1X6BA

Solution structures of the sh3 domain of human rho guanine exchange factor (gef) 16
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
GSSGSSGWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the SH3 domain of human rho guanine exchange factor (GEF) 16
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine exchange factor (GEF) 16
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x6bA01
1I07A 2L3PA 5IHKA 2GTOA 1SEMA 2CH4W 2A28A 2GNCA 2YT6A 2LCSA 1M3AA 3O5ZA 3VS5A 1UFFA 3EG3A 2O2OA 2O9VA 1MV3A 2KRSA 2LQNA 1ZSGA 4E6RA 1EFNA 1K76A 1WXUA 1ZUKA 2X3WD 3EHRA 3H41A 4LN2A 4Z8AA 2DBKA 1GFCA 2BTTA 2F2VA 2K9GA 4CC3A 1PNJA 2JM9A 3REAB 1TUCA 2KBTA 2OJ2A 1JU5C 4J9IA 2NWMA 2PZ1A 2KR3A 2J7IA 2F2WA 1GL5A 1JXMA 2CSQA 1E7OA 2ESWA 3EG1A 3VRYA 4A63B 5I22A 1E6GA 4RUGA 4F16A 1HJDA 2DA9A 1YCSB 2KT1A 4AG1C 5L23A 1BK2A 1W6XA 3VS6A 3EG0A 2YUQA 1NYGA 1T3SA 1W70A 1UG1A 3H0HA 1UJ0A 1SSHA 1X43A 2HBWA 4J9FA 1WLPB 1M3CA 2CSIA 2FPEA 2DJQA 2EKHA 1X2KA 1AWWA 1OPKA 1QKXA 2JM8A 2RQUA 1NYFA 2DMOA 3GBQA 2P4RA 2V1RA 1OEBA 2RF0A 2VVKA 1T0JA 2SRCA 2A08A 1U06A 1YP5A 2LX7A 1M27C 2O31A 4R0KA 2DBMA 2CDTA 1NLOC 2LJ0A 2ED0A 1M8MA 5EC7A 2YUNA 2C0TA 2V1QA 2OAWA 1UHFA 1GRIA 4HCKA 1IO6A 4CC2A 1TG0A 3H0FA 4AFUC 3IQLA 3FJ5A 1J3TA 2RNAA 1GCQC 2DLPA 2KRNA 1PWTA 1AZGB 2DE0X 2FEIA 1QKWA 1I0CA 2JXBA 1RUWA 2D1XA 5GJVB 1CKBA 1KSWA 3CQTA 3PVQA 2K79A 2FRWA 5IXBA 1G83A 2YUPA 1SRLA 5I11A 1RLPC 3R6NA 5GJWB 1X69A 2LNHB 5ECAA 1K4US 1MV0B 3LH5A 1UTIA 1N5ZA 2GBQA 3ZL7C 4ORZA 4F14A 1B3QA 1KFZA 2PNIA 2KYBA 2HCKA 2EGCA 4CC4B 1BBZA 1CKAA 1SHGA 2DF6A 2RQVA 3VS1A 4JJDA 3PVLA 2KXCA 2CUBA 2EGEA 1GBQA 1PKTA 3M0QA 2JMAA 4EIKA 2L0AA 2AZSA 3U23A 1AWOA 4J9GA 2FRYA 2JS0A 1X6GA 2RN8A 1M3BA 2O9SA 2DL8A 1ZX6A 4JJBA 2D8JA 2ENMA 4OMLA 4AFQC 3UA7A 1SRMA 2HSPA 2YSQA 3QWXX 3EG2A 2W0ZA 4RTVA 3NMZC 2ROTA 3M0SA 2KEAA 4RTTA 3EGUA 4HXJA 4HVUA 1KJWA 2BZYA 3SEMA 2VKNA 1ABOA 1WXTA 3I35A 2QDLA 2JT4A 4J9EA 3NPFA 1ZUUA 4ZNXA 2J6KA 2DVJA 2X3XD 3NHNA 4GLMA 3TSWA 2GGRA 1SHFA 1Z9QA 4RTXA 1FYNA 2ECZA 2A36A 3VS0A 1AVZC 1K1ZA 2IIMA 2KYMA 2RQTA 2DL4A 1UHCA 1QWEA 5IXFA 1VYTA 1YN8A 2L2PA 1VYUA 1SPKA 4RTWA 2EW3A 5HCKA 1AWXA 1JQQA 1RI9A 2C0OA 1UGVA 2GQIA 1T3LA 2DM1A 5IH2A 4IIOA 1UECA 1JEGA 4AFSC 1OPLA 1GCPA 2FPFA 2DL3A 4D8KA 4AFZC 2CT3A 2I0NA 1WI7A 2CUDA 4J9DA 1OOTA 2KROA 5FWBA 2GTJA 2LP5A 2O88A 2DYBA 3JV3A 1WFWA 2KT8A 4AG2C 2JTEA 2JMCA 3ULRB 2EQIA 2EYYA 2F2XA 2FO0A 1H3HA 5FWCA 2EYXA 2DNUA 3I9QA 1UDLA 1U3OA 2RPNA 1Y57A 1CSKA 1WA7A 2BZ8A 2DRMA 4HVWA 1BU1A 1NEGA 2K6DA 3RBBB 3THKA 1GFDA 3VS3A 2DRKA 2YUOA 1KIKA 4LUEA 2JS2A 2J06A 1VA7A 1FMKA 3UATA 2K3BA 2NUZA 2W10A 1LCKA 5FW9A 1H8KA 4JZ4A 1QCFA 1TUDA 1NEBA 4ESRA 1QLYA 4RTUA 1G2BA 1NM7A 2E5KA 4WCIA 4HVVA 1YNZA 4LUDA 1AEYA 2LMJA 3VS7A 1NG2A 3PE0A 2AZVA 2AKLA 1WXBA 2EBPA 3M0PA 1VYVA 4K11A 2G6FX 4Y92A 1M30A 1GBRA 1T0HA 2FPDA 2D0NA 3TSZA 1ZLMA 2D8HA 2DILA 1JXOA 2AKKA 4DEXA 3I5SA 1ABQA 1WIEA 4OMNA 1W1FA 2KRMA 1WX6A 3UF4A 4OMMA 1Z9ZA 4J9CA 2CH4A 2CT4A 1PHTA 2LZ6B 2FG0A 2DX1A 1XOVA 4X1VA 3M0TA 4M4ZA 2EPDA 4QT7A 2K2MA 1GCQA 4J9HA 3UA6A 2ABLA 2EGAA 2EYZA 1YWOA 1JO8A 1UE9A 2L3SA 1I1JA 5IHIA 4DEYA 2KNBB 1OV3A 2C0IA 2PTKA 1HSQA 2J05A 1S1NA 1NLPC 1UJYA 4J9BA 2HEQA 1X27A 2JW4A 2MOXA 3A98A 4LNPA 1PRMC 4LE9A 2SEMA 2DL5A 4JJCA 3REBB 3KFVA 1UUEA 4F17A 3TVTA 1E6HA 4CC7A 1QWFA 1K0XA 4JPBW 1MUZA 2HDAA 1ZUYA 2OI3A 2RMOA 2EYWA 3QWYA 1ZBJA 1Y0MA 2DL7A 1A0NB 2M0YA 4IIMA 1B07A 4KRTA 3VRZA 2LQWA 4OMQA 1K0SA 1RLQC 2BZXA 4RTYA 1AWJA 1AZEA 2MIOA 3NGPA 2J6FA 4RTZA 2RQRA 1X2QA 1HD3A 1K9AA 2MCNA 3C0CA 2ED1A 2EVRA 4JZ3A 1U5SA 2CREA 2KGTA 2YDLA 1V1CA 4FSSA 1H92A 2J6OA 3VS4A 2B86A 1AOJA 3M0RA 2H8HA 2KE9A 1AD5A 4Z89A 4GBQA 2K7AA 4OMPA 2ROLA 2KXDA 2RQWA 1PRLC 3I5RA 1X6BA 4OMOA 4Z88A 2L3QA 3SHWA 2A37A 3EHQA 3RNJA 1WYXA 2LJ1A 1YWPA 1ARKA 1BB9A 2AK5A 3M0UA 5IHNA 2XMFA 2M51A 3H0IA 1PKSA 2VWFA 4D8DA 2LJ3A 1WDXA 3VS2A
chains in the Genus database with same CATH superfamily
5J39A 1YIJA 1NJIU 3S3NA 3VYGA 2GQVA 3EGDB 2KQWA 3CMAT 4A4HA 3E19A 1WPYA 1WQ7A 3CC7A 1ZBXA 3GIBA 2X3WD 2KAFA 2CZ7B 3QZ5B 2DBKA 1GFCA 1PNJA 3EGXA 2KBTA 4OB3B 4OB1B 1JU5C 4J9IA 2KR3A 2J7IA 3E2UA 4M7AD 3HRUA 3PNWC 2MI6A 4A63B 1E6GA 4RUGA 5GAN2 3QKJA 1VIFA 1VQ7Q 2M16A 5KYXA 1BK2A 3QZ9B 2XHCA 2MF2A 2GFAA 1NYGA 1Y71A 1YJWQ 8AT1B 3OYMA 1RAAB 5CAIA 3GNGA 3H0HA 2KMTA 2QK0A 2X4XA 4DBFA 4JJNK 1G3SA 4J9FA 3CC4T 4E7IA 2V8JA 3HL8A 1U8RA 3OYAA 4XTYA 2FYKA 2DMOA 2JVVA 3OB9A 1M2VB 1B7TA 5KYUA 1T0JA 2L8DA 2CP2A 1C6VX 3CCLQ 2LX9A 4C92F 4R0KA 2DBMA 5FU7C 2CDTA 3MO8A 3CD6A 2R5AA 2EJ9A 4M77E 5CK9A 2C0TA 3P8HA 5KCOA 3QIIA 3OYYA 1UHFA 4HCKA 3KBGA 1TG0A 3CPWP 3H0FA 1QCNA 3IQLA 1LPLA 1GCQC 4NL3A 1VQ4T 1AZGB 2FEIA 1I0CA 3A5ZB 2CKKA 5GJVB 1CKBA 4J6XA 4V2SA 1B34A 2K79A 5GAOm 5IXBA 2E12A 5GJWB 2LNHB 5ECAA 4NL2A 2OTLT 1WGSA 4C92A 1W2BA 3META 4OP0A 2XICA 3FRNA 2DAQA 4N4HA 2D0QB 2F69A 4ORZA 4ELZC 4Z02A 4M7DA 2GFUA 2K3XA 4FSXA 1KFZA 2DETA 4M77B 2PNIA 4M78A 2EQMA 1VQNQ 1BBZA 2V26A 2RQVA 3LW5E 1BI3A 2AT1B 4JJDA 3CMEQ 5GAOp 2BIVA 1PKTA 3SWNB 5LJ5j 3KUFA 3QXEB 1OZ2A 2NUPA 4C92C 1JBMA 3U23A 3CCST 1LJOA 1KQSA 4BE1A 1PD0A 2E5QA 4QW2A 3JCMe 1LVKA 4XTXA 2BE7D 3CCMT 3HP9A 2KK4A 3FEOA 4O6JA 2ENMA 1SRMA 2OTLA 2YSQA 2RHUA 4OB0B 3EGDA 3TCJA 4RTTA 3EGUA 4L5GA 1WJSA 4HVUA 1C1AA 1YI2Q 4LXCA 3CCJT 1PSFA 4C8QA 4M7AE 1WXTA 1XQHA 5CKHA 1G3TA 4J9EA 4J7FA 2QA4T 1ZUUA 4PJOB 3P8DA 2RHZA 4KUIA 2CP3A 1SHFA 1ZSZB 2DD4A 2VGNA 2QQBA 1KD1R 2KYMA 4C92G 4MDWA 1QWEA 1VYTA 3CC2A 3CC4A 4PJOG 1VYUA 3GF5A 3JCMV 4F7UE 3CC2T 5CQXA 1JJ2A 1VQKQ 1D3BB 4M7DD 4OGEA 1M9SA 1WJQA 4C92B 1JQQA 4M78D 4ME7A 3S6WA 3GOXA 2R5MA 2ZPEB 2DL3A 2XI9A 4HCCA 3QHSA 4E7HA 5FWBA 4EDUA 4WTOB 4EMGA 5GAMg 3V7SA 2EYYA 2QXFA 4C0GA 1LOJA 5FWCA 3V8JA 1H3HA 2EYXA 2DNUA 3I9QA 1UDLA 2RHYA 2RPNA 3DB3A 1YHQA 3RERA 1KG1A 1QCOA 4MDXA 1D1BA 4F04B 3G6EQ 4HVWA 4M7DF 1GFDA 1ZA1B 3JCMh 2DRKA 4M78F 2DXCA 3UT1A 3CCVT 2R58A 1VA7A 1VIEA 3FLGA 2NUZA 2W10A 1LCKA 2DEQA 3RESA 4JZ4A 1QCFA 3CEYA 2E5KA 2K5LA 2DZ9A 4E7KA 1YNZA 1VQ4A 2E41A 4NOYA 3I55Q 1YITT 3ZBDA 5GANd 1VQMT 1G8XA 1N6AA 1M1KR 1NG2A 3CBOA 1W2BS 2JOYA 2IPOB 3M0PA 1YHQQ 3URGA 4K11A 1KHIA 