4C8QG

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
69
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNRKLGLTVIRGTILVSLSSAEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 69
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qG00
4MMLA 1HXDA 2DZ9A 4M7DA 1LNXA 1WPYA 2E10A 3HFOA 4WF2A 2E41A 4C8QC 2EJ9A 4M7AE 3JCMc 4PJOD 3RIRA 4C92B 5GAN3 4JLIA 4XTVA 3QO3A 5GAOr 5GMKh 4F7UF 2DTHA 3SWNB 4C92D 4C92G 3INZA 3JCMV 5GAN7 4M77A 4NL2A 4J6YA 4Y91A 4C92A 1KQ1A 2ZGWA 4A54A 3QHSA 2DKGA 3RUXA 4A53A 5LJ5g 4HT9A 2EAYA 4OP0A 2DJZA 4M7AB 3V7RA 4XTZA 3RESA 2DEQA 4EMKC 5GMKm 4M78E 3V8LA 3PGGA 4X9DA 1JBMA 5LJ5f 1WNLA 1H641 3JCMg 3JB9H 4M7AG 1D3BB 1WQWA 4PNOA 5GMKl 4M7DC 4M7AD 1B34B 3JB9J 1U1SA 4M75E 3JCMf 4PJOE 3RKYA 3JCMh 5LJ5e 4RCBA 4EMGA 5GAMj 4XQ3A 2QTXA 2EWNA 3JCMJ 4M77F 4C8QE 4HT8A 4C92F 4M78B 4DQ2A 5I21A 3JCMe 3JCMQ 2VXEA 3FIFA 3JCMP 4M77C 1I81A 3JCMX 3AHUA 1X01A 2E65A 2EJGA 2HNIA 4XU2A 4M78G 1TH7A 4M78D 2K57A 3JCMW 4EMHA 4M75B 4NOYA 3BW1A 5GMKe 3JB9I 3FJPA 4PJOB 5LJ3g 2DZCA 3L1AA 3HSBA 4F7UE 2CGHA 4M75G 4M75D 3SWNA 4PJOG 4JRKA 4C8QB 5LJ5d 5LJ3f 5GAOn 4XTUA 1Y96B 5GAOq 4M75A 4XTWA 1LOJA 2I2LA 4XTXA 5LJ3h 3BDUA 2EJFA 1HK9A 4J5YA 5GMKi 5GANg 1MGQA 1U1TA 4C8QD 4C8QG 3JCMd 5GAN5 4M7AA 1BIAA 1JRIA 3V7SA 4M7DE 2RM4A 5LJ3e 3L2ZA 3V7CA 5GANf 4J6XA 5GAN6 3EFRA 3BFMA 2DXUA 2Y90A 5GANh 4F7UB 1D3BA 5GAN8 1BIBA 1B34A 1YCYA 5GAMg 4V2SA 1I8FA 3QUIA 5LJ5j 4F7UG 5GANe 3JB9D 3JB9G 4C92C 4EMKB 4XU0A 4M77E 2E1HA 3FB9A 4HA8A 3RKXA 4C92E 4M75F 5GAMh 1I5LA 3SWNC 4M78A 4XU1A 4M7DB 2RB6A 3QSUA 2E64A 4N0AA 4X9CA 4M7AF 5LJ3d 4M7DD 4M7DG 3SB2A 2DTOA 4C8QF 5GMKj 2FYKA 4RCCA 1KQ2A 4M7AC 1N9RA 5GAN4 2YLCA 3GIBA 4JUVA 2DVEA 4PJOA 5GAN2 4QVCA 1M8VA 3EFSA 3JCMb 2YLBA 3V8JA 2JN0A 1M5Q1 4M77B 5GANd 5GAOm 4C8QA 1LJOA 3M4GA 2VXFA 1Y96A 2DXTA 3HFNA 4NL3A 5GAOl 4XTYA 2RD1A 4M77G 4M77D 5DY9A 5GAOp 3JB9F 1WQ7A 4J6WA 5LJ3j 4M78F 3VU3C 3BY7A 5GAMd 4QVDA 5CAIA 4M78C 5GAMf 4F7UA 3RERA 2VC8A 4N0AC 4M7DF 1N9SA 4PJOF 2YHTA 4XU3A 3V8KA 4MMKA 3RKWA 5GANj 2RA2A 1I4K1 4JRIA 4M75C 5LJ5h 2FB7A 4EMKA 4PJOC 2DTIA 5GAMe
chains in the Genus database with same CATH superfamily
2M1HA 4NS5A 2JVVA 1V1CA 2GTOA 2EJ9A 3CCVT 3QZ5B 3S3MA 3C94A 4C92D 1I07A 1VOMA 1SRLA 2ZGWA 3GP8A 1PRMC 2X3WD 2Z0WA 1YI2T 1JQQA 2SEMA 1X69A 1NPPA 3CMEQ 1WJQA 2EQMA 3OY9A 3VUZA 1YJWQ 3LH5A 3OMCA 2FZKB 2HL3A 3UA7A 1Q81R 3VS6A 4PJOB 2DZCA 2X4WA 3C4SA 1IXDA 5GAOq 1VQ4T 2F1LA 5IHKA 1JRIA 4M7DE 4C5HA 2VWFA 3EGXB 2Y90A 4F7UB 1WFWA 2QEXA 4MZMA 2DPPB 3M0RA 1QQJA 1SSHA 1MMDA 3C0CA 4FW2A 1YIJT 1RI9A 3H0IA 2DL4A 2FHDA 1RAHB 1YWOA 4PLIA 2NWMA 2D6FA 2W10A 3CMAQ 4AG1C 2RH2A 3G4SQ 2CUDA 4M7AF 2W0ZA 4E7JA 2YRVA 4RCCA 1N9RA 1WHGA 4PJOA 1WGSA 2XG8D 1UEBA 3I56Q 2H8HA 3THKA 1C6VX 1PNJA 4M77D 3X24B 2RQUA 1VQ7T 1AEYA 1KC8U 4MDXA 1NJIC 4F7UA 2QGGA 5HK3A 5CK9A 2LCLA 2QAZA 1NM7A 3J7AF 1M90U 4M7AE 2K2VA 1NYFA 5GAOr 1UTIA 1OU8A 5KE2A 1GFDA 4RTWA 1GBQA 1T3SA 4R56A 5IAYA 5GAN7 3CMET 1Q82C 3CCRQ 2O9VA 2KNBB 2ZPGB 3UT1A 2DO3A 3FDRA 1YJWT 2ZPIB 3ME9A 1X27A 3HRTA 4CRIA 4JPBW 3G6EQ 3BDLA 5GJWB 6AT1B 5GAMj 1RAGB 3CCQQ 2NYSA 2XDDA 3OYEA 5EG2A 1T0HA 3OYDA 2QA4Q 3I9QA 4NOYA 1KIKA 5D6WA 4LDYA 4PKCC 5ECAA 1B07A 3OYHA 2DIQA 1BI0A 1JB0E 3S6WA 3HSBA 2RJFA 4OVAA 1D0YA 2PUOB 2DL3A 2RHZA 3META 2RI3A 1HK9A 2DJQA 3RBBB 4C8QG 1N8RU 1AHJB 2RJDA 5GANf 3G1JA 5GAN8 3CMAT 3G4ST 2LZ6B 2KR3A 4V2SA 3BE3A 4C92C 3URGA 3TVTA 5AYFA 2BTTA 3I56T 3GBQA 3SWNC 4XU1A 2RI5A 4M4ZA 3UDCA 1KC8R 1V76A 3LGLA 1YJ9Q 4M7DD 2DTOA 1FMKA 3A98A 1K9MC 2YLCA 3P8DA 4N4GA 3JCMb 3HKSA 1VQOQ 1H8KA 1Z9ZA 5GANd 2YUOA 5LL6S 4NL3A 1QP2A 1VQKQ 2HKQB 1M90R 4Y28E 1DJ7B 1FYNA 2KDSA 2O4XB 4WCIA 4ATOA 2DL5A 4PJOF 4MZPA 2QGFB 2D0QB 3M0QA 4FYVB 4LDVA 4LNPA 3CCRT 2I0NA 2VB6A 3IQLA 4JS5A 4QW2A 1IHWA 3OYKA 3CCVA 3OW2P 4F7UF 1PKSA 5FRMA 3PMTA 3L2RA 4NL2A 1WA7A 2F2XA 3G6ET 4J7IA 4OP0A 3V7RA 4XTZA 3OB9A 3I5RA 3CCQT 3V8LA 3LW5E 4M7AD 2X35A 1YI2A 2KRMA 5GJVB 4LUEA 2QA4T 2DRKA 3KBGA 2IPOB 1VQPA 4PJOE 2DAQA 5DM7R 2KEAA 3FJ5A 1OZ3A 3M55A 4DQ2A 3ER0A 4M77C 1ABQA 1VQ6A 4XU2A 3QPHA 1TH7A 1T0JA 4B9WA 3ULRB 5LJ3g 3CEYA 4F7UE 3OS5A 2CP7A 5KE3A 2BKDN 5GAN5 4OB3B 3OYJA 1NLPC 3CC2Q 3OYBA 1WHJA 5GAN6 2CT4A 1YJ9T 2J05A 3GPLA 4ZN1A 2DNUA 3JB9G 1QWEA 3H8ZA 2E4HA 4JJCA 3L42A 3LX7A 1VQOT 5KYYB 1Z9QA 3OMGA 2XICA 1I5OB 5L8RE 4QVZA 3ZL7C 2EW3A 1VQKT 4C8QF 1VQLA 1RLQC 2JOYA 5FU7B 2RHYA 3V8JA 2BZYA 3ZBDA 1A0NB 1JJ2P 4WTOB 3ZEHA 2CZ6B 2KMTA 2O88A 4ELYC 4IUQA 1UGRB 1W6XA 4HCKA 1Y71A 1KK7A 3PNWC 2QEXQ 1O9SA 2COZA 4UC4A 2JJ9A 1RLPC 1PRLC 1W4SA 1PD1A 1GCQA 5KYYA 4PJNA 1M3AA 1MUZA 2RHUA 5DLOA 2RQRA 3CPWP 5KH6A 3EFOB 3DLLA 2KVQG 1N6AA 3M0TA 2LT4A 1LPLA 4OMQA 5CVIA 1UGVA 1VQNQ 2LX9A 5LJ5f 4J9CA 4M7DC 2MCNA 1E6HA 1YJWA 4OB2B 1OQKA 3JCMf 4JZ4A 4RCBA 3FLGA 1UE9A 2QQAA 3QWYA 1XQHA 1QVFS 1D1BA 5I2SA 1LCKA 3FJPA 3CC2T 1WLPB 2GF7A 2EYXA 3PVQA 4HCCA 4L5GA 1BU1A 5LJ5d 4PJOD 4C5EA 2V1QA 4PFOA 4FCYA 2ZCFB 3JCMd 2JMAA 5CKHA 3V7SA 1BI2A 2IVWA 1K0XA 3LWIA 1K1ZA 1U5SA 3CXCP 1ZUKA 2YUQA 1G3SA 1SHFA 1QVFA 2QK0A 2M51A 1ZUUA 3I56A 1K73C 3D7SB 4M7AC 2E6ZA 3X28B 4KH0B 5CO7A 1VQ9A 1UGQB 1OX9A 2QEXT 4MDWA 3M4GA 2RK1A 2NUPB 3GOXA 2RD1A 1QVGA 3JB9F 1Q95G 4J6WA 2QG9B 4CC2A 3PMIA 5GAMd 5HK0A 2WACA 4CI0C 4II1A 1K8AR 2O01E 4MMKA 1U8RA 5LJ5h 4DBQA 4MMLA 2BIVA 2E70A 4HXJA 2VVKA 1M1KR 2ECZA 1VQNT 2GFUA 4AFQC 1ZUYA 2G6FX 4Z02A 3SHWA 2DF6A 4DBRA 3J80E 1H92A 2ZPEB 2LNHB 2NUPA 1Q7YC 3CC7Q 1VYUA 4EMKC 4IURA 2XKOC 3G6EA 1Y07A 5J39A 1MV3A 5FU6C 1KD1R 3QDRB 3CCQA 4AG2C 2KROA 5FROA 2PVOB 1QCFA 2RI2A 4C0GA 2L0AA 2KE9A 3VS2A 3JCMJ 2KI7A 1U06A 4M78B 2KT8A 4J9BA 1UUEA 2LJ1A 2E5KA 2FEIA 4KGXB 3JB9I 4OMMA 4AFZC 4O5VA 3VUBA 4M75G 1VYTA 2DM1A 2FRYA 1FX7A 4M75A 4P5NA 4GBQA 2KBTA 2MI6A 1TS9A 1UJ0A 2KYBA 4LUDA 2HBPA 2XU8A 3QZ9B 3M0SA 3MEAA 4KGVB 2PVGB 2X4JA 1VQPQ 1ZBJA 3MEUA 1J3TA 4M78A 2RF0A 4ME7A 1VQOA 4N0AA 4PL6A 1VQ6Q 2DMOA 2JNGA 4R0KA 3GIBA 2A7YA 1WJSA 3N5BB 4LD6A 1E6GA 4K11A 2P84A 2V1RA 2XI9A 3L2UA 1IB8A 1PKTA 2DL8A 3EG3A 5CKDA 3TCJA 5L23A 2K2MA 4A4HA 1RABB 2IG0A 3J81E 2CZ7B 3JRZA 2CUBA 4J9GA 1M8MA 4PJOC 3I55A 3EHRA 1WIEA 1HXDA 2DZ9A 5CQYA 2DXCA 2L8DA 3CC7T 1I1JA 4A4EA 2QYZA 3QO3A 4GY5A 1VQLQ 2RQTA 4KBMB 3VS4A 4DEXA 1M1GA 1M2OA 4PJLA 3CBMA 4KT0E 2CS7A 1QVGP 2CDTA 1D3BB 3MP8A 2X4XA 1JU5C 1QVPA 4HVWA 4C0ZA 2M16A 1NEGA 3AT1B 4ANJA 3FIFA 2CZ1B 5CQXA 3AHUA 2E12A 4RKUE 5D7UA 1ZBXA 3QXEB 1BYMA 1Y0MA 2JW4A 1WJRA 2X4YA 3CBPA 3CC2A 4HVUA 4XTUA 3KXTA 2DERA 4QQDA 1VQPT 1D0ZA 1OX8A 1UDLA 2CSIA 1CKAA 3EGDB 4OGEA 3NTHA 4E2FB 4ZGJB 4ZGDB 3VRZA 2RO0A 1D3BA 1VQ6T 1PD0A 3KUFA 3L2QA 4F14A 3RKXA 1TSFA 4KH1B 4M75F 2E64A 4X9CA 3OW2S 2YRDA 3VJPA 3VYHB 2HQHA 5GAN4 2VYTA 1RAIB 4DOWA 3M0PA 3L2WA 1LJOA 