4C8QG

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
69
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNRKLGLTVIRGTILVSLSSAEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
total genus 11
structure length 69
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qG00
3JCMf 1M5Q1 2EAYA 4M7AA 2DTIA 4M77B 5GAOp 1HXDA 3JCMd 3SWNB 5GMKi 4C92F 3JB9G 1N9SA 3HFNA 5CAIA 4M7DA 3QSUA 1U1TA 1H641 5GMKj 4M78D 4NL2A 4C92B 4XTVA 3BFMA 3BY7A 4MMKA 4XTWA 4A53A 4M77F 4XU0A 2E41A 3SWNA 5GANe 4M75C 4M75A 5GAMh 3SWNC 2YLCA 4M75F 5LJ3g 5GAMg 2YHTA 2VXEA 5LJ3d 4C8QD 3JB9J 1I8FA 1I4K1 2DZCA 4PNOA 5GANh 1M8VA 1WPYA 3JB9H 2DTHA 1D3BB 2EJGA 3V8LA 2FB7A 5LJ5d 1JRIA 4N0AC 4C8QE 4C8QG 5GAN4 4PJOD 2I2LA 4PJOG 4M7AB 5GANj 4PJOE 4M7DF 1Y96B 3V7SA 4OP0A 2ZGWA 2DVEA 2FYKA 2Y90A 3JCMW 1N9RA 2DZ9A 3RKYA 2DXUA 4M75G 3FB9A 4M75E 4EMKB 5GMKh 5GMKm 4M77C 1BIAA 4M78F 4RCCA 4QVDA 4M78A 3JCMb 1KQ2A 5GAOn 1D3BA 4M78E 4M78G 4C8QB 5GANg 2QTXA 3QO3A 5GAOr 3V8KA 5GMKl 3VU3C 4EMKA 1LJOA 1WQWA 1Y96A 4V2SA 4C8QF 2EWNA 4C8QA 2RA2A 4M75B 3RERA 3M4GA 3HFOA 4XTYA 4M78B 1LOJA 1B34B 4WF2A 4XU2A 3JB9D 4C92C 5LJ5g 4PJOC 2JN0A 5LJ5h 5GAMd 3L1AA 1MGQA 4F7UA 3FIFA 2RM4A 4M7AC 4NL3A 4RCBA 4XTUA 4J6WA 4JRKA 2DTOA 4M7AD 3RUXA 4M7AF 4DQ2A 3JCMP 4HT9A 3EFRA 1HK9A 3PGGA 4F7UF 1X01A 3FJPA 4C92A 3V7CA 3BDUA 5LJ3f 4M75D 1WNLA 3RIRA 4M7DG 5GAN2 4HT8A 4M7DE 5GAMj 1BIBA 3QUIA 5DY9A 2RB6A 5GAN7 5GAOq 2E1HA 1WQ7A 3INZA 1JBMA 4XU1A 4M77D 4C8QC 3JB9I 4M7DB 3HSBA 5GAN8 3SB2A 5LJ3j 3RESA 4X9DA 4F7UB 4J6XA 4J5YA 4XTZA 3JCMh 3V8JA 4J6YA 4EMKC 1TH7A 4NOYA 4QVCA 3JCMJ 4C92G 2YLBA 3RKWA 4C92E 3JB9F 5I21A 2VXFA 1B34A 4XU3A 4M78C 4XQ3A 2DJZA 4XTXA 4M77A 2E10A 5GAMe 2HNIA 3JCMe 4M77G 4JRIA 4M77E 4X9CA 3JCMg 2DKGA 3BW1A 3QHSA 3JCMc 5GMKe 4PJOF 1I5LA 5LJ5f 4M7DC 3EFSA 1KQ1A 3JCMQ 4M7DD 4C92D 3AHUA 5GAMf 2CGHA 4HA8A 4MMLA 4N0AA 5GAN5 1YCYA 2E65A 5GANd 1I81A 3L2ZA 3JCMV 3RKXA 4Y91A 4EMGA 2E64A 4M7AG 4A54A 2EJFA 5GANf 1U1SA 5LJ3e 4M7AE 4PJOB 4JLIA 5GAN3 4PJOA 5LJ3h 2K57A 4F7UG 4F7UE 3GIBA 3V7RA 2RD1A 5GAOm 2DXTA 5LJ5e 2VC8A 4EMHA 4JUVA 2EJ9A 5GAN6 5GAOl 3JCMX 2DEQA 1LNXA 5LJ5j
chains in the Genus database with same CATH superfamily
2CP7A 3MEUA 3TSZA 4M7AA 4M77B 2RQVA 2YRDA 4PFZA 3PNWC 2MIOA 2D6FA 3A98A 1VQ4T 1B3QA 4OB1B 2HSEB 3NMZC 3CC2T 3CD6A 1WFWA 2CYZB 2GGRA 2R57A 2JMCA 2M02A 3QYHB 1WGSA 3EG0A 2NUPB 3CCQA 2L8DA 3REAB 1T3LA 1MMNA 1X2KA 2QEXA 3M9QA 2CP3A 4FIBA 1T3SA 2DZ9A 3VS2A 4X1VA 1BI0A 1UGPB 3CC2Q 3G71T 4PL6A 5DM7R 1VYTA 2ROLA 3CCEA 3I55T 3QJYA 3JB9D 2LMJA 4ANJA 3TREA 3OS1A 2RQWA 2ZPIB 2QGGA 1ZA1B 3JV3A 1KD1U 4FT2A 3URGA 3NTKA 4HT9A 3GNFB 1G83A 1PWTA 1X01A 4CI0C 4C92A 2CH4W 1M3CA 3A8MB 5KYYB 4C8QC 3OS5A 4Z89A 2G6FX 3SB2A 1HSQA 5GJVB 3EH2A 1BI2A 3JCMJ 2G3RA 2DLPA 2MK5A 3PT9A 3DKMA 2RN8A 1YJWT 2EGAA 2CREA 3CCUQ 1FWZA 2LQWA 2X3WD 1QVGS 3OMGA 2KY9A 1MUZA 1SPKA 2E65A 3EHRA 2E6NA 2EGEA 1IHWA 4GY5A 2ZPHB 4JLIA 1VQMQ 3CC7T 1PKSA 2QGFB 4KUDK 4KBMB 3EGDB 3MHXA 3CCLA 1LNXA 2QQAA 1MMAA 3C12A 2NWMA 3EH1A 1M8MA 4C0FA 3HFNA 1H641 2NUZA 3HL8A 1KC8R 1MNEA 3I56T 4ZNXA 2FPFA 1I0CA 4BUGA 1N9RA 2HAXA 4OMLA 3S3MA 4RCCA 2YUNA 2DX1A 4FYVB 2NUPA 1D0XA 2LX9A 4OMFB 4C8QB 3VU3C 1Y96A 2D8HA 4FYYB 4C8QF 4RTVA 4E7LA 2GNCA 2K2MA 2LT4A 2RJCA 3QKJA 2JN0A 4JJCA 5ECAA 2RM4A 4M7AC 2HEQA 1TS9A 1X75C 2EYXA 2L2PA 4HCCA 4BE2A 3HP9A 4M75D 1PKTA 1ZQ1A 2DMOA 1PG5B 2M51A 2BTTA 2X9HA 4XU1A 1IGUA 3HSBA 1TUCA 2RK2A 1ZBXA 3OSSC 2X4YA 1KIKA 3EGDA 3VUBA 1QCOA 1OOTA 1OU9A 3UPUA 2DYBA 3CQTA 5GAMe 2ZAEA 1LCKA 1XOVA 1UTIA 2P4RA 3EFSA 2OI3A 1IXDA 3S3OA 3RR6A 4J9CA 2RHUA 4FM4B 3CCST 4LN2A 3GBQA 2QK0A 3PFSA 3RDVA 1XNIA 2DL3A 5IHIA 2XHCA 4MZPA 3PVQA 1J3TA 1M5Q1 2M0OA 4MZMA 3CCJQ 2AK5A 5FU6C 3OBWA 7AT1B 2EVRA 3EG2A 4ESRA 2O31A 4ME7A 2V8JA 4E6RA 2HQEA 4C0ZA 2PNIA 4QVZA 1Q86C 1R77A 2EGCA 2LNHB 1D3BB 3V8LA 5LJ5d 2FB7A 1K8AR 4N4IA 3P8DA 3C0CA 5GMKh 2A36A 2EW3A 2I0NA 2C06A 2OTJQ 4K11A 4C5HA 1RAHB 4HCKA 4FL6A 2EIFA 1JB0E 4F04B 1W70A 4O6JA 5LJ5h 1PD0A 2CSIA 1KJWA 2XD0A 4ZTFA 3OYKA 4FW1A 1HYOA 3HKSA 1HK9A 3CCSQ 4HVUA 4ZN3A 3ER0A 1O9SA 2GQVA 5IHNA 3QYGB 2RB6A 2E1HA 2CDTA 2FZCB 2OAWA 4R55A 1W4SA 1K8AU 3JCMh 1K1ZA 4QVCA 2O4XB 5KE3A 1Q95G 4PKCC 2W10A 3S6WA 1GFCA 2RI5A 1YITT 1YI2A 4N4GA 5GMKe 4M7DC 3E19A 2QAZA 2DIQA 3VRYA 5KYXA 3OYFA 4E7SA 4BY6C 1D1AA 2JJ9A 1NZ9A 1NEBA 1K9MC 1WA7A 2XG8D 4JS4A 1UGSB 2P4TA 4EMHA 2O4XA 1BB9A 2EJ9A 2L0AA 2WSFE 3JCMX 2LRQA 2IG0A 4CRIA 5C6SA 2RJEA 2QQBA 2HMAA 1YN8A 3MEWA 5GMKj 4KGXB 4M77F 4JJDA 1KSWA 3EFOB 1VQKA 1WZOA 4R56A 2VXEA 1K9MR 1V76A 1TSFA 3SDZA 2X4WA 5GANh 1WPYA 1BK2A 2DTHA 4QT7A 3X28B 4PJOG 4BE1A 5A2QE 1S1NA 4M75G 3ULRB 3CC7Q 1VQMT 3EHQA 4WCIA 1VUBA 2DD4A 2E70A 1WXBA 5M9OA 1YHQT 2GFUA 3A8HB 2E3IA 4V2SA 2HKQB 5IT9E 2CZ7B 1VQ7T 4LDYA 2LQKA 3ASKA 1M2VA 3NFCA 1YJWQ 4HCBA 2KMTA 1MGQA 3PMTA 5KYYA 1UJ0A 1QVFS 1RAFB 3JCMP 3CC4T 3CCJA 4M7DE 3KBGA 5DY9A 3A8GB 3OYYA 1RAGB 2VVKA 1M1FA 1N8RR 4F7UB 2PVOB 2VKNA 1X6OA 2O9VA 1M2VB 4XU3A 4PJMA 3QWYA 1SSHA 4RG2A 2E10A 3JCMg 1X6GA 2QYZA 2V1RA 2DF6A 1QWFA 1KQ1A 2DRMA 4C92D 2C0OA 4MMLA 2BZXA 1Q82U 3FJ5A 4LDXA 1E6HA 1OI1A 4EMGA 1IRXA 1V29B 1K73U 3G6ET 2NLUA 3LX7A 4RTUA 8ATCB 2QG9B 3E2UA 1Y71A 5GAN6 1VQPQ 1YJWA 3CCET 2FPEA 1X6BA 1FMWA 3EG1A 4BB7A 1FXXA 3QDFA 3CMEA 4B9WA 3OW2P 2EYZA 3CPWA 2DJQA 4Z02A 2EFIA 5FWCA 3SEMA 1K73C 3M0UA 5CR2A 2YRVA 2ABLA 4IUQA 2NUTA 2BZ8A 5LJ3d 1ZLMA 2GTOA 5CKEA 1AZGB 4N4HA 2EPDA 4C8QE 2ATCB 1AWXA 2PZ1A 3CD6T 4M7DA 2FYKA 1R0CB 1QQJA 1PSFA 2J06A 2YUOA 4M78G 3LLRA 3CMEQ 4FSXA 2MOXA 5FU7B 3VKIA 1VQ9Q 3H8ZA 3CCVT 1UHFA 3CCJT 3J81E 2RH2A 2RHYA 1JU5C 1B34B 3M53A 2OJ2A 2FRYA 2EKOA 3EG9A 2K79A 1Q7YR 2D9TA 2KT1A 4HXJA 2XICA 5CKFA 3PGGA 4F16A 1H92A 2FRWA 1K9MU 4IUVA 1NJIU 1BIBA 4D6WA 2XDBA 3INZA 5GAN8 1XJWB 1YNZA 4Z8AA 1EZZB 2DL7A 1B34A 3UT1A 2YRCA 2KVQG 4ZGJB 3X25B 2DM1A 1QVGP 2AT1B 2CT4A 1I5LA 4GBQA 3CC4A 2YXYA 4HA8A 1ZSZA 1UHCA 1YFNA 3UA7A 4FYWB 3RKXA 4M7AE 3I35A 5LJ3e 3G1JA 1E6GA 3X20B 2J05A 2DXTA 5GAOm 1NM7A 3RMQA 3OB9A 3MKDA 1K76A 5KH6A 2FZGB 2ESWA 3KUFA 2K3BA 3E9GA 2QDLA 4ZGDB 3D7SB 1N6AA 3SWNB 4C92F 5CAIA 2K5IA 2SEMA 4B6MA 3CCRQ 5I22A 2DETA 2LQNA 4DBFA 3OA6A 1MV3A 4RMOA 2K4YA 2DD5A 2DNUA 1NLOC 2X51A 4OMMA 4BI3A 4PJLA 1NE8A 1AT1B 3L42A 3LH0A 3EAEA 1S72A 4OP0A 3VS0A 5GMKm 2HQHA 3M0SA 2KRMA 4RKUE 3JSCA 4JZ4A 3G71A 5GAOr 1E7OA 4Y92A 2R5MA 1YIJT 2DVJA 4QW2A 1OEBA 1ZUUA 2KGTA 3ZFJA 3CCMA 3M55A 4M75B 1F1BB 3VYHB 2ZZDA 1YJNT 1K73R 4OMOA 4F7UA 5A0LA 3FIFA 3I5SA 2R58A 2M1HA 3H0IA 4JRKA 4M7AD 2E6ZA 3FC3A 3CCLQ 2RHXA 3NTIA 3CC2A 2ED1A 1VOMA 1WNLA 3RIRA 3VS6A 3CCRA 3OYHA 4A4KA 2F2WA 3J7AF 2QEXQ 3V8JA 3CPWS 4C92G 4AMCA 4XK8E 2D8JA 4OB0B 1YWOA 2FVUA 1W6XA 4M77G 3G6EA 3QHSA 4IUPA 2LZ6B 2CH4A 