1AWOA

The solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
SLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE
publication title The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 4
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awoA00
4DEXA 2K3BA 2JXBA 1N5ZA 2JM9A 3VRYA 2AKKA 2ROTA 1I07A 4ZNXA 1X6BA 4CC4B 2KT8A 1ZX6A 2LZ6B 2CSIA 2EKHA 2OAWA 3VS4A 2KYBA 2YDLA 1YNZA 2A08A 4F16A 1WI7A 2KRMA 2J7IA 3VS5A 3THKA 3QWXX 2KYMA 2YT6A 1W1FA 2AZVA 1OPKA 4JJBA 1SEMA 2ENMA 2L3PA 2LQWA 4JPBW 1FYNA 1GRIA 1PWTA 1AWWA 4OMNA 1YWOA 2FG0A 2JM8A 2OI3A 1ZUYA 1UG1A 1E6GA 2HEQA 2DL7A 2A37A 2RQUA 5IHIA 1JU5C 3U23A 1K4US 2M0YA 2EW3A 2H8HA 5IHNA 2RN8A 4Z89A 2K2MA 1YP5A 1BB9A 1JO8A 2CUBA 1RI9A 2KBTA 2KNBB 4RTWA 1X69A 1PNJA 2DRKA 2DBMA 2DRMA 2CT3A 1A0NB 5I22A 2O88A 2AKLA 4LUEA 2F2XA 2JS0A 1CKAA 2BZXA 2DA9A 3EG1A 2LP5A 4LN2A 1G2BA 4LE9A 1UECA 1RLPC 1TUDA 3NMZC 5I11A 2G6FX 1NLPC 4HVWA 1J3TA 2JW4A 1QWFA 2PTKA 4A63B 1UFFA 1WA7A 4J9IA 2PNIA 1I0CA 1KSWA 1I1JA 2KXCA 2KXDA 4LNPA 2MOXA 1VYUA 2D1XA 2CSQA 4F14A 4FSSA 2FRWA 4R0KA 2CUDA 2K79A 1WX6A 1T3LA 2L3SA 1BU1A 1OPLA 4RUGA 3PE0A 1KIKA 3EG3A 5HCKA 4EIKA 1PRMC 2GBQA 1TUCA 3FJ5A 1WIEA 4RTUA 2W0ZA 1YN8A 3EHQA 4DEYA 2VWFA 1ZLMA 3I5RA 1GCPA 1T3SA 1X43A 2LJ1A 1UJ0A 2J06A 1OV3A 1X27A 5IXBA 1E6HA 4RTZA 2DNUA 3PVLA 3UF4A 1YWPA 1M8MA 2KEAA 4Z88A 2QDLA 3QWYA 1AZEA 3H0IA 2X3XD 3M0RA 3ULRB 3CQTA 2DILA 3I9QA 4J9FA 1PHTA 2KR3A 3SEMA 1AOJA 3NHNA 3EG2A 2ED1A 1B07A 2O2OA 1PKSA 1X2QA 1H3HA 2O9VA 1JEGA 5L23A 2M51A 2PZ1A 4KRTA 4HCKA 3M0TA 1MV3A 1YCSB 2C0TA 2KROA 1Z9QA 3EG0A 1SPKA 1U3OA 1M30A 3VS2A 4D8KA 2F2WA 5GJWB 2YUNA 2C0IA 2IIMA 4E6RA 1ABOA 1UJYA 3M0UA 3NPFA 1K1ZA 2EGAA 1WYXA 2YUPA 5EC7A 1GFDA 4M4ZA 2RQRA 3M0SA 3TVTA 1QLYA 4J9HA 2EYXA 4JJDA 1K9AA 2W10A 4OMOA 3M0PA 1SRMA 3H41A 2DVJA 4Z8AA 2K9GA 1RUWA 2RQVA 2V1QA 2D8JA 1NG2A 3O5ZA 1WDXA 1K0SA 4RTXA 3TSWA 2L0AA 1AD5A 1UDLA 5FW9A 1JXOA 2CT4A 3JV3A 1FMKA 4RTVA 4IIMA 1U06A 2JS2A 1QKWA 2DBKA 2NUZA 2DLPA 4JZ4A 1ZSGA 2XMFA 1HD3A 1OOTA 2D0NA 3RBBB 2GTOA 2DM1A 2V1RA 3VS0A 1V1CA 5FWBA 1QKXA 2ED0A 4J9DA 2EYWA 2FO0A 3H0FA 1JQQA 1X2KA 1MV0B 1NM7A 4JZ3A 5IXFA 4QT7A 4LUDA 1CSKA 2LJ3A 2EQIA 4AFSC 2ABLA 4J9BA 2YUQA 1PKTA 3RNJA 2F2VA 2RNAA 3VRZA 1GBRA 3UA7A 4IIOA 1ZBJA 2DJQA 2ROLA 1GBQA 2DE0X 3R6NA 2FPEA 2KE9A 2J6KA 2FPDA 1NLOC 1RLQC 2BZ8A 2YSQA 1GCQA 3REAB 2C0OA 1CKBA 2JMAA 1LCKA 2CDTA 3UATA 2OJ2A 4HVUA 1GL5A 2DMOA 2JTEA 1ARKA 1GFCA 1M3BA 2J6OA 2RF0A 1NEBA 1HSQA 1W70A 2DYBA 2LCSA 2LX7A 1B3QA 3I5SA 4RTTA 2VKNA 4CC3A 1JXMA 4AFZC 2EYYA 3KFVA 3ZL7C 1KJWA 2X3WD 4JJCA 2HBWA 2DX1A 2SRCA 2RMOA 3VS6A 2RQTA 1WLPB 4X1VA 1QCFA 1IO6A 2SEMA 3NGPA 3LH5A 2EPDA 2GTJA 4GLMA 1AZGB 2P4RA 1E7OA 2EVRA 1UGVA 4J9CA 4F17A 2BZYA 1EFNA 2L2PA 2KRSA 2EYZA 2MIOA 3VS1A 2NWMA 4J9EA 2JMCA 2FEIA 2AZSA 4K11A 3C0CA 2YUOA 2AK5A 4J9GA 2DL3A 2RQWA 3TSZA 1SSHA 1H92A 1S1NA 2BTTA 3PVQA 1UHCA 2KRNA 3H0HA 1AWOA 1WXTA 1AWXA 2GQIA 1AWJA 1WXUA 2K6DA 1TG0A 2HCKA 2A36A 4AG2C 1KFZA 3REBB 1Y0MA 2FRYA 1H8KA 2CH4W 2CH4A 3GBQA 1M27C 1AEYA 2I0NA 2EBPA 2GGRA 4HXJA 1K0XA 3EGUA 1SHGA 2KGTA 1UTIA 2LQNA 1VA7A 2L3QA 2DL8A 4WCIA 4CC7A 2O9SA 1BBZA 1WFWA 2CREA 2HDAA 4D8DA 3EHRA 1NEGA 2A28A 4AFUC 2ECZA 3VS7A 4ORZA 3SHWA 2LMJA 2MCNA 2HSPA 4ESRA 4OMMA 1NYFA 4AG1C 2VVKA 2K7AA 1AVZC 2DL5A 3A98A 3UA6A 1Y57A 1K76A 1VYTA 1U5SA 2LNHB 2FPFA 2B86A 1BK2A 5FWCA 4AFQC 3VS3A 1ZUKA 1M3AA 2O31A 4OMPA 5IHKA 2DF6A 2LJ0A 1SRLA 2EGEA 2J05A 1HJDA 1T0JA 2DL4A 4RTYA 4CC2A 3M0QA 4OMQA 1OEBA 4HVVA 4Y92A 1T0HA 2KT1A 1QWEA 1PRLC 1GCQC 2RPNA 2GNCA 1UHFA 1XOVA 2D8HA 5ECAA 4GBQA 1ABQA 3I35A 1ZUUA 2E5KA 1WXBA 1UE9A 1VYVA 2JT4A 1M3CA 1Z9ZA 5GJVB 2EGCA 1SHFA 4OMLA 2ESWA 3IQLA 5IH2A 1W6XA 1X6GA 1MUZA 1NYGA 2J6FA 1G83A 1UUEA
chains in the Genus database with same CATH superfamily
5D6YA 2DYIA 2YWWA 4DEXA 4ME7A 5KYUB 4JS5A 2K3BA 1G5VA 1N5ZA 2E3HA 5HKCA 2AKKA 1FMVA 4KULA 2D6FA 1ZSZC 3EFOA 2OTLQ 1I5OB 4OF1A 2KT8A 4E7KA 1ZX6A 2DEQA 1Y96B 1Q82R 2PUOB 1YBYA 2EKHA 1YFNA 5A0DA 1AT1B 2M16A 2KYBA 3CPWP 4C92E 2PQWA 4KH0B 2J7IA 5C6SA 3RKWA 4BE2A 2XDPA 1W1FA 1SEMA 2L3PA 2K4YA 2LQWA 5GAOm 1FYNA 1PWTA 1AWWA 3EGXA 2FG0A 5GMKl 2DL7A 1XQHA 2EQMA 3QBYA 4C8QC 3PIPA 5IHIA 2DVEA 3F70A 2M0YA 1K73C 3EG9B 1UGSB 2E41A 3LWHA 5IHNA 3RESA 3MPUB 5IT9E 2KVQG 1BB9A 1D1CA 4M78F 2KBTA 4A4FA 3FDRA 1PNJA 2QG9B 3EFOB 4MMLA 2X51A 2DTOA 1YJWQ 1QP2A 3OYDA 4PJOD 3VUBA 2F2XA 1VQLQ 1CKAA 2BZXA 3OS2A 2LP5A 1RLPC 4HVWA 1J3TA 1QWFA 2PTKA 2HBPA 2QA4A 1UFFA 1WA7A 4J9IA 2KQWA 3PNWC 4JUVA 2CP7A 2QQ9A 1VYUA 3QUIA 1TU0B 4F14A 5CQYA 4FSSA 4M7DA 3EGXB 4J83A 1U1SA 2K79A 4N0AA 3A8OB 3V8LA 1VQ7A 3X20B 2K2VA 2HMAA 1N6AA 2GBQA 1TUCA 3MJXA 5CVIA 1VQKT 1WIEA 2ATCB 1NJIC 1EZZB 1YN8A 2YLBA 2RHUA 1TOVA 2LTOA 2HKNA 3I5RA 5CKHA 2HL3A 2LQKA 4AT1B 3L2UA 2J06A 1EX4A 3AHUA 2CP6A 1E6HA 1Q86C 3PVLA 3A8MB 2X35A 1M8MA 3I55A 2QDLA 3P8BB 3UPUA 2DILA 1PHTA 1K73U 3JCMc 3NHNA 3EG2A 2ED1A 1B07A 1G3TA 2WSFE 3JB9I 1X2QA 1BYMA 2M51A 4Q5WA 4HCKA 1RI0A 4M75C 1X75C 4E7JA 2C0TA 2CKKA 4M7DF 1SF9A 1FWZA 2L3RA 3EG0A 2YRDA 2RO0A 4XTXA 3VS2A 2XG8D 2YUNA 4E6RA 1ABOA 2CZ0B 3OYLA 5HK3A 2YUPA 5EC7A 1GFDA 3M0SA 1QLYA 4BE1A 3G4ST 3DLLA 3CMAA 3EGDB 2VC8A 4OMOA 3H41A 2CZ7B 2JTFA 2DVJA 4EMKA 3J80E 2DPPB 1YITA 3N5BB 1YI2Q 5L8RE 1M2OA 2D8JA 2L0AA 1NJIU 1UDLA 1Y07A 1JXOA 3JV3A 3OYJA 3CPWA 1FMKA 4RTVA 4PFZA 4WF2A 5GAOr 1YJNA 3QZ9B 3QZ5B 4C92A 5GANg 4IKFA 5I2SA 1IHVA 2QTVA 2V1RA 3JCMf 3VS0A 1Q86U 2ED0A 4C8QD 1VQKA 3CC4Q 5GAN6 2K57A 5D6XA 4M7AF 2FYKA 2LVMA 5A0LA 3CXCP 3RKXA 2XHCA 1FMWA 2V8KA 2HD0A 1PCXA 1VQOA 2YUQA 4QQDA 4E47A 2JOYA 4EMKB 1GBQA 2J6KA 1RLQC 3QDFA 3H8ZA 2COZA 5GAN7 1ZHIA 4PFPA 4JRKA 4BB7A 5GAN4 2JMAA 3CC7A 4C92G 1BIBA 4M75E 2X4JA 4HVUA 4C92B 2DMOA 3HSBA 2M02A 1PC0A 1M3BA 4C5HA 2AIRB 1MMNA 2RF0A 2DZCA 1NEBA 1HSQA 4A53A 1KQ2A 3I5SA 4LXCA 1JXMA 4AFZC 4J8OA 4LDUA 4OGCA 2X3WD 1ZSZA 2A3LA 2CP5A 2XD0A 4A4GA 1ACMB 3CCLQ 2HKQB 3CCSQ 4C0FA 2EFIA 3CCQQ 3LH5A 1BI3A 2GTJA 2I2LA 1D0ZA 1AZGB 3L42A 3GPLA 1E7OA 3G6EQ 2JVVA 1NPPA 3MKDA 1VQ8Q 2L2PA 1WHLA 1N8RC 2EYZA 2F1LA 2MIOA 1BCMA 3LH0A 4J9EA 1QCNA 2KDSA 1KQSA 2KAFA 3JB9D 3C0CA 