1VQOQ

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqoQ00
1YHQQ 1Q7YR 1YI2Q 1YIJQ 1Q82R 3CCEQ 1YJ9Q 1VQOQ 3G4SQ 1N8RR 1NJIR 1K9MR 1M1KR 1YITQ 1VQ8Q 1KQSP 1S72Q 2OTJQ 1QVGP 3CPWP 1VQ9Q 2QEXQ 1M90R 3CMEQ 1JJ2P 1VQ5Q 3CCSQ 1VQMQ 1K73R 1W2BP 3CC2Q 1VQ7Q 3CCJQ 3CCUQ 3CCQQ 1Q81R 1QVFP 1YJWQ 1VQ6Q 1KD1R 1KC8R 2OTLQ 1VQNQ 3I56Q 3OW2P 3I55Q 3CXCP 3CC4Q 3CCMQ 1Q86R 3CD6Q 3CCLQ 1VQ4Q 1VQLQ 1VQKQ 3CC7Q 1VQPQ 3G71Q 1K8AR 2QA4Q 3CCVQ 3CMAQ 3G6EQ 3CCRQ 1YJNQ
chains in the Genus database with same CATH superfamily
3HFOA 2YUQA 3META 1JEGA 3HTRA 4RTZA 1QVFA 2COZA 4XK8E 1ZLMA 4DBFA 3MP1A 2NUPA 5LJ5d 3WVEB 5HK0A 3CCMA 1Q86R 5GAMd 3CMAT 1Y96A 1VQNA 4PJOC 4B9WA 4IURA 1M2VA 2QA4Q 1WXUA 4PLIA 1MMDA 2E10A 3OS2A 3RNJA 5ECAA 2K3YA 1KQSP 2K2VA 1KD1C 4OMQA 3LH5A 1PC0A 2FVUA 2AHJB 2LCCA 2BTTA 1VQ6A 3CC4Q 3CPWA 1E6HA 1KK7A 2FO0A 2CT4A 4DEXA 2MPXC 3CC7Q 3BY7A 3NHNA 4Y28E 2KNBB 2SRCA 3ZEHA 4II1A 2LQWA 2P0QA 5GANj 3PNWC 1JB0E 3JCMJ 1YITQ 2J6OA 1NM7A 5KYUB 1KD1U 2QDLA 2WSEE 2DRKA 5IAYA 3CCMT 1VQNT 1FMWA 1B3QA 1MNDA 1YP5A 2R57A 5EG2A 4FYXB 1B34A 2HBWA 2M0YA 1NLPC 4R55A 1UHCA 3X24B 2JTFA 1M1GA 2DL3A 1W4SA 4X1VA 5KE2A 1YBYA 4R56A 2RF0A 1VQ8Q 2LCSA 2OAWA 3QKJA 3RESA 1X01A 3MHXA 5LJ3h 1VQ6T 2CH4W 3UA6A 3VS5A 1P92A 1PG5B 1RLPC 3M59A 3V7CA 3JCMX 5CKBA 4C0DC 3CEYA 3H9NA 3L1AA 1AD5A 2XMFA 3A8MB 3VS0A 4RTTA 3SWNA 4M78E 3MJXA 3EG0A 3REBB 1S72A 3OYDA 1XTDA 4BD3A 1LOJA 2AZVA 2K3BA 4KH1B 3CCQQ 1KQ2A 4DQ2A 4MDXA 1QKXA 2PUOB 3GP8A 1SRLA 2EJGA 3G6EQ 4JRPA 4LE9A 1MHNA 2EKHA 3A98A 3I35A 1CKAA 4M75B 1ZBJA 3OQ5A 5IHIA 4LDWA 1NEGA 4A63B 8AT1B 3C4SA 2ZCFB 2K3XA 2OTLQ 2DIGA 4HT8A 3C0CA 4FU6A 3HFNA 1X2KA 2M0OA 3MO8A 4QKUA 2QQAA 4HCBA 1BK2A 2EBPA 4KT0E 1BB9A 2LJ3A 2DJQA 1S72T 1W2BS 3ME9A 4RCCA 3G4SQ 2MCNA 2YUNA 4HA8A 1WJRA 2PVDB 3QJYA 3E1SA 3CC2Q 3A5ZB 2YWWA 3CXCA 2GQVA 1UFFA 2EFIA 1RACB 2HKNA 1M8MA 1OU9A 3L2RA 4RG2A 2R5MA 3CPFA 4M75F 3QG1A 3QPHA 1G3WA 5LJ5h 4Z88A 2MK5A 3JB9J 2MI6A 3HKSA 4CRIA 2LJ1A 3EGXA 1FX7A 3UA7A 4R0KA 2QDYB 1EFNA 2EYWA 1I0CA 1VQPQ 2CH4A 1VIFA 3SWNC 1KG1A 1QVPA 2RQWA 1HD3A 2FEIA 4AFSC 2EYXA 3PVQA 2A7YA 3V8LA 9ATCB 2F5TX 3MEWA 4PKCC 2IG0A 2VGMA 2CDTA 4EDUA 4LDYA 1VQLA 1PHTA 1SF9A 2YT6A 2M1HA 4HCCA 1UJYA 4L5GA 2ABLA 4JS4A 1SRMA 3TVTA 1QCNA 4C92A 4EMKB 2E1HA 1D1BA 2CZ0B 1R0CB 3RMQA 1Q86C 4C92D 3M4GA 4FW1A 3G7ZA 2E6ZA 5GAOn 3JB9D 2HL5C 5LJ3j 1G3YA 1UHFA 2M9UA 2QGFB 2FRYA 3A8GB 2QQBA 2DE0X 1I8FA 3CCRQ 4E2FB 1Q7YR 1K0XA 2QEXT 3T9NA 1BIBA 2YXYA 2VXEA 3OY9A 4JLIA 3SDZA 1ZSZB 1HXDA 2DL7A 1Q86U 5CKFA 3RBBB 4FCYA 2RI5A 2HSEB 1VQLT 2CREA 2DPPB 4NOYA 2Y90A 4KRTA 1BI1A 2YRCA 3G71A 2ZPGB 3CMAQ 2MYSA 4XTYA 3OMCA 2IPOB 2CYZB 3VYHB 1RADB 1YJ9A 1Z9ZA 2RQTA 4GBQA 2DRMA 4F7UB 4M75G 2G6FX 2YLCA 1OX8A 3L2UA 2RQUA 3S3OA 2V1QA 1TU0B 4C5IA 3BDLA 4HXJA 3UF4A 3OYMA 1ZQ1A 4J9GA 1YJNQ 2H8HA 1QVFS 5IN1A 4X9DA 4RMOA 3LGFA 4MZTA 1K0SA 2DXCA 3OW2A 4DBQA 1NPPA 3G71T 1VQNQ 4M75E 2DEQA 4RTWA 4PK4A 2Y4YA 1YJ9T 4E7KA 4IIOA 3RKYA 2JMCA 2GFAA 3J80E 1LNXA 2B8AA 4M77A 3A8LB 4F7UF 3DB4A 4BE1A 4M77D 4WCIA 4KGZB 1NLOC 1AVZC 1NPRA 1PRLC 2KE9A 5LJ5j 1VQ6Q 1KD1R 1UDLA 3ULRB 2K5FA 1PM3A 2HQEA 2F5KA 1VQKA 1T3SA 1K8AR 2DXUA 2I0NA 3QZ9B 4JJDA 3HHTB 2JS2A 1NJIR 4C8QA 1VYTA 5GAN6 3G1JA 1VQ9Q 3OYIA 2RHYA 1WQ7A 4FT2A 3M5AA 4C8QD 1H3ZA 2DILA 4M7DG 1PD1A 1TS9A 1OV3A 4M7DA 3DLMA 4JPBW 1WHGA 3LX7A 4M7AF 2JT4A 3VYGA 2E64A 2VWFA 3OYJA 3M0RA 1V1CA 4PJJA 2K6DA 2M51A 2LP5A 1VQKT 2CS7A 3RDVA 2RH2A 2RM4A 3KUFA 1I5OB 2GCXA 1FXXA 1S1NA 5FU7B 2NUPB 2E41A 1TG0A 1S72Q 3JCMQ 2FPFA 2VXFA 4VUBA 1VQ5A 3L42A 4ATOA 2FYKA 3M54A 1VYVA 2DJZA 1BI0A 2CZ6B 4BDZA 1PD0A 2F1LA 3JSCA 4PFPA 3INZA 2HQHA 2V8JA 2DD5A 2J6FA 1K1ZA 1K9MR 4E6RA 3OS5A 3UATA 1XNIA 5L23A 3OS1A 4JRQA 1M90R 3JCMb 1C0MA 1UGVA 2AKLA 5KYXB 3NTIA 1BCOA 1OPKA 2HMAA 1M5Q1 3P8HA 4NL2A 1Q82C 4A4EA 3JCMg 5GAN5 1G8XA 4N4GA 4PJOA 1KQSA 5FU6C 5A0GA 2I2LA 2W0ZA 3QZ5B 3OYEA 4JRIA 1VQ5T 1KQ1A 2V8KA 4PJOD 1B34B 3CXCS 2QI2A 5GAOq 1X6BA 4AFUC 1ABQA 3QUIA 4M7DC 4Z8AA 5HY6A 3FLGA 2PUKB 2CP3A 4F7UE 3EHRA 3CD6A 3JCMe 3M0UA 2L5QA 4M7AG 5GAN8 4PNOA 4KGXB 4NS5A 1U06A 5CAIA 4CC2A 4OB2B 1VQ7Q 2FZGB 1U5SA 4M78F 4ZGEB 3UDCA 3SFMA 4C5HA 4JLGA 2MMPA 4OB1B 