1JQQA

Crystal structure of pex13p(301-386) sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
ISEFGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PAS20
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, membrane protein
total genus 11
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jqqA00
2DF6A 2JM8A 3VRZA 2XMFA 3VRYA 2DILA 1OV3A 1UJYA 1KFZA 3A98A 2C0TA 1YNZA 2KRSA 1AWJA 2CUDA 4ORZA 2QDLA 2O88A 4F17A 2ROTA 2D8JA 1MV0B 4CC3A 2LCSA 1NLOC 5GJWB 2K7AA 4WCIA 1PRMC 1M3AA 2ESWA 2LQNA 3I9QA 3EG3A 1QCFA 1MV3A 1ABQA 3C0CA 1KJWA 1JO8A 2MIOA 2MOXA 3M0SA 4DEXA 4J9FA 2EBPA 1BU1A 2MCNA 1UGVA 1NM7A 2L0AA 3UA6A 4J9EA 1RI9A 2EQIA 4Z8AA 1GL5A 1M30A 3VS6A 3PE0A 1AZGB 1H92A 1BK2A 2YUQA 3I5SA 4AFZC 4LUDA 2EYYA 1Y57A 4RUGA 2PTKA 2F2WA 2PZ1A 4GLMA 4IIMA 2GGRA 2W0ZA 2LP5A 3UA7A 4J9CA 4LNPA 1LCKA 1NYFA 1ZUKA 1UUEA 1T3SA 2EYZA 2IIMA 2OJ2A 1X69A 1TUCA 2D1XA 1B07A 1RLQC 2O9SA 3O5ZA 2RQRA 3H0IA 2DVJA 1GFDA 5ECAA 2ENMA 2L2PA 4RTTA 3U23A 1NLPC 2SRCA 2KR3A 1AOJA 4OMLA 5IXFA 2DJQA 2KNBB 2V1QA 4HVUA 4AFSC 1QLYA 2ROLA 1ZLMA 1GCPA 3EGUA 2V1RA 1WXTA 2EPDA 2JS0A 2LJ0A 2KEAA 1E6GA 2VKNA 5IH2A 2FO0A 5I11A 2K6DA 4ZNXA 1UFFA 2AZSA 1SEMA 1AWOA 3NPFA 2LQWA 2P4RA 5I22A 1SSHA 2KXDA 3KFVA 2E5KA 5L23A 2DE0X 4FSSA 2CH4W 3EG0A 3H41A 4Z89A 2KGTA 3VS3A 2BZYA 3NHNA 1ZX6A 1YN8A 2JXBA 2K2MA 1IO6A 2JMAA 1AWXA 1FMKA 1X6GA 1WXUA 3GBQA 1ZBJA 3EG1A 1W1FA 1QKWA 2J6KA 2DM1A 2DA9A 4F16A 2LJ1A 2KBTA 3H0FA 1HJDA 1K0SA 1WYXA 2J06A 2RNAA 2L3QA 1U5SA 1B3QA 3REAB 1G83A 1GRIA 1SHGA 2YT6A 4CC7A 2J6OA 2HCKA 1TG0A 1WFWA 2ED0A 2RN8A 3VS7A 1VYUA 2RQVA 2F2XA 1K4US 1KIKA 1UTIA 1ZUUA 2O2OA 1X27A 2FPFA 3R6NA 2FPEA 2LJ3A 2KYBA 3TVTA 1GBQA 3JV3A 1GCQA 1JEGA 4IIOA 2CUBA 2JMCA 1UG1A 2JW4A 4RTWA 1W70A 2F2VA 2AKKA 2KRMA 2O31A 4K11A 4OMQA 1RUWA 5FW9A 2JM9A 1PRLC 2LNHB 2YDLA 2DL3A 1ARKA 1OPKA 2A36A 2GTJA 2RQTA 4RTUA 1CKAA 1OPLA 3THKA 2D0NA 3M0PA 2GTOA 3PVQA 4AFQC 2FRWA 1T3LA 2DLPA 1NYGA 1ABOA 5IHKA 1SRMA 4OMNA 2EYXA 2ECZA 2O9VA 2CT4A 2DRKA 1Z9ZA 3EG2A 3ULRB 1SPKA 1W6XA 3QWYA 2CSQA 4HXJA 2DBKA 3REBB 3UF4A 2X3WD 4J9DA 4M4ZA 3EHRA 4OMMA 1T0HA 2PNIA 4AFUC 2HSPA 2DYBA 1K0XA 4JZ3A 1WLPB 4J9GA 2CREA 2A28A 2H8HA 1S1NA 1K1ZA 2A37A 4D8KA 3I5RA 2KRNA 1PKSA 4F14A 1G2BA 4CC4B 1JXMA 3VS2A 1H3HA 1WX6A 1AWWA 3M0QA 1FYNA 2DMOA 1ZUYA 3LH5A 1M3CA 2JTEA 2AZVA 3VS4A 1UDLA 5IXBA 4OMPA 1BBZA 1XOVA 2X3XD 1WXBA 2KROA 2HDAA 2L3PA 2RMOA 1CSKA 2CDTA 3VS5A 2A08A 1VA7A 1Z9QA 1UECA 4DEYA 1YCSB 1UE9A 1AVZC 1ZSGA 3M0UA 1H8KA 3QWXX 4JJDA 1EFNA 1SHFA 2DL4A 2EGCA 3ZL7C 1Y0MA 4JJCA 4JJBA 4HVVA 1OOTA 2VVKA 2VWFA 1NEGA 2FPDA 1WIEA 2RQUA 1KSWA 2KT8A 1SRLA 2DRMA 2W10A 2YUPA 1MUZA 1J3TA 5GJVB 2LZ6B 3TSZA 5FWBA 3EHQA 2K3BA 4E6RA 1GBRA 1OEBA 1JU5C 1QWFA 1N5ZA 3I35A 5IHNA 1QWEA 5FWCA 4RTYA 1PHTA 2YUNA 1WDXA 2CH4A 2G6FX 1WA7A 1UHFA 1GCQC 4OMOA 4A63B 2LMJA 1A0NB 4AG1C 2FG0A 1VYVA 2GQIA 1HSQA 2EGAA 1PKTA 2AKLA 4JZ4A 2DL5A 4LE9A 3TSWA 4JPBW 2NUZA 2HBWA 4GBQA 2RQWA 2YSQA 3PVLA 4X1VA 4LN2A 4J9BA 3SHWA 1PWTA 2NWMA 1UJ0A 4KRTA 2YUOA 2FRYA 2J7IA 1YP5A 2GNCA 1HD3A 2D8HA 1RLPC 3CQTA 2M51A 2KT1A 4RTZA 2LX7A 1NEBA 1T0JA 4RTVA 4AG2C 2DL7A 1X6BA 3NGPA 2DL8A 2HEQA 1I1JA 2SEMA 1UHCA 3RNJA 3M0TA 1U06A 2BZXA 2DBMA 2J6FA 1E6HA 1V1CA 1JQQA 3NMZC 1I07A 1GFCA 4QT7A 1WI7A 2I0NA 2ABLA 1AD5A 2ED1A 4D8DA 1AZEA 1VYTA 1M8MA 3M0RA 1M27C 2DX1A 2K79A 2KE9A 2AK5A 3VS1A 4RTXA 4HCKA 1K9AA 2EYWA 1K76A 2L3SA 4ESRA 2C0IA 2JT4A 2RF0A 1YWPA 3H0HA 3UATA 3FJ5A 5EC7A 1AEYA 5HCKA 1QKXA 2KYMA 2OI3A 4LUEA 1I0CA 2KXCA 2EVRA 4J9HA 2OAWA 1NG2A 4CC2A 2RPNA 3RBBB 2GBQA 2EW3A 1E7OA 2DNUA 2JS2A 4Z88A 1TUDA 1U3OA 1M3BA 2FEIA 4R0KA 4EIKA 2CSIA 3IQLA 5IHIA 2J05A 2CT3A 4HVWA 3SEMA 2BTTA 1BB9A 1X2QA 1X43A 2M0YA 2K9GA 4Y92A 1CKBA 1PNJA 4J9IA 1YWOA 2EGEA 2EKHA 1JXOA 1X2KA 2C0OA 2BZ8A 2B86A 3VS0A
chains in the Genus database with same CATH superfamily
4PL6A 1PC0A 4HA8A 5GMKl 3G6EA 2DILA 3CCET 2C0TA 2XG8D 2QGGA 4GLKA 4ORZA 4XAXB 4XTZA 1KD1R 2ROTA 1OULA 2DKGA 4M77C 5GAOr 4OB3B 5GJWB 1KC8C 2ESWA 2QEXA 4M7DB 3H8ZA 3I9QA 3JCMV 3CCMA 2XI9A 4M75A 3JB9F 4OB1B 2KVQG 3QJYA 3MP8A 4BY6C 4FW1A 3GNGA 2MIOA 3CC4A 1RAIB 4DEXA 4J9FA 4XTUA 1F1BB 3M57A 2EBPA 3UA6A 1YCYA 4KH1B 1MMNA 4E7IA 1K9MU 1BK2A 2YUQA 3I5SA 8AT1B 5KYUA 4RUGA 1PSEA 5GAMf 3HKSA 4IIMA 5GMKe 1ZA2B 4BE1A 3UA7A 4J9CA 3MP6A 1NYFA 4UC4A 4CRIA 3OS0A 1IRXA 3CCVQ 2OJ2A 3CCRT 3A8LB 2XDPA 1O9SA 1B07A 1RLQC 2DTIA 1QVPA 2COWA 3H0IA 5DLQE 2M0OA 2L2PA 4RTTA 3L2ZA 1NLPC 2SRCA 2KR3A 1AOJA 5CVIA 5IXFA 1KC8U 2E6ZA 4AFSC 1QLYA 3META 1VQLQ 4O6JA 3M55A 4OF1A 4M78B 3HPWA 1E6GA 3JCMX 1OZ2A 1UFFA 3OB9A 2AZSA 5IAYA 4QVZA 1R0CB 2LQWA 4LDYA 5I22A 3KFVA 3MPUB 4C92C 2E5KA 4J5YA 5L23A 2DE0X 3JCMP 2PVDB 4BUGA 2K4YA 1U8RA 2KGTA 2A0FB 4XQ3A 3I56T 4J83A 1YN8A 2MF2A 2DYIA 1NJIU 1FMKA 1X6GA 1VQ6Q 3UWNA 2IVWA 4M7AD 3GBQA 4ZGJB 3V8JA 5GAN4 1QKWA 2J6KA 3LWHA 2LJ1A 3H6ZA 5A2QE 5CQYA 2VGNA 3J7AF 1K0SA 4M75G 3WVEB 2OTLQ 1VQMQ 2L3QA 1K8AR 1TWBA 5GAMd 1QW1A 2EAYA 1SHGA 1FMVA 3SD4A 4KH0B 2J6OA 2H3EB 3OBWA 4DBRA 1JJ2S 2HMAA 1M90R 1WFWA 3C95A 3JCMb 2RD1A 1YFNA 3GOXA 3JSCA 2V26A 3OYKA 4EMGA 5KE3A 1UEBA 1C6VX 2NUPA 1I5LA 3M59A 5I2MA 5LJ3j 1GBQA 8ATCB 1BIBA 2F1LA 4ZTFA 2K57A 2AT1B 4M75F 1X6OA 3CC7T 1VQ7Q 2KRMA 2OAUA 4OMQA 3M4GA 2DL3A 5LJ5j 3I55A 3RESA 4M77E 1YJNQ 2MI6A 2RQTA 4RTUA 4FM4B 4BD3A 3ZFJA 3CCJA 2QTXA 2FRWA 4N0AC 5J39A 3DKMA 1NYGA 5IHKA 4PFOA 2HQHA 4RCBA 2OX7A 3ULRB 1SPKA 3QWYA 3JCMf 2DVEA 4E7ZA 2FVUA 3EHRA 4AFUC 2HSPA 1JJ2P 5A0LA 1Y96B 4L6V5 2H8HA 4HCZA 4R55A 1JXMA 2IG0A 2ZCFB 4IUQA 3LH5A 3RIRA 1UDLA 3P8HA 1RI0A 2EJ9A 3G71A 5M9OA 2L3PA 3MEAA 4C0ZA 1VUBA 3OYAA 4OB0B 1KQ1A 2DTHA 3CMAT 2WSCE 2ZPIB 1UE9A 1ZSGA 3M0UA 4WTOB 2PQWA 4E7JA 1AHJB 1EFNA 3QDRB 1XQHA 1VQNT 2VYTA 2DL4A 1WJQA 1Y0MA 4HVVA 2VVKA 5I21A 4C5EA 2VWFA 1BCMA 3CCUQ 4A4FA 5CKEA 3A8HB 1D0XA 1SRLA 2DRMA 3BDLA 3V7SA 4C92E 2X4JA 1M1GA 2RHYA 1SKUB 3UPUA 2L3RA 3CBOA 2NUPB 2QA4A 1OZ3A 3CC2A 1IHWA 3UDCA 5FU6C 4E6RA 4II1A 1GBRA 1WZOA 1SG5A 4LDUA 3WXMB 1Q86R 3JCMd 1MGQA 4ME7A 3LGLA 2YLCA 2DEUA 3I35A 5IHNA 1QWEA 1RAEB 1NE8A 3VUZA 5C6SA 3P8BB 4A63B 1P92A 1Q81R 2E41A 2IPOB 5KH6A 4M77A 1VQ6A 3OYDA 