4N4GA 4XU0A 2RH2A 3TSZA 1UEBA 1ABQA 1W1FA 2DZCA 2RJFA 4X34A 3PMTA 3WVDB 1WHMA 4BY6C 3I56T 3EFRA 4PJOF 1BCMA 3CXCP 1PHTA 2X35A 4J7IA 7AT1B 2FG0A 2DX1A 1VQ9T 5DM7R 2K2MA 3MEUA 3GLXA 3UA6A 3EFOB 2ABLA 2EGAA 3LX7A 3M57A 2JN0A 2QASA 1UE9A 2X4JA 2VGMA 4DEYA 1BI2A 2A7YA 1VQ6T 2KNBB 4FYYB 2C0IA 2FL7A 1S1NA 4C0ZA 2RK2A 3JCMQ 4B9WA 2EQJA 3WVEB 4PJOC 4MMKA 1X6OA 2SEMA 2LCCA 5LJ5e 3L2QA 4M7DE 1RAIB 5GAMj 3TVTA 3OW2P 3QJ6A 1E6HA 5LJ5f 4TVRA 5GAMf 3EH2A 4LDXA 2YXYA 4C5IA 3VRZA 1GXIE 1MMGA 1RLQC 2RHXA 3MHXA 2XDBA 2L5QA 2YHTA 1YJNQ 1AZEA 3QDFA 2Y90A 1YCYA 4HCZA 2D6FA 4PFZA 2RQRA 3L2UA 1Q81U 1VQ5Q 2LVMA 1K9AA 4XTVA 2L3RA 3JB9J 3CCRT 4MZMA 2EVRA 4JZ3A 4Y91A 2CREA 4IURA 1WJRA 2B86A 4M77A 5FLXE 2H3JA 4M75A 2LTOA 3UWNA 1AD5A 2DFUA 2DK3A 2CZ0B 4A4KA 4GBQA 4Q5WA 2VXEA 2D9TA 2ROLA 2O4XA 1QVFS 5D6YA 4OB2B 1W4SA 2DVEA 2X4WA 1M2OA 3CD6Q 3PTAA 4OMOA 2NUPB 2L3QA 4Z88A 3RNJA 1WYXA 2OTJT 2LJ1A 1BI0A 3VUBA 2OTJA 2HSEB 1ARKA 1BB9A 2YRVA 2M51A 1K73C 3LH0A 3CC7T 3VS2A 1I07A 5IHKA 5GANe 2ZPGB 1SEMA 3G7ZA 1VQNT 2LCSA 1M3AA 3OYLA 4PJOA 3CMET 1C0MA 2P0KA 3JB9I 1JJ2P 1M1FA 1UFFA 4KGXB 1NE8A 1MGQA 3AHUA 1N9RA 2LRQA 3EHRA 4J6WA 4LN2A 4QKUA 2BTTA 2Y4YA 1OQKA 4XAXB 3L2WA 2R57A 1M2VA 2YLBA 3OMCA 2F2WA 2ESWA 3EG1A 3DKMA 4F16A 2DO3A 3OSVA 2VC8A 3E9FA 4JLIA 1O9SA 4KULA 1RI0A 5L23A 1W6XA 4IKFA 4PLIA 1T3SA 2QTXA 5GANh 2MYSA 3OYNA 3OA6A 3FB9A 4DOWA 4BI4A 1M3CA 2CSIA 1X2KA 1AWWA 2JM8A 2ZPFB 3PIPA 1RAFB 4J8OA 3LGLA 1KD1C 3CC2Q 2RF0A 2VVKA 3GNFB 3O8VA 1PC0A 2EQUA 3JAME 4E7ZA 3H6ZA 1YJWT 1IB8A 1YP5A 4AT1B 1M1KC 4ZTJA 2LX7A 1K8AU 3QPHA 2O31A 1FXXA 1IZ6A 1M8MA 4ZGEB 3OSSC 4RMOA 4RG8A 3CCSA 5CCAA 1GRIA 3SD4A 1YI2A 4BE2A 2EFIA 3FJ5A 2RNAA 3CPWA 1PWTA 2RJCA 3HKSA 4ZTFA 2XU8A 1S72T 3JCMd 3J81E 2FZGB 4XTWA 1QVFA 1PCXA 2HQHA 5KE2A 3EG9B 3CCQT 4M78C 1N5ZA 5GAMe 5GAOl 3ZL7C 1VQ4Q 1XTDA 4F14A 2KYBA 5C6SA 1K9MC 2DF6A 4JLGA 3PVLA 4JRQA 2HZYA 2CUBA 2EGEA 1GBQA 5GAN5 1KC8C 4X9DA 2PVGB 2JJ9A 1I5OB 2JMAA 4EIKA 3I55T 3VYHB 5CQYA 2VB6A 2FRYA 2JS0A 2RN8A 3TREA 3BDUA 3V7RA 4A4EA 3OS2A 3C12A 4FIBA 2XD0A 4PJJA 5CKDA 4JJBA 4E47A 4OMLA 2DIQA 3QWXX 2W0ZA 3PT9A 1JB0E 2VYTA 2ROTA 1FX7A 3SEMA 1YFNA 2CS7A 4FYWB 2VKNA 3JCMg 3I35A 5A0LA 3RKXA 3M5AA 2JT4A 1VQOQ 3NPFA 3G71T 1M5Q1 2DVJA 2E65A 1Q7YU 3HSBA 2X3XD 2EKOA 4GLMA 3M4GA 1Z9QA 3CCLA 4RTXA 2M02A 1FYNA 1OX8A 2QG9B 3DB4A 3M55A 4FM4B 2A36A 1AVZC 2DL4A 4DBHA 1XJWB 1YN8A 4RTWA 1D09B 1VOMA 4E2FB 3JCMb 5I21A 3V7CA 3CCET 2HQEA 1D1CA 1RI9A 2MPXC 1NZ9A 2XG8D 4M75D 2YWWA 3BW1A 4JRKA 1UECA 5KYNA 1JEGA 5L8RE 1VQNA 4AFSC 5D6WA 1YBYA 4D8KA 4AFZC 2CT3A 2I0NA 2MK5A 2CUDA 1KHCA 1VQ6A 3OYBA 4J9DA 1OOTA 1VQLA 2GTJA 3N5BB 2O88A 4M75B 2E6NA 2DYBA 5GMKm 4BY6B 4AG2C 3ULRB 2WSFE 2FO0A 2F5KA 1U3OA 3NTIA 3NFCA 4RCBA 3T9NA 1CSKA 2BZ8A 2DRMA 2K2VA 2FVUA 4LDUA 5AT1B 2XDDA 4PJMA 3FC3A 3HRTA 4PJOD 3VS3A 1X75C 3RR6A 2IVWA 1KD1U 2EYQA 1VQPT 2DKGA 2VASA 3L1AA 2J06A 4J6YA 1MHNA 2JUFA 4F7UF 5DY9A 4RTUA 1NM7A 3CD6T 4WCIA 2BKDN 4HVVA 4HCBA 3CCVA 3SB2A 1AEYA 1M90R 3QJYA 4FL6A 2Z0WA 1WXBA 2EBPA 5I2MA 1OX9A 2RJEA 1Y96B 5KYXB 2L89A 2LDMA 1MNDA 2ATCB 1T0HA 4M7AF 2EWNA 1F1BB 2ZCFB 1K73R 1N8RR 1JXOA 4DEXA 3BFMA 1SSFA 4DA4A 5D6XA 5CVIA 3CCUT 1WX6A 2F1LA 3RMQA 2FHDA 1WQWA 3OYKA 1VQMQ 4C0FA 4ZGJB 3G71A 4F7UA 1AHJB 2EJGA 5GMKh 3PIOA 1XOVA 2HAXA 3M53A 1VUBA 2EPDA 1G5VA 2CP6A 4J9HA 3OBYA 1HXDA 1S72A 1YJ9A 2NLUA 2EYZA 3UDCA 2QQSA 2H3EB 1OYXA 2E4HA 1I1JA 2LQKA 3E1SA 5IT9E 4C5GA 2QA4A 4M7AA 1Y96A 2PTKA 1VQ9A 1HSQA 2VUBA 3JCMW 2PVOB 2PQWA 3FDRA 3A98A 2DL5A 3REBB 2E1HA 2K57A 2QQAA 1YJNA 4LDWA 4JPBW 1VQ8Q 1SG5A 1YJ9Q 3M59A 4RKUE 1Y0MA 4LDYA 2M0YA 2E3HA 3F70A 4XTZA 4PKCC 3CPWS 4RTYA 5FU7B 2HBPA 2MIOA 4DQ2A 2J6FA 4PJLA 1RAGB 4M78E 4B9XA 1HD3A 3JSCA 3H9NA 1VQKA 2DJZA 2YDLA 2J6OA 4C92E 2QDYB 1YJNT 4XU2A 2DTIA 2K7AA 4OMPA 4NS5A 2KXDA 2RQWA 5IAYA 1PRLC 3I5RA 1G3YA 5IN1A 3L2ZA 4A4GA 3QSUA 1QVGS 4IUVA 2DEUA 4ANJA 4C8QG 1N8RU 2OX7A 2QAZA 3DLMA 5GAN4 2AK5A 2XMFA 1QP3A 4D8DA 1U1TA 2LJ3A 1WDXA 1M1KU 1K8AC 2COWA 5GMKl 3CCLT 5GAOr 3MKDA 3QG1A 3CCUA 2A28A 2GNCA 4PL6A 2RB6A 3O5ZA 2KSSA 1Q82R 5HY6A 3SWNC 3VU3C 3MP1A 1D1AA 1MV3A 1I8FA 2P0QA 5HK3A 1P92A 2QGGA 2KRSA 4E6RA 1YJWA 2DTOA 4FT4A 1EFNA 4X9CA 1WXUA 1ZUKA 3CCVQ 4M75C 1JJ2S 2HNIA 2RJDA 2O4XB 4CC3A 5LJ3j 2JM9A 3REAB 1RADB 1FMVA 1TUCA 5D7UA 2YLCA 2EQKA 3HPWA 3I56A 1GL5A 1JXMA 1U1SA 2CSQA 5LJ3e 4BACA 1E7OA 5I22A 2HKNA 2RI2A 1HJDA 1QP2A 2DA9A 2JTMA 3JCMX 5GAMd 2LC4A 1N27A 1VQPA 5KYYB 2XDPA 1H3ZA 3G6EA 2QQRA 1W70A 1PG5B 1VQLT 4OVAA 2HQXA 2COZA 1UJ0A 3CCMA 1SSHA 2FZCB 3EAEA 1QVGA 2EIFA 2HBWA 5FU6B 3OW2A 1WLPB 3JCMP 4UC4A 2VV5A 2EKHA 1OPKA 2RQUA 1NYFA 3EH1A 2X4YA 4JS5A 1FWZA 4LD9K 3GBQA 3I56Q 3CCSQ 2P4RA 2V1RA 2DXBA 1K73U 3CCEQ 2SRCA 4MZPA 1ZQ1A 4QVDA 2XIDA 1BKBA 2ZZDA 4IUTA 1NLOC 4M75E 2ED0A 5EC7A 3SFMA 4IUQA 3G4SQ 4FW1A 2PU9B 3OYHA 4FT2A 4VUBA 1IO6A 3ME9A 4CC2A 4II1A 4AFUC 2P0PA 3QYGB 4J5YA 2DLPA 5GAN3 4B6MA 2JXBA 1RUWA 4N0AA 1BCOA 2D1XA 3ASKA 3CQTA 1YIJT 2FRWA 4L59A 3HHTB 1G83A 5I11A 5FRMA 1K4US 4FW2A 3LH5A 1UTIA 4PLLA 3C95A 1Q82U 4LD6A 5KE3A 1UGRB 2HCKA 1MMDA 3CCEA 1SHGA 4LDVA 2NUTA 4ELYC 4QQGA 5DLQE 3M0QA 2G3RA 2KVQG 2L0AA 3FJPA 2AZSA 3CCQQ 1AWOA 2JNGA 3RKYA 3LWHA 1YITA 1MNEA 4M78G 3DLLA 3CMEA 1UB4A 4PK4A 4CRIA 2RI5A 1TSFA 2D8JA 1V29B 4DBQA 3P8BB 5LJ5h 1QW1A 2ZPHB 2QGFB 5KYWB 3CCUQ 1Y7XA 4C8QE 3MEWA 2KEAA 2OTJQ 2A0FB 1N8RC 5GAN7 4PFPA 3S3MA 3CCJA 3CC7Q 1Q86R 4PNOA 1KQSS 2CZ6B 5CO7A 2GGRA 2ECZA 2RO0A 3VS0A 2K3YA 4E7LA 3JB9G 2IIMA 2QEXQ 2ZPBB 1UHCA 3QDRB 3JRZA 5IXFA 2RM4A 3FIFA 2L2PA 2OTLQ 1SPKA 1YITQ 4M77G 2DIGA 5HCKA 1Q7YR 3G1JA 3RUXA 3GP8A 1WHJA 4RG2A 1VQOA 2DM1A 5IH2A 4IIOA 4L6V5 1K8AR 4C8QF 1GCPA 2RD1A 2EJFA 3CMAA 3HFOA 1WI7A 2KROA 1Q95G 3BY7A 2LP5A 4KT0E 1WFWA 2BE9B 2KT8A 3X26B 2EQIA 2F2XA 2P4TA 2LQ8A 1ZSZA 3OYEA 1EZZB 2RK1A 5A0GA 3OMGA 1KQSP 1KQ2A 3VKIA 2K4YA 1WA7A 2LT1A 2I2LA 4C92D 3EG9A 4XU3A 1WHLA 3LGFA 3MPUB 4ZN3A 4E7JA 5KYYA 1QVFP 3X25B 2YUOA 2XKOC 1NPRA 5CKEA 2JS2A 3OYJA 3SDZA 3G4SA 5CIUA 3L2RA 2K3BA 5FW9A 1RAEB 2FZKB 1BI1A 1NEBA 1W2BP 4N4IA 5GANg 4KUDK 1M90C 4LUDA 2LMJA 4C0DC 5EG2A 3VS7A 4A53A 1VQ7T 3KXTA 1D0XA 1TOVA 5GANf 1G3WA 2G6FX 