3MEWA

Crystal structure of novel tudor domain-containing protein sgf29
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
157
Chain Sequence
TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
total genus 25
structure length 157
sequence length 159
ec nomenclature
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mewA02
2LVMA 4E7HA 1KHCA 3ASKA 4LD6A 4QVZA 2HQXA 4HCZA 4RG2A 3NTHA 2MWOA 3FEOA 4IUQA 3OYJA 2O4XA 3FLGA 3UWNA 4B9WA 3OB9A 3OYCA 2EFIA 3P8HA 2EQMA 2JTFA 2K3XA 2RJFA 4OVAA 3UT1A 5J39A 1WGSA 3OYKA 3GOXA 1G5VA 4PLIA 2X4XA 4UC4A 3MEUA 2RJDA 3E9FA 5CIUA 2IG0A 4IUVA 5KE2A 5KH6A 3FC3A 4ZTFA 1MHNA 2VYTA 1WJSA 4E7JA 3S3NA 3S3MA 3C4SA 3OYBA 3QBYA 3LX7A 2L3RA 4II1A 3O8VA 2G3RA 4IUTA 3SD4A 3OA6A 3MEVA 4C5HA 3H6ZA 3OMCA 3OQ5A 2HQEA 4FL6A 3L2WA 3L2VA 3OS0A 4IUPA 3OYFA 3ME9A 4GY5A 3LYIA 3ZEHA 2X4WA 5FRNA 4BE2A 3DB4A 4N4IA 2X35A 5M9OA 1WJQA 2GF7A 3PFSA 3KUFA 1OI1A 3L2UA 2YRVA 3LGFA 4C5EA 2O4XB 5FROA 4QQGA 1SSFA 3MEAA 3Q1JA 3OYDA 3OYIA 2B8AA 2RHUA 2RHXA 3MP8A 4N4GA 1RI0A 4QQDA 3LLRA 2NLUA 2XDPA 4A4HA 3OY9A 4FU6A 1OZ2A 4X34A 3OYEA 4BDZA 2RO0A 3OYLA 4A4FA 4Z02A 4A4GA 2EQUA 2RI5A 4Q5WA 3S6WA 3OYMA 4BDYA 5IN1A 4E7LA 2L89A 2QQRA 3H8ZA 3META 3PNWC 2QQSA 2GFUA 2M0OA 4L59A 3QJ6A 2RHIA 2LDMA 3OS1A 3OYGA 2F5KA 2X4YA 3EAEA 2XK0A 5KCOA 5FRMA 3S3OA 2E6NA 4NS5A 3F70A 2M16A 3L42A 4BE1A 2GFAA 1H3ZA 2D9TA 1OZ3A 5D6YA 4IUUA 2BKDN 2RJEA 4ZTJA 3OS2A 4E7KA 4B9XA 3OMGA 2CKKA 1OYXA 2K3YA 1XNIA 1N27A 2L8DA 3L2QA 3OYHA 2DAQA 4QQ6A 2E5QA 3M9QA 4C5IA 3MO8A 2DIGA 2BIVA 3MP1A 4A4EA 3NTIA 2JZ2A 5C6SA 4BACA 3CEYA 5C0MA 5IAYA 5KCHA 2P0KA 3LGLA 4QW2A 3DB3A 4BE0A 3DLMA 2EQKA 2RHZA 2R5AA 1WJRA 3LH0A 4PL6A 3BDLA 2R57A 2EQJA 2LCCA 2M1HA 3MP6A 2RHYA 2LRQA 2R5MA 4C5GA 3QIIA 3L2RA 2BUDA 4IKFA 2FHDA 2PQWA 5KE3A 4E7IA 3P8DA 3OYAA 3QKJA 4CRIA 4EDUA 5D6XA 2RI3A 3E9GA 4PLLA 5J26A 3OYNA 3NTKA 3FDRA 3PMTA 3MEWA 2R58A 4N4HA 5D6WA 2RJCA 2EKOA 2LTOA 2MWPA 3PMIA 2WACA 2DIQA 4BD3A 4IURA 2RI2A
chains in the Genus database with same CATH superfamily
3GBQA 1BI3A 4KUDK 4PK4A 1RUWA 8AT1B 1UJ0A 3UATA 2RJFA 3OBYA 1M8MA 3PT9A 4M78A 2MCNA 3C4SA 3THKA 3CCMA 1WHJA 5CKHA 4F04B 3H9NA 4IIMA 2YLCA 2CZ7B 3OYFA 1NJIR 4OB0B 2KY9A 1B3QA 4AFSC 3M0PA 3ZL7C 4M7AF 1RL2A 4F7UA 3CC2T 1YITQ 1Y96B 1M2VB 3TQ7P 1AZGB 3LLRA 7AT1B 2H8HA 1VQOA 2HL3A 5GAMj 2COYA 5CQXA 1K76A 4X34A 4J83A 2K79A 3SWNA 2HNIA 3BFMA 4YTLA 1W2BP 3PNWC 4DOVA 3CC4Q 1RLQC 4M4ZA 1M9SA 3EGDB 3OYGA 2F5KA 1SRLA 1V1CA 2E6NA 4NS5A 3SWNC 1PKTA 2LJ3A 1OEBA 5CK9A 1KC8C 1IO6A 1V76A 2YWWA 3JB9H 4EIKA 2L8DA 1FWZA 4ELZC 4EMKB 2GQVA 1YN8A 3JB9D 1X27A 2HQHA 1I5OB 1VQMA 2EGCA 2QI2A 1EFNA 2HBWA 2V8JA 2P0PA 3JCMJ 2VV5A 2XDDA 4J9HA 2L3SA 2EYWA 5LJ3g 2LQKA 1IGUA 2R57A 1VQKQ 2MK5A 4JZ3A 5I11A 1UGQB 4M7DD 2BUDA 2OAWA 4WCIA 2VXEA 3JV3A 3UPUA 4PLLA 2EYYA 1YHQT 2DL4A 3M0QA 2F2WA 3CPWS 1I81A 3VS7A 4LDVA 4E7HA 4WTOB 1OV3A 1KQSA 2LQNA 1RAFB 4X9DA 3G4SQ 2EFIA 2EQMA 3UT1A 2COWA 1PSEA 5CQYA 3E19A 1XJWB 5GMKe 2K5LA 2KRMA 4A63B 2RQWA 1VQKA 4M7AE 5KYNA 3H6ZA 4AFUC 2F1LA 1PNJA 4RTYA 2EJ9A 1PHTA 1ZSZA 4LDWA 2H3EB 3EG9B 2KE9A 3RERA 1GFDA 1K8AU 1QVFS 3DKMA 3C0CA 3JRZA 1SSFA 5A2QE 4HCBA 3NHNA 2QDYB 4F7UG 1UDLA 4A4GA 2J7IA 5LJ5j 4ORZA 4OMFB 4E7LA 3VUZA 2GFUA 2ZPGB 1E7OA 2RHIA 3MCAB 1MMGA 3CC4A 3M55A 1VQ8T 1M90U 3CCEQ 2E12A 1ZUYA 1GBQA 4ZN1A 3CXCA 4LUEA 2RJEA 1YJNT 1WDXA 4DEYA 3QYGB 4OMMA 1JJ2A 1K4US 3M9QA 4OB1B 1X6BA 4A4EA 3NTIA 2JZ2A 5HY6A 5C6SA 1YJNA 2YRDA 4C0FA 4PL6A 5GANf 2EQJA 4B6MA 1W70A 2FL7A 3CCMQ 4C5GA 4PNOA 1KD1R 3R6OA 3RMQA 2FRWA 2RQUA 3QKJA 2HD0A 1O75A 1KIKA 4DA4A 1HSQA 2CSQA 2KROA 1JO8A 2DL7A 2F69A 2VASA 2K2VA 2EJFA 2HQXA 1RAAB 4LDYA 2QASA 4FT2A 2JMCA 3CC4T 4EPCA 4DEXA 2V8IA 3SB2A 4PJOG 1IB8A 4ZN3A 1PKSA 2WSCE 2FYKA 5GANg 4HKEA 4OMQA 2DEQA 3ME9A 1M1KR 2X4WA 5FRNA 4N4IA 2QEXA 3N5BB 3QDRB 3X20B 3KUFA 4M75C 5IHKA 4LDXA 2K5FA 4M7DB 4C8QB 1VQ5Q 2PZ1A 2QQBA 3UDCA 4CC3A 4JJBA 1H8KA 4ANJA 3OYMA 1ZHIA 2VUBA 3EGDA 4M7AB 3CCRA 2DEUA 4L59A 3TSZA 2X4JA 3G71Q 4LUDA 2LJ0A 1V29B 1RLPC 2AZSA 1R0BG 1MNEA 2A37A 4M75G 1H3ZA 3V7SA 2DLPA 3PGGA 2EGEA 2DXCA 1K9MC 5CO7A 4J9IA 2DAQA 3QDFA 4JJDA 1NJIC 3GP8A 3RNJA 1YIJT 3EGXB 1N6AA 1R0CB 3DB3A 3CC7T 3OW2S 2RPNA 4FM4B 3LH0A 1GFCA 1WHLA 3RUXA 2FHDA 2PQWA 3CCLA 4PFZA 3GNFB 1OPKA 4JRQA 4J9DA 3BE3A 4C8QC 4QT7A 2Y4XA 5GAN3 2ROLA 4M75B 3PIPA 4KT0E 3CCUT 5GAN7 1SKUB 4J6YA 4C8QF 1ACMB 2VGMA 1AWWA 4C8QA 5GAOr 5FU6C 1OQKA 3OB9A 4E6RA 2A0FB 1VA7A 4X9CA 1IRXA 2O01E 2YDLA 3H0HA 3FC3A 4C8QG 1Q81U 1MMDA 2YUQA 1SF9A 4XTVA 1ZSZB 2HMAA 3EH1A 2HQEA 3OMCA 1UHFA 3L2WA 1PC0A 4C92F 2ZCFB 4LN2A 2A36A 5EC7A 1X75C 1VQ9Q 3G71T 2DJQA 3VU3C 3J80E 3OYIA 2EW3A 4EMHA 1G3YA 1RAHB 1C0MA 5LJ3j 5IN1A 2P4RA 1G83A 1M3AA 4XAXB 3REAB 3MKDA 2HL5C 1IXDA 3HHTB 2YXYA 2M0YA 4OGEA 2L2PA 1K73U 3HFNA 3CCSA 5LJ3e 1W1FA 2NUZA 1K8AR 1LJOA 2CKKA 2QQ9A 3L2QA 4ZGEB 3CCVQ 2DBMA 2PVOB 1TUDA 1AHJB 1IHWA 4J9EA 1K0SA 2FG0A 5FU6B 1QWFA 2DXTA 4JZ4A 4E2FB 3CEYA 1M3BA 2RHZA 5GAN8 2V26A 2DTHA 1WQWA 3CBMA 4C8QD 2MAMA 2VVKA 5KE3A 3OYAA 3QJYA 2EIFA 3EFRA 1KK7A 4AG1C 3PMTA 5FWBA 2VWFA 3JCMd 3CMET 3CXCS 1BBZA 2DL8A 3ASKA 5GANe 4KH1B 5IH2A 4PJLA 1W2BS 4C92A 1XOVA 1VQOQ 1YI2T 4A53A 4OVAA 3VS1A 2JJ9A 1WGSA 5CIUA 4Z89A 2WSEE 4IUVA 2AHJB 5GAOq 2CYZB 2DE0X 4C92E 3S3NA 4M7AG 2H3JA 4QVDA 4LNPA 5GAN4 3VS4A 5LJ5f 1VQNA 4J7IA 3OS0A 3CCET 4HT9A 3CD6Q 2FPEA 4RG8A 2DZ9A 1Y57A 3PFSA 1D1CA 3L2UA 1TH7A 1X43A 1JJ2P 4CC7A 1Q82C 1PM3A 3OYDA 3MEAA 3Q1JA 1M90R 2B8AA 2RHUA 1WQ7A 4QQDA 3V7CA 3GPLA 4BDZA 4HA8A 4HCCA 2FEIA 5LJ3d 3FB9A 1YJWA 4F17A 3GIBA 3A8GB 2K4YA 2PUKB 1T0JA 3NPFA 3CMEA 4MZMA 3C12A 3CCQQ 1FYNA 3EGXA 2OTJQ 1QP3A 2GFAA 5D6YA 3IQLA 2QEXQ 3CPWA 4PJOE 2RK2A 3HRUA 1NYGA 3PE0A 1ZA2B 3SFMA 5IT9E 3MP1A 1NJIU 3EFSA 2VKNA 3HL8A 4HT8A 3LGLA 5I2SA 2E5KA 2D8HA 4KBMB 3M5AA 1UEBA 1KQ2A 2BZYA 2QK0A 1YCSB 5GAOm 1WHMA 3CCJT 2CZ1B 4M77B 4PJMA 1YNZA 1TOVA 3OYNA 1U1TA 2LT1A 3AHUA 3CPFA 3CCMT 3QSUA 2GTJA 1AWOA 2NUPB 4M78E 1MGQA 3CCLT 1RAEB 1LOJA 8ATCB 3GOXA 1G5VA 4PLIA 2X4XA 1QP2A 4C8QE 3EG9A 2DBKA 4Z88A 1BB9A 3JCMb 1YJNQ 3CC7A 1PD1A 9ATCB 4F7UB 3VS6A 1X2KA 2CP7A 1QVPA 5GAMf 2DERA 3OBWA 5CAIA 2LT4A 3TCJA 2Y90A 3M57A 1OPLA 3REBB 3VRZA 1YBYA 2LC4A 2YUNA 1HXDA 1B34A 4FU6A 1BIBA 1OZ2A 4GLKA 3E1SA 4RTZA 5GANj 3S6WA 3H8ZA 3META 1NBEB 1KD1C 2KXCA 4XU3A 5DM7R 1KFZA 3LWIA 2EQIA 2QA4A 1FMKA 1QW1A 3RMSA 5KCOA 3KBGA 5IXFA 5GANh 1ZBJA 1Q7YU 1W2BA 2DXUA 2RD1A 4BE1A 4GBQA 3SEMA 2L3QA 3JCMP 1X6OA 3JCMe 1H641 1XNIA 4OP0A 3CXCP 4OB3B 3I55Q 1WHHA 2GGRA 2J6FA 2KDSA 4HVWA 1QWEA 4BACA 2DX1A 2RM4A 3NFCA 5KCHA 2P0KA 4M7DC 1VQOT 4QW2A 1VQLA 2HBPA 3RKXA 1MV3A 2IIMA 3QPHA 3PTAA 2XD0A 3I56T 3GNGA 2LQ8A 