1IO6A

Growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution Structure of the C-Terminal SH3 Domain of Grb2 Complexed with a Ligand Peptide: A Ligand Exchange Model of the SH3 Domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1io6A00
3TVTA 2HEQA 1YWOA 5ECAA 3VS3A 4RTYA 3M0RA 2JMAA 2FPFA 4ZNXA 3M0PA 4CC3A 4J9EA 1WXBA 1KSWA 1VYTA 2DJQA 1N5ZA 4RTUA 3EHQA 1NG2A 1V1CA 1IO6A 4OMQA 2EKHA 2F2VA 2V1RA 2D1XA 1BU1A 1ZUUA 2CREA 1Z9QA 2LZ6B 1T0HA 3EGUA 1J3TA 2NUZA 2G6FX 4J9FA 1JXMA 2PNIA 2J7IA 2ED0A 4HVVA 4AFZC 3VS0A 2DBKA 4RTVA 2EGAA 1WIEA 1YNZA 1TG0A 2YUOA 4Z8AA 3M0TA 4AFSC 4OMOA 2YT6A 2GGRA 1T3SA 1WXTA 1JU5C 1M3BA 1PKSA 4J9BA 5HCKA 2GTJA 2JS2A 1WX6A 4GLMA 2YUQA 1H3HA 1ZLMA 3VS2A 2LQWA 4F17A 2RQRA 1NLPC 1WA7A 2RF0A 2LJ3A 1T0JA 2DRKA 2I0NA 1AWXA 2D8JA 2MIOA 5L23A 2KRNA 2BZYA 2GQIA 2KNBB 1E6HA 1UDLA 2K3BA 3H0FA 1M3CA 1B07A 3VS5A 4ORZA 3VS1A 3A98A 4J9HA 3VS6A 2YSQA 2H8HA 3GBQA 1MV0B 1ZX6A 2DLPA 2OJ2A 2ECZA 1YN8A 4FSSA 3C0CA 4KRTA 2O9SA 1SHFA 3NGPA 5GJVB 1JEGA 4RTTA 2NWMA 1ZBJA 2K7AA 4HXJA 1I07A 2KYMA 4JZ3A 1X2QA 2KGTA 2RMOA 1E6GA 4QT7A 2L2PA 4OMMA 3I5SA 4AFQC 4LE9A 2EQIA 2ED1A 1K0XA 1NEGA 2K79A 2A08A 2DL5A 1X69A 2E5KA 1QLYA 2GTOA 1CKBA 2EW3A 3UA7A 2JM9A 2DM1A 1RUWA 1T3LA 2FEIA 1M3AA 1HD3A 1QKXA 3KFVA 1SRMA 2PTKA 3EG1A 3RBBB 2VKNA 2L3QA 1H92A 4LUEA 2XMFA 1W1FA 1WI7A 1X43A 1ZUKA 4HCKA 4J9GA 1Z9ZA 1W6XA 2BZXA 3EG0A 1H8KA 2KRMA 1X2KA 3RNJA 2A36A 5FWCA 2LNHB 3R6NA 2CDTA 4D8KA 1SPKA 2K2MA 1K0SA 2D0NA 1JQQA 1GCQA 2DILA 2DYBA 4IIOA 2DX1A 1WXUA 2OI3A 3REAB 1ARKA 2KXDA 3I9QA 1FYNA 3VS7A 2KR3A 2HDAA 1NEBA 1AVZC 2HSPA 1UG1A 2EYZA 4F16A 1PHTA 2DF6A 2YUPA 3UA6A 2EGEA 2RQUA 1YP5A 2L3PA 4J9IA 2FG0A 5FW9A 1QKWA 2FPDA 2X3XD 2V1QA 1Y0MA 1BB9A 5IH2A 1NLOC 4AFUC 2J06A 1PKTA 2RPNA 2CT3A 2JW4A 2KROA 1PRMC 2YDLA 4OMLA 2ROTA 1GRIA 1A0NB 1AEYA 3UF4A 1RLQC 4JZ4A 2AK5A 1UFFA 4JJDA 2JT4A 2KXCA 1OV3A 2KT8A 3EHRA 4CC7A 5EC7A 1W70A 1CKAA 2L0AA 1QWEA 1YWPA 4RUGA 2FRYA 4A63B 1QWFA 2J6FA 3UATA 1GBRA 1B3QA 2LJ1A 1AWOA 1OEBA 3QWXX 2RQTA 1JO8A 4R0KA 1QCFA 4M4ZA 2M51A 3PVLA 1GFCA 1UTIA 4WCIA 4J9CA 3U23A 1M30A 2J05A 1BBZA 4HVUA 2CUBA 4JJCA 4GBQA 1G83A 4J9DA 2KBTA 4RTXA 3PVQA 2J6KA 3SHWA 2X3WD 3H0HA 3NHNA 1NYFA 1AOJA 2CUDA 1E7OA 1WYXA 3QWYA 1UJYA 4RTZA 4DEYA 2P4RA 3M0SA 1MUZA 1UECA 1AD5A 2DBMA 2L3SA 2AZSA 2AZVA 3JV3A 3NPFA 1M27C 4D8DA 2SEMA 1AZGB 3O5ZA 2EVRA 2ROLA 5IHNA 1U06A 2O9VA 5I11A 2KT1A 2ESWA 2DNUA 4LNPA 2F2WA 1AWJA 3TSZA 5GJWB 2PZ1A 2B86A 2DL4A 1WFWA 3CQTA 1JXOA 2CH4W 1S1NA 1WLPB 2DL7A 2LQNA 4EIKA 4E6RA 1CSKA 4AG2C 2OAWA 2BZ8A 2JTEA 1UE9A 4Y92A 2KYBA 5FWBA 2DL8A 1GCQC 2EYXA 2KEAA 4AG1C 5IXFA 5IXBA 2CH4A 2C0OA 2A28A 2W10A 2GNCA 4Z88A 3H41A 3PE0A 2JXBA 2LCSA 3SEMA 3THKA 1I1JA 2RN8A 1X27A 2JM8A 2RQVA 1M8MA 5IHIA 1PRLC 1PWTA 1PNJA 3M0UA 1X6GA 2RNAA 3NMZC 2LJ0A 5I22A 1MV3A 1ABOA 1FMKA 1KIKA 2MCNA 2KE9A 4Z89A 2M0YA 1LCKA 2VWFA 3VRYA 1UHCA 1UUEA 3I35A 3EG3A 4JJBA 1HSQA 2RQWA 2CSQA 2ENMA 2FRWA 2DA9A 4CC4B 2O31A 1X6BA 3M0QA 1K76A 3VRZA 1Y57A 2D8HA 2BTTA 1WDXA 2J6OA 2C0IA 2VVKA 2JS0A 2O2OA 4OMNA 1OPKA 2HBWA 2FO0A 1OOTA 2DMOA 4X1VA 2ABLA 1ABQA 2O88A 2EGCA 2LMJA 4LN2A 3LH5A 2DL3A 3H0IA 2LX7A 2EYWA 1VYVA 1RLPC 1VYUA 2K9GA 1SRLA 1KFZA 2FPEA 5IHKA 1XOVA 2KRSA 2HCKA 1K9AA 1NYGA 2CSIA 1SEMA 3I5RA 2QDLA 2YUNA 1UHFA 3TSWA 2C0TA 2EYYA 2DVJA 2MOXA 2DE0X 1SHGA 1TUCA 1UJ0A 1GL5A 1SSHA 2EBPA 1U5SA 1ZUYA 2IIMA 4K11A 1UGVA 2F2XA 3EG2A 2EPDA 4ESRA 2DRMA 2K6DA 1K1ZA 1YCSB 1EFNA 4HVWA 3VS4A 3ULRB 3FJ5A 1G2BA 2AKLA 1RI9A 4DEXA 1GFDA 1OPLA 2SRCA 3ZL7C 4LUDA 4RTWA 2GBQA 1KJWA 4OMPA 1K4US 1GBQA 2AKKA 2W0ZA 1U3OA 1AZEA 1VA7A 2A37A 4IIMA 1TUDA 4CC2A 1ZSGA 3IQLA 1I0CA 1HJDA 2JMCA 2LP5A 1GCPA 4JPBW 1BK2A 3REBB 1AWWA 4F14A 2CT4A 1NM7A
chains in the Genus database with same CATH superfamily
2LC4A 1M9SA 2K4YA 4WTOB 1NE8A 4EMKA 5CKEA 3QDFA 2DIGA 3M53A 4CC3A 2PQWA 3C12A 1VQNQ 1WXBA 1VYTA 1BIBA 2QEXT 1D3BB 2QQRA 3EHQA 4M77F 5KCOA 2LRQA 2PVOB 4OMQA 1YITT 2M9UA 3V8KA 1N9RA 4BY6C 1Z9QA 3OYCA 2Y90A 4M78C 4C92A 2V8JA 4FYYB 4NOYA 4BY6B 4HVVA 3VS0A 4M78B 7AT1B 4R55A 1YJWQ 4KGZB 1S72Q 4PJOG 4A4HA 1Q82R 5GMKi 3RESA 4OMOA 4BDYA 2GGRA 1PKSA 1Q95G 1WHMA 2JS2A 1YJNQ 1ZQ1A 1FXXA 4LDXA 3SB2A 1G3TA 2R57A 3KXTA 2RF0A 3FB9A 2XI9A 1T0JA 2QAZA 2DRKA 1XTDA 2MAMA 5GANj 5L23A 5GANe 4C8QE 5LJ3j 2K3BA 5LJ3e 1M1FA 3VS1A 3CXCA 9ATCB 3V7CA 1VQOT 2DEUA 2OTLA 1ZX6A 2E70A 2K57A 1KQ2A 1KD1C 1YN8A 2VGMA 2CS7A 1M90C 1VQ5A 1RAEB 2QA4A 1SHFA 3NGPA 4PNOA 2MI6A 1YJ9Q 2NWMA 4JRKA 1ZBJA 4J6XA 2KYMA 2EQJA 1C6VX 1X2QA 5DY9A 1VQNT 2ZAEA 4IUTA 1AHJB 1KC8C 2L2PA 4OMMA 4FYXB 4AFQC 4LE9A 3TEEA 1Q7YC 1K73R 3BE3A 2E5KA 1VQLQ 1W2BA 3FIFA 3UA7A 1K8AC 2Y4XA 3GNFB 1X01A 4EMHA 1M3AA 2AT1B 4C8QF 2WSFE 1YI2Q 4C0ZA 3E9GA 4PFPA 1JRIA 3F70A 3C94A 1S72T 2GQVA 1VQKQ 1M1KC 4BACA 2E41A 4LUEA 1UGRB 4X9DA 3FDRA 2BZXA 1M2OA 1Q86R 3RNJA 2A36A 1YJNT 2OTJQ 2BIVA 4N4HA 1SPKA 3VU3C 3UT1A 4ZTFA 3BFMA 4FW1A 3RMSA 5J26A 1H641 4IIOA 1SKUB 2DX1A 1WXUA 3CCMQ 2KXDA 2VB6A 2XKOC 3VS7A 2KR3A 4F16A 4PJLA 4E7IA 5EG2A 4Y91A 3HHTB 1QCNA 3E9FA 2YUPA 2HSEB 1PCXA 3JCMe 1Q81U 1YP5A 3V8LA 2E3HA 3R6OA 4JLIA 4M75D 2FPDA 4LD6A 2X3XD 1Y0MA 1YJ9T 1TOVA 4C8QA 4XQ3A 3GF5A 3HKSA 2YDLA 4OMLA 2EJGA 3CPWP 2RI3A 3UF4A 1XJWB 5AYFA 1OV3A 2E5QA 3OW2S 5EC7A 5D7UA 3JB9D 3JCMg 2RHYA 4ZN1A 1N8RC 1I81A 1VQ8Q 1YI2T 5GAN7 3GP8A 4RUGA 2CP0A 3CC2A 4A63B 4NS5A 1C1AA 1B3QA 2LJ1A 5C0MA 1AWOA 3HL8A 3TREA 3X28B 4M4ZA 2DYIA 2CZ6B 3I56Q 1D0YA 3CC7Q 3KBGA 1EIFA 1BBZA 4HVUA 3VUZA 1N27A 4JJCA 4GBQA 1U1SA 5FU7C 2KBTA 2CP7A 2J6KA 3SHWA 2DTIA 3H0HA 3QWYA 3TQ7P 1UJYA 3M0SA 2DBMA 3G4ST 4M7DB 2SEMA 1AZGB 3CD6T 3EGDA 1V76A 2HBPA 4M78F 4ELYC 1U06A 5I11A 4F04B 1TH7A 2DNUA 4LNPA 3OS1A 2DO3A 3CCJA 3X25B 2EAYA 4M75G 2PZ1A 4YTLA 5GAOr 2JOYA 1JJ2P 2CZ7B 2LQNA 1OI1A 3JCMb 2DXBA 1K8AU 1R0BG 5IT9E 4LDWA 2MPXC 2JTEA 4Y92A 1OULA 3DKMA 4RG2A 3M54A 4N0AA 2FB7A 1IGQA 3CC4A 1VQMQ 2A28A 5GAMf 1D3BA 4PKCC 1VQ4A 3CCUQ 5GAN4 2RK1A 4C92D 2XG8D 2RJDA 3THKA 4C5EA 5KYWB 1X27A 3MPUB 3CCRQ 2RQVA 2RI2A 1RABB 2P4TA 3JCMX 4E7KA 2RNAA 2YRCA 4BI4A 3NFCA 2MCNA 4Z89A 3LWIA 2HZYA 2LT1A 1YHQA 4PK4A 1YIJQ 3CMAT 