1AWOA

The solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
SLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
molecule keywords ABL TYROSINE KINASE
total genus 4
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awoA00
4OMMA 2KXCA 1PWTA 1MV3A 4AG2C 2H8HA 4ESRA 2I0NA 1CSKA 1H8KA 1YWOA 1I0CA 2EGAA 4CC4B 1NYFA 4WCIA 2L3PA 2NUZA 4HCKA 2GBQA 1GBQA 5I22A 3H0IA 4CC7A 1WYXA 3QWYA 1EFNA 1IO6A 2ECZA 1RUWA 5IHNA 2PZ1A 3EG2A 1Y0MA 4OMLA 4ORZA 2MIOA 2ABLA 4LUDA 1G83A 1HSQA 3KFVA 2KRNA 2K79A 4M4ZA 2O9SA 3UATA 1PKTA 2VWFA 1GFCA 1PRMC 4AFZC 3TVTA 2YDLA 1HJDA 1FMKA 3NHNA 3H41A 2AZVA 2YUQA 1ABQA 5HCKA 2BZ8A 4R0KA 1UE9A 2LQWA 4JJBA 1TUCA 1SRMA 1WI7A 2EYWA 4K11A 4GBQA 2K6DA 2J6KA 2D0NA 1UG1A 1X2KA 3EG1A 2L3QA 2RQRA 4J9FA 2OAWA 2JM9A 2BTTA 2EW3A 1M3AA 3VRZA 1GCQC 2A37A 3FJ5A 4LUEA 2IIMA 5IXFA 1X69A 3VS6A 1K0XA 2JS0A 2KROA 2L0AA 1GFDA 3M0PA 4Y92A 1LCKA 1WDXA 2J6OA 2DMOA 4A63B 2ENMA 2DL5A 1UTIA 2HEQA 1N5ZA 2FRYA 4CC3A 1I07A 1CKAA 4J9CA 2DJQA 4JJCA 2HBWA 2JS2A 4IIMA 4HVUA 4HVVA 1XOVA 2D1XA 2K9GA 2EGCA 2DLPA 4Z8AA 1SSHA 2BZXA 4J9EA 1FYNA 2L3SA 3VS0A 1ZX6A 1M30A 3O5ZA 3SHWA 1WLPB 1X43A 1KJWA 2RQUA 1ZBJA 1GBRA 1YWPA 2K2MA 2CUBA 2J05A 3PVLA 1ZUYA 3R6NA 4DEXA 2DA9A 2M51A 1Z9QA 2CSIA 4JJDA 1H3HA 2EQIA 3ULRB 2KEAA 2O88A 1X6BA 2DL8A 1JXOA 2LJ1A 2X3WD 1WFWA 2KRMA 1WXTA 2YUOA 1X6GA 2YSQA 1JEGA 1OPKA 3EG0A 1RI9A 3VS2A 1AZGB 2DL7A 2OJ2A 1E6HA 3QWXX 4HVWA 1M3CA 2YUPA 4RUGA 1T3LA 2EYXA 2DBKA 2KE9A 3VS4A 2J7IA 3EG3A 4X1VA 3VRYA 5GJWB 4GLMA 4RTTA 4F17A 1PHTA 1U3OA 1TG0A 1ZLMA 2JMAA 2JTEA 3C0CA 1KFZA 3UA6A 1NG2A 1BU1A 1B07A 2ROTA 1Y57A 1AWOA 2FG0A 2JW4A 1I1JA 1OV3A 1B3QA 4D8KA 2DRMA 5IHKA 3CQTA 1K76A 4CC2A 2RNAA 5FWCA 2KXDA 1SHGA 1A0NB 1M8MA 1Z9ZA 2CUDA 1WXBA 1K0SA 2PNIA 2DYBA 3M0RA 1UDLA 3NGPA 3ZL7C 5IXBA 2A28A 1AD5A 2YT6A 1NEBA 2E5KA 3LH5A 1M27C 1MUZA 1V1CA 2F2WA 2FPDA 2C0TA 2KT8A 1T0HA 4JZ4A 4RTYA 1SHFA 1VYTA 3I9QA 1NLOC 3TSZA 2RQTA 2EKHA 2W10A 1WA7A 2CT3A 2V1RA 1T0JA 4AG1C 4RTVA 2F2VA 3PE0A 3EHRA 2KNBB 4OMOA 1VYUA 3A98A 3THKA 1U06A 4J9HA 1AZEA 2RQVA 3RBBB 1WXUA 1WX6A 3M0QA 3I5SA 3REAB 2DX1A 2DRKA 2RMOA 5I11A 1QKWA 3H0HA 3VS1A 2AKKA 2LQNA 2KBTA 1PNJA 2M0YA 1RLPC 2ROLA 1U5SA 2QDLA 3EGUA 4AFQC 3NMZC 4AFSC 2DVJA 1UECA 1G2BA 2EPDA 1QLYA 1YN8A 1UUEA 4DEYA 2ED1A 2J06A 1YNZA 2O9VA 3H0FA 1K9AA 2EVRA 1BBZA 1YP5A 3M0SA 2EGEA 2EYYA 1ZSGA 2RPNA 2SRCA 4D8DA 2AK5A 1PRLC 2JMCA 2JM8A 2V1QA 4AFUC 2GNCA 1W70A 2G6FX 1X27A 1X2QA 3REBB 1HD3A 1OOTA 3RNJA 1VYVA 1ZUUA 1BK2A 3PVQA 2X3XD 2DE0X 1GRIA 4IIOA 3GBQA 1KSWA 1OEBA 3SEMA 1UFFA 3I5RA 3VS3A 2RQWA 1VA7A 2LCSA 2GTOA 2LZ6B 1JU5C 1CKBA 1T3SA 3I35A 2C0IA 1SPKA 4Z88A 2CSQA 1BB9A 2RF0A 1UJYA 2AZSA 1AEYA 4JPBW 2AKLA 1QWFA 2KR3A 2GTJA 1W6XA 3JV3A 1ABOA 2EBPA 2A36A 4KRTA 1E7OA 2FO0A 3VS5A 2KGTA 5L23A 5ECAA 2OI3A 1AWJA 3TSWA 3U23A 1M3BA 2DF6A 1ARKA 2FRWA 1YCSB 4JZ3A 1MV0B 2ED0A 1ZUKA 2HCKA 2LX7A 2D8HA 1S1NA 2LP5A 4J9GA 2O2OA 1GCPA 4F14A 1UHFA 2NWMA 4J9BA 4LE9A 4Z89A 1GCQA 1QKXA 2D8JA 4RTUA 2HDAA 1NM7A 1JXMA 1TUDA 1WIEA 2XMFA 3NPFA 4E6RA 2FEIA 5IH2A 1J3TA 4OMPA 2SEMA 4HXJA 1AOJA 5GJVB 2ESWA 3M0UA 2MOXA 2K3BA 1JQQA 1AWWA 2KT1A 5FW9A 2KYBA 2LNHB 2JXBA 2KYMA 1GL5A 1NLPC 2P4RA 1H92A 1PKSA 2LJ0A 4J9DA 4OMQA 2DL3A 4LN2A 2YUNA 4RTXA 2MCNA 3IQLA 2VKNA 4EIKA 2O31A 2DBMA 1KIKA 2CREA 2JT4A 4RTWA 2DILA 1K1ZA 2LJ3A 1K4US 2F2XA 2BZYA 1UHCA 4FSSA 1RLQC 2HSPA 3UA7A 1SEMA 4QT7A 2LMJA 1SRLA 2PTKA 4ZNXA 2CH4A 2DNUA 1OPLA 2CT4A 1QWEA 2CDTA 2EYZA 1NEGA 3UF4A 4F16A 5EC7A 1W1FA 2GGRA 1AVZC 2VVKA 2FPFA 4OMNA 5FWBA 3M0TA 2RN8A 4LNPA 2A08A 4J9IA 3VS7A 2CH4W 4RTZA 2J6FA 1QCFA 2B86A 2L2PA 1UGVA 2DL4A 2GQIA 3EHQA 1NYGA 1E6GA 2KRSA 2K7AA 1JO8A 2DM1A 1AWXA 1UJ0A 2FPEA 2W0ZA 2C0OA 5IHIA
chains in the Genus database with same CATH superfamily
4M78B 1PWTA 1UEBA 4ME7A 4QQ6A 1IHVA 4ESRA 2X4JA 2HQHA 1I0CA 4XQ3A 4WCIA 2D9TA 4HCKA 2GBQA 5CKFA 5GAMf 3CCMQ 5I22A 1HYOA 1WYXA 3M9QA 1IXDA 4RCBA 5IHNA 2PZ1A 1Y0MA 4ORZA 2MIOA 2HKQB 1G83A 2RHYA 3MEVA 4YTLA 2CZ0B 3EAEA 1OX8A 4ZN3A 1ZHIA 3P8DA 1BI1A 2QQRA 5A0LA 1WGSA 2YDLA 3L2QA 1KK7A 3JB9D 2AZVA 2YUQA 4BI4A 4R0KA 1NPPA 2GFAA 4JS5A 1TTHB 1UE9A 2C06A 1YBYA 3FLGA 3CC4A 4KUDK 2FVUA 4M7DB 1X2KA 5CQYA 4BE2A 2NUPB 2L3QA 1KQSP 1YIJT 1K8AC 1QQJA 1TWBA 1C0MA 4OF1A 4PL6A 3QZ5B 1YITQ 1M3AA 3VRZA 3I55Q 5GMKe 1VQ9A 1YHQQ 2CP7A 1X69A 2JS0A 1Q82U 2ZCFB 2KROA 3KBGA 4ELZC 2J6OA 2BE7D 3QDFA 2DL5A 3S6WA 2YLCA 1Q95G 1YCYA 1BIAA 2P84A 3M55A 3V8JA 4HVVA 3HFOA 2Y4YA 2DLPA 4L6V5 2BZXA 3V7SA 4BE0A 2M9UA 1EIFA 3BDLA 3OBYA 4RCCA 2OTJT 4EPCA 1VQKT 3OYBA 3OS0A 1X43A 1KJWA 2V26A 4MZPA 4MZTA 2DD5A 5GAN8 2CGHA 3QSUA 3CCMA 2E3IA 4C92C 2CUBA 1VIEA 2DZCA 2FYKA 3DB4A 2QA4Q 1C6VX 2LVMA 3CMAQ 2CSIA 2EQIA 3ULRB 5GAN6 4E7LA 5J39A 1X6BA 1XNIA 1YJNT 2COZA 1WFWA 2KRMA 1WHKA 1X6GA 2YSQA 4C8QB 3PIOA 3VS2A 3OW2A 2OJ2A 2RHIA 3JB9I 2EQUA 2EYXA 2KE9A 3VS4A 3EG3A 4C5GA 4RTTA 4OB3B 1WHJA 3PT9A 1M5Q1 3META 4J6YA 4IKFA 2ATCB 3E2UA 4F04B 5LJ3d 4D8KA 2KVQG 5IHKA 3CQTA 3S3NA 3OYGA 4PJOC 3JCMe 3SD4A 5KE3A 1Z9ZA 1WXBA 4M7DD 1K0SA 2PNIA 1Y07A 1X01A 3NGPA 1UGPB 3R6OA 1K73R 1BYMA 4JJNK 3LH5A 3J7AF 1MUZA 4C92F 1QP3A 1V1CA 2FPDA 4JZ4A 1VQLT 3PTAA 3EH2A 1ZA2B 2RQTA 3MEWA 2EJGA 4HCCA 3HHTB 2CT3A 4JRIA 2YXYA 2DXCA 3M4GA 4OMOA 3A98A 3THKA 5HK3A 1U06A 4FCYA 5J26A 1YIJQ 2RQVA 1G3WA 3GNFB 3I5SA 3REAB 3CBOA 4E7KA 2RMOA 3JCMQ 1WPYA 5CKEA 5A2QE 1WNLA 2MK5A 1VQ9Q 1WQ7A 1FX7A 2M0OA 3RKXA 4PLLA 4IUUA 5KH6A 3NMZC 2DVJA 2EFIA 1UECA 1G2BA 1UUEA 3LWIA 1RAFB 2F5KA 5KYUA 2MAMA 3V8LA 2QDYB 5FROA 1R8OB 2EYYA 4PJOG 1R0CB 1PM3A 4IUPA 4D8DA 2FZKB 1PRLC 3MHXA 2XI9A 3CMET 3WVEB 4FT2A 1W2BA 2DIQA 3LW5E 1Q86C 2OTLT 3RUXA 3ZBDA 1O75A 2G6FX 3N5BB 2CP3A 2F69A 2LTOA 1ZUUA 3PVQA 3PMTA 1VIFA 2OTLA 3I56A 4IIOA 4FM4B 3J81E 1OEBA 4F7UF 2CP2A 3SEMA 4BACA 3CD6A 4QQGA 1VQMQ 2RK1A 2LQKA 3T9NA 1YJ9T 4PJOB 4Q5WA 1B7TA 1SPKA 2CSQA 3CCQQ 1RAEB 2JOYA 2AKLA 4RMOA 3GIBA 3JB9G 2EBPA 3LGFA 3A8HB 5CVIA 5ECAA 4FL6A 1YI2Q 3JB9H 1WHHA 3UT1A 2JTFA 2X4YA 3CBPA 3QJYA 2FRWA 2L8DA 5DLOA 2M16A 1GXIE 4MMLA 4JZ3A 3OQ5A 3M57A 2YRCA 2P0PA 2EYQA 2NUPA 3A8MB 3NTKA 1S1NA 4J9GA 1VQNA 2O2OA 4M78E 1N27A 