  1S72 T;  4C8Q B;  4Y28 E;  1RAF B;  2OAW A;  3A8M B;  1QKX A;  1ZSG A;  3O5Z A;  2QTV A;  1JJ2 S;  5GAN e;  2JT4 A;  3JCM W;  4KUD K;  3PVQ A;  4M7A G;  1Q86 U;  1WJR A;  2RHY A;  4N4I A;  3EG9 A;  5LJ3 d;  2HSE B;  2E41 A;  1N9S A;  3QJY A;  3PGG A;  3M53 A;  2QAZ A;  4OP0 A;  1VQO Q;  2CT3 A;  2OI3 A;  4RTT A;  1RAH B;  2XD0 A;  1W2B A;  1YHQ A;  2PU9 B;  2K4Y A;  4EIK A;  4C5I A;  4M7D E;  4IUT A;  1RI0 A;  4XTV A;  1QCN A;  2QXF A;  4AG2 C;  2JS2 A;  3OYC A;  1FYN A;  1PWT A;  2NYS A;  2KT1 A;  4M7A C;  3J80 E;  1K4U S;  3CCR A;  2QTX A;  1AD5 A;  2H8H A;  3M5A A;  2Z0W A;  1KSW A;  1OUL A;  3JCM V;  3QKJ A;  2EKO A;  3FJP A;  2DBM A;  1ZUY A;  1M1F A;  1W1F A;  2J7I A;  4HCK A;  4JDS A;  2DTO A;  2DBK A;  3PIP A;  2FG0 A;  1NJI U;  5CCA A;  4Z89 A;  5GAN 4;  2DET A;  1I4K 1;  4M78 G;  2G3R A;  2LQW A;  4ANJ A;  2O2O A;  1I07 A;  3PIO A;  4J9E A;  4XTW A;  5FRO A;  2XG8 D;  3G4S Q;  2FPE A;  3GOX A;  1D09 B;  3ER0 A;  4N4G A;  5HCK A;  2JZ2 A;  4JPB W;  3JB9 F;  3OS1 A;  2BE9 B;  1P92 A;  3V7R A;  3QDR B;  2E6Z A;  2I2L A;  3RR6 A;  4PLI A;  3PT9 A;  3OSS C;  3OS5 A;  1H3H A;  5LJ5 j;  3UAT A;  1D1C A;  3MEV A;  1M1K R;  4M75 D;  3BW1 A;  3VRZ A;  5GAO m;  3OYG A;  2VV5 A;  1TUD A;  2XK0 A;  2HNI A;  3QHS A;  4M78 C;  1X43 A;  3QPH A;  3VUB A;  4XTY A;  3NTI A;  3MEW A;  2KI7 A;  1VQ7 Q;  1PSE A;  5LJ3 e;  2NUT B;  2D0N A;  2FPD A;  3CCS T;  2KNB B;  2MMP A;  2E5K A;  2DTI A;  1RAE B;  2DPP B;  2E64 A;  2F2V A;  5GAN 7;  4ZTF A;  2L3Q A;  1QVG S;  3G1J A;  3MPU B;  2C06 A;  5A0G A;  2HDA A;  3CD6 T;  4KT0 E;  1VQL A;  4O5V A;  4C92 C;  1Q86 R;  5IHK A;  2FPF A;  3VS3 A;  1FWZ A;  2EJF A;  2YRV A;  3QUI A;  4L59 A;  1NM7 A;  3OYK A;  4OML A;  2E6N A;  1W70 A;  1VQ5 T;  5KYW B;  2R5A A;  1ABQ A;  4MZP A;  3V8L A;  2C0O A;  3CME A;  3DLM A;  3QYG B;  5CAI A;  2F1L A;  4ZGJ B;  3A98 A;  1UB4 A;  2JS0 A;  1YIJ T;  4HXJ A;  3JRZ A;  4NL3 A;  2PVD B;  2O01 E;  2L89 A;  2RF0 A;  3H0H A;  1NEG A;  1X27 A;  4XU3 A;  5CQX A;  1BBZ A;  5CIU A;  3RMS A;  2QQS A;  2E12 A;  2VAS A;  2VXE A;  4HVU A;  1ZHI A;  3OQ5 A;  2QQ9 A;  5KYU B;  4HT9 A;  3AHU A;  4QT7 A;  1TXQ A;  1V1C A;  2JMA A;  3KBG A;  3C4S A;  1G83 A;  1TOV A;  2E3H A;  2DJQ A;  2EGC A;  4B9X A;  1BI3 A;  1VA7 A;  4QW2 A;  3OYI A;  1MUZ A;  4A63 B;  4B9W A;  5J3B A;  1NBE B;  3HFO