2QGFB 4BI8B 2CP2A 2RQWA 3MKDA 2DZ9A 4CC4B 3META 6AT1B 3VRZA 2D8HA 2VYTA 4M75E 3QSUA 1PC0A 4J7FA 3HTRA 1K9MR 2J6OA 2O2OA 1OPKA 3CCVA 4M77D 3P8BB 3DLLA 2CP5A 2BKDN 4PFZA 3CBOA 3LH5A 3CCET 2DL3A 3H0IA 2LX7A 1UEBA 1G3SA 2A0FB 2R5MA 5IHKA 1XOVA 2YRDA 3MEUA 1N8RU 1SG5A 1BI0A 2KRSA 5CQXA 4DBFA 2FZGB 3FC3A 1NYGA 1SEMA 1B34B 3RR6A 3H9NA 2EYYA 5KYXB 2DE0X 5HKCA 5GAMg 2K2VA 1VQMT 1BIAA 1GL5A 1KQ1A 3CCUT 4EPCA 3LX7A 4LD9K 3OA6A 4FU6A 1UGVA 1WGSA 2EPDA 2EIFA 3A8MB 3VS4A 2C06A 2DXUA 3CCRT 2DXCA 1RI9A 4DEXA 1YCYA 1OPLA 3PMIA 5HY6A 2HD0A 2GBQA 3HRTA 1IB8A 1WZOA 1NPPA 5DM7R 1ZSZB 2MF2A 1ZSGA 2LNVA 1D1BA 4C0DB 1PSFA 2E65A 1ZA2B 5M9OA 4BUGA 1ZBXA 2GFUA 4ZNXA 3M0PA 4JLGA 2ZGWA 2F5TX 3QDRB 2RJFA 4J9EA 1KSWA 1X75C 2DJQA 2LT4A 1NG2A 1IO6A 1QMCA 2F2VA 4M77G 4EDUA 4C8QD 2D1XA 1ZUUA 2LZ6B 2CREA 4KUDK 4JRPA 3HFOA 2VGNA 3SDZA 3EGXB 4M75A 1JXMA 2PNIA 3MJXA 4AFZC 1PD0A 5CO7A 3OYIA 1Y71A 3M0TA 4AT1B 2YT6A 3LWHA 2RHUA 1T3SA 4J9BA 1M3BA 2ZPFB 1WX6A 2NUTA 4DOWA 1H3HA 3VS2A 3CCLQ 3OSVA 3A8GB 4ME7A 1WA7A 1O75A 2VUBA 4OB0B 2LJ3A 5LJ5f 2I0NA 1AWXA 2D8JA 2MIOA 3OBYA 3T9NA 3JCMW 2DTOA 1TWBA 1E6HA 2QK0A 3P8DA 4PFOA 1M3CA 2YHTA 1B07A 1TS9A 3JCMc 1LOJA 3A98A 4J9HA 2KDSA 1QVGP 4MZPA 3PGGA 3CCSQ 3RERA 2HL3A 2OJ2A 5GAMd 1G8XA 1AT1B 1MHNA 4KRTA 4M7AC 3JB9I 2A3LA 2GFAA 5GANh 3VJPA 1JEGA 5A2QE 3UPUA 2BUDA 2E3IA 1TUGB 4HXJA 2V8IA 1D1AA 2E64A 1WJSA 1MGQA 4M77E 3HRSA 2JJ9A 2WACA 3I5SA 1K0XA 1OX9A 2ED1A 2EQIA 1NEGA 3JCMP 4PJOB 3RKWA 1CKBA 2EW3A 3TCJA 2K3XA 2DD5A 3G71A 2DD4A 2QQAA 2LX9A 3KFVA 4C8QG 1SRMA 3EG1A 3RBBB 3VYHB 3L1AA 2ZZDA 1W1FA 4BE2A 5DLOA 4OB3B 2KRMA 2QEXA 2LNHB 1FMWA 4OB2B 1K0SA 1UB4A 2FZKB 4P5NA 1YITA 1LNXA 1WJQA 3HRUA 2D0NA 2V8KA 3LLRA 3RIRA 2DYBA 5A0GA 1ARKA 2XDDA 5C6SA 1D0ZA 5CKBA 2M02A 2XU8A 2HDAA 1AVZC 1NEBA 2HSPA 5CIUA 4OGCA 2DF6A 2Z0WA 4M78D 2OTLQ 3CPWA 2H3JA 4KH1B 4J9IA 1U8RA 1VQ5Q 3OYDA 2QA4Q 1MMDA 4WF2A 2V1QA 2WSCE 1BB9A 2PVDB 3CPFA 5IH2A 2QYZA 4MZTA 1WQWA 1NJIU 1K9MC 2RB6A 2CT3A 2L89A 2ROTA 1Y96B 1UFFA 4JJDA 2VASA 1N9SA 2KXCA 3JCMh 4CC7A 4RCBA 2AIRB 2L0AA 4A54A 1YWPA 4KT0E 4M77A 1GBRA 4HCZA 4E7JA 3EH1A 2O4XB 1QCFA 2RM4A 5FROA 2M51A 2MWPA 4C5IA 2O01E 4O6JA 4J9CA 3U23A 2J05A 5KYXA 2CUBA 4XTYA 3CBPA 4PJMA 4JS4A 3SWNB 2X3WD 1AOJA 2R58A 4KULA 4DEYA 4RMOA 1VQ9Q 1I8FA 2P4RA 1FWZA 1S72A 3NPFA 1AD5A 5GAN8 2AZVA 2PVGB 4D8DA 1JJ2A 2OTLT 1RI0A 2L5QA 4ELZC 2QTXA 5IHNA 2ZPEB 3S3NA 3ZEHA 3JCMJ 1RAGB 2FZCB 4J5YA 4MZMA 1YJWT 1VQ5T 1NZ9A 4M78G 3I55A 4FM4B 4M7AE 2ESWA 1VQ6A 4LDUA 2E6ZA 2E1HA 3TSZA 4ZGDB 1BI1A 5GJWB 2DL4A 2R5AA 2HKNA 2QDYB 4OB1B 2COZA 5LJ5d 1WLPB 2DL7A 4EIKA 2RH2A 5CAIA 1LJOA 4PJNA 3L2VA 2EQMA 1UE9A 3P8HA 2KYBA 1GCQC 2KEAA 1WHHA 5IXFA 3VUBA 3HPWA 3CC2Q 4FYVB 1M4ZA 1YJ9A 2W10A 2GNCA 2DVEA 2DJZA 2LCSA 2QG9B 3LGLA 2A7YA 1I1JA 1IGUA 2H3EB 4ZGEB 1X6GA 4M7AF 2XIDA 2LJ0A 5I22A 1QVFA 1MMGA 1MV3A 4LXCA 1FMKA 1KIKA 2M0YA 4E7ZA 2RK2A 2VWFA 3VRYA 4ANJA 1VQ9T 1QQJA 1VQLT 3OW2P 4XU0A 2MK5A 1HSQA 3OS5A 1M5Q1 2CSQA 1MMAA 2XDPA 5KYYB 4M78E 1QP2A 2DFUA 4FCYA 1VQKT 4GLKA 2KAFA 4F7UB 1WDXA 2OX7A 2C0IA 1D1CA 1RAIB 4OMNA 1WHKA 3CCJQ 2Y4YA 2XK0A 2FO0A 3KUFA 1M1GA 2DMOA 4XK8E 1ABQA 4NL2A 5GMKl 2O88A 2LMJA 2OTJT 2DXTA 1KHIA 3CCQA 5KYUA 2EYWA 1RLPC 1VYUA 2QQBA 1KFZA 3G4SA 1M2VB 3CD6A 2FVUA 3CCMT 4UC4A 4M7AA 2NYSA 4N4GA 4M7DC 2C0TA 4DQ2A 2HAXA 3H6ZA 3CC2T 1SHGA 3CC4Q 2VV5A 1KD1U 1SSHA 1OZ2A 4J6WA 1M90U 1VQ4Q 3CXCP 3OYHA 3CXCS 3EG2A 2V26A 2K6DA 1K1ZA 2F1LA 3ULRB 1OU9A 3FJ5A 3QJYA 1GFDA 3M55A 1G5VA 3RMQA 1KC8U 1Q7YU 4QW2A 2LDMA 5GMKe 1AZEA 5CK9A 2A37A 4IIMA 4CC2A 3JRZA 3OYYA 3S3MA 1HJDA 2JMCA 4FT4A 4JPBW 1AWWA 4F14A 3MP8A 4MDWA 4QQDA 1VQ8T 1W2BS 1M1KU 3TVTA 2HEQA 1VQ7Q 1YWOA 5ECAA 3VS3A 2IVWA 3M0RA 2JMAA 2FPFA 1Q82C 3MCAB 4QVZA 2HNIA 4OGEA 3CCJT 1BKBA 1IREB 3EFSA 3OBWA 4EMKC 4IKFA 3CCVQ 5FRMA 4FT2A 2LCCA 2F69A 4MMKA 3I56T 3CMAA 4EMKB 3CC7T 2K5IA 4BI3A 4M78A 2EKHA 1IHVA 3QUIA 3DB3A 2EQUA 1BU1A 4IUVA 5J39A 1J3TA 4XTVA 2G6FX 5KYNA 4J9FA 2J7IA 4BB7A 3A8HB 4DBHA 1Q81R 2G3RA 4RTVA 5AT1B 2EGAA 2RHXA 5GAN6 1WIEA 2CGHA 1YNZA 4C92B 3CC4T 1TG0A 4Z8AA 1N6AA 4AFSC 1VQ4T 1WXTA 1JU5C 1R0CB 1IRXA 5HCKA 2GTJA 4PLIA 2X4YA 1KQSA 1QVGA 4GLMA 2AHJB 3CCEA 3BDLA 5GAMj 2RQRA 5GAMe 2YRVA 2KSSA 1NLPC 4KH0B 2DERA 2HQXA 2D9TA 4II1A 1Y7XA 3GPLA 1UDLA 3VS5A 4ORZA 4HCCA 2O4XA 1K73C 4RCCA 1P92A 3LW5E 3N5BB 2P84A 1JBMA 4C0FA 2DLPA 2ECZA 4X9CA 4FSSA 4FSXA 3S3OA 1VQ7T 3L42A 1KG1A 2GCXA 5J3BA 1WJRA 3G6EA 2EYQA 2NUPB 1I07A 4JZ3A 3L2QA 3CCVT 2KGTA 2X4WA 2ZPIB 2RMOA 1E6GA 4LDYA 4XTUA 1Q86C 3A5ZB 2A08A 2DL5A 2IPOB 2GTOA 3OYKA 1ZSZC 2JM9A 2VXEA 4D6WA 1RUWA 1T3LA 2FEIA 3J81E 1M90R 1HD3A 3C4SA 1FMVA 1PM3A 4C0DC 3QJ6A 1YIJT 1F1BB 3SFMA 4M7DE 3INZA 2VKNA 2L3QA 1H92A 2XMFA 3OYJA 1X43A 4HCKA 4J9GA 1Z9ZA 2XHCA 4PLLA 3M5AA 4KUIA 3EG0A 1H8KA 1X2KA 2K2MA 5IAYA 4E7HA 4VUBA 3QHSA 1K8AR 1JQQA 1GCQA 2DILA 2F5KA 3OYMA 2M1HA 5D6XA 4QKUA 3I9QA 1BI3A 1FYNA 1WQ7A 4J6YA 1PHTA 5LL6S 5D6YA 4OP0A 2EGEA 3G1JA 2RQUA 4BE0A 4Z02A 1IHWA 2L3PA 1RAAB 2FG0A 3ASKA 1Q82U 3V7SA 1WHLA 4HCBA 3WXMB 3HFNA 4IUUA 2RHZA 4M7DF 1DJ7B 1QVPA 2J06A 1BYMA 2JW4A 1GRIA 1A0NB 1RLQC 1HXDA 4C8QB 2AK5A 5KYYA 4B6MA 1I5OB 2BE7D 2JT4A 2RO0A 4QVCA 2KT8A 3EHRA 3QXEB 1W70A 3G71Q 1QWEA 3M59A 4DA4A 4PL6A 4E7LA 2FRYA 1FX7A 1W4SA 3RKYA 3UATA 1VQPA 2DETA 3QWXX 2RQTA 1JO8A 2KQWA 4NL3A 3JAME 4M7AD 2QEXQ 2JNGA 3JCMV 3V8JA 3PVLA 1GFCA 4WCIA 4GY5A 1M30A 3L2RA 2JTFA 3LYIA 1YITQ 2CYZB 3C95A 4PJOC 1N8RR 3PTAA 4M7DA 4RTXA 3PVQA 1WPYA 3NHNA 4E2FB 3HSBA 1WYXA 4RTZA 1MUZA 1UECA 2L3SA 1XNIA 2COYA 1BCMA 1M27C 4XTWA 5LJ5e 3O5ZA 3X20B 2EWNA 3CMEA 5HK3A 3VYGA 2M0OA 3X26B 2LVMA 2K5FA 2K5LA 2O9VA 3VV0A 5GMKm 2KT1A 5CVIA 2LTOA 1AWJA 3EGDB 2B86A 1Q86U 1WFWA 3CQTA 3OYBA 2CH4W 3CCLT 3CBMA 1TTHB 3OYGA 4AG2C 3M56A 5LJ5g 3UDCA 2OAWA 1ACMB 4OF1A 2MWOA 3OS0A 2QQ9A 3PMTA 3M58A 3G71T 2EYXA 4AG1C 4FW2A 3QBYA 5IXBA 2DEQA 3JSCA 4J8OA 3WVEB 5KYWA 1Q81C 2P0PA 4N0AC 3CCST 4JDSA 4X34A 3X24B 3QZ9B 3PE0A 2JXBA 2LCLA 1HYOA 3SEMA 5GANf 3GOXA 1KK7A 3OW2A 2COWA 4AMCA 2K3YA 3RUXA 4DBRA 5LJ3f 4XTZA 2HKQB 1M8MA 5IHIA 1PRLC 5CQYA 4CI0C 3NMZC 1EZZB 4JJNK 4M7AG 3EAEA 1ABOA 1SSFA 