1OI1A 1QMCA 1OULA 2MWOA 4XU1A 1PSEA 2D8HA 2DYIA 2DILA 1O75A 3V8KA 4HT8A 1QVGP 3I5SA 2KRMA 3VUZA 3CCRQ 1R0BG 2WSEE 4PFOA 1SF9A 5LJ3f 4J9CA 1Q82C 3VV0A 1TUGB 2CH4A 5FROA 2CT4A 3OYIA 2QTVA 4X1VA 5A2QE 3M0TA 4M4ZA 2B8AA 1R8OB 3G6ET 2GF7A 2M9UA 5GAMh 1VQMA 2Y4XA 1JO8A 3A8MB 2L3SA 3AT1B 5IHIA 1OU8A 4JRIA 1OV3A 1NLPC 4J9BA 2HEQA 1X27A 2JW4A 2MOXA 4LNPA 4EMKA 4LE9A 3J7AF 2QQ9A 4JJCA 1UUEA 4J83A 4F17A 3LLRA 3OYGA 4M75F 1MUZA 3MCAB 4ZN1A 2HDAA 1KQ1A 2OI3A 5LJ5d 3QWYA 4M7AC 2DL7A 1A0NB 4KRTA 3M4YA 1B07A 2LQWA 2FB7A 4EPCA 1IHWA 4OMQA 3M9QA 1YHQT 3A8HB 2RA2A 2BZXA 2LNVA 3NGPA 5LL6S 1K9MU 3A8GB 5LJ3h 1ZSZC 3M58A 5LJ3d 1OU9A 1KC8U 1D0YA 3RKWA 1YJ9T 4FCYA 1EIFA 2NUTB 4FU6A 2KGTA 2EAYA 3RDVA 3V8LA 3NTHA 1AOJA 2WACA 3M0RA 2H8HA 6AT1B 2KE9A 2CZ1B 4BE0A 3D7SB 1YIJQ 5M9OA 4C5HA 3CCMQ 1X01A 1TS9A 3CMAQ 2LT4A 4A54A 4M7AG 3EHQA 3INZA 2F5TX 5CKFA 3X28B 1TH7A 3M0UA 1Q86U 3H0IA 1PKSA 4M7AB 2O01E 3CXCS 1Q7YC 2L3PA 2GTOA 1LNXA 2CH4W 2QYZA 2KI7A 3EFSA 2YT6A 3VS5A 4M77F 3OBWA 4OF1A 4C0DB 3EG3A 2O2OA 2O9VA 5AYFA 2JTFA 1WHKA 4GLKA 5GAOq 2LQNA 1VQ5A 1ZSGA 1RABB 1K76A 1VQPQ 1VQKT 3H41A 4Z8AA 5A0DA 1EX4A 2F2VA 2K9GA 2DERA 3RIRA 4Y28E 4M7DC 4BDYA 1S72Q 2OJ2A 2P84A 1XNIA 3TQ7P 2E10A 2C06A 2NWMA 2PZ1A 4OGCA 1MMAA 3VRYA 1IGUA 1QVPA 4C8QD 1I4K1 1YCSB 2KT1A 3LWIA 4AG1C 1R0CB 3VS6A 3EG0A 2PVDB 3J80E 2YUQA 3C4SA 2CP0A 5J26A 1R77A 1KC8R 4JRPA 1UG1A 4PJNA 2MWPA 1X43A 2CP5A 3E9GA 2BUDA 2QEXT 4QQDA 4FYXB 3OS5A 2FPEA 4DBRA 2DJQA 3OYDA 3BE3A 1QKXA 5KYUB 1JRIA 3QO3A 4A4FA 1OEBA 5GANj 5LJ5g 4XK8E 2A08A 3OS1A 1U06A 3OYCA 1M27C 1MMNA 2RHIA 4QVZA 2YRCA 1NJIC 2LJ0A 4OMFB 2YUNA 2NYSA 1TWBA 5DLOA 4BB7A 2V1QA 2OAWA 4P5NA 4D6WA 2PUOB 3HTRA 3CBMA 1AT1B 1J3TA 2HL5C 3OS0A 2KRNA 2DE0X 2A3LA 1QKWA 1KSWA 1ACMB 3PVQA 1D0ZA 1IREB 2YUPA 1SRLA 4R56A 1RLPC 3R6NA 3EGXB 1UGSB 3PMIA 3G4ST 1VQ8T 1X69A 3PFSA 2DXUA 3CCQA 1MV0B 3MP6A 4DOVA 4GY5A 3X20B 2GBQA 4C8QC 5GAN8 4M78B 3L42A 2IG0A 1B3QA 5CR2A 4IUPA 2K5FA 2EGCA 4CC4B 1M1GA 1BYMA 1CKAA 3VS1A 1Q81C 3WXMB 2KXCA 9ATCB 1UGPB 3MP8A 4KGZB 3SWNA 4M7DG 3LYIA 4J9GA 1FMWA 1X6GA 1OZ3A 2QA4Q 1M3BA 2O9SA 2WSCE 4M75G 5LJ3g 2DL8A 1ZA2B 1ZX6A 3PGGA 4M7DB 2DD5A 4AFQC 3UA7A 2HSPA 3EG2A 4RTVA 3NMZC 3M0SA 2CYZB 1WNLA 4HXJA 1KJWA 4F7UG 2BZYA 1QQJA 2HL3A 1IGQA 2XK0A 1Q86C 1H641 1ABOA 1WZOA 4BUGA 1ZHIA 2QDLA 4CI0C 3JCMf 4ZNXA 4F7UB 2J6KA 1I5LA 3NHNA 3OYFA 3TSWA 1PD1A 1VQ5T 1K1ZA 2RQTA 2V8IA 2M1HA 1M90U 3H8ZA 3CC4Q 1D3BA 1RAHB 4HKEA 5KH6A 4KH0B 2EW3A 2X9HA 3CBPA 3OW2S 1TU0B 2ZPIB 2CP7A 1AWXA 1PM3A 2ZAEA 1IXDA 4BI3A 2C0OA 3R6OA 4BI8B 3MEAA 1UGVA 2GQIA 1T3LA 1NPPA 1OPLA 4IUUA 2FPFA 3NTKA 3RMSA 3QBYA 2K5IA 2COYA 2RI3A 1K9MR 4QQ6A 5HKCA 3JV3A 3Q1JA 2JTEA 2JMCA 4AMCA 1TTHB 2HKQB 5I2SA 2HD0A 4HA8A 1Y57A 1VQ8A 1NBEB 5GAN6 2HMAA 4N0AC 3JB9D 1BU1A 5J3BA 1NEGA 2K6DA 3RBBB 3THKA 4BD3A 3I55A 4YTLA 1HK9A 4M77D 3BDLA 5KYWA 2AIRB 1KIKA 4E7SA 3CXCA 1DJ7B 1IRXA 3M56A 3ZEHA 4LUEA 1FMKA 3UATA 8ATCB 2X51A 3A8OB 5FU6C 2QI2A 1H8KA 1TUDA 4ESRA 1N9SA 1QLYA 2E64A 1G2BA 4XTUA 1WHHA 1V76A 4JS4A 3MEVA 2M0OA 3TEEA 3PE0A 1HYOA 2AZVA 2AKLA 4HT9A 1VYVA 3M54A 3QYHB 1VQ9Q 1IHVA 2PUKB 3JB9F 4Y92A 3UPUA 1M30A 1GBRA 2FPDA 4MMLA 1M4ZA 4XQ3A 3GPLA 5GMKj 2D0NA 1ZLMA 2QEXA 2AKKA 2LCLA 1M8VA 1WIEA 2GCXA 4OMNA 4FYVB 3UF4A 4OMMA 1Z9ZA 1VQ6Q 1YI2T 1UGQB 5HK0A 3CCJQ 3MJXA 2LZ6B 1WHGA 2YRDA 5GAOn 4QT7A 4JDSA 1GCQA 5FRNA 3CCRA 4C5EA 2VXFA 1YWOA 1SKUB 2MAMA 5KCHA 1BIAA 2J05A 4KGVB 1UJYA 4PJOE 2MMPA 1RL2A 4ZGDB 1PRMC 2KY9A 1KK7A 1Y07A 4C8QB 3QUIA 3KFVA 3JCMJ 3HRSA 3JB9H 2E70A 1VQ7A 4R55A 1B34B 4CC7A 1QWFA 3TU4K 1K0XA 4ATOA 1Q81R 3A1PA 1ZUYA 4O5VA 2RMOA 2EYWA 1ZBJA 4IIMA 2AHJB 3HFNA 1K0SA 2DTHA 3EFOA 1AWJA 4RCCA 2V8KA 4RTZA 1X2QA 3VJPA 1TXQA 2E3IA 3CPFA 5GMKi 2OAUA 2MCNA 3OY9A 3C0CA 3A8LB 2ED1A 1U5SA 1NJIR 1V1CA 2KDSA 4FSSA 4EMKB 1H92A 3ZFJA 3C94A 3VS4A 1I81A 4EMKC 2DPPB 3JCMc 2JZ2A 4Z89A 2DXTA 1VQLQ 3S3OA 3OQ5A 4M77C 2E6ZA 4MZTA 1X6BA 4JUVA 1BIBA 3L2VA 3SHWA 4KH1B 2A37A 4WF2A 2ZGWA 4BDZA 3ER0A 3X24B 1YWPA 4KBMB 5GMKe 5IHNA 1RACB 5C0MA 4EMHA 2VWFA 2CGHA 4QVCA 1VQOT 3G71Q 5CKBA
chains in the Genus database with same CATH topology
1I07A 2L3PA 5IHKA 2GTOA 1SEMA 2CH4W 2A28A 2GNCA 2YT6A 2LCSA 1M3AA 3O5ZA 3VS5A 1UFFA 3EG3A 2O2OA 2O9VA 1MV3A 2KRSA 2LQNA 1ZSGA 4E6RA 1EFNA 1K76A 1WXUA 1ZUKA 2X3WD 3EHRA 3H41A 4LN2A 4Z8AA 2DBKA 1GFCA 2BTTA 2F2VA 2K9GA 4CC3A 1PNJA 2JM9A 3REAB 1TUCA 2KBTA 2OJ2A 1JU5C 4J9IA 2NWMA 2PZ1A 2KR3A 2J7IA 2F2WA 1GL5A 1JXMA 2CSQA 1E7OA 2ESWA 3EG1A 3VRYA 4A63B 5I22A 1E6GA 4RUGA 4F16A 1HJDA 2DA9A 1YCSB 2KT1A 4AG1C 5L23A 1BK2A 1W6XA 3VS6A 3EG0A 2YUQA 1NYGA 1T3SA 1W70A 1UG1A 3H0HA 1UJ0A 1SSHA 1X43A 2HBWA 4J9FA 1WLPB 1M3CA 2CSIA 2FPEA 2DJQA 2EKHA 1X2KA 1AWWA 1OPKA 1QKXA 2JM8A 2RQUA 1NYFA 2DMOA 3GBQA 2P4RA 2V1RA 1OEBA 2RF0A 2VVKA 1T0JA 2SRCA 2A08A 1U06A 1YP5A 2LX7A 1M27C 2O31A 4R0KA 2DBMA 2CDTA 1NLOC 2LJ0A 2ED0A 1M8MA 5EC7A 2YUNA 2C0TA 2V1QA 2OAWA 1UHFA 1GRIA 4HCKA 1IO6A 4CC2A 1TG0A 3H0FA 4AFUC 3IQLA 3FJ5A 1J3TA 2RNAA 1GCQC 2DLPA 2KRNA 1PWTA 1AZGB 2DE0X 2FEIA 1QKWA 1I0CA 2JXBA 1RUWA 2D1XA 5GJVB 1CKBA 1KSWA 3CQTA 3PVQA 2K79A 2FRWA 5IXBA 1G83A 2YUPA 1SRLA 5I11A 1RLPC 3R6NA 5GJWB 1X69A 2LNHB 5ECAA 1K4US 1MV0B 3LH5A 1UTIA 1N5ZA 2GBQA 3ZL7C 4ORZA 4F14A 1B3QA 1KFZA 2PNIA 2KYBA 2HCKA 2EGCA 4CC4B 1BBZA 1CKAA 1SHGA 2DF6A 2RQVA 3VS1A 4JJDA 3PVLA 2KXCA 2CUBA 2EGEA 1GBQA 1PKTA 3M0QA 2JMAA 4EIKA 2L0AA 2AZSA 3U23A 1AWOA 4J9GA 2FRYA 2JS0A 1X6GA 2RN8A 1M3BA 2O9SA 2DL8A 1ZX6A 4JJBA 2D8JA 2ENMA 4OMLA 4AFQC 3UA7A 1SRMA 2HSPA 2YSQA 3QWXX 3EG2A 2W0ZA 4RTVA 3NMZC 2ROTA 3M0SA 2KEAA 4RTTA 3EGUA 4HXJA 4HVUA 1KJWA 2BZYA 3SEMA 2VKNA 1ABOA 1WXTA 3I35A 2QDLA 2JT4A 4J9EA 3NPFA 1ZUUA 4ZNXA 2J6KA 2DVJA 2X3XD 3NHNA 4GLMA 3TSWA 2GGRA 1SHFA 1Z9QA 4RTXA 1FYNA 2ECZA 2A36A 3VS0A 1AVZC 1K1ZA 2IIMA 2KYMA 2RQTA 2DL4A 1UHCA 1QWEA 5IXFA 1VYTA 1YN8A 2L2PA 1VYUA 1SPKA 4RTWA 2EW3A 5HCKA 1AWXA 1JQQA 1RI9A 2C0OA 1UGVA 2GQIA 1T3LA 2DM1A 5IH2A 4IIOA 1UECA 1JEGA 4AFSC 1OPLA 1GCPA 2FPFA 2DL3A 4D8KA 4AFZC 2CT3A 2I0NA 1WI7A 2CUDA 4J9DA 1OOTA 2KROA 5FWBA 2GTJA 2LP5A 2O88A 2DYBA 3JV3A 1WFWA 2KT8A 4AG2C 2JTEA 2JMCA 3ULRB 2EQIA 2EYYA 2F2XA 