4C8QG

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
69
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNRKLGLTVIRGTILVSLSSAEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 11
structure length 69
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qG00
2I2LA 1KQ2A 4M75D 2ZGWA 5LJ5d 3EFRA 5GAMj 1U1TA 2DKGA 2QTXA 2FYKA 3V7CA 4A53A 5GAN7 4M75E 3QSUA 4J6XA 5GAN4 4MMLA 5GAN3 3V7SA 5GMKe 3JCMg 3BFMA 4EMKB 5GANe 4XU2A 4JUVA 2EJFA 1X01A 3JCMd 1D3BA 4M7AA 4EMKA 2DZ9A 5GANf 1HXDA 2E41A 4C8QA 5LJ3j 3JCMh 4PJOD 3VU3C 5LJ5g 5LJ5f 3SWNB 4J5YA 2DEQA 4PJOF 3JCMQ 5GAOq 4C92C 5GMKl 2E65A 4PJOE 1LNXA 4M7AD 3RKYA 2EAYA 4XTUA 3FB9A 2E64A 3QHSA 4XTYA 1WQ7A 5GMKj 4C92F 4M7AE 4PJOG 3RERA 4M78A 3JCMe 5GANd 4M7DC 2VXFA 4PJOB 4M78G 4RCCA 3JCMJ 1JRIA 2DJZA 2YLCA 4XTWA 4C8QG 3JCMX 3GIBA 3BW1A 3QO3A 2E10A 1TH7A 4N0AC 2CGHA 5GAN5 4C92B 4F7UF 3L1AA 2DZCA 4NL3A 3QUIA 4J6WA 5GAMg 4C8QE 2VC8A 2DTOA 4X9CA 5GANg 5LJ3h 5GANj 3JB9D 1N9RA 1U1SA 4M7DE 4M7DF 3JCMb 4M77C 2DVEA 1D3BB 3JB9H 4C8QD 5I21A 3JCMc 4EMKC 3FIFA 2YLBA 5GMKm 2EJGA 4XU3A 4PJOA 4M7DD 4F7UB 5GAMd 5GAN8 4OP0A 5LJ5j 3JB9J 5CAIA 1Y96A 3RESA 3RKWA 4JRKA 1WPYA 4M7DB 4Y91A 2DTHA 5GAMf 2EWNA 3HFNA 1N9SA 1I81A 1KQ1A 4PJOC 4C8QB 3V8KA 2EJ9A 3AHUA 2Y90A 4MMKA 3SWNA 4M77F 5GAMe 1WNLA 1BIBA 4M78D 1I8FA 5GAN6 1LJOA 4X9DA 3RUXA 5LJ3e 3JCMf 3L2ZA 2JN0A 4C92D 4M75C 4M78E 2DXUA 4V2SA 4XTVA 3JCMW 4C8QF 4RCBA 5GANh 4HT8A 4NL2A 1JBMA 5GAMh 2VXEA 1M5Q1 4M77B 4N0AA 1I4K1 4C92E 3RKXA 5DY9A 5GAOl 3JB9G 1I5LA 1WQWA 2DTIA 1Y96B 4M77G 1HK9A 3PGGA 4M77A 4WF2A 4QVCA 4M7DG 1B34A 4M7DA 4M7AB 5GAOr 3V8LA 3HSBA 4M75G 5GAN2 2RD1A 4M77E 4EMGA 5GAOp 4HT9A 3FJPA 2DXTA 2RA2A 3INZA 4M7AC 3V8JA 4M77D 4XU1A 4J6YA 1LOJA 5LJ3d 4XTXA 3JCMV 4M75F 4XTZA 3JB9I 3BY7A 4C8QC 5LJ3g 2RB6A 4XQ3A 3EFSA 2HNIA 2YHTA 5LJ3f 5GMKh 3SWNC 4C92A 1M8VA 2RM4A 4NOYA 2E1HA 3M4GA 4M78B 4F7UG 5GAOm 3V7RA 4A54A 4F7UA 4QVDA 3HFOA 1YCYA 4XU0A 4HA8A 4M75A 4JLIA 4M75B 3SB2A 1MGQA 5GAOn 4DQ2A 4EMHA 4M7AF 1B34B 4M7AG 2FB7A 4M78C 4C92G 4F7UE 3BDUA 4JRIA 3JB9F 4PNOA 5GMKi 1BIAA 5LJ5h 3RIRA 4M78F 5LJ5e 3JCMP 1H641 2K57A
chains in the Genus database with same CATH superfamily
1PM3A 1VQKQ 2E6ZA 2KE9A 2VUBA 1PHTA 4F14A 4RG2A 3CXCS 1I5OB 2X4WA 5GMKe 4OMMA 2DIQA 1M9SA 1RABB 2EQMA 4IUUA 2YRCA 4BE2A 3HTRA 4OF1A 2CP0A 2QDYB 1S72T 1FMKA 2OI3A 1UUEA 1X2KA 4E7IA 3FB9A 1GL5A 1BI3A 2CYZB 3KUFA 2X9HA 1G3WA 4C8QG 3GIBA 1YWOA 1M3AA 2ZPHB 3BW1A 3CMEA 2E10A 1TH7A 3DLMA 3VS4A 1G3TA 2EYWA 1ARKA 4IKFA 1XJWB 1VQLA 1BCMA 2JXBA 4FSSA 3M0UA 5HK3A 1MV0B 2NWMA 2M02A 3OYNA 3OYJA 2P4TA 2VKNA 1JJ2P 3EG2A 2R5MA 4KBMB 3SWNA 1Q82U 1M3CA 4A4EA 1LJOA 1K0XA 4DEYA 3GF5A 1YBYA 1RAFB 4L6V5 1I4K1 1JXOA 4E7ZA 2HMAA 1VQLQ 3JV3A 4RTXA 2QXFA 2K5IA 4GBQA 1QVGP 2KGTA 4DBHA 2KY9A 4M77E 3RR6A 3P8BB 2LNHB 1WHMA 2RHZA 2G3RA 3SWNC 4HVUA 1ZQ1A 1S72Q 3SFMA 4LUDA 1VQ5Q 1UDLA 3JRZA 3OSVA 3OYBA 1JO8A 3CCQT 1T3SA 3OYYA 3UATA 1BI0A 2KR3A 4CC4B 1VQ9T 3IQLA 4RTYA 2PVGB 3CC4T 4MDXA 5GAN3 2X3XD 2K4YA 1ZSGA 3NFCA 2DZ9A 4FM4B 2MF2A 2QEXT 4PJOD 5LJ5f 3EAEA 2RQRA 1V76A 2KK4A 2RI5A 1K8AU 2EAYA 1MV3A 3CMAT 1VQNT 3CCRT 5KYYA 4PLIA 2VASA 2DX1A 2MK5A 3EG0A 2DL8A 3S3NA 2X35A 1N27A 3CCVT 5KE2A 1VQ4T 2ZPFB 4FCYA 1D1CA 1ZSZA 1M2OA 2CDTA 3QBYA 2CREA 5FLXE 3JCMb 3JB9H 1IHWA 1E6GA 3E9GA 3FIFA 1G8XA 4M7DD 3RESA 2QDLA 2QGFB 4LDWA 1UG1A 4JRKA 2DYIA 4JZ3A 1KQ1A 2YRVA 3CC2T 1O9SA 5FU7B 4M78D 1EX4A 4FSXA 2IPOB 1K8AC 1Y71A 4C92D 1IHVA 1UEBA 3CCVQ 2K2VA 5GANh 4HT8A 1AZGB 2DLPA 4RTZA 3GP8A 1HK9A 1WXUA 2LNVA 4B6MA 1WXBA 3OYFA 3L2VA 2DXTA 3V8JA 3I5SA 1B07A 2F5TX 3LGFA 2RNAA 1Q81R 3ASKA 2JTFA 3EHQA 3CCUT 2ENMA 2X4JA 4FT4A 8AT1B 4HA8A 1Q86R 1PWTA 2KXCA 1IRXA 3M9QA 2DETA 3H9NA 2E3IA 2RQWA 1U5SA 2OAUA 1M90R 3HKSA 1D0ZA 1YITQ 3AT1B 1QCNA 1IZ6A 2A28A 2OAWA 2JMAA 3Q1JA 3CCUQ 2CSIA 4EMKB 2D0QB 3GLXA 1X01A 1LPLA 2DEUA 1WDXA 4BD3A 4C0DB 3ER0A 2JVVA 3CCLT 1M1KR 4HCKA 3JCMQ 1X2QA 2O9SA 2QEXA 4BY6B 1H92A 5KCHA 1T0HA 3JCMe 2DJZA 3I55A 1UTIA 4P5NA 1VQ9A 4F7UF 4F17A 5IT9E 3S3MA 1QVFP 1Q95G 4J7IA 2WSCE 1WIEA 4F7UB 5CAIA 1Y96A 3QIIA 2CP2A 4JJDA 3VYGA 4A4HA 1RLQC 2EJ9A 5C0MA 2EQIA 2F5KA 1BIBA 2FO0A 4V2SA 4M78E 5J3BA 3M5AA 1M27C 4J8OA 5FRNA 1YCSB 5KYUA 2CZ7B 2QQ9A 4J9HA 1OEBA 4JJNK 5IH2A 2NUZA 1BB9A 1KC8U 4M75G 2RD1A 2JMCA 1HYOA 4DBQA 2V1RA 3ZL7C 1IB8A 2M51A 3C4SA 4DEXA 3EFSA 2EYXA 5LJ3f 1NEGA 4M78B 2QEXQ 1Q7YR 2V1QA 1VQ8T 4JLIA 1YHQQ 2HQXA 1W6XA 3M56A 3CCMQ 1ZBXA 5KYXA 4FW1A 1WHJA 5KH6A 2Z0WA 1VYUA 3V7CA 3P8HA 3V7SA 3BFMA 4OMFB 1X43A 3ZBDA 1PNJA 2LQ8A 2QGGA 1WX6A 5D6XA 4QT7A 4M7AD 2DIGA 4X34A 3X20B 5GMKj 1D0YA 1VIEA 3CC4Q 2F2WA 4M78G 2ED1A 2DFUA 4N0AC 4UC4A 1SHGA 4HXJA 1AWWA 3QUIA 4AT1B 1WI7A 2A3LA 1MNEA 5LJ3h 3OB9A 1OPLA 2ZPEB 1SPKA 3EGUA 1OPKA 2CP7A 2KSSA 3I55T 3EGXA 5I11A 4KH1B 1MMAA 3LWHA 1FMVA 2JN0A 2DXUA 1VQ5A 2L3QA 2MCNA 3REBB 5DY9A 3VS1A 1WFWA 3CXCA 3I56A 1I07A 1VIFA 2RHXA 1UGQB 3HSBA 4BE0A 1KFZA 2DMOA 2J6OA 2CS7A 1VYVA 2K2MA 2M0YA 2EFIA 4XTXA 3CCSA 4C8QC 3HRTA 1OX9A 2F2VA 2RHIA 1A0NB 3I35A 1OI1A 2WACA 1YCYA 4CC7A 4M75B 3X28B 2HL3A 2FB7A 2QAZA 1JXMA 2LDMA 1BIAA 3LYIA 5FU6B 1G3YA 2D8HA 2ESWA 5ECAA 3BE3A 2HL5C 3TEEA 3CMEQ 1KQ2A 3EFRA 3TVTA 1GBRA 2LCLA 5L23A 4OB0B 3VRZA 3OYLA 1VA7A 2ROLA 1X6BA 4JUVA 2KDSA 2OTJQ 4JJBA 3LLRA 1RAAB 3QXEB 3OS1A 2QA4Q 2RN8A 4LN2A 3CQTA 2M9UA 1QW1A 2EGAA 3OYKA 4J9EA 1NYGA 2E65A 4HCZA 1OQKA 4Z88A 4BI3A 5KYYB 1RAGB 1QKWA 3CXCP 3JCMJ 2J06A 4XTWA 4BB7A 4BDZA 1B7TA 2L5QA 5I2SA 2DZCA 2VC8A 1J3TA 5GANj 1PC0A 1N9RA 1U1SA 2FL7A 2I0NA 4M7DE 1BK2A 3M0QA 2A7YA 3OY9A 2COZA 3HRUA 2C0TA 2COYA 3A8MB 2VB6A 1ZLMA 3CCEA 4BDYA 2A08A 5IHIA 1N5ZA 4KUDK 2DTHA 2JUFA 4E6RA 2EPDA 4KGXB 3EG9B 1FXXA 2VVKA 1VQNA 4R56A 4M75C 2XKOC 1ZX6A 3CEYA 4TVRA 3QZ5B 4RCBA 1VQOQ 2ZPBB 4BY6C 2FZCB 3VS2A 2QK0A 3CPWP 2GF7A 3QG1A 4RKUE 2W0ZA 2MWPA 4C0FA 1NLOC 4HCCA 4JS5A 2XMFA 2YUQA 3M0PA 4PLLA 1YI2T 2EKHA 2YUNA 3OMGA 4ZN1A 3CCQA 5KCOA 3JCMV 4AFSC 1M1KC 3MEVA 2YHTA 1VQPT 2PUOB 4JZ4A 3CCJT 1MNDA 2L3PA 3MCAB 3CCET 3G1JA 4L5GA 4OB3B 2YUOA 1GCPA 4QKUA 4M7AG 5GMKi 2RMOA 3JCMP 2DL3A 1K9AA 2DJQA 5DLQE 2LJ1A 5GAMj 3H0IA 1PRMC 2LP5A 2DKGA 1HSQA 4N4GA 1TG0A 4IIMA 3CBOA 4J6XA 4RMOA 4B9WA 3G7ZA 2EJFA 1QVGA 1XTDA 1D3BA 4LDVA 1M4ZA 3CCEQ 2AT1B 3VUBA 1DJ7B 2CZ6B 5D6YA 3WVDB 2DPPB 3QDFA 2XICA 2KRNA 1RAIB 2CP3A 5LL6S 3EGDB 1JRIA 1GCQA 5D7UA 2A0FB 5IXFA 1W2BS 1VQOT 2BUDA 1UB4A 2L3SA 1M90C 1JB0E 5IAYA 2V8KA 4C8QE 1YJNA 2KVQG 2LX7A 1OULA 2PUKB 3DB4A 3VS0A 2EIFA 3O5ZA 2FRYA 4QQ6A 5J39A 2YDLA 3MEWA 2EWNA 1JU5C 1N9SA 3MEUA 3UT1A 5FRMA 1RAHB 1FX7A 2IG0A 2V8IA 2Y90A 3PIPA 5GAMe 4HCBA 1I8FA 2KT1A 1VQPQ 3JCMf 3M54A 2YXYA 3THKA 1YHQA 1JBMA 1Q81U 5FWBA 3RMQA 1M1FA 1OX8A 3FEOA 2AHJB 4QVCA 1YJNQ 