1V76A 2YRVA 1Q7YR 4J9GA 2QQAA 5GANh 4QQ6A 5J3BA 3TSZA 1YIJA 2XKOC 1LJOA 2LX9A 5A2QE 2BTTA 3HRSA 2GQIA 5AT1B 1ZSZB 1XTDA 3REBB 1Y0MA 2FRYA 3CCVA 2WSCE 1IGUA 4BY6C 2YLCA 1M1KR 4HXJA 1K0XA 1LPLA 1YJ9Q 4L6V5 2V8JA 2ZCFB 4XU3A 4CC7A 2O9SA 1MHNA 3CD6Q 2HDAA 4D8DA 3MEWA 4QVDA 1NEGA 2A28A 2MWPA 2ECZA 5KYWA 3LWIA 3VS7A 4ORZA 2XI9A 3CCEA 4M77C 4NL3A 3G71T 4ESRA 4C8QG 2P0KA 1HXDA 1N9SA 4AG1C 4C8QB 2VVKA 2YXYA 2QGFB 2DL5A 2F5KA 1K76A 3GNGA 2NLUA 5GMKi 1RAEB 2DD4A 3DB3A 3HPWA 2E5QA 1WHMA 1N8RU 4PKCC 1FXXA 2HQEA 1JJ2P 4PLIA 2RI2A 3CXCA 4LDVA 3M55A 2VXEA 4IUPA 1SRLA 2G3RA 3FEOA 1WJRA 1HJDA 1T0JA 4TVRA 4CC2A 1TS9A 4FT2A 4ATOA 4OMQA 4BACA 5LJ5e 4MZPA 2KMTA 3J81E 1UHFA 5ECAA 5KYWB 3I35A 3GLXA 5HY6A 4LDXA 2R58A 2VGMA 1M3CA 1I81A 1Z9ZA 3JCMP 2VYTA 1SHFA 5FLXE 3IQLA 3OS0A 5IH2A 1W6XA 5LJ5d 3CCRT 1X6GA 1MUZA 1NYGA 3M53A 5CAIA 4Z02A 1SSFA 1KJWA 1G83A 4XTYA 5GMKh 4FIBA 5LJ3e 4A4HA 2JXBA 3JSCA 2JJ9A 3ZFJA 3HL8A 4XTWA 3VU3C 4XAXB 3OBWA 1I07A 1WJSA 1X6BA 4LDWA 1VQNT 1KQSS 2RK1A 2LZ6B 1RADB 3FJPA 2OAWA 5LJ3d 2ZPEB 5FU6C 4Y91A 1WI7A 3JB9G 1QVGP 3VS5A 4M75G 3QWXX 3G71A 1BIAA 4IURA 2KYMA 1Q95G 2YT6A 1OPKA 1TUGB 4M75B 4B9WA 2ZGWA 1YWOA 3ER0A 5FU7C 1IB8A 1ZUYA 2RB6A 4OB0B 4D6WA 3QIIA 2R57A 4N4IA 4PJOC 2AHJB 1Y71A 2WACA 2OTJA 3EFSA 1WJQA 1YP5A 4M78D 3I56T 3RIRA 1R77A 4AMCA 4BDYA 1YHQA 1WPYA 2DRMA 2CT3A 3M4YA 2AKLA 2QGGA 3JRZA 4HCCA 5DY9A 3SD4A 3P8HA 3CC2T 1KD1C 1OX9A 5DM7R 3NMZC 2G6FX 2DTIA 2JW4A 3BFMA 1VQ5T 2E10A 1I1JA 2KXCA 4M77D 1N27A 2D9TA 1VQMA 3E9GA 4R0KA 1WX6A 1BU1A 3PE0A 3CCRA 3EG3A 5HCKA 2QEXQ 4MDXA 1PRMC 5GAMe 3FJ5A 3CMEA 4FYVB 2VWFA 4X9CA 1ZLMA 1OULA 1X43A 3SWNC 3T9NA 4NOYA 1OV3A 4HA8A 1X27A 4A4KA 1JJ2A 2QA4Q 2DNUA 1X01A 1VQ4T 1S72A 4ZN3A 5GAMd 4Z88A 4RKUE 3Q1JA 2X3XD 3MEUA 3M0RA 2DKGA 3CEYA 3I9QA 2RK2A 5KE2A 1D1AA 4UC4A 3H9NA 1I5LA 1AOJA 1VQ6A 5GAOq 1PKSA 4PJNA 5DLOA 2O9VA 3X25B 4PJOE 1IZ6A 3QJ6A 1KC8C 1MV3A 2F5TX 3E1SA 1Z9QA 3JCMW 3CBOA 2QYZA 3M54A 3LGFA 3NTIA 4R55A 4D8KA 1UJYA 3M0UA 3NPFA 3I56A 1KD1U 1K1ZA 1K73R 3I55Q 2RQRA 3R6OA 3TVTA 4NL2A 1D0XA 4IUVA 2OTLT 2EYXA 4JJDA 3CCJQ 2DXBA 2W10A 1WHKA 4PNOA 1OZ3A 2K9GA 2XK0A 1WQWA 3SFMA 3WVEB 3MO8A 4C5IA 4XU2A 3HTRA 5CR2A 2VUBA 1M4ZA 1K9MC 1AD5A 2K5FA 3PFSA 1QKWA 2VXFA 4DBHA 4XU0A 3LLRA 1QVGA 4FT4A 2XMFA 3M57A 2D0NA 3OB9A 3J7AF 2MPXC 3KUFA 1OX8A 4PJLA 3CMAQ 1W4SA 4J9DA 3QXEB 3OYHA 5GAOp 4M7AD 1MV0B 3MCAB 2Y4XA 1YITQ 1JBMA 1NJIR 4F7UG 1YJWT 2ABLA 4FU6A 1VUBA 2P0QA 4F7UB 2BE7D 4BI3A 3RNJA 5CIUA 2RNAA 1VQLT 4BY6B 3UA7A 5KCHA 1YJNQ 1KC8U 2X4YA 2ROLA 2DE0X 4B6MA 1Q86R 2FPEA 2AT1B 2YSQA 2VGNA 3QG1A 4FYXB 1CKBA 2GQVA 4M77G 5KYYA 2CDTA 4J6WA 4M77B 4JLGA 5CKBA 2KK4A 2Y4YA 4DOWA 3EGDA 2EJFA 1Y7XA 1GFCA 3JCMJ 2J6OA 4RG2A 1VQOQ 1JJ2S 3OYCA 1I4K1 3OYBA 4RTTA 1WGSA 1DJ7B 1NBEB 2ZPBB 2HNIA 1OU8A 1K9MU 2OTLA 1RABB 3FIFA 4OB3B 4V2SA 3KFVA 5FRNA 2EJGA 3ZL7C 2RJCA 1KQSP 1WZOA 3LGLA 3CBPA 3CC7Q 2SRCA 4C8QE 3A8LB 4IUTA 3TQ7P 2E4HA 2P4RA 2QTXA 2BZYA 1IREB 5KYYB 2EYQA 2KRSA 3G1JA 2KY9A 3INZA 2JMCA 1RAGB 1FX7A 1UGRB 2EQUA 2FEIA 2K3XA 4GY5A 4BDZA 2RD1A 3ME9A 4K11A 2YUOA 2CP0A 2KSSA 2PUKB 4PJOA 1VIFA 2AK5A 2PVGB 2DL3A 1QW1A 4C0DC 5J39A 1S1NA 4B9XA 7AT1B 1UHCA 2KRNA 4BE0A 1YJWA 2X9HA 1WXTA 3TEEA 2E1HA 3GP8A 2K6DA 1VQLA 3O8VA 2A36A 1YI2T 3M58A 3A8GB 1H8KA 4RCBA 1QVGS 3GBQA 1M27C 1AEYA 2I0NA 2RA2A 5CKFA 3C4SA 1VA7A 2DL8A 5FU6B 3QDRB 9ATCB 2LT1A 2H3JA 1RL2A 1YIJQ 3VYHB 4J7IA 4C0GA 4MDWA 5FU7B 2HSPA 4OMMA 4LDYA 4PJOG 1NYFA 3PIOA 4PJOB 3CC4T 3UDCA 2K7AA 3A98A 1Y57A 4OGEA 4DOVA 1U5SA 3CBMA 1VQ9Q 2QQBA 3CCVQ 4C5GA 3DLMA 1BK2A 4EDUA 5FWCA 2COYA 4HT8A 3FC3A 2RHZA 4MZMA 1MGQA 2DERA 3QYGB 1X6OA 4C92F 2EGEA 4DA4A 2J05A 3G7ZA 3D7SB 2DL4A 4RTYA 3CCEQ 1U8RA 5LJ5f 3URGA 2HZYA 1OEBA 3JCMV 4Y92A 5GMKm 3L2ZA 1QWEA 1GCQC 2RPNA 2GNCA 3OQ5A 4KH1B 1XOVA 5D6WA 2LCLA 3RMQA 5GAN8 3G4SA 3JCMg 1ZUUA 1N8RR 3M4GA 5CO7A 1NPRA 1VYVA 2FZGB 2JT4A 3M5AA 3E9FA 4ZGEB 2BKDN 1PSEA 5IN1A 2EGCA 3X26B 3M56A 4E2FB 4RMOA 4BI8B 2ESWA 2P4TA 1KQ1A 1KHIA 5GANe 2D0QB 5LJ3f 4OP0A 3SWNB 1MMAA 1V29B 3TU4K 3CCLT 3VRYA 1MMGA 3CCST 3CCQT 1Q81C 2ROTA 4PLLA 3G6ET 3C95A 4ZNXA 4FSXA 2MK5A 1QVPA 4CC4B 4C8QA 1K8AC 1VQ8T 3NTHA 5GANd 3L2RA 2MF2A 3VS4A 1W2BA 1YNZA 1BI2A 1LVKA 2KRMA 4M78C 3KBGA 3THKA 2FZCB 2AZVA 1PD0A 2RJDA 3V8KA 2ENMA 4JPBW 3HHTB 3CC4A 1GRIA 1OI1A 5D7UA 5GAN2 4KUIA 2NYSA 2OI3A 1C0MA 1E6GA 2HEQA 2R5AA 2A37A 1OQKA 1JU5C 3QSUA 5A0GA 1K4US 2EWNA 2EW3A 2H8HA 2RN8A 1M90C 2K2MA 4JRPA 5LJ5j 1JB0E 1QP3A 3S3NA 1JO8A 2CUBA 4DBRA 1RI9A 4RTWA 4JRQA 3JB9H 8ATCB 1X69A 2DRKA 2DBMA 2HL5C 4HCZA 5FROA 1A0NB 2O88A 4LUEA 2CP2A 2JS0A 4OB2B 3CD6T 4ZTFA 1TSFA 3EG1A 2M0OA 4LN2A 4LE9A 4C8QF 1QQJA 1UECA 2RHYA 2RHXA 2LT4A 1NLPC 2L8DA 1M5Q1 2FZKB 1RAHB 4II1A 3GF5A 1I0CA 1KSWA 4FCYA 1RAIB 2OTJQ 5LJ3j 4LNPA 2D1XA 3TCJA 2FRWA 2PVOB 1Q81U 3V7CA 3CCUQ 3MEVA 2L3SA 1OPLA 5GAMf 3JCMh 1KIKA 1YHQQ 4XTVA 1K8AU 2DZ9A 1AHJB 1SKUB 2W0ZA 2WSEE 3BDLA 3EHQA 3RR6A 2CYZB 3AT1B 3CCLA 5GAOl 1GCPA 1T3SA 3OS1A 1UJ0A 2ZPGB 3G6EA 2CS7A 5IXBA 4M75A 3EAEA 4M7DC 4RTZA 2QQRA 2MMPA 4N0AC 3VKIA 3CCMQ 1PD1A 2XU8A 4M78E 5CKDA 1HK9A 1VQMQ 1NZ9A 1XNIA 1LNXA 3CQTA 5FRMA 4J9FA 1P92A 3SEMA 4FYYB 1M90U 4F7UE 1VQPQ 2O2OA 3CMEQ 1H3HA 1JEGA 5L23A 2PZ1A 2ZPHB 4KRTA 4FYWB 3M0TA 3QJYA 1YCSB 1QVFA 2QAZA 4E7HA 1SPKA 4IUUA 3ZBDA 5LJ5h 1VIEA 2LCCA 1R0CB 4FW1A 5KE3A 3EFRA 1U1TA 1S72Q 3BY7A 1OZ2A 4M77E 1WHGA 4M4ZA 1UGPB 3PT9A 1M2VB 2XDBA 5GAMg 1W2BS 2VV5A 3ASKA 2OAUA 1K9AA 1VQ6Q 4C5EA 3M0PA 1SRMA 3JB9F 4M75F 1BI1A 1RUWA 2V1QA 3L1AA 4M7AC 2X4WA 1WDXA 1K0SA 4RTXA 5LJ3h 3JCMQ 3DKMA 5GAMj 1KD1R 5FW9A 3GIBA 2CT4A 2FHDA 1D0YA 4JZ4A 1OOTA 2XDDA 3RBBB 4X9DA 3OYEA 2GFAA 2M9UA 1V1CA 5FWBA 4C0DB 1QKXA 4OB1B 3H0FA 3OW2S 1X2KA 4X34A 3HP9A 1NM7A 3L2QA 2EJ9A 5IXFA 4DQ2A 2E6NA 4LUDA 3A1PA 2LJ3A 2R5MA 4M7DE 3P8DA 2QASA 1O75A 3JB9J 4J9BA 2L89A 1PKTA 2F2VA 3HFNA 3CPFA 3TREA 1GBRA 4IIOA 2IVWA 2KE9A 1NLOC 3OSSC 3A8HB 1GCQA 2OX7A 3BDUA 1VOMA 3REAB 2C0OA 4PK4A 4ELZC 2DETA 2HQXA 3HFOA 2HQHA 2QEXT 5CK9A 1VQNA 1KC8R 1W70A 1TXQA 2QQSA 2P84A 4RCCA 1PM3A 5CCAA 3SB2A 4Y28E 1VQ7Q 2VKNA 3C12A 2IG0A 2EYYA 3E2UA 4L5GA 4EMHA 5C0MA 2HSEB 