2MPXC

Three-dimensional structure of cap-gly domain assembled on microtubules determined by mas nmr spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Dynactin subunit 1
publication title THREE-DIMENSIONAL STRUCTURE of CAP-GLY DOMAIN ASSEMBLED ON MICROTUBULES DETERMINED BY MAS NMR SPECTROSCOPY
rcsb
source organism Rattus norvegicus
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2mpxC00
2CP7A 1WHKA 2COWA 1WHHA 3TQ7P 2M02A 1TOVA 2CP6A 2E3HA 2CP3A 1WHMA 2COZA 2COYA 3RDVA 2E4HA 2QK0A 2HL3A 2CP2A 1LPLA 1WHGA 2E3IA 2HQHA 2MPXC 2HKNA 1TXQA 2HKQB 1IXDA 1WHJA 1WHLA 2Z0WA 2HL5C 4B6MA 2CP5A 3E2UA 2CP0A
chains in the Genus database with same CATH superfamily
3HRSA 4HKEA 2KQWA 1BYMA 4NL3A 1VQNQ 4E7HA 4RG2A 3EGXA 4RCBA 2QEXA 4IUUA 1KD1R 3CCQA 3ME9A 1RAGB 2E6ZA 3TEEA 4FU6A 2Z0WA 5KYNA 3S6WA 3GP8A 4BI8B 1VQ6A 1T3LA 2EKOA 3CCUT 4AFUC 4ELZC 3JCMW 3CC7T 2ABLA 3TSZA 4B9XA 1AWJA 1MNEA 3QJ6A 3OYDA 3JRZA 4O6JA 1ZA2B 2L3SA 1VQ8T 2HSEB 3MO8A 4AG2C 1G2BA 3C94A 4RCCA 2QG9B 4J9GA 4Z02A 4RTZA 3WXMB 3GF5A 4LDYA 3CC2Q 1KSWA 1UHCA 3VS4A 3OMGA 4WCIA 5KH6A 4PFPA 4IIMA 5HKCA 1QVFS 1ZUUA 2QQAA 4D6WA 2F2VA 4BE2A 3BY7A 2G3RA 4JJBA 3MP8A 4QW2A 4II1A 4QQGA 1VQ7T 1NJIU 2D6FA 2K5LA 1GCQA 1K0XA 3UF4A 3GOXA 1NM7A 3MJXA 2DL4A 3BW1A 2QDLA 2B86A 4RKUE 4RTTA 3OY9A 3M56A 1C6VX 5FU6B 3OMCA 1BIAA 4M7DC 1Y07A 1OZ2A 1RADB 5CK9A 5GMKm 4PKCC 3REBB 3LWHA 2KMTA 3VJPA 1JJ2A 2DM1A 4XTUA 2KNBB 1BI1A 4MMLA 5EC7A 4HCZA 1VYUA 4J9EA 2JOYA 4F7UE 1AVZC 2FL7A 2K6DA 2YRCA 3VYGA 1VQOQ 3LX7A 3G4SQ 4MZMA 1M8VA 2LRQA 2EGAA 1I5LA 1F1BB 3RKWA 1VQ6T 1JO8A 2JT4A 4KUDK 3BE3A 5GANd 3JB9I 2E5KA 2M1HA 1SEMA 1YFNA 2W0ZA 1NZ9A 1BIBA 2X4YA 4ZN3A 3G6ET 1BCMA 3VS1A 1WJQA 4FYVB 1QQJA 4NOYA 4XQ3A 1WXUA 1ZUYA 1KQSS 2WACA 2VV5A 4J6XA 3V8JA 4L59A 1SSHA 1KC8R 4M7AB 2A7YA 2LT1A 3M5AA 2VGMA 1K9AA 4C92B 1YWPA 1J3TA 2RQVA 3CPWA 2F5TX 1WHLA 2K3BA 3INZA 2OTJQ 3JCMP 1I4K1 1OU9A 1FX7A 1QCOA 4LNPA 3M0UA 3LH0A 1K4US 5L23A 5GAN2 1UGQB 1WGSA 4P5NA 2DD4A 3QKJA 5GAMj 1W70A 2J6OA 3L2VA 5LJ3h 2A08A 4Y28E 2X4XA 1AZEA 2ED1A 1Q7YU 3J7AF 5GAOn 3OSVA 4JLIA 3CCST 3O8VA 4C8QD 2ATCB 3QO3A 4M4ZA 2NUZA 4M7AA 2GBQA 4BE1A 1Z9QA 1WDXA 4C92A 4M7AG 2DVJA 2RB6A 3A5ZB 2AT1B 3GPLA 3RMSA 4C92G 4OMNA 4JRQA 2BUDA 3PT9A 1VQ9A 1MMAA 4J83A 1KD1U 1S72A 3HRTA 1WHMA 1SSFA 1YJWT 2GTJA 4JS4A 5FRNA 5GANh 2DERA 1B34B 2YRDA 2VASA 1TXQA 5KYYB 5GAOl 2AKKA 5FROA 2QQSA 5GAOr 1MMDA 1M1GA 4L5GA 4DBHA 3DKMA 2NWMA 1QCFA 3Q1JA 3JCMc 2LJ1A 2KXCA 1FWZA 4KBMB 3EFOB 1UGVA 1LCKA 2QEXQ 3CCQQ 1K73R 4RTVA 2DZ9A 3E9FA 1H8KA 4C8QG 4X9DA 1XOVA 2M51A 1IHVA 4N0AC 3RMQA 1JXOA 1VQ6Q 2MCNA 4AFQC 1SHGA 4C5IA 2ED0A 1U5SA 5GAMf 3R6NA 1VQKT 1TS9A 3ASKA 3EG9A 1WXBA 1B34A 1B07A 2FRWA 5FW9A 1MV3A 1IGUA 4JUVA 4PK4A 4A54A 4PJOD 2RD1A 4ZGDB 1MV0B 3TREA 1LOJA 5KYYA 2DIGA 1KFZA 5HK0A 2OTLA 5IHNA 4M78D 1M30A 5CKFA 2D8HA 2GGRA 1I8FA 3OS5A 4F04B 3LW5E 4MZPA 2JN0A 2L8DA 3EFOA 3H0IA 4K11A 2LNVA 1ABQA 3NTHA 3EH2A 2EW3A 2QYZA 2X4WA 2KDSA 3EG3A 1D1BA 2VB6A 1PKSA 3GNFB 1PSFA 2E65A 1GFDA 4LUDA 4OVAA 1S72T 2DEUA 1M3AA 3QZ9B 4E6RA 5GAMg 2JS2A 1QWFA 3J81E 1RAFB 3QYHB 4PJJA 5GAN4 1UGRB 4J9BA 2JVVA 4OMQA 4F17A 3CCSQ 4XTWA 1NYFA 2XKOC 1QVGP 1M90R 4YTLA 2KY9A 4OMPA 1I81A 1X69A 1ACMB 2AKLA 3QDFA 4IKFA 5I2SA 2F1LA 2L0AA 2QTXA 1W4SA 3CMAA 4M7AE 1TUGB 3OYJA 2XG8D 1VQPA 2OAUA 1NPRA 2DZCA 2E12A 3KFVA 4C92E 5GMKh 1UFFA 3CCMT 2QAZA 1R0BG 1D0XA 1NE8A 1XNIA 4X9CA 2CP7A 5FU7C 4C0DC 4LUEA 1I5OB 5CKEA 1QCNA 1NJIC 4N4HA 2MI6A 1TTHB 3GNGA 5CIUA 5DM7R 3MP1A 2ZZDA 2FZGB 4FT4A 2QA4A 1UE9A 1G3SA 2L3PA 1ZX6A 4DEXA 3HL8A 1Q81C 3OSSC 1Y96B 2DMOA 3QBYA 1JJ2S 3THKA 1TOVA 2IIMA 4KGXB 3LWIA 4E7KA 1VQ4T 2EQIA 1M3CA 5I11A 5GAN5 4Z8AA 1YITT 4M75A 1RLPC 2KT1A 1PD0A 2X4JA 1AWWA 1HD3A 2EJ9A 2QQBA 2V26A 2Y4XA 2AK5A 1VQNT 5D7UA 2LX9A 3OYNA 2FG0A 2JMAA 3NTKA 1T0HA 1B7TA 4HT8A 4C5EA 1Y96A 3CMAT 1PSEA 3HFOA 1VQPT 2XDBA 3VS5A 4M77D 3OA6A 2VC8A 1OI1A 2FO0A 1VQ9Q 2CREA 3M58A 3M59A 1S72Q 2RHXA 2ENMA 5LJ5j 2F69A 5A0LA 3CPWS 1ZSZC 1W6XA 3RNJA 4X34A 3EGUA 4WF2A 4ZGEB 2WSFE 3UT1A 1W2BS 3QYGB 1YCYA 2YUQA 5L8RE 2YWWA 1UG1A 1YJNA 4R55A 