1JQQA

Crystal structure of pex13p(301-386) sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
b'ISEFGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIKRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PAS20
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, membrane protein
total genus 11
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jqqA00
1WFWA 2JXBA 1TG0A 2EW3A 1NEGA 1SPKA 1JXOA 4J9HA 2K9GA 4LUEA 1CKAA 3THKA 3KFVA 1KSWA 4QT7A 4Z88A 1M27C 2J7IA 2HCKA 2A36A 5IH2A 4HVVA 1WX6A 2YT6A 2DE0X 3VS6A 2W0ZA 4CC3A 1YN8A 2JM9A 5FWBA 4RTYA 1CSKA 1JXMA 4HVUA 4WCIA 1GL5A 3CQTA 2H8HA 4LN2A 3NMZC 2DF6A 5IHKA 1UHFA 3I5RA 2JT4A 1ABOA 1FYNA 2C0TA 1ZSGA 2CT4A 2ABLA 1QLYA 1T0JA 2D1XA 3VS5A 3H0HA 1PKSA 2LQWA 2VKNA 3SHWA 2KR3A 1M30A 3GBQA 5GJVB 2KT1A 3R6NA 4HCKA 2JTEA 4Z89A 5GJWB 3M0PA 2EYZA 1NEBA 2BZYA 1AZGB 4LE9A 1PRLC 1JU5C 2ED1A 2KT8A 1M3AA 2ROTA 3PE0A 3EHQA 2KROA 2GGRA 3NGPA 2ED0A 1Y57A 2EYYA 2DL8A 4HXJA 1YCSB 1OPLA 1YNZA 4EIKA 4J9IA 2X3XD 2KRNA 2RPNA 3ULRB 2M51A 2RF0A 2AKLA 1PWTA 4OMNA 4AFSC 2DRKA 1H3HA 1KFZA 1QWEA 1X6GA 2O9VA 3VS7A 4R0KA 4M4ZA 4LUDA 2KGTA 1T0HA 1WIEA 2RQTA 2DL5A 4J9FA 4HVWA 2P4RA 2K6DA 1SSHA 2A08A 3EGUA 4J9DA 1BBZA 1Y0MA 2EBPA 2HDAA 1WI7A 3TVTA 4RTUA 1B07A 2RQWA 2RQVA 2V1RA 1OV3A 3I35A 1SHGA 2KRSA 2SEMA 3NPFA 1VA7A 1GCQC 2OAWA 4DEXA 1RLPC 1MV3A 1S1NA 3I9QA 4X1VA 2CREA 4J9GA 4J9CA 2C0OA 2L3PA 1J3TA 2YUQA 1WLPB 1YP5A 2HSPA 2CUBA 1T3LA 3A98A 4DEYA 2J6FA 3QWYA 2KNBB 2A37A 2VWFA 1WXTA 1UHCA 2D0NA 1X27A 3M0RA 1W1FA 1ZUKA 1N5ZA 2LZ6B 1UECA 2FRYA 1HD3A 2I0NA 5EC7A 2X3WD 4AG1C 2NUZA 2XMFA 2DBKA 1W6XA 2EGAA 5I11A 4RTXA 1GFDA 2DVJA 2LJ3A 2AZSA 1HSQA 2D8JA 2LX7A 2DBMA 2RNAA 4CC7A 1G2BA 1JO8A 1GBQA 1SHFA 1RUWA 2KBTA 2DNUA 4CC4B 1I1JA 2LCSA 5IXBA 2CH4A 4OMLA 1AVZC 1PRMC 1VYUA 1UG1A 3VRZA 1MUZA 2DYBA 2YDLA 3UF4A 2CDTA 1X2KA 4J9BA 2JS2A 3RNJA 2ENMA 2O9SA 1WDXA 1KIKA 2V1QA 5FW9A 1GCQA 1H92A 1BB9A 2EGCA 3UA6A 2FG0A 4ESRA 2FRWA 1AWJA 2YSQA 2DL7A 3UATA 1HJDA 2RMOA 2RQRA 5L23A 1VYTA 1K0XA 1E6GA 4OMPA 2CSQA 2G6FX 3RBBB 2MIOA 1SEMA 1UE9A 2ROLA 2L3QA 2OJ2A 1A0NB 1RLQC 1B3QA 2IIMA 2LQNA 3ZL7C 3TSZA 1GBRA 4OMOA 1PNJA 2DMOA 1MV0B 1AEYA 3JV3A 2L0AA 2LMJA 1AZEA 1IO6A 2DJQA 2RQUA 1X6BA 1NYGA 2QDLA 1UGVA 4AFQC 2FEIA 2O2OA 1XOVA 4Y92A 3M0QA 1WXUA 1G83A 1EFNA 1NLPC 4GBQA 4LNPA 1ARKA 2FPEA 1LCKA 4RTTA 4OMMA 3VS1A 1I07A 2L3SA 4AG2C 2OI3A 2DL3A 3TSWA 3EG0A 1K9AA 2JS0A 1SRLA 3PVQA 1K0SA 2KXDA 4CC2A 2AZVA 2KE9A 1UFFA 2DRMA 4E6RA 3VS2A 2SRCA 2PTKA 2DA9A 1ZUUA 4RUGA 1NYFA 5ECAA 4RTWA 1I0CA 4F17A 1OOTA 1FMKA 1KJWA 1YWOA 2BZXA 1AWWA 1U3OA 2F2WA 3EG2A 2GNCA 4A63B 2E5KA 3C0CA 1WYXA 5IHNA 5FWCA 2BZ8A 3H0FA 4D8KA 1V1CA 2HEQA 1T3SA 1JQQA 3UA7A 4KRTA 1AOJA 1VYVA 1Z9QA 2K2MA 2K79A 2PNIA 4JPBW 1NM7A 2PZ1A 2C0IA 1M3CA 2DLPA 2DX1A 2GQIA 3FJ5A 2BTTA 4D8DA 1ZX6A 2CSIA 2YUOA 3H0IA 4Z8AA 5IXFA 3QWXX 2KYBA 1X2QA 1E6HA 2B86A 2F2VA 2LJ0A 1QWFA 1UJYA 3IQLA 5HCKA 4F16A 1WA7A 4OMQA 2VVKA 2J05A 4JJCA 2AK5A 2AKKA 3M0TA 2DILA 1UTIA 2K3BA 2GTOA 1K1ZA 4JJBA 1ZUYA 2J6KA 2DM1A 2EPDA 1QKXA 1TUCA 2KEAA 1ZLMA 2GTJA 2EVRA 2JM8A 4J9EA 2W10A 4AFZC 2JMCA 1K4US 4ORZA 2FPFA 2ESWA 4AFUC 4F14A 2CT3A 1X43A 1GFCA 3VS4A 2L2PA 3NHNA 3I5SA 2GBQA 1E7OA 4K11A 4RTVA 3REAB 3U23A 2EKHA 2K7AA 3PVLA 2JMAA 2F2XA 1JEGA 1SRMA 4RTZA 2FO0A 1ABQA 2EYWA 3H41A 3VS0A 2A28A 2KXCA 4IIOA 2DL4A 2D8HA 1AWXA 1UUEA 3M0SA 3EHRA 1WXBA 1OPKA 1U06A 2LJ1A 1AWOA 2EGEA 2J06A 3O5ZA 1GCPA 3REBB 1M3BA 2O31A 1W70A 2MOXA 3VS3A 2CH4W 3LH5A 2JW4A 5I22A 2KRMA 1UDLA 1QKWA 1BK2A 2FPDA 1OEBA 1M8MA 1NLOC 1X69A 1Z9ZA 2KYMA 2LP5A 4JJDA 4JZ4A 2M0YA 4IIMA 1RI9A 1GRIA 1UJ0A 3EG3A 3SEMA 1AD5A 2HBWA 1BU1A 2EYXA 1U5SA 1H8KA 2RN8A 1K76A 1PKTA 2YUNA 2CUDA 3M0UA 2EQIA 1TUDA 2LNHB 4ZNXA 2ECZA 1CKBA 4FSSA 1YWPA 2YUPA 5IHIA 3VRYA 2J6OA 4GLMA 2MCNA 2NWMA 3EG1A 1PHTA 1QCFA 4JZ3A 1NG2A 1ZBJA 2O88A
chains in the Genus database with same CATH superfamily
3MP6A 2JNGA 1K9MU 2QQSA 3V7SA 3TCJA 2E70A 4GY5A 5D6YA 1YI2A 5DM7R 2QG9B 4AMCA 4DA4A 5LJ5h 4QKUA 3MP1A 2F5KA 4QT7A 1S72Q 4BB7A 1IRXA 1VQPA 2J7IA 1WZOA 4F7UB 3QKJA 3A8HB 3G4ST 3VS6A 2W0ZA 3HHTB 3I56Q 2OTLT 1YN8A 1OX8A 1G3SA 1CSKA 3JCMb 4XTVA 1VQKT 4WCIA 1GL5A 3NTKA 3CPWA 1N9RA 3J80E 3NMZC 4KGXB 2DF6A 2BIVA 2FZCB 4PFPA 1Q7YC 2CT4A 2ABLA 1QLYA 2EQUA 3H0HA 1S72A 3SHWA 2A0FB 2KDSA 4FYVB 2HKQB 2KAFA 1K73C 3QJ6A 2XK0A 4OGEA 5GJWB 2DTOA 3JAME 2JTFA 3DB4A 3S3MA 3FEOA 5CVIA 2KK4A 3OMCA 4C5GA 2NUPB 2RJCA 3CPWS 5D6XA 4CI0C 3RDVA 3NGPA 3OQ5A 1WHKA 3OS0A 1QP3A 1EZZB 4PJMA 1D1BA 2DL8A 1MNEA 3CEYA 3CCQQ 4J5YA 1YNZA 4NOYA 1YJWQ 2KRNA 3BW1A 3ULRB 1KC8C 2I2LA 2DXCA 5GAMf 1KQSP 4OMNA 1BI3A 4XTZA 3PMTA 1OULA 3VS7A 1KK7A 4R0KA 1YHQQ 2F1LA 2DTIA 2ZAEA 1WIEA 2R58A 2RQTA 4HVWA 3C12A 4BI8B 1SSHA 2A08A 1BBZA 4FYWB 1KQSS 2D9TA 5KYWB 4MDXA 4C92G 2R5MA 4RTUA 3RERA 3G1JA 1M90R 1PSEA 1YJWA 3OSVA 5GANf 1GCQC 4DEXA 1RLPC 1MV3A 1S1NA 3PFSA 2ZGWA 4X1VA 2K3YA 5GMKe 3M9QA 1D1AA 1YP5A 2CUBA 3H8ZA 3V8KA 3GPLA 3X20B 1T3LA 1YHQA 3GNGA 4DOVA 4DEYA 2CS7A 1M9SA 1BCMA 4X9DA 4C8QD 4E7HA 2DK3A 1ZHIA 4KUIA 5KCHA 3RIRA 1W1FA 1ZUKA 5IAYA 2GFUA 2LZ6B 1M90U 2FB7A 2NLUA 5EC7A 3CCRQ 2X3WD 4AG1C 2DBKA 1BI0A 2QEXQ 2EGAA 9ATCB 3ME9A 4EMHA 2AZSA 3CBOA 2L5QA 1GBQA 1SHFA 4CC4B 2DNUA 3OYIA 1I1JA 4M7AB 1PC0A 5CKHA 3A8LB 2XD0A 3VRZA 5GMKi 1MUZA 3LYIA 2EJ9A 3CCSQ 2DYBA 3UF4A 3RUXA 4A4EA 4P5NA 4J9BA 2Z0WA 4M7DB 3RNJA 5GAMg 2ENMA 1WDXA 3QPHA 1VQ5T 4PLLA 3CMAT 5FW9A 1GCQA 1BB9A 2EGCA 2FG0A 3TEEA 4BY6B 4ESRA 5FLXE 2CP7A 3P8BB 1QMCA 4XU3A 1AWJA 2QGFB 2XKOC 2RMOA 2O01E 4OVAA 3QYGB 3CCVT 2LVMA 1G3TA 4OMPA 3MEWA 1OU8A 3RBBB 2JOYA 3DLMA 3HL8A 7AT1B 4OP0A 5KYWA 2F69A 1SF9A 2HQXA 2E3IA 2L3QA 2Y90A 1A0NB 3MEAA 3S3NA 1ACMB 2FHDA 4ZTJA 5GANg 2VB6A 3C4SA 4BY6C 5LJ3j 4EMKC 1W2BP 3VUBA 2WACA 3JCMW 8AT1B 3CC4T 1N27A 3L42A 3M56A 1N8RR 4Y92A 3L2VA 1G83A 4GBQA 3X24B 2L8DA 4M78F 2P4TA 3CMEQ 4AG2C 1UGRB 4KGZB 4C0FA 1TOVA 1I4K1 1K9AA 1RACB 4E7IA 4CC2A 4C92E 2AZVA 1UFFA 3DB3A 1PSFA 4E6RA 3CCUT 5GAMd 4M7AA 2SRCA 1UEBA 1N8RU 5A2QE 1FMKA 4N4GA 1VQLQ 2QDYB 2DVEA 1AWWA 1NE8A 4M7DA 2GNCA 3N5BB 4KUDK 4CRIA 2BZ8A 3JCMV 5EG2A 3CMEA 2HEQA 1T3SA 1JQQA 