2GFUA 3V7RA 2GF7A 2DX1A 3HKSA 2RMOA 4M7DD 4M7AE 1C1AA 4X1VA 1QCFA 4E7SA 2SEMA 1WHJA 4R56A 2EPDA 4KGZB 5GAMh 2QDYB 1KHCA 1KG1A 2EVRA 4VUBA 1QVFS 1UGVA 4F17A 1EFNA 3KXTA 3JCMX 2DTHA 2MI6A 3VS1A 4OMFB 1K9MR 1ZA2B 5CKEA 1IXDA 4F7UA 2YRCA 3OA6A 3MP1A 3RMSA 3X24B 4E7IA 2BIVA 3CC2A 1R8OB 4A54A 4QVCA 3I55T 2JTMA 5GAN5 2RQWA 4P5NA 1D3BA 4PJJA 3CCJT 1VQ5A 1AWOA 4KUDK 1TG0A 4M77A 4XU1A 4E7LA 2HCKA 4AG2C 2JUFA 1KFZA 4ZN1A 2CH4W 3A5ZB 2CH4A 4ZGDB 1Q82C 3FB9A 2EBPA 2GGRA 5DLQE 1SHGA 2DIQA 2KGTA 2FL7A 4M78G 4WCIA 2L3QA 4FW2A 4M78B 5KH6A 1WFWA 4BD3A 2CREA 1JRIA 3WXMB 5M9OA 2K5LA 4ELYC 2V8IA 4PFOA 3C94A 2QEXA 2LMJA 2Y90A 3CMAT 4YTLA 1VQ4A 4F7UF 3UA6A 1YITT 2QXFA 1XJWB 2FPFA 2B86A 2DJZA 1D3BB 3RDVA 3E19A 4IUQA 2RH2A 4MZTA 4AFQC 1VQKQ 3DB4A 2E65A 1UEBA 1YJNT 1M3AA 4C92D 4ZGJB 4OMPA 4M77F 2LJ0A 1IHWA 3WVDB 2JN0A 4N4GA 3META 4HVVA 2FVUA 1T0HA 1M1GA 2P0PA 1PRLC 3EH2A 3LYIA 1ZBXA 1ABQA 3QYHB 8AT1B 1PSFA 2E5KA 2LQ8A 1N9RA 1WXBA 3OYMA 1VQOT 4J7FA 5GJVB 3LX7A 5GANf 1ZA1B 1Q82U 4LD9K 2J6FA 1W2BP 3MP8A 3CCJA 2ZZDA 1B7TA 1UUEA 2DO3A 3CC7T 4M7DG 2LNVA 2QI2A 2EIFA 1WNLA 3ZEHA 4M7DB 2JM9A 1G3WA 2DEUA 4EMGA 2E64A 2JNGA 2PVDB 3G4SQ 5EG2A 2DAQA 2RJEA 4M7AA 3GNFB 4WTOB 3BE3A 2CSIA 2YDLA 3MP6A 2A08A 4F16A 3GOXA 5IAYA 4JJBA 3OYIA 3OW2P 1QCOA 2E3IA 4OMNA 4KBMB 3OYNA 2JM8A 2LDMA 1OYXA 3MHXA 1UG1A 5KYNA 2RQUA 3U23A 5I2MA 1MMDA 4DBFA 4RG8A 4Z89A 2DIGA 1C6VX 2KNBB 4CRIA 1D09B 2M1HA 4M7AG 2EKOA 4M7AB 5I22A 3RKYA 2EQJA 4L59A 3NFCA 1YCYA 2DA9A 4E7ZA 2O01E 1G2BA 4PJOF 3L2VA 4LD6A 1TUDA 5I11A 1YIJT 1QMCA 5GANj 3SWNA 4F04B 4A63B 2PNIA 5KCOA 1KK7A 1I8FA 2KXDA 2MOXA 2CSQA 1LOJA 1UGQB 2F69A 3JAME 1VQ9T 2CUDA 1G3YA 1T3LA 2L5QA 3CCVT 3VV0A 4RUGA 4EIKA 3V8JA 4RTUA 4QVZA 4DEYA 3EH1A 2EQKA 3S3OA 3X28B 4XTUA 2LJ1A 1ZQ1A 2RHIA 4HKEA 3CCET 1SG5A 6AT1B 1QVFP 1M1FA 1NE8A 3UF4A 1Q81R 4JDSA 1YWPA 2LRQA 4MMKA 4O6JA 5J26A 2KEAA 3QWYA 1AZEA 3H0IA 3ULRB 1K8AR 4DBQA 1EIFA 2KR3A 3VUZA 2LC4A 1GXIE 2QK0A 3H6ZA 2MYSA 1YI2A 4ANJA 4CI0C 2KROA 4BI4A 1U3OA 1M30A 4PL6A 4XK8E 2F2WA 5GJWB 2C0IA 2IIMA 3QPHA 1IRXA 2EGAA 1WYXA 2XICA 2YHTA 4HCBA 2ZPFB 2NUPA 1M90R 4J9HA 3HRTA 3VJPA 5LJ5g 4M75D 3OSVA 4Z8AA 2RQVA 1NG2A 3O5ZA 5LL6S 3TSWA 3PMIA 4KGVB 1PG5B 4IIMA 2RM4A 1U06A 2EAYA 2JS2A 2DBKA 2NUZA 2DLPA 1ZSGA 1HD3A 5GMKj 3CPWS 1VQ9A 2DFUA 3V7SA 1TH7A 2GTOA 1Q7YC 2DM1A 1MNEA 3OW2A 2CP3A 5LJ3g 1YJ9T 3HRUA 3G71Q 2COWA 2EYWA 2FO0A 1JQQA 3JCMe 3S3MA 2E6ZA 4JRIA 4JZ3A 2KI7A 4QT7A 1CSKA 3OS5A 2NUPB 1UB4A 3SDZA 2EQIA 4AFSC 2JZ2A 2NUTA 3NTKA 3VYGA 3FRNA 4A4EA 5KYXA 4J6XA 3VRZA 4JJNK 1M1KC 1ZBJA 2FB7A 2DJQA 3R6NA 2B8AA 3JCMd 3RERA 2FPDA 2K3YA 2BZ8A 2PU9B 3M59A 2BUDA 2OTJT 1TTHB 4JS4A 1R0BG 1LCKA 2CZ6B 3UATA 5I21A 2OJ2A 1GL5A 3CCSA 5GAN3 3CCQA 3CCUT 5GMKe 1M2VA 2JTEA 4N4HA 3L2WA 3FLGA 2E70A 1ARKA 1YHQT 4QKUA 1RAAB 3UT1A 1VQ8A 2DYBA 2LCSA 1RACB 3OYFA 2LX7A 1RAFB 2ZPIB 4ZTJA 1B3QA 1M8VA 5CQXA 4PJMA 2DD5A 4CC3A 3CCRQ 3OYKA 2NUTB 4QW2A 5KYXB 4JJCA 1WHHA 2XIDA 2HBWA 2H3EB 3CCMT 1H641 3VS6A 2RQTA 1WLPB 2A7YA 1VQMT 3BW1A 1IO6A 3NGPA 3QHSA 1Q7YU 4GLMA 2CZ1B 3RUXA 1OU9A 5HK0A 1VQPT 1O9SA 1VQNQ 4J9CA 2MAMA 3CMET 2NWMA 1HYOA 1TWBA 2HAXA 2DXCA 2DK3A 1YJ9A 2AZSA 4O5VA 3CD6A 1M1KU 2IPOB 2O4XA 1S72T 2ZAEA 3OYYA 1IGQA 1SSHA 1H92A 2X4XA 3OMGA 4HT9A 3PVQA 4KT0E 4QQGA 3H0HA 4XQ3A 1BCOA 3PMTA 4FL6A 2DXUA 2RI5A 1AWXA 2E12A 4GLKA 1VQ6T 1AWJA 1WXUA 3I56Q 1B34A 3EGUA 4EMKC 1G3SA 1UTIA 2Z0WA 2LQNA 4OVAA 1BKBA 1G8XA 2RJFA 1BBZA 3M9QA 1H3ZA 3EHRA 3CC2Q 4AFUC 3CCUA 3OYGA 2BE9B 4EPCA 3SHWA 5GAOn 2MCNA 4C92C 3MEAA 2K5IA 1VQ5Q 4NS5A 1WQ7A 4J6YA 2O4XB 2DXTA 4J5YA 1AVZC 3PTAA 1VYTA 4JLIA 2V26A 2LNHB 3PGGA 3OYAA 3LW5E 2A0FB 1MNDA 5AYFA 3OMCA 2VASA 3VS3A 4XTZA 1ZUKA 5KYUA 3CCMA 3S6WA 2O31A 5IHKA 1B34B 2DF6A 4FM4B 3CXCS 3OBYA 1BI0A 3M0QA 1VQPA 4C0ZA 1Y96A 3JCMb 4BUGA 1VQ4Q 2KT1A 2VB6A 3QKJA 2D8HA 2RI3A 4GBQA 2C06A 4KGXB 3QO3A 2QA4T 1UE9A 1M9SA 2CGHA 2GCXA 4OMLA 1D1BA 3UWNA 3OY9A 1VQ7T 1F1BB 2MWOA 3EG9A 4M78A
chains in the Genus database with same CATH topology
4DEXA 2K3BA 2JXBA 1N5ZA 2JM9A 3VRYA 2AKKA 2ROTA 1I07A 4ZNXA 1X6BA 4CC4B 2KT8A 1ZX6A 2LZ6B 2CSIA 2EKHA 2OAWA 3VS4A 2KYBA 2YDLA 1YNZA 2A08A 4F16A 1WI7A 2KRMA 2J7IA 3VS5A 3THKA 3QWXX 2KYMA 2YT6A 1W1FA 2AZVA 1OPKA 4JJBA 1SEMA 2ENMA 2L3PA 2LQWA 4JPBW 1FYNA 1GRIA 1PWTA 1AWWA 4OMNA 1YWOA 2FG0A 2JM8A 2OI3A 1ZUYA 1UG1A 1E6GA 2HEQA 2DL7A 2A37A 2RQUA 5IHIA 1JU5C 3U23A 1K4US 2M0YA 2EW3A 2H8HA 5IHNA 2RN8A 4Z89A 2K2MA 1YP5A 1BB9A 1JO8A 2CUBA 1RI9A 2KBTA 2KNBB 4RTWA 1X69A 1PNJA 2DRKA 2DBMA 2DRMA 2CT3A 1A0NB 5I22A 2O88A 2AKLA 4LUEA 2F2XA 2JS0A 1CKAA 2BZXA 2DA9A 3EG1A 2LP5A 4LN2A 1G2BA 4LE9A 1UECA 1RLPC 1TUDA 3NMZC 5I11A 2G6FX 1NLPC 4HVWA 1J3TA 2JW4A 1QWFA 2PTKA 4A63B 1UFFA 1WA7A 4J9IA 2PNIA 1I0CA 1KSWA 1I1JA 2KXCA 2KXDA 4LNPA 2MOXA 1VYUA 2D1XA 2CSQA 4F14A 4FSSA 2FRWA 4R0KA 2CUDA 2K79A 1WX6A 1T3LA 2L3SA 1BU1A 1OPLA 4RUGA 3PE0A 1KIKA 3EG3A 5HCKA 4EIKA 1PRMC 2GBQA 1TUCA 3FJ5A 1WIEA 4RTUA 2W0ZA 1YN8A 3EHQA 4DEYA 2VWFA 1ZLMA 3I5RA 1GCPA 1T3SA 1X43A 2LJ1A 1UJ0A 2J06A 1OV3A 1X27A 5IXBA 1E6HA 4RTZA 2DNUA 3PVLA 3UF4A 1YWPA 1M8MA 2KEAA 4Z88A 2QDLA 3QWYA 1AZEA 3H0IA 2X3XD 3M0RA 3ULRB 3CQTA 2DILA 3I9QA 4J9FA 1PHTA 2KR3A 3SEMA 1AOJA 3NHNA 3EG2A 2ED1A 1B07A 2O2OA 1PKSA 1X2QA 1H3HA 2O9VA 1JEGA 5L23A 2M51A 2PZ1A 4KRTA 4HCKA 3M0TA 1MV3A 1YCSB 2C0TA 2KROA 1Z9QA 3EG0A 1SPKA 1U3OA 1M30A 3VS2A 4D8KA 2F2WA 5GJWB 2YUNA 2C0IA 2IIMA 4E6RA 1ABOA 1UJYA 3M0UA 3NPFA 1K1ZA 2EGAA 1WYXA 2YUPA 5EC7A 1GFDA 4M4ZA 2RQRA 3M0SA 3TVTA 1QLYA 4J9HA 2EYXA 4JJDA 1K9AA 2W10A 4OMOA 3M0PA 1SRMA 3H41A 2DVJA 4Z8AA 2K9GA 1RUWA 2RQVA 2V1QA 2D8JA 1NG2A 3O5ZA 1WDXA 1K0SA 4RTXA 3TSWA 2L0AA 1AD5A 1UDLA 5FW9A 1JXOA 2CT4A 3JV3A 1FMKA 4RTVA 4IIMA 1U06A 2JS2A 1QKWA 2DBKA 2NUZA 2DLPA 4JZ4A 1ZSGA 2XMFA 1HD3A 1OOTA 2D0NA 3RBBB 2GTOA 2DM1A 2V1RA 3VS0A 1V1CA 5FWBA 1QKXA 2ED0A 4J9DA 2EYWA 2FO0A 3H0FA 1JQQA 1X2KA 1MV0B 1NM7A 4JZ3A 5IXFA 4QT7A 4LUDA 1CSKA 2LJ3A 2EQIA 4AFSC 2ABLA 4J9BA 2YUQA 1PKTA 3RNJA 2F2VA 2RNAA 3VRZA 1GBRA 3UA7A 4IIOA 1ZBJA 2DJQA 2ROLA 1GBQA 2DE0X 3R6NA 2FPEA 2KE9A 2J6KA 2FPDA 1NLOC 1RLQC 2BZ8A 2YSQA 1GCQA 3REAB 