4J9BA 1VQ8Q 3WXMB 4Z89A 1M1KU 3NTIA 3G6EQ 1QKXA 2D8JA 4RTUA 2E10A 5GANh 3VKIA 2DYIA 3NPFA 2R5AA 2FEIA 2RD1A 3CCSQ 1IB8A 2QYZA 1D3BA 4M7AD 2FL7A 1RAGB 3GF5A 1W2BP 1VUBA 5GJVB 5GAN4 3O8VA 2K5LA 1R0BG 1QVGA 3M0UA 4M75A 3M59A 2PU9B 4MDWA 3RKYA 1I4K1 4C0DB 2K3YA 4II1A 1FXXA 1H92A 1PKSA 4N0AC 3IQLA 2VKNA 1K8AU 3CMAT 2ZPEB 2DBMA 3E19A 1KIKA 4M78A 1K1ZA 2LJ3A 1K4US 2F2XA 1ZBXA 3GLXA 4M7DE 4XTXA 4DBQA 1Q86R 2QGGA 3QJ6A 4FSSA 2HSEB 1SEMA 4NS5A 2LMJA 1AHJB 2PTKA 5CCAA 2K5FA 2CT4A 1QWEA 4FYXB 2QA4T 1KC8C 2MYSA 4F16A 1W1FA 2DTIA 2HL5C 4Y28E 3M53A 1JBMA 2FPFA 2LT4A 5FWBA 3NFCA 2RN8A 1SKUB 1VQ8T 3JCMf 2CH4W 2RK2A 3MKDA 3CMAA 1QCFA 1H641 4LDUA 1UJ0A 2CKKA 1BCOA 5IAYA 3OS2A 1M8VA 5FU7C 3INZA 2KXCA 3DKMA 1MV3A 3PNWC 3ZEHA 2I0NA 2XICA 2A0FB 1H8KA 1WHMA 1YWOA 1RI0A 1NYFA 3CCVA 3RDVA 1Q7YR 2DEUA 3G4ST 2H3JA 3H0IA 4CC7A 2DD4A 2D6FA 1YJ9A 2HZYA 4NL2A 1I8FA 3SWNC 2ABLA 2AT1B 4LUDA 1HSQA 2KRNA 2K79A 5GAOq 3L2VA 1PKTA 1GFCA 3GPLA 2QGFB 1O9SA 1FMKA 2G3RA 1ABQA 3JAME 1M2VB 3X24B 1G8XA 1PC0A 3FJPA 2K6DA 2J6KA 3H6ZA 5M9OA 1UG1A 4PFZA 1V76A 3EG1A 3L1AA 2VXEA 2JJ9A 4IUVA 1YJWT 3OYAA 3G71A 2JM9A 1N9RA 2EW3A 2HBPA 7AT1B 5C0MA 2CZ1B 2E4HA 5IXFA 3M0PA 3CPWP 4Y92A 1LCKA 1YJWQ 2R57A 4N4IA 3CPWS 4EMKB 4A63B 5GAOl 1VQ4A 2ENMA 3LLRA 2YRVA 3BFMA 1N5ZA 3HRTA 2FRYA 5A0DA 2XDPA 1UGQB 2DJQA 3M54A 2JS2A 3CCJA 1XOVA 2K9GA 3G4SQ 2EGCA 4Z8AA 3GP8A 4J9EA 3DB3A 1QVFP 3JB9J 1Q81R 5IT9E 2PQWA 2K5IA 3VS0A 3OS1A 5DM7R 1WLPB 4JDSA 4MZMA 1DJ7B 3PFSA 2Y4XA 2RB6A 4DQ2A 1D0ZA 1ZUYA 3R6NA 1TS9A 2QAZA 2WSFE 2M51A 1Z9QA 4PFOA 1YI2T 3KUFA 4JJDA 2RHZA 1H3HA 4FIBA 2B8AA 1VQ4T 2A7YA 2DL8A 1JXOA 2X3WD 2FB7A 2RJDA 3EG0A 3L42A 1VQ9T 2AHJB 2DL7A 3A5ZB 3QWXX 1VOMA 2YUPA 4M75G 2J7IA 3VRYA 4M77G 3SFMA 3MP8A 4E7JA 3VU3C 2P0KA 4A53A 2XU8A 4E7ZA 3E9FA 1TG0A 1OZ3A 2JMAA 3C0CA 2CZ7B 1NG2A 3PMIA 1BU1A 4M75B 1VQ8A 2FG0A 2LCCA 2QQBA 3PGGA 4PJNA 5CIUA 3JCMX 1I1JA 1XQHA 1RAHB 2GFUA 1B3QA 4J8OA 2PVGB 3JCMP 4MDXA 1SG5A 1K76A 5FWCA 4NL3A 2KXDA 1SHGA 2O4XA 3BE3A 2ZPGB 5GAN7 2R5MA 3M58A 5FU6C 5KYWA 1UDLA 3TEEA 3OYMA 1MMDA 4M78C 5IXBA 2A28A 2LT1A 3JCMV 1QCNA 1AD5A 4PJOE 3ZFJA 2QTXA 4M7AG 2C0TA 1T0HA 5D6YA 2X4XA 2EJ9A 1M1KR 1SHFA 1VYTA 2YRDA 3I9QA 3S3MA 3TSZA 4B9WA 4HT8A 2EKHA 2W10A 1YJ9Q 1WA7A 3JRZA 1BI2A 8ATCB 3OSSC 4C92E 1FMWA 4JRQA 3EHRA 4IURA 2KNBB 4J9HA 5GMKh 3F70A 2HL3A 3M0QA 1LVKA 3HL8A 3V7RA 2ZPFB 3MEUA 2DRKA 3TCJA 3H0HA 2DFUA 1RAAB 4E7IA 2M0YA 1RLPC 2ROLA 3VV0A 2QDLA 3VUZA 1TUGB 2BUDA 2XK0A 2VYTA 1W2BS 5D7UA 4HCZA 1P92A 1M1KC 1YN8A 4DEYA 1D1BA 1YNZA 4BY6B 2O9VA 4EDUA 3H0FA 4ZGDB 1BI3A 2KMTA 1N8RU 1K9MC 1M90C 2LCLA 1YP5A 4KGZB 1ZSGA 2HAXA 3CCEQ 3EFOA 2AK5A 2QQAA 3HTRA 2JM8A 4GLKA 5A0GA 2V1QA 3JB9F 5GAMj 2GNCA 1W70A 3CCRA 4R55A 4N4HA 1HD3A 4GY5A 3JCMd 1BK2A 4IUTA 2DE0X 1GRIA 4C92B 1M4ZA 2VV5A 5GAMh 3CCQT 1W4SA 1G3TA 2CZ6B 5J3BA 2JZ2A 2GTOA 4PJLA 1T3SA 3I35A 4M7DF 4Z88A 4ZN1A 1BB9A 3J80E 1UJYA 2YHTA 4DBRA 3RESA 2KR3A 1U1SA 4XAXB 4LDXA 4JLGA 5LJ3g 1XJWB 2FO0A 3VYHB 2OI3A 1KHCA 4EMHA 2DF6A 5GAMd 2CP6A 1QVFS 1I81A 3LWHA 4LDYA 3L2WA 2JUFA 2X4WA 2COWA 4NOYA 2DIGA 2D8HA 3JCMh 1D0YA 4F14A 5KCOA 2NWMA 3KXTA 3GNGA 5GANe 1GCQA 4FYWB 4B9XA 4BD3A 2GF7A 5GANd 4M7AB 5LL6S 3PIPA 1TUDA 2XMFA 4EMKA 3X28B 1M90R 3HRUA 4E6RA 5IH2A 4QKUA 1VQ5T 4HXJA 1AOJA 3G1JA 4LXCA 5GAMe 2MOXA 2K3BA 1JQQA 2PVDB 3OYNA 3X26B 1GL5A 4C92G 1Q82R 3RMSA 4C8QG 2P4RA 1QP2A 1QVPA 2ZPHB 2I2LA 1NPRA 2EKOA 2O01E 4RTXA 2MCNA 1K9MR 2XD0A 1F1BB 5CKBA 3P8BB 4EIKA 2JT4A 6AT1B 2DETA 2DILA 1RABB 3X25B 1VQPA 2E6ZA 1ZSZB 1H3ZA 1D1AA 1RLQC 3UA7A 1RAIB 4FT4A 1VQ7T 4DA4A 4UC4A 4BUGA 3UF4A 1UB4A 4XU2A 5CQXA 3L2ZA 3DLMA 2OTLQ 1WHLA 1VQ4Q 1XTDA 1WZOA 1D09B 3ER0A 4LNPA 4RG2A 5L8RE 3VS7A 4RTZA 2J6FA 3OS5A 2RHUA 2B86A 2L2PA 4JRKA 4L59A 3OB9A 4C0ZA 3LH0A 4A4EA 4FW2A 3QYGB 1NYGA 1E6GA 2D0QB 2ZPIB 2K7AA 4ZTFA 2C0OA 3QIIA 1FWZA 4OMMA 1N8RC 2Z0WA 2K3XA 1D3BB 1AT1B 4OGCA 1CSKA 2LC4A 5GAN2 3MPUB 2M1HA 1LNXA 2EGAA 4J7IA 4CC4B 2NUZA 3RKWA 2KI7A 4X34A 4BDZA 3QWYA 1KQ2A 2ECZA 3SWNA 5LJ5j 4PK4A 4JLIA 5FU7B 4OMLA 2RJEA 1QCOA 1V29B 4Y91A 3JCMb 3Q1JA 3ME9A 3CPFA 3AT1B 4M4ZA 1YIJA 2MF2A 4JS4A 2VWFA 4M7DC 5GAOm 4V2SA 3E9GA 2DERA 1HJDA 3H41A 3EFSA 2CP0A 4M75D 2L3RA 2LQWA 3FB9A 4JJBA 2EYWA 4E2FB 3CCJT 4XK8E 2D0NA 1QVFA 4KH0B 3QYHB 1PG5B 4J9FA 3TQ7P 3CCET 3HP9A 2A37A 2QTVA 4LUEA 4LDVA 4LD9K 2F1LA 3VS6A 1K0XA 4LDWA 3EGXB 4OB1B 1VQ5A 2K2VA 1TSFA 2DMOA 4TVRA 1UTIA 4KBMB 2HEQA 4BI8B 2V8IA 2X9HA 3G7ZA 4JJCA 4IIMA 4HVUA 1UGSB 1KQSS 4PNOA 1SSHA 4IUQA 4FSXA 1Q81U 1FYNA 2DTHA 3OYHA 4M75F 1M30A 1KQ1A 1N9SA 5I2MA 2CP5A 3SHWA 2RQUA 1TU0B 5I21A 4DOVA 4ZGEB 1JB0E 1ZBJA 4WTOB 1S72A 3MEAA 3LYIA 3C94A 4O5VA 3A1PA 3JCMJ 4C5EA 4DEXA 2VGNA 2EQKA 3QO3A 2NYSA 3CCLT 5GANj 1M90U 2O88A 3RR6A 4BI3A 1PSEA 1OI1A 2GQVA 5FRMA 1NZ9A 3OYCA 4J5YA 1WXTA 2HMAA 2YUOA 1JEGA 5KE2A 4M7AA 1AZGB 2P0QA 3QKJA 4FYYB 2HKNA 2EJFA 4RUGA 1VQ7Q 5GAN3 3CC2Q 2DBKA 1YJNQ 2XIDA 4X1VA 1ACMB 4XTUA 2CS7A 4GLMA 4F17A 3P8HA 2AIRB 2RA2A 1MNDA 1NE8A 2DO3A 1ZLMA 3UA6A 3OYLA 2E6NA 1B07A 5GANg 1OULA 3OW2P 1PD1A 1AWOA 3QZ9B 1RACB 3UPUA 2JW4A 3FDRA 3FIFA 4ZGJB 5GAOr 4CC2A 2JTMA 3RMQA 1S72Q 5CKHA 1VQPQ 2DYBA 3M0RA 1BCMA 1YI2A 3HFNA 5LJ5g 1WJRA 3ZL7C 1B34A 2Y90A 2YT6A 1NEBA 2E5KA 2IG0A 5GANf 1M27C 5HY6A 4R56A 3CC7Q 1S72T 3CCST 3QDRB 4RTYA 5KCHA 5FRNA 3CEYA 1NLOC 2H3EB 2QK0A 2LQ8A 4C5IA 5IN1A 2X51A 3HKSA 4J6XA 1VQ6T 4ATOA 2V1RA 1Q81C 4AG1C 2F2VA 4CI0C 1VYUA 2RM4A 1AZEA 3VYGA 1TXQA 2VC8A 3CD6Q 3CXCS 4BY6C 3OYEA 2HQEA 3I55T 4F7UE 1QKWA 3NTHA 1WHGA 2AKKA 2KBTA 1Y71A 2KDSA 1VQMA 3WVDB 4AFSC 2LRQA 3UDCA 2EPDA 1ZSZC 1QLYA 4PJJA 2ED1A 2J06A 2L5QA 2E41A 4OB2B 4J83A 3URGA 3M0SA 2RPNA 2SRCA 2NUTB 2RJFA 1VQNT 4C8QC 1Y7XA 1VQOT 1LPLA 3I55A 1X2QA 4C5HA 3REBB 4E7SA 1OOTA 3RNJA 1WJQA 1VYVA 1YFNA 4C0FA 2X3XD 4EMGA 1KC8U 1EX4A 2DZ9A 3GBQA 1QMCA 2HD0A 1UFFA 3I5RA 3MP1A 4F7UA 3VS3A 3QG1A 1M1FA 2RQWA 4HCBA 3M56A 1NJIC 1IHWA 5LJ5e 1VQLA 2A3LA 4XU0A 2C0IA 1N6AA 1YJNA 2LNVA 3CC4Q 5C6SA 1K8AR 5LJ5f 2L89A 1AEYA 4JPBW 4DOWA 1QWFA 3JV3A 1ABOA 4KRTA 4ZTJA 2DKGA 2KGTA 1UGRB 1Y96A 3EGXA 1AWJA 4RKUE 3U23A 2OAUA 4M75E 4EMKC 4PJOD 2BE9B 