2CDTA

Alpha-spectrin sh3 domain a56s mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPASYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN
publication title Cooperative Propagation of Local Stability Changes from Low-Stability and High-Stability Regions in a SH3 Domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cdtA00
1G83A 2V1QA 4D8KA 1UDLA 1TUDA 2HBWA 4Z89A 1UG1A 1AOJA 3UA7A 2GTJA 2K2MA 4HVWA 2JM8A 2AKKA 2EW3A 4J9IA 1PRLC 3PVQA 4LUDA 4AG1C 4J9BA 2V1RA 1U5SA 4HVUA 1AD5A 2RQVA 1I07A 2JW4A 3EGUA 1X6GA 2HSPA 1SPKA 2CUDA 2DE0X 2J7IA 1NEBA 2DL5A 2KXCA 1ZUUA 1K0XA 1ZUYA 2LX7A 3QWYA 4RTYA 4AFZC 1HJDA 1WXBA 2KGTA 2FPFA 3JV3A 1BK2A 2NUZA 3NPFA 3SEMA 3H41A 2YUNA 3M0PA 2KR3A 1VYTA 2K7AA 1NYGA 3EG3A 2EGAA 1OV3A 4AFUC 1T0HA 2YUPA 1WIEA 2J6OA 2DL4A 3NHNA 5GJWB 2KT1A 2CT3A 5IHIA 4HVVA 1AWXA 1SHFA 2HEQA 1UFFA 2C0OA 2DLPA 1ZUKA 2W10A 2O88A 2GBQA 1PHTA 4RTXA 3TSWA 2GGRA 1XOVA 4X1VA 2EGCA 1WFWA 1LCKA 2K6DA 1GCPA 3ULRB 1OEBA 4JZ4A 2EGEA 4IIMA 4J9HA 3VS0A 2F2VA 5IHNA 1H92A 2JTEA 1PKSA 2DM1A 2DRKA 2GTOA 1NG2A 2MIOA 1V1CA 1OPLA 3THKA 3M0QA 1M8MA 2O9SA 2FRYA 2BTTA 4RUGA 2AKLA 1RLQC 3C0CA 2KEAA 4JZ3A 2RQUA 1BBZA 1UTIA 2CSIA 3UA6A 3M0RA 3EG2A 4ZNXA 2LJ3A 1KSWA 2IIMA 2J06A 1WYXA 4RTTA 5EC7A 1WXTA 4FSSA 1ABQA 2JM9A 4F16A 4F17A 4E6RA 3M0UA 1WLPB 2YT6A 1UHCA 2EBPA 1IO6A 2X3XD 4Y92A 4CC3A 4EIKA 4LNPA 1PRMC 4F14A 4LUEA 1K0SA 4HXJA 2DJQA 1S1NA 2LJ0A 4M4ZA 5FW9A 1X43A 2C0IA 2EYYA 1GFDA 2FRWA 3PVLA 4AG2C 2KROA 3UF4A 3VS1A 2DL7A 5IHKA 2EKHA 4GLMA 1NLOC 2LJ1A 1GBRA 1MV3A 2PNIA 4WCIA 2L3QA 3CQTA 1SSHA 2DILA 4Z8AA 5HCKA 1QLYA 1B3QA 3NMZC 2B86A 1ABOA 1PNJA 1K9AA 1GRIA 2O2OA 2J6FA 1QCFA 1ZX6A 1YNZA 1M3CA 1M27C 4ESRA 1K76A 3I9QA 1X69A 2DL8A 4JJBA 4D8DA 2EYWA 1AWJA 2C0TA 3M0TA 5I11A 2D1XA 1JO8A 4IIOA 2D8JA 2KXDA 2F2XA 2A28A 1UUEA 2L3SA 2RPNA 2FO0A 5ECAA 2EPDA 1SRLA 3H0HA 2ENMA 2DVJA 4AFQC 1WI7A 2BZ8A 1OPKA 2LNHB 2MCNA 2K79A 1I1JA 1W6XA 2ED0A 2KRSA 1VA7A 1HSQA 1K4US 2RNAA 2LCSA 1ZLMA 2D8HA 1KIKA 1T3LA 2XMFA 2KRNA 1X2KA 1YWOA 3SHWA 3VS4A 2KYMA 5IH2A 1GFCA 2CREA 1U3OA 2J05A 2KT8A 1BU1A 2O31A 1JU5C 2YUQA 1CKAA 2VKNA 2M51A 1Z9QA 2D0NA 2DX1A 3REAB 2KRMA 4OMPA 5FWBA 2JT4A 1AZEA 3VRYA 1OOTA 2SEMA 1G2BA 2A36A 1JQQA 1J3TA 2DMOA 3ZL7C 1SHGA 2M0YA 2L3PA 2ROTA 1JEGA 5GJVB 3U23A 2JS0A 4LE9A 1QWEA 4CC2A 1UJ0A 1RLPC 2HDAA 1BB9A 4GBQA 3VS7A 3UATA 3EG0A 1AWWA 1K1ZA 5L23A 1PKTA 1PWTA 2DF6A 1YN8A 2E5KA 2YUOA 2EVRA 1NEGA 1I0CA 1FMKA 1JXOA 3REBB 1M30A 2PZ1A 2F2WA 2JXBA 3GBQA 3EHRA 3A98A 1B07A 2DBMA 1Y0MA 2A37A 5I22A 3R6NA 5FWCA 1MUZA 2CH4W 2P4RA 1UJYA 4J9CA 1NM7A 1X2QA 1GCQC 1SEMA 1YP5A 2JS2A 2LQWA 2EYXA 1RUWA 4JJCA 2KBTA 3RBBB 2DBKA 1W70A 4RTZA 3I35A 4KRTA 1T3SA 2LMJA 3IQLA 2A08A 2DA9A 2OI3A 1AZGB 1E7OA 2VVKA 1GL5A 1ZBJA 4CC4B 2GNCA 2CDTA 2L2PA 1W1FA 3VS6A 3QWXX 2ROLA 2JMCA 2RN8A 3I5RA 2RMOA 1KJWA 1YCSB 1EFNA 3H0FA 2QDLA 1QWFA 2J6KA 3VS3A 1M3BA 2ED1A 2RQRA 2EYZA 2OAWA 1GCQA 1AWOA 4AFSC 1WDXA 3KFVA 2DNUA 4OMQA 2HCKA 2AZVA 2RQTA 1X6BA 2GQIA 1TUCA 1UHFA 1H3HA 2NWMA 4OMNA 2ESWA 2PTKA 2DYBA 1WA7A 2AZSA 2DL3A 1JXMA 2LP5A 4LN2A 4OMMA 4ORZA 2CH4A 4J9FA 1KFZA 1E6HA 1YWPA 1FYNA 1CKBA 1GBQA 2BZXA 2VWFA 4HCKA 1T0JA 4OMLA 4DEYA 1VYVA 4R0KA 2FPEA 1ARKA 1A0NB 1RI9A 4JJDA 2YSQA 1ZSGA 3PE0A 2MOXA 1HD3A 1QKWA 2YDLA 3EHQA 2KYBA 1MV0B 3O5ZA 2FEIA 4RTWA 2L0AA 2H8HA 1H8KA 1M3AA 4OMOA 2I0NA 2BZYA 1N5ZA 4J9GA 1NLPC 1AVZC 2RF0A 2CUBA 2O9VA 1E6GA 2ABLA 3H0IA 2SRCA 4Z88A 2KE9A 1QKXA 2G6FX 1U06A 1Z9ZA 1TG0A 2FG0A 4RTVA 3RNJA 4DEXA 3M0SA 2OJ2A 2FPDA 4QT7A 3NGPA 4J9EA 1UGVA 2DRMA 4JPBW 2K3BA 4RTUA 1X27A 3FJ5A 4J9DA 1UECA 1VYUA 1AEYA 3VS2A 2JMAA 2CSQA 5IXFA 1CSKA 4K11A 1SRMA 3LH5A 2ECZA 4CC7A 2EQIA 1WXUA 4A63B 3EG1A 3VRZA 2AK5A 3VS5A 3TVTA 2RQWA 2LZ6B 1UE9A 2K9GA 1WX6A 3I5SA 5IXBA 2X3WD 3TSZA 2W0ZA 2LQNA 2CT4A 1NYFA 2KNBB 1Y57A
chains in the Genus database with same CATH superfamily
3M59A 5GANh 1N8RR 2HBWA 1PSFA 3CD6T 4FIBA 3F70A 3UA7A 3TU4K 2JM8A 2EW3A 4IUTA 1ZBXA 3PVQA 5I21A 1PD1A 4M7DG 2RI5A 2DO3A 2PU9B 2V1RA 4XQ3A 3A1PA 3HHTB 4B9XA 4II1A 1AD5A 3EGUA 2CUDA 2DE0X 4XTZA 2D0QB 1G3WA 3H6ZA 1NEBA 5LJ5j 2KXCA 2HQXA 1ZUYA 2LX7A 3QWYA 3CC7T 3SFMA 1QVGS 3NPFA 3SEMA 1QCOA 3RKYA 4O5VA 1BI3A 3M0PA 3L1AA 3LH0A 1VYTA 3A8GB 1T0HA 4M75E 1VQPQ 1WIEA 2DL4A 4KBMB 2DVEA 2EKOA 1G8XA 4C92A 4HVVA 2IVWA 2HEQA 1UFFA 4FYVB 5CAIA 1ZUKA 2AHJB 2O88A 4RTXA 3G4SA 3CPWS 5GMKl 4X1VA 2B8AA 2VC8A 1WFWA 3OQ5A 1GCPA 4E47A 3PT9A 3CCLQ 4JZ4A 3MJXA 2EGEA 3DLMA 3OB9A 4M78D 3T9NA 3MCAB 4EMHA 3DLLA 3QBYA 4C92B 4BY6C 4JLIA 5A2QE 3JRZA 3CBPA 2ZPHB 3M0QA 3INZA 2QQRA 4A4FA 4FT4A 1W2BS 1RLQC 4ZN1A 1D1AA 2WSFE 3I55Q 3M0RA 4QKUA 5CKEA 4ZNXA 2DD4A 2NLUA 2VGNA 2LJ3A 2IIMA 1IB8A 4HA8A 1GXIE 2OTLQ 2GQVA 2JM9A 4F17A 2EQUA 2NYSA 3CCEA 1X01A 2EBPA 4Y92A 3ASKA 4F14A 1KQ1A 1K0SA 3G1JA 3PNWC 5FW9A 5GAMg 2C0IA 2K2VA 2FRWA 3OA6A 1IRXA 1R0CB 1VQMT 4IURA 3EFOA 2CP7A 2DL7A 3OSVA 3MEWA 1QP2A 4GLMA 3MP6A 1NLOC 3ZFJA 3CQTA 1K9MU 3M4GA 5HCKA 1B3QA 5CQYA 1YCYA 1GRIA 3JCMP 1QCFA 1M3CA 4M7AC 1KHCA 3HRTA 4M77E 4Y91A 4M75B 2QYZA 3M55A 4JJBA 2ZAEA 2EYWA 1M1FA 3FEOA 2ZPIB 5I11A 3I56A 5CQXA 3L2RA 2A28A 4M75F 3P8HA 3JCMb 5CKBA 1OPKA 2CZ0B 1EIFA 1VQ5A 1LPLA 1YJ9Q 1YI2Q 5J39A 4ELZC 1VQ4T 1HSQA 1K4US 4FT2A 2D8HA 2DZ9A 1TS9A 4KUIA 4RMOA 1YWOA 2HL5C 3CMAA 1YITQ 3TEEA 2QEXT 5A0DA 1BI2A 2PVGB 4C5EA 1BU1A 4X9DA 1ZSZA 3SWNA 3NTKA 1WJQA 2D0NA 2QTXA 2KRMA 4OMPA 3VKIA 3CCSQ 1J3TA 1YHQA 2WSEE 4OB1B 2K3XA 3FB9A 1QWEA 3OYHA 1UJ0A 3BW1A 5GANg 3PMTA 3OMGA 1AWWA 1KC8C 5L23A 4J6WA 2E3IA 1PWTA 2DF6A 4IKFA 2E5KA 2LT4A 8ATCB 1N8RU 1ZSZB 2PVOB 2RM4A 1WHLA 3SWNB 1JXOA 1K8AU 1PG5B 2F2WA 3ER0A 3GBQA 3A98A 3R6NA 1C0MA 1MUZA 4XAXB 2CH4W 5A0GA 5IAYA 1UJYA 1Q82R 1NM7A 4N4HA 5FU6C 1AHJB 4PJNA 1VQPT 3LX7A 1RABB 1SEMA 3S3OA 2ZCFB 3GPLA 1TU0B 3BE3A 3QUIA 2VB6A 4RKUE 3OS1A 1WHKA 4E7HA 2DBKA 1W70A 4XK8E 4M77F 3JCMg 4RTZA 3S3NA 1T3SA 2XDPA 4A54A 4C0DC 3CCLT 2QI2A 4KGZB 1M2VA 1D1BA 4N0AC 4CC4B 2GNCA 2QQSA 3E1SA 2RK1A 3QWXX 3CCRA 2ROLA 4J6YA 2JMCA 2RN8A 3PTAA 4C92D 2E6NA 2QDLA 2J6KA 4L5GA 1M1KU 2K3YA 1M3BA 4OGCA 1VQ6A 3BDUA 4J83A 2RQRA 2YXYA 2OAWA 1AWOA 1EX4A 2EFIA 4M7AG 