1IO6A

Growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution Structure of the C-Terminal SH3 Domain of Grb2 Complexed with a Ligand Peptide: A Ligand Exchange Model of the SH3 Domain
rcsb
source organism Homo sapiens
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1io6A00
2HCKA 1NEBA 2ROLA 2AKLA 2EPDA 3H41A 4ZNXA 2RQTA 2CH4A 2EBPA 1YWOA 1E6HA 1NLPC 2O88A 1PRMC 2DM1A 2KR3A 2CDTA 4F17A 1AZEA 4ORZA 2F2WA 4CC4B 2KNBB 3NMZC 3EG1A 3EHQA 3EHRA 1SRLA 2LX7A 1AVZC 4Z88A 2C0IA 2BZYA 1QWFA 4RTZA 3JV3A 2HEQA 5I22A 1NG2A 2DRMA 2PTKA 1T3SA 2AZSA 2NWMA 3VS7A 4OMMA 2FG0A 4CC2A 2LJ3A 2XMFA 5EC7A 1UJYA 2CH4W 1S1NA 2YT6A 4OMPA 1IO6A 2CREA 1X43A 2EGCA 2KGTA 2L2PA 2RQWA 2RQRA 1GFCA 2GQIA 2G6FX 1VA7A 1ZLMA 2FRWA 4IIMA 1W1FA 3LH5A 2D0NA 2L0AA 3VS4A 1XOVA 2J6OA 2DL3A 2KE9A 2D1XA 2M0YA 2OAWA 1X6GA 1AWOA 1G2BA 1VYTA 2MIOA 2I0NA 2EQIA 3VS1A 2X3XD 1ZX6A 1M3BA 2EYXA 1ZBJA 2K2MA 1JXMA 3TSWA 2YUOA 2AZVA 2HSPA 2O9VA 2CT4A 2W0ZA 2YDLA 5FWBA 1H3HA 2LMJA 5GJVB 2GTJA 3C0CA 5I11A 2V1RA 1GCPA 1B3QA 4QT7A 1WFWA 1UG1A 1WIEA 3EGUA 5IHIA 5IXBA 2EYWA 2J06A 1Y57A 1SHGA 2RF0A 4J9BA 5GJWB 1AWWA 2RQUA 2K6DA 4CC3A 1JU5C 2YUNA 2GBQA 1FMKA 3NPFA 1RLQC 4RTYA 2VVKA 3VS6A 3VS0A 3ZL7C 1NEGA 4AG2C 1T0JA 2DA9A 1SEMA 1WXBA 2LNHB 2YUQA 2L3SA 4WCIA 1T3LA 1GFDA 1M3CA 1WYXA 3VS3A 1UDLA 3EG0A 1QKXA 1PKSA 4AFZC 1BK2A 1WI7A 1TUDA 2J6FA 1KSWA 3PE0A 3VS2A 1KIKA 2RN8A 1G83A 3CQTA 4E6RA 2W10A 4HVVA 1CKAA 2D8JA 1K0SA 1A0NB 2A37A 2GGRA 2OJ2A 4HVUA 1X6BA 2HDAA 3UA6A 1SSHA 4J9HA 1K9AA 1WX6A 3M0SA 2CSQA 1CSKA 2J6KA 1WLPB 1YWPA 3PVQA 4M4ZA 1WXUA 1U5SA 4RTTA 5FW9A 1LCKA 3I5RA 1GBQA 4LUEA 2DL5A 4J9FA 2FPEA 1K0XA 1WXTA 2QDLA 1VYUA 2L3PA 1U06A 1X2QA 2ESWA 4DEXA 1ZUYA 2DL4A 2KT8A 1RUWA 1JEGA 2VKNA 2DF6A 1I07A 2DL8A 2JW4A 1RI9A 3UA7A 1JXOA 2JS0A 4RTVA 4AG1C 2VWFA 3R6NA 1X2KA 2PNIA 4K11A 1UE9A 3QWXX 1PWTA 4J9EA 3M0UA 1W6XA 1OV3A 1VYVA 2BZXA 2D8HA 5IH2A 5IHNA 3I9QA 1UFFA 2BTTA 2C0TA 2DJQA 4JZ4A 1UECA 4GLMA 1AWXA 2DILA 4JZ3A 1BB9A 2ED1A 3O5ZA 1V1CA 2ED0A 2KRSA 1CKBA 4LN2A 1GL5A 2PZ1A 3A98A 2SEMA 3M0QA 1EFNA 1RLPC 4J9IA 2DNUA 2KEAA 2A28A 1AD5A 1UGVA 1MV0B 1NYGA 3KFVA 1KFZA 1WDXA 3TVTA 2LJ0A 4HCKA 2K9GA 4DEYA 1ZSGA 1HSQA 1GCQC 1OPLA 1UHFA 2KXCA 1I1JA 1FYNA 2OI3A 4RUGA 2JM9A 4OMLA 3EG3A 3ULRB 3THKA 4J9GA 1B07A 1SHFA 4Z89A 1TUCA 2DLPA 4X1VA 5L23A 1QKWA 1UHCA 2MOXA 2NUZA 2CUBA 3RBBB 2EGEA 2EYYA 1PRLC 4D8KA 1HD3A 2AKKA 1H92A 2FEIA 4AFSC 2DX1A 2AK5A 2EGAA 4OMQA 5IHKA 4Y92A 3H0FA 2LQNA 2H8HA 2A08A 2B86A 2ENMA 2DVJA 2DRKA 1H8KA 1BU1A 1T0HA 2LP5A 4LUDA 3SEMA 2SRCA 2DL7A 4GBQA 3UATA 4R0KA 2RPNA 2F2VA 2J7IA 1Z9ZA 4A63B 5HCKA 1J3TA 2K7AA 2P4RA 2RMOA 2IIMA 2JM8A 2F2XA 5ECAA 3H0IA 3M0TA 4RTXA 4JJDA 1ZUUA 2CSIA 2DYBA 1YP5A 2LZ6B 4LNPA 3VRYA 1OPKA 2J05A 2ROTA 1NYFA 2LQWA 4EIKA 1BBZA 1I0CA 1QCFA 1SRMA 2O31A 2FRYA 1N5ZA 2YUPA 2O2OA 1AOJA 1W70A 2ECZA 1YCSB 1HJDA 2EYZA 3EG2A 2KYBA 2GTOA 4KRTA 1ARKA 3U23A 2KYMA 2E5KA 2L3QA 1MV3A 1AEYA 1GCQA 2CUDA 2JXBA 1M27C 2ABLA 2KRMA 2FPDA 2LJ1A 4D8DA 1Z9QA 2C0OA 2K79A 3VRZA 2HBWA 1NM7A 2K3BA 2KXDA 3GBQA 3TSZA 1SPKA 3UF4A 1OEBA 1E6GA 4ESRA 1UJ0A 1UUEA 2O9SA 1QWEA 3NHNA 3I5SA 2JT4A 2MCNA 1Y0MA 1K1ZA 4CC7A 2FO0A 2DE0X 3M0RA 2A36A 4AFQC 5FWCA 4RTWA 3RNJA 1NLOC 1OOTA 4OMNA 1ABQA 5IXFA 1PNJA 1ZUKA 2KROA 4FSSA 2CT3A 2EVRA 1PKTA 1M8MA 4RTUA 1U3OA 2JTEA 2GNCA 1KJWA 1MUZA 1M30A 2JMCA 1K76A 2JMAA 1JO8A 1QLYA 3M0PA 3I35A 3PVLA 2KBTA 1X69A 3QWYA 4J9DA 4JPBW 2KRNA 1YN8A 3H0HA 2DBKA 3NGPA 1WA7A 1X27A 1AWJA 1TG0A 1M3AA 2RNAA 4OMOA 3FJ5A 4HVWA 2KT1A 4LE9A 2M51A 1AZGB 3SHWA 2EW3A 1E7OA 2DMOA 2BZ8A 1GBRA 2DBMA 4HXJA 2FPFA 2EKHA 4J9CA 1ABOA 4JJBA 4JJCA 1YNZA 2X3WD 1K4US 1JQQA 1GRIA 3IQLA 1PHTA 4IIOA 2JS2A 4Z8AA 2YSQA 3REAB 2LCSA 2RQVA 3VS5A 2V1QA 4F14A 4AFUC 3REBB 4F16A 1UTIA
chains in the Genus database with same CATH superfamily
3JCMQ 3H41A 4E47A 2EBPA 3OYNA 1E6HA 1NLPC 4PFZA 5GMKm 4PJOE 3MEAA 5LJ5f 4ORZA 2F2WA 4HCZA 2VXFA 3EHQA 2LQ8A 4PL6A 4JRKA 1D3BB 5GANh 2BZYA 2DTOA 4C92B 4RTZA 1VQMQ 1YJWA 3FIFA 5I22A 1NG2A 2DRMA 2Y4YA 2PTKA 3JCMe 4Z02A 2QA4Q 3CCJA 2X4XA 2WACA 3X20B 2CP3A 1DJ7B 2R58A 3G1JA 5LJ5j 4RG8A 1IO6A 2RQWA 2KGTA 2L2PA 2RQRA 1U1TA 1YI2A 1ZLMA 4J83A 2YXYA 4OMFB 1K9MC 2D0NA 2L0AA 4KUIA 2M02A 2C06A 1XOVA 2J6OA 2BKDN 4WF2A 3I55Q 1IHVA 2RI5A 2MIOA 2YRVA 3H9NA 4PJNA 3O8VA 1PCXA 1JXMA 4OB2B 3GPLA 3L42A 4E7IA 3FB9A 3VUBA 5CO7A 2KK4A 2CT4A 2YRDA 3TEEA 2YRCA 5LJ5e 2YDLA 2P84A 5J3BA 2XD0A 3C0CA 2WSCE 2DD4A 4PJLA 4QT7A 2E12A 3QXEB 1VQOA 2QGFB 1VQNT 1RAFB 1Y57A 2BE9B 1SHGA 2RF0A 1JBMA 5J26A 3I56Q 4KBMB 4J9BA 1Y96A 2RD1A 1AWWA 4CC3A 3BDUA 3G4SA 3NPFA 1D1CA 2EAYA 3VS6A 3N5BB 3ZL7C 1NEGA 4C0ZA 1T0JA 2DA9A 4RMOA 1K73C 2YUQA 4JUVA 1ACMB 4M77E 2HZYA 3SWNA 3G71Q 1WYXA 1EIFA 2VGMA 1UDLA 1QKXA 1PKSA 3M59A 5GAOq 4AFZC 5GAMh 4RKUE 4KULA 2H3EB 1WI7A 5GAN6 1TUDA 3FC3A 3CCLA 4ZTJA 1OYXA 4XU3A 1D1BA 3HFNA 4C8QD 2W10A 3EFSA 5KYWA 1RAGB 2JTFA 4QVZA 4HVUA 1X6BA 2RK1A 1MHNA 3UA6A 2H3JA 2DVEA 1RAAB 1KD1U 3X28B 1WX6A 5GANj 5IAYA 2J6KA 1YWPA 1U5SA 4RTTA 1LCKA 1C1AA 1IZ6A 2V8JA 3ZEHA 2K4YA 1ZA2B 4ZGEB 1WXTA 2QDLA 4M75G 4DEXA 3JSCA 1ZUYA 3RUXA 2EJGA 1RUWA 2RK2A 3DKMA 4HCBA 2D0QB 1LJOA 1N9RA 3E9GA 3M9QA 2DF6A 1I07A 2DL8A 3NTIA 1OX9A 2EYQA 3L2UA 1VQ8A 4RTVA 3R6NA 4UC4A 2AIRB 1PC0A 3EH2A 2DIGA 1PWTA 2FYKA 2F1LA 4J9EA 3M0UA 1W6XA 4F7UB 5GAOr 2D8HA 3OMCA 1VQ7Q 4L5GA 3I9QA 2C0TA 4C8QA 3CC7A 1VQOT 3JAME 2VV5A 3A5ZB 1GL5A 4OGCA 2RHIA 2PZ1A 3OS2A 1RLPC 2EWNA 4DQ2A 3G4ST 3KUFA 2KEAA 2DJZA 2LRQA 4X9CA 1YFNA 3L1AA 4C0DC 2L89A 3D7SB 3V8LA 3A1PA 5HKCA 3CC4A 2QQBA 2KXCA 2MAMA 2OI3A 4M7AE 2OTJA 4OMLA 1BCOA 2NUPB 2D9TA 3THKA 3OYJA 2A7YA 4Z89A 2P0KA 1KC8R 3CCJQ 1UHCA 4C8QF 1EZZB 3PMIA 4J6XA 2LX9A 4D8KA 1U8RA 1M90U 2FEIA 5GAMj 2ATCB 2ZCFB 2AK5A 3TQ7P 1YI2Q 1PSEA 5IHKA 1LOJA 1OU9A 2GFAA 1H8KA 1M1KR 2DL7A 1FXXA 3BE3A 4A4FA 4LD6A 2F2VA 4JS4A 4C8QG 2VYTA 1TXQA 4DBRA 4YTLA 4A63B 5CKDA 1WHJA 2ZAEA 1R8OB 2P4RA 4FU6A 4GLKA 3FRNA 1WHGA 4BACA 3CCVA 1QW1A 2IIMA 3GP8A 1QVPA 3CCET 3RDVA 3G6ET 2VASA 4LNPA 3C4SA 3VRYA 3CMAA 4EIKA 2YHTA 1VQ8T 1SRMA 2O31A 2FRYA 2YUPA 2QQRA 4RCBA 1WPYA 4IUTA 1UEBA 4LXCA 3L2RA 