4C8QG

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
69
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNRKLGLTVIRGTILVSLSSAEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 11
structure length 69
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qG00
4M7AG 4F7UE 4PJOG 4QVCA 5GMKe 3FIFA 2EJ9A 2VXFA 2EAYA 4XTXA 4J5YA 3VU3C 3RUXA 3GIBA 3JCMQ 5GAN8 3HFOA 3JCMd 2E65A 4V2SA 4PJOA 2YLCA 4M7AE 4N0AA 5CAIA 5DY9A 2DTHA 5GAOr 5LJ3e 3SB2A 1TH7A 3SWNC 2FYKA 1I81A 2QTXA 4Y91A 1U1TA 2DZ9A 2RD1A 1M5Q1 5GAMe 2CGHA 1B34A 1U1SA 2VXEA 3RESA 5LJ5e 2DJZA 4EMHA 1WQ7A 2DTIA 4J6WA 4NL3A 4M77B 1D3BB 3JCMc 5GMKm 4M7DB 3V7RA 1I8FA 3M4GA 1M8VA 3V8LA 4XQ3A 4EMKB 3FB9A 5GMKi 3JCMJ 4OP0A 4XU1A 4XU0A 1WPYA 5LJ3d 4JUVA 1Y96A 4A54A 1I4K1 5GANd 1N9SA 2RB6A 1WQWA 1KQ2A 2HNIA 4M75F 1JBMA 3HFNA 5GAMd 1D3BA 2YHTA 5LJ5d 4X9CA 4C8QB 1BIAA 3JCMh 4XTUA 4HA8A 1I5LA 2E64A 4M75A 5I21A 2Y90A 3SWNA 3BY7A 1BIBA 5GAN7 4PJOE 4C8QF 5GMKh 4EMKC 2DKGA 4M75C 5GAOl 2DVEA 2E1HA 4M75D 4XU3A 2DEQA 5GAN5 2E10A 3QHSA 4M78B 3FJPA 4C8QA 2I2LA 4M7AB 4EMGA 1YCYA 3JCMb 4PJOC 4A53A 2JN0A 2EJGA 4C8QC 4C8QD 4M78F 4XTVA 5LJ3h 5GAN3 4M77F 3V8JA 2DXTA 4M75G 3EFRA 4MMLA 5GANh 4M7DF 2DZCA 3JCMX 5GAMh 3JCMV 3EFSA 2DXUA 5LJ5h 3HSBA 4M77A 4C92B 2EJFA 5GAOp 3QO3A 4RCCA 3JB9F 4M7DA 2EWNA 4M78C 4C8QG 4F7UB 4EMKA 4M78D 3JB9H 4JRIA 4M77C 1WNLA 4M77D 4M75E 3V7SA 4C92F 1HXDA 5GAN2 3AHUA 4M7DC 4M7DD 1LJOA 4F7UF 1H641 3PGGA 4JRKA 3JCMg 3RKXA 3QSUA 3JCMe 5GAOn 1HK9A 4WF2A 1N9RA 4XTYA 2FB7A 5GAN6 2DTOA 3JB9I 3JB9D 3BFMA 4NOYA 3JCMf 4C8QE 4F7UA 4M78G 5GAN4 4PJOB 3L1AA 1LOJA 1KQ1A 4M77G 4C92C 4HT9A 1MGQA 4X9DA 4C92D 3JB9J 4M7DG 5GMKj 4NL2A 4QVDA 4M7AF 4PJOF 4DQ2A 3V8KA 1LNXA 4PNOA 1B34B 5GAOm 1X01A 3JCMW 1JRIA 5GAOq 3JB9G 5GMKl 4JLIA 4M78A 4M7AA 4XTZA 4M78E 3INZA 5LJ3g 4HT8A 4M77E 5GANg 4MMKA 3RKWA 3L2ZA 4C92G 4M7DE 2K57A 5GANe 3QUIA 2VC8A 3JCMP 4M7AC 5LJ3j 2YLBA 5LJ3f 2RA2A 4F7UG 4N0AC 5GAMg 1Y96B 2ZGWA 5GANf 5GANj 5LJ5g 4M7AD 4PJOD 3BDUA 2E41A 4XTWA 4RCBA 4J6XA 3V7CA 4XU2A 3RIRA 2RM4A 5GAMf 5GAMj 5LJ5j 5LJ5f 4C92A 3RERA 3BW1A 4C92E 3RKYA 4M75B 3SWNB 4J6YA
chains in the Genus database with same CATH superfamily
3NGPA 3PIOA 4QVCA 4BD3A 1GCQA 3UWNA 2EAYA 4HVVA 2HBPA 3D7SB 3H9NA 1UB4A 4M7AE 2YRVA 1K73C 4A4HA 9ATCB 1TH7A 4JJBA 1G2BA 1WQ7A 1TUCA 3I5SA 4K11A 2IPOB 3V8LA 5GMKi 3JCMJ 2KY9A 3ZL7C 4JZ3A 2QI2A 4J9IA 2YUOA 4DBQA 3Q1JA 4JS5A 5IHIA 4IUTA 3LWHA 1PG5B 2EQMA 1R8OB 1OU8A 4A4FA 2K5FA 4OMMA 3HTRA 1UGRB 1KHCA 4JJNK 3QHSA 3FJPA 4M7AB 4ZGJB 3TVTA 2QYZA 2DBMA 3CC4Q 2D0QB 1OQKA 3O5ZA 3PTAA 4O6JA 4DBRA 3EH2A 3X25B 3CC4T 5CKFA 2CH4W 1K73R 2EYYA 3OW2P 3DKMA 1LJOA 2PVGB 2KYMA 3CC7T 4PLLA 2H8HA 1RAGB 1EX4A 4D6WA 4E7SA 3L2QA 2HKQB 4OGCA 1YWOA 3VV0A 2O9SA 3QBYA 2HQHA 2QEXQ 2MMPA 4RTWA 3CXCP 2BE7D 3OBYA 2VUBA 2V26A 2QQ9A 5HK3A 2QEXT 4F7UG 4PJOC 3OW2S 1UJYA 3RIRA 1B3QA 2HEQA 1D0YA 1N8RU 2L2PA 2K4YA 2GFAA 4J9DA 2JVVA 2KMTA 2M9UA 4PLIA 1VQNQ 3O8VA 2YUPA 3VU3C 3RUXA 5KYYA 1GBQA 2DILA 4LN2A 3QIIA 5FRNA 3S3MA 1D1BA 3OYDA 2YRDA 3C95A 5DY9A 4X34A 1SRMA 4WCIA 2K3YA 4JZ4A 1Y07A 2DZ9A 1GXIE 2FEIA 2HCKA 3M5AA 2B8AA 1HJDA 1ZA1B 2OAWA 4CC2A 2CS7A 3OYKA 2EKHA 1OYXA 3G71A 1OZ2A 3HFNA 2E6ZA 4OMQA 4HA8A 4QVZA 3CMAA 2CYZB 2KROA 3C94A 4VUBA 4PJOE 1D1AA 4MZPA 5AT1B 1NJIC 4M75C 2QQBA 2DEQA 2OJ2A 3CCET 4YTLA 1YCYA 5L8RE 2LCLA 2YUNA 2DXTA 2ENMA 2L3QA 5IN1A 1SPKA 5D6YA 1TWBA 4Y28E 4FSSA 2H3JA 2QG9B 2EWNA 3CBPA 2JMAA 3H41A 2ZPEB 5A0LA 3RKXA 1KQSA 4BACA 2M16A 5FWCA 4PJOB 1X6BA 2LJ1A 4KGXB 3JB9J 4LD6A 4M7DG 2DL7A 4R55A 3NTHA 2F69A 2XI9A 1VQOA 1W70A 1MHNA 5ECAA 4HT8A 3M54A 5KYXA 3SHWA 2KVQG 5GANe 3QZ5B 3ME9A 1MMDA 5GANj 1QKWA 2E41A 4LNPA 3OYLA 4E7KA 2EFIA 3JV3A 1Z9ZA 3URGA 1N5ZA 3VRZA 5FLXE 3ULRB 2EYXA 4R56A 2OTLT 2CSIA 3QZ9B 4ME7A 2C0TA 1KD1U 1AEYA 5EG2A 1M1KU 4N0AA 2K79A 2XHCA 4Z88A 4QQDA 3VS7A 1IGQA 2Z0WA 1K4US 2E12A 3J7AF 2WSCE 2RO0A 1VQKA 2CGHA 1B34A 1UGVA 2NLUA 1X6GA 3CCQT 3FB9A 3QPHA 4AFZC 5LJ3d 2X4WA 3G6EA 1XJWB 3KXTA 2YWWA 2O4XA 1I07A 1Q82R 5HCKA 2DRMA 2E5QA 5IXBA 3LGLA 5A0DA 3BY7A 1XQHA 2KSSA 1S72A 2DD5A 1UGSB 1AOJA 3HKSA 1UE9A 3QYGB 2JJ9A 2LZ6B 1SG5A 3DLLA 3OYBA 4ESRA 3CD6A 2DZCA 5D6WA 4QQ6A 1K9MR 3EFSA 2DXUA 1UJ0A 3I5RA 1QP2A 3S3OA 1XNIA 1VQ5T 2J05A 4EMKA 3I35A 3JB9H 2CP7A 1HXDA 3J80E 4LDUA 2L0AA 1WJRA 1TUGB 2FZKB 5A2QE 2K5LA 2HD0A 4OMOA 2K9GA 3E1SA 3L1AA 4F04B 2P4RA 1BKBA 2F2VA 2C0IA 2IIMA 5GMKj 2P0PA 2LX9A 3V8KA 2Y4YA 2C0OA 2VKNA 5GAOq 4J9HA 5I2SA 1YNZA 3JRZA 3UDCA 3JCMP 2COWA 3SFMA 3R6OA 4RTTA 1E6HA 3LH0A 3OS0A 1VQ9A 3G71Q 1YITA 4M7AG 2KXCA 4ZGDB 4ORZA 3CMAQ 1CKBA 1IZ6A 2CP3A 3P8HA 2NUTA 1Q81R 3LLRA 1IB8A 3G71T 3GIBA 4AFQC 1YBYA 2FO0A 2LT4A 2E65A 3GP8A 3M0PA 1RUWA 1BI3A 4L59A 2L89A 1BCMA 2AHJB 3KFVA 3U23A 1KG1A 4C0DC 1X6OA 2DLPA 2JS0A 4JPBW 2DTIA 4GLKA 4RTYA 2DA9A 1K1ZA 1MMAA 1M8VA 2D9TA 2X4JA 4RTVA 4OMPA 5I11A 1JBMA 4ANJA 1NYFA 1LCKA 4LDWA 2KR3A 4P5NA 3REBB 4DBHA 5IH2A 1QP3A 4C8QA 2V1QA 2P84A 1ZSZB 1VQOQ 4RKUE 2AT1B 1VQ8A 1PHTA 5LJ3h 2QASA 3EFRA 2HMAA 4AG2C 2RMOA 1E6GA 4IIMA 1BU1A 3IQLA 1GRIA 3QO3A 1W1FA 2XDDA 4F7UB 4M77D 1NEGA 3VYGA 4M7DC 1N8RC 3VS5A 1SSHA 2AZVA 1YFNA 1QKXA 1VQPA 1RLPC 1F1BB 1N9RA 5GAN6 3M57A 3M55A 1X27A 3NFCA 4F14A 3MEUA 2CP0A 1NZ9A 4QVDA 1UGQB 5L23A 2RQTA 3LW5E 2NUPB 5GMKl 3F70A 1VQKQ 1JJ2P 2CZ1B 4OGEA 3RKWA 1UTIA 1MMNA 1VQKT 1YCSB 3HL8A 1A0NB 2VASA 3MEWA 3MKDA 3G6EQ 1K0XA 3PMTA 2V1RA 3OA6A 1RACB 2RF0A 1PRLC 4UC4A 2KNBB 2P0QA 4C0DB 1S72Q 3UT1A 3I55T 3CC4A 3CCJT 3CBOA 2EGCA 5CAIA 2DTHA 5LJ3e 1N8RR 1ZQ1A 2JW4A 3CC7A 3EH1A 4PFOA 5DLOA 3CD6Q 2GBQA 4KRTA 2R5AA 2QAZA 3CD6T 5KYNA 2O88A 4MDXA 1WQWA 3E2UA 2ESWA 2FPEA 1KQ2A 1W6XA 4ELYC 1UHFA 1U8RA 1BIAA 2LVMA 2DAQA 1TOVA 2JOYA 3X28B 2JXBA 2NWMA 3CEYA 1Q82U 1AHJB 1PKTA 3X26B 1MMGA 1UHCA 3GLXA 4EMGA 1QVFP 2G3RA 2J6OA 4FSXA 3TSZA 2JN0A 3A5ZB 1WXUA 2A36A 4N4HA 1OZ3A 3M58A 4OF1A 1Y71A 2RHZA 4RCCA 3TQ7P 2RJDA 5D6XA 4JJDA 3H8ZA 3EAEA 1VQ9Q 3OMCA 1K9MU 2DD4A 1YITQ 1YI2A 3FC3A 1UUEA 5IT9E 1OU9A 2AKLA 2DM1A 1VQ9T 4L5GA 4HT9A 1KD1C 3RDVA 3H0IA 5EC7A 3X24B 1M1KC 5M9OA 2YT6A 1OI1A 2HAXA 4ZNXA 3CCRT 4WTOB 4Y92A 4HXJA 3M9QA 1RL2A 1J3TA 2XKOC 1JXOA 4FL6A 4M7AC 3HRSA 3CPWS 4XU2A 4DOWA 4BI3A 5LJ5j 5KH6A 3CCEA 1SKUB 3RKYA 3MEVA 3TREA 2YXYA 1ZLMA 3A1PA 1QMCA 2MK5A 3MJXA 3OSVA 2CP6A 1QWFA 3H0FA 1FMKA 4DA4A 2DBKA 5GAOr 2K5IA 1Q81U 3KUFA 2XU8A 1VQ8Q 1ZUUA 3RESA 2MCNA 1QCFA 1D3BB 1M2VB 4RG2A 2E4HA 5FU7C 1VQ8T 4LUEA 4N4GA 1M1KR 2JTMA 1IO6A 5GANd 1WLPB 1N9SA 5KYWB 2PUOB 8ATCB 3META 2YHTA 1IHWA 3OS1A 2QQSA 2RN8A 2E64A 2ED1A 4PKCC 1VQPQ 2HSPA 3A98A 4JDSA 5IHNA 2SEMA 1B7TA 3CCUA 1VQPT 1BI1A 1ZBJA 4X1VA 3JCMb 4A53A 3P8DA 4M77F 3V8JA 3VUZA 4MMLA 2OTLA 3JCMX 5GAOp 3ER0A 2GGRA 3MP1A 