3JB9F 4J6XA 2RJCA 4OMQA 3I55T 2GFAA 1M2VB 2RHYA 3FJPA 4M78E 2AZVA 1TUCA 2X4JA 4NOYA 1H3HA 2OTLT 2NWMA 5LJ5h 3JCMV 2DXCA 2DYBA 2AZSA 2FZGB 2LP5A 1JXMA 3X20B 5C0MA 4M7DA 1VQLQ 2K5FA 4J9FA 2GCXA 4J5YA 4A53A 4PK4A 3CMEA 2VWFA 1U8RA 5FRMA 4BE1A 3EG9A 1Q81C 2E65A 1WHGA 1VYVA 4R0KA 2FPEA 2LDMA 3VUZA 3QDFA 1OI1A 2CZ7B 4J7IA 5C6SA 1HD3A 1I4K1 1QKWA 2KYBA 1YJNQ 5HY6A 4M7DB 2Z0WA 3QKJA 2CYZB 2H3JA 2OAUA 1AVZC 5I2SA 3UWNA 2QA4Q 1JJ2A 2DTIA 1KD1R 3GLXA 2QG9B 1QKXA 1U06A 5FU7C 1TG0A 4KUDK 3L2UA 3EH2A 3RNJA 5KCHA 1YIJA 4XU0A 1FMVA 2MYSA 4JS4A 3J81E 3CCVA 3RMSA 2I2LA 2CP3A 2ZGWA 3KBGA 4F7UA 1YJ9T 3VS2A 1YI2T 5IXFA 4K11A 1D0ZA 2RHIA 4FSXA 4ZGDB 3OYJA 1FMWA 3OYAA 1WXUA 1JBMA 3VRZA 2HQEA 1K73R 2LZ6B 3PMIA 5IN1A 1UE9A 1VIFA 4LDVA 1YITT 2K9GA 1WX6A 3I5SA 5IXBA 2X3WD 1XJWB 3LLRA 2BUDA 1NYFA 4F7UB 5KCOA 4ZGEB 1XNIA 1G83A 3QSUA 3MKDA 1Q7YR 2DXUA 5GAOm 2GTJA 3CCST 4HVWA 1R0BG 2R58A 3OW2P 4JLGA 4F7UF 1PRLC 1UB4A 4QQ6A 3RKWA 5FRNA 4M78F 4AG1C 4FW2A 2YLBA 1WQ7A 2QASA 5GAOp 1H3ZA 2YRVA 2X35A 2X4WA 2XI9A 5DLQE 1VQKQ 2RQVA 4HKEA 1WHHA 4N4GA 2HSPA 1SPKA 3H8ZA 2J7IA 3RR6A 2P0QA 3JAME 5CCAA 1K0XA 4FYYB 2O4XA 2JN0A 1WXBA 2KGTA 4WTOB 3SB2A 2FPFA 2FL7A 2ZZDA 2NUZA 1WJRA 2ATCB 4DOVA 2EGAA 1OV3A 2YUPA 1Y07A 2J6OA 1KG1A 3HPWA 2KT1A 1ZHIA 3NFCA 2CT3A 1K9MC 5KH6A 3M54A 5CKDA 2L89A 1AWXA 1G3TA 1SHFA 2C0OA 3JB9H 2W10A 1M90R 2GBQA 3V8LA 3TSWA 5GAMd 2EJ9A 2CZ1B 2EGCA 2E5QA 2AT1B 2O4XB 1FXXA 2MWOA 1LCKA 5CR2A 4EDUA 2QGGA 1BCOA 1Q82U 2LRQA 2DXTA 2L3RA 3OYFA 3CC4Q 1QQJA 5IHNA 5L8RE 2JTEA 1PKSA 3A8MB 1D3BA 3EGXA 5CO7A 1F1BB 1NG2A 2MIOA 1V1CA 3THKA 3QIIA 1M8MA 1OQKA 2O9SA 1SG5A 2FRYA 2BTTA 4RUGA 1YJWQ 4JZ3A 3D7SB 1QVPA 3PIOA 2EQMA 2JZ2A 2J06A 1WYXA 4RTTA 1NBEB 3V7SA 4C8QC 4C92E 1ABQA 1N27A 2EJFA 1VQ8Q 4E6RA 3EGXB 1VQLT 3M0UA 1S72A 1PC0A 4DA4A 1WLPB 1OX9A 2X3XD 4JDSA 2NUTA 4EIKA 5CK9A 1EZZB 1S1NA 4OMFB 5CIUA 3MP8A 1X43A 2EYYA 1GFDA 3PVLA 2RH2A 2PVDB 3UF4A 3E2UA 2OX7A 5IHKA 5KE2A 2LJ1A 2KSSA 2PNIA 3OYKA 1LNXA 1C6VX 3MHXA 1YJNT 1VQ7A 1ACMB 5LJ3d 4Z8AA 1KQ2A 2QQ9A 1Y96A 2DAQA 4M7DD 3SD4A 1PNJA 2QA4T 5GAOq 2NUTB 3QYGB 4J7FA 4MZMA 1K76A 5GAN4 2EAYA 1X69A 1K8AC 2C0TA 3M0TA 5FLXE 1Q86C 4PJMA 4YTLA 4IIOA 2KXDA 3VYGA 5GANd 4C5GA 4BB7A 1SF9A 4HCBA 1Y96B 2XICA 2RPNA 2DETA 1TOVA 2DEUA 3H0HA 4MZTA 3QHSA 1WI7A 2JOYA 3JCMh 1KD1U 4BI8B 2K79A 1VA7A 4PJOC 2P4TA 5GAOn 5GAOr 2V8JA 1YBYA 2RJDA 1O75A 1JJ2S 1X2KA 4M7AA 2DFUA 3CCLA 2CREA 4F04B 1U3OA 3CCQA 4PLIA 2KT8A 4JUVA 3M57A 3G6EA 2K4YA 4LDUA 1CKAA 1D0YA 3OYIA 1M1KC 2VKNA 2M51A 2HMAA 1Z9QA 3JB9J 3JCMd 2DX1A 3HRUA 3REAB 1AZEA 2OTJA 1OOTA 1G2BA 1JQQA 3OS2A 4OF1A 5GMKe 3ZL7C 4XTVA 2E1HA 1K73U 2ROTA 3U23A 4LE9A 4CC2A 2HDAA 3G4SQ 2M0OA 4UC4A 1VQKT 4GBQA 3V8KA 4C92F 1K1ZA 4BACA 3BY7A 2HKQB 1PKTA 2EJGA 2FVUA 3HKSA 3MEVA 2EQKA 2KDSA 1I0CA 2L8DA 1KQSP 1HK9A 3REBB 3GOXA 3L2QA 3CXCP 3EHRA 1B07A 3WXMB 5I22A 3DB3A 5FWCA 2JUFA 4J9CA 1X2QA 2RB6A 3VU3C 1MMDA 2RO0A 2XU8A 1TSFA 3EAEA 2DKGA 1N9SA 1RUWA 4C8QG 5A0LA 1HYOA 3RBBB 4QW2A 1BCMA 3OY9A 3TREA 2LQKA 3CCEQ 4QVCA 1RI0A 1U1TA 2VVKA 3QDRB 4CI0C 5HK0A 3CC4T 1OU8A 2K5LA 3EFOB 2EWNA 3I5RA 1IXDA 1EFNA 1QWFA 3RKXA 1NJIU 4L6V5 3VS3A 1QVFP 2ED1A 2HL3A 1M90U 5GAMf 1B34A 2EYZA 3MP1A 3EGDA 4QQDA 1YJWT 1QMCA 4AFSC 1WDXA 2CP2A 1G3YA 5M9OA 3KFVA 2BKDN 4P5NA 4BE2A 2DNUA 1UEBA 5D6YA 2RQTA 3J7AF 4A4GA 1G5VA 4OMNA 1VQ8T 1XTDA 3I56Q 4LN2A 1KFZA 1E6HA 1B34B 3AHUA 4N0AA 1YWPA 5FU6B 3EGDB 4LXCA 4JRKA 4C0FA 3CC2A 3M56A 4PJOG 3QO3A 1ARKA 1VQ5Q 2NUPA 1B7TA 1IREB 3EHQA 3PGGA 1MV0B 3V8JA 1D09B 2FEIA 2GF7A 4RTWA 2QQAA 5D7UA 1WZOA 4J9GA 1OULA 2CUBA 2V26A 1VQOA 3CMAQ 3HL8A 1KC8R 3G71A 1TH7A 2KE9A 2G6FX 1Z9ZA 4FW1A 4M75C 2K57A 4DEXA 2NUPB 2FPDA 4HCZA 1TWBA 5LJ3f 5GAN8 4J9EA 1UGVA 4M7DE 3MEUA 4DBRA 4JPBW 1UGPB 2KQWA 4RTUA 3RIRA 3OYMA 1YHQQ 3LGFA 5CVIA 2PUKB 4J9DA 1UECA 1VQ9A 1VQNA 2CSQA 2ZPFB 2ECZA 2EQIA 5KYYA 3E9GA 4BDZA 4XTUA 1QP3A 2FZCB 4A63B 2KY9A 2QQBA 3WVEB 3VS5A 4Q5WA 5GANf 3OYYA 4LD9K 1JRIA 2VXFA 2IPOB 3CCMA 2KNBB 2X51A 4PFPA 4D8KA 1UDLA 1TUDA 2LCLA 4ATOA 4HT9A 4Z89A 1VIEA 1WGSA 2EQJA 2XK0A 1UG1A 2F5KA 4QQGA 5KYYB 4QVDA 3JSCA 4MMLA 3FIFA 4XU3A 4LUDA 3G4ST 4BUGA 2MWPA 3UDCA 4M7AD 5HK3A 1U5SA 4HVUA 1BI1A 5FU7B 4F7UE 1I07A 5DM7R 3OYCA 5DLOA 4BI4A 3PIPA 1YFNA 1IGQA 3X26B 3CCUA 2DPPB 4PFZA 3CCRQ 2E10A 1ZUUA 2HZYA 8AT1B 3OYEA 1N9RA 5KYUA 1QCNA 3JV3A 3CCJA 1VQ6Q 4PKCC 3H41A 2YUNA 6AT1B 2KR3A 4DBFA 3EG3A 2YRDA 3CD6A 4M77C 1Q81R 1YJNA 2X4YA 2DLPA 3JB9I 1XOVA 1WPYA 3CCET 5LJ5d 5KYUB 2K6DA 2JVVA 5GAMe 1VOMA 3CMEQ 2IG0A 3EG9B 2VYTA 4M7DF 2DIGA 2RK2A 1OZ3A 3PFSA 1H92A 3OW2A 2DM1A 2DRKA 3P8BB 2GTOA 1VUBA 4BDYA 3WVDB 3CC7A 3OS0A 4EPCA 1PM3A 2C06A 2KEAA 4FL6A 1BBZA 2MMPA 3HRSA 3UA6A 4M75G 5D6WA 3EG2A 3QXEB 1Y71A 3TCJA 1KSWA 1OU9A 5EC7A 2DZCA 1MHNA 1WXTA 3SDZA 4FSSA 3R6OA 3I56T 4BD3A 2RA2A 2DJZA 1UHCA 3FC3A 1YIJQ 2XDBA 4KT0E 1IO6A 4CC3A 3MO8A 1PRMC 5D6XA 2DJQA 1OX8A 4M4ZA 2DK3A 3CCVQ 3NTIA 1M8VA 2RI3A 4AG2C 1QVGP 1P92A 3OBYA 1VQ5T 2EKHA 2A0FB 4XTXA 1GBRA 3AT1B 3QJYA 4WCIA 2L3QA 3OYLA 1QLYA 4AT1B 2COYA 1K9AA 4FM4B 1MMNA 1ZX6A 2JJ9A 3DKMA 5LJ3e 3CMAT 4HCCA 3CPWP 1KK7A 4ESRA 4V2SA 4KULA 4C8QA 3I9QA 2QTVA 4D8DA 3X28B 4PFOA 1AWJA 2XG8D 1ZQ1A 1JO8A 2RD1A 3RDVA 2XHCA 1H641 1M5Q1 2HAXA 4Z02A 1YHQT 2EPDA 2ENMA 2DVJA 4AFQC 5I2MA 5GMKj 2BZ8A 2LNHB 5GANe 9ATCB 1VQMA 1TTHB 1KC8U 2ED0A 2EYQA 2CKKA 1IZ6A 4C8QB 1W2BP 2HD0A 2RNAA 1K9MR 4LDWA 1KIKA 2VASA 4ZN3A 5J3BA 2JTFA 2VXEA 2DD5A 2KRNA 1TUGB 4OP0A 4XTYA 4L59A 5KYNA 5IH2A 1GFCA 1O9SA 1OYXA 2XD0A 3CBMA 4E7ZA 4A4EA 1BI0A 2J05A 4M77D 4M77G 5GAOl 4HT8A 2QXFA 4MDWA 5GAN5 2O31A 1JU5C 2RHZA 2YUQA 1NJIC 4M78C 2CP5A 2FZKB 4FYWB 1WQWA 3QYHB 2JT4A 2SEMA 1SHGA 2M0YA 2L3PA 3O8VA 1JEGA 5GJVB 2JS0A 3FDRA 4PNOA 4C5HA 3JCMe 1G3SA 3VS7A 3EG0A 3TQ7P 4PJOA 1WNLA 1VQ4A 2RHXA 2YUOA 4MZPA 2DTHA 1NEGA 1HXDA 1D0XA 1IHVA 3JB9G 3CCRT 1FMKA 1M30A 4EMKC 1D3BB 2JXBA 2DBMA 2X9HA 2DXBA 4C0ZA 1C1AA 1VQ6T 2QEXA 5GAN6 1U1SA 2CGHA 4M7AE 2YHTA 4GLKA 1I81A 1UGSB 3HP9A 1GCQC 2BIVA 4CRIA 2PQWA 1W4SA 2XIDA 1YP5A 4PJOB 2LQWA 2EYXA 2D6FA 2PUOB 1OZ2A 2MK5A 5CKFA 3V7RA 2KBTA 3UT1A 3NTHA 3M4YA 4DQ2A 4RCBA 4IUPA 4FCYA 