2C06A

Nmr-based model of the complex of the toxin kid and a 5-nucleotide substrate rna fragment (auaca)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords KID TOXIN PROTEIN
publication title Model for RNA Binding and the Catalytic Site of the Rnase Kid of the Bacterial Pard Toxin-Antitoxin System.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2c06A00
4MDXA 5CKHA 5CK9A 1NE8A 4MZTA 4MZPA 3NFCA 5CQYA 5CKEA 3TCJA 5CKFA 3G7ZA 4OF1A 4ELZC 5HKCA 5CO7A 4MZMA 5CR2A 4VUBA 4ME7A 3VUBA 3HPWA 5CCAA 5HK0A 1VUBA 1M1FA 5DLOA 2MF2A 2C06A 2KMTA 1UB4A 4ELYC 3JSCA 3JRZA 5HK3A 2VUBA 4HKEA 5CQXA 1X75C 5CKBA 5CKDA
chains in the Genus database with same CATH superfamily
3DLMA 2DEUA 1M1KC 1RAGB 3CCLT 3WVDB 2RQWA 4J9FA 1M5Q1 1WHJA 1CKBA 2CSIA 1JRIA 3H0IA 4HXJA 2KEAA 2YSQA 2ZAEA 2XICA 2AKKA 4J9HA 1YBYA 4XU2A 1X69A 3N5BB 2DL5A 3PFSA 5LJ3g 3G6EA 1R0BG 2QAZA 1ZHIA 2DVJA 4LXCA 3VRZA 3C12A 1WLPB 4Y28E 2MIOA 2B8AA 2ECZA 5KYXB 2HNIA 1WHKA 4CRIA 1VYTA 2Y4YA 4ELYC 2KVQG 4OB2B 1SRMA 3QHSA 1G2BA 2HQHA 2GFUA 1UGRB 4J6XA 2DPPB 5GMKe 1RAEB 2DETA 1UGPB 4PFZA 2E6NA 3CC4A 2RI5A 2DZCA 1Q7YU 2O01E 2MYSA 2Z0WA 4AG1C 5ECAA 2YXYA 1VQKA 4HVWA 1IGUA 1NYFA 2VWFA 2CYZB 1G3SA 1G3TA 2JTFA 1QW1A 4II1A 1UJYA 4BACA 1M3BA 2RJFA 3E9GA 4M77D 2JTEA 4M7AC 1Q86U 4RKUE 2HBPA 2K9GA 1ZSZC 3LH0A 1V76A 4C5GA 3M56A 3C0CA 3INZA 4M77A 1K1ZA 4FYVB 3CCJQ 1VYUA 3M53A 2W0ZA 2EGEA 4WTOB 3MHXA 3M4GA 3OY9A 2MK5A 3SEMA 5GAMg 4M7AE 4BB7A 4JUVA 1S72A 1RADB 3CCRA 3V7RA 4AFSC 1RI0A 3FDRA 1PWTA 3JCMW 5LJ3f 1VOMA 4BE1A 2XKOC 4F04B 4OMOA 1IHWA 1MMAA 3HRSA 1R8OB 2O31A 1VQMA 2E3IA 4EMKC 2AT1B 2DK3A 4CC2A 3FIFA 2YUNA 1SKUB 3EAEA 3A1PA 2DFUA 4B9XA 4J8OA 2P0PA 2A36A 4HCBA 3H6ZA 2EQUA 3M0UA 2XDPA 4JJDA 1WJRA 4E7SA 3HP9A 3A98A 2JM8A 3GP8A 1YJ9A 2DYBA 3G1JA 1YJWT 4C8QB 5KYYA 2SEMA 4O6JA 4M78C 2HL5C 4O5VA 1N8RC 2RQVA 4M77F 2P0KA 3DKMA 3E19A 1SHFA 4JS4A 4JJNK 3VKIA 2X4XA 4E47A 2COWA 4M7AD 1BCOA 4M78E 3CCSA 1OX9A 3VS2A 3I56Q 3JCMX 1RI9A 1VQNA 1VQLA 4PKCC 4LDVA 5GAMf 1BIAA 4NL3A 4B9WA 4PJMA 4LDWA 3MP8A 5IXFA 2DXBA 1K9AA 2FEIA 4M77G 4M7AA 3V8JA 2H8HA 2QEXQ 2O4XB 2CKKA 4PJOC 1PC0A 3CCVA 2LQ8A 4KH0B 5CQXA 1WHHA 2X4JA 4DEXA 4LUDA 3OYGA 1VQ5A 2HQEA 4A4GA 2QDYB 1MUZA 4XTWA 4J9GA 3SWNC 3CD6T 1VQPA 1ZUYA 4IUTA 4RMOA 3CCQQ 2LQNA 3I5SA 2EWNA 2LJ3A 2E1HA 3LGLA 3A5ZB 2QXFA 1M2VB 4PJOE 1BK2A 2JS0A 3JCMe 1UEBA 1YNZA 1QMCA 2FVUA 2K3YA 3PMTA 2J06A 1RUWA 3EGDB 2JOYA 4N0AC 5A0DA 2XDDA 3MP6A 3QWXX 1ZSZB 2FL7A 3QG1A 3C4SA 4NL2A 4ZTJA 1EZZB 3CCUT 3OYAA 3CMAA 4C0GA 1V29B 4RTUA 5CVIA 5GANg 4EIKA 4EMGA 2KBTA 4QQDA 4C5EA 4M78D 3MKDA 1OYXA 3CXCP 2FHDA 5GAOm 4IUQA 2NUTB 5GAN3 1YCYA 1SSHA 4M7AF 2LTOA 1X2KA 2RJDA 1UUEA 2E10A 3RKXA 3AT1B 3V8KA 5CKBA 4M78A 1PHTA 2X3WD 2H3EB 1ZUKA 1W6XA 1Y7XA 3GBQA 1IRXA 2BE7D 3TVTA 1KIKA 2EBPA 1YITQ 5CCAA 1KQSA 2DNUA 4YTLA 3DLLA 5FROA 3OS2A 4JRKA 3CXCS 4C92C 2DEQA 1OZ2A 3HFOA 4ESRA 2L5QA 2QQAA 2DJQA 4E7ZA 2JM9A 4M7AG 3P8BB 4PJOD 4UC4A 3CC7T 2DL8A 5CK9A 4Y92A 2V8IA 1LOJA 3PE0A 3LWIA 3PIPA 2JN0A 5GANd 3RKYA 1QVFA 3VUBA 3G71A 4C92E 4PJOA 3M57A 3X26B 1BCMA 1AHJB 1QKXA 1E7OA 1K73R 5M9OA 4FSSA 1QQJA 1NJIR 2AZVA 2K2MA 1TU0B 2CUBA 4GY5A 2DRMA 3SWNA 2YLCA 4RTYA 1TH7A 3EG0A 3JCMJ 5LJ5h 4XU1A 3OYEA 2LZ6B 4RG8A 4HVVA 3L2WA 1I07A 5HCKA 2GTJA 2EJGA 3PGGA 2KI7A 1MHNA 3UATA 2EYQA 4HA8A 4OGEA 5GANf 1PRLC 1M27C 5GAN6 2DIGA 4PFOA 2MAMA 5DLQE 1EX4A 4E7KA 2CZ7B 4M78F 2VB6A 4N0AA 1T0HA 4RTTA 1YN8A 4MZPA 2RHZA 3BY7A 3VS3A 1M3CA 3S3MA 2RHIA 1Y96B 2YRCA 3EFRA 3JB9G 3OB9A 1W2BP 3OYFA 2L3SA 1YCSB 5IAYA 3CCLA 2FO0A 3M58A 4XQ3A 3ME9A 2YUOA 1AT1B 3I9QA 5I2MA 1OI1A 3CQTA 3EHRA 4A4KA 2JW4A 3TEEA 4DBFA 2DERA 1OX8A 3PMIA 3A8OB 4M78G 2V8JA 2EGCA 4PJLA 3X20B 3GNGA 3SHWA 2K7AA 1CSKA 3HKSA 1LPLA 1NYGA 2K5IA 2OTJT 1PD1A 2RJEA 2VV5A 1TG0A 4PJOF 2E64A 1W2BS 3I56T 1QP2A 5DLOA 2AKLA 3KBGA 3OMCA 4C92D 2IVWA 2DMOA 3JCMc 2RHUA 2HCKA 2MWOA 2GFAA 1SRLA 2NUPA 4EPCA 2KY9A 4M7DB 3C95A 1VQ9Q 1M8VA 4Z8AA 4D8DA 2QEXT 1B34A 1YIJQ 3RUXA 2A08A 1BI1A 3QYGB 4ZGDB 1ZSGA 2DVEA 2ESWA 2QQBA 4C92A 5LJ3j 1I5OB 3OQ5A 2QA4A 2EVRA 1PKTA 2F5KA 3JCMP 2CSQA 1AOJA 2DTOA 1U1SA 2CP7A 4PK4A 2FPDA 1Y57A 4PJOG 3QJ6A 3CCQT 1MNDA 1VQ7Q 5DM7R 2YDLA 1U1TA 1VQ4T 1Y71A 2ROTA 1W4SA 1X01A 4N4GA 1VIEA 1I1JA 2M02A 4D6WA 1JB0E 1QWFA 4XTYA 4OMPA 1N5ZA 2KMTA 1VQ7A 2WSEE 3HRUA 4IIMA 1UECA 1F1BB 3EGXA 4Q5WA 5GAN2 3EFSA 1Q86R 5GAN4 3REAB 2EFIA 3META 2PVOB 1HXDA 4RTXA 5GJVB 4E2FB 4EDUA 1Y0MA 2KSSA 3OYDA 3OBYA 3PVLA 3G4SQ 2BKDN 1KC8R 1O9SA 1WJSA 2CP0A 2BUDA 2GNCA 2OAUA 2MCNA 2K57A 2X9HA 3UWNA 2RHYA 1OQKA 2XK0A 4AFQC 2P4TA 1KD1R 4C0DB 1YHQQ 4JZ3A 5D6XA 4OMQA 4C92F 1G3YA 1IREB 2CH4A 2QTVA 3ZBDA 5AT1B 5GAMj 1UGVA 2RD1A 3KUFA 5HK0A 1TSFA 4LDYA 2ZPEB 2ED0A 4JZ4A 2XDBA 3CMEQ 2PUOB 1C6VX 3BE3A 2EJ9A 4C5HA 3M55A 3SDZA 1H3ZA 4J5YA 1BIBA 5GMKi 1AWOA 4D8KA 2PQWA 4C92G 2CT3A 1B7TA 3THKA 3AHUA 3F70A 3RERA 3QZ5B 4XTVA 2L8DA 4HCCA 4Z02A 1YJWA 1E6GA 1AZGB 3G6EQ 5LL6S 2PVGB 2RK1A 1AEYA 4MMLA 1AWXA 3PT9A 3I55T 2LT4A 5DY9A 3L2UA 1K76A 2HL3A 2MI6A 3OYLA 3MPUB 4IIOA 1FWZA 4ZN1A 2I0NA 2D1XA 3IQLA 5GAOr 1WGSA 2BZYA 1FMVA 3PTAA 2LX7A 2QG9B 2LP5A 4FYWB 3FRNA 1AWJA 3OS1A 1KG1A 1G83A 5FWBA 3CC4Q 2EQKA 1OV3A 2VXEA 1VQKQ 4AT1B 2K4YA 3GF5A 4QKUA 1W70A 2CP6A 4AG2C 3CD6A 2IIMA 2OTLT 1QCNA 2NYSA 5EG2A 1WXBA 3ER0A 2L3QA 2HKQB 3HHTB 2K79A 3M5AA 4M75E 5GMKh 1I5LA 2PU9B 4N4HA 4FSXA 3JB9H 1NG2A 1WFWA 2RF0A 3QUIA 2BZ8A 5AYFA 2C0OA 2E3HA 4L6V5 4QVDA 3TSZA 3T9NA 1OU8A 3MEWA 5GAOn 4JRQA 1K73C 5LJ3d 3VS4A 1NJIC 3JCMV 2P84A 1XJWB 1S72Q 3A8MB 3CCRQ 1UTIA 1WQ7A 1YI2T 3CCUA 2EW3A 4XAXB 3VS7A 3J80E 4A4EA 2NWMA 3OYCA 1D1AA 1WNLA 1KC8U 1HYOA 1UHCA 1FYNA 1RLQC 5CKHA 3V7CA 1GXIE 1LCKA 1NE8A 2CZ6B 2J05A 1VQMQ 2VASA 3HSBA 1KD1U 2ABLA 2YWWA 3CC2T 2PZ1A 2GTOA 2HKNA 3CCET 1VQ6T 1UFFA 2DA9A 5GANj 4HCZA 2BTTA 4RTVA 2ZCFB 2E41A 2F5TX 4A54A 4JJCA 1VQOT 1U3OA 2VXFA 2EIFA 2KQWA 1IO6A 4KT0E 4M77B 3SB2A 2K3XA 5GANe 1JO8A 1C0MA 2CGHA 1YJ9Q 2KAFA 4ELZC 1PG5B 4RUGA 3M0QA 5FU6C 2DYIA 1BBZA 2RN8A 4M75D 1UGQB 3WXMB 3CC7A 4BI4A 1ZX6A 2XI9A 3FEOA 2AK5A 1UDLA 3FJPA 4C0FA 3GOXA 2LC4A 3V8LA 4DOVA 5GAMd 4M75A 1W2BA 3LGFA 5GAOp 2V1RA 1YHQT 3CCSQ 2DXCA 1VQNQ 4AFUC 1VQLQ 4QVZA 2XD0A 2EPDA 4GLKA 5C0MA 1QP3A 2HEQA 2C06A 2LCLA 