2L0AA

Solution nmr structure of signal transducing adapter molecule 1 stam-1 from homo sapiens, northeast structural genomics consortium target hr4479e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
b'MGHHHHHHSHMNHQHEARKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transducing adapter molecule 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Northeast Structural Genomics Consortium Target HR4479E
rcsb
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l0aA00
1UFFA 4CC7A 2BZYA 2F2XA 2KRMA 4J9HA 1TUCA 2O2OA 4AG1C 4OMLA 3O5ZA 3EG1A 2QDLA 1AWOA 2DL7A 3THKA 2YUNA 2EQIA 4RTZA 1X43A 2CDTA 1LCKA 2JM8A 1EFNA 1OV3A 1YP5A 2BTTA 2ENMA 2W10A 3NMZC 3PE0A 5IXBA 1WYXA 2E5KA 1M27C 2A37A 4QT7A 2D0NA 2KXDA 2SRCA 1CKAA 1V1CA 1YN8A 2DM1A 3QWYA 2DE0X 2LCSA 2GTJA 2CREA 2JMAA 2YT6A 2DRMA 2GGRA 3VS4A 3REBB 1WLPB 4AFZC 1ABOA 3C0CA 4J9DA 1AZGB 1MV3A 3UF4A 3VRZA 1AWWA 2KROA 2SEMA 3M0SA 1QCFA 1KFZA 2X3WD 1GBQA 1RLPC 1SRLA 2EYYA 1X6GA 4RTWA 4J9GA 2RMOA 2YDLA 2RQTA 1Y57A 2RF0A 4FSSA 2RQUA 4JZ4A 4ORZA 5GJVB 1JEGA 2FO0A 4J9FA 3PVLA 3VRYA 1UUEA 5FW9A 2FEIA 4AFQC 1AVZC 2PZ1A 2M51A 4RUGA 4AFUC 1SRMA 2L3PA 1PRMC 4IIOA 2K79A 1PKTA 5FWBA 3FJ5A 1U06A 4J9EA 2JT4A 3UA7A 3EHRA 2AKLA 2EYWA 1RI9A 5I22A 1NLOC 2CT3A 2G6FX 2OI3A 2FG0A 1SSHA 3VS0A 1OPLA 2RPNA 4LE9A 1H92A 2HCKA 2KRSA 3H41A 3GBQA 4J9BA 2O31A 5FWCA 5IH2A 2AZVA 2OAWA 1M8MA 1UTIA 2L3SA 1AWJA 2EPDA 3PVQA 4EIKA 2YUOA 3JV3A 4CC3A 2RQRA 4HVVA 1TG0A 4HXJA 1UDLA 2J6KA 1KJWA 1HSQA 2D1XA 2DL5A 1N5ZA 2DA9A 2LNHB 2ROTA 4Z89A 2LP5A 1QKWA 4RTVA 1PWTA 1FYNA 4LUDA 1JO8A 1BK2A 2P4RA 1GBRA 1WXBA 2FRYA 4WCIA 2AK5A 3M0UA 4JJDA 4DEYA 2C0OA 1JQQA 1PKSA 2EW3A 2O88A 4LUEA 2JW4A 1H3HA 2DL4A 1AEYA 1GRIA 2IIMA 1G2BA 2VWFA 1AWXA 1MUZA 1YWOA 1ZLMA 2KYBA 1AD5A 1VA7A 1NLPC 1Z9ZA 3A98A 1TUDA 4M4ZA 1WXUA 1ZUUA 2EGCA 2DLPA 2K7AA 1UJ0A 2DVJA 1K1ZA 1K0XA 4LN2A 3SEMA 2ROLA 2ED1A 2GTOA 2CUBA 2KT8A 2O9VA 5IHKA 2HBWA 1E7OA 4X1VA 2K9GA 1B3QA 2AZSA 1MV0B 4Y92A 1X2KA 1ZBJA 3I5RA 4HVWA 1X2QA 2LMJA 4LNPA 2J6OA 4Z8AA 2MCNA 2KXCA 1QLYA 4IIMA 3TSZA 2KGTA 1GCPA 1AOJA 2EGEA 4KRTA 3ZL7C 1VYTA 2KBTA 1ZSGA 2DBKA 2DL3A 2FPDA 4D8KA 2MIOA 2K3BA 1JU5C 1XOVA 2DJQA 1ZUKA 1YCSB 4E6RA 5EC7A 1WXTA 3I35A 1RUWA 1GCQC 2DL8A 2LX7A 4HVUA 2ECZA 1VYVA 1WFWA 1X6BA 4HCKA 1A0NB 1E6GA 1G83A 1NM7A 1AZEA 2C0IA 2D8JA 2DYBA 1NYGA 3R6NA 1FMKA 3NGPA 2C0TA 1ARKA 4J9IA 1J3TA 1PRLC 1NYFA 2JXBA 2CH4W 3H0HA 1GL5A 1KSWA 3RNJA 2EKHA 2B86A 4CC2A 1ABQA 2VKNA 1T3SA 1ZX6A 1UG1A 2M0YA 1UHCA 1H8KA 1U3OA 2RNAA 4ESRA 3REAB 3UA6A 3RBBB 2W0ZA 1BU1A 2JS2A 3EGUA 4JPBW 5GJWB 1UHFA 3UATA 2ESWA 1QWFA 1E6HA 3EG2A 3VS5A 4RTYA 1Z9QA 2HSPA 2L3QA 2DNUA 2EGAA 4RTTA 4OMQA 2VVKA 1IO6A 2O9SA 2LQWA 2KR3A 2L0AA 2BZ8A 2ED0A 2J7IA 5IHIA 1K0SA 2L2PA 4K11A 2JTEA 1YWPA 4RTXA 1WI7A 4F16A 1SHGA 3IQLA 2EYZA 2NUZA 1M3AA 3VS1A 2CT4A 1CSKA 2LJ3A 1UGVA 2MOXA 1SHFA 2OJ2A 5I11A 2RQVA 2H8HA 2A08A 2PTKA 1RLQC 2F2WA 2K2MA 1T0JA 1UE9A 2KE9A 4OMPA 4OMMA 5IXFA 1SEMA 2KT1A 2FPFA 2YUPA 2KRNA 1BB9A 1QKXA 4GBQA 4R0KA 1W6XA 1GFDA 1I07A 1QWEA 1WIEA 2PNIA 2LJ0A 1M3BA 2K6DA 1YNZA 3VS7A 4CC4B 2V1RA 3I5SA 1X69A 4AG2C 4DEXA 2D8HA 1NEGA 1GCQA 3NHNA 1OEBA 2DF6A 3VS3A 4JJCA 1NEBA 2GNCA 1JXMA 5ECAA 3SHWA 1BBZA 2ABLA 2NWMA 5IHNA 2DBMA 4F17A 3I9QA 3EHQA 1WX6A 3CQTA 3EG3A 4J9CA 3EG0A 2A36A 2J05A 3H0FA 5L23A 4OMOA 2RQWA 3TVTA 1WA7A 1UJYA 3M0QA 3LH5A 2HDAA 2J6FA 2A28A 3M0RA 4A63B 4F14A 2DMOA 2JM9A 4Z88A 1JXOA 1HD3A 1OOTA 1I1JA 3VS2A 2LZ6B 3H0IA 2YSQA 3VS6A 1WDXA 2GBQA 1PNJA 3TSWA 2LJ1A 2XMFA 4JZ3A 4RTUA 1I0CA 4AFSC 2I0NA 1ZUYA 2JMCA 2JS0A 2CSQA 1K4US 2EYXA 2LQNA 1T0HA 1M3CA 2HEQA 1CKBA 1K76A 5HCKA 2CH4A 3KFVA 2V1QA 4OMNA 1Y0MA 2EVRA 2J06A 3U23A 1KIKA 2F2VA 2BZXA 2DRKA 1W1FA 2EBPA 1T3LA 2AKKA 3M0TA 1NG2A 1GFCA 1S1NA 1B07A 1M30A 3ULRB 2KNBB 2FRWA 2CSIA 1OPKA 1UECA 3QWXX 2DILA 1PHTA 3M0PA 2GQIA 1VYUA 2RN8A 1K9AA 1U5SA 2DX1A 4D8DA 2CUDA 3NPFA 4GLMA 1X27A 2X3XD 2KYMA 2KEAA 1W70A 4ZNXA 2YUQA 1HJDA 2FPEA 1SPKA 4JJBA
chains in the Genus database with same CATH superfamily
1M90U 4CC7A 2RJCA 1K9MC 1QQJA 1JB0E 1WHHA 1YHQA 3JB9D 1D3BB 4AG1C 3O5ZA 3OYMA 4FL6A 2LRQA 3G6EA 5J26A 4OVAA 1OV3A 5IXBA 3MPUB 2QEXQ 1WYXA 1YFNA 2A37A 2O4XA 2D0NA 1V1CA 1N27A 1VIFA 2DM1A 5GAOm 2OTLA 1QVFA 4PL6A 1K8AC 4LDYA 3CCVT 2CREA 3EG9A 3DB3A 3JCMW 1KQSA 3CCLT 3LW5E 4PJOC 4RG8A 3ER0A 2IVWA 2RO0A 4J9DA 1RADB 4IKFA 3RIRA 2HSEB 1FMVA 1RAEB 4PFZA 3VRZA 1BI2A 3TQ7P 1B34A 4NOYA 2COWA 1FXXA 4M78F 1Q7YR 5LJ5e 2SEMA 4LDVA 3QPHA 1QCFA 2DO3A 4EMHA 3JB9I 1GBQA 5LJ3f 2MWOA 1RLPC 1S72T 1NPRA 2DPPB 2FHDA 2NUPA 4B6MA 4RTWA 4M7AB 3CEYA 2RMOA 2YDLA 3WVEB 2MMPA 3QIIA 2RQUA 4EMKA 5GJVB 1JEGA 2ZPGB 1FX7A 4UC4A 3QZ9B 4AMCA 1TSFA 3PVLA 5KCOA 5C6SA 2L89A 2LCLA 4LXCA 4LD6A 3INZA 1PRMC 4IIOA 3SWNA 4LDUA 2KMTA 3EHRA 3UA7A 1VQ6Q 4E7ZA 2HQHA 4GLKA 2G6FX 1KD1C 3QKJA 1WPYA 1OPLA 1VQ5T 1OQKA 2Y90A 5LJ5d 3V7RA 2AHJB 2E64A 3H41A 3GBQA 3MP6A 3QZ5B 3BY7A 5FWCA 2AZVA 2R5MA 2OAWA 4C5EA 3EFOA 3G71Q 2QEXT 1G3WA 3P8BB 1TUGB 1UDLA 4FYVB 4E7JA 3E9GA 4L5GA 1D1AA 4BACA 1RAHB 1K9MR 2C06A 1G5VA 3E1SA 5KYYB 1RABB 3X26B 1VOMA 3L2ZA 3GOXA 5GAOl 1H3HA 3E19A 3ZFJA 1ACMB 1Q86R 1GRIA 3V8LA 1VQKT 2DK3A 1MUZA 3PMTA 3OYHA 2K5IA 2K2VA 2EIFA 2DLPA 3GNGA 2K7AA 4MZPA 3S6WA 4C0GA 3MP1A 1QP2A 1UJ0A 1K0XA 4LN2A 3SEMA 1RL2A 3URGA 2KT8A 4PJOA 2HBWA 4B9XA 1E7OA 3DKMA 1I5OB 1S72A 2HQXA 2AZSA 2VB6A 2RK2A 4HA8A 1R0BG 2YRDA 1ZBJA 4DA4A 1VQLT 1X2QA 4C8QA 3JCMf 2J6OA 4M7AF 1JJ2A 3JCMg 4BE0A 2E1HA 1SF9A 1TS9A 2KGTA 3EH2A 3ZL7C 4FIBA 3OYAA 2E6ZA 2CP0A 4C5GA 2ZPEB 3ME9A 1YCSB 2AIRB 5EC7A 2D0QB 2LX7A 1Q82U 4KBMB 4X9CA 1X6BA 3N5BB 4XTYA 1IGUA 1LNXA 1E6GA 1NM7A 5KYUB 3G6ET 3JCMV 3V7SA 1KD1R 2RJDA 1PRLC 4JLGA 1D1CA 3PMIA 2CH4W 5FU7C 1IHVA 2EKHA 4CC2A 2VKNA 1T3SA 1G3YA 1JBMA 1UGQB 2GQVA 5GMKi 2XIDA 4BI4A 5GAOr 1BU1A 5GAN8 2OAUA 3HRSA 5DLQE 3CCQT 4BY6B 3CCSQ 2HSPA 1R8OB 1KQSS 1MNEA 1PG5B 1NJIC 4A54A 3O8VA 2L0AA 2J7IA 4M77D 1ZA1B 3G4ST 5IHIA 1U1SA 2OTJA 1VQMA 1Q86C 4RTXA 2DEQA 1SHGA 2LCCA 1M2VB 2NUZA 5DY9A 3LWHA 1Q7YU 1CSKA 1YJ9T 4M7DG 2MOXA 1RLQC 5CKBA 2OX7A 2KT1A 2FPFA 3OY9A 3VUBA 4XTXA 4ZGEB 2KRNA 2LVMA 3MHXA 4R0KA 1QWEA 2PNIA 4D6WA 