A;  3M0P A;  2DMO A;  3I55 T;  1WXB A;  1YHQ Q;  3INZ A;  2AKK A;  1YI2 A;  3C94 A;  2LQ8 A;  4PJO A;  2GBQ A;  1JQQ A;  2JMC A;  2LRQ A;  5HK3 A;  3L1A A;  2DTH A;  3CCR Q;  2ZPF B;  3MET A;  4OGE A;  1KHI A;  1ZLM A;  4PK4 A;  3DLL A;  4M7D D;  4M7A F;  1WHM A;  4OMO A;  2RI2 A;  5GAO p;  2LJ3 A;  4R56 A;  4LDU A;  1VOM A;  2QQB A;  2JM9 A;  2RJC A;  2DL4 A;  1QCO A;  2EPD A;  4UC4 A;  1I81 A;  2DL7 A;  4J9F A;  2XMF A;  3M9Q A;  3V7C A;  1MMD A;  3AT1 B;  1MMG A;  1SKU B;  3GNF B;  1BIA A;  5I11 A;  1RLP C;  1WFW A;  1Q81 U;  3CCE A;  2F2W A;  3VJP A;  4ZTJ A;  2KE9 A;  2K3X A;  2CH4 A;  3M0S A;  2HZY A;  2E3I A;  2JTF A;  1N8R C;  2QA4 T;  2MWO A;  4Y92 A;  1X2K A;  5IN1 A;  2DA9 A;  4J9B A;  1OV3 A;  3QXE B;  2RHI A;  3CC2 T;  1OQK A;  3L2U A;  4KRT A;  3M4Y A;  1G5V A;  1QVF P;  2F69 A;  3G6E A;  4CC7 A;  1TTH B;  3JCM d;  2CUB A;  4EMK C;  1D3B B;  1AEY A;  1YIT T;  1EIF A;  2DL8 A;  1XTD A;  2CSQ A;  1CKA A;  1R0C B;  4RTV A;  1UJ0 A;  2V8J A;  2X3W D;  4FM4 B;  3NHN A;  3SWN A;  3REA B;  1FMK A;  2DK3 A;  2KRM A;  4OF1 A;  2ED1 A;  3X24 B;  4PJN A;  4RCC A;  3KXT A;  4PFZ A;  4IKF A;  4X34 A;  1ZSZ B;  5FRM A;  3QBY A;  2DEQ A;  4M78 F;  5GAN 8;  1W2B P;  1WDX A;  4F7U E;  2KXD A;  2LZ6 B;  1OU8 A;  4PJO E;  1UTI A;  4HCC A;  5CKE A;  2X4J A;  1LCK A;  3FJ5 A;  2EYZ A;  4L6V 5;  4XTX A;  2BZ8 A;  2AKL A;  2EW3 A;  1GCQ A;  3T9N A;  4F7U B;  1WHK A;  2DXB A;  1VQL Q;  1G3W A;  1YJW A;  3QZ9 B;  2DIG A;  1E6H A;  1U1T A;  4FW1 A;  4HCZ A;  4JUV A;  3OMG A;  3OBW A;  2VGM A;  5CVI A;  1M90 C;  4C92 F;  5GAM d;  5KYY B;  3C0C A;  2J6O A;  4XU1 A;  2GFA A;  2ZPI B;  1T0J A;  3TVT A;  4BI3 A;  1UEC A;  5FU6 C;  2K9G A;  4AFS C;  4FYX B;  2ABL A;  3CME Q;  4BE0 A;  2LC4 A;  4QVD A;  3CCS A;  2KBT A;  3C12 A;  3MP8 A;  1C1A A;  2NUP A;  3CCM T;  4RUG A;  1J3T A;  2COZ A;  4JRK A;  3EAE A;  3CCJ T;  2P0Q A;  2LCS A;  3S3N A;  1JO8 A;  2KDS A;  2NUZ A;  2VYT A;  2P4R A;  5IHI A;  2EKH A;  5LJ5 h;  3VS0 A;  4FIB A;  1I0C A;  3HRS A;  4A4H A;  4YTL A;  2MF2 A;  1T3S A;  4DBF A;  2IPO B;  2GQV A;  5A2Q E;  2MOX A;  2HKN A;  2YLC A;  4PJJ A;  2ATC B;  4TVR A;  1BI0 A;  3CCQ Q;  5HK0 A;  2JM8 A;  1M3A A;  4M77 A;  2ZPG B;  2L2P A;  3JB9 G;  4A54 A;  3M0T A;  2K5L A;  3P8B B;  5KYX B;  2W10 A;  2KRN A;  1GBR A;  3EGX A;  2CT4 A;  3LH5 A;  