4M78D 1WNLA 3AHUA 1Q86R 2QDYB 3G4ST 1H641 3L2RA 3CCQA 4C92D 2DIQA 2AK5A 2LQ8A 1SRLA 2CKKA 4MZTA 1KC8R 4JLIA 3CC7Q 2OAUA 4M77E 1X2KA 2LNHB 4BI8B 1OX9A 3OSSC 4OMLA 1MNEA 1Y96B 1U5SA 1WFWA 1VUBA 4AFSC 1R0CB 4J6XA 2CH4A 1WJSA 2JT4A 3EGXB 2DE0X 4XK8E 3PIPA 2EYWA 1RAEB 3EFOA 2KI7A 5CIUA 4ELZC 2KT1A 2O2OA 3QWYA 3I9QA 5FU7B 3CCLT 1VQ5A 2FHDA 3OW2A 4PJMA 4M77B 4C5HA 1QVGP 2GQIA 1WX6A 1BBZA 2A28A 4A4EA 2COYA 2F2XA 1YI2Q 4DEYA 3CXCS 2RI5A 1G83A 4M75A 2P4TA 3L42A 1YI2T 3MO8A 4MDWA 5FU6C 1OEBA 3MP8A 2R5MA 1PWTA 2DETA 1X43A 5GANh 1QVGS 1I1JA 4CC4B 5J26A 2B86A 3EG9A 4M4ZA 4PFZA 4ZGEB 3CCSA 1QW1A 2QA4A 3L2WA 4Z02A 1M3AA 3CCEQ 4BI4A 1WZOA 1SF9A 1TTHB 3QSUA 2LX7A 3JCMe 4XTYA 1YIJT 2DL3A 4IUPA 1VYTA 3FLGA 5KYUA 1YN8A 2PZ1A 4D8DA 3EGDA 1MGQA 5IXFA 4DOVA 3J81E 2K2VA 3A8LB 4M78A 3WVEB 5LJ3g 3L2ZA 2VC8A 3PVQA 3SD4A 3QJ6A 3V7CA 3NTIA 5GAMj 1FMWA 3HRUA 4C92A 2LMJA 1YHQT 1T3SA 2GF7A 2I0NA 1AT1B 4J5YA 2ROTA 2E3IA 4J83A 1NE8A 5GAN8 1Q82C 5HKCA 4IUQA 3CCUQ 4JJCA 1O9SA 3EG1A 3SB2A 1X69A 2A7YA 1Q7YU 1M5Q1 2PTKA 3CBMA 3QKJA 4NL3A 3CCUT 1Z9QA 2RNAA 1JEGA 2OTLQ 2XD0A 1WHMA 2CUBA 3GBQA 4HCBA 2RH2A 3NHNA 5FU6B 4KT0E 1K9MC 4BE1A 4KULA 4ZTJA 1UDLA 1K76A 2K2MA 3M53A 3SWNA 1EFNA 5GAN7 2RQUA 3QWXX 5GMKh 3OS2A 4FYXB 5GAOl 3CCQQ 3TCJA 2D1XA 2E10A 3E9GA 3EHRA 2ZPFB 4C8QD 4M78F 4XTVA 4C5GA 4E6RA 4JS4A 2G6FX 3I55A 3CCJA 2L3RA 4KH0B 2QDLA 2COZA 4C92F 3UATA 1UECA 5KYYB 1HK9A 2RPNA 2DTOA 3FEOA 2J6KA 4F7UA 1Q86U 4LXCA 1N27A 3EG2A 2BZ8A 5CQYA 1VQ7Q 4PFPA 3A8MB 1VQ5Q 2DL4A 2M1HA 2FZGB 1Q81C 3QDRB 2HSEB 4M78E 1VQ7T 4BE0A 5LJ3f 4IIOA 4N0AC 3OYCA 1YJWA 1KC8U 4XTWA 3T9NA 2NUPA 2RM4A 5KE2A 3OYYA 4KUIA 1WDXA 2M51A 4C92E 4J6YA 2KBTA 5GMKe 2DO3A 2CDTA 4PJJA 2DNUA 4J7FA 4BDYA 1M3CA 1XTDA 5HY6A 1VYUA 4J8OA 3M0SA 3PE0A 4GBQA 3GPLA 4E7ZA 2L3PA 4J9EA 2PNIA 2RI2A 3ZFJA 2HZYA 1M8MA 1PKSA 2KEAA 2V8IA 3CCSQ 4XU1A 2QA4Q 1WPYA 1VOMA 4A54A 2DYIA 4AMCA 1ZUKA 3CCRA 1M90U 5LJ5d 1Y7XA 3QDFA 1JO8A 3CCST 2HQEA 3CPFA 2QA4T 2Y90A 3C4SA 2VYTA 2MWOA 4E47A 1Y0MA 4EMKC 1T0JA 3OB9A 3OYAA 3RR6A 2RI3A 3VYHB 4CC7A 2YUQA 2JM9A 2L5QA 1BCOA 2KQWA 2L8DA 5KYXB 4OB2B 4IUVA 1H92A 1VIEA 1IXDA 1HSQA 2DJQA 3OYGA 2H3EB 4M7DA 1LVKA 1Y57A 1WGSA 1MV3A 2V8JA 3RNJA 4OMNA 2RHXA 2EPDA 2RK2A 4FIBA 3JB9D 5CCAA 3G1JA 2X35A 1EZZB 4M77G 5J3BA 1IRXA 2D8JA 2LQWA 2AIRB 2AKKA 2OI3A 4DQ2A 5FRMA 2LC4A 1B34B 1D09B 3CC2T 1SEMA 4XTZA 1TSFA 2O01E 4BDZA 1OV3A 3QUIA 4FU6A 4LDYA 3MEAA 1EIFA 2RQVA 2O4XB 1BI0A 2CP2A 4HCKA 2W10A 1PSEA 3WXMB 5CK9A 2LCSA 2A0FB 2D0NA 4RMOA 4ZN1A 1RI0A 5GJWB 3A8GB 1RAFB 2W0ZA 4AFUC 3S3NA 3A8HB 5CQXA 3HFOA 4Q5WA 3WVDB 4LD9K 2XDBA 1PNJA 4FT4A 3SEMA 2DMOA 3G4SA 2FG0A 4J9BA 1RAHB 2ZCFB 2GCXA 5GMKm 3OYFA 3M4GA 1KJWA 2DEUA 2F5TX 3MPUB 4EMKB 3ZEHA 3I55Q 4XU0A 3CCJQ 4KBMB 2HL3A 4C5EA 1WHGA 1N6AA 1GFCA 1D3BA 5D7UA 2DK3A 1G3WA 2BE9B 2LDMA 1ZSZA 1JJ2S 4C8QF 3CQTA 2DVEA 2E1HA 2RQWA 4FW2A 3KBGA 3OYNA 1GFDA 2EJGA 2KK4A 2QK0A 3GOXA 2JNGA 3E19A 4KH1B 2X3WD 4RTZA 3BE3A 1YWPA 3M0TA 1TUDA 5LJ5h 1YJWQ 2EW3A 3LX7A 3CCLA 4KGVB 4JRIA 1CKAA 3I56Q 2KYBA 2QXFA 1YJWT 3PGGA 4D8KA 2NUTB 2EQUA 3VKIA 1AZGB 2KDSA 4B6MA 3JB9I 1X75C 2ZPIB 3I56T 4C8QE 2EIFA 1VQLA 1KQ1A 1K9AA 1VIFA 2MOXA 2LQKA 1GBRA 4FYYB 3PVLA 2OX7A 3HP9A 1NLOC 5CVIA 3UA7A 4CC3A 3QG1A 2FPDA 1Q7YC 4M7AA 3INZA 2KE9A 4C0GA 4A4KA 1WYXA 1SHGA 1PD0A 5GANg 2E5KA 2WSFE 4PJOD 2E70A 3M4YA 3QXEB 2KGTA 3RBBB 1W2BP 3LH5A 4JRPA 2MI6A 1RADB 3CCRQ 4OP0A 1QVFS 4AG1C 3R6NA 3JCMQ 1NEBA 3C0CA 2LJ0A 3JCMd 3CMEA 4QKUA 2YLCA 2K3BA 1M1FA 3CCVQ 2MIOA 1M27C 2LNVA 3BDLA 3CPWA 5LJ5e 2OTJT 2Y4XA 1R0BG 3CCVT 1YIJA 1K0SA 1W2BS 1WHHA 4RTXA 2JZ2A 1I5OB 2JTFA 2PUKB 1BK2A 1D0ZA 2DRKA 5GAMd 1Q7YR 2CT3A 3SDZA 4LDVA 2ZZDA 2HQXA 2ABLA 4GLMA 1Q86C 5KCOA 4M75D 1KSWA 2DL5A 4FCYA 2CZ7B 5GAN5 2JUFA 2AZSA 2M0OA 1YHQA 1FX7A 4MZMA 1S1NA 1RI9A 1KC8C 3JB9F 1MV0B 2GQVA 1O75A 2F1LA 1D0XA 4M77C 3P8BB 4FYVB 3V7SA 5GAN2 1P92A 4QQGA 4GY5A 3AT1B 4E7HA 2EQIA 1K8AU 2GNCA 4BY6C 1M4ZA 1M2OA 4M78G 4RUGA 1E7OA 1AZEA 1G5VA 5C6SA 2X51A 4DEXA 3E9FA 1LPLA 1QCNA 3G4SQ 2CP5A 2JS2A 4C92G 3VS3A 2WACA 2KRSA 2ZGWA 5GANf 2IVWA 1G3TA 1OOTA 3VS1A 2V8KA 2DERA 1AWOA 1NPPA 1PC0A 3PNWC 1PSFA 1WHLA 2BIVA 2A37A 3MHXA 3VS4A 1M90C 1W4SA 3LWIA 2EJ9A 2VXFA 1NYGA 3VS2A 5CKEA 1GCQC 2VVKA 4ZTFA 2CUDA 4PJOA 3RMSA 3CCMA 2C06A 1HD3A 1I81A 4Y91A 2X3XD 1FYNA 1M3BA 5IAYA 2D6FA 5CKHA 1FWZA 3N5BB 3V7RA 1QCOA 2XICA 4XQ3A 4KGZB 1ZA2B 1VQ4A 5C0MA 3X20B 3CCLQ 2BTTA 2VWFA 2YRCA 4X9CA 3UPUA 3JCMh 4XTUA 4OB1B 1VQ7A 2EKOA 4IUUA 2DKGA 2FRWA 1VQLQ 4LDXA 2RK1A 2YDLA 2X4XA 1TU0B 1VQLT 1M90R 3THKA 4BY6B 2A08A 1GCPA 5GAMh 3OYHA 3CXCA 2K6DA 4J9GA 2JM8A 4CI0C 3JAME 1KIKA 1YJNA 1JQQA 4WF2A 4FW1A 2XIDA 3REAB 5LL6S 5GAN4 2RHIA 1LOJA 4LUDA 4NS5A 4Z8AA 3CMEQ 1G3SA 4PJOF 3VS6A 1QVGA 2EBPA 2MAMA 1VQNT 3CMET 3OYMA 1M1GA 2K57A 1VQMA 3UF4A 1YIJQ 2YLBA 1PD1A 2RA2A 1RAAB 4RCBA 4OB0B 1H8KA 2HKNA 4C0FA 3GNFB 3VUBA 2J06A 2EYZA 1WIEA 1JB0E 5I2MA 2M02A 1UG1A 2EGAA 2LJ3A 4ATOA 3TU4K 3EG3A 4E7LA 3OYIA 1KQSP 2K7AA 2QTXA 5GAMe 1YHQQ 2RJEA 2JTEA 1MNDA 4Z89A 4J6WA 2HL5C 3RMQA 2LTOA 2P0KA 2SRCA 3S6WA 4JUVA 2RB6A 3OYJA 2HNIA 4M75F 5CO7A 3CC2A 1WJQA 2BKDN 2KRMA 1C1AA 1TS9A 2O31A 1BIBA 7AT1B 1RLQC 2PVDB 3EHQA 2NUZA 1KQSS 1OULA 3NPFA 1OPKA 2QQAA 2CREA 2KAFA 3M59A 2X4YA 3VS0A 2XDPA 3OY9A 3JCMV 3LGFA 4N4IA 1AWWA 2DYBA 4C8QG 4M78C 4M75E 3TSWA 4HVWA 1NJIR 4M7DD 3EFOB 4JRKA 1R77A 2XK0A 5CR2A 1WXTA 3M0QA 2FB7A 3LYIA 2ECZA 2EYQA 1TG0A 3H0HA 4C92C 4NL2A 2DVJA 3GF5A 1UGPB 5GAOm 1VYVA 3CCMQ 1T0HA 2R58A 4RG8A 1U3OA 1IHVA 3DB4A 1JXMA 4MMKA 2KRNA 2GTOA 2ZAEA 2CT4A 4E2FB 1G3YA 3CCMT 1QWEA 5LJ5g 1H3ZA 1JU5C 1YP5A 2DFUA 3C12A 1VQ4Q 3OQ5A 1PM3A 3RERA 2ED0A 4M75B 1WHJA 3OMGA 1VQ4T 1CSKA 4DBFA 4QT7A 4XTXA 1NG2A 8AT1B 2O9VA 4V2SA 3FJ5A 3OBWA 2RHUA 2F5KA 2FRYA 3FDRA 3SWNC 2F2WA 2VXEA 4EMHA 3PFSA 1ZUYA 3EG9B 1VA7A 2XMFA 3I56A 2XG8D 1YJ9A 2DIGA 1ZX6A 2QGFB 1PRMC 5KE3A 5A0GA 1VQ6A 4O5VA 2MPXC 2VV5A 1YJNQ 2ROLA 3TEEA 1QVPA 5KYUB 4QW2A 4HKEA 5I21A 3EGDB 1K8AC 3L2UA 1NBEB 5CKDA 1YJNT 2GFUA 4BB7A 1K73U 4M78B 2I2LA 3M0UA 1U06A 4L6V5 4AT1B 3UA6A 5GAN3 2EVRA 1VQMQ 1WA7A 3HSBA 3QJYA 4C92B 1NLPC 1VQMT 4EPCA 4E7IA 2LT1A 1IGUA 4C5IA 4F7UF 1WI7A 2M0YA 2QGGA 3JSCA 2OTJA 2HDAA 4NOYA 1Q95G 3CCVA 2VB6A 1ZHIA 4EDUA 4JLGA 2CSQA 4X9DA 3NMZC 4J7IA 2JMCA 2PQWA 2RQRA 2X9HA 3HPWA 4PNOA 2E6NA 2WSEE 3JCMW 3JB9G 2DXBA 2LRQA 2QTVA 2LQNA 4B9XA 2ZPHB 3CMAT 4PJNA 1B07A 1K8AR 4M7AD 1V76A 1GL5A 2A3LA 2R57A 1AVZC 1KFZA 5LJ5f 2DXCA 1KHIA 5FWBA 3CC2Q 3SWNB 1SSFA 4F7UE 5J39A 3PMIA 4A4GA 2D8HA 3FIFA 2KXDA 2ZPBB 3NTKA 1RAIB 3EG0A 2MWPA 3OS5A 4FM4B 2DPPB 2LCCA 2FYKA 1U1TA 2RD1A 2DJZA 2RJCA 4OMFB 1I8FA 1G8XA 3G7ZA 4BE2A 2IG0A 2RHYA 1I4K1 2DL8A 1VQOT 1C0MA 2E3HA 2RJFA 2CZ0B 4OVAA 4LE9A 