1JQQA

Crystal structure of pex13p(301-386) sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
ISEFGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, membrane protein
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PAS20
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jqqA00
4ORZA 1SPKA 2EGEA 2LJ0A 3I9QA 1IO6A 1AZEA 1UFFA 3LH5A 2ROTA 5IHIA 4HVWA 1AVZC 2CH4A 4D8KA 2D1XA 2MOXA 3UF4A 2RNAA 1MV3A 1X6GA 3M0SA 4CC4B 1T3SA 2JW4A 1JXMA 3C0CA 1UECA 3VS7A 2ABLA 5I22A 1BU1A 2HCKA 2D8JA 1AWOA 2E5KA 1ABQA 1A0NB 1B07A 2M51A 2DF6A 1GFDA 2KT8A 3FJ5A 3JV3A 2DMOA 2IIMA 2D0NA 3CQTA 4JZ3A 3VS1A 3EG1A 2B86A 3M0TA 4LE9A 2X3XD 2A36A 2VKNA 2KR3A 1Y0MA 2C0IA 2MIOA 4A63B 2LCSA 2CREA 2CSIA 2QDLA 1M3AA 2O9SA 1E6GA 2L2PA 1NG2A 4OMNA 2RQVA 1MUZA 3SHWA 2JT4A 1GBQA 3H0IA 4LUDA 3ULRB 2OAWA 2FRYA 1GFCA 2CDTA 2LP5A 2BTTA 2ECZA 2EQIA 1KSWA 2NUZA 3REBB 3I5RA 2BZXA 5EC7A 2RN8A 1B3QA 2YUNA 3TSZA 1UUEA 1ZUKA 2A37A 2LQWA 3UA6A 3VS5A 2EYWA 2DA9A 4LUEA 2J7IA 1PHTA 1T3LA 3NPFA 1BK2A 1NM7A 1UE9A 2CH4W 1JQQA 5ECAA 1YNZA 1UJ0A 1ARKA 1G2BA 1VYTA 1XOVA 1YN8A 1EFNA 2GTJA 2KROA 2BZYA 1QLYA 4DEXA 2KT1A 4GLMA 3RNJA 1H92A 4AFQC 3UATA 3VRZA 2EYXA 1YWOA 3R6NA 2EKHA 2GTOA 2YDLA 1K9AA 3M0RA 3NGPA 1WXBA 1RUWA 1WIEA 2L3QA 1ZX6A 3UA7A 1YWPA 4J9CA 2YUOA 2DRMA 5IHNA 1QWFA 1AZGB 2PNIA 2DLPA 2YUPA 2VWFA 1PNJA 2AZSA 1NLOC 1X2KA 1YCSB 2L3PA 1QCFA 1PWTA 1K0XA 2SEMA 1X6BA 1RLQC 2P4RA 1H3HA 2RQWA 2LNHB 2EVRA 1W6XA 2DNUA 4HVVA 2DL7A 1SRLA 2W10A 1UJYA 1BB9A 4D8DA 1KJWA 1QKWA 5IH2A 1SEMA 1NEBA 1ABOA 2G6FX 1GL5A 5GJWB 2RQUA 1CKAA 1TUCA 1K4US 4LNPA 2EYZA 2DL4A 1AWXA 1PKTA 2JMAA 1VYUA 2JM9A 2DJQA 5FWCA 1I07A 2ED1A 1OEBA 1SHGA 4J9GA 2XMFA 2K7AA 2EGAA 3PVLA 2DM1A 1M8MA 4JJDA 2DRKA 3VS0A 2DILA 2ROLA 1YP5A 2K9GA 3PE0A 5FW9A 2J06A 3NMZC 1KFZA 2FPFA 1OV3A 1M3BA 1HD3A 1OPKA 2LQNA 2YUQA 1M30A 1PKSA 4JZ4A 3KFVA 1KIKA 4M4ZA 1E6HA 3QWYA 2LZ6B 4OMOA 1ZBJA 3I5SA 4HXJA 1WA7A 1QKXA 2FG0A 4AG2C 2DVJA 1JO8A 1G83A 1GCQA 2AK5A 1GCQC 2CT3A 2ENMA 2KYBA 2DE0X 2RMOA 2J6KA 2O2OA 3TVTA 2LJ1A 4RTUA 4RTXA 2EGCA 4DEYA 2L0AA 1AWWA 1U3OA 4F14A 1WI7A 2EPDA 4Y92A 2I0NA 2ED0A 1CKBA 2JXBA 4F17A 1UTIA 2M0YA 2KXCA 2LX7A 1W70A 4J9EA 4OMPA 1K0SA 1S1NA 3U23A 2KE9A 1TUDA 5IXBA 1X2QA 4JPBW 2VVKA 3ZL7C 1NYGA 2DBKA 1OOTA 2K79A 3VRYA 2OJ2A 2J05A 1PRLC 1FMKA 3H0FA 3H41A 4F16A 2GQIA 2EYYA 4QT7A 1NYFA 3H0HA 1X27A 1QWEA 2KRMA 1VYVA 2F2XA 2FPEA 1Z9QA 2X3WD 1E7OA 2FRWA 3IQLA 2KBTA 1UHCA 1T0JA 1VA7A 2DL3A 4CC2A 1T0HA 3EGUA 1JXOA 1FYNA 1Z9ZA 2O31A 4EIKA 2CSQA 2F2VA 2KNBB 2LMJA 3NHNA 1NLPC 1ZLMA 1WXUA 2GNCA 1HJDA 1SSHA 4OMMA 1UGVA 2CUDA 3VS4A 4AG1C 3EHRA 4JJBA 2JM8A 2K2MA 1UDLA 2O9VA 3M0QA 4J9HA 5IXFA 1I1JA 1ZUYA 4LN2A 2D8HA 1X43A 2KGTA 4Z88A 4RTYA 1HSQA 3QWXX 2K3BA 3PVQA 2DBMA 4J9IA 1AWJA 4IIMA 1AOJA 4AFZC 2JS0A 4E6RA 2L3SA 2CUBA 1K1ZA 2K6DA 2FPDA 2PZ1A 1UG1A 3EG3A 1RLPC 1GBRA 2A28A 1Y57A 1V1CA 2H8HA 4CC3A 3VS6A 1U5SA 4RTZA 2AKKA 1I0CA 3RBBB 3A98A 1RI9A 2EBPA 1LCKA 1N5ZA 4HCKA 2A08A 3M0UA 1AD5A 2DYBA 2GGRA 3VS2A 1GCPA 1WX6A 1GRIA 1J3TA 1M27C 2FEIA 5HCKA 2BZ8A 1JEGA 2JS2A 3EG0A 2GBQA 4AFSC 4JJCA 2KRSA 4ZNXA 2PTKA 4KRTA 2DL5A 1M3CA 1OPLA 3VS3A 2W0ZA 2EW3A 2DL8A 1UHFA 4K11A 2HDAA 1SRMA 1WYXA 1W1FA 3EG2A 3M0PA 5I11A 4AFUC 4RUGA 5GJVB 5FWBA 1ZUUA 4ESRA 2YSQA 1WXTA 4J9BA 1PRMC 2J6FA 2KRNA 4RTWA 3REAB 2DX1A 1MV0B 2RQRA 1AEYA 1WDXA 2F2WA 4RTVA 2SRCA 2HBWA 1ZSGA 2KXDA 4RTTA 2RPNA 1BBZA 4CC7A 2KEAA 1WLPB 2AZVA 2RQTA 4Z8AA 4R0KA 2C0TA 4HVUA 2OI3A 5L23A 2V1RA 2J6OA 4OMLA 4X1VA 1JU5C 2C0OA 2HSPA 4WCIA 1SHFA 2NWMA 2KYMA 1H8KA 2FO0A 4GBQA 1CSKA 3EHQA 2AKLA 4IIOA 2LJ3A 3O5ZA 2HEQA 3I35A 1NEGA 1WFWA 4FSSA 2V1QA 3GBQA 2CT4A 5IHKA 2MCNA 4Z89A 4J9DA 1TG0A 2JMCA 2YT6A 2O88A 3THKA 2ESWA 2RF0A 3TSWA 4OMQA 2JTEA 1U06A 1X69A 3SEMA 4J9FA 1K76A
chains in the Genus database with same CATH superfamily
2LDMA 1S72T 3A5ZB 1JJ2P 3I9QA 1KG1A 3C94A 1UFFA 4HKEA 1BI3A 1PCXA 1QMCA 1SKUB 5GAMf 2K2VA 4HVWA 4D8KA 2D1XA 4CC4B 2FYKA 4FW1A 4QVCA 2CZ6B 1BI0A 3C0CA 3ER0A 4ELZC 1BU1A 1FXXA 4XU0A 1PC0A 1MMGA 2HMAA 1ABQA 2LQ8A 5FU7C 5GAOr 2M51A 4BACA 1VQOQ 3CCJQ 2DF6A 4KGZB 1VUBA 1GFDA 3FJ5A 3JV3A 4M7AA 2RHUA 2NYSA 1KD1R 3CCST 3VS1A 2B86A 4BD3A 2Y90A 1G3WA 3M0TA 1QVFP 5L8RE 1YJNA 2X3XD 5GAMj 2KR3A 3GPLA 2C0IA 4A63B 2LCSA 4C5IA 4M7AB 3OW2S 4B6MA 1M3AA 1VQPQ 2COZA 3JCMP 5KH6A 2JT4A 3L2ZA 3JCMX 1VQ7A 1PM3A 8AT1B 5GANg 1GFCA 2BTTA 1KSWA 3CCMA 2BZXA 4ZN3A 1NJIU 3QDRB 1YHQQ 1B3QA 2RHIA 2K3YA 3EFOA 5GMKm 1UUEA 5KCOA 4M78D 4JDSA 1SG5A 2J7IA 1VQ5T 1T3LA 2K57A 1WQ7A 1WJSA 3CCRT 3V8KA 4M7DE 2M02A 3EFOB 3I55A 4E7IA 1VQLQ 1ARKA 2WACA 2BIVA 1ZSZC 3P8HA 5FU6B 2RI5A 1M1KU 1LJOA 4OB1B 3G6ET 2GTJA 3G1JA 3G7ZA 1YIJT 3CC2Q 3OS0A 2LRQA 3VRZA 3R6NA 3M55A 1X6OA 2R58A 1K9AA 3TCJA 5GANh 4M78G 2DK3A 3OYBA 1WXBA 3CMAA 1WIEA 1ZX6A 3CMET 3JCMJ 1YWPA 4E7ZA 5GAMg 2YUOA 1VQKQ 2DRMA 1AZGB 3CC4Q 2PNIA 3VYGA 2VWFA 1M9SA 3CCEA 3CCLT 2M9UA 3LWHA 1X6BA 2C06A 4PFOA 1QQJA 2EVRA 4OMFB 1W6XA 2DNUA 2M16A 1NJIR 4A4KA 4FYVB 5GAOm 5FLXE 3JCMh 1NEBA 2AHJB 2QQSA 4LDXA 1GL5A 4XTVA 3V7CA 5LJ3d 1VQOA 3CCJA 4LDWA 1F1BB 1KHCA 4LNPA 1YJ9A 2EYZA 2RB6A 1K9MC 1PKTA 4FYYB 2JMAA 4C8QC 1OEBA 4J9GA 4ME7A 1VQ6T 3PVLA 1M1KR 2DM1A 1G5VA 3PGGA 5GAMh 4MMKA 2DRKA 3VS0A 2DILA 1VQ8Q 2ROLA 1YP5A 2ZPIB 3HP9A 2E6NA 2K9GA 1VQPA 3PE0A 1HD3A 4M78C 3M57A 2E5QA 1OU8A 1PKSA 3KFVA 4FIBA 3OB9A 2QI2A 1V29B 1WZOA 3LLRA 2CKKA 4HXJA 2LCLA 1YHQA 4AG2C 2XHCA 1QVGS 1LOJA 2A3LA 1JO8A 4M77G 4X34A 2MMPA 1UGSB 1G83A 3EH2A 4RCCA 2ENMA 2VYTA 4PKCC 3VJPA 2RMOA 4HT9A 1YJNT 5I2SA 5GMKi 3FRNA 2LJ1A 4KGVB 3OYAA 4N0AC 4QVDA 1VQLA 2EPDA 4C0DC 1O75A 2I0NA 2ED0A 1BIBA 3RKYA 2LX7A 2LC4A 1VQ7T 4J9EA 3U23A 3CC2A 2QXFA 2KE9A 3CCMT 3LW5E 5A2QE 5IXBA 2CP6A 3OYDA 4JPBW 3GNFB 5DLQE 5CKHA 2F5KA 2DBKA 2DD5A 2AIRB 3VRYA 2OJ2A 5D6YA 2YLBA 3X28B 2K5LA 1X01A 2DIGA 3S6WA 1S72Q 4PJOD 1DJ7B 4B9WA 4DBHA 1VQKA 1NYFA 4M7AE 3VUBA 1ACMB 3CC4A 1X27A 2KRMA 1N6AA 4ANJA 3IQLA 1VA7A 2DL3A 1JXOA 4LDVA 2OTLQ 2CSQA 1IHWA 4PJJA 2LMJA 2GNCA 1SSFA 3J80E 1JJ2S 4M77C 5FRNA 1UGVA 3VS4A 3C95A 1BI2A 2XKOC 4L6V5 3OYJA 2K2MA 1UDLA 3M0QA 4J9HA 2ZPFB 3CXCP 3S3OA 3CCSQ 4PJOG 