1N8RR 3LLRA 2RF0A 4FSSA 3URGA 4N4IA 1HXDA 2EYXA 2CP6A 4D8DA 1Q7YC 5HCKA 2ZGWA 3CCLA 3I56A 3F70A 2LX7A 1MMNA 5CKDA 1QKWA 5IXFA 2RJEA 2CKKA 4OMLA 2PU9B 1OULA 2EYZA 2C0IA 1ZUKA 5DY9A 1PRLC 2RH2A 1QVGA 2K9GA 1D0ZA 2GNCA 3E1SA 2FEIA 4J6YA 4A4FA 3LGLA 2A28A 1K76A 2WSEE 2DD5A 3CBOA 4IUQA 2COZA 3RDVA 3MCAB 1Q82R 5IT9E 2OTLQ 1KD1C 2V1QA 1KQ2A 1H641 2HKNA 1GXIE 4EMKB 1WJRA 2ZCFB 4J6WA 2LQ8A 3S3MA 1LVKA 2B8AA 3G4ST 2CZ1B 2CSIA 1PD1A 5KCOA 2CS7A 2CZ6B 1IREB 3O5ZA 2A37A 5GAOp 5M9OA 1OU8A 3DB3A 2E5QA 3I9QA 1LJOA 2R57A 3QG1A 4M7DD 2QK0A 2MYSA 2BKDN 4ZNXA 2E10A 2CP2A 5GMKi 1KJWA 2LTOA 1DJ7B 2ZPGB 1VQ4Q 2LDMA 2QASA 2JZ2A 1QKXA 5LJ5f 3C4SA 3JCMQ 1X01A 2AZVA 2ESWA 3M4YA 3GBQA 1VQ5A 3DB4A 1YWOA 4EMKA 2M16A 2OTJT 3EFRA 3EHQA 4M75E 2DRKA 4E7JA 4AFZC 4C8QF 2KEAA 5I21A 3E19A 3CCLT 4KUIA 4LN2A 2DYIA 2VVKA 3HKSA 5KYUB 2P4RA 1RUWA 2P84A 5GAOm 3EHRA 3CMAQ 1D09B 4EMHA 1VQPQ 1Q95G 2VKNA 2GTOA 1SKUB 2GFAA 1BKBA 3PNWC 1UEBA 3MEWA 2JUFA 5LJ5g 3QUIA 3CD6A 3UDCA 4PLIA 2RHIA 3TVTA 3L2UA 4OMFB 4LXCA 3QZ5B 2JM9A 4PJMA 3RBBB 2KYBA 3SFMA 3QJYA 2QQ9A 3M4GA 2IVWA 3NGPA 4O5VA 2EJGA 5FWBA 2K3XA 1JU5C 3I35A 5DLQE 5GAMd 1MUZA 3JCMJ 1W1FA 1U06A 2W10A 2QA4Q 5A0DA 1SHFA 4IUVA 3CCJA 2EYYA 3PTAA 2OAWA 2ZPHB 3SEMA 1P92A 2DPPB 1YP5A 4QQDA 2ZPEB 1WLPB 2MMPA 2YT6A 3FC3A 1Y71A 4DEYA 4ESRA 5FWCA 2HMAA 3CEYA 1U1SA 2A36A 1KC8C 2HEQA 2DETA 1X6GA 1Q81U 4HCKA 4OMMA 4OB0B 4LDXA 3U23A 4BY6C 2M9UA 1VQ5T 4J5YA 2BTTA 2M0OA 1IHWA 3TSWA 3CBMA 5KE3A 5LJ3e 2L89A 2QEXT 4PJOF 3CCQT 3CCRA 2RN8A 4BDYA 3M54A 4M78F 4XTYA 3ULRB 4QQ6A 1N8RU 1EX4A 4OB1B 2PVGB 4BI3A 5D6XA 2HCKA 1YIJA 2QI2A 3JCMf 1WX6A 3TQ7P 2CT4A 3IQLA 2JTFA 2K2MA 2NLUA 1OOTA 2P0PA 4Y92A 4JS5A 3CCVA 1GCQC 1XQHA 1EIFA 3AHUA 3CC4A 4FYXB 3M0SA 4NL2A 4F16A 4FYWB 1YJNQ 3QSUA 5GANe 1U8RA 2WSCE 2C0TA 5CCAA 2DXUA 2M02A 2CYZB 3OYAA 3V7RA 4BACA 1C1AA 4QVZA 5GAMh 3CCLQ 2EGCA 2X3WD 5KCHA 3I56Q 3I5RA 3FRNA 1RABB 1QP3A 4OB3B 1PC0A 2LMJA 3NHNA 5I2MA 2KT8A 3JCMb 2AZSA 1HJDA 1WPYA 2DLPA 4KGZB 1N27A 3JCMg 3L2ZA 2P0KA 1IO6A 2PTKA 2JTEA 3VRYA 3META 3VS2A 1ZLMA 4JLGA 2RJFA 3A98A 1YN8A 2DO3A 3MEAA 1M3BA 3CQTA 4OB2B 2O88A 4C8QB 2O31A 3BDLA 1Y57A 4XU2A 1QVPA 1G3YA 2A0FB 2DILA 3J80E 2QGFB 2H3EB 3OS0A 5GJWB 5CQXA 2HDAA 3M0QA 1C0MA 5CAIA 4XTZA 4JRKA 2E4HA 1D3BB 5AT1B 1YIJT 1FYNA 1NG2A 1VOMA 2LNHB 1PRMC 2MWPA 2BZXA 4L6V5 2ZPFB 1TWBA 1RAEB 2QDYB 4XTVA 2D0QB 2KI7A 2I2LA 3SWNB 1BCOA 2DBMA 2E1HA 2CDTA 1I07A 1VQ5Q 2JXBA 2O4XB 2NUTB 3M0TA 1BK2A 2PQWA 2CUDA 4E47A 4C8QA 1QVGS 1JBMA 2P4TA 4IUPA 1LPLA 1X27A 4M7AC 5KYXB 3M9QA 1GFCA 2LZ6B 4C92C 3FLGA 1G8XA 5C0MA 1WFWA 1FMKA 3QPHA 1N9RA 2FPEA 2NYSA 2XMFA 1D3BA 3L2WA 3C95A 1QW1A 2CP3A 2PUKB 4J9FA 2DAQA 4OP0A 1GBQA 2K4YA 3G7ZA 1RI0A 1Q86R 2IPOB 2V1RA 4C0DB 4M77F 3ZL7C 1M90C 3CD6Q 2HQXA 3EG2A 4F14A 2DK3A 3D7SB 5GMKe 4KGVB 1PWTA 4PJOB 1Z9ZA 3VS3A 1WI7A 1ZA1B 2O4XA 1AEYA 1D1AA 2NUTA 3C0CA 1FMVA 1QMCA 1PM3A 2JS0A 4VUBA 3CXCP 4M78B 4HCCA 1I1JA 5LJ3f 3L2QA 4OGEA 2QGGA 1PCXA 3CCJQ 5KYXA 1VQ9T 2QQRA 3H6ZA 1V29B 1IGQA 2KRMA 4B9WA 2YUOA 5GAOq 3G71A 5DLOA 2GCXA 2GFUA 1MNDA 3VS6A 2EYQA 2R5AA 3HP9A 4FW1A 1YHQA 1M27C 3A8LB 3WVDB 2RQUA 2K2VA 2D9TA 1X6BA 2RK2A 3JV3A 4PJOA 4GLKA 3X20B 4E7IA 1KC8U 3RKYA 2NUPB 5A0GA 4PJOG 3CCRQ 4M78A 5LJ5d 2RJCA 2EQUA 4RTXA 5CKHA 4EMGA 4M78G 3EFSA 4BDZA 3A8OB 4KH1B 1E6HA 2DJZA 4PL6A 3M0PA 3HRUA 1YI2A 2HBPA 3DLMA 4OF1A 2YLBA 2O9VA 1X43A 1YIJQ 4XU1A 1QLYA 2CP0A 4M75D 4KRTA 1ZSZB 4QT7A 1WA7A 2OTLT 4M7DF 2XI9A 1WXTA 1UDLA 2YUNA 5I22A 2HZYA 1OPKA 3L42A 2YUPA 3H0FA 1R0CB 1VA7A 2XU8A 3CCVQ 1ZBXA 4JZ3A 3CC4Q 4DOVA 2FRYA 4HVUA 1WYXA 4JJDA 4X1VA 2NUPA 1MGQA 2LP5A 4PFZA 3T9NA 1M1KR 4WTOB 2ECZA 1VIFA 2FB7A 1WIEA 2F2XA 3X28B 3CC2A 4E7LA 2KR3A 2EVRA 2E3HA 1K0SA 7AT1B 1YNZA 3VU3C 2FVUA 3CBPA 4C0FA 1K9MR 1LNXA 4RTYA 2FZKB 2JTMA 4C8QE 2DXBA 1NLPC 1UUEA 1T3SA 1VIEA 9ATCB 4B6MA 2R5MA 2RM4A 1YHQT 1N8RC 1OEBA 2LQWA 4FW2A 1ABOA 1YBYA 3AT1B 2DL8A 2LQNA 1RAHB 2XDDA 1WQWA 4A63B 3MEVA 4PLLA 1MMGA 2BZ8A 3CMEA 4JJCA 1E6GA 1VQMA 3FJPA 1H3HA 2RMOA 1E7OA 1MHNA 8ATCB 5D6YA 1WHKA 4Y91A 5LJ5h 2HSPA 2LC4A 3JB9J 1YCSB 1K73U 1U1TA 1YI2T 