1VQOQ

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqoQ00
2QEXQ 3CXCP 3I55Q 1YITQ 1Q7YR 1VQKQ 1KQSP 1M1KR 3CCQQ 1VQMQ 3CCVQ 3CCUQ 1VQOQ 1VQ7Q 3CCMQ 1K8AR 3G71Q 3OW2P 1VQPQ 1KC8R 1VQLQ 3G6EQ 1K73R 3CMEQ 1N8RR 1KD1R 2OTJQ 1YJ9Q 3CC4Q 1YHQQ 1QVGP 3CC2Q 1Q86R 1YIJQ 1M90R 3G4SQ 1K9MR 3CC7Q 2OTLQ 1YJWQ 3CCSQ 1NJIR 3CPWP 3CCRQ 1Q81R 2QA4Q 1YJNQ 1JJ2P 3CMAQ 3CCJQ 1VQ4Q 1VQ6Q 1VQ9Q 1S72Q 1Q82R 1YI2Q 1VQNQ 3CCEQ 1VQ5Q 1QVFP 1VQ8Q 3CD6Q 3I56Q 1W2BP 3CCLQ
chains in the Genus database with same CATH superfamily
4M75E 4BB7A 4C8QF 2L5QA 1WGSA 2JJ9A 2LQWA 3UWNA 1AEYA 2RH2A 4OMLA 5J26A 3CC4Q 3LH5A 1Y57A 2HQEA 3A1PA 1VA7A 3OYBA 5LJ3e 2K3YA 1Z9QA 3QO3A 3OYCA 3KXTA 4ZNXA 3EGDB 1Q82C 2SRCA 2CZ6B 2HEQA 2RK1A 3VRZA 4A4GA 3OB9A 1PM3A 1LCKA 1FX7A 1X69A 3OYMA 2FYKA 2G6FX 1JU5C 2DYIA 2L3QA 2YDLA 5FWBA 1VQLQ 2YXYA 4J7FA 3NMZC 2KAFA 5GAN6 4JS5A 5IHNA 1QCOA 4IUUA 3GLXA 2O9SA 3S3MA 3C94A 1E7OA 5IXBA 2MAMA 4M75C 5DLOA 3PGGA 4RCCA 5IHIA 3HRSA 1K73U 4OGEA 1PKSA 2HKNA 4JUVA 4BUGA 5LJ5d 3OS1A 2DM1A 3INZA 4QQ6A 4RTZA 1G3WA 2O9VA 2ZAEA 3CCUT 2QQ9A 4PJOG 4BY6B 3QZ5B 2COWA 2PUOB 3P8BB 1UJ0A 2CUDA 2K57A 1YFNA 3EH1A 2AKLA 1KQ1A 3HRTA 4QT7A 4J9IA 2DA9A 3PNWC 1VQNT 2FPDA 2YT6A 1VQ5T 3QYHB 5CKDA 2EIFA 4LN2A 3EG0A 1X6OA 2W0ZA 3X26B 2FB7A 1WXBA 1JBMA 5GMKl 3VJPA 2E4HA 3JSCA 2DE0X 4FU6A 4PJJA 1Y07A 2VC8A 1QLYA 2KY9A 2P84A 3SWNB 5LJ5f 5A0GA 2QDYB 4PJMA 2E64A 2CH4A 1AWXA 2CGHA 3OS5A 1KHIA 4M77C 2A0FB 3SD4A 1RAEB 4M4ZA 3BY7A 1AWJA 3C0CA 1UHFA 1NYGA 3CXCP 2CP6A 1QVFA 4PJOA 4Z88A 5AYFA 4JRIA 5FU6B 1AWOA 1G3YA 1WHMA 1B34B 4Z02A 3JCMh 2MWOA 2YLBA 2E3HA 2HL5C 1I4K1 1XNIA 2FRWA 2O88A 2LT1A 1QP2A 2LC4A 3RNJA 3V7SA 3IQLA 5KYWB 5GMKe 1OQKA 4IKFA 2YUNA 3EG3A 2EYXA 1W70A 1R77A 1YHQA 4PJOD 1ZBJA 2CUBA 4F7UB 4X34A 1VQMT 5CVIA 5GMKm 1GCQC 4IIMA 2YUPA 1VYUA 4MDXA 2XDDA 4WCIA 1Q81R 2D8HA 2ZZDA 3MJXA 2RHXA 1YCYA 1NEGA 4DA4A 3CD6Q 2LMJA 2DXBA 2O01E 5KYUB 3KFVA 5L23A 8ATCB 3HKSA 4WTOB 4E7IA 1VQOQ 1T0JA 4C8QE 2DIQA 2CZ1B 3J81E 4CRIA 1S1NA 4DOVA 4CC3A 2Y4XA 4Y91A 3H6ZA 4J5YA 2L8DA 1PRLC 2HSPA 4C92B 2G3RA 1RLPC 5FLXE 2LDMA 5J3BA 2VXFA 4N4GA 1AT1B 4M77G 3X20B 2DRMA 2COYA 4ANJA 2ZPBB 5GMKi 3PTAA 2JM9A 1DJ7B 3L2WA 3G4ST 1D1CA 4F04B 4IUVA 1UHCA 5CKHA 3CCMA 4DBHA 1W6XA 2P0PA 1SPKA 2RHIA 2LZ6B 4TVRA 2IPOB 2V8JA 3EFOB 3REBB 5GAOl 1SRMA 1K4US 1G3SA 1M1FA 1RI9A 4E47A 2LNHB 1PSEA 4J9CA 3JCMQ 4ME7A 2RMOA 2LP5A 1X43A 2KXCA 1MHNA 1NZ9A 1S72A 1Q95G 2KNBB 1BCMA 3I5RA 4XU2A 1NJIR 2JVVA 3OYGA 2PVOB 2RQVA 2RNAA 1TH7A 2DNUA 1H3ZA 1T3SA 2EKHA 5GAMe 2DX1A 4M77A 4M78G 4LE9A 3TREA 2E12A 4NS5A 4Q5WA 2L3PA 1AZEA 4HVWA 4LDWA 1AOJA 4AG1C 2YLCA 3A8LB 3SEMA 2QA4T 5GAN3 4OGCA 1K8AU 3JCMc 3A98A 1ZHIA 3QSUA 3I56T 3A8MB 3I55T 3CXCA 5GAOm 3RMSA 1IHWA 4M77D 1ZA1B 1YJWA 1RADB 5I21A 2HNIA 3WVEB 2OI3A 3QDFA 3M0SA 4BY6C 2KROA 4M7AE 2LRQA 3PT9A 1RUWA 1WX6A 1PSFA 4DBRA 2QQBA 3L2QA 3OBYA 1IB8A 3L42A 1N27A 4M78A 2O31A 3JCMe 3QUIA 1NG2A 3I9QA 1F1BB 4A53A 2GNCA 3HFOA 2KDSA 2O4XB 2ZPFB 1M8MA 4ELZC 2ABLA 3HRUA 4XU3A 2FPEA 2MCNA 1UGPB 1YITA 4JJCA 4JZ4A 3CCUA 1JXMA 5CCAA 1N8RU 1KJWA 4E7LA 2BZ8A 1VQKQ 4M78D 3E1SA 4J9EA 2X51A 5LJ3j 1M1GA 1K8AC 1GCPA 2DAQA 4M7AC 3NTKA 4BDZA 1VQNA 1VQ5A 1B7TA 5A0DA 1HXDA 4PJOF 1VYVA 1N9SA 3CBPA 3CCRQ 4AT1B 3ZEHA 3AHUA 1T3LA 1ZBXA 3V8LA 3GBQA 2DETA 1H92A 2VKNA 3RIRA 4E7KA 3FJ5A 2HBPA 2EJGA 1U1TA 3EGUA 2J7IA 3TVTA 2DKGA 1VQ4A 1M2VB 1U8RA 4JJBA 5CQXA 3FLGA 3OYYA 2OTLT 3CCST 2JTEA 2P4RA 2NLUA 2IG0A 4F16A 4HCBA 1IZ6A 5I2SA 1N9RA 1V76A 3CCLQ 4L5GA 1MMGA 4LUDA 3ER0A 1YIJA 1R8OB 4BACA 3X28B 3MO8A 3N5BB 2V8KA 3Q1JA 1Q86R 3EGDA 3SB2A 4M75B 5DY9A 2LX7A 3OYNA 1IRXA 5I2MA 5CAIA 2KGTA 1V29B 2QQSA 3AT1B 1SSHA 3THKA 1GXIE 4C92C 2JS0A 1D1AA 3PMTA 3JCMW 3VS1A 2BZYA 5FRMA 1G3TA 2C0OA 1TUGB 5D6XA 3CPWA 2JOYA 1VQPA 1YI2T 2DERA 2CP5A 1KD1U 1LOJA 2CP2A 2RHUA 1JB0E 2RQWA 4Y92A 1WQ7A 5GANh 2QTVA 3BW1A 1JRIA 5GMKj 4C0DC 2OTJT 1YJ9T 2KBTA 3LWHA 5IHKA 3KUFA 3DB4A 3E9GA 1VQ6T 1EFNA 1QQJA 2Y90A 5CIUA 2HQXA 4F7UG 3G4SA 4BE2A 3SWNA 1D0XA 2JTMA 3UA7A 1ZA2B 2ED1A 3EGXB 3X24B 4J7IA 2IVWA 3OYKA 4M77F 1YJNQ 1X2QA 2H3EB 2ZCFB 1ARKA 1WZOA 2DL4A 2KQWA 4EIKA 1S72Q 2KXDA 1K9AA 1Y96A 2E5KA 3QWXX 4HA8A 