4Z88A 1EIFA 2E65A 2QASA 5LJ5f 4JRKA 2DETA 2XIDA 1WHMA 2E10A 2CUBA 2DERA 2RD1A 3CCET 3EG3A 1D09B 1RAAB 1VQ8A 1Y71A 4CC3A 1TS9A 4NL2A 4RTZA 4VUBA 3G71Q 1I0CA 2LNVA 1KQSP 2MF2A 4HCKA 1LCKA 1N5ZA 5KYYB 3FC3A 5AYFA 2FL7A 4A4EA 3DKMA 5FROA 1VQOT 2JTMA 3BDUA 3MEVA 2V8KA 1YJ9T 2CP3A 1VQ5Q 1M27C 3CPFA 5LJ5j 3OW2A 3A8OB 1BI1A 1YITQ 1JEGA 4F7UG 4J6WA 2GBQA 1X75C 3NTKA 2KRSA 3CCRQ 4KRTA 3SWNA 4KH1B 1ZQ1A 4QQDA 2RJCA 1R0BG 1PD0A 1MGQA 1WYXA 3G6EQ 1W1FA 2PUKB 3EFSA 4E7HA 3JCMe 5GJVB 3BW1A 1VQPT 2YSQA 2QDYB 4IUUA 3SWNB 4RTWA 1U8RA 3REAB 1Y96A 4EMGA 2SRCA 3EGDB 1ZSGA 2JUFA 3TEEA 4M75F 1K9MR 1RACB 3QO3A 2DD4A 3OMGA 1BBZA 4L5GA 2FZCB 1TSFA 2NUTB 3DB3A 5GAMe 3CCQQ 4HVUA 1Y96B 2H3EB 1TOVA 2RK1A 1S72A 2J6OA 4WCIA 3M53A 4KT0E 3CPWA 4GBQA 1CSKA 3JCMc 1EZZB 1VQLT 1TUGB 3O5ZA 3I35A 4XK8E 2LCCA 3OYEA 3GBQA 1KC8C 2OTLA 2QGFB 5CR2A 2LQKA 2QQBA 2P84A 2O4XB 3THKA 2ESWA 1VQ9Q 2BE9B 3TSWA 5KYXB 2M0OA 4M75A 2JTEA 3FEOA 5LJ5g 4ORZA 2EGEA 3CCSA 1IO6A 3HRTA 1G3TA 3LH5A 4C92F 3NFCA 2EAYA 1VQNQ 3AT1B 1VQ6Q 1N27A 5IHIA 3CC4T 3UF4A 1VQ4T 4M75B 1JB0E 1T3SA 4RG2A 2HCKA 4OB2B 2L5QA 2HKQB 3MPUB 2X4WA 4ZN1A 3G71A 3QXEB 3QIIA 1M4ZA 4XU3A 5J26A 4DA4A 2PU9B 5HY6A 2IIMA 1M1FA 3CQTA 1OQKA 4PK4A 3EG1A 5KYWB 5FU7B 5KE2A 4M7DD 3J7AF 1MNEA 1VQ5A 2PQWA 2VKNA 1WQWA 3HSBA 1M2VA 2RI3A 3TQ7P 1YITA 5LJ5h 2CSIA 4B9XA 3V7RA 4R55A 3CCRA 4R56A 2XD0A 3DB4A 1D0ZA 1WHGA 2O9SA 3PNWC 3MP1A 2F5TX 2XDBA 3G6EA 3SHWA 1VQ8T 3H0IA 3ULRB 1M2VB 2OAWA 2CDTA 3TREA 1VQ7Q 4C92B 2ECZA 3RESA 4ZTJA 3REBB 1QVGA 3I5RA 4PLIA 2EJ9A 4RCBA 3PMTA 5D6XA 1R8OB 3RKWA 3GOXA 2EKOA 4QVZA 1VIEA 2CS7A 1ZUKA 5GAN5 2E1HA 2EYWA 5GAN6 4ZGDB 2VGNA 4M7DG 1PHTA 3NPFA 1NM7A 1JQQA 8ATCB 3CCQA 2V8JA 1YNZA 3OYIA 1KD1U 1ZSZA 4C92D 2RK2A 3G4ST 1XOVA 1YN8A 4V2SA 1EFNA 3A1PA 1ZHIA 2BZYA 4DEXA 2KT1A 4GLMA 3RNJA 1KC8U 4AFQC 3UATA 1YBYA 2P0KA 5GMKj 2EQUA 1D3BA 1I4K1 5KYUA 1ZSZB 2EKHA 1QP3A 2HZYA 1Q81C 2VXEA 4ZTFA 2YDLA 3JAME 3ZFJA 4LD6A 3L2VA 2EQKA 2LVMA 2KAFA 1VQ9A 1UGPB 4OB3B 3NGPA 2OX7A 2L3QA 3UA7A 4C8QF 2DO3A 2VC8A 5D6WA 1D3BB 5KYUB 2YUPA 3HFNA 2EQMA 3PIPA 4FYXB 3OSVA 4E2FB 3INZA 1VQNA 1YCSB 1VQ6A 5GAN7 2L3PA 3CCEQ 1W2BS 3MEUA 1K0XA 1JJ2A 2P4RA 1H3HA 4ZGJB 3WVDB 2LNHB 1RL2A 2OTLT 2DL7A 1SRLA 1UJYA 2FZKB 1QKWA 4M7DC 1SEMA 1UB4A 5GJWB 1I5OB 1TUCA 1WJRA 1YJ9Q 2V8IA 2DL4A 1YCYA 1IXDA 4C8QA 2DJQA 1I07A 3SFMA 2OAUA 2ED1A 4O5VA 1SHGA 2BKDN 2KVQG 2XMFA 5KE3A 1XQHA 2CP0A 3FIFA 4BB7A 4JJDA 2LT4A 3HPWA 3MP6A 1RADB 2GCXA 1KC8R 4J7FA 2LT1A 4C8QB 5FW9A 2MI6A 2E41A 3NMZC 1TWBA 2ZPHB 4OVAA 3ZBDA 2L3RA 3LGLA 4M4ZA 5GANd 4RMOA 3QWYA 2F69A 3G71T 1ZBJA 1PD1A 3GP8A 3DLLA 1K73C 4EMKC 1MMAA 3MP8A 4C0GA 3OYHA 3CD6T 2AK5A 1GCQC 1WGSA 2KYBA 4M7AD 2DE0X 2HNIA 1BCMA 1EX4A 2O2OA 4M75E 4CRIA 2E64A 1YITT 4DEYA 1SF9A 1FMWA 3MKDA 4N0AA 2DJZA 4JLIA 1WI7A 3S3MA 1CKBA 3PTAA 5GAOq 3HL8A 4M77F 1UTIA 3JCMd 5CKBA 3JCMg 2GFUA 3SD4A 1Q81U 2JNGA 4IUPA 1TUDA 3QG1A 1X2QA 5GMKh 1NBEB 3JB9F 3D7SB 2VVKA 1OOTA 3M4YA 4FSXA 5LJ5e 4M7AG 3H0FA 4Y91A 3H41A 3OSSC 1MNDA 5GAMd 4FT4A 3CCUA 2DXBA 4QT7A 4HT8A 3CCQT 3H0HA 3P8DA 3RKXA 2DVEA 2FPEA 3QZ5B 4PLLA 4E7JA 1VQ4Q 2DPPB 2X3WD 2KBTA 2KK4A 4LDUA 4C5GA 2O31A 2Z0WA 6AT1B 2IVWA 4L59A 4C92E 2HKNA 1NLPC 4NOYA 4M77A 3E2UA 2CGHA 4AG1C 2CUDA 3EHRA 4HCCA 5CVIA 4DBRA 2XDDA 4OF1A 1VQ9T 1D1BA 4BDZA 4WF2A 2DZCA 3R6OA 3RMSA 4M77B 4RTYA 2K3BA 5HK0A 4IIMA 4ZGEB 4E6RA 3GLXA 2PZ1A 1VQNT 3VU3C 4FT2A 2A28A 4FM4B 2H8HA 1Q81R 1U5SA 4YTLA 9ATCB 3NTIA 1O9SA 1YI2Q 3RBBB 1QP2A 4A54A 2EBPA 1K73U 1G3YA 5M9OA 3X20B 2DYBA 2R57A 2RJEA 2GGRA 1GCPA 3JB9D 2FVUA 1GRIA 1J3TA 2WSCE 4TVRA 2COYA 1IRXA 3EG0A 4XQ3A 4ZNXA 2DL5A 5CKFA 1OU9A 4MZTA 2W0ZA 1WHHA 3X24B 3G4SQ 4K11A 2YLCA 1SRMA 1ZUUA 4ESRA 1UGQB 2RJFA 4J9BA 2J6FA 2VB6A 1Q95G 3OQ5A 4BE0A 1AEYA 1WDXA 2F2WA 2ATCB 1RAFB 5FU6C 2RPNA 1RABB 4CC7A 2RQTA 4OB0B 2OI3A 5L23A 2V1RA 4X1VA 4OMLA 2HD0A 2CP5A 1M8VA 3H9NA 2FO0A 4C8QE 1IZ6A 1FX7A 1H641 1VQ4A 3UWNA 3A8HB 4PJLA 3WVEB 2HEQA 1WFWA 2YXYA 2KDSA 1NPPA 1C1AA 5IHKA 4J9DA 1K73R 4IKFA 1QCOA 1TG0A 1Q82C 2ZPGB 2A0FB 4II1A 3JCMW 3L2RA 3RIRA 3M5AA 5KYNA 4EPCA 3SEMA 4F04B 2LJ0A 2YRVA 1K9MU 1W2BA 3CCUT 1FWZA 1AVZC 2HAXA 2RNAA 1MV3A 2MPXC 3M0SA 2HQXA 2XDPA 2JW4A 4Z02A 2DEUA 2PUOB 1UECA 2ABLA 4PJNA 3OS5A 5GMKe 2E5KA 3LH0A 2QTVA 1B07A 1B34A 1YI2A 1QVFS 2KT8A 1W4SA 2GF7A 1RI0A 3QSUA 1KK7A 3CD6Q 5KCHA 3I56Q 2ZPEB 2ZPBB 4IUTA 2D6FA 1Y0MA 2CREA 5CAIA 3OYKA 2QDLA 4MDWA 2X4YA 5C0MA 1E6GA 3E19A 2DXCA 3G4SA 1NG2A 3V8JA 2RQVA 1MUZA 1BIAA 3OW2P 4LUDA 2QQRA 5CIUA 3MHXA 2LP5A 2EQIA 3BFMA 2HQHA 1Y7XA 1AHJB 1B7TA 3TSZA 5C6SA 4PJOC 2LQWA 5CQYA 4M77E 2CYZB 2DA9A 3PFSA 2RHYA 3KXTA 2CH4W 1UE9A 4Q5WA 1UJ0A 1G2BA 3RERA 1HK9A 2PVDB 3CC7T 4XAXB 3LGFA 5CQXA 2DXUA 3OBYA 2HQEA 4XTXA 3SB2A 1LNXA 5GAN4 2VGMA 2XI9A 2Y4YA 2LTOA 1Q82U 2EYXA 1YWOA 2VXFA 3CPWP 4BY6C 1I8FA 2RO0A 3M54A 3QJ6A 4WTOB 4MZMA 3QYHB 2DIQA 5IHNA 2JVVA 4FCYA 5LJ5d 2E12A 4AT1B 3OS2A 1D0XA 2CZ7B 1XNIA 4KUDK 1WHKA 1X2KA 1Q7YC 1QCFA 4FYWB 1PWTA 3Q1JA 2ZCFB 5AT1B 3E9GA 1RLQC 1U1TA 3OBWA 3OY9A 2QA4A 1K8AC 2EQJA 4E7LA 4HVVA 2W10A 2FB7A 4BI8B 1M2OA 1BB9A 4D8DA 1KJWA 4M7DA 3DLMA 5IH2A 2KI7A 1YJWT 2X4XA 2RQUA 3MO8A 4C5HA 3META 1K4US 4XU1A 2MWOA 1AWXA 2VUBA 1VYUA 2JM9A 3QYGB 4M75D 5FWCA 3V7SA 3CD6A 2HBPA 5IT9E 3I56A 2K5FA 3N5BB 3L2WA 2EGAA 2X35A 1D0YA 4IURA 4J7IA 2K3XA 3CBOA 4A4FA 1Q82R 2J06A 1KFZA 2FPFA 2P0PA 1OV3A 2XICA 2LQNA 2YUQA 4JZ4A 3QBYA 2E4HA 2LZ6B 3A8LB 1YI2T 4EMKA 1N8RC 3FB9A 3E9FA 1IREB 2NUPA 3C12A 2FG0A 3JCMQ 2DVJA 3LX7A 4C0FA 3GNGA 1GCQA 4M75G 4FW2A 2CT3A 1GXIE 4MDXA 1R77A 5J39A 4RTXA 3JSCA 2EGCA 3A8MB 4EMKB 1N9RA 2COWA 3A8GB 1AWWA 2L0AA 4XU2A 3RDVA 4F14A 1IGQA 1R0CB 3EH1A 2DXTA 1OZ3A 4F17A 2EYQA 3QUIA 2M0YA 3GF5A 1RAHB 3P8BB 1K0SA 1S1NA 2Y4XA 1C0MA 4RG8A 3ZL7C 1Y07A 3QPHA 1MMNA 1NYGA 4E7SA 2K79A 1PRLC 3UPUA 2JJ9A 2ZZDA 4J83A 3CBPA 2GQIA 2EYYA 4JS4A 3HRUA 3M9QA 3CCUQ 4BE2A 4X9DA 1VYVA 2F2XA 1Z9QA 1Q7YU 1E7OA 2FRWA 1UHCA 1T0JA 4C92G 4Y28E 4CC2A 4EIKA 1FYNA 1Z9ZA 1IHVA 3J81E 1K8AU 1LVKA 4QKUA 3CXCS 1SSHA 4M78F 4OMMA 7AT1B 5EG2A 4JJBA 2JM8A 2RJDA 2DTOA 3X26B 1VQMQ 3M58A 2QG9B 1OX8A 3M56A 4LN2A 2D8HA 4KGXB 2KGTA 