2HQXA 5CKDA 4A4GA 2DEQA 2E3HA 3M5AA 4DBHA 1MV0B 2DK3A 1ZUKA 4A4FA 4XTZA 5CO7A 2LX7A 1IRXA 1D1CA 1GCPA 3FRNA 4LE9A 2IVWA 2EWNA 2DJZA 2M02A 4KH1B 4JRPA 1IGQA 3QUIA 3HRSA 4N0AA 3OYFA 1NM7A 1IREB 4XU3A 4QQDA 4OMPA 4C0DC 1NJIU 5KYXB 2ZGWA 4A4HA 3C12A 2OTJQ 4C92A 4A54A 2DXUA 5FW9A 1M9SA 4QW2A 2QQSA 3CCMT 3L2UA 5LJ3j 4WF2A 2LJ0A 5AT1B 2YUNA 1KQSA 2KQWA 1QVGP 2CREA 4RTWA 5D6XA 1FMVA 1MGQA 2E64A 1UHCA 9ATCB 5HK0A 4OMFB 3MJXA 3H8ZA 1PCXA 1VQ7A 3M4YA 2DNUA 1OPLA 3BY7A 4M77C 3MP6A 5HKCA 1NEGA 4CRIA 5GMKm 5EC7A 3CCLQ 4C8QF 4M7AF 2GGRA 2VVKA 1HXDA 2K4YA 4QVZA 1PD0A 1U8RA 1NJIR 1K73C 5GMKl 3G71T 1UGVA 2PUKB 1JO8A 1AWXA 2X35A 2NLUA 2XHCA 5IHIA 2RHXA 3LX7A 4ELYC 4QVCA 2VGMA 5GMKj 5FLXE 4AG2C 2H8HA 5LJ3e 3V7CA 3V8KA 5I2SA 1YHQA 4M77D 2L3PA 3EGDB 1ZA1B 2QEXT 1GBQA 2XDBA 2RI3A 4KGVB 4KT0E 3CCVQ 1EFNA 1IO6A 3CCRQ 1RUWA 2P4TA 3OMGA 3EG2A 1M2OA 1BI0A 2KSSA 3KFVA 2LDMA 5GAOn 1OZ2A 2QEXQ 5GAMg 4C8QD 3I56Q 1WQWA 1SSFA 3A8GB 4RG8A 2O9SA 3UATA 1B34B 4ANJA 3CC7T 1PRMC 3CCJQ 4AFZC 5EG2A 3TVTA 1OX9A 2ZAEA 2WSCE 3S3OA 3NHNA 4M77E 1OU8A 1ZQ1A 2VXFA 2ZZDA 5HCKA 2BZ8A 2KAFA 2BIVA 4C8QA 4QVDA 1TUCA 1SRMA 3QBYA 1WI7A 1OQKA 4K11A 1BKBA 4GBQA 1M1GA 2QXFA 2V8KA 2RQRA 3OYYA 2WACA 2OAWA 1KHIA 2QI2A 2BTTA 2KK4A 1K9MU 4M78G 1GCQC 3FJ5A 1KD1R 3G71Q 1R77A 4E47A 1MMNA 2IIMA 5CAIA 1VQOQ 4XTYA 1MNEA 2L0AA 2LX9A 1GFDA 3EGDA 1Q86U 3OY9A 1WDXA 3OYDA 3JCMg 4BDYA 1YHQT 2KY9A 4CC3A 3MO8A 1I07A 1CKAA 1MMAA 4J9CA 1NBEB 4FW1A 1JJ2P 3AHUA 2HBWA 2RJCA 2HNIA 3OMCA 4X9DA 2VUBA 1G5VA 3OYIA 1VQPT 3CPWA 2D1XA 2MPXC 2DPPB 2XKOC 2OX7A 1N8RR 3CCRT 3BDUA 5GAN5 1MMGA 2L3SA 1WJSA 4C8QE 3CXCA 4F7UB 1ZX6A 2DTOA 1RL2A 3SB2A 3O5ZA 3CMEA 5KYUB 4Z02A 3TREA 5KYYA 3OSVA 3CCSA 1GBRA 1YWPA 8AT1B 2K2MA 2J05A 3QPHA 3PVLA 5LJ5d 3JCMW 2DA9A 3G6EA 2JVVA 1Q7YU 2KEAA 2WSEE 2CYZB 3C95A 2MI6A 2LJ1A 2RI5A 4O6JA 4JUVA 2V8JA 1OPKA 3QXEB 1RI9A 2DVEA 3MCAB 1E6HA 4HVWA 1U1TA 3CCUQ 1M3CA 1TOVA 3EG9B 1T3LA 2EQJA 5GJWB 2QG9B 1RADB 1I5LA 1PHTA 1U3OA 2JTEA 2OTJA 1KFZA 2DXTA 4N4GA 2ROTA 1Y57A 3VJPA 3L2RA 1OV3A 1Q82C 2DRMA 1KD1C 1KC8R 3D7SB 2RNAA 1VQOA 2QA4A 1EZZB 1A0NB 2E12A 1M8MA 2CUDA 2DXBA 3RERA 3G6ET 4PKCC 4XU1A 2VB6A 1LOJA 1VQ6Q 1VQKQ 2F2WA 4HT9A 1D0XA 2KT8A 4D6WA 1VQ5Q 2QEXA 1VQMT 3G4SA 5KYNA 3CCVT 4J6WA 4BB7A 3TU4K 1G3SA 1M2VA 4PJOA 1YJWA 1MHNA 4M7DA 4DBFA 5LJ5h 1T0JA 1LJOA 2EIFA 4RTVA 4L5GA 3PE0A 1QVGS 2PVOB 3CC4T 1VQLQ 1BIBA 3EG9A 3VUBA 3OA6A 2RO0A 1X6OA 4OP0A 3RBBB 5AYFA 1WXUA 1WX6A 1I5OB 3HSBA 2DX1A 5I11A 1Y96B 3VS1A 2LQNA 1PNJA 3JSCA 1U5SA 2RH2A 4MMKA 4M77F 3EGUA 4AFQC 1G3YA 2E65A 3CC2T 1VQNQ 3CMEQ 1ZSZA 2E1HA 4C92D 1K9AA 1IGUA 2EVRA 1BBZA 2E70A 2O4XB 4M77B 2VASA 4X9CA 5LJ3f 2EGEA 2JMCA 2FZCB 1HK9A 1PSFA 2ZPBB 4AFUC 1IZ6A 1X27A 4PJOF 5KYYB 1QW1A 3EFOB 4OGEA 1KD1U 4HKEA 3RIRA 1KSWA 3GOXA 4KUIA 3ASKA 2R58A 5CK9A 3E1SA 5FU6B 1VA7A 2LCSA 2COYA 4J7FA 1K73U 2LZ6B 5GMKi 1OU9A 3UWNA 1C1AA 1JU5C 1CKBA 3SDZA 2YLBA 4BE1A 4M7DG 2MWOA 4XTWA 4FYVB 4XTVA 2RF0A 3H9NA 3DLLA 2AZSA 3CCEA 3HPWA 2GTJA 4P5NA 3SWNB 1W6XA 2FHDA 2A36A 2K57A 5KYXA 1E7OA 5GAOp 3VS5A 5L23A 4M7AC 3I56T 1Q7YC 3TSWA 5KYWB 1OYXA 1M3BA 1X75C 1ARKA 4KGXB 4E7HA 1YCSB 3BW1A 4C0GA 2QQ9A 1VQKA 5LJ3h 2ED0A 1VQ6A 5DLQE 2QASA 3CC7A 2HCKA 4M78D 3FEOA 3QHSA 2LP5A 3OBWA 1UHFA 1JJ2S 2NUTA 4PJMA 2HDAA 1JXMA 1WIEA 3A8OB 3LGLA 3EFRA 3CCUA 1YITT 3CC2A 1J3TA 4OB0B 2SEMA 1JRIA 1JJ2A 3OYJA 2YWWA 3CCLA 4M7AE 4M75C 3X20B 2EQMA 2ESWA 4HA8A 1AWWA 2KT1A 2KYBA 2LNHB 2JXBA 2KYMA 2XDDA 5D6WA 4OVAA 2IPOB 1NLPC 3CD6T 5DY9A 2XG8D 3CXCP 4J9DA 4PFPA 4OMQA 2DL3A 3CBMA 4LN2A 2E5QA 2BKDN 3A8LB 5CR2A 2O31A 3C4SA 4M78F 2GCXA 2FZGB 4FU6A 2BZYA 2EAYA 4F7UG 2JN0A 3EH1A 4AMCA 3OYKA 2HSPA 3FC3A 4QT7A 2MMPA 1SRLA 4M77A 3CCUT 1YITA 4AT1B 2DAQA 4ZNXA 2CH4A 1TH7A 2PUOB 2CDTA 2JNGA 2EYZA 4A4KA 2RI2A 4VUBA 3JCMc 2MWPA 1AVZC 4OMNA 2F5TX 3M0TA 2A08A 4J9IA 4PLIA 4B6MA 3CCQA 2DL4A 4LD6A 1KG1A 2GQIA 3EHQA 2KRSA 4KULA 3OW2S 2DM1A 2FPEA 2W0ZA 1SF9A
chains in the Genus database with same CATH topology
4OMMA 2KXCA 1PWTA 1MV3A 4AG2C 2H8HA 4ESRA 2I0NA 1CSKA 1H8KA 1YWOA 1I0CA 2EGAA 4CC4B 1NYFA 4WCIA 2L3PA 2NUZA 4HCKA 2GBQA 1GBQA 5I22A 3H0IA 4CC7A 1WYXA 3QWYA 1EFNA 1IO6A 2ECZA 1RUWA 5IHNA 2PZ1A 3EG2A 1Y0MA 4OMLA 4ORZA 2MIOA 2ABLA 4LUDA 1G83A 1HSQA 3KFVA 2KRNA 2K79A 4M4ZA 2O9SA 3UATA 1PKTA 2VWFA 1GFCA 1PRMC 4AFZC 3TVTA 2YDLA 1HJDA 1FMKA 3NHNA 3H41A 2AZVA 2YUQA 1ABQA 5HCKA 2BZ8A 4R0KA 1UE9A 2LQWA 4JJBA 1TUCA 1SRMA 1WI7A 2EYWA 4K11A 4GBQA 2K6DA 2J6KA 2D0NA 1UG1A 1X2KA 3EG1A 2L3QA 2RQRA 4J9FA 2OAWA 2JM9A 2BTTA 2EW3A 1M3AA 3VRZA 1GCQC 2A37A 3FJ5A 4LUEA 2IIMA 5IXFA 1X69A 3VS6A 1K0XA 2JS0A 2KROA 2L0AA 1GFDA 3M0PA 4Y92A 1LCKA 1WDXA 2J6OA 2DMOA 4A63B 2ENMA 2DL5A 1UTIA 2HEQA 1N5ZA 2FRYA 4CC3A 1I07A 1CKAA 4J9CA 2DJQA 4JJCA 2HBWA 2JS2A 4IIMA 4HVUA 4HVVA 1XOVA 2D1XA 2K9GA 2EGCA 2DLPA 4Z8AA 1SSHA 2BZXA 4J9EA 1FYNA 2L3SA 3VS0A 1ZX6A 1M30A 3O5ZA 3SHWA 1WLPB 1X43A 1KJWA 2RQUA 1ZBJA 1GBRA 1YWPA 2K2MA 2CUBA 2J05A 3PVLA 1ZUYA 3R6NA 4DEXA 2DA9A 2M51A 1Z9QA 2CSIA 4JJDA 1H3HA 2EQIA 3ULRB 2KEAA 2O88A 1X6BA 2DL8A 1JXOA 2LJ1A 2X3WD 1WFWA 2KRMA 1WXTA 2YUOA 1X6GA 2YSQA 1JEGA 1OPKA 3EG0A 1RI9A 3VS2A 1AZGB 2DL7A 2OJ2A 1E6HA 3QWXX 4HVWA 1M3CA 2YUPA 4RUGA 1T3LA 2EYXA 2DBKA 2KE9A 3VS4A 2J7IA 3EG3A 4X1VA 3VRYA 5GJWB 4GLMA 4RTTA 4F17A 1PHTA 1U3OA 1TG0A 1ZLMA 2JMAA 2JTEA 3C0CA 1KFZA 3UA6A 1NG2A 1BU1A 1B07A 2ROTA 1Y57A 1AWOA 2FG0A 2JW4A 1I1JA 1OV3A 1B3QA 4D8KA 2DRMA 5IHKA 3CQTA 1K76A 4CC2A 2RNAA 5FWCA 2KXDA 1SHGA 1A0NB 1M8MA 1Z9ZA 2CUDA 1WXBA 1K0SA 2PNIA 2DYBA 3M0RA 1UDLA 3NGPA 3ZL7C 5IXBA 2A28A 1AD5A 2YT6A 1NEBA 2E5KA 3LH5A 1M27C 1MUZA 1V1CA 2F2WA 2FPDA 2C0TA 2KT8A 1T0HA 4JZ4A 4RTYA 1SHFA 1VYTA 3I9QA 1NLOC 3TSZA 2RQTA 2EKHA 2W10A 1WA7A 2CT3A 2V1RA 1T0JA 4AG1C 4RTVA 2F2VA 3PE0A 3EHRA 2KNBB 4OMOA 1VYUA 3A98A 3THKA 1U06A 4J9HA 1AZEA 2RQVA 3RBBB 1WXUA 1WX6A 3M0QA 3I5SA 3REAB 2DX1A 2DRKA 2RMOA 5I11A 1QKWA 3H0HA 3VS1A 2AKKA 2LQNA 2KBTA 1PNJA 2M0YA 1RLPC 2ROLA 1U5SA 2QDLA 3EGUA 4AFQC 3NMZC 4AFSC 2DVJA 1UECA 1G2BA 2EPDA 1QLYA 1YN8A 1UUEA 4DEYA 2ED1A 2J06A 1YNZA 2O9VA 3H0FA 1K9AA 2EVRA 1BBZA 1YP5A 3M0SA 2EGEA 2EYYA 