1VQOQ

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqoQ00
2QEXQ 3CCEQ 1YITQ 1VQOQ 3CMAQ 3CD6Q 1QVFP 1VQ6Q 1VQ4Q 1QVGP 3CCUQ 1YJ9Q 1N8RR 1VQLQ 3G6EQ 1M90R 1YHQQ 1Q82R 1KC8R 3CCLQ 1KD1R 1K9MR 3CC4Q 3OW2P 1W2BP 1K73R 1VQPQ 3I55Q 3CCSQ 1JJ2P 1VQ7Q 1Q81R 3CC7Q 1VQ9Q 3G71Q 1YIJQ 1Q7YR 3CCRQ 1VQMQ 1S72Q 1VQKQ 3CCMQ 1K8AR 1YJWQ 3CPWP 3G4SQ 3CC2Q 3CMEQ 1KQSP 1VQNQ 1NJIR 1Q86R 1VQ8Q 2QA4Q 2OTLQ 2OTJQ 1VQ5Q 3CXCP 1YI2Q 1M1KR 1YJNQ 3I56Q 3CCVQ 3CCJQ 3CCQQ
chains in the Genus database with same CATH superfamily
4DBHA 2CYZB 2ESWA 3I5RA 4Z02A 2LZ6B 4PJNA 1KHIA 3HSBA 4ZTFA 5KE2A 3PMTA 5GAOn 2MI6A 2LQNA 5LJ5h 1UG1A 1NM7A 4PJOA 2KDSA 2AK5A 4FSXA 2KEAA 1HYOA 3OYEA 3G7ZA 3HKSA 5GAN8 1KIKA 1RI9A 4M7DD 1BK2A 3S3MA 2EQJA 3MEAA 4ORZA 1OV3A 2HAXA 2IVWA 1WHMA 4PKCC 2RHIA 4M77C 2R5AA 2COYA 5GAOl 2RJDA 1RACB 1I0CA 3EH1A 3MCAB 2J7IA 5HK0A 4M77G 4HCKA 4TVRA 1BYMA 1WHHA 3PT9A 4M78F 1UDLA 4QT7A 2ATCB 1OX9A 2RI3A 3OSVA 5CIUA 2RJFA 4IUVA 1VQ5A 1VQNT 4HT8A 2KXCA 1AT1B 1X27A 3D7SB 4M75C 2SRCA 4M7DE 1X69A 1KC8U 4M7AC 1KK7A 2F2WA 2RK2A 4M75G 1QCNA 3V7RA 1RLQC 3WVDB 3I35A 4HXJA 4KH1B 2JTFA 2BZYA 1JB0E 1TU0B 4M78G 2ZPEB 1OZ3A 2LMJA 2RQTA 1O75A 2EGEA 2GNCA 1UEBA 1VQ5Q 3GF5A 3EFOB 3V8LA 4PJJA 2HSEB 3QZ5B 2A0FB 1KD1U 4E7HA 1MGQA 4C0DB 1MMGA 3FIFA 4CC4B 2HEQA 3OYFA 1Q81R 1W6XA 2V1RA 2QA4A 3G4ST 4A4FA 3M53A 2VXFA 1M27C 1I4K1 1VQOA 4M78B 1KQ1A 2P0QA 1R8OB 2CDTA 1ZSZC 4CC3A 4ZGEB 2JXBA 2LX7A 2X9HA 1K73U 2Z0WA 3LWHA 4JJCA 4Y91A 4RTZA 2EYXA 2RPNA 2VYTA 1Q7YR 2E6NA 3WXMB 2QA4T 2E64A 4DQ2A 3I9QA 2E10A 3R6NA 3G1JA 5GANj 4Z88A 1ZUYA 2K3XA 2V8JA 2EQKA 1OPKA 2CGHA 3OS2A 4M7DF 2E5QA 4MMLA 1YHQT 2YRVA 3H8ZA 2L3PA 3RMSA 2EJFA 4FYXB 2O2OA 2M9UA 2OTLA 1VIEA 5GAN6 3CXCS 4BD3A 4VUBA 2KBTA 2OI3A 1VQ4A 2DRMA 3JCMf 4LDVA 4XU2A 4KUDK 1VQPA 1YCSB 1PSFA 1I1JA 4JPBW 4ZTJA 1YFNA 2DF6A 1WJSA 1ABQA 1R0CB 3PE0A 3M0RA 1PCXA 3EFOA 1ZUKA 2EKOA 1Y7XA 1QP2A 2DXTA 4PLIA 1VQKQ 4JZ4A 1X6GA 2XDDA 3RKYA 1QVFA 3U23A 2OTLQ 4AG2C 1JXOA 4C8QD 2RHXA 3REAB 3OS5A 4K11A 4AG1C 2ENMA 3KUFA 1YITQ 1NYFA 1QCOA 1VQ4Q 1EX4A 3TU4K 3TCJA 3M59A 3JCMP 2E65A 1K1ZA 1VQPQ 1S1NA 5DM7R 5GANe 1KQSS 4BB7A 2MAMA 2ZAEA 2PVDB 3MHXA 1M4ZA 1X6OA 2E4HA 2B86A 1AWOA 4B9XA 1SSFA 4N4HA 1N8RC 2CZ6B 4FYVB 2DTHA 1EZZB 1D1AA 3MEUA 5EG2A 1RAFB 1NZ9A 1N27A 3MKDA 2Y4YA 2BIVA 4RKUE 1RAEB 2DL4A 3OSSC 2J6OA 1UTIA 4NL2A 3EFSA 4HCZA 1Z9ZA 2QASA 4JS5A 1OOTA 2EJGA 3S6WA 4V2SA 3VS7A 1DJ7B 1SG5A 3G71A 1YJ9Q 1TTHB 5D6YA 1PG5B 4A4HA 1KG1A 4JLGA 2ED0A 4XQ3A 1Y71A 1G83A 1N6AA 4PL6A 2P4TA 2GFUA 1NPRA 2WACA 2ECZA 4BE1A 2BTTA 5CAIA 5C6SA 2XICA 4RCCA 2CZ7B 1RI0A 2DXBA 5GAN3 1I8FA 2MCNA 1W2BP 2ZZDA 1D1CA 2WSFE 4RTUA 3RUXA 2LCLA 4J9DA 4C92G 3G71Q 4LDUA 2I0NA 3LGLA 3L2ZA 3H0IA 1BB9A 4FSSA 4Y92A 4BI8B 2D6FA 4NOYA 3JB9F 3SFMA 1NEBA 2YUPA 4M7DA 2MYSA 3P8DA 5LJ5f 3G6ET 3TQ7P 3FDRA 1T3LA 2LX9A 2EQUA 1BIBA 2RNAA 3VU3C 3CCST 2KAFA 4LD9K 1AZGB 4B6MA 1Q81U 2LQWA 2MK5A 2LCSA 3H0HA 3TVTA 3NHNA 4RTTA 2PTKA 3OMGA 1T0JA 2O4XB 3RMQA 1QVGS 2QDYB 3JB9G 5A2QE 3R6OA 2EGCA 2AIRB 2KMTA 2FYKA 4X1VA 2DD5A 1JJ2S 2HBPA 2VXEA 3H9NA 1Q7YU 1R0BG 1U3OA 5CKEA 2HQXA 1M1FA 1X6BA 1WXBA 2LQ8A 2CP7A 1M5Q1 3H0FA 1E7OA 4A54A 2E41A 1QQJA 3QSUA 2LQKA 3JB9I 4XTZA 2XIDA 2DXUA 5GMKj 4LXCA 3VRYA 1M2VB 1M3BA 4QVCA 3EGDB 4EIKA 5CR2A 1K9AA 2E6ZA 2PUKB 5KYYA 1Q86R 2A28A 1NE8A 2OAWA 2CKKA 4F04B 3KBGA 5CVIA 4E7ZA 4XAXB 2OTJA 2BZ8A 3J81E 2IPOB 3RIRA 3OYIA 2XHCA 3NMZC 1ZHIA 2QQSA 2EYWA 2QQBA 3GBQA 3NTHA 2L2PA 2RQWA 2CUBA 5IHNA 5I2SA 3CPFA 1X2QA 5GAMg 3TREA 2JTEA 5FU6B 1M90C 2DBMA 5IHKA 2PUOB 3M54A 3HTRA 2O4XA 3SWNB 5LJ3f 5FRMA 5GAN5 4MZMA 2JMAA 2KT8A 2LP5A 2XDBA 2DYIA 4F17A 4QKUA 3V7CA 3KXTA 2K2VA 2OTJQ 1AZEA 1M1KR 1M1GA 2E3HA 2DVJA 4QVDA 2GGRA 2A37A 3HRUA 4PJOG 1VQMA 1PC0A 1K0XA 2P0PA 1VYVA 3M57A 4WCIA 5KH6A 1RAIB 2R57A 1Y96B 3AHUA 2EYYA 1UGQB 3E19A 2A3LA 3HRTA 3BFMA 3VYGA 2KK4A 2O9VA 2QEXT 1M2VA 1ZSGA 3ME9A 3EGDA 2DILA 1WXUA 4RCBA 3SDZA 2DX1A 5DY9A 2FEIA 2YWWA 3OYCA 3CCRA 1JU5C 1PNJA 5J39A 4ELYC 2QTXA 2AHJB 4D8KA 3C95A 1YWPA 3L2RA 4PJOB 4GLKA 4JS4A 3JCMb 3CPWS 1VQMQ 2O31A 3CC2A 4KULA 3QJYA 4OF1A 2XKOC 4A4KA 4AFUC 3C4SA 4C8QA 1A0NB 4JRIA 3M58A 3A8GB 1UHFA 2H3JA 