2EWNA 3MEWA 1HSQA 2HL5C 3QWXX 2P0QA 4J9IA 4XTZA 3GIBA 1AWJA 1AOJA 1KQ2A 2JS0A 4X9CA 2L3SA 3F70A 3JRZA 2K6DA 2AT1B 2H3JA 3RR6A 1UG1A 1AT1B 1NPRA 1KQSS 3EAEA 1Y57A 3QZ9B 1V1CA 2CP7A 1LPLA 3AHUA 1QVFA 2QA4T 2RH2A 4N4IA 2QAZA 5GAN8 1RI9A 4M78A 4QQ6A 1N8RU 2A08A 3M0UA 3JCMV 2JTFA 5A0DA 3VS2A 2O01E 5LJ3f 3ZEHA 4P5NA 5GAOn 2BZ8A 4M78B 4C92C 1Q7YR 1TH7A 3I56T 1M3CA 2QQ9A 4C8QD 2EW3A 1KQ1A 2DL8A 1K8AR 3CC7Q 2HDAA 3RMQA 4AFUC 1WXTA 4KULA 1OX9A 2BUDA 2MYSA 4GY5A 5CKDA 2KRNA 2RQRA 2E3IA 2KSSA 5GAN3 3EG9A 4DQ2A 2KXDA 4EDUA 1HYOA 1HXDA 5LJ3j 3L1AA 2MWPA 3H8ZA 4IUQA 1OI1A 4C0DB 4Z8AA 4R0KA 1UGRB 2NLUA 2C0TA 3EG9B 2DKGA 3BDLA 5DLOA 4C8QG 2QEXT 1JU5C 1M90C 1SHFA 2NWMA 5A0LA 2KYMA 1H8KA 3CPWS 3C4SA 2AKLA 4IIOA 2LJ3A 4FSSA 1NEGA 2XU8A 2CT4A 5CK9A 4Z89A 1N8RR 2JMCA 2YT6A 4MZPA 2O88A 3CCVT 5J3BA 1YJWQ 2FZGB 2L89A 1G3SA 2E70A 1U06A 1X69A 2P4TA 4J9FA 1K76A 3BE3A 1OYXA 1SPKA 1VQMA 4E47A 1AZEA 4EMHA 1RAEB 5IN1A 2DAQA 2ROTA 3OYYA 2CH4A 2I2LA 2MOXA 2A7YA 1X6GA 3H6ZA 2G3RA 2DTHA 2B8AA 2DTIA 5DM7R 4DOWA 1JXMA 3VS7A 3WXMB 2F1LA 3FLGA 2BE7D 2JN0A 5I22A 4RKUE 3JCMb 2D8JA 4ATOA 1AWOA 3HRSA 1A0NB 3FDRA 1MMDA 3UDCA 3TU4K 5LJ3g 4PJOF 3X25B 4C5EA 4M77D 2DMOA 3ASKA 2D0NA 4M7AC 4IUVA 4JZ3A 4JJNK 4FL6A 2K5IA 4LE9A 2A36A 3EGXA 4AMCA 2MIOA 1ZBXA 4NS5A 5HK3A 2RHXA 4PJMA 5HKCA 1OZ2A 3OYCA 2L2PA 3MEAA 1JRIA 2RHZA 4OMNA 3CC7A 1QCNA 5GAOp 4GLKA 3EGXB 3M4GA 1GBQA 4MMLA 2FRYA 4HCBA 2NUZA 5EC7A 2RN8A 4PJOA 2YUNA 1TTHB 1ZA2B 3JB9J 4F7UF 2GFAA 2A37A 3HTRA 3UA6A 1IGUA 3VS5A 4LUEA 1BKBA 5LJ3h 4OP0A 4JRPA 5D7UA 3JB9G 1BK2A 3M59A 2ZGWA 2EIFA 5ECAA 1M90U 2EJGA 2JOYA 4JUVA 1WPYA 4PJOB 1M1GA 1VYTA 4DBFA 2XK0A 4XTWA 1WHJA 4J6XA 4KBMB 2YRCA 2KROA 2OTJQ 1QLYA 1H92A 2X51A 1BCOA 2HSEB 1V76A 1D1CA 2GTOA 2CP2A 4BI3A 5I21A 1YJWA 2E3HA 3M0RA 4KUIA 4F7UA 1RUWA 3JB9H 4M78E 4J9CA 3PT9A 2WSEE 1QWFA 2IPOB 3I55T 1I81A 2DLPA 4PFZA 1Q86C 3MCAB 1G8XA 4BY6B 4BUGA 1PNJA 1TXQA 2AZSA 3QHSA 3HFOA 4OGEA 1PSEA 1NLOC 4F7UB 3HHTB 3CXCA 3VKIA 2SEMA 4A4GA 4A4HA 2RQWA 2QYZA 4CI0C 2QA4Q 3OA6A 1W2BP 2L8DA 2QGGA 4LXCA 5I2MA 2EJFA 2XG8D 1ABOA 2G6FX 3FJPA 3CMAT 1CKAA 1YFNA 2YHTA 2YWWA 4KH0B 3L2QA 3OYNA 1M90R 1VQMT 3CBMA 2D0QB 5KYYA 2K7AA 2K4YA 3O8VA 1KQSA 3VYHB 1KHIA 1M8MA 2CZ0B 4NL3A 1B34B 4HA8A 4JRQA 2LX9A 2DEQA 5GANe 5IAYA 2RA2A 2VV5A 1VOMA 1M3BA 1OPKA 2FHDA 1XTDA 1M30A 2IG0A 4PFPA 2MAMA 1KIKA 3PIOA 1E6HA 4OMOA 3CCJT 4QQGA 3I5SA 4FU6A 1WA7A 1QKXA 5CCAA 4N4HA 1MHNA 2J6KA 3EGDA 3TVTA 2D9TA 4RTUA 4E7KA 2QEXQ 2CZ1B 1U3OA 5GMKl 1YIJQ 4Y92A 2NUTA 2EFIA 2R5MA 4O6JA 2JXBA 2OTJA 4OGCA 2KXCA 1W70A 3SDZA 4OMPA 3CCVQ 4J6YA 3E1SA 4M7DF 1YHQT 3PMIA 2DFUA 3CMEQ 3KUFA 3QJYA 3OYGA 3OYMA 1WJQA 2KQWA 5FRMA 2J05A 2KY9A 2PVOB 2E6ZA 1FMKA 3OYFA 4F16A 2YRDA 1Q86U 1PSFA 3S3NA 1KD1C 3CCLQ 2O4XA 1NE8A 4BI4A 1QWEA 2DYIA 4JRIA 4JS5A 4C0ZA 3QDFA 3EFRA 5KYXA 2QK0A 2GQVA 1T0HA 3EGUA 1M5Q1 5A0GA 4J8OA 4D6WA 1RAIB 2F2VA 3T9NA 2KNBB 3NHNA 3CC2T 1ZLMA 1HJDA 1WXUA 3LYIA 1IB8A 2ZAEA 3L2UA 5LJ3e 2WSFE 3OMCA 3OS1A 2O9VA 5IXFA 3MJXA 2QQAA 1I1JA 1ZUYA 4J5YA 3KBGA 1P92A 1X43A 1PG5B 2HL3A 1VQKT 5GAOl 3PVQA 3L42A 2DBMA 5GAN2 4DBQA 4XTUA 4PJOE 4AFZC 4UC4A 4M7DB 3UT1A 4HCZA 1K1ZA 3VUZA 2FPDA 2M1HA 4LDYA 3CEYA 1RLPC 2MK5A 1GBRA 5KYWA 3NTHA 4PNOA 3VS6A 3LWIA 2AKKA 4QW2A 3A98A 1H3ZA 1D1AA 5LL6S 1AD5A 4N4GA 5CO7A 1QVPA 1WX6A 4DOVA 1YJNQ 1Q86R 3VV0A 1U1SA 2FEIA 5HCKA 2QTXA 4C92A 2JS2A 4LD9K 2KMTA 4AFSC 4JJCA 1WNLA 1RAGB 2PTKA 2V26A 1OPLA 3SWNC 3VS3A 4BDYA 4F7UE 2RM4A 2QEXA 4BE1A 1QVGP 1UHFA 1UEBA 3EG2A 3M0PA 2NUPB 2RI2A 5I11A 4RUGA 2X9HA 5FWBA 3URGA 1YIJA 3OYLA 1PRMC 3CCMQ 1QW1A 2DX1A 1MV0B 3ME9A 1N9SA 4A53A 4RTVA 2HBWA 4RTTA 1NJIC 5GANf 3CCVA 2VASA 2DZ9A 4JLGA 2KEAA 1WLPB 2AZVA 3CMEA 5CKEA 2JZ2A 1VIFA 4XTYA 3JB9I 3RUXA 3I55Q 5DY9A 2PVGB 2X4JA 1C6VX 2C0OA 3QKJA 2HSPA 1TU0B 3V8LA 3CCLA 3EHQA 1NZ9A 2R5AA 1JBMA 1M1KC 2V1QA 1BYMA 1XJWB 2MCNA 2OTJT 4ELYC 3JCMf 1WHLA 5GANj 1ZA1B 3BY7A 1I5LA 4M7AF 1FMVA 3CMAQ 2RF0A 3HKSA 4OMQA 1OULA 4PL6A 4M75C
chains in the Genus database with same CATH topology
4ORZA 1SPKA 2EGEA 2LJ0A 3I9QA 1IO6A 1AZEA 1UFFA 3LH5A 2ROTA 5IHIA 4HVWA 1AVZC 2CH4A 4D8KA 2D1XA 2MOXA 3UF4A 2RNAA 1MV3A 1X6GA 3M0SA 4CC4B 1T3SA 2JW4A 1JXMA 3C0CA 1UECA 3VS7A 2ABLA 5I22A 1BU1A 2HCKA 2D8JA 1AWOA 2E5KA 1ABQA 1A0NB 1B07A 2M51A 2DF6A 1GFDA 2KT8A 3FJ5A 3JV3A 2DMOA 2IIMA 2D0NA 3CQTA 4JZ3A 3VS1A 3EG1A 2B86A 3M0TA 4LE9A 2X3XD 2A36A 2VKNA 2KR3A 1Y0MA 2C0IA 2MIOA 4A63B 2LCSA 2CREA 2CSIA 2QDLA 1M3AA 2O9SA 1E6GA 2L2PA 1NG2A 4OMNA 2RQVA 1MUZA 3SHWA 2JT4A 1GBQA 3H0IA 4LUDA 3ULRB 2OAWA 2FRYA 1GFCA 2CDTA 2LP5A 2BTTA 2ECZA 2EQIA 1KSWA 2NUZA 3REBB 3I5RA 2BZXA 5EC7A 2RN8A 1B3QA 2YUNA 3TSZA 1UUEA 1ZUKA 2A37A 2LQWA 3UA6A 3VS5A 2EYWA 2DA9A 4LUEA 2J7IA 1PHTA 1T3LA 3NPFA 1BK2A 1NM7A 1UE9A 2CH4W 1JQQA 5ECAA 1YNZA 1UJ0A 1ARKA 1G2BA 1VYTA 1XOVA 1YN8A 1EFNA 2GTJA 2KROA 2BZYA 1QLYA 4DEXA 2KT1A 4GLMA 3RNJA 1H92A 4AFQC 3UATA 3VRZA 2EYXA 1YWOA 3R6NA 2EKHA 2GTOA 2YDLA 1K9AA 3M0RA 3NGPA 1WXBA 1RUWA 1WIEA 2L3QA 1ZX6A 3UA7A 1YWPA 4J9CA 2YUOA 2DRMA 5IHNA 1QWFA 1AZGB 2PNIA 2DLPA 2YUPA 2VWFA 1PNJA 2AZSA 1NLOC 1X2KA 1YCSB 2L3PA 1QCFA 1PWTA 1K0XA 2SEMA 1X6BA 1RLQC 2P4RA 1H3HA 2RQWA 2LNHB 2EVRA 1W6XA 2DNUA 4HVVA 2DL7A 1SRLA 2W10A 1UJYA 1BB9A 4D8DA 1KJWA 1QKWA 5IH2A 1SEMA 1NEBA 1ABOA 2G6FX 1GL5A 5GJWB 2RQUA 1CKAA 1TUCA 1K4US 4LNPA 2EYZA 2DL4A 1AWXA 1PKTA 2JMAA 1VYUA 2JM9A 2DJQA 5FWCA 1I07A 2ED1A 1OEBA 1SHGA 4J9GA 2XMFA 2K7AA 2EGAA 3PVLA 2DM1A 1M8MA 4JJDA 2DRKA 3VS0A 2DILA 2ROLA 1YP5A 2K9GA 3PE0A 5FW9A 2J06A 3NMZC 1KFZA 2FPFA 1OV3A 1M3BA 1HD3A 1OPKA 2LQNA 2YUQA 1M30A 1PKSA 4JZ4A 3KFVA 1KIKA 4M4ZA 1E6HA 3QWYA 2LZ6B 4OMOA 1ZBJA 3I5SA 4HXJA 1WA7A 1QKXA 2FG0A 4AG2C 2DVJA 1JO8A 1G83A 1GCQA 2AK5A 1GCQC 2CT3A 2ENMA 2KYBA 2DE0X 2RMOA 2J6KA 2O2OA 3TVTA 2LJ1A 4RTUA 4RTXA 2EGCA 4DEYA 2L0AA 1AWWA 1U3OA 4F14A 1WI7A 2EPDA 4Y92A 2I0NA 2ED0A 1CKBA 2JXBA 4F17A 1UTIA 2M0YA 2KXCA 2LX7A 1W70A 4J9EA 4OMPA 1K0SA 1S1NA 3U23A 2KE9A 1TUDA 5IXBA 1X2QA 4JPBW 2VVKA 3ZL7C 1NYGA 2DBKA 1OOTA 2K79A 3VRYA 2OJ2A 2J05A 1PRLC 1FMKA 3H0FA 3H41A 4F16A 2GQIA 2EYYA 4QT7A 1NYFA 3H0HA 1X27A 1QWEA 2KRMA 