1ZSGA 2RPNA 2SRCA 4D8DA 2AK5A 1PRLC 2JMCA 2JM8A 2V1QA 4AFUC 2GNCA 1W70A 2G6FX 1X27A 1X2QA 3REBB 1HD3A 1OOTA 3RNJA 1VYVA 1ZUUA 1BK2A 3PVQA 2X3XD 2DE0X 1GRIA 4IIOA 3GBQA 1KSWA 1OEBA 3SEMA 1UFFA 3I5RA 3VS3A 2RQWA 1VA7A 2LCSA 2GTOA 2LZ6B 1JU5C 1CKBA 1T3SA 3I35A 2C0IA 1SPKA 4Z88A 2CSQA 1BB9A 2RF0A 1UJYA 2AZSA 1AEYA 4JPBW 2AKLA 1QWFA 2KR3A 2GTJA 1W6XA 3JV3A 1ABOA 2EBPA 2A36A 4KRTA 1E7OA 2FO0A 3VS5A 2KGTA 5L23A 5ECAA 2OI3A 1AWJA 3TSWA 3U23A 1M3BA 2DF6A 1ARKA 2FRWA 1YCSB 4JZ3A 1MV0B 2ED0A 1ZUKA 2HCKA 2LX7A 2D8HA 1S1NA 2LP5A 4J9GA 2O2OA 1GCPA 4F14A 1UHFA 2NWMA 4J9BA 4LE9A 4Z89A 1GCQA 1QKXA 2D8JA 4RTUA 2HDAA 1NM7A 1JXMA 1TUDA 1WIEA 2XMFA 3NPFA 4E6RA 2FEIA 5IH2A 1J3TA 4OMPA 2SEMA 4HXJA 1AOJA 5GJVB 2ESWA 3M0UA 2MOXA 2K3BA 1JQQA 1AWWA 2KT1A 5FW9A 2KYBA 2LNHB 2JXBA 2KYMA 1GL5A 1NLPC 2P4RA 1H92A 1PKSA 2LJ0A 4J9DA 4OMQA 2DL3A 4LN2A 2YUNA 4RTXA 2MCNA 3IQLA 2VKNA 4EIKA 2O31A 2DBMA 1KIKA 2CREA 2JT4A 4RTWA 2DILA 1K1ZA 2LJ3A 1K4US 2F2XA 2BZYA 1UHCA 4FSSA 1RLQC 2HSPA 3UA7A 1SEMA 4QT7A 2LMJA 1SRLA 2PTKA 4ZNXA 2CH4A 2DNUA 1OPLA 2CT4A 1QWEA 2CDTA 2EYZA 1NEGA 3UF4A 4F16A 5EC7A 1W1FA 2GGRA 1AVZC 2VVKA 2FPFA 4OMNA 5FWBA 3M0TA 2RN8A 4LNPA 2A08A 4J9IA 3VS7A 2CH4W 4RTZA 2J6FA 1QCFA 2B86A 2L2PA 1UGVA 2DL4A 2GQIA 3EHQA 1NYGA 1E6GA 2KRSA 2K7AA 1JO8A 2DM1A 1AWXA 1UJ0A 2FPEA 2W0ZA 2C0OA 5IHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMM A;  2KXC A;  1PWT A;  1MV3 A;  4AG2 C;  2H8H A;  4ESR A;  2I0N A;  1CSK A;  1H8K A;  1YWO A;  1I0C A;  2EGA A;  4CC4 B;  1NYF A;  4WCI A;  2L3P A;  2NUZ A;  4HCK A;  2GBQ A;  1GBQ A;  5I22 A;  3H0I A;  4CC7 A;  1WYX A;  3QWY A;  1EFN A;  1IO6 A;  2ECZ A;  1RUW A;  5IHN A;  2PZ1 A;  3EG2 A;  1Y0M A;  4OML A;  4ORZ A;  2MIO A;  2ABL A;  4LUD A;  1G83 A;  1HSQ A;  3KFV A;  2KRN A;  2K79 A;  4M4Z A;  2O9S A;  3UAT A;  1PKT A;  2VWF A;  1GFC A;  1PRM C;  4AFZ C;  3TVT A;  2YDL A;  1HJD A;  1FMK A;  3NHN A;  3H41 A;  2AZV A;  2YUQ A;  1ABQ A;  5HCK A;  2BZ8 A;  4R0K A;  1UE9 A;  2LQW A;  4JJB A;  1TUC A;  1SRM A;  1WI7 A;  2EYW A;  4K11 A;  4GBQ A;  2K6D A;  2J6K A;  2D0N A;  1UG1 A;  1X2K A;  3EG1 A;  2L3Q A;  2RQR A;  4J9F A;  2OAW A;  2JM9 A;  2BTT A;  2EW3 A;  1M3A A;  3VRZ A;  1GCQ C;  2A37 A;  3FJ5 A;  4LUE A;  2IIM A;  5IXF A;  1X69 A;  3VS6 A;  1K0X A;  2JS0 A;  2KRO A;  2L0A A;  1GFD A;  3M0P A;  4Y92 A;  1LCK A;  1WDX A;  2J6O A;  2DMO A;  4A63 B;  2ENM A;  2DL5 A;  1UTI A;  2HEQ A;  1N5Z A;  2FRY A;  4CC3 A;  1I07 A;  1CKA A;  4J9C A;  2DJQ A;  4JJC A;  2HBW A;  2JS2 A;  4IIM A;  4HVU A;  4HVV A;  1XOV A;  2D1X A;  2K9G A;  2EGC A;  2DLP A;  4Z8A A;  1SSH A;  2BZX A;  4J9E A;  1FYN A;  2L3S A;  3VS0 A;  1ZX6 A;  1M30 A;  3O5Z A;  3SHW A;  1WLP B;  1X43 A;  1KJW A;  2RQU A;  1ZBJ A;  1GBR A;  1YWP A;  2K2M A;  2CUB A;  2J05 A;  3PVL A;  1ZUY A;  3R6N A;  4DEX A;  2DA9 A;  2M51 A;  1Z9Q A;  2CSI A;  4JJD A;  1H3H A;  2EQI A;  3ULR B;  2KEA A;  2O88 A;  1X6B A;  2DL8 A;  1JXO A;  2LJ1 A;  2X3W D;  1WFW A;  2KRM A;  1WXT A;  2YUO A;  1X6G A;  2YSQ A;  1JEG A;  1OPK A;  3EG0 A;  1RI9 A;  3VS2 A;  1AZG B;  2DL7 A;  2OJ2 A;  1E6H A;  3QWX X;  4HVW A;  1M3C A;  2YUP A;  4RUG A;  1T3L A;  2EYX A;  2DBK A;  2KE9 A;  3VS4 A;  2J7I A;  3EG3 A;  4X1V A;  3VRY A;  5GJW B;  4GLM A;  4RTT A;  4F17 A;  1PHT A;  1U3O A;  1TG0 A;  1ZLM A;  2JMA A;  2JTE A;  3C0C A;  1KFZ A;  3UA6 A;  1NG2 A;  1BU1 A;  1B07 A;  2ROT A;  1Y57 A;  1AWO A;  2FG0 A;  2JW4 A;  1I1J A;  1OV3 A;  1B3Q A;  4D8K A;  2DRM A;  5IHK A;  3CQT A;  1K76 A;  4CC2 A;  2RNA A;  5FWC A;  2KXD A;  1SHG A;  1A0N B;  1M8M A;  1Z9Z A;  2CUD A;  1WXB A;  1K0S A;  2PNI A;  2DYB A;  3M0R A;  1UDL A;  3NGP A;  3ZL7 C;  5IXB A;  2A28 A;  1AD5 A;  2YT6 A;  1NEB A;  2E5K A;  3LH5 A;  1M27 C;  1MUZ A;  1V1C A;  2F2W A;  2FPD A;  2C0T A;  2KT8 A;  1T0H A;  4JZ4 A;  4RTY A;  1SHF A;  1VYT A;  3I9Q A;  1NLO C;  3TSZ A;  2RQT A;  2EKH A;  2W10 A;  1WA7 A;  2CT3 A;  2V1R A;  1T0J A;  4AG1 C;  4RTV A;  2F2V A;  3PE0 A;  3EHR A;  2KNB B;  4OMO A;  1VYU A;  3A98 A;  3THK A;  1U06 A;  4J9H A;  1AZE A;  2RQV A;  3RBB B;  1WXU A;  1WX6 A;  3M0Q A;  3I5S A;  3REA B;  2DX1 A;  2DRK A;  2RMO A;  5I11 A;  1QKW A;  3H0H A;  3VS1 A;  2AKK A;  2LQN A;  2KBT A;  1PNJ A;  2M0Y A;  1RLP C;  2ROL A;  1U5S A;  2QDL A;  3EGU A;  4AFQ C;  3NMZ C;  4AFS C;  2DVJ A;  1UEC A;  1G2B A;  2EPD A;  1QLY A;  1YN8 A;  1UUE A;  4DEY A;  2ED1 A;  2J06 A;  1YNZ A;  2O9V A;  3H0F A;  1K9A A;  2EVR A;  1BBZ A;  1YP5 A;  3M0S A;  2EGE A;  2EYY A;  1ZSG A;  2RPN A;  2SRC A;  4D8D A;  2AK5 A;  1PRL C;  2JMC A;  2JM8 A;  2V1Q A;  4AFU C;  2GNC A;  1W70 A;  2G6F X;  1X27 A;  1X2Q A;  3REB B;  1HD3 A;  1OOT A;  3RNJ A;  1VYV A;  1ZUU A;  1BK2 A;  3PVQ A;  2X3X D;  2DE0 X;  1GRI A;  4IIO A;  3GBQ A;  1KSW A;  1OEB A;  3SEM A;  1UFF A;  3I5R A;  3VS3 A;  2RQW A;  1VA7 A;  2LCS A;  2GTO A;  2LZ6 B;  1JU5 C;  1CKB A;  1T3S A;  3I35 A;  2C0I A;  1SPK A;  4Z88 A;  2CSQ A;  1BB9 A;  2RF0 A;  1UJY A;  2AZS A;  1AEY A;  4JPB W;  2AKL A;  1QWF A;  2KR3 A;  2GTJ A;  1W6X A;  3JV3 A;  1ABO A;  2EBP A;  2A36 A;  4KRT A;  1E7O A;  2FO0 A;  3VS5 A;  2KGT A;  5L23 A;  5ECA A;  2OI3 A;  1AWJ A;  3TSW A;  3U23 A;  1M3B A;  2DF6 A;  1ARK A;  2FRW A;  1YCS B;  4JZ3 A;  1MV0 B;  2ED0 A;  1ZUK A;  2HCK A;  2LX7 A;  2D8H A;  1S1N A;  2LP5 A;  4J9G A;  2O2O A;  1GCP A;  4F14 A;  1UHF A;  2NWM A;  4J9B A;  4LE9 A;  4Z89 A;  1GCQ A;  1QKX A;  2D8J A;  4RTU A;  2HDA A;  1NM7 A;  1JXM A;  1TUD A;  1WIE A;  2XMF A;  3NPF A;  4E6R A;  2FEI A;  5IH2 A;  1J3T A;  4OMP A;  2SEM A;  4HXJ A;  1AOJ A;  5GJV B;  2ESW A;  3M0U A;  2MOX A;  2K3B A;  1JQQ A;  1AWW A;  2KT1 A;  5FW9 A;  2KYB A;  2LNH B;  2JXB A;  2KYM A;  1GL5 A;  1NLP C;  2P4R A;  1H92 A;  1PKS A;  2LJ0 A;  4J9D A;  4OMQ A;  2DL3 A;  4LN2 A;  2YUN A;  4RTX A;  2MCN A;  3IQL A;  2VKN A;  4EIK A;  2O31 A;  2DBM A;  1KIK A;  2CRE A;  2JT4 A;  4RTW A;  2DIL A;  1K1Z A;  2LJ3 A;  1K4U S;  2F2X A;  2BZY A;  1UHC A;  4FSS A;  1RLQ C;  2HSP A;  3UA7 A;  1SEM A;  4QT7 A;  2LMJ A;  1SRL A;  2PTK A;  4ZNX A;  2CH4 A;  2DNU A;  1OPL A;  2CT4 A;  1QWE A;  2CDT A;  2EYZ A;  1NEG A;  3UF4 A;  4F16 A;  5EC7 A;  1W1F A;  2GGR A;  1AVZ C;  2VVK A;  2FPF A;  4OMN A;  5FWB A;  3M0T A;  2RN8 A;  4LNP A;  2A08 A;  4J9I A;  3VS7 A;  2CH4 W;  4RTZ A;  2J6F A;  1QCF A;  2B86 A;  2L2P A;  1UGV A;  2DL4 A;  2GQI A;  3EHQ A;  1NYG A;  1E6G A;  2KRS A;  2K7A A;  1JO8 A;  2DM1 A;  1AWX A;  1UJ0 A;  2FPE A;  2W0Z A;  2C0O A;  5IHI A; 