1XJWB 3M4YA 2P0KA 3PVQA 1PKTA 1B34A 5KE3A 3A8OB 1WIEA 1M8VA 1KC8C 1GBRA 2EWNA 3M57A 3A8HB 3RBBB 2A7YA 1WHJA 2NWMA 4M7DC 2KVQG 1T0HA 1XQHA 2WACA 1SHFA 4PJOE 4BI8B 4ZGDB 3CPWS 2QK0A 5GANg 2LTOA 1OZ2A 4FYXB 3G71A 1C0MA 4C92G 4F7UA 2RJCA 5IAYA 2NUTB 1FMKA 3DLLA 4E7JA 3RESA 1RABB 3REAB 2DJQA 2CS7A 3OSSC 2C0TA 3QKJA 2I2LA 3CCQT 2QA4A 2ENMA 1P92A 2JM8A 3OMCA 2DBMA 2XI9A 3QYGB 4M78F 5GAOn 1M90R 1I5LA 4NOYA 1QKXA 2F2XA 1YJWQ 1TSFA 5KE2A 5KYUA 3LWIA 3CCJT 4C5HA 2E1HA 5KYXB 5FWCA 4PFPA 2HBWA 3MP1A 1PD0A 2BKDN 1HK9A 4CI0C 3E19A 1TOVA 4DBFA 1WPYA 4R55A 4LUEA 1WA7A 3JAME 4F14A 2RN8A 1PCXA 1GFDA 5C6SA 1LNXA 2JS2A 2FZGB 4XAXB 4II1A 2CP3A 3CMAT 3L2UA 4RTYA 1UUEA 2DO3A 2AZSA 1UFFA 1SKUB 1YITQ 1BI1A 1J3TA 3MEAA 3HTRA 4PNOA 2JUFA 2YRDA 2XIDA 1WYXA 4RTUA 2FZCB 5EC7A 1XOVA 2PU9B 1D0YA 1VUBA 4RTWA 4DOWA 3CCEA 1D09B 3MP8A 1ZX6A 3M9QA 1K9MR 3MHXA 4C92D 3EFOA 1D3BB 1QP3A 4MDWA 1WI7A 2QTXA 1TWBA 3FEOA 2V1RA 4M7DG 4OMOA 6AT1B 2AK5A 3CCVT 2KEAA 4HT9A 4OVAA 4RTTA 2GCXA 1QWFA 5GJWB 3TQ7P 1NYFA 2C06A 2QG9B 4A54A 2EJ9A 1VQ4Q 4FYWB 3LYIA 1ZUKA 5HK3A 3RKWA 2B86A 1BU1A 3C12A 5GANe 1M1KR 2OTLA 1TUCA 1K8AR 1M3BA 2CT4A 2ZPIB 2J6FA 5LJ3d 2KSSA 5CKFA 2EGAA 5GAMh 2I0NA 1YIJQ 3CC7Q 2LQNA 4XU0A 2ATCB 2QEXA 2MF2A 1PNJA 4ZTJA 1BK2A 2R5AA 4PK4A 1IO6A 1ZSGA 4IUQA 3CMEA 2RJDA 4JZ3A 3OSVA 4N0AA 1BIBA 1FXXA 4PKCC 2WSEE 4JRPA 3EHQA 3OYEA 4EMGA 1UG1A 1TU0B 2DBKA 2A37A 1LJOA 1AVZC 2MWPA 1FMWA 3CBOA 2R58A 3CC4T 5KYYB 3RR6A 1CKBA 3QIIA 4JLIA 1UJYA 3ZL7C 2RM4A 2Z0WA 5LJ3f 1RLQC 2KRMA 1VQ9T 2NYSA 1G2BA 4M7DD 2FO0A 4M7AB 1HYOA 4HKEA 2O4XA 1VQPQ 1IGUA 3G6EQ 4QQGA 1VQLT 4RTVA 1K73C 2LCLA 1YI2A 3CC2Q 1SSFA 8AT1B 1OPKA 1M2OA 3CQTA 1CSKA 2DFUA 1OX9A 1X27A 5GAMg 1E6HA 1RI0A 4XTYA 1QCFA 5FRNA 2NUPA 4M75G 1PC0A 3TSZA 5FU7C 2X4XA 2PUKB 3NGPA 2X35A 3RERA 4BI3A 4PLLA 4ZGJB 4A4HA 5CKEA 3VUZA 4XTXA 4DBQA 3RKXA 2VGNA 1TTHB 1M2VA 5AT1B 1G5VA 4KGZB 2XDPA 5CK9A 4F7UF 3VKIA 3FC3A 3VU3C 1VQ8A 4RUGA 2DXCA 1HSQA 2L2PA 3SFMA 3JCMg 2YRCA 2E10A 3EG9B 1QVFS 4FSSA 1SF9A 3G71Q 2YRVA 4HCCA 4DQ2A 4M75A 4J6WA 4J9HA 1NLOC 3E9FA 2BUDA 2QQRA 2VYTA 3CEYA 2A08A 3OYHA 1Q7YU 1VIFA 1Z9ZA 2X3XD 2D8JA 2DMOA 2PTKA 4C8QC 2V8IA 3JV3A 5DLQE 1OOTA 1OULA 4C0DB 1KC8R 3FB9A 4M75D 5M9OA 2ZPEB 4OB0B 4J6XA 2MPXC 1NE8A 1BI3A 1Y0MA 4EDUA 4JRKA 4GY5A 3EHRA 3LLRA 4EMKC 1AHJB 2XK0A 1SEMA 3CD6T 3GPLA 2DLPA 2DL7A 2CYZB 2BE9B 2E65A 3ASKA 2FG0A 1VQOT 4IUPA 4OF1A 2JMCA 2HSEB 2RQTA 2F2WA 1I8FA 1V1CA 3NTIA 3CCEQ 2EGCA 4X9CA 2DTHA 4AG2C 1K0SA 3VYGA 4A4FA 3OY9A 2E3IA 1Q7YC 1QW1A 3JB9H 2DXTA 4A63B 2AZVA 4J9BA 2DEUA 4M7DB 3EGXA 2W10A 3M4GA 1UE9A 1X6GA 3CBMA 4PFOA 4EMHA 3DKMA 2GTOA 1JO8A 4MMKA 3NPFA 3WVDB 5CR2A 5D7UA 4LDYA 1GCQA 2NUZA 4FIBA 2JNGA 1EX4A 1WHLA 1FMVA 1W4SA 4KUIA 4QVZA 5I11A 2XICA 1WQWA 2F2VA 2JXBA 4AFSC 4XU1A 2NUTA 1Q82R 4R56A 1MNEA 2DXUA 5GAOq 2EQIA 2PVDB 1PHTA 1BI0A 1UTIA 2QEXQ 4FCYA 1BYMA 1EZZB 3G1JA 4QVCA 1GBQA 1MV0B 1ZSZC 2GBQA 2LCCA 2VVKA 2R57A 3CMEQ 4ORZA 1QVGP 4HT8A 3L2RA 5KYXA 1PD1A 3NHNA 2K2MA 4NL2A 4J9DA 1HD3A 4OMQA 3CXCS 1YP5A 2KYBA 2D0QB 3M0QA 3M0RA 1U06A 1VQ9A 4J83A 1GRIA 1ZLMA 2ROLA 3EAEA 2E6ZA 3T9NA 1WNLA 5GANj 3VUBA 1QWEA 2CT3A 2FEIA 3H0HA 2K3XA 1VQLA 2GQVA 3UATA 2RHZA 2YUOA 3QG1A 1KQSP 3M58A 1Q81U 4QKUA 3JCMf 1N8RC 3M0PA 3QZ9B 4J6YA 2FZKB 4VUBA 4LNPA 4UC4A 2ZGWA 1D3BA 5CKBA 1YHQQ 3OS0A 1G8XA 3ZFJA 4B6MA 3RUXA 3UA6A 1UECA 3JCMP 1VQMA 1B07A 2KK4A 2QQAA 2DEQA 4XTVA 1VQKT 2EJFA 3MCAB 4A4KA 1K73R 3OYFA 3QDRB 2M0YA 3A8GB 1BKBA 5LJ5h 5CO7A 4K11A 4M75F 3CCRT 2DZ9A 1WJQA 1VQ8Q 1O75A 4HVVA 2MIOA 1KG1A 4M7AG 3MEUA 2RO0A 2LX9A 3J80E 2EAYA 3OMGA 3O5ZA 1FYNA 4HXJA 2CSIA 3M53A 2HMAA 3H0FA 2FHDA 3HP9A 4KGXB 4KT0E 3PIPA 4EPCA 2DK3A 3MPUB 2YSQA 1UGSB 3PMIA 4KUDK 1U1SA 1HJDA 2XG8D 4RKUE 3PVLA 2RJEA 3C4SA 2F69A 3CCLT 1MV3A 4FT4A 2DL8A 2CDTA 1NJIU 5C0MA 3CCMQ 3LX7A 5KYYA 2PZ1A 4KRTA 2JW4A 1PG5B 2CP7A 1K0XA 3OS2A 4J9GA 3JCMJ 1RACB 2RQUA 4M7AA 1XTDA 4ATOA 2DTOA 4DEYA 5LJ5g 1YN8A 2CZ7B 3MP6A 5KH6A 1ZUUA 5D6YA 5HY6A 4RG8A 2XU8A 2RK2A 3URGA 2E70A 2CSQA 4NL3A 1D0ZA 2M9UA 1KD1C 4BE1A 3BDUA 3OQ5A 3J7AF 5FU7B 5KYWA 3CD6A 1OPLA 1K76A 1WHHA 2XDBA 4GLMA 2M1HA 4M7AD 3PIOA 2EQKA 4KULA 3OYDA 1OEBA 7AT1B 