1AWOA

The solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
SLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE
publication title The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 4
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awoA00
2EYYA 2KT8A 2YSQA 2LJ0A 3I9QA 4JPBW 1G2BA 1Z9QA 2RQUA 2BZXA 4J9IA 2AKLA 4J9BA 2GTOA 4CC4B 1QLYA 4M4ZA 2CSIA 4DEXA 2FRYA 1T0HA 1ZUUA 4LUDA 5ECAA 4JJBA 2DVJA 5L23A 2KT1A 1ZUKA 4J9HA 2K9GA 1UTIA 2O31A 4OMOA 4QT7A 1GL5A 1M3BA 2DX1A 4J9GA 2SEMA 2DBKA 1VYUA 1ZBJA 3C0CA 3TSWA 3RBBB 1ZSGA 1TUDA 3EGUA 4CC2A 1JXOA 3I5RA 4A63B 1PRLC 2JT4A 3LH5A 1M8MA 3H0HA 1ARKA 2JMCA 4JJDA 3SEMA 3VS4A 1PKTA 1X43A 3EG0A 1K4US 4HXJA 5GJVB 1S1NA 2O2OA 4CC3A 2CH4A 3GBQA 4HVWA 4OMMA 2D8HA 1GCQC 2YUNA 3PVQA 1UHFA 4HVVA 2DILA 2HCKA 5IH2A 1K9AA 4Z88A 2DMOA 1U3OA 1KSWA 4Z89A 4EIKA 1BBZA 2DL5A 1VYTA 1M3AA 1GCQA 2RQVA 2J6OA 1WXUA 2J6KA 1M27C 2JW4A 2EKHA 1RUWA 4IIMA 3R6NA 2YUPA 3REBB 3VS0A 2YDLA 2JM9A 2FPDA 2CDTA 2YUQA 1UG1A 1JEGA 4GLMA 5IXFA 1VYVA 3U23A 3O5ZA 4OMQA 2C0IA 5FW9A 2A28A 3M0SA 3VS6A 2GNCA 1QWEA 1YWPA 2D8JA 2EVRA 3REAB 1GCPA 4D8DA 1AWWA 3EHRA 2CSQA 2EGCA 2F2XA 1SEMA 4LUEA 1K0SA 1YCSB 1NLOC 1GFDA 4AG2C 4D8KA 4LNPA 4GBQA 3UA6A 2L3PA 4AFQC 1TUCA 2HDAA 4OMNA 1AWJA 1H8KA 5FWCA 1BU1A 2JXBA 2K7AA 3UATA 3THKA 1FYNA 2CH4W 2OI3A 4J9DA 5I11A 1KIKA 2O9SA 2VVKA 2A08A 1YN8A 1BB9A 1M3CA 1SRLA 1N5ZA 4AG1C 3PVLA 1I0CA 1T3LA 5GJWB 3PE0A 4F14A 4JJCA 2KNBB 3EHQA 4RTWA 4AFZC 1UHCA 1YWOA 2DRMA 2FPEA 3SHWA 2KROA 1RI9A 2LNHB 3ULRB 4RTXA 2DBMA 2HEQA 3H0IA 2DLPA 2D0NA 2RMOA 1H92A 4ZNXA 2JS2A 2LJ3A 2GTJA 4K11A 1I1JA 4JZ4A 1EFNA 2ENMA 2RF0A 1UUEA 2ED1A 1QKWA 3RNJA 1K0XA 2A37A 2V1RA 1WXTA 1UECA 3NGPA 4LE9A 1A0NB 1WXBA 1SPKA 1UFFA 1ZUYA 4F16A 1GBRA 4CC7A 1B3QA 2DYBA 4X1VA 2K79A 3H41A 2DRKA 2J6FA 1WI7A 1ZLMA 2EBPA 4RUGA 5EC7A 2P4RA 4RTTA 1AEYA 5IXBA 1X6GA 1FMKA 1QCFA 2JS0A 1ABOA 1AOJA 1X27A 1UGVA 2B86A 1YP5A 2AKKA 2KXCA 1UDLA 3M0RA 2NUZA 1Y57A 1Y0MA 1SHGA 1ABQA 2KRMA 1NM7A 2QDLA 2AZSA 2O88A 1CKBA 4LN2A 2PTKA 1GRIA 2K3BA 2KBTA 2E5KA 2VKNA 1NEGA 2ECZA 2CT3A 3I5SA 1E7OA 3VS3A 1AZEA 1YNZA 3M0TA 4AFUC 2DL4A 2L0AA 3NMZC 1I07A 3KFVA 1SHFA 3UA7A 2V1QA 1K76A 2F2VA 2FEIA 1JO8A 3VS2A 1OV3A 2KRNA 1NYFA 2LQNA 2W10A 4RTZA 2EGEA 1OPLA 3VRZA 1HSQA 1M30A 2L3SA 2DF6A 2CT4A 3VS1A 2C0TA 1J3TA 2LJ1A 1UJ0A 1WX6A 2DL7A 3M0UA 3QWYA 2DJQA 1B07A 1SSHA 1GFCA 2DA9A 2PNIA 2KYBA 1JQQA 1W6XA 3IQLA 2FG0A 1W1FA 2RPNA 4HCKA 2J05A 2MIOA 2K6DA 3I35A 2FO0A 2HBWA 1X6BA 1T3SA 2FRWA 2IIMA 2XMFA 3M0QA 2DL8A 3M0PA 2KXDA 1QWFA 2GGRA 1OEBA 2JTEA 5FWBA 5I22A 1WYXA 4Z8AA 1PKSA 1UE9A 3QWXX 1H3HA 1NG2A 2ESWA 1JU5C 3ZL7C 1AD5A 3TVTA 2LX7A 2KGTA 2KR3A 1JXMA 2MOXA 2X3XD 2EQIA 3CQTA 1MUZA 2KRSA 1KFZA 2ED0A 1WFWA 2JM8A 2RQWA 2M0YA 1KJWA 2CREA 2ROTA 2KYMA 3TSZA 2GBQA 2GQIA 1AWXA 1MV0B 1T0JA 5HCKA 1PNJA 2KE9A 2JMAA 2DL3A 2LCSA 1XOVA 2NWMA 2F2WA 3VRYA 3EG2A 2EYXA 1HJDA 2VWFA 4RTYA 4FSSA 1RLQC 1RLPC 1G83A 4DEYA 1OOTA 1TG0A 2ABLA 3NHNA 2CUBA 2RQTA 2EW3A 1QKXA 4J9CA 2HSPA 2LZ6B 1BK2A 2X3WD 2DNUA 4AFSC 2M51A 1W70A 2KEAA 1AZGB 1MV3A 1CSKA 1WIEA 3EG1A 1WA7A 1K1ZA 4HVUA 2SRCA 4RTUA 2CUDA 2O9VA 2J06A 3EG3A 2A36A 4J9FA 2PZ1A 2OAWA 2W0ZA 2AK5A 1U06A 1U5SA 1LCKA 2D1XA 2RNAA 1IO6A 1HD3A 1SRMA 2G6FX 2LMJA 2BZYA 1V1CA 4R0KA 4JZ3A 1X2KA 1NEBA 1X2QA 2BZ8A 3H0FA 1PWTA 3VS7A 5IHKA 2EGAA 2ROLA 2H8HA 2EYZA 4RTVA 1UJYA 2LP5A 1WLPB 2DE0X 2FPFA 1E6HA 2I0NA 2L2PA 4Y92A 3A98A 4ESRA 2LQWA 2MCNA 1GBQA 2YUOA 1X69A 4ORZA 2EYWA 4KRTA 1OPKA 4E6RA 1AVZC 5IHIA 2K2MA 2YT6A 1ZX6A 1WDXA 1PRMC 3UF4A 1AWOA 3NPFA 4OMPA 1E6GA 4IIOA 1PHTA 4WCIA 2OJ2A 1VA7A 3FJ5A 2RQRA 2J7IA 2EPDA 3JV3A 3VS5A 2L3QA 2AZVA 5IHNA 2BTTA 1CKAA 1NLPC 4F17A 2RN8A 2DM1A 4OMLA 1NYGA 1Z9ZA 2C0OA 4J9EA
chains in the Genus database with same CATH superfamily
2E6NA 4XU1A 3I55A 8ATCB 1Z9QA 3L2ZA 2BZXA 2P0QA 1IXDA 3CPWP 5CK9A 2HD0A 4KUDK 1QLYA 2CSIA 1OU8A 1RAGB 1YI2Q 9ATCB 4LUDA 4ZTJA 4J9HA 2K9GA 1UTIA 2O31A 4PL6A 1G5VA 1B34A 1Y7XA 2DX1A 5GAMd 2OAUA 3SB2A 2VYTA 2DPPB 1VYUA 4FIBA 2DTOA 3C0CA 2GCXA 5GAMh 1TOVA 3G6EA 2JOYA 4PJOE 4CC2A 1TXQA 2PUKB 3UWNA 5LJ3g 2MWOA 5J39A 3G6EQ 3CCQA 3ASKA 5GMKj 4QVCA 1RAHB 3JB9I 1ARKA 2JMCA 4JJDA 3SEMA 1X43A 3EG0A 4BE2A 2O4XB 3GBQA 4XTYA 1VQLA 4KUIA 3OYAA 1K9AA 1WGSA 1U3OA 2D0QB 1F1BB 1QVFS 4FT2A 1KG1A 1NZ9A 1XTDA 3J81E 3JCMf 3M9QA 3EH1A 2A0FB 4E7HA 2R58A 1WHGA 1RUWA 1D3BA 2YUPA 3C95A 2QQ9A 2YDLA 3HPWA 3CD6T 5GAN7 4Z02A 3MP6A 2PVOB 3LYIA 3O5ZA 4XU3A 2C0IA 1VQKT 3M0SA 3RKWA 3VS6A 1QVPA 4PNOA 3MEWA 2QA4T 1YWPA 2EQJA 5LL6S 2DO3A 2WSCE 4M78C 2DXCA 1BKBA 1YJNQ 4BI8B 4LUEA 5GMKe 4M75A 3RKXA 4ZGJB 4JS4A 4D8KA 2NUPB 2Y4YA 2L89A 4F7UE 1Q86U 1XNIA 2XK0A 4AFQC 4M78A 4AMCA 5LJ5j 2QQAA 4NOYA 5D6XA 3OBYA 3EGDA 2VASA 3THKA 3OYLA 1TSFA 1M2OA 4E7ZA 2VC8A 1LPLA 3G71A 1YN8A 2VXEA 5CIUA 4M78E 1W2BA 1W4SA 2LX9A 1BB9A 2QXFA 4D6WA 3ZFJA 3CC4A 1M4ZA 5CVIA 2COZA 3G71Q 2QQRA 1I0CA 2Z0WA 2ZPFB 3PE0A 3CC4Q 3EAEA 2XHCA 4RTWA 1N9RA 3SHWA 2F5TX 1RI9A 4MDXA 5DY9A 2H3EB 1VQOA 3H0IA 2RMOA 3CCRT 4C5IA 2B8AA 2LJ3A 1KQSS 4K11A 1VQOQ 4M77G 4YTLA 2ENMA 1KD1U 4JDSA 1MMDA 1UUEA 1K0XA 1UECA 3H8ZA 5IT9E 5C0MA 3CBOA 1UFFA 2JTMA 1FMWA 4A4HA 1VQ8T 1B3QA 1G3WA 4X1VA 6AT1B 2O4XA 3E9FA 3CMET 5LJ5e 2V8JA 4P5NA 1WI7A 2GQVA 1QCNA 4II1A 5EC7A 5J3BA 4IUVA 4RTTA 4FT4A 1QCFA 2JS0A 1UGVA 2B86A 2AKKA 1SSFA 2KXCA 1Y57A 3MP8A 1Y0MA 1SHGA 2KRMA 4IKFA 1NM7A 2QDLA 4C92F 4A53A 3TEEA 1CKBA 5KYUB 1UGPB 2E5KA 2EJFA 3RR6A 3VS3A 1AZEA 2DVEA 1BI3A 2L0AA 3NMZC 1I07A 3E2UA 1YJWT 3VV0A 1YITA 4KULA 1YJ9T 2K3YA 3GP8A 3CC7T 1NYFA 1YITQ 1TUGB 2LQNA 2W10A 4RTZA 1HSQA 3PGGA 2YRVA 2ZPGB 4PFOA 2LJ1A 2XU8A 5GANd 3M0UA 5DM7R 1B07A 2NUPA 4DBQA 3LLRA 2GF7A 2PNIA 1IRXA 3DB3A 1JQQA 4HKEA 5GANh 3J80E 3EG9B 2FG0A 3IQLA 5IN1A 2CP5A 3OY9A 1JJ2P 3QDFA 3OYNA 3HL8A 2MIOA 3I35A 2HBWA 4XTVA 4M77D 2XMFA 3BFMA 5KE3A 3VUZA 3X20B 4C0FA 1OEBA 1WYXA 3GNFB 3E9GA 3CBPA 5I2SA 4EDUA 1PKSA 1UE9A 3X26B 4J6XA 1H3HA 3PMIA 4IURA 3CXCA 1NG2A 1JU5C 1MMAA 4MZMA 3G4SA 3JB9H 2LX7A 2KGTA 1LOJA 4HCZA 2DJZA 1BI0A 1DJ7B 2MOXA 2KRSA 3G7ZA 4AT1B 3G4SQ 2RQWA 3X25B 1VQ9A 4EMKB 2K4YA 5LJ3d 4C8QD 