1W2BA 4DBQA 2BE7D 5GMKm 4M7AD 1HD3A 3O5ZA 5KYNA 1QKWA 4IIOA 2CSQA 3QYHB 2VC8A 4E7LA 3L2QA 2EPDA 3CCRQ 2YLBA 1UHCA 4OMNA 3CCVT 3CC2T 2KGTA 2OJ2A 2ZPHB 1GCPA 1UE9A 1G8XA 3H41A 2VWFA 3OW2S 3F70A 2COWA 2QQAA 1K9MR 1WA7A 1I5OB 2RQVA 4R56A 1FMKA 1EIFA 1WI7A 1SHGA 1BIAA 2FVUA 2BKDN 3CCQT 4J9HA 4Y28E 1Y96A 2P84A 1UGRB 2RHZA 2YHTA 5J3BA 3L1AA 1QVFP 2V8IA 2DM1A 1M8MA 3JV3A 1QW1A 2K5LA 2EQIA 3JSCA 2K9GA 1V76A 2FRYA 2F1LA 4DOWA 1P92A 4FW1A 1ZA2B 4EMKA 4CI0C 4EMGA 2JUFA 2C0TA 5CQXA 2RK1A 1FWZA 4EMHA 1YJWA 2JS0A 1FMWA 3GLXA 1IGQA 1VQ7Q 3A8MB 1M2OA 5FU7B 2LJ1A 5DLOA 1H641 1Q86U 4WTOB 1K0SA 1RADB 2PQWA 2O01E 2J06A 5A0LA 4CC2A 2CT3A 1KD1C 4B9WA 2QI2A 3ZL7C 4JLIA 3UF4A 2G6FX 3P8BB 1UGVA 5GAOp 3A8LB 1NJIC 1H3HA 3RKWA 2M51A 2QG9B 1YJWQ 1VYUA 4ZGDB 1TOVA 2JT4A 3M0SA 4C0DC 3MP6A 1WGSA 1WFWA 4QVZA 1ZUUA 2LC4A 2PZ1A 2EFIA 2JJ9A 1TXQA 2DVEA 5IHIA 4F14A 1K73C 4DBRA 2KROA 1GCQA 4NS5A 4M78C 3BW1A 2EYZA 1RAGB 1VQ8A 1C6VX 3VYHB 2CP6A 4J9IA 1UJ0A 2DEQA 2YDLA 5KCOA 3OYKA 1VQ5T 1M1KU 1WXTA 2FPFA 4GY5A 1M9SA 3GNGA 4IKFA 2J6KA 3I55A 4ANJA 3CD6Q 2BE9B 3J7AF 1N8RR 2EAYA 2DL5A 5HCKA 1E6GA 5GAMj 3HRSA 3OB9A 4DA4A 3PFSA 2GTJA 2RM4A 1AWJA 4J9EA 3PVQA 5LJ3h 1JQQA 3M4GA 2PVGB 2YRDA 4MDWA 6AT1B 1VQ8Q 4N4IA 3FC3A 3VS4A 9ATCB 1UGSB 2RI2A 2RQRA 2VV5A 3PIPA 3KFVA 1WQ7A 5L23A 4C0GA 1NG2A 2NUTA 4F7UE 4LE9A 3I55Q 4ME7A 1XQHA 1HK9A 2IIMA 2FPEA 4P5NA 2DL8A 3UT1A 3NTIA 2HQEA 2EJ9A 2PNIA 1JBMA 2JTMA 1NLPC 1SKUB 4RTXA 2KRSA 1D0YA 3VS0A 3V8KA 1VQOT 3DB3A 4OVAA 1HXDA 2DNUA 2DIGA 2LT1A 2HMAA 4PFZA 1NLOC 3QJ6A 4PFPA 1VQKA 3AT1B 1EFNA 1OQKA 2P4RA 3M0TA 2DJZA 2QQRA 2HL5C 2X4JA 1NBEB 2CP0A 2M0OA 3QG1A 1YITA 3OBYA 5GAMe 4ESRA 2QAZA 1K76A 4J9CA 3CC4A 1M8VA 3MJXA 4IURA 2VVKA 2NUPA 1K9MU 4RTVA 5LJ5j 2VGMA 1NYGA 2K3BA 3HFNA 4M7DG 1GXIE 1VQKT 3DLLA 3X24B 4L6V5 1RABB 1OX8A 2OTLT 4BDZA 2EW3A 2RHUA 4HKEA 1VQLA 2YUQA 1YITT 1VQ4T 4X9DA 3PTAA 2KNBB 4D6WA 3A5ZB 1S72A 1WPYA 1VQPT 2JNGA 1IO6A 3CC4Q 5KYUA 2E1HA 2A7YA 1BI1A 4F7UF 3QWYA 1BI3A 4OMMA 1YJNA 3RERA 4M7DB 3QWXX 1GFCA 4OMQA 1YI2Q 2RB6A 5GAN4 2HNIA 1YJ9A 2NYSA 5GANd 3CCEQ 4IIMA 1D0ZA 1GRIA 2O88A 2DRKA 1SF9A 3CCUQ 1VQLQ 1D3BB 4EDUA 3CPWA 3ZBDA 3MEWA 1MV3A 5A0GA 1ZQ1A 2DE0X 2VUBA 4E7SA 1S72Q 4JZ3A 2JM8A 5IXBA 2NLUA 2ZPFB 3CMAA 3CEYA 1YBYA 2LDMA 4C8QE 2JM9A 1YJNQ 1AHJB 1TH7A 3M56A 1YJ9T 2C0IA 2R5MA 2PU9B 2EKHA 4KRTA 1C0MA 3QXEB 1Q81C 2DXCA 3M0QA 2QGFB 3QKJA 2E70A 3SHWA 3CC7Q 2GQIA 5GMKl 3MPUB 1GFDA 2M0YA 2HBWA 4R55A 2EIFA 4AT1B 2F5TX 2HCKA 2ROTA 4F7UB 3DB4A 5CKFA 1ZSZA 1D09B 1O9SA 3CMAQ 1LCKA 3M0PA 4C92C 2JOYA 5GAOm 1Q7YC 1M90R 5KYYB 2XD0A 3OYYA 4XU1A 3G71T 3ZFJA 3X20B 4M4ZA 4JJNK 4BUGA 5L8RE 1OEBA 5LJ3j 5GANf 3LWIA 2CUDA 4BDYA 4OMOA 1N9SA 2X4XA 2IG0A 4QW2A 2W0ZA 1WHJA 4OB2B 2RMOA 2I2LA 4J9FA 1WJRA 1N8RU 3JCMc 2KY9A 2LJ3A 1YIJA 1JRIA 3REBB 2K3YA 1X43A 2LRQA 5I21A 2GQVA 3OY9A 1D3BA 2ZPBB 3VRZA 4N4GA 5KE3A 1M3AA 4MMKA 2CP2A 1OI1A 1G3TA 2X3WD 2RJCA 2DMOA 2AKKA 4C8QF 4XU0A 4JDSA 4PJMA 2DFUA 2KRNA 5GMKi 2SEMA 3CMEA 3RBBB 1LJOA 1T3SA 1G3SA 1E6HA 3T9NA 1YIJQ 4ELZC 3QYGB 4NL3A 3GNFB 3JCMg 3ULRB 5FLXE 1YCYA 1LPLA 1TWBA 4F16A 2JS2A 3N5BB 1LOJA 2CZ0B 2D9TA 2J6FA 1B7TA 1LVKA 1IHWA 2M16A 4C8QG 2FB7A 4F7UA 1W70A 3NFCA 3I5SA 1I5LA 2BZXA 4DEXA 1WZOA 3OYMA 4OMPA 1WHGA 2E3IA 3VS1A 3MEVA 3CMEQ 2NWMA 3SWNC 2RHYA 1IREB 1B07A 3EGXB 1VQ9A 5FRNA 2CZ1B 3M4YA 1TUGB 4C8QB 2L89A 1ZBJA 2DTIA 5I11A 3OMCA 4C5EA 1W1FA 2MPXC 1VQ6A 2W10A 2X35A 5J26A 5AT1B 3OQ5A 1IB8A 2K57A 2ZGWA 3SEMA 3OYLA 5GJWB 1MHNA 1NPPA 2KXDA 1KJWA 3IQLA 3OA6A 1KQ2A 2YSQA 4BY6C 1VQ9Q 1MNEA 3HPWA 2A08A 2OTJT 3EHRA 4BI4A 2XK0A 2XI9A 1TS9A 4HT9A 4IUUA 4PJOC 4PK4A 4OB0B 3I56Q 5GMKe 3CCLA 4HA8A 4MZTA 4UC4A 5D6WA 1Q82C 1QKXA 3ER0A 1VQ6Q 3EG9A 1PWTA 3BE3A 1JJ2P 1QWFA 4LNPA 2VASA 3JCMV 2DAQA 5I2MA 4C5GA 4M77D 2H3EB 4FT4A 3M9QA 2HKQB 1QVFS 2B8AA 2ED1A 1XNIA 3CQTA 1V1CA 1QP3A 4J83A 3CCMA 3H6ZA 3CCLQ 3L2VA 4ZNXA 3EGXA 1VQMT 1K8AC 1VOMA 3CXCA 2K6DA 2D8JA 4EMKB 5KYWB 3OYAA 1WHKA 7AT1B 1NJIR 1CSKA 1BKBA 1WHLA 2QYZA 2DLPA 2K4YA 5FWCA 3CCJQ 2X3XD 3ASKA 4M75D 5LJ5g 1OU9A 2AZVA 2DL7A 2OAUA 1GCQC 2X4WA 4M78D 3LH5A 3CCRT 1ACMB 2VB6A 5GAOr 3CCMQ 4M77E 1OU8A 3O8VA 2DZ9A 4KT0E 3NTKA 3FEOA 