4GY5A 3I35A 1S72Q 2LMJA 2QK0A 3IQLA 2DA9A 5GMKm 1NPRA 2OI3A 1AZGB 4R55A 3J80E 5IT9E 2QGFB 3CMET 3CBOA 1N8RC 1Q81U 4BY6B 3UPUA 1K8AR 3OMCA 1JB0E 2RMOA 1KJWA 1YCSB 1Q86R 3H0FA 1FX7A 3ME9A 3ZBDA 1VQ7Q 1DJ7B 5KE3A 5LJ5f 2FYKA 2P0PA 1VQPA 3CPFA 3GF5A 4OB2B 2GQIA 1UHFA 2MF2A 4ME7A 4X9CA 4C5IA 1KQSA 3HFOA 3CXCA 3GIBA 2PTKA 2LCCA 1WA7A 1YIJT 4XU1A 2CZ6B 4OMMA 2CH4A 2HKNA 2LTOA 1NE8A 3C12A 3CCVT 1R8OB 4ANJA 2LX9A 4E7LA 2CS7A 3LW5E 4DEYA 3OW2S 2L5QA 3A8OB 1RI9A 4JJDA 4NL2A 2LNVA 2AIRB 1M1KR 2MI6A 3OYBA 3PE0A 3VJPA 2YRCA 4KGXB 2BE9B 5HKCA 1I5OB 4NL3A 3S6WA 1M3AA 3FLGA 2BZYA 1N5ZA 1X6OA 2RF0A 4M7AB 3I55A 4F7UG 3CCQQ 4M78G 4JRPA 2OTLA 2FG0A 1M9SA 2E4HA 1Q7YU 2M02A 4JRIA 3G6EQ 2VV5A 4M7AF 3QPHA 1QVFA 2DTOA 3DB4A 2KK4A 2Y90A 2E64A 3NGPA 1PSEA 2EIFA 2OTJQ 2VGMA 3M9QA 1MMGA 4R56A 3JCMQ 1V29B 1RAAB 5DY9A 3RERA 1VYUA 3L2ZA 1M4ZA 2E3HA 3LYIA 3KXTA 2F1LA 4C8QD 3QG1A 3LH5A 2XDDA 1RL2A 1WHJA 3EFRA 2AK5A 2ZPGB 4PJLA 4IUVA 1RAIB 1BIBA 2D9TA 2DIQA 2LQNA 2CT4A 4M75A 4FU6A 1Y57A 2LC4A 2V1QA 4OVAA 1UGQB 3EH1A 1I5LA 2E12A 1AOJA 2K2MA 4N4IA 5GAN3 2AKKA 4J9IA 4C92C 1IGUA 3ZEHA 2RJEA 3QJ6A 4LDYA 4J9BA 1UGRB 1YJ9A 4MDXA 1YI2A 4IUUA 4XTWA 1TXQA 4AMCA 5J26A 2JW4A 3META 1X6GA 5CKHA 5GAMj 3CEYA 2DL5A 1YITA 3GNFB 2RI2A 4RTYA 4AFZC 1HJDA 3MPUB 1BK2A 2O01E 5GMKh 2YLCA 1RAGB 1Q95G 3MEAA 4ELYC 2K7AA 1NYGA 4AFUC 2H3EB 4WF2A 4PJOD 3EFSA 3NHNA 5GJWB 3QZ5B 3CCSA 1M1GA 1BIAA 5IHIA 2DEQA 2COZA 4D6WA 1PHTA 2GGRA 1S72T 2K5IA 4C0DB 5LJ3g 3ULRB 2Y4XA 3N5BB 1OEBA 4IIMA 4J9HA 3VS0A 5GAN7 1NPPA 5LJ5e 1ZA2B 2X4XA 1RAFB 3C4SA 5GAN2 2F2VA 3E19A 2FB7A 1MNEA 3CC2Q 4PL6A 2QAZA 1VQ7T 1OPLA 3BDLA 2JTMA 1Y7XA 2BE7D 1QW1A 1LVKA 4JS5A 3M5AA 3S3MA 1RAEB 2AKLA 3C0CA 4M77A 2RQUA 3URGA 2ZPEB 1UTIA 2CSIA 1VQOQ 2E41A 5LJ3j 3G71Q 1SKUB 4F16A 1Q86U 4J8OA 2YT6A 3L2VA 2F5TX 1MMAA 3H9NA 4LNPA 2M9UA 1Q82C 4LUEA 4HXJA 2LJ0A 3A8LB 4M77B 1I8FA 2KROA 3VS1A 1PCXA 1VQ9Q 1WJSA 1SSFA 1VQNQ 5GANj 1MV3A 3QZ9B 2WACA 1SSHA 2DILA 3OBWA 3NMZC 2B86A 1ABOA 4BI3A 4LDXA 2A3LA 2HQHA 2O2OA 2J6FA 4IUQA 4PLLA 3JCMW 1YNZA 1M27C 3CCQT 3CCMQ 2KVQG 1KQSS 4OB0B 2DL8A 3CXCS 5KYXA 3G6ET 2D1XA 2KI7A 1VQLA 3JCMf 1ZSZC 4C92G 3SWNC 2D8JA 3FRNA 2OTJT 2F2XA 3Q1JA 1UUEA 2DYIA 2L3SA 2FO0A 5ECAA 4DBHA 4RCCA 1SRLA 2MAMA 3OYDA 1BKBA 2R5AA 3KUFA 4XU2A 2MCNA 2KAFA 4JJNK 4DBQA 1I1JA 1W6XA 2KRSA 2ZPBB 2LCSA 5KYXB 1ZLMA 1T3LA 2XMFA 3L42A 3CCUQ 2QA4A 2LT1A 3SHWA 3VS4A 1MGQA 2KYMA 1IHWA 1XQHA 4KH0B 4BE0A 4OB3B 3LWHA 2RJFA 2DERA 3CCJQ 2E70A 1QVGA 3LGLA 3JCMc 2HNIA 1QVFS 1AT1B 1MNDA 4C8QE 4ZTFA 2HSEB 3CD6Q 5FWBA 3VRYA 2YWWA 2A36A 1KHIA 2DMOA 1D1CA 4JRQA 7AT1B 3V7CA 1RLPC 3OYGA 3G7ZA 3CPWA 1BB9A 2JNGA 2R57A 1KD1C 2M16A 3UATA 2CP0A 1RAHB 4M75D 1WHMA 1YN8A 4FYXB 2EVRA 5GMKi 2FHDA 4MMKA 2PZ1A 1PD0A 4E7IA 4B6MA 1Y0MA 2A37A 2P4RA 3CC7Q 4M78A 2P0KA 3A8HB 2JS2A 3X25B 1W2BA 3BFMA 1N6AA 4Y28E 4NS5A 2COWA 4JJCA 3HTRA 4B9WA 2V8IA 1K73C 3E9FA 1M2OA 3OSSC 4TVRA 4KRTA 1VQKA 4M7DC 2A08A 4E7KA 1E7OA 3RMQA 1JJ2P 1GL5A 1ZBJA 2CDTA 1Q7YC 1LJOA 4RG8A 2L2PA 4KGVB 4M78B 4VUBA 1W1FA 4O6JA 3VS6A 4PJOE 2Y4YA 2M1HA 3CC2T 1RACB 4EMKA 3L2WA 3P8DA 3HFNA 3VUBA 3OS5A 3LWIA 1V76A 1GCQA 2VUBA 3JCMJ 3M58A 1VQOT 2HCKA 4PJJA 2RHUA 1X6BA 3G71T 5GAMh 2KMTA 4DOWA 2R5MA 5FROA 2ESWA 4EMKB 2DL3A 3C94A 3M53A 2E6ZA 2MPXC 4ORZA 3VV0A 4KH1B 4A4HA 1R77A 1FYNA 4C8QF 1CKBA 3RUXA 1GBQA 2BZXA 1NZ9A 3CC4A 2LQ8A 4HCKA 1T0JA 4OMLA 5LL6S 1VQ9T 1BYMA 1VQNT 3A5ZB 1VQMQ 1A0NB 2YSQA 1ZSGA 4QVZA 1NJIR 1M90C 2MOXA 2YDLA 3O5ZA 2L0AA 4ZGJB 2H8HA 1YJWA 1H8KA 4OMOA 1LOJA 2I0NA 2LVMA 2QDYB 1NLPC 2O9VA 1E6GA 3CCMT 2ABLA 3H0IA 2SRCA 1RADB 4Z88A 2HBPA 5KYWA 3GNGA 4E7SA 4RTVA 1VQ8A 3OYNA 2XKOC 3JB9D 3M0SA 4OGEA 2OJ2A 4QT7A 1X75C 2DRMA 3HSBA 2K3BA 2GFUA 3RESA 1ZA1B 3C95A 5AT1B 1X27A 3FJ5A 2WSCE 5EG2A 2V8KA 3GP8A 1AEYA 2P84A 2JMAA 5LJ3h 3VYHB 5KYWB 1FWZA 3JCMX 1CSKA 1SRMA 3X24B 1VQ4Q 4CC7A 5AYFA 4ZTJA 2CP6A 3EG1A 3CCUT 2G3RA 3TVTA 2RQWA 4A4KA 4X34A 4PJOF 3TSZA 2F69A 2W0ZA 3CCJT 4LD6A 2QEXQ 4E2FB 4EMGA 4RG2A 5LJ5g 2A7YA 4C0GA 4E7JA
chains in the Genus database with same CATH topology
1G83A 2V1QA 4D8KA 1UDLA 1TUDA 2HBWA 4Z89A 1UG1A 1AOJA 3UA7A 2GTJA 2K2MA 4HVWA 2JM8A 2AKKA 2EW3A 4J9IA 1PRLC 3PVQA 4LUDA 4AG1C 4J9BA 2V1RA 1U5SA 4HVUA 1AD5A 2RQVA 1I07A 2JW4A 3EGUA 1X6GA 2HSPA 1SPKA 2CUDA 2DE0X 2J7IA 1NEBA 2DL5A 2KXCA 1ZUUA 1K0XA 1ZUYA 2LX7A 3QWYA 4RTYA 4AFZC 1HJDA 1WXBA 2KGTA 2FPFA 3JV3A 1BK2A 2NUZA 3NPFA 3SEMA 3H41A 2YUNA 3M0PA 2KR3A 1VYTA 2K7AA 1NYGA 3EG3A 2EGAA 1OV3A 4AFUC 1T0HA 2YUPA 1WIEA 2J6OA 2DL4A 3NHNA 5GJWB 2KT1A 2CT3A 5IHIA 4HVVA 1AWXA 1SHFA 2HEQA 1UFFA 2C0OA 2DLPA 1ZUKA 2W10A 2O88A 2GBQA 1PHTA 4RTXA 3TSWA 2GGRA 1XOVA 4X1VA 2EGCA 1WFWA 1LCKA 2K6DA 1GCPA 3ULRB 1OEBA 4JZ4A 2EGEA 4IIMA 4J9HA 3VS0A 2F2VA 5IHNA 1H92A 2JTEA 1PKSA 2DM1A 2DRKA 2GTOA 1NG2A 2MIOA 1V1CA 1OPLA 3THKA 3M0QA 1M8MA 2O9SA 2FRYA 2BTTA 4RUGA 2AKLA 1RLQC 3C0CA 2KEAA 4JZ3A 2RQUA 1BBZA 1UTIA 2CSIA 3UA6A 3M0RA 3EG2A 4ZNXA 2LJ3A 1KSWA 2IIMA 2J06A 1WYXA 4RTTA 5EC7A 1WXTA 4FSSA 1ABQA 2JM9A 4F16A 4F17A 4E6RA 3M0UA 1WLPB 2YT6A 1UHCA 2EBPA 1IO6A 2X3XD 4Y92A 4CC3A 4EIKA 4LNPA 1PRMC 4F14A 4LUEA 1K0SA 4HXJA 2DJQA 1S1NA 2LJ0A 4M4ZA 5FW9A 1X43A 2C0IA 2EYYA 1GFDA 2FRWA 3PVLA 4AG2C 2KROA 3UF4A 3VS1A 2DL7A 5IHKA 2EKHA 4GLMA 1NLOC 2LJ1A 1GBRA 1MV3A 2PNIA 4WCIA 2L3QA 3CQTA 1SSHA 2DILA 4Z8AA 5HCKA 1QLYA 1B3QA 3NMZC 2B86A 1ABOA 1PNJA 1K9AA 1GRIA 2O2OA 2J6FA 1QCFA 1ZX6A 1YNZA 1M3CA 1M27C 4ESRA 1K76A 3I9QA 1X69A 2DL8A 4JJBA 4D8DA 2EYWA 1AWJA 2C0TA 3M0TA 5I11A 2D1XA 1JO8A 4IIOA 2D8JA 2KXDA 2F2XA 2A28A 1UUEA 2L3SA 2RPNA 2FO0A 5ECAA 2EPDA 1SRLA 3H0HA 2ENMA 2DVJA 4AFQC 1WI7A 2BZ8A 1OPKA 2LNHB 2MCNA 2K79A 1I1JA 1W6XA 2ED0A 2KRSA 1VA7A 1HSQA 1K4US 2RNAA 2LCSA 1ZLMA 2D8HA 1KIKA 1T3LA 2XMFA 2KRNA 1X2KA 1YWOA 3SHWA 3VS4A 2KYMA 5IH2A 1GFCA 2CREA 1U3OA 2J05A 2KT8A 1BU1A 2O31A 1JU5C 2YUQA 1CKAA 2VKNA 2M51A 1Z9QA 2D0NA 2DX1A 3REAB 2KRMA 4OMPA 5FWBA 2JT4A 1AZEA 3VRYA 1OOTA 2SEMA 1G2BA 2A36A 1JQQA 1J3TA 2DMOA 3ZL7C 1SHGA 2M0YA 2L3PA 2ROTA 1JEGA 5GJVB 3U23A 2JS0A 4LE9A 1QWEA 4CC2A 1UJ0A 1RLPC 2HDAA 1BB9A 4GBQA 3VS7A 3UATA 3EG0A 1AWWA 1K1ZA 5L23A 1PKTA 