2L0AA

Solution nmr structure of signal transducing adapter molecule 1 stam-1 from homo sapiens, northeast structural genomics consortium target hr4479e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
MGHHHHHHSHMNHQHEARKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Signal transducing adapter molecule 1
publication title Northeast Structural Genomics Consortium Target HR4479E
rcsb
source organism Homo sapiens
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l0aA00
1KSWA 1VYUA 1KJWA 2J6OA 3H0HA 3EG2A 1CKBA 2DNUA 2KROA 3EG0A 5HCKA 2KXCA 1E6GA 1OEBA 2PZ1A 1KFZA 1B3QA 3M0TA 2FEIA 1G2BA 1GRIA 1U3OA 2JM9A 1UG1A 2KR3A 2HCKA 1NLOC 3VS7A 2VKNA 3PVLA 2KRSA 4HXJA 3TVTA 2RQRA 1UECA 1SSHA 1K1ZA 2GBQA 1IO6A 2D0NA 2MIOA 2F2WA 1Z9QA 2FO0A 2EW3A 4GLMA 4J9EA 2L3QA 2J7IA 2JM8A 2ECZA 4J9CA 1G83A 2W10A 1VYVA 2FPEA 4CC2A 2LJ3A 4JJBA 4D8DA 4LUEA 1YP5A 2FRWA 2LQWA 4AFSC 2DL5A 1YNZA 5EC7A 1ZSGA 2XMFA 1WX6A 2QDLA 5IH2A 2RQWA 2OI3A 2M0YA 1WI7A 4HVVA 2EBPA 4RTZA 4OMQA 2K79A 1MV0B 4F14A 4J9GA 1CSKA 2D1XA 1E7OA 2LQNA 3QWXX 3A98A 1Z9ZA 2DLPA 1M30A 2RQUA 2RNAA 4JPBW 4Z88A 1PHTA 2EKHA 3TSWA 1AOJA 4AFUC 2HSPA 2YDLA 2EGCA 5FWCA 1B07A 2CDTA 2EYWA 2DX1A 2NWMA 1ZUYA 1UDLA 1ZUUA 2J6KA 1JU5C 2C0TA 1OV3A 5GJVB 2KGTA 1SPKA 2ESWA 4IIOA 2EQIA 2NUZA 4FSSA 2KYMA 3EHQA 2RN8A 2DA9A 4ZNXA 1WFWA 1EFNA 1GCQA 1X2KA 4LUDA 1CKAA 1JEGA 4AG2C 1QWEA 2EYYA 1HJDA 4WCIA 1TG0A 2AZSA 4HVWA 1GBQA 1A0NB 2FRYA 2DL3A 2ED1A 2HBWA 2PTKA 4DEXA 2JXBA 3REAB 3GBQA 2L2PA 5I22A 1U06A 2EGAA 2DM1A 2K7AA 2DBMA 2CUDA 4E6RA 2A36A 2C0OA 3NMZC 3THKA 3I35A 3VS3A 2BZYA 3VS5A 1FYNA 1M8MA 2LX7A 2CT4A 1YWOA 3PE0A 1RLPC 1YN8A 5ECAA 1NEGA 2CSIA 2YUPA 1MV3A 1BK2A 3REBB 1UJ0A 3NHNA 1UHCA 2AK5A 4D8KA 4X1VA 4M4ZA 2VWFA 1AEYA 1PWTA 1WYXA 5IHIA 4J9IA 2X3WD 3M0UA 1SHFA 2HEQA 2J06A 2RQVA 5IXBA 1AVZC 2A37A 4J9DA 1ABOA 1X6GA 4AG1C 1QKWA 2IIMA 3EGUA 1E6HA 3RNJA 1RLQC 2V1RA 1OPKA 1RI9A 2JMCA 3C0CA 4RTTA 3SEMA 2BTTA 1GFDA 1WXTA 2EYXA 4RTWA 1QCFA 1W6XA 5GJWB 1NLPC 2GNCA 1QKXA 3UA6A 1NYGA 4Z8AA 1MUZA 1QLYA 3I9QA 2AKKA 1X69A 4JJDA 2BZXA 1SEMA 3M0SA 1YWPA 1K4US 2LZ6B 3I5RA 1ZBJA 2A08A 3H0IA 3VS6A 4KRTA 4RTYA 2ENMA 2J05A 4R0KA 2LCSA 1WA7A 1GBRA 1I0CA 2F2XA 2JMAA 3SHWA 1AWWA 1HSQA 1BBZA 1UUEA 2LJ0A 1ARKA 1VYTA 1YCSB 1QWFA 2K3BA 1U5SA 3VS1A 2EVRA 4ORZA 2O31A 2KEAA 1V1CA 1Y57A 1GL5A 1HD3A 1NG2A 3EG1A 2F2VA 4JZ4A 2CH4W 2EYZA 1K76A 2PNIA 4EIKA 1NYFA 1UE9A 3IQLA 1M27C 3LH5A 4J9HA 4QT7A 2K9GA 3QWYA 2MOXA 1AZGB 2CH4A 2DL7A 4GBQA 2DL8A 2CSQA 3I5SA 1GFCA 1JO8A 1JXOA 2HDAA 4LNPA 4CC4B 1XOVA 1BB9A 2JT4A 3VS4A 2X3XD 2L0AA 1ABQA 5FW9A 1WDXA 4OMPA 2JS2A 1NM7A 2J6FA 4A63B 4F16A 1RUWA 2DVJA 1BU1A 3U23A 5FWBA 3EHRA 2ED0A 2L3SA 4LE9A 2A28A 2AKLA 1UHFA 2P4RA 5IXFA 1WXUA 1X43A 2G6FX 4J9BA 2KBTA 4AFQC 1PRMC 3UA7A 1K0SA 1X6BA 4AFZC 1VA7A 1JXMA 1S1NA 4JJCA 4Z89A 3ZL7C 4RTUA 1J3TA 1T0HA 4RUGA 4HCKA 1I07A 1LCKA 2FG0A 3PVQA 1TUCA 2D8HA 1M3AA 2VVKA 4F17A 2D8JA 2YUQA 1X2QA 3M0QA 2DF6A 2LMJA 1T3SA 1WLPB 3VRZA 1H3HA 1ZUKA 2CUBA 1X27A 2DE0X 3RBBB 1SRMA 1AWXA 2RF0A 1OOTA 2YSQA 2DJQA 1W70A 2M51A 2YUNA 3FJ5A 4LN2A 4DEYA 3M0PA 3M0RA 3VS0A 2W0ZA 1K9AA 3VS2A 3KFVA 2BZ8A 2DYBA 2KRNA 2H8HA 1AWJA 1UFFA 2B86A 2KXDA 1T0JA 2KT8A 2K2MA 3H41A 2RMOA 1UJYA 2KT1A 2KYBA 2SEMA 3CQTA 5IHKA 4HVUA 1WXBA 2DL4A 4OMNA 1KIKA 2C0IA 2JS0A 3R6NA 2GTJA 1T3LA 2E5KA 4Y92A 1GCQC 2CREA 1M3BA 2EGEA 2LP5A 3H0FA 4RTVA 5L23A 2JW4A 2OAWA 2KRMA 1N5ZA 4IIMA 4OMLA 5I11A 2V1QA 2O9VA 2DILA 1JQQA 2AZVA 3EG3A 2L3PA 2JTEA 3TSZA 1SRLA 2EPDA 2RPNA 1SHGA 2RQTA 3JV3A 2ROLA 4JZ3A 1H92A 2ABLA 1W1FA 2DRKA 2CT3A 2O9SA 1NEBA 1H8KA 4RTXA 2MCNA 3VRYA 2LJ1A 1Y0MA 1AD5A 1UGVA 2OJ2A 1OPLA 1PNJA 4OMOA 3UATA 2YT6A 2LNHB 1TUDA 2DBKA 4K11A 2DMOA 1I1JA 1PRLC 2KE9A 1PKSA 3UF4A 1AZEA 1M3CA 1K0XA 1GCPA 2FPFA 4CC3A 2O88A 2GTOA 1WIEA 4ESRA 3NGPA 3ULRB 2K6DA 2SRCA 1ZX6A 4OMMA 1ZLMA 2ROTA 1FMKA 2DRMA 4J9FA 3O5ZA 2I0NA 1PKTA 2GGRA 3NPFA 2FPDA 2YUOA 5IHNA 1AWOA 2GQIA 4CC7A 1UTIA 2KNBB 2O2OA
chains in the Genus database with same CATH superfamily
1KSWA 1Q81U 3EG2A 4QVZA 5HCKA 1N9RA 2PZ1A 1B3QA 3MCAB 4Y91A 1G2BA 3HSBA 2KR3A 1NLOC 5CVIA 3SFMA 3PVLA 3JCMc 4M7AE 4IURA 4JS4A 1UECA 3HRUA 2KMTA 3T9NA 5CQYA 3CCMT 2K5LA 2EW3A 4XK8E 3VUZA 3L2VA 2L3QA 2COYA 2J7IA 1I5OB 1NJIR 4ANJA 5GAOm 4FT4A 2DD4A 1VYVA 3E19A 1WNLA 3QO3A 2LJ3A 3FLGA 2LDMA 2FRWA 1YCYA 4V2SA 2YRDA 2YXYA 4RG8A 5EC7A 1NJIC 2CYZB 2RI5A 2ZPHB 3JB9H 5FU6B 4EMKA 1Y07A 3OYNA 2M0YA 4RTZA 4J7IA 4OMQA 4QVCA 5IN1A 8AT1B 3HHTB 2KI7A 4PFZA 1SKUB 4J7FA 1ZHIA 3GOXA 2JNGA 1VQ4T 2LQNA 2VUBA 4C0GA 1KQSA 2DLPA 2ZPGB 2RI3A 3H9NA 5FWCA 1M1GA 2QEXQ 3A8OB 4M77G 2DX1A 2M16A 2JTMA 3QUIA 1SPKA 2VYTA 4M7DG 2ESWA 4IIOA 3JCMX 5CKEA 2DA9A 4ZNXA 1WFWA 1X2KA 4LUDA 2QG9B 4A4FA 5CIUA 3A1PA 1JEGA 3QJYA 1RAHB 2EYYA 1VQOA 1VQKQ 3P8DA 5GAOq 1W2BA 5EG2A 2DAQA 2OTLQ 1BI2A 4DBFA 2DL3A 1ZA1B 3OYYA 4M78C 4BI8B 4E7ZA 2JXBA 4F04B 3GBQA 5GAN2 2L2PA 5I22A 1BIBA 2KVQG 3RESA 1WJRA 1MMDA 3CC7Q 3CMAQ 5GAN8 3NMZC 1Q7YR 4M7DA 3THKA 4A4KA 1NPRA 3I35A 5GAN5 2E5QA 1LNXA 1M8MA 2K3YA 1Q86U 1QVFS 1IREB 1YI2Q 1W4SA 1YN8A 1VQPA 3JCMd 1Q7YC 5GAN3 3DB4A 2DXBA 3QG1A 4KUDK 3AT1B 4O5VA 4C5EA 2AK5A 2LT1A 3OYIA 5IHIA 1WYXA 2HNIA 3ZBDA 2QXFA 5IXBA 3FC3A 2A37A 2IPOB 3OMGA 3M4YA 4J9DA 1MMAA 3R6OA 1X6GA 1B34B 3CC4A 4A4HA 1YIJA 1MMNA 1TUGB 2IIMA 4XTZA 1YBYA 3HFOA 1KQSP 3L2QA 1U8RA 1RLQC 2V1RA 2JMCA 2QGFB 4OB1B 3EFSA 2HMAA 3DLMA 1QCFA 1W6XA 1WQWA 2CZ0B 1NLPC 1N9SA 4ZN1A 1MUZA 4HT8A 1X69A 2BZXA 2EFIA 4OP0A 2X4JA 2QQBA 4OVAA 1WHLA 3VV0A 3H0IA 4F7UG 3CCQQ 3V7CA 1WJQA 3S3NA 2JMAA 1KQ1A 4C0FA 1HSQA 1OZ3A 3JCMe 3I55A 4E7IA 3H8ZA 4C5IA 1XJWB 1VYTA 1YCSB 1RAIB 1U5SA 4Q5WA 1W2BP 1R77A 4LXCA 2KEAA 4IUVA 3EG1A 2F2VA 4JZ4A 2CH4W 2VASA 2ZPIB 3TQ7P 1UE9A 1BI1A 1C0MA 5FU7B 4J9HA 3G4SA 5D6WA 4QT7A 4XTVA 3OBWA 4F7UA 3HP9A 4GBQA 3LLRA 3EGXA 5DM7R 1JXOA 2VXEA 5GAMe 2HDAA 1XOVA 2DTOA 2JT4A 3VS4A 5CAIA 1ABQA 1EIFA 5GMKj 1UB4A 2D9TA 4C8QB 2JS2A 1YITQ 4Z02A 2DK3A 3KXTA 3CCMQ 2K5IA 1RUWA 1Y96B 3U23A 2EWNA 3EHRA 1VQOT 2AKLA 3JAME 3FEOA 2JTFA 5GAOl 5D6XA 1X75C 2KAFA 2IVWA 2G6FX 2KBTA 4F7UF 3EG9A 1K0SA 1VA7A 1S1NA 5GANf 3RKYA 3BDUA 4Z89A 