4C8QG

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
69
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNRKLGLTVIRGTILVSLSSAEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 11
structure length 69
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qG00
4C8QF 3L2ZA 5LJ3f 5GMKh 2YLBA 1WNLA 4M77E 3EFRA 5GAOr 3JCMQ 4HA8A 3RKXA 1B34A 4M7AE 1I81A 3FJPA 5DY9A 2E1HA 3QHSA 5GAMg 4V2SA 5GAOp 4DQ2A 4PJOA 3VU3C 1D3BA 3SB2A 3RIRA 1YCYA 1LOJA 2DKGA 4PJOG 3JB9D 1BIAA 2E64A 3JCMg 5GAN6 3JCMf 4M7DA 4PJOC 2VC8A 4M75D 2HNIA 2EJ9A 1N9SA 4C8QA 2I2LA 5LJ5f 5GAMf 4M75B 4M7AB 4M78E 4JRKA 2EWNA 4MMLA 3AHUA 3V8LA 1H641 5GAN3 4C92G 2QTXA 3JCMe 4M7AD 5GANf 5GAN7 5LJ3g 2DVEA 5GANg 4A53A 5GANj 3JB9J 3BY7A 4PJOE 4HT9A 2CGHA 4M78D 5GAMe 1I4K1 4C92F 3INZA 4J6YA 2DTIA 3RKYA 4MMKA 5GMKi 4F7UB 5LJ3e 2DJZA 5GAN2 4PJOF 2DXUA 3V7CA 5CAIA 3PGGA 5GAN4 4M7AA 1LJOA 2DEQA 3BDUA 4C92D 5GAOq 3JCMP 3RESA 4M78F 4M7AG 4M7DF 3SWNA 4M7AC 1M5Q1 4F7UG 5GMKm 3SWNC 3V8KA 5LJ3d 2DXTA 2EJGA 1I5LA 2FYKA 1KQ1A 3V7RA 3JCMb 1WQ7A 4M7DD 1LNXA 1Y96A 4XTWA 2K57A 3JCMh 5LJ5j 4N0AA 1JBMA 3JB9G 4PJOD 2DZ9A 4XQ3A 1U1TA 5LJ5h 3BFMA 5GMKe 5GAMh 4C8QG 4WF2A 2YLCA 1D3BB 4XU1A 5LJ3h 4M7DE 2DZCA 4NOYA 3JCMW 3M4GA 3RKWA 2RM4A 5GANh 4M7AF 5GAOn 4XU2A 4XU3A 3JCMV 4QVCA 1N9RA 4M78A 4M77C 3JCMc 5GAOl 2EAYA 2VXEA 5GAN5 4QVDA 2DTHA 4J5YA 4M77A 4M75F 2RA2A 4X9CA 2VXFA 4EMKC 4EMGA 4EMKA 3JCMX 3JB9F 4PNOA 5GANd 4OP0A 2YHTA 3RUXA 5I21A 4HT8A 3GIBA 4F7UA 4NL3A 4JRIA 4XTVA 3JCMJ 4J6XA 5LJ5g 4C92C 4J6WA 4M77B 4NL2A 3RERA 2RD1A 2ZGWA 1JRIA 5LJ3j 3QUIA 4C92E 3QO3A 4M77F 4A54A 3JCMd 4M7DB 4M78C 2DTOA 4XU0A 4RCCA 4XTZA 2RB6A 1BIBA 1Y96B 4M78G 3QSUA 4XTYA 1WQWA 4JUVA 4M75C 4C8QB 5LJ5d 4JLIA 1WPYA 4XTXA 1HXDA 4M75A 5GAMj 5GAMd 3HFOA 3JB9H 4RCBA 4C8QE 3HFNA 2E41A 3L1AA 4XTUA 4C8QD 2Y90A 1X01A 3EFSA 2E10A 3V8JA 2FB7A 4M77D 5GMKj 1MGQA 4C92B 4EMHA 1TH7A 5GAN8 1I8FA 1U1SA 4F7UF 3BW1A 4Y91A 5LJ5e 4N0AC 3JB9I 2E65A 4M7DG 3FB9A 4M75G 2JN0A 4M7DC 3FIFA 4M78B 4M75E 1B34B 3HSBA 1M8VA 4F7UE 4M77G 5GANe 2EJFA 4C8QC 1HK9A 3SWNB 4PJOB 3V7SA 5GMKl 1KQ2A 4EMKB 4C92A 4X9DA 5GAOm
chains in the Genus database with same CATH superfamily
4FT2A 2IG0A 1UGSB 3VYGA 2XD0A 2LNHB 2J7IA 4GY5A 5GJVB 2EQIA 3GOXA 1N6AA 2EYWA 3TSZA 5AT1B 2DKGA 4M7DA 3JCMf 2LJ3A 2XI9A 4DBRA 3FC3A 2P84A 4FYWB 2RK1A 1S72A 2A7YA 2DFUA 2QA4Q 1ZLMA 2D8HA 4PLLA 3EGDB 2XMFA 1IHVA 4FW1A 2ED1A 3EHQA 2QYZA 2RMOA 2IIMA 1GCPA 5A0GA 2WSCE 1GBQA 4ORZA 1PRMC 5KYYB 3M0TA 3GPLA 4LXCA 3E9FA 4C0FA 1JBMA 1A0NB 2QGFB 2ZPBB 2K9GA 5KH6A 3VS3A 1SF9A 4F04B 2QQAA 1TU0B 1C0MA 2MF2A 5FU7B 1GCQA 4OVAA 2OTJQ 3I9QA 4PLIA 3DLMA 3QJ6A 3OW2P 2KT8A 3PMTA 2FVUA 2BKDN 1VA7A 4GLKA 3KUFA 3LWIA 1MUZA 1T0JA 6AT1B 4RG2A 1N8RC 1RADB 1KSWA 4XTYA 4QQGA 4BI8B 4AT1B 3CBOA 3QYHB 1H3HA 4OMNA 3UPUA 2YUQA 4JDSA 2DXCA 1KC8C 1JO8A 1Z9ZA 1ZX6A 3M59A 3TU4K 2E65A 3OYIA 1N27A 1VOMA 1KHIA 3CD6T 2DIGA 4BE1A 3PNWC 1EIFA 1GRIA 2ATCB 4LNPA 4LDXA 1G3TA 1HSQA 5DY9A 1YI2A 2EGAA 3NHNA 2ABLA 4DQ2A 1O9SA 2CP0A 1KD1R 2XU8A 3X26B 2E64A 1M90R 2NUPB 3SHWA 4Z89A 9ATCB 4KH0B 4C5EA 5FRMA 2EWNA 2E6NA 1W4SA 4BE0A 3ER0A 3JCMe 1ZSGA 1SHFA 1K76A 3QG1A 1AHJB 1YJWT 3BY7A 5GAMe 3HHTB 3ZEHA 5GMKi 1VQMT 1GCQC 2A0FB 3LW5E 3PGGA 5KYUA 3BDUA 2Y4YA 4PJMA 3I56Q 3FDRA 1VQMA 1KG1A 2FYKA 4D6WA 2O2OA 1LNXA 1M27C 1QWFA 4HVVA 2PVDB 1K73C 1BBZA 2DZ9A 3OS0A 3OYLA 2CSIA 2ZAEA 2YLCA 2XDPA 1Q82U 2KXCA 4E7JA 2L3PA 2DTHA 1IHWA 1AEYA 1HYOA 4M75F 3G1JA 2O31A 4ESRA 4UC4A 3A8LB 1QVFS 1D1BA 2AKKA 2EGCA 4OMFB 1I0CA 1B3QA 3MP1A 2KNBB 2BZXA 1M3BA 3JCMd 3OYMA 1Y96B 3M57A 5L23A 1VQ8A 1OOTA 3M4YA 4M75A 2NUTA 5I2SA 3GF5A 3X24B 2M02A 2Y90A 4LDYA 2CZ1B 3EGUA 2EW3A 2RHIA 3VJPA 1NPPA 3C0CA 4C8QC 1WJRA 5KYYA 2QEXA 5GAOr 1Q7YU 3G71Q 4B9XA 1C6VX 1WXUA 3FJPA 3QHSA 4HCCA 2QQSA 2I0NA 4OMPA 4C0GA 1YJ9Q 4J9IA 4KGXB 4PJOC 1BI3A 1QVGP 1DJ7B 4J9GA 1VQ5T 4M7AB 1W1FA 4ZN3A 1U5SA 3UT1A 3AHUA 3LH5A 2HSEB 2QTXA 3VS1A 5C0MA 3URGA 2LQWA 2HCKA 5A2QE 3HRTA 4OMLA 1VQ9A 1E6GA 2YSQA 2RQTA 4F7UB 3G6EA 2CP7A 4C92D 4A4HA 4KH1B 5CK9A 1Y57A 2OTLT 2V8IA 3EHRA 1EFNA 4Y28E 3CC4T 3E1SA 4C0DC 1D1CA 1IRXA 3M4GA 1M4ZA 2K79A 1SG5A 3JCMc 4RKUE 1RUWA 1S72Q 2V8JA 1B7TA 3R6OA 4J9DA 4IURA 3GIBA 1W2BA 2B86A 2K3XA 1ZUYA 1G3YA 4M77B 2ZGWA 3WXMB 1TOVA 4FSSA 4RCCA 2HQHA 2MPXC 5IT9E 4FT4A 1VQ7T 5KYXB 3OBYA 2CUBA 1WHLA 3OQ5A 1T0HA 1D0ZA 3H0FA 4C92B 1OZ3A 4ELZC 3HRSA 3DLLA 2DM1A 3RMQA 1YNZA 3FIFA 1VQPQ 2QQBA 1SSFA 1ZSZC 3FLGA 4OF1A 1TWBA 1AZGB 1JEGA 2C0TA 2ECZA 5CKEA 2ROTA 2R58A 2AHJB 1VQ6A 3P8HA 1QCFA 3ASKA 1VYVA 2E1HA 4M4ZA 3VU3C 3CCSA 3GLXA 1NM7A 2KRSA 4OB0B 4B6MA 1UHCA 3GBQA 4C92G 4OB2B 2MMPA 3NGPA 4JS5A 1YHQT 1VQ7A 2G3RA 2FPFA 1TUGB 3N5BB 4PKCC 4M7AC 1PG5B 5GMKm 4BDZA 3DB3A 2A3LA 3EAEA 4MZPA 2A08A 3HL8A 3TREA 3OYHA 2EQUA 4OMOA 4LDVA 2ENMA 1X2QA 5HCKA 4AFQC 3TVTA 3OYKA 4XU1A 3CMEA 4NOYA 3OBWA 1Q7YR 3QDFA 2DJQA 4XU3A 1KD1C 4JJBA 2RH2A 3BE3A 2C06A 4O6JA 1J3TA 3F70A 2BE9B 5GANd 1MV0B 2DETA 4FIBA 4FSXA 2YHTA 4NL3A 3CQTA 2CKKA 2K5LA 2FZKB 2YUPA 1M2OA 4F17A 2CT3A 2F5KA 2KYBA 4LDUA 2K3YA 2VGNA 3REBB 2M0YA 4CC7A 3KFVA 4JS4A 5CKBA 1X43A 5DM7R 4QQDA 4EIKA 5GAN8 3OYEA 2RHUA 4E6RA 1JXMA 4M75E 4BY6C 4A63B 2RQRA 4LE9A 2E12A 3CCQA 2ZPIB 3CMAQ 2A28A 1QP3A 2FG0A 4KUDK 2O4XB 2KK4A 5GAMg 3RDVA 3SB2A 2ZPEB 3CCUT 5IAYA 5FWBA 1M3CA 1AWWA 4JZ3A 5IXFA 1K0SA 2LMJA 3CCRA 1NJIU 2P4RA 3VRYA 4M78E 2HMAA 2RI3A 5GAN3 2OTJT 4J8OA 2COZA 2V1RA 3JSCA 2HEQA 5GAN7 1PWTA 2DTIA 4LDWA 3OYYA 2CZ0B 5IHKA 3JCMP 3M0SA 4IKFA 1AVZC 4DBQA 5LJ3d 3CCVT 1I5LA 2YUOA 3PIOA 2AK5A 4M7DD 2RQVA 4ZGEB 1Y07A 4RTUA 2QEXQ 1WJQA 2MCNA 1YITT 5FLXE 1QW1A 4BB7A 2PUOB 1UEBA 1D3BB 1W2BS 4M7DE 2BZ8A 3FEOA 1YITQ 1H3ZA 1X6GA 3VS4A 2J06A 5HKCA 1UFFA 5CKDA 3MJXA 4N4IA 1VQ4Q 3J80E 2HD0A 1K1ZA 3EFOA 3CCET 2AZVA 1FWZA 3M53A 2BZYA 3I5RA 3M5AA 4FL6A 5LJ5g 3CBMA 4J6WA 2CP5A 3QUIA 3D7SB 4QW2A 1K9AA 5GAMd 2E6ZA 3SEMA 2E10A 4QQ6A 1QVFP 4AMCA 1G8XA 1C1AA 4LD6A 4DEYA 2DK3A 4R0KA 1B34B 4RTZA 1WHJA 3LGLA 4RTTA 3L2RA 1YI2Q 4EMKB 1FMVA 4C8QF 3NPFA 1M90C 3LLRA 2YLBA 2X4XA 3OYGA 5HK3A 1MNDA 1ZUUA 1WX6A 2J05A 1CSKA 3PFSA 4BY6B 2DA9A 3AT1B 4QVZA 1W2BP 2CUDA 2VC8A 2P0QA 3OS1A 2DX1A 2EJ9A 2HL3A 2V1QA 4RUGA 5LJ5f 3GP8A 3OY9A 1GXIE 2K4YA 3NTIA 4ELYC 1VIEA 2JMAA 3M55A 2QEXT 5GANj 2X51A 1LCKA 1I4K1 3INZA 4J6YA 3G4SQ 1GFDA 2DXUA 2JTMA 3V7CA 4Z8AA 1E6HA 1X75C 2FPDA 4PJNA 4Z88A 1YCSB 1NZ9A 3P8DA 2GF7A 2HKNA 3J7AF 4DBHA 1I07A 3CC7Q 1ZSZA 3MP8A 3SD4A 5D7UA 3THKA 4J9BA 2VASA 2L5QA 3M0PA 3IQLA 1M2VB 4X34A 3CCSQ 3JAME 4DOWA 1G2BA 5GAOn 4M7AF 2L2PA 3EG3A 2AIRB 3OYJA 2RN8A 1AWXA 3CC2T 2DYBA 4YTLA 2KXDA 3A98A 2LQKA 1PSEA 3A5ZB 1QKXA 1K0XA 1VQNQ 2CDTA 2JM8A 4P5NA 5CCAA 2LQ8A 3EGXB 1NEBA 2NWMA 1BKBA 2QK0A 3QO3A 