1PWTA 2DF6A 1YN8A 2E5KA 2YUOA 2EVRA 1NEGA 1I0CA 1FMKA 1JXOA 3REBB 1M30A 2PZ1A 2F2WA 2JXBA 3GBQA 3EHRA 3A98A 1B07A 2DBMA 1Y0MA 2A37A 5I22A 3R6NA 5FWCA 1MUZA 2CH4W 2P4RA 1UJYA 4J9CA 1NM7A 1X2QA 1GCQC 1SEMA 1YP5A 2JS2A 2LQWA 2EYXA 1RUWA 4JJCA 2KBTA 3RBBB 2DBKA 1W70A 4RTZA 3I35A 4KRTA 1T3SA 2LMJA 3IQLA 2A08A 2DA9A 2OI3A 1AZGB 1E7OA 2VVKA 1GL5A 1ZBJA 4CC4B 2GNCA 2CDTA 2L2PA 1W1FA 3VS6A 3QWXX 2ROLA 2JMCA 2RN8A 3I5RA 2RMOA 1KJWA 1YCSB 1EFNA 3H0FA 2QDLA 1QWFA 2J6KA 3VS3A 1M3BA 2ED1A 2RQRA 2EYZA 2OAWA 1GCQA 1AWOA 4AFSC 1WDXA 3KFVA 2DNUA 4OMQA 2HCKA 2AZVA 2RQTA 1X6BA 2GQIA 1TUCA 1UHFA 1H3HA 2NWMA 4OMNA 2ESWA 2PTKA 2DYBA 1WA7A 2AZSA 2DL3A 1JXMA 2LP5A 4LN2A 4OMMA 4ORZA 2CH4A 4J9FA 1KFZA 1E6HA 1YWPA 1FYNA 1CKBA 1GBQA 2BZXA 2VWFA 4HCKA 1T0JA 4OMLA 4DEYA 1VYVA 4R0KA 2FPEA 1ARKA 1A0NB 1RI9A 4JJDA 2YSQA 1ZSGA 3PE0A 2MOXA 1HD3A 1QKWA 2YDLA 3EHQA 2KYBA 1MV0B 3O5ZA 2FEIA 4RTWA 2L0AA 2H8HA 1H8KA 1M3AA 4OMOA 2I0NA 2BZYA 1N5ZA 4J9GA 1NLPC 1AVZC 2RF0A 2CUBA 2O9VA 1E6GA 2ABLA 3H0IA 2SRCA 4Z88A 2KE9A 1QKXA 2G6FX 1U06A 1Z9ZA 1TG0A 2FG0A 4RTVA 3RNJA 4DEXA 3M0SA 2OJ2A 2FPDA 4QT7A 3NGPA 4J9EA 1UGVA 2DRMA 4JPBW 2K3BA 4RTUA 1X27A 3FJ5A 4J9DA 1UECA 1VYUA 1AEYA 3VS2A 2JMAA 2CSQA 5IXFA 1CSKA 4K11A 1SRMA 3LH5A 2ECZA 4CC7A 2EQIA 1WXUA 4A63B 3EG1A 3VRZA 2AK5A 3VS5A 3TVTA 2RQWA 2LZ6B 1UE9A 2K9GA 1WX6A 3I5SA 5IXBA 2X3WD 3TSZA 2W0ZA 2LQNA 2CT4A 1NYFA 2KNBB 1Y57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G83 A;  2V1Q A;  4D8K A;  1UDL A;  1TUD A;  2HBW A;  4Z89 A;  1UG1 A;  1AOJ A;  3UA7 A;  2GTJ A;  2K2M A;  4HVW A;  2JM8 A;  2AKK A;  2EW3 A;  4J9I A;  1PRL C;  3PVQ A;  4LUD A;  4AG1 C;  4J9B A;  2V1R A;  1U5S A;  4HVU A;  1AD5 A;  2RQV A;  1I07 A;  2JW4 A;  3EGU A;  1X6G A;  2HSP A;  1SPK A;  2CUD A;  2DE0 X;  2J7I A;  1NEB A;  2DL5 A;  2KXC A;  1ZUU A;  1K0X A;  1ZUY A;  2LX7 A;  3QWY A;  4RTY A;  4AFZ C;  1HJD A;  1WXB A;  2KGT A;  2FPF A;  3JV3 A;  1BK2 A;  2NUZ A;  3NPF A;  3SEM A;  3H41 A;  2YUN A;  3M0P A;  2KR3 A;  1VYT A;  2K7A A;  1NYG A;  3EG3 A;  2EGA A;  1OV3 A;  4AFU C;  1T0H A;  2YUP A;  1WIE A;  2J6O A;  2DL4 A;  3NHN A;  5GJW B;  2KT1 A;  2CT3 A;  5IHI A;  4HVV A;  1AWX A;  1SHF A;  2HEQ A;  1UFF A;  2C0O A;  2DLP A;  1ZUK A;  2W10 A;  2O88 A;  2GBQ A;  1PHT A;  4RTX A;  3TSW A;  2GGR A;  1XOV A;  4X1V A;  2EGC A;  1WFW A;  1LCK A;  2K6D A;  1GCP A;  3ULR B;  1OEB A;  4JZ4 A;  2EGE A;  4IIM A;  4J9H A;  3VS0 A;  2F2V A;  5IHN A;  1H92 A;  2JTE A;  1PKS A;  2DM1 A;  2DRK A;  2GTO A;  1NG2 A;  2MIO A;  1V1C A;  1OPL A;  3THK A;  3M0Q A;  1M8M A;  2O9S A;  2FRY A;  2BTT A;  4RUG A;  2AKL A;  1RLQ C;  3C0C A;  2KEA A;  4JZ3 A;  2RQU A;  1BBZ A;  1UTI A;  2CSI A;  3UA6 A;  3M0R A;  3EG2 A;  4ZNX A;  2LJ3 A;  1KSW A;  2IIM A;  2J06 A;  1WYX A;  4RTT A;  5EC7 A;  1WXT A;  4FSS A;  1ABQ A;  2JM9 A;  4F16 A;  4F17 A;  4E6R A;  3M0U A;  1WLP B;  2YT6 A;  1UHC A;  2EBP A;  1IO6 A;  2X3X D;  4Y92 A;  4CC3 A;  4EIK A;  4LNP A;  1PRM C;  4F14 A;  4LUE A;  1K0S A;  4HXJ A;  2DJQ A;  1S1N A;  2LJ0 A;  4M4Z A;  5FW9 A;  1X43 A;  2C0I A;  2EYY A;  1GFD A;  2FRW A;  3PVL A;  4AG2 C;  2KRO A;  3UF4 A;  3VS1 A;  2DL7 A;  5IHK A;  2EKH A;  4GLM A;  1NLO C;  2LJ1 A;  1GBR A;  1MV3 A;  2PNI A;  4WCI A;  2L3Q A;  3CQT A;  1SSH A;  2DIL A;  4Z8A A;  5HCK A;  1QLY A;  1B3Q A;  3NMZ C;  2B86 A;  1ABO A;  1PNJ A;  1K9A A;  1GRI A;  2O2O A;  2J6F A;  1QCF A;  1ZX6 A;  1YNZ A;  1M3C A;  1M27 C;  4ESR A;  1K76 A;  3I9Q A;  1X69 A;  2DL8 A;  4JJB A;  4D8D A;  2EYW A;  1AWJ A;  2C0T A;  3M0T A;  5I11 A;  2D1X A;  1JO8 A;  4IIO A;  2D8J A;  2KXD A;  2F2X A;  2A28 A;  1UUE A;  2L3S A;  2RPN A;  2FO0 A;  5ECA A;  2EPD A;  1SRL A;  3H0H A;  2ENM A;  2DVJ A;  4AFQ C;  1WI7 A;  2BZ8 A;  1OPK A;  2LNH B;  2MCN A;  2K79 A;  1I1J A;  1W6X A;  2ED0 A;  2KRS A;  1VA7 A;  1HSQ A;  1K4U S;  2RNA A;  2LCS A;  1ZLM A;  2D8H A;  1KIK A;  1T3L A;  2XMF A;  2KRN A;  1X2K A;  1YWO A;  3SHW A;  3VS4 A;  2KYM A;  5IH2 A;  1GFC A;  2CRE A;  1U3O A;  2J05 A;  2KT8 A;  1BU1 A;  2O31 A;  1JU5 C;  2YUQ A;  1CKA A;  2VKN A;  2M51 A;  1Z9Q A;  2D0N A;  2DX1 A;  3REA B;  2KRM A;  4OMP A;  5FWB A;  2JT4 A;  1AZE A;  3VRY A;  1OOT A;  2SEM A;  1G2B A;  2A36 A;  1JQQ A;  1J3T A;  2DMO A;  3ZL7 C;  1SHG A;  2M0Y A;  2L3P A;  2ROT A;  1JEG A;  5GJV B;  3U23 A;  2JS0 A;  4LE9 A;  1QWE A;  4CC2 A;  1UJ0 A;  1RLP C;  2HDA A;  1BB9 A;  4GBQ A;  3VS7 A;  3UAT A;  3EG0 A;  1AWW A;  1K1Z A;  5L23 A;  1PKT A;  1PWT A;  2DF6 A;  1YN8 A;  2E5K A;  2YUO A;  2EVR A;  1NEG A;  1I0C A;  1FMK A;  1JXO A;  3REB B;  1M30 A;  2PZ1 A;  2F2W A;  2JXB A;  3GBQ A;  3EHR A;  3A98 A;  1B07 A;  2DBM A;  1Y0M A;  2A37 A;  5I22 A;  3R6N A;  5FWC A;  1MUZ A;  2CH4 W;  2P4R A;  1UJY A;  4J9C A;  1NM7 A;  1X2Q A;  1GCQ C;  1SEM A;  1YP5 A;  2JS2 A;  2LQW A;  2EYX A;  1RUW A;  4JJC A;  2KBT A;  3RBB B;  2DBK A;  1W70 A;  4RTZ A;  3I35 A;  4KRT A;  1T3S A;  2LMJ A;  3IQL A;  2A08 A;  2DA9 A;  2OI3 A;  1AZG B;  1E7O A;  2VVK A;  1GL5 A;  1ZBJ A;  4CC4 B;  2GNC A;  2CDT A;  2L2P A;  1W1F A;  3VS6 A;  3QWX X;  2ROL A;  2JMC A;  2RN8 A;  3I5R A;  2RMO A;  1KJW A;  1YCS B;  1EFN A;  3H0F A;  2QDL A;  1QWF A;  2J6K A;  3VS3 A;  1M3B A;  2ED1 A;  2RQR A;  2EYZ A;  2OAW A;  1GCQ A;  1AWO A;  4AFS C;  1WDX A;  3KFV A;  2DNU A;  4OMQ A;  2HCK A;  2AZV A;  2RQT A;  1X6B A;  2GQI A;  1TUC A;  1UHF A;  1H3H A;  2NWM A;  4OMN A;  2ESW A;  2PTK A;  2DYB A;  1WA7 A;  2AZS A;  2DL3 A;  1JXM A;  2LP5 A;  4LN2 A;  4OMM A;  4ORZ A;  2CH4 A;  4J9F A;  1KFZ A;  1E6H A;  1YWP A;  1FYN A;  1CKB A;  1GBQ A;  2BZX A;  2VWF A;  4HCK A;  1T0J A;  4OML A;  4DEY A;  1VYV A;  4R0K A;  2FPE A;  1ARK A;  1A0N B;  1RI9 A;  4JJD A;  2YSQ A;  1ZSG A;  3PE0 A;  2MOX A;  1HD3 A;  1QKW A;  2YDL A;  3EHQ A;  2KYB A;  1MV0 B;  3O5Z A;  2FEI A;  4RTW A;  2L0A A;  2H8H A;  1H8K A;  1M3A A;  4OMO A;  2I0N A;  2BZY A;  1N5Z A;  4J9G A;  1NLP C;  1AVZ C;  2RF0 A;  2CUB A;  2O9V A;  1E6G A;  2ABL A;  3H0I A;  2SRC A;  4Z88 A;  2KE9 A;  1QKX A;  2G6F X;  1U06 A;  1Z9Z A;  1TG0 A;  2FG0 A;  4RTV A;  3RNJ A;  4DEX A;  3M0S A;  2OJ2 A;  2FPD A;  4QT7 A;  3NGP A;  4J9E A;  1UGV A;  2DRM A;  4JPB W;  2K3B A;  4RTU A;  1X27 A;  3FJ5 A;  4J9D A;  1UEC A;  1VYU A;  1AEY A;  3VS2 A;  2JMA A;  2CSQ A;  5IXF A;  1CSK A;  4K11 A;  1SRM A;  3LH5 A;  2ECZ A;  4CC7 A;  2EQI A;  1WXU A;  4A63 B;  3EG1 A;  3VRZ A;  2AK5 A;  3VS5 A;  3TVT A;  2RQW A;  2LZ6 B;  1UE9 A;  2K9G A;  1WX6 A;  3I5S A;  5IXB A;  2X3W D;  3TSZ A;  2W0Z A;  2LQN A;  2CT4 A;  1NYF A;  2KNB B;  1Y57 A; 