1I5OB 2GFAA 2ROTA 2KYMA 2E3HA 2EWNA 2GQIA 4FYYB 4KBMB 4BACA 3CC2T 3MP1A 3M4GA 4XU2A 1VQ9Q 1AWXA 3JCMc 5LJ3h 1MV0B 1PCXA 2KSSA 1U8RA 1Y07A 3PIOA 4Q5WA 2KE9A 2DXTA 2XIDA 2JMAA 2RJEA 1XOVA 5GAMg 1RACB 2RHYA 2EYXA 3QKJA 1RLPC 1VQ4A 1TU0B 1IB8A 3PTAA 1OOTA 1D09B 3NHNA 2RA2A 2KMTA 2HQEA 2LT1A 2RK1A 1C1AA 4OP0A 3G1JA 1QQJA 2P84A 3F70A 4AFSC 2XICA 2KEAA 1AZGB 3CCLA 4F7UG 1MV3A 2XDDA 1WIEA 3EG1A 2KK4A 1Q86R 3CCLQ 5KYUA 2J06A 4ELYC 3EG3A 3CCEA 2OAWA 4C8QF 1KQ1A 3CCVQ 4PJOD 2LCLA 1U5SA 4M78G 1LCKA 3CCEQ 2RNAA 1IO6A 2G6FX 2Y90A 2D9TA 2LMJA 3CMAA 1MMGA 1V1CA 4R0KA 4JZ3A 4C92A 1YIJA 2BZ8A 2CZ1B 4ZGDB 3JCMV 3LGLA 3GLXA 2ROLA 2QTXA 4RG8A 2DEQA 1IGUA 2JTFA 2HL5C 4OGCA 2DE0X 2FPFA 1E6HA 3I56T 5GAOr 4ESRA 4PFPA 2MCNA 1BYMA 1KD1C 1ACMB 1QVFP 3EG9A 4C5GA 3JCMJ 2K5IA 4E6RA 2K2MA 1WDXA 3OW2A 3N5BB 4RMOA 1E6GA 5A0GA 4FSXA 3SDZA 2WACA 3FJ5A 5CKBA 5D6WA 5IHNA 5KYXB 5GANj 2MWPA 2BTTA 2RN8A 2DM1A 4X9DA 5KH6A 3OYFA 3JCMg 3UA6A 2EYYA 2KT8A 4FCYA 1R77A 3BDLA 4J8OA 4EMKC 4XAXB 1KC8R 1WHHA 4J9IA 2AKLA 4HT9A 2COYA 4HA8A 1V29B 4PJOF 4M4ZA 4DEXA 1I81A 2JNGA 4L59A 1PD0A 5J26A 4EMKA 5GAN2 2DVJA 1ZUKA 1M3BA 2RO0A 1N27A 3TSWA 2DIGA 3EGXB 1ZSGA 1TUDA 1JXOA 4OB1B 1PRLC 2L5QA 1ZBXA 3H0HA 5LJ3j 3NTHA 2QQSA 2YXYA 2OX7A 2PVDB 2X4JA 4M78D 5GAN4 1K4US 2XG8D 4QQDA 4GLKA 1S1NA 4PLLA 2O2OA 4CC3A 1I5LA 1C0MA 1VQPT 2D8HA 1UHFA 1UB4A 2HCKA 5GANe 1OI1A 2DMOA 1KQSP 1JJ2S 2E64A 3LGFA 4ZN1A 1VYTA 1M8VA 3MJXA 4B9XA 1YBYA 2FVUA 2JJ9A 3AHUA 3I55T 2RQVA 4FU6A 2J6OA 2VB6A 3QZ9B 1WQ7A 4BY6B 2JW4A 4BDYA 2EKHA 4IIMA 3TREA 3REBB 2JM9A 2FPDA 1NJIU 2CDTA 2RD1A 1OULA 2YUQA 1UG1A 1S72A 4F7UF 3U23A 1M9SA 3OYMA 2H3JA 4OMQA 4F04B 2PUOB 1S72Q 1QWEA 1N6AA 3QJ6A 3REAB 5GAN5 4D8DA 4M75B 4E7KA 4IUTA 4M7AB 3S6WA 3G6ET 1YCSB 1NLOC 5LJ3e 1GFDA 3HRSA 1QW1A 1NE8A 2KAFA 4OMFB 3CCQT 1VIEA 2IVWA 2ZPBB 3EGDB 4C5EA 3L2QA 2OTLQ 2XDPA 3V7SA 1X75C 1Q7YU 4OMNA 1AWJA 1H8KA 1BU1A 2YRDA 5GAOq 4M7DF 5KYXA 3QZ5B 2OI3A 2FB7A 5I11A 2O01E 1KIKA 3P8HA 1VQLT 2A08A 2P0KA 3A1PA 3VU3C 3QIIA 1YI2A 5FROA 3PVLA 4J6YA 2E3IA 4J7FA 1TH7A 5FRMA 1UHCA 4EMGA 1VQNQ 2LNHB 2RI3A 4JRQA 2DBMA 2HEQA 2E1HA 2DLPA 3OSVA 3X28B 1RABB 1K9MR 4ZNXA 2GTJA 2QQBA 2GFUA 4LDWA 3EGXA 1QMCA 2CGHA 3V8KA 3EH2A 4UC4A 1A0NB 2V8IA 1K73U 3QUIA 2HBPA 3QDRB 4WF2A 4CC7A 4FM4B 4C0ZA 2DYBA 3H41A 4L5GA 4C0DB 3FEOA 2EBPA 1Q95G 2DYIA 1WNLA 2P4RA 4KH0B 3TU4K 1X6GA 4BY6C 1KHCA 1X27A 1BI2A 1YP5A 1ZA2B 3LWIA 3G71T 3LH0A 2E6ZA 1PM3A 1ABQA 1R0BG 3QYGB 2EQMA 2AZSA 3UDCA 3RUXA 4GY5A 3CC4T 5CAIA 4PJMA 1UGQB 2MK5A 2ECZA 2KI7A 1K8AU 4KGZB 2K3XA 3OS2A 1YNZA 1VQ6A 2NUTB 2X9HA 3LX7A 4M75C 3KFVA 2RH2A 2A7YA 2EYQA 3DKMA 2V1QA 4M7AC 1WZOA 1K76A 1YJNA 5FLXE 1VQOT 1IREB 1VQ6Q 1EZZB 1OV3A 3H6ZA 1UGRB 3JRZA 3P8DA 5CKEA 7AT1B 2YRCA 3VRZA 1M30A 3VS1A 1J3TA 4M7AA 1WX6A 2WSEE 3GF5A 5I21A 2DJQA 4LDYA 1SSHA 3PT9A 4OF1A 5AYFA 3OYJA 3M57A 4R56A 2VXFA 2KYBA 3JCMd 3TQ7P 3HTRA 4M75E 3OYGA 4ZN3A 4LDVA 5CKHA 3JCMh 4HCKA 1O9SA 2FO0A 2YLCA 3OMGA 4Z8AA 2LRQA 4XU0A 1JJ2A 3HFOA 2IPOB 4B6MA 3MKDA 4E7JA 1IHVA 1R0CB 3ZL7C 5CKFA 5CO7A 2DAQA 1Y96B 4M7DA 1MUZA 2JM8A 4MMKA 2ZPIB 2QAZA 1JB0E 2RM4A 1KJWA 4JJNK 2HQXA 1MHNA 3DLMA 3L2RA 1M2VB 2HZYA 3OYBA 1YITT 2G3RA 1PNJA 2LCSA 2VV5A 4C0DC 2NWMA 2HKQB 2QA4Q 2MMPA 1GXIE 2F2WA 3EG2A 2HNIA 2VWFA 1KC8U 5GAMj 4RTYA 1NJIR 4OB0B 3ER0A 2CP2A 2L3RA 1TG0A 2ZCFB 3A8LB 2CUBA 1Q82R 2RQTA 1HXDA 2EW3A 1BI1A 3OS0A 4E7IA 4J9CA 1M90U 2LZ6B 1U1SA 2DNUA 1R8OB 2FHDA 3RKYA 2C06A 1BIBA 3CCSA 2MI6A 2SRCA 3CCSQ 2CUDA 2O9VA 3OA6A 3VYGA 3JSCA 1Q7YR 2JVVA 1FWZA 2E10A 3SWNB 2RJFA 2NUTA 4FYVB 3G4ST 4NS5A 2CP6A 4C92B 2OTJA 4XTXA 4XTZA 1VQ9T 2LVMA 1ZSZA 1X2KA 2XKOC 3M58A 4NL2A 2OTJQ 2PVGB 2ATCB 4IUQA 1AHJB 2XDBA 2EYZA 4IUUA 3C4SA 1TTHB 2LP5A 2K5LA 5GAMe 2M0OA 2L2PA 3A98A 2LT4A 3MCAB 4NL3A 4ZTFA 1C6VX 3CCJA 5IHIA 3H9NA 1HYOA 5CQXA 1VQ4T 1AWOA 4RG2A 1VQ8Q 1Q81U 2LC4A 4PKCC 3UPUA 1XQHA 3CCJQ 3CMEQ 1AT1B 2RQRA 3JV3A 2EPDA 2CKKA 2K2VA 3VS5A 1QVFA 1NLPC 3LWHA 4A4FA 1K73R 1Z9ZA 4A4EA 2QTVA 3M53A 3I9QA 2LJ0A 4JPBW 5A0DA 3NFCA 1G2BA 1ZHIA 3CCLT 4BB7A 2FYKA 4DBRA 2R5MA 3O8VA 3OMCA 2XI9A 3OYCA 1Y96A 2FZKB 1Y71A 1ZA1B 1ZUUA 4J6WA 3CCET 5ECAA 1QVGS 4JJBA 5L23A 4QT7A 1M2VA 2AT1B 4J9GA 3L2WA 4DBHA 1YJWQ 3ZBDA 4KT0E 1RADB 1RL2A 3CMAT 1YIJT 3CC7Q 2BKDN 1K8AR 3LH5A 4N4GA 4ATOA 4MZPA 4M77F 3QSUA 5D6YA 1PKTA 3OYDA 2CZ0B 4CI0C 1M1KU 2DTHA 4BD3A 1G3SA 1Q86C 4JS5A 1PG5B 4HVWA 1NPRA 3PFSA 3CBMA 3P8BB 4OMMA 1K9MU 2YUNA 1EX4A 4HVVA 2DILA 4X9CA 5IH2A 2KDSA 2RHXA 5FU7B 4N0AA 3X24B 3SWNC 3WVDB 4CRIA 3CCVA 2ZZDA 1KSWA 4Y91A 4LXCA 3JCMe 1QCOA 4Z89A 4M75G 2DL5A 4M7AG 4C92C 1H3ZA 3JCMW 3SWNA 2J6KA 1M27C 2X4XA 1KQSA 3E1SA 4FW2A 1WQWA 5IXFA 4OB3B 2E65A 5FW9A 4MDWA 1D0XA 2GNCA 3BDUA 2D8JA 3CC2Q 4C8QB 2JN0A 4C92E 1D1BA 2LTOA 3T9NA 3RDVA 1VIFA 2EGCA 1K0SA 1LJOA 2I2LA 4PJNA 3AT1B 4AG2C 3OYYA 2E12A 5C6SA 5DLQE 4LNPA 1WHLA 2MAMA 1TUCA 2HDAA 2EAYA 1KC8C 1YHQA 5FWCA 2K7AA 3HFNA 1FYNA 2CH4W 1X6OA 4J9DA 1YHQQ 2DXBA 1M3CA 1N5ZA 4AG1C 1VQMA 1T3LA 1M90C 5GJWB 4JJCA 2CP3A 2EQKA 2KNBB 3EHQA 4JLIA 4IUPA 2FPEA 1YWOA 2DRMA 1VQMQ 2KROA 3M59A 1PD1A 5A0LA 1VQ5A 4RTXA 1M90R 3PIPA 1H92A 2CYZB 5CCAA 2HMAA 3Q1JA 3FIFA 1VQ5Q 2JS2A 4FYXB 4PJOB 3OQ5A 4A4GA 1S72T 3V7RA 1EFNA 4M75D 2RF0A 3PNWC 4DOWA 2ED1A 1QKWA 4KGVB 3RNJA 2V1RA 3NGPA 3JAME 2PQWA 5HKCA 3FB9A 1SPKA 5CR2A 4XTUA 1ZUYA 2DZCA 3S3MA 4F16A 1GBRA 5FU7C 3E19A 1V76A 2K79A 2EJ9A 2L8DA 2J6FA 2X4WA 2EFIA 1MGQA 1P92A 2YLBA 4RUGA 5A2QE 5DLOA 5LJ5f 1VQ7A 1IGQA 2RB6A 2LQ8A 3OS1A 2IG0A 1AOJA 4DA4A 3HRUA 3ZEHA 1VQ7Q 1Q81C 1UDLA 1FX7A 3LW5E 4QVZA 2F1LA 3FJPA 1W2BS 3QBYA 4J5YA 4LN2A 2DK3A 1YI2T 2PTKA 2K3BA 1Q81R 2KBTA 3L1AA 5KE2A 1NEGA 1XJWB 2CT3A 3V8JA 3M0TA 4C8QC 4QQGA 2DL4A 1NBEB 1SHFA 3UA7A 8AT1B 3BW1A 1Q82U 2P4TA 3QXEB 4WTOB 2FEIA 1JO8A 2FL7A 3RESA 5M9OA 3VS2A 2DXUA 1D1CA 2KRNA 4C8QA 4A54A 2KVQG 2EGEA 2HKNA 4M78F 4FW1A 1OPLA 2RHUA 3BY7A 2OTLA 1OQKA 2DF6A 5KYYB 5GAN6 2C0TA 5AT1B 3QWYA 1OX9A 3CCMA 4JUVA 1GFCA 1W6XA 3CCMQ 4L6V5 1W1FA 2RPNA 4E47A 3CCUA 2FZGB 2WSFE 1RAIB 2J05A 2K6DA 2IIMA 3FDRA 2DL8A 3EFSA 2BE9B 3CCUQ 2KXDA 2QDYB 2JTEA 5FWBA 1IZ6A 1VQPQ 5I22A 1WHMA 2QEXA 