2MMPA 1LVKA 2WSCE 1I81A 3EGXB 1QCNA 2V8KA 4PJJA 3LWIA 4F7UG 1D0YA 2PUKB 2BE9B 2O01E 1KC8C 2JUFA 1CKAA 1Q7YU 2LX7A 3C95A 4M7DB 2F1LA 2EAYA 3G4SQ 2DTIA 4BACA 1O75A 1QVFP 3I55Q 3OYIA 1RUWA 1HXDA 4UC4A 4M78D 4LXCA 4MMKA 5GANe 3VS3A 3I5RA 2MI6A 3QJ6A 3SHWA 3GOXA 1D1CA 4C8QD 2KXCA 1I8FA 1I4K1 4FSSA 1NEGA 1QKXA 2KXDA 1EX4A 1M8VA 3QZ9B 3SFMA 2EJGA 4B9XA 3F70A 1VQ7A 1GBQA 2ECZA 2BKDN 2WACA 1NYFA 4C0DC 3JCMb 4OB3B 1ZUKA 1UUEA 2D0QB 1SSFA 5C0MA 1VIEA 1IO6A 1IB8A 2MCNA 3FDRA 3EFOA 3WVEB 1VQ5Q 4WF2A 3L2RA 1Y07A 2K3YA 3HRTA 1N8RU 4E7IA 1MNDA 1HD3A 1G5VA 2DTOA 4BE0A 2K5LA 1N5ZA 3EFRA 4IKFA 4J9EA 1QLYA 3FJPA 1UEBA 3RBBB 5GAN2 4HT8A 3CPWP 2KK4A 3QBYA 2H8HA 5AT1B 3JB9I 1X69A 1IHVA 2K3XA 5KYXB 1JQQA 4BI4A 2JTFA 4XQ3A 2DJZA 2X35A 4XTXA 3VS4A 1ARKA 1QP2A 3MCAB 3M0PA 4ELYC 2K9GA 2BUDA 4M7DD 2XDDA 3T9NA 1N27A 1YCYA 1WJSA 1AZEA 5CKDA 1GRIA 3CMAQ 2VGMA 1FX7A 2QQSA 3GP8A 4PJOB 3CXCP 1Q81U 5AYFA 1BCMA 1NG2A 4A4EA 1YITA 3FEOA 4C5IA 2EYQA 2CP5A 2RJDA 4AT1B 1VQ7Q 2XI9A 1KQSP 2Y4XA 4QQGA 1QCFA 4XTWA 4XU0A 2H3JA 5KYWB 3ZBDA 1SG5A 2J6FA 4M75C 4M75A 2YLCA 5GAMh 3O5ZA 2ZPBB 4JPBW 1RAIB 2DZCA 5KCHA 3L2VA 1Y57A 1UB4A 1Y0MA 1BU1A 2GCXA 5GJWB 3JCMW 2Y90A 1JEGA 2DXUA 1KFZA 1WYXA 1X2QA 5D6XA 4LDWA 1Q86R 2EQIA 4R0KA 2KT8A 1NBEB 2RI2A 3CMAA 2RI3A 4LDUA 1BKBA 3MP6A 4XTYA 1G3YA 2P84A 3CCVA 1FMVA 4XU2A 4KUIA 5LJ5g 4C0GA 2DRKA 2OAUA 4C5GA 2HL3A 2RO0A 2H3EB 3H41A 2KNBB 2PU9B 4RTWA 2EYWA 1ABQA 2OTJA 2LDMA 3I55A 2IPOB 4C5EA 3QUIA 5GAN7 2OTLT 2OX7A 3LH5A 4J9FA 4J6XA 1VYVA 3VJPA 3META 3OW2S 1WXUA 2EYYA 3QG1A 1V1CA 5I21A 1W2BP 4QQ6A 1Q86U 1ZHIA 3QDRB 1JJ2A 3S3NA 2K5FA 3JCMe 4D8DA 1M4ZA 2HSPA 5CKBA 3M5AA 1QWEA 1NPPA 2F5TX 2VV5A 1D1BA 1YIJA 3GIBA 3OSVA 2YDLA 1X43A 5GAOl 2JVVA 5CQXA 1VQLT 1YI2Q 2OTLA 4HKEA 2HQXA 2KRNA 1VQ8Q 1M2OA 1QW1A 1I07A 3TSWA 1TG0A 4RTXA 1C6VX 2VASA 4JLGA 3ZEHA 1WHJA 5LJ3g 4L59A 2KRSA 1K8AC 3N5BB 1RAAB 2JTEA 3A8LB 1T0HA 2VGNA 1M1KU 1YHQA 2YUQA 3L2UA 3EGUA 1T0JA 3CPFA 5GAOn 1GFDA 3A1PA 4JZ3A 1WXTA 3NPFA 1VQ8A 4AFZC 2KQWA 3QPHA 1WJQA 4BDYA 2PVGB 3LGLA 1RLPC 5IXFA 2QQRA 1YJNQ 3UATA 4JDSA 1LOJA 3CCQQ 4JJBA 2RNAA 1LPLA 1ABOA 2KEAA 2LVMA 2O2OA 4RTTA 1YITQ 4EDUA 1MV0B 1K0XA 1EIFA 2A3LA 4RTYA 5J3BA 4J8OA 2CUDA 2E5QA 2JOYA 1ZUYA 1VQLA 2LCLA 2CP2A 4KGZB 1S72Q 2L5QA 3HRSA 2LQ8A 2QQ9A 4LNPA 4ATOA 1Z9QA 2EQJA 2LC4A 5KE2A 1VQ5A 4EMKC 2YLBA 3CCLT 1BYMA 3PIPA 4KH1B 3HTRA 3CC7A 3ME9A 3BW1A 2DFUA 4J9BA 1M90U 2KSSA 4NS5A 1N8RC 1K0SA 2EQKA 3G4ST 1YI2T 1K9AA 2PQWA 4J9GA 1YP5A 3HRUA 4IUUA 1QVGA 4EIKA 2VC8A 1JO8A 2F2XA 4LUEA 3FLGA 2CP0A 1SKUB 1VQ9T 2KROA 2C0TA 3H0HA 3HPWA 4O5VA 4M75F 2YHTA 2HKNA 1P92A 3UWNA 1Q7YC 3JB9H 2HCKA 2GTJA 3AT1B 3I56Q 3DB3A 4PJOE 2AKLA 1Y96B 3E9FA 4Y28E 2A28A 1PM3A 4M75E 4EMKB 1UG1A 1G2BA 5IN1A 4AFQC 2LJ3A 3VS7A 2A7YA 1NPRA 4KGVB 1GL5A 3LGFA 2HD0A 5IH2A 4XAXB 4IIOA 2XU8A 1W1FA 2RA2A 5CVIA 2EQMA 3GNGA 3TVTA 1TUGB 3LW5E 4BD3A 4J6WA 4AG2C 3QIIA 4OB2B 3PTAA 2DXBA 4M7DG 3MPUB 1M3BA 5GAMj 1OX8A 5CCAA 4A4HA 2F2VA 4KT0E 2HL5C 3CBOA 1TH7A 2BE7D 1OULA 2LCCA 3TCJA 1H8KA 4OF1A 1VIFA 1VQKT 4KH0B 4FU6A 4Q5WA 2PUOB 3OYBA 2QA4A 2RD1A 4ZGEB 4E47A 1VQOT 5HK3A 5LJ5j 4E7KA 4DA4A 2P0QA 1Q82R 1D09B 2DBKA 2HDAA 4IIMA 1OZ3A 4C92B 4XTVA 3L2WA 4J9HA 2XMFA 3PE0A 4OMNA 3RNJA 2V26A 4D8KA 3VUZA 4HVWA 4VUBA 1VQNQ 1D0ZA 2QASA 1OQKA 2ROTA 2AZVA 1ZBJA 1G3WA 3CCMT 1ZA2B 5GANj 3CCUT 1Q82C 3CCUA 3RKYA 2P0PA 4DBHA 4M78A 1KQ2A 1KD1R 1TTHB 2QTXA 5L8RE 3V8KA 4E7HA 3HHTB 4KRTA 1RI0A 3X26B 5HY6A 2EWNA 4C8QA 1PNJA 5KYWA 5L23A 2CT3A 2CP6A 5J39A 2QA4T 2W0ZA 4C92C 2DL4A 1KQSS 1OPKA 1YHQQ 1SEMA 4J9DA 3TU4K 3RUXA 2J6OA 2X4JA 3J80E 2MWOA 2K6DA 3Q1JA 2FEIA 2D1XA 3DLMA 4PLIA 1KQSA 4M77D 4ZN1A 5CIUA 2A0FB 2HZYA 4J5YA 4OGEA 4JJNK 3OS2A 2AIRB 4QKUA 4PFPA 3JCMc 2JS0A 2XK0A 5LJ5f 3JCMQ 2L3PA 1U5SA 2KYMA 1FMKA 5CQYA 1NJIR 4EPCA 3MO8A 3I56A 2DBMA 3QXEB 1RI9A 5GANd 1GCQC 5FW9A 1TU0B 1VQNT 4M7AG 5GANf 1SRLA 4OGCA 5LJ3h 4FYXB 3VV0A 2K57A 5LJ5e 1CKBA 2VWFA 3UF4A 3GLXA 5FROA 2KBTA 3OYEA 2MF2A 3OYLA 2O9SA 5GAOp 5I2SA 2BIVA 5EC7A 2CUBA 2M0YA 3GF5A 4PK4A 1U1TA 4YTLA 2LP5A 4A53A 1WHLA 3OYNA 3SWNC 5GAMg 1AD5A 3M56A 4J7IA 2ZPFB 1SHFA 2K7AA 1GXIE 3FRNA 4J7FA 4RUGA 2CZ0B 2KAFA 3V7SA 1S72T 2RHIA 1QKWA 4M77C 1BIAA 4M78F 8AT1B 1WHHA 2EKHA 1M27C 1WQWA 2K2VA 2LNVA 2GQIA 1FYNA 3P8HA 4JRPA 1M1KR 4M78B 3G7ZA 1UFFA 4BI8B 3VS1A 2ED0A 5GAMd 1H3HA 2V8IA 3OQ5A 4F14A 2QDYB 2QXFA 1AOJA 4J83A 3M54A 4M7AF 1KC8U 1B7TA 3OYCA 4A4FA 4CC3A 2JW4A 5GAOq 1ACMB 3NHNA 3QZ5B 1WJRA 3M4YA 5LJ3j 4C0DB 4C92E 9ATCB 3JB9F 1WHGA 4GLKA 2E12A 4OMQA 4OVAA 1I5OB 4M77A 2GFAA 2QEXT 1I1JA 5KYNA 2HNIA 4LUDA 4TVRA 4FT4A 5KYUB 4P5NA 3R6NA 3CCQT 3DB4A 3AHUA 5GAMf 1AWWA 1RACB 4WTOB 1AEYA 3H6ZA 3VYGA 5FWBA 2RF0A 2MWPA 3MP1A 5GAN3 1SHGA 1VYUA 4F7UE 5FRNA 1UJYA 3MP8A 1PRMC 3X24B 3SD4A 2GF7A 5IXBA 2DERA 3LYIA 1M9SA 2DILA 3QSUA 2L3QA 1VQLQ 3BY7A 4BY6B 3U23A 2RQTA 2YT6A 1M1GA 1OX9A 3JB9J 4CC7A 1OYXA 1BBZA 4ORZA 1U06A 4N0AC 1R0BG 4PJNA 1VQ6Q 5GAN4 4PJOD 1UGVA 1XQHA 4E7JA 3FB9A 2LJ0A 3C94A 2DAQA 1OU8A 1IZ6A 2JT4A 2A37A 5FU7C 1TOVA 1VQ8T 3REBB 2ZPEB 5LL6S 3PVLA 2M16A 1OV3A 1WLPB 4A4GA 2JM9A 4DBRA 1VQOQ 2VYTA 1JXMA 3QWXX 3GPLA 4NL3A 2JZ2A 2F69A 3VS5A 5CK9A 3M59A 2ENMA 2DL5A 1YCSB 3A5ZB 3MEAA 1VQ9A 2FZKB 1VQKQ 1GBRA 3CCVQ 2DYIA 3JRZA 1G8XA 1SF9A 3KFVA 3OYJA 2RK1A 4XTZA 1U3OA 4J6YA 2AZSA 2IIMA 2LJ1A 5I2MA 2YUPA 5HCKA 3MEVA 4M78C 3UDCA 2CZ6B 1KK7A 1M1KC 3CEYA 3H9NA 1RL2A 2F5KA 2RQRA 4CC4B 3CD6Q 4HVVA 1K4US 1RLQC 4OMPA 1B07A 3MJXA 3L2ZA 1VQ4A 2DA9A 3OYGA 1NLPC 2E64A 3CMET 5IHKA 3G71Q 2O88A 1QVFA 4DBQA 1DJ7B 3V7RA 1GCQA 4AFUC 2P0KA 3PIOA 2RJFA 2DEQA 2HBWA 1VQ5T 4E7ZA 3EG9B 1AWJA 2KYBA 1HJDA 2V1QA 1NYGA 3TQ7P 2QI2A 1U8RA 4IURA 4AG1C 2NUTB 2J6KA 1RADB 2XKOC 4IUTA 3EGXA 1PCXA 1BI3A 2GBQA 1G3TA 3KXTA 1AHJB 2OTLQ 3IQLA 1W2BS 1IREB 3BE3A 2AKKA 2E3HA 3G6EQ 1BCOA 5EG2A 5GMKl 2JNGA 1WIEA 2PTKA 2CS7A 1LJOA 1PHTA 1XTDA 5HKCA 1VQ4Q 4L6V5 3CMAT 1ZSZC 2YSQA 2R5AA 1EFNA 4PLLA 3CBMA 3M0TA 5KYUA 3L1AA 1VQNA 3A8OB 3H0FA 1RAEB 4RCBA 2KI7A 4XTUA 3WVDB 5FRMA 1M30A 2WSEE 2DE0X 2ZCFB 4F7UF 4DOVA 2L3SA 1C1AA 3BDUA 1VQMA 3M57A 4BDZA 3THKA 1WHMA 1TUDA 3CCMQ 2Z0WA 1YJ9A 4X9DA 4NOYA 1IGQA 3OY9A 3RKWA 4JS5A 2DK3A 5HK0A 4X9CA 2DKGA 1VA7A 2JMAA 4PJOF 2DIGA 1PD1A 5GAN5 5D6WA 2LCSA 4Y91A 5CKHA 4A54A 1VQPT 1ZSZB 4A63B 4LDVA 1RABB 1X27A 4DEXA 4ELZC 2M9UA 4MDXA 3TEEA 3P8BB 1YJ9T 3JCMf 1VQ6T 4ZTJA 2EQUA 3OS0A 3JCMd 1VQOA 2DPPB 4NL2A 1Q81R 2OTJT 3BFMA 1YBYA 3M0RA 1SRMA 1Q81C 2FL7A 1ZSGA 2B86A 3OMCA 5FU6B 2JS2A 1UE9A 1UGRB 2DO3A 2RMOA 3ZL7C 3JAME 1QP3A 5IAYA 1JRIA 4DEYA 4LD6A 2JM8A 4C8QG 5CO7A 2KDSA 1MHNA 2ZGWA 3CC4Q 2IVWA 2Y4YA 3OW2A 1G3SA 2L3RA 4M78E 5GANg 4EMKA 2X4XA 2JXBA 1H3ZA 1TWBA 4F17A 1M90C 3UA6A 2A08A 4KULA 