2L0AA

Solution nmr structure of signal transducing adapter molecule 1 stam-1 from homo sapiens, northeast structural genomics consortium target hr4479e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
MGHHHHHHSHMNHQHEARKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transducing adapter molecule 1
publication title Northeast Structural Genomics Consortium Target HR4479E
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l0aA00
1K1ZA 2W10A 4CC4B 1ARKA 3H0IA 1MV3A 1PRLC 1BBZA 2ED1A 1JEGA 2LNHB 2J06A 4OMMA 1UJYA 2LJ3A 3EHQA 2ENMA 3H0HA 1K0SA 1UFFA 3PVQA 4RTZA 1AZGB 2YSQA 4J9HA 2DBMA 2FPDA 5IHNA 4LNPA 1MUZA 3VS0A 1XOVA 3FJ5A 2J6OA 2LQNA 4JPBW 2D0NA 3EHRA 3REBB 4D8DA 2JS0A 2ECZA 2JT4A 5L23A 2DNUA 2KYBA 4HVVA 2GGRA 4J9CA 4OMLA 2SRCA 2L3SA 2AK5A 4JJDA 1X43A 3TSWA 1YP5A 1GCQA 2YT6A 4JJCA 2KEAA 3IQLA 3GBQA 1B07A 4OMQA 2KRMA 4OMOA 5I22A 1RLQC 3EGUA 2DVJA 2DL5A 1X27A 2EGEA 2FPEA 3UF4A 2DL4A 2ABLA 3VS2A 4RTUA 2LJ1A 1U3OA 1I07A 1Z9QA 5I11A 4AFZC 1AD5A 1WXBA 2BTTA 1OEBA 1W70A 1T0HA 5FW9A 4ZNXA 1AWXA 2CDTA 2LQWA 3EG1A 2DE0X 1OPLA 2JTEA 2GTJA 2RNAA 4J9EA 1ZUUA 4CC2A 1GL5A 1KSWA 1JXOA 1K9AA 4AFSC 2DJQA 2J6KA 1QLYA 3NHNA 2O2OA 1WIEA 3C0CA 3UATA 3NGPA 5IXFA 2EBPA 1M27C 2V1QA 1WA7A 2DRKA 2X3XD 2K6DA 2IIMA 2AZVA 1CKBA 4AFUC 4E6RA 2RMOA 3NMZC 2EYWA 1LCKA 1JQQA 2ESWA 1H3HA 4HVUA 1MV0B 1NYFA 1NYGA 3VS1A 4RTYA 3M0PA 2VKNA 3U23A 2KRNA 3VS3A 5FWBA 2VVKA 1UE9A 2ROTA 5HCKA 4DEXA 4ESRA 4OMPA 2PTKA 2LMJA 2KT8A 1AWOA 1E6GA 3SHWA 1RLPC 2YUNA 2O88A 1K4US 2K3BA 4J9FA 3TVTA 2DA9A 2GNCA 1E7OA 3PVLA 2J05A 2O31A 2EW3A 1M3CA 1NM7A 2KRSA 2V1RA 1B3QA 1ABOA 1T3LA 2GBQA 3I35A 2EGAA 1N5ZA 3VS5A 2L3QA 1GBRA 2FRYA 1H8KA 2GQIA 1NLOC 1H92A 1X6GA 1NEBA 1PHTA 2JMCA 1AWJA 1PNJA 2MCNA 1QWEA 3RNJA 2K9GA 4GBQA 1HD3A 1UECA 1M3BA 2CH4A 3M0TA 2C0IA 2AKKA 1W6XA 2JM9A 4AG1C 1AOJA 1AWWA 3VS6A 3CQTA 2L0AA 2RQRA 2F2VA 4HCKA 2PZ1A 1ABQA 3O5ZA 4J9DA 3RBBB 2XMFA 1YWPA 4F14A 4LUEA 2BZXA 2CREA 1VA7A 2D8JA 4JZ4A 1UHFA 2KYMA 4IIOA 1GRIA 1T3SA 1JU5C 3PE0A 5IXBA 1WI7A 1PKSA 3VRYA 3SEMA 1QWFA 4CC7A 2F2XA 1X2QA 2NUZA 4J9GA 2DBKA 2A36A 2BZ8A 4JJBA 1Y57A 4HVWA 1UDLA 2JMAA 3EG0A 3H0FA 4JZ3A 2G6FX 1ZSGA 2FO0A 4Z89A 1NEGA 4F17A 4Y92A 1HSQA 2DMOA 4LN2A 1KJWA 2B86A 1CSKA 1EFNA 1YCSB 1WXUA 2JM8A 2YDLA 2W0ZA 3M0RA 1V1CA 2HSPA 3QWYA 2YUOA 1OOTA 2LCSA 2K2MA 4GLMA 2M0YA 2DL7A 3NPFA 1YN8A 5GJVB 2EYZA 4M4ZA 1BB9A 2RN8A 2ED0A 3R6NA 2DYBA 1M8MA 4RTWA 1UHCA 2EKHA 2CH4W 2QDLA 1S1NA 5FWCA 1TUDA 2KROA 2ROLA 1Z9ZA 4OMNA 3THKA 2PNIA 3ZL7C 4WCIA 1UTIA 2KXCA 1VYVA 1VYUA 2BZYA 1K0XA 4ORZA 2JXBA 2DF6A 3REAB 2J6FA 4RTVA 2YUQA 1X6BA 3VS4A 1M30A 2X3WD 4AG2C 2YUPA 1ZBJA 1ZUYA 2RQUA 4Z88A 1AEYA 2C0TA 1QCFA 3I5SA 2EQIA 1GFCA 3JV3A 5EC7A 4CC3A 1WFWA 2HBWA 3VRZA 3KFVA 2MOXA 2LZ6B 1FYNA 2K79A 2KBTA 4IIMA 2EPDA 1SRLA 2M51A 1GCQC 1RI9A 3M0UA 1ZLMA 2E5KA 1AZEA 4RTXA 1U06A 1E6HA 2KE9A 2LP5A 3H41A 4R0KA 1SRMA 2J7IA 1YWOA 2JS2A 3ULRB 2JW4A 4FSSA 1KIKA 3UA7A 2A08A 1GFDA 2O9SA 4A63B 2EGCA 2KR3A 2RQTA 2HDAA 1JO8A 3A98A 1NLPC 1SHFA 2I0NA 4QT7A 2L2PA 4AFQC 1W1FA 4RUGA 1PRMC 2F2WA 2KXDA 2OI3A 1TG0A 1OV3A 4EIKA 3UA6A 2FG0A 1HJDA 2HEQA 5ECAA 2RPNA 1GCPA 2CSIA 1KFZA 1Y0MA 1WX6A 2DL8A 2D8HA 2KT1A 4F16A 2L3PA 2LJ0A 2EVRA 2C0OA 1M3AA 2NWMA 1U5SA 1X2KA 1UG1A 3EG3A 4RTTA 2CT3A 5IHKA 1SEMA 2FRWA 4J9IA 1A0NB 5IHIA 1UGVA 4D8KA 1QKWA 2HCKA 2KGTA 2GTOA 1X69A 4LUDA 1SPKA 1NG2A 2OAWA 4KRTA 3VS7A 1FMKA 1BU1A 1RUWA 3I5RA 1GBQA 1UJ0A 3TSZA 2FPFA 1K76A 2RQVA 1TUCA 1WDXA 2DLPA 2AZSA 2D1XA 4K11A 3EG2A 1QKXA 1UUEA 4DEYA 2LX7A 2AKLA 1PKTA 2OJ2A 4Z8AA 1JXMA 3I9QA 2K7AA 1J3TA 1AVZC 1IO6A 1SSHA 4LE9A 2SEMA 4X1VA 1I0CA 1I1JA 2CT4A 2DX1A 2KNBB 2CSQA 5GJWB 2FEIA 1OPKA 1ZUKA 2H8HA 1WLPB 3M0QA 2RF0A 4J9BA 2DILA 1VYTA 1BK2A 1T0JA 3M0SA 2A28A 1SHGA 2A37A 2CUBA 1G2BA 1G83A 1CKAA 4HXJA 1WYXA 2DRMA 3LH5A 2CUDA 1YNZA 2EYXA 5IH2A 1PWTA 2MIOA 1ZX6A 1WXTA 2EYYA 3QWXX 2VWFA 2DM1A 2O9VA 2DL3A 2P4RA 2RQWA
chains in the Genus database with same CATH superfamily
2V8JA 2QTVA 4FYVB 3BY7A 4FT4A 3JCMe 4QVDA 2RHZA 2K5LA 2E1HA 1K0SA 4PLIA 5LL6S 1AZGB 3CCSQ 2HQHA 4J9HA 4DBFA 3OY9A 1BCOA 5IHNA 5GMKm 2DFUA 1XOVA 2YRCA 1VQLQ 1VQ6A 2LQNA 1BIBA 3H8ZA 2QQBA 2YXYA 3CMET 3A1PA 1R8OB 3CPFA 2OTJA 2XIDA 3CC2T 3PMTA 2Y90A 5L23A 2KYBA 2CP0A 2RJDA 2EIFA 1KHIA 3R6OA 1X43A 2RI3A 4PJOB 4M75B 1I8FA 4HKEA 1VQNT 3RMSA 2CS7A 2YT6A 4JJCA 5LJ5d 2KEAA 1VQ4A 5FRMA 3EGUA 2DVJA 3RUXA 1X27A 3UF4A 1IRXA 2ABLA 2I2LA 2NUTB 4BE0A 1LOJA 2LJ1A 3NFCA 2E64A 1Z9QA 3CCEQ 1N9SA 3G71A 2EJGA 1D0XA 3CPWP 1YJNT 1OX8A 1RAIB 2E5QA 3G4ST 2KSSA 2LQWA 4XU0A 2BKDN 2CP5A 4C92C 3G6EA 2RNAA 3BFMA 4HCCA 3M54A 3OS2A 1WIEA 3UATA 4C0ZA 1AT1B 3NGPA 1VQPQ 1KQSP 3FEOA 2ZPFB 2HQXA 1K8AU 1NZ9A 3QO3A 5AYFA 4M77F 4E6RA 2K5FA 1VQMT 3VUBA 4ELZC 1W2BA 2EYWA 3I56Q 4QW2A 2DERA 3M57A 1KQ2A 4LD6A 4OB2B 1NYGA 3CPWS 3M0PA 3CCLQ 1ZQ1A 3U23A 1HK9A 2OX7A 3AHUA 2DD4A 1ZSZB 4RKUE 3X28B 4B6MA 4M77E 1UE9A 4M77A 2ROTA 4O6JA 5C6SA 3CCST 1KC8C 1AWOA 1RAAB 1RLPC 4PFPA 2L89A 1K4US 1OYXA 4XK8E 4J9FA 1KQSS 1E7OA 4FYYB 2E10A 2O31A 4NOYA 4F7UB 4M7AA 3QZ9B 1BI1A 2KRSA 2V1RA 2X4XA 4ZN1A 2VXFA 3OQ5A 3JCMX 2VGNA 1WHHA 1Q95G 3WVDB 3EFOB 3VS5A 1RADB 4JUVA 2OTLQ 1H8KA 2XDDA 3JB9J 1QP3A 2EAYA 2L5QA 3HP9A 5GAOq 1PNJA 4LDVA 2COWA 4GBQA 2DZ9A 2CZ1B 3CMAT 2RHUA 3CCET 1EZZB 2AKKA 2DTIA 1YITA 4BY6C 1AOJA 3LW5E 1LNXA 2BE7D 3I55T 2D0QB 4FSXA 1YWPA 4F14A 5KCHA 2R57A 2CREA 3LYIA 4PJOD 4M75D 4R55A 4IUTA 1N8RU 3UT1A 3HHTB 3FLGA 1HYOA 5IXBA 4PJOF 3HRUA 4M75F 4N0AA 4LD9K 1VQPT 1WI7A 1VQ6T 2DXTA 4MZMA 5LJ5g 3DKMA 1RL2A 2NUZA 2PVGB 1OULA 3KXTA 1QVFS 2QEXQ 1M9SA 2BZ8A 4C8QB 4HVWA 4JZ3A 5I2MA 3GPLA 2RHIA 2GFAA 3OYGA 3FIFA 2P0PA 4PJOE 4M75E 4F17A 4CI0C 1WXUA 2JM8A 4JJNK 1SG5A 1K9MC 1KD1U 5GMKl 2NUTA 3M0RA 1V1CA 3QWYA 3CCVT 2K2MA 4GLMA 1YN8A 5GJVB 1YCYA 2MF2A 4QVZA 2RN8A 2D9TA 4TVRA 2DYBA 4RTWA 4M78A 2E41A 3CC7A 2MI6A 1PD1A 1UHCA 2DIQA 2XKOC 1G3SA 5FWCA 2DXUA 1M1KU 2DK3A 4C5EA 1S72T 1Z9ZA 4JDSA 2P0QA 4BI4A 4WCIA 2QK0A 3ER0A 2F69A 2DF6A 3REAB 2J6FA 4PKCC 4BUGA 4C5HA 1VQ9Q 2ZPEB 2COZA 4B9WA 2RI5A 5L8RE 2RQUA 2BIVA 4M7DG 3QBYA 1U1SA 2ZPGB 1UB4A 3HFOA 1VQ8A 4KGXB 5KYUA 3SD4A 