4J7FA 4MZMA 4FYXB 2EJGA 4MDWA 1PKTA 2AKLA 1LVKA 7AT1B 4LE9A 3TSWA 2NUZA 2GCXA 1VQMA 2OTLA 2RQWA 4F7UE 3X20B 2EKOA 2KDSA 1IREB 1YJ9Q 2DAQA 1PWTA 5HK3A 3PIPA 1UJ0A 4C8QB 4IUTA 4JLGA 1PD1A 4R56A 1Q7YU 3FJPA 3CQTA 1ZHIA 4RTVA 4NL2A 2HD0A 3HSBA 1G3TA 3QZ5B 3G6ET 1PM3A 4M7DD 1WHHA 1UHCA 1UB4A 3PFSA 2HBPA 2LNVA 4XU3A 4Z02A 3AT1B 1I07A 4WF2A 3WVDB 1YI2A 4E2FB 4ZN3A 2CP7A 4VUBA 1VQ7A 3CCMT 1X01A 2CZ6B 4N4HA 2K79A 3VS1A 3OS2A 4PJJA 5GAOn 3CC4T 5LL6S 3V8KA 2DEQA 2L3SA 1Y7XA 1YJNA 1YWPA 2L8DA 1QVFA 2VUBA 2DXTA 4E7LA 3VU3C 5GAN7 2RI2A 1YJWT 2EVRA 2OAWA 3JCMg 4C92A 2K3YA 4DA4A 3AHUA 3EH1A 4XK8E 1IGUA 4FW2A 4M77G 1IZ6A 2COZA 4M78D 3QDFA 3Q1JA 4Z88A 3E1SA 4EIKA 2XK0A 3SEMA 2ZPHB 4MMLA 4KT0E 1N9SA 2M0YA 2K9GA 2CZ0B 2C0OA 4TVRA 4M77B 4RKUE 1VQ8T 3VS0A 4E7KA 2CZ7B 2DF6A 2JM8A 5J26A 2E4HA 3JCMc 4DQ2A 2QASA 1AWJA 4F17A 3OS5A 4BY6B 2RO0A 3V7RA 4F7UA 2JJ9A 4CC3A 2LCSA 1NLOC 1UGPB 2X35A 5KCOA 4KUDK 1I8FA 3EG3A 4JRPA 3LW5E 3S6WA 2ZPGB 3VKIA 3C0CA 2FB7A 1N8RU 2QXFA 3CCSA 3HL8A 2MCNA 1BU1A 2O4XA 1UGVA 2L0AA 1RI9A 2R57A 2EQIA 3PMTA 3FC3A 4EDUA 5GAMe 5GMKm 1WHJA 2GFAA 5KYWB 1EZZB 2MMPA 1H92A 4AFZC 4E47A 2EYYA 1JB0E 1W2BA 2VC8A 2F2WA 3L1AA 5GAN3 5KE2A 1BI0A 1Y71A 4N0AA 3QBYA 4KGZB 1LCKA 1ZUKA 3CCLT 4P5NA 1GXIE 2XD0A 4A4KA 1FXXA 5CCAA 1VQ5Q 2BIVA 2FZCB 2GFUA 3O5ZA 1K73U 5CK9A 2KNBB 1Q82C 2V1QA 2V8JA 4C92B 2ROLA 1GCPA 4AMCA 5IN1A 2V1RA 2JS0A 3I55T 5IH2A 1RAGB 4LD6A 1FX7A 2JUFA 3NPFA 2P4RA 3CCJT 3CPWA 3HHTB 1QMCA 4MMKA 3OW2P 3H41A 5GANj 1RAFB 4Z89A 3JCMW 1U1SA 3S3OA 2EQJA 3QYHB 2EQUA 3JCMQ 1ZX6A 2PUKB 3GF5A 4F7UG 2JMAA 2YXYA 1AWXA 4OP0A 1VQOQ 1ZBJA 3EG1A 1W1FA 2DM1A 1VQKQ 1QQJA 2LRQA 1K9MR 1HJDA 2E64A 1WYXA 3ASKA 2FZKB 3ER0A 2ZPEB 1U5SA 3GLXA 3QHSA 4KGVB 1B3QA 2VB6A 1EIFA 2G3RA 1M1KU 3E19A 3CD6T 3M53A 3G71T 1AT1B 2E10A 3OYLA 1VYUA 2Z0WA 2DD4A 2CZ1B 2C06A 4J6YA 4F7UF 3BFMA 1KIKA 1UTIA 2DK3A 1FMWA 4EMKB 5AT1B 1X27A 1VIEA 3UT1A 1UGSB 2XIDA 3CXCS 2KYBA 4AT1B 1JEGA 1KD1C 4IIOA 4J8OA 4C0GA 2JW4A 1YHQT 1TTHB 1BI1A 2AKKA 4C0FA 3CCQT 1RUWA 5FW9A 2JM9A 2YDLA 3GIBA 4FL6A 5FRMA 1OPKA 2RB6A 2YRCA 4PLIA 1CKAA 2K3XA 2QA4T 2D0NA 3CC2T 3M0PA 2GTOA 3DLLA 1NJIR 4NL3A 3RUXA 3CCEQ 2RI5A 4JRQA 4OMNA 2EYXA 2NUTA 2Y4XA 2LQKA 5GAOq 2E3IA 3JCMe 1Z9ZA 1M1FA 1WJRA 4M7DF 1W6XA 1LNXA 3QKJA 4E7HA 3PMIA 3SWNB 2QAZA 2X51A 3TQ7P 1T0HA 2DYBA 1K0XA 3O8VA 1OU9A 4C8QD 4BI3A 1D0ZA 1K1ZA 3X26B 4A53A 2KRNA 4F14A 1G2BA 1BI3A 3VS2A 3J81E 2DIQA 2OTLT 2FYKA 1FYNA 3CXCP 3EFOA 2KSSA 4A4EA 3CBPA 2AHJB 2KROA 5FROA 2RMOA 2CP2A 4EMHA 3QIIA 3GPLA 1YCSB 5GAMh 4JJDA 4ANJA 3LGFA 2RJFA 2VGMA 4FYVB 4NOYA 1SHFA 3CCRQ 4L5GA 2WSEE 4JJBA 2EWNA 1OOTA 5CO7A 1NEGA 5FU6B 4FSXA 3OYGA 1YI2T 5KYNA 2RQUA 3RKXA 2JZ2A 3KUFA 2K5LA 1M9SA 1VQ7T 1J3TA 1BYMA 3LX7A 3FIFA 5FWBA 2E12A 3HP9A 2MWOA 1YITT 2QYZA 2EIFA 4M75B 1S72Q 4MDXA 2K3BA 3SB2A 1K8AC 1JU5C 2DJZA 3QSUA 2QQSA 2YHTA 3JCMJ 1QWFA 4C0DC 1OX9A 2LCCA 1QVGS 1GCQC 4OMOA 3I56Q 1M90C 1I5OB 1VYVA 5KYUB 3OMCA 1HSQA 1JRIA 4PJLA 1VQKA 3CMET 4M77D 3EFSA 3LH0A 4JZ4A 4JPBW 1HK9A 1M2VA 4IUUA 4J6XA 2YSQA 1IGQA 3PVLA 2DETA 4XU2A 4J9BA 2E1HA 3RR6A 2NWMA 4PLLA 2YRDA 2YUOA 2FRYA 1YP5A 2GNCA 4NS5A 4M7DC 5AYFA 2M16A 1D1CA 1T0JA 4BACA 3PNWC 1I1JA 1OYXA 4PJMA 4PJOG 4ELZC 1V1CA 4YTLA 1UGQB 2LCLA 2MAMA 1VQ4T 2I0NA 3A8MB 1M90U 5DM7R 1M8MA 3CC7Q 3M0RA 2F69A 1QVGP 1D1AA 2EYWA 3CCST 1ACMB 4OGEA 2RF0A 4MZPA 3BDUA 1VQ9T 3FJ5A 5EC7A 5HCKA 1R0BG 1QKXA 1H3ZA 5D7UA 2QGFB 5GAOp 5J3BA 3CCEA 4PJOF 1KQSS 3CCVA 1NG2A 2YRVA 4X9DA 1WPYA 5GAOl 2RPNA 2RJDA 1OI1A 5GMKh 3A8GB 3FRNA 3OYFA 2EW3A 1PCXA 3RMSA 4C92D 1MMAA 1QCNA 1KQ2A 2JS2A 2QQAA 2QTVA 1VOMA 1M4ZA 1TUDA 2KI7A 3H9NA 2K5IA 3JCMh 1KK7A 1OX8A 4R0KA 3HRSA 4RG8A 1Q7YR 1JJ2A 1VQLA 2HAXA 5FRNA 4HVWA 2XICA 3OY9A 1X2QA 1X43A 2RK1A 4Y92A 2AIRB 1CKBA 1PNJA 2EYQA 2EKHA 1JXOA 1X2KA 4X9CA 2KK4A 4KGXB 2B86A 3VRZA 5GANf 2XMFA 3VRYA 1D3BA 4FT4A 1D1BA 1OV3A 1B34A 1UJYA 5CAIA 1KFZA 1VIFA 3A98A 5KYXA 3VYHB 1YNZA 2QDLA 2F5KA 3EGXA 3CMAQ 2CP0A 2CGHA 1ZSZC 2LT4A 2D8JA 4FU6A 1Q86C 5D6YA 2OTJT 1B7TA 1VQNQ 4WCIA 1PRMC 2V8KA 1M3AA 5GAMj 3CCRA 2LQNA 5HKCA 2M02A 1QCFA 2E5QA 1MV3A 1ABQA 5KYYA 1KJWA 1JO8A 3JB9D 1Q81C 1KQSP 2MOXA 1TXQA 1OU8A 1ZA1B 5FU7B 5A0DA 3TEEA 1IXDA 1NM7A 4J9EA 5CKBA 4Z8AA 1M30A 3PE0A 1S72A 1YBYA 1MMGA 1BKBA 4BE0A 1Y57A 5CKDA 3M58A 2PTKA 5C0MA 2PZ1A 4QVDA 2GGRA 1BI2A 2W0ZA 1RADB 2D0QB 1RABB 1G8XA 3G1JA 2LVMA 4MZTA 3TU4K 1UUEA 3I56A 1T3SA 2IIMA 2VV5A 2JN0A 1TSFA 2QEXT 4M7AG 4B6MA 4C5IA 2VASA 1LPLA 1TS9A 2ZGWA 2DVJA 3OYIA 4M7DE 1GFDA 4C8QF 3L2RA 2DJQA 4HVUA 2XU8A 4BDZA 2QQ9A 2CYZB 1NBEB 1ZLMA 3ZEHA 3EGUA 1WXTA 1HYOA 2VKNA 4PJOC 3C94A 2LT1A 2K6DA 4OMFB 4ZNXA 3HRTA 2RHUA 1PD0A 1SSHA 4IUPA 1D0YA 4FSSA 2X4XA 3G6EQ 2M9UA 2H3JA 3VS3A 1N8RR 3OMGA 2BZYA 3NHNA 2XDBA 4M7AF 2LTOA 1IO6A 4BB7A 1WXUA 4JLIA 2NLUA 2KBTA 1B34B 3LLRA 3CC7A 1MNEA 2M1HA 3MCAB 1N6AA 3CCMQ 3HFNA 2PUOB 1QP2A 2ZPFB 3CC4Q 2RHZA 2YT6A 1YIJQ 2DERA 4CC7A 2KAFA 3CPFA 5IT9E 2HCKA 4XU1A 3MO8A 4F04B 5CR2A 2ED0A 2RN8A 1YJWQ 2RQVA 2F2XA 5I2SA 1K4US 2P4TA 1K73R 1ZUUA 2BKDN 2FPFA 2FPEA 3M54A 2R5MA 1V76A 3TVTA 3X24B 2QQRA 1M8VA 1GCQA 3CCUA 1MMDA 3D7SB 4LXCA 2JMCA 5GMKj 4RG2A 3GP8A 3OW2S 1UG1A 4M75D 4RTWA 1W70A 4K11A 2P0PA 4FIBA 1PRLC 2P0QA 1WQWA 2K5FA 5GANg 5GAN6 2GTJA 3OQ5A 4E7SA 3LYIA 2QI2A 1VQ8Q 4N4IA 1WHLA 3PVQA 1T3LA 5LJ3f 5CQXA 1ABOA 1C0MA 4M7DA 2O9VA 3EG2A 4CI0C 4QQGA 3CMAA 3L2VA 4HXJA 3MEVA 3REBB 4J9DA 4C8QC 4M4ZA 5LJ5f 2HKNA 4J7IA 4JZ3A 2DIGA 5CKFA 4J9GA 2CREA 2A28A 1M1KR 1YJ9A 1S1NA 3L2QA 1VQKT 3I5RA 1JBMA 1VQPQ 3E9FA 2QG9B 3MHXA 3M0QA 3N5BB 1ZUYA 1BCOA 4GY5A 5IXBA 1BBZA 2GF7A 2X3XD 2HDAA 4M7AC 2FHDA 2ZZDA 4FYYB 4A4GA 2A08A 1VA7A 4DEYA 2BE9B 2KY9A 3PIOA 3HFOA 1AVZC 1H8KA 3CCLQ 2RHXA 4PK4A 3T9NA 4PJOE 2EGCA 4HKEA 3EG9A 3OSSC 3SDZA 1H641 3QXEB 1TU0B 1WIEA 5DLOA 4F7UB 1KSWA 1QCOA 2Y4YA 2YLBA 2YUPA 5LJ3d 2JTFA 4C0DB 1Q82U 2LZ6B 1K9MC 2HZYA 3EGDA 2ZPBB 3G4SQ 3PTAA 2JVVA 1N5ZA 4QW2A 2CKKA 3CCJQ 2RK2A 4PKCC 2L5QA 1KC8R 2O4XB 5FWCA 4RTYA 1PHTA 4QVCA 1X75C 4M7DG 1G3WA 2G6FX 1WA7A 1UHFA 3OW2A 3CCVT 5GAN2 2FG0A 1QP3A 1ZSZA 2GQIA 1XNIA 1PG5B 2EGAA 4FYWB 1W4SA 3HRUA 3PT9A 4GBQA 2HQEA 