2COYA 3OYDA 2FPDA 2FG0A 2MPXC 3C4SA 2DXCA 4MDWA 2RPNA 1QMCA 2AHJB 1WDXA 1MMDA 2MAMA 3OYAA 1ZX6A 2CSQA 4DQ2A 3EG3A 3CBPA 3NTHA 1KG1A 3PMIA 1OPLA 2CKKA 1M90R 1BI1A 1WQ7A 3I9QA 1JBMA 4II1A 2LTOA 2RHZA 1YWPA 2COWA 2JTMA 1QVPA 3VRZA 3CCRT 1UECA 4JRIA 3O8VA 4PJOA 2DL8A 4RTZA 4N0AA 4AFSC 1OZ2A 3M58A 3JCMV 1CSKA 3WXMB 1U1SA 2C0IA 1W2BA 5FLXE 1VQ6A 1YJNA 5A0GA 4JUVA 1UGQB 3OYMA 1C0MA 4QQDA 1KD1C 3NGPA 4PFOA 5GMKi 3L2QA 3JB9G 1N9SA 5A0DA 3CCSA 4JRQA 1KHIA 1KHCA 4M4ZA 4E2FB 2E41A 3SWNA 2MYSA 2E5KA 1WI7A 1M3AA 3OBYA 1TXQA 1R8OB 4PNOA 3LWHA 4LD9K 1GCPA 4MZTA 5D6YA 2I2LA 2XIDA 4M7AB 4M7DF 2DVEA 4J9IA 2COZA 4HCZA 2KE9A 2D0NA 2ZPGB 3CXCA 4RG8A 6AT1B 5DLOA 4QVDA 3DLLA 1D3BA 3QO3A 1Y7XA 2YWWA 4L5GA 1VQPA 1PC0A 3RERA 3HFOA 3CXCS 2HBPA 4FW2A 3M0QA 4PJOC 5I11A 1YIJQ 2BZYA 3G4SA 1UDLA 2E4HA 5KCOA 3R6OA 1PSEA 1WX6A 1MMGA 3V7CA 5LJ3f 2QA4Q 2L89A 2VB6A 2RQUA 1JXOA 1AWOA 1JJ2S 5D7UA 2NYSA 4FCYA 3RESA 1Z9ZA 2PVDB 1PRLC 2B8AA 2VXFA 4LE9A 5DLQE 2LT1A 2XDPA 2VUBA 1WHKA 2J7IA 4M77E 4X34A 4DOWA 2EBPA 4Z88A 2CGHA 2SRCA 2KR3A 2CZ1B 2EJFA 3CCEQ 4GLMA 1YJ9Q 5J26A 4CC2A 1JJ2P 3RMSA 2DEUA 3BDLA 1AVZC 1A0NB 1NJIC 2X3XD 2QTVA 2FO0A 3M4GA 3E1SA 2FHDA
chains in the Genus database with same CATH topology
3MEUA 4M7AA 2OTLA 4HKEA 2HQXA 4M77B 3MP8A 3X24B 4BB7A 3SD4A 2GF7A 1FXXA 3PNWC 3CMEA 3LYIA 1M9SA 1QW1A 4B9WA 2D6FA 3CPWA 1VQ4T 3QSUA 4OB1B 4Z02A 2EFIA 3BY7A 4BY6B 3CC2T 3CD6A 4JLGA 1K73C 2CYZB 3ZEHA 5CR2A 2YRVA 2R57A 5LJ3g 4IUQA 1M1GA 4L59A 5LJ3d 3JB9J 3QYHB 1OYXA 1K8AC 3N5BB 5CKEA 1WGSA 3CCQA 2L8DA 4N0AC 3A8LB 4N4HA 4C8QE 2VGNA 5GAN4 1M1KU 4PJOD 1YHQA 2QEXA 3M9QA 3CD6T 1XQHA 3L2UA 4FIBA 2FYKA 4E7JA 4M7DA 2DZ9A 3FB9A 1PSFA 3C94A 1BI0A 1UGPB 2DAQA 3CPFA 5GAOn 3G71T 4M78G 1IZ6A 4PL6A 3LLRA 1VQ8A 4FSXA 5FU7C 2KQWA 3QPHA 1WJQA 5FU7B 3VKIA 5DM7R 4BDYA 2PVGB 3H8ZA 1VQ8T 3CCEA 3LGLA 3CCVT 3I55T 3CCJT 3J81E 2ZPEB 2QQRA 5LL6S 2M16A 2RH2A 2RHYA 3QJYA 4JDSA 1LOJA 4A4GA 1B34B 3JB9D 2VYTA 3TREA 3OS1A 3M53A 2ZPIB 3GPLA 4NL3A 2LVMA 1KD1U 4FT2A 4EDUA 2JZ2A 1EIFA 2A3LA 2F69A 5J3BA 4J8OA 2EKOA 3URGA 3M59A 5CK9A 2D9TA 2E5QA 2JOYA 2XICA 3NTKA 1VQLA 1JJ2A 2LCLA 5CKFA 4HT9A 3GNFB 3PGGA 1X01A 4CI0C 4C92A 3A5ZB 3MEAA 1K9MU 4IUVA 2L5QA 3HRSA 2LQ8A 1BIBA 4D6WA 2QQ9A 1NJIU 1VQ9A 3A8MB 2XDBA 4ATOA 3INZA 4C8QC 3OS5A 5GAN8 3JRZA 3SB2A 2EQJA 2LC4A 3OYJA 5KE2A 2RK1A 4XTZA 1VQ5A 4EMKC 4J6YA 1BI2A 3JCMJ 2G3RA 2YLBA 3CCLT 1BYMA 3PIPA 1B34A 5I2MA 3UT1A 2KVQG 3MEVA 4M78C 4ZGJB 3PT9A 3X25B 3UDCA 3DKMA 3CC7A 2CZ6B 3ME9A 1M1KC 3BW1A 3CEYA 1I5LA 1YJWT 1RL2A 2F5KA 3CC4A 1FWZA 1M90U 1QVGS 2KSSA 4NS5A 1N8RC 3OMGA 4HA8A 2KY9A 2E65A 3L2ZA 1VQ4A 3RKXA 2EQKA 2E6NA 3OYGA 2E64A 3G4ST 1YI2T 3CMET 4M7AE 4GY5A 5LJ3e 2ZPHB 2PQWA 4JLIA 1QVFA 1DJ7B 3CC7T 3V7RA 3X20B 3HRUA 4IUUA 2DXTA 5GAOm 1QVGA 2P0KA 4KBMB 3OB9A 3RMQA 4KUDK 2VC8A 3PIOA 3MHXA 3CCLA 5KH6A 2RJFA 2DEQA 3KUFA 1LNXA 2QQAA 1VQ5T 3E9GA 4ZGDB 3C12A 3FLGA 1N6AA 3SWNB 4C0FA 4C92F 1VQ9T 2QI2A 3HFNA 5CAIA 1U8RA 1H641 2K5IA 4IURA 3HL8A 3HPWA 4O5VA 4M75F 2YHTA 3OA6A 3CMAA 2XKOC 4RMOA 4IUTA 2K4YA 2DD5A 1P92A 3I56T 4BI3A 3UWNA 1Q7YC 3JB9H 1NE8A 1BI3A 1G3TA 3KXTA 3L42A 3JB9G 1AHJB 3LH0A 3DB3A 3EAEA 4PJOE 1S72A 1Y96B 1W2BS 3E9FA 4OP0A 4Y28E 4BUGA 1N9RA 1IREB 5GMKm 4M75E 2HAXA 4EMKB 3S3MA 4RCCA 4RKUE 3JSCA 3G71A 5IN1A 2LX9A 4OMFB 4C8QB 5GAOr 5GMKl 5EG2A 2JNGA 3VU3C 2A7YA 2CS7A 2R5MA 1LJOA 1NPRA 1XTDA 1Y96A 4QW2A 4L6V5 5HKCA 1YIJT 3CMAT 3LGFA 2HD0A 4XAXB 4C8QF 2XU8A 3ZFJA 4E7LA 3CCMA 3M55A 2RA2A 4M75B 2R5AA 2EQMA 3M4GA 5CVIA 3GNGA 2ZZDA 3VYHB 1YJNT 4PLLA 3CBMA 2LT4A 2RJCA 3QKJA 2JN0A 3L1AA 4F7UA 5A0LA 3LW5E 3FIFA 4BD3A 2RM4A 4M7AC 1VQNA 2R58A 3A8OB 2M1HA 4RCBA 4XTUA 4J6WA 4JRKA 3WVDB 2E6ZA 4M7AD 3FC3A 5FRMA 2RHXA 2WSEE 2ZCFB 1X75C 3NTIA 3CC2A 3QIIA 4F7UF 3CCET 4HCCA 4DOVA 4OB2B 4BE2A 3BDUA 3PTAA 1VQMA 3HP9A 4M75D 2DXBA 1WNLA 3RIRA 1ZQ1A 4M7DG 3M57A 4BDZA 5GAMj 3CCRA 4XU1A 5CCAA 4A4HA 4KT0E 3HSBA 2RK2A 3OYHA 4A4KA 1YJ9A 1ZBXA 3CBOA 3OSSC 4X9DA 3J7AF 2X4YA 3V8JA 1TH7A 4NOYA 3CPWS 4C92G 3RKWA 3OY9A 3VUBA 4XK8E 4JS5A 2LCCA 3TCJA 3UPUA 1VQLT 2DK3A 4OB0B 5HK0A 4OF1A 5GAMe 2FVUA 4M77G 1VIFA 1XOVA 4X9CA 3G6EA 2DKGA 3QHSA 1VQKT 4PJOF 3EFSA 4FU6A 2DIGA 4IUPA 4Q5WA 2PUOB 2MMPA 5GAN5 3S3OA 2RHUA 2WSCE 5D6WA 1I81A 4FM4B 3OYBA 3CCST 4Y91A 5CKHA 4A54A 2V8KA 1VQPT 3LWIA 4LDVA 4F7UG 2QA4A 3PFSA 2RD1A 4ELZC 2PUKB 4ZGEB 1XNIA 2M9UA 2O01E 4MDXA 2XHCA 3TEEA 3P8BB 4MZPA 2JUFA 4E47A 1VQOT 5HK3A 1YJ9T 1Q7YU 1KC8C 3C95A 4M7DB 5LJ5j 4E7KA 3JCMf 1M5Q1 4DA4A 2EAYA 4BACA 2DTIA 4ZTJA 1VQ6T 2M0OA 4MZMA 1O75A 3OYIA 2EQUA 1HXDA 2P0QA 3JCMd 3OS0A 5FU6C 1VQOA 2DPPB 4UC4A 3OBWA 1OZ3A 4M78D 4NL2A 4C92B 4XTVA 2OTJT 3BFMA 3L2WA 4MMKA 1YBYA 4ME7A 2V8JA 5GANe 2HQEA 4C0ZA 2FL7A 3OMCA 5FU6B 1Q81C 2MI6A 3QJ6A 4QVZA 3GOXA 3VUZA 4C8QD 4VUBA 1UGRB 1Q86C 2DO3A 1I8FA 1I4K1 3JAME 1QP3A 1M8VA 3QZ9B 1D3BB 1G3WA 2EJGA 2FB7A 3SFMA 1JRIA 3V8LA 5IAYA 5LJ5d 3CCMT 4LD6A 4N4IA 4C8QG 4B9XA 5CO7A 2KDSA 3F70A 5GANj 1VQ7A 1MHNA 3CCUT 2BKDN 2WACA 2ZGWA 3CCUA 1Q82C 3P8DA 3RKYA 4C0DC 2IVWA 2P0PA 5GMKh 3JCMb 4M78A 1KQ2A 2Y4YA 3OW2A 4OB3B 1G3SA 2L3RA 4M78E 5GANg 2C06A 2QTXA 5L8RE 3V8KA 2D0QB 1SSFA 3HHTB 2X4XA 1VIEA 4C5HA 4EMKA 5C0MA 4E7HA 1M90C 1H3ZA 1RI0A 4KULA 3X26B 3OYDA 5HY6A 2EWNA 3FDRA 4C8QA 4FL6A 3C4SA 3WVEB 2EIFA 4WF2A 2DXCA 4MDWA 5J39A 2QA4T 1JB0E 3L2RA 4C92C 1Y07A 2K3YA 4O6JA 5LJ5h 2AHJB 3HRTA 1N8RU 1KQSS 2XD0A 1Q86U 4E7IA 4ZTFA 3OYKA 1G5VA 2MAMA 3TU4K 2DTOA 3RUXA 4BE0A 2X4JA 3OYAA 2K5LA 3HKSA 3J80E 4DQ2A 2MWOA 3EFRA 1HK9A 4IKFA 3CBPA 3FJPA 3NTHA 3ER0A 1UEBA 3Q1JA 1O9SA 4ZN3A 1KG1A 3DLMA 2GQVA 3PMIA 5GAN2 2CKKA 4PLIA 4HT8A 1KQSA 2RB6A 1BI1A 2KK4A 2E1HA 3QBYA 1WQ7A 3QYGB 1JBMA 4II1A 4M77D 3JB9I 4ZN1A 5CIUA 1W4SA 4R55A 2LTOA 1K8AU 4J5YA 3JCMh 4OGEA 4QVCA 2O4XB 4JJNK 2RHZA 5KE3A 2K3XA 4PKCC 3S6WA 2RI5A 4BI4A 2JTFA 2JTMA 4XQ3A 3OS2A 2DJZA 1QVPA 2X35A 4XTXA 1YITT 3CCRT 1YI2A 1QP2A 3MCAB 4N4GA 4JRIA 3JCMc 5GMKe 3O8VA 4M7DC 4ELYC 4PJOA 2XK0A 5LJ5f 2BUDA 3JCMQ 5CQYA 4M7DD 2XDDA 4EPCA 3E19A 3MO8A 3T9NA 3I56A 2DIQA 3QXEB 4N0AA 3OYFA 1N27A 1YCYA 1WJSA 5CKDA 5GANd 4BY6C 1OZ2A 3M58A 3JCMV 1NZ9A 2VGMA 1FX7A 2QQSA 3GP8A 1VQNT 4M7AG 4PJOB 3WXMB 5GANf 1U1SA 1Q81U 5AYFA 4OGCA 5LJ3h 1W2BA 3VV0A 2K57A 5FLXE 1K9MC 1VQ6A 2XG8D 4A4EA 4JS4A 1YITA 1UGSB 1YJNA 2P4TA 5LJ5e 5A0GA 3GLXA 3FEOA 4EMHA 4C5IA 2O4XA 4JUVA 2EJ9A 2WSFE 1UGQB 5FROA 3JCMX 2LRQA 2EYQA 3OYMA 2RJDA 3OYEA 2IG0A 4QQDA 1KD1C 2MF2A 4CRIA 3OYLA 5GAOp 5I2SA 2BIVA 2RJEA 5C6SA 3GF5A 1N9SA 2QQBA 5A0DA 5GMKi 3MEWA 2XI9A 1U1TA 4YTLA 5GMKj 1KHIA 3CCSA 4JRQA 1KHCA 2Y4XA 4QQGA 4A53A 4XTWA 2H3JA 4M77F 4XU0A 2E41A 3SWNA 3ZBDA 4M75C 4M75A 5GAMh 3SWNC 2YLCA 5GAMg 3OYNA 4R56A 1VQKA 3M56A 2VXEA 2ZPBB 4J7IA 