2CDTA

Alpha-spectrin sh3 domain a56s mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPASYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative Propagation of Local Stability Changes from Low-Stability and High-Stability Regions in a SH3 Domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cdtA00
1YWOA 1E6GA 1X6BA 2DILA 3EGUA 4Z8AA 3REBB 1OPKA 2BTTA 2DVJA 2E5KA 2RN8A 4JJDA 1SPKA 1IO6A 1YCSB 2C0IA 2FPFA 3M0QA 3VS4A 4IIOA 2LCSA 1QWEA 2KXCA 1T3SA 1JO8A 4E6RA 1GFCA 4CC2A 4M4ZA 2FO0A 2J6KA 3M0TA 5L23A 2D0NA 4OMPA 1EFNA 2AZVA 2AK5A 3O5ZA 4QT7A 4X1VA 5HCKA 1NLPC 4J9DA 4A63B 2K6DA 1HJDA 5IHKA 2J7IA 2DNUA 2CH4A 2LJ3A 3I9QA 1AZEA 3EG2A 1B3QA 1FYNA 1I07A 1JXMA 2GGRA 1M27C 3H0IA 2LJ1A 1SHFA 2LZ6B 1PKSA 1JEGA 1U3OA 2X3WD 1B07A 3REAB 4J9CA 1KSWA 2B86A 4EIKA 5IHIA 3ZL7C 2LJ0A 2YUNA 3I5RA 1CSKA 3VRZA 1QCFA 2DL5A 1MV3A 1UJ0A 2L2PA 2A36A 2J06A 2L3QA 2DA9A 2FEIA 2GNCA 4FSSA 3C0CA 1VYUA 2FG0A 3UA7A 2G6FX 3NMZC 2JM8A 1M30A 3EG3A 5IHNA 4DEYA 2K9GA 2CT3A 2JTEA 1AD5A 2ROLA 4LUEA 1GL5A 2HCKA 2RF0A 2OI3A 2DRKA 4J9BA 1GBRA 2A37A 2IIMA 2O88A 2F2WA 2RQTA 4RTUA 2YSQA 1QKWA 2KT1A 2KR3A 1PHTA 1PNJA 1T0JA 1VA7A 1M3AA 4J9EA 2EKHA 4RTVA 1YP5A 3FJ5A 1T3LA 1OEBA 2RQRA 2V1QA 1ZSGA 2JS2A 2JT4A 2KRNA 4J9GA 1X6GA 1GFDA 1RI9A 4CC3A 1TUCA 4Y92A 2NUZA 2ABLA 2JXBA 1AOJA 2RQUA 3PVLA 4HCKA 3VS1A 3M0PA 1H92A 1G83A 4R0KA 4F16A 2CDTA 4RTZA 2DRMA 1X69A 2KNBB 1WLPB 1PWTA 2DX1A 2GQIA 1K76A 1TG0A 4JZ3A 1GCPA 1QLYA 4AFZC 4D8DA 1RLQC 2CUDA 1WXBA 1KFZA 4OMMA 2HEQA 4RUGA 4F14A 2PTKA 2RNAA 2GTOA 4JPBW 4F17A 2K7AA 1WXUA 2O2OA 3VS7A 2LMJA 3NGPA 4RTTA 1Z9QA 1HSQA 2JMAA 2YUOA 3TVTA 2YT6A 2L3SA 2EGEA 2DBKA 2RMOA 1BU1A 3TSZA 2KE9A 1SEMA 3EG0A 1CKAA 1M8MA 3NPFA 3RBBB 1LCKA 2J6FA 2M0YA 2GTJA 2XMFA 4DEXA 1X27A 3NHNA 2EGCA 1AWOA 5IXFA 3VS0A 2LQNA 1HD3A 2ESWA 2A08A 1S1NA 2P4RA 3M0UA 1MUZA 1M3CA 2K79A 1I0CA 2J05A 3SEMA 1M3BA 1OPLA 4WCIA 4GBQA 4ORZA 5IXBA 3EHRA 1SSHA 1JQQA 1K1ZA 4AFUC 1ZLMA 1AVZC 3H0FA 1NG2A 1UHCA 1W70A 2FPDA 2VWFA 1K4US 2KYBA 2OJ2A 3EHQA 4GLMA 2DF6A 4J9FA 3PVQA 3UF4A 1UDLA 2EYXA 4HXJA 2RPNA 2BZ8A 2ENMA 1NM7A 1ABQA 1GCQC 2EPDA 2AZSA 2C0OA 2SEMA 4JZ4A 1WXTA 4CC4B 2L0AA 3VS6A 3IQLA 1UJYA 3EG1A 2L3PA 2JMCA 1E7OA 1GRIA 4OMQA 2SRCA 1WDXA 1YWPA 4LNPA 2EW3A 1UHFA 2JM9A 1SRMA 1J3TA 2KROA 3UA6A 5FWCA 2EVRA 4D8KA 2DL3A 1ZUKA 4AFSC 1X2QA 2RQWA 2KBTA 2AKLA 1NEGA 1NLOC 2KGTA 1UTIA 2JS0A 3M0RA 1WFWA 4JJBA 2C0TA 2O31A 1PRMC 1NYGA 2YUQA 2OAWA 4J9IA 2W10A 2EYZA 1RUWA 4AFQC 2DJQA 2V1RA 4HVUA 3U23A 2FPEA 1T0HA 2CREA 1NEBA 2CSIA 1Z9ZA 2EGAA 3RNJA 1AWJA 4KRTA 1N5ZA 2EYYA 1K9AA 1ZUUA 1W1FA 2BZYA 4HVVA 1VYTA 2MCNA 1E6HA 2LQWA 1K0SA 2VKNA 3QWXX 1UGVA 1ABOA 1X43A 3VS3A 2MOXA 1WYXA 3LH5A 2PZ1A 2KXDA 1ZX6A 3VS5A 2NWMA 2D1XA 1WA7A 2D8HA 3SHWA 1ZUYA 2M51A 1U06A 3VS2A 2HDAA 4J9HA 2DMOA 2D8JA 1AWXA 1KJWA 3I5SA 1V1CA 1UUEA 1ZBJA 1YNZA 1AZGB 2FRWA 3JV3A 1CKBA 2CUBA 1OV3A 2DM1A 1PKTA 2JW4A 2KYMA 1G2BA 1TUDA 5GJVB 1GBQA 3R6NA 1PRLC 1KIKA 1OOTA 1VYVA 1K0XA 3VRYA 3H0HA 1SHGA 1AEYA 4RTYA 5FWBA 3H41A 1A0NB 5IH2A 2MIOA 4RTXA 2DL7A 2EYWA 1UECA 2KEAA 3GBQA 5ECAA 2ECZA 1XOVA 2F2VA 2X3XD 1H3HA 1NYFA 1X2KA 2BZXA 4Z88A 2DE0X 1H8KA 3KFVA 5FW9A 4OMLA 5I11A 3PE0A 2K3BA 1ARKA 2DBMA 1Y57A 1SRLA 4AG1C 2FRYA 1MV0B 2DL8A 2KT8A 1JU5C 1QKXA 4CC7A 1W6XA 2CSQA 2RQVA 2LNHB 4Z89A 2CH4W 2QDLA 1BK2A 2EBPA 2GBQA 5I22A 1YN8A 1UG1A 4ESRA 4HVWA 1BBZA 1WX6A 2W0ZA 3QWYA 5EC7A 2H8HA 1BB9A 2K2MA 4LUDA 2ROTA 2DYBA 2DL4A 2J6OA 2AKKA 1JXOA 1Y0MA 4RTWA 2ED1A 2A28A 4LE9A 1RLPC 4IIMA 2I0NA 1UFFA 3I35A 1AWWA 4LN2A 3M0SA 2KRMA 2YUPA 2VVKA 2ED0A 3CQTA 4AG2C 3ULRB 4K11A 4OMOA 2LP5A 2O9SA 1FMKA 2HBWA 3THKA 2CT4A 2LX7A 1I1JA 1WIEA 2KRSA 2EQIA 3TSWA 2DLPA 3A98A 1U5SA 2YDLA 2O9VA 4ZNXA 1UE9A 4JJCA 2PNIA 5GJWB 1GCQA 3UATA 1WI7A 2HSPA 4OMNA 1QWFA 2F2XA
chains in the Genus database with same CATH superfamily
3PFSA 1E6GA 2XDDA 2DFUA 3RESA 3REBB 2DAQA 2E5KA 3OSVA 1IO6A 4PJJA 1K9MC 2FPFA 2EQUA 2LCSA 1MGQA 1GFCA 2FZGB 5L23A 2QQAA 2OTJA 3JCMd 5HCKA 4A63B 4J9DA 1G8XA 2K6DA 2R57A 5LJ5h 4JUVA 1HJDA 1LOJA 5CVIA 1YHQQ 1B3QA 5GAMj 1M90R 2LZ6B 3CCUA 1PKSA 2X3WD 3FJPA 2YUNA 3L2WA 1QCFA 1X6OA 3CCVQ 3TQ7P 5A0LA 2A36A 1PCXA 1U1SA 2RI5A 1U8RA 2FEIA 1YJNQ 2LC4A 4LDUA 2FG0A 2E4HA 2G6FX 4A4KA 2JM8A 3M4YA 1M30A 4DEYA 1VQ7T 4BUGA 5GAN5 1GL5A 2RF0A 2LQ8A 3PNWC 4M77D 2D0QB 5FLXE 1QVGP 3C4SA 2A37A 1I8FA 1YITA 3JCMe 2K5IA 1W4SA 4RTUA 1QKWA 2KT1A 2KR3A 1PNJA 2EIFA 5GAOn 1M3AA 2M16A 2EKHA 4FW1A 3I55T 3FJ5A 1LNXA 4C5EA 1ZSGA 1TUCA 1BI1A 2LX9A 4RKUE 3S6WA 3OMCA 1WJSA 3OB9A 3QUIA 3DB4A 2QA4Q 4HCKA 1YJWQ 3CCSQ 4R0KA 4QQGA 3HRUA 2KNBB 4C92C 3QO3A 1PWTA 2R5AA 4ELZC 4OF1A 3CCET 1K76A 1TG0A 2QTXA 4JZ3A 3A8OB 4M7DG 2RA2A 4D8DA 5CO7A 1RLQC 2CUDA 4CRIA 2WSFE 3EH2A 3G4ST 2VASA 2Y4XA 2RJDA 2PTKA 2XDBA 9ATCB 3QBYA 4JPBW 3OBYA 4QKUA 4RG2A 1WXUA 3ZFJA 1QVFA 2YUOA 5GAOl 3CCLQ 2A3LA 3HPWA 2YT6A 3JCMg 3TVTA 1H3ZA 4M77E 2EGEA 2DTIA 2RMOA 2QQBA 1RAHB 1SEMA 1YJ9A 2DXTA 3RBBB 3TCJA 3CMEQ 3LH0A 2J6FA 1NPRA 1MMNA 4NS5A 2XMFA 3CD6T 4MDWA 2OTLA 4EMGA 1B34B 1WZOA 2O4XA 4L5GA 2EGCA 4XTZA 1VQ9A 2A0FB 3ME9A 5IXFA 3VS0A 5GMKm 3QZ9B 3JCMX 1C1AA 1IHWA 4E7JA 3CBPA 1S1NA 4BDZA 1OU9A 1MUZA 1M3CA 1Q82C 3CCSA 1I0CA 2J05A 3SEMA 1Q81R 2ZPBB 4XAXB 3M55A 2FL7A 2ZPFB 4R55A 5LJ3d 4AFUC 2EJGA 1UHCA 3V7RA 2YXYA 2KYBA 4PJNA 4MDXA 3EHQA 3EFOA 3OYIA 3C95A 4J9FA 3UF4A 2EYXA 4BE0A 5LJ5g 1VQ5T 4M7DA 4M7DB 5LJ3h 3X26B 1VQ8A 2AZSA 2GQVA 2HSEB 4FM4B 3EGXA 3HFNA 2GCXA 2L0AA 2COYA 3IQLA 3NTKA 3TEEA 1UJYA 2LDMA 4MMLA 1HK9A 1IXDA 1PSFA 2XDPA 4XU2A 1WHMA 4LD9K 1UHFA 2JM9A 5FU7C 1M1KC 1J3TA 2KROA 5FWCA 1X01A 3HP9A 3G4SA 1NJIC 4D8KA 1ZUKA 4AFSC 2HAXA 4FSXA 2AKLA 1UTIA 1YI2Q 2VGNA 1K8AC 4JJBA 2O31A 2QGGA 3MHXA 4J9IA 4C92G 1YFNA 2X9HA 3L2UA 1RUWA 3MP8A 6AT1B 3HTRA 1Z9ZA 2EGAA 1Y96B 3RNJA 3EG9B 2CGHA 4KRTA 2EYYA 1KHIA 1K9AA 1M8VA 3OYLA 3EFRA 4KBMB 2BZYA 2DEQA 2ZZDA 1WJRA 2HKQB 1E6HA 2MCNA 1K0SA 1UB4A 2VKNA 3FC3A 1UGVA 1X43A 1WYXA 4BD3A 2KXDA 2NWMA 1UGQB 3SFMA 1VQ6A 3CC2A 3BE3A 4M7AB 4MZTA 4LXCA 2D8JA 2H3EB 1AWXA 1M1FA 3CPFA 1ZBJA 1UGSB 2P4TA 2VGMA 4FYWB 1YNZA 1S72T 3I55A 2RHIA 2QA4A 3BFMA 4E7KA 2VYTA 