4EDUA 4J8OA 2J6FA 1Q82C 3MKDA 3OYYA 2ZPBB 2YHTA 4BE0A 3CXCA 4M77B 3EG0A 3E9GA 3REAB 3SD4A 2HQEA 4J9CA 2YDLA 1UTIA 2Y90A 3H8ZA 4MMKA 2BE9B 4F7UB 4J7IA 2G6FX 4M75C 4NS5A 5KE2A 2EIFA 2QA4T 2LVMA 3L2RA 3CPFA 6AT1B 2MWOA 5CO7A 3JCMd 2QTVA 2RK1A 1WJSA 4LDWA 1OZ3A 4AG1C 4RTUA 1UJ0A 4PJOE 3KUFA 1PNJA 2F5KA 2XICA 1A0NB 1M9SA 4DQ2A 2V8IA 1M2VB 1NBEB 4XK8E 4M78E 3NMZC 4M77A 4N4GA 1S1NA 3CCUA 2PVDB 3SB2A 1D0YA 1ZSGA 4E7SA 3CC7A 2YXYA 2EGEA 4M77G 2OI3A 2J6KA 2E41A 3QIIA 4PJLA 2EKHA 2DIQA 1NEGA 4HCBA 3S3NA 1SRMA 2CP5A 3OYHA 2EQKA 4FCYA 1VQ8A 3CMET 4F7UG 1CKBA 3X26B 2J7IA 3OQ5A 2MK5A 3PFSA 4R0KA 3ZEHA 4QVCA 3JB9H 1M90U 4GBQA 2GQVA 3OYCA 5CR2A 2I0NA 2EWNA 2K57A 2HAXA 5LL6S 2HD0A 4CC7A 3N5BB 1TUDA 4A53A 4M7DB 1M5Q1 3LH5A 3G71Q 1M2VA 1XJWB 1G5VA 1VQ7A 2X3XD 4XU3A 2DEQA 2DA9A 1YHQQ 2EQMA 1YJNT 2CT3A 3FB9A 3S3OA 4ZTFA 1BI0A 3M55A 5IH2A 2JNGA 1KK7A 3VUZA 4JRPA 4FSXA 1HSQA 3OYFA 3I56T 1V1CA 4AMCA 2X35A 3OYIA 3JCMh 4D8KA 4JDSA 2KSSA 2L5QA 4LDVA 3VS7A 2M0YA 2E6NA 4MDWA 3ZFJA 3FEOA 3JAME 3CCEA 1M1KU 2HBWA 1IXDA 2HKQB 1YI2Q 2CH4W 2LT4A 4AFSC 3M53A 1SG5A 4M7DA 2VWFA 3M0RA 3BDUA 1WQ7A 2D8JA 3OS1A 3PIOA 2PUOB 1VYVA 1ZQ1A 1K9MU 1K8AR 4M7DG 1GL5A 1RAIB 4RUGA 3G6EA 2JJ9A 1UHFA 2KROA 4JPBW 3PMIA 3P8BB 1SF9A 2DF6A 1RAAB 2CZ7B 3FIFA 1G83A 1X75C 2DX1A 5KYUA 2L2PA 1T0JA 4EMKC 2VGNA 4J7FA 1RACB 4J9IA 4UC4A 1HYOA 1PHTA 2C0OA 2K7AA 2DVEA 1R8OB 5LJ3d 5GAMe 1ARKA 1SRLA 4EPCA 3OW2P 2BIVA 1WHJA 3I55A 2C06A 2RA2A 1YJ9A 1R77A 2J06A 1TH7A 2L3QA 3CMEQ 3EGDB 3JB9D 3CCSA 4M77E 4A4HA 4MDXA 2BZYA 1VQMQ 1AT1B 4KT0E 1AHJB 1NLOC 2H8HA 2XIDA 4LE9A 2LJ3A 2SRCA 5IXBA 2KAFA 2PNIA 1EZZB 1PKTA 2EFIA 2R58A 2V8JA 3CCET 3VYHB 2ZAEA 2O01E 1IZ6A 3CD6T 3MP6A 1SPKA 2RQRA 2EYWA 2OX7A 3QWXX 5CQYA 1ZHIA 3EG1A 1YJWA 4M7AD 1O9SA 3MHXA 5CKBA 2KBTA 2RQWA 2SEMA 2PZ1A 1O75A 2RHYA 4C92D 1TG0A 2DL5A 3P8HA 1Q82U 1VYTA 3CCJT 3EGDA 1XTDA 1N6AA 4IIOA 2KK4A 3OYMA 1IRXA 5IHIA 4CC4B 2F2WA 3V7CA 1QVFP 3PVLA 1D1CA 4LD9K 2DL7A 2XDPA 1G3TA 2MOXA 1FMWA 1KQ1A 2H3JA 3JB9G 2EQJA 2RI5A 1W2BA 1OPLA 3H9NA 4DBQA 1KG1A 3I55T 4R56A 3P8DA 3CCUQ 3UA6A 1YJ9T 4XTXA 4HA8A 2O9SA 1GBRA 4DBFA 5GAN8 3CC7Q 1K73C 1VQKA 4M75F 3BFMA 3EAEA 3KBGA 3UATA 4ZGJB 3CCRT 4BB7A 5FU6C 5LJ3j 2VUBA 4XAXB 3E2UA 1VQ8Q 4M7DE 2X51A 3CXCS 3ZBDA 3A1PA 4N0AA 2DJQA 3VUBA 4IURA 1X2QA 2COYA 2XK0A 1M4ZA 1Q86C 2CZ0B 2XD0A 1AZGB 4AT1B 3VS0A 2J05A 2DYBA 3PVQA 2DE0X 3H0HA 5CVIA 1B3QA 2VXEA 3CCVT 3OYGA 1IB8A 2LCSA 3CC4T 3X25B 1VQ7Q 3C12A 4CRIA 3HHTB 2Y4YA 2FYKA 4J9HA 1KQSP 3EG9B 4JRIA 2MPXC 4CC2A 4HXJA 3A8MB 5GANj 1UB4A 1K8AU 2KXDA 2JMCA 1G3WA 1JB0E 1U3OA 1N5ZA 4KULA 4BD3A 2FZCB 3OW2A 1EFNA 4RG8A 4RMOA 3NFCA 5HY6A 4C5HA 4HVVA 3V7SA 3HTRA 2DNUA 2JM8A 4DOWA 1UGSB 2O2OA 3CCEQ 3OYBA 5FU7B 1V76A 1M8MA 1KHCA 1VQLA 2EPDA 2HNIA 2QXFA 3SWNA 2RNAA 1KHIA 1AWXA 1AD5A 4F7UF 3CCMA 4FIBA 3G6EQ 2DBKA 2MF2A 1JQQA 2K5IA 4KH0B 5KYWB 4CI0C 2P0QA 5IN1A 2E3IA 5D6WA 4DBRA 2AIRB 2JW4A 1AWOA 3X24B 4Q5WA 3DLLA 1OV3A 3VV0A 2RPNA 5GMKl 2X9HA 1OQKA 4C8QC 2DKGA 3OS2A 3A8GB 4E7ZA 4BUGA 2YLCA 4QKUA 4JZ4A 5IAYA 4PNOA 3JCMX 1Y0MA 2LCLA 2GF7A 1GRIA 2K79A 3SDZA 2CH4A 3I55Q 1VQ4A 2RHUA 4IUTA 1YITA 5GJVB 1QVFA 2FHDA 2KRNA 1YJ9Q 1HK9A 1M1KC 2ZPIB 5KYWA 5GANf 4OGCA 5LJ3g 4C0GA 3OBYA 2KGTA 1K9MC 3SWNC 2PVOB 1VQNA 5GAN7 4EIKA 3RR6A 1WHGA 2HQHA 2K3YA 2KRSA 2V8KA 4FM4B 3HFNA 1AOJA 3H41A 3RUXA 3MEUA 3OYLA 2DXCA 3OB9A 3MPUB 2DTHA 5GAN3 1VQLT 3PMTA 1BI2A 2BE7D 1UJYA 2KYMA 3LGFA 3R6OA 4GY5A 2AHJB 5LJ5e 3UPUA 5IHKA 4QVDA 5HK3A 4M75B 2RHZA 1YJWQ 2YSQA 2OJ2A 1VUBA 5GMKj 2HL5C 4OMOA 3M57A 5J26A 3QXEB 1UECA 2DTIA 4ELYC 5AYFA 2RI3A 1QWEA 8AT1B 1WHHA 5GAN6 3PGGA 1KIKA 5GANg 1FXXA 1TSFA 1CSKA 3EH1A 3I5SA 4Z89A 5C6SA 4PJOC 1KQSA 2MIOA 4ZTJA 2EJFA 2LQKA 3JSCA 2GQIA 4FYYB 3G71T 4M78C 4PJNA 4Z88A 4ORZA 1ZSZA 1RI9A 2ROLA 1QP2A 2DL3A 2YRVA 5J3BA 4C5GA 3GIBA 3RESA 4RTWA 2RQTA 2LJ0A 3QHSA 4XU0A 1BB9A 1VQKQ 1X6OA 2CGHA 1ZBJA 4DA4A 4M75G 2CUBA 2VYTA 3PIPA 1RL2A 2FPDA 1NYGA 3JCMV 3V8LA 1PG5B 1WZOA 4MZTA 1JXMA 1JEGA 1VQOA 1X2KA 2E70A 4FL6A 1WNLA 1UGPB 3G4SA 1NJIR 3OYEA 4J9DA 3L1AA 4GLMA 2FPFA 4ATOA 1Y7XA 3WVEB 