2VXFA 1PC0A 2X51A 2FPDA 3EGDA 2COYA 4BE1A 1GL5A 4M78F 5D6XA 3OYLA 1GRIA 2XD0A 1OV3A 4RTVA 3S3NA 1VQLT 1VQMA 3RDVA 2DTIA 3EG2A 3OW2A 2JTMA 3REAB 3OYYA 4JLIA 4XTVA 1TU0B 5GMKh 1FMVA 4BI3A 1JEGA 2KGTA 3OSVA 1VQNA 3M9QA 1VQ9Q 1FXXA 1KQ1A 4FSXA 3RUXA 1K76A 2YXYA 2EAYA 2DJZA 2KSSA 4M78E 7AT1B 2L3PA 1JXMA 1MMNA 2OX7A 4IIOA 3X25B 8ATCB 2EYQA 1Q86U 2QXFA 4X34A 1VUBA 1G2BA 2E3HA 2EYZA 2K6DA 2JUFA 3NHNA 2E65A 4OMOA 2MAMA 4EMHA 3L1AA 1TXQA 2EVRA 5KYXB 2DILA 2CGHA 1JJ2S 4RMOA 4JRKA 4C8QB 5LJ3f 4DBFA 2HQEA 3M5AA 1AWXA 4HKEA 1U1TA 2XMFA 2GFAA 3H6ZA 2LC4A 1M1KC 3M4YA 4BI4A 1YCYA 4BB7A 3JSCA 4RTZA 5GANe 1SEMA 1TG0A 2RB6A 2HDAA 2Y4YA 1AWOA 5LJ3d 2NUZA 1JJ2A 2EQKA 2DD5A 1G3WA 2M9UA 4QVCA 5KYXA 2HCKA 1CSKA 2JN0A 4C8QA 4A4KA 2LJ0A 1UFFA 2FL7A 3R6NA 5GAOl 1C0MA 5IH2A 4J9EA 1RAAB 2K7AA 2AHJB 5CAIA 2MMPA 2AK5A 3OYMA 2LQWA 1X43A 2KXDA 3A8HB 3TQ7P 3CPWA 1G5VA 1VQ9T 4DOVA 4BY6B 2BZ8A 3JCMc 2EYWA 1NLOC 3X20B 2HSEB 1Q86R 3CC7A 2J6KA 3L2VA 2DTHA 2K5IA 2NUTB 1ARKA 3OYNA 3QHSA 1XJWB 3DLMA 5GMKm 3CXCS 2MPXC 2DBMA 5FWCA 1GCQC 2Y4XA 1Y57A 4BACA 2DIGA 4OB1B 1BBZA 3RKYA 2JMCA 3VS3A 2E6NA 4BDYA 1YCSB 4HCZA 2RMOA 5FU7C 4HT8A 3I55Q 2JTEA 2OJ2A 1W1FA 2MWOA 3EG0A 3QWXX 2EJGA 4M78D 1LVKA 2QDYB 1X75C 4D6WA 1KHIA 1D1AA 2NUTA 1LOJA 2LDMA 3CXCA 1ABOA 3BDUA 4LDWA 2F5KA 1CKBA 1H3HA 2EKHA 2RM4A 1X2KA 3EH1A 5GANh 2H3EB 1S72Q 1N8RR 2PZ1A 3QUIA 2PQWA 2XDPA 3OYGA 1WI7A 4XU0A 3PE0A 2CP5A 2PUKB 3QYGB 4IUTA 2VKNA 2ATCB 3RMSA 2OTLQ 1JXOA 4OF1A 3WVDB 4E7IA 2L3SA 4ZNXA 4OMNA 3HRSA 1QKXA 4JRPA 2D0NA 4E7LA 2O31A 2HAXA 4F04B 3M58A 3MKDA 5J26A 4JRQA 4IIMA 4C5IA 2EPDA 3NTIA 3U23A 3HFOA 1SF9A 2F69A 2O2OA 1R0CB 2AZVA 2CT3A 1RADB 2KQWA 1UB4A 4C92G 1T3LA 3OSSC 4DEYA 3JAME 2EQIA 4C92A 5CKBA 1Q81C 2DETA 4A4GA 2DEQA 2GGRA 3I55T 1OPLA 4XAXB 2RHXA 1WYXA 2DD4A 5FLXE 2CP6A 5LJ5e 4EMGA 1NJIU 1BCMA 2EWNA 1VQMQ 1PHTA 4C8QE 5A0DA 3JCMe 3VYGA 2VGMA 5KYUA 2FPFA 3VRYA 4LN2A 1IZ6A 2HNIA 3VKIA 1UHCA 1C1AA 1FWZA 1D09B 1WXUA 2GQIA 4FIBA 3CCLQ 2V8JA 1S72T 1N27A 5GAOn 2I2LA 2BUDA 1PG5B 1G83A 1YP5A 1GCPA 2PU9B 2BE7D 2YUNA 1Q82U 1AWWA 2A3LA 3WXMB 3BFMA 1ACMB 4BE0A 3Q1JA 2OTLT 1SPKA 1IRXA 9ATCB 1N5ZA 2A08A 2KT1A 3H0FA 4C0FA 1VIFA 2ESWA 2DXBA 1YJNA 1KQ2A 1KQSP 3MEWA 1MMGA 2L3RA 1PSEA 4FYXB 3CCEA 1QVGS 1YWPA 4D8KA 4KRTA 4QQ6A 4M77G 3VU3C 1ZX6A 3M54A 1UGPB 4M78C 4R55A 5GAMf 1K0SA 2ZAEA 2BE9B 4N0AC 3ZFJA 3HRUA 2RA2A 1OPKA 3JB9H 4KULA 1GXIE 2C0OA 1VQ5A 2B86A 1QMCA 2RJEA 1ZLMA 2CKKA 2A37A 2EYYA 4JDSA 5IHNA 1W2BA 1NJIR 4PJMA 1K9MU 2K79A 2HQXA 4A54A 2DKGA 2HBWA 3QIIA 1SSFA 2OTJA 1VQMT 4ELZC 1BI3A 3T9NA 1BK2A 2QI2A 4J9DA 1ZSZB 4GLKA 3JCMh 2HD0A 2YDLA 4E6RA 2L2PA 1EIFA 4FYYB 4XQ3A 4FM4B 3CCLT 4C92F 2FG0A 2C0IA 1E7OA 2QQSA 2K4YA 3NMZC 4M75B 3SEMA 4CC4B 2JXBA 5A0LA 4A63B 1F1BB 1R77A 3O8VA 4LDUA 1NPRA 1Y7XA 2KY9A 4XTWA 1KC8C 2YUPA 4L59A 4BE2A 1MGQA 4C8QD 2R57A 4RTYA 2VUBA 2MF2A 1UGSB 1XOVA 3A8OB 2DXUA 2CREA 1QCOA 1ZSZA 4J83A 2AKLA 2NLUA 3GNFB 1UG1A 4X1VA 2YSQA 1M90C 1AZGB 1M1FA 3H9NA 2E1HA 5GAMh 1IGUA 4C92E 1SKUB 4FYWB 8AT1B 3LYIA 3EAEA 2D1XA 4E7HA 2K3XA 4M7DG 4HCBA 2FYKA 2YT6A 1HJDA 1JO8A 4QQGA 5GAN2 4IKFA 4D8DA 4OB0B 1NEBA 1SHGA 3FC3A 3PT9A 3UF4A 1EFNA 2FO0A 5GAOp 2ABLA 2LJ3A 4Z8AA 2LMJA 4EPCA 3I35A 3CCUQ 3CPFA 1AD5A 2VC8A 1SG5A 5GANj 3ASKA 1I4K1 1K9MR 3JB9J 5AT1B 2IIMA 3SD4A 1SRMA 2ENMA 1RUWA 2CZ0B 2KRSA 2LNVA 2LVMA 2EKOA 1UHFA 1O75A 4OMFB 3INZA 1N8RC 1PWTA 4IUPA 2VGNA 3OS2A 1NBEB 3DB3A 4HT9A 1WDXA 2A28A 2CYZB 1WZOA 2QTVA 3G71A 1NYGA 2D8JA 4X9DA 1WNLA 4M7AG 3NPFA 1WQWA 3E19A 4Z88A 5EC7A 3M53A 1B7TA 4LDXA 3M56A 2E3IA 1P92A 3MP6A 5I21A 4J7FA 4CC7A 1I81A 3PFSA 3VS0A 2GTJA 2RQWA 3JCMW 5GMKe 2MYSA 2R5AA 1AZEA 4A4FA 1W2BP 1UECA 3VS7A 3M0UA 1S72A 2R5MA 3REBB 3MJXA 1NZ9A 3CCSQ 4QT7A 2DK3A 4FT4A 3CCMA 3OYFA 1M3CA 2C0TA 3JB9D 1BKBA 2OTLA 2FZGB 5CR2A 1VQ8A 3PIOA 1M3BA 1I5LA 4J9IA 2C06A 4ESRA 2ZPFB 4FT2A 2CH4W 1QW1A 3P8HA 2DBKA 2AIRB 1M2VA 2KK4A 3CCUT 1XTDA 5IN1A 3A8GB 3O5ZA 2DXTA 1TTHB 2D8HA 1TOVA 2AKKA 2ED0A 4PFPA 2ZPHB 1EZZB 2VASA 4RTTA 3LGFA 2EGEA 3UWNA 4M7DF 4C0DB 1OI1A 1M4ZA 4O6JA 2HMAA 1WPYA 4C8QC 2J6FA 4BUGA 3FEOA 2H3JA 1AVZC 2G3RA 1YJNQ 4Z89A 1D1CA 3S3OA 5IT9E 1KG1A 1K73U 3H41A 3NTKA 4Y91A 3VS1A 3E2UA 3A1PA 3CCEQ 1QLYA 1MNDA 3RESA 4FL6A 3I5SA 1D0XA 4MZTA 2HSPA 1JBMA 5I11A 2CP0A 3NFCA 2GBQA 5KYNA 2COWA 2EQUA 4N4HA 1U1SA 4M75E 1GBRA 2P4RA 5I22A 1ZSGA 2P0QA 1QP3A 2VXEA 2SRCA 2WSFE 3CCLA 4ZTFA 1VQ5Q 3HP9A 3LLRA 3CCST 4LD9K 4PJOG 2DA9A 5GMKi 3MP1A 1R0BG 2RPNA 3P8BB 4OMLA 2LQKA 2OTJQ 5LJ3e 3OYCA 3L2ZA 2QQBA 1Q7YU 2LT1A 3CD6Q 4BY6C 3CQTA 5LJ5j 2PNIA 4F7UG 1OULA 3EGXA 3A8LB 3FB9A 4HA8A 3QSUA 3PVLA 1K8AC 3C95A 3SB2A 1YHQA 2K5FA 4JUVA 3QBYA 3EFSA 3M57A 2MOXA 1M5Q1 2PVDB 2A36A 4YTLA 4XTYA 1WHMA 2DEUA 1X6BA 4RUGA 3EG1A 2EIFA 2J7IA 3FRNA 4QVDA 3VV0A 2GQVA 2K3BA 2YHTA 1K73R 3RKWA 1QKWA 1YJNT 4FW1A 3CPWS 1GFCA 4JS4A 2HKNA 1KD1C 1IHVA 4KUDK 1BCOA 3OBYA 4WF2A 3C12A 2E41A 3CCET 5GAN3 5CKFA 1MNEA 2OI3A 1M30A 1ZQ1A 4ZN3A 4RG8A 3EG9B 2RNAA 4PK4A 2K9GA 2P0PA 3NGPA 3QDFA 2DYIA 2DVJA 3PGGA 1H641 4PNOA 3OS1A 1VQ5T 1FMWA 3CCJA 1TWBA 2M0OA 3SFMA 2D9TA 2QTXA 3DB4A 1PSFA 2DRMA 2LRQA 2O9SA 4JJNK 1Q7YR 3OBWA 1KQSS 4HVVA 3HL8A 2OTJT 2JM9A 3BW1A 4KUIA 4LXCA 4M75D 5KCHA 3WVEB 3CD6T 3EG9A 2ROTA 4XTXA 5LJ3h 5HKCA 2EJFA 2VV5A 4JZ3A 4ZGEB 3G71Q 3EGUA 4J6XA 4J9FA 1MHNA 3TU4K 1NE8A 1RACB 1U3OA 3CC4Q 4N4IA 1YITA 4ORZA 2EQJA 3H0HA 1WHLA 3E9FA 1KQSA 3F70A 3GLXA 2KXCA 4J8OA 2DVEA 1R8OB 4IUVA 4KGZB 4B9XA 4QKUA 3RR6A 5IXFA 2KAFA 3QYHB 3CCUA 5DY9A 3DKMA 2JTFA 4JJDA 1H3ZA 2JS0A 4BDZA 2DL7A 3CCMQ 5C0MA 2O4XA 2FB7A 5FRNA 1VQ8Q 4JLGA 5J3BA 5CIUA 1LNXA 2DX1A 2E10A 1WXBA 4L6V5 2F2VA 3EH2A 3RIRA 4C92B 1X6GA 4TVRA 4EDUA 4RTUA 3SWNB 5IHIA 3OS0A 3JCMV 5C6SA 2XK0A 2EFIA 4F16A 1WX6A 2ED1A 5D6YA 2KRNA 3E1SA 2YRCA 3VS5A 1B34B 3E9GA 3OA6A 2OAWA 5KYUB 1VQ4A 1UJYA 2QASA 2A0FB 2QQRA 2CH4A 3X26B 1YN8A 1NG2A 2YWWA 4XK8E 2HEQA 3JCMX 1AWJA 3RMQA 2FVUA 1S1NA 3G71T 1YIJA 5FWBA 1HYOA 3MPUB 3SWNA 4JJBA 3CCSA 3CC4T 3QKJA 4J5YA 5GANg 4C5GA 1YNZA 1OZ2A 1PCXA 2WSCE 3EFRA 3KFVA 1B34A 1OU9A 3TREA 2P4TA 1I8FA 2F2WA 1VQ7A 4AFUC 2B8AA 1V29B 1ZA2B 4RTXA 2L3QA 5FW9A 1TUGB 3PTAA 2RK2A 1K4US 5GMKj 3PIPA 5I2MA 2RQVA 2LQNA 3MEVA 1G3TA 1IREB 4M77B 1AT1B 2LX7A 2AT1B 2MWPA 3CCMT 5CKEA 1ZSZC 4LE9A 1HSQA 1K8AU 3JV3A 1VQ8T 3A5ZB 3CMEA 3RERA 2RJCA 3QJYA 4XU3A 4JRIA 4M75C 1M1KU 5CCAA 1WHKA 1OYXA 5GAMe 2X3XD 1EX4A 3RNJA 4FU6A 2F5TX 2PTKA 2EGAA 2FPEA 1YHQQ 1VYVA 2GNCA 2BZXA 1W2BS 1PM3A 4F17A 4IUUA 1KD1U 4M77A 4J6YA 2OAUA 2JM8A 1M27C 1OEBA 3EFOA 4A53A 1QWFA 3HTRA 5DLQE 2DYBA 4EIKA 2DE0X 2E5QA 1KJWA 2HZYA 2MIOA 3OYIA 2K3YA 1WXTA 3GNGA 3JCMP 3CMAA 3G4SA 3MO8A 1X01A 3M59A 2LQ8A 3SDZA 1AOJA 1VA7A 4AMCA 2LCCA 2FZCB 2EBPA 