2Y4XA 3RKWA 3G71T 3CCJQ 2K79A 4JPBW 2FZGB 4C92F 2QK0A 2DLPA 2DX1A 2GQIA 5GANd 3JB9G 4O6JA 1VIEA 1D3BA 5IXFA 1X01A 2EQKA 3RKYA 4MZTA 1UJYA 3CCLQ 1VQLA 1VQ8T 3EAEA 2AK5A 5KYYA 2AKKA 4LDYA 3OYHA 2DILA 2YWWA 2QA4T 3A8GB 4R55A 1K1ZA 4JJBA 1ZUYA 2J6KA 4PJOF 4BE2A 3ZFJA 1QKXA 2G3RA 1RAIB 3CCJA 2EVRA 4AFZC 3JCMP 2BUDA 4E7SA 1ZA1B 3OYKA 4ORZA 1BCOA 2ESWA 4F14A 1XTDA 4KGVB 2BE7D 2X9HA 3KUFA 3CCEQ 1RAAB 3CCLA 5LJ5g 3PVLA 1V76A 2K2VA 1IZ6A 1M1FA 4JRIA 3CD6Q 2DJZA 1RAGB 2EYWA 5KE2A 3M4YA 2A28A 1VOMA 4BDYA 2DL4A 2ZPFB 1AWXA 1UUEA 4J6XA 3A8MB 2LQKA 3M0SA 4C8QB 1OPKA 2R57A 2OX7A 1AWOA 2EGEA 1M4ZA 5KYXB 1M3BA 2RO0A 2O31A 5GAMe 2KSSA 3CCEA 1XQHA 4IUVA 1FMWA 2HD0A 3GOXA 1U1SA 1QKWA 1BK2A 2XHCA 2COZA 3CD6A 1KD1R 2E41A 4FT4A 4M78C 1YJ9T 1UJ0A 3CCMQ 3SEMA 4ME7A 2K4YA 1H8KA 1K76A 2RHUA 1IHVA 2EQIA 1SKUB 1QVGP 1WQ7A 4FSSA 5GANe 2KMTA 2J6OA 4XTUA 4GLMA 1KD1U 3HRTA 1LVKA 1ZBJA 2RB6A 4ANJA 4E2FB 2V8JA 4YTLA 1VQNT 5LJ5d 1JXOA 4J9HA 1QVGS 1H641 1CKAA 1LNXA 2KY9A 4Z88A 1M27C 3WVEB 2IG0A 1WX6A 1U1TA 2DE0X 4CC3A 4M75D 1YJNQ 3JB9J 1VQMQ 4RKUE 2DD5A 3CBMA 4M78A 3CQTA 1G3YA 4C8QA 4LN2A 5KYUB 3GP8A 4IUPA 1QVFA 4C0ZA 4F7UF 3I5RA 3X26B 2JT4A 2QQ9A 1ABOA 1FYNA 4JRKA 1Q81C 2YLCA 2GFAA 4PJOC 1VQ4T 2E6NA 5KYXA 4L5GA 2LTOA 2VKNA 4N0AC 3V8LA 2LNVA 2HZYA 4Y91A 1QVPA 1YBYA 2KT1A 2L3RA 3JB9F 3M0PA 1OQKA 1RL2A 1TSFA 2K57A 2BZYA 1AZGB 1RI0A 1I5OB 4IKFA 2KT8A 2PU9B 1M3AA 2GF7A 2KROA 1YIJQ 2IVWA 4ELYC 1Y57A 2EYYA 3KBGA 3OA6A 1QVFS 4HXJA 2OTJQ 4FYYB 1Q82R 1TU0B 4FSXA 1K9MC 3OW2P 2RF0A 3A1PA 3H9NA 3UT1A 1VQOT 1SSFA 1QCOA 3HTRA 2DRKA 2K5IA 1KFZA 2KQWA 3VUZA 1QWEA 2O9VA 1T0HA 1JJ2P 5GAN6 3M59A 4J9FA 1Q82U 5GMKl 4PJOA 1YIJA 2K6DA 3QHSA 3EGUA 4J9DA 1Y0MA 2DXBA 1UGQB 4N0AA 2EBPA 1YITQ 2OTJA 2AIRB 3CC2Q 2RQWA 2RQVA 3FLGA 1OV3A 5J26A 1SHGA 2KRSA 2SEMA 1VA7A 1QQJA 1M8VA 2VC8A 2L3PA 5LJ3f 4PK4A 5KYUA 3RKXA 1YI2T 2ZCFB 2D6FA 4M77D 2CZ0B 2X51A 2ZPIB 2J6FA 3QWYA 3EFOB 1NZ9A 5IT9E 4OF1A 4F04B 1VQPT 1RABB 2EKOA 1TH7A 1Q86R 4C0DC 1HK9A 2I0NA 3CC2A 2NUZA 2OTLQ 4OB2B 5I11A 4M7AE 4FM4B 3FC3A 4XU0A 5A0LA 2DVJA 1NJIR 1MNDA 2LX7A 2MF2A 2LT1A 1G2BA 1JO8A 5C6SA 2DIQA 1RUWA 2KBTA 4XTWA 3PIPA 5IXBA 1OYXA 1YFNA 1WHJA 1AVZC 4M7DE 1Q86U 4C0GA 1B7TA 1S72T 2NYSA 1X2KA 2CP3A 2JS2A 3EGDB 1NJIU 2OTLA 2XI9A 5GAN4 2WSFE 2MAMA 4OGCA 5D6WA 4M7AF 2FRWA 3I56A 1M2VB 1I81A 2DL7A 2RQRA 3OYMA 3QSUA 2NUTB 3R6OA 4M78G 1K0XA 5IN1A 1TUGB 2CSQA 2CP0A 2DZCA 1KQSA 4M7DF 1SEMA 1VQ6Q 2ROLA 3ER0A 3JCMf 3CPFA 2IIMA 2LQNA 4ZGEB 1D1CA 3HPWA 2OAUA 2DMOA 5HK0A 1MV0B 1AEYA 2H3EB 2DTHA 2LMJA 1AZEA 5GMKj 2YLBA 3OYJA 5FU7B 2P0PA 4ZN3A 3NTHA 1M90C 4L6V5 5D7UA 4XU2A 2FEIA 1XOVA 3AHUA 3OYYA 3EH1A 2P0QA 5GAOl 1ARKA 1VQ6A 1GXIE 4F7UA 4M75B 1YJWT 4RTTA 3T9NA 3CCQA 2X4JA 2A3LA 3TSWA 1EIFA 2JS0A 2YRVA 1MGQA 1YHQT 1MMGA 3X25B 1ZBXA 2DRMA 1DJ7B 1PD0A 5ECAA 3SDZA 3MEVA 3OYGA 1JRIA 1KJWA 4PJOG 1YWOA 2BZXA 4HCZA 2YRCA 3EGDA 4RCBA 1TS9A 2RHZA 1IB8A 3L2WA 1R77A 1WYXA 4LD9K 3H0FA 3I55Q 3M55A 1V1CA 2EWNA 2QXFA 1M2VA 1AOJA 1VYVA 1KQ2A 2K2MA 3UWNA 2NUTA 3META 1NM7A 2C0IA 2VGMA 4ZTFA 3EFSA 2JN0A 1VQ7Q 2NUPA 2CSIA 2COWA 4J6YA 4J8OA 3L1AA 5J39A 1VUBA 5GAN3 3JRZA 2DZ9A 1E6HA 2B86A 2DEQA 2F2VA 2LJ0A 3IQLA 5HCKA 4F16A 3BDLA 2BKDN 2VVKA 2PVGB 2QQBA 2GTOA 3CCRA 2FL7A 2DXTA 2ZPBB 3I55A 1LOJA 2QEXA 2DM1A 3FJPA 2CZ7B 3GIBA 1G8XA 3CCVQ 3FRNA 2JMCA 3FB9A 2MWPA 4FU6A 4M7AC 1VQ7A 3OS2A 5KYNA 1X43A 3D7SB 1GFCA 1D0XA 4C92D 3NHNA 3CCSA 3MJXA 1E7OA 4M78E 1W2BA 3REAB 3U23A 3J81E 2JMAA 4C8QE 2HAXA 4M7DC 5J3BA 1SRMA 3WXMB 1ABQA 4M77B 2CZ6B 3VS0A 2KXCA 3WVDB 2D8HA 1WXBA 1U06A 3M4GA 2RI3A 1BIBA 4VUBA 1I5LA 1M1GA 4A53A 5KE3A 2HL5C 4JRQA 4IURA 2CH4W 5CK9A 2JW4A 2R5AA 2VXFA 5AYFA 4A4HA 3URGA 4C8QF 1W2BS 2JZ2A 4M77C 4HCCA 2DERA 2KYMA 2LP5A 4JZ4A 2M0YA 3X28B 3SWNB 3JB9H 2P84A 1BU1A 2HBWA 2EYXA 2RN8A 4J6WA 5GAN2 1NPRA 1TUDA 2LNHB 1CKBA 1D0YA 5IHIA 4IUUA 5CO7A 3JCMQ 4F7UG 3MEUA 3CMET 1ZSZB 2NWMA 5FU6B 2XG8D 1WHMA 1NG2A 5LJ3e 3NFCA 3G71Q 3PGGA 1AT1B 4PJOE 2JXBA 3MHXA 1FXXA 3RMQA 1NEGA 8ATCB 3A8OB 2V8KA 2CP5A 5AT1B 2K9GA 4LUEA 3THKA 1VQLT 2O4XB 2LRQA 2HCKA 5IH2A 1RADB 5LJ3h 3S3OA 5CCAA 4FW2A 1ZSZC 2DPPB 5FU6C 4FYXB 1BIAA 4RTYA 4M77A 3CCJT 2PVDB 3J7AF 2M1HA 5IHKA 2C0TA 1ZSGA 4PJJA 1FWZA 1T0JA 3VS5A 5HKCA 1PKSA 2LQWA 3CCLT 1M1KR 5GAMj 3QZ5B 3OYEA 2RA2A 3JCMc 3INZA 3GBQA 5GJVB 2FVUA 1C0MA 2JTEA 4HCKA 4Z89A 2DXUA 2EYZA 4LE9A 1PRLC 1RAFB 2QAZA 2RH2A 2HNIA 3SWNA 1JU5C 3EHQA 2GGRA 2RK1A 3OY9A 1M1KU 1KD1C 2M02A 1YCSB 3JCMe 3CCET 1OPLA 2AHJB 5GANj 4J9IA 2RPNA 3O8VA 1ZSZA 2AKLA 3CD6T 1PWTA 4ELZC 1Q95G 3M57A 2MYSA 4AFSC 3OYAA 2EJGA 1H3HA 4IUTA 3JSCA 2F5TX 3QJYA 4II1A 4M4ZA 2MWOA 1HYOA 5LL6S 1QVGA 2KGTA 3JB9D 4C8QC 3JCMh 3JB9I 2P4RA 4OB0B 1R0BG 2XDBA 2O4XA 4MMLA 3MO8A 1WI7A 3TQ7P 2EJFA 1B07A 3UPUA 3I35A 3NPFA 2K5LA 4NL2A 4DOWA 3I9QA 1J3TA 2HSPA 5CQXA 2QTVA 1X75C 3A98A 3ZBDA 4F7UE 1B34B 2XDPA 4J7FA 2D0NA 1X27A 1JBMA 3CCMA 4RG2A 4M7AG 1EX4A 3MKDA 3MPUB 2FRYA 1HD3A 4LDVA 4QQGA 3OS5A 4MZMA 3OBWA 4M7DG 4RTXA 1WNLA 3OYDA 1HSQA 2D8JA 2QQAA 2DBMA 2RNAA 3G6EQ 2M16A 4JLIA 1IHWA 5GAN7 4OMLA 3F70A 1PRMC 4NS5A 2YDLA 3V8JA 4PL6A 1KHCA 3CC7Q 1OI1A 2E5QA 1Y96B 2O9SA 3A5ZB 4JJNK 2MK5A 1H92A 3UA6A 4C5EA 5CQYA 4B6MA 4LD6A 1Q82C 4BE1A 1VIFA 1VQ9Q 2YSQA 4M77G 1YJNA 2H3JA 3G6EA 3S6WA 2HMAA 3ASKA 4RG8A 2PUKB 1VQMA 2XU8A 1E6GA 2LCCA 6AT1B 1V29B 4XTYA 3CXCP 3PMIA 3OW2A 2CYZB 3LWHA 2AT1B 2X35A 4Y28E 2OJ2A 4ZN1A 5LJ5j 3CC7A 1B3QA 4J7IA 1GBRA 4OMFB 1M5Q1 1JJ2A 4XQ3A 3JV3A 3TU4K 2L0AA 4A54A 2E12A 3KXTA 3RESA 1K8AR 4TVRA 3OMGA 2XICA 2M9UA 2DJQA 1LPLA 2RQUA 2RM4A 1VQ9A 5GAOq 1YIJT 2QDLA 4AFQC 4E47A 4LDXA 2OTJT 3PTAA 3OS1A 1EFNA 4LNPA 3OW2S 2QGGA 4WF2A 2VYTA 4OMMA 3VS1A 5L8RE 1I07A 3C95A 2D0QB 1K8AU 3LWIA 1I8FA 1YI2Q 1Q86C 1JJ2S 1K0SA 2KXDA 2DO3A 5DLOA 3VS2A 2DA9A 3H6ZA 4QQDA 1ZUUA 2B8AA 3HP9A 3LLRA 1NYFA 4M75F 1MMDA 1I0CA 4MZPA 1OX9A 1OOTA 2EFIA 2HSEB 2DEUA 1MMNA 3CC2T 2F2WA 1QP2A 2EYQA 3VYGA 2VV5A 2ZZDA 1UGSB 1Y96A 1C6VX 2E5KA 4A63B 1YITA 1HXDA 3G4SQ 5IHNA 5FWCA 1WJQA 4PJNA 3QDFA 3L2ZA 4D8KA 1G3WA 3TREA 1D09B 1QW1A 1VQKQ 4KRTA 3GLXA 2E1HA 2LCLA 3PNWC 2PZ1A 2ZPGB 1M3CA 2DD4A 2MMPA 2YUOA 4PKCC 