2FO0A 1H3HA 5FWCA 2EYXA 2DNUA 3I9QA 1UDLA 1U3OA 2RPNA 1Y57A 1CSKA 1WA7A 2BZ8A 2DRMA 4HVWA 1BU1A 1NEGA 2K6DA 3RBBB 3THKA 1GFDA 3VS3A 2DRKA 2YUOA 1KIKA 4LUEA 2JS2A 2J06A 1VA7A 1FMKA 3UATA 2K3BA 2NUZA 2W10A 1LCKA 5FW9A 1H8KA 4JZ4A 1QCFA 1TUDA 1NEBA 4ESRA 1QLYA 4RTUA 1G2BA 1NM7A 2E5KA 4WCIA 4HVVA 1YNZA 4LUDA 1AEYA 2LMJA 3VS7A 1NG2A 3PE0A 2AZVA 2AKLA 1WXBA 2EBPA 3M0PA 1VYVA 4K11A 2G6FX 4Y92A 1M30A 1GBRA 1T0HA 2FPDA 2D0NA 3TSZA 1ZLMA 2D8HA 2DILA 1JXOA 2AKKA 4DEXA 3I5SA 1ABQA 1WIEA 4OMNA 1W1FA 2KRMA 1WX6A 3UF4A 4OMMA 1Z9ZA 4J9CA 2CH4A 2CT4A 1PHTA 2LZ6B 2FG0A 2DX1A 1XOVA 4X1VA 3M0TA 4M4ZA 2EPDA 4QT7A 2K2MA 1GCQA 4J9HA 3UA6A 2ABLA 2EGAA 2EYZA 1YWOA 1JO8A 1UE9A 2L3SA 1I1JA 5IHIA 4DEYA 2KNBB 1OV3A 2C0IA 2PTKA 1HSQA 2J05A 1S1NA 1NLPC 1UJYA 4J9BA 2HEQA 1X27A 2JW4A 2MOXA 3A98A 4LNPA 1PRMC 4LE9A 2SEMA 2DL5A 4JJCA 3REBB 3KFVA 1UUEA 4F17A 3TVTA 1E6HA 4CC7A 1QWFA 1K0XA 4JPBW 1MUZA 2HDAA 1ZUYA 2OI3A 2RMOA 2EYWA 3QWYA 1ZBJA 1Y0MA 2DL7A 1A0NB 2M0YA 4IIMA 1B07A 4KRTA 3VRZA 2LQWA 4OMQA 1K0SA 1RLQC 2BZXA 4RTYA 1AWJA 1AZEA 2MIOA 3NGPA 2J6FA 4RTZA 2RQRA 1X2QA 1HD3A 1K9AA 2MCNA 3C0CA 2ED1A 2EVRA 4JZ3A 1U5SA 2CREA 2KGTA 2YDLA 1V1CA 4FSSA 1H92A 2J6OA 3VS4A 2B86A 1AOJA 3M0RA 2H8HA 2KE9A 1AD5A 4Z89A 4GBQA 2K7AA 4OMPA 2ROLA 2KXDA 2RQWA 1PRLC 3I5RA 1X6BA 4OMOA 4Z88A 2L3QA 3SHWA 2A37A 3EHQA 3RNJA 1WYXA 2LJ1A 1YWPA 1ARKA 1BB9A 2AK5A 3M0UA 5IHNA 2XMFA 2M51A 3H0IA 1PKSA 2VWFA 4D8DA 2LJ3A 1WDXA 3VS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I07 A;  2L3P A;  5IHK A;  2GTO A;  1SEM A;  2CH4 W;  2A28 A;  2GNC A;  2YT6 A;  2LCS A;  1M3A A;  3O5Z A;  3VS5 A;  1UFF A;  3EG3 A;  2O2O A;  2O9V A;  1MV3 A;  2KRS A;  2LQN A;  1ZSG A;  4E6R A;  1EFN A;  1K76 A;  1WXU A;  1ZUK A;  2X3W D;  3EHR A;  3H41 A;  4LN2 A;  4Z8A A;  2DBK A;  1GFC A;  2BTT A;  2F2V A;  2K9G A;  4CC3 A;  1PNJ A;  2JM9 A;  3REA B;  1TUC A;  2KBT A;  2OJ2 A;  1JU5 C;  4J9I A;  2NWM A;  2PZ1 A;  2KR3 A;  2J7I A;  2F2W A;  1GL5 A;  1JXM A;  2CSQ A;  1E7O A;  2ESW A;  3EG1 A;  3VRY A;  4A63 B;  5I22 A;  1E6G A;  4RUG A;  4F16 A;  1HJD A;  2DA9 A;  1YCS B;  2KT1 A;  4AG1 C;  5L23 A;  1BK2 A;  1W6X A;  3VS6 A;  3EG0 A;  2YUQ A;  1NYG A;  1T3S A;  1W70 A;  1UG1 A;  3H0H A;  1UJ0 A;  1SSH A;  1X43 A;  2HBW A;  4J9F A;  1WLP B;  1M3C A;  2CSI A;  2FPE A;  2DJQ A;  2EKH A;  1X2K A;  1AWW A;  1OPK A;  1QKX A;  2JM8 A;  2RQU A;  1NYF A;  2DMO A;  3GBQ A;  2P4R A;  2V1R A;  1OEB A;  2RF0 A;  2VVK A;  1T0J A;  2SRC A;  2A08 A;  1U06 A;  1YP5 A;  2LX7 A;  1M27 C;  2O31 A;  4R0K A;  2DBM A;  2CDT A;  1NLO C;  2LJ0 A;  2ED0 A;  1M8M A;  5EC7 A;  2YUN A;  2C0T A;  2V1Q A;  2OAW A;  1UHF A;  1GRI A;  4HCK A;  1IO6 A;  4CC2 A;  1TG0 A;  3H0F A;  4AFU C;  3IQL A;  3FJ5 A;  1J3T A;  2RNA A;  1GCQ C;  2DLP A;  2KRN A;  1PWT A;  1AZG B;  2DE0 X;  2FEI A;  1QKW A;  1I0C A;  2JXB A;  1RUW A;  2D1X A;  5GJV B;  1CKB A;  1KSW A;  3CQT A;  3PVQ A;  2K79 A;  2FRW A;  5IXB A;  1G83 A;  2YUP A;  1SRL A;  5I11 A;  1RLP C;  3R6N A;  5GJW B;  1X69 A;  2LNH B;  5ECA A;  1K4U S;  1MV0 B;  3LH5 A;  1UTI A;  1N5Z A;  2GBQ A;  3ZL7 C;  4ORZ A;  4F14 A;  1B3Q A;  1KFZ A;  2PNI A;  2KYB A;  2HCK A;  2EGC A;  4CC4 B;  1BBZ A;  1CKA A;  1SHG A;  2DF6 A;  2RQV A;  3VS1 A;  4JJD A;  3PVL A;  2KXC A;  2CUB A;  2EGE A;  1GBQ A;  1PKT A;  3M0Q A;  2JMA A;  4EIK A;  2L0A A;  2AZS A;  3U23 A;  1AWO A;  4J9G A;  2FRY A;  2JS0 A;  1X6G A;  2RN8 A;  1M3B A;  2O9S A;  2DL8 A;  1ZX6 A;  4JJB A;  2D8J A;  2ENM A;  4OML A;  4AFQ C;  3UA7 A;  1SRM A;  2HSP A;  2YSQ A;  3QWX X;  3EG2 A;  2W0Z A;  4RTV A;  3NMZ C;  2ROT A;  3M0S A;  2KEA A;  4RTT A;  3EGU A;  4HXJ A;  4HVU A;  1KJW A;  2BZY A;  3SEM A;  2VKN A;  1ABO A;  1WXT A;  3I35 A;  2QDL A;  2JT4 A;  4J9E A;  3NPF A;  1ZUU A;  4ZNX A;  2J6K A;  2DVJ A;  2X3X D;  3NHN A;  4GLM A;  3TSW A;  2GGR A;  1SHF A;  1Z9Q A;  4RTX A;  1FYN A;  2ECZ A;  2A36 A;  3VS0 A;  1AVZ C;  1K1Z A;  2IIM A;  2KYM A;  2RQT A;  2DL4 A;  1UHC A;  1QWE A;  5IXF A;  1VYT A;  1YN8 A;  2L2P A;  1VYU A;  1SPK A;  4RTW A;  2EW3 A;  5HCK A;  1AWX A;  1JQQ A;  1RI9 A;  2C0O A;  1UGV A;  2GQI A;  1T3L A;  2DM1 A;  5IH2 A;  4IIO A;  1UEC A;  1JEG A;  4AFS C;  1OPL A;  1GCP A;  2FPF A;  2DL3 A;  4D8K A;  4AFZ C;  2CT3 A;  2I0N A;  1WI7 A;  2CUD A;  4J9D A;  1OOT A;  2KRO A;  5FWB A;  2GTJ A;  2LP5 A;  2O88 A;  2DYB A;  3JV3 A;  1WFW A;  2KT8 A;  4AG2 C;  2JTE A;  2JMC A;  3ULR B;  2EQI A;  2EYY A;  2F2X A;  2FO0 A;  1H3H A;  5FWC A;  2EYX A;  2DNU A;  3I9Q A;  1UDL A;  1U3O A;  2RPN A;  1Y57 A;  1CSK A;  1WA7 A;  2BZ8 A;  2DRM A;  4HVW A;  1BU1 A;  1NEG A;  2K6D A;  3RBB B;  3THK A;  1GFD A;  3VS3 A;  2DRK A;  2YUO A;  1KIK A;  4LUE A;  2JS2 A;  2J06 A;  1VA7 A;  1FMK A;  3UAT A;  2K3B A;  2NUZ A;  2W10 A;  1LCK A;  5FW9 A;  1H8K A;  4JZ4 A;  1QCF A;  1TUD A;  1NEB A;  4ESR A;  1QLY A;  4RTU A;  1G2B A;  1NM7 A;  2E5K A;  4WCI A;  4HVV A;  1YNZ A;  4LUD A;  1AEY A;  2LMJ A;  3VS7 A;  1NG2 A;  3PE0 A;  2AZV A;  2AKL A;  1WXB A;  2EBP A;  3M0P A;  1VYV A;  4K11 A;  2G6F X;  4Y92 A;  1M30 A;  1GBR A;  1T0H A;  2FPD A;  2D0N A;  3TSZ A;  1ZLM A;  2D8H A;  2DIL A;  1JXO A;  2AKK A;  4DEX A;  3I5S A;  1ABQ A;  1WIE A;  4OMN A;  1W1F A;  2KRM A;  1WX6 A;  3UF4 A;  4OMM A;  1Z9Z A;  4J9C A;  2CH4 A;  2CT4 A;  1PHT A;  2LZ6 B;  2FG0 A;  2DX1 A;  1XOV A;  4X1V A;  3M0T A;  4M4Z A;  2EPD A;  4QT7 A;  2K2M A;  1GCQ A;  4J9H A;  3UA6 A;  2ABL A;  2EGA A;  2EYZ A;  1YWO A;  1JO8 A;  1UE9 A;  2L3S A;  1I1J A;  5IHI A;  4DEY A;  2KNB B;  1OV3 A;  2C0I A;  2PTK A;  1HSQ A;  2J05 A;  1S1N A;  1NLP C;  1UJY A;  4J9B A;  2HEQ A;  1X27 A;  2JW4 A;  2MOX A;  3A98 A;  4LNP A;  1PRM C;  4LE9 A;  2SEM A;  2DL5 A;  4JJC A;  3REB B;  3KFV A;  1UUE A;  4F17 A;  3TVT A;  1E6H A;  4CC7 A;  1QWF A;  1K0X A;  4JPB W;  1MUZ A;  2HDA A;  1ZUY A;  2OI3 A;  2RMO A;  2EYW A;  3QWY A;  1ZBJ A;  1Y0M A;  2DL7 A;  1A0N B;  2M0Y A;  4IIM A;  1B07 A;  4KRT A;  3VRZ A;  2LQW A;  4OMQ A;  1K0S A;  1RLQ C;  2BZX A;  4RTY A;  1AWJ A;  1AZE A;  2MIO A;  3NGP A;  2J6F A;  4RTZ A;  2RQR A;  1X2Q A;  1HD3 A;  1K9A A;  2MCN A;  3C0C A;  2ED1 A;  2EVR A;  4JZ3 A;  1U5S A;  2CRE A;  2KGT A;  2YDL A;  1V1C A;  4FSS A;  1H92 A;  2J6O A;  3VS4 A;  2B86 A;  1AOJ A;  3M0R A;  2H8H A;  2KE9 A;  1AD5 A;  4Z89 A;  4GBQ A;  2K7A A;  4OMP A;  2ROL A;  2KXD A;  2RQW A;  1PRL C;  3I5R A;  1X6B A;  4OMO A;  4Z88 A;  2L3Q A;  3SHW A;  2A37 A;  3EHQ A;  3RNJ A;  1WYX A;  2LJ1 A;  1YWP A;  1ARK A;  1BB9 A;  2AK5 A;  3M0U A;  5IHN A;  2XMF A;  2M51 A;  3H0I A;  1PKS A;  2VWF A;  4D8D A;  2LJ3 A;  1WDX A;  3VS2 A; 