1OYXA 3S3NA 1PD0A 3C12A 2XG8D 4FIBA 3JAME 4LDWA 1B34B 2CP3A 1Y07A 2GBQA 2FZKB 1KSWA 2YLCA 1KQSA 4RUGA 3FRNA 5FW9A 4C0ZA 2KE9A 4HVWA 1AOJA 2DZCA 2WSCE 4J6XA 8AT1B 4WF2A 3QDFA 1Z9QA 4J9BA 2L5QA 1FYNA 1VA7A 1KFZA 4M75E 5FU7C 5GANh 2F5KA 5FROA 3A1PA 3WVEB 1VQ7A 1BU1A 2ZPIB 3VJPA 3P8HA 4KBMB 4RTYA 3OYDA 4M7AE 1K4US 3PNWC 1OZ2A 4XTYA 1PRLC 4IUPA 1I07A 2MIOA 1LNXA 2ROLA 1UFFA 3SB2A 3BDLA 1AD5A 2LNVA 2QXFA 2RH2A 2QTVA 1FXXA 1SEMA 5DLQE 2C0OA 3DLMA 1RUWA 4CRIA 2MMPA 2MF2A 5KYWA 3MP1A 4ATOA 1KC8C 3EFRA 4KUIA 2DERA 2F2XA 1VQ7T 1TG0A 5KYXA 5GAOq 2JZ2A 1XOVA 2GF7A 3INZA 4LUEA 1SHFA 4J6YA 2AKLA 1M1KC 3QHSA 2KYMA 1MMAA 3CPWP 4HCCA 3A8HB 4M77F 4Z89A 1WQWA 2M02A 2JMCA 2KRMA 4PJLA 1AEYA 1JEGA 3FJPA 5HKCA 2NUTB 3DKMA 3LLRA 5LJ3g 1VQNA 2K79A 1YJWT 3CBPA 1B34A 1C1AA 3EG0A 1H3ZA 3LX7A 1AWWA 3OYHA 2V1QA 3QIIA 3CD6A 5CKDA 3X25B 2L3SA 1X75C 1YWOA 2JW4A 4FU6A 1R77A 2QGGA 4M75F 4JRKA 3VKIA 3VUZA 2KSSA 4CC7A 4M7AF 3LGFA 3VS5A 3OW2P 2K7AA 2BUDA 4E7IA 4OMFB 2RA2A 2HSPA 3FLGA 4J7IA 4O6JA 4DBFA 1UJYA 1WLPB 2EQMA 5HK3A 1VQNQ 1QVGA 2NUPB 5HY6A 5GAN7 3CD6T 2QQ9A 1JJ2A 2AT1B 3QZ9B 4M77B 1X2KA 3G4SA 2FG0A 4LDXA 3OYJA 2D1XA 4II1A 4M7AG 2DPPB 5IN1A 4RTWA 1VQ8T 2X4YA 4FL6A 2WSEE 1BBZA 3JCMe 4OB3B 2ABLA 4N0AA 3OYNA 4YTLA 5KYUB 2KR3A 3JCMd 1K9MC 3EHQA 4ZN3A 1NEGA 1PM3A 3I55T 4Q5WA 4O5VA 2QK0A 4M75B 2RI5A 3LYIA 3C0CA 4BE2A 1NJIU 3G4SQ 3J80E 1CKBA 4M7AB 3JB9H 2F69A 3PMIA 1MMNA 1HSQA 2CH4W 1ABOA 1YHQA 1U1TA 4JRQA 3PIOA 4FYYB 1VUBA 4C92D 2EBPA 1G3YA 2CH4A 2CREA 3RDVA 4XTVA 2EGAA 2FZGB 3QDRB 1H92A 2KQWA 3E9GA 5IXFA 4LUDA 2EWNA 3VS6A 1QCFA 2KI7A 2QA4Q 1H8KA 4BI3A 1QWEA 3GIBA 1PKTA 1VQOQ 4M7DC 4QQDA 3X26B 4DOVA 2YUOA 1YHQQ 1AWXA 4PFOA 3X28B 3OYGA 3FB9A 5GAMd 4KGVB 5EC7A 4E7JA 2VKNA 4HVVA 2LTOA 4M77A 2GFAA 4A4EA 3S3OA 1YI2A 1ZSZB 3JB9D 3CCEA 2RD1A 4C5IA 1N5ZA 1TSFA 1U1SA 3CCUA 2DA9A 2K5FA 1TUCA 2LVMA 4DEYA 3NGPA 4C92E 1ZLMA 4Z8AA 4FW2A 3CC4T 1W2BS 3ZEHA 5GMKh 1MNDA 4BACA 3A98A 2XMFA 3HFOA 5LL6S 4L5GA 4A53A 2A36A 1U8RA 1ZX6A 3UA7A 3EG3A 1YI2T 4M75A 3CCET 3EH2A 5CCAA 1SPKA 3UA6A 4MDXA 3CCUT 1VQLT 2RN8A 4LDYA 4D8DA 4M78A 4M7AA 3CC7A 2H8HA 3HL8A 3PGGA 1PRMC 2DTOA 3RESA 1S72T 3PVLA 5CK9A 4GBQA 1D1BA 2RF0A 1YJNT 4F7UG 2FPDA 5IT9E 2Y4XA 2CSIA 4OGEA 1OPLA 3QBYA 5LJ5e 1F1BB 1YNZA 1PKSA 3UDCA 1RAHB 5GAMf 3CBMA 5KCHA 2EVRA 2L3RA 1IGUA 3LW5E 4J7FA 1Q95G 2M1HA 3CC7T 3LH0A 2DBKA 5LJ5d 1PSEA 1WJQA 2L0AA 2K2MA 2HKNA 2VGNA 1WX6A 4E7KA 1IHVA 3CXCP 1IRXA 2DD4A 3CMAT 4C5HA 2X51A 1V29B 3C94A 3OW2A 3QO3A 5IH2A 2KVQG 2DL3A 4C92F 2C06A 3EG1A 3OS1A 3A8OB 1M30A 1QVPA 3QPHA 4KGXB 2R58A 1RAAB 4IUTA 2D0NA 4JJDA 1D0XA 1UECA 2ZPGB 3CBOA 1OULA 4PJOD 3G6EA 3CCSA 2P0KA 5A0DA 4J6WA 2PVOB 1GBRA 1ARKA 3THKA 1Q82R 4HCBA 1T0HA 4RMOA 2Y90A 2COZA 3UATA 3URGA 5CO7A 4A4GA 2MWOA 2E5KA 1KQSP 3E2UA 3VUBA 1U5SA 1N9RA 5CKBA 4PLLA 3VS2A 2E12A 4OP0A 3SD4A 3UPUA 3JCMJ 3NPFA 5IAYA 3G6EQ 2FL7A 5GAN2 2YUNA 3EGUA 1YIJT 3CCSQ 5CKHA 1SRLA 1WIEA 1ZBXA 2F2VA 3BY7A 1K8AR 2NUZA 4C92B 4MZPA 1BCMA 2MOXA 4PJOE 3EG9B 4C8QC 5FWBA 2K5IA 1XTDA 4JJBA 3HP9A 4C0FA 4GLMA 1RLPC 2RQUA 2D0QB 2YRCA 4ZGJB 3Q1JA 5LJ3e 3TSWA 1G2BA 4J8OA 3GOXA 2GCXA 4LD6A 2YXYA 3CMET 1AVZC 1WYXA 5FU6C 5LJ3d 3JB9J 3OYBA 2HQHA 1JXMA 3E9FA 3OBWA 1IZ6A 5ECAA 4J5YA 4J9GA 2HDAA 2CS7A 2D8HA 3RKXA 4ZN1A 1KHCA 1PD1A 4X34A 1Y57A 1QMCA 2FRWA 2LJ0A 2YT6A 1MV0B 2DETA 2FO0A 3E1SA 3I56A 1CKAA 5M9OA 1BI2A 4JUVA 5CQYA 1UUEA 2CP5A 3JCMX 3M5AA 2KT1A 4E2FB 1FX7A 1VQ9T 4XTWA 4XK8E 2LT4A 2O9SA 4RG8A 3JCMW 1PHTA 2L3QA 2DIQA 1SRMA 2GTOA 3TSZA 2LNHB 4QQGA 3I56T 4XTXA 2DEUA 1W4SA 4PJOF 3MP8A 4FCYA 2ZCFB 1VQ6T 3GPLA 1MUZA 4C92A 1HJDA 2JN0A 3FJ5A 3META 5C0MA 3JCMh 4EMKC 3QUIA 1QVGP 4RG2A 3EG2A 2KYBA 4OGCA 1KC8R 2MWPA 1UGPB 2HL3A 4EPCA 4AMCA 5GJVB 3OS0A 3VS3A 3CCJA 2QEXA 1MMDA 1G5VA 4KGZB 1SSHA 1JO8A 1YN8A 2JVVA 3BDUA 3CCLT 4BE0A 4FT2A 2HD0A 1GL5A 1KD1R 5D6XA 3JCMQ 2HZYA 2DJQA 5GANg 4AFSC 4PNOA 2DO3A 1WDXA 4KH0B 2AZSA 2DK3A 2RO0A 3M0UA 1GBQA 1X01A 3M55A 1TUDA 3CCJT 2J05A 1BCOA 4L59A 4JRPA 4BY6B 5KYXB 2QEXQ 1IXDA 2FHDA 1B3QA 3TEEA 4AFZC 1M90U 1FMVA 2CT4A 2DKGA 2RJEA 1K73R 2XDPA 5GAMh 4R0KA 4FYWB 3CCMT 3HHTB 4HVUA 3CCVA 1UB4A 3RR6A 4E47A 1J3TA 2G3RA 2EYQA 4IUQA 1ZA1B 2OX7A 4LN2A 4FM4B 1RL2A 1VIFA 1Q82U 1G3WA 4E6RA 2V8KA 2V26A 3V7SA 3V8JA 2LCCA 5D7UA 3CCQA 1Q86C 3VV0A 3L2WA 1M3CA 2XU8A 3SWNA 3L2UA 3EAEA 8ATCB 3GP8A 4XU3A 1I81A 2L8DA 3CCVQ 3CC2Q 4N0AC 2DYBA 3RNJA 1Y0MA 4QQ6A 1QLYA 1U06A 5AYFA 4M78E 5I22A 1YP5A 3MO8A 1WNLA 4OMLA 1VYTA 4OB1B 1XJWB 2FZCB 3L42A 4AFQC 3UWNA 1K8AU 4XTUA 4X9CA 4A63B 2QDLA 1BI0A 3JRZA 3CCQQ