#chains in the Genus database with same CATH topology
 3M59 A;  5GAN h;  1N8R R;  2HBW A;  1PSF A;  3CD6 T;  4FIB A;  3F70 A;  3UA7 A;  3TU4 K;  2JM8 A;  2EW3 A;  4IUT A;  1ZBX A;  3PVQ A;  5I21 A;  1PD1 A;  4M7D G;  2RI5 A;  2DO3 A;  2PU9 B;  2V1R A;  4XQ3 A;  3A1P A;  3HHT B;  4B9X A;  4II1 A;  1AD5 A;  3EGU A;  2CUD A;  2DE0 X;  4XTZ A;  2D0Q B;  1G3W A;  3H6Z A;  1NEB A;  5LJ5 j;  2KXC A;  2HQX A;  1ZUY A;  2LX7 A;  3QWY A;  3CC7 T;  3SFM A;  1QVG S;  3NPF A;  3SEM A;  1QCO A;  3RKY A;  4O5V A;  1BI3 A;  3M0P A;  3L1A A;  3LH0 A;  1VYT A;  3A8G B;  1T0H A;  4M75 E;  1VQP Q;  1WIE A;  2DL4 A;  4KBM B;  2DVE A;  2EKO A;  1G8X A;  4C92 A;  4HVV A;  2IVW A;  2HEQ A;  1UFF A;  4FYV B;  5CAI A;  1ZUK A;  2AHJ B;  2O88 A;  4RTX A;  3G4S A;  3CPW S;  5GMK l;  4X1V A;  2B8A A;  2VC8 A;  1WFW A;  3OQ5 A;  1GCP A;  4E47 A;  3PT9 A;  3CCL Q;  4JZ4 A;  3MJX A;  2EGE A;  3DLM A;  3OB9 A;  4M78 D;  3T9N A;  3MCA B;  4EMH A;  3DLL A;  3QBY A;  4C92 B;  4BY6 C;  4JLI A;  5A2Q E;  3JRZ A;  3CBP A;  2ZPH B;  3M0Q A;  3INZ A;  2QQR A;  4A4F A;  4FT4 A;  1W2B S;  1RLQ C;  4ZN1 A;  1D1A A;  2WSF E;  3I55 Q;  3M0R A;  4QKU A;  5CKE A;  4ZNX A;  2DD4 A;  2NLU A;  2VGN A;  2LJ3 A;  2IIM A;  1IB8 A;  4HA8 A;  1GXI E;  2OTL Q;  2GQV A;  2JM9 A;  4F17 A;  2EQU A;  2NYS A;  3CCE A;  1X01 A;  2EBP A;  4Y92 A;  3ASK A;  4F14 A;  1KQ1 A;  1K0S A;  3G1J A;  3PNW C;  5FW9 A;  5GAM g;  2C0I A;  2K2V A;  2FRW A;  3OA6 A;  1IRX A;  1R0C B;  1VQM T;  4IUR A;  3EFO A;  2CP7 A;  2DL7 A;  3OSV A;  3MEW A;  1QP2 A;  4GLM A;  3MP6 A;  1NLO C;  3ZFJ A;  3CQT A;  1K9M U;  3M4G A;  5HCK A;  1B3Q A;  5CQY A;  1YCY A;  1GRI A;  3JCM P;  1QCF A;  1M3C A;  4M7A C;  1KHC A;  3HRT A;  4M77 E;  4Y91 A;  4M75 B;  2QYZ A;  3M55 A;  4JJB A;  2ZAE A;  2EYW A;  1M1F A;  3FEO A;  2ZPI B;  5I11 A;  3I56 A;  5CQX A;  3L2R A;  2A28 A;  4M75 F;  3P8H A;  3JCM b;  5CKB A;  1OPK A;  2CZ0 B;  1EIF A;  1VQ5 A;  1LPL A;  1YJ9 Q;  1YI2 Q;  5J39 A;  4ELZ C;  1VQ4 T;  1HSQ A;  1K4U S;  4FT2 A;  2D8H A;  2DZ9 A;  1TS9 A;  4KUI A;  4RMO A;  1YWO A;  2HL5 C;  3CMA A;  1YIT Q;  3TEE A;  2QEX T;  5A0D A;  1BI2 A;  2PVG B;  4C5E A;  1BU1 A;  4X9D A;  1ZSZ A;  3SWN A;  3NTK A;  1WJQ A;  2D0N A;  2QTX A;  2KRM A;  4OMP A;  3VKI A;  3CCS Q;  1J3T A;  1YHQ A;  2WSE E;  4OB1 B;  2K3X A;  3FB9 A;  1QWE A;  3OYH A;  1UJ0 A;  3BW1 A;  5GAN g;  3PMT A;  3OMG A;  1AWW A;  1KC8 C;  5L23 A;  4J6W A;  2E3I A;  1PWT A;  2DF6 A;  4IKF A;  2E5K A;  2LT4 A;  8ATC B;  1N8R U;  1ZSZ B;  2PVO B;  2RM4 A;  1WHL A;  3SWN B;  1JXO A;  1K8A U;  1PG5 B;  2F2W A;  3ER0 A;  3GBQ A;  3A98 A;  3R6N A;  1C0M A;  1MUZ A;  4XAX B;  2CH4 W;  5A0G A;  5IAY A;  1UJY A;  1Q82 R;  1NM7 A;  4N4H A;  5FU6 C;  1AHJ B;  4PJN A;  1VQP T;  3LX7 A;  1RAB B;  1SEM A;  3S3O A;  2ZCF B;  3GPL A;  1TU0 B;  3BE3 A;  3QUI A;  2VB6 A;  4RKU E;  3OS1 A;  1WHK A;  4E7H A;  2DBK A;  1W70 A;  4XK8 E;  4M77 F;  3JCM g;  4RTZ A;  3S3N A;  1T3S A;  2XDP A;  4A54 A;  4C0D C;  3CCL T;  2QI2 A;  4KGZ B;  1M2V A;  1D1B A;  4N0A C;  4CC4 B;  2GNC A;  2QQS A;  3E1S A;  2RK1 A;  3QWX X;  3CCR A;  2ROL A;  4J6Y A;  2JMC A;  2RN8 A;  3PTA A;  4C92 D;  2E6N A;  2QDL A;  2J6K A;  4L5G A;  1M1K U;  2K3Y A;  1M3B A;  4OGC A;  1VQ6 A;  3BDU A;  4J83 A;  2RQR A;  2YXY A;  2OAW A;  1AWO A;  1EX4 A;  2EFI A;  4M7A G;  3JB9 F;  4J6X A;  2RJC A;  4OMQ A;  3I55 T;  2GFA A;  1M2V B;  2RHY A;  3FJP A;  4M78 E;  2AZV A;  1TUC A;  2X4J A;  4NOY A;  1H3H A;  2OTL T;  2NWM A;  5LJ5 h;  3JCM V;  2DXC A;  2DYB A;  2AZS A;  2FZG B;  2LP5 A;  1JXM A;  3X20 B;  5C0M A;  4M7D A;  1VQL Q;  2K5F A;  4J9F A;  2GCX A;  4J5Y A;  4A53 A;  4PK4 A;  3CME A;  2VWF A;  1U8R A;  5FRM A;  4BE1 A;  3EG9 A;  1Q81 C;  2E65 A;  1WHG A;  1VYV A;  4R0K A;  2FPE A;  2LDM A;  3VUZ A;  3QDF A;  1OI1 A;  2CZ7 B;  4J7I A;  5C6S A;  1HD3 A;  1I4K 1;  1QKW A;  2KYB A;  1YJN Q;  5HY6 A;  4M7D B;  2Z0W A;  3QKJ A;  2CYZ B;  2H3J A;  2OAU A;  1AVZ C;  5I2S A;  3UWN A;  2QA4 Q;  1JJ2 A;  2DTI A;  1KD1 R;  3GLX A;  2QG9 B;  1QKX A;  1U06 A;  5FU7 C;  1TG0 A;  4KUD K;  3L2U A;  3EH2 A;  3RNJ A;  5KCH A;  1YIJ A;  4XU0 A;  1FMV A;  2MYS A;  4JS4 A;  3J81 E;  3CCV A;  3RMS A;  2I2L A;  2CP3 A;  2ZGW A;  3KBG A;  4F7U A;  1YJ9 T;  3VS2 A;  1YI2 T;  5IXF A;  4K11 A;  1D0Z A;  2RHI A;  4FSX A;  4ZGD B;  3OYJ A;  1FMW A;  3OYA A;  1WXU A;  1JBM A;  3VRZ A;  2HQE A;  1K73 R;  2LZ6 B;  3PMI A;  5IN1 A;  1UE9 A;  1VIF A;  4LDV A;  1YIT T;  2K9G A;  1WX6 A;  3I5S A;  5IXB A;  2X3W D;  1XJW B;  3LLR A;  2BUD A;  1NYF A;  4F7U B;  5KCO A;  4ZGE B;  1XNI A;  1G83 A;  3QSU A;  3MKD A;  1Q7Y R;  2DXU A;  5GAO m;  2GTJ A;  3CCS T;  4HVW A;  1R0B G;  2R58 A;  3OW2 P;  4JLG A;  4F7U F;  1PRL C;  1UB4 A;  4QQ6 A;  3RKW A;  5FRN A;  4M78 F;  4AG1 C;  4FW2 A;  2YLB A;  1WQ7 A;  2QAS A;  5GAO p;  1H3Z A;  2YRV A;  2X35 A;  2X4W A;  2XI9 A;  5DLQ E;  1VQK Q;  2RQV A;  4HKE A;  1WHH A;  4N4G A;  2HSP A;  1SPK A;  3H8Z A;  2J7I A;  3RR6 A;  2P0Q A;  3JAM E;  5CCA A;  1K0X A;  4FYY B;  2O4X A;  2JN0 A;  1WXB A;  2KGT A;  4WTO B;  3SB2 A;  2FPF A;  2FL7 A;  2ZZD A;  2NUZ A;  1WJR A;  2ATC B;  4DOV A;  2EGA A;  1OV3 A;  2YUP A;  1Y07 A;  2J6O A;  1KG1 A;  3HPW A;  2KT1 A;  1ZHI A;  3NFC A;  2CT3 A;  1K9M C;  5KH6 A;  3M54 A;  5CKD A;  2L89 A;  1AWX A;  1G3T A;  1SHF A;  2C0O A;  3JB9 H;  2W10 A;  1M90 R;  2GBQ A;  3V8L A;  3TSW A;  5GAM d;  2EJ9 A;  2CZ1 B;  2EGC A;  2E5Q A;  2AT1 B;  2O4X