#chains in the Genus database with same CATH topology
 5J39 A;  1YIJ A;  1NJI U;  3S3N A;  3VYG A;  2GQV A;  3EGD B;  2KQW A;  3CMA T;  4A4H A;  3E19 A;  1WPY A;  1WQ7 A;  3CC7 A;  1ZBX A;  3GIB A;  2X3W D;  2KAF A;  2CZ7 B;  3QZ5 B;  2DBK A;  1GFC A;  1PNJ A;  3EGX A;  2KBT A;  4OB3 B;  4OB1 B;  1JU5 C;  4J9I A;  2KR3 A;  2J7I A;  3E2U A;  4M7A D;  3HRU A;  3PNW C;  2MI6 A;  4A63 B;  1E6G A;  4RUG A;  5GAN 2;  3QKJ A;  1VIF A;  1VQ7 Q;  2M16 A;  5KYX A;  1BK2 A;  3QZ9 B;  2XHC A;  2MF2 A;  2GFA A;  1NYG A;  1Y71 A;  1YJW Q;  8AT1 B;  3OYM A;  1RAA B;  5CAI A;  3GNG A;  3H0H A;  2KMT A;  2QK0 A;  2X4X A;  4DBF A;  4JJN K;  1G3S A;  4J9F A;  3CC4 T;  4E7I A;  2V8J A;  3HL8 A;  1U8R A;  3OYA A;  4XTY A;  2FYK A;  2DMO A;  2JVV A;  3OB9 A;  1M2V B;  1B7T A;  5KYU A;  1T0J A;  2L8D A;  2CP2 A;  1C6V X;  3CCL Q;  2LX9 A;  4C92 F;  4R0K A;  2DBM A;  5FU7 C;  2CDT A;  3MO8 A;  3CD6 A;  2R5A A;  2EJ9 A;  4M77 E;  5CK9 A;  2C0T A;  3P8H A;  5KCO A;  3QII A;  3OYY A;  1UHF A;  4HCK A;  3KBG A;  1TG0 A;  3CPW P;  3H0F A;  1QCN A;  3IQL A;  1LPL A;  1GCQ C;  4NL3 A;  1VQ4 T;  1AZG B;  2FEI A;  1I0C A;  3A5Z B;  2CKK A;  5GJV B;  1CKB A;  4J6X A;  4V2S A;  1B34 A;  2K79 A;  5GAO m;  5IXB A;  2E12 A;  5GJW B;  2LNH B;  5ECA A;  4NL2 A;  2OTL T;  1WGS A;  4C92 A;  1W2B A;  3MET A;  4OP0 A;  2XIC A;  3FRN A;  2DAQ A;  4N4H A;  2D0Q B;  2F69 A;  4ORZ A;  4ELZ C;  4Z02 A;  4M7D A;  2GFU A;  2K3X A;  4FSX A;  1KFZ A;  2DET A;  4M77 B;  2PNI A;  4M78 A;  2EQM A;  1VQN Q;  1BBZ A;  2V26 A;  2RQV A;  3LW5 E;  1BI3 A;  2AT1 B;  4JJD A;  3CME Q;  5GAO p;  2BIV A;  1PKT A;  3SWN B;  5LJ5 j;  3KUF A;  3QXE B;  1OZ2 A;  2NUP A;  4C92 C;  1JBM A;  3U23 A;  3CCS T;  1LJO A;  1KQS A;  4BE1 A;  1PD0 A;  2E5Q A;  4QW2 A;  3JCM e;  1LVK A;  4XTX A;  2BE7 D;  3CCM T;  3HP9 A;  2KK4 A;  3FEO A;  4O6J A;  2ENM A;  1SRM A;  2OTL A;  2YSQ A;  2RHU A;  4OB0 B;  3EGD A;  3TCJ A;  4RTT A;  3EGU A;  4L5G A;  1WJS A;  4HVU A;  1C1A A;  1YI2 Q;  4LXC A;  3CCJ T;  1PSF A;  4C8Q A;  4M7A E;  1WXT A;  1XQH A;  5CKH A;  1G3T A;  4J9E A;  4J7F A;  2QA4 T;  1ZUU A;  4PJO B;  3P8D A;  2RHZ A;  4KUI A;  2CP3 A;  1SHF A;  1ZSZ B;  2DD4 A;  2VGN A;  2QQB A;  1KD1 R;  2KYM A;  4C92 G;  4MDW A;  1QWE A;  1VYT A;  3CC2 A;  3CC4 A;  4PJO G;  1VYU A;  3GF5 A;  3JCM V;  4F7U E;  3CC2 T;  5CQX A;  1JJ2 A;  1VQK Q;  1D3B B;  4M7D D;  4OGE A;  1M9S A;  1WJQ A;  4C92 B;  1JQQ A;  4M78 D;  4ME7 A;  3S6W A;  3GOX A;  2R5M A;  2ZPE B;  2DL3 A;  2XI9 A;  4HCC A;  3QHS A;  4E7H A;  5FWB A;  4EDU A;  4WTO B;  4EMG A;  5GAM g;  3V7S A;  2EYY A;  2QXF A;  4C0G A;  1LOJ A;  5FWC A;  3V8J A;  1H3H A;  2EYX A;  2DNU A;  3I9Q A;  1UDL A;  2RHY A;  2RPN A;  3DB3 A;  1YHQ A;  3RER A;  1KG1 A;  1QCO A;  4MDX A;  1D1B A;  4F04 B;  3G6E Q;  4HVW A;  4M7D F;  1GFD A;  1ZA1 B;  3JCM h;  2DRK A;  4M78 F;  2DXC A;  3UT1 A;  3CCV T;  2R58 A;  1VA7 A;  1VIE A;  3FLG A;  2NUZ A;  2W10 A;  1LCK A;  2DEQ A;  3RES A;  4JZ4 A;  1QCF A;  3CEY A;  2E5K A;  2K5L A;  2DZ9 A;  4E7K A;  1YNZ A;  1VQ4 A;  2E41 A;  4NOY A;  3I55 Q;  1YIT T;  3ZBD A;  5GAN d;  1VQM T;  1G8X A;  1N6A A;  1M1K R;  1NG2 A;  3CBO A;  1W2B S;  2JOY A;  2IPO B;  3M0P A;  1YHQ Q;  3URG A;  4K11 A;  1KHI A;  4N4G A;  4XU0 A;  2RH2 A;  3TSZ A;  1UEB A;  1ABQ A;  1W1F A;  2DZC A;  2RJF A;  4X34 A;  3PMT A;  3WVD B;  1WHM A;  4BY6 C;  3I56 T;  3EFR A;  4PJO F;  1BCM A;  3CXC P;  1PHT A;  2X35 A;  4J7I A;  7AT1 B;  2FG0 A;  2DX1 A;  1VQ9 T;  5DM7 R;  2K2M A;  3MEU A;  3GLX A;  3UA6 A;  3EFO B;  2ABL A;  2EGA A;  3LX7 A;  3M57 A;  2JN0 A;  2QAS A;  1UE9 A;  2X4J A;  2VGM A;  4DEY A;  1BI2 A;  2A7Y A;  1VQ6 T;  2KNB B;  4FYY B;  2C0I A;  2FL7 A;  1S1N A;  4C0Z A;  2RK2 A;  3JCM Q;  4B9W A;  2EQJ A;  3WVE B;  4PJO C;  4MMK A;  1X6O A;  2SEM A;  2LCC A;  5LJ5 e;  3L2Q A;  4M7D E;  1RAI B;  5GAM j;  3TVT A;  3OW2 P;  3QJ6 A;  1E6H A;  5LJ5 f;  4TVR A;  5GAM f;  3EH2 A;  4LDX A;  2YXY A;  4C5I A;  3VRZ A;  1GXI E;  1MMG A;  1RLQ C;  2RHX A;  3MHX A;  2XDB A;  2L5Q A;  2YHT A;  1YJN Q;  1AZE A;  3QDF A;  2Y90 A;  1YCY A;  4HCZ A;  2D6F A;  4PFZ A;  2RQR A;  3L2U A;  1Q81 U;  1VQ5 Q;  2LVM A;  1K9A A;  4XTV A;  2L3R A;  3JB9 J;  3CCR T;  4MZM A;  2EVR A;  4JZ3 A;  4Y91 A;  2CRE A;  4IUR A;  1WJR A;  2B86 A;  4M77 A;  5FLX E;  2H3J A;  4M75 A;  2LTO A;  3UWN A;  1AD5 A;  2DFU A;  2DK3 A;  2CZ0 B;  4A4K A;  4GBQ A;  4Q5W A;  2VXE A;  2D9T A;  2ROL A;  2O4X A;  1QVF S;  5D6Y A;  4OB2 B;  1W4S A;  2DVE A;  2X4W A;  1M2O A;  3CD6 Q;  3PTA A;  4OMO A;  2NUP B;  2L3Q A;  4Z88 A;  3RNJ A;  1WYX A;  2OTJ T;  2LJ1 A;  1BI0 A;  3VUB A;  2OTJ A;  2HSE B;  1ARK A;  1BB9 A;  2YRV A;  2M51 A;  1K73 C;  3LH0 A;  3CC7 T;  3VS2 A;  1I07 A;  5IHK A;  5GAN e;  2ZPG B;  1SEM A;  3G7Z A;  1VQN T;  2LCS A;  1M3A A;  3OYL A;  4PJO A;  3CME T;  1C0M A;  2P0K A;  3JB9 I;  1JJ2 P;  1M1F A;  1UFF A;  4KGX B;  1NE8 A;  1MGQ A;  3AHU A;  1N9R A;  2LRQ A;  3EHR A;  4J6W A;  4LN2 A;  4QKU A;  2BTT A;  2Y4Y A;  1OQK A;  4XAX B;  3L2W A;  2R57 A;  1M2V A;  2YLB A;  3OMC A;  2F2W A;  2ESW A;  3EG1 A;  3DKM A;  4F16 A;  2DO3 A;  3OSV A;  2VC8 A;  3E9F A;  4JLI A;  1O9S A;  4KUL A;  1RI0 A;  5L23 A;  1W6X A;  4IKF A;  4PLI A;  1T3S A;  2QTX A;  5GAN h;  2MYS A;  3OYN A;  3OA6 A;  3FB9 A;  4DOW A;  4BI4 A;  1M3C A;  2CSI A;  1X2K A;  1AWW A;  2JM8 A;  2ZPF B;  3PIP A;  1RAF B;  4J8O A;  3LGL A;  1KD1 C;  3CC2 Q;  2RF0 