5KCOA 1ZA1B 3TREA 2DD5A 5FRNA 3L2ZA 1TS9A 3H0FA 3CMET 3CCVQ 5EC7A 1VQ5Q 1M3AA 4OP0A 2M0YA 1QKWA 2O4XA 4OGCA 1YJNA 2FPFA 1VQPQ 1TWBA 5IHKA 2MOXA 1Q7YC 2OJ2A 3QYHB 1BI3A 2KNBB 1M2OA 5KYYB 1KQ1A 1X27A 1D0ZA 4KGXB 4J7IA 1BYMA 4JS5A 4KRTA 3OYBA 4LD6A 1I81A 3QJYA 3QXEB 5L23A 1RL2A 4OMLA 1Q86C 4LDXA 3ZFJA 2AHJB 4R56A 5J3BA 2L3PA 4PLLA 1NZ9A 3QSUA 1GBRA 2E6ZA 2EJFA 3D7SB 2DXTA 3UA6A 5A0GA 2GBQA 2OTJA 4J9DA 4OB0B 3JCMh 2G3RA 1QVPA 1D3BA 2E5KA 2V26A 1HD3A 3CMAQ 1KD1C 4M7AB 5FRMA 1WZOA 3E1SA 3GIBA 4Z88A 1T3LA 4J9CA 4HT8A 1I4K1 4QVCA 1K8AR 2WACA 3VJPA 3RESA 3EG9A 3HL8A 3VRYA 1H8KA 2K6DA 3JSCA 5IHIA 3JB9D 3A8LB 1X75C 4LDUA 1VQKT 1PD0A 1KSWA 2NUTA 2VKNA 1M90R 1O75A 4F7UE 3VYGA 4M75G 1EIFA 4J83A 5KYWB 1TTHB 2O9SA 1VQ4A 2PNIA 4ME7A 1N6AA 2DRKA 2LCCA 1J3TA 1KJWA 2LMJA 2EYYA 3NTKA 1VQ8A 1HJDA 4QT7A 1M1KR 1UB4A 2F69A 3Q1JA 4BY6C 3CEYA 4KH1B 1PKSA 2ENMA 5D6WA 2B86A 4EMKB 3MO8A 4DA4A 1T0JA 2COYA 1GCQC 3RNJA 5A2QE 5J39A 5FU7C 4DBRA 5GAN7 2KDSA 3G71Q 1T3SA 2QDLA 1ABOA 4M7DE 1OZ3A 5A0LA 3EFOA 2P0QA 2LJ0A 3CCMA 1RAFB 3S6WA 4HT9A 1H3HA 2MWPA 2YT6A 2NUZA 2KT1A 1E6HA 3CCJT 4IKFA 3MEAA 4Y91A 2C0IA 2MMPA 2RI3A 1XQHA 3JCMb 4R0KA 2RQRA 4M78B 1WQWA 3O5ZA 3OSSC 2X4YA 3OW2P 2LCSA 4V2SA 2DAQA 2L0AA 3VS5A 1UE9A 1XTDA 3OYYA 2EYXA 3JB9F 3RDVA 2QQSA 1YJ9T 1Q81R 5IH2A 1D1CA 4E7HA 4KGVB 3OW2S 3CCLQ 4FYXB 4PLIA 1QLYA 4F7UA 1N9SA 1NLPC 3TQ7P 4PJOB 1G3WA 1G8XA 2EAYA 2H3JA 3VS6A 2RNAA 2K5LA 1YP5A 3SWNB 4BE0A 2YHTA 4PNOA 2RM4A 3RKWA 1H92A 1IGQA 2BE9B 2DF6A 9ATCB 1NPPA 2AIRB 3OS0A 2HDAA 1ZA2B 1N9RA 3I55A 1BB9A 1WX6A 2D0QB 3A8GB 1RLPC 4FM4B 2G6FX 2L3RA 3VS0A 1GFCA 3H9NA 4M7DA 2QA4Q 1VQ5T 4JDSA 4DBQA 1MMGA 4C0ZA 3LW5E 4X9DA 2KRMA 1K8AU 2GF7A 4JLGA 2HZYA 2IPOB 4DEYA 2KT8A 3EH2A 3M59A 2JUFA 1JU5C 2K2VA 3OYKA 1GCQA 2DL7A 5CKEA 3JB9J 2VYTA 1AD5A 3QWYA 1XNIA 1M90U 5KYUB 4ZNXA 2I2LA 1FXXA 3HPWA 2J6KA 2OTLA 4FCYA 4BDYA 3V7SA 4IUUA 2CH4W 1JXMA 2DTHA 4MDWA 2QQRA 1M9SA 1WXTA 1M1KU 5LJ3e 2FZGB 2RJCA 1FMWA 3LWHA 4FYYB 1N8RR 4PL6A 3E2UA 2PVDB 4MZMA 1Z9ZA 5GAOq 1QCOA 4WCIA 1W1FA 3M4YA 1Q95G 1B34B 2CUDA 3RMQA 4C92B 2DBMA 1M4ZA 1K9MR 5CKDA 1YI2A 4F7UG 3RMSA 3L2QA 4L59A 3PVQA 1WHGA 5FWCA 1TUCA 3QO3A 2M9UA 2M16A 2A28A 2FRWA 3X25B 1KQ2A 3CC2A 4KULA 4A63B 5LJ5g 2JZ2A 4FT2A 1YWOA 3CCEA 1VQ6A 1AZEA 1QVGP 2R58A 1IB8A 2QQ9A 3RIRA 4X1VA 1P92A 2CZ1B 2CP3A 2PUKB 3EGXB 1VQOA 1D1BA 2JJ9A 4FW2A 2RQTA 2A37A 4RTZA 1Q82R 1YITT 1Q81U 3OS5A 1K0XA 1LVKA 3UPUA 2X4WA 3EG2A 3QDFA 1YJWQ 1X6OA 5FW9A 1R77A 1DJ7B 5GAMe 1VYVA 2DIQA 1QVGS 2JS2A 3X28B 1A0NB 3QZ9B 3S3NA 2D8HA 1HSQA 2K3BA 2HAXA 3GPLA 3LX7A 4DBHA 1RAHB 1GFDA 2DILA 1KQSP 2KYBA 5LJ5d 4EMHA 3CPWP 4JPBW 1D0XA 1M8MA 3OYNA 2A3LA 4PJJA 2R5MA 3FB9A 1LNXA 2ED1A 3S3OA 2OAWA 2ZPBB 3JB9I 1M90C 1V1CA 2CT4A 1ZBXA 2D9TA 4KBMB 3DB3A 1TUGB 2QK0A 1WA7A 2Y4XA 4CC7A 1QVFP 4PFPA 4E7JA 1X6BA 3MCAB 4JJBA 2F1LA 3CPWS 3CD6Q 3VU3C 5KYXA 4C8QC 2E70A 1MV0B 3NPFA 3M54A 3E9FA 5LJ5f 4DQ2A 3SD4A 4M75C 2DKGA 3ZL7C 2RMOA 4J9EA 4F16A 1QVFS 2O88A 2O9VA 4NS5A 4C8QE 4E7IA 4MDXA 2NLUA 2MPXC 3I35A 1ZUUA 2RPNA 4HCKA 1JEGA 3NFCA 4KUDK 3CXCA 3UT1A 1UGSB 4BD3A 5GAN8 1N8RU 1WYXA 5GMKj 1MNEA 1NLOC 4BE2A 2VGMA 1TUDA 3CCUQ 1UHFA 3M0SA 1PCXA 2QA4T 5C6SA 5GAN5 2FG0A 3EH1A 1ZBJA 2L89A 4XU0A 1IHVA 3O8VA 1K9MU 1RACB 3M9QA 5I22A 1VQ9T 1MV3A 1YIJT 3QDRB 1PSEA 5IXBA 2RB6A 1SEMA 1Q81C 2YLBA 1I8FA 2DD4A 5GAOl 3R6OA 4XTUA 1D0YA 2ZPHB 4QQGA 2LVMA 3I5RA 1VQ7T 1B3QA 1NM7A 2JMCA 2EKOA 4X34A 3DB4A 3NHNA 3H41A 5GJWB 1GL5A 4OB1B 3OW2A 2QGFB 4OMMA 2ZGWA 4XTZA 4VUBA 1SPKA 1X2QA 1SF9A 3WVEB 2MF2A 1OPLA 3CC7Q 3FLGA 2DJZA 1K4US 4OMFB 2XIDA 5KE3A 2LNVA 1Q82U 2LRQA 4KGZB 1D09B 3EG1A 4C8QD 3RR6A 3LLRA 4RCCA 5CKFA 1TOVA 2YRDA 3L2VA 2EYWA 4XK8E 5GANh 3A8HB 1M30A 2E65A 3CCJA 4XTXA 3H0HA 2LJ1A 4OMNA 4C8QA 1OPKA 3G4ST 2LQWA 3M0RA 4CC4B 2WSCE 3MJXA 5CQYA 1RAIB 2O2OA 3OYMA 2X35A 4IUPA 3FJ5A 2HQXA 1YJNQ 2CS7A 4ANJA 1JJ2P 2R57A 1C1AA 2LNHB 1S1NA 4GLMA 3OA6A 1GRIA 2FB7A 2HSEB 4J9BA 2JNGA 2RH2A 2D8JA 2P4RA 5D7UA 5KYNA 1SHGA 4KUIA 3OMGA 1QWEA 3RBBB 3VUZA 3JCMQ 2V8KA 4P5NA 2J6OA 1WDXA 1YFNA 1KHCA 2KYMA 3NTHA 4M75B 1N27A 1JJ2S 2KR3A 1BKBA 3P8HA 4BI3A 4OVAA 2DZ9A 2GGRA 3GNFB 2OTJQ 4WF2A 2EQJA 3QIIA 5KH6A 1R0CB 1K9MC 5FLXE 1PSFA 1M2VA 2PTKA 3EGUA 3FC3A 1PNJA 2YRVA 3UDCA 2GQVA 3G6ET 3GLXA 4J6YA 1OOTA 1U5SA 3CBMA 4C8QF 3P8DA 4ORZA 3EGDA 4HKEA 2L2PA 2ZPGB 5J26A 2CZ0B 5HKCA 1KC8C 1ZSZA 3EHQA 1WIEA 4E7LA 2W10A 3UF4A 1M1GA 2HSPA 4M75F 4CI0C 2KGTA 3I56A 2EGAA 4OF1A 3LH5A 6AT1B 3HFNA 3MEVA 3VYHB 2LDMA 1VQ4Q 1NEGA 3L2RA 2A0FB 2KRNA 5KCHA 2ZPFB 2LQKA 2QEXA 1VQ8Q 5KYWA 3CC4T 2SRCA 3JRZA 5I21A 4C8QG 2KXDA 4AMCA 4B6MA 2DBKA 1Q82C 4JRIA 2CP5A 4F14A 3OYJA 2M0OA 4C5IA 1OU9A 2IG0A 1B07A 3CCQA 1XOVA 4HVUA 4ZGJB 3BW1A 2C0TA 4PJNA 2M1HA 1I0CA 4EMKA 2ZZDA 1D3BB 3ASKA 1FX7A 1NPRA 1QVGA 5KE2A 4M7DC 2DTIA 3CCMQ 1ACMB 1BI0A 4RTWA 4QW2A 3CBOA 4OB3B 7AT1B 3EG9B 4ZTFA 2ATCB 4L5GA 3L1AA 1WHMA 3G7ZA 3PIOA 4NOYA 2DL3A 1S72T 2DLPA 5FU6B 1WPYA 3CCRT 1UJ0A 2E5QA 4FL6A 2RQUA 2F2WA 3NGPA 5HK3A 2ROLA 2KXCA 2K5FA 2JVVA 1ARKA 2KE9A 5D6YA 2M51A 2ZPIB 3HTRA 4AFZC 3TCJA 1SSFA 4LN2A 3LYIA 3OSVA 2RHXA 4N4IA 1VQMT 4BI8B 3CPWA 2D0NA 8AT1B 3MEUA 2A7YA 1WI7A 4CC3A 4A53A 1LJOA 2KK4A 1HK9A 2DXUA 3TSWA 3J81E 2LX9A 1WXUA 3QPHA 5LJ5j 2KRSA 1Z9QA 2WSFE 1YWPA 3SFMA 3EFOB 1X43A 5CIUA 1YITA 4FU6A 4LUEA 1FMKA 4J7FA 5HY6A 2OI3A 1BU1A 4IURA 2QI2A 5GMKl 3OYIA 3MP1A 1MGQA 2QYZA 2F2VA 5LJ5e 1PM3A 4C0DC 4FW1A 1Y96A 4J9IA 2EYZA 1ZQ1A 4E6RA 3I55Q 3REBB 3KXTA 3KFVA 2RK2A 2F2XA 4LNPA 2HBWA 5I11A 2VC8A 3U23A 1KFZA 3CCST 1YJNT 1VQNT 2VUBA 1VQLT 3JCMg 4M7DD 2GCXA 3PNWC 2R5AA 2FPEA 3NTIA 4FT4A 4BDZA 2DE0X 3C94A 4M4ZA 3CPFA 3CCVT 2EKHA 4TVRA 5CO7A 4F7UB 1JBMA 2BIVA 5IN1A 1IZ6A 1NEBA 5IHNA 3TU4K 2VVKA 1GCPA 2OTLQ 1RAAB 2J7IA 1VQPT 5KYUA 3OYHA 4GBQA 3M0PA 1VIFA 5I2SA 2LT1A 1IXDA 1SG5A 4RCBA 2EQIA 2VGNA 2FRYA 5CAIA 3R6NA 5L8RE 2E12A 2YUPA 1U8RA 2FZKB 3JCMd 4JRPA 2D6FA 4F7UF 4BY6B 2RO0A 2RA2A 1H641 1YI2Q 4LE9A 1EFNA 5LJ3h 1Y07A 2NUPB 2E4HA 1ZLMA 3CMAT 2DL4A 1M1FA 1JXOA 2HD0A 5FU7B 2QGGA 2X3XD 3ZEHA 1OEBA 4RG2A 1VQ9A 1ABQA 2X51A 3CC2Q 1K0SA 1WJQA 1VQ8T 1YIJA 1PRMC 2RI2A 4QQ6A 4DOWA 3OBWA 3CCEQ 1VQ6Q 2FZCB 2JTMA 1Q7YR 2JMAA 3NMZC 3JCMf 5CR2A 4M7DF 4ATOA 2XU8A 2COZA 3M0TA 2JT4A 1VQOQ 1NBEB 2XHCA 4MMKA 4Z89A 1BI2A 1WHLA 4FIBA 4A4HA 4F17A 1G5VA 4K11A 2DM1A 4ZGEB 2OX7A 3J7AF 3BDLA 2J6FA 4IUVA 2V1QA 4MZTA 2EQMA 3CCMT 1TXQA 1JJ2A 1KHIA 2XMFA 4BUGA 2FYKA 1MMNA 2QASA 3L42A 2CREA 4JLIA 3HRTA 3ULRB 1AVZC 1VUBA 2Y90A 1U06A 1JQQA 4M7DG 2BZXA 1K73U 3G71T 1NJIU 4ZN3A 4R55A 3H8ZA 2JXBA 5GAMh 4LD9K 5IT9E 1AWWA 3G4SA 8ATCB 2KROA 4J6WA 1RABB 2XG8D 1KK7A 2DX1A 3UA7A 4XU3A 2CP2A 1GBQA 2AZSA 2GQIA 1OULA 1K8AC 4M77C 1YHQA 2YUQA 1X6GA 3VV0A 2QTXA 3QKJA 1QCFA 2DO3A 3JAME 3BDUA 3VS1A 1MMDA 1CKAA 3JV3A 5GMKm 3URGA 1VA7A 1UG1A 3EG3A 3QBYA 3BFMA 3CMEA 3CBPA 3X24B 2CDTA 4A4FA 4M77E 4X9CA 1KQSS 2HMAA