1VQ4A 1H3HA 3H0FA 1U8RA 1M9SA 4IUVA 2OJ2A 4ZNXA 4DBHA 5LJ3g 3ASKA 3QWYA 5GMKi 2VKNA 2CZ7B 2RHXA 1V76A 2R5AA 2XI9A 1QP2A 5LL6S 2QEXQ 2O9SA 2EIFA 3FIFA 1W2BP 2YSQA 1ZSZC 3CD6T 2RO0A 3TU4K 2P4RA 1M27C 3WVDB 1VQLQ 4XAXB 1R77A 1R0BG 2O88A 4KULA 4BB7A 3QHSA 2RMOA 4RG8A 4X34A 5I21A 3FEOA 4J7IA 4IUUA 4JJCA 3RR6A 2LCLA 2O31A 4L6V5 4A4FA 3EG9B 1VQ4T 2C06A 4JJBA 2KSSA 2YUOA 1YCYA 3NMZC 1PRMC 3VV0A 4QQGA 4XQ3A 1VIEA 2DK3A 3MP6A 2WSCE 2GGRA 3VS6A 4BUGA 4JJNK 1X69A 5CVIA 3A8OB 2RJDA 4Q5WA 1K8AC 4DOWA 2SEMA 1Y7XA 2XK0A 4BY6B 2ROLA 4E7JA 1QMCA 1RAFB 1NJIC 1N9RA 3G71Q 3VKIA 3MEAA 2AT1B 4KGVB 1RAHB 1ACMB 2DYIA 4M7AC 3GOXA 2L89A 3HP9A 1EIFA 2FG0A 1X6OA 3GNFB 1UGSB 1AT1B 1WHJA 1OYXA 2K57A 4AMCA 1O75A 2KQWA 2BIVA 2COYA 2PZ1A 1K8AU 2ZAEA 4AG2C 5CQXA 2LTOA 2ZPHB 2HAXA 3QJ6A 3MEUA 1NJIU 5GJWB 4XTUA 2CSQA 4HCZA 4M78G 4PFZA 5LJ5g 4TVRA 5CQYA 2L0AA 4ZGDB 1QLYA 5GAMg 1LCKA 1OZ3A 3OSVA 1K73C 4HKEA 1H641 1IHVA 4BI3A 3VS4A 3LLRA 5CIUA 3M56A 2JM9A 3OW2S 5I2MA 2DAQA 3C95A 1MMNA 1QW1A 4FW2A 1AWJA 4D8DA 2LZ6B 2X51A 3ZFJA 3HSBA 1OX9A 2OAUA 2EPDA 4C92B 3JB9I 5CK9A 5LJ5e 1N27A 1GFCA 5FRNA 1WI7A 5GAMe 4B9XA 2LT1A 2E6NA 3KXTA 3FJPA 2RA2A 4JDSA 1U3OA 2F2XA 2VASA 1NBEB 1RABB 2HEQA 5IXFA 3GF5A 5KYYA 3PE0A 4GY5A 2QTVA 2C0IA 1T0HA 1VQKQ 1K9MC 2KBTA 2RHIA 1M90C 1G83A 3QBYA 1WHLA 2WSFE 2LRQA 3R6OA 1JJ2P 2GQIA 2RQVA 2MOXA 2WACA 3EFOB 2KXDA 3CCJA 3M9QA 2YLBA 1QVFP 2HL3A 1IGUA 3OBWA 4MDWA 1K9MU 2QYZA 2RI2A 2E3IA 3ZBDA 2VV5A 4J83A 1M90U 1WDXA 3BE3A 4FL6A 4NL3A 2BZ8A 2JW4A 4J9CA 2OTJQ 3J7AF 5CKHA 3H0HA 3CCSQ 2RB6A 3OYLA 4ZGJB 4PJLA 5D7UA 3CBOA 4M78C 5A2QE 3RKWA 3L2VA 1IZ6A 3CCJT 1VQ5Q 5GAOl 1EZZB 1G3SA 1ZHIA 2JUFA 4N4HA 2J7IA 3S3MA 1UECA 4M77B 4MMKA 3O5ZA 3OYBA 2CP2A 4LD9K 1GFDA 4J7FA 1XOVA 4L59A 3QYHB 1OPLA 5KE3A 2DF6A 1M1FA 2DFUA 1YI2A 2KRSA 1VQOA 1W6XA 5AT1B 3HPWA 3EAEA 4JRKA 4J6XA 2K2MA 2JNGA 3DB3A 1M4ZA 1NYGA 3I55A 1KQSS 2O01E 2DVEA 3CCLQ 2OI3A 2JN0A 1GBRA 5IHNA 4FSSA 3THKA 3CCVQ 2FZKB 1BBZA 2BZYA 1Q82R 3PMIA 3J81E 2EQJA 2Y4XA 3H8ZA 2RNAA 5KYWB 1TUGB 3QSUA 3JCMP 3I9QA 4PJMA 3CCUA 1TUCA 3KFVA 3S3NA 3CD6Q 4LN2A 2D1XA 4MZMA 1YI2T 3GPLA 1HJDA 1D09B 1VQOT 1D0YA 3JCMV 3C94A 2RQRA 4QQDA 1QWEA 4BI8B 4GLMA 4ZN3A 2G3RA 3SD4A 2O9VA 2V1RA 5GMKe 3CBPA 4LDUA 3I56A 3P8BB 1N9SA 3A8HB 1VQ4Q 1M1KC 3Q1JA 3VRYA 5KYNA 4RCBA 4WTOB 2LMJA 4J6WA 1XJWB 2ED0A 3JRZA 3O8VA 3OA6A 3CCUT 1RAGB 4Z02A 2EGCA 4C92E 2D6FA 1Y71A 3UT1A 2BE7D 2QXFA 4M75A 3X28B 2JOYA 4LNPA 1KC8R 2X4YA 3CC4A 2CUBA 2RN8A 1M1KU 2DMOA 1MV3A 3OYKA 3CC7A 1D3BA 4MZPA 1UB4A 3NPFA 1IREB 3H41A 1YIJA 1KJWA 2V8IA 1QQJA 5A0LA 3JCMf 2EWNA 2NUTB 4BACA 2EW3A 1NZ9A 1AEYA 5J26A 5GANg 3I56T 4PJOB 4KH0B 3ZL7C 2GTJA 3EGDA 4QT7A 1V29B 1JRIA 3CCMQ 2OX7A 1RAAB 4E7IA 3PFSA 3TSZA 2MAMA 2RPNA 1GL5A 3EG3A 2EYQA 1Q95G 1AHJB 2D8JA 1VQ8A 2JXBA 2DTOA 2E65A 3FRNA 2CGHA 4AG1C 1H8KA 5GANe 2IIMA 3CC7T 3CPWS 1PNJA 2L3SA 4F04B 3VU3C 4BE2A 1JXOA 1WQWA 1TH7A 5IHKA 4PJNA 2ZPFB 1N8RC 3SEMA 4DEYA 1YIJT 3OS0A 2DIQA 1SHFA 4JUVA 1UGPB 4QVDA 2DX1A 3L2WA 2K5LA 3FDRA 3JV3A 3JCMc 1UJ0A 2K5IA 5IH2A 1TXQA 2AK5A 3OB9A 4OMMA 1Y57A 4LUDA 3OYHA 1N8RU 1QCOA 2ENMA 2DNUA 5CKDA 2EJ9A 1OQKA 1VQ8T 4M7DD 2FRWA 1MUZA 5FRMA 1QVGA 5GMKl 2A08A 3GNGA 4M77E 4K11A 4F17A 1Q81C 4OGCA 3V7RA 4M4ZA 5IXBA 4QQ6A 2XDDA 2DYBA 1K73R 1G5VA 4M75C 4J8OA 4C0DB 2YRDA 2DETA 2L3PA 3RIRA 2EKOA 2OTLA 4EMKA 1QP3A 1M30A 4J9BA 4OP0A 1E7OA 3EFRA 4DBRA 1M8VA 2FL7A 1WFWA 1Q81U 2L3QA 2X9HA 1HSQA 3M53A 2RK2A 1VUBA 3SB2A 1R8OB 5GAN7 3JAME 1Y96B 1UGQB 3JCMd 2B86A 5FWCA 2DXBA 1M2VB 3EG2A 1SG5A 1ZSZA 1TTHB 2W10A 1X27A 2VB6A 1A0NB 3PIOA 2XD0A 3MPUB 1IB8A 1X75C 1SKUB 2EQKA 1BI3A 3OYNA 4FM4B 4JZ3A 2LX7A 2ROTA 1AZEA 3UWNA 1M2OA 1RI9A 1D0ZA 2H3JA 2DVJA 2OTLT 1PSFA 4RTYA 3CCJQ 4F7UG 4OMLA 2EAYA 1FMKA 4F7UA 3KBGA 4WF2A 3VS7A 2AIRB 3OW2P 1CKBA 2CP6A 2EYYA 2IVWA 4DA4A 2M16A 2JJ9A 2DL8A 3OMGA 3QO3A 1CSKA 4E47A 3LWHA 1SEMA 1KHIA 2CSIA 2FPDA 1W70A 4CI0C 5CCAA 1WZOA 4O6JA 1UUEA 5J39A 2KR3A 4B6MA 3EHQA 1Q82U 3TREA 5AYFA 1AZGB 1X2QA 3LH0A 4OVAA 3L2ZA 4RTXA 4RTUA 2CKKA 2HDAA 3RUXA 4XU2A 3FC3A 2DTHA 1WA7A 4IUQA 1M3AA 1LVKA 4V2SA 1MNEA 2P4TA 4M7AA 4IIMA 3VRZA 5DLOA 3M0QA 4N0AC 4JZ4A 2DL4A 2DBKA 2Z0WA 