4HCZA 1OV3A 4M75C 2DM1A 2JW4A 2KYMA 3UPUA 1YITT 5AT1B 3VKIA 1G2BA 1GBQA 1JJ2S 2QDYB 1Q86R 4FYVB 4B9WA 2Y4YA 2E64A 5FWBA 3H41A 1A0NB 1JJ2A 3JB9F 3VUZA 5KYWB 3OSSC 3C12A 2ECZA 3OYJA 2F1LA 3CPWA 2X3XD 3DB3A 4JRPA 2R58A 1KK7A 2BZXA 5KYXA 2YHTA 1D3BB 5D6WA 3HHTB 2K3BA 3CEYA 5GANg 4OGCA 3ASKA 3H8ZA 4C8QE 2DL8A 1W6XA 2KMTA 4ANJA 2DXBA 3CPWP 2LNHB 1BK2A 2GBQA 2RI2A 1YN8A 4ESRA 2HQHA 1D09B 3CCRT 4JDSA 4EDUA 2CZ6B 2DK3A 1BB9A 3RKYA 1Y7XA 3ZEHA 2HMAA 2DYBA 4MMKA 1JXOA 2ED1A 4EMKC 2JTMA 2KVQG 4IUUA 2A28A 4LE9A 3NTIA 2RK1A 2I0NA 1BI3A 3MPUB 4M75A 4M7AE 3MEVA 3CBMA 3ULRB 4OMOA 1S72A 2X4XA 4WF2A 1D0YA 3TSWA 4PLLA 2DYIA 2DTHA 2JNGA 2DLPA 1D1AA 2O4XB 2L5QA 2YDLA 4IUQA 2DJZA 4E7HA 2E5QA 2PNIA 3JB9J 3F70A 3QPHA 3RKXA 4OMFB 2C06A 2ZAEA 3EH1A 3CCJQ 3EGUA 1QW1A 3KXTA 1I4K1 4Z8AA 1OPKA 3MEUA 2RN8A 2PVGB 4JJDA 1SPKA 4HA8A 3M0QA 1VQ5A 2CP2A 2FO0A 3CCRQ 4XU3A 4OMPA 2QQRA 4QT7A 3O5ZA 2JTFA 1VQMT 2DXCA 3TU4K 4M75B 2VB6A 1D1CA 4ZTFA 4M7DC 3QKJA 1IB8A 3LLRA 5HY6A 2BKDN 4C5HA 3JCMh 2MWPA 2LJ1A 2FHDA 1MHNA 1B07A 3LYIA 3REAB 4J9CA 1KSWA 4EIKA 2P0QA 3CC7Q 4M7AG 2LJ0A 1W2BA 5GAN6 3I5RA 3LWIA 1CSKA 3VRZA 2DL5A 1MV3A 1UJ0A 5KCOA 2L2PA 3GP8A 5GAN8 2LNVA 2DEUA 2QGFB 4F7UA 1Q81U 2LCLA 3QHSA 3NMZC 2XI9A 4MZMA 3EG3A 1SSFA 3CCUQ 1FMVA 3BDLA 2HCKA 3AHUA 4FYXB 1M1GA 5DM7R 4J9BA 1GBRA 3CPWS 3JB9D 3I56T 3QDFA 3JB9G 1ZQ1A 1R0CB 1YIJA 1UEBA 3DLMA 2YSQA 1VQKT 2QK0A 1YP5A 2FZCB 4M75F 1YCYA 1QCOA 1D0ZA 2FB7A 4M78G 2KRNA 4J9GA 4BI3A 1X6GA 1RI9A 1D1BA 1OYXA 1TS9A 4L59A 2NUZA 1YJWA 5J39A 3EFSA 1VQPQ 5C0MA 1D0XA 1N8RC 3OYGA 4XU0A 5KYUA 4J83A 4ZN1A 3FLGA 1WLPB 2RO0A 5I2SA 2DX1A 1G3TA 2EFIA 2GQIA 4O5VA 4AFZC 2E6ZA 1KD1U 1OX8A 2CP7A 1KFZA 1MMGA 4RUGA 4C0DB 4M7AA 2GFAA 4OGEA 5LL6S 3RR6A 3I56Q 3LW5E 4F17A 2CZ7B 2O2OA 2FYKA 3VS7A 3QXEB 2LMJA 3NGPA 3FRNA 4RTTA 1YI2T 1HSQA 3JCMP 4E7SA 2P0PA 2JVVA 3QDRB 1BU1A 3QYGB 2PVDB 3TSZA 2KE9A 3EG0A 2Z0WA 1LCKA 3META 1PM3A 4J6XA 4DEXA 1AHJB 1OU8A 4EMKB 1X27A 1KC8U 4AT1B 2RM4A 1ACMB 2MMPA 3VJPA 1KQ2A 1AWOA 2JN0A 4A4HA 3G7ZA 2ESWA 1DJ7B 4PJOA 3M0UA 2K79A 4ZGEB 4IURA 5KH6A 4ORZA 4BACA 5IXBA 4BDYA 3M53A 1SSHA 4PJOE 1AVZC 3H0FA 1NJIU 4F04B 2GF7A 1Q86U 2FPDA 2VWFA 5CIUA 4PJMA 2HL5C 1ZA1B 4HXJA 2RPNA 4HT9A 4X34A 5GANj 1NM7A 2Y90A 4XQ3A 1HYOA 3G71A 4CC4B 2F69A 3EFOB 3A8LB 1M90C 2CP6A 3OYFA 5GANh 2V8JA 5J26A 4C8QC 4E7LA 3CCJT 4IUVA 2RHUA 1WDXA 3CD6A 4LNPA 3CC7A 2MPXC 3CMET 4KUIA 2K5FA 2EVRA 4JLGA 2XICA 3QZ5B 4KH1B 2KBTA 2E70A 1Q7YR 1NEGA 2PUOB 3CCLT 2KGTA 1N8RU 1X75C 5GANd 2LTOA 4C8QF 2DIGA 2XG8D 5KYWA 1ZSZA 4M77B 2OTJT 3OY9A 4AFQC 1BCMA 1NZ9A 1K9MR 3HSBA 2DJQA 1WHKA 2FPEA 1NPPA 3G4SQ 1T0HA 2CREA 2CSIA 1AWJA 4C8QD 2ZCFB 4L6V5 5KYYB 1EZZB 4HVVA 4ZGDB 2PQWA 2DPPB 4F7UE 3OS1A 4C92E 2NLUA 4VUBA 5FU6C 3CCST 3OQ5A 2QEXA 1WA7A 3OYBA 1BYMA 2D8HA 1M5Q1 1R0BG 2HDAA 3EAEA 4JJNK 1KQSS 1BI2A 3VU3C 5AYFA 1KJWA 2M9UA 3M57A 3I5SA 1WQ7A 1VQ8Q 2M1HA 5FROA 4B9XA 1IZ6A 3E9FA 3D7SB 3BDUA 4M7AD 3CCVA 1RACB 1BCOA 4PL6A 5CKDA 1PKTA 4C8QA 3SWNA 1TU0B 1VIEA 4HT8A 1TUDA 3VYHB 3CC2T 4LDXA 1PRLC 1VYVA 1M2VA 3EG9A 1VQ7Q 3I56A 1WGSA 3QSUA 4C0DC 1U1TA 2QASA 4JLIA 3PIOA 1N9SA 2QXFA 1VQMQ 3OS2A 3E1SA 3JCMJ 1WNLA 2DZCA 3OYCA 3RDVA 5I21A 3OMGA 2NUTA 2HL3A 5CKHA 1H3HA 1NYFA 1JB0E 1K73R 2R5MA 3M59A 1YITQ 1K9MU 2VXEA 1JBMA 3KFVA 1FWZA 4OMLA 5LJ5j 1TSFA 1Y57A 2X4JA 5GAN4 2E65A 2FRYA 3CCJA 1QVFP 2KT8A 2XKOC 1JU5C 1RAFB 1YJ9T 1WHJA 1QKXA 3CBOA 2OTJQ 4B6MA 4BY6B 2RQVA 2QAZA 4E7ZA 1NE8A 5IN1A 5CR2A 3EGXB 2RD1A 4PNOA 4JS4A 1VQLA 1WX6A 3FDRA 3UDCA 1EX4A 5EC7A 1IRXA 4ZN3A 4LUDA 3PTAA 2WSCE 3PIPA 2EWNA 3A8MB 5I2MA 4O6JA 3H9NA 3OW2S 3I35A 3CCEA 1AWWA 2QG9B 2KRMA 4DBQA 2VVKA 5CQYA 5A0DA 4ZTJA 4K11A 2XIDA 4BY6C 2LP5A 1RI0A 2O9SA 4II1A 2HBWA 2CT4A 4BI8B 2KQWA 1WIEA 4GLKA 4M78E 2KRSA 2IG0A 3A98A 3JB9I 4NL3A 5KE3A 3OA6A 3OYYA 1IGUA 3JCMQ 5GJWB 3E9GA 5GAMd 1BI0A 2BE7D 1NBEB 3INZA 2RH2A 4PJOD 1ZA2B 4OMNA 4C0GA 4DBHA 1YWOA 2E12A 4FIBA 2QI2A 4DBRA 4QQ6A 1Q82R 2M02A 2MYSA 1VQ4A 1YCSB 2C0IA 4IIOA 2KXCA 5CKBA 5DLOA 1JO8A 4DBFA 1C0MA 2XU8A 2JOYA 2J6KA 4RG8A 1KD1R 4F7UF 2A7YA 3A5ZB 1BIAA 2AK5A 1NLPC 4LDVA 2KI7A 1TH7A 1G3WA 2EJ9A 2YLBA 2CH4A 3HRTA 2BUDA 3I9QA 2HQXA 1VQPA 2CP3A 4PFPA 2GGRA 1M27C 2E1HA 2MI6A 3H0IA 3JRZA 1QQJA 4N0AC 1U3OA 2B86A 3WVDB 5IHIA 3ZL7C 4MZPA 2F5TX 4PJOG 3L2VA 3RIRA 2J06A 4C92A 4ELYC 5LJ3j 2GNCA 4LDYA 4FSSA 1Q7YC 2D6FA 3SWNC 3C0CA 4PJOC 4QVZA 1VYUA 1OX9A 7AT1B 2BE9B 1FMWA 3NTHA 3H6ZA 4PJOF 3UA7A 1Q86C 2K9GA 2EKOA 2JTEA 2ROLA 5KYXB 2DD5A 4JRQA 1QVFS 1OZ3A 1VQOA 4M77C 2OI3A 1QP3A 3E2UA 1LVKA 1TWBA 3NFCA 2F2WA 2DO3A 3S3MA 1VQKQ 4IUPA 5KYNA 1YIJT 4OB2B 4C0ZA 5J3BA 2E41A 4DQ2A 4J9EA 4YTLA 4P5NA 5GAMf 4N4IA 1OZ2A 2JT4A 3CCEQ 3GIBA 1EIFA 4CC3A 5HKCA 2JJ9A 8ATCB 2RQUA 3VUBA 4M7AF 1PD0A 4C8QB 3VS1A 1H92A 3V7CA 3OYHA 2CDTA 4FT4A 2DRMA 2LVMA 2LT1A 1VQLQ 1VQ6T 3LWHA 1QLYA 1K73U 3TREA 2RHYA 1WXBA 3I55Q 2COWA 3O8VA 4N0AA 4A4EA 2HEQA 5KCHA 4DOWA 2L3RA 2RNAA 4PJOB 1I81A 1QVGA 2V8IA 2K3YA 4E47A 2EQKA 1Z9QA 2JMAA 5HK0A 4EMKA 2DBKA 1NJIR 1XQHA 1Q95G 4OP0A 1CKAA 3CXCP 1M8MA 3CC4A 5GMKe 2GTJA 3C94A 3V8LA 3GLXA 1R8OB 2DD4A 2X35A 3CCVT 3SD4A 2OX7A 1TOVA 1FXXA 3MO8A 1HD3A 2A08A 4XTUA 3V8JA 2WSEE 2LCCA 3CD6Q 1M3BA 5CKEA 5LJ3g 4WCIA 4FYYB 1VQ4Q 2AHJB 2OTLQ 3MP6A 2QEXT 3EHRA 1YHQT 3SB2A 3M58A 1JQQA 1UGRB 1ZLMA 1KD1C 1NG2A 1W70A 5KYUB 4IKFA 1K4US 3QG1A 1TXQA 2YRDA 2OJ2A 3P8BB 3CC4T 4DOVA 3CCRA 2BZ8A 1ABQA 1YI2A 4NL2A 1GCQC 1M90U 2EPDA 2C0OA 3MJXA 3GOXA 1WXTA 1XNIA 4OVAA 1BIBA 4GY5A 5FRMA 3EG1A 2JMCA 4OMQA 1UGPB 4Y28E 2ZPEB 2SRCA 3M54A 1VOMA 1IREB 1Y71A 1SRMA 4NOYA 3OYAA 3GNGA 1VQ9T 1SF9A 2DL3A 5GMKh 3ER0A 1OQKA 4Y91A 2RQWA 2K3XA 2G3RA 2QA4T 5GMKi 2OTLT 3JCMc 1VQ4T 2H3JA 1RAEB 3OYEA 1O9SA 5D6XA 2JS0A 2NUTB 3M0RA 1WFWA 3L2RA 2PUKB 4ME7A 3V7SA 2W10A 2EYZA 2HZYA 4HCBA 4RCBA 1VQNQ 4C92B 2V1RA 2PU9B 3U23A 3CC2Q 4M78B 2K57A 3RMSA 1OI1A 1N5ZA 1MMAA 1VUBA 2EAYA 1ZUUA 2IVWA 1W1FA 3BW1A 5GANf 1JJ2P 3CMEA 2E10A 3QWXX 1JRIA 1VQ8T 1M9SA 3LH5A 1ZX6A 3PMIA 3LGLA 3SHWA 3J81E 5GAOq 1VQKA 3L42A 3VS2A 3X25B 2KAFA 1N8RR 3OYNA 3PT9A 4N4GA 2K4YA 1V1CA 4KULA 1GXIE 2P84A 4C8QG 4X9DA 5CK9A 4M7AC 3OYMA 2FRWA 