1X6BA

Solution structures of the sh3 domain of human rho guanine exchange factor (gef) 16
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
GSSGSSGWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine exchange factor (GEF) 16
publication title Solution structures of the SH3 domain of human rho guanine exchange factor (GEF) 16
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x6bA01
4F17A 1AWXA 3M0PA 1M3BA 2RQTA 2KROA 2D8JA 4CC3A 1K4US 3IQLA 3TSWA 2HDAA 2KRSA 2RQUA 1LCKA 1GCPA 5ECAA 1PKTA 1K0SA 1BU1A 2O9VA 1UFFA 2D8HA 1HSQA 2DX1A 2BZ8A 5L23A 1N5ZA 2FPEA 2DBKA 1JXMA 2K3BA 1RUWA 1WXBA 4IIOA 2J06A 2CREA 1UJ0A 2RNAA 1UG1A 2DE0X 2SEMA 2BTTA 1ZX6A 1X2QA 1JXOA 2O9SA 2ROTA 2DRMA 1CKBA 2K79A 1OEBA 2PNIA 1X6GA 3VS3A 2W0ZA 2KE9A 1OPKA 2KYMA 1M27C 1ZSGA 4OMOA 1PHTA 1K0XA 3EHRA 3A98A 3I9QA 5I22A 2OAWA 2CT3A 1H3HA 2EKHA 2HSPA 2ENMA 1I1JA 3CQTA 3EHQA 2IIMA 3H41A 1PNJA 2ESWA 1AWOA 1ZUUA 4GBQA 3VS4A 3THKA 1T0HA 4F16A 4HVVA 2C0TA 2VWFA 2YDLA 1ZUYA 4GLMA 2DVJA 4E6RA 1PKSA 1YWOA 2X3WD 1ARKA 1ZBJA 2DL4A 2AZVA 2E5KA 3ZL7C 2EYYA 4RTXA 3VS1A 1ABOA 3EGUA 1OOTA 4J9BA 2KT1A 4AG1C 4LN2A 4JZ4A 4RTZA 2CUDA 2O31A 5IHNA 1GRIA 4Z8AA 2L3QA 2FPFA 2KGTA 3REBB 2CH4W 2JT4A 4OMNA 2C0IA 1H92A 5GJVB 2SRCA 2V1QA 3M0TA 2J6KA 2HCKA 1UGVA 2GGRA 4OMMA 2KRNA 3H0HA 1SPKA 3SHWA 2J7IA 1XOVA 1NLPC 1QKXA 1NEGA 4J9CA 4AFSC 2GTOA 2J6OA 4ESRA 4M4ZA 4RTUA 2CUBA 1M8MA 2EYXA 2G6FX 5IXBA 1M3AA 3SEMA 1IO6A 3VS0A 4JJCA 1KIKA 1UDLA 1JO8A 2F2WA 5FWBA 2DL8A 4Y92A 3UA7A 2KNBB 2JM9A 2EVRA 2J05A 1E6HA 2K7AA 2EQIA 1TG0A 3TVTA 4KRTA 4Z89A 1PWTA 3NMZC 4J9HA 4LE9A 4AG2C 2RN8A 1M30A 5I11A 1GBRA 2FG0A 2KYBA 2PZ1A 2AZSA 2LMJA 4JZ3A 4Z88A 1JEGA 1VA7A 2GBQA 3PE0A 1A0NB 3M0SA 3RBBB 3NGPA 2EGEA 4FSSA 3RNJA 4CC4B 3I5SA 3O5ZA 1QWFA 4QT7A 4D8KA 1WYXA 4JJBA 2M51A 2RQWA 1KJWA 4CC2A 1W1FA 4R0KA 2LJ0A 1AD5A 1Y0MA 1EFNA 3NPFA 4DEXA 1SEMA 1E6GA 1NLOC 1RLPC 4OMPA 3M0QA 1B07A 2P4RA 2OI3A 2KR3A 1SRLA 2QDLA 5IHIA 2LNHB 2CT4A 1B3QA 1SSHA 1JQQA 2DL7A 3PVLA 1VYTA 1I0CA 2ED0A 2KXDA 3U23A 3LH5A 5GJWB 1GL5A 1H8KA 2KRMA 1G83A 1U3OA 1G2BA 2LJ1A 1OPLA 2W10A 3H0IA 4D8DA 1U5SA 3I5RA 1NYFA 1M3CA 2RPNA 1ABQA 1W6XA 2EGAA 2HEQA 3FJ5A 3EG3A 1WIEA 1ZLMA 4HVWA 2F2XA 2YUOA 2NUZA 2FEIA 1X27A 1T3SA 2D1XA 4JJDA 4F14A 2VKNA 4IIMA 2EPDA 4J9FA 2EYZA 1K1ZA 2RF0A 2EBPA 2M0YA 1BBZA 2ABLA 2L3SA 4LNPA 1SHFA 3EG2A 1BB9A 4J9IA 3VS7A 2YSQA 5EC7A 2O88A 3KFVA 3M0UA 1YN8A 1Y57A 1RLQC 4RUGA 1GCQC 2PTKA 4AFQC 5IHKA 1NYGA 1OV3A 2DL3A 3UA6A 4OMQA 2JW4A 1WXUA 2D0NA 1AZGB 2DBMA 1UHFA 1SHGA 3GBQA 2MCNA 1X6BA 3ULRB 2KBTA 2AKKA 2CH4A 2DA9A 4LUDA 1MV3A 2MOXA 4DEYA 1RI9A 1ZUKA 1FMKA 1QWEA 2DYBA 1SRMA 1UJYA 2FPDA 1UTIA 2RMOA 2BZYA 1UECA 2K9GA 2L3PA 3M0RA 2CSQA 1J3TA 5FW9A 1KFZA 2AKLA 4AFUC 4EIKA 2JMCA 3EG1A 2F2VA 3PVQA 2KXCA 1AVZC 1GCQA 1HD3A 2FRYA 3H0FA 2EGCA 1TUCA 1Z9ZA 1T0JA 2RQVA 1NG2A 2CDTA 1YCSB 1YWPA 2CSIA 2ED1A 4HCKA 4WCIA 4J9DA 1CKAA 2K6DA 2KEAA 1UE9A 2DMOA 3QWYA 3VS5A 2YUNA 1VYUA 2H8HA 3VRZA 1PRMC 2ECZA 2O2OA 2DJQA 3VRYA 1AEYA 2DRKA 1E7OA 2LZ6B 2MIOA 1WA7A 3UATA 2RQRA 2K2MA 2FO0A 3R6NA 1WLPB 1WFWA 1X2KA 1FYNA 2FRWA 1UUEA 2DM1A 3VS2A 2A36A 2I0NA 1HJDA 1NEBA 2X3XD 2C0OA 1AWJA 2EYWA 1U06A 1I07A 2A37A 2AK5A 2A08A 2LQWA 5HCKA 1YP5A 2JMAA 5IXFA 2ROLA 2YUPA 2LJ3A 3EG0A 2GTJA 2NWMA 4LUEA 2VVKA 2J6FA 1S1NA 1MV0B 2DLPA 1WX6A 2YUQA 4J9EA 1GBQA 1QLYA 3C0CA 4X1VA 3TSZA 1BK2A 2DF6A 1UHCA 3JV3A 1MUZA 3UF4A 2A28A 2L0AA 2DL5A 2B86A 2DNUA 4JPBW 4RTWA 2OJ2A 4A63B 1X43A 1CSKA 4ZNXA 1V1CA 1QKWA 3I35A 2KT8A 2HBWA 2XMFA 2JS2A 1TUDA 1NM7A 1VYVA 1KSWA 1GFDA 2DILA 4K11A 4J9GA 4OMLA 2V1RA 1PRLC 1AOJA 2JTEA 1WI7A 2LP5A 5FWCA 4AFZC 2LQNA 3NHNA 1YNZA 3REAB 2GNCA 4HVUA 4HXJA 1QCFA 2JM8A 4ORZA 4RTTA 2LX7A 2YT6A 1K76A 2L2PA 1JU5C 1WDXA 2JXBA 4RTYA 1GFCA 4RTVA 1AZEA 1AWWA 1T3LA 3QWXX 2GQIA 3VS6A 1Z9QA 5IH2A 2EW3A 2JS0A 1W70A 1WXTA 2LCSA 1X69A 4CC7A 1K9AA 2BZXA
chains in the Genus database with same CATH superfamily
2FZGB 3PGGA 3L2UA 3M0PA 4KH1B 2D8JA 4CC3A 2HKNA 3IQLA 3TSWA 4FW1A 3S6WA 1RAAB 4M7DG 5ECAA 1K0SA 1BU1A 3M56A 1TH7A 5J3BA 1UFFA 2D8HA 3CCMQ 2RH2A 4F7UE 2DBKA 2VGNA 1PSEA 5GAOr 2QEXA 1R8OB 1UG1A 2GFAA 2KDSA 5GMKh 1AT1B 5KYXA 1JXOA 2BKDN 5LL6S 4M7DF 2RI3A 1VQ6A 3JCMV 2RB6A 3CD6A 1CKBA 2DTIA 3CPWA 4Q5WA 3S3NA 2OTJQ 1VQLA 4R55A 4M77B 2KYMA 4C8QF 4JRKA 1FX7A 5GANf 3EHRA 3A98A 3HKSA 3CC2T 3FIFA 2K5LA 3CPWS 1H3HA 3INZA 2HSPA 2XK0A 3CQTA 2PUKB 2DTOA 4RCBA 1PG5B 4V2SA 1PNJA 2ZPFB 8AT1B 3THKA 3OMGA 2XDBA 1T0HA 3PIOA 1KD1U 2O4XA 4PJOB 3F70A 5J26A 4E6RA 2OX7A 1PKSA 1ZBJA 2DEQA 5KYWB 3JCMe 4D6WA 4FM4B 3CCEQ 1VQ9T 2D0QB 3VS1A 5FLXE 3EGUA 4J9BA 3CCSQ 4BDZA 4JUVA 3QBYA 4RTZA 1GRIA 2HL5C 1S72A 2NUPA 1KD1R 4PJMA 2E1HA 3G6EA 4OMNA 1M5Q1 1I5LA 4XU3A 3OQ5A 2SRCA 1VQOA 3CBMA 4RG2A 2QASA 4C5EA 4OMMA 2VXEA 1Y7XA 1RACB 1QCNA 1Q7YU 4NL3A 3FDRA 2H3JA 1OZ3A 2MMPA 4M7AD 4RTUA 1M8MA 2G6FX 3E9FA 3CCMA 1K73U 1M3AA 3SEMA 3VS0A 2XHCA 4JJCA 3I55T 3MEVA 1SSFA 3JCMf 1TUGB 2QQBA 2JTFA 4Y92A 5FWBA 4HCCA 1RAHB 1G5VA 3QHSA 3EG9A 1Q7YR 3PTAA 4KRTA 2NUTA 1PWTA 3NMZC 2RN8A 2DO3A 1M30A 3OYAA 2OTJA 3FJPA 4JZ3A 1BI1A 1VA7A 3PE0A 5GMKi 1NJIU 3M0SA 3RNJA 5D6XA 3TU4K 3CXCP 1OQKA 3O5ZA 2RI5A 3TEEA 4JJBA 2M51A 2RQWA 1D09B 1W1FA 3CCVQ 1Q82R 4N4HA 2LJ0A 4DEXA 1N9RA 1OYXA 1SEMA 5GAN3 2MI6A 4OVAA 4BE2A 1RLPC 2R5AA 3OBWA 4OMPA 4LDVA 1WJQA 1B07A 1G3WA 2P4RA 2P0QA 2OI3A 1TOVA 1JBMA 2KR3A 1BKBA 5IHIA 3LGLA 1B3QA 1D3BB 2PVGB 5CVIA 3CCEA 2DL7A 1RL2A 1N8RR 1IHVA 1I0CA 3JSCA 3LH5A 5GJWB 1GL5A 3AHUA 3CCSA 4B9WA 1B34A 1YI2Q 4D8DA 3PNWC 3I5RA 1VQ5Q 1M3CA 1W6XA 2FB7A 2EGAA 2HEQA 3GOXA 2F2XA 3QXEB 4OGEA 2YUOA 5KYNA 4JJNK 3CMET 3LGFA 2CP0A 1QW1A 1M1GA 4J9FA 3OSSC 2EYZA 2QA4Q 3G1JA 2HKQB 2RF0A 4A4EA 4C0ZA 2M0YA 1WQ7A 2L3SA 3EFOB 3OYYA 4M78B 1ACMB 4J9IA 2HQEA 2O88A 3M0UA 1YN8A 1Y57A 4J83A 1N27A 2ATCB 4BB7A 4QQDA 2M16A 5CR2A 2LT1A 2PTKA 4BI3A 2DBMA 4TVRA 4E7LA 3X26B 4M7DE 1KHCA 1RADB 2BE7D 4LUDA 1M1KR 3FLGA 1I4K1 3E2UA 2DKGA 4IUVA 5KYUA 1ZUKA 1FMKA 3X25B 1QWEA 2KK4A 1Q86U 4C8QE 1SRMA 2RMOA 3G7ZA 1UECA 2NLUA 2DXTA 3CCVA 2RJFA 4IUPA 1ZA2B 1QCOA 2XI9A 1K9MU 2JVVA 4OB0B 3PVQA 3H0FA 2E12A 3M9QA 2HSEB 1YCSB 