2C06A

Nmr-based model of the complex of the toxin kid and a 5-nucleotide substrate rna fragment (auaca)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KID TOXIN PROTEIN
publication title Model for RNA Binding and the Catalytic Site of the Rnase Kid of the Bacterial Pard Toxin-Antitoxin System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2c06A00
4ELZC 4MDXA 4ELYC 5CR2A 4OF1A 4VUBA 5CKDA 4ME7A 5CKEA 5CCAA 2KMTA 5CKBA 1M1FA 4MZMA 1NE8A 2MF2A 5CO7A 5CK9A 3VUBA 3JRZA 1X75C 4HKEA 4MZTA 5HK0A 3HPWA 5CKFA 5HK3A 1UB4A 3G7ZA 2C06A 5DLOA 5CQYA 5CKHA 3JSCA 3TCJA 1VUBA 5CQXA 4MZPA 2VUBA 5HKCA 3NFCA
chains in the Genus database with same CATH superfamily
4UC4A 5AT1B 2HQEA 1UE9A 5GAMd 2XIDA 2P4RA 4PFOA 4XU0A 4OMFB 1YCSB 1K8AR 4C8QC 1YWPA 1HD3A 4CC3A 4O6JA 4N0AA 1QWEA 3H0HA 4KUIA 2K6DA 1M90R 2NUPA 4XTVA 1R8OB 2IVWA 3M0SA 5GAN5 3QHSA 1VQ8T 2EFIA 4OF1A 1YJ9A 1TXQA 4JRQA 3OYHA 1Q86R 3UF4A 9ATCB 2X9HA 3CC4A 3X24B 4IUUA 2LC4A 3JB9D 3JCMc 4IUQA 4HKEA 2DXTA 3SB2A 3QPHA 3OYBA 4OGEA 4YTLA 3CD6Q 1X6OA 3QYHB 1UGQB 1Q7YU 1YNZA 3HRTA 1OZ2A 4E7IA 4M77F 2QDYB 1N9SA 2A08A 2DBKA 3CMET 1BI1A 1X6BA 3DKMA 2PNIA 2EYQA 4E7KA 5LJ5g 3CCEA 3OYEA 5D6XA 4C5IA 2DM1A 2F2VA 4XTXA 2OTLT 2EJ9A 4DOWA 2XU8A 1JU5C 4MDWA 3JB9G 2CSIA 4AMCA 2JS2A 2I2LA 1VQKQ 1QCNA 1AWOA 4M7AB 2VKNA 3OS0A 3UWNA 3SEMA 3A8MB 3OYKA 2CUBA 2ROTA 4E7SA 3M55A 4BY6C 2DTIA 4N0AC 2EQKA 3CD6A 1VQ4T 1XQHA 1IRXA 2XK0A 3EG9A 1YITQ 2YUNA 2G3RA 2IG0A 3RBBB 3HTRA 3TSZA 2XKOC 4M7DE 1S72Q 2KSSA 4VUBA 1QP2A 2CGHA 1MUZA 3M5AA 3L42A 3REBB 1YJWQ 1VQ6T 4QT7A 3LLRA 5GAN3 1LPLA 5FU6C 2F2WA 4JLGA 2DA9A 4M78C 4X1VA 4OMMA 4M7DA 1K4US 2L3RA 1VQKA 1U5SA 1Q7YR 1PKTA 3OQ5A 4WTOB 3WVEB 1TH7A 3FDRA 3PT9A 2EQUA 5CKDA 3MKDA 4J9IA 4AFUC 2X35A 2ATCB 3MEVA 4DQ2A 1M1FA 1HXDA 1YJNA 2RJCA 2RQVA 5D6YA 3JB9H 2A37A 2LVMA 1UGPB 1G3WA 1ZBJA 4J6XA 1K9AA 1GFDA 2RQWA 2ZCFB 2MIOA 3C0CA 2KAFA 4PFZA 2RF0A 1PSFA 2VWFA 4FL6A 1BYMA 3GNFB 3VUBA 5GAOq 5FWCA 1RI9A 4J9GA 2HL3A 1AT1B 2RB6A 1WQWA 3M56A 1MNDA 2BE9B 3J81E 3J7AF 1U06A 3UA6A 4F04B 1ZUUA 3J80E 3OYFA 2GTOA 5I2SA 4C92E 3G6ET 4ELZC 3CCMQ 2RPNA 4M7DC 1VYUA 4IUVA 4C92A 2EAYA 2P0PA 5LJ3g 3QYGB 4QW2A 1UEBA 4C0FA 1B07A 2DIGA 3X25B 1AOJA 3OYDA 2DYIA 4A54A 4XTUA 1AWJA 3HSBA 2CP0A 2A28A 2YUPA 5GANj 2JMCA 5GANe 1QCOA 3CCMA 4LDXA 2CZ7B 4QVZA 3EFRA 4KULA 1BU1A 2O31A 3G4ST 3SHWA 2MWOA 3O8VA 2QG9B 1OPLA 2SEMA 3KFVA 4L59A 4NL3A 3QSUA 2DFUA 3CCUQ 1NZ9A 2D9TA 4E7LA 3ME9A 2FZKB 3THKA 3OYAA 1VQ5Q 3GBQA 2HAXA 3M54A 1BCOA 3JB9F 2GFUA 2DK3A 2DL3A 4EMHA 4E47A 2ROLA 1JXOA 2RH2A 4BI4A 4XAXB 2FYKA 4JRPA 4II1A 1KHCA 3JCMg 2E3HA 4FYWB 4KBMB 3H41A 1H8KA 2B86A 3EH2A 4KGXB 1E6HA 1NPPA 2E12A 2DRKA 5KYYA 2RN8A 4Z8AA 2H8HA 3L2UA 4M7AE 1K0XA 1LOJA 1VQ5A 5GAMg 3EFOB 2K57A 1RLQC 1I5LA 3Q1JA 4M7AA 1RABB 4PLIA 1C0MA 4GLMA 3JCMP 2L3SA 1LVKA 1M3AA 3M9QA 3C95A 2E41A 4HCZA 3EGDB 1BCMA 1VQ4Q 4ZGJB 3S3OA 3UATA 3NTHA 4C0ZA 1JEGA 1PCXA 1EIFA 2RNAA 3CMEA 3ZEHA 2P0QA 1I4K1 3OMGA 4J9CA 2DRMA 1FWZA 1VOMA 5GANh 2LT1A 1WDXA 2DAQA 1VQ6Q 2JTFA 3N5BB 5IT9E 3I35A 3CCQQ 1M3BA 1M3CA 2K7AA 2V8KA 1PD0A 2RHYA 4B9WA 1G3TA 2VXFA 2O2OA 2RHXA 5HCKA 1EZZB 1PSEA 4BY6B 1VIFA 3HRSA 3OS1A 3CMAT 5CK9A 3DB3A 2NUPB 2K79A 3I55T 1VQ4A 4RTXA 5HK0A 1N8RC 5J39A 2LCSA 2DMOA 1X6GA 1WZOA 2DYBA 2ESWA 4F7UG 1TG0A 2EPDA 1D1AA 1OYXA 1QVPA 2LQWA 2WSEE 1YHQT 1OEBA 2QK0A 3RMSA 4M78B 4JUVA 4M77A 2OTJQ 1QVGP 1VQ6A 1OOTA 1X27A 2EKHA 1YI2T 2EQJA 3UT1A 3CCQA 2V8JA 1IB8A 1D0ZA 3M0PA 3OYYA 4E2FB 5KE3A 3TQ7P 4LDWA 2F69A 3E9GA 2AIRB 5IXBA 4PK4A 2XD0A 1VQOT 1VQMQ 3UA7A 2RO0A 2AT1B 3E2UA 3V7RA 4DBQA 4GLKA 1SRMA 1G5VA 4FU6A 3CCLQ 2RI5A 4CI0C 5GMKl 2NUZA 4FW1A 2OJ2A 4J9HA 1AD5A 1H641 2HBWA 1K76A 2JM9A 1UUEA 3JCMW 1OU8A 4C5HA 4JJCA 3CXCA 3MP6A 3MEUA 3PVQA 3FB9A 4XQ3A 2BUDA 2NLUA 3CBMA 1TU0B 4CRIA 2PTKA 1U8RA 2X4XA 1KFZA 2LCLA 2QQSA 2R5MA 1G8XA 2DO3A 4LE9A 1RAFB 5DLQE 2LJ0A 2L89A 1ZQ1A 4XK8E 2QEXQ 3H0IA 2M0OA 3RIRA 2GQIA 3HRUA 4OMNA 5A2QE 4M77C 4RG8A 2XDBA 4M7DB 3G6EA 2E65A 2HNIA 2V8IA 1OI1A 2CP2A 5CIUA 5GANf 3LYIA 2JTMA 1NYGA 5LJ3d 2F5TX 4QVDA 1KC8U 2RK2A 1ZUKA 1S1NA 3REAB 2GCXA 4Z88A 1V76A 4ZNXA 1K9MU 4M75D 5KYNA 1UGVA 2HQHA 3MHXA 1BI0A 1NG2A 1MMGA 2VB6A 1KIKA 2LJ1A 1RL2A 1ZBXA 4N4HA 3G4SA 2DILA 3SWNC 1UTIA 1VQPT 4EMKA 4OMOA 4LUDA 4TVRA 1BK2A 2D8HA 4RTYA 5LJ5j 1X43A 5LJ5e 3QJ6A 2FB7A 4M75G 1JJ2S 6AT1B 4WCIA 4XU2A 3G7ZA 2O01E 2V1RA 4Z02A 4QQ6A 2FL7A 3EFOA 3LW5E 2DERA 2GBQA 4PJOD 2RJDA 1OX8A 3VYGA 2E70A 4C8QD 3JCMd 3EGDA 3FC3A 2COZA 3CC7T 1OPKA 3ZFJA 4QVCA 4ZTFA 1YIJT 2DVJA 2MAMA 1KC8R 4A4GA 4F7UF 2O9SA 2L0AA 1NLOC 4FCYA 5A0GA 4QKUA 4AG1C 2W10A 2JT4A 1K9MR 4BACA 2J6KA 3RDVA 2Y4XA 2PVOB 4HT9A 1PM3A 1ACMB 4PJOG 3G1JA 4PNOA 3NHNA 2V1QA 1UJ0A 4RMOA 4O5VA 1N8RU 1RAIB 2JVVA 3CMAQ 2C06A 2FRYA 1Y7XA 3URGA 3CCEQ 2PVDB 5CKHA 2XDPA 4EMKC 1I1JA 2DXCA 3FJPA 1XTDA 3CCRT 4KH1B 2RA2A 1QVFS 1IHWA 5D7UA 3C94A 4M78E 3HFOA 4LXCA 4D8KA 2MK5A 1ZUYA 1KQSA 4N4IA 2PUKB 3EAEA 1D1CA 5HK3A 4M78A 1WGSA 2HQXA 5GAN4 2ZPIB 4ORZA 1M5Q1 3CPWP 1R0BG 1W6XA 3VS0A 1YWOA 2LX7A 1GCQA 5D6WA 3CMAA 2EYYA 3PVLA 5LJ5h 4HT8A 3I55A 5KYYB 3T9NA 1MGQA 3E9FA 4FYYB 2JXBA 4GY5A 1M1KC 1AVZC 4OGCA 4J9DA 5HKCA 1YHQA 3X26B 1NPRA 1Q82C 2RQUA 3OW2P 1G3YA 1Q81U 1I8FA 1YI2A 2JN0A 4BUGA 4PL6A 4GBQA 4AT1B 5LJ3e 4B9XA 3M58A 2EQMA 3INZA 4J9EA 1O75A 2DPPB 1YJNQ 2X4WA 3VS2A 2E5QA 3CBOA 3OYIA 2CDTA 1WX6A 3QJYA 2CKKA 3OY9A 3PE0A 3X20B 2FRWA 3VS1A 3RR6A 1E6GA 5GAOp 2OX7A 2LMJA 1WPYA 1R77A 7AT1B 1ARKA 1HSQA 3JB9I 5GMKi 4FYXB 2JM8A 3LH0A 2LRQA 2M16A 3LWHA 1GCQC 2J06A 2ENMA 3A8HB 5CCAA 3OYJA 5ECAA 2H3EB 3VU3C 3I9QA 4M75F 3HKSA 1JJ2P 2XMFA 1SF9A 2EWNA 2CREA 4FW2A 4RG2A 3SFMA 3GLXA 5KYWB 3G71T 3S6WA 4E6RA 4M77B 4RUGA 4OMQA 1M4ZA 4DBHA 2E1HA 3VS3A 3QUIA 4MMKA 4X9DA 2RK1A 1Q81R 4XU1A 3JCMe 2MOXA 1BKBA 2PZ1A 1UGSB 2DJQA 4EDUA 1Y96B 1K73C 1O9SA 1X2KA 4PLLA 5EG2A 3BFMA 2A0FB 2J6OA 4LDYA 4RTUA 5KYXB 2D8JA 1PG5B 2BZYA 1XOVA 3O5ZA 4XTWA 1SEMA 1AHJB 2DKGA 2F2XA 4PJOF 5GAMj 2HMAA 5GAMe 1QVGS 4R56A 2FHDA 3R6NA 4C8QF 1WHKA 4AG2C 1CSKA 2GNCA 3D7SB 5IH2A 2DF6A 2M02A 2QXFA 3SWNB 2BKDN 4L6V5 1IREB 5J26A 4QQGA 1QVFP 1VQPA 2PU9B 3LX7A 4AFZC 1T0HA 5FWBA 1BIBA 3VRZA 3SD4A 2DBMA 3VKIA 5GMKm 3GF5A 4C92D 1IXDA 2FZGB 1PRMC 