5GAOr 2C0OA 2K3YA 5FROA 2FZGB 5A2QE 3FJPA 4Y28E 1PG5B 1NJIR 1YIJA 2O31A 4CRIA 1FWZA 2P0QA 4NOYA 2E1HA 2P84A 5GAOm 2KRSA 1ABOA 4MZTA 3A8OB 1TWBA 2NUTB 1MGQA 3C95A 2RJCA 4M78C 4JRIA 4OMPA 3QYGB 1M30A 3G71A 1D1AA 3NTHA 2ABLA 3MO8A 5LJ5d 1GFCA 1BI2A 2GTJA 4R0KA 2R57A 4D8KA 3CCMA 1TUCA 2LMJA 2YUPA 2GNCA 3CD6Q 1GXIE 5KE3A 1VQ7T 1UJYA 3VV0A 4PFZA 4C8QA 5LJ3j 3JCMh 3A5ZB 2DA9A 1KG1A 3H41A 2FEIA 2XU8A 1K76A 1Q7YC 1RADB 2E64A 3E9FA 3BDLA 4M7DC 2DXBA 2VXFA 3CMAQ 4RCCA 4J9DA 2YLCA 1RAEB 4DOWA 4WCIA 1VQMT 2CGHA 3G6EQ 2NLUA 4L59A 4J9FA 1VQ4Q 1K8AR 2LQNA 1YJNT 2EJGA 2CT4A 4IUQA 9ATCB 2OTLA 2LZ6B 4OMLA 3VRYA 4ZGJB 5KYUB 4J9GA 4FU6A 3L2ZA 1T0JA 2K7AA 1CKAA 3OYMA 1OU9A 2O88A 2KROA 4N0AA 3M58A 1BU1A 2K6DA 1WQWA 1WHGA 3TU4K 2H3EB 4JS4A 3VKIA 2HQHA 1ZUYA 3E1SA 3MHXA 2RHYA 2GTOA 4XU1A 1ABQA 1KQSA 4E7KA 3PT9A 3BY7A 2O01E 3LW5E 3OW2A 3NGPA 1AOJA 1S1NA 2JZ2A 3MKDA 4XU0A 5CKHA 4C92G 1Q82C 1T3LA 3R6NA 3GOXA 5GJWB 2E70A 3RIRA 1W70A 3RBBB 1WJQA 4ESRA 4M75E 1YI2A 1ZSZC 4ME7A 1AWJA 1JJ2A 4XU2A 4EIKA 4EMKA 2MIOA 3ZEHA 4PJOE 5HK0A 5KYWA 3OYGA 4FYYB 4OB2B 4XTYA 1UHCA 3X26B 1NM7A 3RDVA 4C92F 3CPWA 1O75A 4BI8B 4J9IA 2JW4A 4KH0B 1VOMA 2YT6A 3JCMX 4AMCA 2YRDA 5A0LA 3META 4C92B 2FPFA 2XHCA 3UWNA 3OYAA 1KD1R 4LUEA 2PNIA 4M7DF 2AK5A 5CKDA 3C12A 4RTTA 5GMKm 1WXTA 4XU3A 4AFQC 1K9MU 2SRCA 3RKWA 2CH4W 2FZKB 4M7DB 2JM9A 1PKTA 2DD4A 2GBQA 3V8KA 2B8AA 4PFOA 3VUZA 1WNLA 4R55A 4ZTFA 5FWCA 3A8GB 5LJ3e 3WVEB 1QQJA 1K1ZA 2O2OA 2VV5A 1GCQC 3NPFA 2DF6A 4OMQA 1M5Q1 1KC8C 1GBQA 2DL4A 3FC3A 5CKEA 1X69A 1YWPA 4GY5A 3CCUA 2YSQA 4M77A 4MZPA 4ZN3A 1Q81C 4M7DA 2HQEA 3JSCA 1NJIC 2DAQA 2BZ8A 4MDWA 2RA2A 2LJ3A 1W1FA 3OYCA 5LJ3d 1K9MC 3CC2A 4XTZA 2DERA 1QWEA 4VUBA 4XQ3A 2DRKA 2W10A 4KT0E 4C92A 4QVDA 1YN8A 3NTIA 3HPWA 2LCSA 2GQIA 1N8RR 2C06A 4F7UE 1W2BP 1I1JA 2KEAA 2BIVA 1LCKA 1KK7A 1FYNA 2GFAA 1X27A 4A53A 1UGSB 1WJSA 5GAN7 3UA7A 3QSUA 2RF0A 2EYYA 2X4YA 1K73C 4KULA 3WXMB 3JCMg 3H0FA 1UGPB 1YJWQ 3RMSA 1FMWA 3TSWA 4ZNXA 3D7SB 1TTHB 2OJ2A 2AZVA 1JEGA 4RG8A 2XDPA 2EYZA 1SEMA 2ZPIB 1M1GA 1SF9A 3M57A 1VQNQ 4BI4A 1NG2A 1WHLA 4N4HA 2EKOA 4KRTA 3E19A 5GAMg 2LQKA 4E7HA 4GLKA 1VQ5T 3H6ZA 4KGVB 5CR2A 1D09B 2B86A 4OP0A 5HCKA 2ZCFB 2E4HA 1ZUUA 3CC4A 5GAMf 1ZBJA 4B9XA 3M0RA 3S3OA 3I55Q 5C6SA 5M9OA 1Y7XA 3LH0A 2KYBA 3QYHB 4X1VA 4HKEA 2LTOA 4M7AF 3RKXA 3JB9G 4N4IA 2OX7A 4Y92A 3QJYA 2HBWA 1BI1A 3CCLQ 5HKCA 2RI3A 3J80E 1B34A 4RUGA 3HP9A 1K0SA 2CP6A 4EMGA 4HT9A 3QPHA 4LXCA 3QWYA 1WHKA 1SRLA 2NUTA 2CT3A 1MHNA 2X4XA 4AFZC 3EG3A 4F04B 2RQUA 1Z9ZA 1SG5A 3OBYA 2RO0A 5EC7A 2BTTA 1M3BA 1AVZC 4QQDA 3JB9F 3CBMA 4LD9K 2JM8A 2HKQB 2E3HA 2EW3A 5I2MA 2L89A 3CMET 2FRWA 2LT4A 4J83A 2OTLT 5EG2A 1UE9A 3MJXA 3CPWS 2NYSA 5DLOA 2F2XA 1K4US 1KHCA 1VQLT 3DB3A 1H3HA 2O9VA 1S72A 1EZZB 1MUZA 3PVLA 4ELYC 1CSKA 3QHSA 3OW2S 1JJ2S 1PD1A 2DL7A 2XG8D 2NUPB 3A8LB 5CO7A 3X25B 1QKXA 3QO3A 2KBTA 5GAN5 1NBEB 4M4ZA 1QP2A 1G83A 3OYHA 2J05A 4PJLA 4M77C 1OOTA 2YLBA 4PJOA 3LH5A 1UFFA 5GAN8 4C5HA 2DL5A 3LX7A 4Y91A 1OU8A 1PKSA 3CCQQ 1P92A 4MMKA 4M77F 1M8MA 2EGEA 3S6WA 1W2BA 4E7LA 3G71T 3J81E 4JJCA 4NL2A 4M77B 2VWFA 5I22A 3URGA 5J26A 3PGGA 2CH4A 1VQ6Q 3MEAA 3V8LA 1YITA 3FLGA 1Q86U 1YIJT 3UA6A 1TUGB 4A63B 2OTLQ 3TCJA 1CKBA 3TQ7P 3GBQA 2HNIA 3NMZC 2A37A 2GGRA 3OBWA 5GMKh 1GRIA 3V7RA 4A54A 1OV3A 2JTEA 3RNJA 3F70A 4FYWB 5GAOn 2KMTA 1K73U 5LJ5h 1H641 2I2LA 1VQ9Q 2PQWA 4ELZC 1SRMA 4MMLA 1XOVA 2GCXA 3LGLA 4OGCA 5GANe 4AG2C 1B3QA 5GANf 2QI2A 1HXDA 1IO6A 1C0MA 1PRLC 1U06A 2MAMA 3M53A 1BBZA 4C5GA 5HY6A 3VU3C 1WJRA 3SWNB 4F16A 5GAOq 4PKCC 1LNXA 3OSSC 1JQQA 1M2VA 5IHNA 4XTUA 1VQKA 2X51A 3G71Q 1TUDA 3C94A 2KNBB 3EFOA 1YJWT 4DOVA 3M0SA 2QQRA 1R0BG 4QQGA 1BCOA 4GLMA 3GNGA 2HDAA 2AZSA 2DXCA 2ZPGB 1KQSP 4RTWA 2DVEA 3UF4A 3MPUB 2PZ1A 2RK1A 4Z02A 1VQ4A 2QQAA 2IIMA 3OQ5A 3PTAA 1PCXA 1WZOA 3UPUA 4C8QB 5CCAA 2PTKA 2CKKA 4QW2A 1R0CB 2QQBA 2KI7A 3L2RA 2RJDA 3CMAA 4QVZA 3SD4A 2BE9B 2XIDA 2D6FA 1IGUA 3L42A 3L2QA 8ATCB 4DBRA 2D0NA 2RPNA 4C5IA 1C1AA 4Q5WA 3CCJA 2PVOB 2XDDA 5IN1A 1ZUKA 1TXQA 2QASA 2DRMA 3GNFB 1RLPC 4M7AB 1GFDA 3CCRA 3TREA 3PIOA 1K73R 1VUBA 1OZ2A 5GAOp 2J6KA 2QTVA 1AEYA 1KD1C 3VS7A 1HD3A 1M8VA 1NEBA 1SKUB 5FW9A 1B34B 3G4SQ 4JPBW 4ATOA 2ZGWA 3EH2A 1U1TA 1RI0A 1NZ9A 5GAN4 1ZA2B 1Q7YU 1ZA1B 2V26A 3EH1A 5D6WA 3PMIA 4EDUA 1PSFA 6AT1B 2J6FA 2BZXA 2BKDN 1M90U 4KUIA 4PFPA 2L3RA 1ACMB 1WQ7A 3VJPA 1K9MR 4A4KA 1KHIA 3JAME 5KYWB 4CI0C 4OB1B 4LDUA 4FW2A 1Q82R 2O4XB 1TOVA 2DBKA 2COWA 3EGDA 4XAXB 1YJ9Q 1YP5A 2XDBA 2K5FA 2DE0X 3C0CA 1TU0B 2MOXA 2MYSA 1VQ8Q 1QCFA 4PL6A 5IHKA 4JRQA 3A98A 4IURA 2HAXA 4O5VA 1UGRB 1Y07A 2DK3A 1YJWA 1I81A 1D0XA 1R8OB 4DBFA 2Y4XA 5A0DA 2VXEA 2RI2A 3SDZA 1NLPC 4PJJA 3NHNA 4HVWA 4DA4A 4M77G 2K5LA 4M7DG 2HD0A 1YI2Q 1G3SA 3CC7Q 3OS0A 2RHUA 3FDRA 3QZ9B 4J7FA 2EQUA 1V29B 4XK8E 2LJ0A 2M1HA 4AFUC 2HEQA 2GQVA 3UDCA 4C0GA 4F7UA 1VQ7A 4BUGA 2GFUA 1VQ6T 3CBPA 2BZYA 1YIJQ 3CCMT 1M1KU 2QYZA 2EQJA 1E7OA 1UHFA 2P0KA 1BKBA 2MMPA 2QTXA 4IUVA 1SSHA 2RH2A 2JNGA 4PJNA 2LT1A 1G2BA 4E47A 4ANJA 3U23A 3OYIA 1Q86C 2HKNA 4PJOF 3G6EA 2F1LA 3NTKA 4EPCA 4M7AE 1H8KA 1RL2A 3EHRA 3REAB 1WA7A 2ED0A 1N8RC 2EVRA 2P4RA 4C0ZA 2BE7D 3L1AA 3FJ5A 4J6WA 2DVJA 2J7IA 2JJ9A 2KRMA 3PVQA 1YHQT 2DM1A 2EGCA 1UJ0A 1D3BB 2LQWA 3CCSQ 3PNWC 2LC4A 4LD6A 5CKBA 4OGEA 3CD6A 1QVPA 2K9GA 1WPYA 2V8JA 2L0AA 3CC2Q 3HFNA 3EGXB 3I5RA 2K79A 1SSFA 3I56Q 3RUXA 1NYFA 4OMNA 2F69A 2RJFA 3H8ZA 4C8QF 4Z8AA 3A1PA 1I5LA 2JS0A 1MMGA 1VQOA 4FYVB 3DKMA 1Y96B 4LDXA 2D9TA 3EFOB 3MP1A 3L2WA 2H8HA 4A4FA 4D6WA 1KSWA 3MP8A 3EG9A 1LVKA 2O4XA 2EQKA 5LJ3g 4BACA 1G5VA 1WYXA 4OMOA 2VGNA 4M75A 1PSEA 3M4YA 1OYXA 4HVVA 4A4GA 5CQXA 1NE8A 2DILA 5CKFA 1KQSS 4PNOA 2KYMA 2XD0A 4NS5A 2Y4YA 3PFSA 4IUPA 1EFNA 3FRNA 4KGZB 4M75D 1VQMA 4PK4A 1AZEA 3HHTB 1U8RA 1PD0A 3ULRB 4ZGDB 1RACB 1I0CA 2DD5A 3JCMd 2OTJT 4Z89A 2AKLA 1VQ7Q 2PU9B 3R6OA 1W4SA 2LCCA 2QA4T 5LJ5g 2FPEA 3G4ST 2DEQA 2D8JA 4C92C 3P8DA 5CVIA 2AKKA 2K3BA 2SEMA 5AYFA 3KFVA 5FU7C 2ECZA 3G6ET 2DBMA 2CSQA 2NUPA 4X9CA 2ZZDA 2EYQA 1AD5A 3KBGA 2KQWA 2CUDA 2FHDA 1Z9QA 3CC7T 4J9BA 1KC8R 1E6HA 4IUTA 2E5QA 3HL8A 4X9DA 1YJ9T 3MP6A 2MPXC 3KXTA 5FU6C 1WLPB 4XTVA 1NJIU 2HZYA 5GAOl 3J7AF 3O8VA 1D1BA 2C0IA 2RK2A 5KYXB 4J9CA 4E7JA 3OA6A 1KJWA 1IGQA 1ZSZB 1AT1B 3T9NA 3INZA 4M7AC 4BE1A 4M77D 1U3OA 1LOJA 2WSEE 4M75F 5L8RE 2R5AA 1ZHIA 3GPLA 2G6FX 3QJ6A 5CK9A 1VYTA 2ATCB 2CZ1B 1AWOA 5A0GA 1QVFS 3L2UA 2ROTA 4LE9A 3I9QA 2AIRB 2QG9B 3QKJA 3X24B 2X3WD 3QWXX 4JLGA 2HSEB 3OMCA 4D8DA 1RUWA 1TSFA 2KT8A 1M2VB 4E7SA 1SHFA 2E41A 2HSPA 1BYMA 2JTMA 4LDYA 2E12A 2HBPA 1KD1U 3CCST 3SHWA 1QCOA 2DYBA 4C0DC 3CCVA 1QMCA 3CPFA 4JDSA 1HJDA 2A36A 4C5EA 4ZGEB 3OW2P 3VS5A 2KXDA 4PJOB 2YWWA 3I56T 1EIFA 3PMTA 3SEMA 3VS6A 2LRQA 1YFNA 2RQTA 3CCJQ 