1VQOQ

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqoQ00
3CCMQ 3CMEQ 1YJWQ 1JJ2P 1VQPQ 3G4SQ 1M90R 3CCUQ 1N8RR 3CCEQ 3CCLQ 1S72Q 1Q86R 3CPWP 1VQ7Q 1VQ8Q 1VQOQ 3CMAQ 1VQMQ 3OW2P 3G6EQ 3I56Q 3CCRQ 1W2BP 1K9MR 2OTLQ 1QVFP 1YJNQ 1YI2Q 2QEXQ 1Q81R 1M1KR 2OTJQ 1VQNQ 1VQLQ 3CCSQ 1YHQQ 3CCJQ 2QA4Q 1VQ4Q 3CCVQ 1Q82R 1Q7YR 1VQ5Q 3I55Q 1KQSP 3CC2Q 3CXCP 1QVGP 1NJIR 1YJ9Q 1VQ9Q 1K8AR 3CCQQ 1VQKQ 1KD1R 3G71Q 3CC7Q 3CD6Q 3CC4Q 1YIJQ 1YITQ 1VQ6Q 1KC8R 1K73R
chains in the Genus database with same CATH superfamily
4IURA 1U8RA 2DEQA 4M75D 3H8ZA 5LJ3h 2MCNA 4MMKA 4A4KA 2VXFA 2ZGWA 4AFQC 4JUVA 3EFSA 2DIGA 4FT4A 2F2XA 2LNVA 1G3YA 2ZPHB 4MZMA 3TCJA 4RTVA 2GQVA 1M8MA 4E7SA 1Q82C 2RA2A 2M0OA 2IPOB 1E6GA 3ZEHA 1TXQA 1Y7XA 2J6FA 2HZYA 4KGXB 4MZPA 1S72Q 8ATCB 2YSQA 3CC7T 1ZSZC 1PRLC 3LGFA 3VYHB 1VUBA 3CMET 2ECZA 1MV0B 3OBYA 2LCSA 1PRMC 2YUPA 1GL5A 3C0CA 3I55Q 1O9SA 2DKGA 2KK4A 2X35A 3CCQA 1I0CA 1WHLA 4HVVA 5CCAA 5EG2A 4R55A 2RHIA 4PJOF 3QIIA 1QVPA 4C92F 2CSIA 4LNPA 2X9HA 3M4GA 2M9UA 4M77F 5GAMg 2DERA 1GBRA 1AEYA 1TWBA 4JLGA 5AYFA 4BB7A 2GQIA 4C92D 1NJIR 3FLGA 1D3BA 1TTHB 4OB1B 3LW5E 3JCMd 2EIFA 3D7SB 2JS2A 2FRYA 2QXFA 3LH0A 2L8DA 4WF2A 3JB9J 3E2UA 3QG1A 1EIFA 3GP8A 1XTDA 1OU8A 4C8QD 1Y96A 3LYIA 3NTKA 2HMAA 3BW1A 2LQKA 5KCHA 1H3ZA 1RADB 1M1KC 3CD6A 3GLXA 2DTHA 2KRMA 5GAMf 2BE7D 4OGCA 2CKKA 2DZCA 4E7ZA 2HQXA 1A0NB 1HYOA 1EZZB 3HRUA 4A4EA 2OTJQ 1MUZA 1IZ6A 4LDUA 2L0AA 5D7UA 4RTXA 4F14A 1I8FA 4QQDA 2X4JA 1MMNA 1X2KA 1YJWA 4LD9K 1X6BA 1K76A 2X4YA 3QZ9B 2F2WA 1UJYA 4B9WA 5KYUB 1BCMA 3FIFA 4JRPA 3PMTA 4XQ3A 2QG9B 1GRIA 2QA4Q 3M5AA 1UE9A 2RI5A 2QQRA 5I2MA 4EMKC 1MV3A 2DL7A 3G71A 1R8OB 2CZ6B 4D8DA 3VUBA 1D1AA 4E7IA 2P84A 3CCEA 1M5Q1 3L2RA 2MYSA 1AHJB 3RR6A 5LJ5d 4FYVB 1YBYA 4C5GA 3G6EQ 2L89A 2A0FB 1XNIA 2CZ7B 2DBMA 4J8OA 4C0FA 4R56A 1M9SA 3JCMc 3KUFA 5KYUA 2XKOC 1YHQA 3GIBA 2K3YA 3PTAA 1ZLMA 2IVWA 4J9CA 2LZ6B 2OTJT 4XAXB 4PK4A 5CAIA 1KC8C 3QO3A 2DYBA 3SHWA 1QVFS 1KC8U 5GMKj 2PUOB 4QQGA 1W2BP 4E7HA 4LUDA 3E9FA 5CIUA 4DOWA 4OMMA 3JCMb 2DFUA 3L2QA 4OB3B 5KYYB 2EYWA 4M7AF 1XJWB 1JJ2P 2CT3A 2KXCA 2RK2A 1WJRA 4KH0B 1U1TA 3L2UA 2RK1A 5GJWB 3V7CA 4CI0C 3GBQA 2K7AA 2J06A 3ZBDA 3PVQA 1ACMB 1VQ4Q 4EIKA 5D6YA 1HJDA 2BZYA 2VASA 3G6ET 3KBGA 2COYA 1YIJA 2L3RA 2XDPA 4J7IA 3VS3A 4A54A 4N4IA 1IGQA 2EPDA 1G83A 3R6OA 4QQ6A 3CPWP 3NTHA 4AG1C 4JS5A 5DY9A 5KYWA 2MK5A 3CCJA 4AFZC 4DA4A 3OYGA 2KDSA 3I35A 5GAN2 1K9AA 4B9XA 3VKIA 3VS6A 1H3HA 4HT9A 3RKWA 2DAQA 3DLMA 4M7DE 1H8KA 2JM8A 3JCMV 5GAN3 3HSBA 5CK9A 2AHJB 2MPXC 1R0BG 2KNBB 5GMKm 3CCQQ 2NWMA 2MI6A 4RCCA 3MEVA 4HCBA 5GJVB 3QYHB 1VQ4T 4XU3A 4JRQA 2LCLA 2QI2A 5GAMd 1RACB 5HY6A 2O01E 2I0NA 2DXUA 2EYZA 1M90U 1C6VX 3OYMA 1KQ1A 1BU1A 4Q5WA 3A5ZB 4JS4A 2FPFA 2VUBA 2FVUA 2CZ0B 1RL2A 1WXUA 1UFFA 2RB6A 4L6V5 1IXDA 4PJMA 1NPPA 4FW1A 4Z88A 2PVDB 3CMAA 3J81E 1KK7A 2DX1A 3EGDB 3EH1A 2DM1A 1OULA 3META 1OZ2A 3SEMA 1SHFA 3CD6Q 4ZTJA 4BI8B 3H0FA 3EG0A 3RESA 3OBWA 3CCQT 1UGPB 2EYYA 3V8KA 4XU2A 3H6ZA 4PJOG 4XTVA 5A2QE 3OYFA 3CCRQ 3UT1A 4C92G 2YUNA 4OMQA 2M16A 2DRMA 1K1ZA 3QXEB 4M78D 7AT1B 2R5AA 1PHTA 4M77G 3EGDA 2C06A 3MCAB 2X4WA 1YITA 8AT1B 2V1RA 2QASA 4KBMB 1YJWQ 2JM9A 4QKUA 1NEGA 1M3BA 3GOXA 2RJEA 3M0TA 4GBQA 1OQKA 2YUOA 1ZSZB 4M7DC 1T0HA 4ELZC 2K79A 5I22A 3DLLA 2B86A 2D9TA 3OYDA 1OZ3A 3CC2A 3UATA 2GF7A 5GAOp 2LQNA 3G71Q 3RERA 1RLPC 5GAOm 2XD0A 1FMKA 4RTWA 4FSSA 3QBYA 1N8RR 3CCEQ 2IG0A 4WCIA 3TSZA 3CD6T 4XTUA 2JTEA 1UGRB 3OB9A 4J5YA 4FYXB 5GANg 2Y4YA 1YHQQ 2E41A 4C0ZA 1UDLA 1ZSZA 3CXCP 1PKTA 1YFNA 3CCRT 5FU7B 4A63B 1AWJA 5AT1B 3EFOB 1VQPA 2X51A 5FWCA 1IHVA 1VQOQ 1NZ9A 2DVJA 1WHMA 2DYIA 3PGGA 5I2SA 2E1HA 2PZ1A 1XQHA 1UTIA 2E64A 1PSEA 5KH6A 2LX7A 4RG2A 2SRCA 3EG9B 1VQ6A 3QDFA 3MP1A 2HBWA 3JCMf 2LQ8A 1V29B 3HP9A 2XI9A 5GANf 1D0YA 1ZBJA 2KE9A 3G71T 2DXBA 2J6OA 3FJPA 3SD4A 3CCET 3L1AA 2RO0A 1BB9A 1KG1A 4KUIA 4OGEA 1NBEB 3G7ZA 2PVGB 2OTLT 3M0PA 2CP3A 2E5QA 1K73R 2ZAEA 1YHQT 1MNDA 1I07A 3G4SA 1WXBA 3TEEA 4HCCA 4RCBA 3EG9A 2DEUA 1T3LA 3H41A 3OYNA 2H8HA 2KR3A 2IIMA 2JTFA 1VQLA 3I5SA 3RKXA 3CCJQ 4BE0A 1VQOT 1N9RA 1VQ5A 2LNHB 2JMAA 2FPEA 3JCMJ 3MHXA 4EMKB 1J3TA 3SFMA 3OY9A 2AZSA 4M7AG 2G3RA 2DIQA 5GMKe 