#chains in the Genus database with same CATH topology
 4M78 B;  1PWT A;  1UEB A;  4ME7 A;  4QQ6 A;  1IHV A;  4ESR A;  2X4J A;  2HQH A;  1I0C A;  4XQ3 A;  4WCI A;  2D9T A;  4HCK A;  2GBQ A;  5CKF A;  5GAM f;  3CCM Q;  5I22 A;  1HYO A;  1WYX A;  3M9Q A;  1IXD A;  4RCB A;  5IHN A;  2PZ1 A;  1Y0M A;  4ORZ A;  2MIO A;  2HKQ B;  1G83 A;  2RHY A;  3MEV A;  4YTL A;  2CZ0 B;  3EAE A;  1OX8 A;  4ZN3 A;  1ZHI A;  3P8D A;  1BI1 A;  2QQR A;  5A0L A;  1WGS A;  2YDL A;  3L2Q A;  1KK7 A;  3JB9 D;  2AZV A;  2YUQ A;  4BI4 A;  4R0K A;  1NPP A;  2GFA A;  4JS5 A;  1TTH B;  1UE9 A;  2C06 A;  1YBY A;  3FLG A;  3CC4 A;  4KUD K;  2FVU A;  4M7D B;  1X2K A;  5CQY A;  4BE2 A;  2NUP B;  2L3Q A;  1KQS P;  1YIJ T;  1K8A C;  1QQJ A;  1TWB A;  1C0M A;  4OF1 A;  4PL6 A;  3QZ5 B;  1YIT Q;  1M3A A;  3VRZ A;  3I55 Q;  5GMK e;  1VQ9 A;  1YHQ Q;  2CP7 A;  1X69 A;  2JS0 A;  1Q82 U;  2ZCF B;  2KRO A;  3KBG A;  4ELZ C;  2J6O A;  2BE7 D;  3QDF A;  2DL5 A;  3S6W A;  2YLC A;  1Q95 G;  1YCY A;  1BIA A;  2P84 A;  3M55 A;  3V8J A;  4HVV A;  3HFO A;  2Y4Y A;  2DLP A;  4L6V 5;  2BZX A;  3V7S A;  4BE0 A;  2M9U A;  1EIF A;  3BDL A;  3OBY A;  4RCC A;  2OTJ T;  4EPC A;  1VQK T;  3OYB A;  3OS0 A;  1X43 A;  1KJW A;  2V26 A;  4MZP A;  4MZT A;  2DD5 A;  5GAN 8;  2CGH A;  3QSU A;  3CCM A;  2E3I A;  4C92 C;  2CUB A;  1VIE A;  2DZC A;  2FYK A;  3DB4 A;  2QA4 Q;  1C6V X;  2LVM A;  3CMA Q;  2CSI A;  2EQI A;  3ULR B;  5GAN 6;  4E7L A;  5J39 A;  1X6B A;  1XNI A;  1YJN T;  2COZ A;  1WFW A;  2KRM A;  1WHK A;  1X6G A;  2YSQ A;  4C8Q B;  3PIO A;  3VS2 A;  3OW2 A;  2OJ2 A;  2RHI A;  3JB9 I;  2EQU A;  2EYX A;  2KE9 A;  3VS4 A;  3EG3 A;  4C5G A;  4RTT A;  4OB3 B;  1WHJ A;  3PT9 A;  1M5Q 1;  3MET A;  4J6Y A;  4IKF A;  2ATC B;  3E2U A;  4F04 B;  5LJ3 d;  4D8K A;  2KVQ G;  5IHK A;  3CQT A;  3S3N A;  3OYG A;  4PJO C;  3JCM e;  3SD4 A;  5KE3 A;  1Z9Z A;  1WXB A;  4M7D D;  1K0S A;  2PNI A;  1Y07 A;  1X01 A;  3NGP A;  1UGP B;  3R6O A;  1K73 R;  1BYM A;  4JJN K;  3LH5 A;  3J7A F;  1MUZ A;  4C92 F;  1QP3 A;  1V1C A;  2FPD A;  4JZ4 A;  1VQL T;  3PTA A;  3EH2 A;  1ZA2 B;  2RQT A;  3MEW A;  2EJG A;  4HCC A;  3HHT B;  2CT3 A;  4JRI A;  2YXY A;  2DXC A;  3M4G A;  4OMO A;  3A98 A;  3THK A;  5HK3 A;  1U06 A;  4FCY A;  5J26 A;  1YIJ Q;  2RQV A;  1G3W A;  3GNF B;  3I5S A;  3REA B;  3CBO A;  4E7K A;  2RMO A;  3JCM Q;  1WPY A;  5CKE A;  5A2Q E;  1WNL A;  2MK5 A;  1VQ9 Q;  1WQ7 A;  1FX7 A;  2M0O A;  3RKX A;  4PLL A;  4IUU A;  5KH6 A;  3NMZ C;  2DVJ A;  2EFI A;  1UEC A;  1G2B A;  1UUE A;  3LWI A;  1RAF B;  2F5K A;  5KYU A;  2MAM A;  3V8L A;  2QDY B;  5FRO A;  1R8O B;  2EYY A;  4PJO G;  1R0C B;  1PM3 A;  4IUP A;  4D8D A;  2FZK B;  1PRL C;  3MHX A;  2XI9 A;  3CME T;  3WVE B;  4FT2 A;  1W2B A;  2DIQ A;  3LW5 E;  1Q86 C;  2OTL T;  3RUX A;  3ZBD A;  1O75 A;  2G6F X;  3N5B B;  2CP3 A;  2F69 A;  2LTO A;  1ZUU A;  3PVQ A;  3PMT A;  1VIF A;  2OTL A;  3I56 A;  4IIO A;  4FM4 B;  3J81 E;  1OEB A;  4F7U F;  2CP2 A;  3SEM A;  4BAC A;  3CD6 A;  4QQG A;  1VQM Q;  2RK1 A;  2LQK A;  3T9N A;  1YJ9 T;  4PJO B;  4Q5W A;  1B7T A;  1SPK A;  2CSQ A;  3CCQ Q;  1RAE B;  2JOY A;  2AKL A;  4RMO A;  3GIB A;  3JB9 G;  2EBP A;  3LGF A;  3A8H B;  5CVI A;  5ECA A;  4FL6 A;  1YI2 Q;  3JB9 H;  1WHH A;  3UT1 A;  2JTF A;  2X4Y A;  3CBP A;  3QJY A;  2FRW A;  2L8D A;  5DLO A;  2M16 A;  1GXI E;  4MML A;  4JZ3 A;  3OQ5 A;  3M57 A;  2YRC A;  2P0P A;  2EYQ A;  2NUP A;  3A8M B;  3NTK A;  1S1N A;  4J9G A;  1VQN A;  2O2O A;  4M78 E;  1N27 A;  4J9B A;  1VQ8 Q;  3WXM B;  4Z89 A;  1M1K U;  3NTI A;  3G6E Q;  1QKX A;  2D8J A;  4RTU A;  2E10 A;  5GAN h;  3VKI A;  2DYI A;  3NPF A;  2R5A A;  2FEI A;  2RD1 A;  3CCS Q;  1IB8 A;  2QYZ A;  1D3B A;  4M7A D;  2FL7 A;  1RAG B;  3GF5 A;  1W2B P;  1VUB A;  5GJV B;  5GAN 4;  3O8V A;  2K5L A;  1R0B G;  1QVG A;  3M0U A;  4M75 A;  3M59 A;  2PU9 B;  4MDW A;  3RKY A;  1I4K 1;  4C0D B;  2K3Y A;  4II1 A;  1FXX A;  1H92 A;  1PKS A;  4N0A C;  3IQL A;  2VKN A;  1K8A U;  3CMA T;  2ZPE B;  2DBM A;  3E19 A;  1KIK A;  4M78 A;  1K1Z A;  2LJ3 A;  1K4U S;  2F2X A;  1ZBX A;  3GLX A;  4M7D E;  4XTX A;  4DBQ A;  1Q86 R;  2QGG A;  3QJ6 A;  4FSS A;  2HSE B;  1SEM A;  4NS5 A;  2LMJ A;  1AHJ B;  2PTK A;  5CCA A;  2K5F A;  2CT4 A;  1QWE A;  4FYX B;  2QA4 T;  1KC8 C;  2MYS A;  4F16 A;  1W1F A;  2DTI A;  2HL5 C;  4Y28 E;  3M53 A;  1JBM A;  2FPF A;  2LT4 A;  5FWB A;  3NFC A;  2RN8 A;  1SKU B;  1VQ8 T;  3JCM f;  2CH4 W;  2RK2 A;  3MKD A;  3CMA A;  1QCF A;  1H64 1;  4LDU A;  1UJ0 A;  2CKK A;  1BCO A;  5IAY A;  3OS2 A;  1M8V A;  5FU7 C;  3INZ A;  2KXC A;  3DKM A;  1MV3 A;  3PNW C;  3ZEH A;  2I0N A;  2XIC A;  2A0F B;  1H8K A;  1WHM A;  1YWO A;  1RI0 A;  1NYF A;  3CCV A;  3RDV A;  1Q7Y R;  2DEU A;  3G4S T;  2H3J A;  3H0I A;  4CC7 A;  2DD4 A;  2D6F A;  1YJ9 A;  2HZY A;  4NL2 A;  1I8F A;  3SWN C;  2ABL A;  2AT1 B;  4LUD A;  1HSQ A;  2KRN A;  2K79 A;  5GAO q;  3L2V A;  1PKT A;  1GFC A;  3GPL A;  2QGF B;  1O9S A;  1FMK A;  2G3R A;  1ABQ A;  3JAM E;  1M2V B;  3X24 B;  1G8X A;  1PC0 A;  3FJP A;  2K6D A;  2J6K A;  3H6Z A;  5M9O A;  1UG1 A;  4PFZ A;  1V76 A;  3EG1 A;  3L1A A;  2VXE A;  2JJ9 A;  4IUV A;  1YJW T;  3OYA A;  3G71 A;  2JM9 A;  1N9R A;  2EW3 A;  2HBP A;  7AT1 B;  5C0M A;  2CZ1 B;  2E4H A;  5IXF A;  3M0P A;  3CPW P;  4Y92 A;  1LCK A;  1YJW Q;  2R57 A;  4N4I A;  3CPW S;  4EMK B;  4A63 B;  5GAO l;  1VQ4 A;  2ENM A;  3LLR A;  2YRV A;  3BFM A;  1N5Z A;  3HRT A;  2FRY A;  5A0D A;  2XDP A;  1UGQ B;  2DJQ A;  3M54 A;  2JS2 A;  3CCJ A;  1XOV A;  2K9G A;  