2RA2A 5GAMh 4J6WA 1QVPA 4IIMA 1SRLA 3JCMJ 4KH1B 1AZEA 1RAFB 3HTRA 4F7UF 1YJWA 1YI2A 2B8AA 3H41A 4J6XA 2J7IA 4A4HA 2VC8A 4JRKA 4JS4A 1M2OA 3CCMT 5GMKj 2XU8A 1JO8A 4OF1A 5KYXB 2YHTA 5I21A 1W1FA 2LQ8A 4EIKA 5J26A 1M90U 1KC8U 3EFOA 3OBWA 3OYFA 3JB9I 4OB3B 1PSEA 1VOMA 4M78G 3H6ZA 1XJWB 5FROA 4F16A 3GF5A 2C0OA 1X2KA 3EG3A 1SEMA 4BB7A 4MMLA 4D8KA 1QKWA 2KGTA 3MEAA 3CCRA 4XTXA 3URGA 1VQ7A 2LT1A 2XK0A 4KRTA 5GANh 4ATOA 4E7ZA 3TSZA 4J7IA 3X20B 1TWBA 3CCJQ 3T9NA 1UUEA 4C8QF 4M77C 1PKTA 2OJ2A 3RKWA 5CQYA 4XU3A 3SWNC 1J3TA 1SSHA 4PJMA 3RR6A 1M8VA 2O4XB 2DJZA 3UDCA 2QTXA 1ZUKA 2KK4A 3CCQT 5GMKe 4BD3A 5LJ3h 2DILA 4M7AC 1BK2A 2AHJB 2A28A 3INZA 4LDUA 4C8QE 4C8QA 1OX9A 2ZCFB 1QVGS 2E3IA 3LH5A 1VQOQ 1UGSB 1PWTA 1UGPB 1QVGA 1JBMA 1YHQT 2VWFA 2O9VA 3JB9G 2DL3A 1K1ZA 1QMCA 2W10A 7AT1B 3JCMW 4B9XA 3DLLA 2GQVA 1PRLC 1BBZA 4E7IA 3J80E 1K73R 4KT0E 3MPUB 1N8RR 1RAGB 2ZPBB 4X9DA 3M5AA 1OZ2A 2JNGA 3VS0A 4EDUA 3NTHA 4PLLA 4JPBW 1TH7A 2XG8D 1WQWA 2K3YA 2JS0A 2ECZA 1NE8A 2DNUA 3DLMA 2EJFA 2MMPA 4HVVA 4J9CA 4OMLA 2JTMA 3SDZA 2L3SA 4JJDA 5FLXE 2DD5A 3CMEQ 1KD1R 3WVEB 3IQLA 4C92G 1OI1A 2EFIA 2KRMA 5I22A 4BE1A 2DL5A 2FPEA 2DL4A 1U8RA 3NTIA 3DB3A 4LXCA 1VQNQ 1AD5A 2BTTA 2VASA 2IVWA 1TSFA 3EFRA 3CCJT 4ZGJB 2DTOA 4OB0B 2XHCA 3CD6A 3CXCP 3RIRA 2RJFA 5FW9A 1D09B 2F1LA 3OW2A 3MEWA 3LWHA 4E7KA 2JTEA 2QXFA 2GTJA 3SB2A 1GL5A 3NHNA 5CVIA 4M78C 3OYNA 1YJNQ 2JVVA 1YJ9A 2FB7A 2V1QA 2XDBA 4KULA 4VUBA 5KYXA 2CGHA 5FU6C 1SKUB 2AZVA 1CKBA 1D3BA 3QKJA 3P8BB 4AFUC 4IKFA 1JJ2P 2HSEB 2ATCB 1LCKA 1H3HA 1WJQA 4RTYA 3JCMc 2VKNA 5KYWB 2KRNA 1VQMQ 5I2SA 5KH6A 5GAN4 1WZOA 1B34A 3VJPA 2KT8A 1D0ZA 1LJOA 1E6GA 2RJEA 2O88A 2YUNA 3FDRA 3QIIA 1JB0E 2F5KA 3TVTA 3CC4T 2X4YA 3RESA 2EW3A 1M3CA 1MHNA 2X9HA 1M90R 1T3LA 1KC8R 2AIRB 2ZPHB 1JJ2S 3I35A 3VYGA 2BUDA 1QCNA 2L3QA 1GBRA 1HXDA 3EFSA 1VIEA 4M7DB 1X6GA 3HSBA 2H3JA 4OB1B 3E9GA 2JMCA 3OYIA 3L2UA 4JLIA 4V2SA 4C5GA 3J81E 2CZ7B 1F1BB 1M3BA 2CH4A 3M0TA 2C0IA 2KQWA 1W6XA 2JM9A 2FVUA 3TQ7P 3CQTA 3CEYA 3QHSA 3O5ZA 1WJSA 1Q82U 2QASA 3QYHB 3CMAQ 2D8JA 4PJLA 1T3SA 3HPWA 1JU5C 4E47A 3CCLA 2K2VA 1PKSA 2E6NA 3I55Q 2YLCA 2A0FB 2QDYB 3PNWC 4XTUA 5CR2A 5GAOr 5LJ5j 3E19A 4J9GA 1G8XA 2FL7A 2DBKA 2A36A 3F70A 5IT9E 3L42A 2ZZDA 1YIJT 3H0FA 2K3XA 2HNIA 2ZGWA 2NUPA 8ATCB 4WTOB 1BI2A 3V8LA 2G6FX 2FHDA 5CKDA 1VQ6Q 4XU2A 2HL3A 1ZSGA 2Y4XA 1NEGA 3M4GA 1HSQA 4LN2A 2X4WA 1CSKA 2OTJQ 1YCSB 1KHCA 3JAME 4C0DB 1YBYA 1IXDA 3OS0A 5GAMd 3TEEA 5DLOA 2LNVA 1WHKA 1TUGB 2OTLA 3JCMh 3QDFA 4E7SA 4DQ2A 4IUPA 3JRZA 2ZAEA 3R6NA 4A54A 4EMKB 2RO0A 2JN0A 1M8MA 4JRIA 9ATCB 2Z0WA 3HL8A 3CPWA 3CD6T 3RDVA 2LRQA 4BI3A 2DEUA 2M02A 3A8MB 4A53A 5HK0A 3MEVA 2EWNA 2KROA 4PK4A 3CCVQ 4OMNA 2NLUA 3OYLA 5LJ5f 2E4HA 2PNIA 3N5BB 1Y7XA 1VYVA 1MMDA 1K0XA 4RTVA 1FWZA 3MCAB 1M2VB 4L59A 4IUVA 1YJ9T 2X3WD 4AG2C 2YUPA 3ZEHA 1KQSA 4Z88A 1Y96B 1S72Q 2JOYA 1QCFA 1BI3A 3I5SA 5LJ5e 1GFCA 3JV3A 1IZ6A 3EGDB 5EC7A 1WFWA 2LCLA 4MZPA 2MOXA 2LZ6B 1VQ5A 1WQ7A 2M51A 2RJCA 1RI9A 3GOXA 3M0UA 3MHXA 1ZLMA 2QEXA 4C0GA 2RHYA 1E6HA 1UGQB 2RK1A 1SRMA 4YTLA 3CCUT 1YWOA 4M7DD 2KAFA 4MDXA 2L3RA 5GANd 5GAN8 1C0MA 2LX9A 4ZGEB 4M7DF 4A63B 2EGCA 2KR3A 3PIPA 2RQTA 2XD0A 3JCMb 2HDAA 1NPRA 1VUBA 5DM7R 4O5VA 1K73U 1SHFA 3QJ6A 4DBHA 4QT7A 3QJYA 1XQHA 4RUGA 2OI3A 2KXDA 2GF7A 2FG0A 5KE3A 1HJDA 4QQDA 3CCMQ 3HKSA 2RPNA 3S3OA 5LJ3d 1B7TA 4M7DE 1W4SA 4Q5WA 4C0FA 1PG5B 2OTJT 3EGXB 3L1AA 4M77G 1WX6A 2KT1A 4C92B 2C06A 2LJ0A 4EPCA 4PFOA 2NWMA 1U5SA 4RTTA 3PGGA 1QVFA 1UGVA 2WSEE 2HCKA 1I81A 4PJOA 1WNLA 4M75A 1VQ9A 1X69A 5D7UA 1I5OB 5A0LA 4M7AG 1H3ZA 1VQ4T 1IGUA 1GBQA 3QG1A 2FPFA 3A8GB 1K76A 3V8KA 2G3RA 1QW1A 4XTZA 2AZSA 3Q1JA 4M78D 2CYZB 4DEYA 2LX7A 4BDYA 4Z8AA 1JXMA 2R5MA 3TU4K 4P5NA 1YITQ 1AVZC 1IO6A 3G71T 4X1VA 3OYHA 2JUFA 2CT4A 2KNBB 5D6YA 2PUKB 1IHVA 2X35A 3RERA 1FMWA 2DPPB 4DBRA 4FW1A 2HL5C 4QQGA 1MNDA 3G6ET 4RG2A 3M0SA 1T0JA 5GAMg 3QZ5B 5IN1A 2CUBA 1YFNA 1V76A 1G83A 3E9FA 2QA4A 4JRPA 1TTHB 3C94A 4XQ3A 4HXJA 2DRMA 1LVKA 1YNZA 1ZX6A 3CCQQ 2EYYA 2V26A 3A8OB 2HKQB 2E12A 1JRIA 2MK5A 4F04B 5HK3A 1PM3A 3EG9B 2EYQA 2RQWA 1Q82R 5GANe 4OVAA 1ZA2B 3O8VA 1MV3A 2LNHB 2J06A 4OMMA 1UJYA 2LJ3A 1RABB 2QG9B 3EHQA 2ENMA 3H0HA 3VKIA 1UGRB 3PVQA 4J7FA 2HKNA 2YRVA 1YHQQ 4FCYA 5A0DA 2K57A 4MDWA 4NL2A 1ZSZA 1MUZA 4LNPA 1UEBA 2COYA 3FJ5A 2D0NA 4BY6B 4QKUA 3REBB 3JB9D 4BACA 3GNFB 3P8DA 4D8DA 3J7AF 3JB9F 2GGRA 2SRCA 4F7UE 4F7UA 2AK5A 3OSVA 1IREB 1WHLA 4D6WA 3TSWA 1Y07A 1YP5A 1EIFA 1B07A 4OMQA 2KI7A 3EH2A 4OMOA 4XAXB 1RLQC 3SFMA 1TU0B 2HZYA 5GANg 2EGEA 4FW2A 4RTUA 1U3OA 3KUFA 5IAYA 1I07A 2A7YA 5I11A 4AFZC 4J6YA 3H9NA 1NJIC 1WXBA 4QVCA 1N27A 2DVEA 4HA8A 4AMCA 3X26B 1W70A 1T0HA 2LT4A 3HFNA 1YITT 3OYYA 3D7SB 2QQ9A 3EG1A 3MP8A 1OPLA 3A5ZB 4C92D 4J9EA 1ZUUA 5LJ3g 4OP0A 2QI2A 2DJQA 2J6KA 4HCBA 1QLYA 1ZA1B 2P84A 3QPHA 2O2OA 3DB4A 3C0CA 5FU7C 4C92F 1M27C 3HRSA 3LWIA 5C0MA 3P8HA 3PIOA 2K6DA 3V7RA 2RMOA 4AT1B 2VUBA 2GFUA 2ESWA 3AT1B 1MV0B 4N4GA 3OS1A 3VS1A 4C92E 3BW1A 1IHWA 1I4K1 1ACMB 3M9QA 4PNOA 4IUUA 5CCAA 4DEXA 1IGQA 4ESRA 1RAHB 2PTKA 2VB6A 3OYBA 3CMEA 2DXCA 1OU9A 4GY5A 3MO8A 3CC2A 2J05A 3CCRQ 2DTHA 4DA4A 4HCZA 1NM7A 1B3QA 1ABOA 1OZ3A 5CO7A 2GBQA 2EGAA 4XU1A 1N5ZA 5KCOA 3JCMP 3CC7T 3RMQA 1NLOC 1K9MU 2QYZA 2DEQA 3CC4Q 1I5LA 1R77A 2XDPA 2YRDA 1VQKA 3LGFA 2LCCA 2VYTA 2QA4T 2MCNA 3S6WA 3PMIA 2DKGA 2HD0A 4N0AC 1HD3A 3EAEA 2AT1B 5CKEA 4E2FB 1YJNA 1DJ7B 1K8AC 2Y4YA 1H641 4AG1C 4R56A 2PQWA 3G4SA 4J8OA 1VQ8T 2L0AA 2RQRA 2VGMA 2WSFE 2KVQG 1ABQA 3JCMd 1MNEA 4J9DA 3RBBB 2XMFA 4XTWA 3MJXA 5A2QE 1VA7A 4PJOC 4M75C 4JZ4A 2FZCB 2KYMA 4IIOA 1YJWT 1YI2T 3L2WA 5GAOp 1GRIA 1KG1A 1U1TA 3PE0A 4C8QG 3OYMA 4OGCA 1VQMA 3JCMV 3SEMA 1D1BA 5GMKh 4CC7A 3C95A 1X2QA 1O75A 2MWPA 2E6ZA 4CRIA 2JJ9A 2MAMA 4JJBA 2F5TX 1Y57A 4A4KA 4FT2A 1UDLA 2RM4A 2EKOA 3CBOA 3META 4RMOA 3JB9H 4M77B 3SWNB 4ANJA 2B86A 1EFNA 3LH0A 3NTKA 2P0KA 3OA6A 2YDLA 3CCSA 4FIBA 3M58A 1YIJQ 2KMTA 4ME7A 3ASKA 1VQLA 2M9UA 4M7AB 2WSCE 2X51A 2M0YA 3QXEB 3JCMQ 1BB9A 3CXCS 2ED0A 4PJJA 1ZBXA 2KDSA 2IPOB 3CCRT 2DO3A 2QDLA 2CH4W 1VQ7T 4JLGA 2X4JA 2H3EB 2ROLA 3ZL7C 1AHJB 2JXBA 2YUQA 4X9CA 1X6BA 3CD6Q 4KUIA 1ZSZC 3VS4A 5GAOm 2DXBA 