3MHXA 4CC3A 1HD3A 2K5LA 5KCOA 1Y96B 1MV0B 3UA6A 2V8KA 3GF5A 1YFNA 1ZA1B 2P0KA 4AFSC 5KYWB 5IXBA 3CD6A 2ZZDA 1G8XA 1XNIA 4GLMA 2V26A 1BIBA 1IO6A 3R6OA 4PJJA 2EGCA 1B3QA 1Q82R 2RHIA 3CCJQ 1KFZA 2JS2A 1YBYA 1M9SA 4M7DB 2QDLA 2DFUA 3OYAA 2CP2A 1ZHIA 2R58A 4BI8B 3TSZA 5M9OA 1M8VA 2XDBA 3CCRA 1W70A 5GAOm 1Y96A 3HFNA 3HPWA 5KYWA 5A2QE 1TUDA 1Q86C 4E7SA 5LJ3j 2CSQA 3CBOA 2XHCA 2FRWA 2QQ9A 1I0CA 3V8KA 1YHQT 4FSSA 2JZ2A 1YITQ 1KHCA 1RAEB 4M7DA 1G3YA 2QA4A 2M02A 1QCNA 1VIEA 3TEEA 3LWHA 1TUCA 4Y92A 2M0YA 4OMPA 4RG2A 2L89A 2MK5A 1RL2A 4E7ZA 5LJ5g 2J6OA 2LCSA 4M7AB 3CCVQ 4DBHA 2CP3A 2HL5C 3JCMg 4BD3A 5GMKl 4J9HA 1MMAA 2AZSA 4VUBA 2J06A 4PFZA 4M77F 1RI0A 4Q5WA 1YI2Q 3JCMQ 1KSWA 1X2QA 3OQ5A 1YJ9A 4AT1B 4M78G 2K57A 4B6MA 3HHTB 4DA4A 2ZPBB 2X9HA 2DLPA 5A0GA 3TSWA 4PLLA 1VQKA 3CCJT 3CC4A 4M7AA 1BIAA 4C0DC 2ROLA 1Q81U 3V7CA 4ZTJA 5HCKA 2WSEE 3A8MB 2LTOA 3QG1A 4OGCA 5GAMg 1K9AA 1X6OA 2RN8A 1VQ4Q 1WHHA 2GCXA 4EMKB 3EHQA 5FU6B 4M77E 2V8IA 2JT4A 1M2VB 2L5QA 4E47A 5HY6A 3G7ZA 1IGQA 2KYMA 1YIJQ 1QVFP 3UPUA 3QJ6A 3MCAB 2YLBA 4E7KA 2XIDA 1WQ7A 1YITT 1RAFB 3BY7A 3LH0A 2LP5A 1BI1A 1N9SA 1BB9A 1OOTA 3UATA 4EMKA 1VQ7Q
chains in the Genus database with same CATH topology
2M1HA 1KD1C 4NS5A 4MMLA 2JVVA 2BIVA 4C5IA 2E70A 3NTIA 4KUDK 3OBYA 4WF2A 3C12A 3HFOA 2E41A 2F69A 3CCET 2EJ9A 3CCVT 5GAN3 5CKFA 2KQWA 2GFUA 1VQNT 4Z02A 3QZ5B 3S3MA 1UB4A 3C94A 4C92G 4C92D 3J80E 1ZQ1A 4ZN3A 3OSSC 4RG8A 3JAME 4C92A 2ZPEB 5CKBA 1Q81C 2ZGWA 1Q7YC 3GP8A 4A4GA 2P0PA 2DEQA 4EMKC 4IURA 2XKOC 3G6EA 1YI2T 3PGGA 3I55T 1Y07A 5J39A 5FU6C 1H641 3QDRB 4PNOA 4XAXB 3CCQA 2RHXA 3OS1A 1NPPA 2DD4A 5FLXE 5FROA 1VQ5T 2PVOB 1WJQA 2RI2A 4C0GA 5LJ5e 3CCJA 2EQMA 2M0OA 4EMGA 1NJIU 3SFMA 2D9TA 3OY9A 2QTXA 2EWNA 3DB4A 3JCMJ 3VUZA 1PSFA 4C8QE 2LRQA 3OMCA 4M78B 5A0DA 3JCMe 3VYGA 2VGMA 4JJNK 1IZ6A 2HNIA 3OBWA 1KQSS 3VKIA 3HL8A 2OTJT 3BW1A 3JB9I 4PJOB 1FWZA 4O5VA 2DZCA 2X4WA 4KUIA 3VUBA 3C4SA 4FIBA 4M75G 4M75D 5KCHA 3WVEB 1S72T 2V8JA 1N27A 5GAOn 3CD6T 1FX7A 4M75A 5GAOq 2I2LA 4XTXA 5LJ3h 2BUDA 2EJFA 4P5NA 5HKCA 1VQ4T 2PU9B 2VV5A 2MI6A 4ZGEB 1JRIA 4M7DE 4C5HA 1Q82U 2A3LA 4J6XA 3WXMB 3BFMA 1MHNA 2Y90A 4F7UB 3TU4K 4BE0A 2HBPA 2XU8A 1NE8A 3Q1JA 3QZ9B 4MZMA 2QEXA 2OTLT 2DPPB 3MEAA 2PVGB 4N4IA 2X4JA 1YIJT 3MEUA 1YITA 2EQJA 2FHDA 3E9FA 4PLIA 1KQSA 2D6FA 3F70A 4M78A 3GLXA 4ME7A 1VQOA 4N0AA 4C0FA 2RH2A 4M7AF 1VIFA 4PL6A 4E7JA 2JNGA 2YRVA 4RCCA 1YJNA 2DXBA 4J8OA 1KQ2A 1N9RA 2A7YA 1WJSA 3GIBA 4PJOA 2DVEA 1WGSA 1R8OB 3N5BB 4LD6A 4IUVA 2XG8D 4B9XA 3MEWA 2L3RA 1UEBA 1PSEA 2KAFA 3QYHB 2XI9A 3CCUA 3L2UA 3CCEA 1QVGS 4QQ6A 3X24B 4M77G 4M77D 5DY9A 5CKDA 3DKMA 1VQ7T 3TCJA 2JTFA 3VU3C 4A4HA 1KC8U 2IG0A 4MDXA 3M54A 1UGPB 4M78C 3J81E 4R55A 2CZ7B 4F7UA 5GAMf 1NJIC 1H3ZA 3JRZA 4N0AC 5HK3A 4BDZA 3ZFJA 5CK9A 3HRUA 2LCLA 2RA2A 5C0MA 2O4XA 2FB7A 4PJOC 3JB9H 3I55A 5FRNA 4KULA 1GXIE 1HXDA 2DZ9A 4JLGA 5J3BA 5CQYA 5CIUA 1LNXA 2E10A 2DXCA 2L8DA 3J7AF 1M90U 1VQ5A 3CC7T 4M7AE 4L6V5 2K2VA 3RIRA 4A4EA 4C92B 2RJEA 5GAOr 3QO3A 2CKKA 4JDSA 5KE2A 4TVRA 4GY5A 4EDUA 4KBMB 3SWNB 3OS0A 4R56A 3JCMV 5IAYA 5GAN7 1W2BA 3CMET 5C6SA 1Q82C 2XK0A 1K9MU 1M1GA 2HQXA 4A54A 2EFIA 2DKGA 3CBMA 3QIIA 1SSFA 2ZPGB 3UT1A 2DO3A 2OTJA 4KT0E 1VQMT 3FDRA 2CS7A 1YJWT 5D6YA 2ZPIB 4ELZC 1BI3A 3T9NA 3ME9A 1D3BB 3E1SA 3MP8A 2X4XA 2QI2A 3HRTA 1B34B 3E9GA 3OA6A 1QVPA 4GLKA 3JCMh 4CRIA 2HD0A 1VQ4A 3BDLA 5GAMj 1EIFA 4XQ3A 4C0ZA 2M16A 2QQRA 4FM4B 3CCLT 3X26B 4C92F 2XDDA 3OYEA 3FIFA 2CZ1B 4XK8E 5CQXA 5EG2A 3JCMX 3AHUA 2E12A 3RMQA 3OYDA 4RKUE 2QQSA 1ZBXA 2FVUA 2K4YA 4M75B 4NOYA 3G71T 1YIJA 3QXEB 5D6WA 5A0LA 4LDYA 4EMKA 1BYMA 4PKCC 1WJRA 3OYHA 2X4YA 2DIQA 3CBPA 1BI0A 3O8VA 1JB0E 4LDUA 3S6WA 1NPRA 3SWNA 1Y7XA 2KY9A 2RJFA 3CCSA 3CC2A 4OVAA 4XTUA 2PUOB 2RHZA 4XTWA 3KXTA 3QKJA 3CC4T 3META 2RI3A 4J5YA 1HK9A 4QQDA 5GANg 4L59A 4C5GA 4BE2A 1VQPT 1MGQA 4OGEA 4C8QD 4C8QG 3NTHA 4ZGJB 1N8RU 1AHJB 2R57A 2VUBA 1OZ2A 2MF2A 1UGSB 1XOVA 2RJDA 4ZGDB 5GANf 3A8OB 2WSCE 3EFRA 2DXUA 2RO0A 1D3BA 5GAN8 3CMAT 3G4ST 1B34A 1VQ6T 4V2SA 3TREA 2P4TA 1I8FA 4J83A 3GNFB 2NLUA 3KUFA 4C92C 3L2QA 3URGA 1VQ7A 5AYFA 1M90C 2B8AA 1M1FA 1V29B 2E1HA 5GAMh 3I56T 3RKXA 4C92E 4M75F 3SWNC 4XU1A 2RI5A 3LYIA 2E64A 3EAEA 3UDCA 3PTAA 2RK2A 4X9CA 4E7HA 2K3XA 3LGLA 3OW2S 4HCBA 4M7DD 2DTOA 4M7DG 5GMKj 3VJPA 2FYKA 3VYHB 3PIPA 1K9MC 5GAN4 2VYTA 2YLCA 5I2MA 4QQGA 5GAN2 4IKFA 3P8DA 4N4GA 3MEVA 4OB0B 1G3TA 3HKSA 4DOWA 1IREB 3JCMb 4M77B 5GANd 3L2WA 1LJOA 3FC3A 2VXFA 3PT9A 2MWPA 3CCMT 5LL6S 4NL3A 5CKEA 1QP2A 5GAOp 1K8AU 4BE1A 4Y28E 1VQ8T 1DJ7B 4M78F 5D6XA 4EPCA 3OYLA 2KDSA 2O4XB 3A5ZB 4ATOA 3CMEA 3RERA 3CPFA 2RJCA 2VC8A 2XD0A 5GANj 4PJOF 3QJYA 4XU3A 3S3NA 3ASKA 4MZPA 1I4K1 4JRIA 4M75C 1VQMA 1M1KU 1VQLT 5CCAA 2DTIA 2D0QB 5GAMe 1OYXA 3JB9J 4LDVA 3SD4A 3OW2A 2JTMA 3CCRT 2CZ0B 2LNVA 2LVMA 2EKOA 4JS5A 4FU6A 2F5TX 3OYYA 4QW2A 4JLIA 4XTVA 3OYKA 1O75A 5GMKh 3CCVA 4OMFB 4F7UF 4BI3A 1W2BS 3OSVA 5FRMA 1VQNA 3M9QA 3INZA 1N8RC 3PMTA 4IUUA 3L2RA 4M77A 4NL2A 4J6YA 1KD1U 2OAUA 4IUPA 1FXXA 1KQ1A 2VGNA 4FSXA 3G6ET 4A53A 3RUXA 3OS2A 4J7IA 3DB3A 2EAYA 4OP0A 2CYZB 2DJZA 2KSSA 4XTZA 3V7RA 3OB9A 3G71A 5DLQE 4M78E 3CCQT 3V8LA 4X9DA 1WNLA 3LW5E 4M7AG 4M7AD 3X25B 1WQWA 3E19A 2X35A 1YI2A 3M53A 2EYQA 1Q86U 2QA4T 3KBGA 1VQPA 2E5QA 4PJOE 4LDXA 2DAQA 5DM7R 2QXFA 3M56A 1OZ3A 4X34A 1VUBA 1P92A 3M55A 3MP6A 3OYIA 2K3YA 4DQ2A 5I21A 3ER0A 3GNGA 3JCMP 4J7FA 4M77C 3CMAA 3G4SA 1I81A 3MO8A 3PFSA 2JUFA 1VQ6A 1X01A 2E65A 3M59A 3QPHA 1TH7A 2LQ8A 4XU2A 3SDZA 3JCMW 2MAMA 4B9WA 4EMHA 5GMKe 5LJ3g 3L1AA 2LCCA 2R5AA 3CEYA 4F7UE 2CGHA 1JJ2S 3MHXA 3OS5A 4A4FA 4RMOA 4JRKA 4C8QB 2K5LA 5LJ3f 5KCOA 1Y96B 2HQEA 3M5AA 5KE3A 2V8KA 3GF5A 2P0KA 4HKEA 1S72A 2R5MA 1U1TA 2BKDN 3CD6A 5GAN5 2ZZDA 2GFAA 3H6ZA 1XNIA 4OB3B 3OYJA 3OYBA 5GAN6 1NZ9A 2LC4A 2DK3A 4FT4A 1M1KC 1BIBA 3M4YA 3R6OA 4BI4A 1YCYA 4BB7A 1YJ9T 3JSCA 3CCMA 3GPLA 4ZN1A 3OYFA 5GANe 3JB9D 1BKBA 3JB9G 2OTLA 2RHIA 3H8ZA 5CR2A 1VQ8A 3L42A 3PIOA 3LX7A 1VQOT 1YBYA 1M9SA 4M7DB 1I5LA 2C06A 3OMGA 5L8RE 2XICA 2RB6A 4QVZA 3OYAA 2Y4YA 2ZPFB 4FT2A 1ZHIA 5LJ3d 1VQKT 1QW1A 2R58A 4BI8B 4C8QF 1JJ2A 3P8HA 1VQLA 5M9OA 2JOYA 1M8VA 2EQKA 2DD5A 1G3WA 2M9UA 5FU7B 4QVCA 2KK4A 2XDBA 3CCUT 1XTDA 2RHYA 5IN1A 3V8JA 2JN0A 3CCRA 5GAOm 4C8QA 3A8GB 3ZBDA 1Y96A 4A4KA 2DXTA 2FL7A 3HFNA 2CZ6B 3ZEHA 2KMTA 3HPWA 5GAOl 5A2QE 4ELYC 1Q86C 2ZPHB 5LJ3j 3LGFA 4IUQA 1UGRB 3CBOA 2AHJB 2XHCA 5CAIA 2MMPA 1Y71A 3PNWC 3UWNA 2QQ9A 4M7DF 3OYMA 1O9SA 3V8KA 1YHQT 4C0DB 4UC4A 3A8HB 1OI1A 1W4SA 3CPWA 2JZ2A 1G5VA 1KHCA 1M4ZA 1VQ9T 4M7DA 4O6JA 4DOVA 1WPYA 4C8QC 2RHUA 1G3YA 5DLOA 2QA4A 4BUGA 4BY6B 3JCMc 3FEOA 2H3JA 1VIEA 3TEEA 3X20B 5KH6A 3CC7A 3LWHA 2G3RA 3DLLA 3L2VA 2DTHA 1N6AA 2K5IA 2KVQG 3S3OA 