4X9CA 3H0IA 3PIOA 4QW2A 3QWXX 2KYBA 4N4HA 1Y71A 1QWFA 4Q5WA 4OMQA 2E65A 1UB4A 2HKNA 3G4SA 2XDDA 3I56T 4FL6A 1BI1A 4NL3A 2QASA 4AT1B 2EPDA 1PG5B 3E2UA 1VQKA 2KEAA 4ATOA 1ZLMA 1WHHA 2JM8A 3FIFA 3OSSC 5CKBA 4OB3B 1K4US 2FPFA 4C8QG 3CPWP 3HRUA 2DAQA 2M0OA 3VS4A 2L2PA 3Q1JA 4M77E 2DKGA 2GBQA 3JCMJ 2DYIA 4K11A 4RTVA 1XNIA 2EKHA 4JDSA 1AHJB 2JTMA 4LXCA 1Q7YR 1BYMA 4RTZA 2FO0A 4PLIA 4WTOB 5LJ3g 2YRDA 2E64A 3EHRA 3LW5E 2HQEA 2A7YA 1RAEB 1JB0E 4RCCA 4BDZA 1K73R 3LX7A 2DIGA 3LH0A 4JLGA 3EFOA 1VQ6T 4FT2A 3REBB 2MOXA 3CCQT 3VS3A 3QXEB 4M77F 5GAOr 1Q7YU 2EQMA 2FZKB 3EGXB 1M2OA 2FPDA 1OEBA 3SFMA 1M8MA 1X69A 1Z9ZA 2EAYA 1KG1A 4R56A 4IIMA 1K73U 4QQ6A 1RAHB 1RI9A 1KHIA 1KC8R 5FU7C 1WQWA 1U5SA 2LT4A 4KH0B 3OYCA 1QCNA 3PT9A 1PKTA 2CUDA 4GLKA 4B9WA 2RHXA 5KCOA 1PM3A 3QBYA 2QQRA 1R8OB 3VRYA 2RJDA 4M75C 2O88A 4BI4A 3NTIA 1WFWA 1TG0A 4FCYA 1KC8U 2EW3A 4M78D 3OBYA 5GAN8 5GAOp 1SPKA 1ZQ1A 1WHLA 4XTXA 3AT1B 1WJRA 3KFVA 1KSWA 2GCXA 2VUBA 2A36A 5LJ3d 4HVVA 4PFOA 5GMKh 2YT6A 3JCMg 5A0DA 2RHIA 3CMAQ 1VQ5Q 3CCRT 4MDWA 2JUFA 2JM9A 3G7ZA 3I55T 5FWBA 2QEXT 4HT9A 1JXMA 4HVUA 4V2SA 2H8HA 3GF5A 2P0KA 1UHFA 1VQ7T 2ZPEB 2CP6A 4C5IA 4O5VA 3CCST 2D1XA 3P8DA 1NPPA 4KH1B 2KR3A 1M30A 2PVOB 4BE0A 2XIDA 2VASA 4M75A 3EGXA 4Z02A 1O9SA 1UGPB 3R6NA 3OYFA 3CMAA 1VQ5A 4EMKB 2RHYA 4HA8A 1NEBA 1N8RC 2ED1A 2X4YA 2RJEA 4XAXB 2ROTA 3PE0A 2DETA 3VKIA 5CKEA 2ED0A 5KH6A 3CC4Q 1D3BB 2X4WA 4A4KA 3CCVA 4E7KA 4PJOD 2KVQG 3HFNA 4JS4A 5KYYB 4EIKA 2X3XD 3HKSA 2M51A 2KI7A 2BE9B 1ZA2B 5DY9A 4EMGA 1X6GA 4JUVA 4LUDA 3M5AA 3CCUQ 3JCMd 2YHTA 4DBHA 2DL5A 2E6ZA 3CC4A 3JCMX 1XJWB 2HDAA 3TVTA 3EH2A 1PCXA 5LJ5f 2VGNA 2K3XA 2V1RA 2LX9A 2OAWA 3ZEHA 4HT8A 2CREA 4J9GA 4J9CA 2C0OA 2YUQA 4DBRA 1WLPB 2HQHA 3OB9A 2LDMA 1YCYA 1OU9A 3SWNC 1FX7A 2KNBB 3CCUA 2A37A 2VWFA 2EQJA 1WXTA 1UHCA 4LDUA 3M0RA 2IPOB 1WJSA 4XU1A 1N5ZA 1UECA 5I2SA 5CKFA 2FYKA 4E7ZA 1VQ8Q 5DLQE 1H3ZA 2XMFA 5M9OA 4DBFA 2QA4Q 1W6XA 4EMKA 5FRMA 5CR2A 1GFDA 2LJ3A 2MPXC 4CC7A 4X34A 1M1KC 2CZ1B 3BDUA 3RR6A 1P92A 3G71A 2LCSA 2CH4A 1VYUA 1UG1A 1N6AA 1BI2A 1MHNA 4ZGDB 2CDTA 4PNOA 5GAOn 4UC4A 2K5FA 2RD1A 1KIKA 2V1QA 1VQ8A 1Y07A 3E9GA 2E3HA 5HK3A 2QA4A 3QG1A 5C0MA 2VXEA 4PFZA 1HJDA 3UATA 1TXQA 5L23A 1VYTA 4E7JA 1NBEB 2X4XA 3SB2A 2G6FX 3M53A 2MIOA 3QIIA 1U8RA 1UE9A 4D6WA 3C94A 2V26A 1RLQC 3ZL7C 3TSZA 4OMOA 1PNJA 1C1AA 4M75G 5GMKm 4M78B 1Y7XA 1FMVA 1MMAA 1IO6A 1WGSA 1YJ9Q 4QVZA 1IGUA 1X6BA 4A4FA 5FROA 4KULA 2GQVA 4RMOA 1NYGA 1UGVA 2V8IA 4N4IA 2O2OA 1SG5A 1WXUA 3M0QA 1NLPC 3QDRB 2JVVA 2HL3A 4C5HA 3BE3A 4BI3A 2FPEA 3EG9B 2JJ9A 1LCKA 4XK8E 4EDUA 1WPYA 1W4SA 4IUQA 1OZ3A 2L3SA 3P8HA 2OI3A 2DL3A 2LQ8A 5FRNA 3QO3A 3SD4A 3EG0A 4BACA 1SRLA 3PVQA 3VYHB 1WHGA 3LGFA 3VU3C 2KE9A 3VJPA 1IREB 1YJ9A 3OYLA 1VQNQ 2WSEE 2CP2A 2PTKA 4B9XA 5GAMh 3CCMT 5A0GA 4RUGA 4RTWA 4HCBA 5CAIA 4F17A 2CGHA 4C92B 1BKBA 2QTXA 4EPCA 1U3OA 1G5VA 2MI6A 3EG2A 2QI2A 4L59A 1R0CB 3C0CA 2PQWA 3LGLA 4BD3A 3UA7A 2E4HA 1Z9QA 3M58A 2PNIA 2RI5A 4FW1A 3CBPA 4JRPA 2L89A 2ZPHB 3FJ5A 2BTTA 3EFRA 4D8DA 4PJOB 1ZX6A 5GANh 1VQNA 3QZ9B 4Z8AA 4OB1B 1VQ4Q 1IGQA 3M54A 4C92C 1X2QA 2RK2A 2COYA 2WSCE 4HKEA 1WA7A 2J05A 4JJCA 3M0TA 1UTIA 2K3BA 3BY7A 5CKDA 3RMSA 2C06A 2EIFA 3CXCA 1OZ2A 2LC4A 3V7RA 1O75A 4DBQA 3G6ET 1YJNT 1VQMT 1IXDA 1TUCA 5HY6A 2DFUA 2RJFA 3GNFB 4DQ2A 2GTJA 4JS5A 5I2MA 4J9EA 2W10A 4J83A 5CIUA 4AFUC 2CT3A 4LDWA 3E19A 1K8AC 3MCAB 1VQ4A 3EG9A 3CC7T 3I5SA 1QVFP 1F1BB 4KBMB 5GAN5 2YXYA 2K7AA 4BUGA 3L2UA 2F2XA 1JEGA 1Q81R 2QYZA 1VQOQ 3H41A 3DKMA 4A4GA 1VQ9T 5GAOm 4IIOA 1N9SA 3CXCS 3QUIA 4QVCA 1TWBA 4PJLA 3UDCA 2LJ1A 3HSBA 1B34A 4M75E 2J06A 3E1SA 3O5ZA 4C92A 4M7AD 1D0ZA 1GCPA 3E9FA 3L2QA 2CKKA 2PUOB 1W70A 5I21A 1Q81U 3LH5A 5I22A 2KRMA 2ATCB 1UDLA 4KT0E 2E10A 4M7DD 1X6OA 3FDRA 1NLOC 1VQOA 2RI2A 3VV0A 4JJDA 1KQ1A 1GRIA 1K9MR 3EG3A 4QVDA 4MMKA 1AD5A 3DLLA 4E7LA 2YUNA 1VQPQ 2Y4YA 4C0DB 3OYNA 1PD1A 1LJOA 3M0UA 1NJIC 5LJ5e 3MP8A 4ZGJB 4ZNXA 1YITT 2ECZA 2HBPA 1TTHB 1YWPA 2YUPA 3OYBA 3HRSA 2MCNA 3QYHB 3EG1A 1PHTA 1QCFA 4JZ3A 3BFMA 4FIBA 3L2RA 3V7CA 3HFOA
chains in the Genus database with same CATH topology
1WFWA 2JXBA 1TG0A 2EW3A 1NEGA 1SPKA 1JXOA 4J9HA 2K9GA 4LUEA 1CKAA 3THKA 3KFVA 1KSWA 4QT7A 4Z88A 1M27C 2J7IA 2HCKA 2A36A 5IH2A 4HVVA 1WX6A 2YT6A 2DE0X 3VS6A 2W0ZA 4CC3A 1YN8A 2JM9A 5FWBA 4RTYA 1CSKA 1JXMA 4HVUA 4WCIA 1GL5A 3CQTA 2H8HA 4LN2A 3NMZC 2DF6A 5IHKA 1UHFA 3I5RA 2JT4A 1ABOA 1FYNA 2C0TA 1ZSGA 2CT4A 2ABLA 1QLYA 1T0JA 2D1XA 3VS5A 3H0HA 1PKSA 2LQWA 2VKNA 3SHWA 2KR3A 1M30A 3GBQA 5GJVB 2KT1A 3R6NA 4HCKA 2JTEA 4Z89A 5GJWB 3M0PA 2EYZA 1NEBA 2BZYA 1AZGB 4LE9A 1PRLC 1JU5C 2ED1A 2KT8A 1M3AA 2ROTA 3PE0A 3EHQA 2KROA 2GGRA 3NGPA 2ED0A 1Y57A 2EYYA 2DL8A 4HXJA 1YCSB 1OPLA 1YNZA 4EIKA 4J9IA 2X3XD 2KRNA 2RPNA 3ULRB 2M51A 2RF0A 2AKLA 1PWTA 4OMNA 4AFSC 2DRKA 1H3HA 1KFZA 1QWEA 1X6GA 2O9VA 3VS7A 4R0KA 4M4ZA 4LUDA 2KGTA 1T0HA 1WIEA 2RQTA 2DL5A 4J9FA 4HVWA 2P4RA 2K6DA 1SSHA 2A08A 3EGUA 4J9DA 1BBZA 1Y0MA 2EBPA 2HDAA 1WI7A 3TVTA 4RTUA 1B07A 2RQWA 2RQVA 2V1RA 1OV3A 3I35A 1SHGA 2KRSA 2SEMA 3NPFA 1VA7A 1GCQC 2OAWA 4DEXA 1RLPC 1MV3A 1S1NA 3I9QA 4X1VA 2CREA 4J9GA 4J9CA 2C0OA 2L3PA 1J3TA 2YUQA 1WLPB 1YP5A 2HSPA 2CUBA 1T3LA 3A98A 4DEYA 2J6FA 3QWYA 2KNBB 2A37A 2VWFA 1WXTA 1UHCA 2D0NA 1X27A 3M0RA 1W1FA 1ZUKA 1N5ZA 2LZ6B 1UECA 2FRYA 1HD3A 2I0NA 5EC7A 2X3WD 4AG1C 2NUZA 2XMFA 2DBKA 1W6XA 2EGAA 5I11A 4RTXA 1GFDA 2DVJA 2LJ3A 2AZSA 1HSQA 2D8JA 2LX7A 2DBMA 2RNAA 4CC7A 1G2BA 1JO8A 1GBQA 1SHFA 1RUWA 2KBTA 2DNUA 4CC4B 1I1JA 2LCSA 5IXBA 2CH4A 4OMLA 1AVZC 1PRMC 1VYUA 1UG1A 3VRZA 1MUZA 2DYBA 2YDLA 3UF4A 2CDTA 1X2KA 4J9BA 2JS2A 3RNJA 2ENMA 2O9SA 1WDXA 1KIKA 2V1QA 5FW9A 1GCQA 1H92A 1BB9A 2EGCA 3UA6A 2FG0A 4ESRA 2FRWA 1AWJA 2YSQA 2DL7A 3UATA 1HJDA 2RMOA 2RQRA 5L23A 1VYTA 1K0XA 1E6GA 4OMPA 2CSQA 2G6FX 3RBBB 2MIOA 1SEMA 1UE9A 2ROLA 2L3QA 2OJ2A 1A0NB 1RLQC 1B3QA 2IIMA 2LQNA 3ZL7C 3TSZA 1GBRA 4OMOA 1PNJA 2DMOA 1MV0B 1AEYA 3JV3A 2L0AA 2LMJA 1AZEA 1IO6A 2DJQA 2RQUA 1X6BA 1NYGA 2QDLA 1UGVA 4AFQC 2FEIA 2O2OA 1XOVA 4Y92A 3M0QA 1WXUA 1G83A 1EFNA 1NLPC 4GBQA 4LNPA 1ARKA 2FPEA 1LCKA 4RTTA 4OMMA 3VS1A 1I07A 2L3SA 4AG2C 2OI3A 2DL3A 3TSWA 