4FYXB 4FYWB 3SWNC 3M5AA 2LT4A 1OX8A 1M3BA 3KXTA 2K6DA 3SDZA 4XTVA 1YIJA 2VGMA 2HQEA 3T9NA 4OP0A 3TU4K 2RB6A 4OGEA 1WHKA 3M54A 4FT2A 3HRUA 4DEXA 2D8HA 1NEGA 4M78B 1Q81C 1PM3A 4JJCA 3FDRA 3G71T 3OYYA 3M59A 4A4KA 1KQ2A 2ZCFB 4WTOB 5IHNA 3GF5A 5CKFA 4M7DD 4KUDK 1M8VA 4QKUA 3JCMe 5GAN2 2EAYA 4PJLA 3H0FA 4HCBA 1VQ6T 1C0MA 1IHWA 4RKUE 3RKWA 4XTWA 4KT0E 3CCMT 1Y96B 3CCJQ 4MDXA 4A4EA 3M0RA 1BIAA 4EMKC 1JXOA 3VS2A 1OI1A 2LZ6B 3H0IA 5KYUA 1K73C 3VS6A 1WDXA 2YRCA 1PNJA 2HKQB 3HHTB 4M78D 4AFSC 2I0NA 3X28B 3RMSA 1K4US 2LQNA 1T0HA 1MMDA 1K76A 2V1QA 2F2VA 2BZXA 2JN0A 4J6WA 1T3LA 2AKKA 4C92F 4X9DA 1VQ7T 1MGQA 4MZMA 4PFPA 2CSIA 1WJSA 2KSSA 1UECA 1Q81R 2CS7A 3C4SA 3QJ6A 3S3OA 3JB9H 4KULA 3EFSA 3JCMc 1U5SA 3SFMA 1NE8A 1RAFB 1XJWB 2RA2A 1G8XA 2CUDA 3NPFA 4C5IA 2L8DA 3MEAA 3RDVA 3CCLQ 1V76A 4RG2A 2FPEA 1SPKA 4NL2A 4EDUA 2PVGB 1VQ9T 4MMKA 1OU8A 4ZTJA 4J9HA 1TUCA 2O2OA 4A53A 2CP6A 1AWOA 2DL7A 2PUKB 5GMKe 3OYJA 4QQ6A 1LCKA 1YP5A 2BTTA 5LJ5j 2E5KA 5GANf 4M78C 4QT7A 2VXFA 4M78A 1QW1A 2KXDA 4JS4A 1CKAA 3QWYA 1ZHIA 1D09B 1XNIA 4J5YA 3VS4A 3A5ZB 2V26A 3REBB 5GAN7 1M1GA 1ABOA 3C0CA 4YTLA 3SWNB 1MV3A 3VKIA 4A4HA 2A3LA 2JUFA 3CCJA 4BD3A 1LOJA 5D6XA 4F7UE 1VQ4T 3LGFA 3M0SA 1RACB 4JS5A 2RHXA 2LDMA 2XKOC 1HYOA 1YJNT 2EYYA 3QG1A 2RQTA 4ORZA 2X4JA 3TEEA 2BKDN 2P0QA 4M78E 3J81E 1IZ6A 2COYA 4DBQA 2FL7A 2M51A 1SRMA 3H8ZA 1PKTA 2EQJA 2JT4A 1BCMA 2AKLA 1RI9A 5I22A 2OI3A 3CCLA 2FG0A 1IRXA 3VS0A 4LE9A 2KRSA 5A0LA 4J9BA 2RI2A 4ZTFA 4QVCA 3OS0A 3SB2A 2IG0A 3PVQA 4EPCA 3QUIA 4JRIA 2YUOA 3JV3A 3CBOA 4CC3A 1QVFP 2M0OA 1TG0A 5GAMh 2J6KA 3LGLA 5C0MA 1N5ZA 1VUBA 5FRNA 2ROTA 4J7IA 5GAOq 4RTVA 1QVGS 2QXFA 1FYNA 2P4RA 4ME7A 2FRYA 4C92A 2AK5A 4DEYA 5HKCA 2O88A 1C6VX 2EW3A 1ZSZC 4LDXA 2CGHA 2EWNA 3Q1JA 4XU1A 1AEYA 2OTJT 1W2BA 2VWFA 1YCYA 2DD5A 3HL8A 4BDZA 1AWXA 3CC7A 1ZLMA 3BW1A 2KYBA 2COZA 1B7TA 1VA7A 1NLPC 1TUDA 5LL6S 2EGCA 3CCET 2QK0A 3M53A 3LLRA 1NJIU 2PVOB 3GLXA 3CC2Q 1K1ZA 2VGNA 2CP2A 4C92D 2CUBA 1SSFA 2P84A 4LD9K 2E3IA 4JUVA 1B3QA 4KGVB 5GANj 5LJ3h 3C95A 1YIJT 1MV0B 2JTFA 3I5RA 3F70A 4HVWA 2LMJA 3L2UA 4PJOE 2EQUA 1VQ7A 2LQKA 3M56A 1KG1A 4KRTA 1BCOA 1N8RU 5GAMg 2KBTA 3QO3A 3X20B 3SD4A 2RHYA 3FB9A 2CP3A 4M75B 3CXCS 2MI6A 4D8KA 1D0ZA 4C0FA 4V2SA 1ZUKA 4E7KA 2ZPIB 4E6RA 1WXTA 1YJ9A 4QQDA 1GCQC 1TTHB 2JZ2A 3HTRA 4QQGA 3OYNA 3EH1A 3CCST 2CZ6B 4E47A 4C8QG 3R6OA 1YJWA 2DYBA 1O9SA 5I2MA 3G4SA 4KH1B 1M1KC 2LQ8A 4J9IA 2DKGA 3CCUT 2JNGA 2JXBA 1JJ2S 1KC8C 2QGGA 1H3ZA 3D7SB 1ZX6A 2DETA 3EG9B 2M0YA 4MMLA 3RBBB 3HPWA 2W0ZA 2HZYA 2JS2A 2K4YA 3EGUA 4M77E 2VV5A 4F7UF 3JRZA 3UATA 2FB7A 5FU6B 3CBMA 2F5TX 4FSXA 1E6HA 3EG2A 2L3QA 4DQ2A 2D9TA 4PJOD 1IB8A 2VVKA 5GAN6 1EZZB 3CCUQ 2ED0A 1K0SA 2L2PA 2DZ9A 4K11A 3DLLA 5FROA 2YRVA 1DJ7B 1WI7A 4KH0B 4EMKB 4C8QC 5KCHA 2HBPA 2X35A 4C92B 4CI0C 2X4YA 3G7ZA 2WSEE 2CT4A 5LJ3g 5CCAA 3CCVQ 2LJ3A 1UGVA 1P92A 1WHMA 1SHFA 4N4IA 3MP8A 4L59A 2OJ2A 2H8HA 2A08A 2RQVA 5I11A 2F2WA 1T0JA 3LH0A 1U8RA 1OYXA 5IXFA 1UGPB 4R56A 1QKXA 2QQ9A 2LTOA 4FYYB 1W6XA 5LJ5f 3H6ZA 4M77C 5GAN3 2LJ0A 1QVPA 1V29B 1YNZA 2LC4A 1YJ9Q 4OMFB 4II1A 2NLUA 2ZAEA 3CC7T 4CC4B 2V1RA 3JB9J 2PVDB 3I5SA 1X69A 4AG2C 3WXMB 1GCQA 2RI3A 4PNOA 1C1AA 2GNCA 1JXMA 3G4SQ 5ECAA 5AYFA 5GANg 2XDDA 1WHLA 2NWMA 4F17A 3CXCA 3JCMJ 5L8RE 2D6FA 3EG0A 2DYIA 1VQKA 4XAXB 4MDWA 5GAMj 1KK7A 3M0QA 3JCMP 2QTVA 3VYHB 2J6FA 3KBGA 2A28A 1OZ2A 4C92C 4F7UG 2QA4A 4M75E 2DZCA 2JM9A 3QBYA 6AT1B 1HD3A 3ZBDA 1OOTA 1I1JA 1H641 1KC8R 4ZN1A 2YSQA 2LJ1A 4JZ3A 1I0CA 1BI3A 4J6XA 2JMCA 2XDBA 2JS0A 1OX9A 2RHIA 4OMNA 1Y0MA 2EVRA 2V8IA 2HAXA 1VQPT 1S1NA 2HMAA 4F04B 1B07A 4PFOA 1FMWA 1OPKA 3QWXX 2DILA 4M7DF 3UT1A 1VQ9A 4FCYA 1NJIR 1LPLA 3M0PA 1RI0A 2GQIA 1VYUA 2RN8A 1K9AA 2DX1A 5GANh 4PJMA 4IUTA 3HKSA 5GANe 2Y4XA 1PSFA 4C92E 1YHQT 2W10A 2CKKA 4M75C 1UFFA 4ELYC 2BZYA 4F7UA 4KGXB 2F2XA 2YXYA 2KRMA 2KQWA 1U1TA 4BE2A 2P0KA 4X34A 2M1HA 2NUTA 1QVFS 2K3XA 1HXDA 2QDLA 3OQ5A 5CKDA 1I8FA 2RHUA 4PJJA 4RTZA 1X43A 2CDTA 1EFNA 2JM8A 3NMZC 2DJZA 1BIBA 3CCRA 4PLIA 5GAMd 2DEUA 2SRCA 5CIUA 1YN8A 3M4GA 3RERA 2RD1A 2DE0X 4Q5WA 1XTDA 1G3SA 2GTJA 3V8KA 2YT6A 2GGRA 4HT9A 2FZGB 1WLPB 2MF2A 1YBYA 3UPUA 4HT8A 2K5LA 2Z0WA 3OW2A 2QA4Q 1GXIE 2VUBA 2E10A 3DLMA 4A4FA 1MHNA 2KROA 4FT4A 3I56A 1KFZA 2X3WD 3I55T 1BKBA 1RAGB 3TREA 1Y7XA 1ZSZA 1BI1A 1R0CB 3CC4Q 1X6GA 4J9GA 4JDSA 2X9HA 1YI2Q 2DIQA 1YJNA 2DAQA 3S3MA 3CC2T 2FO0A 5CAIA 5CR2A 2EJGA 2QQBA 2E4HA 1I81A 4M7AG 3FC3A 2FEIA 4AFQC 2FYKA 2FZCB 2FZKB 1AVZC 2PZ1A 4RUGA 4AFUC 1MMGA 2CYZB 1UB4A 4C0DC 2K79A 5FWBA 4XTUA 1K8AU 3GIBA 3FJPA 4ANJA 4ZGDB 2EYWA 2CT3A 8ATCB 5CO7A 3I55A 3VU3C 2RPNA 4PKCC 2HCKA 5CQXA 4A4GA 1K9MU 3CMAT 2O31A 3OMGA 5IH2A 3OYKA 2QQRA 1K73R 2P0PA 3LYIA 5J39A 1M8MA 9ATCB 2L3SA 1QP3A 4XU3A 2KAFA 1AWJA 2F1LA 4EIKA 3CCQQ 4C8QF 1G3TA 2RQRA 4HVVA 4HXJA 4OF1A 2ATCB 2IPOB 2QTXA 3JAME 2QEXA 3UDCA 2KK4A 2DA9A 1UEBA 3FEOA 2LNHB 2Y4YA 3MKDA 1VQNQ 4Z89A 5GAMe 3ASKA 1VQOQ 4PLLA 1EX4A 2OTLQ 4C0DB 2P4TA 3RUXA 1BK2A 1WXBA 4WCIA 3NTKA 4PJNA 2H3JA 4BB7A 3CCRT 3M0UA 4JJDA 1F1BB 2C0OA 1JQQA 1PKSA 2JW4A 4XQ3A 2DL4A 4ELZC 1O75A 4F7UB 1YWOA 1Q82C 2KY9A 2NUTB 3OW2P 2ZPFB 4RMOA 4M75A 3MEVA 3A98A 5GAMf 3C94A 1WXUA 3I56Q 4FW1A 3M58A 3L2VA 8AT1B 1MMNA 2DVJA 1M1KR 1VQPQ 1M2OA 4HCCA 2ROLA 4IUQA 2GTOA 1BI0A 1WNLA 2O9VA 5IHKA 4M77G 5LJ3j 4KGZB 2DTHA 3OS5A 4M7DE 2K9GA 3HRTA 3META 5IAYA 2JOYA 4IUUA 4J83A 1WQWA 2YHTA 3M57A 1OZ3A 4Z8AA 3L42A 1I5LA 3CPWS 2KXCA 2F5KA 4IIMA 3TSZA 5J3BA 5FU7B 3M4YA 4O5VA 3G1JA 5A0DA 1YI2T 3HFOA 1VQ6A 2VASA 2GFAA 2DIGA 2L3RA 4M77A 1OU9A 3BE3A 4DBHA 3L2QA 4C92G 3OS2A 4KUIA 1ZSZB 2DBKA 2DL3A 4O6JA 3OYIA 1TH7A 2K3BA 1JU5C 2ZPHB 1XOVA 1KHCA 5D6YA 1YIJQ 2DL8A 3BFMA 5CKEA 1VYVA 3WVDB 2E41A 3PTAA 3G71A 2RJFA 4BE1A 3CCQA 2XICA 2CZ7B 2GF7A 1AZEA 3ZEHA 3E9FA 2D8JA 1NYGA 3NTIA 1N9RA 1VQNA 1J3TA 2B8AA 2E5QA 2O4XB 1EIFA 2DD4A 1VQOA 4M7DC 1AT1B 1NYFA 1Q86U 1WJRA 2AT1B 2CP7A 1GL5A 1KSWA 2M16A 1X01A 1UHCA 1H8KA 2DTOA 4XU2A 2RNAA 4ESRA 5GMKj 3JCMd 3REAB 3EGXA 4XTZA 2DERA 4XU0A 1W2BP 1X6OA 2WSCE 4JPBW 5EG2A 5KYNA 1UHFA 2RJEA 5FRMA 2ESWA 1QWFA 5M9OA 1JJ2P 2I2LA 1TOVA 2ZGWA 5LJ3d 4J6YA 1I4K1 2DNUA 2EGAA 1N8RC 3RESA 4WF2A 