1CKBA 2CUBA 3VV0A 1VQLT 1VQ6Q 1XJWB 2KSSA 2QYZA 3HFOA 4C0FA 5GJVB 1KC8R 1KIKA 1OOTA 1QVPA 1K0XA 3VRYA 3QYHB 3JB9H 1Y96A 4PLIA 1SHGA 4LD6A 1AEYA 4RTYA 5GAMe 1G3YA 2QTVA 3URGA 3RMQA 4A4GA 4QVDA 2DZ9A 1ZSZB 1UECA 1F1BB 2KEAA 5CQXA 3GBQA 5ECAA 2CYZB 1XOVA 1VQ7A 3FEOA 2F2VA 4C92F 5HK3A 1HXDA 5KE2A 1YIJQ 4PFOA 2DETA 1H8KA 5FW9A 1H641 4ZGJB 5DY9A 5I11A 3PE0A 3S3NA 3PMTA 2DBMA 3MEAA 2RJEA 3J80E 3A8HB 1KQSP 1SRLA 4AG1C 1MV0B 4KT0E 4BE1A 3FIFA 3R6OA 3A1PA 2X4YA 2CP5A 1QP2A 1QMCA 2EBPA 2YWWA 1Q81C 1UG1A 2VC8A 3PGGA 1BBZA 2W0ZA 2LT4A 1M2VB 2LQKA 3QWYA 2HD0A 2K2MA 4E7IA 2ROTA 3WVEB 2J6OA 2AKKA 1Y0MA 2EQJA 3OBWA 2CKKA 3Q1JA 1RLPC 4A53A 3CMAQ 2BIVA 4LN2A 3M0SA 5GAMh 1KC8C 3BY7A 2GFUA 2RHXA 4AG2C 5IAYA 1VQ5Q 3AT1B 1FMKA 3THKA 1I5OB 4FU6A 1I1JA 3CCQA 2CZ0B 2RI3A 1U5SA 3X28B 4M77G 1RAIB 4ZNXA 4JJCA 4Z02A 4PKCC 5KYYA 1M4ZA 5LJ5e 4M78A 4DA4A 5LJ5d 4M77F 1M2OA 1X6BA 2DILA 5CKFA 2BTTA 2VXFA 2DVJA 2KY9A 4F7UG 3VS4A 1VQNT 1S72Q 3OS0A 5FU7B 3JAME 1QWEA 4J6WA 1T3SA 4E6RA 4CC2A 3G6EQ 4M4ZA 3M0TA 5D7UA 4OB1B 4M78F 1QVGS 1PG5B 3DLLA 2D0NA 1EFNA 4M75G 2AZVA 3V8KA 1LPLA 4X1VA 3OW2P 2HKNA 2XHCA 3RKWA 2CP0A 5IHKA 3P8HA 2J7IA 4M7DD 2DNUA 2FZKB 4X9CA 2LJ3A 1AZEA 1RADB 3EG2A 2HQEA 3S3OA 4M7DF 1VQPT 1FYNA 5DLQE 3GF5A 1I07A 1JXMA 2XD0A 4J8OA 1SHFA 1WQWA 2E3HA 2DXUA 2COZA 1WPYA 1SG5A 1JEGA 4M78D 2CZ1B 3G6EA 1KHCA 2AT1B 3CCMQ 2VV5A 2L89A 2KK4A 1OULA 5A2QE 2MWOA 2L3QA 4C5GA 2DA9A 5GAN3 3KBGA 4M77A 3CC4Q 4HKEA 3J7AF 1KQSA 2L8DA 2EYQA 4KGXB 4XK8E 5GANe 2X4WA 3CCUT 5IHNA 1YJWT 1V29B 2QEXQ 2CT3A 1AD5A 4LUEA 4C92D 4M75E 1N9RA 2KDSA 2I2LA 1N6AA 2DRKA 3E19A 4QQDA 1C6VX 1ZSZC 2IIMA 2O88A 2HNIA 2RQTA 3QJYA 4CI0C 2RJFA 1PHTA 1T0JA 2JZ2A 1VA7A 4RTVA 4OB3B 1T3LA 3CC7T 1OEBA 2RQRA 2V1QA 2RK2A 2JS2A 1GFDA 4QVCA 4Y92A 2ABLA 1W2BP 4KGZB 2JXBA 1WHHA 1AOJA 3PVLA 3JCMV 2EQMA 3M0PA 1G83A 4RCCA 2O01E 5GAN7 4F16A 4RTZA 1O75A 1X69A 5M9OA 1VIFA 4IUTA 1MNEA 4J5YA 4M7DE 1GCPA 4UC4A 2NUPB 1QCNA 5LJ3e 4XTXA 4OMMA 3VYGA 3MEWA 2RHZA 4R56A 4F14A 2P0KA 4BE2A 2GTOA 3SDZA 4EPCA 4PK4A 2K7AA 3UWNA 1B34A 1R77A 2L3SA 4J7IA 3HL8A 3JSCA 3CCLA 3CMAA 4KUDK 2MAMA 3NPFA 3QJ6A 5LJ3f 3OW2A 2M0YA 3RERA 3CCQQ 4A54A 4V2SA 3HKSA 1ZHIA 4OB0B 2ATCB 3NHNA 2YRCA 1IHVA 1TTHB 3CCMT 1MNDA 2LQNA 1IGQA 1RL2A 5GAMg 5FRNA 2P4RA 4FW2A 5GAN2 1VQMA 3CCQT 1OPLA 2NUPA 4GBQA 1N27A 4QW2A 3L2ZA 2FVUA 5C6SA 1K1ZA 4F7UB 1RAAB 4EMHA 2ZPGB 3LX7A 4PFZA 4GLMA 2DF6A 1PSEA 4FCYA 3PVQA 1KG1A 1UDLA 3G6ET 2MK5A 2ENMA 5L8RE 3L2QA 4JRKA 3KUFA 1MMDA 2SEMA 1RABB 3OYKA 4JZ4A 1G5VA 2RB6A 1I5LA 3M56A 2DTOA 2K2VA 2NYSA 3VS6A 5GAOm 1Q82U 3CXCS 2L3PA 1E7OA 1GRIA 3EGDB 2OAUA 5CCAA 1YWPA 4WTOB 2EW3A 4KGVB 3UA6A 2B8AA 3HRSA 1M1KU 2ZPHB 3X20B 1X2QA 8AT1B 1NLOC 4AMCA 3MCAB 1AT1B 2YRVA 3WXMB 2C0TA 4JRIA 1PRMC 1YJNT 1NYGA 2YUQA 2OAWA 1Y07A 4HVUA 1K73C 3M9QA 2V8KA 1NEBA 4XTYA 1YBYA 3GPLA 2K5LA 1PD1A 3MKDA 1V76A 3SWNB 1VYTA 2LQWA 4C5IA 3OS5A 2EJFA 1ABOA 3VS3A 1W2BS 2MOXA 4KH0B 3RUXA 2PZ1A 4FL6A 3VS5A 2ZPIB 2D1XA 2X51A 3T9NA 1ZUYA 1XTDA 2M51A 1U06A 2JUFA 3DKMA 3JCMW 5LJ5f 1YJNA 4J9HA 4BB7A 2DMOA 2PVOB 4PJLA 4LDWA 3LGFA 5GAOp 4RMOA 3G71Q 1UUEA 2D9TA 3FB9A 1VQOQ 1AZGB 5GMKj 3JV3A 3MP1A 3P8DA 2WACA 4E2FB 4A4FA 2F5KA 2YLCA 4TVRA 2MF2A 1VQOT 3R6NA 4XTWA 3G71T 3M4GA 3H0HA 3L1AA 1Q7YU 1YHQA 4J7FA 4BI4A 5CAIA 3JCMb 2XK0A 3ZBDA 5IH2A 2MIOA 4RTXA 5GMKl 2IPOB 2DL7A 2EYWA 1K8AR 1SKUB 1WHGA 3JCMf 1KQ1A 1YJ9Q 3M5AA 4XTVA 2QQ9A 2CS7A 1X2KA 5A0GA 1D3BA 4XU1A 4Z88A 2DE0X 4D6WA 2DERA 1BKBA 1ARKA 1FX7A 2DIQA 5D6YA 1RAGB 3A8GB 1LJOA 4CC7A 2DKGA 1P92A 3EGDA 2CSQA 4FT2A 4Z89A 2CH4W 2QDLA 3OYDA 5I22A 3N5BB 3CXCA 4M78C 2HBPA 4HVWA 2QQSA 1PC0A 2M0OA 3G1JA 2H8HA 1K8AU 4Q5WA 5EG2A 2RJCA 2DL4A 4RTWA 3CMAT 4IIMA 1UFFA 3UT1A 4HCCA 5FU6B 1ZBXA 2YUPA 4ATOA 3X24B 2E3IA 2ED0A 3CQTA 1VQNA 1B7TA 1WHLA 5IT9E 2AIRB 2LX7A 2DVEA 3CCMA 1TUGB 2EQIA 5GAOr 1M1KR 2LRQA 4M75D 2O9VA 1UE9A 1VQ9Q 4J6YA 1GCQA 2V26A 2VUBA 3UATA 3GNFB 2E6NA 4JS5A 1WJQA 1WI7A 2HSPA 4N4HA 1G3SA 3QIIA 1QWFA 2ZGWA 2F2XA
chains in the Genus database with same CATH topology
1YWOA 1E6GA 1X6BA 2DILA 3EGUA 4Z8AA 3REBB 1OPKA 2BTTA 2DVJA 2E5KA 2RN8A 4JJDA 1SPKA 1IO6A 1YCSB 2C0IA 2FPFA 3M0QA 3VS4A 4IIOA 2LCSA 1QWEA 2KXCA 1T3SA 1JO8A 4E6RA 1GFCA 4CC2A 4M4ZA 2FO0A 2J6KA 3M0TA 5L23A 2D0NA 4OMPA 1EFNA 2AZVA 2AK5A 3O5ZA 4QT7A 4X1VA 5HCKA 1NLPC 4J9DA 4A63B 2K6DA 1HJDA 5IHKA 2J7IA 2DNUA 2CH4A 2LJ3A 3I9QA 1AZEA 3EG2A 1B3QA 1FYNA 1I07A 1JXMA 2GGRA 1M27C 3H0IA 2LJ1A 1SHFA 2LZ6B 1PKSA 1JEGA 1U3OA 2X3WD 1B07A 3REAB 4J9CA 1KSWA 2B86A 4EIKA 5IHIA 3ZL7C 2LJ0A 2YUNA 3I5RA 1CSKA 3VRZA 1QCFA 2DL5A 1MV3A 1UJ0A 2L2PA 2A36A 2J06A 2L3QA 2DA9A 2FEIA 2GNCA 4FSSA 3C0CA 1VYUA 2FG0A 3UA7A 2G6FX 3NMZC 2JM8A 1M30A 3EG3A 5IHNA 4DEYA 2K9GA 2CT3A 2JTEA 1AD5A 2ROLA 4LUEA 1GL5A 2HCKA 2RF0A 2OI3A 2DRKA 4J9BA 1GBRA 2A37A 2IIMA 2O88A 2F2WA 2RQTA 4RTUA 2YSQA 1QKWA 2KT1A 2KR3A 1PHTA 1PNJA 1T0JA 1VA7A 1M3AA 4J9EA 2EKHA 4RTVA 1YP5A 3FJ5A 1T3LA 1OEBA 2RQRA 2V1QA 1ZSGA 2JS2A 2JT4A 2KRNA 4J9GA 1X6GA 1GFDA 1RI9A 4CC3A 1TUCA 4Y92A 2NUZA 2ABLA 2JXBA 1AOJA 2RQUA 3PVLA 4HCKA 3VS1A 3M0PA 1H92A 1G83A 4R0KA 4F16A 2CDTA 4RTZA 2DRMA 1X69A 2KNBB 1WLPB 1PWTA 2DX1A 2GQIA 1K76A 1TG0A 4JZ3A 1GCPA 1QLYA 4AFZC 4D8DA 1RLQC 2CUDA 1WXBA 1KFZA 4OMMA 2HEQA 4RUGA 4F14A 2PTKA 2RNAA 2GTOA 4JPBW 4F17A 2K7AA 1WXUA 2O2OA 3VS7A 2LMJA 3NGPA 4RTTA 1Z9QA 1HSQA 2JMAA 2YUOA 3TVTA 2YT6A 2L3SA 2EGEA 2DBKA 2RMOA 1BU1A 3TSZA 2KE9A 1SEMA 3EG0A 1CKAA 1M8MA 3NPFA 3RBBB 1LCKA 2J6FA 2M0YA 2GTJA 2XMFA 4DEXA 1X27A 3NHNA 2EGCA 1AWOA 5IXFA 3VS0A 2LQNA 1HD3A 2ESWA 2A08A 1S1NA 2P4RA 3M0UA 1MUZA 1M3CA 2K79A 1I0CA 2J05A 3SEMA 1M3BA 1OPLA 4WCIA 4GBQA 4ORZA 5IXBA 3EHRA 1SSHA 1JQQA 1K1ZA 4AFUC 1ZLMA 1AVZC 3H0FA 1NG2A 1UHCA 1W70A 2FPDA 2VWFA 1K4US 2KYBA 2OJ2A 3EHQA 4GLMA 2DF6A 4J9FA 3PVQA 3UF4A 1UDLA 2EYXA 4HXJA 2RPNA 2BZ8A 2ENMA 1NM7A 1ABQA 1GCQC 2EPDA 2AZSA 2C0OA 2SEMA 4JZ4A 1WXTA 4CC4B 2L0AA 3VS6A 3IQLA 1UJYA 3EG1A 2L3PA 2JMCA 1E7OA 1GRIA 4OMQA 2SRCA 1WDXA 1YWPA 4LNPA 2EW3A 1UHFA 2JM9A 1SRMA 1J3TA 2KROA 3UA6A 5FWCA 2EVRA 4D8KA 2DL3A 1ZUKA 4AFSC 1X2QA 2RQWA 2KBTA 2AKLA 1NEGA 1NLOC 2KGTA 1UTIA 