2K3YA 1XTDA 3U23A 2E5KA 2R5MA 4PJOD 4JLGA 2RI3A 2JXBA 3JB9I 3CC7T 1G3SA 3SWNC 2KRMA 2FPDA 1WJRA 4D8DA 3QG1A 1MGQA 2HBWA 3PGGA 2DEUA 2KXDA 3GBQA 2OTLA 4M7DE 1UGSB 1UGQB 4JJNK 4MDWA 4IUVA 3QZ5B 5FLXE 3M5AA 3LYIA 3NHNA 3CCLQ 3WVEB 2JT4A 4KGZB 3RMSA 9ATCB 1Y0MA 1K1ZA 2OTJT 4E2FB 3PFSA 4N4IA 2A36A 4C92E 4RTWA 3V7CA 1NLOC 3CXCA 3VU3C 4XK8E 1ZBXA 5D7UA 1D1AA 4ZGDB 5A0DA 2QA4A 2LCCA 3JRZA 2EJ9A 2XK0A 3MO8A 2JTEA 2GNCA 2JMCA 2YWWA 4PJOA 1QLYA 4J9DA 3QWYA 1N8RU 2EQKA 3S6WA 4JPBW 1MNDA 4J6WA 1VQ9A 1D09B 2ZZDA 3H0HA 4HKEA 1AWJA 5LJ3f 1TG0A 1M3AA 1YJ9Q 1ZQ1A 1M2OA 1YHQT 4LE9A 2CP6A 2E4HA 2EW3A 3VKIA 2EQJA 2FPFA 4JJCA 1BI0A 3CCRA 1EX4A 3HFOA 4IIOA 3JCMh 1PM3A 2LDMA 3JB9D 3X25B 2QEXQ 1IGQA 3M54A 1RAHB 3MHXA 2E1HA 1X01A 4F14A 2DYIA 4EMKB 3REBB 3CC2Q 1KHCA 4PJOF 2X3XD 4KH0B 5DY9A 2AKLA 2EPDA 1ZA1B 4R55A 1NJIR 2CH4A 3RMQA 1YWOA 2VGNA 1B34B 1YJNA 3J7AF 2CDTA 4F17A 2DD5A 5J39A 2KNBB 3NMZC 4BI3A 3I56A 8AT1B 2CGHA 4E7JA 3EHRA 1SRLA 2QASA 1H641 3MEWA 2C0IA 4XAXB 4PLLA 1HYOA 2HEQA 1M1GA 3CC4Q 1T3SA 4PJOG 4FM4B 1SG5A 1B7TA 2NWMA 2QQ9A 5CKFA 5AT1B 5C0MA 5LJ3e 5L8RE 2CS7A 2MK5A 2YT6A 5LJ5h 3BY7A 4OMPA 2CREA 4VUBA 2X51A 1VA7A 4IIMA 1RAIB 4BI8B 3WVDB 1UTIA 3VS4A 1V29B 2CZ7B 2M0YA 2OAWA 2E3HA 1VQMT 1G2BA 3JCMb 2EFIA 2E65A 2EQIA 1M90C 2QA4T 3VS1A 2JZ2A 4J8OA 3L2WA 2EYXA 2K2MA 3TSWA 1C0MA 2YUOA 2W0ZA 4FT4A 4KT0E 3OS5A 4O6JA 1WQ7A 4XU2A 3L2ZA 3CCUQ 1H3HA 5GJVB 2GTJA 5I11A 4BDZA 4FW1A 2V1RA 3I55T 5D6WA 4LDXA 1WHKA 1M8VA 1WIEA 5HY6A 1PD1A 3HRUA 2COWA 5LJ3d 2AHJB 3OYMA 2VC8A 3KXTA 4Q5WA 3UT1A 4C0FA 1JU5C 2GBQA 4XTWA 2VVKA 4BI4A 4F7UE 1Y96B 4XU0A 4AG2C 2L8DA 3OY9A 4XTVA 1IXDA 3F70A 3HTRA 4X34A 4OGEA 3OYCA 1T3LA 4M78E 3M57A 2FZKB 4EMKA 4B6MA 3SWNB 1OZ3A 4C5IA 1RADB 2J6FA 3I56T 3VS2A 2HNIA 1G83A 3CBMA 2M16A 4M77G 4E6RA 3CPFA 4HVVA 1JJ2A 4DOWA 2KAFA 1Q82U 2A37A 3E1SA 2GGRA 2OJ2A 2ZPGB 5M9OA 2HDAA 3G71T 1Q95G 1I5OB 1SSHA 5KYWB 1K9AA 2R57A 3M0SA 1O9SA 5KYUB 3PVQA 4PK4A 5GAN7 1WXUA 2YLBA 5HK0A 5GAOp 2QQSA 5FW9A 3I5RA 2CZ1B 3P8HA 4J9FA 1VQKA 2FPEA 2JVVA 5GAN5 4M75D 3LH0A 2L3PA 1U06A 2RHUA 5KH6A 4RG2A 3VYHB 1RI0A 3TREA 2HMAA 1QVGA 1VQ9Q 3EGDA 2JW4A 1RI9A 3UA7A 1N8RC 1QVFA 2JS0A 2HKNA 2VWFA 2PNIA 4K11A 1VQ4Q 2LTOA 1FX7A 2BZXA 3CCRQ 2DFUA 2X35A 4ZGJB 3A8HB 1R0BG 2BTTA 1KQSP 1G5VA 1NE8A 2MYSA 1S72Q 1AWXA 1PSFA 2LNVA 3URGA 2ED1A 1WGSA 3A8GB 1M4ZA 3SB2A 3CMEA 4C8QB 1K8AR 2V8KA 4ME7A 2VXEA 3PIOA 3A98A 7AT1B 1EFNA 4M7DD 3CPWP 2A28A 3ME9A 1AD5A 2XICA 1I4K1 1YJNQ 1Q7YU 1WQWA 4IUPA 1WDXA 4M7AF 2PVOB 4BE0A 1VQ7T 4DEYA 1ZSGA 3OYHA 1GCQC 1N9SA 4M75A 4MZPA 3CCQT 2JM9A 3VJPA 1B07A 1SHFA 3TU4K 1TS9A 5L23A 2GF7A 1QKWA 1TSFA 2DTIA 3OYYA 2HQEA 3QSUA 2LT4A 2EYYA 2PVGB 4AT1B 4M7AG 4KGXB 5GAOm 3T9NA 2VB6A 2QXFA 2EGAA 2H8HA 2PUKB 2DVJA 3RESA 1Y07A 2K5FA 2CZ6B 1ZHIA 2DXBA 4Y91A 1YJWT 2DPPB 3JCMc 2RHYA 4R0KA 3LGLA 1KQSS 4M75F 1Z9ZA 3PMTA 1VQ5Q 1J3TA 2K7AA 3CCJT 1Q81R 3LX7A 4M7DA 3Q1JA 5KYUA 2RMOA 4V2SA 4FT2A 4JJDA 1ZUUA 2CSIA 1YI2T 3CPWS 2J05A 2L5QA 2ROTA 1NYFA 4LD9K 1QCFA 1N5ZA 1AOJA 5CAIA 1HJDA 2NUTA 4BD3A 1YJ9A 4BDYA 4KRTA 3DLLA 2IPOB 3C12A 1I5LA 3AT1B 3MP8A 2LJ1A 2RI2A 1Z9QA 4EMKC 1NZ9A 4M7DF 1ZSZB 4MMKA 4MMLA 3P8BB 4QQGA 2QEXA 1NM7A 2JTMA 3CBOA 4PJJA 1Y7XA 3CC2A 4ESRA 2K3XA 4AMCA 4QQDA 2X4WA 1UJ0A 3OSSC 1UUEA 3DLMA 4QVDA 1W2BA 1QWEA 4DBQA 2DAQA 2P0PA 5KCHA 4P5NA 4M7DG 2DE0X 3VV0A 2MI6A 3GLXA 4JDSA 5GAN4 5FWCA 1VIFA 5GANg 4OMNA 3VYGA 3OBWA 1PNJA 1AT1B 1IRXA 2KROA 4KH1B 4FSSA 2P4TA 1UGPB 3ZBDA 2EVRA 1Q82C 2NYSA 3EGXA 1U3OA 1MUZA 1XJWB 1M30A 2DXTA 3M0PA 1TU0B 1X69A 3CCLT 1VQKQ 4PNOA 2HBPA 3S3OA 2WSFE 5FU7B 1WZOA 4PJOB 4XTXA 1Q86R 3S3NA 4L6V5 2K5LA 3NGPA 3UWNA 2O01E 3FJ5A 4HVWA 2KT1A 2K5IA 3SHWA 2DO3A 2E5QA 2DKGA 2YLCA 2BZ8A 2DBMA 4HXJA 2EKHA 4JJBA 3EAEA 2RJCA 3FLGA 2I2LA 1GRIA 1VQ6Q 1PHTA 2ZPBB 2QDYB 4Z8AA 1RL2A 1SF9A 3MPUB 3OMGA 3CEYA 1WNLA 1KQ2A 3JCMX 2F69A 3CD6Q 3VS5A 5LJ3h 5GMKe 1LPLA 3CCUA 3E9FA 4BUGA 4E7LA 3JB9J 4M78D 3EFRA 3EH1A 1WHLA 2RQTA 3CBPA 4QKUA 3CMEQ 2O88A 2DM1A 3RKYA 4MZMA 4PFOA 1BIBA 5I2SA 4A53A 4M75C 3EG1A 1K9MR 1Y71A 4A4GA 1QMCA 1AVZC 4OF1A 4EMGA 4HCCA 3JV3A 1W2BP 3RKWA 2QQAA 4O5VA 2IVWA 1Q7YC 1ZSZA 3CC2T 2FG0A 3QKJA 4CC2A 3QHSA 5EC7A 2HAXA 4Y28E 1VOMA 3QPHA 1S1NA 4A4KA 1X43A 5GMKl 1GFCA 4QVCA 4ATOA 5GAMg 2G6FX 2CP5A 3HKSA 2XG8D 5I2MA 3LH5A 1BYMA 1X6GA 3CC4T 3HP9A 1VUBA 3PNWC 3M4GA 3X24B 3M56A 4J5YA 4NS5A 3MEUA 4M78A 3OS1A 1ZX6A 4FYXB 4C5HA 1M3BA 3QJYA 3RR6A 2O9VA 4FL6A 1WJSA 1OULA 2M1HA 1K73R 2LMJA 4OB3B 2DZCA 3MP1A 1M5Q1 2X4JA 1GCPA 2FZCB 1UG1A 5FRMA 3EG9A 1TOVA 3EGUA 2E3IA 2JOYA 5IHIA 5IXBA 3OYAA 3OB9A 2EYWA 2E41A 2J06A 1IB8A 3LWIA 1W2BS 2MWPA 5GJWB 1QQJA 4FW2A 1KQ1A 4B9XA 2RQUA 2K6DA 2NLUA 2YUNA 2HQXA 2FHDA 1FMKA 4RTYA 1VQ4A 3VS0A 1PG5B 2DK3A 4M78F 2CP7A 4OP0A 3CCVT 3CCUT 1GXIE 1WXBA 2RJEA 2HSEB 2LNHB 2L3SA 4WCIA 4C8QC 1M3CA 4ANJA 5KYYB 3VS3A 1S72A 2MF2A 3CMAT 4L59A 2FB7A 1BK2A 3V8JA 2X4YA 5LJ3j 3OW2A 2KMTA 1BI2A 1KSWA 2MMPA 4LDVA 1YIJQ 4M77D 4C5GA 3OSVA 3BFMA 4M78G 4HT8A 4FYVB 3CCSQ 1BI3A 2D6FA 1A0NB 4C0GA 1VQLQ 1U1SA 1KG1A 2K57A 4E7HA 1G3WA 2CP2A 4TVRA 4A4EA 4J9HA 3M53A 2CSQA 1CSKA 5GAN8 3JCMP 1WLPB 4IUUA 2OTLT 3OYEA 2QTVA 4LUEA 2FZGB 1M1FA 4MDXA 1C6VX 4DBFA 4LDUA 2CKKA 4XU1A 1VYUA 2ZPEB 1X2QA 2ESWA 2V26A 2DL4A 2KT8A 3CXCP 1R0CB 4DA4A 4PFPA 1N27A 4ELYC 3EGDB 1W4SA 3QWXX 4M7AB 2X9HA 1OV3A 1VQ5A 2RB6A 4M77A 5IH2A 1XNIA 4PKCC 2KY9A 3HL8A 5IHNA 2O4XB 4JZ4A 5D6YA 2XDBA 1UECA 4GLMA 2DILA 3OYIA 1BB9A 1TUGB 5CK9A 1V1CA 2RO0A 1VQ9T 3QYHB 2IG0A 1CKBA 4LN2A 3L2QA 1G8XA 2RJFA 2SEMA 3EFOA 3M0QA 2DNUA 1BI1A 4F04B 4JS5A 3KFVA 3NTKA 1YHQQ 1KFZA 2XIDA 3TVTA 3CCRT 2LJ0A 1YITQ 4HCKA 1QCOA 1OPLA 1UHFA 1NJIU 3ER0A 1I1JA 1ZSZC 1S72T 4D6WA 4R56A 3EG3A 3ULRB 4M75B 4M77F 2PUOB 5KYYA 5CKEA 2MOXA 2NUZA 3CXCS 3PTAA 2L3RA 5CQXA 4OB0B 1QCNA 3RBBB 2EGEA 4M7AD 1F1BB 1HD3A 1YJNT 5FU6B 2HL3A 2JNGA 3GOXA 2DETA 4AFSC 1FWZA 4BE2A 4OMQA 3H0FA 2A08A 2B86A 2DRKA 1BU1A 1T0HA 2OAUA 4LUDA 3SEMA 2SRCA 3OYKA 3META 4GBQA 2XDPA 4ZTFA 2RHZA 5KYXB 2J7IA 2GQVA 5HCKA 2EQUA 1KC8C 5DLQE 3V8KA 4BY6C 1X75C 4ELZC 2JM8A 4M7DB 2F2XA 5FU7C 5ECAA 3H0IA 4PJOC 3M0TA 4RTXA 2Y4XA 1MMAA 