1VQLT 4X1VA 4JS5A 4Q5WA 3M5AA 1YIJA 4JDSA 4XTXA 2ZAEA 4KRTA 1ZQ1A 2NYSA 3L2WA 2J7IA 1XTDA 3A1PA 1HD3A 4BI8B 3A8OB 3BE3A 2KT1A 4RTZA 1NEBA 4AG2C 4ELYC 3CD6Q 2EJFA 3QPHA 3G71Q 1YJWA 5CKHA 2HEQA 1SF9A 2SEMA 3SFMA 3RNJA 4ZN1A 1U06A 2BZXA 1NJIC 1E6HA 2J6FA 1VQ6T 1FWZA 4PFZA 3QZ9B 3OSVA 3S3NA 4OVAA 5CIUA 3OYJA 1KD1U 1WI7A 2ABLA 3NTIA 4M78G 1AD5A 2ED1A 2E3HA 3DLMA 1AZEA 1G3SA 1VYTA 1YHQQ 1VQMT 1R8OB 2DX1A 3CCQQ 4XTYA 4RTXA 3RMQA 1K9AA 1K76A 3M9QA 2DXUA 5LJ3g 2C0IA 2HL3A 4D6WA 2F5TX 2P0KA 4PJNA 3H0HA 3MP1A 3UATA 1R77A 1I4K1 1VQ8A 2GQVA 1AEYA 2QA4Q 4C8QE 3CC2Q 2KYMA 4PJOA 1WHGA 3EG9B 2OI3A 2Y90A 4HT8A 1S72T 4JRKA 1I0CA 3OBYA 2KXCA 2QK0A 5LJ5g 3VV0A 1Y96A 4HCCA 4XU0A 2CS7A 3RBBB 5D6WA 1VQ5A 2D9TA 3C12A 4M78F 2RJCA 3EGDB 1XJWB 1U3OA 3EAEA 4M7AE 3IQLA 5IHIA 1O75A 3ME9A 2BTTA 1VQPA 1BB9A 2COYA 4JJNK 2HQXA 3P8DA 5GANe 4LDVA 1YWOA 1YJNT 1NZ9A 2LQ8A 2D6FA 3L42A 1WQ7A 3CXCA 1ZSZB 5FLXE 2HKQB 2KRSA 2CUDA 2O88A 5GAN8 5GAOm 3V8LA 4QKUA 3URGA 3CCLA 1VQOA 5L8RE 1MV0B 2A7YA 4B9WA 4EPCA 2K7AA 1RACB 1WNLA 4QQDA 2NUTB 3X25B 2YWWA 4X34A 1M5Q1 1Y07A 2E70A 3OA6A 1YI2Q 3OYNA 5HY6A 3M0SA 4EMKC 4N4GA 1GL5A 1G3YA 3DB3A 3G7ZA 3VJPA 3VS6A 1YITQ 1AZGB 2CP6A 1BIAA 4KULA 3BW1A 4OGCA 3G4SA 4LUDA 5GMKi 1K8AU 2DO3A 2EFIA 2R58A 4GLMA 2LP5A 5D6XA 2LX9A 4KBMB 4BDYA 4LNPA 3EFOB 1DJ7B 1M2OA 3RKYA 4OB2B 2EYZA 1NPRA 2MK5A 2XHCA 3X28B 1X69A 1TUCA 4PFPA 2D1XA 3M4YA 2O9SA 4C8QA 2RQRA 4PJOB 3CCUT 2P84A 3CMEQ 5ECAA 2ENMA 4O5VA 3NFCA 3U23A 3OYYA 4OMLA 3JAME 2BUDA 3NTHA 2JOYA 2HNIA 2EPDA 2LJ0A 3ZBDA 2KEAA 3LWIA 2FO0A 3SWNC 5I11A 1TUGB 3MEWA 2DTOA 4JUVA 3M56A 2VXFA 4BE2A 1WHMA 4DBQA 1SEMA 1AWOA 3PGGA 5GAMg 2KXDA 1HXDA 4Y91A 3CD6A 2CH4W 3EG0A 4M78C 2FZGB 4M7AA 1IHVA 3CBMA 1RAAB 2HSEB 2K2MA 2JXBA 4QQ6A 1PSFA 4JS4A 1QVFS 1G5VA 1VQ4Q 2DA9A 4F16A 3JB9I 3H0FA 1WJSA 1KHIA 1YHQA 2L89A 2J06A 2RNAA 5DY9A 3CCQA 4L59A 3INZA 1IB8A 3MKDA 1LJOA 1YJ9T 1QVGA 3FB9A 1MHNA 1NPPA 3BY7A 1N27A 2R5AA 3REAB 1G83A 1GRIA 4IURA 3CCSQ 1Q7YC 1VQ9Q 2MWPA 5HK0A 1M2VB 1TG0A 1OQKA 3J80E 4IUVA 3VS7A 2CP3A 1MNDA 1ZBXA 4V2SA 2O2OA 3R6NA 3F70A 2LC4A 4DOWA 3E9GA 4C5HA 2LJ3A 4XTWA 4M75C 3JV3A 3VUBA 2RA2A 2CUBA 2MPXC 2F2VA 4C8QG 2O31A 3S3MA 2LNHB 1D09B 1ARKA 2A36A 4LDWA 3NTKA 1QVFP 5LJ3e 1OPLA 6AT1B 3THKA 3R6OA 4BI4A 4A54A 4DOVA 2XKOC 4AFQC 2DLPA 4ZTJA 1SRMA 1EX4A 2ECZA 5GANh 2PU9B 2CT4A 2DRKA 2DZCA 5LJ5e 4C5GA 2CSQA 3OYCA 2DBKA 3QO3A 3UF4A 2X3WD 1Q86U 1SSFA 2OTJQ 1C1AA 2KQWA 4OMMA 2V8IA 3RDVA 2PNIA 4ZGDB 1W2BS 5GANd 2JTMA 2X4WA 4HCBA 5KYWA 4J6WA 1WLPB 3MJXA 2VXEA 2PVOB 4D8KA 2A37A 2K2VA 2RH2A 1Q81U 4M7AB 1KQSA 2RJEA 1PKSA 4LD9K 1H3HA 4CC4B 3FDRA 3V7CA 1WX6A 1AWWA 2DMOA 2EQKA 2BE7D 3FEOA 1M3CA 2JTEA 1YITA 2AZVA 3VS4A 1YIJT 4OMPA 1XOVA 4FCYA 1WXBA 3TREA 2RI3A 2LDMA 1CSKA 3HTRA 2CDTA 3VS5A 1Z9QA 1UECA 3QJ6A 3OYBA 1V29B 2RM4A 4ATOA 3QWXX 3FLGA 4FT2A 4Y28E 3EFRA 1D3BB 2QQBA 1RAHB 2WACA 4JRIA 3QUIA 4DBFA 5KYXB 3ZL7C 2QEXQ 4JJCA 3CPWS 1N8RC 3EGXB 2FPDA 2JNGA 3CMEA 2ATCB 2KT8A 3MEUA 2W10A 1KG1A 1MUZA 4M78E 2WSFE 5GJVB 3TSZA 3OYHA 3C4SA 3EHQA 2X9HA 1W2BP 1RL2A 3E2UA 5KYYB 1OEBA 3TCJA 1LOJA 2YUNA 1WDXA 2CH4A 4DBHA 4ZGEB 2LMJA 1A0NB 3JB9J 5KCHA 4AG1C 1KHCA 2CP5A 1VQ5T 3RERA 3L2UA 4M77F 1VQ4A 1K73C 4B9XA 3CEYA 2DL5A 5EG2A 2DXCA 2HBWA 4LN2A 4HT9A 3SHWA 1VQPT 2XDDA 4EMKA 2DPPB 1VQ9A 4M75E 2D8HA 1RLPC 3CPWP 2M51A 2LX7A 2DL7A 1X6BA 1TOVA 3NGPA 3KXTA 2HL5C 2DL8A 1UGRB 3EH2A 3JB9H 5FU7C 5GAN5 9ATCB 1VQNA 3M0TA 4PNOA 4IKFA 2DBMA 3OYMA 1I81A 1JQQA 3NMZC 3OYEA 3VYGA 1Q82R 1VQOT 3DB4A 4C92G 1GFCA 1WHKA 4QT7A 4A4HA 2DZ9A 4D8DA 2E6NA 1TH7A 1M27C 2KE9A 2E65A 2X4YA 2AK5A 1N9RA 4HCKA 1Q95G 2KMTA 4XTVA 2B8AA 5A0GA 4ESRA 2JT4A 3GNFB 4RCCA 2DFUA 1M1KC 3QG1A 3OS1A 1WGSA 2O01E 3SWNA 4LUEA 2RHIA 2QDYB 4J9HA 3G4ST 4PJOD 4KUIA 5LJ3h 4CC2A 2GBQA 4M78A 3RKWA 2EQMA 4C92F 2OTJA 1U1TA 1E7OA 2DNUA 2A3LA 3QYGB 2DXBA 2DD5A 1M3BA 2FEIA 2MYSA 5LJ5h 2CSIA 2J05A 2CT3A 3JB9G 2I2LA 4RMOA 3JRZA 2PVGB 3A5ZB 3I55Q 4LDXA 4J9IA 2EGEA 3KBGA 2FL7A 2BZ8A 5LJ5d
chains in the Genus database with same CATH topology
2DF6A 2JM8A 3VRZA 2XMFA 3VRYA 2DILA 1OV3A 1UJYA 1KFZA 3A98A 2C0TA 1YNZA 2KRSA 1AWJA 2CUDA 4ORZA 2QDLA 2O88A 4F17A 2ROTA 2D8JA 1MV0B 4CC3A 2LCSA 1NLOC 5GJWB 2K7AA 4WCIA 1PRMC 1M3AA 2ESWA 2LQNA 3I9QA 3EG3A 1QCFA 1MV3A 1ABQA 3C0CA 1KJWA 1JO8A 2MIOA 2MOXA 3M0SA 4DEXA 4J9FA 2EBPA 1BU1A 2MCNA 1UGVA 1NM7A 2L0AA 3UA6A 4J9EA 1RI9A 2EQIA 4Z8AA 1GL5A 1M30A 3VS6A 3PE0A 1AZGB 1H92A 1BK2A 2YUQA 3I5SA 4AFZC 4LUDA 2EYYA 1Y57A 4RUGA 2PTKA 2F2WA 2PZ1A 4GLMA 4IIMA 2GGRA 2W0ZA 2LP5A 3UA7A 4J9CA 4LNPA 1LCKA 1NYFA 1ZUKA 1UUEA 1T3SA 2EYZA 2IIMA 2OJ2A 1X69A 1TUCA 2D1XA 1B07A 1RLQC 2O9SA 3O5ZA 2RQRA 3H0IA 2DVJA 1GFDA 5ECAA 2ENMA 2L2PA 4RTTA 3U23A 1NLPC 2SRCA 2KR3A 1AOJA 4OMLA 5IXFA 2DJQA 2KNBB 2V1QA 4HVUA 4AFSC 1QLYA 2ROLA 1ZLMA 1GCPA 3EGUA 2V1RA 1WXTA 2EPDA 2JS0A 2LJ0A 2KEAA 1E6GA 2VKNA 5IH2A 2FO0A 5I11A 2K6DA 4ZNXA 1UFFA 2AZSA 1SEMA 1AWOA 3NPFA 2LQWA 2P4RA 5I22A 1SSHA 2KXDA 3KFVA 2E5KA 5L23A 2DE0X 4FSSA 2CH4W 3EG0A 3H41A 4Z89A 2KGTA 3VS3A 2BZYA 3NHNA 1ZX6A 1YN8A 2JXBA 2K2MA 1IO6A 2JMAA 1AWXA 1FMKA 1X6GA 1WXUA 3GBQA 1ZBJA 3EG1A 1W1FA 1QKWA 2J6KA 2DM1A 2DA9A 4F16A 2LJ1A 2KBTA 3H0FA 1HJDA 1K0SA 1WYXA 2J06A 2RNAA 2L3QA 1U5SA 1B3QA 3REAB 1G83A 1GRIA 1SHGA 2YT6A 4CC7A 2J6OA 2HCKA 1TG0A 1WFWA 2ED0A 2RN8A 3VS7A 1VYUA 2RQVA 2F2XA 1K4US 1KIKA 1UTIA 1ZUUA 2O2OA 1X27A 2FPFA 3R6NA 2FPEA 2LJ3A 2KYBA 3TVTA 1GBQA 3JV3A 1GCQA 1JEGA 4IIOA 2CUBA 2JMCA 1UG1A 2JW4A 4RTWA 1W70A 2F2VA 2AKKA 2KRMA 2O31A 4K11A 4OMQA 1RUWA 5FW9A 2JM9A 1PRLC 2LNHB 2YDLA 2DL3A 1ARKA 1OPKA 2A36A 2GTJA 2RQTA 4RTUA 1CKAA 1OPLA 3THKA 2D0NA 3M0PA 2GTOA 3PVQA 4AFQC 2FRWA 1T3LA 2DLPA 1NYGA 1ABOA 5IHKA 1SRMA 4OMNA 2EYXA 2ECZA 2O9VA 2CT4A 2DRKA 1Z9ZA 3EG2A 3ULRB 1SPKA 1W6XA 3QWYA 2CSQA 4HXJA 2DBKA 3REBB 3UF4A 2X3WD 4J9DA 4M4ZA 3EHRA 4OMMA 1T0HA 2PNIA 4AFUC 2HSPA 2DYBA 1K0XA 4JZ3A 1WLPB 4J9GA 2CREA 2A28A 2H8HA 1S1NA 1K1ZA 2A37A 4D8KA 3I5RA 2KRNA 1PKSA 4F14A 1G2BA 4CC4B 1JXMA 3VS2A 1H3HA 1WX6A 1AWWA 3M0QA 1FYNA 2DMOA 1ZUYA 3LH5A 1M3CA 2JTEA 2AZVA 3VS4A 1UDLA 5IXBA 4OMPA 1BBZA 1XOVA 2X3XD 1WXBA 2KROA 