4PJJA 3UT1A 1VQNA 1BCMA 2M1HA 1TS9A 1QP2A 1K9MC 2ESWA 2QEXQ 3JB9G 1WJSA 4M7DB 1AD5A 1M1KR 2VGNA 4PJOC 4ELZC 2XD0A 4EPCA 1JXMA 3OBWA 2EJGA 3CQTA 3I55Q 1KFZA 2ED0A 3JB9J 4Y28E 4VUBA 1N8RU 3TSZA 1VQ6T 3OYIA 4PJOA 5KCHA 3S3OA 1YJNT 2DZ9A 2YHTA 3MEVA 5KCOA 1G3TA 1SG5A 2JUFA 3L42A 2HAXA 4FSSA 1RLQC 1G83A 3NTIA 2X4YA 2E5QA 1ZQ1A 4HT8A 4C92G 3CCQQ 4LDXA 4V2SA 2X3WD 1QVGP 1LNXA 3GIBA 1H641 5KYNA 2HSEB 1WA7A 4PFZA 3HHTB 2VUBA 1VQLQ 4RTUA 3MPUB 3HSBA 3MO8A 4JRKA 2DETA 2A3LA 4BE0A 3MEAA 2A36A 4J9FA 2PZ1A 2W0ZA 4BUGA 2AK5A 3CXCS 3VYHB 3RERA 1HD3A 1SRMA 1ZSZB 3D7SB 3INZA 1YFNA 2QK0A 3H0FA 5IHKA 2P0PA 2HL3A 2EGAA 2H8HA 5KYYA 4RTVA 4C5HA 1UJYA 3M54A 3JB9D 4F7UA 4FL6A 2CZ6B 1GBQA 5FU6B 1X69A 3C94A 4ORZA 4M7AE 4E7LA 2PU9B 3QJYA 3S3NA 1PRMC 3UF4A 1B7TA 4IIOA 1PHTA 4DBFA 1JBMA 2OJ2A 1WJQA 3TCJA 1VA7A 4M7DC 2L3QA 2QASA 4OMLA 1NYGA 2C0OA 4J9EA 4O5VA 3DB4A 2ZPHB 2YSQA 2RQUA 1VOMA 3CCST 4J9BA 2GTOA 4CC4B 2COWA 2NLUA 3CD6A 3RMQA 3JCMX 3JCMQ 2FRYA 4MMLA 5KYWB 3RMSA 1T0HA 4BE1A 5GAOm 1OZ3A 1VQKA 4C92D 4R55A 3CD6Q 2QA4A 2KT1A 4M7DE 3NTKA 4N4IA 4OMOA 1NJIC 1GL5A 1VQKQ 3HP9A 2K57A 2DBKA 2SEMA 4OVAA 3JB9F 1ZBJA 2OTJT 3RBBB 3EGUA 3I5RA 1X01A 1I4K1 5GAN3 1Q82C 4A63B 2JT4A 1M8MA 3QYHB 3VS4A 1MNEA 2LDMA 2RHZA 4HXJA 5GJVB 1D1AA 1MMNA 2CH4A 1N9SA 1UEBA 3CCJT 1GCQC 1Q7YC 3PVQA 3OW2S 4E7SA 4RCCA 5GAOn 4JRIA 4Z88A 4C8QG 3VJPA 1RI0A 5GANf 1O75A 4EIKA 3V7CA 1BBZA 3GPLA 1M3AA 1ZSZC 1GCQA 5L8RE 1SKUB 2DKGA 2DEUA 4X34A 1WXUA 3QHSA 2V26A 3CCRA 3M55A 2FZCB 2DFUA 3R6NA 3VS0A 1WPYA 1JEGA 3CCRQ 4GLMA 1VYVA 1FMVA 2K5FA 1HK9A 1WHJA 2A28A 4KGXB 3A5ZB 3QG1A 4PLIA 5FU6C 2BIVA 3CPWS 1MNDA 4JLGA 2EVRA 2YWWA 2RHIA 1GCPA 3ME9A 1N8RC 1VQ8A 1AWWA 3EHRA 2CSQA 1OZ2A 2F2XA 1SEMA 2Y4XA 3DLLA 4FYWB 2VGMA 3CMEA 5GAOl 4JRPA 4GBQA 2L3PA 1K73C 1IHWA 1N8RR 5LJ5g 5LJ3f 3JCMP 1W2BP 5CKDA 4QQ6A 2JXBA 3UATA 4PJOG 2O9SA 2VVKA 4BDZA 2ZAEA 3KUFA 3L2VA 1SRLA 2DIQA 2E70A 1SF9A 3OYHA 4F14A 3CCVT 4QW2A 4LD6A 4AFZC 1YJWA 5KYWA 3SFMA 2MPXC 2MF2A 3ULRB 2D0NA 1K8AC 4LD9K 1YJ9A 1RAFB 3JCMb 3CC7A 2BUDA 4KH1B 3WXMB 1I1JA 1YJ9Q 4JZ4A 2D6FA 2R5AA 2QYZA 3QO3A 1LVKA 4J7IA 2A37A 5HK3A 1WXTA 4XK8E 4LE9A 5D7UA 3L2UA 1WXBA 4N0AC 4BI4A 5HK0A 2HQHA 1RAAB 1M1GA 2DRKA 2NYSA 4TVRA 3BE3A 5EG2A 2F5KA 2KY9A 1ZLMA 2V8KA 3VUBA 1VQ4Q 3URGA 1AEYA 5IXBA 1YHQT 1FMKA 4M77B 1ABOA 3OSSC 2JZ2A 1WHKA 3M0RA 2M16A 2NUZA 1BCOA 4RCBA 1FXXA 2KQWA 3M5AA 2RI5A 2O88A 4O6JA 3A8MB 1NPPA 5IAYA 1GRIA 4PJLA 4A4KA 1VQMT 2VKNA 3QPHA 3I5SA 1E7OA 3META 4ANJA 4AFUC 3CC2A 3VKIA 1VQ5T 1JRIA 1PSFA 2CP7A 2F2VA 2DERA 4HCBA 1BIAA 2E4HA 4XQ3A 2L3SA 2CT4A 1YCYA 1UJ0A 3V8LA 2AIRB 3CMAQ 2DL7A 4M7DG 1YIJQ 2DD4A 4LDUA 2DA9A 2ZGWA 3HKSA 1G3YA 4E2FB 4PK4A 2EQUA 3RIRA 3CXCP 1X6BA 1T3SA 2FRWA 3M0QA 5FRNA 1KQ2A 1QP3A 3M0PA 1QWFA 2GGRA 4J83A 1KD1R 5GMKm 1VQ7T 3EFOB 2AHJB 3QWXX 1D0YA 2QI2A 3C12A 3FC3A 3TVTA 2DTIA 2LQKA 3KBGA 2KR3A 4C0GA 1KHIA 2X3XD 2EQIA 2EKOA 1PSEA 2CS7A 2QGGA 1WFWA 1I8FA 2M0YA 3EFRA 2CREA 2RK2A 3J7AF 2CZ7B 2LCCA 2GBQA 2EIFA 4MZTA 5GAN8 3CPFA 5GMKh 1B34B 5CQYA 3M56A 3CPWA 4M7AD 3A8HB 1T0JA 5HCKA 1U1TA 5I2MA 3I56A 2DL3A 5GMKi 2DD5A 1KK7A 4OGEA 3VRYA 3OYKA 1HJDA 3I56Q 4DQ2A 2OTLT 4M77C 1M5Q1 2MYSA 3WVEB 1OYXA 4DEYA 3MHXA 3CCMT 3GOXA 2ABLA 3OYEA 4QKUA 1VUBA 1QKXA 2HSPA 4M77A 3CCUT 1BK2A 4EMHA 2QG9B 2M51A 1W70A 1D0ZA 2M02A 2F69A 1RAEB 1CSKA 3A8GB 2CP0A 1K1ZA 4BI3A 4HVUA 4M7DD 2QEXT 1PC0A 1M1FA 1VQNT 4M77E 1QVGA 2LNVA 3OB9A 1UGSB 3FRNA 1U06A 3R6OA 2RJCA 2D1XA 1D3BB 4M75F 2QGFB 3OS5A 4M7AF 2E41A 1WJRA 2BZYA 2ZPEB 5GMKl 3A8OB 4ME7A 4B9WA 1NEBA 1X2QA 2X51A 3MEUA 4RKUE 3CEYA 5LJ5d 1PWTA 3VS7A 4HCCA 3SD4A 5GAOp 4F7UB 3KXTA 3M4YA 5LJ5h 3OW2P 4C8QE 1WLPB 2I0NA 2R57A 2RJDA 4Y92A 4OB2B 2LQWA 2YUOA 2EYWA 1OX8A 4KRTA 5GAMf 1OPKA 2X35A 1OU9A 1AVZC 1VQPA 2YT6A 1ZX6A 4M78B 3HRTA 4N4HA 1EIFA 4DOVA 3NPFA 4OMPA 4ZGEB 2RI2A 4WCIA 2BE7D 3GNGA 1M1KC 2J7IA 5GANg 1G8XA 3PMTA 2AZVA 1TWBA 4XTWA 2M9UA 5HY6A 1CKAA 4F17A 4QVDA 3EFOA 3FLGA
chains in the Genus database with same CATH topology
2EYYA 2KT8A 2YSQA 2LJ0A 3I9QA 4JPBW 1G2BA 1Z9QA 2RQUA 2BZXA 4J9IA 2AKLA 4J9BA 2GTOA 4CC4B 1QLYA 4M4ZA 2CSIA 4DEXA 2FRYA 1T0HA 1ZUUA 4LUDA 5ECAA 4JJBA 2DVJA 5L23A 2KT1A 1ZUKA 4J9HA 2K9GA 1UTIA 2O31A 4OMOA 4QT7A 1GL5A 1M3BA 2DX1A 4J9GA 2SEMA 2DBKA 1VYUA 1ZBJA 3C0CA 3TSWA 3RBBB 1ZSGA 1TUDA 3EGUA 4CC2A 1JXOA 3I5RA 4A63B 1PRLC 2JT4A 3LH5A 1M8MA 3H0HA 1ARKA 2JMCA 4JJDA 3SEMA 3VS4A 1PKTA 1X43A 3EG0A 1K4US 4HXJA 5GJVB 1S1NA 2O2OA 4CC3A 2CH4A 3GBQA 4HVWA 4OMMA 2D8HA 1GCQC 2YUNA 3PVQA 1UHFA 4HVVA 2DILA 2HCKA 5IH2A 1K9AA 4Z88A 2DMOA 1U3OA 1KSWA 4Z89A 4EIKA 1BBZA 2DL5A 1VYTA 1M3AA 1GCQA 2RQVA 2J6OA 1WXUA 2J6KA 1M27C 2JW4A 2EKHA 1RUWA 4IIMA 3R6NA 2YUPA 3REBB 3VS0A 2YDLA 2JM9A 2FPDA 2CDTA 2YUQA 1UG1A 1JEGA 4GLMA 5IXFA 1VYVA 3U23A 3O5ZA 4OMQA 2C0IA 5FW9A 2A28A 3M0SA 3VS6A 2GNCA 1QWEA 1YWPA 2D8JA 2EVRA 3REAB 1GCPA 4D8DA 1AWWA 3EHRA 2CSQA 2EGCA 2F2XA 1SEMA 4LUEA 1K0SA 1YCSB 1NLOC 1GFDA 4AG2C 4D8KA 4LNPA 4GBQA 3UA6A 2L3PA 4AFQC 1TUCA 2HDAA 4OMNA 1AWJA 1H8KA 5FWCA 1BU1A 2JXBA 2K7AA 3UATA 3THKA 1FYNA 2CH4W 2OI3A 4J9DA 5I11A 1KIKA 2O9SA 2VVKA 2A08A 1YN8A 1BB9A 1M3CA 1SRLA 1N5ZA 4AG1C 3PVLA 1I0CA 1T3LA 5GJWB 3PE0A 4F14A 4JJCA 2KNBB 3EHQA 4RTWA 4AFZC 1UHCA 1YWOA 2DRMA 2FPEA 3SHWA 2KROA 1RI9A 2LNHB 3ULRB 4RTXA 2DBMA 2HEQA 3H0IA 2DLPA 2D0NA 2RMOA 1H92A 4ZNXA 2JS2A 2LJ3A 2GTJA 4K11A 1I1JA 4JZ4A 1EFNA 2ENMA 2RF0A 1UUEA 2ED1A 1QKWA 3RNJA 1K0XA 2A37A 2V1RA 1WXTA 1UECA 3NGPA 4LE9A 1A0NB 1WXBA 1SPKA 1UFFA 1ZUYA 4F16A 1GBRA 4CC7A 1B3QA 2DYBA 4X1VA 2K79A 3H41A 2DRKA 2J6FA 1WI7A 1ZLMA 2EBPA 4RUGA 5EC7A 2P4RA 4RTTA 1AEYA 5IXBA 1X6GA 1FMKA 1QCFA 2JS0A 1ABOA 1AOJA 1X27A 1UGVA 2B86A 1YP5A 2AKKA 2KXCA 1UDLA 3M0RA 2NUZA 1Y57A 1Y0MA 1SHGA 1ABQA 2KRMA 1NM7A 2QDLA 2AZSA 2O88A 1CKBA 4LN2A 2PTKA 1GRIA 2K3BA 2KBTA 2E5KA 2VKNA 1NEGA 2ECZA 2CT3A 3I5SA 1E7OA 3VS3A 1AZEA 1YNZA 3M0TA 4AFUC 2DL4A 2L0AA 3NMZC 1I07A 3KFVA 1SHFA 3UA7A 2V1QA 1K76A 2F2VA 2FEIA 1JO8A 3VS2A 1OV3A 2KRNA 1NYFA 2LQNA 2W10A 4RTZA 2EGEA 1OPLA 3VRZA 1HSQA 1M30A 2L3SA 2DF6A 2CT4A 3VS1A 2C0TA 1J3TA 2LJ1A 1UJ0A 1WX6A 2DL7A 3M0UA 3QWYA 