3ASKA 5CR2A 2FVUA 1BBZA 1M1KC 3MCAB 2O2OA 1W70A 2RH2A 3GNFB 1YCSB 3OW2S 2DEQA 2KYBA 5A2QE 2GTOA 1VQ5T 1IHWA 3QZ9B 1MV3A 2NUTB 2COZA 1AEYA 5CVIA 4M7AA 2KQWA 3JCMV 2ABLA 1VQPQ 2JUFA 2R5AA 2XKOC 1VQ6A 2HD0A 2O4XA 3JCMg 2K79A 3UDCA 2KVQG 5A0GA 2K3BA 3CD6A 2Z0WA 3M55A 3UF4A 4DBHA 3MKDA 1KD1R 1HXDA 5IT9E 5GMKi 2KDSA 3QDFA 1UGRB 3M0RA 1M9SA 2F5TX 4AFQC 2Y90A 3LGFA 1OOTA 3A8MB 1ZUKA 2VUBA 3LLRA 2CT3A 3HRTA 3J81E 1PKTA 1M8MA 4RTUA 1TTHB 3JCMW 3CCMQ 4C92D 3JCMd 4XTZA 1K76A 2DZ9A 1JO8A 1JJ2P 5GMKh 1LVKA 3OQ5A 5LJ5g 3EGXB 3E19A 2KRNA 1V76A 1NPRA 1YBYA 2DBKA 1WA7A 3KBGA 4DOVA 4OMOA 1VIEA 4LDYA 4N4HA 1RAEB 2M51A 2K2VA 4XTYA 3FEOA 5KYXA 4E7ZA 4M77C 1N6AA 2X3WD 1K4US 1TH7A 1AHJB 4JLIA 3OYBA 3IQLA 4IUQA 2JS2A 3QYGB 4QW2A 2OX7A 2LCSA 5GANf 1QVGP 4B9WA 3INZA 1VQKT 2QI2A 4NL2A 4AFUC 4NL3A 4F16A 3PT9A 2HCKA 1NEBA 3QDRB 3JCMJ 1QVFP 2ROLA 3S3MA 2LVMA 4ZNXA 4J7FA 5LJ5d 1MNEA 1PRMC 3OS0A 2KR3A 2LC4A 4BB7A 1AZEA 1D3BA 4CC4B 1NPPA 4C92A 2G3RA 2LX7A 1VQ6T 2QTXA 5GAOn 1K8AU 5EG2A 4Z88A 1QWFA 5KYNA 5GAN2 1KK7A 2AZSA 3CD6T 5AYFA 4FCYA 3VS7A 1M90R 4OMMA 1JJ2S 3OYDA 2BIVA 2LJ3A 2XMFA 1JB0E 2XI9A 3UPUA 4ZN1A 2PVDB 2LT1A 1UJYA 2CH4W 5A0LA 2LCLA 5LL6S 3CMET 1NJIC 1MMDA 3C95A 2EGCA 5KE3A 2GQIA 3CCEA 3G6EA 3M58A 2KI7A 2FRWA 4CI0C 1W1FA 1BKBA 3SFMA 1YIJA 4A4HA 2DL3A 2KE9A 2D1XA 2M0OA 1D0YA 3RERA 4PJMA 1AWOA 2DXUA 1VYTA 3CCSA 1VQNQ 4C92F 3QJ6A 5GANe 4E7SA 3ZFJA 2I0NA 1VQLA 3OYFA 2HL5C 1QVGS 3MJXA 5HK3A 3CCQQ 1ZBJA 3MP6A 4XTUA 2DTHA 4M78B 1QVFS 2AZVA 2CYZB 4II1A 2HSPA 4FYYB 1MMNA 2F5KA 4WTOB 5FWBA 2LQKA 1QP2A 3WXMB 5GAN3 1B3QA 3OYGA 1Q81U 4C92G 1WFWA 4GY5A 3C94A 4BY6B 3LW5E 5GMKj 2KSSA 5DM7R 2XU8A 2RM4A 5GAMf 3EG9B 4M7AC 3GIBA 1JRIA 1RLQC 4PLIA 1YJWQ 1G3TA 2HKQB 3QUIA 1SEMA 3X26B 1GFDA 4J7IA 2CZ0B 5GANd 3GF5A 5I21A 3EG0A 1I81A 3L2VA 1I8FA 3PE0A 3QIIA 3LWHA 4XQ3A 1KIKA 3M4YA 1YJ9T 2RN8A 2PU9B 3CQTA 1OX8A 1CKAA 2D8JA 1K0SA 1YHQA 3HHTB 1YITA 1IGUA 1N8RR 4M75E 4N0AA 4KUDK 4JRQA 1YCYA 2QEXT 1O75A 4M4ZA 5FRNA 5DLOA 4E7KA 3BW1A 2RA2A 5FU6C 1GBQA 2ZGWA 2DL5A 5GAMe 5KE2A 1YIJT 1K0XA 2ZPHB 3V7RA 4KGVB 1D0XA 1D0ZA 1G3YA 4IURA 1VQOQ 3CCST 2A3LA 1JEGA 2VKNA 4CRIA 3DB4A 2P0QA 3PIPA 1VQLT 2V8IA 4FYWB 2EJFA 2EIFA 1WHHA 5C6SA 1JXOA 3G4SQ 4AG1C 4F7UA 1KC8U 3P8DA 1X2KA 3HPWA 1UE9A 1PD0A 2E6NA 6AT1B 3QO3A 1Q86U 4OVAA 1VYVA 4M7DC 1OZ2A 4J6YA 3RIRA 1UFFA 1RACB 2DJQA 3G7ZA 5CCAA 4M77B 4JZ3A 1M1KU 5KCOA 3QBYA 2ED0A 1KHIA 2KRSA 2WSEE 3R6OA 4C92C 4IKFA 4J9IA 1UGVA 3EFOB 1MV0B 5GAMd 1NYGA 2QYZA 1M2VB 3TCJA 2BE7D 8ATCB 1VQMA 2K9GA 3OA6A 1HSQA 4F7UF 2NUPA 2QGGA 1OI1A 1FYNA 3OBYA 4QQ6A 2QG9B 4RUGA 2FL7A 5CQYA 1VQPA 3V7SA 3SDZA 4N4GA 4A54A 4J9GA 1TUCA 2AT1B 2DLPA 4X1VA 3OYLA 1K9MU 1OQKA 1K8AC 1KD1C 2RJDA 2CUBA 5D6XA 2GFUA 1PRLC 3H8ZA 2AKKA 1H92A 5CKBA 4HA8A 4C8QE 4F7UG 3I55A 3CCEQ 2DX1A 3G6EQ 1YITT 3BDLA 1WHMA 4FSXA 4Y92A 2LQNA 3FJPA 2ENMA 3H6ZA 2B8AA 3VUZA 2M9UA 1OU8A 2E64A 2LP5A 1BCMA 1SKUB 1VQ8Q 2DERA 2GCXA 3JB9H 1TWBA 4EDUA 3UATA 3DB3A 2MWOA 1XQHA 2RPNA 1UB4A 1BIAA 3A8LB 3NTHA 2XDDA 3CC7Q 4X9DA 2E70A 2QAZA 3GNGA 1RABB 3CCMA 5GAOl 4RCCA 2DYBA 1YP5A 2LZ6B 1OPKA 2LQWA 3SD4A 1I0CA 5CKHA 1NBEB 2A0FB 2ECZA 2EYZA 1IREB 3EG2A 1K73U 4JRIA 4FIBA 1ARKA 2KYMA 2L3QA 1Q81C 1GCQA 2CUDA 3HRSA 2JN0A 4C0DB 2BUDA 1M27C 2OTJQ 3G71A 4MZTA 4NOYA 2C0OA 2COYA 3VRZA 5FROA 3AHUA 2JJ9A 1X6OA 3TSZA 1SPKA 5LJ3g 1Q82R 1OEBA 1E6GA 1LNXA 1H3ZA 2EKOA 2O9SA 3MEVA 1R77A 3I5SA 1SSFA 3J80E 4OB1B 2MCNA 4JRPA 4BE1A 1M2VA 2DXCA 4CC7A 2CP0A 2FO0A 1VQPT 1VQ4T 2RHXA 4N0AC 3RNJA 3HSBA 1ABQA 5IXFA 2ZPFB 5IN1A 1QP3A 3OW2P 4EMHA 5CIUA 4ZN3A 3CCVQ 4EPCA 3E2UA 2E6ZA 1P92A 1KJWA 2PQWA 1FMVA 2JMAA 3PVLA 3I35A 2KBTA 3JCMf 3CMAQ 2EQMA 2HQHA 1YN8A 1X27A 1KQSA 1HK9A 3JB9F 2RNAA 2XHCA 1WJQA 1AZGB 1FMWA 1MMGA 2QK0A 1E7OA 2MPXC 2ZPIB 2DMOA 1VQNA 3A8OB 1GBRA 4LDWA 4J9CA 1ABOA 4M78C 1YNZA 1VQ7A 3FDRA 1JQQA 4HT9A 3NFCA 3CCMT 3CPWA 3CCQA 3RKXA 2YSQA 3REAB 2RQVA 3JB9G 2OTLQ 2DIQA 2E10A 2V1QA 1Q7YR 1Q86C 4C5EA 1B34A 3O5ZA
chains in the Genus database with same CATH topology
2HCKA 1NEBA 2ROLA 2AKLA 2EPDA 3H41A 4ZNXA 2RQTA 2CH4A 2EBPA 1YWOA 1E6HA 1NLPC 2O88A 1PRMC 2DM1A 2KR3A 2CDTA 4F17A 1AZEA 4ORZA 2F2WA 4CC4B 2KNBB 3NMZC 3EG1A 3EHQA 3EHRA 1SRLA 2LX7A 1AVZC 4Z88A 2C0IA 2BZYA 1QWFA 4RTZA 3JV3A 2HEQA 5I22A 1NG2A 2DRMA 2PTKA 1T3SA 2AZSA 2NWMA 3VS7A 4OMMA 2FG0A 4CC2A 2LJ3A 2XMFA 5EC7A 1UJYA 2CH4W 1S1NA 2YT6A 4OMPA 1IO6A 2CREA 1X43A 2EGCA 2KGTA 2L2PA 2RQWA 2RQRA 1GFCA 2GQIA 2G6FX 1VA7A 1ZLMA 2FRWA 4IIMA 1W1FA 3LH5A 2D0NA 2L0AA 3VS4A 1XOVA 2J6OA 2DL3A 2KE9A 2D1XA 2M0YA 2OAWA 1X6GA 1AWOA 1G2BA 1VYTA 2MIOA 2I0NA 2EQIA 3VS1A 2X3XD 1ZX6A 1M3BA 2EYXA 1ZBJA 2K2MA 1JXMA 3TSWA 2YUOA 2AZVA 2HSPA 2O9VA 2CT4A 2W0ZA 2YDLA 5FWBA 1H3HA 2LMJA 5GJVB 2GTJA 3C0CA 5I11A 2V1RA 1GCPA 1B3QA 4QT7A 1WFWA 1UG1A 1WIEA 3EGUA 5IHIA 5IXBA 2EYWA 2J06A 1Y57A 1SHGA 2RF0A 4J9BA 5GJWB 1AWWA 2RQUA 2K6DA 4CC3A 1JU5C 2YUNA 2GBQA 1FMKA 3NPFA 1RLQC 4RTYA 2VVKA 3VS6A 3VS0A 3ZL7C 1NEGA 4AG2C 1T0JA 2DA9A 1SEMA 1WXBA 2LNHB 2YUQA 2L3SA 4WCIA 1T3LA 1GFDA 1M3CA 1WYXA 3VS3A 1UDLA 3EG0A 1QKXA 1PKSA 4AFZC 1BK2A 1WI7A 1TUDA 2J6FA 1KSWA 3PE0A 3VS2A 1KIKA 2RN8A 1G83A 3CQTA 4E6RA 2W10A 4HVVA 1CKAA 2D8JA 1K0SA 1A0NB 2A37A 2GGRA 2OJ2A 4HVUA 1X6BA 2HDAA 3UA6A 1SSHA 4J9HA 1K9AA 1WX6A 3M0SA 2CSQA 1CSKA 2J6KA 1WLPB 1YWPA 3PVQA 4M4ZA 1WXUA 1U5SA 4RTTA 5FW9A 1LCKA 3I5RA 1GBQA 4LUEA 2DL5A 4J9FA 2FPEA 1K0XA 1WXTA 2QDLA 1VYUA 2L3PA 1U06A 1X2QA 2ESWA 4DEXA 1ZUYA 2DL4A 2KT8A 1RUWA 1JEGA 2VKNA 2DF6A 1I07A 2DL8A 2JW4A 1RI9A 3UA7A 1JXOA 2JS0A 4RTVA 4AG1C 2VWFA 3R6NA 1X2KA 2PNIA 4K11A 1UE9A 3QWXX 1PWTA 4J9EA 3M0UA 1W6XA 1OV3A 1VYVA 2BZXA 2D8HA 5IH2A 5IHNA 3I9QA 1UFFA 2BTTA 2C0TA 2DJQA 4JZ4A 1UECA 4GLMA 1AWXA 2DILA 4JZ3A 1BB9A 2ED1A 3O5ZA 1V1CA 2ED0A 2KRSA 1CKBA 4LN2A 1GL5A 2PZ1A 3A98A 2SEMA 3M0QA 1EFNA 1RLPC 4J9IA 2DNUA 2KEAA 2A28A 1AD5A 1UGVA 1MV0B 1NYGA 3KFVA 1KFZA 1WDXA 3TVTA 2LJ0A 4HCKA 2K9GA 4DEYA 1ZSGA 1HSQA 1GCQC 1OPLA 1UHFA 2KXCA 1I1JA 1FYNA 2OI3A 4RUGA 2JM9A 4OMLA 3EG3A 3ULRB 3THKA 4J9GA 1B07A 1SHFA 4Z89A 1TUCA 2DLPA 4X1VA 5L23A 1QKWA 1UHCA 2MOXA 2NUZA 2CUBA 3RBBB 2EGEA 