1RI9A 2DTOA 3JB9D 4C8QD 4EMKC 1X6GA 1YJ9A 5GAMd 5LJ5j 1NPPA 3CC7A 4FYXB 1VQPA 4JRPA 4RTVA 4E2FB 4YTLA 1MMDA 2CZ0B 3M55A 3H0HA 2PVDB 3JCMW 2VGMA 4AG1C 2K3XA 5GAMh 3G4SA 1QVGS 2DTIA 2R58A 2FPDA 1OZ3A 2E6NA 2JS2A 1Y0MA 4FL6A 1NPRA 5GAN2 1AHJB 4J6YA 2VYTA 3JB9I 2RB6A 5CIUA 2DNUA 2QA4A 2M16A 3PE0A 3M0TA 2OTJA 4II1A 1F1BB 2L8DA 4EMHA 2RJEA 4ORZA 4M78F 3LWIA 4WTOB 2EBPA 4IIOA 5CQYA 2L2PA 1UGVA 1IXDA 4LNPA 2FYKA 1V1CA 3CCRQ 2ZAEA 3EG1A 5KYNA 1X6OA 3QDRB 1VQ8A 2DO3A 4CC3A 4M7AA 3OYEA 1QP3A 2P0PA 3VYHB 2KAFA 3ME9A 3TSZA 4J5YA 5GMKl 1MMNA 2XI9A 2LX9A 3RKYA 3OYDA 2D1XA 4PJOG 3RERA 4M78A 5GANd 3N5BB 1VQKT 3HRSA 3OS5A 1KIKA 4NL3A 5IXBA 1Y57A 5GANg 1TS9A 4MZMA 3ZFJA 4CC2A 2JOYA 2QQSA 3JCMc 5I21A 2H3JA 5AT1B 1IREB 2FVUA 3JB9J 2LVMA 4K11A 2FG0A 2XK0A 3M59A 2HCKA 4PJOC 2MWOA 3AHUA 3CD6T 1N6AA 5GAN6 4FT2A 1R77A 3A8HB 1YNZA 4C92E 1AWXA 3VS3A 2WSFE 2RQVA 2CP5A 4RTUA 2M0OA 1XQHA 4WF2A 3OS2A 1WHHA 2E5KA 1N8RU 1H3ZA 1QWFA 4FIBA 7AT1B 2CUBA 4ZTJA 1VQMQ 1QVFA 2MI6A 1QLYA 1YITT 1UECA 2JT4A 3CCLA 2RM4A 5GJVB 1VQ6A 3M4GA 4F7UG 1C6VX 3HFOA 1X75C 4O6JA 3SB2A 2IVWA 4DQ2A 5DM7R 3BDUA 4OVAA 3E2UA 1XNIA 4PJMA 5LJ5e 3DLLA 1WGSA 2K57A
chains in the Genus database with same CATH topology
3TEEA 1KQ2A 3EFRA 2GFAA 2E6ZA 2MMPA 2QTXA 4IUVA 2RH2A 1UGSB 1WJSA 2JNGA 4A53A 5GAN7 2LCLA 2VUBA 3QSUA 4OB0B 2LT1A 3OYLA 4RG2A 3CXCS 2X4YA 1K73C 4KULA 2X4WA 3WXMB 5GMKe 3JCMg 1UGPB 2DIQA 1M9SA 4E47A 4JUVA 3RMSA 2EQMA 4IUUA 2KDSA 4BE2A 4OF1A 3LLRA 3OYIA 1Q86C 3QXEB 2QDYB 3OS1A 1S72T 2M9UA 1QW1A 4PJOF 3OYKA 3G6EA 2E65A 4HCZA 4RG8A 2XDPA 4E7IA 3FB9A 2ZPIB 3NTKA 1M1GA 1BI3A 4BI3A 4EPCA 4M7AE 2CYZB 3M57A 1RL2A 3KUFA 3JCMJ 1G3WA 1K9MC 4BI4A 4XTWA 4C8QG 3GIBA 2ZPHB 3BW1A 4N4HA 4BB7A 3CMEA 1N8RC 4BDZA 2E10A 1TH7A 2EKOA 3DLMA 2L5QA 4C0ZA 3L1AA 2DZCA 1G3TA 3E19A 5I2SA 4J6WA 5GAMg 4IKFA 1VQLA 2VC8A 5GAMe 2LQKA 5GANj 1N9RA 1U1SA 2FL7A 4E7HA 1YHQT 4GLKA 1VQ5T 3H6ZA 4M7DE 2A7YA 1D3BB 3OY9A 5HK3A 5CR2A 3HRUA 3PNWC 2LC4A 3A8MB 4LD6A 4OP0A 4OGEA 5CKBA 3CCEA 4BDYA 3CD6A 3OYNA 2ZCFB 1QVPA 1WPYA 2P4TA 2V8JA 3OYJA 3CC4A 2DTHA 5GAMf 4KUDK 3HFNA 2R5MA 2JUFA 4KBMB 4B9XA 3S3OA 1SSFA 3SWNA 5C6SA 1Q82U 5M9OA 1Y7XA 3LH0A 4A4EA 1LJOA 1FXXA 3RUXA 1VQNA 4R56A 3QYHB 2F69A 2XKOC 3CEYA 4M75C 2RJFA 4TVRA 3H8ZA 3QZ5B 4C8QF 4RCBA 4HKEA 2LTOA 2ZPBB 4BY6C 3GF5A 1YBYA 4M7AF 4L6V5 1I4K1 3RKXA 1I5LA 3JB9G 4N4IA 2GF7A 3QG1A 4RKUE 1VQOA 2QXFA 3QJYA 3DKMA 1Y96B 2MWPA 1BI1A 2D9TA 2K5IA 2RI3A 4C0FA 5HKCA 4LDXA 3J80E 4HCCA 1B34A 3MP1A 4JS5A 3L2WA 3HP9A 2KY9A 4A4FA 4D6WA 4PLLA 4M77E 1YI2T 4EMGA 3P8BB 4HT9A 3MP8A 3QPHA 2O4XA 3OMGA 4ZN1A 3CCQA 1MHNA 2EQKA 2RHZA 5KCOA 3JCMV 1M1KC 2X4XA 5LJ3g 3MEVA 2G3RA 2YHTA 4BACA 1VQPT 1G5VA 3SWNC 1ZQ1A 2PUOB 3CCJT 3SFMA 3MCAB 3CCET 4L5GA 2VGNA 3OBYA 2RO0A 4M75A 4OB3B 1PSEA 3M4YA 1OYXA 4M7AG 4A4GA 5CQXA 1NE8A 5CKFA 3JRZA 3OSVA 4PNOA 4QQDA 5GMKi 3OYBA 1KQSS 3JB9F 3CBMA 2XD0A 4NS5A 2Y4YA 3PFSA 3JCMP 4LD9K 4IUPA 5DLQE 3FRNA 3CCQT 3OYYA 4M75D 5GAMj 1BI0A 5I2MA 1VQ9T 1VQMA 2L89A 2DKGA 3CMET 4N4GA 3CC4T 2PVGB 4J83A 2LT4A 3CBOA 4J6XA 3HHTB 5EG2A 2OTLT 4MDXA 5GAN3 4RMOA 1U8RA 2K4YA 4ZGDB 4B9WA 3CPWS 2DD5A 3G7ZA 2EJFA 3NFCA 1XTDA 1D3BA 3JCMd 4LDVA 1M4ZA 2DZ9A 5DLOA 2PU9B 3R6OA 4FM4B 1BYMA 2MF2A 1W4SA 3VUBA 2QEXT 2LCCA 2QA4T 5LJ5g 5LJ5f 4PJOD 3EAEA 1KHCA 3G4ST 1DJ7B 1VQLT 2DEQA 3DB3A 2CZ6B 5D6YA 2KK4A 2RI5A 4C92C 3P8DA 3WVDB 1S72A 5CVIA 1K8AU 3CC2T 2DPPB 2XICA 2EAYA 4ELYC 3QHSA 3CMAT 3OW2S 1VQNT 1JJ2S 2XG8D 5LL6S 3CCRT 4PLIA 5AYFA 1JRIA 3A8LB 5CO7A 5FU7C 3X25B 1W2BS 3QO3A 4HCBA 3S3NA 2BUDA 2X35A 1UB4A 5GAN5 1VQOT 1M90C 1N27A 1JB0E 3CCVT 5KE2A 5IAYA 3G6ET 1VQ4T 2V8KA 3PIPA 4C8QE 1QP2A 2ZPFB 1BKBA 4X9CA 3OYHA 2ZZDA 1YJNA 2EYQA 2KVQG 3QBYA 5FLXE 4M77C 3JCMb 3JB9H 2PUKB 3DB4A 3E9GA 3FIFA 2YLBA 4PJOA 4M7DD 5GAN8 4C5HA 2EIFA 3KBGA 3RESA 4QQ6A 4LDWA 5J39A 4JRKA 2KQWA 3LX7A 4Y91A 3MEWA 2EWNA 2FHDA 1N9SA 1KQ1A 3MEUA 3UT1A 5FRMA 2YRVA 3CC7T 2IG0A 2V8IA 1FX7A 1P92A 1O9SA 2E5QA 2Y90A 3HL8A 4IUTA 4M77F 1I8FA 4M78D 5FU7B 3S6WA 4FSXA 4X9DA 4E7LA 3G71T 1K8AC 1YJ9T 1Y71A 3MP6A 3JCMf 3M54A 1UEBA 5FU6C 4C92D 3J81E 3KXTA 4XTVA 1NJIU 2K2VA 5GANh 1YHQA 4HT8A 4NL2A 1JBMA 1Q81U 4M77B 3RMQA 5GAOl 3J7AF 3O8VA 3URGA 1M1FA 2RK2A 5J26A 3FEOA 2AHJB 3GP8A 1HK9A 3PGGA 4E7JA 4QVCA 3OA6A 2LNVA 5GAOr 3MEAA 3V8LA 1YITA 3FLGA 2K3YA 5FROA 1Q86U 1YIJT 3OYFA 3T9NA 5A2QE 3L2VA 3FJPA 2DXTA 3INZA 4M7AC 4Y28E 4BE1A 3V8JA 4M77D 3LGFA 2F5TX 1LOJA 2WSEE 1YIJA 4M75F 3TCJA 4CRIA 5L8RE 3ASKA 2JTFA 1FWZA 2R5AA 2HNIA 1ZHIA 3CCUT 3OBWA 2P0QA 5GMKh 2X4JA 4FT4A 4NOYA 2E1HA 3GPLA 5GAOm 3V7RA 4A54A 4MZTA 3A8OB 3F70A 3QJ6A 5CK9A 4HA8A 5GAOn 1MGQA 2CZ1B 3DLLA 2KMTA 3C95A 1K73U 2RJCA 4M78C 3M9QA 4JRIA 5A0GA 1QVFS 3L2UA 5LJ5h 3QYGB 3G71A 1H641 3QKJA 3NTHA 2I2LA 3MO8A 2OAUA 3X24B 5LJ5d 3HKSA 1BI2A 2R57A 3CCMA 2PQWA 4JLGA 4ELZC 3OMCA 1IZ6A 4MMLA 1GXIE 1XOVA 3Q1JA 5KE3A 2GCXA 4EMKB 2D0QB 3LGLA 3GLXA 4OGCA 5GANe 1VQ7T 1X01A 3VV0A 5GANf 2QI2A 4BD3A 1HXDA 2E41A 2MAMA 3M53A 4C0DB 4C8QA 3ER0A 4C5GA 2JTMA 5LJ3j 3JCMh 2JVVA 4LDYA 5HY6A 3A5ZB 3VU3C 3CCLT 2E12A 1WJRA 2HBPA 1KD1U 3CCST 3SWNB 1KG1A 3JCMQ 5GAOq 4PKCC 4C0DC 1QVGA 3CCVA 1LNXA 2XU8A 3CPFA 3OSSC 4JDSA 2QEXA 1Q7YC 4BY6B 4XTUA 2E64A 5KCHA 1VQKA 3E9FA 3BDLA 4C5EA 4ZGEB 3JCMe 4M7DC 2DXBA 2VXFA 4PJOB 4RCCA 3C94A 3I56T 2DJZA 2YLCA 1EIFA 3I55A 3PMTA 1YJWT 4DOVA 4DOWA 2LRQA 2QQRA 4P5NA 1VQMT 1VQ9A 2CGHA 4F7UF 4QQGA 5IT9E 3GNGA 3S3MA 2NLUA 2DTOA 4L59A 3JB9D 2DXCA 2ZPGB 4J7IA 2DVEA 2WSCE 4C8QD 4EMKC 1YJ9A 2RK1A 1YJNT 2EJGA 4Z02A 4IUQA 4F7UB 5GAMd 5LJ5j 1NPPA 1VQ4A 5CAIA 2QQAA 1Y96A 3QIIA 3OQ5A 3PTAA 3CC7A 2OTLA 3UPUA 3VYGA 1VQPA 4A4HA 4C8QB 5CCAA 2EJ9A 5C0MA 4JRPA 2F5KA 2CKKA 4QW2A 4ZGJB 1BIBA 4YTLA 2QQBA 2CZ0B 3L2RA 3CMAA 2RJDA 4FU6A 3M55A 3L2ZA 4QVZA 3SD4A 3OYMA 4M78E 4V2SA 2PVDB 2XIDA 5J3BA 3JCMW 3M5AA 2VGMA 3L42A 2K3XA 3L2QA 2D6FA 5GAMh 4N0AA 3M58A 4J8OA 4C5IA 3G4SA 5FRNA 1QVGS 2CZ7B 1WQWA 2DTIA 2QQ9A 4Q5WA 3TU4K 3CCJA 4JJNK 2PVOB 2XDDA 3VKIA 5IN1A 2R58A 4JS4A 1OZ3A 2E6NA 3GNFB 3E1SA 1KC8U 4M7AB 3CCRA 4FL6A 1NPRA 3MHXA 3TREA 4M75G 5GAN2 1VUBA 1OZ2A 1AHJB 2RD1A 5GAOp 3PIOA 2RHYA 4XU1A 4J6YA 1KQSA 4E7KA 1KD1C 3PT9A 2VYTA 3JB9I 3BY7A 3C4SA 2RB6A 3EFSA 2O01E 5CIUA 2P0KA 2QA4A 3LW5E 5LJ3f 3OW2A 2M16A 1M8VA 2JZ2A 4M78B 2OTJA 1VQ8T 4XU0A 4II1A 4JLIA 2L8DA 4EMHA 1B34B 2RJEA 5CKHA 4C92G 1Q82C 2HQXA 3GOXA 3M56A 2E70A 4M78F 3RIRA 1ZBXA 3LWIA 4ATOA 5KH6A 2ZGWA 5CQYA 1U1TA 2FYKA 3V7CA 1RI0A 1WJQA 1NZ9A 4M75E 3P8HA 1YI2A 5GAN4 1Q7YU 3V7SA 1X6OA 3QDRB 3BFMA 4ME7A 1VQ8A 1JJ2A 2DO3A 4XU2A 5D6WA 4M7AA 3PMIA 4EMKA 4OMFB 1QP3A 3OYEA 2P0PA 4EDUA 3ZBDA 2LQ8A 3VYHB 2KAFA 3ME9A 1PSFA 4J5YA 3ZEHA 5D6XA 5GMKl 2XI9A 2BKDN 4PJOE 1M90U 4M7AD 