1VYVA 2F2XA 2FPEA 1Z9QA 2X3WD 1E7OA 2FRWA 3IQLA 2KBTA 1UHCA 1T0JA 1VA7A 2DL3A 4CC2A 1T0HA 3EGUA 1JXOA 1FYNA 1Z9ZA 2O31A 4EIKA 2CSQA 2F2VA 2KNBB 2LMJA 3NHNA 1NLPC 1ZLMA 1WXUA 2GNCA 1HJDA 1SSHA 4OMMA 1UGVA 2CUDA 3VS4A 4AG1C 3EHRA 4JJBA 2JM8A 2K2MA 1UDLA 2O9VA 3M0QA 4J9HA 5IXFA 1I1JA 1ZUYA 4LN2A 2D8HA 1X43A 2KGTA 4Z88A 4RTYA 1HSQA 3QWXX 2K3BA 3PVQA 2DBMA 4J9IA 1AWJA 4IIMA 1AOJA 4AFZC 2JS0A 4E6RA 2L3SA 2CUBA 1K1ZA 2K6DA 2FPDA 2PZ1A 1UG1A 3EG3A 1RLPC 1GBRA 2A28A 1Y57A 1V1CA 2H8HA 4CC3A 3VS6A 1U5SA 4RTZA 2AKKA 1I0CA 3RBBB 3A98A 1RI9A 2EBPA 1LCKA 1N5ZA 4HCKA 2A08A 3M0UA 1AD5A 2DYBA 2GGRA 3VS2A 1GCPA 1WX6A 1GRIA 1J3TA 1M27C 2FEIA 5HCKA 2BZ8A 1JEGA 2JS2A 3EG0A 2GBQA 4AFSC 4JJCA 2KRSA 4ZNXA 2PTKA 4KRTA 2DL5A 1M3CA 1OPLA 3VS3A 2W0ZA 2EW3A 2DL8A 1UHFA 4K11A 2HDAA 1SRMA 1WYXA 1W1FA 3EG2A 3M0PA 5I11A 4AFUC 4RUGA 5GJVB 5FWBA 1ZUUA 4ESRA 2YSQA 1WXTA 4J9BA 1PRMC 2J6FA 2KRNA 4RTWA 3REAB 2DX1A 1MV0B 2RQRA 1AEYA 1WDXA 2F2WA 4RTVA 2SRCA 2HBWA 1ZSGA 2KXDA 4RTTA 2RPNA 1BBZA 4CC7A 2KEAA 1WLPB 2AZVA 2RQTA 4Z8AA 4R0KA 2C0TA 4HVUA 2OI3A 5L23A 2V1RA 2J6OA 4OMLA 4X1VA 1JU5C 2C0OA 2HSPA 4WCIA 1SHFA 2NWMA 2KYMA 1H8KA 2FO0A 4GBQA 1CSKA 3EHQA 2AKLA 4IIOA 2LJ3A 3O5ZA 2HEQA 3I35A 1NEGA 1WFWA 4FSSA 2V1QA 3GBQA 2CT4A 5IHKA 2MCNA 4Z89A 4J9DA 1TG0A 2JMCA 2YT6A 2O88A 3THKA 2ESWA 2RF0A 3TSWA 4OMQA 2JTEA 1U06A 1X69A 3SEMA 4J9FA 1K76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORZ A;  1SPK A;  2EGE A;  2LJ0 A;  3I9Q A;  1IO6 A;  1AZE A;  1UFF A;  3LH5 A;  2ROT A;  5IHI A;  4HVW A;  1AVZ C;  2CH4 A;  4D8K A;  2D1X A;  2MOX A;  3UF4 A;  2RNA A;  1MV3 A;  1X6G A;  3M0S A;  4CC4 B;  1T3S A;  2JW4 A;  1JXM A;  3C0C A;  1UEC A;  3VS7 A;  2ABL A;  5I22 A;  1BU1 A;  2HCK A;  2D8J A;  1AWO A;  2E5K A;  1ABQ A;  1A0N B;  1B07 A;  2M51 A;  2DF6 A;  1GFD A;  2KT8 A;  3FJ5 A;  3JV3 A;  2DMO A;  2IIM A;  2D0N A;  3CQT A;  4JZ3 A;  3VS1 A;  3EG1 A;  2B86 A;  3M0T A;  4LE9 A;  2X3X D;  2A36 A;  2VKN A;  2KR3 A;  1Y0M A;  2C0I A;  2MIO A;  4A63 B;  2LCS A;  2CRE A;  2CSI A;  2QDL A;  1M3A A;  2O9S A;  1E6G A;  2L2P A;  1NG2 A;  4OMN A;  2RQV A;  1MUZ A;  3SHW A;  2JT4 A;  1GBQ A;  3H0I A;  4LUD A;  3ULR B;  2OAW A;  2FRY A;  1GFC A;  2CDT A;  2LP5 A;  2BTT A;  2ECZ A;  2EQI A;  1KSW A;  2NUZ A;  3REB B;  3I5R A;  2BZX A;  5EC7 A;  2RN8 A;  1B3Q A;  2YUN A;  3TSZ A;  1UUE A;  1ZUK A;  2A37 A;  2LQW A;  3UA6 A;  3VS5 A;  2EYW A;  2DA9 A;  4LUE A;  2J7I A;  1PHT A;  1T3L A;  3NPF A;  1BK2 A;  1NM7 A;  1UE9 A;  2CH4 W;  1JQQ A;  5ECA A;  1YNZ A;  1UJ0 A;  1ARK A;  1G2B A;  1VYT A;  1XOV A;  1YN8 A;  1EFN A;  2GTJ A;  2KRO A;  2BZY A;  1QLY A;  4DEX A;  2KT1 A;  4GLM A;  3RNJ A;  1H92 A;  4AFQ C;  3UAT A;  3VRZ A;  2EYX A;  1YWO A;  3R6N A;  2EKH A;  2GTO A;  2YDL A;  1K9A A;  3M0R A;  3NGP A;  1WXB A;  1RUW A;  1WIE A;  2L3Q A;  1ZX6 A;  3UA7 A;  1YWP A;  4J9C A;  2YUO A;  2DRM A;  5IHN A;  1QWF A;  1AZG B;  2PNI A;  2DLP A;  2YUP A;  2VWF A;  1PNJ A;  2AZS A;  1NLO C;  1X2K A;  1YCS B;  2L3P A;  1QCF A;  1PWT A;  1K0X A;  2SEM A;  1X6B A;  1RLQ C;  2P4R A;  1H3H A;  2RQW A;  2LNH B;  2EVR A;  1W6X A;  2DNU A;  4HVV A;  2DL7 A;  1SRL A;  2W10 A;  1UJY A;  1BB9 A;  4D8D A;  1KJW A;  1QKW A;  5IH2 A;  1SEM A;  1NEB A;  1ABO A;  2G6F X;  1GL5 A;  5GJW B;  2RQU A;  1CKA A;  1TUC A;  1K4U S;  4LNP A;  2EYZ A;  2DL4 A;  1AWX A;  1PKT A;  2JMA A;  1VYU A;  2JM9 A;  2DJQ A;  5FWC A;  1I07 A;  2ED1 A;  1OEB A;  1SHG A;  4J9G A;  2XMF A;  2K7A A;  2EGA A;  3PVL A;  2DM1 A;  1M8M A;  4JJD A;  2DRK A;  3VS0 A;  2DIL A;  2ROL A;  1YP5 A;  2K9G A;  3PE0 A;  5FW9 A;  2J06 A;  3NMZ C;  1KFZ A;  2FPF A;  1OV3 A;  1M3B A;  1HD3 A;  1OPK A;  2LQN A;  2YUQ A;  1M30 A;  1PKS A;  4JZ4 A;  3KFV A;  1KIK A;  4M4Z A;  1E6H A;  3QWY A;  2LZ6 B;  4OMO A;  1ZBJ A;  3I5S A;  4HXJ A;  1WA7 A;  1QKX A;  2FG0 A;  4AG2 C;  2DVJ A;  1JO8 A;  1G83 A;  1GCQ A;  2AK5 A;  1GCQ C;  2CT3 A;  2ENM A;  2KYB A;  2DE0 X;  2RMO A;  2J6K A;  2O2O A;  3TVT A;  2LJ1 A;  4RTU A;  4RTX A;  2EGC A;  4DEY A;  2L0A A;  1AWW A;  1U3O A;  4F14 A;  1WI7 A;  2EPD A;  4Y92 A;  2I0N A;  2ED0 A;  1CKB A;  2JXB A;  4F17 A;  1UTI A;  2M0Y A;  2KXC A;  2LX7 A;  1W70 A;  4J9E A;  4OMP A;  1K0S A;  1S1N A;  3U23 A;  2KE9 A;  1TUD A;  5IXB A;  1X2Q A;  4JPB W;  2VVK A;  3ZL7 C;  1NYG A;  2DBK A;  1OOT A;  2K79 A;  3VRY A;  2OJ2 A;  2J05 A;  1PRL C;  1FMK A;  3H0F A;  3H41 A;  4F16 A;  2GQI A;  2EYY A;  4QT7 A;  1NYF A;  3H0H A;  1X27 A;  1QWE A;  2KRM A;  1VYV A;  2F2X A;  2FPE A;  1Z9Q A;  2X3W D;  1E7O A;  2FRW A;  3IQL A;  2KBT A;  1UHC A;  1T0J A;  1VA7 A;  2DL3 A;  4CC2 A;  1T0H A;  3EGU A;  1JXO A;  1FYN A;  1Z9Z A;  2O31 A;  4EIK A;  2CSQ A;  2F2V A;  2KNB B;  2LMJ A;  3NHN A;  1NLP C;  1ZLM A;  1WXU A;  2GNC A;  1HJD A;  1SSH A;  4OMM A;  1UGV A;  2CUD A;  3VS4 A;  4AG1 C;  3EHR A;  4JJB A;  2JM8 A;  2K2M A;  1UDL A;  2O9V A;  3M0Q A;  4J9H A;  5IXF A;  1I1J A;  1ZUY A;  4LN2 A;  2D8H A;  1X43 A;  2KGT A;  4Z88 A;  4RTY A;  1HSQ A;  3QWX X;  2K3B A;  3PVQ A;  2DBM A;  4J9I A;  1AWJ A;  4IIM A;  1AOJ A;  4AFZ C;  2JS0 A;  4E6R A;  2L3S A;  2CUB A;  1K1Z A;  2K6D A;  2FPD A;  2PZ1 A;  1UG1 A;  3EG3 A;  1RLP C;  1GBR A;  2A28 A;  1Y57 A;  1V1C A;  2H8H A;  4CC3 A;  3VS6 A;  1U5S A;  4RTZ A;  2AKK A;  1I0C A;  3RBB B;  3A98 A;  1RI9 A;  2EBP A;  1LCK A;  1N5Z A;  4HCK A;  2A08 A;  3M0U A;  1AD5 A;  2DYB A;  2GGR A;  3VS2 A;  1GCP A;  1WX6 A;  1GRI A;  1J3T A;  1M27 C;  2FEI A;  5HCK A;  2BZ8 A;  1JEG A;  2JS2 A;  3EG0 A;  2GBQ A;  4AFS C;  4JJC A;  2KRS A;  4ZNX A;  2PTK A;  4KRT A;  2DL5 A;  1M3C A;  1OPL A;  3VS3 A;  2W0Z A;  2EW3 A;  2DL8 A;  1UHF A;  4K11 A;  2HDA A;  1SRM A;  1WYX A;  1W1F A;  3EG2 A;  3M0P A;  5I11 A;  4AFU C;  4RUG A;  5GJV B;  5FWB A;  1ZUU A;  4ESR A;  2YSQ A;  1WXT A;  4J9B A;  1PRM C;  2J6F A;  2KRN A;  4RTW A;  3REA B;  2DX1 A;  1MV0 B;  2RQR A;  1AEY A;  1WDX A;  2F2W A;  4RTV A;  2SRC A;  2HBW A;  1ZSG A;  2KXD A;  4RTT A;  2RPN A;  1BBZ A;  4CC7 A;  2KEA A;  1WLP B;  2AZV A;  2RQT A;  4Z8A A;  4R0K A;  2C0T A;  4HVU A;  2OI3 A;  5L23 A;  2V1R A;  2J6O A;  4OML A;  4X1V A;  1JU5 C;  2C0O A;  2HSP A;  4WCI A;  1SHF A;  2NWM A;  2KYM A;  1H8K A;  2FO0 A;  4GBQ A;  1CSK A;  3EHQ A;  2AKL A;  4IIO A;  2LJ3 A;  3O5Z A;  2HEQ A;  3I35 A;  1NEG A;  1WFW A;  4FSS A;  2V1Q A;  3GBQ A;  2CT4 A;  5IHK A;  2MCN A;  4Z89 A;  4J9D A;  1TG0 A;  2JMC A;  2YT6 A;  2O88 A;  3THK A;  2ESW A;  2RF0 A;  3TSW A;  4OMQ A;  2JTE A;  1U06 A;  1X69 A;  3SEM A;  4J9F A;  1K76 A; 