2EYYA 1PRLC 4D8KA 1HD3A 2AKKA 1H92A 2FEIA 4AFSC 2DX1A 2AK5A 2EGAA 4OMQA 5IHKA 4Y92A 3H0FA 2LQNA 2H8HA 2A08A 2B86A 2ENMA 2DVJA 2DRKA 1H8KA 1BU1A 1T0HA 2LP5A 4LUDA 3SEMA 2SRCA 2DL7A 4GBQA 3UATA 4R0KA 2RPNA 2F2VA 2J7IA 1Z9ZA 4A63B 5HCKA 1J3TA 2K7AA 2P4RA 2RMOA 2IIMA 2JM8A 2F2XA 5ECAA 3H0IA 3M0TA 4RTXA 4JJDA 1ZUUA 2CSIA 2DYBA 1YP5A 2LZ6B 4LNPA 3VRYA 1OPKA 2J05A 2ROTA 1NYFA 2LQWA 4EIKA 1BBZA 1I0CA 1QCFA 1SRMA 2O31A 2FRYA 1N5ZA 2YUPA 2O2OA 1AOJA 1W70A 2ECZA 1YCSB 1HJDA 2EYZA 3EG2A 2KYBA 2GTOA 4KRTA 1ARKA 3U23A 2KYMA 2E5KA 2L3QA 1MV3A 1AEYA 1GCQA 2CUDA 2JXBA 1M27C 2ABLA 2KRMA 2FPDA 2LJ1A 4D8DA 1Z9QA 2C0OA 2K79A 3VRZA 2HBWA 1NM7A 2K3BA 2KXDA 3GBQA 3TSZA 1SPKA 3UF4A 1OEBA 1E6GA 4ESRA 1UJ0A 1UUEA 2O9SA 1QWEA 3NHNA 3I5SA 2JT4A 2MCNA 1Y0MA 1K1ZA 4CC7A 2FO0A 2DE0X 3M0RA 2A36A 4AFQC 5FWCA 4RTWA 3RNJA 1NLOC 1OOTA 4OMNA 1ABQA 5IXFA 1PNJA 1ZUKA 2KROA 4FSSA 2CT3A 2EVRA 1PKTA 1M8MA 4RTUA 1U3OA 2JTEA 2GNCA 1KJWA 1MUZA 1M30A 2JMCA 1K76A 2JMAA 1JO8A 1QLYA 3M0PA 3I35A 3PVLA 2KBTA 1X69A 3QWYA 4J9DA 4JPBW 2KRNA 1YN8A 3H0HA 2DBKA 3NGPA 1WA7A 1X27A 1AWJA 1TG0A 1M3AA 2RNAA 4OMOA 3FJ5A 4HVWA 2KT1A 4LE9A 2M51A 1AZGB 3SHWA 2EW3A 1E7OA 2DMOA 2BZ8A 1GBRA 2DBMA 4HXJA 2FPFA 2EKHA 4J9CA 1ABOA 4JJBA 4JJCA 1YNZA 2X3WD 1K4US 1JQQA 1GRIA 3IQLA 1PHTA 4IIOA 2JS2A 4Z8AA 2YSQA 3REAB 2LCSA 2RQVA 3VS5A 2V1QA 4F14A 4AFUC 3REBB 4F16A 1UTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCK A;  1NEB A;  2ROL A;  2AKL A;  2EPD A;  3H41 A;  4ZNX A;  2RQT A;  2CH4 A;  2EBP A;  1YWO A;  1E6H A;  1NLP C;  2O88 A;  1PRM C;  2DM1 A;  2KR3 A;  2CDT A;  4F17 A;  1AZE A;  4ORZ A;  2F2W A;  4CC4 B;  2KNB B;  3NMZ C;  3EG1 A;  3EHQ A;  3EHR A;  1SRL A;  2LX7 A;  1AVZ C;  4Z88 A;  2C0I A;  2BZY A;  1QWF A;  4RTZ A;  3JV3 A;  2HEQ A;  5I22 A;  1NG2 A;  2DRM A;  2PTK A;  1T3S A;  2AZS A;  2NWM A;  3VS7 A;  4OMM A;  2FG0 A;  4CC2 A;  2LJ3 A;  2XMF A;  5EC7 A;  1UJY A;  2CH4 W;  1S1N A;  2YT6 A;  4OMP A;  1IO6 A;  2CRE A;  1X43 A;  2EGC A;  2KGT A;  2L2P A;  2RQW A;  2RQR A;  1GFC A;  2GQI A;  2G6F X;  1VA7 A;  1ZLM A;  2FRW A;  4IIM A;  1W1F A;  3LH5 A;  2D0N A;  2L0A A;  3VS4 A;  1XOV A;  2J6O A;  2DL3 A;  2KE9 A;  2D1X A;  2M0Y A;  2OAW A;  1X6G A;  1AWO A;  1G2B A;  1VYT A;  2MIO A;  2I0N A;  2EQI A;  3VS1 A;  2X3X D;  1ZX6 A;  1M3B A;  2EYX A;  1ZBJ A;  2K2M A;  1JXM A;  3TSW A;  2YUO A;  2AZV A;  2HSP A;  2O9V A;  2CT4 A;  2W0Z A;  2YDL A;  5FWB A;  1H3H A;  2LMJ A;  5GJV B;  2GTJ A;  3C0C A;  5I11 A;  2V1R A;  1GCP A;  1B3Q A;  4QT7 A;  1WFW A;  1UG1 A;  1WIE A;  3EGU A;  5IHI A;  5IXB A;  2EYW A;  2J06 A;  1Y57 A;  1SHG A;  2RF0 A;  4J9B A;  5GJW B;  1AWW A;  2RQU A;  2K6D A;  4CC3 A;  1JU5 C;  2YUN A;  2GBQ A;  1FMK A;  3NPF A;  1RLQ C;  4RTY A;  2VVK A;  3VS6 A;  3VS0 A;  3ZL7 C;  1NEG A;  4AG2 C;  1T0J A;  2DA9 A;  1SEM A;  1WXB A;  2LNH B;  2YUQ A;  2L3S A;  4WCI A;  1T3L A;  1GFD A;  1M3C A;  1WYX A;  3VS3 A;  1UDL A;  3EG0 A;  1QKX A;  1PKS A;  4AFZ C;  1BK2 A;  1WI7 A;  1TUD A;  2J6F A;  1KSW A;  3PE0 A;  3VS2 A;  1KIK A;  2RN8 A;  1G83 A;  3CQT A;  4E6R A;  2W10 A;  4HVV A;  1CKA A;  2D8J A;  1K0S A;  1A0N B;  2A37 A;  2GGR A;  2OJ2 A;  4HVU A;  1X6B A;  2HDA A;  3UA6 A;  1SSH A;  4J9H A;  1K9A A;  1WX6 A;  3M0S A;  2CSQ A;  1CSK A;  2J6K A;  1WLP B;  1YWP A;  3PVQ A;  4M4Z A;  1WXU A;  1U5S A;  4RTT A;  5FW9 A;  1LCK A;  3I5R A;  1GBQ A;  4LUE A;  2DL5 A;  4J9F A;  2FPE A;  1K0X A;  1WXT A;  2QDL A;  1VYU A;  2L3P A;  1U06 A;  1X2Q A;  2ESW A;  4DEX A;  1ZUY A;  2DL4 A;  2KT8 A;  1RUW A;  1JEG A;  2VKN A;  2DF6 A;  1I07 A;  2DL8 A;  2JW4 A;  1RI9 A;  3UA7 A;  1JXO A;  2JS0 A;  4RTV A;  4AG1 C;  2VWF A;  3R6N A;  1X2K A;  2PNI A;  4K11 A;  1UE9 A;  3QWX X;  1PWT A;  4J9E A;  3M0U A;  1W6X A;  1OV3 A;  1VYV A;  2BZX A;  2D8H A;  5IH2 A;  5IHN A;  3I9Q A;  1UFF A;  2BTT A;  2C0T A;  2DJQ A;  4JZ4 A;  1UEC A;  4GLM A;  1AWX A;  2DIL A;  4JZ3 A;  1BB9 A;  2ED1 A;  3O5Z A;  1V1C A;  2ED0 A;  2KRS A;  1CKB A;  4LN2 A;  1GL5 A;  2PZ1 A;  3A98 A;  2SEM A;  3M0Q A;  1EFN A;  1RLP C;  4J9I A;  2DNU A;  2KEA A;  2A28 A;  1AD5 A;  1UGV A;  1MV0 B;  1NYG A;  3KFV A;  1KFZ A;  1WDX A;  3TVT A;  2LJ0 A;  4HCK A;  2K9G A;  4DEY A;  1ZSG A;  1HSQ A;  1GCQ C;  1OPL A;  1UHF A;  2KXC A;  1I1J A;  1FYN A;  2OI3 A;  4RUG A;  2JM9 A;  4OML A;  3EG3 A;  3ULR B;  3THK A;  4J9G A;  1B07 A;  1SHF A;  4Z89 A;  1TUC A;  2DLP A;  4X1V A;  5L23 A;  1QKW A;  1UHC A;  2MOX A;  2NUZ A;  2CUB A;  3RBB B;  2EGE A;  2EYY A;  1PRL C;  4D8K A;  1HD3 A;  2AKK A;  1H92 A;  2FEI A;  4AFS C;  2DX1 A;  2AK5 A;  2EGA A;  4OMQ A;  5IHK A;  4Y92 A;  3H0F A;  2LQN A;  2H8H A;  2A08 A;  2B86 A;  2ENM A;  2DVJ A;  2DRK A;  1H8K A;  1BU1 A;  1T0H A;  2LP5 A;  4LUD A;  3SEM A;  2SRC A;  2DL7 A;  4GBQ A;  3UAT A;  4R0K A;  2RPN A;  2F2V A;  2J7I A;  1Z9Z A;  4A63 B;  5HCK A;  1J3T A;  2K7A A;  2P4R A;  2RMO A;  2IIM A;  2JM8 A;  2F2X A;  5ECA A;  3H0I A;  3M0T A;  4RTX A;  4JJD A;  1ZUU A;  2CSI A;  2DYB A;  1YP5 A;  2LZ6 B;  4LNP A;  3VRY A;  1OPK A;  2J05 A;  2ROT A;  1NYF A;  2LQW A;  4EIK A;  1BBZ A;  1I0C A;  1QCF A;  1SRM A;  2O31 A;  2FRY A;  1N5Z A;  2YUP A;  2O2O A;  1AOJ A;  1W70 A;  2ECZ A;  1YCS B;  1HJD A;  2EYZ A;  3EG2 A;  2KYB A;  2GTO A;  4KRT A;  1ARK A;  3U23 A;  2KYM A;  2E5K A;  2L3Q A;  1MV3 A;  1AEY A;  1GCQ A;  2CUD A;  2JXB A;  1M27 C;  2ABL A;  2KRM A;  2FPD A;  2LJ1 A;  4D8D A;  1Z9Q A;  2C0O A;  2K79 A;  3VRZ A;  2HBW A;  1NM7 A;  2K3B A;  2KXD A;  3GBQ A;  3TSZ A;  1SPK A;  3UF4 A;  1OEB A;  1E6G A;  4ESR A;  1UJ0 A;  1UUE A;  2O9S A;  1QWE A;  3NHN A;  3I5S A;  2JT4 A;  2MCN A;  1Y0M A;  1K1Z A;  4CC7 A;  2FO0 A;  2DE0 X;  3M0R A;  2A36 A;  4AFQ C;  5FWC A;  4RTW A;  3RNJ A;  1NLO C;  1OOT A;  4OMN A;  1ABQ A;  5IXF A;  1PNJ A;  1ZUK A;  2KRO A;  4FSS A;  2CT3 A;  2EVR A;  1PKT A;  1M8M A;  4RTU A;  1U3O A;  2JTE A;  2GNC A;  1KJW A;  1MUZ A;  1M30 A;  2JMC A;  1K76 A;  2JMA A;  1JO8 A;  1QLY A;  3M0P A;  3I35 A;  3PVL A;  2KBT A;  1X69 A;  3QWY A;  4J9D A;  4JPB W;  2KRN A;  1YN8 A;  3H0H A;  2DBK A;  3NGP A;  1WA7 A;  1X27 A;  1AWJ A;  1TG0 A;  1M3A A;  2RNA A;  4OMO A;  3FJ5 A;  4HVW A;  2KT1 A;  4LE9 A;  2M51 A;  1AZG B;  3SHW A;  2EW3 A;  1E7O A;  2DMO A;  2BZ8 A;  1GBR A;  2DBM A;  4HXJ A;  2FPF A;  2EKH A;  4J9C A;  1ABO A;  4JJB A;  4JJC A;  1YNZ A;  2X3W D;  1K4U S;  1JQQ A;  1GRI A;  3IQL A;  1PHT A;  4IIO A;  2JS2 A;  4Z8A A;  2YSQ A;  3REA B;  2LCS A;  2RQV A;  3VS5 A;  2V1Q A;  4F14 A;  4AFU C;  3REB B;  4F16 A;  1UTI A; 