1T0HA 4RUGA 5LL6S 1I07A 2FG0A 2K5FA 4ZGEB 2D8HA 2D8JA 4JUVA 4E7SA 2V26A 1X2QA 2YUQA 3ZFJA 2E4HA 4FYWB 2E65A 3RBBB 2LQ8A 1AWXA 2RF0A 5LJ3d 1VUBA 1VQ4Q 3HRSA 2GFUA 3LGFA 1I4K1 2M51A 2YUNA 3QSUA 4PJNA 4LN2A 2XICA 2RJEA 1K9AA 2NUPB 2GFAA 3VS2A 4C8QE 2DYBA 2RH2A 2D0QB 2H8HA 4XU3A 2KXDA 2B86A 3PMTA 3CC4T 1KG1A 2NYSA 1OZ2A 5KYWA 1HXDA 4ZGJB 3S3OA 2QGGA 4HVUA 1IGUA 4M78F 3CCLA 4QKUA 1T3LA 2E5KA 1GCQC 2CREA 1M3BA 2VC8A 2EGEA 3BW1A 2QQRA 4C5HA 2KRMA 4OMLA 2O9VA 4QQGA 4PLLA 2O4XB 2JTEA 4PFPA 2WSFE 2HL3A 2QDYB 2MWOA 4DBQA 4C92B 3KUFA 2EPDA 2CZ1B 1Y71A 4BDYA 2O9SA 1H8KA 3J81E 3VRYA 3V7RA 2R57A 2EAYA 1Q82U 3JCMJ 5KE2A 4A54A 4N4HA 1PNJA 2OAUA 2P4TA 3M53A 1NZ9A 1TUDA 3G4ST 2CZ7B 4K11A 1PRLC 2XIDA 4M78B 1PKSA 1AZEA 1GCPA 3QDFA 1P92A 4BI4A 2JZ2A 3MJXA 2CP0A 1QP2A 4D6WA 2K6DA 4J83A 4OMMA 1BKBA 2ROTA 1PKTA 4PJMA 3JCMh 1X01A 3HFNA 4JRQA 1MGQA 1AWOA 5CK9A 4CC7A 5CQXA 2ZPBB 1WPYA 3DLLA 3J7AF 1WQ7A 2P0PA 2Y4YA 1CKBA 2DNUA 3CMEQ 2KROA 4C92E 3OYFA 4LDXA 1JB0E 1R8OB 2FEIA 1OQKA 1FMVA 2HCKA 3VS7A 2VKNA 4QW2A 2KRSA 1UGRB 3TVTA 3TU4K 2E3HA 2HKNA 3CBMA 2EQKA 1SSHA 1QCNA 2CP2A 1LOJA 1IO6A 1K8AR 3CC2A 3JCMW 3CBPA 2MIOA 2F2WA 1RAEB 5AT1B 4M78E 2P0KA 2JM8A 5LJ5j 2EQUA 2W10A 5KYUB 2BUDA 4DOVA 2AHJB 2FPEA 2HZYA 1R0BG 4JJBA 4LUEA 1K8AC 2MI6A 4ATOA 4PJJA 3CCVA 4ZTFA 1QVGA 1KC8U 1ZSGA 1WX6A 5KYYB 4BE1A 3VYHB 2OI3A 1WI7A 2LT4A 3CCLT 5GMKm 1WZOA 1VQLA 5I2MA 4M77C 1ZA2B 4YTLA 3EGDB 2K3XA 4DA4A 3QWXX 4EMHA 1YJWA 1Z9ZA 4N4GA 2RNAA 4JPBW 1IHVA 1PHTA 2EKHA 3TSWA 1YJNA 4AFUC 4M7DC 2HSPA 2L3RA 4MDXA 4UC4A 1B07A 4XAXB 5CKHA 1M90U 2FZGB 1K73R 1M1KU 4HT9A 2C0TA 1OV3A 1M9SA 2QYZA 2P84A 2XDBA 2EQIA 4FSSA 4J5YA 2LC4A 1EFNA 2XD0A 1GCQA 1K73C 1CKAA 1LPLA 3EAEA 3MP1A 3JB9J 1OX9A 1QWEA 1D3BA 2CP6A 1TG0A 1D1BA 2AZSA 3WVDB 4HVWA 1GBQA 4WTOB 3PT9A 2FRYA 2HBWA 2ED1A 4JLGA 4DEXA 1TXQA 3CC4Q 1U06A 2DM1A 4OB3B 2FZCB 2K7AA 3LH0A 4E6RA 1I8FA 3SWNC 2A36A 2C0OA 3OYKA 2YRCA 1TWBA 3VS5A 2BZYA 2LX7A 3JSCA 2CT4A 3E9FA 4M77D 1RLPC 1D0ZA 5LJ3h 1JBMA 2NUTA 2CSIA 3OS0A 4M7DD 1AHJB 3QPHA 5C0MA 4PJOB 1BK2A 2HD0A 2R5MA 4Y28E 1UJ0A 4FYXB 1G8XA 1TH7A 1QVGP 3CD6A 1VQ5A 2X51A 4L5GA 5KYNA 2CP5A 2DO3A 4D8KA 1AEYA 2RJDA 4J6WA 2XKOC 4J9IA 3UDCA 4M75B 1Q81R 2HEQA 2J06A 1AVZC 5LJ5f 2VGNA 4KH0B 5LJ3g 2DJZA 1QKWA 3M58A 2Z0WA 2DERA 3MKDA 3OYGA 3C0CA 3OYAA 2M9UA 2EYXA 5KCHA 1YFNA 1QLYA 3I9QA 5M9OA 2AKKA 5D7UA 1M8VA 3A8GB 4N4IA 1MNEA 3X20B 3M0SA 1YWPA 4MMLA 5CCAA 1BI3A 2YLBA 1ZBJA 3CCVT 1QVPA 3OSVA 2LCSA 1VQ6A 4OGEA 3G6EQ 1WA7A 2ZPEB 1GBRA 2F2XA 4HCBA 4FW2A 1BBZA 1UGPB 1ARKA 1VQLT 5KYXB 2K3BA 2D6FA 4PJOE 3VS1A 3QXEB 2EVRA 3EFRA 2O31A 5IT9E 1V1CA 1HD3A 1YJWT 4XTYA 1YJNT 3V8JA 3CCEA 3E9GA 1K76A 4RCBA 4M75E 1M27C 1QCOA 2QK0A 4E47A 2BIVA 3CBOA 3OW2A 2DL8A 3UWNA 2CSQA 4FCYA 1M2OA 3I5SA 1GFCA 1JO8A 3TREA 4LNPA 1Q95G 2X35A 5HK3A 2E41A 4FU6A 5FW9A 3UT1A 1WDXA 1LJOA 3SD4A 2XG8D 2RHIA 3L2WA 4A63B 3OYJA 1S72A 4M77A 1BU1A 2X4WA 1M4ZA 1C1AA 4BY6C 3A8LB 4LE9A 4L6V5 1QMCA 2E12A 2P4RA 3NTHA 3QZ9B 3OSSC 4LDVA 4X9DA 1X43A 2R5AA 3OS2A 1V29B 2DTHA 5J26A 4RTUA 5GANj 3OMCA 1TSFA 4EMKB 1AT1B 4C0DC 4F17A 3PTAA 2M0OA 3M0QA 3C94A 2DF6A 2LMJA 1H3HA 4M77F 2CUBA 1D1AA 5GMKl 1X27A 1VQMA 3ASKA 3CXCA 1OOTA 4M7DF 2YSQA 1XQHA 1Q86R 1QW1A 1YJ9A 3CD6T 2DJQA 1VQ5T 3CPWS 3A5ZB 4N0AA 9ATCB 3GF5A 5GAOp 4DEYA 2DZ9A 3M0PA 2EJ9A 4IUQA 4MZMA 3SWNA 1Q86C 2CS7A 3FJPA 4ZGDB 2P0QA 2KRNA 1AWJA 2MPXC 3FIFA 1SSFA 1O9SA 4CI0C 3MO8A 4RKUE 3PNWC 3CQTA 2PVDB 1WXBA 3G71A 3NTKA 3CCSA 3VUBA 1KIKA 2AIRB 2JS0A 3ME9A 2FB7A 1YHQA 2GTJA 3LYIA 4J6YA 4Y92A 3OW2P 2MYSA 3M54A 4KH1B 1RI0A 2JW4A 1FWZA 4M7DB 4A4EA 1VQ6T 2DXTA 3EG3A 3GP8A 1D0XA 2QQ9A 2GQVA 3TSZA 2K2VA 4O6JA 1FMWA 5I21A 1HK9A 3CCRA 2RQTA 3OYBA 4JZ3A 1H92A 3M59A 2RHXA 5GAN6 1Y0MA 1ZSZC 3CCET 2OJ2A 2L5QA 2YT6A 1K9MU 4ME7A 3E2UA 4QQDA 3BFMA 5DY9A 2L8DA 2KE9A 1IRXA 2ATCB 4CC3A 3HKSA 4C92G 1QVGS 1LVKA 1WIEA 3CXCP 4ESRA 3SWNB 2CP3A 3ULRB 2RHUA 1ZLMA 1S72T 1FMKA 3O5ZA 3URGA 3NPFA 2FPDA 4VUBA 5CR2A 5FLXE 4J8OA 4AT1B 5A0LA 1VIEA 5IHNA 4FW1A 2V8IA 2RK2A 2HQHA 2DTIA 2GQIA 5HK0A 4BDZA 3GLXA 1FX7A 3CCVQ 4JRIA 5J3BA 1VQNA 4JDSA 1VQPT 1KJWA 2CZ6B 2J6OA 3M57A 1VOMA 3EG0A 2KXCA 1E6GA 1OEBA 4XTUA 1KFZA 3CCUA 5DLOA 1GRIA 2QTVA 1VQLQ 2JM9A 3MHXA 1VQMT 4JLIA 1RL2A 1VQ8A 2HAXA 4EPCA 4BACA 2JOYA 5GANg 2CP7A 1K1ZA 1YJ9T 2FL7A 1YJNQ 1WGSA 1VQKA 3JB9G 2OTLA 2FO0A 3WXMB 4F7UB 1YIJT 4J9EA 3OYEA 5GAMj 2RK1A 4M7AD 1GXIE 2DIQA 3EGXB 2ZZDA 4J9CA 3VYGA 4OF1A 2GCXA 3OYHA 2EJGA 4AFSC 2Y4XA 3CMAA 2DL5A 5LJ5d 1DJ7B 2XK0A 3D7SB 2XMFA 2QDLA 2QQAA 5IH2A 1YI2A 4LDUA 1RAFB 2EQMA 4XU0A 3OA6A 3G71T 3CCST 2EBPA 2K79A 1MV0B 1YHQT 2MMPA 4F14A 2A7YA 3EG9B 4J6XA 3I55T 2QA4A 2OTJA 3OYDA 4J9GA 5LJ3e 2QASA 4B9XA 2JN0A 2RQUA 4Z88A 1M30A 2DXCA 5FU6C 1AOJA 3EH2A 2PUOB 2YDLA 1IXDA 3SB2A 4RG2A 4BE2A 2MAMA 2DIGA 1ZUUA 3CCRT 1N8RU 3I56A 1JU5C 1PSFA 5GJVB 2FYKA 3BE3A 2HSEB 2KYMA 2RN8A 4OB2B 2LCCA 5GMKh 3CD6Q 1VQ5Q 4F7UE 2FHDA 1RACB 4AG2C 4OGCA 1M2VA 1ZBXA 4WCIA 1Q82R 3X24B 3TEEA 3RMSA 5FROA 2PTKA 4M7AG 3CCQA 3REAB 4KUIA 1TU0B 3EH1A 5KYWB 3EFOA 1MHNA 2DBMA 4NL3A 1MNDA 1Q82C 3G7ZA 3A8HB 1KQSS 3JCMf 3OS1A 3MEUA 3HL8A 1ZSZA 3P8HA 2VGMA 4ZTJA 4MMKA 4B9WA 1MV3A 2XU8A 3Q1JA 1VQNT 3M9QA 4RCCA 5KH6A 1VQ6Q 3NHNA 4L59A 2HQXA 1U1TA 1UHCA 4M7AA 1WHMA 1K8AU 2M02A 3LWHA 3CCUT 4X1VA 2DXUA 4M4ZA 4PJLA 3OW2S 3M0UA 3V7SA 4LD6A 2RQVA 5GAMf 1YITA 1VQ8T 2RHZA 2ZPFB 4AG1C 3CCMA 1W2BS 4FYYB 3MEAA 2EYQA 2EJFA 5FRMA 2O01E 1VQKT 3CCEQ 1E6HA 1OPKA 1RI9A 2OTLT 2BTTA 1GFDA 3RUXA 1PD1A 2HQEA 4E7JA 5GJWB 2L89A 2GNCA 1QKXA 2BE7D 4Z8AA 4JJDA 1VQOQ 2DVEA 3CMAT 3ER0A 1SEMA 2LZ6B 4M75G 2EKOA 2E64A 3I5RA 7AT1B 4KRTA 3VKIA 2J05A 1S72Q 1XTDA 2WACA 5GAN4 3INZA 2EQJA 2KSSA 1UGQB 2BKDN 1UUEA 2LJ0A 2F5KA 1KC8R 1D1CA 1VQ4A 1TS9A 2XI9A 3KBGA 2QA4T 2PVOB 2OTJT 1ZSZB 1OU9A 2HL5C 1VQ9A 1Y57A 1VQPQ 1KD1U 1JRIA 1KC8C 4EIKA 1M5Q1 1NYFA 2E70A 3N5BB 3LH5A 4HCZA 1G3WA 2K9GA 3FDRA 2MOXA 2CH4A 2DL7A 3I56T 3L2UA 3M5AA 5GAN7 2X3XD 1M90R 4OMPA 3RKXA 1NM7A 1YJ9Q 3G1JA 4JS5A 2J6FA 2DKGA 1BCMA 4N0AC 3VU3C 1M1KR 3M56A 2DVJA 2F69A 1IGQA 4X34A 3RERA 1YIJQ 2ED0A 1UHFA 1M90C 3NFCA 1G3SA 2DEQA 5IXFA 2QAZA 2DZCA 4C8QC 3CCQT 1M1KC 