1X6BA 2R5MA 2ZPGB 1RAFB 2HL3A 1MMNA 1BCOA 1D1BA 2EPDA 2VB6A 1WHGA 2L3RA 2K5IA 3I56A 1NJIC 1C6VX 2RB6A 3I55A 3EG1A 3HHTB 2YWWA 2DL3A 4ZGEB 1I1JA 2KI7A 1C1AA 4L59A 3V7CA 2CH4W 3GOXA 1KQSA 1ABQA 4MZTA 2EBPA 1KQ2A 5CQYA 3JCMV 2GF7A 2P0QA 5IXFA 2KT1A 3M0UA 4PJOC 9ATCB 2SEMA 1SRLA 3H8ZA 3EG9A 2D0NA 1YJNT 4C92A 2E41A 2Y4YA 5GAMj 3GP8A 1S72T 4C8QB 2RI3A 2OAWA 3OYAA 3JB9I 1Q7YR 4E7ZA 5GAN8 2D1XA 1BI2A 3RMQA 3CCUQ 2GQIA 2RQRA 3L1AA 1CKAA 3MEVA 4CC7A 4C0FA 2RA2A 2DF6A 4AFZC 4B9XA 1OV3A 1H641 2P4TA 2MYSA 4P5NA 3HSBA 4RMOA 3DLMA 4EMKB 1YWOA 1X75C 2XKOC 1VQNQ 1Y7XA 1VQ5Q 2A36A 3JCMb 2EQMA 2QXFA 4A4EA 3TU4K 3M59A 2RD1A 1I81A 4X9DA 4QVDA 2BE7D 5LJ5e 3JB9J 2L0AA 4OMPA 3LGLA 2PQWA 2A3LA 2FRYA 2K3BA 2LT4A 4AFQC 1YJWT 1X2KA 1VQ9Q 4AMCA 1TUDA 3S3NA 4ELYC 3M55A 2LVMA 4FW1A 2KR3A 5GAOr 1YWPA 1Q86U 1KQSS 2K6DA 1QMCA 4OB3B 2RI5A 2MK5A 3CCSA 1SG5A 4HVUA 1VQ7T 3META 1BIAA 2FPFA 4J8OA 3JB9G 3TSWA 4RCBA 1B3QA 3GNGA 1LPLA 2DILA 3VS6A 4M77E 1IGQA 2DZCA 4M7DA 1YITT 1VQMQ 2QYZA 2EYQA 2A28A 1NPRA 2EKOA 1UB4A 2J6OA 4LDXA 1NEBA 1M9SA 1VQKA 4Z8AA 2X4WA 3QXEB 1ZUYA 4FYVB 5HK0A 1WXTA 5GANd 4R0KA 1W2BP 2K2VA 2AHJB 1ZSZB 4PJLA 2K9GA 4OMNA 1YNZA 3CCRA 4ZN1A 5IN1A 2M51A 1N8RR 2HDAA 4JS4A 2YUQA 2D9TA 2BIVA 1Q86C 2M16A 4M78E 2WSFE 2JN0A 3C95A 4JJNK 1VQ4T 3JRZA 2ED0A 3VS3A 2L89A 2X9HA 2QGFB 3PFSA 2OTJA 1YJ9A 1X01A 2ROTA 4D8DA 1Y96B 3P8HA 2FL7A 5GANf 4M7AF 1M30A 5LL6S 4FM4B 3JB9D 1VQ6A 1JEGA 5IT9E 3M54A 1KIKA 5FW9A 3G4SQ 3CCLA 1YIJT 3CC7T 1JJ2P 4QW2A 3LH0A 3QWYA 3RDVA 4D6WA 2HD0A 2AT1B 4MZPA 2LJ0A 3M0TA 4PJNA 4N4HA 4QQDA 3OW2P 1GFCA 4E7HA 4LDUA 3LGFA 1MUZA 1UDLA 3A5ZB 1WLPB 2MMPA 4M78C 2LJ3A 4AFUC 2JMAA 1SHGA 2MI6A 4OP0A 2RI2A 3SDZA 3PE0A 2K5FA 2VGMA 1M90U 3H0IA 4KBMB 4LDVA 4E7SA 5GAOp 4Z89A 2K7AA 1UGRB 1VQPT 3G6ET 3V8KA 4C5EA 3CC2T 4DEXA 5HKCA 4YTLA 2QA4Q 4WF2A 1JQQA 4J9FA 4BD3A 2O2OA 4OB1B 2RPNA 1VIEA 1WJRA 4FYYB 3GF5A 3GNFB 3CCQA 2QAZA 3H41A 3I56Q 3BE3A 3DB3A 4O5VA 3I55Q 4C5IA 2DD5A 4BE0A 4C92F 3OYLA 4KGVB 3FJPA 1AZGB 2LQKA 1KD1R 3CCJA 3HL8A 1E6GA 2VV5A 4GLKA 2VASA 2EQJA 3ULRB 1W1FA 4PFZA 4HCZA 3E2UA 4BI4A 1K9MU 2K4YA 4E6RA 2X4JA 1YJNA 1LVKA 3V7RA 3CMAA 1MNDA 2EVRA 2FVUA 4FL6A 1M90C 1ABOA 4V2SA 4FSXA 1MGQA 5ECAA 3TEEA 2HCKA 2MOXA 2KRNA 3HFNA 4IURA 1W2BA 3CPFA 1KSWA 1I5OB 2B8AA 2VUBA 2YHTA 3EH2A 1I07A 4OMMA 3G71T 2VWFA 4PL6A 3UF4A 2JZ2A 3UPUA 3CPWP 1M1KU 2LCSA 4O6JA 3FRNA 3CCVA 2KRSA 1M5Q1 1MMDA 5GAMd 5FROA 3R6OA 1UGQB 2OX7A 3MEWA 1IXDA 1UEBA 3OBWA 4JRQA 2DPPB 4M7DF 1K9MC 2HZYA 2AKKA 2OTLQ 3CCSQ 4XK8E 1MMAA 2OJ2A 1G83A 2J6KA 3L2ZA 3QPHA 4LD6A 1M3CA 1WHKA 1JJ2A 2E6NA 1KHCA 4C8QG 1VQ7A 2J06A 1N5ZA 3VRYA 2DJZA 2ECZA 2EQUA 3OW2A 4PJOB 2CREA 5GAMf 1RL2A 5GJVB 4F7UE 3SWNC 5GAN5 2QDLA 4OMFB 3UDCA 5LJ5j 3JB9F 2BTTA 1NBEB 3CCET 1BBZA 4RTXA 1W2BS 3JCMd 3CC4A 1VOMA 3GIBA 1M1KC 1R0BG 4JDSA 1PRMC 1WJSA 4C5GA 3MKDA 2CP0A 1AWWA 2H8HA 1O9SA 5FU6C 3KBGA 2L3SA 5A0LA 2EYZA 4LD9K 3M5AA 1ACMB 4C8QA 2NUPB 1K1ZA 3FIFA 1YI2Q 1RAAB 4ESRA 2F5KA 3P8DA 3I5SA 3EFSA 3QJ6A 4MZMA 2KMTA 3VV0A 1WXUA 2QASA 2E5QA 4MMLA 3VS7A 1I0CA 3VS2A 2OTJQ 1YJ9Q 4C92E 4EMKA 5DM7R 1RAGB 4C0GA 2PVGB 4C8QD 1U3OA 3EG2A 4FT2A 2IIMA 1JJ2S 1VQ6Q 3RKYA 2KE9A 1KFZA 4XTZA 5L8RE 1NM7A 4KH0B 3BFMA 4L6V5 1M4ZA 2WSCE 1QKWA 2AIRB 1KK7A 2DIGA 2QEXT 3F70A 3CC7A 1TS9A 1QCNA 2DL5A 3OW2S 5GAN2 4KH1B 3TCJA 3CMET 2HQHA 3QHSA 5KCHA 3I35A 2X4YA 1WFWA 3U23A 3D7SB 2PNIA 5LJ3h 1IREB 5EG2A 2K79A 3X25B 2HKQB 4XQ3A 2EFIA 1ZQ1A 2DVJA 4GBQA 2DTIA 2D6FA 5KYNA 3G7ZA 3WXMB 1Q81C 2GFUA 2GGRA 3R6NA 5IH2A 1KC8U 3UT1A 4F17A 2GFAA 2LNVA 3G6EA 3OYIA 1TXQA 4IIOA 1OZ3A 2CZ0B 3O8VA 5J39A 3CC2A 1OX8A 4XTUA 3CCQQ 2F1LA 5GAN7 1A0NB 4JLGA 3EFRA 3FDRA 2EYYA 2VXEA 3V8JA 1M27C 2LQ8A 4HCKA 4PLIA 1FWZA 4M77B 1YHQT 2KT8A 4Y28E 1OU9A 3HPWA 1YBYA 3CCJQ 3QBYA 4M7DE 1ZSZA 3LW5E 4ZTFA 2M0OA 2LJ1A 3NFCA 1WDXA 1NPPA 4C0ZA 1BB9A 1NLPC 2C0IA 2V1QA 1OYXA 4RG2A 3SHWA 5I22A 1QVPA 4X1VA 2DVEA 5LJ3g 3VS4A 2OAUA 4CC2A 1R0CB 4XTWA 1OU8A 1YCSB 4FW2A 4IUTA 1RAIB 1QVGA 1Y71A 2EW3A 1OI1A 2KYMA 3CMAQ 3QJYA 2XHCA 3VS0A 1VQOA 4JPBW 1H3HA 5D6WA 2CKKA 1VQ8T 4N4IA 1EIFA 2EYWA 1M3AA 1AD5A 3NTHA 3VYHB 1N6AA 2XMFA 2QI2A 4M78B 5HCKA 1RAHB 1PWTA 3JCMX 4LXCA 1IHVA 2V26A 2RF0A 2HAXA 4E2FB 2JTFA 1TG0A 4N0AC 3M56A 2M02A 1GL5A 2RJFA 5KCOA 1QVFP 5GMKh 2K5LA 3S3OA 1U5SA 4B9WA 2EGEA 3CCVQ 2X3WD 2DYBA 2ESWA 5A2QE 4JJDA 3CCMT 2H3JA 1Q82U 2GTJA 1JXOA 2JT4A 2QGGA 2ZPHB 4D8KA 3OYJA 3L2VA 3OA6A 5GAN4 4BDYA 2F5TX 2J05A 2DD4A 3BDLA 1VQ7Q 1VYTA 2RHYA 2BZXA 3ZBDA 1QVGS 2DRKA 3VS5A 1UGVA 3ME9A 4ZN3A 4CC4B 3H9NA 4OB2B 2COZA 3S6WA 1H8KA 2XD0A
