2CDTA

Alpha-spectrin sh3 domain a56s mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPASYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Cooperative Propagation of Local Stability Changes from Low-Stability and High-Stability Regions in a SH3 Domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cdtA00
2YSQA 4JPBW 4RTXA 1X2KA 3VS0A 3GBQA 3I35A 2D8JA 1E7OA 2CH4W 2CSIA 1AZEA 1J3TA 4ESRA 2KRSA 2YUQA 2DF6A 1MV0B 2DE0X 2BZ8A 2FG0A 2VWFA 1ZLMA 1NLOC 1CSKA 1OPLA 1SHGA 3VS4A 2AZVA 3UATA 1Z9ZA 2RPNA 1ABQA 4IIOA 2BZXA 1H3HA 2KNBB 1SPKA 2LQNA 2OI3A 2DL5A 3TVTA 2KGTA 1B3QA 2ENMA 4X1VA 1SEMA 2DNUA 2J06A 2GGRA 2DA9A 4HCKA 1X27A 3VRZA 2M51A 2EYYA 2D8HA 1M27C 3A98A 3UA7A 3M0PA 1K9AA 2FRWA 2A36A 3IQLA 3EG0A 1HJDA 1EFNA 2EBPA 5EC7A 2H8HA 3NGPA 2OJ2A 4AFSC 1OEBA 1M3CA 1UGVA 4AG1C 2LJ1A 2CUBA 2A08A 3I5RA 1M30A 2K3BA 1IO6A 2V1RA 1GCQC 3PVQA 4JZ4A 2X3WD 2KR3A 1Y0MA 2O9SA 1T3SA 1UFFA 2L2PA 2O9VA 2DMOA 2CH4A 2RQWA 3SEMA 1SHFA 2F2VA 1AWOA 1GCQA 3U23A 4FSSA 2AZSA 2JMCA 1UG1A 1VYTA 4JZ3A 1AWWA 3O5ZA 4J9IA 1T3LA 4GBQA 1GBRA 4J9DA 2MCNA 3VS6A 1YN8A 2F2WA 2V1QA 2PNIA 1JO8A 2DRMA 2DYBA 2K7AA 2RQUA 4F17A 1WLPB 1YP5A 2GNCA 3KFVA 1NYFA 4Z88A 2EGCA 1G83A 1N5ZA 1NEBA 1AWJA 3H0IA 2YT6A 1X6GA 2AKKA 1X69A 3VS1A 1NEGA 1JU5C 1Z9QA 4J9HA 1WI7A 2OAWA 4D8KA 1KSWA 1ZUKA 1M8MA 1YNZA 2ECZA 1RUWA 3EHQA 3H41A 3EGUA 1WXTA 2A28A 4HXJA 4Z8AA 1Y57A 1M3BA 4ORZA 1SRLA 2JS2A 2DL4A 4RTZA 1BK2A 4M4ZA 2K6DA 2KXDA 2RQTA 1UHCA 2DL3A 4JJCA 2O2OA 2JT4A 2PTKA 2EVRA 2FPEA 2RN8A 2EYXA 1AD5A 1SRMA 5IH2A 2CDTA 4F14A 1U5SA 2GBQA 4D8DA 2NWMA 4OMLA 2RQRA 4OMMA 4OMOA 1AWXA 1ABOA 3EG2A 4RTYA 5HCKA 1H92A 1H8KA 2K79A 2YDLA 1RLQC 1GFDA 2CT4A 5IXFA 3M0RA 2KYBA 4WCIA 2RQVA 1WXBA 1BU1A 5GJVB 2X3XD 1U3OA 1ZX6A 2GQIA 4J9CA 2DL7A 3I5SA 1NYGA 1VA7A 2J6KA 1UJ0A 4QT7A 4R0KA 2BTTA 1HSQA 1WFWA 4J9FA 4EIKA 1QWEA 2SEMA 1WA7A 3M0TA 2LMJA 1QWFA 2I0NA 1QLYA 1NG2A 2K9GA 1YWOA 2SRCA 1OOTA 2DJQA 3REAB 3RNJA 2JXBA 1SSHA 2A37A 1ZSGA 3R6NA 1NLPC 2C0TA 1NM7A 1U06A 1I0CA 3NHNA 2D0NA 1GL5A 3EHRA 2KROA 4LN2A 2GTJA 2G6FX 3PE0A 1PKTA 4KRTA 4OMQA 2J6OA 1QCFA 3M0UA 1UECA 1CKBA 2DLPA 3I9QA 2AK5A 2LP5A 2HBWA 3FJ5A 1A0NB 1S1NA 4GLMA 1AEYA 1ZBJA 2ABLA 4HVVA 5L23A 2O31A 4OMNA 4ZNXA 2JMAA 1PRMC 2J05A 2NUZA 2LCSA 1TG0A 1PWTA 1W6XA 3JV3A 2KT1A 1WIEA 1GRIA 3REBB 2E5KA 1WYXA 2FO0A 4JJDA 1WXUA 2EYWA 2IIMA 2KEAA 4HVUA 5FWCA 1KIKA 3THKA 2KYMA 1GCPA 4RTWA 4JJBA 2KXCA 4RUGA 2BZYA 2FPDA 2KRMA 4RTTA 1ZUUA 2J6FA 1B07A 2KBTA 2L0AA 3NMZC 3RBBB 1YWPA 2K2MA 1TUCA 2L3PA 4F16A 2RF0A 1JXOA 4RTUA 2D1XA 4CC7A 5GJWB 1W1FA 4J9GA 2HDAA 2ESWA 1E6GA 3C0CA 2EYZA 2LQWA 4CC3A 1I07A 1BBZA 2VVKA 3EG1A 1GFCA 2PZ1A 4AG2C 4Y92A 3TSZA 2DX1A 1M3AA 1GBQA 2YUNA 1WX6A 1JXMA 1KFZA 5IHNA 4LUEA 1YCSB 1XOVA 3M0QA 1TUDA 1OPKA 2HCKA 3H0HA 1UE9A 1AVZC 4AFQC 1JQQA 3UF4A 2RMOA 3EG3A 1ZUYA 2JM9A 4K11A 1RI9A 2ED0A 2DBKA 1UJYA 5ECAA 1OV3A 2O88A 1PKSA 2HEQA 4CC4B 4DEYA 1HD3A 5IHKA 4J9BA 4LUDA 3UA6A 3M0SA 1G2BA 1FMKA 1FYNA 4HVWA 2JTEA 1AZGB 2CREA 3VS2A 4E6RA 2DILA 4Z89A 2YUPA 2B86A 2GTOA 5I22A 1VYVA 3ZL7C 2ED1A 2AKLA 2LNHB 1KJWA 4CC2A 2C0IA 5FW9A 3VS3A 4RTVA 2FPFA 1PHTA 5I11A 1T0JA 3PVLA 1X43A 1UDLA 1JEGA 1PNJA 3H0FA 2F2XA 5IHIA 1VYUA 1MV3A 1AOJA 3LH5A 2L3SA 2QDLA 2MOXA 2JM8A 2FEIA 2EW3A 4J9EA 2DM1A 2JS0A 2LZ6B 1PRLC 1X6BA 2CT3A 2M0YA 2EGAA 4LNPA 1K4US 2DBMA 1LCKA 3VS5A 3QWXX 1X2QA 1K1ZA 2YUOA 1MUZA 2HSPA 1UHFA 1K0SA 2DL8A 1BB9A 4IIMA 3ULRB 2DRKA 2EPDA 1RLPC 2EGEA 2W0ZA 2FRYA 2LJ3A 3VS7A 2RNAA 1QKXA 2EKHA 2KRNA 2J7IA 2CUDA 1ARKA 2MIOA 3TSWA 2C0OA 2CSQA 4LE9A 1V1CA 2W10A 3QWYA 4AFUC 2KE9A 2LX7A 1W70A 1K76A 2DVJA 1T0HA 4DEXA 1E6HA 5FWBA 1I1JA 5IXBA 4AFZC 4A63B 3CQTA 2XMFA 2LJ0A 1WDXA 1UUEA 2P4RA 1QKWA 3NPFA 2ROTA 2L3QA 2JW4A 2ROLA 1CKAA 1K0XA 4OMPA 3VRYA 1UTIA 2VKNA 2EQIA 3SHWA 2KT8A
chains in the Genus database with same CATH superfamily
2D6FA 1X2KA 3SWNB 3VS0A 1TOVA 5LJ3e 1YFNA 4J6XA 2K5IA 4FSXA 1OX8A 2VWFA 1ZLMA 1ZQ1A 3VJPA 3HHTB 1ZSZC 1KK7A 1K8AU 1SHGA 2AZVA 5KYXB 1Z9ZA 2K4YA 2RPNA 1IB8A 3GLXA 4P5NA 2FZGB 1TS9A 4XAXB 3HPWA 2VGMA 3G6ET 2E65A 2ENMA 3MPUB 1DJ7B 4NL2A 3CCJA 4KH0B 2RHIA 3EH1A 3OY9A 1TUGB 2EYYA 2M51A 8ATCB 3OB9A 4M7DC 4N4GA 3FIFA 3A98A 3JCMW 3UA7A 3M0PA 4B6MA 3CCRA 3RUXA 2A36A 2VGNA 2E10A 2H8HA 1G3WA 2OJ2A 2HQHA 4AFSC 4OF1A 3QXEB 2LJ1A 1M4ZA 4RCCA 4O5VA 1VQ4T 2CKKA 2ZGWA 1WHJA 4XU2A 2L2PA 4JS4A 3JCMc 2PUOB 1K73U 4LDWA 3AHUA 1M8VA 2JMCA 2E1HA 2P0QA 2DO3A 3QO3A 3M54A 2GCXA 4JZ3A 1K9MU 3O5ZA 2EWNA 4J9IA 1PCXA 3SB2A 3INZA 1QVFS 2K7AA 3E1SA 2RJCA 2K3YA 1W2BS 2HD0A 1YP5A 3CBOA 4PKCC 5FU6C 1NPPA 4BY6C 2EGCA 1G83A 4KT0E 1N8RC 3RKYA 1N5ZA 4FT2A 3QSUA 1AWJA 2AKKA 3JCMV 3HFNA 5HK3A 3VS1A 1KQSP 2R5MA 1JU5C 1M90U 3JCMh 4F7UB 4IUVA 3VKIA 5KYWB 2OTLT 3I55A 1YNZA 2ECZA 3EHQA 3G1JA 1WXTA 5KYUB 4Z8AA 1SG5A 1Y57A 3M5AA 2LX9A 4RTZA 2MAMA 5KYYB 3EFSA 3KXTA 5DLQE 1FX7A 4M78C 4F7UE 1NJIC 2AT1B 2DL3A 5CIUA 3S6WA 3J7AF 2DXTA 1N27A 2EJFA 4NL3A 5GAMf 2CDTA 1I81A 4F14A 2RO0A 3RKXA 1ACMB 1Q86R 4HCCA 4Z02A 2H3EB 4C5HA 1VQ8Q 3MHXA 1ABOA 3A8HB 2PUKB 2NLUA 3CPFA 3EG2A 4RTYA 5D6WA 2K79A 2XICA 1RLQC 5GANg 5GAN8 2QASA 2QK0A 4IURA 1B7TA 4F7UA 5LJ5e 1UB4A 2RQVA 1WXBA 1X01A 4D6WA 5KYWA 5KCOA 4M77F 1UJ0A 2YRDA 5KYUA 4OGCA 1Y71A 1VQ6A 3CCEA 1I4K1 4MMKA 2CYZB 1VUBA 5KYYA 1YCYA 5GANf 3RNJA 2DTIA 5GAN2 4ZTJA 4PFZA 4C92F 2MF2A 2QI2A 3E19A 1I0CA 1GL5A 3CC7Q 2GTJA 3PE0A 1JRIA 2FZCB 1QVGS 4L59A 5D7UA 1S1NA 3PTAA 1AEYA 1JBMA 3TU4K 2OTJQ 3CPWA 4LXCA 2CP3A 2O31A 3EG9B 4A4EA 2J05A 4M77G 4BE1A 2HZYA 2LCSA 3CC2A 1W6XA 1WIEA 1GRIA 1VQ7A 3M59A 4E7ZA 4JJDA 3CC2T 2KEAA 2QGFB 4HVUA 1ZA2B 1KIKA 3ZEHA 3THKA 3OSVA 4C92G 4ME7A 4JJBA 4BD3A 4RUGA 2CP7A 2LT1A 2DEUA 1M2VB 2BZYA 2V8KA 3OS1A 1N9RA 2E3HA 3NMZC 3RBBB 5LJ3h 4KUDK 1YWPA 2XDPA 1JB0E 4F16A 1QVFP 4RTUA 4E7SA 3FDRA 4LDYA 1W2BP 3X24B 1AHJB 3X26B 1E6GA 5CK9A 2QEXQ 4J6WA 3V8LA 4MZTA 1BBZA 3X25B 2HKNA 1XNIA 1JJ2S 1MGQA 3M0QA 2CP5A 2XHCA 3PGGA 3H0HA 1AVZC 1BKBA 1JQQA 3EG9A 3UF4A 4DBQA 2RMOA 4C92D 2KI7A 2XU8A 4HA8A 4M7DF 5GMKe 1ZUYA 3OS2A 5LJ5f 4K11A 4DOVA 3JSCA 1YIJQ 3BFMA 2RJDA 3HL8A 2PVOB 4CC4B 4M7AC 4PJOC 1N9SA 1HD3A 4YTLA 3UA6A 