2DJQA 1B07A 1SSHA 1GFCA 2DA9A 2PNIA 2KYBA 1JQQA 1W6XA 3IQLA 2FG0A 1W1FA 2RPNA 4HCKA 2J05A 2MIOA 2K6DA 3I35A 2FO0A 2HBWA 1X6BA 1T3SA 2FRWA 2IIMA 2XMFA 3M0QA 2DL8A 3M0PA 2KXDA 1QWFA 2GGRA 1OEBA 2JTEA 5FWBA 5I22A 1WYXA 4Z8AA 1PKSA 1UE9A 3QWXX 1H3HA 1NG2A 2ESWA 1JU5C 3ZL7C 1AD5A 3TVTA 2LX7A 2KGTA 2KR3A 1JXMA 2MOXA 2X3XD 2EQIA 3CQTA 1MUZA 2KRSA 1KFZA 2ED0A 1WFWA 2JM8A 2RQWA 2M0YA 1KJWA 2CREA 2ROTA 2KYMA 3TSZA 2GBQA 2GQIA 1AWXA 1MV0B 1T0JA 5HCKA 1PNJA 2KE9A 2JMAA 2DL3A 2LCSA 1XOVA 2NWMA 2F2WA 3VRYA 3EG2A 2EYXA 1HJDA 2VWFA 4RTYA 4FSSA 1RLQC 1RLPC 1G83A 4DEYA 1OOTA 1TG0A 2ABLA 3NHNA 2CUBA 2RQTA 2EW3A 1QKXA 4J9CA 2HSPA 2LZ6B 1BK2A 2X3WD 2DNUA 4AFSC 2M51A 1W70A 2KEAA 1AZGB 1MV3A 1CSKA 1WIEA 3EG1A 1WA7A 1K1ZA 4HVUA 2SRCA 4RTUA 2CUDA 2O9VA 2J06A 3EG3A 2A36A 4J9FA 2PZ1A 2OAWA 2W0ZA 2AK5A 1U06A 1U5SA 1LCKA 2D1XA 2RNAA 1IO6A 1HD3A 1SRMA 2G6FX 2LMJA 2BZYA 1V1CA 4R0KA 4JZ3A 1X2KA 1NEBA 1X2QA 2BZ8A 3H0FA 1PWTA 3VS7A 5IHKA 2EGAA 2ROLA 2H8HA 2EYZA 4RTVA 1UJYA 2LP5A 1WLPB 2DE0X 2FPFA 1E6HA 2I0NA 2L2PA 4Y92A 3A98A 4ESRA 2LQWA 2MCNA 1GBQA 2YUOA 1X69A 4ORZA 2EYWA 4KRTA 1OPKA 4E6RA 1AVZC 5IHIA 2K2MA 2YT6A 1ZX6A 1WDXA 1PRMC 3UF4A 1AWOA 3NPFA 4OMPA 1E6GA 4IIOA 1PHTA 4WCIA 2OJ2A 1VA7A 3FJ5A 2RQRA 2J7IA 2EPDA 3JV3A 3VS5A 2L3QA 2AZVA 5IHNA 2BTTA 1CKAA 1NLPC 4F17A 2RN8A 2DM1A 4OMLA 1NYGA 1Z9ZA 2C0OA 4J9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYY A;  2KT8 A;  2YSQ A;  2LJ0 A;  3I9Q A;  4JPB W;  1G2B A;  1Z9Q A;  2RQU A;  2BZX A;  4J9I A;  2AKL A;  4J9B A;  2GTO A;  4CC4 B;  1QLY A;  4M4Z A;  2CSI A;  4DEX A;  2FRY A;  1T0H A;  1ZUU A;  4LUD A;  5ECA A;  4JJB A;  2DVJ A;  5L23 A;  2KT1 A;  1ZUK A;  4J9H A;  2K9G A;  1UTI A;  2O31 A;  4OMO A;  4QT7 A;  1GL5 A;  1M3B A;  2DX1 A;  4J9G A;  2SEM A;  2DBK A;  1VYU A;  1ZBJ A;  3C0C A;  3TSW A;  3RBB B;  1ZSG A;  1TUD A;  3EGU A;  4CC2 A;  1JXO A;  3I5R A;  4A63 B;  1PRL C;  2JT4 A;  3LH5 A;  1M8M A;  3H0H A;  1ARK A;  2JMC A;  4JJD A;  3SEM A;  3VS4 A;  1PKT A;  1X43 A;  3EG0 A;  1K4U S;  4HXJ A;  5GJV B;  1S1N A;  2O2O A;  4CC3 A;  2CH4 A;  3GBQ A;  4HVW A;  4OMM A;  2D8H A;  1GCQ C;  2YUN A;  3PVQ A;  1UHF A;  4HVV A;  2DIL A;  2HCK A;  5IH2 A;  1K9A A;  4Z88 A;  2DMO A;  1U3O A;  1KSW A;  4Z89 A;  4EIK A;  1BBZ A;  2DL5 A;  1VYT A;  1M3A A;  1GCQ A;  2RQV A;  2J6O A;  1WXU A;  2J6K A;  1M27 C;  2JW4 A;  2EKH A;  1RUW A;  4IIM A;  3R6N A;  2YUP A;  3REB B;  3VS0 A;  2YDL A;  2JM9 A;  2FPD A;  2CDT A;  2YUQ A;  1UG1 A;  1JEG A;  4GLM A;  5IXF A;  1VYV A;  3U23 A;  3O5Z A;  4OMQ A;  2C0I A;  5FW9 A;  2A28 A;  3M0S A;  3VS6 A;  2GNC A;  1QWE A;  1YWP A;  2D8J A;  2EVR A;  3REA B;  1GCP A;  4D8D A;  1AWW A;  3EHR A;  2CSQ A;  2EGC A;  2F2X A;  1SEM A;  4LUE A;  1K0S A;  1YCS B;  1NLO C;  1GFD A;  4AG2 C;  4D8K A;  4LNP A;  4GBQ A;  3UA6 A;  2L3P A;  4AFQ C;  1TUC A;  2HDA A;  4OMN A;  1AWJ A;  1H8K A;  5FWC A;  1BU1 A;  2JXB A;  2K7A A;  3UAT A;  3THK A;  1FYN A;  2CH4 W;  2OI3 A;  4J9D A;  5I11 A;  1KIK A;  2O9S A;  2VVK A;  2A08 A;  1YN8 A;  1BB9 A;  1M3C A;  1SRL A;  1N5Z A;  4AG1 C;  3PVL A;  1I0C A;  1T3L A;  5GJW B;  3PE0 A;  4F14 A;  4JJC A;  2KNB B;  3EHQ A;  4RTW A;  4AFZ C;  1UHC A;  1YWO A;  2DRM A;  2FPE A;  3SHW A;  2KRO A;  1RI9 A;  2LNH B;  3ULR B;  4RTX A;  2DBM A;  2HEQ A;  3H0I A;  2DLP A;  2D0N A;  2RMO A;  1H92 A;  4ZNX A;  2JS2 A;  2LJ3 A;  2GTJ A;  4K11 A;  1I1J A;  4JZ4 A;  1EFN A;  2ENM A;  2RF0 A;  1UUE A;  2ED1 A;  1QKW A;  3RNJ A;  1K0X A;  2A37 A;  2V1R A;  1WXT A;  1UEC A;  3NGP A;  4LE9 A;  1A0N B;  1WXB A;  1SPK A;  1UFF A;  1ZUY A;  4F16 A;  1GBR A;  4CC7 A;  1B3Q A;  2DYB A;  4X1V A;  2K79 A;  3H41 A;  2DRK A;  2J6F A;  1WI7 A;  1ZLM A;  2EBP A;  4RUG A;  5EC7 A;  2P4R A;  4RTT A;  1AEY A;  5IXB A;  1X6G A;  1FMK A;  1QCF A;  2JS0 A;  1ABO A;  1AOJ A;  1X27 A;  1UGV A;  2B86 A;  1YP5 A;  2AKK A;  2KXC A;  1UDL A;  3M0R A;  2NUZ A;  1Y57 A;  1Y0M A;  1SHG A;  1ABQ A;  2KRM A;  1NM7 A;  2QDL A;  2AZS A;  2O88 A;  1CKB A;  4LN2 A;  2PTK A;  1GRI A;  2K3B A;  2KBT A;  2E5K A;  2VKN A;  1NEG A;  2ECZ A;  2CT3 A;  3I5S A;  1E7O A;  3VS3 A;  1AZE A;  1YNZ A;  3M0T A;  4AFU C;  2DL4 A;  2L0A A;  3NMZ C;  1I07 A;  3KFV A;  1SHF A;  3UA7 A;  2V1Q A;  1K76 A;  2F2V A;  2FEI A;  1JO8 A;  3VS2 A;  1OV3 A;  2KRN A;  1NYF A;  2LQN A;  2W10 A;  4RTZ A;  2EGE A;  1OPL A;  3VRZ A;  1HSQ A;  1M30 A;  2L3S A;  2DF6 A;  2CT4 A;  3VS1 A;  2C0T A;  1J3T A;  2LJ1 A;  1UJ0 A;  1WX6 A;  2DL7 A;  3M0U A;  3QWY A;  2DJQ A;  1B07 A;  1SSH A;  1GFC A;  2DA9 A;  2PNI A;  2KYB A;  1JQQ A;  1W6X A;  3IQL A;  2FG0 A;  1W1F A;  2RPN A;  4HCK A;  2J05 A;  2MIO A;  2K6D A;  3I35 A;  2FO0 A;  2HBW A;  1X6B A;  1T3S A;  2FRW A;  2IIM A;  2XMF A;  3M0Q A;  2DL8 A;  3M0P A;  2KXD A;  1QWF A;  2GGR A;  1OEB A;  2JTE A;  5FWB A;  5I22 A;  1WYX A;  4Z8A A;  1PKS A;  1UE9 A;  3QWX X;  1H3H A;  1NG2 A;  2ESW A;  1JU5 C;  3ZL7 C;  1AD5 A;  3TVT A;  2LX7 A;  2KGT A;  2KR3 A;  1JXM A;  2MOX A;  2X3X D;  2EQI A;  3CQT A;  1MUZ A;  2KRS A;  1KFZ A;  2ED0 A;  1WFW A;  2JM8 A;  2RQW A;  2M0Y A;  1KJW A;  2CRE A;  2ROT A;  2KYM A;  3TSZ A;  2GBQ A;  2GQI A;  1AWX A;  1MV0 B;  1T0J A;  5HCK A;  1PNJ A;  2KE9 A;  2JMA A;  2DL3 A;  2LCS A;  1XOV A;  2NWM A;  2F2W A;  3VRY A;  3EG2 A;  2EYX A;  1HJD A;  2VWF A;  4RTY A;  4FSS A;  1RLQ C;  1RLP C;  1G83 A;  4DEY A;  1OOT A;  1TG0 A;  2ABL A;  3NHN A;  2CUB A;  2RQT A;  2EW3 A;  1QKX A;  4J9C A;  2HSP A;  2LZ6 B;  1BK2 A;  2X3W D;  2DNU A;  4AFS C;  2M51 A;  1W70 A;  2KEA A;  1AZG B;  1MV3 A;  1CSK A;  1WIE A;  3EG1 A;  1WA7 A;  1K1Z A;  4HVU A;  2SRC A;  4RTU A;  2CUD A;  2O9V A;  2J06 A;  3EG3 A;  2A36 A;  4J9F A;  2PZ1 A;  2OAW A;  2W0Z A;  2AK5 A;  1U06 A;  1U5S A;  1LCK A;  2D1X A;  2RNA A;  1IO6 A;  1HD3 A;  1SRM A;  2G6F X;  2LMJ A;  2BZY A;  1V1C A;  4R0K A;  4JZ3 A;  1X2K A;  1NEB A;  1X2Q A;  2BZ8 A;  3H0F A;  1PWT A;  3VS7 A;  5IHK A;  2EGA A;  2ROL A;  2H8H A;  2EYZ A;  4RTV A;  1UJY A;  2LP5 A;  1WLP B;  2DE0 X;  2FPF A;  1E6H A;  2I0N A;  2L2P A;  4Y92 A;  3A98 A;  4ESR A;  2LQW A;  2MCN A;  1GBQ A;  2YUO A;  1X69 A;  4ORZ A;  2EYW A;  4KRT A;  1OPK A;  4E6R A;  1AVZ C;  5IHI A;  2K2M A;  2YT6 A;  1ZX6 A;  1WDX A;  1PRM C;  3UF4 A;  1AWO A;  3NPF A;  4OMP A;  1E6G A;  4IIO A;  1PHT A;  4WCI A;  2OJ2 A;  1VA7 A;  3FJ5 A;  2RQR A;  2J7I A;  2EPD A;  3JV3 A;  3VS5 A;  2L3Q A;  2AZV A;  5IHN A;  2BTT A;  1CKA A;  1NLP C;  4F17 A;  2RN8 A;  2DM1 A;  4OML A;  1NYG A;  1Z9Z A;  2C0O A;  4J9E A; 