2CKKA 1ZUYA 4J83A 3CMAA 2HAXA 1N9RA 4X34A 3CCEA 2C0TA 1TXQA 1WGSA 2O4XA 5GAOn 1JJ2A 2HBWA 2E3HA 3VRZA 3KFVA 3UPUA 1YJ9Q 3I55A 3C12A 2K79A 2KBTA 2RI2A 2CP2A 2CP3A 4NS5A 1G3YA 1KK7A 4GLKA 4ZN3A 2M16A 2LP5A 4R0KA 4QQ6A 4ELYC 1BYMA 1VQPA 1Q7YC 2MYSA 2RD1A 4FSSA 1KIKA 3UA7A 2DAQA 1KD1C 1Q81C 1GFDA 1C6VX 4Y28E 3I56A 1M1FA 3A98A 2DZCA 4E7JA 3CCUQ 1Q86C 2I0NA 1GXIE 1X01A 2E65A 3L2RA 1PRMC 2F2WA 1TG0A 2XICA 3UA6A 3QYGB 4HT9A 3FC3A 1W2BP 2PUOB 1M1KC 1GCPA 2CSIA 2R58A 1KFZA 4IUQA 1Y71A 3E2UA 1VQKT 2DL8A 2D8HA 2L3PA 4LDYA 2EVRA 3JCMg 2O01E 3CCVA 3GLXA 1UG1A 2CT3A 5IHKA 2K5IA 4M78B 1A0NB 4E7HA 5IHIA 5J39A 3KBGA 1FX7A 5EG2A 1QCOA 4LUDA 1SPKA 3OBYA 1KQ1A 5FU6B 2OAWA 1S72A 3VS7A 1FMKA 4KBMB 4C8QC 1P92A 1BU1A 1UJ0A 1TUCA 1WDXA 2DLPA 3C4SA 1QKXA 1RI0A 1WHJA 4M77D 3I9QA 2K7AA 4LE9A 1IB8A 2QQRA 1I0CA 1VQ4Q 2DX1A 1W2BS 2CSQA 1K9MR 3S3NA 3QUIA 5KYUB 2H8HA 2LVMA 3M0QA 1XTDA 4NL3A 2RF0A 1VYTA 1FMVA 4M7AD 4EMGA 2A37A 1G2BA 3G71Q 5GAMj 2PVDB 1WYXA 4M7AF 2CUDA 1QP2A 3M59A 2EYXA 2JTFA 1WXTA 3OMGA 3SWNA 3G6EQ 4LDWA 5AT1B 2DETA 2DM1A 1M90C 3LLRA 2P4RA 4CC4B 1ARKA 3H0IA 2LC4A 3CCMA 2ED1A 1JEGA 3E1SA 1VQLT 4RCCA 2LQKA 2PVOB 3S3MA 4M7AE 1UFFA 1BKBA 4RTZA 4XTVA 3EH1A 2YSQA 1WJRA 5KYWA 2EQJA 2DBMA 2M0OA 2FPDA 5CKFA 1SSFA 1PSFA 2VXEA 2WACA 2J6OA 2GCXA 3EHRA 5GAN7 1WPYA 3HRTA 2JT4A 5GAMf 2KY9A 2R5AA 3FRNA 1QVFP 1V29B 4KUDK 3OS5A 3BDUA 1X6OA 3MKDA 2D6FA 1GCQA 3M53A 3GBQA 1WHMA 2PU9B 5D6WA 4A4EA 5GAMe 4M7DA 2HMAA 3VS2A 3CBMA 5GANj 1BCMA 2FZGB 1BIAA 1XNIA 1RACB 4HT8A 3MP6A 2QAZA 3LGLA 5KYYB 1OEBA 5GAOl 3X24B 4BI8B 2EQKA 4ZNXA 3FJPA 1AWXA 1VQ5Q 2CDTA 2K4YA 3CCQA 2DE0X 1NJIR 4KGVB 4CC2A 1KSWA 1JXOA 1K9AA 4AFSC 3G1JA 1M5Q1 2OAUA 3I56T 5LJ3j 5IXFA 2EBPA 3GP8A 4L5GA 1OQKA 1WA7A 1PD0A 3M55A 2DRKA 2X3XD 2L8DA 2IIMA 4M78F 3CCLT 1Q7YU 6AT1B 1YHQA 3OYKA 1C1AA 5LJ5h 3RKXA 5HKCA 3GNGA 1Q81U 3NMZC 1JQQA 3ZFJA 4BDZA 4A4FA 5GANf 4HVUA 1NYFA 4JRQA 4OMFB 3OYAA 1Q86U 2DYIA 3CBPA 3VS3A 4RG8A 4M78E 4N4HA 5FWBA 2VVKA 3TREA 5HCKA 1OU8A 1NPPA 4OMPA 2LMJA 3SHWA 1EX4A 2FZKB 2OTLT 3VUZA 1SF9A 2K3BA 2E70A 2DA9A 2GNCA 4FYXB 5LJ3f 2HQEA 3PVLA 5CAIA 4DBQA 1TS9A 4FM4B 5CKHA 4EMKA 3UWNA 3BE3A 4LDXA 2FRYA 2GQIA 1H92A 2V8KA 3TCJA 2EJ9A 1NEBA 1PHTA 5LJ3e 4PJOG 4M75G 1AWJA 1D1AA 5D6XA 2YLBA 3VYHB 1QWEA 4A4GA 3RNJA 3CC7Q 2K9GA 4MZTA 1UECA 1M2VA 3CCJA 2RHXA 2MWOA 4N4IA 2RB6A 1Y96A 5GAN6 1AWWA 1D1CA 3VS6A 2QA4Q 2F2VA 4HCKA 2PZ1A 4PFZA 3ZBDA 3EGDA 4C5IA 3VV0A 1VQ5T 4LUEA 2BZXA 4DOWA 1K8AR 4BE2A 1UHFA 2QEXT 4DOVA 2DIGA 2RK2A 1VQ8Q 1D3BB 4FL6A 2BE9B 1VQOA 3VRYA 1QWFA 4PJNA 2F2XA 4RCBA 1MMAA 4ZGDB 2V8IA 2JMAA 1YJWQ 1YI2Q 3EG0A 3OB9A 1M4ZA 3RKYA 4IURA 2FO0A 1QVGP 4Z89A 1B34B 4Y92A 2QGFB 1M1GA 2DMOA 1KJWA 5CKBA 1FXXA 1PC0A 3ME9A 4PL6A 4C8QD 2W0ZA 2NYSA 2HSPA 2YUOA 1OOTA 3EGXA 2LCSA 3CC4A 3V7CA 4C92A 2DL7A 3NPFA 2EYZA 4M4ZA 5GAN2 1NBEB 3OYJA 5KYYA 1VQ9T 5GMKi 2EKHA 1S1NA 4ZTJA 1TUDA 4F7UG 2ZPIB 3THKA 1UTIA 2KXCA 1X75C 1VYUA 2M1HA 2BZYA 2LDMA 1Q82C 1TOVA 4ORZA 3OSSC 4XTYA 3QSUA 1M30A 4II1A 2CP6A 4ZTFA 1VQ7Q 1ZBJA 3X25B 5A0GA 1AEYA 1N6AA 1VQNA 4E7LA 5CK9A 3V8JA 2EQIA 4KH0B 3OYEA 1MMGA 3FB9A 4CC3A 4L6V5 4Y91A 2IG0A 3M56A 2EQUA 1FYNA 5GAN3 2EPDA 1GCQC 1R0CB 4JS5A 2E5KA 3BDLA 4FYWB 1RAEB 1U06A 4RTXA 2KE9A 3A8LB 3GIBA 2MPXC 2JS2A 4M7DC 3OW2P 3ULRB 2JW4A 3PTAA 2A08A 3EG9A 3PT9A 3LX7A 4J5YA 2O9SA 4KGZB 2NUPB 1YIJA 2XI9A 1MMNA 1LPLA 1NLPC 1Q7YR 2P4TA 2RH2A 3OMCA 2L2PA 3A8HB 4AFQC 1OV3A 2VV5A 1Q81R 2HEQA 4Z02A 5GAN5 3MP1A 5ECAA 5KYNA 3CC2Q 4OGEA 1Y0MA 3V7SA 3JSCA 1Q86R 1BI0A 1M3AA 5HY6A 3L2VA 5CIUA 3WXMB 1QQJA 2FRWA 3OYDA 4J9IA 3OW2S 5FU7B 1M1KR 5DY9A 4EMHA 1ZHIA 2GTOA 1D0YA 1WHGA 1VQKQ 1NG2A 2QGGA 8AT1B 1R0BG 1RUWA 2EQMA 3PFSA 3I5RA 4WF2A 2RQVA 2QQSA 2D1XA 4K11A 5CQXA 5DLQE 3EG2A 5J3BA 3QDRB 2CZ6B 2QQAA 2AKLA 2CP7A 2A3LA 1MGQA 3G4SQ 1O9SA 1PCXA 2SEMA 2JZ2A 1I1JA 3M4YA 5GJWB 4C0DC 5M9OA 3VU3C 3L2ZA 2FEIA 1VQOT 3CXCA 1G5VA 1OPKA 2HBPA 1WLPB 4J9BA 5FRNA 3L2QA 3OYCA 1SHGA 4FU6A 4EMKC 1CKAA 4UC4A 1NJIU 4MMKA 3JCMf 1G3WA 1K73C 5KE2A 5IH2A 1N8RC 1G3TA 2MIOA 3G7ZA 2CZ0B 3MEUA 3QWXX 1VIFA 2FYKA 3CCUA 2YWWA 2LTOA
chains in the Genus database with same CATH topology
1K1ZA 2W10A 4CC4B 1ARKA 3H0IA 1MV3A 1PRLC 1BBZA 2ED1A 1JEGA 2LNHB 2J06A 4OMMA 1UJYA 2LJ3A 3EHQA 2ENMA 3H0HA 1K0SA 1UFFA 3PVQA 4RTZA 1AZGB 2YSQA 4J9HA 2DBMA 2FPDA 5IHNA 4LNPA 1MUZA 3VS0A 1XOVA 3FJ5A 2J6OA 2LQNA 4JPBW 2D0NA 3EHRA 3REBB 4D8DA 2JS0A 2ECZA 2JT4A 5L23A 2DNUA 2KYBA 4HVVA 2GGRA 4J9CA 4OMLA 2SRCA 2L3SA 2AK5A 4JJDA 1X43A 3TSWA 1YP5A 1GCQA 2YT6A 4JJCA 2KEAA 3IQLA 3GBQA 1B07A 4OMQA 2KRMA 4OMOA 5I22A 1RLQC 3EGUA 2DVJA 2DL5A 1X27A 2EGEA 2FPEA 3UF4A 2DL4A 2ABLA 3VS2A 4RTUA 2LJ1A 1U3OA 1I07A 1Z9QA 5I11A 4AFZC 1AD5A 1WXBA 2BTTA 1OEBA 1W70A 1T0HA 5FW9A 4ZNXA 1AWXA 2CDTA 2LQWA 3EG1A 2DE0X 1OPLA 2JTEA 2GTJA 2RNAA 4J9EA 1ZUUA 4CC2A 1GL5A 1KSWA 1JXOA 1K9AA 4AFSC 2DJQA 2J6KA 1QLYA 3NHNA 2O2OA 1WIEA 3C0CA 3UATA 3NGPA 5IXFA 2EBPA 1M27C 2V1QA 1WA7A 2DRKA 2X3XD 2K6DA 2IIMA 2AZVA 1CKBA 4AFUC 4E6RA 2RMOA 3NMZC 2EYWA 1LCKA 1JQQA 2ESWA 1H3HA 4HVUA 1MV0B 1NYFA 1NYGA 3VS1A 4RTYA 3M0PA 2VKNA 3U23A 2KRNA 3VS3A 5FWBA 2VVKA 1UE9A 2ROTA 5HCKA 4DEXA 4ESRA 4OMPA 2PTKA 2LMJA 2KT8A 1AWOA 1E6GA 3SHWA 1RLPC 2YUNA 2O88A 1K4US 2K3BA 4J9FA 3TVTA 2DA9A 2GNCA 1E7OA 3PVLA 2J05A 2O31A 2EW3A 1M3CA 1NM7A 2KRSA 2V1RA 1B3QA 1ABOA 1T3LA 2GBQA 3I35A 2EGAA 1N5ZA 3VS5A 2L3QA 1GBRA 2FRYA 1H8KA 2GQIA 1NLOC 1H92A 1X6GA 1NEBA 1PHTA 2JMCA 1AWJA 1PNJA 2MCNA 1QWEA 3RNJA 2K9GA 4GBQA 1HD3A 1UECA 1M3BA 2CH4A 3M0TA 2C0IA 2AKKA 1W6XA 2JM9A 4AG1C 1AOJA 1AWWA 3VS6A 3CQTA 2L0AA 2RQRA 2F2VA 4HCKA 2PZ1A 1ABQA 3O5ZA 4J9DA 3RBBB 2XMFA 1YWPA 4F14A 4LUEA 2BZXA 2CREA 1VA7A 2D8JA 4JZ4A 1UHFA 2KYMA 4IIOA 1GRIA 1T3SA 1JU5C 3PE0A 5IXBA 1WI7A 1PKSA 3VRYA 3SEMA 1QWFA 4CC7A 2F2XA 1X2QA 2NUZA 4J9GA 2DBKA 2A36A 2BZ8A 4JJBA 1Y57A 4HVWA 1UDLA 2JMAA 3EG0A 3H0FA 4JZ3A 2G6FX 1ZSGA 2FO0A 4Z89A 1NEGA 4F17A 4Y92A 1HSQA 2DMOA 4LN2A 1KJWA 2B86A 1CSKA 1EFNA 1YCSB 1WXUA 2JM8A 2YDLA 2W0ZA 3M0RA 1V1CA 2HSPA 3QWYA 2YUOA 1OOTA 2LCSA 2K2MA 4GLMA 2M0YA 2DL7A 3NPFA 1YN8A 5GJVB 2EYZA 4M4ZA 1BB9A 2RN8A 2ED0A 3R6NA 2DYBA 1M8MA 4RTWA 