2HDAA 2L3PA 2RMOA 1CSKA 2CDTA 3VS5A 2A08A 1VA7A 1Z9QA 1UECA 4DEYA 1YCSB 1UE9A 1AVZC 1ZSGA 3M0UA 1H8KA 3QWXX 4JJDA 1EFNA 1SHFA 2DL4A 2EGCA 3ZL7C 1Y0MA 4JJCA 4JJBA 4HVVA 1OOTA 2VVKA 2VWFA 1NEGA 2FPDA 1WIEA 2RQUA 1KSWA 2KT8A 1SRLA 2DRMA 2W10A 2YUPA 1MUZA 1J3TA 5GJVB 2LZ6B 3TSZA 5FWBA 3EHQA 2K3BA 4E6RA 1GBRA 1OEBA 1JU5C 1QWFA 1N5ZA 3I35A 5IHNA 1QWEA 5FWCA 4RTYA 1PHTA 2YUNA 1WDXA 2CH4A 2G6FX 1WA7A 1UHFA 1GCQC 4OMOA 4A63B 2LMJA 1A0NB 4AG1C 2FG0A 1VYVA 2GQIA 1HSQA 2EGAA 1PKTA 2AKLA 4JZ4A 2DL5A 4LE9A 3TSWA 4JPBW 2NUZA 2HBWA 4GBQA 2RQWA 2YSQA 3PVLA 4X1VA 4LN2A 4J9BA 3SHWA 1PWTA 2NWMA 1UJ0A 4KRTA 2YUOA 2FRYA 2J7IA 1YP5A 2GNCA 1HD3A 2D8HA 1RLPC 3CQTA 2M51A 2KT1A 4RTZA 2LX7A 1NEBA 1T0JA 4RTVA 4AG2C 2DL7A 1X6BA 3NGPA 2DL8A 2HEQA 1I1JA 2SEMA 1UHCA 3RNJA 3M0TA 1U06A 2BZXA 2DBMA 2J6FA 1E6HA 1V1CA 1JQQA 3NMZC 1I07A 1GFCA 4QT7A 1WI7A 2I0NA 2ABLA 1AD5A 2ED1A 4D8DA 1AZEA 1VYTA 1M8MA 3M0RA 1M27C 2DX1A 2K79A 2KE9A 2AK5A 3VS1A 4RTXA 4HCKA 1K9AA 2EYWA 1K76A 2L3SA 4ESRA 2C0IA 2JT4A 2RF0A 1YWPA 3H0HA 3UATA 3FJ5A 5EC7A 1AEYA 5HCKA 1QKXA 2KYMA 2OI3A 4LUEA 1I0CA 2KXCA 2EVRA 4J9HA 2OAWA 1NG2A 4CC2A 2RPNA 3RBBB 2GBQA 2EW3A 1E7OA 2DNUA 2JS2A 4Z88A 1TUDA 1U3OA 1M3BA 2FEIA 4R0KA 4EIKA 2CSIA 3IQLA 5IHIA 2J05A 2CT3A 4HVWA 3SEMA 2BTTA 1BB9A 1X2QA 1X43A 2M0YA 2K9GA 4Y92A 1CKBA 1PNJA 4J9IA 1YWOA 2EGEA 2EKHA 1JXOA 1X2KA 2C0OA 2BZ8A 2B86A 3VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF6 A;  2JM8 A;  3VRZ A;  2XMF A;  3VRY A;  2DIL A;  1OV3 A;  1UJY A;  1KFZ A;  3A98 A;  2C0T A;  1YNZ A;  2KRS A;  1AWJ A;  2CUD A;  4ORZ A;  2QDL A;  2O88 A;  4F17 A;  2ROT A;  2D8J A;  1MV0 B;  4CC3 A;  2LCS A;  1NLO C;  5GJW B;  2K7A A;  4WCI A;  1PRM C;  1M3A A;  2ESW A;  2LQN A;  3I9Q A;  3EG3 A;  1QCF A;  1MV3 A;  1ABQ A;  3C0C A;  1KJW A;  1JO8 A;  2MIO A;  2MOX A;  3M0S A;  4DEX A;  4J9F A;  2EBP A;  1BU1 A;  2MCN A;  1UGV A;  1NM7 A;  2L0A A;  3UA6 A;  4J9E A;  1RI9 A;  2EQI A;  4Z8A A;  1GL5 A;  1M30 A;  3VS6 A;  3PE0 A;  1AZG B;  1H92 A;  1BK2 A;  2YUQ A;  3I5S A;  4AFZ C;  4LUD A;  2EYY A;  1Y57 A;  4RUG A;  2PTK A;  2F2W A;  2PZ1 A;  4GLM A;  4IIM A;  2GGR A;  2W0Z A;  2LP5 A;  3UA7 A;  4J9C A;  4LNP A;  1LCK A;  1NYF A;  1ZUK A;  1UUE A;  1T3S A;  2EYZ A;  2IIM A;  2OJ2 A;  1X69 A;  1TUC A;  2D1X A;  1B07 A;  1RLQ C;  2O9S A;  3O5Z A;  2RQR A;  3H0I A;  2DVJ A;  1GFD A;  5ECA A;  2ENM A;  2L2P A;  4RTT A;  3U23 A;  1NLP C;  2SRC A;  2KR3 A;  1AOJ A;  4OML A;  5IXF A;  2DJQ A;  2KNB B;  2V1Q A;  4HVU A;  4AFS C;  1QLY A;  2ROL A;  1ZLM A;  1GCP A;  3EGU A;  2V1R A;  1WXT A;  2EPD A;  2JS0 A;  2LJ0 A;  2KEA A;  1E6G A;  2VKN A;  5IH2 A;  2FO0 A;  5I11 A;  2K6D A;  4ZNX A;  1UFF A;  2AZS A;  1SEM A;  1AWO A;  3NPF A;  2LQW A;  2P4R A;  5I22 A;  1SSH A;  2KXD A;  3KFV A;  2E5K A;  5L23 A;  2DE0 X;  4FSS A;  2CH4 W;  3EG0 A;  3H41 A;  4Z89 A;  2KGT A;  3VS3 A;  2BZY A;  3NHN A;  1ZX6 A;  1YN8 A;  2JXB A;  2K2M A;  1IO6 A;  2JMA A;  1AWX A;  1FMK A;  1X6G A;  1WXU A;  3GBQ A;  1ZBJ A;  3EG1 A;  1W1F A;  1QKW A;  2J6K A;  2DM1 A;  2DA9 A;  4F16 A;  2LJ1 A;  2KBT A;  3H0F A;  1HJD A;  1K0S A;  1WYX A;  2J06 A;  2RNA A;  2L3Q A;  1U5S A;  1B3Q A;  3REA B;  1G83 A;  1GRI A;  1SHG A;  2YT6 A;  4CC7 A;  2J6O A;  2HCK A;  1TG0 A;  1WFW A;  2ED0 A;  2RN8 A;  3VS7 A;  1VYU A;  2RQV A;  2F2X A;  1K4U S;  1KIK A;  1UTI A;  1ZUU A;  2O2O A;  1X27 A;  2FPF A;  3R6N A;  2FPE A;  2LJ3 A;  2KYB A;  3TVT A;  1GBQ A;  3JV3 A;  1GCQ A;  1JEG A;  4IIO A;  2CUB A;  2JMC A;  1UG1 A;  2JW4 A;  4RTW A;  1W70 A;  2F2V A;  2AKK A;  2KRM A;  2O31 A;  4K11 A;  4OMQ A;  1RUW A;  5FW9 A;  2JM9 A;  1PRL C;  2LNH B;  2YDL A;  2DL3 A;  1ARK A;  1OPK A;  2A36 A;  2GTJ A;  2RQT A;  4RTU A;  1CKA A;  1OPL A;  3THK A;  2D0N A;  3M0P A;  2GTO A;  3PVQ A;  4AFQ C;  2FRW A;  1T3L A;  2DLP A;  1NYG A;  1ABO A;  5IHK A;  1SRM A;  4OMN A;  2EYX A;  2ECZ A;  2O9V A;  2CT4 A;  2DRK A;  1Z9Z A;  3EG2 A;  3ULR B;  1SPK A;  1W6X A;  3QWY A;  2CSQ A;  4HXJ A;  2DBK A;  3REB B;  3UF4 A;  2X3W D;  4J9D A;  4M4Z A;  3EHR A;  4OMM A;  1T0H A;  2PNI A;  4AFU C;  2HSP A;  2DYB A;  1K0X A;  4JZ3 A;  1WLP B;  4J9G A;  2CRE A;  2A28 A;  2H8H A;  1S1N A;  1K1Z A;  2A37 A;  4D8K A;  3I5R A;  2KRN A;  1PKS A;  4F14 A;  1G2B A;  4CC4 B;  1JXM A;  3VS2 A;  1H3H A;  1WX6 A;  1AWW A;  3M0Q A;  1FYN A;  2DMO A;  1ZUY A;  3LH5 A;  1M3C A;  2JTE A;  2AZV A;  3VS4 A;  1UDL A;  5IXB A;  4OMP A;  1BBZ A;  1XOV A;  2X3X D;  1WXB A;  2KRO A;  2HDA A;  2L3P A;  2RMO A;  1CSK A;  2CDT A;  3VS5 A;  2A08 A;  1VA7 A;  1Z9Q A;  1UEC A;  4DEY A;  1YCS B;  1UE9 A;  1AVZ C;  1ZSG A;  3M0U A;  1H8K A;  3QWX X;  4JJD A;  1EFN A;  1SHF A;  2DL4 A;  2EGC A;  3ZL7 C;  1Y0M A;  4JJC A;  4JJB A;  4HVV A;  1OOT A;  2VVK A;  2VWF A;  1NEG A;  2FPD A;  1WIE A;  2RQU A;  1KSW A;  2KT8 A;  1SRL A;  2DRM A;  2W10 A;  2YUP A;  1MUZ A;  1J3T A;  5GJV B;  2LZ6 B;  3TSZ A;  5FWB A;  3EHQ A;  2K3B A;  4E6R A;  1GBR A;  1OEB A;  1JU5 C;  1QWF A;  1N5Z A;  3I35 A;  5IHN A;  1QWE A;  5FWC A;  4RTY A;  1PHT A;  2YUN A;  1WDX A;  2CH4 A;  2G6F X;  1WA7 A;  1UHF A;  1GCQ C;  4OMO A;  4A63 B;  2LMJ A;  1A0N B;  4AG1 C;  2FG0 A;  1VYV A;  2GQI A;  1HSQ A;  2EGA A;  1PKT A;  2AKL A;  4JZ4 A;  2DL5 A;  4LE9 A;  3TSW A;  4JPB W;  2NUZ A;  2HBW A;  4GBQ A;  2RQW A;  2YSQ A;  3PVL A;  4X1V A;  4LN2 A;  4J9B A;  3SHW A;  1PWT A;  2NWM A;  1UJ0 A;  4KRT A;  2YUO A;  2FRY A;  2J7I A;  1YP5 A;  2GNC A;  1HD3 A;  2D8H A;  1RLP C;  3CQT A;  2M51 A;  2KT1 A;  4RTZ A;  2LX7 A;  1NEB A;  1T0J A;  4RTV A;  4AG2 C;  2DL7 A;  1X6B A;  3NGP A;  2DL8 A;  2HEQ A;  1I1J A;  2SEM A;  1UHC A;  3RNJ A;  3M0T A;  1U06 A;  2BZX A;  2DBM A;  2J6F A;  1E6H A;  1V1C A;  1JQQ A;  3NMZ C;  1I07 A;  1GFC A;  4QT7 A;  1WI7 A;  2I0N A;  2ABL A;  1AD5 A;  2ED1 A;  4D8D A;  1AZE A;  1VYT A;  1M8M A;  3M0R A;  1M27 C;  2DX1 A;  2K79 A;  2KE9 A;  2AK5 A;  3VS1 A;  4RTX A;  4HCK A;  1K9A A;  2EYW A;  1K76 A;  2L3S A;  4ESR A;  2C0I A;  2JT4 A;  2RF0 A;  1YWP A;  3H0H A;  3UAT A;  3FJ5 A;  5EC7 A;  1AEY A;  5HCK A;  1QKX A;  2KYM A;  2OI3 A;  4LUE A;  1I0C A;  2KXC A;  2EVR A;  4J9H A;  2OAW A;  1NG2 A;  4CC2 A;  2RPN A;  3RBB B;  2GBQ A;  2EW3 A;  1E7O A;  2DNU A;  2JS2 A;  4Z88 A;  1TUD A;  1U3O A;  1M3B A;  2FEI A;  4R0K A;  4EIK A;  2CSI A;  3IQL A;  5IHI A;  2J05 A;  2CT3 A;  4HVW A;  3SEM A;  2BTT A;  1BB9 A;  1X2Q A;  1X43 A;  2M0Y A;  2K9G A;  4Y92 A;  1CKB A;  1PNJ A;  4J9I A;  1YWO A;  2EGE A;  2EKH A;  1JXO A;  1X2K A;  2C0O A;  2BZ8 A;  2B86 A;  3VS0 A; 