1YBYA 1YWPA 4HCKA 4A4HA 2K5FA 2L5QA 1CKAA 3E19A 1O75A 1MHNA 2DXUA 1VIEA 4DBQA 1QP2A 3RUXA 2F1LA 1K9MR 4BACA 2KY9A 1YI2A 2K4YA 1AEYA 1E7OA 3GNFB 2K57A 1VQ5A 3UATA 1JRIA 1BCMA 1X2KA 4VUBA 1FYNA 5I2MA 3UWNA 1U1SA 1UUEA 2HBPA 1HJDA 3X28B 1FMWA 1IHWA 2LQ8A 2MF2A 1VQ7Q 4M7AG 2AK5A 2LQWA 3NTIA 4XU1A 2QA4A 1K8AC 1YP5A 1Y07A 2GTJA 2NWMA 4Z02A 4IURA 1EZZB 2ZGWA 1GBQA 3MJXA 2QEXT 4XTWA 3JV3A 3L1AA 1Q81U 2A28A 2L0AA 4JPBW 4M7AF 4C8QD 4RTWA 3L2RA 1VQ6T 3CD6T 4PKCC 1U1TA 4LD9K 4M7DB 1RAEB 1UGSB 1VQNQ 2A7YA 2X51A 2DFUA 4RKUE 1MNDA 2MPXC 3OB9A 2V1RA 5IT9E 1AOJA 4B9XA 4C5IA 1VUBA 2WSCE 4FU6A 3RR6A 2LQNA 2DD4A 3BW1A 2VUBA 3URGA 1QCFA 5CAIA 1UGRB 2V8JA 4RTTA 2FVUA 1IGUA 2LX7A 3JCMQ 1K76A 3P8HA 2JXBA 3WVEB 4RTYA 4RTVA 2QQ9A 3VKIA 1M1FA 3M55A 3PMIA 1TXQA 2EW3A 4X34A 4PLLA 1DJ7B 4JLIA 3DKMA 1S72T 1RAGB 1AWXA 2BUDA 3WVDB 1ZSZC 4F17A 1M3BA 1BCOA 3H9NA 2MK5A 3G6ET 1K4US 2QQSA 3FC3A 5GAOn 4M77C 1VQOT 2O9VA 1IRXA 2DX1A 3OYIA 3JCMJ 2BZ8A 2FPEA 3OS0A 1JXMA 1VQ7A 1RUWA 3GP8A 3M57A 4LXCA 4IIOA 2J06A 2CREA 3CCMT 2HAXA 2HL3A 1X2QA 1D1BA 1NPPA 3BY7A 2DEUA 2DRMA 1ZSZA 3JB9J 3VS3A 4DQ2A 3E1SA 1OPKA 1Y96B 4M77A 3DLLA 4BE1A 1K0XA 4JRQA 2PQWA 4OMFB 4BD3A 4WTOB 5LJ5g 4PJJA 2VB6A 2OTJT 2ENMA 1VQNA 2RHUA 2XD0A 2QDYB 2XICA 1AWOA 1ZUUA 3JCMW 2H3EB 2LVMA 2E64A 3QZ9B 3ER0A 4GBQA 4BI4A 2Y4YA 5LJ3f 3SWNB 1ZQ1A 2C0TA 1VQPQ 2YDLA 1ZUYA 2X3WD 4M75C 1VQ4T 5GAMe 5LJ5e 4QVCA 1N9SA 2COWA 1O9SA 3OBYA 1C6VX 3EGXB 1WGSA 4OP0A 3J80E 4RTXA 5GAN4 2KT1A 3L2QA 3LX7A 1AHJB 2HQXA 3RERA 2CUDA 3CCET 3ME9A 5IHNA 4Z8AA 2E10A 2QTXA 2FPFA 2VGMA 2F5KA 2CH4W 3A8OB 3GLXA 3M4YA 3CCST 2L3RA 4KBMB 1PSFA 2V1QA 2HCKA 2GGRA 5GANg 3MCAB 1KG1A 2K5IA 1MMAA 1XOVA 3G71T 4M75A 2DTHA 1YJ9Q 4C0FA 4R56A 1QKXA 5FRNA 4J9CA 2J6OA 4ESRA 3RKYA 5CQYA 2AT1B 3L2VA 4FYYB 4L5GA 5GAMf 1C1AA 1RAIB 4FSXA 1QP3A 3A5ZB 3OYNA 2J05A 2V26A 1TG0A 2EQKA 3TVTA 1D0XA 1F1BB 4Z89A 3QJYA 3OA6A 4FYVB 4J9HA 4AG2C 4C0DB 3CMAQ 4C8QG 1JEGA 2GBQA 1A0NB 3RBBB 3NGPA 2EGEA 3ZFJA 1QWFA 4M7AE 4QT7A 4XTVA 4D8KA 3C12A 4XK8E 4LDWA 4CC2A 2XDPA 1Y0MA 2E6NA 2RK1A 1E6GA 3CCVT 1VQPA 4BY6C 3NFCA 3E9GA 3DLMA 2CT4A 2EYQA 3JCMg 1D3BA 1VYTA 4XU2A 3U23A 1VQ8Q 2QTVA 3LW5E 4M78C 1Y71A 4O5VA 2LJ1A 1G3YA 3H0IA 1X6OA 1WHKA 3NTHA 1BI2A 5L8RE 4KGXB 1YI2T 1WIEA 2NUZA 4MMKA 3UPUA 1VQ5T 1KQ1A 1X27A 1YCYA 3GPLA 4F14A 2LDMA 1YJ9A 3M4GA 1K1ZA 2CZ0B 2FZKB 3CC4Q 3CEYA 2EBPA 2B8AA 1BBZA 2ABLA 1LVKA 3Q1JA 1N6AA 2PU9B 3EG2A 3EFOA 2YSQA 4M78A 3KFVA 2OTLQ 4PFPA 4Y91A 4AFQC 4M75D 4PFZA 1OV3A 3OYKA 2DL3A 2JW4A 1UHFA 1SHGA 3GBQA 2MCNA 1X6BA 3QKJA 2KBTA 2AKKA 1IZ6A 3RMSA 4PFOA 5D7UA 2M0OA 3CMAA 3QG1A 4F7UB 3VU3C 3TREA 2DYBA 2JNGA 1PD1A 2FPDA 1YJWQ 2DJZA 4HA8A 2BZYA 2ZPHB 2K9GA 2L3PA 5IAYA 2CSQA 2RJCA 1YITQ 3QO3A 3SDZA 3LH0A 1KFZA 2QXFA 1K8AU 5GAOl 2DERA 3MP8A 1K73R 2JMCA 4P5NA 2KXCA 2FRYA 3JB9H 3MP1A 4HCBA 1NG2A 4DBFA 2ED1A 4J9DA 1VQMQ 4A53A 3CBOA 3HFOA 1VQKT 2M02A 3KUFA 2K6DA 2KEAA 5FU7B 1KK7A 1VQ8A 3CCQQ 2YRDA 2LCCA 3VRZA 4IKFA 1PRMC 4BUGA 4RMOA 2ZPGB 4J6WA 2DRKA 3OSVA 2D6FA 5A2QE 3HRUA 1WA7A 1BI0A 1NJIR 2FO0A 5CKDA 1WLPB 5KYXB 1KHIA 2EWNA 2DM1A 1KC8U 3VS2A 2I0NA 2YHTA 1R77A 2DIQA 4A4KA 5GAN8 2D9TA 3M53A 1I07A 2DAQA 1BIAA 3EH1A 3MEUA 1YJNQ 4JDSA 5GMKe 3CC4A 2JMAA 5IXFA 2WSFE 3H8ZA 1S1NA 4E7KA 2QGFB 1KC8R 2OTLA 1QLYA 1QVFA 3MEAA 3MPUB 3V7RA 1BK2A 2QI2A 2HD0A 3GF5A 2DF6A 3HSBA 2CGHA 2L8DA 1MUZA 2DZ9A 3UF4A 5GAOm 1RI0A 2RHIA 3V7SA 1YIJQ 1QVFS 9ATCB 2DNUA 1SF9A 1KQSA 2NYSA 3PFSA 5FRMA 1YHQT 1CSKA 3I35A 3MEWA 3V8JA 3ZEHA 2PUOB 1W2BA 3KBGA 1KQSS 2HBWA 3VJPA 2JS2A 3J81E 1NM7A 3CPWP 3AT1B 3LWIA 1YJWA 2DILA 4K11A 4J9GA 4OMLA 1PRLC 3A8HB 4DA4A 1YITA 1W2BS 3PT9A 1IB8A 4AFZC 3CCUQ 3VUBA 1B7TA 1EX4A 3REAB 1VIFA 2JM8A 4A4FA 1QVGA 4HT8A 4OB2B 4N4GA 2YT6A 1JU5C 2XIDA 1VQMA 2EAYA 5M9OA 2EJFA 1T3LA 1QVGS 3QWXX 2GQIA 3CCQA 4ZN3A 1Z9QA 4XTUA 2JS0A 1WXTA 1KD1C 3RKWA 1X69A 4CC7A 2BZXA 1OU9A 4M77F 4ATOA 4N0AC 1Q86R 1TS9A 2ZPIB 1LOJA 2JTMA 2KRSA 2NUTB 2DZCA 3DB3A 3NTKA 4QQGA 5L23A 1N5ZA 3OY9A 4ANJA 3GIBA 4XTZA 4E2FB 1YJNA 1LJOA 4E47A 1UGPB 2RNAA 4RG8A 2DVEA 1G3TA 4FIBA 2SEMA 2BTTA 2LTOA 1I81A 3EFSA 1ZX6A 4EPCA 5CK9A 3HFNA 4DOWA 2CZ7B 2ROTA 2K2VA 4M75G 1Q7YC 1HK9A 2PNIA 1X6GA 4N0AA 2KE9A 3I56Q 1M90U 2HNIA 1YIJA 5GAOq 2RM4A 5KE2A 1FWZA 3M5AA 1K73C 4OMOA 5I22A 1TSFA 2OAWA 3FB9A 3C4SA 4DBHA 3EHQA 5LJ5h 1XNIA 1GXIE 2ESWA 2F5TX 3CCLQ 1Q82C 4M75F 3VS4A 3JB9F 2Z0WA 3LWHA 4ELZC 3KXTA 4GLMA 2DVJA 4AT1B 2DL4A 4MZTA 3EAEA 2E5QA 1M8VA 3QPHA 3CCUA 2R58A 1NZ9A 1VQLT 4CRIA 2LQKA 3ZL7C 1G8XA 1VQPT 2E65A 1PM3A 3L42A 1D0YA 1ABOA 1SG5A 4C92C 5GAN5 1OOTA 3A8LB 2QK0A 4LN2A 2P0KA 1N8RC 2VASA 4FYWB 4JZ4A 4C8QB 2O31A 1TWBA 1Q81R 3S3MA 2IPOB 4KGZB 2JT4A 5I21A 4J5YA 5GJVB 3WXMB 5GAOp 1OU8A 2GCXA 1UGVA 3JCMb 3L2WA 2MWOA 4C0DC 2KRNA 4L6V5 3H0HA 1SPKA 4OB1B 5FROA 1RABB 2IVWA 3QJ6A 5GANh 1WQWA 3SD4A 2FYKA 3OYLA 1ZHIA 1NEGA 4AFSC 5KYYA 4M4ZA 2CUBA 4C0GA 2GFUA 2V8IA 5IXBA 1PCXA 1IO6A 4HT9A 1UDLA 1QVFP 4C92A 2DK3A 5LJ3g 1YJ9T 2DPPB 2EJGA 4OF1A 5A0GA 1WZOA 3UA7A 2YRVA 2EVRA 4ME7A 1E6HA 2EQIA 1UGQB 1OI1A 1WNLA 4EDUA 4FT4A 4QQ6A 5I11A 2FG0A 5CCAA 2E41A 5LJ3e 2PZ1A 3MKDA 4MZMA 2LMJA 4Z88A 3I56A 1M2OA 3L2ZA 1XQHA 1RAFB 3V8LA 2DIGA 3UDCA 1M1KC 4E7SA 4CC4B 5GANd 2RD1A 1IREB 4YTLA 1WYXA 1X75C 3CMAT 1KJWA 5A0LA 4PJOC 2OAUA 2KQWA 3OYGA 1EFNA 4XTYA 3CCLA 1I8FA 3OYHA 4FL6A 3H6ZA 2RJDA 1QVPA 2YRCA 1WHGA 3EGDB 5CIUA 3HPWA 3M0QA 1SRLA 1NE8A 2QDLA 3ASKA 3S3OA 4NOYA 5GAMg 5CKBA 4M78F 1JQQA 1Q86C 3JCMh 1WPYA 1G83A 1U3OA 2KVQG 2W10A 3LYIA 1NYFA 1VQ8T 1K9MC 3BFMA 2RPNA 1ABQA 4PJOA 2E70A 3FJ5A 3EG3A 2CZ1B 5GAMj 5LJ5j 1ZLMA 5KYWA 3P8DA 4PNOA 1T3SA 1ZA1B 2D1XA 3O8VA 4M77E 4IIMA 4XQ3A 4XU0A 2M9UA 5I2SA 4LNPA 1BB9A 3FRNA 3VS7A 3OYJA 1SKUB 4II1A 1RLQC 5CKFA 3JCMd 4EMHA 3CC4T 2JJ9A 5FU6B 1GCQC 3CXCA 1NPRA 5IHKA 1WXUA 1AZGB 5DM7R 3CCJQ 2E3HA 3ULRB 4XAXB 2CH4A 3CXCS 5FU7C 4C92D 2MOXA 1RI9A 4F7UA 2ZPBB 5GANj 4IUTA 2K3YA 2M1HA 3X20B 4F04B 3BDUA 5CKHA 5J39A 5D6WA 5FW9A 3RMQA 1P92A 2XG8D 1YJWT 3P8BB 1VOMA 2XU8A 4EIKA 3CC7Q 3EG1A 3T9NA 4E7JA 1GCQA 4M75E 1YITT 1HD3A 2EGCA 1TUCA 1Z9ZA 1T0JA 2YWWA 2A0FB 1ZBXA 2CDTA 2EFIA 4WCIA 4E7ZA 1MGQA 3J7AF 