3MEWA

Crystal structure of novel tudor domain-containing protein sgf29
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
157
Chain Sequence
TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
total genus 25
structure length 157
sequence length 159
ec nomenclature
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mewA02
3OB9A 3LYIA 4N4GA 5IN1A 2XK0A 2E6NA 3OYHA 2P0KA 3O8VA 3S6WA 1OYXA 3H8ZA 2MWPA 3FDRA 4FU6A 3LGFA 2XDPA 1RI0A 3H6ZA 1WJRA 3LX7A 3SD4A 2X35A 2EQJA 5C0MA 2DAQA 2D9TA 5D6XA 4X34A 3P8HA 4BDZA 3ASKA 3L2QA 3F70A 3KUFA 4BD3A 4N4IA 4B9XA 5M9OA 4IUQA 3S3MA 4CRIA 3CEYA 4E7KA 3MEAA 4L59A 3OYNA 4E7IA 2RHIA 4ZTFA 2CKKA 2EKOA 3C4SA 2RJFA 1SSFA 2BKDN 2GF7A 5FRNA 2NLUA 2F5KA 2LDMA 3QKJA 3L2RA 3MP6A 4C5IA 3PNWC 5FROA 1WJQA 4RG2A 3OYLA 3P8DA 4OVAA 2K3YA 2RJCA 3E9FA 2LCCA 4QQDA 3E9GA 3QBYA 3OYDA 4Q5WA 4ZTJA 3OS0A 4E7LA 2X4WA 3OYGA 4GY5A 2MWOA 5KH6A 2RHXA 3OYAA 2WACA 5D6YA 3M9QA 4A4HA 2K3XA 3OA6A 2X4YA 1OI1A 1G5VA 3PMTA 4BE0A 4E7JA 3L42A 3S3NA 3OY9A 3OYKA 2EQKA 3OQ5A 4PLLA 2QQRA 2RHZA 3OYIA 2EFIA 1N27A 4IUVA 2YRVA 4QVZA 2E5QA 3OS2A 3OYFA 1MHNA 1WJSA 3GOXA 3OYMA 5KCHA 2RHYA 3OYBA 2LVMA 4N4HA 4QW2A 4BDYA 2EQUA 2M1HA 4Z02A 2LRQA 4UC4A 2M0OA 4QQ6A 2RJDA 3OMGA 4LD6A 2IG0A 2FHDA 3META 3LH0A 3LGLA 2R58A 2R5MA 2X4XA 5KCOA 3LLRA 4A4FA 1OZ3A 3MP1A 4BE2A 3L2VA 1OZ2A 3EAEA 2L89A 2VYTA 4IUPA 4PL6A 3L2WA 2M16A 3FLGA 3UT1A 4B9WA 4IUUA 2RI3A 4A4GA 5J26A 3OS1A 1KHCA 5D6WA 2EQMA 4IKFA 2O4XB 2BUDA 4EDUA 2R57A 5KE3A 3NTIA 2R5AA 3QJ6A 3DB4A 5C6SA 2RJEA 4PLIA 2RHUA 2BIVA 3OMCA 4II1A 3MP8A 4C5EA 2GFUA 3DB3A 3MEWA 2DIQA 4IUTA 3OYCA 4NS5A 4HCZA 5J39A 3ZEHA 3QIIA 3BDLA 3L2UA 3Q1JA 2DIGA 4C5HA 3MEVA 2G3RA 3OYJA 4BE1A 5FRMA 3PFSA 4E7HA 4QQGA 1XNIA 2HQXA 3OYEA 2L8DA 4BACA 3UWNA 2JTFA 3NTKA 4FL6A 1WGSA 2LTOA 3DLMA 5IAYA 2L3RA 4IURA 2JZ2A 5KE2A 2PQWA 5CIUA 2B8AA 3FEOA 3FC3A 2O4XA 3ME9A 3MO8A 3NTHA 4A4EA 3S3OA 1H3ZA 2HQEA 2GFAA 2RI5A 3PMIA 2QQSA 3MEUA 4C5GA 2RO0A 2RI2A
chains in the Genus database with same CATH superfamily
1V76A 1VQMA 3MJXA 4M78D 2EGEA 5KYWA 4LUEA 4C8QE 4ZGJB 2L2PA 3PGGA 4FT2A 3VYHB 2X35A 1B34A 2CT4A 4ELZC 1Q82R 1N8RC 5FU6B 1UJ0A 2MI6A 4IUQA 3UDCA 1Q82U 2NWMA 1K8AC 1QP3A 3VUBA 3FIFA 2RJCA 3R6OA 5IHKA 1SEMA 2X4YA 3GIBA 1H641 2KNBB 4TVRA 1QLYA 2OTJQ 3OYKA 1VYTA 4BI3A 2SEMA 2RHZA 3PVLA 4IUVA 5GAN2 5IHNA 1QQJA 3OYBA 3SEMA 1ZUKA 4JJBA 1YJNQ 4PJMA 4C8QC 2O88A 4L5GA 1IHWA 1WHHA 1PWTA 1YCSB 2QA4T 2L3SA 1BCMA 1BI1A 3L2VA 2V8IA 1KSWA 5GJVB 2RMOA 2AT1B 2ZCFB 3CCSA 3CPWS 2XDBA 3CCST 1FMWA 1S72A 3VKIA 4J7IA 2CSQA 4DOWA 3JCMg 2BTTA 4M78B 1HYOA 2HSPA 4ME7A 2VWFA 2M0YA 2LMJA 3RMQA 5LJ3d 3Q1JA 2DIGA 4RTZA 2J05A 2FYKA 3OYEA 1XTDA 3UWNA 1QKWA 4QKUA 3RUXA 4AG2C 2E3HA 2FZCB 3RESA 3CD6T 3PMIA 1VYVA 4KUDK 2XK0A 4PK4A 1M4ZA 1HSQA 2QTXA 1HK9A 3O8VA 2A37A 1OYXA 1JJ2A 4XU0A 1UJYA 3JB9G 2EYYA 4F7UF 1Y07A 4WTOB 3CXCP 3BE3A 5GANf 3CC4Q 2L5QA 1AWXA 3OYNA 1TOVA 3C4SA 1N5ZA 2BKDN 4JRIA 5FRNA 1WI7A 2LDMA 4DA4A 4E47A 2EYZA 2FRWA 5GAMj 1VQKA 1X6BA 4QVDA 5KH6A 5GAOn 5CAIA 3QZ5B 3CCVT 1NEGA 2SRCA 1M9SA 1QVGS 2AKKA 4DEYA 2RHYA 1W1FA 2C0TA 2CP3A 1AHJB 2O31A 2CUDA 1U1TA 3URGA 2E3IA 4FYWB 2FHDA 1JQQA 1YN8A 1QW1A 3CD6A 2VUBA 3RERA 4LD9K 4XTVA 1TG0A 1SF9A 2L89A 3PIOA 2PVOB 2E4HA 2RI3A 1Y71A 3RBBB 2HD0A 1S1NA 1K76A 2RHUA 3CCMQ 2E6ZA 3LWHA 2D0QB 2EWNA 4HCZA 2ZPBB 3A98A 1T3SA 3HL8A 4XTWA 2X51A 2MCNA 4HXJA 1WXBA 2OJ2A 3VRZA 2LX9A 3CCJT 2HQXA 1YNZA 2MK5A 4QT7A 3G6ET 1K9MC 2OX7A 2X4JA 4CC3A 3QJYA 1VQKT 4OMNA 1ZSZC 2RPNA 2KT8A 3QYGB 2RO0A 4XTZA 1YJ9T 1K0XA 1VQ5T 3WVEB 2K7AA 2DTIA 3PE0A 4PFZA 3S6WA 2IVWA 5L23A 4ZGDB 1K9AA 1Q7YR 2CREA 4YTLA 2CS7A 4ZN1A 2ZGWA 1VQPA 4X34A 4EIKA 1T0JA 1IXDA 3UF4A 1QVGP 4CRIA 2KR3A 3CCQT 2QYZA 4M78A 2RJFA 2K4YA 2ED0A 2CP6A 3HRSA 3E9FA 2EJ9A 1ZSZA 3HFNA 3E1SA 2QXFA 4M77B 1PM3A 3NHNA 4E7JA 3PIPA 1YITT 1Y96A 1SPKA 1EFNA 2EYXA 1RLQC 2ZPIB 4X9DA 2RF0A 3GOXA 1CKAA 1G3SA 1M1FA 2CDTA 1VA7A 2QQAA 1K73R 3H0FA 3CC2A 5LJ3e 5CKFA 4IIMA 4C92G 1ACMB 3INZA 1VQOA 1VQOT 2EQMA 4A4KA 4M75G 3G4ST 3CMET 1YWPA 1OX9A 2K5IA 3JCMV 2NUPB 3MP8A 4OB3B 2K2MA 4GLKA 2GFUA 1I8FA 4BB7A 4J8OA 2CP0A 1UDLA 4J9GA 2CH4A 1LNXA 1D0XA 4CI0C 4LDWA 3A5ZB 3SDZA 2EYQA 1WYXA 3BY7A 2KMTA 4RTUA 1NLOC 3CCRA 1GCQA 2GFAA 2E70A 2KT1A 3TVTA 5GMKl 3JAME 2XDPA 2ESWA 1IO6A 1N6AA 1YCYA 1KQ1A 1MMNA 3A1PA 2DFUA 1VQMT 2CZ1B 2DEQA 5GAMd 2W0ZA 1NE8A 2NUPA 1WJQA 2LCCA 4Q5WA 2WSCE 1QP2A 1G2BA 1PRMC 2ED1A 3JCMX 1YI2A 3M0PA 3H41A 1OI1A 1G5VA 3EFOA 4BUGA 4M7DE 1Z9ZA 4PJOE 2COWA 1TUCA 3OS2A 3WXMB 1YIJQ 1RAAB 2JMAA 2YDLA 2DPPB 3AHUA 8ATCB 1GFDA 4PFOA 3M0RA 2R5MA 4RKUE 4HVVA 5LJ5h 1AWOA 1WDXA 4ESRA 2V8KA 2WSFE 3MKDA 4D8DA 3H0HA 3I55Q 2AZVA 1V29B 1TUGB 4XU2A 3UA6A 1WQ7A 3OYCA 1Q82C 1O75A 1WA7A 3BDLA 1PCXA 1Q81U 4LDXA 2KVQG 1WHJA 4ORZA 1WGSA 4MZTA 5LJ3g 3M4YA 2HKNA 5KYUB 4JS5A 1TTHB 2Y4YA 2PTKA 3ZFJA 1YI2Q 1H3ZA 2KI7A 1K9MR 2OTJA 5GAMe 1M90R 4M75A 5CCAA 4M7AD 1VQ8A 1KFZA 2FRYA 1NPRA 1VQ8Q 1VQNT 1OQKA 2QDYB 1ZQ1A 1RABB 3OBWA 1JEGA 4WF2A 3VU3C 3CC7Q 2QGGA 4KGXB 4L59A 4E7IA 4M7AB 2CKKA 1ZBJA 2DVEA 3NGPA 2XHCA 1IRXA 2JXBA 4JDSA 1Z9QA 2EPDA 2XKOC 1I5OB 2PNIA 2YRDA 3OYGA 1JJ2P 4O5VA 2MWOA 5FWBA 2PU9B 1UFFA 2A7YA 4XK8E 4BE0A 5I22A 2HKQB 1NG2A 1VIFA 1C0MA 1RAIB 3CXCA 4OF1A 2OTLQ 3CMAQ 2IIMA 4PJJA 2EQUA 4Z02A 2LX7A 4L6V5 3RKXA 4HT9A 2RQTA 1VQPQ 1GL5A 2HNIA 2R58A 1D1CA 1SG5A 4LN2A 3C94A 1OZ2A 2EGCA 4OGEA 2JN0A 4BI4A 2J6OA 4JZ4A 3GP8A 2CP2A 4M77D 5DLQE 2LT4A 2K5LA 3VS4A 2D6FA 5FLXE 2QAZA 2RJEA 4II1A 2F2VA 1LJOA 4PJOB 2FPDA 4JZ3A 5FWCA 1JJ2S 3M55A 2GQIA 3VJPA 4DBFA 1P92A 2YUNA 5KYXB 3VRYA 4WCIA 1QVGA 4IURA 2F2WA 4AFSC 2LJ3A 3FC3A 1U1SA 2NUZA 3NTHA 1BKBA 1X2QA 2JNGA 1X75C 2D0NA 2ENMA 4N4GA 2E6NA 2OTLA 1YJ9A 1PC0A 1N8RR 3EGDA 3G6EA 3IQLA 4M78E 3THKA 3VV0A 1YJWT 4C92E 4M4ZA 3A8LB 3DKMA 2FB7A 2B86A 2OAUA 3V7CA 4BI8B 3ER0A 1NM7A 4XTUA 5M9OA 4KGVB 1KC8R 3G71Q 2VVKA 3L2RA 3QKJA 4C5IA 3QO3A 2DF6A 3ULRB 4HCKA 4R0KA 1T3LA 2ROLA 3OA6A 2DX1A 1VQLT 2LP5A 4PLLA 1VQLA 2YT6A 2EFIA 2OAWA 3OYFA 1G83A 1NYFA 3JCMe 1W2BA 2H8HA 3EG9A 2RQVA 2VB6A 3J81E 1EX4A 4Z88A 3M0QA 5J3BA 1EZZB 1AWJA 1U5SA 2LNHB 4IUPA 5GJWB 3VUZA 3CC2Q 1QCNA 1GCPA 2W10A 1KQSS 3CCUA 1AZGB 2AHJB 3OS1A 1KHCA 1YBYA 2EAYA 3CCUQ 4RTWA 2F2XA 2L3PA 5FU7C 4KUIA 3UA7A 3M4GA 4MZPA 1MGQA 4QVCA 4JJCA 2ZPEB 4J6YA 1VQ6T 2A0FB 4M75F 3CCLT 4C5HA 3VS0A 1VYUA 2PUKB 1SKUB 2KYBA 5IAYA 2DJQA 4KULA 3TQ7P 2B8AA 1KQSP 1VQ7T 4OB1B 4A4EA 4FW2A 2FVUA 3JB9I 3V8LA 1VQ9T 4F04B 3QZ9B 2VC8A 4PJOD 2VGMA 3TSZA 1VQ9A 1WLPB 1D3BB 1M2VA 1Q86C 1G3TA 2F1LA 2CZ7B 2QQ9A 3GNGA 3ZBDA 3CCRT 2JVVA 2BZXA 3M5AA 4A63B 5GAOq 3P8BB 4OGCA 3S3MA 1KIKA 1E6HA 4M78F 2KRSA 2EKOA 3EG9B 