A;  2VVK A;  3GNF B;  3O8V A;  1PC0 A;  2EQU A;  3JAM E;  4E7Z A;  3H6Z A;  1YJW T;  1IB8 A;  1YP5 A;  4AT1 B;  1M1K C;  4ZTJ A;  2LX7 A;  1K8A U;  3QPH A;  2O31 A;  1FXX A;  1IZ6 A;  1M8M A;  4ZGE B;  3OSS C;  4RMO A;  4RG8 A;  3CCS A;  5CCA A;  1GRI A;  3SD4 A;  1YI2 A;  4BE2 A;  2EFI A;  3FJ5 A;  2RNA A;  3CPW A;  1PWT A;  2RJC A;  3HKS A;  4ZTF A;  2XU8 A;  1S72 T;  3JCM d;  3J81 E;  2FZG B;  4XTW A;  1QVF A;  1PCX A;  2HQH A;  5KE2 A;  3EG9 B;  3CCQ T;  4M78 C;  1N5Z A;  5GAM e;  5GAO l;  3ZL7 C;  1VQ4 Q;  1XTD A;  4F14 A;  2KYB A;  5C6S A;  1K9M C;  2DF6 A;  4JLG A;  3PVL A;  4JRQ A;  2HZY A;  2CUB A;  2EGE A;  1GBQ A;  5GAN 5;  1KC8 C;  4X9D A;  2PVG B;  2JJ9 A;  1I5O B;  2JMA A;  4EIK A;  3I55 T;  3VYH B;  5CQY A;  2VB6 A;  2FRY A;  2JS0 A;  2RN8 A;  3TRE A;  3BDU A;  3V7R A;  4A4E A;  3OS2 A;  3C12 A;  4FIB A;  2XD0 A;  4PJJ A;  5CKD A;  4JJB A;  4E47 A;  4OML A;  2DIQ A;  3QWX X;  2W0Z A;  3PT9 A;  1JB0 E;  2VYT A;  2ROT A;  1FX7 A;  3SEM A;  1YFN A;  2CS7 A;  4FYW B;  2VKN A;  3JCM g;  3I35 A;  5A0L A;  3RKX A;  3M5A A;  2JT4 A;  1VQO Q;  3NPF A;  3G71 T;  1M5Q 1;  2DVJ A;  2E65 A;  1Q7Y U;  3HSB A;  2X3X D;  2EKO A;  4GLM A;  3M4G A;  1Z9Q A;  3CCL A;  4RTX A;  2M02 A;  1FYN A;  1OX8 A;  2QG9 B;  3DB4 A;  3M55 A;  4FM4 B;  2A36 A;  1AVZ C;  2DL4 A;  4DBH A;  1XJW B;  1YN8 A;  4RTW A;  1D09 B;  1VOM A;  4E2F B;  3JCM b;  5I21 A;  3V7C A;  3CCE T;  2HQE A;  1D1C A;  1RI9 A;  2MPX C;  1NZ9 A;  2XG8 D;  4M75 D;  2YWW A;  3BW1 A;  4JRK A;  1UEC A;  5KYN A;  1JEG A;  5L8R E;  1VQN A;  4AFS C;  5D6W A;  1YBY A;  4D8K A;  4AFZ C;  2CT3 A;  2I0N A;  2MK5 A;  2CUD A;  1KHC A;  1VQ6 A;  3OYB A;  4J9D A;  1OOT A;  1VQL A;  2GTJ A;  3N5B B;  2O88 A;  4M75 B;  2E6N A;  2DYB A;  5GMK m;  4BY6 B;  4AG2 C;  3ULR B;  2WSF E;  2FO0 A;  2F5K A;  1U3O A;  3NTI A;  3NFC A;  4RCB A;  3T9N A;  1CSK A;  2BZ8 A;  2DRM A;  2K2V A;  2FVU A;  4LDU A;  5AT1 B;  2XDD A;  4PJM A;  3FC3 A;  3HRT A;  4PJO D;  3VS3 A;  1X75 C;  3RR6 A;  2IVW A;  1KD1 U;  2EYQ A;  1VQP T;  2DKG A;  2VAS A;  3L1A A;  2J06 A;  4J6Y A;  1MHN A;  2JUF A;  4F7U F;  5DY9 A;  4RTU A;  1NM7 A;  3CD6 T;  4WCI A;  2BKD N;  4HVV A;  4HCB A;  3CCV A;  3SB2 A;  1AEY A;  1M90 R;  3QJY A;  4FL6 A;  2Z0W A;  1WXB A;  2EBP A;  5I2M A;  1OX9 A;  2RJE A;  1Y96 B;  5KYX B;  2L89 A;  2LDM A;  1MND A;  2ATC B;  1T0H A;  4M7A F;  2EWN A;  1F1B B;  2ZCF B;  1K73 R;  1N8R R;  1JXO A;  4DEX A;  3BFM A;  1SSF A;  4DA4 A;  5D6X A;  5CVI A;  3CCU T;  1WX6 A;  2F1L A;  3RMQ A;  2FHD A;  1WQW A;  3OYK A;  1VQM Q;  4C0F A;  4ZGJ B;  3G71 A;  4F7U A;  1AHJ B;  2EJG A;  5GMK h;  3PIO A;  1XOV A;  2HAX A;  3M53 A;  1VUB A;  2EPD A;  1G5V A;  2CP6 A;  4J9H A;  3OBY A;  1HXD A;  1S72 A;  1YJ9 A;  2NLU A;  2EYZ A;  3UDC A;  2QQS A;  2H3E B;  1OYX A;  2E4H A;  1I1J A;  2LQK A;  3E1S A;  5IT9 E;  4C5G A;  2QA4 A;  4M7A A;  1Y96 A;  2PTK A;  1VQ9 A;  1HSQ A;  2VUB A;  3JCM W;  2PVO B;  2PQW A;  3FDR A;  3A98 A;  2DL5 A;  3REB B;  2E1H A;  2K57 A;  2QQA A;  1YJN A;  4LDW A;  4JPB W;  1VQ8 Q;  1SG5 A;  1YJ9 Q;  3M59 A;  4RKU E;  1Y0M A;  4LDY A;  2M0Y A;  2E3H A;  3F70 A;  4XTZ A;  4PKC C;  3CPW S;  4RTY A;  5FU7 B;  2HBP A;  2MIO A;  4DQ2 A;  2J6F A;  4PJL A;  1RAG B;  4M78 E;  4B9X A;  1HD3 A;  3JSC A;  3H9N A;  1VQK A;  2DJZ A;  2YDL A;  2J6O A;  4C92 E;  2QDY B;  1YJN T;  4XU2 A;  2DTI A;  2K7A A;  4OMP A;  4NS5 A;  2KXD A;  2RQW A;  5IAY A;  1PRL C;  3I5R A;  1G3Y A;  5IN1 A;  3L2Z A;  4A4G A;  3QSU A;  1QVG S;  4IUV A;  2DEU A;  4ANJ A;  4C8Q G;  1N8R U;  2OX7 A;  2QAZ A;  3DLM A;  5GAN 4;  2AK5 A;  2XMF A;  1QP3 A;  4D8D A;  1U1T A;  2LJ3 A;  1WDX A;  1M1K U;  1K8A C;  2COW A;  5GMK l;  3CCL T;  5GAO r;  3MKD A;  3QG1 A;  3CCU A;  2A28 A;  2GNC A;  4PL6 A;  2RB6 A;  3O5Z A;  2KSS A;  1Q82 R;  5HY6 A;  3SWN C;  3VU3 C;  3MP1 A;  1D1A A;  1MV3 A;  1I8F A;  2P0Q A;  5HK3 A;  1P92 A;  2QGG A;  2KRS A;  4E6R A;  1YJW A;  2DTO A;  4FT4 A;  1EFN A;  4X9C A;  1WXU A;  1ZUK A;  3CCV Q;  4M75 C;  1JJ2 S;  2HNI A;  2RJD A;  2O4X B;  4CC3 A;  5LJ3 j;  2JM9 A;  3REA B;  1RAD B;  1FMV A;  1TUC A;  5D7U A;  2YLC A;  2EQK A;  3HPW A;  3I56 A;  1GL5 A;  1JXM A;  1U1S A;  2CSQ A;  5LJ3 e;  4BAC A;  1E7O A;  5I22 A;  2HKN A;  2RI2 A;  1HJD A;  1QP2 A;  2DA9 A;  2JTM A;  3JCM X;  5GAM d;  2LC4 A;  1N27 A;  1VQP A;  5KYY B;  2XDP A;  1H3Z A;  3G6E A;  2QQR A;  1W70 A;  1PG5 B;  1VQL T;  4OVA A;  2HQX A;  2COZ A;  1UJ0 A;  3CCM A;  1SSH A;  2FZC B;  3EAE A;  1QVG A;  2EIF A;  2HBW A;  5FU6 B;  3OW2 A;  1WLP B;  3JCM P;  4UC4 A;  2VV5 A;  2EKH A;  1OPK A;  2RQU A;  1NYF A;  3EH1 A;  2X4Y A;  4JS5 A;  1FWZ A;  4LD9 K;  3GBQ A;  3I56 Q;  3CCS Q;  2P4R A;  2V1R A;  2DXB A;  1K73 U;  3CCE Q;  2SRC A;  4MZP A;  1ZQ1 A;  4QVD A;  2XID A;  1BKB A;  2ZZD A;  4IUT A;  1NLO C;  4M75 E;  2ED0 A;  5EC7 A;  3SFM A;  4IUQ A;  3G4S Q;  4FW1 A;  2PU9 B;  3OYH A;  4FT2 A;  4VUB A;  1IO6 A;  3ME9 A;  4CC2 A;  4II1 A;  4AFU C;  2P0P A;  3QYG B;  4J5Y A;  2DLP A;  5GAN 3;  4B6M A;  2JXB A;  1RUW A;  4N0A A;  1BCO A;  2D1X A;  3ASK A;  3CQT A;  1YIJ T;  2FRW A;  4L59 A;  3HHT B;  1G83 A;  5I11 A;  5FRM A;  1K4U S;  4FW2 A;  3LH5 A;  1UTI A;  4PLL A;  3C95 A;  1Q82 U;  4LD6 A;  5KE3 A;  1UGR B;  2HCK A;  1MMD A;  3CCE A;  1SHG A;  4LDV A;  2NUT A;  4ELY C;  4QQG A;  5DLQ E;  3M0Q A;  2G3R A;  2KVQ G;  2L0A A;  3FJP A;  2AZS A;  3CCQ Q;  1AWO A;  2JNG A;  3RKY A;  3LWH A;  1YIT A;  1MNE A;  4M78 G;  3DLL A;  3CME A;  1UB4 A;  4PK4 A;  4CRI A;  2RI5 A;  1TSF A;  2D8J A;  1V29 B;  4DBQ A;  3P8B B;  5LJ5 h;  1QW1 A;  2ZPH B;  2QGF B;  5KYW B;  3CCU Q;  1Y7X A;  4C8Q E;  3MEW A;  2KEA A;  2OTJ Q;  2A0F B;  1N8R C;  5GAN 7;  4PFP A;  3S3M A;  3CCJ A;  3CC7 Q;  1Q86 R;  4PNO A;  1KQS S;  2CZ6 B;  5CO7 A;  2GGR A;  2ECZ A;  2RO0 A;  3VS0 A;  2K3Y A;  4E7L A;  3JB9 G;  2IIM A;  2QEX Q;  2ZPB B;  1UHC A;  3QDR B;  3JRZ A;  5IXF A;  2RM4 A;  3FIF A;  2L2P A;  2OTL Q;  1SPK A;  1YIT Q;  4M77 G;  2DIG A;  5HCK A;  1Q7Y R;  3G1J