#chains in the Genus database with same CATH topology
 2E6N A;  4XU1 A;  3I55 A;  8ATC B;  1Z9Q A;  3L2Z A;  2BZX A;  2P0Q A;  1IXD A;  3CPW P;  5CK9 A;  2HD0 A;  4KUD K;  1QLY A;  2CSI A;  1OU8 A;  1RAG B;  1YI2 Q;  9ATC B;  4LUD A;  4ZTJ A;  4J9H A;  2K9G A;  1UTI A;  2O31 A;  4PL6 A;  1G5V A;  1B34 A;  1Y7X A;  2DX1 A;  5GAM d;  2OAU A;  3SB2 A;  2VYT A;  2DPP B;  1VYU A;  4FIB A;  2DTO A;  3C0C A;  2GCX A;  5GAM h;  1TOV A;  3G6E A;  2JOY A;  4PJO E;  4CC2 A;  1TXQ A;  2PUK B;  3UWN A;  5LJ3 g;  2MWO A;  5J39 A;  3G6E Q;  3CCQ A;  3ASK A;  5GMK j;  4QVC A;  1RAH B;  3JB9 I;  1ARK A;  2JMC A;  4JJD A;  3SEM A;  1X43 A;  3EG0 A;  4BE2 A;  2O4X B;  3GBQ A;  4XTY A;  1VQL A;  4KUI A;  3OYA A;  1K9A A;  1WGS A;  1U3O A;  2D0Q B;  1F1B B;  1QVF S;  4FT2 A;  1KG1 A;  1NZ9 A;  1XTD A;  3J81 E;  3JCM f;  3M9Q A;  3EH1 A;  2A0F B;  4E7H A;  2R58 A;  1WHG A;  1RUW A;  1D3B A;  2YUP A;  3C95 A;  2QQ9 A;  2YDL A;  3HPW A;  3CD6 T;  5GAN 7;  4Z02 A;  3MP6 A;  2PVO B;  3LYI A;  3O5Z A;  4XU3 A;  2C0I A;  1VQK T;  3M0S A;  3RKW A;  3VS6 A;  1QVP A;  4PNO A;  3MEW A;  2QA4 T;  1YWP A;  2EQJ A;  5LL6 S;  2DO3 A;  2WSC E;  4M78 C;  2DXC A;  1BKB A;  1YJN Q;  4BI8 B;  4LUE A;  5GMK e;  4M75 A;  3RKX A;  4ZGJ B;  4JS4 A;  4D8K A;  2NUP B;  2Y4Y A;  2L89 A;  4F7U E;  1Q86 U;  1XNI A;  2XK0 A;  4AFQ C;  4M78 A;  4AMC A;  5LJ5 j;  2QQA A;  4NOY A;  5D6X A;  3OBY A;  3EGD A;  2VAS A;  3THK A;  3OYL A;  1TSF A;  1M2O A;  4E7Z A;  2VC8 A;  1LPL A;  3G71 A;  1YN8 A;  2VXE A;  5CIU A;  4M78 E;  1W2B A;  1W4S A;  2LX9 A;  1BB9 A;  2QXF A;  4D6W A;  3ZFJ A;  3CC4 A;  1M4Z A;  5CVI A;  2COZ A;  3G71 Q;  2QQR A;  1I0C A;  2Z0W A;  2ZPF B;  3PE0 A;  3CC4 Q;  3EAE A;  2XHC A;  4RTW A;  1N9R A;  3SHW A;  2F5T X;  1RI9 A;  4MDX A;  5DY9 A;  2H3E B;  1VQO A;  3H0I A;  2RMO A;  3CCR T;  4C5I A;  2B8A A;  2LJ3 A;  1KQS S;  4K11 A;  1VQO Q;  4M77 G;  4YTL A;  2ENM A;  1KD1 U;  4JDS A;  1MMD A;  1UUE A;  1K0X A;  1UEC A;  3H8Z A;  5IT9 E;  5C0M A;  3CBO A;  1UFF A;  2JTM A;  1FMW A;  4A4H A;  1VQ8 T;  1B3Q A;  1G3W A;  4X1V A;  6AT1 B;  2O4X A;  3E9F A;  3CME T;  5LJ5 e;  2V8J A;  4P5N A;  1WI7 A;  2GQV A;  1QCN A;  4II1 A;  5EC7 A;  5J3B A;  4IUV A;  4RTT A;  4FT4 A;  1QCF A;  2JS0 A;  1UGV A;  2B86 A;  2AKK A;  1SSF A;  2KXC A;  1Y57 A;  3MP8 A;  1Y0M A;  1SHG A;  2KRM A;  4IKF A;  1NM7 A;  2QDL A;  4C92 F;  4A53 A;  3TEE A;  1CKB A;  5KYU B;  1UGP B;  2E5K A;  2EJF A;  3RR6 A;  3VS3 A;  1AZE A;  2DVE A;  1BI3 A;  2L0A A;  3NMZ C;  1I07 A;  3E2U A;  1YJW T;  3VV0 A;  1YIT A;  4KUL A;  1YJ9 T;  2K3Y A;  3GP8 A;  3CC7 T;  1NYF A;  1YIT Q;  1TUG B;  2LQN A;  2W10 A;  4RTZ A;  1HSQ A;  3PGG A;  2YRV A;  2ZPG B;  4PFO A;  2LJ1 A;  2XU8 A;  5GAN d;  3M0U A;  5DM7 R;  1B07 A;  2NUP A;  4DBQ A;  3LLR A;  2GF7 A;  2PNI A;  1IRX A;  3DB3 A;  1JQQ A;  4HKE A;  5GAN h;  3J80 E;  3EG9 B;  2FG0 A;  3IQL A;  5IN1 A;  2CP5 A;  3OY9 A;  1JJ2 P;  3QDF A;  3OYN A;  3HL8 A;  2MIO A;  3I35 A;  2HBW A;  4XTV A;  4M77 D;  2XMF A;  3BFM A;  5KE3 A;  3VUZ A;  3X20 B;  4C0F A;  1OEB A;  1WYX A;  3GNF B;  3E9G A;  3CBP A;  5I2S A;  4EDU A;  1PKS A;  1UE9 A;  3X26 B;  4J6X A;  1H3H A;  3PMI A;  4IUR A;  3CXC A;  1NG2 A;  1JU5 C;  1MMA A;  4MZM A;  3G4S A;  3JB9 H;  2LX7 A;  2KGT A;  1LOJ A;  4HCZ A;  2DJZ A;  1BI0 A;  1DJ7 B;  2MOX A;  2KRS A;  3G7Z A;  4AT1 B;  3G4S Q;  2RQW A;  3X25 B;  1VQ9 A;  4EMK B;  2K4Y A;  5LJ3 d;  4C8Q D;  1I5O B;  2GFA A;  2ROT A;  2KYM A;  2E3H A;  2EWN A;  2GQI A;  4FYY B;  4KBM B;  4BAC A;  3CC2 T;  3MP1 A;  3M4G A;  4XU2 A;  1VQ9 Q;  1AWX A;  3JCM c;  5LJ3 h;  1MV0 B;  1PCX A;  2KSS A;  1U8R A;  1Y07 A;  3PIO A;  4Q5W A;  2KE9 A;  2DXT A;  2XID A;  2JMA A;  2RJE A;  1XOV A;  5GAM g;  1RAC B;  2RHY A;  2EYX A;  3QKJ A;  1RLP C;  1VQ4 A;  1TU0 B;  1IB8 A;  3PTA A;  1OOT A;  1D09 B;  3NHN A;  2RA2 A;  2KMT A;  2HQE A;  2LT1 A;  2RK1 A;  1C1A A;  4OP0 A;  3G1J A;  1QQJ A;  2P84 A;  3F70 A;  4AFS C;  2XIC A;  2KEA A;  1AZG B;  3CCL A;  4F7U G;  1MV3 A;  2XDD A;  1WIE A;  3EG1 A;  2KK4 A;  1Q86 R;  3CCL Q;  5KYU A;  2J06 A;  4ELY C;  3EG3 A;  3CCE A;  2OAW A;  4C8Q F;  1KQ1 A;  3CCV Q;  4PJO D;  2LCL A;  1U5S A;  4M78 G;  1LCK A;  3CCE Q;  2RNA A;  1IO6 A;  2G6F X;  2Y90 A;  2D9T A;  2LMJ A;  3CMA A;  1MMG A;  1V1C A;  4R0K A;  4JZ3 A;  4C92 A;  1YIJ A;  2BZ8 A;  2CZ1 B;  4ZGD B;  3JCM V;  3LGL A;  3GLX A;  2ROL A;  2QTX A;  4RG8 A;  2DEQ A;  1IGU A;  2JTF A;  2HL5 C;  4OGC A;  2DE0 X;  2FPF A;  1E6H A;  3I56 T;  5GAO r;  4ESR A;  4PFP A;  2MCN A;  1BYM A;  1KD1 C;  1ACM B;  1QVF P;  3EG9 A;  4C5G A;  3JCM J;  2K5I A;  4E6R A;  2K2M A;  1WDX A;  3OW2 A;  3N5B B;  4RMO A;  1E6G A;  5A0G A;  4FSX A;  3SDZ A;  2WAC A;  3FJ5 A;  5CKB A;  5D6W A;  5IHN A;  5KYX B;  5GAN j;  2MWP A;  2BTT A;  2RN8 A;  2DM1 A;  4X9D A;  5KH6 A;  3OYF A;  3JCM g;  3UA6 A;  2EYY A;  2KT8 A;  4FCY A;  1R77 A;  3BDL A;  4J8O A;  4EMK C;  4XAX B;  1KC8 R;  1WHH A;  4J9I A;  2AKL A;  4HT9 A;  2COY A;  4HA8 A;  1V29 B;  4PJO F;  4M4Z A;  4DEX A;  1I81 A;  2JNG A;  4L59 A;  1PD0 A;  5J26 A;  4EMK A;  5GAN 2;  2DVJ A;  1ZUK A;  1M3B A;  2RO0 A;  1N27 A;  3TSW A;  2DIG A;  3EGX B;  1ZSG A;  1TUD A;  1JXO A;  4OB1 B;  1PRL C;  2L5Q A;  1ZBX A;  3H0H A;  5LJ3 j;  3NTH A;  2QQS A;  2YXY A;  2OX7 A;  2PVD B;  2X4J A;  4M78 D;  5GAN 4;  1K4U S;  2XG8 D;  4QQD A;  4GLK A;  1S1N A;  4PLL A;  2O2O A;  4CC3 A;  1I5L A;  1C0M A;  1VQP T;  2D8H A;  1UHF A;  1UB4 A;  2HCK A;  5GAN e;  