5CKBA 1GBQA 2F5KA 2CZ0B 3TU4K 4LUDA 3X24B 3CCEQ 1UTIA 4HCCA 1B07A 3OS0A 1M1GA 4GY5A 1QCOA 2CGHA 1JBMA 3PMTA 4XTYA 2H3EB 1M30A 3EHQA 3JCMd 2XIDA 2DL5A 4CC2A 1IHVA 2HZYA 1H92A 4BDYA 5LJ5g 1D1AA 1JXOA 5GAOr 1AVZC 4LD6A 4HKEA 4A4FA 2E41A 1KC8U 2G6FX 1I07A 1V1CA 4F14A 4IUUA 4A4GA 5J26A 3RR6A 2JS2A 2P4TA 3PTAA 5KE3A 2R5AA 4OMMA 3DB4A 4FT4A 5IH2A 3JB9D 1S72Q 2DILA 1Q7YC 3CC4A 5GMKj 4M7AC 4J9EA 1W4SA 4NL3A 3I56T 3QIIA 3M0TA 3R6NA 1JXMA 5A0DA 2DRMA 5DLOA 4KT0E 2GTOA 1QMCA 2JS0A 2LTOA 3DLMA 5KE2A 3EFSA 1SRLA 3HTRA 1M1KR 1NYGA 1OEBA 4PJOA 5I2SA 1M3BA 2RI2A 2HDAA 1M2OA 4J9DA 2KQWA 3H8ZA 2MWPA 3LGFA 2V1RA 3G7ZA 1R8OB 3LX7A 2HSEB 2DAQA 2FPEA 1HJDA 1WX6A 2E5KA 2YRCA 1RL2A 3QYHB 2P84A 2OTJT 1RAHB 1KJWA 3E19A 2QK0A 3JB9H 1PKTA 2JMCA 3I5SA 3NPFA 1QKXA 1UB4A 4MDWA 2CP7A 2XICA 5EG2A 3CBOA 1YJNT 1Q81C 1HD3A 2KYMA 3QBYA 4C8QF 4EMKB 3M56A 1M3AA 2Y4XA 2QA4Q 2YUPA 4PJNA 2M02A 2BZYA 3I56A 3L42A 4HCBA 4GLMA 3CCSQ 5KYYA 1VQ4T 2EYWA 2HL3A 4JRQA 2V26A 1AEYA 4A54A 4N4HA 2QI2A 2EW3A 1X43A 4UC4A 2L0AA 4M7AA 3LWIA 2IG0A 2QEXT 3RKYA 3LH0A 2K5FA 5KCOA 3HSBA 1OZ3A 2VYTA 4PNOA 2C0OA 4F16A 5GMKe 4M7AG 1WNLA 2XU8A 3M59A 4J9IA 4RTVA 4R55A 4IKFA 2E65A 1NJIC 4JLGA 3JSCA 3CD6Q 4J6XA 4M7AE 1X27A 3CPFA 4RG8A 3TSWA 9ATCB 1XNIA 1HXDA 2OI3A 2VXFA 4O6JA 3X28B 5LJ3h 2V8JA 1MNEA 3GLXA 2HQEA 3VS1A 1GBRA 3OB9A 5GAOl 2GBQA 3HRTA 3CCJA 4EMKA 5FU7B 1WHMA 2EJFA 3SD4A 1X69A 2Y90A 4MDXA 4D6WA 1WQWA 5I2MA 3QDRB 1UECA 2O01E 1MUZA 2VXEA 1MMGA 4BDZA 1J3TA 1GRIA 1BI0A 5IXBA 1Q81R 4N4IA 1I5LA 4XU3A 3CEYA 2GTJA 4M77G 5IXFA 2O9SA 1C6VX 2EGAA 2O9VA 4Y91A 5HY6A 1K73C 1R0CB 3KXTA 2QTVA 3E9GA 4M77F 5LL6S 4DEXA 3OYAA 3QXEB 5CQXA 4PJOC 2D8HA 3OQ5A 4C0GA 2JM8A 3OS5A 1AD5A 1WJSA 2DBKA 4ZN3A 1JB0E 4DQ2A 2RJDA 4JUVA 5GMKi 5L8RE 2J6FA 1YHQQ 2KRMA 1X01A 1D0YA 2V1QA 1B7TA 1OPKA 3L1AA 3I9QA 4PL6A 2LT1A 3REBB 4C8QB 4AT1B 2C0IA 1D3BA 2JTEA 1WHGA 3LH5A 5C6SA 1VQKQ 2LQKA 1YJ9Q 5GAN3 2MPXC 2P4RA 1VQ5A 1C1AA 3CBPA 4MMLA 1MNDA 1TH7A 3L2UA 3OYJA 1WFWA 2LCSA 1RAFB 2DXTA 1BI3A 1SSHA 2L3RA 1M27C 2HL5C 2PQWA 3JCMh 2KSSA 3GPLA 2DM1A 4AFQC 3H9NA 2HQHA 2RI5A 4OP0A 1YWOA 3CCQQ 5IN1A 3SWNB 1BU1A 2JM9A 2YWWA 5A0LA 2PUOB 3PVQA 4M7DF 4C0ZA 5I11A 2PVGB 2QG9B 3GBQA 2GGRA 4R56A 1UGSB 1LOJA 4C0DB 1VIEA 2LJ0A 2D9TA 2KGTA 2DD5A 1YITQ 3KBGA 3I35A 1D09B 1GFCA 4M77C 3EG1A 2F69A 4OMQA 1K73U 1JO8A 2FZKB 1XQHA 1FMKA 2RN8A 3M57A 4ELYC 2VASA 4RUGA 4ZTJA 1OX8A 2K9GA 2WACA 2ECZA 2H3JA 4C8QD 5GMKh 1K4US 4HVWA 3VS3A 2DTHA 4VUBA 1M1KU 1WHLA 3OW2P 2YRVA 4EMGA 3QDFA 3CCLA 2KDSA 3OYMA 2DE0X 1B34B 3G4SQ 3CMEQ 3EGXA 2LRQA 1OOTA 3JCMP 5DM7R 1E6GA 1Q95G 4PJOG 4BE2A 1JRIA 5LJ5d 2RK1A 2DXCA 3L2WA 2M16A 3FLGA 2K2VA 2VV5A 4FIBA 2O4XB 2PVDB 4NL2A 1AOJA 5AYFA 1PRLC 2A36A 3NTIA 3O5ZA 1NZ9A 3UATA 4B6MA 1GXIE 4LNPA 4DBHA 3REAB 2X3XD 4Y28E 3V7SA 1BYMA 2DIQA 4C92C 4FYXB 4NS5A 3ZEHA 2QQBA 1WIEA 4C92D 4J6WA 4J7FA 2HCKA 4FW1A 1TS9A 4BE1A 1ZUYA 2G3RA 5EC7A 1LVKA 5CKEA 2LNVA 4HT8A 5GANd 2DL4A 2K3BA 2A08A 1MV3A 3JB9F 5LJ5j 4F7UG 3TCJA 3SWNA 6AT1B 2YLBA 2DETA 3OYLA 3HHTB 3J7AF 2FG0A 1YFNA 2HBPA 4ZGEB 4CC7A 1CSKA 2KROA 3L2QA 4M7DG 3OW2S 1KD1U 2WSEE 3VS5A 4ZTFA 1QVFP 3M54A 3HKSA 3OYYA 4BY6B 1CKBA 1WHKA 4FCYA 2YUQA 2FZGB 3LW5E 2LC4A 2LQ8A 2X4WA 2YXYA 4M78G 3JRZA 1PD0A 3CC7A 4C8QA 4A4HA 3CC4T 2K3XA 4ATOA 2BE9B 3GF5A 3G1JA 3EHRA 5GAN7 2EVRA 3OY9A 2EQKA 4J5YA 5GANg 2DL3A 1M5Q1 1YJNA 3I55T 1VQ4A 1MV0B 5KCHA 1UGRB 2COYA 5A2QE 2YSQA 5GANj 5KYXA 1QVFA 5CR2A 4RCBA 1AWWA 3MP1A 1BCOA 1OU9A 1M1KC 2DA9A 4OMOA 4KH1B 3CCVQ 1VUBA 4M7DA 2CYZB 3A8GB 2KY9A 1M3CA 1OULA 3KFVA 3QWYA 2BUDA 4PJOF 1F1BB 1ARKA 1ZLMA 5HK3A 4C5EA 5ECAA 1KD1R 3DB3A 2JTMA 2ZPFB 2J6KA 4AFZC 1NPPA 1YP5A 5FU6C 5LJ5e 1IZ6A 3G71A 3V8KA 4E2FB 2RD1A 1VQ8T 2GNCA 1FX7A 4KRTA 1KC8C 3ME9A 2D1XA 3CCMT 5HK0A 3CC7T 4V2SA 4XAXB 2GCXA 2DVJA 4FYVB 1KHIA 3L2ZA 4C5GA 1QVFS 3OYHA 4XQ3A 2P0KA 2Z0WA 1LPLA 2DJZA 4N0AA 2DXUA 1U8RA 3M58A 1N9RA 3WVDB 5GAN4 4J9HA 1W70A 3VS6A 1U06A 3CCJQ 2EQJA 5C0MA 3G6EQ 2DZCA 3BDUA 1UHCA 1PSEA 3CCVA 1RLPC 2ABLA 2AK5A 3EGUA 2MIOA 2RHIA 2OTLT 4HVUA 3CMAT 1VQ5Q 3CBMA 3PNWC 3AT1B 4M75B 5I21A 3JCMb 4QQDA 4PKCC 1VQPT 4DBQA 3TEEA 1GCQC 4F7UE 1EIFA 3VS7A 1M90U 4IIOA 3CXCS 2NYSA 2LZ6B 4FSSA 4EMHA 3M0SA 4D8KA 4C8QG 4JS4A 2LQNA 1M8VA 2LVMA 2DTOA 2EBPA 1IGUA 2LJ1A 2JUFA 2MF2A 3E2UA 2M0OA 2DXBA 2E12A 3X25B 3CCMA 3JCMJ 3MPUB 4RTYA 7AT1B 1ABQA 2EQIA 1R77A 3UT1A 3HFOA 2JOYA 5D6WA 1PD1A 2R57A 1UGVA 4M75C 2M9UA 1RUWA 2C06A 1RAEB 4IUTA 1G3WA 5KYNA 2J7IA 2EKHA 2MMPA 3HPWA 5GAMf 2GQVA 3SWNC 2XG8D 4RTTA 2DEUA 3C12A 2M51A 3OSVA 1XOVA 4E7HA 1X2KA 1YJWQ 2E1HA 3NTKA 1VQOQ 1W2BP 3ZL7C 4LDYA 3FEOA 2AKLA 2RQUA 1RACB 2MYSA 3S3OA 2DBMA 4F7UA 3MEUA 2FEIA 2K6DA 4EPCA 4K11A 2HAXA 2ZPHB 1FYNA 4M78C 4J9FA 4CC4B 3BW1A 5GAN6 1WJRA 5D6XA 3P8HA 4FM4B 2NUTB 1NJIU 2XD0A 3KUFA 4BD3A 4B9XA 3RMSA 4AMCA 3JCMQ 1K8AR 3MEAA 5HCKA 3CPWP 2QGFB 1SHFA 1AZEA 1WZOA 3U23A 1RAGB 4M7DD 1A0NB 1PG5B 2DLPA 2DO3A 5FROA 1M90C 4RG2A 4OVAA 2DD4A 2KBTA 1UGPB 4Y92A 3SB2A 1QWEA 4E7ZA 4AG1C 1UGQB 4DBRA 2RHXA 4M77A 5D6YA 4JRPA 1W2BS 4FSXA 3N5BB 1Y57A 1VQMQ 3CC2T 1ZSZB 2KAFA 2QQRA 1ZUUA 1N27A 3EG3A 4A53A 2A28A 3CCUT 2CUBA 1ZBXA 2BE7D 3HRUA 4J9CA 2K79A 3EGXB 5GAN8 1ZX6A 3SHWA 1K1ZA 4OMFB 4E7SA 3META 4RCCA 4X1VA 3JCMc 1T0HA 3LLRA 4KH0B 2ZZDA 3OSSC 3CCLQ 1DJ7B 2I0NA 3M53A 4Z89A 2DRKA 2RM4A 1RADB 3HP9A 1UG1A 1YIJT 2KK4A 2P0QA 3V8JA 1ZSGA 4JJDA 2YLCA 3I5RA 1VQ7A 2ZPGB 1ZA1B 1N9SA 1NLPC 1VQ9Q 1W6XA 5J39A 2RK2A 4OB2B 3X20B 3RNJA 1Y7XA 3OW2A 2RQWA 3CCRQ 2XDDA 1ZHIA 4LDUA 4JJNK 2JTFA 4FL6A 3FB9A 1M2VB 5CIUA 3JV3A 2DZ9A 1Y96B 3OBYA 1QWFA 2QQSA 2MAMA 2DNUA 3RDVA 1IB8A 1I1JA 4M75D 1LCKA 3RKWA 3PT9A 2ZAEA 4Z8AA 1SRMA 3ASKA 2E10A 1YI2T 4RTXA 1UEBA 5A0GA 5LJ3f 3FJPA 3SFMA 1SSFA 2GF7A 3QHSA 1H3HA 2FPFA 3P8DA 1PSFA 4C92A 1UE9A 4E7LA 1VQNA 3CQTA 1VQNQ 4LE9A 4OB0B 4XU1A 5GANe 2IPOB 3V7RA 2EIFA 1K8AU 2KRNA 5GAN5 2CT3A 3QG1A 4GBQA 2KXCA 3S3NA 1B3QA 1KD1C 1MHNA 3JCMf 2NUTA 2DK3A 5CVIA 4NOYA 2VGNA 2DYIA 4EMKC 1G8XA 1S72T 3I56Q 4KBMB 2QDLA 1QCFA 5GAMg 1KG1A 2DL8A 3EAEA 4FYYB 3VYGA 3I55A 4J9BA 1Y0MA 5HKCA 3BFMA 4PLIA 4MMKA 2CP5A 1KQ2A 1X6GA 2CZ6B 4OMLA 3FJ5A 2QEXA 2ROTA 4C0FA 3MEWA 1U3OA 1E7OA 3NMZC 5IHIA 4OMPA 1Q86R 3MEVA 3PFSA 1BBZA 2LCLA 4LDVA 1I81A 2L8DA 2FL7A 1ZA2B 3EGDB 4DOVA 2I2LA 1Q86U 2ATCB 3MO8A 2D8JA 2DKGA 5DY9A 1MMDA 4ANJA 2KEAA 2YUOA 2F5TX 1JU5C 1KQSA 3FDRA 1TU0B 4M77E 1IGQA 3NFCA 2KE9A 4LXCA 1PNJA 3T9NA 3MHXA 3F70A 3GNFB 4KGZB 1VQ4Q 1R0BG 3FRNA 2KXDA 3CMAA 1M8MA 4ZNXA 1FMVA 1OV3A 2P0PA 1OU8A 4JRKA 4AFUC 5LJ5f 3JB9J 2RQRA 2QEXQ 3C95A 3M9QA 3UPUA 5GANh 3OYIA 4JLIA 2E5QA 2RA2A 4C92B 2RB6A 5KYUA 3VS2A 3G71T 4F17A 2DERA 4XTXA 5CO7A 