1Q81R 3PE0A 3G1JA 3HPWA 1N9SA 4LD6A 4E2FB 3NTIA 3OBWA 1Q86U 5ECAA 3RIRA 2EBPA 1CKAA 1OYXA 5A2QE 1M2OA 2D0NA 3FDRA 2LCCA 2A3LA 2IG0A 4CC3A 2D1XA 5FRMA 4V2SA 4LDUA 3CC2T 2RI2A 1BI3A 4TVRA 2OTJA 3UWNA 1M1FA 2VXFA 1I0CA 3QDRB 2E64A 3JB9F 4PFOA 2EAYA 1JRIA 3A8HB 1OX8A 1JJ2P 3VRZA 3LYIA 3GLXA 3JCMe 2XHCA 3RKXA 3V8KA 1RLQC 3QWYA 1VQLQ 1H3ZA 4F7UA 2K5FA 3NPFA 1GCPA 3FJ5A 4ZN1A 2DTOA 1TUCA 2KE9A 1BU1A 1TU0B 3CCMQ 1VQMT 1NEBA 2RJDA 1OX9A 4ANJA 3VKIA 4HVWA 2CSQA 3UA7A 4M7AF 2L3RA 2DFUA 3ER0A 4C92F 3EGXB 3KXTA 1VQOT 1H92A 1NPPA 3TU4K 4A4GA 2DXTA 4C0ZA 2RO0A 2COWA 1K8AC 4A4EA 5J39A 3RERA 2DRMA 4BI4A 4HT9A 5FLXE 1BBZA 1K1ZA 1Q7YR 4BY6B 4A4KA 3OYKA 4JJNK 3OW2S 2HL3A 3CPWP 3TCJA 3HSBA 1YITQ 2ROTA 3SHWA 2MAMA 2KVQG 5EG2A 4FT2A 4M77C 1W2BP 4ME7A
chains in the Genus database with same CATH topology
2CP7A 1WHKA 2COWA 1WHHA 3TQ7P 2M02A 1TOVA 2CP6A 2E3HA 2CP3A 1WHMA 2COZA 2COYA 3RDVA 2E4HA 2QK0A 2HL3A 2CP2A 1LPLA 1WHGA 2E3IA 2HQHA 2MPXC 2HKNA 1TXQA 2HKQB 1IXDA 1WHJA 1WHLA 2Z0WA 2HL5C 4B6MA 2CP5A 3E2UA 2CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP7 A;  1WHK A;  2COW A;  1WHH A;  3TQ7 P;  2M02 A;  1TOV A;  2CP6 A;  2E3H A;  2CP3 A;  1WHM A;  2COZ A;  2COY A;  3RDV A;  2E4H A;  2QK0 A;  2HL3 A;  2CP2 A;  1LPL A;  1WHG A;  2E3I A;  2HQH A;  2MPX C;  2HKN A;  1TXQ A;  2HKQ B;  1IXD A;  1WHJ A;  1WHL A;  2Z0W A;  2HL5 C;  4B6M A;  2CP5 A;  3E2U A;  2CP0 A; 
#chains in the Genus database with same CATH topology
 3HRS A;  4HKE A;  2KQW A;  1BYM A;  4NL3 A;  1VQN Q;  4E7H A;  4RG2 A;  3EGX A;  4RCB A;  2QEX A;  4IUU A;  1KD1 R;  3CCQ A;  3ME9 A;  1RAG B;  2E6Z A;  3TEE A;  4FU6 A;  2Z0W A;  5KYN A;  3S6W A;  3GP8 A;  4BI8 B;  1VQ6 A;  1T3L A;  2EKO A;  3CCU T;  4AFU C;  4ELZ C;  3JCM W;  3CC7 T;  2ABL A;  3TSZ A;  4B9X A;  1AWJ A;  1MNE A;  3QJ6 A;  3OYD A;  3JRZ A;  4O6J A;  1ZA2 B;  2L3S A;  1VQ8 T;  2HSE B;  3MO8 A;  4AG2 C;  1G2B A;  3C94 A;  4RCC A;  2QG9 B;  4J9G A;  4Z02 A;  4RTZ A;  3WXM B;  3GF5 A;  4LDY A;  3CC2 Q;  1KSW A;  1UHC A;  3VS4 A;  3OMG A;  4WCI A;  5KH6 A;  4PFP A;  4IIM A;  5HKC A;  1QVF S;  1ZUU A;  2QQA A;  4D6W A;  2F2V A;  4BE2 A;  3BY7 A;  2G3R A;  4JJB A;  3MP8 A;  4QW2 A;  4II1 A;  4QQG A;  1VQ7 T;  1NJI U;  2D6F A;  2K5L A;  1GCQ A;  1K0X A;  3UF4 A;  3GOX A;  1NM7 A;  3MJX A;  2DL4 A;  3BW1 A;  2QDL A;  2B86 A;  4RKU E;  4RTT A;  3OY9 A;  3M56 A;  1C6V X;  5FU6 B;  3OMC A;  1BIA A;  4M7D C;  1Y07 A;  1OZ2 A;  1RAD B;  5CK9 A;  5GMK m;  4PKC C;  3REB B;  3LWH A;  2KMT A;  3VJP A;  1JJ2 A;  2DM1 A;  4XTU A;  2KNB B;  1BI1 A;  4MML A;  5EC7 A;  4HCZ A;  1VYU A;  4J9E A;  2JOY A;  4F7U E;  1AVZ C;  2FL7 A;  2K6D A;  2YRC A;  3VYG A;  1VQO Q;  3LX7 A;  3G4S Q;  4MZM A;  1M8V A;  2LRQ A;  2EGA A;  1I5L A;  1F1B B;  3RKW A;  1VQ6 T;  1JO8 A;  2JT4 A;  4KUD K;  3BE3 A;  5GAN d;  3JB9 I;  2E5K A;  2M1H A;  1SEM A;  1YFN A;  2W0Z A;  1NZ9 A;  1BIB A;  2X4Y A;  4ZN3 A;  3G6E T;  1BCM A;  3VS1 A;  1WJQ A;  4FYV B;  1QQJ A;  4NOY A;  4XQ3 A;  1WXU A;  1ZUY A;  1KQS S;  2WAC A;  2VV5 A;  4J6X A;  3V8J A;  4L59 A;  1SSH A;  1KC8 R;  4M7A B;  2A7Y A;  2LT1 A;  3M5A A;  2VGM A;  1K9A A;  4C92 B;  1YWP A;  1J3T A;  2RQV A;  3CPW A;  2F5T X;  1WHL A;  2K3B A;  3INZ A;  2OTJ Q;  3JCM P;  1I4K 1;  1OU9 A;  1FX7 A;  1QCO A;  4LNP A;  3M0U A;  3LH0 A;  1K4U S;  5L23 A;  5GAN 2;  1UGQ B;  1WGS A;  4P5N A;  2DD4 A;  3QKJ A;  5GAM j;  1W70 A;  2J6O A;  3L2V A;  5LJ3 h;  2A08 A;  4Y28 E;  2X4X A;  1AZE A;  2ED1 A;  1Q7Y U;  3J7A F;  5GAO n;  3OSV A;  4JLI A;  3CCS T;  3O8V A;  4C8Q D;  2ATC B;  3QO3 A;  4M4Z A;  2NUZ A;  4M7A A;  2GBQ A;  4BE1 A;  1Z9Q A;  1WDX A;  4C92 A;  4M7A G;  2DVJ A;  2RB6 A;  3A5Z B;  2AT1 B;  3GPL A;  3RMS A;  4C92 G;  4OMN A;  4JRQ A;  2BUD A;  3PT9 A;  1VQ9 A;  1MMA A;  4J83 A;  1KD1 U;  1S72 A;  3HRT A;  1WHM A;  1SSF A;  1YJW T;  2GTJ A;  4JS4 A;  5FRN A;  5GAN h;  2DER A;  1B34 B;  2YRD A;  2VAS A;  1TXQ A;  5KYY B;  5GAO l;  2AKK A;  5FRO A;  2QQS A;  5GAO r;  1MMD A;  1M1G A;  4L5G A;  4DBH A;  