5IT9E 1KG1A 4RG2A 1K73U 2L89A 3NTKA 2LT4A 4Y91A 3OYNA 1RL2A 3QHSA 5LJ5g 4M7AB 5CVIA 3RESA 3DLMA 4FL6A 5GMKm 2LX9A 4MZTA 3CXCS 1JBMA 5LJ5f 3JCMg 3NFCA 4BD3A 4M7DC 5GMKl 2Y4XA 1YJWA 4BACA 2EQUA 4OB2B 4HT9A 4N4HA 1U1SA 4VUBA 4M75E 3JCMf 2DIGA 4OB1B 3RKYA 4RCBA 2E6NA 3FLGA 4BDYA 4HCZA 5FU7C 4M77F 1RI0A 4Q5WA 4HT8A 2QQAA 2P0QA 3JCMQ 1QP3A 2VXEA 3OQ5A 2MWOA 2WSFE 1YJ9A 3CCLA 2EJGA 1XQHA 4M78G 4M78D 2K57A 2QDYB 4ZTFA 1QVFS 5I2SA 1X75C 3HHTB 4DA4A 3FJPA 3CC2T 3HP9A 3LLRA 4D6WA 3CCST 4LD9K 3HSBA 2ZPBB 2GF7A 1KHIA 4HCCA 4L5GA 4PJOG 5LJ5d 5A0GA 4PJOD 4C5EA 5GMKi 1LOJA 2LDMA 3MP1A 3BDUA 4PLLA 3CXCA 4LDWA 1VQKA 2F5KA 2ZCFB 3JCMd 3CCJT 3CC4A 3P8BB 1BIAA 5CKHA 4C0DC 3V7SA 2LQKA 4M7AA 2RM4A 1BI2A 2IVWA 3L2ZA 3V7CA 2QQBA 5LJ3e 3OYCA 3LWIA 4ZTJA 1Q81U 5GANh 1Q7YU 2WSEE 2LT1A 3A8MB 2LTOA 3QG1A 4OGCA 5GAMg 4BY6C 5LJ5j 3QUIA 4F7UG 2PQWA 1X6OA 2XDPA 3OYGA 1G3SA 2GCXA 4EMKB 3A8LB 4XU0A 5FU6B 4M77E 3FB9A 4HA8A 2PUKB 3QYGB 2V8IA 1QVFA 4IUTA 3QSUA 2L5QA 3I56A 4E47A 3RMSA 1K8AC 3C95A 5HY6A 3SB2A 1YHQA 1K73C 3G7ZA 4M7AC 2K5FA 4OF1A 4JUVA 3QBYA 3WVDB 1KC8C 2E6ZA 3X28B 3UPUA 5CO7A 3EFSA 3M57A 3QJ6A 4E7IA 1UGQB 3MCAB 2YLBA 1VQ9A 1M5Q1 2PVDB 4E7KA 2QEXT 4MDWA 3M4GA 2RK1A 3HRSA 4YTLA 3GOXA 4XTYA 2RD1A 4JRPA 2XIDA 1QVGA 3JB9F 1WQ7A 4J6WA 4E7LA 1YITT 2HAXA 3BY7A 3PMIA 2EIFA 3FRNA 5GAMd 4QVDA 5HK0A 3LH0A 1BI1A 2WACA 4CI0C 4II1A 3M58A 3VV0A 2GQVA 1N9SA 2O01E 2YHTA 4MMKA 3RKWA 1YJNT 1U8RA 5LJ5h 3CPWS 4JS4A 5J26A 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MML A;  1HXD A;  2DZ9 A;  4M7D A;  1LNX A;  1WPY A;  2E10 A;  3HFO A;  4WF2 A;  2E41 A;  4C8Q C;  2EJ9 A;  4M7A E;  3JCM c;  4PJO D;  3RIR A;  4C92 B;  5GAN 3;  4JLI A;  4XTV A;  3QO3 A;  5GAO r;  5GMK h;  4F7U F;  2DTH A;  3SWN B;  4C92 D;  4C92 G;  3INZ A;  3JCM V;  5GAN 7;  4M77 A;  4NL2 A;  4J6Y A;  4Y91 A;  4C92 A;  1KQ1 A;  2ZGW A;  4A54 A;  3QHS A;  2DKG A;  3RUX A;  4A53 A;  5LJ5 g;  4HT9 A;  2EAY A;  4OP0 A;  2DJZ A;  4M7A B;  3V7R A;  4XTZ A;  3RES A;  2DEQ A;  4EMK C;  5GMK m;  4M78 E;  3V8L A;  3PGG A;  4X9D A;  1JBM A;  5LJ5 f;  1WNL A;  1H64 1;  3JCM g;  3JB9 H;  4M7A G;  1D3B B;  1WQW A;  4PNO A;  5GMK l;  4M7D C;  4M7A D;  1B34 B;  3JB9 J;  1U1S A;  4M75 E;  3JCM f;  4PJO E;  3RKY A;  3JCM h;  5LJ5 e;  4RCB A;  4EMG A;  5GAM j;  4XQ3 A;  2QTX A;  2EWN A;  3JCM J;  4M77 F;  4C8Q E;  4HT8 A;  4C92 F;  4M78 B;  4DQ2 A;  5I21 A;  3JCM e;  3JCM Q;  2VXE A;  3FIF A;  3JCM P;  4M77 C;  1I81 A;  3JCM X;  3AHU A;  1X01 A;  2E65 A;  2EJG A;  2HNI A;  4XU2 A;  4M78 G;  1TH7 A;  4M78 D;  2K57 A;  3JCM W;  4EMH A;  4M75 B;  4NOY A;  3BW1 A;  5GMK e;  3JB9 I;  3FJP A;  4PJO B;  5LJ3 g;  2DZC A;  3L1A A;  3HSB A;  4F7U E;  2CGH A;  4M75 G;  4M75 D;  3SWN A;  4PJO G;  4JRK A;  4C8Q B;  5LJ5 d;  5LJ3 f;  5GAO n;  4XTU A;  1Y96 B;  5GAO q;  4M75 A;  4XTW A;  1LOJ A;  2I2L A;  4XTX A;  5LJ3 h;  3BDU A;  2EJF A;  1HK9 A;  4J5Y A;  5GMK i;  5GAN g;  1MGQ A;  1U1T A;  4C8Q D;  4C8Q G;  3JCM d;  5GAN 5;  4M7A A;  1BIA A;  1JRI A;  3V7S A;  4M7D E;  2RM4 A;  5LJ3 e;  3L2Z A;  3V7C A;  5GAN f;  4J6X A;  5GAN 6;  3EFR A;  3BFM A;  2DXU A;  2Y90 A;  5GAN h;  4F7U B;  1D3B A;  5GAN 8;  1BIB A;  1B34 A;  1YCY A;  5GAM g;  4V2S A;  1I8F A;  3QUI A;  5LJ5 j;  4F7U G;  5GAN e;  3JB9 D;  3JB9 G;  4C92 C;  4EMK B;  4XU0 A;  4M77 E;  2E1H A;  3FB9 A;  4HA8 A;  3RKX A;  4C92 E;  4M75 F;  5GAM h;  1I5L A;  3SWN C;  4M78 A;  4XU1 A;  4M7D B;  2RB6 A;  3QSU A;  2E64 A;  4N0A A;  4X9C A;  4M7A F;  5LJ3 d;  4M7D D;  4M7D G;  3SB2 A;  2DTO A;  4C8Q F;  5GMK j;  2FYK A;  4RCC A;  1KQ2 A;  4M7A C;  1N9R A;  5GAN 4;  2YLC A;  3GIB A;  4JUV A;  2DVE A;  4PJO A;  5GAN 2;  4QVC A;  1M8V A;  3EFS A;  3JCM b;  2YLB A;  3V8J A;  2JN0 A;  1M5Q 1;  4M77 B;  5GAN d;  5GAO m;  4C8Q A;  1LJO A;  3M4G A;  2VXF A;  1Y96 A;  2DXT A;  3HFN A;  4NL3 A;  5GAO l;  4XTY A;  2RD1 A;  4M77 G;  4M77 D;  5DY9 A;  5GAO p;  3JB9 F;  1WQ7 A;  4J6W A;  5LJ3 j;  4M78 F;  3VU3 C;  3BY7 A;  5GAM d;  4QVD A;  5CAI A;  4M78 C;  5GAM f;  4F7U A;  3RER A;  2VC8 A;  4N0A C;  4M7D F;  1N9S A;  4PJO F;  2YHT A;  4XU3 A;  3V8K A;  4MMK A;  3RKW A;  5GAN j;  2RA2 A;  1I4K 1;  4JRI A;  4M75 C;  5LJ5 h;  2FB7 A;  4EMK A;  4PJO C;  2DTI A;  5GAM e; 
#chains in the Genus database with same CATH topology
 2M1H A;  4NS5 A;  2JVV A;  1V1C A;  2GTO A;  2EJ9 A;  3CCV T;  3QZ5 B;  3S3M A;  3C94 A;  4C92 D;  1I07 A;  1VOM A;  1SRL A;  2ZGW A;  3GP8 A;  1PRM C;  2X3W D;  2Z0W A;  1YI2 T;  1JQQ A;  2SEM A;  1X69 A;  1NPP A;  3CME Q;  1WJQ A;  2EQM A;  3OY9 A;  3VUZ A;  1YJW Q;  3LH5 A;  3OMC A;  2FZK B;  2HL3 A;  3UA7 A;  1Q81 R;  3VS6 A;  4PJO B;  2DZC A;  2X4W A;  3C4S A;  1IXD A;  5GAO q;  1VQ4 T;  2F1L A;  5IHK A;  1JRI A;  4M7D E;  4C5H A;  2VWF A;  3EGX B;  2Y90 A;  4F7U B;  1WFW A;  2QEX A;  4MZM A;  2DPP B;  3M0R A;  1QQJ A;  1SSH A;  1MMD A;  3C0C A;  4FW2 A;  1YIJ T;  1RI9 A;  3H0I A;  2DL4 A;  2FHD A;  1RAH B;  1YWO A;  4PLI A;  2NWM A;  2D6F A;  2W10 A;  3CMA Q;  4AG1 C;  2RH2 A;  3G4S Q;  2CUD A;  4M7A F;  2W0Z A;  4E7J A;  2YRV A;  4RCC A;  1N9R A;  1WHG A;  4PJO A;  1WGS A;  2XG8 D;  1UEB A;  3I56 Q;  2H8H A;  3THK A;  1C6V X;  1PNJ A;  4M77 D;  3X24 B;  2RQU A;  1VQ7 T;  1AEY A;  1KC8 U;  4MDX A;  1NJI C;  4F7U A;  2QGG A;  5HK3 A;  5CK9 A;  2LCL A;  2QAZ A;  1NM7 A;  3J7A F;  1M90 U;  4M7A E;  2K2V A;  1NYF A;  5GAO r;  1UTI A;  1OU8 A;  5KE2 A;  1GFD A;  4RTW A;  1GBQ A;  1T3S A;  4R56 A;  5IAY A;  5GAN 7;  3CME T;  1Q82 C;  3CCR Q;  2O9V A;  2KNB B;  2ZPG B;  3UT1 A;  2DO3 A;  3FDR A;  1YJW T;  2ZPI B;  3ME9 A;  1X27 A;  3HRT A;  4CRI A;  4JPB W;  3G6E Q;  3BDL A;  5GJW B;  6AT1 B;  5GAM j;  1RAG B;  3CCQ Q;  2NYS A;  2XDD A;  3OYE A;  5EG2 A;  1T0H A;  3OYD A;  2QA4 Q;  3I9Q A;  4NOY A;  1KIK A;  5D6W A;  4LDY A;  4PKC C;  5ECA A;  1B07 A;  3OYH A;  2DIQ A;  1BI0 A;  1JB0 E;  3S6W A;  3HSB A;  2RJF A;  4OVA A;  1D0Y A;  2PUO B;  2DL3 A;  2RHZ A;  3MET A;  2RI3 A;  1HK9 A;  2DJQ A;  3RBB B;  4C8Q G;  1N8R U;  1AHJ B;  2RJD A;  5GAN f;  3G1J A;  5GAN 8;  3CMA T;  3G4S T;  2LZ6 B;  2KR3 A;  4V2S A;  3BE3 A;  4C92 C;  3URG A;  3TVT A;  5AYF A;  2BTT A;  3I56 T;  3GBQ A;  3SWN C;  4XU1 A;  2RI5 A;  4M4Z A;  3UDC A;  1KC8 R;  1V76 A;  3LGL A;  1YJ9 Q;  4M7D D;  2DTO A;  1FMK A;  3A98 A;  1K9M C;  2YLC A;  3P8D A;  4N4G A;  3JCM b;  3HKS A;  1VQO Q;  1H8K A;  1Z9Z A;  5GAN d;  2YUO A;  5LL6 S;  4NL3 A;  1QP2 A;  1VQK Q;  2HKQ B;  1M90 R;  4Y28 E;  1DJ7 B;  1FYN A;  2KDS A;  2O4X B;  4WCI A;  4ATO A;  2DL5 A;  4PJO F;  4MZP A;  2QGF B;  2D0Q B;  3M0Q A;  4FYV