2DIGA 4X34A 2LX9A 3X20B 3RKYA 4KUIA 5HK0A 3OYGA 4OB2B 4XTYA 3OYDA 2L3RA 1WQ7A 3VJPA 3X26B 4C92F 5GMKj 3CPWA 1O75A 4PJOG 4A4KA 4M78A 1VIEA 4BI8B 5GANd 3RERA 4M78G 1KHIA 3N5BB 3JAME 3JCMX 1VQKT 4CI0C 3HRSA 5A0LA 3META 4OB1B 4LDUA 4N0AC 4UC4A 3OS5A 4C92B 2O4XB 4NL3A 2XHCA 3QUIA 4XAXB 3UWNA 3OYAA 2A3LA 2K5FA 2XDBA 5GANg 5LJ3h 4MZMA 3ZFJA 3OB9A 4M7DF 5CKDA 2JOYA 2QQSA 3C12A 2ZPEB 3JCMc 2H3JA 5I21A 5GMKm 1IREB 4XU3A 2FVUA 3JB9J 1K9MU 2LVMA 4PL6A 4JRQA 3M59A 2XK0A 3RKWA 4IURA 2HAXA 4O5VA 1UGRB 4M7DB 1Y07A 2DK3A 2KSSA 3I55T 1YJWA 1W2BA 1I81A 2DD4A 4PJOC 3V8KA 2B8AA 2MWOA 3AHUA 3VUZA 3CD6T 1N6AA 1WNLA 4R55A 4ZTFA 5GAN6 3A8GB 5LJ3e 1R8OB 3LWHA 3WVEB 2JN0A 2VV5A 2DXUA 4FT2A 1VQ5A 3A8HB 2Y4XA 5A0DA 2VXEA 1M5Q1 2RI2A 4C92E 1KC8C 5DY9A 3SDZA 2WSFE 3FC3A 5CKEA 4DA4A 4M77G 3CXCA 2M0OA 4GY5A 3CCUA 1XQHA 2K5LA 4M77A 4WF2A 3I56A 4M7DG 4MZPA 4ZN3A 1Q81C 3OS2A 4M7DA 2HD0A 2HQEA 1VIFA 2RHXA 1UGQB 1N8RU 3HSBA 3JSCA 1NJIC 2DAQA 1H3ZA 4BE0A 4FIBA 4MDWA 1G3SA 2RA2A 3OS0A 2RHUA 2CS7A 3FDRA 4ZTJA 2MI6A 3OYCA 1QVFA 3QZ9B 2EFIA 4J7FA 2EQUA 4XTXA 5LJ3d 1YITT 1V29B 4XK8E 4XTZA 3CCSA 2M1HA 4C8QC 3CC2A 4VUBA 4XQ3A 3CCLA 3HRTA 2GQVA 4KT0E 4C92A 2RM4A 1VQ6A 3M4GA 2RHIA 3UDCA 4C0GA 1OI1A 4F7UG 2WACA 4F7UA 4QVDA 3HFOA 1YCYA 1VQ7A 3NTIA 4BUGA 1X75C 4O6JA 4M75B 3HPWA 2GFUA 2IVWA 3SB2A 4DQ2A 3X28B 5DM7R 2C06A 1VQ6T 2FB7A 4F7UE 3BDUA 2LDMA 2BIVA 2OTJT 3CBPA 1M1KU 1BIAA 3CCMT 4MMKA 3LYIA 2EQJA 4OVAA 1XNIA 5LJ5e 5FU6B 1G3YA 1WGSA 2K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  1KQ2 A;  4M75 D;  2ZGW A;  5LJ5 d;  3EFR A;  5GAM j;  1U1T A;  2DKG A;  2QTX A;  2FYK A;  3V7C A;  4A53 A;  5GAN 7;  4M75 E;  3QSU A;  4J6X A;  5GAN 4;  4MML A;  5GAN 3;  3V7S A;  5GMK e;  3JCM g;  3BFM A;  4EMK B;  5GAN e;  4XU2 A;  4JUV A;  2EJF A;  1X01 A;  3JCM d;  1D3B A;  4M7A A;  4EMK A;  2DZ9 A;  5GAN f;  1HXD A;  2E41 A;  4C8Q A;  5LJ3 j;  3JCM h;  4PJO D;  3VU3 C;  5LJ5 g;  5LJ5 f;  3SWN B;  4J5Y A;  2DEQ A;  4PJO F;  3JCM Q;  5GAO q;  4C92 C;  5GMK l;  2E65 A;  4PJO E;  1LNX A;  4M7A D;  3RKY A;  2EAY A;  4XTU A;  3FB9 A;  2E64 A;  3QHS A;  4XTY A;  1WQ7 A;  5GMK j;  4C92 F;  4M7A E;  4PJO G;  3RER A;  4M78 A;  3JCM e;  5GAN d;  4M7D C;  2VXF A;  4PJO B;  4M78 G;  4RCC A;  3JCM J;  1JRI A;  2DJZ A;  2YLC A;  4XTW A;  4C8Q G;  3JCM X;  3GIB A;  3BW1 A;  3QO3 A;  2E10 A;  1TH7 A;  4N0A C;  2CGH A;  5GAN 5;  4C92 B;  4F7U F;  3L1A A;  2DZC A;  4NL3 A;  3QUI A;  4J6W A;  5GAM g;  4C8Q E;  2VC8 A;  2DTO A;  4X9C A;  5GAN g;  5LJ3 h;  5GAN j;  3JB9 D;  1N9R A;  1U1S A;  4M7D E;  4M7D F;  3JCM b;  4M77 C;  2DVE A;  1D3B B;  3JB9 H;  4C8Q D;  5I21 A;  3JCM c;  4EMK C;  3FIF A;  2YLB A;  5GMK m;  2EJG A;  4XU3 A;  4PJO A;  4M7D D;  4F7U B;  5GAM d;  5GAN 8;  4OP0 A;  5LJ5 j;  3JB9 J;  5CAI A;  1Y96 A;  3RES A;  3RKW A;  4JRK A;  1WPY A;  4M7D B;  4Y91 A;  2DTH A;  5GAM f;  2EWN A;  3HFN A;  1N9S A;  1I81 A;  1KQ1 A;  4PJO C;  4C8Q B;  3V8K A;  2EJ9 A;  3AHU A;  2Y90 A;  4MMK A;  3SWN A;  4M77 F;  5GAM e;  1WNL A;  1BIB A;  4M78 D;  1I8F A;  5GAN 6;  1LJO A;  4X9D A;  3RUX A;  5LJ3 e;  3JCM f;  3L2Z A;  2JN0 A;  4C92 D;  4M75 C;  4M78 E;  2DXU A;  4V2S A;  4XTV A;  3JCM W;  4C8Q F;  4RCB A;  5GAN h;  4HT8 A;  4NL2 A;  1JBM A;  5GAM h;  2VXE A;  1M5Q 1;  4M77 B;  4N0A A;  1I4K 1;  4C92 E;  3RKX A;  5DY9 A;  5GAO l;  3JB9 G;  1I5L A;  1WQW A;  2DTI A;  1Y96 B;  4M77 G;  1HK9 A;  3PGG A;  4M77 A;  4WF2 A;  4QVC A;  4M7D G;  1B34 A;  4M7D A;  4M7A B;  5GAO r;  3V8L A;  3HSB A;  4M75 G;  5GAN 2;  2RD1 A;  4M77 E;  4EMG A;  5GAO p;  4HT9 A;  3FJP A;  2DXT A;  2RA2 A;  3INZ A;  4M7A C;  3V8J A;  4M77 D;  4XU1 A;  4J6Y A;  1LOJ A;  5LJ3 d;  4XTX A;  3JCM V;  4M75 F;  4XTZ A;  3JB9 I;  3BY7 A;  4C8Q C;  5LJ3 g;  2RB6 A;  4XQ3 A;  3EFS A;  2HNI A;  2YHT A;  5LJ3 f;  5GMK h;  3SWN C;  4C92 A;  1M8V A;  2RM4 A;  4NOY A;  2E1H A;  3M4G A;  4M78 B;  4F7U G;  5GAO m;  3V7R A;  4A54 A;  4F7U A;  4QVD A;  3HFO A;  1YCY A;  4XU0 A;  4HA8 A;  4M75 A;  4JLI A;  4M75 B;  3SB2 A;  1MGQ A;  5GAO n;  4DQ2 A;  4EMH A;  4M7A F;  1B34 B;  4M7A G;  2FB7 A;  4M78 C;  4C92 G;  4F7U E;  3BDU A;  4JRI A;  3JB9 F;  4PNO A;  5GMK i;  1BIA A;  5LJ5 h;  3RIR A;  4M78 F;  5LJ5 e;  3JCM P;  1H64 1;  2K57 A; 
#chains in the Genus database with same CATH topology
 1PM3 A;  1VQK Q;  2E6Z A;  2KE9 A;  2VUB A;  1PHT A;  4F14 A;  4RG2 A;  3CXC S;  1I5O B;  2X4W A;  5GMK e;  4OMM A;  2DIQ A;  1M9S A;  1RAB B;  2EQM A;  4IUU A;  2YRC A;  4BE2 A;  3HTR A;  4OF1 A;  2CP0 A;  2QDY B;  1S72 T;  1FMK A;  2OI3 A;  1UUE A;  1X2K A;  4E7I A;  3FB9 A;  1GL5 A;  1BI3 A;  2CYZ B;  3KUF A;  2X9H A;  1G3W A;  4C8Q G;  3GIB A;  1YWO A;  1M3A A;  2ZPH B;  3BW1 A;  3CME A;  2E10 A;  1TH7 A;  3DLM A;  3VS4 A;  1G3T A;  2EYW A;  1ARK A;  4IKF A;  1XJW B;  1VQL A;  1BCM A;  2JXB A;  4FSS A;  3M0U A;  5HK3 A;  1MV0 B;  2NWM A;  2M02 A;  3OYN A;  3OYJ A;  2P4T A;  2VKN A;  1JJ2 P;  3EG2 A;  2R5M A;  4KBM B;  3SWN A;  1Q82 U;  1M3C A;  4A4E A;  1LJO A;  1K0X A;  4DEY A;  3GF5 A;  1YBY A;  1RAF B;  4L6V 5;  1I4K 1;  1JXO A;  4E7Z A;  2HMA A;  1VQL Q;  3JV3 A;  4RTX A;  2QXF A;  2K5I A;  4GBQ A;  1QVG P;  2KGT A;  4DBH A;  2KY9 A;  4M77 E;  3RR6 A;  3P8B B;  2LNH B;  1WHM A;  2RHZ A;  2G3R A;  3SWN C;  4HVU A;  1ZQ1 A;  1S72 Q;  3SFM A;  4LUD A;  1VQ5 Q;  1UDL A;  3JRZ A;  3OSV A;  3OYB A;  1JO8 A;  3CCQ T;  1T3S A;  3OYY A;  3UAT A;  1BI0 A;  2KR3 A;  4CC4 B;  1VQ9 T;  3IQL A;  4RTY A;  2PVG B;  3CC4 T;  4MDX A;  5GAN 3;  2X3X D;  2K4Y A;  1ZSG A;  3NFC A;  2DZ9 A;  4FM4 B;  2MF2 A;  2QEX T;  4PJO D;  5LJ5 f;  3EAE A;  2RQR A;  1V76 A;  2KK4 A;  2RI5 A;  1K8A U;  2EAY A;  1MV3 A;  3CMA T;  1VQN T;  3CCR T;  5KYY A;  4PLI A;  2VAS A;  2DX1 A;  2MK5 A;  3EG0 A;  2DL8 A;  3S3N A;  2X35 A;  1N27 A;  3CCV T;  5KE2 A;  1VQ4 T;  2ZPF B;  4FCY A;  1D1C A;  1ZSZ A;  1M2O A;  2CDT A;  3QBY A;  2CRE A;  5FLX E;  3JCM b;  3JB9 H;  1IHW A;  1E6G A;  3E9G A;  3FIF A;  1G8X A;  4M7D D;  3RES A;  2QDL A;  2QGF B;  4LDW A;  1UG1 A;  4JRK A;  2DYI A;  4JZ3 A;  1KQ1 A;  2YRV A;  3CC2 T;  1O9S A;  5FU7 B;  4M78 D;  1EX4 A;  4FSX A;  2IPO B;  1K8A C;  1Y71 A;  4C92 D;  1IHV A;  1UEB A;  3CCV Q;  2K2V A;  5GAN h;  4HT8 A;  1AZG B;  2DLP A;  4RTZ A;  3GP8 A;  1HK9 A;  1WXU A;  2LNV A;  4B6M A;  1WXB A;  3OYF A;  3L2V A;  2DXT A;  3V8J A;  3I5S A;  1B07 A;  2F5T X;  3LGF A;  2RNA A;  1Q81 R;  3ASK A;  2JTF A;  3EHQ A;  3CCU T;  2ENM A;  2X4J A;  4FT4 A;  8AT1 B;  4HA8 A;  1Q86 R;  1PWT A;  2KXC A;  1IRX A;  3M9Q A;  2DET A;  3H9N A;  2E3I A;  2RQW A;  1U5S A;  2OAU A;  