2KDSA 4M7AD 2X4JA 1JXMA 4EMKC 5GAOm 4J6YA 4EPCA 5IT9E 1WIEA 3SWNB 1O9SA 4J5YA 2VVKA 1WHKA 5CKEA 4PJOE 2LQKA 1BU1A 3V8KA 1YI2Q 2E4HA 4OB3B 2LDMA 1VQOQ 2K79A 2QQ9A 3EG1A 4ANJA 5KYYB 3TEEA 2PNIA 2XKOC 4CC3A 3H0IA 3GLXA 1KC8C 2LQNA 4XTVA 1ZA2B 1IXDA 4QW2A 1WLPB 2MWOA 1AWXA 2KYBA 2F69A 2QGGA 3MEVA 2VYTA 2AZSA 1C1AA 2VUBA 2XU8A 2V26A 3URGA 3CCEA 5LJ3e 1MMGA 2CP7A 2QTXA 2NYSA 1KC8U 4LDXA 1NEBA 3M55A 3CCUQ 2KY9A 3R6NA 4A4GA 5DLQE 2O2OA 3VUBA 4D8KA 2RHZA 1BIAA 2K4YA 3H6ZA 4XU3A 3JCMW 2DERA 3C12A 3GBQA 3NTKA 4HVWA 2J05A 1YJNA 1JJ2A 2JS0A 3OYGA 4GLKA 4KBMB 2XG8D 3QXEB 3E9FA 4A53A 1LPLA 2LJ0A 1EX4A 2FPEA 2PQWA 3I56Q 1RUWA 2PTKA 4F14A 5GAN2 1ZUKA 3CCET 1M3CA 3F70A 1WX6A 3JCMh 1OEBA 2RI3A 5GAN3 4UC4A 2L3RA 3EGXB 1TSFA 1YJ9Q 1JQQA 1M1KR 1YNZA 2LT4A 4ORZA 1Y07A 3QWXX 3ER0A 2DEUA 1UG1A 3GIBA 2BE9B 3QYGB 1YJNT 2D0NA 2O4XA 5KYXA 1H92A 3PMTA 1I4K1 4M78A 1YIJQ 3OBYA 2MF2A 5FLXE 4PFOA 1VQ9A 4DOVA 2XHCA 1WYXA 4M78D 3M0PA 3LWIA 3RMSA 1RAIB 4E7ZA 1GXIE 2ZGWA 4ESRA 2KRNA 4BDYA 3IQLA 2CP5A 1FWZA 2RJEA 2KRMA 1K73U 2QG9B 2ZPIB 5FW9A 1ZUYA 4FSXA 2HZYA 1PCXA 2HQXA 2LC4A 1VYUA 2HNIA 2H3EB 1OULA 2KXCA 1MV0B 1YJWA 4HVUA 1KIKA 1N6AA 3TCJA 2JVVA 1J3TA 1VQ9T 3OYYA 2KROA 4HVVA 1N8RR 3PTAA 1X6GA 2KMTA 1UGRB 3EFSA 4OGEA 5FU7C 3HRUA 4ZTJA 4N4IA 2EGAA 1GRIA 2DKGA 1PWTA 2AKKA 1IRXA 3LW5E 3QDRB 2QQRA 3FB9A 4C92F 1QVGS 3D7SB 4E7LA 3JB9F 2ESWA 3OYAA 5D6WA 3N5BB 1BCMA 5GMKm 3CMEA 1T0JA 1I1JA 2KT1A 3EGUA 3V8JA 1YJWT 4OMOA 3OYFA 1D3BB 5DY9A 4IKFA 3VS2A 1Q81R 3U23A 3X26B 2C0OA 3EG9A 4C0GA 5GANf 4FYYB 4EMGA 2LX9A 3CPWP 2JMAA 1ZSGA 5I11A 1TWBA 4X9CA 1E6GA 3EGDB 3DLLA 2DZCA 4QVCA 3MKDA 2DA9A 2A36A 2GBQA 1X43A 2F2WA 1AWOA 1YWPA 1TUDA 4OF1A 5DM7R 1U1SA 1WJQA 2RJFA 1SPKA 1Z9QA 2HKQB 2X3WD 2QAZA 2GTOA 4LD6A 2GFUA 4OB0B 1YHQA 3CMET 3M4YA 2D8HA 3HL8A 1K9AA 4ELZC 5GAOp 2RHUA 5GAMh 1YWOA 2XICA 2ZPEB 3RKXA 1VQMA 1VQ7A 4FIBA 2C0TA 2DLPA 2J06A 2E3HA 2JZ2A 4C0FA 5KYUA 1LJOA 5GAOr 2F2VA 1I07A 2K7AA 2M02A 2JM8A 5FU6B 4C8QB 1RLQC 1UE9A 1GCPA 1HYOA 1TOVA 4A4KA 1WNLA 2XIDA 1B7TA 4ELYC 2QEXA 2KYMA 4M7DB 2JTEA 5FROA 2P84A 7AT1B 3L2QA 2DZ9A 2ZPBB 2QQSA 2KT8A 4FYWB 1YFNA 2LNHB 4FT4A 4M77F 4F16A 3PGGA 1HK9A 1QCFA 2GNCA 5KH6A 1YHQT 3CQTA 2MWPA 1WJSA 4C92G 1NE8A 1VQMT 1VQ7T 1M3BA 4LDVA 1VA7A 3BW1A 3JB9G 3VS3A 1D1AA 3I55T 5D6YA 2DO3A 5C6SA 6AT1B 1B07A 2VC8A 3DKMA 2NWMA 1UEBA 2A0FB 4C8QF 1BI2A 4QVZA 1ZA1B 2RD1A 2QA4A 5HKCA 5GANd 3X20B 2X4XA 1OI1A 4M7DF 1D0XA 1JU5C 3VUZA 5EC7A 1QWFA 2E70A 5D6XA 1RAEB 1AWWA 2D9TA 3CXCP 4HT9A 3EFOA 1PKSA 1SSFA 4M75D 1NG2A 2YDLA 4BY6C 2PVGB 2YRVA 8ATCB 3CCEQ 4FYVB 2QASA 2J6KA 2DXTA 4CC7A 1YITA 4E7SA 4Y91A 3TSWA 3LGLA 5GAN4 1BYMA 3A1PA 2ED1A 3AHUA 1KFZA 4HCKA 5HCKA 3OSSC 1ARKA 2PU9B 2QA4T 1K4US 4A54A 1PKTA 3NFCA 2RK1A 1JJ2S 3I5RA 1G3TA 3E2UA 3X25B 1UTIA 3MP8A 2PVOB 2R58A 1FYNA 4BI4A 2XDPA 2A28A 1IGQA 1GBQA 3QIIA 1WXTA 1GCQA 2LVMA 1U1TA 5HK3A 2HCKA 3CC4T 2RJCA 1N5ZA 1JO8A 4M7AB 4KUDK 4M77G 4A4HA 1YITT 1OU8A 4Z89A 4XTZA 4C92C 4IUPA 2HSPA 3BDUA 4C5EA 1WHMA 3S6WA 3M0TA 3EH1A 1NYFA 4RTVA 4PJOF 2EGEA 2QK0A 1IHWA 1IO6A 1WHHA 3CCQA 5LJ3f 1WXBA 2ATCB 5GAMj 2HD0A 3M58A 3QDFA 4J9IA 5GMKh 4J9FA 2EJFA 2YHTA 4C8QG 2EVRA 2DM1A 3G6EA 1F1BB 3PVLA 5L8RE 4ZN1A 2DTIA 3NGPA 2DBMA 2X3XD 3UPUA 3M57A 4XU1A 2ZZDA 4N0AA 5GJVB 2P0KA 1VOMA 4XTXA 1DJ7B 5C0MA 2X35A 5KYWA 4BE0A 3M0SA 5CR2A 5KCHA 4J9EA 1BKBA 3FJ5A 4XU0A 1C6VX 2GF7A 3OYCA 1T3LA 3G4SA 1ZX6A 1W2BA 2OTJA 4C8QE 2EQMA 1SHGA 5J3BA 3CCQT 4AFZC 1WPYA 3CCSA 3CC2A 4AT1B 4YTLA 2KI7A 4J9HA 1KSWA 1W1FA 1YJWQ 2DL5A 2P0PA 3G6ET 4M7DE 2LNVA 3VJPA 1Y0MA 5KCOA 2KEAA 2ECZA 2DD4A 5I2SA 2YUPA 1I81A 4LXCA 4RKUE 3HRTA 1GCQC 2E5KA 1QKWA 2E12A 3VS1A 2E5QA 4AFQC 3AT1B 2EQUA 1SSHA 5GANh 5M9OA 4RUGA 4ZTFA 1K76A 2BZXA 4IUTA 3BFMA 1VQPA 3G4ST 1YCSB 4M77C 2OTJT 2NUZA 2KAFA 3EH2A 3CCST 3CC2T 1D1CA 3WXMB 3CMEQ 2O4XB 3JB9H 3CBMA 5LJ5f 4ME7A 1ABOA 4OMPA 2HBPA 1RI0A 5GAMf 5CO7A 4M78B 2NUTA 2JTMA 4J9DA 4PJOG 3NTHA 1ZUUA 5LJ3d 1RL2A 3CCLA 2VGNA 3CCVA 4C8QC 2CZ1B 1MGQA 2NLUA 2EYZA 3V7SA 4E7HA 4EMHA 5I22A 4C0ZA 4P5NA 2KK4A 1XQHA 4OMFB 2FB7A 2LQ8A 4MMLA 3SHWA 1VQPT 3LYIA 1Q7YC 3HRSA 3MCAB 3P8DA 4EIKA 1WGSA 1FMVA 3CCRA 1YHQQ 2A3LA 4D6WA 2D0QB 1YN8A 3E19A 5FWBA 4CC4B 1QVGP 3PT9A 3RERA 1OZ2A 2CUDA 2KVQG 4XTWA 1VQMQ 2K9GA 2L8DA 2XDBA 2FHDA 3E9GA 4O5VA 4C5GA 3CCLT 2CP0A 1Q7YU 3CCVT 1AOJA 4JS5A 3I55Q 3I5SA 2EQIA 1JBMA 1MMAA 4OMNA 3CMAA 4LUEA 4Y92A 2MIOA 4PLLA 4PL6A 2A37A 3TQ7P 1I5LA 4KUIA 1G2BA 2KGTA 5GMKj 4M7AE 1OOTA 2BKDN 2COWA 2CT3A 2FZCB 1ZBXA 2L2PA 3CCRT 3REAB 1PSEA 3PIPA 5A0DA 2X4WA 2BUDA 1KHCA