5GJVB 4JRQA 1ARKA 1IREB 1AD5A 3DLMA 1HYOA 1M30A 2CZ6B 5CKBA 4E7JA 4C8QC 2FZCB 4TVRA 2FPFA 4M7DF 2BZXA 1DJ7B 3PT9A 3EGUA 4FYWB 6AT1B 4KUDK 1UFFA 2BZYA 2EJFA 5AYFA 1M2VA 2ATCB 3L2VA 1JJ2A 5FROA 2FL7A 1NM7A 3JCMg 4EIKA 4PK4A 5KYWA 1H3HA 5GAOn 3BFMA 1NJIU 3M0RA 1M9SA 4A63B 3GNGA 3VRYA 3G6ET 2J7IA 5KCHA 1LNXA 4II1A 1FMVA 1X01A 1JRIA 2FVUA 1NPRA 1C6VX 1XOVA 2VGMA 4F17A 1S72T 4M7DE 5LJ3j 1D1CA 5GAMg 1OX8A 1T3LA 3DB3A 1YJ9Q 2EQJA 1VQ6Q 4PJLA 2GTJA 2YSQA 1BI2A 4PJOG 1YJ9T 2BUDA 2LP5A 5DM7R 4CRIA 3ZBDA 5DLQE 1VQ6T 2EGEA 4F16A 4BUGA 2QEXA 1ZBXA 1WHKA 1ZSZC 4IKFA 3HRTA 4XAXB 1WXBA 1U1SA 3JCMc 3OYEA 4M7DB 1QLYA 1QVFA 2ZPGB 2DF6A 1Y96A 3A8OB 1ABOA 4HCZA 3FRNA 3HHTB 3QYHB 4C8QB 3EGXA 1VQNA 4HVUA 1I5LA 3CPWP 2OTJQ 4OB3B 3MP6A 5I22A 4XU3A 1PCXA 2HBWA 3H6ZA 4R0KA 1W2BA 2PU9B 1YITT 1FXXA 1V1CA 1I0CA 1MUZA 4M75G 3VJPA 4IURA 1KK7A 2QQRA 4M77A 1OPLA 1UEBA 2DX1A 2VGNA 2EQKA 4ZN3A 4HCCA 2PVOB 4J9CA 3ASKA 1QQJA 1RABB 1ABQA 2K3XA 2J6FA 3JCMf 5IHKA 1ACMB 2KT8A 2L3SA 4M7AF 4FT2A 1ZSGA 2MF2A 1SHFA 3M56A 4RTUA 1X2QA 1AWXA 4B9WA 2NYSA 1BB9A 2MYSA 3BDUA 4C0ZA 5GAMf 1V29B 1TXQA 5HK0A 1AWJA 3BW1A 1BYMA 3MCAB 1KD1R 4J9FA 5FW9A 4PL6A
chains in the Genus database with same CATH topology
4UC4A 3PIOA 4QVCA 4BD3A 5GMKe 2P0QA 2DO3A 4C0DB 4J7FA 3UWNA 4BDYA 2EAYA 1JB0E 3UT1A 2HBPA 5I2MA 1XTDA 5HY6A 3I55T 3CC4A 3CCJT 3CBOA 1UB4A 4ATOA 2YRVA 4J8OA 5CAIA 1K73C 3TU4K 2DTHA 4M7AE 4A4HA 5LJ3e 4E7LA 3OYIA 1TH7A 1ZQ1A 3GPLA 2QTXA 3CC7A 5GAMe 2RJEA 5DLOA 1WQ7A 4J6WA 2RI2A 3ZFJA 3RMQA 2LTOA 2P0KA 3V8LA 5GMKi 3JCMJ 2KY9A 2V8IA 4XU1A 1WPYA 2R5AA 4JUVA 2QI2A 3S6WA 4A54A 3CD6T 2RB6A 3JB9F 4MDXA 1WQWA 3OYJA 1KQ2A 2HNIA 3Q1JA 4M75F 5CO7A 3CCRA 4JS5A 4ELYC 3CC2A 4IUTA 1M90U 5LJ5d 3LWHA 1WJQA 2BKDN 1Y7XA 1BIAA 2LVMA 1U8RA 2DAQA 3CCST 2HQEA 3CPFA 2JOYA 2QA4T 3X28B 2Y90A 3C4SA 2VYTA 1BIBA 2EQMA 1R8OB 2MWOA 4A4FA 2K5FA 3CEYA 4E47A 4EMKC 2PVDB 1AHJB 1Q82U 3X26B 1KQSS 1UGRB 3OB9A 3OYAA 1KHCA 4JJNK 2RI3A 3VYHB 3GLXA 3QHSA 3FJPA 2QQAA 2G3RA 4M7AB 4EMGA 4ZGJB 2L5QA 2KQWA 2L8DA 4FSXA 2JN0A 2KAFA 3A5ZB 4OB2B 3M59A 2D0QB 4IUVA 2X4YA 1VIEA 3PTAA 4O6JA 2XDPA 3OY9A 3JCMV 3X25B 4N4HA 1OZ3A 3OYGA 3M58A 3LGFA 4OF1A 1Y71A 3CC4T 5CKFA 2RHZA 4N4IA 4RCCA 4M7DA 1WGSA 4C8QG 2RJDA 4M78C 5D6XA 2V8JA 3H8ZA 3EAEA 4M75E 3OMCA 1K9MU 4M7DD 3DKMA 2DD4A 1LJOA 2PVGB 2RHXA 3CC7T 1YI2A 2RK2A 4PLLA 4JRKA 2XK0A 3FC3A 4FIBA 5CR2A 2FB7A 5IT9E 5CCAA 3JB9D 4D6WA 3LYIA 1VQ9T 2X35A 2EYQA 4L5GA 4HT9A 3L2QA 4M77G 5J3BA 4OGCA 4C92C 1KD1C 3X24B 3VV0A 1M1KC 5M9OA 4NL2A 3QBYA 3GF5A 1OI1A 1UGPB 4DQ2A 2HAXA 5FRMA 2LC4A 3CCRT 1B34B 5GAOm 3CC2T 2MMPA 2R58A 4RG8A 3M9QA 3OBYA 2VUBA 1RL2A 4XTZA 2QQ9A 2XKOC 2O01E 4FL6A 3DB4A 4MMKA 4BDZA 3QUIA 4FU6A 4LDYA 5HK3A 3MEAA 4M7AC 2QEXT 4F7UG 3HRSA 4PJOC 1G3YA 3CCMT 5LJ5g 1H3ZA 3CPWS 3C12A 3OW2S 1EIFA 4XU2A 2O4XB 3RIRA 4DOWA 4BI3A 5LJ5j 1BI0A 5KH6A 3OQ5A 3CCEA 3RERA 1PSEA 3WXMB 5CK9A 1N8RU 3RKYA 2K4YA 4M75B 2GFAA 3MEVA 3TREA 2JVVA 2KMTA 3OMGA 4ZN1A 2M9UA 4PLIA 4RMOA 3O8VA 1VQ4T 1RI0A 4XTXA 3A8GB 3RUXA 3OSVA 3VU3C 3S3NA 3A8HB 5CQXA 5FRNA 3QIIA 3HFOA 4V2SA 4Q5WA 3WVDB 3S3MA 4DA4A 3OBWA 3OYDA 4LD9K 2XDBA 3C95A 5DY9A 5GAOr 4X34A 2RHUA 2K5IA 2F5KA 3KUFA 1Q81U 3SWNC 3FDRA 4FT4A 2K3YA 2XU8A 1Y07A 2DZ9A 3RESA 3G4SA 1GXIE 2VXEA 4EMHA 3PFSA 2ZCFB 1D3BB 2GCXA 5GMKm 3M5AA 3OYFA 3I56A 2B8AA 3M4GA 4RG2A 2F5TX 4EMKB 2XG8D 5FU7C 1YJ9A 2DIGA 1VQ8T 3ZEHA 4N4GA 4XU0A 2JTMA 5GANd 5KE3A 1N9SA 2CS7A 4KBMB 5A0GA 3OYKA 4C5EA 1OYXA 2PUOB 1VQ6A 1N6AA 4O5VA 3G71A 1OZ2A 3HFNA 2VV5A 1D3BA 2E6ZA 2YHTA 3META 2DK3A 3OS1A 3TEEA 1QVPA 1G3WA 2QQSA 4HA8A 4QW2A 4QVZA 4HKEA 3CMAA 2E64A 2CYZB 2LDMA 3C94A 4PKCC 4VUBA 5I21A 1K8AC 1JJ2S 4PJOE 4C8QF 3L2UA 4MZPA 5CKDA 4JDSA 1NJIC 4M75C 1YJNT 2DVEA 2E1HA 2GFUA 2QQBA 4BB7A 2DEQA 3KBGA 1K73U 3CCUA 1VQPT 1BI1A 3CCET 4M78B 4YTLA 2I2LA 3OYNA 1YCYA 3JCMb 5L8RE 4L6V5 4A53A 2LCLA 2EJGA 3P8DA 2KK4A 5GAN3 4M77F 3S3OA 3V8JA 2DXTA 3VUZA 3GOXA 4MMLA 2JNGA 3E19A 5IN1A 2OTLA 5D6YA 3JCMX 5LJ5h 4Y28E 3HSBA 3QJYA 3ER0A 4C92B 5GAOp 2H3JA 3MP1A 3LX7A 2EWNA 3CCLA 4M78D 3CBPA 4JRIA 1VQMT 1WNLA 4EPCA 3AHUA 2QXFA 4E7IA 1YJWT 2QDYB 2LT1A 2ZPEB 4F7UF 4C5IA 3G4ST 1H641 3PGGA 5A0LA 3RKXA 1KQSA 2EQUA 3VKIA 2KDSA 4BACA 3JB9I 2M16A 3JSCA 2OTJA 1X75C 2ZPIB 4NOYA 3CCVA 3I56T 4C8QE 4PJOB 1ZHIA 2EIFA 4JLGA 1KQ1A 4EDUA 3L2RA 3CCQA 1VIFA 4X9DA 4C92D 2LQKA 4LD6A 3JB9J 4M7DG 2DIQA 4R55A 4J7IA 2PQWA 3HP9A 3NTHA 5CVIA 2F69A 2LQ8A 3HPWA 4PNOA 2E6NA 2WSEE 2XI9A 3JCMW 3JB9G 2CKKA 4MZTA 1VQOA 3QG1A 1Q7YC 4JLIA 1MHNA 2DXBA 4M7AA 2LRQA 4B9XA 3INZA 4C0GA 2OAUA 2ZPHB 3M54A 4M77E 4A4KA 5GANg 3CMAT 4HT8A 2KVQG 5GANe 4BI8B 2WSFE 3QZ5B 3ME9A 4M7AD 3OSSC 5GANj 1Y96B 2E70A 4PJOD 2A3LA 2E41A 1VUBA 2R57A 3M4YA 3QXEB 4J6XA 3OYLA 4E7KA 2EFIA 1WJSA 5LJ5f 2DXCA 4JRPA 1KHIA 2MI6A 4XK8E 4OP0A 3PIPA 3SWNB 1SSFA 3URGA 1QVFS 5FLXE 4F7UE 5J39A 3PMIA 4R56A 4A4GA 3FIFA 2ZPBB 2OTLT 3QZ9B 4ME7A 3NTKA 5CIUA 4ELZC 1KD1U 5EG2A 3JCMQ 5FU7B 2MWPA 1M1KU 3OS5A 3JCMd 3CMEA 4FM4B 3CCLT 2YLCA 4N0AA 2FHDA 1VQ5A 1M1FA 2XHCA 4QQDA 2DPPB 2LCCA 2FYKA 2E12A 3J7AF 2WSCE 2RO0A 1VQKA 1U1TA 2LNVA 2RD1A 3BDLA 3CPWA 2CGHA 1B34A 3OW2A 5LJ5e 2DJZA 2OTJT 2Y4XA 4M77B 3CCVT 2RJCA 4OMFB 1YIJA 2NLUA 1I8FA 1W2BS 2JZ2A 4C5HA 3CCQT 3G7ZA 3FB9A 3QPHA 4BE2A 2IG0A 2RHYA 5LJ3d 2JTFA 2X4WA 2PUKB 1I4K1 3G6EA 3KXTA 1VQOT 2RJFA 2O4XA 2CZ0B 4A4EA 5GAMd 4OVAA 2E5QA 3CXCS 2RI5A 3LGLA 4M75A 5A0DA 4JRQA 3SDZA 2P4TA 1XQHA 2KSSA 3BY7A 2ZZDA 2HQXA 4LDVA 1S72A 2DD5A 3L42A 1IREB 1UGSB 1Q86C 5KCOA 4M75D 3HKSA 1YI2T 3DLMA 3MO8A 3QYGB 4MDWA 2CZ7B 5GAN5 5FU6C 2CZ6B 2JUFA 3MP8A 2R5MA 5CKBA 3DLLA 4E7JA 4C8QC 2M0OA 4TVRA 3OYBA 1FX7A 1YHQA 4MZMA 3CD6A 5GANh 1QVGS 4M7DF 2DZCA 5D6WA 1DJ7B 3PT9A 4QQ6A 5J26A 3EFSA 2DXUA 4KUDK 1KC8C 1QP2A 2EJFA 5AYFA 4ZGEB 1XNIA 1QW1A 3CCSA 3L2WA 3L2VA 2QA4A 2GQVA 1VQ5T 4Z02A 1O75A 4EMKA 3JB9H 4M77C 3P8BB 1JJ2A 3V7SA 4BI4A 1HXDA 5GAN2 3J80E 5FROA 2FL7A 1P92A 4LDUA 4QQGA 1WJRA 3JCMg 4GY5A 3QSUA 5A2QE 3JCMe 5GAOn 4E7HA 4XTYA 1K8AU 1YIJT 4IUPA 2K5LA 4BY6C 3BFMA 1M4ZA 3FLGA 2HD0A 4M78G 1NJIU 3E1SA 3L1AA 1BKBA 1MGQA 4DOVA 1M9SA 3J81E 3GNGA 5GMKj 1G5VA 3G6ET 5C6SA 2P0PA 2LX9A 5KCHA 3V8KA 2Y4YA 1LNXA 3E9FA 4II1A 1X01A 1JRIA 2FVUA 5GAOq 1NPRA 2K2VA 3A8LB 5I2SA 4M78A 3JRZA 3WVEB 5LJ3g 1XOVA 2VGMA 3UDCA 4C92G 3L2ZA 1S72T 4M7DE 3JCMP 2VC8A 2WACA 5LJ3j 3SFMA 5GAMg 2ZGWA 5GANf 2IVWA 3SD4A 3DB3A 3QJ6A 1G3TA 2V8KA 3R6OA 3V7CA 3NTIA 5GAMj 3LH0A 2EQJA 1NPPA 3HRUA 3PNWC 4C92A 3OS0A 1VQ9A 1PSFA 2BIVA 1YITA 1BI2A 3MHXA 4M7AG 1YHQT 1M90C 4PJOG 1YJ9T 1W4SA 2BUDA 1VQLA 4ZGDB 2GF7A 5DM7R 3LWIA 2EJ9A 2VXFA 4CRIA 3ZBDA 1IZ6A 5DLQE 4J5YA 3P8HA 1VQ6T 3LLRA 3G71T 5CKEA 3GIBA 4J83A 1NE8A 5GAN8 1YBYA 4ZTFA 1Q82C 