1OU9A 2KVQG 2VGNA 4M7DF 4JRKA 4C92G 5FW9A 3G4SA 3D7SB 1J3TA 3M4GA 5A0DA 4E7IA 5GAOl 3E9GA 1PRMC 5GJVB 2QGGA 1I5LA 5CKBA 2DRKA 4BD3A 3FJPA 1WHGA 2KQWA 3EG1A 4HCZA 4C92D 1R8OB 2CZ0B 2QA4T 1QVGA 1AWJA 4Y28E 3QYHB 1Q86C 2QYZA 5KYUA 1G3SA 1VYUA 2ABLA 1VQNT 5KH6A 4LXCA 3JCMX 3EGUA 3HFOA 3OA6A 1KQSP 4C5HA 1BK2A 2LCSA 3CPWP 1QCOA 4LE9A 1TXQA 3V8KA 5KYWA 1OI1A 1AZEA 1WXBA 2CP5A 2Y4YA 3G6ET 2YUOA 2L5QA 1VQ7T 3H0IA 4FCYA 3EHRA 4MMLA 2FZCB 1M5Q1 1NG2A 5KYYB 2M0OA 4JS4A 3CCLQ 5HK3A 2JOYA 1D3BA 4TVRA 4QKUA 3OS1A 2E65A 3I5RA 2O9SA 1FMWA 3HKSA 4NOYA 5GAMg 1JXMA 3F70A 5ECAA 1YITA 2GNCA 2CUDA 4M77C 2BZ8A 4B9XA 4EMKA 1K1ZA 4AFZC 1QLYA 3M58A 2OTLA 2QGFB 4ZNXA 3CCJQ 4ME7A 1NEGA 2E1HA 3QHSA 1K73C 5CVIA 1BCOA 3BDLA 4PJNA 2KBTA 4KGXB 1YJ9A 2DD5A 2DJZA 2R5MA 1ZUUA 3P8DA 1C1AA 2XI9A 3CCRQ 4M78D 5J26A 1NM7A 4ATOA 2X3XD 2I2LA 2R58A 1DJ7B 1Q81C 4M7AA 1LCKA 2LVMA 1SSHA 2YRCA 1QCFA 1M1GA 3OYJA 3NTHA 2MWOA 4C0ZA 4WF2A 2MYSA 2RF0A 4XU2A 5KYXA 3OYCA 4JJNK 2JTFA 2GCXA 4A54A 1M27C 2FRYA 4FSSA 5IXBA 1VYVA 3U23A 3JB9I 3KFVA 3OYBA 2L3RA 4DBQA 3VJPA 2DFUA 5AT1B 2HEQA 4XTUA 1M30A 1VQPQ 4IUPA 1K73R 3VS3A 2XDBA 2YSQA 3CD6T 3TREA 1K8AC 4QVCA 5LJ5g 1WPYA 1X6GA 2SEMA 1AT1B 3A5ZB 3L1AA 2EVRA 3VS0A 2NYSA 3CCQA 1U06A 5DLOA 3TEEA 2DL5A 4DQ2A 4M7DG 4RCBA 2JVVA 2LDMA 2MMPA 1TSFA 4MDWA 1TS9A 1WA7A 4XTYA 3L42A 2YLBA 5LJ3f 2LNHB 2AK5A 4IUUA 4HVUA 4KGVB 1YJ9Q 4L5GA 1T0HA 1QVGP 3CCST 2E5QA 1N8RU 2C06A 4M7AD 5LJ5h 5IAYA 1CKAA 1WX6A 2JT4A 2LZ6B 4J5YA 1SEMA 1ARKA 3V8JA 3RDVA 4FIBA 2DK3A 4BUGA 4MDXA 2EYXA 1OX8A 1UGRB 1OULA 3CQTA 2EBPA 1BCMA 5DY9A 1YJ9T 1NLOC 3NTKA 1VQ6Q 4FYXB 1M1KU 2EJGA 1UE9A 5GAMh 2DVJA 3C95A 2COZA 4LD6A 1MV0B 2E4HA 2V8KA 4FYVB 4JJCA 3FLGA 1LNXA 4XK8E 3UWNA 1ABQA 1MMNA 2M02A 2RJDA 2VYTA 1M1KC 1VQ7Q 4IUTA 4DBHA 1O9SA 2X3WD 4Y92A 3MEVA 1WLPB 3TSWA 3A98A 3G6EQ 4JLGA 3L2VA 2CUBA 4JDSA 4M75F 3FJ5A 1AVZC 5GAOn 5A0LA 2XIDA 1K9MR 1Y07A 3JCMh 1OX9A 4J9FA 3MJXA 2RNAA 3SDZA 1T3LA 3P8BB 4A4FA 5CR2A 1XQHA 1I0CA 4J6XA 4M75D 1N8RC 2D0QB 4JLIA 2DVEA 2KRNA 1GCQA 1R77A 1NE8A 1KQSS 2D1XA 3JCMW 2J6OA 3I5SA 5LJ5e 2D9TA 1Q7YR 1VIEA 4ESRA 1U3OA 1YIJA 1U5SA 1M8VA 1D0YA 1MUZA 1XTDA 4XTXA 2X51A 3SHWA 3VV0A 2ZPEB 4MMKA 2BIVA 1VQLQ 4NL3A 4AFQC 1QQJA 1E6HA 3I56Q 2ZPFB 3UF4A 2LCCA 2RQRA 2XG8D 2KYBA 4OMPA 4BI4A 2HSEB 1C6VX 1YHQQ 1E6GA 2RI3A 3CCUA 4M77A 3EHQA 5A0GA 4J8OA 5D6WA 1YWOA 2EKOA 2LTOA 2VB6A 2WACA 2I0NA 2O9VA 1VQ6A 2DZCA 2QQAA 1ZX6A 4LDUA 5GJWB 2JNGA 4P5NA 3V7RA 1VQ4Q 1WNLA 3JCMV 1N5ZA 1NPRA 2A28A 1Z9ZA 2ZPIB 1NLPC 3BDUA 3JB9F 3AT1B 1YHQA 1JEGA 2F2XA 3MEUA 3M56A 2IG0A 2YT6A 2CSIA 2J6KA 4ZTFA 2K6DA 4PFOA 2MF2A 3ZFJA 4XTWA 3A8HB 2E6ZA 3RIRA 4M78C 5KYWB 5FU7C 4RTWA 2W0ZA 4GY5A 4PJJA 5GMKl 1G3WA 2PNIA 2JMAA 3OSSC 3X24B 3J7AF 5I2MA 2CP2A 1M1FA 2CP0A 2E3IA 2K57A 4N4GA 4D8KA 2JUFA 1QCNA 1CSKA 4D8DA 4A4HA 5GMKi 2XDPA 2GQIA 4J9BA 4BB7A 5L8RE 2EWNA 1IZ6A 3QJ6A 1W6XA 1F1BB 1RADB 2X4YA 4M77D 1HYOA 2RMOA 4M77F 2G6FX 4M78F 2BKDN 2A08A 1OOTA 1PSFA 1OYXA 2YUPA 1UG1A 4GLMA 2FO0A 1I07A 3CMAT 1D0XA 2DNUA 2DYIA 3J81E 2E10A 3UA7A 1VQ4T 1I8FA 3KXTA 3WVEB 2J05A 2KSSA 2RQTA 3BY7A 1RABB 2IPOB 1VQ7A 2CGHA 5FU7B 3WXMB 5CCAA 1QKWA 1RAGB 3X26B 3G7ZA 3I55T 1B34B 2HSPA 1U8RA 2GTOA 5L23A 3HP9A 3PMIA 2MI6A 1FXXA 3EH2A 1BI2A 4NL2A 1FMVA 5GMKj 3CCQT 2KT1A 1JB0E 2JTMA 2C0TA 2K2MA 2MIOA 2CZ6B 4DBFA 2JM9A 1X01A 2ENMA 1K0XA 2OI3A 5GAN5 1JJ2S 4CI0C 1RI9A 1UHCA 2E70A 4A4KA 2L3PA 4F7UF 1PRLC 2RN8A 2LCLA 4M7DA 2JS0A 1VOMA 2OTLQ 3HTRA 4RUGA 2KXDA 1QKXA 3HPWA 3HRTA 3JCMc 1AWXA 4F14A 2Z0WA 1YP5A 1UB4A 4BY6C 1Q82U 1CKBA 4M75E 1S72T 1ZQ1A 1KC8R 3GF5A 2O4XB 1Q7YC 2A3LA 3A8OB 2NLUA 3JSCA 2AKLA 1NEBA 2JN0A 2DTOA 1QVFA 2HCKA 1N8RR 2DD4A 2C0IA 3M59A 2LMJA 3EAEA 2XK0A 1K9AA 3EG0A 1GCPA 1OZ3A 3C94A 4J9GA 1M3CA 2LP5A 2K5IA 5HKCA 2O2OA 4BI8B 3M54A 1RAIB 2LX7A 5GAMe 2EQKA 1QVFP 4XU1A 2R5AA 5GAOp 3EG3A 2AT1B 1GCQC 4FSXA 5IHNA 4PFPA 3QXEB 1VQ6T 3CCSQ 1YI2A 4EDUA 1ZUKA 1AOJA 2ROTA 1AEYA 3VS2A 4R55A 3M0UA 5KYXB 3SWNB 4N4HA 5FLXE 2RA2A 2MWPA 2NUPA 3NGPA 1X69A 2DIQA 4M7DE 2OTJT 4M78G 1SHFA 2RI2A 4V2SA 4CC2A 4RG2A 4FW2A 1ZA1B 2O4XA 2ZPBB 3QG1A 2HKNA 3P8HA 2BE9B 4EMKC 3OW2P 4R0KA 3LX7A 4PKCC 3SD4A 2G3RA 2ED0A 3A8LB 1D1BA 1GRIA 3EFOB 1BI0A 3VUBA 3MPUB 3I55A 1WI7A 2JS2A 2KK4A 4BE2A 5M9OA 1VQMQ 2CDTA 2EYQA 1ZSGA 5LJ3h 1AD5A 1GL5A 1ABOA 4QQGA 1VQ8A 2HDAA 2RHXA 2QAZA 4PJOC 4Z02A 2EQUA 2ZPHB 1S72Q 3JAME 1YCYA 1VIFA 4AMCA 1FX7A 1S1NA 4VUBA 3VYGA 2M51A 3CCUQ 4PJOA 2P4TA 3HSBA 3QO3A 1GXIE 4HVVA 4JS5A 4ZTJA 4E7KA 4R56A 2K3YA 4O6JA 3RESA 3X28B 1TUGB 4XTZA 3CCRT 1G2BA 2KT8A 3LH5A 4RTUA 2B86A 2DO3A 4CC4B 3CBPA 3I9QA 3RKYA 2ATCB 3L2ZA 2KGTA 2FVUA 2RK1A 5I22A 1YIJQ 2KRSA 3QIIA 3L2RA 5HK0A 2RB6A 1Y7XA 1KSWA 1LPLA 1Y0MA 2CP6A 5D6XA 3CCVT 2KYMA 2LQWA 3TU4K 1JBMA 3G71A 3E2UA 3VKIA 2PVGB 1Q81R 1UUEA 1M4ZA 2K7AA 2P0QA 1KHCA 1UGPB 4MZPA 5LL6S 1I4K1 2JXBA 2MOXA 3CMAQ 2QDLA 1N9RA 5KE2A 3E9FA 3WVDB 1WJSA 2QTXA 4LD9K 3T9NA 2QXFA 4II1A 3O8VA 4RMOA 1VQ5T 3I35A 2DPPB 4FL6A 2ED1A 1BKBA 5D7UA 4L6V5 4M77E 4ZGJB 2AKKA 3VYHB 1TUCA 2V1QA 3EFOA 2VXFA 3JB9G 2DKGA 4C5EA 1Q86R 4JPBW 1TWBA 2EYZA 5GAN6 4N0AA 4MZTA 5GAMd 3HRSA 2RO0A 1UTIA 2HZYA 1YJWQ 1D3BB 1KD1U 5FWCA 2X9HA 4X1VA 3RR6A 1WFWA 4E47A 2QA4Q 3OSVA 1EZZB 4RCCA 5CKEA 4EMGA 4N0AC 2ESWA 3S3OA 2ZZDA 2OTLT 5I21A 1LVKA 1UGSB 1UJYA 3OS2A 2LX9A 1K9MU 3GLXA 4AT1B 5GANd 3CCJA 4KULA 2PU9B 1VQNQ 3QUIA 3QWYA 1X2QA 3CC2A 2ZAEA 3DLMA 3R6NA 1ZSZC 1WJRA 2NUTB 1EIFA 4XU0A 2ZGWA 3CC7Q 2EAYA 1OU8A 2M1HA 2WSFE 2RHYA 3ULRB 2P84A 1UGVA 1H3HA 1MMAA 4ELYC 4E7ZA 1Y71A 1KG1A 4F7UE 4Y91A 2A7YA 4Z8AA 2KR3A 4FW1A 4RKUE 3UA6A 2CT3A 2DXBA 5AYFA 3O5ZA 2E3HA 2FPFA 3G1JA 3RBBB 3OW2A 2JM8A 4AG2C 4IUQA 2DYBA 3QZ5B 2EGAA 3OYYA 3OS5A 2K3XA 3X25B 4J6WA 3OYKA 3VS5A 5CKFA 4UC4A 2KMTA 1PCXA 2KI7A 2O31A 1MHNA 2E41A 3S3MA 2XKOC 4C0GA 2FZKB 2XMFA 2V1RA 3H0FA 3CMAA 3LYIA 3ZEHA 2IVWA 3DB4A 1WJQA 4BI3A 3LGFA 5FROA 3MP8A 1JQQA 1RI0A 2KNBB 2OX7A 2LJ1A 4J9CA 1B07A 3OYEA 2KAFA 4Q5WA 4BDYA 1M2VA 2KEAA 1D0ZA 4XQ3A 4J7FA 3G4ST 2NUTA 4KUIA 2CREA 2NWMA 2DM1A 4IIOA 1NZ9A 2QG9B 2OAUA 1BU1A 2M16A 2W10A 4KGZB 2SRCA 3OMGA 1VQ9A 1D1AA 1N27A 2PUOB 1HD3A 2ECZA 1SHGA 4OF1A 2YHTA 4ZGDB 1G8XA 2DRMA 3CD6A 2JTEA 2OJ2A 1ZBXA 3M53A 1NPPA 2DMOA 6AT1B 2DILA 1M2OA 1B7TA 1TTHB 1VUBA 4M75A 5J3BA 4IKFA 1VQ4A 2CS7A 2QTVA 1Q86U 3VRYA 1S72A 4CRIA 2CP3A 4M7AC 4OMNA 2QEXT 3FIFA 4DBRA 3PVQA 2BZXA 4IURA 4JUVA 3OYLA 1VQ8Q 1Y96A 4QVZA 4HCKA 2BTTA 4B9WA 1VQLT 3I56A 4O5VA 4OGCA 2O88A 4E7JA 1KJWA 2VC8A 1SG5A 2D0NA 1H92A 3OQ5A 4OB2B 4C0DC 4F16A 1YITT 1IGQA 3JB9J 2DA9A 2LNVA 1GBRA 1UFFA 2GF7A 3TVTA 3DLLA 3MHXA 3M0TA 2YRVA 1QMCA 1YWPA 1BI1A 2XU8A 2CT4A 3OY9A 4KH0B 