1UHCA 2EKHA 2CH4W 2QDLA 1S1NA 5FWCA 1TUDA 2KROA 2ROLA 1Z9ZA 4OMNA 3THKA 2PNIA 3ZL7C 4WCIA 1UTIA 2KXCA 1VYVA 1VYUA 2BZYA 1K0XA 4ORZA 2JXBA 2DF6A 3REAB 2J6FA 4RTVA 2YUQA 1X6BA 3VS4A 1M30A 2X3WD 4AG2C 2YUPA 1ZBJA 1ZUYA 2RQUA 4Z88A 1AEYA 2C0TA 1QCFA 3I5SA 2EQIA 1GFCA 3JV3A 5EC7A 4CC3A 1WFWA 2HBWA 3VRZA 3KFVA 2MOXA 2LZ6B 1FYNA 2K79A 2KBTA 4IIMA 2EPDA 1SRLA 2M51A 1GCQC 1RI9A 3M0UA 1ZLMA 2E5KA 1AZEA 4RTXA 1U06A 1E6HA 2KE9A 2LP5A 3H41A 4R0KA 1SRMA 2J7IA 1YWOA 2JS2A 3ULRB 2JW4A 4FSSA 1KIKA 3UA7A 2A08A 1GFDA 2O9SA 4A63B 2EGCA 2KR3A 2RQTA 2HDAA 1JO8A 3A98A 1NLPC 1SHFA 2I0NA 4QT7A 2L2PA 4AFQC 1W1FA 4RUGA 1PRMC 2F2WA 2KXDA 2OI3A 1TG0A 1OV3A 4EIKA 3UA6A 2FG0A 1HJDA 2HEQA 5ECAA 2RPNA 1GCPA 2CSIA 1KFZA 1Y0MA 1WX6A 2DL8A 2D8HA 2KT1A 4F16A 2L3PA 2LJ0A 2EVRA 2C0OA 1M3AA 2NWMA 1U5SA 1X2KA 1UG1A 3EG3A 4RTTA 2CT3A 5IHKA 1SEMA 2FRWA 4J9IA 1A0NB 5IHIA 1UGVA 4D8KA 1QKWA 2HCKA 2KGTA 2GTOA 1X69A 4LUDA 1SPKA 1NG2A 2OAWA 4KRTA 3VS7A 1FMKA 1BU1A 1RUWA 3I5RA 1GBQA 1UJ0A 3TSZA 2FPFA 1K76A 2RQVA 1TUCA 1WDXA 2DLPA 2AZSA 2D1XA 4K11A 3EG2A 1QKXA 1UUEA 4DEYA 2LX7A 2AKLA 1PKTA 2OJ2A 4Z8AA 1JXMA 3I9QA 2K7AA 1J3TA 1AVZC 1IO6A 1SSHA 4LE9A 2SEMA 4X1VA 1I0CA 1I1JA 2CT4A 2DX1A 2KNBB 2CSQA 5GJWB 2FEIA 1OPKA 1ZUKA 2H8HA 1WLPB 3M0QA 2RF0A 4J9BA 2DILA 1VYTA 1BK2A 1T0JA 3M0SA 2A28A 1SHGA 2A37A 2CUBA 1G2BA 1G83A 1CKAA 4HXJA 1WYXA 2DRMA 3LH5A 2CUDA 1YNZA 2EYXA 5IH2A 1PWTA 2MIOA 1ZX6A 1WXTA 2EYYA 3QWXX 2VWFA 2DM1A 2O9VA 2DL3A 2P4RA 2RQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1Z A;  2W10 A;  4CC4 B;  1ARK A;  3H0I A;  1MV3 A;  1PRL C;  1BBZ A;  2ED1 A;  1JEG A;  2LNH B;  2J06 A;  4OMM A;  1UJY A;  2LJ3 A;  3EHQ A;  2ENM A;  3H0H A;  1K0S A;  1UFF A;  3PVQ A;  4RTZ A;  1AZG B;  2YSQ A;  4J9H A;  2DBM A;  2FPD A;  5IHN A;  4LNP A;  1MUZ A;  3VS0 A;  1XOV A;  3FJ5 A;  2J6O A;  2LQN A;  4JPB W;  2D0N A;  3EHR A;  3REB B;  4D8D A;  2JS0 A;  2ECZ A;  2JT4 A;  5L23 A;  2DNU A;  2KYB A;  4HVV A;  2GGR A;  4J9C A;  4OML A;  2SRC A;  2L3S A;  2AK5 A;  4JJD A;  1X43 A;  3TSW A;  1YP5 A;  1GCQ A;  2YT6 A;  4JJC A;  2KEA A;  3IQL A;  3GBQ A;  1B07 A;  4OMQ A;  2KRM A;  4OMO A;  5I22 A;  1RLQ C;  3EGU A;  2DVJ A;  2DL5 A;  1X27 A;  2EGE A;  2FPE A;  3UF4 A;  2DL4 A;  2ABL A;  3VS2 A;  4RTU A;  2LJ1 A;  1U3O A;  1I07 A;  1Z9Q A;  5I11 A;  4AFZ C;  1AD5 A;  1WXB A;  2BTT A;  1OEB A;  1W70 A;  1T0H A;  5FW9 A;  4ZNX A;  1AWX A;  2CDT A;  2LQW A;  3EG1 A;  2DE0 X;  1OPL A;  2JTE A;  2GTJ A;  2RNA A;  4J9E A;  1ZUU A;  4CC2 A;  1GL5 A;  1KSW A;  1JXO A;  1K9A A;  4AFS C;  2DJQ A;  2J6K A;  1QLY A;  3NHN A;  2O2O A;  1WIE A;  3C0C A;  3UAT A;  3NGP A;  5IXF A;  2EBP A;  1M27 C;  2V1Q A;  1WA7 A;  2DRK A;  2X3X D;  2K6D A;  2IIM A;  2AZV A;  1CKB A;  4AFU C;  4E6R A;  2RMO A;  3NMZ C;  2EYW A;  1LCK A;  1JQQ A;  2ESW A;  1H3H A;  4HVU A;  1MV0 B;  1NYF A;  1NYG A;  3VS1 A;  4RTY A;  3M0P A;  2VKN A;  3U23 A;  2KRN A;  3VS3 A;  5FWB A;  2VVK A;  1UE9 A;  2ROT A;  5HCK A;  4DEX A;  4ESR A;  4OMP A;  2PTK A;  2LMJ A;  2KT8 A;  1AWO A;  1E6G A;  3SHW A;  1RLP C;  2YUN A;  2O88 A;  1K4U S;  2K3B A;  4J9F A;  3TVT A;  2DA9 A;  2GNC A;  1E7O A;  3PVL A;  2J05 A;  2O31 A;  2EW3 A;  1M3C A;  1NM7 A;  2KRS A;  2V1R A;  1B3Q A;  1ABO A;  1T3L A;  2GBQ A;  3I35 A;  2EGA A;  1N5Z A;  3VS5 A;  2L3Q A;  1GBR A;  2FRY A;  1H8K A;  2GQI A;  1NLO C;  1H92 A;  1X6G A;  1NEB A;  1PHT A;  2JMC A;  1AWJ A;  1PNJ A;  2MCN A;  1QWE A;  3RNJ A;  2K9G A;  4GBQ A;  1HD3 A;  1UEC A;  1M3B A;  2CH4 A;  3M0T A;  2C0I A;  2AKK A;  1W6X A;  2JM9 A;  4AG1 C;  1AOJ A;  1AWW A;  3VS6 A;  3CQT A;  2L0A A;  2RQR A;  2F2V A;  4HCK A;  2PZ1 A;  1ABQ A;  3O5Z A;  4J9D A;  3RBB B;  2XMF A;  1YWP A;  4F14 A;  4LUE A;  2BZX A;  2CRE A;  1VA7 A;  2D8J A;  4JZ4 A;  1UHF A;  2KYM A;  4IIO A;  1GRI A;  1T3S A;  1JU5 C;  3PE0 A;  5IXB A;  1WI7 A;  1PKS A;  3VRY A;  3SEM A;  1QWF A;  4CC7 A;  2F2X A;  1X2Q A;  2NUZ A;  4J9G A;  2DBK A;  2A36 A;  2BZ8 A;  4JJB A;  1Y57 A;  4HVW A;  1UDL A;  2JMA A;  3EG0 A;  3H0F A;  4JZ3 A;  2G6F X;  1ZSG A;  2FO0 A;  4Z89 A;  1NEG A;  4F17 A;  4Y92 A;  1HSQ A;  2DMO A;  4LN2 A;  1KJW A;  2B86 A;  1CSK A;  1EFN A;  1YCS B;  1WXU A;  2JM8 A;  2YDL A;  2W0Z A;  3M0R A;  1V1C A;  2HSP A;  3QWY A;  2YUO A;  1OOT A;  2LCS A;  2K2M A;  4GLM A;  2M0Y A;  2DL7 A;  3NPF A;  1YN8 A;  5GJV B;  2EYZ A;  4M4Z A;  1BB9 A;  2RN8 A;  2ED0 A;  3R6N A;  2DYB A;  1M8M A;  4RTW A;  1UHC A;  2EKH A;  2CH4 W;  2QDL A;  1S1N A;  5FWC A;  1TUD A;  2KRO A;  2ROL A;  1Z9Z A;  4OMN A;  3THK A;  2PNI A;  3ZL7 C;  4WCI A;  1UTI A;  2KXC A;  1VYV A;  1VYU A;  2BZY A;  1K0X A;  4ORZ A;  2JXB A;  2DF6 A;  3REA B;  2J6F A;  4RTV A;  2YUQ A;  1X6B A;  3VS4 A;  1M30 A;  2X3W D;  4AG2 C;  2YUP A;  1ZBJ A;  1ZUY A;  2RQU A;  4Z88 A;  1AEY A;  2C0T A;  1QCF A;  3I5S A;  2EQI A;  1GFC A;  3JV3 A;  5EC7 A;  4CC3 A;  1WFW A;  2HBW A;  3VRZ A;  3KFV A;  2MOX A;  2LZ6 B;  1FYN A;  2K79 A;  2KBT A;  4IIM A;  2EPD A;  1SRL A;  2M51 A;  1GCQ C;  1RI9 A;  3M0U A;  1ZLM A;  2E5K A;  1AZE A;  4RTX A;  1U06 A;  1E6H A;  2KE9 A;  2LP5 A;  3H41 A;  4R0K A;  1SRM A;  2J7I A;  1YWO A;  2JS2 A;  3ULR B;  2JW4 A;  4FSS A;  1KIK A;  3UA7 A;  2A08 A;  1GFD A;  2O9S A;  4A63 B;  2EGC A;  2KR3 A;  2RQT A;  2HDA A;  1JO8 A;  3A98 A;  1NLP C;  1SHF A;  2I0N A;  4QT7 A;  2L2P A;  4AFQ C;  1W1F A;  4RUG A;  1PRM C;  2F2W A;  2KXD A;  2OI3 A;  1TG0 A;  1OV3 A;  4EIK A;  3UA6 A;  2FG0 A;  1HJD A;  2HEQ A;  5ECA A;  2RPN A;  1GCP A;  2CSI A;  1KFZ A;  1Y0M A;  1WX6 A;  2DL8 A;  2D8H A;  2KT1 A;  4F16 A;  2L3P A;  2LJ0 A;  2EVR A;  2C0O A;  1M3A A;  2NWM A;  1U5S A;  1X2K A;  1UG1 A;  3EG3 A;  4RTT A;  2CT3 A;  5IHK A;  1SEM A;  2FRW A;  4J9I A;  1A0N B;  5IHI A;  1UGV A;  4D8K A;  1QKW A;  2HCK A;  2KGT A;  2GTO A;  1X69 A;  4LUD A;  1SPK A;  1NG2 A;  2OAW A;  4KRT A;  3VS7 A;  1FMK A;  1BU1 A;  1RUW A;  3I5R A;  1GBQ A;  1UJ0 A;  3TSZ A;  2FPF A;  1K76 A;  2RQV A;  1TUC A;  1WDX A;  2DLP A;  2AZS A;  2D1X A;  4K11 A;  3EG2 A;  1QKX A;  1UUE A;  4DEY A;  2LX7 A;  2AKL A;  1PKT A;  2OJ2 A;  4Z8A A;  1JXM A;  3I9Q A;  2K7A A;  1J3T A;  1AVZ C;  1IO6 A;  1SSH A;  4LE9 A;  2SEM A;  4X1V A;  1I0C A;  1I1J A;  2CT4 A;  2DX1 A;  2KNB B;  2CSQ A;  5GJW B;  2FEI A;  1OPK A;  1ZUK A;  2H8H A;  1WLP B;  3M0Q A;  2RF0 A;  4J9B A;  2DIL A;  1VYT A;  1BK2 A;  1T0J A;  3M0S A;  2A28 A;  1SHG A;  2A37 A;  2CUB A;  1G2B A;  1G83 A;  1CKA A;  4HXJ A;  1WYX A;  2DRM A;  3LH5 A;  2CUD A;  1YNZ A;  2EYX A;  5IH2 A;  1PWT A;  2MIO A;  1ZX6 A;  1WXT A;  2EYY A;  3QWX X;  2VWF A;  2DM1 A;  2O9V A;  2DL3 A;  2P4R A;  2RQW A; 