2LT4A 5HKCA 2E65A 4IUQA 3GP8A 4PJOA 4BUGA 1BI3A 4L59A 2QEXA 1ZBXA 3RMSA 1O9SA 2L89A 3SB2A 2A7YA 3CCMA 2AHJB 1Q7YU 2C06A 4IKFA 1I81A 3HRTA 4Y91A 4XAXB 1M5Q1 3CBMA 1KG1A 1U1SA 1X6OA 3QKJA 4C0DC 4NL3A 2DTIA 5IAYA 3CCUT 2D6FA 4GLKA 3JCMc 3OYEA 5CKHA 1FWZA 3N5BB 3V7RA 2XD0A 4M7DB 1M8VA 2XICA 4XQ3A 2D9TA 2X4JA 1QVFA 2ZPGB 1VQ4A 4HCBA 5C0MA 1Y96A 3A8OB 3X20B 2RH2A 5FU6B 4HCZA 4KT0E 1JBMA 3FRNA 3HHTB 1K9MC 4BE1A 3QYHB 4X9CA 4C8QB 4KULA 3UPUA 3JCMh 4ZTJA 4XTUA 1VQNA 4OB1B 4LDWA 1I5LA 2EKOA 1VQ7A 3M53A 3SWNA 4OB3B 4P5NA 5GAN7 3MP6A 5GMKh 3OS2A 4IUUA 2DKGA 5GAOl 4LDXA 3TCJA 4XU3A 2RK1A 2X4XA 1QP3A 2E10A 3E9GA 4C8QA 3H6ZA 2ZPFB 1W2BA 2PU9B 1YITT 1FXXA 1VQLT 4RKUE 1VQ8A 4C8QD 4M78F 4XTVA 5LJ3h 4C5GA 4M75G 3EFRA 4JS4A 3VJPA 4IURA 4BY6B 2QQRA 5GAMh 4M77A 3QO3A 3OYHA 3I55A 2XDDA 3CCJA 2L3RA 4F7UB 3CXCA 1UEBA 2VGNA 2EQKA 4ZN3A 4HCCA 4M77D 2PVOB 3VYGA 4C92F 4CI0C 3JAME 3ASKA 1N8RC 4M7DC 1YJNA 2K3XA 1VQPA 1HK9A 4WF2A 1N9RA 5GAN6 2DTOA 3M57A 2XIDA 3FEOA 3JCMf 3M55A 4F7UA 1Q86U 5LL6S 5GAN4 2RHIA 1LOJA 1N27A 3NFCA 3MEUA 4NS5A 5CQYA 1NZ9A 1G3SA 4QVDA 4M7AF 4PJOF 3A8MB 4FT2A 1UGQB 1QVGA 2MF2A 2M1HA 3M56A 3LW5E 2MAMA 5GMKl 1Q81C 3F70A 3QDRB 2CZ1B 4M78E 1VQNT 4OGEA 4B9WA 3CMET 1VQ7T 3OYMA 1M1GA 3RKWA 2K57A 1VQMA 4BE0A 2YLBA 5LJ3f 2RA2A 4N0AC 3OYCA 1YJWA 1KC8U 3BDUA 4XTWA 1VQKT 4RCBA 3HL8A 3T9NA 4C0ZA 4OB0B 2RM4A 3MEWA 1V29B 5GAMf 5KE2A 3OYYA 4KUIA 5HK0A 3PMTA 3BW1A 4C92E 1BYMA 4C0FA 3OA6A 3MCAB 3GNFB 4J6YA 4PL6A 3VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  4F7U E;  4PJO G;  4QVC A;  5GMK e;  3FIF A;  2EJ9 A;  2VXF A;  2EAY A;  4XTX A;  4J5Y A;  3VU3 C;  3RUX A;  3GIB A;  3JCM Q;  5GAN 8;  3HFO A;  3JCM d;  2E65 A;  4V2S A;  4PJO A;  2YLC A;  4M7A E;  4N0A A;  5CAI A;  5DY9 A;  2DTH A;  5GAO r;  5LJ3 e;  3SB2 A;  1TH7 A;  3SWN C;  2FYK A;  1I81 A;  2QTX A;  4Y91 A;  1U1T A;  2DZ9 A;  2RD1 A;  1M5Q 1;  5GAM e;  2CGH A;  1B34 A;  1U1S A;  2VXE A;  3RES A;  5LJ5 e;  2DJZ A;  4EMH A;  1WQ7 A;  2DTI A;  4J6W A;  4NL3 A;  4M77 B;  1D3B B;  3JCM c;  5GMK m;  4M7D B;  3V7R A;  1I8F A;  3M4G A;  1M8V A;  3V8L A;  4XQ3 A;  4EMK B;  3FB9 A;  5GMK i;  3JCM J;  4OP0 A;  4XU1 A;  4XU0 A;  1WPY A;  5LJ3 d;  4JUV A;  1Y96 A;  4A54 A;  1I4K 1;  5GAN d;  1N9S A;  2RB6 A;  1WQW A;  1KQ2 A;  2HNI A;  4M75 F;  1JBM A;  3HFN A;  5GAM d;  1D3B A;  2YHT A;  5LJ5 d;  4X9C A;  4C8Q B;  1BIA A;  3JCM h;  4XTU A;  4HA8 A;  1I5L A;  2E64 A;  4M75 A;  5I21 A;  2Y90 A;  3SWN A;  3BY7 A;  1BIB A;  5GAN 7;  4PJO E;  4C8Q F;  5GMK h;  4EMK C;  2DKG A;  4M75 C;  5GAO l;  2DVE A;  2E1H A;  4M75 D;  4XU3 A;  2DEQ A;  5GAN 5;  2E10 A;  3QHS A;  4M78 B;  3FJP A;  4C8Q A;  2I2L A;  4M7A B;  4EMG A;  1YCY A;  3JCM b;  4PJO C;  4A53 A;  2JN0 A;  2EJG A;  4C8Q C;  4C8Q D;  4M78 F;  4XTV A;  5LJ3 h;  5GAN 3;  4M77 F;  3V8J A;  2DXT A;  4M75 G;  3EFR A;  4MML A;  5GAN h;  4M7D F;  2DZC A;  3JCM X;  5GAM h;  3JCM V;  3EFS A;  2DXU A;  5LJ5 h;  3HSB A;  4M77 A;  4C92 B;  2EJF A;  5GAO p;  3QO3 A;  4RCC A;  3JB9 F;  4M7D A;  2EWN A;  4M78 C;  4C8Q G;  4F7U B;  4EMK A;  4M78 D;  3JB9 H;  4JRI A;  4M77 C;  1WNL A;  4M77 D;  4M75 E;  3V7S A;  4C92 F;  1HXD A;  5GAN 2;  3AHU A;  4M7D C;  4M7D D;  1LJO A;  4F7U F;  1H64 1;  3PGG A;  4JRK A;  3JCM g;  3RKX A;  3QSU A;  3JCM e;  5GAO n;  1HK9 A;  4WF2 A;  1N9R A;  4XTY A;  2FB7 A;  5GAN 6;  2DTO A;  3JB9 I;  3JB9 D;  3BFM A;  4NOY A;  3JCM f;  4C8Q E;  4F7U A;  4M78 G;  5GAN 4;  4PJO B;  3L1A A;  1LOJ A;  1KQ1 A;  4M77 G;  4C92 C;  4HT9 A;  1MGQ A;  4X9D A;  4C92 D;  3JB9 J;  4M7D G;  5GMK j;  4NL2 A;  4QVD A;  4M7A F;  4PJO F;  4DQ2 A;  3V8K A;  1LNX A;  4PNO A;  1B34 B;  5GAO m;  1X01 A;  3JCM W;  1JRI A;  5GAO q;  3JB9 G;  5GMK l;  4JLI A;  4M78 A;  4M7A A;  4XTZ A;  4M78 E;  3INZ A;  5LJ3 g;  4HT8 A;  4M77 E;  5GAN g;  4MMK A;  3RKW A;  3L2Z A;  4C92 G;  4M7D E;  2K57 A;  5GAN e;  3QUI A;  2VC8 A;  3JCM P;  4M7A C;  5LJ3 j;  2YLB A;  5LJ3 f;  2RA2 A;  4F7U G;  4N0A C;  5GAM g;  1Y96 B;  2ZGW A;  5GAN f;  5GAN j;  5LJ5 g;  4M7A D;  4PJO D;  3BDU A;  2E41 A;  4XTW A;  4RCB A;  4J6X A;  3V7C A;  4XU2 A;  3RIR A;  2RM4 A;  5GAM f;  5GAM j;  5LJ5 j;  5LJ5 f;  4C92 A;  3RER A;  3BW1 A;  4C92 E;  3RKY A;  4M75 B;  3SWN B;  4J6Y A; 
#chains in the Genus database with same CATH topology
 3NGP A;  3PIO A;  4QVC A;  4BD3 A;  1GCQ A;  3UWN A;  2EAY A;  4HVV A;  2HBP A;  3D7S B;  3H9N A;  1UB4 A;  4M7A E;  2YRV A;  1K73 C;  4A4H A;  9ATC B;  1TH7 A;  4JJB A;  1G2B A;  1WQ7 A;  1TUC A;  3I5S A;  4K11 A;  2IPO B;  3V8L A;  5GMK i;  3JCM J;  2KY9 A;  3ZL7 C;  4JZ3 A;  2QI2 A;  4J9I A;  2YUO A;  4DBQ A;  3Q1J A;  4JS5 A;  5IHI A;  4IUT A;  3LWH A;  1PG5 B;  2EQM A;  1R8O B;  1OU8 A;  4A4F A;  2K5F A;  4OMM A;  3HTR A;  1UGR B;  1KHC A;  4JJN K;  3QHS A;  3FJP A;  4M7A B;  4ZGJ B;  3TVT A;  2QYZ A;  2DBM A;  3CC4 Q;  2D0Q B;  1OQK A;  3O5Z A;  3PTA A;  4O6J A;  4DBR A;  3EH2 A;  3X25 B;  3CC4 T;  5CKF A;  2CH4 W;  1K73 R;  2EYY A;  3OW2 P;  3DKM A;  1LJO A;  2PVG B;  2KYM A;  3CC7 T;  4PLL A;  2H8H A;  1RAG B;  1EX4 A;  4D6W A;  4E7S A;  3L2Q A;  2HKQ B;  4OGC A;  1YWO A;  3VV0 A;  2O9S A;  3QBY A;  2HQH A;  2QEX Q;  2MMP A;  4RTW A;  3CXC P;  2BE7 D;  3OBY A;  2VUB A;  2V26 A;  2QQ9 A;  5HK3 A;  2QEX T;  4F7U G;  4PJO C;  3OW2 S;  1UJY A;  3RIR A;  1B3Q A;  2HEQ A;  1D0Y A;  1N8R U;  2L2P A;  2K4Y A;  2GFA A;  4J9D A;  2JVV A;  2KMT A;  2M9U A;  4PLI A;  1VQN Q;  3O8V A;  2YUP A;  3VU3 C;  3RUX A;  5KYY A;  1GBQ A;  2DIL A;  4LN2 A;  3QII A;  5FRN A;  3S3M A;  1D1B A;  3OYD A;  2YRD A;  3C95 A;  5DY9 A;  4X34 A;  1SRM A;  4WCI A;  2K3Y A;  4JZ4 A;  1Y07 A;  2DZ9 A;  1GXI E;  2FEI A;  2HCK A;  3M5A A;  2B8A A;  1HJD A;  1ZA1 B;  2OAW A;  4CC2 A;  2CS7 A;  3OYK A;  2EKH A;  1OYX A;  3G71 A;  1OZ2 A;  3HFN A;  2E6Z A;  4OMQ A;  4HA8 A;  4QVZ A;  3CMA A;  2CYZ B;  2KRO A;  3C94 A;  4VUB A;  4PJO E;  1D1A A;  4MZP A;  5AT1 B;  1NJI C;  4M75 C;  2QQB A;  2DEQ A;  2OJ2 A;  3CCE T;  4YTL A;  1YCY A;  5L8R E;  2LCL A;  2YUN A;  2DXT A;  2ENM A;  2L3Q A;  5IN1 A;  1SPK A;  5D6Y A;  1TWB A;  4Y28 E;  4FSS A;  2H3J A;  2QG9 B;  2EWN A;  3CBP A;  2JMA A;  3H41 A;  2ZPE B;  5A0L A;  3RKX A;  1KQS A;  4BAC A;  2M16 A;  5FWC A;  4PJO B;  1X6B A;  2LJ1 A;  4KGX B;  3JB9 J;  4LD6 A;  4M7D G;  2DL7 A;  4R55 A;  3NTH A;  2F69 A;  2XI9 A;  1VQO A;  1W70 A;  1MHN A;  5ECA A;  4HT8 A;  3M54 A;  5KYX A;  3SHW A;  2KVQ G;  5GAN e;  3QZ5 B;  3ME9 A;  1MMD A;  5GAN j;  1QKW A;  2E41 A;  4LNP A;  3OYL A;  4E7K A;  2EFI A;  3JV3 A;  1Z9Z A;  3URG A;  1N5Z A;  3VRZ A;  5FLX E;  