2JS0A 3M0RA 1WFWA 4JJBA 2C0TA 2O31A 1PRMC 1NYGA 2YUQA 2OAWA 4J9IA 2W10A 2EYZA 1RUWA 4AFQC 2DJQA 2V1RA 4HVUA 3U23A 2FPEA 1T0HA 2CREA 1NEBA 2CSIA 1Z9ZA 2EGAA 3RNJA 1AWJA 4KRTA 1N5ZA 2EYYA 1K9AA 1ZUUA 1W1FA 2BZYA 4HVVA 1VYTA 2MCNA 1E6HA 2LQWA 1K0SA 2VKNA 3QWXX 1UGVA 1ABOA 1X43A 3VS3A 2MOXA 1WYXA 3LH5A 2PZ1A 2KXDA 1ZX6A 3VS5A 2NWMA 2D1XA 1WA7A 2D8HA 3SHWA 1ZUYA 2M51A 1U06A 3VS2A 2HDAA 4J9HA 2DMOA 2D8JA 1AWXA 1KJWA 3I5SA 1V1CA 1UUEA 1ZBJA 1YNZA 1AZGB 2FRWA 3JV3A 1CKBA 2CUBA 1OV3A 2DM1A 1PKTA 2JW4A 2KYMA 1G2BA 1TUDA 5GJVB 1GBQA 3R6NA 1PRLC 1KIKA 1OOTA 1VYVA 1K0XA 3VRYA 3H0HA 1SHGA 1AEYA 4RTYA 5FWBA 3H41A 1A0NB 5IH2A 2MIOA 4RTXA 2DL7A 2EYWA 1UECA 2KEAA 3GBQA 5ECAA 2ECZA 1XOVA 2F2VA 2X3XD 1H3HA 1NYFA 1X2KA 2BZXA 4Z88A 2DE0X 1H8KA 3KFVA 5FW9A 4OMLA 5I11A 3PE0A 2K3BA 1ARKA 2DBMA 1Y57A 1SRLA 4AG1C 2FRYA 1MV0B 2DL8A 2KT8A 1JU5C 1QKXA 4CC7A 1W6XA 2CSQA 2RQVA 2LNHB 4Z89A 2CH4W 2QDLA 1BK2A 2EBPA 2GBQA 5I22A 1YN8A 1UG1A 4ESRA 4HVWA 1BBZA 1WX6A 2W0ZA 3QWYA 5EC7A 2H8HA 1BB9A 2K2MA 4LUDA 2ROTA 2DYBA 2DL4A 2J6OA 2AKKA 1JXOA 1Y0MA 4RTWA 2ED1A 2A28A 4LE9A 1RLPC 4IIMA 2I0NA 1UFFA 3I35A 1AWWA 4LN2A 3M0SA 2KRMA 2YUPA 2VVKA 2ED0A 3CQTA 4AG2C 3ULRB 4K11A 4OMOA 2LP5A 2O9SA 1FMKA 2HBWA 3THKA 2CT4A 2LX7A 1I1JA 1WIEA 2KRSA 2EQIA 3TSWA 2DLPA 3A98A 1U5SA 2YDLA 2O9VA 4ZNXA 1UE9A 4JJCA 2PNIA 5GJWB 1GCQA 3UATA 1WI7A 2HSPA 4OMNA 1QWFA 2F2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWO A;  1E6G A;  1X6B A;  2DIL A;  3EGU A;  4Z8A A;  3REB B;  1OPK A;  2BTT A;  2DVJ A;  2E5K A;  2RN8 A;  4JJD A;  1SPK A;  1IO6 A;  1YCS B;  2C0I A;  2FPF A;  3M0Q A;  3VS4 A;  4IIO A;  2LCS A;  1QWE A;  2KXC A;  1T3S A;  1JO8 A;  4E6R A;  1GFC A;  4CC2 A;  4M4Z A;  2FO0 A;  2J6K A;  3M0T A;  5L23 A;  2D0N A;  4OMP A;  1EFN A;  2AZV A;  2AK5 A;  3O5Z A;  4QT7 A;  4X1V A;  5HCK A;  1NLP C;  4J9D A;  4A63 B;  2K6D A;  1HJD A;  5IHK A;  2J7I A;  2DNU A;  2CH4 A;  2LJ3 A;  3I9Q A;  1AZE A;  3EG2 A;  1B3Q A;  1FYN A;  1I07 A;  1JXM A;  2GGR A;  1M27 C;  3H0I A;  2LJ1 A;  1SHF A;  2LZ6 B;  1PKS A;  1JEG A;  1U3O A;  2X3W D;  1B07 A;  3REA B;  4J9C A;  1KSW A;  2B86 A;  4EIK A;  5IHI A;  3ZL7 C;  2LJ0 A;  2YUN A;  3I5R A;  1CSK A;  3VRZ A;  1QCF A;  2DL5 A;  1MV3 A;  1UJ0 A;  2L2P A;  2A36 A;  2J06 A;  2L3Q A;  2DA9 A;  2FEI A;  2GNC A;  4FSS A;  3C0C A;  1VYU A;  2FG0 A;  3UA7 A;  2G6F X;  3NMZ C;  2JM8 A;  1M30 A;  3EG3 A;  5IHN A;  4DEY A;  2K9G A;  2CT3 A;  2JTE A;  1AD5 A;  2ROL A;  4LUE A;  1GL5 A;  2HCK A;  2RF0 A;  2OI3 A;  2DRK A;  4J9B A;  1GBR A;  2A37 A;  2IIM A;  2O88 A;  2F2W A;  2RQT A;  4RTU A;  2YSQ A;  1QKW A;  2KT1 A;  2KR3 A;  1PHT A;  1PNJ A;  1T0J A;  1VA7 A;  1M3A A;  4J9E A;  2EKH A;  4RTV A;  1YP5 A;  3FJ5 A;  1T3L A;  1OEB A;  2RQR A;  2V1Q A;  1ZSG A;  2JS2 A;  2JT4 A;  2KRN A;  4J9G A;  1X6G A;  1GFD A;  1RI9 A;  4CC3 A;  1TUC A;  4Y92 A;  2NUZ A;  2ABL A;  2JXB A;  1AOJ A;  2RQU A;  3PVL A;  4HCK A;  3VS1 A;  3M0P A;  1H92 A;  1G83 A;  4R0K A;  4F16 A;  2CDT A;  4RTZ A;  2DRM A;  1X69 A;  2KNB B;  1WLP B;  1PWT A;  2DX1 A;  2GQI A;  1K76 A;  1TG0 A;  4JZ3 A;  1GCP A;  1QLY A;  4AFZ C;  4D8D A;  1RLQ C;  2CUD A;  1WXB A;  1KFZ A;  4OMM A;  2HEQ A;  4RUG A;  4F14 A;  2PTK A;  2RNA A;  2GTO A;  4JPB W;  4F17 A;  2K7A A;  1WXU A;  2O2O A;  3VS7 A;  2LMJ A;  3NGP A;  4RTT A;  1Z9Q A;  1HSQ A;  2JMA A;  2YUO A;  3TVT A;  2YT6 A;  2L3S A;  2EGE A;  2DBK A;  2RMO A;  1BU1 A;  3TSZ A;  2KE9 A;  1SEM A;  3EG0 A;  1CKA A;  1M8M A;  3NPF A;  3RBB B;  1LCK A;  2J6F A;  2M0Y A;  2GTJ A;  2XMF A;  4DEX A;  1X27 A;  3NHN A;  2EGC A;  1AWO A;  5IXF A;  3VS0 A;  2LQN A;  1HD3 A;  2ESW A;  2A08 A;  1S1N A;  2P4R A;  3M0U A;  1MUZ A;  1M3C A;  2K79 A;  1I0C A;  2J05 A;  3SEM A;  1M3B A;  1OPL A;  4WCI A;  4GBQ A;  4ORZ A;  5IXB A;  3EHR A;  1SSH A;  1JQQ A;  1K1Z A;  4AFU C;  1ZLM A;  1AVZ C;  3H0F A;  1NG2 A;  1UHC A;  1W70 A;  2FPD A;  2VWF A;  1K4U S;  2KYB A;  2OJ2 A;  3EHQ A;  4GLM A;  2DF6 A;  4J9F A;  3PVQ A;  3UF4 A;  1UDL A;  2EYX A;  4HXJ A;  2RPN A;  2BZ8 A;  2ENM A;  1NM7 A;  1ABQ A;  1GCQ C;  2EPD A;  2AZS A;  2C0O A;  2SEM A;  4JZ4 A;  1WXT A;  4CC4 B;  2L0A A;  3VS6 A;  3IQL A;  1UJY A;  3EG1 A;  2L3P A;  2JMC A;  1E7O A;  1GRI A;  4OMQ A;  2SRC A;  1WDX A;  1YWP A;  4LNP A;  2EW3 A;  1UHF A;  2JM9 A;  1SRM A;  1J3T A;  2KRO A;  3UA6 A;  5FWC A;  2EVR A;  4D8K A;  2DL3 A;  1ZUK A;  4AFS C;  1X2Q A;  2RQW A;  2KBT A;  2AKL A;  1NEG A;  1NLO C;  2KGT A;  1UTI A;  2JS0 A;  3M0R A;  1WFW A;  4JJB A;  2C0T A;  2O31 A;  1PRM C;  1NYG A;  2YUQ A;  2OAW A;  4J9I A;  2W10 A;  2EYZ A;  1RUW A;  4AFQ C;  2DJQ A;  2V1R A;  4HVU A;  3U23 A;  2FPE A;  1T0H A;  2CRE A;  1NEB A;  2CSI A;  1Z9Z A;  2EGA A;  3RNJ A;  1AWJ A;  4KRT A;  1N5Z A;  2EYY A;  1K9A A;  1ZUU A;  1W1F A;  2BZY A;  4HVV A;  1VYT A;  2MCN A;  1E6H A;  2LQW A;  1K0S A;  2VKN A;  3QWX X;  1UGV A;  1ABO A;  1X43 A;  3VS3 A;  2MOX A;  1WYX A;  3LH5 A;  2PZ1 A;  2KXD A;  1ZX6 A;  3VS5 A;  2NWM A;  2D1X A;  1WA7 A;  2D8H A;  3SHW A;  1ZUY A;  2M51 A;  1U06 A;  3VS2 A;  2HDA A;  4J9H A;  2DMO A;  2D8J A;  1AWX A;  1KJW A;  3I5S A;  1V1C A;  1UUE A;  1ZBJ A;  1YNZ A;  1AZG B;  2FRW A;  3JV3 A;  1CKB A;  2CUB A;  1OV3 A;  2DM1 A;  1PKT A;  2JW4 A;  2KYM A;  1G2B A;  1TUD A;  5GJV B;  1GBQ A;  3R6N A;  1PRL C;  1KIK A;  1OOT A;  1VYV A;  1K0X A;  3VRY A;  3H0H A;  1SHG A;  1AEY A;  4RTY A;  5FWB A;  3H41 A;  1A0N B;  5IH2 A;  2MIO A;  4RTX A;  2DL7 A;  2EYW A;  1UEC A;  2KEA A;  3GBQ A;  5ECA A;  2ECZ A;  1XOV A;  2F2V A;  2X3X D;  1H3H A;  1NYF A;  1X2K A;  2BZX A;  4Z88 A;  2DE0 X;  1H8K A;  3KFV A;  5FW9 A;  4OML A;  5I11 A;  3PE0 A;  2K3B A;  1ARK A;  2DBM A;  1Y57 A;  1SRL A;  4AG1 C;  2FRY A;  1MV0 B;  2DL8 A;  2KT8 A;  1JU5 C;  1QKX A;  4CC7 A;  1W6X A;  2CSQ A;  2RQV A;  2LNH B;  4Z89 A;  2CH4 W;  2QDL A;  1BK2 A;  2EBP A;  2GBQ A;  5I22 A;  1YN8 A;  1UG1 A;  4ESR A;  4HVW A;  1BBZ A;  1WX6 A;  2W0Z A;  3QWY A;  5EC7 A;  2H8H A;  1BB9 A;  2K2M A;  4LUD A;  2ROT A;  2DYB A;  2DL4 A;  2J6O A;  2AKK A;  1JXO A;  1Y0M A;  4RTW A;  2ED1 A;  2A28 A;  4LE9 A;  1RLP C;  4IIM A;  2I0N A;  1UFF A;  3I35 A;  1AWW A;  4LN2 A;  3M0S A;  2KRM A;  2YUP A;  2VVK A;  2ED0 A;  3CQT A;  4AG2 C;  3ULR B;  4K11 A;  4OMO A;  2LP5 A;  2O9S A;  1FMK A;  2HBW A;  3THK A;  2CT4 A;  2LX7 A;  1I1J A;  1WIE A;  2KRS A;  2EQI A;  3TSW A;  2DLP A;  3A98 A;  1U5S A;  2YDL A;  2O9V A;  4ZNX A;  1UE9 A;  4JJC A;  2PNI A;  5GJW B;  1GCQ A;  3UAT A;  1WI7 A;  2HSP A;  4OMN A;  1QWF A;  2F2X A; 