#chains in the Genus database with same CATH topology
 2V8J A;  2QTV A;  4FYV B;  3BY7 A;  4FT4 A;  3JCM e;  4QVD A;  2RHZ A;  2K5L A;  2E1H A;  1K0S A;  4PLI A;  5LL6 S;  1AZG B;  3CCS Q;  2HQH A;  4J9H A;  4DBF A;  3OY9 A;  1BCO A;  5IHN A;  5GMK m;  2DFU A;  1XOV A;  2YRC A;  1VQL Q;  1VQ6 A;  2LQN A;  1BIB A;  3H8Z A;  2QQB A;  2YXY A;  3CME T;  3A1P A;  1R8O B;  3CPF A;  2OTJ A;  2XID A;  3CC2 T;  3PMT A;  2Y90 A;  5L23 A;  2KYB A;  2CP0 A;  2RJD A;  2EIF A;  1KHI A;  3R6O A;  1X43 A;  2RI3 A;  4PJO B;  4M75 B;  1I8F A;  4HKE A;  1VQN T;  3RMS A;  2CS7 A;  2YT6 A;  4JJC A;  5LJ5 d;  2KEA A;  1VQ4 A;  5FRM A;  3EGU A;  2DVJ A;  3RUX A;  1X27 A;  3UF4 A;  1IRX A;  2ABL A;  2I2L A;  2NUT B;  4BE0 A;  1LOJ A;  2LJ1 A;  3NFC A;  2E64 A;  1Z9Q A;  3CCE Q;  1N9S A;  3G71 A;  2EJG A;  1D0X A;  3CPW P;  1YJN T;  1OX8 A;  1RAI B;  2E5Q A;  3G4S T;  2KSS A;  2LQW A;  4XU0 A;  2BKD N;  2CP5 A;  4C92 C;  3G6E A;  2RNA A;  3BFM A;  4HCC A;  3M54 A;  3OS2 A;  1WIE A;  3UAT A;  4C0Z A;  1AT1 B;  3NGP A;  1VQP Q;  1KQS P;  3FEO A;  2ZPF B;  2HQX A;  1K8A U;  1NZ9 A;  3QO3 A;  5AYF A;  4M77 F;  4E6R A;  2K5F A;  1VQM T;  3VUB A;  4ELZ C;  1W2B A;  2EYW A;  3I56 Q;  4QW2 A;  2DER A;  3M57 A;  1KQ2 A;  4LD6 A;  4OB2 B;  1NYG A;  3CPW S;  3M0P A;  3CCL Q;  1ZQ1 A;  3U23 A;  1HK9 A;  2OX7 A;  3AHU A;  2DD4 A;  1ZSZ B;  4RKU E;  3X28 B;  4B6M A;  4M77 E;  1UE9 A;  4M77 A;  2ROT A;  4O6J A;  5C6S A;  3CCS T;  1KC8 C;  1AWO A;  1RAA B;  1RLP C;  4PFP A;  2L89 A;  1K4U S;  1OYX A;  4XK8 E;  4J9F A;  1KQS S;  1E7O A;  4FYY B;  2E10 A;  2O31 A;  4NOY A;  4F7U B;  4M7A A;  3QZ9 B;  1BI1 A;  2KRS A;  2V1R A;  2X4X A;  4ZN1 A;  2VXF A;  3OQ5 A;  3JCM X;  2VGN A;  1WHH A;  1Q95 G;  3WVD B;  3EFO B;  3VS5 A;  1RAD B;  4JUV A;  2OTL Q;  1H8K A;  2XDD A;  3JB9 J;  1QP3 A;  2EAY A;  2L5Q A;  3HP9 A;  5GAO q;  1PNJ A;  4LDV A;  2COW A;  4GBQ A;  2DZ9 A;  2CZ1 B;  3CMA T;  2RHU A;  3CCE T;  1EZZ B;  2AKK A;  2DTI A;  1YIT A;  4BY6 C;  1AOJ A;  3LW5 E;  1LNX A;  2BE7 D;  3I55 T;  2D0Q B;  4FSX A;  1YWP A;  4F14 A;  5KCH A;  2R57 A;  2CRE A;  3LYI A;  4PJO D;  4M75 D;  4R55 A;  4IUT A;  1N8R U;  3UT1 A;  3HHT B;  3FLG A;  1HYO A;  5IXB A;  4PJO F;  3HRU A;  4M75 F;  4N0A A;  4LD9 K;  1VQP T;  1WI7 A;  1VQ6 T;  2DXT A;  4MZM A;  5LJ5 g;  3DKM A;  1RL2 A;  2NUZ A;  2PVG B;  1OUL A;  3KXT A;  1QVF S;  2QEX Q;  1M9S A;  2BZ8 A;  4C8Q B;  4HVW A;  4JZ3 A;  5I2M A;  3GPL A;  2RHI A;  2GFA A;  3OYG A;  3FIF A;  2P0P A;  4PJO E;  4M75 E;  4F17 A;  4CI0 C;  1WXU A;  2JM8 A;  4JJN K;  1SG5 A;  1K9M C;  1KD1 U;  5GMK l;  2NUT A;  3M0R A;  1V1C A;  3QWY A;  3CCV T;  2K2M A;  4GLM A;  1YN8 A;  5GJV B;  1YCY A;  2MF2 A;  4QVZ A;  2RN8 A;  2D9T A;  4TVR A;  2DYB A;  4RTW A;  4M78 A;  2E41 A;  3CC7 A;  2MI6 A;  1PD1 A;  1UHC A;  2DIQ A;  2XKO C;  1G3S A;  5FWC A;  2DXU A;  1M1K U;  2DK3 A;  4C5E A;  1S72 T;  1Z9Z A;  4JDS A;  2P0Q A;  4BI4 A;  4WCI A;  2QK0 A;  3ER0 A;  2F69 A;  2DF6 A;  3REA B;  2J6F A;  4PKC C;  4BUG A;  4C5H A;  1VQ9 Q;  2ZPE B;  2COZ A;  4B9W A;  2RI5 A;  5L8R E;  2RQU A;  2BIV A;  4M7D G;  3QBY A;  1U1S A;  2ZPG B;  1UB4 A;  3HFO A;  1VQ8 A;  4KGX B;  5KYU A;  3SD4 A;  2RA2 A;  5GAM h;  4J6W A;  1QVP A;  4IIM A;  1SRL A;  3JCM J;  4KH1 B;  1AZE A;  1RAF B;  3HTR A;  4F7U F;  1YJW A;  1YI2 A;  2B8A A;  3H41 A;  4J6X A;  2J7I A;  4A4H A;  2VC8 A;  4JRK A;  4JS4 A;  1M2O A;  3CCM T;  5GMK j;  2XU8 A;  1JO8 A;  4OF1 A;  5KYX B;  2YHT A;  5I21 A;  1W1F A;  2LQ8 A;  4EIK A;  5J26 A;  1M90 U;  1KC8 U;  3EFO A;  3OBW A;  3OYF A;  3JB9 I;  4OB3 B;  1PSE A;  1VOM A;  4M78 G;  3H6Z A;  1XJW B;  5FRO A;  4F16 A;  3GF5 A;  2C0O A;  1X2K A;  3EG3 A;  1SEM A;  4BB7 A;  4MML A;  4D8K A;  1QKW A;  2KGT A;  3MEA A;  3CCR A;  4XTX A;  3URG A;  1VQ7 A;  2LT1 A;  2XK0 A;  4KRT A;  5GAN h;  4ATO A;  4E7Z A;  3TSZ A;  4J7I A;  3X20 B;  1TWB A;  3CCJ Q;  3T9N A;  1UUE A;  4C8Q F;  4M77 C;  1PKT A;  2OJ2 A;  3RKW A;  5CQY A;  4XU3 A;  3SWN C;  1J3T A;  1SSH A;  4PJM A;  3RR6 A;  1M8V A;  2O4X B;  2DJZ A;  3UDC A;  2QTX A;  1ZUK A;  2KK4 A;  3CCQ T;  5GMK e;  4BD3 A;  5LJ3 h;  2DIL A;  4M7A C;  1BK2 A;  2AHJ B;  2A28 A;  3INZ A;  4LDU A;  4C8Q E;  4C8Q A;  1OX9 A;  2ZCF B;  1QVG S;  2E3I A;  3LH5 A;  1VQO Q;  1UGS B;  1PWT A;  1UGP B;  1QVG A;  1JBM A;  1YHQ T;  2VWF A;  2O9V A;  3JB9 G;  2DL3 A;  1K1Z A;  1QMC A;  2W10 A;  7AT1 B;  3JCM W;  4B9X A;  3DLL A;  2GQV A;  1PRL C;  1BBZ A;  4E7I A;  3J80 E;  1K73 R;  4KT0 E;  3MPU B;  1N8R R;  1RAG B;  2ZPB B;  4X9D A;  3M5A A;  1OZ2 A;  2JNG A;  3VS0 A;  4EDU A;  3NTH A;  4PLL A;  4JPB W;  1TH7 A;  2XG8 D;  1WQW A;  2K3Y A;  2JS0 A;  2ECZ A;  1NE8 A;  2DNU A;  3DLM A;  2EJF A;  2MMP A;  4HVV A;  4J9C A;  4OML A;  2JTM A;  3SDZ A;  2L3S A;  4JJD A;  5FLX E;  2DD5 A;  3CME Q;  1KD1 R;  3WVE B;  3IQL A;  4C92 G;  1OI1 A;  2EFI A;  2KRM A;  5I22 A;  4BE1 A;  2DL5 A;  2FPE A;  2DL4 A;  1U8R A;  3NTI A;  3DB3 A;  4LXC A;  1VQN Q;  1AD5 A;  2BTT A;  2VAS A;  2IVW A;  1TSF A;  3EFR A;  3CCJ T;  4ZGJ B;  2DTO A;  4OB0 B;  2XHC A;  3CD6 A;  3CXC P;  3RIR A;  2RJF A;  5FW9 A;  1D09 B;  2F1L A;  3OW2 A;  3MEW A;  3LWH A;  4E7K A;  2JTE A;  2QXF A;  2GTJ A;  3SB2 A;  1GL5 A;  3NHN A;  5CVI A;  4M78 C;  3OYN A;  1YJN Q;  2JVV A;  1YJ9 A;  2FB7 A;  2V1Q A;  2XDB A;  4KUL A;  4VUB A;  5KYX A;  2CGH A;  5FU6 C;  1SKU B;  2AZV A;  1CKB A;  1D3B A;  3QKJ A;  