5IH2A 4M78C 2RHZA 3QSUA 2RQUA 2RI5A 4PFZA 2GFUA 3TSWA 3EFSA 1AD5A 4OGCA 4ANJA 2VUBA 2PTKA 2VWFA 3QDRB 1WA7A 1XJWB 2X4YA 5LJ5e 4BI3A 4LN2A 3QWXX 1RAEB 1B07A 4M77G 4F7UE 1TS9A 4MDXA 1RAFB 3HPWA 1SHGA 5D6YA 3UF4A 1YJ9A 5IHNA 2CH4A 2L0AA 3JCMQ 4ZTJA 1I81A 5KYWA 1UGPB 2XDDA 5GAOp 3M0UA 2HSPA 4KT0E 5GAN6 3PTAA 1K73U 2H3JA 3MP6A 2MIOA 2EBPA 5FW9A 1YJ9T 2GNCA 3CCMA 3PE0A 2WSFE 2E5QA 3M56A 2L3QA 3G6EQ 4GLMA 1PHTA 2EYYA 1SKUB 3QYGB 4MZTA 2JTEA 4PJOE 2DO3A 5LJ3e 2LJ1A 2YXYA 1YJNQ 1PNJA 1OULA 3QWYA 4JJCA 1KC8R 2Z0WA 1M2VA 5GJWB 3V7RA 2AKLA 2M51A 1N5ZA 3Q1JA 4AG1C 3CC2Q 4N0AA 1U06A 2D0NA 4MDWA 3VKIA 1GBRA 8ATCB 2XG8D 2ESWA 2K2VA 1AOJA 1YI2T 2V8KA 3CCLA 4E7KA 4J5YA 3PVLA 2VXFA 2X3WD 1K9MU 4EMGA 2R5MA 2E3IA 4OP0A 1U3OA 1VQ8Q 1PRLC 3LYIA 1IO6A 4TVRA 4BACA 1WXBA 1UGRB 2JMCA 4HCBA 1WFWA 1WXTA 5KE2A 3VYHB 4XTZA 2AZSA 4C8QB 2DNUA 4XTXA 4R55A 2BTTA 1UECA 1ARKA 3H41A 3VS2A 5CKFA 1I5OB 1M1KR 2JZ2A 4M77D 1OZ2A 3SDZA 4M7DG 2CZ6B 3H9NA 1JQQA 5GMKl 3EFOB 3R6NA 4WCIA 4AFSC 2LQNA 1T3SA 2FHDA 2JTFA 4E7IA 4V2SA 4QT7A 2RHYA 1MMAA 2JNGA 1TUDA 3JCMg 3OS2A 1MNEA 4M75D 1FX7A 1NYFA 3C4SA 4WTOB 1V1CA 5FRNA 1H641 2RJFA 4M7AD 3OYNA 2V26A 2FO0A 5KCHA 4IUQA 4F14A 2DJZA 3QKJA 1VQ8T 1BCMA 1PCXA 4FYXB 2DILA 4JRPA 2EJGA 1LVKA 2CYZB 3OYBA 1WQ7A 1Y96A 3JCMh 5KCOA 5GAMh 4WF2A 1X2KA 2NUPA 1AWJA 2DPPB 2LCLA 3OYAA 1N9RA 1WJSA 4M77C 3M58A 5GAOl 2VXEA 4ATOA 4M77A 4FU6A 1K73R 1WHGA 2X35A 3ME9A 4JZ4A 2HL5C 2M1HA 3PMIA 4QKUA 2QDLA 2KRMA 3I56A 3U23A 1Q86C 4NL2A 2DIQA 2P4TA 1VQOQ 4LD9K 2F1LA 4A54A 1ZA1B 2DLPA 1UUEA 3QBYA 2PQWA 2CP6A 1M30A 3L1AA 3QZ9B 2LCSA 1TSFA 1U1SA 4A4FA 3CD6A 2YRCA 1NPRA 3M54A 4XAXB 3HSBA 4RTXA 4LUDA 2EJFA 2KGTA 3S3NA 1QKWA 4XK8E 3S3MA 1W70A 1NJIR 3RKXA 3CCUA 1N8RU 1OEBA 4CC4B 4PJOA 3RIRA 1RAAB 5KE3A 5HK0A 2MWPA 4IUUA 2K3BA 2BUDA 5GAMf 3QIIA 4ZNXA 4JRKA 5LL6S 4F16A 4J7FA 1PKSA 3CC4A 1CKAA 5LJ3g 2DVEA 3ZBDA 2DD4A 1VQNT 4C92F 2EPDA 4PJOF 1VQKT 3I55A 3OW2A 2BE7D 4PFPA 1RABB 4M78F 4M7DF 2OTLQ 4F7UG 1UB4A 4JPBW 1NYGA 2MOXA 3G71A 5CVIA 1XOVA 4HVWA 2K57A 4E47A 1VQ9T 1TXQA 1X27A 5LJ5j 4PJOD 1KQSP 3KBGA 3ULRB 4KBMB 5LJ5h 5AYFA 4C8QG 4L5GA 1UJYA 1Y71A 3JCMW 3RKWA 4BE2A 1QLYA 4M78A 2LTOA 2F69A 5GAN5 1ZSZB 4N4GA 4KULA 1PC0A 3KXTA 2RA2A 4EMKC 4RMOA 2GBQA 3O5ZA 2X4JA 4BI4A 3EG1A 3RNJA 1R8OB 2GQIA 3LH0A 2XKOC 1QQJA 4XTVA 4Q5WA 4HXJA 2K6DA 2E5KA 1MMGA 4C92E 2FL7A 4JJDA 3P8BB 2RNAA 2YUNA 1M8MA 2LP5A 1HXDA 1Q82R 4C8QD 1SSHA 2X3XD 1WYXA 2DRKA 3VV0A 4C5HA 5GMKj 5HY6A 1I8FA 2EKOA 3CMAA 2KEAA 1KQSS 4Y91A 4ZGDB 2JN0A 2KE9A 3UATA 3OYFA 4PJOB 2KRNA 1KQ2A 2DL4A 1GL5A 4MZMA 4K11A 2LX9A 1Q95G 1IGQA 3A8MB 1E7OA 3MEWA 3JB9D 2K5IA 2L3RA 3MKDA 4DBFA 4C8QA 2I2LA 1UHFA 3OMCA 1VQOT 3CPWA 4HKEA 5KYWB 3OMGA 3MEAA 1Q81C 5IXBA 1HD3A 5GANg 4KUIA 2XICA 2SEMA 1ABQA 4IUTA 2RJDA 3UWNA 2DEQA 1OU8A 1YITA 3MPUB 1NEGA 2JXBA 2P0KA 1YIJT 2VV5A 3JB9G 2L8DA 2DBMA 2DE0X 2XK0A 1O75A 2NLUA 2FRWA 4IIMA 2DZCA 1M3AA 2O9VA 3JCMV 2LC4A 2M0OA 1PD0A 4X9CA 1QVGS 1VQ7Q 2R5AA 4J9HA 2DBKA 2JS0A 5I21A 4J83A 4AFUC 2O4XA 4IUPA 1Y0MA 1WZOA 5IHIA 3LX7A 4B9WA 2EYXA 3RERA 2EIFA 3DB4A 4RTYA 2VKNA 2KY9A 3PIPA 3JB9J 2CZ7B 4FM4B 2VYTA 3L42A 4EDUA 3CXCA 3CCEQ 1M90U 1VQ5Q 3X25B 4M75G 2NYSA 2M16A 5CQYA 1YHQQ 4PL6A 4C92A 4OMQA 3MEVA 3CCJA 1MMDA 1FMKA 3M0RA 1UGQB 2ZPHB 1D3BA 1YCYA 2DL8A 1IGUA 5CIUA 2ED0A 2HNIA 3G4SA 2RPNA 2OI3A 2LDMA 5I11A 3V8LA 1I1JA 3T9NA 3CCJT 2OAWA 1PM3A 1AZEA 1UJ0A 4MMKA 1ZA2B 2VVKA 4DEXA 2DAQA 2DERA 3EG9A 3CPWS 1QCNA 3G7ZA 1ZQ1A 3S6WA 3C94A 3CCUQ 3BFMA 1CKBA 4JLGA 2EYZA 4RG8A 2KR3A 3UA7A 3HTRA 2DL7A 2EGEA 3VUZA 5CKHA 4AFZC 5I22A 3OW2S 4XU2A 3E19A 3CCRQ 1AT1B 2KAFA 2MYSA 1T3LA 1QVFA 2OX7A 1BI2A 2GQVA 3CMET 1NLPC 3EGDA 4EMKA 2XHCA 3CC4Q 4L59A 3A8HB 1QWEA 1VQ4T 1JU5C 3A8GB 4Z02A 1G3WA 3RR6A 1R0CB 3QZ5B 4PK4A 4FCYA 1XNIA 3H0IA 3I55Q 4IUVA 2L89A 1JRIA 2DYIA 5CO7A 1BI0A 4XU0A 1WQWA 3E9GA 5GAOq 2LX7A 4X1VA 5EC7A 3HFOA 2E41A 3M0QA 4OB1B 1NJIC 1MGQA 1S1NA 1MV3A 3SFMA 2QXFA 1IXDA 4BD3A 3J81E 2D6FA 2VGMA 3WVDB 3UA6A 5J39A 3L2WA 3SWNB 2W0ZA 3V7SA 2WSEE 1OX9A 3A8OB 4KGVB 1WNLA 2IVWA 3CCMQ 2AT1B 3A1PA 1WGSA 3L2VA 2LZ6B 3CEYA 1WHHA 1BIAA 2CREA 4J9EA 1JJ2P 1X6OA 4MMLA 1VUBA 3I35A 5GANf 4LUEA 1FXXA 2CGHA 5I2MA 3CC2A 4A4GA 4CRIA 1BI1A 1FYNA 2O9SA 3NTKA 3LGFA 4EPCA 1VQKQ 1K8AR 3MHXA 3CCLQ 1QVGA 2D8JA 3JCMb 1YWOA 1ABOA 1ZUKA 3VRZA 1EX4A 1WI7A 2JVVA 3NTHA 4QVCA 1PSFA 4AG2C 2EQMA 3TEEA 7AT1B 2EAYA 1YN8A 2F2WA 3CC7T 3CXCS 3G4ST 1XQHA 4HT8A 1F1BB 1ZBJA 2CH4W 5KYUB 5FU7C 2L3SA 1Q7YC 2PZ1A 5FU6C 1RI0A 1WHKA 4M77F 1KIKA 3G6ET 2HAXA 3CD6Q 1BYMA 1WPYA 1BB9A 5GAMj 2JM9A 3CXCP 2EQJA 3HFNA 1D0XA 2LRQA 5A0DA 2D9TA 3CCLT 1VQLQ 4A4KA 3BW1A 3TCJA 1YJWQ 5GANe 3FRNA 1VYUA 4PJJA 2ZPGB 2KROA 2PNIA 4R56A 1B34A 1OPKA 1U8RA 3OA6A 2YDLA 3H6ZA 3G71T 2JW4A 3EGXA 2EVRA 3VS0A 2Y4XA 1WDXA 3I55T 1RAHB 2NUTB 4M75B 4JRQA 2HQXA 3CCVQ 5M9OA 1VQ6T 2H3EB 3HRUA 2EKHA 2GCXA 2CSQA 4A53A 3VS6A 3OYCA 4M78D 2JS2A 2LJ0A 2LVMA 3H0HA 1QVPA 5GAN4 1WIEA 2KT1A 1YHQA 3RESA 1JXOA 1NBEB 1M5Q1 2GGRA 1SPKA 2PUKB 3V8KA 2DL5A 4CC3A 3PT9A 1K9MR 1KQ1A 2A36A 3OSSC 4ZN1A 3META 5GMKe 2O01E 4A4EA 2CP3A 2RK2A 2DL3A 4KGZB 5LJ3h 3CCMT 1MHNA 2RM4A 1D1AA 1VIFA 2KBTA 5IN1A 2JOYA 2GTOA 4GBQA 1VQPT 3OS5A 3L2UA 3JCMX 2MAMA 4PNOA 2DMOA 2KVQG 3RUXA 1P92A 4F7UA 3O8VA 3CCRT 4JJNK 2MI6A 2MWOA 3CPWP 3PVQA 3EH2A 1H92A 3I56T 2HQEA 5LJ5d 1M1FA 3CBPA 3ZL7C 1X01A 2XIDA 4IIOA 5FU6B 4F7UF 3JB9I 1Y7XA 2F5TX 3FB9A 1SEMA 4C0ZA 3C95A 4E7LA 1Q81R 4RTVA 1UTIA 2O88A 1HK9A 4X9DA 5EG2A 1YWPA 1EZZB 4J7IA 3L2ZA 1W6XA 1IB8A 1RLQC 4BUGA 4M7AE 1ZHIA 1RI9A 1YIJQ 3UDCA 1SRLA 2RF0A 1Z9QA 5CR2A 1LOJA 4PJOG 1RLPC 2RO0A 3MO8A 1JB0E 1FMWA 2LT1A 5FWCA 3CMAT 4C5GA 1V29B 4HVUA 2CT4A 1KFZA 3HP9A 4CI0C 3RKYA 5GAN2 1KD1U 4M7AA 1Q82C 3SWNA 1KHCA 2ZPFB 2RQWA 2B8AA 1N8RR 3BDLA 5KYNA 4FYVB 1M9SA 3E2UA 4FYYB 1VQMQ 2OJ2A 5FROA 1KQSA 1QMCA 3EG9B 3RMSA 3X28B 2K5FA 2KI7A 2C0OA 3OYDA 1D09B 4KRTA 2NUZA 1KC8U 1K8AC 2YRVA 2KYMA 2A37A 1QP2A 4J6XA 3CPFA 2J6FA 1M1GA 3CCEA 5LJ3j 1PKTA 4M7DB 3QJYA 1VQKA 2ZZDA 4M78G 1BIBA 2HBWA 1M1KC 1TG0A 4JLIA 2QA4A 1D0YA 2QAZA 4RCBA 4C8QE 1AWOA 4XTUA 5L8RE 1V76A 4EMHA 2LCCA 1H8KA 2RHXA 3CCJQ 5ECAA 1M8VA 1IZ6A 3C12A 4II1A 1NE8A 1G5VA 4OMMA 2FEIA 3REAB 3VUBA 1X6BA 1VQLT 2KMTA 4M77E 1MMNA 2CP2A 1Q86U 2YRDA 2J6KA 4E7SA 1VQPA 4CC2A 1VQOA 1NLOC 2D0QB 1BCOA 2DRMA 3TQ7P 1M1KU 4ME7A 2H8HA 2OTJA 2SRCA 4FW2A 1N9SA 1YBYA 2DVJA 1WLPB 4D8DA 1RACB 2DXBA 1G3SA 2QG9B 1VQLA 2CS7A 5D6XA 1XTDA 1UG1A 3I5SA 4HT9A 3OB9A 4HCKA 1NG2A 4HCZA 5CAIA 4M7AG 1YJWA 2XDBA 3X20B 4O5VA 2DXTA 8AT1B 1JJ2S 2DEUA 3JV3A 2JJ9A 5DLOA 2RJCA 1RL2A 4XTWA 4RTWA 2C0IA 4DOVA 2KQWA 1K9MC 2QDYB 1U1TA 1BU1A 2DD5A 2E3HA 2PVOB 3EG0A 4E7ZA 5GANh 2ROLA 1R77A 1VYTA 3EH1A 5J26A 