#chains in the Genus database with same CATH topology
 3PFS A;  1E6G A;  2XDD A;  2DFU A;  3RES A;  3REB B;  2DAQ A;  2E5K A;  3OSV A;  1IO6 A;  4PJJ A;  1K9M C;  2FPF A;  2EQU A;  2LCS A;  1MGQ A;  1GFC A;  2FZG B;  5L23 A;  2QQA A;  2OTJ A;  3JCM d;  5HCK A;  4A63 B;  4J9D A;  1G8X A;  2K6D A;  2R57 A;  5LJ5 h;  4JUV A;  1HJD A;  1LOJ A;  5CVI A;  1YHQ Q;  1B3Q A;  5GAM j;  1M90 R;  2LZ6 B;  3CCU A;  1PKS A;  2X3W D;  3FJP A;  2YUN A;  3L2W A;  1QCF A;  1X6O A;  3CCV Q;  3TQ7 P;  5A0L A;  2A36 A;  1PCX A;  1U1S A;  2RI5 A;  1U8R A;  2FEI A;  1YJN Q;  2LC4 A;  4LDU A;  2FG0 A;  2E4H A;  2G6F X;  4A4K A;  2JM8 A;  3M4Y A;  1M30 A;  4DEY A;  1VQ7 T;  4BUG A;  5GAN 5;  1GL5 A;  2RF0 A;  2LQ8 A;  3PNW C;  4M77 D;  2D0Q B;  5FLX E;  1QVG P;  3C4S A;  2A37 A;  1I8F A;  1YIT A;  3JCM e;  2K5I A;  1W4S A;  4RTU A;  1QKW A;  2KT1 A;  2KR3 A;  1PNJ A;  2EIF A;  5GAO n;  1M3A A;  2M16 A;  2EKH A;  4FW1 A;  3I55 T;  3FJ5 A;  1LNX A;  4C5E A;  1ZSG A;  1TUC A;  1BI1 A;  2LX9 A;  4RKU E;  3S6W A;  3OMC A;  1WJS A;  3OB9 A;  3QUI A;  3DB4 A;  2QA4 Q;  4HCK A;  1YJW Q;  3CCS Q;  4R0K A;  4QQG A;  3HRU A;  2KNB B;  4C92 C;  3QO3 A;  1PWT A;  2R5A A;  4ELZ C;  4OF1 A;  3CCE T;  1K76 A;  1TG0 A;  2QTX A;  4JZ3 A;  3A8O B;  4M7D G;  2RA2 A;  4D8D A;  5CO7 A;  1RLQ C;  2CUD A;  4CRI A;  2WSF E;  3EH2 A;  3G4S T;  2VAS A;  2Y4X A;  2RJD A;  2PTK A;  2XDB A;  9ATC B;  3QBY A;  4JPB W;  3OBY A;  4QKU A;  4RG2 A;  1WXU A;  3ZFJ A;  1QVF A;  2YUO A;  5GAO l;  3CCL Q;  2A3L A;  3HPW A;  2YT6 A;  3JCM g;  3TVT A;  1H3Z A;  4M77 E;  2EGE A;  2DTI A;  2RMO A;  2QQB A;  1RAH B;  1SEM A;  1YJ9 A;  2DXT A;  3RBB B;  3TCJ A;  3CME Q;  3LH0 A;  2J6F A;  1NPR A;  1MMN A;  4NS5 A;  2XMF A;  3CD6 T;  4MDW A;  2OTL A;  4EMG A;  1B34 B;  1WZO A;  2O4X A;  4L5G A;  2EGC A;  4XTZ A;  1VQ9 A;  2A0F B;  3ME9 A;  5IXF A;  3VS0 A;  5GMK m;  3QZ9 B;  3JCM X;  1C1A A;  1IHW A;  4E7J A;  3CBP A;  1S1N A;  4BDZ A;  1OU9 A;  1MUZ A;  1M3C A;  1Q82 C;  3CCS A;  1I0C A;  2J05 A;  3SEM A;  1Q81 R;  2ZPB B;  4XAX B;  3M55 A;  2FL7 A;  2ZPF B;  4R55 A;  5LJ3 d;  4AFU C;  2EJG A;  1UHC A;  3V7R A;  2YXY A;  2KYB A;  4PJN A;  4MDX A;  3EHQ A;  3EFO A;  3OYI A;  3C95 A;  4J9F A;  3UF4 A;  2EYX A;  4BE0 A;  5LJ5 g;  1VQ5 T;  4M7D A;  4M7D B;  5LJ3 h;  3X26 B;  1VQ8 A;  2AZS A;  2GQV A;  2HSE B;  4FM4 B;  3EGX A;  3HFN A;  2GCX A;  2L0A A;  2COY A;  3IQL A;  3NTK A;  3TEE A;  1UJY A;  2LDM A;  4MML A;  1HK9 A;  1IXD A;  1PSF A;  2XDP A;  4XU2 A;  1WHM A;  4LD9 K;  1UHF A;  2JM9 A;  5FU7 C;  1M1K C;  1J3T A;  2KRO A;  5FWC A;  1X01 A;  3HP9 A;  3G4S A;  1NJI C;  4D8K A;  1ZUK A;  4AFS C;  2HAX A;  4FSX A;  2AKL A;  1UTI A;  1YI2 Q;  2VGN A;  1K8A C;  4JJB A;  2O31 A;  2QGG A;  3MHX A;  4J9I A;  4C92 G;  1YFN A;  2X9H A;  3L2U A;  1RUW A;  3MP8 A;  6AT1 B;  3HTR A;  1Z9Z A;  2EGA A;  1Y96 B;  3RNJ A;  3EG9 B;  2CGH A;  4KRT A;  2EYY A;  1KHI A;  1K9A A;  1M8V A;  3OYL A;  3EFR A;  4KBM B;  2BZY A;  2DEQ A;  2ZZD A;  1WJR A;  2HKQ B;  1E6H A;  2MCN A;  1K0S A;  1UB4 A;  2VKN A;  3FC3 A;  1UGV A;  1X43 A;  1WYX A;  4BD3 A;  2KXD A;  2NWM A;  1UGQ B;  3SFM A;  1VQ6 A;  3CC2 A;  3BE3 A;  4M7A B;  4MZT A;  4LXC A;  2D8J A;  2H3E B;  1AWX A;  1M1F A;  3CPF A;  1ZBJ A;  1UGS B;  2P4T A;  2VGM A;  4FYW B;  1YNZ A;  1S72 T;  3I55 A;  2RHI A;  2QA4 A;  3BFM A;  4E7K A;  2VYT A;  4HCZ A;  1OV3 A;  4M75 C;  2DM1 A;  2JW4 A;  2KYM A;  3UPU A;  1YIT T;  5AT1 B;  3VKI A;  1G2B A;  1GBQ A;  1JJ2 S;  2QDY B;  1Q86 R;  4FYV B;  4B9W A;  2Y4Y A;  2E64 A;  5FWB A;  3H41 A;  1A0N B;  1JJ2 A;  3JB9 F;  3VUZ A;  5KYW B;  3OSS C;  3C12 A;  2ECZ A;  3OYJ A;  2F1L A;  3CPW A;  2X3X D;  3DB3 A;  4JRP A;  2R58 A;  1KK7 A;  2BZX A;  5KYX A;  2YHT A;  1D3B B;  5D6W A;  3HHT B;  2K3B A;  3CEY A;  5GAN g;  4OGC A;  3ASK A;  3H8Z A;  4C8Q E;  2DL8 A;  1W6X A;  2KMT A;  4ANJ A;  2DXB A;  3CPW P;  2LNH B;  1BK2 A;  2GBQ A;  2RI2 A;  1YN8 A;  4ESR A;  2HQH A;  1D09 B;  3CCR T;  4JDS A;  4EDU A;  2CZ6 B;  2DK3 A;  1BB9 A;  3RKY A;  1Y7X A;  3ZEH A;  2HMA A;  2DYB A;  4MMK A;  1JXO A;  2ED1 A;  4EMK C;  2JTM A;  2KVQ G;  4IUU A;  2A28 A;  4LE9 A;  3NTI A;  2RK1 A;  2I0N A;  1BI3 A;  3MPU B;  4M75 A;  4M7A E;  3MEV A;  3CBM A;  3ULR B;  4OMO A;  1S72 A;  2X4X A;  4WF2 A;  1D0Y A;  3TSW A;  4PLL A;  2DYI A;  2DTH A;  2JNG A;  2DLP A;  1D1A A;  2O4X B;  2L5Q A;  2YDL A;  4IUQ A;  2DJZ A;  4E7H A;  2E5Q A;  2PNI A;  3JB9 J;  3F70 A;  3QPH A;  3RKX A;  4OMF B;  2C06 A;  2ZAE A;  3EH1 A;  3CCJ Q;  3EGU A;  1QW1 A;  3KXT A;  1I4K 1;  4Z8A A;  1OPK A;  3MEU A;  2RN8 A;  2PVG B;  4JJD A;  1SPK A;  4HA8 A;  3M0Q A;  1VQ5 A;  2CP2 A;  2FO0 A;  3CCR Q;  4XU3 A;  4OMP A;  2QQR A;  4QT7 A;  3O5Z A;  2JTF A;  1VQM T;  2DXC A;  3TU4 K;  4M75 B;  2VB6 A;  1D1C A;  4ZTF A;  4M7D C;  3QKJ A;  1IB8 A;  3LLR A;  5HY6 A;  2BKD N;  4C5H A;  3JCM h;  2MWP A;  2LJ1 A;  2FHD A;  1MHN A;  1B07 A;  3LYI A;  3REA B;  4J9C A;  1KSW A;  4EIK A;  2P0Q A;  3CC7 Q;  4M7A G;  2LJ0 A;  1W2B A;  5GAN 6;  3I5R A;  3LWI A;  1CSK A;  3VRZ A;  2DL5 A;  1MV3 A;  1UJ0 A;  5KCO A;  2L2P A;  3GP8 A;  5GAN 8;  2LNV A;  2DEU A;  2QGF B;  4F7U A;  1Q81 U;  2LCL A;  3QHS A;  3NMZ C;  2XI9 A;  4MZM A;  3EG3 A;  1SSF A;  3CCU Q;  1FMV A;  3BDL A;  2HCK A;  3AHU A;  4FYX B;  1M1G A;  5DM7 R;  4J9B A;  1GBR A;  3CPW S;  3JB9 D;  3I56 T;  3QDF A;  3JB9 G;  1ZQ1 A;  1R0C B;  1YIJ A;  1UEB A;  3DLM A;  2YSQ A;  1VQK T;  2QK0 A;  1YP5 