3ULR B;  2EYX A;  4R56 A;  2OTL T;  2CSI A;  3QZ9 B;  4ME7 A;  2C0T A;  1KD1 U;  1AEY A;  5EG2 A;  1M1K U;  4N0A A;  2K79 A;  2XHC A;  4Z88 A;  4QQD A;  3VS7 A;  1IGQ A;  2Z0W A;  1K4U S;  2E12 A;  3J7A F;  2WSC E;  2RO0 A;  1VQK A;  2CGH A;  1B34 A;  1UGV A;  2NLU A;  1X6G A;  3CCQ T;  3FB9 A;  3QPH A;  4AFZ C;  5LJ3 d;  2X4W A;  3G6E A;  1XJW B;  3KXT A;  2YWW A;  2O4X A;  1I07 A;  1Q82 R;  5HCK A;  2DRM A;  2E5Q A;  5IXB A;  3LGL A;  5A0D A;  3BY7 A;  1XQH A;  2KSS A;  1S72 A;  2DD5 A;  1UGS B;  1AOJ A;  3HKS A;  1UE9 A;  3QYG B;  2JJ9 A;  2LZ6 B;  1SG5 A;  3DLL A;  3OYB A;  4ESR A;  3CD6 A;  2DZC A;  5D6W A;  4QQ6 A;  1K9M R;  3EFS A;  2DXU A;  1UJ0 A;  3I5R A;  1QP2 A;  3S3O A;  1XNI A;  1VQ5 T;  2J05 A;  4EMK A;  3I35 A;  3JB9 H;  2CP7 A;  1HXD A;  3J80 E;  4LDU A;  2L0A A;  1WJR A;  1TUG B;  2FZK B;  5A2Q E;  2K5L A;  2HD0 A;  4OMO A;  2K9G A;  3E1S A;  3L1A A;  4F04 B;  2P4R A;  1BKB A;  2F2V A;  2C0I A;  2IIM A;  5GMK j;  2P0P A;  2LX9 A;  3V8K A;  2Y4Y A;  2C0O A;  2VKN A;  5GAO q;  4J9H A;  5I2S A;  1YNZ A;  3JRZ A;  3UDC A;  3JCM P;  2COW A;  3SFM A;  3R6O A;  4RTT A;  1E6H A;  3LH0 A;  3OS0 A;  1VQ9 A;  3G71 Q;  1YIT A;  4M7A G;  2KXC A;  4ZGD B;  4ORZ A;  3CMA Q;  1CKB A;  1IZ6 A;  2CP3 A;  3P8H A;  2NUT A;  1Q81 R;  3LLR A;  1IB8 A;  3G71 T;  3GIB A;  4AFQ C;  1YBY A;  2FO0 A;  2LT4 A;  2E65 A;  3GP8 A;  3M0P A;  1RUW A;  1BI3 A;  4L59 A;  2L89 A;  1BCM A;  2AHJ B;  3KFV A;  3U23 A;  1KG1 A;  4C0D C;  1X6O A;  2DLP A;  2JS0 A;  4JPB W;  2DTI A;  4GLK A;  4RTY A;  2DA9 A;  1K1Z A;  1MMA A;  1M8V A;  2D9T A;  2X4J A;  4RTV A;  4OMP A;  5I11 A;  1JBM A;  4ANJ A;  1NYF A;  1LCK A;  4LDW A;  2KR3 A;  4P5N A;  3REB B;  4DBH A;  5IH2 A;  1QP3 A;  4C8Q A;  2V1Q A;  2P84 A;  1ZSZ B;  1VQO Q;  4RKU E;  2AT1 B;  1VQ8 A;  1PHT A;  5LJ3 h;  2QAS A;  3EFR A;  2HMA A;  4AG2 C;  2RMO A;  1E6G A;  4IIM A;  1BU1 A;  3IQL A;  1GRI A;  3QO3 A;  1W1F A;  2XDD A;  4F7U B;  4M77 D;  1NEG A;  3VYG A;  4M7D C;  1N8R C;  3VS5 A;  1SSH A;  2AZV A;  1YFN A;  1QKX A;  1VQP A;  1RLP C;  1F1B B;  1N9R A;  5GAN 6;  3M57 A;  3M55 A;  1X27 A;  3NFC A;  4F14 A;  3MEU A;  2CP0 A;  1NZ9 A;  4QVD A;  1UGQ B;  5L23 A;  2RQT A;  3LW5 E;  2NUP B;  5GMK l;  3F70 A;  1VQK Q;  1JJ2 P;  2CZ1 B;  4OGE A;  3RKW A;  1UTI A;  1MMN A;  1VQK T;  1YCS B;  3HL8 A;  1A0N B;  2VAS A;  3MEW A;  3MKD A;  3G6E Q;  1K0X A;  3PMT A;  2V1R A;  3OA6 A;  1RAC B;  2RF0 A;  1PRL C;  4UC4 A;  2KNB B;  2P0Q A;  4C0D B;  1S72 Q;  3UT1 A;  3I55 T;  3CC4 A;  3CCJ T;  3CBO A;  2EGC A;  5CAI A;  2DTH A;  5LJ3 e;  1N8R R;  1ZQ1 A;  2JW4 A;  3CC7 A;  3EH1 A;  4PFO A;  5DLO A;  3CD6 Q;  2GBQ A;  4KRT A;  2R5A A;  2QAZ A;  3CD6 T;  5KYN A;  2O88 A;  4MDX A;  1WQW A;  3E2U A;  2ESW A;  2FPE A;  1KQ2 A;  1W6X A;  4ELY C;  1UHF A;  1U8R A;  1BIA A;  2LVM A;  2DAQ A;  1TOV A;  2JOY A;  3X28 B;  2JXB A;  2NWM A;  3CEY A;  1Q82 U;  1AHJ B;  1PKT A;  3X26 B;  1MMG A;  1UHC A;  3GLX A;  4EMG A;  1QVF P;  2G3R A;  2J6O A;  4FSX A;  3TSZ A;  2JN0 A;  3A5Z B;  1WXU A;  2A36 A;  4N4H A;  1OZ3 A;  3M58 A;  4OF1 A;  1Y71 A;  2RHZ A;  4RCC A;  3TQ7 P;  2RJD A;  5D6X A;  4JJD A;  3H8Z A;  3EAE A;  1VQ9 Q;  3OMC A;  1K9M U;  2DD4 A;  1YIT Q;  1YI2 A;  3FC3 A;  1UUE A;  5IT9 E;  1OU9 A;  2AKL A;  2DM1 A;  1VQ9 T;  4L5G A;  4HT9 A;  1KD1 C;  3RDV A;  3H0I A;  5EC7 A;  3X24 B;  1M1K C;  5M9O A;  2YT6 A;  1OI1 A;  2HAX A;  4ZNX A;  3CCR T;  4WTO B;  4Y92 A;  4HXJ A;  3M9Q A;  1RL2 A;  1J3T A;  2XKO C;  1JXO A;  4FL6 A;  4M7A C;  3HRS A;  3CPW S;  4XU2 A;  4DOW A;  4BI3 A;  5LJ5 j;  5KH6 A;  3CCE A;  1SKU B;  3RKY A;  3MEV A;  3TRE A;  2YXY A;  1ZLM A;  3A1P A;  1QMC A;  2MK5 A;  3MJX A;  3OSV A;  2CP6 A;  1QWF A;  3H0F A;  1FMK A;  4DA4 A;  2DBK A;  5GAO r;  2K5I A;  1Q81 U;  3KUF A;  2XU8 A;  1VQ8 Q;  1ZUU A;  3RES A;  2MCN A;  1QCF A;  1D3B B;  1M2V B;  4RG2 A;  2E4H A;  5FU7 C;  1VQ8 T;  4LUE A;  4N4G A;  1M1K R;  2JTM A;  1IO6 A;  5GAN d;  1WLP B;  1N9S A;  5KYW B;  2PUO B;  8ATC B;  3MET A;  2YHT A;  1IHW A;  3OS1 A;  2QQS A;  2RN8 A;  2E64 A;  2ED1 A;  4PKC C;  1VQP Q;  2HSP A;  3A98 A;  4JDS A;  5IHN A;  2SEM A;  1B7T A;  3CCU A;  1VQP T;  1BI1 A;  1ZBJ A;  4X1V A;  3JCM b;  4A53 A;  3P8D A;  4M77 F;  3V8J A;  3VUZ A;  4MML A;  2OTL A;  3JCM X;  5GAO p;  3ER0 A;  2GGR A;  3MP1 A;  4M78 D;  1WNL A;  3AHU A;  1Q86 R;  2QDY B;  3G4S T;  1H64 1;  3L2R A;  3CCQ A;  4C92 D;  2DIQ A;  2AK5 A;  2LQ8 A;  1SRL A;  2CKK A;  4MZT A;  1KC8 R;  4JLI A;  3CC7 Q;  2OAU A;  4M77 E;  1X2K A;  2LNH B;  4BI8 B;  1OX9 A;  3OSS C;  4OML A;  1MNE A;  1Y96 B;  1U5S A;  1WFW A;  1VUB A;  4AFS C;  1R0C B;  4J6X A;  2CH4 A;  1WJS A;  2JT4 A;  3EGX B;  2DE0 X;  4XK8 E;  3PIP A;  2EYW A;  1RAE B;  3EFO A;  2KI7 A;  5CIU A;  4ELZ C;  2KT1 A;  2O2O A;  3QWY A;  3I9Q A;  5FU7 B;  3CCL T;  1VQ5 A;  2FHD A;  3OW2 A;  4PJM A;  4M77 B;  4C5H A;  1QVG P;  2GQI A;  1WX6 A;  1BBZ A;  2A28 A;  4A4E A;  2COY A;  2F2X A;  1YI2 Q;  4DEY A;  3CXC S;  2RI5 A;  1G83 A;  4M75 A;  2P4T A;  3L42 A;  1YI2 T;  3MO8 A;  4MDW A;  5FU6 C;  1OEB A;  3MP8 A;  2R5M A;  1PWT A;  2DET A;  1X43 A;  5GAN h;  1QVG S;  1I1J A;  4CC4 B;  5J26 A;  2B86 A;  3EG9 A;  4M4Z A;  4PFZ A;  4ZGE B;  3CCS A;  1QW1 A;  2QA4 A;  3L2W A;  4Z02 A;  1M3A A;  3CCE Q;  4BI4 A;  1WZO A;  1SF9 A;  1TTH B;  3QSU A;  2LX7 A;  3JCM e;  4XTY A;  1YIJ T;  2DL3 A;  4IUP A;  1VYT A;  3FLG A;  5KYU A;  1YN8 A;  2PZ1 A;  4D8D A;  3EGD A;  1MGQ A;  5IXF A;  4DOV A;  3J81 E;  2K2V A;  3A8L B;  4M78 A;  3WVE B;  5LJ3 g;  3L2Z A;  2VC8 A;  3PVQ A;  3SD4 A;  3QJ6 A;  3V7C A;  3NTI A;  5GAM j;  1FMW A;  3HRU A;  4C92 A;  2LMJ A;  1YHQ T;  1T3S A;  2GF7 A;  2I0N A;  1AT1 B;  4J5Y A;  2ROT A;  2E3I A;  4J83 A;  1NE8 A;  5GAN 8;  1Q82 C;  5HKC A;  4IUQ A;  3CCU Q;  4JJC A;  1O9S A;  3EG1 A;  3SB2 A;  1X69 A;  2A7Y A;  1Q7Y U;  1M5Q 1;  2PTK A;  3CBM A;  3QKJ A;  4NL3 A;  3CCU T;  1Z9Q A;  2RNA A;  1JEG A;  2OTL Q;  2XD0 A;  1WHM A;  2CUB A;  3GBQ A;  4HCB A;  2RH2 A;  3NHN A;  5FU6 B;  4KT0 E;  1K9M C;  4BE1 A;  4KUL A;  4ZTJ A;  1UDL A;  1K76 A;  2K2M A;  3M53 A;  3SWN A;  1EFN A;  5GAN 7;  2RQU A;  3QWX X;  5GMK h;  3OS2 A;  4FYX B;  5GAO l;  3CCQ Q;  3TCJ A;  2D1X A;  2E10 A;  3E9G A;  3EHR A;  2ZPF B;  4C8Q D;  4M78 F;  4XTV A;  4C5G A;  4E6R A;  4JS4 A;  2G6F X;  3I55 A;  3CCJ A;  2L3R A;  4KH0 B;  2QDL A;  2COZ A;  4C92 F;  3UAT A;  1UEC A;  5KYY B;  1HK9 A;  2RPN A;  2DTO A;  3FEO A;  2J6K A;  4F7U A;  1Q86 U;  4LXC A;  1N27 A;  3EG2 A;  2BZ8 A;  5CQY A;  1VQ7 Q;  4PFP A;  3A8M B;  