2DF6A 4E7HA 2VB6A 1OI1A 4QVDA 4J9CA 1IREB 3CCVA 2RJEA 3H8ZA 4Y92A 1OQKA 4DA4A 3CMEQ 2K7AA 2FPEA 5J3BA 2QA4T 1OPLA 2X9HA 3CCQT 2OTLA 5DLQE 1VQ5A 2KDSA 5CQXA 2GTJA 1OX8A 1RAGB 2F2VA 2RD1A 2FRYA 1ACMB 2QTVA 2M9UA 2DTOA 3VS7A 2HDAA 2P0PA 4JUVA 3JB9H 2COYA 3L2QA 4PFOA 1K8AU 3GNGA 4N4HA 2W10A 5A0LA 4C0DB 2YT6A 3HKSA 1K4US 1TH7A 5D6WA 1Q81U 2KSSA 4N0AC 2E70A 4M7DC 1QCOA 4M78B 3S3OA 2QQRA 4NS5A 3M9QA 1R0BG 2BIVA 2X4WA 5GAOm 2EYQA 4ZGJB 5LJ3f 5GMKh 3EFRA 3JRZA 1HJDA 2FZGB 4HA8A 1WHMA 3CC7A 2PU9B 4C5IA 3CCQQ 1G83A 2HZYA 4ZTFA 1VQ6Q 1KK7A 2G6FX 2JUFA 2EFIA 2QI2A 1YP5A 4BDYA 1RAIB 2HKQB 3LWHA 1UDLA 4VUBA 3WVEB 1ZBXA 2RI2A 1LJOA 3MEUA 3QPHA 1VQNA 2R57A 3SWNC 3QXEB 1JJ2A 1S72T 1BK2A 2QASA 3VS5A 3OSVA 4XQ3A 3RBBB 2GFAA 4E2FB 2PVGB 1OYXA 1YIJA 4D8KA 1Q86R 3MCAB 3ZFJA 2FZCB 2ZCFB 2F2XA 2QGGA 3CCST 2MK5A 2J6OA 3FJ5A 2E4HA 2IPOB 1UE9A 4OGEA 1X69A 3JB9F 2LT4A 1YJNT 2WACA 1OV3A 1PD1A 5KYXA 4JRIA 3JCMJ 2D1XA 2YWWA 4C92C 1GFCA 2OAUA 4J9FA 2K2MA 1VQ4A 1KJWA 3DKMA 3NMZC 2RB6A 1TTHB 4M75C 1LPLA 5C6SA 1TUCA 2COWA 3NFCA 2QQ9A 3V8JA 2FB7A 3GNFB 1OU9A 1VQ9Q 4L6V5 1SRMA 2JT4A 1UGVA 3EG2A 1YJNA 1YFNA 2LNVA 4OB3B 4PJLA 2HBPA 2EQKA
chains in the Genus database with same CATH topology
4FT2A 2IG0A 1UGSB 3VYGA 2ZPIB 2XD0A 1QP3A 4R56A 4GY5A 4KUDK 2O4XB 1B34A 3RKXA 3CCUA 1U8RA 3OA6A 3GOXA 2KK4A 1N8RU 5GAMg 1N6AA 3H6ZA 3G71T 4PJOA 3SB2A 3RIRA 2ZPEB 2DKGA 5KE3A 5HK0A 4M7DA 2MWPA 3JCMf 5IAYA 3CCUT 2XI9A 2Y4XA 4IUUA 3FC3A 3I55T 2BUDA 2RK1A 3CCRA 5GAMf 1S72A 3QIIA 4M75B 4JRQA 1NJIU 2A7YA 4M78E 4JRKA 5LL6S 2HQXA 2RI3A 4J7FA 5M9OA 5GAN3 1VQ6T 3CC4A 2OTJT 4PLLA 3HRUA 3JSCA 4J8OA 5GAN7 5LJ3g 2DVEA 2GCXA 2DD4A 3ZBDA 1VQNT 4A53A 3OYCA 4M78D 4C92F 2LVMA 2DTIA 4LDWA 1QVPA 4PJOF 5GAN4 3OYYA 2CZ0B 3I55A 3OW2A 1VQKT 5A0GA 3JCMP 2WSCE 3RESA 4M78F 1YHQA 4IKFA 4M7DF 1M5Q1 4F7UG 1UB4A 2PUKB 3V8KA 5LJ3d 3CCVT 1I5LA 3PIOA 3PT9A 3G71A 1KQ1A 3OSSC 5CVIA 3GPLA 1XOVA 4M7DD 2K57A 3E9FA 4C0FA 4ZGEB 3META 1Y07A 4E47A 4ZN1A 5LJ5j 1VQ9T 1JBMA 4PJOD 1WJQA 1YITT 3KBGA 2ZPBB 5FLXE 1QW1A 4KBMB 4BB7A 2PUOB 5GMKe 5LJ5h 2O01E 5AYFA 4C8QG 1UEBA 1D3BB 4L5GA 4A4EA 2RK2A 5LJ3h 5KH6A 1Y71A 3FEOA 3CCMT 3JCMW 4M7DE 1H3ZA 1MHNA 3RKWA 2QQAA 2RM4A 1W2BS 4BE2A 2MF2A 5FU7B 5HKCA 1VIFA 4OVAA 4M78A 2LTOA 5CKDA 2F69A 4PLIA 5GAN5 3DLMA 4N4IA 2JOYA 3QJ6A 4N4GA 4KULA 5IN1A 3KXTA 2RA2A 3J80E 4EMKC 4RMOA 3OS5A 3L2UA 1VQPT 2HD0A 3JCMX 2MAMA 4PNOA 3PMTA 2X4JA 4BI4A 3CCET 1FWZA 2KVQG 2FVUA 1R8OB 2BKDN 3RUXA 1P92A 3LH0A 2XKOC 3M53A 4F7UA 4GLKA 3O8VA 4FL6A 3M5AA 4XTVA 4Q5WA 5LJ5g 3CCRT 3KUFA 3CBMA 3LWIA 4J6WA 4JJNK 2MI6A 2MWOA 3QUIA 4C92E 2FL7A 4RG2A 1N8RC 3P8BB 4XTYA 2HQEA 4QW2A 4QQGA 4BI8B 5LJ5d 5GAMd 3I56T 1HXDA 1M1FA 2E6ZA 3CBOA 3CBPA 3QYHB 3UPUA 4C8QD 4JDSA 1X01A 2DXCA 2E10A 3VV0A 4QQ6A 4C5HA 5GMKj 1KC8C 5HY6A 2XIDA 1I8FA 2EKOA 3CMAA 5FU6B 4F7UF 4Y91A 3JB9I 1Y7XA 3M59A 3TU4K 2E65A 1KQSS 2F5TX 3FB9A 4LD6A 4ZGDB 2DK3A 2JN0A 4C0ZA 3OYIA 1B34B 3C95A 4E7LA 1N27A 3LGLA 3OYFA 3L2RA 1HK9A 1KHIA 4PJOB 3CD6T 1KQ2A 2DIGA 4EMKB 4BE1A 4X9DA 5EG2A 3PNWC 1EIFA 4C8QF 2QA4A 4J7IA 4MZMA 3L2ZA 3LLRA 1M90C 2YLBA 2LX9A 2X4XA 4LDXA 1G3TA 3OYGA 4BUGA 5HK3A 3A8MB 4M7AE 1ZHIA 5DY9A 1YI2A 3UDCA 2E12A 3PFSA 4DQ2A 3CCQA 1O9SA 4BY6B 3MEWA 1LOJA 2RO0A 3MO8A 2XU8A 4PJOG 2E64A 2K5IA 4QVZA 3X26B 3JB9D 1JB0E 2VC8A 2P0QA 3OS1A 2L3RA 2EJ9A 2LT1A 4C8QA 2I2LA 5LJ5f 3OMCA 4C5EA 3GP8A 5FRMA 1VQOT 3CPWA 4HKEA 2EWNA 2E6NA 3CMAT 3OMGA 3MEAA 3OY9A 1Q81C 1GXIE 1W4SA 2K4YA 4BE0A 3ER0A 3NTIA 3JCMe 4ELYC 1VIEA 4C5GA 1V29B 3M55A 2QEXT 3QG1A 4KUIA 2XICA 1AHJB 5GANg 5GANj 3BY7A 1YJWT 5GAMe 3HHTB 4IUTA 1I4K1 3HP9A 3INZA 2RJDA 4J6YA 3RKYA 3UWNA 3ZEHA 4CI0C 5GMKi 5GAN2 1VQMT 2DXUA 2JTMA 3V7CA 3LW5E 3PGGA 1KD1U 1Q82C 2DEQA 4M7AA 1X75C 3BDUA 2Y4YA 1YITA 3SWNA 1KHCA 2ZPFB 1NZ9A 2B8AA 3FDRA 1VQMA 1KG1A 3BDLA 3P8DA 2FYKA 2GF7A 4D6WA 2P0KA 1YIJT 1LNXA 2PVDB 2VV5A 1K73C 3J7AF 3JB9G 1M9SA 2DZ9A 2L8DA 3OS0A 3OYLA 3MP8A 3SD4A 2XK0A 1O75A 2NLUA 2YLCA 5FROA 2L5QA 2DZCA 1KQSA 4X34A 3RMSA 4DOWA 5GAOn 3JAME 4M7AF 3X28B 2XDPA 3JCMV 1Q82U 2LC4A 2M0OA 2K5FA 4E7JA 2DTHA 3OYDA 3OYJA 4M75F 4X9CA 1QVGS 3CC2T 4YTLA 2LQKA 4UC4A 1KC8U 1K8AC 2R5AA 2YRVA 1PSEA 3A8LB 5I21A 1QVFS 3A5ZB 4J83A 1QP2A 2O4XA 4IUPA 4OMFB 4J6XA 4P5NA 5CCAA 3CPFA 3LX7A 4B9WA 2LQ8A 3MP1A 3CCEA 1M1GA 3RERA 2EIFA 5LJ3j 3DB4A 1BKBA 3QO3A 3JCMd 4M7DB 3QJYA 1VQKA 4M78C 2KY9A 3OYMA 2RHZA 2ZZDA 3QSUA 4M78G 1BIBA 1Y96B 3M57A 3PIPA 1VQ8A 3JB9J 2CZ7B 2RI5A 3M4YA 4JLIA 1M1KC 4M75A 5I2SA 3GF5A 4FM4B 2VYTA 3L42A 4RCBA 2GFUA 3X24B 4C8QE 4XTUA 5L8RE 4EDUA 3CXCA 1M90U 2Y90A 3EFSA 3X25B 4OGCA 2VUBA 4EMHA 2LCCA 3QDRB 4LDYA 2CZ1B 2X4YA 2RHXA 5LJ5e 2RHIA 4BI3A 4M75G 3VJPA 2M16A 1M8VA 1NPPA 1IZ6A 5CQYA 4F7UE 4M77G 3C12A 4II1A 4MDXA 1NE8A 4C8QC 1G5VA 3HPWA 4PL6A 3VUBA 5D6YA 4C92A 1WJRA 3MEVA 1YJ9A 3CCJA 1VQLT 2KMTA 4M77E 2QEXA 5GAOr 1Q7YU 1Q86U 4B9XA 3JCMQ 4ZTJA 1I81A 3FJPA 1VQPA 1UGPB 3QHSA 2XDDA 4HCCA 5GAOp 1VQOA 1UGQB 2QQSA 2ZPHB 1D3BA 1YCYA 2D0QB 4KT0E 4C0GA 5GAN6 3PTAA 1M1KU 1K73U 4ME7A 2H3JA 4PJOC 1BI3A 5CIUA 2HNIA 3G4SA 2OTJA 3MP6A 1DJ7B 1N9SA 1YJ9T 1VQ5T 2LDMA 3CCMA 1YBYA 4M7AB 2WSFE 2E5QA 3M56A 4ZN3A 2DXBA 3UT1A 3V8LA 3AHUA 3T9NA 5C0MA 2QTXA 1G3SA 3URGA 3CCJT 1VQLA 2CS7A 5D6XA 5A2QE 1XTDA 3HRTA 3QYGB 4MZTA 1VQ9A 4HT9A 4PJOE 2DO3A 3OB9A 4MMKA 5LJ3e 4F7UB 4HCZA 5CAIA 3G6EA 4C92D 4M7AG 1YJWA 4A4HA 2XDBA 3X20B 5CK9A 2DAQA 4O5VA 2DXTA 1JJ2S 3CPWS 5DLOA 3V7RA 2RJCA 2V8IA 1RL2A 2OTLT 4XTWA 3Q1JA 3G7ZA 4N0AA 4DOVA 2KQWA 4Y28E 1ZQ1A 3S6WA 3C94A 2QDYB 3E1SA 3CC4T 4C0DC 1U1TA 1K9MC 3BFMA 2DD5A 4MDWA 4JLGA 3VKIA 5CR2A 4RG8A 2XG8D 3M4GA 2PVOB 3VUZA 5GANh 2K2VA 5CKHA 3OW2S 1M4ZA 1YI2T 3E19A 4XU2A 2V8KA 2KAFA 3CCLA 4E7KA 5J26A 4E7HA 3JCMc 1QVFA 4RKUE 1BI2A 1OI1A 4QVDA 2GQVA 2V8JA 4J5YA 3CMET 1IREB 3R6OA 3CCVA 2RJEA 2VXFA 1K9MU 3H8ZA 2R5MA 4EMGA 2XHCA 4EMKA 4L59A 3A8HB 4OP0A 4DA4A 1VQ4T 3LYIA 4IURA 3A8GB 5J3BA 2QA4T 4TVRA 4Z02A 4BACA 3GIBA 1W2BA 1G3WA 3QZ5B 2K3XA 3CCQT 1XNIA 2OTLA 5DLQE 1G3YA 1VQ5A 4M77B 2KDSA 5CQXA 4IUVA 2RD1A 2ZGWA 1UGRB 2L89A 4HCBA 1JRIA 3WXMB 5CO7A 5KE2A 3VYHB 1BI0A 2M9UA 2DTOA 4XU0A 4RCCA 4XTZA 1WQWA 2P0PA 3E9GA 4FT4A 4JUVA 4XTXA 4C8QB 5GAOq 4R55A 5IT9E 3L2QA 1VQ7T 3HFOA 1K8AU 3GNGA 4N4HA 3JB9H 2E41A 3OBYA 5A0LA 5CKFA 4C0DB 3OQ5A 1NJIC 4OB1B 2JZ2A 3HKSA 4M77D 1MGQA 4C92B 1TH7A 5D6WA 1OZ3A 1Q81U 1OZ2A 3SFMA 2KSSA 2QXFA 3HRSA 3SDZA 4ELZC 4N0AC 3DLLA 4M7DG 2E70A 3RMQA 4BD3A 4M7DC 3FIFA 3J81E 2CZ6B 4M78B 2D6FA 2VGMA 3WVDB 3S3OA 5J39A 2QQBA 2QQRA 1SSFA 3FLGA 4NS5A 3SWNB 3L2WA 3V7SA 5GMKl 3M9QA 4OF1A 2BIVA 2WSEE 2X4WA 5GAOm 3A8OB 2EYQA 4ZGJB 5LJ3f 5GMKh 1WNLA 2IVWA 3EFRA 5CKEA 3JRZA 2R58A 2AHJB 2FHDA 4HA8A 1WGSA 2JTFA 1VQ6A 3P8HA 