chains in the Genus database with same CATH topology
1YHQQ 1Q7YR 1YI2Q 1YIJQ 1Q82R 3CCEQ 1YJ9Q 1VQOQ 3G4SQ 1N8RR 1NJIR 1K9MR 1M1KR 1YITQ 1VQ8Q 1KQSP 1S72Q 2OTJQ 1QVGP 3CPWP 1VQ9Q 2QEXQ 1M90R 3CMEQ 1JJ2P 1VQ5Q 3CCSQ 1VQMQ 1K73R 1W2BP 3CC2Q 1VQ7Q 3CCJQ 3CCUQ 3CCQQ 1Q81R 1QVFP 1YJWQ 1VQ6Q 1KD1R 1KC8R 2OTLQ 1VQNQ 3I56Q 3OW2P 3I55Q 3CXCP 3CC4Q 3CCMQ 1Q86R 3CD6Q 3CCLQ 1VQ4Q 1VQLQ 1VQKQ 3CC7Q 1VQPQ 3G71Q 1K8AR 2QA4Q 3CCVQ 3CMAQ 3G6EQ 3CCRQ 1YJNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Q;  1Q7Y R;  1YI2 Q;  1YIJ Q;  1Q82 R;  3CCE Q;  1YJ9 Q;  1VQO Q;  3G4S Q;  1N8R R;  1NJI R;  1K9M R;  1M1K R;  1YIT Q;  1VQ8 Q;  1KQS P;  1S72 Q;  2OTJ Q;  1QVG P;  3CPW P;  1VQ9 Q;  2QEX Q;  1M90 R;  3CME Q;  1JJ2 P;  1VQ5 Q;  3CCS Q;  1VQM Q;  1K73 R;  1W2B P;  3CC2 Q;  1VQ7 Q;  3CCJ Q;  3CCU Q;  3CCQ Q;  1Q81 R;  1QVF P;  1YJW Q;  1VQ6 Q;  1KD1 R;  1KC8 R;  2OTL Q;  1VQN Q;  3I56 Q;  3OW2 P;  3I55 Q;  3CXC P;  3CC4 Q;  3CCM Q;  1Q86 R;  3CD6 Q;  3CCL Q;  1VQ4 Q;  1VQL Q;  1VQK Q;  3CC7 Q;  1VQP Q;  3G71 Q;  1K8A R;  2QA4 Q;  3CCV Q;  3CMA Q;  3G6E Q;  3CCR Q;  1YJN Q; 
#chains in the Genus database with same CATH topology
 3HFO A;  2YUQ A;  3MET A;  1JEG A;  3HTR A;  4RTZ A;  1QVF A;  2COZ A;  4XK8 E;  1ZLM A;  4DBF A;  3MP1 A;  2NUP A;  5LJ5 d;  3WVE B;  5HK0 A;  3CCM A;  1Q86 R;  5GAM d;  3CMA T;  1Y96 A;  1VQN A;  4PJO C;  4B9W A;  4IUR A;  1M2V A;  2QA4 Q;  1WXU A;  4PLI A;  1MMD A;  2E10 A;  3OS2 A;  3RNJ A;  5ECA A;  2K3Y A;  1KQS P;  2K2V A;  1KD1 C;  4OMQ A;  3LH5 A;  1PC0 A;  2FVU A;  2AHJ B;  2LCC A;  2BTT A;  1VQ6 A;  3CC4 Q;  3CPW A;  1E6H A;  1KK7 A;  2FO0 A;  2CT4 A;  4DEX A;  2MPX C;  3CC7 Q;  3BY7 A;  3NHN A;  4Y28 E;  2KNB B;  2SRC A;  3ZEH A;  4II1 A;  2LQW A;  2P0Q A;  5GAN j;  3PNW C;  1JB0 E;  3JCM J;  1YIT Q;  2J6O A;  1NM7 A;  5KYU B;  1KD1 U;  2QDL A;  2WSE E;  2DRK A;  5IAY A;  3CCM T;  1VQN T;  1FMW A;  1B3Q A;  1MND A;  1YP5 A;  2R57 A;  5EG2 A;  4FYX B;  1B34 A;  2HBW A;  2M0Y A;  1NLP C;  4R55 A;  1UHC A;  3X24 B;  2JTF A;  1M1G A;  2DL3 A;  1W4S A;  4X1V A;  5KE2 A;  1YBY A;  4R56 A;  2RF0 A;  1VQ8 Q;  2LCS A;  2OAW A;  3QKJ A;  3RES A;  1X01 A;  3MHX A;  5LJ3 h;  1VQ6 T;  2CH4 W;  3UA6 A;  3VS5 A;  1P92 A;  1PG5 B;  1RLP C;  3M59 A;  3V7C A;  3JCM X;  5CKB A;  4C0D C;  3CEY A;  3H9N A;  3L1A A;  1AD5 A;  2XMF A;  3A8M B;  3VS0 A;  4RTT A;  3SWN A;  4M78 E;  3MJX A;  3EG0 A;  3REB B;  1S72 A;  3OYD A;  1XTD A;  4BD3 A;  1LOJ A;  2AZV A;  2K3B A;  4KH1 B;  3CCQ Q;  1KQ2 A;  4DQ2 A;  4MDX A;  1QKX A;  2PUO B;  3GP8 A;  1SRL A;  2EJG A;  3G6E Q;  4JRP A;  4LE9 A;  1MHN A;  2EKH A;  3A98 A;  3I35 A;  1CKA A;  4M75 B;  1ZBJ A;  3OQ5 A;  5IHI A;  4LDW A;  1NEG A;  4A63 B;  8AT1 B;  3C4S A;  2ZCF B;  2K3X A;  2OTL Q;  2DIG A;  4HT8 A;  3C0C A;  4FU6 A;  3HFN A;  1X2K A;  2M0O A;  3MO8 A;  4QKU A;  2QQA A;  4HCB A;  1BK2 A;  2EBP A;  4KT0 E;  1BB9 A;  2LJ3 A;  2DJQ A;  1S72 T;  1W2B S;  3ME9 A;  4RCC A;  3G4S Q;  2MCN A;  2YUN A;  4HA8 A;  1WJR A;  2PVD B;  3QJY A;  3E1S A;  3CC2 Q;  3A5Z B;  2YWW A;  3CXC A;  2GQV A;  1UFF A;  2EFI A;  1RAC B;  2HKN A;  1M8M A;  1OU9 A;  3L2R A;  4RG2 A;  2R5M A;  3CPF A;  4M75 F;  3QG1 A;  3QPH A;  1G3W A;  5LJ5 h;  4Z88 A;  2MK5 A;  3JB9 J;  2MI6 A;  3HKS A;  4CRI A;  2LJ1 A;  3EGX A;  1FX7 A;  3UA7 A;  4R0K A;  2QDY B;  1EFN A;  2EYW A;  1I0C A;  1VQP Q;  2CH4 A;  1VIF A;  3SWN C;  1KG1 A;  1QVP A;  2RQW A;  1HD3 A;  2FEI A;  4AFS C;  2EYX A;  3PVQ A;  2A7Y A;  3V8L A;  9ATC B;  2F5T X;  3MEW A;  4PKC C;  2IG0 A;  2VGM A;  2CDT A;  4EDU A;  4LDY A;  1VQL A;  1PHT A;  1SF9 A;  2YT6 A;  2M1H A;  4HCC A;  1UJY A;  4L5G A;  2ABL A;  4JS4 A;  1SRM A;  3TVT A;  1QCN A;  4C92 