B;  1FXX A;  2MWO A;  1LCK A;  5CR2 A;  4EDU A;  2QGG A;  1BCO A;  1Q82 U;  2LRQ A;  2DXT A;  2L3R A;  3OYF A;  3CC4 Q;  1QQJ A;  5IHN A;  5L8R E;  2JTE A;  1PKS A;  3A8M B;  1D3B A;  3EGX A;  5CO7 A;  1F1B B;  1NG2 A;  2MIO A;  1V1C A;  3THK A;  3QII A;  1M8M A;  1OQK A;  2O9S A;  1SG5 A;  2FRY A;  2BTT A;  4RUG A;  1YJW Q;  4JZ3 A;  3D7S B;  1QVP A;  3PIO A;  2EQM A;  2JZ2 A;  2J06 A;  1WYX A;  4RTT A;  1NBE B;  3V7S A;  4C8Q C;  4C92 E;  1ABQ A;  1N27 A;  2EJF A;  1VQ8 Q;  4E6R A;  3EGX B;  1VQL T;  3M0U A;  1S72 A;  1PC0 A;  4DA4 A;  1WLP B;  1OX9 A;  2X3X D;  4JDS A;  2NUT A;  4EIK A;  5CK9 A;  1EZZ B;  1S1N A;  4OMF B;  5CIU A;  3MP8 A;  1X43 A;  2EYY A;  1GFD A;  3PVL A;  2RH2 A;  2PVD B;  3UF4 A;  3E2U A;  2OX7 A;  5IHK A;  5KE2 A;  2LJ1 A;  2KSS A;  2PNI A;  3OYK A;  1LNX A;  1C6V X;  3MHX A;  1YJN T;  1VQ7 A;  1ACM B;  5LJ3 d;  4Z8A A;  1KQ2 A;  2QQ9 A;  1Y96 A;  2DAQ A;  4M7D D;  3SD4 A;  1PNJ A;  2QA4 T;  5GAO q;  2NUT B;  3QYG B;  4J7F A;  4MZM A;  1K76 A;  5GAN 4;  2EAY A;  1X69 A;  1K8A C;  2C0T A;  3M0T A;  5FLX E;  1Q86 C;  4PJM A;  4YTL A;  4IIO A;  2KXD A;  3VYG A;  5GAN d;  4C5G A;  4BB7 A;  1SF9 A;  4HCB A;  1Y96 B;  2XIC A;  2RPN A;  2DET A;  1TOV A;  2DEU A;  3H0H A;  4MZT A;  3QHS A;  1WI7 A;  2JOY A;  3JCM h;  1KD1 U;  4BI8 B;  2K79 A;  1VA7 A;  4PJO C;  2P4T A;  5GAO n;  5GAO r;  2V8J A;  1YBY A;  2RJD A;  1O75 A;  1JJ2 S;  1X2K A;  4M7A A;  2DFU A;  3CCL A;  2CRE A;  4F04 B;  1U3O A;  3CCQ A;  4PLI A;  2KT8 A;  4JUV A;  3M57 A;  3G6E A;  2K4Y A;  4LDU A;  1CKA A;  1D0Y A;  3OYI A;  1M1K C;  2VKN A;  2M51 A;  2HMA A;  1Z9Q A;  3JB9 J;  3JCM d;  2DX1 A;  3HRU A;  3REA B;  1AZE A;  2OTJ A;  1OOT A;  1G2B A;  1JQQ A;  3OS2 A;  4OF1 A;  5GMK e;  3ZL7 C;  4XTV A;  2E1H A;  1K73 U;  2ROT A;  3U23 A;  4LE9 A;  4CC2 A;  2HDA A;  3G4S Q;  2M0O A;  4UC4 A;  1VQK T;  4GBQ A;  3V8K A;  4C92 F;  1K1Z A;  4BAC A;  3BY7 A;  2HKQ B;  1PKT A;  2EJG A;  2FVU A;  3HKS A;  3MEV A;  2EQK A;  2KDS A;  1I0C A;  2L8D A;  1KQS P;  1HK9 A;  3REB B;  3GOX A;  3L2Q A;  3CXC P;  3EHR A;  1B07 A;  3WXM B;  5I22 A;  3DB3 A;  5FWC A;  2JUF A;  4J9C A;  1X2Q A;  2RB6 A;  3VU3 C;  1MMD A;  2RO0 A;  2XU8 A;  1TSF A;  3EAE A;  2DKG A;  1N9S A;  1RUW A;  4C8Q G;  5A0L A;  1HYO A;  3RBB B;  4QW2 A;  1BCM A;  3OY9 A;  3TRE A;  2LQK A;  3CCE Q;  4QVC A;  1RI0 A;  1U1T A;  2VVK A;  3QDR B;  4CI0 C;  5HK0 A;  3CC4 T;  1OU8 A;  2K5L A;  3EFO B;  2EWN A;  3I5R A;  1IXD A;  1EFN A;  1QWF A;  3RKX A;  1NJI U;  4L6V 5;  3VS3 A;  1QVF P;  2ED1 A;  2HL3 A;  1M90 U;  5GAM f;  1B34 A;  2EYZ A;  3MP1 A;  3EGD A;  4QQD A;  1YJW T;  1QMC A;  4AFS C;  1WDX A;  2CP2 A;  1G3Y A;  5M9O A;  3KFV A;  2BKD N;  4P5N A;  4BE2 A;  2DNU A;  1UEB A;  5D6Y A;  2RQT A;  3J7A F;  4A4G A;  1G5V A;  4OMN A;  1VQ8 T;  1XTD A;  3I56 Q;  4LN2 A;  1KFZ A;  1E6H A;  1B34 B;  3AHU A;  4N0A A;  1YWP A;  5FU6 B;  3EGD B;  4LXC A;  4JRK A;  4C0F A;  3CC2 A;  3M56 A;  4PJO G;  3QO3 A;  1ARK A;  1VQ5 Q;  2NUP A;  1B7T A;  1IRE B;  3EHQ A;  3PGG A;  1MV0 B;  3V8J A;  1D09 B;  2FEI A;  2GF7 A;  4RTW A;  2QQA A;  5D7U A;  1WZO A;  4J9G A;  1OUL A;  2CUB A;  2V26 A;  1VQO A;  3CMA Q;  3HL8 A;  1KC8 R;  3G71 A;  1TH7 A;  2KE9 A;  2G6F X;  1Z9Z A;  4FW1 A;  4M75 C;  2K57 A;  4DEX A;  2NUP B;  2FPD A;  4HCZ A;  1TWB A;  5LJ3 f;  5GAN 8;  4J9E A;  1UGV A;  4M7D E;  3MEU A;  4DBR A;  4JPB W;  1UGP B;  2KQW A;  4RTU A;  3RIR A;  3OYM A;  1YHQ Q;  3LGF A;  5CVI A;  2PUK B;  4J9D A;  1UEC A;  1VQ9 A;  1VQN A;  2CSQ A;  2ZPF B;  2ECZ A;  2EQI A;  5KYY A;  3E9G A;  4BDZ A;  4XTU A;  1QP3 A;  2FZC B;  4A63 B;  2KY9 A;  2QQB A;  3WVE B;  3VS5 A;  4Q5W A;  5GAN f;  3OYY A;  4LD9 K;  1JRI A;  2VXF A;  2IPO B;  3CCM A;  2KNB B;  2X51 A;  4PFP A;  4D8K A;  1UDL A;  1TUD A;  2LCL A;  4ATO A;  4HT9 A;  4Z89 A;  1VIE A;  1WGS A;  2EQJ A;  2XK0 A;  1UG1 A;  2F5K A;  4QQG A;  5KYY B;  4QVD A;  3JSC A;  4MML A;  3FIF A;  4XU3 A;  4LUD A;  3G4S T;  4BUG A;  2MWP A;  3UDC A;  4M7A D;  5HK3 A;  1U5S A;  4HVU A;  1BI1 A;  5FU7 B;  4F7U E;  1I07 A;  5DM7 R;  3OYC A;  5DLO A;  4BI4 A;  3PIP A;  1YFN A;  1IGQ A;  3X26 B;  3CCU A;  2DPP B;  4PFZ A;  3CCR Q;  2E10 A;  1ZUU A;  2HZY A;  8AT1 B;  3OYE A;  1N9R A;  5KYU A;  1QCN A;  3JV3 A;  3CCJ A;  1VQ6 Q;  4PKC C;  3H41 A;  2YUN A;  6AT1 B;  2KR3 A;  4DBF A;  3EG3 A;  2YRD A;  3CD6 A;  4M77 C;  1Q81 R;  1YJN A;  2X4Y A;  2DLP A;  3JB9 I;  1XOV A;  1WPY A;  3CCE T;  5LJ5 d;  5KYU B;  2K6D A;  2JVV A;  5GAM e;  1VOM A;  3CME Q;  2IG0 A;  3EG9 B;  2VYT A;  4M7D F;  2DIG A;  2RK2 A;  1OZ3 A;  3PFS A;  1H92 A;  3OW2 A;  2DM1 A;  2DRK A;  3P8B B;  2GTO A;  1VUB A;  4BDY A;  3WVD B;  3CC7 A;  3OS0 A;  4EPC A;  1PM3 A;  2C06 A;  2KEA A;  4FL6 A;  1BBZ A;  2MMP A;  3HRS A;  3UA6 A;  4M75 G;  5D6W A;  3EG2 A;  3QXE B;  1Y71 A;  3TCJ A;  1KSW A;  1OU9 A;  5EC7 A;  2DZC A;  1MHN A;  1WXT A;  3SDZ A;  4FSS A;  3R6O A;  3I56 T;  4BD3 A;  2RA2 A;  2DJZ A;  1UHC A;  3FC3 A;  1YIJ Q;  2XDB A;  4KT0 E;  1IO6 A;  4CC3 A;  3MO8 A;  1PRM C;  5D6X A;  2DJQ A;  1OX8 A;  4M4Z A;  2DK3 A;  3CCV Q;  3NTI A;  1M8V A;  2RI3 A;  4AG2 C;  1QVG P;  1P92 A;  3OBY A;  1VQ5 T;  2EKH A;  2A0F B;  4XTX A;  1GBR A;  3AT1 B;  3QJY A;  4WCI A;  2L3Q A;  3OYL A;  1QLY A;  4AT1 B;  2COY A;  1K9A A;  4FM4 B;  1MMN A;  1ZX6 A;  2JJ9 A;  3DKM A;  5LJ3 e;  3CMA T;  4HCC A;  3CPW P;  1KK7 A;  4ESR A;  4V2S A;  4KUL A;  4C8Q A;  3I9Q A;  2QTV A;  4D8D A;  3X28 B;  4PFO A;  1AWJ A;  2XG8 D;  1ZQ1 A;  1JO8 A;  2RD1 A;  3RDV A;  2XHC A;  1H64 1;  1M5Q 1;  2HAX A;  4Z02 A;  1YHQ T;  2EPD A;  2ENM A;  2DVJ A;  4AFQ C;  5I2M A;  5GMK j;  2BZ8 A;  2LNH B;  5GAN e;  9ATC B;  1VQM A;  1TTH B;  1KC8 U;  2ED0 A;  2EYQ A;  2CKK A;  1IZ6 A;  4C8Q B;  1W2B P;  2HD0 A;  2RNA A;  1K9M R;  4LDW A;  1KIK A;  2VAS A;  4ZN3 A;  5J3B A;  2JTF A;  2VXE A;  2DD5 A;  2KRN A;  1TUG B;  4OP0 A;  4XTY A;  4L59 A;  5KYN A;  5IH2 A;  1GFC A;  1O9S A;  1OYX A;  2XD0 A;  3CBM A;  4E7Z A;  4A4E A;  1BI0 