4HA8A 4ESRA 4HCCA 1K1ZA 2E10A 1T0JA 1ABOA 3L2ZA 3PMIA 2KROA 2VXEA 2DLPA 1OULA 1W2BS 2K5LA 1VQ8Q 3CCRQ 2GGRA 1YIJA 1CKAA 4J5YA 3PIPA 3H6ZA 3FLGA 2JUFA 3SDZA 5CQXA 5GMKe 2BZXA 1ZLMA 1PKSA 2RMOA 2JTEA 1RLPC 5GAOr 4JJBA 2KE9A 2Z0WA 4C92G 1WI7A 3P8DA 4D6WA 2GFAA 2HKQB 3JCMX 1Y07A 1JQQA 4JS4A 4CC7A 4E7ZA 2FPFA 2DZCA 3CMEQ 2D6FA 1BI3A 2AHJB 1TUDA 1A0NB 4EMKB 5I21A 2HCKA 3OS5A 2A36A 2LDMA 1QKWA 8AT1B 2JS0A 1VQ8A 2OTLQ 3CCRA 2XHCA 1Q82U 2K5FA 1AWXA 4PJNA 4LNPA 4OB0B 1D09B 1MMAA 1PHTA 5I11A 5GAMh 4KUDK 2A3LA 2Y4YA 2BZ8A 4X34A 1UHCA 4A4KA 4OB2B 1VQLT 2FG0A 4AFSC 3BW1A 1EX4A 3RNJA 1M90C 2K9GA 2KR3A 1KK7A 4Y92A 1BIAA 1BB9A 1U3OA 2EGAA 2RHUA 4BDZA 2EJFA 8ATCB 2CSQA 2C0IA 3BDUA 1MV0B 4XTZA 1IGQA 2RHZA 4FSXA 2NYSA 4IIOA 2EVRA 1JRIA 2OTLA 1WYXA 3UDCA 3V8LA 2DD4A 4M7AD 1C6VX 1WHJA 5GAN2 3L2RA 2DD5A 3LH5A 4ZTJA 4ZGDB 5GANg 1OZ3A 2WSFE 3NTIA 5FLXE 2Y90A 2ZPHB 2P84A 1T3SA 2F1LA 3PMTA 3VRYA 1QMCA 1ZA2B 3JV3A 2YXYA 4M77E 1Q82R 1KHIA 2CT3A 4HVUA 3G71Q 3OSVA 3U23A 1Q95G 5A0DA 4QQDA 5KYWA 2CH4W 2DEQA 4BB7A 5CKBA 3C4SA 2DIQA 2DJZA 2BE7D 4BE2A 4M7AG 1X75C 2HEQA 2HKNA 4X9CA 1K73U 3TSWA 2KYBA 5GAN8 4CC4B 1HJDA 4DA4A 3JCMQ 1OQKA 4MDXA 4J6YA 2ED1A 1Y96A 5M9OA 1MNEA 2O4XA 1GFCA 4XU3A 2E4HA 2BIVA 1YN8A 4ZN1A 5KYXA 2RJEA 1R0CB 1JB0E 3G6EQ 3CD6T 3BY7A 2HSEB 1X69A 3VS5A 4NOYA 5CVIA 5DY9A 4PJLA 4J8OA 1IGUA 1N5ZA 3G71A 4JRKA 1LCKA 2QYZA 1Q7YC 1FMKA 1QW1A 2C0TA 3CCJT 3MEAA 4HCKA 3CPWS 2K3XA 1LNXA 4MMLA 3I56T 1W2BP 3GOXA 3GIBA 2CP7A 4KGVB 5IXFA 3SWNA 4MZMA 1M8MA 2NUTB 2LCCA 1C1AA 4HVWA 1U1TA 4RTWA 3EGXA 3JCMJ 1QCFA 1UB4A 5FRNA 1N27A 2FEIA 2E6ZA 3DB4A 3QKJA 2K3BA 2JNGA 4J9FA 4C92F 1IO6A 1YFNA 4KH0B 3ZL7C 1I07A 2DETA 2X3XD 2HSPA 5GAOn 3G4SQ 1YITT 3OW2S 4OMPA 1K73R 1NBEB 2H3JA 1PD1A 3EG2A 1ZSZA 1BBZA 5CKFA 2DL4A 2I0NA 3A8LB 4OB1B 1S72T 1GL5A 3VS4A 1YJWT 3MJXA 2JW4A 1SRLA 5J3BA 5FU7C 2DEUA 5IHIA 3HP9A 2L3PA 2YRDA 2L2PA 3P8BB 3L2WA 4Q5WA 1JXMA 4J7IA 1AZEA 3E19A 1TSFA 3M4YA 4JPBW 2BTTA 1V1CA 1VUBA 2MWPA 2EBPA 4MZPA 2F5KA 2QTXA 4P5NA 2O88A 3TVTA 4PJOE 4JRIA 1QP3A 1QVGA 1Y71A 4A53A 1I5OB 4PJOA 5FRMA 1M2VA 1OU9A 3X28B 3RMQA 3QWXX 1PNJA 3CCVT 1WNLA 4BDYA 3DLLA 3A8GB 2K5IA 3R6OA 2KXCA 4EPCA 3FIFA 4M75C 1ZSZC 1D3BA 1NE8A 2HZYA 1P92A 3M0QA 2VC8A 2P4TA 4K11A 1CKBA 3CCMT 1B7TA 2EQIA 2FPDA 2KYMA 2KT8A 4FM4B 2KGTA 1GCPA 1ZA1B 4KRTA 1NJIC 5IHKA 2QAZA 3QWYA 4RTTA 3HFNA 2EKOA 4M7AF 3QO3A 2QA4T 2FPEA 4IUPA 3OB9A 1YCYA 5FW9A 2QTVA 5EC7A 2XG8D 2YUOA 1SKUB 4R0KA 4C8QG 1VQLA 1K0SA 2KI7A 3KBGA 2JMAA 4BI3A 3H8ZA 3JB9J 3I55Q 2R58A 4ANJA 2KRSA 2GTJA 1WA7A 2LJ3A 4PJOC 1Y57A 3WVDB 1WHHA 2YLCA 1YHQQ 2RJFA 3H0FA 5KYUA 2NWMA 1OX9A 2KXDA 1F1BB 3NTKA 3CQTA 2VVKA 1YI2Q 3LWIA 1G2BA 5KH6A 3CCUT 3QIIA 2EIFA 2DVEA 2EYXA 3QDFA 1VQ5T 2KBTA 5IAYA 1VQOQ 3JCMb 1IHVA 5GANd 1VQ7T 3KUFA 1RI0A 1I0CA 3RKXA 1WXBA 3M0TA 2M1HA 5C0MA 1TWBA 4FT2A 1ABQA 1SHGA 1KG1A 2GF7A 4DOVA 1N6AA 2COYA 3EHQA 1WJQA 1TUCA 2KDSA 3DLMA 3NGPA 4C5GA 3V8KA 4BI8B 1H3ZA 3CEYA 4M78D 2DX1A 4FYVB 3CCJQ 2RM4A 1D1BA 1PWTA 3QXEB 2J7IA 2ZAEA 4F7UB 4E7HA 5LJ3j 3I56Q 1KQ2A 1N8RR 5KE2A 2EJGA 3CC2T 3EH1A 1WHMA 3VS6A 2NUTA 4J9BA 1XNIA 2M0YA 2XICA 3H9NA 2WSCE 2YSQA 1VQOA 2C0OA 4FIBA 2ZPGB 1UHFA 4HVVA 5IN1A 4BD3A 1WQ7A 5I22A 4PJJA 4OP0A 2HL5C 1UGRB 1UG1A 1NYFA 4LD9K 2JJ9A 2ZPBB 4M78G 3VJPA 2CZ6B 1KD1C 1QQJA 2LTOA 4OB3B 2YWWA 4Z89A 1SPKA 1ZSGA 2L5QA 1FMWA 1JBMA 3CCJA 2HDAA 2LT4A 4J7FA 4WF2A 4HXJA 3I56A 3M57A 4Y28E 1G83A 3CXCS 3MPUB 4LDUA 3CBPA 1Z9ZA 3CCQT 2DL8A 1BI2A 2YLBA 2RI3A 5L8RE 2COWA 3M0UA 3BE3A 2QGFB 3VYHB 5LL6S 4C0DB 4CC2A 2PVGB 4M7DD 1FMVA 2KEAA 2KY9A 3OMCA 3RERA 2LZ6B 3OYGA 2QI2A 4OVAA 1YITA 3NPFA 1GBRA 1VQPQ 2KT1A 3PFSA 2VASA 2E6NA 1NEBA 5IHNA 3A8OB 2O4XB 3PTAA 1S72A 3CPWA 3FRNA 5FU7B 2OTJT 1YJWA 4FT4A 1TTHB 4D8DA 1TS9A 2ECZA 1LJOA 2DZ9A 1RAEB 3CCVQ 4JZ3A 2LQNA 4RTZA 1DJ7B 3EG3A 3HL8A 1H92A 3QG1A 2M51A 4M7DG 5LJ5f 3NMZC 4KT0E 1FYNA 4LD6A 3OYCA 1B34B 4RKUE 1VQMT 2QQBA 5GAN7 2R5AA 5LJ3h 3HPWA 2X51A 1D0YA 4XTYA 1MV3A 4BE0A 2R57A 1G3SA 1UECA 3CC7Q 2E5KA 1WXUA 1NJIU 1YIJQ 1V29B 4J6WA 3OW2A 4ELYC 5CR2A 3CCLT 4PKCC 2FO0A 3EGXB 4R55A 3MP8A 2JOYA 3A1PA 2DTOA 1VQ9T 1NEGA 3CCST 1SG5A 5GAOm 1MMDA 3CCVA 2QA4Q 5CQYA 2QQAA 4JDSA 3TREA 2DTHA 1NLPC 2CS7A 4RCBA 4RCCA 2YRVA 4M75B 1ZSZB 2QEXT 4A4HA 1WLPB 3MCAB 4A4EA 3CC7A 1ZX6A 2O9VA 2LQKA 1X01A 1YBYA 2XDDA 2AZVA 3TCJA 5GMKj 1XJWB 2CUDA 2CP5A 3ER0A 2VGNA 1WXTA 2LNVA 4DBFA 2GQVA 5GAN6 4ME7A 4OMLA 2CYZB 1VQNT 1JJ2A 2HD0A 5CO7A 2V26A 3L2QA 3JCMh 2QA4A 4HCBA 4DEYA 1VYVA 4LDVA 1W1FA 3F70A 1SHFA 1TOVA 1VIEA 1KC8C 1NJIR 2K2VA 3VV0A 1M1KU 4V2SA 1RAAB 4JZ4A 1VQ7Q 2FZCB 3S3NA 1Y0MA 2EGEA 2KQWA 2DXUA 4C92C 3NFCA 4PJOB 2HBPA 2E64A 3QDRB 1W70A 1K9MC 1M2VB 1WJSA 4F16A 5CKEA 3EGUA 1NM7A 2YRCA 3RKWA 4C8QB 4JS5A 2RD1A 2D1XA 4M78F 2DL5A 2RQRA 4DBRA 4F7UE 1K8AC 3OBYA 3L1AA 1KQSS 2LNHB 3META 3A5ZB 1M9SA 1Z9QA 2VUBA 1D3BB 4JLIA 4F7UA 1AEYA 3CCUA 3CXCP 3CC2Q 1RAHB 2WACA 2YDLA 1UJYA 2XI9A 3M53A 4Y91A 1WHGA 3QBYA 1Q86C 3OYMA 2ZPFB 5LJ3f 1VQ7A 1IZ6A 1QWFA 2DL7A 3V7CA 2J6FA 2MYSA 4IIMA 5GJWB 1KD1U 3C12A 1ZHIA 3I5SA 2E3IA 3TEEA 2OAWA 1QVFA 2VGMA 1AZGB 2QASA 2QQ9A 3IQLA 1YJ9T 2FVUA 2KMTA 2K3YA 3CC4T 1QKXA 1UFFA 5LJ5d 4M4ZA 1M30A 4JJNK 1OV3A 2ZPEB 4RTVA 3M59A 1M1KR 2ABLA 4N4GA 1M2OA 2SRCA 3FEOA 3CC2A 4L5GA 4ZGEB 4IKFA 2AK5A 2J05A 4IURA 5GMKh 4FSSA 1KSWA 5KYUB 1GRIA 1EFNA 4M7DF 2K2MA 2YUQA 3CCET 1I81A 5HY6A 3WXMB 1M1GA 2L8DA 2W0ZA 4IUTA 2MCNA 4C5EA 3E1SA 2AKLA 4NL2A 4E7JA 1E7OA 5GJVB 2CH4A 4AFQC 1AWWA 1U1SA 4C0GA 3A98A 2RI2A 4NS5A 5FU6B 3OYLA 3EG0A 3S3MA 2D0NA 3CPFA 4M7AC 3JCMf 5GAOl 1M8VA 2CZ0B 3KXTA 2AZSA 2B8AA 1KD1R 3OS2A 5A0LA 5KCOA 1WIEA 2RHIA 4M77D 1B3QA 3UPUA 1SSFA 1RACB 1B34A 3RKYA 3LGLA 2K4YA 3M4GA 1VA7A 3VS7A 5GAMf 3M0RA 2EYZA 3P8HA 1MHNA 3VUZA 1QLYA 3JRZA 1RADB 2CZ1B 2RQTA 2X4JA 2PQWA 3EFSA 4MZTA 1D0XA 3EG1A 1VQ9Q 1VQKT 3L2VA 3CCSQ 2OTJA 2YHTA 2DXBA 4C0DC 4A63B 1Q81C 4M77G 2L3QA 3JAME 1WHLA 3EG9B 2D0QB 3FJ5A 3GP8A 1X2QA 2M9UA 4M75E 1YJNT 3MEWA 1TUGB 1J3TA 1VQMA 2OAUA 3QZ5B 1PRLC 4JJDA 4M75A 2PUOB 2LX9A 3JCMV 1HK9A 2QGGA 5AYFA 3OBWA 3BDLA 2ED0A 4PFPA 5C6SA 3I5RA 3OSSC 2KVQG 3RUXA 3CCLA 3PIOA 1GXIE 1YP5A 2OI3A 4EIKA 2ZZDA 2DNUA 1VQ9A 2X3WD 1KQ1A 4LUEA 2JZ2A 3CCSA 2ZGWA 2MMPA 2CP6A 2VYTA 1KQSP 1VQNQ 2KNBB 1FX7A 3AHUA 3EHRA 2KK4A 5I2MA 3HHTB 3ULRB 2YT6A 4PJMA 1UDLA 1N9RA 1WFWA 3TU4K 1JO8A 1HYOA 2QEXA 2X4YA 2MF2A 4C8QE 5KCHA 3RESA 2P0KA 1K8AU 3QZ9B 4ATOA 3PGGA 4C8QA 4ZN3A 1M90U 4J83A 2QQRA 5FROA 4A4FA 2LP5A 1WJRA 2LQ8A 1VQLQ 1MMNA 2KRNA 1T3LA 1VQNA 3MP1A 1PC0A 5L23A 1Q86U 4B6MA 1VYTA 3GNGA 4F14A 1H3HA 2G6FX 3AT1B 1RUWA 2A7YA 2EGCA 3V7SA 1W4SA 2AKKA 5DLOA 1RAGB 2IPOB 4C92B 3PNWC 4KGZB 4F17A 1W2BA 1M27C 3MO8A 1FXXA 2KRMA 1KJWA 2EYWA 3V8JA 5DM7R 3ZBDA 4DEXA 1SSHA 3OYNA 3OA6A 1GBQA 1YJ9Q 2EW3A 2DE0X 4EMGA 4LN2A 3CC4Q 2MI6A 2QDLA 2VV5A 3LGFA 2IIMA 2CP3A 2CT4A 2MPXC 4BE1A 3ASKA 3GPLA 3JSCA 5CAIA