4E7IA 3ASKA 3L2VA 2E1HA 3CC7A 4V2SA 3VU3C 3CEYA 3CCSA 2RHYA 3GLXA 2JNGA 1BIAA 3JCMg 3OS2A 2PU9B 4C5IA 4M75D 1FX7A 4ZTFA 4OB0B 2JUFA 3C4SA 1X6OA 2EFIA 2QI2A 4MMLA 4BDYA 5FRNA 1VUBA 1H641 2RJFA 4OB2B 4C92G 2MMPA 5GANf 4M7AD 3LWHA 3OYNA 4JS5A 1YHQT 1FXXA 2CGHA 1VQ7A 5I2MA 5KCHA 3CC2A 4IUQA 4VUBA 3WVEB 4A4GA 4CRIA 2DJZA 1BI1A 2G3RA 3QKJA 1VQ8T 1ZBXA 2RI2A 1LJOA 3NTKA 3MEUA 3QPHA 3N5BB 4PKCC 1VQNA 4M7AC 5GMKm 2R57A 3LGFA 3SWNC 4EPCA 3QXEB 4BDZA 1JJ2A 3DB3A 4JRPA 2A3LA 2EJGA 3EAEA 4MZPA 2CYZB 3MHXA 1QVGA 1S72T 3JCMb 1WQ7A 3OYBA 1Y96A 3HL8A 3JCMh 3TREA 3OYHA 3OSVA 2EQUA 4XQ3A 4LDVA 2GFAA 5KCOA 2PVGB 5GAMh 1OYXA 4WF2A 1YIJA 3OYKA 4XU1A 3CMEA 2JVVA 4NOYA 3OBWA 3NTHA 3MCAB 3ZFJA 2DPPB 4XU3A 2ZCFB 2LCLA 3OYAA 1KD1C 4QVCA 1N9RA 1PSFA 1WJSA 2EQMA 4M77C 3TEEA 3M58A 5GAOl 3CCST 2RH2A 2EAYA 2VXEA 2C06A 4ATOA 4O6JA 4M77A 4FU6A 3F70A 3CC7T 4OGEA 3JB9F 2X35A 3ME9A 2LT4A 5GANd 3G4ST 3CXCS 1YJNT 2M1HA 3PMIA 4FIBA 4FSXA 1XQHA 2YHTA 4HT8A 2WACA 4NL3A 2CKKA 4JRIA 2K5LA 3I56A 5FU7C 3JCMJ 4C92C 1Q7YC 4NL2A 1Q86C 2OAUA 5FU6C 1RI0A 2DIQA 2P4TA 1VQ4A 2F5KA 4LD9K 4M77F 4A54A 3DKMA 3G6ET 4LDUA 2HAXA 2K3YA 2VGNA 2RB6A 3QBYA 2PQWA 4M75C 1BYMA 1WPYA 5GAMj 2EQJA 3HFNA 3L1AA 2LRQA 5CKBA 5A0DA 5C6SA 2D9TA 3CCLT 4JS4A 3NFCA 2QQ9A 3QZ9B 5DM7R 4QQDA 3V8JA 2FB7A 3GNFB 5GAN8 4L6V5 1U1SA 4A4KA 3BW1A 4A4FA 3CD6A 1NPRA 2RHUA 3M54A 3TCJA 3OYEA 4XAXB 4M75E 3HSBA 4BY6C 5GANe 2EJFA 3S3NA 1YJNA 3FRNA 2LNVA 4OB3B 4XK8E 3S3MA 2HBPA 2EQKA 2ZPGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q F;  3L2Z A;  5LJ3 f;  5GMK h;  2YLB A;  1WNL A;  4M77 E;  3EFR A;  5GAO r;  3JCM Q;  4HA8 A;  3RKX A;  1B34 A;  4M7A E;  1I81 A;  3FJP A;  5DY9 A;  2E1H A;  3QHS A;  5GAM g;  4V2S A;  5GAO p;  4DQ2 A;  4PJO A;  3VU3 C;  1D3B A;  3SB2 A;  3RIR A;  1YCY A;  1LOJ A;  2DKG A;  4PJO G;  3JB9 D;  1BIA A;  2E64 A;  3JCM g;  5GAN 6;  3JCM f;  4M7D A;  4PJO C;  2VC8 A;  4M75 D;  2HNI A;  2EJ9 A;  1N9S A;  4C8Q A;  2I2L A;  5LJ5 f;  5GAM f;  4M75 B;  4M7A B;  4M78 E;  4JRK A;  2EWN A;  4MML A;  3AHU A;  3V8L A;  1H64 1;  5GAN 3;  4C92 G;  2QTX A;  3JCM e;  4M7A D;  5GAN f;  5GAN 7;  5LJ3 g;  2DVE A;  5GAN g;  4A53 A;  5GAN j;  3JB9 J;  3BY7 A;  4PJO E;  4HT9 A;  2CGH A;  4M78 D;  5GAM e;  1I4K 1;  4C92 F;  3INZ A;  4J6Y A;  2DTI A;  3RKY A;  4MMK A;  5GMK i;  4F7U B;  5LJ3 e;  2DJZ A;  5GAN 2;  4PJO F;  2DXU A;  3V7C A;  5CAI A;  3PGG A;  5GAN 4;  4M7A A;  1LJO A;  2DEQ A;  3BDU A;  4C92 D;  5GAO q;  3JCM P;  3RES A;  4M78 F;  4M7A G;  4M7D F;  3SWN A;  4M7A C;  1M5Q 1;  4F7U G;  5GMK m;  3SWN C;  3V8K A;  5LJ3 d;  2DXT A;  2EJG A;  1I5L A;  2FYK A;  1KQ1 A;  3V7R A;  3JCM b;  1WQ7 A;  4M7D D;  1LNX A;  1Y96 A;  4XTW A;  2K57 A;  3JCM h;  5LJ5 j;  4N0A A;  1JBM A;  3JB9 G;  4PJO D;  2DZ9 A;  4XQ3 A;  1U1T A;  5LJ5 h;  3BFM A;  5GMK e;  5GAM h;  4C8Q G;  4WF2 A;  2YLC A;  1D3B B;  4XU1 A;  5LJ3 h;  4M7D E;  2DZC A;  4NOY A;  3JCM W;  3M4G A;  3RKW A;  2RM4 A;  5GAN h;  4M7A F;  5GAO n;  4XU2 A;  4XU3 A;  3JCM V;  4QVC A;  1N9R A;  4M78 A;  4M77 C;  3JCM c;  5GAO l;  2EAY A;  2VXE A;  5GAN 5;  4QVD A;  2DTH A;  4J5Y A;  4M77 A;  4M75 F;  2RA2 A;  4X9C A;  2VXF A;  4EMK C;  4EMG A;  4EMK A;  3JCM X;  3JB9 F;  4PNO A;  5GAN d;  4OP0 A;  2YHT A;  3RUX A;  5I21 A;  4HT8 A;  3GIB A;  4F7U A;  4NL3 A;  4JRI A;  4XTV A;  3JCM J;  4J6X A;  5LJ5 g;  4C92 C;  4J6W A;  4M77 B;  4NL2 A;  3RER A;  2RD1 A;  2ZGW A;  1JRI A;  5LJ3 j;  3QUI A;  4C92 E;  3QO3 A;  4M77 F;  4A54 A;  3JCM d;  4M7D B;  4M78 C;  2DTO A;  4XU0 A;  4RCC A;  4XTZ A;  2RB6 A;  1BIB A;  1Y96 B;  4M78 G;  3QSU A;  4XTY A;  1WQW A;  4JUV A;  4M75 C;  4C8Q B;  5LJ5 d;  4JLI A;  1WPY A;  4XTX A;  1HXD A;  4M75 A;  5GAM j;  5GAM d;  3HFO A;  3JB9 H;  4RCB A;  4C8Q E;  3HFN A;  2E41 A;  3L1A A;  4XTU A;  4C8Q D;  2Y90 A;  1X01 A;  3EFS A;  2E10 A;  3V8J A;  2FB7 A;  4M77 D;  5GMK j;  1MGQ A;  4C92 B;  4EMH A;  1TH7 A;  5GAN 8;  1I8F A;  1U1S A;  4F7U F;  3BW1 A;  4Y91 A;  5LJ5 e;  4N0A C;  3JB9 I;  2E65 A;  4M7D G;  3FB9 A;  4M75 G;  2JN0 A;  4M7D C;  3FIF A;  4M78 B;  4M75 E;  1B34 B;  3HSB A;  1M8V A;  4F7U E;  4M77 G;  5GAN e;  2EJF A;  4C8Q C;  1HK9 A;  3SWN B;  4PJO B;  3V7S A;  5GMK l;  1KQ2 A;  4EMK B;  4C92 A;  4X9D A;  5GAO m; 
#chains in the Genus database with same CATH topology
 4FT2 A;  2IG0 A;  1UGS B;  3VYG A;  2XD0 A;  2LNH B;  2J7I A;  4GY5 A;  5GJV B;  2EQI A;  3GOX A;  1N6A A;  2EYW A;  3TSZ A;  5AT1 B;  2DKG A;  4M7D A;  3JCM f;  2LJ3 A;  2XI9 A;  4DBR A;  3FC3 A;  2P84 A;  4FYW B;  2RK1 A;  1S72 A;  2A7Y A;  2DFU A;  2QA4 Q;  1ZLM A;  2D8H A;  4PLL A;  3EGD B;  2XMF A;  1IHV A;  4FW1 A;  2ED1 A;  3EHQ A;  2QYZ A;  2RMO A;  2IIM A;  1GCP A;  5A0G A;  2WSC E;  1GBQ A;  4ORZ A;  1PRM C;  5KYY B;  3M0T A;  3GPL A;  4LXC A;  3E9F A;  4C0F A;  1JBM A;  1A0N B;  2QGF B;  2ZPB B;  2K9G A;  5KH6 A;  3VS3 A;  1SF9 A;  4F04 B;  2QQA A;  1TU0 B;  1C0M A;  2MF2 A;  5FU7 B;  1GCQ A;  4OVA A;  2OTJ Q;  3I9Q A;  4PLI A;  3DLM A;  3QJ6 A;  3OW2 P;  2KT8 A;  3PMT A;  2FVU A;  2BKD N;  1VA7 A;  4GLK A;  3KUF A;  3LWI A;  1MUZ A;  1T0J A;  6AT1 B;  4RG2 A;  1N8R C;  1RAD B;  1KSW A;  4XTY A;  4QQG A;  4BI8 B;  4AT1 B;  3CBO A;  3QYH B;  1H3H A;  4OMN A;  3UPU A;  2YUQ A;  4JDS A;  2DXC A;  1KC8 C;  1JO8 A;  1Z9Z A;  1ZX6 A;  3M59 A;  3TU4 K;  2E65 A;  3OYI A;  1N27 A;  1VOM A;  1KHI A;  3CD6 T;  2DIG A;  4BE1 A;  3PNW C;  1EIF A;  1GRI A;  2ATC B;  4LNP A;  4LDX A;  1G3T A;  1HSQ A;  5DY9 A;  1YI2 A;  2EGA A;  3NHN A;  2ABL A;  4DQ2 A;  1O9S A;  2CP0 A;  1KD1 R;  2XU8 A;  3X26 B;  2E64 A;  1M90 R;  2NUP B;  3SHW A;  4Z89 A;  9ATC B;  4KH0 B;  4C5E A;  5FRM A;  2EWN A;  2E6N A;  1W4S A;  4BE0 A;  3ER0 A;  3JCM e;  1ZSG A;  1SHF A;  1K76 A;  3QG1 A;  1AHJ B;  1YJW T;  3BY7 A;  5GAM e;  3HHT B;  3ZEH A;  5GMK i;  1VQM T;  1GCQ C;  2A0F B;  3LW5 E;  3PGG A;  5KYU A;  3BDU A;  2Y4Y A;  4PJM A;  3I56 Q;  3FDR A;  1VQM A;  1KG1 A;  2FYK A;  4D6W A;  2O2O A;  1LNX A;  1M27 C;  1QWF A;  4HVV A;  2PVD B;  1K73 C;  1BBZ A;  2DZ9 A;  3OS0 A;  3OYL A;  2CSI A;  2ZAE A;  2YLC A;  2XDP A;  1Q82 U;  2KXC A;  4E7J A;  2L3P A;  2DTH A;  1IHW A;  1AEY A;  1HYO A;  4M75 F;  3G1J A;  2O31 A;  4ESR A;  4UC4 A;  3A8L B;  1QVF S;  1D1B A;  2AKK A;  2EGC A;  4OMF B;  1I0C A;  1B3Q A;  3MP1 A;  2KNB B;  2BZX A;  1M3B A;  3JCM d;  3OYM A;  1Y96 B;  3M57 A;  5L23 A;  1VQ8 A;  1OOT A;  3M4Y A;  4M75 A;  2NUT A;  5I2S A;  3GF5 A;  3X24 B;  2M02 A;  2Y90 A;  4LDY A;  2CZ1 B;  3EGU A;  2EW3 A;  2RHI A;  3VJP A;  1NPP A;  3C0C A;  4C8Q C;  1WJR A;  5KYY A;  2QEX A;  5GAO