A;  2J05 A;  4M77 D;  4M77 G;  5GAO l;  4HT8 A;  2QXF A;  4MDW A;  5GAN 5;  2O31 A;  1JU5 C;  2RHZ A;  2YUQ A;  1NJI C;  4M78 C;  2CP5 A;  2FZK B;  4FYW B;  1WQW A;  3QYH B;  2JT4 A;  2SEM A;  1SHG A;  2M0Y A;  2L3P A;  3O8V A;  1JEG A;  5GJV B;  2JS0 A;  3FDR A;  4PNO A;  4C5H A;  3JCM e;  1G3S A;  3VS7 A;  3EG0 A;  3TQ7 P;  4PJO A;  1WNL A;  1VQ4 A;  2RHX A;  2YUO A;  4MZP A;  2DTH A;  1NEG A;  1HXD A;  1D0X A;  1IHV A;  3JB9 G;  3CCR T;  1FMK A;  1M30 A;  4EMK C;  1D3B B;  2JXB A;  2DBM A;  2X9H A;  2DXB A;  4C0Z A;  1C1A A;  1VQ6 T;  2QEX A;  5GAN 6;  1U1S A;  2CGH A;  4M7A E;  2YHT A;  4GLK A;  1I81 A;  1UGS B;  3HP9 A;  1GCQ C;  2BIV A;  4CRI A;  2PQW A;  1W4S A;  2XID A;  1YP5 A;  4PJO B;  2LQW A;  2EYX A;  2D6F A;  2PUO B;  1OZ2 A;  2MK5 A;  5CKF A;  3V7R A;  2KBT A;  3UT1 A;  3NTH A;  3M4Y A;  4DQ2 A;  4RCB A;  4IUP A;  4FCY A;  4GY5 A;  3I35 A;  1S72 Q;  2LMJ A;  2QK0 A;  3IQL A;  2DA9 A;  5GMK m;  1NPR A;  2OI3 A;  1AZG B;  4R55 A;  3J80 E;  5IT9 E;  2QGF B;  3CME T;  3CBO A;  1N8R C;  1Q81 U;  4BY6 B;  3UPU A;  1K8A R;  3OMC A;  1JB0 E;  2RMO A;  1KJW A;  1YCS B;  1Q86 R;  3H0F A;  1FX7 A;  3ME9 A;  3ZBD A;  1VQ7 Q;  1DJ7 B;  5KE3 A;  5LJ5 f;  2FYK A;  2P0P A;  1VQP A;  3CPF A;  3GF5 A;  4OB2 B;  2GQI A;  1UHF A;  2MF2 A;  4ME7 A;  4X9C A;  4C5I A;  1KQS A;  3HFO A;  3CXC A;  3GIB A;  2PTK A;  2LCC A;  1WA7 A;  1YIJ T;  4XU1 A;  2CZ6 B;  4OMM A;  2CH4 A;  2HKN A;  2LTO A;  1NE8 A;  3C12 A;  3CCV T;  1R8O B;  4ANJ A;  2LX9 A;  4E7L A;  2CS7 A;  3LW5 E;  4DEY A;  3OW2 S;  2L5Q A;  3A8O B;  1RI9 A;  4JJD A;  4NL2 A;  2LNV A;  2AIR B;  1M1K R;  2MI6 A;  3OYB A;  3PE0 A;  3VJP A;  2YRC A;  4KGX B;  2BE9 B;  5HKC A;  1I5O B;  4NL3 A;  3S6W A;  1M3A A;  3FLG A;  2BZY A;  1N5Z A;  1X6O A;  2RF0 A;  4M7A B;  3I55 A;  4F7U G;  3CCQ Q;  4M78 G;  4JRP A;  2OTL A;  2FG0 A;  1M9S A;  2E4H A;  1Q7Y U;  2M02 A;  4JRI A;  3G6E Q;  2VV5 A;  4M7A F;  3QPH A;  1QVF A;  2DTO A;  3DB4 A;  2KK4 A;  2Y90 A;  2E64 A;  3NGP A;  1PSE A;  2EIF A;  2OTJ Q;  2VGM A;  3M9Q A;  1MMG A;  4R56 A;  3JCM Q;  1V29 B;  1RAA B;  5DY9 A;  3RER A;  1VYU A;  3L2Z A;  1M4Z A;  2E3H A;  3LYI A;  3KXT A;  2F1L A;  4C8Q D;  3QG1 A;  3LH5 A;  2XDD A;  1RL2 A;  1WHJ A;  3EFR A;  2AK5 A;  2ZPG B;  4PJL A;  4IUV A;  1RAI B;  1BIB A;  2D9T A;  2DIQ A;  2LQN A;  2CT4 A;  4M75 A;  4FU6 A;  1Y57 A;  2LC4 A;  2V1Q A;  4OVA A;  1UGQ B;  3EH1 A;  1I5L A;  2E12 A;  1AOJ A;  2K2M A;  4N4I A;  5GAN 3;  2AKK A;  4J9I A;  4C92 C;  1IGU A;  3ZEH A;  2RJE A;  3QJ6 A;  4LDY A;  4J9B A;  1UGR B;  1YJ9 A;  4MDX A;  1YI2 A;  4IUU A;  4XTW A;  1TXQ A;  4AMC A;  5J26 A;  2JW4 A;  3MET A;  1X6G A;  5CKH A;  5GAM j;  3CEY A;  2DL5 A;  1YIT A;  3GNF B;  2RI2 A;  4RTY A;  4AFZ C;  1HJD A;  3MPU B;  1BK2 A;  2O01 E;  5GMK h;  2YLC A;  1RAG B;  1Q95 G;  3MEA A;  4ELY C;  2K7A A;  1NYG A;  4AFU C;  2H3E B;  4WF2 A;  4PJO D;  3EFS A;  3NHN A;  5GJW B;  3QZ5 B;  3CCS A;  1M1G A;  1BIA A;  5IHI A;  2DEQ A;  2COZ A;  4D6W A;  1PHT A;  2GGR A;  1S72 T;  2K5I A;  4C0D B;  5LJ3 g;  3ULR B;  2Y4X A;  3N5B B;  1OEB A;  4IIM A;  4J9H A;  3VS0 A;  5GAN 7;  1NPP A;  5LJ5 e;  1ZA2 B;  2X4X A;  1RAF B;  3C4S A;  5GAN 2;  2F2V A;  3E19 A;  2FB7 A;  1MNE A;  3CC2 Q;  4PL6 A;  2QAZ A;  1VQ7 T;  1OPL A;  3BDL A;  2JTM A;  1Y7X A;  2BE7 D;  1QW1 A;  1LVK A;  4JS5 A;  3M5A A;  3S3M A;  1RAE B;  2AKL A;  3C0C A;  4M77 A;  2RQU A;  3URG A;  2ZPE B;  1UTI A;  2CSI A;  1VQO Q;  2E41 A;  5LJ3 j;  3G71 Q;  1SKU B;  4F16 A;  1Q86 U;  4J8O A;  2YT6 A;  3L2V A;  2F5T X;  1MMA A;  3H9N A;  4LNP A;  2M9U A;  1Q82 C;  4LUE A;  4HXJ A;  2LJ0 A;  3A8L B;  4M77 B;  1I8F A;  2KRO A;  3VS1 A;  1PCX A;  1VQ9 Q;  1WJS A;  1SSF A;  1VQN Q;  5GAN j;  1MV3 A;  3QZ9 B;  2WAC A;  1SSH A;  2DIL A;  3OBW A;  3NMZ C;  2B86 A;  1ABO A;  4BI3 A;  4LDX A;  2A3L A;  2HQH A;  2O2O A;  2J6F A;  4IUQ A;  4PLL A;  3JCM W;  1YNZ A;  1M27 C;  3CCQ T;  3CCM Q;  2KVQ G;  1KQS S;  4OB0 B;  2DL8 A;  3CXC S;  5KYX A;  3G6E T;  2D1X A;  2KI7 A;  1VQL A;  3JCM f;  1ZSZ C;  4C92 G;  3SWN C;  2D8J A;  3FRN A;  2OTJ T;  2F2X A;  3Q1J A;  1UUE A;  2DYI A;  2L3S A;  2FO0 A;  5ECA A;  4DBH A;  4RCC A;  1SRL A;  2MAM A;  3OYD A;  1BKB A;  2R5A A;  3KUF A;  4XU2 A;  2MCN A;  2KAF A;  4JJN K;  4DBQ A;  1I1J A;  1W6X A;  2KRS A;  2ZPB B;  2LCS A;  5KYX B;  1ZLM A;  1T3L A;  2XMF A;  3L42 A;  3CCU Q;  2QA4 A;  2LT1 A;  3SHW A;  3VS4 A;  1MGQ A;  2KYM A;  1IHW A;  1XQH A;  4KH0 B;  4BE0 A;  4OB3 B;  3LWH A;  2RJF A;  2DER A;  3CCJ Q;  2E70 A;  1QVG A;  3LGL A;  3JCM c;  2HNI A;  1QVF S;  1AT1 B;  1MND A;  4C8Q E;  4ZTF A;  2HSE B;  3CD6 Q;  5FWB A;  3VRY A;  2YWW A;  2A36 A;  1KHI A;  2DMO A;  1D1C A;  4JRQ A;  7AT1 B;  3V7C A;  1RLP C;  3OYG A;  3G7Z A;  3CPW A;  1BB9 A;  2JNG A;  2R57 A;  1KD1 C;  2M16 A;  3UAT A;  2CP0 A;  1RAH B;  4M75 D;  1WHM A;  1YN8 A;  4FYX B;  2EVR A;  5GMK i;  2FHD A;  4MMK A;  2PZ1 A;  1PD0 A;  4E7I A;  4B6M A;  1Y0M A;  2A37 A;  2P4R A;  3CC7 Q;  4M78 A;  2P0K A;  3A8H B;  2JS2 A;  3X25 B;  1W2B A;  3BFM A;  1N6A A;  4Y28 E;  4NS5 A;  2COW A;  4JJC A;  3HTR A;  4B9W A;  2V8I A;  1K73 C;  3E9F A;  1M2O A;  3OSS C;  4TVR A;  4KRT A;  1VQK A;  4M7D C;  2A08 A;  4E7K A;  1E7O A;  3RMQ A;  1JJ2 P;  1GL5 A;  1ZBJ A;  2CDT A;  1Q7Y C;  1LJO A;  4RG8 A;  2L2P A;  4KGV B;  4M78 B;  4VUB A;  1W1F A;  4O6J A;  3VS6 A;  4PJO E;  2Y4Y A;  2M1H A;  3CC2 T;  1RAC B;  4EMK A;  3L2W A;  3P8D A;  3HFN A;  3VUB A;  3OS5 A;  3LWI A;  1V76 A;  1GCQ A;  2VUB A;  3JCM J;  3M58 A;  1VQO T;  2HCK A;  4PJJ A;  2RHU A;  1X6B A;  3G71 T;  5GAM h;  2KMT A;  4DOW A;  2R5M A;  5FRO A;  2ESW A;  4EMK B;  2DL3 A;  3C94 A;  3M53 A;  2E6Z A;  2MPX C;  4ORZ A;  3VV0 A;  4KH1 B;  4A4H A;  1R77 A;  1FYN A;  4C8Q F;  1CKB A;  3RUX A;  1GBQ A;  2BZX A;  1NZ9 A;  3CC4 A;  2LQ8 A;  4HCK A;  1T0J A;  4OML A;  5LL6 S;  1VQ9 T;  1BYM A;  1VQN T;  3A5Z B;  1VQM Q;  1A0N B;  2YSQ A;  1ZSG A;  4QVZ A;  1NJI R;  1M90 C;  2MOX A;  2YDL A;  3O5Z A;  2L0A A;  4ZGJ B;  2H8H A;  1YJW A;  1H8K A;  4OMO A;  1LOJ A;  2I0N A;  2LVM A;  2QDY B;  1NLP C;  2O9V A;  1E6G A;  3CCM T;  2ABL A;  3H0I A;  2SRC A;  1RAD B;  4Z88 A;  2HBP A;  5KYW A;  3GNG A;  4E7S A;  4RTV A;  1VQ8 A;  3OYN A;  2XKO C;  3JB9 D;  3M0S A;  4OGE A;  2OJ2 A;  4QT7 A;  1X75 C;  2DRM A;  3HSB A;  2K3B A;  2GFU A;  3RES A;  1ZA1 B;  3C95 A;  5AT1 B;  1X27 A;  3FJ5 A;  2WSC E;  5EG2 A;  2V8K A;  3GP8 A;  1AEY A;  2P84 A;  2JMA A;  5LJ3 h;  3VYH B;  5KYW B;  1FWZ A;  3JCM X;  1CSK A;  1SRM A;  3X24 B;  1VQ4 Q;  4CC7 A;  5AYF A;  4ZTJ A;  2CP6 A;  3EG1 A;  3CCU T;  2G3R A;  3TVT A;  2RQW A;  4A4K A;  4X34 A;  4PJO F;  3TSZ A;  2F69 A;  2W0Z A;  3CCJ T;  4LD6 A;  2QEX Q;  4E2F B;  4EMG A;  4RG2 A;  5LJ5 g;  2A7Y A;  4C0G A;  4E7J A; 