3EG0A 1K9AA 2JS0A 1SRLA 3PVQA 1K0SA 2KXDA 4CC2A 2AZVA 2KE9A 1UFFA 2DRMA 4E6RA 3VS2A 2SRCA 2PTKA 2DA9A 1ZUUA 4RUGA 1NYFA 5ECAA 4RTWA 1I0CA 4F17A 1OOTA 1FMKA 1KJWA 1YWOA 2BZXA 1AWWA 1U3OA 2F2WA 3EG2A 2GNCA 4A63B 2E5KA 3C0CA 1WYXA 5IHNA 5FWCA 2BZ8A 3H0FA 4D8KA 1V1CA 2HEQA 1T3SA 1JQQA 3UA7A 4KRTA 1AOJA 1VYVA 1Z9QA 2K2MA 2K79A 2PNIA 4JPBW 1NM7A 2PZ1A 2C0IA 1M3CA 2DLPA 2DX1A 2GQIA 3FJ5A 2BTTA 4D8DA 1ZX6A 2CSIA 2YUOA 3H0IA 4Z8AA 5IXFA 3QWXX 2KYBA 1X2QA 1E6HA 2B86A 2F2VA 2LJ0A 1QWFA 1UJYA 3IQLA 5HCKA 4F16A 1WA7A 4OMQA 2VVKA 2J05A 4JJCA 2AK5A 2AKKA 3M0TA 2DILA 1UTIA 2K3BA 2GTOA 1K1ZA 4JJBA 1ZUYA 2J6KA 2DM1A 2EPDA 1QKXA 1TUCA 2KEAA 1ZLMA 2GTJA 2EVRA 2JM8A 4J9EA 2W10A 4AFZC 2JMCA 1K4US 4ORZA 2FPFA 2ESWA 4AFUC 4F14A 2CT3A 1X43A 1GFCA 3VS4A 2L2PA 3NHNA 3I5SA 2GBQA 1E7OA 4K11A 4RTVA 3REAB 3U23A 2EKHA 2K7AA 3PVLA 2JMAA 2F2XA 1JEGA 1SRMA 4RTZA 2FO0A 1ABQA 2EYWA 3H41A 3VS0A 2A28A 2KXCA 4IIOA 2DL4A 2D8HA 1AWXA 1UUEA 3M0SA 3EHRA 1WXBA 1OPKA 1U06A 2LJ1A 1AWOA 2EGEA 2J06A 3O5ZA 1GCPA 3REBB 1M3BA 2O31A 1W70A 2MOXA 3VS3A 2CH4W 3LH5A 2JW4A 5I22A 2KRMA 1UDLA 1QKWA 1BK2A 2FPDA 1OEBA 1M8MA 1NLOC 1X69A 1Z9ZA 2KYMA 2LP5A 4JJDA 4JZ4A 2M0YA 4IIMA 1RI9A 1GRIA 1UJ0A 3EG3A 3SEMA 1AD5A 2HBWA 1BU1A 2EYXA 1U5SA 1H8KA 2RN8A 1K76A 1PKTA 2YUNA 2CUDA 3M0UA 2EQIA 1TUDA 2LNHB 4ZNXA 2ECZA 1CKBA 4FSSA 1YWPA 2YUPA 5IHIA 3VRYA 2J6OA 4GLMA 2MCNA 2NWMA 3EG1A 1PHTA 1QCFA 4JZ3A 1NG2A 1ZBJA 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFW A;  2JXB A;  1TG0 A;  2EW3 A;  1NEG A;  1SPK A;  1JXO A;  4J9H A;  2K9G A;  4LUE A;  1CKA A;  3THK A;  3KFV A;  1KSW A;  4QT7 A;  4Z88 A;  1M27 C;  2J7I A;  2HCK A;  2A36 A;  5IH2 A;  4HVV A;  1WX6 A;  2YT6 A;  2DE0 X;  3VS6 A;  2W0Z A;  4CC3 A;  1YN8 A;  2JM9 A;  5FWB A;  4RTY A;  1CSK A;  1JXM A;  4HVU A;  4WCI A;  1GL5 A;  3CQT A;  2H8H A;  4LN2 A;  3NMZ C;  2DF6 A;  5IHK A;  1UHF A;  3I5R A;  2JT4 A;  1ABO A;  1FYN A;  2C0T A;  1ZSG A;  2CT4 A;  2ABL A;  1QLY A;  1T0J A;  2D1X A;  3VS5 A;  3H0H A;  1PKS A;  2LQW A;  2VKN A;  3SHW A;  2KR3 A;  1M30 A;  3GBQ A;  5GJV B;  2KT1 A;  3R6N A;  4HCK A;  2JTE A;  4Z89 A;  5GJW B;  3M0P A;  2EYZ A;  1NEB A;  2BZY A;  1AZG B;  4LE9 A;  1PRL C;  1JU5 C;  2ED1 A;  2KT8 A;  1M3A A;  2ROT A;  3PE0 A;  3EHQ A;  2KRO A;  2GGR A;  3NGP A;  2ED0 A;  1Y57 A;  2EYY A;  2DL8 A;  4HXJ A;  1YCS B;  1OPL A;  1YNZ A;  4EIK A;  4J9I A;  2X3X D;  2KRN A;  2RPN A;  3ULR B;  2M51 A;  2RF0 A;  2AKL A;  1PWT A;  4OMN A;  4AFS C;  2DRK A;  1H3H A;  1KFZ A;  1QWE A;  1X6G A;  2O9V A;  3VS7 A;  4R0K A;  4M4Z A;  4LUD A;  2KGT A;  1T0H A;  1WIE A;  2RQT A;  2DL5 A;  4J9F A;  4HVW A;  2P4R A;  2K6D A;  1SSH A;  2A08 A;  3EGU A;  4J9D A;  1BBZ A;  1Y0M A;  2EBP A;  2HDA A;  1WI7 A;  3TVT A;  4RTU A;  1B07 A;  2RQW A;  2RQV A;  2V1R A;  1OV3 A;  3I35 A;  1SHG A;  2KRS A;  2SEM A;  3NPF A;  1VA7 A;  1GCQ C;  2OAW A;  4DEX A;  1RLP C;  1MV3 A;  1S1N A;  3I9Q A;  4X1V A;  2CRE A;  4J9G A;  4J9C A;  2C0O A;  2L3P A;  1J3T A;  2YUQ A;  1WLP B;  1YP5 A;  2HSP A;  2CUB A;  1T3L A;  3A98 A;  4DEY A;  2J6F A;  3QWY A;  2KNB B;  2A37 A;  2VWF A;  1WXT A;  1UHC A;  2D0N A;  1X27 A;  3M0R A;  1W1F A;  1ZUK A;  1N5Z A;  2LZ6 B;  1UEC A;  2FRY A;  1HD3 A;  2I0N A;  5EC7 A;  2X3W D;  4AG1 C;  2NUZ A;  2XMF A;  2DBK A;  1W6X A;  2EGA A;  5I11 A;  4RTX A;  1GFD A;  2DVJ A;  2LJ3 A;  2AZS A;  1HSQ A;  2D8J A;  2LX7 A;  2DBM A;  2RNA A;  4CC7 A;  1G2B A;  1JO8 A;  1GBQ A;  1SHF A;  1RUW A;  2KBT A;  2DNU A;  4CC4 B;  1I1J A;  2LCS A;  5IXB A;  2CH4 A;  4OML A;  1AVZ C;  1PRM C;  1VYU A;  1UG1 A;  3VRZ A;  1MUZ A;  2DYB A;  2YDL A;  3UF4 A;  2CDT A;  1X2K A;  4J9B A;  2JS2 A;  3RNJ A;  2ENM A;  2O9S A;  1WDX A;  1KIK A;  2V1Q A;  5FW9 A;  1GCQ A;  1H92 A;  1BB9 A;  2EGC A;  3UA6 A;  2FG0 A;  4ESR A;  2FRW A;  1AWJ A;  2YSQ A;  2DL7 A;  3UAT A;  1HJD A;  2RMO A;  2RQR A;  5L23 A;  1VYT A;  1K0X A;  1E6G A;  4OMP A;  2CSQ A;  2G6F X;  3RBB B;  2MIO A;  1SEM A;  1UE9 A;  2ROL A;  2L3Q A;  2OJ2 A;  1A0N B;  1RLQ C;  1B3Q A;  2IIM A;  2LQN A;  3ZL7 C;  3TSZ A;  1GBR A;  4OMO A;  1PNJ A;  2DMO A;  1MV0 B;  1AEY A;  3JV3 A;  2L0A A;  2LMJ A;  1AZE A;  1IO6 A;  2DJQ A;  2RQU A;  1X6B A;  1NYG A;  2QDL A;  1UGV A;  4AFQ C;  2FEI A;  2O2O A;  1XOV A;  4Y92 A;  3M0Q A;  1WXU A;  1G83 A;  1EFN A;  1NLP C;  4GBQ A;  4LNP A;  1ARK A;  2FPE A;  1LCK A;  4RTT A;  4OMM A;  3VS1 A;  1I07 A;  2L3S A;  4AG2 C;  2OI3 A;  2DL3 A;  3TSW A;  3EG0 A;  1K9A A;  2JS0 A;  1SRL A;  3PVQ A;  1K0S A;  2KXD A;  4CC2 A;  2AZV A;  2KE9 A;  1UFF A;  2DRM A;  4E6R A;  3VS2 A;  2SRC A;  2PTK A;  2DA9 A;  1ZUU A;  4RUG A;  1NYF A;  5ECA A;  4RTW A;  1I0C A;  4F17 A;  1OOT A;  1FMK A;  1KJW A;  1YWO A;  2BZX A;  1AWW A;  1U3O A;  2F2W A;  3EG2 A;  2GNC A;  4A63 B;  2E5K A;  3C0C A;  1WYX A;  5IHN A;  5FWC A;  2BZ8 A;  3H0F A;  4D8K A;  1V1C A;  2HEQ A;  1T3S A;  1JQQ A;  3UA7 A;  4KRT A;  1AOJ A;  1VYV A;  1Z9Q A;  2K2M A;  2K79 A;  2PNI A;  4JPB W;  1NM7 A;  2PZ1 A;  2C0I A;  1M3C A;  2DLP A;  2DX1 A;  2GQI A;  3FJ5 A;  2BTT A;  4D8D A;  1ZX6 A;  2CSI A;  2YUO A;  3H0I A;  4Z8A A;  5IXF A;  3QWX X;  2KYB A;  1X2Q A;  1E6H A;  2B86 A;  2F2V A;  2LJ0 A;  1QWF A;  1UJY A;  3IQL A;  5HCK A;  4F16 A;  1WA7 A;  4OMQ A;  2VVK A;  2J05 A;  4JJC A;  2AK5 A;  2AKK A;  3M0T A;  2DIL A;  1UTI A;  2K3B A;  2GTO A;  1K1Z A;  4JJB A;  1ZUY A;  2J6K A;  2DM1 A;  2EPD A;  1QKX A;  1TUC A;  2KEA A;  1ZLM A;  2GTJ A;  2EVR A;  2JM8 A;  4J9E A;  2W10 A;  4AFZ C;  2JMC A;  1K4U S;  4ORZ A;  2FPF A;  2ESW A;  4AFU C;  4F14 A;  2CT3 A;  1X43 A;  1GFC A;  3VS4 A;  2L2P A;  3NHN A;  3I5S A;  2GBQ A;  1E7O A;  4K11 A;  4RTV A;  3REA B;  3U23 A;  2EKH A;  2K7A A;  3PVL A;  2JMA A;  2F2X A;  1JEG A;  1SRM A;  4RTZ A;  2FO0 A;  1ABQ A;  2EYW A;  3H41 A;  3VS0 A;  2A28 A;  2KXC A;  4IIO A;  2DL4 A;  2D8H A;  1AWX A;  1UUE A;  3M0S A;  3EHR A;  1WXB A;  1OPK A;  1U06 A;  2LJ1 A;  1AWO A;  2EGE A;  2J06 A;  3O5Z A;  1GCP A;  3REB B;  1M3B A;  2O31 A;  1W70 A;  2MOX A;  3VS3 A;  2CH4 W;  3LH5 A;  2JW4 A;  5I22 A;  2KRM A;  1UDL A;  1QKW A;  1BK2 A;  2FPD A;  1OEB A;  1M8M A;  1NLO C;  1X69 A;  1Z9Z A;  2KYM A;  2LP5 A;  4JJD A;  4JZ4 A;  2M0Y A;  4IIM A;  1RI9 A;  1GRI A;  1UJ0 A;  3EG3 A;  3SEM A;  1AD5 A;  2HBW A;  1BU1 A;  2EYX A;  1U5S A;  1H8K A;  2RN8 A;  1K76 A;  1PKT A;  2YUN A;  2CUD A;  3M0U A;  2EQI A;  1TUD A;  2LNH B;  4ZNX A;  2ECZ A;  1CKB A;  4FSS A;  1YWP A;  2YUP A;  5IHI A;  3VRY A;  2J6O A;  4GLM A;  2MCN A;  2NWM A;  3EG1 A;  1PHT A;  1QCF A;  4JZ3 A;  1NG2 A;  1ZBJ A;  2O88 A; 