2C0OA 1CKBA 2JMAA 1LCKA 2CDTA 3UATA 2OJ2A 4HVUA 1GL5A 2DMOA 2JTEA 1ARKA 1GFCA 1M3BA 2J6OA 2RF0A 1NEBA 1HSQA 1W70A 2DYBA 2LCSA 2LX7A 1B3QA 3I5SA 4RTTA 2VKNA 4CC3A 1JXMA 4AFZC 2EYYA 3KFVA 3ZL7C 1KJWA 2X3WD 4JJCA 2HBWA 2DX1A 2SRCA 2RMOA 3VS6A 2RQTA 1WLPB 4X1VA 1QCFA 1IO6A 2SEMA 3NGPA 3LH5A 2EPDA 2GTJA 4GLMA 1AZGB 2P4RA 1E7OA 2EVRA 1UGVA 4J9CA 4F17A 2BZYA 1EFNA 2L2PA 2KRSA 2EYZA 2MIOA 3VS1A 2NWMA 4J9EA 2JMCA 2FEIA 2AZSA 4K11A 3C0CA 2YUOA 2AK5A 4J9GA 2DL3A 2RQWA 3TSZA 1SSHA 1H92A 1S1NA 2BTTA 3PVQA 1UHCA 2KRNA 3H0HA 1AWOA 1WXTA 1AWXA 2GQIA 1AWJA 1WXUA 2K6DA 1TG0A 2HCKA 2A36A 4AG2C 1KFZA 3REBB 1Y0MA 2FRYA 1H8KA 2CH4W 2CH4A 3GBQA 1M27C 1AEYA 2I0NA 2EBPA 2GGRA 4HXJA 1K0XA 3EGUA 1SHGA 2KGTA 1UTIA 2LQNA 1VA7A 2L3QA 2DL8A 4WCIA 4CC7A 2O9SA 1BBZA 1WFWA 2CREA 2HDAA 4D8DA 3EHRA 1NEGA 2A28A 4AFUC 2ECZA 3VS7A 4ORZA 3SHWA 2LMJA 2MCNA 2HSPA 4ESRA 4OMMA 1NYFA 4AG1C 2VVKA 2K7AA 1AVZC 2DL5A 3A98A 3UA6A 1Y57A 1K76A 1VYTA 1U5SA 2LNHB 2FPFA 2B86A 1BK2A 5FWCA 4AFQC 3VS3A 1ZUKA 1M3AA 2O31A 4OMPA 5IHKA 2DF6A 2LJ0A 1SRLA 2EGEA 2J05A 1HJDA 1T0JA 2DL4A 4RTYA 4CC2A 3M0QA 4OMQA 1OEBA 4HVVA 4Y92A 1T0HA 2KT1A 1QWEA 1PRLC 1GCQC 2RPNA 2GNCA 1UHFA 1XOVA 2D8HA 5ECAA 4GBQA 1ABQA 3I35A 1ZUUA 2E5KA 1WXBA 1UE9A 1VYVA 2JT4A 1M3CA 1Z9ZA 5GJVB 2EGCA 1SHFA 4OMLA 2ESWA 3IQLA 5IH2A 1W6XA 1X6GA 1MUZA 1NYGA 2J6FA 1G83A 1UUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEX A;  2K3B A;  2JXB A;  1N5Z A;  2JM9 A;  3VRY A;  2AKK A;  2ROT A;  1I07 A;  4ZNX A;  1X6B A;  4CC4 B;  2KT8 A;  1ZX6 A;  2LZ6 B;  2CSI A;  2EKH A;  2OAW A;  3VS4 A;  2KYB A;  2YDL A;  1YNZ A;  2A08 A;  4F16 A;  1WI7 A;  2KRM A;  2J7I A;  3VS5 A;  3THK A;  3QWX X;  2KYM A;  2YT6 A;  1W1F A;  2AZV A;  1OPK A;  4JJB A;  1SEM A;  2ENM A;  2L3P A;  2LQW A;  4JPB W;  1FYN A;  1GRI A;  1PWT A;  1AWW A;  4OMN A;  1YWO A;  2FG0 A;  2JM8 A;  2OI3 A;  1ZUY A;  1UG1 A;  1E6G A;  2HEQ A;  2DL7 A;  2A37 A;  2RQU A;  5IHI A;  1JU5 C;  3U23 A;  1K4U S;  2M0Y A;  2EW3 A;  2H8H A;  5IHN A;  2RN8 A;  4Z89 A;  2K2M A;  1YP5 A;  1BB9 A;  1JO8 A;  2CUB A;  1RI9 A;  2KBT A;  2KNB B;  4RTW A;  1X69 A;  1PNJ A;  2DRK A;  2DBM A;  2DRM A;  2CT3 A;  1A0N B;  5I22 A;  2O88 A;  2AKL A;  4LUE A;  2F2X A;  2JS0 A;  1CKA A;  2BZX A;  2DA9 A;  3EG1 A;  2LP5 A;  4LN2 A;  1G2B A;  4LE9 A;  1UEC A;  1RLP C;  1TUD A;  3NMZ C;  5I11 A;  2G6F X;  1NLP C;  4HVW A;  1J3T A;  2JW4 A;  1QWF A;  2PTK A;  4A63 B;  1UFF A;  1WA7 A;  4J9I A;  2PNI A;  1I0C A;  1KSW A;  1I1J A;  2KXC A;  2KXD A;  4LNP A;  2MOX A;  1VYU A;  2D1X A;  2CSQ A;  4F14 A;  4FSS A;  2FRW A;  4R0K A;  2CUD A;  2K79 A;  1WX6 A;  1T3L A;  2L3S A;  1BU1 A;  1OPL A;  4RUG A;  3PE0 A;  1KIK A;  3EG3 A;  5HCK A;  4EIK A;  1PRM C;  2GBQ A;  1TUC A;  3FJ5 A;  1WIE A;  4RTU A;  2W0Z A;  1YN8 A;  3EHQ A;  4DEY A;  2VWF A;  1ZLM A;  3I5R A;  1GCP A;  1T3S A;  1X43 A;  2LJ1 A;  1UJ0 A;  2J06 A;  1OV3 A;  1X27 A;  5IXB A;  1E6H A;  4RTZ A;  2DNU A;  3PVL A;  3UF4 A;  1YWP A;  1M8M A;  2KEA A;  4Z88 A;  2QDL A;  3QWY A;  1AZE A;  3H0I A;  2X3X D;  3M0R A;  3ULR B;  3CQT A;  2DIL A;  3I9Q A;  4J9F A;  1PHT A;  2KR3 A;  3SEM A;  1AOJ A;  3NHN A;  3EG2 A;  2ED1 A;  1B07 A;  2O2O A;  1PKS A;  1X2Q A;  1H3H A;  2O9V A;  1JEG A;  5L23 A;  2M51 A;  2PZ1 A;  4KRT A;  4HCK A;  3M0T A;  1MV3 A;  1YCS B;  2C0T A;  2KRO A;  1Z9Q A;  3EG0 A;  1SPK A;  1U3O A;  1M30 A;  3VS2 A;  4D8K A;  2F2W A;  5GJW B;  2YUN A;  2C0I A;  2IIM A;  4E6R A;  1ABO A;  1UJY A;  3M0U A;  3NPF A;  1K1Z A;  2EGA A;  1WYX A;  2YUP A;  5EC7 A;  1GFD A;  4M4Z A;  2RQR A;  3M0S A;  3TVT A;  1QLY A;  4J9H A;  2EYX A;  4JJD A;  1K9A A;  2W10 A;  4OMO A;  3M0P A;  1SRM A;  3H41 A;  2DVJ A;  4Z8A A;  2K9G A;  1RUW A;  2RQV A;  2V1Q A;  2D8J A;  1NG2 A;  3O5Z A;  1WDX A;  1K0S A;  4RTX A;  3TSW A;  2L0A A;  1AD5 A;  1UDL A;  5FW9 A;  1JXO A;  2CT4 A;  3JV3 A;  1FMK A;  4RTV A;  4IIM A;  1U06 A;  2JS2 A;  1QKW A;  2DBK A;  2NUZ A;  2DLP A;  4JZ4 A;  1ZSG A;  2XMF A;  1HD3 A;  1OOT A;  2D0N A;  3RBB B;  2GTO A;  2DM1 A;  2V1R A;  3VS0 A;  1V1C A;  5FWB A;  1QKX A;  2ED0 A;  4J9D A;  2EYW A;  2FO0 A;  3H0F A;  1JQQ A;  1X2K A;  1MV0 B;  1NM7 A;  4JZ3 A;  5IXF A;  4QT7 A;  4LUD A;  1CSK A;  2LJ3 A;  2EQI A;  4AFS C;  2ABL A;  4J9B A;  2YUQ A;  1PKT A;  3RNJ A;  2F2V A;  2RNA A;  3VRZ A;  1GBR A;  3UA7 A;  4IIO A;  1ZBJ A;  2DJQ A;  2ROL A;  1GBQ A;  2DE0 X;  3R6N A;  2FPE A;  2KE9 A;  2J6K A;  2FPD A;  1NLO C;  1RLQ C;  2BZ8 A;  2YSQ A;  1GCQ A;  3REA B;  2C0O A;  1CKB A;  2JMA A;  1LCK A;  2CDT A;  3UAT A;  2OJ2 A;  4HVU A;  1GL5 A;  2DMO A;  2JTE A;  1ARK A;  1GFC A;  1M3B A;  2J6O A;  2RF0 A;  1NEB A;  1HSQ A;  1W70 A;  2DYB A;  2LCS A;  2LX7 A;  1B3Q A;  3I5S A;  4RTT A;  2VKN A;  4CC3 A;  1JXM A;  4AFZ C;  2EYY A;  3KFV A;  3ZL7 C;  1KJW A;  2X3W D;  4JJC A;  2HBW A;  2DX1 A;  2SRC A;  2RMO A;  3VS6 A;  2RQT A;  1WLP B;  4X1V A;  1QCF A;  1IO6 A;  2SEM A;  3NGP A;  3LH5 A;  2EPD A;  2GTJ A;  4GLM A;  1AZG B;  2P4R A;  1E7O A;  2EVR A;  1UGV A;  4J9C A;  4F17 A;  2BZY A;  1EFN A;  2L2P A;  2KRS A;  2EYZ A;  2MIO A;  3VS1 A;  2NWM A;  4J9E A;  2JMC A;  2FEI A;  2AZS A;  4K11 A;  3C0C A;  2YUO A;  2AK5 A;  4J9G A;  2DL3 A;  2RQW A;  3TSZ A;  1SSH A;  1H92 A;  1S1N A;  2BTT A;  3PVQ A;  1UHC A;  2KRN A;  3H0H A;  1AWO A;  1WXT A;  1AWX A;  2GQI A;  1AWJ A;  1WXU A;  2K6D A;  1TG0 A;  2HCK A;  2A36 A;  4AG2 C;  1KFZ A;  3REB B;  1Y0M A;  2FRY A;  1H8K A;  2CH4 W;  2CH4 A;  3GBQ A;  1M27 C;  1AEY A;  2I0N A;  2EBP A;  2GGR A;  4HXJ A;  1K0X A;  3EGU A;  1SHG A;  2KGT A;  1UTI A;  2LQN A;  1VA7 A;  2L3Q A;  2DL8 A;  4WCI A;  4CC7 A;  2O9S A;  1BBZ A;  1WFW A;  2CRE A;  2HDA A;  4D8D A;  3EHR A;  1NEG A;  2A28 A;  4AFU C;  2ECZ A;  3VS7 A;  4ORZ A;  3SHW A;  2LMJ A;  2MCN A;  2HSP A;  4ESR A;  4OMM A;  1NYF A;  4AG1 C;  2VVK A;  2K7A A;  1AVZ C;  2DL5 A;  3A98 A;  3UA6 A;  1Y57 A;  1K76 A;  1VYT A;  1U5S A;  2LNH B;  2FPF A;  2B86 A;  1BK2 A;  5FWC A;  4AFQ C;  3VS3 A;  1ZUK A;  1M3A A;  2O31 A;  4OMP A;  5IHK A;  2DF6 A;  2LJ0 A;  1SRL A;  2EGE A;  2J05 A;  1HJD A;  1T0J A;  2DL4 A;  4RTY A;  4CC2 A;  3M0Q A;  4OMQ A;  1OEB A;  4HVV A;  4Y92 A;  1T0H A;  2KT1 A;  1QWE A;  1PRL C;  1GCQ C;  2RPN A;  2GNC A;  1UHF A;  1XOV A;  2D8H A;  5ECA A;  4GBQ A;  1ABQ A;  3I35 A;  1ZUU A;  2E5K A;  1WXB A;  1UE9 A;  1VYV A;  2JT4 A;  1M3C A;  1Z9Z A;  5GJV B;  2EGC A;  1SHF A;  4OML A;  2ESW A;  3IQL A;  5IH2 A;  1W6X A;  1X6G A;  1MUZ A;  1NYG A;  2J6F A;  1G83 A;  1UUE A; 