3G4S Q;  2EGC A;  4Z8A A;  3GP8 A;  4J9E A;  3DB3 A;  1QVF P;  3JB9 J;  1Q81 R;  5IT9 E;  2PQW A;  2K5I A;  3VS0 A;  3OS1 A;  5DM7 R;  1WLP B;  4JDS A;  4MZM A;  1DJ7 B;  3PFS A;  2Y4X A;  2RB6 A;  4DQ2 A;  1D0Z A;  1ZUY A;  3R6N A;  1TS9 A;  2QAZ A;  2WSF E;  2M51 A;  1Z9Q A;  4PFO A;  1YI2 T;  3KUF A;  4JJD A;  2RHZ A;  1H3H A;  4FIB A;  2B8A A;  1VQ4 T;  2A7Y A;  2DL8 A;  1JXO A;  2X3W D;  2FB7 A;  2RJD A;  3EG0 A;  3L42 A;  1VQ9 T;  2AHJ B;  2DL7 A;  3A5Z B;  3QWX X;  1VOM A;  2YUP A;  4M75 G;  2J7I A;  3VRY A;  4M77 G;  3SFM A;  3MP8 A;  4E7J A;  3VU3 C;  2P0K A;  4A53 A;  2XU8 A;  4E7Z A;  3E9F A;  1TG0 A;  1OZ3 A;  2JMA A;  3C0C A;  2CZ7 B;  1NG2 A;  3PMI A;  1BU1 A;  4M75 B;  1VQ8 A;  2FG0 A;  2LCC A;  2QQB A;  3PGG A;  4PJN A;  5CIU A;  3JCM X;  1I1J A;  1XQH A;  1RAH B;  2GFU A;  1B3Q A;  4J8O A;  2PVG B;  3JCM P;  4MDX A;  1SG5 A;  1K76 A;  5FWC A;  4NL3 A;  2KXD A;  1SHG A;  2O4X A;  3BE3 A;  2ZPG B;  5GAN 7;  2R5M A;  3M58 A;  5FU6 C;  5KYW A;  1UDL A;  3TEE A;  3OYM A;  1MMD A;  4M78 C;  5IXB A;  2A28 A;  2LT1 A;  3JCM V;  1QCN A;  1AD5 A;  4PJO E;  3ZFJ A;  2QTX A;  4M7A G;  2C0T A;  1T0H A;  5D6Y A;  2X4X A;  2EJ9 A;  1M1K R;  1SHF A;  1VYT A;  2YRD A;  3I9Q A;  3S3M A;  3TSZ A;  4B9W A;  4HT8 A;  2EKH A;  2W10 A;  1YJ9 Q;  1WA7 A;  3JRZ A;  1BI2 A;  8ATC B;  3OSS C;  4C92 E;  1FMW A;  4JRQ A;  3EHR A;  4IUR A;  2KNB B;  4J9H A;  5GMK h;  3F70 A;  2HL3 A;  3M0Q A;  1LVK A;  3HL8 A;  3V7R A;  2ZPF B;  3MEU A;  2DRK A;  3TCJ A;  3H0H A;  2DFU A;  1RAA B;  4E7I A;  2M0Y A;  1RLP C;  2ROL A;  3VV0 A;  2QDL A;  3VUZ A;  1TUG B;  2BUD A;  2XK0 A;  2VYT A;  1W2B S;  5D7U A;  4HCZ A;  1P92 A;  1M1K C;  1YN8 A;  4DEY A;  1D1B A;  1YNZ A;  4BY6 B;  2O9V A;  4EDU A;  3H0F A;  4ZGD B;  1BI3 A;  2KMT A;  1N8R U;  1K9M C;  1M90 C;  2LCL A;  1YP5 A;  4KGZ B;  1ZSG A;  2HAX A;  3CCE Q;  3EFO A;  2AK5 A;  2QQA A;  3HTR A;  2JM8 A;  4GLK A;  5A0G A;  2V1Q A;  3JB9 F;  5GAM j;  2GNC A;  1W70 A;  3CCR A;  4R55 A;  4N4H A;  1HD3 A;  4GY5 A;  3JCM d;  1BK2 A;  4IUT A;  2DE0 X;  1GRI A;  4C92 B;  1M4Z A;  2VV5 A;  5GAM h;  3CCQ T;  1W4S A;  1G3T A;  2CZ6 B;  5J3B A;  2JZ2 A;  2GTO A;  4PJL A;  1T3S A;  3I35 A;  4M7D F;  4Z88 A;  4ZN1 A;  1BB9 A;  3J80 E;  1UJY A;  2YHT A;  4DBR A;  3RES A;  2KR3 A;  1U1S A;  4XAX B;  4LDX A;  4JLG A;  5LJ3 g;  1XJW B;  2FO0 A;  3VYH B;  2OI3 A;  1KHC A;  4EMH A;  2DF6 A;  5GAM d;  2CP6 A;  1QVF S;  1I81 A;  3LWH A;  4LDY A;  3L2W A;  2JUF A;  2X4W A;  2COW A;  4NOY A;  2DIG A;  2D8H A;  3JCM h;  1D0Y A;  4F14 A;  5KCO A;  2NWM A;  3KXT A;  3GNG A;  5GAN e;  1GCQ A;  4FYW B;  4B9X A;  4BD3 A;  2GF7 A;  5GAN d;  4M7A B;  5LL6 S;  3PIP A;  1TUD A;  2XMF A;  4EMK A;  3X28 B;  1M90 R;  3HRU A;  4E6R A;  5IH2 A;  4QKU A;  1VQ5 T;  4HXJ A;  1AOJ A;  3G1J A;  4LXC A;  5GAM e;  2MOX A;  2K3B A;  1JQQ A;  2PVD B;  3OYN A;  3X26 B;  1GL5 A;  4C92 G;  1Q82 R;  3RMS A;  4C8Q G;  2P4R A;  1QP2 A;  1QVP A;  2ZPH B;  2I2L A;  1NPR A;  2EKO A;  2O01 E;  4RTX A;  2MCN A;  1K9M R;  2XD0 A;  1F1B B;  5CKB A;  3P8B B;  4EIK A;  2JT4 A;  6AT1 B;  2DET A;  2DIL A;  1RAB B;  3X25 B;  1VQP A;  2E6Z A;  1ZSZ B;  1H3Z A;  1D1A A;  1RLQ C;  3UA7 A;  1RAI B;  4FT4 A;  1VQ7 T;  4DA4 A;  4UC4 A;  4BUG A;  3UF4 A;  1UB4 A;  4XU2 A;  5CQX A;  3L2Z A;  3DLM A;  2OTL Q;  1WHL A;  1VQ4 Q;  1XTD A;  1WZO A;  1D09 B;  3ER0 A;  4LNP A;  4RG2 A;  5L8R E;  3VS7 A;  4RTZ A;  2J6F A;  3OS5 A;  2RHU A;  2B86 A;  2L2P A;  4JRK A;  4L59 A;  3OB9 A;  4C0Z A;  3LH0 A;  4A4E A;  4FW2 A;  3QYG B;  1NYG A;  1E6G A;  2D0Q B;  2ZPI B;  2K7A A;  4ZTF A;  2C0O A;  3QII A;  1FWZ A;  4OMM A;  1N8R C;  2Z0W A;  2K3X A;  1D3B B;  1AT1 B;  4OGC A;  1CSK A;  2LC4 A;  5GAN 2;  3MPU B;  2M1H A;  1LNX A;  2EGA A;  4J7I A;  4CC4 B;  2NUZ A;  3RKW A;  2KI7 A;  4X34 A;  4BDZ A;  3QWY A;  1KQ2 A;  2ECZ A;  3SWN A;  5LJ5 j;  4PK4 A;  4JLI A;  5FU7 B;  4OML A;  2RJE A;  1QCO A;  1V29 B;  4Y91 A;  3JCM b;  3Q1J A;  3ME9 A;  3CPF A;  3AT1 B;  4M4Z A;  1YIJ A;  2MF2 A;  4JS4 A;  2VWF A;  4M7D C;  5GAO m;  4V2S A;  3E9G A;  2DER A;  1HJD A;  3H41 A;  3EFS A;  2CP0 A;  4M75 D;  2L3R A;  2LQW A;  3FB9 A;  4JJB A;  2EYW A;  4E2F B;  3CCJ T;  4XK8 E;  2D0N A;  1QVF A;  4KH0 B;  3QYH B;  1PG5 B;  4J9F A;  3TQ7 P;  3CCE T;  3HP9 A;  2A37 A;  2QTV A;  4LUE A;  4LDV A;  4LD9 K;  2F1L A;  3VS6 A;  1K0X A;  4LDW A;  3EGX B;  4OB1 B;  1VQ5 A;  2K2V A;  1TSF A;  2DMO A;  4TVR A;  1UTI A;  4KBM B;  2HEQ A;  4BI8 B;  2V8I A;  2X9H A;  3G7Z A;  4JJC A;  4IIM A;  4HVU A;  1UGS B;  1KQS S;  4PNO A;  1SSH A;  4IUQ A;  4FSX A;  1Q81 U;  1FYN A;  2DTH A;  3OYH A;  4M75 F;  1M30 A;  1KQ1 A;  1N9S A;  5I2M A;  2CP5 A;  3SHW A;  2RQU A;  1TU0 B;  5I21 A;  4DOV A;  4ZGE B;  1JB0 E;  1ZBJ A;  4WTO B;  1S72 A;  3MEA A;  3LYI A;  3C94 A;  4O5V A;  3A1P A;  3JCM J;  4C5E A;  4DEX A;  2VGN A;  2EQK A;  3QO3 A;  2NYS A;  3CCL T;  5GAN j;  1M90 U;  2O88 A;  3RR6 A;  4BI3 A;  1PSE A;  1OI1 A;  2GQV A;  5FRM A;  1NZ9 A;  3OYC A;  4J5Y A;  1WXT A;  2HMA A;  2YUO A;  1JEG A;  5KE2 A;  4M7A A;  1AZG B;  2P0Q A;  3QKJ A;  4FYY B;  2HKN A;  2EJF A;  4RUG A;  1VQ7 Q;  5GAN 3;  3CC2 Q;  2DBK A;  1YJN Q;  2XID A;  4X1V A;  1ACM B;  4XTU A;  2CS7 A;  4GLM A;  4F17 A;  3P8H A;  2AIR B;  2RA2 A;  1MND A;  1NE8 A;  2DO3 A;  1ZLM A;  3UA6 A;  3OYL A;  2E6N A;  1B07 A;  5GAN g;  1OUL A;  3OW2 P;  1PD1 A;  1AWO A;  3QZ9 B;  1RAC B;  3UPU A;  2JW4 A;  3FDR A;  3FIF A;  4ZGJ B;  5GAO r;  4CC2 A;  2JTM A;  3RMQ A;  1S72 Q;  5CKH A;  1VQP Q;  2DYB A;  3M0R A;  1BCM A;  1YI2 A;  3HFN A;  5LJ5 g;  1WJR A;  3ZL7 C;  1B34 A;  2Y90 A;  2YT6 A;  1NEB A;  2E5K A;  2IG0 A;  5GAN f;  1M27 C;  5HY6 A;  4R56 A;  3CC7 Q;  1S72 T;  3CCS T;  3QDR B;  4RTY A;  5KCH A;  5FRN A;  3CEY A;  1NLO C;  2H3E B;  2QK0 A;  2LQ8 A;  4C5I A;  5IN1 A;  2X51 A;  3HKS A;  4J6X A;  1VQ6 T;  4ATO A;  2V1R A;  1Q81 C;  4AG1 C;  2F2V A;  4CI0 C;  1VYU A;  2RM4 A;  1AZE A;  3VYG A;  1TXQ A;  2VC8 A;  