B;  4LDV A;  4LNP A;  3CCR T;  2I0N A;  2VB6 A;  3IQL A;  4JS5 A;  4QW2 A;  1IHW A;  3OYK A;  3CCV A;  3OW2 P;  4F7U F;  1PKS A;  5FRM A;  3PMT A;  3L2R A;  4NL2 A;  1WA7 A;  2F2X A;  3G6E T;  4J7I A;  4OP0 A;  3V7R A;  4XTZ A;  3OB9 A;  3I5R A;  3CCQ T;  3V8L A;  3LW5 E;  4M7A D;  2X35 A;  1YI2 A;  2KRM A;  5GJV B;  4LUE A;  2QA4 T;  2DRK A;  3KBG A;  2IPO B;  1VQP A;  4PJO E;  2DAQ A;  5DM7 R;  2KEA A;  3FJ5 A;  1OZ3 A;  3M55 A;  4DQ2 A;  3ER0 A;  4M77 C;  1ABQ A;  1VQ6 A;  4XU2 A;  3QPH A;  1TH7 A;  1T0J A;  4B9W A;  3ULR B;  5LJ3 g;  3CEY A;  4F7U E;  3OS5 A;  2CP7 A;  5KE3 A;  2BKD N;  5GAN 5;  4OB3 B;  3OYJ A;  1NLP C;  3CC2 Q;  3OYB A;  1WHJ A;  5GAN 6;  2CT4 A;  1YJ9 T;  2J05 A;  3GPL A;  4ZN1 A;  2DNU A;  3JB9 G;  1QWE A;  3H8Z A;  2E4H A;  4JJC A;  3L42 A;  3LX7 A;  1VQO T;  5KYY B;  1Z9Q A;  3OMG A;  2XIC A;  1I5O B;  5L8R E;  4QVZ A;  3ZL7 C;  2EW3 A;  1VQK T;  4C8Q F;  1VQL A;  1RLQ C;  2JOY A;  5FU7 B;  2RHY A;  3V8J A;  2BZY A;  3ZBD A;  1A0N B;  1JJ2 P;  4WTO B;  3ZEH A;  2CZ6 B;  2KMT A;  2O88 A;  4ELY C;  4IUQ A;  1UGR B;  1W6X A;  4HCK A;  1Y71 A;  1KK7 A;  3PNW C;  2QEX Q;  1O9S A;  2COZ A;  4UC4 A;  2JJ9 A;  1RLP C;  1PRL C;  1W4S A;  1PD1 A;  1GCQ A;  5KYY A;  4PJN A;  1M3A A;  1MUZ A;  2RHU A;  5DLO A;  2RQR A;  3CPW P;  5KH6 A;  3EFO B;  3DLL A;  2KVQ G;  1N6A A;  3M0T A;  2LT4 A;  1LPL A;  4OMQ A;  5CVI A;  1UGV A;  1VQN Q;  2LX9 A;  5LJ5 f;  4J9C A;  4M7D C;  2MCN A;  1E6H A;  1YJW A;  4OB2 B;  1OQK A;  3JCM f;  4JZ4 A;  4RCB A;  3FLG A;  1UE9 A;  2QQA A;  3QWY A;  1XQH A;  1QVF S;  1D1B A;  5I2S A;  1LCK A;  3FJP A;  3CC2 T;  1WLP B;  2GF7 A;  2EYX A;  3PVQ A;  4HCC A;  4L5G A;  1BU1 A;  5LJ5 d;  4PJO D;  4C5E A;  2V1Q A;  4PFO A;  4FCY A;  2ZCF B;  3JCM d;  2JMA A;  5CKH A;  3V7S A;  1BI2 A;  2IVW A;  1K0X A;  3LWI A;  1K1Z A;  1U5S A;  3CXC P;  1ZUK A;  2YUQ A;  1G3S A;  1SHF A;  1QVF A;  2QK0 A;  2M51 A;  1ZUU A;  3I56 A;  1K73 C;  3D7S B;  4M7A C;  2E6Z A;  3X28 B;  4KH0 B;  5CO7 A;  1VQ9 A;  1UGQ B;  1OX9 A;  2QEX T;  4MDW A;  3M4G A;  2RK1 A;  2NUP B;  3GOX A;  2RD1 A;  1QVG A;  3JB9 F;  1Q95 G;  4J6W A;  2QG9 B;  4CC2 A;  3PMI A;  5GAM d;  5HK0 A;  2WAC A;  4CI0 C;  4II1 A;  1K8A R;  2O01 E;  4MMK A;  1U8R A;  5LJ5 h;  4DBQ A;  4MML A;  2BIV A;  2E70 A;  4HXJ A;  2VVK A;  1M1K R;  2ECZ A;  1VQN T;  2GFU A;  4AFQ C;  1ZUY A;  2G6F X;  4Z02 A;  3SHW A;  2DF6 A;  4DBR A;  3J80 E;  1H92 A;  2ZPE B;  2LNH B;  2NUP A;  1Q7Y C;  3CC7 Q;  1VYU A;  4EMK C;  4IUR A;  2XKO C;  3G6E A;  1Y07 A;  5J39 A;  1MV3 A;  5FU6 C;  1KD1 R;  3QDR B;  3CCQ A;  4AG2 C;  2KRO A;  5FRO A;  2PVO B;  1QCF A;  2RI2 A;  4C0G A;  2L0A A;  2KE9 A;  3VS2 A;  3JCM J;  2KI7 A;  1U06 A;  4M78 B;  2KT8 A;  4J9B A;  1UUE A;  2LJ1 A;  2E5K A;  2FEI A;  4KGX B;  3JB9 I;  4OMM A;  4AFZ C;  4O5V A;  3VUB A;  4M75 G;  1VYT A;  2DM1 A;  2FRY A;  1FX7 A;  4M75 A;  4P5N A;  4GBQ A;  2KBT A;  2MI6 A;  1TS9 A;  1UJ0 A;  2KYB A;  4LUD A;  2HBP A;  2XU8 A;  3QZ9 B;  3M0S A;  3MEA A;  4KGV B;  2PVG B;  2X4J A;  1VQP Q;  1ZBJ A;  3MEU A;  1J3T A;  4M78 A;  2RF0 A;  4ME7 A;  1VQO A;  4N0A A;  4PL6 A;  1VQ6 Q;  2DMO A;  2JNG A;  4R0K A;  3GIB A;  2A7Y A;  1WJS A;  3N5B B;  4LD6 A;  1E6G A;  4K11 A;  2P84 A;  2V1R A;  2XI9 A;  3L2U A;  1IB8 A;  1PKT A;  2DL8 A;  3EG3 A;  5CKD A;  3TCJ A;  5L23 A;  2K2M A;  4A4H A;  1RAB B;  2IG0 A;  3J81 E;  2CZ7 B;  3JRZ A;  2CUB A;  4J9G A;  1M8M A;  4PJO C;  3I55 A;  3EHR A;  1WIE A;  1HXD A;  2DZ9 A;  5CQY A;  2DXC A;  2L8D A;  3CC7 T;  1I1J A;  4A4E A;  2QYZ A;  3QO3 A;  4GY5 A;  1VQL Q;  2RQT A;  4KBM B;  3VS4 A;  4DEX A;  1M1G A;  1M2O A;  4PJL A;  3CBM A;  4KT0 E;  2CS7 A;  1QVG P;  2CDT A;  1D3B B;  3MP8 A;  2X4X A;  1JU5 C;  1QVP A;  4HVW A;  4C0Z A;  2M16 A;  1NEG A;  3AT1 B;  4ANJ A;  3FIF A;  2CZ1 B;  5CQX A;  3AHU A;  2E12 A;  4RKU E;  5D7U A;  1ZBX A;  3QXE B;  1BYM A;  1Y0M A;  2JW4 A;  1WJR A;  2X4Y A;  3CBP A;  3CC2 A;  4HVU A;  4XTU A;  3KXT A;  2DER A;  4QQD A;  1VQP T;  1D0Z A;  1OX8 A;  1UDL A;  2CSI A;  1CKA A;  3EGD B;  4OGE A;  3NTH A;  4E2F B;  4ZGJ B;  4ZGD B;  3VRZ A;  2RO0 A;  1D3B A;  1VQ6 T;  1PD0 A;  3KUF A;  3L2Q A;  4F14 A;  3RKX A;  1TSF A;  4KH1 B;  4M75 F;  2E64 A;  4X9C A;  3OW2 S;  2YRD A;  3VJP A;  3VYH B;  2HQH A;  5GAN 4;  2VYT A;  1RAI B;  4DOW A;  3M0P A;  3L2W A;  1LJO A;  2VXF A;  1PC0 A;  2X51 A;  2FPD A;  3EGD A;  2COY A;  4BE1 A;  1GL5 A;  4M78 F;  5D6X A;  3OYL A;  1GRI A;  2XD0 A;  1OV3 A;  4RTV A;  3S3N A;  1VQL T;  1VQM A;  3RDV A;  2DTI A;  3EG2 A;  3OW2 A;  2JTM A;  3REA B;  3OYY A;  4JLI A;  4XTV A;  1TU0 B;  5GMK h;  1FMV A;  4BI3 A;  1JEG A;  2KGT A;  3OSV A;  1VQN A;  3M9Q A;  1VQ9 Q;  1FXX A;  1KQ1 A;  4FSX A;  3RUX A;  1K76 A;  2YXY A;  2EAY A;  2DJZ A;  2KSS A;  4M78 E;  7AT1 B;  2L3P A;  1JXM A;  1MMN A;  2OX7 A;  4IIO A;  3X25 B;  8ATC B;  2EYQ A;  1Q86 U;  2QXF A;  4X34 A;  1VUB A;  1G2B A;  2E3H A;  2EYZ A;  2K6D A;  2JUF A;  3NHN A;  2E65 A;  4OMO A;  2MAM A;  4EMH A;  3L1A A;  1TXQ A;  2EVR A;  5KYX B;  2DIL A;  2CGH A;  1JJ2 S;  4RMO A;  4JRK A;  4C8Q B;  5LJ3 f;  4DBF A;  2HQE A;  3M5A A;  1AWX A;  4HKE A;  1U1T A;  2XMF A;  2GFA A;  3H6Z A;  2LC4 A;  1M1K C;  3M4Y A;  4BI4 A;  1YCY A;  4BB7 A;  3JSC A;  4RTZ A;  5GAN e;  1SEM A;  1TG0 A;  2RB6 A;  2HDA A;  2Y4Y A;  1AWO A;  5LJ3 d;  2NUZ A;  1JJ2 A;  2EQK A;  2DD5 A;  1G3W A;  2M9U A;  4QVC A;  5KYX A;  2HCK A;  1CSK A;  2JN0 A;  4C8Q A;  4A4K A;  2LJ0 A;  1UFF A;  2FL7 A;  3R6N A;  5GAO l;  1C0M A;  5IH2 A;  4J9E A;  1RAA B;  2K7A A;  2AHJ B;  5CAI A;  2MMP A;  2AK5 A;  3OYM A;  2LQW A;  1X43 A;  2KXD A;  3A8H B;  3TQ7 P;  3CPW A;  1G5V A;  1VQ9 T;  4DOV A;  4BY6 B;  2BZ8 A;  3JCM c;  2EYW A;  1NLO C;  3X20 B;  2HSE B;  1Q86 R;  3CC7 A;  2J6K A;  3L2V A;  2DTH A;  2K5I A;  2NUT B;  1ARK A;  3OYN A;  3QHS A;  1XJW B;  3DLM A;  5GMK m;  3CXC S;  2MPX C;  2DBM A;  5FWC A;  1GCQ C;  2Y4X A;  1Y57 A;  4BAC A;  2DIG A;  4OB1 B;  1BBZ A;  3RKY A;  2JMC A;  3VS3 A;  2E6N A;  4BDY A;  1YCS B;  4HCZ A;  2RMO A;  5FU7 C;  4HT8 A;  3I55 Q;  2JTE A;  2OJ2 A;  1W1F A;  2MWO A;  3EG0 A;  3QWX X;  2EJG A;  4M78 D;  1LVK A;  2QDY B;  1X75 C;  4D6W A;  1KHI A;  1D1A A;  2NUT A;  1LOJ A;  2LDM A;  3CXC A;  1ABO A;  3BDU A;  4LDW A;  2F5K A;  1CKB A;  1H3H A;  2EKH A;  2RM4 A;  1X2K A;  3EH1 A;  5GAN h;  2H3E B;  1S72 Q;  1N8R R;  2PZ1 A;  3QUI A;  2PQW A;  2XDP A;  3OYG A;  1WI7 A;  4XU0 A;  3PE0 A;  2CP5 A;  2PUK B;  3QYG B;  4IUT A;  2VKN A;  2ATC B;  3RMS A;  2OTL Q;  1JXO A;  4OF1 A;  3WVD B;  4E7I