#chains in the Genus database with same CATH topology
 4PL6 A;  1PC0 A;  4HA8 A;  5GMK l;  3G6E A;  2DIL A;  3CCE T;  2C0T A;  2XG8 D;  2QGG A;  4GLK A;  4ORZ A;  4XAX B;  4XTZ A;  1KD1 R;  2ROT A;  1OUL A;  2DKG A;  4M77 C;  5GAO r;  4OB3 B;  5GJW B;  1KC8 C;  2ESW A;  2QEX A;  4M7D B;  3H8Z A;  3I9Q A;  3JCM V;  3CCM A;  2XI9 A;  4M75 A;  3JB9 F;  4OB1 B;  2KVQ G;  3QJY A;  3MP8 A;  4BY6 C;  4FW1 A;  3GNG A;  2MIO A;  3CC4 A;  1RAI B;  4DEX A;  4J9F A;  4XTU A;  1F1B B;  3M57 A;  2EBP A;  3UA6 A;  1YCY A;  4KH1 B;  1MMN A;  4E7I A;  1K9M U;  1BK2 A;  2YUQ A;  3I5S A;  8AT1 B;  5KYU A;  4RUG A;  1PSE A;  5GAM f;  3HKS A;  4IIM A;  5GMK e;  1ZA2 B;  4BE1 A;  3UA7 A;  4J9C A;  3MP6 A;  1NYF A;  4UC4 A;  4CRI A;  3OS0 A;  1IRX A;  3CCV Q;  2OJ2 A;  3CCR T;  3A8L B;  2XDP A;  1O9S A;  1B07 A;  1RLQ C;  2DTI A;  1QVP A;  2COW A;  3H0I A;  5DLQ E;  2M0O A;  2L2P A;  4RTT A;  3L2Z A;  1NLP C;  2SRC A;  2KR3 A;  1AOJ A;  5CVI A;  5IXF A;  1KC8 U;  2E6Z A;  4AFS C;  1QLY A;  3MET A;  1VQL Q;  4O6J A;  3M55 A;  4OF1 A;  4M78 B;  3HPW A;  1E6G A;  3JCM X;  1OZ2 A;  1UFF A;  3OB9 A;  2AZS A;  5IAY A;  4QVZ A;  1R0C B;  2LQW A;  4LDY A;  5I22 A;  3KFV A;  3MPU B;  4C92 C;  2E5K A;  4J5Y A;  5L23 A;  2DE0 X;  3JCM P;  2PVD B;  4BUG A;  2K4Y A;  1U8R A;  2KGT A;  2A0F B;  4XQ3 A;  3I56 T;  4J83 A;  1YN8 A;  2MF2 A;  2DYI A;  1NJI U;  1FMK A;  1X6G A;  1VQ6 Q;  3UWN A;  2IVW A;  4M7A D;  3GBQ A;  4ZGJ B;  3V8J A;  5GAN 4;  1QKW A;  2J6K A;  3LWH A;  2LJ1 A;  3H6Z A;  5A2Q E;  5CQY A;  2VGN A;  3J7A F;  1K0S A;  4M75 G;  3WVE B;  2OTL Q;  1VQM Q;  2L3Q A;  1K8A R;  1TWB A;  5GAM d;  1QW1 A;  2EAY A;  1SHG A;  1FMV A;  3SD4 A;  4KH0 B;  2J6O A;  2H3E B;  3OBW A;  4DBR A;  1JJ2 S;  2HMA A;  1M90 R;  1WFW A;  3C95 A;  3JCM b;  2RD1 A;  1YFN A;  3GOX A;  3JSC A;  2V26 A;  3OYK A;  4EMG A;  5KE3 A;  1UEB A;  1C6V X;  2NUP A;  1I5L A;  3M59 A;  5I2M A;  5LJ3 j;  1GBQ A;  8ATC B;  1BIB A;  2F1L A;  4ZTF A;  2K57 A;  2AT1 B;  4M75 F;  1X6O A;  3CC7 T;  1VQ7 Q;  2KRM A;  2OAU A;  4OMQ A;  3M4G A;  2DL3 A;  5LJ5 j;  3I55 A;  3RES A;  4M77 E;  1YJN Q;  2MI6 A;  2RQT A;  4RTU A;  4FM4 B;  4BD3 A;  3ZFJ A;  3CCJ A;  2QTX A;  2FRW A;  4N0A C;  5J39 A;  3DKM A;  1NYG A;  5IHK A;  4PFO A;  2HQH A;  4RCB A;  2OX7 A;  3ULR B;  1SPK A;  3QWY A;  3JCM f;  2DVE A;  4E7Z A;  2FVU A;  3EHR A;  4AFU C;  2HSP A;  1JJ2 P;  5A0L A;  1Y96 B;  4L6V 5;  2H8H A;  4HCZ A;  4R55 A;  1JXM A;  2IG0 A;  2ZCF B;  4IUQ A;  3LH5 A;  3RIR A;  1UDL A;  3P8H A;  1RI0 A;  2EJ9 A;  3G71 A;  5M9O A;  2L3P A;  3MEA A;  4C0Z A;  1VUB A;  3OYA A;  4OB0 B;  1KQ1 A;  2DTH A;  3CMA T;  2WSC E;  2ZPI B;  1UE9 A;  1ZSG A;  3M0U A;  4WTO B;  2PQW A;  4E7J A;  1AHJ B;  1EFN A;  3QDR B;  1XQH A;  1VQN T;  2VYT A;  2DL4 A;  1WJQ A;  1Y0M A;  4HVV A;  2VVK A;  5I21 A;  4C5E A;  2VWF A;  1BCM A;  3CCU Q;  4A4F A;  5CKE A;  3A8H B;  1D0X A;  1SRL A;  2DRM A;  3BDL A;  3V7S A;  4C92 E;  2X4J A;  1M1G A;  2RHY A;  1SKU B;  3UPU A;  2L3R A;  3CBO A;  2NUP B;  2QA4 A;  1OZ3 A;  3CC2 A;  1IHW A;  3UDC A;  5FU6 C;  4E6R A;  4II1 A;  1GBR A;  1WZO A;  1SG5 A;  4LDU A;  3WXM B;  1Q86 R;  3JCM d;  1MGQ A;  4ME7 A;  3LGL A;  2YLC A;  2DEU A;  3I35 A;  5IHN A;  1QWE A;  1RAE B;  1NE8 A;  3VUZ A;  5C6S A;  3P8B B;  4A63 B;  1P92 A;  1Q81 R;  2E41 A;  2IPO B;  5KH6 A;  4M77 A;  1VQ6 A;  3OYD A;  4J7F A;  4MZM A;  4FYX B;  2EJG A;  4MDW A;  1PKT A;  2AKL A;  1LVK A;  7AT1 B;  4LE9 A;  3TSW A;  2NUZ A;  2GCX A;  1VQM A;  2OTL A;  2RQW A;  4F7U E;  3X20 B;  2EKO A;  2KDS A;  1IRE B;  1YJ9 Q;  2DAQ A;  1PWT A;  5HK3 A;  3PIP A;  1UJ0 A;  4C8Q B;  4IUT A;  4JLG A;  1PD1 A;  4R56 A;  1Q7Y U;  3FJP A;  3CQT A;  1ZHI A;  4RTV A;  4NL2 A;  2HD0 A;  3HSB A;  1G3T A;  3QZ5 B;  3G6E T;  1PM3 A;  4M7D D;  1WHH A;  1UHC A;  1UB4 A;  3PFS A;  2HBP A;  2LNV A;  4XU3 A;  4Z02 A;  3AT1 B;  1I07 A;  4WF2 A;  3WVD B;  1YI2 A;  4E2F B;  4ZN3 A;  2CP7 A;  4VUB A;  1VQ7 A;  3CCM T;  1X01 A;  2CZ6 B;  4N4H A;  2K79 A;  3VS1 A;  3OS2 A;  4PJJ A;  5GAO n;  3CC4 T;  5LL6 S;  3V8K A;  2DEQ A;  2L3S A;  1Y7X A;  1YJN A;  1YWP A;  2L8D A;  1QVF A;  2VUB A;  2DXT A;  4E7L A;  3VU3 C;  5GAN 7;  2RI2 A;  1YJW T;  2EVR A;  2OAW A;  3JCM g;  4C92 A;  2K3Y A;  4DA4 A;  3AHU A;  3EH1 A;  4XK8 E;  1IGU A;  4FW2 A;  4M77 G;  1IZ6 A;  2COZ A;  4M78 D;  3QDF A;  3Q1J A;  4Z88 A;  3E1S A;  4EIK A;  2XK0 A;  3SEM A;  2ZPH B;  4MML A;  4KT0 E;  1N9S A;  2M0Y A;  2K9G A;  2CZ0 B;  2C0O A;  4TVR A;  4M77 B;  4RKU E;  1VQ8 T;  3VS0 A;  4E7K A;  2CZ7 B;  2DF6 A;  2JM8 A;  5J26 A;  2E4H A;  3JCM c;  4DQ2 A;  2QAS A;  1AWJ A;  4F17 A;  3OS5 A;  4BY6 B;  2RO0 A;  3V7R A;  4F7U A;  2JJ9 A;  4CC3 A;  2LCS A;  1NLO C;  1UGP B;  2X35 A;  5KCO A;  4KUD K;  1I8F A;  3EG3 A;  4JRP A;  3LW5 E;  3S6W A;  2ZPG B;  3VKI A;  3C0C A;  2FB7 A;  1N8R U;  2QXF A;  3CCS A;  3HL8 A;  2MCN A;  1BU1 A;  2O4X A;  1UGV A;  2L0A A;  1RI9 A;  2R57 A;  2EQI A;  3PMT A;  3FC3 A;  4EDU A;  5GAM e;  5GMK m;  1WHJ A;  2GFA A;  5KYW B;  1EZZ B;  2MMP A;  1H92 A;  4AFZ C;  4E47 A;  2EYY A;  1JB0 E;  1W2B A;  2VC8 A;  2F2W A;  3L1A A;  5GAN 3;  5KE2 A;  1BI0 A;  1Y71 A;  4N0A A;  3QBY A;  4KGZ B;  1LCK A;  1ZUK A;  3CCL T;  4P5N A;  1GXI E;  2XD0 A;  4A4K A;  1FXX A;  5CCA A;  1VQ5 Q;  2BIV A;  2FZC B;  2GFU A;  3O5Z A;  1K73 U;  5CK9 A;  2KNB B;  1Q82 C;  2V1Q A;  2V8J A;  4C92 B;  2ROL A;  1GCP A;  4AMC A;  5IN1 A;  2V1R A;  2JS0 A;  3I55 T;  5IH2 