5GMKm 4OMQA 1VQ5Q 2O9SA 4E2FB 4TVRA 4FW2A 2LQWA 1NZ9A 2BZ8A 1VQPA 2VC8A 3CPFA 2KVQG 3JB9G 2NUPB 1TWBA 5IT9E 4M7AA 3OW2S 3BDUA 4M7DA 1NPPA 4F16A 3MEUA 4M77F 5I2SA 2EYZA 1S72Q 1M3AA 4XK8E 3QYGB 2YWWA 2DFUA 1D1BA 2OTLT 2K2MA 2KE9A 3L2RA 3JCMh 4OMMA 1SEMA 3V8JA 2BIVA 4GBQA 1GFDA 2LT1A 3GPLA 3OS1A 3UWNA 2QI2A 4OB2B 3A8LB 3EAEA 3OYFA 4M77B 2QYZA 1LJOA 1M4ZA 1Y07A 2K3YA 4VUBA 2GFUA 5KE2A 3EFOB 2QGFB 1RAAB 3PGGA 2DF6A 2XHCA 1JRIA 3VS3A 3VV0A 1NEBA 1KQSP 3HP9A 5KE3A 3CD6T 1N9SA 3CMAQ 1BBZA 2DBMA 3I9QA 1PCXA 3RMQA 1QVGP 5KYYA 3CQTA 3EG3A 4J9CA 4JRKA 3OYBA 2XU8A 2J05A 5L23A 1FWZA 2RQWA 5HY6A 5A0GA 4AT1B 3EGXB 3LH5A 2HDAA 3CCSA 4A63B 4Z88A 4N0AC 3A8HB 2QASA 1VQ4A 2E3HA 1VQ5A 3TSWA 2XMFA 1PSEA 2XDPA 5CKHA 1YITA 1LVKA 2OTJQ 4RCCA 2WACA 2CSQA 1QCNA 2EYXA 5GMKl 1VQMQ 4M75D 2HEQA 5KYXA 1KC8U 5HCKA 4E7IA 2CH4A 3KFVA 2J06A 1KIKA 3LX7A 4M7AD 2DRKA 3QHSA 1GFCA 4R55A 4M75F 1D0YA 4M7DB 3ULRB 2MK5A 1N8RR 3OBWA 1PHTA 1X75C 1RAIB 4C8QB 4BI3A 4GY5A 1M5Q1 2PUOB 3GP8A 1Q95G 2E70A 2M9UA 5I21A 3PFSA 3X25B 5KH6A 1X27A 2X3XD 2KYMA 1W70A 2YUQA 2A7YA 3CBPA 3I56T 1OULA 3TCJA 1QCOA 3QJYA 2YLCA 2JTMA 4OMLA 3RKXA 3A1PA 3EG1A 4C8QE 1VQ8T 3THKA 2YUNA 2EQIA 1HK9A 3PNWC 4DBFA 4ATOA 2ENMA 3PE0A 4OB1B 2PQWA 1M27C 4C8QD 3CMAA 4B9WA 2RH2A 2LCSA 3CMET 1UGSB 4QVZA 3QSUA 2JMAA 2DRMA 2VYTA 3H9NA 3CCJT 4AFZC 4IUVA 2RK1A 4Z02A 5KYWB 1AZGB 4NS5A 2QQAA 2QAZA 3UF4A 5FU6C 2CZ1B 1WJQA 3L1AA 1AWWA 4N4GA 3MJXA 1XQHA 1ZA2B 2E6NA 2MWPA 1VQ4Q 1D3BA 2NYSA 3CC2A 1YITQ 3CCMA 1BYMA 1SRLA 3HFNA 4PJOF 2WSFE 1Y57A 2RF0A 4FSSA 4E7SA 1VQ8A 4JZ4A 2EKOA 1M2VA 3QDFA 4J9FA 3VRYA 1UUEA 5FW9A 1W4SA 4J8OA 3M9QA 3VJPA 5CVIA 5HK0A 2K5FA 2BE7D 1Q82R 3M55A 2L3PA 4RCBA 2XK0A 1WGSA 1YJWT 4LDWA 3FJ5A 1U06A 4J9EA 2RHZA 3CC4T 1NLOC 3EGDB 2XD0A 4Y91A 1SSHA 2EQMA 1WHGA 1H92A 3OSSC 3LWIA 3OB9A 3VYGA 3OYGA 3KUFA 2QA4T 3RKYA 1UTIA 2EPDA 5LJ5g 2MAMA 4CRIA 2EFIA 4E7HA 1YJWQ 2VXEA 1KJWA 1HSQA 2D1XA 2DL5A 1YITT 1KHIA 2X51A 1M9SA 3OYLA 2R5AA 2LP5A 4DBRA 1WQ7A 3CCEQ 1QKWA 2L5QA 1PWTA 4P5NA 3FRNA 2MYSA 4LUDA 2E65A 1JO8A 1GBRA 1PD1A 2DXTA 3CD6Q 4J7FA 3CPWA 4FM4B 3DB4A 4LUEA 2K57A 1PC0A 2IIMA 2EYQA 1G2BA 2R58A 3NTHA 4DOVA 1Y96A 3JSCA 2E12A 1AD5A 2RM4A 1AHJB 4M78G 1Z9ZA 4M4ZA 1Y71A 2EQKA 1IREB 1ZUUA 2X4WA 5DM7R 3CCUA 1WZOA 2LX9A 3OA6A 3JB9F 2ED1A 3CCMQ 5GMKh 3S3NA 4PJOG 3PIPA 1N6AA 4QW2A 1VQ8Q 4X1VA 4BY6C 4C0ZA 2QG9B 2X4XA 4Y92A 5KYWA 1X2KA 4L6V5 3CMEQ 2RI5A 4LNPA 7AT1B 2MCNA 1VQOT 1VQNT 1QLYA 3X24B 1WHJA 3A8MB 1GCPA 1AOJA 2EGEA 1VYTA 3V7CA 4NL3A 5DLOA 2PU9B 1Q81U 1ZSGA 2HKNA 2DXCA 1M1FA 2FPDA 3MEWA 5GAN5 2MIOA 2G3RA 2DJQA 5FLXE 1IGQA 3RR6A 3EGDA 3I35A 1RUWA 4HVUA 2ECZA 4Y28E 1WFWA 4HCKA 4OB0B 1A0NB 2MPXC 4PJOB 1G83A 3A8OB 3J80E 3GNFB 2C0IA 3PIOA 3R6NA 4PK4A 1FMKA 3NGPA 2C0TA 3C12A 1ARKA 3BDLA 1TU0B 3OMCA 2JJ9A 3CCEA 1KQ1A 5GAOp 4M7AC 1VQLA 3H0HA 3RNJA 2B86A 1ABQA 3MO8A 1UG1A 3CD6A 1U3OA 1W2BS 3UA6A 3A8GB 4QVDA 1VQKQ 2HNIA 1ZQ1A 2EJFA 3OYDA 3J7AF 2XG8D 5GJWB 1TXQA 3P8DA 1MMAA 3CC7Q 3FIFA 4C5HA 3VS5A 4N0AA 4RTYA 1Z9QA 2QQSA 3QXEB 4RTTA 1IO6A 3OYEA 3JCMX 2KR3A 2BUDA 2JTEA 1YWPA 1M90C 3CXCP 3AHUA 2CZ0B 1UGRB 2XI9A 3MCAB 3IQLA 5CK9A 1SKUB 2FVUA 4M75G 4MZTA 3VS1A 1PD0A 3JCMb 1K8AR 3CMEA 5HK3A 2EJ9A 2PTKA 1VQ9Q 4M7AE 1UE9A 4OMPA 4JRQA 1M1KU 1VQ7Q 2F69A 2H3EB 2YUPA 1BB9A 2O01E 3PT9A 1NBEB 2DTIA 1I07A 1WIEA 2YLBA 4HCZA 5GANd 1K73U 4DOWA 5A2QE 4IUPA 1Q7YC 2V8JA 3OSVA 2HL5C 4BDYA 1IXDA 3FLGA 4JLIA 5GAOn 1YHQQ 3VS7A 2KDSA 2JVVA 2CP5A 4HKEA 3NHNA 3G6EQ 2DXBA 1OEBA 4ZGJB 5KYXB 3EFRA 3CCRQ 2ZPBB 1M90R 1D0XA 3SHWA 1VQLQ 2ABLA 3VUZA 3EHQA 1WX6A 3AT1B 1QMCA 1ZBXA 4JRPA 2LNVA 4JJNK 1KD1U 4BI8B 2A36A 1QVGA 1B34B 4OMOA 3TVTA 1WA7A 1UJYA 4OGCA 2A0FB 5CQYA 3QDRB 2ZZDA 2KI7A 3P8HA 2DXUA 4F14A 3OYCA 2DMOA 3QYHB 1SG5A 5LJ5h 2BE9B 2HL3A 5IN1A 2GBQA 4RTUA 2GCXA 3OBYA 1ZUYA 1R77A 2QDYB 3CC4A 1VIEA 2V8KA 5D6WA 1M3CA 5LJ3e 1VQMT 2M02A 1YI2A 1CKBA 4IURA 4N4HA 5GAN4 1YJNQ 3U23A 4EMGA 5D7UA 1W1FA 2EBPA 3M0TA 1NG2A 2HD0A 1M30A 4FU6A 2DVEA 2KNBB 2FRWA 3CCVA 1MNDA 3CPWP 4E7LA 3E2UA 2R57A 4ZN3A 3HSBA 4OB3B 4BUGA 4D8DA 4GLMA 3JCMQ 3L2WA 2KEAA 3NFCA 5AT1B 4ZNXA 1HJDA 3I55Q 4JJBA
chains in the Genus database with same CATH topology
1UFFA 4CC7A 2BZYA 2F2XA 2KRMA 4J9HA 1TUCA 2O2OA 4AG1C 4OMLA 3O5ZA 3EG1A 2QDLA 1AWOA 2DL7A 3THKA 2YUNA 2EQIA 4RTZA 1X43A 2CDTA 1LCKA 2JM8A 1EFNA 1OV3A 1YP5A 2BTTA 2ENMA 2W10A 3NMZC 3PE0A 5IXBA 1WYXA 2E5KA 1M27C 2A37A 4QT7A 2D0NA 2KXDA 2SRCA 1CKAA 1V1CA 1YN8A 2DM1A 3QWYA 2DE0X 2LCSA 2GTJA 2CREA 2JMAA 2YT6A 2DRMA 2GGRA 3VS4A 3REBB 1WLPB 4AFZC 1ABOA 3C0CA 4J9DA 1AZGB 1MV3A 3UF4A 3VRZA 1AWWA 2KROA 2SEMA 3M0SA 1QCFA 1KFZA 2X3WD 1GBQA 1RLPC 1SRLA 2EYYA 1X6GA 4RTWA 4J9GA 2RMOA 2YDLA 2RQTA 1Y57A 2RF0A 4FSSA 2RQUA 4JZ4A 4ORZA 5GJVB 1JEGA 2FO0A 4J9FA 3PVLA 3VRYA 1UUEA 5FW9A 2FEIA 4AFQC 1AVZC 2PZ1A 2M51A 4RUGA 4AFUC 1SRMA 2L3PA 1PRMC 4IIOA 2K79A 1PKTA 5FWBA 3FJ5A 1U06A 4J9EA 2JT4A 3UA7A 3EHRA 2AKLA 2EYWA 1RI9A 5I22A 1NLOC 2CT3A 2G6FX 2OI3A 2FG0A 1SSHA 3VS0A 1OPLA 2RPNA 4LE9A 1H92A 2HCKA 2KRSA 3H41A 3GBQA 4J9BA 2O31A 5FWCA 5IH2A 2AZVA 2OAWA 1M8MA 1UTIA 2L3SA 1AWJA 2EPDA 3PVQA 4EIKA 2YUOA 3JV3A 4CC3A 2RQRA 4HVVA 1TG0A 4HXJA 1UDLA 2J6KA 1KJWA 1HSQA 2D1XA 2DL5A 1N5ZA 2DA9A 2LNHB 2ROTA 4Z89A 2LP5A 1QKWA 4RTVA 1PWTA 1FYNA 4LUDA 1JO8A 1BK2A 2P4RA 1GBRA 1WXBA 2FRYA 4WCIA 2AK5A 3M0UA 4JJDA 4DEYA 2C0OA 1JQQA 1PKSA 2EW3A 2O88A 4LUEA 2JW4A 1H3HA 2DL4A 1AEYA 1GRIA 2IIMA 1G2BA 2VWFA 1AWXA 1MUZA 1YWOA 1ZLMA 2KYBA 1AD5A 1VA7A 1NLPC 1Z9ZA 3A98A 1TUDA 4M4ZA 1WXUA 1ZUUA 2EGCA 2DLPA 2K7AA 1UJ0A 2DVJA 1K1ZA 1K0XA 4LN2A 3SEMA 2ROLA 2ED1A 2GTOA 2CUBA 2KT8A 2O9VA 5IHKA 2HBWA 1E7OA 4X1VA 2K9GA 1B3QA 2AZSA 1MV0B 4Y92A 1X2KA 1ZBJA 3I5RA 4HVWA 1X2QA 2LMJA 4LNPA 2J6OA 4Z8AA 2MCNA 2KXCA 1QLYA 4IIMA 3TSZA 2KGTA 1GCPA 1AOJA 2EGEA 4KRTA 3ZL7C 1VYTA 2KBTA 1ZSGA 2DBKA 2DL3A 2FPDA 4D8KA 2MIOA 2K3BA 1JU5C 1XOVA 2DJQA 1ZUKA 1YCSB 4E6RA 5EC7A 1WXTA 3I35A 1RUWA 1GCQC 2DL8A 2LX7A 4HVUA 2ECZA 1VYVA 1WFWA 1X6BA 4HCKA 1A0NB 1E6GA 1G83A 1NM7A 1AZEA 2C0IA 2D8JA 2DYBA 1NYGA 3R6NA 1FMKA 3NGPA 2C0TA 1ARKA 4J9IA 1J3TA 1PRLC 1NYFA 2JXBA 2CH4W 3H0HA 1GL5A 1KSWA 3RNJA 2EKHA 2B86A 