3QWYA 2JN0A 4DBRA 5AT1B 2EKOA 2ECZA 2VV5A 5KH6A 2O2OA 1VQMT 1PC0A 4BE0A 4DOVA 2DJQA 2BIVA 4FT2A 3X24B 2K3XA 4B6MA 2RQRA 1LNXA 3CCQT 1M2VB 4M77D 4KGVB 1WFWA 2FRWA 3A1PA 3OS1A 1WHLA 1R0BG 4ELYC 2C0OA 1AWJA 4ZGDB 2RA2A 2EYWA 1U06A 1ZSZB 4KUIA 2CS7A 3CCRQ 5HCKA 1BIBA 2ROLA 5HY6A 3MP6A 2YUPA 4PJOD 3EG0A 4X9DA 2VVKA 5CKEA 2J6FA 1C0MA 1YJNT 2DLPA 4J9EA 4ZGEB 4X1VA 4KUDK 2VC8A 1VQ4Q 4PJLA 4FCYA 1TTHB 4UC4A 2DL5A 2B86A 3QYGB 3CCJA 3JCMc 2OJ2A 4J6XA 4PL6A 3HL8A 1V76A 2CP3A 1X43A 3G4SQ 4E7IA 2KT8A 3DB4A 5A0DA 1YIJT 2QA4T 3BDLA 3JCMX 2E3IA 4EMKB 4ZTFA 3JB9D 1D1AA 2JTEA 2CYZB 2RHYA 2LP5A 1M9SA 3HHTB 3G71Q 3QZ5B 3CC7A 3RKXA 4ZGJB 2GNCA 4HVUA 4HXJA 2DXBA 4QKUA 5HK0A 3A8MB 4MDXA 1FMVA 4JS4A 5CQXA 2A3LA 4M75B 2L2PA 3CCUT 6AT1B 4M7AB 1GFCA 3ZBDA 1AWWA 4M78E 2AIRB 2X4WA 4FYXB 1W70A 2LCSA 4IUUA 5EG2A 3META 3JCMP 2RQTA 2KROA 5IN1A 2KSSA 2HDAA 1Q82U 1X01A 2RQUA 2XDDA 1LCKA 1GCPA 4AMCA 1PKTA 5GMKl 4C5HA 2WSEE 1HSQA 1K8AR 3GNGA 3M58A 4KH0B 2K3BA 4KULA 3CCRA 4GLKA 1WXBA 3RESA 4MMLA 1UJ0A 2F69A 2DE0X 3VYGA 3RDVA 1N8RU 1NBEB 2HZYA 2O9SA 2MYSA 1VQ4A 1KQ2A 3CC2Q 2K79A 1OEBA 2CP2A 1JJ2A 4M7DC 2W0ZA 1OZ2A 4ZN1A 2R57A 1M27C 1ZSGA 3N5BB 1WJSA 1PHTA 5GMKj 3I9QA 4C92G 3G4SA 3C95A 1I5OB 4C5GA 1V29B 1JJ2S 4J7FA 2PVDB 5GAN6 2DYIA 2CT3A 2VYTA 4C8QC 2EKHA 4JLGA 1VQ7T 1I1JA 1W4SA 3I56T 2IIMA 3H41A 1XTDA 1XJWB 4OGCA 2LT4A 7AT1B 2O4XB 2P0PA 4F16A 2ZCFB 4HVVA 2VWFA 1VQ9Q 1H3ZA 2LCLA 5HK3A 1YWOA 4WF2A 2EQUA 1ARKA 3CCLT 3V8KA 3G71A 3QDFA 2AZVA 1Q95G 4C92F 4M78D 2E5KA 4L59A 3QYHB 1D1CA 4M7DA 2EYYA 4BDYA 3CBPA 4BY6B 2E6ZA 3MHXA 4QVDA 3OS2A 4AG1C 4J8OA 5GMKm 2RJEA 2LRQA 2NUPB 2E4HA 2ZAEA 1MMNA 1VQNT 2L3QA 4C8QA 2KGTA 2JOYA 3REBB 1M1KU 2LNVA 2C0IA 1H92A 3M0TA 3OYEA 4M77G 2J6KA 1BYMA 1LPLA 2HMAA 3SHWA 4JRPA 5KCHA 3I55Q 2J7IA 1NLPC 2GTOA 2RK2A 1WHHA 2EYXA 1KIKA 2GQVA 1UB4A 1JO8A 2AHJB 1MNEA 2F2WA 4PJOG 2DL8A 2EJ9A 1OX8A 2KNBB 5LJ3h 2C06A 2JM9A 1EIFA 2K7AA 3EG9B 4LDYA 4LE9A 3CC2A 2QQRA 1GBRA 2KYBA 4PLIA 1VQKQ 3VYHB 2AZSA 2QG9B 2EIFA 4FSSA 4A4GA 4J6YA 2FZCB 4PJNA 3I5SA 4PJOF 2FHDA 4HKEA 4QVZA 3SWNC 4R0KA 4A54A 2VXFA 3OW2A 1AD5A 3NPFA 1D0ZA 3JB9G 4X9CA 1UEBA 1NLOC 3OS5A 1HXDA 2X35A 1H641 1VQ9A 3OW2S 5LJ3d 3EGDA 3MO8A 3JB9I 3OYBA 1Y96A 2L89A 2LNHB 1MMDA 4F7UG 2COYA 1SSHA 5GAN7 3A8GB 3PVLA 3SFMA 5GAMh 2ED0A 2KXDA 4HCZA 2MWPA 4KT0E 1H8KA 1B34B 2KRMA 2LX9A 1G2BA 1OPLA 2MAMA 5DY9A 1G3SA 1U5SA 1M90R 3CMEQ 3OYFA 1QMCA 3SWNA 2ZZDA 5FU6C 1QQJA 1WHMA 3FEOA 5HKCA 2KMTA 4HVWA 1NJIC 2YLBA 3LLRA 2QQAA 2FEIA 5DLOA 3QIIA 4M7DD 4F7UF 3TCJA 2YXYA 4JJDA 1YHQQ 3EGXA 3I55A 2X4JA 2VKNA 1WHJA 2EPDA 1SHFA 2EQMA 3PIPA 3RIRA 5EC7A 2RI2A 4GY5A 5GAMd 2HQHA 5LJ5d 2V8KA 2X9HA 4RUGA 4JS5A 1JJ2P 1OX9A 2IG0A 1KC8C 2X4YA 5C6SA 1NYGA 3UA6A 4OMQA 2D0NA 2DETA 3CPFA 3VV0A 3OYMA 1FXXA 2CP5A 3EFRA 2DA9A 2CZ6B 1VQKA 5KYUB 3D7SB 4DEYA 2CP7A 4NL2A 3CCJT 5KE3A 1PD0A 2DXCA 3VUZA 1UJYA 1UTIA 1KQSP 3QUIA 3M0RA 5CO7A 4RCCA 1J3TA 4FW2A 2JZ2A 2AKLA 2P84A 4O6JA 4AFUC 2R5MA 2QAZA 5AYFA 1W2BP 2F2VA 1IGQA 5LJ3j 1AVZC 3BE3A 2RQVA 2RHXA 4M78G 2CSIA 2RO0A 3CC7T 4ZTJA 2O01E 1UE9A 1IXDA 2DMOA 4C92E 1YFNA 4NS5A 3VS5A 2PVOB 2YUNA 1VYUA 2BE9B 2H8HA 2WACA 2X4XA 3UT1A 1QVGP 3VRYA 4JRIA 3JRZA 1BI3A 2LZ6B 2MIOA 5DLQE 3CMEA 3PMTA 1U8RA 2K2MA 2Y90A 3R6NA 1M2VA 4LD6A 2A36A 4OB3B 3HRTA 4Y28E 1NEBA 3OYCA 2X3XD 2JUFA 4XTXA 1YHQA 4N4IA 8ATCB 5KCOA 2KAFA 4E7HA 3M54A 2DD5A 2P4TA 2A37A 3C94A 4CI0C 2A08A 3M59A 1WJRA 2QEXQ 2EQJA 1M4ZA 2LJ3A 3QDRB 4IUQA 3HP9A 4EMKC 4LUEA 3R6OA 3SB2A 3JAME 3CCRT 1MV0B 1WX6A 2YUQA 3C0CA 3TSZA 1VQ6Q 2YLCA 3CD6Q 2CP6A 2QYZA 1UHCA 4EMGA 3EH2A 1VQLQ 3OYDA 1R0CB 4LDXA 2ZPEB 3QSUA 4MDWA 4MZPA 4A63B 2FL7A 3V7CA 4ZNXA 1V1CA 4BI8B 1QKWA 1OULA 3OMCA 2G3RA 4M7AC 3OW2P 1TU0B 2GF7A 5C0MA 2XMFA 2QGGA 3HRSA 1TUDA 1HYOA 1VYVA 4QW2A 1KSWA 1GFDA 3G4ST 2RHZA 4LDUA 4PJOE 4PK4A 5GAN2 1WI7A 4EMKA 2OTLT 5FWCA 5D6YA 3NHNA 1YNZA 3TQ7P 2Y4XA 1M90C 2LC4A 4ORZA 2XKOC 2COZA 3HTRA 2CKKA 4J7IA 1WDXA 5KYYB 2KI7A 1AZEA 1S72Q 4M7AA 3VS6A 3G6EQ 2I2LA 4C92B 5IH2A 1Q81C 5LJ5f 1JB0E 1VQOQ 1K9AA 5GANe 1MV3A 1MMGA
chains in the Genus database with same CATH topology
4F17A 1AWXA 3M0PA 1M3BA 2RQTA 2KROA 2D8JA 4CC3A 1K4US 3IQLA 3TSWA 2HDAA 2KRSA 2RQUA 1LCKA 1GCPA 5ECAA 1PKTA 1K0SA 1BU1A 2O9VA 1UFFA 2D8HA 1HSQA 2DX1A 2BZ8A 5L23A 1N5ZA 2FPEA 2DBKA 1JXMA 2K3BA 1RUWA 1WXBA 4IIOA 2J06A 2CREA 1UJ0A 2RNAA 1UG1A 2DE0X 2SEMA 2BTTA 1ZX6A 1X2QA 1JXOA 2O9SA 2ROTA 2DRMA 1CKBA 2K79A 1OEBA 2PNIA 1X6GA 3VS3A 2W0ZA 2KE9A 1OPKA 2KYMA 1M27C 1ZSGA 4OMOA 1PHTA 1K0XA 3EHRA 3A98A 3I9QA 5I22A 2OAWA 2CT3A 1H3HA 2EKHA 2HSPA 2ENMA 1I1JA 3CQTA 3EHQA 2IIMA 3H41A 1PNJA 2ESWA 1AWOA 1ZUUA 4GBQA 3VS4A 3THKA 1T0HA 4F16A 4HVVA 2C0TA 2VWFA 2YDLA 1ZUYA 4GLMA 2DVJA 4E6RA 1PKSA 1YWOA 2X3WD 1ARKA 1ZBJA 2DL4A 2AZVA 2E5KA 3ZL7C 2EYYA 4RTXA 3VS1A 1ABOA 3EGUA 1OOTA 4J9BA 2KT1A 4AG1C 4LN2A 4JZ4A 4RTZA 2CUDA 2O31A 5IHNA 1GRIA 4Z8AA 2L3QA 2FPFA 2KGTA 3REBB 2CH4W 2JT4A 4OMNA 2C0IA 1H92A 5GJVB 2SRCA 2V1QA 3M0TA 2J6KA 2HCKA 1UGVA 2GGRA 4OMMA 2KRNA 3H0HA 1SPKA 3SHWA 2J7IA 1XOVA 1NLPC 1QKXA 1NEGA 4J9CA 4AFSC 2GTOA 2J6OA 4ESRA 4M4ZA 4RTUA 2CUBA 1M8MA 2EYXA 2G6FX 5IXBA 1M3AA 3SEMA 1IO6A 3VS0A 4JJCA 1KIKA 1UDLA 1JO8A 2F2WA 5FWBA 2DL8A 4Y92A 3UA7A 2KNBB 2JM9A 2EVRA 2J05A 1E6HA 2K7AA 2EQIA 1TG0A 3TVTA 4KRTA 4Z89A 1PWTA 3NMZC 4J9HA 4LE9A 4AG2C 2RN8A 1M30A 5I11A 1GBRA 2FG0A 2KYBA 2PZ1A 2AZSA 2LMJA 4JZ3A 4Z88A 1JEGA 1VA7A 2GBQA 3PE0A 1A0NB 3M0SA 3RBBB 3NGPA 2EGEA 4FSSA 3RNJA 4CC4B 3I5SA 3O5ZA 1QWFA 4QT7A 4D8KA 1WYXA 4JJBA 2M51A 2RQWA 1KJWA 4CC2A 1W1FA 4R0KA 2LJ0A 1AD5A 1Y0MA 1EFNA 3NPFA 4DEXA 1SEMA 1E6GA 1NLOC 1RLPC 4OMPA 3M0QA 1B07A 2P4RA 2OI3A 2KR3A 1SRLA 2QDLA 5IHIA 2LNHB 2CT4A 1B3QA 1SSHA 1JQQA 2DL7A 3PVLA 1VYTA 1I0CA 2ED0A 2KXDA 3U23A 3LH5A 5GJWB 1GL5A 1H8KA 2KRMA 1G83A 1U3OA 1G2BA 2LJ1A 1OPLA 2W10A 3H0IA 4D8DA 1U5SA 3I5RA 1NYFA 1M3CA 2RPNA 1ABQA 1W6XA 2EGAA 2HEQA 3FJ5A 3EG3A 1WIEA 1ZLMA 4HVWA 2F2XA 2YUOA 2NUZA 2FEIA 1X27A 1T3SA 2D1XA 4JJDA 4F14A 2VKNA 4IIMA 2EPDA 4J9FA 2EYZA 1K1ZA 2RF0A 2EBPA 2M0YA 1BBZA 2ABLA 2L3SA 4LNPA 1SHFA 3EG2A 1BB9A 4J9IA 3VS7A 2YSQA 5EC7A 2O88A 3KFVA 3M0UA 1YN8A 