A;  2FZC B;  4M75 F;  1YCY A;  1QCO A;  1D0Z A;  2FB7 A;  4M78 G;  2KRN A;  4J9G A;  4BI3 A;  1X6G A;  1RI9 A;  1D1B A;  1OYX A;  1TS9 A;  4L59 A;  2NUZ A;  1YJW A;  5J39 A;  3EFS A;  1VQP Q;  5C0M A;  1D0X A;  1N8R C;  3OYG A;  4XU0 A;  5KYU A;  4J83 A;  4ZN1 A;  3FLG A;  1WLP B;  2RO0 A;  5I2S A;  2DX1 A;  1G3T A;  2EFI A;  2GQI A;  4O5V A;  4AFZ C;  2E6Z A;  1KD1 U;  1OX8 A;  2CP7 A;  1KFZ A;  1MMG A;  4RUG A;  4C0D B;  4M7A A;  2GFA A;  4OGE A;  5LL6 S;  3RR6 A;  3I56 Q;  3LW5 E;  4F17 A;  2CZ7 B;  2O2O A;  2FYK A;  3VS7 A;  3QXE B;  2LMJ A;  3NGP A;  3FRN A;  4RTT A;  1YI2 T;  1HSQ A;  3JCM P;  4E7S A;  2P0P A;  2JVV A;  3QDR B;  1BU1 A;  3QYG B;  2PVD B;  3TSZ A;  2KE9 A;  3EG0 A;  2Z0W A;  1LCK A;  3MET A;  1PM3 A;  4J6X A;  4DEX A;  1AHJ B;  1OU8 A;  4EMK B;  1X27 A;  1KC8 U;  4AT1 B;  2RM4 A;  1ACM B;  2MMP A;  3VJP A;  1KQ2 A;  1AWO A;  2JN0 A;  4A4H A;  3G7Z A;  2ESW A;  1DJ7 B;  4PJO A;  3M0U A;  2K79 A;  4ZGE B;  4IUR A;  5KH6 A;  4ORZ A;  4BAC A;  5IXB A;  4BDY A;  3M53 A;  1SSH A;  4PJO E;  1AVZ C;  3H0F A;  1NJI U;  4F04 B;  2GF7 A;  1Q86 U;  2FPD A;  2VWF A;  5CIU A;  4PJM A;  2HL5 C;  1ZA1 B;  4HXJ A;  2RPN A;  4HT9 A;  4X34 A;  5GAN j;  1NM7 A;  2Y90 A;  4XQ3 A;  1HYO A;  3G71 A;  4CC4 B;  2F69 A;  3EFO B;  3A8L B;  1M90 C;  2CP6 A;  3OYF A;  5GAN h;  2V8J A;  5J26 A;  4C8Q C;  4E7L A;  3CCJ T;  4IUV A;  2RHU A;  1WDX A;  3CD6 A;  4LNP A;  3CC7 A;  2MPX C;  3CME T;  4KUI A;  2K5F A;  2EVR A;  4JLG A;  2XIC A;  3QZ5 B;  4KH1 B;  2KBT A;  2E70 A;  1Q7Y R;  1NEG A;  2PUO B;  3CCL T;  2KGT A;  1N8R U;  1X75 C;  5GAN d;  2LTO A;  4C8Q F;  2DIG A;  2XG8 D;  5KYW A;  1ZSZ A;  4M77 B;  2OTJ T;  3OY9 A;  4AFQ C;  1BCM A;  1NZ9 A;  1K9M R;  3HSB A;  2DJQ A;  1WHK A;  2FPE A;  1NPP A;  3G4S Q;  1T0H A;  2CRE A;  2CSI A;  1AWJ A;  4C8Q D;  2ZCF B;  4L6V 5;  5KYY B;  1EZZ B;  4HVV A;  4ZGD B;  2PQW A;  2DPP B;  4F7U E;  3OS1 A;  4C92 E;  2NLU A;  4VUB A;  5FU6 C;  3CCS T;  3OQ5 A;  2QEX A;  1WA7 A;  3OYB A;  1BYM A;  2D8H A;  1M5Q 1;  1R0B G;  2HDA A;  3EAE A;  4JJN K;  1KQS S;  1BI2 A;  3VU3 C;  5AYF A;  1KJW A;  2M9U A;  3M57 A;  3I5S A;  1WQ7 A;  1VQ8 Q;  2M1H A;  5FRO A;  4B9X A;  1IZ6 A;  3E9F A;  3D7S B;  3BDU A;  4M7A D;  3CCV A;  1RAC B;  1BCO A;  4PL6 A;  5CKD A;  1PKT A;  4C8Q A;  3SWN A;  1TU0 B;  1VIE A;  4HT8 A;  1TUD A;  3VYH B;  3CC2 T;  4LDX A;  1PRL C;  1VYV A;  1M2V A;  3EG9 A;  1VQ7 Q;  3I56 A;  1WGS A;  3QSU A;  4C0D C;  1U1T A;  2QAS A;  4JLI A;  3PIO A;  1N9S A;  2QXF A;  1VQM Q;  3OS2 A;  3E1S A;  3JCM J;  1WNL A;  2DZC A;  3OYC A;  3RDV A;  5I21 A;  3OMG A;  2NUT A;  2HL3 A;  5CKH A;  1H3H A;  1NYF A;  1JB0 E;  1K73 R;  2R5M A;  3M59 A;  1YIT Q;  1K9M U;  2VXE A;  1JBM A;  3KFV A;  1FWZ A;  4OML A;  5LJ5 j;  1TSF A;  1Y57 A;  2X4J A;  5GAN 4;  2E65 A;  2FRY A;  3CCJ A;  1QVF P;  2KT8 A;  2XKO C;  1JU5 C;  1RAF B;  1YJ9 T;  1WHJ A;  1QKX A;  3CBO A;  2OTJ Q;  4B6M A;  4BY6 B;  2RQV A;  2QAZ A;  4E7Z A;  1NE8 A;  5IN1 A;  5CR2 A;  3EGX B;  2RD1 A;  4PNO A;  4JS4 A;  1VQL A;  1WX6 A;  3FDR A;  3UDC A;  1EX4 A;  5EC7 A;  1IRX A;  4ZN3 A;  4LUD A;  3PTA A;  2WSC E;  3PIP A;  2EWN A;  3A8M B;  5I2M A;  4O6J A;  3H9N A;  3OW2 S;  3I35 A;  3CCE A;  1AWW A;  2QG9 B;  2KRM A;  4DBQ A;  2VVK A;  5CQY A;  5A0D A;  4ZTJ A;  4K11 A;  2XID A;  4BY6 C;  2LP5 A;  1RI0 A;  2O9S A;  4II1 A;  2HBW A;  2CT4 A;  4BI8 B;  2KQW A;  1WIE A;  4GLK A;  4M78 E;  2KRS A;  2IG0 A;  3A98 A;  3JB9 I;  4NL3 A;  5KE3 A;  3OA6 A;  3OYY A;  1IGU A;  3JCM Q;  5GJW B;  3E9G A;  5GAM d;  1BI0 A;  2BE7 D;  1NBE B;  3INZ A;  2RH2 A;  4PJO D;  1ZA2 B;  4OMN A;  4C0G A;  4DBH A;  1YWO A;  2E12 A;  4FIB A;  2QI2 A;  4DBR A;  4QQ6 A;  1Q82 R;  2M02 A;  2MYS A;  1VQ4 A;  1YCS B;  2C0I A;  4IIO A;  2KXC A;  5CKB A;  5DLO A;  1JO8 A;  4DBF A;  1C0M A;  2XU8 A;  2JOY A;  2J6K A;  4RG8 A;  1KD1 R;  4F7U F;  2A7Y A;  3A5Z B;  1BIA A;  2AK5 A;  1NLP C;  4LDV A;  2KI7 A;  1TH7 A;  1G3W A;  2EJ9 A;  2YLB A;  2CH4 A;  3HRT A;  2BUD A;  3I9Q A;  2HQX A;  1VQP A;  2CP3 A;  4PFP A;  2GGR A;  1M27 C;  2E1H A;  2MI6 A;  3H0I A;  3JRZ A;  1QQJ A;  4N0A C;  1U3O A;  2B86 A;  3WVD B;  5IHI A;  3ZL7 C;  4MZP A;  2F5T X;  4PJO G;  3L2V A;  3RIR A;  2J06 A;  4C92 A;  4ELY C;  5LJ3 j;  2GNC A;  4LDY A;  4FSS A;  1Q7Y C;  2D6F A;  3SWN C;  3C0C A;  4PJO C;  4QVZ A;  1VYU A;  1OX9 A;  7AT1 B;  2BE9 B;  1FMW A;  3NTH A;  3H6Z A;  4PJO F;  3UA7 A;  1Q86 C;  2K9G A;  2EKO A;  2JTE A;  2ROL A;  5KYX B;  2DD5 A;  4JRQ A;  1QVF S;  1OZ3 A;  1VQO A;  4M77 C;  2OI3 A;  1QP3 A;  3E2U A;  1LVK A;  1TWB A;  3NFC A;  2F2W A;  2DO3 A;  3S3M A;  1VQK Q;  4IUP A;  5KYN A;  1YIJ T;  4OB2 B;  4C0Z A;  5J3B A;  2E41 A;  4DQ2 A;  4J9E A;  4YTL A;  4P5N A;  5GAM f;  4N4I A;  1OZ2 A;  2JT4 A;  3CCE Q;  3GIB A;  1EIF A;  4CC3 A;  5HKC A;  2JJ9 A;  8ATC B;  2RQU A;  3VUB A;  4M7A F;  1PD0 A;  4C8Q B;  3VS1 A;  1H92 A;  3V7C A;  3OYH A;  2CDT A;  4FT4 A;  2DRM A;  2LVM A;  2LT1 A;  1VQL Q;  1VQ6 T;  3LWH A;  1QLY A;  1K73 U;  3TRE A;  2RHY A;  1WXB A;  3I55 Q;  2COW A;  3O8V A;  4N0A A;  4A4E A;  2HEQ A;  5KCH A;  4DOW A;  2L3R A;  2RNA A;  4PJO B;  1I81 A;  1QVG A;  2V8I A;  2K3Y A;  4E47 A;  2EQK A;  1Z9Q A;  2JMA A;  5HK0 A;  4EMK A;  2DBK A;  1NJI R;  1XQH A;  1Q95 G;  4OP0 A;  1CKA A;  3CXC P;  1M8M A;  3CC4 A;  5GMK e;  2GTJ A;  3C94 A;  3V8L A;  3GLX A;  1R8O B;  2DD4 A;  2X35 A;  3CCV T;  3SD4 A;  2OX7 A;  1TOV A;  1FXX A;  3MO8 A;  1HD3 A;  2A08 A;  4XTU A;  3V8J A;  2WSE E;  2LCC A;  3CD6 Q;  1M3B A;  5CKE A;  5LJ3 g;  4WCI A;  4FYY B;  1VQ4 Q;  2AHJ B;  2OTL Q;  3MP6 A;  2QEX T;  3EHR A;  1YHQ T;  3SB2 A;  3M58 A;  1JQQ A;  1UGR B;  1ZLM A;  1KD1 C;  1NG2 A;  1W70 A;  5KYU B;  4IKF A;  1K4U S;  3QG1 A;  1TXQ A;  2YRD A;  2OJ2 A;  3P8B B;  3CC4 T;  4DOV A;  3CCR A;  2BZ8 A;  1ABQ A;  1YI2 A;  4NL2 A;  1GCQ C;  1M90 U;  2EPD A;  2C0O A;  3MJX A;  3GOX A;  1WXT A;  1XNI A;  4OVA A;  1BIB A;  4GY5 A;  5FRM A;  3EG1 A;  2JMC A;  4OMQ A;  