chains in the Genus database with same CATH topology
2QEXQ 3CXCP 3I55Q 1YITQ 1Q7YR 1VQKQ 1KQSP 1M1KR 3CCQQ 1VQMQ 3CCVQ 3CCUQ 1VQOQ 1VQ7Q 3CCMQ 1K8AR 3G71Q 3OW2P 1VQPQ 1KC8R 1VQLQ 3G6EQ 1K73R 3CMEQ 1N8RR 1KD1R 2OTJQ 1YJ9Q 3CC4Q 1YHQQ 1QVGP 3CC2Q 1Q86R 1YIJQ 1M90R 3G4SQ 1K9MR 3CC7Q 2OTLQ 1YJWQ 3CCSQ 1NJIR 3CPWP 3CCRQ 1Q81R 2QA4Q 1YJNQ 1JJ2P 3CMAQ 3CCJQ 1VQ4Q 1VQ6Q 1VQ9Q 1S72Q 1Q82R 1YI2Q 1VQNQ 3CCEQ 1VQ5Q 1QVFP 1VQ8Q 3CD6Q 3I56Q 1W2BP 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  3CXC P;  3I55 Q;  1YIT Q;  1Q7Y R;  1VQK Q;  1KQS P;  1M1K R;  3CCQ Q;  1VQM Q;  3CCV Q;  3CCU Q;  1VQO Q;  1VQ7 Q;  3CCM Q;  1K8A R;  3G71 Q;  3OW2 P;  1VQP Q;  1KC8 R;  1VQL Q;  3G6E Q;  1K73 R;  3CME Q;  1N8R R;  1KD1 R;  2OTJ Q;  1YJ9 Q;  3CC4 Q;  1YHQ Q;  1QVG P;  3CC2 Q;  1Q86 R;  1YIJ Q;  1M90 R;  3G4S Q;  1K9M R;  3CC7 Q;  2OTL Q;  1YJW Q;  3CCS Q;  1NJI R;  3CPW P;  3CCR Q;  1Q81 R;  2QA4 Q;  1YJN Q;  1JJ2 P;  3CMA Q;  3CCJ Q;  1VQ4 Q;  1VQ6 Q;  1VQ9 Q;  1S72 Q;  1Q82 R;  1YI2 Q;  1VQN Q;  3CCE Q;  1VQ5 Q;  1QVF P;  1VQ8 Q;  3CD6 Q;  3I56 Q;  1W2B P;  3CCL Q; 
#chains in the Genus database with same CATH topology
 4M75 E;  4BB7 A;  4C8Q F;  2L5Q A;  1WGS A;  2JJ9 A;  2LQW A;  3UWN A;  1AEY A;  2RH2 A;  4OML A;  5J26 A;  3CC4 Q;  3LH5 A;  1Y57 A;  2HQE A;  3A1P A;  1VA7 A;  3OYB A;  5LJ3 e;  2K3Y A;  1Z9Q A;  3QO3 A;  3OYC A;  3KXT A;  4ZNX A;  3EGD B;  1Q82 C;  2SRC A;  2CZ6 B;  2HEQ A;  2RK1 A;  3VRZ A;  4A4G A;  3OB9 A;  1PM3 A;  1LCK A;  1FX7 A;  1X69 A;  3OYM A;  2FYK A;  2G6F X;  1JU5 C;  2DYI A;  2L3Q A;  2YDL A;  5FWB A;  1VQL Q;  2YXY A;  4J7F A;  3NMZ C;  2KAF A;  5GAN 6;  4JS5 A;  5IHN A;  1QCO A;  4IUU A;  3GLX A;  2O9S A;  3S3M A;  3C94 A;  1E7O A;  5IXB A;  2MAM A;  4M75 C;  5DLO A;  3PGG A;  4RCC A;  5IHI A;  3HRS A;  1K73 U;  4OGE A;  1PKS A;  2HKN A;  4JUV A;  4BUG A;  5LJ5 d;  3OS1 A;  2DM1 A;  3INZ A;  4QQ6 A;  4RTZ A;  1G3W A;  2O9V A;  2ZAE A;  3CCU T;  2QQ9 A;  4PJO G;  4BY6 B;  3QZ5 B;  2COW A;  2PUO B;  3P8B B;  1UJ0 A;  2CUD A;  2K57 A;  1YFN A;  3EH1 A;  2AKL A;  1KQ1 A;  3HRT A;  4QT7 A;  4J9I A;  2DA9 A;  3PNW C;  1VQN T;  2FPD A;  2YT6 A;  1VQ5 T;  3QYH B;  5CKD A;  2EIF A;  4LN2 A;  3EG0 A;  1X6O A;  2W0Z A;  3X26 B;  2FB7 A;  1WXB A;  1JBM A;  5GMK l;  3VJP A;  2E4H A;  3JSC A;  2DE0 X;  4FU6 A;  4PJJ A;  1Y07 A;  2VC8 A;  1QLY A;  2KY9 A;  2P84 A;  3SWN B;  5LJ5 f;  5A0G A;  2QDY B;  4PJM A;  2E64 A;  2CH4 A;  1AWX A;  2CGH A;  3OS5 A;  1KHI A;  4M77 C;  2A0F B;  3SD4 A;  1RAE B;  4M4Z A;  3BY7 A;  1AWJ A;  3C0C A;  1UHF A;  1NYG A;  3CXC P;  2CP6 A;  1QVF A;  4PJO A;  4Z88 A;  5AYF A;  4JRI A;  5FU6 B;  1AWO A;  1G3Y A;  1WHM A;  1B34 B;  4Z02 A;  3JCM h;  2MWO A;  2YLB A;  2E3H A;  2HL5 C;  1I4K 1;  1XNI A;  2FRW A;  2O88 A;  2LT1 A;  1QP2 A;  2LC4 A;  3RNJ A;  3V7S A;  3IQL A;  5KYW B;  5GMK e;  1OQK A;  4IKF A;  2YUN A;  3EG3 A;  2EYX A;  1W70 A;  1R77 A;  1YHQ A;  4PJO D;  1ZBJ A;  2CUB A;  4F7U B;  4X34 A;  1VQM T;  5CVI A;  5GMK m;  1GCQ C;  4IIM A;  2YUP A;  1VYU A;  4MDX A;  2XDD A;  4WCI A;  1Q81 R;  2D8H A;  2ZZD A;  3MJX A;  2RHX A;  1YCY A;  1NEG A;  4DA4 A;  3CD6 Q;  2LMJ A;  2DXB A;  2O01 E;  5KYU B;  3KFV A;  5L23 A;  8ATC B;  3HKS A;  4WTO B;  4E7I A;  1VQO Q;  1T0J A;  4C8Q E;  2DIQ A;  2CZ1 B;  3J81 E;  4CRI A;  1S1N A;  4DOV A;  4CC3 A;  2Y4X A;  4Y91 A;  3H6Z A;  4J5Y A;  2L8D A;  1PRL C;  2HSP A;  4C92 B;  2G3R A;  1RLP C;  5FLX E;  2LDM A;  5J3B A;  2VXF A;  4N4G A;  1AT1 B;  4M77 G;  3X20 B;  2DRM A;  2COY A;  4ANJ A;  2ZPB B;  5GMK i;  3PTA A;  2JM9 A;  1DJ7 B;  3L2W A;  3G4S T;  1D1C A;  4F04 B;  4IUV A;  1UHC A;  5CKH A;  3CCM A;  4DBH A;  1W6X A;  2P0P A;  1SPK