A;  2L3S A;  4ZNX A;  4OMN A;  3HRS A;  1QKX A;  4JRP A;  2D0N A;  4E7L A;  2O31 A;  2HAX A;  4F04 B;  3M58 A;  3MKD A;  5J26 A;  4JRQ A;  4IIM A;  4C5I A;  2EPD A;  3NTI A;  3U23 A;  3HFO A;  1SF9 A;  2F69 A;  2O2O A;  1R0C B;  2AZV A;  2CT3 A;  1RAD B;  2KQW A;  1UB4 A;  4C92 G;  1T3L A;  3OSS C;  4DEY A;  3JAM E;  2EQI A;  4C92 A;  5CKB A;  1Q81 C;  2DET A;  4A4G A;  2DEQ A;  2GGR A;  3I55 T;  1OPL A;  4XAX B;  2RHX A;  1WYX A;  2DD4 A;  5FLX E;  2CP6 A;  5LJ5 e;  4EMG A;  1NJI U;  1BCM A;  2EWN A;  1VQM Q;  1PHT A;  4C8Q E;  5A0D A;  3JCM e;  3VYG A;  2VGM A;  5KYU A;  2FPF A;  3VRY A;  4LN2 A;  1IZ6 A;  2HNI A;  3VKI A;  1UHC A;  1C1A A;  1FWZ A;  1D09 B;  1WXU A;  2GQI A;  4FIB A;  3CCL Q;  2V8J A;  1S72 T;  1N27 A;  5GAO n;  2I2L A;  2BUD A;  1PG5 B;  1G83 A;  1YP5 A;  1GCP A;  2PU9 B;  2BE7 D;  2YUN A;  1Q82 U;  1AWW A;  2A3L A;  3WXM B;  3BFM A;  1ACM B;  4BE0 A;  3Q1J A;  2OTL T;  1SPK A;  1IRX A;  9ATC B;  1N5Z A;  2A08 A;  2KT1 A;  3H0F A;  4C0F A;  1VIF A;  2ESW A;  2DXB A;  1YJN A;  1KQ2 A;  1KQS P;  3MEW A;  1MMG A;  2L3R A;  1PSE A;  4FYX B;  3CCE A;  1QVG S;  1YWP A;  4D8K A;  4KRT A;  4QQ6 A;  4M77 G;  3VU3 C;  1ZX6 A;  3M54 A;  1UGP B;  4M78 C;  4R55 A;  5GAM f;  1K0S A;  2ZAE A;  2BE9 B;  4N0A C;  3ZFJ A;  3HRU A;  2RA2 A;  1OPK A;  3JB9 H;  4KUL A;  1GXI E;  2C0O A;  1VQ5 A;  2B86 A;  1QMC A;  2RJE A;  1ZLM A;  2CKK A;  2A37 A;  2EYY A;  4JDS A;  5IHN A;  1W2B A;  1NJI R;  4PJM A;  1K9M U;  2K79 A;  2HQX A;  4A54 A;  2DKG A;  2HBW A;  3QII A;  1SSF A;  2OTJ A;  1VQM T;  4ELZ C;  1BI3 A;  3T9N A;  1BK2 A;  2QI2 A;  4J9D A;  1ZSZ B;  4GLK A;  3JCM h;  2HD0 A;  2YDL A;  4E6R A;  2L2P A;  1EIF A;  4FYY B;  4XQ3 A;  4FM4 B;  3CCL T;  4C92 F;  2FG0 A;  2C0I A;  1E7O A;  2QQS A;  2K4Y A;  3NMZ C;  4M75 B;  3SEM A;  4CC4 B;  2JXB A;  5A0L A;  4A63 B;  1F1B B;  1R77 A;  3O8V A;  4LDU A;  1NPR A;  1Y7X A;  2KY9 A;  4XTW A;  1KC8 C;  2YUP A;  4L59 A;  4BE2 A;  1MGQ A;  4C8Q D;  2R57 A;  4RTY A;  2VUB A;  2MF2 A;  1UGS B;  1XOV A;  3A8O B;  2DXU A;  2CRE A;  1QCO A;  1ZSZ A;  4J83 A;  2AKL A;  2NLU A;  3GNF B;  1UG1 A;  4X1V A;  2YSQ A;  1M90 C;  1AZG B;  1M1F A;  3H9N A;  2E1H A;  5GAM h;  1IGU A;  4C92 E;  1SKU B;  4FYW B;  8AT1 B;  3LYI A;  3EAE A;  2D1X A;  4E7H A;  2K3X A;  4M7D G;  4HCB A;  2FYK A;  2YT6 A;  1HJD A;  1JO8 A;  4QQG A;  5GAN 2;  4IKF A;  4D8D A;  4OB0 B;  1NEB A;  1SHG A;  3FC3 A;  3PT9 A;  3UF4 A;  1EFN A;  2FO0 A;  5GAO p;  2ABL A;  2LJ3 A;  4Z8A A;  2LMJ A;  4EPC A;  3I35 A;  3CCU Q;  3CPF A;  1AD5 A;  2VC8 A;  1SG5 A;  5GAN j;  3ASK A;  1I4K 1;  1K9M R;  3JB9 J;  5AT1 B;  2IIM A;  3SD4 A;  1SRM A;  2ENM A;  1RUW A;  2CZ0 B;  2KRS A;  2LNV A;  2LVM A;  2EKO A;  1UHF A;  1O75 A;  4OMF B;  3INZ A;  1N8R C;  1PWT A;  4IUP A;  2VGN A;  3OS2 A;  1NBE B;  3DB3 A;  4HT9 A;  1WDX A;  2A28 A;  2CYZ B;  1WZO A;  2QTV A;  3G71 A;  1NYG A;  2D8J A;  4X9D A;  1WNL A;  4M7A G;  3NPF A;  1WQW A;  3E19 A;  4Z88 A;  5EC7 A;  3M53 A;  1B7T A;  4LDX A;  3M56 A;  2E3I A;  1P92 A;  3MP6 A;  5I21 A;  4J7F A;  4CC7 A;  1I81 A;  3PFS A;  3VS0 A;  2GTJ A;  2RQW A;  3JCM W;  5GMK e;  2MYS A;  2R5A A;  1AZE A;  4A4F A;  1W2B P;  1UEC A;  3VS7 A;  3M0U A;  1S72 A;  2R5M A;  3REB B;  3MJX A;  1NZ9 A;  3CCS Q;  4QT7 A;  2DK3 A;  4FT4 A;  3CCM A;  3OYF A;  1M3C A;  2C0T A;  3JB9 D;  1BKB A;  2OTL A;  2FZG B;  5CR2 A;  1VQ8 A;  3PIO A;  1M3B A;  1I5L A;  4J9I A;  2C06 A;  4ESR A;  2ZPF B;  4FT2 A;  2CH4 W;  1QW1 A;  3P8H A;  2DBK A;  2AIR B;  1M2V A;  2KK4 A;  3CCU T;  1XTD A;  5IN1 A;  3A8G B;  3O5Z A;  2DXT A;  1TTH B;  2D8H A;  1TOV A;  2AKK A;  2ED0 A;  4PFP A;  2ZPH B;  1EZZ B;  2VAS A;  4RTT A;  3LGF A;  2EGE A;  3UWN A;  4M7D F;  4C0D B;  1OI1 A;  1M4Z A;  4O6J A;  2HMA A;  1WPY A;  4C8Q C;  2J6F A;  4BUG A;  3FEO A;  2H3J A;  1AVZ C;  2G3R A;  1YJN Q;  4Z89 A;  1D1C A;  3S3O A;  5IT9 E;  1KG1 A;  1K73 U;  3H41 A;  3NTK A;  4Y91 A;  3VS1 A;  3E2U A;  3A1P A;  3CCE Q;  1QLY A;  1MND A;  3RES A;  4FL6 A;  3I5S A;  1D0X A;  4MZT A;  2HSP A;  1JBM A;  5I11 A;  2CP0 A;  3NFC A;  2GBQ A;  5KYN A;  2COW A;  2EQU A;  4N4H A;  1U1S A;  4M75 E;  1GBR A;  2P4R A;  5I22 A;  1ZSG A;  2P0Q A;  1QP3 A;  2VXE A;  2SRC A;  2WSF E;  3CCL A;  4ZTF A;  1VQ5 Q;  3HP9 A;  3LLR A;  3CCS T;  4LD9 K;  4PJO G;  2DA9 A;  5GMK i;  3MP1 A;  1R0B G;  2RPN A;  3P8B B;  4OML A;  2LQK A;  2OTJ Q;  5LJ3 e;  3OYC A;  3L2Z A;  2QQB A;  1Q7Y U;  2LT1 A;  3CD6 Q;  4BY6 C;  3CQT A;  5LJ5 j;  2PNI A;  4F7U G;  1OUL A;  3EGX A;  3A8L B;  3FB9 A;  4HA8 A;  3QSU A;  3PVL A;  1K8A C;  3C95 A;  3SB2 A;  1YHQ A;  2K5F A;  4JUV A;  3QBY A;  3EFS A;  3M57 A;  2MOX A;  1M5Q 1;  2PVD B;  2A36 A;  4YTL A;  4XTY A;  1WHM A;  2DEU A;  1X6B A;  4RUG A;  3EG1 A;  2EIF A;  2J7I A;  3FRN A;  4QVD A;  3VV0 A;  2GQV A;  2K3B A;  2YHT A;  1K73 R;  3RKW A;  1QKW A;  1YJN T;  4FW1 A;  3CPW S;  1GFC A;  4JS4 A;  2HKN A;  1KD1 C;  1IHV A;  4KUD K;  1BCO A;  3OBY A;  4WF2 A;  3C12 A;  2E41 A;  3CCE T;  5GAN 3;  5CKF A;  1MNE A;  2OI3 A;  1M30 A;  1ZQ1 A;  4ZN3 A;  4RG8 A;  3EG9 B;  2RNA A;  4PK4 A;  2K9G A;  2P0P A;  3NGP A;  3QDF A;  2DYI A;  2DVJ A;  3PGG A;  1H64 1;  4PNO A;  3OS1 A;  1VQ5 T;  1FMW A;  3CCJ A;  1TWB A;  2M0O A;  3SFM A;  2D9T A;  2QTX A;  3DB4 A;  1PSF A;  2DRM A;  2LRQ A;  2O9S A;  4JJN K;  1Q7Y R;  3OBW A;  1KQS S;  4HVV A;  3HL8 A;  2OTJ T;  2JM9 A;  3BW1 A;  4KUI A;  4LXC A;  4M75 D;  5KCH A;  3WVE B;  3CD6 T;  3EG9 A;  2ROT A;  4XTX A;  5LJ3 h;  5HKC A;  2EJF A;  2VV5 A;  4JZ3 A;  4ZGE B;  3G71 Q;  3EGU A;  4J6X A;  4J9F A;  1MHN A;  3TU4 K;  1NE8 A;  1RAC B;  1U3O A;  3CC4 Q;  4N4I A;  1YIT A;  4ORZ A;  2EQJ A;  3H0H A;  1WHL A;  3E9F A;  1KQS A;  3F70 A;  3GLX A;  2KXC A;  4J8O A;  2DVE A;  1R8O B;  4IUV A;  4KGZ B;  4B9X A;  4QKU A;  3RR6 A;  5IXF A;  2KAF A;  3QYH B;  3CCU A;  5DY9 A;  3DKM A;  2JTF A;  4JJD A;  1H3Z A;  2JS0 A;  4BDZ A;  2DL7 A;  3CCM Q;  5C0M A;  2O4X A;  2FB7 A;  5FRN A;  1VQ8 Q;  4JLG A;  5J3B A;  5CIU A;  1LNX A;  2DX1 A;  2E10 A;  1WXB A;  4L6V 5;  2F2V A;  3EH2 A;  3RIR A;  4C92 B;  1X6G A;  4TVR A;  4EDU A;  4RTU A;  3SWN B;  5IHI A;  3OS0 A;  3JCM V;  5C6S A;  2XK0 A;  2EFI A;  4F16 A;  1WX6 A;  2ED1 A;  5D6Y A;  2KRN A;  3E1S A;  2YRC A;  3VS5 A;  1B34 B;  3E9G A;  3OA6 A;  2OAW A;  5KYU B;  1VQ4 A;  1UJY A;  2QAS A;  2A0F B;  2QQR A;  2CH4 A;  3X26 B;  1YN8 A;  1NG2 A;  2YWW A;  4XK8 E;  2HEQ A;  3JCM X;  1AWJ A;  3RMQ A;  2FVU A;  1S1N A;  3G71 T;  1YIJ A;  5FWB A;  1HYO A;  3MPU B;  3SWN A;  4JJB A;  3CCS A;  3CC4 