1Y57A 1RLQC 4RUGA 1GCQC 2PTKA 4AFQC 5IHKA 1NYGA 1OV3A 2DL3A 3UA6A 4OMQA 2JW4A 1WXUA 2D0NA 1AZGB 2DBMA 1UHFA 1SHGA 3GBQA 2MCNA 1X6BA 3ULRB 2KBTA 2AKKA 2CH4A 2DA9A 4LUDA 1MV3A 2MOXA 4DEYA 1RI9A 1ZUKA 1FMKA 1QWEA 2DYBA 1SRMA 1UJYA 2FPDA 1UTIA 2RMOA 2BZYA 1UECA 2K9GA 2L3PA 3M0RA 2CSQA 1J3TA 5FW9A 1KFZA 2AKLA 4AFUC 4EIKA 2JMCA 3EG1A 2F2VA 3PVQA 2KXCA 1AVZC 1GCQA 1HD3A 2FRYA 3H0FA 2EGCA 1TUCA 1Z9ZA 1T0JA 2RQVA 1NG2A 2CDTA 1YCSB 1YWPA 2CSIA 2ED1A 4HCKA 4WCIA 4J9DA 1CKAA 2K6DA 2KEAA 1UE9A 2DMOA 3QWYA 3VS5A 2YUNA 1VYUA 2H8HA 3VRZA 1PRMC 2ECZA 2O2OA 2DJQA 3VRYA 1AEYA 2DRKA 1E7OA 2LZ6B 2MIOA 1WA7A 3UATA 2RQRA 2K2MA 2FO0A 3R6NA 1WLPB 1WFWA 1X2KA 1FYNA 2FRWA 1UUEA 2DM1A 3VS2A 2A36A 2I0NA 1HJDA 1NEBA 2X3XD 2C0OA 1AWJA 2EYWA 1U06A 1I07A 2A37A 2AK5A 2A08A 2LQWA 5HCKA 1YP5A 2JMAA 5IXFA 2ROLA 2YUPA 2LJ3A 3EG0A 2GTJA 2NWMA 4LUEA 2VVKA 2J6FA 1S1NA 1MV0B 2DLPA 1WX6A 2YUQA 4J9EA 1GBQA 1QLYA 3C0CA 4X1VA 3TSZA 1BK2A 2DF6A 1UHCA 3JV3A 1MUZA 3UF4A 2A28A 2L0AA 2DL5A 2B86A 2DNUA 4JPBW 4RTWA 2OJ2A 4A63B 1X43A 1CSKA 4ZNXA 1V1CA 1QKWA 3I35A 2KT8A 2HBWA 2XMFA 2JS2A 1TUDA 1NM7A 1VYVA 1KSWA 1GFDA 2DILA 4K11A 4J9GA 4OMLA 2V1RA 1PRLC 1AOJA 2JTEA 1WI7A 2LP5A 5FWCA 4AFZC 2LQNA 3NHNA 1YNZA 3REAB 2GNCA 4HVUA 4HXJA 1QCFA 2JM8A 4ORZA 4RTTA 2LX7A 2YT6A 1K76A 2L2PA 1JU5C 1WDXA 2JXBA 4RTYA 1GFCA 4RTVA 1AZEA 1AWWA 1T3LA 3QWXX 2GQIA 3VS6A 1Z9QA 5IH2A 2EW3A 2JS0A 1W70A 1WXTA 2LCSA 1X69A 4CC7A 1K9AA 2BZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F17 A;  1AWX A;  3M0P A;  1M3B A;  2RQT A;  2KRO A;  2D8J A;  4CC3 A;  1K4U S;  3IQL A;  3TSW A;  2HDA A;  2KRS A;  2RQU A;  1LCK A;  1GCP A;  5ECA A;  1PKT A;  1K0S A;  1BU1 A;  2O9V A;  1UFF A;  2D8H A;  1HSQ A;  2DX1 A;  2BZ8 A;  5L23 A;  1N5Z A;  2FPE A;  2DBK A;  1JXM A;  2K3B A;  1RUW A;  1WXB A;  4IIO A;  2J06 A;  2CRE A;  1UJ0 A;  2RNA A;  1UG1 A;  2DE0 X;  2SEM A;  2BTT A;  1ZX6 A;  1X2Q A;  1JXO A;  2O9S A;  2ROT A;  2DRM A;  1CKB A;  2K79 A;  1OEB A;  2PNI A;  1X6G A;  3VS3 A;  2W0Z A;  2KE9 A;  1OPK A;  2KYM A;  1M27 C;  1ZSG A;  4OMO A;  1PHT A;  1K0X A;  3EHR A;  3A98 A;  3I9Q A;  5I22 A;  2OAW A;  2CT3 A;  1H3H A;  2EKH A;  2HSP A;  2ENM A;  1I1J A;  3CQT A;  3EHQ A;  2IIM A;  3H41 A;  1PNJ A;  2ESW A;  1AWO A;  1ZUU A;  4GBQ A;  3VS4 A;  3THK A;  1T0H A;  4F16 A;  4HVV A;  2C0T A;  2VWF A;  2YDL A;  1ZUY A;  4GLM A;  2DVJ A;  4E6R A;  1PKS A;  1YWO A;  2X3W D;  1ARK A;  1ZBJ A;  2DL4 A;  2AZV A;  2E5K A;  3ZL7 C;  2EYY A;  4RTX A;  3VS1 A;  1ABO A;  3EGU A;  1OOT A;  4J9B A;  2KT1 A;  4AG1 C;  4LN2 A;  4JZ4 A;  4RTZ A;  2CUD A;  2O31 A;  5IHN A;  1GRI A;  4Z8A A;  2L3Q A;  2FPF A;  2KGT A;  3REB B;  2CH4 W;  2JT4 A;  4OMN A;  2C0I A;  1H92 A;  5GJV B;  2SRC A;  2V1Q A;  3M0T A;  2J6K A;  2HCK A;  1UGV A;  2GGR A;  4OMM A;  2KRN A;  3H0H A;  1SPK A;  3SHW A;  2J7I A;  1XOV A;  1NLP C;  1QKX A;  1NEG A;  4J9C A;  4AFS C;  2GTO A;  2J6O A;  4ESR A;  4M4Z A;  4RTU A;  2CUB A;  1M8M A;  2EYX A;  2G6F X;  5IXB A;  1M3A A;  3SEM A;  1IO6 A;  3VS0 A;  4JJC A;  1KIK A;  1UDL A;  1JO8 A;  2F2W A;  5FWB A;  2DL8 A;  4Y92 A;  3UA7 A;  2KNB B;  2JM9 A;  2EVR A;  2J05 A;  1E6H A;  2K7A A;  2EQI A;  1TG0 A;  3TVT A;  4KRT A;  4Z89 A;  1PWT A;  3NMZ C;  4J9H A;  4LE9 A;  4AG2 C;  2RN8 A;  1M30 A;  5I11 A;  1GBR A;  2FG0 A;  2KYB A;  2PZ1 A;  2AZS A;  2LMJ A;  4JZ3 A;  4Z88 A;  1JEG A;  1VA7 A;  2GBQ A;  3PE0 A;  1A0N B;  3M0S A;  3RBB B;  3NGP A;  2EGE A;  4FSS A;  3RNJ A;  4CC4 B;  3I5S A;  3O5Z A;  1QWF A;  4QT7 A;  4D8K A;  1WYX A;  4JJB A;  2M51 A;  2RQW A;  1KJW A;  4CC2 A;  1W1F A;  4R0K A;  2LJ0 A;  1AD5 A;  1Y0M A;  1EFN A;  3NPF A;  4DEX A;  1SEM A;  1E6G A;  1NLO C;  1RLP C;  4OMP A;  3M0Q A;  1B07 A;  2P4R A;  2OI3 A;  2KR3 A;  1SRL A;  2QDL A;  5IHI A;  2LNH B;  2CT4 A;  1B3Q A;  1SSH A;  1JQQ A;  2DL7 A;  3PVL A;  1VYT A;  1I0C A;  2ED0 A;  2KXD A;  3U23 A;  3LH5 A;  5GJW B;  1GL5 A;  1H8K A;  2KRM A;  1G83 A;  1U3O A;  1G2B A;  2LJ1 A;  1OPL A;  2W10 A;  3H0I A;  4D8D A;  1U5S A;  3I5R A;  1NYF A;  1M3C A;  2RPN A;  1ABQ A;  1W6X A;  2EGA A;  2HEQ A;  3FJ5 A;  3EG3 A;  1WIE A;  1ZLM A;  4HVW A;  2F2X A;  2YUO A;  2NUZ A;  2FEI A;  1X27 A;  1T3S A;  2D1X A;  4JJD A;  4F14 A;  2VKN A;  4IIM A;  2EPD A;  4J9F A;  2EYZ A;  1K1Z A;  2RF0 A;  2EBP A;  2M0Y A;  1BBZ A;  2ABL A;  2L3S A;  4LNP A;  1SHF A;  3EG2 A;  1BB9 A;  4J9I A;  3VS7 A;  2YSQ A;  5EC7 A;  2O88 A;  3KFV A;  3M0U A;  1YN8 A;  1Y57 A;  1RLQ C;  4RUG A;  1GCQ C;  2PTK A;  4AFQ C;  5IHK A;  1NYG A;  1OV3 A;  2DL3 A;  3UA6 A;  4OMQ A;  2JW4 A;  1WXU A;  2D0N A;  1AZG B;  2DBM A;  1UHF A;  1SHG A;  3GBQ A;  2MCN A;  1X6B A;  3ULR B;  2KBT A;  2AKK A;  2CH4 A;  2DA9 A;  4LUD A;  1MV3 A;  2MOX A;  4DEY A;  1RI9 A;  1ZUK A;  1FMK A;  1QWE A;  2DYB A;  1SRM A;  1UJY A;  2FPD A;  1UTI A;  2RMO A;  2BZY A;  1UEC A;  2K9G A;  2L3P A;  3M0R A;  2CSQ A;  1J3T A;  5FW9 A;  1KFZ A;  2AKL A;  4AFU C;  4EIK A;  2JMC A;  3EG1 A;  2F2V A;  3PVQ A;  2KXC A;  1AVZ C;  1GCQ A;  1HD3 A;  2FRY A;  3H0F A;  2EGC A;  1TUC A;  1Z9Z A;  1T0J A;  2RQV A;  1NG2 A;  2CDT A;  1YCS B;  1YWP A;  2CSI A;  2ED1 A;  4HCK A;  4WCI A;  4J9D A;  1CKA A;  2K6D A;  2KEA A;  1UE9 A;  2DMO A;  3QWY A;  3VS5 A;  2YUN A;  1VYU A;  2H8H A;  3VRZ A;  1PRM C;  2ECZ A;  2O2O A;  2DJQ A;  3VRY A;  1AEY A;  2DRK A;  1E7O A;  2LZ6 B;  2MIO A;  1WA7 A;  3UAT A;  2RQR A;  2K2M A;  2FO0 A;  3R6N A;  1WLP B;  1WFW A;  1X2K A;  1FYN A;  2FRW A;  1UUE A;  2DM1 A;  3VS2 A;  2A36 A;  2I0N A;  1HJD A;  1NEB A;  2X3X D;  2C0O A;  1AWJ A;  2EYW A;  1U06 A;  1I07 A;  2A37 A;  2AK5 A;  2A08 A;  2LQW A;  5HCK A;  1YP5 A;  2JMA A;  5IXF A;  2ROL A;  2YUP A;  2LJ3 A;  3EG0 A;  2GTJ A;  2NWM A;  4LUE A;  2VVK A;  2J6F A;  1S1N A;  1MV0 B;  2DLP A;  1WX6 A;  2YUQ A;  4J9E A;  1GBQ A;  1QLY A;  3C0C A;  4X1V A;  3TSZ A;  1BK2 A;  2DF6 A;  1UHC A;  3JV3 A;  1MUZ A;  3UF4 A;  2A28 A;  2L0A A;  2DL5 A;  2B86 A;  2DNU A;  4JPB W;  4RTW A;  2OJ2 A;  4A63 B;  1X43 A;  1CSK A;  4ZNX A;  1V1C A;  1QKW A;  3I35 A;  2KT8 A;  2HBW A;  2XMF A;  2JS2 A;  1TUD A;  1NM7 A;  1VYV A;  1KSW A;  1GFD A;  2DIL A;  4K11 A;  4J9G A;  4OML A;  2V1R A;  1PRL C;  1AOJ A;  2JTE A;  1WI7 A;  2LP5 A;  5FWC A;  4AFZ C;  2LQN A;  3NHN A;  1YNZ A;  3REA B;  2GNC A;  4HVU A;  4HXJ A;  1QCF A;  2JM8 A;  4ORZ A;  4RTT A;  2LX7 A;  2YT6 A;  1K76 A;  2L2P A;  1JU5 C;  1WDX A;  2JXB A;  4RTY A;  1GFC A;  4RTV A;  1AZE A;  1AWW A;  1T3L A;  3QWX X;  2GQI A;  3VS6 A;  1Z9Q A;  5IH2 A;  2EW3 A;  2JS0 A;  1W70 A;  1WXT A;  2LCS A;  1X69 A;  4CC7 A;  1K9A A;  2BZX A; 