3P8B B;  4AFU C;  4IKF A;  1JJ2 P;  2HSE B;  2ATC B;  1LCK A;  1H3H A;  1WJQ A;  4RTY A;  3JCM c;  2VKN A;  5KYW B;  2KRN A;  1VQM Q;  5I2S A;  5KH6 A;  5GAN 4;  1WZO A;  1B34 A;  3VJP A;  2KT8 A;  1D0Z A;  1LJO A;  1E6G A;  2RJE A;  2O88 A;  2YUN A;  3FDR A;  3QII A;  1JB0 E;  2F5K A;  3TVT A;  3CC4 T;  2X4Y A;  3RES A;  2EW3 A;  1M3C A;  1MHN A;  2X9H A;  1M90 R;  1T3L A;  1KC8 R;  2AIR B;  2ZPH B;  1JJ2 S;  3I35 A;  3VYG A;  2BUD A;  1QCN A;  2L3Q A;  1GBR A;  1HXD A;  3EFS A;  1VIE A;  4M7D B;  1X6G A;  3HSB A;  2H3J A;  4OB1 B;  3E9G A;  2JMC A;  3OYI A;  3L2U A;  4JLI A;  4V2S A;  4C5G A;  3J81 E;  2CZ7 B;  1F1B B;  1M3B A;  2CH4 A;  3M0T A;  2C0I A;  2KQW A;  1W6X A;  2JM9 A;  2FVU A;  3TQ7 P;  3CQT A;  3CEY A;  3QHS A;  3O5Z A;  1WJS A;  1Q82 U;  2QAS A;  3QYH B;  3CMA Q;  2D8J A;  4PJL A;  1T3S A;  3HPW A;  1JU5 C;  4E47 A;  3CCL A;  2K2V A;  1PKS A;  2E6N A;  3I55 Q;  2YLC A;  2A0F B;  2QDY B;  3PNW C;  4XTU A;  5CR2 A;  5GAO r;  5LJ5 j;  3E19 A;  4J9G A;  1G8X A;  2FL7 A;  2DBK A;  2A36 A;  3F70 A;  5IT9 E;  3L42 A;  2ZZD A;  1YIJ T;  3H0F A;  2K3X A;  2HNI A;  2ZGW A;  2NUP A;  8ATC B;  4WTO B;  1BI2 A;  3V8L A;  2G6F X;  2FHD A;  5CKD A;  1VQ6 Q;  4XU2 A;  2HL3 A;  1ZSG A;  2Y4X A;  1NEG A;  3M4G A;  1HSQ A;  4LN2 A;  2X4W A;  1CSK A;  2OTJ Q;  1YCS B;  1KHC A;  3JAM E;  4C0D B;  1YBY A;  1IXD A;  3OS0 A;  5GAM d;  3TEE A;  5DLO A;  2LNV A;  1WHK A;  1TUG B;  2OTL A;  3JCM h;  3QDF A;  4E7S A;  4DQ2 A;  4IUP A;  3JRZ A;  2ZAE A;  3R6N A;  4A54 A;  4EMK B;  2RO0 A;  2JN0 A;  1M8M A;  4JRI A;  9ATC B;  2Z0W A;  3HL8 A;  3CPW A;  3CD6 T;  3RDV A;  2LRQ A;  4BI3 A;  2DEU A;  2M02 A;  3A8M B;  4A53 A;  5HK0 A;  3MEV A;  2EWN A;  2KRO A;  4PK4 A;  3CCV Q;  4OMN A;  2NLU A;  3OYL A;  5LJ5 f;  2E4H A;  2PNI A;  3N5B B;  1Y7X A;  1VYV A;  1MMD A;  1K0X A;  4RTV A;  1FWZ A;  3MCA B;  1M2V B;  4L59 A;  4IUV A;  1YJ9 T;  2X3W D;  4AG2 C;  2YUP A;  3ZEH A;  1KQS A;  4Z88 A;  1Y96 B;  1S72 Q;  2JOY A;  1QCF A;  1BI3 A;  3I5S A;  5LJ5 e;  1GFC A;  3JV3 A;  1IZ6 A;  3EGD B;  5EC7 A;  1WFW A;  2LCL A;  4MZP A;  2MOX A;  2LZ6 B;  1VQ5 A;  1WQ7 A;  2M51 A;  2RJC A;  1RI9 A;  3GOX A;  3M0U A;  3MHX A;  1ZLM A;  2QEX A;  4C0G A;  2RHY A;  1E6H A;  1UGQ B;  2RK1 A;  1SRM A;  4YTL A;  3CCU T;  1YWO A;  4M7D D;  2KAF A;  4MDX A;  2L3R A;  5GAN d;  5GAN 8;  1C0M A;  2LX9 A;  4ZGE B;  4M7D F;  4A63 B;  2EGC A;  2KR3 A;  3PIP A;  2RQT A;  2XD0 A;  3JCM b;  2HDA A;  1NPR A;  1VUB A;  5DM7 R;  4O5V A;  1K73 U;  1SHF A;  3QJ6 A;  4DBH A;  4QT7 A;  3QJY A;  1XQH A;  4RUG A;  2OI3 A;  2KXD A;  2GF7 A;  2FG0 A;  5KE3 A;  1HJD A;  4QQD A;  3CCM Q;  3HKS A;  2RPN A;  3S3O A;  5LJ3 d;  1B7T A;  4M7D E;  1W4S A;  4Q5W A;  4C0F A;  1PG5 B;  2OTJ T;  3EGX B;  3L1A A;  4M77 G;  1WX6 A;  2KT1 A;  4C92 B;  2C06 A;  2LJ0 A;  4EPC A;  4PFO A;  2NWM A;  1U5S A;  4RTT A;  3PGG A;  1QVF A;  1UGV A;  2WSE E;  2HCK A;  1I81 A;  4PJO A;  1WNL A;  4M75 A;  1VQ9 A;  1X69 A;  5D7U A;  1I5O B;  5A0L A;  4M7A G;  1H3Z A;  1VQ4 T;  1IGU A;  1GBQ A;  3QG1 A;  2FPF A;  3A8G B;  1K76 A;  3V8K A;  2G3R A;  1QW1 A;  4XTZ A;  2AZS A;  3Q1J A;  4M78 D;  2CYZ B;  4DEY A;  2LX7 A;  4BDY A;  4Z8A A;  1JXM A;  2R5M A;  3TU4 K;  4P5N A;  1YIT Q;  1AVZ C;  1IO6 A;  3G71 T;  4X1V A;  3OYH A;  2JUF A;  2CT4 A;  2KNB B;  5D6Y A;  2PUK B;  1IHV A;  2X35 A;  3RER A;  1FMW A;  2DPP B;  4DBR A;  4FW1 A;  2HL5 C;  4QQG A;  1MND A;  3G6E T;  4RG2 A;  3M0S A;  1T0J A;  5GAM g;  3QZ5 B;  5IN1 A;  2CUB A;  1YFN A;  1V76 A;  1G83 A;  3E9F A;  2QA4 A;  4JRP A;  1TTH B;  3C94 A;  4XQ3 A;  4HXJ A;  2DRM A;  1LVK A;  1YNZ A;  1ZX6 A;  3CCQ Q;  2EYY A;  2V26 A;  3A8O B;  2HKQ B;  2E12 A;  1JRI A;  2MK5 A;  4F04 B;  5HK3 A;  1PM3 A;  3EG9 B;  2EYQ A;  2RQW A;  1Q82 R;  5GAN e;  4OVA A;  1ZA2 B;  3O8V A;  1MV3 A;  2LNH B;  2J06 A;  4OMM A;  1UJY A;  2LJ3 A;  1RAB B;  2QG9 B;  3EHQ A;  2ENM A;  3H0H A;  3VKI A;  1UGR B;  3PVQ A;  4J7F A;  2HKN A;  2YRV A;  1YHQ Q;  4FCY A;  5A0D A;  2K57 A;  4MDW A;  4NL2 A;  1ZSZ A;  1MUZ A;  4LNP A;  1UEB A;  2COY A;  3FJ5 A;  2D0N A;  4BY6 B;  4QKU A;  3REB B;  3JB9 D;  4BAC A;  3GNF B;  3P8D A;  4D8D A;  3J7A F;  3JB9 F;  2GGR A;  2SRC A;  4F7U E;  4F7U A;  2AK5 A;  3OSV A;  1IRE B;  1WHL A;  4D6W A;  3TSW A;  1Y07 A;  1YP5 A;  1EIF A;  1B07 A;  4OMQ A;  2KI7 A;  3EH2 A;  4OMO A;  4XAX B;  1RLQ C;  3SFM A;  1TU0 B;  2HZY A;  5GAN g;  2EGE A;  4FW2 A;  4RTU A;  1U3O A;  3KUF A;  5IAY A;  1I07 A;  2A7Y A;  5I11 A;  4AFZ C;  4J6Y A;  3H9N A;  1NJI C;  1WXB A;  4QVC A;  1N27 A;  2DVE A;  4HA8 A;  4AMC A;  3X26 B;  1W70 A;  1T0H A;  2LT4 A;  3HFN A;  1YIT T;  3OYY A;  3D7S B;  2QQ9 A;  3EG1 A;  3MP8 A;  1OPL A;  3A5Z B;  4C92 D;  4J9E A;  1ZUU A;  5LJ3 g;  4OP0 A;  2QI2 A;  2DJQ A;  2J6K A;  4HCB A;  1QLY A;  1ZA1 B;  2P84 A;  3QPH A;  2O2O A;  3DB4 A;  3C0C A;  5FU7 C;  4C92 F;  1M27 C;  3HRS A;  3LWI A;  5C0M A;  3P8H A;  3PIO A;  2K6D A;  3V7R A;  2RMO A;  4AT1 B;  2VUB A;  2GFU A;  2ESW A;  3AT1 B;  1MV0 B;  4N4G A;  3OS1 A;  3VS1 A;  4C92 E;  3BW1 A;  1IHW A;  1I4K 1;  1ACM B;  3M9Q A;  4PNO A;  4IUU A;  5CCA A;  4DEX A;  1IGQ A;  4ESR A;  1RAH B;  2PTK A;  2VB6 A;  3OYB A;  3CME A;  2DXC A;  1OU9 A;  4GY5 A;  3MO8 A;  3CC2 A;  2J05 A;  3CCR Q;  2DTH A;  4DA4 A;  4HCZ A;  1NM7 A;  1B3Q A;  1ABO A;  1OZ3 A;  5CO7 A;  2GBQ A;  2EGA A;  4XU1 A;  1N5Z A;  5KCO A;  3JCM P;  3CC7 T;  3RMQ A;  1NLO C;  1K9M U;  2QYZ A;  2DEQ A;  3CC4 Q;  1I5L A;  1R77 A;  2XDP A;  2YRD A;  1VQK A;  3LGF A;  2LCC A;  2VYT A;  2QA4 T;  2MCN A;  3S6W A;  3PMI A;  2DKG A;  2HD0 A;  4N0A C;  1HD3 A;  3EAE A;  2AT1 B;  5CKE A;  4E2F B;  1YJN A;  1DJ7 B;  1K8A C;  2Y4Y A;  1H64 1;  4AG1 C;  4R56 A;  2PQW A;  3G4S A;  4J8O A;  1VQ8 T;  2L0A A;  2RQR A;  2VGM A;  2WSF E;  2KVQ G;  1ABQ A;  3JCM d;  1MNE A;  4J9D A;  3RBB B;  2XMF A;  4XTW A;  3MJX A;  5A2Q E;  1VA7 A;  4PJO C;  4M75 C;  4JZ4 A;  2FZC B;  2KYM A;  4IIO A;  1YJW T;  1YI2 T;  3L2W A;  5GAO p;  1GRI A;  1KG1 