chains in the Genus database with same CATH topology
1VQ8A 3MEUA 4UC4A 2KY9A 2XHCA 3OMCA 3CCRA 3FB9A 4XQ3A 1Q82U 3RERA 2BUDA 3OYGA 2NLUA 2K5FA 3CBMA 2HQEA 2QI2A 5GAMd 4CRIA 4OB0B 4OVAA 2X4XA 1YITA 1U8RA 2LCLA 5GAMh 4KUDK 2QQSA 2XIDA 2R5MA 4XU0A 2DO3A 4OMFB 3PFSA 2A3LA 2Y4YA 4C8QC 5DLQE 2E6NA 4O6JA 4X34A 2L89A 1ZQ1A 4XK8E 3A8OB 4N0AA 2O4XB 3PTAA 1S72A 4A4KA 4OB2B 3CPWA 3FRNA 2M0OA 3RIRA 5FU7B 1VQLT 4KUIA 3HRUA 2OTJT 1YJWA 3BW1A 4FT4A 4XTVA 5A2QE 1R8OB 2IVWA 4M77C 4RG8A 3QHSA 1LJOA 2DZ9A 5GAN5 2E65A 3G6EA 1M90C 1VQ8T 4M7DB 2HNIA 2EFIA 4OF1A 1YJ9A 1BIAA 2V8IA 1OI1A 4JRQA 3OYHA 2RHUA 1DJ7B 4BDZA 2EJFA 3CC4A 5CIUA 3HL8A 3X24B 3QG1A 4IUUA 5LJ5f 4M7DG 2LC4A 5GANf 3LYIA 4KT0E 4LD6A 3OYCA 3JB9D 3JCMc 2JTMA 1B34B 4IUQA 3BDUA 4RKUE 4HKEA 1VQMT 2DXTA 4XTZA 2QQBA 5LJ3d 2F5TX 5GAN7 2RHZA 2R5AA 4FSXA 3SB2A 5LJ3h 3HPWA 3QPHA 1JRIA 4XTYA 2OTLA 3OYBA 4OGEA 4YTLA 4QVDA 4BE0A 2R57A 1KC8U 2RK2A 1G3SA 1X6OA 3QYHB 1NJIU 1UGQB 1Q7YU 3UDCA 3HRTA 1OZ2A 3V8LA 1V29B 4E7IA 2GCXA 4J6WA 2DD4A 4M77F 3OW2A 4ELYC 5CR2A 4M7AD 3CCLT 1K9MU 2QDYB 1N9SA 4M75D 4PKCC 3CMET 4R55A 3MP8A 1BI1A 3MHXA 5GAN2 2JOYA 3DKMA 2DTOA 2DD5A 3L2RA 1VQ9T 4ZTJA 2EYQA 4ZGDB 4E7KA 5LJ5g 3CCEA 5GANg 3CCST 3OYEA 1BI0A 5GAOm 1OZ3A 2WSFE 5D6XA 4C5IA 3NTIA 4XTXA 2OTLT 2EJ9A 1RL2A 5FLXE 4DOWA 2Y90A 1ZBXA 3CCVA 2ZPHB 2XU8A 3PMTA 4MDWA 5CQYA 4N4HA 3JB9G 2QQAA 4JDSA 3TREA 3G4SA 2DTHA 4M77E 2CS7A 2I2LA 4RCBA 2YRVA 4RCCA 3SWNC 1VQPT 1KHIA 4M7AB 3OSVA 3OS0A 3UWNA 4EMKA 5A0DA 4M75B 3A8MB 4TVRA 4QQDA 3OYKA 2DEQA 2QEXT 4BB7A 5CKBA 3C4SA 2DIQA 2DJZA 3M55A 4A4HA 5LJ5j 4BY6C 2DTIA 3MCAB 4N0AC 4A4EA 3QJ6A 5LJ5e 4BE2A 4M7AG 2EQKA 3CD6A 1X75C 2FB7A 3CC7A 1VQ4T 4M75G 2LQKA 1XQHA 4X9CA 1K73U 1X01A 1YBYA 1JJ2S 4XU2A 3G7ZA 2O01E 2XK0A 2XDDA 4Z02A 2G3RA 4QQ6A 5GAN8 2IG0A 2FL7A 3LW5E 3TCJA 5GMKj 4DA4A 3JCMQ 3ER0A 2VGNA 4MDXA 2LNVA 4J6YA 4PJOD 1Y96A 2GQVA 5GAN6 2XKOC 5M9OA 4M7DE 2O4XA 2RJDA 2KSSA 4XU3A 4VUBA 1QP2A 4ME7A 2CGHA 2BIVA 3M5AA 3L42A 2CYZB 3VYGA 4ZN1A 2E70A 3LLRA 1VQ6T 1VQNT 5GAN3 5FU6C 2RJEA 4JLGA 2HD0A 4C8QD 4M78C 1JB0E 3JCMd 1JJ2A 5CO7A 3L2QA 4M7DA 3FC3A 3JCMh 2QA4A 4HCBA 3CD6T 3BY7A 4LDVA 3CC7T 3F70A 3ZFJA 2L3RA 4QVCA 4ZTFA 1YIJT 2MAMA 4NOYA 5CVIA 1VQKA 5DY9A 1VIEA 4J8OA 4A4GA 4F7UF 1KC8C 2K2VA 3G71A 4JRKA 3VV0A 1M1KU 4V2SA 3OQ5A 5A0GA 1Q7YC 3S3NA 2KQWA 3WVEB 1TH7A 2DXUA 4C92C 3NFCA 1QW1A 3FDRA 3CCJT 3MEAA 3PT9A 4BACA 2HBPA 2E64A 3QDRB 3CPWS 1K9MC 2K3XA 4PJOB 1WJSA 2EQUA 1LNXA 5CKDA 4MMLA 2Y4XA 3I56T 3GOXA 2PVOB 3GIBA 5CKEA 2X35A 4HT9A 3MEVA 3RKWA 4DQ2A 3SWNA 1M1FA 4C8QB 4JS5A 4MZMA 2RD1A 1HXDA 2LCCA 1YJNA 2RJCA 4PJOG 4M78F 4PNOA 5D6YA 1U1TA 3JB9H 3JCMJ 4F7UE 2LVMA 1UB4A 4RMOA 4O5VA 3OBYA 1N8RU 1UGPB 2JVVA 1G3WA 3L1AA 2C06A 1N27A 1KQSS 1Y7XA 2E6ZA 4J6XA 3DB4A 3META 3A5ZB 3URGA 2PVDB 5CKHA 2XDPA 3QKJA 4EMKC 1M9SA 2VUBA 1D3BB 4JLIA 2JNGA 2DXCA 4F7UA 3CCUA 2ZCFB 3FJPA 1XTDA 4C92F 2KAFA 2WACA 3CCRT 2XI9A 1QVFS 2RA2A 3M53A 4Y91A 5GAOn 1PSFA 1YITT 3QBYA 3C94A 4M78E 3OW2S 1Q86C 3HFOA 4FL6A 1BYMA 3GNFB 3VUBA 5GAOq 2ZPFB 3OYMA 5LJ3f 1VQ7A 1IZ6A 1KQSA 4N4IA 2H3JA 2PUKB 2RB6A 3EAEA 3V7CA 1WQWA 3M56A 5CKFA 5HK3A 4M78A 1WGSA 3A8LB 4OB1B 3C12A 1S72T 1KD1U 2HQXA 5GAN4 3J81E 2ZPIB 1ZHIA 3J7AF 3J80E 1M5Q1 1YJWT 3TEEA 3OYFA 1QVFA 2VGMA 5J3BA 5FU7C 5I2SA 4C92E 3HP9A 3G6ET 4ELZC 2QQ9A 1YJ9T 4M7DC 2FVUA 3P8BB 4IUVA 2KMTA 2K3YA 4C92A 2EAYA 3CC4T 3L2WA 5D6WA 3CMAA 4Q5WA 5LJ5d 2P0PA 4J7IA 5LJ5h 5LJ3g 4JJNK 4HT8A 3I55A 3QYGB 2ZPEB 3M59A 1MGQA 3T9NA 4N4GA 3E19A 3E9FA 3FEOA 4QW2A 3M4YA 4GY5A 1M1KC 3CC2A 4L5GA 4ZGEB 4IKFA 1UEBA 4C0FA 4OGCA 2DIGA 1VUBA 2MWPA 3X25B 4MZPA 2F5KA 2QTXA 4IURA 5HKCA 1K8AC 4P5NA 1YHQA 3X26B 5GMKh 1NPRA 3OYDA 1Q82C 4A54A 4PJOE 4JRIA 1QP3A 4XTUA 1QVGA 1Y71A 4A53A 4M7DF 1G3YA 3HSBA 1Q81U 1I8FA 1YI2A 2JN0A 3CCET 1I81A 5HY6A 3WXMB 1M1GA 4BUGA 4PL6A 5GANj 2L8DA 5FRMA 4PJOA 5GANe 3X28B 5LJ3e 4B9XA 3M58A 2EQMA 4IUTA 3RMQA 3INZA 3CCMA 4LDXA 1O75A 3CCVT 2DPPB 2CZ7B 4QVZA 4C5EA 2X4WA 3E1SA 3EFRA 4KULA 4NL2A 3G4ST 4E7JA 1WNLA 4BDYA 3DLLA 2E5QA 2MWOA 3CBOA 3A8GB 3O8VA 3OYIA 1U1SA 4C0GA 5FU6B 2K5IA 2RI2A 3QJYA 2CKKA 4NS5A 3OYLA 3S3MA 4NL3A 3CPFA 3R6OA 4L59A 4M7AC 4EPCA 3FIFA 3QSUA 3OY9A 3JCMf 2XDBA 4M75C 3X20B 5GAOl 1D3BA 1M8VA 1NE8A 2CZ0B 3KXTA 1P92A 2B8AA 1NZ9A 5GAOp 2D9TA 3OS2A 4E7LA 2VC8A 3ME9A 1WPYA 2P4TA 3OYAA 5A0LA 5KCOA 3M54A 3CCMT 2HAXA 3JB9F 2GFUA 2RHIA 4M77D 4FM4B 3JB9I 5GMKi 3UPUA 1NJIC 2DK3A 4EMHA 3LH0A 1SSFA 2LRQA 1B34A 2M16A 4E47A 3RKYA 3LWHA 3LGLA 2K4YA 2RH2A 3HFNA 3M4GA 4XAXB 4BI4A 2FYKA 3A8HB 2EKOA 4II1A 5CCAA 4JRPA 1KHCA 5GAMf 3OYJA 3JCMg 4M7AF 3VU3C 3P8HA 1MHNA 3QO3A 4KBMB 4M75F 3VUZA 2QA4T 3HKSA 3JRZA 2CZ1B 2X4JA 2EWNA 4IUPA 3OB9A 2PQWA 1YCYA 3EFSA 4MZTA 1VQKT 2XG8D 4RG2A 3SFMA 3L2VA 3GLXA 3G71T 4C8QG 1VQLA 3S6WA 4M77B 2OTJA 1M4ZA 3KBGA 4BI3A 2E1HA 3H8ZA 1NPPA 2YHTA 3JB9J 2DXBA 2E12A 2R58A 3QUIA 4MMKA 4X9DA 2RK1A 3L2UA 4C0DC 4PJOC 1Q81C 4M77G 3WVDB 4M7AE 3JAME 2D0QB 3GP8A 1LOJA 2M9UA 1VQ5A 5GAMg 2YLCA 4M75E 4XU1A 3JCMe 1YJNT 1BKBA 3MEWA 2K57A 2RJFA 1UGSB 1VQMA 1I5LA 2OAUA 3Q1JA 4M7AA 4EDUA 1Y96B 4PLIA 3QZ5B 1K73C 1O9SA 4M75A 4PLLA 2PUOB 3NTKA 5EG2A 2LX9A 3BFMA 3JCMP 3JCMV 4LDYA 1HK9A 3M9QA 3C95A 5AYFA 3LWIA 2E41A 3OBWA 4HCZA 5KH6A 3BDLA 4ZGJB 3CCUT 3S3OA 4C0ZA 3NTHA 1XOVA 3QIIA 3OSSC 3RUXA 2KVQG 5C6SA 2EIFA 1EIFA 3CCLA 2DVEA 4XTWA 3PIOA 3CMEA 2DKGA 1AHJB 1GXIE 3ZEHA 1VQ5T 2P0QA 1I4K1 3OMGA 4PJOF 5IAYA 2ZZDA 5GAMj 1VQ9A 1KQ1A 3JCMb 5GAMe 2JZ2A 3CCSA 1FWZA 2ZGWA 2MMPA 5GANd 4R56A 1QVGS 1VQ7T 3KUFA 2FHDA 5GANh 2LT1A 2VYTA 4C8QF 1RI0A 