A;  3RUX A;  3GP8 A;  1WHJ A;  4RG2 A;  1VQO A;  2DM1 A;  5IH2 A;  4IIO A;  4L6V 5;  1K8A R;  4C8Q F;  1GCP A;  2RD1 A;  2EJF A;  3CMA A;  3HFO A;  1WI7 A;  2KRO A;  1Q95 G;  3BY7 A;  2LP5 A;  4KT0 E;  1WFW A;  2BE9 B;  2KT8 A;  3X26 B;  2EQI A;  2F2X A;  2P4T A;  2LQ8 A;  1ZSZ A;  3OYE A;  1EZZ B;  2RK1 A;  5A0G A;  3OMG A;  1KQS P;  1KQ2 A;  3VKI A;  2K4Y A;  1WA7 A;  2LT1 A;  2I2L A;  4C92 D;  3EG9 A;  4XU3 A;  1WHL A;  3LGF A;  3MPU B;  4ZN3 A;  4E7J A;  5KYY A;  1QVF P;  3X25 B;  2YUO A;  2XKO C;  1NPR A;  5CKE A;  2JS2 A;  3OYJ A;  3SDZ A;  3G4S A;  5CIU A;  3L2R A;  2K3B A;  5FW9 A;  1RAE B;  2FZK B;  1BI1 A;  1NEB A;  1W2B P;  4N4I A;  5GAN g;  4KUD K;  1M90 C;  4LUD A;  2LMJ A;  4C0D C;  5EG2 A;  3VS7 A;  4A53 A;  1VQ7 T;  3KXT A;  1D0X A;  1TOV A;  5GAN f;  1G3W A;  2G6F X;  1OI1 A;  1QMC A;  1OUL A;  2MWO A;  4XU1 A;  1PSE A;  2D8H A;  2DYI A;  2DIL A;  1O75 A;  3V8K A;  4HT8 A;  1QVG P;  3I5S A;  2KRM A;  3VUZ A;  3CCR Q;  1R0B G;  2WSE E;  4PFO A;  1SF9 A;  5LJ3 f;  4J9C A;  1Q82 C;  3VV0 A;  1TUG B;  2CH4 A;  5FRO A;  2CT4 A;  3OYI A;  2QTV A;  4X1V A;  5A2Q E;  3M0T A;  4M4Z A;  2B8A A;  1R8O B;  3G6E T;  2GF7 A;  2M9U A;  5GAM h;  1VQM A;  2Y4X A;  1JO8 A;  3A8M B;  2L3S A;  3AT1 B;  5IHI A;  1OU8 A;  4JRI A;  1OV3 A;  1NLP C;  4J9B A;  2HEQ A;  1X27 A;  2JW4 A;  2MOX A;  4LNP A;  4EMK A;  4LE9 A;  3J7A F;  2QQ9 A;  4JJC A;  1UUE A;  4J83 A;  4F17 A;  3LLR A;  3OYG A;  4M75 F;  1MUZ A;  3MCA B;  4ZN1 A;  2HDA A;  1KQ1 A;  2OI3 A;  5LJ5 d;  3QWY A;  4M7A C;  2DL7 A;  1A0N B;  4KRT A;  3M4Y A;  1B07 A;  2LQW A;  2FB7 A;  4EPC A;  1IHW A;  4OMQ A;  3M9Q A;  1YHQ T;  3A8H B;  2RA2 A;  2BZX A;  2LNV A;  3NGP A;  5LL6 S;  1K9M U;  3A8G B;  5LJ3 h;  1ZSZ C;  3M58 A;  5LJ3 d;  1OU9 A;  1KC8 U;  1D0Y A;  3RKW A;  1YJ9 T;  4FCY A;  1EIF A;  2NUT B;  4FU6 A;  2KGT A;  2EAY A;  3RDV A;  3V8L A;  3NTH A;  1AOJ A;  2WAC A;  3M0R A;  2H8H A;  6AT1 B;  2KE9 A;  2CZ1 B;  4BE0 A;  3D7S B;  1YIJ Q;  5M9O A;  4C5H A;  3CCM Q;  1X01 A;  1TS9 A;  3CMA Q;  2LT4 A;  4A54 A;  4M7A G;  3EHQ A;  3INZ A;  2F5T X;  5CKF A;  3X28 B;  1TH7 A;  3M0U A;  1Q86 U;  3H0I A;  1PKS A;  4M7A B;  2O01 E;  3CXC S;  1Q7Y C;  2L3P A;  2GTO A;  1LNX A;  2CH4 W;  2QYZ A;  2KI7 A;  3EFS A;  2YT6 A;  3VS5 A;  4M77 F;  3OBW A;  4OF1 A;  4C0D B;  3EG3 A;  2O2O A;  2O9V A;  5AYF A;  2JTF A;  1WHK A;  4GLK A;  5GAO q;  2LQN A;  1VQ5 A;  1ZSG A;  1RAB B;  1K76 A;  1VQP Q;  1VQK T;  3H41 A;  4Z8A A;  5A0D A;  1EX4 A;  2F2V A;  2K9G A;  2DER A;  3RIR A;  4Y28 E;  4M7D C;  4BDY A;  1S72 Q;  2OJ2 A;  2P84 A;  1XNI A;  3TQ7 P;  2E10 A;  2C06 A;  2NWM A;  2PZ1 A;  4OGC A;  1MMA A;  3VRY A;  1IGU A;  1QVP A;  4C8Q D;  1I4K 1;  1YCS B;  2KT1 A;  3LWI A;  4AG1 C;  1R0C B;  3VS6 A;  3EG0 A;  2PVD B;  3J80 E;  2YUQ A;  3C4S A;  2CP0 A;  5J26 A;  1R77 A;  1KC8 R;  4JRP A;  1UG1 A;  4PJN A;  2MWP A;  1X43 A;  2CP5 A;  3E9G A;  2BUD A;  2QEX T;  4QQD A;  4FYX B;  3OS5 A;  2FPE A;  4DBR A;  2DJQ A;  3OYD A;  3BE3 A;  1QKX A;  5KYU B;  1JRI A;  3QO3 A;  4A4F A;  1OEB A;  5GAN j;  5LJ5 g;  4XK8 E;  2A08 A;  3OS1 A;  1U06 A;  3OYC A;  1M27 C;  1MMN A;  2RHI A;  4QVZ A;  2YRC A;  1NJI C;  2LJ0 A;  4OMF B;  2YUN A;  2NYS A;  1TWB A;  5DLO A;  4BB7 A;  2V1Q A;  2OAW A;  4P5N A;  4D6W A;  2PUO B;  3HTR A;  3CBM A;  1AT1 B;  1J3T A;  2HL5 C;  3OS0 A;  2KRN A;  2DE0 X;  2A3L A;  1QKW A;  1KSW A;  1ACM B;  3PVQ A;  1D0Z A;  1IRE B;  2YUP A;  1SRL A;  4R56 A;  1RLP C;  3R6N A;  3EGX B;  1UGS B;  3PMI A;  3G4S T;  1VQ8 T;  1X69 A;  3PFS A;  2DXU A;  3CCQ A;  1MV0 B;  3MP6 A;  4DOV A;  4GY5 A;  3X20 B;  2GBQ A;  4C8Q C;  5GAN 8;  4M78 B;  3L42 A;  2IG0 A;  1B3Q A;  5CR2 A;  4IUP A;  2K5F A;  2EGC A;  4CC4 B;  1M1G A;  1BYM A;  1CKA A;  3VS1 A;  1Q81 C;  3WXM B;  2KXC A;  9ATC B;  1UGP B;  3MP8 A;  4KGZ B;  3SWN A;  4M7D G;  3LYI A;  4J9G A;  1FMW A;  1X6G A;  1OZ3 A;  2QA4 Q;  1M3B A;  2O9S A;  2WSC E;  4M75 G;  5LJ3 g;  2DL8 A;  1ZA2 B;  1ZX6 A;  3PGG A;  4M7D B;  2DD5 A;  4AFQ C;  3UA7 A;  2HSP A;  3EG2 A;  4RTV A;  3NMZ C;  3M0S A;  2CYZ B;  1WNL A;  4HXJ A;  1KJW A;  4F7U G;  2BZY A;  1QQJ A;  2HL3 A;  1IGQ A;  2XK0 A;  1Q86 C;  1H64 1;  1ABO A;  1WZO A;  4BUG A;  1ZHI A;  2QDL A;  4CI0 C;  3JCM f;  4ZNX A;  4F7U B;  2J6K A;  1I5L A;  3NHN A;  3OYF A;  3TSW A;  1PD1 A;  1VQ5 T;  1K1Z A;  2RQT A;  2V8I A;  2M1H A;  1M90 U;  3H8Z A;  3CC4 Q;  1D3B A;  1RAH B;  4HKE A;  5KH6 A;  4KH0 B;  2EW3 A;  2X9H A;  3CBP A;  3OW2 S;  1TU0 B;  2ZPI B;  2CP7 A;  1AWX A;  1PM3 A;  2ZAE A;  1IXD A;  4BI3 A;  2C0O A;  3R6O A;  4BI8 B;  3MEA A;  1UGV A;  2GQI A;  1T3L A;  1NPP A;  1OPL A;  4IUU A;  2FPF A;  3NTK A;  3RMS A;  3QBY A;  2K5I A;  2COY A;  2RI3 A;  1K9M R;  4QQ6 A;  5HKC A;  3JV3 A;  3Q1J A;  2JTE A;  2JMC A;  4AMC A;  1TTH B;  2HKQ B;  5I2S A;  2HD0 A;  4HA8 A;  1Y57 A;  1VQ8 A;  1NBE B;  5GAN 6;  2HMA A;  4N0A C;  3JB9 D;  1BU1 A;  5J3B A;  1NEG A;  2K6D A;  3RBB B;  3THK A;  4BD3 A;  3I55 A;  4YTL A;  1HK9 A;  4M77 D;  3BDL A;  5KYW A;  2AIR B;  1KIK A;  4E7S A;  3CXC A;  1DJ7 B;  1IRX A;  3M56 A;  3ZEH A;  4LUE A;  1FMK A;  3UAT A;  8ATC B;  2X51 A;  3A8O B;  5FU6 C;  2QI2 A;  1H8K A;  1TUD A;  4ESR A;  1N9S A;  1QLY A;  2E64 A;  1G2B A;  4XTU A;  1WHH A;  1V76 A;  4JS4 A;  3MEV A;  2M0O A;  3TEE A;  3PE0 A;  1HYO A;  2AZV A;  2AKL A;  4HT9 A;  1VYV A;  3M54 A;  3QYH B;  1VQ9 Q;  1IHV A;  2PUK B;  3JB9 F;  4Y92 A;  3UPU A;  1M30 A;  1GBR A;  2FPD A;  4MML A;  1M4Z A;  4XQ3 A;  3GPL A;  5GMK j;  2D0N A;  1ZLM A;  2QEX A;  2AKK A;  2LCL A;  1M8V A;  1WIE A;  2GCX A;  4OMN A;  4FYV B;  3UF4 A;  4OMM A;  1Z9Z A;  1VQ6 Q;  1YI2 T;  1UGQ B;  5HK0 A;  3CCJ Q;  3MJX A;  2LZ6 B;  1WHG A;  2YRD A;  5GAO n;  4QT7 A;  4JDS A;  1GCQ A;  5FRN A;  3CCR A;  4C5E A;  2VXF A;  1YWO A;  1SKU B;  2MAM A;  5KCH A;  1BIA A;  2J05 A;  4KGV B;  1UJY A;  4PJO E;  2MMP A;  1RL2 A;  4ZGD B;  1PRM C;  2KY9 A;  1KK7 A;  1Y07 A;  4C8Q B;  3QUI A;  3KFV A;  3JCM J;  3HRS A;  3JB9 H;  2E70 A;  1VQ7 A;  4R55 A;  1B34 B;  4CC7 A;  1QWF A;  3TU4 K;  1K0X A;  4ATO A;  1Q81 R;  3A1P A;  1ZUY A;  4O5V A;  2RMO A;  2EYW A;  1ZBJ A;  4IIM A;  2AHJ B;  3HFN A;  1K0S A;  2DTH A;  3EFO A;  1AWJ A;  4RCC A;  2V8K A;  4RTZ A;  1X2Q A;  3VJP A;  1TXQ A;  2E3I A;  3CPF A;  5GMK i;  2OAU A;  2MCN A;  3OY9 A;  3C0C A;  3A8L B;  2ED1 A;  1U5S A;  1NJI R;  1V1C A;  2KDS A;  4FSS A;  4EMK B;  1H92 A;  3ZFJ A;  3C94 A;  3VS4 A;  1I81 A;  4EMK C;  2DPP B;  3JCM c;  2JZ2 A;  4Z89 A;  2DXT A;  1VQL Q;  3S3O A;  3OQ5 A;  4M77 C;  2E6Z A;  4MZT A;  1X6B A;  4JUV A;  1BIB A;  3L2V A;  3SHW A;  4KH1 B;  2A37 A;  4WF2 A;  2ZGW A;  4BDZ A;  3ER0 A;  3X24 B;  1YWP A;  4KBM B;  5GMK e;  5IHN A;  1RAC B;  5C0M A;  4EMH A;  2VWF A;  2CGH A;  4QVC A;  1VQO T;  3G71 Q;  5CKB A; 