2M1HA 3OMGA 3LGLA 2X4XA 5CK9A 3MCAB 3TREA 2FO0A 1I0CA 1VQLQ 2QASA 4B9WA 1TSFA 2XMFA 1QVPA 5CQYA 2JT4A 4EDUA 5KYWB 3OMCA 1WPYA 5AT1B 5IT9E 4M7DC 4M7AF 5GMKm 3X26B 5FW9A 1OPLA 1SHGA 4M75E 1BIAA 4QQGA 3CPWA 1TXQA 1TWBA 4BACA 1NEBA 1WXUA 3A8HB 4BY6C 3DLLA 2JZ2A 1YJWA 1XJWB 3EFOB 1N8RU 4M7DB 3LYIA 2J06A 2X3WD 3A8OB 2DYBA 1VQ6Q 3CCQA 4FU6A 1RI0A 3D7SB 3H6ZA 1G3YA 1KK7A 2AZSA 3EH2A 2MOXA 1BK2A 3C0CA 1VQ7Q 5KYYB 4E7KA 4JPBW 1MMAA 1D0ZA 8AT1B 1YITA 1PKSA 1AT1B 2NLUA 2EJGA 1D1BA 3MP6A 5GAMh 1Q7YU 2HBWA 3H0IA 3J80E 5GAOm 2K3YA 2DL7A 3OYDA 1YHQT 4PJLA 1YHQA 3A8MB 2PZ1A 2JJ9A 4PFPA 3EG0A 2A3LA 3RIRA 2JW4A 4P5NA 4N0AC 4QVZA 5CKHA 1FXXA 2XI9A 4X9CA 1WXTA 2CSIA 2E64A 4QW2A 1IREB 3QSUA 2AIRB 3QUIA 3CCEA 3EH1A 1BI2A 4QQ6A 3CCET 1BIBA 1ABOA 1TUDA 3QPHA 4J83A 1UUEA 3EFRA 2HEQA 1O9SA 4E6RA 2X9HA 4MZMA 2YHTA 1VQ6A 3JCMW 2RNAA 2COZA 2LQWA 3G4SA 1UHFA 3CMEA 2L3QA 3QJ6A 4C0DC 2BIVA 3EG2A 4HA8A 4C92F 4F7UB 4RMOA 2O2OA 2RH2A 1K9MU 5CKDA 1FWZA 3QWXX 5FRMA 5GAOp 2BZ8A 1YIJA 2VKNA 1VOMA 1X6OA 1NJIR 2K57A 1PHTA 1RI9A 5LJ3j 1H8KA 3M0UA 2CH4W 1NBEB 1I4K1 2DMOA 2O4XA 1BB9A 5D7UA 2QA4A 2HMAA 1K0SA
chains in the Genus database with same CATH topology
3OB9A 1VQMA 2OTJA 5GAMe 4EPCA 4M78D 5GAOl 3HRTA 2HAXA 4C8QE 3CCJA 2ZPHB 4EMKA 5FU7B 4M78C 4ZGJB 4M75A 5CCAA 2EJFA 3BW1A 4FT2A 3PGGA 5GAN6 1VQ8A 1WJRA 2Y90A 3SD4A 3VYHB 2X35A 1NPRA 1WQWA 4D6WA 1VQNT 4MDXA 5I2MA 3QDRB 5D6XA 2O01E 1B34A 3P8HA 2VXEA 4FM4B 4ELZC 4BDZA 1NJIU 1BI0A 1ZQ1A 2QDYB 3KUFA 4BD3A 4N4IA 5FU6B 4B9XA 3OBWA 2MI6A 4XU3A 4IUQA 3RMSA 4WF2A 3CEYA 3UDCA 4M77G 3VU3C 3JCMQ 3MEAA 4L59A 4E7IA 4M7AB 2CKKA 2DVEA 4M7DD 1Q82U 4Y91A 5HY6A 2DO3A 2XHCA 5FROA 1K8AC 1QP3A 1K73C 3VUBA 4RG2A 3FIFA 3KXTA 1M90C 4JDSA 4OVAA 2DD4A 2RJCA 1UGPB 3R6OA 2XKOC 3E9GA 3SB2A 4M77F 3OYGA 4O5VA 2MWOA 5LL6S 1UGQB 3OYAA 2RHXA 4M77A 2PU9B 5D6YA 3QXEB 2A7YA 4XK8E 5CQXA 4JRPA 2X4YA 1W2BS 4FSXA 3GIBA 1H641 3N5BB 4TVRA 4BE0A 4PJOC 3CC2T 1VIFA 3OYKA 4BI3A 3OQ5A 2KAFA 2QQRA 2RHZA 4C0GA 1N27A 4IUVA 4A53A 5GAN2 3CXCA 4OF1A 3OS5A 3CCUT 1WJSA 1ZBXA 3OYBA 4ZN3A 3HRUA 2EQUA 4Z02A 5GAN8 1JB0E 4L6V5 4C8QC 2RJDA 3RKXA 4DQ2A 4OMFB 4L5GA 4JUVA 4HT9A 3META 4RCCA 3JCMc 5GMKi 2HNIA 5L8RE 2R58A 3LLRA 2QA4T 1X01A 1BI1A 3L2VA 3C94A 1OZ2A 2V8IA 3L1AA 4OGEA 2ZZDA 3OSSC 2JN0A 4BI4A 1DJ7B 2ZCFB 2LT1A 3M53A 4PL6A 3GP8A 4C8QB 3CCSA 4M77D 3CPWS 2RM4A 2XDBA 3CCST 5DLQE 1D3BA 2LT4A 2K5LA 3HP9A 2D6FA 1YIJT 5FLXE 1S72A 2KK4A 2P0QA 3V8JA 3VKIA 5C6SA 2RJEA 2YLCA 4J7IA 4DOWA 4II1A 1VQ7A 1LJOA 4PJOB 3JCMg 2LQKA 2ZPGB 4M78B 1N9SA 5GAN3 5J39A 4ME7A 2RK2A 3RMQA 1JJ2S 4OB2B 1VQ5A 3M55A 3VJPA 3CBPA 4MMLA 1TH7A 5LJ3d 3L2UA 3X20B 3Q1JA 1P92A 2DIGA 3OYJA 1Y7XA 3OW2A 2DXTA 2XDDA 1BI3A 2FYKA 1ZHIA 4LDUA 3OYEA 1XTDA 3UWNA 2JTFA 4FL6A 4JJNK 1QVGA 3FB9A 2L3RA 4IURA 2PQWA 5CIUA 3RUXA 3JCMh 2KSSA 3FC3A 1U1SA 2DZ9A 3GPLA 3NTHA 3RESA 1Y96B 1BKBA 3CD6T 3OBYA 2RI5A 3PMIA 2QQSA 2JNGA 4OP0A 2MAMA 1X75C 4KUDK 5IN1A 4N4GA 2OTLA 2XK0A 2E6NA 3SWNB 1YJ9A 4M75D 1M4ZA 2QTXA 3O8VA 1HK9A 1OYXA 1JJ2A 4XU0A 2PUOB 5A0LA 4M7DF 4C0ZA 3G6EA 3JB9G 4F7UF 1Y07A 2PVGB 3RKWA 3PT9A 4M78E 3VV0A 4R56A 1UGSB 1I5LA 1LOJA 1YJWT 4C0DB 1VIEA 4C92E 3A8LB 3DKMA 2D9TA 2FB7A 5GANf 2OAUA 4BI8B 3V7CA 3ER0A 3ASKA 4XTUA 2DD5A 2L5QA 2E10A 5M9OA 3KBGA 1YI2T 1UEBA 3OYNA 5A0GA 5LJ3f 3FJPA 4M77C 3SFMA 3C4SA 1SSFA 2BKDN 2GF7A 4JRIA 5FRNA 2F69A 3L2RA 2LDMA 3QHSA 3QKJA 1K73U 1XQHA 4C5IA 3QO3A 4DA4A 3M57A 4E47A 3P8DA 1PSFA 4ELYC 4C92A 4ZTJA 4E7LA 1VQNA 5GAMj 1VQKA 4OB0B 4XU1A 4QVDA 5KH6A 5GANe 2WACA 3V7RA 3OA6A 2EIFA 5GAOn 2H3JA 5CAIA 4C8QD 1K8AU 3QZ5B 5GMKh 5GAN5 3CCVT 3QG1A 3S3NA 1VQLT 1M9SA 1QVGS 4PLLA 2DTHA 4VUBA 1VQLA 1M1KU 2EFIA 2YRVA 4EMGA 3CCLA 3OYFA 2KDSA 1KD1C 1MHNA 3JCMe 3JCMf 3OYMA 2RHYA 1B34B 2DK3A 1W2BA 1AHJB 5CVIA 1U1TA 3URGA 2LRQA 2VGNA 4NOYA 4EMKC 3JCMP 5DM7R 1S72T 2FHDA 3J81E 1QW1A 4PJOG 5J3BA 4KBMB 4BE2A 1JRIA 3CD6A 2VUBA 5LJ5d 5GAMg 3RERA 1KG1A 4LD9K 4XTVA 2RK1A 3EAEA 2DXCA 2L89A 3VYGA 4IUPA 3VUZA 3I55A 3L2WA 2M16A 3FLGA 2K2VA 2VV5A 3PIOA 2PVOB 1KQSS 3CCUA 2RI3A 4FIBA 2AHJB 1Y71A 1KHCA 1YBYA 2EAYA 2HD0A 3OS1A 2O4XB 2PVDB 4NL2A 5HKCA 5AYFA 3BFMA 5FU7C 3NTIA 1NZ9A 4KUIA 1GXIE 4PLIA 2RHUA 4MMKA 1KQ2A 2CZ6B 2E6ZA 4Y28E 3V7SA 3M4GA 2QEXA 3LWHA 4C0FA 2D0QB 2EWNA 3MEWA 2DIQA 1MGQA 4MZPA 4NS5A 4C92C 1BYMA 4QVCA 4HCZA 3ZEHA 2QQBA 2ZPEB 4J6YA 4C92D 2ZPBB 4J6WA 4J7FA 1VQ6T 4M75F 3CCLT 3HL8A 4XTWA 3MEVA 2G3RA 4C5HA 4BE1A 3PFSA 2LCLA 4LDVA 2PUKB 1I81A 2LX9A 5CKEA 3CCJT 2HQXA 2L8DA 2FL7A 2LNVA 4HT8A 5GANd 3G6ET 5IAYA 1K9MC 2X4JA 4DOVA 2I2LA 4KULA 2B8AA 1Q86U 3QJYA 4OB1B 5LJ5j 1VQ7T 3MO8A 1VQKT 4A4EA 4F7UG 3JB9F 2DKGA 3TCJA 3SWNA 3QYGB 2YLBA 5DY9A 2RO0A 3OYLA 2FVUA 4XTZA 1YJ9T 3JB9I 3V8LA 1VQ9T 1VQ5T 3QZ9B 2VC8A 3HHTB 3WVEB 4PJOD 2DTIA 2VGMA 1VQ9A 3S6WA 2F5TX 2IVWA 1KQSA 3J7AF 3FDRA 4M77E 4ZGDB 1D3BB 2HBPA 3NFCA 4YTLA 1G3TA 1Q86C 4ZGEB 2CZ7B 2QQ9A 3GNGA 3ZBDA 3CCRT 2JVVA 2CS7A 4ZN1A 2ZGWA 1VQPA 3M5AA 4X34A 3T9NA 3MHXA 3L2QA 3F70A 5GAOq 3P8BB 3GNFB 4OGCA 4CRIA 3S3MA 2XD0A 4M7DG 3OW2S 1KD1U 2WSEE 4ZTFA 3FRNA 4M78F 3CCQT 2EKOA 4M78A 3M54A 2RJFA 2K4YA 3HKSA 3OYYA 5CKBA 4BY6B 3CMAA 2F5KA 2CZ0B 3TU4K 2P0PA 4JRKA 3X24B 5LJ5f 3HRSA 3E9FA 3JB9J 3LW5E 4HCCA 2LC4A 3OS0A 1M1GA 2EJ9A 2LQ8A 2X4WA 3C95A 4GY5A 3HFNA 4M78G 3JRZA 3CC7A 2CGHA 3M9QA 3E1SA 4C8QA 4A4HA 3CC4T 2K3XA 4ATOA 2QXFA 1JBMA 3PMTA 4M77B 3GF5A 4XTYA 5GAN7 4E7JA 3UPUA 3PIPA 1YITT 3OY9A 1Y96A 2EQKA 3JCMd 5GANh 3OYIA 2XIDA 4J5YA 4JLIA 5GANg 2E5QA 2ZPIB 1M5Q1 2RA2A 4X9DA 2RB6A 4C92B 3I55T 3G71T 1VQ4A 1YJNA 3GOXA 5KCHA 1G3SA 1UGRB 1M1FA 4XTXA 5A2QE 5CO7A 5LJ5g 4BDYA 5GANj 2M1HA 5GAOr 1QVFA 5CR2A 3OMGA 2QQAA 4LD6A 4RCBA 3LGLA 4HKEA 2X4XA 4A4FA 2E41A 3MP1A 5CK9A 3MCAB 3TREA 3CC2A 1KC8U 5LJ3e 5CKFA 1M1KC 1VUBA 4M7DA 2CYZB 3A8GB 4C92G 2KY9A 4B9WA 4IUUA 3INZA 4A4GA 1VQOA 5J26A 2P4TA 1QVPA 1VQOT 2EQMA 5CQYA 3PTAA 4A4KA 2BUDA 4PJOF 4EDUA 5KE3A 4M75G 3G4ST 2R5AA 3CMET 3DB4A 4FT4A 2K5IA 3OMCA 3JCMV 1WPYA 5HK3A 3MP8A 4OB3B 4GLKA 4C5EA 5IT9E 2GFUA 3JB9D 1Q7YC 4M7DC 1I8FA 3DB3A 4BB7A 4J8OA 5GMKj 3CC4A 2JTMA 4M7AF 4M7AC 1W4SA 4NL3A 2ZPFB 3I56T 1NPPA 3QIIA 5GMKm 5FU6C 3X26B 5LJ5e 1IZ6A 1LNXA 5A0DA 3G71A 3V8KA 4CI0C 5DLOA 4M75E 1BIAA 4KT0E 4LDWA 4QQGA 3A5ZB 3SDZA 2EYQA 3CPWA 2RD1A 1VQ8T 1FX7A 4BACA 3BY7A 2LTOA 2KMTA 3A8HB 3DLMA 4BY6C 3DLLA 2JZ2A 5KE2A 3EFSA 3CCRA 1YJWA 1KC8C 3ME9A 3CCMT 5HK0A 3CC7T 4V2SA 2GFAA 4XAXB 2GCXA 2E70A 1N8RU 4PJOA 4C5GA 1KHIA 3L2ZA 5I2SA 4M7DB 2RI2A 1QVFS 3LYIA 3OYHA 4XQ3A 2P0KA 3A8OB 2KQWA 2DJZA 3H8ZA 2DXUA 4N0AA 5GMKl 2MWPA 3M58A 4FU6A 3JAME 3CCQA 1U8RA 1N9RA 3WVDB 5GAN4 3LGFA 3G7ZA 2XDPA 1RI0A 1R8OB 3H6ZA 