r;  1Q7Y U;  3G71 Q;  4B9X A;  1C6V X;  1WXU A;  3FJP A;  3QHS A;  4HCC A;  2QQS A;  2I0N A;  4OMP A;  4C0G A;  1YJ9 Q;  4J9I A;  4KGX B;  4PJO C;  1BI3 A;  1QVG P;  1DJ7 B;  4J9G A;  1VQ5 T;  4M7A B;  1W1F A;  4ZN3 A;  1U5S A;  3UT1 A;  3AHU A;  3LH5 A;  2HSE B;  2QTX A;  3VS1 A;  5C0M A;  3URG A;  2LQW A;  2HCK A;  5A2Q E;  3HRT A;  4OML A;  1VQ9 A;  1E6G A;  2YSQ A;  2RQT A;  4F7U B;  3G6E A;  2CP7 A;  4C92 D;  4A4H A;  4KH1 B;  5CK9 A;  1Y57 A;  2OTL T;  2V8I A;  3EHR A;  1EFN A;  4Y28 E;  3CC4 T;  3E1S A;  4C0D C;  1D1C A;  1IRX A;  3M4G A;  1M4Z A;  2K79 A;  1SG5 A;  3JCM c;  4RKU E;  1RUW A;  1S72 Q;  2V8J A;  1B7T A;  3R6O A;  4J9D A;  4IUR A;  3GIB A;  1W2B A;  2B86 A;  2K3X A;  1ZUY A;  1G3Y A;  4M77 B;  2ZGW A;  3WXM B;  1TOV A;  4FSS A;  4RCC A;  2HQH A;  2MPX C;  5IT9 E;  4FT4 A;  1VQ7 T;  5KYX B;  3OBY A;  2CUB A;  1WHL A;  3OQ5 A;  1T0H A;  1D0Z A;  3H0F A;  4C92 B;  1OZ3 A;  4ELZ C;  3HRS A;  3DLL A;  2DM1 A;  3RMQ A;  1YNZ A;  3FIF A;  1VQP Q;  2QQB A;  1SSF A;  1ZSZ C;  3FLG A;  4OF1 A;  1TWB A;  1AZG B;  1JEG A;  2C0T A;  2ECZ A;  5CKE A;  2ROT A;  2R58 A;  2AHJ B;  1VQ6 A;  3P8H A;  1QCF A;  3ASK A;  1VYV A;  2E1H A;  4M4Z A;  3VU3 C;  3CCS A;  3GLX A;  1NM7 A;  2KRS A;  4OB0 B;  4B6M A;  1UHC A;  3GBQ A;  4C92 G;  4OB2 B;  2MMP A;  3NGP A;  4JS5 A;  1YHQ T;  1VQ7 A;  2G3R A;  2FPF A;  1TUG B;  3N5B B;  4PKC C;  4M7A C;  1PG5 B;  5GMK m;  4BDZ A;  3DB3 A;  2A3L A;  3EAE A;  4MZP A;  2A08 A;  3HL8 A;  3TRE A;  3OYH A;  2EQU A;  4OMO A;  4LDV A;  2ENM A;  1X2Q A;  5HCK A;  4AFQ C;  3TVT A;  3OYK A;  4XU1 A;  3CME A;  4NOY A;  3OBW A;  1Q7Y R;  3QDF A;  2DJQ A;  4XU3 A;  1KD1 C;  4JJB A;  2RH2 A;  3BE3 A;  2C06 A;  4O6J A;  1J3T A;  3F70 A;  2BE9 B;  5GAN d;  1MV0 B;  2DET A;  4FIB A;  4FSX A;  2YHT A;  4NL3 A;  3CQT A;  2CKK A;  2K5L A;  2FZK B;  2YUP A;  1M2O A;  4F17 A;  2CT3 A;  2F5K A;  2KYB A;  4LDU A;  2K3Y A;  2VGN A;  3REB B;  2M0Y A;  4CC7 A;  3KFV A;  4JS4 A;  5CKB A;  1X43 A;  5DM7 R;  4QQD A;  4EIK A;  5GAN 8;  3OYE A;  2RHU A;  4E6R A;  1JXM A;  4M75 E;  4BY6 C;  4A63 B;  2RQR A;  4LE9 A;  2E12 A;  3CCQ A;  2ZPI B;  3CMA Q;  2A28 A;  1QP3 A;  2FG0 A;  4KUD K;  2O4X B;  2KK4 A;  5GAM g;  3RDV A;  3SB2 A;  2ZPE B;  3CCU T;  5IAY A;  5FWB A;  1M3C A;  1AWW A;  4JZ3 A;  5IXF A;  1K0S A;  2LMJ A;  3CCR A;  1NJI U;  2P4R A;  3VRY A;  4M78 E;  2HMA A;  2RI3 A;  5GAN 3;  2OTJ T;  4J8O A;  2COZ A;  2V1R A;  3JSC A;  2HEQ A;  5GAN 7;  1PWT A;  2DTI A;  4LDW A;  3OYY A;  2CZ0 B;  5IHK A;  3JCM P;  3M0S A;  4IKF A;  1AVZ C;  4DBQ A;  5LJ3 d;  3CCV T;  1I5L A;  2YUO A;  3PIO A;  2AK5 A;  4M7D D;  2RQV A;  4ZGE B;  1Y07 A;  4RTU A;  2QEX Q;  1WJQ A;  2MCN A;  1YIT T;  5FLX E;  1QW1 A;  4BB7 A;  2PUO B;  1UEB A;  1D3B B;  1W2B S;  4M7D E;  2BZ8 A;  3FEO A;  1YIT Q;  1H3Z A;  1X6G A;  3VS4 A;  2J06 A;  5HKC A;  1UFF A;  5CKD A;  3MJX A;  4N4I A;  1VQ4 Q;  3J80 E;  2HD0 A;  1K1Z A;  3EFO A;  3CCE T;  2AZV A;  1FWZ A;  3M53 A;  2BZY A;  3I5R A;  3M5A A;  4FL6 A;  5LJ5 g;  3CBM A;  4J6W A;  2CP5 A;  3QUI A;  3D7S B;  4QW2 A;  1K9A A;  5GAM d;  2E6Z A;  3SEM A;  2E10 A;  4QQ6 A;  1QVF P;  4AMC A;  1G8X A;  1C1A A;  4LD6 A;  4DEY A;  2DK3 A;  4R0K A;  1B34 B;  4RTZ A;  1WHJ A;  3LGL A;  4RTT A;  3L2R A;  1YI2 Q;  4EMK B;  1FMV A;  4C8Q F;  3NPF A;  1M90 C;  3LLR A;  2YLB A;  2X4X A;  3OYG A;  5HK3 A;  1MND A;  1ZUU A;  1WX6 A;  2J05 A;  1CSK A;  3PFS A;  4BY6 B;  2DA9 A;  3AT1 B;  4QVZ A;  1W2B P;  2CUD A;  2VC8 A;  2P0Q A;  3OS1 A;  2DX1 A;  2EJ9 A;  2HL3 A;  2V1Q A;  4RUG A;  5LJ5 f;  3GP8 A;  3OY9 A;  1GXI E;  2K4Y A;  3NTI A;  4ELY C;  1VIE A;  2JMA A;  3M55 A;  2QEX T;  5GAN j;  2X51 A;  1LCK A;  1I4K 1;  3INZ A;  4J6Y A;  3G4S Q;  1GFD A;  2DXU A;  2JTM A;  3V7C A;  4Z8A A;  1E6H A;  1X75 C;  2FPD A;  4PJN A;  4Z88 A;  1YCS B;  1NZ9 A;  3P8D A;  2GF7 A;  2HKN A;  3J7A F;  4DBH A;  1I07 A;  3CC7 Q;  1ZSZ A;  3MP8 A;  3SD4 A;  5D7U A;  3THK A;  4J9B A;  2VAS A;  2L5Q A;  3M0P A;  3IQL A;  1M2V B;  4X34 A;  3CCS Q;  3JAM E;  4DOW A;  1G2B A;  5GAO n;  4M7A F;  2L2P A;  3EG3 A;  2AIR B;  3OYJ A;  2RN8 A;  1AWX A;  3CC2 T;  2DYB A;  4YTL A;  2KXD A;  3A98 A;  2LQK A;  1PSE A;  3A5Z B;  1QKX A;  1K0X A;  1VQN Q;  2CDT A;  2JM8 A;  4P5N A;  5CCA A;  2LQ8 A;  3EGX B;  1NEB A;  2NWM A;  1BKB A;  2QK0 A;  3QO3 A;  5IH2 A;  4M78 C;  2RHZ A;  3QSU A;  2RQU A;  2RI5 A;  4PFZ A;  2GFU A;  3TSW A;  3EFS A;  1AD5 A;  4OGC A;  4ANJ A;  2VUB A;  2PTK A;  2VWF A;  3QDR B;  1WA7 A;  1XJW B;  2X4Y A;  5LJ5 e;  4BI3 A;  4LN2 A;  3QWX X;  1RAE B;  1B07 A;  4M77 G;  4F7U E;  1TS9 A;  4MDX A;  1RAF B;  3HPW A;  1SHG A;  5D6Y A;  3UF4 A;  1YJ9 A;  5IHN A;  2CH4 A;  2L0A A;  3JCM Q;  4ZTJ A;  1I81 A;  5KYW A;  1UGP B;  2XDD A;  5GAO p;  3M0U A;  2HSP A;  4KT0 E;  5GAN 6;  3PTA A;  1K73 U;  2H3J A;  3MP6 A;  2MIO A;  2EBP A;  5FW9 A;  1YJ9 T;  2GNC A;  3CCM A;  3PE0 A;  2WSF E;  2E5Q A;  3M56 A;  2L3Q A;  3G6E Q;  4GLM A;  1PHT A;  2EYY A;  1SKU B;  3QYG B;  4MZT A;  2JTE A;  4PJO E;  2DO3 A;  5LJ3 e;  2LJ1 A;  2YXY A;  1YJN Q;  1PNJ A;  1OUL A;  3QWY A;  4JJC A;  1KC8 R;  2Z0W A;  1M2V A;  5GJW B;  3V7R A;  2AKL A;  2M51 A;  1N5Z A;  3Q1J A;  4AG1 C;  3CC2 Q;  4N0A A;  1U06 A;  2D0N A;  4MDW A;  3VKI A;  1GBR A;  8ATC B;  2XG8 D;  2ESW A;  2K2V A;  1AOJ A;  1YI2 T;  2V8K A;  3CCL A;  4E7K A;  4J5Y A;  3PVL A;  2VXF A;  2X3W D;  1K9M U;  4EMG A;  2R5M A;  2E3I A;  4OP0 A;  1U3O A;  1VQ8 Q;  1PRL C;  3LYI A;  1IO6 A;  4TVR A;  4BAC A;  1WXB A;  1UGR B;  2JMC A;  4HCB A;  1WFW A;  1WXT A;  5KE2 A;  3VYH B;  4XTZ A;  2AZS A;  4C8Q B;  2DNU A;  4XTX A;  4R55 A;  2BTT A;  1UEC A;  1ARK A;  3H41 A;  3VS2 A;  5CKF A;  1I5O B;  1M1K R;  2JZ2 A;  4M77 D;  1OZ2 A;  3SDZ A;  4M7D G;  2CZ6 B;  3H9N A;  1JQQ A;  5GMK l;  3EFO B;  3R6N A;  4WCI A;  4AFS C;  2LQN A;  1T3S A;  2FHD A;  2JTF A;  4E7I A;  4V2S A;  4QT7 A;  2RHY A;  1MMA A;  2JNG A;  1TUD A;  3JCM g;  3OS2 A;  1MNE A;  4M75 D;  1FX7 A;  1NYF A;  3C4S A;  4WTO B;  1V1C A;  5FRN A;  1H64 1;  2RJF A;  4M7A D;  3OYN A;  2V26 A;  2FO0 A;  5KCH A;  4IUQ A;  4F14 A;  2DJZ A;  3QKJ A;  1VQ8 T;  1BCM A;  1PCX A;  4FYX B;  2DIL A;  4JRP A;  2EJG A;  1LVK A;  2CYZ B;  3OYB A;  1WQ7 A;  1Y96 A;  3JCM h;  5KCO A;  5GAM h;  4WF2 A;  1X2K A;  2NUP A;  1AWJ A;  2DPP B;  2LCL A;  3OYA A;  1N9R A;  1WJS A;  4M77 C;  3M58 A;  5GAO l;  2VXE A;  4ATO A;  4M77 A;  4FU6 A;  1K73 R;  1WHG A;  2X35 A;  3ME9 A;  4JZ4 A;  2HL5 C;  2M1H A;  3PMI A;  4QKU A;  2QDL A;  2KRM A;  3I56 A;  3U23 A;  1Q86 C;  4NL2 A;  