2DAQA 2JTFA 3N5BB 5IT9E 1FX7A 3RKXA 3AHUA 5C0MA 2M1HA 2KK4A 5I2MA 2QXFA 3HHTB 4FT2A 3SWNB 1KG1A 2BKDN 4L6V5 1IREB 2V8KA 2GF7A 5J26A 2RHYA 1N6AA 4QQGA 4DOVA 1VQPA 2PU9B 1G3TA 2KDSA 1N9RA 1WJQA 2VXFA 3LX7A 3DLMA 2RHXA 4B9WA 4C5GA 3V8KA 3TU4K 4BI8B 1H3ZA 1PSEA 3CEYA 4M78D 4BY6B 2QEXA 1VIFA 3HRSA 2X4YA 2RM4A 2MF2A 3OS1A 3CMAT 5CK9A 3QXEB 1BIBA 3DB3A 4C8QE 4F7UB 4E7HA 5LJ3j 5FRNA 1KQ2A 5KCHA 3I55T 1VQ4A 3SD4A 5HK0A 3RESA 2P0KA 1N8RC 5KE2A 1K8AU 3VKIA 3QZ9B 2EJGA 3CC2T 5GMKm 3GF5A 5J39A 4ATOA 3PGGA 4C8QA 4C92D 4F7UG 1XNIA 4HA8A 4ZN3A 1OYXA 2XICA 1QVPA 2WSCE 1VQOA 2WSEE 1YHQT 1M90U 4HCCA 4FIBA 2E10A 4J83A 2QQRA 5FROA 4A4FA 3L2ZA 1WJRA 3RMSA 2LQ8A 2ZPGB 3PMIA 4JUVA 4M78B 4M77A 3CXCA 5IN1A 2VXEA 1VQ6A 4BD3A 1VQNA 1WQ7A 2K5LA 3MP1A 1YI2T 1W2BS 1Q86U 2EQJA 3UT1A 3CCQA 3GNGA 4OP0A 2V8JA 1UGRB 4LD9K 1YIJA 2ZPBB 3OYYA 4M78G 4J5YA 3VJPA 3PIPA 2CZ6B 1KD1C 3H6ZA 5KE3A 2A7YA 3V7SA 2LTOA 1W4SA 2F69A 4LDWA 3E9GA 4OB3B 5DLOA 4C92B 3FLGA 3PNWC 2JUFA 2XD0A 2L5QA 5CQXA 3SDZA 1VQOT 5GMKe 1JBMA 3CCJA 2RO0A 1W2BA 2LT4A 4J7FA 4WF2A 3MO8A 3I56A 5GAOr 1FXXA 3M57A 4Y28E 4C92G 3CXCS 3P8DA 4LDUA 3V7RA 3V8JA 4D6WA 2GFAA 3CBPA 3ZBDA 3JCMX 5DM7R 4GLKA 3OYNA 3OA6A 1Y07A 3CCQT 1G5VA 4FU6A 4JS4A 1BI2A 2RI5A 2YLBA 4CI0C 5GMKl 2RI3A 5L8RE 4EMGA 2DZCA 2D6FA 1BI3A 2AHJB 2MI6A 3LGFA 2VV5A 4EMKB 1H641 5I21A 4BE1A 3ASKA 3OS5A 3GPLA 3JCMW 3JSCA 3VYHB 4C5HA 2LDMA 5LL6S 4C0DB 5CAIA 2PVGB 4M7DD 3MP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELZ C;  4MDX A;  4ELY C;  5CR2 A;  4OF1 A;  4VUB A;  5CKD A;  4ME7 A;  5CKE A;  5CCA A;  2KMT A;  5CKB A;  1M1F A;  4MZM A;  1NE8 A;  2MF2 A;  5CO7 A;  5CK9 A;  3VUB A;  3JRZ A;  1X75 C;  4HKE A;  4MZT A;  5HK0 A;  3HPW A;  5CKF A;  5HK3 A;  1UB4 A;  3G7Z A;  2C06 A;  5DLO A;  5CQY A;  5CKH A;  3JSC A;  3TCJ A;  1VUB A;  5CQX A;  4MZP A;  2VUB A;  5HKC A;  3NFC A; 
#chains in the Genus database with same CATH topology
 4UC4 A;  5AT1 B;  2HQE A;  1UE9 A;  5GAM d;  2XID A;  2P4R A;  4PFO A;  4XU0 A;  4OMF B;  1YCS B;  1K8A R;  4C8Q C;  1YWP A;  1HD3 A;  4CC3 A;  4O6J A;  4N0A A;  1QWE A;  3H0H A;  4KUI A;  2K6D A;  1M90 R;  2NUP A;  4XTV A;  1R8O B;  2IVW A;  3M0S A;  5GAN 5;  3QHS A;  1VQ8 T;  2EFI A;  4OF1 A;  1YJ9 A;  1TXQ A;  4JRQ A;  3OYH A;  1Q86 R;  3UF4 A;  9ATC B;  2X9H A;  3CC4 A;  3X24 B;  4IUU A;  2LC4 A;  3JB9 D;  3JCM c;  4IUQ A;  4HKE A;  2DXT A;  3SB2 A;  3QPH A;  3OYB A;  4OGE A;  4YTL A;  3CD6 Q;  1X6O A;  3QYH B;  1UGQ B;  1Q7Y U;  1YNZ A;  3HRT A;  1OZ2 A;  4E7I A;  4M77 F;  2QDY B;  1N9S A;  2A08 A;  2DBK A;  3CME T;  1BI1 A;  1X6B A;  3DKM A;  2PNI A;  2EYQ A;  4E7K A;  5LJ5 g;  3CCE A;  3OYE A;  5D6X A;  4C5I A;  2DM1 A;  2F2V A;  4XTX A;  2OTL T;  2EJ9 A;  4DOW A;  2XU8 A;  1JU5 C;  4MDW A;  3JB9 G;  2CSI A;  4AMC A;  2JS2 A;  2I2L A;  1VQK Q;  1QCN A;  1AWO A;  4M7A B;  2VKN A;  3OS0 A;  3UWN A;  3SEM A;  3A8M B;  3OYK A;  2CUB A;  2ROT A;  4E7S A;  3M55 A;  4BY6 C;  2DTI A;  4N0A C;  2EQK A;  3CD6 A;  1VQ4 T;  1XQH A;  1IRX A;  2XK0 A;  3EG9 A;  1YIT Q;  2YUN A;  2G3R A;  2IG0 A;  3RBB B;  3HTR A;  3TSZ A;  2XKO C;  4M7D E;  1S72 Q;  2KSS A;  4VUB A;  1QP2 A;  2CGH A;  1MUZ A;  3M5A A;  3L42 A;  3REB B;  1YJW Q;  1VQ6 T;  4QT7 A;  3LLR A;  5GAN 3;  1LPL A;  5FU6 C;  2F2W A;  4JLG A;  2DA9 A;  4M78 C;  4X1V A;  4OMM A;  4M7D A;  1K4U S;  2L3R A;  1VQK A;  1U5S A;  1Q7Y R;  1PKT A;  3OQ5 A;  4WTO B;  3WVE B;  1TH7 A;  3FDR A;  3PT9 A;  2EQU A;  5CKD A;  3MKD A;  4J9I A;  4AFU C;  2X35 A;  2ATC B;  3MEV A;  4DQ2 A;  1M1F A;  1HXD A;  1YJN A;  2RJC A;  2RQV A;  5D6Y A;  3JB9 H;  2A37 A;  2LVM A;  1UGP B;  1G3W A;  1ZBJ A;  4J6X A;  1K9A A;  1GFD A;  2RQW A;  2ZCF B;  2MIO A;  3C0C A;  2KAF A;  4PFZ A;  2RF0 A;  1PSF A;  2VWF A;  4FL6 A;  1BYM A;  3GNF B;  3VUB A;  5GAO q;  5FWC A;  1RI9 A;  4J9G A;  2HL3 A;  1AT1 B;  2RB6 A;  1WQW A;  3M56 A;  1MND A;  2BE9 B;  3J81 E;  3J7A F;  1U06 A;  3UA6 A;  4F04 B;  1ZUU A;  3J80 E;  3OYF A;  2GTO A;  5I2S A;  4C92 E;  3G6E T;  4ELZ C;  3CCM Q;  2RPN A;  4M7D C;  1VYU A;  4IUV A;  4C92 A;  2EAY A;  2P0P A;  5LJ3 g;  3QYG B;  4QW2 A;  1UEB A;  4C0F A;  1B07 A;  2DIG A;  3X25 B;  1AOJ A;  3OYD A;  2DYI A;  4A54 A;  4XTU A;  1AWJ A;  3HSB A;  2CP0 A;  2A28 A;  2YUP A;  5GAN j;  2JMC A;  5GAN e;  1QCO A;  3CCM A;  4LDX A;  2CZ7 B;  4QVZ A;  3EFR A;  4KUL A;  1BU1 A;  2O31 A;  3G4S T;  3SHW A;  2MWO A;  3O8V A;  2QG9 B;  1OPL A;  2SEM A;  3KFV A;  4L59 A;  4NL3 A;  3QSU A;  2DFU A;  3CCU Q;  1NZ9 A;  2D9T A;  4E7L A;  3ME9 A;  2FZK B;  3THK A;  3OYA A;  1VQ5 Q;  3GBQ A;  2HAX A;  3M54 A;  1BCO A;  3JB9 F;  2GFU A;  2DK3 A;  2DL3 A;  4EMH A;  4E47 A;  2ROL A;  1JXO A;  2RH2 A;  4BI4 A;  4XAX B;  2FYK A;  4JRP A;  4II1 A;  1KHC A;  3JCM g;  2E3H A;  4FYW B;  4KBM B;  3H41 A;  1H8K A;  2B86 A;  3EH2 A;  4KGX B;  1E6H A;  1NPP A;  2E12 A;  2DRK A;  5KYY A;  2RN8 A;  4Z8A A;  2H8H A;  3L2U A;  4M7A E;  1K0X A;  1LOJ A;  1VQ5 A;  5GAM g;  3EFO B;  2K57 A;  1RLQ C;  1I5L A;  3Q1J A;  4M7A A;  1RAB B;  4PLI A;  1C0M A;  4GLM A;  3JCM P;  2L3S A;  1LVK A;  1M3A A;  3M9Q A;  3C95 A;  2E41 A;  4HCZ A;  3EGD B;  1BCM A;  1VQ4 Q;  4ZGJ B;  3S3O A;  3UAT A;  3NTH A;  4C0Z A;  1JEG A;  1PCX A;  1EIF A;  2RNA A;  3CME A;  3ZEH A;  2P0Q A;  1I4K 1;  3OMG A;  4J9C A;  2DRM A;  1FWZ A;  1VOM A;  5GAN h;  2LT1 A;  1WDX A;  2DAQ A;  1VQ6 Q;  2JTF A;  3N5B B;  5IT9 E;  3I35 A;  3CCQ Q;  1M3B A;  1M3C A;  2K7A A;  2V8K A;  1PD0 A;  2RHY A;  4B9W A;  1G3T A;  2VXF A;  2O2O A;  2RHX A;  5HCK A;  1EZZ B;  1PSE A;  4BY6 B;  1VIF A;  3HRS A;  3OS1 A;  3CMA T;  5CK9 A;  3DB3 A;  2NUP B;  2K79 A;  3I55 T;  1VQ4 A;  4RTX A;  5HK0 A;  1N8R C;  5J39 A;  2LCS A;  2DMO A;  1X6G A;  1WZO A;  2DYB A;  2ESW A;  4F7U G;  1TG0 A;  2EPD A;  1D1A A;  1OYX A;  1QVP A;  2LQW A;  2WSE E;  1YHQ T;  1OEB A;  2QK0 A;  3RMS A;  4M78 B;  4JUV A;  4M77 A;  2OTJ Q;  1QVG P;  1VQ6 A;  1OOT A;  1X27 A;  2EKH A;  1YI2 T;  2EQJ A;  3UT1 A;  3CCQ A;  2V8J A;  1IB8 A;  1D0Z A;  3M0P A;  3OYY A;  4E2F B;  5KE3 A;  3TQ7 P;  4LDW A;  2F69 A;  3E9G A;  2AIR B;  5IXB A;  4PK4 A;  