1G3YA 3LX7A 2EQJA 5C0MA 2DAQA 1N6AA 1YCYA 1KQ1A 1RL2A 2DZCA 3BDUA 3QYHB 1VQMT 1PSEA 2OTJT 3CCVA 3E19A 2CZ1B 3JB9H 4E7KA 2RHIA 2OTLT 3CMAT 2DEQA 1YITA 5GAMd 2NLUA 2EJGA 1UB4A 4MDWA 1NE8A 3MP6A 5GAMh 3CBMA 3PNWC 1Q7YU 2XICA 1WJQA 5EG2A 3CBOA 4M75B 3J80E 1YJNT 1Q81C 5GAOm 5I21A 2K3YA 4QQDA 3JCMb 2LCCA 4PKCC 3OYDA 3QBYA 4C8QF 4Q5WA 4EMKB 2WSCE 1VQPT 1N8RC 3TEEA 3M56A 1QP2A 1YHQT 4F7UE 1EIFA 2Y4XA 1YHQA 3JCMX 1YI2A 3A8MB 1OI1A 1M90U 1G5VA 3I56A 3L42A 2A3LA 3RIRA 4P5NA 3CXCS 4EMHA 4BUGA 4HCBA 4M7DE 4PJOE 4N0AC 4QVZA 1VQ4T 5CKHA 4C8QG 1FXXA 3OS2A 4JRQA 4JS4A 2XI9A 4X9CA 3WXMB 1M8VA 2LVMA 2DTOA 4N4HA 2E64A 4QW2A 4A54A 1IREB 3QSUA 2QI2A 3QUIA 3CCEA 2DPPB 2JUFA 2MF2A 1BI2A 2M0OA 4QQ6A 2DXBA 4UC4A 3CCET 4M7AA 1BIBA 2E12A 3LWIA 3AHUA 3X25B 2IG0A 2QEXT 3RKYA 3LH0A 2K5FA 3QPHA 4J83A 2R5MA 5KCOA 3HSBA 3CCMA 4M7AD 1OZ3A 3EFRA 4RKUE 5LJ5h 3JCMJ 1O9SA 2V8KA 2VYTA 4PNOA 4MZMA 2WSFE 5GMKe 3UT1A 4M7AG 2YHTA 1WNLA 3HFOA 1VQ6A 2XU8A 3M59A 2JOYA 5D6WA 3JCMW 4R55A 4IKFA 2E65A 1NJIC 3G4SA 3CMEA 2R57A 3QJ6A 4M75C 4JLGA 1V29B 4C0DC 2BIVA 2M9UA 3JSCA 4HA8A 4XU2A 2C06A 4J6XA 4C92F 4F7UB 4RMOA 1WQ7A 1G3WA 4IUTA 3OYCA 1O75A 1Q82C 2MMPA 3HPWA 2RH2A 5GAMf 2GQVA 1K9MU 4M7AE 3CPFA 3SWNC 2XG8D 5CKDA 1FWZA 3BDLA 4RG8A 3C12A 3OSVA 5FRMA 5GAOp 1XOVA 1YIJA 1Q81U 4E7HA 1X6OA 4LDXA 2K57A 2KVQG 1XNIA 2E1HA 3NTKA 1WGSA 1HXDA 4MZTA 5LJ3j 5LJ3g 2VXFA 3M4YA 4LDYA 4O6JA 1I4K1 5LJ3h 2V8JA 3FEOA 3X28B 2O4XA 3GLXA 4JS5A 2Y4YA 3ZFJA 3S3OA 1H3ZA 2HQEA 2QA4A 4F7UA 3MEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB9 A;  3LYI A;  4N4G A;  5IN1 A;  2XK0 A;  2E6N A;  3OYH A;  2P0K A;  3O8V A;  3S6W A;  1OYX A;  3H8Z A;  2MWP A;  3FDR A;  4FU6 A;  3LGF A;  2XDP A;  1RI0 A;  3H6Z A;  1WJR A;  3LX7 A;  3SD4 A;  2X35 A;  2EQJ A;  5C0M A;  2DAQ A;  2D9T A;  5D6X A;  4X34 A;  3P8H A;  4BDZ A;  3ASK A;  3L2Q A;  3F70 A;  3KUF A;  4BD3 A;  4N4I A;  4B9X A;  5M9O A;  4IUQ A;  3S3M A;  4CRI A;  3CEY A;  4E7K A;  3MEA A;  4L59 A;  3OYN A;  4E7I A;  2RHI A;  4ZTF A;  2CKK A;  2EKO A;  3C4S A;  2RJF A;  1SSF A;  2BKD N;  2GF7 A;  5FRN A;  2NLU A;  2F5K A;  2LDM A;  3QKJ A;  3L2R A;  3MP6 A;  4C5I A;  3PNW C;  5FRO A;  1WJQ A;  4RG2 A;  3OYL A;  3P8D A;  4OVA A;  2K3Y A;  2RJC A;  3E9F A;  2LCC A;  4QQD A;  3E9G A;  3QBY A;  3OYD A;  4Q5W A;  4ZTJ A;  3OS0 A;  4E7L A;  2X4W A;  3OYG A;  4GY5 A;  2MWO A;  5KH6 A;  2RHX A;  3OYA A;  2WAC A;  5D6Y A;  3M9Q A;  4A4H A;  2K3X A;  3OA6 A;  2X4Y A;  1OI1 A;  1G5V A;  3PMT A;  4BE0 A;  4E7J A;  3L42 A;  3S3N A;  3OY9 A;  3OYK A;  2EQK A;  3OQ5 A;  4PLL A;  2QQR A;  2RHZ A;  3OYI A;  2EFI A;  1N27 A;  4IUV A;  2YRV A;  4QVZ A;  2E5Q A;  3OS2 A;  3OYF A;  1MHN A;  1WJS A;  3GOX A;  3OYM A;  5KCH A;  2RHY A;  3OYB A;  2LVM A;  4N4H A;  4QW2 A;  4BDY A;  2EQU A;  2M1H A;  4Z02 A;  2LRQ A;  4UC4 A;  2M0O A;  4QQ6 A;  2RJD A;  3OMG A;  4LD6 A;  2IG0 A;  2FHD A;  3MET A;  3LH0 A;  3LGL A;  2R58 A;  2R5M A;  2X4X A;  5KCO A;  3LLR A;  4A4F A;  1OZ3 A;  3MP1 A;  4BE2 A;  3L2V A;  1OZ2 A;  3EAE A;  2L89 A;  2VYT A;  4IUP A;  4PL6 A;  3L2W A;  2M16 A;  3FLG A;  3UT1 A;  4B9W A;  4IUU A;  2RI3 A;  4A4G A;  5J26 A;  3OS1 A;  1KHC A;  5D6W A;  2EQM A;  4IKF A;  2O4X B;  2BUD A;  4EDU A;  2R57 A;  5KE3 A;  3NTI A;  2R5A A;  3QJ6 A;  3DB4 A;  5C6S A;  2RJE A;  4PLI A;  2RHU A;  2BIV A;  3OMC A;  4II1 A;  3MP8 A;  4C5E A;  2GFU A;  3DB3 A;  3MEW A;  2DIQ A;  4IUT A;  3OYC A;  4NS5 A;  4HCZ A;  5J39 A;  3ZEH A;  3QII A;  3BDL A;  3L2U A;  3Q1J A;  2DIG A;  4C5H A;  3MEV A;  2G3R A;  3OYJ A;  4BE1 A;  5FRM A;  3PFS A;  4E7H A;  4QQG A;  1XNI A;  2HQX A;  3OYE A;  2L8D A;  4BAC A;  3UWN A;  2JTF A;  3NTK A;  4FL6 A;  1WGS A;  2LTO A;  3DLM A;  5IAY A;  2L3R A;  4IUR A;  2JZ2 A;  5KE2 A;  2PQW A;  5CIU A;  2B8A A;  3FEO A;  3FC3 A;  2O4X A;  3ME9 A;  3MO8 A;  3NTH A;  4A4E A;  3S3O A;  1H3Z A;  2HQE A;  2GFA A;  2RI5 A;  3PMI A;  2QQS A;  3MEU A;  4C5G A;  2RO0 A;  2RI2 A; 
#chains in the Genus database with same CATH topology
 1V76 A;  1VQM A;  3MJX A;  4M78 D;  2EGE A;  5KYW A;  4LUE A;  4C8Q E;  4ZGJ B;  2L2P A;  3PGG A;  4FT2 A;  3VYH B;  2X35 A;  1B34 A;  2CT4 A;  4ELZ C;  1Q82 R;  1N8R C;  5FU6 B;  1UJ0 A;  2MI6 A;  4IUQ A;  3UDC A;  1Q82 U;  2NWM A;  1K8A C;  1QP3 A;  3VUB A;  3FIF A;  2RJC A;  3R6O A;  5IHK A;  1SEM A;  2X4Y A;  3GIB A;  1H64 1;  2KNB B;  4TVR A;  1QLY A;  2OTJ Q;  3OYK A;  1VYT A;  4BI3 A;  2SEM A;  2RHZ A;  3PVL A;  4IUV A;  5GAN 2;  5IHN A;  1QQJ A;  3OYB A;  3SEM A;  1ZUK A;  4JJB A;  1YJN Q;  4PJM A;  4C8Q C;  2O88 A;  4L5G A;  1IHW A;  1WHH A;  1PWT A;  1YCS B;  2QA4 T;  2L3S A;  1BCM A;  1BI1 A;  3L2V A;  2V8I A;  1KSW A;  5GJV B;  2RMO A;  2AT1 B;  2ZCF B;  3CCS A;  3CPW S;  2XDB A;  3CCS T;  1FMW A;  1S72 A;  3VKI A;  4J7I A;  2CSQ A;  4DOW A;  3JCM g;  2BTT A;  4M78 B;  1HYO A;  2HSP A;  4ME7 A;  2VWF A;  2M0Y A;  2LMJ A;  3RMQ A;  5LJ3 d;  3Q1J A;  2DIG A;  4RTZ A;  2J05 A;  2FYK A;  3OYE A;  1XTD A;  3UWN A;  1QKW A;  4QKU A;  3RUX A;  4AG2 C;  2E3H A;  2FZC B;  3RES A;  3CD6 T;  3PMI A;  1VYV A;  4KUD K;  2XK0 A;  4PK4 A;  1M4Z A;  1HSQ A;  2QTX A;  1HK9 A;  3O8V A;  2A37 A;  1OYX A;  1JJ2 A;  4XU0 A;  1UJY A;  3JB9 G;  2EYY A;  4F7U F;  1Y07 A;  4WTO B;  3CXC P;  3BE3 A;  5GAN f;  3CC4 Q;  2L5Q A;  1AWX A;  3OYN A;  1TOV A;  3C4S A;  1N5Z A;  2BKD N;  4JRI A;  5FRN A;  1WI7 A;  2LDM A;  4DA4 A;  4E47 A;  2EYZ A;  2FRW A;  5GAM j;  1VQK A;  1X6B A;  4QVD A;  5KH6 A;  5GAO n;  5CAI A;  3QZ5 B;  3CCV T;  1NEG A;  2SRC A;  1M9S A;  1QVG S;  2AKK A;  4DEY A;  2RHY A;  1W1F A;  2C0T A;  2CP3 A;  1AHJ B;  2O31 A;  2CUD A;  1U1T A;  3URG A;  2E3I A;  4FYW B;  2FHD A;  1JQQ A;  1YN8 A;  1QW1 A;  3CD6 A;  2VUB A;  3RER A;  4LD9 K;  4XTV A;  1TG0 A;  1SF9 A;  2L89 A;  3PIO A;  2PVO B;  2E4H A;  2RI3 A;  1Y71 A;  3RBB B;  2HD0 A;  1S1N A;  1K76 A;  2RHU A;  3CCM Q;  2E6Z A;  3LWH A;  2D0Q B;  2EWN A;  4HCZ A;  2ZPB B;  3A98 A;  1T3S A;  3HL8 A;  4XTW A;  2X51 A;  2MCN A;  4HXJ A;  1WXB A;  2OJ2 A;  3VRZ A;  2LX9 A;  3CCJ T;  2HQX A;  1YNZ A;  2MK5 A;  4QT7 A;  3G6E T;  1K9M C;  2OX7 A;  2X4J A;  4CC3 A;  3QJY A;  1VQK T;  4OMN A;  1ZSZ C;  2RPN A;  2KT8 A;  3QYG B;  2RO0 A;  4XTZ A;  1YJ9 T;  1K0X A;  1VQ5 T;  3WVE B;  2K7A A;  2DTI A;  3PE0 A;  4PFZ A;  3S6W A;  2IVW A;  5L23 A;  4ZGD B;  1K9A A;  1Q7Y R;  2CRE A;  4YTL A;  2CS7 A;  4ZN1 A;  2ZGW A;  1VQP A;  4X34 A;  4EIK A;  1T0J A;  1IXD A;  3UF4 A;  1QVG P;  4CRI A;  2KR3 A;  3CCQ T;  2QYZ A;  4M78 A;  2RJF A;  2K4Y A;  2ED0 