5J39A 3L42A 4J9BA 4AFQC 1PRMC 3UA7A 1X6BA 4AFZC 3PFSA 1JXMA 4JJCA 4LDYA 3PIOA 3X25B 4HCKA 4R56A 3PVQA 2VXFA 3MEWA 1M3AA 3A8MB 3G71Q 1EX4A 5GANd 3HPWA 3CCSQ 4C5GA 1H3ZA 1PCXA 1WLPB 2MK5A 4CRIA 1YHQQ 1PC0A 4KGVB 3I55Q 2DE0X 2HBPA 2RB6A 3GIBA 1WHKA 1SRMA 3MP8A 4B6MA 2I2LA 3CCJA 1NJIU 5CO7A 1TOVA 1W70A 5A0GA 3FJ5A 2K4YA 4IUUA 1JJ2A 3E1SA 2ZGWA 3CCRQ 3BDLA 1Q81C 3CC2T 5LJ5h 1YITT 1NE8A 3KFVA 3G4SQ 3QIIA 4AMCA 2K2MA 3H41A 1UJYA 5CKBA 2KYBA 1D3BB 1O75A 1R0CB 5IHKA 2B8AA 3F70A 4DBHA 1M1FA 4HKEA 2DL4A 4C8QD 2AT1B 4OMNA 2C0IA 3TCJA 5GAOr 4EDUA 1H641 1WJSA 5LJ5g 4PFOA 3OYCA 2LP5A 1OULA 3H0FA 3CMEA 5L23A 3V8LA 3PMIA 4KULA 2OAWA 5GANe 5I11A 2KY9A 2AZVA 4XTWA 1QQJA 2RA2A 4DOWA 3L2RA 1X6OA 2YWWA 2NUTB 2RD1A 2A3LA 2RPNA 3JCMb 2ROLA 1G3TA 3META 1VQ7A 4II1A 1NEBA 1VQ9T 4RTXA 3LW5E 2MCNA 2VB6A 2LJ1A 3S3MA 1VQNQ 1AD5A 1RABB 2LQKA 1B34A 2LTOA 1UGVA 2K57A 4PKCC 4C92C 1WHGA 4LD9K 3CCUQ 1BYMA 4P5NA 4KGXB 2DMOA 1Q7YU 3HTRA 1VQ8Q 2DD5A 3UF4A 1K0XA 2FPFA 1PD0A 5HKCA 2GTOA 2LNVA 1ACMB 1RAAB 2SRCA 1ZX6A 4BI3A 4FYVB 2KDSA 4J9FA 4WF2A 2EIFA 1JJ2P 2MF2A 4JRPA 2YUOA 4MZTA 4PL6A 4C8QG 3CCLQ 1HYOA 3P8BB 1FXXA 1VYUA 2IG0A 4NL2A 3H0HA 5GMKi 2QI2A 1B7TA 3M0TA 2YLCA 1IZ6A 1U3OA 1UG1A 3RKWA 2QA4Q 2OTJQ 1G5VA 3DB3A 4HXJA 2RQRA 2RJCA 3M4GA 3CCJT 4C92D 3O8VA 4FSXA 2LCLA 2HKQB 2KK4A 2GBQA 2FVUA 4C8QA 2PU9B 4BD3A 2D0NA 4JRKA 5GMKe 2YRVA 1Z9QA 4GLMA 1Y96A 2ECZA 1G83A 2V8KA 3I56Q 1RAGB 1WHJA 4CC2A 4D8DA 1YP5A 2LQWA 3V8KA 4BE0A 3MEVA 1PG5B 5GAMd 1YNZA 2LVMA 4M78D 4M77B 4PLIA 8ATCB 5L8RE 1Y7XA 2RQWA 4HVVA 4C8QF 2ZAEA 1NBEB 3OY9A 3VJPA 5KCOA 3CMET 1CSKA 4E7HA 2D1XA 3HRTA 1E7OA 3A98A 1N6AA 1F1BB 2RO0A 2BE9B 3UPUA 2EGCA 3JB9D 2CDTA 4A4GA 2EYWA 2A0FB 2NWMA 1ZUYA 1OYXA 1UDLA 2NLUA 2J6KA 2KGTA 1VQ7T 3OYMA 2NUZA 2NUPA 4LDWA 4R55A 5A0DA 2XDPA 3EHQA 1WHHA 5CKFA 4M7AC 1U1SA 2XDDA 3OB9A 4OB0B 1HJDA 2H3EB 2DFUA 3CC2Q 2X4YA 1A0NB 3MP6A 1IB8A 3G6EA 2GF7A 4M77E 4QVDA 1K9MR 2PVGB 2EGAA 1BCOA 4BUGA 3LWIA 2CUDA 4QQ6A 4M7DE 5I2SA 4TVRA 5GANh 1PSEA 4XTXA 3LGLA 3GPLA 4M78G 3ZEHA 2QEXA 2O4XA 3CPFA 3VS3A 1FYNA 1K9MC 4RMOA 3PIPA 1YWOA 2E6NA 3PE0A 5ECAA 1NEGA 4C92A 1G3YA 2YUPA 3JCMP 4C0ZA 3REBB 3RDVA 4XQ3A 1OX8A 4KBMB 1OI1A 4E7LA 1YJWQ 2DEUA 2VWFA 4ELZC 1PWTA 2F5TX 2X3WD 2LX9A 1SHFA 4PJOC 1KQ2A 3RR6A 1XNIA 4M78A 4XU1A 1RADB 3JCMV 1ABOA 1VQ9Q 5D6YA 2RM4A 3QDRB 3RMQA 4C92F 2V8JA 3EGUA 4OMFB 4HA8A 3QZ5B 3RNJA 3CC7A 2COZA 2DYIA 3QYHB 4RTTA 4M75C 3SEMA 1VIFA 1WXTA 4RTWA 3UA6A 1NYGA 2VV5A 2PUKB 1TTHB 1OU8A 6AT1B 5AYFA 1BIAA 2RJFA 4IKFA 3H6ZA 3OBYA 1BI0A 1K4US 5FRNA 2A08A 3VS6A 4RTYA 2ENMA 4R0KA 1I0CA 3SHWA 2OX7A 1AWWA 2DPPB 3QBYA 2KQWA 1QVFA 2WSEE 1QWFA 4GLKA 1D0YA 3S6WA 1V76A 4ORZA 1GL5A 1NG2A 2EYZA 4IUTA 4X9CA 2E1HA 3WVEB 2PNIA 1JJ2S 3JB9F 3IQLA 3NTIA 4PJOD 3C12A 2M1HA 1IHWA 3QWYA 4DQ2A 1AZGB 4BY6B 2QTXA 5KYUA 4CC4B 5LJ5e 2MWPA 1BB9A 3FRNA 3CPWA 2L0AA 3CCJQ 2COWA 4IUPA 4M75D 3PGGA 1N8RR 4F16A 5KYYA 2RI2A 5FWBA 1KK7A 4XU2A 2L3SA 4ZN3A 4C0DB 3QKJA 1I5LA 2A28A 4FT2A 5HY6A 1MMGA 1WXUA 1N8RC 4MDWA 3G6ET 3FB9A 2QQSA 3RIRA 3J80E 1D09B 3ZL7C 3OS5A 3EGDA 1J3TA 5IAYA 1LCKA 4A53A 1EZZB 3C95A 1TUCA 2E3IA 2VVKA 3OQ5A 2QEXT 2DETA 1KHCA 2JVVA 3L1AA 5LJ3j 1T3SA 4KT0E 3VRZA 3QHSA 3GNGA 1ZUKA 4EMGA 4HCCA 1UEBA 4NS5A 2G3RA 5KE3A 4EMKC 3C4SA 2PQWA 1UGSB 4E7KA 3JB9I 4FM4B 4PNOA 4KGZB 3JCMg 2H3JA 3M0RA 3VS0A 2W0ZA 5GAMh 4PJOG 1QVFP 4E2FB 1VQ7Q 2BZ8A 2E10A 3QJ6A 5C6SA 1UFFA 4M7AF 1T0JA 2KT8A 3JRZA 3CC7T 2RMOA 5GAOn 2Y90A 2KT1A 2X4XA 1M2VB 2SEMA 2X9HA 3R6NA 1YI2T 2JUFA 4GY5A 5GAMg 2CGHA 4RTVA 3EFOB 4ELYC 3CPWP 1C6VX 1K73U 1N5ZA 4IIMA 2R58A 4PJOA 2V1QA 2DILA 1JQQA 3CXCS 2L3PA 4FL6A 2E6ZA 2YHTA 4DBRA 1SG5A 2XHCA 1NPPA 1N27A 4MZPA 1SRLA 1SHGA 3JV3A 3M55A 3QYGB 5CKDA 2ABLA 4M75A 4NOYA 1W1FA 2DRKA 4PK4A 2CT3A 2CKKA 3AHUA 1VQMQ 4M7AB 1OPLA 4OMOA 3UATA 2C06A 2ZCFB 2LNHB 4PJOF 3CEYA 2DBKA 3L2ZA 2RHYA 5FU7C 2WSCE 5DLQE 1I1JA 3SDZA 1QP3A 3X26B 1KD1R 3DKMA 1M3CA 1PM3A 2O88A 3GNFB 4M75F 2FZKB 1I81A 3LX7A 3MPUB 3NGPA 4FIBA 4JJNK 1ZQ1A 1SF9A 1KD1C 1KHIA 2DRMA 2LRQA 4BB7A 2I0NA 3OYLA 2GGRA 2JJ9A 2F1LA 3X28B 3BY7A 3JCMQ 5KYXA 5LJ3f 1UTIA 2KNBB 2O2OA 5A2QE
chains in the Genus database with same CATH topology
1KSWA 1VYUA 1KJWA 2J6OA 3H0HA 3EG2A 1CKBA 2DNUA 2KROA 3EG0A 5HCKA 2KXCA 1E6GA 1OEBA 2PZ1A 1KFZA 1B3QA 3M0TA 2FEIA 1G2BA 1GRIA 1U3OA 2JM9A 1UG1A 2KR3A 2HCKA 1NLOC 3VS7A 2VKNA 3PVLA 2KRSA 4HXJA 3TVTA 2RQRA 1UECA 1SSHA 1K1ZA 2GBQA 1IO6A 2D0NA 2MIOA 2F2WA 1Z9QA 2FO0A 2EW3A 4GLMA 4J9EA 2L3QA 2J7IA 2JM8A 2ECZA 4J9CA 1G83A 2W10A 1VYVA 2FPEA 4CC2A 2LJ3A 4JJBA 4D8DA 4LUEA 1YP5A 2FRWA 2LQWA 4AFSC 2DL5A 1YNZA 5EC7A 1ZSGA 2XMFA 1WX6A 2QDLA 5IH2A 2RQWA 2OI3A 2M0YA 1WI7A 4HVVA 2EBPA 4RTZA 4OMQA 2K79A 1MV0B 4F14A 4J9GA 1CSKA 2D1XA 1E7OA 2LQNA 3QWXX 3A98A 1Z9ZA 2DLPA 1M30A 2RQUA 2RNAA 4JPBW 4Z88A 1PHTA 2EKHA 3TSWA 1AOJA 4AFUC 2HSPA 2YDLA 2EGCA 5FWCA 1B07A 2CDTA 2EYWA 2DX1A 2NWMA 1ZUYA 1UDLA 1ZUUA 2J6KA 1JU5C 2C0TA 1OV3A 5GJVB 2KGTA 1SPKA 2ESWA 4IIOA 2EQIA 2NUZA 4FSSA 2KYMA 3EHQA 2RN8A 2DA9A 4ZNXA 1WFWA 1EFNA 1GCQA 1X2KA 4LUDA 1CKAA 1JEGA 4AG2C 1QWEA 2EYYA 1HJDA 4WCIA 1TG0A 2AZSA 4HVWA 1GBQA 1A0NB 2FRYA 2DL3A 2ED1A 2HBWA 2PTKA 4DEXA 2JXBA 3REAB 3GBQA 2L2PA 5I22A 1U06A 2EGAA 2DM1A 2K7AA 2DBMA 2CUDA 4E6RA 2A36A 2C0OA 3NMZC 3THKA 3I35A 3VS3A 2BZYA 3VS5A 1FYNA 1M8MA 2LX7A 2CT4A 1YWOA 3PE0A 1RLPC 1YN8A 5ECAA 1NEGA 2CSIA 2YUPA 1MV3A 1BK2A 3REBB 1UJ0A 3NHNA 1UHCA 2AK5A 4D8KA 4X1VA 4M4ZA 2VWFA 1AEYA 1PWTA 1WYXA 5IHIA 4J9IA 2X3WD 3M0UA 1SHFA 2HEQA 2J06A 2RQVA 5IXBA 1AVZC 2A37A 4J9DA 1ABOA 1X6GA 4AG1C 1QKWA 2IIMA 3EGUA 1E6HA 3RNJA 1RLQC 2V1RA 1OPKA 1RI9A 2JMCA 3C0CA 4RTTA 3SEMA 2BTTA 1GFDA 1WXTA 2EYXA 4RTWA 1QCFA 1W6XA 5GJWB 1NLPC 2GNCA 1QKXA 3UA6A 1NYGA 4Z8AA 1MUZA 1QLYA 3I9QA 2AKKA 1X69A 4JJDA 2BZXA 1SEMA 3M0SA 1YWPA 1K4US 2LZ6B 3I5RA 1ZBJA 2A08A 3H0IA 3VS6A 4KRTA 4RTYA 2ENMA 2J05A 4R0KA 2LCSA 1WA7A 1GBRA 1I0CA 2F2XA 2JMAA 3SHWA 1AWWA 1HSQA 1BBZA 1UUEA 2LJ0A 1ARKA 1VYTA 1YCSB 1QWFA 2K3BA 1U5SA 3VS1A 2EVRA 4ORZA 2O31A 2KEAA 1V1CA 1Y57A 1GL5A 1HD3A 1NG2A 3EG1A 2F2VA 4JZ4A 2CH4W 2EYZA 1K76A 2PNIA 4EIKA 1NYFA 1UE9A 3IQLA 1M27C 3LH5A 4J9HA 