2ZPFB 3OBYA 3SDZA 2X4WA 2DZCA 1R8OB 4PNOA 5GANh 1GXIE 5KCHA 1WPYA 3L2VA 2DTHA 3LWHA 4LD9K 4MZTA 3FRNA 1UB4A 3X28B 4J7FA 2GCXA 5D6YA 2I2LA 2XIDA 4PJOG 4M7AB 4BE1A 4M7DF 3V7SA 2CZ0B 2KAFA 2DVEA 2Y90A 2RHIA 5A2QE 3JCMW 1S72T 2DXUA 4HCZA 4M75G 2ZPGB 3CXCA 4RG8A 4M77C 1BIAA 4LDWA 4M78F 5D6XA 4QVDA 5DLOA 3DLLA 1VQMT 1D3BA 1VUBA 3QO3A 2RI2A 2DD4A 2E70A 1Y7XA 1WQWA 2K2VA 2LNVA 2RI3A 2GFUA 3A8HB 4L5GA 4LDUA 5M9OA 1BKBA 1VQPA 1YHQT 5IT9E 4V2SA 2CZ7B 1VQ7T 3P8HA 4LDYA 3MP6A 2LQKA 4XTYA 3HFOA 3ASKA 3CXCS 4M78B 1G3YA 4JRPA 3RERA 3G7ZA 3CCVA 2HBPA 3NFCA 4XU2A 4BI8B 2KMTA 4KUIA 4C0GA 5LJ5g 4HCBA 5GAMd 4PJOC 1MGQA 2OAUA 2V8IA 4C5GA 3PMTA 3OQ5A 2QDYB 2QXFA 4J83A 2RO0A 3M54A 3G4SA 2PU9B 4M7AF 5KCOA 1KC8U 3R6OA 1QVFS 1PSEA 3OYCA 3JCMP 4A4FA 3V7CA 2OTJA 5LJ3f 2LDMA 3CC4T 3I55A 2L89A 3CCJA 4M7DE 4C5EA 1JJ2S 3KBGA 3QUIA 5DY9A 5GAN7 3A8GB 3OYYA 5GAOq 2OTLT 3QZ5B 1WJRA 1M1FA 3M4YA 5LJ3j 3RESA 4F7UB 4J6XA 3VJPA 2PVDB 2PVOB 3META 3OW2S 4C0DB 4C92E 3QG1A 3JB9F 2B8AA 5I21A 1X6OA 2VXFA 4XU3A 4GLKA 2E12A 4QQ6A 4OVAA 5DLQE 3L2QA 2LT1A 2XDPA 1ZHIA 2GFAA 4M77A 2VUBA 2E10A 3QDRB 4RG2A 2HNIA 2QEXT 2K5FA 3JCMe 4M77E 4TVRA 4FT4A 3JCMg 3S3NA 4X34A 4DOWA 4P5NA 1M4ZA 3CCQT 1KQ1A 3DB4A 4C92D 3AHUA 5GAMf 2CGHA 4MMLA 5CKBA 3M5AA 3H6ZA 3VYGA 1Q82U 4LDXA 1OI1A 2F5TX 1NPPA 4EMGA 2CZ1B 1V29B 2VV5A 2EJFA 1K73U 2MWPA 3MP1A 2NLUA 5GAN3 3LX7A 3G6ET 1YIJA 5J26A 4F7UE 3GIBA 3RMSA 3BDLA 5FRNA 1NJIC 3OSVA 1Y71A 5GAN6 5GAOl 2JVVA 1YJWA 3E1SA 5CQXA 2FHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM f;  1M5Q 1;  2EAY A;  4M7A A;  2DTI A;  4M77 B;  5GAO p;  1HXD A;  3JCM d;  3SWN B;  5GMK i;  4C92 F;  3JB9 G;  1N9S A;  3HFN A;  5CAI A;  4M7D A;  3QSU A;  1U1T A;  1H64 1;  5GMK j;  4M78 D;  4NL2 A;  4C92 B;  4XTV A;  3BFM A;  3BY7 A;  4MMK A;  4XTW A;  4A53 A;  4M77 F;  4XU0 A;  2E41 A;  3SWN A;  5GAN e;  4M75 C;  4M75 A;  5GAM h;  3SWN C;  2YLC A;  4M75 F;  5LJ3 g;  5GAM g;  2YHT A;  2VXE A;  5LJ3 d;  4C8Q D;  3JB9 J;  1I8F A;  1I4K 1;  2DZC A;  4PNO A;  5GAN h;  1M8V A;  1WPY A;  3JB9 H;  2DTH A;  1D3B B;  2EJG A;  3V8L A;  2FB7 A;  5LJ5 d;  1JRI A;  4N0A C;  4C8Q E;  4C8Q G;  5GAN 4;  4PJO D;  2I2L A;  4PJO G;  4M7A B;  5GAN j;  4PJO E;  4M7D F;  1Y96 B;  3V7S A;  4OP0 A;  2ZGW A;  2DVE A;  2FYK A;  2Y90 A;  3JCM W;  1N9R A;  2DZ9 A;  3RKY A;  2DXU A;  4M75 G;  3FB9 A;  4M75 E;  4EMK B;  5GMK h;  5GMK m;  4M77 C;  1BIA A;  4M78 F;  4RCC A;  4QVD A;  4M78 A;  3JCM b;  1KQ2 A;  5GAO n;  1D3B A;  4M78 E;  4M78 G;  4C8Q B;  5GAN g;  2QTX A;  3QO3 A;  5GAO r;  3V8K A;  5GMK l;  3VU3 C;  4EMK A;  1LJO A;  1WQW A;  1Y96 A;  4V2S A;  4C8Q F;  2EWN A;  4C8Q A;  2RA2 A;  4M75 B;  3RER A;  3M4G A;  3HFO A;  4XTY A;  4M78 B;  1LOJ A;  1B34 B;  4WF2 A;  4XU2 A;  3JB9 D;  4C92 C;  5LJ5 g;  4PJO C;  2JN0 A;  5LJ5 h;  5GAM d;  3L1A A;  1MGQ A;  4F7U A;  3FIF A;  2RM4 A;  4M7A C;  4NL3 A;  4RCB A;  4XTU A;  4J6W A;  4JRK A;  2DTO A;  4M7A D;  3RUX A;  4M7A F;  4DQ2 A;  3JCM P;  4HT9 A;  3EFR A;  1HK9 A;  3PGG A;  4F7U F;  1X01 A;  3FJP A;  4C92 A;  3V7C A;  3BDU A;  5LJ3 f;  4M75 D;  1WNL A;  3RIR A;  4M7D G;  5GAN 2;  4HT8 A;  4M7D E;  5GAM j;  1BIB A;  3QUI A;  5DY9 A;  2RB6 A;  5GAN 7;  5GAO q;  2E1H A;  1WQ7 A;  3INZ A;  1JBM A;  4XU1 A;  4M77 D;  4C8Q C;  3JB9 I;  4M7D B;  3HSB A;  5GAN 8;  3SB2 A;  5LJ3 j;  3RES A;  4X9D A;  4F7U B;  4J6X A;  4J5Y A;  4XTZ A;  3JCM h;  3V8J A;  4J6Y A;  4EMK C;  1TH7 A;  4NOY A;  4QVC A;  3JCM J;  4C92 G;  2YLB A;  3RKW A;  4C92 E;  3JB9 F;  5I21 A;  2VXF A;  1B34 A;  4XU3 A;  4M78 C;  4XQ3 A;  2DJZ A;  4XTX A;  4M77 A;  2E10 A;  5GAM e;  2HNI A;  3JCM e;  4M77 G;  4JRI A;  4M77 E;  4X9C A;  3JCM g;  2DKG A;  3BW1 A;  3QHS A;  3JCM c;  5GMK e;  4PJO F;  1I5L A;  5LJ5 f;  4M7D C;  3EFS A;  1KQ1 A;  3JCM Q;  4M7D D;  4C92 D;  3AHU A;  5GAM f;  2CGH A;  4HA8 A;  4MML A;  4N0A A;  5GAN 5;  1YCY A;  2E65 A;  5GAN d;  1I81 A;  3L2Z A;  3JCM V;  3RKX A;  4Y91 A;  4EMG A;  2E64 A;  4M7A G;  4A54 A;  2EJF A;  5GAN f;  1U1S A;  5LJ3 e;  4M7A E;  4PJO B;  4JLI A;  5GAN 3;  4PJO A;  5LJ3 h;  2K57 A;  4F7U G;  4F7U E;  3GIB A;  3V7R A;  2RD1 A;  5GAO m;  2DXT A;  5LJ5 e;  2VC8 A;  4EMH A;  4JUV A;  2EJ9 A;  5GAN 6;  5GAO l;  3JCM X;  2DEQ A;  1LNX A;  5LJ5 j; 
#chains in the Genus database with same CATH topology
 2CP7 A;  3MEU A;  3TSZ A;  4M7A A;  4M77 B;  2RQV A;  2YRD A;  4PFZ A;  3PNW C;  2MIO A;  2D6F A;  3A98 A;  1VQ4 T;  1B3Q A;  4OB1 B;  2HSE B;  3NMZ C;  3CC2 T;  3CD6 A;  1WFW A;  2CYZ B;  2GGR A;  2R57 A;  2JMC A;  2M02 A;  3QYH B;  1WGS A;  3EG0 A;  2NUP B;  3CCQ A;  2L8D A;  3REA B;  1T3L A;  1MMN A;  1X2K A;  2QEX A;  3M9Q A;  2CP3 A;  4FIB A;  1T3S A;  2DZ9 A;  3VS2 A;  4X1V A;  1BI0 A;  1UGP B;  3CC2 Q;  3G71 T;  4PL6 A;  5DM7 R;  1VYT A;  2ROL A;  3CCE A;  3I55 T;  3QJY A;  3JB9 D;  2LMJ A;  4ANJ A;  3TRE A;  3OS1 A;  2RQW A;  2ZPI B;  2QGG A;  1ZA1 B;  3JV3 A;  1KD1 U;  4FT2 A;  3URG A;  3NTK A;  4HT9 A;  3GNF B;  1G83 A;  1PWT A;  1X01 A;  4CI0 C;  4C92 A;  2CH4 W;  1M3C A;  3A8M B;  5KYY B;  4C8Q C;  3OS5 A;  4Z89 A;  2G6F X;  3SB2 A;  1HSQ A;  5GJV B;  3EH2 A;  1BI2 A;  3JCM J;  2G3R A;  2DLP A;  2MK5 A;  3PT9 A;  3DKM A;  2RN8 A;  1YJW T;  2EGA A;  2CRE A;  3CCU Q;  1FWZ A;  2LQW A;  2X3W D;  1QVG S;  3OMG A;  2KY9 A;  1MUZ A;  1SPK A;  2E65 A;  3EHR A;  2E6N A;  2EGE A;  1IHW A;  4GY5 A;  2ZPH B;  4JLI A;  1VQM Q;  3CC7 T;  1PKS A;  2QGF B;  4KUD K;  4KBM B;  3EGD B;  3MHX A;  3CCL A;  1LNX A;  2QQA A;  1MMA A;  3C12 A;  2NWM A;  3EH1 A;  1M8M A;  4C0F A;  3HFN A;  1H64 1;  2NUZ A;  3HL8 A;  1KC8 R;  1MNE A;  3I56 T;  4ZNX A;  2FPF A;  1I0C A;  4BUG A;  1N9R A;  2HAX A;  4OML A;  3S3M A;  4RCC A;  2YUN A;  2DX1 A;  4FYV B;  2NUP A;  1D0X A;  2LX9 A;  4OMF B;  4C8Q B;  3VU3 C;  1Y96 A;  2D8H A;  4FYY B;  4C8Q F;  4RTV A;  4E7L A;  2GNC A;  2K2M A;  2LT4 A;  2RJC A;  3QKJ A;  2JN0 A;  4JJC A;  5ECA A;  2RM4 A;  4M7A C;  2HEQ A;  1TS9 A;  1X75 C;  2EYX A;  2L2P A;  4HCC A;  4BE2 A;  3HP9 A;  4M75 D;  1PKT A;  1ZQ1 A;  2DMO A;  1PG5 B;  2M51 A;  2BTT A;  2X9H A;  4XU1 A;  1IGU A;  3HSB A;  1TUC A;  2RK2 A;  1ZBX A;  3OSS C;  2X4Y A;  1KIK A;  3EGD A;  3VUB A;  1QCO A;  1OOT A;  1OU9 A;  3UPU A;  2DYB A;  3CQT A;  5GAM e;  2ZAE A;  1LCK A;  1XOV A;  1UTI A;  2P4R A;  3EFS A;  2OI3 A;  1IXD A;  3S3O A;  3RR6 A;  4J9C A;  2RHU A;  4FM4 B;  3CCS T;  4LN2 A;  3GBQ A;  2QK0 A;  3PFS A;  3RDV A;  1XNI A;  2DL3 A;  5IHI A;  2XHC A;  4MZP A;  3PVQ A;  1J3T A;  1M5Q 1;  2M0O A;  4MZM A;  3CCJ Q;  2AK5 A;  5FU6 C;  3OBW A;  7AT1 B;  2EVR A;  3EG2 A;  