#chains in the Genus database with same CATH topology
 3MP6 A;  2JNG A;  1K9M U;  2QQS A;  3V7S A;  3TCJ A;  2E70 A;  4GY5 A;  5D6Y A;  1YI2 A;  5DM7 R;  2QG9 B;  4AMC A;  4DA4 A;  5LJ5 h;  4QKU A;  3MP1 A;  2F5K A;  4QT7 A;  1S72 Q;  4BB7 A;  1IRX A;  1VQP A;  2J7I A;  1WZO A;  4F7U B;  3QKJ A;  3A8H B;  3G4S T;  3VS6 A;  2W0Z A;  3HHT B;  3I56 Q;  2OTL T;  1YN8 A;  1OX8 A;  1G3S A;  1CSK A;  3JCM b;  4XTV A;  1VQK T;  4WCI A;  1GL5 A;  3NTK A;  3CPW A;  1N9R A;  3J80 E;  3NMZ C;  4KGX B;  2DF6 A;  2BIV A;  2FZC B;  4PFP A;  1Q7Y C;  2CT4 A;  2ABL A;  1QLY A;  2EQU A;  3H0H A;  1S72 A;  3SHW A;  2A0F B;  2KDS A;  4FYV B;  2HKQ B;  2KAF A;  1K73 C;  3QJ6 A;  2XK0 A;  4OGE A;  5GJW B;  2DTO A;  3JAM E;  2JTF A;  3DB4 A;  3S3M A;  3FEO A;  5CVI A;  2KK4 A;  3OMC A;  4C5G A;  2NUP B;  2RJC A;  3CPW S;  5D6X A;  4CI0 C;  3RDV A;  3NGP A;  3OQ5 A;  1WHK A;  3OS0 A;  1QP3 A;  1EZZ B;  4PJM A;  1D1B A;  2DL8 A;  1MNE A;  3CEY A;  3CCQ Q;  4J5Y A;  1YNZ A;  4NOY A;  1YJW Q;  2KRN A;  3BW1 A;  3ULR B;  1KC8 C;  2I2L A;  2DXC A;  5GAM f;  1KQS P;  4OMN A;  1BI3 A;  4XTZ A;  3PMT A;  1OUL A;  3VS7 A;  1KK7 A;  4R0K A;  1YHQ Q;  2F1L A;  2DTI A;  2ZAE A;  1WIE A;  2R58 A;  2RQT A;  4HVW A;  3C12 A;  4BI8 B;  1SSH A;  2A08 A;  1BBZ A;  4FYW B;  1KQS S;  2D9T A;  5KYW B;  4MDX A;  4C92 G;  2R5M A;  4RTU A;  3RER A;  3G1J A;  1M90 R;  1PSE A;  1YJW A;  3OSV A;  5GAN f;  1GCQ C;  4DEX A;  1RLP C;  1MV3 A;  1S1N A;  3PFS A;  2ZGW A;  4X1V A;  2K3Y A;  5GMK e;  3M9Q A;  1D1A A;  1YP5 A;  2CUB A;  3H8Z A;  3V8K A;  3GPL A;  3X20 B;  1T3L A;  1YHQ A;  3GNG A;  4DOV A;  4DEY A;  2CS7 A;  1M9S A;  1BCM A;  4X9D A;  4C8Q D;  4E7H A;  2DK3 A;  1ZHI A;  4KUI A;  5KCH A;  3RIR A;  1W1F A;  1ZUK A;  5IAY A;  2GFU A;  2LZ6 B;  1M90 U;  2FB7 A;  2NLU A;  5EC7 A;  3CCR Q;  2X3W D;  4AG1 C;  2DBK A;  1BI0 A;  2QEX Q;  2EGA A;  9ATC B;  3ME9 A;  4EMH A;  2AZS A;  3CBO A;  2L5Q A;  1GBQ A;  1SHF A;  4CC4 B;  2DNU A;  3OYI A;  1I1J A;  4M7A B;  1PC0 A;  5CKH A;  3A8L B;  2XD0 A;  3VRZ A;  5GMK i;  1MUZ A;  3LYI A;  2EJ9 A;  3CCS Q;  2DYB A;  3UF4 A;  3RUX A;  4A4E A;  4P5N A;  4J9B A;  2Z0W A;  4M7D B;  3RNJ A;  5GAM g;  2ENM A;  1WDX A;  3QPH A;  1VQ5 T;  4PLL A;  3CMA T;  5FW9 A;  1GCQ A;  1BB9 A;  2EGC A;  2FG0 A;  3TEE A;  4BY6 B;  4ESR A;  5FLX E;  2CP7 A;  3P8B B;  1QMC A;  4XU3 A;  1AWJ A;  2QGF B;  2XKO C;  2RMO A;  2O01 E;  4OVA A;  3QYG B;  3CCV T;  2LVM A;  1G3T A;  4OMP A;  3MEW A;  1OU8 A;  3RBB B;  2JOY A;  3DLM A;  3HL8 A;  7AT1 B;  4OP0 A;  5KYW A;  2F69 A;  1SF9 A;  2HQX A;  2E3I A;  2L3Q A;  2Y90 A;  1A0N B;  3MEA A;  3S3N A;  1ACM B;  2FHD A;  4ZTJ A;  5GAN g;  2VB6 A;  3C4S A;  4BY6 C;  5LJ3 j;  4EMK C;  1W2B P;  3VUB A;  2WAC A;  3JCM W;  8AT1 B;  3CC4 T;  1N27 A;  3L42 A;  3M56 A;  1N8R R;  4Y92 A;  3L2V A;  1G83 A;  4GBQ A;  3X24 B;  2L8D A;  4M78 F;  2P4T A;  3CME Q;  4AG2 C;  1UGR B;  4KGZ B;  4C0F A;  1TOV A;  1I4K 1;  1K9A A;  1RAC B;  4E7I A;  4CC2 A;  4C92 E;  2AZV A;  1UFF A;  3DB3 A;  1PSF A;  4E6R A;  3CCU T;  5GAM d;  4M7A A;  2SRC A;  1UEB A;  1N8R U;  5A2Q E;  1FMK A;  4N4G A;  1VQL Q;  2QDY B;  2DVE A;  1AWW A;  1NE8 A;  4M7D A;  2GNC A;  3N5B B;  4KUD K;  4CRI A;  2BZ8 A;  3JCM V;  5EG2 A;  3CME A;  2HEQ A;  1T3S A;  1JQQ A;  2Y4X A;  3RKW A;  3G71 T;  3CCJ Q;  2K79 A;  4JPB W;  2FZG B;  4C92 F;  2QK0 A;  2DLP A;  2DX1 A;  2GQI A;  5GAN d;  3JB9 G;  4O6J A;  1VIE A;  1D3B A;  5IXF A;  1X01 A;  2EQK A;  3RKY A;  4MZT A;  1UJY A;  3CCL Q;  1VQL A;  1VQ8 T;  3EAE A;  2AK5 A;  5KYY A;  2AKK A;  4LDY A;  3OYH A;  2DIL A;  2YWW A;  2QA4 T;  3A8G B;  4R55 A;  1K1Z A;  4JJB A;  1ZUY A;  2J6K A;  4PJO F;  4BE2 A;  3ZFJ A;  1QKX A;  2G3R A;  1RAI B;  3CCJ A;  2EVR A;  4AFZ C;  3JCM P;  2BUD A;  4E7S A;  1ZA1 B;  3OYK A;  4ORZ A;  1BCO A;  2ESW A;  4F14 A;  1XTD A;  4KGV B;  2BE7 D;  2X9H A;  3KUF A;  3CCE Q;  1RAA B;  3CCL A;  5LJ5 g;  3PVL A;  1V76 A;  2K2V A;  1IZ6 A;  1M1F A;  4JRI A;  3CD6 Q;  2DJZ A;  1RAG B;  2EYW A;  5KE2 A;  3M4Y A;  2A28 A;  1VOM A;  4BDY A;  2DL4 A;  2ZPF B;  1AWX A;  1UUE A;  4J6X A;  3A8M B;  2LQK A;  3M0S A;  4C8Q B;  1OPK A;  2R57 A;  2OX7 A;  1AWO A;  2EGE A;  1M4Z A;  5KYX B;  1M3B A;  2RO0 A;  2O31 A;  5GAM e;  2KSS A;  3CCE A;  1XQH A;  4IUV A;  1FMW A;  2HD0 A;  3GOX A;  1U1S A;  1QKW A;  1BK2 A;  2XHC A;  2COZ A;  3CD6 A;  1KD1 R;  2E41 A;  4FT4 A;  4M78 C;  1YJ9 T;  1UJ0 A;  3CCM Q;  3SEM A;  4ME7 A;  2K4Y A;  1H8K A;  1K76 A;  2RHU A;  1IHV A;  2EQI A;  1SKU B;  1QVG P;  1WQ7 A;  4FSS A;  5GAN e;  2KMT A;  2J6O A;  4XTU A;  4GLM A;  1KD1 U;  3HRT A;  1LVK A;  1ZBJ A;  2RB6 A;  4ANJ A;  4E2F B;  2V8J A;  4YTL A;  1VQN T;  5LJ5 d;  1JXO A;  4J9H A;  1QVG S;  1H64 1;  1CKA A;  1LNX A;  2KY9 A;  4Z88 A;  1M27 C;  3WVE B;  2IG0 A;  1WX6 A;  1U1T A;  2DE0 X;  4CC3 A;  4M75 D;  1YJN Q;  3JB9 J;  1VQM Q;  4RKU E;  2DD5 A;  3CBM A;  4M78 A;  3CQT A;  1G3Y A;  4C8Q A;  4LN2 A;  5KYU B;  3GP8 A;  4IUP A;  1QVF A;  4C0Z A;  4F7U F;  3I5R A;  3X26 B;  2JT4 A;  2QQ9 A;  1ABO A;  1FYN A;  4JRK A;  1Q81 C;  2YLC A;  2GFA A;  4PJO C;  1VQ4 T;  2E6N A;  5KYX A;  4L5G A;  2LTO A;  2VKN A;  4N0A C;  3V8L A;  2LNV A;  2HZY A;  4Y91 A;  1QVP A;  1YBY A;  2KT1 A;  2L3R A;  3JB9 F;  3M0P A;  1OQK A;  1RL2 A;  1TSF A;  2K57 A;  2BZY A;  1AZG B;  1RI0 A;  1I5O B;  4IKF A;  2KT8 A;  2PU9 B;  1M3A A;  2GF7 A;  2KRO A;  1YIJ Q;  2IVW A;  4ELY C;  1Y57 A;  