1G2BA 1VQMQ 3M4YA 1IHVA 2JTEA 1M2VA 1GXIE 4QQ6A 2V8JA 2GTOA 2JTMA 3V8JA 1YITA 2AKLA 5HK0A 5GAOq 4CI0C 5GAOm 1Q86C 2DXUA 3GPLA 1D0XA 4OB2B 3VYHB 1F1BB 4JJNK 2L89A 4FYVB 1YJNQ 4M7DG 3CCQA 3OYKA 2FPFA 1PHTA 3VU3C 1T0JA 1B34B 3HRUA 1X43A 2NUTB 2L8DA 1W4SA 3CCMA 2JJ9A 2XD0A 1VYUA 2LNVA 2L3SA 2QDLA 4BDYA 2JM8A 2FEIA 1RAHB 3QPHA 2JS0A 2PVGB 3FC3A 1X6BA 4C0FA 4LNPA 2M0OA 1K4US 3CC7T 4RG2A 1MMDA 4BE2A 5GAOp 1WJRA 1RADB 1PSEA 1UGSB 4FW1A 2YUOA 2FB7A 2YLBA 2HQXA 1UHFA 1OI1A 6AT1B 3CCUQ 2FYKA 4IIMA 4BI8B 3WVDB 5KE3A 4M7DD 2LJ3A 4DBHA 2RNAA 4QQGA 2X9HA 2VYTA 4QVZA 1QVGP 4M78F 2QG9B 5GAOr 4J7FA 1V1CA 3FRNA 2KE9A 5D6YA 3P8BB 2DVJA 3E9FA 1PD1A 3PT9A 3OW2A 1MNDA 4KULA 2X35A 1I1JA 4A63B 3RR6A 1B34A 1BYMA 2XMFA 2LJ0A 1WDXA 4BI4A 2NUTA 1D09B 1QKWA 1I5OB 2K5LA 3CMEQ 2L3RA 2ROTA 3E9GA 2AIRB 2DD4A 1KQ1A 2E41A 2ZPEB 2QYZA 1BI3A 2LTOA 2VXFA 2KVQG 4ZGEB 3A1PA 3VRYA 1Q82U 3A8OB 2RA2A 3META 4RTXA 4XU3A 1IGQA 3GBQA 3I35A 3L2ZA 3L2QA 2E3IA 4M78G 3QHSA 2E6NA 3Q1JA 4C0DC 2KRSA 3JB9I 5LJ5h 2DF6A 1MV0B 2P84A 4OVAA 1VQNQ 4JRPA 4XTZA 3CC4Q 2LCCA 3M53A 4BACA 2HKQB 1NLOC 4MZMA 1OPLA 4M75B 1PSFA 1YIJT 2BZXA 1MMNA 1SPKA 1JJ2P 3TVTA 3OYBA 1SEMA 1VQ5Q 1VQMT 2GGRA 2DA9A 4XQ3A 1C6VX 4PJLA 2EQKA 3VRZA 5GAMj 3LWIA 4M75E 4F04B 2QA4A 5M9OA 1M27C 1WGSA 2QTXA 3J81E 4M78D 4OP0A 3QJ6A 3OS0A 1G3TA 4MMLA 4XU0A 3CD6Q 3EG0A 2FL7A 1QCOA 3M56A 1HJDA 1YJNT 1WHMA 3NGPA 4CRIA 1OEBA 2WSFE 1KG1A 2A08A 4EMGA 1M30A 2A3LA 3QJYA 2BUDA 4FYXB 2V1RA 2ZCFB 4JZ4A 1R8OB 4A53A 1WHLA 2KR3A 1G8XA 5GAMd 1PD0A 1P92A 4M77C 2CH4A 1RAIB 3SEMA 1VQKQ 2LRQA 3MP6A 1AWOA 1GCQA 2PU9B 2IG0A 4HCZA 3U23A 4FSSA 4M75A 3JB9H 2AZSA 2QGGA 1RL2A 1UG1A 3G71Q 5GANj 4GBQA 4OB3B 3OYHA 2MCNA 1YN8A 2V1QA 2PNIA 3F70A 1VQOQ 1YHQQ 2Y90A 2AHJB 1WLPB 3KFVA 3QDFA 4Z88A 4NOYA 2D9TA 1M1KR 1UEBA 3H6ZA 7AT1B 4JDSA 3H0IA 4OMFB 2KDSA 1NJIR 3JCMf 1X69A 2F69A 5DLOA 5KYNA 1Z9QA 1AT1B 1MMAA 4D8KA 2DZ9A 1KSWA 1ZUKA 5GANd 5GMKi 1KQSA 3PIPA 1M8MA 3CMAQ 5GMKh 1RUWA 3H41A 2A28A 4XTXA 4PJOF 2JS2A 1BK2A 2K6DA 2P0KA 4EMKC 1D0YA 2RD1A 2LC4A 2KXDA 2O01E 3L2VA 4HT9A 2O2OA 1Y7XA 3DB3A 5CKDA 3T9NA 3G6EA 2FHDA 3JB9F 5CQXA 3DLLA 4D8DA 2MI6A 5KE2A 4C0GA 1U8RA 3CC4T 1R0CB 2M02A 3TQ7P 4M7AG 4IUUA 4PJOG 1H92A 2VXEA 1H8KA 2YDLA 2EKOA 4LDUA 1GFDA 1OYXA 1WQ7A 3M0RA 3OYIA 5LJ5j 1BU1A 5GJVB 3DLMA 2DL7A 4FU6A 3D7SB 1VQ4A 3L2UA 4R0KA 1WFWA 4J9FA 3ME9A 1V29B 1QWEA 2EAYA 4MZPA 1RAAB 3M0TA 2LMJA 1QWFA 2R58A 1R77A 1NG2A 5A0GA 4TVRA 2K9GA 5AYFA 2K2VA 4N0AC 3REAB 3CD6T 1XQHA 3LYIA 3JCMX 2A37A 1G3SA 1ZSGA 3R6NA 1U06A 2XK0A 3NHNA 3C95A 1SSFA 2WSEE 1VIEA 4OMQA 4M7AD 2QQSA 5GAN7 4PJOD 2Z0WA 2J6OA 1QCNA 2KSSA 3M0UA 2E4HA 1CKBA 2DLPA 3I9QA 2AK5A 3FJ5A 5LL6S 3NTHA 2ABLA 1D1CA 5GAOn 2K3XA 3L42A 3C4SA 2DYIA 4OMNA 1XJWB 5CKFA 5GAN6 1O75A 3X20B 1VQPQ 1TG0A 3G71T 1PWTA 2KT1A 3REBB 2E5KA 4O6JA 3UDCA 2EYWA 1VQOT 2IIMA 3SFMA 3PNWC 2KYMA 2OTLA 1GCPA 4RTWA 3QYHB 2COYA 2KXCA 2DXCA 5LJ3f 2V26A 4IUQA 3OBYA 1QP2A 1I8FA 2KRMA 3BDUA 3OMCA 4RTTA 3OS5A 2OAUA 5AT1B 3G4SA 3JAME 1RAEB 2CZ1B 3OYNA 3L2RA 4E7JA 3MCAB 5GAMg 1JXOA 1W1FA 4J9GA 2HDAA 2MK5A 3G4ST 2ESWA 1M1KC 1BI2A 5CKEA 3JCMQ 2YHTA 1QVFA 3CMAT 2VB6A 2LQWA 2XIDA 1I07A 2DVEA 3G7ZA 4DBRA 1GFCA 1W2BA 4AG2C 3PMTA 3TSZA 1QW1A 2DX1A 5DY9A 2HQEA 2JOYA 1JXMA 5IHNA 4LUEA 2DKGA 3CCLQ 2XG8D 1TUDA 1UE9A 1Q7YU 4ZN1A 4E7HA 1EZZB 1YI2Q 3EFOB 2PQWA 1RI9A 5GMKj 1HXDA 3BE3A 1HK9A 2O88A 3RKWA 3NTIA 3S3MA 1WJSA 3OYYA 4A4KA 4DEYA 4LUDA 4E47A 3M0SA 4ZGJB 1IXDA 1FMKA 1FYNA 1YJ9Q 3TREA 5KH6A 4M77B 2RJFA 2YUPA 2B86A 1ZBXA 1FMWA 5C6SA 4CC2A 4FL6A 3S3NA 1D1AA 3KUFA 2IPOB 3NTKA 4FIBA 4C92B 1D1BA 3BDLA 1XTDA 5I11A 3M9QA 3PVLA 3EAEA 4M77E 4A4GA 1OZ2A 1H3ZA 5CAIA 2QTVA 3OYMA 4GLKA 1PM3A 2F2XA 3FB9A 5FU7B 3P8HA 4ZN3A 3OBWA 3OSSC 1K8AR 2MOXA 3EGXB 2VUBA 2DM1A 3V8KA 3EFOA 1PRLC 4C92E 4PL6A 3I56Q 4BE0A 2M0YA 2EGAA 5GAN3 1YJWQ 1LNXA 4UC4A 5D6XA 3PMIA 3VS5A 3QWXX 2DIQA 3OYEA 1X2QA 1K1ZA 4XTUA 3HKSA 1BB9A 2DRKA 4HKEA 2EGEA 2W0ZA 4M77A 3MKDA 3ZBDA 3JCMJ 1QKXA 1VQPT 2KRNA 4PLIA 2J7IA 2KMTA 5EG2A 4JRQA 2MIOA 1ARKA 2C0OA 3HFOA 1SKUB 1IHWA 4DOWA 4LE9A 3QWYA 2E64A 4GY5A 1ZSZB 1BCMA 4DEXA 1PC0A 5FWBA 4C92A 4BDZA 1VQ9Q 3A8LB 1QVGA 2EQJA 1M5Q1 1QQJA 4XTWA 5LJ5g 3HP9A 2P4RA 4E2FB 3RERA 3GF5A 4RMOA 3NPFA 4M77D 2I2LA 3CEYA 1K73R 1VQLQ 3EGXA 4B9XA 4RG8A 1UTIA 2VKNA 4M7DB 4JPBW 4E7KA 1D3BB 2D8JA 1VIFA 1E7OA 1BCOA 2CH4W 8AT1B 2DTHA 2NUPA 3QUIA 1AZEA 1WJQA 1IZ6A 1X75C 3CCLT 4J7IA 2DEQA 2YUQA 2DE0X 1VQ8A 1Q81C 1YI2T 1CSKA 4M7DE 4LD6A 1C1AA 2DFUA 3UATA 2K5FA 4HT8A 1QP3A 4OB0B 1VQ8T 1MHNA 3CCVQ 3PFSA 2KNBB 2KY9A 2DL5A 3FJPA 1N8RU 2KGTA 3JCMd 1ZSZA 1B3QA 1IRXA 2O4XB 4C8QF 2J06A 4L5GA 1S72Q 2CP0A 1JJ2A 4ATOA 2DIGA 2RH2A 1YJ9T 4HCKA 4KGXB 1X27A 2OX7A 3E2UA 3UWNA 2QQRA 1IREB 4XU1A 3C94A 3SWNC 4EDUA 5FU6B 3LW5E 4BY6B 2FRWA 9ATCB 4EMHA 2DK3A 2P0PA 3OYJA 4NS5A 5CR2A 1EFNA 4M7DA 3MJXA 1M1KU 5IAYA 3CC7A 1MNEA 1M3CA 1D0ZA 1D3BA 3AT1B 1KC8R 3I5RA 3JRZA 2RK2A 2RK1A 4PFPA 2HL3A 1NJIU 1IO6A 3N5BB 3PVQA 3DB4A 4PFOA 1Y0MA 2O9SA 4N4IA 4ANJA 4C8QG 1SF9A 2OTJA 2O9VA 3ASKA 2RQWA 4PNOA 1SHFA 2E6ZA 4IUTA 2F2VA 3I56T 2NYSA 2OTJT 3LH0A 1OU8A 4J5YA 4J9DA 3DKMA 4HCBA 4M78B 3VS6A 2F2WA 2O4XA 2C06A 1JO8A 4XTVA 1K8AC 2DYBA 2PVDB 4BB7A 2JTFA 3CBPA 2GNCA 1TTHB 2MPXC 1NYFA 2ZAEA 4QW2A 1IGUA 1WHGA 1HYOA 1X6GA 3JCMP 4M78E 5L8RE 5A0LA 2VV5A 4X9DA 4J9HA 1WI7A 2OAWA 2ATCB 2QEXA 1VQ9T 5FRNA 3CCSQ 2Y4XA 3QBYA 3OYCA 3HTRA 2QEXT 3GIBA 4BI3A 2BIVA 4HXJA 1M3BA 1SRLA 2DL4A 2F5TX 2DTOA 5LJ3j 2BE7D 3EGDB 5J39A 4JJCA 1YIJA 3OYGA 2PTKA 2EVRA 2FPEA 2RN8A 3FEOA 4Y28E 1AD5A 4IUPA 4M78A 1K73C 3MEUA 5J26A 1KHIA 2GBQA 5CQYA 1VQMA 2H3JA 4X9CA 1AWXA 3QDRB 3LWHA 1TSFA 5LJ3d 1N6AA 3CCVT 4N4HA 5IXFA 4C5GA 1YJNA 2X3XD 2ZPBB 5GAOl 1U3OA 4J9CA 3QKJA 3I5SA 3CCJQ 2J6KA 4FYYB 4QT7A 3VUZA 4X34A 4BUGA 1HSQA 4EIKA 2SEMA 2I0NA 1YWOA 4C0ZA 1FXXA 2SRCA 2RHXA 2JXBA 3CCRQ 3EGDA 3QZ9B 2MWPA 3OYAA 2LQ8A 1NLPC 1NM7A 2D0NA 5I21A 2KROA 4LN2A 4KRTA 2RHUA 3JCMg 1QCFA 3CCUA 3TCJA 2LP5A 2QAZA 2HBWA 1PG5B 4QQDA 2GFUA 3CCUT 1KC8C 2JMAA 1PRMC 4JRKA 5KCHA 3QIIA 1RAGB 2LDMA 2L5QA 2DETA 1WXUA 5FWCA 2EQMA 5GAN5 2EFIA 3SDZA 4R56A 1RABB 3WVEB 