#chains in the Genus database with same CATH topology
 2FZG B;  3PGG A;  3L2U A;  3M0P A;  4KH1 B;  2D8J A;  4CC3 A;  2HKN A;  3IQL A;  3TSW A;  4FW1 A;  3S6W A;  1RAA B;  4M7D G;  5ECA A;  1K0S A;  1BU1 A;  3M56 A;  1TH7 A;  5J3B A;  1UFF A;  2D8H A;  3CCM Q;  2RH2 A;  4F7U E;  2DBK A;  2VGN A;  1PSE A;  5GAO r;  2QEX A;  1R8O B;  1UG1 A;  2GFA A;  2KDS A;  5GMK h;  1AT1 B;  5KYX A;  1JXO A;  2BKD N;  5LL6 S;  4M7D F;  2RI3 A;  1VQ6 A;  3JCM V;  2RB6 A;  3CD6 A;  1CKB A;  2DTI A;  3CPW A;  4Q5W A;  3S3N A;  2OTJ Q;  1VQL A;  4R55 A;  4M77 B;  2KYM A;  4C8Q F;  4JRK A;  1FX7 A;  5GAN f;  3EHR A;  3A98 A;  3HKS A;  3CC2 T;  3FIF A;  2K5L A;  3CPW S;  1H3H A;  3INZ A;  2HSP A;  2XK0 A;  3CQT A;  2PUK B;  2DTO A;  4RCB A;  1PG5 B;  4V2S A;  1PNJ A;  2ZPF B;  8AT1 B;  3THK A;  3OMG A;  2XDB A;  1T0H A;  3PIO A;  1KD1 U;  2O4X A;  4PJO B;  3F70 A;  5J26 A;  4E6R A;  2OX7 A;  1PKS A;  1ZBJ A;  2DEQ A;  5KYW B;  3JCM e;  4D6W A;  4FM4 B;  3CCE Q;  1VQ9 T;  2D0Q B;  3VS1 A;  5FLX E;  3EGU A;  4J9B A;  3CCS Q;  4BDZ A;  4JUV A;  3QBY A;  4RTZ A;  1GRI A;  2HL5 C;  1S72 A;  2NUP A;  1KD1 R;  4PJM A;  2E1H A;  3G6E A;  4OMN A;  1M5Q 1;  1I5L A;  4XU3 A;  3OQ5 A;  2SRC A;  1VQO A;  3CBM A;  4RG2 A;  2QAS A;  4C5E A;  4OMM A;  2VXE A;  1Y7X A;  1RAC B;  1QCN A;  1Q7Y U;  4NL3 A;  3FDR A;  2H3J A;  1OZ3 A;  2MMP A;  4M7A D;  4RTU A;  1M8M A;  2G6F X;  3E9F A;  3CCM A;  1K73 U;  1M3A A;  3SEM A;  3VS0 A;  2XHC A;  4JJC A;  3I55 T;  3MEV A;  1SSF A;  3JCM f;  1TUG B;  2QQB A;  2JTF A;  4Y92 A;  5FWB A;  4HCC A;  1RAH B;  1G5V A;  3QHS A;  3EG9 A;  1Q7Y R;  3PTA A;  4KRT A;  2NUT A;  1PWT A;  3NMZ C;  2RN8 A;  2DO3 A;  1M30 A;  3OYA A;  2OTJ A;  3FJP A;  4JZ3 A;  1BI1 A;  1VA7 A;  3PE0 A;  5GMK i;  1NJI U;  3M0S A;  3RNJ A;  5D6X A;  3TU4 K;  3CXC P;  1OQK A;  3O5Z A;  2RI5 A;  3TEE A;  4JJB A;  2M51 A;  2RQW A;  1D09 B;  1W1F A;  3CCV Q;  1Q82 R;  4N4H A;  2LJ0 A;  4DEX A;  1N9R A;  1OYX A;  1SEM A;  5GAN 3;  2MI6 A;  4OVA A;  4BE2 A;  1RLP C;  2R5A A;  3OBW A;  4OMP A;  4LDV A;  1WJQ A;  1B07 A;  1G3W A;  2P4R A;  2P0Q A;  2OI3 A;  1TOV A;  1JBM A;  2KR3 A;  1BKB A;  5IHI A;  3LGL A;  1B3Q A;  1D3B B;  2PVG B;  5CVI A;  3CCE A;  2DL7 A;  1RL2 A;  1N8R R;  1IHV A;  1I0C A;  3JSC A;  3LH5 A;  5GJW B;  1GL5 A;  3AHU A;  3CCS A;  4B9W A;  1B34 A;  1YI2 Q;  4D8D A;  3PNW C;  3I5R A;  1VQ5 Q;  1M3C A;  1W6X A;  2FB7 A;  2EGA A;  2HEQ A;  3GOX A;  2F2X A;  3QXE B;  4OGE A;  2YUO A;  5KYN A;  4JJN K;  3CME T;  3LGF A;  2CP0 A;  1QW1 A;  1M1G A;  4J9F A;  3OSS C;  2EYZ A;  2QA4 Q;  3G1J A;  2HKQ B;  2RF0 A;  4A4E A;  4C0Z A;  2M0Y A;  1WQ7 A;  2L3S A;  3EFO B;  3OYY A;  4M78 B;  1ACM B;  4J9I A;  2HQE A;  2O88 A;  3M0U A;  1YN8 A;  1Y57 A;  4J83 A;  1N27 A;  2ATC B;  4BB7 A;  4QQD A;  2M16 A;  5CR2 A;  2LT1 A;  2PTK A;  4BI3 A;  2DBM A;  4TVR A;  4E7L A;  3X26 B;  4M7D E;  1KHC A;  1RAD B;  2BE7 D;  4LUD A;  1M1K R;  3FLG A;  1I4K 1;  3E2U A;  2DKG A;  4IUV A;  5KYU A;  1ZUK A;  1FMK A;  3X25 B;  1QWE A;  2KK4 A;  1Q86 U;  4C8Q E;  1SRM A;  2RMO A;  3G7Z A;  1UEC A;  2NLU A;  2DXT A;  3CCV A;  2RJF A;  4IUP A;  1ZA2 B;  1QCO A;  2XI9 A;  1K9M U;  2JVV A;  4OB0 B;  3PVQ A;  3H0F A;  2E12 A;  3M9Q A;  2HSE B;  1YCS B;  1YBY A;  1YWP A;  4HCK A;  4A4H A;  2K5F A;  2L5Q A;  1CKA A;  3E19 A;  1O75 A;  1MHN A;  2DXU A;  1VIE A;  4DBQ A;  1QP2 A;  3RUX A;  2F1L A;  1K9M R;  4BAC A;  2KY9 A;  1YI2 A;  2K4Y A;  1AEY A;  1E7O A;  3GNF B;  2K57 A;  1VQ5 A;  3UAT A;  1JRI A;  1BCM A;  1X2K A;  4VUB A;  1FYN A;  5I2M A;  3UWN A;  1U1S A;  1UUE A;  2HBP A;  1HJD A;  3X28 B;  1FMW A;  1IHW A;  2LQ8 A;  2MF2 A;  1VQ7 Q;  4M7A G;  2AK5 A;  2LQW A;  3NTI A;  4XU1 A;  2QA4 A;  1K8A C;  1YP5 A;  1Y07 A;  2GTJ A;  2NWM A;  4Z02 A;  4IUR A;  1EZZ B;  2ZGW A;  1GBQ A;  3MJX A;  2QEX T;  4XTW A;  3JV3 A;  3L1A A;  1Q81 U;  2A28 A;  2L0A A;  4JPB W;  4M7A F;  4C8Q D;  4RTW A;  3L2R A;  1VQ6 T;  3CD6 T;  4PKC C;  1U1T A;  4LD9 K;  4M7D B;  1RAE B;  1UGS B;  1VQN Q;  2A7Y A;  2X51 A;  2DFU A;  4RKU E;  1MND A;  2MPX C;  3OB9 A;  2V1R A;  5IT9 E;  1AOJ A;  4B9X A;  4C5I A;  1VUB A;  2WSC E;  4FU6 A;  3RR6 A;  2LQN A;  2DD4 A;  3BW1 A;  2VUB A;  3URG A;  1QCF A;  5CAI A;  1UGR B;  2V8J A;  4RTT A;  2FVU A;  1IGU A;  2LX7 A;  3JCM Q;  1K76 A;  3P8H A;  2JXB A;  3WVE B;  4RTY A;  4RTV A;  2QQ9 A;  3VKI A;  1M1F A;  3M55 A;  3PMI A;  1TXQ A;  2EW3 A;  4X34 A;  4PLL A;  1DJ7 B;  4JLI A;  3DKM A;  1S72 T;  1RAG B;  1AWX A;  2BUD A;  3WVD B;  1ZSZ C;  4F17 A;  1M3B A;  1BCO A;  3H9N A;  2MK5 A;  3G6E T;  1K4U S;  2QQS A;  3FC3 A;  5GAO n;  4M77 C;  1VQO T;  2O9V A;  1IRX A;  2DX1 A;  3OYI A;  3JCM J;  2BZ8 A;  2FPE A;  3OS0 A;  1JXM A;  1VQ7 A;  1RUW A;  3GP8 A;  3M57 A;  4LXC A;  4IIO A;  2J06 A;  2CRE A;  3CCM T;  2HAX A;  2HL3 A;  1X2Q A;  1D1B A;  1NPP A;  3BY7 A;  2DEU A;  2DRM A;  1ZSZ A;  3JB9 J;  3VS3 A;  4DQ2 A;  3E1S A;  1OPK A;  1Y96 B;  4M77 A;  3DLL A;  4BE1 A;  1K0X A;  4JRQ A;  2PQW A;  4OMF B;  4BD3 A;  4WTO B;  5LJ5 g;  4PJJ A;  2VB6 A;  2OTJ T;  2ENM A;  1VQN A;  2RHU A;  2XD0 A;  2QDY B;  2XIC A;  1AWO A;  1ZUU A;  3JCM W;  2H3E B;  2LVM A;  2E64 A;  3QZ9 B;  3ER0 A;  4GBQ A;  4BI4 A;  2Y4Y A;  5LJ3 f;  3SWN B;  1ZQ1 A;  2C0T A;  1VQP Q;  2YDL A;  1ZUY A;  2X3W D;  4M75 C;  1VQ4 T;  5GAM e;  5LJ5 e;  4QVC A;  1N9S A;  2COW A;  1O9S A;  3OBY A;  1C6V X;  3EGX B;  1WGS A;  4OP0 A;  3J80 E;  