A;  4EMK B;  2E1H A;  1D1B A;  2CZ0 B;  1R0C B;  3RMQ A;  1Q86 C;  4C92 D;  3M4G A;  4FW1 A;  3G7Z A;  2E6Z A;  5GAO n;  3JB9 D;  2HL5 C;  5LJ3 j;  1G3Y A;  1UHF A;  2M9U A;  2QGF B;  2FRY A;  3A8G B;  2QQB A;  2DE0 X;  1I8F A;  3CCR Q;  4E2F B;  1Q7Y R;  1K0X A;  2QEX T;  3T9N A;  1BIB A;  2YXY A;  2VXE A;  3OY9 A;  4JLI A;  3SDZ A;  1ZSZ B;  1HXD A;  2DL7 A;  1Q86 U;  5CKF A;  3RBB B;  4FCY A;  2RI5 A;  2HSE B;  1VQL T;  2CRE A;  2DPP B;  4NOY A;  2Y90 A;  4KRT A;  1BI1 A;  2YRC A;  3G71 A;  2ZPG B;  3CMA Q;  2MYS A;  4XTY A;  3OMC A;  2IPO B;  2CYZ B;  3VYH B;  1RAD B;  1YJ9 A;  1Z9Z A;  2RQT A;  4GBQ A;  2DRM A;  4F7U B;  4M75 G;  2G6F X;  2YLC A;  1OX8 A;  3L2U A;  2RQU A;  3S3O A;  2V1Q A;  1TU0 B;  4C5I A;  3BDL A;  4HXJ A;  3UF4 A;  3OYM A;  1ZQ1 A;  4J9G A;  1YJN Q;  2H8H A;  1QVF S;  5IN1 A;  4X9D A;  4RMO A;  3LGF A;  4MZT A;  1K0S A;  2DXC A;  3OW2 A;  4DBQ A;  1NPP A;  3G71 T;  1VQN Q;  4M75 E;  2DEQ A;  4RTW A;  4PK4 A;  2Y4Y A;  1YJ9 T;  4E7K A;  4IIO A;  3RKY A;  2JMC A;  2GFA A;  3J80 E;  1LNX A;  2B8A A;  4M77 A;  3A8L B;  4F7U F;  3DB4 A;  4BE1 A;  4M77 D;  4WCI A;  4KGZ B;  1NLO C;  1AVZ C;  1NPR A;  1PRL C;  2KE9 A;  5LJ5 j;  1VQ6 Q;  1KD1 R;  1UDL A;  3ULR B;  2K5F A;  1PM3 A;  2HQE A;  2F5K A;  1VQK A;  1T3S A;  1K8A R;  2DXU A;  2I0N A;  3QZ9 B;  4JJD A;  3HHT B;  2JS2 A;  1NJI R;  4C8Q A;  1VYT A;  5GAN 6;  3G1J A;  1VQ9 Q;  3OYI A;  2RHY A;  1WQ7 A;  4FT2 A;  3M5A A;  4C8Q D;  1H3Z A;  2DIL A;  4M7D G;  1PD1 A;  1TS9 A;  1OV3 A;  4M7D A;  3DLM A;  4JPB W;  1WHG A;  3LX7 A;  4M7A F;  2JT4 A;  3VYG A;  2E64 A;  2VWF A;  3OYJ A;  3M0R A;  1V1C A;  4PJJ A;  2K6D A;  2M51 A;  2LP5 A;  1VQK T;  2CS7 A;  3RDV A;  2RH2 A;  2RM4 A;  3KUF A;  1I5O B;  2GCX A;  1FXX A;  1S1N A;  5FU7 B;  2NUP B;  2E41 A;  1TG0 A;  1S72 Q;  3JCM Q;  2FPF A;  2VXF A;  4VUB A;  1VQ5 A;  3L42 A;  4ATO A;  2FYK A;  3M54 A;  1VYV A;  2DJZ A;  1BI0 A;  2CZ6 B;  4BDZ A;  1PD0 A;  2F1L A;  3JSC A;  4PFP A;  3INZ A;  2HQH A;  2V8J A;  2DD5 A;  2J6F A;  1K1Z A;  1K9M R;  4E6R A;  3OS5 A;  3UAT A;  1XNI A;  5L23 A;  3OS1 A;  4JRQ A;  1M90 R;  3JCM b;  1C0M A;  1UGV A;  2AKL A;  5KYX B;  3NTI A;  1BCO A;  1OPK A;  2HMA A;  1M5Q 1;  3P8H A;  4NL2 A;  1Q82 C;  4A4E A;  3JCM g;  5GAN 5;  1G8X A;  4N4G A;  4PJO A;  1KQS A;  5FU6 C;  5A0G A;  2I2L A;  2W0Z A;  3QZ5 B;  3OYE A;  4JRI A;  1VQ5 T;  1KQ1 A;  2V8K A;  4PJO D;  1B34 B;  3CXC S;  2QI2 A;  5GAO q;  1X6B A;  4AFU C;  1ABQ A;  3QUI A;  4M7D C;  4Z8A A;  5HY6 A;  3FLG A;  2PUK B;  2CP3 A;  4F7U E;  3EHR A;  3CD6 A;  3JCM e;  3M0U A;  2L5Q A;  4M7A G;  5GAN 8;  4PNO A;  4KGX B;  4NS5 A;  1U06 A;  5CAI A;  4CC2 A;  4OB2 B;  1VQ7 Q;  2FZG B;  1U5S A;  4M78 F;  4ZGE B;  3UDC A;  3SFM A;  4C5H A;  4JLG A;  2MMP A;  4OB1 B;  1VQ4 A;  1H3H A;  3H0F A;  1U8R A;  1M9S A;  4IUV A;  2OJ2 A;  4ZNX A;  4DBH A;  5LJ3 g;  3ASK A;  3QWY A;  5GMK i;  2VKN A;  2CZ7 B;  2RHX A;  1V76 A;  2R5A A;  2XI9 A;  1QP2 A;  5LL6 S;  2QEX Q;  2O9S A;  2EIF A;  3FIF A;  1W2B P;  2YSQ A;  1ZSZ C;  3CD6 T;  2RO0 A;  3TU4 K;  2P4R A;  1M27 C;  3WVD B;  1VQL Q;  4XAX B;  1R77 A;  1R0B G;  2O88 A;  4KUL A;  4BB7 A;  3QHS A;  2RMO A;  4RG8 A;  4X34 A;  5I21 A;  3FEO A;  4J7I A;  4IUU A;  4JJC A;  3RR6 A;  2LCL A;  2O31 A;  4L6V 5;  4A4F A;  3EG9 B;  1VQ4 T;  2C06 A;  4JJB A;  2KSS A;  2YUO A;  1YCY A;  3NMZ C;  1PRM C;  3VV0 A;  4QQG A;  4XQ3 A;  1VIE A;  2DK3 A;  3MP6 A;  2WSC E;  2GGR A;  3VS6 A;  4BUG A;  4JJN K;  1X69 A;  5CVI A;  3A8O B;  2RJD A;  4Q5W A;  1K8A C;  4DOW A;  2SEM A;  1Y7X A;  2XK0 A;  4BY6 B;  2ROL A;  4E7J A;  1QMC A;  1RAF B;  1NJI C;  1N9R A;  3G71 Q;  3VKI A;  3MEA A;  2AT1 B;  4KGV B;  1RAH B;  1ACM B;  2DYI A;  4M7A C;  3GOX A;  2L89 A;  3HP9 A;  1EIF A;  2FG0 A;  1X6O A;  3GNF B;  1UGS B;  1AT1 B;  1WHJ A;  1OYX A;  2K57 A;  4AMC A;  1O75 A;  2KQW A;  2BIV A;  2COY A;  2PZ1 A;  1K8A U;  2ZAE A;  4AG2 C;  5CQX A;  2LTO A;  2ZPH B;  2HAX A;  3QJ6 A;  3MEU A;  1NJI U;  5GJW B;  4XTU A;  2CSQ A;  4HCZ A;  4M78 G;  4PFZ A;  5LJ5 g;  4TVR A;  5CQY A;  2L0A