4QT7A 2K9GA 3QWYA 2MOXA 1AZGB 2CH4A 2DL7A 4GBQA 2DL8A 2CSQA 3I5SA 1GFCA 1JO8A 1JXOA 2HDAA 4LNPA 4CC4B 1XOVA 1BB9A 2JT4A 3VS4A 2X3XD 2L0AA 1ABQA 5FW9A 1WDXA 4OMPA 2JS2A 1NM7A 2J6FA 4A63B 4F16A 1RUWA 2DVJA 1BU1A 3U23A 5FWBA 3EHRA 2ED0A 2L3SA 4LE9A 2A28A 2AKLA 1UHFA 2P4RA 5IXFA 1WXUA 1X43A 2G6FX 4J9BA 2KBTA 4AFQC 1PRMC 3UA7A 1K0SA 1X6BA 4AFZC 1VA7A 1JXMA 1S1NA 4JJCA 4Z89A 3ZL7C 4RTUA 1J3TA 1T0HA 4RUGA 4HCKA 1I07A 1LCKA 2FG0A 3PVQA 1TUCA 2D8HA 1M3AA 2VVKA 4F17A 2D8JA 2YUQA 1X2QA 3M0QA 2DF6A 2LMJA 1T3SA 1WLPB 3VRZA 1H3HA 1ZUKA 2CUBA 1X27A 2DE0X 3RBBB 1SRMA 1AWXA 2RF0A 1OOTA 2YSQA 2DJQA 1W70A 2M51A 2YUNA 3FJ5A 4LN2A 4DEYA 3M0PA 3M0RA 3VS0A 2W0ZA 1K9AA 3VS2A 3KFVA 2BZ8A 2DYBA 2KRNA 2H8HA 1AWJA 1UFFA 2B86A 2KXDA 1T0JA 2KT8A 2K2MA 3H41A 2RMOA 1UJYA 2KT1A 2KYBA 2SEMA 3CQTA 5IHKA 4HVUA 1WXBA 2DL4A 4OMNA 1KIKA 2C0IA 2JS0A 3R6NA 2GTJA 1T3LA 2E5KA 4Y92A 1GCQC 2CREA 1M3BA 2EGEA 2LP5A 3H0FA 4RTVA 5L23A 2JW4A 2OAWA 2KRMA 1N5ZA 4IIMA 4OMLA 5I11A 2V1QA 2O9VA 2DILA 1JQQA 2AZVA 3EG3A 2L3PA 2JTEA 3TSZA 1SRLA 2EPDA 2RPNA 1SHGA 2RQTA 3JV3A 2ROLA 4JZ3A 1H92A 2ABLA 1W1FA 2DRKA 2CT3A 2O9SA 1NEBA 1H8KA 4RTXA 2MCNA 3VRYA 2LJ1A 1Y0MA 1AD5A 1UGVA 2OJ2A 1OPLA 1PNJA 4OMOA 3UATA 2YT6A 2LNHB 1TUDA 2DBKA 4K11A 2DMOA 1I1JA 1PRLC 2KE9A 1PKSA 3UF4A 1AZEA 1M3CA 1K0XA 1GCPA 2FPFA 4CC3A 2O88A 2GTOA 1WIEA 4ESRA 3NGPA 3ULRB 2K6DA 2SRCA 1ZX6A 4OMMA 1ZLMA 2ROTA 1FMKA 2DRMA 4J9FA 3O5ZA 2I0NA 1PKTA 2GGRA 3NPFA 2FPDA 2YUOA 5IHNA 1AWOA 2GQIA 4CC7A 1UTIA 2KNBB 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  1VYU A;  1KJW A;  2J6O A;  3H0H A;  3EG2 A;  1CKB A;  2DNU A;  2KRO A;  3EG0 A;  5HCK A;  2KXC A;  1E6G A;  1OEB A;  2PZ1 A;  1KFZ A;  1B3Q A;  3M0T A;  2FEI A;  1G2B A;  1GRI A;  1U3O A;  2JM9 A;  1UG1 A;  2KR3 A;  2HCK A;  1NLO C;  3VS7 A;  2VKN A;  3PVL A;  2KRS A;  4HXJ A;  3TVT A;  2RQR A;  1UEC A;  1SSH A;  1K1Z A;  2GBQ A;  1IO6 A;  2D0N A;  2MIO A;  2F2W A;  1Z9Q A;  2FO0 A;  2EW3 A;  4GLM A;  4J9E A;  2L3Q A;  2J7I A;  2JM8 A;  2ECZ A;  4J9C A;  1G83 A;  2W10 A;  1VYV A;  2FPE A;  4CC2 A;  2LJ3 A;  4JJB A;  4D8D A;  4LUE A;  1YP5 A;  2FRW A;  2LQW A;  4AFS C;  2DL5 A;  1YNZ A;  5EC7 A;  1ZSG A;  2XMF A;  1WX6 A;  2QDL A;  5IH2 A;  2RQW A;  2OI3 A;  2M0Y A;  1WI7 A;  4HVV A;  2EBP A;  4RTZ A;  4OMQ A;  2K79 A;  1MV0 B;  4F14 A;  4J9G A;  1CSK A;  2D1X A;  1E7O A;  2LQN A;  3QWX X;  3A98 A;  1Z9Z A;  2DLP A;  1M30 A;  2RQU A;  2RNA A;  4JPB W;  4Z88 A;  1PHT A;  2EKH A;  3TSW A;  1AOJ A;  4AFU C;  2HSP A;  2YDL A;  2EGC A;  5FWC A;  1B07 A;  2CDT A;  2EYW A;  2DX1 A;  2NWM A;  1ZUY A;  1UDL A;  1ZUU A;  2J6K A;  1JU5 C;  2C0T A;  1OV3 A;  5GJV B;  2KGT A;  1SPK A;  2ESW A;  4IIO A;  2EQI A;  2NUZ A;  4FSS A;  2KYM A;  3EHQ A;  2RN8 A;  2DA9 A;  4ZNX A;  1WFW A;  1EFN A;  1GCQ A;  1X2K A;  4LUD A;  1CKA A;  1JEG A;  4AG2 C;  1QWE A;  2EYY A;  1HJD A;  4WCI A;  1TG0 A;  2AZS A;  4HVW A;  1GBQ A;  1A0N B;  2FRY A;  2DL3 A;  2ED1 A;  2HBW A;  2PTK A;  4DEX A;  2JXB A;  3REA B;  3GBQ A;  2L2P A;  5I22 A;  1U06 A;  2EGA A;  2DM1 A;  2K7A A;  2DBM A;  2CUD A;  4E6R A;  2A36 A;  2C0O A;  3NMZ C;  3THK A;  3I35 A;  3VS3 A;  2BZY A;  3VS5 A;  1FYN A;  1M8M A;  2LX7 A;  2CT4 A;  1YWO A;  3PE0 A;  1RLP C;  1YN8 A;  5ECA A;  1NEG A;  2CSI A;  2YUP A;  1MV3 A;  1BK2 A;  3REB B;  1UJ0 A;  3NHN A;  1UHC A;  2AK5 A;  4D8K A;  4X1V A;  4M4Z A;  2VWF A;  1AEY A;  1PWT A;  1WYX A;  5IHI A;  4J9I A;  2X3W D;  3M0U A;  1SHF A;  2HEQ A;  2J06 A;  2RQV A;  5IXB A;  1AVZ C;  2A37 A;  4J9D A;  1ABO A;  1X6G A;  4AG1 C;  1QKW A;  2IIM A;  3EGU A;  1E6H A;  3RNJ A;  1RLQ C;  2V1R A;  1OPK A;  1RI9 A;  2JMC A;  3C0C A;  4RTT A;  3SEM A;  2BTT A;  1GFD A;  1WXT A;  2EYX A;  4RTW A;  1QCF A;  1W6X A;  5GJW B;  1NLP C;  2GNC A;  1QKX A;  3UA6 A;  1NYG A;  4Z8A A;  1MUZ A;  1QLY A;  3I9Q A;  2AKK A;  1X69 A;  4JJD A;  2BZX A;  1SEM A;  3M0S A;  1YWP A;  1K4U S;  2LZ6 B;  3I5R A;  1ZBJ A;  2A08 A;  3H0I A;  3VS6 A;  4KRT A;  4RTY A;  2ENM A;  2J05 A;  4R0K A;  2LCS A;  1WA7 A;  1GBR A;  1I0C A;  2F2X A;  2JMA A;  3SHW A;  1AWW A;  1HSQ A;  1BBZ A;  1UUE A;  2LJ0 A;  1ARK A;  1VYT A;  1YCS B;  1QWF A;  2K3B A;  1U5S A;  3VS1 A;  2EVR A;  4ORZ A;  2O31 A;  2KEA A;  1V1C A;  1Y57 A;  1GL5 A;  1HD3 A;  1NG2 A;  3EG1 A;  2F2V A;  4JZ4 A;  2CH4 W;  2EYZ A;  1K76 A;  2PNI A;  4EIK A;  1NYF A;  1UE9 A;  3IQL A;  1M27 C;  3LH5 A;  4J9H A;  4QT7 A;  2K9G A;  3QWY A;  2MOX A;  1AZG B;  2CH4 A;  2DL7 A;  4GBQ A;  2DL8 A;  2CSQ A;  3I5S A;  1GFC A;  1JO8 A;  1JXO A;  2HDA A;  4LNP A;  4CC4 B;  1XOV A;  1BB9 A;  2JT4 A;  3VS4 A;  2X3X D;  2L0A A;  1ABQ A;  5FW9 A;  1WDX A;  4OMP A;  2JS2 A;  1NM7 A;  2J6F A;  4A63 B;  4F16 A;  1RUW A;  2DVJ A;  1BU1 A;  3U23 A;  5FWB A;  3EHR A;  2ED0 A;  2L3S A;  4LE9 A;  2A28 A;  2AKL A;  1UHF A;  2P4R A;  5IXF A;  1WXU A;  1X43 A;  2G6F X;  4J9B A;  2KBT A;  4AFQ C;  1PRM C;  3UA7 A;  1K0S A;  1X6B A;  4AFZ C;  1VA7 A;  1JXM A;  1S1N A;  4JJC A;  4Z89 A;  3ZL7 C;  4RTU A;  1J3T A;  1T0H A;  4RUG A;  4HCK A;  1I07 A;  1LCK A;  2FG0 A;  3PVQ A;  1TUC A;  2D8H A;  1M3A A;  2VVK A;  4F17 A;  2D8J A;  2YUQ A;  1X2Q A;  3M0Q A;  2DF6 A;  2LMJ A;  1T3S A;  1WLP B;  3VRZ A;  1H3H A;  1ZUK A;  2CUB A;  1X27 A;  2DE0 X;  3RBB B;  1SRM A;  1AWX A;  2RF0 A;  1OOT A;  2YSQ A;  2DJQ A;  1W70 A;  2M51 A;  2YUN A;  3FJ5 A;  4LN2 A;  4DEY A;  3M0P A;  3M0R A;  3VS0 A;  2W0Z A;  1K9A A;  3VS2 A;  3KFV A;  2BZ8 A;  2DYB A;  2KRN A;  2H8H A;  1AWJ A;  1UFF A;  2B86 A;  2KXD A;  1T0J A;  2KT8 A;  2K2M A;  3H41 A;  2RMO A;  1UJY A;  2KT1 A;  2KYB A;  2SEM A;  3CQT A;  5IHK A;  4HVU A;  1WXB A;  2DL4 A;  4OMN A;  1KIK A;  2C0I A;  2JS0 A;  3R6N A;  2GTJ A;  1T3L A;  2E5K A;  4Y92 A;  1GCQ C;  2CRE A;  1M3B A;  2EGE A;  2LP5 A;  3H0F A;  4RTV A;  5L23 A;  2JW4 A;  2OAW A;  2KRM A;  1N5Z A;  4IIM A;  4OML A;  5I11 A;  2V1Q A;  2O9V A;  2DIL A;  1JQQ A;  2AZV A;  3EG3 A;  2L3P A;  2JTE A;  3TSZ A;  1SRL A;  2EPD A;  2RPN A;  1SHG A;  2RQT A;  3JV3 A;  2ROL A;  4JZ3 A;  1H92 A;  2ABL A;  1W1F A;  2DRK A;  2CT3 A;  2O9S A;  1NEB A;  1H8K A;  4RTX A;  2MCN A;  3VRY A;  2LJ1 A;  1Y0M A;  1AD5 A;  1UGV A;  2OJ2 A;  1OPL A;  1PNJ A;  4OMO A;  3UAT A;  2YT6 A;  2LNH B;  1TUD A;  2DBK A;  4K11 A;  2DMO A;  1I1J A;  1PRL C;  2KE9 A;  1PKS A;  3UF4 A;  1AZE A;  1M3C A;  1K0X A;  1GCP A;  2FPF A;  4CC3 A;  2O88 A;  2GTO A;  1WIE A;  4ESR A;  3NGP A;  3ULR B;  2K6D A;  2SRC A;  1ZX6 A;  4OMM A;  1ZLM A;  2ROT A;  1FMK A;  2DRM A;  4J9F A;  3O5Z A;  2I0N A;  1PKT A;  2GGR A;  3NPF A;  2FPD A;  2YUO A;  5IHN A;  1AWO A;  2GQI A;  4CC7 A;  1UTI A;  2KNB B;  2O2O A; 