#chains in the Genus database with same CATH topology
 5D6Y A;  2DYI A;  2YWW A;  4DEX A;  4ME7 A;  5KYU B;  4JS5 A;  2K3B A;  1G5V A;  1N5Z A;  2E3H A;  5HKC A;  2AKK A;  1FMV A;  4KUL A;  2D6F A;  1ZSZ C;  3EFO A;  2OTL Q;  1I5O B;  4OF1 A;  2KT8 A;  4E7K A;  1ZX6 A;  2DEQ A;  1Y96 B;  1Q82 R;  2PUO B;  1YBY A;  2EKH A;  1YFN A;  5A0D A;  1AT1 B;  2M16 A;  2KYB A;  3CPW P;  4C92 E;  2PQW A;  4KH0 B;  2J7I A;  5C6S A;  3RKW A;  4BE2 A;  2XDP A;  1W1F A;  1SEM A;  2L3P A;  2K4Y A;  2LQW A;  5GAO m;  1FYN A;  1PWT A;  1AWW A;  3EGX A;  2FG0 A;  5GMK l;  2DL7 A;  1XQH A;  2EQM A;  3QBY A;  4C8Q C;  3PIP A;  5IHI A;  2DVE A;  3F70 A;  2M0Y A;  1K73 C;  3EG9 B;  1UGS B;  2E41 A;  3LWH A;  5IHN A;  3RES A;  3MPU B;  5IT9 E;  2KVQ G;  1BB9 A;  1D1C A;  4M78 F;  2KBT A;  4A4F A;  3FDR A;  1PNJ A;  2QG9 B;  3EFO B;  4MML A;  2X51 A;  2DTO A;  1YJW Q;  1QP2 A;  3OYD A;  4PJO D;  3VUB A;  2F2X A;  1VQL Q;  1CKA A;  2BZX A;  3OS2 A;  2LP5 A;  1RLP C;  4HVW A;  1J3T A;  1QWF A;  2PTK A;  2HBP A;  2QA4 A;  1UFF A;  1WA7 A;  4J9I A;  2KQW A;  3PNW C;  4JUV A;  2CP7 A;  2QQ9 A;  1VYU A;  3QUI A;  1TU0 B;  4F14 A;  5CQY A;  4FSS A;  4M7D A;  3EGX B;  4J83 A;  1U1S A;  2K79 A;  4N0A A;  3A8O B;  3V8L A;  1VQ7 A;  3X20 B;  2K2V A;  2HMA A;  1N6A A;  2GBQ A;  1TUC A;  3MJX A;  5CVI A;  1VQK T;  1WIE A;  2ATC B;  1NJI C;  1EZZ B;  1YN8 A;  2YLB A;  2RHU A;  1TOV A;  2LTO A;  2HKN A;  3I5R A;  5CKH A;  2HL3 A;  2LQK A;  4AT1 B;  3L2U A;  2J06 A;  1EX4 A;  3AHU A;  2CP6 A;  1E6H A;  1Q86 C;  3PVL A;  3A8M B;  2X35 A;  1M8M A;  3I55 A;  2QDL A;  3P8B B;  3UPU A;  2DIL A;  1PHT A;  1K73 U;  3JCM c;  3NHN A;  3EG2 A;  2ED1 A;  1B07 A;  1G3T A;  2WSF E;  3JB9 I;  1X2Q A;  1BYM A;  2M51 A;  4Q5W A;  4HCK A;  1RI0 A;  4M75 C;  1X75 C;  4E7J A;  2C0T A;  2CKK A;  4M7D F;  1SF9 A;  1FWZ A;  2L3R A;  3EG0 A;  2YRD A;  2RO0 A;  4XTX A;  3VS2 A;  2XG8 D;  2YUN A;  4E6R A;  1ABO A;  2CZ0 B;  3OYL A;  5HK3 A;  2YUP A;  5EC7 A;  1GFD A;  3M0S A;  1QLY A;  4BE1 A;  3G4S T;  3DLL A;  3CMA A;  3EGD B;  2VC8 A;  4OMO A;  3H41 A;  2CZ7 B;  2JTF A;  2DVJ A;  4EMK A;  3J80 E;  2DPP B;  1YIT A;  3N5B B;  1YI2 Q;  5L8R E;  1M2O A;  2D8J A;  2L0A A;  1NJI U;  1UDL A;  1Y07 A;  1JXO A;  3JV3 A;  3OYJ A;  3CPW A;  1FMK A;  4RTV A;  4PFZ A;  4WF2 A;  5GAO r;  1YJN A;  3QZ9 B;  3QZ5 B;  4C92 A;  5GAN g;  4IKF A;  5I2S A;  1IHV A;  2QTV A;  2V1R A;  3JCM f;  3VS0 A;  1Q86 U;  2ED0 A;  4C8Q D;  1VQK A;  3CC4 Q;  5GAN 6;  2K57 A;  5D6X A;  4M7A F;  2FYK A;  2LVM A;  5A0L A;  3CXC P;  3RKX A;  2XHC A;  1FMW A;  2V8K A;  2HD0 A;  1PCX A;  1VQO A;  2YUQ A;  4QQD A;  4E47 A;  2JOY A;  4EMK B;  1GBQ A;  2J6K A;  1RLQ C;  3QDF A;  3H8Z A;  2COZ A;  5GAN 7;  1ZHI A;  4PFP A;  4JRK A;  4BB7 A;  5GAN 4;  2JMA A;  3CC7 A;  4C92 G;  1BIB A;  4M75 E;  2X4J A;  4HVU A;  4C92 B;  2DMO A;  3HSB A;  2M02 A;  1PC0 A;  1M3B A;  4C5H A;  2AIR B;  1MMN A;  2RF0 A;  2DZC A;  1NEB A;  1HSQ A;  4A53 A;  1KQ2 A;  3I5S A;  4LXC A;  1JXM A;  4AFZ C;  4J8O A;  4LDU A;  4OGC A;  2X3W D;  1ZSZ A;  2A3L A;  2CP5 A;  2XD0 A;  4A4G A;  1ACM B;  3CCL Q;  2HKQ B;  3CCS Q;  4C0F A;  2EFI A;  3CCQ Q;  3LH5 A;  1BI3 A;  2GTJ A;  2I2L A;  1D0Z A;  1AZG B;  3L42 A;  3GPL A;  1E7O A;  3G6E Q;  2JVV A;  1NPP A;  3MKD A;  1VQ8 Q;  2L2P A;  1WHL A;  1N8R C;  2EYZ A;  2F1L A;  2MIO A;  1BCM A;  3LH0 A;  4J9E A;  1QCN A;  2KDS A;  1KQS A;  2KAF A;  3JB9 D;  3C0C A;  1V76 A;  2YRV A;  1Q7Y R;  4J9G A;  2QQA A;  5GAN h;  4QQ6 A;  5J3B A;  3TSZ A;  1YIJ A;  2XKO C;  1LJO A;  2LX9 A;  5A2Q E;  2BTT A;  3HRS A;  2GQI A;  5AT1 B;  1ZSZ B;  1XTD A;  3REB B;  1Y0M A;  2FRY A;  3CCV A;  2WSC E;  1IGU A;  4BY6 C;  2YLC A;  1M1K R;  4HXJ A;  1K0X A;  1LPL A;  1YJ9 Q;  4L6V 5;  2V8J A;  2ZCF B;  4XU3 A;  4CC7 A;  2O9S A;  1MHN A;  3CD6 Q;  2HDA A;  4D8D A;  3MEW A;  4QVD A;  1NEG A;  2A28 A;  2MWP A;  2ECZ A;  5KYW A;  3LWI A;  3VS7 A;  4ORZ A;  2XI9 A;  3CCE A;  4M77 C;  4NL3 A;  3G71 T;  4ESR A;  4C8Q G;  2P0K A;  1HXD A;  1N9S A;  4AG1 C;  4C8Q B;  2VVK A;  2YXY A;  2QGF B;  2DL5 A;  2F5K A;  1K76 A;  3GNG A;  2NLU A;  5GMK i;  1RAE B;  2DD4 A;  3DB3 A;  3HPW A;  2E5Q A;  1WHM A;  1N8R U;  4PKC C;  1FXX A;  2HQE A;  1JJ2 P;  4PLI A;  2RI2 A;  3CXC A;  4LDV A;  3M55 A;  2VXE A;  4IUP A;  1SRL A;  2G3R A;  3FEO A;  1WJR A;  1HJD A;  1T0J A;  4TVR A;  4CC2 A;  1TS9 A;  4FT2 A;  4ATO A;  4OMQ A;  4BAC A;  5LJ5 e;  4MZP A;  2KMT A;  3J81 E;  1UHF A;  5ECA A;  5KYW B;  3I35 A;  3GLX A;  5HY6 A;  4LDX A;  2R58 A;  2VGM A;  1M3C A;  1I81 A;  1Z9Z A;  3JCM P;  2VYT A;  1SHF A;  5FLX E;  3IQL A;  3OS0 A;  5IH2 A;  1W6X A;  5LJ5 d;  3CCR T;  1X6G A;  1MUZ A;  1NYG A;  3M53 A;  5CAI A;  4Z02 A;  1SSF A;  1KJW A;  1G83 A;  4XTY A;  5GMK h;  4FIB A;  5LJ3 e;  4A4H A;  2JXB A;  3JSC A;  2JJ9 A;  3ZFJ A;  3HL8 A;  4XTW A;  3VU3 C;  4XAX B;  3OBW A;  1I07 A;  1WJS A;  1X6B A;  4LDW A;  1VQN T;  1KQS S;  2RK1 A;  2LZ6 B;  1RAD B;  3FJP A;  2OAW A;  5LJ3 d;  2ZPE B;  5FU6 C;  4Y91 A;  1WI7 A;  3JB9 G;  1QVG P;  3VS5 A;  4M75 G;  3QWX X;  3G71 A;  1BIA A;  4IUR A;  2KYM A;  1Q95 G;  2YT6 A;  1OPK A;  1TUG B;  4M75 B;  4B9W A;  2ZGW A;  1YWO A;  3ER0 A;  5FU7 C;  1IB8 A;  1ZUY A;  2RB6 A;  4OB0 B;  4D6W A;  3QII A;  2R57 A;  4N4I A;  4PJO C;  2AHJ B;  1Y71 A;  2WAC A;  2OTJ A;  3EFS A;  1WJQ A;  1YP5 A;  4M78 D;  3I56 T;  3RIR A;  1R77 A;  4AMC A;  4BDY A;  1YHQ A;  1WPY A;  2DRM A;  2CT3 A;  3M4Y A;  2AKL A;  2QGG A;  3JRZ A;  