4CC2A 1ABQA 2VKNA 1T3SA 1ZX6A 1UG1A 2M0YA 1UHCA 1H8KA 1U3OA 2RNAA 4ESRA 3REAB 3UA6A 3RBBB 2W0ZA 1BU1A 2JS2A 3EGUA 4JPBW 5GJWB 1UHFA 3UATA 2ESWA 1QWFA 1E6HA 3EG2A 3VS5A 4RTYA 1Z9QA 2HSPA 2L3QA 2DNUA 2EGAA 4RTTA 4OMQA 2VVKA 1IO6A 2O9SA 2LQWA 2KR3A 2L0AA 2BZ8A 2ED0A 2J7IA 5IHIA 1K0SA 2L2PA 4K11A 2JTEA 1YWPA 4RTXA 1WI7A 4F16A 1SHGA 3IQLA 2EYZA 2NUZA 1M3AA 3VS1A 2CT4A 1CSKA 2LJ3A 1UGVA 2MOXA 1SHFA 2OJ2A 5I11A 2RQVA 2H8HA 2A08A 2PTKA 1RLQC 2F2WA 2K2MA 1T0JA 1UE9A 2KE9A 4OMPA 4OMMA 5IXFA 1SEMA 2KT1A 2FPFA 2YUPA 2KRNA 1BB9A 1QKXA 4GBQA 4R0KA 1W6XA 1GFDA 1I07A 1QWEA 1WIEA 2PNIA 2LJ0A 1M3BA 2K6DA 1YNZA 3VS7A 4CC4B 2V1RA 3I5SA 1X69A 4AG2C 4DEXA 2D8HA 1NEGA 1GCQA 3NHNA 1OEBA 2DF6A 3VS3A 4JJCA 1NEBA 2GNCA 1JXMA 5ECAA 3SHWA 1BBZA 2ABLA 2NWMA 5IHNA 2DBMA 4F17A 3I9QA 3EHQA 1WX6A 3CQTA 3EG3A 4J9CA 3EG0A 2A36A 2J05A 3H0FA 5L23A 4OMOA 2RQWA 3TVTA 1WA7A 1UJYA 3M0QA 3LH5A 2HDAA 2J6FA 2A28A 3M0RA 4A63B 4F14A 2DMOA 2JM9A 4Z88A 1JXOA 1HD3A 1OOTA 1I1JA 3VS2A 2LZ6B 3H0IA 2YSQA 3VS6A 1WDXA 2GBQA 1PNJA 3TSWA 2LJ1A 2XMFA 4JZ3A 4RTUA 1I0CA 4AFSC 2I0NA 1ZUYA 2JMCA 2JS0A 2CSQA 1K4US 2EYXA 2LQNA 1T0HA 1M3CA 2HEQA 1CKBA 1K76A 5HCKA 2CH4A 3KFVA 2V1QA 4OMNA 1Y0MA 2EVRA 2J06A 3U23A 1KIKA 2F2VA 2BZXA 2DRKA 1W1FA 2EBPA 1T3LA 2AKKA 3M0TA 1NG2A 1GFCA 1S1NA 1B07A 1M30A 3ULRB 2KNBB 2FRWA 2CSIA 1OPKA 1UECA 3QWXX 2DILA 1PHTA 3M0PA 2GQIA 1VYUA 2RN8A 1K9AA 1U5SA 2DX1A 4D8DA 2CUDA 3NPFA 4GLMA 1X27A 2X3XD 2KYMA 2KEAA 1W70A 4ZNXA 2YUQA 1HJDA 2FPEA 1SPKA 4JJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFF A;  4CC7 A;  2BZY A;  2F2X A;  2KRM A;  4J9H A;  1TUC A;  2O2O A;  4AG1 C;  4OML A;  3O5Z A;  3EG1 A;  2QDL A;  1AWO A;  2DL7 A;  3THK A;  2YUN A;  2EQI A;  4RTZ A;  1X43 A;  2CDT A;  1LCK A;  2JM8 A;  1EFN A;  1OV3 A;  1YP5 A;  2BTT A;  2ENM A;  2W10 A;  3NMZ C;  3PE0 A;  5IXB A;  1WYX A;  2E5K A;  1M27 C;  2A37 A;  4QT7 A;  2D0N A;  2KXD A;  2SRC A;  1CKA A;  1V1C A;  1YN8 A;  2DM1 A;  3QWY A;  2DE0 X;  2LCS A;  2GTJ A;  2CRE A;  2JMA A;  2YT6 A;  2DRM A;  2GGR A;  3VS4 A;  3REB B;  1WLP B;  4AFZ C;  1ABO A;  3C0C A;  4J9D A;  1AZG B;  1MV3 A;  3UF4 A;  3VRZ A;  1AWW A;  2KRO A;  2SEM A;  3M0S A;  1QCF A;  1KFZ A;  2X3W D;  1GBQ A;  1RLP C;  1SRL A;  2EYY A;  1X6G A;  4RTW A;  4J9G A;  2RMO A;  2YDL A;  2RQT A;  1Y57 A;  2RF0 A;  4FSS A;  2RQU A;  4JZ4 A;  4ORZ A;  5GJV B;  1JEG A;  2FO0 A;  4J9F A;  3PVL A;  3VRY A;  1UUE A;  5FW9 A;  2FEI A;  4AFQ C;  1AVZ C;  2PZ1 A;  2M51 A;  4RUG A;  4AFU C;  1SRM A;  2L3P A;  1PRM C;  4IIO A;  2K79 A;  1PKT A;  5FWB A;  3FJ5 A;  1U06 A;  4J9E A;  2JT4 A;  3UA7 A;  3EHR A;  2AKL A;  2EYW A;  1RI9 A;  5I22 A;  1NLO C;  2CT3 A;  2G6F X;  2OI3 A;  2FG0 A;  1SSH A;  3VS0 A;  1OPL A;  2RPN A;  4LE9 A;  1H92 A;  2HCK A;  2KRS A;  3H41 A;  3GBQ A;  4J9B A;  2O31 A;  5FWC A;  5IH2 A;  2AZV A;  2OAW A;  1M8M A;  1UTI A;  2L3S A;  1AWJ A;  2EPD A;  3PVQ A;  4EIK A;  2YUO A;  3JV3 A;  4CC3 A;  2RQR A;  4HVV A;  1TG0 A;  4HXJ A;  1UDL A;  2J6K A;  1KJW A;  1HSQ A;  2D1X A;  2DL5 A;  1N5Z A;  2DA9 A;  2LNH B;  2ROT A;  4Z89 A;  2LP5 A;  1QKW A;  4RTV A;  1PWT A;  1FYN A;  4LUD A;  1JO8 A;  1BK2 A;  2P4R A;  1GBR A;  1WXB A;  2FRY A;  4WCI A;  2AK5 A;  3M0U A;  4JJD A;  4DEY A;  2C0O A;  1JQQ A;  1PKS A;  2EW3 A;  2O88 A;  4LUE A;  2JW4 A;  1H3H A;  2DL4 A;  1AEY A;  1GRI A;  2IIM A;  1G2B A;  2VWF A;  1AWX A;  1MUZ A;  1YWO A;  1ZLM A;  2KYB A;  1AD5 A;  1VA7 A;  1NLP C;  1Z9Z A;  3A98 A;  1TUD A;  4M4Z A;  1WXU A;  1ZUU A;  2EGC A;  2DLP A;  2K7A A;  1UJ0 A;  2DVJ A;  1K1Z A;  1K0X A;  4LN2 A;  3SEM A;  2ROL A;  2ED1 A;  2GTO A;  2CUB A;  2KT8 A;  2O9V A;  5IHK A;  2HBW A;  1E7O A;  4X1V A;  2K9G A;  1B3Q A;  2AZS A;  1MV0 B;  4Y92 A;  1X2K A;  1ZBJ A;  3I5R A;  4HVW A;  1X2Q A;  2LMJ A;  4LNP A;  2J6O A;  4Z8A A;  2MCN A;  2KXC A;  1QLY A;  4IIM A;  3TSZ A;  2KGT A;  1GCP A;  1AOJ A;  2EGE A;  4KRT A;  3ZL7 C;  1VYT A;  2KBT A;  1ZSG A;  2DBK A;  2DL3 A;  2FPD A;  4D8K A;  2MIO A;  2K3B A;  1JU5 C;  1XOV A;  2DJQ A;  1ZUK A;  1YCS B;  4E6R A;  5EC7 A;  1WXT A;  3I35 A;  1RUW A;  1GCQ C;  2DL8 A;  2LX7 A;  4HVU A;  2ECZ A;  1VYV A;  1WFW A;  1X6B A;  4HCK A;  1A0N B;  1E6G A;  1G83 A;  1NM7 A;  1AZE A;  2C0I A;  2D8J A;  2DYB A;  1NYG A;  3R6N A;  1FMK A;  3NGP A;  2C0T A;  1ARK A;  4J9I A;  1J3T A;  1PRL C;  1NYF A;  2JXB A;  2CH4 W;  3H0H A;  1GL5 A;  1KSW A;  3RNJ A;  2EKH A;  2B86 A;  4CC2 A;  1ABQ A;  2VKN A;  1T3S A;  1ZX6 A;  1UG1 A;  2M0Y A;  1UHC A;  1H8K A;  1U3O A;  2RNA A;  4ESR A;  3REA B;  3UA6 A;  3RBB B;  2W0Z A;  1BU1 A;  2JS2 A;  3EGU A;  4JPB W;  5GJW B;  1UHF A;  3UAT A;  2ESW A;  1QWF A;  1E6H A;  3EG2 A;  3VS5 A;  4RTY A;  1Z9Q A;  2HSP A;  2L3Q A;  2DNU A;  2EGA A;  4RTT A;  4OMQ A;  2VVK A;  1IO6 A;  2O9S A;  2LQW A;  2KR3 A;  2L0A A;  2BZ8 A;  2ED0 A;  2J7I A;  5IHI A;  1K0S A;  2L2P A;  4K11 A;  2JTE A;  1YWP A;  4RTX A;  1WI7 A;  4F16 A;  1SHG A;  3IQL A;  2EYZ A;  2NUZ A;  1M3A A;  3VS1 A;  2CT4 A;  1CSK A;  2LJ3 A;  1UGV A;  2MOX A;  1SHF A;  2OJ2 A;  5I11 A;  2RQV A;  2H8H A;  2A08 A;  2PTK A;  1RLQ C;  2F2W A;  2K2M A;  1T0J A;  1UE9 A;  2KE9 A;  4OMP A;  4OMM A;  5IXF A;  1SEM A;  2KT1 A;  2FPF A;  2YUP A;  2KRN A;  1BB9 A;  1QKX A;  4GBQ A;  4R0K A;  1W6X A;  1GFD A;  1I07 A;  1QWE A;  1WIE A;  2PNI A;  2LJ0 A;  1M3B A;  2K6D A;  1YNZ A;  3VS7 A;  4CC4 B;  2V1R A;  3I5S A;  1X69 A;  4AG2 C;  4DEX A;  2D8H A;  1NEG A;  1GCQ A;  3NHN A;  1OEB A;  2DF6 A;  3VS3 A;  4JJC A;  1NEB A;  2GNC A;  1JXM A;  5ECA A;  3SHW A;  1BBZ A;  2ABL A;  2NWM A;  5IHN A;  2DBM A;  4F17 A;  3I9Q A;  3EHQ A;  1WX6 A;  3CQT A;  3EG3 A;  4J9C A;  3EG0 A;  2A36 A;  2J05 A;  3H0F A;  5L23 A;  4OMO A;  2RQW A;  3TVT A;  1WA7 A;  1UJY A;  3M0Q A;  3LH5 A;  2HDA A;  2J6F A;  2A28 A;  3M0R A;  4A63 B;  4F14 A;  2DMO A;  2JM9 A;  4Z88 A;  1JXO A;  1HD3 A;  1OOT A;  1I1J A;  3VS2 A;  2LZ6 B;  3H0I A;  2YSQ A;  3VS6 A;  1WDX A;  2GBQ A;  1PNJ A;  3TSW A;  2LJ1 A;  2XMF A;  4JZ3 A;  4RTU A;  1I0C A;  4AFS C;  2I0N A;  1ZUY A;  2JMC A;  2JS0 A;  2CSQ A;  1K4U S;  2EYX A;  2LQN A;  1T0H A;  1M3C A;  2HEQ A;  1CKB A;  1K76 A;  5HCK A;  2CH4 A;  3KFV A;  2V1Q A;  4OMN A;  1Y0M A;  2EVR A;  2J06 A;  3U23 A;  1KIK A;  2F2V A;  2BZX A;  2DRK A;  1W1F A;  2EBP A;  1T3L A;  2AKK A;  3M0T A;  1NG2 A;  1GFC A;  1S1N A;  1B07 A;  1M30 A;  3ULR B;  2KNB B;  2FRW A;  2CSI A;  1OPK A;  1UEC A;  3QWX X;  2DIL A;  1PHT A;  3M0P A;  2GQI A;  1VYU A;  2RN8 A;  1K9A A;  1U5S A;  2DX1 A;  4D8D A;  2CUD A;  3NPF A;  4GLM A;  1X27 A;  2X3X D;  2KYM A;  2KEA A;  1W70 A;  4ZNX A;  2YUQ A;  1HJD A;  2FPE A;  1SPK A;  4JJB A; 