chains in the Genus database with same CATH topology
2QEXQ 3CCEQ 1YITQ 1VQOQ 3CMAQ 3CD6Q 1QVFP 1VQ6Q 1VQ4Q 1QVGP 3CCUQ 1YJ9Q 1N8RR 1VQLQ 3G6EQ 1M90R 1YHQQ 1Q82R 1KC8R 3CCLQ 1KD1R 1K9MR 3CC4Q 3OW2P 1W2BP 1K73R 1VQPQ 3I55Q 3CCSQ 1JJ2P 1VQ7Q 1Q81R 3CC7Q 1VQ9Q 3G71Q 1YIJQ 1Q7YR 3CCRQ 1VQMQ 1S72Q 1VQKQ 3CCMQ 1K8AR 1YJWQ 3CPWP 3G4SQ 3CC2Q 3CMEQ 1KQSP 1VQNQ 1NJIR 1Q86R 1VQ8Q 2QA4Q 2OTLQ 2OTJQ 1VQ5Q 3CXCP 1YI2Q 1M1KR 1YJNQ 3I56Q 3CCVQ 3CCJQ 3CCQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  3CCE Q;  1YIT Q;  1VQO Q;  3CMA Q;  3CD6 Q;  1QVF P;  1VQ6 Q;  1VQ4 Q;  1QVG P;  3CCU Q;  1YJ9 Q;  1N8R R;  1VQL Q;  3G6E Q;  1M90 R;  1YHQ Q;  1Q82 R;  1KC8 R;  3CCL Q;  1KD1 R;  1K9M R;  3CC4 Q;  3OW2 P;  1W2B P;  1K73 R;  1VQP Q;  3I55 Q;  3CCS Q;  1JJ2 P;  1VQ7 Q;  1Q81 R;  3CC7 Q;  1VQ9 Q;  3G71 Q;  1YIJ Q;  1Q7Y R;  3CCR Q;  1VQM Q;  1S72 Q;  1VQK Q;  3CCM Q;  1K8A R;  1YJW Q;  3CPW P;  3G4S Q;  3CC2 Q;  3CME Q;  1KQS P;  1VQN Q;  1NJI R;  1Q86 R;  1VQ8 Q;  2QA4 Q;  2OTL Q;  2OTJ Q;  1VQ5 Q;  3CXC P;  1YI2 Q;  1M1K R;  1YJN Q;  3I56 Q;  3CCV Q;  3CCJ Q;  3CCQ Q; 
#chains in the Genus database with same CATH topology
 4DBH A;  2CYZ B;  2ESW A;  3I5R A;  4Z02 A;  2LZ6 B;  4PJN A;  1KHI A;  3HSB A;  4ZTF A;  5KE2 A;  3PMT A;  5GAO n;  2MI6 A;  2LQN A;  5LJ5 h;  1UG1 A;  1NM7 A;  4PJO A;  2KDS A;  2AK5 A;  4FSX A;  2KEA A;  1HYO A;  3OYE A;  3G7Z A;  3HKS A;  5GAN 8;  1KIK A;  1RI9 A;  4M7D D;  1BK2 A;  3S3M A;  2EQJ A;  3MEA A;  4ORZ A;  1OV3 A;  2HAX A;  2IVW A;  1WHM A;  4PKC C;  2RHI A;  4M77 C;  2R5A A;  2COY A;  5GAO l;  2RJD A;  1RAC B;  1I0C A;  3EH1 A;  3MCA B;  2J7I A;  5HK0 A;  4M77 G;  4HCK A;  4TVR A;  1BYM A;  1WHH A;  3PT9 A;  4M78 F;  1UDL A;  4QT7 A;  2ATC B;  1OX9 A;  2RI3 A;  3OSV A;  5CIU A;  2RJF A;  4IUV A;  1VQ5 A;  1VQN T;  4HT8 A;  2KXC A;  1AT1 B;  1X27 A;  3D7S B;  4M75 C;  2SRC A;  4M7D E;  1X69 A;  1KC8 U;  4M7A C;  1KK7 A;  2F2W A;  2RK2 A;  4M75 G;  1QCN A;  3V7R A;  1RLQ C;  3WVD B;  3I35 A;  4HXJ A;  4KH1 B;  2JTF A;  2BZY A;  1JB0 E;  1TU0 B;  4M78 G;  2ZPE B;  1OZ3 A;  2LMJ A;  2RQT A;  1O75 A;  2EGE A;  2GNC A;  1UEB A;  1VQ5 Q;  3GF5 A;  3EFO B;  3V8L A;  4PJJ A;  2HSE B;  3QZ5 B;  2A0F B;  1KD1 U;  4E7H A;  1MGQ A;  4C0D B;  1MMG A;  3FIF A;  4CC4 B;  2HEQ A;  3OYF A;  1Q81 R;  1W6X A;  2V1R A;  2QA4 A;  3G4S T;  4A4F A;  3M53 A;  2VXF A;  1M27 C;  1I4K 1;  1VQO A;  4M78 B;  1KQ1 A;  2P0Q A;  1R8O B;  2CDT A;  1ZSZ C;  4CC3 A;  4ZGE B;  2JXB A;  2LX7 A;  2X9H A;  1K73 U;  2Z0W A;  3LWH A;  4JJC A;  4Y91 A;  4RTZ A;  2EYX A;  2RPN A;  2VYT A;  1Q7Y R;  2E6N A;  3WXM B;  2QA4 T;  2E64 A;  4DQ2 A;  3I9Q A;  2E10 A;  3R6N A;  3G1J A;  5GAN j;  4Z88 A;  1ZUY A;  2K3X A;  2V8J A;  2EQK A;  1OPK A;  2CGH A;  3OS2 A;  4M7D F;  2E5Q A;  4MML A;  1YHQ T;  2YRV A;  3H8Z A;  2L3P A;  3RMS A;  2EJF A;  4FYX B;  2O2O A;  2M9U A;  2OTL A;  1VIE A;  5GAN 6;  3CXC S;  4BD3 A;  4VUB A;  2KBT A;  2OI3 A;  1VQ4 A;  2DRM A;  3JCM f;  4LDV A;  4XU2 A;  4KUD K;  1VQP A;  1YCS B;  1PSF A;  1I1J A;  4JPB W;  4ZTJ A;  1YFN A;  2DF6 A;  1WJS A;  1ABQ A;  1R0C B;  3PE0 A;  3M0R A;  1PCX A;  3EFO A;  1ZUK A;  2EKO A;  1Y7X A;  1QP2 A;  2DXT A;  4PLI A;  1VQK Q;  4JZ4 A;  1X6G A;  2XDD A;  3RKY A;  1QVF A;  3U23 A;  2OTL Q;  4AG2 C;  1JXO A;  4C8Q D;  2RHX A;  3REA B;  3OS5 A;  4K11 A;  4AG1 C;  2ENM A;  3KUF A;  1YIT Q;  1NYF A;  1QCO A;  1VQ4 Q;  1EX4 A;  3TU4 K;  3TCJ A;  3M59 A;  3JCM P;  2E65 A;  1K1Z A;  1VQP Q;  1S1N A;  5DM7 R;  5GAN e;  1KQS S;  4BB7 A;  2MAM A;  2ZAE A;  2PVD B;  3MHX A;  1M4Z A;  1X6O A;  2E4H A;  2B86 A;  1AWO A;  4B9X A;  1SSF A;  4N4H A;  1N8R C;  2CZ6 B;  4FYV B;  2DTH A;  1EZZ B;  1D1A