3INZA 3JCMg 2PVDB 2RI5A 1VYTA 5KYUB 2L89A 2QQRA 5LJ5d 4PJOB 4HXJA 3RKWA 1YI2Q 2FZGB 1HJDA 1HK9A 1PWTA 1VQMT 4RTXA 1BIAA 2DL3A 2L0AA 3NMZC 4KRTA 1WXUA 2DETA 1PD0A 1M90C 3PIOA 1Q82R 1KC8U 1JXOA 2EKHA 3OYHA 4E7SA 4OMOA 3MO8A 3LW5E 1IREB 3ZBDA 3G6EA 5C0MA 1TU0B 4JRIA 1VQKT 4BE0A 1W4SA 4JRPA 2OTJA 3M4YA 3PVLA 1YFNA 3CMEQ 2J06A 2LRQA 4M78B 2RQVA 2GBQA 4PJOF 1P92A 5HCKA 4C92B 1ZLMA 2CH4W 1A0NB 5GMKm 2RJCA 4FYYB 5KYYA 1D09B 2D8JA 2D6FA 3QZ9B 1SRMA 1TG0A 3A1PA 3FEOA 1IHVA 3H41A 4FYWB 5J39A 1YJWT 3EG2A 3LWHA 1N9SA 2HKQB 3QWXX 4C0DB 5GMKh 1KHIA 1UECA 1WHKA 2PTKA 3QBYA 1JRIA 3A8MB 5CKDA 2HAXA 3CC2Q 2E64A 2RH2A 4RTVA 1VQ9T 1KQ1A 2X35A 2AZVA 3BW1A 5GAN2 1Z9QA 2K9GA 1PG5B 2DTIA 3CCEA 3JCMQ 2FB7A 3FRNA 4D6WA 1MNDA 2F2VA 2DF6A 2QQSA 3V8LA 2FPDA 1RACB 1QVGS 5FRMA 2JW4A 4K11A 4BY6B 1VQPT 2M9UA 3M0RA 4C92C 1G3TA 5IHIA 1VQ5A 2CH4A 1VQPA 4FT4A 4QQ6A 4C5IA 2DIGA 3CCVA 1Q95G 3M0SA 2XICA 2XHCA 1I1JA 3JCMf 1WIEA 4PJOD 2EPDA 1WZOA 1WYXA 5EG2A 2AIRB 3MP6A 2MPXC 1T3SA 4RTTA 1JU5C 3CBOA 3URGA 4M77G 1WXTA 3ER0A 2C0OA 4DOWA 1SPKA 1NYFA 3FDRA 2F5TX 1U1SA 3MEWA 2K3BA 5DLQE 1BYMA 2BE7D 4OMLA 1EX4A
chains in the Genus database with same CATH topology
2P0QA 1KHCA 3C95A 3ASKA 5GANe 1BI3A 4LD6A 4KUDK 1UGPB 1W2BS 4C92A 2V8KA 4MZPA 1XOVA 5LL6S 1I4K1 1LNXA 3FLGA 4XK8E 3UWNA 1YI2T 4A53A 2RJFA 4OVAA 3OBYA 1WGSA 1N9RA 5CIUA 5KE2A 2RJDA 3E9FA 2WSEE 3PT9A 4IUVA 2AHJB 3WVDB 2CYZB 5GAOq 4C92E 2VYTA 1WJSA 2QTXA 4M78A 3T9NA 3S3NA 4LD9K 3C4SA 1M1KC 2QXFA 2H3JA 4QVDA 4IUTA 4II1A 3CCMA 3O8VA 1O9SA 3MEVA 4RMOA 5CKHA 1VQ5T 4JLGA 5GAN4 5LJ5f 2DPPB 4FL6A 3L2VA 4J7IA 1VQNA 4JDSA 2YLCA 3OS0A 1BKBA 3CCET 4HT9A 2CZ7B 4M75F 3OYFA 4RG8A 4L6V5 4M77E 2DZ9A 4OB0B 2KY9A 4ZGJB 4M7AF 1RL2A 4F7UA 5GAOn 3VYHB 5A0LA 3PFSA 3CC2T 2VXFA 1TH7A 3L2UA 2XIDA 2DKGA 4C5EA 3JB9G 1Q82C 1Y96B 3OYDA 1Y07A 3MEAA 3Q1JA 2B8AA 2RHUA 1WQ7A 3JCMh 4QQDA 3V7CA 3LLRA 5GAN6 4N0AA 4MZTA 1VQOA 5GAMd 3SDZA 5GAMj 3HRSA 3GPLA 3P8BB 5CQXA 4X34A 4J83A 3SWNA 2RO0A 4BDZA 4HA8A 4A4FA 5CR2A 2HNIA 1XQHA 3BFMA 4YTLA 4HCCA 5LJ3d 1KD1U 3PNWC 1D3BB 3FB9A 4J6XA 4M75D 4DOVA 1YJWA 1N8RC 3GIBA 2D0QB 4E47A 3A8GB 2K4YA 4JLIA 2PUKB 2DVEA 1M9SA 3OYGA 3OSVA 2F5KA 5CKEA 4RCCA 4EMGA 4N0AC 1NE8A 1KQSS 3CMEA 2E6NA 3S3OA 4NS5A 4MZMA 3C12A 2ZZDA 3SWNC 3JCMW 2OTLT 5I21A 1QP3A 1UGSB 5LJ5e 2GFAA 2D9TA 1VIEA 5D6YA 5CK9A 1KC8C 1YIJA 3OS2A 2LX9A 1M8VA 3JB9H 3CPWA 1K9MU 3GLXA 4PJOE 1XTDA 4XTXA 2L8DA 2RK2A 5GANd 3HRUA 3VV0A 1FWZA 2ZPEB 3CCJA 4ELZC 4EMKB 2GQVA 4KULA 2PU9B 3JB9D 3SFMA 4MMKA 5IT9E 2BIVA 3MP1A 3QUIA 1VQMA 1NJIU 3EFSA 3HL8A 4HT8A 3LGLA 2QI2A 5I2SA 4NL3A 3JCMJ 2V8JA 2P0PA 2VV5A 2XDDA 4KBMB 3CC2A 3M5AA 3DLMA 1UEBA 5LJ3g 1KQ2A 1WJRA 2LQKA 1EIFA 2ZPFB 4XU0A 2R57A 2ZGWA 2EAYA 2LCCA 2M1HA 2WSFE 2RHYA 5GAOm 2XG8D 1UGQB 4M7DD 3CCJT 2BUDA 2CZ1B 4BI4A 4ELYC 1KG1A 1Y71A 4M77B 4F7UE 2VXEA 4Y91A 2A7YA 3UPUA 2RI3A 3CCUA 3OYNA 4PLLA 4RKUE 1U1TA 1YHQT 2LT1A 4M77A 2DXBA 5AYFA 5A0GA 4J8OA 5D6WA 3CPWS 2EKOA 2LTOA 2WACA 3AHUA 1VQ6A 3CPFA 3CCMT 1I81A 3QSUA 2DZCA 2QQAA 4LDVA 4E7HA 3OW2A 4LDUA 4M78E 1MGQA 2JNGA 4IUQA 4P5NA 3V7RA 1WNLA 3JCMV 3QZ5B 1KQSA 3OYYA 3OS5A 1NPRA 4X9DA 3CCLT 2ZPIB 2EFIA 1LOJA 2EQMA 2K3XA 3UT1A 3X25B 1PSEA 3BDUA 3JB9F 4J6WA 3OYKA 3GOXA 1YHQA 5CKFA 5CQYA 4PLIA 2X4XA 1QP2A 3MEUA 4UC4A 2KMTA 3M56A 2IG0A 4C8QE 3E19A 4ZTFA 1MHNA 2E41A 5GMKe 2K5LA 2MF2A 3ZFJA 3S3MA 2XKOC 4XTWA 4C0GA 3A8HB 2E6ZA 3RIRA 3JCMb 3CC7A 1VQKA 4M7AE 3H6ZA 4F7UB 1QVPA 4M78C 2EJ9A 5FU7C 5GAMf 4GY5A 3CMAA 3LYIA 4LDWA 3ZEHA 5GMKl 2IVWA 3DB4A 3OBWA 1G3WA 5CAIA 2LT4A 1WJQA 3OSSC 3RERA 3X24B 3J7AF 5I2MA 4BI3A 1K8AU 1M1FA 3TCJA 3DKMA 1QVFS 3LGFA 3JRZA 5FROA 1SSFA 5A2QE 4HCBA 2K57A 2Y90A 3M57A 3MP8A 4N4GA 1YBYA 2JUFA 2LC4A 1RI0A 4A4HA 5GMKi 2XDPA 2QDYB 1HXDA 1B34A 4FU6A 1BIBA 1OZ2A 4F7UG 4GLKA 3E1SA 3OYEA 5GANj 4A4GA 4BB7A 2KAFA 4Q5WA 5L8RE 3S6WA 5LJ5j 4OMFB 4BDYA 4E7LA 3H8ZA 3META 2EWNA 3VUZA 2GFUA 1KD1C 4XQ3A 4XU3A 5DM7R 1IZ6A 2ZPGB 3QJ6A 4J7FA 2RHIA 3MCAB 3LWIA 3G4ST 4KUIA 1QW1A 2QA4A 3RMSA 2X4YA 4M77D 3CC4A 5KCOA 3KBGA 5GANh 4M77F 3M55A 1VQ8T 1Q7YU 1NZ9A 1W2BA 2DXUA 1M90U 4M78F 2E12A 2OAUA 2M16A 2RD1A 4ZN1A 3CXCA 4BE1A 2BKDN 2RJEA 3JCMP 1YJNT 1X6OA 3JCMe 1H641 3OMGA 1PSFA 1VQ9A 1OYXA 1XNIA 4OP0A 1N27A 4OB3B 3QYGB 2PUOB 2KDSA 1JJ2A 3M9QA 4OB1B 3CMAT 4A4EA 4BACA 3NTIA 2JZ2A 2RM4A 2YHTA 3NFCA 4OF1A 5HY6A 5C6SA 5KCHA 1YJNA 4ZGDB 2P0KA 4M7DC 1VQOT 4QW2A 1VQLA 3J81E 2HBPA 2E10A 3CD6A 4C0FA 1VQ4T 1I8FA 1ZBXA 3RKXA 3QPHA 3M53A 3KXTA 3PTAA 3WVEB 3I56T 1NPPA 3GNGA 2LQ8A 2XD0A 4PL6A 5GANf 2KSSA 2KVQG 2EQJA 2VGNA 3BY7A 4JRKA 4C92G 4M7DF 1VUBA 2FL7A 1VQ7A 2CGHA 3G4SA 4M75A 4PNOA 5FU7B 3M4GA 3R6OA 5J3BA 3WXMB 4C5GA 3RMQA 5A0DA 3X26B 2CS7A 3G7ZA 5CCAA 4E7IA 1VQ4A 1Q86U 1S72A 3QKJA 4CRIA 3I55T 5GAOl 4M7AC 1B34B 3E9GA 2HD0A 1U8RA 1O75A 2QEXT 3FIFA 1I5LA 4DA4A 3HP9A 3PMIA 2MI6A 1FXXA 5CKBA 4BD3A 1BI2A 4NL2A 4IURA 3FJPA 2KQWA 2F69A 4JUVA 5GMKj 3OYLA 1Y96A 3CCQT 2K2VA 2EJFA 2HQXA 4HCZA 4QVZA 4C92D 1JB0E 2JTMA 1R8OB 4LDYA 2CZ0B 4FT2A 2QA4T 2CZ6B 4B9WA 1QVGA 4Y28E 3QYHB 3CC4T 1X01A 1Q86C 1VQLT 5GAN5 1JJ2S 4CI0C 1G3SA 1VQNT 4EPCA 5KH6A 2V8IA 3I56A 4O5VA 3SB2A 4OGCA 2E70A 3JCMX 4PJOG 4E7JA 4A4KA 2VC8A 4F7UF 3HFOA 3OA6A 4ZN3A 4C5HA 2LCLA 2WSCE 2FYKA 5GANg 3OQ5A 4OB2B 4C0DC 4HKEA 4M7DA 1YITT 2DEQA 3HPWA 3ME9A 3HRTA 2X4WA 3JB9J 3JCMc 5FRNA 2LNVA 4N4IA 2QEXA 3N5BB 3QDRB 1UB4A 3X20B 3V8KA 2GF7A 4BY6C 3KUFA 3DLLA 4M75C 1Q82U 1OI1A 3MHXA 2YRVA 4M75E 1ZQ1A 1S72T 3GF5A 4LDXA 2O4XB 1Q7YC 2K5FA 4M7DB 4C8QB 1BI1A 2Y4YA 3G6ET 2QQBA 2XU8A 2A3LA 3UDCA 3A8OB 3OY9A 2L5QA 2NLUA 1VQ7T 3JSCA 4MMLA 2PVDB 3INZA 1ZHIA 1M5Q1 2RI5A 3JCMg 3OYMA 2JN0A 2VUBA 2L89A 2DTOA 2QQRA 5LJ5d 1QVFA 4M7AB 4PJOB 2M0OA 3CCRA 3RKWA 4L59A 4JS4A 5HK3A 2JOYA 1D3BA 4TVRA 2DD4A 1HK9A 3OS1A 2E65A 2X4JA 3M59A 1VQMT 1V29B 3EAEA 2XK0A 3HKSA 4NOYA 1BIAA 5GAMg 4M75G 3F70A 1M90C 1H3ZA 3V7SA 3PIOA 1YITA 1OZ3A 3C94A 3PGGA 2DXCA 1K9MC 4M77C 4B9XA 4EMKA 1KC8U 5CO7A 2K5IA 5HKCA 3OYHA 3M58A 2DAQA 2OTLA 1NJIC 3MO8A 3LW5E 4BI8B 1IREB 3ZBDA 3G6EA 3M54A 3GP8A 1YIJT 5C0MA 1N6AA 1G5VA 4IKFA 4ME7A 3DB3A 4JRIA 1VQKT 3CC7T 5GAMe 4BE0A 2E1HA 3QHSA 3OW2S 1K73C 1W4SA 2EQKA 4XU1A 4JRPA 2OTJA 4FM4B 2R5AA 3M4YA 5CVIA 3LH0A 5GAOp 3BDLA 1YJ9A 4FSXA 3QXEB 2DD5A 2DJZA 2LRQA 2R5MA 4M78B 3RUXA 2FHDA 2PQWA 1VQ6T 3CCLA 3P8DA 4M7AG 1YI2A 3GNFB 2XI9A 4JRQA 4EDUA 4M78D 4R55A 5J26A 4C8QC 4PJOF 1P92A 4C92B 4ATOA 3SWNB 2I2LA 2Y4XA 5GAN3 2R58A 4N4HA 5FLXE 2RJCA 2RA2A 4M75B 5GMKm 2MWPA 1DJ7B 1Q81C 2DIQA 4M7DE 2OTJT 4M78G 3PIPA 4M7AA 2D6FA 4KT0E 2RI2A 2LVMA 4V2SA 3CCUT 5GAN7 4J6YA 3QZ9B 1M1GA 4RG2A 3OYJA 3NTHA 2MWOA 3FEOA 2VGMA 4C0ZA 