4A54A 1Q86U 4KH1B 1H641 2FPDA 4M7AB 2CP2A 3CMEA 1ZUUA 2J6FA 2RHYA 4PJOB 2L0AA 2K2MA 1TUCA 2A0FB 2MMPA 2L3PA 5DM7R 5GJWB 5FRMA 4KBMB 3CMET 2WSCE 3CCST 2V8IA 3UT1A 4CC3A 2VVKA 3EG1A 2PZ1A 3I55Q 4M7AE 4PJOE 2JUFA 2KK4A 1GBQA 3OMGA 1KFZA 3WXMB 1VQNA 1XOVA 1OPKA 2HCKA 2GQVA 3CC4A 1QMCA 3QG1A 4XK8E 3EG3A 1VQNT 3GP8A 1Q95G 5J3BA 2ED0A 1TH7A 3RMQA 2DBKA 1UJYA 5ECAA 1OV3A 1OULA 2HEQA 4QKUA 4JLGA 1VQ5A 2RI5A 5IHKA 4HVWA 4FW2A 3OQ5A 3JB9J 2RI3A 1VQ5T 2JNGA 4M7AA 3EFRA 4PJOA 4WTOB 5I22A 2XDBA 2RB6A 3ZL7C 2ED1A 2LNHB 1BIAA 3CD6A 2X4YA 1Q82R 5GAMe 5GMKm 3JB9G 5FW9A 4FCYA 2COZA 3H9NA 3ZFJA 3VS3A 3CCJT 4RTVA 2CZ7B 3ER0A 4JS5A 1UDLA 4C8QC 4ZGDB 2M9UA 1VQ6Q 3CCEQ 5LJ5d 1QVPA 5IHIA 1AOJA 3LH5A 1VQKA 3SWNA 3CCRT 2CT3A 4FYWB 1Y07A 5LJ3g 3G71A 1VQKT 1LCKA 1VQOA 1YHQA 4XTYA 3MEWA 5KYXA 3JB9D 3ULRB 5CKHA 5GANe 2EPDA 3RESA 1YHQT 4QVCA 3QYGB 3VS7A 1NE8A 4JUVA 2EKHA 1M1GA 3KBGA 4C0DB 2CUDA 3CC2Q 2W10A 2LX7A 1VQ7Q 1W70A 3EH2A 2XDDA 2ZZDA 2KAFA 1NZ9A 5IXBA 3CMAA 2YRVA 2ZPIB 2DZCA 3RMSA 1UUEA 2X4JA 3MP8A 4C5IA 1Q81R 3OA6A 1ZHIA 2JW4A 2K57A 3CXCP 2LQKA 4F7UF 1CKAA 1R0BG 1K0XA 2EIFA 4OMPA 3SHWA 4A4HA 2BE9B 2RI2A 2YSQA 4WF2A 3I55T 3OYDA 2CSIA 1J3TA 2XI9A 2VASA 4ESRA 3MO8A 3R6OA 2ZPFB 2BZ8A 2FG0A 4J6YA 3M55A 3VS4A 1KC8U 4R55A 2KQWA 1ABQA 4IIOA 3MP1A 1KHCA 1H3HA 4E7LA 2IVWA 2LQNA 3LLRA 2OI3A 4PJNA 3L1AA 4DBFA 4F7UG 4X1VA 2DNUA 1YBYA 1KD1R 2E12A 2G3RA 1WNLA 2D8HA 2DPPB 3OYLA 1TWBA 3CPWS 1UGRB 3V7CA 1RI0A 2MWOA 4E7IA 1K9AA 2MYSA 5GMKl 1YITQ 2CS7A 3IQLA 5EC7A 2EBPA 1OQKA 3FLGA 4EPCA 3QZ5B 1UGVA 4AG1C 3CCQQ 2CUBA 3HRSA 2K3BA 4C5EA 4Q5WA 1M2OA 1GCQC 2YLCA 4M75C 2X3WD 2EQUA 1Q82C 1VQ6T 5A2QE 3CCET 3M4GA 1T3SA 1UFFA 3CCMQ 4KGZB 2DMOA 2NUPB 2F1LA 1VQPA 2E70A 1VYTA 5CVIA 1AWWA 1T3LA 1GBRA 2DERA 4EMKB 4KGVB 4RCBA 1RACB 2DD5A 4V2SA 1V76A 2DRMA 3BW1A 5FLXE 3JCMb 2RQUA 2YXYA 1ZA1B 4OB1B 4F17A 3CBMA 3M57A 2HMAA 4QVDA 1NEBA 2CGHA 4FM4B 2YT6A 3RDVA 2VC8A 2DAQA 1NEGA 5CO7A 1VQ7T 2RJEA 2P4TA 5C0MA 5CKBA 5HKCA 2QQAA 3BY7A 3V7SA 1KQ2A 2X4WA 4A4FA 3EGUA 1K9MR 3GOXA 4ORZA 3CCLA 2HBPA 4M4ZA 1NBEB 1YI2A 2RQTA 1UHCA 2JT4A 1U1TA 5I2SA 5HY6A 2GF7A 2EYXA 4EMKA 1SRMA 4JLIA 5IH2A 1WZOA 1M90R 1U5SA 1WHHA 4J83A 2XKOC 3SD4A 4C8QB 2NWMA 4OMLA 3H8ZA 2RQRA 3GNFB 5GAMh 4J8OA 1X6OA 4OMMA 1YJ9A 1FMVA 4OMOA 2E5QA 3VV0A 5HCKA 2CZ0B 3J80E 1RAFB 2CT4A 4LD9K 3VUBA 2KYBA 4WCIA 2RHZA 4C8QE 1ZX6A 2FVUA 2GQIA 3L2WA 4LDXA 1MMGA 4VUBA 1TU0B 1NYGA 1VA7A 3X28B 1WQWA 2BTTA 2EJ9A 2LT4A 2ZPHB 1WA7A 1QLYA 2QA4Q 4ELYC 1YITT 1Q7YR 1KD1C 1LJOA 2JN0A 3A8MB 1OOTA 2DJQA 1SSHA 2WACA 3I56A 1YJWA 2A7YA 5GANh 5CCAA 4LDVA 2C0TA 3CCQT 3EHRA 2G6FX 1PKTA 2YWWA 3LGFA 1WPYA 4N0AA 3OW2S 1YJWT 3CPWP 2FZKB 1UECA 4C8QA 3CCMT 1A0NB 1NPRA 4GLMA 2CZ6B 1OU9A 1ZBJA 2QQBA 5FROA 3LGLA 4HVVA 5L23A 4ZNXA 3OYFA 3VYGA 2GFAA 2NUZA 1OX9A 1LOJA 2LVMA 1G3YA 3JV3A 2YRCA 4PJJA 1WYXA 5I2MA 1LVKA 2FO0A 4MDXA 2Y4YA 1VQ9A 4B9WA 3URGA 5GAN4 1M9SA 5IT9E 4PJMA 4C8QD 1I5LA 1B07A 2KBTA 1VQLA 2HAXA 2RF0A 4CC7A 2D1XA 2M16A 2JZ2A 1VQLT 3C0CA 1EX4A 1M1FA 2EYZA 1O9SA 1FWZA 2RM4A 4Y92A 3S3OA 1M3AA 3P8DA 3V7RA 2YUNA 1WX6A 3A5ZB 1YCSB 3JCMe 1C0MA 4AFQC 3NFCA 4PK4A 1K9MC 2JM9A 3CCVA 3PIOA 3HRTA 1UGQB 1PKSA 1Y96B 3TEEA 3G6EQ 2EJGA 4J9BA 1S72A 4ELZC 1BI0A 1AZGB 2CREA 3VS2A 4E6RA 3RIRA 1OZ3A 2DILA 2DJZA 4M75F 1S72T 4Z89A 2QXFA 1EIFA 1VYVA 1G5VA 1M90C 2R5AA 4PLLA 2QQ9A 1KJWA 2HSEB 4Y91A 3M58A 2EYQA 2B8AA 2C0IA 4KUIA 2QDYB 2X51A 4OGEA 3HSBA 4RKUE 4DQ2A 4AMCA 1VQ4Q 4FT4A 2D0QB 1JEGA 1PNJA 3H0FA 3MEAA 2QA4T 1MV3A 2CP6A 2HNIA 4AT1B 2X4XA 2JVVA 1WHKA 2EW3A 4J9EA 1BIBA 2LZ6B 3UPUA 4M75G 2DBMA 1N8RR 1Q81U 1Y96A 1Q7YC 1KQSS 1MUZA 2HSPA 1K0SA 2LCLA 2DL8A 4IKFA 1UGPB 1VOMA 2DXBA 2ZPGB 1RLPC 3CXCS 5IN1A 1U1SA 2FRYA 4ZTFA 4L6V5 4DA4A 4C92C 3OW2P 3TSWA 1TXQA 2CSQA 4II1A 3GNGA 3LX7A 4AFUC 3MEVA 4JRIA 1K76A 3CCSA 1T0HA 1E6HA 5A0DA 2BKDN 2F5KA 5FU7C 4AFZC 3CQTA 3A8GB 2OTLQ 4M75D 2COWA 3O8VA 3C12A 1BI1A 3G4SQ 2HL5C 2L3QA 2R57A 2ROLA 1KD1U 2M1HA 4M7AF 4MDWA 1LPLA 2EQIA 2KT8A 3CXCA
chains in the Genus database with same CATH topology
2YSQA 4JPBW 4RTXA 1X2KA 3VS0A 3GBQA 3I35A 2D8JA 1E7OA 2CH4W 2CSIA 1AZEA 1J3TA 4ESRA 2KRSA 2YUQA 2DF6A 1MV0B 2DE0X 2BZ8A 2FG0A 2VWFA 1ZLMA 1NLOC 1CSKA 1OPLA 1SHGA 3VS4A 2AZVA 3UATA 1Z9ZA 2RPNA 1ABQA 4IIOA 2BZXA 1H3HA 2KNBB 1SPKA 2LQNA 2OI3A 2DL5A 3TVTA 2KGTA 1B3QA 2ENMA 4X1VA 1SEMA 2DNUA 2J06A 2GGRA 2DA9A 4HCKA 1X27A 3VRZA 2M51A 2EYYA 2D8HA 1M27C 3A98A 3UA7A 3M0PA 1K9AA 2FRWA 2A36A 3IQLA 3EG0A 1HJDA 1EFNA 2EBPA 5EC7A 2H8HA 3NGPA 2OJ2A 4AFSC 1OEBA 1M3CA 1UGVA 4AG1C 2LJ1A 2CUBA 2A08A 3I5RA 1M30A 2K3BA 1IO6A 2V1RA 1GCQC 3PVQA 4JZ4A 2X3WD 2KR3A 1Y0MA 2O9SA 1T3SA 1UFFA 2L2PA 2O9VA 2DMOA 2CH4A 2RQWA 3SEMA 1SHFA 2F2VA 1AWOA 1GCQA 3U23A 4FSSA 2AZSA 2JMCA 1UG1A 1VYTA 4JZ3A 1AWWA 3O5ZA 4J9IA 1T3LA 4GBQA 1GBRA 4J9DA 2MCNA 3VS6A 1YN8A 2F2WA 2V1QA 2PNIA 1JO8A 2DRMA 2DYBA 2K7AA 2RQUA 4F17A 1WLPB 1YP5A 2GNCA 3KFVA 1NYFA 4Z88A 2EGCA 1G83A 1N5ZA 1NEBA 1AWJA 3H0IA 2YT6A 1X6GA 2AKKA 1X69A 3VS1A 1NEGA 1JU5C 1Z9QA 4J9HA 1WI7A 2OAWA 4D8KA 1KSWA 1ZUKA 1M8MA 1YNZA 2ECZA 1RUWA 3EHQA 3H41A 3EGUA 1WXTA 2A28A 4HXJA 4Z8AA 1Y57A 1M3BA 4ORZA 1SRLA 2JS2A 2DL4A 4RTZA 1BK2A 4M4ZA 2K6DA 2KXDA 2RQTA 1UHCA 2DL3A 4JJCA 2O2OA 2JT4A 2PTKA 2EVRA 2FPEA 2RN8A 2EYXA 1AD5A 1SRMA 5IH2A 2CDTA 4F14A 1U5SA 2GBQA 4D8DA 2NWMA 4OMLA 2RQRA 4OMMA 4OMOA 1AWXA 1ABOA 3EG2A 4RTYA 5HCKA 1H92A 1H8KA 2K79A 2YDLA 1RLQC 1GFDA 2CT4A 5IXFA 3M0RA 2KYBA 4WCIA 2RQVA 1WXBA 1BU1A 5GJVB 2X3XD 1U3OA 1ZX6A 2GQIA 4J9CA 2DL7A 3I5SA 1NYGA 1VA7A 2J6KA 1UJ0A 4QT7A 4R0KA 2BTTA 1HSQA 1WFWA 4J9FA 4EIKA 1QWEA 2SEMA 1WA7A 3M0TA 2LMJA 1QWFA 2I0NA 1QLYA 1NG2A 2K9GA 1YWOA 2SRCA 1OOTA 2DJQA 3REAB 3RNJA 2JXBA 1SSHA 2A37A 1ZSGA 3R6NA 1NLPC 2C0TA 1NM7A 1U06A 1I0CA 3NHNA 2D0NA 1GL5A 3EHRA 2KROA 4LN2A 2GTJA 2G6FX 3PE0A 1PKTA 4KRTA 4OMQA 2J6OA 1QCFA 3M0UA 1UECA 1CKBA 2DLPA 3I9QA 2AK5A 2LP5A 2HBWA 3FJ5A 1A0NB 1S1NA 4GLMA 1AEYA 1ZBJA 2ABLA 4HVVA 5L23A 2O31A 4OMNA 4ZNXA 2JMAA 1PRMC 2J05A 2NUZA 2LCSA 1TG0A 1PWTA 1W6XA 3JV3A 2KT1A 1WIEA 1GRIA 3REBB 2E5KA 1WYXA 2FO0A 4JJDA 1WXUA 2EYWA 2IIMA 2KEAA 4HVUA 5FWCA 1KIKA 