2XD0 A;  1VQO T;  1VQM Q;  3UA7 A;  2RO0 A;  2AT1 B;  3E2U A;  3V7R A;  4DBQ A;  4GLK A;  1SRM A;  1G5V A;  4FU6 A;  3CCL Q;  2RI5 A;  4CI0 C;  5GMK l;  2NUZ A;  4FW1 A;  2OJ2 A;  4J9H A;  1AD5 A;  1H64 1;  2HBW A;  1K76 A;  2JM9 A;  1UUE A;  3JCM W;  1OU8 A;  4C5H A;  4JJC A;  3CXC A;  3MP6 A;  3MEU A;  3PVQ A;  3FB9 A;  4XQ3 A;  2BUD A;  2NLU A;  3CBM A;  1TU0 B;  4CRI A;  2PTK A;  1U8R A;  2X4X A;  1KFZ A;  2LCL A;  2QQS A;  2R5M A;  1G8X A;  2DO3 A;  4LE9 A;  1RAF B;  5DLQ E;  2LJ0 A;  2L89 A;  1ZQ1 A;  4XK8 E;  2QEX Q;  3H0I A;  2M0O A;  3RIR A;  2GQI A;  3HRU A;  4OMN A;  5A2Q E;  4M77 C;  4RG8 A;  2XDB A;  4M7D B;  3G6E A;  2E65 A;  2HNI A;  2V8I A;  1OI1 A;  2CP2 A;  5CIU A;  5GAN f;  3LYI A;  2JTM A;  1NYG A;  5LJ3 d;  2F5T X;  4QVD A;  1KC8 U;  2RK2 A;  1ZUK A;  1S1N A;  3REA B;  2GCX A;  4Z88 A;  1V76 A;  4ZNX A;  1K9M U;  4M75 D;  5KYN A;  1UGV A;  2HQH A;  3MHX A;  1BI0 A;  1NG2 A;  1MMG A;  2VB6 A;  1KIK A;  2LJ1 A;  1RL2 A;  1ZBX A;  4N4H A;  3G4S A;  2DIL A;  3SWN C;  1UTI A;  1VQP T;  4EMK A;  4OMO A;  4LUD A;  4TVR A;  1BK2 A;  2D8H A;  4RTY A;  5LJ5 j;  1X43 A;  5LJ5 e;  3QJ6 A;  2FB7 A;  4M75 G;  1JJ2 S;  6AT1 B;  4WCI A;  4XU2 A;  3G7Z A;  2O01 E;  2V1R A;  4Z02 A;  4QQ6 A;  2FL7 A;  3EFO A;  3LW5 E;  2DER A;  2GBQ A;  4PJO D;  2RJD A;  1OX8 A;  3VYG A;  2E70 A;  4C8Q D;  3JCM d;  3EGD A;  3FC3 A;  2COZ A;  3CC7 T;  1OPK A;  3ZFJ A;  4QVC A;  4ZTF A;  1YIJ T;  2DVJ A;  2MAM A;  1KC8 R;  4A4G A;  4F7U F;  2O9S A;  2L0A A;  1NLO C;  4FCY A;  5A0G A;  4QKU A;  4AG1 C;  2W10 A;  2JT4 A;  1K9M R;  4BAC A;  2J6K A;  3RDV A;  2Y4X A;  2PVO B;  4HT9 A;  1PM3 A;  1ACM B;  4PJO G;  3G1J A;  4PNO A;  3NHN A;  2V1Q A;  1UJ0 A;  4RMO A;  4O5V A;  1N8R U;  1RAI B;  2JVV A;  3CMA Q;  2C06 A;  2FRY A;  1Y7X A;  3URG A;  3CCE Q;  2PVD B;  5CKH A;  2XDP A;  4EMK C;  1I1J A;  2DXC A;  3FJP A;  1XTD A;  3CCR T;  4KH1 B;  2RA2 A;  1QVF S;  1IHW A;  5D7U A;  3C94 A;  4M78 E;  3HFO A;  4LXC A;  4D8K A;  2MK5 A;  1ZUY A;  1KQS A;  4N4I A;  2PUK B;  3EAE A;  1D1C A;  5HK3 A;  4M78 A;  1WGS A;  2HQX A;  5GAN 4;  2ZPI B;  4ORZ A;  1M5Q 1;  3CPW P;  1R0B G;  1W6X A;  3VS0 A;  1YWO A;  2LX7 A;  1GCQ A;  5D6W A;  3CMA A;  2EYY A;  3PVL A;  5LJ5 h;  4HT8 A;  3I55 A;  5KYY B;  3T9N A;  1MGQ A;  3E9F A;  4FYY B;  2JXB A;  4GY5 A;  1M1K C;  1AVZ C;  4OGC A;  4J9D A;  5HKC A;  1YHQ A;  3X26 B;  1NPR A;  1Q82 C;  2RQU A;  3OW2 P;  1G3Y A;  1Q81 U;  1I8F A;  1YI2 A;  2JN0 A;  4BUG A;  4PL6 A;  4GBQ A;  4AT1 B;  5LJ3 e;  4B9X A;  3M58 A;  2EQM A;  3INZ A;  4J9E A;  1O75 A;  2DPP B;  1YJN Q;  2X4W A;  3VS2 A;  2E5Q A;  3CBO A;  3OYI A;  2CDT A;  1WX6 A;  3QJY A;  2CKK A;  3OY9 A;  3PE0 A;  3X20 B;  2FRW A;  3VS1 A;  3RR6 A;  1E6G A;  5GAO p;  2OX7 A;  2LMJ A;  1WPY A;  1R77 A;  7AT1 B;  1ARK A;  1HSQ A;  3JB9 I;  5GMK i;  4FYX B;  2JM8 A;  3LH0 A;  2LRQ A;  2M16 A;  3LWH A;  1GCQ C;  2J06 A;  2ENM A;  3A8H B;  5CCA A;  3OYJ A;  5ECA A;  2H3E B;  3VU3 C;  3I9Q A;  4M75 F;  3HKS A;  1JJ2 P;  2XMF A;  1SF9 A;  2EWN A;  2CRE A;  4FW2 A;  4RG2 A;  3SFM A;  3GLX A;  5KYW B;  3G71 T;  3S6W A;  4E6R A;  4M77 B;  4RUG A;  4OMQ A;  1M4Z A;  4DBH A;  2E1H A;  3VS3 A;  3QUI A;  4MMK A;  4X9D A;  2RK1 A;  1Q81 R;  4XU1 A;  3JCM e;  2MOX A;  1BKB A;  2PZ1 A;  1UGS B;  2DJQ A;  4EDU A;  1Y96 B;  1K73 C;  1O9S A;  1X2K A;  4PLL A;  5EG2 A;  3BFM A;  2A0F B;  2J6O A;  4LDY A;  4RTU A;  5KYX B;  2D8J A;  1PG5 B;  2BZY A;  1XOV A;  3O5Z A;  4XTW A;  1SEM A;  1AHJ B;  2DKG A;  2F2X A;  4PJO F;  5GAM j;  2HMA A;  5GAM e;  1QVG S;  4R56 A;  2FHD A;  3R6N A;  4C8Q F;  1WHK A;  4AG2 C;  1CSK A;  2GNC A;  3D7S B;  5IH2 A;  2DF6 A;  2M02 A;  2QXF A;  3SWN B;  2BKD N;  4L6V 5;  1IRE B;  5J26 A;  4QQG A;  1QVF P;  1VQP A;  2PU9 B;  3LX7 A;  4AFZ C;  1T0H A;  5FWB A;  1BIB A;  3VRZ A;  3SD4 A;  2DBM A;  3VKI A;  5GMK m;  3GF5 A;  4C92 D;  1IXD A;  2FZG B;  1PRM C;  4HA8 A;  4ESR A;  4HCC A;  1K1Z A;  2E10 A;  1T0J A;  1ABO A;  3L2Z A;  3PMI A;  2KRO A;  2VXE A;  2DLP A;  1OUL A;  1W2B S;  2K5L A;  1VQ8 Q;  3CCR Q;  2GGR A;  1YIJ A;  1CKA A;  4J5Y A;  3PIP A;  3H6Z A;  3FLG A;  2JUF A;  3SDZ A;  5CQX A;  5GMK e;  2BZX A;  1ZLM A;  1PKS A;  2RMO A;  2JTE A;  1RLP C;  5GAO r;  4JJB A;  2KE9 A;  2Z0W A;  4C92 G;  1WI7 A;  3P8D A;  4D6W A;  2GFA A;  2HKQ B;  3JCM X;  1Y07 A;  1JQQ A;  4JS4 A;  4CC7 A;  4E7Z A;  2FPF A;  2DZC A;  3CME Q;  2D6F A;  1BI3 A;  2AHJ B;  1TUD A;  1A0N B;  4EMK B;  5I21 A;  2HCK A;  3OS5 A;  2A36 A;  2LDM A;  1QKW A;  8AT1 B;  2JS0 A;  1VQ8 A;  2OTL Q;  3CCR A;  2XHC A;  1Q82 U;  2K5F A;  1AWX A;  4PJN A;  4LNP A;  4OB0 B;  1D09 B;  1MMA A;  1PHT A;  5I11 A;  5GAM h;  4KUD K;  2A3L A;  2Y4Y A;  2BZ8 A;  4X34 A;  1UHC A;  4A4K A;  4OB2 B;  1VQL T;  2FG0 A;  4AFS C;  3BW1 A;  1EX4 A;  3RNJ A;  1M90 C;  2K9G A;  2KR3 A;  1KK7 A;  4Y92 A;  1BIA A;  1BB9 A;  1U3O A;  2EGA A;  2RHU A;  4BDZ A;  2EJF A;  8ATC B;  2CSQ A;  2C0I A;  3BDU A;  1MV0 B;  4XTZ A;  1IGQ A;  2RHZ A;  4FSX A;  2NYS A;  4IIO A;  2EVR A;  1JRI A;  2OTL A;  1WYX A;  3UDC A;  3V8L A;  2DD4 A;  4M7A D;  1C6V X;  1WHJ A;  5GAN 2;  3L2R A;  2DD5 A;  3LH5 A;  4ZTJ A;  4ZGD B;  5GAN g;  1OZ3 A;  2WSF E;  3NTI A;  5FLX E;  2Y90 A;  2ZPH B;  2P84 A;  1T3S A;  2F1L A;  3PMT A;  3VRY A;  1QMC A;  1ZA2 B;  3JV3 A;  2YXY A;  4M77 E;  1Q82 R;  1KHI A;  2CT3 A;  4HVU A;  3G71 Q;  3OSV A;  3U23 A;  1Q95 G;  5A0D A;  4QQD A;  5KYW A;  2CH4 W;  2DEQ A;  4BB7 A;  5CKB A;  3C4S A;  2DIQ A;  2DJZ A;  2BE7 D;  4BE2 A;  4M7A G;  1X75 C;  2HEQ A;  2HKN A;  4X9C A;  1K73 U;  3TSW A;  2KYB A;  5GAN 8;  4CC4 B;  1HJD A;  4DA4 A;  3JCM Q;  1OQK A;  4MDX A;  4J6Y A;  2ED1 A;  1Y96 A;  5M9O A;  1MNE A;  2O4X A;  1GFC A;  4XU3 A;  2E4H A;  2BIV A;  1YN8 A;  4ZN1 A;  5KYX A;  2RJE A;  1R0C B;  1JB0 E;  3G6E Q;  3CD6 T;  3BY7 A;  2HSE B;  1X69 A;  3VS5 A;  4NOY A;  5CVI A;  5DY9 A;  4PJL A;  4J8O A;  1IGU A;  1N5Z A;  3G71 A;  4JRK A;  1LCK A;  2QYZ A;  1Q7Y C;  1FMK A;  1QW1 A;  2C0T A;  3CCJ T;  3MEA A;  4HCK A;  3CPW S;  2K3X A;  1LNX A;  4MML A;  3I56 T;  