A;  2RHI A;  2LZ6 B;  4TVR A;  2IPO B;  2V8J A;  3EFO B;  3REB B;  5GAO l;  1SRM A;  1K4U S;  1G3S A;  1M1F A;  1RI9 A;  4E47 A;  2LNH B;  1PSE A;  4J9C A;  3JCM Q;  4ME7 A;  2RMO A;  2LP5 A;  1X43 A;  2KXC A;  1MHN A;  1NZ9 A;  1S72 A;  1Q95 G;  2KNB B;  1BCM A;  3I5R A;  4XU2 A;  1NJI R;  2JVV A;  3OYG A;  2PVO B;  2RQV A;  2RNA A;  1TH7 A;  2DNU A;  1H3Z A;  1T3S A;  2EKH A;  5GAM e;  2DX1 A;  4M77 A;  4M78 G;  4LE9 A;  3TRE A;  2E12 A;  4NS5 A;  4Q5W A;  2L3P A;  1AZE A;  4HVW A;  4LDW A;  1AOJ A;  4AG1 C;  2YLC A;  3A8L B;  3SEM A;  2QA4 T;  5GAN 3;  4OGC A;  1K8A U;  3JCM c;  3A98 A;  1ZHI A;  3QSU A;  3I56 T;  3A8M B;  3I55 T;  3CXC A;  5GAO m;  3RMS A;  1IHW A;  4M77 D;  1ZA1 B;  1YJW A;  1RAD B;  5I21 A;  2HNI A;  3WVE B;  2OI3 A;  3QDF A;  3M0S A;  4BY6 C;  2KRO A;  4M7A E;  2LRQ A;  3PT9 A;  1RUW A;  1WX6 A;  1PSF A;  4DBR A;  2QQB A;  3L2Q A;  3OBY A;  1IB8 A;  3L42 A;  1N27 A;  4M78 A;  2O31 A;  3JCM e;  3QUI A;  1NG2 A;  3I9Q A;  1F1B B;  4A53 A;  2GNC A;  3HFO A;  2KDS A;  2O4X B;  2ZPF B;  1M8M A;  4ELZ C;  2ABL A;  3HRU A;  4XU3 A;  2FPE A;  2MCN A;  1UGP B;  1YIT A;  4JJC A;  4JZ4 A;  3CCU A;  1JXM A;  5CCA A;  1N8R U;  1KJW A;  4E7L A;  2BZ8 A;  1VQK Q;  4M78 D;  3E1S A;  4J9E A;  2X51 A;  5LJ3 j;  1M1G A;  1K8A C;  1GCP A;  2DAQ A;  4M7A C;  3NTK A;  4BDZ A;  1VQN A;  1VQ5 A;  1B7T A;  5A0D A;  1HXD A;  4PJO F;  1VYV A;  1N9S A;  3CBP A;  3CCR Q;  4AT1 B;  3ZEH A;  3AHU A;  1T3L A;  1ZBX A;  3V8L A;  3GBQ A;  2DET A;  1H92 A;  2VKN A;  3RIR A;  4E7K A;  3FJ5 A;  2HBP A;  2EJG A;  1U1T A;  3EGU A;  2J7I A;  3TVT A;  2DKG A;  1VQ4 A;  1M2V B;  1U8R A;  4JJB A;  5CQX A;  3FLG A;  3OYY A;  2OTL T;  3CCS T;  2JTE A;  2P4R A;  2NLU A;  2IG0 A;  4F16 A;  4HCB A;  1IZ6 A;  5I2S A;  1N9R A;  1V76 A;  3CCL Q;  4L5G A;  1MMG A;  4LUD A;  3ER0 A;  1YIJ A;  1R8O B;  4BAC A;  3X28 B;  3MO8 A;  3N5B B;  2V8K A;  3Q1J A;  1Q86 R;  3EGD A;  3SB2 A;  4M75 B;  5DY9 A;  2LX7 A;  3OYN A;  1IRX A;  5I2M A;  5CAI A;  2KGT A;  1V29 B;  2QQS A;  3AT1 B;  1SSH A;  3THK A;  1GXI E;  4C92 C;  2JS0 A;  1D1A A;  3PMT A;  3JCM W;  3VS1 A;  2BZY A;  5FRM A;  1G3T A;  2C0O A;  1TUG B;  5D6X A;  3CPW A;  2JOY A;  1VQP A;  1YI2 T;  2DER A;  2CP5 A;  1KD1 U;  1LOJ A;  2CP2 A;  2RHU A;  1JB0 E;  2RQW A;  4Y92 A;  1WQ7 A;  5GAN h;  2QTV A;  3BW1 A;  1JRI A;  5GMK j;  4C0D C;  2OTJ T;  1YJ9 T;  2KBT A;  3LWH A;  5IHK A;  3KUF A;  3DB4 A;  3E9G A;  1VQ6 T;  1EFN A;  1QQJ A;  2Y90 A;  5CIU A;  2HQX A;  4F7U G;  3G4S A;  4BE2 A;  3SWN A;  1D0X A;  2JTM A;  3UA7 A;  1ZA2 B;  2ED1 A;  3EGX B;  3X24 B;  4J7I A;  2IVW A;  3OYK A;  4M77 F;  1YJN Q;  1X2Q A;  2H3E B;  2ZCF B;  1ARK A;  1WZO A;  2DL4 A;  2KQW A;  4EIK A;  1S72 Q;  2KXD A;  1K9A A;  1Y96 A;  2E5K A;  3QWX X;  4HA8 A;  1XJW B;  3M4Y A;  2P0K A;  3PVQ A;  1PKT A;  1B34 A;  5KE3 A;  3A8O B;  1WIE A;  1M8V A;  1KC8 C;  1GBR A;  2EWN A;  3M57 A;  3A8H B;  3RBB B;  2A7Y A;  1WHJ A;  2NWM A;  4M7D C;  2KVQ G;  1T0H A;  1XQH A;  2WAC A;  1SHF A;  4PJO E;  4BI8 B;  4ZGD B;  3CPW S;  2QK0 A;  5GAN g;  2LTO A;  1OZ2 A;  4FYX B;  3G71 A;  1C0M A;  4C92 G;  4F7U A;  2RJC A;  5IAY A;  2NUT B;  1FMK A;  3DLL A;  4E7J A;  3RES A;  1RAB B;  3REA B;  2DJQ A;  2CS7 A;  3OSS C;  2C0T A;  3QKJ A;  2I2L A;  3CCQ T;  2QA4 A;  2ENM A;  1P92 A;  2JM8 A;  3OMC A;  2DBM A;  2XI9 A;  3QYG B;  4M78 F;  5GAO n;  1M90 R;  1I5L A;  4NOY A;  1QKX A;  2F2X A;  1YJW Q;  1TSF A;  5KE2 A;  5KYU A;  3LWI A;  3CCJ T;  4C5H A;  2E1H A;  5KYX B;  5FWC A;  4PFP A;  2HBW A;  3MP1 A;  1PD0 A;  2BKD N;  1HK9 A;  4CI0 C;  3E19 A;  1TOV A;  4DBF A;  1WPY A;  4R55 A;  4LUE A;  1WA7 A;  3JAM E;  4F14 A;  2RN8 A;  1PCX A;  1GFD A;  5C6S A;  1LNX A;  2JS2 A;  2FZG B;  4XAX B;  4II1 A;  2CP3 A;  3CMA T;  3L2U A;  4RTY A;  1UUE A;  2DO3 A;  2AZS A;  1UFF A;  1SKU B;  1YIT Q;  1BI1 A;  1J3T A;  3MEA A;  3HTR A;  4PNO A;  2JUF A;  2YRD A;  2XID A;  1WYX A;  4RTU A;  2FZC B;  5EC7 A;  1XOV A;  2PU9 B;  1D0Y A;  1VUB A;  4RTW A;  4DOW A;  3CCE A;  1D09 B;  3MP8 A;  1ZX6 A;  3M9Q A;  1K9M R;  3MHX