1M90 R;  3HKS A;  1D0Z A;  1YIT Q;  3AT1 B;  1QCN A;  1IZ6 A;  2A28 A;  2OAW A;  2JMA A;  3Q1J A;  3CCU Q;  2CSI A;  4EMK B;  2D0Q B;  3GLX A;  1X01 A;  1LPL A;  2DEU A;  1WDX A;  4BD3 A;  4C0D B;  3ER0 A;  2JVV A;  3CCL T;  1M1K R;  4HCK A;  3JCM Q;  1X2Q A;  2O9S A;  2QEX A;  4BY6 B;  1H92 A;  5KCH A;  1T0H A;  3JCM e;  2DJZ A;  3I55 A;  1UTI A;  4P5N A;  1VQ9 A;  4F7U F;  4F17 A;  5IT9 E;  3S3M A;  1QVF P;  1Q95 G;  4J7I A;  2WSC E;  1WIE A;  4F7U B;  5CAI A;  1Y96 A;  3QII A;  2CP2 A;  4JJD A;  3VYG A;  4A4H A;  1RLQ C;  2EJ9 A;  5C0M A;  2EQI A;  2F5K A;  1BIB A;  2FO0 A;  4V2S A;  4M78 E;  5J3B A;  3M5A A;  1M27 C;  4J8O A;  5FRN A;  1YCS B;  5KYU A;  2CZ7 B;  2QQ9 A;  4J9H A;  1OEB A;  4JJN K;  5IH2 A;  2NUZ A;  1BB9 A;  1KC8 U;  4M75 G;  2RD1 A;  2JMC A;  1HYO A;  4DBQ A;  2V1R A;  3ZL7 C;  1IB8 A;  2M51 A;  3C4S A;  4DEX A;  3EFS A;  2EYX A;  5LJ3 f;  1NEG A;  4M78 B;  2QEX Q;  1Q7Y R;  2V1Q A;  1VQ8 T;  4JLI A;  1YHQ Q;  2HQX A;  1W6X A;  3M56 A;  3CCM Q;  1ZBX A;  5KYX A;  4FW1 A;  1WHJ A;  5KH6 A;  2Z0W A;  1VYU A;  3V7C A;  3P8H A;  3V7S A;  3BFM A;  4OMF B;  1X43 A;  3ZBD A;  1PNJ A;  2LQ8 A;  2QGG A;  1WX6 A;  5D6X A;  4QT7 A;  4M7A D;  2DIG A;  4X34 A;  3X20 B;  5GMK j;  1D0Y A;  1VIE A;  3CC4 Q;  2F2W A;  4M78 G;  2ED1 A;  2DFU A;  4N0A C;  4UC4 A;  1SHG A;  4HXJ A;  1AWW A;  3QUI A;  4AT1 B;  1WI7 A;  2A3L A;  1MNE A;  5LJ3 h;  3OB9 A;  1OPL A;  2ZPE B;  1SPK A;  3EGU A;  1OPK A;  2CP7 A;  2KSS A;  3I55 T;  3EGX A;  5I11 A;  4KH1 B;  1MMA A;  3LWH A;  1FMV A;  2JN0 A;  2DXU A;  1VQ5 A;  2L3Q A;  2MCN A;  3REB B;  5DY9 A;  3VS1 A;  1WFW A;  3CXC A;  3I56 A;  1I07 A;  1VIF A;  2RHX A;  1UGQ B;  3HSB A;  4BE0 A;  1KFZ A;  2DMO A;  2J6O A;  2CS7 A;  1VYV A;  2K2M A;  2M0Y A;  2EFI A;  4XTX A;  3CCS A;  4C8Q C;  3HRT A;  1OX9 A;  2F2V A;  2RHI A;  1A0N B;  3I35 A;  1OI1 A;  2WAC A;  1YCY A;  4CC7 A;  4M75 B;  3X28 B;  2HL3 A;  2FB7 A;  2QAZ A;  1JXM A;  2LDM A;  1BIA A;  3LYI A;  5FU6 B;  1G3Y A;  2D8H A;  2ESW A;  5ECA A;  3BE3 A;  2HL5 C;  3TEE A;  3CME Q;  1KQ2 A;  3EFR A;  3TVT A;  1GBR A;  2LCL A;  5L23 A;  4OB0 B;  3VRZ A;  3OYL A;  1VA7 A;  2ROL A;  1X6B A;  4JUV A;  2KDS A;  2OTJ Q;  4JJB A;  3LLR A;  1RAA B;  3QXE B;  3OS1 A;  2QA4 Q;  2RN8 A;  4LN2 A;  3CQT A;  2M9U A;  1QW1 A;  2EGA A;  3OYK A;  4J9E A;  1NYG A;  2E65 A;  4HCZ A;  1OQK A;  4Z88 A;  4BI3 A;  5KYY B;  1RAG B;  1QKW A;  3CXC P;  3JCM J;  2J06 A;  4XTW A;  4BB7 A;  4BDZ A;  1B7T A;  2L5Q A;  5I2S A;  2DZC A;  2VC8 A;  1J3T A;  5GAN j;  1PC0 A;  1N9R A;  1U1S A;  2FL7 A;  2I0N A;  4M7D E;  1BK2 A;  3M0Q A;  2A7Y A;  3OY9 A;  2COZ A;  3HRU A;  2C0T A;  2COY A;  3A8M B;  2VB6 A;  1ZLM A;  3CCE A;  4BDY A;  2A08 A;  5IHI A;  1N5Z A;  4KUD K;  2DTH A;  2JUF A;  4E6R A;  2EPD A;  4KGX B;  3EG9 B;  1FXX A;  2VVK A;  1VQN A;  4R56 A;  4M75 C;  2XKO C;  1ZX6 A;  3CEY A;  4TVR A;  3QZ5 B;  4RCB A;  1VQO Q;  2ZPB B;  4BY6 C;  2FZC B;  3VS2 A;  2QK0 A;  3CPW P;  2GF7 A;  3QG1 A;  4RKU E;  2W0Z A;  2MWP A;  4C0F A;  1NLO C;  4HCC A;  4JS5 A;  2XMF A;  2YUQ A;  3M0P A;  4PLL A;  1YI2 T;  2EKH A;  2YUN A;  3OMG A;  4ZN1 A;  3CCQ A;  5KCO A;  3JCM V;  4AFS C;  1M1K C;  3MEV A;  2YHT A;  1VQP T;  2PUO B;  4JZ4 A;  3CCJ T;  1MND A;  2L3P A;  3MCA B;  3CCE T;  3G1J A;  4L5G A;  4OB3 B;  2YUO A;  1GCP A;  4QKU A;  4M7A G;  5GMK i;  2RMO A;  3JCM P;  2DL3 A;  1K9A A;  2DJQ A;  5DLQ E;  2LJ1 A;  5GAM j;  3H0I A;  1PRM C;  2LP5 A;  2DKG A;  1HSQ A;  4N4G A;  1TG0 A;  4IIM A;  3CBO A;  4J6X A;  4RMO A;  4B9W A;  3G7Z A;  2EJF A;  1QVG A;  1XTD A;  1D3B A;  4LDV A;  1M4Z A;  3CCE Q;  2AT1 B;  3VUB A;  1DJ7 B;  2CZ6 B;  5D6Y A;  3WVD B;  2DPP B;  3QDF A;  2XIC A;  2KRN A;  1RAI B;  2CP3 A;  5LL6 S;  3EGD B;  1JRI A;  1GCQ A;  5D7U A;  2A0F B;  5IXF A;  1W2B S;  1VQO T;  2BUD A;  1UB4 A;  2L3S A;  1M90 C;  1JB0 E;  5IAY A;  2V8K A;  4C8Q E;  1YJN A;  2KVQ G;  2LX7 A;  1OUL A;  2PUK B;  3DB4 A;  3VS0 A;  2EIF A;  3O5Z A;  2FRY A;  4QQ6 A;  5J39 A;  2YDL A;  3MEW A;  2EWN A;  1JU5 C;  1N9S A;  3MEU A;  3UT1 A;  5FRM A;  1RAH B;  1FX7 A;  2IG0 A;  2V8I A;  2Y90 A;  3PIP A;  5GAM e;  4HCB A;  1I8F A;  2KT1 A;  1VQP Q;  3JCM f;  3M54 A;  2YXY A;  3THK A;  1YHQ A;  1JBM A;  1Q81 U;  5FWB A;  3RMQ A;  1M1F A;  1OX8 A;  3FEO A;  2AHJ B;  4QVC A;  1YJN Q;  5GAO r;  2C0O A;  2K3Y A;  5FRO A;  2FZG B;  5A2Q E;  3FJP A;  4Y28 E;  1PG5 B;  1NJI R;  1YIJ A;  2O31 A;  4CRI A;  1FWZ A;  2P0Q A;  4NOY A;  2E1H A;  2P84 A;  5GAO m;  2KRS A;  1ABO A;  4MZT A;  3A8O B;  1TWB A;  2NUT B;  1MGQ A;  3C95 A;  2RJC A;  4M78 C;  4JRI A;  4OMP A;  3QYG B;  1M30 A;  3G71 A;  1D1A A;  3NTH A;  2ABL A;  3MO8 A;  5LJ5 d;  1GFC A;  1BI2 A;  2GTJ A;  4R0K A;  2R57 A;  4D8K A;  3CCM A;  1TUC A;  2LMJ A;  2YUP A;  2GNC A;  3CD6 Q;  1GXI E;  5KE3 A;  1VQ7 T;  1UJY A;  3VV0 A;  4PFZ A;  4C8Q A;  5LJ3 j;  3JCM h;  3A5Z B;  2DA9 A;  1KG1 A;  3H41 A;  2FEI A;  2XU8 A;  1K76 A;  1Q7Y C;  1RAD B;  2E64 A;  3E9F A;  3BDL A;  4M7D C;  2DXB A;  2VXF A;  3CMA Q;  4RCC A;  4J9D A;  2YLC A;  1RAE B;  4DOW A;  4WCI A;  1VQM T;  2CGH A;  3G6E Q;  2NLU A;  4L59 A;  4J9F A;  1VQ4 Q;  1K8A R;  2LQN A;  1YJN T;  2EJG A;  2CT4 A;  4IUQ A;  9ATC B;  2OTL A;  2LZ6 B;  4OML A;  3VRY A;  4ZGJ B;  5KYU B;  4J9G A;  4FU6 A;  3L2Z A;  1T0J A;  2K7A A;  1CKA A;  3OYM A;  1OU9 A;  2O88 A;  2KRO A;  4N0A A;  3M58 A;  1BU1 A;  2K6D A;  1WQW A;  1WHG A;  3TU4 K;  2H3E B;  4JS4 A;  3VKI A;  2HQH A;  1ZUY A;  3E1S A;  3MHX A;  2RHY A;  2GTO A;  4XU1 A;  1ABQ A;  1KQS A;  4E7K A;  3PT9 A;  3BY7 A;  2O01 E;  3LW5 E;  3OW2 A;  3NGP A;  1AOJ A;  1S1N A;  2JZ2 A;  3MKD A;  4XU0 A;  5CKH A;  4C92 G;  1Q82 C;  1T3L A;  3R6N A;  3GOX A;  5GJW B;  2E70 A;  3RIR A;  1W70 A;  3RBB B;  1WJQ A;  4ESR A;  4M75 E;  1YI2 A;  1ZSZ C;  4ME7 A;  1AWJ A;  1JJ2 A;  4XU2 A;  4EIK A;  4EMK A;  2MIO A;  3ZEH A;  4PJO E;  5HK0 A;  5KYW A;  3OYG A;  4FYY B;  4OB2 B;  4XTY A;  1UHC A;  3X26 B;  1NM7 A;  3RDV A;  4C92 F;  3CPW A;  1O75 A;  4BI8 B;  4J9I A;  2JW4 A;  4KH0 B;  1VOM A;  2YT6 A;  3JCM X;  4AMC A;  2YRD A;  5A0L A;  3MET A;  4C92 B;  2FPF A;  2XHC A;  3UWN A;  3OYA A;  1KD1 R;  4LUE A;  2PNI A;  4M7D F;  2AK5 A;  5CKD A;  3C12 A;  4RTT A;  5GMK m;  1WXT A;  4XU3 A;  4AFQ C;  1K9M U;  2SRC A;  3RKW A;  2CH4 W;  2FZK B;  4M7D B;  2JM9 A;  1PKT A;  2DD4 A;  2GBQ A;  3V8K A;  2B8A A;  4PFO A;  3VUZ A;  1WNL A;  4R55 A;  4ZTF A;  5FWC A;  3A8G B;  5LJ3 e;  3WVE B;  1QQJ A;  1K1Z A;  2O2O A;  2VV5 A;  1GCQ C;  3NPF A;  2DF6 A;  4OMQ A;  1M5Q 1;  