chains in the Genus database with same CATH topology
1M8VA 3DLMA 5D6WA 1M1KC 3CCLT 3WVDB 2QEXT 1B34A 4EMKB 5CQYA 3RUXA 1M5Q1 3OYMA 2X35A 3MO8A 1BI1A 3QYGB 4IUPA 2DVEA 2QQBA 4C92A 4ZGDB 5LJ3j 3DLLA 3OQ5A 2QA4A 1JRIA 2HQXA 4DA4A 4PJOD 2F5KA 3JCMP 2CS7A 5A2QE 5J39A 2DTOA 2R57A 1U1SA 2KDSA 5FU7C 5GAN7 2XICA 4M7DE 4PJOG 1YBYA 3OA6A 1OZ3A 3QJ6A 5A0LA 3CCQT 2P0QA 4XU2A 3CCMA 2FB7A 5DM7R 3S6WA 1U1TA 4HT9A 1VQ4T 2MWPA 1Y71A 2JNGA 2RH2A 3N5BB 1W4SA 3CMAA 1X01A 4N4GA 1VIEA 3PFSA 5LJ3g 3G6EA 3CCJT 4IKFA 4KUIA 3OMGA 3VUZA 1ZHIA 3JCMQ 2V8KA 3MEAA 4P5NA 4Y91A 3C12A 4D6WA 2MMPA 2RI3A 4Y28E 1XQHA 3JCMb 1JB0E 1KHCA 4M78B 1WQWA 2B8AA 2HNIA 3NTHA 4M75B 1N27A 4XTYA 1JJ2S 3P8HA 1BKBA 4BI3A 4CRIA 2KMTA 2Y4YA 2X4YA 3OSSC 4OVAA 2KVQG 2WSEE 3HRUA 4OB2B 4ELYC 3QHSA 2DZ9A 4V2SA 4Q5WA 5GAN2 4PJOC 2DAQA 2GFUA 3GNFB 1UGRB 1XTDA 3EFSA 5GAN4 4WF2A 2EFIA 2DPPB 3META 4J6XA 5GMKe 2EQJA 3OYYA 3QIIA 5KH6A 2PVOB 1HXDA 1K9MC 5FLXE 1PSFA 1UGPB 4EDUA 2KSSA 3FC3A 2E6NA 3JB9F 3CC4A 2RI5A 2DZCA 2YRVA 1Q7YU 3UDCA 2QQSA 2GQVA 2O01E 3OBYA 3GLXA 4J6YA 3OYDA 3G6ET 1YJ9T 2BKDN 1O9SA 4E7HA 1VQKA 1WJSA 3CBMA 4C8QF 2BUDA 2CYZB 1G3SA 2OAUA 1G3TA 2JTFA 2K57A 3P8DA 2RHYA 3UWNA 3OW2S 1QW1A 4II1A 4PLIA 4HKEA 2ZPGB 5J26A 4F7UA 1N9SA 4BACA 2CZ0B 5HKCA 2XK0A 1KC8C 2P4TA 2RJFA 3E9GA 4C0DB 4M77D 4E7LA 4PJOB 1M1GA 4M75F 4CI0C 1G3WA 4M7AC 2EAYA 2H3JA 5D6XA 1Q86U 4C92F 3I56A 1G3YA 4RKUE 1IREB 4OF1A 2HBPA 3ZBDA 5GAMj 2K5LA 2RD1A 3HFNA 3LH0A 4C5GA 3SWNB 3MEVA 3KUFA 4BE0A 3VYHB 2YHTA 2LDMA 5HK0A 4LDYA 4PNOA 2RM4A 3M56A 2ZPEB 3INZA 4M77A 3RKWA 3L2RA 5KCHA 2ZPFB 2XDBA 2LQKA 2QEXA 2PUOB 3CC4T 1NPPA 3JRZA 5I21A 3M53A 3OS0A 4C8QG 2EJ9A 3MHXA 4C5HA 3M55A 3M4GA 3OY9A 1N9RA 1Q82C 3I55A 5GAMg 4M7AE 4BB7A 4JRIA 4JUVA 3SDZA 3OYJA 1S72A 1H3ZA 3CCRA 4J5YA 2M0OA 3V7RA 1BIBA 4C5IA 2D0QB 3A8GB 2IG0A 1RI0A 5GMKi 4FM4B 2L3RA 3FDRA 3CCQA 1XOVA 4M7DA 2PQWA 4ZGJB 4C92G 3JCMW 3AHUA 3BW1A 1VQ5T 5LJ3f 4JDSA 3F70A 4BE1A 2M1HA 2XKOC 4C0ZA 3LW5E 3QZ5B 4EMKA 3RERA 4X9DA 2ZZDA 1D3BB 3ASKA 3HRSA 1FX7A 1NPRA 4XTVA 1QVGA 2L8DA 2GF7A 1K8AU 4HCCA 4Z02A 5KE2A 4JLGA 1YJWA 4M7DC 1R8OB 2DTIA 1BI0A 4QW2A 1VQMA 3CBOA 4OB3B 4EMKC 3M59A 2JUFA 2K2VA 2DK3A 3OYKA 4ZTFA 5CKEA 3FIFA 4L5GA 5LL6S 3L1AA 3JB9J 2PVGB 2VYTA 3G7ZA 2RK1A 1XNIA 1M90U 3PIOA 4MMLA 4NOYA 2I2LA 3EAEA 3PT9A 3I55T 2LT4A 4B9XA 1FXXA 3HPWA 4J8OA 5DY9A 3L2UA 5FU6B 1S72T 1WPYA 2OTLA 2P0PA 3CCRT 4BDYA 3V7SA 4IUUA 2E5QA 4FL6A 2MI6A 3OYLA 4HCBA 3H6ZA 2DTHA 1FWZA 2EQUA 4MDWA 4ZN1A 5HK3A 2K5FA 2QQRA 2XDPA 1M9SA 2JVVA 1M1KU 1WJRA 3HP9A 5D6YA 5LJ3e 1WGSA 5GAOr 2ZPIB 2RJCA 3LWHA 3GP8A 1GXIE 3PTAA 1YJ9A 1YJWT 4C8QB 3TCJA 3FRNA 4PL6A 1SSFA 2PVDB 3OS1A 4O6JA 3LYIA 3OSVA 4M78C 1KG1A 4MZMA 2RHXA 4N4IA 1VQMT 5GAOq 4O5VA 4BI8B 3CPWA 1N8RC 2EQKA 4M77F 3M4YA 2P0KA 1B34B 2VXEA 3MEUA 2A7YA 3DKMA 3RMQA 3E19A 4C92B 2K4YA 3GF5A 4A53A 4JS4A 4JJNK 1LJOA 2KK4A 3VKIA 1M4ZA 3CD6A 2X4XA 1HK9A 5CKDA 2OTLT 4E47A 2DXUA 3J81E 1YI2A 4F7UG 2LX9A 5EG2A 3QPHA 3ER0A 5LJ5j 3RMSA 4M7AD 1VQ7A 2WSFE 3SFMA 4M78E 3L2QA 3CCSA 5CIUA 1YITA 3HHTB 3M5AA 4M75E 4L59A 5GMKh 3JCMX 4FU6A 1I5LA 2PU9B 1VQNA 1VQLA 4N4HA 4FSXA 4PKCC 3JB9H 4LDVA 5GAMf 4MDXA 1BIAA 3QO3A 4J7FA 5HY6A 2M9UA 3QUIA 4IURA 4LDWA 2M16A 2QI2A 3MP8A 5AYFA 2DXBA 4B9WA 5GMKl 3X25B 3OYIA 1KQ2A 4L6V5 4QVDA 3MP1A 3T9NA 1MGQA 4M77G 4M7AA 3V8JA 3CC2A 4KULA 5LJ5e 4C0DC 2O4XB 2CKKA 5LJ5g 2JZ2A 3CCVA 2LQ8A 3MEWA 4FT2A 1Y96A 5CQXA 5GAOn 2X4JA 4JRQA 3CCEA 1K73C 1ZQ1A 5LJ3d 1VQ6A 1NJIC 3OYGA 3JCMV 2R58A 1VQ5A 2HQEA 4A4GA 3KXTA 4NL3A 2QQ9A 3RIRA 2QDYB 3A8MB 4XTWA 2RK2A 3SWNC 3CD6T 1P92A 2CZ1B 1VQPA 2PUKB 1WQ7A 1VQOA 4IUTA 4RMOA 1YI2T 3CCUA 4XAXB 2EWNA 3J80E 2E1HA 2VC8A 3LGLA 4A4EA 3OYCA 3CCST 3A5ZB 1YJNT 2QXFA 1WNLA 1YITT 1Q81U 3OS5A 4PJOE 1KC8U 3JCMe 1VQNT 2VUBA 1VQLT 1UEBA 2X4WA 3JCMg 2GCXA 3UPUA 4M7DD 3PNWC 1X6OA 2R5AA 3NTIA 5CKHA 1DJ7B 3V7CA 5GAMe 2CZ6B 1NE8A 2DIQA 2FVUA 2K3YA 4FT4A 4BDZA 3PMTA 1QVGS 3HSBA 1KD1U 3C94A 3CC2T 3X28B 2JOYA 4N0AC 3CPFA 3QZ9B 3CCVT 5A0DA 4TVRA 5CO7A 4F7UB 1JBMA 2BIVA 3MP6A 5IN1A 2XDDA 1IZ6A 3CCET 3S3NA 1VQ6T 2FL7A 3TU4K 5GANj 3QG1A 4HCZA 2HAXA 3GPLA 2ZCFB 2E41A 3C4SA 2F5TX 3LX7A 4NL2A 4A54A 4ZTJA 1VQPT 3JAME 3OYHA 1VQOT 5LJ5d 3CCUT 1VIFA 2VXFA 4EMHA 3OYAA 3OYNA 2A3LA 2EIFA 5I2SA 2KQWA 2R5MA 4KT0E 4M77B 3SB2A 2K3XA 1LNXA 2LT1A 3FB9A 1V29B 4C0GA 4RCBA 5GANe 5CVIA 2CGHA 5GANg 2ZPBB 3S3OA 2KAFA 3JB9I 4ELZC 4EMGA 4QQDA 1M90C 2VGNA 5FU6C 4C5EA 4M78D 1ZBXA 2D9TA 4KBMB 4M75D 5CAIA 1OYXA 1UGQB 2FHDA 3DB3A 5L8RE 3WXMB 5GAOm 3CC7A 4IUQA 4BI4A 2E12A 5GAN3 1YCYA 4M7AF 2XI9A 2LTOA 3FEOA 2Y4XA 2RJDA 3FJPA 1U8RA 2E10A 3JCMd 4E7JA 4JRPA 3MCAB 3RKXA 2D6FA 3V8KA 4F7UF 4BY6B 4C0FA 5CKBA 3CPWS 2RO0A 4M78A 2RA2A 3VU3C 2LC4A 3V8LA 3GOXA 4DOVA 5GAMd 4M75A 4C8QC 1H641 2E70A 1W2BA 1Y7XA 3LGFA 5GAOp 5LJ3h 1Y07A 1YHQT 3M54A 3E9FA 5LJ5f 2DXCA 4DQ2A 3SD4A 5CCAA 4M75C 1KQSA 3CMAT 4YTLA 4QVZA 5FROA 3OS2A 4GLKA 1M1FA 4JRKA 5C0MA 3CXCS 4C92C 2XD0A 1QP3A 2DEQA 2C06A 1OZ2A 2LCLA 3HFOA 2HD0A 2L5QA 5FU7B 2QQAA 5KCOA 3TREA 2DD5A 2DKGA 3ZEHA 1QVFS 5FRNA 4RG2A 1VQ9A 3L2ZA 4M7AG 1WJQA 3P8BB 4NS5A 4UC4A 4C8QE 3CMET 2NLUA 4E7IA 5CK9A 1YIJA 4QQ6A 2RI2A 4DOWA 2V8IA 1VQ8T 3CC7T 1LOJA 3OBWA 3LWIA 3PIPA 2JN0A 3NFCA 4KUDK 2JTMA 5GANd 3UT1A 3CXCA 1UGSB 4OP0A 2O4XA 4OGCA 4BD3A 1YJNA 3JCMf 5GAN8 3RKYA 5CR2A 1N8RU 5GMKj 4M7DF 1QVFA 4ATOA 3VUBA 3G71A 2XU8A 4BE2A 2VGMA 4C92E 4PJOA 3M57A 3X26B 1Q7YC 2XHCA 3QYHB 4MMKA 1BI3A 1AHJB 2QA4T 1BI2A 4FIBA 5C6SA 4A4HA 5M9OA 1KQ1A 5GAN5 4J7IA 1BYMA 4GY5A 1G5VA 3SWNA 4ZGEB 2YLCA 4JS5A 1TH7A 3JCMJ 