A;  4ZGD B;  1QLY A;  5GAM g;  1LCK A;  1OZ3 A;  3OSV A;  1K73 C;  4HKE A;  1H64 1;  1IHV A;  4BI3 A;  3VS4 A;  3LLR A;  5CIU A;  3M56 A;  2JM9 A;  3OW2 S;  5I2M A;  2DAQ A;  3C95 A;  1MMN A;  1QW1 A;  4FW2 A;  1AWJ A;  4D8D A;  2LZ6 B;  2X51 A;  3ZFJ A;  3HSB A;  1OX9 A;  2OAU A;  2EPD A;  4C92 B;  3JB9 I;  5CK9 A;  5LJ5 e;  1N27 A;  1GFC A;  5FRN A;  1WI7 A;  5GAM e;  4B9X A;  2LT1 A;  2E6N A;  3KXT A;  3FJP A;  2RA2 A;  4JDS A;  1U3O A;  2F2X A;  2VAS A;  1NBE B;  1RAB B;  2HEQ A;  5IXF A;  3GF5 A;  5KYY A;  3PE0 A;  4GY5 A;  2QTV A;  2C0I A;  1T0H A;  1VQK Q;  1K9M C;  2KBT A;  2RHI A;  1M90 C;  1G83 A;  3QBY A;  1WHL A;  2WSF E;  2LRQ A;  3R6O A;  1JJ2 P;  2GQI A;  2RQV A;  2MOX A;  2WAC A;  3EFO B;  2KXD A;  3CCJ A;  3M9Q A;  2YLB A;  1QVF P;  2HL3 A;  1IGU A;  3OBW A;  4MDW A;  1K9M U;  2QYZ A;  2RI2 A;  2E3I A;  3ZBD A;  2VV5 A;  4J83 A;  1M90 U;  1WDX A;  3BE3 A;  4FL6 A;  4NL3 A;  2BZ8 A;  2JW4 A;  4J9C A;  2OTJ Q;  3J7A F;  5CKH A;  3H0H A;  3CCS Q;  2RB6 A;  3OYL A;  4ZGJ B;  4PJL A;  5D7U A;  3CBO A;  4M78 C;  5A2Q E;  3RKW A;  3L2V A;  1IZ6 A;  3CCJ T;  1VQ5 Q;  5GAO l;  1EZZ B;  1G3S A;  1ZHI A;  2JUF A;  4N4H A;  2J7I A;  3S3M A;  1UEC A;  4M77 B;  4MMK A;  3O5Z A;  3OYB A;  2CP2 A;  4LD9 K;  1GFD A;  4J7F A;  1XOV A;  4L59 A;  3QYH B;  1OPL A;  5KE3 A;  2DF6 A;  1M1F A;  2DFU A;  1YI2 A;  2KRS A;  1VQO A;  1W6X A;  5AT1 B;  3HPW A;  3EAE A;  4JRK A;  4J6X A;  2K2M A;  2JNG A;  3DB3 A;  1M4Z A;  1NYG A;  3I55 A;  1KQS S;  2O01 E;  2DVE A;  3CCL Q;  2OI3 A;  2JN0 A;  1GBR A;  5IHN A;  4FSS A;  3THK A;  3CCV Q;  2FZK B;  1BBZ A;  2BZY A;  1Q82 R;  3PMI A;  3J81 E;  2EQJ A;  2Y4X A;  3H8Z A;  2RNA A;  5KYW B;  1TUG B;  3QSU A;  3JCM P;  3I9Q A;  4PJM A;  3CCU A;  1TUC A;  3KFV A;  3S3N A;  3CD6 Q;  4LN2 A;  2D1X A;  4MZM A;  1YI2 T;  3GPL A;  1HJD A;  1D09 B;  1VQO T;  1D0Y A;  3JCM V;  3C94 A;  2RQR A;  4QQD A;  1QWE A;  4BI8 B;  4GLM A;  4ZN3 A;  2G3R A;  3SD4 A;  2O9V A;  2V1R A;  5GMK e;  3CBP A;  4LDU A;  3I56 A;  3P8B B;  1N9S A;  3A8H B;  1VQ4 Q;  1M1K C;  3Q1J A;  3VRY A;  5KYN A;  4RCB A;  4WTO B;  2LMJ A;  4J6W A;  1XJW B;  2ED0 A;  3JRZ A;  3O8V A;  3OA6 A;  3CCU T;  1RAG B;  4Z02 A;  2EGC A;  4C92 E;  2D6F A;  1Y71 A;  3UT1 A;  2BE7 D;  2QXF A;  4M75 A;  3X28 B;  2JOY A;  4LNP A;  1KC8 R;  2X4Y A;  3CC4 A;  2CUB A;  2RN8 A;  1M1K U;  2DMO A;  1MV3 A;  3OYK A;  3CC7 A;  1D3B A;  4MZP A;  1UB4 A;  3NPF A;  1IRE B;  3H41 A;  1YIJ A;  1KJW A;  2V8I A;  1QQJ A;  5A0L A;  3JCM f;  2EWN A;  2NUT B;  4BAC A;  2EW3 A;  1NZ9 A;  1AEY A;  5J26 A;  5GAN g;  3I56 T;  4PJO B;  4KH0 B;  3ZL7 C;  2GTJ A;  3EGD A;  4QT7 A;  1V29 B;  1JRI A;  3CCM Q;  2OX7 A;  1RAA B;  4E7I A;  3PFS A;  3TSZ A;  2MAM A;  2RPN A;  1GL5 A;  3EG3 A;  2EYQ A;  1Q95 G;  1AHJ B;  2D8J A;  1VQ8 A;  2JXB A;  2DTO A;  2E65 A;  3FRN A;  2CGH A;  4AG1 C;  1H8K A;  5GAN e;  2IIM A;  3CC7 T;  3CPW S;  1PNJ A;  2L3S A;  4F04 B;  3VU3 C;  4BE2 A;  1JXO A;  1WQW A;  1TH7 A;  5IHK A;  4PJN A;  2ZPF B;  1N8R C;  3SEM A;  4DEY A;  1YIJ T;  3OS0 A;  2DIQ A;  1SHF A;  4JUV A;  1UGP B;  4QVD A;  2DX1 A;  3L2W A;  2K5L A;  3FDR A;  3JV3 A;  3JCM c;  1UJ0 A;  2K5I A;  5IH2 A;  1TXQ A;  2AK5 A;  3OB9 A;  4OMM A;  1Y57 A;  4LUD A;  3OYH A;  1N8R U;  1QCO A;  2ENM A;  2DNU A;  5CKD A;  2EJ9 A;  1OQK A;  1VQ8 T;  4M7D D;  2FRW A;  1MUZ A;  5FRM A;  1QVG A;  5GMK l;  2A08 A;  3GNG A;  4M77 E;  4K11 A;  4F17 A;  1Q81 C;  4OGC A;  3V7R A;  4M4Z A;  5IXB A;  4QQ6 A;  2XDD A;  2DYB A;  1K73 R;  1G5V A;  4M75 C;  4J8O A;  4C0D B;  2YRD A;  2DET A;  2L3P A;  3RIR A;  2EKO A;  2OTL A;  4EMK A;  1QP3 A;  1M30 A;  4J9B A;  4OP0 A;  1E7O A;  3EFR A;  4DBR A;  1M8V A;  2FL7 A;  1WFW A;  1Q81 U;  2L3Q A;  2X9H A;  1HSQ A;  3M53 A;  2RK2 A;  1VUB A;  3SB2 A;  1R8O B;  5GAN 7;  3JAM E;  1Y96 B;  1UGQ B;  3JCM d;  2B86 A;  5FWC A;  2DXB A;  1M2V B;  3EG2 A;  1SG5 A;  1ZSZ A;  1TTH B;  2W10 A;  1X27 A;  2VB6 A;  1A0N B;  3PIO A;  2XD0 A;  3MPU B;  1IB8 A;  1X75 C;  1SKU B;  2EQK A;  1BI3 A;  3OYN A;  4FM4 B;  4JZ3 A;  2LX7 A;  2ROT