4PFOA 4RTYA 2LP5A 2P4TA 3MEAA 4TVRA 2K4YA 4BY6B 2HAXA 2BZXA 4OVAA 1KIKA 3O8VA 3ZFJA 2A28A 2HSPA 1X75C 3JAME 1X43A 4A4HA 1FYNA 3C12A 3GPLA 4EMKA 1VQMA 1ZHIA 2ROTA 3EG3A 5FU6C 4AFUC 4DBFA 2FPDA 1FXXA 2DPPB 4FL6A 1JBMA 3PNWC 4M75F 2PNIA 1Q7YR 1MMAA 2Y90A 4XU0A 1IRXA 1HK9A 3QWXX 2HEQA 2OJ2A 4F7UF 3CCJT 4KH1B 3NGPA 2CH4A 2L3QA 3HKSA 3CMAQ 2ZPFB 1BIAA 3I56Q 3CQTA 1K0XA 2YWWA 2DO3A 1GCQC 3PE0A 4PLIA 1UB4A 1X01A 3FEOA 5CQXA 5CVIA 2RI3A 2KT8A 2OAUA 4MDWA 1HXDA 4HA8A 2EKOA 2GCXA 1WQWA 1Q86R 2L2PA 4KUDK 2CZ1B 3JCMe 1NLOC 2M51A 4GY5A 1QP3A 2DL3A 2FZCB 5GAN5 4RTTA 1D3BB 2HKNA 1NYGA 5IAYA 5CKEA 5GAOq 3TU4K 2K5IA 1D09B 1JJ2S 4C5IA 1AT1B 1YJ9A 1PCXA 1QKXA 3AT1B 4CC4B 1Q81C 1V76A 1YITQ 4DBHA 1IB8A 3OQ5A 1Q81U 3V8LA 2RJCA 2A08A 1M2OA 4OF1A 4NL3A 2KAFA 3ASKA 4HXJA 2MMPA 4OMLA 4BE1A 4LUEA 1Y96B 2A37A 4GLMA 1NE8A 4E2FB 3VRZA 2AK5A 1FWZA 2RQRA 1TSFA 1X2QA 1R0CB 2DE0X 2EBPA 2QQ9A 3QSUA 1JXOA 5CKDA 3CMAT 3CC2Q 2CH4W 2GFUA 1QVGP 4RUGA 2FRWA 1MNEA 3I56T 5M9OA 1GBQA 1W6XA 1W2BA 3TVTA 1B07A 2GTOA 4C8QF 5GANd 3RDVA 5IXFA 2QTXA 2OAWA 3A1PA 1RI0A 2COWA 1I4K1 4PJOE 4X34A 1Y0MA 2DLPA 4LDYA 1JJ2A 2X3XD 1E7OA 2F69A 4J9IA 1S72T 2V8KA 2EJ9A 2XMFA 2LTOA 5I11A 1YCYA 2KRSA 4N4GA 1ZX6A 2E3HA 4M77E 2CGHA 1X69A 3CBMA 1VQPQ 3QZ5B 2E3IA 3I55T 1BIBA 5GAN6 3M59A 1VQ7Q 4D8KA 4J9FA 1YITT 1SF9A 2LMJA 1ZBXA 4R0KA 5KCOA 1FX7A 5LJ5e 5KE3A 5GMKh 4AMCA 1KD1R 2LVMA 4RKUE 2NUPA 1VQ6Q 2LJ0A 3AHUA 4QT7A 4AG2C 3CCMA 2J7IA 2B8AA 4M75C 3BDLA 5GAOr 2DRKA 2EKHA 4XTYA 3VU3C 1VQ8Q 2KROA 9ATCB 4Y92A 2EQMA 2K5FA 3OYHA 4A4FA 1Q95G 1WJQA 1Q82R 2J05A 3LX7A 1YN8A 3JCMP 1ZUYA 2HCKA 4JZ4A 2D1XA 1T0JA 3SB2A 1ARKA 1OX8A 2XK0A 4Z8AA 2M02A 5GMKi 3G4SQ 1M27C 1UHCA 4PJNA 4CC7A 4OP0A 1SHGA 4L59A 1QMCA 2V1QA 1WI7A 4KGVB 1YJNA 4A4GA 1VQPT 3VYGA 3RUXA 4M7DB 1MMDA 2NUTA 4BE2A 1VQ7T 4UC4A 3CCVQ 4PL6A 1VQ5Q 2RQVA 4JRIA 2VGMA 2X3WD 2R5MA 1G2BA 5CKFA 2E65A 1KFZA 2O2OA 2RHYA 1WJSA 5DLOA 3CCLA 2ROLA 1BCOA 2RHZA 1K0SA 1VQ6T 4RMOA 3OYBA 4MMLA 3JB9I 5IHIA 4IUTA 1PC0A 1AD5A 5IT9E 1VQNA 2O9VA 4PJOC 1VQ8T 3I5RA 4MDXA 2JTMA 2DF6A 3EHQA 4C92C 4JJNK 2EVRA 2AIRB 4M7DA 3LGLA 3X28B 1QCNA 4EDUA 4M77C 4B6MA 2QA4T 3FRNA 3F70A 3THKA 2BUDA 5KYWB 1VQMQ 1G3TA 1NPRA 3A8MB 3FDRA 3V8JA 5FRNA 1UEBA 2F1LA 2QTVA 2FHDA 3G4ST 2WSCE 1AWOA 4C8QC 3OYIA 4ZN1A 1B34B 1M1KR 2QEXA 2LCCA 5GAN4 2CREA 1WXTA 1QCFA 5LJ3g 5C6SA 1JRIA 2FL7A 3H9NA 3SWNC 1M30A 3CCVT 4AT1B 3UF4A 4M7AE 3X26B 2GBQA 3JB9D 4J9BA 3URGA 3QKJA 2EYQA 3OSVA 1M3AA 5GAMe 4E7JA 4PFZA 4E7KA 2DL8A 2F5TX 3ER0A 1B34A 1W1FA 4HVWA 1N9SA 1WPYA 2V26A 1TUDA 1ZA1B 2P0QA 3IQLA 2EW3A 5LJ3f 2BE9B 2DXCA 1M1GA 4OMFB 5L23A 4M7DD 5GAN7 2PTKA 5D6XA 5GANj 4X9DA 5EC7A 1VQMT 1XOVA 2C0IA 1YJ9Q 1G5VA 4M75G 1GXIE 5KYNA 2BKDN 4J6XA 3G1JA 1RABB 4F7UG 4XTWA 5LJ5h 2YLCA 3CXCA 3I9QA 3EAEA 1M90C 1YWOA 2BIVA 1N8RU 2GGRA 1PWTA 3QDRB 3J80E 2QQBA 2RHXA 3REAB 4VUBA 4JJCA 2EQJA 4O6JA 2WSFE 2AKKA 2K5LA 1PD0A 3CC7A 4V2SA 1KHIA 4FW2A 3CMEA 2KMTA 1K9MR 1KHCA 5FU6B 4IUUA 4XK8E 5D6WA 2RJFA 5GAN8 1IO6A 3M56A 4HVUA 3M4YA 1K8AR 4JLIA 4DEXA 1WHHA 2HD0A 3OA6A 2M1HA 1N27A 1SPKA 1G3WA 3A8LB 2XIDA 2QYZA 4M78F 3S3OA 1YJ9T 2HQEA 2VKNA 3MP6A 2HNIA 4ZN3A 2PUKB 4M7AC 3NTIA 1P92A 1K4US 2PU9B 3PMIA 4FYWB 2VV5A 3OS1A 1C0MA 2FG0A 1WDXA 4HCKA 4HT8A 2H3EB 2QQSA 3M0UA 4Y91A 3CCMQ 3UA7A 3VRYA 2AT1B 1K73C 4KRTA 2EJGA 4C8QG 1K73U 4J9DA 2WACA 3JV3A 2D6FA 5FROA 3UDCA 1QVFP 4DOVA 3EFRA 1T3SA 1DJ7B 5KYXA 1YI2A 3ULRB 1M8VA 2BTTA 3A8OB 4N4HA 3V7RA 2D0NA 4BACA 1GCQA 2RM4A 3R6NA 2KYBA 1RUWA 1TS9A 1UECA 2E4HA 2FZKB 3HL8A 4Z02A 1I5LA 3S3NA 3JRZA 3P8BB 2HBPA 2DA9A 4BDYA 5KE2A 1KQSP 2KGTA 2CP2A 3FB9A 3QJYA 3BE3A 1MMGA 5GAMh 4WTOB 1SRLA 4HKEA 2R57A 3QPHA 2K9GA 4E6RA 2W0ZA 3M54A 3T9NA 1QLYA 3A8HB 2P0KA 1OV3A 1Y71A 3CCMT 1X6GA 3A98A 1YJWT 2YT6A 1AWWA 2R58A 3PIPA 4ZGEB 1C1AA 1VQNQ 2EGEA 5CO7A 1NLPC 3QWYA 4FSXA 1RI9A 3OYEA 3WVDB 4Z89A 2QK0A 2J6KA 1Q7YC 3EGXA 1BI1A 3P8HA 4OMNA 1Q7YU 1ZUKA 1I1JA 2LX9A 3L42A 1W70A 2RN8A 1RAIB 5J26A 4EPCA 5LJ3d 4PJLA 3QHSA 3L2VA 2K3XA 1OOTA 1QVGS 1PD1A 2QEXQ 1WGSA 2OTJA 2CP6A 4ANJA 4O5VA 3TSWA 1YIJQ 1SKUB 4GLKA 2NLUA 1KJWA 4M75B 3CCUA 1GFCA 2KQWA 3C4SA 5IN1A 3HPWA 1OI1A 4IIOA 3H0IA 1B3QA 1Q86U 