#chains in the Genus database with same CATH topology
 1M90 U;  4CC7 A;  2RJC A;  1K9M C;  1QQJ A;  1JB0 E;  1WHH A;  1YHQ A;  3JB9 D;  1D3B B;  4AG1 C;  3O5Z A;  3OYM A;  4FL6 A;  2LRQ A;  3G6E A;  5J26 A;  4OVA A;  1OV3 A;  5IXB A;  3MPU B;  2QEX Q;  1WYX A;  1YFN A;  2A37 A;  2O4X A;  2D0N A;  1V1C A;  1N27 A;  1VIF A;  2DM1 A;  5GAO m;  2OTL A;  1QVF A;  4PL6 A;  1K8A C;  4LDY A;  3CCV T;  2CRE A;  3EG9 A;  3DB3 A;  3JCM W;  1KQS A;  3CCL T;  3LW5 E;  4PJO C;  4RG8 A;  3ER0 A;  2IVW A;  2RO0 A;  4J9D A;  1RAD B;  4IKF A;  3RIR A;  2HSE B;  1FMV A;  1RAE B;  4PFZ A;  3VRZ A;  1BI2 A;  3TQ7 P;  1B34 A;  4NOY A;  2COW A;  1FXX A;  4M78 F;  1Q7Y R;  5LJ5 e;  2SEM A;  4LDV A;  3QPH A;  1QCF A;  2DO3 A;  4EMH A;  3JB9 I;  1GBQ A;  5LJ3 f;  2MWO A;  1RLP C;  1S72 T;  1NPR A;  2DPP B;  2FHD A;  2NUP A;  4B6M A;  4RTW A;  4M7A B;  3CEY A;  2RMO A;  2YDL A;  3WVE B;  2MMP A;  3QII A;  2RQU A;  4EMK A;  5GJV B;  1JEG A;  2ZPG B;  1FX7 A;  4UC4 A;  3QZ9 B;  4AMC A;  1TSF A;  3PVL A;  5KCO A;  5C6S A;  2L89 A;  2LCL A;  4LXC A;  4LD6 A;  3INZ A;  1PRM C;  4IIO A;  3SWN A;  4LDU A;  2KMT A;  3EHR A;  3UA7 A;  1VQ6 Q;  4E7Z A;  2HQH A;  4GLK A;  2G6F X;  1KD1 C;  3QKJ A;  1WPY A;  1OPL A;  1VQ5 T;  1OQK A;  2Y90 A;  5LJ5 d;  3V7R A;  2AHJ B;  2E64 A;  3H41 A;  3GBQ A;  3MP6 A;  3QZ5 B;  3BY7 A;  5FWC A;  2AZV A;  2R5M A;  2OAW A;  4C5E A;  3EFO A;  3G71 Q;  2QEX T;  1G3W A;  3P8B B;  1TUG B;  1UDL A;  4FYV B;  4E7J A;  3E9G A;  4L5G A;  1D1A A;  4BAC A;  1RAH B;  1K9M R;  2C06 A;  1G5V A;  3E1S A;  5KYY B;  1RAB B;  3X26 B;  1VOM A;  3L2Z A;  3GOX A;  5GAO l;  1H3H A;  3E19 A;  3ZFJ A;  1ACM B;  1Q86 R;  1GRI A;  3V8L A;  1VQK T;  2DK3 A;  1MUZ A;  3PMT A;  3OYH A;  2K5I A;  2K2V A;  2EIF A;  2DLP A;  3GNG A;  2K7A A;  4MZP A;  3S6W A;  4C0G A;  3MP1 A;  1QP2 A;  1UJ0 A;  1K0X A;  4LN2 A;  3SEM A;  1RL2 A;  3URG A;  2KT8 A;  4PJO A;  2HBW A;  4B9X A;  1E7O A;  3DKM A;  1I5O B;  1S72 A;  2HQX A;  2AZS A;  2VB6 A;  2RK2 A;  4HA8 A;  1R0B G;  2YRD A;  1ZBJ A;  4DA4 A;  1VQL T;  1X2Q A;  4C8Q A;  3JCM f;  2J6O A;  4M7A F;  1JJ2 A;  3JCM g;  4BE0 A;  2E1H A;  1SF9 A;  1TS9 A;  2KGT A;  3EH2 A;  3ZL7 C;  4FIB A;  3OYA A;  2E6Z A;  2CP0 A;  4C5G A;  2ZPE B;  3ME9 A;  1YCS B;  2AIR B;  5EC7 A;  2D0Q B;  2LX7 A;  1Q82 U;  4KBM B;  4X9C A;  1X6B A;  3N5B B;  4XTY A;  1IGU A;  1LNX A;  1E6G A;  1NM7 A;  5KYU B;  3G6E T;  3JCM V;  3V7S A;  1KD1 R;  2RJD A;  1PRL C;  4JLG A;  1D1C A;  3PMI A;  2CH4 W;  5FU7 C;  1IHV A;  2EKH A;  4CC2 A;  2VKN A;  1T3S A;  1G3Y A;  1JBM A;  1UGQ B;  2GQV A;  5GMK i;  2XID A;  4BI4 A;  5GAO r;  1BU1 A;  5GAN 8;  2OAU A;  3HRS A;  5DLQ E;  3CCQ T;  4BY6 B;  3CCS Q;  2HSP A;  1R8O B;  1KQS S;  1MNE A;  1PG5 B;  1NJI C;  4A54 A;  3O8V A;  2L0A A;  2J7I A;  4M77 D;  1ZA1 B;  3G4S T;  5IHI A;  1U1S A;  2OTJ A;  1VQM A;  1Q86 C;  4RTX A;  2DEQ A;  1SHG A;  2LCC A;  1M2V B;  2NUZ A;  5DY9 A;  3LWH A;  1Q7Y U;  1CSK A;  1YJ9 T;  4M7D G;  2MOX A;  1RLQ C;  5CKB A;  2OX7 A;  2KT1 A;  2FPF A;  3OY9 A;  3VUB A;  4XTX A;  4ZGE B;  2KRN A;  2LVM A;  3MHX A;  4R0K A;  1QWE A;  2PNI A;  4D6W A;  4FYX B;  4FYW B;  3SWN C;  3M5A A;  2LT4 A;  1OX8 A;  1M3B A;  3KXT A;  2K6D A;  3SDZ A;  4XTV A;  1YIJ A;  2VGM A;  2HQE A;  3T9N A;  4OP0 A;  3TU4 K;  2RB6 A;  4OGE A;  1WHK A;  3M54 A;  4FT2 A;  3HRU A;  4DEX A;  2D8H A;  1NEG A;  4M78 B;  1Q81 C;  1PM3 A;  4JJC A;  3FDR A;  3G71 T;  3OYY A;  3M59 A;  4A4K A;  1KQ2 A;  2ZCF B;  4WTO B;  5IHN A;  3GF5 A;  5CKF A;  4M7D D;  4KUD K;  1M8V A;  4QKU A;  3JCM e;  5GAN 2;  2EAY A;  4PJL A;  3H0F A;  4HCB A;  1VQ6 T;  1C0M A;  1IHW A;  4RKU E;  3RKW A;  4XTW A;  4KT0 E;  3CCM T;  1Y96 B;  3CCJ Q;  4MDX A;  4A4E A;  3M0R A;  1BIA A;  4EMK C;  1JXO A;  3VS2 A;  1OI1 A;  2LZ6 B;  3H0I A;  5KYU A;  1K73 C;  3VS6 A;  1WDX A;  2YRC A;  1PNJ A;  2HKQ B;  3HHT B;  4M78 D;  4AFS C;  2I0N A;  3X28 B;  3RMS A;  1K4U S;  2LQN A;  1T0H A;  1MMD A;  1K76 A;  2V1Q A;  2F2V A;  2BZX A;  2JN0 A;  4J6W A;  1T3L A;  2AKK A;  4C92 F;  4X9D A;  1VQ7 T;  1MGQ A;  4MZM A;  4PFP A;  2CSI A;  1WJS A;  2KSS A;  1UEC A;  1Q81 R;  2CS7 A;  3C4S A;  3QJ6 A;  3S3O A;  3JB9 H;  4KUL A;  3EFS A;  3JCM c;  1U5S A;  3SFM A;  1NE8 A;  1RAF B;  1XJW B;  2RA2 A;  1G8X A;  2CUD A;  3NPF A;  4C5I A;  2L8D A;  3MEA A;  3RDV A;  3CCL Q;  1V76 A;  4RG2 A;  2FPE A;  1SPK A;  4NL2 A;  4EDU A;  2PVG B;  1VQ9 T;  4MMK A;  1OU8 A;  4ZTJ A;  4J9H A;  1TUC A;  2O2O A;  4A53 A;  2CP6 A;  1AWO A;  2DL7 A;  2PUK B;  5GMK e;  3OYJ A;  4QQ6 A;  1LCK A;  1YP5 A;  2BTT A;  5LJ5 j;  2E5K A;  5GAN f;  4M78 C;  4QT7 A;  2VXF A;  4M78 A;  1QW1 A;  2KXD A;  4JS4 A;  1CKA A;  3QWY A;  1ZHI A;  1D09 B;  1XNI A;  4J5Y A;  3VS4 A;  3A5Z B;  2V26 A;  3REB B;  5GAN 7;  1M1G A;  1ABO A;  3C0C A;  4YTL A;  3SWN B;  1MV3 A;  3VKI A;  4A4H A;  2A3L A;  2JUF A;  3CCJ A;  4BD3 A;  1LOJ A;  5D6X A;  4F7U E;  1VQ4 T;  3LGF A;  3M0S A;  1RAC B;  4JS5 A;  2RHX A;  2LDM A;  2XKO C;  1HYO A;  1YJN T;  2EYY A;  3QG1 A;  2RQT A;  4ORZ A;  2X4J A;  3TEE A;  2BKD N;  2P0Q A;  4M78 E;  3J81 E;  1IZ6 A;  2COY A;  4DBQ A;  2FL7 A;  2M51 A;  1SRM A;  3H8Z A;  1PKT A;  2EQJ A;  2JT4 A;  1BCM A;  2AKL A;  1RI9 A;  5I22 A;  2OI3 A;  3CCL A;  2FG0 A;  1IRX A;  3VS0 A;  4LE9 A;  2KRS A;  5A0L A;  4J9B A;  2RI2 A;  4ZTF A;  4QVC A;  3OS0 A;  3SB2 A;  2IG0 A;  3PVQ A;  4EPC A;  3QUI