A;  1AZE A;  3UWN A;  1M2O A;  1RI9 A;  1D0Z A;  2H3J A;  2DVJ A;  2OTL T;  1PSF A;  4RTY A;  3CCJ Q;  4F7U G;  4OML A;  2EAY A;  1FMK A;  4F7U A;  3KBG A;  4WF2 A;  3VS7 A;  2AIR B;  3OW2 P;  1CKB A;  2CP6 A;  2EYY A;  2IVW A;  4DA4 A;  2M16 A;  2JJ9 A;  2DL8 A;  3OMG A;  3QO3 A;  1CSK A;  4E47 A;  3LWH A;  1SEM A;  1KHI A;  2CSI A;  2FPD A;  1W70 A;  4CI0 C;  5CCA A;  1WZO A;  4O6J A;  1UUE A;  5J39 A;  2KR3 A;  4B6M A;  3EHQ A;  1Q82 U;  3TRE A;  5AYF A;  1AZG B;  1X2Q A;  3LH0 A;  4OVA A;  3L2Z A;  4RTX A;  4RTU A;  2CKK A;  2HDA A;  3RUX A;  4XU2 A;  3FC3 A;  2DTH A;  1WA7 A;  4IUQ A;  1M3A A;  1LVK A;  4V2S A;  1MNE A;  2P4T A;  4M7A A;  4IIM A;  3VRZ A;  5DLO A;  3M0Q A;  4N0A C;  4JZ4 A;  2DL4 A;  2DBK A;  2Z0W A;  2KDS A;  4M7A D;  2X4J A;  1JXM A;  4EMK C;  5GAO m;  4J6Y A;  4EPC A;  5IT9 E;  1WIE A;  3SWN B;  1O9S A;  4J5Y A;  2VVK A;  1WHK A;  5CKE A;  4PJO E;  2LQK A;  1BU1 A;  3V8K A;  1YI2 Q;  2E4H A;  4OB3 B;  2LDM A;  1VQO Q;  2K79 A;  2QQ9 A;  3EG1 A;  4ANJ A;  5KYY B;  3TEE A;  2PNI A;  2XKO C;  4CC3 A;  3H0I A;  3GLX A;  1KC8 C;  2LQN A;  4XTV A;  1ZA2 B;  1IXD A;  4QW2 A;  1WLP B;  2MWO A;  1AWX A;  2KYB A;  2F69 A;  2QGG A;  3MEV A;  2VYT A;  2AZS A;  1C1A A;  2VUB A;  2XU8 A;  2V26 A;  3URG A;  3CCE A;  5LJ3 e;  1MMG A;  2CP7 A;  2QTX A;  2NYS A;  1KC8 U;  4LDX A;  1NEB A;  3M55 A;  3CCU Q;  2KY9 A;  3R6N A;  4A4G A;  5DLQ E;  2O2O A;  3VUB A;  4D8K A;  2RHZ A;  1BIA A;  2K4Y A;  3H6Z A;  4XU3 A;  3JCM W;  2DER A;  3C12 A;  3GBQ A;  3NTK A;  4HVW A;  2J05 A;  1YJN A;  1JJ2 A;  2JS0 A;  3OYG A;  4GLK A;  4KBM B;  2XG8 D;  3QXE B;  3E9F A;  4A53 A;  1LPL A;  2LJ0 A;  1EX4 A;  2FPE A;  2PQW A;  3I56 Q;  1RUW A;  2PTK A;  4F14 A;  5GAN 2;  1ZUK A;  3CCE T;  1M3C A;  3F70 A;  1WX6 A;  3JCM h;  1OEB A;  2RI3 A;  5GAN 3;  4UC4 A;  2L3R A;  3EGX B;  1TSF A;  1YJ9 Q;  1JQQ A;  1M1K R;  1YNZ A;  2LT4 A;  4ORZ A;  1Y07 A;  3QWX X;  3ER0 A;  2DEU A;  1UG1 A;  3GIB A;  2BE9 B;  3QYG B;  1YJN T;  2D0N A;  2O4X A;  5KYX A;  1H92 A;  3PMT A;  1I4K 1;  4M78 A;  1YIJ Q;  3OBY A;  2MF2 A;  5FLX E;  4PFO A;  1VQ9 A;  4DOV A;  2XHC A;  1WYX A;  4M78 D;  3M0P A;  3LWI A;  3RMS A;  1RAI B;  4E7Z A;  1GXI E;  2ZGW A;  4ESR A;  2KRN A;  4BDY A;  3IQL A;  2CP5 A;  1FWZ A;  2RJE A;  2KRM A;  1K73 U;  2QG9 B;  2ZPI B;  5FW9 A;  1ZUY A;  4FSX A;  2HZY A;  1PCX A;  2HQX A;  2LC4 A;  1VYU A;  2HNI A;  2H3E B;  1OUL A;  2KXC A;  1MV0 B;  1YJW A;  4HVU A;  1KIK A;  1N6A A;  3TCJ A;  2JVV A;  1J3T A;  1VQ9 T;  3OYY A;  2KRO A;  4HVV A;  1N8R R;  3PTA A;  1X6G A;  2KMT A;  1UGR B;  3EFS A;  4OGE A;  5FU7 C;  3HRU A;  4ZTJ A;  4N4I A;  2EGA A;  1GRI A;  2DKG A;  1PWT A;  2AKK A;  1IRX A;  3LW5 E;  3QDR B;  2QQR A;  3FB9 A;  4C92 F;  1QVG S;  3D7S B;  4E7L A;  3JB9 F;  2ESW A;  3OYA A;  5D6W A;  3N5B B;  1BCM A;  5GMK m;  3CME A;  1T0J A;  1I1J A;  2KT1 A;  3EGU A;  3V8J A;  1YJW T;  4OMO A;  3OYF A;  1D3B B;  5DY9 A;  4IKF A;  3VS2 A;  1Q81 R;  3U23 A;  3X26 B;  2C0O A;  3EG9 A;  4C0G A;  5GAN f;  4FYY B;  4EMG A;  2LX9 A;  3CPW P;  2JMA A;  1ZSG A;  5I11 A;  1TWB A;  4X9C A;  1E6G A;  3EGD B;  3DLL A;  2DZC A;  4QVC A;  3MKD A;  2DA9 A;  2A36 A;  2GBQ A;  1X43 A;  2F2W A;  1AWO A;  1YWP A;  1TUD A;  4OF1 A;  5DM7 R;  1U1S A;  1WJQ A;  2RJF A;  1SPK A;  1Z9Q A;  2HKQ B;  2X3W D;  2QAZ A;  2GTO A;  4LD6 A;  2GFU A;  4OB0 B;  1YHQ A;  3CME T;  3M4Y A;  2D8H A;  3HL8 A;  1K9A A;  4ELZ C;  5GAO p;  2RHU A;  5GAM h;  1YWO A;  2XIC A;  2ZPE B;  3RKX A;  1VQM A;  1VQ7 A;  4FIB A;  2C0T A;  2DLP A;  2J06 A;  2E3H A;  2JZ2 A;  4C0F A;  5KYU A;  1LJO A;  5GAO r;  2F2V A;  1I07 A;  2K7A A;  2M02 A;  2JM8 A;  5FU6 B;  4C8Q B;  1RLQ C;  1UE9 A;  1GCP A;  1HYO A;  1TOV A;  4A4K A;  1WNL A;  2XID A;  1B7T A;  4ELY C;  2QEX A;  2KYM A;  4M7D B;  2JTE A;  5FRO A;  2P84 A;  7AT1 B;  3L2Q A;  2DZ9 A;  2ZPB B;  2QQS A;  2KT8 A;  4FYW B;  1YFN A;  2LNH B;  4FT4 A;  4M77 F;  4F16 A;  3PGG A;  1HK9 A;  1QCF A;  2GNC A;  5KH6 A;  1YHQ T;  3CQT A;  2MWP A;  1WJS A;  4C92 G;  1NE8 A;  1VQM T;  1VQ7 T;  1M3B A;  4LDV