2EYY A;  3KBG A;  3OA6 A;  1QVF S;  4HXJ A;  2OTJ Q;  4FYY B;  1Q82 R;  1TU0 B;  4FSX A;  1K9M C;  3OW2 P;  2RF0 A;  3A1P A;  3H9N A;  3UT1 A;  1VQO T;  1SSF A;  1QCO A;  3HTR A;  2DRK A;  2K5I A;  1KFZ A;  2KQW A;  3VUZ A;  1QWE A;  2O9V A;  1T0H A;  1JJ2 P;  5GAN 6;  3M59 A;  4J9F A;  1Q82 U;  5GMK l;  4PJO A;  1YIJ A;  2K6D A;  3QHS A;  3EGU A;  4J9D A;  1Y0M A;  2DXB A;  1UGQ B;  4N0A A;  2EBP A;  1YIT Q;  2OTJ A;  2AIR B;  3CC2 Q;  2RQW A;  2RQV A;  3FLG A;  1OV3 A;  5J26 A;  1SHG A;  2KRS A;  2SEM A;  1VA7 A;  1QQJ A;  1M8V A;  2VC8 A;  2L3P A;  5LJ3 f;  4PK4 A;  5KYU A;  3RKX A;  1YI2 T;  2ZCF B;  2D6F A;  4M77 D;  2CZ0 B;  2X51 A;  2ZPI B;  2J6F A;  3QWY A;  3EFO B;  1NZ9 A;  5IT9 E;  4OF1 A;  4F04 B;  1VQP T;  1RAB B;  2EKO A;  1TH7 A;  1Q86 R;  4C0D C;  1HK9 A;  2I0N A;  3CC2 A;  2NUZ A;  2OTL Q;  4OB2 B;  5I11 A;  4M7A E;  4FM4 B;  3FC3 A;  4XU0 A;  5A0L A;  2DVJ A;  1NJI R;  1MND A;  2LX7 A;  2MF2 A;  2LT1 A;  1G2B A;  1JO8 A;  5C6S A;  2DIQ A;  1RUW A;  2KBT A;  4XTW A;  3PIP A;  5IXB A;  1OYX A;  1YFN A;  1WHJ A;  1AVZ C;  4M7D E;  1Q86 U;  4C0G A;  1B7T A;  1S72 T;  2NYS A;  1X2K A;  2CP3 A;  2JS2 A;  3EGD B;  1NJI U;  2OTL A;  2XI9 A;  5GAN 4;  2WSF E;  2MAM A;  4OGC A;  5D6W A;  4M7A F;  2FRW A;  3I56 A;  1M2V B;  1I81 A;  2DL7 A;  2RQR A;  3OYM A;  3QSU A;  2NUT B;  3R6O A;  4M78 G;  1K0X A;  5IN1 A;  1TUG B;  2CSQ A;  2CP0 A;  2DZC A;  1KQS A;  4M7D F;  1SEM A;  1VQ6 Q;  2ROL A;  3ER0 A;  3JCM f;  3CPF A;  2IIM A;  2LQN A;  4ZGE B;  1D1C A;  3HPW A;  2OAU A;  2DMO A;  5HK0 A;  1MV0 B;  1AEY A;  2H3E B;  2DTH A;  2LMJ A;  1AZE A;  5GMK j;  2YLB A;  3OYJ A;  5FU7 B;  2P0P A;  4ZN3 A;  3NTH A;  1M90 C;  4L6V 5;  5D7U A;  4XU2 A;  2FEI A;  1XOV A;  3AHU A;  3OYY A;  3EH1 A;  2P0Q A;  5GAO l;  1ARK A;  1VQ6 A;  1GXI E;  4F7U A;  4M75 B;  1YJW T;  4RTT A;  3T9N A;  3CCQ A;  2X4J A;  2A3L A;  3TSW A;  1EIF A;  2JS0 A;  2YRV A;  1MGQ A;  1YHQ T;  1MMG A;  3X25 B;  1ZBX A;  2DRM A;  1DJ7 B;  1PD0 A;  5ECA A;  3SDZ A;  3MEV A;  3OYG A;  1JRI A;  1KJW A;  4PJO G;  1YWO A;  2BZX A;  4HCZ A;  2YRC A;  3EGD A;  4RCB A;  1TS9 A;  2RHZ A;  1IB8 A;  3L2W A;  1R77 A;  1WYX A;  4LD9 K;  3H0F A;  3I55 Q;  3M55 A;  1V1C A;  2EWN A;  2QXF A;  1M2V A;  1AOJ A;  1VYV A;  1KQ2 A;  2K2M A;  3UWN A;  2NUT A;  3MET A;  1NM7 A;  2C0I A;  2VGM A;  4ZTF A;  3EFS A;  2JN0 A;  1VQ7 Q;  2NUP A;  2CSI A;  2COW A;  4J6Y A;  4J8O A;  3L1A A;  5J39 A;  1VUB A;  5GAN 3;  3JRZ A;  2DZ9 A;  1E6H A;  2B86 A;  2DEQ A;  2F2V A;  2LJ0 A;  3IQL A;  5HCK A;  4F16 A;  3BDL A;  2BKD N;  2VVK A;  2PVG B;  2QQB A;  2GTO A;  3CCR A;  2FL7 A;  2DXT A;  2ZPB B;  3I55 A;  1LOJ A;  2QEX A;  2DM1 A;  3FJP A;  2CZ7 B;  3GIB A;  1G8X A;  3CCV Q;  3FRN A;  2JMC A;  3FB9 A;  2MWP A;  4FU6 A;  4M7A C;  1VQ7 A;  3OS2 A;  5KYN A;  1X43 A;  3D7S B;  1GFC A;  1D0X A;  4C92 D;  3NHN A;  3CCS A;  3MJX A;  1E7O A;  4M78 E;  1W2B A;  3REA B;  3U23 A;  3J81 E;  2JMA A;  4C8Q E;  2HAX A;  4M7D C;  5J3B A;  1SRM A;  3WXM B;  1ABQ A;  4M77 B;  2CZ6 B;  3VS0 A;  2KXC A;  3WVD B;  2D8H A;  1WXB A;  1U06 A;  3M4G A;  2RI3 A;  1BIB A;  4VUB A;  1I5L A;  1M1G A;  4A53 A;  5KE3 A;  2HL5 C;  4JRQ A;  4IUR A;  2CH4 W;  5CK9 A;  2JW4 A;  2R5A A;  2VXF A;  5AYF A;  4A4H A;  3URG A;  4C8Q F;  1W2B S;  2JZ2 A;  4M77 C;  4HCC A;  2DER A;  2KYM A;  2LP5 A;  4JZ4 A;  2M0Y A;  3X28 B;  3SWN B;  3JB9 H;  2P84 A;  1BU1 A;  2HBW A;  2EYX A;  2RN8 A;  4J6W A;  5GAN 2;  1NPR A;  1TUD A;  2LNH B;  1CKB A;  1D0Y A;  5IHI A;  4IUU A;  5CO7 A;  3JCM Q;  4F7U G;  3MEU A;  3CME T;  1ZSZ B;  2NWM A;  5FU6 B;  2XG8 D;  1WHM A;  1NG2 A;  5LJ3 e;  3NFC A;  3G71 Q;  3PGG A;  1AT1 B;  4PJO E;  2JXB A;  3MHX A;  1FXX A;  3RMQ A;  1NEG A;  8ATC B;  3A8O B;  2V8K A;  2CP5 A;  5AT1 B;  2K9G A;  4LUE A;  3THK A;  1VQL T;  2O4X B;  2LRQ A;  2HCK A;  5IH2 A;  1RAD B;  5LJ3 h;  3S3O A;  5CCA A;  4FW2 A;  1ZSZ C;  2DPP B;  5FU6 C;  4FYX B;  1BIA A;  4RTY A;  4M77 A;  3CCJ T;  2PVD B;  3J7A F;  2M1H A;  5IHK A;  2C0T A;  1ZSG A;  4PJJ A;  1FWZ A;  1T0J A;  3VS5 A;  5HKC A;  1PKS A;  2LQW A;  3CCL T;  1M1K R;  5GAM j;  3QZ5 B;  3OYE A;  2RA2 A;  3JCM c;  3INZ A;  3GBQ A;  5GJV B;  2FVU A;  1C0M A;  2JTE A;  4HCK A;  4Z89 A;  2DXU A;  2EYZ A;  4LE9 A;  1PRL C;  1RAF B;  2QAZ A;  2RH2 A;  2HNI A;  3SWN A;  1JU5 C;  3EHQ A;  2GGR A;  2RK1 A;  3OY9 A;  1M1K U;  1KD1 C;  2M02 A;  1YCS B;  3JCM e;  3CCE T;  1OPL A;  2AHJ B;  5GAN j;  4J9I A;  2RPN A;  3O8V A;  1ZSZ A;  2AKL A;  3CD6 T;  1PWT A;  4ELZ C;  1Q95 G;  3M57 A;  2MYS A;  4AFS C;  3OYA A;  2EJG A;  1H3H A;  4IUT A;  3JSC A;  2F5T X;  3QJY A;  4II1 A;  4M4Z A;  2MWO A;  1HYO A;  5LL6 S;  1QVG A;  2KGT A;  3JB9 D;  4C8Q C;  3JCM h;  3JB9 I;  2P4R A;  4OB0 B;  1R0B G;  2XDB A;  2O4X A;  4MML A;  3MO8 A;  1WI7 A;  3TQ7 P;  2EJF A;  1B07 A;  3UPU A;  3I35 A;  3NPF A;  2K5L A;  4NL2 A;  4DOW A;  3I9Q A;  1J3T A;  2HSP A;  5CQX A;  2QTV A;  1X75 C;  3A98 A;  3ZBD A;  4F7U E;  1B34 B;  2XDP A;  4J7F A;  2D0N A;  1X27 A;  1JBM A;  3CCM A;  4RG2 A;  4M7A G;  1EX4 A;  3MKD A;  3MPU B;  2FRY A;  1HD3 A;  4LDV A;  4QQG A;  3OS5 A;  4MZM A;  3OBW A;  4M7D G;  4RTX A;  1WNL A;  3OYD A;  1HSQ A;  2D8J A;  2QQA A;  2DBM A;  2RNA A;  3G6E Q;  2M16 A;  4JLI A;  1IHW A;  5GAN 7;  4OML A;  3F70 A;  1PRM C;  4NS5 A;  2YDL A;  3V8J A;  4PL6 A;  1KHC A;  3CC7 Q;  1OI1 A;  2E5Q A;  1Y96 B;  2O9S A;  3A5Z B;  4JJN K;  2MK5 A;  1H92 A;  3UA6 A;  4C5E A;  5CQY A;  4B6M A;  4LD6 A;  1Q82 C;  4BE1 A;  1VIF A;  1VQ9 Q;  2YSQ A;  4M77 G;  1YJN A;  2H3J A;  3G6E A;  3S6W A;  2HMA A;  3ASK A;  4RG8 A;  2PUK B;  1VQM A;  2XU8 A;  1E6G A;  2LCC A;  6AT1 B;  1V29 B;  4XTY A;  3CXC P;  3PMI A;  3OW2 A;  2CYZ B;  3LWH A;  2AT1 B;  2X35 A;  4Y28 E;  2OJ2 A;  4ZN1 A;  5LJ5 j;  3CC7 A;  1B3Q A;  4J7I A;  1GBR A;  4OMF B;  1M5Q 1;  1JJ2 A;  4XQ3 A;  3JV3 A;  3TU4 K;  2L0A A;  4A54 A;  2E12 A;  3KXT A;  3RES A;  1K8A R;  4TVR A;  3OMG A;  2XIC A;  2M9U A;  2DJQ A;  1LPL A;  