4ESR A;  2O31 A;  4ME7 A;  2V8J A;  4E6R A;  2HQE A;  4C0Z A;  2PNI A;  4QVZ A;  1Q86 C;  1R77 A;  2EGC A;  2LNH B;  1D3B B;  3V8L A;  5LJ5 d;  2FB7 A;  1K8A R;  4N4I A;  3P8D A;  3C0C A;  5GMK h;  2A36 A;  2EW3 A;  2I0N A;  2C06 A;  2OTJ Q;  4K11 A;  4C5H A;  1RAH B;  4HCK A;  4FL6 A;  2EIF A;  1JB0 E;  4F04 B;  1W70 A;  4O6J A;  5LJ5 h;  1PD0 A;  2CSI A;  1KJW A;  2XD0 A;  4ZTF A;  3OYK A;  4FW1 A;  1HYO A;  3HKS A;  1HK9 A;  3CCS Q;  4HVU A;  4ZN3 A;  3ER0 A;  1O9S A;  2GQV A;  5IHN A;  3QYG B;  2RB6 A;  2E1H A;  2CDT A;  2FZC B;  2OAW A;  4R55 A;  1W4S A;  1K8A U;  3JCM h;  1K1Z A;  4QVC A;  2O4X B;  5KE3 A;  1Q95 G;  4PKC C;  2W10 A;  3S6W A;  1GFC A;  2RI5 A;  1YIT T;  1YI2 A;  4N4G A;  5GMK e;  4M7D C;  3E19 A;  2QAZ A;  2DIQ A;  3VRY A;  5KYX A;  3OYF A;  4E7S A;  4BY6 C;  1D1A A;  2JJ9 A;  1NZ9 A;  1NEB A;  1K9M C;  1WA7 A;  2XG8 D;  4JS4 A;  1UGS B;  2P4T A;  4EMH A;  2O4X A;  1BB9 A;  2EJ9 A;  2L0A A;  2WSF E;  3JCM X;  2LRQ A;  2IG0 A;  4CRI A;  5C6S A;  2RJE A;  2QQB A;  2HMA A;  1YN8 A;  3MEW A;  5GMK j;  4KGX B;  4M77 F;  4JJD A;  1KSW A;  3EFO B;  1VQK A;  1WZO A;  4R56 A;  2VXE A;  1K9M R;  1V76 A;  1TSF A;  3SDZ A;  2X4W A;  5GAN h;  1WPY A;  1BK2 A;  2DTH A;  4QT7 A;  3X28 B;  4PJO G;  4BE1 A;  5A2Q E;  1S1N A;  4M75 G;  3ULR B;  3CC7 Q;  1VQM T;  3EHQ A;  4WCI A;  1VUB A;  2DD4 A;  2E70 A;  1WXB A;  5M9O A;  1YHQ T;  2GFU A;  3A8H B;  2E3I A;  4V2S A;  2HKQ B;  5IT9 E;  2CZ7 B;  1VQ7 T;  4LDY A;  2LQK A;  3ASK A;  1M2V A;  3NFC A;  1YJW Q;  4HCB A;  2KMT A;  1MGQ A;  3PMT A;  5KYY A;  1UJ0 A;  1QVF S;  1RAF B;  3JCM P;  3CC4 T;  3CCJ A;  4M7D E;  3KBG A;  5DY9 A;  3A8G B;  3OYY A;  1RAG B;  2VVK A;  1M1F A;  1N8R R;  4F7U B;  2PVO B;  2VKN A;  1X6O A;  2O9V A;  1M2V B;  4XU3 A;  4PJM A;  3QWY A;  1SSH A;  4RG2 A;  2E10 A;  3JCM g;  1X6G A;  2QYZ A;  2V1R A;  2DF6 A;  1QWF A;  1KQ1 A;  2DRM A;  4C92 D;  2C0O A;  4MML A;  2BZX A;  1Q82 U;  3FJ5 A;  4LDX A;  1E6H A;  1OI1 A;  4EMG A;  1IRX A;  1V29 B;  1K73 U;  3G6E T;  2NLU A;  3LX7 A;  4RTU A;  8ATC B;  2QG9 B;  3E2U A;  1Y71 A;  5GAN 6;  1VQP Q;  1YJW A;  3CCE T;  2FPE A;  1X6B A;  1FMW A;  3EG1 A;  4BB7 A;  1FXX A;  3QDF A;  3CME A;  4B9W A;  3OW2 P;  2EYZ A;  3CPW A;  2DJQ A;  4Z02 A;  2EFI A;  5FWC A;  3SEM A;  1K73 C;  3M0U A;  5CR2 A;  2YRV A;  2ABL A;  4IUQ A;  2NUT A;  2BZ8 A;  5LJ3 d;  1ZLM A;  2GTO A;  5CKE A;  1AZG B;  4N4H A;  2EPD A;  4C8Q E;  2ATC B;  1AWX A;  2PZ1 A;  3CD6 T;  4M7D A;  2FYK A;  1R0C B;  1QQJ A;  1PSF A;  2J06 A;  2YUO A;  4M78 G;  3LLR A;  3CME Q;  4FSX A;  2MOX A;  5FU7 B;  3VKI A;  1VQ9 Q;  3H8Z A;  3CCV T;  1UHF A;  3CCJ T;  3J81 E;  2RH2 A;  2RHY A;  1JU5 C;  1B34 B;  3M53 A;  2OJ2 A;  2FRY A;  2EKO A;  3EG9 A;  2K79 A;  1Q7Y R;  2D9T A;  2KT1 A;  4HXJ A;  2XIC A;  5CKF A;  3PGG A;  4F16 A;  1H92 A;  2FRW A;  1K9M U;  4IUV A;  1NJI U;  1BIB A;  4D6W A;  2XDB A;  3INZ A;  5GAN 8;  1XJW B;  1YNZ A;  4Z8A A;  1EZZ B;  2DL7 A;  1B34 A;  3UT1 A;  2YRC A;  2KVQ G;  4ZGJ B;  3X25 B;  2DM1 A;  1QVG P;  2AT1 B;  2CT4 A;  1I5L A;  4GBQ A;  3CC4 A;  2YXY A;  4HA8 A;  1ZSZ A;  1UHC A;  1YFN A;  3UA7 A;  4FYW B;  3RKX A;  4M7A E;  3I35 A;  5LJ3 e;  3G1J A;  1E6G A;  3X20 B;  2J05 A;  2DXT A;  5GAO m;  1NM7 A;  3RMQ A;  3OB9 A;  3MKD A;  1K76 A;  5KH6 A;  2FZG B;  2ESW A;  3KUF A;  2K3B A;  3E9G A;  2QDL A;  4ZGD B;  3D7S B;  1N6A A;  3SWN B;  4C92 F;  5CAI A;  2K5I A;  2SEM A;  4B6M A;  3CCR Q;  5I22 A;  2DET A;  2LQN A;  4DBF A;  3OA6 A;  1MV3 A;  4RMO A;  2K4Y A;  2DD5 A;  2DNU A;  1NLO C;  2X51 A;  4OMM A;  4BI3 A;  4PJL A;  1NE8 A;  1AT1 B;  3L42 A;  3LH0 A;  3EAE A;  1S72 A;  4OP0 A;  3VS0 A;  5GMK m;  2HQH A;  3M0S A;  2KRM A;  4RKU E;  3JSC A;  4JZ4 A;  3G71 A;  5GAO r;  1E7O A;  4Y92 A;  2R5M A;  1YIJ T;  2DVJ A;  4QW2 A;  1OEB A;  1ZUU A;  2KGT A;  3ZFJ A;  3CCM A;  3M55 A;  4M75 B;  1F1B B;  3VYH B;  2ZZD A;  1YJN T;  1K73 R;  4OMO A;  4F7U A;  5A0L A;  3FIF A;  3I5S A;  2R58 A;  2M1H A;  3H0I A;  4JRK A;  4M7A D;  2E6Z A;  3FC3 A;  3CCL Q;  2RHX A;  3NTI A;  3CC2 A;  2ED1 A;  1VOM A;  1WNL A;  3RIR A;  3VS6 A;  3CCR A;  3OYH A;  4A4K A;  2F2W A;  3J7A F;  2QEX Q;  3V8J A;  3CPW S;  4C92 G;  4AMC A;  4XK8 E;  2D8J A;  4OB0 B;  1YWO A;  2FVU A;  1W6X A;  4M77 G;  3G6E A;  3QHS A;  4IUP A;  2LZ6 B;  2CH4 A;  2MMP A;  1LVK A;  2WSC E;  1I81 A;  3EGX B;  1QCN A;  2V8K A;  4PJJ A;  3LWI A;  4F7U G;  1D0Y A;  2PUK B;  2BE9 B;  2O01 E;  1KC8 C;  2JUF A;  1CKA A;  1Q7Y U;  2LX7 A;  3C95 A;  4M7D B;  2F1L A;  2EAY A;  3G4S Q;  2DTI A;  4BAC A;  1O75 A;  1QVF P;  3I55 Q;  3OYI A;  1RUW A;  1HXD A;  4UC4 A;  4M78 D;  4LXC A;  4MMK A;  5GAN e;  3VS3 A;  3I5R A;  2MI6 A;  3QJ6 A;  3SHW A;  3GOX A;  1D1C A;  4C8Q D;  2KXC A;  1I8F A;  1I4K 1;  4FSS A;  1NEG A;  1QKX A;  2KXD A;  1EX4 A;  1M8V A;  3QZ9 B;  3SFM A;  2EJG A;  4B9X A;  3F70 A;  1VQ7 A;  1GBQ A;  2ECZ A;  2BKD N;  2WAC A;  1NYF A;  4C0D C;  3JCM b;  4OB3 B;  1ZUK A;  1UUE A;  2D0Q B;  1SSF A;  5C0M A;  1VIE A;  1IO6 A;  1IB8 A;  2MCN A;  3FDR A;  3EFO A;  3WVE B;  1VQ5 Q;  4WF2 A;  3L2R A;  1Y07 A;  2K3Y A;  3HRT A;  1N8R U;  4E7I A;  1MND A;  1HD3 A;  1G5V A;  2DTO A;  4BE0 A;  2K5L A;  1N5Z A;  3EFR A;  4IKF A;  4J9E A;  1QLY A;  3FJP A;  1UEB A;  3RBB B;  5GAN 2;  4HT8 A;  3CPW P;  2KK4 A;  3QBY A;  2H8H A;  5AT1 B;  3JB9 I;  1X69 A;  1IHV A;  2K3X A;  5KYX B;  1JQQ A;  4BI4 A;  2JTF A;  4XQ3 A;  2DJZ A;  2X35 A;  4XTX A;  3VS4 A;  1ARK A;  1QP2 A;  3MCA B;  3M0P A;  4ELY C;  2K9G A;  2BUD A;  4M7D D;  2XDD A;  3T9N A;  1N27 A;  1YCY A;  1WJS A;  1AZE A;  5CKD A;  1GRI A;  3CMA Q;  2VGM A;  1FX7 A;  2QQS A;  3GP8 A;  4PJO B;  3CXC P;  1Q81 U;  5AYF A;  1BCM A;  1NG2 A;  4A4E A;  1YIT A;  3FEO A;  4C5I A;  2EYQ A;  2CP5 A;  2RJD A;  4AT1 B;  1VQ7 Q;  2XI9 A;  1KQS P;  2Y4X A;  4QQG A;  1QCF A;  4XTW A;  4XU0 A;  2H3J A;  5KYW B;  3ZBD A;  1SG5 A;  2J6F A;  4M75 C;  4M75 A;  2YLC A;  5GAM h;  3O5Z A;  2ZPB B;  4JPB W;  1RAI B;  2DZC A;  5KCH A;  3L2V A;  1Y57 A;  1UB4 A;  1Y0M A;  1BU1 A;  2GCX A;  5GJW B;  3JCM W;  2Y90 A;  1JEG A;  2DXU A;  1KFZ A;  1WYX A;  1X2Q A;  5D6X A;  4LDW A;  1Q86 R;  2EQI A;  4R0K A;  2KT8 A;  1NBE B;  2RI2 A;  3CMA A;  2RI3 A;  4LDU A;  1BKB A;  3MP6 A;  4XTY A;  1G3Y A;  2P84 A;  3CCV A;  1FMV A;  4XU2 A;  4KUI A;  5LJ5 g;  4C0G A;  2DRK A;  2OAU A;  4C5G A;  2HL3 A;  2RO0 A;  2H3E B;  3H41 A;  2KNB B;  2PU9 B;  4RTW A;  2EYW A;  1ABQ A;  2OTJ A;  2LDM A;  3I55 A;  2IPO B;  4C5E A;  3QUI A;  5GAN 7;  2OTL T;  2OX7 A;  3LH5 A;  4J9F A;  4J6X