2DIQ A;  2P4T A;  1VQO Q;  4LD9 K;  2F1L A;  4A54 A;  1ZA1 B;  2DLP A;  1UUE A;  3QBY A;  2PQW A;  2CP6 A;  1M30 A;  3L1A A;  3QZ9 B;  2LCS A;  1TSF A;  1U1S A;  4A4F A;  3CD6 A;  2YRC A;  1NPR A;  3M54 A;  4XAX B;  3HSB A;  4RTX A;  4LUD A;  2EJF A;  2KGT A;  3S3N A;  1QKW A;  4XK8 E;  3S3M A;  1W70 A;  1NJI R;  3RKX A;  3CCU A;  1N8R U;  1OEB A;  4CC4 B;  4PJO A;  3RIR A;  1RAA B;  5KE3 A;  5HK0 A;  2MWP A;  4IUU A;  2K3B A;  2BUD A;  5GAM f;  3QII A;  4ZNX A;  4JRK A;  5LL6 S;  4F16 A;  4J7F A;  1PKS A;  3CC4 A;  1CKA A;  5LJ3 g;  2DVE A;  3ZBD A;  2DD4 A;  1VQN T;  4C92 F;  2EPD A;  4PJO F;  1VQK T;  3I55 A;  3OW2 A;  2BE7 D;  4PFP A;  1RAB B;  4M78 F;  4M7D F;  2OTL Q;  4F7U G;  1UB4 A;  4JPB W;  1NYG A;  2MOX A;  3G71 A;  5CVI A;  1XOV A;  4HVW A;  2K57 A;  4E47 A;  1VQ9 T;  1TXQ A;  1X27 A;  5LJ5 j;  4PJO D;  1KQS P;  3KBG A;  3ULR B;  4KBM B;  5LJ5 h;  5AYF A;  4C8Q G;  4L5G A;  1UJY A;  1Y71 A;  3JCM W;  3RKW A;  4BE2 A;  1QLY A;  4M78 A;  2LTO A;  2F69 A;  5GAN 5;  1ZSZ B;  4N4G A;  4KUL A;  1PC0 A;  3KXT A;  2RA2 A;  4EMK C;  4RMO A;  2GBQ A;  3O5Z A;  2X4J A;  4BI4 A;  3EG1 A;  3RNJ A;  1R8O B;  2GQI A;  3LH0 A;  2XKO C;  1QQJ A;  4XTV A;  4Q5W A;  4HXJ A;  2K6D A;  2E5K A;  1MMG A;  4C92 E;  2FL7 A;  4JJD A;  3P8B B;  2RNA A;  2YUN A;  1M8M A;  2LP5 A;  1HXD A;  1Q82 R;  4C8Q D;  1SSH A;  2X3X D;  1WYX A;  2DRK A;  3VV0 A;  4C5H A;  5GMK j;  5HY6 A;  1I8F A;  2EKO A;  3CMA A;  2KEA A;  1KQS S;  4Y91 A;  4ZGD B;  2JN0 A;  2KE9 A;  3UAT A;  3OYF A;  4PJO B;  2KRN A;  1KQ2 A;  2DL4 A;  1GL5 A;  4MZM A;  4K11 A;  2LX9 A;  1Q95 G;  1IGQ A;  3A8M B;  1E7O A;  3MEW A;  3JB9 D;  2K5I A;  2L3R A;  3MKD A;  4DBF A;  4C8Q A;  2I2L A;  1UHF A;  3OMC A;  1VQO T;  3CPW A;  4HKE A;  5KYW B;  3OMG A;  3MEA A;  1Q81 C;  5IXB A;  1HD3 A;  5GAN g;  4KUI A;  2XIC A;  2SEM A;  1ABQ A;  4IUT A;  2RJD A;  3UWN A;  2DEQ A;  1OU8 A;  1YIT A;  3MPU B;  1NEG A;  2JXB A;  2P0K A;  1YIJ T;  2VV5 A;  3JB9 G;  2L8D A;  2DBM A;  2DE0 X;  2XK0 A;  1O75 A;  2NLU A;  2FRW A;  4IIM A;  2DZC A;  1M3A A;  2O9V A;  3JCM V;  2LC4 A;  2M0O A;  1PD0 A;  4X9C A;  1QVG S;  1VQ7 Q;  2R5A A;  4J9H A;  2DBK A;  2JS0 A;  5I21 A;  4J83 A;  4AFU C;  2O4X A;  4IUP A;  1Y0M A;  1WZO A;  5IHI A;  3LX7 A;  4B9W A;  2EYX A;  3RER A;  2EIF A;  3DB4 A;  4RTY A;  2VKN A;  2KY9 A;  3PIP A;  3JB9 J;  2CZ7 B;  4FM4 B;  2VYT A;  3L42 A;  4EDU A;  3CXC A;  3CCE Q;  1M90 U;  1VQ5 Q;  3X25 B;  4M75 G;  2NYS A;  2M16 A;  5CQY A;  1YHQ Q;  4PL6 A;  4C92 A;  4OMQ A;  3MEV A;  3CCJ A;  1MMD A;  1FMK A;  3M0R A;  1UGQ B;  2ZPH B;  1D3B A;  1YCY A;  2DL8 A;  1IGU A;  5CIU A;  2ED0 A;  2HNI A;  3G4S A;  2RPN A;  2OI3 A;  2LDM A;  5I11 A;  3V8L A;  1I1J A;  3T9N A;  3CCJ T;  2OAW A;  1PM3 A;  1AZE A;  1UJ0 A;  4MMK A;  1ZA2 B;  2VVK A;  4DEX A;  2DAQ A;  2DER A;  3EG9 A;  3CPW S;  1QCN A;  3G7Z A;  1ZQ1 A;  3S6W A;  3C94 A;  3CCU Q;  3BFM A;  1CKB A;  4JLG A;  2EYZ A;  4RG8 A;  2KR3 A;  3UA7 A;  3HTR A;  2DL7 A;  2EGE A;  3VUZ A;  5CKH A;  4AFZ C;  5I22 A;  3OW2 S;  4XU2 A;  3E19 A;  3CCR Q;  1AT1 B;  2KAF A;  2MYS A;  1T3L A;  1QVF A;  2OX7 A;  1BI2 A;  2GQV A;  3CME T;  1NLP C;  3EGD A;  4EMK A;  2XHC A;  3CC4 Q;  4L59 A;  3A8H B;  1QWE A;  1VQ4 T;  1JU5 C;  3A8G B;  4Z02 A;  1G3W A;  3RR6 A;  1R0C B;  3QZ5 B;  4PK4 A;  4FCY A;  1XNI A;  3H0I A;  3I55 Q;  4IUV A;  2L89 A;  1JRI A;  2DYI A;  5CO7 A;  1BI0 A;  4XU0 A;  1WQW A;  3E9G A;  5GAO q;  2LX7 A;  4X1V A;  5EC7 A;  3HFO A;  2E41 A;  3M0Q A;  4OB1 B;  1NJI C;  1MGQ A;  1S1N A;  1MV3 A;  3SFM A;  2QXF A;  1IXD A;  4BD3 A;  3J81 E;  2D6F A;  2VGM A;  3WVD B;  3UA6 A;  5J39 A;  3L2W A;  3SWN B;  2W0Z A;  3V7S A;  2WSE E;  1OX9 A;  3A8O B;  4KGV B;  1WNL A;  2IVW A;  3CCM Q;  2AT1 B;  3A1P A;  1WGS A;  3L2V A;  2LZ6 B;  3CEY A;  1WHH A;  1BIA A;  2CRE A;  4J9E A;  1JJ2 P;  1X6O A;  4MML A;  1VUB A;  3I35 A;  5GAN f;  4LUE A;  1FXX A;  2CGH A;  5I2M A;  3CC2 A;  4A4G A;  4CRI A;  1BI1 A;  1FYN A;  2O9S A;  3NTK A;  3LGF A;  4EPC A;  1VQK Q;  1K8A R;  3MHX A;  3CCL Q;  1QVG A;  2D8J A;  3JCM b;  1YWO A;  1ABO A;  1ZUK A;  3VRZ A;  1EX4 A;  1WI7 A;  2JVV A;  3NTH A;  4QVC A;  1PSF A;  4AG2 C;  2EQM A;  3TEE A;  7AT1 B;  2EAY A;  1YN8 A;  2F2W A;  3CC7 T;  3CXC S;  3G4S T;  1XQH A;  4HT8 A;  1F1B B;  1ZBJ A;  2CH4 W;  5KYU B;  5FU7 C;  2L3S A;  1Q7Y C;  2PZ1 A;  5FU6 C;  1RI0 A;  1WHK A;  4M77 F;  1KIK A;  3G6E T;  2HAX A;  3CD6 Q;  1BYM A;  1WPY A;  1BB9 A;  5GAM j;  2JM9 A;  3CXC P;  2EQJ A;  3HFN A;  1D0X A;  2LRQ A;  5A0D A;  2D9T A;  3CCL T;  1VQL Q;  4A4K A;  3BW1 A;  3TCJ A;  1YJW Q;  5GAN e;  3FRN A;  1VYU A;  4PJJ A;  2ZPG B;  2KRO A;  2PNI A;  4R56 A;  1B34 A;  1OPK A;  1U8R A;  3OA6 A;  2YDL A;  3H6Z A;  3G71 T;  2JW4 A;  3EGX A;  2EVR A;  3VS0 A;  2Y4X A;  1WDX A;  3I55 T;  1RAH B;  2NUT B;  4M75 B;  4JRQ A;  2HQX A;  3CCV Q;  5M9O A;  1VQ6 T;  2H3E B;  3HRU A;  2EKH A;  2GCX A;  2CSQ A;  4A53 A;  3VS6 A;  3OYC A;  4M78 D;  2JS2 A;  2LJ0 A;  2LVM A;  3H0H A;  1QVP A;  5GAN 4;  1WIE A;  2KT1 A;  1YHQ A;  3RES A;  1JXO A;  1NBE B;  1M5Q 1;  2GGR A;  1SPK A;  2PUK B;  3V8K A;  2DL5 A;  4CC3 A;  3PT9 A;  1K9M R;  1KQ1 A;  2A36 A;  3OSS C;  4ZN1 A;  3MET A;  5GMK e;  2O01 E;  4A4E A;  2CP3 A;  2RK2 A;  2DL3 A;  4KGZ B;  5LJ3 h;  3CCM T;  1MHN A;  2RM4 A;  1D1A A;  1VIF A;  2KBT A;  5IN1 A;  2JOY A;  2GTO A;  4GBQ A;  1VQP T;  3OS5 A;  3L2U A;  3JCM X;  2MAM A;  4PNO A;  2DMO A;  2KVQ G;  3RUX A;  1P92 A;  4F7U A;  3O8V A;  3CCR T;  4JJN K;  2MI6 A;  2MWO A;  3CPW P;  3PVQ A;  3EH2 A;  1H92 A;  3I56 T;  2HQE A;  5LJ5 d;  1M1F A;  3CBP A;  3ZL7 C;  1X01 A;  2XID A;  4IIO A;  5FU6 B;  4F7U F;  3JB9 I;  1Y7X A;  2F5T X;  3FB9 A;  1SEM A;  4C0Z A;  3C95 A;  4E7L A;  1Q81 R;  4RTV A;  1UTI A;  2O88 A;  1HK9 A;  4X9D A;  5EG2 A;  1YWP A;  1EZZ B;  4J7I A;  3L2Z A;  1W6X A;  1IB8 A;  1RLQ C;  4BUG A;  4M7A E;  1ZHI A;  1RI9 A;  1YIJ Q;  3UDC A;  1SRL A;  2RF0 A;  1Z9Q A;  5CR2 A;  1LOJ A;  4PJO G;  1RLP C;  2RO0 A;  3MO8 A;  1JB0 E;  1FMW A;  2LT1 A;  5FWC A;  3CMA T;  4C5G A;  1V29 B;  4HVU A;  2CT4 A;  1KFZ A;  3HP9 A;  4CI0 C;  3RKY A;  5GAN 2;  1KD1 U;  4M7A A;  1Q82 C;  3SWN A;  1KHC A;  2ZPF B;  2RQW A;  2B8A A;  1N8R R;  3BDL A;  5KYN A;  4FYV B;  1M9S A;  3E2U A;  4FYY B;  1VQM Q;  2OJ2 A;  5FRO A;  1KQS A;  1QMC A;  3EG9 B;  3RMS A;  3X28 B;  2K5F A;  2KI7 A;  2C0O A;  3OYD A;  1D09 B;  4KRT A;  2NUZ A;  1KC8 U;  1K8A C;  2YRV A;  2KYM A;  2A37 A;  1QP2 A;  4J6X A;  3CPF A;  2J6F A;  1M1G A;  3CCE A;  5LJ3 j;  1PKT A;  