3CD6 Q;  3CXC S;  4BY6 C;  3OYE A;  2HQE A;  3I55 T;  4F7U E;  1QKW A;  3NTH A;  1WHG A;  2AKK A;  2KBT A;  1Y71 A;  2KDS A;  1VQM A;  3WVD B;  4AFS C;  2LRQ A;  3UDC A;  2EPD A;  1ZSZ C;  1QLY A;  4PJJ A;  2ED1 A;  2J06 A;  2L5Q A;  2E41 A;  4OB2 B;  4J83 A;  3URG A;  3M0S A;  2RPN A;  2SRC A;  2NUT B;  2RJF A;  1VQN T;  4C8Q C;  1Y7X A;  1VQO T;  1LPL A;  3I55 A;  1X2Q A;  4C5H A;  3REB B;  4E7S A;  1OOT A;  3RNJ A;  1WJQ A;  1VYV A;  1YFN A;  4C0F A;  2X3X D;  4EMG A;  1KC8 U;  1EX4 A;  2DZ9 A;  3GBQ A;  1QMC A;  2HD0 A;  1UFF A;  3I5R A;  3MP1 A;  4F7U A;  3VS3 A;  3QG1 A;  1M1F A;  2RQW A;  4HCB A;  3M56 A;  1NJI C;  1IHW A;  5LJ5 e;  1VQL A;  2A3L A;  4XU0 A;  2C0I A;  1N6A A;  1YJN A;  2LNV A;  3CC4 Q;  5C6S A;  1K8A R;  5LJ5 f;  2L89 A;  1AEY A;  4JPB W;  4DOW A;  1QWF A;  3JV3 A;  1ABO A;  4KRT A;  4ZTJ A;  2DKG A;  2KGT A;  1UGR B;  1Y96 A;  3EGX A;  1AWJ A;  4RKU E;  3U23 A;  2OAU A;  4M75 E;  4EMK C;  4PJO D;  2BE9 B;  2HQX A;  5CKD A;  4A4G A;  2DEQ A;  2E3H A;  3M5A A;  4DBH A;  1MV0 B;  2DK3 A;  1ZUK A;  4A4F A;  4XTZ A;  5CO7 A;  2LX7 A;  1IRX A;  1D1C A;  1GCP A;  3FRN A;  4LE9 A;  2IVW A;  2EWN A;  2DJZ A;  2M02 A;  4KH1 B;  4JRP A;  1IGQ A;  3QUI A;  3HRS A;  4N0A A;  3OYF A;  1NM7 A;  1IRE B;  4XU3 A;  4QQD A;  4OMP A;  4C0D C;  1NJI U;  5KYX B;  2ZGW A;  4A4H A;  3C12 A;  2OTJ Q;  4C92 A;  4A54 A;  2DXU A;  5FW9 A;  1M9S A;  4QW2 A;  2QQS A;  3CCM T;  3L2U A;  5LJ3 j;  4WF2 A;  2LJ0 A;  5AT1 B;  2YUN A;  1KQS A;  2KQW A;  1QVG P;  2CRE A;  4RTW A;  5D6X A;  1FMV A;  1MGQ A;  2E64 A;  1UHC A;  9ATC B;  5HK0 A;  4OMF B;  3MJX A;  3H8Z A;  1PCX A;  1VQ7 A;  3M4Y A;  2DNU A;  1OPL A;  3BY7 A;  4M77 C;  3MP6 A;  5HKC A;  1NEG A;  4CRI A;  5GMK m;  5EC7 A;  3CCL Q;  4C8Q F;  4M7A F;  2GGR A;  2VVK A;  1HXD A;  2K4Y A;  4QVZ A;  1PD0 A;  1U8R A;  1NJI R;  1K73 C;  5GMK l;  3G71 T;  1UGV A;  2PUK B;  1JO8 A;  1AWX A;  2X35 A;  2NLU A;  2XHC A;  5IHI A;  2RHX A;  3LX7 A;  4ELY C;  4QVC A;  2VGM A;  5GMK j;  5FLX E;  4AG2 C;  2H8H A;  5LJ3 e;  3V7C A;  3V8K A;  5I2S A;  1YHQ A;  4M77 D;  2L3P A;  3EGD B;  1ZA1 B;  2QEX T;  1GBQ A;  2XDB A;  2RI3 A;  4KGV B;  4KT0 E;  3CCV Q;  1EFN A;  1IO6 A;  3CCR Q;  1RUW A;  2P4T A;  3OMG A;  3EG2 A;  1M2O A;  1BI0 A;  2KSS A;  3KFV A;  2LDM A;  5GAO n;  1OZ2 A;  2QEX Q;  5GAM g;  4C8Q D;  3I56 Q;  1WQW A;  1SSF A;  3A8G B;  4RG8 A;  2O9S A;  3UAT A;  1B34 B;  4ANJ A;  3CC7 T;  1PRM C;  3CCJ Q;  4AFZ C;  5EG2 A;  3TVT A;  1OX9 A;  2ZAE A;  2WSC E;  3S3O A;  3NHN A;  4M77 E;  1OU8 A;  1ZQ1 A;  2VXF A;  2ZZD A;  5HCK A;  2BZ8 A;  2KAF A;  2BIV A;  4C8Q A;  4QVD A;  1TUC A;  1SRM A;  3QBY A;  1WI7 A;  1OQK A;  4K11 A;  1BKB A;  4GBQ A;  1M1G A;  2QXF A;  2V8K A;  2RQR A;  3OYY A;  2WAC A;  2OAW A;  1KHI A;  2QI2 A;  2BTT A;  2KK4 A;  1K9M U;  4M78 G;  1GCQ C;  3FJ5 A;  1KD1 R;  3G71 Q;  1R77 A;  4E47 A;  1MMN A;  2IIM A;  5CAI A;  1VQO Q;  4XTY A;  1MNE A;  2L0A A;  2LX9 A;  1GFD A;  3EGD A;  1Q86 U;  3OY9 A;  1WDX A;  3OYD A;  3JCM g;  4BDY A;  1YHQ T;  2KY9 A;  4CC3 A;  3MO8 A;  1I07 A;  1CKA A;  1MMA A;  4J9C A;  1NBE B;  4FW1 A;  1JJ2 P;  3AHU A;  2HBW A;  2RJC A;  2HNI A;  3OMC A;  4X9D A;  2VUB A;  1G5V A;  3OYI A;  1VQP T;  3CPW A;  2D1X A;  2MPX C;  2DPP B;  2XKO C;  2OX7 A;  1N8R R;  3CCR T;  3BDU A;  5GAN 5;  1MMG A;  2L3S A;  1WJS A;  4C8Q E;  3CXC A;  4F7U B;  1ZX6 A;  2DTO A;  1RL2 A;  3SB2 A;  3O5Z A;  3CME A;  5KYU B;  4Z02 A;  3TRE A;  5KYY A;  3OSV A;  3CCS A;  1GBR A;  1YWP A;  8AT1 B;  2K2M A;  2J05 A;  3QPH A;  3PVL A;  5LJ5 d;  3JCM W;  2DA9 A;  3G6E A;  2JVV A;  1Q7Y U;  2KEA A;  2WSE E;  2CYZ B;  3C95 A;  2MI6 A;  2LJ1 A;  2RI5 A;  4O6J A;  4JUV A;  2V8J A;  1OPK A;  3QXE B;  1RI9 A;  2DVE A;  3MCA B;  1E6H A;  4HVW A;  1U1T A;  3CCU Q;  1M3C A;  1TOV A;  3EG9 B;  1T3L A;  2EQJ A;  5GJW B;  2QG9 B;  1RAD B;  1I5L A;  1PHT A;  1U3O A;  2JTE A;  2OTJ A;  1KFZ A;  2DXT A;  4N4G A;  2ROT A;  1Y57 A;  3VJP A;  3L2R A;  1OV3 A;  1Q82 C;  2DRM A;  1KD1 C;  1KC8 R;  3D7S B;  2RNA A;  1VQO A;  2QA4 A;  1EZZ B;  1A0N B;  2E12 A;  1M8M A;  2CUD A;  2DXB A;  3RER A;  3G6E T;  4PKC C;  4XU1 A;  2VB6 A;  1LOJ A;  1VQ6 Q;  1VQK Q;  2F2W A;  4HT9 A;  1D0X A;  2KT8 A;  4D6W A;  1VQ5 Q;  2QEX A;  1VQM T;  3G4S A;  5KYN A;  3CCV T;  4J6W A;  4BB7 A;  3TU4 K;  1G3S A;  1M2V A;  4PJO A;  1YJW A;  1MHN A;  4M7D A;  4DBF A;  5LJ5 h;  1T0J A;  1LJO A;  2EIF A;  4RTV A;  4L5G A;  3PE0 A;  1QVG S;  2PVO B;  3CC4 T;  1VQL Q;  1BIB A;  3EG9 A;  3VUB A;  3OA6 A;  2RO0 A;  1X6O A;  4OP0 A;  3RBB B;  5AYF A;  1WXU A;  1WX6 A;  1I5O B;  3HSB A;  2DX1 A;  5I11 A;  1Y96 B;  3VS1 A;  2LQN A;  1PNJ A;  3JSC A;  1U5S A;  2RH2 A;  4MMK A;  4M77 F;  3EGU A;  4AFQ C;  1G3Y A;  2E65 A;  3CC2 T;  1VQN Q;  3CME Q;  1ZSZ A;  2E1H A;  4C92 D;  1K9A A;  1IGU A;  2EVR A;  1BBZ A;  2E70 A;  2O4X B;  4M77 B;  2VAS A;  4X9C A;  5LJ3 f;  2EGE A;  2JMC A;  2FZC B;  1HK9 A;  1PSF A;  2ZPB B;  4AFU C;  1IZ6 A;  1X27 A;  4PJO F;  5KYY B;  1QW1 A;  3EFO B;  4OGE A;  1KD1 U;  4HKE A;  3RIR A;  1KSW A;  3GOX A;  4KUI A;  3ASK A;  2R58 A;  5CK9 A;  3E1S A;  5FU6 B;  1VA7 A;  2LCS A;  2COY A;  4J7F A;  1K73 U;  2LZ6 B;  5GMK i;  1OU9 A;  3UWN A;  1C1A A;  1JU5 C;  1CKB A;  3SDZ A;  2YLB A;  4BE1 A;  4M7D G;  2MWO A;  4XTW A;  4FYV B;  4XTV A;  2RF0 A;  3H9N A;  3DLL A;  2AZS A;  3CCE A;  3HPW A;  2GTJ A;  4P5N A;  3SWN B;  1W6X A;  2FHD A;  2A36 A;  2K57 A;  5KYX A;  1E7O A;  5GAO p;  3VS5 A;  5L23 A;  4M7A C;  3I56 T;  1Q7Y C;  3TSW A;  5KYW B;  1OYX A;  1M3B A;  1X75 C;  1ARK A;  4KGX B;  4E7H A;  1YCS B;  3BW1 A;  4C0G A;  2QQ9 A;  1VQK A;  5LJ3 h;  2ED0 A;  1VQ6 A;  5DLQ E;  2QAS A;  3CC7 A;  2HCK A;  4M78 D;  3FEO A;  3QHS A;  2LP5 A;  3OBW A;  1UHF A;  1JJ2 S;  2NUT A;  4PJM A;  2HDA A;  1JXM A;  1WIE A;  3A8O B;  3LGL A;  3EFR A;  3CCU A;  1YIT T;  3CC2 A;  1J3T A;  4OB0 B;  2SEM A;  1JRI A;  1JJ2 A;  3OYJ A;  2YWW A;  3CCL A;  4M7A E;  4M75 C;  3X20 B;  2EQM A;  2ESW A;  4HA8 A;  1AWW A;  2KT1 A;  2KYB A;  2LNH B;  2JXB A;  2KYM A;  2XDD A;  5D6W A;  4OVA A;  2IPO B;  1NLP C;  3CD6 T;  5DY9 A;  2XG8 D;  3CXC P;  4J9D A;  4PFP A;  4OMQ A;  2DL3 A;  3CBM A;  4LN2 A;  2E5Q A;  2BKD N;  3A8L B;  5CR2 A;  2O31 A;  3C4S A;  4M78 F;  2GCX A;  2FZG B;  4FU6 A;  2BZY A;  2EAY A;  4F7U G;  2JN0 A;  3EH1 A;  4AMC A;  3OYK A;  2HSP A;  3FC3 A;  4QT7 A;  2MMP A;  1SRL A;  4M77 A;  3CCU T;  1YIT A;  4AT1 B;  2DAQ A;  4ZNX A;  2CH4 A;  1TH7 A;  2PUO B;  2CDT A;  2JNG A;  2EYZ A;  4A4K A;  2RI2 A;  4VUB A;  3JCM c;  2MWP A;  1AVZ C;  4OMN A;  2F5T X;  3M0T A;  2A08 A;  4J9I A;  4PLI A;  4B6M A;  3CCQ A;  2DL4 A;  4LD6 A;  1KG1 A;  2GQI A;  3EHQ A;  2KRS A;  4KUL A;  3OW2 S;  2DM1 A;  2FPE A;  2W0Z A;  1SF9 A; 