3FRN A;  1WXT A;  3L2V A;  4C8Q A;  5DM7 R;  2V1R A;  4XQ3 A;  4LDW A;  4XTU A;  4FYW B;  2EQM A;  2OJ2 A;  3CBM A;  3LWI A;  3JCM f;  1TS9 A;  2RI3 A;  3A1P A;  4XU0 A;  2YXY A;  5GMK e;  3MO8 A;  3SB2 A;  3M0Q A;  2AK5 A;  3QG1 A;  5ECA A;  4F14 A;  2JN0 A;  5DLO A;  3TCJ A;  3L2R A;  4WCI A;  5FLX E;  2DLP A;  1PC0 A;  2WAC A;  3L2W A;  3I55 A;  2JJ9 A;  4RTY A;  1XOV A;  1GFD A;  3M0U A;  2K57 A;  3CCE Q;  3PMI A;  4AMC A;  3HKS A;  3M56 A;  1D0Y A;  1R8O B;  1VQ9 T;  1I5L A;  3CC7 T;  4QQ6 A;  1NJI C;  4JRI A;  2PTK A;  4A4G A;  4DOW A;  2JVV A;  4MDW A;  4NS5 A;  1M2V B;  1IHW A;  1N6A A;  4MDX A;  3LGF A;  3OB9 A;  1VQM T;  2KRO A;  2PUO B;  3MJX A;  3JAM E;  3VU3 C;  2FZK B;  1HXD A;  2COY A;  3G6E Q;  5GAO r;  2DM1 A;  4M7A B;  1IXD A;  1ZQ1 A;  2CGH A;  3MP1 A;  1QVF S;  5GAO n;  3CXC S;  2J6F A;  1JXO A;  2FB7 A;  1NPP A;  1SEM A;  3SEM A;  2WSF E;  3CCL T;  5GAM f;  4MZT A;  4M77 E;  2OTL A;  2DXT A;  2RH2 A;  1I8F A;  3I56 T;  3OYB A;  3J81 E;  4LN2 A;  4D8K A;  1WA7 A;  4Y91 A;  1Y0M A;  1RL2 A;  2LNH B;  2RHX A;  1SSH A;  2JXB A;  1UUE A;  1M90 U;  2RHU A;  1XQH A;  4OMF B;  5GMK m;  1TSF A;  4RTX A;  4IIO A;  3GBQ A;  3QYH B;  3CC2 A;  1JEG A;  1VQ8 T;  1K9M R;  1M8M A;  5KYN A;  4LNP A;  3EGU A;  4X9D A;  1W2B S;  4RCB A;  5FRN A;  2X9H A;  2HBP A;  1FMV A;  2X51 A;  4F04 B;  1X6B A;  1G8X A;  4ELZ C;  3CXC A;  3MEU A;  4J9G A;  4C0F A;  4LDY A;  4A4F A;  4J9H A;  2HQH A;  2P4T A;  1JRI A;  3EH1 A;  2EVR A;  4PJO D;  1YJW Q;  1OPK A;  1YWO A;  4PJM A;  3KUF A;  3QZ5 B;  1YNZ A;  1KQS S;  3UA6 A;  2B86 A;  3SWN C;  2QQR A;  5GAO l;  2CP2 A;  4OB2 B;  1G3S A;  3CQT A;  1TG0 A;  3HRT A;  1VQN A;  1GXI E;  4M75 G;  2EFI A;  3J7A F;  4F17 A;  3ZEH A;  2DNU A;  4ELY C;  3TU4 K;  2NUT A;  1KQ2 A;  4M78 B;  3CCV A;  2ED0 A;  3TSZ A;  3QWY A;  1SG5 A; 
#chains in the Genus database with same CATH homology
 1OOT A;  2F2X A;  3VS2 A;  5IHK A;  2FPF A;  3VS3 A;  4R0K A;  4D8D A;  3ULR B;  2A28 A;  2EYX A;  3TSW A;  1NYG A;  1WX6 A;  2RQW A;  1NM7 A;  2DX1 A;  2LP5 A;  4OML A;  1W70 A;  1AZG B;  1KIK A;  2K79 A;  2GQI A;  4HVV A;  5GJV B;  1ABQ A;  2EBP A;  4AFZ C;  1SRL A;  2C0O A;  2ENM A;  2MCN A;  1GCQ C;  2EYY A;  3A98 A;  2JS0 A;  4HXJ A;  1CKB A;  2RF0 A;  3H0H A;  1NEG A;  2HEQ A;  1M3C A;  1X27 A;  1BBZ A;  1MV3 A;  5FWB