3J7AF 3BDLA 3OYBA 4IUVA 4LD6A 4MZTA 2L89A 4XU0A 5LJ5h 1I81A 2EQMA 3O8VA 4XU1A 3OYEA 3CCMT 1K9MU 3QJYA 4RG8A 1KHIA 1JJ2A 4BUGA 3M9QA 3QXEB 2FYKA 1RL2A 3L2WA 3L42A 1VQ9T 1Q86C 4JLIA 4LDXA 2EJGA 3PGGA 3ZFJA 1MHNA 1YIJT 3HRTA 2AHJB 3QDRB 1PSEA 4R56A 1VUBA 2Y90A 5J3BA 2EYQA 4M7DG 4HA8A 4PLLA 1NZ9A 4OGEA 5GANf 3QSUA 2RB6A 2E6ZA 5GAN6 2EJFA 2DXTA 2DIGA 2YLBA 5A0GA 1I8FA 2DD4A 2MAMA 1Q81C 5GAOl 3G71T 1K73U 5DLQE 3R6OA 2CZ7B 4M78F 4N0AA 4XTUA 4ZN3A 2ZPHB 4QQGA 4E7KA 1NJIU 2LVMA 4OB0B 3JCMh 2G3RA 1VQ7T 4MZPA 1QVPA 2RHZA 1D3BA 2EKOA 3BY7A 3H8ZA 4X34A 3DB4A 4R55A 1KD1C 4M7AB 5GAMh 4LD9K 5FRMA 3E1SA 5IT9E 4OB1B 3OW2A 3GIBA 3S3MA 2ZGWA 3G4SA 4XTZA 4VUBA 2RHIA 4HT8A 1Y96B 4J6WA 1I4K1 4QVCA 3EFRA 3JB9G 3OB9A 3OYFA 3WVEB 2WACA 3VJPA 3RESA 2XG8D 5IAYA 3HL8A 2MF2A 4XU3A 3CCLA 3M58A 3FLGA 2OTJA 2DJZA 3JSCA 4XQ3A 4OMFB 3ME9A 2XIDA 3JB9D 3A8LB 5KE3A 1K8AC 5I2MA 1OI1A 1X75C 2LNVA 1Q82U 2LRQA 4LDUA 4M77C 1YHQA 1VQKT 4A4KA 3TEEA 3VV0A 2QTXA 3QKJA 2DO3A 3PMIA 1O75A 3A8OB 2V8JA 4M78G 3X20B 3LLRA 3GNGA 4C8QD 3VYGA 4F7UE 3BDUA 4M75G 4RCCA 5CKFA 3HKSA 5GMKm 1EIFA 4J83A 3URGA 3L2VA 2OTJT 2K5IA 4XK8E 2RJEA 2VV5A 3A8HB 5GANh 1VQ4A 4ME7A 4PJOF 3QBYA 2E65A 1N6AA 2E64A 2LCCA 1W2BS 3BFMA 3I56T 4XTXA 3CCJA 1QP2A 3NTKA 5DLOA 3CMEA 1VQ8A 3KBGA 3OMCA 4C92D 4C8QA 3CBPA 1UB4A 2IVWA 2F69A 3X24B 3Q1JA 3JCMc 4BY6C 4A4FA 2RHUA 3G4ST 4M77E 4X9CA 2MWOA 2GFAA 2WSCE 3CEYA 4EPCA 1KQSS 2KY9A 4M7DB 3C95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDX A;  5CKH A;  5CK9 A;  1NE8 A;  4MZT A;  4MZP A;  3NFC A;  5CQY A;  5CKE A;  3TCJ A;  5CKF A;  3G7Z A;  4OF1 A;  4ELZ C;  5HKC A;  5CO7 A;  4MZM A;  5CR2 A;  4VUB A;  4ME7 A;  3VUB A;  3HPW A;  5CCA A;  5HK0 A;  1VUB A;  1M1F A;  5DLO A;  2MF2 A;  2C06 A;  2KMT A;  1UB4 A;  4ELY C;  3JSC A;  3JRZ A;  5HK3 A;  2VUB A;  4HKE A;  5CQX A;  1X75 C;  5CKB A;  5CKD A; 
#chains in the Genus database with same CATH topology
 3DLM A;  2DEU A;  1M1K C;  1RAG B;  3CCL T;  3WVD B;  2RQW A;  4J9F A;  1M5Q 1;  1WHJ A;  1CKB A;  2CSI A;  1JRI A;  3H0I A;  4HXJ A;  2KEA A;  2YSQ A;  2ZAE A;  2XIC A;  2AKK A;  4J9H A;  1YBY A;  4XU2 A;  1X69 A;  3N5B B;  2DL5 A;  3PFS A;  5LJ3 g;  3G6E A;  1R0B G;  2QAZ A;  1ZHI A;  2DVJ A;  4LXC A;  3VRZ A;  3C12 A;  1WLP B;  4Y28 E;  2MIO A;  2B8A A;  2ECZ A;  5KYX B;  2HNI A;  1WHK A;  4CRI A;  1VYT A;  2Y4Y A;  4ELY C;  2KVQ G;  4OB2 B;  1SRM A;  3QHS A;  1G2B A;  2HQH A;  2GFU A;  1UGR B;  4J6X A;  2DPP B;  5GMK e;  1RAE B;  2DET A;  1UGP B;  4PFZ A;  2E6N A;  3CC4 A;  2RI5 A;  2DZC A;  1Q7Y U;  2O01 E;  2MYS A;  2Z0W A;  4AG1 C;  5ECA A;  2YXY A;  1VQK A;  4HVW A;  1IGU A;  1NYF A;  2VWF A;  2CYZ B;  1G3S A;  1G3T A;  2JTF A;  1QW1 A;  4II1 A;  1UJY A;  4BAC A;  1M3B A;  2RJF A;  3E9G A;  4M77 D;  2JTE A;  4M7A C;  1Q86 U;  4RKU E;  2HBP A;  2K9G A;  1ZSZ C;  3LH0 A;  1V76 A;  4C5G A;  3M56 A;  3C0C A;  3INZ A;  4M77 A;  1K1Z A;  4FYV B;  3CCJ Q;  1VYU A;  3M53 A;  2W0Z A;  2EGE A;  4WTO B;  3MHX A;  3M4G A;  3OY9 A;  2MK5 A;  3SEM A;  5GAM g;  4M7A E;  4BB7 A;  4JUV A;  1S72 A;  1RAD B;  3CCR A;  3V7R A;  4AFS C;  1RI0 A;  3FDR A;  1PWT A;  3JCM W;  5LJ3 f;  1VOM A;  4BE1 A;  2XKO C;  4F04 B;  4OMO A;  1IHW A;  1MMA A;  3HRS A;  1R8O B;  2O31 A;  1VQM A;  2E3I A;  4EMK C;  2AT1 B;  2DK3 A;  4CC2 A;  3FIF A;  2YUN A;  1SKU B;  3EAE A;  3A1P A;  2DFU A;  4B9X A;  4J8O A;  2P0P A;  2A36 A;  4HCB A;  3H6Z A;  2EQU A;  3M0U A;  2XDP A;  4JJD A;  1WJR A;  4E7S A;  3HP9 A;  3A98 A;  2JM8 A;  3GP8 A;  1YJ9 A;  2DYB A;  3G1J A;  1YJW T;  4C8Q B;  5KYY A;  2SEM A;  4O6J A;  4M78 C;  2HL5 C;  4O5V A;  1N8R C;  2RQV A;  4M77 F;  2P0K A;  3DKM A;  3E19 A;  1SHF A;  4JS4 A;  4JJN K;  3VKI A;  2X4X A;  4E47 A;  2COW A;  4M7A D;  1BCO A;  4M78 E;  3CCS A;  1OX9 A;  3VS2 A;  3I56 Q;  3JCM X;  1RI9 A;  1VQN A;  1VQL A;  4PKC C;  4LDV A;  5GAM f;  1BIA A;  4NL3 A;  4B9W A;  4PJM A;  4LDW A;  3MP8 A;  5IXF A;  2DXB A;  1K9A A;  2FEI A;  4M77 G;  4M7A A;  3V8J A;  2H8H A;  2QEX Q;  2O4X B;  2CKK A;  4PJO C;  1PC0 A;  3CCV A;  2LQ8 A;  4KH0 B;  5CQX A;  1WHH A;  2X4J A;  4DEX A;  4LUD A;  3OYG A;  1VQ5 A;  2HQE A;  4A4G A;  2QDY B;  1MUZ A;  4XTW A;  4J9G A;  3SWN C;  3CD6 T;  1VQP A;  1ZUY A;  4IUT A;  4RMO A;  3CCQ Q;  2LQN A;  3I5S A;  2EWN A;  2LJ3 A;  2E1H A;  3LGL A;  3A5Z B;  2QXF A;  1M2V B;  4PJO E;  1BK2 A;  2JS0 A;  3JCM e;  1UEB A;  1YNZ A;  1QMC A;  2FVU A;  2K3Y A;  3PMT A;  2J06 A;  1RUW A;  3EGD B;  2JOY A;  4N0A C;  5A0D A;  2XDD A;  3MP6 A;  3QWX X;  1ZSZ B;  2FL7 A;  3QG1 A;  3C4S A;  4NL2 A;  4ZTJ A;  1EZZ B;  3CCU T;  3OYA A;  3CMA A;  4C0G A;  1V29 B;  4RTU A;  5CVI A;  5GAN g;  4EIK A;  4EMG A;  2KBT A;  4QQD A;  4C5E A;  4M78 D;  3MKD A;  1OYX A;  3CXC P;  2FHD A;  5GAO m;  4IUQ A;  2NUT B;  5GAN 3;  1YCY A;  1SSH A;  4M7A F;  2LTO A;  1X2K A;  2RJD A;  1UUE A;  2E10 A;  3RKX A;  3AT1 B;  3V8K A;  5CKB A;  4M78 A;  1PHT A;  2X3W D;  2H3E B;  1ZUK A;  1W6X A;  1Y7X A;  3GBQ A;  1IRX A;  2BE7 D;  3TVT A;  1KIK A;  2EBP A;  1YIT Q;  5CCA A;  1KQS A;  2DNU A;  4YTL A;  3DLL A;  5FRO A;  3OS2 A;  4JRK A;  3CXC S;  4C92 C;  2DEQ A;  1OZ2 A;  3HFO A;  4ESR A;  2L5Q A;  2QQA A;  2DJQ A;  4E7Z A;  2JM9 A;  4M7A G;  3P8B B;  4PJO D;  4UC4 A;  3CC7 T;  2DL8 A;  5CK9 A;  4Y92 A;  2V8I A;  1LOJ A;  3PE0 A;  3LWI A;  3PIP A;  2JN0 A;  5GAN d;  3RKY A;  1QVF A;  3VUB A;  3G71 A;  4C92 E;  4PJO A;  3M57 A;  3X26 B;  1BCM A;  1AHJ B;  1QKX A;  1E7O A;  1K73 R;  5M9O A;  4FSS A;  1QQJ A;  1NJI R;  2AZV A;  2K2M A;  1TU0 B;  2CUB A;  4GY5 A;  2DRM A;  3SWN A;  2YLC A;  4RTY A;  1TH7 A;  3EG0 A;  3JCM J;  5LJ5 h;  4XU1 A;  3OYE A;  2LZ6 B;  4RG8 A;  4HVV A;  3L2W A;  1I07 A;  5HCK A;  2GTJ A;  2EJG A;  3PGG A;  2KI7 A;  1MHN A;  3UAT A;  2EYQ A;  4HA8 A;  4OGE A;  5GAN f;  1PRL C;  1M27 C;  5GAN 6;  2DIG A;  4PFO A;  2MAM A;  5DLQ E;  1EX4 A;  4E7K A;  2CZ7 B;  4M78 F;  2VB6 A;  4N0A A;  1T0H A;  4RTT A;  1YN8 A;  4MZP A;  2RHZ A;  3BY7 A;  3VS3 A;  1M3C A;  3S3M A;  2RHI A;  1Y96 B;  2YRC A;  3EFR A;  3JB9 G;  3OB9 A;  1W2B P;  3OYF A;  2L3S A;  1YCS B;  5IAY