A;  4C92 D;  3EFO A;  1D3B B;  1QP3 A;  4MDW A;  1WI7 A;  2QTX A;  1TWB A;  3FEO A;  2V1R A;  4M7D G;  4OMO A;  6AT1 B;  2AK5 A;  3CCV T;  2KEA A;  4HT9 A;  4OVA A;  4RTT A;  2GCX A;  1QWF A;  5GJW B;  3TQ7 P;  1NYF A;  2C06 A;  2QG9 B;  4A54 A;  2EJ9 A;  1VQ4 Q;  4FYW B;  3LYI A;  1ZUK A;  5HK3 A;  3RKW A;  2B86 A;  1BU1 A;  3C12 A;  5GAN e;  1M1K R;  2OTL A;  1TUC A;  1K8A R;  1M3B A;  2CT4 A;  2ZPI B;  2J6F A;  5LJ3 d;  2KSS A;  5CKF A;  2EGA A;  5GAM h;  2I0N A;  1YIJ Q;  3CC7 Q;  2LQN A;  4XU0 A;  2ATC B;  2QEX A;  2MF2 A;  1PNJ A;  4ZTJ A;  1BK2 A;  2R5A A;  4PK4 A;  1IO6 A;  1ZSG A;  4IUQ A;  3CME A;  2RJD A;  4JZ3 A;  3OSV A;  4N0A A;  1BIB A;  1FXX A;  4PKC C;  2WSE E;  4JRP A;  3EHQ A;  3OYE A;  4EMG A;  1UG1 A;  1TU0 B;  2DBK A;  2A37 A;  1LJO A;  1AVZ C;  2MWP A;  1FMW A;  3CBO A;  2R58 A;  3CC4 T;  5KYY B;  3RR6 A;  1CKB A;  3QII A;  4JLI A;  1UJY A;  3ZL7 C;  2RM4 A;  2Z0W A;  5LJ3 f;  1RLQ C;  2KRM A;  1VQ9 T;  2NYS A;  1G2B A;  4M7D D;  2FO0 A;  4M7A B;  1HYO A;  4HKE A;  2O4X A;  1VQP Q;  1IGU A;  3G6E Q;  4QQG A;  1VQL T;  4RTV A;  1K73 C;  2LCL A;  1YI2 A;  3CC2 Q;  1SSF A;  8AT1 B;  1OPK A;  1M2O A;  3CQT A;  1CSK A;  2DFU A;  1OX9 A;  1X27 A;  5GAM g;  1E6H A;  1RI0 A;  4XTY A;  1QCF A;  5FRN A;  2NUP A;  4M75 G;  1PC0 A;  3TSZ A;  5FU7 C;  2X4X A;  2PUK B;  3NGP A;  2X35 A;  3RER A;  4BI3 A;  4PLL A;  4ZGJ B;  4A4H A;  5CKE A;  3VUZ A;  4XTX A;  4DBQ A;  3RKX A;  2VGN A;  1TTH B;  1M2V A;  5AT1 B;  1G5V A;  4KGZ B;  2XDP A;  5CK9 A;  4F7U F;  3VKI A;  3FC3 A;  3VU3 C;  1VQ8 A;  4RUG A;  2DXC A;  1HSQ A;  2L2P A;  3SFM A;  3JCM g;  2YRC A;  2E10 A;  3EG9 B;  1QVF S;  4FSS A;  1SF9 A;  3G71 Q;  2YRV A;  4HCC A;  4DQ2 A;  4M75 A;  4J6W A;  4J9H A;  1NLO C;  3E9F A;  2BUD A;  2QQR A;  2VYT A;  3CEY A;  2A08 A;  3OYH A;  1Q7Y U;  1VIF A;  1Z9Z A;  2X3X D;  2D8J A;  2DMO A;  2PTK A;  4C8Q C;  2V8I A;  3JV3 A;  5DLQ E;  1OOT A;  1OUL A;  4C0D B;  1KC8 R;  3FB9 A;  4M75 D;  5M9O A;  2ZPE B;  4OB0 B;  4J6X A;  2MPX C;  1NE8 A;  1BI3 A;  1Y0M A;  4EDU A;  4JRK A;  4GY5 A;  3EHR A;  3LLR A;  4EMK C;  1AHJ B;  2XK0 A;  1SEM A;  3CD6 T;  3GPL A;  2DLP A;  2DL7 A;  2CYZ B;  2BE9 B;  2E65 A;  3ASK A;  2FG0 A;  1VQO T;  4IUP A;  4OF1 A;  2JMC A;  2HSE B;  2RQT A;  2F2W A;  1I8F A;  1V1C A;  3NTI A;  3CCE Q;  2EGC A;  4X9C A;  2DTH A;  4AG2 C;  1K0S A;  3VYG A;  4A4F A;  3OY9 A;  2E3I A;  1Q7Y C;  1QW1 A;  3JB9 H;  2DXT A;  4A63 B;  2AZV A;  4J9B A;  2DEU A;  4M7D B;  3EGX A;  2W10 A;  3M4G A;  1UE9 A;  1X6G A;  3CBM A;  4PFO A;  4EMH A;  3DKM A;  2GTO A;  1JO8 A;  4MMK A;  3NPF A;  3WVD B;  5CR2 A;  5D7U A;  4LDY A;  1GCQ A;  2NUZ A;  4FIB A;  2JNG A;  1EX4 A;  1WHL A;  1FMV A;  1W4S A;  4KUI A;  4QVZ A;  5I11 A;  2XIC A;  1WQW A;  2F2V A;  2JXB A;  4AFS C;  4XU1 A;  2NUT A;  1Q82 R;  4R56 A;  1MNE A;  2DXU A;  5GAO q;  2EQI A;  2PVD B;  1PHT A;  1BI0 A;  1UTI A;  2QEX Q;  4FCY A;  1BYM A;  1EZZ B;  3G1J A;  4QVC A;  1GBQ A;  1MV0 B;  1ZSZ C;  2GBQ A;  2LCC A;  2VVK A;  2R57 A;  3CME Q;  4ORZ A;  1QVG P;  4HT8 A;  3L2R A;  5KYX A;  1PD1 A;  3NHN A;  2K2M A;  4NL2 A;  4J9D A;  1HD3 A;  4OMQ A;  3CXC S;  1YP5 A;  2KYB A;  2D0Q B;  3M0Q A;  3M0R A;  1U06 A;  1VQ9 A;  4J83 A;  1GRI A;  1ZLM A;  2ROL A;  3EAE A;  2E6Z A;  3T9N A;  1WNL A;  5GAN j;  3VUB A;  1QWE A;  2CT3 A;  2FEI A;  3H0H A;  2K3X A;  1VQL A;  2GQV A;  3UAT A;  2RHZ A;  2YUO A;  3QG1 A;  1KQS P;  3M58 A;  1Q81 U;  4QKU A;  3JCM f;  1N8R C;  3M0P A;  3QZ9 B;  4J6Y A;  2FZK B;  4VUB A;  4LNP A;  4UC4 A;  2ZGW A;  1D3B A;  5CKB A;  1YHQ Q;  3OS0 A;  1G8X A;  3ZFJ A;  4B6M A;  3RUX A;  3UA6 A;  1UEC A;  3JCM P;  1VQM A;  1B07 A;  2KK4 A;  2QQA A;  2DEQ A;  4XTV A;  1VQK T;  2EJF A;  3MCA B;  4A4K A;  1K73 R;  3OYF A;  3QDR B;  2M0Y A;  3A8G B;  1BKB A;  5LJ5 h;  5CO7 A;  4K11 A;  4M75 F;  3CCR T;  2DZ9 A;  1WJQ A;  1VQ8 Q;  1O75 A;  4HVV A;  2MIO A;  1KG1 A;  4M7A G;  3MEU A;  2RO0 A;  2LX9 A;  3J80 E;  2EAY A;  3OMG A;  3O5Z A;  1FYN A;  4HXJ A;  2CSI A;  3M53 A;  2HMA A;  3H0F A;  2FHD A;  3HP9 A;  4KGX B;  4KT0 