4C8QF 2O4XA 2ZPBB 4WF2A 4C8QA 5GAOr 3QG1A 5FU6C 4XU2A 3OB9A 3OYCA 3P8HA 4JJNK 2JTFA 2GCXA 5J39A 4A54A 4EMKC 4X9CA 1YJWT 2O01E 3LWHA 3FC3A 1N9SA 4C0DB 5GMKh 1KHIA 4C8QG 3OYBA 3JB9I 3QBYA 3LX7A 2L3RA 4PKCC 3SD4A 2G3RA 1Q81U 3VJPA 4XTVA 3A8LB 3OMCA 4XTUA 2HQEA 3L2WA 1JRIA 3A8MB 5CKDA 4C92F 1BI0A 3VUBA 4IUPA 2E64A 3I55A 2ZCFB 2HAXA 2KK4A 2RH2A 4BE2A 1VQ9T 2XDBA 1X75C 1KQ1A 2X35A 5M9OA 3G71T 3BW1A 5GAN2 3CD6T 2EYQA 3TREA 2DTIA 5LJ3h 3CCEA 1K8AC 3VU3C 3JCMQ 3J80E 4QQGA 1VQ8A 2FB7A 3OYIA 2RHXA 4QVCA 4EMHA 1G3YA 3FRNA 4D6WA 5LJ5g 4PJOC 1WPYA 3A5ZB 3L1AA 4Z02A 2EQUA 5LJ3j 2ZPHB 5IN1A 3CCQA 2QQSA 5DLOA 3TEEA 4XAXB 4DQ2A 3V8LA 3JAME 1YCYA 1VIFA 4M7DG 4RCBA 2JVVA 2LDMA 2MMPA 1FX7A 3HHTB 1QVGS 4MDWA 4VUBA 3VYGA 4OGEA 5FRMA 4PJOA 2P4TA 3HSBA 4BY6B 4XTYA 1VQPT 2M9UA 3HFNA 3QO3A 4C92C 1K73U 1GXIE 3CCSA 5LJ3e 1G3TA 3L42A 2YLBA 5LJ3f 4IUUA 4JS5A 1LJOA 4ZTJA 4E7KA 4R56A 2CKKA 2K3YA 4O6JA 3RESA 1VQ5A 4L5GA 3X28B 2QQ9A 3L2QA 4ZGEB 4XTZA 3CCRT 1VQPA 2PVOB 4FT4A 4QQ6A 3CCST 2E5QA 4C5IA 1AHJB 1N8RU 2C06A 4M7AD 2DIGA 5FU6B 3CCVA 2DXTA 2XICA 5LJ5h 2XHCA 3CEYA 5IAYA 2DO3A 3JCMf 4PJOD 3CBPA 4J5YA 3RKYA 3V8JA 2RHZA 5GAN8 4FIBA 3L2ZA 2DK3A 5EG2A 4BUGA 4MDXA 2FVUA 3MP6A 2DTHA 2RK1A 1WQWA 1UGRB 3CBMA 2MAMA 3CBOA 3QIIA 3URGA 4C8QD 3L2RA 4M77G 5KE3A 2RB6A 5HK0A 1Y7XA 3OYAA 3QJYA 3ER0A 5DY9A 2EIFA 5D6XA 3CCVT 3EFRA 1YJ9T 4DOWA 3NTKA 3FDRA 3TU4K 1JBMA 2F5TX 3PMTA 1U1SA 3MEWA 3VKIA 3G71A 2PVGB 1M1KU 5DLQE 2EJGA 1BYMA 3JCMd 3CMET 1M4ZA 3CXCS 5GAMh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVM A;  4E7H A;  1KHC A;  3ASK A;  4LD6 A;  4QVZ A;  2HQX A;  4HCZ A;  4RG2 A;  3NTH A;  2MWO A;  3FEO A;  4IUQ A;  3OYJ A;  2O4X A;  3FLG A;  3UWN A;  4B9W A;  3OB9 A;  3OYC A;  2EFI A;  3P8H A;  2EQM A;  2JTF A;  2K3X A;  2RJF A;  4OVA A;  3UT1 A;  5J39 A;  1WGS A;  3OYK A;  3GOX A;  1G5V A;  4PLI A;  2X4X A;  4UC4 A;  3MEU A;  2RJD A;  3E9F A;  5CIU A;  2IG0 A;  4IUV A;  5KE2 A;  5KH6 A;  3FC3 A;  4ZTF A;  1MHN A;  2VYT A;  1WJS A;  4E7J A;  3S3N A;  3S3M A;  3C4S A;  3OYB A;  3QBY A;  3LX7 A;  2L3R A;  4II1 A;  3O8V A;  2G3R A;  4IUT A;  3SD4 A;  3OA6 A;  3MEV A;  4C5H A;  3H6Z A;  3OMC A;  3OQ5 A;  2HQE A;  4FL6 A;  3L2W A;  3L2V A;  3OS0 A;  4IUP A;  3OYF A;  3ME9 A;  4GY5 A;  3LYI A;  3ZEH A;  2X4W A;  5FRN A;  4BE2 A;  3DB4 A;  4N4I A;  2X35 A;  5M9O A;  1WJQ A;  2GF7 A;  3PFS A;  3KUF A;  1OI1 A;  3L2U A;  2YRV A;  3LGF A;  4C5E A;  2O4X B;  5FRO A;  4QQG A;  1SSF A;  3MEA A;  3Q1J A;  3OYD A;  3OYI A;  2B8A A;  2RHU A;  2RHX A;  3MP8 A;  4N4G A;  1RI0 A;  4QQD A;  3LLR A;  2NLU A;  2XDP A;  4A4H A;  3OY9 A;  4FU6 A;  1OZ2 A;  4X34 A;  3OYE A;  4BDZ A;  2RO0 A;  3OYL A;  4A4F A;  4Z02 A;  4A4G A;  2EQU A;  2RI5 A;  4Q5W A;  3S6W A;  3OYM A;  4BDY A;  5IN1 A;  4E7L A;  2L89 A;  2QQR A;  3H8Z A;  3MET A;  3PNW C;  2QQS A;  2GFU A;  2M0O A;  4L59 A;  3QJ6 A;  2RHI A;  2LDM A;  3OS1 A;  3OYG A;  2F5K A;  2X4Y A;  3EAE A;  2XK0 A;  5KCO A;  5FRM A;  3S3O A;  2E6N A;  4NS5 A;  3F70 A;  2M16 A;  3L42 A;  4BE1 A;  2GFA A;  1H3Z A;  2D9T A;  1OZ3 A;  5D6Y A;  4IUU A;  2BKD N;  2RJE A;  4ZTJ A;  3OS2 A;  4E7K A;  4B9X A;  3OMG A;  2CKK A;  1OYX A;  2K3Y A;  1XNI A;  1N27 A;  2L8D A;  3L2Q A;  3OYH A;  2DAQ A;  4QQ6 A;  2E5Q A;  3M9Q A;  4C5I A;  3MO8 A;  2DIG A;  2BIV A;  3MP1 A;  4A4E A;  3NTI A;  2JZ2 A;  5C6S A;  4BAC A;  3CEY A;  5C0M A;  5IAY A;  5KCH A;  2P0K A;  3LGL A;  4QW2 A;  3DB3 A;  4BE0 A;  3DLM A;  2EQK A;  2RHZ A;  2R5A A;  1WJR A;  3LH0 A;  4PL6 A;  3BDL A;  2R57 A;  2EQJ A;  2LCC A;  2M1H A;  3MP6 A;  2RHY A;  2LRQ A;  2R5M A;  4C5G A;  3QII A;  3L2R A;  2BUD A;  4IKF A;  2FHD A;  2PQW A;  5KE3 A;  4E7I A;  3P8D A;  3OYA A;  3QKJ A;  4CRI A;  4EDU A;  5D6X A;  2RI3 A;  3E9G A;  4PLL A;  5J26 A;  3OYN A;  3NTK A;  3FDR A;  3PMT A;  3MEW A;  2R58 A;  4N4H A;  5D6W A;  2RJC A;  2EKO A;  2LTO A;  2MWP A;  3PMI A;  2WAC A;  2DIQ A;  4BD3 A;  4IUR A;  2RI2 A; 
#chains in the Genus database with same CATH topology
 3GBQ A;  1BI3 A;  4KUD K;  4PK4 A;  1RUW A;  8AT1 B;  1UJ0 A;  3UAT A;  2RJF A;  3OBY A;  1M8M A;  3PT9 A;  4M78 A;  2MCN A;  3C4S A;  3THK A;  3CCM A;  1WHJ A;  5CKH A;  4F04 B;  3H9N A;  4IIM A;  2YLC A;  2CZ7 B;  3OYF A;  1NJI R;  4OB0 B;  2KY9 A;  1B3Q A;  4AFS C;  3M0P A;  3ZL7 C;  4M7A F;  1RL2 A;  4F7U A;  3CC2 T;  1YIT Q;  1Y96 B;  1M2V B;  3TQ7 P;  1AZG B;  3LLR A;  7AT1 B;  2H8H A;  1VQO A;  2HL3 A;  5GAM j;  2COY A;  5CQX A;  1K76 A;  4X34 A;  4J83 A;  2K79 A;  3SWN A;  2HNI A;  3BFM A;  4YTL A;  1W2B P;  3PNW C;  4DOV A;  3CC4 Q;  1RLQ C;  4M4Z A;  1M9S A;  3EGD B;  3OYG A;  2F5K A;  1SRL A;  1V1C A;  2E6N A;  4NS5 A;  3SWN C;  1PKT A;  2LJ3 A;  1OEB A;  5CK9 A;  1KC8 C;  1IO6 A;  1V76 A;  2YWW A;  3JB9 H;  4EIK A;  2L8D A;  1FWZ A;  4ELZ C;  4EMK B;  2GQV A;  1YN8 A;  3JB9 D;  1X27 A;  2HQH A;  1I5O B;  1VQM A;  2EGC A;  2QI2 A;  1EFN A;  2HBW A;  2V8J A;  2P0P A;  3JCM J;  2VV5 A;  2XDD A;  4J9H A;  2L3S A;  2EYW A;  5LJ3 g;  2LQK A;  1IGU A;  2R57 A;  1VQK Q;  2MK5 A;  4JZ3 A;  5I11 A;  1UGQ B;  4M7D D;  2BUD A;  2OAW A;  4WCI A;  2VXE A;  3JV3 A;  3UPU A;  4PLL A;  2EYY A;  1YHQ T;  2DL4 A;  3M0Q A;  2F2W A;  3CPW S;  1I81 A;  3VS7 A;  4LDV A;  4E7H A;  4WTO B;  1OV3 A;  1KQS A;  2LQN A;  1RAF B;  4X9D A;  3G4S Q;  2EFI A;  2EQM A;  3UT1 A;  2COW A;  1PSE A;  5CQY A;  3E19 A;  1XJW B;  5GMK e;  2K5L A;  2KRM A;  4A63 B;  2RQW A;  1VQK A;  4M7A E;  5KYN A;  3H6Z A;  4AFU C;  2F1L A;  1PNJ A;  4RTY A;  2EJ9 A;  1PHT A;  1ZSZ A;  4LDW A;  2H3E B;  3EG9 B;  2KE9 A;  3RER A;  1GFD A;  1K8A U;  1QVF S;  3DKM A;  3C0C A;  3JRZ A;  1SSF A;  5A2Q E;  4HCB A;  3NHN A;  2QDY B;  4F7U G;  1UDL A;  4A4G A;  2J7I A;  5LJ5 j;  4ORZ A;  4OMF B;  4E7L A;  3VUZ A;  2GFU A;  2ZPG B;  1E7O A;  2RHI A;  3MCA B;  1MMG A;  3CC4 A;  3M55 A;  1VQ8 T;  1M90 U;  3CCE Q;  2E12 A;  1ZUY A;  1GBQ A;  4ZN1 A;  3CXC A;  4LUE A;  2RJE A;  1YJN T;  1WDX A;  4DEY A;  3QYG B;  4OMM A;  1JJ2 A;  1K4U S;  3M9Q A;  4OB1 B;  1X6B A;  4A4E A;  3NTI A;  2JZ2 A;  5HY6 A;  5C6S A;  1YJN A;  2YRD A;  4C0F A;  4PL6 A;  5GAN f;  2EQJ A;  4B6M A;  1W70 A;  2FL7 A;  3CCM Q;  4C5G A;  4PNO A;  1KD1 R;  3R6O A;  3RMQ A;  2FRW A;  2RQU A;  3QKJ A;  2HD0 A;  1O75 A;  1KIK A;  4DA4 A;  1HSQ A;  2CSQ A;  2KRO A;  1JO8 A;  2DL7 A;  2F69 A;  2VAS A;  2K2V A;  2EJF A;  2HQX A;  1RAA B;  4LDY A;  2QAS A;  4FT2 A;  2JMC A;  3CC4 T;  4EPC A;  4DEX A;  2V8I A;  3SB2 A;  4PJO G;  1IB8 A;  4ZN3 A;  1PKS A;  2WSC E;  2FYK A;  5GAN