A;  3H0F A;  2VVK A;  4HVU A;  2O88 A;  3KFV A;  4GBQ A;  4CC3 A;  1T3L A;  1GCP A;  1U06 A;  4QT7 A;  1K0X A;  1V1C A;  2RMO A;  1K9A A;  1UG1 A;  1WLP B;  2JMA A;  1ARK A;  1H8K A;  1G83 A;  2GNC A;  2LQN A;  2O31 A;  1IO6 A;  1PRL C;  2DJQ A;  2EGC A;  1ZUK A;  2YUO A;  2RQU A;  1ZBJ A;  1VA7 A;  4F16 A;  4RTU A;  4LUE A;  1MUZ A;  4A63 B;  1KJW A;  1UHC A;  3M0P A;  1Z9Z A;  2DMO A;  1WXB A;  4IIM A;  2AKK A;  2YUP A;  3RNJ A;  3I5S A;  1BK2 A;  5IHN A;  1QLY A;  2LMJ A;  1QWE A;  2A37 A;  2GBQ A;  4JJC A;  1GBQ A;  1KFZ A;  1JQQ A;  2JMC A;  1UGV A;  4K11 A;  3VS5 A;  1ZLM A;  1SHF A;  4OMO A;  1NEB A;  2LJ3 A;  2YUQ A;  4HVW A;  2BTT A;  5L23 A;  2JM9 A;  2DL4 A;  2CDT A;  2EPD A;  2DL7 A;  4J9F A;  2XMF A;  2ROT A;  1UE9 A;  3I5R A;  1AOJ A;  3NPF A;  2PNI A;  4LUD A;  2L0A A;  1M27 C;  1G2B A;  4Z8A A;  3U23 A;  5I11 A;  1RLP C;  2FO0 A;  1WFW A;  2AZV A;  2F2W A;  5FWC A;  2KE9 A;  3R6N A;  2CH4 A;  3M0S A;  2DRK A;  1K1Z A;  5IXF A;  1T0H A;  1SRM A;  2O9V A;  1X2K A;  4Y92 A;  1PKS A;  2BZX A;  1GFC A;  3UF4 A;  2DA9 A;  4J9B A;  1OV3 A;  2NWM A;  4KRT A;  5IXB A;  1QWF A;  1Z9Q A;  2KRS A;  2KR3 A;  3EHR A;  2BZY A;  4CC7 A;  2LX7 A;  1UJY A;  2CUB A;  1PKT A;  1AEY A;  3EG3 A;  1YCS B;  2DL8 A;  4M4Z A;  4JZ3 A;  2CSQ A;  1CKA A;  1OEB A;  4RTV A;  1UJ0 A;  1W6X A;  2X3W D;  1GL5 A;  1B3Q A;  1WYX A;  3NHN A;  3REA B;  1FMK A;  2KRM A;  2VKN A;  1A0N B;  3VS7 A;  2W0Z A;  2ED1 A;  2C0I A;  2A36 A;  3EG0 A;  1ABO A;  1HD3 A;  1U5S A;  1WIE A;  1MV0 B;  3UA7 A;  1UDL A;  2V1Q A;  3NMZ C;  2G6F X;  2VWF A;  3THK A;  1WDX A;  2KXD A;  5EC7 A;  2LZ6 B;  2RPN A;  2RN8 A;  2RQV A;  1UTI A;  4X1V A;  3REB B;  2DE0 X;  2DIL A;  2RQT A;  2YDL A;  3SHW A;  1E6G A;  2PZ1 A;  4CC4 B;  1ZX6 A;  2EGE A;  1LCK A;  2HBW A;  2DF6 A;  3FJ5 A;  2EYZ A;  2FEI A;  2LJ0 A;  3NGP A;  3M0R A;  2BZ8 A;  2AKL A;  2EW3 A;  1SHG A;  2L3S A;  1GCQ A;  2YUN A;  1AWJ A;  2DRM A;  2K6D A;  1JXM A;  1E6H A;  2I0N A;  2ECZ A;  2KYB A;  1BU1 A;  4OMQ A;  2DL5 A;  3ZL7 C;  2EGA A;  2EQI A;  1YP5 A;  4J9I A;  3C0C A;  2J6O A;  2X3X D;  2J05 A;  1T0J A;  1I1J A;  3EG2 A;  3TVT A;  1UEC A;  2K9G A;  4AFS C;  4FSS A;  2ABL A;  4GLM A;  2K2M A;  1UFF A;  1WI7 A;  2JTE A;  4AFU C;  2JW4 A;  4RTZ A;  2KBT A;  2ROL A;  3I9Q A;  2HSP A;  3I35 A;  3VS4 A;  4RUG A;  