2RQU A;  2RM4 A;  1VQ9 A;  5GAO q;  1YIJ T;  2QDL A;  4AFQ C;  4E47 A;  4LDX A;  2OTJ T;  3PTA A;  3OS1 A;  1EFN A;  4LNP A;  3OW2 S;  2QGG A;  4WF2 A;  2VYT A;  4OMM A;  3VS1 A;  5L8R E;  1I07 A;  3C95 A;  2D0Q B;  1K8A U;  3LWI A;  1I8F A;  1YI2 Q;  1Q86 C;  1JJ2 S;  1K0S A;  2KXD A;  2DO3 A;  5DLO A;  3VS2 A;  2DA9 A;  3H6Z A;  4QQD A;  1ZUU A;  2B8A A;  3HP9 A;  3LLR A;  1NYF A;  4M75 F;  1MMD A;  1I0C A;  4MZP A;  1OX9 A;  1OOT A;  2EFI A;  2HSE B;  2DEU A;  1MMN A;  3CC2 T;  2F2W A;  1QP2 A;  2EYQ A;  3VYG A;  2VV5 A;  2ZZD A;  1UGS B;  1Y96 A;  1C6V X;  2E5K A;  4A63 B;  1YIT A;  1HXD A;  3G4S Q;  5IHN A;  5FWC A;  1WJQ A;  4PJN A;  3QDF A;  3L2Z A;  4D8K A;  1G3W A;  3TRE A;  1D09 B;  1QW1 A;  1VQK Q;  4KRT A;  3GLX A;  2E1H A;  2LCL A;  3PNW C;  2PZ1 A;  2ZPG B;  1M3C A;  2DD4 A;  2MMP A;  2YUO A;  4PKC C;  4X9C A;  3H0I A;  3PIO A;  4QW2 A;  3QWX X;  2KYB A;  4N4H A;  1Y71 A;  1QWF A;  4Q5W A;  4OMQ A;  2E65 A;  1UB4 A;  2HKN A;  3G4S A;  2XDD A;  3I56 T;  4FL6 A;  1BI1 A;  4NL3 A;  2QAS A;  4AT1 B;  2EPD A;  1PG5 B;  3E2U A;  1VQK A;  2KEA A;  4ATO A;  1ZLM A;  1WHH A;  2JM8 A;  3FIF A;  3OSS C;  5CKB A;  4OB3 B;  1K4U S;  2FPF A;  4C8Q G;  3CPW P;  3HRU A;  2DAQ A;  2M0O A;  3VS4 A;  2L2P A;  3Q1J A;  4M77 E;  2DKG A;  2GBQ A;  3JCM J;  2DYI A;  4K11 A;  4RTV A;  1XNI A;  2EKH A;  4JDS A;  1AHJ B;  2JTM A;  4LXC A;  1Q7Y R;  1BYM A;  4RTZ A;  2FO0 A;  4PLI A;  4WTO B;  5LJ3 g;  2YRD A;  2E64 A;  3EHR A;  3LW5 E;  2HQE A;  2A7Y A;  1RAE B;  1JB0 E;  4RCC A;  4BDZ A;  1K73 R;  3LX7 A;  2DIG A;  3LH0 A;  4JLG A;  3EFO A;  1VQ6 T;  4FT2 A;  3REB B;  2MOX A;  3CCQ T;  3VS3 A;  3QXE B;  4M77 F;  5GAO r;  1Q7Y U;  2EQM A;  2FZK B;  3EGX B;  1M2O A;  2FPD A;  1OEB A;  3SFM A;  1M8M A;  1X69 A;  1Z9Z A;  2EAY A;  1KG1 A;  4R56 A;  4IIM A;  1K73 U;  4QQ6 A;  1RAH B;  1RI9 A;  1KHI A;  1KC8 R;  5FU7 C;  1WQW A;  1U5S A;  2LT4 A;  4KH0 B;  3OYC A;  1QCN A;  3PT9 A;  1PKT A;  2CUD A;  4GLK A;  4B9W A;  2RHX A;  5KCO A;  1PM3 A;  3QBY A;  2QQR A;  1R8O B;  3VRY A;  2RJD A;  4M75 C;  2O88 A;  4BI4 A;  3NTI A;  1WFW A;  1TG0 A;  4FCY A;  1KC8 U;  2EW3 A;  4M78 D;  3OBY A;  5GAN 8;  5GAO p;  1SPK A;  1ZQ1 A;  1WHL A;  4XTX A;  3AT1 B;  1WJR A;  3KFV A;  1KSW A;  2GCX A;  2VUB A;  2A36 A;  5LJ3 d;  4HVV A;  4PFO A;  5GMK h;  2YT6 A;  3JCM g;  5A0D A;  2RHI A;  3CMA Q;  1VQ5 Q;  3CCR T;  4MDW A;  2JUF A;  2JM9 A;  3G7Z A;  3I55 T;  5FWB A;  2QEX T;  4HT9 A;  1JXM A;  4HVU A;  4V2S A;  2H8H A;  3GF5 A;  2P0K A;  1UHF A;  1VQ7 T;  2ZPE B;  2CP6 A;  4C5I A;  4O5V A;  3CCS T;  2D1X A;  3P8D A;  1NPP A;  4KH1 B;  2KR3 A;  1M30 A;  2PVO B;  4BE0 A;  2XID A;  2VAS A;  4M75 A;  3EGX A;  4Z02 A;  1O9S A;  1UGP B;  3R6N A;  3OYF A;  3CMA A;  1VQ5 A;  4EMK B;  2RHY A;  4HA8 A;  1NEB A;  1N8R C;  2ED1 A;  2X4Y A;  2RJE A;  4XAX B;  2ROT A;  3PE0 A;  2DET A;  3VKI A;  5CKE A;  2ED0 A;  5KH6 A;  3CC4 Q;  1D3B B;  2X4W A;  4A4K A;  3CCV A;  4E7K A;  4PJO D;  2KVQ G;  3HFN A;  4JS4 A;  5KYY B;  4EIK A;  2X3X D;  3HKS A;  2M51 A;  2KI7 A;  2BE9 B;  1ZA2 B;  5DY9 A;  4EMG A;  1X6G A;  4JUV A;  4LUD A;  3M5A A;  3CCU Q;  3JCM d;  2YHT A;  4DBH A;  2DL5 A;  2E6Z A;  3CC4 A;  3JCM X;  1XJW B;  2HDA A;  3TVT A;  3EH2 A;  1PCX A;  5LJ5 f;  2VGN A;  2K3X A;  2V1R A;  2LX9 A;  2OAW A;  3ZEH A;  4HT8 A;  2CRE A;  4J9G A;  4J9C A;  2C0O A;  2YUQ A;  4DBR A;  1WLP B;  2HQH A;  3OB9 A;  2LDM A;  1YCY A;  1OU9 A;  3SWN C;  1FX7 A;  2KNB B;  3CCU A;  2A37 A;  2VWF A;  2EQJ A;  1WXT A;  1UHC A;  4LDU A;  3M0R A;  2IPO B;  1WJS A;  4XU1 A;  1N5Z A;  1UEC A;  5I2S A;  5CKF A;  2FYK A;  4E7Z A;  1VQ8 Q;  5DLQ E;  1H3Z A;  2XMF A;  5M9O A;  4DBF A;  2QA4 Q;  1W6X A;  4EMK A;  5FRM A;  5CR2 A;  1GFD A;  2LJ3 A;  2MPX C;  4CC7 A;  4X34 A;  1M1K C;  2CZ1 B;  3BDU A;  3RR6 A;  1P92 A;  3G71 A;  2LCS A;  2CH4 A;  1VYU A;  1UG1 A;  1N6A A;  1BI2 A;  1MHN A;  4ZGD B;  2CDT A;  4PNO A;  5GAO n;  4UC4 A;  2K5F A;  2RD1 A;  1KIK A;  2V1Q A;  1VQ8 A;  1Y07 A;  3E9G A;  2E3H A;  5HK3 A;  2QA4 A;  3QG1 A;  5C0M A;  2VXE A;  4PFZ A;  1HJD A;  3UAT A;  1TXQ A;  5L23 A;  1VYT A;  4E7J A;  1NBE B;  2X4X A;  3SB2 A;  2G6F X;  3M53 A;  2MIO A;  3QII A;  1U8R A;  1UE9 A;  4D6W A;  3C94 A;  2V26 A;  1RLQ C;  3ZL7 C;  3TSZ A;  4OMO A;  1PNJ A;  1C1A A;  4M75 G;  5GMK m;  4M78 B;  1Y7X A;  1FMV A;  1MMA A;  1IO6 A;  1WGS A;  1YJ9 Q;  4QVZ A;  1IGU A;  1X6B A;  4A4F A;  5FRO A;  4KUL A;  2GQV A;  4RMO A;  1NYG A;  1UGV A;  2V8I A;  4N4I A;  2O2O A;  1SG5 A;  1WXU A;  3M0Q A;  1NLP C;  3QDR B;  2JVV A;  2HL3 A;  4C5H A;  3BE3 A;  4BI3 A;  2FPE A;  3EG9 B;  2JJ9 A;  1LCK A;  4XK8 E;  4EDU A;  1WPY A;  1W4S A;  4IUQ A;  1OZ3 A;  2L3S A;  3P8H A;  2OI3 A;  2DL3 A;  2LQ8 A;  5FRN A;  3QO3 A;  3SD4 A;  3EG0 A;  4BAC A;  1SRL A;  3PVQ A;  3VYH B;  1WHG A;  3LGF A;  3VU3 C;  2KE9 A;  3VJP A;  1IRE B;  1YJ9 A;  3OYL A;  1VQN Q;  2WSE E;  2CP2 A;  2PTK A;  4B9X A;  5GAM h;  3CCM T;  5A0G A;  4RUG A;  4RTW A;  4HCB A;  5CAI A;  4F17 A;  2CGH A;  4C92 B;  1BKB A;  2QTX A;  4EPC A;  1U3O A;  1G5V A;  2MI6 A;  3EG2 A;  2QI2 A;  4L59 A;  1R0C B;  3C0C A;  2PQW A;  3LGL A;  4BD3 A;  3UA7 A;  2E4H A;  1Z9Q A;  3M58 A;  2PNI A;  2RI5 A;  4FW1 A;  3CBP A;  4JRP A;  2L89 A;  2ZPH B;  3FJ5 A;  2BTT A;  3EFR A;  4D8D A;  4PJO B;  1ZX6 A;  5GAN h;  1VQN A;  3QZ9 B;  4Z8A A;  4OB1 B;  1VQ4 Q;  1IGQ A;  3M54 A;  4C92 C;  1X2Q A;  2RK2 A;  2COY A;  2WSC E;  4HKE A;  1WA7 A;  2J05 A;  4JJC A;  3M0T A;  1UTI A;  2K3B A;  3BY7 A;  5CKD A;  3RMS A;  2C06 A;  2EIF A;  3CXC A;  1OZ2 A;  2LC4 A;  3V7R A;  1O75 A;  4DBQ A;  3G6E T;  1YJN T;  1VQM T;  1IXD A;  1TUC A;  5HY6 A;  2DFU A;  2RJF A;  3GNF B;  4DQ2 A;  2GTJ A;  4JS5 A;  5I2M A;  4J9E A;  2W10 A;  4J83 A;  5CIU A;  4AFU C;  2CT3 A;  4LDW A;  3E19 A;  1K8A C;  3MCA B;  1VQ4 A;  3EG9 A;  3CC7 T;  3I5S A;  1QVF P;  1F1B B;  4KBM B;  5GAN 5;  2YXY A;  2K7A A;  4BUG A;  3L2U A;  2F2X A;  1JEG A;  1Q81 R;  2QYZ A;  1VQO Q;  3H41 A;  3DKM A;  4A4G A;  1VQ9 T;  5GAO m;  4IIO A;  1N9S A;  3CXC S;  3QUI A;  4QVC A;  1TWB A;  4PJL A;  3UDC A;  2LJ1 A;  3HSB A;  1B34 A;  4M75 E;  2J06 A;  3E1S A;  3O5Z A;  4C92 A;  4M7A D;  1D0Z A;  1GCP A;  3E9F A;  3L2Q A;  2CKK A;  2PUO B;  1W70 A;  5I21 A;  1Q81 U;  3LH5 A;  5I22 A;  2KRM A;  2ATC B;  1UDL A;  4KT0 E;  2E10 A;  4M7D D;  1X6O A;  3FDR A;  1NLO C;  1VQO A;  2RI2 A;  3VV0 A;  4JJD A;  1KQ1 A;  1GRI A;  1K9M R;  3EG3 A;  4QVD A;  4MMK A;  1AD5 A;  3DLL A;  4E7L A;  2YUN A;  1VQP Q;  2Y4Y A;  4C0D B;  3OYN A;  1PD1 A;  1LJO A;  3M0U A;  1NJI C;  5LJ5 e;  3MP8 A;  4ZGJ B;  4ZNX A;  1YIT T;  2ECZ A;  2HBP A;  1TTH B;  1YWP A;  2YUP A;  3OYB A;  3HRS A;  2MCN A;  3QYH B;  3EG1 A;  1PHT A;  1QCF A;  4JZ3 A;  3BFM A;  4FIB A;  3L2R A;  3V7C A;  3HFO A; 