2KE9A 2QGGA 3I35A 3EG3A 1KHCA 2WSEE 3TU4K 4JJBA 1VQOA 3NTIA 2FRWA 4J83A 5GAOl 2P0KA 4A4KA 2XICA 1K76A 2RHIA 3BDUA 1WHJA 3EG9B 4L5GA 3I55Q 2JS0A 3ZFJA 1VQ6Q 1GXIE 3HP9A 2HBWA 1VQNA 1RADB 1OOTA 3L2WA 3EH2A 4X1VA 2EGCA 4E47A 3QYHB 4HT9A 1JB0E 1B34A 2DK3A 3PIPA 2QTVA 3SWNC 2DTHA 2CP6A 5CKHA 2NUPA 3OYNA 2CSIA 3I5RA 2QDLA 2YUNA 1UHFA 2ZPGB 3TSWA 1YJWA 2MOXA 3SD4A 1PSEA 1TUCA 1UJ0A 2EBPA 1OQKA 1U5SA 1PD1A 3JB9H 5GANg 3A8LB 1QCOA 2F2XA 1YJNA 2DRMA 2PUKB 5LJ3g 5GAOq 2HL5C 4QQGA 2QA4T 3QO3A 1YFNA 2AKLA 2YLBA 5FLXE 1ZSZA 3ZL7C 4JRIA 1QP3A 1KJWA 2ATCB 3OYFA 2D6FA 3H8ZA 5L8RE 3M9QA 3OMCA 1K4US 1GBQA 2AKKA 3JCMf 4XAXB 4PJOE 3EFOB 4QQ6A 2LP5A 1UGSB 4IUPA 1GCPA 5IN1A 4OMFB 2CT4A 1NM7A 3AT1B 3VKIA 3MHXA 1IZ6A 3M57A 1I4K1 2JVVA 4RTYA 4RKUE 5GMKh 3I55T 1VQ6T 1LPLA 3E1SA 2PUOB 2E6NA 3QZ5B 4KGVB 3E2UA 3EGXA 1VQ9A 1N5ZA 4RTUA 1VQLA 2I2LA 3CCQQ 1D0XA 1V1CA 2V1RA 4J7IA 2M16A 1T0HA 3EGUA 3G4SQ 2NUZA 2RA2A 3CD6Q 2ED0A 1YI2A 2RJCA 4M75C 2DBKA 2FYKA 4PJOF 1VQKA 1XQHA 3BY7A 3OMGA 2YUOA 4M75B 4FL6A 1R8OB 4CRIA 5CKFA 2IG0A 2X4JA 1QW1A 5GAOp 1NJIR 3J7AF 5D6WA 2XD0A 4R56A 2HQHA 2OTJA 2L8DA 3Q1JA 2YUQA 1ZLMA 1K9MU 2LQWA 4F17A 4ZGJB 3PNWC 3CPWS 3FRNA 5KE2A 4LDVA 2NUTB 3LH0A 2KRNA 3CCMA 2BZYA 2GQIA 1VIEA 2KNBB 3H0FA 3ZBDA 2P0QA 2QXFA 3VS6A 2BE9B 2YSQA 2CZ0B 2H8HA 3GBQA 1MV0B 5KH6A 4BD3A 4IURA 2FHDA 2RJEA 3LGFA 4XU1A 5GAMh 2DIQA 4M7DD 3C0CA 2O9SA 5GANd 4BDZA 5GJVB 5LJ3d 4RTTA 4PJOA 2K7AA 3JB9J 2DKGA 4QT7A 4O5VA 2JN0A 3QKJA 1D09B 3CMAQ 2K79A 1X69A 3CCQT 1QLYA 5FU7B 3DLMA 5GMKj 2DM1A 8ATCB 2PU9B 1R77A 1VQ8A 3GIBA 1YBYA 1QKXA 1YHQQ 1VUBA 2PTKA 1I5LA 5CKDA 8AT1B 3L2ZA 3EFRA 2EQKA 3MP6A 1WI7A 1W2BP 1ZUKA 1HK9A 1W6XA 1G3YA 4A4FA 1OZ3A 4MDXA 3I56A 5FWCA 3R6NA 2CDTA 3MEVA 4D8KA 5A0LA 3CC7A 3CCEQ 1UGQB 2VC8A 1JJ2S 1OU8A 4F7UG 3NTKA 4Q5WA 2FL7A 3NTHA 3URGA 1TXQA 2OI3A 3REAB 3MEWA 2MYSA 3A8OB 4L59A 3L2UA 3ME9A 2YWWA 2JUFA 1UG1A 2EYZA 3OYEA 3JB9G 2EJFA 3UA6A 1BI2A 4C92C 1MMNA 3QPHA 5FW9A 4B9WA 1QKWA 2CZ1B 3PFSA 3M4GA 4KBMB 4Y28E 3JCMQ 2EFIA 5KE3A 2JZ2A 1IXDA 5I2MA 3G6EQ 4V2SA 1Y96A 4C5HA 3MO8A 5FU6C 3WVDB 1WNLA 1NLOC 4AFUC 1ZA1B 4JRQA 4M7DG 1PKTA 2QI2A 2RPNA 2KROA 1PRMC 5FU6B 5CR2A 1U1TA 1AEYA 4JZ4A 2KK4A 2LQKA 2E10A 3JCMd 4HA8A 1NPRA 1O9SA 4A53A 3EG9A 3OYLA 3CEYA 1CKAA 2L3RA 3UWNA 5GAN3 3S6WA 1VQ7A 1QVFP 1YHQT 2VXFA 2HMAA 4B9XA 3D7SB 1VQMA 1QVFS 1QWFA 3CCUA 1B7TA 2J6FA 2OAUA 1OEBA 4M77C 1NBEB 4R0KA 3RDVA 4XU3A 3CCRA 4F7UE 2DPPB 4M77B 1UTIA 1RAHB 3SWNA 2EKOA 1C0MA 2LQ8A 1G83A 3DB4A 4ZTJA 4J9DA 2QASA 2HQEA 3MP1A 4C0GA 4C5GA 4ATOA 1YIJA 1NYFA 2CUDA 5KCHA 1E7OA 5GAOm 3JV3A 2AZSA 2YXYA 3FEOA 1KD1R 4FIBA 3QG1A 2EVRA 5HK0A 4JS5A 2ROLA 1EX4A 1V29B 2RD1A 5GAN5 1RL2A 4FYWB 3G6ET 1Y07A 2F2WA 3EFOA 4M75F 4C92G 1SF9A 3PT9A 4JUVA 1KC8R 2E12A 1JXOA 2B8AA 2GF7A 5DLQE 1Q7YR 4TVRA 2KI7A 1S1NA 3QYGB 4A4GA 3OB9A 5LJ5h 4E6RA 1CSKA 4F7UF 2BZ8A 1MNDA 3OSSC 2X9HA 3A1PA 5FWBA 2DL8A 2JTMA 1OYXA 2ZPHB 4IUQA 1ZHIA 3JB9F 2CH4A 4DOVA 1M1KR 2C0OA 4BE1A 3OS2A 4QVDA 2YLCA 3GNGA 4Z88A 4DBQA 3H41A 1VQPQ 2DZCA 5I2SA 1PG5B 3FLGA 2RN8A 1BCOA 1NJIC 2JM8A 4E7SA 2ZPBB 4L6V5 1VOMA 4OVAA 1PWTA 1PNJA 3M0UA 4C8QC 4N4IA 5FRNA 4HKEA 1TSFA 1LCKA 1UHCA 1UUEA 3BW1A 4MMLA 3FJPA 2NLUA 3PIOA 2ENMA 3AHUA 4F7UA 2DA9A 2RI5A 2O31A 3CMEQ 1X6BA 3M0QA 1H3ZA 4A4EA 4C92E 1Y57A 3RKXA 2CKKA 2BTTA 2VVKA 4EMGA 4RG8A 3M4YA 1M2VA 5I21A 2ABLA 2X51A 2QQSA 1MNEA 4LN2A 2KMTA 4XTXA 2X4XA 1VYVA 2X35A 4PJJA 2K9GA 5GAOn 1KQSP 4XU2A 2E4HA 1SRLA 2DAQA 3ER0A 2FPEA 1LVKA 2MMPA 1KQSS 1QVGS 4PJOD 2HCKA 1K9AA 5A0DA 1K73U 5KYUB 1UGPB 2KY9A 2DVJA 2XDBA 4ZN3A 5LJ5j 1X6OA 3MEAA 3O8VA 3GLXA 5CCAA 1VQPT 4HT8A 1ZUYA 4M7AB 5LJ3h 2IIMA 4K11A 4KGXB 4ESRA 2CP3A 3G7ZA 3CCLA 1YCSB 1EFNA 4HVWA 1VIFA 1G2BA 2EJ9A 4C92F 2D0QB 2SRCA 4LUDA 4RTWA 1OX8A 3E19A 4OMPA 1G3WA 1TU0B 1M8VA 1WHGA 2W0ZA 1U3OA 1VA7A 5GAN2 1TUDA 3OY9A 2ZCFB 3J80E 1RAFB 3OYAA 1RACB 3IQLA 3QIIA 3CCSA 1I0CA 3V7RA 1VQOQ 1BK2A 2KVQG 3OQ5A 3REBB 3CMET
chains in the Genus database with same CATH topology
3TVTA 2HEQA 1YWOA 5ECAA 3VS3A 4RTYA 3M0RA 2JMAA 2FPFA 4ZNXA 3M0PA 4CC3A 4J9EA 1WXBA 1KSWA 1VYTA 2DJQA 1N5ZA 4RTUA 3EHQA 1NG2A 1V1CA 1IO6A 4OMQA 2EKHA 2F2VA 2V1RA 2D1XA 1BU1A 1ZUUA 2CREA 1Z9QA 2LZ6B 1T0HA 3EGUA 1J3TA 2NUZA 2G6FX 4J9FA 1JXMA 2PNIA 2J7IA 2ED0A 4HVVA 4AFZC 3VS0A 2DBKA 4RTVA 2EGAA 1WIEA 1YNZA 1TG0A 2YUOA 4Z8AA 3M0TA 4AFSC 4OMOA 2YT6A 2GGRA 1T3SA 1WXTA 1JU5C 1M3BA 1PKSA 4J9BA 5HCKA 2GTJA 2JS2A 1WX6A 4GLMA 2YUQA 1H3HA 1ZLMA 3VS2A 2LQWA 4F17A 2RQRA 1NLPC 1WA7A 2RF0A 2LJ3A 1T0JA 2DRKA 2I0NA 1AWXA 2D8JA 2MIOA 5L23A 2KRNA 2BZYA 2GQIA 2KNBB 1E6HA 1UDLA 2K3BA 3H0FA 1M3CA 1B07A 3VS5A 4ORZA 3VS1A 3A98A 4J9HA 3VS6A 2YSQA 2H8HA 3GBQA 1MV0B 1ZX6A 2DLPA 2OJ2A 2ECZA 1YN8A 4FSSA 3C0CA 4KRTA 2O9SA 1SHFA 3NGPA 5GJVB 1JEGA 4RTTA 2NWMA 1ZBJA 2K7AA 4HXJA 1I07A 2KYMA 4JZ3A 1X2QA 2KGTA 2RMOA 1E6GA 4QT7A 2L2PA 4OMMA 3I5SA 4AFQC 4LE9A 2EQIA 2ED1A 1K0XA 1NEGA 2K79A 2A08A 2DL5A 1X69A 2E5KA 1QLYA 2GTOA 1CKBA 2EW3A 3UA7A 2JM9A 2DM1A 1RUWA 1T3LA 2FEIA 1M3AA 1HD3A 1QKXA 3KFVA 1SRMA 2PTKA 3EG1A 3RBBB 2VKNA 2L3QA 1H92A 4LUEA 2XMFA 1W1FA 1WI7A 1X43A 1ZUKA 4HCKA 4J9GA 1Z9ZA 1W6XA 2BZXA 3EG0A 1H8KA 2KRMA 1X2KA 3RNJA 2A36A 5FWCA 2LNHB 3R6NA 2CDTA 4D8KA 1SPKA 2K2MA 1K0SA 2D0NA 1JQQA 1GCQA 2DILA 2DYBA 4IIOA 2DX1A 1WXUA 2OI3A 3REAB 1ARKA 2KXDA 3I9QA 1FYNA 3VS7A 2KR3A 2HDAA 1NEBA 1AVZC 2HSPA 1UG1A 2EYZA 4F16A 1PHTA 2DF6A 2YUPA 3UA6A 2EGEA 2RQUA 1YP5A 2L3PA 4J9IA 2FG0A 5FW9A 1QKWA 2FPDA 2X3XD 2V1QA 1Y0MA 1BB9A 5IH2A 1NLOC 4AFUC 2J06A 1PKTA 2RPNA 2CT3A 2JW4A 2KROA 1PRMC 2YDLA 4OMLA 2ROTA 1GRIA 1A0NB 1AEYA 3UF4A 1RLQC 4JZ4A 2AK5A 1UFFA 4JJDA 2JT4A 2KXCA 1OV3A 2KT8A 3EHRA 4CC7A 5EC7A 1W70A 1CKAA 2L0AA 1QWEA 1YWPA 4RUGA 2FRYA 4A63B 1QWFA 2J6FA 3UATA 1GBRA 1B3QA 2LJ1A 1AWOA 1OEBA 3QWXX 2RQTA 1JO8A 4R0KA 1QCFA 4M4ZA 2M51A 3PVLA 1GFCA 1UTIA 4WCIA 4J9CA 3U23A 1M30A 2J05A 1BBZA 4HVUA 2CUBA 4JJCA 4GBQA 1G83A 4J9DA 2KBTA 4RTXA 3PVQA 2J6KA 3SHWA 2X3WD 3H0HA 3NHNA 1NYFA 1AOJA 2CUDA 1E7OA 1WYXA 3QWYA 1UJYA 4RTZA 4DEYA 2P4RA 3M0SA 1MUZA 1UECA 1AD5A 2DBMA 2L3SA 2AZSA 2AZVA 3JV3A 3NPFA 1M27C 4D8DA 2SEMA 