1VQ5 Q;  2DL4 A;  2M1H A;  2FZG B;  1Q81 C;  3QDR B;  2HSE B;  4M78 E;  1VQ7 T;  4BE0 A;  5LJ3 f;  4IIO A;  4N0A C;  3OYC A;  1YJW A;  1KC8 U;  4XTW A;  3T9N A;  2NUP A;  2RM4 A;  5KE2 A;  3OYY A;  4KUI A;  1WDX A;  2M51 A;  4C92 E;  4J6Y A;  2KBT A;  5GMK e;  2DO3 A;  2CDT A;  4PJJ A;  2DNU A;  4J7F A;  4BDY A;  1M3C A;  1XTD A;  5HY6 A;  1VYU A;  4J8O A;  3M0S A;  3PE0 A;  4GBQ A;  3GPL A;  4E7Z A;  2L3P A;  4J9E A;  2PNI A;  2RI2 A;  3ZFJ A;  2HZY A;  1M8M A;  1PKS A;  2KEA A;  2V8I A;  3CCS Q;  4XU1 A;  2QA4 Q;  1WPY A;  1VOM A;  4A54 A;  2DYI A;  4AMC A;  1ZUK A;  3CCR A;  1M90 U;  5LJ5 d;  1Y7X A;  3QDF A;  1JO8 A;  3CCS T;  2HQE A;  3CPF A;  2QA4 T;  2Y90 A;  3C4S A;  2VYT A;  2MWO A;  4E47 A;  1Y0M A;  4EMK C;  1T0J A;  3OB9 A;  3OYA A;  3RR6 A;  2RI3 A;  3VYH B;  4CC7 A;  2YUQ A;  2JM9 A;  2L5Q A;  1BCO A;  2KQW A;  2L8D A;  5KYX B;  4OB2 B;  4IUV A;  1H92 A;  1VIE A;  1IXD A;  1HSQ A;  2DJQ A;  3OYG A;  2H3E B;  4M7D A;  1LVK A;  1Y57 A;  1WGS A;  1MV3 A;  2V8J A;  3RNJ A;  4OMN A;  2RHX A;  2EPD A;  2RK2 A;  4FIB A;  3JB9 D;  5CCA A;  3G1J A;  2X35 A;  1EZZ B;  4M77 G;  5J3B A;  1IRX A;  2D8J A;  2LQW A;  2AIR B;  2AKK A;  2OI3 A;  4DQ2 A;  5FRM A;  2LC4 A;  1B34 B;  1D09 B;  3CC2 T;  1SEM A;  4XTZ A;  1TSF A;  2O01 E;  4BDZ A;  1OV3 A;  3QUI A;  4FU6 A;  4LDY A;  3MEA A;  1EIF A;  2RQV A;  2O4X B;  1BI0 A;  2CP2 A;  4HCK A;  2W10 A;  1PSE A;  3WXM B;  5CK9 A;  2LCS A;  2A0F B;  2D0N A;  4RMO A;  4ZN1 A;  1RI0 A;  5GJW B;  3A8G B;  1RAF B;  2W0Z A;  4AFU C;  3S3N A;  3A8H B;  5CQX A;  3HFO A;  4Q5W A;  3WVD B;  4LD9 K;  2XDB A;  1PNJ A;  4FT4 A;  3SEM A;  2DMO A;  3G4S A;  2FG0 A;  4J9B A;  1RAH B;  2ZCF B;  2GCX A;  5GMK m;  3OYF A;  3M4G A;  1KJW A;  2DEU A;  2F5T X;  3MPU B;  4EMK B;  3ZEH A;  3I55 Q;  4XU0 A;  3CCJ Q;  4KBM B;  2HL3 A;  4C5E A;  1WHG A;  1N6A A;  1GFC A;  1D3B A;  5D7U A;  2DK3 A;  1G3W A;  2BE9 B;  2LDM A;  1ZSZ A;  1JJ2 S;  4C8Q F;  3CQT A;  2DVE A;  2E1H A;  2RQW A;  4FW2 A;  3KBG A;  3OYN A;  1GFD A;  2EJG A;  2KK4 A;  2QK0 A;  3GOX A;  2JNG A;  3E19 A;  4KH1 B;  2X3W D;  4RTZ A;  3BE3 A;  1YWP A;  3M0T A;  1TUD A;  5LJ5 h;  1YJW Q;  2EW3 A;  3LX7 A;  3CCL A;  4KGV B;  4JRI A;  1CKA A;  3I56 Q;  2KYB A;  2QXF A;  1YJW T;  3PGG A;  4D8K A;  2NUT B;  2EQU A;  3VKI A;  1AZG B;  2KDS A;  4B6M A;  3JB9 I;  1X75 C;  2ZPI B;  3I56 T;  4C8Q E;  2EIF A;  1VQL A;  1KQ1 A;  1K9A A;  1VIF A;  2MOX A;  2LQK A;  1GBR A;  4FYY B;  3PVL A;  2OX7 A;  3HP9 A;  1NLO C;  5CVI A;  3UA7 A;  4CC3 A;  3QG1 A;  2FPD A;  1Q7Y C;  4M7A A;  3INZ A;  2KE9 A;  4C0G A;  4A4K A;  1WYX A;  1SHG A;  1PD0 A;  5GAN g;  2E5K A;  2WSF E;  4PJO D;  2E70 A;  3M4Y A;  3QXE B;  2KGT A;  3RBB B;  1W2B P;  3LH5 A;  4JRP A;  2MI6 A;  1RAD B;  3CCR Q;  4OP0 A;  1QVF S;  4AG1 C;  3R6N A;  3JCM Q;  1NEB A;  3C0C A;  2LJ0 A;  3JCM d;  3CME A;  4QKU A;  2YLC A;  2K3B A;  1M1F A;  3CCV Q;  2MIO A;  1M27 C;  2LNV A;  3BDL A;  3CPW A;  5LJ5 e;  2OTJ T;  2Y4X A;  1R0B G;  3CCV T;  1YIJ A;  1K0S A;  1W2B S;  1WHH A;  4RTX A;  2JZ2 A;  1I5O B;  2JTF A;  2PUK B;  1BK2 A;  1D0Z A;  2DRK A;  5GAM d;  1Q7Y R;  2CT3 A;  3SDZ A;  4LDV A;  2ZZD A;  2HQX A;  2ABL A;  4GLM A;  1Q86 C;  5KCO A;  4M75 D;  1KSW A;  2DL5 A;  4FCY A;  2CZ7 B;  5GAN 5;  2JUF A;  2AZS A;  2M0O A;  1YHQ A;  1FX7 A;  4MZM A;  1S1N A;  1RI9 A;  1KC8 C;  3JB9 F;  1MV0 B;  2GQV A;  1O75 A;  2F1L A;  1D0X A;  4M77 C;  3P8B B;  4FYV B;  3V7S A;  5GAN 2;  1P92 A;  4QQG A;  4GY5 A;  3AT1 B;  4E7H A;  2EQI A;  1K8A U;  2GNC A;  4BY6 C;  1M4Z A;  1M2O A;  4M78 G;  4RUG A;  1E7O A;  1AZE A;  1G5V A;  5C6S A;  2X51 A;  4DEX A;  3E9F A;  1LPL A;  1QCN A;  3G4S Q;  2CP5 A;  2JS2 A;  4C92 G;  3VS3 A;  2WAC A;  2KRS A;  2ZGW A;  5GAN f;  2IVW A;  1G3T A;  1OOT A;  3VS1 A;  2V8K A;  2DER A;  1AWO A;  1NPP A;  1PC0 A;  3PNW C;  1PSF A;  1WHL A;  2BIV A;  2A37 A;  3MHX A;  3VS4 A;  1M90 C;  1W4S A;  3LWI A;  2EJ9 A;  2VXF A;  1NYG A;  3VS2 A;  5CKE A;  1GCQ C;  2VVK A;  4ZTF A;  2CUD A;  4PJO A;  3RMS A;  3CCM A;  2C06 A;  1HD3 A;  1I81 A;  4Y91 A;  2X3X D;  1FYN A;  1M3B A;  5IAY A;  2D6F A;  5CKH A;  1FWZ A;  3N5B B;  3V7R A;  1QCO A;  2XIC A;  4XQ3 A;  4KGZ B;  1ZA2 B;  1VQ4 A;  5C0M A;  3X20 B;  3CCL Q;  2BTT A;  2VWF A;  2YRC A;  4X9C A;  3UPU A;  3JCM h;  4XTU A;  4OB1 B;  1VQ7 A;  2EKO A;  4IUU A;  2DKG A;  2FRW A;  1VQL Q;  4LDX A;  2RK1 A;  2YDL A;  2X4X A;  1TU0 B;  1VQL T;  1M90 R;  3THK A;  4BY6 B;  2A08 A;  1GCP A;  5GAM h;  3OYH A;  3CXC A;  2K6D A;  4J9G A;  2JM8 A;  4CI0 C;  3JAM E;  1KIK A;  1YJN A;  1JQQ A;  4WF2 A;  4FW1 A;  2XID A;  3REA B;  5LL6 S;  5GAN 4;  2RHI A;  1LOJ A;  4LUD A;  4NS5 A;  4Z8A A;  3CME Q;  1G3S A;  4PJO F;  3VS6 A;  1QVG A;  2EBP A;  2MAM A;  1VQN T;  3CME T;  3OYM A;  1M1G A;  2K57 A;  1VQM A;  3UF4 A;  1YIJ Q;  2YLB A;  1PD1 A;  2RA2 A;  1RAA B;  4RCB A;  4OB0 B;  1H8K A;  2HKN A;  4C0F A;  3GNF B;  3VUB A;  2J06 A;  2EYZ A;  1WIE A;  1JB0 E;  5I2M A;  2M02 A;  1UG1 A;  2EGA A;  2LJ3 A;  4ATO A;  3TU4 K;  3EG3 A;  4E7L A;  3OYI A;  1KQS P;  2K7A A;  2QTX A;  5GAM e;  1YHQ Q;  2RJE A;  2JTE A;  1MND A;  4Z89 A;  4J6W A;  2HL5 C;  3RMQ A;  2LTO A;  2P0K A;  2SRC A;  3S6W A;  4JUV A;  2RB6 A;  3OYJ A;  2HNI A;  4M75 F;  5CO7 A;  3CC2 A;  1WJQ A;  2BKD N;  2KRM A;  1C1A A;  1TS9 A;  2O31 A;  1BIB A;  7AT1 B;  1RLQ C;  2PVD B;  3EHQ A;  2NUZ A;  1KQS S;  1OUL A;  3NPF A;  1OPK A;  2QQA A;  2CRE A;  2KAF A;  3M59 A;  2X4Y A;  3VS0 A;  2XDP A;  3OY9 A;  3JCM V;  3LGF A;  4N4I A;  1AWW A;  2DYB A;  4C8Q G;  4M78 C;  4M75 E;  3TSW A;  4HVW A;  1NJI R;  4M7D D;  3EFO B;  4JRK A;  1R77 A;  2XK0 A;  5CR2 A;  1WXT A;  3M0Q A;  2FB7 A;  3LYI A;  2ECZ A;  2EYQ A;  1TG0 A;  3H0H A;  4C92 C;  4NL2 A;  2DVJ A;  3GF5 A;  1UGP B;  5GAO m;  1VYV A;  3CCM Q;  1T0H A;  2R58 A;  4RG8 A;  1U3O A;  1IHV A;  3DB4 A;  1JXM A;  4MMK A;  2KRN A;  2GTO A;  2ZAE A;  2CT4 A;  4E2F B;  1G3Y A;  3CCM T;  1QWE A;  5LJ5 g;  1H3Z A;  1JU5 C;  1YP5 A;  2DFU A;  3C12 A;  1VQ4 Q;  3OQ5 A;  1PM3 A;  3RER A;  2ED0 A;  4M75 B;  1WHJ A;  3OMG A;  1VQ4 T;  1CSK A;  4DBF A;  4QT7 A;  4XTX A;  1NG2 A;  8AT1 B;  2O9V A;  4V2S A;  3FJ5 A;  3OBW A;  2RHU A;  2F5K A;  2FRY A;  3FDR A;  3SWN C;  2F2W A;  2VXE A;  4EMH A;  3PFS A;  1ZUY A;  3EG9 B;  1VA7 A;  2XMF A;  3I56 A;  2XG8 D;  1YJ9 A;  2DIG A;  1ZX6 A;  2QGF B;  1PRM C;  5KE3 A;  5A0G A;  1VQ6 A;  4O5V A;  2MPX C;  2VV5 A;  1YJN Q;  2ROL A;  3TEE A;  1QVP A;  5KYU B;  4QW2 A;  4HKE A;  5I21 A;  3EGD B;  1K8A C;  3L2U A;  1NBE B;  5CKD A;  