2MWOA 4M78C 3MO8A 2G6FX 4LDWA 2DMOA 2EQIA 1MGQA 1YCSB 3L2ZA 3JB9H 3CC4A 2GTJA 1VQNT 2E10A 4N0AC 2QQAA 2EQUA 2DVEA 2ED1A 1QVGA 3ZL7C 1V1CA 4M4ZA 1VYVA 1WA7A 1Z9QA 3NPFA 1ZUUA 4M75A 2LT4A 3S3MA 2YXYA 2DTOA 4PFPA 2CP0A 2RPNA 2HQHA 5LJ5g 3E9GA 3EHRA 2VGNA 3VS4A 4DBQA 4F7UA 1JB0E 2QEXT 4QVDA 1NJIC 5CR2A 1NJIU 4LDVA 4MZTA 1YIJT 4ZTFA 2DILA 2Z0WA 4OB2B 1QCOA 1TUCA 4J6YA 1KQ2A 1X6OA 5A0DA 2JUFA 1ABOA 2FO0A 2VYTA 5J39A 4PJOB 2RH2A 3U23A 4C92B 4DQ2A 1HSQA 3CC7Q 2NYSA 1RAGB 2I2LA 4J9GA 4M77B 1Y07A 3OS5A 3OW2P 1OPKA 3RBBB 1OU9A 4LDXA 3N5BB 3DB3A 3M0QA 3HTRA 1SRMA 1VQ4A 2KI7A 3VS1A 2KY9A 2D8JA 2LT1A 3HFOA 2C0TA 1WHJA 3OYJA 3X24B 3PVLA 1EX4A 4M75E 3UA6A 1SSFA 1WHKA 4XTXA 3SWNB 1KD1C 4PJOA 1B7TA 1LPLA 3DKMA 4C92A 1KD1U 1W2BS 4F7UE 4J7FA 2JW4A 2CUDA 1BI2A 1I81A 2YRCA 1PSFA 4M77A 3KXTA 1H641 5L8RE 5GANe 2PVOB 1OPLA 1QW1A 2MIOA 3OS0A 2WSEE 2OX7A 4YTLA 1VQ9A 4C8QA 4XU1A 1Q82U 2CSQA 2O31A 4NL2A 1TU0B 2XICA 1M2VA 1VA7A 4K11A 2KBTA 5HK0A 1SEMA 2H3JA 3SWNA 4A53A 3RMQA 1YI2Q 1R77A 4E47A 4LD6A 1CSKA 1D0XA 1NG2A 2DK3A 4ZGDB 2O9SA 4FU6A 3A8GB 1VQKA 1MHNA 3GNGA 4C5EA 1OEBA 2CDTA 2A7YA 3CPWS 1LVKA 2VXEA 4ME7A 2AKLA 4M78G 1G8XA 1VOMA 2ATCB 2NUPB 2YUQA 2ZCFB 4C92E 2QDYB 4PJOD 1SSHA 5LJ3j 5FU7C 5IXBA 2E12A 4EMGA 3JCMW 1ZQ1A 4C0DC 3VS0A 3C94A 4JPBW 4IUPA 4M77D 3O5ZA 4LXCA 3C95A 1UHFA 1NYFA 3OYKA 4C8QE 3OSSC 3HRTA 2E70A 2W10A 3CPWA 2JMCA 1RLQC 1M1KU 1YI2T 2K6DA 3JSCA 3EG1A 4L5GA 2CP7A 3CC2T 1WQ7A 2NUTB 2HDAA 5J3BA 3EH2A 1BI3A 3CCRA 1S1NA 2FZGB 4M7AB 2DL5A 2MOXA 1VIEA 2XDBA 4BI4A 5FRMA 2HL3A 2JXBA 1U3OA 1QWEA 1U5SA 4RG8A 2EYXA 1O75A 3QYGB 3TREA 3EGUA 3BFMA 1UUEA 1NM7A 3INZA 3CCUQ 2RNAA 2EQKA 2C0OA 4BD3A 2XU8A 4QVCA 3RIRA 2LC4A 5GAOn 4PKCC 4JDSA 1KSWA 2AZVA 4OMPA 2D8HA 4IUVA 1IHWA 2XHCA 4RTZA 2LDMA 4Y28E 3JCMX 4BDZA 1PNJA 3CBPA 2QDLA 1Q81R 1LCKA 1VQLQ 1HD3A 3CCSA 5ECAA 2VB6A 1RAHB 3E1SA 2RJDA 2DJZA 4M7AA 3CC4Q 2YRDA 5I21A 5CQYA 1TH7A 4ZNXA 4EMHA 1D1BA 4XTZA 4CC3A 1IGUA 3PT9A 4ATOA 3HRSA 3LWHA 2ESWA 4BY6C 2OTLA 1VYTA 1YP5A 2FEIA 2JJ9A 3VS5A 1OYXA 2OI3A 3JCMh 4ORZA 5LL6S 4JZ3A 5GANh 4IUQA 1SG5A 4D6WA 5A0GA 3OYCA 4PNOA 1WZOA 1VQOA 2DTIA 4OMOA 2LJ1A 3OMGA 4HCZA 3LWIA 3CCUT 2E5KA 2LQWA 3MEWA 3VUZA 1K9MC 1PG5B 3P8DA 2DD5A 2DL4A 2RD1A 3RNJA 1K9MU 1LNXA 1VYUA 3JB9F 3M55A 2EAYA 1VQLT 1K8AC 4PLLA 1FMWA 1K8AU 1VQ5T 3CC4T 4M7AD 1KQSS 1RAEB 2DD4A 3CXCS 2XG8D 2ZPIB 3UWNA 4DEYA 3NFCA 1YWPA 2GNCA 2VVKA 3BY7A 2MF2A 1IREB 2F2VA 1QVFA 4M7DF 3OYYA 5IHKA 3CEYA 3RKYA 5KYYA 2O4XB 1LJOA 1U1SA 3JCMQ 2DZ9A 1BKBA 4BI3A 1GFDA 1PKSA 2EJFA 1M3CA 2DNUA 2EFIA 4ELYC 1N6AA 4M78B 4J9EA 3VV0A 2EGCA 3PFSA 1VQ9Q 1F1BB 3VS7A 4AFSC 2RF0A 2V8IA 4X9CA 2YLBA 3M58A 3HHTB 4J6WA 2FB7A 2JZ2A 2KXDA 2KRNA 3BDUA 5GMKl 1KQSA 2O88A 1ZSGA 2DBKA 4ZGJB 1N8RC 1TOVA 2O4XA 1AOJA 4J9HA 4KGZB 1YNZA 2MAMA 4IKFA 1U06A 4JJDA 1VQKQ 1N5ZA 2LRQA 2COZA 4KULA 1KC8R 2E6ZA 4M78A 2KT1A 1UG1A 3RMSA 1WHGA 5CKHA 2ZZDA 2RQTA 2D0QB 3VS2A 3OYLA 5FLXE 2L5QA 4X1VA 1WFWA 1QWFA 4N0AA 1QQJA 2A3LA 5FWBA 3CPFA 1WNLA 5DLQE 2Y4XA 1WLPB 1Y57A 2DJQA 1UGVA 2JVVA 1ZA2B 4FT2A 1W4SA 2PQWA 1UGSB 1NEBA 1VQ9T 5KYXB 1Z9ZA 2RQUA 3I56A 1UJ0A 1AZGB 4F04B 3OS2A 1RAFB 4C5HA 1JXMA 2KSSA 1WX6A 3MKDA 3OYAA 2V8JA 2KVQG 5HK3A 2JOYA 2ZPBB 2ZPEB 3SDZA 1S72A 1VQKT 3V7SA 1I5OB 3Q1JA 1LOJA 3M53A 4M78E 4QW2A 3NHNA 5LJ5j 4CRIA 3I55A 1VIFA 4F17A 2YRVA 2BZ8A 2YHTA 1M4ZA 1QKWA 3OW2S 2X4XA 3TQ7P 2JS0A 1GCPA 6AT1B 2JNGA 4J83A 4ESRA 3L2WA 2RQWA 1EFNA 2K3BA 5GAOl 2ABLA 2CYZB 1YJNQ 2MWPA 2SEMA 2DXTA 2JN0A 3CCSQ 3EGXB 4II1A 3M9QA 2K2VA 1JQQA 5LJ3e 4DBRA 2E6NA 2A36A 2GFAA 2QGFB 3FJ5A 2FYKA 1CKBA 3QUIA 3X20B 1UGQB 3FC3A 4OB0B 3REBB 1M90R 3MEUA 2KEAA 2ZPGB 3CCLQ 4JJBA 5C0MA 3MPUB 2QAZA 1D0ZA 1QP2A 2CT4A 3JCMg 2OTLQ 2LJ3A 4NS5A 2P0PA 1WIEA 1JEGA 1BK2A 4JRKA 3OW2A 2RI2A 2K57A 2HKQB 4QVZA 4C0DB 4PJJA 3MJXA 2CUBA 2EWNA 2KYMA 4P5NA 2QGGA 1VQ7A 4C0GA 3J7AF 5CKBA 1OX9A 3E19A 3VJPA 2ED0A 4CC2A 2M0YA 3NMZC 2L3SA 1YJNT 2K2MA 1BI0A 1AWXA 3CCST 1PM3A 5HKCA 3M0RA 2XDDA 1VQ8A 2RMOA 4NOYA 1RAAB 3EFOA 4FYYB 4F16A 3MP8A 2F5KA 3X25B 4F7UB 1Q86C 1E6HA 2RHUA 3CCLT 1M1FA 1CKAA 1BYMA 3H0HA 2QA4A 3EG2A 3ME9A 1JO8A 2DETA 2VWFA 1TG0A 2HL5C 2HSEB 5IH2A 1AVZC 3LLRA 3M0SA 3GNFB 2L3PA 5FW9A 1X27A 3UPUA 2EGAA 3WVEB 3G6EA 1ABQA 5GAMj 3OMCA 2CS7A 3CCVA 5HCKA 1WYXA 1G3SA 2JT4A 4LN2A 3S6WA 2NUZA 1BBZA 1JU5C 4LE9A 3CBOA 5IHNA 3JB9G 2CP5A 2ENMA 2VC8A 4E7LA 5A0LA 2P4RA 2YDLA 3KFVA 4FM4B 3WXMB 3LH5A 3M57A 3HFNA 4IIMA 3PIOA 4BUGA 4KT0E 1TUGB 3CMEQ 1FMVA 1D1CA 4M7DG 3DB4A 3QJ6A 5LJ5f 1AZEA 5DM7R 3GF5A 4C8QB 4FCYA 1H92A 4RTUA 1M2VB 4FIBA