#chains in the Genus database with same CATH topology
 2LDM A;  1S72 T;  3A5Z B;  1JJ2 P;  3I9Q A;  1KG1 A;  3C94 A;  1UFF A;  4HKE A;  1BI3 A;  1PCX A;  1QMC A;  1SKU B;  5GAM f;  2K2V A;  4HVW A;  4D8K A;  2D1X A;  4CC4 B;  2FYK A;  4FW1 A;  4QVC A;  2CZ6 B;  1BI0 A;  3C0C A;  3ER0 A;  4ELZ C;  1BU1 A;  1FXX A;  4XU0 A;  1PC0 A;  1MMG A;  2HMA A;  1ABQ A;  2LQ8 A;  5FU7 C;  5GAO r;  2M51 A;  4BAC A;  1VQO Q;  3CCJ Q;  2DF6 A;  4KGZ B;  1VUB A;  1GFD A;  3FJ5 A;  3JV3 A;  4M7A A;  2RHU A;  2NYS A;  1KD1 R;  3CCS T;  3VS1 A;  2B86 A;  4BD3 A;  2Y90 A;  1G3W A;  3M0T A;  1QVF P;  5L8R E;  1YJN A;  2X3X D;  5GAM j;  2KR3 A;  3GPL A;  2C0I A;  4A63 B;  2LCS A;  4C5I A;  4M7A B;  3OW2 S;  4B6M A;  1M3A A;  1VQP Q;  2COZ A;  3JCM P;  5KH6 A;  2JT4 A;  3L2Z A;  3JCM X;  1VQ7 A;  1PM3 A;  8AT1 B;  5GAN g;  1GFC A;  2BTT A;  1KSW A;  3CCM A;  2BZX A;  4ZN3 A;  1NJI U;  3QDR B;  1YHQ Q;  1B3Q A;  2RHI A;  2K3Y A;  3EFO A;  5GMK m;  1UUE A;  5KCO A;  4M78 D;  4JDS A;  1SG5 A;  2J7I A;  1VQ5 T;  1T3L A;  2K57 A;  1WQ7 A;  1WJS A;  3CCR T;  3V8K A;  4M7D E;  2M02 A;  3EFO B;  3I55 A;  4E7I A;  1VQL Q;  1ARK A;  2WAC A;  2BIV A;  1ZSZ C;  3P8H A;  5FU6 B;  2RI5 A;  1M1K U;  1LJO A;  4OB1 B;  3G6E T;  2GTJ A;  3G1J A;  3G7Z A;  1YIJ T;  3CC2 Q;  3OS0 A;  2LRQ A;  3VRZ A;  3R6N A;  3M55 A;  1X6O A;  2R58 A;  1K9A A;  3TCJ A;  5GAN h;  4M78 G;  2DK3 A;  3OYB A;  1WXB A;  3CMA A;  1WIE A;  1ZX6 A;  3CME T;  3JCM J;  1YWP A;  4E7Z A;  5GAM g;  2YUO A;  1VQK Q;  2DRM A;  1AZG B;  3CC4 Q;  2PNI A;  3VYG A;  2VWF A;  1M9S A;  3CCE A;  3CCL T;  2M9U A;  3LWH A;  1X6B A;  2C06 A;  4PFO A;  1QQJ A;  2EVR A;  4OMF B;  1W6X A;  2DNU A;  2M16 A;  1NJI R;  4A4K A;  4FYV B;  5GAO m;  5FLX E;  3JCM h;  1NEB A;  2AHJ B;  2QQS A;  4LDX A;  1GL5 A;  4XTV A;  3V7C A;  5LJ3 d;  1VQO A;  3CCJ A;  4LDW A;  1F1B B;  1KHC A;  4LNP A;  1YJ9 A;  2EYZ A;  2RB6 A;  1K9M C;  1PKT A;  4FYY B;  2JMA A;  4C8Q C;  1OEB A;  4J9G A;  4ME7 A;  1VQ6 T;  3PVL A;  1M1K R;  2DM1 A;  1G5V A;  3PGG A;  5GAM h;  4MMK A;  2DRK A;  3VS0 A;  2DIL A;  1VQ8 Q;  2ROL A;  1YP5 A;  2ZPI B;  3HP9 A;  2E6N A;  2K9G A;  1VQP A;  3PE0 A;  1HD3 A;  4M78 C;  3M57 A;  2E5Q A;  1OU8 A;  1PKS A;  3KFV A;  4FIB A;  3OB9 A;  2QI2 A;  1V29 B;  1WZO A;  3LLR A;  2CKK A;  4HXJ A;  2LCL A;  1YHQ A;  4AG2 C;  2XHC A;  1QVG S;  1LOJ A;  2A3L A;  1JO8 A;  4M77 G;  4X34 A;  2MMP A;  1UGS B;  1G83 A;  3EH2 A;  4RCC A;  2ENM A;  2VYT A;  4PKC C;  3VJP A;  2RMO A;  4HT9 A;  1YJN T;  5I2S A;  5GMK i;  3FRN A;  2LJ1 A;  4KGV B;  3OYA A;  4N0A C;  4QVD A;  1VQL A;  2EPD A;  4C0D C;  1O75 A;  2I0N A;  2ED0 A;  1BIB A;  3RKY A;  2LX7 A;  2LC4 A;  1VQ7 T;  4J9E A;  3U23 A;  3CC2 A;  2QXF A;  2KE9 A;  3CCM T;  3LW5 E;  5A2Q E;  5IXB A;  2CP6 A;  3OYD A;  4JPB W;  3GNF B;  5DLQ E;  5CKH A;  2F5K A;  2DBK A;  2DD5 A;  2AIR B;  3VRY A;  2OJ2 A;  5D6Y A;  2YLB A;  3X28 B;  2K5L A;  1X01 A;  2DIG A;  3S6W A;  1S72 Q;  4PJO D;  1DJ7 B;  4B9W A;  4DBH A;  1VQK A;  1NYF A;  4M7A E;  3VUB A;  1ACM B;  3CC4 A;  1X27 A;  2KRM A;  1N6A A;  4ANJ A;  3IQL A;  1VA7 A;  2DL3 A;  1JXO A;  4LDV A;  2OTL Q;  2CSQ A;  1IHW A;  4PJJ A;  2LMJ A;  2GNC A;  1SSF A;  3J80 E;  1JJ2 S;  4M77 C;  5FRN A;  1UGV A;  3VS4 A;  3C95 A;  1BI2 A;  2XKO C;  4L6V 5;  3OYJ A;  2K2M A;  1UDL A;  3M0Q A;  4J9H A;  2ZPF B;  3CXC P;  3S3O A;  3CCS Q;  4PJO G;  4Z88 A;  1EIF A;  2E65 A;  2QAS A;  5LJ5 f;  4JRK A;  2DET A;  2XID A;  1WHM A;  2E10 A;  2CUB A;  2DER A;  2RD1 A;  3CCE T;  3EG3 A;  1D09 B;  1RAA B;  1VQ8 A;  1Y71 A;  4CC3 A;  1TS9 A;  4NL2 A;  4RTZ A;  4VUB A;  3G71 Q;  1I0C A;  2LNV A;  1KQS P;  2MF2 A;  4HCK A;  1LCK A;  1N5Z A;  5KYY B;  3FC3 A;  5AYF A;  2FL7 A;  4A4E A;  3DKM A;  5FRO A;  1VQO T;  2JTM A;  3BDU A;  3MEV A;  2V8K A;  1YJ9 T;  2CP3 A;  1VQ5 Q;  1M27 C;  3CPF A;  5LJ5 j;  3OW2 A;  3A8O B;  1BI1 A;  1YIT Q;  1JEG A;  4F7U G;  4J6W A;  2GBQ A;  1X75 C;  3NTK A;  2KRS A;  3CCR Q;  4KRT A;  3SWN A;  4KH1 B;  1ZQ1 A;  4QQD A;  2RJC A;  1R0B G;  1PD0 A;  1MGQ A;  1WYX A;  3G6E Q;  1W1F A;  2PUK B;  3EFS A;  4E7H A;  3JCM e;  5GJV B;  3BW1 A;  1VQP T;  2YSQ A;  2QDY B;  4IUU A;  3SWN B;  4RTW A;  1U8R A;  3REA B;  1Y96 A;  4EMG A;  2SRC A;  3EGD B;  1ZSG A;  2JUF A;  3TEE A;  4M75 F;  1K9M R;  1RAC B;  3QO3 A;  2DD4 A;  3OMG A;  1BBZ A;  4L5G A;  2FZC B;  1TSF A;  2NUT B;  3DB3 A;  5GAM e;  3CCQ Q;  4HVU A;  1Y96 B;  2H3E B;  1TOV A;  2RK1 A;  1S72 A;  2J6O A;  4WCI A;  3M53 A;  4KT0 E;  3CPW A;  4GBQ A;  1CSK A;  3JCM c;  1EZZ B;  1VQL T;  1TUG B;  3O5Z A;  3I35 A;  4XK8 E;  2LCC A;  3OYE A;  3GBQ A;  1KC8 C;  2OTL A;  2QGF B;  5CR2 A;  2LQK A;  2QQB A;  2P84 A;  2O4X B;  3THK A;  2ESW A;  1VQ9 Q;  2BE9 B;  3TSW A;  5KYX B;  2M0O A;  4M75 A;  2JTE A;  3FEO A;  5LJ5 g;  4ORZ A;  2EGE A;  3CCS A;  1IO6 A;  3HRT A;  1G3T A;  3LH5 A;  4C92 F;  3NFC A;  2EAY A;  1VQN Q;  3AT1 B;  1VQ6 Q;  1N27 A;  5IHI A;  3CC4 T;  3UF4 A;  1VQ4 T;  4M75 B;  1JB0 E;  1T3S A;  4RG2 A;  2HCK A;  4OB2 B;  2L5Q A;  2HKQ B;  3MPU B;  2X4W A;  4ZN1 A;  3G71 A;  3QXE B;  3QII A;  1M4Z A;  4XU3 A;  5J26 A;  4DA4 A;  2PU9 B;  5HY6 A;  2IIM A;  1M1F A;  3CQT A;  1OQK A;  4PK4 A;  3EG1 A;  5KYW B;  5FU7 B;  5KE2 A;  4M7D D;  3J7A F;  1MNE A;  1VQ5 A;  2PQW A;  2VKN A;  1WQW A;  3HSB A;  1M2V A;  2RI3 A;  3TQ7 P;  1YIT A;  5LJ5 h;  2CSI A;  4B9X A;  3V7R A;  4R55 A;  3CCR A;  4R56 A;  2XD0 A;  3DB4 A;  1D0Z A;  1WHG A;  2O9S A;  3PNW