A;  3CCL A;  2FO0 A;  3M58 A;  4XQ3 A;  3ME9 A;  2YUO A;  1AT1 B;  3I9Q A;  5I2M A;  1OI1 A;  3CQT A;  3EHR A;  4A4K A;  2JW4 A;  3TEE A;  4DBF A;  2DER A;  1OX8 A;  3PMI A;  3A8O B;  4M78 G;  2V8J A;  2EGC A;  4PJL A;  3X20 B;  3GNG A;  3SHW A;  2K7A A;  1CSK A;  3HKS A;  1LPL A;  1NYG A;  2K5I A;  2OTJ T;  1PD1 A;  2RJE A;  2VV5 A;  1TG0 A;  4PJO F;  2E64 A;  1W2B S;  3I56 T;  1QP2 A;  5DLO A;  2AKL A;  3KBG A;  3OMC A;  4C92 D;  2IVW A;  2DMO A;  3JCM c;  2RHU A;  2HCK A;  2MWO A;  2GFA A;  1SRL A;  2NUP A;  4EPC A;  2KY9 A;  4M7D B;  3C95 A;  1VQ9 Q;  1M8V A;  4Z8A A;  4D8D A;  2QEX T;  1B34 A;  1YIJ Q;  3RUX A;  2A08 A;  1BI1 A;  3QYG B;  4ZGD B;  1ZSG A;  2DVE A;  2ESW A;  2QQB A;  4C92 A;  5LJ3 j;  1I5O B;  3OQ5 A;  2QA4 A;  2EVR A;  1PKT A;  2F5K A;  3JCM P;  2CSQ A;  1AOJ A;  2DTO A;  1U1S A;  2CP7 A;  4PK4 A;  2FPD A;  1Y57 A;  4PJO G;  3QJ6 A;  3CCQ T;  1MND A;  1VQ7 Q;  5DM7 R;  2YDL A;  1U1T A;  1VQ4 T;  1Y71 A;  2ROT A;  1W4S A;  1X01 A;  4N4G A;  1VIE A;  1I1J A;  2M02 A;  4D6W A;  1JB0 E;  1QWF A;  4XTY A;  4OMP A;  1N5Z A;  2KMT A;  1VQ7 A;  2WSE E;  3HRU A;  4IIM A;  1UEC A;  1F1B B;  3EGX A;  4Q5W A;  5GAN 2;  3EFS A;  1Q86 R;  5GAN 4;  3REA B;  2EFI A;  3MET A;  2PVO B;  1HXD A;  4RTX A;  5GJV B;  4E2F B;  4EDU A;  1Y0M A;  2KSS A;  3OYD A;  3OBY A;  3PVL A;  3G4S Q;  2BKD N;  1KC8 R;  1O9S A;  1WJS A;  2CP0 A;  2BUD A;  2GNC A;  2OAU A;  2MCN A;  2K57 A;  2X9H A;  3UWN A;  2RHY A;  1OQK A;  2XK0 A;  4AFQ C;  2P4T A;  1KD1 R;  4C0D B;  1YHQ Q;  4JZ3 A;  5D6X A;  4OMQ A;  4C92 F;  1G3Y A;  1IRE B;  2CH4 A;  2QTV A;  3ZBD A;  5AT1 B;  5GAM j;  1UGV A;  2RD1 A;  3KUF A;  5HK0 A;  1TSF A;  4LDY A;  2ZPE B;  2ED0 A;  4JZ4 A;  2XDB A;  3CME Q;  2PUO B;  1C6V X;  3BE3 A;  2EJ9 A;  4C5H A;  3M55 A;  3SDZ A;  1H3Z A;  4J5Y A;  1BIB A;  5GMK i;  1AWO A;  4D8K A;  2PQW A;  4C92 G;  2CT3 A;  1B7T A;  3THK A;  3AHU A;  3F70 A;  3RER A;  3QZ5 B;  4XTV A;  2L8D A;  4HCC A;  4Z02 A;  1YJW A;  1E6G A;  1AZG B;  3G6E Q;  5LL6 S;  2PVG B;  2RK1 A;  1AEY A;  4MML A;  1AWX A;  3PT9 A;  3I55 T;  2LT4 A;  5DY9 A;  3L2U A;  1K76 A;  2HL3 A;  2MI6 A;  3OYL A;  3MPU B;  4IIO A;  1FWZ A;  4ZN1 A;  2I0N A;  2D1X A;  3IQL A;  5GAO r;  1WGS A;  2BZY A;  1FMV A;  3PTA A;  2LX7 A;  2QG9 B;  2LP5 A;  4FYW B;  3FRN A;  1AWJ A;  3OS1 A;  1KG1 A;  1G83 A;  5FWB A;  3CC4 Q;  2EQK A;  1OV3 A;  2VXE A;  1VQK Q;  4AT1 B;  2K4Y A;  3GF5 A;  4QKU A;  1W70 A;  2CP6 A;  4AG2 C;  3CD6 A;  2IIM A;  2OTL T;  1QCN A;  2NYS A;  5EG2 A;  1WXB A;  3ER0 A;  2L3Q A;  2HKQ B;  3HHT B;  2K79 A;  3M5A A;  4M75 E;  5GMK h;  1I5L A;  2PU9 B;  4N4H A;  4FSX A;  3JB9 H;  1NG2 A;  1WFW A;  2RF0 A;  3QUI A;  2BZ8 A;  5AYF A;  2C0O A;  2E3H A;  4L6V 5;  4QVD A;  3TSZ A;  3T9N A;  1OU8 A;  3MEW A;  5GAO n;  4JRQ A;  1K73 C;  5LJ3 d;  3VS4 A;  1NJI C;  3JCM V;  2P84 A;  1XJW B;  1S72 Q;  3A8M B;  3CCR Q;  1UTI A;  1WQ7 A;  1YI2 T;  3CCU A;  2EW3 A;  4XAX B;  3VS7 A;  3J80 E;  4A4E A;  2NWM A;  3OYC A;  1D1A A;  1WNL A;  1KC8 U;  1HYO A;  1UHC A;  1FYN A;  1RLQ C;  5CKH A;  3V7C A;  1GXI E;  1LCK A;  1NE8 A;  2CZ6 B;  2J05 A;  1VQM Q;  2VAS A;  3HSB A;  1KD1 U;  2ABL A;  2YWW A;  3CC2 T;  2PZ1 A;  2GTO A;  2HKN A;  3CCE T;  1VQ6 T;  1UFF A;  2DA9 A;  5GAN j;  4HCZ A;  2BTT A;  4RTV A;  2ZCF B;  2E41 A;  2F5T X;  4A54 A;  4JJC A;  1VQO T;  1U3O A;  2VXF A;  2EIF A;  2KQW A;  1IO6 A;  4KT0 E;  4M77 B;  3SB2 A;  2K3X A;  5GAN e;  1JO8 A;  1C0M A;  2CGH A;  1YJ9 Q;  2KAF A;  4ELZ C;  1PG5 B;  4RUG A;  3M0Q A;  5FU6 C;  2DYI A;  1BBZ A;  2RN8 A;  4M75 D;  1UGQ B;  3WXM B;  3CC7 A;  4BI4 A;  1ZX6 A;  2XI9 A;  3FEO A;  2AK5 A;  1UDL A;  3FJP A;  4C0F A;  3GOX A;  2LC4 A;  3V8L A;  4DOV A;  5GAM d;  4M75 A;  1W2B A;  3LGF A;  5GAO p;  2V1R A;  1YHQ T;  3CCS Q;  2DXC A;  1VQN Q;  4AFU C;  1VQL Q;  4QVZ A;  2XD0 A;  2EPD A;  4GLK A;  5C0M A;  1QP3 A;  2HEQ A;  2C06 A;  2LCL A;  5KCO A;  1ZA1 B;  3TRE A;  2DD5 A;  5FRN A;  3L2Z A;  1TS9 A;  3H0F A;  3CME T;  3CCV Q;  5EC7 A;  1VQ5 Q;  1M3A A;  4OP0 A;  2M0Y A;  1QKW A;  2O4X A;  4OGC A;  1YJN A;  2FPF A;  1VQP Q;  1TWB A;  5IHK A;  2MOX A;  1Q7Y C;  2OJ2 A;  3QYH B;  1BI3 A;  2KNB B;  1M2O A;  5KYY B;  1KQ1 A;  1X27 A;  1D0Z A;  4KGX B;  4J7I A;  1BYM A;  4JS5 A;  4KRT A;  3OYB A;  4LD6 A;  1I81 A;  3QJY A;  3QXE B;  5L23 A;  1RL2 A;  4OML A;  1Q86 C;  4LDX A;  3ZFJ A;  2AHJ B;  4R56 A;  5J3B A;  2L3P A;  4PLL A;  1NZ9 A;  3QSU A;  1GBR A;  2E6Z A;  2EJF A;  3D7S B;  2DXT A;  3UA6 A;  5A0G A;  2GBQ A;  2OTJ A;  4J9D A;  4OB0 B;  3JCM h;  2G3R A;  1QVP A;  1D3B A;  2E5K A;  2V26 A;  1HD3 A;  3CMA Q;  1KD1 C;  4M7A B;  5FRM A;  1WZO A;  3E1S A;  3GIB A;  4Z88 A;  1T3L A;  4J9C A;  4HT8 A;  1I4K 1;  4QVC A;  1K8A R;  2WAC A;  3VJP A;  3RES A;  3EG9 A;  3HL8 A;  3VRY A;  1H8K A;  2K6D A;  3JSC A;  5IHI A;  3JB9 D;  3A8L B;  1X75 C;  4LDU A;  1VQK T;  1PD0 A;  1KSW A;  2NUT A;  2VKN A;  1M90 R;  1O75 A;  4F7U E;  3VYG A;  4M75 G;  1EIF A;  4J83 A;  5KYW B;  1TTH B;  2O9S A;  1VQ4 A;  2PNI A;  4ME7 A;  1N6A A;  2DRK A;  2LCC A;  1J3T A;  1KJW A;  2LMJ A;  2EYY A;  3NTK A;  1VQ8 A;  1HJD A;  4QT7 A;  1M1K R;  1UB4 A;  2F69 A;  3Q1J A;  4BY6 C;  3CEY A;  4KH1 B;  1PKS A;  2ENM A;  5D6W A;  2B86 A;  4EMK B;  3MO8 A;  4DA4 A;  1T0J A;  2COY A;  1GCQ C;  3RNJ A;  5A2Q E;  5J39 A;  5FU7 C;  4DBR A;  5GAN 7;  2KDS A;  3G71 Q;  1T3S A;  2QDL A;  1ABO A;  4M7D E;  1OZ3 A;  5A0L A;  3EFO A;  2P0Q A;  2LJ0 A;  3CCM A;  1RAF B;  3S6W A;  4HT9 A;  1H3H A;  2MWP A;  2YT6 A;  2NUZ A;  2KT1 A;  1E6H A;  3CCJ T;  4IKF A;  3MEA A;  4Y91 A;  2C0I A;  2MMP A;  2RI3 A;  1XQH A;  3JCM b;  4R0K A;  2RQR A;  4M78 B;  1WQW A;  3O5Z A;  3OSS C;  2X4Y A;  3OW2 P;  2LCS A;  4V2S A;  2DAQ A;  2L0A A;  3VS5 A;  1UE9 A;  1XTD A;  3OYY A;  2EYX A;  3JB9 F;  3RDV A;  2QQS A;  1YJ9 T;  1Q81 R;  5IH2 A;  1D1C A;  4E7H A;  4KGV B;  3OW2 S;  3CCL Q;  4FYX B;  4PLI A;  1QLY A;  4F7U A;  1N9S A;  1NLP C;  3TQ7 P;  4PJO B;  1G3W A;  1G8X A;  2EAY A;  2H3J A;  3VS6 A;  2RNA A;  2K5L A;  1YP5 A;  3SWN B;  4BE0 A;  2YHT A;  