1UGP B;  4Y28 E;  2ZPE B;  2SRC A;  3M54 A;  1VOM A;  1IRE B;  1Y71 A;  1SRM A;  4NOY A;  3OYA A;  3GNG A;  1VQ9 T;  1SF9 A;  2DL3 A;  5GMK h;  3ER0 A;  1OQK A;  4Y91 A;  2RQW A;  2K3X A;  2G3R A;  2QA4 T;  5GMK i;  2OTL T;  3JCM c;  1VQ4 T;  2H3J A;  1RAE B;  3OYE A;  1O9S A;  5D6X A;  2JS0 A;  2NUT B;  3M0R A;  1WFW A;  3L2R A;  2PUK B;  4ME7 A;  3V7S A;  2W10 A;  2EYZ A;  2HZY A;  4HCB A;  4RCB A;  1VQN Q;  4C92 B;  2V1R A;  2PU9 B;  3U23 A;  3CC2 Q;  4M78 B;  2K57 A;  3RMS A;  1OI1 A;  1N5Z A;  1MMA A;  1VUB A;  2EAY A;  1ZUU A;  2IVW A;  1W1F A;  3BW1 A;  5GAN f;  1JJ2 P;  3CME A;  2E10 A;  3QWX X;  1JRI A;  1VQ8 T;  1M9S A;  3LH5 A;  1ZX6 A;  3PMI A;  3LGL A;  3SHW A;  3J81 E;  5GAO q;  1VQK A;  3L42 A;  3VS2 A;  3X25 B;  2KAF A;  1N8R R;  3OYN A;  3PT9 A;  4N4G A;  2K4Y A;  1V1C A;  4KUL A;  1GXI E;  2P84 A;  4C8Q G;  4X9D A;  5CK9 A;  4M7A C;  3OYM A;  2FRW A;  1CKB A;  2CUB A;  3VV0 A;  1VQL T;  1VQ6 Q;  1XJW B;  2KSS A;  2QYZ A;  3HFO A;  4C0F A;  5GJV B;  1KC8 R;  1KIK A;  1OOT A;  1QVP A;  1K0X A;  3VRY A;  3QYH B;  3JB9 H;  1Y96 A;  4PLI A;  1SHG A;  4LD6 A;  1AEY A;  4RTY A;  5GAM e;  1G3Y A;  2QTV A;  3URG A;  3RMQ A;  4A4G A;  4QVD A;  2DZ9 A;  1ZSZ B;  1UEC A;  1F1B B;  2KEA A;  5CQX A;  3GBQ A;  5ECA A;  2CYZ B;  1XOV A;  1VQ7 A;  3FEO A;  2F2V A;  4C92 F;  5HK3 A;  1HXD A;  5KE2 A;  1YIJ Q;  4PFO A;  2DET A;  1H8K A;  5FW9 A;  1H64 1;  4ZGJ B;  5DY9 A;  5I11 A;  3PE0 A;  3S3N A;  3PMT A;  2DBM A;  3MEA A;  2RJE A;  3J80 E;  3A8H B;  1KQS P;  1SRL A;  4AG1 C;  1MV0 B;  4KT0 E;  4BE1 A;  3FIF A;  3R6O A;  3A1P A;  2X4Y A;  2CP5 A;  1QP2 A;  1QMC A;  2EBP A;  2YWW A;  1Q81 C;  1UG1 A;  2VC8 A;  3PGG A;  1BBZ A;  2W0Z A;  2LT4 A;  1M2V B;  2LQK A;  3QWY A;  2HD0 A;  2K2M A;  4E7I A;  2ROT A;  3WVE B;  2J6O A;  2AKK A;  1Y0M A;  2EQJ A;  3OBW A;  2CKK A;  3Q1J A;  1RLP C;  4A53 A;  3CMA Q;  2BIV A;  4LN2 A;  3M0S A;  5GAM h;  1KC8 C;  3BY7 A;  2GFU A;  2RHX A;  4AG2 C;  5IAY A;  1VQ5 Q;  3AT1 B;  1FMK A;  3THK A;  1I5O B;  4FU6 A;  1I1J A;  3CCQ A;  2CZ0 B;  2RI3 A;  1U5S A;  3X28 B;  4M77 G;  1RAI B;  4ZNX A;  4JJC A;  4Z02 A;  4PKC C;  5KYY A;  1M4Z A;  5LJ5 e;  4M78 A;  4DA4 A;  5LJ5 d;  4M77 F;  1M2O A;  1X6B A;  2DIL A;  5CKF A;  2BTT A;  2VXF A;  2DVJ A;  2KY9 A;  4F7U G;  3VS4 A;  1VQN T;  1S72 Q;  3OS0 A;  5FU7 B;  3JAM E;  1QWE A;  4J6W A;  1T3S A;  4E6R A;  4CC2 A;  3G6E Q;  4M4Z A;  3M0T A;  5D7U A;  4OB1 B;  4M78 F;  1QVG S;  1PG5 B;  3DLL A;  2D0N A;  1EFN A;  4M75 G;  2AZV A;  3V8K A;  1LPL A;  4X1V A;  3OW2 P;  2HKN A;  2XHC A;  3RKW A;  2CP0 A;  5IHK A;  3P8H A;  2J7I A;  4M7D D;  2DNU A;  2FZK B;  4X9C A;  2LJ3 A;  1AZE A;  1RAD B;  3EG2 A;  2HQE A;  3S3O A;  4M7D F;  1VQP T;  1FYN A;  5DLQ E;  3GF5 A;  1I07 A;  1JXM A;  2XD0 A;  4J8O A;  1SHF A;  1WQW A;  2E3H A;  2DXU A;  2COZ A;  1WPY A;  1SG5 A;  1JEG A;  4M78 D;  2CZ1 B;  3G6E A;  1KHC A;  2AT1 B;  3CCM Q;  2VV5 A;  2L89 A;  2KK4 A;  1OUL A;  5A2Q E;  2MWO A;  2L3Q A;  4C5G A;  2DA9 A;  5GAN 3;  3KBG A;  4M77 A;  3CC4 Q;  4HKE A;  3J7A F;  1KQS A;  2L8D A;  2EYQ A;  4KGX B;  4XK8 E;  5GAN e;  2X4W A;  3CCU T;  5IHN A;  1YJW T;  1V29 B;  2QEX Q;  2CT3 A;  1AD5 A;  4LUE A;  4C92 D;  4M75 E;  1N9R A;  2KDS A;  2I2L A;  1N6A A;  2DRK A;  3E19 A;  4QQD A;  1C6V X;  1ZSZ C;  2IIM A;  2O88 A;  2HNI A;  2RQT A;  3QJY A;  4CI0 C;  2RJF A;  1PHT A;  1T0J A;  2JZ2 A;  1VA7 A;  4RTV A;  4OB3 B;  1T3L A;  3CC7 T;  1OEB A;  2RQR A;  2V1Q A;  2RK2 A;  2JS2 A;  1GFD A;  4QVC A;  4Y92 A;  2ABL A;  1W2B P;  4KGZ B;  2JXB A;  1WHH A;  1AOJ A;  3PVL A;  3JCM V;  2EQM A;  3M0P A;  1G83 A;  4RCC A;  2O01 E;  5GAN 7;  4F16 A;  4RTZ A;  1O75 A;  1X69 A;  5M9O A;  1VIF A;  4IUT A;  1MNE A;  4J5Y A;  4M7D E;  1GCP A;  4UC4 A;  2NUP B;  1QCN A;  5LJ3 e;  4XTX A;  4OMM A;  3VYG A;  3MEW A;  2RHZ A;  4R56 A;  4F14 A;  2P0K A;  4BE2 A;  2GTO A;  3SDZ A;  4EPC A;  4PK4 A;  2K7A A;  3UWN A;  1B34 A;  1R77 A;  2L3S A;  4J7I A;  3HL8 A;  3JSC A;  3CCL A;  3CMA A;  4KUD K;  2MAM A;  3NPF A;  3QJ6 A;  5LJ3 f;  3OW2 A;  2M0Y A;  3RER A;  3CCQ Q;  4A54 A;  4V2S A;  3HKS A;  1ZHI A;  4OB0 B;  2ATC B;  3NHN A;  2YRC A;  1IHV A;  1TTH B;  3CCM T;  1MND A;  2LQN A;  1IGQ A;  1RL2 A;  5GAM g;  5FRN A;  2P4R A;  4FW2 A;  5GAN 2;  1VQM A;  3CCQ T;  1OPL A;  2NUP A;  4GBQ A;  1N27 A;  4QW2 A;  3L2Z A;  2FVU A;  5C6S A;  1K1Z A;  4F7U B;  1RAA B;  4EMH A;  2ZPG B;  3LX7 A;  4PFZ A;  4GLM A;  2DF6 A;  1PSE A;  4FCY A;  3PVQ A;  1KG1 A;  1UDL A;  3G6E T;  2MK5 A;  2ENM A;  5L8R E;  3L2Q A;  4JRK A;  3KUF A;  1MMD A;  2SEM A;  1RAB B;  3OYK A;  4JZ4 A;  1G5V A;  2RB6 A;  1I5L A;  3M56 A;  2DTO A;  2K2V A;  2NYS A;  3VS6 A;  5GAO m;  1Q82 U;  3CXC S;  2L3P A;  1E7O A;  1GRI A;  3EGD B;  2OAU A;  5CCA A;  1YWP A;  4WTO B;  2EW3 A;  4KGV B;  3UA6 A;  2B8A A;  3HRS A;  1M1K U;  2ZPH B;  3X20 B;  1X2Q A;  8AT1 B;  1NLO C;  4AMC A;  3MCA B;  1AT1 B;  2YRV A;  3WXM B;  2C0T A;  4JRI A;  1PRM C;  1YJN T;  1NYG A;  2YUQ A;  2OAW A;  1Y07 A;  4HVU A;  1K73 C;  3M9Q A;  2V8K A;  1NEB A;  4XTY A;  1YBY A;  3GPL A;  2K5L A;  1PD1 A;  3MKD A;  1V76 A;  3SWN B;  1VYT A;  2LQW A;  4C5I A;  3OS5 A;  2EJF A;  1ABO A;  3VS3 A;  1W2B S;  2MOX A;  4KH0 B;  3RUX A;  2PZ1 A;  4FL6 A;  3VS5 A;  2ZPI B;  2D1X A;  2X51 A;  3T9N A;  1ZUY A;  1XTD A;  2M51 A;  1U06 A;  2JUF A;  3DKM A;  3JCM W;  5LJ5 f;  1YJN A;  4J9H A;  4BB7 A;  2DMO A;  2PVO B;  4PJL A;  4LDW A;  3LGF A;  5GAO p;  4RMO A;  3G71 Q;  1UUE A;  2D9T A;  3FB9 A;  1VQO Q;  1AZG B;  5GMK j;  3JV3 A;  3MP1 A;  3P8D A;  2WAC A;  4E2F B;  4A4F A;  2F5K A;  2YLC A;  4TVR A;  2MF2 A;  1VQO T;  3R6N A;  4XTW A;  3G71 T;  3M4G A;  3H0H A;  3L1A A;  1Q7Y U;  1YHQ A;  4J7F A;  4BI4 A;  5CAI A;  3JCM b;  2XK0 A;  3ZBD A;  5IH2 A;  2MIO A;  4RTX A;  5GMK l;  2IPO B;  2DL7 A;  2EYW A;  1K8A R;  1SKU B;  1WHG A;  3JCM f;  1KQ1 A;  1YJ9 Q;  3M5A A;  4XTV A;  2QQ9 A;  2CS7 A;  1X2K A;  5A0G A;  1D3B A;  4XU1 A;  4Z88 A;  2DE0 X;  4D6W A;  2DER A;  1BKB A;  1ARK A;  1FX7 A;  2DIQ A;  5D6Y A;  1RAG B;  3A8G B;  1LJO A;  4CC7 A;  2DKG A;  1P92 A;  3EGD A;  2CSQ A;  4FT2 A;  4Z89 A;  2CH4 W;  2QDL A;  3OYD A;  5I22 A;  3N5B B;  3CXC A;  4M78 C;  2HBP A;  4HVW A;  2QQS A;  1PC0 A;  2M0O A;  3G1J A;  2H8H A;  1K8A U;  4Q5W A;  5EG2 A;  2RJC A;  2DL4 A;  4RTW A;  3CMA T;  4IIM A;  1UFF A;  3UT1 A;  4HCC A;  5FU6 B;  1ZBX A;  2YUP A;  4ATO A;  3X24 B;  2E3I A;  2ED0 A;  3CQT A;  1VQN A;  1B7T A;  1WHL A;  5IT9 E;  2AIR B;  2LX7 A;  2DVE A;  3CCM A;  1TUG B;  2EQI A;  5GAO r;  1M1K R;  2LRQ A;  4M75 D;  2O9V A;  1UE9 A;  1VQ9 Q;  4J6Y A;  1GCQ A;  2V26 A;  2VUB A;  3UAT A;  3GNF B;  2E6N A;  4JS5 A;  1WJQ A;  1WI7 A;  2HSP A;  4N4H A;  1G3S A;  3QII A;  1QWF A;  2ZGW A;  2F2X A; 