#chains in the Genus database with same CATH topology
 1KSW A;  1Q81 U;  3EG2 A;  4QVZ A;  5HCK A;  1N9R A;  2PZ1 A;  1B3Q A;  3MCA B;  4Y91 A;  1G2B A;  3HSB A;  2KR3 A;  1NLO C;  5CVI A;  3SFM A;  3PVL A;  3JCM c;  4M7A E;  4IUR A;  4JS4 A;  1UEC A;  3HRU A;  2KMT A;  3T9N A;  5CQY A;  3CCM T;  2K5L A;  2EW3 A;  4XK8 E;  3VUZ A;  3L2V A;  2L3Q A;  2COY A;  2J7I A;  1I5O B;  1NJI R;  4ANJ A;  5GAO m;  4FT4 A;  2DD4 A;  1VYV A;  3E19 A;  1WNL A;  3QO3 A;  2LJ3 A;  3FLG A;  2LDM A;  2FRW A;  1YCY A;  4V2S A;  2YRD A;  2YXY A;  4RG8 A;  5EC7 A;  1NJI C;  2CYZ B;  2RI5 A;  2ZPH B;  3JB9 H;  5FU6 B;  4EMK A;  1Y07 A;  3OYN A;  2M0Y A;  4RTZ A;  4J7I A;  4OMQ A;  4QVC A;  5IN1 A;  8AT1 B;  3HHT B;  2KI7 A;  4PFZ A;  1SKU B;  4J7F A;  1ZHI A;  3GOX A;  2JNG A;  1VQ4 T;  2LQN A;  2VUB A;  4C0G A;  1KQS A;  2DLP A;  2ZPG B;  2RI3 A;  3H9N A;  5FWC A;  1M1G A;  2QEX Q;  3A8O B;  4M77 G;  2DX1 A;  2M16 A;  2JTM A;  3QUI A;  1SPK A;  2VYT A;  4M7D G;  2ESW A;  4IIO A;  3JCM X;  5CKE A;  2DA9 A;  4ZNX A;  1WFW A;  1X2K A;  4LUD A;  2QG9 B;  4A4F A;  5CIU A;  3A1P A;  1JEG A;  3QJY A;  1RAH B;  2EYY A;  1VQO A;  1VQK Q;  3P8D A;  5GAO q;  1W2B A;  5EG2 A;  2DAQ A;  2OTL Q;  1BI2 A;  4DBF A;  2DL3 A;  1ZA1 B;  3OYY A;  4M78 C;  4BI8 B;  4E7Z A;  2JXB A;  4F04 B;  3GBQ A;  5GAN 2;  2L2P A;  5I22 A;  1BIB A;  2KVQ G;  3RES A;  1WJR A;  1MMD A;  3CC7 Q;  3CMA Q;  5GAN 8;  3NMZ C;  1Q7Y R;  4M7D A;  3THK A;  4A4K A;  1NPR A;  3I35 A;  5GAN 5;  2E5Q A;  1LNX A;  1M8M A;  2K3Y A;  1Q86 U;  1QVF S;  1IRE B;  1YI2 Q;  1W4S A;  1YN8 A;  1VQP A;  3JCM d;  1Q7Y C;  5GAN 3;  3DB4 A;  2DXB A;  3QG1 A;  4KUD K;  3AT1 B;  4O5V A;  4C5E A;  2AK5 A;  2LT1 A;  3OYI A;  5IHI A;  1WYX A;  2HNI A;  3ZBD A;  2QXF A;  5IXB A;  3FC3 A;  2A37 A;  2IPO B;  3OMG A;  3M4Y A;  4J9D A;  1MMA A;  3R6O A;  1X6G A;  1B34 B;  3CC4 A;  4A4H A;  1YIJ A;  1MMN A;  1TUG B;  2IIM A;  4XTZ A;  1YBY A;  3HFO A;  1KQS P;  3L2Q A;  1U8R A;  1RLQ C;  2V1R A;  2JMC A;  2QGF B;  4OB1 B;  3EFS A;  2HMA A;  3DLM A;  1QCF A;  1W6X A;  1WQW A;  2CZ0 B;  1NLP C;  1N9S A;  4ZN1 A;  1MUZ A;  4HT8 A;  1X69 A;  2BZX A;  2EFI A;  4OP0 A;  2X4J A;  2QQB A;  4OVA A;  1WHL A;  3VV0 A;  3H0I A;  4F7U G;  3CCQ Q;  3V7C A;  1WJQ A;  3S3N A;  2JMA A;  1KQ1 A;  4C0F A;  1HSQ A;  1OZ3 A;  3JCM e;  3I55 A;  4E7I A;  3H8Z A;  4C5I A;  1XJW B;  1VYT A;  1YCS B;  1RAI B;  1U5S A;  4Q5W A;  1W2B P;  1R77 A;  4LXC A;  2KEA A;  4IUV A;  3EG1 A;  2F2V A;  4JZ4 A;  2CH4 W;  2VAS A;  2ZPI B;  3TQ7 P;  1UE9 A;  1BI1 A;  1C0M A;  5FU7 B;  4J9H A;  3G4S A;  5D6W A;  4QT7 A;  4XTV A;  3OBW A;  4F7U A;  3HP9 A;  4GBQ A;  3LLR A;  3EGX A;  5DM7 R;  1JXO A;  2VXE A;  5GAM e;  2HDA A;  1XOV A;  2DTO A;  2JT4 A;  3VS4 A;  5CAI A;  1ABQ A;  1EIF A;  5GMK j;  1UB4 A;  2D9T A;  4C8Q B;  2JS2 A;  1YIT Q;  4Z02 A;  2DK3 A;  3KXT A;  3CCM Q;  2K5I A;  1RUW A;  1Y96 B;  3U23 A;  2EWN A;  3EHR A;  1VQO T;  2AKL A;  3JAM E;  3FEO A;  2JTF A;  5GAO l;  5D6X A;  1X75 C;  2KAF A;  2IVW A;  2G6F X;  2KBT A;  4F7U F;  3EG9 A;  1K0S A;  1VA7 A;  1S1N A;  5GAN f;  3RKY A;  3BDU A;  4Z89 A;  1T0H A;  4RUG A;  5LL6 S;  1I07 A;  2FG0 A;  2K5F A;  4ZGE B;  2D8H A;  2D8J A;  4JUV A;  4E7S A;  2V26 A;  1X2Q A;  2YUQ A;  3ZFJ A;  2E4H A;  4FYW B;  2E65 A;  3RBB B;  2LQ8 A;  1AWX A;  2RF0 A;  5LJ3 d;  1VUB A;  1VQ4 Q;  3HRS A;  2GFU A;  3LGF A;  1I4K 1;  2M51 A;  2YUN A;  3QSU A;  4PJN A;  4LN2 A;  2XIC A;  2RJE A;  1K9A A;  2NUP B;  2GFA A;  3VS2 A;  4C8Q E;  2DYB A;  2RH2 A;  2D0Q B;  2H8H A;  4XU3 A;  2KXD A;  2B86 A;  3PMT A;  3CC4 T;  1KG1 A;  2NYS A;  1OZ2 A;  5KYW A;  1HXD A;  4ZGJ B;  3S3O A;  2QGG A;  4HVU A;  1IGU A;  4M78 F;  3CCL A;  4QKU A;  1T3L A;  2E5K A;  1GCQ C;  2CRE A;  1M3B A;  2VC8 A;  2EGE A;  3BW1 A;  2QQR A;  4C5H A;  2KRM A;  4OML A;  2O9V A;  4QQG A;  4PLL A;  2O4X B;  2JTE A;  4PFP A;  2WSF E;  2HL3 A;  2QDY B;  2MWO A;  4DBQ A;  4C92 B;  3KUF A;  2EPD A;  2CZ1 B;  1Y71 A;  4BDY A;  2O9S A;  1H8K A;  3J81 E;  3VRY A;  3V7R A;  2R57 A;  2EAY A;  1Q82 U;  3JCM J;  5KE2 A;  4A54 A;  4N4H A;  1PNJ A;  2OAU A;  2P4T A;  3M53 A;  1NZ9 A;  1TUD A;  3G4S T;  2CZ7 B;  4K11 A;  1PRL C;  2XID A;  4M78 B;  1PKS A;  1AZE A;  1GCP A;  3QDF A;  1P92 A;  4BI4 A;  2JZ2 A;  3MJX A;  2CP0 A;  1QP2 A;  4D6W A;  2K6D A;  4J83 A;  4OMM A;  1BKB A;  2ROT A;  1PKT A;  4PJM A;  3JCM h;  1X01 A;  3HFN A;  4JRQ A;  1MGQ A;  1AWO A;  5CK9 A;  4CC7 A;  5CQX A;  2ZPB B;  1WPY A;  3DLL A;  3J7A F;  1WQ7 A;  2P0P A;  2Y4Y A;  1CKB A;  2DNU A;  3CME Q;  2KRO A;  4C92 E;  3OYF A;  4LDX A;  1JB0 E;  1R8O B;  2FEI A;  1OQK A;  1FMV A;  2HCK A;  3VS7 A;  2VKN A;  4QW2 A;  2KRS A;  1UGR B;  3TVT A;  3TU4 K;  2E3H A;  2HKN A;  3CBM A;  2EQK A;  1SSH A;  1QCN A;  2CP2 A;  1LOJ A;  1IO6 A;  1K8A R;  3CC2 A;  3JCM W;  3CBP A;  2MIO A;  2F2W A;  1RAE B;  5AT1 B;  4M78 E;  2P0K A;  2JM8 A;  5LJ5 j;  2EQU A;  2W10 A;  5KYU B;  2BUD A;  4DOV A;  2AHJ B;  2FPE A;  2HZY A;  1R0B G;  4JJB A;  4LUE A;  1K8A C;  2MI6 A;  4ATO A;  4PJJ A;  3CCV A;  4ZTF A;  1QVG A;  1KC8 U;  1ZSG A;  1WX6 A;  5KYY B;  4BE1 A;  3VYH B;  2OI3 A;  1WI7 A;  2LT4 A;  3CCL T;  5GMK m;  1WZO A;  1VQL A;  5I2M A;  4M77 C;  1ZA2 B;  4YTL A;  3EGD B;  2K3X A;  4DA4 A;  3QWX X;  4EMH A;  1YJW A;  1Z9Z A;  4N4G A;  2RNA A;  4JPB W;  1IHV A;  1PHT A;  2EKH A;  3TSW A;  1YJN A;  4AFU C;  4M7D