4RTX A;  5GAN 4;  2KT1 A;  3L2Q A;  3LX7 A;  1AHJ B;  2HQX A;  3RER A;  2CUD A;  3CCE T;  3ME9 A;  5IHN A;  4Z8A A;  2E10 A;  2QTX A;  2FPF A;  2VGM A;  2F5K A;  2CH4 W;  3A8O B;  3GLX A;  3M4Y A;  3CCS T;  2L3R A;  4KBM B;  1PSF A;  2V1Q A;  2HCK A;  2GGR A;  5GAN g;  3MCA B;  1KG1 A;  2K5I A;  1MMA A;  1XOV A;  3G71 T;  4M75 A;  2DTH A;  1YJ9 Q;  4C0F A;  4R56 A;  1QKX A;  5FRN A;  4J9C A;  2J6O A;  4ESR A;  3RKY A;  5CQY A;  2AT1 B;  3L2V A;  4FYY B;  4L5G A;  5GAM f;  1C1A A;  1RAI B;  4FSX A;  1QP3 A;  3A5Z B;  3OYN A;  2J05 A;  2V26 A;  1TG0 A;  2EQK A;  3TVT A;  1D0X A;  1F1B B;  4Z89 A;  3QJY A;  3OA6 A;  4FYV B;  4J9H A;  4AG2 C;  4C0D B;  3CMA Q;  4C8Q G;  1JEG A;  2GBQ A;  1A0N B;  3RBB B;  3NGP A;  2EGE A;  3ZFJ A;  1QWF A;  4M7A E;  4QT7 A;  4XTV A;  4D8K A;  3C12 A;  4XK8 E;  4LDW A;  4CC2 A;  2XDP A;  1Y0M A;  2E6N A;  2RK1 A;  1E6G A;  3CCV T;  1VQP A;  4BY6 C;  3NFC A;  3E9G A;  3DLM A;  2CT4 A;  2EYQ A;  3JCM g;  1D3B A;  1VYT A;  4XU2 A;  3U23 A;  1VQ8 Q;  2QTV A;  3LW5 E;  4M78 C;  1Y71 A;  4O5V A;  2LJ1 A;  1G3Y A;  3H0I A;  1X6O A;  1WHK A;  3NTH A;  1BI2 A;  5L8R E;  4KGX B;  1YI2 T;  1WIE A;  2NUZ A;  4MMK A;  3UPU A;  1VQ5 T;  1KQ1 A;  1X27 A;  1YCY A;  3GPL A;  4F14 A;  2LDM A;  1YJ9 A;  3M4G A;  1K1Z A;  2CZ0 B;  2FZK B;  3CC4 Q;  3CEY A;  2EBP A;  2B8A A;  1BBZ A;  2ABL A;  1LVK A;  3Q1J A;  1N6A A;  2PU9 B;  3EG2 A;  3EFO A;  2YSQ A;  4M78 A;  3KFV A;  2OTL Q;  4PFP A;  4Y91 A;  4AFQ C;  4M75 D;  4PFZ A;  1OV3 A;  3OYK A;  2DL3 A;  2JW4 A;  1UHF A;  1SHG A;  3GBQ A;  2MCN A;  1X6B A;  3QKJ A;  2KBT A;  2AKK A;  1IZ6 A;  3RMS A;  4PFO A;  5D7U A;  2M0O A;  3CMA A;  3QG1 A;  4F7U B;  3VU3 C;  3TRE A;  2DYB A;  2JNG A;  1PD1 A;  2FPD A;  1YJW Q;  2DJZ A;  4HA8 A;  2BZY A;  2ZPH B;  2K9G A;  2L3P A;  5IAY A;  2CSQ A;  2RJC A;  1YIT Q;  3QO3 A;  3SDZ A;  3LH0 A;  1KFZ A;  2QXF A;  1K8A U;  5GAO l;  2DER A;  3MP8 A;  1K73 R;  2JMC A;  4P5N A;  2KXC A;  2FRY A;  3JB9 H;  3MP1 A;  4HCB A;  1NG2 A;  4DBF A;  2ED1 A;  4J9D A;  1VQM Q;  4A53 A;  3CBO A;  3HFO A;  1VQK T;  2M02 A;  3KUF A;  2K6D A;  2KEA A;  5FU7 B;  1KK7 A;  1VQ8 A;  3CCQ Q;  2YRD A;  2LCC A;  3VRZ A;  4IKF A;  1PRM C;  4BUG A;  4RMO A;  2ZPG B;  4J6W A;  2DRK A;  3OSV A;  2D6F A;  5A2Q E;  3HRU A;  1WA7 A;  1BI0 A;  1NJI R;  2FO0 A;  5CKD A;  1WLP B;  5KYX B;  1KHI A;  2EWN A;  2DM1 A;  1KC8 U;  3VS2 A;  2I0N A;  2YHT A;  1R77 A;  2DIQ A;  4A4K A;  5GAN 8;  2D9T A;  3M53 A;  1I07 A;  2DAQ A;  1BIA A;  3EH1 A;  3MEU A;  1YJN Q;  4JDS A;  5GMK e;  3CC4 A;  2JMA A;  5IXF A;  2WSF E;  3H8Z A;  1S1N A;  4E7K A;  2QGF B;  1KC8 R;  2OTL A;  1QLY A;  1QVF A;  3MEA A;  3MPU B;  3V7R A;  1BK2 A;  2QI2 A;  2HD0 A;  3GF5 A;  2DF6 A;  3HSB A;  2CGH A;  2L8D A;  1MUZ A;  2DZ9 A;  3UF4 A;  5GAO m;  1RI0 A;  2RHI A;  3V7S A;  1YIJ Q;  1QVF S;  9ATC B;  2DNU A;  1SF9 A;  1KQS A;  2NYS A;  3PFS A;  5FRM A;  1YHQ T;  1CSK A;  3I35 A;  3MEW A;  3V8J A;  3ZEH A;  2PUO B;  1W2B A;  3KBG A;  1KQS S;  2HBW A;  3VJP A;  2JS2 A;  3J81 E;  1NM7 A;  3CPW P;  3AT1 B;  3LWI A;  1YJW A;  2DIL A;  4K11 A;  4J9G A;  4OML A;  1PRL C;  3A8H B;  4DA4 A;  1YIT A;  1W2B S;  3PT9 A;  1IB8 A;  4AFZ C;  3CCU Q;  3VUB A;  1B7T A;  1EX4 A;  3REA B;  1VIF A;  2JM8 A;  4A4F A;  1QVG A;  4HT8 A;  4OB2 B;  4N4G A;  2YT6 A;  1JU5 C;  2XID A;  1VQM A;  2EAY A;  5M9O A;  2EJF A;  1T3L A;  1QVG S;  3QWX X;  2GQI A;  3CCQ A;  4ZN3 A;  1Z9Q A;  4XTU A;  2JS0 A;  1WXT A;  1KD1 C;  3RKW A;  1X69 A;  4CC7 A;  2BZX A;  1OU9 A;  4M77 F;  4ATO A;  4N0A C;  1Q86 R;  1TS9 A;  2ZPI B;  1LOJ A;  2JTM A;  2KRS A;  2NUT B;  2DZC A;  3DB3 A;  3NTK A;  4QQG A;  5L23 A;  1N5Z A;  3OY9 A;  4ANJ A;  3GIB A;  4XTZ A;  4E2F B;  1YJN A;  1LJO A;  4E47 A;  1UGP B;  2RNA A;  4RG8 A;  2DVE A;  1G3T A;  4FIB A;  2SEM A;  2BTT A;  2LTO A;  1I81 A;  3EFS A;  1ZX6 A;  4EPC A;  5CK9 A;  3HFN A;  4DOW A;  2CZ7 B;  2ROT A;  2K2V A;  4M75 G;  1Q7Y C;  1HK9 A;  2PNI A;  1X6G A;  4N0A A;  2KE9 A;  3I56 Q;  1M90 U;  2HNI A;  1YIJ A;  5GAO q;  2RM4 A;  5KE2 A;  1FWZ A;  3M5A A;  1K73 C;  4OMO A;  5I22 A;  1TSF A;  2OAW A;  3FB9 A;  3C4S A;  4DBH A;  3EHQ A;  5LJ5 h;  1XNI A;  1GXI E;  2ESW A;  2F5T X;  3CCL Q;  1Q82 C;  4M75 F;  3VS4 A;  3JB9 F;  2Z0W A;  3LWH A;  4ELZ C;  3KXT A;  4GLM A;  2DVJ A;  4AT1 B;  2DL4 A;  4MZT A;  3EAE A;  2E5Q A;  1M8V A;  3QPH A;  3CCU A;  2R58 A;  1NZ9 A;  1VQL T;  4CRI A;  2LQK A;  3ZL7 C;  1G8X A;  1VQP T;  2E65 A;  1PM3 A;  3L42 A;  1D0Y A;  1ABO A;  1SG5 A;  4C92 C;  5GAN 5;  1OOT A;  3A8L B;  2QK0 A;  4LN2 A;  2P0K A;  1N8R C;  2VAS A;  4FYW B;  4JZ4 A;  4C8Q B;  2O31 A;  1TWB A;  1Q81 R;  3S3M A;  2IPO B;  4KGZ B;  2JT4 A;  5I21 A;  4J5Y A;  5GJV B;  3WXM B;  5GAO p;  1OU8 A;  2GCX A;  1UGV A;  3JCM b;  3L2W A;  2MWO A;  4C0D C;  2KRN A;  4L6V 5;  3H0H A;  1SPK A;  4OB1 B;  5FRO A;  1RAB B;  2IVW A;  3QJ6 A;  5GAN h;  1WQW A;  3SD4 A;  2FYK A;  3OYL A;  1ZHI A;  1NEG A;  4AFS C;  5KYY A;  4M4Z A;  2CUB A;  4C0G A;  2GFU A;  2V8I A;  5IXB A;  1PCX A;  1IO6 A;  4HT9 A;  1UDL A;  1QVF P;  4C92 A;  2DK3 A;  5LJ3 g;  1YJ9 T;  2DPP B;  2EJG A;  4OF1 A;  5A0G A;  1WZO A;  3UA7 A;  2YRV A;  2EVR A;  4ME7 A;  1E6H A;  2EQI A;  1UGQ B;  1OI1 A;  1WNL A;  4EDU A;  4FT4 A;  4QQ6 A;  5I11 A;  2FG0 A;  5CCA A;  2E41 A;  5LJ3 e;  2PZ1 A;  3MKD A;  4MZM A;  2LMJ A;  4Z88 A;  3I56 A;  1M2O A;  3L2Z A;  1XQH A;  1RAF B;  3V8L A;  2DIG A;  3UDC A;  1M1K C;  4E7S A;  4CC4 B;  5GAN d;  2RD1 A;  1IRE B;  4YTL A;  1WYX A;  1X75 C;  3CMA T;  1KJW A;  5A0L A;  4PJO C;  2OAU A;  2KQW A;  3OYG A;  1EFN A;  4XTY A;  3CCL A;  1I8F A;  3OYH A;  4FL6 A;  3H6Z A;  2RJD A;  1QVP A;  2YRC A;  1WHG A;  3EGD B;  5CIU A;  3HPW A;  3M0Q A;  1SRL A;  1NE8 A;  2QDL A;  3ASK A;  3S3O A;  4NOY A;  5GAM g;  5CKB A;  4M78 F;  1JQQ A;  1Q86 C;  3JCM h;  1WPY A;  1G83 A;  1U3O A;  2KVQ G;  2W10 A;  3LYI A;  1NYF A;  1VQ8 T;  1K9M C;  3BFM A;  2RPN A;  1ABQ A;  4PJO A;  2E70 A;  3FJ5 A;  3EG3 A;  2CZ1 