1KC8 C;  1GBQ A;  2DL4 A;  3FC3 A;  5CKE A;  1X69 A;  1YWP A;  4GY5 A;  3CCU A;  2YSQ A;  4M77 A;  4MZP A;  4ZN3 A;  1Q81 C;  4M7D A;  2HQE A;  3JSC A;  1NJI C;  2DAQ A;  2BZ8 A;  4MDW A;  2RA2 A;  2LJ3 A;  1W1F A;  3OYC A;  5LJ3 d;  1K9M C;  3CC2 A;  4XTZ A;  2DER A;  1QWE A;  4VUB A;  4XQ3 A;  2DRK A;  2W10 A;  4KT0 E;  4C92 A;  4QVD A;  1YN8 A;  3NTI A;  3HPW A;  2LCS A;  2GQI A;  1N8R R;  2C06 A;  4F7U E;  1W2B P;  1I1J A;  2KEA A;  2BIV A;  1LCK A;  1KK7 A;  1FYN A;  2GFA A;  1X27 A;  4A53 A;  1UGS B;  1WJS A;  5GAN 7;  3UA7 A;  3QSU A;  2RF0 A;  2EYY A;  2X4Y A;  1K73 C;  4KUL A;  3WXM B;  3JCM g;  3H0F A;  1UGP B;  1YJW Q;  3RMS A;  1FMW A;  3TSW A;  4ZNX A;  3D7S B;  1TTH B;  2OJ2 A;  2AZV A;  1JEG A;  4RG8 A;  2XDP A;  2EYZ A;  1SEM A;  2ZPI B;  1M1G A;  1SF9 A;  3M57 A;  1VQN Q;  4BI4 A;  1NG2 A;  1WHL A;  4N4H A;  2EKO A;  4KRT A;  3E19 A;  5GAM g;  2LQK A;  4E7H A;  4GLK A;  1VQ5 T;  3H6Z A;  4KGV B;  5CR2 A;  1D09 B;  2B86 A;  4OP0 A;  5HCK A;  2ZCF B;  2E4H A;  1ZUU A;  3CC4 A;  5GAM f;  1ZBJ A;  4B9X A;  3M0R A;  3S3O A;  3I55 Q;  5C6S A;  5M9O A;  1Y7X A;  3LH0 A;  2KYB A;  3QYH B;  4X1V A;  4HKE A;  2LTO A;  4M7A F;  3RKX A;  3JB9 G;  4N4I A;  2OX7 A;  4Y92 A;  3QJY A;  2HBW A;  1BI1 A;  3CCL Q;  5HKC A;  2RI3 A;  3J80 E;  1B34 A;  4RUG A;  3HP9 A;  1K0S A;  2CP6 A;  4EMG A;  4HT9 A;  3QPH A;  4LXC A;  3QWY A;  1WHK A;  1SRL A;  2NUT A;  2CT3 A;  1MHN A;  2X4X A;  4AFZ C;  3EG3 A;  4F04 B;  2RQU A;  1Z9Z A;  1SG5 A;  3OBY A;  2RO0 A;  5EC7 A;  2BTT A;  1M3B A;  1AVZ C;  4QQD A;  3JB9 F;  3CBM A;  4LD9 K;  2JM8 A;  2HKQ B;  2E3H A;  2EW3 A;  5I2M A;  2L89 A;  3CME T;  2FRW A;  2LT4 A;  4J83 A;  2OTL T;  5EG2 A;  1UE9 A;  3MJX A;  3CPW S;  2NYS A;  5DLO A;  2F2X A;  1K4U S;  1KHC A;  1VQL T;  3DB3 A;  1H3H A;  2O9V A;  1S72 A;  1EZZ B;  1MUZ A;  3PVL A;  4ELY C;  1CSK A;  3QHS A;  3OW2 S;  1JJ2 S;  1PD1 A;  2DL7 A;  2XG8 D;  2NUP B;  3A8L B;  5CO7 A;  3X25 B;  1QKX A;  3QO3 A;  2KBT A;  5GAN 5;  1NBE B;  4M4Z A;  1QP2 A;  1G83 A;  3OYH A;  2J05 A;  4PJL A;  4M77 C;  1OOT A;  2YLB A;  4PJO A;  3LH5 A;  1UFF A;  5GAN 8;  4C5H A;  2DL5 A;  3LX7 A;  4Y91 A;  1OU8 A;  1PKS A;  3CCQ Q;  1P92 A;  4MMK A;  4M77 F;  1M8M A;  2EGE A;  3S6W A;  1W2B A;  4E7L A;  3G71 T;  3J81 E;  4JJC A;  4NL2 A;  4M77 B;  2VWF A;  5I22 A;  3URG A;  5J26 A;  3PGG A;  2CH4 A;  1VQ6 Q;  3MEA A;  3V8L A;  1YIT A;  3FLG A;  1Q86 U;  1YIJ T;  3UA6 A;  1TUG B;  4A63 B;  2OTL Q;  3TCJ A;  1CKB A;  3TQ7 P;  3GBQ A;  2HNI A;  3NMZ C;  2A37 A;  2GGR A;  3OBW A;  5GMK h;  1GRI A;  3V7R A;  4A54 A;  1OV3 A;  2JTE A;  3RNJ A;  3F70 A;  4FYW B;  5GAO n;  2KMT A;  1K73 U;  5LJ5 h;  1H64 1;  2I2L A;  1VQ9 Q;  2PQW A;  4ELZ C;  1SRM A;  4MML A;  1XOV A;  2GCX A;  3LGL A;  4OGC A;  5GAN e;  4AG2 C;  1B3Q A;  5GAN f;  2QI2 A;  1HXD A;  1IO6 A;  1C0M A;  1PRL C;  1U06 A;  2MAM A;  3M53 A;  1BBZ A;  4C5G A;  5HY6 A;  3VU3 C;  1WJR A;  3SWN B;  4F16 A;  5GAO q;  4PKC C;  1LNX A;  3OSS C;  1JQQ A;  1M2V A;  5IHN A;  4XTU A;  1VQK A;  2X51 A;  3G71 Q;  1TUD A;  3C94 A;  2KNB B;  3EFO A;  1YJW T;  4DOV A;  3M0S A;  2QQR A;  1R0B G;  4QQG A;  1BCO A;  4GLM A;  3GNG A;  2HDA A;  2AZS A;  2DXC A;  2ZPG B;  1KQS P;  4RTW A;  2DVE A;  3UF4 A;  3MPU B;  2PZ1 A;  2RK1 A;  4Z02 A;  1VQ4 A;  2QQA A;  2IIM A;  3OQ5 A;  3PTA A;  1PCX A;  1WZO A;  3UPU A;  4C8Q B;  5CCA A;  2PTK A;  2CKK A;  4QW2 A;  1R0C B;  2QQB A;  2KI7 A;  3L2R A;  2RJD A;  3CMA A;  4QVZ A;  3SD4 A;  2BE9 B;  2XID A;  2D6F A;  1IGU A;  3L42 A;  3L2Q A;  8ATC B;  4DBR A;  2D0N A;  2RPN A;  4C5I A;  1C1A A;  4Q5W A;  3CCJ A;  2PVO B;  2XDD A;  5IN1 A;  1ZUK A;  1TXQ A;  2QAS A;  2DRM A;  3GNF B;  1RLP C;  4M7A B;  1GFD A;  3CCR A;  3TRE A;  3PIO A;  1K73 R;  1VUB A;  1OZ2 A;  5GAO p;  2J6K A;  2QTV A;  1AEY A;  1KD1 C;  3VS7 A;  1HD3 A;  1M8V A;  1NEB A;  1SKU B;  5FW9 A;  1B34 B;  3G4S Q;  4JPB W;  4ATO A;  2ZGW A;  3EH2 A;  1U1T A;  1RI0 A;  1NZ9 A;  5GAN 4;  1ZA2 B;  1Q7Y U;  1ZA1 B;  2V26 A;  3EH1 A;  5D6W A;  3PMI A;  4EDU A;  1PSF A;  6AT1 B;  2J6F A;  2BZX A;  2BKD N;  1M90 U;  4KUI A;  4PFP A;  2L3R A;  1ACM B;  1WQ7 A;  3VJP A;  1K9M R;  4A4K A;  1KHI A;  3JAM E;  5KYW B;  4CI0 C;  4OB1 B;  4LDU A;  4FW2 A;  1Q82 R;  2O4X B;  1TOV A;  2DBK A;  2COW A;  3EGD A;  4XAX B;  1YJ9 Q;  1YP5 A;  2XDB A;  2K5F A;  2DE0 X;  3C0C A;  1TU0 B;  2MOX A;  2MYS A;  1VQ8 Q;  1QCF A;  4PL6 A;  5IHK A;  4JRQ A;  3A98 A;  4IUR A;  2HAX A;  4O5V A;  1UGR B;  1Y07 A;  2DK3 A;  1YJW A;  1I81 A;  1D0X A;  1R8O B;  4DBF A;  2Y4X A;  5A0D A;  2VXE A;  2RI2 A;  3SDZ A;  1NLP C;  4PJJ A;  3NHN A;  4HVW A;  4DA4 A;  4M77 G;  2K5L A;  4M7D G;  2HD0 A;  1YI2 Q;  1G3S A;  3CC7 Q;  3OS0 A;  2RHU A;  3FDR A;  3QZ9 B;  4J7F A;  2EQU A;  1V29 B;  4XK8 E;  2LJ0 A;  2M1H A;  4AFU C;  2HEQ A;  2GQV A;  3UDC A;  4C0G A;  4F7U A;  1VQ7 A;  4BUG A;  2GFU A;  1VQ6 T;  3CBP A;  2BZY A;  1YIJ Q;  3CCM T;  1M1K U;  2QYZ A;  2EQJ A;  1E7O A;  1UHF A;  2P0K A;  1BKB A;  2MMP A;  2QTX A;  4IUV A;  1SSH A;  2RH2 A;  2JNG A;  4PJN A;  2LT1 A;  1G2B A;  4E47 A;  4ANJ A;  3U23 A;  3OYI A;  1Q86 C;  2HKN A;  4PJO F;  3G6E A;  2F1L A;  3NTK A;  4EPC A;  4M7A E;  1H8K A;  1RL2 A;  3EHR A;  3REA B;  1WA7 A;  2ED0 A;  1N8R C;  2EVR A;  2P4R A;  4C0Z A;  2BE7 D;  3L1A A;  3FJ5 A;  4J6W A;  2DVJ A;  2J7I A;  2JJ9 A;  2KRM A;  3PVQ A;  1YHQ T;  2DM1 A;  2EGC A;  1UJ0 A;  1D3B B;  2LQW A;  3CCS Q;  3PNW C;  2LC4 A;  4LD6 A;  5CKB A;  4OGE A;  3CD6 A;  1QVP A;  2K9G A;  1WPY A;  2V8J A;  2L0A A;  3CC2 Q;  3HFN A;  3EGX B;  3I5R A;  2K79 A;  1SSF A;  3I56 Q;  3RUX A;  1NYF A;  4OMN A;  2F69 A;  2RJF A;  3H8Z A;  4C8Q F;  4Z8A A;  3A1P A;  1I5L A;  2JS0 A;  1MMG A;  1VQO A;  4FYV B;  3DKM A;  1Y96 B;  4LDX A;  2D9T A;  3EFO B;  3MP1 A;  3L2W A;  2H8H A;  4A4F A;  4D6W A;  1KSW A;  3MP8 A;  3EG9 A;  1LVK A;  2O4X A;  2EQK A;  5LJ3 g;  4BAC A;  1G5V A;  1WYX A;  4OMO A;  2VGN A;  4M75 A;  1PSE A;  3M4Y A;  1OYX A;  4HVV A;  4A4G A;  5CQX A;  1NE8 A;  2DIL A;  5CKF A;  1KQS S;  4PNO A;  2KYM A;  2XD0 A;  4NS5 A;  2Y4Y A;  3PFS A;  4IUP A;  1EFN A;  3FRN A;  4KGZ B;  4M75 D;  1VQM A;  4PK4 A;  1AZE A;  3HHT B;  1U8R A;  1PD0 A;  3ULR B;  4ZGD B;  1RAC B;  1I0C A;  2DD5 A;  3JCM d;  2OTJ T;  4Z89 A;  2AKL A;  1VQ7 Q;  2PU9 B;  3R6O A;  1W4S A;  2LCC A;  2QA4 T;  5LJ5 g;  2FPE A;  3G4S T;  2DEQ A;  2D8J A;  4C92 C;  3P8D A;  5CVI A;  2AKK A;  2K3B A;  2SEM A;  5AYF A;  3KFV A;  5FU7 C;  2ECZ A;  3G6E T;  2DBM A;  2CSQ A;  2NUP A;  4X9C A;  2ZZD A;  2EYQ A;  