4M7D B;  3QJY A;  1VQK A;  2ZZD A;  4M78 G;  1BIB A;  2HBW A;  1M1K C;  1TG0 A;  4JLI A;  2QA4 A;  1D0Y A;  2QAZ A;  4RCB A;  4C8Q E;  1AWO A;  4XTU A;  5L8R E;  1V76 A;  4EMH A;  2LCC A;  1H8K A;  2RHX A;  3CCJ Q;  5ECA A;  1M8V A;  1IZ6 A;  3C12 A;  4II1 A;  1NE8 A;  1G5V A;  4OMM A;  2FEI A;  3REA B;  3VUB A;  1X6B A;  1VQL T;  2KMT A;  4M77 E;  1MMN A;  2CP2 A;  1Q86 U;  2YRD A;  2J6K A;  4E7S A;  1VQP A;  4CC2 A;  1VQO A;  1NLO C;  2D0Q B;  1BCO A;  2DRM A;  3TQ7 P;  1M1K U;  4ME7 A;  2H8H A;  2OTJ A;  2SRC A;  4FW2 A;  1N9S A;  1YBY A;  2DVJ A;  1WLP B;  4D8D A;  1RAC B;  2DXB A;  1G3S A;  2QG9 B;  1VQL A;  2CS7 A;  5D6X A;  1XTD A;  1UG1 A;  3I5S A;  4HT9 A;  3OB9 A;  4HCK A;  1NG2 A;  4HCZ A;  5CAI A;  4M7A G;  1YJW A;  2XDB A;  3X20 B;  4O5V A;  2DXT A;  8AT1 B;  1JJ2 S;  2DEU A;  3JV3 A;  2JJ9 A;  5DLO A;  2RJC A;  1RL2 A;  4XTW A;  4RTW A;  2C0I A;  4DOV A;  2KQW A;  1K9M C;  2QDY B;  1U1T A;  1BU1 A;  2DD5 A;  2E3H A;  2PVO B;  3EG0 A;  4E7Z A;  5GAN h;  2ROL A;  1R77 A;  1VYT A;  3EH1 A;  5J26 A;  2DF6 A;  4E7H A;  2VB6 A;  1OI1 A;  4QVD A;  4J9C A;  1IRE B;  3CCV A;  2RJE A;  3H8Z A;  4Y92 A;  1OQK A;  4DA4 A;  3CME Q;  2K7A A;  2FPE A;  5J3B A;  2QA4 T;  1OPL A;  2X9H A;  3CCQ T;  2OTL A;  5DLQ E;  1VQ5 A;  2KDS A;  5CQX A;  2GTJ A;  1OX8 A;  1RAG B;  2F2V A;  2RD1 A;  2FRY A;  1ACM B;  2QTV A;  2M9U A;  2DTO A;  3VS7 A;  2HDA A;  2P0P A;  4JUV A;  3JB9 H;  2COY A;  3L2Q A;  4PFO A;  1K8A U;  3GNG A;  4N4H A;  2W10 A;  5A0L A;  4C0D B;  2YT6 A;  3HKS A;  1K4U S;  1TH7 A;  5D6W A;  1Q81 U;  2KSS A;  4N0A C;  2E70 A;  4M7D C;  1QCO A;  4M78 B;  3S3O A;  2QQR A;  4NS5 A;  3M9Q A;  1R0B G;  2BIV A;  2X4W A;  5GAO m;  2EYQ A;  4ZGJ B;  5LJ3 f;  5GMK h;  3EFR A;  3JRZ A;  1HJD A;  2FZG B;  4HA8 A;  1WHM A;  3CC7 A;  2PU9 B;  4C5I A;  3CCQ Q;  1G83 A;  2HZY A;  4ZTF A;  1VQ6 Q;  1KK7 A;  2G6F X;  2JUF A;  2EFI A;  2QI2 A;  1YP5 A;  4BDY A;  1RAI B;  2HKQ B;  3LWH A;  1UDL A;  4VUB A;  3WVE B;  1ZBX A;  2RI2 A;  1LJO A;  3MEU A;  3QPH A;  1VQN A;  2R57 A;  3SWN C;  3QXE B;  1JJ2 A;  1S72 T;  1BK2 A;  2QAS A;  3VS5 A;  3OSV A;  4XQ3 A;  3RBB B;  2GFA A;  4E2F B;  2PVG B;  1OYX A;  1YIJ A;  4D8K A;  1Q86 R;  3MCA B;  3ZFJ A;  2FZC B;  2ZCF B;  2F2X A;  2QGG A;  3CCS T;  2MK5 A;  2J6O A;  3FJ5 A;  2E4H A;  2IPO B;  1UE9 A;  4OGE A;  1X69 A;  3JB9 F;  2LT4 A;  1YJN T;  2WAC A;  1OV3 A;  1PD1 A;  5KYX A;  4JRI A;  3JCM J;  2D1X A;  2YWW A;  4C92 C;  1GFC A;  2OAU A;  4J9F A;  2K2M A;  1VQ4 A;  1KJW A;  3DKM A;  3NMZ C;  2RB6 A;  1TTH B;  4M75 C;  1LPL A;  5C6S A;  1TUC A;  2COW A;  3NFC A;  2QQ9 A;  3V8J A;  2FB7 A;  3GNF B;  1OU9 A;  1VQ9 Q;  4L6V 5;  1SRM A;  2JT4 A;  1UGV A;  3EG2 A;  1YJN A;  1YFN A;  2LNV A;  4OB3 B;  4PJL A;  2HBP A;  2EQK A; 
#chains in the Genus database with same CATH homology
 4FT2 A;  2IG0 A;  1UGS B;  3VYG A;  2ZPI B;  2XD0 A;  1QP3 A;  4R56 A;  4GY5 A;  4KUD K;  2O4X B;  1B34 A;  3RKX A;  3CCU A;  1U8R A;  3OA6 A;  3GOX A;  2KK4 A;  1N8R U;  5GAM g;  1N6A A;  3H6Z A;  3G71 T;  4PJO A;  3SB2 A;  3RIR A;  2ZPE B;  2DKG A;  5KE3 A;  5HK0 A;  4M7D A;  2MWP A;  3JCM f;  5IAY A;  3CCU T;  2XI9 A;  2Y4X A;  4IUU A;  3FC3 A;  3I55 T;  2BUD A;  2RK1 A;  3CCR A;  5GAM f;  1S72 A;  3QII A;  4M75 B;  4JRQ A;  1NJI U;  2A7Y A;  4M78 E;  4JRK A;  5LL6 S;  2HQX A;  2RI3 A;  4J7F A;  5M9O A;  5GAN 3;  1VQ6 T;  3CC4 A;  2OTJ T;  4PLL A;  3HRU A;  3JSC A;  4J8O A;  5GAN 7;  5LJ3 g;  2DVE A;  2GCX A;  2DD4 A;  3ZBD A;  1VQN T;  4A53 A;  3OYC A;  4M78 D;  4C92 F;  2LVM A;  2DTI A;  4LDW A;  1QVP A;  4PJO F;  5GAN 4;  3OYY A;  2CZ0 B;  3I55 A;  3OW2 A;  1VQK T;  5A0G A;  3JCM P;  2WSC E;  3RES A;  4M78 F;  1YHQ A;  4IKF A;  4M7D F;  1M5Q 1;  4F7U G;  1UB4 A;  2PUK B;  3V8K A;  5LJ3 d;  3CCV T;  1I5L A;  3PIO A;  3PT9 A;  3G71 A;  1KQ1 A;  3OSS C;  5CVI A;  3GPL A;  1XOV A;  4M7D D;  2K57 A;  3E9F A;  4C0F A;  4ZGE B;  3MET A;  1Y07 A;  4E47 A;  4ZN1 A;  5LJ5 j;  1VQ9 T;  1JBM A;  4PJO D;  1WJQ A;  1YIT T;  3KBG A;  2ZPB B;  5FLX E;  1QW1 A;  4KBM B;  4BB7 A;  2PUO B;  5GMK e;  5LJ5 h;  2O01 E;  5AYF A;  4C8Q G;  1UEB A;  1D3B B;  4L5G A;  4A4E A;  2RK2 A;  5LJ3 h;  5KH6 A;  1Y71 A;  3FEO A;  3CCM T;  3JCM W;  4M7D E;  1H3Z A;  1MHN A;  3RKW A;  2QQA A;  2RM4 A;  1W2B S;  4BE2 A;  2MF2 A;  5FU7 B;  5HKC A;  1VIF A;  4OVA A;  4M78 A;  2LTO A;  5CKD A;  2F69 A;  4PLI A;  5GAN 5;  3DLM A;  4N4I A;  2JOY A;  3QJ6 A;  4N4G A;  4KUL A;  5IN1 A;  3KXT A;  2RA2 A;  3J80 E;  4EMK C;  4RMO A;  3OS5 A;  3L2U A;  1VQP T;  2HD0 A;  3JCM X;  2MAM A;  4PNO A;  3PMT A;  2X4J A;  4BI4 A;  3CCE T;  1FWZ A;  2KVQ G;  2FVU A;  1R8O B;  2BKD N;  3RUX A;  1P92 A;  3LH0 A;  2XKO C;  3M53 A;  4F7U A;  4GLK A;  3O8V A;  4FL6 A;  3M5A A;  4XTV A;  4Q5W A;  5LJ5 g;  3CCR T;  3KUF A;  3CBM A;  3LWI A;  4J6W A;  4JJN K;  2MI6 A;  2MWO A;  3QUI A;  4C92 E;  2FL7 A;  4RG2 A;  1N8R C;  3P8B B;  4XTY A;  2HQE A;  4QW2 A;  4QQG A;  4BI8 B;  5LJ5 d;  5GAM d;  3I56 T;  1HXD A;  1M1F A;  2E6Z A;  3CBO A;  3CBP A;  3QYH B;  3UPU A;  4C8Q D;  4JDS A;  1X01 A;  2DXC A;  2E10 A;  3VV0 A;  4QQ6 A;  4C5H A;  5GMK j;  1KC8 C;  5HY6 A;  2XID A;  1I8F A;  2EKO A;  3CMA A;  5FU6 B;  4F7U F;  4Y91 A;  3JB9 I;  1Y7X A;  3M59 A;  3TU4 K;  2E65 A;  1KQS S;  2F5T X;  3FB9 A;  4LD6 A;  4ZGD B;  2DK3 A;  2JN0 A;  4C0Z A;  3OYI A;  1B34 B;  3C95 A;  4E7L A;  1N27 A;  3LGL A;  3OYF A;  3L2R A;  1HK9 A;  1KHI A;  4PJO B;  3CD6 T;  1KQ2 A;  2DIG A;  4EMK B;  4BE1 A;  4X9D A;  5EG2 A;  3PNW C;  1EIF A;  4C8Q F;  2QA4 A;  4J7I A;  4MZM A;  3L2Z A;  3LLR A;  1M90 C;  2YLB A;  2LX9 A;  2X4X A;  4LDX A;  1G3T A;  3OYG A;  4BUG A;  5HK3 A;  3A8M B;  4M7A E;  1ZHI A;  5DY9 A;  1YI2 A;  3UDC A;  2E12 A;  3PFS A;  4DQ2 A;  3CCQ A;  1O9S A;  4BY6 B;  3MEW A;  1LOJ A;  2RO0 A;  3MO8 A;  2XU8 A;  4PJO G;  2E64 A;  2K5I A;  4QVZ A;  3X26 B;  3JB9 D;  1JB0 E;  2VC8 A;  2P0Q A;  3OS1 A;  2L3R A;  2EJ9 A;  2LT1 A;  4C8Q A;  2I2L A;  5LJ5 f;  3OMC A;  4C5E A;  3GP8 A;  5FRM A;  1VQO T;  3CPW A;  4HKE A;  2EWN A;  2E6N A;  3CMA T;  3OMG A;  3MEA A;  3OY9 A;  1Q81 C;  1GXI E;  1W4S A;  2K4Y A;  4BE0 A;  3ER0 A;  3NTI A;  3JCM e;  4ELY C;  1VIE A;  4C5G A;  1V29 B;  3M55 A;  2QEX T;  3QG1 A;  4KUI A;  2XIC A;  1AHJ B;  5GAN g;  5GAN j;  3BY7 A;  1YJW T;  5GAM e;  3HHT B;  4IUT A;  1I4K 1;  3HP9 A;  3INZ A;  2RJD A;  4J6Y A;  3RKY A;  3UWN A;  3ZEH A;  4CI0 C;  5GMK i;  5GAN 2;  1VQM T;  2DXU A;  2JTM A;  3V7C A;  3LW5 E;  3PGG A;  1KD1 U;  1Q82 C;  2DEQ A;  4M7A A;  1X75 C;  3BDU A;  2Y4Y