1OI1 A;  2DMO A;  1KQS P;  1JJ2 S;  2E64 A;  3LGF A;  4ZN1 A;  1VYT A;  1M8V A;  3MJX A;  4B9X A;  1YBY A;  2FVU A;  2JJ9 A;  3AHU A;  3I55 T;  2RQV A;  4FU6 A;  2J6O A;  2VB6 A;  3QZ9 B;  1WQ7 A;  4BY6 B;  2JW4 A;  4BDY A;  2EKH A;  4IIM A;  3TRE A;  3REB B;  2JM9 A;  2FPD A;  1NJI U;  2CDT A;  2RD1 A;  1OUL A;  2YUQ A;  1UG1 A;  1S72 A;  4F7U F;  3U23 A;  1M9S A;  3OYM A;  2H3J A;  4OMQ A;  4F04 B;  2PUO B;  1S72 Q;  1QWE A;  1N6A A;  3QJ6 A;  3REA B;  5GAN 5;  4D8D A;  4M75 B;  4E7K A;  4IUT A;  4M7A B;  3S6W A;  3G6E T;  1YCS B;  1NLO C;  5LJ3 e;  1GFD A;  3HRS A;  1QW1 A;  1NE8 A;  2KAF A;  4OMF B;  3CCQ T;  1VIE A;  2IVW A;  2ZPB B;  3EGD B;  4C5E A;  3L2Q A;  2OTL Q;  2XDP A;  3V7S A;  1X75 C;  1Q7Y U;  4OMN A;  1AWJ A;  1H8K A;  1BU1 A;  2YRD A;  5GAO q;  4M7D F;  5KYX A;  3QZ5 B;  2OI3 A;  2FB7 A;  5I11 A;  2O01 E;  1KIK A;  3P8H A;  1VQL T;  2A08 A;  2P0K A;  3A1P A;  3VU3 C;  3QII A;  1YI2 A;  5FRO A;  3PVL A;  4J6Y A;  2E3I A;  4J7F A;  1TH7 A;  5FRM A;  1UHC A;  4EMG A;  1VQN Q;  2LNH B;  2RI3 A;  4JRQ A;  2DBM A;  2HEQ A;  2E1H A;  2DLP A;  3OSV A;  3X28 B;  1RAB B;  1K9M R;  4ZNX A;  2GTJ A;  2QQB A;  2GFU A;  4LDW A;  3EGX A;  1QMC A;  2CGH A;  3V8K A;  3EH2 A;  4UC4 A;  1A0N B;  2V8I A;  1K73 U;  3QUI A;  2HBP A;  3QDR B;  4WF2 A;  4CC7 A;  4FM4 B;  4C0Z A;  2DYB A;  3H41 A;  4L5G A;  4C0D B;  3FEO A;  2EBP A;  1Q95 G;  2DYI A;  1WNL A;  2P4R A;  4KH0 B;  3TU4 K;  1X6G A;  4BY6 C;  1KHC A;  1X27 A;  1BI2 A;  1YP5 A;  1ZA2 B;  3LWI A;  3G71 T;  3LH0 A;  2E6Z A;  1PM3 A;  1ABQ A;  1R0B G;  3QYG B;  2EQM A;  2AZS A;  3UDC A;  3RUX A;  4GY5 A;  3CC4 T;  5CAI A;  4PJM A;  1UGQ B;  2MK5 A;  2ECZ A;  2KI7 A;  1K8A U;  4KGZ B;  2K3X A;  3OS2 A;  1YNZ A;  1VQ6 A;  2NUT B;  2X9H A;  3LX7 A;  4M75 C;  3KFV A;  2RH2 A;  2A7Y A;  2EYQ A;  3DKM A;  2V1Q A;  4M7A C;  1WZO A;  1K76 A;  1YJN A;  5FLX E;  1VQO T;  1IRE B;  1VQ6 Q;  1EZZ B;  1OV3 A;  3H6Z A;  1UGR B;  3JRZ A;  3P8D A;  5CKE A;  7AT1 B;  2YRC A;  3VRZ A;  1M30 A;  3VS1 A;  1J3T A;  4M7A A;  1WX6 A;  2WSE E;  3GF5 A;  5I21 A;  2DJQ A;  4LDY A;  1SSH A;  3PT9 A;  4OF1 A;  5AYF A;  3OYJ A;  3M57 A;  4R56 A;  2VXF A;  2KYB A;  3JCM d;  3TQ7 P;  3HTR A;  4M75 E;  3OYG A;  4ZN3 A;  4LDV A;  5CKH A;  3JCM h;  4HCK A;  1O9S A;  2FO0 A;  2YLC A;  3OMG A;  4Z8A A;  2LRQ A;  4XU0 A;  1JJ2 A;  3HFO A;  2IPO B;  4B6M A;  3MKD A;  4E7J A;  1IHV A;  1R0C B;  3ZL7 C;  5CKF A;  5CO7 A;  2DAQ A;  1Y96 B;  4M7D A;  1MUZ A;  2JM8 A;  4MMK A;  2ZPI B;  2QAZ A;  1JB0 E;  2RM4 A;  1KJW A;  4JJN K;  2HQX A;  1MHN A;  3DLM A;  3L2R A;  1M2V B;  2HZY A;  3OYB A;  1YIT T;  2G3R A;  1PNJ A;  2LCS A;  2VV5 A;  4C0D C;  2NWM A;  2HKQ B;  2QA4 Q;  2MMP A;  1GXI E;  2F2W A;  3EG2 A;  2HNI A;  2VWF A;  1KC8 U;  5GAM j;  4RTY A;  1NJI R;  4OB0 B;  3ER0 A;  2CP2 A;  2L3R A;  1TG0 A;  2ZCF B;  3A8L B;  2CUB A;  1Q82 R;  2RQT A;  1HXD A;  2EW3 A;  1BI1 A;  3OS0 A;  4E7I A;  4J9C A;  1M90 U;  2LZ6 B;  1U1S A;  2DNU A;  1R8O B;  2FHD A;  3RKY A;  2C06 A;  1BIB A;  3CCS A;  2MI6 A;  2SRC A;  3CCS Q;  2CUD A;  2O9V A;  3OA6 A;  3VYG A;  3JSC A;  1Q7Y R;  2JVV A;  1FWZ A;  2E10 A;  3SWN B;  2RJF A;  2NUT A;  4FYV B;  3G4S T;  4NS5 A;  2CP6 A;  4C92 B;  2OTJ A;  4XTX A;  4XTZ A;  1VQ9 T;  2LVM A;  1ZSZ A;  1X2K A;  2XKO C;  3M58 A;  4NL2 A;  2OTJ Q;  2PVG B;  2ATC B;  4IUQ A;  1AHJ B;  2XDB A;  2EYZ A;  4IUU A;  3C4S A;  1TTH B;  2LP5 A;  2K5L A;  5GAM e;  2M0O A;  2L2P A;  3A98 A;  2LT4 A;  3MCA B;  4NL3 A;  4ZTF A;  1C6V X;  3CCJ A;  5IHI A;  3H9N A;  1HYO A;  5CQX A;  1VQ4 T;  1AWO A;  4RG2 A;  1VQ8 Q;  1Q81 U;  2LC4 A;  4PKC C;  3UPU A;  1XQH A;  3CCJ Q;  3CME Q;  1AT1 B;  2RQR A;  3JV3 A;  2EPD A;  2CKK A;  2K2V A;  3VS5 A;  1QVF A;  1NLP C;  3LWH A;  4A4F A;  1K73 R;  1Z9Z A;  4A4E A;  2QTV A;  3M53 A;  3I9Q A;  2LJ0 A;  4JPB W;  5A0D A;  3NFC A;  1G2B A;  1ZHI A;  3CCL T;  4BB7 A;  2FYK A;  4DBR A;  2R5M A;  3O8V A;  3OMC A;  2XI9 A;  3OYC A;  1Y96 A;  2FZK B;  1Y71 A;  1ZA1 B;  1ZUU A;  4J6W A;  3CCE T;  5ECA A;  1QVG S;  4JJB A;  5L23 A;  4QT7 A;  1M2V A;  2AT1 B;  4J9G A;  3L2W A;  4DBH A;  1YJW Q;  3ZBD A;  4KT0 E;  1RAD B;  1RL2 A;  3CMA T;  1YIJ T;  3CC7 Q;  2BKD N;  1K8A R;  3LH5 A;  4N4G A;  4ATO A;  4MZP A;  4M77 F;  3QSU A;  5D6Y A;  1PKT A;  3OYD A;  2CZ0 B;  4CI0 C;  1M1K U;  2DTH A;  4BD3 A;  1G3S A;  1Q86 C;  4JS5 A;  1PG5 B;  4HVW A;  1NPR A;  3PFS A;  3CBM A;  3P8B B;  4OMM A;  1K9M U;  2YUN A;  1EX4 A;  4HVV A;  2DIL A;  4X9C A;  5IH2 A;  2KDS A;  2RHX A;  5FU7 B;  4N0A A;  3X24 B;  3SWN C;  3WVD B;  4CRI A;  3CCV A;  2ZZD A;  1KSW A;  4Y91 A;  4LXC A;  3JCM e;  1QCO A;  4Z89 A;  4M75 G;  2DL5 A;  4M7A G;  4C92 C;  1H3Z A;  3JCM W;  3SWN A;  2J6K A;  1M27 C;  2X4X A;  1KQS A;  3E1S A;  4FW2 A;  1WQW A;  5IXF A;  4OB3 B;  2E65 A;  5FW9 A;  4MDW A;  1D0X A;  2GNC A;  3BDU A;  2D8J A;  3CC2 Q;  4C8Q B;  2JN0 A;  4C92 E;  1D1B A;  2LTO A;  3T9N A;  3RDV A;  1VIF A;  2EGC A;  1K0S A;  1LJO A;  2I2L A;  4PJN A;  3AT1 B;  4AG2 C;  3OYY A;  2E12 A;  5C6S A;  5DLQ E;  4LNP A;  1WHL A;  2MAM A;  1TUC A;  2HDA A;  2EAY A;  1KC8 C;  1YHQ A;  5FWC A;  2K7A A;  3HFN A;  1FYN A;  2CH4 W;  1X6O A;  4J9D A;  1YHQ Q;  2DXB A;  1M3C A;  1N5Z A;  4AG1 C;  1VQM A;  1T3L A;  1M90 C;  5GJW B;  4JJC A;  2CP3 A;  2EQK A;  2KNB B;  3EHQ A;  4JLI A;  4IUP A;  2FPE A;  1YWO A;  2DRM A;  1VQM Q;  2KRO A;  3M59 A;  1PD1 A;  5A0L A;  1VQ5 A;  4RTX A;  1M90 R;  3PIP A;  1H92 A;  2CYZ B;  5CCA A;  2HMA A;  3Q1J A;  3FIF A;  1VQ5 Q;  2JS2 A;  4FYX B;  4PJO B;  3OQ5 A;  4A4G A;  1S72 T;  3V7R A;  1EFN A;  4M75 D;  2RF0 A;  3PNW C;  4DOW A;  2ED1 A;  1QKW A;  4KGV B;  3RNJ A;  2V1R A;  3NGP A;  3JAM E;  2PQW A;  5HKC A;  3FB9 A;  1SPK A;  5CR2 A;  4XTU A;  1ZUY A;  2DZC A;  3S3M A;  4F16 A;  1GBR A;  5FU7 C;  3E19 A;  1V76 A;  2K79 A;  2EJ9 A;  2L8D A;  2J6F A;  2X4W A;  2EFI A;  1MGQ A;  1P92 A;  2YLB A;  4RUG A;  5A2Q E;  5DLO A;  5LJ5 f;  1VQ7 A;  1IGQ A;  2RB6 