1YJN T;  2GFU A;  4BB7 A;  1K73 U;  4M78 B;  2I2L A;  3M0U A;  1U06 A;  4L6V 5;  4AT1 B;  3UA6 A;  5GAN 3;  2EVR A;  1VQM Q;  1WA7 A;  3HSB A;  3QJY A;  4C92 B;  1NLP C;  1VQM T;  4EPC A;  4E7I A;  2LT1 A;  1IGU A;  4C5I A;  4F7U F;  1WI7 A;  2M0Y A;  2QGG A;  3JSC A;  2OTJ A;  2HDA A;  4NOY A;  1Q95 G;  3CCV A;  2VB6 A;  1ZHI A;  4EDU A;  4JLG A;  2CSQ A;  4X9D A;  3NMZ C;  4J7I A;  2JMC A;  2PQW A;  2RQR A;  2X9H A;  3HPW A;  4PNO A;  2E6N A;  2WSE E;  3JCM W;  3JB9 G;  2DXB A;  2LRQ A;  2QTV A;  2LQN A;  4B9X A;  2ZPH B;  3CMA T;  4PJN A;  1B07 A;  1K8A R;  4M7A D;  1V76 A;  1GL5 A;  2A3L A;  2R57 A;  1AVZ C;  1KFZ A;  5LJ5 f;  2DXC A;  1KHI A;  5FWB A;  3CC2 Q;  3SWN B;  1SSF A;  4F7U E;  5J39 A;  3PMI A;  4A4G A;  2D8H A;  3FIF A;  2KXD A;  2ZPB B;  3NTK A;  1RAI B;  3EG0 A;  2MWP A;  3OS5 A;  4FM4 B;  2DPP B;  2LCC A;  2FYK A;  1U1T A;  2RD1 A;  2DJZ A;  2RJC A;  4OMF B;  1I8F A;  1G8X A;  3G7Z A;  4BE2 A;  2IG0 A;  2RHY A;  1I4K 1;  2DL8 A;  1VQO T;  1C0M A;  2E3H A;  2RJF A;  2CZ0 B;  4OVA A;  4LE9 A;  5GJV B;  4JRQ A;  1ARK A;  1IRE B;  1AD5 A;  3DLM A;  1HYO A;  1M30 A;  2CZ6 B;  5CKB A;  4E7J A;  4C8Q C;  2FZC B;  4TVR A;  2FPF A;  4M7D F;  2BZX A;  1DJ7 B;  3PT9 A;  3EGU A;  4FYW B;  6AT1 B;  4KUD K;  1UFF A;  2BZY A;  2EJF A;  5AYF A;  1M2V A;  2ATC B;  3L2V A;  1JJ2 A;  5FRO A;  2FL7 A;  1NM7 A;  3JCM g;  4EIK A;  4PK4 A;  5KYW A;  1H3H A;  5GAO n;  3BFM A;  1NJI U;  3M0R A;  1M9S A;  4A63 B;  3GNG A;  3VRY A;  3G6E T;  2J7I A;  5KCH A;  1LNX A;  4II1 A;  1FMV A;  1X01 A;  1JRI A;  2FVU A;  1NPR A;  1C6V X;  1XOV A;  2VGM A;  4F17 A;  1S72 T;  4M7D E;  5LJ3 j;  1D1C A;  5GAM g;  1OX8 A;  1T3L A;  3DB3 A;  1YJ9 Q;  2EQJ A;  1VQ6 Q;  4PJL A;  2GTJ A;  2YSQ A;  1BI2 A;  4PJO G;  1YJ9 T;  2BUD A;  2LP5 A;  5DM7 R;  4CRI A;  3ZBD A;  5DLQ E;  1VQ6 T;  2EGE A;  4F16 A;  4BUG A;  2QEX A;  1ZBX A;  1WHK A;  1ZSZ C;  4IKF A;  3HRT A;  4XAX B;  1WXB A;  1U1S A;  3JCM c;  3OYE A;  4M7D B;  1QLY A;  1QVF A;  2ZPG B;  2DF6 A;  1Y96 A;  3A8O B;  1ABO A;  4HCZ A;  3FRN A;  3HHT B;  3QYH B;  4C8Q B;  3EGX A;  1VQN A;  4HVU A;  1I5L A;  3CPW P;  2OTJ Q;  4OB3 B;  3MP6 A;  5I22 A;  4XU3 A;  1PCX A;  2HBW A;  3H6Z A;  4R0K A;  1W2B A;  2PU9 B;  1YIT T;  1FXX A;  1V1C A;  1I0C A;  1MUZ A;  4M75 G;  3VJP A;  4IUR A;  1KK7 A;  2QQR A;  4M77 A;  1OPL A;  1UEB A;  2DX1 A;  2VGN A;  2EQK A;  4ZN3 A;  4HCC A;  2PVO B;  4J9C A;  3ASK A;  1QQJ A;  1RAB B;  1ABQ A;  2K3X A;  2J6F A;  3JCM f;  5IHK A;  1ACM B;  2KT8 A;  2L3S A;  4M7A F;  4FT2 A;  1ZSG A;  2MF2 A;  1SHF A;  3M56 A;  4RTU A;  1X2Q A;  1AWX A;  4B9W A;  2NYS A;  1BB9 A;  2MYS A;  3BDU A;  4C0Z A;  5GAM f;  1V29 B;  1TXQ A;  5HK0 A;  1AWJ A;  3BW1 A;  1BYM A;  3MCA B;  1KD1 R;  4J9F A;  5FW9 A;  4PL6 A; 
#chains in the Genus database with same CATH homology
 4UC4 A;  3PIO A;  4QVC A;  4BD3 A;  5GMK e;  2P0Q A;  2DO3 A;  4C0D B;  4J7F A;  3UWN A;  4BDY A;  2EAY A;  1JB0 E;  3UT1 A;  2HBP A;  5I2M A;  1XTD A;  5HY6 A;  3I55 T;  3CC4 A;  3CCJ T;  3CBO A;  1UB4 A;  4ATO A;  2YRV A;  4J8O A;  5CAI A;  1K73 C;  3TU4 K;  2DTH A;  4M7A E;  4A4H A;  5LJ3 e;  4E7L A;  3OYI A;  1TH7 A;  1ZQ1 A;  3GPL A;  2QTX A;  3CC7 A;  5GAM e;  2RJE A;  5DLO A;  1WQ7 A;  4J6W A;  2RI2 A;  3ZFJ A;  3RMQ A;  2LTO A;  2P0K A;  3V8L A;  5GMK i;  3JCM J;  2KY9 A;  2V8I A;  4XU1 A;  1WPY A;  2R5A A;  4JUV A;  2QI2 A;  3S6W A;  4A54 A;  3CD6 T;  2RB6 A;  3JB9 F;  4MDX A;  1WQW A;  3OYJ A;  1KQ2 A;  2HNI A;  3Q1J A;  4M75 F;  5CO7 A;  3CCR A;  4JS5 A;  4ELY C;  3CC2 A;  4IUT A;  1M90 U;  5LJ5 d;  3LWH A;  1WJQ A;  2BKD N;  1Y7X A;  1BIA A;  2LVM A;  1U8R A;  2DAQ A;  3CCS T;  2HQE A;  3CPF A;  2JOY A;  2QA4 T;  3X28 B;  2Y90 A;  3C4S A;  2VYT A;  1BIB A;  2EQM A;  1R8O B;  2MWO A;  4A4F A;  2K5F A;  3CEY A;  4E47 A;  4EMK C;  2PVD B;  1AHJ B;  1Q82 U;  3X26 B;  1KQS S;  1UGR B;  3OB9 A;  3OYA A;  1KHC A;  4JJN K;  2RI3 A;  3VYH B;  3GLX A;  3QHS A;  3FJP A;  2QQA A;  2G3R A;  4M7A B;  4EMG A;  4ZGJ B;  2L5Q A;  2KQW A;  2L8D A;  4FSX A;  2JN0 A;  2KAF A;  3A5Z B;  4OB2 B;  3M59 A;  2D0Q B;  4IUV A;  2X4Y A;  1VIE A;  3PTA A;  4O6J A;  2XDP A;  3OY9 A;  3JCM V;  3X25 B;  4N4H A;  1OZ3 A;  3OYG A;  3M58 A;  3LGF A;  4OF1 A;  1Y71 A;  3CC4 T;  5CKF A;  2RHZ A;  4N4I A;  4RCC A;  4M7D A;  1WGS A;  4C8Q G;  2RJD A;  4M78 C;  5D6X A;  2V8J A;  3H8Z A;  3EAE A;  4M75 E;  3OMC A;  1K9M U;  4M7D D;  3DKM A;  2DD4 A;  1LJO A;  2PVG B;  2RHX A;  3CC7 T;  1YI2 A;  2RK2 A;  4PLL A;  4JRK A;  2XK0 A;  3FC3 A;  4FIB A;  5CR2 A;  2FB7 A;  5IT9 E;  5CCA A;  3JB9 D;  4D6W A;  3LYI A;  1VQ9 T;  2X35 A;  2EYQ A;  4L5G A;  4HT9 A;  3L2Q A;  4M77 G;  5J3B A;  4OGC A;  4C92 C;  1KD1 C;  3X24 B;  3VV0 A;  1M1K C;  5M9O A;  4NL2 A;  3QBY A;  3GF5 A;  1OI1 A;  1UGP B;  4DQ2 A;  2HAX A;  5FRM A;  2LC4 A;  3CCR T;  1B34 B;  5GAO m;  3CC2 T;  2MMP A;  2R58 A;  4RG8 A;  3M9Q A;  3OBY A;  2VUB A;  1RL2 A;  4XTZ A;  2QQ9 A;  2XKO C;  2O01 E;  4FL6 A;  3DB4 A;  4MMK A;  4BDZ A;  3QUI A;  4FU6 A;  4LDY A;  5HK3 A;  3MEA A;  4M7A C;  2QEX T;  4F7U G;  3HRS A;  4PJO C;  1G3Y A;  3CCM T;  5LJ5 g;  1H3Z A;  3CPW S;  3C12 A;  3OW2 S;  1EIF A;  4XU2 A;  2O4X B;  3RIR A;  4DOW A;  4BI3 A;  5LJ5 j;  1BI0 A;  5KH6 A;  3OQ5 A;  3CCE A;  3RER A;  1PSE A;  3WXM B;  5CK9 A;  1N8R U;  3RKY A;  2K4Y A;  4M75 B;  2GFA A;  3MEV A;  3TRE A;  2JVV A;  2KMT A;  3OMG A;  4ZN1 A;  2M9U A;  4PLI A;  4RMO A;  3O8V A;  1VQ4 T;  1RI0 A;  4XTX A;  3A8G B;  3RUX A;  3OSV A;  3VU3 C;  3S3N A;  3A8H B;  5CQX A;  5FRN A;  3QII A;  3HFO A;  4V2S A;  4Q5W A;  3WVD B;  3S3M A;  4DA4 A;  3OBW A;  3OYD A;  4LD9 K;  2XDB A;  3C95 A;  5DY9 A;  5GAO r;  4X34 A;  2RHU A;  2K5I A;  2F5K A;  3KUF A;  1Q81 U;  3SWN C;  3FDR A;  4FT4 A;  2K3Y A;  2XU8 A;  1Y07 A;  2DZ9 A;  3RES A;  3G4S A;  1GXI E;  2VXE A;  4EMH A;  3PFS A;  2ZCF B;  1D3B B;  2GCX A;  5GMK m;  3M5A A;  3OYF A;  3I56 A;  2B8A A;  3M4G A;  4RG2 A;  2F5T X;  4EMK B;  2XG8 D;  5FU7 C;  1YJ9 A;  2DIG A;  1VQ8 T;  3ZEH A;  4N4G A;  4XU0 A;  2JTM A;  5GAN d;  5KE3 A;  1N9S A;  2CS7 A;  4KBM B;  5A0G A;  3OYK A;  4C5E A;  1OYX A;  2PUO B;  1VQ6 A;  1N6A A;  4O5V A;  3G71 A;  1OZ2 A;  3HFN A;  2VV5 A;  1D3B A;  2E6Z A;  2YHT A;  3MET A;  2DK3 A;  3OS1 A;  3TEE A;  1QVP A;  1G3W A;  2QQS A;  4HA8 A;  4QW2 A;  4QVZ A;  4HKE A;  3CMA A;  2E64 A;  2CYZ B;  2LDM A;  3C94 A;  4PKC C;  4VUB A;  5I21 A;  1K8A C;  1JJ2 S;  4PJO E;  4C8Q F;  3L2U A;  4MZP A;  5CKD A;  4JDS A;  1NJI C;  4M75 C;  1YJN T;  2DVE A;  2E1H A;  2GFU A;  2QQB