1W2B P;  3GOX A;  3GIB A;  2CP7 A;  4KGV B;  5IXF A;  3SWN A;  4MZM A;  1M8M A;  2NUT B;  2LCC A;  1C1A A;  4HVW A;  1U1T A;  4RTW A;  3EGX A;  3JCM J;  1QCF A;  1UB4 A;  5FRN A;  1N27 A;  2FEI A;  2E6Z A;  3DB4 A;  3QKJ A;  2K3B A;  2JNG A;  4J9F A;  4C92 F;  1IO6 A;  1YFN A;  4KH0 B;  3ZL7 C;  1I07 A;  2DET A;  2X3X D;  2HSP A;  5GAO n;  3G4S Q;  1YIT T;  3OW2 S;  4OMP A;  1K73 R;  1NBE B;  2H3J A;  1PD1 A;  3EG2 A;  1ZSZ A;  1BBZ A;  5CKF A;  2DL4 A;  2I0N A;  3A8L B;  4OB1 B;  1S72 T;  1GL5 A;  3VS4 A;  1YJW T;  3MJX A;  2JW4 A;  1SRL A;  5J3B A;  5FU7 C;  2DEU A;  5IHI A;  3HP9 A;  2L3P A;  2YRD A;  2L2P A;  3P8B B;  3L2W A;  4Q5W A;  1JXM A;  4J7I A;  1AZE A;  3E19 A;  1TSF A;  3M4Y A;  4JPB W;  2BTT A;  1V1C A;  1VUB A;  2MWP A;  2EBP A;  4MZP A;  2F5K A;  2QTX A;  4P5N A;  2O88 A;  3TVT A;  4PJO E;  4JRI A;  1QP3 A;  1QVG A;  1Y71 A;  4A53 A;  1I5O B;  4PJO A;  5FRM A;  1M2V A;  1OU9 A;  3X28 B;  3RMQ A;  3QWX X;  1PNJ A;  3CCV T;  1WNL A;  4BDY A;  3DLL A;  3A8G B;  2K5I A;  3R6O A;  2KXC A;  4EPC A;  3FIF A;  4M75 C;  1ZSZ C;  1D3B A;  1NE8 A;  2HZY A;  1P92 A;  3M0Q A;  2VC8 A;  2P4T A;  4K11 A;  1CKB A;  3CCM T;  1B7T A;  2EQI A;  2FPD A;  2KYM A;  2KT8 A;  4FM4 B;  2KGT A;  1GCP A;  1ZA1 B;  4KRT A;  1NJI C;  5IHK A;  2QAZ A;  3QWY A;  4RTT A;  3HFN A;  2EKO A;  4M7A F;  3QO3 A;  2QA4 T;  2FPE A;  4IUP A;  3OB9 A;  1YCY A;  5FW9 A;  2QTV A;  5EC7 A;  2XG8 D;  2YUO A;  1SKU B;  4R0K A;  4C8Q G;  1VQL A;  1K0S A;  2KI7 A;  3KBG A;  2JMA A;  4BI3 A;  3H8Z A;  3JB9 J;  3I55 Q;  2R58 A;  4ANJ A;  2KRS A;  2GTJ A;  1WA7 A;  2LJ3 A;  4PJO C;  1Y57 A;  3WVD B;  1WHH A;  2YLC A;  1YHQ Q;  2RJF A;  3H0F A;  5KYU A;  2NWM A;  1OX9 A;  2KXD A;  1F1B B;  3NTK A;  3CQT A;  2VVK A;  1YI2 Q;  3LWI A;  1G2B A;  5KH6 A;  3CCU T;  3QII A;  2EIF A;  2DVE A;  2EYX A;  3QDF A;  1VQ5 T;  2KBT A;  5IAY A;  1VQO Q;  3JCM b;  1IHV A;  5GAN d;  1VQ7 T;  3KUF A;  1RI0 A;  1I0C A;  3RKX A;  1WXB A;  3M0T A;  2M1H A;  5C0M A;  1TWB A;  4FT2 A;  1ABQ A;  1SHG A;  1KG1 A;  2GF7 A;  4DOV A;  1N6A A;  2COY A;  3EHQ A;  1WJQ A;  1TUC A;  2KDS A;  3DLM A;  3NGP A;  4C5G A;  3V8K A;  4BI8 B;  1H3Z A;  3CEY A;  4M78 D;  2DX1 A;  4FYV B;  3CCJ Q;  2RM4 A;  1D1B A;  1PWT A;  3QXE B;  2J7I A;  2ZAE A;  4F7U B;  4E7H A;  5LJ3 j;  3I56 Q;  1KQ2 A;  1N8R R;  5KE2 A;  2EJG A;  3CC2 T;  3EH1 A;  1WHM A;  3VS6 A;  2NUT A;  4J9B A;  1XNI A;  2M0Y A;  2XIC A;  3H9N A;  2WSC E;  2YSQ A;  1VQO A;  2C0O A;  4FIB A;  2ZPG B;  1UHF A;  4HVV A;  5IN1 A;  4BD3 A;  1WQ7 A;  5I22 A;  4PJJ A;  4OP0 A;  2HL5 C;  1UGR B;  1UG1 A;  1NYF A;  4LD9 K;  2JJ9 A;  2ZPB B;  4M78 G;  3VJP A;  2CZ6 B;  1KD1 C;  1QQJ A;  2LTO A;  4OB3 B;  2YWW A;  4Z89 A;  1SPK A;  1ZSG A;  2L5Q A;  1FMW A;  1JBM A;  3CCJ A;  2HDA A;  2LT4 A;  4J7F A;  4WF2 A;  4HXJ A;  3I56 A;  3M57 A;  4Y28 E;  1G83 A;  3CXC S;  3MPU B;  4LDU A;  3CBP A;  1Z9Z A;  3CCQ T;  2DL8 A;  1BI2 A;  2YLB A;  2RI3 A;  5L8R E;  2COW A;  3M0U A;  3BE3 A;  2QGF B;  3VYH B;  5LL6 S;  4C0D B;  4CC2 A;  2PVG B;  4M7D D;  1FMV A;  2KEA A;  2KY9 A;  3OMC A;  3RER A;  2LZ6 B;  3OYG A;  2QI2 A;  4OVA A;  1YIT A;  3NPF A;  1GBR A;  1VQP Q;  2KT1 A;  3PFS A;  2VAS A;  2E6N A;  1NEB A;  5IHN A;  3A8O B;  2O4X B;  3PTA A;  1S72 A;  3CPW A;  3FRN A;  5FU7 B;  2OTJ T;  1YJW A;  4FT4 A;  1TTH B;  4D8D A;  1TS9 A;  2ECZ A;  1LJO A;  2DZ9 A;  1RAE B;  3CCV Q;  4JZ3 A;  2LQN A;  4RTZ A;  1DJ7 B;  3EG3 A;  3HL8 A;  1H92 A;  3QG1 A;  2M51 A;  4M7D G;  5LJ5 f;  3NMZ C;  4KT0 E;  1FYN A;  4LD6 A;  3OYC A;  1B34 B;  4RKU E;  1VQM T;  2QQB A;  5GAN 7;  2R5A A;  5LJ3 h;  3HPW A;  2X51 A;  1D0Y A;  4XTY A;  1MV3 A;  4BE0 A;  2R57 A;  1G3S A;  1UEC A;  3CC7 Q;  2E5K A;  1WXU A;  1NJI U;  1YIJ Q;  1V29 B;  4J6W A;  3OW2 A;  4ELY C;  5CR2 A;  3CCL T;  4PKC C;  2FO0 A;  3EGX B;  4R55 A;  3MP8 A;  2JOY A;  3A1P A;  2DTO A;  1VQ9 T;  1NEG A;  3CCS T;  1SG5 A;  5GAO m;  1MMD A;  3CCV A;  2QA4 Q;  5CQY A;  2QQA A;  4JDS A;  3TRE A;  2DTH A;  1NLP C;  2CS7 A;  4RCB A;  4RCC A;  2YRV A;  4M75 B;  1ZSZ B;  2QEX T;  4A4H A;  1WLP B;  3MCA B;  4A4E A;  3CC7 A;  1ZX6 A;  2O9V A;  2LQK A;  1X01 A;  1YBY A;  2XDD A;  2AZV A;  3TCJ A;  5GMK j;  1XJW B;  2CUD A;  2CP5 A;  3ER0 A;  2VGN A;  1WXT A;  2LNV A;  4DBF A;  2GQV A;  5GAN 6;  4ME7 A;  4OML A;  2CYZ B;  1VQN T;  1JJ2 A;  2HD0 A;  5CO7 A;  2V26 A;  3L2Q A;  3JCM h;  2QA4 A;  4HCB A;  4DEY A;  1VYV A;  4LDV A;  1W1F A;  3F70 A;  1SHF A;  1TOV A;  1VIE A;  1KC8 C;  1NJI R;  2K2V A;  3VV0 A;  1M1K U;  4V2S A;  1RAA B;  4JZ4 A;  1VQ7 Q;  2FZC B;  3S3N A;  1Y0M A;  2EGE A;  2KQW A;  2DXU A;  4C92 C;  3NFC A;  4PJO B;  2HBP A;  2E64 A;  3QDR B;  1W70 A;  1K9M C;  1M2V B;  1WJS A;  4F16 A;  5CKE A;  3EGU A;  1NM7 A;  2YRC A;  3RKW A;  4C8Q B;  4JS5 A;  2RD1 A;  2D1X A;  4M78 F;  2DL5 A;  2RQR A;  4DBR A;  4F7U E;  1K8A C;  3OBY A;  3L1A A;  1KQS S;  2LNH B;  3MET A;  3A5Z B;  1M9S A;  1Z9Q A;  2VUB A;  1D3B B;  4JLI A;  4F7U A;  1AEY A;  3CCU A;  3CXC P;  3CC2 Q;  1RAH B;  2WAC A;  2YDL A;  1UJY A;  2XI9 A;  3M53 A;  4Y91 A;  1WHG A;  3QBY A;  1Q86 C;  3OYM A;  2ZPF B;  5LJ3 f;  1VQ7 A;  1IZ6 A;  1QWF A;  2DL7 A;  3V7C A;  2J6F A;  2MYS A;  4IIM A;  5GJW B;  1KD1 U;  3C12 A;  1ZHI A;  3I5S A;  2E3I A;  3TEE A;  2OAW A;  1QVF A;  2VGM A;  1AZG B;  2QAS A;  2QQ9 A;  3IQL A;  1YJ9 T;  2FVU A;  2KMT A;  2K3Y A;  3CC4 T;  1QKX A;  1UFF A;  5LJ5 d;  4M4Z A;  1M30 A;  4JJN K;  1OV3 A;  2ZPE B;  4RTV A;  3M59 A;  1M1K R;  2ABL A;  4N4G A;  1M2O A;  2SRC A;  3FEO A;  3CC2 A;  4L5G A;  4ZGE B;  4IKF A;  2AK5 A;  2J05 A;  4IUR A;  5GMK h;  4FSS A;  1KSW A;  5KYU B;  1GRI A;  1EFN A;  4M7D F;  2K2M A;  2YUQ A;  3CCE T;  1I81 A;  5HY6 A;  3WXM B;  1M1G A;  2L8D A;  2W0Z A;  4IUT A;  2MCN A;  4C5E A;  3E1S A;  2AKL A;  4NL2 A;  4E7J A;  1E7O A;  5GJV B;  2CH4 A;  4AFQ C;  1AWW A;  1U1S A;  4C0G A;  3A98 A;  2RI2 A;  4NS5 A;  5FU6 B;  3OYL A;  3EG0 A;  3S3M A;  2D0N A;  3CPF A;  4M7A C;  3JCM f;  5GAO l;  1M8V A;  2CZ0 B;  3KXT A;  2AZS A;  2B8A A;  1KD1 R;  3OS2 A;  5A0L A;  5KCO