chains in the Genus database with same CATH topology
3CCMQ 3CMEQ 1YJWQ 1JJ2P 1VQPQ 3G4SQ 1M90R 3CCUQ 1N8RR 3CCEQ 3CCLQ 1S72Q 1Q86R 3CPWP 1VQ7Q 1VQ8Q 1VQOQ 3CMAQ 1VQMQ 3OW2P 3G6EQ 3I56Q 3CCRQ 1W2BP 1K9MR 2OTLQ 1QVFP 1YJNQ 1YI2Q 2QEXQ 1Q81R 1M1KR 2OTJQ 1VQNQ 1VQLQ 3CCSQ 1YHQQ 3CCJQ 2QA4Q 1VQ4Q 3CCVQ 1Q82R 1Q7YR 1VQ5Q 3I55Q 1KQSP 3CC2Q 3CXCP 1QVGP 1NJIR 1YJ9Q 1VQ9Q 1K8AR 3CCQQ 1VQKQ 1KD1R 3G71Q 3CC7Q 3CD6Q 3CC4Q 1YIJQ 1YITQ 1VQ6Q 1KC8R 1K73R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM Q;  3CME Q;  1YJW Q;  1JJ2 P;  1VQP Q;  3G4S Q;  1M90 R;  3CCU Q;  1N8R R;  3CCE Q;  3CCL Q;  1S72 Q;  1Q86 R;  3CPW P;  1VQ7 Q;  1VQ8 Q;  1VQO Q;  3CMA Q;  1VQM Q;  3OW2 P;  3G6E Q;  3I56 Q;  3CCR Q;  1W2B P;  1K9M R;  2OTL Q;  1QVF P;  1YJN Q;  1YI2 Q;  2QEX Q;  1Q81 R;  1M1K R;  2OTJ Q;  1VQN Q;  1VQL Q;  3CCS Q;  1YHQ Q;  3CCJ Q;  2QA4 Q;  1VQ4 Q;  3CCV Q;  1Q82 R;  1Q7Y R;  1VQ5 Q;  3I55 Q;  1KQS P;  3CC2 Q;  3CXC P;  1QVG P;  1NJI R;  1YJ9 Q;  1VQ9 Q;  1K8A R;  3CCQ Q;  1VQK Q;  1KD1 R;  3G71 Q;  3CC7 Q;  3CD6 Q;  3CC4 Q;  1YIJ Q;  1YIT Q;  1VQ6 Q;  1KC8 R;  1K73 R; 
#chains in the Genus database with same CATH topology
 4IUR A;  1U8R A;  2DEQ A;  4M75 D;  3H8Z A;  5LJ3 h;  2MCN A;  4MMK A;  4A4K A;  2VXF A;  2ZGW A;  4AFQ C;  4JUV A;  3EFS A;  2DIG A;  4FT4 A;  2F2X A;  2LNV A;  1G3Y A;  2ZPH B;  4MZM A;  3TCJ A;  4RTV A;  2GQV A;  1M8M A;  4E7S A;  1Q82 C;  2RA2 A;  2M0O A;  2IPO B;  1E6G A;  3ZEH A;  1TXQ A;  1Y7X A;  2J6F A;  2HZY A;  4KGX B;  4MZP A;  1S72 Q;  8ATC B;  2YSQ A;  3CC7 T;  1ZSZ C;  1PRL C;  3LGF A;  3VYH B;  1VUB A;  3CME T;  2ECZ A;  1MV0 B;  3OBY A;  2LCS A;  1PRM C;  2YUP A;  1GL5 A;  3C0C A;  3I55 Q;  1O9S A;  2DKG A;  2KK4 A;  2X35 A;  3CCQ A;  1I0C A;  1WHL A;  4HVV A;  5CCA A;  5EG2 A;  4R55 A;  2RHI A;  4PJO F;  3QII A;  1QVP A;  4C92 F;  2CSI A;  4LNP A;  2X9H A;  3M4G A;  2M9U A;  4M77 F;  5GAM g;  2DER A;  1GBR A;  1AEY A;  1TWB A;  4JLG A;  5AYF A;  4BB7 A;  2GQI A;  4C92 D;  1NJI R;  3FLG A;  1D3B A;  1TTH B;  4OB1 B;  3LW5 E;  3JCM d;  2EIF A;  3D7S B;  2JS2 A;  2FRY A;  2QXF A;  3LH0 A;  2L8D A;  4WF2 A;  3JB9 J;  3E2U A;  3QG1 A;  1EIF A;  3GP8 A;  1XTD A;  1OU8 A;  4C8Q D;  1Y96 A;  3LYI A;  3NTK A;  2HMA A;  3BW1 A;  2LQK A;  5KCH A;  1H3Z A;  1RAD B;  1M1K C;  3CD6 A;  3GLX A;  2DTH A;  2KRM A;  5GAM f;  2BE7 D;  4OGC A;  2CKK A;  2DZC A;  4E7Z A;  2HQX A;  1A0N B;  1HYO A;  1EZZ B;  3HRU A;  4A4E A;  2OTJ Q;  1MUZ A;  1IZ6 A;  4LDU A;  2L0A A;  5D7U A;  4RTX A;  4F14 A;  1I8F A;  4QQD A;  2X4J A;  1MMN A;  1X2K A;  1YJW A;  4LD9 K;  1X6B A;  1K76 A;  2X4Y A;  3QZ9 B;  2F2W A;  1UJY A;  4B9W A;  5KYU B;  1BCM A;  3FIF A;  4JRP A;  3PMT A;  4XQ3 A;  2QG9 B;  1GRI A;  2QA4 Q;  3M5A A;  1UE9 A;  2RI5 A;  2QQR A;  5I2M A;  4EMK C;  1MV3 A;  2DL7 A;  3G71 A;  1R8O B;  2CZ6 B;  4D8D A;  3VUB A;  1D1A A;  4E7I A;  2P84 A;  3CCE A;  1M5Q 1;  3L2R A;  2MYS A;  1AHJ B;  3RR6 A;  5LJ5 d;  4FYV B;  1YBY A;  4C5G A;  3G6E Q;  2L89 A;  2A0F B;  1XNI A;  2CZ7 B;  2DBM A;  4J8O A;  4C0F A;  4R56 A;  1M9S A;  3JCM c;  3KUF A;  5KYU A;  2XKO C;  1YHQ A;  3GIB A;  2K3Y A;  3PTA A;  1ZLM A;  2IVW A;  4J9C A;  2LZ6 B;  2OTJ T;  4XAX B;  4PK4 A;  5CAI A;  1KC8 C;  3QO3 A;  2DYB A;  3SHW A;  1QVF S;  1KC8 U;  5GMK j;  2PUO B;  4QQG A;  1W2B P;  4E7H A;  4LUD A;  3E9F A;  5CIU A;  4DOW A;  4OMM A;  3JCM b;  2DFU A;  3L2Q A;  4OB3 B;  5KYY B;  2EYW A;  4M7A F;  1XJW B;  1JJ2 P;  2CT3 A;  2KXC A;  2RK2 A;  1WJR A;  4KH0 B;  1U1T A;  3L2U A;  2RK1 A;  5GJW B;  3V7C A;  4CI0 C;  3GBQ A;  2K7A A;  2J06 A;  3ZBD A;  3PVQ A;  1ACM B;  1VQ4 Q;  4EIK A;  5D6Y A;  1HJD A;  2BZY A;  2VAS A;  3G6E T;  3KBG A;  2COY A;  1YIJ A;  2L3R A;  2XDP A;  4J7I A;  3VS3 A;  4A54 A;  4N4I A;  1IGQ A;  2EPD A;  1G83 A;  3R6O A;  4QQ6 A;  3CPW P;  3NTH A;  4AG1 C;  4JS5 A;  5DY9 A;  5KYW A;  2MK5 A;  3CCJ A;  4AFZ C;  4DA4 A;  3OYG A;  2KDS A;  3I35 A;  5GAN 2;  1K9A A;  4B9X A;  3VKI A;  3VS6 A;  1H3H A;  4HT9 A;  3RKW A;  2DAQ A;  3DLM A;  4M7D E;  1H8K A;  2JM8 A;  3JCM V;  5GAN 3;  3HSB A;  5CK9 A;  2AHJ B;  2MPX C;  1R0B G;  2KNB B;  5GMK m;  3CCQ Q;  2NWM A;  2MI6 A;  4RCC A;  3MEV A;  4HCB A;  5GJV B;  3QYH B;  1VQ4 T;  4XU3 A;  4JRQ A;  2LCL A;  2QI2 A;  5GAM d;  1RAC B;  5HY6 A;  2O01 E;  2I0N A;  2DXU A;  2EYZ A;  1M90 U;  1C6V X;  3OYM A;  1KQ1 A;  1BU1 A;  4Q5W A;  3A5Z B;  4JS4 A;  2FPF A;  2VUB A;  2FVU A;  2CZ0 B;  1RL2 A;  1WXU A;  1UFF A;  2RB6 A;  4L6V 5;  1IXD A;  4PJM A;  1NPP A;  4FW1 A;  4Z88 A;  2PVD B;  3CMA A;  3J81 E;  1KK7 A;  2DX1 A;  3EGD B;  3EH1 A;  2DM1 A;  1OUL A;  3MET A;  1OZ2 A;  3SEM A;  1SHF A;  3CD6 Q;  4ZTJ A;  4BI8 B;  3H0F A;  3EG0 A;  3RES A;  3OBW A;  3CCQ T;  1UGP B;  2EYY A;  3V8K A;  4XU2 A;  3H6Z A;  4PJO G;  4XTV A;  5A2Q E;  3OYF A;  3CCR Q;  3UT1 A;  4C92 G;  2YUN A;  4OMQ A;  2M16 A;  2DRM A;  1K1Z A;  3QXE B;  4M78 D;  7AT1 B;  2R5A A;  1PHT A;  4M77 G;  3EGD A;  2C06 A;  3MCA B;  2X4W A;  1YIT A;  8AT1 B;  2V1R A;  2QAS A;  4KBM B;  1YJW Q;  2JM9 A;  4QKU A;  1NEG A;  1M3B A;  3GOX A;  2RJE A;  3M0T A;  4GBQ A;  1OQK A;  2YUO A;  1ZSZ B;  4M7D C;  1T0H A;  4ELZ C;  2K79 A;  5I22 A;  3DLL A;  2B86 A;  2D9T A;  3OYD A;  1OZ3 A;  3CC2 A;  3UAT A;  2GF7 A;  5GAO p;  2LQN A;  3G71 Q;  3RER A;  1RLP C;  5GAO m;  2XD0 A;  1FMK A;  4RTW A;  4FSS A;  3QBY A;  1N8R R;  3CCE Q;  2IG0 A;  4WCI A;  3TSZ A;  3CD6 T;  4XTU A;  2JTE A;  1UGR B;  3OB9 A;  4J5Y A;  4FYX B;  5GAN g;  2Y4Y A;  1YHQ Q;  2E41 A;  4C0Z A;  1UDL A;  1ZSZ A;  3CXC P;  1PKT A;  1YFN A;  3CCR T;  5FU7 B;  4A63 B;  1AWJ A;  5AT1 B;  3EFO B;  1VQP A;  2X51 A;  5FWC A;  1IHV A;  1VQO Q;  1NZ9 A;  2DVJ A;  1WHM A;  2DYI A;  3PGG A;  5I2S A;  2E1H A;  2PZ1 A;  1XQH A;  1UTI A;  2E64 A;  1PSE A;  5KH6 A;  2LX7 A;  4RG2 A;  2SRC A;  3EG9 B;  1VQ6 A;  3QDF A;  3MP1 A;  2HBW A;  3JCM f;  2LQ8 A;  1V29 B;  3HP9 A;  2XI9 A;  5GAN f;  1D0Y A;  1ZBJ A;  2KE9 A;  3G71 T;  2DXB A;  2J6O A;  3FJP A;  3SD4 A;  3CCE T;  3L1A A;  2RO0 A;  1BB9 A;  1KG1 A;  4KUI A;  4OGE A;  1NBE B;  3G7Z A;  2PVG B;  2OTL T;  3M0P A;  2CP3 A;  2E5Q A;  1K73 R;  2ZAE A;  1YHQ T;  1MND A;  1I07 A;  3G4S A;  1WXB A;  3TEE A;  4HCC A;  4RCB A;  3EG9 A;  2DEU A;  1T3L A;  3H41 A;  3OYN A;  2H8H A;  2KR3 A;  2IIM A;  2JTF A;  1VQL A;  3I5S A;  3RKX A;  3CCJ Q;  4BE0 A;  1VQO T;  1N9R A;  1VQ5 A;  2LNH B;  2JMA A;  2FPE A;  3JCM J;  3MHX A;  4EMK B;  1J3T A;  3SFM A;  3OY9 A;  2AZS A;  4M7A G;  2G3R A;  2DIQ A;  5GMK e;  4PFO A;  4RTY A;  2LP5 A;  2P4T A;  3MEA A;  4TVR A;  2K4Y A;  4BY6 B;  2HAX A;  2BZX A;  4OVA A;  1KIK A;  3O8V A;  3ZFJ A;  2A28 A;  2HSP A;  1X75 C;  3JAM E;  1X43 A;  4A4H A;  1FYN A;  3C12 A;  3GPL A;  4EMK A;  1VQM A;  1ZHI A;  2ROT A;  3EG3 A;  5FU6 C;  4AFU C;  4DBF A;  2FPD A;  1FXX A;  2DPP B;  4FL6 A;  1JBM A;  3PNW C;  4M75 F;  2PNI A;  1Q7Y R;  1MMA A;  2Y90 A;  4XU0 A;  1IRX A;  1HK9 A;  3QWX X;  2HEQ A;  2OJ2 A;  4F7U F;  3CCJ T;  4KH1 B;  3NGP A;  2CH4 A;  2L3Q A;  3HKS A;  3CMA Q;  2ZPF B;  1BIA A;  3I56 Q;  3CQT A;  1K0X A;  2YWW A;  2DO3 A;  1GCQ C;  3PE0 A;  4PLI A;  1UB4 A;  1X01 A;  3FEO A;  5CQX A;  5CVI A;  2RI3 A;  2KT8 A;  2OAU A;  4MDW A;  1HXD A;  4HA8 A;  2EKO A;  2GCX A;  1WQW A;  1Q86 R;  2L2P A;  4KUD K;  2CZ1 B;  3JCM e;  1NLO C;  2M51 A;  4GY5 A;  1QP3 A;  2DL3 A;  2FZC B;  5GAN 5;  4RTT A;  1D3B B;  2HKN A;  1NYG A;  5IAY A;  5CKE A;  5GAO q;  3TU4 K;  2K5I A;  1D09 B;  1JJ2 S;  4C5I A;  1AT1 B;  1YJ9 A;  1PCX A;  1QKX A;  3AT1 B;  4CC4 B;  1Q81 C;  1V76 A;  1YIT Q;  4DBH A;  1IB8 A;  3OQ5 A;  1Q81 U;  3V8L A;  2RJC A;  2A08 A;  1M2O A;  4OF1 A;  4NL3 A;  2KAF A;  3ASK A;  4HXJ A;  2MMP A;  4OML A;  4BE1 A;  4LUE A;  1Y96 B;  2A37 A;  4GLM A;  1NE8 A;  4E2F B;  3VRZ A;  2AK5 A;  1FWZ A;  2RQR