B;  5GAM j;  5LJ5 j;  1ZLM A;  5KYW A;  3P8D A;  4PNO A;  1T3S A;  1ZA1 B;  2D1X A;  3O8V A;  4M77 E;  4IIM A;  4XQ3 A;  4XU0 A;  2M9U A;  5I2S A;  4LNP A;  1BB9 A;  3FRN A;  3VS7 A;  3OYJ A;  1SKU B;  4II1 A;  1RLQ C;  5CKF A;  3JCM d;  4EMH A;  3CC4 T;  2JJ9 A;  5FU6 B;  1GCQ C;  3CXC A;  1NPR A;  5IHK A;  1WXU A;  1AZG B;  5DM7 R;  3CCJ Q;  2E3H A;  3ULR B;  4XAX B;  2CH4 A;  3CXC S;  5FU7 C;  4C92 D;  2MOX A;  1RI9 A;  4F7U A;  2ZPB B;  5GAN j;  4IUT A;  2K3Y A;  2M1H A;  3X20 B;  4F04 B;  3BDU A;  5CKH A;  5J39 A;  5D6W A;  5FW9 A;  3RMQ A;  1P92 A;  2XG8 D;  1YJW T;  3P8B B;  1VOM A;  2XU8 A;  4EIK A;  3CC7 Q;  3EG1 A;  3T9N A;  4E7J A;  1GCQ A;  4M75 E;  1YIT T;  1HD3 A;  2EGC A;  1TUC A;  1Z9Z A;  1T0J A;  2YWW A;  2A0F B;  1ZBX A;  2CDT A;  2EFI A;  4WCI A;  4E7Z A;  1MGQ A;  3J7A F;  3QWY A;  2JN0 A;  4DBR A;  5AT1 B;  2EKO A;  2ECZ A;  2VV5 A;  5KH6 A;  2O2O A;  1VQM T;  1PC0 A;  4BE0 A;  4DOV A;  2DJQ A;  2BIV A;  4FT2 A;  3X24 B;  2K3X A;  4B6M A;  2RQR A;  1LNX A;  3CCQ T;  1M2V B;  4M77 D;  4KGV B;  1WFW A;  2FRW A;  3A1P A;  3OS1 A;  1WHL A;  1R0B G;  4ELY C;  2C0O A;  1AWJ A;  4ZGD B;  2RA2 A;  2EYW A;  1U06 A;  1ZSZ B;  4KUI A;  2CS7 A;  3CCR Q;  5HCK A;  1BIB A;  2ROL A;  5HY6 A;  3MP6 A;  2YUP A;  4PJO D;  3EG0 A;  4X9D A;  2VVK A;  5CKE A;  2J6F A;  1C0M A;  1YJN T;  2DLP A;  4J9E A;  4ZGE B;  4X1V A;  4KUD K;  2VC8 A;  1VQ4 Q;  4PJL A;  4FCY A;  1TTH B;  4UC4 A;  2DL5 A;  2B86 A;  3QYG B;  3CCJ A;  3JCM c;  2OJ2 A;  4J6X A;  4PL6 A;  3HL8 A;  1V76 A;  2CP3 A;  1X43 A;  3G4S Q;  4E7I A;  2KT8 A;  3DB4 A;  5A0D A;  1YIJ T;  2QA4 T;  3BDL A;  3JCM X;  2E3I A;  4EMK B;  4ZTF A;  3JB9 D;  1D1A A;  2JTE A;  2CYZ B;  2RHY A;  2LP5 A;  1M9S A;  3HHT B;  3G71 Q;  3QZ5 B;  3CC7 A;  3RKX A;  4ZGJ B;  2GNC A;  4HVU A;  4HXJ A;  2DXB A;  4QKU A;  5HK0 A;  3A8M B;  4MDX A;  1FMV A;  4JS4 A;  5CQX A;  2A3L A;  4M75 B;  2L2P A;  3CCU T;  6AT1 B;  4M7A B;  1GFC A;  3ZBD A;  1AWW A;  4M78 E;  2AIR B;  2X4W A;  4FYX B;  1W70 A;  2LCS A;  4IUU A;  5EG2 A;  3MET A;  3JCM P;  2RQT A;  2KRO A;  5IN1 A;  2KSS A;  2HDA A;  1Q82 U;  1X01 A;  2RQU A;  2XDD A;  1LCK A;  1GCP A;  4AMC A;  1PKT A;  5GMK l;  4C5H A;  2WSE E;  1HSQ A;  1K8A R;  3GNG A;  3M58 A;  4KH0 B;  2K3B A;  4KUL A;  3CCR A;  4GLK A;  1WXB A;  3RES A;  4MML A;  1UJ0 A;  2F69 A;  2DE0 X;  3VYG A;  3RDV A;  1N8R U;  1NBE B;  2HZY A;  2O9S A;  2MYS A;  1VQ4 A;  1KQ2 A;  3CC2 Q;  2K79 A;  1OEB A;  2CP2 A;  1JJ2 A;  4M7D C;  2W0Z A;  1OZ2 A;  4ZN1 A;  2R57 A;  1M27 C;  1ZSG A;  3N5B B;  1WJS A;  1PHT A;  5GMK j;  3I9Q A;  4C92 G;  3G4S A;  3C95 A;  1I5O B;  4C5G A;  1V29 B;  1JJ2 S;  4J7F A;  2PVD B;  5GAN 6;  2DYI A;  2CT3 A;  2VYT A;  4C8Q C;  2EKH A;  4JLG A;  1VQ7 T;  1I1J A;  1W4S A;  3I56 T;  2IIM A;  3H41 A;  1XTD A;  1XJW B;  4OGC A;  2LT4 A;  7AT1 B;  2O4X B;  2P0P A;  4F16 A;  2ZCF B;  4HVV A;  2VWF A;  1VQ9 Q;  1H3Z A;  2LCL A;  5HK3 A;  1YWO A;  4WF2 A;  2EQU A;  1ARK A;  3CCL T;  3V8K A;  3G71 A;  3QDF A;  2AZV A;  1Q95 G;  4C92 F;  4M78 D;  2E5K A;  4L59 A;  3QYH B;  1D1C A;  4M7D A;  2EYY A;  4BDY A;  3CBP A;  4BY6 B;  2E6Z A;  3MHX A;  4QVD A;  3OS2 A;  4AG1 C;  4J8O A;  5GMK m;  2RJE A;  2LRQ A;  2NUP B;  2E4H A;  2ZAE A;  1MMN A;  1VQN T;  2L3Q A;  4C8Q A;  2KGT A;  2JOY A;  3REB B;  1M1K U;  2LNV A;  2C0I A;  1H92 A;  3M0T A;  3OYE A;  4M77 G;  2J6K A;  1BYM A;  1LPL A;  2HMA A;  3SHW A;  4JRP A;  5KCH A;  3I55 Q;  2J7I A;  1NLP C;  2GTO A;  2RK2 A;  1WHH A;  2EYX A;  1KIK A;  2GQV A;  1UB4 A;  1JO8 A;  2AHJ B;  1MNE A;  2F2W A;  4PJO G;  2DL8 A;  2EJ9 A;  1OX8 A;  2KNB B;  5LJ3 h;  2C06 A;  2JM9 A;  1EIF A;  2K7A A;  3EG9 B;  4LDY A;  4LE9 A;  3CC2 A;  2QQR A;  1GBR A;  2KYB A;  4PLI A;  1VQK Q;  3VYH B;  2AZS A;  2QG9 B;  2EIF A;  4FSS A;  4A4G A;  4J6Y A;  2FZC B;  4PJN A;  3I5S A;  4PJO F;  2FHD A;  4HKE A;  4QVZ A;  3SWN C;  4R0K A;  4A54 A;  2VXF A;  3OW2 A;  1AD5 A;  3NPF A;  1D0Z A;  3JB9 G;  4X9C A;  1UEB A;  1NLO C;  3OS5 A;  1HXD A;  2X35 A;  1H64 1;  1VQ9 A;  3OW2 S;  5LJ3 d;  3EGD A;  3MO8 A;  3JB9 I;  3OYB A;  1Y96 A;  2L89 A;  2LNH B;  1MMD A;  4F7U G;  2COY A;  1SSH A;  5GAN 7;  3A8G B;  3PVL A;  3SFM A;  5GAM h;  2ED0 A;  2KXD A;  4HCZ A;  2MWP A;  4KT0 E;  1H8K A;  1B34 B;  2KRM A;  2LX9 A;  1G2B A;  1OPL A;  2MAM A;  5DY9 A;  1G3S A;  1U5S A;  1M90 R;  3CME Q;  3OYF A;  1QMC A;  3SWN A;  2ZZD A;  5FU6 C;  1QQJ A;  1WHM A;  3FEO A;  5HKC A;  2KMT A;  4HVW A;  1NJI C;  2YLB A;  3LLR A;  2QQA A;  2FEI A;  5DLO A;  3QII A;  4M7D D;  4F7U F;  3TCJ A;  2YXY A;  4JJD A;  1YHQ Q;  3EGX A;  3I55 A;  2X4J A;  2VKN A;  1WHJ A;  2EPD A;  1SHF A;  2EQM A;  3PIP A;  3RIR A;  5EC7 A;  2RI2 A;  4GY5 A;  5GAM d;  2HQH A;  5LJ5 d;  2V8K A;  2X9H A;  4RUG A;  4JS5 A;  1JJ2 P;  1OX9 A;  2IG0 A;  1KC8 C;  2X4Y A;  5C6S A;  1NYG A;  3UA6 A;  4OMQ A;  2D0N A;  2DET A;  3CPF A;  3VV0 A;  3OYM A;  1FXX A;  2CP5 A;  3EFR A;  2DA9 A;  2CZ6 B;  1VQK A;  5KYU B;  3D7S B;  4DEY A;  2CP7 A;  4NL2 A;  3CCJ T;  5KE3 A;  1PD0 A;  2DXC A;  3VUZ A;  1UJY A;  1UTI A;  1KQS P;  3QUI A;  3M0R A;  5CO7 A;  4RCC A;  1J3T A;  4FW2 A;  2JZ2 A;  2AKL A;  2P84 A;  4O6J A;  4AFU C;  2R5M A;  2QAZ A;  5AYF A;  1W2B P;  2F2V A;  1IGQ A;  5LJ3 j;  1AVZ C;  3BE3 A;  2RQV A;  2RHX A;  4M78 G;  2CSI A;  2RO0 A;  3CC7 T;  4ZTJ A;  2O01 E;  1UE9 A;  1IXD A;  2DMO A;  4C92 E;  1YFN A;  4NS5 A;  3VS5 A;  2PVO B;  2YUN A;  1VYU A;  2BE9 B;  2H8H A;  2WAC A;  2X4X A;  3UT1 A;  1QVG P;  3VRY A;  4JRI A;  3JRZ A;  1BI3 A;  2LZ6 B;  2MIO A;  5DLQ E;  3CME A;  3PMT A;  1U8R A;  2K2M A;  2Y90 A;  3R6N A;  1M2V A;  4LD6 A;  2A36 A;  4OB3 B;  3HRT A;  4Y28 E;  1NEB A;  3OYC A;  2X3X D;  2JUF A;  4XTX A;  1YHQ A;  4N4I A;  8ATC B;  5KCO A;  2KAF A;  4E7H A;  3M54 A;  2DD5 A;  2P4T A;  2A37 A;  3C94 A;  4CI0 C;  2A08 A;  3M59 A;  1WJR A;  2QEX Q;  2EQJ A;  1M4Z A;  2LJ3 A;  3QDR B;  4IUQ A;  3HP9 A;  4EMK C;  4LUE A;  3R6O A;  3SB2 A;  3JAM E;  3CCR T;  1MV0 B;  1WX6 A;  2YUQ A;  3C0C A;  3TSZ A;  1VQ6 Q;  2YLC A;  3CD6 Q;  2CP6 A;  2QYZ A;  1UHC A;  4EMG A;  3EH2 A;  1VQL Q;  3OYD A;  1R0C B;  4LDX A;  2ZPE B;  3QSU A;  4MDW A;  4MZP A;  4A63 B;  2FL7 A;  3V7C A;  4ZNX A;  1V1C A;  4BI8 B;  1QKW A;  1OUL A;  3OMC A;  2G3R A;  4M7A C;  3OW2 P;  1TU0 B;  2GF7 A;  5C0M A;  2XMF A;  2QGG A;  3HRS A;  1TUD A;  1HYO A;  1VYV A;  4QW2 A;  1KSW A;  1GFD A;  3G4S T;  2RHZ A;  4LDU A;  4PJO E;  4PK4 A;  5GAN 2;  1WI7 A;  4EMK A;  2OTL T;  5FWC A;  5D6Y A;  3NHN A;  1YNZ A;  3TQ7 P;  2Y4X A;  1M90 C;  2LC4 A;  4ORZ A;  2XKO C;  2COZ A;  3HTR A;  2CKK A;  4J7I A;  1WDX A;  5KYY B;  2KI7 A;  1AZE A;  1S72 Q;  4M7A A;  3VS6 A;  3G6E Q;  2I2L A;  4C92 B;  5IH2 A;  1Q81 C;  5LJ5 f;  1JB0 E;  1VQO Q;  1K9A A;  5GAN e;  1MV3 A;  1MMG A; 