1AD5 A;  3KBG A;  2KQW A;  2CUD A;  2FHD A;  1Z9Q A;  3CC7 T;  4J9B A;  1KC8 R;  1E6H A;  4IUT A;  2E5Q A;  3HL8 A;  4X9D A;  1YJ9 T;  3MP6 A;  2MPX C;  3KXT A;  5FU6 C;  1WLP B;  4XTV A;  1NJI U;  2HZY A;  5GAO l;  3J7A F;  3O8V A;  1D1B A;  2C0I A;  2RK2 A;  5KYX B;  4J9C A;  4E7J A;  3OA6 A;  1KJW A;  1IGQ A;  1ZSZ B;  1AT1 B;  3T9N A;  3INZ A;  4M7A C;  4BE1 A;  4M77 D;  1U3O A;  1LOJ A;  2WSE E;  4M75 F;  5L8R E;  2R5A A;  1ZHI A;  3GPL A;  2G6F X;  3QJ6 A;  5CK9 A;  1VYT A;  2ATC B;  2CZ1 B;  1AWO A;  5A0G A;  1QVF S;  3L2U A;  2ROT A;  4LE9 A;  3I9Q A;  2AIR B;  2QG9 B;  3QKJ A;  3X24 B;  2X3W D;  3QWX X;  4JLG A;  2HSE B;  3OMC A;  4D8D A;  1RUW A;  1TSF A;  2KT8 A;  1M2V B;  4E7S A;  1SHF A;  2E41 A;  2HSP A;  1BYM A;  2JTM A;  4LDY A;  2E12 A;  2HBP A;  1KD1 U;  3CCS T;  3SHW A;  1QCO A;  2DYB A;  4C0D C;  3CCV A;  1QMC A;  3CPF A;  4JDS A;  1HJD A;  2A36 A;  4C5E A;  4ZGE B;  3OW2 P;  3VS5 A;  2KXD A;  4PJO B;  2YWW A;  3I56 T;  1EIF A;  3PMT A;  3SEM A;  3VS6 A;  2LRQ A;  1YFN A;  2RQT A;  3CCJ Q;  1RI9 A;  2DTO A;  3JB9 D;  4C8Q D;  4EMK C;  1X6G A;  1YJ9 A;  5GAM d;  5LJ5 j;  1NPP A;  3CC7 A;  4FYX B;  1VQP A;  4JRP A;  4RTV A;  4E2F B;  4YTL A;  1MMD A;  2CZ0 B;  3M55 A;  3H0H A;  2PVD B;  3JCM W;  2VGM A;  4AG1 C;  2K3X A;  5GAM h;  3G4S A;  1QVG S;  2DTI A;  2R58 A;  2FPD A;  1OZ3 A;  2E6N A;  2JS2 A;  1Y0M A;  4FL6 A;  1NPR A;  5GAN 2;  1AHJ B;  4J6Y A;  2VYT A;  3JB9 I;  2RB6 A;  5CIU A;  2DNU A;  2QA4 A;  2M16 A;  3PE0 A;  3M0T A;  2OTJ A;  4II1 A;  1F1B B;  2L8D A;  4EMH A;  2RJE A;  4ORZ A;  4M78 F;  3LWI A;  4WTO B;  2EBP A;  4IIO A;  5CQY A;  2L2P A;  1UGV A;  1IXD A;  4LNP A;  2FYK A;  1V1C A;  3CCR Q;  2ZAE A;  3EG1 A;  5KYN A;  1X6O A;  3QDR B;  1VQ8 A;  2DO3 A;  4CC3 A;  4M7A A;  3OYE A;  1QP3 A;  2P0P A;  3VYH B;  2KAF A;  3ME9 A;  3TSZ A;  4J5Y A;  5GMK l;  1MMN A;  2XI9 A;  2LX9 A;  3RKY A;  3OYD A;  2D1X A;  4PJO G;  3RER A;  4M78 A;  5GAN d;  3N5B B;  1VQK T;  3HRS A;  3OS5 A;  1KIK A;  4NL3 A;  5IXB A;  1Y57 A;  5GAN g;  1TS9 A;  4MZM A;  3ZFJ A;  4CC2 A;  2JOY A;  2QQS A;  3JCM c;  5I21 A;  2H3J A;  5AT1 B;  1IRE B;  2FVU A;  3JB9 J;  2LVM A;  4K11 A;  2FG0 A;  2XK0 A;  3M59 A;  2HCK A;  4PJO C;  2MWO A;  3AHU A;  3CD6 T;  1N6A A;  5GAN 6;  4FT2 A;  1R77 A;  3A8H B;  1YNZ A;  4C92 E;  1AWX A;  3VS3 A;  2WSF E;  2RQV A;  2CP5 A;  4RTU A;  2M0O A;  1XQH A;  4WF2 A;  3OS2 A;  1WHH A;  2E5K A;  1N8R U;  1H3Z A;  1QWF A;  4FIB A;  7AT1 B;  2CUB A;  4ZTJ A;  1VQM Q;  1QVF A;  2MI6 A;  1QLY A;  1YIT T;  1UEC A;  2JT4 A;  3CCL A;  2RM4 A;  5GJV B;  1VQ6 A;  3M4G A;  4F7U G;  1C6V X;  3HFO A;  1X75 C;  4O6J A;  3SB2 A;  2IVW A;  4DQ2 A;  5DM7 R;  3BDU A;  4OVA A;  3E2U A;  1XNI A;  4PJM A;  5LJ5 e;  3DLL A;  1WGS A;  2K57 A; 
#chains in the Genus database with same CATH homology
 3TEE A;  1KQ2 A;  3EFR A;  2GFA A;  2E6Z A;  2MMP A;  2QTX A;  4IUV A;  2RH2 A;  1UGS B;  1WJS A;  2JNG A;  4A53 A;  5GAN 7;  2LCL A;  2VUB A;  3QSU A;  4OB0 B;  2LT1 A;  3OYL A;  4RG2 A;  3CXC S;  2X4Y A;  1K73 C;  4KUL A;  2X4W A;  3WXM B;  5GMK e;  3JCM g;  1UGP B;  2DIQ A;  1M9S A;  4E47 A;  4JUV A;  3RMS A;  2EQM A;  4IUU A;  2KDS A;  4BE2 A;  4OF1 A;  3LLR A;  3OYI A;  1Q86 C;  3QXE B;  2QDY B;  3OS1 A;  1S72 T;  2M9U A;  1QW1 A;  4PJO F;  3OYK A;  3G6E A;  2E65 A;  4HCZ A;  4RG8 A;  2XDP A;  4E7I A;  3FB9 A;  2ZPI B;  3NTK A;  1M1G A;  1BI3 A;  4BI3 A;  4EPC A;  4M7A E;  2CYZ B;  3M57 A;  1RL2 A;  3KUF A;  3JCM J;  1G3W A;  1K9M C;  4BI4 A;  4XTW A;  4C8Q G;  3GIB A;  2ZPH B;  3BW1 A;  4N4H A;  4BB7 A;  3CME A;  1N8R C;  4BDZ A;  2E10 A;  1TH7 A;  2EKO A;  3DLM A;  2L5Q A;  4C0Z A;  3L1A A;  2DZC A;  1G3T A;  3E19 A;  5I2S A;  4J6W A;  5GAM g;  4IKF A;  1VQL A;  2VC8 A;  5GAM e;  2LQK A;  5GAN j;  1N9R A;  1U1S A;  2FL7 A;  4E7H A;  1YHQ T;  4GLK A;  1VQ5 T;  3H6Z A;  4M7D E;  2A7Y A;  1D3B B;  3OY9 A;  5HK3 A;  5CR2 A;  3HRU A;  3PNW C;  2LC4 A;  3A8M B;  4LD6 A;  4OP0 A;  4OGE A;  5CKB A;  3CCE A;  4BDY A;  3CD6 A;  3OYN A;  2ZCF B;  1QVP A;  1WPY A;  2P4T A;  2V8J A;  3OYJ A;  3CC4 A;  2DTH A;  5GAM f;  4KUD K;  3HFN A;  2R5M A;  2JUF A;  4KBM B;  4B9X A;  3S3O A;  1SSF A;  3SWN A;  5C6S A;  1Q82 U;  5M9O A;  1Y7X A;  3LH0 A;  4A4E A;  1LJO A;  1FXX A;  3RUX A;  1VQN A;  4R56 A;  3QYH B;  2F69 A;  2XKO C;  3CEY A;  4M75 C;  2RJF A;  4TVR A;  3H8Z A;  3QZ5 B;  4C8Q F;  4RCB A;  4HKE A;  2LTO A;  2ZPB B;  4BY6 C;  3GF5 A;  1YBY A;  4M7A F;  4L6V 5;  1I4K 1;  3RKX A;  1I5L A;  3JB9 G;  4N4I A;  2GF7 A;  3QG1 A;  4RKU E;  1VQO A;  2QXF A;  3QJY A;  3DKM A;  1Y96 B;  2MWP A;  1BI1 A;  2D9T A;  2K5I A;  2RI3 A;  4C0F A;  5HKC A;  4LDX A;  3J80 E;  4HCC A;  1B34 A;  3MP1 A;  4JS5 A;  3L2W A;  3HP9 A;  2KY9 A;  4A4F A;  4D6W A;  4PLL A;  4M77 E;  1YI2 T;  4EMG A;  3P8B B;  4HT9 A;  3MP8 A;  3QPH A;  2O4X A;  3OMG A;  4ZN1 A;  3CCQ A;  1MHN A;  2EQK A;  2RHZ A;  5KCO A;  3JCM V;  1M1K C;  2X4X A;  5LJ3 g;  3MEV A;  2G3R A;  2YHT A;  4BAC A;  1VQP T;  1G5V A;  3SWN C;  1ZQ1 A;  2PUO B;  3CCJ T;  3SFM A;  3MCA B;  3CCE T;  4L5G A;  2VGN A;  3OBY A;  2RO0 A;  4M75 A;  4OB3 B;  1PSE A;  3M4Y A;  1OYX A;  4M7A G;  4A4G A;  5CQX A;  1NE8 A;  5CKF A;  3JRZ A;  3OSV A;  4PNO A;  4QQD A;  5GMK i;  3OYB A;  1KQS S;  3JB9 F;  3CBM A;  2XD0 A;  4NS5 A;  2Y4Y A;  3PFS A;  3JCM P;  4LD9 K;  4IUP A;  5DLQ E;  3FRN A;  3CCQ T;  3OYY A;  4M75 D;  5GAM j;  1BI0 A;  5I2M A;  1VQ9 T;  1VQM A;  2L89 A;  2DKG A;  3CME T;  4N4G A;  3CC4 T;  2PVG B;  4J83 A;  2LT4 A;  3CBO A;  4J6X A;  3HHT B;  5EG2 A;  2OTL T;  4MDX A;  5GAN 3;  4RMO A;  1U8R A;  2K4Y A;  4ZGD B;  4B9W A;  3CPW S;  2DD5 A;  3G7Z A;  2EJF A;  3NFC A;  1XTD A;  1D3B A;  3JCM d;  4LDV A;  1M4Z A;  2DZ9 A;  5DLO A;  2PU9 B;  3R6O A;  4FM4 B;  1BYM A;  2MF2 A;  1W4S A;  3VUB A;  2QEX T;  2LCC A;  2QA4 T;  5LJ5 g;  5LJ5 f;  4PJO D;  3EAE A;  1KHC A;  3G4S T;  1DJ7 B;  1VQL T;  2DEQ A;  3DB3 A;  2CZ6 B;  5D6Y A;  2KK4 A;  2RI5 A;  4C92 C;  3P8D A;  3WVD B;  1S72 A;  5CVI A;  1K8A U;  3CC2 T;  2DPP B;  2XIC A;  2EAY A;  4ELY C;  3QHS A;  3CMA T;  3OW2 S;  1VQN T;  1JJ2 S;  2XG8 D;  5LL6 S;  3CCR T;  4PLI A;  5AYF A;  1JRI A;  3A8L B;  5CO7 A;  5FU7 C;  3X25 B;  1W2B S;  3QO3 A;  4HCB A;  3S3N A;  2BUD A;  2X35 A;  1UB4 A;  5GAN 5;  1VQO T;  1M90 C;  1N27 A;  1JB0 E;  3CCV T;  5KE2 A;  5IAY A;  3G6E T;  1VQ4 T;  2V8K A;  3PIP A;  4C8Q E;  1QP2 A;  2ZPF B;  1BKB A;  4X9C A;  3OYH A;  2ZZD A;  1YJN A;  2EYQ A;  2KVQ G;  3QBY A;  5FLX E;  4M77 C;  3JCM b;  3JB9 H;  2PUK B;  3DB4 A;  3E9G