A;  1U1T A;  3PE0 A;  4C8Q G;  3OYM A;  4OGC A;  1VQM A;  3JCM V;  3SEM A;  1D1B A;  5GMK h;  4CC7 A;  3C95 A;  1X2Q A;  1O75 A;  2MWP A;  2E6Z A;  4CRI A;  2JJ9 A;  2MAM A;  4JJB A;  2F5T X;  1Y57 A;  4A4K A;  4FT2 A;  1UDL A;  2RM4 A;  2EKO A;  3CBO A;  3MET A;  4RMO A;  3JB9 H;  4M77 B;  3SWN B;  4ANJ A;  2B86 A;  1EFN A;  3LH0 A;  3NTK A;  2P0K A;  3OA6 A;  2YDL A;  3CCS A;  4FIB A;  3M58 A;  1YIJ Q;  2KMT A;  4ME7 A;  3ASK A;  1VQL A;  2M9U A;  4M7A B;  2WSC E;  2X51 A;  2M0Y A;  3QXE B;  3JCM Q;  1BB9 A;  3CXC S;  2ED0 A;  4PJJ A;  1ZBX A;  2KDS A;  2IPO B;  3CCR T;  2DO3 A;  2QDL A;  2CH4 W;  1VQ7 T;  4JLG A;  2X4J A;  2H3E B;  2ROL A;  3ZL7 C;  1AHJ B;  2JXB A;  2YUQ A;  4X9C A;  1X6B A;  3CD6 Q;  4KUI A;  1ZSZ C;  3VS4 A;  5GAO m;  2DXB A;  2CKK A;  1ZUY A;  4J83 A;  3CMA A;  2HAX A;  1N9R A;  4X34 A;  3CCE A;  2C0T A;  1TXQ A;  1WGS A;  2O4X A;  5GAO n;  1JJ2 A;  2HBW A;  2E3H A;  3VRZ A;  3KFV A;  3UPU A;  1YJ9 Q;  3I55 A;  3C12 A;  2K79 A;  2KBT A;  2RI2 A;  2CP2 A;  2CP3 A;  4NS5 A;  1G3Y A;  1KK7 A;  4GLK A;  4ZN3 A;  2M16 A;  2LP5 A;  4R0K A;  4QQ6 A;  4ELY C;  1BYM A;  1VQP A;  1Q7Y C;  2MYS A;  2RD1 A;  4FSS A;  1KIK A;  3UA7 A;  2DAQ A;  1KD1 C;  1Q81 C;  1GFD A;  1C6V X;  4Y28 E;  3I56 A;  1M1F A;  3A98 A;  2DZC A;  4E7J A;  3CCU Q;  1Q86 C;  2I0N A;  1GXI E;  1X01 A;  2E65 A;  3L2R A;  1PRM C;  2F2W A;  1TG0 A;  2XIC A;  3UA6 A;  3QYG B;  4HT9 A;  3FC3 A;  1W2B P;  2PUO B;  1M1K C;  1GCP A;  2CSI A;  2R58 A;  1KFZ A;  4IUQ A;  1Y71 A;  3E2U A;  1VQK T;  2DL8 A;  2D8H A;  2L3P A;  4LDY A;  2EVR A;  3JCM g;  2O01 E;  3CCV A;  3GLX A;  1UG1 A;  2CT3 A;  5IHK A;  2K5I A;  4M78 B;  1A0N B;  4E7H A;  5IHI A;  5J39 A;  3KBG A;  1FX7 A;  5EG2 A;  1QCO A;  4LUD A;  1SPK A;  3OBY A;  1KQ1 A;  5FU6 B;  2OAW A;  1S72 A;  3VS7 A;  1FMK A;  4KBM B;  4C8Q C;  1P92 A;  1BU1 A;  1UJ0 A;  1TUC A;  1WDX A;  2DLP A;  3C4S A;  1QKX A;  1RI0 A;  1WHJ A;  4M77 D;  3I9Q A;  2K7A A;  4LE9 A;  1IB8 A;  2QQR A;  1I0C A;  1VQ4 Q;  2DX1 A;  1W2B S;  2CSQ A;  1K9M R;  3S3N A;  3QUI A;  5KYU B;  2H8H A;  2LVM A;  3M0Q A;  1XTD A;  4NL3 A;  2RF0 A;  1VYT A;  1FMV A;  4M7A D;  4EMG A;  2A37 A;  1G2B A;  3G71 Q;  5GAM j;  2PVD B;  1WYX A;  4M7A F;  2CUD A;  1QP2 A;  3M59 A;  2EYX A;  2JTF A;  1WXT A;  3OMG A;  3SWN A;  3G6E Q;  4LDW A;  5AT1 B;  2DET A;  2DM1 A;  1M90 C;  3LLR A;  2P4R A;  4CC4 B;  1ARK A;  3H0I A;  2LC4 A;  3CCM A;  2ED1 A;  1JEG A;  3E1S A;  1VQL T;  4RCC A;  2LQK A;  2PVO B;  3S3M A;  4M7A E;  1UFF A;  1BKB A;  4RTZ A;  4XTV A;  3EH1 A;  2YSQ A;  1WJR A;  5KYW A;  2EQJ A;  2DBM A;  2M0O A;  2FPD A;  5CKF A;  1SSF A;  1PSF A;  2VXE A;  2WAC A;  2J6O A;  2GCX A;  3EHR A;  5GAN 7;  1WPY A;  3HRT A;  2JT4 A;  5GAM f;  2KY9 A;  2R5A A;  3FRN A;  1QVF P;  1V29 B;  4KUD K;  3OS5 A;  3BDU A;  1X6O A;  3MKD A;  2D6F A;  1GCQ A;  3M53 A;  3GBQ A;  1WHM A;  2PU9 B;  5D6W A;  4A4E A;  5GAM e;  4M7D A;  2HMA A;  3VS2 A;  3CBM A;  5GAN j;  1BCM A;  2FZG B;  1BIA A;  1XNI A;  1RAC B;  4HT8 A;  3MP6 A;  2QAZ A;  3LGL A;  5KYY B;  1OEB A;  5GAO l;  3X24 B;  4BI8 B;  2EQK A;  4ZNX A;  3FJP A;  1AWX A;  1VQ5 Q;  2CDT A;  2K4Y A;  3CCQ A;  2DE0 X;  1NJI R;  4KGV B;  4CC2 A;  1KSW A;  1JXO A;  1K9A A;  4AFS C;  3G1J A;  1M5Q 1;  2OAU A;  3I56 T;  5LJ3 j;  5IXF A;  2EBP A;  3GP8 A;  4L5G A;  1OQK A;  1WA7 A;  1PD0 A;  3M55 A;  2DRK A;  2X3X D;  2L8D A;  2IIM A;  4M78 F;  3CCL T;  1Q7Y U;  6AT1 B;  1YHQ A;  3OYK A;  1C1A A;  5LJ5 h;  3RKX A;  5HKC A;  3GNG A;  1Q81 U;  3NMZ C;  1JQQ A;  3ZFJ A;  4BDZ A;  4A4F A;  5GAN f;  4HVU A;  1NYF A;  4JRQ A;  4OMF B;  3OYA A;  1Q86 U;  2DYI A;  3CBP A;  3VS3 A;  4RG8 A;  4M78 E;  4N4H A;  5FWB A;  2VVK A;  3TRE A;  5HCK A;  1OU8 A;  1NPP A;  4OMP A;  2LMJ A;  3SHW A;  1EX4 A;  2FZK B;  2OTL T;  3VUZ A;  1SF9 A;  2K3B A;  2E70 A;  2DA9 A;  2GNC A;  4FYX B;  5LJ3 f;  2HQE A;  3PVL A;  5CAI A;  4DBQ A;  1TS9 A;  4FM4 B;  5CKH A;  4EMK A;  3UWN A;  3BE3 A;  4LDX A;  2FRY A;  2GQI A;  1H92 A;  2V8K A;  3TCJ A;  2EJ9 A;  1NEB A;  1PHT A;  5LJ3 e;  4PJO G;  4M75 G;  1AWJ A;  1D1A A;  5D6X A;  2YLB A;  3VYH B;  1QWE A;  4A4G A;  3RNJ A;  3CC7 Q;  2K9G A;  4MZT A;  1UEC A;  1M2V A;  3CCJ A;  2RHX A;  2MWO A;  4N4I A;  2RB6 A;  1Y96 A;  5GAN 6;  1AWW A;  1D1C A;  3VS6 A;  2QA4 Q;  2F2V A;  4HCK A;  2PZ1 A;  4PFZ A;  3ZBD A;  3EGD A;  4C5I A;  3VV0 A;  1VQ5 T;  4LUE A;  2BZX A;  4DOW A;  1K8A R;  4BE2 A;  1UHF A;  2QEX T;  4DOV A;  2DIG A;  2RK2 A;  1VQ8 Q;  1D3B B;  4FL6 A;  2BE9 B;  1VQO A;  3VRY A;  1QWF A;  4PJN A;  2F2X A;  4RCB A;  1MMA A;  4ZGD B;  2V8I A;  2JMA A;  1YJW Q;  1YI2 Q;  3EG0 A;  3OB9 A;  1M4Z A;  3RKY A;  4IUR A;  2FO0 A;  1QVG P;  4Z89 A;  1B34 B;  4Y92 A;  2QGF B;  1M1G A;  2DMO A;  1KJW A;  5CKB A;  1FXX A;  1PC0 A;  3ME9 A;  4PL6 A;  4C8Q D;  2W0Z A;  2NYS A;  2HSP A;  2YUO A;  1OOT A;  3EGX A;  2LCS A;  3CC4 A;  3V7C A;  4C92 A;  2DL7 A;  3NPF A;  2EYZ A;  4M4Z A;  5GAN 2;  1NBE B;  3OYJ A;  5KYY A;  1VQ9 T;  5GMK i;  2EKH A;  1S1N A;  4ZTJ A;  1TUD A;  4F7U G;  2ZPI B;  3THK A;  1UTI A;  2KXC A;  1X75 C;  1VYU A;  2M1H A;  2BZY A;  2LDM A;  1Q82 C;  1TOV A;  4ORZ A;  3OSS C;  4XTY A;  3QSU A;  1M30 A;  4II1 A;  2CP6 A;  4ZTF A;  1VQ7 Q;  1ZBJ A;  3X25 B;  5A0G A;  1AEY A;  1N6A A;  1VQN A;  4E7L A;  5CK9 A;  3V8J A;  2EQI A;  4KH0 B;  3OYE A;  1MMG A;  3FB9 A;  4CC3 A;  4L6V 5;  4Y91 A;  2IG0 A;  3M56 A;  2EQU A;  1FYN A;  5GAN 3;  2EPD A;  1GCQ C;  1R0C B;  4JS5 A;  2E5K A;  3BDL A;  4FYW B;  1RAE B;  1U06 A;  4RTX A;  2KE9 A;  3A8L B;  3GIB A;  2MPX C;  2JS2 A;  4M7D C;  3OW2 P;  3ULR B;  2JW4 A;  3PTA A;  2A08 A;  3EG9 A;  3PT9 A;  3LX7 A;  4J5Y A;  2O9S A;  4KGZ B;  2NUP B;  1YIJ A;  2XI9 A;  1MMN A;  1LPL A;  1NLP C;  1Q7Y R;  2P4T A;  2RH2 A;  3OMC A;  2L2P A;  3A8H B;  4AFQ C;  1OV3 A;  2VV5 A;  1Q81 R;  2HEQ A;  4Z02 A;  5GAN 5;  3MP1 A;  5ECA A;  5KYN A;  3CC2 Q;  4OGE A;  1Y0M A;  3V7S A;  3JSC A;  1Q86 R;  1BI0 A;  1M3A A;  5HY6 A;  3L2V A;  5CIU A;  3WXM B;  1QQJ A;  2FRW A;  3OYD A;  4J9I A;  3OW2 S;  5FU7 B;  1M1K R;  5DY9 A;  4EMH A;  1ZHI A;  2GTO A;  1D0Y A;  1WHG A;  1VQK Q;  1NG2 A;  2QGG A;  8AT1 B;  1R0B G;  1RUW A;  2EQM A;  3PFS A;  3I5R A;  4WF2 A;  2RQV A;  2QQS A;  2D1X A;  4K11 A;  5CQX A;  5DLQ E;  3EG2 A;  5J3B A;  3QDR B;  2CZ6 B;  2QQA A;  2AKL A;  2CP7 A;  2A3L A;  1MGQ A;  3G4S Q;  1O9S A;  1PCX A;  2SEM A;  2JZ2 A;  1I1J A;  3M4Y A;  5GJW B;  4C0D C;  5M9O A;  3VU3 C;  3L2Z A;  2FEI A;  1VQO T;  3CXC A;  1G5V A;  1OPK A;  2HBP A;  1WLP B;  4J9B A;  5FRN A;  3L2Q A;  3OYC A;  1SHG A;  4FU6 A;  4EMK C;  1CKA A;  4UC4 A;  1NJI U;  4MMK A;  3JCM f;  1G3W A;  1K73 C;  5KE2 A;  5IH2 A;  1N8R C;  1G3T A;  2MIO A;  3G7Z A;  2CZ0 B;  3MEU A;  3QWX X;  1VIF A;  2FYK A;  3CCU A;  2YWW A;  2LTO A; 