A;  2CP6 A;  3HRS A;  3E9F A;  2EJ9 A;  1ZSZ A;  3HFN A;  3E1S A;  2QXF A;  4M77 B;  1PM3 A;  3NHN A;  4E7J A;  3PIP A;  1YIT T;  1Y96 A;  1SPK A;  1EFN A;  2EYX A;  1RLQ C;  2ZPI B;  4X9D A;  2RF0 A;  3GOX A;  1CKA A;  1G3S A;  1M1F A;  2CDT A;  1VA7 A;  2QQA A;  1K73 R;  3H0F A;  3CC2 A;  5LJ3 e;  5CKF A;  4IIM A;  4C92 G;  1ACM B;  3INZ A;  1VQO A;  1VQO T;  2EQM A;  4A4K A;  4M75 G;  3G4S T;  3CME T;  1YWP A;  1OX9 A;  2K5I A;  3JCM V;  2NUP B;  3MP8 A;  4OB3 B;  2K2M A;  4GLK A;  2GFU A;  1I8F A;  4BB7 A;  4J8O A;  2CP0 A;  1UDL A;  4J9G A;  2CH4 A;  1LNX A;  1D0X A;  4CI0 C;  4LDW A;  3A5Z B;  3SDZ A;  2EYQ A;  1WYX A;  3BY7 A;  2KMT A;  4RTU A;  1NLO C;  3CCR A;  1GCQ A;  2GFA A;  2E70 A;  2KT1 A;  3TVT A;  5GMK l;  3JAM E;  2XDP A;  2ESW A;  1IO6 A;  1N6A A;  1YCY A;  1KQ1 A;  1MMN A;  3A1P A;  2DFU A;  1VQM T;  2CZ1 B;  2DEQ A;  5GAM d;  2W0Z A;  1NE8 A;  2NUP A;  1WJQ A;  2LCC A;  4Q5W A;  2WSC E;  1QP2 A;  1G2B A;  1PRM C;  2ED1 A;  3JCM X;  1YI2 A;  3M0P A;  3H41 A;  1OI1 A;  1G5V A;  3EFO A;  4BUG A;  4M7D E;  1Z9Z A;  4PJO E;  2COW A;  1TUC A;  3OS2 A;  3WXM B;  1YIJ Q;  1RAA B;  2JMA A;  2YDL A;  2DPP B;  3AHU A;  8ATC B;  1GFD A;  4PFO A;  3M0R A;  2R5M A;  4RKU E;  4HVV A;  5LJ5 h;  1AWO A;  1WDX A;  4ESR A;  2V8K A;  2WSF E;  3MKD A;  4D8D A;  3H0H A;  3I55 Q;  2AZV A;  1V29 B;  1TUG B;  4XU2 A;  3UA6 A;  1WQ7 A;  3OYC A;  1Q82 C;  1O75 A;  1WA7 A;  3BDL A;  1PCX A;  1Q81 U;  4LDX A;  2KVQ G;  1WHJ A;  4ORZ A;  1WGS A;  4MZT A;  5LJ3 g;  3M4Y A;  2HKN A;  5KYU B;  4JS5 A;  1TTH B;  2Y4Y A;  2PTK A;  3ZFJ A;  1YI2 Q;  1H3Z A;  2KI7 A;  1K9M R;  2OTJ A;  5GAM e;  1M90 R;  4M75 A;  5CCA A;  4M7A D;  1VQ8 A;  1KFZ A;  2FRY A;  1NPR A;  1VQ8 Q;  1VQN T;  1OQK A;  2QDY B;  1ZQ1 A;  1RAB B;  3OBW A;  1JEG A;  4WF2 A;  3VU3 C;  3CC7 Q;  2QGG A;  4KGX B;  4L59 A;  4E7I A;  4M7A B;  2CKK A;  1ZBJ A;  2DVE A;  3NGP A;  2XHC A;  1IRX A;  2JXB A;  4JDS A;  1Z9Q A;  2EPD A;  2XKO C;  1I5O B;  2PNI A;  2YRD A;  3OYG A;  1JJ2 P;  4O5V A;  2MWO A;  5FWB A;  2PU9 B;  1UFF A;  2A7Y A;  4XK8 E;  4BE0 A;  5I22 A;  2HKQ B;  1NG2 A;  1VIF A;  1C0M A;  1RAI B;  3CXC A;  4OF1 A;  2OTL Q;  3CMA Q;  2IIM A;  4PJJ A;  2EQU A;  4Z02 A;  2LX7 A;  4L6V 5;  3RKX A;  4HT9 A;  2RQT A;  1VQP Q;  1GL5 A;  2HNI A;  2R58 A;  1D1C A;  1SG5 A;  4LN2 A;  3C94 A;  1OZ2 A;  2EGC A;  4OGE A;  2JN0 A;  4BI4 A;  2J6O A;  4JZ4 A;  3GP8 A;  2CP2 A;  4M77 D;  5DLQ E;  2LT4 A;  2K5L A;  3VS4 A;  2D6F A;  5FLX E;  2QAZ A;  2RJE A;  4II1 A;  2F2V A;  1LJO A;  4PJO B;  2FPD A;  4JZ3 A;  5FWC A;  1JJ2 S;  3M55 A;  2GQI A;  3VJP A;  4DBF A;  1P92 A;  2YUN A;  5KYX B;  3VRY A;  4WCI A;  1QVG A;  4IUR A;  2F2W A;  4AFS C;  2LJ3 A;  3FC3 A;  1U1S A;  2NUZ A;  3NTH A;  1BKB A;  1X2Q A;  2JNG A;  1X75 C;  2D0N A;  2ENM A;  4N4G A;  2E6N A;  2OTL A;  1YJ9 A;  1PC0 A;  1N8R R;  3EGD A;  3G6E A;  3IQL A;  4M78 E;  3THK A;  3VV0 A;  1YJW T;  4C92 E;  4M4Z A;  3A8L B;  3DKM A;  2FB7 A;  2B86 A;  2OAU A;  3V7C A;  4BI8 B;  3ER0 A;  1NM7 A;  4XTU A;  5M9O A;  4KGV B;  1KC8 R;  3G71 Q;  2VVK A;  3L2R A;  3QKJ A;  4C5I A;  3QO3 A;  2DF6 A;  3ULR B;  4HCK A;  4R0K A;  1T3L A;  2ROL A;  3OA6 A;  2DX1 A;  1VQL T;  2LP5 A;  4PLL A;  1VQL A;  2YT6 A;  2EFI A;  2OAW A;  3OYF A;  1G83 A;  1NYF A;  3JCM e;  1W2B A;  2H8H A;  3EG9 A;  2RQV A;  2VB6 A;  3J81 E;  1EX4 A;  4Z88 A;  3M0Q A;  5J3B A;  1EZZ B;  1AWJ A;  1U5S A;  2LNH B;  4IUP A;  5GJW B;  3VUZ A;  3CC2 Q;  1QCN A;  1GCP A;  2W10 A;  1KQS S;  3CCU A;  1AZG B;  2AHJ B;  3OS1 A;  1KHC A;  1YBY A;  2EAY A;  3CCU Q;  4RTW A;  2F2X A;  2L3P A;  5FU7 C;  4KUI A;  3UA7 A;  3M4G A;  4MZP A;  1MGQ A;  4QVC A;  4JJC A;  2ZPE B;  4J6Y A;  1VQ6 T;  2A0F B;  4M75 F;  3CCL T;  4C5H A;  3VS0 A;  1VYU A;  2PUK B;  1SKU B;  2KYB A;  5IAY A;  2DJQ A;  4KUL A;  3TQ7 P;  2B8A A;  1KQS P;  1VQ7 T;  4OB1 B;  4A4E A;  4FW2 A;  2FVU A;  3JB9 I;  3V8L A;  1VQ9 T;  4F04 B;  3QZ9 B;  2VC8 A;  4PJO D;  2VGM A;  3TSZ A;  1VQ9 A;  1WLP B;  1D3B B;  1M2V A;  1Q86 C;  1G3T A;  2F1L A;  2CZ7 B;  2QQ9 A;  3GNG A;  3ZBD A;  3CCR T;  2JVV A;  2BZX A;  3M5A A;  4A63 B;  5GAO q;  3P8B B;  4OGC A;  3S3M A;  1KIK A;  1E6H A;  4M78 F;  2KRS A;  2EKO A;  3EG9 B;  5CKB A;  1GBQ A;  2F5K A;  2CZ0 B;  3TU4 K;  4LUD A;  3X24 B;  3CCE Q;  1UTI A;  4HCC A;  1B07 A;  3OS0 A;  1M1G A;  4GY5 A;  1QCO A;  2CGH A;  1JBM A;  3PMT A;  4XTY A;  2H3E B;  1M30 A;  3EHQ A;  3JCM d;  2XID A;  2DL5 A;  4CC2 A;  1IHV A;  2HZY A;  1H92 A;  4BDY A;  5LJ5 g;  1D1A A;  1JXO A;  5GAO r;  1AVZ C;  4LD6 A;  4HKE A;  4A4F A;  2E41 A;  1KC8 U;  2G6F X;  1I07 A;  1V1C A;  4F14 A;  4IUU A;  4A4G A;  5J26 A;  3RR6 A;  2JS2 A;  2P4T A;  3PTA A;  5KE3 A;  2R5A A;  4OMM A;  3DB4 A;  4FT4 A;  5IH2 A;  3JB9 D;  1S72 Q;  2DIL A;  1Q7Y C;  3CC4 A;  5GMK j;  4M7A C;  4J9E A;  1W4S A;  4NL3 A;  3I56 T;  3QII A;  3M0T A;  3R6N A;  1JXM A;  5A0D A;  2DRM A;  5DLO A;  4KT0 E;  2GTO A;  1QMC A;  2JS0 A;  2LTO A;  3DLM A;  5KE2 A;  3EFS A;  1SRL A;  3HTR A;  1M1K R;  1NYG A;  1OEB A;  4PJO A;  5I2S A;  1M3B A;  2RI2 A;  2HDA A;  1M2O A;  4J9D A;  2KQW A;  3H8Z A;  2MWP A;  3LGF A;  2V1R A;  3G7Z A;  1R8O B;  3LX7 A;  2HSE B;  2DAQ A;  2FPE A;  1HJD A;  1WX6 A;  2E5K A;  2YRC A;  1RL2 A;  3QYH B;  2P84 A;  2OTJ T;  1RAH B;  1KJW A;  3E19 A;  2QK0 A;  3JB9 H;  1PKT A;  2JMC A;  3I5S A;  3NPF A;  1QKX A;  1UB4 A;  4MDW A;  2CP7 A;  2XIC A;  5EG2 A;  3CBO A;  1YJN T;  1Q81 C;  1HD3 A;  2KYM A;  3QBY A;  4C8Q F;  4EMK B;  3M56 A;  1M3A A;  2Y4X A;  2QA4 Q;  2YUP A;  4PJN A;  2M02 A;  2BZY A;  3I56 A;  3L42 A;  4HCB A;  4GLM A;  3CCS Q;  5KYY A;  1VQ4 T;  2EYW A;  2HL3 A;  4JRQ A;  2V26 A;  1AEY A;  4A54 A;  4N4H A;  2QI2 A;  2EW3 A;  1X43 A;  4UC4 A;  2L0A A;  4M7A A;  3LWI A;  2IG0 A;  2QEX T;  3RKY A;  3LH0 A;  2K5F A;  5KCO A;  3HSB A;  1OZ3 A;  2VYT A;  4PNO A;  2C0O A;  4F16 A;  5GMK e;  4M7A G;  1WNL A;  2XU8 A;  3M59 A;  4J9I A;  4RTV A;  4R55 A;  4IKF A;  2E65 A;  1NJI C;  4JLG A;  3JSC A;  3CD6 Q;  4J6X A;  4M7A E;  1X27 A;  3CPF A;  4RG8 A;  3TSW A;  9ATC B;  1XNI A;  1HXD A;  2OI3 A;  2VXF A;  4O6J A;  3X28 B;  5LJ3 h;  2V8J A;  1MNE A;  3GLX A;  2HQE A;  3VS1 A;  1GBR A;  3OB9 A;  5GAO l;  2GBQ A;  3HRT A;  3CCJ A;  4EMK A;  5FU7 B;  1WHM A;  2EJF A;  3SD4 A;  1X69 A;  2Y90 A;  4MDX A;  4D6W A;  1WQW A;  5I2M A;  3QDR B;  1UEC A;  2O01 E;  1MUZ A;  2VXE A;  1MMG A;  4BDZ A;  1J3T A;  1GRI A;  1BI0 A;  5IXB A;  1Q81 R;  4N4I A;  1I5L A;  4XU3 