T;  3QKJ A;  4J5Y A;  5GAN g;  4C5G A;  1YNZ A;  1OZ2 A;  1PCX A;  2WSC E;  3EFR A;  3KFV A;  1B34 A;  1OU9 A;  3TRE A;  2P4T A;  1I8F A;  2F2W A;  1VQ7 A;  4AFU C;  2B8A A;  1V29 B;  1ZA2 B;  4RTX A;  2L3Q A;  5FW9 A;  1TUG B;  3PTA A;  2RK2 A;  1K4U S;  5GMK j;  3PIP A;  5I2M A;  2RQV A;  2LQN A;  3MEV A;  1G3T A;  1IRE B;  4M77 B;  1AT1 B;  2LX7 A;  2AT1 B;  2MWP A;  3CCM T;  5CKE A;  1ZSZ C;  4LE9 A;  1HSQ A;  1K8A U;  3JV3 A;  1VQ8 T;  3A5Z B;  3CME A;  3RER A;  2RJC A;  3QJY A;  4XU3 A;  4JRI A;  4M75 C;  1M1K U;  5CCA A;  1WHK A;  1OYX A;  5GAM e;  2X3X D;  1EX4 A;  3RNJ A;  4FU6 A;  2F5T X;  2PTK A;  2EGA A;  2FPE A;  1YHQ Q;  1VYV A;  2GNC A;  2BZX A;  1W2B S;  1PM3 A;  4F17 A;  4IUU A;  1KD1 U;  4M77 A;  4J6Y A;  2OAU A;  2JM8 A;  1M27 C;  1OEB A;  3EFO A;  4A53 A;  1QWF A;  3HTR A;  5DLQ E;  2DYB A;  4EIK A;  2DE0 X;  2E5Q A;  1KJW A;  2HZY A;  2MIO A;  3OYI A;  2K3Y A;  1WXT A;  3GNG A;  3JCM P;  3CMA A;  3G4S A;  3MO8 A;  1X01 A;  3M59 A;  2LQ8 A;  3SDZ A;  1AOJ A;  1VA7 A;  4AMC A;  2LCC A;  2FZC B;  2EBP A;  3MHX A;  4CC3 A;  1HD3 A;  2K5L A;  5KCO A;  1Y96 B;  1MV0 B;  3UA6 A;  2V8K A;  3GF5 A;  1YFN A;  1ZA1 B;  2P0K A;  4AFS C;  5KYW B;  5IXB A;  3CD6 A;  2ZZD A;  1G8X A;  1XNI A;  4GLM A;  2V26 A;  1BIB A;  1IO6 A;  3R6O A;  4PJJ A;  2EGC A;  1B3Q A;  1Q82 R;  2RHI A;  3CCJ Q;  1KFZ A;  2JS2 A;  1YBY A;  1M9S A;  4M7D B;  2QDL A;  2DFU A;  3OYA A;  2CP2 A;  1ZHI A;  2R58 A;  4BI8 B;  3TSZ A;  5M9O A;  1M8V A;  2XDB A;  3CCR A;  1W70 A;  5GAO m;  1Y96 A;  3HFN A;  3HPW A;  5KYW A;  5A2Q E;  1TUD A;  1Q86 C;  4E7S A;  5LJ3 j;  2CSQ A;  3CBO A;  2XHC A;  2FRW A;  2QQ9 A;  1I0C A;  3V8K A;  1YHQ T;  4FSS A;  2JZ2 A;  1YIT Q;  1KHC A;  1RAE B;  4M7D A;  1G3Y A;  2QA4 A;  2M02 A;  1QCN A;  1VIE A;  3TEE A;  3LWH A;  1TUC A;  4Y92 A;  2M0Y A;  4OMP A;  4RG2 A;  2L89 A;  2MK5 A;  1RL2 A;  4E7Z A;  5LJ5 g;  2J6O A;  2LCS A;  4M7A B;  3CCV Q;  4DBH A;  2CP3 A;  2HL5 C;  3JCM g;  4BD3 A;  5GMK l;  4J9H A;  1MMA A;  2AZS A;  4VUB A;  2J06 A;  4PFZ A;  4M77 F;  1RI0 A;  4Q5W A;  1YI2 Q;  3JCM Q;  1KSW A;  1X2Q A;  3OQ5 A;  1YJ9 A;  4AT1 B;  4M78 G;  2K57 A;  4B6M A;  3HHT B;  4DA4 A;  2ZPB B;  2X9H A;  2DLP A;  5A0G A;  3TSW A;  4PLL A;  1VQK A;  3CCJ T;  3CC4 A;  4M7A A;  1BIA A;  4C0D C;  2ROL A;  1Q81 U;  3V7C A;  4ZTJ A;  5HCK A;  2WSE E;  3A8M B;  2LTO A;  3QG1 A;  4OGC A;  5GAM g;  1K9A A;  1X6O A;  2RN8 A;  1VQ4 Q;  1WHH A;  2GCX A;  4EMK B;  3EHQ A;  5FU6 B;  4M77 E;  2V8I A;  2JT4 A;  1M2V B;  2L5Q A;  4E47 A;  5HY6 A;  3G7Z A;  1IGQ A;  2KYM A;  1YIJ Q;  1QVF P;  3UPU A;  3QJ6 A;  3MCA B;  2YLB A;  4E7K A;  2XID A;  1WQ7 A;  1YIT T;  1RAF B;  3BY7 A;  3LH0 A;  2LP5 A;  1BI1 A;  1N9S A;  1BB9 A;  1OOT A;  3UAT A;  4EMK A;  1VQ7 Q; 
#chains in the Genus database with same CATH homology
 2M1H A;  1KD1 C;  4NS5 A;  4MML A;  2JVV A;  2BIV A;  4C5I A;  2E70 A;  3NTI A;  4KUD K;  3OBY A;  4WF2 A;  3C12 A;  3HFO A;  2E41 A;  2F69 A;  3CCE T;  2EJ9 A;  3CCV T;  5GAN 3;  5CKF A;  2KQW A;  2GFU A;  1VQN T;  4Z02 A;  3QZ5 B;  3S3M A;  1UB4 A;  3C94 A;  4C92 G;  4C92 D;  3J80 E;  1ZQ1 A;  4ZN3 A;  3OSS C;  4RG8 A;  3JAM E;  4C92 A;  2ZPE B;  5CKB A;  1Q81 C;  2ZGW A;  1Q7Y C;  3GP8 A;  4A4G A;  2P0P A;  2DEQ A;  4EMK C;  4IUR A;  2XKO C;  3G6E A;  1YI2 T;  3PGG A;  3I55 T;  1Y07 A;  5J39 A;  5FU6 C;  1H64 1;  3QDR B;  4PNO A;  4XAX B;  3CCQ A;  2RHX A;  3OS1 A;  1NPP A;  2DD4 A;  5FLX E;  5FRO A;  1VQ5 T;  2PVO B;  1WJQ A;  2RI2 A;  4C0G A;  5LJ5 e;  3CCJ A;  2EQM A;  2M0O A;  4EMG A;  1NJI U;  3SFM A;  2D9T A;  3OY9 A;  2QTX A;  2EWN A;  3DB4 A;  3JCM J;  3VUZ A;  1PSF A;  4C8Q E;  2LRQ A;  3OMC A;  4M78 B;  5A0D A;  3JCM e;  3VYG A;  2VGM A;  4JJN K;  1IZ6 A;  2HNI A;  3OBW A;  1KQS S;  3VKI A;  3HL8 A;  2OTJ T;  3BW1 A;  3JB9 I;  4PJO B;  1FWZ A;  4O5V A;  2DZC A;  2X4W A;  4KUI A;  3VUB A;  3C4S A;  4FIB A;  4M75 G;  4M75 D;  5KCH A;  3WVE B;  1S72 T;  2V8J A;  1N27 A;  5GAO n;  3CD6 T;  1FX7 A;  4M75 A;  5GAO q;  2I2L A;  4XTX A;  5LJ3 h;  2BUD A;  2EJF A;  4P5N A;  5HKC A;  1VQ4 T;  2PU9 B;  2VV5 A;  2MI6 A;  4ZGE B;  1JRI A;  4M7D E;  4C5H A;  1Q82 U;  2A3L A;  4J6X A;  3WXM B;  3BFM A;  1MHN A;  2Y90 A;  4F7U B;  3TU4 K;  4BE0 A;  2HBP A;  2XU8 A;  1NE8 A;  3Q1J A;  3QZ9 B;  4MZM A;  2QEX A;  2OTL T;  2DPP B;  3MEA A;  2PVG B;  4N4I A;  2X4J A;  1YIJ T;  3MEU A;  1YIT A;  2EQJ A;  2FHD A;  3E9F A;  4PLI A;  1KQS A;  2D6F A;  3F70 A;  4M78 A;  3GLX A;  4ME7 A;  1VQO A;  4N0A A;  4C0F A;  2RH2 A;  4M7A F;  1VIF A;  4PL6 A;  4E7J A;  2JNG A;  2YRV A;  4RCC A;  1YJN A;  2DXB A;  4J8O A;  1KQ2 A;  1N9R A;  2A7Y A;  1WJS A;  3GIB A;  4PJO A;  2DVE A;  1WGS A;  1R8O B;  3N5B B;  4LD6 A;  4IUV A;  2XG8 D;  4B9X A;  3MEW A;  2L3R A;  1UEB A;  1PSE A;  2KAF A;  3QYH B;  2XI9 A;  3CCU A;  3L2U A;  3CCE A;  1QVG S;  4QQ6 A;  3X24 B;  4M77 G;  4M77 D;  5DY9 A;  5CKD A;  3DKM A;  1VQ7 T;  3TCJ A;  2JTF A;  3VU3 C;  4A4H A;  1KC8 U;  2IG0 A;  4MDX A;  3M54 A;  1UGP B;  4M78 C;  3J81 E;  4R55 A;  2CZ7 B;  4F7U A;  5GAM f;  1NJI C;  1H3Z A;  3JRZ A;  4N0A C;  5HK3 A;  4BDZ A;  3ZFJ A;  5CK9 A;  3HRU A;  2LCL A;  2RA2 A;  5C0M A;  2O4X A;  2FB7 A;  4PJO C;  3JB9 H;  3I55 A;  5FRN A;  4KUL A;  1GXI E;  1HXD A;  2DZ9 A;  4JLG A;  5J3B A;  5CQY A;  5CIU A;  1LNX A;  2E10 A;  2DXC A;  2L8D A;  3J7A F;  1M90 U;  1VQ5 A;  3CC7 T;  4M7A E;  4L6V 5;  2K2V A;  3RIR A;  4A4E A;  4C92 B;  2RJE A;  5GAO r;  3QO3 A;  2CKK A;  4JDS A;  5KE2 A;  4TVR A;  4GY5 A;  4EDU A;  4KBM B;  3SWN B;  3OS0 A;  4R56 A;  3JCM V;  5IAY A;  5GAN 7;  1W2B A;  3CME T;  5C6S A;  1Q82 C;  2XK0 A;  1K9M U;  1M1G A;  2HQX A;  4A54 A;  2EFI A;  2DKG A;  3CBM A;  3QII A;  1SSF A;  2ZPG B;  3UT1 A;  2DO3 A;  2OTJ A;  4KT0 E;  1VQM T;  3FDR A;  2CS7 A;  1YJW T;  5D6Y A;  2ZPI B;  4ELZ C;  1BI3 A;  3T9N A;  3ME9 A;  1D3B B;  3E1S A;  3MP8 A;  2X4X A;  2QI2 A;  3HRT A;  1B34 B;  3E9G A;  3OA6 A;  1QVP A;  4GLK A;  3JCM h;  4CRI A;  2HD0 A;  1VQ4 A;  3BDL A;  5GAM j;  1EIF A;  4XQ3 A;  4C0Z A;  2M16 A;  2QQR A;  4FM4 B;  3CCL T;  3X26 B;  4C92 F;  2XDD A;  3OYE A;  3FIF A;  2CZ1 B;  4XK8 E;  5CQX A;  5EG2 A;  3JCM X;  3AHU A;  2E12 A;  3RMQ A;  3OYD A;  4RKU E;  2QQS A;  1ZBX A;  2FVU A;  2K4Y A;  4M75 B;  4NOY A;  3G71 T;  1YIJ A;  3QXE B;  5D6W A;  5A0L A;  4LDY A;  4EMK A;  1BYM A;  4PKC C;  1WJR A;  3OYH A;  2X4Y A;  2DIQ A;  3CBP A;  1BI0 A;  3O8V A;  1JB0 E;  4LDU A;  3S6W A;  1NPR A;  3SWN A;  1Y7X A;  2KY9 A;  2RJF A;  3CCS A;  3CC2 A;  4OVA A;  4XTU A;  