C;  3MP1 A;  2F5T X;  2XDB A;  3G6E A;  3SHW A;  1VQ8 T;  3H0I A;  3ULR B;  1M2V B;  2OAW A;  2CDT A;  3TRE A;  1VQ7 Q;  4C92 B;  2ECZ A;  3RES A;  4ZTJ A;  3REB B;  1QVG A;  3I5R A;  4PLI A;  2EJ9 A;  4RCB A;  3PMT A;  5D6X A;  1R8O B;  3RKW A;  3GOX A;  2EKO A;  4QVZ A;  1VIE A;  2CS7 A;  1ZUK A;  5GAN 5;  2E1H A;  2EYW A;  5GAN 6;  4ZGD B;  2VGN A;  4M7D G;  1PHT A;  3NPF A;  1NM7 A;  1JQQ A;  8ATC B;  3CCQ A;  2V8J A;  1YNZ A;  3OYI A;  1KD1 U;  1ZSZ A;  4C92 D;  2RK2 A;  3G4S T;  1XOV A;  1YN8 A;  4V2S A;  1EFN A;  3A1P A;  1ZHI A;  2BZY A;  4DEX A;  2KT1 A;  4GLM A;  3RNJ A;  1KC8 U;  4AFQ C;  3UAT A;  1YBY A;  2P0K A;  5GMK j;  2EQU A;  1D3B A;  1I4K 1;  5KYU A;  1ZSZ B;  2EKH A;  1QP3 A;  2HZY A;  1Q81 C;  2VXE A;  4ZTF A;  2YDL A;  3JAM E;  3ZFJ A;  4LD6 A;  3L2V A;  2EQK A;  2LVM A;  2KAF A;  1VQ9 A;  1UGP B;  4OB3 B;  3NGP A;  2OX7 A;  2L3Q A;  3UA7 A;  4C8Q F;  2DO3 A;  2VC8 A;  5D6W A;  1D3B B;  5KYU B;  2YUP A;  3HFN A;  2EQM A;  3PIP A;  4FYX B;  3OSV A;  4E2F B;  3INZ A;  1VQN A;  1YCS B;  1VQ6 A;  5GAN 7;  2L3P A;  3CCE Q;  1W2B S;  3MEU A;  1K0X A;  1JJ2 A;  2P4R A;  1H3H A;  4ZGJ B;  3WVD B;  2LNH B;  1RL2 A;  2OTL T;  2DL7 A;  1SRL A;  1UJY A;  2FZK B;  1QKW A;  4M7D C;  1SEM A;  1UB4 A;  5GJW B;  1I5O B;  1TUC A;  1WJR A;  1YJ9 Q;  2V8I A;  2DL4 A;  1YCY A;  1IXD A;  4C8Q A;  2DJQ A;  1I07 A;  3SFM A;  2OAU A;  2ED1 A;  4O5V A;  1SHG A;  2BKD N;  2KVQ G;  2XMF A;  5KE3 A;  1XQH A;  2CP0 A;  3FIF A;  4BB7 A;  4JJD A;  2LT4 A;  3HPW A;  3MP6 A;  1RAD B;  2GCX A;  1KC8 R;  4J7F A;  2LT1 A;  4C8Q B;  5FW9 A;  2MI6 A;  2E41 A;  3NMZ C;  1TWB A;  2ZPH B;  4OVA A;  3ZBD A;  2L3R A;  3LGL A;  4M4Z A;  5GAN d;  4RMO A;  3QWY A;  2F69 A;  3G71 T;  1ZBJ A;  1PD1 A;  3GP8 A;  3DLL A;  1K73 C;  4EMK C;  1MMA A;  3MP8 A;  4C0G A;  3OYH A;  3CD6 T;  2AK5 A;  1GCQ C;  1WGS A;  2KYB A;  4M7A D;  2DE0 X;  2HNI A;  1BCM A;  1EX4 A;  2O2O A;  4M75 E;  4CRI A;  2E64 A;  1YIT T;  4DEY A;  1SF9 A;  1FMW A;  3MKD A;  4N0A A;  2DJZ A;  4JLI A;  1WI7 A;  3S3M A;  1CKB A;  3PTA A;  5GAO q;  3HL8 A;  4M77 F;  1UTI A;  3JCM d;  5CKB A;  3JCM g;  2GFU A;  3SD4 A;  1Q81 U;  2JNG A;  4IUP A;  1TUD A;  3QG1 A;  1X2Q A;  5GMK h;  1NBE B;  3JB9 F;  3D7S B;  2VVK A;  1OOT A;  3M4Y A;  4FSX A;  5LJ5 e;  4M7A G;  3H0F A;  4Y91 A;  3H41 A;  3OSS C;  1MND A;  5GAM d;  4FT4 A;  3CCU A;  2DXB A;  4QT7 A;  4HT8 A;  3CCQ T;  3H0H A;  3P8D A;  3RKX A;  2DVE A;  2FPE A;  3QZ5 B;  4PLL A;  4E7J A;  1VQ4 Q;  2DPP B;  2X3W D;  2KBT A;  2KK4 A;  4LDU A;  4C5G A;  2O31 A;  2Z0W A;  6AT1 B;  2IVW A;  4L59 A;  4C92 E;  2HKN A;  1NLP C;  4NOY A;  4M77 A;  3E2U A;  2CGH A;  4AG1 C;  2CUD A;  3EHR A;  4HCC A;  5CVI A;  4DBR A;  2XDD A;  4OF1 A;  1VQ9 T;  1D1B A;  4BDZ A;  4WF2 A;  2DZC A;  3R6O A;  3RMS A;  4M77 B;  4RTY A;  2K3B A;  5HK0 A;  4IIM A;  4ZGE B;  4E6R A;  3GLX A;  2PZ1 A;  1VQN T;  3VU3 C;  4FT2 A;  2A28 A;  4FM4 B;  2H8H A;  1Q81 R;  1U5S A;  4YTL A;  9ATC B;  3NTI A;  1O9S A;  1YI2 Q;  3RBB B;  1QP2 A;  4A54 A;  2EBP A;  1K73 U;  1G3Y A;  5M9O A;  3X20 B;  2DYB A;  2R57 A;  2RJE A;  2GGR A;  1GCP A;  3JB9 D;  2FVU A;  1GRI A;  1J3T A;  2WSC E;  4TVR A;  2COY A;  1IRX A;  3EG0 A;  4XQ3 A;  4ZNX A;  2DL5 A;  5CKF A;  1OU9 A;  4MZT A;  2W0Z A;  1WHH A;  3X24 B;  3G4S Q;  4K11 A;  2YLC A;  1SRM A;  1ZUU A;  4ESR A;  1UGQ B;  2RJF A;  4J9B A;  2J6F A;  2VB6 A;  1Q95 G;  3OQ5 A;  4BE0 A;  1AEY A;  1WDX A;  2F2W A;  2ATC B;  1RAF B;  5FU6 C;  2RPN A;  1RAB B;  4CC7 A;  2RQT A;  4OB0 B;  2OI3 A;  5L23 A;  2V1R A;  4X1V A;  4OML A;  2HD0 A;  2CP5 A;  1M8V A;  3H9N A;  2FO0 A;  4C8Q E;  1IZ6 A;  1FX7 A;  1H64 1;  1VQ4 A;  3UWN A;  3A8H B;  4PJL A;  3WVE B;  2HEQ A;  1WFW A;  2YXY A;  2KDS A;  1NPP A;  1C1A A;  5IHK A;  4J9D A;  1K73 R;  4IKF A;  1QCO A;  1TG0 A;  1Q82 C;  2ZPG B;  2A0F B;  4II1 A;  3JCM W;  3L2R A;  3RIR A;  3M5A A;  5KYN A;  4EPC A;  3SEM A;  4F04 B;  2LJ0 A;  2YRV A;  1K9M U;  1W2B A;  3CCU T;  1FWZ A;  1AVZ C;  2HAX A;  2RNA A;  1MV3 A;  2MPX C;  3M0S A;  2HQX A;  2XDP A;  2JW4 A;  4Z02 A;  2DEU A;  2PUO B;  1UEC A;  2ABL A;  4PJN A;  3OS5 A;  5GMK e;  2E5K A;  3LH0 A;  2QTV A;  1B07 A;  1B34 A;  1YI2 A;  1QVF S;  2KT8 A;  1W4S A;  2GF7 A;  1RI0 A;  3QSU A;  1KK7 A;  3CD6 Q;  5KCH A;  3I56 Q;  2ZPE B;  2ZPB B;  4IUT A;  2D6F A;  1Y0M A;  2CRE A;  5CAI A;  3OYK A;  2QDL A;  4MDW A;  2X4Y A;  5C0M A;  1E6G A;  3E19 A;  2DXC A;  3G4S A;  1NG2 A;  3V8J A;  2RQV A;  1MUZ A;  1BIA A;  3OW2 P;  4LUD A;  2QQR A;  5CIU A;  3MHX A;  2LP5 A;  2EQI A;  3BFM A;  2HQH A;  1Y7X A;  1AHJ B;  1B7T A;  3TSZ A;  5C6S A;  4PJO C;  2LQW A;  5CQY A;  4M77 E;  2CYZ B;  2DA9 A;  3PFS A;  2RHY A;  3KXT A;  2CH4 W;  1UE9 A;  4Q5W A;  1UJ0 A;  1G2B A;  3RER A;  1HK9 A;  2PVD B;  3CC7 T;  4XAX B;  3LGF A;  5CQX A;  2DXU A;  3OBY A;  2HQE A;  4XTX A;  3SB2 A;  1LNX A;  5GAN 4;  2VGM A;  2XI9 A;  2Y4Y A;  2LTO A;  1Q82 U;  2EYX A;  1YWO A;  2VXF A;  3CPW P;  4BY6 C;  1I8F A;  2RO0 A;  3M54 A;  3QJ6 A;  4WTO B;  4MZM A;  3QYH B;  2DIQ A;  5IHN A;  2JVV A;  4FCY A;  5LJ5 d;  2E12 A;  4AT1 B;  3OS2 A;  1D0X A;  2CZ7 B;  1XNI A;  4KUD K;  1WHK A;  1X2K A;  1Q7Y C;  1QCF A;  4FYW B;  1PWT A;  3Q1J A;  2ZCF B;  5AT1 B;  3E9G A;  1RLQ C;  1U1T A;  3OBW A;  3OY9 A;  2QA4 A;  1K8A C;  2EQJ A;  4E7L A;  4HVV A;  2W10 A;  2FB7 A;  4BI8 B;  1M2O A;  1BB9 A;  4D8D A;  1KJW A;  4M7D A;  3DLM A;  5IH2 A;  2KI7 A;  1YJW T;  2X4X A;  2RQU A;  3MO8 A;  4C5H A;  3MET A;  1K4U S;  4XU1 A;  2MWO A;  1AWX A;  2VUB A;  1VYU A;  2JM9 A;  3QYG B;  4M75 D;  5FWC A;  3V7S A;  3CD6 A;  2HBP A;  5IT9 E;  3I56 A;  2K5F A;  3N5B B;  3L2W A;  2EGA A;  2X35 A;  1D0Y A;  4IUR A;  4J7I A;  2K3X A;  3CBO A;  4A4F A;  1Q82 R;  2J06 A;  1KFZ A;  2FPF A;  2P0P A;  1OV3 A;  2XIC A;  2LQN A;  2YUQ A;  4JZ4 A;  3QBY A;  2E4H A;  2LZ6 B;  3A8L B;  1YI2 T;  4EMK A;  1N8R C;  3FB9 A;  3E9F A;  1IRE B;  2NUP A;  3C12 A;  2FG0 A;  3JCM Q;  2DVJ A;  3LX7 A;  4C0F A;  3GNG A;  1GCQ A;  4M75 G;  4FW2 A;  2CT3 A;  1GXI E;  4MDX A;  1R77 A;  5J39 A;  4RTX A;  3JSC A;  2EGC A;  3A8M B;  4EMK B;  1N9R A;  2COW A;  3A8G B;  1AWW A;  2L0A A;  4XU2 A;  3RDV A;  4F14 A;  1IGQ A;  1R0C B;  3EH1 A;  2DXT A;  1OZ3 A;  4F17 A;  2EYQ A;  3QUI A;  2M0Y A;  3GF5 A;  1RAH B;  3P8B B;  1K0S A;  1S1N A;  2Y4X A;  1C0M A;  4RG8 A;  3ZL7 C;  1Y07 A;  3QPH A;  1MMN A;  1NYG A;  4E7S A;  2K79 A;  1PRL C;  3UPU A;  2JJ9 A;  2ZZD A;  4J83 A;  3CBP A;  2GQI A;  2EYY A;  4JS4 A;  3HRU A;  3M9Q A;  3CCU Q;  4BE2 A;  4X9D A;  1VYV A;  2F2X A;  1Z9Q A;  1Q7Y U;  1E7O A;  2FRW A;  1UHC A;  1T0J A;  4C92 G;  4Y28 E;  4CC2 A;  4EIK A;  1FYN A;  1Z9Z A;  1IHV A;  3J81 E;  1K8A U;  1LVK A;  4QKU A;  3CXC S;  1SSH A;  4M78 F;  4OMM A;  7AT1 B;  5EG2 A;  4JJB A;  2JM8 A;  2RJD A;  2DTO A;  3X26 B;  1VQM Q;  3M58 A;  2QG9 B;  1OX8 A;  3M56 A;  4LN2 A;  2D8H A;  4KGX B;  2KGT A;  2EWN A;  3MEW A;  1HSQ A;  2HL5 C;  3QWX X;  2P0Q A;  4J9I A;  4XTZ A;  3GIB A;  1AWJ A;  1AOJ A;  1KQ2 A;  2JS0 A;  4X9C A;  2L3S A;  3F70 A;  3JRZ A;  2K6D A;  2AT1 B;  2H3J A;  3RR6 A;  1UG1 A;  1AT1 B;  1NPR A;  1KQS S;  3EAE A;  1Y57 A;  3QZ9 B;  1V1C A;  2CP7 A;  1LPL A;  3AHU A;  1QVF A;  2QA4 T;  2RH2 A;  4N4I A;  2QAZ A;  5GAN 8;  1RI9 A;  4M78 A;  4QQ6 A;  1N8R U;  2A08 A;  3M0U A;  3JCM V;  2JTF A;  5A0D A;  3VS2 A;  2O01 E;  5LJ3 f;  3ZEH A;  4P5N A;  5GAO n;  2BZ8 A;  4M78 B;  4C92 C;  1Q7Y R;  1TH7 A;  3I56 T;  1M3C A;  2QQ9 A;  4C8Q D;  2EW3 A;  1KQ1 A;  2DL8 A;  1K8A R;  3CC7 Q;  2HDA A;  3RMQ A;  4AFU C;  1WXT A;  4KUL A;  1OX9 A;  2BUD A;  2MYS A;  4GY5 A;  5CKD A;  2KRN A;  2RQR A;  2E3I A;  2KSS A;  5GAN 3;  3EG9 A;  4DQ2 A;  2KXD A;  4EDU A;  1HYO A;  1HXD A;  5LJ3 j;  3L1A A;  2MWP A;  3H8Z A;  4IUQ A;  1OI1 A;  4C0D B;  4Z8A A;  4R0K A;  1UGR B;  2NLU A;  2C0T A;  3EG9 B;  2DKG A;  3BDL A;  5DLO A;  4C8Q G;  2QEX T;  1JU5 C;  1M90 C;  1SHF A;  2NWM A;  5A0L A;  2KYM A;  1H8K A;  3CPW S;  3C4S A;  2AKL A;  4IIO A;  2LJ3 A;  4FSS A;  1NEG A;  2XU8 A;  2CT4 A;  5CK9 A;  4Z89 A;  1N8R R;  2JMC A;  2YT6 A;  4MZP A;  2O88 A;  3CCV T;  5J3B A;  1YJW Q;  2FZG B;  2L89 A;  1G3S A;  2E70 A;  1U06 A;  1X69 A;  2P4T A;  4J9F A;  1K76 A;  3BE3 A;  1OYX A;  1SPK A;  1VQM A;  4E47 A;  1AZE A;  4EMH A;  1RAE B;  5IN1 A;  2DAQ A;  2ROT A;  3OYY A;  2CH4 A;  2I2L A;  2MOX A;  2A7Y A;  1X6G A;  3H6Z A;  2G3R A;  2DTH A;  2B8A A;  2DTI A;  5DM7 R;  4DOW A;  1JXM A;  3VS7 A;  3WXM B;  2F1L A;  3FLG A;  2BE7 D;  2JN0 A;  5I22 A;  4RKU E;  3JCM b;  2D8J A;  4ATO A;  1AWO A;  3HRS A;  1A0N B;  3FDR A;  1MMD A;  3UDC A;  3TU4 K;  5LJ3 g;  4PJO F;  3X25 B;  4C5E A;  4M77 D;  2DMO A;  3ASK A;  2D0N A;  4M7A C;  4IUV A;  4JZ3 A;  4JJN K;  4FL6 A;  2K5I A;  4LE9 A;  2A36 A;  3EGX A;  4AMC A;  2MIO A;  1ZBX A;  4NS5 A;  5HK3 A;  2RHX A;  4PJM A;  5HKC A;  1OZ2 A;  3OYC A;  2L2P A;  3MEA A;  1JRI A;  2RHZ A;  4OMN A;  3CC7 A;  1QCN A;  5GAO p;  4GLK A;  3EGX B;  3M4G A;  1GBQ A;  4MML A;  2FRY A;  4HCB A;  2NUZ A;  5EC7 A;  2RN8 A;  4PJO A;  2YUN A;  1TTH B;  1ZA2 B;  3JB9 J;  4F7U F;  2GFA A;  2A37 A;  3HTR A;  3UA6 A;  1IGU A;  3VS5 A;  4LUE A;  1BKB A;  5LJ3 h;  4OP0 A;  4JRP A;  5D7U A;  3JB9 G;  1BK2 A;  3M59 A;  2ZGW A;  2EIF A;  5ECA A;  1M90 U;  2EJG A;  2JOY A;  4JUV A;  1WPY A;  4PJO B;  1M1G A;  1VYT A;  4DBF A;  2XK0 A;  4XTW A;  1WHJ A;  4J6X A;  4KBM B;  2YRC A;  2KRO A;  2OTJ Q;  1QLY A;  1H92 A;  2X51 A;  1BCO A;  2HSE B;  1V76 A;  1D1C A;  2GTO A;  2CP2 A;  4BI3 A;  5I21 A;  1YJW A;  2E3H A;  3M0R A;  4KUI A;  4F7U A;  1RUW A;  3JB9 H;  4M78 E;  4J9C A;  3PT9 A;  2WSE E;  1QWF A;  2IPO B;  3I55 T;  1I81 A;  2DLP A;  4PFZ A;  1Q86 C;  3MCA B;  1G8X A;  4BY6 B;  4BUG A;  1PNJ A;  1TXQ A;  2AZS A;  3QHS A;  3HFO A;  4OGE A;  1PSE A;  1NLO C;  4F7U B;  3HHT B;  3CXC A;  3VKI A;  2SEM A;  4A4G A;  4A4H A;  2RQW A;  2QYZ A;  4CI0 C;  2QA4 Q;  3OA6 A;  1W2B P;  2L8D A;  2QGG A;  4LXC A;  5I2M A;  2EJF A;  2XG8 D;  1ABO A;  2G6F X;  3FJP A;  3CMA T;  1CKA A;  1YFN A;  2YHT A;  2YWW A;  4KH0 B;  3L2Q A;  3OYN A;  1M90 R;  1VQM T;  3CBM A;  2D0Q B;  5KYY A;  2K7A A;  2K4Y A;  3O8V A;  1KQS A;  3VYH B;  1KHI A;  1M8M A;  2CZ0 B;  4NL3 A;  1B34 B;  4HA8 A;  4JRQ A;  2LX9 A;  2DEQ A;  5GAN e;  5IAY A;  2RA2 A;  2VV5 A;  1VOM A;  1M3B A;  1OPK A;  2FHD A;  1XTD A;  1M30 A;  2IG0 A;  4PFP A;  2MAM A;  1KIK A;  3PIO A;  1E6H A;  4OMO A;  3CCJ T;  4QQG A;  3I5S A;  4FU6 A;  1WA7 A;  1QKX A;  5CCA A;  4N4H A;  1MHN A;  2J6K A;  3EGD A;  3TVT A;  2D9T A;  4RTU A;  4E7K A;  2QEX Q;  2CZ1 B;  1U3O A;  5GMK l;  1YIJ Q;  4Y92 A;  2NUT A;  2EFI A;  2R5M A;  4O6J A;  2JXB A;  2OTJ A;  4OGC A;  2KXC A;  1W70 A;  3SDZ A;  4OMP A;  3CCV Q;  4J6Y A;  3E1S A;  4M7D F;  1YHQ T;  3PMI A;  2DFU A;  3CME Q;  3KUF A;  3QJY A;  3OYG A;  3OYM A;  1WJQ A;  2KQW A;  5FRM A;  2J05 A;  2KY9 A;  2PVO B;  2E6Z A;  1FMK A;  3OYF A;  4F16 A;  2YRD A;  1Q86 U;  1PSF A;  3S3N A;  1KD1 C;  3CCL Q;  2O4X A;  1NE8 A;  4BI4 A;  1QWE A;  2DYI A;  4JRI A;  4JS5 A;  4C0Z A;  3QDF A;  3EFR A;  5KYX A;  2QK0 A;  2GQV A;  1T0H A;  3EGU A;  1M5Q 1;  5A0G A;  4J8O A;  4D6W A;  1RAI B;  2F2V A;  3T9N A;  2KNB B;  3NHN A;  3CC2 T;  1ZLM A;  1HJD A;  1WXU A;  3LYI A;  1IB8 A;  2ZAE A;  3L2U A;  5LJ3 e;  2WSF E;  3OMC A;  3OS1 A;  2O9V A;  5IXF A;  3MJX A;  2QQA A;  1I1J A;  1ZUY A;  4J5Y A;  3KBG A;  1P92 A;  1X43 A;  1PG5 B;  2HL3 A;  1VQK T;  5GAO l;  3PVQ A;  3L42 A;  2DBM A;  5GAN 2;  4DBQ A;  4XTU A;  4PJO E;  4AFZ C;  4UC4 A;  4M7D B;  3UT1 A;  4HCZ A;  1K1Z A;  3VUZ A;  2FPD A;  2M1H A;  4LDY A;  3CEY A;  1RLP C;  2MK5 A;  1GBR A;  5KYW A;  3NTH A;  4PNO A;  3VS6 A;  3LWI A;  2AKK A;  4QW2 A;  3A98 A;  1H3Z A;  1D1A A;  5LL6 S;  1AD5 A;  4N4G A;  5CO7 A;  1QVP A;  1WX6 A;  4DOV A;  1YJN Q;  1Q86 R;  3VV0 A;  1U1S A;  2FEI A;  5HCK A;  2QTX A;  4C92 A;  2JS2 A;  4LD9 K;  2KMT A;  4AFS C;  4JJC A;  1WNL A;  1RAG B;  2PTK A;  2V26 A;  1OPL A;  3SWN C;  3VS3 A;  4BDY A;  4F7U E;  2RM4 A;  2QEX A;  4BE1 A;  1QVG P;  1UHF A;  1UEB A;  3EG2 A;  3M0P A;  2NUP B;  2RI2 A;  5I11 A;  4RUG A;  2X9H A;  5FWB A;  3URG A;  1YIJ A;  3OYL A;  1PRM C;  3CCM Q;  1QW1 A;  2DX1 A;  1MV0 B;  3ME9 A;  1N9S A;  4A53 A;  4RTV A;  2HBW A;  4RTT A;  1NJI C;  5GAN f;  3CCV A;  2VAS A;  2DZ9 A;  4JLG A;  2KEA A;  1WLP B;  2AZV A;  3CME A;  5CKE A;  2JZ2 A;  1VIF A;  4XTY A;  3JB9 I;  3RUX A;  3I55 Q;  5DY9 A;  2PVG B;  2X4J A;  1C6V X;  2C0O A;  3QKJ A;  2HSP A;  1TU0 B;  3V8L A;  3CCL A;  3EHQ A;  1NZ9 A;  2R5A A;  1JBM A;  1M1K C;  2V1Q A;  1BYM A;  1XJW B;  2MCN A;  2OTJ T;  4ELY C;  3JCM f;  1WHL A;  5GAN j;  1ZA1 B;  3BY7 A;  1I5L A;  4M7A F;  1FMV A;  3CMA Q;  2RF0 A;  3HKS A;  4OMQ A;  1OUL A;  4PL6 A;  4M75 C; 