A;  1TSF A;  1X2Q A;  1R0C B;  2DE0 X;  2EBP A;  2QQ9 A;  3QSU A;  1JXO A;  5CKD A;  3CMA T;  3CC2 Q;  2CH4 W;  2GFU A;  1QVG P;  4RUG A;  2FRW A;  1MNE A;  3I56 T;  5M9O A;  1GBQ A;  1W6X A;  1W2B A;  3TVT A;  1B07 A;  2GTO A;  4C8Q F;  5GAN d;  3RDV A;  5IXF A;  2QTX A;  2OAW A;  3A1P A;  1RI0 A;  2COW A;  1I4K 1;  4PJO E;  4X34 A;  1Y0M A;  2DLP A;  4LDY A;  1JJ2 A;  2X3X D;  1E7O A;  2F69 A;  4J9I A;  1S72 T;  2V8K A;  2EJ9 A;  2XMF A;  2LTO A;  5I11 A;  1YCY A;  2KRS A;  4N4G A;  1ZX6 A;  2E3H A;  4M77 E;  2CGH A;  1X69 A;  3CBM A;  1VQP Q;  3QZ5 B;  2E3I A;  3I55 T;  1BIB A;  5GAN 6;  3M59 A;  1VQ7 Q;  4D8K A;  4J9F A;  1YIT T;  1SF9 A;  2LMJ A;  1ZBX A;  4R0K A;  5KCO A;  1FX7 A;  5LJ5 e;  5KE3 A;  5GMK h;  4AMC A;  1KD1 R;  2LVM A;  4RKU E;  2NUP A;  1VQ6 Q;  2LJ0 A;  3AHU A;  4QT7 A;  4AG2 C;  3CCM A;  2J7I A;  2B8A A;  4M75 C;  3BDL A;  5GAO r;  2DRK A;  2EKH A;  4XTY A;  3VU3 C;  1VQ8 Q;  2KRO A;  9ATC B;  4Y92 A;  2EQM A;  2K5F A;  3OYH A;  4A4F A;  1Q95 G;  1WJQ A;  1Q82 R;  2J05 A;  3LX7 A;  1YN8 A;  3JCM P;  1ZUY A;  2HCK A;  4JZ4 A;  2D1X A;  1T0J A;  3SB2 A;  1ARK A;  1OX8 A;  2XK0 A;  4Z8A A;  2M02 A;  5GMK i;  3G4S Q;  1M27 C;  1UHC A;  4PJN A;  4CC7 A;  4OP0 A;  1SHG A;  4L59 A;  1QMC A;  2V1Q A;  1WI7 A;  4KGV B;  1YJN A;  4A4G A;  1VQP T;  3VYG A;  3RUX A;  4M7D B;  1MMD A;  2NUT A;  4BE2 A;  1VQ7 T;  4UC4 A;  3CCV Q;  4PL6 A;  1VQ5 Q;  2RQV A;  4JRI A;  2VGM A;  2X3W D;  2R5M A;  1G2B A;  5CKF A;  2E65 A;  1KFZ A;  2O2O A;  2RHY A;  1WJS A;  5DLO A;  3CCL A;  2ROL A;  1BCO A;  2RHZ A;  1K0S A;  1VQ6 T;  4RMO A;  3OYB A;  4MML A;  3JB9 I;  5IHI A;  4IUT A;  1PC0 A;  1AD5 A;  5IT9 E;  1VQN A;  2O9V A;  4PJO C;  1VQ8 T;  3I5R A;  4MDX A;  2JTM A;  2DF6 A;  3EHQ A;  4C92 C;  4JJN K;  2EVR A;  2AIR B;  4M7D A;  3LGL A;  3X28 B;  1QCN A;  4EDU A;  4M77 C;  4B6M A;  2QA4 T;  3FRN A;  3F70 A;  3THK A;  2BUD A;  5KYW B;  1VQM Q;  1G3T A;  1NPR A;  3A8M B;  3FDR A;  3V8J A;  5FRN A;  1UEB A;  2F1L A;  2QTV A;  2FHD A;  3G4S T;  2WSC E;  1AWO A;  4C8Q C;  3OYI A;  4ZN1 A;  1B34 B;  1M1K R;  2QEX A;  2LCC A;  5GAN 4;  2CRE A;  1WXT A;  1QCF A;  5LJ3 g;  5C6S A;  1JRI A;  2FL7 A;  3H9N A;  3SWN C;  1M30 A;  3CCV T;  4AT1 B;  3UF4 A;  4M7A E;  3X26 B;  2GBQ A;  3JB9 D;  4J9B A;  3URG A;  3QKJ A;  2EYQ A;  3OSV A;  1M3A A;  5GAM e;  4E7J A;  4PFZ A;  4E7K A;  2DL8 A;  2F5T X;  3ER0 A;  1B34 A;  1W1F A;  4HVW A;  1N9S A;  1WPY A;  2V26 A;  1TUD A;  1ZA1 B;  2P0Q A;  3IQL A;  2EW3 A;  5LJ3 f;  2BE9 B;  2DXC A;  1M1G A;  4OMF B;  5L23 A;  4M7D D;  5GAN 7;  2PTK A;  5D6X A;  5GAN j;  4X9D A;  5EC7 A;  1VQM T;  1XOV A;  2C0I A;  1YJ9 Q;  1G5V A;  4M75 G;  1GXI E;  5KYN A;  2BKD N;  4J6X A;  3G1J A;  1RAB B;  4F7U G;  4XTW A;  5LJ5 h;  2YLC A;  3CXC A;  3I9Q A;  3EAE A;  1M90 C;  1YWO A;  2BIV A;  1N8R U;  2GGR A;  1PWT A;  3QDR B;  3J80 E;  2QQB A;  2RHX A;  3REA B;  4VUB A;  4JJC A;  2EQJ A;  4O6J A;  2WSF E;  2AKK A;  2K5L A;  1PD0 A;  3CC7 A;  4V2S A;  1KHI A;  4FW2 A;  3CME A;  2KMT A;  1K9M R;  1KHC A;  5FU6 B;  4IUU A;  4XK8 E;  5D6W A;  2RJF A;  5GAN 8;  1IO6 A;  3M56 A;  4HVU A;  3M4Y A;  1K8A R;  4JLI A;  4DEX A;  1WHH A;  2HD0 A;  3OA6 A;  2M1H A;  1N27 A;  1SPK A;  1G3W A;  3A8L B;  2XID A;  2QYZ A;  4M78 F;  3S3O A;  1YJ9 T;  2HQE A;  2VKN A;  3MP6 A;  2HNI A;  4ZN3 A;  2PUK B;  4M7A C;  3NTI A;  1P92 A;  1K4U S;  2PU9 B;  3PMI A;  4FYW B;  2VV5 A;  3OS1 A;  1C0M A;  2FG0 A;  1WDX A;  4HCK A;  4HT8 A;  2H3E B;  2QQS A;  3M0U A;  4Y91 A;  3CCM Q;  3UA7 A;  3VRY A;  2AT1 B;  1K73 C;  4KRT A;  2EJG A;  4C8Q G;  1K73 U;  4J9D A;  2WAC A;  3JV3 A;  2D6F A;  5FRO A;  3UDC A;  1QVF P;  4DOV A;  3EFR A;  1T3S A;  1DJ7 B;  5KYX A;  1YI2 A;  3ULR B;  1M8V A;  2BTT A;  3A8O B;  4N4H A;  3V7R A;  2D0N A;  4BAC A;  1GCQ A;  2RM4 A;  3R6N A;  2KYB A;  1RUW A;  1TS9 A;  1UEC A;  2E4H A;  2FZK B;  3HL8 A;  4Z02 A;  1I5L A;  3S3N A;  3JRZ A;  3P8B B;  2HBP A;  2DA9 A;  4BDY A;  5KE2 A;  1KQS P;  2KGT A;  2CP2 A;  3FB9 A;  3QJY A;  3BE3 A;  1MMG A;  5GAM h;  4WTO B;  1SRL A;  4HKE