A;  2LQ8 A;  3OS1 A;  2IG0 A;  1AOJ A;  4DA4 A;  3HRU A;  3ZEH A;  1VQ7 Q;  1Q81 C;  1UDL A;  1FX7 A;  3LW5 E;  4QVZ A;  2F1L A;  3FJP A;  1W2B S;  3QBY A;  4J5Y A;  4LN2 A;  2DK3 A;  1YI2 T;  2PTK A;  2K3B A;  1Q81 R;  2KBT A;  3L1A A;  5KE2 A;  1NEG A;  1XJW B;  2CT3 A;  3V8J A;  3M0T A;  4C8Q C;  4QQG A;  2DL4 A;  1NBE B;  1SHF A;  3UA7 A;  8AT1 B;  3BW1 A;  1Q82 U;  2P4T A;  3QXE B;  4WTO B;  2FEI A;  1JO8 A;  2FL7 A;  3RES A;  5M9O A;  3VS2 A;  2DXU A;  1D1C A;  2KRN A;  4C8Q A;  4A54 A;  2KVQ G;  2EGE A;  2HKN A;  4M78 F;  4FW1 A;  1OPL A;  2RHU A;  3BY7 A;  2OTL A;  1OQK A;  2DF6 A;  5KYY B;  5GAN 6;  2C0T A;  5AT1 B;  3QWY A;  1OX9 A;  3CCM A;  4JUV A;  1GFC A;  1W6X A;  3CCM Q;  4L6V 5;  1W1F A;  2RPN A;  4E47 A;  3CCU A;  2FZG B;  2WSF E;  1RAI B;  2J05 A;  2K6D A;  2IIM A;  3FDR A;  2DL8 A;  3EFS A;  2BE9 B;  3CCU Q;  2KXD A;  2QDY B;  2JTE A;  5FWB A;  1IZ6 A;  1VQP Q;  5I22 A;  1WHM A;  2QEX A;  4PJJ A;  3UT1 A;  1VQN A;  1BCM A;  2M1H A;  1TS9 A;  1QP2 A;  1K9M C;  2ESW A;  2QEX Q;  3JB9 G;  1WJS A;  4M7D B;  1AD5 A;  1M1K R;  2VGN A;  4PJO C;  4ELZ C;  2XD0 A;  4EPC A;  1JXM A;  3OBW A;  2EJG A;  3CQT A;  3I55 Q;  1KFZ A;  2ED0 A;  3JB9 J;  4Y28 E;  4VUB A;  1N8R U;  3TSZ A;  1VQ6 T;  3OYI A;  4PJO A;  5KCH A;  3S3O A;  1YJN T;  2DZ9 A;  2YHT A;  3MEV A;  5KCO A;  1G3T A;  1SG5 A;  2JUF A;  3L42 A;  2HAX A;  4FSS A;  1RLQ C;  1G83 A;  3NTI A;  2X4Y A;  2E5Q A;  1ZQ1 A;  4HT8 A;  4C92 G;  3CCQ Q;  4LDX A;  4V2S A;  2X3W D;  1QVG P;  1LNX A;  3GIB A;  1H64 1;  5KYN A;  2HSE B;  1WA7 A;  4PFZ A;  3HHT B;  2VUB A;  1VQL Q;  4RTU A;  3MPU B;  3HSB A;  3MO8 A;  4JRK A;  2DET A;  2A3L A;  4BE0 A;  3MEA A;  2A36 A;  4J9F A;  2PZ1 A;  2W0Z A;  4BUG A;  2AK5 A;  3CXC S;  3VYH B;  3RER A;  1HD3 A;  1SRM A;  1ZSZ B;  3D7S B;  3INZ A;  1YFN A;  2QK0 A;  3H0F A;  5IHK A;  2P0P A;  2HL3 A;  2EGA A;  2H8H A;  5KYY A;  4RTV A;  4C5H A;  1UJY A;  3M54 A;  3JB9 D;  4F7U A;  4FL6 A;  2CZ6 B;  1GBQ A;  5FU6 B;  1X69 A;  3C94 A;  4ORZ A;  4M7A E;  4E7L A;  2PU9 B;  3QJY A;  3S3N A;  1PRM C;  3UF4 A;  1B7T A;  4IIO A;  1PHT A;  4DBF A;  1JBM A;  2OJ2 A;  1WJQ A;  3TCJ A;  1VA7 A;  4M7D C;  2L3Q A;  2QAS A;  4OML A;  1NYG A;  2C0O A;  4J9E A;  4O5V A;  3DB4 A;  2ZPH B;  2YSQ A;  2RQU A;  1VOM A;  3CCS T;  4J9B A;  2GTO A;  4CC4 B;  2COW A;  2NLU A;  3CD6 A;  3RMQ A;  3JCM X;  3JCM Q;  2FRY A;  4MML A;  5KYW B;  3RMS A;  1T0H A;  4BE1 A;  5GAO m;  1OZ3 A;  1VQK A;  4C92 D;  4R55 A;  3CD6 Q;  2QA4 A;  2KT1 A;  4M7D E;  3NTK A;  4N4I A;  4OMO A;  1NJI C;  1GL5 A;  1VQK Q;  3HP9 A;  2K57 A;  2DBK A;  2SEM A;  4OVA A;  3JB9 F;  1ZBJ A;  2OTJ T;  3RBB B;  3EGU A;  3I5R A;  1X01 A;  1I4K 1;  5GAN 3;  1Q82 C;  4A63 B;  2JT4 A;  1M8M A;  3QYH B;  3VS4 A;  1MNE A;  2LDM A;  2RHZ A;  4HXJ A;  5GJV B;  1D1A A;  1MMN A;  2CH4 A;  1N9S A;  1UEB A;  3CCJ T;  1GCQ C;  1Q7Y C;  3PVQ A;  3OW2 S;  4E7S A;  4RCC A;  5GAO n;  4JRI A;  4Z88 A;  4C8Q G;  3VJP A;  1RI0 A;  5GAN f;  1O75 A;  4EIK A;  3V7C A;  1BBZ A;  3GPL A;  1M3A A;  1ZSZ C;  1GCQ A;  5L8R E;  1SKU B;  2DKG A;  2DEU A;  4X34 A;  1WXU A;  3QHS A;  2V26 A;  3CCR A;  3M55 A;  2FZC B;  2DFU A;  3R6N A;  3VS0 A;  1WPY A;  1JEG A;  3CCR Q;  4GLM A;  1VYV A;  1FMV A;  2K5F A;  1HK9 A;  1WHJ A;  2A28 A;  4KGX B;  3A5Z B;  3QG1 A;  4PLI A;  5FU6 C;  2BIV A;  3CPW S;  1MND A;  4JLG A;  2EVR A;  2YWW A;  2RHI A;  1GCP A;  3ME9 A;  1N8R C;  1VQ8 A;  1AWW A;  3EHR A;  2CSQ A;  1OZ2 A;  2F2X A;  1SEM A;  2Y4X A;  3DLL A;  4FYW B;  2VGM A;  3CME A;  5GAO l;  4JRP A;  4GBQ A;  2L3P A;  1K73 C;  1IHW A;  1N8R R;  5LJ5 g;  5LJ3 f;  3JCM P;  1W2B P;  5CKD A;  4QQ6 A;  2JXB A;  3UAT A;  4PJO G;  2O9S A;  2VVK A;  4BDZ A;  2ZAE A;  3KUF A;  3L2V A;  1SRL A;  2DIQ A;  2E70 A;  1SF9 A;  3OYH A;  4F14 A;  3CCV T;  4QW2 A;  4LD6 A;  4AFZ C;  1YJW A;  5KYW A;  3SFM A;  2MPX C;  2MF2 A;  3ULR B;  2D0N A;  1K8A C;  4LD9 K;  1YJ9 A;  1RAF B;  3JCM b;  3CC7 A;  2BUD A;  4KH1 B;  3WXM B;  1I1J A;  1YJ9 Q;  4JZ4 A;  2D6F A;  2R5A A;  2QYZ A;  3QO3 A;  1LVK A;  4J7I A;  2A37 A;  5HK3 A;  1WXT A;  4XK8 E;  4LE9 A;  5D7U A;  3L2U A;  1WXB A;  4N0A C;  4BI4 A;  5HK0 A;  2HQH A;  1RAA B;  1M1G A;  2DRK A;  2NYS A;  4TVR A;  3BE3 A;  5EG2 A;  2F5K A;  2KY9 A;  1ZLM A;  2V8K A;  3VUB A;  1VQ4 Q;  3URG A;  1AEY A;  5IXB A;  1YHQ T;  1FMK A;  4M77 B;  1ABO A;  3OSS C;  2JZ2 A;  1WHK A;  3M0R A;  2M16 A;  2NUZ A;  1BCO A;  4RCB A;  1FXX A;  2KQW A;  3M5A A;  2RI5 A;  2O88 A;  4O6J A;  3A8M B;  1NPP A;  5IAY A;  1GRI A;  4PJL A;  4A4K A;  1VQM T;  2VKN A;  3QPH A;  3I5S A;  1E7O A;  3MET A;  4ANJ A;  4AFU C;  3CC2 A;  3VKI A;  1VQ5 T;  1JRI A;  1PSF A;  2CP7 A;  2F2V A;  2DER A;  4HCB A;  1BIA A;  2E4H A;  4XQ3 A;  2L3S A;  2CT4 A;  1YCY A;  1UJ0 A;  3V8L A;  2AIR B;  3CMA Q;  2DL7 A;  4M7D G;  1YIJ Q;  2DD4 A;  4LDU A;  2DA9 A;  2ZGW A;  3HKS A;  1G3Y A;  4E2F B;  4PK4 A;  2EQU A;  3RIR A;  3CXC P;  1X6B A;  1T3S A;  2FRW A;  3M0Q A;  5FRN A;  1KQ2 A;  1QP3 A;  3M0P A;  1QWF A;  2GGR A;  4J83 A;  1KD1 R;  5GMK m;  1VQ7 T;  3EFO B;  2AHJ B;  3QWX X;  1D0Y A;  2QI2 A;  3C12 A;  3FC3 A;  3TVT A;  2DTI A;  2LQK A;  3KBG A;  2KR3 A;  4C0G A;  1KHI A;  2X3X D;  2EQI A;  2EKO A;  1PSE A;  2CS7 A;  2QGG A;  1WFW A;  1I8F A;  2M0Y A;  3EFR A;  2CRE A;  2RK2 A;  3J7A F;  2CZ7 B;  2LCC A;  2GBQ A;  2EIF A;  4MZT A;  5GAN 8;  3CPF A;  5GMK h;  1B34 B;  5CQY A;  3M56 A;  3CPW A;  4M7A D;  3A8H B;  1T0J A;  5HCK A;  1U1T A;  5I2M A;  3I56 A;  2DL3 A;  5GMK i;  2DD5 A;  1KK7 A;  4OGE A;  3VRY A;  3OYK A;  1HJD A;  3I56 Q;  4DQ2 A;  2OTL T;  4M77 C;  1M5Q 1;  2MYS A;  3WVE B;  1OYX A;  4DEY A;  3MHX A;  3CCM T;  3GOX A;  2ABL A;  3OYE A;  4QKU A;  1VUB A;  1QKX A;  2HSP A;  4M77 A;  3CCU T;  1BK2 A;  4EMH A;  2QG9 B;  2M51 A;  1W70 A;  1D0Z A;  2M02 A;  2F69 A;  1RAE B;  1CSK A;  3A8G B;  2CP0 A;  1K1Z A;  4BI3 A;  4HVU A;  4M7D D;  2QEX T;  1PC0 A;  1M1F A;  1VQN T;  4M77 E;  1QVG A;  2LNV A;  3OB9 A;  1UGS B;  3FRN A;  1U06 A;  3R6O A;  2RJC A;  2D1X A;  1D3B B;  4M75 F;  2QGF B;  3OS5 A;  4M7A F;  2E41 A;  1WJR A;  2BZY A;  2ZPE B;  5GMK l;  3A8O B;  4ME7 A;  4B9W A;  1NEB A;  1X2Q A;  2X51 A;  3MEU A;  4RKU E;  3CEY A;  5LJ5 d;  1PWT A;  3VS7 A;  4HCC A;  3SD4 A;  5GAO p;  4F7U B;  3KXT A;  3M4Y A;  5LJ5 h;  3OW2 P;  4C8Q E;  1WLP B;  2I0N A;  2R57 A;  2RJD A;  4Y92 A;  4OB2 B;  2LQW A;  2YUO A;  2EYW A;  1OX8 A;  4KRT A;  5GAM f;  1OPK A;  2X35 A;  1OU9 A;  1AVZ C;  1VQP A;  2YT6 A;  1ZX6 A;  4M78 B;  3HRT A;  4N4H A;  1EIF A;  4DOV A;  3NPF A;  4OMP A;  4ZGE B;  2RI2 A;  4WCI A;  2BE7 D;  3GNG A;  1M1K C;  2J7I A;  5GAN g;  1G8X A;  3PMT A;  2AZV A;  1TWB A;  4XTW A;  2M9U A;  5HY6 A;  1CKA A;  4F17 A;  4QVD A;  3EFO A;  3FLG A; 