1AZGB 3O5ZA 2EVRA 2ROLA 5IHNA 1U06A 2O9VA 5I11A 2KT1A 2ESWA 2DNUA 4LNPA 2F2WA 1AWJA 3TSZA 5GJWB 2PZ1A 2B86A 2DL4A 1WFWA 3CQTA 1JXOA 2CH4W 1S1NA 1WLPB 2DL7A 2LQNA 4EIKA 4E6RA 1CSKA 4AG2C 2OAWA 2BZ8A 2JTEA 1UE9A 4Y92A 2KYBA 5FWBA 2DL8A 1GCQC 2EYXA 2KEAA 4AG1C 5IXFA 5IXBA 2CH4A 2C0OA 2A28A 2W10A 2GNCA 4Z88A 3H41A 3PE0A 2JXBA 2LCSA 3SEMA 3THKA 1I1JA 2RN8A 1X27A 2JM8A 2RQVA 1M8MA 5IHIA 1PRLC 1PWTA 1PNJA 3M0UA 1X6GA 2RNAA 3NMZC 2LJ0A 5I22A 1MV3A 1ABOA 1FMKA 1KIKA 2MCNA 2KE9A 4Z89A 2M0YA 1LCKA 2VWFA 3VRYA 1UHCA 1UUEA 3I35A 3EG3A 4JJBA 1HSQA 2RQWA 2CSQA 2ENMA 2FRWA 2DA9A 4CC4B 2O31A 1X6BA 3M0QA 1K76A 3VRZA 1Y57A 2D8HA 2BTTA 1WDXA 2J6OA 2C0IA 2VVKA 2JS0A 2O2OA 4OMNA 1OPKA 2HBWA 2FO0A 1OOTA 2DMOA 4X1VA 2ABLA 1ABQA 2O88A 2EGCA 2LMJA 4LN2A 3LH5A 2DL3A 3H0IA 2LX7A 2EYWA 1VYVA 1RLPC 1VYUA 2K9GA 1SRLA 1KFZA 2FPEA 5IHKA 1XOVA 2KRSA 2HCKA 1K9AA 1NYGA 2CSIA 1SEMA 3I5RA 2QDLA 2YUNA 1UHFA 3TSWA 2C0TA 2EYYA 2DVJA 2MOXA 2DE0X 1SHGA 1TUCA 1UJ0A 1GL5A 1SSHA 2EBPA 1U5SA 1ZUYA 2IIMA 4K11A 1UGVA 2F2XA 3EG2A 2EPDA 4ESRA 2DRMA 2K6DA 1K1ZA 1YCSB 1EFNA 4HVWA 3VS4A 3ULRB 3FJ5A 1G2BA 2AKLA 1RI9A 4DEXA 1GFDA 1OPLA 2SRCA 3ZL7C 4LUDA 4RTWA 2GBQA 1KJWA 4OMPA 1K4US 1GBQA 2AKKA 2W0ZA 1U3OA 1AZEA 1VA7A 2A37A 4IIMA 1TUDA 4CC2A 1ZSGA 3IQLA 1I0CA 1HJDA 2JMCA 2LP5A 1GCPA 4JPBW 1BK2A 3REBB 1AWWA 4F14A 2CT4A 1NM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVT A;  2HEQ A;  1YWO A;  5ECA A;  3VS3 A;  4RTY A;  3M0R A;  2JMA A;  2FPF A;  4ZNX A;  3M0P A;  4CC3 A;  4J9E A;  1WXB A;  1KSW A;  1VYT A;  2DJQ A;  1N5Z A;  4RTU A;  3EHQ A;  1NG2 A;  1V1C A;  1IO6 A;  4OMQ A;  2EKH A;  2F2V A;  2V1R A;  2D1X A;  1BU1 A;  1ZUU A;  2CRE A;  1Z9Q A;  2LZ6 B;  1T0H A;  3EGU A;  1J3T A;  2NUZ A;  2G6F X;  4J9F A;  1JXM A;  2PNI A;  2J7I A;  2ED0 A;  4HVV A;  4AFZ C;  3VS0 A;  2DBK A;  4RTV A;  2EGA A;  1WIE A;  1YNZ A;  1TG0 A;  2YUO A;  4Z8A A;  3M0T A;  4AFS C;  4OMO A;  2YT6 A;  2GGR A;  1T3S A;  1WXT A;  1JU5 C;  1M3B A;  1PKS A;  4J9B A;  5HCK A;  2GTJ A;  2JS2 A;  1WX6 A;  4GLM A;  2YUQ A;  1H3H A;  1ZLM A;  3VS2 A;  2LQW A;  4F17 A;  2RQR A;  1NLP C;  1WA7 A;  2RF0 A;  2LJ3 A;  1T0J A;  2DRK A;  2I0N A;  1AWX A;  2D8J A;  2MIO A;  5L23 A;  2KRN A;  2BZY A;  2GQI A;  2KNB B;  1E6H A;  1UDL A;  2K3B A;  3H0F A;  1M3C A;  1B07 A;  3VS5 A;  4ORZ A;  3VS1 A;  3A98 A;  4J9H A;  3VS6 A;  2YSQ A;  2H8H A;  3GBQ A;  1MV0 B;  1ZX6 A;  2DLP A;  2OJ2 A;  2ECZ A;  1YN8 A;  4FSS A;  3C0C A;  4KRT A;  2O9S A;  1SHF A;  3NGP A;  5GJV B;  1JEG A;  4RTT A;  2NWM A;  1ZBJ A;  2K7A A;  4HXJ A;  1I07 A;  2KYM A;  4JZ3 A;  1X2Q A;  2KGT A;  2RMO A;  1E6G A;  4QT7 A;  2L2P A;  4OMM A;  3I5S A;  4AFQ C;  4LE9 A;  2EQI A;  2ED1 A;  1K0X A;  1NEG A;  2K79 A;  2A08 A;  2DL5 A;  1X69 A;  2E5K A;  1QLY A;  2GTO A;  1CKB A;  2EW3 A;  3UA7 A;  2JM9 A;  2DM1 A;  1RUW A;  1T3L A;  2FEI A;  1M3A A;  1HD3 A;  1QKX A;  3KFV A;  1SRM A;  2PTK A;  3EG1 A;  3RBB B;  2VKN A;  2L3Q A;  1H92 A;  4LUE A;  2XMF A;  1W1F A;  1WI7 A;  1X43 A;  1ZUK A;  4HCK A;  4J9G A;  1Z9Z A;  1W6X A;  2BZX A;  3EG0 A;  1H8K A;  2KRM A;  1X2K A;  3RNJ A;  2A36 A;  5FWC A;  2LNH B;  3R6N A;  2CDT A;  4D8K A;  1SPK A;  2K2M A;  1K0S A;  2D0N A;  1JQQ A;  1GCQ A;  2DIL A;  2DYB A;  4IIO A;  2DX1 A;  1WXU A;  2OI3 A;  3REA B;  1ARK A;  2KXD A;  3I9Q A;  1FYN A;  3VS7 A;  2KR3 A;  2HDA A;  1NEB A;  1AVZ C;  2HSP A;  1UG1 A;  2EYZ A;  4F16 A;  1PHT A;  2DF6 A;  2YUP A;  3UA6 A;  2EGE A;  2RQU A;  1YP5 A;  2L3P A;  4J9I A;  2FG0 A;  5FW9 A;  1QKW A;  2FPD A;  2X3X D;  2V1Q A;  1Y0M A;  1BB9 A;  5IH2 A;  1NLO C;  4AFU C;  2J06 A;  1PKT A;  2RPN A;  2CT3 A;  2JW4 A;  2KRO A;  1PRM C;  2YDL A;  4OML A;  2ROT A;  1GRI A;  1A0N B;  1AEY A;  3UF4 A;  1RLQ C;  4JZ4 A;  2AK5 A;  1UFF A;  4JJD A;  2JT4 A;  2KXC A;  1OV3 A;  2KT8 A;  3EHR A;  4CC7 A;  5EC7 A;  1W70 A;  1CKA A;  2L0A A;  1QWE A;  1YWP A;  4RUG A;  2FRY A;  4A63 B;  1QWF A;  2J6F A;  3UAT A;  1GBR A;  1B3Q A;  2LJ1 A;  1AWO A;  1OEB A;  3QWX X;  2RQT A;  1JO8 A;  4R0K A;  1QCF A;  4M4Z A;  2M51 A;  3PVL A;  1GFC A;  1UTI A;  4WCI A;  4J9C A;  3U23 A;  1M30 A;  2J05 A;  1BBZ A;  4HVU A;  2CUB A;  4JJC A;  4GBQ A;  1G83 A;  4J9D A;  2KBT A;  4RTX A;  3PVQ A;  2J6K A;  3SHW A;  2X3W D;  3H0H A;  3NHN A;  1NYF A;  1AOJ A;  2CUD A;  1E7O A;  1WYX A;  3QWY A;  1UJY A;  4RTZ A;  4DEY A;  2P4R A;  3M0S A;  1MUZ A;  1UEC A;  1AD5 A;  2DBM A;  2L3S A;  2AZS A;  2AZV A;  3JV3 A;  3NPF A;  1M27 C;  4D8D A;  2SEM A;  1AZG B;  3O5Z A;  2EVR A;  2ROL A;  5IHN A;  1U06 A;  2O9V A;  5I11 A;  2KT1 A;  2ESW A;  2DNU A;  4LNP A;  2F2W A;  1AWJ A;  3TSZ A;  5GJW B;  2PZ1 A;  2B86 A;  2DL4 A;  1WFW A;  3CQT A;  1JXO A;  2CH4 W;  1S1N A;  1WLP B;  2DL7 A;  2LQN A;  4EIK A;  4E6R A;  1CSK A;  4AG2 C;  2OAW A;  2BZ8 A;  2JTE A;  1UE9 A;  4Y92 A;  2KYB A;  5FWB A;  2DL8 A;  1GCQ C;  2EYX A;  2KEA A;  4AG1 C;  5IXF A;  5IXB A;  2CH4 A;  2C0O A;  2A28 A;  2W10 A;  2GNC A;  4Z88 A;  3H41 A;  3PE0 A;  2JXB A;  2LCS A;  3SEM A;  3THK A;  1I1J A;  2RN8 A;  1X27 A;  2JM8 A;  2RQV A;  1M8M A;  5IHI A;  1PRL C;  1PWT A;  1PNJ A;  3M0U A;  1X6G A;  2RNA A;  3NMZ C;  2LJ0 A;  5I22 A;  1MV3 A;  1ABO A;  1FMK A;  1KIK A;  2MCN A;  2KE9 A;  4Z89 A;  2M0Y A;  1LCK A;  2VWF A;  3VRY A;  1UHC A;  1UUE A;  3I35 A;  3EG3 A;  4JJB A;  1HSQ A;  2RQW A;  2CSQ A;  2ENM A;  2FRW A;  2DA9 A;  4CC4 B;  2O31 A;  1X6B A;  3M0Q A;  1K76 A;  3VRZ A;  1Y57 A;  2D8H A;  2BTT A;  1WDX A;  2J6O A;  2C0I A;  2VVK A;  2JS0 A;  2O2O A;  4OMN A;  1OPK A;  2HBW A;  2FO0 A;  1OOT A;  2DMO A;  4X1V A;  2ABL A;  1ABQ A;  2O88 A;  2EGC A;  2LMJ A;  4LN2 A;  3LH5 A;  2DL3 A;  3H0I A;  2LX7 A;  2EYW A;  1VYV A;  1RLP C;  1VYU A;  2K9G A;  1SRL A;  1KFZ A;  2FPE A;  5IHK A;  1XOV A;  2KRS A;  2HCK A;  1K9A A;  1NYG A;  2CSI A;  1SEM A;  3I5R A;  2QDL A;  2YUN A;  1UHF A;  3TSW A;  2C0T A;  2EYY A;  2DVJ A;  2MOX A;  2DE0 X;  1SHG A;  1TUC A;  1UJ0 A;  1GL5 A;  1SSH A;  2EBP A;  1U5S A;  1ZUY A;  2IIM A;  4K11 A;  1UGV A;  2F2X A;  3EG2 A;  2EPD A;  4ESR A;  2DRM A;  2K6D A;  1K1Z A;  1YCS B;  1EFN A;  4HVW A;  3VS4 A;  3ULR B;  3FJ5 A;  1G2B A;  2AKL A;  1RI9 A;  4DEX A;  1GFD A;  1OPL A;  2SRC A;  3ZL7 C;  4LUD A;  4RTW A;  2GBQ A;  1KJW A;  4OMP A;  1K4U S;  1GBQ A;  2AKK A;  2W0Z A;  1U3O A;  1AZE A;  1VA7 A;  2A37 A;  4IIM A;  1TUD A;  4CC2 A;  1ZSG A;  3IQL A;  1I0C A;  1HJD A;  2JMC A;  2LP5 A;  1GCP A;  4JPB W;  1BK2 A;  3REB B;  1AWW A;  4F14 A;  2CT4 A;  1NM7 A; 