A;  2R57 A;  3QPH A;  2K9G A;  4E6R A;  2W0Z A;  3M54 A;  3T9N A;  1QLY A;  3A8H B;  2P0K A;  1OV3 A;  1Y71 A;  3CCM T;  1X6G A;  3A98 A;  1YJW T;  2YT6 A;  1AWW A;  2R58 A;  3PIP A;  4ZGE B;  1C1A A;  1VQN Q;  2EGE A;  5CO7 A;  1NLP C;  3QWY A;  4FSX A;  1RI9 A;  3OYE A;  3WVD B;  4Z89 A;  2QK0 A;  2J6K A;  1Q7Y C;  3EGX A;  1BI1 A;  3P8H A;  4OMN A;  1Q7Y U;  1ZUK A;  1I1J A;  2LX9 A;  3L42 A;  1W70 A;  2RN8 A;  1RAI B;  5J26 A;  4EPC A;  5LJ3 d;  4PJL A;  3QHS A;  3L2V A;  2K3X A;  1OOT A;  1QVG S;  1PD1 A;  2QEX Q;  1WGS A;  2OTJ A;  2CP6 A;  4ANJ A;  4O5V A;  3TSW A;  1YIJ Q;  1SKU B;  4GLK A;  2NLU A;  1KJW A;  4M75 B;  3CCU A;  1GFC A;  2KQW A;  3C4S A;  5IN1 A;  3HPW A;  1OI1 A;  4IIO A;  3H0I A;  1B3Q A;  1Q86 U;  2MWO A;  4M78 C;  3MO8 A;  2G6F X;  4LDW A;  2DMO A;  2EQI A;  1MGQ A;  1YCS B;  3L2Z A;  3JB9 H;  3CC4 A;  2GTJ A;  1VQN T;  2E10 A;  4N0A C;  2QQA A;  2EQU A;  2DVE A;  2ED1 A;  1QVG A;  3ZL7 C;  1V1C A;  4M4Z A;  1VYV A;  1WA7 A;  1Z9Q A;  3NPF A;  1ZUU A;  4M75 A;  2LT4 A;  3S3M A;  2YXY A;  2DTO A;  4PFP A;  2CP0 A;  2RPN A;  2HQH A;  5LJ5 g;  3E9G A;  3EHR A;  2VGN A;  3VS4 A;  4DBQ A;  4F7U A;  1JB0 E;  2QEX T;  4QVD A;  1NJI C;  5CR2 A;  1NJI U;  4LDV A;  4MZT A;  1YIJ T;  4ZTF A;  2DIL A;  2Z0W A;  4OB2 B;  1QCO A;  1TUC A;  4J6Y A;  1KQ2 A;  1X6O A;  5A0D A;  2JUF A;  1ABO A;  2FO0 A;  2VYT A;  5J39 A;  4PJO B;  2RH2 A;  3U23 A;  4C92 B;  4DQ2 A;  1HSQ A;  3CC7 Q;  2NYS A;  1RAG B;  2I2L A;  4J9G A;  4M77 B;  1Y07 A;  3OS5 A;  3OW2 P;  1OPK A;  3RBB B;  1OU9 A;  4LDX A;  3N5B B;  3DB3 A;  3M0Q A;  3HTR A;  1SRM A;  1VQ4 A;  2KI7 A;  3VS1 A;  2KY9 A;  2D8J A;  2LT1 A;  3HFO A;  2C0T A;  1WHJ A;  3OYJ A;  3X24 B;  3PVL A;  1EX4 A;  4M75 E;  3UA6 A;  1SSF A;  1WHK A;  4XTX A;  3SWN B;  1KD1 C;  4PJO A;  1B7T A;  1LPL A;  3DKM A;  4C92 A;  1KD1 U;  1W2B S;  4F7U E;  4J7F A;  2JW4 A;  2CUD A;  1BI2 A;  1I81 A;  2YRC A;  1PSF A;  4M77 A;  3KXT A;  1H64 1;  5L8R E;  5GAN e;  2PVO B;  1OPL A;  1QW1 A;  2MIO A;  3OS0 A;  2WSE E;  2OX7 A;  4YTL A;  1VQ9 A;  4C8Q A;  4XU1 A;  1Q82 U;  2CSQ A;  2O31 A;  4NL2 A;  1TU0 B;  2XIC A;  1M2V A;  1VA7 A;  4K11 A;  2KBT A;  5HK0 A;  1SEM A;  2H3J A;  3SWN A;  4A53 A;  3RMQ A;  1YI2 Q;  1R77 A;  4E47 A;  4LD6 A;  1CSK A;  1D0X A;  1NG2 A;  2DK3 A;  4ZGD B;  2O9S A;  4FU6 A;  3A8G B;  1VQK A;  1MHN A;  3GNG A;  4C5E A;  1OEB A;  2CDT A;  2A7Y A;  3CPW S;  1LVK A;  2VXE A;  4ME7 A;  2AKL A;  4M78 G;  1G8X A;  1VOM A;  2ATC B;  2NUP B;  2YUQ A;  2ZCF B;  4C92 E;  2QDY B;  4PJO D;  1SSH A;  5LJ3 j;  5FU7 C;  5IXB A;  2E12 A;  4EMG A;  3JCM W;  1ZQ1 A;  4C0D C;  3VS0 A;  3C94 A;  4JPB W;  4IUP A;  4M77 D;  3O5Z A;  4LXC A;  3C95 A;  1UHF A;  1NYF A;  3OYK A;  4C8Q E;  3OSS C;  3HRT A;  2E70 A;  2W10 A;  3CPW A;  2JMC A;  1RLQ C;  1M1K U;  1YI2 T;  2K6D A;  3JSC A;  3EG1 A;  4L5G A;  2CP7 A;  3CC2 T;  1WQ7 A;  2NUT B;  2HDA A;  5J3B A;  3EH2 A;  1BI3 A;  3CCR A;  1S1N A;  2FZG B;  4M7A B;  2DL5 A;  2MOX A;  1VIE A;  2XDB A;  4BI4 A;  5FRM A;  2HL3 A;  2JXB A;  1U3O A;  1QWE A;  1U5S A;  4RG8 A;  2EYX A;  1O75 A;  3QYG B;  3TRE A;  3EGU A;  3BFM A;  1UUE A;  1NM7 A;  3INZ A;  3CCU Q;  2RNA A;  2EQK A;  2C0O A;  4BD3 A;  2XU8 A;  4QVC A;  3RIR A;  2LC4 A;  5GAO n;  4PKC C;  4JDS A;  1KSW A;  2AZV A;  4OMP A;  2D8H A;  4IUV A;  1IHW A;  2XHC A;  4RTZ A;  2LDM A;  4Y28 E;  3JCM X;  4BDZ A;  1PNJ A;  3CBP A;  2QDL A;  1Q81 R;  1LCK A;  1VQL Q;  1HD3 A;  3CCS A;  5ECA A;  2VB6 A;  1RAH B;  3E1S A;  2RJD A;  2DJZ A;  4M7A A;  3CC4 Q;  2YRD A;  5I21 A;  5CQY A;  1TH7 A;  4ZNX A;  4EMH A;  1D1B A;  4XTZ A;  4CC3 A;  1IGU A;  3PT9 A;  4ATO A;  3HRS A;  3LWH A;  2ESW A;  4BY6 C;  2OTL A;  1VYT A;  1YP5 A;  2FEI A;  2JJ9 A;  3VS5 A;  1OYX A;  2OI3 A;  3JCM h;  4ORZ A;  5LL6 S;  4JZ3 A;  5GAN h;  4IUQ A;  1SG5 A;  4D6W A;  5A0G A;  3OYC A;  4PNO A;  1WZO A;  1VQO A;  2DTI A;  4OMO A;  2LJ1 A;  3OMG A;  4HCZ A;  3LWI A;  3CCU T;  2E5K A;  2LQW A;  3MEW A;  3VUZ A;  1K9M C;  1PG5 B;  3P8D A;  2DD5 A;  2DL4 A;  2RD1 A;  3RNJ A;  1K9M U;  1LNX