C;  2HSP A;  2L3R A;  4MDX A;  4UC4 A;  1B07 A;  4XAX B;  5CKH A;  1M90 U;  2FZG B;  1K73 R;  1M1K U;  4HT9 A;  2C0T A;  1OV3 A;  1M9S A;  2QYZ A;  2P84 A;  2XDB A;  2EQI A;  4FSS A;  4J5Y A;  2LC4 A;  1EFN A;  2XD0 A;  1GCQ A;  1K73 C;  1CKA A;  1LPL A;  3EAE A;  3MP1 A;  3JB9 J;  1OX9 A;  1QWE A;  1D3B A;  2CP6 A;  1TG0 A;  1D1B A;  2AZS A;  3WVD B;  4HVW A;  1GBQ A;  4WTO B;  3PT9 A;  2FRY A;  2HBW A;  2ED1 A;  4JLG A;  4DEX A;  1TXQ A;  3CC4 Q;  1U06 A;  2DM1 A;  4OB3 B;  2FZC B;  2K7A A;  3LH0 A;  4E6R A;  1I8F A;  3SWN C;  2A36 A;  2C0O A;  3OYK A;  2YRC A;  1TWB A;  3VS5 A;  2BZY A;  2LX7 A;  3JSC A;  2CT4 A;  3E9F A;  4M77 D;  1RLP C;  1D0Z A;  5LJ3 h;  1JBM A;  2NUT A;  2CSI A;  3OS0 A;  4M7D D;  1AHJ B;  3QPH A;  5C0M A;  4PJO B;  1BK2 A;  2HD0 A;  2R5M A;  4Y28 E;  1UJ0 A;  4FYX B;  1G8X A;  1TH7 A;  1QVG P;  3CD6 A;  1VQ5 A;  2X51 A;  4L5G A;  5KYN A;  2CP5 A;  2DO3 A;  4D8K A;  1AEY A;  2RJD A;  4J6W A;  2XKO C;  4J9I A;  3UDC A;  4M75 B;  1Q81 R;  2HEQ A;  2J06 A;  1AVZ C;  5LJ5 f;  2VGN A;  4KH0 B;  5LJ3 g;  2DJZ A;  1QKW A;  3M58 A;  2Z0W A;  2DER A;  3MKD A;  3OYG A;  3C0C A;  3OYA A;  2M9U A;  2EYX A;  5KCH A;  1YFN A;  1QLY A;  3I9Q A;  5M9O A;  2AKK A;  5D7U A;  1M8V A;  3A8G B;  4N4I A;  1MNE A;  3X20 B;  3M0S A;  1YWP A;  4MML A;  5CCA A;  1BI3 A;  2YLB A;  1ZBJ A;  3CCV T;  1QVP A;  3OSV A;  2LCS A;  1VQ6 A;  4OGE A;  3G6E Q;  1WA7 A;  2ZPE B;  1GBR A;  2F2X A;  4HCB A;  4FW2 A;  1BBZ A;  1UGP B;  1ARK A;  1VQL T;  5KYX B;  2K3B A;  2D6F A;  4PJO E;  3VS1 A;  3QXE B;  2EVR A;  3EFR A;  2O31 A;  5IT9 E;  1V1C A;  1HD3 A;  1YJW T;  4XTY A;  1YJN T;  3V8J A;  3CCE A;  3E9G A;  1K76 A;  4RCB A;  4M75 E;  1M27 C;  1QCO A;  2QK0 A;  4E47 A;  2BIV A;  3CBO A;  3OW2 A;  2DL8 A;  3UWN A;  2CSQ A;  4FCY A;  1M2O A;  3I5S A;  1GFC A;  1JO8 A;  3TRE A;  4LNP A;  1Q95 G;  2X35 A;  5HK3 A;  2E41 A;  4FU6 A;  5FW9 A;  3UT1 A;  1WDX A;  1LJO A;  3SD4 A;  2XG8 D;  2RHI A;  3L2W A;  4A63 B;  3OYJ A;  1S72 A;  4M77 A;  1BU1 A;  2X4W A;  1M4Z A;  1C1A A;  4BY6 C;  3A8L B;  4LE9 A;  4L6V 5;  1QMC A;  2E12 A;  2P4R A;  3NTH A;  3QZ9 B;  3OSS C;  4LDV A;  4X9D A;  1X43 A;  2R5A A;  3OS2 A;  1V29 B;  2DTH A;  5J26 A;  4RTU A;  5GAN j;  3OMC A;  1TSF A;  4EMK B;  1AT1 B;  4C0D C;  4F17 A;  3PTA A;  2M0O A;  3M0Q A;  3C94 A;  2DF6 A;  2LMJ A;  1H3H A;  4M77 F;  2CUB A;  1D1A A;  5GMK l;  1X27 A;  1VQM A;  3ASK A;  3CXC A;  1OOT A;  4M7D F;  2YSQ A;  1XQH A;  1Q86 R;  1QW1 A;  1YJ9 A;  3CD6 T;  2DJQ A;  1VQ5 T;  3CPW S;  3A5Z B;  4N0A A;  9ATC B;  3GF5 A;  5GAO p;  4DEY A;  2DZ9 A;  3M0P A;  2EJ9 A;  4IUQ A;  4MZM A;  3SWN A;  1Q86 C;  2CS7 A;  3FJP A;  4ZGD B;  2P0Q A;  2KRN A;  1AWJ A;  2MPX C;  3FIF A;  1SSF A;  1O9S A;  4CI0 C;  3MO8 A;  4RKU E;  3PNW C;  3CQT A;  2PVD B;  1WXB A;  3G71 A;  3NTK A;  3CCS A;  3VUB A;  1KIK A;  2AIR B;  2JS0 A;  3ME9 A;  2FB7 A;  1YHQ A;  2GTJ A;  3LYI A;  4J6Y A;  4Y92 A;  3OW2 P;  2MYS A;  3M54 A;  4KH1 B;  1RI0 A;  2JW4 A;  1FWZ A;  4M7D B;  4A4E A;  1VQ6 T;  2DXT A;  3EG3 A;  3GP8 A;  1D0X A;  2QQ9 A;  2GQV A;  3TSZ A;  2K2V A;  4O6J A;  1FMW A;  5I21 A;  1HK9 A;  3CCR A;  2RQT A;  3OYB A;  4JZ3 A;  1H92 A;  3M59 A;  2RHX A;  5GAN 6;  1Y0M A;  1ZSZ C;  3CCE T;  2OJ2 A;  2L5Q A;  2YT6 A;  1K9M U;  4ME7 A;  3E2U A;  4QQD A;  3BFM A;  5DY9 A;  2L8D A;  2KE9 A;  1IRX A;  2ATC B;  4CC3 A;  3HKS A;  4C92 G;  1QVG S;  1LVK A;  1WIE A;  3CXC P;  4ESR A;  3SWN B;  2CP3 A;  3ULR B;  2RHU A;  1ZLM A;  1S72 T;  1FMK A;  3O5Z A;  3URG A;  3NPF A;  2FPD A;  4VUB A;  5CR2 A;  5FLX E;  4J8O A;  4AT1 B;  5A0L A;  1VIE A;  5IHN A;  4FW1 A;  2V8I A;  2RK2 A;  2HQH A;  2DTI A;  2GQI A;  5HK0 A;  4BDZ A;  3GLX A;  1FX7 A;  3CCV Q;  4JRI A;  5J3B A;  1VQN A;  4JDS A;  1VQP T;  1KJW A;  2CZ6 B;  2J6O A;  3M57 A;  1VOM A;  3EG0 A;  2KXC A;  1E6G A;  1OEB A;  4XTU A;  1KFZ A;  3CCU A;  5DLO A;  1GRI A;  2QTV A;  1VQL Q;  2JM9 A;  3MHX A;  1VQM T;  4JLI A;  1RL2 A;  1VQ8 A;  2HAX A;  4EPC A;  4BAC A;  2JOY A;  5GAN g;  2CP7 A;  1K1Z A;  1YJ9 T;  2FL7 A;  1YJN Q;  1WGS A;  1VQK A;  3JB9 G;  2OTL A;  2FO0 A;  3WXM B;  4F7U B;  1YIJ T;  4J9E A;  3OYE A;  5GAM j;  2RK1 A;  4M7A D;  1GXI E;  2DIQ A;  3EGX B;  2ZZD A;  4J9C A;  3VYG A;  4OF1 A;  2GCX A;  3OYH A;  2EJG A;  4AFS C;  2Y4X A;  3CMA A;  2DL5 A;  5LJ5 d;  1DJ7 B;  2XK0 A;  3D7S B;  2XMF A;  2QDL A;  2QQA A;  5IH2 A;  1YI2 A;  4LDU A;  1RAF B;  2EQM A;  4XU0 A;  3OA6 A;  3G71 T;  3CCS T;  2EBP A;  2K79 A;  1MV0 B;  1YHQ T;  2MMP A;  4F14 A;  2A7Y A;  3EG9 B;  4J6X A;  3I55 T;  2QA4 A;  2OTJ A;  3OYD A;  4J9G A;  5LJ3 e;  2QAS A;  4B9X A;  2JN0 A;  2RQU A;  4Z88 A;  1M30 A;  2DXC A;  5FU6 C;  1AOJ A;  3EH2 A;  2PUO B;  2YDL A;  1IXD A;  3SB2 A;  4RG2 A;  4BE2 A;  2MAM A;  2DIG A;  1ZUU A;  3CCR T;  1N8R U;  3I56 A;  1JU5 C;  1PSF A;  5GJV B;  2FYK A;  3BE3 A;  2HSE B;  2KYM A;  2RN8 A;  4OB2 B;  2LCC A;  5GMK h;  3CD6 Q;  1VQ5 Q;  4F7U E;  2FHD A;  1RAC B;  4AG2 C;  4OGC A;  1M2V A;  1ZBX A;  4WCI A;  1Q82 R;  3X24 B;  3TEE A;  3RMS A;  5FRO A;  2PTK A;  4M7A G;  3CCQ A;  3REA B;  4KUI A;  1TU0 B;  3EH1 A;  5KYW B;  3EFO A;  1MHN A;  2DBM A;  4NL3 A;  1MND A;  1Q82 C;  3G7Z A;  3A8H B;  1KQS S;  3JCM f;  3OS1 A;  3MEU A;  3HL8 A;  1ZSZ A;  3P8H A;  2VGM A;  4ZTJ A;  4MMK A;  4B9W A;  1MV3 A;  2XU8 A;  3Q1J A;  1VQN T;  3M9Q A;  4RCC A;  5KH6 A;  1VQ6 Q;  3NHN A;  4L59 A;  2HQX A;  1U1T A;  1UHC A;  4M7A A;  1WHM A;  1K8A U;  2M02 A;  3LWH A;  3CCU T;  4X1V A;  2DXU A;  4M4Z A;  4PJL A;  3OW2 S;  3M0U A;  3V7S A;  4LD6 A;  2RQV A;  5GAM f;  1YIT A;  1VQ8 T;  2RHZ A;  2ZPF B;  4AG1 C;  3CCM A;  1W2B S;  4FYY B;  3MEA A;  2EYQ A;  2EJF A;  5FRM A;  2O01 E;  1VQK T;  3CCE Q;  1E6H A;  1OPK A;  1RI9 A;  2OTL T;  2BTT A;  1GFD A;  3RUX A;  1PD1 A;  2HQE A;  4E7J A;  5GJW B;  2L89 A;  2GNC A;  1QKX A;  2BE7 D;  4Z8A A;  4JJD A;  1VQO Q;  2DVE A;  3CMA T;  3ER0 A;  1SEM A;  2LZ6 B;  4M75 G;  2EKO A;  2E64 A;  3I5R A;  7AT1 B;  4KRT A;  3VKI A;  