#chains in the Genus database with same CATH topology
 2LC4 A;  1M9S A;  2K4Y A;  4WTO B;  1NE8 A;  4EMK A;  5CKE A;  3QDF A;  2DIG A;  3M53 A;  4CC3 A;  2PQW A;  3C12 A;  1VQN Q;  1WXB A;  1VYT A;  1BIB A;  2QEX T;  1D3B B;  2QQR A;  3EHQ A;  4M77 F;  5KCO A;  2LRQ A;  2PVO B;  4OMQ A;  1YIT T;  2M9U A;  3V8K A;  1N9R A;  4BY6 C;  1Z9Q A;  3OYC A;  2Y90 A;  4M78 C;  4C92 A;  2V8J A;  4FYY B;  4NOY A;  4BY6 B;  4HVV A;  3VS0 A;  4M78 B;  7AT1 B;  4R55 A;  1YJW Q;  4KGZ B;  1S72 Q;  4PJO G;  4A4H A;  1Q82 R;  5GMK i;  3RES A;  4OMO A;  4BDY A;  2GGR A;  1PKS A;  1Q95 G;  1WHM A;  2JS2 A;  1YJN Q;  1ZQ1 A;  1FXX A;  4LDX A;  3SB2 A;  1G3T A;  2R57 A;  3KXT A;  2RF0 A;  3FB9 A;  2XI9 A;  1T0J A;  2QAZ A;  2DRK A;  1XTD A;  2MAM A;  5GAN j;  5L23 A;  5GAN e;  4C8Q E;  5LJ3 j;  2K3B A;  5LJ3 e;  1M1F A;  3VS1 A;  3CXC A;  9ATC B;  3V7C A;  1VQO T;  2DEU A;  2OTL A;  1ZX6 A;  2E70 A;  2K57 A;  1KQ2 A;  1KD1 C;  1YN8 A;  2VGM A;  2CS7 A;  1M90 C;  1VQ5 A;  1RAE B;  2QA4 A;  1SHF A;  3NGP A;  4PNO A;  2MI6 A;  1YJ9 Q;  2NWM A;  4JRK A;  1ZBJ A;  4J6X A;  2KYM A;  2EQJ A;  1C6V X;  1X2Q A;  5DY9 A;  1VQN T;  2ZAE A;  4IUT A;  1AHJ B;  1KC8 C;  2L2P A;  4OMM A;  4FYX B;  4AFQ C;  4LE9 A;  3TEE A;  1Q7Y C;  1K73 R;  3BE3 A;  2E5K A;  1VQL Q;  1W2B A;  3FIF A;  3UA7 A;  1K8A C;  2Y4X A;  3GNF B;  1X01 A;  4EMH A;  1M3A A;  2AT1 B;  4C8Q F;  2WSF E;  1YI2 Q;  4C0Z A;  3E9G A;  4PFP A;  1JRI A;  3F70 A;  3C94 A;  1S72 T;  2GQV A;  1VQK Q;  1M1K C;  4BAC A;  2E41 A;  4LUE A;  1UGR B;  4X9D A;  3FDR A;  2BZX A;  1M2O A;  1Q86 R;  3RNJ A;  2A36 A;  1YJN T;  2OTJ Q;  2BIV A;  4N4H A;  1SPK A;  3VU3 C;  3UT1 A;  4ZTF A;  3BFM A;  4FW1 A;  3RMS A;  5J26 A;  1H64 1;  4IIO A;  1SKU B;  2DX1 A;  1WXU A;  3CCM Q;  2KXD A;  2VB6 A;  2XKO C;  3VS7 A;  2KR3 A;  4F16 A;  4PJL A;  4E7I A;  5EG2 A;  4Y91 A;  3HHT B;  1QCN A;  3E9F A;  2YUP A;  2HSE B;  1PCX A;  3JCM e;  1Q81 U;  1YP5 A;  3V8L A;  2E3H A;  3R6O A;  4JLI A;  4M75 D;  2FPD A;  4LD6 A;  2X3X D;  1Y0M A;  1YJ9 T;  1TOV A;  4C8Q A;  4XQ3 A;  3GF5 A;  3HKS A;  2YDL A;  4OML A;  2EJG A;  3CPW P;  2RI3 A;  3UF4 A;  1XJW B;  5AYF A;  1OV3 A;  2E5Q A;  3OW2 S;  5EC7 A;  5D7U A;  3JB9 D;  3JCM g;  2RHY A;  4ZN1 A;  1N8R C;  1I81 A;  1VQ8 Q;  1YI2 T;  5GAN 7;  3GP8 A;  4RUG A;  2CP0 A;  3CC2 A;  4A63 B;  4NS5 A;  1C1A A;  1B3Q A;  2LJ1 A;  5C0M A;  1AWO A;  3HL8 A;  3TRE A;  3X28 B;  4M4Z A;  2DYI A;  2CZ6 B;  3I56 Q;  1D0Y A;  3CC7 Q;  3KBG A;  1EIF A;  1BBZ A;  4HVU A;  3VUZ A;  1N27 A;  4JJC A;  4GBQ A;  1U1S A;  5FU7 C;  2KBT A;  2CP7 A;  2J6K A;  3SHW A;  2DTI A;  3H0H A;  3QWY A;  3TQ7 P;  1UJY A;  3M0S A;  2DBM A;  3G4S T;  4M7D B;  2SEM A;  1AZG B;  3CD6 T;  3EGD A;  1V76 A;  2HBP A;  4M78 F;  4ELY C;  1U06 A;  5I11 A;  4F04 B;  1TH7 A;  2DNU A;  4LNP A;  3OS1 A;  2DO3 A;  3CCJ A;  3X25 B;  2EAY A;  4M75 G;  2PZ1 A;  4YTL A;  5GAO r;  2JOY A;  1JJ2 P;  2CZ7 B;  2LQN A;  1OI1 A;  3JCM b;  2DXB A;  1K8A U;  1R0B G;  5IT9 E;  4LDW A;  2MPX C;  2JTE A;  4Y92 A;  1OUL A;  3DKM A;  4RG2 A;  3M54 A;  4N0A A;  2FB7 A;  1IGQ A;  3CC4 A;  1VQM Q;  2A28 A;  5GAM f;  1D3B A;  4PKC C;  1VQ4 A;  3CCU Q;  5GAN 4;  2RK1 A;  4C92 D;  2XG8 D;  2RJD A;  3THK A;  4C5E A;  5KYW B;  1X27 A;  3MPU B;  3CCR Q;  2RQV A;  2RI2 A;  1RAB B;  2P4T A;  3JCM X;  4E7K A;  2RNA A;  2YRC A;  4BI4 A;  3NFC A;  2MCN A;  4Z89 A;  3LWI A;  2HZY A;  2LT1 A;  1YHQ A;  4PK4 A;  1YIJ Q;  3CMA T;  2QGF B;  4BI8 B;  2CP2 A;  2RQW A;  3MKD A;  2DZ9 A;  4CC4 B;  3MET A;  6AT1 B;  3VRZ A;  2D8H A;  2VYT A;  4M75 E;  3QSU A;  1PC0 A;  4J7F A;  3HTR A;  1K9M R;  2J6O A;  2O2O A;  1OPK A;  3CCV A;  4M77 D;  3P8B B;  3DLL A;  2CP5 A;  2BKD N;  4PFZ A;  3CBO A;  3LH5 A;  3CCE T;  2DL3 A;  3H0I A;  2LX7 A;  1UEB A;  1G3S A;  2A0F B;  2R5M A;  5IHK A;  1XOV A;  2YRD A;  3MEU A;  1N8R U;  1SG5 A;  1BI0 A;  2KRS A;  5CQX A;  4DBF A;  2FZG B;  3FC3 A;  1NYG A;  1SEM A;  1B34 B;  3RR6 A;  3H9N A;  2EYY A;  5KYX B;  2DE0 X;  5HKC A;  5GAM g;  2K2V A;  1VQM T;  1BIA A;  1GL5 A;  1KQ1 A;  3CCU T;  4EPC A;  3LX7 A;  4LD9 K;  3OA6 A;  4FU6 A;  1UGV A;  1WGS A;  2EPD A;  2EIF A;  3A8M B;  3VS4 A;  2C06 A;  2DXU A;  3CCR T;  2DXC A;  1RI9 A;  4DEX A;  1YCY A;  1OPL A;  3PMI A;  5HY6 A;  2HD0 A;  2GBQ A;  3HRT A;  1IB8 A;  1WZO A;  1NPP A;  5DM7 R;  1ZSZ B;  2MF2 A;  1ZSG A;  2LNV A;  1D1B A;  4C0D B;  1PSF A;  2E65 A;  1ZA2 B;  5M9O A;  4BUG A;  1ZBX A;  2GFU A;  4ZNX A;  3M0P A;  4JLG A;  2ZGW A;  2F5T X;  3QDR B;  2RJF A;  4J9E A;  1KSW A;  1X75 C;  2DJQ A;  2LT4 A;  1NG2 A;  1IO6 A;  1QMC A;  2F2V A;  4M77 G;  4EDU A;  4C8Q D;  2D1X A;  1ZUU A;  2LZ6 B;  2CRE A;  4KUD K;  4JRP A;  3HFO A;  2VGN A;  3SDZ A;  3EGX B;  4M75 A;  1JXM A;  2PNI A;  3MJX A;  4AFZ C;  1PD0 A;  5CO7 A;  3OYI A;  1Y71 A;  3M0T A;  4AT1 B;  2YT6 A;  3LWH A;  2RHU A;  1T3S A;  4J9B A;  1M3B A;  2ZPF B;  1WX6 A;  2NUT A;  4DOW A;  1H3H A;  3VS2 A;  3CCL Q;  3OSV A;  3A8G B;  4ME7 A;  1WA7 A;  1O75 A;  2VUB A;  4OB0 B;  2LJ3 A;  5LJ5 f;  2I0N A;  1AWX A;  2D8J A;  2MIO A;  3OBY A;  3T9N A;  3JCM W;  2DTO A;  1TWB A;  1E6H A;  2QK0 A;  3P8D A;  4PFO A;  1M3C A;  2YHT A;  1B07 A;  1TS9 A;  3JCM c;  1LOJ A;  3A98 A;  4J9H A;  2KDS A;  1QVG P;  4MZP A;  3PGG A;  3CCS Q;  3RER A;  2HL3 A;  2OJ2 A;  5GAM d;  1G8X A;  1AT1 B;  1MHN A;  4KRT A;  4M7A C;  3JB9 I;  2A3L A;  2GFA A;  5GAN h;  3VJP A;  1JEG A;  5A2Q E;  3UPU A;  2BUD A;  2E3I A;  1TUG B;  4HXJ A;  2V8I A;  1D1A