A;  1RAG B;  4LD6 A;  1FX7 A;  2JUF A;  3NPF A;  2P4R A;  3CCJ T;  3CPW A;  3HHT B;  1QMC A;  4MMK A;  3OW2 P;  3H41 A;  5GAN j;  1RAF B;  4Z89 A;  3JCM W;  1U1S A;  3S3O A;  2EQJ A;  3QYH B;  2EQU A;  3JCM Q;  1ZX6 A;  2PUK B;  3GF5 A;  4F7U G;  2JMA A;  2YXY A;  1AWX A;  4OP0 A;  1VQO Q;  1ZBJ A;  3EG1 A;  1W1F A;  2DM1 A;  1VQK Q;  1QQJ A;  2LRQ A;  1K9M R;  1HJD A;  2E64 A;  1WYX A;  3ASK A;  2FZK B;  3ER0 A;  2ZPE B;  1U5S A;  3GLX A;  3QHS A;  4KGV B;  1B3Q A;  2VB6 A;  1EIF A;  2G3R A;  1M1K U;  3E19 A;  3CD6 T;  3M53 A;  3G71 T;  1AT1 B;  2E10 A;  3OYL A;  1VYU A;  2Z0W A;  2DD4 A;  2CZ1 B;  2C06 A;  4J6Y A;  4F7U F;  3BFM A;  1KIK A;  1UTI A;  2DK3 A;  1FMW A;  4EMK B;  5AT1 B;  1X27 A;  1VIE A;  3UT1 A;  1UGS B;  2XID A;  3CXC S;  2KYB A;  4AT1 B;  1JEG A;  1KD1 C;  4IIO A;  4J8O A;  4C0G A;  2JW4 A;  1YHQ T;  1TTH B;  1BI1 A;  2AKK A;  4C0F A;  3CCQ T;  1RUW A;  5FW9 A;  2JM9 A;  2YDL A;  3GIB A;  4FL6 A;  5FRM A;  1OPK A;  2RB6 A;  2YRC A;  4PLI A;  1CKA A;  2K3X A;  2QA4 T;  2D0N A;  3CC2 T;  3M0P A;  2GTO A;  3DLL A;  1NJI R;  4NL3 A;  3RUX A;  3CCE Q;  2RI5 A;  4JRQ A;  4OMN A;  2EYX A;  2NUT A;  2Y4X A;  2LQK A;  5GAO q;  2E3I A;  3JCM e;  1Z9Z A;  1M1F A;  1WJR A;  4M7D F;  1W6X A;  1LNX A;  3QKJ A;  4E7H A;  3PMI A;  3SWN B;  2QAZ A;  2X51 A;  3TQ7 P;  1T0H A;  2DYB A;  1K0X A;  3O8V A;  1OU9 A;  4C8Q D;  4BI3 A;  1D0Z A;  1K1Z A;  3X26 B;  4A53 A;  2KRN A;  4F14 A;  1G2B A;  1BI3 A;  3VS2 A;  3J81 E;  2DIQ A;  2OTL T;  2FYK A;  1FYN A;  3CXC P;  3EFO A;  2KSS A;  4A4E A;  3CBP A;  2AHJ B;  2KRO A;  5FRO A;  2RMO A;  2CP2 A;  4EMH A;  3QII A;  3GPL A;  1YCS B;  5GAM h;  4JJD A;  4ANJ A;  3LGF A;  2RJF A;  2VGM A;  4FYV B;  4NOY A;  1SHF A;  3CCR Q;  4L5G A;  2WSE E;  4JJB A;  2EWN A;  1OOT A;  5CO7 A;  1NEG A;  5FU6 B;  4FSX A;  3OYG A;  1YI2 T;  5KYN A;  2RQU A;  3RKX A;  2JZ2 A;  3KUF A;  2K5L A;  1M9S A;  1VQ7 T;  1J3T A;  1BYM A;  3LX7 A;  3FIF A;  5FWB A;  2E12 A;  3HP9 A;  2MWO A;  1YIT T;  2QYZ A;  2EIF A;  4M75 B;  1S72 Q;  4MDX A;  2K3B A;  3SB2 A;  1K8A C;  1JU5 C;  2DJZ A;  3QSU A;  2QQS A;  2YHT A;  3JCM J;  1QWF A;  4C0D C;  1OX9 A;  2LCC A;  1QVG S;  1GCQ C;  4OMO A;  3I56 Q;  1M90 C;  1I5O B;  1VYV A;  5KYU B;  3OMC A;  1HSQ A;  1JRI A;  4PJL A;  1VQK A;  3CME T;  4M77 D;  3EFS A;  3LH0 A;  4JZ4 A;  4JPB W;  1HK9 A;  1M2V A;  4IUU A;  4J6X A;  2YSQ A;  1IGQ A;  3PVL A;  2DET A;  4XU2 A;  4J9B A;  2E1H A;  3RR6 A;  2NWM A;  4PLL A;  2YRD A;  2YUO A;  2FRY A;  1YP5 A;  2GNC A;  4NS5 A;  4M7D C;  5AYF A;  2M16 A;  1D1C A;  1T0J A;  4BAC A;  3PNW C;  1I1J A;  1OYX A;  4PJM A;  4PJO G;  4ELZ C;  1V1C A;  4YTL A;  1UGQ B;  2LCL A;  2MAM A;  1VQ4 T;  2I0N A;  3A8M B;  1M90 U;  5DM7 R;  1M8M A;  3CC7 Q;  3M0R A;  2F69 A;  1QVG P;  1D1A A;  2EYW A;  3CCS T;  1ACM B;  4OGE A;  2RF0 A;  4MZP A;  3BDU A;  1VQ9 T;  3FJ5 A;  5EC7 A;  5HCK A;  1R0B G;  1QKX A;  1H3Z A;  5D7U A;  2QGF B;  5GAO p;  5J3B A;  3CCE A;  4PJO F;  1KQS S;  3CCV A;  1NG2 A;  2YRV A;  4X9D A;  1WPY A;  5GAO l;  2RPN A;  2RJD A;  1OI1 A;  5GMK h;  3A8G B;  3FRN A;  3OYF A;  2EW3 A;  1PCX A;  3RMS A;  4C92 D;  1MMA A;  1QCN A;  1KQ2 A;  2JS2 A;  2QQA A;  2QTV A;  1VOM A;  1M4Z A;  1TUD A;  2KI7 A;  3H9N A;  2K5I A;  3JCM h;  1KK7 A;  1OX8 A;  4R0K A;  3HRS A;  4RG8 A;  1Q7Y R;  1JJ2 A;  1VQL A;  2HAX A;  5FRN A;  4HVW A;  2XIC A;  3OY9 A;  1X2Q A;  1X43 A;  2RK1 A;  4Y92 A;  2AIR B;  1CKB A;  1PNJ A;  2EYQ A;  2EKH A;  1JXO A;  1X2K A;  4X9C A;  2KK4 A;  4KGX B;  2B86 A;  3VRZ A;  5GAN f;  2XMF A;  3VRY A;  1D3B A;  4FT4 A;  1D1B A;  1OV3 A;  1B34 A;  1UJY A;  5CAI A;  1KFZ A;  1VIF A;  3A98 A;  5KYX A;  3VYH B;  1YNZ A;  2QDL A;  2F5K A;  3EGX A;  3CMA Q;  2CP0 A;  2CGH A;  1ZSZ C;  2LT4 A;  2D8J A;  4FU6 A;  1Q86 C;  5D6Y A;  2OTJ T;  1B7T A;  1VQN Q;  4WCI A;  1PRM C;  2V8K A;  1M3A A;  5GAM j;  3CCR A;  2LQN A;  5HKC A;  2M02 A;  1QCF A;  2E5Q A;  1MV3 A;  1ABQ A;  5KYY A;  1KJW A;  1JO8 A;  3JB9 D;  1Q81 C;  1KQS P;  2MOX A;  1TXQ A;  1OU8 A;  1ZA1 B;  5FU7 B;  5A0D A;  3TEE A;  1IXD A;  1NM7 A;  4J9E A;  5CKB A;  4Z8A A;  1M30 A;  3PE0 A;  1S72 A;  1YBY A;  1MMG A;  1BKB A;  4BE0 A;  1Y57 A;  5CKD A;  3M58 A;  2PTK A;  5C0M A;  2PZ1 A;  4QVD A;  2GGR A;  1BI2 A;  2W0Z A;  1RAD B;  2D0Q B;  1RAB B;  1G8X A;  3G1J A;  2LVM A;  4MZT A;  3TU4 K;  1UUE A;  3I56 A;  1T3S A;  2IIM A;  2VV5 A;  2JN0 A;  1TSF A;  2QEX T;  4M7A G;  4B6M A;  4C5I A;  2VAS A;  1LPL A;  1TS9 A;  2ZGW A;  2DVJ A;  3OYI A;  4M7D E;  1GFD A;  4C8Q F;  3L2R A;  2DJQ A;  4HVU A;  2XU8 A;  4BDZ A;  2QQ9 A;  2CYZ B;  1NBE B;  1ZLM A;  3ZEH A;  3EGU A;  1WXT A;  1HYO A;  2VKN A;  4PJO C;  3C94 A;  2LT1 A;  2K6D A;  4OMF B;  4ZNX A;  3HRT A;  2RHU A;  1PD0 A;  1SSH A;  4IUP A;  1D0Y A;  4FSS A;  2X4X A;  3G6E Q;  2M9U A;  2H3J A;  3VS3 A;  1N8R R;  3OMG A;  2BZY A;  3NHN A;  2XDB A;  4M7A F;  2LTO A;  1IO6 A;  4BB7 A;  1WXU A;  4JLI A;  2NLU A;  2KBT A;  1B34 B;  3LLR A;  3CC7 A;  1MNE A;  2M1H A;  3MCA B;  1N6A A;  3CCM Q;  3HFN A;  2PUO B;  1QP2 A;  2ZPF B;  3CC4 Q;  2RHZ A;  2YT6 A;  1YIJ Q;  2DER A;  4CC7 A;  2KAF A;  3CPF A;  5IT9 E;  2HCK A;  4XU1 A;  3MO8 A;  4F04 B;  5CR2 A;  2ED0 A;  2RN8 A;  1YJW Q;  2RQV A;  2F2X A;  5I2S A;  1K4U S;  2P4T A;  1K73 R;  1ZUU A;  2BKD N;  2FPF A;  2FPE A;  3M54 A;  2R5M A;  1V76 A;  3TVT A;  3X24 B;  2QQR A;  1M8V A;  1GCQ A;  3CCU A;  1MMD A;  3D7S B;  4LXC A;  2JMC A;  5GMK j;  4RG2 A;  3GP8 A;  3OW2 S;  1UG1 A;  4M75 D;  4RTW A;  1W70 A;  4K11 A;  2P0P A;  4FIB A;  1PRL C;  2P0Q A;  1WQW A;  2K5F A;  5GAN g;  5GAN 6;  2GTJ A;  3OQ5 A;  4E7S A;  3LYI A;  2QI2 A;  1VQ8 Q;  4N4I A;  1WHL A;  3PVQ A;  1T3L A;  5LJ3 f;  5CQX A;  1ABO A;  1C0M A;  4M7D A;  2O9V A;  3EG2 A;  4CI0 C;  4QQG A;  3CMA A;  3L2V A;  4HXJ A;  3MEV A;  3REB B;  4J9D A;  4C8Q C;  4M4Z A;  5LJ5 f;  2HKN A;  4J7I A;  4JZ3 A;  2DIG A;  5CKF A;  4J9G A;  2CRE A;  2A28 A;  1M1K R;  1YJ9 A;  1S1N A;  3L2Q A;  1VQK T;  