4HCC A;  5DY9 A;  3SD4 A;  3P8H A;  3CC2 T;  1KD1 C;  1OX9 A;  5DM7 R;  3NMZ C;  2G6F X;  2DTI A;  2JW4 A;  3BFM A;  1VQ5 T;  2E10 A;  1I1J A;  2KXC A;  4M77 D;  1N27 A;  2D9T A;  1VQM A;  3E9G A;  4R0K A;  1WX6 A;  1BU1 A;  3PE0 A;  3CCR A;  3EG3 A;  5HCK A;  2QEX Q;  4MDX A;  1PRM C;  5GAM e;  3FJ5 A;  3CME A;  4FYV B;  2VWF A;  4X9C A;  1ZLM A;  1OUL A;  1X43 A;  3SWN C;  3T9N A;  4NOY A;  1OV3 A;  4HA8 A;  1X27 A;  4A4K A;  1JJ2 A;  2QA4 Q;  2DNU A;  1X01 A;  1VQ4 T;  1S72 A;  4ZN3 A;  5GAM d;  4Z88 A;  4RKU E;  3Q1J A;  2X3X D;  3MEU A;  3M0R A;  2DKG A;  3CEY A;  3I9Q A;  2RK2 A;  5KE2 A;  1D1A A;  4UC4 A;  3H9N A;  1I5L A;  1AOJ A;  1VQ6 A;  5GAO q;  1PKS A;  4PJN A;  5DLO A;  2O9V A;  3X25 B;  4PJO E;  1IZ6 A;  3QJ6 A;  1KC8 C;  1MV3 A;  2F5T X;  3E1S A;  1Z9Q A;  3JCM W;  3CBO A;  2QYZ A;  3M54 A;  3LGF A;  3NTI A;  4R55 A;  4D8K A;  1UJY A;  3M0U A;  3NPF A;  3I56 A;  1KD1 U;  1K1Z A;  1K73 R;  3I55 Q;  2RQR A;  3R6O A;  3TVT A;  4NL2 A;  1D0X A;  4IUV A;  2OTL T;  2EYX A;  4JJD A;  3CCJ Q;  2DXB A;  2W10 A;  1WHK A;  4PNO A;  1OZ3 A;  2K9G A;  2XK0 A;  1WQW A;  3SFM A;  3WVE B;  3MO8 A;  4C5I A;  4XU2 A;  3HTR A;  5CR2 A;  2VUB A;  1M4Z A;  1K9M C;  1AD5 A;  2K5F A;  3PFS A;  1QKW A;  2VXF A;  4DBH A;  4XU0 A;  3LLR A;  1QVG A;  4FT4 A;  2XMF A;  3M57 A;  2D0N A;  3OB9 A;  3J7A F;  2MPX C;  3KUF A;  1OX8 A;  4PJL A;  3CMA Q;  1W4S A;  4J9D A;  3QXE B;  3OYH A;  5GAO p;  4M7A D;  1MV0 B;  3MCA B;  2Y4X A;  1YIT Q;  1JBM A;  1NJI R;  4F7U G;  1YJW T;  2ABL A;  4FU6 A;  1VUB A;  2P0Q A;  4F7U B;  2BE7 D;  4BI3 A;  3RNJ A;  5CIU A;  2RNA A;  1VQL T;  4BY6 B;  3UA7 A;  5KCH A;  1YJN Q;  1KC8 U;  2X4Y A;  2ROL A;  2DE0 X;  4B6M A;  1Q86 R;  2FPE A;  2AT1 B;  2YSQ A;  2VGN A;  3QG1 A;  4FYX B;  1CKB A;  2GQV A;  4M77 G;  5KYY A;  2CDT A;  4J6W A;  4M77 B;  4JLG A;  5CKB A;  2KK4 A;  2Y4Y A;  4DOW A;  3EGD A;  2EJF A;  1Y7X A;  1GFC A;  3JCM J;  2J6O A;  4RG2 A;  1VQO Q;  1JJ2 S;  3OYC A;  1I4K 1;  3OYB A;  4RTT A;  1WGS A;  1DJ7 B;  1NBE B;  2ZPB B;  2HNI A;  1OU8 A;  1K9M U;  2OTL A;  1RAB B;  3FIF A;  4OB3 B;  4V2S A;  3KFV A;  5FRN A;  2EJG A;  3ZL7 C;  2RJC A;  1KQS P;  1WZO A;  3LGL A;  3CBP A;  3CC7 Q;  2SRC A;  4C8Q E;  3A8L B;  4IUT A;  3TQ7 P;  2E4H A;  2P4R A;  2QTX A;  2BZY A;  1IRE B;  5KYY B;  2EYQ A;  2KRS A;  3G1J A;  2KY9 A;  3INZ A;  2JMC A;  1RAG B;  1FX7 A;  1UGR B;  2EQU A;  2FEI A;  2K3X A;  4GY5 A;  4BDZ A;  2RD1 A;  3ME9 A;  4K11 A;  2YUO A;  2CP0 A;  2KSS A;  2PUK B;  4PJO A;  1VIF A;  2AK5 A;  2PVG B;  2DL3 A;  1QW1 A;  4C0D C;  5J39 A;  1S1N A;  4B9X A;  7AT1 B;  1UHC A;  2KRN A;  4BE0 A;  1YJW A;  2X9H A;  1WXT A;  3TEE A;  2E1H A;  3GP8 A;  2K6D A;  1VQL A;  3O8V A;  2A36 A;  1YI2 T;  3M58 A;  3A8G B;  1H8K A;  4RCB A;  1QVG S;  3GBQ A;  1M27 C;  1AEY A;  2I0N A;  2RA2 A;  5CKF A;  3C4S A;  1VA7 A;  2DL8 A;  5FU6 B;  3QDR B;  9ATC B;  2LT1 A;  2H3J A;  1RL2 A;  1YIJ Q;  3VYH B;  4J7I A;  4C0G A;  4MDW A;  5FU7 B;  2HSP A;  4OMM A;  4LDY A;  4PJO G;  1NYF A;  3PIO A;  4PJO B;  3CC4 T;  3UDC A;  2K7A A;  3A98 A;  1Y57 A;  4OGE A;  4DOV A;  1U5S A;  3CBM A;  1VQ9 Q;  2QQB A;  3CCV Q;  4C5G A;  3DLM A;  1BK2 A;  4EDU A;  5FWC A;  2COY A;  4HT8 A;  3FC3 A;  2RHZ A;  4MZM A;  1MGQ A;  2DER A;  3QYG B;  1X6O A;  4C92 F;  2EGE A;  4DA4 A;  2J05 A;  3G7Z A;  3D7S B;  2DL4 A;  4RTY A;  3CCE Q;  1U8R A;  5LJ5 f;  3URG A;  2HZY A;  1OEB A;  3JCM V;  4Y92 A;  5GMK m;  3L2Z A;  1QWE A;  1GCQ C;  2RPN A;  2GNC A;  3OQ5 A;  4KH1 B;  1XOV A;  5D6W A;  2LCL A;  3RMQ A;  5GAN 8;  3G4S A;  3JCM g;  1ZUU A;  1N8R R;  3M4G A;  5CO7 A;  1NPR A;  1VYV A;  2FZG B;  2JT4 A;  3M5A A;  3E9F A;  4ZGE B;  2BKD N;  1PSE A;  5IN1 A;  2EGC A;  3X26 B;  3M56 A;  4E2F B;  4RMO A;  4BI8 B;  2ESW A;  2P4T A;  1KQ1 A;  1KHI A;  5GAN e;  2D0Q B;  5LJ3 f;  4OP0 A;  3SWN B;  1MMA A;  1V29 B;  3TU4 K;  3CCL T;  3VRY A;  1MMG A;  3CCS T;  3CCQ T;  1Q81 C;  2ROT A;  4PLL A;  3G6E T;  3C95 A;  4ZNX A;  4FSX A;  2MK5 A;  1QVP A;  4CC4 B;  4C8Q A;  1K8A C;  1VQ8 T;  3NTH A;  5GAN d;  3L2R A;  2MF2 A;  3VS4 A;  1W2B A;  1YNZ A;  1BI2 A;  1LVK A;  2KRM A;  4M78 C;  3KBG A;  3THK A;  2FZC B;  2AZV A;  1PD0 A;  2RJD A;  3V8K A;  2ENM A;  4JPB W;  3HHT B;  3CC4 A;  1GRI A;  1OI1 A;  5D7U A;  5GAN 2;  4KUI A;  2NYS A;  2OI3 A;  1C0M A;  1E6G A;  2HEQ A;  2R5A A;  2A37 A;  1OQK A;  1JU5 C;  3QSU A;  5A0G A;  1K4U S;  2EWN A;  2EW3 A;  2H8H A;  2RN8 A;  1M90 C;  2K2M A;  4JRP A;  5LJ5 j;  1JB0 E;  1QP3 A;  3S3N A;  1JO8 A;  2CUB A;  4DBR A;  1RI9 A;  4RTW A;  4JRQ A;  3JB9 H;  8ATC B;  1X69 A;  2DRK A;  2DBM A;  2HL5 C;  4HCZ A;  5FRO A;  1A0N B;  2O88 A;  4LUE A;  2CP2 A;  2JS0 A;  4OB2 B;  3CD6 T;  4ZTF A;  1TSF A;  3EG1 A;  2M0O A;  4LN2 A;  4LE9 A;  4C8Q F;  1QQJ A;  1UEC A;  2RHY A;  2RHX A;  2LT4 A;  1NLP C;  2L8D A;  1M5Q 1;  2FZK B;  1RAH B;  4II1 A;  3GF5 A;  1I0C A;  1KSW A;  4FCY A;  1RAI B;  2OTJ Q;  5LJ3 j;  4LNP A;  2D1X A;  3TCJ A;  2FRW A;  2PVO B;  1Q81 U;  3V7C A;  3CCU Q;  3MEV A;  2L3S A;  1OPL A;  5GAM f;  3JCM h;  1KIK A;  1YHQ Q;  4XTV A;  1K8A U;  2DZ9 A;  1AHJ B;  1SKU B;  2W0Z A;  2WSE E;  3BDL A;  3EHQ A;  3RR6 A;  2CYZ B;  3AT1 B;  3CCL A;  5GAO l;  1GCP A;  1T3S A;  3OS1 A;  1UJ0 A;  2ZPG B;  3G6E A;  2CS7 A;  5IXB A;  4M75 A;  3EAE A;  4M7D C;  4RTZ A;  2QQR A;  2MMP A;  4N0A C;  3VKI A;  3CCM Q;  1PD1 A;  2XU8 A;  4M78 E;  5CKD A;  1HK9 A;  1VQM Q;  1NZ9 A;  1XNI A;  1LNX A;  3CQT A;  5FRM A;  4J9F A;  1P92 A;  3SEM A;  4FYY B;  1M90 U;  4F7U E;  1VQP Q;  2O2O A;  3CME Q;  1H3H A;  1JEG A;  5L23 A;  2PZ1 A;  2ZPH B;  4KRT A;  4FYW B;  3M0T A;  3QJY A;  1YCS B;  1QVF A;  2QAZ A;  4E7H A;  1SPK A;  4IUU A;  3ZBD A;  5LJ5 h;  1VIE A;  2LCC A;  1R0C B;  4FW1 A;  5KE3 A;  3EFR A;  1U1T A;  1S72 Q;  3BY7 A;  1OZ2 A;  4M77 E;  1WHG A;  4M4Z A;  1UGP B;  3PT9 A;  1M2V B;  2XDB A;  5GAM g;  1W2B S;  2VV5 A;  3ASK A;  2OAU A;  1K9A A;  1VQ6 Q;  4C5E A;  3M0P A;  1SRM A;  3JB9 