#chains in the Genus database with same CATH homology
 4F17 A;  1AWX A;  3M0P A;  1M3B A;  2RQT A;  2KRO A;  2D8J A;  4CC3 A;  1K4U S;  3IQL A;  3TSW A;  2HDA A;  2KRS A;  2RQU A;  1LCK A;  1GCP A;  5ECA A;  1PKT A;  1K0S A;  1BU1 A;  2O9V A;  1UFF A;  2D8H A;  1HSQ A;  2DX1 A;  2BZ8 A;  5L23 A;  1N5Z A;  2FPE A;  2DBK A;  1JXM A;  2K3B A;  1RUW A;  1WXB A;  4IIO A;  2J06 A;  2CRE A;  1UJ0 A;  2RNA A;  1UG1 A;  2DE0 X;  2SEM A;  2BTT A;  1ZX6 A;  1X2Q A;  1JXO A;  2O9S A;  2ROT A;  2DRM A;  1CKB A;  2K79 A;  1OEB A;  2PNI A;  1X6G A;  3VS3 A;  2W0Z A;  2KE9 A;  1OPK A;  2KYM A;  1M27 C;  1ZSG A;  4OMO A;  1PHT A;  1K0X A;  3EHR A;  3A98 A;  3I9Q A;  5I22 A;  2OAW A;  2CT3 A;  1H3H A;  2EKH A;  2HSP A;  2ENM A;  1I1J A;  3CQT A;  3EHQ A;  2IIM A;  3H41 A;  1PNJ A;  2ESW A;  1AWO A;  1ZUU A;  4GBQ A;  3VS4 A;  3THK A;  1T0H A;  4F16 A;  4HVV A;  2C0T A;  2VWF A;  2YDL A;  1ZUY A;  4GLM A;  2DVJ A;  4E6R A;  1PKS A;  1YWO A;  2X3W D;  1ARK A;  1ZBJ A;  2DL4 A;  2AZV A;  2E5K A;  3ZL7 C;  2EYY A;  4RTX A;  3VS1 A;  1ABO A;  3EGU A;  1OOT A;  4J9B A;  2KT1 A;  4AG1 C;  4LN2 A;  4JZ4 A;  4RTZ A;  2CUD A;  2O31 A;  5IHN A;  1GRI A;  4Z8A A;  2L3Q A;  2FPF A;  2KGT A;  3REB B;  2CH4 W;  2JT4 A;  4OMN A;  2C0I A;  1H92 A;  5GJV B;  2SRC A;  2V1Q A;  3M0T A;  2J6K A;  2HCK A;  1UGV A;  2GGR A;  4OMM A;  2KRN A;  3H0H A;  1SPK A;  3SHW A;  2J7I A;  1XOV A;  1NLP C;  1QKX A;  1NEG A;  4J9C A;  4AFS C;  2GTO A;  2J6O A;  4ESR A;  4M4Z A;  4RTU A;  2CUB A;  1M8M A;  2EYX A;  2G6F X;  5IXB A;  1M3A A;  3SEM A;  1IO6 A;  3VS0 A;  4JJC A;  1KIK A;  1UDL A;  1JO8 A;  2F2W A;  5FWB A;  2DL8 A;  4Y92 A;  3UA7 A;  2KNB B;  2JM9 A;  2EVR A;  2J05 A;  1E6H A;  2K7A A;  2EQI A;  1TG0 A;  3TVT A;  4KRT A;  4Z89 A;  1PWT A;  3NMZ C;  4J9H A;  4LE9 A;  4AG2 C;  2RN8 A;  1M30 A;  5I11 A;  1GBR A;  2FG0 A;  2KYB A;  2PZ1 A;  2AZS A;  2LMJ A;  4JZ3 A;  4Z88 A;  1JEG A;  1VA7 A;  2GBQ A;  3PE0 A;  1A0N B;  3M0S A;  3RBB B;  3NGP A;  2EGE A;  4FSS A;  3RNJ A;  4CC4 B;  3I5S A;  3O5Z A;  1QWF A;  4QT7 A;  4D8K A;  1WYX A;  4JJB A;  2M51 A;  2RQW A;  1KJW A;  4CC2 A;  1W1F A;  4R0K A;  2LJ0 A;  1AD5 A;  1Y0M A;  1EFN A;  3NPF A;  4DEX A;  1SEM A;  1E6G A;  1NLO C;  1RLP C;  4OMP A;  3M0Q A;  1B07 A;  2P4R A;  2OI3 A;  2KR3 A;  1SRL A;  2QDL A;  5IHI A;  2LNH B;  2CT4 A;  1B3Q A;  1SSH A;  1JQQ A;  2DL7 A;  3PVL A;  1VYT A;  1I0C A;  2ED0 A;  2KXD A;  3U23 A;  3LH5 A;  5GJW B;  1GL5 A;  1H8K A;  2KRM A;  1G83 A;  1U3O A;  1G2B A;  2LJ1 A;  1OPL A;  2W10 A;  3H0I A;  4D8D A;  1U5S A;  3I5R A;  1NYF A;  1M3C A;  2RPN A;  1ABQ A;  1W6X A;  2EGA A;  2HEQ A;  3FJ5 A;  3EG3 A;  1WIE A;  1ZLM A;  4HVW A;  2F2X A;  2YUO A;  2NUZ A;  2FEI A;  1X27 A;  1T3S A;  2D1X A;  4JJD A;  4F14 A;  2VKN A;  4IIM A;  2EPD A;  4J9F A;  2EYZ A;  1K1Z A;  2RF0 A;  2EBP A;  2M0Y A;  1BBZ A;  2ABL A;  2L3S A;  4LNP A;  1SHF A;  3EG2 A;  1BB9 A;  4J9I A;  3VS7 A;  2YSQ A;  5EC7 A;  2O88 A;  3KFV A;  3M0U A;  1YN8 A;  1Y57 A;  1RLQ C;  4RUG A;  1GCQ C;  2PTK A;  4AFQ C;  5IHK A;  1NYG A;  1OV3 A;  2DL3 A;  3UA6 A;  4OMQ A;  2JW4 A;  1WXU A;  2D0N A;  1AZG B;  2DBM A;  1UHF A;  1SHG A;  3GBQ A;  2MCN A;  1X6B A;  3ULR B;  2KBT A;  2AKK A;  2CH4 A;  2DA9 A;  4LUD A;  1MV3 A;  2MOX A;  4DEY A;  1RI9 A;  1ZUK A;  1FMK A;  1QWE A;  2DYB A;  1SRM A;  1UJY A;  2FPD A;  1UTI A;  2RMO A;  2BZY A;  1UEC A;  2K9G A;  2L3P A;  3M0R A;  2CSQ A;  1J3T A;  5FW9 A;  1KFZ A;  2AKL A;  4AFU C;  4EIK A;  2JMC A;  3EG1 A;  2F2V A;  3PVQ A;  2KXC A;  1AVZ C;  1GCQ A;  1HD3 A;  2FRY A;  3H0F A;  2EGC A;  1TUC A;  1Z9Z A;  1T0J A;  2RQV A;  1NG2 A;  2CDT A;  1YCS B;  1YWP A;  2CSI A;  2ED1 A;  4HCK A;  4WCI A;  4J9D A;  1CKA A;  2K6D A;  2KEA A;  1UE9 A;  2DMO A;  3QWY A;  3VS5 A;  2YUN A;  1VYU A;  2H8H A;  3VRZ A;  1PRM C;  2ECZ A;  2O2O A;  2DJQ A;  3VRY A;  1AEY A;  2DRK A;  1E7O A;  2LZ6 B;  2MIO A;  1WA7 A;  3UAT A;  2RQR A;  2K2M A;  2FO0 A;  3R6N A;  1WLP B;  1WFW A;  1X2K A;  1FYN A;  2FRW A;  1UUE A;  2DM1 A;  3VS2 A;  2A36 A;  2I0N A;  1HJD A;  1NEB A;  2X3X D;  2C0O A;  1AWJ A;  2EYW A;  1U06 A;  1I07 A;  2A37 A;  2AK5 A;  2A08 A;  2LQW A;  5HCK A;  1YP5 A;  2JMA A;  5IXF A;  2ROL A;  2YUP A;  2LJ3 A;  3EG0 A;  2GTJ A;  2NWM A;  4LUE A;  2VVK A;  2J6F A;  1S1N A;  1MV0 B;  2DLP A;  1WX6 A;  2YUQ A;  4J9E A;  1GBQ A;  1QLY A;  3C0C A;  4X1V A;  3TSZ A;  1BK2 A;  2DF6 A;  1UHC A;  3JV3 A;  1MUZ A;  3UF4 A;  2A28 A;  2L0A A;  2DL5 A;  2B86 A;  2DNU A;  4JPB W;  4RTW A;  2OJ2 A;  4A63 B;  1X43 A;  1CSK A;  4ZNX A;  1V1C A;  1QKW A;  3I35 A;  2KT8 A;  2HBW A;  2XMF A;  2JS2 A;  1TUD A;  1NM7 A;  1VYV A;  1KSW A;  1GFD A;  2DIL A;  4K11 A;  4J9G A;  4OML A;  2V1R A;  1PRL C;  1AOJ A;  2JTE A;  1WI7 A;  2LP5 A;  5FWC A;  4AFZ C;  2LQN A;  3NHN A;  1YNZ A;  3REA B;  2GNC A;  4HVU A;  4HXJ A;  1QCF A;  2JM8 A;  4ORZ A;  4RTT A;  2LX7 A;  2YT6 A;  1K76 A;  2L2P A;  1JU5 C;  1WDX A;  2JXB A;  4RTY A;  1GFC A;  4RTV A;  1AZE A;  1AWW A;  1T3L A;  3QWX X;  2GQI A;  3VS6 A;  1Z9Q A;  5IH2 A;  2EW3 A;  2JS0 A;  1W70 A;  1WXT A;  2LCS A;  1X69 A;  4CC7 A;  1K9A A;  2BZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...