3I5R A;  1JBM A;  1VQP Q;  3E9F A;  2QG9 B;  3MHX A;  3M0Q A;  3N5B B;  1ZUY A;  1BCO A;  4GY5 A;  5IXB A;  1BBZ A;  2GF7 A;  2X3X D;  2HDA A;  4M7A C;  2FHD A;  2ZZD A;  4FYY B;  4A4G A;  2A08 A;  1VA7 A;  4DEY A;  2BE9 B;  2KY9 A;  3PIO A;  3HFO A;  1AVZ C;  1H8K A;  3CCL Q;  2RHX A;  4PK4 A;  3T9N A;  4PJO E;  2EGC A;  4HKE A;  3EG9 A;  3OSS C;  3SDZ A;  1H64 1;  3QXE B;  1TU0 B;  1WIE A;  5DLO A;  4F7U B;  1KSW A;  1QCO A;  2Y4Y A;  2YLB A;  2YUP A;  5LJ3 d;  2JTF A;  4C0D B;  1Q82 U;  2LZ6 B;  1K9M C;  2HZY A;  3EGD A;  2ZPB B;  3G4S Q;  3PTA A;  2JVV A;  1N5Z A;  4QW2 A;  2CKK A;  3CCJ Q;  2RK2 A;  4PKC C;  2L5Q A;  1KC8 R;  2O4X B;  5FWC A;  4RTY A;  1PHT A;  4QVC A;  1X75 C;  4M7D G;  1G3W A;  2G6F X;  1WA7 A;  1UHF A;  3OW2 A;  3CCV T;  5GAN 2;  2FG0 A;  1QP3 A;  1ZSZ A;  2GQI A;  1XNI A;  1PG5 B;  2EGA A;  4FYW B;  1W4S A;  3HRU A;  3PT9 A;  4GBQ A;  2HQE A;  1VQL T;  4X1V A;  4JS5 A;  4Q5W A;  3M5A A;  1YIJ A;  4JDS A;  4XTX A;  2ZAE A;  4KRT A;  1ZQ1 A;  2NYS A;  3L2W A;  2J7I A;  1XTD A;  3A1P A;  1HD3 A;  4BI8 B;  3A8O B;  3BE3 A;  2KT1 A;  4RTZ A;  1NEB A;  4AG2 C;  4ELY C;  3CD6 Q;  2EJF A;  3QPH A;  3G71 Q;  1YJW A;  5CKH A;  2HEQ A;  1SF9 A;  2SEM A;  3SFM A;  3RNJ A;  4ZN1 A;  1U06 A;  2BZX A;  1NJI C;  1E6H A;  2J6F A;  1VQ6 T;  1FWZ A;  4PFZ A;  3QZ9 B;  3OSV A;  3S3N A;  4OVA A;  5CIU A;  3OYJ A;  1KD1 U;  1WI7 A;  2ABL A;  3NTI A;  4M78 G;  1AD5 A;  2ED1 A;  2E3H A;  3DLM A;  1AZE A;  1G3S A;  1VYT A;  1YHQ Q;  1VQM T;  1R8O B;  2DX1 A;  3CCQ Q;  4XTY A;  4RTX A;  3RMQ A;  1K9A A;  1K76 A;  3M9Q A;  2DXU A;  5LJ3 g;  2C0I A;  2HL3 A;  4D6W A;  2F5T X;  2P0K A;  4PJN A;  3H0H A;  3MP1 A;  3UAT A;  1R77 A;  1I4K 1;  1VQ8 A;  2GQV A;  1AEY A;  2QA4 Q;  4C8Q E;  3CC2 Q;  2KYM A;  4PJO A;  1WHG A;  3EG9 B;  2OI3 A;  2Y90 A;  4HT8 A;  1S72 T;  4JRK A;  1I0C A;  3OBY A;  2KXC A;  2QK0 A;  5LJ5 g;  3VV0 A;  1Y96 A;  4HCC A;  4XU0 A;  2CS7 A;  3RBB B;  5D6W A;  1VQ5 A;  2D9T A;  3C12 A;  4M78 F;  2RJC A;  3EGD B;  1XJW B;  1U3O A;  3EAE A;  4M7A E;  3IQL A;  5IHI A;  1O75 A;  3ME9 A;  2BTT A;  1VQP A;  1BB9 A;  2COY A;  4JJN K;  2HQX A;  3P8D A;  5GAN e;  4LDV A;  1YWO A;  1YJN T;  1NZ9 A;  2LQ8 A;  2D6F A;  3L42 A;  1WQ7 A;  3CXC A;  1ZSZ B;  5FLX E;  2HKQ B;  2KRS A;  2CUD A;  2O88 A;  5GAN 8;  5GAO m;  3V8L A;  4QKU A;  3URG A;  3CCL A;  1VQO A;  5L8R E;  1MV0 B;  2A7Y A;  4B9W A;  4EPC A;  2K7A A;  1RAC B;  1WNL A;  4QQD A;  2NUT B;  3X25 B;  2YWW A;  4X34 A;  1M5Q 1;  1Y07 A;  2E70 A;  3OA6 A;  1YI2 Q;  3OYN A;  5HY6 A;  3M0S A;  4EMK C;  4N4G A;  1GL5 A;  1G3Y A;  3DB3 A;  3G7Z A;  3VJP A;  3VS6 A;  1YIT Q;  1AZG B;  2CP6 A;  1BIA A;  4KUL A;  3BW1 A;  4OGC A;  3G4S A;  4LUD A;  5GMK i;  1K8A U;  2DO3 A;  2EFI A;  2R58 A;  4GLM A;  2LP5 A;  5D6X A;  2LX9 A;  4KBM B;  4BDY A;  4LNP A;  3EFO B;  1DJ7 B;  1M2O A;  3RKY A;  4OB2 B;  2EYZ A;  1NPR A;  2MK5 A;  2XHC A;  3X28 B;  1X69 A;  1TUC A;  4PFP A;  2D1X A;  3M4Y A;  2O9S A;  4C8Q A;  2RQR A;  4PJO B;  3CCU T;  2P84 A;  3CME Q;  5ECA A;  2ENM A;  4O5V A;  3NFC A;  3U23 A;  3OYY A;  4OML A;  3JAM E;  2BUD A;  3NTH A;  2JOY A;  2HNI A;  2EPD A;  2LJ0 A;  3ZBD A;  2KEA A;  3LWI A;  2FO0 A;  3SWN C;  5I11 A;  1TUG B;  3MEW A;  2DTO A;  4JUV A;  3M56 A;  2VXF A;  4BE2 A;  1WHM A;  4DBQ A;  1SEM A;  1AWO A;  3PGG A;  5GAM g;  2KXD A;  1HXD A;  4Y91 A;  3CD6 A;  2CH4 W;  3EG0 A;  4M78 C;  2FZG B;  4M7A A;  1IHV A;  3CBM A;  1RAA B;  2HSE B;  2K2M A;  2JXB A;  4QQ6 A;  1PSF A;  4JS4 A;  1QVF S;  1G5V A;  1VQ4 Q;  2DA9 A;  4F16 A;  3JB9 I;  3H0F A;  1WJS A;  1KHI A;  1YHQ A;  2L89 A;  2J06 A;  2RNA A;  5DY9 A;  3CCQ A;  4L59 A;  3INZ A;  1IB8 A;  3MKD A;  1LJO A;  1YJ9 T;  1QVG A;  3FB9 A;  1MHN A;  1NPP A;  3BY7 A;  1N27 A;  2R5A A;  3REA B;  1G83 A;  1GRI A;  4IUR A;  3CCS Q;  1Q7Y C;  1VQ9 Q;  2MWP A;  5HK0 A;  1M2V B;  1TG0 A;  1OQK A;  3J80 E;  4IUV A;  3VS7 A;  2CP3 A;  1MND A;  1ZBX A;  4V2S A;  2O2O A;  3R6N A;  3F70 A;  2LC4 A;  4DOW A;  3E9G A;  4C5H A;  2LJ3 A;  4XTW A;  4M75 C;  3JV3 A;  3VUB A;  2RA2 A;  2CUB A;  2MPX C;  2F2V A;  4C8Q G;  2O31 A;  3S3M A;  2LNH B;  1D09 B;  1ARK A;  2A36 A;  4LDW A;  3NTK A;  1QVF P;  5LJ3 e;  1OPL A;  6AT1 B;  3THK A;  3R6O A;  4BI4 A;  4A54 A;  4DOV A;  2XKO C;  4AFQ C;  2DLP A;  4ZTJ A;  1SRM A;  1EX4 A;  2ECZ A;  5GAN h;  2PU9 B;  2CT4 A;  2DRK A;  2DZC A;  5LJ5 e;  4C5G A;  2CSQ A;  3OYC A;  2DBK A;  3QO3 A;  3UF4 A;  2X3W D;  1Q86 U;  1SSF A;  2OTJ Q;  1C1A A;  2KQW A;  4OMM A;  2V8I A;  3RDV A;  2PNI A;  4ZGD B;  1W2B S;  5GAN d;  2JTM A;  2X4W A;  4HCB A;  5KYW A;  4J6W A;  1WLP B;  3MJX A;  2VXE A;  2PVO B;  4D8K A;  2A37 A;  2K2V A;  2RH2 A;  1Q81 U;  4M7A B;  1KQS A;  2RJE A;  1PKS A;  4LD9 K;  1H3H A;  4CC4 B;  3FDR A;  3V7C A;  1WX6 A;  1AWW A;  2DMO A;  2EQK A;  2BE7 D;  3FEO A;  1M3C A;  2JTE A;  1YIT A;  2AZV A;  3VS4 A;  1YIJ T;  4OMP A;  1XOV A;  4FCY A;  1WXB A;  3TRE A;  2RI3 A;  2LDM A;  1CSK A;  3HTR A;  2CDT A;  3VS5 A;  1Z9Q A;  1UEC A;  3QJ6 A;  3OYB A;  1V29 B;  2RM4 A;  4ATO A;  3QWX X;  3FLG A;  4FT2 A;  4Y28 E;  3EFR A;  1D3B B;  2QQB A;  1RAH B;  2WAC A;  4JRI A;  3QUI A;  4DBF A;  5KYX B;  3ZL7 C;  2QEX Q;  4JJC A;  3CPW S;  1N8R C;  3EGX B;  2FPD A;  2JNG A;  3CME A;  2ATC B;  2KT8 A;  3MEU A;  2W10 A;  1KG1 A;  1MUZ A;  4M78 E;  2WSF E;  5GJV B;  3TSZ A;  3OYH A;  3C4S A;  3EHQ A;  2X9H A;  1W2B P;  1RL2 A;  3E2U A;  5KYY B;  1OEB A;  3TCJ A;  1LOJ A;  2YUN A;  1WDX A;  2CH4 A;  4DBH A;  4ZGE B;  2LMJ A;  1A0N B;  3JB9 J;  5KCH A;  4AG1 C;  1KHC A;  2CP5 A;  1VQ5 T;  3RER A;  3L2U A;  4M77 F;  1VQ4 A;  1K73 C;  4B9X A;  3CEY A;  2DL5 A;  5EG2 A;  2DXC A;  2HBW A;  4LN2 A;  4HT9 A;  3SHW A;  1VQP T;  2XDD A;  4EMK A;  2DPP B;  1VQ9 A;  4M75 E;  2D8H A;  1RLP C;  3CPW P;  2M51 A;  2LX7 A;  2DL7 A;  1X6B A;  1TOV A;  3NGP A;  3KXT A;  2HL5 C;  2DL8 A;  1UGR B;  3EH2 A;  3JB9 H;  5FU7 C;  5GAN 5;  9ATC B;  1VQN A;  3M0T A;  4PNO A;  4IKF A;  2DBM A;  3OYM A;  1I81 A;  1JQQ A;  3NMZ C;  3OYE A;  3VYG A;  1Q82 R;  1VQO T;  3DB4 A;  4C92 G;  1GFC A;  1WHK A;  4QT7 A;  4A4H A;  2DZ9 A;  4D8D A;  2E6N A;  1TH7 A;  1M27 C;  2KE9 A;  2E65 A;  2X4Y A;  2AK5 A;  1N9R A;  4HCK A;  1Q95 G;  2KMT A;  4XTV A;  2B8A A;  5A0G A;  4ESR A;  2JT4 A;  3GNF B;  4RCC A;  2DFU A;  1M1K C;  3QG1 A;  3OS1 A;  1WGS A;  2O01 E;  3SWN A;  4LUE A;  2RHI A;  2QDY B;  4J9H A;  3G4S T;  4PJO D;  4KUI A;  5LJ3 h;  4CC2 A;  2GBQ A;  4M78 A;  3RKW A;  2EQM A;  4C92 F;  2OTJ A;  1U1T A;  1E7O A;  2DNU A;  2A3L A;  3QYG B;  2DXB A;  2DD5 A;  1M3B A;  2FEI A;  2MYS A;  5LJ5 h;  2CSI A;  2J05 A;  2CT3 A;  3JB9 G;  2I2L A;  4RMO A;  3JRZ A;  2PVG B;  3A5Z B;  3I55 Q;  4LDX A;  4J9I A;  2EGE A;  3KBG A;  2FL7 A;  2BZ8 A;  5LJ5 d; 