2J05 A;  1S72 Q;  1XTD A;  2WAC A;  5GAN 4;  3INZ A;  2EQJ A;  2KSS A;  1UGQ B;  2BKD N;  1UUE A;  2LJ0 A;  2F5K A;  1KC8 R;  1D1C A;  1VQ4 A;  1TS9 A;  2XI9 A;  3KBG A;  2QA4 T;  2PVO B;  2OTJ T;  1ZSZ B;  1OU9 A;  2HL5 C;  1VQ9 A;  1Y57 A;  1VQP Q;  1KD1 U;  1JRI A;  1KC8 C;  4EIK A;  1M5Q 1;  1NYF A;  2E70 A;  3N5B B;  3LH5 A;  4HCZ A;  1G3W A;  2K9G A;  3FDR A;  2MOX A;  2CH4 A;  2DL7 A;  3I56 T;  3L2U A;  3M5A A;  5GAN 7;  2X3X D;  1M90 R;  4OMP A;  3RKX A;  1NM7 A;  1YJ9 Q;  3G1J A;  4JS5 A;  2J6F A;  2DKG A;  1BCM A;  4N0A C;  3VU3 C;  1M1K R;  3M56 A;  2DVJ A;  2F69 A;  1IGQ A;  4X34 A;  3RER A;  1YIJ Q;  2ED0 A;  1UHF A;  1M90 C;  3NFC A;  1G3S A;  2DEQ A;  5IXF A;  2QAZ A;  2DZC A;  4C8Q C;  3CCQ T;  1M1K C;  5J39 A;  3L42 A;  4J9B A;  4AFQ C;  1PRM C;  3UA7 A;  1X6B A;  4AFZ C;  3PFS A;  1JXM A;  4JJC A;  4LDY A;  3PIO A;  3X25 B;  4HCK A;  4R56 A;  3PVQ A;  2VXF A;  3MEW A;  1M3A A;  3A8M B;  3G71 Q;  1EX4 A;  5GAN d;  3HPW A;  3CCS Q;  4C5G A;  1H3Z A;  1PCX A;  1WLP B;  2MK5 A;  4CRI A;  1YHQ Q;  1PC0 A;  4KGV B;  3I55 Q;  2DE0 X;  2HBP A;  2RB6 A;  3GIB A;  1WHK A;  1SRM A;  3MP8 A;  4B6M A;  2I2L A;  3CCJ A;  1NJI U;  5CO7 A;  1TOV A;  1W70 A;  5A0G A;  3FJ5 A;  2K4Y A;  4IUU A;  1JJ2 A;  3E1S A;  2ZGW A;  3CCR Q;  3BDL A;  1Q81 C;  3CC2 T;  5LJ5 h;  1YIT T;  1NE8 A;  3KFV A;  3G4S Q;  3QII A;  4AMC A;  2K2M A;  3H41 A;  1UJY A;  5CKB A;  2KYB A;  1D3B B;  1O75 A;  1R0C B;  5IHK A;  2B8A A;  3F70 A;  4DBH A;  1M1F A;  4HKE A;  2DL4 A;  4C8Q D;  2AT1 B;  4OMN A;  2C0I A;  3TCJ A;  5GAO r;  4EDU A;  1H64 1;  1WJS A;  5LJ5 g;  4PFO A;  3OYC A;  2LP5 A;  1OUL A;  3H0F A;  3CME A;  5L23 A;  3V8L A;  3PMI A;  4KUL A;  2OAW A;  5GAN e;  5I11 A;  2KY9 A;  2AZV A;  4XTW A;  1QQJ A;  2RA2 A;  4DOW A;  3L2R A;  1X6O A;  2YWW A;  2NUT B;  2RD1 A;  2A3L A;  2RPN A;  3JCM b;  2ROL A;  1G3T A;  3MET A;  1VQ7 A;  4II1 A;  1NEB A;  1VQ9 T;  4RTX A;  3LW5 E;  2MCN A;  2VB6 A;  2LJ1 A;  3S3M A;  1VQN Q;  1AD5 A;  1RAB B;  2LQK A;  1B34 A;  2LTO A;  1UGV A;  2K57 A;  4PKC C;  4C92 C;  1WHG A;  4LD9 K;  3CCU Q;  1BYM A;  4P5N A;  4KGX B;  2DMO A;  1Q7Y U;  3HTR A;  1VQ8 Q;  2DD5 A;  3UF4 A;  1K0X A;  2FPF A;  1PD0 A;  5HKC A;  2GTO A;  2LNV A;  1ACM B;  1RAA B;  2SRC A;  1ZX6 A;  4BI3 A;  4FYV B;  2KDS A;  4J9F A;  4WF2 A;  2EIF A;  1JJ2 P;  2MF2 A;  4JRP A;  2YUO A;  4MZT A;  4PL6 A;  4C8Q G;  3CCL Q;  1HYO A;  3P8B B;  1FXX A;  1VYU A;  2IG0 A;  4NL2 A;  3H0H A;  5GMK i;  2QI2 A;  1B7T A;  3M0T A;  2YLC A;  1IZ6 A;  1U3O A;  1UG1 A;  3RKW A;  2QA4 Q;  2OTJ Q;  1G5V A;  3DB3 A;  4HXJ A;  2RQR A;  2RJC A;  3M4G A;  3CCJ T;  4C92 D;  3O8V A;  4FSX A;  2LCL A;  2HKQ B;  2KK4 A;  2GBQ A;  2FVU A;  4C8Q A;  2PU9 B;  4BD3 A;  2D0N A;  4JRK A;  5GMK e;  2YRV A;  1Z9Q A;  4GLM A;  1Y96 A;  2ECZ A;  1G83 A;  2V8K A;  3I56 Q;  1RAG B;  1WHJ A;  4CC2 A;  4D8D A;  1YP5 A;  2LQW A;  3V8K A;  4BE0 A;  3MEV A;  1PG5 B;  5GAM d;  1YNZ A;  2LVM A;  4M78 D;  4M77 B;  4PLI A;  8ATC B;  5L8R E;  1Y7X A;  2RQW A;  4HVV A;  4C8Q F;  2ZAE A;  1NBE B;  3OY9 A;  3VJP A;  5KCO A;  3CME T;  1CSK A;  4E7H A;  2D1X A;  3HRT A;  1E7O A;  3A98 A;  1N6A A;  1F1B B;  2RO0 A;  2BE9 B;  3UPU A;  2EGC A;  3JB9 D;  2CDT A;  4A4G A;  2EYW A;  2A0F B;  2NWM A;  1ZUY A;  1OYX A;  1UDL A;  2NLU A;  2J6K A;  2KGT A;  1VQ7 T;  3OYM A;  2NUZ A;  2NUP A;  4LDW A;  4R55 A;  5A0D A;  2XDP A;  3EHQ A;  1WHH A;  5CKF A;  4M7A C;  1U1S A;  2XDD A;  3OB9 A;  4OB0 B;  1HJD A;  2H3E B;  2DFU A;  3CC2 Q;  2X4Y A;  1A0N B;  3MP6 A;  1IB8 A;  3G6E A;  2GF7 A;  4M77 E;  4QVD A;  1K9M R;  2PVG B;  2EGA A;  1BCO A;  4BUG A;  3LWI A;  2CUD A;  4QQ6 A;  4M7D E;  5I2S A;  4TVR A;  5GAN h;  1PSE A;  4XTX A;  3LGL A;  3GPL A;  4M78 G;  3ZEH A;  2QEX A;  2O4X A;  3CPF A;  3VS3 A;  1FYN A;  1K9M C;  4RMO A;  3PIP A;  1YWO A;  2E6N A;  3PE0 A;  5ECA A;  1NEG A;  4C92 A;  1G3Y A;  2YUP A;  3JCM P;  4C0Z A;  3REB B;  3RDV A;  4XQ3 A;  1OX8 A;  4KBM B;  1OI1 A;  4E7L A;  1YJW Q;  2DEU A;  2VWF A;  4ELZ C;  1PWT A;  2F5T X;  2X3W D;  2LX9 A;  1SHF A;  4PJO C;  1KQ2 A;  3RR6 A;  1XNI A;  4M78 A;  4XU1 A;  1RAD B;  3JCM V;  1ABO A;  1VQ9 Q;  5D6Y A;  2RM4 A;  3QDR B;  3RMQ A;  4C92 F;  2V8J A;  3EGU A;  4OMF B;  4HA8 A;  3QZ5 B;  3RNJ A;  3CC7 A;  2COZ A;  2DYI A;  3QYH B;  4RTT A;  4M75 C;  3SEM A;  1VIF A;  1WXT A;  4RTW A;  3UA6 A;  1NYG A;  2VV5 A;  2PUK B;  1TTH B;  1OU8 A;  6AT1 B;  5AYF A;  1BIA A;  2RJF A;  4IKF A;  3H6Z A;  3OBY A;  1BI0 A;  1K4U S;  5FRN A;  2A08 A;  3VS6 A;  4RTY A;  2ENM A;  4R0K A;  1I0C A;  3SHW A;  2OX7 A;  1AWW A;  2DPP B;  3QBY A;  2KQW A;  1QVF A;  2WSE E;  1QWF A;  4GLK A;  1D0Y A;  3S6W A;  1V76 A;  4ORZ A;  1GL5 A;  1NG2 A;  2EYZ A;  4IUT A;  4X9C A;  2E1H A;  3WVE B;  2PNI A;  1JJ2 S;  3JB9 F;  3IQL A;  3NTI A;  4PJO D;  3C12 A;  2M1H A;  1IHW A;  3QWY A;  4DQ2 A;  1AZG B;  4BY6 B;  2QTX A;  5KYU A;  4CC4 B;  5LJ5 e;  2MWP A;  1BB9 A;  3FRN A;  3CPW A;  2L0A A;  3CCJ Q;  2COW A;  4IUP A;  4M75 D;  3PGG A;  1N8R R;  4F16 A;  5KYY A;  2RI2 A;  5FWB A;  1KK7 A;  4XU2 A;  2L3S A;  4ZN3 A;  4C0D B;  3QKJ A;  1I5L A;  2A28 A;  4FT2 A;  5HY6 A;  1MMG A;  1WXU A;  1N8R C;  4MDW A;  3G6E T;  3FB9 A;  2QQS A;  3RIR A;  3J80 E;  1D09 B;  3ZL7 C;  3OS5 A;  3EGD A;  1J3T A;  5IAY A;  1LCK A;  4A53 A;  1EZZ B;  3C95 A;  1TUC A;  2E3I A;  2VVK A;  3OQ5 A;  2QEX T;  2DET A;  1KHC A;  2JVV A;  3L1A A;  5LJ3 j;  1T3S A;  4KT0 E;  3VRZ A;  3QHS A;  3GNG A;  1ZUK A;  4EMG A;  4HCC A;  1UEB A;  4NS5 A;  2G3R A;  5KE3 A;  4EMK C;  3C4S A;  2PQW A;  1UGS B;  4E7K A;  3JB9 I;  4FM4 B;  4PNO A;  4KGZ B;  3JCM g;  2H3J A;  3M0R A;  3VS0 A;  2W0Z A;  5GAM h;  4PJO G;  1QVF P;  4E2F B;  1VQ7 Q;  2BZ8 A;  2E10 A;  3QJ6 A;  5C6S A;  1UFF A;  4M7A F;  1T0J A;  2KT8 A;  3JRZ A;  3CC7 T;  2RMO A;  5GAO n;  2Y90 A;  2KT1 A;  2X4X A;  1M2V B;  2SEM A;  2X9H A;  3R6N A;  1YI2 T;  2JUF A;  4GY5 A;  5GAM g;  2CGH A;  4RTV A;  3EFO B;  4ELY C;  3CPW P;  1C6V X;  1K73 U;  1N5Z A;  4IIM A;  2R58 A;  4PJO A;  2V1Q A;  2DIL A;  1JQQ A;  3CXC S;  2L3P A;  4FL6 A;  2E6Z A;  2YHT A;  4DBR A;  1SG5 A;  2XHC A;  1NPP A;  1N27 A;  4MZP A;  1SRL A;  1SHG A;  3JV3 A;  3M55 A;  3QYG B;  5CKD A;  2ABL A;  4M75 A;  4NOY A;  1W1F A;  2DRK A;  4PK4 A;  2CT3 A;  2CKK A;  3AHU A;  1VQM Q;  4M7A B;  1OPL A;  4OMO A;  3UAT A;  2C06 A;  2ZCF B;  2LNH B;  4PJO F;  3CEY A;  2DBK A;  3L2Z A;  2RHY A;  5FU7 C;  2WSC E;  5DLQ E;  1I1J A;  3SDZ A;  1QP3 A;  3X26 B;  1KD1 R;  3DKM A;  1M3C A;  1PM3 A;  2O88 A;  3GNF B;  4M75 F;  2FZK B;  1I81 A;  3LX7 A;  3MPU B;  3NGP A;  4FIB A;  4JJN K;  1ZQ1 A;  1SF9 A;  1KD1 C;  1KHI A;  2DRM A;  2LRQ A;  4BB7 A;  2I0N A;  3OYL A;  2GGR A;  2JJ9 A;  2F1L A;  3X28 B;  3BY7 A;  3JCM Q;  5KYX A;  5LJ3 f;  1UTI A;  2KNB B;  2O2O A;  5A2Q E; 