A;  4BB7 A;  2DEQ A;  3KBG A;  1K73 U;  3CCU A;  1VQP T;  1BI1 A;  3CCE T;  4M78 B;  4YTL A;  2I2L A;  3OYN A;  1YCY A;  3JCM b;  5L8R E;  4L6V 5;  4A53 A;  2LCL A;  2EJG A;  3P8D A;  2KK4 A;  5GAN 3;  4M77 F;  3S3O A;  3V8J A;  2DXT A;  3VUZ A;  3GOX A;  4MML A;  2JNG A;  3E19 A;  5IN1 A;  2OTL A;  5D6Y A;  3JCM X;  5LJ5 h;  4Y28 E;  3HSB A;  3QJY A;  3ER0 A;  4C92 B;  5GAO p;  2H3J A;  3MP1 A;  3LX7 A;  2EWN A;  3CCL A;  4M78 D;  3CBP A;  4JRI A;  1VQM T;  1WNL A;  4EPC A;  3AHU A;  2QXF A;  4E7I A;  1YJW T;  2QDY B;  2LT1 A;  2ZPE B;  4F7U F;  4C5I A;  3G4S T;  1H64 1;  3PGG A;  5A0L A;  3RKX A;  1KQS A;  2EQU A;  3VKI A;  2KDS A;  4BAC A;  3JB9 I;  2M16 A;  3JSC A;  2OTJ A;  1X75 C;  2ZPI B;  4NOY A;  3CCV A;  3I56 T;  4C8Q E;  4PJO B;  1ZHI A;  2EIF A;  4JLG A;  1KQ1 A;  4EDU A;  3L2R A;  3CCQ A;  1VIF A;  4X9D A;  4C92 D;  2LQK A;  4LD6 A;  3JB9 J;  4M7D G;  2DIQ A;  4R55 A;  4J7I A;  2PQW A;  3HP9 A;  3NTH A;  5CVI A;  2F69 A;  2LQ8 A;  3HPW A;  4PNO A;  2E6N A;  2WSE E;  2XI9 A;  3JCM W;  3JB9 G;  2CKK A;  4MZT A;  1VQO A;  3QG1 A;  1Q7Y C;  4JLI A;  1MHN A;  2DXB A;  4M7A A;  2LRQ A;  4B9X A;  3INZ A;  4C0G A;  2OAU A;  2ZPH B;  3M54 A;  4M77 E;  4A4K A;  5GAN g;  3CMA T;  4HT8 A;  2KVQ G;  5GAN e;  4BI8 B;  2WSF E;  3QZ5 B;  3ME9 A;  4M7A D;  3OSS C;  5GAN j;  1Y96 B;  2E70 A;  4PJO D;  2A3L A;  2E41 A;  1VUB A;  2R57 A;  3M4Y A;  3QXE B;  4J6X A;  3OYL A;  4E7K A;  2EFI A;  1WJS A;  5LJ5 f;  2DXC A;  4JRP A;  1KHI A;  2MI6 A;  4XK8 E;  4OP0 A;  3PIP A;  3SWN B;  1SSF A;  3URG A;  1QVF S;  5FLX E;  4F7U E;  5J39 A;  3PMI A;  4R56 A;  4A4G A;  3FIF A;  2ZPB B;  2OTL T;  3QZ9 B;  4ME7 A;  3NTK A;  5CIU A;  4ELZ C;  1KD1 U;  5EG2 A;  3JCM Q;  5FU7 B;  2MWP A;  1M1K U;  3OS5 A;  3JCM d;  3CME A;  4FM4 B;  3CCL T;  2YLC A;  4N0A A;  2FHD A;  1VQ5 A;  1M1F A;  2XHC A;  4QQD A;  2DPP B;  2LCC A;  2FYK A;  2E12 A;  3J7A F;  2WSC E;  2RO0 A;  1VQK A;  1U1T A;  2LNV A;  2RD1 A;  3BDL A;  3CPW A;  2CGH A;  1B34 A;  3OW2 A;  5LJ5 e;  2DJZ A;  2OTJ T;  2Y4X A;  4M77 B;  3CCV T;  2RJC A;  4OMF B;  1YIJ A;  2NLU A;  1I8F A;  1W2B S;  2JZ2 A;  4C5H A;  3CCQ T;  3G7Z A;  3FB9 A;  3QPH A;  4BE2 A;  2IG0 A;  2RHY A;  5LJ3 d;  2JTF A;  2X4W A;  2PUK B;  1I4K 1;  3G6E A;  3KXT A;  1VQO T;  2RJF A;  2O4X A;  2CZ0 B;  4A4E A;  5GAM d;  4OVA A;  2E5Q A;  3CXC S;  2RI5 A;  3LGL A;  4M75 A;  5A0D A;  4JRQ A;  3SDZ A;  2P4T A;  1XQH A;  2KSS A;  3BY7 A;  2ZZD A;  2HQX A;  4LDV A;  1S72 A;  2DD5 A;  3L42 A;  1IRE B;  1UGS B;  1Q86 C;  5KCO A;  4M75 D;  3HKS A;  1YI2 T;  3DLM A;  3MO8 A;  3QYG B;  4MDW A;  2CZ7 B;  5GAN 5;  5FU6 C;  2CZ6 B;  2JUF A;  3MP8 A;  2R5M A;  5CKB A;  3DLL A;  4E7J A;  4C8Q C;  2M0O A;  4TVR A;  3OYB A;  1FX7 A;  1YHQ A;  4MZM A;  3CD6 A;  5GAN h;  1QVG S;  4M7D F;  2DZC A;  5D6W A;  1DJ7 B;  3PT9 A;  4QQ6 A;  5J26 A;  3EFS A;  2DXU A;  4KUD K;  1KC8 C;  1QP2 A;  2EJF A;  5AYF A;  4ZGE B;  1XNI A;  1QW1 A;  3CCS A;  3L2W A;  3L2V A;  2QA4 A;  2GQV A;  1VQ5 T;  4Z02 A;  1O75 A;  4EMK A;  3JB9 H;  4M77 C;  3P8B B;  1JJ2 A;  3V7S A;  4BI4 A;  1HXD A;  5GAN 2;  3J80 E;  5FRO A;  2FL7 A;  1P92 A;  4LDU A;  4QQG A;  1WJR A;  3JCM g;  4GY5 A;  3QSU A;  5A2Q E;  3JCM e;  5GAO n;  4E7H A;  4XTY A;  1K8A U;  1YIJ T;  4IUP A;  2K5L A;  4BY6 C;  3BFM A;  1M4Z A;  3FLG A;  2HD0 A;  4M78 G;  1NJI U;  3E1S A;  3L1A A;  1BKB A;  1MGQ A;  4DOV A;  1M9S A;  3J81 E;  3GNG A;  5GMK j;  1G5V A;  3G6E T;  5C6S A;  2P0P A;  2LX9 A;  5KCH A;  3V8K A;  2Y4Y A;  1LNX A;  3E9F A;  4II1 A;  1X01 A;  1JRI A;  2FVU A;  5GAO q;  1NPR A;  2K2V A;  3A8L B;  5I2S A;  4M78 A;  3JRZ A;  3WVE B;  5LJ3 g;  1XOV A;  2VGM A;  3UDC A;  4C92 G;  3L2Z A;  1S72 T;  4M7D E;  3JCM P;  2VC8 A;  2WAC A;  5LJ3 j;  3SFM A;  5GAM g;  2ZGW A;  5GAN f;  2IVW A;  3SD4 A;  3DB3 A;  3QJ6 A;  1G3T A;  2V8K A;  3R6O A;  3V7C A;  3NTI A;  5GAM j;  3LH0 A;  2EQJ A;  1NPP A;  3HRU A;  3PNW C;  4C92 A;  3OS0 A;  1VQ9 A;  1PSF A;  2BIV A;  1YIT A;  1BI2 A;  3MHX A;  4M7A G;  1YHQ T;  1M90 C;  4PJO G;  1YJ9 T;  1W4S A;  2BUD A;  1VQL A;  4ZGD B;  2GF7 A;  5DM7 R;  3LWI A;  2EJ9 A;  2VXF A;  4CRI A;  3ZBD A;  1IZ6 A;  5DLQ E;  4J5Y A;  3P8H A;  1VQ6 T;  3LLR A;  3G71 T;  5CKE A;  3GIB A;  4J83 A;  1NE8 A;  5GAN 8;  1YBY A;  4ZTF A;  1Q82 C;  2LT4 A;  5HKC A;  2E65 A;  4IUQ A;  3GP8 A;  4PJO A;  4BUG A;  1BI3 A;  4L59 A;  2QEX A;  1ZBX A;  3RMS A;  1O9S A;  2L89 A;  3SB2 A;  2A7Y A;  3CCM A;  2AHJ B;  1Q7Y U;  2C06 A;  4IKF A;  1I81 A;  3HRT A;  4Y91 A;  4XAX B;  1M5Q 1;  3CBM A;  1KG1 A;  1U1S A;  1X6O A;  3QKJ A;  4C0D C;  4NL3 A;  2DTI A;  5IAY A;  3CCU T;  2D6F A;  4GLK A;  3JCM c;  3OYE A;  5CKH A;  1FWZ A;  3N5B B;  3V7R A;  2XD0 A;  4M7D B;  1M8V A;  2XIC A;  4XQ3 A;  2D9T A;  2X4J A;  1QVF A;  2ZPG B;  1VQ4 A;  4HCB A;  5C0M A;  1Y96 A;  3A8O B;  3X20 B;  2RH2 A;  5FU6 B;  4HCZ A;  4KT0 E;  1JBM A;  3FRN A;  3HHT B;  1K9M C;  4BE1 A;  3QYH B;  4X9C A;  4C8Q B;  4KUL A;  3UPU A;  3JCM h;  4ZTJ A;  4XTU A;  1VQN A;  4OB1 B;  4LDW A;  1I5L A;  2EKO A;  1VQ7 A;  3M53 A;  3SWN A;  4OB3 B;  4P5N A;  5GAN 7;  3MP6 A;  5GMK h;  3OS2 A;  4IUU A;  2DKG A;  5GAO l;  4LDX A;  3TCJ A;  4XU3 A;  2RK1 A;  2X4X A;  1QP3 A;  2E10 A;  3E9G A;  4C8Q A;  3H6Z A;  2ZPF B;  1W2B A;  2PU9 B;  1YIT T;  1FXX A;  1VQL T;  4RKU E;  1VQ8 A;  4C8Q D;  4M78 F;  4XTV A;  5LJ3 h;  4C5G A;  4M75 G;  3EFR A;  4JS4 A;  3VJP A;  4IUR A;  4BY6 B;  2QQR A;  5GAM h;  4M77 A;  3QO3 A;  3OYH A;  3I55 A;  2XDD A;  3CCJ A;  2L3R A;  4F7U B;  3CXC A;  1UEB A;  2VGN A;  2EQK A;  4ZN3 A;  4HCC A;  4M77 D;  2PVO B;  3VYG A;  4C92 F;  4CI0 C;  3JAM E;  3ASK A;  1N8R C;  4M7D C;  1YJN A;  2K3X A;  1VQP A;  1HK9 A;  4WF2 A;  1N9R A;  5GAN 6;  2DTO A;  3M57 A;  2XID A;  3FEO A;  3JCM f;  3M55 A;  4F7U A;  1Q86 U;  5LL6 S;  5GAN 4;  2RHI A;  1LOJ A;  1N27 A;  3NFC A;  3MEU A;  4NS5 A;  5CQY A;  1NZ9 A;  1G3S A;  4QVD A;  4M7A F;  4PJO F;  3A8M B;  4FT2 A;  1UGQ B;  1QVG A;  2MF2 A;  2M1H A;  3M56 A;  3LW5 E;  2MAM A;  5GMK l;  1Q81 C;  3F70 A;  3QDR B;  2CZ1 B;  4M78 E;  1VQN T;  4OGE A;  4B9W A;  3CME T;  1VQ7 T;  3OYM A;  1M1G A;  3RKW A;  2K57 A;  1VQM A;  4BE0 A;  2YLB A;  5LJ3 f;  2RA2 A;  4N0A C;  3OYC A;  1YJW A;  1KC8 U;  3BDU A;  4XTW A;  1VQK T;  4RCB A;  3HL8 A;  3T9N A;  4C0Z A;  4OB0 B;  2RM4 A;  3MEW A;  1V29 B;  5GAM f;  5KE2 A;  3OYY A;  4KUI A;  5HK0 A;  3PMT A;  3BW1 A;  4C92 E;  1BYM A;  4C0F A;  3OA6 A;  3MCA B;  3GNF B;  4J6Y A;  4PL6 A;  3VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...