g;  4HKE A;  4OMQ A;  2DEQ A;  3ME9 A;  1M1K R;  2X4W A;  5FRN A;  4N4I A;  2QEX A;  3N5B B;  3QDR B;  3X20 B;  3KUF A;  4M75 C;  5IHK A;  4LDX A;  2K5F A;  4M7D B;  4C8Q B;  1VQ5 Q;  2PZ1 A;  2QQB A;  3UDC A;  4CC3 A;  4JJB A;  1H8K A;  4ANJ A;  3OYM A;  1ZHI A;  2VUB A;  3EGD A;  4M7A B;  3CCR A;  2DEU A;  4L59 A;  3TSZ A;  2X4J A;  3G71 Q;  4LUD A;  2LJ0 A;  1V29 B;  1RLP C;  2AZS A;  1R0B G;  1MNE A;  2A37 A;  4M75 G;  1H3Z A;  3V7S A;  2DLP A;  3PGG A;  2EGE A;  2DXC A;  1K9M C;  5CO7 A;  4J9I A;  2DAQ A;  3QDF A;  4JJD A;  1NJI C;  3GP8 A;  3RNJ A;  1YIJ T;  3EGX B;  1N6A A;  1R0C B;  3DB3 A;  3CC7 T;  3OW2 S;  2RPN A;  4FM4 B;  3LH0 A;  1GFC A;  1WHL A;  3RUX A;  2FHD A;  2PQW A;  3CCL A;  4PFZ A;  3GNF B;  1OPK A;  4JRQ A;  4J9D A;  3BE3 A;  4C8Q C;  4QT7 A;  2Y4X A;  5GAN 3;  2ROL A;  4M75 B;  3PIP A;  4KT0 E;  3CCU T;  5GAN 7;  1SKU B;  4J6Y A;  4C8Q F;  1ACM B;  2VGM A;  1AWW A;  4C8Q A;  5GAO r;  5FU6 C;  1OQK A;  3OB9 A;  4E6R A;  2A0F B;  1VA7 A;  4X9C A;  1IRX A;  2O01 E;  2YDL A;  3H0H A;  3FC3 A;  4C8Q G;  1Q81 U;  1MMD A;  2YUQ A;  1SF9 A;  4XTV A;  1ZSZ B;  2HMA A;  3EH1 A;  2HQE A;  3OMC A;  1UHF A;  3L2W A;  1PC0 A;  4C92 F;  2ZCF B;  4LN2 A;  2A36 A;  5EC7 A;  1X75 C;  1VQ9 Q;  3G71 T;  2DJQ A;  3VU3 C;  3J80 E;  3OYI A;  2EW3 A;  4EMH A;  1G3Y A;  1RAH B;  1C0M A;  5LJ3 j;  5IN1 A;  2P4R A;  1G83 A;  1M3A A;  4XAX B;  3REA B;  3MKD A;  2HL5 C;  1IXD A;  3HHT B;  2YXY A;  2M0Y A;  4OGE A;  2L2P A;  1K73 U;  3HFN A;  3CCS A;  5LJ3 e;  1W1F A;  2NUZ A;  1K8A R;  1LJO A;  2CKK A;  2QQ9 A;  3L2Q A;  4ZGE B;  3CCV Q;  2DBM A;  2PVO B;  1TUD A;  1AHJ B;  1IHW A;  4J9E A;  1K0S A;  2FG0 A;  5FU6 B;  1QWF A;  2DXT A;  4JZ4 A;  4E2F B;  3CEY A;  1M3B A;  2RHZ A;  5GAN 8;  2V26 A;  2DTH A;  1WQW A;  3CBM A;  4C8Q D;  2MAM A;  2VVK A;  5KE3 A;  3OYA A;  3QJY A;  2EIF A;  3EFR A;  1KK7 A;  4AG1 C;  3PMT A;  5FWB A;  2VWF A;  3JCM d;  3CME T;  3CXC S;  1BBZ A;  2DL8 A;  3ASK A;  5GAN e;  4KH1 B;  5IH2 A;  4PJL A;  1W2B S;  4C92 A;  1XOV A;  1VQO Q;  1YI2 T;  4A53 A;  4OVA A;  3VS1 A;  2JJ9 A;  1WGS A;  5CIU A;  4Z89 A;  2WSE E;  4IUV A;  2AHJ B;  5GAO q;  2CYZ B;  2DE0 X;  4C92 E;  3S3N A;  4M7A G;  2H3J A;  4QVD A;  4LNP A;  5GAN 4;  3VS4 A;  5LJ5 f;  1VQN A;  4J7I A;  3OS0 A;  3CCE T;  4HT9 A;  3CD6 Q;  2FPE A;  4RG8 A;  2DZ9 A;  1Y57 A;  3PFS A;  1D1C A;  3L2U A;  1TH7 A;  1X43 A;  1JJ2 P;  4CC7 A;  1Q82 C;  1PM3 A;  3OYD A;  3MEA A;  3Q1J A;  1M90 R;  2B8A A;  2RHU A;  1WQ7 A;  4QQD A;  3V7C A;  3GPL A;  4BDZ A;  4HA8 A;  4HCC A;  2FEI A;  5LJ3 d;  3FB9 A;  1YJW A;  4F17 A;  3GIB A;  3A8G B;  2K4Y A;  2PUK B;  1T0J A;  3NPF A;  3CME A;  4MZM A;  3C12 A;  3CCQ Q;  1FYN A;  3EGX A;  2OTJ Q;  1QP3 A;  2GFA A;  5D6Y A;  3IQL A;  2QEX Q;  3CPW A;  4PJO E;  2RK2 A;  3HRU A;  1NYG A;  3PE0 A;  1ZA2 B;  3SFM A;  5IT9 E;  3MP1 A;  1NJI U;  3EFS A;  2VKN A;  3HL8 A;  4HT8 A;  3LGL A;  5I2S A;  2E5K A;  2D8H A;  4KBM B;  3M5A A;  1UEB A;  1KQ2 A;  2BZY A;  2QK0 A;  1YCS B;  5GAO m;  1WHM A;  3CCJ T;  2CZ1 B;  4M77 B;  4PJM A;  1YNZ A;  1TOV A;  3OYN A;  1U1T A;  2LT1 A;  3AHU A;  3CPF A;  3CCM T;  3QSU A;  2GTJ A;  1AWO A;  2NUP B;  4M78 E;  1MGQ A;  3CCL T;  1RAE B;  1LOJ A;  8ATC B;  3GOX A;  1G5V A;  4PLI A;  2X4X A;  1QP2 A;  4C8Q E;  3EG9 A;  2DBK A;  4Z88 A;  1BB9 A;  3JCM b;  1YJN Q;  3CC7 A;  1PD1 A;  9ATC B;  4F7U B;  3VS6 A;  1X2K A;  2CP7 A;  1QVP A;  5GAM f;  2DER A;  3OBW A;  5CAI A;  2LT4 A;  3TCJ A;  2Y90 A;  3M57 A;  1OPL A;  3REB B;  3VRZ A;  1YBY A;  2LC4 A;  2YUN A;  1HXD A;  1B34 A;  4FU6 A;  1BIB A;  1OZ2 A;  4GLK A;  3E1S A;  4RTZ A;  5GAN j;  3S6W A;  3H8Z A;  3MET A;  1NBE B;  1KD1 C;  2KXC A;  4XU3 A;  5DM7 R;  1KFZ A;  3LWI A;  2EQI A;  2QA4 A;  1FMK A;  1QW1 A;  3RMS A;  5KCO A;  3KBG A;  5IXF A;  5GAN h;  1ZBJ A;  1Q7Y U;  1W2B A;  2DXU A;  2RD1 A;  4BE1 A;  4GBQ A;  3SEM A;  2L3Q A;  3JCM P;  1X6O A;  3JCM e;  1H64 1;  1XNI A;  4OP0 A;  3CXC P;  4OB3 B;  3I55 Q;  1WHH A;  2GGR A;  2J6F A;  2KDS A;  4HVW A;  1QWE A;  4BAC A;  2DX1 A;  2RM4 A;  3NFC A;  5KCH A;  2P0K A;  4M7D C;  1VQO T;  4QW2 A;  1VQL A;  2HBP A;  3RKX A;  1MV3 A;  2IIM A;  3QPH A;  3PTA A;  2XD0 A;  3I56 T;  3GNG A;  2LQ8 A;  1OU9 A;  2KVQ G;  2VGN A;  4M7D F;  4JRK A;  4C92 G;  5FW9 A;  3G4S A;  3D7S B;  1J3T A;  3M4G A;  5A0D A;  4E7I A;  5GAO l;  3E9G A;  1PRM C;  5GJV B;  2QGG A;  1I5L A;  5CKB A;  2DRK A;  4BD3 A;  3FJP A;  1WHG A;  2KQW A;  3EG1 A;  4HCZ A;  4C92 D;  1R8O B;  2CZ0 B;  2QA4 T;  1QVG A;  1AWJ A;  4Y28 E;  3QYH B;  1Q86 C;  2QYZ A;  5KYU A;  1G3S A;  1VYU A;  2ABL A;  1VQN T;  5KH6 A;  4LXC A;  3JCM X;  3EGU A;  3HFO A;  3OA6 A;  1KQS P;  4C5H A;  1BK2 A;  2LCS A;  3CPW P;  1QCO A;  4LE9 A;  1TXQ A;  3V8K A;  5KYW A;  1OI1 A;  1AZE A;  1WXB A;  2CP5 A;  2Y4Y A;  3G6E T;  2YUO A;  2L5Q A;  1VQ7 T;  3H0I A;  4FCY A;  3EHR A;  4MML A;  2FZC B;  1M5Q 1;  1NG2 A;  5KYY B;  2M0O A;  4JS4 A;  3CCL Q;  5HK3 A;  2JOY A;  1D3B A;  4TVR A;  4QKU A;  3OS1 A;  2E65 A;  3I5R A;  2O9S A;  1FMW A;  3HKS A;  4NOY A;  5GAM g;  1JXM A;  3F70 A;  5ECA A;  1YIT A;  2GNC A;  2CUD A;  4M77 C;  2BZ8 A;  4B9X A;  4EMK A;  1K1Z A;  4AFZ C;  1QLY A;  3M58 A;  2OTL A;  2QGF B;  4ZNX A;  3CCJ Q;  4ME7 A;  1NEG A;  2E1H A;  3QHS A;  1K73 C;  5CVI A;  1BCO A;  3BDL A;  4PJN A;  2KBT A;  4KGX B;  1YJ9 A;  2DD5 A;  2DJZ A;  2R5M A;  1ZUU A;  3P8D A;  1C1A A;  2XI9 A;  3CCR Q;  4M78 D;  5J26 A;  1NM7 A;  4ATO A;  2X3X D;  2I2L A;  2R58 A;  1DJ7 B;  1Q81 C;  4M7A A;  1LCK A;  2LVM A;  1SSH A;  2YRC A;  1QCF A;  1M1G A;  3OYJ A;  3NTH A;  2MWO A;  4C0Z A;  4WF2 A;  2MYS A;  2RF0 A;  4XU2 A;  5KYX A;  3OYC A;  4JJN K;  2JTF A;  2GCX A;  4A54 A;  1M27 C;  2FRY A;  4FSS A;  5IXB A;  1VYV A;  3U23 A;  3JB9 I;  3KFV A;  3OYB A;  2L3R A;  4DBQ A;  3VJP A;  2DFU A;  5AT1 B;  2HEQ A;  4XTU A;  1M30 A;  1VQP Q;  4IUP A;  1K73 R;  3VS3 A;  2XDB A;  2YSQ A;  3CD6 T;  3TRE A;  1K8A C;  4QVC A;  5LJ5 g;  1WPY A;  1X6G A;  2SEM A;  1AT1 B;  3A5Z B;  3L1A A;  2EVR A;  3VS0 A;  2NYS A;  3CCQ A;  1U06 A;  5DLO A;  3TEE A;  2DL5 A;  4DQ2 A;  4M7D G;  4RCB A;  2JVV A;  2LDM A;  2MMP A;  1TSF A;  4MDW A;  1TS9 A;  1WA7 A;  4XTY A;  3L42 A;  2YLB A;  5LJ3 f;  2LNH B;  2AK5 A;  4IUU A;  4HVU A;  4KGV B;  1YJ9 Q;  4L5G A;  1T0H A;  1QVG P;  3CCS T;  2E5Q A;  1N8R U;  2C06 A;  4M7A D;  5LJ5 h;  5IAY A;  1CKA A;  1WX6 A;  2JT4 A;  2LZ6 B;  4J5Y A;  1SEM A;  1ARK A;  3V8J A;  3RDV A;  4FIB A;  2DK3 A;  4BUG