#chains in the Genus database with same CATH homology
 1YWO A;  1E6G A;  1X6B A;  2DIL A;  3EGU A;  4Z8A A;  3REB B;  1OPK A;  2BTT A;  2DVJ A;  2E5K A;  2RN8 A;  4JJD A;  1SPK A;  1IO6 A;  1YCS B;  2C0I A;  2FPF A;  3M0Q A;  3VS4 A;  4IIO A;  2LCS A;  1QWE A;  2KXC A;  1T3S A;  1JO8 A;  4E6R A;  1GFC A;  4CC2 A;  4M4Z A;  2FO0 A;  2J6K A;  3M0T A;  5L23 A;  2D0N A;  4OMP A;  1EFN A;  2AZV A;  2AK5 A;  3O5Z A;  4QT7 A;  4X1V A;  5HCK A;  1NLP C;  4J9D A;  4A63 B;  2K6D A;  1HJD A;  5IHK A;  2J7I A;  2DNU A;  2CH4 A;  2LJ3 A;  3I9Q A;  1AZE A;  3EG2 A;  1B3Q A;  1FYN A;  1I07 A;  1JXM A;  2GGR A;  1M27 C;  3H0I A;  2LJ1 A;  1SHF A;  2LZ6 B;  1PKS A;  1JEG A;  1U3O A;  2X3W D;  1B07 A;  3REA B;  4J9C A;  1KSW A;  2B86 A;  4EIK A;  5IHI A;  3ZL7 C;  2LJ0 A;  2YUN A;  3I5R A;  1CSK A;  3VRZ A;  1QCF A;  2DL5 A;  1MV3 A;  1UJ0 A;  2L2P A;  2A36 A;  2J06 A;  2L3Q A;  2DA9 A;  2FEI A;  2GNC A;  4FSS A;  3C0C A;  1VYU A;  2FG0 A;  3UA7 A;  2G6F X;  3NMZ C;  2JM8 A;  1M30 A;  3EG3 A;  5IHN A;  4DEY A;  2K9G A;  2CT3 A;  2JTE A;  1AD5 A;  2ROL A;  4LUE A;  1GL5 A;  2HCK A;  2RF0 A;  2OI3 A;  2DRK A;  4J9B A;  1GBR A;  2A37 A;  2IIM A;  2O88 A;  2F2W A;  2RQT A;  4RTU A;  2YSQ A;  1QKW A;  2KT1 A;  2KR3 A;  1PHT A;  1PNJ A;  1T0J A;  1VA7 A;  1M3A A;  4J9E A;  2EKH A;  4RTV A;  1YP5 A;  3FJ5 A;  1T3L A;  1OEB A;  2RQR A;  2V1Q A;  1ZSG A;  2JS2 A;  2JT4 A;  2KRN A;  4J9G A;  1X6G A;  1GFD A;  1RI9 A;  4CC3 A;  1TUC A;  4Y92 A;  2NUZ A;  2ABL A;  2JXB A;  1AOJ A;  2RQU A;  3PVL A;  4HCK A;  3VS1 A;  3M0P A;  1H92 A;  1G83 A;  4R0K A;  4F16 A;  2CDT A;  4RTZ A;  2DRM A;  1X69 A;  2KNB B;  1WLP B;  1PWT A;  2DX1 A;  2GQI A;  1K76 A;  1TG0 A;  4JZ3 A;  1GCP A;  1QLY A;  4AFZ C;  4D8D A;  1RLQ C;  2CUD A;  1WXB A;  1KFZ A;  4OMM A;  2HEQ A;  4RUG A;  4F14 A;  2PTK A;  2RNA A;  2GTO A;  4JPB W;  4F17 A;  2K7A A;  1WXU A;  2O2O A;  3VS7 A;  2LMJ A;  3NGP A;  4RTT A;  1Z9Q A;  1HSQ A;  2JMA A;  2YUO A;  3TVT A;  2YT6 A;  2L3S A;  2EGE A;  2DBK A;  2RMO A;  1BU1 A;  3TSZ A;  2KE9 A;  1SEM A;  3EG0 A;  1CKA A;  1M8M A;  3NPF A;  3RBB B;  1LCK A;  2J6F A;  2M0Y A;  2GTJ A;  2XMF A;  4DEX A;  1X27 A;  3NHN A;  2EGC A;  1AWO A;  5IXF A;  3VS0 A;  2LQN A;  1HD3 A;  2ESW A;  2A08 A;  1S1N A;  2P4R A;  3M0U A;  1MUZ A;  1M3C A;  2K79 A;  1I0C A;  2J05 A;  3SEM A;  1M3B A;  1OPL A;  4WCI A;  4GBQ A;  4ORZ A;  5IXB A;  3EHR A;  1SSH A;  1JQQ A;  1K1Z A;  4AFU C;  1ZLM A;  1AVZ C;  3H0F A;  1NG2 A;  1UHC A;  1W70 A;  2FPD A;  2VWF A;  1K4U S;  2KYB A;  2OJ2 A;  3EHQ A;  4GLM A;  2DF6 A;  4J9F A;  3PVQ A;  3UF4 A;  1UDL A;  2EYX A;  4HXJ A;  2RPN A;  2BZ8 A;  2ENM A;  1NM7 A;  1ABQ A;  1GCQ C;  2EPD A;  2AZS A;  2C0O A;  2SEM A;  4JZ4 A;  1WXT A;  4CC4 B;  2L0A A;  3VS6 A;  3IQL A;  1UJY A;  3EG1 A;  2L3P A;  2JMC A;  1E7O A;  1GRI A;  4OMQ A;  2SRC A;  1WDX A;  1YWP A;  4LNP A;  2EW3 A;  1UHF A;  2JM9 A;  1SRM A;  1J3T A;  2KRO A;  3UA6 A;  5FWC A;  2EVR A;  4D8K A;  2DL3 A;  1ZUK A;  4AFS C;  1X2Q A;  2RQW A;  2KBT A;  2AKL A;  1NEG A;  1NLO C;  2KGT A;  1UTI A;  2JS0 A;  3M0R A;  1WFW A;  4JJB A;  2C0T A;  2O31 A;  1PRM C;  1NYG A;  2YUQ A;  2OAW A;  4J9I A;  2W10 A;  2EYZ A;  1RUW A;  4AFQ C;  2DJQ A;  2V1R A;  4HVU A;  3U23 A;  2FPE A;  1T0H A;  2CRE A;  1NEB A;  2CSI A;  1Z9Z A;  2EGA A;  3RNJ A;  1AWJ A;  4KRT A;  1N5Z A;  2EYY A;  1K9A A;  1ZUU A;  1W1F A;  2BZY A;  4HVV A;  1VYT A;  2MCN A;  1E6H A;  2LQW A;  1K0S A;  2VKN A;  3QWX X;  1UGV A;  1ABO A;  1X43 A;  3VS3 A;  2MOX A;  1WYX A;  3LH5 A;  2PZ1 A;  2KXD A;  1ZX6 A;  3VS5 A;  2NWM A;  2D1X A;  1WA7 A;  2D8H A;  3SHW A;  1ZUY A;  2M51 A;  1U06 A;  3VS2 A;  2HDA A;  4J9H A;  2DMO A;  2D8J A;  1AWX A;  1KJW A;  3I5S A;  1V1C A;  1UUE A;  1ZBJ A;  1YNZ A;  1AZG B;  2FRW A;  3JV3 A;  1CKB A;  2CUB A;  1OV3 A;  2DM1 A;  1PKT A;  2JW4 A;  2KYM A;  1G2B A;  1TUD A;  5GJV B;  1GBQ A;  3R6N A;  1PRL C;  1KIK A;  1OOT A;  1VYV A;  1K0X A;  3VRY A;  3H0H A;  1SHG A;  1AEY A;  4RTY A;  5FWB A;  3H41 A;  1A0N B;  5IH2 A;  2MIO A;  4RTX A;  2DL7 A;  2EYW A;  1UEC A;  2KEA A;  3GBQ A;  5ECA A;  2ECZ A;  1XOV A;  2F2V A;  2X3X D;  1H3H A;  1NYF A;  1X2K A;  2BZX A;  4Z88 A;  2DE0 X;  1H8K A;  3KFV A;  5FW9 A;  4OML A;  5I11 A;  3PE0 A;  2K3B A;  1ARK A;  2DBM A;  1Y57 A;  1SRL A;  4AG1 C;  2FRY A;  1MV0 B;  2DL8 A;  2KT8 A;  1JU5 C;  1QKX A;  4CC7 A;  1W6X A;  2CSQ A;  2RQV A;  2LNH B;  4Z89 A;  2CH4 W;  2QDL A;  1BK2 A;  2EBP A;  2GBQ A;  5I22 A;  1YN8 A;  1UG1 A;  4ESR A;  4HVW A;  1BBZ A;  1WX6 A;  2W0Z A;  3QWY A;  5EC7 A;  2H8H A;  1BB9 A;  2K2M A;  4LUD A;  2ROT A;  2DYB A;  2DL4 A;  2J6O A;  2AKK A;  1JXO A;  1Y0M A;  4RTW A;  2ED1 A;  2A28 A;  4LE9 A;  1RLP C;  4IIM A;  2I0N A;  1UFF A;  3I35 A;  1AWW A;  4LN2 A;  3M0S A;  2KRM A;  2YUP A;  2VVK A;  2ED0 A;  3CQT A;  4AG2 C;  3ULR B;  4K11 A;  4OMO A;  2LP5 A;  2O9S A;  1FMK A;  2HBW A;  3THK A;  2CT4 A;  2LX7 A;  1I1J A;  1WIE A;  2KRS A;  2EQI A;  3TSW A;  2DLP A;  3A98 A;  1U5S A;  2YDL A;  2O9V A;  4ZNX A;  1UE9 A;  4JJC A;  2PNI A;  5GJW B;  1GCQ A;  3UAT A;  1WI7 A;  2HSP A;  4OMN A;  1QWF A;  2F2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...