A;  3MEU A;  5EG2 A;  1RAF B;  1NZ9 A;  1N27 A;  3MKD A;  2Y4Y A;  2BIV A;  4RKU E;  1RAE B;  2DL4 A;  3OSS C;  2J6O A;  1UTI A;  4NL2 A;  3EFS A;  4HCZ A;  1Z9Z A;  2QAS A;  4JS5 A;  1OOT A;  2EJG A;  3S6W A;  4V2S A;  3VS7 A;  1DJ7 B;  1SG5 A;  3G71 A;  1YJ9 Q;  1TTH B;  5D6Y A;  1PG5 B;  4A4H A;  1KG1 A;  4JLG A;  2ED0 A;  4XQ3 A;  1Y71 A;  1G83 A;  1N6A A;  4PL6 A;  2P4T A;  2GFU A;  1NPR A;  2WAC A;  2ECZ A;  4BE1 A;  2BTT A;  5CAI A;  5C6S A;  2XIC A;  4RCC A;  2CZ7 B;  1RI0 A;  2DXB A;  5GAN 3;  1I8F A;  2MCN A;  1W2B P;  2ZZD A;  1D1C A;  2WSF E;  4RTU A;  3RUX A;  2LCL A;  4J9D A;  4C92 G;  3G71 Q;  4LDU A;  2I0N A;  3LGL A;  3L2Z A;  3H0I A;  1BB9 A;  4FSS A;  4Y92 A;  4BI8 B;  2D6F A;  4NOY A;  3JB9 F;  3SFM A;  1NEB A;  2YUP A;  4M7D A;  2MYS A;  3P8D A;  5LJ5 f;  3G6E T;  3TQ7 P;  3FDR A;  1T3L A;  2LX9 A;  2EQU A;  1BIB A;  2RNA A;  3VU3 C;  3CCS T;  2KAF A;  4LD9 K;  1AZG B;  4B6M A;  1Q81 U;  2LQW A;  2MK5 A;  2LCS A;  3H0H A;  3TVT A;  3NHN A;  4RTT A;  2PTK A;  3OMG A;  1T0J A;  2O4X B;  3RMQ A;  1QVG S;  2QDY B;  3JB9 G;  5A2Q E;  3R6O A;  2EGC A;  2AIR B;  2KMT A;  2FYK A;  4X1V A;  2DD5 A;  1JJ2 S;  2HBP A;  2VXE A;  3H9N A;  1Q7Y U;  1R0B G;  1U3O A;  5CKE A;  2HQX A;  1M1F A;  1X6B A;  1WXB A;  2LQ8 A;  2CP7 A;  1M5Q 1;  3H0F A;  1E7O A;  4A54 A;  2E41 A;  1QQJ A;  3QSU A;  2LQK A;  3JB9 I;  4XTZ A;  2XID A;  2DXU A;  5GMK j;  4LXC A;  3VRY A;  1M2V B;  1M3B A;  4QVC A;  3EGD B;  4EIK A;  5CR2 A;  1K9A A;  2E6Z A;  2PUK B;  5KYY A;  1Q86 R;  2A28 A;  1NE8 A;  2OAW A;  2CKK A;  4F04 B;  3KBG A;  5CVI A;  4E7Z A;  4XAX B;  2OTJ A;  2BZ8 A;  3J81 E;  2IPO B;  3RIR A;  3OYI A;  2XHC A;  3NMZ C;  1ZHI A;  2QQS A;  2EYW A;  2QQB A;  3GBQ A;  3NTH A;  2L2P A;  2RQW A;  2CUB A;  5IHN A;  5I2S A;  3CPF A;  1X2Q A;  5GAM g;  3TRE A;  2JTE A;  5FU6 B;  1M90 C;  2DBM A;  5IHK A;  2PUO B;  3M54 A;  3HTR A;  2O4X A;  3SWN B;  5LJ3 f;  5FRM A;  5GAN 5;  4MZM A;  2JMA A;  2KT8 A;  2LP5 A;  2XDB A;  2DYI A;  4F17 A;  4QKU A;  3V7C A;  3KXT A;  2K2V A;  2OTJ Q;  1AZE A;  1M1K R;  1M1G A;  2E3H A;  2DVJ A;  4QVD A;  2GGR A;  2A37 A;  3HRU A;  4PJO G;  1VQM A;  1PC0 A;  1K0X A;  2P0P A;  1VYV A;  3M57 A;  4WCI A;  5KH6 A;  1RAI B;  2R57 A;  1Y96 B;  3AHU A;  2EYY A;  1UGQ B;  3E19 A;  2A3L A;  3HRT A;  3BFM A;  3VYG A;  2KK4 A;  2O9V A;  2QEX T;  1M2V A;  1ZSG A;  3ME9 A;  3EGD A;  2DIL A;  1WXU A;  4RCB A;  3SDZ A;  2DX1 A;  5DY9 A;  2FEI A;  2YWW A;  3OYC A;  3CCR A;  1JU5 C;  1PNJ A;  5J39 A;  4ELY C;  2QTX A;  2AHJ B;  4D8K A;  3C95 A;  1YWP A;  3L2R A;  4PJO B;  4GLK A;  4JS4 A;  3JCM b;  3CPW S;  1VQM Q;  2O31 A;  3CC2 A;  4KUL A;  3QJY A;  4OF1 A;  2XKO C;  4A4K A;  4AFU C;  3C4S A;  4C8Q A;  1A0N B;  4JRI A;  3M58 A;  3A8G B;  1UHF A;  2H3J A;  1W2B A;  4DBQ A;  2BE7 D;  5GMK m;  4M7A D;  1HD3 A;  3O5Z A;  5KYN A;  1QKW A;  4IIO A;  2CSQ A;  3QYH B;  2VC8 A;  4E7L A;  3L2Q A;  2EPD A;  3CCR Q;  2YLB A;  1UHC A;  4OMN A;  3CCV T;  3CC2 T;  2KGT A;  2OJ2 A;  2ZPH B;  1GCP A;  1UE9 A;  1G8X A;  3H41 A;  2VWF A;  3OW2 S;  3F70 A;  2COW A;  2QQA A;  1K9M R;  1WA7 A;  1I5O B;  2RQV A;  4R56 A;  1FMK A;  1EIF A;  1WI7 A;  1SHG A;  1BIA A;  2FVU A;  2BKD N;  3CCQ T;  4J9H A;  4Y28 E;  1Y96 A;  2P84 A;  1UGR B;  2RHZ A;  2YHT A;  5J3B A;  3L1A A;  1QVF P;  2V8I A;  2DM1 A;  1M8M A;  3JV3 A;  1QW1 A;  2K5L A;  2EQI A;  3JSC A;  2K9G A;  1V76 A;  2FRY A;  2F1L A;  4DOW A;  1P92 A;  4FW1 A;  1ZA2 B;  4EMK A;  4CI0 C;  4EMG A;  2JUF A;  2C0T A;  5CQX A;  2RK1 A;  1FWZ A;  4EMH A;  1YJW A;  2JS0 A;  1FMW A;  3GLX A;  1IGQ A;  1VQ7 Q;  3A8M B;  1M2O A;  5FU7 B;  2LJ1 A;  5DLO A;  1H64 1;  1Q86 U;  4WTO B;  1K0S A;  1RAD B;  2PQW A;  2O01 E;  2J06 A;  5A0L A;  4CC2 A;  2CT3 A;  1KD1 C;  4B9W A;  2QI2 A;  3ZL7 C;  4JLI A;  3UF4 A;  2G6F X;  3P8B B;  1UGV A;  5GAO p;  3A8L B;  1NJI C;  1H3H A;  3RKW A;  2M51 A;  2QG9 B;  1YJW Q;  1VYU A;  4ZGD B;  1TOV A;  2JT4 A;  3M0S A;  4C0D C;  3MP6 A;  1WGS A;  1WFW A;  4QVZ A;  1ZUU A;  2LC4 A;  2PZ1 A;  2EFI A;  2JJ9 A;  1TXQ A;  2DVE A;  5IHI