A;  3FIF A;  2YLB A;  4PJO A;  4M7D D;  5GAN 8;  4C5H A;  2EIF A;  3KBG A;  3RES A;  4QQ6 A;  4LDW A;  5J39 A;  4JRK A;  2KQW A;  3LX7 A;  4Y91 A;  3MEW A;  2EWN A;  2FHD A;  1N9S A;  1KQ1 A;  3MEU A;  3UT1 A;  5FRM A;  2YRV A;  3CC7 T;  2IG0 A;  2V8I A;  1FX7 A;  1P92 A;  1O9S A;  2E5Q A;  2Y90 A;  3HL8 A;  4IUT A;  4M77 F;  1I8F A;  4M78 D;  5FU7 B;  3S6W A;  4FSX A;  4X9D A;  4E7L A;  3G71 T;  1K8A C;  1YJ9 T;  1Y71 A;  3MP6 A;  3JCM f;  3M54 A;  1UEB A;  5FU6 C;  4C92 D;  3J81 E;  3KXT A;  4XTV A;  1NJI U;  2K2V A;  5GAN h;  1YHQ A;  4HT8 A;  4NL2 A;  1JBM A;  1Q81 U;  4M77 B;  3RMQ A;  5GAO l;  3J7A F;  3O8V A;  3URG A;  1M1F A;  2RK2 A;  5J26 A;  3FEO A;  2AHJ B;  3GP8 A;  1HK9 A;  3PGG A;  4E7J A;  4QVC A;  3OA6 A;  2LNV A;  5GAO r;  3MEA A;  3V8L A;  1YIT A;  3FLG A;  2K3Y A;  5FRO A;  1Q86 U;  1YIJ T;  3OYF A;  3T9N A;  5A2Q E;  3L2V A;  3FJP A;  2DXT A;  3INZ A;  4M7A C;  4Y28 E;  4BE1 A;  3V8J A;  4M77 D;  3LGF A;  2F5T X;  1LOJ A;  2WSE E;  1YIJ A;  4M75 F;  3TCJ A;  4CRI A;  5L8R E;  3ASK A;  2JTF A;  1FWZ A;  2R5A A;  2HNI A;  1ZHI A;  3CCU T;  3OBW A;  2P0Q A;  5GMK h;  2X4J A;  4FT4 A;  4NOY A;  2E1H A;  3GPL A;  5GAO m;  3V7R A;  4A54 A;  4MZT A;  3A8O B;  3F70 A;  3QJ6 A;  5CK9 A;  4HA8 A;  5GAO n;  1MGQ A;  2CZ1 B;  3DLL A;  2KMT A;  3C95 A;  1K73 U;  2RJC A;  4M78 C;  3M9Q A;  4JRI A;  5A0G A;  1QVF S;  3L2U A;  5LJ5 h;  3QYG B;  3G71 A;  1H64 1;  3QKJ A;  3NTH A;  2I2L A;  3MO8 A;  2OAU A;  3X24 B;  5LJ5 d;  3HKS A;  1BI2 A;  2R57 A;  3CCM A;  2PQW A;  4JLG A;  4ELZ C;  3OMC A;  1IZ6 A;  4MML A;  1GXI E;  1XOV A;  3Q1J A;  5KE3 A;  2GCX A;  4EMK B;  2D0Q B;  3LGL A;  3GLX A;  4OGC A;  5GAN e;  1VQ7 T;  1X01 A;  3VV0 A;  5GAN f;  2QI2 A;  4BD3 A;  1HXD A;  2E41 A;  2MAM A;  3M53 A;  4C0D B;  4C8Q A;  3ER0 A;  4C5G A;  2JTM A;  5LJ3 j;  3JCM h;  2JVV A;  4LDY A;  5HY6 A;  3A5Z B;  3VU3 C;  3CCL T;  2E12 A;  1WJR A;  2HBP A;  1KD1 U;  3CCS T;  3SWN B;  1KG1 A;  3JCM Q;  5GAO q;  4PKC C;  4C0D C;  1QVG A;  3CCV A;  1LNX A;  2XU8 A;  3CPF A;  3OSS C;  4JDS A;  2QEX A;  1Q7Y C;  4BY6 B;  4XTU A;  2E64 A;  5KCH A;  1VQK A;  3E9F A;  3BDL A;  4C5E A;  4ZGE B;  3JCM e;  4M7D C;  2DXB A;  2VXF A;  4PJO B;  4RCC A;  3C94 A;  3I56 T;  2DJZ A;  2YLC A;  1EIF A;  3I55 A;  3PMT A;  1YJW T;  4DOV A;  4DOW A;  2LRQ A;  2QQR A;  4P5N A;  1VQM T;  1VQ9 A;  2CGH A;  4F7U F;  4QQG A;  5IT9 E;  3GNG A;  3S3M A;  2NLU A;  2DTO A;  4L59 A;  3JB9 D;  2DXC A;  2ZPG B;  4J7I A;  2DVE A;  2WSC E;  4C8Q D;  4EMK C;  1YJ9 A;  2RK1 A;  1YJN T;  2EJG A;  4Z02 A;  4IUQ A;  4F7U B;  5GAM d;  5LJ5 j;  1NPP A;  1VQ4 A;  5CAI A;  2QQA A;  1Y96 A;  3QII A;  3OQ5 A;  3PTA A;  3CC7 A;  2OTL A;  3UPU A;  3VYG A;  1VQP A;  4A4H A;  4C8Q B;  5CCA A;  2EJ9 A;  5C0M A;  4JRP A;  2F5K A;  2CKK A;  4QW2 A;  4ZGJ B;  1BIB A;  4YTL A;  2QQB A;  2CZ0 B;  3L2R A;  3CMA A;  2RJD A;  4FU6 A;  3M55 A;  3L2Z A;  4QVZ A;  3SD4 A;  3OYM A;  4M78 E;  4V2S A;  2PVD B;  2XID A;  5J3B A;  3JCM W;  3M5A A;  2VGM A;  3L42 A;  2K3X A;  3L2Q A;  2D6F A;  5GAM h;  4N0A A;  3M58 A;  4J8O A;  4C5I A;  3G4S A;  5FRN A;  1QVG S;  2CZ7 B;  1WQW A;  2DTI A;  2QQ9 A;  4Q5W A;  3TU4 K;  3CCJ A;  4JJN K;  2PVO B;  2XDD A;  3VKI A;  5IN1 A;  2R58 A;  4JS4 A;  1OZ3 A;  2E6N A;  3GNF B;  3E1S A;  1KC8 U;  4M7A B;  3CCR A;  4FL6 A;  1NPR A;  3MHX A;  3TRE A;  4M75 G;  5GAN 2;  1VUB A;  1OZ2 A;  1AHJ B;  2RD1 A;  5GAO p;  3PIO A;  2RHY A;  4XU1 A;  4J6Y A;  1KQS A;  4E7K A;  1KD1 C;  3PT9 A;  2VYT A;  3JB9 I;  3BY7 A;  3C4S A;  2RB6 A;  3EFS A;  2O01 E;  5CIU A;  2P0K A;  2QA4 A;  3LW5 E;  5LJ3 f;  3OW2 A;  2M16 A;  1M8V A;  2JZ2 A;  4M78 B;  2OTJ A;  1VQ8 T;  4XU0 A;  4II1 A;  4JLI A;  2L8D A;  4EMH A;  1B34 B;  2RJE A;  5CKH A;  4C92 G;  1Q82 C;  2HQX A;  3GOX A;  3M56 A;  2E70 A;  4M78 F;  3RIR A;  1ZBX A;  3LWI A;  4ATO A;  5KH6 A;  2ZGW A;  5CQY A;  1U1T A;  2FYK A;  3V7C A;  1RI0 A;  1WJQ A;  1NZ9 A;  4M75 E;  3P8H A;  1YI2 A;  5GAN 4;  1Q7Y U;  3V7S A;  1X6O A;  3QDR B;  3BFM A;  4ME7 A;  1VQ8 A;  1JJ2 A;  2DO3 A;  4XU2 A;  5D6W A;  4M7A A;  3PMI A;  4EMK A;  4OMF B;  1QP3 A;  3OYE A;  2P0P A;  4EDU A;  3ZBD A;  2LQ8 A;  3VYH B;  2KAF A;  3ME9 A;  1PSF A;  4J5Y A;  3ZEH A;  5D6X A;  5GMK l;  2XI9 A;  2BKD N;  4PJO E;  1M90 U;  4M7A D;  2DIG A;  4X34 A;  2LX9 A;  3X20 B;  3RKY A;  4KUI A;  5HK0 A;  3OYG A;  4OB2 B;  4XTY A;  3OYD A;  2L3R A;  1WQ7 A;  3VJP A;  3X26 B;  4C92 F;  5GMK j;  3CPW A;  1O75 A;  4PJO G;  4A4K A;  4M78 A;  1VIE A;  4BI8 B;  5GAN d;  3RER A;  4M78 G;  1KHI A;  3N5B B;  3JAM E;  3JCM X;  1VQK T;  4CI0 C;  3HRS A;  5A0L A;  3MET A;  4OB1 B;  4LDU A;  4N0A C;  4UC4 A;  3OS5 A;  4C92 B;  2O4X B;  4NL3 A;  2XHC A;  3QUI A;  4XAX B;  3UWN A;  3OYA A;  2A3L A;  2K5F A;  2XDB A;  5GAN g;  5LJ3 h;  4MZM A;  3ZFJ A;  3OB9 A;  4M7D F;  5CKD A;  2JOY A;  2QQS A;  3C12 A;  2ZPE B;  3JCM c;  2H3J A;  5I21 A;  5GMK m;  1IRE B;  4XU3 A;  2FVU A;  3JB9 J;  1K9M U;  2LVM A;  4PL6 A;  4JRQ A;  3M59 A;  2XK0 A;  3RKW A;  4IUR A;  2HAX A;  4O5V A;  1UGR B;  4M7D B;  1Y07 A;  2DK3 A;  2KSS A;  3I55 T;  1YJW A;  1W2B A;  1I81 A;  2DD4 A;  4PJO C;  3V8K A;  2B8A A;  2MWO A;  3AHU A;  3VUZ A;  3CD6 T;  1N6A A;  1WNL A;  4R55 A;  4ZTF A;  5GAN 6;  3A8G B;  5LJ3 e;  1R8O B;  3LWH A;  3WVE B;  2JN0 A;  2VV5 A;  2DXU A;  4FT2 A;  1VQ5 A;  3A8H B;  2Y4X A;  5A0D A;  2VXE A;  1M5Q 1;  2RI2 A;  4C92 E;  1KC8 C;  5DY9 A;  3SDZ A;  2WSF E;  3FC3 A;  5CKE A;  4DA4 A;  4M77 G;  3CXC A;  2M0O A;  4GY5 A;  3CCU A;  1XQH A;  2K5L A;  4M77 A;  4WF2 A;  3I56 A;  4M7D G;  4MZP A;  4ZN3 A;  1Q81 C;  3OS2 A;  4M7D A;  2HD0 A;  2HQE A;  1VIF A;  2RHX A;  1UGQ B;  1N8R U;  3HSB A;  3JSC A;  1NJI C;  2DAQ A;  1H3Z A;  4BE0 A;  4FIB A;  4MDW A;  1G3S A;  2RA2 A;  3OS0 A;  2RHU A;  2CS7 A;  3FDR A;  4ZTJ A;  2MI6 A;  3OYC A;  1QVF A;  3QZ9 B;  2EFI A;  4J7F A;  2EQU A;  4XTX A;  5LJ3 d;  1YIT T;  1V29 B;  4XK8 E;  4XTZ A;  3CCS A;  2M1H A;  4C8Q C;  3CC2 A;  4VUB A;  4XQ3 A;  3CCL A;  3HRT A;  2GQV A;  4KT0 E;  4C92 A;  2RM4 A;  1VQ6 A;  3M4G A;  2RHI A;  3UDC A;  4C0G A;  1OI1 A;  4F7U G;  2WAC A;  4F7U A;  4QVD A;  3HFO A;  1YCY A;  1VQ7 A;  3NTI A;  4BUG A;  1X75 C;  4O6J A;  4M75 B;  3HPW A;  2GFU A;  2IVW A;  3SB2 A;  4DQ2 A;  3X28 B;  5DM7 R;  2C06 A;  1VQ6 T;  2FB7 A;  4F7U E;  3BDU A;  2LDM A;  2BIV A;  2OTJ T;  3CBP A;  1M1K U;  1BIA A;  3CCM T;  4MMK A;  3LYI A;  2EQJ A;  4OVA A;  1XNI A;  5LJ5 e;  5FU6 B;  1G3Y A;  1WGS A;  2K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...