A;  3CEY A;  2GTJ A;  4M77 G;  5IXF A;  2O9S A;  1C6V X;  2EGA A;  2O9V A;  4Y91 A;  5HY6 A;  1K73 C;  1R0C B;  3KXT A;  2QTV A;  3E9G A;  4M77 F;  5LL6 S;  4DEX A;  3OYA A;  3QXE B;  5CQX A;  4PJO C;  2D8H A;  3OQ5 A;  4C0G A;  2JM8 A;  3OS5 A;  1AD5 A;  1WJS A;  2DBK A;  4ZN3 A;  1JB0 E;  4DQ2 A;  2RJD A;  4JUV A;  5GMK i;  5L8R E;  2J6F A;  1YHQ Q;  2KRM A;  1X01 A;  1D0Y A;  2V1Q A;  1B7T A;  1OPK A;  3L1A A;  3I9Q A;  4PL6 A;  2LT1 A;  3REB B;  4C8Q B;  4AT1 B;  2C0I A;  1D3B A;  2JTE A;  1WHG A;  3LH5 A;  5C6S A;  1VQK Q;  2LQK A;  1YJ9 Q;  5GAN 3;  2MPX C;  2P4R A;  1VQ5 A;  1C1A A;  3CBP A;  4MML A;  1MND A;  1TH7 A;  3L2U A;  3OYJ A;  1WFW A;  2LCS A;  1RAF B;  2DXT A;  1BI3 A;  1SSH A;  2L3R A;  1M27 C;  2HL5 C;  2PQW A;  3JCM h;  2KSS A;  3GPL A;  2DM1 A;  4AFQ C;  3H9N A;  2HQH A;  2RI5 A;  4OP0 A;  1YWO A;  3CCQ Q;  5IN1 A;  3SWN B;  1BU1 A;  2JM9 A;  2YWW A;  5A0L A;  2PUO B;  3PVQ A;  4M7D F;  4C0Z A;  5I11 A;  2PVG B;  2QG9 B;  3GBQ A;  2GGR A;  4R56 A;  1UGS B;  1LOJ A;  4C0D B;  1VIE A;  2LJ0 A;  2D9T A;  2KGT A;  2DD5 A;  1YIT Q;  3KBG A;  3I35 A;  1D09 B;  1GFC A;  4M77 C;  3EG1 A;  2F69 A;  4OMQ A;  1K73 U;  1JO8 A;  2FZK B;  1XQH A;  1FMK A;  2RN8 A;  3M57 A;  4ELY C;  2VAS A;  4RUG A;  4ZTJ A;  1OX8 A;  2K9G A;  2WAC A;  2ECZ A;  2H3J A;  4C8Q D;  5GMK h;  1K4U S;  4HVW A;  3VS3 A;  2DTH A;  4VUB A;  1M1K U;  1WHL A;  3OW2 P;  2YRV A;  4EMG A;  3QDF A;  3CCL A;  2KDS A;  3OYM A;  2DE0 X;  1B34 B;  3G4S Q;  3CME Q;  3EGX A;  2LRQ A;  1OOT A;  3JCM P;  5DM7 R;  1E6G A;  1Q95 G;  4PJO G;  4BE2 A;  1JRI A;  5LJ5 d;  2RK1 A;  2DXC A;  3L2W A;  2M16 A;  3FLG A;  2K2V A;  2VV5 A;  4FIB A;  2O4X B;  2PVD B;  4NL2 A;  1AOJ A;  5AYF A;  1PRL C;  2A36 A;  3NTI A;  3O5Z A;  1NZ9 A;  3UAT A;  4B6M A;  1GXI E;  4LNP A;  4DBH A;  3REA B;  2X3X D;  4Y28 E;  3V7S A;  1BYM A;  2DIQ A;  4C92 C;  4FYX B;  4NS5 A;  3ZEH A;  2QQB A;  1WIE A;  4C92 D;  4J6W A;  4J7F A;  2HCK A;  4FW1 A;  1TS9 A;  4BE1 A;  1ZUY A;  2G3R A;  5EC7 A;  1LVK A;  5CKE A;  2LNV A;  4HT8 A;  5GAN d;  2DL4 A;  2K3B A;  2A08 A;  1MV3 A;  3JB9 F;  5LJ5 j;  4F7U G;  3TCJ A;  3SWN A;  6AT1 B;  2YLB A;  2DET A;  3OYL A;  3HHT B;  3J7A F;  2FG0 A;  1YFN A;  2HBP A;  4ZGE B;  4CC7 A;  1CSK A;  2KRO A;  3L2Q A;  4M7D G;  3OW2 S;  1KD1 U;  2WSE E;  3VS5 A;  4ZTF A;  1QVF P;  3M54 A;  3HKS A;  3OYY A;  4BY6 B;  1CKB A;  1WHK A;  4FCY A;  2YUQ A;  2FZG B;  3LW5 E;  2LC4 A;  2LQ8 A;  2X4W A;  2YXY A;  4M78 G;  3JRZ A;  1PD0 A;  3CC7 A;  4C8Q A;  4A4H A;  3CC4 T;  2K3X A;  4ATO A;  2BE9 B;  3GF5 A;  3G1J A;  3EHR A;  5GAN 7;  2EVR A;  3OY9 A;  2EQK A;  4J5Y A;  5GAN g;  2DL3 A;  1M5Q 1;  1YJN A;  3I55 T;  1VQ4 A;  1MV0 B;  5KCH A;  1UGR B;  2COY A;  5A2Q E;  2YSQ A;  5GAN j;  5KYX A;  1QVF A;  5CR2 A;  4RCB A;  1AWW A;  3MP1 A;  1BCO A;  1OU9 A;  1M1K C;  2DA9 A;  4OMO A;  4KH1 B;  3CCV Q;  1VUB A;  4M7D A;  2CYZ B;  3A8G B;  2KY9 A;  1M3C A;  1OUL A;  3KFV A;  3QWY A;  2BUD A;  4PJO F;  1F1B B;  1ARK A;  1ZLM A;  5HK3 A;  4C5E A;  5ECA A;  1KD1 R;  3DB3 A;  2JTM A;  2ZPF B;  2J6K A;  4AFZ C;  1NPP A;  1YP5 A;  5FU6 C;  5LJ5 e;  1IZ6 A;  3G71 A;  3V8K A;  4E2F B;  2RD1 A;  1VQ8 T;  2GNC A;  1FX7 A;  4KRT A;  1KC8 C;  3ME9 A;  2D1X A;  3CCM T;  5HK0 A;  3CC7 T;  4V2S A;  4XAX B;  2GCX A;  2DVJ A;  4FYV B;  1KHI A;  3L2Z A;  4C5G A;  1QVF S;  3OYH A;  4XQ3 A;  2P0K A;  2Z0W A;  1LPL A;  2DJZ A;  4N0A A;  2DXU A;  1U8R A;  3M58 A;  1N9R A;  3WVD B;  5GAN 4;  4J9H A;  1W70 A;  3VS6 A;  1U06 A;  3CCJ Q;  2EQJ A;  5C0M A;  3G6E Q;  2DZC A;  3BDU A;  1UHC A;  1PSE A;  3CCV A;  1RLP C;  2ABL A;  2AK5 A;  3EGU A;  2MIO A;  2RHI A;  2OTL T;  4HVU A;  3CMA T;  1VQ5 Q;  3CBM A;  3PNW C;  3AT1 B;  4M75 B;  5I21 A;  3JCM b;  4QQD A;  4PKC C;  1VQP T;  4DBQ A;  3TEE A;  1GCQ C;  4F7U E;  1EIF A;  3VS7 A;  1M90 U;  4IIO A;  3CXC S;  2NYS A;  2LZ6 B;  4FSS A;  4EMH A;  3M0S A;  4D8K A;  4C8Q G;  4JS4 A;  2LQN A;  1M8V A;  2LVM A;  2DTO A;  2EBP A;  1IGU A;  2LJ1 A;  2JUF A;  2MF2 A;  3E2U A;  2M0O A;  2DXB A;  2E12 A;  3X25 B;  3CCM A;  3JCM J;  3MPU B;  4RTY A;  7AT1 B;  1ABQ A;  2EQI A;  1R77 A;  3UT1 A;  3HFO A;  2JOY A;  5D6W A;  1PD1 A;  2R57 A;  1UGV A;  4M75 C;  2M9U A;  1RUW A;  2C06 A;  1RAE B;  4IUT A;  1G3W A;  5KYN A;  2J7I A;  2EKH A;  2MMP A;  3HPW A;  5GAM f;  2GQV A;  3SWN C;  2XG8 D;  4RTT A;  2DEU A;  3C12 A;  2M51 A;  3OSV A;  1XOV A;  4E7H A;  1X2K A;  1YJW Q;  2E1H A;  3NTK A;  1VQO Q;  1W2B P;  3ZL7 C;  4LDY A;  3FEO A;  2AKL A;  2RQU A;  1RAC B;  2MYS A;  3S3O A;  2DBM A;  4F7U A;  3MEU A;  2FEI A;  2K6D A;  4EPC A;  4K11 A;  2HAX A;  2ZPH B;  1FYN A;  4M78 C;  4J9F A;  4CC4 B;  3BW1 A;  5GAN 6;  1WJR A;  5D6X A;  3P8H A;  4FM4 B;  2NUT B;  1NJI U;  2XD0 A;  3KUF A;  4BD3 A;  4B9X A;  3RMS A;  4AMC A;  3JCM Q;  1K8A R;  3MEA A;  5HCK A;  3CPW P;  2QGF B;  1SHF A;  1AZE A;  1WZO A;  3U23 A;  1RAG B;  4M7D D;  1A0N B;  1PG5 B;  2DLP A;  2DO3 A;  5FRO A;  1M90 C;  4RG2 A;  4OVA A;  2DD4 A;  2KBT A;  1UGP B;  4Y92 A;  3SB2 A;  1QWE A;  4E7Z A;  4AG1 C;  1UGQ B;  4DBR A;  2RHX A;  4M77 A;  5D6Y A;  4JRP A;  1W2B S;  4FSX A;  3N5B B;  1Y57 A;  1VQM Q;  3CC2 T;  1ZSZ B;  2KAF A;  2QQR A;  1ZUU A;  1N27 A;  3EG3 A;  4A53 A;  2A28 A;  3CCU T;  2CUB A;  1ZBX A;  2BE7 D;  3HRU A;  4J9C A;  2K79 A;  3EGX B;  5GAN 8;  1ZX6 A;  3SHW A;  1K1Z A;  4OMF B;  4E7S A;  3MET A;  4RCC A;  4X1V A;  3JCM c;  1T0H A;  3LLR A;  4KH0 B;  2ZZD A;  3OSS C;  3CCL Q;  1DJ7 B;  2I0N A;  3M53 A;  4Z89 A;  2DRK A;  2RM4 A;  1RAD B;  3HP9 A;  1UG1 A;  1YIJ T;  2KK4 A;  2P0Q A;  3V8J A;  1ZSG A;  4JJD A;  2YLC A;  3I5R A;  1VQ7 A;  2ZPG B;  1ZA1 B;  1N9S A;  1NLP C;  1VQ9 Q;  1W6X A;  5J39 A;  2RK2 A;  4OB2 B;  3X20 B;  3RNJ A;  1Y7X A;  3OW2 A;  2RQW A;  3CCR Q;  2XDD A;  1ZHI A;  4LDU A;  4JJN K;  2JTF A;  4FL6 A;  3FB9 A;  1M2V B;  5CIU A;  3JV3 A;  2DZ9 A;  1Y96 B;  3OBY A;  1QWF A;  2QQS A;  2MAM A;  2DNU A;  3RDV A;  1IB8 A;  1I1J A;  4M75 D;  1LCK A;  3RKW A;  3PT9 A;  2ZAE A;  4Z8A A;  1SRM A;  3ASK A;  2E10 A;  1YI2 T;  4RTX A;  1UEB A;  5A0G A;  5LJ3 f;  3FJP A;  3SFM A;  1SSF A;  2GF7 A;  3QHS A;  1H3H A;  2FPF A;  3P8D A;  1PSF A;  4C92 A;  1UE9 A;  4E7L A;  1VQN A;  3CQT A;  1VQN Q;  4LE9 A;  4OB0 B;  4XU1 A;  5GAN e;  2IPO B;  3V7R A;  2EIF A;  1K8A U;  2KRN A;  5GAN 5;  2CT3 A;  3QG1 A;  4GBQ A;  2KXC A;  3S3N A;  1B3Q A;  1KD1 C;  1MHN A;  3JCM f;  2NUT A;  2DK3 A;  5CVI A;  4NOY A;  2VGN A;  2DYI A;  4EMK C;  