E;  3PIP A;  4EPC A;  2DK3 A;  3MPU B;  2YSQ A;  1UGS B;  3PMI A;  4KUD K;  1U1S A;  1HJD A;  2XG8 D;  4RKU E;  3PVL A;  2RJE A;  3C4S A;  2F69 A;  3CCL T;  1MV3 A;  4FT4 A;  2DL8 A;  2CDT A;  1NJI U;  5C0M A;  3CCM Q;  3LX7 A;  5KYY A;  2PZ1 A;  4KRT A;  2JW4 A;  1PG5 B;  2CP7 A;  1K0X A;  3OS2 A;  4J9G A;  3JCM J;  1RAC B;  2RQU A;  4M7A A;  1XTD A;  4ATO A;  2DTO A;  4DEY A;  5LJ5 g;  1YN8 A;  2CZ7 B;  3MP6 A;  5KH6 A;  1ZUU A;  5D6Y A;  5HY6 A;  4RG8 A;  2XU8 A;  2RK2 A;  3URG A;  2E70 A;  2CSQ A;  4NL3 A;  1D0Z A;  2M9U A;  1KD1 C;  4BE1 A;  3BDU A;  3OQ5 A;  3J7A F;  5FU7 B;  5KYW A;  3CD6 A;  1OPL A;  1K76 A;  1WHH A;  2XDB A;  4GLM A;  2M1H A;  4M7A D;  3PIO A;  2EQK A;  4KUL A;  3OYD A;  1OEB A;  7AT1 B;  1X6B A;  2R5M A;  2ZPG B;  1RAF B;  2HL3 A;  1MMN A;  1BCO A;  1D1B A;  2EPD A;  2VB6 A;  1WHG A;  2L3R A;  2K5I A;  3I56 A;  1NJI C;  1C6V X;  2RB6 A;  3I55 A;  3EG1 A;  3HHT B;  2YWW A;  2DL3 A;  4ZGE B;  1I1J A;  2KI7 A;  1C1A A;  4L59 A;  3V7C A;  2CH4 W;  3GOX A;  1KQS A;  1ABQ A;  4MZT A;  2EBP A;  1KQ2 A;  5CQY A;  3JCM V;  2GF7 A;  2P0Q A;  5IXF A;  2KT1 A;  3M0U A;  4PJO C;  9ATC B;  2SEM A;  1SRL A;  3H8Z A;  3EG9 A;  2D0N A;  1YJN T;  4C92 A;  2E41 A;  2Y4Y A;  5GAM j;  3GP8 A;  1S72 T;  4C8Q B;  2RI3 A;  2OAW A;  3OYA A;  3JB9 I;  1Q7Y R;  4E7Z A;  5GAN 8;  2D1X A;  1BI2 A;  3RMQ A;  3CCU Q;  2GQI A;  2RQR A;  3L1A A;  1CKA A;  3MEV A;  4CC7 A;  4C0F A;  2RA2 A;  2DF6 A;  4AFZ C;  4B9X A;  1OV3 A;  1H64 1;  2P4T A;  2MYS A;  4P5N A;  3HSB A;  4RMO A;  3DLM A;  4EMK B;  1YWO A;  1X75 C;  2XKO C;  1VQN Q;  1Y7X A;  1VQ5 Q;  2A36 A;  3JCM b;  2EQM A;  2QXF A;  4A4E A;  3TU4 K;  3M59 A;  2RD1 A;  1I81 A;  4X9D A;  4QVD A;  2BE7 D;  5LJ5 e;  3JB9 J;  2L0A A;  4OMP A;  3LGL A;  2PQW A;  2A3L A;  2FRY A;  2K3B A;  2LT4 A;  4AFQ C;  1YJW T;  1X2K A;  1VQ9 Q;  4AMC A;  1TUD A;  3S3N A;  4ELY C;  3M55 A;  2LVM A;  4FW1 A;  2KR3 A;  5GAO r;  1YWP A;  1Q86 U;  1KQS S;  2K6D A;  1QMC A;  4OB3 B;  2RI5 A;  2MK5 A;  3CCS A;  1SG5 A;  4HVU A;  1VQ7 T;  3MET A;  1BIA A;  2FPF A;  4J8O A;  3JB9 G;  3TSW A;  4RCB A;  1B3Q A;  3GNG A;  1LPL A;  2DIL A;  3VS6 A;  4M77 E;  1IGQ A;  2DZC A;  4M7D A;  1YIT T;  1VQM Q;  2QYZ A;  2EYQ A;  2A28 A;  1NPR A;  2EKO A;  1UB4 A;  2J6O A;  4LDX A;  1NEB A;  1M9S A;  1VQK A;  4Z8A A;  2X4W A;  3QXE B;  1ZUY A;  4FYV B;  5HK0 A;  1WXT A;  5GAN d;  4R0K A;  1W2B P;  2K2V A;  2AHJ B;  1ZSZ B;  4PJL A;  2K9G A;  4OMN A;  1YNZ A;  3CCR A;  4ZN1 A;  5IN1 A;  2M51 A;  1N8R R;  2HDA A;  4JS4 A;  2YUQ A;  2D9T A;  2BIV A;  1Q86 C;  2M16 A;  4M78 E;  2WSF E;  2JN0 A;  3C95 A;  4JJN K;  1VQ4 T;  3JRZ A;  2ED0 A;  3VS3 A;  2L89 A;  2X9H A;  2QGF B;  3PFS A;  2OTJ A;  1YJ9 A;  1X01 A;  2ROT A;  4D8D A;  1Y96 B;  3P8H A;  2FL7 A;  5GAN f;  4M7A F;  1M30 A;  5LL6 S;  4FM4 B;  3JB9 D;  1VQ6 A;  1JEG A;  5IT9 E;  3M54 A;  1KIK A;  5FW9 A;  3G4S Q;  3CCL A;  1YIJ T;  3CC7 T;  1JJ2 P;  4QW2 A;  3LH0 A;  3QWY A;  3RDV A;  4D6W A;  2HD0 A;  2AT1 B;  4MZP A;  2LJ0 A;  3M0T A;  4PJN A;  4N4H A;  4QQD A;  3OW2 P;  1GFC A;  4E7H A;  4LDU A;  3LGF A;  1MUZ A;  1UDL A;  3A5Z B;  1WLP B;  2MMP A;  4M78 C;  2LJ3 A;  4AFU C;  2JMA A;  1SHG A;  2MI6 A;  4OP0 A;  2RI2 A;  3SDZ A;  3PE0 A;  2K5F A;  2VGM A;  1M90 U;  3H0I A;  4KBM B;  4LDV A;  4E7S A;  5GAO p;  4Z89 A;  2K7A A;  1UGR B;  1VQP T;  3G6E T;  3V8K A;  4C5E A;  3CC2 T;  4DEX A;  5HKC A;  4YTL A;  2QA4 Q;  4WF2 A;  1JQQ A;  4J9F A;  4BD3 A;  2O2O A;  4OB1 B;  2RPN A;  1VIE A;  1WJR A;  4FYY B;  3GF5 A;  3GNF B;  3CCQ A;  2QAZ A;  3H41 A;  3I56 Q;  3BE3 A;  3DB3 A;  4O5V A;  3I55 Q;  4C5I A;  2DD5 A;  4BE0 A;  4C92 F;  3OYL A;  4KGV B;  3FJP A;  1AZG B;  2LQK A;  1KD1 R;  3CCJ A;  3HL8 A;  1E6G A;  2VV5 A;  4GLK A;  2VAS A;  2EQJ A;  3ULR B;  1W1F A;  4PFZ A;  4HCZ A;  3E2U A;  4BI4 A;  1K9M U;  2K4Y A;  4E6R A;  2X4J A;  1YJN A;  1LVK A;  3V7R A;  3CMA A;  1MND A;  2EVR A;  2FVU A;  4FL6 A;  1M90 C;  1ABO A;  4V2S A;  4FSX A;  1MGQ A;  5ECA A;  3TEE A;  2HCK A;  2MOX A;  2KRN A;  3HFN A;  4IUR A;  1W2B A;  