4PNO A;  2RM4 A;  3RKW A;  1H92 A;  1IGQ A;  2BE9 B;  2DF6 A;  9ATC B;  1NPP A;  2AIR B;  3OS0 A;  2HDA A;  1ZA2 B;  1N9R A;  3I55 A;  1BB9 A;  1WX6 A;  2D0Q B;  3A8G B;  1RLP C;  4FM4 B;  2G6F X;  2L3R A;  3VS0 A;  1GFC A;  3H9N A;  4M7D A;  2QA4 Q;  1VQ5 T;  4JDS A;  4DBQ A;  1MMG A;  4C0Z A;  3LW5 E;  4X9D A;  2KRM A;  1K8A U;  2GF7 A;  4JLG A;  2HZY A;  2IPO B;  4DEY A;  2KT8 A;  3EH2 A;  3M59 A;  2JUF A;  1JU5 C;  2K2V A;  3OYK A;  1GCQ A;  2DL7 A;  5CKE A;  3JB9 J;  2VYT A;  1AD5 A;  3QWY A;  1XNI A;  1M90 U;  5KYU B;  4ZNX A;  2I2L A;  1FXX A;  3HPW A;  2J6K A;  2OTL A;  4FCY A;  4BDY A;  3V7S A;  4IUU A;  2CH4 W;  1JXM A;  2DTH A;  4MDW A;  2QQR A;  1M9S A;  1WXT A;  1M1K U;  5LJ3 e;  2FZG B;  2RJC A;  1FMW A;  3LWH A;  4FYY B;  1N8R R;  4PL6 A;  3E2U A;  2PVD B;  4MZM A;  1Z9Z A;  5GAO q;  1QCO A;  4WCI A;  1W1F A;  3M4Y A;  1Q95 G;  1B34 B;  2CUD A;  3RMQ A;  4C92 B;  2DBM A;  1M4Z A;  1K9M R;  5CKD A;  1YI2 A;  4F7U G;  3RMS A;  3L2Q A;  4L59 A;  3PVQ A;  1WHG A;  5FWC A;  1TUC A;  3QO3 A;  2M9U A;  2M16 A;  2A28 A;  2FRW A;  3X25 B;  1KQ2 A;  3CC2 A;  4KUL A;  4A63 B;  5LJ5 g;  2JZ2 A;  4FT2 A;  1YWO A;  3CCE A;  1VQ6 A;  1AZE A;  1QVG P;  2R58 A;  1IB8 A;  2QQ9 A;  3RIR A;  4X1V A;  1P92 A;  2CZ1 B;  2CP3 A;  2PUK B;  3EGX B;  1VQO A;  1D1B A;  2JJ9 A;  4FW2 A;  2RQT A;  2A37 A;  4RTZ A;  1Q82 R;  1YIT T;  1Q81 U;  3OS5 A;  1K0X A;  1LVK A;  3UPU A;  2X4W A;  3EG2 A;  3QDF A;  1YJW Q;  1X6O A;  5FW9 A;  1R77 A;  1DJ7 B;  5GAM e;  1VYV A;  2DIQ A;  1QVG S;  2JS2 A;  3X28 B;  1A0N B;  3QZ9 B;  3S3N A;  2D8H A;  1HSQ A;  2K3B A;  2HAX A;  3GPL A;  3LX7 A;  4DBH A;  1RAH B;  1GFD A;  2DIL A;  1KQS P;  2KYB A;  5LJ5 d;  4EMH A;  3CPW P;  4JPB W;  1D0X A;  1M8M A;  3OYN A;  2A3L A;  4PJJ A;  2R5M A;  3FB9 A;  1LNX A;  2ED1 A;  3S3O A;  2OAW A;  2ZPB B;  3JB9 I;  1M90 C;  1V1C A;  2CT4 A;  1ZBX A;  2D9T A;  4KBM B;  3DB3 A;  1TUG B;  2QK0 A;  1WA7 A;  2Y4X A;  4CC7 A;  1QVF P;  4PFP A;  4E7J A;  1X6B A;  3MCA B;  4JJB A;  2F1L A;  3CPW S;  3CD6 Q;  3VU3 C;  5KYX A;  4C8Q C;  2E70 A;  1MV0 B;  3NPF A;  3M54 A;  3E9F A;  5LJ5 f;  4DQ2 A;  3SD4 A;  4M75 C;  2DKG A;  3ZL7 C;  2RMO A;  4J9E A;  4F16 A;  1QVF S;  2O88 A;  2O9V A;  4NS5 A;  4C8Q E;  4E7I A;  4MDX A;  2NLU A;  2MPX C;  3I35 A;  1ZUU A;  2RPN A;  4HCK A;  1JEG A;  3NFC A;  4KUD K;  3CXC A;  3UT1 A;  1UGS B;  4BD3 A;  5GAN 8;  1N8R U;  1WYX A;  5GMK j;  1MNE A;  1NLO C;  4BE2 A;  2VGM A;  1TUD A;  3CCU Q;  1UHF A;  3M0S A;  1PCX A;  2QA4 T;  5C6S A;  5GAN 5;  2FG0 A;  3EH1 A;  1ZBJ A;  2L89 A;  4XU0 A;  1IHV A;  3O8V A;  1K9M U;  1RAC B;  3M9Q A;  5I22 A;  1VQ9 T;  1MV3 A;  1YIJ T;  3QDR B;  1PSE A;  5IXB A;  2RB6 A;  1SEM A;  1Q81 C;  2YLB A;  1I8F A;  2DD4 A;  5GAO l;  3R6O A;  4XTU A;  1D0Y A;  2ZPH B;  4QQG A;  2LVM A;  3I5R A;  1VQ7 T;  1B3Q A;  1NM7 A;  2JMC A;  2EKO A;  4X34 A;  3DB4 A;  3NHN A;  3H41 A;  5GJW B;  1GL5 A;  4OB1 B;  3OW2 A;  2QGF B;  4OMM A;  2ZGW A;  4XTZ A;  4VUB A;  1SPK A;  1X2Q A;  1SF9 A;  3WVE B;  2MF2 A;  1OPL A;  3CC7 Q;  3FLG A;  2DJZ A;  1K4U S;  4OMF B;  2XID A;  5KE3 A;  2LNV A;  1Q82 U;  2LRQ A;  4KGZ B;  1D09 B;  3EG1 A;  4C8Q D;  3RR6 A;  3LLR A;  4RCC A;  5CKF A;  1TOV A;  2YRD A;  3L2V A;  2EYW A;  4XK8 E;  5GAN h;  3A8H B;  1M30 A;  2E65 A;  3CCJ A;  4XTX A;  3H0H A;  2LJ1 A;  4OMN A;  4C8Q A;  1OPK A;  3G4S T;  2LQW A;  3M0R A;  4CC4 B;  2WSC E;  3MJX A;  5CQY A;  1RAI B;  2O2O A;  3OYM A;  2X35 A;  4IUP A;  3FJ5 A;  2HQX A;  1YJN Q;  2CS7 A;  4ANJ A;  1JJ2 P;  2R57 A;  1C1A A;  2LNH B;  1S1N A;  4GLM A;  3OA6 A;  1GRI A;  2FB7 A;  2HSE B;  4J9B A;  2JNG A;  2RH2 A;  2D8J A;  2P4R A;  5D7U A;  5KYN A;  1SHG A;  4KUI A;  3OMG A;  1QWE A;  3RBB B;  3VUZ A;  3JCM Q;  2V8K A;  4P5N A;  2J6O A;  1WDX A;  1YFN A;  1KHC A;  2KYM A;  3NTH A;  4M75 B;  1N27 A;  1JJ2 S;  2KR3 A;  1BKB A;  3P8H A;  4BI3 A;  4OVA A;  2DZ9 A;  2GGR A;  3GNF B;  2OTJ Q;  4WF2 A;  2EQJ A;  3QII A;  5KH6 A;  1R0C B;  1K9M C;  5FLX E;  1PSF A;  1M2V A;  2PTK A;  3EGU A;  3FC3 A;  1PNJ A;  2YRV A;  3UDC A;  2GQV A;  3G6E T;  3GLX A;  4J6Y A;  1OOT A;  1U5S A;  3CBM A;  4C8Q F;  3P8D A;  4ORZ A;  3EGD A;  4HKE A;  2L2P A;  2ZPG B;  5J26 A;  2CZ0 B;  5HKC A;  1KC8 C;  1ZSZ A;  3EHQ A;  1WIE A;  4E7L A;  2W10 A;  3UF4 A;  1M1G A;  2HSP A;  4M75 F;  4CI0 C;  2KGT A;  3I56 A;  2EGA A;  4OF1 A;  3LH5 A;  6AT1 B;  3HFN A;  3MEV A;  3VYH B;  2LDM A;  1VQ4 Q;  1NEG A;  3L2R A;  2A0F B;  2KRN A;  5KCH A;  2ZPF B;  2LQK A;  2QEX A;  1VQ8 Q;  5KYW A;  3CC4 T;  2SRC A;  3JRZ A;  5I21 A;  4C8Q G;  2KXD A;  4AMC A;  4B6M A;  2DBK A;  1Q82 C;  4JRI A;  2CP5 A;  4F14 A;  3OYJ A;  2M0O A;  4C5I A;  1OU9 A;  2IG0 A;  1B07 A;  3CCQ A;  1XOV A;  4HVU A;  4ZGJ B;  3BW1 A;  2C0T A;  4PJN A;  2M1H A;  1I0C A;  4EMK A;  2ZZD A;  1D3B B;  3ASK A;  1FX7 A;  1NPR A;  1QVG A;  5KE2 A;  4M7D C;  2DTI A;  3CCM Q;  1ACM B;  1BI0 A;  4RTW A;  4QW2 A;  3CBO A;  4OB3 B;  7AT1 B;  3EG9 B;  4ZTF A;  2ATC B;  4L5G A;  3L1A A;  1WHM A;  3G7Z A;  3PIO A;  4NOY A;  2DL3 A;  1S72 T;  2DLP A;  5FU6 B;  1WPY A;  3CCR T;  1UJ0 A;  2E5Q A;  4FL6 A;  2RQU A;  2F2W A;  3NGP A;  5HK3 A;  2ROL A;  2KXC A;  2K5F A;  2JVV A;  1ARK A;  2KE9 A;  5D6Y A;  2M51 A;  2ZPI B;  3HTR A;  4AFZ C;  3TCJ A;  1SSF A;  4LN2 A;  3LYI A;  3OSV A;  2RHX A;  4N4I A;  1VQM T;  4BI8 B;  3CPW A;  2D0N A;  8AT1 B;  3MEU A;  2A7Y A;  1WI7 A;  4CC3 A;  4A53 A;  1LJO A;  2KK4 A;  1HK9 A;  2DXU A;  3TSW A;  3J81 E;  2LX9 A;  1WXU A;  3QPH A;  5LJ5 j;  2KRS A;  1Z9Q A;  2WSF E;  1YWP A;  3SFM A;  3EFO B;  1X43 A;  5CIU A;  1YIT A;  4FU6 A;  4LUE A;  1FMK A;  4J7F A;  5HY6 A;  2OI3 A;  1BU1 A;  4IUR A;  2QI2 A;  5GMK l;  3OYI A;  3MP1 A;  1MGQ A;  2QYZ A;  2F2V A;  5LJ5 e;  1PM3 A;  4C0D C;  4FW1 A;  1Y96 A;  4J9I A;  2EYZ A;  1ZQ1 A;  4E6R A;  3I55 Q;  3REB B;  3KXT A;  3KFV A;  2RK2 A;  2F2X A;  4LNP A;  2HBW A;  5I11 A;  2VC8 A;  3U23 A;  1KFZ A;  3CCS T;  1YJN T;  1VQN T;  2VUB A;  1VQL T;  3JCM g;  4M7D D;  2GCX A;  3PNW C;  2R5A A;  2FPE A;  3NTI A;  4FT4 A;  4BDZ A;  