#chains in the Genus database with same CATH homology
 4OMM A;  2KXC A;  1PWT A;  1MV3 A;  4AG2 C;  2H8H A;  4ESR A;  2I0N A;  1CSK A;  1H8K A;  1YWO A;  1I0C A;  2EGA A;  4CC4 B;  1NYF A;  4WCI A;  2L3P A;  2NUZ A;  4HCK A;  2GBQ A;  1GBQ A;  5I22 A;  3H0I A;  4CC7 A;  1WYX A;  3QWY A;  1EFN A;  1IO6 A;  2ECZ A;  1RUW A;  5IHN A;  2PZ1 A;  3EG2 A;  1Y0M A;  4OML A;  4ORZ A;  2MIO A;  2ABL A;  4LUD A;  1G83 A;  1HSQ A;  3KFV A;  2KRN A;  2K79 A;  4M4Z A;  2O9S A;  3UAT A;  1PKT A;  2VWF A;  1GFC A;  1PRM C;  4AFZ C;  3TVT A;  2YDL A;  1HJD A;  1FMK A;  3NHN A;  3H41 A;  2AZV A;  2YUQ A;  1ABQ A;  5HCK A;  2BZ8 A;  4R0K A;  1UE9 A;  2LQW A;  4JJB A;  1TUC A;  1SRM A;  1WI7 A;  2EYW A;  4K11 A;  4GBQ A;  2K6D A;  2J6K A;  2D0N A;  1UG1 A;  1X2K A;  3EG1 A;  2L3Q A;  2RQR A;  4J9F A;  2OAW A;  2JM9 A;  2BTT A;  2EW3 A;  1M3A A;  3VRZ A;  1GCQ C;  2A37 A;  3FJ5 A;  4LUE A;  2IIM A;  5IXF A;  1X69 A;  3VS6 A;  1K0X A;  2JS0 A;  2KRO A;  2L0A A;  1GFD A;  3M0P A;  4Y92 A;  1LCK A;  1WDX A;  2J6O A;  2DMO A;  4A63 B;  2ENM A;  2DL5 A;  1UTI A;  2HEQ A;  1N5Z A;  2FRY A;  4CC3 A;  1I07 A;  1CKA A;  4J9C A;  2DJQ A;  4JJC A;  2HBW A;  2JS2 A;  4IIM A;  4HVU A;  4HVV A;  1XOV A;  2D1X A;  2K9G A;  2EGC A;  2DLP A;  4Z8A A;  1SSH A;  2BZX A;  4J9E A;  1FYN A;  2L3S A;  3VS0 A;  1ZX6 A;  1M30 A;  3O5Z A;  3SHW A;  1WLP B;  1X43 A;  1KJW A;  2RQU A;  1ZBJ A;  1GBR A;  1YWP A;  2K2M A;  2CUB A;  2J05 A;  3PVL A;  1ZUY A;  3R6N A;  4DEX A;  2DA9 A;  2M51 A;  1Z9Q A;  2CSI A;  4JJD A;  1H3H A;  2EQI A;  3ULR B;  2KEA A;  2O88 A;  1X6B A;  2DL8 A;  1JXO A;  2LJ1 A;  2X3W D;  1WFW A;  2KRM A;  1WXT A;  2YUO A;  1X6G A;  2YSQ A;  1JEG A;  1OPK A;  3EG0 A;  1RI9 A;  3VS2 A;  1AZG B;  2DL7 A;  2OJ2 A;  1E6H A;  3QWX X;  4HVW A;  1M3C A;  2YUP A;  4RUG A;  1T3L A;  2EYX A;  2DBK A;  2KE9 A;  3VS4 A;  2J7I A;  3EG3 A;  4X1V A;  3VRY A;  5GJW B;  4GLM A;  4RTT A;  4F17 A;  1PHT A;  1U3O A;  1TG0 A;  1ZLM A;  2JMA A;  2JTE A;  3C0C A;  1KFZ A;  3UA6 A;  1NG2 A;  1BU1 A;  1B07 A;  2ROT A;  1Y57 A;  1AWO A;  2FG0 A;  2JW4 A;  1I1J A;  1OV3 A;  1B3Q A;  4D8K A;  2DRM A;  5IHK A;  3CQT A;  1K76 A;  4CC2 A;  2RNA A;  5FWC A;  2KXD A;  1SHG A;  1A0N B;  1M8M A;  1Z9Z A;  2CUD A;  1WXB A;  1K0S A;  2PNI A;  2DYB A;  3M0R A;  1UDL A;  3NGP A;  3ZL7 C;  5IXB A;  2A28 A;  1AD5 A;  2YT6 A;  1NEB A;  2E5K A;  3LH5 A;  1M27 C;  1MUZ A;  1V1C A;  2F2W A;  2FPD A;  2C0T A;  2KT8 A;  1T0H A;  4JZ4 A;  4RTY A;  1SHF A;  1VYT A;  3I9Q A;  1NLO C;  3TSZ A;  2RQT A;  2EKH A;  2W10 A;  1WA7 A;  2CT3 A;  2V1R A;  1T0J A;  4AG1 C;  4RTV A;  2F2V A;  3PE0 A;  3EHR A;  2KNB B;  4OMO A;  1VYU A;  3A98 A;  3THK A;  1U06 A;  4J9H A;  1AZE A;  2RQV A;  3RBB B;  1WXU A;  1WX6 A;  3M0Q A;  3I5S A;  3REA B;  2DX1 A;  2DRK A;  2RMO A;  5I11 A;  1QKW A;  3H0H A;  3VS1 A;  2AKK A;  2LQN A;  2KBT A;  1PNJ A;  2M0Y A;  1RLP C;  2ROL A;  1U5S A;  2QDL A;  3EGU A;  4AFQ C;  3NMZ C;  4AFS C;  2DVJ A;  1UEC A;  1G2B A;  2EPD A;  1QLY A;  1YN8 A;  1UUE A;  4DEY A;  2ED1 A;  2J06 A;  1YNZ A;  2O9V A;  3H0F A;  1K9A A;  2EVR A;  1BBZ A;  1YP5 A;  3M0S A;  2EGE A;  2EYY A;  1ZSG A;  2RPN A;  2SRC A;  4D8D A;  2AK5 A;  1PRL C;  2JMC A;  2JM8 A;  2V1Q A;  4AFU C;  2GNC A;  1W70 A;  2G6F X;  1X27 A;  1X2Q A;  3REB B;  1HD3 A;  1OOT A;  3RNJ A;  1VYV A;  1ZUU A;  1BK2 A;  3PVQ A;  2X3X D;  2DE0 X;  1GRI A;  4IIO A;  3GBQ A;  1KSW A;  1OEB A;  3SEM A;  1UFF A;  3I5R A;  3VS3 A;  2RQW A;  1VA7 A;  2LCS A;  2GTO A;  2LZ6 B;  1JU5 C;  1CKB A;  1T3S A;  3I35 A;  2C0I A;  1SPK A;  4Z88 A;  2CSQ A;  1BB9 A;  2RF0 A;  1UJY A;  2AZS A;  1AEY A;  4JPB W;  2AKL A;  1QWF A;  2KR3 A;  2GTJ A;  1W6X A;  3JV3 A;  1ABO A;  2EBP A;  2A36 A;  4KRT A;  1E7O A;  2FO0 A;  3VS5 A;  2KGT A;  5L23 A;  5ECA A;  2OI3 A;  1AWJ A;  3TSW A;  3U23 A;  1M3B A;  2DF6 A;  1ARK A;  2FRW A;  1YCS B;  4JZ3 A;  1MV0 B;  2ED0 A;  1ZUK A;  2HCK A;  2LX7 A;  2D8H A;  1S1N A;  2LP5 A;  4J9G A;  2O2O A;  1GCP A;  4F14 A;  1UHF A;  2NWM A;  4J9B A;  4LE9 A;  4Z89 A;  1GCQ A;  1QKX A;  2D8J A;  4RTU A;  2HDA A;  1NM7 A;  1JXM A;  1TUD A;  1WIE A;  2XMF A;  3NPF A;  4E6R A;  2FEI A;  5IH2 A;  1J3T A;  4OMP A;  2SEM A;  4HXJ A;  1AOJ A;  5GJV B;  2ESW A;  3M0U A;  2MOX A;  2K3B A;  1JQQ A;  1AWW A;  2KT1 A;  5FW9 A;  2KYB A;  2LNH B;  2JXB A;  2KYM A;  1GL5 A;  1NLP C;  2P4R A;  1H92 A;  1PKS A;  2LJ0 A;  4J9D A;  4OMQ A;  2DL3 A;  4LN2 A;  2YUN A;  4RTX A;  2MCN A;  3IQL A;  2VKN A;  4EIK A;  2O31 A;  2DBM A;  1KIK A;  2CRE A;  2JT4 A;  4RTW A;  2DIL A;  1K1Z A;  2LJ3 A;  1K4U S;  2F2X A;  2BZY A;  1UHC A;  4FSS A;  1RLQ C;  2HSP A;  3UA7 A;  1SEM A;  4QT7 A;  2LMJ A;  1SRL A;  2PTK A;  4ZNX A;  2CH4 A;  2DNU A;  1OPL A;  2CT4 A;  1QWE A;  2CDT A;  2EYZ A;  1NEG A;  3UF4 A;  4F16 A;  5EC7 A;  1W1F A;  2GGR A;  1AVZ C;  2VVK A;  2FPF A;  4OMN A;  5FWB A;  3M0T A;  2RN8 A;  4LNP A;  2A08 A;  4J9I A;  3VS7 A;  2CH4 W;  4RTZ A;  2J6F A;  1QCF A;  2B86 A;  2L2P A;  1UGV A;  2DL4 A;  2GQI A;  3EHQ A;  1NYG A;  1E6G A;  2KRS A;  2K7A A;  1JO8 A;  2DM1 A;  1AWX A;  1UJ0 A;  2FPE A;  2W0Z A;  2C0O A;  5IHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...