#chains in the Genus database with same CATH homology
 1I07 A;  2L3P A;  5IHK A;  2GTO A;  1SEM A;  2CH4 W;  2A28 A;  2GNC A;  2YT6 A;  2LCS A;  1M3A A;  3O5Z A;  3VS5 A;  1UFF A;  3EG3 A;  2O2O A;  2O9V A;  1MV3 A;  2KRS A;  2LQN A;  1ZSG A;  4E6R A;  1EFN A;  1K76 A;  1WXU A;  1ZUK A;  2X3W D;  3EHR A;  3H41 A;  4LN2 A;  4Z8A A;  2DBK A;  1GFC A;  2BTT A;  2F2V A;  2K9G A;  4CC3 A;  1PNJ A;  2JM9 A;  3REA B;  1TUC A;  2KBT A;  2OJ2 A;  1JU5 C;  4J9I A;  2NWM A;  2PZ1 A;  2KR3 A;  2J7I A;  2F2W A;  1GL5 A;  1JXM A;  2CSQ A;  1E7O A;  2ESW A;  3EG1 A;  3VRY A;  4A63 B;  5I22 A;  1E6G A;  4RUG A;  4F16 A;  1HJD A;  2DA9 A;  1YCS B;  2KT1 A;  4AG1 C;  5L23 A;  1BK2 A;  1W6X A;  3VS6 A;  3EG0 A;  2YUQ A;  1NYG A;  1T3S A;  1W70 A;  1UG1 A;  3H0H A;  1UJ0 A;  1SSH A;  1X43 A;  2HBW A;  4J9F A;  1WLP B;  1M3C A;  2CSI A;  2FPE A;  2DJQ A;  2EKH A;  1X2K A;  1AWW A;  1OPK A;  1QKX A;  2JM8 A;  2RQU A;  1NYF A;  2DMO A;  3GBQ A;  2P4R A;  2V1R A;  1OEB A;  2RF0 A;  2VVK A;  1T0J A;  2SRC A;  2A08 A;  1U06 A;  1YP5 A;  2LX7 A;  1M27 C;  2O31 A;  4R0K A;  2DBM A;  2CDT A;  1NLO C;  2LJ0 A;  2ED0 A;  1M8M A;  5EC7 A;  2YUN A;  2C0T A;  2V1Q A;  2OAW A;  1UHF A;  1GRI A;  4HCK A;  1IO6 A;  4CC2 A;  1TG0 A;  3H0F A;  4AFU C;  3IQL A;  3FJ5 A;  1J3T A;  2RNA A;  1GCQ C;  2DLP A;  2KRN A;  1PWT A;  1AZG B;  2DE0 X;  2FEI A;  1QKW A;  1I0C A;  2JXB A;  1RUW A;  2D1X A;  5GJV B;  1CKB A;  1KSW A;  3CQT A;  3PVQ A;  2K79 A;  2FRW A;  5IXB A;  1G83 A;  2YUP A;  1SRL A;  5I11 A;  1RLP C;  3R6N A;  5GJW B;  1X69 A;  2LNH B;  5ECA A;  1K4U S;  1MV0 B;  3LH5 A;  1UTI A;  1N5Z A;  2GBQ A;  3ZL7 C;  4ORZ A;  4F14 A;  1B3Q A;  1KFZ A;  2PNI A;  2KYB A;  2HCK A;  2EGC A;  4CC4 B;  1BBZ A;  1CKA A;  1SHG A;  2DF6 A;  2RQV A;  3VS1 A;  4JJD A;  3PVL A;  2KXC A;  2CUB A;  2EGE A;  1GBQ A;  1PKT A;  3M0Q A;  2JMA A;  4EIK A;  2L0A A;  2AZS A;  3U23 A;  1AWO A;  4J9G A;  2FRY A;  2JS0 A;  1X6G A;  2RN8 A;  1M3B A;  2O9S A;  2DL8 A;  1ZX6 A;  4JJB A;  2D8J A;  2ENM A;  4OML A;  4AFQ C;  3UA7 A;  1SRM A;  2HSP A;  2YSQ A;  3QWX X;  3EG2 A;  2W0Z A;  4RTV A;  3NMZ C;  2ROT A;  3M0S A;  2KEA A;  4RTT A;  3EGU A;  4HXJ A;  4HVU A;  1KJW A;  2BZY A;  3SEM A;  2VKN A;  1ABO A;  1WXT A;  3I35 A;  2QDL A;  2JT4 A;  4J9E A;  3NPF A;  1ZUU A;  4ZNX A;  2J6K A;  2DVJ A;  2X3X D;  3NHN A;  4GLM A;  3TSW A;  2GGR A;  1SHF A;  1Z9Q A;  4RTX A;  1FYN A;  2ECZ A;  2A36 A;  3VS0 A;  1AVZ C;  1K1Z A;  2IIM A;  2KYM A;  2RQT A;  2DL4 A;  1UHC A;  1QWE A;  5IXF A;  1VYT A;  1YN8 A;  2L2P A;  1VYU A;  1SPK A;  4RTW A;  2EW3 A;  5HCK A;  1AWX A;  1JQQ A;  1RI9 A;  2C0O A;  1UGV A;  2GQI A;  1T3L A;  2DM1 A;  5IH2 A;  4IIO A;  1UEC A;  1JEG A;  4AFS C;  1OPL A;  1GCP A;  2FPF A;  2DL3 A;  4D8K A;  4AFZ C;  2CT3 A;  2I0N A;  1WI7 A;  2CUD A;  4J9D A;  1OOT A;  2KRO A;  5FWB A;  2GTJ A;  2LP5 A;  2O88 A;  2DYB A;  3JV3 A;  1WFW A;  2KT8 A;  4AG2 C;  2JTE A;  2JMC A;  3ULR B;  2EQI A;  2EYY A;  2F2X A;  2FO0 A;  1H3H A;  5FWC A;  2EYX A;  2DNU A;  3I9Q A;  1UDL A;  1U3O A;  2RPN A;  1Y57 A;  1CSK A;  1WA7 A;  2BZ8 A;  2DRM A;  4HVW A;  1BU1 A;  1NEG A;  2K6D A;  3RBB B;  3THK A;  1GFD A;  3VS3 A;  2DRK A;  2YUO A;  1KIK A;  4LUE A;  2JS2 A;  2J06 A;  1VA7 A;  1FMK A;  3UAT A;  2K3B A;  2NUZ A;  2W10 A;  1LCK A;  5FW9 A;  1H8K A;  4JZ4 A;  1QCF A;  1TUD A;  1NEB A;  4ESR A;  1QLY A;  4RTU A;  1G2B A;  1NM7 A;  2E5K A;  4WCI A;  4HVV A;  1YNZ A;  4LUD A;  1AEY A;  2LMJ A;  3VS7 A;  1NG2 A;  3PE0 A;  2AZV A;  2AKL A;  1WXB A;  2EBP A;  3M0P A;  1VYV A;  4K11 A;  2G6F X;  4Y92 A;  1M30 A;  1GBR A;  1T0H A;  2FPD A;  2D0N A;  3TSZ A;  1ZLM A;  2D8H A;  2DIL A;  1JXO A;  2AKK A;  4DEX A;  3I5S A;  1ABQ A;  1WIE A;  4OMN A;  1W1F A;  2KRM A;  1WX6 A;  3UF4 A;  4OMM A;  1Z9Z A;  4J9C A;  2CH4 A;  2CT4 A;  1PHT A;  2LZ6 B;  2FG0 A;  2DX1 A;  1XOV A;  4X1V A;  3M0T A;  4M4Z A;  2EPD A;  4QT7 A;  2K2M A;  1GCQ A;  4J9H A;  3UA6 A;  2ABL A;  2EGA A;  2EYZ A;  1YWO A;  1JO8 A;  1UE9 A;  2L3S A;  1I1J A;  5IHI A;  4DEY A;  2KNB B;  1OV3 A;  2C0I A;  2PTK A;  1HSQ A;  2J05 A;  1S1N A;  1NLP C;  1UJY A;  4J9B A;  2HEQ A;  1X27 A;  2JW4 A;  2MOX A;  3A98 A;  4LNP A;  1PRM C;  4LE9 A;  2SEM A;  2DL5 A;  4JJC A;  3REB B;  3KFV A;  1UUE A;  4F17 A;  3TVT A;  1E6H A;  4CC7 A;  1QWF A;  1K0X A;  4JPB W;  1MUZ A;  2HDA A;  1ZUY A;  2OI3 A;  2RMO A;  2EYW A;  3QWY A;  1ZBJ A;  1Y0M A;  2DL7 A;  1A0N B;  2M0Y A;  4IIM A;  1B07 A;  4KRT A;  3VRZ A;  2LQW A;  4OMQ A;  1K0S A;  1RLQ C;  2BZX A;  4RTY A;  1AWJ A;  1AZE A;  2MIO A;  3NGP A;  2J6F A;  4RTZ A;  2RQR A;  1X2Q A;  1HD3 A;  1K9A A;  2MCN A;  3C0C A;  2ED1 A;  2EVR A;  4JZ3 A;  1U5S A;  2CRE A;  2KGT A;  2YDL A;  1V1C A;  4FSS A;  1H92 A;  2J6O A;  3VS4 A;  2B86 A;  1AOJ A;  3M0R A;  2H8H A;  2KE9 A;  1AD5 A;  4Z89 A;  4GBQ A;  2K7A A;  4OMP A;  2ROL A;  2KXD A;  2RQW A;  1PRL C;  3I5R A;  1X6B A;  4OMO A;  4Z88 A;  2L3Q A;  3SHW A;  2A37 A;  3EHQ A;  3RNJ A;  1WYX A;  2LJ1 A;  1YWP A;  1ARK A;  1BB9 A;  2AK5 A;  3M0U A;  5IHN A;  2XMF A;  2M51 A;  3H0I A;  1PKS A;  2VWF A;  4D8D A;  2LJ3 A;  1WDX A;  3VS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...