#chains in the Genus database with same CATH topology
 3JCM Q;  3H41 A;  4E47 A;  2EBP A;  3OYN A;  1E6H A;  1NLP C;  4PFZ A;  5GMK m;  4PJO E;  3MEA A;  5LJ5 f;  4ORZ A;  2F2W A;  4HCZ A;  2VXF A;  3EHQ A;  2LQ8 A;  4PL6 A;  4JRK A;  1D3B B;  5GAN h;  2BZY A;  2DTO A;  4C92 B;  4RTZ A;  1VQM Q;  1YJW A;  3FIF A;  5I22 A;  1NG2 A;  2DRM A;  2Y4Y A;  2PTK A;  3JCM e;  4Z02 A;  2QA4 Q;  3CCJ A;  2X4X A;  2WAC A;  3X20 B;  2CP3 A;  1DJ7 B;  2R58 A;  3G1J A;  5LJ5 j;  4RG8 A;  1IO6 A;  2RQW A;  2KGT A;  2L2P A;  2RQR A;  1U1T A;  1YI2 A;  1ZLM A;  4J83 A;  2YXY A;  4OMF B;  1K9M C;  2D0N A;  2L0A A;  4KUI A;  2M02 A;  2C06 A;  1XOV A;  2J6O A;  2BKD N;  4WF2 A;  3I55 Q;  1IHV A;  2RI5 A;  2MIO A;  2YRV A;  3H9N A;  4PJN A;  3O8V A;  1PCX A;  1JXM A;  4OB2 B;  3GPL A;  3L42 A;  4E7I A;  3FB9 A;  3VUB A;  5CO7 A;  2KK4 A;  2CT4 A;  2YRD A;  3TEE A;  2YRC A;  5LJ5 e;  2YDL A;  2P84 A;  5J3B A;  2XD0 A;  3C0C A;  2WSC E;  2DD4 A;  4PJL A;  4QT7 A;  2E12 A;  3QXE B;  1VQO A;  2QGF B;  1VQN T;  1RAF B;  1Y57 A;  2BE9 B;  1SHG A;  2RF0 A;  1JBM A;  5J26 A;  3I56 Q;  4KBM B;  4J9B A;  1Y96 A;  2RD1 A;  1AWW A;  4CC3 A;  3BDU A;  3G4S A;  3NPF A;  1D1C A;  2EAY A;  3VS6 A;  3N5B B;  3ZL7 C;  1NEG A;  4C0Z A;  1T0J A;  2DA9 A;  4RMO A;  1K73 C;  2YUQ A;  4JUV A;  1ACM B;  4M77 E;  2HZY A;  3SWN A;  3G71 Q;  1WYX A;  1EIF A;  2VGM A;  1UDL A;  1QKX A;  1PKS A;  3M59 A;  5GAO q;  4AFZ C;  5GAM h;  4RKU E;  4KUL A;  2H3E B;  1WI7 A;  5GAN 6;  1TUD A;  3FC3 A;  3CCL A;  4ZTJ A;  1OYX A;  4XU3 A;  1D1B A;  3HFN A;  4C8Q D;  2W10 A;  3EFS A;  5KYW A;  1RAG B;  2JTF A;  4QVZ A;  4HVU A;  1X6B A;  2RK1 A;  1MHN A;  3UA6 A;  2H3J A;  2DVE A;  1RAA B;  1KD1 U;  3X28 B;  1WX6 A;  5GAN j;  5IAY A;  2J6K A;  1YWP A;  1U5S A;  4RTT A;  1LCK A;  1C1A A;  1IZ6 A;  2V8J A;  3ZEH A;  2K4Y A;  1ZA2 B;  4ZGE B;  1WXT A;  2QDL A;  4M75 G;  4DEX A;  3JSC A;  1ZUY A;  3RUX A;  2EJG A;  1RUW A;  2RK2 A;  3DKM A;  4HCB A;  2D0Q B;  1LJO A;  1N9R A;  3E9G A;  3M9Q A;  2DF6 A;  1I07 A;  2DL8 A;  3NTI A;  1OX9 A;  2EYQ A;  3L2U A;  1VQ8 A;  4RTV A;  3R6N A;  4UC4 A;  2AIR B;  1PC0 A;  3EH2 A;  2DIG A;  1PWT A;  2FYK A;  2F1L A;  4J9E A;  3M0U A;  1W6X A;  4F7U B;  5GAO r;  2D8H A;  3OMC A;  1VQ7 Q;  4L5G A;  3I9Q A;  2C0T A;  4C8Q A;  3CC7 A;  1VQO T;  3JAM E;  2VV5 A;  3A5Z B;  1GL5 A;  4OGC A;  2RHI A;  2PZ1 A;  3OS2 A;  1RLP C;  2EWN A;  4DQ2 A;  3G4S T;  3KUF A;  2KEA A;  2DJZ A;  2LRQ A;  4X9C A;  1YFN A;  3L1A A;  4C0D C;  2L89 A;  3D7S B;  3V8L A;  3A1P A;  5HKC A;  3CC4 A;  2QQB A;  2KXC A;  2MAM A;  2OI3 A;  4M7A E;  2OTJ A;  4OML A;  1BCO A;  2NUP B;  2D9T A;  3THK A;  3OYJ A;  2A7Y A;  4Z89 A;  2P0K A;  1KC8 R;  3CCJ Q;  1UHC A;  4C8Q F;  1EZZ B;  3PMI A;  4J6X A;  2LX9 A;  4D8K A;  1U8R A;  1M90 U;  2FEI A;  5GAM j;  2ATC B;  2ZCF B;  2AK5 A;  3TQ7 P;  1YI2 Q;  1PSE A;  5IHK A;  1LOJ A;  1OU9 A;  2GFA A;  1H8K A;  1M1K R;  2DL7 A;  1FXX A;  3BE3 A;  4A4F A;  4LD6 A;  2F2V A;  4JS4 A;  4C8Q G;  2VYT A;  1TXQ A;  4DBR A;  4YTL A;  4A63 B;  5CKD A;  1WHJ A;  2ZAE A;  1R8O B;  2P4R A;  4FU6 A;  4GLK A;  3FRN A;  1WHG A;  4BAC A;  3CCV A;  1QW1 A;  2IIM A;  3GP8 A;  1QVP A;  3CCE T;  3RDV A;  3G6E T;  2VAS A;  4LNP A;  3C4S A;  3VRY A;  3CMA A;  4EIK A;  2YHT A;  1VQ8 T;  1SRM A;  2O31 A;  2FRY A;  2YUP A;  2QQR A;  4RCB A;  1WPY A;  4IUT A;  1UEB A;  4LXC A;  3L2R A;  2K3Y A;  1XTD A;  3U23 A;  2E5K A;  2R5M A;  4PJO D;  4JLG A;  2RI3 A;  2JXB A;  3JB9 I;  3CC7 T;  1G3S A;  3SWN C;  2KRM A;  2FPD A;  1WJR A;  4D8D A;  3QG1 A;  1MGQ A;  2HBW A;  3PGG A;  2DEU A;  2KXD A;  3GBQ A;  2OTL A;  4M7D E;  1UGS B;  1UGQ B;  4JJN K;  4MDW A;  4IUV A;  3QZ5 B;  5FLX E;  3M5A A;  3LYI A;  3NHN A;  3CCL Q;  3WVE B;  2JT4 A;  4KGZ B;  3RMS A;  9ATC B;  1Y0M A;  1K1Z A;  2OTJ T;  4E2F B;  3PFS A;  4N4I A;  2A36 A;  4C92 E;  4RTW A;  3V7C A;  1NLO C;  3CXC A;  3VU3 C;  4XK8 E;  1ZBX A;  5D7U A;  1D1A A;  4ZGD B;  5A0D A;  2QA4 A;  2LCC A;  3JRZ A;  2EJ9 A;  2XK0 A;  3MO8 A;  2JTE A;  2GNC A;  2JMC A;  2YWW A;  4PJO A;  1QLY A;  4J9D A;  3QWY A;  1N8R U;  2EQK A;  3S6W A;  4JPB W;  1MND A;  4J6W A;  1VQ9 A;  1D09 B;  2ZZD A;  3H0H A;  4HKE A;  1AWJ A;  5LJ3 f;  1TG0 A;  1M3A A;  1YJ9 Q;  1ZQ1 A;  1M2O A;  1YHQ T;  4LE9 A;  2CP6 A;  2E4H A;  2EW3 A;  3VKI A;  2EQJ A;  2FPF A;  4JJC A;  1BI0 A;  3CCR A;  1EX4 A;  3HFO A;  4IIO A;  3JCM h;  1PM3 A;  2LDM A;  3JB9 D;  3X25 B;  2QEX Q;  1IGQ A;  3M54 A;  1RAH B;  3MHX A;  2E1H A;  1X01 A;  4F14 A;  2DYI A;  4EMK B;  3REB B;  3CC2 Q;  1KHC A;  4PJO F;  2X3X D;  4KH0 B;  5DY9 A;  2AKL A;  2EPD A;  1ZA1 B;  4R55 A;  1NJI R;  2CH4 A;  3RMQ A;  1YWO A;  2VGN A;  1B34 B;  1YJN A;  3J7A F;  2CDT A;  4F17 A;  2DD5 A;  5J39 A;  2KNB B;  3NMZ C;  4BI3 A;  3I56 A;  8AT1 B;  2CGH A;  4E7J A;  3EHR A;  1SRL A;  2QAS A;  1H64 1;  3MEW A;  2C0I A;  4XAX B;  4PLL A;  1HYO A;  2HEQ A;  1M1G A;  3CC4 Q;  1T3S A;  4PJO G;  4FM4 B;  1SG5 A;  1B7T A;  2NWM A;  2QQ9 A;  5CKF A;  5AT1 B;  5C0M A;  5LJ3 e;  5L8R E;  2CS7 A;  2MK5 A;  2YT6 A;  5LJ5 h;  3BY7 A;  4OMP A;  2CRE A;  4VUB A;  2X51 A;  1VA7 A;  4IIM A;  1RAI B;  4BI8 B;  3WVD B;  1UTI A;  3VS4 A;  1V29 B;  2CZ7 B;  2M0Y A;  2OAW A;  2E3H A;  1VQM T;  1G2B A;  3JCM b;  2EFI A;  2E65 A;  2EQI A;  1M90 C;  2QA4 T;  3VS1 A;  2JZ2 A;  4J8O A;  3L2W A;  2EYX A;  2K2M A;  3TSW A;  1C0M A;  2YUO A;  2W0Z A;  4FT4 A;  4KT0 E;  3OS5 A;  4O6J A;  1WQ7 A;  4XU2 A;  3L2Z