A;  1VYV A;  3VJP A;  3MET A;  3OW2 S;  1WXU A;  2EYY A;  3QG1 A;  1V1C A;  5I21 A;  1W2B P;  4QQ6 A;  1Q86 U;  1ZHI A;  3QDR B;  1JJ2 A;  3S3N A;  2K5F A;  3JCM e;  4D8D A;  1M4Z A;  2HSP A;  5CKB A;  3M5A A;  1QWE A;  1NPP A;  2F5T X;  2VV5 A;  1D1B A;  1YIJ A;  3GIB A;  3OSV A;  2YDL A;  1X43 A;  5GAO l;  2JVV A;  5CQX A;  1VQL T;  1YI2 Q;  2OTL A;  4HKE A;  2HQX A;  2KRN A;  1VQ8 Q;  1M2O A;  1QW1 A;  1I07 A;  3TSW A;  1TG0 A;  4RTX A;  1C6V X;  2VAS A;  4JLG A;  3ZEH A;  1WHJ A;  5LJ3 g;  4L59 A;  2KRS A;  1K8A C;  3N5B B;  1RAA B;  2JTE A;  3A8L B;  1T0H A;  2VGN A;  1M1K U;  1YHQ A;  2YUQ A;  3L2U A;  3EGU A;  1T0J A;  3CPF A;  5GAO n;  1GFD A;  3A1P A;  4JZ3 A;  1WXT A;  3NPF A;  1VQ8 A;  4AFZ C;  2KQW A;  3QPH A;  1WJQ A;  4BDY A;  2PVG B;  3LGL A;  1RLP C;  5IXF A;  2QQR A;  1YJN Q;  3UAT A;  4JDS A;  1LOJ A;  3CCQ Q;  4JJB A;  2RNA A;  1LPL A;  1ABO A;  2KEA A;  2LVM A;  2O2O A;  4RTT A;  1YIT Q;  4EDU A;  1MV0 B;  1K0X A;  1EIF A;  2A3L A;  4RTY A;  5J3B A;  4J8O A;  2CUD A;  2E5Q A;  2JOY A;  1ZUY A;  1VQL A;  2LCL A;  2CP2 A;  4KGZ B;  1S72 Q;  2L5Q A;  3HRS A;  2LQ8 A;  2QQ9 A;  4LNP A;  4ATO A;  1Z9Q A;  2EQJ A;  2LC4 A;  5KE2 A;  1VQ5 A;  4EMK C;  2YLB A;  3CCL T;  1BYM A;  3PIP A;  4KH1 B;  3HTR A;  3CC7 A;  3ME9 A;  3BW1 A;  2DFU A;  4J9B A;  1M90 U;  2KSS A;  4NS5 A;  1N8R C;  1K0S A;  2EQK A;  3G4S T;  1YI2 T;  1K9A A;  2PQW A;  4J9G A;  1YP5 A;  3HRU A;  4IUU A;  1QVG A;  4EIK A;  2VC8 A;  1JO8 A;  2F2X A;  4LUE A;  3FLG A;  2CP0 A;  1SKU B;  1VQ9 T;  2KRO A;  2C0T A;  3H0H A;  3HPW A;  4O5V A;  4M75 F;  2YHT A;  2HKN A;  1P92 A;  3UWN A;  1Q7Y C;  3JB9 H;  2HCK A;  2GTJ A;  3AT1 B;  3I56 Q;  3DB3 A;  4PJO E;  2AKL A;  1Y96 B;  3E9F A;  4Y28 E;  2A28 A;  1PM3 A;  4M75 E;  4EMK B;  1UG1 A;  1G2B A;  5IN1 A;  4AFQ C;  2LJ3 A;  3VS7 A;  2A7Y A;  1NPR A;  4KGV B;  1GL5 A;  3LGF A;  2HD0 A;  5IH2 A;  4XAX B;  4IIO A;  2XU8 A;  1W1F A;  2RA2 A;  5CVI A;  2EQM A;  3GNG A;  3TVT A;  1TUG B;  3LW5 E;  4BD3 A;  4J6W A;  4AG2 C;  3QII A;  4OB2 B;  3PTA A;  2DXB A;  4M7D G;  3MPU B;  1M3B A;  5GAM j;  1OX8 A;  5CCA A;  4A4H A;  2F2V A;  4KT0 E;  2HL5 C;  3CBO A;  1TH7 A;  2BE7 D;  1OUL A;  2LCC A;  3TCJ A;  1H8K A;  4OF1 A;  1VIF A;  1VQK T;  4KH0 B;  4FU6 A;  4Q5W A;  2PUO B;  3OYB A;  2QA4 A;  2RD1 A;  4ZGE B;  4E47 A;  1VQO T;  5HK3 A;  5LJ5 j;  4E7K A;  4DA4 A;  2P0Q A;  1Q82 R;  1D09 B;  2DBK A;  2HDA A;  4IIM A;  1OZ3 A;  4C92 B;  4XTV A;  3L2W A;  4J9H A;  2XMF A;  3PE0 A;  4OMN A;  3RNJ A;  2V26 A;  4D8K A;  3VUZ A;  4HVW A;  4VUB A;  1VQN Q;  1D0Z A;  2QAS A;  1OQK A;  2ROT A;  2AZV A;  1ZBJ A;  1G3W A;  3CCM T;  1ZA2 B;  5GAN j;  3CCU T;  1Q82 C;  3CCU A;  3RKY A;  2P0P A;  4DBH A;  4M78 A;  1KQ2 A;  1KD1 R;  1TTH B;  2QTX A;  5L8R E;  3V8K A;  4E7H A;  3HHT B;  4KRT A;  1RI0 A;  3X26 B;  5HY6 A;  2EWN A;  4C8Q A;  1PNJ A;  5KYW A;  5L23 A;  2CT3 A;  2CP6 A;  5J39 A;  2QA4 T;  2W0Z A;  4C92 C;  2DL4 A;  1KQS S;  1OPK A;  1YHQ Q;  1SEM A;  4J9D A;  3TU4 K;  3RUX A;  2J6O A;  2X4J A;  3J80 E;  2MWO A;  2K6D A;  3Q1J A;  2FEI A;  2D1X A;  3DLM A;  4PLI A;  1KQS A;  4M77 D;  4ZN1 A;  5CIU A;  2A0F B;  2HZY A;  4J5Y A;  4OGE A;  4JJN K;  3OS2 A;  2AIR B;  4QKU A;  4PFP A;  3JCM c;  2JS0 A;  2XK0 A;  5LJ5 f;  3JCM Q;  2L3P A;  1U5S A;  2KYM A;  1FMK A;  5CQY A;  1NJI R;  4EPC A;  3MO8 A;  3I56 A;  2DBM A;  3QXE B;  1RI9 A;  5GAN d;  1GCQ C;  5FW9 A;  1TU0 B;  1VQN T;  4M7A G;  5GAN f;  1SRL A;  4OGC A;  5LJ3 h;  4FYX B;  3VV0 A;  2K57 A;  5LJ5 e;  1CKB A;  2VWF A;  3UF4 A;  3GLX A;  5FRO A;  2KBT A;  3OYE A;  2MF2 A;  3OYL A;  2O9S A;  5GAO p;  5I2S A;  2BIV A;  5EC7 A;  2CUB A;  2M0Y A;  3GF5 A;  4PK4 A;  1U1T A;  4YTL A;  2LP5 A;  4A53 A;  1WHL A;  3OYN A;  3SWN C;  5GAM g;  1AD5 A;  3M56 A;  4J7I A;  2ZPF B;  1SHF A;  2K7A A;  1GXI E;  3FRN A;  4J7F A;  4RUG A;  2CZ0 B;  2KAF A;  3V7S A;  1S72 T;  2RHI A;  1QKW A;  4M77 C;  1BIA A;  4M78 F;  8AT1 B;  1WHH A;  2EKH A;  1M27 C;  1WQW A;  2K2V A;  2LNV A;  2GQI A;  1FYN A;  3P8H A;  4JRP A;  1M1K R;  4M78 B;  3G7Z A;  1UFF A;  4BI8 B;  3VS1 A;  2ED0 A;  5GAM d;  1H3H A;  2V8I A;  3OQ5 A;  4F14 A;  2QDY B;  2QXF A;  1AOJ A;  4J83 A;  3M54 A;  4M7A F;  1KC8 U;  1B7T A;  3OYC A;  4A4F A;  4CC3 A;  2JW4 A;  5GAO q;  1ACM B;  3NHN A;  3QZ5 B;  1WJR A;  3M4Y A;  5LJ3 j;  4C0D B;  4C92 E;  9ATC B;  3JB9 F;  1WHG A;  4GLK A;  2E12 A;  4OMQ A;  4OVA A;  1I5O B;  4M77 A;  2GFA A;  2QEX T;  1I1J A;  5KYN A;  2HNI A;  4LUD A;  4TVR A;  4FT4 A;  5KYU B;  4P5N A;  3R6N A;  3CCQ T;  3DB4 A;  3AHU A;  5GAM f;  1AWW A;  1RAC B;  4WTO B;  1AEY A;  3H6Z A;  3VYG A;  5FWB A;  2RF0 A;  2MWP A;  3MP1 A;  5GAN 3;  1SHG A;  1VYU A;  4F7U E;  5FRN A;  1UJY A;  3MP8 A;  1PRM C;  3X24 B;  3SD4 A;  2GF7 A;  5IXB A;  2DER A;  3LYI A;  1M9S A;  2DIL A;  3QSU A;  2L3Q A;  1VQL Q;  3BY7 A;  4BY6 B;  3U23 A;  2RQT A;  2YT6 A;  1M1G A;  1OX9 A;  3JB9 J;  4CC7 A;  1OYX A;  1BBZ A;  4ORZ A;  1U06 A;  4N0A C;  1R0B G;  4PJN A;  1VQ6 Q;  5GAN 4;  4PJO D;  1UGV A;  1XQH A;  4E7J A;  3FB9 A;  2LJ0 A;  3C94 A;  2DAQ A;  1OU8 A;  1IZ6 A;  2JT4 A;  2A37 A;  5FU7 C;  1TOV A;  1VQ8 T;  3REB B;  2ZPE B;  5LL6 S;  3PVL A;  2M16 A;  1OV3 A;  1WLP B;  4A4G A;  2JM9 A;  4DBR A;  1VQO Q;  2VYT A;  1JXM A;  3QWX X;  3GPL A;  4NL3 A;  2JZ2 A;  2F69 A;  3VS5 A;  5CK9 A;  3M59 A;  2ENM A;  2DL5 A;  1YCS B;  3A5Z B;  3MEA A;  1VQ9 A;  2FZK B;  1VQK Q;  1GBR A;  3CCV Q;  2DYI A;  3JRZ A;  1G8X A;  1SF9 A;  3KFV A;  3OYJ A;  2RK1 A;  4XTZ A;  1U3O A;  4J6Y A;  2AZS A;  2IIM A;  2LJ1 A;  5I2M A;  2YUP A;  5HCK A;  3MEV A;  4M78 C;  3UDC A;  2CZ6 B;  1KK7 A;  1M1K C;  3CEY A;  3H9N A;  1RL2 A;  2F5K A;  2RQR A;  4CC4 B;  3CD6 Q;  4HVV A;  1K4U S;  1RLQ C;  4OMP A;  1B07 A;  3MJX A;  3L2Z A;  1VQ4 A;  2DA9 A;  3OYG A;  1NLP C;  2E64 A;  3CME T;  5IHK A;  3G71 Q;  2O88 A;  1QVF A;  4DBQ A;  1DJ7 B;  3V7R A;  1GCQ A;  4AFU C;  2P0K A;  3PIO A;  2RJF A;  2DEQ A;  2HBW A;  1VQ5 T;  4E7Z A;  3EG9 B;  1AWJ A;  2KYB A;  1HJD A;  2V1Q A;  1NYG A;  3TQ7 P;  2QI2 A;  1U8R A;  4IUR A;  4AG1 C;  2NUT B;  2J6K A;  1RAD B;  2XKO C;  4IUT A;  3EGX A;  1PCX A;  1BI3 A;  2GBQ A;  1G3T A;  3KXT A;  1AHJ B;  2OTL Q;  3IQL A;  1W2B S;  1IRE B;  3BE3 A;  2AKK A;  2E3H A;  3G6E Q;  1BCO A;  5EG2 A;  5GMK l;  2JNG A;  1WIE A;  2PTK A;  2CS7 A;  1LJO A;  1PHT A;  1XTD A;  5HKC A;  1VQ4 Q;  4L6V 5;  3CMA T;  1ZSZ C;  2YSQ A;  2R5A A;  1EFN A;  4PLL A;  3CBM A;  3M0T A;  5KYU A;  3L1A A;  1VQN A;  3A8O B;  3H0F A;  1RAE B;  4RCB A;  2KI7 A;  