#chains in the Genus database with same CATH homology
 1K1Z A;  2W10 A;  4CC4 B;  1ARK A;  3H0I A;  1MV3 A;  1PRL C;  1BBZ A;  2ED1 A;  1JEG A;  2LNH B;  2J06 A;  4OMM A;  1UJY A;  2LJ3 A;  3EHQ A;  2ENM A;  3H0H A;  1K0S A;  1UFF A;  3PVQ A;  4RTZ A;  1AZG B;  2YSQ A;  4J9H A;  2DBM A;  2FPD A;  5IHN A;  4LNP A;  1MUZ A;  3VS0 A;  1XOV A;  3FJ5 A;  2J6O A;  2LQN A;  4JPB W;  2D0N A;  3EHR A;  3REB B;  4D8D A;  2JS0 A;  2ECZ A;  2JT4 A;  5L23 A;  2DNU A;  2KYB A;  4HVV A;  2GGR A;  4J9C A;  4OML A;  2SRC A;  2L3S A;  2AK5 A;  4JJD A;  1X43 A;  3TSW A;  1YP5 A;  1GCQ A;  2YT6 A;  4JJC A;  2KEA A;  3IQL A;  3GBQ A;  1B07 A;  4OMQ A;  2KRM A;  4OMO A;  5I22 A;  1RLQ C;  3EGU A;  2DVJ A;  2DL5 A;  1X27 A;  2EGE A;  2FPE A;  3UF4 A;  2DL4 A;  2ABL A;  3VS2 A;  4RTU A;  2LJ1 A;  1U3O A;  1I07 A;  1Z9Q A;  5I11 A;  4AFZ C;  1AD5 A;  1WXB A;  2BTT A;  1OEB A;  1W70 A;  1T0H A;  5FW9 A;  4ZNX A;  1AWX A;  2CDT A;  2LQW A;  3EG1 A;  2DE0 X;  1OPL A;  2JTE A;  2GTJ A;  2RNA A;  4J9E A;  1ZUU A;  4CC2 A;  1GL5 A;  1KSW A;  1JXO A;  1K9A A;  4AFS C;  2DJQ A;  2J6K A;  1QLY A;  3NHN A;  2O2O A;  1WIE A;  3C0C A;  3UAT A;  3NGP A;  5IXF A;  2EBP A;  1M27 C;  2V1Q A;  1WA7 A;  2DRK A;  2X3X D;  2K6D A;  2IIM A;  2AZV A;  1CKB A;  4AFU C;  4E6R A;  2RMO A;  3NMZ C;  2EYW A;  1LCK A;  1JQQ A;  2ESW A;  1H3H A;  4HVU A;  1MV0 B;  1NYF A;  1NYG A;  3VS1 A;  4RTY A;  3M0P A;  2VKN A;  3U23 A;  2KRN A;  3VS3 A;  5FWB A;  2VVK A;  1UE9 A;  2ROT A;  5HCK A;  4DEX A;  4ESR A;  4OMP A;  2PTK A;  2LMJ A;  2KT8 A;  1AWO A;  1E6G A;  3SHW A;  1RLP C;  2YUN A;  2O88 A;  1K4U S;  2K3B A;  4J9F A;  3TVT A;  2DA9 A;  2GNC A;  1E7O A;  3PVL A;  2J05 A;  2O31 A;  2EW3 A;  1M3C A;  1NM7 A;  2KRS A;  2V1R A;  1B3Q A;  1ABO A;  1T3L A;  2GBQ A;  3I35 A;  2EGA A;  1N5Z A;  3VS5 A;  2L3Q A;  1GBR A;  2FRY A;  1H8K A;  2GQI A;  1NLO C;  1H92 A;  1X6G A;  1NEB A;  1PHT A;  2JMC A;  1AWJ A;  1PNJ A;  2MCN A;  1QWE A;  3RNJ A;  2K9G A;  4GBQ A;  1HD3 A;  1UEC A;  1M3B A;  2CH4 A;  3M0T A;  2C0I A;  2AKK A;  1W6X A;  2JM9 A;  4AG1 C;  1AOJ A;  1AWW A;  3VS6 A;  3CQT A;  2L0A A;  2RQR A;  2F2V A;  4HCK A;  2PZ1 A;  1ABQ A;  3O5Z A;  4J9D A;  3RBB B;  2XMF A;  1YWP A;  4F14 A;  4LUE A;  2BZX A;  2CRE A;  1VA7 A;  2D8J A;  4JZ4 A;  1UHF A;  2KYM A;  4IIO A;  1GRI A;  1T3S A;  1JU5 C;  3PE0 A;  5IXB A;  1WI7 A;  1PKS A;  3VRY A;  3SEM A;  1QWF A;  4CC7 A;  2F2X A;  1X2Q A;  2NUZ A;  4J9G A;  2DBK A;  2A36 A;  2BZ8 A;  4JJB A;  1Y57 A;  4HVW A;  1UDL A;  2JMA A;  3EG0 A;  3H0F A;  4JZ3 A;  2G6F X;  1ZSG A;  2FO0 A;  4Z89 A;  1NEG A;  4F17 A;  4Y92 A;  1HSQ A;  2DMO A;  4LN2 A;  1KJW A;  2B86 A;  1CSK A;  1EFN A;  1YCS B;  1WXU A;  2JM8 A;  2YDL A;  2W0Z A;  3M0R A;  1V1C A;  2HSP A;  3QWY A;  2YUO A;  1OOT A;  2LCS A;  2K2M A;  4GLM A;  2M0Y A;  2DL7 A;  3NPF A;  1YN8 A;  5GJV B;  2EYZ A;  4M4Z A;  1BB9 A;  2RN8 A;  2ED0 A;  3R6N A;  2DYB A;  1M8M A;  4RTW A;  1UHC A;  2EKH A;  2CH4 W;  2QDL A;  1S1N A;  5FWC A;  1TUD A;  2KRO A;  2ROL A;  1Z9Z A;  4OMN A;  3THK A;  2PNI A;  3ZL7 C;  4WCI A;  1UTI A;  2KXC A;  1VYV A;  1VYU A;  2BZY A;  1K0X A;  4ORZ A;  2JXB A;  2DF6 A;  3REA B;  2J6F A;  4RTV A;  2YUQ A;  1X6B A;  3VS4 A;  1M30 A;  2X3W D;  4AG2 C;  2YUP A;  1ZBJ A;  1ZUY A;  2RQU A;  4Z88 A;  1AEY A;  2C0T A;  1QCF A;  3I5S A;  2EQI A;  1GFC A;  3JV3 A;  5EC7 A;  4CC3 A;  1WFW A;  2HBW A;  3VRZ A;  3KFV A;  2MOX A;  2LZ6 B;  1FYN A;  2K79 A;  2KBT A;  4IIM A;  2EPD A;  1SRL A;  2M51 A;  1GCQ C;  1RI9 A;  3M0U A;  1ZLM A;  2E5K A;  1AZE A;  4RTX A;  1U06 A;  1E6H A;  2KE9 A;  2LP5 A;  3H41 A;  4R0K A;  1SRM A;  2J7I A;  1YWO A;  2JS2 A;  3ULR B;  2JW4 A;  4FSS A;  1KIK A;  3UA7 A;  2A08 A;  1GFD A;  2O9S A;  4A63 B;  2EGC A;  2KR3 A;  2RQT A;  2HDA A;  1JO8 A;  3A98 A;  1NLP C;  1SHF A;  2I0N A;  4QT7 A;  2L2P A;  4AFQ C;  1W1F A;  4RUG A;  1PRM C;  2F2W A;  2KXD A;  2OI3 A;  1TG0 A;  1OV3 A;  4EIK A;  3UA6 A;  2FG0 A;  1HJD A;  2HEQ A;  5ECA A;  2RPN A;  1GCP A;  2CSI A;  1KFZ A;  1Y0M A;  1WX6 A;  2DL8 A;  2D8H A;  2KT1 A;  4F16 A;  2L3P A;  2LJ0 A;  2EVR A;  2C0O A;  1M3A A;  2NWM A;  1U5S A;  1X2K A;  1UG1 A;  3EG3 A;  4RTT A;  2CT3 A;  5IHK A;  1SEM A;  2FRW A;  4J9I A;  1A0N B;  5IHI A;  1UGV A;  4D8K A;  1QKW A;  2HCK A;  2KGT A;  2GTO A;  1X69 A;  4LUD A;  1SPK A;  1NG2 A;  2OAW A;  4KRT A;  3VS7 A;  1FMK A;  1BU1 A;  1RUW A;  3I5R A;  1GBQ A;  1UJ0 A;  3TSZ A;  2FPF A;  1K76 A;  2RQV A;  1TUC A;  1WDX A;  2DLP A;  2AZS A;  2D1X A;  4K11 A;  3EG2 A;  1QKX A;  1UUE A;  4DEY A;  2LX7 A;  2AKL A;  1PKT A;  2OJ2 A;  4Z8A A;  1JXM A;  3I9Q A;  2K7A A;  1J3T A;  1AVZ C;  1IO6 A;  1SSH A;  4LE9 A;  2SEM A;  4X1V A;  1I0C A;  1I1J A;  2CT4 A;  2DX1 A;  2KNB B;  2CSQ A;  5GJW B;  2FEI A;  1OPK A;  1ZUK A;  2H8H A;  1WLP B;  3M0Q A;  2RF0 A;  4J9B A;  2DIL A;  1VYT A;  1BK2 A;  1T0J A;  3M0S A;  2A28 A;  1SHG A;  2A37 A;  2CUB A;  1G2B A;  1G83 A;  1CKA A;  4HXJ A;  1WYX A;  2DRM A;  3LH5 A;  2CUD A;  1YNZ A;  2EYX A;  5IH2 A;  1PWT A;  2MIO A;  1ZX6 A;  1WXT A;  2EYY A;  3QWX X;  2VWF A;  2DM1 A;  2O9V A;  2DL3 A;  2P4R A;  2RQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...