3DKM A;  2NWM A;  1QCF A;  3Q1J A;  3JCM c;  2LJ1 A;  2KXC A;  1FWZ A;  4KBM B;  3EFO B;  1UGV A;  1LCK A;  2QEX Q;  3CCQ Q;  1K73 R;  4RTV A;  2DZ9 A;  3E9F A;  1H8K A;  4C8Q G;  4X9D A;  1XOV A;  2M51 A;  1IHV A;  4N0A C;  3RMQ A;  1JXO A;  1VQ6 Q;  2MCN A;  4AFQ C;  1SHG A;  4C5I A;  2ED0 A;  1U5S A;  5GAM f;  3R6N A;  1VQK T;  1TS9 A;  3ASK A;  3EG9 A;  1WXB A;  1B34 A;  1B07 A;  2FRW A;  5FW9 A;  1MV3 A;  1IGU A;  4JUV A;  4PK4 A;  4A54 A;  4PJO D;  2RD1 A;  4ZGD B;  1MV0 B;  3TRE A;  1LOJ A;  5KYY A;  2DIG A;  1KFZ A;  5HK0 A;  2OTL A;  5IHN A;  4M78 D;  1M30 A;  5CKF A;  2D8H A;  2GGR A;  1I8F A;  3OS5 A;  4F04 B;  3LW5 E;  4MZP A;  2JN0 A;  2L8D A;  3EFO A;  3H0I A;  4K11 A;  2LNV A;  1ABQ A;  3NTH A;  3EH2 A;  2EW3 A;  2QYZ A;  2X4W A;  2KDS A;  3EG3 A;  1D1B A;  2VB6 A;  1PKS A;  3GNF B;  1PSF A;  2E65 A;  1GFD A;  4LUD A;  4OVA A;  1S72 T;  2DEU A;  1M3A A;  3QZ9 B;  4E6R A;  5GAM g;  2JS2 A;  1QWF A;  3J81 E;  1RAF B;  3QYH B;  4PJJ A;  5GAN 4;  1UGR B;  4J9B A;  2JVV A;  4OMQ A;  4F17 A;  3CCS Q;  4XTW A;  1NYF A;  2XKO C;  1QVG P;  1M90 R;  4YTL A;  2KY9 A;  4OMP A;  1I81 A;  1X69 A;  1ACM B;  2AKL A;  3QDF A;  4IKF A;  5I2S A;  2F1L A;  2L0A A;  2QTX A;  1W4S A;  3CMA A;  4M7A E;  1TUG B;  3OYJ A;  2XG8 D;  1VQP A;  2OAU A;  1NPR A;  2DZC A;  2E12 A;  3KFV A;  4C92 E;  5GMK h;  1UFF A;  3CCM T;  2QAZ A;  1R0B G;  1D0X A;  1NE8 A;  1XNI A;  4X9C A;  2CP7 A;  5FU7 C;  4C0D C;  4LUE A;  1I5O B;  5CKE A;  1QCN A;  1NJI C;  4N4H A;  2MI6 A;  1TTH B;  3GNG A;  5CIU A;  5DM7 R;  3MP1 A;  2ZZD A;  2FZG B;  4FT4 A;  2QA4 A;  1UE9 A;  1G3S A;  2L3P A;  1ZX6 A;  4DEX A;  3HL8 A;  1Q81 C;  3OSS C;  1Y96 B;  2DMO A;  3QBY A;  1JJ2 S;  3THK A;  1TOV A;  2IIM A;  4KGX B;  3LWI A;  4E7K A;  1VQ4 T;  2EQI A;  1M3C A;  5I11 A;  5GAN 5;  4Z8A A;  1YIT T;  4M75 A;  1RLP C;  2KT1 A;  1PD0 A;  2X4J A;  1AWW A;  1HD3 A;  2EJ9 A;  2QQB A;  2V26 A;  2Y4X A;  2AK5 A;  1VQN T;  5D7U A;  2LX9 A;  3OYN A;  2FG0 A;  2JMA A;  3NTK A;  1T0H A;  1B7T A;  4HT8 A;  4C5E A;  1Y96 A;  3CMA T;  1PSE A;  3HFO A;  1VQP T;  2XDB A;  3VS5 A;  4M77 D;  3OA6 A;  2VC8 A;  1OI1 A;  2FO0 A;  1VQ9 Q;  2CRE A;  3M58 A;  3M59 A;  1S72 Q;  2RHX A;  2ENM A;  5LJ5 j;  2F69 A;  5A0L A;  3CPW S;  1ZSZ C;  1W6X A;  3RNJ A;  4X34 A;  3EGU A;  4WF2 A;  4ZGE B;  2WSF E;  3UT1 A;  1W2B S;  3QYG B;  1YCY A;  2YUQ A;  5L8R E;  2YWW A;  1UG1 A;  1YJN A;  4R55 A;  1N8R R;  3LLR A;  2RF0 A;  4FSS A;  3URG A;  4N4I A;  1HXD A;  2EYX A;  2CP6 A;  4D8D A;  1Q7Y C;  5HCK A;  2ZGW A;  3CCL A;  3I56 A;  3F70 A;  2LX7 A;  1MMN A;  5CKD A;  1QKW A;  5IXF A;  2RJE A;  2CKK A;  4OML A;  2PU9 B;  1OUL A;  2EYZ A;  2C0I A;  1ZUK A;  5DY9 A;  1PRL C;  2RH2 A;  1QVG A;  2K9G A;  1D0Z A;  2GNC A;  3E1S A;  2FEI A;  4J6Y A;  4A4F A;  3LGL A;  2A28 A;  1K76 A;  2WSE E;  2DD5 A;  3CBO A;  4IUQ A;  2COZ A;  3RDV A;  3MCA B;  1Q82 R;  5IT9 E;  2OTL Q;  1KD1 C;  2V1Q A;  1KQ2 A;  1H64 1;  2HKN A;  1GXI E;  4EMK B;  1WJR A;  2ZCF B;  4J6W A;  2LQ8 A;  3S3M A;  1LVK A;  2B8A A;  3G4S T;  2CZ1 B;  2CSI A;  1PD1 A;  5KCO A;  2CS7 A;  2CZ6 B;  1IRE B;  3O5Z A;  2A37 A;  5GAO p;  5M9O A;  1OU8 A;  3DB3 A;  2E5Q A;  3I9Q A;  1LJO A;  2R57 A;  3QG1 A;  4M7D D;  2QK0 A;  2MYS A;  2BKD N;  4ZNX A;  2E10 A;  2CP2 A;  5GMK i;  1KJW A;  2LTO A;  1DJ7 B;  2ZPG B;  1VQ4 Q;  2LDM A;  2QAS A;  2JZ2 A;  1QKX A;  5LJ5 f;  3C4S A;  3JCM Q;  1X01 A;  2AZV A;  2ESW A;  3M4Y A;  3GBQ A;  1VQ5 A;  3DB4 A;  1YWO A;  4EMK A;  2M16 A;  2OTJ T;  3EFR A;  3EHQ A;  4M75 E;  2DRK A;  4E7J A;  4AFZ C;  4C8Q F;  2KEA A;  5I21 A;  3E19 A;  3CCL T;  4KUI A;  4LN2 A;  2DYI A;  2VVK A;  3HKS A;  5KYU B;  2P4R A;  1RUW A;  2P84 A;  5GAO m;  3EHR A;  3CMA Q;  1D09 B;  4EMH A;  1VQP Q;  1Q95 G;  2VKN A;  2GTO A;  1SKU B;  2GFA A;  1BKB A;  3PNW C;  1UEB A;  3MEW A;  2JUF A;  5LJ5 g;  3QUI A;  3CD6 A;  3UDC A;  4PLI A;  2RHI A;  3TVT A;  3L2U A;  4OMF B;  4LXC A;  3QZ5 B;  2JM9 A;  4PJM A;  3RBB B;  2KYB A;  3SFM A;  