4XTU A;  3WVD B;  5FRM A;  1M30 A;  2WSE E;  2DE0 X;  2ZCF B;  4F7U F;  4DOV A;  2L3S A;  1C1A A;  3BDU A;  1VQM A;  3M57 A;  4BDZ A;  3THK A;  1WHM A;  1TUD A;  3CCM Q;  2Z0W A;  1YJ9 A;  4X9D A;  4NOY A;  1IGQ A;  3OY9 A;  3RKW A;  4JS5 A;  2DK3 A;  5HK0 A;  4X9C A;  2DKG A;  1VA7 A;  2JMA A;  4PJO F;  2DIG A;  1PD1 A;  5GAN 5;  5D6W A;  2LCS A;  4Y91 A;  5CKH A;  4A54 A;  1VQP T;  1ZSZ B;  4A63 B;  4LDV A;  1RAB B;  1X27 A;  4DEX A;  4ELZ C;  2M9U A;  4MDX A;  3TEE A;  3P8B B;  1YJ9 T;  3JCM f;  1VQ6 T;  4ZTJ A;  2EQU A;  3OS0 A;  3JCM d;  1VQO A;  2DPP B;  4NL2 A;  1Q81 R;  2OTJ T;  3BFM A;  1YBY A;  3M0R A;  1SRM A;  1Q81 C;  2FL7 A;  1ZSG A;  2B86 A;  3OMC A;  5FU6 B;  2JS2 A;  1UE9 A;  1UGR B;  2DO3 A;  2RMO A;  3ZL7 C;  3JAM E;  1QP3 A;  5IAY A;  1JRI A;  4DEY A;  4LD6 A;  2JM8 A;  4C8Q G;  5CO7 A;  2KDS A;  1MHN A;  2ZGW A;  3CC4 Q;  2IVW A;  2Y4Y A;  3OW2 A;  1G3S A;  2L3R A;  4M78 E;  5GAN g;  4EMK A;  2X4X A;  2JXB A;  1H3Z A;  1TWB A;  4F17 A;  1M90 C;  3UA6 A;  2A08 A;  4KUL A;  2COY A;  3OYD A;  2FPD A;  2FG0 A;  2MPX C;  3C4S A;  2DXC A;  4MDW A;  2RPN A;  1QMC A;  2AHJ B;  1WDX A;  1MMD A;  2MAM A;  3OYA A;  1ZX6 A;  2CSQ A;  4DQ2 A;  3EG3 A;  3CBP A;  3NTH A;  1KG1 A;  3PMI A;  1OPL A;  2CKK A;  1M90 R;  1BI1 A;  1WQ7 A;  3I9Q A;  1JBM A;  4II1 A;  2LTO A;  2RHZ A;  1YWP A;  2COW A;  2JTM A;  1QVP A;  3VRZ A;  3CCR T;  1UEC A;  4JRI A;  3O8V A;  4PJO A;  2DL8 A;  4RTZ A;  4N0A A;  4AFS C;  1OZ2 A;  3M58 A;  3JCM V;  1CSK A;  3WXM B;  1U1S A;  2C0I A;  1W2B A;  5FLX E;  1VQ6 A;  1YJN A;  5A0G A;  4JUV A;  1UGQ B;  3OYM A;  1C0M A;  4QQD A;  1KD1 C;  3NGP A;  4PFO A;  5GMK i;  3L2Q A;  3JB9 G;  1N9S A;  5A0D A;  3CCS A;  4JRQ A;  1KHI A;  1KHC A;  4M4Z A;  4E2F B;  2E41 A;  3SWN A;  2MYS A;  2E5K A;  1WI7 A;  1M3A A;  3OBY A;  1TXQ A;  1R8O B;  4PNO A;  3LWH A;  4LD9 K;  1GCP A;  4MZT A;  5D6Y A;  2I2L A;  2XID A;  4M7A B;  4M7D F;  2DVE A;  4J9I A;  2COZ A;  4HCZ A;  2KE9 A;  2D0N A;  2ZPG B;  3CXC A;  4RG8 A;  6AT1 B;  5DLO A;  4QVD A;  3DLL A;  1D3B A;  3QO3 A;  1Y7X A;  2YWW A;  4L5G A;  1VQP A;  1PC0 A;  3RER A;  3HFO A;  3CXC S;  2HBP A;  4FW2 A;  3M0Q A;  4PJO C;  5I11 A;  1YIJ Q;  2BZY A;  3G4S A;  1UDL A;  2E4H A;  5KCO A;  3R6O A;  1PSE A;  1WX6 A;  1MMG A;  3V7C A;  5LJ3 f;  2QA4 Q;  2L89 A;  2VB6 A;  2RQU A;  1JXO A;  1AWO A;  1JJ2 S;  5D7U A;  2NYS A;  4FCY A;  3RES A;  1Z9Z A;  2PVD B;  1PRL C;  2B8A A;  2VXF A;  4LE9 A;  5DLQ E;  2LT1 A;  2XDP A;  2VUB A;  1WHK A;  2J7I A;  4M77 E;  4X34 A;  4DOW A;  2EBP A;  4Z88 A;  2CGH A;  2SRC A;  2KR3 A;  2CZ1 B;  2EJF A;  3CCE Q;  4GLM A;  1YJ9 Q;  5J26 A;  4CC2 A;  1JJ2 P;  3RMS A;  2DEU A;  3BDL A;  1AVZ C;  1A0N B;  1NJI C;  2X3X D;  2QTV A;  2FO0 A;  3M4G A;  3E1S A;  2FHD A; 
#chains in the Genus database with same CATH homology
 3MEU A;  4M7A A;  2OTL A;  4HKE A;  2HQX A;  4M77 B;  3MP8 A;  3X24 B;  4BB7 A;  3SD4 A;  2GF7 A;  1FXX A;  3PNW C;  3CME A;  3LYI A;  1M9S A;  1QW1 A;  4B9W A;  2D6F A;  3CPW A;  1VQ4 T;  3QSU A;  4OB1 B;  4Z02 A;  2EFI A;  3BY7 A;  4BY6 B;  3CC2 T;  3CD6 A;  4JLG A;  1K73 C;  2CYZ B;  3ZEH A;  5CR2 A;  2YRV A;  2R57 A;  5LJ3 g;  4IUQ A;  1M1G A;  4L59 A;  5LJ3 d;  3JB9 J;  3QYH B;  1OYX A;  1K8A C;  3N5B B;  5CKE A;  1WGS A;  3CCQ A;  2L8D A;  4N0A C;  3A8L B;  4N4H A;  4C8Q E;  2VGN A;  5GAN 4;  1M1K U;  4PJO D;  1YHQ A;  2QEX A;  3M9Q A;  3CD6 T;  1XQH A;  3L2U A;  4FIB A;  2FYK A;  4E7J A;  4M7D A;  2DZ9 A;  3FB9 A;  1PSF A;  3C94 A;  1BI0 A;  1UGP B;  2DAQ A;  3CPF A;  5GAO n;  3G71 T;  4M78 G;  1IZ6 A;  4PL6 A;  3LLR A;  1VQ8 A;  4FSX A;  5FU7 C;  2KQW A;  3QPH A;  1WJQ A;  5FU7 B;  3VKI A;  5DM7 R;  4BDY A;  2PVG B;  3H8Z A;  1VQ8 T;  3CCE A;  3LGL A;  3CCV T;  3I55 T;  3CCJ T;  3J81 E;  2ZPE B;  2QQR A;  5LL6 S;  2M16 A;  2RH2 A;  2RHY A;  3QJY A;  4JDS A;  1LOJ A;  4A4G A;  1B34 B;  3JB9 D;  2VYT A;  3TRE A;  3OS1 A;  3M53 A;  2ZPI B;  3GPL A;  4NL3 A;  2LVM A;  1KD1 U;  4FT2 A;  4EDU A;  2JZ2 A;  1EIF A;  2A3L A;  2F69 A;  5J3B A;  4J8O A;  2EKO A;  3URG A;  3M59 A;  5CK9 A;  2D9T A;  2E5Q A;  2JOY A;  2XIC A;  3NTK A;  1VQL A;  1JJ2 A;  2LCL A;  5CKF A;  4HT9 A;  3GNF B;  3PGG A;  1X01 A;  4CI0 C;  4C92 A;  3A5Z B;  3MEA A;  1K9M U;  4IUV A;  2L5Q A;  3HRS A;  2LQ8 A;  1BIB A;  4D6W A;  2QQ9 A;  1NJI U;  1VQ9 A;  3A8M B;  2XDB A;  4ATO A;  3INZ A;  4C8Q C;  3OS5 A;  5GAN 8;  3JRZ A;  3SB2 A;  2EQJ A;  2LC4 A;  3OYJ A;  5KE2 A;  2RK1 A;  4XTZ A;  1VQ5 A;  4EMK C;  4J6Y A;  1BI2 A;  3JCM J;  2G3R A;  2YLB A;  3CCL T;  1BYM A;  3PIP A;  1B34 A;  5I2M A;  3UT1 A;  2KVQ G;  3MEV A;  4M78 C;  4ZGJ B;  3PT9 A;  3X25 B;  3UDC A;  3DKM A;  3CC7 A;  2CZ6 B;  3ME9 A;  1M1K C;  3BW1 A;  3CEY A;  1I5L A;  1YJW T;  1RL2 A;  2F5K A;  3CC4 A;  1FWZ A;  1M90 U;  1QVG S;  2KSS A;  4NS5 A;  1N8R C;  3OMG A;  4HA8 A;  2KY9 A;  2E65 A;  3L2Z A;  1VQ4 A;  3RKX A;  2EQK A;  2E6N A;  3OYG A;  2E64 A;  3G4S T;  1YI2 T;  3CME T;  4M7A E;  4GY5 A;  5LJ3 e;  2ZPH B;  2PQW A;  4JLI A;  1QVF A;  1DJ7 B;  3CC7 T;  3V7R A;  3X20 B;  3HRU A;  4IUU A;  2DXT A;  5GAO m;  1QVG A;  2P0K A;  4KBM B;  3OB9 A;  3RMQ A;  4KUD K;  2VC8 A;  3PIO A;  3MHX A;  3CCL A;  5KH6 A;  2RJF A;  2DEQ A;  3KUF A;  1LNX A;  2QQA A;  1VQ5 T;  3E9G A;  4ZGD B;  3C12 A;  3FLG A;  1N6A A;  3SWN B;  4C0F A;  4C92 F;  1VQ9 T;  2QI2 A;  3HFN A;  5CAI A;  1U8R A;  1H64 1;  2K5I A;  4IUR A;  3HL8 A;  3HPW A;  4O5V A;  4M75 F;  2YHT A;  3OA6 A;  3CMA A;  2XKO C;  4RMO A;  4IUT A;  2K4Y A;  2DD5 A;  1P92 A;  3I56 T;  4BI3 A;  3UWN A;  1Q7Y C;  3JB9 H;  1NE8 A;  1BI3 A;  1G3T A;  3KXT A;  3L42 A;  3JB9 G;  1AHJ B;  3LH0 A;  3DB3 A;  3EAE A;  4PJO E;  1S72 A;  1Y96 B;  1W2B S;  3E9F A;  4OP0 A;  4Y28 E;  4BUG A;  1N9R A;  1IRE B;  5GMK m;  4M75 E;  2HAX A;  4EMK B;  3S3M A;  4RCC A;  4RKU E;  3JSC A;  3G71 A;  5IN1 A;  2LX9 A;  4OMF B;  4C8Q B;  5GAO r;  5GMK l;  5EG2 A;  2JNG A;  3VU3 C;  2A7Y A;  2CS7 A;  2R5M A;  1LJO A;  1NPR A;  1XTD A;  1Y96 A;  4QW2 A;  4L6V 5;  5HKC A;  1YIJ T;  3CMA T;  3LGF A;  2HD0 A;  4XAX B;  4C8Q F;  2XU8 A;  3ZFJ A;  4E7L A;  3CCM A;  3M55 A;  2RA2 A;  4M75 B;  2R5A A;  2EQM A;  3M4G A;  5CVI A;  3GNG A;  2ZZD A;  3VYH B;  1YJN T;  4PLL A;  3CBM A;  2LT4 A;  2RJC A;  3QKJ A;  2JN0 A;  3L1A A;  4F7U A;  5A0L A;  3LW5 E;  3FIF A;  4BD3 A;  2RM4 A;  4M7A C;  1VQN A;  2R58 A;  3A8O B;  2M1H A;  4RCB A;  4XTU A;  4J6W A;  4JRK A;  3WVD B;  2E6Z A;  4M7A D;  3FC3 A;  5FRM A;  2RHX A;  2WSE E;  2ZCF B;  1X75 C;  3NTI A;  3CC2 A;  3QII A;  4F7U F;  