A;  4MDX A;  2EYX A;  1OX8 A;  1UGR B;  1OUL A;  3CQT A;  2EBP A;  1BCM A;  5DY9 A;  1YJ9 T;  1NLO C;  3NTK A;  1VQ6 Q;  4FYX B;  1M1K U;  2EJG A;  1UE9 A;  5GAM h;  2DVJ A;  3C95 A;  2COZ A;  4LD6 A;  1MV0 B;  2E4H A;  2V8K A;  4FYV B;  4JJC A;  3FLG A;  1LNX A;  4XK8 E;  3UWN A;  1ABQ A;  1MMN A;  2M02 A;  2RJD A;  2VYT A;  1M1K C;  1VQ7 Q;  4IUT A;  4DBH A;  1O9S A;  2X3W D;  4Y92 A;  3MEV A;  1WLP B;  3TSW A;  3A98 A;  3G6E Q;  4JLG A;  3L2V A;  2CUB A;  4JDS A;  4M75 F;  3FJ5 A;  1AVZ C;  5GAO n;  5A0L A;  2XID A;  1K9M R;  1Y07 A;  3JCM h;  1OX9 A;  4J9F A;  3MJX A;  2RNA A;  3SDZ A;  1T3L A;  3P8B B;  4A4F A;  5CR2 A;  1XQH A;  1I0C A;  4J6X A;  4M75 D;  1N8R C;  2D0Q B;  4JLI A;  2DVE A;  2KRN A;  1GCQ A;  1R77 A;  1NE8 A;  1KQS S;  2D1X A;  3JCM W;  2J6O A;  3I5S A;  5LJ5 e;  2D9T A;  1Q7Y R;  1VIE A;  4ESR A;  1U3O A;  1YIJ A;  1U5S A;  1M8V A;  1D0Y A;  1MUZ A;  1XTD A;  4XTX A;  2X51 A;  3SHW A;  3VV0 A;  2ZPE B;  4MMK A;  2BIV A;  1VQL Q;  4NL3 A;  4AFQ C;  1QQJ A;  1E6H A;  3I56 Q;  2ZPF B;  3UF4 A;  2LCC A;  2RQR A;  2XG8 D;  2KYB A;  4OMP A;  4BI4 A;  2HSE B;  1C6V X;  1YHQ Q;  1E6G A;  2RI3 A;  3CCU A;  4M77 A;  3EHQ A;  5A0G A;  4J8O A;  5D6W A;  1YWO A;  2EKO A;  2LTO A;  2VB6 A;  2WAC A;  2I0N A;  2O9V A;  1VQ6 A;  2DZC A;  2QQA A;  1ZX6 A;  4LDU A;  5GJW B;  2JNG A;  4P5N A;  3V7R A;  1VQ4 Q;  1WNL A;  3JCM V;  1N5Z A;  1NPR A;  2A28 A;  1Z9Z A;  2ZPI B;  1NLP C;  3BDU A;  3JB9 F;  3AT1 B;  1YHQ A;  1JEG A;  2F2X A;  3MEU A;  3M56 A;  2IG0 A;  2YT6 A;  2CSI A;  2J6K A;  4ZTF A;  2K6D A;  4PFO A;  2MF2 A;  3ZFJ A;  4XTW A;  3A8H B;  2E6Z A;  3RIR A;  4M78 C;  5KYW B;  5FU7 C;  4RTW A;  2W0Z A;  4GY5 A;  4PJJ A;  5GMK l;  1G3W A;  2PNI A;  2JMA A;  3OSS C;  3X24 B;  3J7A F;  5I2M A;  2CP2 A;  1M1F A;  2CP0 A;  2E3I A;  2K57 A;  4N4G A;  4D8K A;  2JUF A;  1QCN A;  1CSK A;  4D8D A;  4A4H A;  5GMK i;  2XDP A;  2GQI A;  4J9B A;  4BB7 A;  5L8R E;  2EWN A;  1IZ6 A;  3QJ6 A;  1W6X A;  1F1B B;  1RAD B;  2X4Y A;  4M77 D;  1HYO A;  2RMO A;  4M77 F;  2G6F X;  4M78 F;  2BKD N;  2A08 A;  1OOT A;  1PSF A;  1OYX A;  2YUP A;  1UG1 A;  4GLM A;  2FO0 A;  1I07 A;  3CMA T;  1D0X A;  2DNU A;  2DYI A;  3J81 E;  2E10 A;  3UA7 A;  1VQ4 T;  1I8F A;  3KXT A;  3WVE B;  2J05 A;  2KSS A;  2RQT A;  3BY7 A;  1RAB B;  2IPO B;  1VQ7 A;  2CGH A;  5FU7 B;  3WXM B;  5CCA A;  1QKW A;  1RAG B;  3X26 B;  3G7Z A;  3I55 T;  1B34 B;  2HSP A;  1U8R A;  2GTO A;  5L23 A;  3HP9 A;  3PMI A;  2MI6 A;  1FXX A;  3EH2 A;  1BI2 A;  4NL2 A;  1FMV A;  5GMK j;  3CCQ T;  2KT1 A;  1JB0 E;  2JTM A;  2C0T A;  2K2M A;  2MIO A;  2CZ6 B;  4DBF A;  2JM9 A;  1X01 A;  2ENM A;  1K0X A;  2OI3 A;  5GAN 5;  1JJ2 S;  4CI0 C;  1RI9 A;  1UHC A;  2E70 A;  4A4K A;  2L3P A;  4F7U F;  1PRL C;  2RN8 A;  2LCL A;  4M7D A;  2JS0 A;  1VOM A;  2OTL Q;  3HTR A;  4RUG A;  2KXD A;  1QKX A;  3HPW A;  3HRT A;  3JCM c;  1AWX A;  4F14 A;  2Z0W A;  1YP5 A;  1UB4 A;  4BY6 C;  1Q82 U;  1CKB A;  4M75 E;  1S72 T;  1ZQ1 A;  1KC8 R;  3GF5 A;  2O4X B;  1Q7Y C;  2A3L A;  3A8O B;  2NLU A;  3JSC A;  2AKL A;  1NEB A;  2JN0 A;  2DTO A;  1QVF A;  2HCK A;  1N8R R;  2DD4 A;  2C0I A;  3M59 A;  2LMJ A;  3EAE A;  2XK0 A;  1K9A A;  3EG0 A;  1GCP A;  1OZ3 A;  3C94 A;  4J9G A;  1M3C A;  2LP5 A;  2K5I A;  5HKC A;  2O2O A;  4BI8 B;  3M54 A;  1RAI B;  2LX7 A;  5GAM e;  2EQK A;  1QVF P;  4XU1 A;  2R5A A;  5GAO p;  3EG3 A;  2AT1 B;  1GCQ C;  4FSX A;  5IHN A;  4PFP A;  3QXE B;  1VQ6 T;  3CCS Q;  1YI2 A;  4EDU A;  1ZUK A;  1AOJ A;  2ROT A;  1AEY A;  3VS2 A;  4R55 A;  3M0U A;  5KYX B;  3SWN B;  4N4H A;  5FLX E;  2RA2 A;  2MWP A;  2NUP A;  3NGP A;  1X69 A;  2DIQ A;  4M7D E;  2OTJ T;  4M78 G;  1SHF A;  2RI2 A;  4V2S A;  4CC2 A;  4RG2 A;  4FW2 A;  1ZA1 B;  2O4X A;  2ZPB B;  3QG1 A;  2HKN A;  3P8H A;  2BE9 B;  4EMK C;  3OW2 P;  4R0K A;  3LX7 A;  4PKC C;  3SD4 A;  2G3R A;  2ED0 A;  3A8L B;  1D1B A;  1GRI A;  3EFO B;  1BI0 A;  3VUB A;  3MPU B;  3I55 A;  1WI7 A;  2JS2 A;  2KK4 A;  4BE2 A;  5M9O A;  1VQM Q;  2CDT A;  2EYQ A;  1ZSG A;  5LJ3 h;  1AD5 A;  1GL5 A;  1ABO A;  4QQG A;  1VQ8 A;  2HDA A;  2RHX A;  2QAZ A;  4PJO C;  4Z02 A;  2EQU A;  2ZPH B;  1S72 Q;  3JAM E;  1YCY A;  1VIF A;  4AMC A;  1FX7 A;  1S1N A;  4VUB A;  3VYG A;  2M51 A;  3CCU Q;  4PJO A;  2P4T A;  3HSB A;  3QO3 A;  1GXI E;  4HVV A;  4JS5 A;  4ZTJ A;  4E7K A;  4R56 A;  2K3Y A;  4O6J A;  3RES A;  3X28 B;  1TUG B;  4XTZ A;  3CCR T;  1G2B A;  2KT8 A;  3LH5 A;  4RTU A;  2B86 A;  2DO3 A;  4CC4 B;  3CBP A;  3I9Q A;  3RKY A;  2ATC B;  3L2Z A;  2KGT A;  2FVU A;  2RK1 A;  5I22 A;  1YIJ Q;  2KRS A;  3QII A;  3L2R A;  5HK0 A;  2RB6 A;  1Y7X A;  1KSW A;  1LPL A;  1Y0M A;  2CP6 A;  5D6X A;  3CCV T;  2KYM A;  2LQW A;  3TU4 K;  1JBM A;  3G71 A;  3E2U A;  3VKI A;  2PVG B;  1Q81 R;  1UUE A;  1M4Z A;  2K7A A;  2P0Q A;  1KHC A;  1UGP B;  4MZP A;  5LL6 S;  1I4K 1;  2JXB A;  2MOX A;  3CMA Q;  2QDL A;  1N9R A;  5KE2 A;  3E9F A;  3WVD B;  1WJS A;  2QTX A;  4LD9 K;  3T9N A;  2QXF A;  4II1 A;  3O8V A;  4RMO A;  1VQ5 T;  3I35 A;  2DPP B;  4FL6 A;  2ED1 A;  1BKB A;  5D7U A;  4L6V 5;  4M77 E;  4ZGJ B;  2AKK A;  3VYH B;  1TUC A;  2V1Q A;  3EFO A;  2VXF A;  3JB9 G;  2DKG A;  4C5E A;  1Q86 R;  4JPB W;  1TWB A;  2EYZ A;  5GAN 6;  4N0A A;  4MZT A;  5GAM d;  3HRS A;  2RO0 A;  1UTI A;  2HZY A;  1YJW Q;  1D3B B;  1KD1 U;  5FWC A;  2X9H A;  4X1V A;  3RR6 A;  1WFW A;  4E47 A;  2QA4 Q;  3OSV A;  1EZZ B;  4RCC A;  5CKE A;  4EMG A;  4N0A C;  2ESW A;  3S3O A;  2ZZD A;  2OTL T;  5I21 A;  1LVK A;  1UGS B;  1UJY A;  3OS2 A;  2LX9 A;  1K9M U;  3GLX A;  4AT1 B;  5GAN d;  3CCJ A;  4KUL A;  2PU9 B;  1VQN Q;  3QUI A;  3QWY A;  1X2Q A;  3CC2 A;  2ZAE A;  3DLM A;  3R6N A;  1ZSZ C;  1WJR A;  2NUT B;  1EIF A;  4XU0 A;  2ZGW A;  3CC7 Q;  2EAY A;  1OU8 A;  2M1H A;  2WSF E;  2RHY A;  3ULR B;  2P84 A;  1UGV A;  1H3H A;  1MMA A;  4ELY C;  4E7Z A;  1Y71 A;  1KG1 A;  4F7U E;  4Y91 A;  2A7Y A;  4Z8A A;  2KR3 A;  4FW1 A;  4RKU E;  3UA6 A;  2CT3 A;  2DXB A;  5AYF A;  3O5Z A;  2E3H A;  2FPF A;  3G1J A;  3RBB B;  3OW2 A;  2JM8 A;  4AG2 C;  4IUQ A;  2DYB A;  3QZ5 B;  2EGA A;  3OYY A;  3OS5 A;  2K3X A;  3X25 B;  4J6W A;  3OYK A;  3VS5 A;  5CKF A;  4UC4 A;  2KMT A;  1PCX A;  2KI7 A;  2O31 A;  1MHN A;  2E41 A;  3S3M A;  2XKO C;  4C0G A;  2FZK B;  2XMF A;  2V1R A;  3H0F A;  3CMA A;  3LYI A;  3ZEH A;  2IVW A;  3DB4 A;  1WJQ A;  4BI3 A;  3LGF A;  5FRO A;  3MP8 A;  1JQQ A;  1RI0 A;  2KNB B;  2OX7 A;  2LJ1 A;  4J9C A;  1B07 A;  3OYE A;  2KAF A;  4Q5W A;  4BDY A;  1M2V A;  2KEA