A;  2E64 A;  1WJS A;  1MGQ A;  4M77 E;  3HRS A;  2JJ9 A;  2WAC A;  3I5S A;  1K0X A;  1OX9 A;  2ED1 A;  2EQI A;  1NEG A;  3JCM P;  4PJO B;  3RKW A;  1CKB A;  2EW3 A;  3TCJ A;  2K3X A;  2DD5 A;  3G71 A;  2DD4 A;  2QQA A;  2LX9 A;  3KFV A;  4C8Q G;  1SRM A;  3EG1 A;  3RBB B;  3VYH B;  3L1A A;  2ZZD A;  1W1F A;  4BE2 A;  5DLO A;  4OB3 B;  2KRM A;  2QEX A;  2LNH B;  1FMW A;  4OB2 B;  1K0S A;  1UB4 A;  2FZK B;  4P5N A;  1YIT A;  1LNX A;  1WJQ A;  3HRU A;  2D0N A;  2V8K A;  3LLR A;  3RIR A;  2DYB A;  5A0G A;  1ARK A;  2XDD A;  5C6S A;  1D0Z A;  5CKB A;  2M02 A;  2XU8 A;  2HDA A;  1AVZ C;  1NEB A;  2HSP A;  5CIU A;  4OGC A;  2DF6 A;  2Z0W A;  4M78 D;  2OTL Q;  3CPW A;  2H3J A;  4KH1 B;  4J9I A;  1U8R A;  1VQ5 Q;  3OYD A;  2QA4 Q;  1MMD A;  4WF2 A;  2V1Q A;  2WSC E;  1BB9 A;  2PVD B;  3CPF A;  5IH2 A;  2QYZ A;  4MZT A;  1WQW A;  1NJI U;  1K9M C;  2RB6 A;  2CT3 A;  2L89 A;  2ROT A;  1Y96 B;  1UFF A;  4JJD A;  2VAS A;  1N9S A;  2KXC A;  3JCM h;  4CC7 A;  4RCB A;  2AIR B;  2L0A A;  4A54 A;  1YWP A;  4KT0 E;  4M77 A;  1GBR A;  4HCZ A;  4E7J A;  3EH1 A;  2O4X B;  1QCF A;  2RM4 A;  5FRO A;  2M51 A;  2MWP A;  4C5I A;  2O01 E;  4O6J A;  4J9C A;  3U23 A;  2J05 A;  5KYX A;  2CUB A;  4XTY A;  3CBP A;  4PJM A;  4JS4 A;  3SWN B;  2X3W D;  1AOJ A;  2R58 A;  4KUL A;  4DEY A;  4RMO A;  1VQ9 Q;  1I8F A;  2P4R A;  1FWZ A;  1S72 A;  3NPF A;  1AD5 A;  5GAN 8;  2AZV A;  2PVG B;  4D8D A;  1JJ2 A;  2OTL T;  1RI0 A;  2L5Q A;  4ELZ C;  2QTX A;  5IHN A;  2ZPE B;  3S3N A;  3ZEH A;  3JCM J;  1RAG B;  2FZC B;  4J5Y A;  4MZM A;  1YJW T;  1VQ5 T;  1NZ9 A;  4M78 G;  3I55 A;  4FM4 B;  4M7A E;  2ESW A;  1VQ6 A;  4LDU A;  2E6Z A;  2E1H A;  3TSZ A;  4ZGD B;  1BI1 A;  5GJW B;  2DL4 A;  2R5A A;  2HKN A;  2QDY B;  4OB1 B;  2COZ A;  5LJ5 d;  1WLP B;  2DL7 A;  4EIK A;  2RH2 A;  5CAI A;  1LJO A;  4PJN A;  3L2V A;  2EQM A;  1UE9 A;  3P8H A;  2KYB A;  1GCQ C;  2KEA A;  1WHH A;  5IXF A;  3VUB A;  3HPW A;  3CC2 Q;  4FYV B;  1M4Z A;  1YJ9 A;  2W10 A;  2GNC A;  2DVE A;  2DJZ A;  2LCS A;  2QG9 B;  3LGL A;  2A7Y A;  1I1J A;  1IGU A;  2H3E B;  4ZGE B;  1X6G A;  4M7A F;  2XID A;  2LJ0 A;  5I22 A;  1QVF A;  1MMG A;  1MV3 A;  4LXC A;  1FMK A;  1KIK A;  2M0Y A;  4E7Z A;  2RK2 A;  2VWF A;  3VRY A;  4ANJ A;  1VQ9 T;  1QQJ A;  1VQL T;  3OW2 P;  4XU0 A;  2MK5 A;  1HSQ A;  3OS5 A;  1M5Q 1;  2CSQ A;  1MMA A;  2XDP A;  5KYY B;  4M78 E;  1QP2 A;  2DFU A;  4FCY A;  1VQK T;  4GLK A;  2KAF A;  4F7U B;  1WDX A;  2OX7 A;  2C0I A;  1D1C A;  1RAI B;  4OMN A;  1WHK A;  3CCJ Q;  2Y4Y A;  2XK0 A;  2FO0 A;  3KUF A;  1M1G A;  2DMO A;  4XK8 E;  1ABQ A;  4NL2 A;  5GMK l;  2O88 A;  2LMJ A;  2OTJ T;  2DXT A;  1KHI A;  3CCQ A;  5KYU A;  2EYW A;  1RLP C;  1VYU A;  2QQB A;  1KFZ A;  3G4S A;  1M2V B;  3CD6 A;  2FVU A;  3CCM T;  4UC4 A;  4M7A A;  2NYS A;  4N4G A;  4M7D C;  2C0T A;  4DQ2 A;  2HAX A;  3H6Z A;  3CC2 T;  1SHG A;  3CC4 Q;  2VV5 A;  1KD1 U;  1SSH A;  1OZ2 A;  4J6W A;  1M90 U;  1VQ4 Q;  3CXC P;  3OYH A;  3CXC S;  3EG2 A;  2V26 A;  2K6D A;  1K1Z A;  2F1L A;  3ULR B;  1OU9 A;  3FJ5 A;  3QJY A;  1GFD A;  3M55 A;  1G5V A;  3RMQ A;  1KC8 U;  1Q7Y U;  4QW2 A;  2LDM A;  5GMK e;  1AZE A;  5CK9 A;  2A37 A;  4IIM A;  4CC2 A;  3JRZ A;  3OYY A;  3S3M A;  1HJD A;  2JMC A;  4FT4 A;  4JPB W;  1AWW A;  4F14 A;  3MP8 A;  4MDW A;  4QQD A;  1VQ8 T;  1W2B S;  1M1K U;  3TVT A;  2HEQ A;  1VQ7 Q;  1YWO A;  5ECA A;  3VS3 A;  2IVW A;  3M0R A;  2JMA A;  2FPF A;  1Q82 C;  3MCA B;  4QVZ A;  2HNI A;  4OGE A;  3CCJ T;  1BKB A;  1IRE B;  3EFS A;  3OBW A;  4EMK C;  4IKF A;  3CCV Q;  5FRM A;  4FT2 A;  2LCC A;  2F69 A;  4MMK A;  3I56 T;  3CMA A;  4EMK B;  3CC7 T;  2K5I A;  4BI3 A;  4M78 A;  2EKH A;  1IHV A;  3QUI A;  3DB3 A;  2EQU A;  1BU1 A;  4IUV A;  5J39 A;  1J3T A;  4XTV A;  2G6F X;  5KYN A;  4J9F A;  2J7I A;  4BB7 A;  3A8H B;  4DBH A;  1Q81 R;  2G3R A;  4RTV A;  5AT1 B;  2EGA A;  2RHX A;  5GAN 6;  1WIE A;  2CGH A;  1YNZ A;  4C92 B;  3CC4 T;  1TG0 A;  4Z8A A;  1N6A A;  4AFS C;  1VQ4 T;  1WXT A;  1JU5 C;  1R0C B;  1IRX A;  5HCK A;  2GTJ A;  4PLI A;  2X4Y A;  1KQS A;  1QVG A;  4GLM A;  2AHJ B;  3CCE A;  3BDL A;  5GAM j;  2RQR A;  5GAM e;  2YRV A;  2KSS A;  1NLP C;  4KH0 B;  2DER A;  2HQX A;  2D9T A;  4II1 A;  1Y7X A;  3GPL A;  1UDL A;  3VS5 A;  4ORZ A;  4HCC A;  2O4X A;  1K73 C;  4RCC A;  1P92 A;  3LW5 E;  3N5B B;  2P84 A;  1JBM A;  4C0F A;  2DLP A;  2ECZ A;  4X9C A;  4FSS A;  4FSX A;  3S3O A;  1VQ7 T;  3L42 A;  1KG1 A;  2GCX A;  5J3B A;  1WJR A;  3G6E A;  2EYQ A;  2NUP B;  1I07 A;  4JZ3 A;  3L2Q A;  3CCV T;  2KGT A;  2X4W A;  2ZPI B;  2RMO A;  1E6G A;  4LDY A;  4XTU A;  1Q86 C;  3A5Z B;  2A08 A;  2DL5 A;  2IPO B;  2GTO A;  3OYK A;  1ZSZ C;  2JM9 A;  2VXE A;  4D6W A;  1RUW A;  1T3L A;  2FEI A;  3J81 E;  1M90 R;  1HD3 A;  3C4S A;  1FMV A;  1PM3 A;  4C0D C;  3QJ6 A;  1YIJ T;  1F1B B;  3SFM A;  4M7D E;  3INZ A;  2VKN A;  2L3Q A;  1H92 A;  2XMF A;  3OYJ A;  1X43 A;  4HCK A;  4J9G A;  1Z9Z A;  2XHC A;  4PLL A;  3M5A A;  4KUI A;  3EG0 A;  1H8K A;  1X2K A;  2K2M A;  5IAY A;  4E7H A;  4VUB A;  3QHS A;  1K8A R;  1JQQ A;  1GCQ A;  2DIL A;  2F5K A;  3OYM A;  2M1H A;  5D6X A;  4QKU A;  3I9Q A;  1BI3 A;  1FYN A;  1WQ7 A;  4J6Y A;  1PHT A;  5LL6 S;  5D6Y A;  4OP0 A;  2EGE A;  3G1J A;  2RQU A;  4BE0 A;  4Z02 A;  1IHW A;  2L3P A;  1RAA B;  2FG0 A;  3ASK A;  1Q82 U;  3V7S A;  1WHL A;  4HCB A;  3WXM B;  3HFN A;  4IUU A;  2RHZ A;  4M7D F;  1DJ7 B;  1QVP A;  2J06 A;  1BYM A;  2JW4 A;  1GRI A;  1A0N B;  1RLQ C;  1HXD A;  4C8Q B;  2AK5 A;  5KYY A;  4B6M A;  1I5O B;  2BE7 D;  2JT4 A;  2RO0 A;  4QVC A;  2KT8 A;  3EHR A;  3QXE B;  1W70 A;  3G71 Q;  1QWE A;  3M59 A;  4DA4 A;  4PL6 A;  4E7L A;  2FRY A;  1FX7 A;  1W4S A;  3RKY A;  3UAT A;  1VQP A;  2DET A;  3QWX X;  2RQT A;  1JO8 A;  2KQW A;  4NL3 A;  3JAM E;  4M7A D;  2QEX Q;  2JNG A;  3JCM V;  3V8J A;  3PVL A;  1GFC A;  4WCI A;  4GY5 A;  1M30 A;  3L2R A;  2JTF A;  3LYI A;  1YIT Q;  2CYZ B;  3C95 A;  4PJO C;  1N8R R;  3PTA A;  4M7D A;  4RTX A;  3PVQ A;  1WPY