A;  1WIE A;  2RHI A;  4M77 D;  1B3Q A;  3UPU A;  1SSF A;  1RAC B;  1B34 A;  3RKY A;  3LGL A;  2K4Y A;  3M4G A;  1VA7 A;  3VS7 A;  5GAM f;  3M0R A;  2EYZ A;  3P8H A;  1MHN A;  3VUZ A;  1QLY A;  3JRZ A;  1RAD B;  2CZ1 B;  2RQT A;  2X4J A;  2PQW A;  3EFS A;  4MZT A;  1D0X A;  3EG1 A;  1VQ9 Q;  1VQK T;  3L2V A;  3CCS Q;  2OTJ A;  2YHT A;  2DXB A;  4C0D C;  4A63 B;  1Q81 C;  4M77 G;  2L3Q A;  3JAM E;  1WHL A;  3EG9 B;  2D0Q B;  3FJ5 A;  3GP8 A;  1X2Q A;  2M9U A;  4M75 E;  1YJN T;  3MEW A;  1TUG B;  1J3T A;  1VQM A;  2OAU A;  3QZ5 B;  1PRL C;  4JJD A;  4M75 A;  2PUO B;  2LX9 A;  3JCM V;  1HK9 A;  2QGG A;  5AYF A;  3OBW A;  3BDL A;  2ED0 A;  4PFP A;  5C6S A;  3I5R A;  3OSS C;  2KVQ G;  3RUX A;  3CCL A;  3PIO A;  1GXI E;  1YP5 A;  2OI3 A;  4EIK A;  2ZZD A;  2DNU A;  1VQ9 A;  2X3W D;  1KQ1 A;  4LUE A;  2JZ2 A;  3CCS A;  2ZGW A;  2MMP A;  2CP6 A;  2VYT A;  1KQS P;  1VQN Q;  2KNB B;  1FX7 A;  3AHU A;  3EHR A;  2KK4 A;  5I2M A;  3HHT B;  3ULR B;  2YT6 A;  4PJM A;  1UDL A;  1N9R A;  1WFW A;  3TU4 K;  1JO8 A;  1HYO A;  2QEX A;  2X4Y A;  2MF2 A;  4C8Q E;  5KCH A;  3RES A;  2P0K A;  1K8A U;  3QZ9 B;  4ATO A;  3PGG A;  4C8Q A;  4ZN3 A;  1M90 U;  4J83 A;  2QQR A;  5FRO A;  4A4F A;  2LP5 A;  1WJR A;  2LQ8 A;  1VQL Q;  1MMN A;  2KRN A;  1T3L A;  1VQN A;  3MP1 A;  1PC0 A;  5L23 A;  1Q86 U;  4B6M A;  1VYT A;  3GNG A;  4F14 A;  1H3H A;  2G6F X;  3AT1 B;  1RUW A;  2A7Y A;  2EGC A;  3V7S A;  1W4S A;  2AKK A;  5DLO A;  1RAG B;  2IPO B;  4C92 B;  3PNW C;  4KGZ B;  4F17 A;  1W2B A;  1M27 C;  3MO8 A;  1FXX A;  2KRM A;  1KJW A;  2EYW A;  3V8J A;  5DM7 R;  3ZBD A;  4DEX A;  1SSH A;  3OYN A;  3OA6 A;  1GBQ A;  1YJ9 Q;  2EW3 A;  2DE0 X;  4EMG A;  4LN2 A;  3CC4 Q;  2MI6 A;  2QDL A;  2VV5 A;  3LGF A;  2IIM A;  2CP3 A;  2CT4 A;  2MPX C;  4BE1 A;  3ASK A;  3GPL A;  3JSC A;  5CAI A; 
#chains in the Genus database with same CATH homology
 1VQ8 A;  3MEU A;  4UC4 A;  2KY9 A;  2XHC A;  3OMC A;  3CCR A;  3FB9 A;  4XQ3 A;  1Q82 U;  3RER A;  2BUD A;  3OYG A;  2NLU A;  2K5F A;  3CBM A;  2HQE A;  2QI2 A;  5GAM d;  4CRI A;  4OB0 B;  4OVA A;  2X4X A;  1YIT A;  1U8R A;  2LCL A;  5GAM h;  4KUD K;  2QQS A;  2XID A;  2R5M A;  4XU0 A;  2DO3 A;  4OMF B;  3PFS A;  2A3L A;  2Y4Y A;  4C8Q C;  5DLQ E;  2E6N A;  4O6J A;  4X34 A;  2L89 A;  1ZQ1 A;  4XK8 E;  3A8O B;  4N0A A;  2O4X B;  3PTA A;  1S72 A;  4A4K A;  4OB2 B;  3CPW A;  3FRN A;  2M0O A;  3RIR A;  5FU7 B;  1VQL T;  4KUI A;  3HRU A;  2OTJ T;  1YJW A;  3BW1 A;  4FT4 A;  4XTV A;  5A2Q E;  1R8O B;  2IVW A;  4M77 C;  4RG8 A;  3QHS A;  1LJO A;  2DZ9 A;  5GAN 5;  2E65 A;  3G6E A;  1M90 C;  1VQ8 T;  4M7D B;  2HNI A;  2EFI A;  4OF1 A;  1YJ9 A;  1BIA A;  2V8I A;  1OI1 A;  4JRQ A;  3OYH A;  2RHU A;  1DJ7 B;  4BDZ A;  2EJF A;  3CC4 A;  5CIU A;  3HL8 A;  3X24 B;  3QG1 A;  4IUU A;  5LJ5 f;  4M7D G;  2LC4 A;  5GAN f;  3LYI A;  4KT0 E;  4LD6 A;  3OYC A;  3JB9 D;  3JCM c;  2JTM A;  1B34 B;  4IUQ A;  3BDU A;  4RKU E;  4HKE A;  1VQM T;  2DXT A;  4XTZ A;  2QQB A;  5LJ3 d;  2F5T X;  5GAN 7;  2RHZ A;  2R5A A;  4FSX A;  3SB2 A;  5LJ3 h;  3HPW A;  3QPH A;  1JRI A;  4XTY A;  2OTL A;  3OYB A;  4OGE A;  4YTL A;  4QVD A;  4BE0 A;  2R57 A;  1KC8 U;  2RK2 A;  1G3S A;  1X6O A;  3QYH B;  1NJI U;  1UGQ B;  1Q7Y U;  3UDC A;  3HRT A;  1OZ2 A;  3V8L A;  1V29 B;  4E7I A;  2GCX A;  4J6W A;  2DD4 A;  4M77 F;  3OW2 A;  4ELY C;  5CR2 A;  4M7A D;  3CCL T;  1K9M U;  2QDY B;  1N9S A;  4M75 D;  4PKC C;  3CME T;  4R55 A;  3MP8 A;  1BI1 A;  3MHX A;  5GAN 2;  2JOY A;  3DKM A;  2DTO A;  2DD5 A;  3L2R A;  1VQ9 T;  4ZTJ A;  2EYQ A;  4ZGD B;  4E7K A;  5LJ5 g;  3CCE A;  5GAN g;  3CCS T;  3OYE A;  1BI0 A;  5GAO m;  1OZ3 A;  2WSF E;  5D6X A;  4C5I A;  3NTI A;  4XTX A;  2OTL T;  2EJ9 A;  1RL2 A;  5FLX E;  4DOW A;  2Y90 A;  1ZBX A;  3CCV A;  2ZPH B;  2XU8 A;  3PMT A;  4MDW A;  5CQY A;  4N4H A;  3JB9 G;  2QQA A;  4JDS A;  3TRE A;  3G4S A;  2DTH A;  4M77 E;  2CS7 A;  2I2L A;  4RCB A;  2YRV A;  4RCC A;  3SWN C;  1VQP T;  1KHI A;  4M7A B;  3OSV A;  3OS0 A;  3UWN A;  4EMK A;  5A0D A;  4M75 B;  3A8M B;  4TVR A;  4QQD A;  3OYK A;  2DEQ A;  2QEX T;  4BB7 A;  5CKB A;  3C4S A;  2DIQ A;  2DJZ A;  3M55 A;  4A4H A;  5LJ5 j;  4BY6 C;  2DTI A;  3MCA B;  4N0A C;  4A4E A;  3QJ6 A;  5LJ5 e;  4BE2 A;  4M7A G;  2EQK A;  3CD6 A;  1X75 C;  2FB7 A;  3CC7 A;  1VQ4 T;  4M75 G;  2LQK A;  1XQH A;  4X9C A;  1K73 U;  1X01 A;  1YBY A;  1JJ2 S;  4XU2 A;  3G7Z A;  2O01 E;  2XK0 A;  2XDD A;  4Z02 A;  2G3R A;  4QQ6 A;  5GAN 8;  2IG0 A;  2FL7 A;  3LW5 E;  3TCJ A;  5GMK j;  4DA4 A;  3JCM Q;  3ER0 A;  2VGN A;  4MDX A;  2LNV A;  4J6Y A;  4PJO D;  1Y96 A;  2GQV A;  5GAN 6;  2XKO C;  5M9O A;  4M7D E;  2O4X A;  2RJD A;  2KSS A;  4XU3 A;  4VUB A;  1QP2 A;  4ME7 A;  2CGH A;  2BIV A;  3M5A A;  3L42 A;  2CYZ B;  3VYG A;  4ZN1 A;  2E70 A;  3LLR A;  1VQ6 T;  1VQN T;  5GAN 3;  5FU6 C;  2RJE A;  4JLG A;  2HD0 A;  4C8Q D;  4M78 C;  1JB0 E;  3JCM d;  1JJ2 A;  5CO7 A;  3L2Q A;  4M7D A;  3FC3 A;  3JCM h;  2QA4 A;  4HCB A;  3CD6 T;  3BY7 A;  4LDV A;  3CC7 T;  3F70 A;  3ZFJ A;  2L3R A;  4QVC A;  4ZTF A;  1YIJ T;  2MAM A;  4NOY A;  5CVI A;  1VQK A;  5DY9 A;  1VIE A;  4J8O A;  4A4G A;  4F7U F;  1KC8 C;  2K2V A;  3G71 A;  4JRK A;  3VV0 A;  1M1K U;  4V2S A;  3OQ5 A;  5A0G A;  1Q7Y C;  3S3N A;  2KQW A;  3WVE B;  1TH7 A;  2DXU A;  4C92 C;  3NFC A;  1QW1 A;  3FDR A;  3CCJ T;  3MEA A;  3PT9 A;  4BAC A;  2HBP A;  2E64 A;  3QDR B;  3CPW S;  1K9M C;  2K3X A;  4PJO B;  1WJS A;  2EQU A;  1LNX A;  5CKD A;  4MML A;  2Y4X A;  3I56 T;  3GOX A;  2PVO B;  3GIB A;  5CKE A;  2X35 A;  4HT9 A;  3MEV A;  3RKW A;  4DQ2 A;  3SWN A;  1M1F A;  4C8Q B;  4JS5 A;  4MZM A;  2RD1 A;  1HXD A;  2LCC A;  1YJN A;  2RJC A;  4PJO G;  4M78 F;  4PNO A;  5D6Y A;  1U1T A;  3JB9 H;  3JCM J;  4F7U E;  2LVM A;  1UB4 A;  4RMO A;  4O5V A;  3OBY A;  1N8R U;  1UGP B;  2JVV A;  1G3W A;  3L1A A;  2C06 A;  1N27 A;  1KQS S;  1Y7X A;  2E6Z A;  4J6X A;  3DB4 A;  3MET A;  3A5Z B;  3URG A;  2PVD B;  5CKH A;  2XDP A;  3QKJ A;  4EMK C;  1M9S A;  2VUB A;  1D3B B;  4JLI A;  2JNG A;  2DXC A;  4F7U A;  3CCU A;  2ZCF B;  3FJP A;  1XTD A;  4C92 