3CCE T;  4HCC A;  4DOV A;  4OB2 B;  4BE2 A;  3BDU A;  3PTA A;  1VQM A;  3HP9 A;  4M75 D;  2DXB A;  1WNL A;  3RIR A;  1ZQ1 A;  4M7D G;  3M57 A;  4BDZ A;  5GAM j;  3CCR A;  4XU1 A;  5CCA A;  4A4H A;  4KT0 E;  3HSB A;  2RK2 A;  3OYH A;  4A4K A;  1YJ9 A;  1ZBX A;  3CBO A;  3OSS C;  4X9D A;  3J7A F;  2X4Y A;  3V8J A;  1TH7 A;  4NOY A;  3CPW S;  4C92 G;  3RKW A;  3OY9 A;  3VUB A;  4XK8 E;  4JS5 A;  2LCC A;  3TCJ A;  3UPU A;  1VQL T;  2DK3 A;  4OB0 B;  5HK0 A;  4OF1 A;  5GAM e;  2FVU A;  4M77 G;  1VIF A;  1XOV A;  4X9C A;  3G6E A;  2DKG A;  3QHS A;  1VQK T;  4PJO F;  3EFS A;  4FU6 A;  2DIG A;  4IUP A;  4Q5W A;  2PUO B;  2MMP A;  5GAN 5;  3S3O A;  2RHU A;  2WSC E;  5D6W A;  1I81 A;  4FM4 B;  3OYB A;  3CCS T;  4Y91 A;  5CKH A;  4A54 A;  2V8K A;  1VQP T;  3LWI A;  4LDV A;  4F7U G;  2QA4 A;  3PFS A;  2RD1 A;  4ELZ C;  2PUK B;  4ZGE B;  1XNI A;  2M9U A;  2O01 E;  4MDX A;  2XHC A;  3TEE A;  3P8B B;  4MZP A;  2JUF A;  4E47 A;  1VQO T;  5HK3 A;  1YJ9 T;  1Q7Y U;  1KC8 C;  3C95 A;  4M7D B;  5LJ5 j;  4E7K A;  3JCM f;  1M5Q 1;  4DA4 A;  2EAY A;  4BAC A;  2DTI A;  4ZTJ A;  1VQ6 T;  2M0O A;  4MZM A;  1O75 A;  3OYI A;  2EQU A;  1HXD A;  2P0Q A;  3JCM d;  3OS0 A;  5FU6 C;  1VQO A;  2DPP B;  4UC4 A;  3OBW A;  1OZ3 A;  4M78 D;  4NL2 A;  4C92 B;  4XTV A;  2OTJ T;  3BFM A;  3L2W A;  4MMK A;  1YBY A;  4ME7 A;  2V8J A;  5GAN e;  2HQE A;  4C0Z A;  2FL7 A;  3OMC A;  5FU6 B;  1Q81 C;  2MI6 A;  3QJ6 A;  4QVZ A;  3GOX A;  3VUZ A;  4C8Q D;  4VUB A;  1UGR B;  1Q86 C;  2DO3 A;  1I8F A;  1I4K 1;  3JAM E;  1QP3 A;  1M8V A;  3QZ9 B;  1D3B B;  1G3W A;  2EJG A;  2FB7 A;  3SFM A;  1JRI A;  3V8L A;  5IAY A;  5LJ5 d;  3CCM T;  4LD6 A;  4N4I A;  4C8Q G;  4B9X A;  5CO7 A;  2KDS A;  3F70 A;  5GAN j;  1VQ7 A;  1MHN A;  3CCU T;  2BKD N;  2WAC A;  2ZGW A;  3CCU A;  1Q82 C;  3P8D A;  3RKY A;  4C0D C;  2IVW A;  2P0P A;  5GMK h;  3JCM b;  4M78 A;  1KQ2 A;  2Y4Y A;  3OW2 A;  4OB3 B;  1G3S A;  2L3R A;  4M78 E;  5GAN g;  2C06 A;  2QTX A;  5L8R E;  3V8K A;  2D0Q B;  1SSF A;  3HHT B;  2X4X A;  1VIE A;  4C5H A;  4EMK A;  5C0M A;  4E7H A;  1M90 C;  1H3Z A;  1RI0 A;  4KUL A;  3X26 B;  3OYD A;  5HY6 A;  2EWN A;  3FDR A;  4C8Q A;  4FL6 A;  3C4S A;  3WVE B;  2EIF A;  4WF2 A;  2DXC A;  4MDW A;  5J39 A;  2QA4 T;  1JB0 E;  3L2R A;  4C92 C;  1Y07 A;  2K3Y A;  4O6J A;  5LJ5 h;  2AHJ B;  3HRT A;  1N8R U;  1KQS S;  2XD0 A;  1Q86 U;  4E7I A;  4ZTF A;  3OYK A;  1G5V A;  2MAM A;  3TU4 K;  2DTO A;  3RUX A;  4BE0 A;  2X4J A;  3OYA A;  2K5L A;  3HKS A;  3J80 E;  4DQ2 A;  2MWO A;  3EFR A;  1HK9 A;  4IKF A;  3CBP A;  3FJP A;  3NTH A;  3ER0 A;  1UEB A;  3Q1J A;  1O9S A;  4ZN3 A;  1KG1 A;  3DLM A;  2GQV A;  3PMI A;  5GAN 2;  2CKK A;  4PLI A;  4HT8 A;  1KQS A;  2RB6 A;  1BI1 A;  2KK4 A;  2E1H A;  3QBY A;  1WQ7 A;  3QYG B;  1JBM A;  4II1 A;  4M77 D;  3JB9 I;  4ZN1 A;  5CIU A;  1W4S A;  4R55 A;  2LTO A;  1K8A U;  4J5Y A;  3JCM h;  4OGE A;  4QVC A;  2O4X B;  4JJN K;  2RHZ A;  5KE3 A;  2K3X A;  4PKC C;  3S6W A;  2RI5 A;  4BI4 A;  2JTF A;  2JTM A;  4XQ3 A;  3OS2 A;  2DJZ A;  1QVP A;  2X35 A;  4XTX A;  1YIT T;  3CCR T;  1YI2 A;  1QP2 A;  3MCA B;  4N4G A;  4JRI A;  3JCM c;  5GMK e;  3O8V A;  4M7D C;  4ELY C;  4PJO A;  2XK0 A;  5LJ5 f;  2BUD A;  3JCM Q;  5CQY A;  4M7D D;  2XDD A;  4EPC A;  3E19 A;  3MO8 A;  3T9N A;  3I56 A;  2DIQ A;  3QXE B;  4N0A A;  3OYF A;  1N27 A;  1YCY A;  1WJS A;  5CKD A;  5GAN d;  4BY6 C;  1OZ2 A;  3M58 A;  3JCM V;  1NZ9 A;  2VGM A;  1FX7 A;  2QQS A;  3GP8 A;  1VQN T;  4M7A G;  4PJO B;  3WXM B;  5GAN f;  1U1S A;  1Q81 U;  5AYF A;  4OGC A;  5LJ3 h;  1W2B A;  3VV0 A;  2K57 A;  5FLX E;  1K9M C;  1VQ6 A;  2XG8 D;  4A4E A;  4JS4 A;  1YIT A;  1UGS B;  1YJN A;  2P4T A;  5LJ5 e;  5A0G A;  3GLX A;  3FEO A;  4EMH A;  4C5I A;  2O4X A;  4JUV A;  2EJ9 A;  2WSF E;  1UGQ B;  5FRO A;  3JCM X;  2LRQ A;  2EYQ A;  3OYM A;  2RJD A;  3OYE A;  2IG0 A;  4QQD A;  1KD1 C;  2MF2 A;  4CRI A;  3OYL A;  5GAO p;  5I2S A;  2BIV A;  2RJE A;  5C6S A;  3GF5 A;  1N9S A;  2QQB A;  5A0D A;  5GMK i;  3MEW A;  2XI9 A;  1U1T A;  4YTL A;  5GMK j;  1KHI A;  3CCS A;  4JRQ A;  1KHC A;  2Y4X A;  4QQG A;  4A53 A;  4XTW A;  2H3J A;  4M77 F;  4XU0 A;  2E41 A;  3SWN A;  3ZBD A;  4M75 C;  4M75 A;  5GAM h;  3SWN C;  2YLC A;  5GAM g;  3OYN A;  4R56 A;  1VQK A;  3M56 A;  2VXE A;  2ZPB B;  4J7I A;  2ZPF B;  3OBY A;  3SDZ A;  2X4W A;  2DZC A;  1R8O B;  4PNO A;  5GAN h;  1GXI E;  5KCH A;  1WPY A;  3L2V A;  2DTH A;  3LWH A;  4LD9 K;  4MZT A;  3FRN A;  1UB4 A;  3X28 B;  4J7F A;  2GCX A;  5D6Y A;  2I2L A;  2XID A;  4PJO G;  4M7A B;  4BE1 A;  4M7D F;  3V7S A;  2CZ0 B;  2KAF A;  2DVE A;  2Y90 A;  2RHI A;  5A2Q E;  3JCM W;  1S72 T;  2DXU A;  4HCZ A;  4M75 G;  2ZPG B;  3CXC A;  4RG8 A;  4M77 C;  1BIA A;  4LDW A;  4M78 F;  5D6X A;  4QVD A;  5DLO A;  3DLL A;  1VQM T;  1D3B A;  1VUB A;  3QO3 A;  2RI2 A;  2DD4 A;  2E70 A;  1Y7X A;  1WQW A;  2K2V A;  2LNV A;  2RI3 A;  2GFU A;  3A8H B;  4L5G A;  4LDU A;  5M9O A;  1BKB A;  1VQP A;  1YHQ T;  5IT9 E;  4V2S A;  2CZ7 B;  1VQ7 T;  3P8H A;  4LDY A;  3MP6 A;  2LQK A;  4XTY A;  3HFO A;  3ASK A;  3CXC S;  4M78 B;  1G3Y A;  4JRP A;  3RER A;  3G7Z A;  3CCV A;  2HBP A;  3NFC A;  4XU2 A;  4BI8 B;  2KMT A;  4KUI A;  4C0G A;  5LJ5 g;  4HCB A;  5GAM d;  4PJO C;  1MGQ A;  2OAU A;  2V8I A;  4C5G A;  3PMT A;  3OQ5 A;  2QDY B;  2QXF A;  4J83 A;  2RO0 A;  3M54 A;  3G4S A;  2PU9 B;  4M7A F;  5KCO A;  1KC8 U;  3R6O A;  1QVF S;  1PSE A;  3OYC A;  3JCM P;  4A4F A;  3V7C A;  2OTJ A;  5LJ3 f;  2LDM A;  3CC4 T;  3I55 A;  2L89 A;  3CCJ A;  4M7D E;  4C5E A;  1JJ2 S;  3KBG A;  3QUI A;  5DY9 A;  5GAN 7;  3A8G B;  3OYY A;  5GAO q;  2OTL T;  3QZ5 B;  1WJR A;  1M1F A;  3M4Y A;  5LJ3 j;  3RES A;  4F7U B;  4J6X A;  3VJP A;  2PVD B;  2PVO B;  3MET A;  3OW2 S;  4C0D B;  4C92 E;  3QG1 A;  3JB9 F;  2B8A A;  5I21 A;  1X6O A;  2VXF A;  4XU3 A;  4GLK A;  2E12 A;  4QQ6 A;  4OVA A;  5DLQ E;  3L2Q A;  2LT1 A;  2XDP A;  1ZHI A;  2GFA A;  4M77 A;  2VUB A;  2E10 A;  3QDR B;  4RG2 A;  2HNI A;  2QEX T;  2K5F A;  3JCM e;  4M77 E;  4TVR A;  4FT4 A;  3JCM g;  3S3N A;  4X34 A;  4DOW A;  4P5N A;  1M4Z A;  3CCQ T;  1KQ1 A;  3DB4 A;  4C92 D;  3AHU A;  5GAM f;  2CGH A;  4MML A;  5CKB A;  3M5A A;  3H6Z A;  3VYG A;  1Q82 U;  4LDX A;  1OI1 A;  2F5T X;  1NPP A;  4EMG A;  2CZ1 B;  1V29 B;  2VV5 A;  2EJF A;  1K73 U;  2MWP A;  3MP1 A;  2NLU A;  5GAN 3;  3LX7 A;  3G6E T;  1YIJ A;  5J26 A;  4F7U E;  3GIB A;  3RMS A;  3BDL A;  5FRN A;  1NJI C;  3OSV A;  1Y71 A;  5GAN 6;  5GAO l;  2JVV A;  1YJW A;  3E1S A;  5CQX A;  2FHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...