3THKA 2KYMA 1GCPA 4RTWA 4JJBA 2KXCA 4RUGA 2BZYA 2FPDA 2KRMA 4RTTA 1ZUUA 2J6FA 1B07A 2KBTA 2L0AA 3NMZC 3RBBB 1YWPA 2K2MA 1TUCA 2L3PA 4F16A 2RF0A 1JXOA 4RTUA 2D1XA 4CC7A 5GJWB 1W1FA 4J9GA 2HDAA 2ESWA 1E6GA 3C0CA 2EYZA 2LQWA 4CC3A 1I07A 1BBZA 2VVKA 3EG1A 1GFCA 2PZ1A 4AG2C 4Y92A 3TSZA 2DX1A 1M3AA 1GBQA 2YUNA 1WX6A 1JXMA 1KFZA 5IHNA 4LUEA 1YCSB 1XOVA 3M0QA 1TUDA 1OPKA 2HCKA 3H0HA 1UE9A 1AVZC 4AFQC 1JQQA 3UF4A 2RMOA 3EG3A 1ZUYA 2JM9A 4K11A 1RI9A 2ED0A 2DBKA 1UJYA 5ECAA 1OV3A 2O88A 1PKSA 2HEQA 4CC4B 4DEYA 1HD3A 5IHKA 4J9BA 4LUDA 3UA6A 3M0SA 1G2BA 1FMKA 1FYNA 4HVWA 2JTEA 1AZGB 2CREA 3VS2A 4E6RA 2DILA 4Z89A 2YUPA 2B86A 2GTOA 5I22A 1VYVA 3ZL7C 2ED1A 2AKLA 2LNHB 1KJWA 4CC2A 2C0IA 5FW9A 3VS3A 4RTVA 2FPFA 1PHTA 5I11A 1T0JA 3PVLA 1X43A 1UDLA 1JEGA 1PNJA 3H0FA 2F2XA 5IHIA 1VYUA 1MV3A 1AOJA 3LH5A 2L3SA 2QDLA 2MOXA 2JM8A 2FEIA 2EW3A 4J9EA 2DM1A 2JS0A 2LZ6B 1PRLC 1X6BA 2CT3A 2M0YA 2EGAA 4LNPA 1K4US 2DBMA 1LCKA 3VS5A 3QWXX 1X2QA 1K1ZA 2YUOA 1MUZA 2HSPA 1UHFA 1K0SA 2DL8A 1BB9A 4IIMA 3ULRB 2DRKA 2EPDA 1RLPC 2EGEA 2W0ZA 2FRYA 2LJ3A 3VS7A 2RNAA 1QKXA 2EKHA 2KRNA 2J7IA 2CUDA 1ARKA 2MIOA 3TSWA 2C0OA 2CSQA 4LE9A 1V1CA 2W10A 3QWYA 4AFUC 2KE9A 2LX7A 1W70A 1K76A 2DVJA 1T0HA 4DEXA 1E6HA 5FWBA 1I1JA 5IXBA 4AFZC 4A63B 3CQTA 2XMFA 2LJ0A 1WDXA 1UUEA 2P4RA 1QKWA 3NPFA 2ROTA 2L3QA 2JW4A 2ROLA 1CKAA 1K0XA 4OMPA 3VRYA 1UTIA 2VKNA 2EQIA 3SHWA 2KT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSQ A;  4JPB W;  4RTX A;  1X2K A;  3VS0 A;  3GBQ A;  3I35 A;  2D8J A;  1E7O A;  2CH4 W;  2CSI A;  1AZE A;  1J3T A;  4ESR A;  2KRS A;  2YUQ A;  2DF6 A;  1MV0 B;  2DE0 X;  2BZ8 A;  2FG0 A;  2VWF A;  1ZLM A;  1NLO C;  1CSK A;  1OPL A;  1SHG A;  3VS4 A;  2AZV A;  3UAT A;  1Z9Z A;  2RPN A;  1ABQ A;  4IIO A;  2BZX A;  1H3H A;  2KNB B;  1SPK A;  2LQN A;  2OI3 A;  2DL5 A;  3TVT A;  2KGT A;  1B3Q A;  2ENM A;  4X1V A;  1SEM A;  2DNU A;  2J06 A;  2GGR A;  2DA9 A;  4HCK A;  1X27 A;  3VRZ A;  2M51 A;  2EYY A;  2D8H A;  1M27 C;  3A98 A;  3UA7 A;  3M0P A;  1K9A A;  2FRW A;  2A36 A;  3IQL A;  3EG0 A;  1HJD A;  1EFN A;  2EBP A;  5EC7 A;  2H8H A;  3NGP A;  2OJ2 A;  4AFS C;  1OEB A;  1M3C A;  1UGV A;  4AG1 C;  2LJ1 A;  2CUB A;  2A08 A;  3I5R A;  1M30 A;  2K3B A;  1IO6 A;  2V1R A;  1GCQ C;  3PVQ A;  4JZ4 A;  2X3W D;  2KR3 A;  1Y0M A;  2O9S A;  1T3S A;  1UFF A;  2L2P A;  2O9V A;  2DMO A;  2CH4 A;  2RQW A;  3SEM A;  1SHF A;  2F2V A;  1AWO A;  1GCQ A;  3U23 A;  4FSS A;  2AZS A;  2JMC A;  1UG1 A;  1VYT A;  4JZ3 A;  1AWW A;  3O5Z A;  4J9I A;  1T3L A;  4GBQ A;  1GBR A;  4J9D A;  2MCN A;  3VS6 A;  1YN8 A;  2F2W A;  2V1Q A;  2PNI A;  1JO8 A;  2DRM A;  2DYB A;  2K7A A;  2RQU A;  4F17 A;  1WLP B;  1YP5 A;  2GNC A;  3KFV A;  1NYF A;  4Z88 A;  2EGC A;  1G83 A;  1N5Z A;  1NEB A;  1AWJ A;  3H0I A;  2YT6 A;  1X6G A;  2AKK A;  1X69 A;  3VS1 A;  1NEG A;  1JU5 C;  1Z9Q A;  4J9H A;  1WI7 A;  2OAW A;  4D8K A;  1KSW A;  1ZUK A;  1M8M A;  1YNZ A;  2ECZ A;  1RUW A;  3EHQ A;  3H41 A;  3EGU A;  1WXT A;  2A28 A;  4HXJ A;  4Z8A A;  1Y57 A;  1M3B A;  4ORZ A;  1SRL A;  2JS2 A;  2DL4 A;  4RTZ A;  1BK2 A;  4M4Z A;  2K6D A;  2KXD A;  2RQT A;  1UHC A;  2DL3 A;  4JJC A;  2O2O A;  2JT4 A;  2PTK A;  2EVR A;  2FPE A;  2RN8 A;  2EYX A;  1AD5 A;  1SRM A;  5IH2 A;  2CDT A;  4F14 A;  1U5S A;  2GBQ A;  4D8D A;  2NWM A;  4OML A;  2RQR A;  4OMM A;  4OMO A;  1AWX A;  1ABO A;  3EG2 A;  4RTY A;  5HCK A;  1H92 A;  1H8K A;  2K79 A;  2YDL A;  1RLQ C;  1GFD A;  2CT4 A;  5IXF A;  3M0R A;  2KYB A;  4WCI A;  2RQV A;  1WXB A;  1BU1 A;  5GJV B;  2X3X D;  1U3O A;  1ZX6 A;  2GQI A;  4J9C A;  2DL7 A;  3I5S A;  1NYG A;  1VA7 A;  2J6K A;  1UJ0 A;  4QT7 A;  4R0K A;  2BTT A;  1HSQ A;  1WFW A;  4J9F A;  4EIK A;  1QWE A;  2SEM A;  1WA7 A;  3M0T A;  2LMJ A;  1QWF A;  2I0N A;  1QLY A;  1NG2 A;  2K9G A;  1YWO A;  2SRC A;  1OOT A;  2DJQ A;  3REA B;  3RNJ A;  2JXB A;  1SSH A;  2A37 A;  1ZSG A;  3R6N A;  1NLP C;  2C0T A;  1NM7 A;  1U06 A;  1I0C A;  3NHN A;  2D0N A;  1GL5 A;  3EHR A;  2KRO A;  4LN2 A;  2GTJ A;  2G6F X;  3PE0 A;  1PKT A;  4KRT A;  4OMQ A;  2J6O A;  1QCF A;  3M0U A;  1UEC A;  1CKB A;  2DLP A;  3I9Q A;  2AK5 A;  2LP5 A;  2HBW A;  3FJ5 A;  1A0N B;  1S1N A;  4GLM A;  1AEY A;  1ZBJ A;  2ABL A;  4HVV A;  5L23 A;  2O31 A;  4OMN A;  4ZNX A;  2JMA A;  1PRM C;  2J05 A;  2NUZ A;  2LCS A;  1TG0 A;  1PWT A;  1W6X A;  3JV3 A;  2KT1 A;  1WIE A;  1GRI A;  3REB B;  2E5K A;  1WYX A;  2FO0 A;  4JJD A;  1WXU A;  2EYW A;  2IIM A;  2KEA A;  4HVU A;  5FWC A;  1KIK A;  3THK A;  2KYM A;  1GCP A;  4RTW A;  4JJB A;  2KXC A;  4RUG A;  2BZY A;  2FPD A;  2KRM A;  4RTT A;  1ZUU A;  2J6F A;  1B07 A;  2KBT A;  2L0A A;  3NMZ C;  3RBB B;  1YWP A;  2K2M A;  1TUC A;  2L3P A;  4F16 A;  2RF0 A;  1JXO A;  4RTU A;  2D1X A;  4CC7 A;  5GJW B;  1W1F A;  4J9G A;  2HDA A;  2ESW A;  1E6G A;  3C0C A;  2EYZ A;  2LQW A;  4CC3 A;  1I07 A;  1BBZ A;  2VVK A;  3EG1 A;  1GFC A;  2PZ1 A;  4AG2 C;  4Y92 A;  3TSZ A;  2DX1 A;  1M3A A;  1GBQ A;  2YUN A;  1WX6 A;  1JXM A;  1KFZ A;  5IHN A;  4LUE A;  1YCS B;  1XOV A;  3M0Q A;  1TUD A;  1OPK A;  2HCK A;  3H0H A;  1UE9 A;  1AVZ C;  4AFQ C;  1JQQ A;  3UF4 A;  2RMO A;  3EG3 A;  1ZUY A;  2JM9 A;  4K11 A;  1RI9 A;  2ED0 A;  2DBK A;  1UJY A;  5ECA A;  1OV3 A;  2O88 A;  1PKS A;  2HEQ A;  4CC4 B;  4DEY A;  1HD3 A;  5IHK A;  4J9B A;  4LUD A;  3UA6 A;  3M0S A;  1G2B A;  1FMK A;  1FYN A;  4HVW A;  2JTE A;  1AZG B;  2CRE A;  3VS2 A;  4E6R A;  2DIL A;  4Z89 A;  2YUP A;  2B86 A;  2GTO A;  5I22 A;  1VYV A;  3ZL7 C;  2ED1 A;  2AKL A;  2LNH B;  1KJW A;  4CC2 A;  2C0I A;  5FW9 A;  3VS3 A;  4RTV A;  2FPF A;  1PHT A;  5I11 A;  1T0J A;  3PVL A;  1X43 A;  1UDL A;  1JEG A;  1PNJ A;  3H0F A;  2F2X A;  5IHI A;  1VYU A;  1MV3 A;  1AOJ A;  3LH5 A;  2L3S A;  2QDL A;  2MOX A;  2JM8 A;  2FEI A;  2EW3 A;  4J9E A;  2DM1 A;  2JS0 A;  2LZ6 B;  1PRL C;  1X6B A;  2CT3 A;  2M0Y A;  2EGA A;  4LNP A;  1K4U S;  2DBM A;  1LCK A;  3VS5 A;  3QWX X;  1X2Q A;  1K1Z A;  2YUO A;  1MUZ A;  2HSP A;  1UHF A;  1K0S A;  2DL8 A;  1BB9 A;  4IIM A;  3ULR B;  2DRK A;  2EPD A;  1RLP C;  2EGE A;  2W0Z A;  2FRY A;  2LJ3 A;  3VS7 A;  2RNA A;  1QKX A;  2EKH A;  2KRN A;  2J7I A;  2CUD A;  1ARK A;  2MIO A;  3TSW A;  2C0O A;  2CSQ A;  4LE9 A;  1V1C A;  2W10 A;  3QWY A;  4AFU C;  2KE9 A;  2LX7 A;  1W70 A;  1K76 A;  2DVJ A;  1T0H A;  4DEX A;  1E6H A;  5FWB A;  1I1J A;  5IXB A;  4AFZ C;  4A63 B;  3CQT A;  2XMF A;  2LJ0 A;  1WDX A;  1UUE A;  2P4R A;  1QKW A;  3NPF A;  2ROT A;  2L3Q A;  2JW4 A;  2ROL A;  1CKA A;  1K0X A;  4OMP A;  3VRY A;  1UTI A;  2VKN A;  2EQI A;  3SHW A;  2KT8 A; 