3CPF A;  1KSW A;  1I5O B;  2B8A A;  2VUB A;  2YHT A;  3EH2 A;  1I07 A;  4OMM A;  3G71 T;  2VWF A;  4PL6 A;  3UF4 A;  2JZ2 A;  3UPU A;  3CPW P;  1M1K U;  2LCS A;  4O6J A;  3FRN A;  3CCV A;  2KRS A;  1M5Q 1;  1MMD A;  5GAM d;  5FRO A;  3R6O A;  1UGQ B;  2OX7 A;  3MEW A;  1IXD A;  1UEB A;  3OBW A;  4JRQ A;  2DPP B;  4M7D F;  1K9M C;  2HZY A;  2AKK A;  2OTL Q;  3CCS Q;  4XK8 E;  1MMA A;  2OJ2 A;  1G83 A;  2J6K A;  3L2Z A;  3QPH A;  4LD6 A;  1M3C A;  1WHK A;  1JJ2 A;  2E6N A;  1KHC A;  4C8Q G;  1VQ7 A;  2J06 A;  1N5Z A;  3VRY A;  2DJZ A;  2ECZ A;  2EQU A;  3OW2 A;  4PJO B;  2CRE A;  5GAM f;  1RL2 A;  5GJV B;  4F7U E;  3SWN C;  5GAN 5;  2QDL A;  4OMF B;  3UDC A;  5LJ5 j;  3JB9 F;  2BTT A;  1NBE B;  3CCE T;  1BBZ A;  4RTX A;  1W2B S;  3JCM d;  3CC4 A;  1VOM A;  3GIB A;  1M1K C;  1R0B G;  4JDS A;  1PRM C;  1WJS A;  4C5G A;  3MKD A;  2CP0 A;  1AWW A;  2H8H A;  1O9S A;  5FU6 C;  3KBG A;  2L3S A;  5A0L A;  2EYZ A;  4LD9 K;  3M5A A;  1ACM B;  4C8Q A;  2NUP B;  1K1Z A;  3FIF A;  1YI2 Q;  1RAA B;  4ESR A;  2F5K A;  3P8D A;  3I5S A;  3EFS A;  3QJ6 A;  4MZM A;  2KMT A;  3VV0 A;  1WXU A;  2QAS A;  2E5Q A;  4MML A;  3VS7 A;  1I0C A;  3VS2 A;  2OTJ Q;  1YJ9 Q;  4C92 E;  4EMK A;  5DM7 R;  1RAG B;  4C0G A;  2PVG B;  4C8Q D;  1U3O A;  3EG2 A;  4FT2 A;  2IIM A;  1JJ2 S;  1VQ6 Q;  3RKY A;  2KE9 A;  1KFZ A;  4XTZ A;  5L8R E;  1NM7 A;  4KH0 B;  3BFM A;  4L6V 5;  1M4Z A;  2WSC E;  1QKW A;  2AIR B;  1KK7 A;  2DIG A;  2QEX T;  3F70 A;  3CC7 A;  1TS9 A;  1QCN A;  2DL5 A;  3OW2 S;  5GAN 2;  4KH1 B;  3TCJ A;  3CME T;  2HQH A;  3QHS A;  5KCH A;  3I35 A;  2X4Y A;  1WFW A;  3U23 A;  3D7S B;  2PNI A;  5LJ3 h;  1IRE B;  5EG2 A;  2K79 A;  3X25 B;  2HKQ B;  4XQ3 A;  2EFI A;  1ZQ1 A;  2DVJ A;  4GBQ A;  2DTI A;  2D6F A;  5KYN A;  3G7Z A;  3WXM B;  1Q81 C;  2GFU A;  2GGR A;  3R6N A;  5IH2 A;  1KC8 U;  3UT1 A;  4F17 A;  2GFA A;  2LNV A;  3G6E A;  3OYI A;  1TXQ A;  4IIO A;  1OZ3 A;  2CZ0 B;  3O8V A;  5J39 A;  3CC2 A;  1OX8 A;  4XTU A;  3CCQ Q;  2F1L A;  5GAN 7;  1A0N B;  4JLG A;  3EFR A;  3FDR A;  2EYY A;  2VXE A;  3V8J A;  1M27 C;  2LQ8 A;  4HCK A;  4PLI A;  1FWZ A;  4M77 B;  1YHQ T;  2KT8 A;  4Y28 E;  1OU9 A;  3HPW A;  1YBY A;  3CCJ Q;  3QBY A;  4M7D E;  1ZSZ A;  3LW5 E;  4ZTF A;  2M0O A;  2LJ1 A;  3NFC A;  1WDX A;  1NPP A;  4C0Z A;  1BB9 A;  1NLP C;  2C0I A;  2V1Q A;  1OYX A;  4RG2 A;  3SHW A;  5I22 A;  1QVP A;  4X1V A;  2DVE A;  5LJ3 g;  3VS4 A;  2OAU A;  4CC2 A;  1R0C B;  4XTW A;  1OU8 A;  1YCS B;  4FW2 A;  4IUT A;  1RAI B;  1QVG A;  1Y71 A;  2EW3 A;  1OI1 A;  2KYM A;  3CMA Q;  3QJY A;  2XHC A;  3VS0 A;  1VQO A;  4JPB W;  1H3H A;  5D6W A;  2CKK A;  1VQ8 T;  4N4I A;  1EIF A;  2EYW A;  1M3A A;  1AD5 A;  3NTH A;  3VYH B;  1N6A A;  2XMF A;  2QI2 A;  4M78 B;  5HCK A;  1RAH B;  1PWT A;  3JCM X;  4LXC A;  1IHV A;  2V26 A;  2RF0 A;  2HAX A;  4E2F B;  2JTF A;  1TG0 A;  4N0A C;  3M56 A;  2M02 A;  1GL5 A;  2RJF A;  5KCO A;  1QVF P;  5GMK h;  2K5L A;  3S3O A;  1U5S A;  4B9W A;  2EGE A;  3CCV Q;  2X3W D;  2DYB A;  2ESW A;  5A2Q E;  4JJD A;  3CCM T;  2H3J A;  1Q82 U;  2GTJ A;  1JXO A;  2JT4 A;  2QGG A;  2ZPH B;  4D8K A;  3OYJ A;  3L2V A;  3OA6 A;  5GAN 4;  4BDY A;  2F5T X;  2J05 A;  2DD4 A;  3BDL A;  1VQ7 Q;  1VYT A;  2RHY A;  2BZX A;  3ZBD A;  1QVG S;  2DRK A;  3VS5 A;  1UGV A;  3ME9 A;  4ZN3 A;  4CC4 B;  3H9N A;  4OB2 B;  2COZ A;  3S6W A;  1H8K A;  2XD0 A; 
#chains in the Genus database with same CATH homology
 2QEX Q;  3CXC P;  3I55 Q;  1YIT Q;  1Q7Y R;  1VQK Q;  1KQS P;  1M1K R;  3CCQ Q;  1VQM Q;  3CCV Q;  3CCU Q;  1VQO Q;  1VQ7 Q;  3CCM Q;  1K8A R;  3G71 Q;  3OW2 P;  1VQP Q;  1KC8 R;  1VQL Q;  3G6E Q;  1K73 R;  3CME Q;  1N8R R;  1KD1 R;  2OTJ Q;  1YJ9 Q;  3CC4 Q;  1YHQ Q;  1QVG P;  3CC2 Q;  1Q86 R;  1YIJ Q;  1M90 R;  3G4S Q;  1K9M R;  3CC7 Q;  2OTL Q;  1YJW Q;  3CCS Q;  1NJI R;  3CPW P;  3CCR Q;  1Q81 R;  2QA4 Q;  1YJN Q;  1JJ2 P;  3CMA Q;  3CCJ Q;  1VQ4 Q;  1VQ6 Q;  1VQ9 Q;  1S72 Q;  1Q82 R;  1YI2 Q;  1VQN Q;  3CCE Q;  1VQ5 Q;  1QVF P;  1VQ8 Q;  3CD6 Q;  3I56 Q;  1W2B P;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...