#chains in the Genus database with same CATH homology
 2EYY A;  2KT8 A;  2YSQ A;  2LJ0 A;  3I9Q A;  4JPB W;  1G2B A;  1Z9Q A;  2RQU A;  2BZX A;  4J9I A;  2AKL A;  4J9B A;  2GTO A;  4CC4 B;  1QLY A;  4M4Z A;  2CSI A;  4DEX A;  2FRY A;  1T0H A;  1ZUU A;  4LUD A;  5ECA A;  4JJB A;  2DVJ A;  5L23 A;  2KT1 A;  1ZUK A;  4J9H A;  2K9G A;  1UTI A;  2O31 A;  4OMO A;  4QT7 A;  1GL5 A;  1M3B A;  2DX1 A;  4J9G A;  2SEM A;  2DBK A;  1VYU A;  1ZBJ A;  3C0C A;  3TSW A;  3RBB B;  1ZSG A;  1TUD A;  3EGU A;  4CC2 A;  1JXO A;  3I5R A;  4A63 B;  1PRL C;  2JT4 A;  3LH5 A;  1M8M A;  3H0H A;  1ARK A;  2JMC A;  4JJD A;  3SEM A;  3VS4 A;  1PKT A;  1X43 A;  3EG0 A;  1K4U S;  4HXJ A;  5GJV B;  1S1N A;  2O2O A;  4CC3 A;  2CH4 A;  3GBQ A;  4HVW A;  4OMM A;  2D8H A;  1GCQ C;  2YUN A;  3PVQ A;  1UHF A;  4HVV A;  2DIL A;  2HCK A;  5IH2 A;  1K9A A;  4Z88 A;  2DMO A;  1U3O A;  1KSW A;  4Z89 A;  4EIK A;  1BBZ A;  2DL5 A;  1VYT A;  1M3A A;  1GCQ A;  2RQV A;  2J6O A;  1WXU A;  2J6K A;  1M27 C;  2JW4 A;  2EKH A;  1RUW A;  4IIM A;  3R6N A;  2YUP A;  3REB B;  3VS0 A;  2YDL A;  2JM9 A;  2FPD A;  2CDT A;  2YUQ A;  1UG1 A;  1JEG A;  4GLM A;  5IXF A;  1VYV A;  3U23 A;  3O5Z A;  4OMQ A;  2C0I A;  5FW9 A;  2A28 A;  3M0S A;  3VS6 A;  2GNC A;  1QWE A;  1YWP A;  2D8J A;  2EVR A;  3REA B;  1GCP A;  4D8D A;  1AWW A;  3EHR A;  2CSQ A;  2EGC A;  2F2X A;  1SEM A;  4LUE A;  1K0S A;  1YCS B;  1NLO C;  1GFD A;  4AG2 C;  4D8K A;  4LNP A;  4GBQ A;  3UA6 A;  2L3P A;  4AFQ C;  1TUC A;  2HDA A;  4OMN A;  1AWJ A;  1H8K A;  5FWC A;  1BU1 A;  2JXB A;  2K7A A;  3UAT A;  3THK A;  1FYN A;  2CH4 W;  2OI3 A;  4J9D A;  5I11 A;  1KIK A;  2O9S A;  2VVK A;  2A08 A;  1YN8 A;  1BB9 A;  1M3C A;  1SRL A;  1N5Z A;  4AG1 C;  3PVL A;  1I0C A;  1T3L A;  5GJW B;  3PE0 A;  4F14 A;  4JJC A;  2KNB B;  3EHQ A;  4RTW A;  4AFZ C;  1UHC A;  1YWO A;  2DRM A;  2FPE A;  3SHW A;  2KRO A;  1RI9 A;  2LNH B;  3ULR B;  4RTX A;  2DBM A;  2HEQ A;  3H0I A;  2DLP A;  2D0N A;  2RMO A;  1H92 A;  4ZNX A;  2JS2 A;  2LJ3 A;  2GTJ A;  4K11 A;  1I1J A;  4JZ4 A;  1EFN A;  2ENM A;  2RF0 A;  1UUE A;  2ED1 A;  1QKW A;  3RNJ A;  1K0X A;  2A37 A;  2V1R A;  1WXT A;  1UEC A;  3NGP A;  4LE9 A;  1A0N B;  1WXB A;  1SPK A;  1UFF A;  1ZUY A;  4F16 A;  1GBR A;  4CC7 A;  1B3Q A;  2DYB A;  4X1V A;  2K79 A;  3H41 A;  2DRK A;  2J6F A;  1WI7 A;  1ZLM A;  2EBP A;  4RUG A;  5EC7 A;  2P4R A;  4RTT A;  1AEY A;  5IXB A;  1X6G A;  1FMK A;  1QCF A;  2JS0 A;  1ABO A;  1AOJ A;  1X27 A;  1UGV A;  2B86 A;  1YP5 A;  2AKK A;  2KXC A;  1UDL A;  3M0R A;  2NUZ A;  1Y57 A;  1Y0M A;  1SHG A;  1ABQ A;  2KRM A;  1NM7 A;  2QDL A;  2AZS A;  2O88 A;  1CKB A;  4LN2 A;  2PTK A;  1GRI A;  2K3B A;  2KBT A;  2E5K A;  2VKN A;  1NEG A;  2ECZ A;  2CT3 A;  3I5S A;  1E7O A;  3VS3 A;  1AZE A;  1YNZ A;  3M0T A;  4AFU C;  2DL4 A;  2L0A A;  3NMZ C;  1I07 A;  3KFV A;  1SHF A;  3UA7 A;  2V1Q A;  1K76 A;  2F2V A;  2FEI A;  1JO8 A;  3VS2 A;  1OV3 A;  2KRN A;  1NYF A;  2LQN A;  2W10 A;  4RTZ A;  2EGE A;  1OPL A;  3VRZ A;  1HSQ A;  1M30 A;  2L3S A;  2DF6 A;  2CT4 A;  3VS1 A;  2C0T A;  1J3T A;  2LJ1 A;  1UJ0 A;  1WX6 A;  2DL7 A;  3M0U A;  3QWY A;  2DJQ A;  1B07 A;  1SSH A;  1GFC A;  2DA9 A;  2PNI A;  2KYB A;  1JQQ A;  1W6X A;  3IQL A;  2FG0 A;  1W1F A;  2RPN A;  4HCK A;  2J05 A;  2MIO A;  2K6D A;  3I35 A;  2FO0 A;  2HBW A;  1X6B A;  1T3S A;  2FRW A;  2IIM A;  2XMF A;  3M0Q A;  2DL8 A;  3M0P A;  2KXD A;  1QWF A;  2GGR A;  1OEB A;  2JTE A;  5FWB A;  5I22 A;  1WYX A;  4Z8A A;  1PKS A;  1UE9 A;  3QWX X;  1H3H A;  1NG2 A;  2ESW A;  1JU5 C;  3ZL7 C;  1AD5 A;  3TVT A;  2LX7 A;  2KGT A;  2KR3 A;  1JXM A;  2MOX A;  2X3X D;  2EQI A;  3CQT A;  1MUZ A;  2KRS A;  1KFZ A;  2ED0 A;  1WFW A;  2JM8 A;  2RQW A;  2M0Y A;  1KJW A;  2CRE A;  2ROT A;  2KYM A;  3TSZ A;  2GBQ A;  2GQI A;  1AWX A;  1MV0 B;  1T0J A;  5HCK A;  1PNJ A;  2KE9 A;  2JMA A;  2DL3 A;  2LCS A;  1XOV A;  2NWM A;  2F2W A;  3VRY A;  3EG2 A;  2EYX A;  1HJD A;  2VWF A;  4RTY A;  4FSS A;  1RLQ C;  1RLP C;  1G83 A;  4DEY A;  1OOT A;  1TG0 A;  2ABL A;  3NHN A;  2CUB A;  2RQT A;  2EW3 A;  1QKX A;  4J9C A;  2HSP A;  2LZ6 B;  1BK2 A;  2X3W D;  2DNU A;  4AFS C;  2M51 A;  1W70 A;  2KEA A;  1AZG B;  1MV3 A;  1CSK A;  1WIE A;  3EG1 A;  1WA7 A;  1K1Z A;  4HVU A;  2SRC A;  4RTU A;  2CUD A;  2O9V A;  2J06 A;  3EG3 A;  2A36 A;  4J9F A;  2PZ1 A;  2OAW A;  2W0Z A;  2AK5 A;  1U06 A;  1U5S A;  1LCK A;  2D1X A;  2RNA A;  1IO6 A;  1HD3 A;  1SRM A;  2G6F X;  2LMJ A;  2BZY A;  1V1C A;  4R0K A;  4JZ3 A;  1X2K A;  1NEB A;  1X2Q A;  2BZ8 A;  3H0F A;  1PWT A;  3VS7 A;  5IHK A;  2EGA A;  2ROL A;  2H8H A;  2EYZ A;  4RTV A;  1UJY A;  2LP5 A;  1WLP B;  2DE0 X;  2FPF A;  1E6H A;  2I0N A;  2L2P A;  4Y92 A;  3A98 A;  4ESR A;  2LQW A;  2MCN A;  1GBQ A;  2YUO A;  1X69 A;  4ORZ A;  2EYW A;  4KRT A;  1OPK A;  4E6R A;  1AVZ C;  5IHI A;  2K2M A;  2YT6 A;  1ZX6 A;  1WDX A;  1PRM C;  3UF4 A;  1AWO A;  3NPF A;  4OMP A;  1E6G A;  4IIO A;  1PHT A;  4WCI A;  2OJ2 A;  1VA7 A;  3FJ5 A;  2RQR A;  2J7I A;  2EPD A;  3JV3 A;  3VS5 A;  2L3Q A;  2AZV A;  5IHN A;  2BTT A;  1CKA A;  1NLP C;  4F17 A;  2RN8 A;  2DM1 A;  4OML A;  1NYG A;  1Z9Z A;  2C0O A;  4J9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...