#chains in the Genus database with same CATH topology
 2D6F A;  1X2K A;  3SWN B;  3VS0 A;  1TOV A;  5LJ3 e;  1YFN A;  4J6X A;  2K5I A;  4FSX A;  1OX8 A;  2VWF A;  1ZLM A;  1ZQ1 A;  3VJP A;  3HHT B;  1ZSZ C;  1KK7 A;  1K8A U;  1SHG A;  2AZV A;  5KYX B;  1Z9Z A;  2K4Y A;  2RPN A;  1IB8 A;  3GLX A;  4P5N A;  2FZG B;  1TS9 A;  4XAX B;  3HPW A;  2VGM A;  3G6E T;  2E65 A;  2ENM A;  3MPU B;  1DJ7 B;  4NL2 A;  3CCJ A;  4KH0 B;  2RHI A;  3EH1 A;  3OY9 A;  1TUG B;  2EYY A;  2M51 A;  8ATC B;  3OB9 A;  4M7D C;  4N4G A;  3FIF A;  3A98 A;  3JCM W;  3UA7 A;  3M0P A;  4B6M A;  3CCR A;  3RUX A;  2A36 A;  2VGN A;  2E10 A;  2H8H A;  1G3W A;  2OJ2 A;  2HQH A;  4AFS C;  4OF1 A;  3QXE B;  2LJ1 A;  1M4Z A;  4RCC A;  4O5V A;  1VQ4 T;  2CKK A;  2ZGW A;  1WHJ A;  4XU2 A;  2L2P A;  4JS4 A;  3JCM c;  2PUO B;  1K73 U;  4LDW A;  3AHU A;  1M8V A;  2JMC A;  2E1H A;  2P0Q A;  2DO3 A;  3QO3 A;  3M54 A;  2GCX A;  4JZ3 A;  1K9M U;  3O5Z A;  2EWN A;  4J9I A;  1PCX A;  3SB2 A;  3INZ A;  1QVF S;  2K7A A;  3E1S A;  2RJC A;  2K3Y A;  1W2B S;  2HD0 A;  1YP5 A;  3CBO A;  4PKC C;  5FU6 C;  1NPP A;  4BY6 C;  2EGC A;  1G83 A;  4KT0 E;  1N8R C;  3RKY A;  1N5Z A;  4FT2 A;  3QSU A;  1AWJ A;  2AKK A;  3JCM V;  3HFN A;  5HK3 A;  3VS1 A;  1KQS P;  2R5M A;  1JU5 C;  1M90 U;  3JCM h;  4F7U B;  4IUV A;  3VKI A;  5KYW B;  2OTL T;  3I55 A;  1YNZ A;  2ECZ A;  3EHQ A;  3G1J A;  1WXT A;  5KYU B;  4Z8A A;  1SG5 A;  1Y57 A;  3M5A A;  2LX9 A;  4RTZ A;  2MAM A;  5KYY B;  3EFS A;  3KXT A;  5DLQ E;  1FX7 A;  4M78 C;  4F7U E;  1NJI C;  2AT1 B;  2DL3 A;  5CIU A;  3S6W A;  3J7A F;  2DXT A;  1N27 A;  2EJF A;  4NL3 A;  5GAM f;  2CDT A;  1I81 A;  4F14 A;  2RO0 A;  3RKX A;  1ACM B;  1Q86 R;  4HCC A;  4Z02 A;  2H3E B;  4C5H A;  1VQ8 Q;  3MHX A;  1ABO A;  3A8H B;  2PUK B;  2NLU A;  3CPF A;  3EG2 A;  4RTY A;  5D6W A;  2K79 A;  2XIC A;  1RLQ C;  5GAN g;  5GAN 8;  2QAS A;  2QK0 A;  4IUR A;  1B7T A;  4F7U A;  5LJ5 e;  1UB4 A;  2RQV A;  1WXB A;  1X01 A;  4D6W A;  5KYW A;  5KCO A;  4M77 F;  1UJ0 A;  2YRD A;  5KYU A;  4OGC A;  1Y71 A;  1VQ6 A;  3CCE A;  1I4K 1;  4MMK A;  2CYZ B;  1VUB A;  5KYY A;  1YCY A;  5GAN f;  3RNJ A;  2DTI A;  5GAN 2;  4ZTJ A;  4PFZ A;  4C92 F;  2MF2 A;  2QI2 A;  3E19 A;  1I0C A;  1GL5 A;  3CC7 Q;  2GTJ A;  3PE0 A;  1JRI A;  2FZC B;  1QVG S;  4L59 A;  5D7U A;  1S1N A;  3PTA A;  1AEY A;  1JBM A;  3TU4 K;  2OTJ Q;  3CPW A;  4LXC A;  2CP3 A;  2O31 A;  3EG9 B;  4A4E A;  2J05 A;  4M77 G;  4BE1 A;  2HZY A;  2LCS A;  3CC2 A;  1W6X A;  1WIE A;  1GRI A;  1VQ7 A;  3M59 A;  4E7Z A;  4JJD A;  3CC2 T;  2KEA A;  2QGF B;  4HVU A;  1ZA2 B;  1KIK A;  3ZEH A;  3THK A;  3OSV A;  4C92 G;  4ME7 A;  4JJB A;  4BD3 A;  4RUG A;  2CP7 A;  2LT1 A;  2DEU A;  1M2V B;  2BZY A;  2V8K A;  3OS1 A;  1N9R A;  2E3H A;  3NMZ C;  3RBB B;  5LJ3 h;  4KUD K;  1YWP A;  2XDP A;  1JB0 E;  4F16 A;  1QVF P;  4RTU A;  4E7S A;  3FDR A;  4LDY A;  1W2B P;  3X24 B;  1AHJ B;  3X26 B;  1E6G A;  5CK9 A;  2QEX Q;  4J6W A;  3V8L A;  4MZT A;  1BBZ A;  3X25 B;  2HKN A;  1XNI A;  1JJ2 S;  1MGQ A;  3M0Q A;  2CP5 A;  2XHC A;  3PGG A;  3H0H A;  1AVZ C;  1BKB A;  1JQQ A;  3EG9 A;  3UF4 A;  4DBQ A;  2RMO A;  4C92 D;  2KI7 A;  2XU8 A;  4HA8 A;  4M7D F;  5GMK e;  1ZUY A;  3OS2 A;  5LJ5 f;  4K11 A;  4DOV A;  3JSC A;  1YIJ Q;  3BFM A;  2RJD A;  3HL8 A;  2PVO B;  4CC4 B;  4M7A C;  4PJO C;  1N9S A;  1HD3 A;  4YTL A;  3UA6 A;  1G2B A;  1VQM Q;  3M4Y A;  1IHV A;  2JTE A;  1M2V A;  1GXI E;  4QQ6 A;  2V8J A;  2GTO A;  2JTM A;  3V8J A;  1YIT A;  2AKL A;  5HK0 A;  5GAO q;  4CI0 C;  5GAO m;  1Q86 C;  2DXU A;  3GPL A;  1D0X A;  4OB2 B;  3VYH B;  1F1B B;  4JJN K;  2L89 A;  4FYV B;  1YJN Q;  4M7D G;  3CCQ A;  3OYK A;  2FPF A;  1PHT A;  3VU3 C;  1T0J A;  1B34 B;  3HRU A;  1X43 A;  2NUT B;  2L8D A;  1W4S A;  3CCM A;  2JJ9 A;  2XD0 A;  1VYU A;  2LNV A;  2L3S A;  2QDL A;  4BDY A;  2JM8 A;  2FEI A;  1RAH B;  3QPH A;  2JS0 A;  2PVG B;  3FC3 A;  1X6B A;  4C0F A;  4LNP A;  2M0O A;  1K4U S;  3CC7 T;  4RG2 A;  1MMD A;  4BE2 A;  5GAO p;  1WJR A;  1RAD B;  1PSE A;  1UGS B;  4FW1 A;  2YUO A;  2FB7 A;  2YLB A;  2HQX A;  1UHF A;  1OI1 A;  6AT1 B;  3CCU Q;  2FYK A;  4IIM A;  4BI8 B;  3WVD B;  5KE3 A;  4M7D D;  2LJ3 A;  4DBH A;  2RNA A;  4QQG A;  2X9H A;  2VYT A;  4QVZ A;  1QVG P;  4M78 F;  2QG9 B;  5GAO r;  4J7F A;  1V1C A;  3FRN A;  2KE9 A;  5D6Y A;  3P8B B;  2DVJ A;  3E9F A;  1PD1 A;  3PT9 A;  3OW2 A;  1MND A;  4KUL A;  2X35 A;  1I1J A;  4A63 B;  3RR6 A;  1B34 A;  1BYM A;  2XMF A;  2LJ0 A;  1WDX A;  4BI4 A;  2NUT A;  1D09 B;  1QKW A;  1I5O B;  2K5L A;  3CME Q;  2L3R A;  2ROT A;  3E9G A;  2AIR B;  2DD4 A;  1KQ1 A;  2E41 A;  2ZPE B;  2QYZ A;  1BI3 A;  2LTO A;  2VXF A;  2KVQ G;  4ZGE B;  3A1P A;  3VRY A;  1Q82 U;  3A8O B;  2RA2 A;  3MET A;  4RTX A;  4XU3 A;  1IGQ A;  3GBQ A;  3I35 A;  3L2Z A;  3L2Q A;  2E3I A;  4M78 G;  3QHS A;  2E6N A;  3Q1J A;  4C0D C;  2KRS A;  3JB9 I;  5LJ5 h;  2DF6 A;  1MV0 B;  2P84 A;  4OVA A;  1VQN Q;  4JRP A;  4XTZ A;  3CC4 Q;  2LCC A;  3M53 A;  4BAC A;  2HKQ B;  1NLO C;  4MZM A;  1OPL A;  4M75 B;  1PSF A;  1YIJ T;  2BZX A;  1MMN A;  1SPK A;  1JJ2 P;  3TVT A;  3OYB A;  1SEM A;  1VQ5 Q;  1VQM T;  2GGR A;  2DA9 A;  4XQ3 A;  1C6V X;  4PJL A;  2EQK A;  3VRZ A;  5GAM j;  3LWI A;  4M75 E;  4F04 B;  2QA4 A;  5M9O A;  1M27 C;  1WGS A;  2QTX A;  3J81 E;  4M78 D;  4OP0 A;  3QJ6 A;  3OS0 A;  1G3T A;  4MML A;  4XU0 A;  3CD6 Q;  3EG0 A;  2FL7 A;  1QCO A;  3M56 A;  1HJD A;  1YJN T;  1WHM A;  3NGP A;  4CRI A;  1OEB A;  2WSF