1G8X A;  1S72 T;  3I56 Q;  4KBM B;  2QDL A;  1QCF A;  5GAM g;  1KG1 A;  2DL8 A;  3EAE A;  4FYY B;  3VYG A;  3I55 A;  4J9B A;  1Y0M A;  5HKC A;  3BFM A;  4PLI A;  4MMK A;  2CP5 A;  1KQ2 A;  1X6G A;  2CZ6 B;  4OML A;  3FJ5 A;  2QEX A;  2ROT A;  4C0F A;  3MEW A;  1U3O A;  1E7O A;  3NMZ C;  5IHI A;  4OMP A;  1Q86 R;  3MEV A;  3PFS A;  1BBZ A;  2LCL A;  4LDV A;  1I81 A;  2L8D A;  2FL7 A;  1ZA2 B;  3EGD B;  4DOV A;  2I2L A;  1Q86 U;  2ATC B;  3MO8 A;  2D8J A;  2DKG A;  5DY9 A;  1MMD A;  4ANJ A;  2KEA A;  2YUO A;  2F5T X;  1JU5 C;  1KQS A;  3FDR A;  1TU0 B;  4M77 E;  1IGQ A;  3NFC A;  2KE9 A;  4LXC A;  1PNJ A;  3T9N A;  3MHX A;  3F70 A;  3GNF B;  4KGZ B;  1VQ4 Q;  1R0B G;  3FRN A;  2KXD A;  3CMA A;  1M8M A;  4ZNX A;  1FMV A;  1OV3 A;  2P0P A;  1OU8 A;  4JRK A;  4AFU C;  5LJ5 f;  3JB9 J;  2RQR A;  2QEX Q;  3C95 A;  3M9Q A;  3UPU A;  5GAN h;  3OYI A;  4JLI A;  2E5Q A;  2RA2 A;  4C92 B;  2RB6 A;  5KYU A;  3VS2 A;  3G71 T;  4F17 A;  2DER A;  4XTX A;  5CO7 A;  2M1H A;  3OMG A;  3LGL A;  2X4X A;  5CK9 A;  3MCA B;  3TRE A;  2FO0 A;  1I0C A;  1VQL Q;  2QAS A;  4B9W A;  1TSF A;  2XMF A;  1QVP A;  5CQY A;  2JT4 A;  4EDU A;  5KYW B;  3OMC A;  1WPY A;  5AT1 B;  5IT9 E;  4M7D C;  4M7A F;  5GMK m;  3X26 B;  5FW9 A;  1OPL A;  1SHG A;  4M75 E;  1BIA A;  4QQG A;  3CPW A;  1TXQ A;  1TWB A;  4BAC A;  1NEB A;  1WXU A;  3A8H B;  4BY6 C;  3DLL A;  2JZ2 A;  1YJW A;  1XJW B;  3EFO B;  1N8R U;  4M7D B;  3LYI A;  2J06 A;  2X3W D;  3A8O B;  2DYB A;  1VQ6 Q;  3CCQ A;  4FU6 A;  1RI0 A;  3D7S B;  3H6Z A;  1G3Y A;  1KK7 A;  2AZS A;  3EH2 A;  2MOX A;  1BK2 A;  3C0C A;  1VQ7 Q;  5KYY B;  4E7K A;  4JPB W;  1MMA A;  1D0Z A;  8AT1 B;  1YIT A;  1PKS A;  1AT1 B;  2NLU A;  2EJG A;  1D1B A;  3MP6 A;  5GAM h;  1Q7Y U;  2HBW A;  3H0I A;  3J80 E;  5GAO m;  2K3Y A;  2DL7 A;  3OYD A;  1YHQ T;  4PJL A;  1YHQ A;  3A8M B;  2PZ1 A;  2JJ9 A;  4PFP A;  3EG0 A;  2A3L A;  3RIR A;  2JW4 A;  4P5N A;  4N0A C;  4QVZ A;  5CKH A;  1FXX A;  2XI9 A;  4X9C A;  1WXT A;  2CSI A;  2E64 A;  4QW2 A;  1IRE B;  3QSU A;  2AIR B;  3QUI A;  3CCE A;  3EH1 A;  1BI2 A;  4QQ6 A;  3CCE T;  1BIB A;  1ABO A;  1TUD A;  3QPH A;  4J83 A;  1UUE A;  3EFR A;  2HEQ A;  1O9S A;  4E6R A;  2X9H A;  4MZM A;  2YHT A;  1VQ6 A;  3JCM W;  2RNA A;  2COZ A;  2LQW A;  3G4S A;  1UHF A;  3CME A;  2L3Q A;  3QJ6 A;  4C0D C;  2BIV A;  3EG2 A;  4HA8 A;  4C92 F;  4F7U B;  4RMO A;  2O2O A;  2RH2 A;  1K9M U;  5CKD A;  1FWZ A;  3QWX X;  5FRM A;  5GAO p;  2BZ8 A;  1YIJ A;  2VKN A;  1VOM A;  1X6O A;  1NJI R;  2K57 A;  1PHT A;  1RI9 A;  5LJ3 j;  1H8K A;  3M0U A;  2CH4 W;  1NBE B;  1I4K 1;  2DMO A;  2O4X A;  1BB9 A;  5D7U A;  2QA4 A;  2HMA A;  1K0S A; 
#chains in the Genus database with same CATH homology
 3OB9 A;  1VQM A;  2OTJ A;  5GAM e;  4EPC A;  4M78 D;  5GAO l;  3HRT A;  2HAX A;  4C8Q E;  3CCJ A;  2ZPH B;  4EMK A;  5FU7 B;  4M78 C;  4ZGJ B;  4M75 A;  5CCA A;  2EJF A;  3BW1 A;  4FT2 A;  3PGG A;  5GAN 6;  1VQ8 A;  1WJR A;  2Y90 A;  3SD4 A;  3VYH B;  2X35 A;  1NPR A;  1WQW A;  4D6W A;  1VQN T;  4MDX A;  5I2M A;  3QDR B;  5D6X A;  2O01 E;  1B34 A;  3P8H A;  2VXE A;  4FM4 B;  4ELZ C;  4BDZ A;  1NJI U;  1BI0 A;  1ZQ1 A;  2QDY B;  3KUF A;  4BD3 A;  4N4I A;  5FU6 B;  4B9X A;  3OBW A;  2MI6 A;  4XU3 A;  4IUQ A;  3RMS A;  4WF2 A;  3CEY A;  3UDC A;  4M77 G;  3VU3 C;  3JCM Q;  3MEA A;  4L59 A;  4E7I A;  4M7A B;  2CKK A;  2DVE A;  4M7D D;  1Q82 U;  4Y91 A;  5HY6 A;  2DO3 A;  2XHC A;  5FRO A;  1K8A C;  1QP3 A;  1K73 C;  3VUB A;  4RG2 A;  3FIF A;  3KXT A;  1M90 C;  4JDS A;  4OVA A;  2DD4 A;  2RJC A;  1UGP B;  3R6O A;  2XKO C;  3E9G A;  3SB2 A;  4M77 F;  3OYG A;  4O5V A;  2MWO A;  5LL6 S;  1UGQ B;  3OYA A;  2RHX A;  4M77 A;  2PU9 B;  5D6Y A;  3QXE B;  2A7Y A;  4XK8 E;  5CQX A;  4JRP A;  2X4Y A;  1W2B S;  4FSX A;  3GIB A;  1H64 1;  3N5B B;  4TVR A;  4BE0 A;  4PJO C;  3CC2 T;  1VIF A;  3OYK A;  4BI3 A;  3OQ5 A;  2KAF A;  2QQR A;  2RHZ A;  4C0G A;  1N27 A;  4IUV A;  4A53 A;  5GAN 2;  3CXC A;  4OF1 A;  3OS5 A;  3CCU T;  1WJS A;  1ZBX A;  3OYB A;  4ZN3 A;  3HRU A;  2EQU A;  4Z02 A;  5GAN 8;  1JB0 E;  4L6V 5;  4C8Q C;  2RJD A;  3RKX A;  4DQ2 A;  4OMF B;  4L5G A;  4JUV A;  4HT9 A;  3MET A;  4RCC A;  3JCM c;  5GMK i;  2HNI A;  5L8R E;  2R58 A;  3LLR A;  2QA4 T;  1X01 A;  1BI1 A;  3L2V A;  3C94 A;  1OZ2 A;  2V8I A;  3L1A A;  4OGE A;  2ZZD A;  3OSS C;  2JN0 A;  4BI4 A;  1DJ7 B;  2ZCF B;  2LT1 A;  3M53 A;  4PL6 A;  3GP8 A;  4C8Q B;  3CCS A;  4M77 D;  3CPW S;  2RM4 A;  2XDB A;  3CCS T;  5DLQ E;  1D3B A;  2LT4 A;  2K5L A;  3HP9 A;  2D6F A;  1YIJ T;  5FLX E;  1S72 A;  2KK4 A;  2P0Q A;  3V8J A;  3VKI A;  5C6S A;  2RJE A;  2YLC A;  4J7I A;  4DOW A;  4II1 A;  1VQ7 A;  1LJO A;  4PJO B;  3JCM g;  2LQK A;  2ZPG B;  4M78 B;  1N9S A;  5GAN 3;  5J39 A;  4ME7 A;  2RK2 A;  3RMQ A;  1JJ2 S;  4OB2 B;  1VQ5 A;  3M55 A;  3VJP A;  3CBP A;  4MML A;  1TH7 A;  5LJ3 d;  3L2U A;  3X20 B;  3Q1J A;  1P92 A;  2DIG A;  3OYJ A;  1Y7X A;  3OW2 A;  2DXT A;  2XDD A;  1BI3 A;  2FYK A;  1ZHI A;  4LDU A;  3OYE A;  1XTD A;  3UWN A;  2JTF A;  4FL6 A;  4JJN K;  1QVG A;  3FB9 A;  2L3R A;  4IUR A;  2PQW A;  5CIU A;  3RUX A;  3JCM h;  2KSS A;  3FC3 A;  1U1S A;  2DZ9 A;  3GPL A;  3NTH A;  3RES A;  1Y96 B;  1BKB A;  3CD6 T;  3OBY A;  2RI5 A;  3PMI A;  2QQS A;  2JNG A;  4OP0 A;  2MAM A;  1X75 C;  4KUD K;  5IN1 A;  4N4G A;  2OTL A;  2XK0 A;  2E6N A;  3SWN B;  1YJ9 A;  4M75 D;  1M4Z A;  2QTX A;  3O8V A;  1HK9 A;  1OYX A;  1JJ2 A;  4XU0 A;  2PUO B;  5A0L A;  4M7D F;  4C0Z A;  3G6E A;  3JB9 G;  4F7U F;  1Y07 A;  2PVG B;  3RKW A;  3PT9 A;  4M78 E;  3VV0 A;  4R56 A;  1UGS B;  1I5L A;  1LOJ A;  1YJW T;  4C0D B;  1VIE A;  4C92 E;  3A8L B;  3DKM A;  2D9T A;  2FB7 A;  5GAN f;  2OAU A;  4BI8 B;  3V7C A;  3ER0 A;  3ASK A;  4XTU A;  2DD5 A;  2L5Q A;  2E10 A;  5M9O A;  3KBG A;  1YI2 T;  1UEB A;  3OYN A;  5A0G A;  5LJ3 f;  3FJP A;  4M77 C;  3SFM A;  3C4S A;  1SSF A;  2BKD N;  2GF7 A;  4JRI A;  5FRN A;  2F69 A;  3L2R A;  2LDM A;  3QHS A;  3QKJ A;  1K73 U;  1XQH A;  4C5I A;  3QO3 A;  4DA4 A;  3M57 A;  4E47 A;  3P8D A;  1PSF A;  4ELY C;  4C92 A;  4ZTJ A;  4E7L A;  1VQN A;  5GAM j;  1VQK A;  4OB0 B;  4XU1 A;  4QVD A;  5KH6 A;  5GAN e;  2WAC A;  3V7R A;  3OA6 A;  2EIF A;  5GAO n;  2H3J A;  5CAI A;  4C8Q D;  1K8A U;  3QZ5 B;  5GMK h;  5GAN 5;  3CCV T;  3QG1 A;  3S3N A;  1VQL T;  1M9S A;  1QVG S;  4PLL A;  2DTH A;  4VUB A;  1VQL A;  1M1K U;  2EFI A;  2YRV A;  4EMG A;  3CCL A;  3OYF A;  2KDS A;  1KD1 C;  1MHN A;  3JCM e;  3JCM f;  3OYM A;  2RHY A;  1B34 B;  2DK3 A;  