F;  4M75 F;  1BI1 A;  1RUW A;  2V1Q A;  3L1A A;  4M7A C;  2X4W A;  1WDX A;  1K0S A;  4RTX A;  5LJ3 h;  3JCM Q;  3DKM A;  5GAM j;  1KD1 R;  5FW9 A;  3GIB A;  2CT4 A;  2FHD A;  1D0Y A;  4JZ4 A;  1OOT A;  2XDD A;  3RBB B;  4X9D A;  3OYE A;  2GFA A;  2M9U A;  1V1C A;  5FWB A;  4C0D B;  1QKX A;  4OB1 B;  3H0F A;  3OW2 S;  1X2K A;  4X34 A;  3HP9 A;  1NM7 A;  3L2Q A;  2EJ9 A;  5IXF A;  4DQ2 A;  2E6N A;  4LUD A;  3A1P A;  2LJ3 A;  2R5M A;  4M7D E;  3P8D A;  2QAS A;  1O75 A;  3JB9 J;  4J9B A;  2L89 A;  1PKT A;  2F2V A;  3HFN A;  3CPF A;  3TRE A;  1GBR A;  4IIO A;  2IVW A;  2KE9 A;  1NLO C;  3OSS C;  3A8H B;  1GCQ A;  2OX7 A;  3BDU A;  1VOM A;  3REA B;  2C0O A;  4PK4 A;  4ELZ C;  2DET A;  2HQX A;  3HFO A;  2HQH A;  2QEX T;  5CK9 A;  1VQN A;  1KC8 R;  1W70 A;  1TXQ A;  2QQS A;  2P84 A;  4RCC A;  1PM3 A;  5CCA A;  3SB2 A;  4Y28 E;  1VQ7 Q;  2VKN A;  3C12 A;  2IG0 A;  2EYY A;  3E2U A;  4L5G A;  4EMH A;  5C0M A;  2HSE B;  2GFU A;  3V7R A;  2GF7 A;  2DX1 A;  3HKS A;  2RMO A;  4M7D D;  4M7A E;  1C1A A;  4X1V A;  1QCF A;  4E7S A;  2SEM A;  1WHJ A;  4R56 A;  2EPD A;  4KGZ B;  5GAM h;  2QDY B;  1KHC A;  1KG1 A;  2EVR A;  4VUB A;  1QVF S;  1UGV A;  4F17 A;  1EFN A;  3KXT A;  3JCM X;  2DTH A;  2MI6 A;  3VS1 A;  4OMF B;  1K9M R;  1ZA2 B;  5CKE A;  1IXD A;  4F7U A;  2YRC A;  3OA6 A;  3MP1 A;  3RMS A;  3X24 B;  4E7I A;  2BIV A;  3CC2 A;  1R8O B;  4A54 A;  4QVC A;  3I55 T;  2JTM A;  5GAN 5;  2RQW A;  4P5N A;  1D3B A;  4PJJ A;  3CCJ T;  1VQ5 A;  1AWO A;  4KUD K;  1TG0 A;  4M77 A;  4XU1 A;  4E7L A;  2HCK A;  4AG2 C;  2JUF A;  1KFZ A;  4ZN1 A;  2CH4 W;  3A5Z B;  2CH4 A;  4ZGD B;  1Q82 C;  3FB9 A;  2EBP A;  2GGR A;  5DLQ E;  1SHG A;  2DIQ A;  2KGT A;  2FL7 A;  4M78 G;  4WCI A;  2L3Q A;  4FW2 A;  4M78 B;  5KH6 A;  1WFW A;  4BD3 A;  2CRE A;  1JRI A;  3WXM B;  5M9O A;  2K5L A;  4ELY C;  2V8I A;  4PFO A;  3C94 A;  2QEX A;  2LMJ A;  2Y90 A;  3CMA T;  4YTL A;  1VQ4 A;  4F7U F;  3UA6 A;  1YIT T;  2QXF A;  1XJW B;  2FPF A;  2B86 A;  2DJZ A;  1D3B B;  3RDV A;  3E19 A;  4IUQ A;  2RH2 A;  4MZT A;  4AFQ C;  1VQK Q;  3DB4 A;  2E65 A;  1UEB A;  1YJN T;  1M3A A;  4C92 D;  4ZGJ B;  4OMP A;  4M77 F;  2LJ0 A;  1IHW A;  3WVD B;  2JN0 A;  4N4G A;  3MET A;  4HVV A;  2FVU A;  1T0H A;  1M1G A;  2P0P A;  1PRL C;  3EH2 A;  3LYI A;  1ZBX A;  1ABQ A;  3QYH B;  8AT1 B;  1PSF A;  2E5K A;  2LQ8 A;  1N9R A;  1WXB A;  3OYM A;  1VQO T;  4J7F A;  5GJV B;  3LX7 A;  5GAN f;  1ZA1 B;  1Q82 U;  4LD9 K;  2J6F A;  1W2B P;  3MP8 A;  3CCJ A;  2ZZD A;  1B7T A;  1UUE A;  2DO3 A;  3CC7 T;  4M7D G;  2LNV A;  2QI2 A;  2EIF A;  1WNL A;  3ZEH A;  4M7D B;  2JM9 A;  1G3W A;  2DEU A;  4EMG A;  2E64 A;  2JNG A;  2PVD B;  3G4S Q;  5EG2 A;  2DAQ A;  2RJE A;  4M7A A;  3GNF B;  4WTO B;  3BE3 A;  2CSI A;  2YDL A;  3MP6 A;  2A08 A;  4F16 A;  3GOX A;  5IAY A;  4JJB A;  3OYI A;  3OW2 P;  1QCO A;  2E3I A;  4OMN A;  4KBM B;  3OYN A;  2JM8 A;  2LDM A;  1OYX A;  3MHX A;  1UG1 A;  5KYN A;  2RQU A;  3U23 A;  5I2M A;  1MMD A;  4DBF A;  4RG8 A;  4Z89 A;  2DIG A;  1C6V X;  2KNB B;  4CRI A;  1D09 B;  2M1H A;  4M7A G;  2EKO A;  4M7A B;  5I22 A;  3RKY A;  2EQJ A;  4L59 A;  3NFC A;  1YCY A;  2DA9 A;  4E7Z A;  2O01 E;  1G2B A;  4PJO F;  3L2V A;  4LD6 A;  1TUD A;  5I11 A;  1YIJ T;  1QMC A;  5GAN j;  3SWN A;  4F04 B;  4A63 B;  2PNI A;  5KCO A;  1KK7 A;  1I8F A;  2KXD A;  2MOX A;  2CSQ A;  1LOJ A;  1UGQ B;  2F69 A;  3JAM E;  1VQ9 T;  2CUD A;  1G3Y A;  1T3L A;  2L5Q A;  3CCV T;  3VV0 A;  4RUG A;  4EIK A;  3V8J A;  4RTU A;  4QVZ A;  4DEY A;  3EH1 A;  2EQK A;  3S3O A;  3X28 B;  4XTU A;  2LJ1 A;  1ZQ1 A;  2RHI A;  4HKE A;  3CCE T;  1SG5 A;  6AT1 B;  1QVF P;  1M1F A;  1NE8 A;  3UF4 A;  1Q81 R;  4JDS A;  1YWP A;  2LRQ A;  4MMK A;  4O6J A;  5J26 A;  2KEA A;  3QWY A;  1AZE A;  3H0I A;  3ULR B;  1K8A R;  4DBQ A;  1EIF A;  2KR3 A;  3VUZ A;  2LC4 A;  1GXI E;  2QK0 A;  3H6Z A;  2MYS A;  1YI2 A;  4ANJ A;  4CI0 C;  2KRO A;  4BI4 A;  1U3O A;  1M30 A;  4PL6 A;  4XK8 E;  2F2W A;  5GJW B;  2C0I A;  2IIM A;  3QPH A;  1IRX A;  2EGA A;  1WYX A;  2XIC A;  2YHT A;  4HCB A;  2ZPF B;  2NUP A;  1M90 R;  4J9H A;  3HRT A;  3VJP A;  5LJ5 g;  4M75 D;  3OSV A;  4Z8A A;  2RQV A;  1NG2 A;  3O5Z A;  5LL6 S;  3TSW A;  3PMI A;  4KGV B;  1PG5 B;  4IIM A;  2RM4 A;  1U06 A;  2EAY A;  2JS2 A;  2DBK A;  2NUZ A;  2DLP A;  1ZSG A;  1HD3 A;  5GMK j;  3CPW S;  1VQ9 A;  2DFU A;  3V7S A;  1TH7 A;  2GTO A;  1Q7Y C;  2DM1 A;  1MNE A;  3OW2 A;  2CP3 A;  5LJ3 g;  1YJ9 T;  3HRU A;  3G71 Q;  2COW A;  2EYW A;  2FO0 A;  1JQQ A;  3JCM e;  3S3M A;  2E6Z A;  4JRI A;  4JZ3 A;  2KI7 A;  4QT7 A;  1CSK A;  3OS5 A;  2NUP B;  1UB4 A;  3SDZ A;  2EQI A;  4AFS C;  2JZ2 A;  2NUT A;  3NTK A;  3VYG A;  3FRN A;  4A4E A;  5KYX A;  4J6X A;  3VRZ A;  4JJN K;  1M1K C;  1ZBJ A;  2FB7 A;  2DJQ A;  3R6N A;  2B8A A;  3JCM d;  3RER A;  2FPD A;  2K3Y A;  2BZ8 A;  2PU9 B;  3M59 A;  2BUD A;  2OTJ T;  1TTH B;  4JS4 A;  1R0B G;  1LCK A;  2CZ6 B;  3UAT A;  5I21 A;  2OJ2 A;  1GL5 A;  3CCS A;  5GAN 3;  3CCQ A;  3CCU T;  5GMK e;  1M2V A;  2JTE A;  4N4H A;  3L2W A;  3FLG A;  2E70 A;  1ARK A;  1YHQ T;  4QKU A;  1RAA B;  3UT1 A;  1VQ8 A;  2DYB A;  2LCS A;  1RAC B;  3OYF A;  2LX7 A;  1RAF B;  2ZPI B;  4ZTJ A;  1B3Q A;  1M8V A;  5CQX A;  4PJM A;  2DD5 A;  4CC3 A;  3CCR Q;  3OYK A;  2NUT B;  4QW2 A;  5KYX B;  4JJC A;  1WHH A;  2XID A;  2HBW A;  2H3E B;  3CCM T;  1H64 1;  3VS6 A;  2RQT A;  1WLP B;  2A7Y A;  1VQM T;  3BW1 A;  1IO6 A;  3NGP A;  3QHS A;  1Q7Y U;  4GLM A;  2CZ1 B;  3RUX A;  1OU9 A;  5HK0 A;  1VQP T;  1O9S A;  1VQN Q;  4J9C A;  2MAM A;  3CME T;  2NWM A;  1HYO A;  1TWB A;  2HAX A;  2DXC A;  2DK3 A;  1YJ9 A;  2AZS A;  4O5V A;  3CD6 A;  1M1K U;  2IPO B;  2O4X A;  1S72 T;  2ZAE A;  3OYY A;  1IGQ A;  1SSH A;  1H92 A;  2X4X A;  3OMG A;  4HT9 A;  3PVQ A;  4KT0 E;  4QQG A;  3H0H A;  4XQ3 A;  1BCO A;  3PMT A;  4FL6 A;  2DXU A;  2RI5 A;  1AWX A;  2E12 A;  4GLK A;  1VQ6 T;  1AWJ A;  1WXU A;  3I56 Q;  1B34 A;  3EGU A;  4EMK C;  1G3S A;  1UTI A;  2Z0W A;  2LQN A;  4OVA A;  1BKB A;  1G8X A;  2RJF A;  1BBZ A;  3M9Q A;  1H3Z A;  3EHR A;  3CC2 Q;  4AFU C;  3CCU A;  3OYG A;  2BE9 B;  4EPC A;  3SHW A;  5GAO n;  2MCN A;  4C92 C;  3MEA A;  2K5I A;  1VQ5 Q;  4NS5 A;  1WQ7 A;  4J6Y A;  2O4X B;  2DXT A;  4J5Y A;  1AVZ C;  3PTA A;  1VYT A;  4JLI A;  2V26 A;  2LNH B;  3PGG A;  3OYA A;  3LW5 E;  2A0F B;  1MND A;  5AYF A;  3OMC A;  2VAS A;  3VS3 A;  4XTZ A;  1ZUK A;  5KYU A;  3CCM A;  3S6W A;  2O31 A;  5IHK A;  1B34 B;  2DF6 A;  4FM4 B;  3CXC S;  3OBY A;  1BI0 A;  3M0Q A;  1VQP A;  4C0Z A;  1Y96 A;  3JCM b;  4BUG A;  1VQ4 Q;  2KT1 A;  2VB6 A;  3QKJ A;  2D8H A;  2RI3 A;  4GBQ A;  2C06 A;  4KGX B;  3QO3 A;  2QA4 T;  1UE9 A;  1M9S A;  2CGH A;  2GCX A;  4OML A;  1D1B A;  3UWN A;  3OY9 A;  1VQ7 T;  1F1B B;  2MWO A;  3EG9 A;  4M78 A; 