A;  1VA7 A;  3BW1 A;  3JB9 G;  3VS3 A;  1D1A A;  3I55 T;  5D6Y A;  2DO3 A;  5C6S A;  6AT1 B;  1B07 A;  2VC8 A;  3DKM A;  2NWM A;  1UEB A;  2A0F B;  4C8Q F;  1BI2 A;  4QVZ A;  1ZA1 B;  2RD1 A;  2QA4 A;  5HKC A;  5GAN d;  3X20 B;  2X4X A;  1OI1 A;  4M7D F;  1D0X A;  1JU5 C;  3VUZ A;  5EC7 A;  1QWF A;  2E70 A;  5D6X A;  1RAE B;  1AWW A;  2D9T A;  3CXC P;  4HT9 A;  3EFO A;  1PKS A;  1SSF A;  4M75 D;  1NG2 A;  2YDL A;  4BY6 C;  2PVG B;  2YRV A;  8ATC B;  3CCE Q;  4FYV B;  2QAS A;  2J6K A;  2DXT A;  4CC7 A;  1YIT A;  4E7S A;  4Y91 A;  3TSW A;  3LGL A;  5GAN 4;  1BYM A;  3A1P A;  2ED1 A;  3AHU A;  1KFZ A;  4HCK A;  5HCK A;  3OSS C;  1ARK A;  2PU9 B;  2QA4 T;  1K4U S;  4A54 A;  1PKT A;  3NFC A;  2RK1 A;  1JJ2 S;  3I5R A;  1G3T A;  3E2U A;  3X25 B;  1UTI A;  3MP8 A;  2PVO B;  2R58 A;  1FYN A;  4BI4 A;  2XDP A;  2A28 A;  1IGQ A;  1GBQ A;  3QII A;  1WXT A;  1GCQ A;  2LVM A;  1U1T A;  5HK3 A;  2HCK A;  3CC4 T;  2RJC A;  1N5Z A;  1JO8 A;  4M7A B;  4KUD K;  4M77 G;  4A4H A;  1YIT T;  1OU8 A;  4Z89 A;  4XTZ A;  4C92 C;  4IUP A;  2HSP A;  3BDU A;  4C5E A;  1WHM A;  3S6W A;  3M0T A;  3EH1 A;  1NYF A;  4RTV A;  4PJO F;  2EGE A;  2QK0 A;  1IHW A;  1IO6 A;  1WHH A;  3CCQ A;  5LJ3 f;  1WXB A;  2ATC B;  5GAM j;  2HD0 A;  3M58 A;  3QDF A;  4J9I A;  5GMK h;  4J9F A;  2EJF A;  2YHT A;  4C8Q G;  2EVR A;  2DM1 A;  3G6E A;  1F1B B;  3PVL A;  5L8R E;  4ZN1 A;  2DTI A;  3NGP A;  2DBM A;  2X3X D;  3UPU A;  3M57 A;  4XU1 A;  2ZZD A;  4N0A A;  5GJV B;  2P0K A;  1VOM A;  4XTX A;  1DJ7 B;  5C0M A;  2X35 A;  5KYW A;  4BE0 A;  3M0S A;  5CR2 A;  5KCH A;  4J9E A;  1BKB A;  3FJ5 A;  4XU0 A;  1C6V X;  2GF7 A;  3OYC A;  1T3L A;  3G4S A;  1ZX6 A;  1W2B A;  2OTJ A;  4C8Q E;  2EQM A;  1SHG A;  5J3B A;  3CCQ T;  4AFZ C;  1WPY A;  3CCS A;  3CC2 A;  4AT1 B;  4YTL A;  2KI7 A;  4J9H A;  1KSW A;  1W1F A;  1YJW Q;  2DL5 A;  2P0P A;  3G6E T;  4M7D E;  2LNV A;  3VJP A;  1Y0M A;  5KCO A;  2KEA A;  2ECZ A;  2DD4 A;  5I2S A;  2YUP A;  1I81 A;  4LXC A;  4RKU E;  3HRT A;  1GCQ C;  2E5K A;  1QKW A;  2E12 A;  3VS1 A;  2E5Q A;  4AFQ C;  3AT1 B;  2EQU A;  1SSH A;  5GAN h;  5M9O A;  4RUG A;  4ZTF A;  1K76 A;  2BZX A;  4IUT A;  3BFM A;  1VQP A;  3G4S T;  1YCS B;  4M77 C;  2OTJ T;  2NUZ A;  2KAF A;  3EH2 A;  3CCS T;  3CC2 T;  1D1C A;  3WXM B;  3CME Q;  2O4X B;  3JB9 H;  3CBM A;  5LJ5 f;  4ME7 A;  1ABO A;  4OMP A;  2HBP A;  1RI0 A;  5GAM f;  5CO7 A;  4M78 B;  2NUT A;  2JTM A;  4J9D A;  4PJO G;  3NTH A;  1ZUU A;  5LJ3 d;  1RL2 A;  3CCL A;  2VGN A;  3CCV A;  4C8Q C;  2CZ1 B;  1MGQ A;  2NLU A;  2EYZ A;  3V7S A;  4E7H A;  4EMH A;  5I22 A;  4C0Z A;  4P5N A;  2KK4 A;  1XQH A;  4OMF B;  2FB7 A;  2LQ8 A;  4MML A;  3SHW A;  1VQP T;  3LYI A;  1Q7Y C;  3HRS A;  3MCA B;  3P8D A;  4EIK A;  1WGS A;  1FMV A;  3CCR A;  1YHQ Q;  2A3L A;  4D6W A;  2D0Q B;  1YN8 A;  3E19 A;  5FWB A;  4CC4 B;  1QVG P;  3PT9 A;  3RER A;  1OZ2 A;  2CUD A;  2KVQ G;  4XTW A;  1VQM Q;  2K9G A;  2L8D A;  2XDB A;  2FHD A;  3E9G A;  4O5V A;  4C5G A;  3CCL T;  2CP0 A;  1Q7Y U;  3CCV T;  1AOJ A;  4JS5 A;  3I55 Q;  3I5S A;  2EQI A;  1JBM A;  1MMA A;  4OMN A;  3CMA A;  4LUE A;  4Y92 A;  2MIO A;  4PLL A;  4PL6 A;  2A37 A;  3TQ7 P;  1I5L A;  4KUI A;  1G2B A;  2KGT A;  5GMK j;  4M7A E;  1OOT A;  2BKD N;  2COW A;  2CT3 A;  2FZC B;  1ZBX A;  2L2P A;  3CCR T;  3REA B;  1PSE A;  3PIP A;  5A0D A;  2X4W A;  2BUD A;  1KHC A; 
#chains in the Genus database with same CATH homology
 1YHQ Q;  1Q7Y R;  1YI2 Q;  1YIJ Q;  1Q82 R;  3CCE Q;  1YJ9 Q;  1VQO Q;  3G4S Q;  1N8R R;  1NJI R;  1K9M R;  1M1K R;  1YIT Q;  1VQ8 Q;  1KQS P;  1S72 Q;  2OTJ Q;  1QVG P;  3CPW P;  1VQ9 Q;  2QEX Q;  1M90 R;  3CME Q;  1JJ2 P;  1VQ5 Q;  3CCS Q;  1VQM Q;  1K73 R;  1W2B P;  3CC2 Q;  1VQ7 Q;  3CCJ Q;  3CCU Q;  3CCQ Q;  1Q81 R;  1QVF P;  1YJW Q;  1VQ6 Q;  1KD1 R;  1KC8 R;  2OTL Q;  1VQN Q;  3I56 Q;  3OW2 P;  3I55 Q;  3CXC P;  3CC4 Q;  3CCM Q;  1Q86 R;  3CD6 Q;  3CCL Q;  1VQ4 Q;  1VQL Q;  1VQK Q;  3CC7 Q;  1VQP Q;  3G71 Q;  1K8A R;  2QA4 Q;  3CCV Q;  3CMA Q;  3G6E Q;  3CCR Q;  1YJN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...