A;  1D0Z A;  4XQ3 A;  4J7F A;  3G4S T;  2NUT A;  4KUI A;  2CRE A;  2NWM A;  2DM1 A;  4IIO A;  1NZ9 A;  2QG9 B;  2OAU A;  1BU1 A;  2M16 A;  2W10 A;  4KGZ B;  2SRC A;  3OMG A;  1VQ9 A;  1D1A A;  1N27 A;  2PUO B;  1HD3 A;  2ECZ A;  1SHG A;  4OF1 A;  2YHT A;  4ZGD B;  1G8X A;  2DRM A;  3CD6 A;  2JTE A;  2OJ2 A;  1ZBX A;  3M53 A;  1NPP A;  2DMO A;  6AT1 B;  2DIL A;  1M2O A;  1B7T A;  1TTH B;  1VUB A;  4M75 A;  5J3B A;  4IKF A;  1VQ4 A;  2CS7 A;  2QTV A;  1Q86 U;  3VRY A;  1S72 A;  4CRI A;  2CP3 A;  4M7A C;  4OMN A;  2QEX T;  3FIF A;  4DBR A;  3PVQ A;  2BZX A;  4IUR A;  4JUV A;  3OYL A;  1VQ8 Q;  1Y96 A;  4QVZ A;  4HCK A;  2BTT A;  4B9W A;  1VQL T;  3I56 A;  4O5V A;  4OGC A;  2O88 A;  4E7J A;  1KJW A;  2VC8 A;  1SG5 A;  2D0N A;  1H92 A;  3OQ5 A;  4OB2 B;  4C0D C;  4F16 A;  1YIT T;  1IGQ A;  3JB9 J;  2DA9 A;  2LNV A;  1GBR A;  1UFF A;  2GF7 A;  3TVT A;  3DLL A;  3MHX A;  3M0T A;  2YRV A;  1QMC A;  1YWP A;  1BI1 A;  2XU8 A;  2CT4 A;  3OY9 A;  4KH0 B;  3INZ A;  3JCM g;  2PVD B;  2RI5 A;  1VYT A;  5KYU B;  2L89 A;  2QQR A;  5LJ5 d;  4PJO B;  4HXJ A;  3RKW A;  1YI2 Q;  2FZG B;  1HJD A;  1HK9 A;  1PWT A;  1VQM T;  4RTX A;  1BIA A;  2DL3 A;  2L0A A;  3NMZ C;  4KRT A;  1WXU A;  2DET A;  1PD0 A;  1M90 C;  3PIO A;  1Q82 R;  1KC8 U;  1JXO A;  2EKH A;  3OYH A;  4E7S A;  4OMO A;  3MO8 A;  3LW5 E;  1IRE B;  3ZBD A;  3G6E A;  5C0M A;  1TU0 B;  4JRI A;  1VQK T;  4BE0 A;  1W4S A;  4JRP A;  2OTJ A;  3M4Y A;  3PVL A;  1YFN A;  3CME Q;  2J06 A;  2LRQ A;  4M78 B;  2RQV A;  2GBQ A;  4PJO F;  1P92 A;  5HCK A;  4C92 B;  1ZLM A;  2CH4 W;  1A0N B;  5GMK m;  2RJC A;  4FYY B;  5KYY A;  1D09 B;  2D8J A;  2D6F A;  3QZ9 B;  1SRM A;  1TG0 A;  3A1P A;  3FEO A;  1IHV A;  3H41 A;  4FYW B;  5J39 A;  1YJW T;  3EG2 A;  3LWH A;  1N9S A;  2HKQ B;  3QWX X;  4C0D B;  5GMK h;  1KHI A;  1UEC A;  1WHK A;  2PTK A;  3QBY A;  1JRI A;  3A8M B;  5CKD A;  2HAX A;  3CC2 Q;  2E64 A;  2RH2 A;  4RTV A;  1VQ9 T;  1KQ1 A;  2X35 A;  2AZV A;  3BW1 A;  5GAN 2;  1Z9Q A;  2K9G A;  1PG5 B;  2DTI A;  3CCE A;  3JCM Q;  2FB7 A;  3FRN A;  4D6W A;  1MND A;  2F2V A;  2DF6 A;  2QQS A;  3V8L A;  2FPD A;  1RAC B;  1QVG S;  5FRM A;  2JW4 A;  4K11 A;  4BY6 B;  1VQP T;  2M9U A;  3M0R A;  4C92 C;  1G3T A;  5IHI A;  1VQ5 A;  2CH4 A;  1VQP A;  4FT4 A;  4QQ6 A;  4C5I A;  2DIG A;  3CCV A;  1Q95 G;  3M0S A;  2XIC A;  2XHC A;  1I1J A;  3JCM f;  1WIE A;  4PJO D;  2EPD A;  1WZO A;  1WYX A;  5EG2 A;  2AIR B;  3MP6 A;  2MPX C;  1T3S A;  4RTT A;  1JU5 C;  3CBO A;  3URG A;  4M77 G;  1WXT A;  3ER0 A;  2C0O A;  4DOW A;  1SPK A;  1NYF A;  3FDR A;  2F5T X;  1U1S A;  3MEW A;  2K3B A;  5DLQ E;  1BYM A;  2BE7 D;  4OML A;  1EX4 A; 
#chains in the Genus database with same CATH homology
 2P0Q A;  1KHC A;  3C95 A;  3ASK A;  5GAN e;  1BI3 A;  4LD6 A;  4KUD K;  1UGP B;  1W2B S;  4C92 A;  2V8K A;  4MZP A;  1XOV A;  5LL6 S;  1I4K 1;  1LNX A;  3FLG A;  4XK8 E;  3UWN A;  1YI2 T;  4A53 A;  2RJF A;  4OVA A;  3OBY A;  1WGS A;  1N9R A;  5CIU A;  5KE2 A;  2RJD A;  3E9F A;  2WSE E;  3PT9 A;  4IUV A;  2AHJ B;  3WVD B;  2CYZ B;  5GAO q;  4C92 E;  2VYT A;  1WJS A;  2QTX A;  4M78 A;  3T9N A;  3S3N A;  4LD9 K;  3C4S A;  1M1K C;  2QXF A;  2H3J A;  4QVD A;  4IUT A;  4II1 A;  3CCM A;  3O8V A;  1O9S A;  3MEV A;  4RMO A;  5CKH A;  1VQ5 T;  4JLG A;  5GAN 4;  5LJ5 f;  2DPP B;  4FL6 A;  3L2V A;  4J7I A;  1VQN A;  4JDS A;  2YLC A;  3OS0 A;  1BKB A;  3CCE T;  4HT9 A;  2CZ7 B;  4M75 F;  3OYF A;  4RG8 A;  4L6V 5;  4M77 E;  2DZ9 A;  4OB0 B;  2KY9 A;  4ZGJ B;  4M7A F;  1RL2 A;  4F7U A;  5GAO n;  3VYH B;  5A0L A;  3PFS A;  3CC2 T;  2VXF A;  1TH7 A;  3L2U A;  2XID A;  2DKG A;  4C5E A;  3JB9 G;  1Q82 C;  1Y96 B;  3OYD A;  1Y07 A;  3MEA A;  3Q1J A;  2B8A A;  2RHU A;  1WQ7 A;  3JCM h;  4QQD A;  3V7C A;  3LLR A;  5GAN 6;  4N0A A;  4MZT A;  1VQO A;  5GAM d;  3SDZ A;  5GAM j;  3HRS A;  3GPL A;  3P8B B;  5CQX A;  4X34 A;  4J83 A;  3SWN A;  2RO0 A;  4BDZ A;  4HA8 A;  4A4F A;  5CR2 A;  2HNI A;  1XQH A;  3BFM A;  4YTL A;  4HCC A;  5LJ3 d;  1KD1 U;  3PNW C;  1D3B B;  3FB9 A;  4J6X A;  4M75 D;  4DOV A;  1YJW A;  1N8R C;  3GIB A;  2D0Q B;  4E47 A;  3A8G B;  2K4Y A;  4JLI A;  2PUK B;  2DVE A;  1M9S A;  3OYG A;  3OSV A;  2F5K A;  5CKE A;  4RCC A;  4EMG A;  4N0A C;  1NE8 A;  1KQS S;  3CME A;  2E6N A;  3S3O A;  4NS5 A;  4MZM A;  3C12 A;  2ZZD A;  3SWN C;  3JCM W;  2OTL T;  5I21 A;  1QP3 A;  1UGS B;  5LJ5 e;  2GFA A;  2D9T A;  1VIE A;  5D6Y A;  5CK9 A;  1KC8 C;  1YIJ A;  3OS2 A;  2LX9 A;  1M8V A;  3JB9 H;  3CPW A;  1K9M U;  3GLX A;  4PJO E;  1XTD A;  4XTX A;  2L8D A;  2RK2 A;  5GAN d;  3HRU A;  3VV0 A;  1FWZ A;  2ZPE B;  3CCJ A;  4ELZ C;  4EMK B;  2GQV A;  4KUL A;  2PU9 B;  3JB9 D;  3SFM A;  4MMK A;  5IT9 E;  2BIV A;  3MP1 A;  3QUI A;  1VQM A;  1NJI U;  3EFS A;  3HL8 A;  4HT8 A;  3LGL A;  2QI2 A;  5I2S A;  4NL3 A;  3JCM J;  2V8J A;  2P0P A;  2VV5 A;  2XDD A;  4KBM B;  3CC2 A;  3M5A A;  3DLM A;  1UEB A;  5LJ3 g;  1KQ2 A;  1WJR A;  2LQK A;  1EIF A;  2ZPF B;  4XU0 A;  2R57 A;  2ZGW A;  2EAY A;  2LCC A;  2M1H A;  2WSF E;  2RHY A;  5GAO m;  2XG8 D;  1UGQ B;  4M7D D;  3CCJ T;  2BUD A;  2CZ1 B;  4BI4 A;  4ELY C;  1KG1 A;  1Y71 A;  4M77 B;  4F7U E;  2VXE A;  4Y91 A;  2A7Y A;  3UPU A;  2RI3 A;  3CCU A;  3OYN A;  4PLL A;  4RKU E;  1U1T A;  1YHQ T;  2LT1 A;  4M77 A;  2DXB A;  5AYF A;  5A0G A;  4J8O A;  5D6W A;  3CPW S;  2EKO A;  2LTO A;  2WAC A;  3AHU A;  1VQ6 A;  3CPF A;  3CCM T;  1I81 A;  3QSU A;  2DZC A;  2QQA A;  4LDV A;  4E7H A;  3OW2 A;  4LDU A;  4M78 E;  1MGQ A;  2JNG A;  4IUQ A;  4P5N A;  3V7R A;  1WNL A;  3JCM V;  3QZ5 B;  1KQS A;  3OYY A;  3OS5 A;  1NPR A;  4X9D A;  3CCL T;  2ZPI B;  2EFI A;  1LOJ A;  2EQM A;  2K3X A;  3UT1 A;  3X25 B;  1PSE A;  3BDU A;  3JB9 F;  4J6W A;  3OYK A;  3GOX A;  1YHQ A;  5CKF A;  5CQY A;  4PLI A;  2X4X A;  1QP2 A;  3MEU A;  4UC4 A;  2KMT A;  3M56 A;  2IG0 A;  4C8Q E;  3E19 A;  4ZTF A;  1MHN A;  2E41 A;  5GMK e;  2K5L A;  2MF2 A;  3ZFJ A;  3S3M A;  2XKO C;  4XTW A;  4C0G A;  3A8H B;  2E6Z A;  3RIR A;  3JCM b;  3CC7 A;  1VQK A;  4M7A E;  3H6Z A;  4F7U B;  1QVP A;  4M78 C;  2EJ9 A;  5FU7 C;  5GAM f;  4GY5 A;  3CMA A;  3LYI A;  4LDW A;  3ZEH A;  5GMK l;  2IVW A;  3DB4 A;  3OBW A;  1G3W A;  5CAI A;  2LT4 A;  1WJQ A;  3OSS C;  3RER A;  3X24 B;  3J7A F;  5I2M A;  4BI3 A;  1K8A U;  1M1F A;  3TCJ A;  3DKM A;  1QVF S;  3LGF A;  3JRZ A;  5FRO A;  1SSF A;  5A2Q E;  4HCB A;  2K57 A;  2Y90 A;  3M57 A;  3MP8 A;  4N4G A;  1YBY A;  2JUF A;  2LC4 A;  1RI0 A;  4A4H A;  5GMK i;  2XDP A;  2QDY B;  1HXD A;  