F;  2KAF A;  2WAC A;  3CCR T;  2XI9 A;  1QVF S;  2RA2 A;  3M53 A;  4Y91 A;  5GAO n;  1PSF A;  1YIT T;  3QBY A;  3C94 A;  4M78 E;  3OW2 S;  1Q86 C;  3HFO A;  4FL6 A;  1BYM A;  3GNF B;  3VUB A;  5GAO q;  2ZPF B;  3OYM A;  5LJ3 f;  1VQ7 A;  1IZ6 A;  1KQS A;  4N4I A;  2H3J A;  2PUK B;  2RB6 A;  3EAE A;  3V7C A;  1WQW A;  3M56 A;  5CKF A;  5HK3 A;  4M78 A;  1WGS A;  3A8L B;  4OB1 B;  3C12 A;  1S72 T;  1KD1 U;  2HQX A;  5GAN 4;  3J81 E;  2ZPI B;  1ZHI A;  3J7A F;  3J80 E;  1M5Q 1;  1YJW T;  3TEE A;  3OYF A;  1QVF A;  2VGM A;  5J3B A;  5FU7 C;  5I2S A;  4C92 E;  3HP9 A;  3G6E T;  4ELZ C;  2QQ9 A;  1YJ9 T;  4M7D C;  2FVU A;  3P8B B;  4IUV A;  2KMT A;  2K3Y A;  4C92 A;  2EAY A;  3CC4 T;  3L2W A;  5D6W A;  3CMA A;  4Q5W A;  5LJ5 d;  2P0P A;  4J7I A;  5LJ5 h;  5LJ3 g;  4JJN K;  4HT8 A;  3I55 A;  3QYG B;  2ZPE B;  3M59 A;  1MGQ A;  3T9N A;  4N4G A;  3E19 A;  3E9F A;  3FEO A;  4QW2 A;  3M4Y A;  4GY5 A;  1M1K C;  3CC2 A;  4L5G A;  4ZGE B;  4IKF A;  1UEB A;  4C0F A;  4OGC A;  2DIG A;  1VUB A;  2MWP A;  3X25 B;  4MZP A;  2F5K A;  2QTX A;  4IUR A;  5HKC A;  1K8A C;  4P5N A;  1YHQ A;  3X26 B;  5GMK h;  1NPR A;  3OYD A;  1Q82 C;  4A54 A;  4PJO E;  4JRI A;  1QP3 A;  4XTU A;  1QVG A;  1Y71 A;  4A53 A;  4M7D F;  1G3Y A;  3HSB A;  1Q81 U;  1I8F A;  1YI2 A;  2JN0 A;  3CCE T;  1I81 A;  5HY6 A;  3WXM B;  1M1G A;  4BUG A;  4PL6 A;  5GAN j;  2L8D A;  5FRM A;  4PJO A;  5GAN e;  3X28 B;  5LJ3 e;  4B9X A;  3M58 A;  2EQM A;  4IUT A;  3RMQ A;  3INZ A;  3CCM A;  4LDX A;  1O75 A;  3CCV T;  2DPP B;  2CZ7 B;  4QVZ A;  4C5E A;  2X4W A;  3E1S A;  3EFR A;  4KUL A;  4NL2 A;  3G4S T;  4E7J A;  1WNL A;  4BDY A;  3DLL A;  2E5Q A;  2MWO A;  3CBO A;  3A8G B;  3O8V A;  3OYI A;  1U1S A;  4C0G A;  5FU6 B;  2K5I A;  2RI2 A;  3QJY A;  2CKK A;  4NS5 A;  3OYL A;  3S3M A;  4NL3 A;  3CPF A;  3R6O A;  4L59 A;  4M7A C;  4EPC A;  3FIF A;  3QSU A;  3OY9 A;  3JCM f;  2XDB A;  4M75 C;  3X20 B;  5GAO l;  1D3B A;  1M8V A;  1NE8 A;  2CZ0 B;  3KXT A;  1P92 A;  2B8A A;  1NZ9 A;  5GAO p;  2D9T A;  3OS2 A;  4E7L A;  2VC8 A;  3ME9 A;  1WPY A;  2P4T A;  3OYA A;  5A0L A;  5KCO A;  3M54 A;  3CCM T;  2HAX A;  3JB9 F;  2GFU A;  2RHI A;  4M77 D;  4FM4 B;  3JB9 I;  5GMK i;  3UPU A;  1NJI C;  2DK3 A;  4EMH A;  3LH0 A;  1SSF A;  2LRQ A;  1B34 A;  2M16 A;  4E47 A;  3RKY A;  3LWH A;  3LGL A;  2K4Y A;  2RH2 A;  3HFN A;  3M4G A;  4XAX B;  4BI4 A;  2FYK A;  3A8H B;  2EKO A;  4II1 A;  5CCA A;  4JRP A;  1KHC A;  5GAM f;  3OYJ A;  3JCM g;  4M7A F;  3VU3 C;  3P8H A;  1MHN A;  3QO3 A;  4KBM B;  4M75 F;  3VUZ A;  2QA4 T;  3HKS A;  3JRZ A;  2CZ1 B;  2X4J A;  2EWN A;  4IUP A;  3OB9 A;  2PQW A;  1YCY A;  3EFS A;  4MZT A;  1VQK T;  2XG8 D;  4RG2 A;  3SFM A;  3L2V A;  3GLX A;  3G71 T;  4C8Q G;  1VQL A;  3S6W A;  4M77 B;  2OTJ A;  1M4Z A;  3KBG A;  4BI3 A;  2E1H A;  3H8Z A;  1NPP A;  2YHT A;  3JB9 J;  2DXB A;  2E12 A;  2R58 A;  3QUI A;  4MMK A;  4X9D A;  2RK1 A;  3L2U A;  4C0D C;  4PJO C;  1Q81 C;  4M77 G;  3WVD B;  4M7A E;  3JAM E;  2D0Q B;  3GP8 A;  1LOJ A;  2M9U A;  1VQ5 A;  5GAM g;  2YLC A;  4M75 E;  4XU1 A;  3JCM e;  1YJN T;  1BKB A;  3MEW A;  2K57 A;  2RJF A;  1UGS B;  1VQM A;  1I5L A;  2OAU A;  3Q1J A;  4M7A A;  4EDU A;  1Y96 B;  4PLI A;  3QZ5 B;  1K73 C;  1O9S A;  4M75 A;  4PLL A;  2PUO B;  3NTK A;  5EG2 A;  2LX9 A;  3BFM A;  3JCM P;  3JCM V;  4LDY A;  1HK9 A;  3M9Q A;  3C95 A;  5AYF A;  3LWI A;  2E41 A;  3OBW A;  4HCZ A;  5KH6 A;  3BDL A;  4ZGJ B;  3CCU T;  3S3O A;  4C0Z A;  3NTH A;  1XOV A;  3QII A;  3OSS C;  3RUX A;  2KVQ G;  5C6S A;  2EIF A;  1EIF A;  3CCL A;  2DVE A;  4XTW A;  3PIO A;  3CME A;  2DKG A;  1AHJ B;  1GXI E;  3ZEH A;  1VQ5 T;  2P0Q A;  1I4K 1;  3OMG A;  4PJO F;  5IAY A;  2ZZD A;  5GAM j;  1VQ9 A;  1KQ1 A;  3JCM b;  5GAM e;  2JZ2 A;  3CCS A;  1FWZ A;  2ZGW A;  2MMP A;  5GAN d;  4R56 A;  1QVG S;  1VQ7 T;  3KUF A;  2FHD A;  5GAN h;  2LT1 A;  2VYT A;  4C8Q F;  1RI0 A;  2DAQ A;  2JTF A;  3N5B B;  5IT9 E;  1FX7 A;  3RKX A;  3AHU A;  5C0M A;  2M1H A;  2KK4 A;  5I2M A;  2QXF A;  3HHT B;  4FT2 A;  3SWN B;  1KG1 A;  2BKD N;  4L6V 5;  1IRE B;  2V8K A;  2GF7 A;  5J26 A;  2RHY A;  1N6A A;  4QQG A;  4DOV A;  1VQP A;  2PU9 B;  1G3T A;  2KDS A;  1N9R A;  1WJQ A;  2VXF A;  3LX7 A;  3DLM A;  2RHX A;  4B9W A;  4C5G A;  3V8K A;  3TU4 K;  4BI8 B;  1H3Z A;  1PSE A;  3CEY A;  4M78 D;  4BY6 B;  2QEX A;  1VIF A;  3HRS A;  2X4Y A;  2RM4 A;  2MF2 A;  3OS1 A;  3CMA T;  5CK9 A;  3QXE B;  1BIB A;  3DB3 A;  4C8Q E;  4F7U B;  4E7H A;  5LJ3 j;  5FRN A;  1KQ2 A;  5KCH A;  3I55 T;  1VQ4 A;  3SD4 A;  5HK0 A;  3RES A;  2P0K A;  1N8R C;  5KE2 A;  1K8A U;  3VKI A;  3QZ9 B;  2EJG A;  3CC2 T;  5GMK m;  3GF5 A;  5J39 A;  4ATO A;  3PGG A;  4C8Q A;  4C92 D;  4F7U G;  1XNI A;  4HA8 A;  4ZN3 A;  1OYX A;  2XIC A;  1QVP A;  2WSC E;  1VQO A;  2WSE E;  1YHQ T;  1M90 U;  4HCC A;  4FIB A;  2E10 A;  4J83 A;  2QQR A;  5FRO A;  4A4F A;  3L2Z A;  1WJR A;  3RMS A;  2LQ8 A;  2ZPG B;  3PMI A;  4JUV A;  4M78 B;  4M77 A;  3CXC A;  5IN1 A;  2VXE A;  1VQ6 A;  4BD3 A;  1VQN A;  1WQ7 A;  2K5L A;  3MP1 A;  1YI2 T;  1W2B S;  1Q86 U;  2EQJ A;  3UT1 A;  3CCQ A;  3GNG A;  4OP0 A;  2V8J A;  1UGR B;  4LD9 K;  1YIJ A;  2ZPB B;  3OYY A;  4M78 G;  4J5Y A;  3VJP A;  3PIP A;  2CZ6 B;  1KD1 C;  3H6Z A;  5KE3 A;  2A7Y A;  3V7S A;  2LTO A;  1W4S A;  2F69 A;  4LDW A;  3E9G A;  4OB3 B;  5DLO A;  4C92 B;  3FLG A;  3PNW C;  2JUF A;  2XD0 A;  2L5Q A;  5CQX A;  3SDZ A;  1VQO T;  5GMK e;  1JBM A;  3CCJ A;  2RO0 A;  1W2B A;  2LT4 A;  4J7F A;  4WF2 A;  3MO8 A;  3I56 A;  5GAO r;  1FXX A;  3M57 A;  4Y28 E;  4C92 G;  3CXC S;  3P8D A;  4LDU A;  3V7R A;  3V8J A;  4D6W A;  2GFA A;  3CBP A;  3ZBD A;  3JCM X;  5DM7 R;  4GLK A;  3OYN A;  3OA6 A;  1Y07 A;  3CCQ T;  1G5V A;  4FU6 A;  4JS4 A;  1BI2 A;  2RI5 A;  2YLB A;  4CI0 C;  5GMK l;  2RI3 A;  5L8R E;  4EMG A;  2DZC A;  2D6F A;  1BI3 A;  2AHJ B;  2MI6 A;  3LGF A;  2VV5 A;  4EMK B;  1H64 1;  5I21 A;  4BE1 A;  3ASK A;  3OS5 A;  3GPL A;  3JCM W;  3JSC A;  3VYH B;  4C5H A;  2LDM A;  5LL6 S;  4C0D B;  5CAI A;  2PVG B;  4M7D D;  3MP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...