2DE0 X;  3C94 A;  4M4Z A;  3CPF A;  3CCV T;  2EKH A;  4TVR A;  5CO7 A;  4F7U B;  1JBM A;  2BIV A;  5IN1 A;  1IZ6 A;  1NEB A;  5IHN A;  3TU4 K;  2VVK A;  1GCP A;  2OTL Q;  1RAA B;  2J7I A;  1VQP T;  5KYU A;  3OYH A;  4GBQ A;  3M0P A;  1VIF A;  5I2S A;  2LT1 A;  1IXD A;  1SG5 A;  4RCB A;  2EQI A;  2VGN A;  2FRY A;  5CAI A;  3R6N A;  5L8R E;  2E12 A;  2YUP A;  1U8R A;  2FZK B;  3JCM d;  4JRP A;  2D6F A;  4F7U F;  4BY6 B;  2RO0 A;  2RA2 A;  1H64 1;  1YI2 Q;  4LE9 A;  1EFN A;  5LJ3 h;  1Y07 A;  2NUP B;  2E4H A;  1ZLM A;  3CMA T;  2DL4 A;  1M1F A;  1JXO A;  2HD0 A;  5FU7 B;  2QGG A;  2X3X D;  3ZEH A;  1OEB A;  4RG2 A;  1VQ9 A;  1ABQ A;  2X51 A;  3CC2 Q;  1K0S A;  1WJQ A;  1VQ8 T;  1YIJ A;  1PRM C;  2RI2 A;  4QQ6 A;  4DOW A;  3OBW A;  3CCE Q;  1VQ6 Q;  2FZC B;  2JTM A;  1Q7Y R;  2JMA A;  3NMZ C;  3JCM f;  5CR2 A;  4M7D F;  4ATO A;  2XU8 A;  2COZ A;  3M0T A;  2JT4 A;  1VQO Q;  1NBE B;  2XHC A;  4MMK A;  4Z89 A;  1BI2 A;  1WHL A;  4FIB A;  4A4H A;  4F17 A;  1G5V A;  4K11 A;  2DM1 A;  4ZGE B;  2OX7 A;  3J7A F;  3BDL A;  2J6F A;  4IUV A;  2V1Q A;  4MZT A;  2EQM A;  3CCM T;  1TXQ A;  1JJ2 A;  1KHI A;  2XMF A;  4BUG A;  2FYK A;  1MMN A;  2QAS A;  3L42 A;  2CRE A;  4JLI A;  3HRT A;  3ULR B;  1AVZ C;  1VUB A;  2Y90 A;  1U06 A;  1JQQ A;  4M7D G;  2BZX A;  1K73 U;  3G71 T;  1NJI U;  4ZN3 A;  4R55 A;  3H8Z A;  2JXB A;  5GAM h;  4LD9 K;  5IT9 E;  1AWW A;  3G4S A;  8ATC B;  2KRO A;  4J6W A;  1RAB B;  2XG8 D;  1KK7 A;  2DX1 A;  3UA7 A;  4XU3 A;  2CP2 A;  1GBQ A;  2AZS A;  2GQI A;  1OUL A;  1K8A C;  4M77 C;  1YHQ A;  2YUQ A;  1X6G A;  3VV0 A;  2QTX A;  3QKJ A;  1QCF A;  2DO3 A;  3JAM E;  3BDU A;  3VS1 A;  1MMD A;  1CKA A;  3JV3 A;  5GMK m;  3URG A;  1VA7 A;  1UG1 A;  3EG3 A;  3QBY A;  3BFM A;  3CME A;  3CBP A;  3X24 B;  2CDT A;  4A4F A;  4M77 E;  4X9C A;  1KQS S;  2HMA A; 
#chains in the Genus database with same CATH homology
 1M8V A;  3DLM A;  5D6W A;  1M1K C;  3CCL T;  3WVD B;  2QEX T;  1B34 A;  4EMK B;  5CQY A;  3RUX A;  1M5Q 1;  3OYM A;  2X35 A;  3MO8 A;  1BI1 A;  3QYG B;  4IUP A;  2DVE A;  2QQB A;  4C92 A;  4ZGD B;  5LJ3 j;  3DLL A;  3OQ5 A;  2QA4 A;  1JRI A;  2HQX A;  4DA4 A;  4PJO D;  2F5K A;  3JCM P;  2CS7 A;  5A2Q E;  5J39 A;  2DTO A;  2R57 A;  1U1S A;  2KDS A;  5FU7 C;  5GAN 7;  2XIC A;  4M7D E;  4PJO G;  1YBY A;  3OA6 A;  1OZ3 A;  3QJ6 A;  5A0L A;  3CCQ T;  2P0Q A;  4XU2 A;  3CCM A;  2FB7 A;  5DM7 R;  3S6W A;  1U1T A;  4HT9 A;  1VQ4 T;  2MWP A;  1Y71 A;  2JNG A;  2RH2 A;  3N5B B;  1W4S A;  3CMA A;  1X01 A;  4N4G A;  1VIE A;  3PFS A;  5LJ3 g;  3G6E A;  3CCJ T;  4IKF A;  4KUI A;  3OMG A;  3VUZ A;  1ZHI A;  3JCM Q;  2V8K A;  3MEA A;  4P5N A;  4Y91 A;  3C12 A;  4D6W A;  2MMP A;  2RI3 A;  4Y28 E;  1XQH A;  3JCM b;  1JB0 E;  1KHC A;  4M78 B;  1WQW A;  2B8A A;  2HNI A;  3NTH A;  4M75 B;  1N27 A;  4XTY A;  1JJ2 S;  3P8H A;  1BKB A;  4BI3 A;  4CRI A;  2KMT A;  2Y4Y A;  2X4Y A;  3OSS C;  4OVA A;  2KVQ G;  2WSE E;  3HRU A;  4OB2 B;  4ELY C;  3QHS A;  2DZ9 A;  4V2S A;  4Q5W A;  5GAN 2;  4PJO C;  2DAQ A;  2GFU A;  3GNF B;  1UGR B;  1XTD A;  3EFS A;  5GAN 4;  4WF2 A;  2EFI A;  2DPP B;  3MET A;  4J6X A;  5GMK e;  2EQJ A;  3OYY A;  3QII A;  5KH6 A;  2PVO B;  1HXD A;  1K9M C;  5FLX E;  1PSF A;  1UGP B;  4EDU A;  2KSS A;  3FC3 A;  2E6N A;  3JB9 F;  3CC4 A;  2RI5 A;  2DZC A;  2YRV A;  1Q7Y U;  3UDC A;  2QQS A;  2GQV A;  2O01 E;  3OBY A;  3GLX A;  4J6Y A;  3OYD A;  3G6E T;  1YJ9 T;  2BKD N;  1O9S A;  4E7H A;  1VQK A;  1WJS A;  3CBM A;  4C8Q F;  2BUD A;  2CYZ B;  1G3S A;  2OAU A;  1G3T A;  2JTF A;  2K57 A;  3P8D A;  2RHY A;  3UWN A;  3OW2 S;  1QW1 A;  4II1 A;  4PLI A;  4HKE A;  2ZPG B;  5J26 A;  4F7U A;  1N9S A;  4BAC A;  2CZ0 B;  5HKC A;  2XK0 A;  1KC8 C;  2P4T A;  2RJF A;  3E9G A;  4C0D B;  4M77 D;  4E7L A;  4PJO B;  1M1G A;  4M75 F;  4CI0 C;  1G3W A;  4M7A C;  2EAY A;  2H3J A;  5D6X A;  1Q86 U;  4C92 F;  3I56 A;  1G3Y A;  4RKU E;  1IRE B;  4OF1 A;  2HBP A;  3ZBD A;  5GAM j;  2K5L A;  2RD1 A;  3HFN A;  3LH0 A;  4C5G A;  3SWN B;  3MEV A;  3KUF A;  4BE0 A;  3VYH B;  2YHT A;  2LDM A;  5HK0 A;  4LDY A;  4PNO A;  2RM4 A;  3M56 A;  2ZPE B;  3INZ A;  4M77 A;  3RKW A;  3L2R A;  5KCH A;  2ZPF B;  2XDB A;  2LQK A;  2QEX A;  2PUO B;  3CC4 T;  1NPP A;  3JRZ A;  5I21 A;  3M53 A;  3OS0 A;  4C8Q G;  2EJ9 A;  3MHX A;  4C5H A;  3M55 A;  3M4G A;  3OY9 A;  1N9R A;  1Q82 C;  3I55 A;  5GAM g;  4M7A E;  4BB7 A;  4JRI A;  4JUV A;  3SDZ A;  3OYJ A;  1S72 A;  1H3Z A;  3CCR A;  4J5Y A;  2M0O A;  3V7R A;  1BIB A;  4C5I A;  2D0Q B;  3A8G B;  2IG0 A;  1RI0 A;  5GMK i;  4FM4 B;  2L3R A;  3FDR A;  3CCQ A;  1XOV A;  4M7D A;  2PQW A;  4ZGJ B;  4C92 G;  3JCM W;  3AHU A;  3BW1 A;  1VQ5 T;  5LJ3 f;  4JDS A;  3F70 A;  4BE1 A;  2M1H A;  2XKO C;  4C0Z A;  3LW5 E;  3QZ5 B;  4EMK A;  3RER A;  4X9D A;  2ZZD A;  1D3B B;  3ASK A;  3HRS A;  1FX7 A;  1NPR A;  4XTV A;  1QVG A;  2L8D A;  2GF7 A;  1K8A U;  4HCC A;  4Z02 A;  5KE2 A;  4JLG A;  1YJW A;  4M7D C;  1R8O B;  2DTI A;  1BI0 A;  4QW2 A;  1VQM A;  3CBO A;  4OB3 B;  4EMK C;  3M59 A;  2JUF A;  2K2V A;  2DK3 A;  3OYK A;  4ZTF A;  5CKE A;  3FIF A;  4L5G A;  5LL6 S;  3L1A A;  3JB9 J;  2PVG B;  2VYT A;  3G7Z A;  2RK1 A;  1XNI A;  1M90 U;  3PIO A;  4MML A;  4NOY A;  2I2L A;  3EAE A;  3PT9 A;  3I55 T;  2LT4 A;  4B9X A;  1FXX A;  3HPW A;  4J8O A;  5DY9 A;  3L2U A;  5FU6 B;  1S72 T;  1WPY A;  2OTL A;  2P0P A;  3CCR T;  4BDY A;  3V7S A;  4IUU A;  2E5Q A;  4FL6 A;  2MI6 A;  3OYL A;  4HCB A;  3H6Z A;  2DTH A;  1FWZ A;  2EQU A;  4MDW A;  4ZN1 A;  5HK3 A;  2K5F A;  2QQR A;  2XDP A;  1M9S A;  2JVV A;  1M1K U;  1WJR A;  3HP9 A;  5D6Y A;  5LJ3 e;  1WGS A;  5GAO r;  2ZPI B;  2RJC A;  3LWH A;  3GP8 A;  1GXI E;  3PTA A;  1YJ9 A;  1YJW T;  4C8Q B;  3TCJ A;  3FRN A;  4PL6 A;  1SSF A;  2PVD B;  3OS1 A;  4O6J A;  3LYI A;  3OSV A;  4M78 C;  1KG1 A;  4MZM A;  2RHX A;  4N4I A;  1VQM T;  5GAO q;  4O5V A;  4BI8 B;  3CPW A;  1N8R C;  2EQK A;  4M77 F;  3M4Y A;  2P0K A;  1B34 B;  2VXE A;  3MEU A;  2A7Y A;  3DKM A;  3RMQ A;  3E19 A;  4C92 B;  2K4Y A;  3GF5 A;  4A53 A;  4JS4 A;  4JJN K;  1LJO A;  2KK4 A;  3VKI A;  1M4Z A;  3CD6 