#chains in the Genus database with same CATH homology
 4ORZ A;  1SPK A;  2EGE A;  2LJ0 A;  3I9Q A;  1IO6 A;  1AZE A;  1UFF A;  3LH5 A;  2ROT A;  5IHI A;  4HVW A;  1AVZ C;  2CH4 A;  4D8K A;  2D1X A;  2MOX A;  3UF4 A;  2RNA A;  1MV3 A;  1X6G A;  3M0S A;  4CC4 B;  1T3S A;  2JW4 A;  1JXM A;  3C0C A;  1UEC A;  3VS7 A;  2ABL A;  5I22 A;  1BU1 A;  2HCK A;  2D8J A;  1AWO A;  2E5K A;  1ABQ A;  1A0N B;  1B07 A;  2M51 A;  2DF6 A;  1GFD A;  2KT8 A;  3FJ5 A;  3JV3 A;  2DMO A;  2IIM A;  2D0N A;  3CQT A;  4JZ3 A;  3VS1 A;  3EG1 A;  2B86 A;  3M0T A;  4LE9 A;  2X3X D;  2A36 A;  2VKN A;  2KR3 A;  1Y0M A;  2C0I A;  2MIO A;  4A63 B;  2LCS A;  2CRE A;  2CSI A;  2QDL A;  1M3A A;  2O9S A;  1E6G A;  2L2P A;  1NG2 A;  4OMN A;  2RQV A;  1MUZ A;  3SHW A;  2JT4 A;  1GBQ A;  3H0I A;  4LUD A;  3ULR B;  2OAW A;  2FRY A;  1GFC A;  2CDT A;  2LP5 A;  2BTT A;  2ECZ A;  2EQI A;  1KSW A;  2NUZ A;  3REB B;  3I5R A;  2BZX A;  5EC7 A;  2RN8 A;  1B3Q A;  2YUN A;  3TSZ A;  1UUE A;  1ZUK A;  2A37 A;  2LQW A;  3UA6 A;  3VS5 A;  2EYW A;  2DA9 A;  4LUE A;  2J7I A;  1PHT A;  1T3L A;  3NPF A;  1BK2 A;  1NM7 A;  1UE9 A;  2CH4 W;  1JQQ A;  5ECA A;  1YNZ A;  1UJ0 A;  1ARK A;  1G2B A;  1VYT A;  1XOV A;  1YN8 A;  1EFN A;  2GTJ A;  2KRO A;  2BZY A;  1QLY A;  4DEX A;  2KT1 A;  4GLM A;  3RNJ A;  1H92 A;  4AFQ C;  3UAT A;  3VRZ A;  2EYX A;  1YWO A;  3R6N A;  2EKH A;  2GTO A;  2YDL A;  1K9A A;  3M0R A;  3NGP A;  1WXB A;  1RUW A;  1WIE A;  2L3Q A;  1ZX6 A;  3UA7 A;  1YWP A;  4J9C A;  2YUO A;  2DRM A;  5IHN A;  1QWF A;  1AZG B;  2PNI A;  2DLP A;  2YUP A;  2VWF A;  1PNJ A;  2AZS A;  1NLO C;  1X2K A;  1YCS B;  2L3P A;  1QCF A;  1PWT A;  1K0X A;  2SEM A;  1X6B A;  1RLQ C;  2P4R A;  1H3H A;  2RQW A;  2LNH B;  2EVR A;  1W6X A;  2DNU A;  4HVV A;  2DL7 A;  1SRL A;  2W10 A;  1UJY A;  1BB9 A;  4D8D A;  1KJW A;  1QKW A;  5IH2 A;  1SEM A;  1NEB A;  1ABO A;  2G6F X;  1GL5 A;  5GJW B;  2RQU A;  1CKA A;  1TUC A;  1K4U S;  4LNP A;  2EYZ A;  2DL4 A;  1AWX A;  1PKT A;  2JMA A;  1VYU A;  2JM9 A;  2DJQ A;  5FWC A;  1I07 A;  2ED1 A;  1OEB A;  1SHG A;  4J9G A;  2XMF A;  2K7A A;  2EGA A;  3PVL A;  2DM1 A;  1M8M A;  4JJD A;  2DRK A;  3VS0 A;  2DIL A;  2ROL A;  1YP5 A;  2K9G A;  3PE0 A;  5FW9 A;  2J06 A;  3NMZ C;  1KFZ A;  2FPF A;  1OV3 A;  1M3B A;  1HD3 A;  1OPK A;  2LQN A;  2YUQ A;  1M30 A;  1PKS A;  4JZ4 A;  3KFV A;  1KIK A;  4M4Z A;  1E6H A;  3QWY A;  2LZ6 B;  4OMO A;  1ZBJ A;  3I5S A;  4HXJ A;  1WA7 A;  1QKX A;  2FG0 A;  4AG2 C;  2DVJ A;  1JO8 A;  1G83 A;  1GCQ A;  2AK5 A;  1GCQ C;  2CT3 A;  2ENM A;  2KYB A;  2DE0 X;  2RMO A;  2J6K A;  2O2O A;  3TVT A;  2LJ1 A;  4RTU A;  4RTX A;  2EGC A;  4DEY A;  2L0A A;  1AWW A;  1U3O A;  4F14 A;  1WI7 A;  2EPD A;  4Y92 A;  2I0N A;  2ED0 A;  1CKB A;  2JXB A;  4F17 A;  1UTI A;  2M0Y A;  2KXC A;  2LX7 A;  1W70 A;  4J9E A;  4OMP A;  1K0S A;  1S1N A;  3U23 A;  2KE9 A;  1TUD A;  5IXB A;  1X2Q A;  4JPB W;  2VVK A;  3ZL7 C;  1NYG A;  2DBK A;  1OOT A;  2K79 A;  3VRY A;  2OJ2 A;  2J05 A;  1PRL C;  1FMK A;  3H0F A;  3H41 A;  4F16 A;  2GQI A;  2EYY A;  4QT7 A;  1NYF A;  3H0H A;  1X27 A;  1QWE A;  2KRM A;  1VYV A;  2F2X A;  2FPE A;  1Z9Q A;  2X3W D;  1E7O A;  2FRW A;  3IQL A;  2KBT A;  1UHC A;  1T0J A;  1VA7 A;  2DL3 A;  4CC2 A;  1T0H A;  3EGU A;  1JXO A;  1FYN A;  1Z9Z A;  2O31 A;  4EIK A;  2CSQ A;  2F2V A;  2KNB B;  2LMJ A;  3NHN A;  1NLP C;  1ZLM A;  1WXU A;  2GNC A;  1HJD A;  1SSH A;  4OMM A;  1UGV A;  2CUD A;  3VS4 A;  4AG1 C;  3EHR A;  4JJB A;  2JM8 A;  2K2M A;  1UDL A;  2O9V A;  3M0Q A;  4J9H A;  5IXF A;  1I1J A;  1ZUY A;  4LN2 A;  2D8H A;  1X43 A;  2KGT A;  4Z88 A;  4RTY A;  1HSQ A;  3QWX X;  2K3B A;  3PVQ A;  2DBM A;  4J9I A;  1AWJ A;  4IIM A;  1AOJ A;  4AFZ C;  2JS0 A;  4E6R A;  2L3S A;  2CUB A;  1K1Z A;  2K6D A;  2FPD A;  2PZ1 A;  1UG1 A;  3EG3 A;  1RLP C;  1GBR A;  2A28 A;  1Y57 A;  1V1C A;  2H8H A;  4CC3 A;  3VS6 A;  1U5S A;  4RTZ A;  2AKK A;  1I0C A;  3RBB B;  3A98 A;  1RI9 A;  2EBP A;  1LCK A;  1N5Z A;  4HCK A;  2A08 A;  3M0U A;  1AD5 A;  2DYB A;  2GGR A;  3VS2 A;  1GCP A;  1WX6 A;  1GRI A;  1J3T A;  1M27 C;  2FEI A;  5HCK A;  2BZ8 A;  1JEG A;  2JS2 A;  3EG0 A;  2GBQ A;  4AFS C;  4JJC A;  2KRS A;  4ZNX A;  2PTK A;  4KRT A;  2DL5 A;  1M3C A;  1OPL A;  3VS3 A;  2W0Z A;  2EW3 A;  2DL8 A;  1UHF A;  4K11 A;  2HDA A;  1SRM A;  1WYX A;  1W1F A;  3EG2 A;  3M0P A;  5I11 A;  4AFU C;  4RUG A;  5GJV B;  5FWB A;  1ZUU A;  4ESR A;  2YSQ A;  1WXT A;  4J9B A;  1PRM C;  2J6F A;  2KRN A;  4RTW A;  3REA B;  2DX1 A;  1MV0 B;  2RQR A;  1AEY A;  1WDX A;  2F2W A;  4RTV A;  2SRC A;  2HBW A;  1ZSG A;  2KXD A;  4RTT A;  2RPN A;  1BBZ A;  4CC7 A;  2KEA A;  1WLP B;  2AZV A;  2RQT A;  4Z8A A;  4R0K A;  2C0T A;  4HVU A;  2OI3 A;  5L23 A;  2V1R A;  2J6O A;  4OML A;  4X1V A;  1JU5 C;  2C0O A;  2HSP A;  4WCI A;  1SHF A;  2NWM A;  2KYM A;  1H8K A;  2FO0 A;  4GBQ A;  1CSK A;  3EHQ A;  2AKL A;  4IIO A;  2LJ3 A;  3O5Z A;  2HEQ A;  3I35 A;  1NEG A;  1WFW A;  4FSS A;  2V1Q A;  3GBQ A;  2CT4 A;  5IHK A;  2MCN A;  4Z89 A;  4J9D A;  1TG0 A;  2JMC A;  2YT6 A;  2O88 A;  3THK A;  2ESW A;  2RF0 A;  3TSW A;  4OMQ A;  2JTE A;  1U06 A;  1X69 A;  3SEM A;  4J9F A;  1K76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...