2LJ1 A;  1J3T A;  3EG1 A;  4J9D A;  4Z88 A;  3PE0 A;  2GGR A;  4J9C A;  1Y57 A;  1OPL A;  1HJD A;  1RUW A;  1NG2 A;  4AFQ C;  2LCS A;  1JU5 C;  1JO8 A;  2NUZ A;  4RTW A;  2P4R A;  5IHI A;  1PHT A;  1RLQ C;  2EKH A;  2O9S A;  1BB9 A;  3VS0 A;  3RBB B;  1AWO A;  1I0C A;  4DEY A;  2MIO A;  2K3B A;  1T3S A;  4OMP A;  2HCK A;  2MOX A;  1AZE A;  2KXC A;  2DL3 A;  1HSQ A;  1UHF A;  1VYV A;  1H92 A;  2JM8 A;  1M3A A;  1S1N A;  2L2P A;  2J6K A;  2SEM A;  4DEX A;  1E7O A;  2OAW A;  2CSI A;  1QKX A;  3M0T A;  1ZSG A;  2W10 A;  3H0I A;  2KRN A;  1GBR A;  3O5Z A;  2CT4 A;  1TUC A;  3LH5 A;  2JT4 A;  3PVQ A;  1WXT A;  2KT8 A;  4AG1 C;  5FW9 A;  2V1R A;  2OJ2 A;  1WXU A;  2A08 A;  1PRM C;  2L3P A;  2D8J A;  1N5Z A;  1M3B A;  2CT3 A;  2OI3 A;  4RTT A;  4ORZ A;  1VYU A;  2AK5 A;  3M0Q A;  2RQR A;  5ECA A;  3VS6 A;  4EIK A;  4F14 A;  2KGT A;  1CSK A;  2CH4 W;  4WCI A;  1X69 A;  1B07 A;  2M51 A;  2DLP A;  1K0S A;  2M0Y A;  4AG2 C;  2JS2 A;  2D1X A;  4RTY A;  1XOV A;  3VRY A;  1FYN A;  1PWT A;  2KT1 A;  5GJW B;  2J06 A;  1GFD A;  3M0U A;  1K4U S;  1SPK A;  2GTJ A;  4JJB A;  1AD5 A;  2PTK A;  2H8H A;  2C0T A;  1K76 A;  1YN8 A;  1AVZ C;  3IQL A;  1KSW A;  2EYW A;  4JJD A;  1NLO C;  1NYF A;  2KRO A;  3VS1 A;  2RNA A;  1RI9 A;  5IH2 A;  1VYT A;  2DM1 A;  2DBM A;  1ZUY A;  3EHQ A;  1W1F A;  2J7I A;  4HCK A;  2CRE A;  2DBK A;  2KYM A;  1EFN A;  1X6G A;  2FRW A;  1GRI A;  3QWX X;  2J6F A;  2GTO A;  2FG0 A;  2ESW A;  2AZS A;  3H41 A;  1JXO A;  2QDL A;  1SEM A;  4ESR A;  4Z89 A;  3SEM A;  2FRY A;  2DYB A;  2KEA A;  4ZNX A;  2LQW A;  2O2O A;  1I07 A;  4J9E A;  4JZ4 A;  1X2Q A;  4LN2 A;  4D8K A;  1WA7 A;  1PNJ A;  2SRC A;  1AWX A;  2FPE A;  1Y0M A;  2LNH B;  1SSH A;  2JXB A;  5HCK A;  1U3O A;  1UUE A;  4JPB W;  4RTX A;  4IIO A;  3GBQ A;  1JEG A;  1M30 A;  1QKW A;  1H3H A;  1M8M A;  3UAT A;  1AWW A;  4LNP A;  2YSQ A;  3EGU A;  2D8H A;  1X6B A;  3VRZ A;  1QCF A;  3JV3 A;  4LE9 A;  1TUD A;  2IIM A;  1X43 A;  4J9G A;  4CC2 A;  2YT6 A;  3PVL A;  1YWP A;  4J9H A;  2K7A A;  2CUD A;  2EVR A;  1OPK A;  1YWO A;  2D0N A;  2DVJ A;  1YNZ A;  4OMM A;  3UA6 A;  2B86 A;  2FPD A;  2KNB B;  1NLP C;  3CQT A;  1TG0 A;  2E5K A;  2F2V A;  4E6R A;  2L3Q A;  4F17 A;  4OMN A;  2DNU A;  1ZUU A;  5I22 A;  2HDA A;  2ED0 A;  3TSZ A;  3QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...