3QJY A;  2QQ9 A;  3M4G A;  2IVW A;  3NGP A;  4O5V A;  2EJG A;  5FWB A;  2K3X A;  1JU5 C;  3I35 A;  5DLQ E;  5GAM d;  1MUZ A;  3JCM J;  1W1F A;  1U06 A;  2W10 A;  2QA4 Q;  5A0D A;  1SHF A;  4IUV A;  3CCJ A;  2EYY A;  3PTA A;  2OAW A;  2ZPH B;  3SEM A;  1P92 A;  2DPP B;  1YP5 A;  4QQD A;  2ZPE B;  1WLP B;  2MMP A;  2YT6 A;  3FC3 A;  1Y71 A;  4DEY A;  4ESR A;  5FWC A;  2HMA A;  3CEY A;  1U1S A;  2A36 A;  1KC8 C;  2HEQ A;  2DET A;  1X6G A;  1Q81 U;  4HCK A;  4OMM A;  4OB0 B;  4LDX A;  3U23 A;  4BY6 C;  2M9U A;  1VQ5 T;  4J5Y A;  2BTT A;  2M0O A;  1IHW A;  3TSW A;  3CBM A;  5KE3 A;  5LJ3 e;  2L89 A;  2QEX T;  4PJO F;  3CCQ T;  3CCR A;  2RN8 A;  4BDY A;  3M54 A;  4M78 F;  4XTY A;  3ULR B;  4QQ6 A;  1N8R U;  1EX4 A;  4OB1 B;  2PVG B;  4BI3 A;  5D6X A;  2HCK A;  1YIJ A;  2QI2 A;  3JCM f;  1WX6 A;  3TQ7 P;  2CT4 A;  3IQL A;  2JTF A;  2K2M A;  2NLU A;  1OOT A;  2P0P A;  4Y92 A;  4JS5 A;  3CCV A;  1GCQ C;  1XQH A;  1EIF A;  3AHU A;  3CC4 A;  4FYX B;  3M0S A;  4NL2 A;  4F16 A;  4FYW B;  1YJN Q;  3QSU A;  5GAN e;  1U8R A;  2WSC E;  2C0T A;  5CCA A;  2DXU A;  2M02 A;  2CYZ B;  3OYA A;  3V7R A;  4BAC A;  1C1A A;  4QVZ A;  5GAM h;  3CCL Q;  2EGC A;  2X3W D;  5KCH A;  3I56 Q;  3I5R A;  3FRN A;  1RAB B;  1QP3 A;  4OB3 B;  1PC0 A;  2LMJ A;  3NHN A;  5I2M A;  2KT8 A;  3JCM b;  2AZS A;  1HJD A;  1WPY A;  2DLP A;  4KGZ B;  1N27 A;  3JCM g;  3L2Z A;  2P0K A;  1IO6 A;  2PTK A;  2JTE A;  3VRY A;  3MET A;  3VS2 A;  1ZLM A;  4JLG A;  2RJF A;  3A98 A;  1YN8 A;  2DO3 A;  3MEA A;  1M3B A;  3CQT A;  4OB2 B;  2O88 A;  4C8Q B;  2O31 A;  3BDL A;  1Y57 A;  4XU2 A;  1QVP A;  1G3Y A;  2A0F B;  2DIL A;  3J80 E;  2QGF B;  2H3E B;  3OS0 A;  5GJW B;  5CQX A;  2HDA A;  3M0Q A;  1C0M A;  5CAI A;  4XTZ A;  4JRK A;  2E4H A;  1D3B B;  5AT1 B;  1YIJ T;  1FYN A;  1NG2 A;  1VOM A;  2LNH B;  1PRM C;  2MWP A;  2BZX A;  4L6V 5;  2ZPF B;  1TWB A;  1RAE B;  2QDY B;  4XTV A;  2D0Q B;  2KI7 A;  2I2L A;  3SWN B;  1BCO A;  2DBM A;  2E1H A;  2CDT A;  1I07 A;  1VQ5 Q;  2JXB A;  2O4X B;  2NUT B;  3M0T A;  1BK2 A;  2PQW A;  2CUD A;  4E47 A;  4C8Q A;  1QVG S;  1JBM A;  2P4T A;  4IUP A;  1LPL A;  1X27 A;  4M7A C;  5KYX B;  3M9Q A;  1GFC A;  2LZ6 B;  4C92 C;  3FLG A;  1G8X A;  5C0M A;  1WFW A;  1FMK A;  3QPH A;  1N9R A;  2FPE A;  2NYS A;  2XMF A;  1D3B A;  3L2W A;  3C95 A;  1QW1 A;  2CP3 A;  2PUK B;  4J9F A;  2DAQ A;  4OP0 A;  1GBQ A;  2K4Y A;  3G7Z A;  1RI0 A;  1Q86 R;  2IPO B;  2V1R A;  4C0D B;  4M77 F;  3ZL7 C;  1M90 C;  3CD6 Q;  2HQX A;  3EG2 A;  4F14 A;  2DK3 A;  3D7S B;  5GMK e;  4KGV B;  1PWT A;  4PJO B;  1Z9Z A;  3VS3 A;  1WI7 A;  1ZA1 B;  2O4X A;  1AEY A;  1D1A A;  2NUT A;  3C0C A;  1FMV A;  1QMC A;  1PM3 A;  2JS0 A;  4VUB A;  3CXC P;  4M78 B;  4HCC A;  1I1J A;  5LJ3 f;  3L2Q A;  4OGE A;  2QGG A;  1PCX A;  3CCJ Q;  5KYX A;  1VQ9 T;  2QQR A;  3H6Z A;  1V29 B;  1IGQ A;  2KRM A;  4B9W A;  2YUO A;  5GAO q;  3G71 A;  5DLO A;  2GCX A;  2GFU A;  1MND A;  3VS6 A;  2EYQ A;  2R5A A;  3HP9 A;  4FW1 A;  1YHQ A;  1M27 C;  3A8L B;  3WVD B;  2RQU A;  2K2V A;  2D9T A;  1X6B A;  2RK2 A;  3JV3 A;  4PJO A;  4GLK A;  3X20 B;  4E7I A;  1KC8 U;  3RKY A;  2NUP B;  5A0G A;  4PJO G;  3CCR Q;  4M78 A;  5LJ5 d;  2RJC A;  2EQU A;  4RTX A;  5CKH A;  4EMG A;  4M78 G;  3EFS A;  4BDZ A;  3A8O B;  4KH1 B;  1E6H A;  2DJZ A;  4PL6 A;  3M0P A;  3HRU A;  1YI2 A;  2HBP A;  3DLM A;  4OF1 A;  2YLB A;  2O9V A;  1X43 A;  1YIJ Q;  4XU1 A;  1QLY A;  2CP0 A;  4M75 D;  4KRT A;  1ZSZ B;  4QT7 A;  1WA7 A;  2OTL T;  4M7D F;  2XI9 A;  1WXT A;  1UDL A;  2YUN A;  5I22 A;  2HZY A;  1OPK A;  3L42 A;  2YUP A;  3H0F A;  1R0C B;  1VA7 A;  2XU8 A;  3CCV Q;  1ZBX A;  4JZ3 A;  3CC4 Q;  4DOV A;  2FRY A;  4HVU A;  1WYX A;  4JJD A;  4X1V A;  2NUP A;  1MGQ A;  2LP5 A;  4PFZ A;  3T9N A;  1M1K R;  4WTO B;  2ECZ A;  1VIF A;  2FB7 A;  1WIE A;  2F2X A;  3X28 B;  3CC2 A;  4E7L A;  2KR3 A;  2EVR A;  2E3H A;  1K0S A;  7AT1 B;  1YNZ A;  3VU3 C;  2FVU A;  3CBP A;  4C0F A;  1K9M R;  1LNX A;  4RTY A;  2FZK B;  2JTM A;  4C8Q E;  2DXB A;  