A;  3NHN A;  4E2F B;  3HSB A;  1WYX A;  4RTZ A;  1MUZ A;  1UEC A;  2L3S A;  1XNI A;  2COY A;  1BCM A;  1M27 C;  4XTW A;  5LJ5 e;  3O5Z A;  3X20 B;  2EWN A;  3CME A;  5HK3 A;  3VYG A;  2M0O A;  3X26 B;  2LVM A;  2K5F A;  2K5L A;  2O9V A;  3VV0 A;  5GMK m;  2KT1 A;  5CVI A;  2LTO A;  1AWJ A;  3EGD B;  2B86 A;  1Q86 U;  1WFW A;  3CQT A;  3OYB A;  2CH4 W;  3CCL T;  3CBM A;  1TTH B;  3OYG A;  4AG2 C;  3M56 A;  5LJ5 g;  3UDC A;  2OAW A;  1ACM B;  4OF1 A;  2MWO A;  3OS0 A;  2QQ9 A;  3PMT A;  3M58 A;  3G71 T;  2EYX A;  4AG1 C;  4FW2 A;  3QBY A;  5IXB A;  2DEQ A;  3JSC A;  4J8O A;  3WVE B;  5KYW A;  1Q81 C;  2P0P A;  4N0A C;  3CCS T;  4JDS A;  4X34 A;  3X24 B;  3QZ9 B;  3PE0 A;  2JXB A;  2LCL A;  1HYO A;  3SEM A;  5GAN f;  3GOX A;  1KK7 A;  3OW2 A;  2COW A;  4AMC A;  2K3Y A;  3RUX A;  4DBR A;  5LJ3 f;  4XTZ A;  2HKQ B;  1M8M A;  5IHI A;  1PRL C;  5CQY A;  4CI0 C;  3NMZ C;  1EZZ B;  4JJN K;  4M7A G;  3EAE A;  1ABO A;  1SSF A;  2KE9 A;  2QGG A;  3I35 A;  3EG3 A;  1KHC A;  2WSE E;  3TU4 K;  4JJB A;  1VQO A;  3NTI A;  2FRW A;  4J83 A;  5GAO l;  2P0K A;  4A4K A;  2XIC A;  1K76 A;  2RHI A;  3BDU A;  1WHJ A;  3EG9 B;  4L5G A;  3I55 Q;  2JS0 A;  3ZFJ A;  1VQ6 Q;  1GXI E;  3HP9 A;  2HBW A;  1VQN A;  1RAD B;  1OOT A;  3L2W A;  3EH2 A;  4X1V A;  2EGC A;  4E47 A;  3QYH B;  4HT9 A;  1JB0 E;  1B34 A;  2DK3 A;  3PIP A;  2QTV A;  3SWN C;  2DTH A;  2CP6 A;  5CKH A;  2NUP A;  3OYN A;  2CSI A;  3I5R A;  2QDL A;  2YUN A;  1UHF A;  2ZPG B;  3TSW A;  1YJW A;  2MOX A;  3SD4 A;  1PSE A;  1TUC A;  1UJ0 A;  2EBP A;  1OQK A;  1U5S A;  1PD1 A;  3JB9 H;  5GAN g;  3A8L B;  1QCO A;  2F2X A;  1YJN A;  2DRM A;  2PUK B;  5LJ3 g;  5GAO q;  2HL5 C;  4QQG A;  2QA4 T;  3QO3 A;  1YFN A;  2AKL A;  2YLB A;  5FLX E;  1ZSZ A;  3ZL7 C;  4JRI A;  1QP3 A;  1KJW A;  2ATC B;  3OYF A;  2D6F A;  3H8Z A;  5L8R E;  3M9Q A;  3OMC A;  1K4U S;  1GBQ A;  2AKK A;  3JCM f;  4XAX B;  4PJO E;  3EFO B;  4QQ6 A;  2LP5 A;  1UGS B;  4IUP A;  1GCP A;  5IN1 A;  4OMF B;  2CT4 A;  1NM7 A;  3AT1 B;  3VKI A;  3MHX A;  1IZ6 A;  3M57 A;  1I4K 1;  2JVV A;  4RTY A;  4RKU E;  5GMK h;  3I55 T;  1VQ6 T;  1LPL A;  3E1S A;  2PUO B;  2E6N A;  3QZ5 B;  4KGV B;  3E2U A;  3EGX A;  1VQ9 A;  1N5Z A;  4RTU A;  1VQL A;  2I2L A;  3CCQ Q;  1D0X A;  1V1C A;  2V1R A;  4J7I A;  2M16 A;  1T0H A;  3EGU A;  3G4S Q;  2NUZ A;  2RA2 A;  3CD6 Q;  2ED0 A;  1YI2 A;  2RJC A;  4M75 C;  2DBK A;  2FYK A;  4PJO F;  1VQK A;  1XQH A;  3BY7 A;  3OMG A;  2YUO A;  4M75 B;  4FL6 A;  1R8O B;  4CRI A;  5CKF A;  2IG0 A;  2X4J A;  1QW1 A;  5GAO p;  1NJI R;  3J7A F;  5D6W A;  2XD0 A;  4R56 A;  2HQH A;  2OTJ A;  2L8D A;  3Q1J A;  2YUQ A;  1ZLM A;  1K9M U;  2LQW A;  4F17 A;  4ZGJ B;  3PNW C;  3CPW S;  3FRN A;  5KE2 A;  4LDV A;  2NUT B;  3LH0 A;  2KRN A;  3CCM A;  2BZY A;  2GQI A;  1VIE A;  2KNB B;  3H0F A;  3ZBD A;  2P0Q A;  2QXF A;  3VS6 A;  2BE9 B;  2YSQ A;  2CZ0 B;  2H8H A;  3GBQ A;  1MV0 B;  5KH6 A;  4BD3 A;  4IUR A;  2FHD A;  2RJE A;  3LGF A;  4XU1 A;  5GAM h;  2DIQ A;  4M7D D;  3C0C A;  2O9S A;  5GAN d;  4BDZ A;  5GJV B;  5LJ3 d;  4RTT A;  4PJO A;  2K7A A;  3JB9 J;  2DKG A;  4QT7 A;  4O5V A;  2JN0 A;  3QKJ A;  1D09 B;  3CMA Q;  2K79 A;  1X69 A;  3CCQ T;  1QLY A;  5FU7 B;  3DLM A;  5GMK j;  2DM1 A;  8ATC B;  2PU9 B;  1R77 A;  1VQ8 A;  3GIB A;  1YBY A;  1QKX A;  1YHQ Q;  1VUB A;  2PTK A;  1I5L A;  5CKD A;  8AT1 B;  3L2Z A;  3EFR A;  2EQK A;  3MP6 A;  1WI7 A;  1W2B P;  1ZUK A;  1HK9 A;  1W6X A;  1G3Y A;  4A4F A;  1OZ3 A;  4MDX A;  3I56 A;  5FWC A;  3R6N A;  2CDT A;  3MEV A;  4D8K A;  5A0L A;  3CC7 A;  3CCE Q;  1UGQ B;  2VC8 A;  1JJ2 S;  1OU8 A;  4F7U G;  3NTK A;  4Q5W A;  2FL7 A;  3NTH A;  3URG A;  1TXQ A;  2OI3 A;  3REA B;  3MEW A;  2MYS A;  3A8O B;  4L59 A;  3L2U A;  3ME9 A;  2YWW A;  2JUF A;  1UG1 A;  2EYZ A;  3OYE A;  3JB9 G;  2EJF A;  3UA6 A;  1BI2 A;  4C92 C;  1MMN A;  3QPH A;  5FW9 A;  4B9W A;  1QKW A;  2CZ1 B;  3PFS A;  3M4G A;  4KBM B;  4Y28 E;  3JCM Q;  2EFI A;  5KE3 A;  2JZ2 A;  1IXD A;  5I2M A;  3G6E Q;  4V2S A;  1Y96 A;  4C5H A;  3MO8 A;  5FU6 C;  3WVD B;  1WNL A;  1NLO C;  4AFU C;  1ZA1 B;  4JRQ A;  4M7D G;  1PKT A;  2QI2 A;  2RPN A;  2KRO A;  1PRM C;  5FU6 B;  5CR2 A;  1U1T A;  1AEY A;  4JZ4 A;  2KK4 A;  2LQK A;  2E10 A;  3JCM d;  4HA8 A;  1NPR A;  1O9S A;  4A53 A;  3EG9 A;  3OYL A;  3CEY A;  1CKA A;  2L3R A;  3UWN A;  5GAN 3;  3S6W A;  1VQ7 A;  1QVF P;  1YHQ T;  2VXF A;  2HMA A;  4B9X A;  3D7S B;  1VQM A;  1QVF S;  1QWF A;  3CCU A;  1B7T A;  2J6F A;  2OAU A;  1OEB A;  4M77 C;  1NBE B;  4R0K A;  3RDV A;  4XU3 A;  3CCR A;  4F7U E;  2DPP B;  4M77 B;  1UTI A;  1RAH B;  3SWN A;  2EKO A;  1C0M A;  2LQ8 A;  1G83 A;  3DB4 A;  4ZTJ A;  4J9D A;  2QAS A;  2HQE A;  3MP1 A;  4C0G A;  4C5G A;  4ATO A;  1YIJ A;  1NYF A;  2CUD A;  5KCH A;  1E7O A;  5GAO m;  3JV3 A;  2AZS A;  2YXY A;  3FEO A;  1KD1 R;  4FIB A;  3QG1 A;  2EVR A;  5HK0 A;  4JS5 A;  2ROL A;  1EX4 A;  1V29 B;  2RD1 A;  5GAN 5;  1RL2 A;  4FYW B;  3G6E T;  1Y07 A;  2F2W A;  3EFO A;  4M75 F;  4C92 G;  1SF9 A;  3PT9 A;  4JUV A;  1KC8 R;  2E12 A;  1JXO A;  2B8A A;  2GF7 A;  5DLQ E;  1Q7Y R;  4TVR A;  2KI7 A;  1S1N A;  3QYG B;  4A4G A;  3OB9 A;  5LJ5 h;  4E6R A;  1CSK A;  4F7U F;  2BZ8 A;  1MND A;  3OSS C;  2X9H A;  3A1P A;  5FWB A;  2DL8 A;  2JTM A;  1OYX A;  2ZPH B;  4IUQ A;  1ZHI A;  3JB9 F;  2CH4 A;  4DOV A;  1M1K R;  2C0O A;  4BE1 A;  3OS2 A;  4QVD A;  2YLC A;  3GNG A;  4Z88 A;  4DBQ A;  3H41 A;  1VQP Q;  2DZC A;  5I2S A;  1PG5 B;  3FLG A;  2RN8 A;  1BCO A;  1NJI C;  2JM8 A;  4E7S A;  2ZPB B;  4L6V 5;  1VOM A;  4OVA A;  1PWT A;  1PNJ A;  3M0U A;  4C8Q C;  4N4I A;  5FRN A;  4HKE A;  1TSF A;  1LCK A;  1UHC A;  1UUE A;  3BW1 A;  4MML A;  3FJP A;  2NLU A;  3PIO A;  2ENM A;  3AHU A;  4F7U A;  2DA9 A;  2RI5 A;  2O31 A;  3CME Q;  1X6B A;  3M0Q A;  1H3Z A;  4A4E A;  4C92 E;  1Y57 A;  3RKX A;  2CKK A;  2BTT A;  2VVK A;  4EMG A;  4RG8 A;  3M4Y A;  1M2V A;  5I21 A;  2ABL A;  2X51 A;  2QQS A;  1MNE A;  4LN2 A;  2KMT A;  4XTX A;  2X4X A;  1VYV A;  2X35 A;  4PJJ A;  2K9G A;  5GAO n;  1KQS P;  4XU2 A;  2E4H A;  1SRL A;  2DAQ A;  3ER0 A;  2FPE A;  1LVK A;  2MMP A;  1KQS S;  1QVG S;  4PJO D;  2HCK A;  1K9A A;  5A0D A;  1K73 U;  5KYU B;  1UGP B;  2KY9 A;  2DVJ A;  2XDB A;  4ZN3 A;  5LJ5 j;  1X6O A;  3MEA A;  3O8V A;  3GLX A;  5CCA A;  1VQP T;  4HT8 A;  1ZUY A;  4M7A B;  5LJ3 h;  2IIM A;  4K11 A;  4KGX B;  4ESR A;  2CP3 A;  3G7Z A;  3CCL A;  1YCS B;  1EFN A;  4HVW A;  1VIF A;  1G2B A;  2EJ9 A;  4C92 F;  2D0Q B;  2SRC A;  4LUD A;  4RTW A;  1OX8 A;  3E19 A;  4OMP A;  1G3W A;  1TU0 B;  1M8V A;  1WHG A;  2W0Z A;  1U3O A;  1VA7 A;  5GAN 2;  1TUD A;  3OY9 A;  2ZCF B;  3J80 E;  1RAF B;  3OYA A;  1RAC B;  3IQL A;  3QII A;  3CCS A;  1I0C A;  3V7R A;  1VQO Q;  1BK2 A;  2KVQ G;  3OQ5 A;  3REB B;  3CME T; 