2PUO B;  2RHZ A;  4XTW A;  3KXT A;  3QKJ A;  3CC4 T;  3MET A;  2RI3 A;  4J5Y A;  1HK9 A;  4QQD A;  5GAN g;  4L59 A;  4C5G A;  4BE2 A;  1VQP T;  1MGQ A;  4OGE A;  4C8Q D;  4C8Q G;  3NTH A;  4ZGJ B;  1N8R U;  1AHJ B;  2R57 A;  2VUB A;  1OZ2 A;  2MF2 A;  1UGS B;  1XOV A;  2RJD A;  4ZGD B;  5GAN f;  3A8O B;  2WSC E;  3EFR A;  2DXU A;  2RO0 A;  1D3B A;  5GAN 8;  3CMA T;  3G4S T;  1B34 A;  1VQ6 T;  4V2S A;  3TRE A;  2P4T A;  1I8F A;  4J83 A;  3GNF B;  2NLU A;  3KUF A;  4C92 C;  3L2Q A;  3URG A;  1VQ7 A;  5AYF A;  1M90 C;  2B8A A;  1M1F A;  1V29 B;  2E1H A;  5GAM h;  3I56 T;  3RKX A;  4C92 E;  4M75 F;  3SWN C;  4XU1 A;  2RI5 A;  3LYI A;  2E64 A;  3EAE A;  3UDC A;  3PTA A;  2RK2 A;  4X9C A;  4E7H A;  2K3X A;  3LGL A;  3OW2 S;  4HCB A;  4M7D D;  2DTO A;  4M7D G;  5GMK j;  3VJP A;  2FYK A;  3VYH B;  3PIP A;  1K9M C;  5GAN 4;  2VYT A;  2YLC A;  5I2M A;  4QQG A;  5GAN 2;  4IKF A;  3P8D A;  4N4G A;  3MEV A;  4OB0 B;  1G3T A;  3HKS A;  4DOW A;  1IRE B;  3JCM b;  4M77 B;  5GAN d;  3L2W A;  1LJO A;  3FC3 A;  2VXF A;  3PT9 A;  2MWP A;  3CCM T;  5LL6 S;  4NL3 A;  5CKE A;  1QP2 A;  5GAO p;  1K8A U;  4BE1 A;  4Y28 E;  1VQ8 T;  1DJ7 B;  4M78 F;  5D6X A;  4EPC A;  3OYL A;  2KDS A;  2O4X B;  3A5Z B;  4ATO A;  3CME A;  3RER A;  3CPF A;  2RJC A;  2VC8 A;  2XD0 A;  5GAN j;  4PJO F;  3QJY A;  4XU3 A;  3S3N A;  3ASK A;  4MZP A;  1I4K 1;  4JRI A;  4M75 C;  1VQM A;  1M1K U;  1VQL T;  5CCA A;  2DTI A;  2D0Q B;  5GAM e;  1OYX A;  3JB9 J;  4LDV A;  3SD4 A;  3OW2 A;  2JTM A;  3CCR T;  2CZ0 B;  2LNV A;  2LVM A;  2EKO A;  4JS5 A;  4FU6 A;  2F5T X;  3OYY A;  4QW2 A;  4JLI A;  4XTV A;  3OYK A;  1O75 A;  5GMK h;  3CCV A;  4OMF B;  4F7U F;  4BI3 A;  1W2B S;  3OSV A;  5FRM A;  1VQN A;  3M9Q A;  3INZ A;  1N8R C;  3PMT A;  4IUU A;  3L2R A;  4M77 A;  4NL2 A;  4J6Y A;  1KD1 U;  2OAU A;  4IUP A;  1FXX A;  1KQ1 A;  2VGN A;  4FSX A;  3G6E T;  4A53 A;  3RUX A;  3OS2 A;  4J7I A;  3DB3 A;  2EAY A;  4OP0 A;  2CYZ B;  2DJZ A;  2KSS A;  4XTZ A;  3V7R A;  3OB9 A;  3G71 A;  5DLQ E;  4M78 E;  3CCQ T;  3V8L A;  4X9D A;  1WNL A;  3LW5 E;  4M7A G;  4M7A D;  3X25 B;  1WQW A;  3E19 A;  2X35 A;  1YI2 A;  3M53 A;  2EYQ A;  1Q86 U;  2QA4 T;  3KBG A;  1VQP A;  2E5Q A;  4PJO E;  4LDX A;  2DAQ A;  5DM7 R;  2QXF A;  3M56 A;  1OZ3 A;  4X34 A;  1VUB A;  1P92 A;  3M55 A;  3MP6 A;  3OYI A;  2K3Y A;  4DQ2 A;  5I21 A;  3ER0 A;  3GNG A;  3JCM P;  4J7F A;  4M77 C;  3CMA A;  3G4S A;  1I81 A;  3MO8 A;  3PFS A;  2JUF A;  1VQ6 A;  1X01 A;  2E65 A;  3M59 A;  3QPH A;  1TH7 A;  2LQ8 A;  4XU2 A;  3SDZ A;  3JCM W;  2MAM A;  4B9W A;  4EMH A;  5GMK e;  5LJ3 g;  3L1A A;  2LCC A;  2R5A A;  3CEY A;  4F7U E;  2CGH A;  1JJ2 S;  3MHX A;  3OS5 A;  4A4F A;  4RMO A;  4JRK A;  4C8Q B;  2K5L A;  5LJ3 f;  5KCO A;  1Y96 B;  2HQE A;  3M5A A;  5KE3 A;  2V8K A;  3GF5 A;  2P0K A;  4HKE A;  1S72 A;  2R5M A;  1U1T A;  2BKD N;  3CD6 A;  5GAN 5;  2ZZD A;  2GFA A;  3H6Z A;  1XNI A;  4OB3 B;  3OYJ A;  3OYB A;  5GAN 6;  1NZ9 A;  2LC4 A;  2DK3 A;  4FT4 A;  1M1K C;  1BIB A;  3M4Y A;  3R6O A;  4BI4 A;  1YCY A;  4BB7 A;  1YJ9 T;  3JSC A;  3CCM A;  3GPL A;  4ZN1 A;  3OYF A;  5GAN e;  3JB9 D;  1BKB A;  3JB9 G;  2OTL A;  2RHI A;  3H8Z A;  5CR2 A;  1VQ8 A;  3L42 A;  3PIO A;  3LX7 A;  1VQO T;  1YBY A;  1M9S A;  4M7D B;  1I5L A;  2C06 A;  3OMG A;  5L8R E;  2XIC A;  2RB6 A;  4QVZ A;  3OYA A;  2Y4Y A;  2ZPF B;  4FT2 A;  1ZHI A;  5LJ3 d;  1VQK T;  1QW1 A;  2R58 A;  4BI8 B;  4C8Q F;  1JJ2 A;  3P8H A;  1VQL A;  5M9O A;  2JOY A;  1M8V A;  2EQK A;  2DD5 A;  1G3W A;  2M9U A;  5FU7 B;  4QVC A;  2KK4 A;  2XDB A;  3CCU T;  1XTD A;  2RHY A;  5IN1 A;  3V8J A;  2JN0 A;  3CCR A;  5GAO m;  4C8Q A;  3A8G B;  3ZBD A;  1Y96 A;  4A4K A;  2DXT A;  2FL7 A;  3HFN A;  2CZ6 B;  3ZEH A;  2KMT A;  3HPW A;  5GAO l;  5A2Q E;  4ELY C;  1Q86 C;  2ZPH B;  5LJ3 j;  3LGF A;  4IUQ A;  1UGR B;  3CBO A;  2AHJ B;  2XHC A;  5CAI A;  2MMP A;  1Y71 A;  3PNW C;  3UWN A;  2QQ9 A;  4M7D F;  3OYM A;  1O9S A;  3V8K A;  1YHQ T;  4C0D B;  4UC4 A;  3A8H B;  1OI1 A;  1W4S A;  3CPW A;  2JZ2 A;  1G5V A;  1KHC A;  1M4Z A;  1VQ9 T;  4M7D A;  4O6J A;  4DOV A;  1WPY A;  4C8Q C;  2RHU A;  1G3Y A;  5DLO A;  2QA4 A;  4BUG A;  4BY6 B;  3JCM c;  3FEO A;  2H3J A;  1VIE A;  3TEE A;  3X20 B;  5KH6 A;  3CC7 A;  3LWH A;  2G3R A;  3DLL A;  3L2V A;  2DTH A;  1N6A A;  2K5I A;  2KVQ G;  3S3O A;  5IT9 E;  1KG1 A;  4RG2 A;  1K73 U;  2L89 A;  3NTK A;  2LT4 A;  4Y91 A;  3OYN A;  1RL2 A;  3QHS A;  5LJ5 g;  4M7A B;  5CVI A;  3RES A;  3DLM A;  4FL6 A;  5GMK m;  2LX9 A;  4MZT A;  3CXC S;  1JBM A;  5LJ5 f;  3JCM g;  3NFC A;  4BD3 A;  4M7D C;  5GMK l;  2Y4X A;  1YJW A;  4BAC A;  2EQU A;  4OB2 B;  4HT9 A;  4N4H A;  1U1S A;  4VUB A;  4M75 E;  3JCM f;  2DIG A;  4OB1 B;  3RKY A;  4RCB A;  2E6N A;  3FLG A;  4BDY A;  4HCZ A;  5FU7 C;  4M77 F;  1RI0 A;  4Q5W A;  4HT8 A;  2QQA A;  2P0Q A;  3JCM Q;  1QP3 A;  2VXE A;  3OQ5 A;  2MWO A;  2WSF E;  1YJ9 A;  3CCL A;  2EJG A;  1XQH A;  4M78 G;  4M78 D;  2K57 A;  2QDY B;  4ZTF A;  1QVF S;  5I2S A;  1X75 C;  3HHT B;  4DA4 A;  3FJP A;  3CC2 T;  3HP9 A;  3LLR A;  4D6W A;  3CCS T;  4LD9 K;  3HSB A;  2ZPB B;  2GF7 A;  1KHI A;  4HCC A;  4L5G A;  4PJO G;  5LJ5 d;  5A0G A;  4PJO D;  4C5E A;  5GMK i;  1LOJ A;  2LDM A;  3MP1 A;  3BDU A;  4PLL A;  3CXC A;  4LDW A;  1VQK A;  2F5K A;  2ZCF B;  3JCM d;  3CCJ T;  3CC4 A;  3P8B B;  1BIA A;  5CKH A;  4C0D C;  3V7S A;  2LQK A;  4M7A A;  2RM4 A;  1BI2 A;  2IVW A;  3L2Z A;  3V7C A;  2QQB A;  5LJ3 e;  3OYC A;  3LWI A;  4ZTJ A;  1Q81 U;  5GAN h;  1Q7Y U;  2WSE E;  2LT1 A;  3A8M B;  2LTO A;  3QG1 A;  4OGC A;  5GAM g;  4BY6 C;  5LJ5 j;  3QUI A;  4F7U G;  2PQW A;  1X6O A;  2XDP A;  3OYG A;  1G3S A;  2GCX A;  4EMK B;  3A8L B;  4XU0 A;  5FU6 B;  4M77 E;  3FB9 A;  4HA8 A;  2PUK B;  3QYG B;  2V8I A;  1QVF A;  4IUT A;  3QSU A;  2L5Q A;  3I56 A;  4E47 A;  3RMS A;  1K8A C;  3C95 A;  5HY6 A;  3SB2 A;  1YHQ A;  1K73 C;  3G7Z A;  4M7A C;  2K5F A;  4OF1 A;  4JUV A;  3QBY A;  3WVD B;  1KC8 C;  2E6Z A;  3X28 B;  3UPU A;  5CO7 A;  3EFS A;  3M57 A;  3QJ6 A;  4E7I A;  1UGQ B;  3MCA B;  2YLB A;  1VQ9 A;  1M5Q 1;  2PVD B;  4E7K A;  2QEX T;  4MDW A;  3M4G A;  2RK1 A;  3HRS A;  4YTL A;  3GOX A;  4XTY A;  2RD1 A;  4JRP A;  2XID A;  1QVG A;  3JB9 F;  1WQ7 A;  4J6W A;  4E7L A;  1YIT T;  2HAX A;  3BY7 A;  3PMI A;  2EIF A;  3FRN A;  5GAM d;  4QVD A;  5HK0 A;  3LH0 A;  1BI1 A;  2WAC A;  4CI0 C;  4II1 A;  3M58 A;  3VV0 A;  2GQV A;  1N9S A;  2O01 E;  2YHT A;  4MMK A;  3RKW A;  1YJN T;  1U8R A;  5LJ5 h;  3CPW S;  4JS4 A;  5J26 A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...