#chains in the Genus database with same CATH homology
 2DF6 A;  2JM8 A;  3VRZ A;  2XMF A;  3VRY A;  2DIL A;  1OV3 A;  1UJY A;  1KFZ A;  3A98 A;  2C0T A;  1YNZ A;  2KRS A;  1AWJ A;  2CUD A;  4ORZ A;  2QDL A;  2O88 A;  4F17 A;  2ROT A;  2D8J A;  1MV0 B;  4CC3 A;  2LCS A;  1NLO C;  5GJW B;  2K7A A;  4WCI A;  1PRM C;  1M3A A;  2ESW A;  2LQN A;  3I9Q A;  3EG3 A;  1QCF A;  1MV3 A;  1ABQ A;  3C0C A;  1KJW A;  1JO8 A;  2MIO A;  2MOX A;  3M0S A;  4DEX A;  4J9F A;  2EBP A;  1BU1 A;  2MCN A;  1UGV A;  1NM7 A;  2L0A A;  3UA6 A;  4J9E A;  1RI9 A;  2EQI A;  4Z8A A;  1GL5 A;  1M30 A;  3VS6 A;  3PE0 A;  1AZG B;  1H92 A;  1BK2 A;  2YUQ A;  3I5S A;  4AFZ C;  4LUD A;  2EYY A;  1Y57 A;  4RUG A;  2PTK A;  2F2W A;  2PZ1 A;  4GLM A;  4IIM A;  2GGR A;  2W0Z A;  2LP5 A;  3UA7 A;  4J9C A;  4LNP A;  1LCK A;  1NYF A;  1ZUK A;  1UUE A;  1T3S A;  2EYZ A;  2IIM A;  2OJ2 A;  1X69 A;  1TUC A;  2D1X A;  1B07 A;  1RLQ C;  2O9S A;  3O5Z A;  2RQR A;  3H0I A;  2DVJ A;  1GFD A;  5ECA A;  2ENM A;  2L2P A;  4RTT A;  3U23 A;  1NLP C;  2SRC A;  2KR3 A;  1AOJ A;  4OML A;  5IXF A;  2DJQ A;  2KNB B;  2V1Q A;  4HVU A;  4AFS C;  1QLY A;  2ROL A;  1ZLM A;  1GCP A;  3EGU A;  2V1R A;  1WXT A;  2EPD A;  2JS0 A;  2LJ0 A;  2KEA A;  1E6G A;  2VKN A;  5IH2 A;  2FO0 A;  5I11 A;  2K6D A;  4ZNX A;  1UFF A;  2AZS A;  1SEM A;  1AWO A;  3NPF A;  2LQW A;  2P4R A;  5I22 A;  1SSH A;  2KXD A;  3KFV A;  2E5K A;  5L23 A;  2DE0 X;  4FSS A;  2CH4 W;  3EG0 A;  3H41 A;  4Z89 A;  2KGT A;  3VS3 A;  2BZY A;  3NHN A;  1ZX6 A;  1YN8 A;  2JXB A;  2K2M A;  1IO6 A;  2JMA A;  1AWX A;  1FMK A;  1X6G A;  1WXU A;  3GBQ A;  1ZBJ A;  3EG1 A;  1W1F A;  1QKW A;  2J6K A;  2DM1 A;  2DA9 A;  4F16 A;  2LJ1 A;  2KBT A;  3H0F A;  1HJD A;  1K0S A;  1WYX A;  2J06 A;  2RNA A;  2L3Q A;  1U5S A;  1B3Q A;  3REA B;  1G83 A;  1GRI A;  1SHG A;  2YT6 A;  4CC7 A;  2J6O A;  2HCK A;  1TG0 A;  1WFW A;  2ED0 A;  2RN8 A;  3VS7 A;  1VYU A;  2RQV A;  2F2X A;  1K4U S;  1KIK A;  1UTI A;  1ZUU A;  2O2O A;  1X27 A;  2FPF A;  3R6N A;  2FPE A;  2LJ3 A;  2KYB A;  3TVT A;  1GBQ A;  3JV3 A;  1GCQ A;  1JEG A;  4IIO A;  2CUB A;  2JMC A;  1UG1 A;  2JW4 A;  4RTW A;  1W70 A;  2F2V A;  2AKK A;  2KRM A;  2O31 A;  4K11 A;  4OMQ A;  1RUW A;  5FW9 A;  2JM9 A;  1PRL C;  2LNH B;  2YDL A;  2DL3 A;  1ARK A;  1OPK A;  2A36 A;  2GTJ A;  2RQT A;  4RTU A;  1CKA A;  1OPL A;  3THK A;  2D0N A;  3M0P A;  2GTO A;  3PVQ A;  4AFQ C;  2FRW A;  1T3L A;  2DLP A;  1NYG A;  1ABO A;  5IHK A;  1SRM A;  4OMN A;  2EYX A;  2ECZ A;  2O9V A;  2CT4 A;  2DRK A;  1Z9Z A;  3EG2 A;  3ULR B;  1SPK A;  1W6X A;  3QWY A;  2CSQ A;  4HXJ A;  2DBK A;  3REB B;  3UF4 A;  2X3W D;  4J9D A;  4M4Z A;  3EHR A;  4OMM A;  1T0H A;  2PNI A;  4AFU C;  2HSP A;  2DYB A;  1K0X A;  4JZ3 A;  1WLP B;  4J9G A;  2CRE A;  2A28 A;  2H8H A;  1S1N A;  1K1Z A;  2A37 A;  4D8K A;  3I5R A;  2KRN A;  1PKS A;  4F14 A;  1G2B A;  4CC4 B;  1JXM A;  3VS2 A;  1H3H A;  1WX6 A;  1AWW A;  3M0Q A;  1FYN A;  2DMO A;  1ZUY A;  3LH5 A;  1M3C A;  2JTE A;  2AZV A;  3VS4 A;  1UDL A;  5IXB A;  4OMP A;  1BBZ A;  1XOV A;  2X3X D;  1WXB A;  2KRO A;  2HDA A;  2L3P A;  2RMO A;  1CSK A;  2CDT A;  3VS5 A;  2A08 A;  1VA7 A;  1Z9Q A;  1UEC A;  4DEY A;  1YCS B;  1UE9 A;  1AVZ C;  1ZSG A;  3M0U A;  1H8K A;  3QWX X;  4JJD A;  1EFN A;  1SHF A;  2DL4 A;  2EGC A;  3ZL7 C;  1Y0M A;  4JJC A;  4JJB A;  4HVV A;  1OOT A;  2VVK A;  2VWF A;  1NEG A;  2FPD A;  1WIE A;  2RQU A;  1KSW A;  2KT8 A;  1SRL A;  2DRM A;  2W10 A;  2YUP A;  1MUZ A;  1J3T A;  5GJV B;  2LZ6 B;  3TSZ A;  5FWB A;  3EHQ A;  2K3B A;  4E6R A;  1GBR A;  1OEB A;  1JU5 C;  1QWF A;  1N5Z A;  3I35 A;  5IHN A;  1QWE A;  5FWC A;  4RTY A;  1PHT A;  2YUN A;  1WDX A;  2CH4 A;  2G6F X;  1WA7 A;  1UHF A;  1GCQ C;  4OMO A;  4A63 B;  2LMJ A;  1A0N B;  4AG1 C;  2FG0 A;  1VYV A;  2GQI A;  1HSQ A;  2EGA A;  1PKT A;  2AKL A;  4JZ4 A;  2DL5 A;  4LE9 A;  3TSW A;  4JPB W;  2NUZ A;  2HBW A;  4GBQ A;  2RQW A;  2YSQ A;  3PVL A;  4X1V A;  4LN2 A;  4J9B A;  3SHW A;  1PWT A;  2NWM A;  1UJ0 A;  4KRT A;  2YUO A;  2FRY A;  2J7I A;  1YP5 A;  2GNC A;  1HD3 A;  2D8H A;  1RLP C;  3CQT A;  2M51 A;  2KT1 A;  4RTZ A;  2LX7 A;  1NEB A;  1T0J A;  4RTV A;  4AG2 C;  2DL7 A;  1X6B A;  3NGP A;  2DL8 A;  2HEQ A;  1I1J A;  2SEM A;  1UHC A;  3RNJ A;  3M0T A;  1U06 A;  2BZX A;  2DBM A;  2J6F A;  1E6H A;  1V1C A;  1JQQ A;  3NMZ C;  1I07 A;  1GFC A;  4QT7 A;  1WI7 A;  2I0N A;  2ABL A;  1AD5 A;  2ED1 A;  4D8D A;  1AZE A;  1VYT A;  1M8M A;  3M0R A;  1M27 C;  2DX1 A;  2K79 A;  2KE9 A;  2AK5 A;  3VS1 A;  4RTX A;  4HCK A;  1K9A A;  2EYW A;  1K76 A;  2L3S A;  4ESR A;  2C0I A;  2JT4 A;  2RF0 A;  1YWP A;  3H0H A;  3UAT A;  3FJ5 A;  5EC7 A;  1AEY A;  5HCK A;  1QKX A;  2KYM A;  2OI3 A;  4LUE A;  1I0C A;  2KXC A;  2EVR A;  4J9H A;  2OAW A;  1NG2 A;  4CC2 A;  2RPN A;  3RBB B;  2GBQ A;  2EW3 A;  1E7O A;  2DNU A;  2JS2 A;  4Z88 A;  1TUD A;  1U3O A;  1M3B A;  2FEI A;  4R0K A;  4EIK A;  2CSI A;  3IQL A;  5IHI A;  2J05 A;  2CT3 A;  4HVW A;  3SEM A;  2BTT A;  1BB9 A;  1X2Q A;  1X43 A;  2M0Y A;  2K9G A;  4Y92 A;  1CKB A;  1PNJ A;  4J9I A;  1YWO A;  2EGE A;  2EKH A;  1JXO A;  1X2K A;  2C0O A;  2BZ8 A;  2B86 A;  3VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...