A;  1YIT A;  3SWN A;  1KHC A;  2ZPF B;  1NZ9 A;  2B8A A;  3FDR A;  1VQM A;  1KG1 A;  3BDL A;  3P8D A;  2FYK A;  2GF7 A;  4D6W A;  2P0K A;  1YIJ T;  1LNX A;  2PVD B;  2VV5 A;  1K73 C;  3J7A F;  3JB9 G;  1M9S A;  2DZ9 A;  2L8D A;  3OS0 A;  3OYL A;  3MP8 A;  3SD4 A;  2XK0 A;  1O75 A;  2NLU A;  2YLC A;  5FRO A;  2L5Q A;  2DZC A;  1KQS A;  4X34 A;  3RMS A;  4DOW A;  5GAO n;  3JAM E;  4M7A F;  3X28 B;  2XDP A;  3JCM V;  1Q82 U;  2LC4 A;  2M0O A;  2K5F A;  4E7J A;  2DTH A;  3OYD A;  3OYJ A;  4M75 F;  4X9C A;  1QVG S;  3CC2 T;  4YTL A;  2LQK A;  4UC4 A;  1KC8 U;  1K8A C;  2R5A A;  2YRV A;  1PSE A;  3A8L B;  5I21 A;  1QVF S;  3A5Z B;  4J83 A;  1QP2 A;  2O4X A;  4IUP A;  4OMF B;  4J6X A;  4P5N A;  5CCA A;  3CPF A;  3LX7 A;  4B9W A;  2LQ8 A;  3MP1 A;  3CCE A;  1M1G A;  3RER A;  2EIF A;  5LJ3 j;  3DB4 A;  1BKB A;  3QO3 A;  3JCM d;  4M7D B;  3QJY A;  1VQK A;  4M78 C;  2KY9 A;  3OYM A;  2RHZ A;  2ZZD A;  3QSU A;  4M78 G;  1BIB A;  1Y96 B;  3M57 A;  3PIP A;  1VQ8 A;  3JB9 J;  2CZ7 B;  2RI5 A;  3M4Y A;  4JLI A;  1M1K C;  4M75 A;  5I2S A;  3GF5 A;  4FM4 B;  2VYT A;  3L42 A;  4RCB A;  2GFU A;  3X24 B;  4C8Q E;  4XTU A;  5L8R E;  4EDU A;  3CXC A;  1M90 U;  2Y90 A;  3EFS A;  3X25 B;  4OGC A;  2VUB A;  4EMH A;  2LCC A;  3QDR B;  4LDY A;  2CZ1 B;  2X4Y A;  2RHX A;  5LJ5 e;  2RHI A;  4BI3 A;  4M75 G;  3VJP A;  2M16 A;  1M8V A;  1NPP A;  1IZ6 A;  5CQY A;  4F7U E;  4M77 G;  3C12 A;  4II1 A;  4MDX A;  1NE8 A;  4C8Q C;  1G5V A;  3HPW A;  4PL6 A;  3VUB A;  5D6Y A;  4C92 A;  1WJR A;  3MEV A;  1YJ9 A;  3CCJ A;  1VQL T;  2KMT A;  4M77 E;  2QEX A;  5GAO r;  1Q7Y U;  1Q86 U;  4B9X A;  3JCM Q;  4ZTJ A;  1I81 A;  3FJP A;  1VQP A;  1UGP B;  3QHS A;  2XDD A;  4HCC A;  5GAO p;  1VQO A;  1UGQ B;  2QQS A;  2ZPH B;  1D3B A;  1YCY A;  2D0Q B;  4KT0 E;  4C0G A;  5GAN 6;  3PTA A;  1M1K U;  1K73 U;  4ME7 A;  2H3J A;  4PJO C;  1BI3 A;  5CIU A;  2HNI A;  3G4S A;  2OTJ A;  3MP6 A;  1DJ7 B;  1N9S A;  1YJ9 T;  1VQ5 T;  2LDM A;  3CCM A;  1YBY A;  4M7A B;  2WSF E;  2E5Q A;  3M56 A;  4ZN3 A;  2DXB A;  3UT1 A;  3V8L A;  3AHU A;  3T9N A;  5C0M A;  2QTX A;  1G3S A;  3URG A;  3CCJ T;  1VQL A;  2CS7 A;  5D6X A;  5A2Q E;  1XTD A;  3HRT A;  3QYG B;  4MZT A;  1VQ9 A;  4HT9 A;  4PJO E;  2DO3 A;  3OB9 A;  4MMK A;  5LJ3 e;  4F7U B;  4HCZ A;  5CAI A;  3G6E A;  4C92 D;  4M7A G;  1YJW A;  4A4H A;  2XDB A;  3X20 B;  5CK9 A;  2DAQ A;  4O5V A;  2DXT A;  1JJ2 S;  3CPW S;  5DLO A;  3V7R A;  2RJC A;  2V8I A;  1RL2 A;  2OTL T;  4XTW A;  3Q1J A;  3G7Z A;  4N0A A;  4DOV A;  2KQW A;  4Y28 E;  1ZQ1 A;  3S6W A;  3C94 A;  2QDY B;  3E1S A;  3CC4 T;  4C0D C;  1U1T A;  1K9M C;  3BFM A;  2DD5 A;  4MDW A;  4JLG A;  3VKI A;  5CR2 A;  4RG8 A;  2XG8 D;  3M4G A;  2PVO B;  3VUZ A;  5GAN h;  2K2V A;  5CKH A;  3OW2 S;  1M4Z A;  1YI2 T;  3E19 A;  4XU2 A;  2V8K A;  2KAF A;  3CCL A;  4E7K A;  5J26 A;  4E7H A;  3JCM c;  1QVF A;  4RKU E;  1BI2 A;  1OI1 A;  4QVD A;  2GQV A;  2V8J A;  4J5Y A;  3CME T;  1IRE B;  3R6O A;  3CCV A;  2RJE A;  2VXF A;  1K9M U;  3H8Z A;  2R5M A;  4EMG A;  2XHC A;  4EMK A;  4L59 A;  3A8H B;  4OP0 A;  4DA4 A;  1VQ4 T;  3LYI A;  4IUR A;  3A8G B;  5J3B A;  2QA4 T;  4TVR A;  4Z02 A;  4BAC A;  3GIB A;  1W2B A;  1G3W A;  3QZ5 B;  2K3X A;  3CCQ T;  1XNI A;  2OTL A;  5DLQ E;  1G3Y A;  1VQ5 A;  4M77 B;  2KDS A;  5CQX A;  4IUV A;  2RD1 A;  2ZGW A;  1UGR B;  2L89 A;  4HCB A;  1JRI A;  3WXM B;  5CO7 A;  5KE2 A;  3VYH B;  1BI0 A;  2M9U A;  2DTO A;  4XU0 A;  4RCC A;  4XTZ A;  1WQW A;  2P0P A;  3E9G A;  4FT4 A;  4JUV A;  4XTX A;  4C8Q B;  5GAO q;  4R55 A;  5IT9 E;  3L2Q A;  1VQ7 T;  3HFO A;  1K8A U;  3GNG A;  4N4H A;  3JB9 H;  2E41 A;  3OBY A;  5A0L A;  5CKF A;  4C0D B;  3OQ5 A;  1NJI C;  4OB1 B;  2JZ2 A;  3HKS A;  4M77 D;  1MGQ A;  4C92 B;  1TH7 A;  5D6W A;  1OZ3 A;  1Q81 U;  1OZ2 A;  3SFM A;  2KSS A;  2QXF A;  3HRS A;  3SDZ A;  4ELZ C;  4N0A C;  3DLL A;  4M7D G;  2E70 A;  3RMQ A;  4BD3 A;  4M7D C;  3FIF A;  3J81 E;  2CZ6 B;  4M78 B;  2D6F A;  2VGM A;  3WVD B;  3S3O A;  5J39 A;  2QQB A;  2QQR A;  1SSF A;  3FLG A;  4NS5 A;  3SWN B;  3L2W A;  3V7S A;  5GMK l;  3M9Q A;  4OF1 A;  2BIV A;  2WSE E;  2X4W A;  5GAO m;  3A8O B;  2EYQ A;  4ZGJ B;  5LJ3 f;  5GMK h;  1WNL A;  2IVW A;  3EFR A;  5CKE A;  3JRZ A;  2R58 A;  2AHJ B;  2FHD A;  4HA8 A;  1WGS A;  2JTF A;  1VQ6 A;  3P8H A;  4E7I A;  3ASK A;  3L2V A;  2E1H A;  3CC7 A;  4V2S A;  3VU3 C;  3CEY A;  3CCS A;  2RHY A;  3GLX A;  2JNG A;  1BIA A;  3JCM g;  3OS2 A;  2PU9 B;  4C5I A;  4M75 D;  1FX7 A;  4ZTF A;  4OB0 B;  2JUF A;  3C4S A;  1X6O A;  2EFI A;  2QI2 A;  4MML A;  4BDY A;  5FRN A;  1VUB A;  1H64 1;  2RJF A;  4OB2 B;  4C92 G;  2MMP A;  5GAN f;  4M7A D;  3LWH A;  3OYN A;  4JS5 A;  1YHQ T;  1FXX A;  2CGH A;  1VQ7 A;  5I2M A;  5KCH A;  3CC2 A;  4IUQ A;  4VUB A;  3WVE B;  4A4G A;  4CRI A;  2DJZ A;  1BI1 A;  2G3R A;  3QKJ A;  1VQ8 T;  1ZBX A;  2RI2 A;  1LJO A;  3NTK A;  3MEU A;  3QPH A;  3N5B B;  4PKC C;  1VQN A;  4M7A C;  5GMK m;  2R57 A;  3LGF A;  3SWN C;  4EPC A;  3QXE B;  4BDZ A;  1JJ2 A;  3DB3 A;  4JRP A;  2A3L A;  2EJG A;  3EAE A;  4MZP A;  2CYZ B;  3MHX A;  1QVG A;  1S72 T;  3JCM b;  1WQ7 A;  3OYB A;  1Y96 A;  3HL8 A;  3JCM h;  3TRE A;  3OYH A;  3OSV A;  2EQU A;  4XQ3 A;  4LDV A;  2GFA A;  5KCO A;  2PVG B;  5GAM h;  1OYX A;  4WF2 A;  1YIJ A;  3OYK A;  4XU1 A;  3CME A;  2JVV A;  4NOY A;  3OBW A;  3NTH A;  3MCA B;  3ZFJ A;  2DPP B;  4XU3 A;  2ZCF B;  2LCL A;  3OYA A;  1KD1 C;  4QVC A;  1N9R A;  1PSF A;  1WJS A;  2EQM A;  4M77 C;  3TEE A;  3M58 A;  5GAO l;  3CCS T;  2RH2 A;  2EAY A;  2VXE A;  2C06 A;  4ATO A;  4O6J A;  4M77 A;  4FU6 A;  3F70 A;  3CC7 T;  4OGE A;  3JB9 F;  2X35 A;  3ME9 A;  2LT4 A;  5GAN d;  3G4S T;  3CXC S;  1YJN T;  2M1H A;  3PMI A;  4FIB A;  4FSX A;  1XQH A;  2YHT A;  4HT8 A;  2WAC A;  4NL3 A;  2CKK A;  4JRI A;  2K5L A;  3I56 A;  5FU7 C;  3JCM J;  4C92 C;  1Q7Y C;  4NL2 A;  1Q86 C;  2OAU A;  5FU6 C;  1RI0 A;  2DIQ A;  2P4T A;  1VQ4 A;  2F5K A;  4LD9 K;  4M77 F;  4A54 A;  3DKM A;  3G6E T;  4LDU A;  2HAX A;  2K3Y A;  2VGN A;  2RB6 A;  3QBY A;  2PQW A;  4M75 C;  1BYM A;  1WPY A;  5GAM j;  2EQJ A;  3HFN A;  3L1A A;  2LRQ A;  5CKB A;  5A0D A;  5C6S A;  2D9T A;  3CCL T;  4JS4 A;  3NFC A;  2QQ9 A;  3QZ9 B;  5DM7 R;  4QQD A;  3V8J A;  2FB7 A;  3GNF B;  5GAN 8;  4L6V 5;  1U1S A;  4A4K A;  3BW1 A;  4A4F A;  3CD6 A;  1NPR A;  2RHU A;  3M54 A;  3TCJ A;  3OYE A;  4XAX B;  4M75 E;  3HSB A;  4BY6 C;  5GAN e;  2EJF A;  3S3N A;  1YJN A;  3FRN A;  2LNV A;  4OB3 B;  4XK8 E;  3S3M A;  2HBP A;  2EQK A;  2ZPG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...