#chains in the Genus database with same CATH homology
 4DEX A;  2K3B A;  2JXB A;  1N5Z A;  2JM9 A;  3VRY A;  2AKK A;  2ROT A;  1I07 A;  4ZNX A;  1X6B A;  4CC4 B;  2KT8 A;  1ZX6 A;  2LZ6 B;  2CSI A;  2EKH A;  2OAW A;  3VS4 A;  2KYB A;  2YDL A;  1YNZ A;  2A08 A;  4F16 A;  1WI7 A;  2KRM A;  2J7I A;  3VS5 A;  3THK A;  3QWX X;  2KYM A;  2YT6 A;  1W1F A;  2AZV A;  1OPK A;  4JJB A;  1SEM A;  2ENM A;  2L3P A;  2LQW A;  4JPB W;  1FYN A;  1GRI A;  1PWT A;  1AWW A;  4OMN A;  1YWO A;  2FG0 A;  2JM8 A;  2OI3 A;  1ZUY A;  1UG1 A;  1E6G A;  2HEQ A;  2DL7 A;  2A37 A;  2RQU A;  5IHI A;  1JU5 C;  3U23 A;  1K4U S;  2M0Y A;  2EW3 A;  2H8H A;  5IHN A;  2RN8 A;  4Z89 A;  2K2M A;  1YP5 A;  1BB9 A;  1JO8 A;  2CUB A;  1RI9 A;  2KBT A;  2KNB B;  4RTW A;  1X69 A;  1PNJ A;  2DRK A;  2DBM A;  2DRM A;  2CT3 A;  1A0N B;  5I22 A;  2O88 A;  2AKL A;  4LUE A;  2F2X A;  2JS0 A;  1CKA A;  2BZX A;  2DA9 A;  3EG1 A;  2LP5 A;  4LN2 A;  1G2B A;  4LE9 A;  1UEC A;  1RLP C;  1TUD A;  3NMZ C;  5I11 A;  2G6F X;  1NLP C;  4HVW A;  1J3T A;  2JW4 A;  1QWF A;  2PTK A;  4A63 B;  1UFF A;  1WA7 A;  4J9I A;  2PNI A;  1I0C A;  1KSW A;  1I1J A;  2KXC A;  2KXD A;  4LNP A;  2MOX A;  1VYU A;  2D1X A;  2CSQ A;  4F14 A;  4FSS A;  2FRW A;  4R0K A;  2CUD A;  2K79 A;  1WX6 A;  1T3L A;  2L3S A;  1BU1 A;  1OPL A;  4RUG A;  3PE0 A;  1KIK A;  3EG3 A;  5HCK A;  4EIK A;  1PRM C;  2GBQ A;  1TUC A;  3FJ5 A;  1WIE A;  4RTU A;  2W0Z A;  1YN8 A;  3EHQ A;  4DEY A;  2VWF A;  1ZLM A;  3I5R A;  1GCP A;  1T3S A;  1X43 A;  2LJ1 A;  1UJ0 A;  2J06 A;  1OV3 A;  1X27 A;  5IXB A;  1E6H A;  4RTZ A;  2DNU A;  3PVL A;  3UF4 A;  1YWP A;  1M8M A;  2KEA A;  4Z88 A;  2QDL A;  3QWY A;  1AZE A;  3H0I A;  2X3X D;  3M0R A;  3ULR B;  3CQT A;  2DIL A;  3I9Q A;  4J9F A;  1PHT A;  2KR3 A;  3SEM A;  1AOJ A;  3NHN A;  3EG2 A;  2ED1 A;  1B07 A;  2O2O A;  1PKS A;  1X2Q A;  1H3H A;  2O9V A;  1JEG A;  5L23 A;  2M51 A;  2PZ1 A;  4KRT A;  4HCK A;  3M0T A;  1MV3 A;  1YCS B;  2C0T A;  2KRO A;  1Z9Q A;  3EG0 A;  1SPK A;  1U3O A;  1M30 A;  3VS2 A;  4D8K A;  2F2W A;  5GJW B;  2YUN A;  2C0I A;  2IIM A;  4E6R A;  1ABO A;  1UJY A;  3M0U A;  3NPF A;  1K1Z A;  2EGA A;  1WYX A;  2YUP A;  5EC7 A;  1GFD A;  4M4Z A;  2RQR A;  3M0S A;  3TVT A;  1QLY A;  4J9H A;  2EYX A;  4JJD A;  1K9A A;  2W10 A;  4OMO A;  3M0P A;  1SRM A;  3H41 A;  2DVJ A;  4Z8A A;  2K9G A;  1RUW A;  2RQV A;  2V1Q A;  2D8J A;  1NG2 A;  3O5Z A;  1WDX A;  1K0S A;  4RTX A;  3TSW A;  2L0A A;  1AD5 A;  1UDL A;  5FW9 A;  1JXO A;  2CT4 A;  3JV3 A;  1FMK A;  4RTV A;  4IIM A;  1U06 A;  2JS2 A;  1QKW A;  2DBK A;  2NUZ A;  2DLP A;  4JZ4 A;  1ZSG A;  2XMF A;  1HD3 A;  1OOT A;  2D0N A;  3RBB B;  2GTO A;  2DM1 A;  2V1R A;  3VS0 A;  1V1C A;  5FWB A;  1QKX A;  2ED0 A;  4J9D A;  2EYW A;  2FO0 A;  3H0F A;  1JQQ A;  1X2K A;  1MV0 B;  1NM7 A;  4JZ3 A;  5IXF A;  4QT7 A;  4LUD A;  1CSK A;  2LJ3 A;  2EQI A;  4AFS C;  2ABL A;  4J9B A;  2YUQ A;  1PKT A;  3RNJ A;  2F2V A;  2RNA A;  3VRZ A;  1GBR A;  3UA7 A;  4IIO A;  1ZBJ A;  2DJQ A;  2ROL A;  1GBQ A;  2DE0 X;  3R6N A;  2FPE A;  2KE9 A;  2J6K A;  2FPD A;  1NLO C;  1RLQ C;  2BZ8 A;  2YSQ A;  1GCQ A;  3REA B;  2C0O A;  1CKB A;  2JMA A;  1LCK A;  2CDT A;  3UAT A;  2OJ2 A;  4HVU A;  1GL5 A;  2DMO A;  2JTE A;  1ARK A;  1GFC A;  1M3B A;  2J6O A;  2RF0 A;  1NEB A;  1HSQ A;  1W70 A;  2DYB A;  2LCS A;  2LX7 A;  1B3Q A;  3I5S A;  4RTT A;  2VKN A;  4CC3 A;  1JXM A;  4AFZ C;  2EYY A;  3KFV A;  3ZL7 C;  1KJW A;  2X3W D;  4JJC A;  2HBW A;  2DX1 A;  2SRC A;  2RMO A;  3VS6 A;  2RQT A;  1WLP B;  4X1V A;  1QCF A;  1IO6 A;  2SEM A;  3NGP A;  3LH5 A;  2EPD A;  2GTJ A;  4GLM A;  1AZG B;  2P4R A;  1E7O A;  2EVR A;  1UGV A;  4J9C A;  4F17 A;  2BZY A;  1EFN A;  2L2P A;  2KRS A;  2EYZ A;  2MIO A;  3VS1 A;  2NWM A;  4J9E A;  2JMC A;  2FEI A;  2AZS A;  4K11 A;  3C0C A;  2YUO A;  2AK5 A;  4J9G A;  2DL3 A;  2RQW A;  3TSZ A;  1SSH A;  1H92 A;  1S1N A;  2BTT A;  3PVQ A;  1UHC A;  2KRN A;  3H0H A;  1AWO A;  1WXT A;  1AWX A;  2GQI A;  1AWJ A;  1WXU A;  2K6D A;  1TG0 A;  2HCK A;  2A36 A;  4AG2 C;  1KFZ A;  3REB B;  1Y0M A;  2FRY A;  1H8K A;  2CH4 W;  2CH4 A;  3GBQ A;  1M27 C;  1AEY A;  2I0N A;  2EBP A;  2GGR A;  4HXJ A;  1K0X A;  3EGU A;  1SHG A;  2KGT A;  1UTI A;  2LQN A;  1VA7 A;  2L3Q A;  2DL8 A;  4WCI A;  4CC7 A;  2O9S A;  1BBZ A;  1WFW A;  2CRE A;  2HDA A;  4D8D A;  3EHR A;  1NEG A;  2A28 A;  4AFU C;  2ECZ A;  3VS7 A;  4ORZ A;  3SHW A;  2LMJ A;  2MCN A;  2HSP A;  4ESR A;  4OMM A;  1NYF A;  4AG1 C;  2VVK A;  2K7A A;  1AVZ C;  2DL5 A;  3A98 A;  3UA6 A;  1Y57 A;  1K76 A;  1VYT A;  1U5S A;  2LNH B;  2FPF A;  2B86 A;  1BK2 A;  5FWC A;  4AFQ C;  3VS3 A;  1ZUK A;  1M3A A;  2O31 A;  4OMP A;  5IHK A;  2DF6 A;  2LJ0 A;  1SRL A;  2EGE A;  2J05 A;  1HJD A;  1T0J A;  2DL4 A;  4RTY A;  4CC2 A;  3M0Q A;  4OMQ A;  1OEB A;  4HVV A;  4Y92 A;  1T0H A;  2KT1 A;  1QWE A;  1PRL C;  1GCQ C;  2RPN A;  2GNC A;  1UHF A;  1XOV A;  2D8H A;  5ECA A;  4GBQ A;  1ABQ A;  3I35 A;  1ZUU A;  2E5K A;  1WXB A;  1UE9 A;  1VYV A;  2JT4 A;  1M3C A;  1Z9Z A;  5GJV B;  2EGC A;  1SHF A;  4OML A;  2ESW A;  3IQL A;  5IH2 A;  1W6X A;  1X6G A;  1MUZ A;  1NYG A;  2J6F A;  1G83 A;  1UUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...