A;  3CCU Q;  1H3H A;  5GJV B;  2GTJ A;  5I11 A;  4BDZ A;  4FW1 A;  2V1R A;  3I55 T;  5D6W A;  4LDX A;  1WHK A;  1M8V A;  1WIE A;  5HY6 A;  1PD1 A;  3HRU A;  2COW A;  5LJ3 d;  2AHJ B;  3OYM A;  2VC8 A;  3KXT A;  4Q5W A;  3UT1 A;  4C0F A;  1JU5 C;  2GBQ A;  4XTW A;  2VVK A;  4BI4 A;  4F7U E;  1Y96 B;  4XU0 A;  4AG2 C;  2L8D A;  3OY9 A;  4XTV A;  1IXD A;  3F70 A;  3HTR A;  4X34 A;  4OGE A;  3OYC A;  1T3L A;  4M78 E;  3M57 A;  2FZK B;  4EMK A;  4B6M A;  3SWN B;  1OZ3 A;  4C5I A;  1RAD B;  2J6F A;  3I56 T;  3VS2 A;  2HNI A;  1G83 A;  3CBM A;  2M16 A;  4M77 G;  4E6R A;  3CPF A;  4HVV A;  1JJ2 A;  4DOW A;  2KAF A;  1Q82 U;  2A37 A;  3E1S A;  2GGR A;  2OJ2 A;  2ZPG B;  5M9O A;  2HDA A;  3G71 T;  1Q95 G;  1I5O B;  1SSH A;  5KYW B;  1K9A A;  2R57 A;  3M0S A;  1O9S A;  5KYU B;  3PVQ A;  4PK4 A;  5GAN 7;  1WXU A;  2YLB A;  5HK0 A;  5GAO p;  2QQS A;  5FW9 A;  3I5R A;  2CZ1 B;  3P8H A;  4J9F A;  1VQK A;  2FPE A;  2JVV A;  5GAN 5;  4M75 D;  3LH0 A;  2L3P A;  1U06 A;  2RHU A;  5KH6 A;  4RG2 A;  3VYH B;  1RI0 A;  3TRE A;  2HMA A;  1QVG A;  1VQ9 Q;  3EGD A;  2JW4 A;  1RI9 A;  3UA7 A;  1N8R C;  1QVF A;  2JS0 A;  2HKN A;  2VWF A;  2PNI A;  4K11 A;  1VQ4 Q;  2LTO A;  1FX7 A;  2BZX A;  3CCR Q;  2DFU A;  2X35 A;  4ZGJ B;  3A8H B;  1R0B G;  2BTT A;  1KQS P;  1G5V A;  1NE8 A;  2MYS A;  1S72 Q;  1AWX A;  1PSF A;  2LNV A;  3URG A;  2ED1 A;  1WGS A;  3A8G B;  1M4Z A;  3SB2 A;  3CME A;  4C8Q B;  1K8A R;  2V8K A;  4ME7 A;  2VXE A;  3PIO A;  3A98 A;  7AT1 B;  1EFN A;  4M7D D;  3CPW P;  2A28 A;  3ME9 A;  1AD5 A;  2XIC A;  1I4K 1;  1YJN Q;  1Q7Y U;  1WQW A;  4IUP A;  1WDX A;  4M7A F;  2PVO B;  4BE0 A;  1VQ7 T;  4DEY A;  1ZSG A;  3OYH A;  1GCQ C;  1N9S A;  4M75 A;  4MZP A;  3CCQ T;  2JM9 A;  3VJP A;  1B07 A;  1SHF A;  3TU4 K;  1TS9 A;  5L23 A;  2GF7 A;  1QKW A;  1TSF A;  2DTI A;  3OYY A;  2HQE A;  3QSU A;  2LT4 A;  2EYY A;  2PVG B;  4AT1 B;  4M7A G;  4KGX B;  5GAO m;  3T9N A;  2VB6 A;  2QXF A;  2EGA A;  2H8H A;  2PUK B;  2DVJ A;  3RES A;  1Y07 A;  2K5F A;  2CZ6 B;  1ZHI A;  2DXB A;  4Y91 A;  1YJW T;  2DPP B;  3JCM c;  2RHY A;  4R0K A;  3LGL A;  1KQS S;  4M75 F;  1Z9Z A;  3PMT A;  1VQ5 Q;  1J3T A;  2K7A A;  3CCJ T;  1Q81 R;  3LX7 A;  4M7D A;  3Q1J A;  5KYU A;  2RMO A;  4V2S A;  4FT2 A;  4JJD A;  1ZUU A;  2CSI A;  1YI2 T;  3CPW S;  2J05 A;  2L5Q A;  2ROT A;  1NYF A;  4LD9 K;  1QCF A;  1N5Z A;  1AOJ A;  5CAI A;  1HJD A;  2NUT A;  4BD3 A;  1YJ9 A;  4BDY A;  4KRT A;  3DLL A;  2IPO B;  3C12 A;  1I5L A;  3AT1 B;  3MP8 A;  2LJ1 A;  2RI2 A;  1Z9Q A;  4EMK C;  1NZ9 A;  4M7D F;  1ZSZ B;  4MMK A;  4MML A;  3P8B B;  4QQG A;  2QEX A;  1NM7 A;  2JTM A;  3CBO A;  4PJJ A;  1Y7X A;  3CC2 A;  4ESR A;  2K3X A;  4AMC A;  4QQD A;  2X4W A;  1UJ0 A;  3OSS C;  1UUE A;  3DLM A;  4QVD A;  1W2B A;  1QWE A;  4DBQ A;  2DAQ A;  2P0P A;  5KCH A;  4P5N A;  4M7D G;  2DE0 X;  3VV0 A;  2MI6 A;  3GLX A;  4JDS A;  5GAN 4;  5FWC A;  1VIF A;  5GAN g;  4OMN A;  3VYG A;  3OBW A;  1PNJ A;  1AT1 B;  1IRX A;  2KRO A;  4KH1 B;  4FSS A;  2P4T A;  1UGP B;  3ZBD A;  2EVR A;  1Q82 C;  2NYS A;  3EGX A;  1U3O A;  1MUZ A;  1XJW B;  1M30 A;  2DXT A;  3M0P A;  1TU0 B;  1X69 A;  3CCL T;  1VQK Q;  4PNO A;  2HBP A;  3S3O A;  2WSF E;  5FU7 B;  1WZO A;  4PJO B;  4XTX A;  1Q86 R;  3S3N A;  4L6V 5;  2K5L A;  3NGP A;  3UWN A;  2O01 E;  3FJ5 A;  4HVW A;  2KT1 A;  2K5I A;  3SHW A;  2DO3 A;  2E5Q A;  2DKG A;  2YLC A;  2BZ8 A;  2DBM A;  4HXJ A;  2EKH A;  4JJB A;  3EAE A;  2RJC A;  3FLG A;  2I2L A;  1GRI A;  1VQ6 Q;  1PHT A;  2ZPB B;  2QDY B;  4Z8A A;  1RL2 A;  1SF9 A;  3MPU B;  3OMG A;  3CEY A;  1WNL A;  1KQ2 A;  3JCM X;  2F69 A;  3CD6 Q;  3VS5 A;  5LJ3 h;  5GMK e;  1LPL A;  3CCU A;  3E9F A;  4BUG A;  4E7L A;  3JB9 J;  4M78 D;  3EFR A;  3EH1 A;  1WHL A;  2RQT A;  3CBP A;  4QKU A;  3CME Q;  2O88 A;  2DM1 A;  3RKY A;  4MZM A;  4PFO A;  1BIB A;  5I2S A;  4A53 A;  4M75 C;  3EG1 A;  1K9M R;  1Y71 A;  4A4G A;  1QMC A;  1AVZ C;  4OF1 A;  4EMG A;  4HCC A;  3JV3 A;  1W2B P;  3RKW A;  2QQA A;  4O5V A;  2IVW A;  1Q7Y C;  1ZSZ A;  3CC2 T;  2FG0 A;  3QKJ A;  4CC2 A;  3QHS A;  5EC7 A;  2HAX A;  4Y28 E;  1VOM A;  3QPH A;  1S1N A;  4A4K A;  1X43 A;  5GMK l;  1GFC A;  4QVC A;  4ATO A;  5GAM g;  2G6F X;  2CP5 A;  3HKS A;  2XG8 D;  5I2M A;  3LH5 A;  1BYM A;  1X6G A;  3CC4 T;  3HP9 A;  1VUB A;  3PNW C;  3M4G A;  3X24 B;  3M56 A;  4J5Y A;  4NS5 A;  3MEU A;  4M78 A;  3OS1 A;  1ZX6 A;  4FYX B;  4C5H A;  1M3B A;  3QJY A;  3RR6 A;  2O9V A;  4FL6 A;  1WJS A;  1OUL A;  2M1H A;  1K73 R;  2LMJ A;  4OB3 B;  2DZC A;  3MP1 A;  1M5Q 1;  2X4J A;  1GCP A;  2FZC B;  1UG1 A;  5FRM A;  3EG9 A;  1TOV A;  3EGU A;  2E3I A;  2JOY A;  5IHI A;  5IXB A;  3OYA A;  3OB9 A;  2EYW A;  2E41 A;  2J06 A;  1IB8 A;  3LWI A;  1W2B S;  2MWP A;  5GJW B;  1QQJ A;  4FW2 A;  1KQ1 A;  4B9X A;  2RQU A;  2K6D A;  2NLU A;  2YUN A;  2HQX A;  2FHD A;  1FMK A;  4RTY A;  1VQ4 A;  3VS0 A;  1PG5 B;  2DK3 A;  4M78 F;  2CP7 A;  4OP0 A;  3CCV T;  3CCU T;  1GXI E;  1WXB A;  2RJE A;  2HSE B;  2LNH B;  2L3S A;  4WCI A;  4C8Q C;  1M3C A;  4ANJ A;  5KYY B;  3VS3 A;  1S72 A;  2MF2 A;  3CMA T;  4L59 A;  2FB7 A;  1BK2 A;  3V8J A;  2X4Y A;  5LJ3 j;  3OW2 A;  2KMT A;  1BI2 A;  1KSW A;  2MMP A;  4LDV A;  1YIJ Q;  4M77 D;  4C5G A;  3OSV A;  3BFM A;  4M78 G;  4HT8 A;  4FYV B;  3CCS Q;  1BI3 A;  2D6F A;  1A0N B;  4C0G A;  1VQL Q;  1U1S A;  1KG1 A;  2K57 A;  4E7H A;  1G3W A;  2CP2 A;  4TVR A;  4A4E A;  4J9H A;  3M53 A;  2CSQ A;  1CSK A;  5GAN 8;  3JCM P;  1WLP B;  4IUU A;  2OTL T;  3OYE A;  2QTV A;  4LUE A;  2FZG B;  1M1F A;  4MDX A;  1C6V X;  4DBF A;  4LDU A;  2CKK A;  4XU1 A;  1VYU A;  2ZPE B;  1X2Q A;  2ESW A;  2V26 A;  2DL4 A;  2KT8 A;  3CXC P;  1R0C B;  4DA4 A;  4PFP A;  1N27 A;  4ELY C;  3EGD B;  1W4S A;  3QWX X;  4M7A B;  2X9H A;  1OV3 A;  1VQ5 A;  2RB6 A;  4M77 A;  5IH2 A;  1XNI A;  4PKC C;  2KY9 A;  3HL8 A;  5IHN A;  2O4X B;  4JZ4 A;  5D6Y A;  2XDB A;  1UEC A;  4GLM A;  2DIL A;  3OYI A;  1BB9 A;  1TUG B;  5CK9 A;  1V1C A;  2RO0 A;  1VQ9 T;  3QYH B;  2IG0 