#chains in the Genus database with same CATH homology
 1WFW A;  2JXB A;  1TG0 A;  2EW3 A;  1NEG A;  1SPK A;  1JXO A;  4J9H A;  2K9G A;  4LUE A;  1CKA A;  3THK A;  3KFV A;  1KSW A;  4QT7 A;  4Z88 A;  1M27 C;  2J7I A;  2HCK A;  2A36 A;  5IH2 A;  4HVV A;  1WX6 A;  2YT6 A;  2DE0 X;  3VS6 A;  2W0Z A;  4CC3 A;  1YN8 A;  2JM9 A;  5FWB A;  4RTY A;  1CSK A;  1JXM A;  4HVU A;  4WCI A;  1GL5 A;  3CQT A;  2H8H A;  4LN2 A;  3NMZ C;  2DF6 A;  5IHK A;  1UHF A;  3I5R A;  2JT4 A;  1ABO A;  1FYN A;  2C0T A;  1ZSG A;  2CT4 A;  2ABL A;  1QLY A;  1T0J A;  2D1X A;  3VS5 A;  3H0H A;  1PKS A;  2LQW A;  2VKN A;  3SHW A;  2KR3 A;  1M30 A;  3GBQ A;  5GJV B;  2KT1 A;  3R6N A;  4HCK A;  2JTE A;  4Z89 A;  5GJW B;  3M0P A;  2EYZ A;  1NEB A;  2BZY A;  1AZG B;  4LE9 A;  1PRL C;  1JU5 C;  2ED1 A;  2KT8 A;  1M3A A;  2ROT A;  3PE0 A;  3EHQ A;  2KRO A;  2GGR A;  3NGP A;  2ED0 A;  1Y57 A;  2EYY A;  2DL8 A;  4HXJ A;  1YCS B;  1OPL A;  1YNZ A;  4EIK A;  4J9I A;  2X3X D;  2KRN A;  2RPN A;  3ULR B;  2M51 A;  2RF0 A;  2AKL A;  1PWT A;  4OMN A;  4AFS C;  2DRK A;  1H3H A;  1KFZ A;  1QWE A;  1X6G A;  2O9V A;  3VS7 A;  4R0K A;  4M4Z A;  4LUD A;  2KGT A;  1T0H A;  1WIE A;  2RQT A;  2DL5 A;  4J9F A;  4HVW A;  2P4R A;  2K6D A;  1SSH A;  2A08 A;  3EGU A;  4J9D A;  1BBZ A;  1Y0M A;  2EBP A;  2HDA A;  1WI7 A;  3TVT A;  4RTU A;  1B07 A;  2RQW A;  2RQV A;  2V1R A;  1OV3 A;  3I35 A;  1SHG A;  2KRS A;  2SEM A;  3NPF A;  1VA7 A;  1GCQ C;  2OAW A;  4DEX A;  1RLP C;  1MV3 A;  1S1N A;  3I9Q A;  4X1V A;  2CRE A;  4J9G A;  4J9C A;  2C0O A;  2L3P A;  1J3T A;  2YUQ A;  1WLP B;  1YP5 A;  2HSP A;  2CUB A;  1T3L A;  3A98 A;  4DEY A;  2J6F A;  3QWY A;  2KNB B;  2A37 A;  2VWF A;  1WXT A;  1UHC A;  2D0N A;  1X27 A;  3M0R A;  1W1F A;  1ZUK A;  1N5Z A;  2LZ6 B;  1UEC A;  2FRY A;  1HD3 A;  2I0N A;  5EC7 A;  2X3W D;  4AG1 C;  2NUZ A;  2XMF A;  2DBK A;  1W6X A;  2EGA A;  5I11 A;  4RTX A;  1GFD A;  2DVJ A;  2LJ3 A;  2AZS A;  1HSQ A;  2D8J A;  2LX7 A;  2DBM A;  2RNA A;  4CC7 A;  1G2B A;  1JO8 A;  1GBQ A;  1SHF A;  1RUW A;  2KBT A;  2DNU A;  4CC4 B;  1I1J A;  2LCS A;  5IXB A;  2CH4 A;  4OML A;  1AVZ C;  1PRM C;  1VYU A;  1UG1 A;  3VRZ A;  1MUZ A;  2DYB A;  2YDL A;  3UF4 A;  2CDT A;  1X2K A;  4J9B A;  2JS2 A;  3RNJ A;  2ENM A;  2O9S A;  1WDX A;  1KIK A;  2V1Q A;  5FW9 A;  1GCQ A;  1H92 A;  1BB9 A;  2EGC A;  3UA6 A;  2FG0 A;  4ESR A;  2FRW A;  1AWJ A;  2YSQ A;  2DL7 A;  3UAT A;  1HJD A;  2RMO A;  2RQR A;  5L23 A;  1VYT A;  1K0X A;  1E6G A;  4OMP A;  2CSQ A;  2G6F X;  3RBB B;  2MIO A;  1SEM A;  1UE9 A;  2ROL A;  2L3Q A;  2OJ2 A;  1A0N B;  1RLQ C;  1B3Q A;  2IIM A;  2LQN A;  3ZL7 C;  3TSZ A;  1GBR A;  4OMO A;  1PNJ A;  2DMO A;  1MV0 B;  1AEY A;  3JV3 A;  2L0A A;  2LMJ A;  1AZE A;  1IO6 A;  2DJQ A;  2RQU A;  1X6B A;  1NYG A;  2QDL A;  1UGV A;  4AFQ C;  2FEI A;  2O2O A;  1XOV A;  4Y92 A;  3M0Q A;  1WXU A;  1G83 A;  1EFN A;  1NLP C;  4GBQ A;  4LNP A;  1ARK A;  2FPE A;  1LCK A;  4RTT A;  4OMM A;  3VS1 A;  1I07 A;  2L3S A;  4AG2 C;  2OI3 A;  2DL3 A;  3TSW A;  3EG0 A;  1K9A A;  2JS0 A;  1SRL A;  3PVQ A;  1K0S A;  2KXD A;  4CC2 A;  2AZV A;  2KE9 A;  1UFF A;  2DRM A;  4E6R A;  3VS2 A;  2SRC A;  2PTK A;  2DA9 A;  1ZUU A;  4RUG A;  1NYF A;  5ECA A;  4RTW A;  1I0C A;  4F17 A;  1OOT A;  1FMK A;  1KJW A;  1YWO A;  2BZX A;  1AWW A;  1U3O A;  2F2W A;  3EG2 A;  2GNC A;  4A63 B;  2E5K A;  3C0C A;  1WYX A;  5IHN A;  5FWC A;  2BZ8 A;  3H0F A;  4D8K A;  1V1C A;  2HEQ A;  1T3S A;  1JQQ A;  3UA7 A;  4KRT A;  1AOJ A;  1VYV A;  1Z9Q A;  2K2M A;  2K79 A;  2PNI A;  4JPB W;  1NM7 A;  2PZ1 A;  2C0I A;  1M3C A;  2DLP A;  2DX1 A;  2GQI A;  3FJ5 A;  2BTT A;  4D8D A;  1ZX6 A;  2CSI A;  2YUO A;  3H0I A;  4Z8A A;  5IXF A;  3QWX X;  2KYB A;  1X2Q A;  1E6H A;  2B86 A;  2F2V A;  2LJ0 A;  1QWF A;  1UJY A;  3IQL A;  5HCK A;  4F16 A;  1WA7 A;  4OMQ A;  2VVK A;  2J05 A;  4JJC A;  2AK5 A;  2AKK A;  3M0T A;  2DIL A;  1UTI A;  2K3B A;  2GTO A;  1K1Z A;  4JJB A;  1ZUY A;  2J6K A;  2DM1 A;  2EPD A;  1QKX A;  1TUC A;  2KEA A;  1ZLM A;  2GTJ A;  2EVR A;  2JM8 A;  4J9E A;  2W10 A;  4AFZ C;  2JMC A;  1K4U S;  4ORZ A;  2FPF A;  2ESW A;  4AFU C;  4F14 A;  2CT3 A;  1X43 A;  1GFC A;  3VS4 A;  2L2P A;  3NHN A;  3I5S A;  2GBQ A;  1E7O A;  4K11 A;  4RTV A;  3REA B;  3U23 A;  2EKH A;  2K7A A;  3PVL A;  2JMA A;  2F2X A;  1JEG A;  1SRM A;  4RTZ A;  2FO0 A;  1ABQ A;  2EYW A;  3H41 A;  3VS0 A;  2A28 A;  2KXC A;  4IIO A;  2DL4 A;  2D8H A;  1AWX A;  1UUE A;  3M0S A;  3EHR A;  1WXB A;  1OPK A;  1U06 A;  2LJ1 A;  1AWO A;  2EGE A;  2J06 A;  3O5Z A;  1GCP A;  3REB B;  1M3B A;  2O31 A;  1W70 A;  2MOX A;  3VS3 A;  2CH4 W;  3LH5 A;  2JW4 A;  5I22 A;  2KRM A;  1UDL A;  1QKW A;  1BK2 A;  2FPD A;  1OEB A;  1M8M A;  1NLO C;  1X69 A;  1Z9Z A;  2KYM A;  2LP5 A;  4JJD A;  4JZ4 A;  2M0Y A;  4IIM A;  1RI9 A;  1GRI A;  1UJ0 A;  3EG3 A;  3SEM A;  1AD5 A;  2HBW A;  1BU1 A;  2EYX A;  1U5S A;  1H8K A;  2RN8 A;  1K76 A;  1PKT A;  2YUN A;  2CUD A;  3M0U A;  2EQI A;  1TUD A;  2LNH B;  4ZNX A;  2ECZ A;  1CKB A;  4FSS A;  1YWP A;  2YUP A;  5IHI A;  3VRY A;  2J6O A;  4GLM A;  2MCN A;  2NWM A;  3EG1 A;  1PHT A;  1QCF A;  4JZ3 A;  1NG2 A;  1ZBJ A;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...