A;  4F14 A;  1K73 C;  4DBR A;  2KRO A;  1GCQ A;  4NS5 A;  4M78 C;  3BW1 A;  2EYZ A;  1RAG B;  1VQ8 A;  1C6V X;  3VYH B;  2CP6 A;  4J9I A;  1UJ0 A;  2DEQ A;  2YDL A;  5KCO A;  3OYK A;  1VQ5 T;  1M1K U;  1WXT A;  2FPF A;  4GY5 A;  1M9S A;  3GNG A;  4IKF A;  2J6K A;  3I55 A;  4ANJ A;  3CD6 Q;  2BE9 B;  3J7A F;  1N8R R;  2EAY A;  2DL5 A;  5HCK A;  1E6G A;  5GAM j;  3HRS A;  3OB9 A;  4DA4 A;  3PFS A;  2GTJ A;  2RM4 A;  1AWJ A;  4J9E A;  3PVQ A;  5LJ3 h;  1JQQ A;  3M4G A;  2PVG B;  2YRD A;  4MDW A;  6AT1 B;  1VQ8 Q;  4N4I A;  3FC3 A;  3VS4 A;  9ATC B;  1UGS B;  2RI2 A;  2RQR A;  2VV5 A;  3PIP A;  3KFV A;  1WQ7 A;  5L23 A;  4C0G A;  1NG2 A;  2NUT A;  4F7U E;  4LE9 A;  3I55 Q;  4ME7 A;  1XQH A;  1HK9 A;  2IIM A;  2FPE A;  4P5N A;  2DL8 A;  3UT1 A;  3NTI A;  2HQE A;  2EJ9 A;  2PNI A;  1JBM A;  2JTM A;  1NLP C;  1SKU B;  4RTX A;  2KRS A;  1D0Y A;  3VS0 A;  3V8K A;  1VQO T;  3DB3 A;  4OVA A;  1HXD A;  2DNU A;  2DIG A;  2LT1 A;  2HMA A;  4PFZ A;  1NLO C;  3QJ6 A;  4PFP A;  1VQK A;  3AT1 B;  1EFN A;  1OQK A;  2P4R A;  3M0T A;  2DJZ A;  2QQR A;  2HL5 C;  2X4J A;  1NBE B;  2CP0 A;  2M0O A;  3QG1 A;  1YIT A;  3OBY A;  5GAM e;  4ESR A;  2QAZ A;  1K76 A;  4J9C A;  3CC4 A;  1M8V A;  3MJX A;  4IUR A;  2VVK A;  2NUP A;  1K9M U;  4RTV A;  5LJ5 j;  2VGM A;  1NYG A;  2K3B A;  3HFN A;  4M7D G;  1GXI E;  1VQK T;  3DLL A;  3X24 B;  4L6V 5;  1RAB B;  1OX8 A;  2OTL T;  4BDZ A;  2EW3 A;  2RHU A;  4HKE A;  1VQL A;  2YUQ A;  1YIT T;  1VQ4 T;  4X9D A;  3PTA A;  2KNB B;  4D6W A;  3A5Z B;  1S72 A;  1WPY A;  1VQP T;  2JNG A;  1IO6 A;  3CC4 Q;  5KYU A;  2E1H A;  2A7Y A;  1BI1 A;  4F7U F;  3QWY A;  1BI3 A;  4OMM A;  1YJN A;  3RER A;  4M7D B;  3QWX X;  1GFC A;  4OMQ A;  1YI2 Q;  2RB6 A;  5GAN 4;  2HNI A;  1YJ9 A;  2NYS A;  5GAN d;  3CCE Q;  4IIM A;  1D0Z A;  1GRI A;  2O88 A;  2DRK A;  1SF9 A;  3CCU Q;  1VQL Q;  1D3B B;  4EDU A;  3CPW A;  3ZBD A;  3MEW A;  1MV3 A;  5A0G A;  1ZQ1 A;  2DE0 X;  2VUB A;  4E7S A;  1S72 Q;  4JZ3 A;  2JM8 A;  5IXB A;  2NLU A;  2ZPF B;  3CMA A;  3CEY A;  1YBY A;  2LDM A;  4C8Q E;  2JM9 A;  1YJN Q;  1AHJ B;  1TH7 A;  3M56 A;  1YJ9 T;  2C0I A;  2R5M A;  2PU9 B;  2EKH A;  4KRT A;  1C0M A;  3QXE B;  1Q81 C;  2DXC A;  3M0Q A;  2QGF B;  3QKJ A;  2E70 A;  3SHW A;  3CC7 Q;  2GQI A;  5GMK l;  3MPU B;  1GFD A;  2M0Y A;  2HBW A;  4R55 A;  2EIF A;  4AT1 B;  2F5T X;  2HCK A;  2ROT A;  4F7U B;  3DB4 A;  5CKF A;  1ZSZ A;  1D09 B;  1O9S A;  3CMA Q;  1LCK A;  3M0P A;  4C92 C;  2JOY A;  5GAO m;  1Q7Y C;  1M90 R;  5KYY B;  2XD0 A;  3OYY A;  4XU1 A;  3G71 T;  3ZFJ A;  3X20 B;  4M4Z A;  4JJN K;  4BUG A;  5L8R E;  1OEB A;  5LJ3 j;  5GAN f;  3LWI A;  2CUD A;  4BDY A;  4OMO A;  1N9S A;  2X4X A;  2IG0 A;  4QW2 A;  2W0Z A;  1WHJ A;  4OB2 B;  2RMO A;  2I2L A;  4J9F A;  1WJR A;  1N8R U;  3JCM c;  2KY9 A;  2LJ3 A;  1YIJ A;  1JRI A;  3REB B;  2K3Y A;  1X43 A;  2LRQ A;  5I21 A;  2GQV A;  3OY9 A;  1D3B A;  2ZPB B;  3VRZ A;  4N4G A;  5KE3 A;  1M3A A;  4MMK A;  2CP2 A;  1OI1 A;  1G3T A;  2X3W D;  2RJC A;  2DMO A;  2AKK A;  4C8Q F;  4XU0 A;  4JDS A;  4PJM A;  2DFU A;  2KRN A;  5GMK i;  2SEM A;  3CME A;  3RBB B;  1LJO A;  1T3S A;  1G3S A;  1E6H A;  3T9N A;  1YIJ Q;  4ELZ C;  3QYG B;  4NL3 A;  3GNF B;  3JCM g;  3ULR B;  5FLX E;  1YCY A;  1LPL A;  1TWB A;  4F16 A;  2JS2 A;  3N5B B;  1LOJ A;  2CZ0 B;  2D9T A;  2J6F A;  1B7T A;  1LVK A;  1IHW A;  2M16 A;  4C8Q G;  2FB7 A;  4F7U A;  1W70 A;  3NFC A;  3I5S A;  1I5L A;  2BZX A;  4DEX A;  1WZO A;  3OYM A;  4OMP A;  1WHG A;  2E3I A;  3VS1 A;  3MEV A;  3CME Q;  2NWM A;  3SWN C;  2RHY A;  1IRE B;  1B07 A;  3EGX B;  1VQ9 A;  5FRN A;  2CZ1 B;  3M4Y A;  1TUG B;  4C8Q B;  2L89 A;  1ZBJ A;  2DTI A;  5I11 A;  3OMC A;  4C5E A;  1W1F A;  2MPX C;  1VQ6 A;  2W10 A;  2X35 A;  5J26 A;  5AT1 B;  3OQ5 A;  1IB8 A;  2K57 A;  2ZGW A;  3SEM A;  3OYL A;  5GJW B;  1MHN A;  1NPP A;  2KXD A;  1KJW A;  3IQL A;  3OA6 A;  1KQ2 A;  2YSQ A;  4BY6 C;  1VQ9 Q;  1MNE A;  3HPW A;  2A08 A;  2OTJ T;  3EHR A;  4BI4 A;  2XK0 A;  2XI9 A;  1TS9 A;  4HT9 A;  4IUU A;  4PJO C;  4PK4 A;  4OB0 B;  3I56 Q;  5GMK e;  3CCL A;  4HA8 