A;  1VYU A;  3JB9 F;  3M55 A;  2EAY A;  1VQL T;  1K8A C;  4PLL A;  1FMW A;  1K8A U;  1VQ5 T;  3CC4 T;  4M7A D;  1KQS S;  1RAE B;  2DD4 A;  3CXC S;  2XG8 D;  2ZPI B;  3UWN A;  4DEY A;  3NFC A;  1YWP A;  2GNC A;  2VVK A;  3BY7 A;  2MF2 A;  1IRE B;  2F2V A;  1QVF A;  4M7D F;  3OYY A;  5IHK A;  3CEY A;  3RKY A;  5KYY A;  2O4X B;  1LJO A;  1U1S A;  3JCM Q;  2DZ9 A;  1BKB A;  4BI3 A;  1GFD A;  1PKS A;  2EJF A;  1M3C A;  2DNU A;  2EFI A;  4ELY C;  1N6A A;  4M78 B;  4J9E A;  3VV0 A;  2EGC A;  3PFS A;  1VQ9 Q;  1F1B B;  3VS7 A;  4AFS C;  2RF0 A;  2V8I A;  4X9C A;  2YLB A;  3M58 A;  3HHT B;  4J6W A;  2FB7 A;  2JZ2 A;  2KXD A;  2KRN A;  3BDU A;  5GMK l;  1KQS A;  2O88 A;  1ZSG A;  2DBK A;  4ZGJ B;  1N8R C;  1TOV A;  2O4X A;  1AOJ A;  4J9H A;  4KGZ B;  1YNZ A;  2MAM A;  4IKF A;  1U06 A;  4JJD A;  1VQK Q;  1N5Z A;  2LRQ A;  2COZ A;  4KUL A;  1KC8 R;  2E6Z A;  4M78 A;  2KT1 A;  1UG1 A;  3RMS A;  1WHG A;  5CKH A;  2ZZD A;  2RQT A;  2D0Q B;  3VS2 A;  3OYL A;  5FLX E;  2L5Q A;  4X1V A;  1WFW A;  1QWF A;  4N0A A;  1QQJ A;  2A3L A;  5FWB A;  3CPF A;  1WNL A;  5DLQ E;  2Y4X A;  1WLP B;  1Y57 A;  2DJQ A;  1UGV A;  2JVV A;  1ZA2 B;  4FT2 A;  1W4S A;  2PQW A;  1UGS B;  1NEB A;  1VQ9 T;  5KYX B;  1Z9Z A;  2RQU A;  3I56 A;  1UJ0 A;  1AZG B;  4F04 B;  3OS2 A;  1RAF B;  4C5H A;  1JXM A;  2KSS A;  1WX6 A;  3MKD A;  3OYA A;  2V8J A;  2KVQ G;  5HK3 A;  2JOY A;  2ZPB B;  2ZPE B;  3SDZ A;  1S72 A;  1VQK T;  3V7S A;  1I5O B;  3Q1J A;  1LOJ A;  3M53 A;  4M78 E;  4QW2 A;  3NHN A;  5LJ5 j;  4CRI A;  3I55 A;  1VIF A;  4F17 A;  2YRV A;  2BZ8 A;  2YHT A;  1M4Z A;  1QKW A;  3OW2 S;  2X4X A;  3TQ7 P;  2JS0 A;  1GCP A;  6AT1 B;  2JNG A;  4J83 A;  4ESR A;  3L2W A;  2RQW A;  1EFN A;  2K3B A;  5GAO l;  2ABL A;  2CYZ B;  1YJN Q;  2MWP A;  2SEM A;  2DXT A;  2JN0 A;  3CCS Q;  3EGX B;  4II1 A;  3M9Q A;  2K2V A;  1JQQ A;  5LJ3 e;  4DBR A;  2E6N A;  2A36 A;  2GFA A;  2QGF B;  3FJ5 A;  2FYK A;  1CKB A;  3QUI A;  3X20 B;  1UGQ B;  3FC3 A;  4OB0 B;  3REB B;  1M90 R;  3MEU A;  2KEA A;  2ZPG B;  3CCL Q;  4JJB A;  5C0M A;  3MPU B;  2QAZ A;  1D0Z A;  1QP2 A;  2CT4 A;  3JCM g;  2OTL Q;  2LJ3 A;  4NS5 A;  2P0P A;  1WIE A;  1JEG A;  1BK2 A;  4JRK A;  3OW2 A;  2RI2 A;  2K57 A;  2HKQ B;  4QVZ A;  4C0D B;  4PJJ A;  3MJX A;  2CUB A;  2EWN A;  2KYM A;  4P5N A;  2QGG A;  1VQ7 A;  4C0G A;  3J7A F;  5CKB A;  1OX9 A;  3E19 A;  3VJP A;  2ED0 A;  4CC2 A;  2M0Y A;  3NMZ C;  2L3S A;  1YJN T;  2K2M A;  1BI0 A;  1AWX A;  3CCS T;  1PM3 A;  5HKC A;  3M0R A;  2XDD A;  1VQ8 A;  2RMO A;  4NOY A;  1RAA B;  3EFO A;  4FYY B;  4F16 A;  3MP8 A;  2F5K A;  3X25 B;  4F7U B;  1Q86 C;  1E6H A;  2RHU A;  3CCL T;  1M1F A;  1CKA A;  1BYM A;  3H0H A;  2QA4 A;  3EG2 A;  3ME9 A;  1JO8 A;  2DET A;  2VWF A;  1TG0 A;  2HL5 C;  2HSE B;  5IH2 A;  1AVZ C;  3LLR A;  3M0S A;  3GNF B;  2L3P A;  5FW9 A;  1X27 A;  3UPU A;  2EGA A;  3WVE B;  3G6E A;  1ABQ A;  5GAM j;  3OMC A;  2CS7 A;  3CCV A;  5HCK A;  1WYX A;  1G3S A;  2JT4 A;  4LN2 A;  3S6W A;  2NUZ A;  1BBZ A;  1JU5 C;  4LE9 A;  3CBO A;  5IHN A;  3JB9 G;  2CP5 A;  2ENM A;  2VC8 A;  4E7L A;  5A0L A;  2P4R A;  2YDL A;  3KFV A;  4FM4 B;  3WXM B;  3LH5 A;  3M57 A;  3HFN A;  4IIM A;  3PIO A;  4BUG A;  4KT0 E;  1TUG B;  3CME Q;  1FMV A;  1D1C A;  4M7D G;  3DB4 A;  3QJ6 A;  5LJ5 f;  1AZE A;  5DM7 R;  3GF5 A;  4C8Q B;  4FCY A;  1H92 A;  4RTU A;  1M2V B;  4FIB A; 
#chains in the Genus database with same CATH homology
 3CCM Q;  3CME Q;  1YJW Q;  1JJ2 P;  1VQP Q;  3G4S Q;  1M90 R;  3CCU Q;  1N8R R;  3CCE Q;  3CCL Q;  1S72 Q;  1Q86 R;  3CPW P;  1VQ7 Q;  1VQ8 Q;  1VQO Q;  3CMA Q;  1VQM Q;  3OW2 P;  3G6E Q;  3I56 Q;  3CCR Q;  1W2B P;  1K9M R;  2OTL Q;  1QVF P;  1YJN Q;  1YI2 Q;  2QEX Q;  1Q81 R;  1M1K R;  2OTJ Q;  1VQN Q;  1VQL Q;  3CCS Q;  1YHQ Q;  3CCJ Q;  2QA4 Q;  1VQ4 Q;  3CCV Q;  1Q82 R;  1Q7Y R;  1VQ5 Q;  3I55 Q;  1KQS P;  3CC2 Q;  3CXC P;  1QVG P;  1NJI R;  1YJ9 Q;  1VQ9 Q;  1K8A R;  3CCQ Q;  1VQK Q;  1KD1 R;  3G71 Q;  3CC7 Q;  3CD6 Q;  3CC4 Q;  1YIJ Q;  1YIT Q;  1VQ6 Q;  1KC8 R;  1K73 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...