A;  4JRI A;  2YUO A;  3JV3 A;  3CBO A;  4CC3 A;  1QVF P;  2M0O A;  1TG0 A;  5GAM h;  2J6K A;  3LGL A;  5C0M A;  1N5Z A;  1VUB A;  5FRN A;  2ROT A;  4J7I A;  5GAO q;  4RTV A;  1QVG S;  2QXF A;  1FYN A;  2P4R A;  4ME7 A;  2FRY A;  4C92 A;  2AK5 A;  4DEY A;  5HKC A;  2O88 A;  1C6V X;  2EW3 A;  1ZSZ C;  4LDX A;  2CGH A;  2EWN A;  3Q1J A;  4XU1 A;  1AEY A;  2OTJ T;  1W2B A;  2VWF A;  1YCY A;  2DD5 A;  3HL8 A;  4BDZ A;  1AWX A;  3CC7 A;  1ZLM A;  3BW1 A;  2KYB A;  2COZ A;  1B7T A;  1VA7 A;  1NLP C;  1TUD A;  5LL6 S;  2EGC A;  3CCE T;  2QK0 A;  3M53 A;  3LLR A;  1NJI U;  2PVO B;  3GLX A;  3CC2 Q;  1K1Z A;  2VGN A;  2CP2 A;  4C92 D;  2CUB A;  1SSF A;  2P84 A;  4LD9 K;  2E3I A;  4JUV A;  1B3Q A;  4KGV B;  5GAN j;  5LJ3 h;  3C95 A;  1YIJ T;  1MV0 B;  2JTF A;  3I5R A;  3F70 A;  4HVW A;  2LMJ A;  3L2U A;  4PJO E;  2EQU A;  1VQ7 A;  2LQK A;  3M56 A;  1KG1 A;  4KRT A;  1BCO A;  1N8R U;  5GAM g;  2KBT A;  3QO3 A;  3X20 B;  3SD4 A;  2RHY A;  3FB9 A;  2CP3 A;  4M75 B;  3CXC S;  2MI6 A;  4D8K A;  1D0Z A;  4C0F A;  4V2S A;  1ZUK A;  4E7K A;  2ZPI B;  4E6R A;  1WXT A;  1YJ9 A;  4QQD A;  1GCQ C;  1TTH B;  2JZ2 A;  3HTR A;  4QQG A;  3OYN A;  3EH1 A;  3CCS T;  2CZ6 B;  4E47 A;  4C8Q G;  3R6O A;  1YJW A;  2DYB A;  1O9S A;  5I2M A;  3G4S A;  4KH1 B;  1M1K C;  2LQ8 A;  4J9I A;  2DKG A;  3CCU T;  2JNG A;  2JXB A;  1JJ2 S;  1KC8 C;  2QGG A;  1H3Z A;  3D7S B;  1ZX6 A;  2DET A;  3EG9 B;  2M0Y A;  4MML A;  3RBB B;  3HPW A;  2W0Z A;  2HZY A;  2JS2 A;  2K4Y A;  3EGU A;  4M77 E;  2VV5 A;  4F7U F;  3JRZ A;  3UAT A;  2FB7 A;  5FU6 B;  3CBM A;  2F5T X;  4FSX A;  1E6H A;  3EG2 A;  2L3Q A;  4DQ2 A;  2D9T A;  4PJO D;  1IB8 A;  2VVK A;  5GAN 6;  1EZZ B;  3CCU Q;  2ED0 A;  1K0S A;  2L2P A;  2DZ9 A;  4K11 A;  3DLL A;  5FRO A;  2YRV A;  1DJ7 B;  1WI7 A;  4KH0 B;  4EMK B;  4C8Q C;  5KCH A;  2HBP A;  2X35 A;  4C92 B;  4CI0 C;  2X4Y A;  3G7Z A;  2WSE E;  2CT4 A;  5LJ3 g;  5CCA A;  3CCV Q;  2LJ3 A;  1UGV A;  1P92 A;  1WHM A;  1SHF A;  4N4I A;  3MP8 A;  4L59 A;  2OJ2 A;  2H8H A;  2A08 A;  2RQV A;  5I11 A;  2F2W A;  1T0J A;  3LH0 A;  1U8R A;  1OYX A;  5IXF A;  1UGP B;  4R56 A;  1QKX A;  2QQ9 A;  2LTO A;  4FYY B;  1W6X A;  5LJ5 f;  3H6Z A;  4M77 C;  5GAN 3;  2LJ0 A;  1QVP A;  1V29 B;  1YNZ A;  2LC4 A;  1YJ9 Q;  4OMF B;  4II1 A;  2NLU A;  2ZAE A;  3CC7 T;  4CC4 B;  2V1R A;  3JB9 J;  2PVD B;  3I5S A;  1X69 A;  4AG2 C;  3WXM B;  1GCQ A;  2RI3 A;  4PNO A;  1C1A A;  2GNC A;  1JXM A;  3G4S Q;  5ECA A;  5AYF A;  5GAN g;  2XDD A;  1WHL A;  2NWM A;  4F17 A;  3CXC A;  3JCM J;  5L8R E;  2D6F A;  3EG0 A;  2DYI A;  1VQK A;  4XAX B;  4MDW A;  5GAM j;  1KK7 A;  3M0Q A;  3JCM P;  2QTV A;  3VYH B;  2J6F A;  3KBG A;  2A28 A;  1OZ2 A;  4C92 C;  4F7U G;  2QA4 A;  4M75 E;  2DZC A;  2JM9 A;  3QBY A;  6AT1 B;  1HD3 A;  3ZBD A;  1OOT A;  1I1J A;  1H64 1;  1KC8 R;  4ZN1 A;  2YSQ A;  2LJ1 A;  4JZ3 A;  1I0C A;  1BI3 A;  4J6X A;  2JMC A;  2XDB A;  2JS0 A;  1OX9 A;  2RHI A;  4OMN A;  1Y0M A;  2EVR A;  2V8I A;  2HAX A;  1VQP T;  1S1N A;  2HMA A;  4F04 B;  1B07 A;  4PFO A;  1FMW A;  1OPK A;  3QWX X;  2DIL A;  4M7D F;  3UT1 A;  1VQ9 A;  4FCY A;  1NJI R;  1LPL A;  3M0P A;  1RI0 A;  2GQI A;  1VYU A;  2RN8 A;  1K9A A;  2DX1 A;  5GAN h;  4PJM A;  4IUT A;  3HKS A;  5GAN e;  2Y4X A;  1PSF A;  4C92 E;  1YHQ T;  2W10 A;  2CKK A;  4M75 C;  1UFF A;  4ELY C;  2BZY A;  4F7U A;  4KGX B;  2F2X A;  2YXY A;  2KRM A;  2KQW A;  1U1T A;  4BE2 A;  2P0K A;  4X34 A;  2M1H A;  2NUT A;  1QVF S;  2K3X A;  1HXD A;  2QDL A;  3OQ5 A;  5CKD A;  1I8F A;  2RHU A;  4PJJ A;  4RTZ A;  1X43 A;  2CDT A;  1EFN A;  2JM8 A;  3NMZ C;  2DJZ A;  1BIB A;  3CCR A;  4PLI A;  5GAM d;  2DEU A;  2SRC A;  5CIU A;  1YN8 A;  3M4G A;  3RER A;  2RD1 A;  2DE0 X;  4Q5W A;  1XTD A;  1G3S A;  2GTJ A;  3V8K A;  2YT6 A;  2GGR A;  4HT9 A;  2FZG B;  1WLP B;  2MF2 A;  1YBY A;  3UPU A;  4HT8 A;  2K5L A;  2Z0W A;  3OW2 A;  2QA4 Q;  1GXI E;  2VUB A;  2E10 A;  3DLM A;  4A4F A;  1MHN A;  2KRO A;  4FT4 A;  3I56 A;  1KFZ A;  2X3W D;  3I55 T;  1BKB A;  1RAG B;  3TRE A;  1Y7X A;  1ZSZ A;  1BI1 A;  1R0C B;  3CC4 Q;  1X6G A;  4J9G A;  4JDS A;  2X9H A;  1YI2 Q;  2DIQ A;  1YJN A;  2DAQ A;  3S3M A;  3CC2 T;  2FO0 A;  5CAI A;  5CR2 A;  2EJG A;  2QQB A;  2E4H A;  1I81 A;  4M7A G;  3FC3 A;  2FEI A;  4AFQ C;  2FYK A;  2FZC B;  2FZK B;  1AVZ C;  2PZ1 A;  4RUG A;  4AFU C;  1MMG A;  2CYZ B;  1UB4 A;  4C0D C;  2K79 A;  5FWB A;  4XTU A;  1K8A U;  3GIB A;  3FJP A;  4ANJ A;  4ZGD B;  2EYW A;  2CT3 A;  8ATC B;  5CO7 A;  3I55 A;  3VU3 C;  2RPN A;  4PKC C;  2HCK A;  5CQX A;  4A4G A;  1K9M U;  3CMA T;  2O31 A;  3OMG A;  5IH2 A;  3OYK A;  2QQR A;  1K73 R;  2P0P A;  3LYI A;  5J39 A;  1M8M A;  9ATC B;  2L3S A;  1QP3 A;  4XU3 A;  2KAF A;  1AWJ A;  2F1L A;  4EIK A;  3CCQ Q;  4C8Q F;  1G3T A;  2RQR A;  4HVV A;  4HXJ A;  4OF1 A;  2ATC B;  2IPO B;  2QTX A;  3JAM E;  2QEX A;  3UDC A;  2KK4 A;  2DA9 A;  1UEB A;  3FEO A;  2LNH B;  2Y4Y A;  3MKD A;  1VQN Q;  4Z89 A;  5GAM e;  3ASK A;  1VQO Q;  4PLL A;  1EX4 A;  2OTL Q;  4C0D B;  2P4T A;  3RUX A;  1BK2 A;  1WXB A;  4WCI A;  3NTK A;  4PJN A;  2H3J A;  4BB7 A;  3CCR T;  3M0U A;  4JJD A;  1F1B B;  2C0O A;  1JQQ A;  1PKS A;  2JW4 A;  4XQ3 A;  2DL4 A;  4ELZ C;  1O75 A;  4F7U B;  1YWO A;  1Q82 C;  2KY9 A;  2NUT B;  3OW2 P;  2ZPF B;  4RMO A;  4M75 A;  3MEV A;  3A98 A;  5GAM f;  3C94 A;  1WXU A;  3I56 Q;  4FW1 A;  3M58 A;  3L2V A;  8AT1 B;  1MMN A;  2DVJ A;  1M1K R;  1VQP Q;  1M2O A;  4HCC A;  2ROL A;  4IUQ A;  2GTO A;  1BI0 A;  1WNL A;  2O9V A;  5IHK A;  4M77 G;  5LJ3 j;  4KGZ B;  2DTH A;  3OS5 A;  4M7D E;  2K9G A;  3HRT A;  3MET A;  5IAY A;  2JOY A;  4IUU A;  4J83 A;  1WQW A;  2YHT A;  3M57 A;  1OZ3 A;  4Z8A A;  3L42 A;  1I5L A;  3CPW S;  2KXC A;  2F5K A;  4IIM A;  3TSZ A;  5J3B A;  5FU7 B;  3M4Y A;  4O5V A;  3G1J A;  5A0D A;  1YI2 T;  3HFO A;  1VQ6 A;  2VAS A;  2GFA A;  2DIG A;  2L3R A;  4M77 A;  1OU9 A;  3BE3 A;  4DBH A;  3L2Q A;  4C92 G;  3OS2 A;  4KUI A;  1ZSZ B;  2DBK A;  2DL3 A;  4O6J A;  3OYI A;  1TH7 A;  2K3B A;  1JU5 C;  2ZPH B;  