1NLP C;  1UUE A;  1T3S A;  1VIE A;  9ATC B;  4B6M A;  2R5M A;  2RM4 A;  1YHQ T;  1N8R C;  1OEB A;  2LQW A;  4FW2 A;  1ABO A;  1YBY A;  3AT1 B;  2DL8 A;  2LQN A;  1RAH B;  2XDD A;  1WQW A;  4A63 B;  3MEV A;  4PLL A;  1MMG A;  2BZ8 A;  3CME A;  4JJC A;  1E6G A;  1VQM A;  3FJP A;  1H3H A;  2RMO A;  1E7O A;  1MHN A;  8ATC B;  5D6Y A;  1WHK A;  4Y91 A;  5LJ5 h;  2HSP A;  2LC4 A;  3JB9 J;  1YCS B;  1K73 U;  1U1T A;  1YI2 T;  4EDU A;  4J8O A;  2J6F A;  1Q82 C;  3MKD A;  3OYY A;  2ZPB B;  2YHT A;  4BE0 A;  3CXC A;  4M77 B;  3EG0 A;  3E9G A;  3REA B;  3SD4 A;  2HQE A;  4J9C A;  2YDL A;  1UTI A;  2Y90 A;  3H8Z A;  4MMK A;  2BE9 B;  4F7U B;  4J7I A;  2G6F X;  4M75 C;  4NS5 A;  5KE2 A;  2EIF A;  2QA4 T;  2LVM A;  3L2R A;  3CPF A;  6AT1 B;  2MWO A;  5CO7 A;  3JCM d;  2QTV A;  2RK1 A;  1WJS A;  4LDW A;  1OZ3 A;  4AG1 C;  4RTU A;  1UJ0 A;  4PJO E;  3KUF A;  1PNJ A;  2F5K A;  2XIC A;  1A0N B;  1M9S A;  4DQ2 A;  2V8I A;  1M2V B;  1NBE B;  4XK8 E;  4M78 E;  3NMZ C;  4M77 A;  4N4G A;  1S1N A;  3CCU A;  2PVD B;  3SB2 A;  1D0Y A;  1ZSG A;  4E7S A;  3CC7 A;  2YXY A;  2EGE A;  4M77 G;  2OI3 A;  2J6K A;  2E41 A;  3QII A;  4PJL A;  2EKH A;  2DIQ A;  1NEG A;  4HCB A;  3S3N A;  1SRM A;  2CP5 A;  3OYH A;  2EQK A;  4FCY A;  1VQ8 A;  3CME T;  4F7U G;  1CKB A;  3X26 B;  2J7I A;  3OQ5 A;  2MK5 A;  3PFS A;  4R0K A;  3ZEH A;  4QVC A;  3JB9 H;  1M90 U;  4GBQ A;  2GQV A;  3OYC A;  5CR2 A;  2I0N A;  2EWN A;  2K57 A;  2HAX A;  5LL6 S;  2HD0 A;  4CC7 A;  3N5B B;  1TUD A;  4A53 A;  4M7D B;  1M5Q 1;  3LH5 A;  3G71 Q;  1M2V A;  1XJW B;  1G5V A;  1VQ7 A;  2X3X D;  4XU3 A;  2DEQ A;  2DA9 A;  1YHQ Q;  2EQM A;  1YJN T;  2CT3 A;  3FB9 A;  3S3O A;  4ZTF A;  1BI0 A;  3M55 A;  5IH2 A;  2JNG A;  1KK7 A;  3VUZ A;  4JRP A;  4FSX A;  1HSQ A;  3OYF A;  3I56 T;  1V1C A;  4AMC A;  2X35 A;  3OYI A;  3JCM h;  4D8K A;  4JDS A;  2KSS A;  2L5Q A;  4LDV A;  3VS7 A;  2M0Y A;  2E6N A;  4MDW A;  3ZFJ A;  3FEO A;  3JAM E;  3CCE A;  1M1K U;  2HBW A;  1IXD A;  2HKQ B;  1YI2 Q;  2CH4 W;  2LT4 A;  4AFS C;  3M53 A;  1SG5 A;  4M7D A;  2VWF A;  3M0R A;  3BDU A;  1WQ7 A;  2D8J A;  3OS1 A;  3PIO A;  2PUO B;  1VYV A;  1ZQ1 A;  1K9M U;  1K8A R;  4M7D G;  1GL5 A;  1RAI B;  4RUG A;  3G6E A;  2JJ9 A;  1UHF A;  2KRO A;  4JPB W;  3PMI A;  3P8B B;  1SF9 A;  2DF6 A;  1RAA B;  2CZ7 B;  3FIF A;  1G83 A;  1X75 C;  2DX1 A;  5KYU A;  2L2P A;  1T0J A;  4EMK C;  2VGN A;  4J7F A;  1RAC B;  4J9I A;  4UC4 A;  1HYO A;  1PHT A;  2C0O A;  2K7A A;  2DVE A;  1R8O B;  5LJ3 d;  5GAM e;  1ARK A;  1SRL A;  4EPC A;  3OW2 P;  2BIV A;  1WHJ A;  3I55 A;  2C06 A;  2RA2 A;  1YJ9 A;  1R77 A;  2J06 A;  1TH7 A;  2L3Q A;  3CME Q;  3EGD B;  3JB9 D;  3CCS A;  4M77 E;  4A4H A;  4MDX A;  2BZY A;  1VQM Q;  1AT1 B;  4KT0 E;  1AHJ B;  1NLO C;  2H8H A;  2XID A;  4LE9 A;  2LJ3 A;  2SRC A;  5IXB A;  2KAF A;  2PNI A;  1EZZ B;  1PKT A;  2EFI A;  2R58 A;  2V8J A;  3CCE T;  3VYH B;  2ZAE A;  2O01 E;  1IZ6 A;  3CD6 T;  3MP6 A;  1SPK A;  2RQR A;  2EYW A;  2OX7 A;  3QWX X;  5CQY A;  1ZHI A;  3EG1 A;  1YJW A;  4M7A D;  1O9S A;  3MHX A;  5CKB A;  2KBT A;  2RQW A;  2SEM A;  2PZ1 A;  1O75 A;  2RHY A;  4C92 D;  1TG0 A;  2DL5 A;  3P8H A;  1Q82 U;  1VYT A;  3CCJ T;  3EGD A;  1XTD A;  1N6A A;  4IIO A;  2KK4 A;  3OYM A;  1IRX A;  5IHI A;  4CC4 B;  2F2W A;  3V7C A;  1QVF P;  3PVL A;  1D1C A;  4LD9 K;  2DL7 A;  2XDP A;  1G3T A;  2MOX A;  1FMW A;  1KQ1 A;  2H3J A;  3JB9 G;  2EQJ A;  2RI5 A;  1W2B A;  1OPL A;  3H9N A;  4DBQ A;  1KG1 A;  3I55 T;  4R56 A;  3P8D A;  3CCU Q;  3UA6 A;  1YJ9 T;  4XTX A;  4HA8 A;  2O9S A;  1GBR A;  4DBF A;  5GAN 8;  3CC7 Q;  1K73 C;  1VQK A;  4M75 F;  3BFM A;  3EAE A;  3KBG A;  3UAT A;  4ZGJ B;  3CCR T;  4BB7 A;  5FU6 C;  5LJ3 j;  2VUB A;  4XAX B;  3E2U A;  1VQ8 Q;  4M7D E;  2X51 A;  3CXC S;  3ZBD A;  3A1P A;  4N0A A;  2DJQ A;  3VUB A;  4IUR A;  1X2Q A;  2COY A;  2XK0 A;  1M4Z A;  1Q86 C;  2CZ0 B;  2XD0 A;  1AZG B;  4AT1 B;  3VS0 A;  2J05 A;  2DYB A;  3PVQ A;  2DE0 X;  3H0H A;  5CVI A;  1B3Q A;  2VXE A;  3CCV T;  3OYG A;  1IB8 