1W2B A;  1AHJ B;  5CVI A;  1U1T A;  3URG A;  2LRQ A;  2VGN A;  4NOY A;  4EMK C;  3JCM P;  5DM7 R;  1S72 T;  2FHD A;  3J81 E;  1QW1 A;  4PJO G;  5J3B A;  4KBM B;  4BE2 A;  1JRI A;  3CD6 A;  2VUB A;  5LJ5 d;  5GAM g;  3RER A;  1KG1 A;  4LD9 K;  4XTV A;  2RK1 A;  3EAE A;  2DXC A;  2L89 A;  3VYG A;  4IUP A;  3VUZ A;  3I55 A;  3L2W A;  2M16 A;  3FLG A;  2K2V A;  2VV5 A;  3PIO A;  2PVO B;  1KQS S;  3CCU A;  2RI3 A;  4FIB A;  2AHJ B;  1Y71 A;  1KHC A;  1YBY A;  2EAY A;  2HD0 A;  3OS1 A;  2O4X B;  2PVD B;  4NL2 A;  5HKC A;  5AYF A;  3BFM A;  5FU7 C;  3NTI A;  1NZ9 A;  4KUI A;  1GXI E;  4PLI A;  2RHU A;  4MMK A;  1KQ2 A;  2CZ6 B;  2E6Z A;  4Y28 E;  3V7S A;  3M4G A;  2QEX A;  3LWH A;  4C0F A;  2D0Q B;  2EWN A;  3MEW A;  2DIQ A;  1MGQ A;  4MZP A;  4NS5 A;  4C92 C;  1BYM A;  4QVC A;  4HCZ A;  3ZEH A;  2QQB A;  2ZPE B;  4J6Y A;  4C92 D;  2ZPB B;  4J6W A;  4J7F A;  1VQ6 T;  4M75 F;  3CCL T;  3HL8 A;  4XTW A;  3MEV A;  2G3R A;  4C5H A;  4BE1 A;  3PFS A;  2LCL A;  4LDV A;  2PUK B;  1I81 A;  2LX9 A;  5CKE A;  3CCJ T;  2HQX A;  2L8D A;  2FL7 A;  2LNV A;  4HT8 A;  5GAN d;  3G6E T;  5IAY A;  1K9M C;  2X4J A;  4DOV A;  2I2L A;  4KUL A;  2B8A A;  1Q86 U;  3QJY A;  4OB1 B;  5LJ5 j;  1VQ7 T;  3MO8 A;  1VQK T;  4A4E A;  4F7U G;  3JB9 F;  2DKG A;  3TCJ A;  3SWN A;  3QYG B;  2YLB A;  5DY9 A;  2RO0 A;  3OYL A;  2FVU A;  4XTZ A;  1YJ9 T;  3JB9 I;  3V8L A;  1VQ9 T;  1VQ5 T;  3QZ9 B;  2VC8 A;  3HHT B;  3WVE B;  4PJO D;  2DTI A;  2VGM A;  1VQ9 A;  3S6W A;  2F5T X;  2IVW A;  1KQS A;  3J7A F;  3FDR A;  4M77 E;  4ZGD B;  1D3B B;  2HBP A;  3NFC A;  4YTL A;  1G3T A;  1Q86 C;  4ZGE B;  2CZ7 B;  2QQ9 A;  3GNG A;  3ZBD A;  3CCR T;  2JVV A;  2CS7 A;  4ZN1 A;  2ZGW A;  1VQP A;  3M5A A;  4X34 A;  3T9N A;  3MHX A;  3L2Q A;  3F70 A;  5GAO q;  3P8B B;  3GNF B;  4OGC A;  4CRI A;  3S3M A;  2XD0 A;  4M7D G;  3OW2 S;  1KD1 U;  2WSE E;  4ZTF A;  3FRN A;  4M78 F;  3CCQ T;  2EKO A;  4M78 A;  3M54 A;  2RJF A;  2K4Y A;  3HKS A;  3OYY A;  5CKB A;  4BY6 B;  3CMA A;  2F5K A;  2CZ0 B;  3TU4 K;  2P0P A;  4JRK A;  3X24 B;  5LJ5 f;  3HRS A;  3E9F A;  3JB9 J;  3LW5 E;  4HCC A;  2LC4 A;  3OS0 A;  1M1G A;  2EJ9 A;  2LQ8 A;  2X4W A;  3C95 A;  4GY5 A;  3HFN A;  4M78 G;  3JRZ A;  3CC7 A;  2CGH A;  3M9Q A;  3E1S A;  4C8Q A;  4A4H A;  3CC4 T;  2K3X A;  4ATO A;  2QXF A;  1JBM A;  3PMT A;  4M77 B;  3GF5 A;  4XTY A;  5GAN 7;  4E7J A;  3UPU A;  3PIP A;  1YIT T;  3OY9 A;  1Y96 A;  2EQK A;  3JCM d;  5GAN h;  3OYI A;  2XID A;  4J5Y A;  4JLI A;  5GAN g;  2E5Q A;  2ZPI B;  1M5Q 1;  2RA2 A;  4X9D A;  2RB6 A;  4C92 B;  3I55 T;  3G71 T;  1VQ4 A;  1YJN A;  3GOX A;  5KCH A;  1G3S A;  1UGR B;  1M1F A;  4XTX A;  5A2Q E;  5CO7 A;  5LJ5 g;  4BDY A;  5GAN j;  2M1H A;  5GAO r;  1QVF A;  5CR2 A;  3OMG A;  2QQA A;  4LD6 A;  4RCB A;  3LGL A;  4HKE A;  2X4X A;  4A4F A;  2E41 A;  3MP1 A;  5CK9 A;  3MCA B;  3TRE A;  3CC2 A;  1KC8 U;  5LJ3 e;  5CKF A;  1M1K C;  1VUB A;  4M7D A;  2CYZ B;  3A8G B;  4C92 G;  2KY9 A;  4B9W A;  4IUU A;  3INZ A;  4A4G A;  1VQO A;  5J26 A;  2P4T A;  1QVP A;  1VQO T;  2EQM A;  5CQY A;  3PTA A;  4A4K A;  2BUD A;  4PJO F;  4EDU A;  5KE3 A;  4M75 G;  3G4S T;  2R5A A;  3CME T;  3DB4 A;  4FT4 A;  2K5I A;  3OMC A;  3JCM V;  1WPY A;  5HK3 A;  3MP8 A;  4OB3 B;  4GLK A;  4C5E A;  5IT9 E;  2GFU A;  3JB9 D;  1Q7Y C;  4M7D C;  1I8F A;  3DB3 A;  4BB7 A;  4J8O A;  5GMK j;  3CC4 A;  2JTM A;  4M7A F;  4M7A C;  1W4S A;  4NL3 A;  2ZPF B;  3I56 T;  1NPP A;  3QII A;  5GMK m;  5FU6 C;  3X26 B;  5LJ5 e;  1IZ6 A;  1LNX A;  5A0D A;  3G71 A;  3V8K A;  4CI0 C;  5DLO A;  4M75 E;  1BIA A;  4KT0 E;  4LDW A;  4QQG A;  3A5Z B;  3SDZ A;  2EYQ A;  3CPW A;  2RD1 A;  1VQ8 T;  1FX7 A;  4BAC A;  3BY7 A;  2LTO A;  2KMT A;  3A8H B;  3DLM A;  4BY6 C;  3DLL A;  2JZ2 A;  5KE2 A;  3EFS A;  3CCR A;  1YJW A;  1KC8 C;  3ME9 A;  3CCM T;  5HK0 A;  3CC7 T;  4V2S A;  2GFA A;  4XAX B;  2GCX A;  2E70 A;  1N8R U;  4PJO A;  4C5G A;  1KHI A;  3L2Z A;  5I2S A;  4M7D B;  2RI2 A;  1QVF S;  3LYI A;  3OYH A;  4XQ3 A;  2P0K A;  3A8O B;  2KQW A;  2DJZ A;  3H8Z A;  2DXU A;  4N0A A;  5GMK l;  2MWP A;  3M58 A;  4FU6 A;  3JAM E;  3CCQ A;  1U8R A;  1N9R A;  3WVD B;  5GAN 4;  3LGF A;  3G7Z A;  2XDP A;  1RI0 A;  1R8O B;  3H6Z A;  1G3Y A;  3LX7 A;  2EQJ A;  5C0M A;  2DAQ A;  1N6A A;  1YCY A;  1KQ1 A;  1RL2 A;  2DZC A;  3BDU A;  3QYH B;  1VQM T;  1PSE A;  2OTJ T;  3CCV A;  3E19 A;  2CZ1 B;  3JB9 H;  4E7K A;  2RHI A;  2OTL T;  3CMA T;  2DEQ A;  1YIT A;  5GAM d;  2NLU A;  2EJG A;  1UB4 A;  4MDW A;  1NE8 A;  3MP6 A;  5GAM h;  3CBM A;  3PNW C;  1Q7Y U;  2XIC A;  1WJQ A;  5EG2 A;  3CBO A;  4M75 B;  3J80 E;  1YJN T;  1Q81 C;  5GAO m;  5I21 A;  2K3Y A;  4QQD A;  3JCM b;  2LCC A;  4PKC C;  3OYD A;  3QBY A;  4C8Q F;  4Q5W A;  4EMK B;  2WSC E;  1VQP T;  1N8R C;  3TEE A;  3M56 A;  1QP2 A;  1YHQ T;  4F7U E;  1EIF A;  2Y4X A;  1YHQ A;  3JCM X;  1YI2 A;  3A8M B;  1OI1 A;  1M90 U;  1G5V A;  3I56 A;  3L42 A;  2A3L A;  3RIR A;  4P5N A;  3CXC S;  4EMH A;  4BUG A;  4HCB A;  4M7D E;  4PJO E;  4N0A C;  4QVZ A;  1VQ4 T;  5CKH A;  4C8Q G;  1FXX A;  3OS2 A;  4JRQ A;  4JS4 A;  2XI9 A;  4X9C A;  3WXM B;  1M8V A;  2LVM A;  2DTO A;  4N4H A;  2E64 A;  4QW2 A;  4A54 A;  1IRE B;  3QSU A;  2QI2 A;  3QUI A;  3CCE A;  2DPP B;  2JUF A;  2MF2 A;  1BI2 A;  2M0O A;  4QQ6 A;  2DXB A;  4UC4 A;  3CCE T;  4M7A A;  1BIB A;  2E12 A;  3LWI A;  3AHU A;  3X25 B;  2IG0 A;  2QEX T;  3RKY A;  3LH0 A;  2K5F A;  3QPH A;  4J83 A;  2R5M A;  5KCO A;  3HSB A;  3CCM A;  4M7A D;  1OZ3 A;  3EFR A;  4RKU E;  5LJ5 h;  3JCM J;  1O9S A;  2V8K A;  2VYT A;  4PNO A;  4MZM A;  2WSF E;  5GMK e;  3UT1 A;  4M7A G;  2YHT A;  1WNL A;  3HFO A;  1VQ6 A;  2XU8 A;  3M59 A;  2JOY A;  5D6W A;  3JCM W;  4R55 A;  4IKF A;  2E65 A;  1NJI C;  3G4S A;  3CME A;  2R57 A;  3QJ6 A;  4M75 C;  4JLG A;  1V29 B;  4C0D C;  2BIV A;  2M9U A;  3JSC A;  4HA8 A;  4XU2 A;  2C06 A;  4J6X A;  4C92 F;  4F7U B;  4RMO A;  1WQ7 A;  1G3W A;  4IUT A;  3OYC A;  1O75 A;  1Q82 C;  2MMP A;  3HPW A;  2RH2 A;  5GAM f;  2GQV A;  1K9M U;  4M7A E;  3CPF A;  3SWN C;  2XG8 D;  5CKD A;  1FWZ A;  3BDL A;  4RG8 A;  3C12 A;  3OSV A;  5FRM A;  5GAO p;  1XOV A;  1YIJ A;  1Q81 U;  4E7H A;  1X6O A;  4LDX A;  2K57 A;  2KVQ G;  1XNI A;  2E1H A;  3NTK A;  1WGS A;  1HXD A;  4MZT A;  5LJ3 j;  5LJ3 g;  2VXF A;  3M4Y A;  4LDY A;  4O6J A;  1I4K 1;  5LJ3 h;  2V8J A;  3FEO A;  3X28 B;  2O4X A;  3GLX A;  4JS5 A;  2Y4Y A;  3ZFJ A;  3S3O A;  1H3Z A;  2HQE A;  2QA4 A;  4F7U A;  3MEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...