1XOV A;  1KHC A;  5D6Y A;  1YIJ Q;  2DL8 A;  3BFM A;  5CKE A;  1VYV A;  3WVD B;  2E41 A;  3PTA A;  3G71 A;  2RJF A;  4BE1 A;  3CCQ A;  2XIC A;  2CZ7 B;  2GF7 A;  1AZE A;  3ZEH A;  3E9F A;  2D8J A;  1NYG A;  3NTI A;  1N9R A;  1VQN A;  1J3T A;  2B8A A;  2E5Q A;  2O4X B;  1EIF A;  2DD4 A;  1VQO A;  4M7D C;  1AT1 B;  1NYF A;  1Q86 U;  1WJR A;  2AT1 B;  2CP7 A;  1GL5 A;  1KSW A;  2M16 A;  1X01 A;  1UHC A;  1H8K A;  2DTO A;  4XU2 A;  2RNA A;  4ESR A;  5GMK j;  3JCM d;  3REA B;  3EGX A;  4XTZ A;  2DER A;  4XU0 A;  1W2B P;  1X6O A;  2WSC E;  4JPB W;  5EG2 A;  5KYN A;  1UHF A;  2RJE A;  5FRM A;  2ESW A;  1QWF A;  5M9O A;  1JJ2 P;  2I2L A;  1TOV A;  2ZGW A;  5LJ3 d;  4J6Y A;  1I4K 1;  2DNU A;  2EGA A;  1N8R C;  3RES A;  4WF2 A;  5GMK m;  4OMQ A;  1VQ5 Q;  2O9S A;  4E2F B;  4TVR A;  4FW2 A;  2LQW A;  1NZ9 A;  2BZ8 A;  1VQP A;  2VC8 A;  3CPF A;  2KVQ G;  3JB9 G;  2NUP B;  1TWB A;  5IT9 E;  4M7A A;  3OW2 S;  3BDU A;  4M7D A;  1NPP A;  4F16 A;  3MEU A;  4M77 F;  5I2S A;  2EYZ A;  1S72 Q;  1M3A A;  4XK8 E;  3QYG B;  2YWW A;  2DFU A;  1D1B A;  2OTL T;  2K2M A;  2KE9 A;  3L2R A;  3JCM h;  4OMM A;  1SEM A;  3V8J A;  2BIV A;  4GBQ A;  1GFD A;  2LT1 A;  3GPL A;  3OS1 A;  3UWN A;  2QI2 A;  4OB2 B;  3A8L B;  3EAE A;  3OYF A;  4M77 B;  2QYZ A;  1LJO A;  1M4Z A;  1Y07 A;  2K3Y A;  4VUB A;  2GFU A;  5KE2 A;  3EFO B;  2QGF B;  1RAA B;  3PGG A;  2DF6 A;  2XHC A;  1JRI A;  3VS3 A;  3VV0 A;  1NEB A;  1KQS P;  3HP9 A;  5KE3 A;  3CD6 T;  1N9S A;  3CMA Q;  1BBZ A;  2DBM A;  3I9Q A;  1PCX A;  3RMQ A;  1QVG P;  5KYY A;  3CQT A;  3EG3 A;  4J9C A;  4JRK A;  3OYB A;  2XU8 A;  2J05 A;  5L23 A;  1FWZ A;  2RQW A;  5HY6 A;  5A0G A;  4AT1 B;  3EGX B;  3LH5 A;  2HDA A;  3CCS A;  4A63 B;  4Z88 A;  4N0A C;  3A8H B;  2QAS A;  1VQ4 A;  2E3H A;  1VQ5 A;  3TSW A;  2XMF A;  1PSE A;  2XDP A;  5CKH A;  1YIT A;  1LVK A;  2OTJ Q;  4RCC A;  2WAC A;  2CSQ A;  1QCN A;  2EYX A;  5GMK l;  1VQM Q;  4M75 D;  2HEQ A;  5KYX A;  1KC8 U;  5HCK A;  4E7I A;  2CH4 A;  3KFV A;  2J06 A;  1KIK A;  3LX7 A;  4M7A D;  2DRK A;  3QHS A;  1GFC A;  4R55 A;  4M75 F;  1D0Y A;  4M7D B;  3ULR B;  2MK5 A;  1N8R R;  3OBW A;  1PHT A;  1X75 C;  1RAI B;  4C8Q B;  4BI3 A;  4GY5 A;  1M5Q 1;  2PUO B;  3GP8 A;  1Q95 G;  2E70 A;  2M9U A;  5I21 A;  3PFS A;  3X25 B;  5KH6 A;  1X27 A;  2X3X D;  2KYM A;  1W70 A;  2YUQ A;  2A7Y A;  3CBP A;  3I56 T;  1OUL A;  3TCJ A;  1QCO A;  3QJY A;  2YLC A;  2JTM A;  4OML A;  3RKX A;  3A1P A;  3EG1 A;  4C8Q E;  1VQ8 T;  3THK A;  2YUN A;  2EQI A;  1HK9 A;  3PNW C;  4DBF A;  4ATO A;  2ENM A;  3PE0 A;  4OB1 B;  2PQW A;  1M27 C;  4C8Q D;  3CMA A;  4B9W A;  2RH2 A;  2LCS A;  3CME T;  1UGS B;  4QVZ A;  3QSU A;  2JMA A;  2DRM A;  2VYT A;  3H9N A;  3CCJ T;  4AFZ C;  4IUV A;  2RK1 A;  4Z02 A;  5KYW B;  1AZG B;  4NS5 A;  2QQA A;  2QAZ A;  3UF4 A;  5FU6 C;  2CZ1 B;  1WJQ A;  3L1A A;  1AWW A;  4N4G A;  3MJX A;  1XQH A;  1ZA2 B;  2E6N A;  2MWP A;  1VQ4 Q;  1D3B A;  2NYS A;  3CC2 A;  1YIT Q;  3CCM A;  1BYM A;  1SRL A;  3HFN A;  4PJO F;  2WSF E;  1Y57 A;  2RF0 A;  4FSS A;  4E7S A;  1VQ8 A;  4JZ4 A;  2EKO A;  1M2V A;  3QDF A;  4J9F A;  3VRY A;  1UUE A;  5FW9 A;  1W4S A;  4J8O A;  3M9Q A;  3VJP A;  5CVI A;  5HK0 A;  2K5F A;  2BE7 D;  1Q82 R;  3M55 A;  2L3P A;  4RCB A;  2XK0 A;  1WGS A;  1YJW T;  4LDW A;  3FJ5 A;  1U06 A;  4J9E A;  2RHZ A;  3CC4 T;  1NLO C;  3EGD B;  2XD0 A;  4Y91 A;  1SSH A;  2EQM A;  1WHG A;  1H92 A;  3OSS C;  3LWI A;  3OB9 A;  3VYG A;  3OYG A;  3KUF A;  2QA4 T;  3RKY A;  1UTI A;  2EPD A;  5LJ5 g;  2MAM A;  4CRI A;  2EFI A;  4E7H A;  1YJW Q;  2VXE A;  1KJW A;  1HSQ A;  2D1X A;  2DL5 A;  1YIT T;  1KHI A;  2X51 A;  1M9S A;  3OYL A;  2R5A A;  2LP5 A;  4DBR A;  1WQ7 A;  3CCE Q;  1QKW A;  2L5Q A;  1PWT A;  4P5N A;  3FRN A;  2MYS A;  4LUD A;  2E65 A;  1JO8 A;  1GBR A;  1PD1 A;  2DXT A;  3CD6 Q;  4J7F A;  3CPW A;  4FM4 B;  3DB4 A;  4LUE A;  2K57 A;  1PC0 A;  2IIM A;  2EYQ A;  1G2B A;  2R58 A;  3NTH A;  4DOV A;  1Y96 A;  3JSC A;  2E12 A;  1AD5 A;  2RM4 A;  1AHJ B;  4M78 G;  1Z9Z A;  4M4Z A;  1Y71 A;  2EQK A;  1IRE B;  1ZUU A;  2X4W A;  5DM7 R;  3CCU A;  1WZO A;  2LX9 A;  3OA6 A;  3JB9 F;  2ED1 A;  3CCM Q;  5GMK h;  3S3N A;  4PJO G;  3PIP A;  1N6A A;  4QW2 A;  1VQ8 Q;  4X1V A;  4BY6 C;  4C0Z A;  2QG9 B;  2X4X A;  4Y92 A;  5KYW A;  1X2K A;  4L6V 5;  3CME Q;  2RI5 A;  4LNP A;  7AT1 B;  2MCN A;  1VQO T;  1VQN T;  1QLY A;  3X24 B;  1WHJ A;  3A8M B;  1GCP A;  1AOJ A;  2EGE A;  1VYT A;  3V7C A;  4NL3 A;  5DLO A;  2PU9 B;  1Q81 U;  1ZSG A;  2HKN A;  2DXC A;  1M1F A;  2FPD A;  3MEW A;  5GAN 5;  2MIO A;  2G3R A;  2DJQ A;  5FLX E;  1IGQ A;  3RR6 A;  3EGD A;  3I35 A;  1RUW A;  4HVU A;  2ECZ A;  4Y28 E;  1WFW A;  4HCK A;  4OB0 B;  1A0N B;  2MPX C;  4PJO B;  1G83 A;  3A8O B;  3J80 E;  3GNF B;  2C0I A;  3PIO A;  3R6N A;  4PK4 A;  1FMK A;  3NGP A;  2C0T A;  3C12 A;  1ARK A;  3BDL A;  1TU0 B;  3OMC A;  2JJ9 A;  3CCE A;  1KQ1 A;  5GAO p;  4M7A C;  1VQL A;  3H0H A;  3RNJ A;  2B86 A;  1ABQ A;  3MO8 A;  1UG1 A;  3CD6 A;  1U3O A;  1W2B S;  3UA6 A;  3A8G B;  4QVD A;  1VQK Q;  2HNI A;  1ZQ1 A;  2EJF A;  3OYD A;  3J7A F;  2XG8 D;  5GJW B;  1TXQ A;  3P8D A;  1MMA A;  3CC7 Q;  3FIF A;  4C5H A;  3VS5 A;  4N0A A;  4RTY A;  1Z9Q A;  2QQS A;  3QXE B;  4RTT A;  1IO6 A;  3OYE A;  3JCM X;  2KR3 A;  2BUD A;  2JTE A;  1YWP A;  1M90 C;  3CXC P;  3AHU A;  2CZ0 B;  1UGR B;  2XI9 A;  3MCA B;  3IQL A;  5CK9 A;  1SKU B;  2FVU A;  4M75 G;  4MZT A;  3VS1 A;  1PD0 A;  3JCM b;  1K8A R;  3CME A;  5HK3 A;  2EJ9 A;  2PTK A;  1VQ9 Q;  4M7A E;  1UE9 A;  4OMP A;  4JRQ A;  1M1K U;  1VQ7 Q;  2F69 A;  2H3E B;  2YUP A;  1BB9 A;  2O01 E;  3PT9 A;  1NBE B;  2DTI A;  1I07 A;  1WIE A;  2YLB A;  4HCZ A;  5GAN d;  1K73 U;  4DOW A;  5A2Q E;  4IUP A;  1Q7Y C;  2V8J A;  3OSV A;  2HL5 C;  4BDY A;  1IXD A;  3FLG A;  4JLI A;  5GAO n;  1YHQ Q;  3VS7 A;  2KDS A;  2JVV A;  2CP5 A;  4HKE A;  3NHN A;  3G6E Q;  2DXB A;  1OEB A;  4ZGJ B;  5KYX B;  3EFR A;  3CCR Q;  2ZPB B;  1M90 R;  1D0X A;  3SHW A;  1VQL Q;  2ABL A;  3VUZ A;  3EHQ A;  1WX6 A;  3AT1 B;  1QMC A;  1ZBX A;  4JRP A;  2LNV A;  4JJN K;  1KD1 U;  4BI8 B;  2A36 A;  1QVG A;  1B34 B;  4OMO A;  3TVT A;  1WA7 A;  1UJY A;  4OGC A;  2A0F B;  5CQY A;  3QDR B;  2ZZD A;  2KI7 A;  3P8H A;  2DXU A;  4F14 A;  3OYC A;  2DMO A;  3QYH B;  1SG5 A;  5LJ5 h;  2BE9 B;  2HL3 A;  5IN1 A;  2GBQ A;  4RTU A;  2GCX A;  3OBY A;  1ZUY A;  1R77 A;  2QDY B;  3CC4 A;  1VIE A;  2V8K A;  5D6W A;  1M3C A;  5LJ3 e;  1VQM T;  2M02 A;  1YI2 A;  1CKB A;  4IUR A;  4N4H A;  5GAN 4;  1YJN Q;  3U23 A;  4EMG A;  5D7U A;  1W1F A;  2EBP A;  3M0T A;  1NG2 A;  2HD0 A;  1M30 A;  4FU6 A;  2DVE A;  2KNB B;  2FRW A;  3CCV A;  1MND A;  3CPW P;  4E7L A;  3E2U A;  2R57 A;  4ZN3 A;  3HSB A;  4OB3 B;  4BUG A;  4D8D A;  4GLM A;  3JCM Q;  3L2W A;  2KEA A;  3NFC A;  5AT1 B;  4ZNX A;  1HJD A;  3I55 Q;  4JJB A; 