E;  1KG1 A;  2A08 A;  4EMG A;  1M30 A;  2A3L A;  3QJY A;  2BUD A;  4FYX B;  2V1R A;  2ZCF B;  4JZ4 A;  1R8O B;  4A53 A;  1WHL A;  2KR3 A;  1G8X A;  5GAM d;  1PD0 A;  1P92 A;  4M77 C;  2CH4 A;  1RAI B;  3SEM A;  1VQK Q;  2LRQ A;  3MP6 A;  1AWO A;  1GCQ A;  2PU9 B;  2IG0 A;  4HCZ A;  3U23 A;  4FSS A;  4M75 A;  3JB9 H;  2AZS A;  2QGG A;  1RL2 A;  1UG1 A;  3G71 Q;  5GAN j;  4GBQ A;  4OB3 B;  3OYH A;  2MCN A;  1YN8 A;  2V1Q A;  2PNI A;  3F70 A;  1VQO Q;  1YHQ Q;  2Y90 A;  2AHJ B;  1WLP B;  3KFV A;  3QDF A;  4Z88 A;  4NOY A;  2D9T A;  1M1K R;  1UEB A;  3H6Z A;  7AT1 B;  4JDS A;  3H0I A;  4OMF B;  2KDS A;  1NJI R;  3JCM f;  1X69 A;  2F69 A;  5DLO A;  5KYN A;  1Z9Q A;  1AT1 B;  1MMA A;  4D8K A;  2DZ9 A;  1KSW A;  1ZUK A;  5GAN d;  5GMK i;  1KQS A;  3PIP A;  1M8M A;  3CMA Q;  5GMK h;  1RUW A;  3H41 A;  2A28 A;  4XTX A;  4PJO F;  2JS2 A;  1BK2 A;  2K6D A;  2P0K A;  4EMK C;  1D0Y A;  2RD1 A;  2LC4 A;  2KXD A;  2O01 E;  3L2V A;  4HT9 A;  2O2O A;  1Y7X A;  3DB3 A;  5CKD A;  3T9N A;  3G6E A;  2FHD A;  3JB9 F;  5CQX A;  3DLL A;  4D8D A;  2MI6 A;  5KE2 A;  4C0G A;  1U8R A;  3CC4 T;  1R0C B;  2M02 A;  3TQ7 P;  4M7A G;  4IUU A;  4PJO G;  1H92 A;  2VXE A;  1H8K A;  2YDL A;  2EKO A;  4LDU A;  1GFD A;  1OYX A;  1WQ7 A;  3M0R A;  3OYI A;  5LJ5 j;  1BU1 A;  5GJV B;  3DLM A;  2DL7 A;  4FU6 A;  3D7S B;  1VQ4 A;  3L2U A;  4R0K A;  1WFW A;  4J9F A;  3ME9 A;  1V29 B;  1QWE A;  2EAY A;  4MZP A;  1RAA B;  3M0T A;  2LMJ A;  1QWF A;  2R58 A;  1R77 A;  1NG2 A;  5A0G A;  4TVR A;  2K9G A;  5AYF A;  2K2V A;  4N0A C;  3REA B;  3CD6 T;  1XQH A;  3LYI A;  3JCM X;  2A37 A;  1G3S A;  1ZSG A;  3R6N A;  1U06 A;  2XK0 A;  3NHN A;  3C95 A;  1SSF A;  2WSE E;  1VIE A;  4OMQ A;  4M7A D;  2QQS A;  5GAN 7;  4PJO D;  2Z0W A;  2J6O A;  1QCN A;  2KSS A;  3M0U A;  2E4H A;  1CKB A;  2DLP A;  3I9Q A;  2AK5 A;  3FJ5 A;  5LL6 S;  3NTH A;  2ABL A;  1D1C A;  5GAO n;  2K3X A;  3L42 A;  3C4S A;  2DYI A;  4OMN A;  1XJW B;  5CKF A;  5GAN 6;  1O75 A;  3X20 B;  1VQP Q;  1TG0 A;  3G71 T;  1PWT A;  2KT1 A;  3REB B;  2E5K A;  4O6J A;  3UDC A;  2EYW A;  1VQO T;  2IIM A;  3SFM A;  3PNW C;  2KYM A;  2OTL A;  1GCP A;  4RTW A;  3QYH B;  2COY A;  2KXC A;  2DXC A;  5LJ3 f;  2V26 A;  4IUQ A;  3OBY A;  1QP2 A;  1I8F A;  2KRM A;  3BDU A;  3OMC A;  4RTT A;  3OS5 A;  2OAU A;  5AT1 B;  3G4S A;  3JAM E;  1RAE B;  2CZ1 B;  3OYN A;  3L2R A;  4E7J A;  3MCA B;  5GAM g;  1JXO A;  1W1F A;  4J9G A;  2HDA A;  2MK5 A;  3G4S T;  2ESW A;  1M1K C;  1BI2 A;  5CKE A;  3JCM Q;  2YHT A;  1QVF A;  3CMA T;  2VB6 A;  2LQW A;  2XID A;  1I07 A;  2DVE A;  3G7Z A;  4DBR A;  1GFC A;  1W2B A;  4AG2 C;  3PMT A;  3TSZ A;  1QW1 A;  2DX1 A;  5DY9 A;  2HQE A;  2JOY A;  1JXM A;  5IHN A;  4LUE A;  2DKG A;  3CCL Q;  2XG8 D;  1TUD A;  1UE9 A;  1Q7Y U;  4ZN1 A;  4E7H A;  1EZZ B;  1YI2 Q;  3EFO B;  2PQW A;  1RI9 A;  5GMK j;  1HXD A;  3BE3 A;  1HK9 A;  2O88 A;  3RKW A;  3NTI A;  3S3M A;  1WJS A;  3OYY A;  4A4K A;  4DEY A;  4LUD A;  4E47 A;  3M0S A;  4ZGJ B;  1IXD A;  1FMK A;  1FYN A;  1YJ9 Q;  3TRE A;  5KH6 A;  4M77 B;  2RJF A;  2YUP A;  2B86 A;  1ZBX A;  1FMW A;  5C6S A;  4CC2 A;  4FL6 A;  3S3N A;  1D1A A;  3KUF A;  2IPO B;  3NTK A;  4FIB A;  4C92 B;  1D1B A;  3BDL A;  1XTD A;  5I11 A;  3M9Q A;  3PVL A;  3EAE A;  4M77 E;  4A4G A;  1OZ2 A;  1H3Z A;  5CAI A;  2QTV A;  3OYM A;  4GLK A;  1PM3 A;  2F2X A;  3FB9 A;  5FU7 B;  3P8H A;  4ZN3 A;  3OBW A;  3OSS C;  1K8A R;  2MOX A;  3EGX B;  2VUB A;  2DM1 A;  3V8K A;  3EFO A;  1PRL C;  4C92 E;  4PL6 A;  3I56 Q;  4BE0 A;  2M0Y A;  2EGA A;  5GAN 3;  1YJW Q;  1LNX A;  4UC4 A;  5D6X A;  3PMI A;  3VS5 A;  3QWX X;  2DIQ A;  3OYE A;  1X2Q A;  1K1Z A;  4XTU A;  3HKS A;  1BB9 A;  2DRK A;  4HKE A;  2EGE A;  2W0Z A;  4M77 A;  3MKD A;  3ZBD A;  3JCM J;  1QKX A;  1VQP T;  2KRN A;  4PLI A;  2J7I A;  2KMT A;  5EG2 A;  4JRQ A;  2MIO A;  1ARK A;  2C0O A;  3HFO A;  1SKU B;  1IHW A;  4DOW A;  4LE9 A;  3QWY A;  2E64 A;  4GY5 A;  1ZSZ B;  1BCM A;  4DEX A;  1PC0 A;  5FWB A;  4C92 A;  4BDZ A;  1VQ9 Q;  3A8L B;  1QVG A;  2EQJ A;  1M5Q 1;  1QQJ A;  4XTW A;  5LJ5 g;  3HP9 A;  2P4R A;  4E2F B;  3RER A;  3GF5 A;  4RMO A;  3NPF A;  4M77 D;  2I2L A;  3CEY A;  1K73 R;  1VQL Q;  3EGX A;  4B9X A;  4RG8 A;  1UTI A;  2VKN A;  4M7D B;  4JPB W;  4E7K A;  1D3B B;  2D8J A;  1VIF A;  1E7O A;  1BCO A;  2CH4 W;  8AT1 B;  2DTH A;  2NUP A;  3QUI A;  1AZE A;  1WJQ A;  1IZ6 A;  1X75 C;  3CCL T;  4J7I A;  2DEQ A;  2YUQ A;  2DE0 X;  1VQ8 A;  1Q81 C;  1YI2 T;  1CSK A;  4M7D E;  4LD6 A;  1C1A A;  2DFU A;  3UAT A;  2K5F A;  4HT8 A;  1QP3 A;  4OB0 B;  1VQ8 T;  1MHN A;  3CCV Q;  3PFS A;  2KNB B;  2KY9 A;  2DL5 A;  3FJP A;  1N8R U;  2KGT A;  3JCM d;  1ZSZ A;  1B3Q A;  1IRX A;  2O4X B;  4C8Q F;  2J06 A;  4L5G A;  1S72 Q;  2CP0 A;  1JJ2 A;  4ATO A;  2DIG A;  2RH2 A;  1YJ9 T;  4HCK A;  4KGX B;  1X27 A;  2OX7 A;  3E2U A;  3UWN A;  2QQR A;  1IRE B;  4XU1 A;  3C94 A;  3SWN C;  4EDU A;  5FU6 B;  3LW5 E;  4BY6 B;  2FRW A;  9ATC B;  4EMH A;  2DK3 A;  2P0P A;  3OYJ A;  4NS5 A;  5CR2 A;  1EFN A;  4M7D A;  3MJX A;  1M1K U;  5IAY A;  3CC7 A;  1MNE A;  1M3C A;  1D0Z A;  1D3B A;  3AT1 B;  1KC8 R;  3I5R A;  3JRZ A;  2RK2 A;  2RK1 A;  4PFP A;  2HL3 A;  1NJI U;  1IO6 A;  3N5B B;  3PVQ A;  3DB4 A;  4PFO A;  1Y0M A;  2O9S A;  4N4I A;  4ANJ A;  4C8Q G;  1SF9 A;  2OTJ A;  2O9V A;  3ASK A;  2RQW A;  4PNO A;  1SHF A;  2E6Z A;  4IUT A;  2F2V A;  3I56 T;  2NYS A;  2OTJ T;  3LH0 A;  1OU8 A;  4J5Y A;  4J9D A;  3DKM A;  4HCB A;  4M78 B;  3VS6 A;  2F2W A;  2O4X A;  2C06 A;  1JO8 A;  4XTV A;  1K8A C;  2DYB A;  2PVD B;  4BB7 A;  2JTF A;  3CBP A;  2GNC A;  1TTH B;  2MPX C;  1NYF A;  2ZAE A;  4QW2 A;  1IGU A;  1WHG A;  1HYO A;  1X6G A;  3JCM P;  4M78 E;  5L8R E;  5A0L A;  2VV5 A;  4X9D A;  4J9H A;  1WI7 A;  2OAW A;  2ATC B;  2QEX A;  1VQ9 T;  5FRN A;  3CCS Q;  2Y4X A;  3QBY A;  3OYC A;  3HTR A;  2QEX T;  3GIB A;  4BI3 A;  2BIV A;  4HXJ A;  1M3B A;  1SRL A;  2DL4 A;  2F5T X;  2DTO A;  5LJ3 j;  2BE7 D;  3EGD B;  5J39 A;  4JJC A;  1YIJ A;  3OYG A;  