A;  4MZT A;  4UC4 A;  5D6W A;  1Q82 C;  1QKX A;  3ER0 A;  1VQ6 Q;  3EG9 A;  1PWT A;  3BE3 A;  1JJ2 P;  1QWF A;  4LNP A;  2VAS A;  3JCM V;  2DAQ A;  5I2M A;  4C5G A;  4M77 D;  2H3E B;  4FT4 A;  3M9Q A;  2HKQ B;  1QVF S;  2B8A A;  2ED1 A;  1XNI A;  3CQT A;  1V1C A;  1QP3 A;  4J83 A;  3CCM A;  3H6Z A;  3CCL Q;  3L2V A;  4ZNX A;  3EGX A;  1VQM T;  1K8A C;  1VOM A;  3CXC A;  2K6D A;  2D8J A;  4EMK B;  5KYW B;  3OYA A;  1WHK A;  7AT1 B;  1NJI R;  1CSK A;  1BKB A;  1WHL A;  2QYZ A;  2DLP A;  2K4Y A;  5FWC A;  3CCJ Q;  2X3X D;  3ASK A;  4M75 D;  5LJ5 g;  1OU9 A;  2AZV A;  2DL7 A;  2OAU A;  1GCQ C;  2X4W A;  4M78 D;  3LH5 A;  3CCR T;  1ACM B;  2VB6 A;  5GAO r;  3CCM Q;  4M77 E;  1OU8 A;  3O8V A;  2DZ9 A;  4KT0 E;  3NTK A;  3FEO A;  1OYX A;  3S3N A;  1PD0 A;  3C12 A;  2XG8 D;  4FIB A;  3JAM E;  4LDW A;  1B34 B;  2CP3 A;  1Y07 A;  2GBQ A;  2FZK B;  1KSW A;  2YLC A;  1KQS A;  4RUG A;  3FRN A;  5FW9 A;  4C0Z A;  2KE9 A;  4HVW A;  1AOJ A;  2DZC A;  2WSC E;  4J6X A;  8AT1 B;  4WF2 A;  3QDF A;  1Z9Q A;  4J9B A;  2L5Q A;  1FYN A;  1VA7 A;  1KFZ A;  4M75 E;  5FU7 C;  5GAN h;  2F5K A;  5FRO A;  3A1P A;  3WVE B;  1VQ7 A;  1BU1 A;  2ZPI B;  3VJP A;  3P8H A;  4KBM B;  4RTY A;  3OYD A;  4M7A E;  1K4U S;  3PNW C;  1OZ2 A;  4XTY A;  1PRL C;  4IUP A;  1I07 A;  2MIO A;  1LNX A;  2ROL A;  1UFF A;  3SB2 A;  3BDL A;  1AD5 A;  2LNV A;  2QXF A;  2RH2 A;  2QTV A;  1FXX A;  1SEM A;  5DLQ E;  2C0O A;  3DLM A;  1RUW A;  4CRI A;  2MMP A;  2MF2 A;  5KYW A;  3MP1 A;  4ATO A;  1KC8 C;  3EFR A;  4KUI A;  2DER A;  2F2X A;  1VQ7 T;  1TG0 A;  5KYX A;  5GAO q;  2JZ2 A;  1XOV A;  2GF7 A;  3INZ A;  4LUE A;  1SHF A;  4J6Y A;  2AKL A;  1M1K C;  3QHS A;  2KYM A;  1MMA A;  3CPW P;  4HCC A;  3A8H B;  4M77 F;  4Z89 A;  1WQW A;  2M02 A;  2JMC A;  2KRM A;  4PJL A;  1AEY A;  1JEG A;  3FJP A;  5HKC A;  2NUT B;  3DKM A;  3LLR A;  5LJ3 g;  1VQN A;  2K79 A;  1YJW T;  3CBP A;  1B34 A;  1C1A A;  3EG0 A;  1H3Z A;  3LX7 A;  1AWW A;  3OYH A;  2V1Q A;  3QII A;  3CD6 A;  5CKD A;  3X25 B;  2L3S A;  1X75 C;  1YWO A;  2JW4 A;  4FU6 A;  1R77 A;  2QGG A;  4M75 F;  4JRK A;  3VKI A;  3VUZ A;  2KSS A;  4CC7 A;  4M7A F;  3LGF A;  3VS5 A;  3OW2 P;  2K7A A;  2BUD A;  4E7I A;  4OMF B;  2RA2 A;  2HSP A;  3FLG A;  4J7I A;  4O6J A;  4DBF A;  1UJY A;  1WLP B;  2EQM A;  5HK3 A;  1VQN Q;  1QVG A;  2NUP B;  5HY6 A;  5GAN 7;  3CD6 T;  2QQ9 A;  1JJ2 A;  2AT1 B;  3QZ9 B;  4M77 B;  1X2K A;  3G4S A;  2FG0 A;  4LDX A;  3OYJ A;  2D1X A;  4II1 A;  4M7A G;  2DPP B;  5IN1 A;  4RTW A;  1VQ8 T;  2X4Y A;  4FL6 A;  2WSE E;  1BBZ A;  3JCM e;  4OB3 B;  2ABL A;  4N0A A;  3OYN A;  4YTL A;  5KYU B;  2KR3 A;  3JCM d;  1K9M C;  3EHQ A;  4ZN3 A;  1NEG A;  1PM3 A;  3I55 T;  4Q5W A;  4O5V A;  2QK0 A;  4M75 B;  2RI5 A;  3LYI A;  3C0C A;  4BE2 A;  1NJI U;  3G4S Q;  3J80 E;  1CKB A;  4M7A B;  3JB9 H;  2F69 A;  3PMI A;  1MMN A;  1HSQ A;  2CH4 W;  1ABO A;  1YHQ A;  1U1T A;  4JRQ A;  3PIO A;  4FYY B;  1VUB A;  4C92 D;  2EBP A;  1G3Y A;  2CH4 A;  2CRE A;  3RDV A;  4XTV A;  2EGA A;  2FZG B;  3QDR B;  1H92 A;  2KQW A;  3E9G A;  5IXF A;  4LUD A;  2EWN A;  3VS6 A;  1QCF A;  2KI7 A;  2QA4 Q;  1H8K A;  4BI3 A;  1QWE A;  3GIB A;  1PKT A;  1VQO Q;  4M7D C;  4QQD A;  3X26 B;  4DOV A;  2YUO A;  1YHQ Q;  1AWX A;  4PFO A;  3X28 B;  3OYG A;  3FB9 A;  5GAM d;  4KGV B;  5EC7 A;  4E7J A;  2VKN A;  4HVV A;  2LTO A;  4M77 A;  2GFA A;  4A4E A;  3S3O A;  1YI2 A;  1ZSZ B;  3JB9 D;  3CCE A;  2RD1 A;  4C5I A;  1N5Z A;  1TSF A;  1U1S A;  3CCU A;  2DA9 A;  2K5F A;  1TUC A;  2LVM A;  4DEY A;  3NGP A;  4C92 E;  1ZLM A;  4Z8A A;  4FW2 A;  3CC4 T;  1W2B S;  3ZEH A;  5GMK h;  1MND A;  4BAC A;  3A98 A;  2XMF A;  3HFO A;  5LL6 S;  4L5G A;  4A53 A;  2A36 A;  1U8R A;  1ZX6 A;  3UA7 A;  3EG3 A;  1YI2 T;  4M75 A;  3CCE T;  3EH2 A;  5CCA A;  1SPK A;  3UA6 A;  4MDX A;  3CCU T;  1VQL T;  2RN8 A;  4LDY A;  4D8D A;  4M78 A;  4M7A A;  3CC7 A;  2H8H A;  3HL8 A;  3PGG A;  1PRM C;  2DTO A;  3RES A;  1S72 T;  3PVL A;  5CK9 A;  4GBQ A;  1D1B A;  2RF0 A;  1YJN T;  4F7U G;  2FPD A;  5IT9 E;  2Y4X A;  2CSI A;  4OGE A;  1OPL A;  3QBY A;  5LJ5 