#chains in the Genus database with same CATH homology
 1UFF A;  4CC7 A;  2BZY A;  2F2X A;  2KRM A;  4J9H A;  1TUC A;  2O2O A;  4AG1 C;  4OML A;  3O5Z A;  3EG1 A;  2QDL A;  1AWO A;  2DL7 A;  3THK A;  2YUN A;  2EQI A;  4RTZ A;  1X43 A;  2CDT A;  1LCK A;  2JM8 A;  1EFN A;  1OV3 A;  1YP5 A;  2BTT A;  2ENM A;  2W10 A;  3NMZ C;  3PE0 A;  5IXB A;  1WYX A;  2E5K A;  1M27 C;  2A37 A;  4QT7 A;  2D0N A;  2KXD A;  2SRC A;  1CKA A;  1V1C A;  1YN8 A;  2DM1 A;  3QWY A;  2DE0 X;  2LCS A;  2GTJ A;  2CRE A;  2JMA A;  2YT6 A;  2DRM A;  2GGR A;  3VS4 A;  3REB B;  1WLP B;  4AFZ C;  1ABO A;  3C0C A;  4J9D A;  1AZG B;  1MV3 A;  3UF4 A;  3VRZ A;  1AWW A;  2KRO A;  2SEM A;  3M0S A;  1QCF A;  1KFZ A;  2X3W D;  1GBQ A;  1RLP C;  1SRL A;  2EYY A;  1X6G A;  4RTW A;  4J9G A;  2RMO A;  2YDL A;  2RQT A;  1Y57 A;  2RF0 A;  4FSS A;  2RQU A;  4JZ4 A;  4ORZ A;  5GJV B;  1JEG A;  2FO0 A;  4J9F A;  3PVL A;  3VRY A;  1UUE A;  5FW9 A;  2FEI A;  4AFQ C;  1AVZ C;  2PZ1 A;  2M51 A;  4RUG A;  4AFU C;  1SRM A;  2L3P A;  1PRM C;  4IIO A;  2K79 A;  1PKT A;  5FWB A;  3FJ5 A;  1U06 A;  4J9E A;  2JT4 A;  3UA7 A;  3EHR A;  2AKL A;  2EYW A;  1RI9 A;  5I22 A;  1NLO C;  2CT3 A;  2G6F X;  2OI3 A;  2FG0 A;  1SSH A;  3VS0 A;  1OPL A;  2RPN A;  4LE9 A;  1H92 A;  2HCK A;  2KRS A;  3H41 A;  3GBQ A;  4J9B A;  2O31 A;  5FWC A;  5IH2 A;  2AZV A;  2OAW A;  1M8M A;  1UTI A;  2L3S A;  1AWJ A;  2EPD A;  3PVQ A;  4EIK A;  2YUO A;  3JV3 A;  4CC3 A;  2RQR A;  4HVV A;  1TG0 A;  4HXJ A;  1UDL A;  2J6K A;  1KJW A;  1HSQ A;  2D1X A;  2DL5 A;  1N5Z A;  2DA9 A;  2LNH B;  2ROT A;  4Z89 A;  2LP5 A;  1QKW A;  4RTV A;  1PWT A;  1FYN A;  4LUD A;  1JO8 A;  1BK2 A;  2P4R A;  1GBR A;  1WXB A;  2FRY A;  4WCI A;  2AK5 A;  3M0U A;  4JJD A;  4DEY A;  2C0O A;  1JQQ A;  1PKS A;  2EW3 A;  2O88 A;  4LUE A;  2JW4 A;  1H3H A;  2DL4 A;  1AEY A;  1GRI A;  2IIM A;  1G2B A;  2VWF A;  1AWX A;  1MUZ A;  1YWO A;  1ZLM A;  2KYB A;  1AD5 A;  1VA7 A;  1NLP C;  1Z9Z A;  3A98 A;  1TUD A;  4M4Z A;  1WXU A;  1ZUU A;  2EGC A;  2DLP A;  2K7A A;  1UJ0 A;  2DVJ A;  1K1Z A;  1K0X A;  4LN2 A;  3SEM A;  2ROL A;  2ED1 A;  2GTO A;  2CUB A;  2KT8 A;  2O9V A;  5IHK A;  2HBW A;  1E7O A;  4X1V A;  2K9G A;  1B3Q A;  2AZS A;  1MV0 B;  4Y92 A;  1X2K A;  1ZBJ A;  3I5R A;  4HVW A;  1X2Q A;  2LMJ A;  4LNP A;  2J6O A;  4Z8A A;  2MCN A;  2KXC A;  1QLY A;  4IIM A;  3TSZ A;  2KGT A;  1GCP A;  1AOJ A;  2EGE A;  4KRT A;  3ZL7 C;  1VYT A;  2KBT A;  1ZSG A;  2DBK A;  2DL3 A;  2FPD A;  4D8K A;  2MIO A;  2K3B A;  1JU5 C;  1XOV A;  2DJQ A;  1ZUK A;  1YCS B;  4E6R A;  5EC7 A;  1WXT A;  3I35 A;  1RUW A;  1GCQ C;  2DL8 A;  2LX7 A;  4HVU A;  2ECZ A;  1VYV A;  1WFW A;  1X6B A;  4HCK A;  1A0N B;  1E6G A;  1G83 A;  1NM7 A;  1AZE A;  2C0I A;  2D8J A;  2DYB A;  1NYG A;  3R6N A;  1FMK A;  3NGP A;  2C0T A;  1ARK A;  4J9I A;  1J3T A;  1PRL C;  1NYF A;  2JXB A;  2CH4 W;  3H0H A;  1GL5 A;  1KSW A;  3RNJ A;  2EKH A;  2B86 A;  4CC2 A;  1ABQ A;  2VKN A;  1T3S A;  1ZX6 A;  1UG1 A;  2M0Y A;  1UHC A;  1H8K A;  1U3O A;  2RNA A;  4ESR A;  3REA B;  3UA6 A;  3RBB B;  2W0Z A;  1BU1 A;  2JS2 A;  3EGU A;  4JPB W;  5GJW B;  1UHF A;  3UAT A;  2ESW A;  1QWF A;  1E6H A;  3EG2 A;  3VS5 A;  4RTY A;  1Z9Q A;  2HSP A;  2L3Q A;  2DNU A;  2EGA A;  4RTT A;  4OMQ A;  2VVK A;  1IO6 A;  2O9S A;  2LQW A;  2KR3 A;  2L0A A;  2BZ8 A;  2ED0 A;  2J7I A;  5IHI A;  1K0S A;  2L2P A;  4K11 A;  2JTE A;  1YWP A;  4RTX A;  1WI7 A;  4F16 A;  1SHG A;  3IQL A;  2EYZ A;  2NUZ A;  1M3A A;  3VS1 A;  2CT4 A;  1CSK A;  2LJ3 A;  1UGV A;  2MOX A;  1SHF A;  2OJ2 A;  5I11 A;  2RQV A;  2H8H A;  2A08 A;  2PTK A;  1RLQ C;  2F2W A;  2K2M A;  1T0J A;  1UE9 A;  2KE9 A;  4OMP A;  4OMM A;  5IXF A;  1SEM A;  2KT1 A;  2FPF A;  2YUP A;  2KRN A;  1BB9 A;  1QKX A;  4GBQ A;  4R0K A;  1W6X A;  1GFD A;  1I07 A;  1QWE A;  1WIE A;  2PNI A;  2LJ0 A;  1M3B A;  2K6D A;  1YNZ A;  3VS7 A;  4CC4 B;  2V1R A;  3I5S A;  1X69 A;  4AG2 C;  4DEX A;  2D8H A;  1NEG A;  1GCQ A;  3NHN A;  1OEB A;  2DF6 A;  3VS3 A;  4JJC A;  1NEB A;  2GNC A;  1JXM A;  5ECA A;  3SHW A;  1BBZ A;  2ABL A;  2NWM A;  5IHN A;  2DBM A;  4F17 A;  3I9Q A;  3EHQ A;  1WX6 A;  3CQT A;  3EG3 A;  4J9C A;  3EG0 A;  2A36 A;  2J05 A;  3H0F A;  5L23 A;  4OMO A;  2RQW A;  3TVT A;  1WA7 A;  1UJY A;  3M0Q A;  3LH5 A;  2HDA A;  2J6F A;  2A28 A;  3M0R A;  4A63 B;  4F14 A;  2DMO A;  2JM9 A;  4Z88 A;  1JXO A;  1HD3 A;  1OOT A;  1I1J A;  3VS2 A;  2LZ6 B;  3H0I A;  2YSQ A;  3VS6 A;  1WDX A;  2GBQ A;  1PNJ A;  3TSW A;  2LJ1 A;  2XMF A;  4JZ3 A;  4RTU A;  1I0C A;  4AFS C;  2I0N A;  1ZUY A;  2JMC A;  2JS0 A;  2CSQ A;  1K4U S;  2EYX A;  2LQN A;  1T0H A;  1M3C A;  2HEQ A;  1CKB A;  1K76 A;  5HCK A;  2CH4 A;  3KFV A;  2V1Q A;  4OMN A;  1Y0M A;  2EVR A;  2J06 A;  3U23 A;  1KIK A;  2F2V A;  2BZX A;  2DRK A;  1W1F A;  2EBP A;  1T3L A;  2AKK A;  3M0T A;  1NG2 A;  1GFC A;  1S1N A;  1B07 A;  1M30 A;  3ULR B;  2KNB B;  2FRW A;  2CSI A;  1OPK A;  1UEC A;  3QWX X;  2DIL A;  1PHT A;  3M0P A;  2GQI A;  1VYU A;  2RN8 A;  1K9A A;  1U5S A;  2DX1 A;  4D8D A;  2CUD A;  3NPF A;  4GLM A;  1X27 A;  2X3X D;  2KYM A;  2KEA A;  1W70 A;  4ZNX A;  2YUQ A;  1HJD A;  2FPE A;  1SPK A;  4JJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...