A;  1CKB A;  4LN2 A;  3L2Q A;  1G8X A;  2RJF A;  2SEM A;  3EFO A;  3M0Q A;  2DNU A;  1BI1 A;  4F04 B;  4JS5 A;  3KFV A;  3NTK A;  1YHQ Q;  1KFZ A;  2XID A;  3TVT A;  3CCR T;  2LJ0 A;  1YIT Q;  4HCK A;  1QCO A;  1OPL A;  1UHF A;  1NJI U;  3ER0 A;  1I1J A;  1ZSZ C;  1S72 T;  4D6W A;  4R56 A;  3EG3 A;  3ULR B;  4M75 B;  4M77 F;  2PUO B;  5KYY A;  5CKE A;  2MOX A;  2NUZ A;  3CXC S;  3PTA A;  2L3R A;  5CQX A;  4OB0 B;  1QCN A;  3RBB B;  2EGE A;  4M7A D;  1F1B B;  1HD3 A;  1YJN T;  5FU6 B;  2HL3 A;  2JNG A;  3GOX A;  2DET A;  4AFS C;  1FWZ A;  4BE2 A;  4OMQ A;  3H0F A;  2A08 A;  2B86 A;  2DRK A;  1BU1 A;  1T0H A;  2OAU A;  4LUD A;  3SEM A;  2SRC A;  3OYK A;  3MET A;  4GBQ A;  2XDP A;  4ZTF A;  2RHZ A;  5KYX B;  2J7I A;  2GQV A;  5HCK A;  2EQU A;  1KC8 C;  5DLQ E;  3V8K A;  4BY6 C;  1X75 C;  4ELZ C;  2JM8 A;  4M7D B;  2F2X A;  5FU7 C;  5ECA A;  3H0I A;  4PJO C;  3M0T A;  4RTX A;  2Y4X A;  1MMA A;  3ASK A;  5CR2 A;  2FVU A;  1BBZ A;  1M1K C;  3MCA B;  2O2O A;  1W70 A;  2RH2 A;  3GNF B;  1YCS B;  3OW2 S;  2DEQ A;  2KYB A;  5A2Q E;  2GTO A;  1VQ5 T;  1IHW A;  3QZ9 B;  1MV3 A;  2NUT B;  2COZ A;  1AEY A;  5CVI A;  4M7A A;  2KQW A;  3JCM V;  2ABL A;  1VQP Q;  2JUF A;  2R5A A;  2XKO C;  1VQ6 A;  2HD0 A;  2O4X A;  3JCM g;  2K79 A;  3UDC A;  2KVQ G;  5A0G A;  2K3B A;  3CD6 A;  2Z0W A;  3M55 A;  3UF4 A;  4DBH A;  3MKD A;  1KD1 R;  1HXD A;  5IT9 E;  5GMK i;  2KDS A;  3QDF A;  1UGR B;  3M0R A;  1M9S A;  2F5T X;  4AFQ C;  2Y90 A;  3LGF A;  1OOT A;  3A8M B;  1ZUK A;  2VUB A;  3LLR A;  2CT3 A;  3HRT A;  3J81 E;  1PKT A;  1M8M A;  4RTU A;  1TTH B;  3JCM W;  3CCM Q;  4C92 D;  3JCM d;  4XTZ A;  1K76 A;  2DZ9 A;  1JO8 A;  1JJ2 P;  5GMK h;  1LVK A;  3OQ5 A;  5LJ5 g;  3EGX B;  3E19 A;  2KRN A;  1V76 A;  1NPR A;  1YBY A;  2DBK A;  1WA7 A;  3KBG A;  4DOV A;  4OMO A;  1VIE A;  4LDY A;  4N4H A;  1RAE B;  2M51 A;  2K2V A;  4XTY A;  3FEO A;  5KYX A;  4E7Z A;  4M77 C;  1N6A A;  2X3W D;  1K4U S;  1TH7 A;  1AHJ B;  4JLI A;  3OYB A;  3IQL A;  4IUQ A;  2JS2 A;  3QYG B;  4QW2 A;  2OX7 A;  2LCS A;  5GAN f;  1QVG P;  4B9W A;  3INZ A;  1VQK T;  2QI2 A;  4NL2 A;  4AFU C;  4NL3 A;  4F16 A;  3PT9 A;  2HCK A;  1NEB A;  3QDR B;  3JCM J;  1QVF P;  2ROL A;  3S3M A;  2LVM A;  4ZNX A;  4J7F A;  5LJ5 d;  1MNE A;  1PRM C;  3OS0 A;  2KR3 A;  2LC4 A;  4BB7 A;  1AZE A;  1D3B A;  4CC4 B;  1NPP A;  4C92 A;  2G3R A;  2LX7 A;  1VQ6 T;  2QTX A;  5GAO n;  1K8A U;  5EG2 A;  4Z88 A;  1QWF A;  5KYN A;  5GAN 2;  1KK7 A;  2AZS A;  3CD6 T;  5AYF A;  4FCY A;  3VS7 A;  1M90 R;  4OMM A;  1JJ2 S;  3OYD A;  2BIV A;  2LJ3 A;  2XMF A;  1JB0 E;  2XI9 A;  3UPU A;  4ZN1 A;  2PVD B;  2LT1 A;  1UJY A;  2CH4 W;  5A0L A;  2LCL A;  5LL6 S;  3CME T;  1NJI C;  1MMD A;  3C95 A;  2EGC A;  5KE3 A;  2GQI A;  3CCE A;  3G6E A;  3M58 A;  2KI7 A;  2FRW A;  4CI0 C;  1W1F A;  1BKB A;  3SFM A;  1YIJ A;  4A4H A;  2DL3 A;  2KE9 A;  2D1X A;  2M0O A;  1D0Y A;  3RER A;  4PJM A;  1AWO A;  2DXU A;  1VYT A;  3CCS A;  1VQN Q;  4C92 F;  3QJ6 A;  5GAN e;  4E7S A;  3ZFJ A;  2I0N A;  1VQL A;  3OYF A;  2HL5 C;  1QVG S;  3MJX A;  5HK3 A;  3CCQ Q;  1ZBJ A;  3MP6 A;  4XTU A;  2DTH A;  4M78 B;  1QVF S;  2AZV A;  2CYZ B;  4II1 A;  2HSP A;  4FYY B;  1MMN A;  2F5K A;  4WTO B;  5FWB A;  2LQK A;  1QP2 A;  3WXM B;  5GAN 3;  1B3Q A;  3OYG A;  1Q81 U;  4C92 G;  1WFW A;  4GY5 A;  3C94 A;  4BY6 B;  3LW5 E;  5GMK j;  2KSS A;  5DM7 R;  2XU8 A;  2RM4 A;  5GAM f;  3EG9 B;  4M7A C;  3GIB A;  1JRI A;  1RLQ C;  4PLI A;  1YJW Q;  1G3T A;  2HKQ B;  3QUI A;  1SEM A;  3X26 B;  1GFD A;  4J7I A;  2CZ0 B;  5GAN d;  3GF5 A;  5I21 A;  3EG0 A;  1I81 A;  3L2V A;  1I8F A;  3PE0 A;  3QII A;  3LWH A;  4XQ3 A;  1KIK A;  3M4Y A;  1YJ9 T;  2RN8 A;  2PU9 B;  3CQT A;  1OX8 A;  1CKA A;  2D8J A;  1K0S A;  1YHQ A;  3HHT B;  1YIT A;  1IGU A;  1N8R R;  4M75 E;  4N0A A;  4KUD K;  4JRQ A;  1YCY A;  2QEX T;  1O75 A;  4M4Z A;  5FRN A;  5DLO A;  4E7K A;  3BW1 A;  2RA2 A;  5FU6 C;  1GBQ A;  2ZGW A;  2DL5 A;  5GAM e;  5KE2 A;  1YIJ T;  1K0X A;  2ZPH B;  3V7R A;  4KGV B;  1D0X A;  1D0Z A;  1G3Y A;  4IUR A;  1VQO Q;  3CCS T;  2A3L A;  1JEG A;  2VKN A;  4CRI A;  3DB4 A;  2P0Q A;  3PIP A;  1VQL T;  2V8I A;  4FYW B;  2EJF A;  2EIF A;  1WHH A;  5C6S A;  1JXO A;  3G4S Q;  4AG1 C;  4F7U A;  1KC8 U;  3P8D A;  1X2K A;  3HPW A;  1UE9 A;  1PD0 A;  2E6N A;  6AT1 B;  3QO3 A;  1Q86 U;  4OVA A;  1VYV A;  4M7D C;  1OZ2 A;  4J6Y A;  3RIR A;  1UFF A;  1RAC B;  2DJQ A;  3G7Z A;  5CCA A;  4M77 B;  4JZ3 A;  1M1K U;  5KCO A;  3QBY A;  2ED0 A;  1KHI A;  2KRS A;  2WSE E;  3R6O A;  4C92 C;  4IKF A;  4J9I A;  1UGV A;  3EFO B;  1MV0 B;  5GAM d;  1NYG A;  2QYZ A;  1M2V B;  3TCJ A;  2BE7 D;  8ATC B;  1VQM A;  2K9G A;  3OA6 A;  1HSQ A;  4F7U F;  2NUP A;  2QGG A;  1OI1 A;  1FYN A;  3OBY A;  4QQ6 A;  2QG9 B;  4RUG A;  2FL7 A;  5CQY A;  1VQP A;  3V7S A;  3SDZ A;  4N4G A;  4A54 A;  4J9G A;  1TUC A;  2AT1 B;  2DLP A;  4X1V A;  3OYL A;  1K9M U;  1OQK A;  1K8A C;  1KD1 C;  2RJD A;  2CUB A;  5D6X A;  2GFU A;  1PRL C;  3H8Z A;  2AKK A;  1H92 A;  5CKB A;  4HA8 A;  4C8Q E;  4F7U G;  3I55 A;  3CCE Q;  2DX1 A;  3G6E Q;  1YIT T;  3BDL A;  1WHM A;  4FSX A;  4Y92 A;  2LQN A;  3FJP A;  2ENM A;  3H6Z A;  2B8A A;  3VUZ A;  2M9U A;  1OU8 A;  2E64 A;  2LP5 A;  1BCM A;  1SKU B;  1VQ8 Q;  2DER A;  2GCX A;  3JB9 H;  1TWB A;  4EDU A;  3UAT A;  3DB3 A;  2MWO A;  1XQH A;  2RPN A;  1UB4 A;  1BIA A;  3A8L B;  3NTH A;  2XDD A;  3CC7 Q;  4X9D A;  2E70 A;  2QAZ A;  3GNG A;  1RAB B;  3CCM A;  5GAO l;  4RCC A;  2DYB A;  1YP5 A;  2LZ6 B;  1OPK A;  2LQW A;  3SD4 A;  1I0C A;  5CKH A;  1NBE B;  2A0F B;  2ECZ A;  2EYZ A;  1IRE B;  3EG2 A;  1K73 U;  4JRI A;  4FIB A;  1ARK A;  2KYM A;  2L3Q A;  1Q81 C;  1GCQ A;  2CUD A;  3HRS A;  2JN0 A;  4C0D B;  2BUD A;  1M27 C;  2OTJ Q;  3G71 A;  4MZT A;  4NOY A;  2C0O A;  2COY A;  3VRZ A;  5FRO A;  3AHU A;  2JJ9 A;  1X6O A;  3TSZ A;  1SPK A;  5LJ3 g;  1Q82 R;  1OEB A;  1E6G A;  1LNX A;  1H3Z A;  2EKO A;  2O9S A;  3MEV A;  1R77 A;  3I5S A;  1SSF A;  3J80 E;  4OB1 B;  2MCN A;  4JRP A;  4BE1 A;  1M2V A;  2DXC A;  4CC7 A;  2CP0 A;  2FO0 A;  1VQP T;  1VQ4 T;  2RHX A;  4N0A C;  3RNJ A;  3HSB A;  1ABQ A;  5IXF A;  2ZPF B;  5IN1 A;  1QP3 A;  3OW2 P;  4EMH A;  5CIU A;  4ZN3 A;  3CCV Q;  4EPC A;  3E2U A;  2E6Z A;  1P92 A;  1KJW A;  2PQW A;  1FMV A;  2JMA A;  3PVL A;  3I35 A;  2KBT A;  3JCM f;  3CMA Q;  2EQM A;  2HQH A;  1YN8 A;  1X27 A;  1KQS A;  1HK9 A;  3JB9 F;  2RNA A;  2XHC A;  1WJQ A;  1AZG B;  1FMW A;  1MMG A;  2QK0 A;  1E7O A;  2MPX C;  2ZPI B;  2DMO A;  1VQN A;  3A8O B;  1GBR A;  4LDW A;  4J9C A;  1ABO A;  4M78 C;  1YNZ A;  1VQ7 A;  3FDR A;  1JQQ A;  4HT9 A;  3NFC A;  3CCM T;  3CPW A;  3CCQ A;  3RKX A;  2YSQ A;  3REA B;  2RQV A;  3JB9 G;  2OTL Q;  2DIQ A;  2E10 A;  2V1Q A;  1Q7Y R;  1Q86 C;  4C5E A;  1B34 A;  3O5Z A; 