1B34 A;  4FU6 A;  1BIB A;  1OZ2 A;  4F7U G;  4GLK A;  3E1S A;  3OYE A;  5GAN j;  4A4G A;  4BB7 A;  2KAF A;  4Q5W A;  5L8R E;  3S6W A;  5LJ5 j;  4OMF B;  4BDY A;  4E7L A;  3H8Z A;  3MET A;  2EWN A;  3VUZ A;  2GFU A;  1KD1 C;  4XQ3 A;  4XU3 A;  5DM7 R;  1IZ6 A;  2ZPG B;  3QJ6 A;  4J7F A;  2RHI A;  3MCA B;  3LWI A;  3G4S T;  4KUI A;  1QW1 A;  2QA4 A;  3RMS A;  2X4Y A;  4M77 D;  3CC4 A;  5KCO A;  3KBG A;  5GAN h;  4M77 F;  3M55 A;  1VQ8 T;  1Q7Y U;  1NZ9 A;  1W2B A;  2DXU A;  1M90 U;  4M78 F;  2E12 A;  2OAU A;  2M16 A;  2RD1 A;  4ZN1 A;  3CXC A;  4BE1 A;  2BKD N;  2RJE A;  3JCM P;  1YJN T;  1X6O A;  3JCM e;  1H64 1;  3OMG A;  1PSF A;  1VQ9 A;  1OYX A;  1XNI A;  4OP0 A;  1N27 A;  4OB3 B;  3QYG B;  2PUO B;  2KDS A;  1JJ2 A;  3M9Q A;  4OB1 B;  3CMA T;  4A4E A;  4BAC A;  3NTI A;  2JZ2 A;  2RM4 A;  2YHT A;  3NFC A;  4OF1 A;  5HY6 A;  5C6S A;  5KCH A;  1YJN A;  4ZGD B;  2P0K A;  4M7D C;  1VQO T;  4QW2 A;  1VQL A;  3J81 E;  2HBP A;  2E10 A;  3CD6 A;  4C0F A;  1VQ4 T;  1I8F A;  1ZBX A;  3RKX A;  3QPH A;  3M53 A;  3KXT A;  3PTA A;  3WVE B;  3I56 T;  1NPP A;  3GNG A;  2LQ8 A;  2XD0 A;  4PL6 A;  5GAN f;  2KSS A;  2KVQ G;  2EQJ A;  2VGN A;  3BY7 A;  4JRK A;  4C92 G;  4M7D F;  1VUB A;  2FL7 A;  1VQ7 A;  2CGH A;  3G4S A;  4M75 A;  4PNO A;  5FU7 B;  3M4G A;  3R6O A;  5J3B A;  3WXM B;  4C5G A;  3RMQ A;  5A0D A;  3X26 B;  2CS7 A;  3G7Z A;  5CCA A;  4E7I A;  1VQ4 A;  1Q86 U;  1S72 A;  3QKJ A;  4CRI A;  3I55 T;  5GAO l;  4M7A C;  1B34 B;  3E9G A;  2HD0 A;  1U8R A;  1O75 A;  2QEX T;  3FIF A;  1I5L A;  4DA4 A;  3HP9 A;  3PMI A;  2MI6 A;  1FXX A;  5CKB A;  4BD3 A;  1BI2 A;  4NL2 A;  4IUR A;  3FJP A;  2KQW A;  2F69 A;  4JUV A;  5GMK j;  3OYL A;  1Y96 A;  3CCQ T;  2K2V A;  2EJF A;  2HQX A;  4HCZ A;  4QVZ A;  4C92 D;  1JB0 E;  2JTM A;  1R8O B;  4LDY A;  2CZ0 B;  4FT2 A;  2QA4 T;  2CZ6 B;  4B9W A;  1QVG A;  4Y28 E;  3QYH B;  3CC4 T;  1X01 A;  1Q86 C;  1VQL T;  5GAN 5;  1JJ2 S;  4CI0 C;  1G3S A;  1VQN T;  4EPC A;  5KH6 A;  2V8I A;  3I56 A;  4O5V A;  3SB2 A;  4OGC A;  2E70 A;  3JCM X;  4PJO G;  4E7J A;  4A4K A;  2VC8 A;  4F7U F;  3HFO A;  3OA6 A;  4ZN3 A;  4C5H A;  2LCL A;  2WSC E;  2FYK A;  5GAN g;  3OQ5 A;  4OB2 B;  4C0D C;  4HKE A;  4M7D A;  1YIT T;  2DEQ A;  3HPW A;  3ME9 A;  3HRT A;  2X4W A;  3JB9 J;  3JCM c;  5FRN A;  2LNV A;  4N4I A;  2QEX A;  3N5B B;  3QDR B;  1UB4 A;  3X20 B;  3V8K A;  2GF7 A;  4BY6 C;  3KUF A;  3DLL A;  4M75 C;  1Q82 U;  1OI1 A;  3MHX A;  2YRV A;  4M75 E;  1ZQ1 A;  1S72 T;  3GF5 A;  4LDX A;  2O4X B;  1Q7Y C;  2K5F A;  4M7D B;  4C8Q B;  1BI1 A;  2Y4Y A;  3G6E T;  2QQB A;  2XU8 A;  2A3L A;  3UDC A;  3A8O B;  3OY9 A;  2L5Q A;  2NLU A;  1VQ7 T;  3JSC A;  4MML A;  2PVD B;  3INZ A;  1ZHI A;  1M5Q 1;  2RI5 A;  3JCM g;  3OYM A;  2JN0 A;  2VUB A;  2L89 A;  2DTO A;  2QQR A;  5LJ5 d;  1QVF A;  4M7A B;  4PJO B;  2M0O A;  3CCR A;  3RKW A;  4L59 A;  4JS4 A;  5HK3 A;  2JOY A;  1D3B A;  4TVR A;  2DD4 A;  1HK9 A;  3OS1 A;  2E65 A;  2X4J A;  3M59 A;  1VQM T;  1V29 B;  3EAE A;  2XK0 A;  3HKS A;  4NOY A;  1BIA A;  5GAM g;  4M75 G;  3F70 A;  1M90 C;  1H3Z A;  3V7S A;  3PIO A;  1YIT A;  1OZ3 A;  3C94 A;  3PGG A;  2DXC A;  1K9M C;  4M77 C;  4B9X A;  4EMK A;  1KC8 U;  5CO7 A;  2K5I A;  5HKC A;  3OYH A;  3M58 A;  2DAQ A;  2OTL A;  1NJI C;  3MO8 A;  3LW5 E;  4BI8 B;  1IRE B;  3ZBD A;  3G6E A;  3M54 A;  3GP8 A;  1YIJ T;  5C0M A;  1N6A A;  1G5V A;  4IKF A;  4ME7 A;  3DB3 A;  4JRI A;  1VQK T;  3CC7 T;  5GAM e;  4BE0 A;  2E1H A;  3QHS A;  3OW2 S;  1K73 C;  1W4S A;  2EQK A;  4XU1 A;  4JRP A;  2OTJ A;  4FM4 B;  2R5A A;  3M4Y A;  5CVI A;  3LH0 A;  5GAO p;  3BDL A;  1YJ9 A;  4FSX A;  3QXE B;  2DD5 A;  2DJZ A;  2LRQ A;  2R5M A;  4M78 B;  3RUX A;  2FHD A;  2PQW A;  1VQ6 T;  3CCL A;  3P8D A;  4M7A G;  1YI2 A;  3GNF B;  2XI9 A;  4JRQ A;  4EDU A;  4M78 D;  4R55 A;  5J26 A;  4C8Q C;  4PJO F;  1P92 A;  4C92 B;  4ATO A;  3SWN B;  2I2L A;  2Y4X A;  5GAN 3;  2R58 A;  4N4H A;  5FLX E;  2RJC A;  2RA2 A;  4M75 B;  5GMK m;  2MWP A;  1DJ7 B;  1Q81 C;  2DIQ A;  4M7D E;  2OTJ T;  4M78 G;  3PIP A;  4M7A A;  2D6F A;  4KT0 E;  2RI2 A;  2LVM A;  4V2S A;  3CCU T;  5GAN 7;  4J6Y A;  3QZ9 B;  1M1G A;  4RG2 A;  3OYJ A;  3NTH A;  2MWO A;  3FEO A;  2VGM A;  4C0Z A;  4C8Q F;  2O4X A;  2ZPB B;  4WF2 A;  4C8Q A;  5GAO r;  3QG1 A;  5FU6 C;  4XU2 A;  3OB9 A;  3OYC A;  3P8H A;  4JJN K;  2JTF A;  2GCX A;  5J39 A;  4A54 A;  4EMK C;  4X9C A;  1YJW T;  2O01 E;  3LWH A;  3FC3 A;  1N9S A;  4C0D B;  5GMK h;  1KHI A;  4C8Q G;  3OYB A;  3JB9 I;  3QBY A;  3LX7 A;  2L3R A;  4PKC C;  3SD4 A;  2G3R A;  1Q81 U;  3VJP A;  4XTV A;  3A8L B;  3OMC A;  4XTU A;  2HQE A;  3L2W A;  1JRI A;  3A8M B;  5CKD A;  4C92 F;  1BI0 A;  3VUB A;  4IUP A;  2E64 A;  3I55 A;  2ZCF B;  2HAX A;  2KK4 A;  2RH2 A;  4BE2 A;  1VQ9 T;  2XDB A;  1X75 C;  1KQ1 A;  2X35 A;  5M9O A;  3G71 T;  3BW1 A;  5GAN 2;  3CD6 T;  2EYQ A;  3TRE A;  2DTI A;  5LJ3 h;  3CCE A;  1K8A C;  3VU3 C;  3JCM Q;  3J80 E;  4QQG A;  1VQ8 A;  2FB7 A;  3OYI A;  2RHX A;  4QVC A;  4EMH A;  1G3Y A;  3FRN A;  4D6W A;  5LJ5 g;  4PJO C;  1WPY A;  3A5Z B;  3L1A A;  4Z02 A;  2EQU A;  5LJ3 j;  2ZPH B;  5IN1 A;  3CCQ A;  2QQS A;  5DLO A;  3TEE A;  4XAX B;  4DQ2 A;  3V8L A;  3JAM E;  1YCY A;  1VIF A;  4M7D G;  4RCB A;  2JVV A;  2LDM A;  2MMP A;  1FX7 A;  3HHT B;  1QVG S;  4MDW A;  4VUB A;  3VYG A;  4OGE A;  5FRM A;  4PJO A;  2P4T A;  3HSB A;  4BY6 B;  4XTY A;  1VQP T;  2M9U A;  3HFN A;  3QO3 A;  4C92 C;  1K73 U;  1GXI E;  3CCS A;  5LJ3 e;  1G3T A;  3L42 A;  2YLB A;  5LJ3 f;  4IUU A;  4JS5 A;  1LJO A;  4ZTJ A;  4E7K A;  4R56 A;  2CKK A;  2K3Y A;  4O6J A;  3RES A;  1VQ5 A;  4L5G A;  3X28 B;  2QQ9 A;  3L2Q A;  4ZGE B;  4XTZ A;  3CCR T;  1VQP A;  2PVO B;  4FT4 A;  4QQ6 A;  3CCS T;  2E5Q A;  4C5I A;  1AHJ B;  1N8R U;  2C06 A;  4M7A D;  2DIG A;  5FU6 B;  3CCV A;  2DXT A;  2XIC A;  5LJ5 h;  2XHC A;  3CEY A;  5IAY A;  2DO3 A;  3JCM f;  4PJO D;  3CBP A;  4J5Y A;  3RKY A;  3V8J A;  2RHZ A;  5GAN 8;  4FIB A;  3L2Z A;  2DK3 A;  5EG2 A;  4BUG A;  4MDX A;  2FVU A;  3MP6 A;  2DTH A;  2RK1 A;  1WQW A;  1UGR B;  3CBM A;  2MAM A;  3CBO A;  3QII A;  3URG A;  4C8Q D;  3L2R A;  4M77 G;  5KE3 A;  2RB6 A;  5HK0 A;  1Y7X A;  3OYA A;  3QJY A;  3ER0 A;  5DY9 A;  2EIF A;  5D6X A;  3CCV T;  3EFR A;  1YJ9 T;  4DOW A;  3NTK A;  3FDR A;  3TU4 K;  1JBM A;  2F5T X;  3PMT A;  1U1S A;  3MEW A;  3VKI A;  3G71 A;  2PVG B;  1M1K U;  5DLQ E;  2EJG A;  1BYM A;  3JCM d;  3CME T;  1M4Z A;  3CXC S;  5GAM h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...