2PTK A;  2EVR A;  2FPE A;  2RN8 A;  3FEO A;  4Y28 E;  1AD5 A;  4IUP A;  4M78 A;  1K73 C;  3MEU A;  5J26 A;  1KHI A;  2GBQ A;  5CQY A;  1VQM A;  2H3J A;  4X9C A;  1AWX A;  3QDR B;  3LWH A;  1TSF A;  5LJ3 d;  1N6A A;  3CCV T;  4N4H A;  5IXF A;  4C5G A;  1YJN A;  2X3X D;  2ZPB B;  5GAO l;  1U3O A;  4J9C A;  3QKJ A;  3I5S A;  3CCJ Q;  2J6K A;  4FYY B;  4QT7 A;  3VUZ A;  4X34 A;  4BUG A;  1HSQ A;  4EIK A;  2SEM A;  2I0N A;  1YWO A;  4C0Z A;  1FXX A;  2SRC A;  2RHX A;  2JXB A;  3CCR Q;  3EGD A;  3QZ9 B;  2MWP A;  3OYA A;  2LQ8 A;  1NLP C;  1NM7 A;  2D0N A;  5I21 A;  2KRO A;  4LN2 A;  4KRT A;  2RHU A;  3JCM g;  1QCF A;  3CCU A;  3TCJ A;  2LP5 A;  2QAZ A;  2HBW A;  1PG5 B;  4QQD A;  2GFU A;  3CCU T;  1KC8 C;  2JMA A;  1PRM C;  4JRK A;  5KCH A;  3QII A;  1RAG B;  2LDM A;  2L5Q A;  2DET A;  1WXU A;  5FWC A;  2EQM A;  5GAN 5;  2EFI A;  3SDZ A;  4R56 A;  1RAB B;  3WVE B;  4A54 A;  1Q86 U;  4KH1 B;  1H64 1;  2FPD A;  4M7A B;  2CP2 A;  3CME A;  1ZUU A;  2J6F A;  2RHY A;  4PJO B;  2L0A A;  2K2M A;  1TUC A;  2A0F B;  2MMP A;  2L3P A;  5DM7 R;  5GJW B;  5FRM A;  4KBM B;  3CME T;  2WSC E;  3CCS T;  2V8I A;  3UT1 A;  4CC3 A;  2VVK A;  3EG1 A;  2PZ1 A;  3I55 Q;  4M7A E;  4PJO E;  2JUF A;  2KK4 A;  1GBQ A;  3OMG A;  1KFZ A;  3WXM B;  1VQN A;  1XOV A;  1OPK A;  2HCK A;  2GQV A;  3CC4 A;  1QMC A;  3QG1 A;  4XK8 E;  3EG3 A;  1VQN T;  3GP8 A;  1Q95 G;  5J3B A;  2ED0 A;  1TH7 A;  3RMQ A;  2DBK A;  1UJY A;  5ECA A;  1OV3 A;  1OUL A;  2HEQ A;  4QKU A;  4JLG A;  1VQ5 A;  2RI5 A;  5IHK A;  4HVW A;  4FW2 A;  3OQ5 A;  3JB9 J;  2RI3 A;  1VQ5 T;  2JNG A;  4M7A A;  3EFR A;  4PJO A;  4WTO B;  5I22 A;  2XDB A;  2RB6 A;  3ZL7 C;  2ED1 A;  2LNH B;  1BIA A;  3CD6 A;  2X4Y A;  1Q82 R;  5GAM e;  5GMK m;  3JB9 G;  5FW9 A;  4FCY A;  2COZ A;  3H9N A;  3ZFJ A;  3VS3 A;  3CCJ T;  4RTV A;  2CZ7 B;  3ER0 A;  4JS5 A;  1UDL A;  4C8Q C;  4ZGD B;  2M9U A;  1VQ6 Q;  3CCE Q;  5LJ5 d;  1QVP A;  5IHI A;  1AOJ A;  3LH5 A;  1VQK A;  3SWN A;  3CCR T;  2CT3 A;  4FYW B;  1Y07 A;  5LJ3 g;  3G71 A;  1VQK T;  1LCK A;  1VQO A;  1YHQ A;  4XTY A;  3MEW A;  5KYX A;  3JB9 D;  3ULR B;  5CKH A;  5GAN e;  2EPD A;  3RES A;  1YHQ T;  4QVC A;  3QYG B;  3VS7 A;  1NE8 A;  4JUV A;  2EKH A;  1M1G A;  3KBG A;  4C0D B;  2CUD A;  3CC2 Q;  2W10 A;  2LX7 A;  1VQ7 Q;  1W70 A;  3EH2 A;  2XDD A;  2ZZD A;  2KAF A;  1NZ9 A;  5IXB A;  3CMA A;  2YRV A;  2ZPI B;  2DZC A;  3RMS A;  1UUE A;  2X4J A;  3MP8 A;  4C5I A;  1Q81 R;  3OA6 A;  1ZHI A;  2JW4 A;  2K57 A;  3CXC P;  2LQK A;  4F7U F;  1CKA A;  1R0B G;  1K0X A;  2EIF A;  4OMP A;  3SHW A;  4A4H A;  2BE9 B;  2RI2 A;  2YSQ A;  4WF2 A;  3I55 T;  3OYD A;  2CSI A;  1J3T A;  2XI9 A;  2VAS A;  4ESR A;  3MO8 A;  3R6O A;  2ZPF B;  2BZ8 A;  2FG0 A;  4J6Y A;  3M55 A;  3VS4 A;  1KC8 U;  4R55 A;  2KQW A;  1ABQ A;  4IIO A;  3MP1 A;  1KHC A;  1H3H A;  4E7L A;  2IVW A;  2LQN A;  3LLR A;  2OI3 A;  4PJN A;  3L1A A;  4DBF A;  4F7U G;  4X1V A;  2DNU A;  1YBY A;  1KD1 R;  2E12 A;  2G3R A;  1WNL A;  2D8H A;  2DPP B;  3OYL A;  1TWB A;  3CPW S;  1UGR B;  3V7C A;  1RI0 A;  2MWO A;  4E7I A;  1K9A A;  2MYS A;  5GMK l;  1YIT Q;  2CS7 A;  3IQL A;  5EC7 A;  2EBP A;  1OQK A;  3FLG A;  4EPC A;  3QZ5 B;  1UGV A;  4AG1 C;  3CCQ Q;  2CUB A;  3HRS A;  2K3B A;  4C5E A;  4Q5W A;  1M2O A;  1GCQ C;  2YLC A;  4M75 C;  2X3W D;  2EQU A;  1Q82 C;  1VQ6 T;  5A2Q E;  3CCE T;  3M4G A;  1T3S A;  1UFF A;  3CCM Q;  4KGZ B;  2DMO A;  2NUP B;  2F1L A;  1VQP A;  2E70 A;  1VYT A;  5CVI A;  1AWW A;  1T3L A;  1GBR A;  2DER A;  4EMK B;  4KGV B;  4RCB A;  1RAC B;  2DD5 A;  4V2S A;  1V76 A;  2DRM A;  3BW1 A;  5FLX E;  3JCM b;  2RQU A;  2YXY A;  1ZA1 B;  4OB1 B;  4F17 A;  3CBM A;  3M57 A;  2HMA A;  4QVD A;  1NEB A;  2CGH A;  4FM4 B;  2YT6 A;  3RDV A;  2VC8 A;  2DAQ A;  1NEG A;  5CO7 A;  1VQ7 T;  2RJE A;  2P4T A;  5C0M A;  5CKB A;  5HKC A;  2QQA A;  3BY7 A;  3V7S A;  1KQ2 A;  2X4W A;  4A4F A;  3EGU A;  1K9M R;  3GOX A;  4ORZ A;  3CCL A;  2HBP A;  4M4Z A;  1NBE B;  1YI2 A;  2RQT A;  1UHC A;  2JT4 A;  1U1T A;  5I2S A;  5HY6 A;  2GF7 A;  2EYX A;  4EMK A;  1SRM A;  4JLI A;  5IH2 A;  1WZO A;  1M90 R;  1U5S A;  1WHH A;  4J83 A;  2XKO C;  3SD4 A;  4C8Q B;  2NWM A;  4OML A;  3H8Z A;  2RQR A;  3GNF B;  5GAM h;  4J8O A;  1X6O A;  4OMM A;  1YJ9 A;  1FMV A;  4OMO A;  2E5Q A;  3VV0 A;  5HCK A;  2CZ0 B;  3J80 E;  1RAF B;  2CT4 A;  4LD9 K;  3VUB A;  2KYB A;  4WCI A;  2RHZ A;  4C8Q E;  1ZX6 A;  2FVU A;  2GQI A;  3L2W A;  4LDX A;  1MMG A;  4VUB A;  1TU0 B;  1NYG A;  1VA7 A;  3X28 B;  1WQW A;  2BTT A;  2EJ9 A;  2LT4 A;  2ZPH B;  1WA7 A;  1QLY A;  2QA4 Q;  4ELY C;  1YIT T;  1Q7Y R;  1KD1 C;  1LJO A;  2JN0 A;  3A8M B;  1OOT A;  2DJQ A;  1SSH A;  2WAC A;  3I56 A;  1YJW A;  2A7Y A;  5GAN h;  5CCA A;  4LDV A;  2C0T A;  3CCQ T;  3EHR A;  2G6F X;  1PKT A;  2YWW A;  3LGF A;  1WPY A;  4N0A A;  3OW2 S;  1YJW T;  3CPW P;  2FZK B;  1UEC A;  4C8Q A;  3CCM T;  1A0N B;  1NPR A;  4GLM A;  2CZ6 B;  1OU9 A;  1ZBJ A;  2QQB A;  5FRO A;  3LGL A;  4HVV A;  5L23 A;  4ZNX A;  3OYF A;  3VYG A;  2GFA A;  2NUZ A;  1OX9 A;  1LOJ A;  2LVM A;  1G3Y A;  3JV3 A;  2YRC A;  4PJJ A;  1WYX A;  5I2M A;  1LVK A;  2FO0 A;  4MDX A;  2Y4Y A;  1VQ9 A;  4B9W A;  3URG A;  5GAN 4;  1M9S A;  5IT9 E;  4PJM A;  4C8Q D;  1I5L A;  1B07 A;  2KBT A;  1VQL A;  2HAX A;  2RF0 A;  4CC7 A;  2D1X A;  2M16 A;  2JZ2 A;  1VQL T;  3C0C A;  1EX4 A;  1M1F A;  2EYZ A;  1O9S A;  1FWZ A;  2RM4 A;  4Y92 A;  3S3O A;  1M3A A;  3P8D A;  3V7R A;  2YUN A;  1WX6 A;  3A5Z B;  1YCS B;  3JCM e;  1C0M A;  4AFQ C;  3NFC A;  4PK4 A;  1K9M C;  2JM9 A;  3CCV A;  3PIO A;  3HRT A;  1UGQ B;  1PKS A;  1Y96 B;  3TEE A;  3G6E Q;  2EJG A;  4J9B A;  1S72 A;  4ELZ C;  1BI0 A;  1AZG B;  2CRE A;  3VS2 A;  4E6R A;  3RIR A;  1OZ3 A;  2DIL A;  2DJZ A;  4M75 F;  1S72 T;  4Z89 A;  2QXF A;  1EIF A;  1VYV A;  1G5V A;  1M90 C;  2R5A A;  4PLL A;  2QQ9 A;  1KJW A;  2HSE B;  4Y91 A;  3M58 A;  2EYQ A;  2B8A A;  2C0I A;  4KUI A;  2QDY B;  2X51 A;  4OGE A;  3HSB A;  4RKU E;  4DQ2 A;  4AMC A;  1VQ4 Q;  4FT4 A;  2D0Q B;  1JEG A;  1PNJ A;  3H0F A;  3MEA A;  2QA4 T;  1MV3 A;  2CP6 A;  2HNI A;  4AT1 B;  2X4X A;  2JVV A;  1WHK A;  2EW3 A;  4J9E A;  1BIB A;  2LZ6 B;  3UPU A;  4M75 G;  2DBM A;  1N8R R;  1Q81 U;  1Y96 A;  1Q7Y C;  1KQS S;  1MUZ A;  2HSP A;  1K0S A;  2LCL A;  2DL8 A;  4IKF A;  1UGP B;  1VOM A;  2DXB A;  2ZPG B;  1RLP C;  3CXC S;  5IN1 A;  1U1S A;  2FRY A;  4ZTF A;  4L6V 5;  4DA4 A;  4C92 C;  3OW2 P;  3TSW A;  1TXQ A;  2CSQ A;  4II1 A;  3GNG A;  3LX7 A;  4AFU C;  3MEV A;  4JRI A;  1K76 A;  3CCS A;  1T0H A;  1E6H A;  5A0D A;  2BKD N;  2F5K A;  5FU7 C;  4AFZ C;  3CQT A;  3A8G B;  2OTL Q;  4M75 D;  2COW A;  3O8V A;  3C12 A;  1BI1 A;  3G4S Q;  2HL5 C;  2L3Q A;  2R57 A;  2ROL A;  1KD1 U;  2M1H A;  4M7A F;  4MDW A;  1LPL A;  2EQI A;  2KT8 A;  3CXC A; 