#chains in the Genus database with same CATH homology
 3TVT A;  2HEQ A;  1YWO A;  5ECA A;  3VS3 A;  4RTY A;  3M0R A;  2JMA A;  2FPF A;  4ZNX A;  3M0P A;  4CC3 A;  4J9E A;  1WXB A;  1KSW A;  1VYT A;  2DJQ A;  1N5Z A;  4RTU A;  3EHQ A;  1NG2 A;  1V1C A;  1IO6 A;  4OMQ A;  2EKH A;  2F2V A;  2V1R A;  2D1X A;  1BU1 A;  1ZUU A;  2CRE A;  1Z9Q A;  2LZ6 B;  1T0H A;  3EGU A;  1J3T A;  2NUZ A;  2G6F X;  4J9F A;  1JXM A;  2PNI A;  2J7I A;  2ED0 A;  4HVV A;  4AFZ C;  3VS0 A;  2DBK A;  4RTV A;  2EGA A;  1WIE A;  1YNZ A;  1TG0 A;  2YUO A;  4Z8A A;  3M0T A;  4AFS C;  4OMO A;  2YT6 A;  2GGR A;  1T3S A;  1WXT A;  1JU5 C;  1M3B A;  1PKS A;  4J9B A;  5HCK A;  2GTJ A;  2JS2 A;  1WX6 A;  4GLM A;  2YUQ A;  1H3H A;  1ZLM A;  3VS2 A;  2LQW A;  4F17 A;  2RQR A;  1NLP C;  1WA7 A;  2RF0 A;  2LJ3 A;  1T0J A;  2DRK A;  2I0N A;  1AWX A;  2D8J A;  2MIO A;  5L23 A;  2KRN A;  2BZY A;  2GQI A;  2KNB B;  1E6H A;  1UDL A;  2K3B A;  3H0F A;  1M3C A;  1B07 A;  3VS5 A;  4ORZ A;  3VS1 A;  3A98 A;  4J9H A;  3VS6 A;  2YSQ A;  2H8H A;  3GBQ A;  1MV0 B;  1ZX6 A;  2DLP A;  2OJ2 A;  2ECZ A;  1YN8 A;  4FSS A;  3C0C A;  4KRT A;  2O9S A;  1SHF A;  3NGP A;  5GJV B;  1JEG A;  4RTT A;  2NWM A;  1ZBJ A;  2K7A A;  4HXJ A;  1I07 A;  2KYM A;  4JZ3 A;  1X2Q A;  2KGT A;  2RMO A;  1E6G A;  4QT7 A;  2L2P A;  4OMM A;  3I5S A;  4AFQ C;  4LE9 A;  2EQI A;  2ED1 A;  1K0X A;  1NEG A;  2K79 A;  2A08 A;  2DL5 A;  1X69 A;  2E5K A;  1QLY A;  2GTO A;  1CKB A;  2EW3 A;  3UA7 A;  2JM9 A;  2DM1 A;  1RUW A;  1T3L A;  2FEI A;  1M3A A;  1HD3 A;  1QKX A;  3KFV A;  1SRM A;  2PTK A;  3EG1 A;  3RBB B;  2VKN A;  2L3Q A;  1H92 A;  4LUE A;  2XMF A;  1W1F A;  1WI7 A;  1X43 A;  1ZUK A;  4HCK A;  4J9G A;  1Z9Z A;  1W6X A;  2BZX A;  3EG0 A;  1H8K A;  2KRM A;  1X2K A;  3RNJ A;  2A36 A;  5FWC A;  2LNH B;  3R6N A;  2CDT A;  4D8K A;  1SPK A;  2K2M A;  1K0S A;  2D0N A;  1JQQ A;  1GCQ A;  2DIL A;  2DYB A;  4IIO A;  2DX1 A;  1WXU A;  2OI3 A;  3REA B;  1ARK A;  2KXD A;  3I9Q A;  1FYN A;  3VS7 A;  2KR3 A;  2HDA A;  1NEB A;  1AVZ C;  2HSP A;  1UG1 A;  2EYZ A;  4F16 A;  1PHT A;  2DF6 A;  2YUP A;  3UA6 A;  2EGE A;  2RQU A;  1YP5 A;  2L3P A;  4J9I A;  2FG0 A;  5FW9 A;  1QKW A;  2FPD A;  2X3X D;  2V1Q A;  1Y0M A;  1BB9 A;  5IH2 A;  1NLO C;  4AFU C;  2J06 A;  1PKT A;  2RPN A;  2CT3 A;  2JW4 A;  2KRO A;  1PRM C;  2YDL A;  4OML A;  2ROT A;  1GRI A;  1A0N B;  1AEY A;  3UF4 A;  1RLQ C;  4JZ4 A;  2AK5 A;  1UFF A;  4JJD A;  2JT4 A;  2KXC A;  1OV3 A;  2KT8 A;  3EHR A;  4CC7 A;  5EC7 A;  1W70 A;  1CKA A;  2L0A A;  1QWE A;  1YWP A;  4RUG A;  2FRY A;  4A63 B;  1QWF A;  2J6F A;  3UAT A;  1GBR A;  1B3Q A;  2LJ1 A;  1AWO A;  1OEB A;  3QWX X;  2RQT A;  1JO8 A;  4R0K A;  1QCF A;  4M4Z A;  2M51 A;  3PVL A;  1GFC A;  1UTI A;  4WCI A;  4J9C A;  3U23 A;  1M30 A;  2J05 A;  1BBZ A;  4HVU A;  2CUB A;  4JJC A;  4GBQ A;  1G83 A;  4J9D A;  2KBT A;  4RTX A;  3PVQ A;  2J6K A;  3SHW A;  2X3W D;  3H0H A;  3NHN A;  1NYF A;  1AOJ A;  2CUD A;  1E7O A;  1WYX A;  3QWY A;  1UJY A;  4RTZ A;  4DEY A;  2P4R A;  3M0S A;  1MUZ A;  1UEC A;  1AD5 A;  2DBM A;  2L3S A;  2AZS A;  2AZV A;  3JV3 A;  3NPF A;  1M27 C;  4D8D A;  2SEM A;  1AZG B;  3O5Z A;  2EVR A;  2ROL A;  5IHN A;  1U06 A;  2O9V A;  5I11 A;  2KT1 A;  2ESW A;  2DNU A;  4LNP A;  2F2W A;  1AWJ A;  3TSZ A;  5GJW B;  2PZ1 A;  2B86 A;  2DL4 A;  1WFW A;  3CQT A;  1JXO A;  2CH4 W;  1S1N A;  1WLP B;  2DL7 A;  2LQN A;  4EIK A;  4E6R A;  1CSK A;  4AG2 C;  2OAW A;  2BZ8 A;  2JTE A;  1UE9 A;  4Y92 A;  2KYB A;  5FWB A;  2DL8 A;  1GCQ C;  2EYX A;  2KEA A;  4AG1 C;  5IXF A;  5IXB A;  2CH4 A;  2C0O A;  2A28 A;  2W10 A;  2GNC A;  4Z88 A;  3H41 A;  3PE0 A;  2JXB A;  2LCS A;  3SEM A;  3THK A;  1I1J A;  2RN8 A;  1X27 A;  2JM8 A;  2RQV A;  1M8M A;  5IHI A;  1PRL C;  1PWT A;  1PNJ A;  3M0U A;  1X6G A;  2RNA A;  3NMZ C;  2LJ0 A;  5I22 A;  1MV3 A;  1ABO A;  1FMK A;  1KIK A;  2MCN A;  2KE9 A;  4Z89 A;  2M0Y A;  1LCK A;  2VWF A;  3VRY A;  1UHC A;  1UUE A;  3I35 A;  3EG3 A;  4JJB A;  1HSQ A;  2RQW A;  2CSQ A;  2ENM A;  2FRW A;  2DA9 A;  4CC4 B;  2O31 A;  1X6B A;  3M0Q A;  1K76 A;  3VRZ A;  1Y57 A;  2D8H A;  2BTT A;  1WDX A;  2J6O A;  2C0I A;  2VVK A;  2JS0 A;  2O2O A;  4OMN A;  1OPK A;  2HBW A;  2FO0 A;  1OOT A;  2DMO A;  4X1V A;  2ABL A;  1ABQ A;  2O88 A;  2EGC A;  2LMJ A;  4LN2 A;  3LH5 A;  2DL3 A;  3H0I A;  2LX7 A;  2EYW A;  1VYV A;  1RLP C;  1VYU A;  2K9G A;  1SRL A;  1KFZ A;  2FPE A;  5IHK A;  1XOV A;  2KRS A;  2HCK A;  1K9A A;  1NYG A;  2CSI A;  1SEM A;  3I5R A;  2QDL A;  2YUN A;  1UHF A;  3TSW A;  2C0T A;  2EYY A;  2DVJ A;  2MOX A;  2DE0 X;  1SHG A;  1TUC A;  1UJ0 A;  1GL5 A;  1SSH A;  2EBP A;  1U5S A;  1ZUY A;  2IIM A;  4K11 A;  1UGV A;  2F2X A;  3EG2 A;  2EPD A;  4ESR A;  2DRM A;  2K6D A;  1K1Z A;  1YCS B;  1EFN A;  4HVW A;  3VS4 A;  3ULR B;  3FJ5 A;  1G2B A;  2AKL A;  1RI9 A;  4DEX A;  1GFD A;  1OPL A;  2SRC A;  3ZL7 C;  4LUD A;  4RTW A;  2GBQ A;  1KJW A;  4OMP A;  1K4U S;  1GBQ A;  2AKK A;  2W0Z A;  1U3O A;  1AZE A;  1VA7 A;  2A37 A;  4IIM A;  1TUD A;  4CC2 A;  1ZSG A;  3IQL A;  1I0C A;  1HJD A;  2JMC A;  2LP5 A;  1GCP A;  4JPB W;  1BK2 A;  3REB B;  1AWW A;  4F14 A;  2CT4 A;  1NM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...