#chains in the Genus database with same CATH homology
 2HCK A;  1NEB A;  2ROL A;  2AKL A;  2EPD A;  3H41 A;  4ZNX A;  2RQT A;  2CH4 A;  2EBP A;  1YWO A;  1E6H A;  1NLP C;  2O88 A;  1PRM C;  2DM1 A;  2KR3 A;  2CDT A;  4F17 A;  1AZE A;  4ORZ A;  2F2W A;  4CC4 B;  2KNB B;  3NMZ C;  3EG1 A;  3EHQ A;  3EHR A;  1SRL A;  2LX7 A;  1AVZ C;  4Z88 A;  2C0I A;  2BZY A;  1QWF A;  4RTZ A;  3JV3 A;  2HEQ A;  5I22 A;  1NG2 A;  2DRM A;  2PTK A;  1T3S A;  2AZS A;  2NWM A;  3VS7 A;  4OMM A;  2FG0 A;  4CC2 A;  2LJ3 A;  2XMF A;  5EC7 A;  1UJY A;  2CH4 W;  1S1N A;  2YT6 A;  4OMP A;  1IO6 A;  2CRE A;  1X43 A;  2EGC A;  2KGT A;  2L2P A;  2RQW A;  2RQR A;  1GFC A;  2GQI A;  2G6F X;  1VA7 A;  1ZLM A;  2FRW A;  4IIM A;  1W1F A;  3LH5 A;  2D0N A;  2L0A A;  3VS4 A;  1XOV A;  2J6O A;  2DL3 A;  2KE9 A;  2D1X A;  2M0Y A;  2OAW A;  1X6G A;  1AWO A;  1G2B A;  1VYT A;  2MIO A;  2I0N A;  2EQI A;  3VS1 A;  2X3X D;  1ZX6 A;  1M3B A;  2EYX A;  1ZBJ A;  2K2M A;  1JXM A;  3TSW A;  2YUO A;  2AZV A;  2HSP A;  2O9V A;  2CT4 A;  2W0Z A;  2YDL A;  5FWB A;  1H3H A;  2LMJ A;  5GJV B;  2GTJ A;  3C0C A;  5I11 A;  2V1R A;  1GCP A;  1B3Q A;  4QT7 A;  1WFW A;  1UG1 A;  1WIE A;  3EGU A;  5IHI A;  5IXB A;  2EYW A;  2J06 A;  1Y57 A;  1SHG A;  2RF0 A;  4J9B A;  5GJW B;  1AWW A;  2RQU A;  2K6D A;  4CC3 A;  1JU5 C;  2YUN A;  2GBQ A;  1FMK A;  3NPF A;  1RLQ C;  4RTY A;  2VVK A;  3VS6 A;  3VS0 A;  3ZL7 C;  1NEG A;  4AG2 C;  1T0J A;  2DA9 A;  1SEM A;  1WXB A;  2LNH B;  2YUQ A;  2L3S A;  4WCI A;  1T3L A;  1GFD A;  1M3C A;  1WYX A;  3VS3 A;  1UDL A;  3EG0 A;  1QKX A;  1PKS A;  4AFZ C;  1BK2 A;  1WI7 A;  1TUD A;  2J6F A;  1KSW A;  3PE0 A;  3VS2 A;  1KIK A;  2RN8 A;  1G83 A;  3CQT A;  4E6R A;  2W10 A;  4HVV A;  1CKA A;  2D8J A;  1K0S A;  1A0N B;  2A37 A;  2GGR A;  2OJ2 A;  4HVU A;  1X6B A;  2HDA A;  3UA6 A;  1SSH A;  4J9H A;  1K9A A;  1WX6 A;  3M0S A;  2CSQ A;  1CSK A;  2J6K A;  1WLP B;  1YWP A;  3PVQ A;  4M4Z A;  1WXU A;  1U5S A;  4RTT A;  5FW9 A;  1LCK A;  3I5R A;  1GBQ A;  4LUE A;  2DL5 A;  4J9F A;  2FPE A;  1K0X A;  1WXT A;  2QDL A;  1VYU A;  2L3P A;  1U06 A;  1X2Q A;  2ESW A;  4DEX A;  1ZUY A;  2DL4 A;  2KT8 A;  1RUW A;  1JEG A;  2VKN A;  2DF6 A;  1I07 A;  2DL8 A;  2JW4 A;  1RI9 A;  3UA7 A;  1JXO A;  2JS0 A;  4RTV A;  4AG1 C;  2VWF A;  3R6N A;  1X2K A;  2PNI A;  4K11 A;  1UE9 A;  3QWX X;  1PWT A;  4J9E A;  3M0U A;  1W6X A;  1OV3 A;  1VYV A;  2BZX A;  2D8H A;  5IH2 A;  5IHN A;  3I9Q A;  1UFF A;  2BTT A;  2C0T A;  2DJQ A;  4JZ4 A;  1UEC A;  4GLM A;  1AWX A;  2DIL A;  4JZ3 A;  1BB9 A;  2ED1 A;  3O5Z A;  1V1C A;  2ED0 A;  2KRS A;  1CKB A;  4LN2 A;  1GL5 A;  2PZ1 A;  3A98 A;  2SEM A;  3M0Q A;  1EFN A;  1RLP C;  4J9I A;  2DNU A;  2KEA A;  2A28 A;  1AD5 A;  1UGV A;  1MV0 B;  1NYG A;  3KFV A;  1KFZ A;  1WDX A;  3TVT A;  2LJ0 A;  4HCK A;  2K9G A;  4DEY A;  1ZSG A;  1HSQ A;  1GCQ C;  1OPL A;  1UHF A;  2KXC A;  1I1J A;  1FYN A;  2OI3 A;  4RUG A;  2JM9 A;  4OML A;  3EG3 A;  3ULR B;  3THK A;  4J9G A;  1B07 A;  1SHF A;  4Z89 A;  1TUC A;  2DLP A;  4X1V A;  5L23 A;  1QKW A;  1UHC A;  2MOX A;  2NUZ A;  2CUB A;  3RBB B;  2EGE A;  2EYY A;  1PRL C;  4D8K A;  1HD3 A;  2AKK A;  1H92 A;  2FEI A;  4AFS C;  2DX1 A;  2AK5 A;  2EGA A;  4OMQ A;  5IHK A;  4Y92 A;  3H0F A;  2LQN A;  2H8H A;  2A08 A;  2B86 A;  2ENM A;  2DVJ A;  2DRK A;  1H8K A;  1BU1 A;  1T0H A;  2LP5 A;  4LUD A;  3SEM A;  2SRC A;  2DL7 A;  4GBQ A;  3UAT A;  4R0K A;  2RPN A;  2F2V A;  2J7I A;  1Z9Z A;  4A63 B;  5HCK A;  1J3T A;  2K7A A;  2P4R A;  2RMO A;  2IIM A;  2JM8 A;  2F2X A;  5ECA A;  3H0I A;  3M0T A;  4RTX A;  4JJD A;  1ZUU A;  2CSI A;  2DYB A;  1YP5 A;  2LZ6 B;  4LNP A;  3VRY A;  1OPK A;  2J05 A;  2ROT A;  1NYF A;  2LQW A;  4EIK A;  1BBZ A;  1I0C A;  1QCF A;  1SRM A;  2O31 A;  2FRY A;  1N5Z A;  2YUP A;  2O2O A;  1AOJ A;  1W70 A;  2ECZ A;  1YCS B;  1HJD A;  2EYZ A;  3EG2 A;  2KYB A;  2GTO A;  4KRT A;  1ARK A;  3U23 A;  2KYM A;  2E5K A;  2L3Q A;  1MV3 A;  1AEY A;  1GCQ A;  2CUD A;  2JXB A;  1M27 C;  2ABL A;  2KRM A;  2FPD A;  2LJ1 A;  4D8D A;  1Z9Q A;  2C0O A;  2K79 A;  3VRZ A;  2HBW A;  1NM7 A;  2K3B A;  2KXD A;  3GBQ A;  3TSZ A;  1SPK A;  3UF4 A;  1OEB A;  1E6G A;  4ESR A;  1UJ0 A;  1UUE A;  2O9S A;  1QWE A;  3NHN A;  3I5S A;  2JT4 A;  2MCN A;  1Y0M A;  1K1Z A;  4CC7 A;  2FO0 A;  2DE0 X;  3M0R A;  2A36 A;  4AFQ C;  5FWC A;  4RTW A;  3RNJ A;  1NLO C;  1OOT A;  4OMN A;  1ABQ A;  5IXF A;  1PNJ A;  1ZUK A;  2KRO A;  4FSS A;  2CT3 A;  2EVR A;  1PKT A;  1M8M A;  4RTU A;  1U3O A;  2JTE A;  2GNC A;  1KJW A;  1MUZ A;  1M30 A;  2JMC A;  1K76 A;  2JMA A;  1JO8 A;  1QLY A;  3M0P A;  3I35 A;  3PVL A;  2KBT A;  1X69 A;  3QWY A;  4J9D A;  4JPB W;  2KRN A;  1YN8 A;  3H0H A;  2DBK A;  3NGP A;  1WA7 A;  1X27 A;  1AWJ A;  1TG0 A;  1M3A A;  2RNA A;  4OMO A;  3FJ5 A;  4HVW A;  2KT1 A;  4LE9 A;  2M51 A;  1AZG B;  3SHW A;  2EW3 A;  1E7O A;  2DMO A;  2BZ8 A;  1GBR A;  2DBM A;  4HXJ A;  2FPF A;  2EKH A;  4J9C A;  1ABO A;  4JJB A;  4JJC A;  1YNZ A;  2X3W D;  1K4U S;  1JQQ A;  1GRI A;  3IQL A;  1PHT A;  4IIO A;  2JS2 A;  4Z8A A;  2YSQ A;  3REA B;  2LCS A;  2RQV A;  3VS5 A;  2V1Q A;  4F14 A;  4AFU C;  3REB B;  4F16 A;  1UTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...