#chains in the Genus database with same CATH homology
 1KSW A;  1VYU A;  1KJW A;  2J6O A;  3H0H A;  3EG2 A;  1CKB A;  2DNU A;  2KRO A;  3EG0 A;  5HCK A;  2KXC A;  1E6G A;  1OEB A;  2PZ1 A;  1KFZ A;  1B3Q A;  3M0T A;  2FEI A;  1G2B A;  1GRI A;  1U3O A;  2JM9 A;  1UG1 A;  2KR3 A;  2HCK A;  1NLO C;  3VS7 A;  2VKN A;  3PVL A;  2KRS A;  4HXJ A;  3TVT A;  2RQR A;  1UEC A;  1SSH A;  1K1Z A;  2GBQ A;  1IO6 A;  2D0N A;  2MIO A;  2F2W A;  1Z9Q A;  2FO0 A;  2EW3 A;  4GLM A;  4J9E A;  2L3Q A;  2J7I A;  2JM8 A;  2ECZ A;  4J9C A;  1G83 A;  2W10 A;  1VYV A;  2FPE A;  4CC2 A;  2LJ3 A;  4JJB A;  4D8D A;  4LUE A;  1YP5 A;  2FRW A;  2LQW A;  4AFS C;  2DL5 A;  1YNZ A;  5EC7 A;  1ZSG A;  2XMF A;  1WX6 A;  2QDL A;  5IH2 A;  2RQW A;  2OI3 A;  2M0Y A;  1WI7 A;  4HVV A;  2EBP A;  4RTZ A;  4OMQ A;  2K79 A;  1MV0 B;  4F14 A;  4J9G A;  1CSK A;  2D1X A;  1E7O A;  2LQN A;  3QWX X;  3A98 A;  1Z9Z A;  2DLP A;  1M30 A;  2RQU A;  2RNA A;  4JPB W;  4Z88 A;  1PHT A;  2EKH A;  3TSW A;  1AOJ A;  4AFU C;  2HSP A;  2YDL A;  2EGC A;  5FWC A;  1B07 A;  2CDT A;  2EYW A;  2DX1 A;  2NWM A;  1ZUY A;  1UDL A;  1ZUU A;  2J6K A;  1JU5 C;  2C0T A;  1OV3 A;  5GJV B;  2KGT A;  1SPK A;  2ESW A;  4IIO A;  2EQI A;  2NUZ A;  4FSS A;  2KYM A;  3EHQ A;  2RN8 A;  2DA9 A;  4ZNX A;  1WFW A;  1EFN A;  1GCQ A;  1X2K A;  4LUD A;  1CKA A;  1JEG A;  4AG2 C;  1QWE A;  2EYY A;  1HJD A;  4WCI A;  1TG0 A;  2AZS A;  4HVW A;  1GBQ A;  1A0N B;  2FRY A;  2DL3 A;  2ED1 A;  2HBW A;  2PTK A;  4DEX A;  2JXB A;  3REA B;  3GBQ A;  2L2P A;  5I22 A;  1U06 A;  2EGA A;  2DM1 A;  2K7A A;  2DBM A;  2CUD A;  4E6R A;  2A36 A;  2C0O A;  3NMZ C;  3THK A;  3I35 A;  3VS3 A;  2BZY A;  3VS5 A;  1FYN A;  1M8M A;  2LX7 A;  2CT4 A;  1YWO A;  3PE0 A;  1RLP C;  1YN8 A;  5ECA A;  1NEG A;  2CSI A;  2YUP A;  1MV3 A;  1BK2 A;  3REB B;  1UJ0 A;  3NHN A;  1UHC A;  2AK5 A;  4D8K A;  4X1V A;  4M4Z A;  2VWF A;  1AEY A;  1PWT A;  1WYX A;  5IHI A;  4J9I A;  2X3W D;  3M0U A;  1SHF A;  2HEQ A;  2J06 A;  2RQV A;  5IXB A;  1AVZ C;  2A37 A;  4J9D A;  1ABO A;  1X6G A;  4AG1 C;  1QKW A;  2IIM A;  3EGU A;  1E6H A;  3RNJ A;  1RLQ C;  2V1R A;  1OPK A;  1RI9 A;  2JMC A;  3C0C A;  4RTT A;  3SEM A;  2BTT A;  1GFD A;  1WXT A;  2EYX A;  4RTW A;  1QCF A;  1W6X A;  5GJW B;  1NLP C;  2GNC A;  1QKX A;  3UA6 A;  1NYG A;  4Z8A A;  1MUZ A;  1QLY A;  3I9Q A;  2AKK A;  1X69 A;  4JJD A;  2BZX A;  1SEM A;  3M0S A;  1YWP A;  1K4U S;  2LZ6 B;  3I5R A;  1ZBJ A;  2A08 A;  3H0I A;  3VS6 A;  4KRT A;  4RTY A;  2ENM A;  2J05 A;  4R0K A;  2LCS A;  1WA7 A;  1GBR A;  1I0C A;  2F2X A;  2JMA A;  3SHW A;  1AWW A;  1HSQ A;  1BBZ A;  1UUE A;  2LJ0 A;  1ARK A;  1VYT A;  1YCS B;  1QWF A;  2K3B A;  1U5S A;  3VS1 A;  2EVR A;  4ORZ A;  2O31 A;  2KEA A;  1V1C A;  1Y57 A;  1GL5 A;  1HD3 A;  1NG2 A;  3EG1 A;  2F2V A;  4JZ4 A;  2CH4 W;  2EYZ A;  1K76 A;  2PNI A;  4EIK A;  1NYF A;  1UE9 A;  3IQL A;  1M27 C;  3LH5 A;  4J9H A;  4QT7 A;  2K9G A;  3QWY A;  2MOX A;  1AZG B;  2CH4 A;  2DL7 A;  4GBQ A;  2DL8 A;  2CSQ A;  3I5S A;  1GFC A;  1JO8 A;  1JXO A;  2HDA A;  4LNP A;  4CC4 B;  1XOV A;  1BB9 A;  2JT4 A;  3VS4 A;  2X3X D;  2L0A A;  1ABQ A;  5FW9 A;  1WDX A;  4OMP A;  2JS2 A;  1NM7 A;  2J6F A;  4A63 B;  4F16 A;  1RUW A;  2DVJ A;  1BU1 A;  3U23 A;  5FWB A;  3EHR A;  2ED0 A;  2L3S A;  4LE9 A;  2A28 A;  2AKL A;  1UHF A;  2P4R A;  5IXF A;  1WXU A;  1X43 A;  2G6F X;  4J9B A;  2KBT A;  4AFQ C;  1PRM C;  3UA7 A;  1K0S A;  1X6B A;  4AFZ C;  1VA7 A;  1JXM A;  1S1N A;  4JJC A;  4Z89 A;  3ZL7 C;  4RTU A;  1J3T A;  1T0H A;  4RUG A;  4HCK A;  1I07 A;  1LCK A;  2FG0 A;  3PVQ A;  1TUC A;  2D8H A;  1M3A A;  2VVK A;  4F17 A;  2D8J A;  2YUQ A;  1X2Q A;  3M0Q A;  2DF6 A;  2LMJ A;  1T3S A;  1WLP B;  3VRZ A;  1H3H A;  1ZUK A;  2CUB A;  1X27 A;  2DE0 X;  3RBB B;  1SRM A;  1AWX A;  2RF0 A;  1OOT A;  2YSQ A;  2DJQ A;  1W70 A;  2M51 A;  2YUN A;  3FJ5 A;  4LN2 A;  4DEY A;  3M0P A;  3M0R A;  3VS0 A;  2W0Z A;  1K9A A;  3VS2 A;  3KFV A;  2BZ8 A;  2DYB A;  2KRN A;  2H8H A;  1AWJ A;  1UFF A;  2B86 A;  2KXD A;  1T0J A;  2KT8 A;  2K2M A;  3H41 A;  2RMO A;  1UJY A;  2KT1 A;  2KYB A;  2SEM A;  3CQT A;  5IHK A;  4HVU A;  1WXB A;  2DL4 A;  4OMN A;  1KIK A;  2C0I A;  2JS0 A;  3R6N A;  2GTJ A;  1T3L A;  2E5K A;  4Y92 A;  1GCQ C;  2CRE A;  1M3B A;  2EGE A;  2LP5 A;  3H0F A;  4RTV A;  5L23 A;  2JW4 A;  2OAW A;  2KRM A;  1N5Z A;  4IIM A;  4OML A;  5I11 A;  2V1Q A;  2O9V A;  2DIL A;  1JQQ A;  2AZV A;  3EG3 A;  2L3P A;  2JTE A;  3TSZ A;  1SRL A;  2EPD A;  2RPN A;  1SHG A;  2RQT A;  3JV3 A;  2ROL A;  4JZ3 A;  1H92 A;  2ABL A;  1W1F A;  2DRK A;  2CT3 A;  2O9S A;  1NEB A;  1H8K A;  4RTX A;  2MCN A;  3VRY A;  2LJ1 A;  1Y0M A;  1AD5 A;  1UGV A;  2OJ2 A;  1OPL A;  1PNJ A;  4OMO A;  3UAT A;  2YT6 A;  2LNH B;  1TUD A;  2DBK A;  4K11 A;  2DMO A;  1I1J A;  1PRL C;  2KE9 A;  1PKS A;  3UF4 A;  1AZE A;  1M3C A;  1K0X A;  1GCP A;  2FPF A;  4CC3 A;  2O88 A;  2GTO A;  1WIE A;  4ESR A;  3NGP A;  3ULR B;  2K6D A;  2SRC A;  1ZX6 A;  4OMM A;  1ZLM A;  2ROT A;  1FMK A;  2DRM A;  4J9F A;  3O5Z A;  2I0N A;  1PKT A;  2GGR A;  3NPF A;  2FPD A;  2YUO A;  5IHN A;  1AWO A;  2GQI A;  4CC7 A;  1UTI A;  2KNB B;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...