A;  2LCS A;  3CC4 T;  3X25 B;  1VQ7 Q;  3C12 A;  4CRI A;  3HHT B;  2Y4Y A;  2FYK A;  4J9H A;  1KQS P;  3EG9 B;  4JRI A;  2MPX C;  4CC2 A;  4HXJ A;  3A8M B;  5GAN j;  1UB4 A;  1K8A U;  2KXD A;  2JMC A;  1G3W A;  1JB0 E;  1U3O A;  1N5Z A;  4KUL A;  4BD3 A;  2FZC B;  3OW2 A;  1EFN A;  4RG8 A;  4RMO A;  3NFC A;  5HY6 A;  4C5H A;  4HVV A;  3V7S A;  3HTR A;  2DNU A;  2JM8 A;  4DOW A;  1UGS B;  2O2O A;  3CCE Q;  3OYB A;  5FU7 B;  1V76 A;  1M8M A;  1KHC A;  1VQL A;  2EPD A;  2HNI A;  2QXF A;  3SWN A;  2RNA A;  1KHI A;  1AWX A;  1AD5 A;  4F7U F;  3CCM A;  4FIB A;  3G6E Q;  2DBK A;  2MF2 A;  1JQQ A;  2K5I A;  4KH0 B;  5KYW B;  4CI0 C;  2P0Q A;  5IN1 A;  2E3I A;  5D6W A;  4DBR A;  2AIR B;  2JW4 A;  1AWO A;  3X24 B;  4Q5W A;  3DLL A;  1OV3 A;  3VV0 A;  2RPN A;  5GMK l;  2X9H A;  1OQK A;  4C8Q C;  2DKG A;  3OS2 A;  3A8G B;  4E7Z A;  4BUG A;  2YLC A;  4QKU A;  4JZ4 A;  5IAY A;  4PNO A;  3JCM X;  1Y0M A;  2LCL A;  2GF7 A;  1GRI A;  2K79 A;  3SDZ A;  2CH4 A;  3I55 Q;  1VQ4 A;  2RHU A;  4IUT A;  1YIT A;  5GJV B;  1QVF A;  2FHD A;  2KRN A;  1YJ9 Q;  1HK9 A;  1M1K C;  2ZPI B;  5KYW A;  5GAN f;  4OGC A;  5LJ3 g;  4C0G A;  3OBY A;  2KGT A;  1K9M C;  3SWN C;  2PVO B;  1VQN A;  5GAN 7;  4EIK A;  3RR6 A;  1WHG A;  2HQH A;  2K3Y A;  2KRS A;  2V8K A;  4FM4 B;  3HFN A;  1AOJ A;  3H41 A;  3RUX A;  3MEU A;  3OYL A;  2DXC A;  3OB9 A;  3MPU B;  2DTH A;  5GAN 3;  1VQL T;  3PMT A;  1BI2 A;  2BE7 D;  1UJY A;  2KYM A;  3LGF A;  3R6O A;  4GY5 A;  2AHJ B;  5LJ5 e;  3UPU A;  5IHK A;  4QVD A;  5HK3 A;  4M75 B;  2RHZ A;  1YJW Q;  2YSQ A;  2OJ2 A;  1VUB A;  5GMK j;  2HL5 C;  4OMO A;  3M57 A;  5J26 A;  3QXE B;  1UEC A;  2DTI A;  4ELY C;  5AYF A;  2RI3 A;  1QWE A;  8AT1 B;  1WHH A;  5GAN 6;  3PGG A;  1KIK A;  5GAN g;  1FXX A;  1TSF A;  1CSK A;  3EH1 A;  3I5S A;  4Z89 A;  5C6S A;  4PJO C;  1KQS A;  2MIO A;  4ZTJ A;  2EJF A;  2LQK A;  3JSC A;  2GQI A;  4FYY B;  3G71 T;  4M78 C;  4PJN A;  4Z88 A;  4ORZ A;  1ZSZ A;  1RI9 A;  2ROL A;  1QP2 A;  2DL3 A;  2YRV A;  5J3B A;  4C5G A;  3GIB A;  3RES A;  4RTW A;  2RQT A;  2LJ0 A;  3QHS A;  4XU0 A;  1BB9 A;  1VQK Q;  1X6O A;  2CGH A;  1ZBJ A;  4DA4 A;  4M75 G;  2CUB A;  2VYT A;  3PIP A;  1RL2 A;  2FPD A;  1NYG A;  3JCM V;  3V8L A;  1PG5 B;  1WZO A;  4MZT A;  1JXM A;  1JEG A;  1VQO A;  1X2K A;  2E70 A;  4FL6 A;  1WNL A;  1UGP B;  3G4S A;  1NJI R;  3OYE A;  4J9D A;  3L1A A;  4GLM A;  2FPF A;  4ATO A;  1Y7X A;  3WVE B;  1Q81 R;  3PE0 A;  3G1J A;  3HPW A;  1N9S A;  4LD6 A;  4E2F B;  3NTI A;  3OBW A;  1Q86 U;  5ECA A;  3RIR A;  2EBP A;  1CKA A;  1OYX A;  5A2Q E;  1M2O A;  2D0N A;  3FDR A;  2LCC A;  2A3L A;  2IG0 A;  4CC3 A;  2D1X A;  5FRM A;  4V2S A;  4LDU A;  3CC2 T;  2RI2 A;  1BI3 A;  4TVR A;  2OTJ A;  3UWN A;  1M1F A;  2VXF A;  1I0C A;  3QDR B;  2E64 A;  3JB9 F;  4PFO A;  2EAY A;  1JRI A;  3A8H B;  1OX8 A;  1JJ2 P;  3VRZ A;  3LYI A;  3GLX A;  3JCM e;  2XHC A;  3RKX A;  3V8K A;  1RLQ C;  3QWY A;  1VQL Q;  1H3Z A;  4F7U A;  2K5F A;  3NPF A;  1GCP A;  3FJ5 A;  4ZN1 A;  2DTO A;  1TUC A;  2KE9 A;  1BU1 A;  1TU0 B;  3CCM Q;  1VQM T;  1NEB A;  2RJD A;  1OX9 A;  4ANJ A;  3VKI A;  4HVW A;  2CSQ A;  3UA7 A;  4M7A F;  2L3R A;  2DFU A;  3ER0 A;  4C92 F;  3EGX B;  3KXT A;  1VQO T;  1H92 A;  1NPP A;  3TU4 K;  4A4G A;  2DXT A;  4C0Z A;  2RO0 A;  2COW A;  1K8A C;  4A4E A;  5J39 A;  3RER A;  2DRM A;  4BI4 A;  4HT9 A;  5FLX E;  1BBZ A;  1K1Z A;  1Q7Y R;  4BY6 B;  4A4K A;  3OYK A;  4JJN K;  3OW2 S;  2HL3 A;  3CPW P;  3TCJ A;  3HSB A;  1YIT Q;  2ROT A;  3SHW A;  2MAM A;  2KVQ G;  5EG2 A;  4FT2 A;  4M77 C;  1W2B P;  4ME7 A; 
#chains in the Genus database with same CATH homology
 2CP7 A;  1WHK A;  2COW A;  1WHH A;  3TQ7 P;  2M02 A;  1TOV A;  2CP6 A;  2E3H A;  2CP3 A;  1WHM A;  2COZ A;  2COY A;  3RDV A;  2E4H A;  2QK0 A;  2HL3 A;  2CP2 A;  1LPL A;  1WHG A;  2E3I A;  2HQH A;  2MPX C;  2HKN A;  1TXQ A;  2HKQ B;  1IXD A;  1WHJ A;  1WHL A;  2Z0W A;  2HL5 C;  4B6M A;  2CP5 A;  3E2U A;  2CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...