#chains in the Genus database with same CATH homology
 2YSQ A;  4JPB W;  4RTX A;  1X2K A;  3VS0 A;  3GBQ A;  3I35 A;  2D8J A;  1E7O A;  2CH4 W;  2CSI A;  1AZE A;  1J3T A;  4ESR A;  2KRS A;  2YUQ A;  2DF6 A;  1MV0 B;  2DE0 X;  2BZ8 A;  2FG0 A;  2VWF A;  1ZLM A;  1NLO C;  1CSK A;  1OPL A;  1SHG A;  3VS4 A;  2AZV A;  3UAT A;  1Z9Z A;  2RPN A;  1ABQ A;  4IIO A;  2BZX A;  1H3H A;  2KNB B;  1SPK A;  2LQN A;  2OI3 A;  2DL5 A;  3TVT A;  2KGT A;  1B3Q A;  2ENM A;  4X1V A;  1SEM A;  2DNU A;  2J06 A;  2GGR A;  2DA9 A;  4HCK A;  1X27 A;  3VRZ A;  2M51 A;  2EYY A;  2D8H A;  1M27 C;  3A98 A;  3UA7 A;  3M0P A;  1K9A A;  2FRW A;  2A36 A;  3IQL A;  3EG0 A;  1HJD A;  1EFN A;  2EBP A;  5EC7 A;  2H8H A;  3NGP A;  2OJ2 A;  4AFS C;  1OEB A;  1M3C A;  1UGV A;  4AG1 C;  2LJ1 A;  2CUB A;  2A08 A;  3I5R A;  1M30 A;  2K3B A;  1IO6 A;  2V1R A;  1GCQ C;  3PVQ A;  4JZ4 A;  2X3W D;  2KR3 A;  1Y0M A;  2O9S A;  1T3S A;  1UFF A;  2L2P A;  2O9V A;  2DMO A;  2CH4 A;  2RQW A;  3SEM A;  1SHF A;  2F2V A;  1AWO A;  1GCQ A;  3U23 A;  4FSS A;  2AZS A;  2JMC A;  1UG1 A;  1VYT A;  4JZ3 A;  1AWW A;  3O5Z A;  4J9I A;  1T3L A;  4GBQ A;  1GBR A;  4J9D A;  2MCN A;  3VS6 A;  1YN8 A;  2F2W A;  2V1Q A;  2PNI A;  1JO8 A;  2DRM A;  2DYB A;  2K7A A;  2RQU A;  4F17 A;  1WLP B;  1YP5 A;  2GNC A;  3KFV A;  1NYF A;  4Z88 A;  2EGC A;  1G83 A;  1N5Z A;  1NEB A;  1AWJ A;  3H0I A;  2YT6 A;  1X6G A;  2AKK A;  1X69 A;  3VS1 A;  1NEG A;  1JU5 C;  1Z9Q A;  4J9H A;  1WI7 A;  2OAW A;  4D8K A;  1KSW A;  1ZUK A;  1M8M A;  1YNZ A;  2ECZ A;  1RUW A;  3EHQ A;  3H41 A;  3EGU A;  1WXT A;  2A28 A;  4HXJ A;  4Z8A A;  1Y57 A;  1M3B A;  4ORZ A;  1SRL A;  2JS2 A;  2DL4 A;  4RTZ A;  1BK2 A;  4M4Z A;  2K6D A;  2KXD A;  2RQT A;  1UHC A;  2DL3 A;  4JJC A;  2O2O A;  2JT4 A;  2PTK A;  2EVR A;  2FPE A;  2RN8 A;  2EYX A;  1AD5 A;  1SRM A;  5IH2 A;  2CDT A;  4F14 A;  1U5S A;  2GBQ A;  4D8D A;  2NWM A;  4OML A;  2RQR A;  4OMM A;  4OMO A;  1AWX A;  1ABO A;  3EG2 A;  4RTY A;  5HCK A;  1H92 A;  1H8K A;  2K79 A;  2YDL A;  1RLQ C;  1GFD A;  2CT4 A;  5IXF A;  3M0R A;  2KYB A;  4WCI A;  2RQV A;  1WXB A;  1BU1 A;  5GJV B;  2X3X D;  1U3O A;  1ZX6 A;  2GQI A;  4J9C A;  2DL7 A;  3I5S A;  1NYG A;  1VA7 A;  2J6K A;  1UJ0 A;  4QT7 A;  4R0K A;  2BTT A;  1HSQ A;  1WFW A;  4J9F A;  4EIK A;  1QWE A;  2SEM A;  1WA7 A;  3M0T A;  2LMJ A;  1QWF A;  2I0N A;  1QLY A;  1NG2 A;  2K9G A;  1YWO A;  2SRC A;  1OOT A;  2DJQ A;  3REA B;  3RNJ A;  2JXB A;  1SSH A;  2A37 A;  1ZSG A;  3R6N A;  1NLP C;  2C0T A;  1NM7 A;  1U06 A;  1I0C A;  3NHN A;  2D0N A;  1GL5 A;  3EHR A;  2KRO A;  4LN2 A;  2GTJ A;  2G6F X;  3PE0 A;  1PKT A;  4KRT A;  4OMQ A;  2J6O A;  1QCF A;  3M0U A;  1UEC A;  1CKB A;  2DLP A;  3I9Q A;  2AK5 A;  2LP5 A;  2HBW A;  3FJ5 A;  1A0N B;  1S1N A;  4GLM A;  1AEY A;  1ZBJ A;  2ABL A;  4HVV A;  5L23 A;  2O31 A;  4OMN A;  4ZNX A;  2JMA A;  1PRM C;  2J05 A;  2NUZ A;  2LCS A;  1TG0 A;  1PWT A;  1W6X A;  3JV3 A;  2KT1 A;  1WIE A;  1GRI A;  3REB B;  2E5K A;  1WYX A;  2FO0 A;  4JJD A;  1WXU A;  2EYW A;  2IIM A;  2KEA A;  4HVU A;  5FWC A;  1KIK A;  3THK A;  2KYM A;  1GCP A;  4RTW A;  4JJB A;  2KXC A;  4RUG A;  2BZY A;  2FPD A;  2KRM A;  4RTT A;  1ZUU A;  2J6F A;  1B07 A;  2KBT A;  2L0A A;  3NMZ C;  3RBB B;  1YWP A;  2K2M A;  1TUC A;  2L3P A;  4F16 A;  2RF0 A;  1JXO A;  4RTU A;  2D1X A;  4CC7 A;  5GJW B;  1W1F A;  4J9G A;  2HDA A;  2ESW A;  1E6G A;  3C0C A;  2EYZ A;  2LQW A;  4CC3 A;  1I07 A;  1BBZ A;  2VVK A;  3EG1 A;  1GFC A;  2PZ1 A;  4AG2 C;  4Y92 A;  3TSZ A;  2DX1 A;  1M3A A;  1GBQ A;  2YUN A;  1WX6 A;  1JXM A;  1KFZ A;  5IHN A;  4LUE A;  1YCS B;  1XOV A;  3M0Q A;  1TUD A;  1OPK A;  2HCK A;  3H0H A;  1UE9 A;  1AVZ C;  4AFQ C;  1JQQ A;  3UF4 A;  2RMO A;  3EG3 A;  1ZUY A;  2JM9 A;  4K11 A;  1RI9 A;  2ED0 A;  2DBK A;  1UJY A;  5ECA A;  1OV3 A;  2O88 A;  1PKS A;  2HEQ A;  4CC4 B;  4DEY A;  1HD3 A;  5IHK A;  4J9B A;  4LUD A;  3UA6 A;  3M0S A;  1G2B A;  1FMK A;  1FYN A;  4HVW A;  2JTE A;  1AZG B;  2CRE A;  3VS2 A;  4E6R A;  2DIL A;  4Z89 A;  2YUP A;  2B86 A;  2GTO A;  5I22 A;  1VYV A;  3ZL7 C;  2ED1 A;  2AKL A;  2LNH B;  1KJW A;  4CC2 A;  2C0I A;  5FW9 A;  3VS3 A;  4RTV A;  2FPF A;  1PHT A;  5I11 A;  1T0J A;  3PVL A;  1X43 A;  1UDL A;  1JEG A;  1PNJ A;  3H0F A;  2F2X A;  5IHI A;  1VYU A;  1MV3 A;  1AOJ A;  3LH5 A;  2L3S A;  2QDL A;  2MOX A;  2JM8 A;  2FEI A;  2EW3 A;  4J9E A;  2DM1 A;  2JS0 A;  2LZ6 B;  1PRL C;  1X6B A;  2CT3 A;  2M0Y A;  2EGA A;  4LNP A;  1K4U S;  2DBM A;  1LCK A;  3VS5 A;  3QWX X;  1X2Q A;  1K1Z A;  2YUO A;  1MUZ A;  2HSP A;  1UHF A;  1K0S A;  2DL8 A;  1BB9 A;  4IIM A;  3ULR B;  2DRK A;  2EPD A;  1RLP C;  2EGE A;  2W0Z A;  2FRY A;  2LJ3 A;  3VS7 A;  2RNA A;  1QKX A;  2EKH A;  2KRN A;  2J7I A;  2CUD A;  1ARK A;  2MIO A;  3TSW A;  2C0O A;  2CSQ A;  4LE9 A;  1V1C A;  2W10 A;  3QWY A;  4AFU C;  2KE9 A;  2LX7 A;  1W70 A;  1K76 A;  2DVJ A;  1T0H A;  4DEX A;  1E6H A;  5FWB A;  1I1J A;  5IXB A;  4AFZ C;  4A63 B;  3CQT A;  2XMF A;  2LJ0 A;  1WDX A;  1UUE A;  2P4R A;  1QKW A;  3NPF A;  2ROT A;  2L3Q A;  2JW4 A;  2ROL A;  1CKA A;  1K0X A;  4OMP A;  3VRY A;  1UTI A;  2VKN A;  2EQI A;  3SHW A;  2KT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...