e;  1F1B B;  1YNZ A;  1PKS A;  3UDC A;  1RAH B;  5GAM f;  3CBM A;  5KCH A;  2EVR A;  2L3R A;  1IGU A;  3LW5 E;  4J7F A;  1Q95 G;  2M1H A;  3CC7 T;  3LH0 A;  2DBK A;  5LJ5 d;  1PSE A;  1WJQ A;  2L0A A;  2K2M A;  2HKN A;  2VGN A;  1WX6 A;  4E7K A;  1IHV A;  3CXC P;  1IRX A;  2DD4 A;  3CMA T;  4C5H A;  2X51 A;  1V29 B;  3C94 A;  3OW2 A;  3QO3 A;  5IH2 A;  2KVQ G;  2DL3 A;  4C92 F;  2C06 A;  3EG1 A;  3OS1 A;  3A8O B;  1M30 A;  1QVP A;  3QPH A;  4KGX B;  2R58 A;  1RAA B;  4IUT A;  2D0N A;  4JJD A;  1D0X A;  1UEC A;  2ZPG B;  3CBO A;  1OUL A;  4PJO D;  3G6E A;  3CCS A;  2P0K A;  5A0D A;  4J6W A;  2PVO B;  1GBR A;  1ARK A;  3THK A;  1Q82 R;  4HCB A;  1T0H A;  4RMO A;  2Y90 A;  2COZ A;  3UAT A;  3URG A;  5CO7 A;  4A4G A;  2MWO A;  2E5K A;  1KQS P;  3E2U A;  3VUB A;  1U5S A;  1N9R A;  5CKB A;  4PLL A;  3VS2 A;  2E12 A;  4OP0 A;  3SD4 A;  3UPU A;  3JCM J;  3NPF A;  5IAY A;  3G6E Q;  2FL7 A;  5GAN 2;  2YUN A;  3EGU A;  1YIJ T;  3CCS Q;  5CKH A;  1SRL A;  1WIE A;  1ZBX A;  2F2V A;  3BY7 A;  1K8A R;  2NUZ A;  4C92 B;  4MZP A;  1BCM A;  2MOX A;  4PJO E;  3EG9 B;  4C8Q C;  5FWB A;  2K5I A;  1XTD A;  4JJB A;  3HP9 A;  4C0F A;  4GLM A;  1RLP C;  2RQU A;  2D0Q B;  2YRC A;  4ZGJ B;  3Q1J A;  5LJ3 e;  3TSW A;  1G2B A;  4J8O A;  3GOX A;  2GCX A;  4LD6 A;  2YXY A;  3CME T;  1AVZ C;  1WYX A;  5FU6 C;  5LJ3 d;  3JB9 J;  3OYB A;  2HQH A;  1JXM A;  3E9F A;  3OBW A;  1IZ6 A;  5ECA A;  4J5Y A;  4J9G A;  2HDA A;  2CS7 A;  2D8H A;  3RKX A;  4ZN1 A;  1KHC A;  1PD1 A;  4X34 A;  1Y57 A;  1QMC A;  2FRW A;  2LJ0 A;  2YT6 A;  1MV0 B;  2DET A;  2FO0 A;  3E1S A;  3I56 A;  1CKA A;  5M9O A;  1BI2 A;  4JUV A;  5CQY A;  1UUE A;  2CP5 A;  3JCM X;  3M5A A;  2KT1 A;  4E2F B;  1FX7 A;  1VQ9 T;  4XTW A;  4XK8 E;  2LT4 A;  2O9S A;  4RG8 A;  3JCM W;  1PHT A;  2L3Q A;  2DIQ A;  1SRM A;  2GTO A;  3TSZ A;  2LNH B;  4QQG A;  3I56 T;  4XTX A;  2DEU A;  1W4S A;  4PJO F;  3MP8 A;  4FCY A;  2ZCF B;  1VQ6 T;  3GPL A;  1MUZ A;  4C92 A;  1HJD A;  2JN0 A;  3FJ5 A;  3MET A;  5C0M A;  3JCM h;  4EMK C;  3QUI A;  1QVG P;  4RG2 A;  3EG2 A;  2KYB A;  4OGC A;  1KC8 R;  2MWP A;  1UGP B;  2HL3 A;  4EPC A;  4AMC A;  5GJV B;  3OS0 A;  3VS3 A;  3CCJ A;  2QEX A;  1MMD A;  1G5V A;  4KGZ B;  1SSH A;  1JO8 A;  1YN8 A;  2JVV A;  3BDU A;  3CCL T;  4BE0 A;  4FT2 A;  2HD0 A;  1GL5 A;  1KD1 R;  5D6X A;  3JCM Q;  2HZY A;  2DJQ A;  5GAN g;  4AFS C;  4PNO A;  2DO3 A;  1WDX A;  4KH0 B;  2AZS A;  2DK3 A;  2RO0 A;  3M0U A;  1GBQ A;  1X01 A;  3M55 A;  1TUD A;  3CCJ T;  2J05 A;  1BCO A;  4L59 A;  4JRP A;  4BY6 B;  5KYX B;  2QEX Q;  1IXD A;  2FHD A;  1B3Q A;  3TEE A;  4AFZ C;  1M90 U;  1FMV A;  2CT4 A;  2DKG A;  2RJE A;  1K73 R;  2XDP A;  5GAM h;  4R0K A;  4FYW B;  3CCM T;  3HHT B;  4HVU A;  3CCV A;  1UB4 A;  3RR6 A;  4E47 A;  1J3T A;  2G3R A;  2EYQ A;  4IUQ A;  1ZA1 B;  2OX7 A;  4LN2 A;  4FM4 B;  1RL2 A;  1VIF A;  1Q82 U;  1G3W A;  4E6R A;  2V8K A;  2V26 A;  3V7S A;  3V8J A;  2LCC A;  5D7U A;  3CCQ A;  1Q86 C;  3VV0 A;  3L2W A;  1M3C A;  2XU8 A;  3SWN A;  3L2U A;  3EAE A;  8ATC B;  3GP8 A;  4XU3 A;  1I81 A;  2L8D A;  3CCV Q;  3CC2 Q;  4N0A C;  2DYB A;  3RNJ A;  1Y0M A;  4QQ6 A;  1QLY A;  1U06 A;  5AYF A;  4M78 E;  5I22 A;  1YP5 A;  3MO8 A;  1WNL A;  4OML A;  1VYT A;  4OB1 B;  1XJW B;  2FZC B;  3L42 A;  4AFQ C;  3UWN A;  1K8A U;  4XTU A;  4X9C A;  4A63 B;  2QDL A;  1BI0 A;  3JRZ A;  3CCQ Q; 
#chains in the Genus database with same CATH homology
 2QEX Q;  3CCE Q;  1YIT Q;  1VQO Q;  3CMA Q;  3CD6 Q;  1QVF P;  1VQ6 Q;  1VQ4 Q;  1QVG P;  3CCU Q;  1YJ9 Q;  1N8R R;  1VQL Q;  3G6E Q;  1M90 R;  1YHQ Q;  1Q82 R;  1KC8 R;  3CCL Q;  1KD1 R;  1K9M R;  3CC4 Q;  3OW2 P;  1W2B P;  1K73 R;  1VQP Q;  3I55 Q;  3CCS Q;  1JJ2 P;  1VQ7 Q;  1Q81 R;  3CC7 Q;  1VQ9 Q;  3G71 Q;  1YIJ Q;  1Q7Y R;  3CCR Q;  1VQM Q;  1S72 Q;  1VQK Q;  3CCM Q;  1K8A R;  1YJW Q;  3CPW P;  3G4S Q;  3CC2 Q;  3CME Q;  1KQS P;  1VQN Q;  1NJI R;  1Q86 R;  1VQ8 Q;  2QA4 Q;  2OTL Q;  2OTJ Q;  1VQ5 Q;  3CXC P;  1YI2 Q;  1M1K R;  1YJN Q;  3I56 Q;  3CCV Q;  3CCJ Q;  3CCQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...