A;  2X4X A;  1HK9 A;  5CKD A;  2OTL T;  4E47 A;  2DXU A;  3J81 E;  1YI2 A;  4F7U G;  2LX9 A;  5EG2 A;  3QPH A;  3ER0 A;  5LJ5 j;  3RMS A;  4M7A D;  1VQ7 A;  2WSF E;  3SFM A;  4M78 E;  3L2Q A;  3CCS A;  5CIU A;  1YIT A;  3HHT B;  3M5A A;  4M75 E;  4L59 A;  5GMK h;  3JCM X;  4FU6 A;  1I5L A;  2PU9 B;  1VQN A;  1VQL A;  4N4H A;  4FSX A;  4PKC C;  3JB9 H;  4LDV A;  5GAM f;  4MDX A;  1BIA A;  3QO3 A;  4J7F A;  5HY6 A;  2M9U A;  3QUI A;  4IUR A;  4LDW A;  2M16 A;  2QI2 A;  3MP8 A;  5AYF A;  2DXB A;  4B9W A;  5GMK l;  3X25 B;  3OYI A;  1KQ2 A;  4L6V 5;  4QVD A;  3MP1 A;  3T9N A;  1MGQ A;  4M77 G;  4M7A A;  3V8J A;  3CC2 A;  4KUL A;  5LJ5 e;  4C0D C;  2O4X B;  2CKK A;  5LJ5 g;  2JZ2 A;  3CCV A;  2LQ8 A;  3MEW A;  4FT2 A;  1Y96 A;  5CQX A;  5GAO n;  2X4J A;  4JRQ A;  3CCE A;  1K73 C;  1ZQ1 A;  5LJ3 d;  1VQ6 A;  1NJI C;  3OYG A;  3JCM V;  2R58 A;  1VQ5 A;  2HQE A;  4A4G A;  3KXT A;  4NL3 A;  2QQ9 A;  3RIR A;  2QDY B;  3A8M B;  4XTW A;  2RK2 A;  3SWN C;  3CD6 T;  1P92 A;  2CZ1 B;  1VQP A;  2PUK B;  1WQ7 A;  1VQO A;  4IUT A;  4RMO A;  1YI2 T;  3CCU A;  4XAX B;  2EWN A;  3J80 E;  2E1H A;  2VC8 A;  3LGL A;  4A4E A;  3OYC A;  3CCS T;  3A5Z B;  1YJN T;  2QXF A;  1WNL A;  1YIT T;  1Q81 U;  3OS5 A;  4PJO E;  1KC8 U;  3JCM e;  1VQN T;  2VUB A;  1VQL T;  1UEB A;  2X4W A;  3JCM g;  2GCX A;  3UPU A;  4M7D D;  3PNW C;  1X6O A;  2R5A A;  3NTI A;  5CKH A;  1DJ7 B;  3V7C A;  5GAM e;  2CZ6 B;  1NE8 A;  2DIQ A;  2FVU A;  2K3Y A;  4FT4 A;  4BDZ A;  3PMT A;  1QVG S;  3HSB A;  1KD1 U;  3C94 A;  3CC2 T;  3X28 B;  2JOY A;  4N0A C;  3CPF A;  3QZ9 B;  3CCV T;  5A0D A;  4TVR A;  5CO7 A;  4F7U B;  1JBM A;  2BIV A;  3MP6 A;  5IN1 A;  2XDD A;  1IZ6 A;  3CCE T;  3S3N A;  1VQ6 T;  2FL7 A;  3TU4 K;  5GAN j;  3QG1 A;  4HCZ A;  2HAX A;  3GPL A;  2ZCF B;  2E41 A;  3C4S A;  2F5T X;  3LX7 A;  4NL2 A;  4A54 A;  4ZTJ A;  1VQP T;  3JAM E;  3OYH A;  1VQO T;  5LJ5 d;  3CCU T;  1VIF A;  2VXF A;  4EMH A;  3OYA A;  3OYN A;  2A3L A;  2EIF A;  5I2S A;  2KQW A;  2R5M A;  4KT0 E;  4M77 B;  3SB2 A;  2K3X A;  1LNX A;  2LT1 A;  3FB9 A;  1V29 B;  4C0G A;  4RCB A;  5GAN e;  5CVI A;  2CGH A;  5GAN g;  2ZPB B;  3S3O A;  2KAF A;  3JB9 I;  4ELZ C;  4EMG A;  4QQD A;  1M90 C;  2VGN A;  5FU6 C;  4C5E A;  4M78 D;  1ZBX A;  2D9T A;  4KBM B;  4M75 D;  5CAI A;  1OYX A;  1UGQ B;  2FHD A;  3DB3 A;  5L8R E;  3WXM B;  5GAO m;  3CC7 A;  4IUQ A;  4BI4 A;  2E12 A;  5GAN 3;  1YCY A;  4M7A F;  2XI9 A;  2LTO A;  3FEO A;  2Y4X A;  2RJD A;  3FJP A;  1U8R A;  2E10 A;  3JCM d;  4E7J A;  4JRP A;  3MCA B;  3RKX A;  2D6F A;  3V8K A;  4F7U F;  4BY6 B;  4C0F A;  5CKB A;  3CPW S;  2RO0 A;  4M78 A;  2RA2 A;  3VU3 C;  2LC4 A;  3V8L A;  3GOX A;  4DOV A;  5GAM d;  4M75 A;  4C8Q C;  1H64 1;  2E70 A;  1W2B A;  1Y7X A;  3LGF A;  5GAO p;  5LJ3 h;  1Y07 A;  1YHQ T;  3M54 A;  3E9F A;  5LJ5 f;  2DXC A;  4DQ2 A;  3SD4 A;  5CCA A;  4M75 C;  1KQS A;  3CMA T;  4YTL A;  4QVZ A;  5FRO A;  3OS2 A;  4GLK A;  1M1F A;  4JRK A;  5C0M A;  3CXC S;  4C92 C;  2XD0 A;  1QP3 A;  2DEQ A;  2C06 A;  1OZ2 A;  2LCL A;  3HFO A;  2HD0 A;  2L5Q A;  5FU7 B;  2QQA A;  5KCO A;  3TRE A;  2DD5 A;  2DKG A;  3ZEH A;  1QVF S;  5FRN A;  4RG2 A;  1VQ9 A;  3L2Z A;  4M7A G;  1WJQ A;  3P8B B;  4NS5 A;  4UC4 A;  4C8Q E;  3CME T;  2NLU A;  4E7I A;  5CK9 A;  1YIJ A;  4QQ6 A;  2RI2 A;  4DOW A;  2V8I A;  1VQ8 T;  3CC7 T;  1LOJ A;  3OBW A;  3LWI A;  3PIP A;  2JN0 A;  3NFC A;  4KUD K;  2JTM A;  5GAN d;  3UT1 A;  3CXC A;  1UGS B;  4OP0 A;  2O4X A;  4OGC A;  4BD3 A;  1YJN A;  3JCM f;  5GAN 8;  3RKY A;  5CR2 A;  1N8R U;  5GMK j;  4M7D F;  1QVF A;  4ATO A;  3VUB A;  3G71 A;  2XU8 A;  4BE2 A;  2VGM A;  4C92 E;  4PJO A;  3M57 A;  3X26 B;  1Q7Y C;  2XHC A;  3QYH B;  4MMK A;  1BI3 A;  1AHJ B;  2QA4 T;  1BI2 A;  4FIB A;  5C6S A;  4A4H A;  5M9O A;  1KQ1 A;  5GAN 5;  4J7I A;  1BYM A;  4GY5 A;  1G5V A;  3SWN A;  4ZGE B;  2YLC A;  4JS5 A;  1TH7 A;  3JCM J;  3J7A F;  3BDL A;  3OYB A;  4IUV A;  4LD6 A;  4MZT A;  2L89 A;  4XU0 A;  5LJ5 h;  1I81 A;  2EQM A;  3O8V A;  4XU1 A;  3OYE A;  3CCM T;  1K9M U;  3QJY A;  4RG8 A;  1KHI A;  1JJ2 A;  4BUG A;  3M9Q A;  3QXE B;  2FYK A;  1RL2 A;  3L2W A;  3L42 A;  1VQ9 T;  1Q86 C;  4JLI A;  4LDX A;  2EJG A;  3PGG A;  3ZFJ A;  1MHN A;  1YIJ T;  3HRT A;  2AHJ B;  3QDR B;  1PSE A;  4R56 A;  1VUB A;  2Y90 A;  5J3B A;  2EYQ A;  4M7D G;  4HA8 A;  4PLL A;  1NZ9 A;  4OGE A;  5GAN f;  3QSU A;  2RB6 A;  2E6Z A;  5GAN 6;  2EJF A;  2DXT A;  2DIG A;  2YLB A;  5A0G A;  1I8F A;  2DD4 A;  2MAM A;  1Q81 C;  5GAO l;  3G71 T;  1K73 U;  5DLQ E;  3R6O A;  2CZ7 B;  4M78 F;  4N0A A;  4XTU A;  4ZN3 A;  2ZPH B;  4QQG A;  4E7K A;  1NJI U;  2LVM A;  4OB0 B;  3JCM h;  2G3R A;  1VQ7 T;  4MZP A;  1QVP A;  2RHZ A;  1D3B A;  2EKO A;  3BY7 A;  3H8Z A;  4X34 A;  3DB4 A;  4R55 A;  1KD1 C;  4M7A B;  5GAM h;  4LD9 K;  5FRM A;  3E1S A;  5IT9 E;  4OB1 B;  3OW2 A;  3GIB A;  3S3M A;  2ZGW A;  3G4S A;  4XTZ A;  4VUB A;  2RHI A;  4HT8 A;  1Y96 B;  4J6W A;  1I4K 1;  4QVC A;  3EFR A;  3JB9 G;  3OB9 A;  3OYF A;  3WVE B;  2WAC A;  3VJP A;  3RES A;  2XG8 D;  5IAY A;  3HL8 A;  2MF2 A;  4XU3 A;  3CCL A;  3M58 A;  3FLG A;  2OTJ A;  2DJZ A;  3JSC A;  4XQ3 A;  4OMF B;  3ME9 A;  2XID A;  3JB9 D;  3A8L B;  5KE3 A;  1K8A C;  5I2M A;  1OI1 A;  1X75 C;  2LNV A;  1Q82 U;  2LRQ A;  4LDU A;  4M77 C;  1YHQ A;  1VQK T;  4A4K A;  3TEE A;  3VV0 A;  2QTX A;  3QKJ A;  2DO3 A;  3PMI A;  1O75 A;  3A8O B;  2V8J A;  4M78 G;  3X20 B;  3LLR A;  3GNG A;  4C8Q D;  3VYG A;  4F7U E;  3BDU A;  4M75 G;  4RCC A;  5CKF A;  3HKS A;  5GMK m;  1EIF A;  4J83 A;  3URG A;  3L2V A;  2OTJ T;  2K5I A;  4XK8 E;  2RJE A;  2VV5 A;  3A8H B;  5GAN h;  1VQ4 A;  4ME7 A;  4PJO F;  3QBY A;  2E65 A;  1N6A A;  2E64 A;  2LCC A;  1W2B S;  3BFM A;  3I56 T;  4XTX A;  3CCJ A;  1QP2 A;  3NTK A;  5DLO A;  3CME A;  1VQ8 A;  3KBG A;  3OMC A;  4C92 D;  4C8Q A;  3CBP A;  1UB4 A;  2IVW A;  2F69 A;  3X24 B;  3Q1J A;  3JCM c;  4BY6 C;  4A4F A;  2RHU A;  3G4S T;  4M77 E;  4X9C A;  2MWO A;  2GFA A;  2WSC E;  3CEY A;  4EPC A;  1KQS S;  2KY9 A;  4M7D B;  3C95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...