#chains in the Genus database with same CATH homology
 1G83 A;  2V1Q A;  4D8K A;  1UDL A;  1TUD A;  2HBW A;  4Z89 A;  1UG1 A;  1AOJ A;  3UA7 A;  2GTJ A;  2K2M A;  4HVW A;  2JM8 A;  2AKK A;  2EW3 A;  4J9I A;  1PRL C;  3PVQ A;  4LUD A;  4AG1 C;  4J9B A;  2V1R A;  1U5S A;  4HVU A;  1AD5 A;  2RQV A;  1I07 A;  2JW4 A;  3EGU A;  1X6G A;  2HSP A;  1SPK A;  2CUD A;  2DE0 X;  2J7I A;  1NEB A;  2DL5 A;  2KXC A;  1ZUU A;  1K0X A;  1ZUY A;  2LX7 A;  3QWY A;  4RTY A;  4AFZ C;  1HJD A;  1WXB A;  2KGT A;  2FPF A;  3JV3 A;  1BK2 A;  2NUZ A;  3NPF A;  3SEM A;  3H41 A;  2YUN A;  3M0P A;  2KR3 A;  1VYT A;  2K7A A;  1NYG A;  3EG3 A;  2EGA A;  1OV3 A;  4AFU C;  1T0H A;  2YUP A;  1WIE A;  2J6O A;  2DL4 A;  3NHN A;  5GJW B;  2KT1 A;  2CT3 A;  5IHI A;  4HVV A;  1AWX A;  1SHF A;  2HEQ A;  1UFF A;  2C0O A;  2DLP A;  1ZUK A;  2W10 A;  2O88 A;  2GBQ A;  1PHT A;  4RTX A;  3TSW A;  2GGR A;  1XOV A;  4X1V A;  2EGC A;  1WFW A;  1LCK A;  2K6D A;  1GCP A;  3ULR B;  1OEB A;  4JZ4 A;  2EGE A;  4IIM A;  4J9H A;  3VS0 A;  2F2V A;  5IHN A;  1H92 A;  2JTE A;  1PKS A;  2DM1 A;  2DRK A;  2GTO A;  1NG2 A;  2MIO A;  1V1C A;  1OPL A;  3THK A;  3M0Q A;  1M8M A;  2O9S A;  2FRY A;  2BTT A;  4RUG A;  2AKL A;  1RLQ C;  3C0C A;  2KEA A;  4JZ3 A;  2RQU A;  1BBZ A;  1UTI A;  2CSI A;  3UA6 A;  3M0R A;  3EG2 A;  4ZNX A;  2LJ3 A;  1KSW A;  2IIM A;  2J06 A;  1WYX A;  4RTT A;  5EC7 A;  1WXT A;  4FSS A;  1ABQ A;  2JM9 A;  4F16 A;  4F17 A;  4E6R A;  3M0U A;  1WLP B;  2YT6 A;  1UHC A;  2EBP A;  1IO6 A;  2X3X D;  4Y92 A;  4CC3 A;  4EIK A;  4LNP A;  1PRM C;  4F14 A;  4LUE A;  1K0S A;  4HXJ A;  2DJQ A;  1S1N A;  2LJ0 A;  4M4Z A;  5FW9 A;  1X43 A;  2C0I A;  2EYY A;  1GFD A;  2FRW A;  3PVL A;  4AG2 C;  2KRO A;  3UF4 A;  3VS1 A;  2DL7 A;  5IHK A;  2EKH A;  4GLM A;  1NLO C;  2LJ1 A;  1GBR A;  1MV3 A;  2PNI A;  4WCI A;  2L3Q A;  3CQT A;  1SSH A;  2DIL A;  4Z8A A;  5HCK A;  1QLY A;  1B3Q A;  3NMZ C;  2B86 A;  1ABO A;  1PNJ A;  1K9A A;  1GRI A;  2O2O A;  2J6F A;  1QCF A;  1ZX6 A;  1YNZ A;  1M3C A;  1M27 C;  4ESR A;  1K76 A;  3I9Q A;  1X69 A;  2DL8 A;  4JJB A;  4D8D A;  2EYW A;  1AWJ A;  2C0T A;  3M0T A;  5I11 A;  2D1X A;  1JO8 A;  4IIO A;  2D8J A;  2KXD A;  2F2X A;  2A28 A;  1UUE A;  2L3S A;  2RPN A;  2FO0 A;  5ECA A;  2EPD A;  1SRL A;  3H0H A;  2ENM A;  2DVJ A;  4AFQ C;  1WI7 A;  2BZ8 A;  1OPK A;  2LNH B;  2MCN A;  2K79 A;  1I1J A;  1W6X A;  2ED0 A;  2KRS A;  1VA7 A;  1HSQ A;  1K4U S;  2RNA A;  2LCS A;  1ZLM A;  2D8H A;  1KIK A;  1T3L A;  2XMF A;  2KRN A;  1X2K A;  1YWO A;  3SHW A;  3VS4 A;  2KYM A;  5IH2 A;  1GFC A;  2CRE A;  1U3O A;  2J05 A;  2KT8 A;  1BU1 A;  2O31 A;  1JU5 C;  2YUQ A;  1CKA A;  2VKN A;  2M51 A;  1Z9Q A;  2D0N A;  2DX1 A;  3REA B;  2KRM A;  4OMP A;  5FWB A;  2JT4 A;  1AZE A;  3VRY A;  1OOT A;  2SEM A;  1G2B A;  2A36 A;  1JQQ A;  1J3T A;  2DMO A;  3ZL7 C;  1SHG A;  2M0Y A;  2L3P A;  2ROT A;  1JEG A;  5GJV B;  3U23 A;  2JS0 A;  4LE9 A;  1QWE A;  4CC2 A;  1UJ0 A;  1RLP C;  2HDA A;  1BB9 A;  4GBQ A;  3VS7 A;  3UAT A;  3EG0 A;  1AWW A;  1K1Z A;  5L23 A;  1PKT A;  1PWT A;  2DF6 A;  1YN8 A;  2E5K A;  2YUO A;  2EVR A;  1NEG A;  1I0C A;  1FMK A;  1JXO A;  3REB B;  1M30 A;  2PZ1 A;  2F2W A;  2JXB A;  3GBQ A;  3EHR A;  3A98 A;  1B07 A;  2DBM A;  1Y0M A;  2A37 A;  5I22 A;  3R6N A;  5FWC A;  1MUZ A;  2CH4 W;  2P4R A;  1UJY A;  4J9C A;  1NM7 A;  1X2Q A;  1GCQ C;  1SEM A;  1YP5 A;  2JS2 A;  2LQW A;  2EYX A;  1RUW A;  4JJC A;  2KBT A;  3RBB B;  2DBK A;  1W70 A;  4RTZ A;  3I35 A;  4KRT A;  1T3S A;  2LMJ A;  3IQL A;  2A08 A;  2DA9 A;  2OI3 A;  1AZG B;  1E7O A;  2VVK A;  1GL5 A;  1ZBJ A;  4CC4 B;  2GNC A;  2CDT A;  2L2P A;  1W1F A;  3VS6 A;  3QWX X;  2ROL A;  2JMC A;  2RN8 A;  3I5R A;  2RMO A;  1KJW A;  1YCS B;  1EFN A;  3H0F A;  2QDL A;  1QWF A;  2J6K A;  3VS3 A;  1M3B A;  2ED1 A;  2RQR A;  2EYZ A;  2OAW A;  1GCQ A;  1AWO A;  4AFS C;  1WDX A;  3KFV A;  2DNU A;  4OMQ A;  2HCK A;  2AZV A;  2RQT A;  1X6B A;  2GQI A;  1TUC A;  1UHF A;  1H3H A;  2NWM A;  4OMN A;  2ESW A;  2PTK A;  2DYB A;  1WA7 A;  2AZS A;  2DL3 A;  1JXM A;  2LP5 A;  4LN2 A;  4OMM A;  4ORZ A;  2CH4 A;  4J9F A;  1KFZ A;  1E6H A;  1YWP A;  1FYN A;  1CKB A;  1GBQ A;  2BZX A;  2VWF A;  4HCK A;  1T0J A;  4OML A;  4DEY A;  1VYV A;  4R0K A;  2FPE A;  1ARK A;  1A0N B;  1RI9 A;  4JJD A;  2YSQ A;  1ZSG A;  3PE0 A;  2MOX A;  1HD3 A;  1QKW A;  2YDL A;  3EHQ A;  2KYB A;  1MV0 B;  3O5Z A;  2FEI A;  4RTW A;  2L0A A;  2H8H A;  1H8K A;  1M3A A;  4OMO A;  2I0N A;  2BZY A;  1N5Z A;  4J9G A;  1NLP C;  1AVZ C;  2RF0 A;  2CUB A;  2O9V A;  1E6G A;  2ABL A;  3H0I A;  2SRC A;  4Z88 A;  2KE9 A;  1QKX A;  2G6F X;  1U06 A;  1Z9Z A;  1TG0 A;  2FG0 A;  4RTV A;  3RNJ A;  4DEX A;  3M0S A;  2OJ2 A;  2FPD A;  4QT7 A;  3NGP A;  4J9E A;  1UGV A;  2DRM A;  4JPB W;  2K3B A;  4RTU A;  1X27 A;  3FJ5 A;  4J9D A;  1UEC A;  1VYU A;  1AEY A;  3VS2 A;  2JMA A;  2CSQ A;  5IXF A;  1CSK A;  4K11 A;  1SRM A;  3LH5 A;  2ECZ A;  4CC7 A;  2EQI A;  1WXU A;  4A63 B;  3EG1 A;  3VRZ A;  2AK5 A;  3VS5 A;  3TVT A;  2RQW A;  2LZ6 B;  1UE9 A;  2K9G A;  1WX6 A;  3I5S A;  5IXB A;  2X3W D;  3TSZ A;  2W0Z A;  2LQN A;  2CT4 A;  1NYF A;  2KNB B;  1Y57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...