3MEWA

Crystal structure of novel tudor domain-containing protein sgf29
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
157
Chain Sequence
TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 157
sequence length 159
ec nomenclature
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mewA02
2RHIA 3NTIA 3OYHA 3OQ5A 3P8DA 4B9XA 3FDRA 3KUFA 4RG2A 1WJQA 5KE3A 3QIIA 2LCCA 2CKKA 2M0OA 5J26A 4BD3A 3MEUA 2RHUA 4C5IA 3MEVA 2L8DA 2DIQA 3QKJA 2E6NA 3QJ6A 3OYDA 2D9TA 3OMGA 1WJSA 2DAQA 3MP8A 2EQMA 2JZ2A 3F70A 4FL6A 3L2VA 3OS0A 3EAEA 3MP1A 2RO0A 4QQDA 3UWNA 4X34A 4E7HA 3LGFA 2QQRA 3PMTA 2M1HA 3DLMA 1RI0A 5CIUA 1MHNA 3DB4A 2RJDA 3PFSA 4BDYA 4LD6A 2X35A 4N4IA 3L2WA 2RJFA 4IUQA 1OI1A 4PLIA 2X4WA 1KHCA 5FRNA 2EFIA 3META 4IUTA 2R5MA 2EQUA 3MEAA 2E5QA 2L3RA 2BKDN 3QBYA 3OS1A 2R57A 3ASKA 2EQJA 1SSFA 3L2RA 3S3OA 5KCHA 2QQSA 4N4GA 4Z02A 4IKFA 3OYGA 2X4YA 3S3MA 3OYMA 3MO8A 5KCOA 3C4SA 4CRIA 3CEYA 3NTKA 2MWOA 5J39A 2M16A 2LVMA 4PL6A 2MWPA 4A4EA 4L59A 5IAYA 4E7IA 3OYAA 2R5AA 2RHZA 4IURA 2WACA 2K3XA 3O8VA 4BE2A 2LDMA 1XNIA 3OMCA 4QW2A 5IN1A 3UT1A 2RI2A 2RHYA 3BDLA 4PLLA 3S6WA 4OVAA 3OY9A 4E7JA 2G3RA 3OYEA 3GOXA 1OZ2A 2IG0A 5KE2A 2F5KA 5M9OA 4II1A 2GFUA 3OB9A 3OA6A 3E9FA 3FC3A 4ZTFA 4IUPA 3LX7A 1H3ZA 2YRVA 3LGLA 3ME9A 5FRMA 2JTFA 3LH0A 2LTOA 4IUVA 3SD4A 1WGSA 2RI5A 2K3YA 3H8ZA 3OYJA 5C0MA 2X4XA 3MP6A 4QQGA 1OYXA 2GF7A 3OS2A 5FROA 2LRQA 3OYCA 4C5EA 4EDUA 5D6XA 2RJCA 4UC4A 2HQXA 4E7LA 4FU6A 3DB3A 4IUUA 2L89A 2PQWA 3FEOA 3L2QA 2XK0A 3NTHA 3PNWC 1OZ3A 5C6SA 2O4XA 3PMIA 2HQEA 3E9GA 5D6WA 4E7KA 2GFAA 2RJEA 3P8HA 4A4HA 4BACA 3M9QA 4BDZA 2RI3A 4N4HA 2FHDA 4QQ6A 3OYBA 2BUDA 3OYNA 4ZTJA 3LYIA 4Q5WA 4B9WA 2EKOA 3FLGA 4A4FA 2B8AA 2XDPA 2EQKA 1G5VA 1N27A 2R58A 4NS5A 4QVZA 3MEWA 1WJRA 4C5HA 3OYFA 2NLUA 3OYKA 2DIGA 2VYTA 2RHXA 4BE0A 3L2UA 4BE1A 2P0KA 3ZEHA 3OYIA 5D6YA 3H6ZA 5KH6A 4GY5A 4C5GA 2BIVA 3L42A 4HCZA 3LLRA 3S3NA 3OYLA 4A4GA 3Q1JA 2O4XB
chains in the Genus database with same CATH superfamily
3M57A 3THKA 1PG5B 3KUFA 2O01E 5IXFA 4MDWA 4BD3A 1K8AR 2HL3A 3MEUA 2E1HA 1D3BB 1ABQA 3NFCA 2RO0A 5FU7B 2YSQA 3CCMT 5FLXE 2FZCB 2JVVA 1AWXA 2EFIA 2RK1A 2E5QA 4D8DA 3I56A 4RTZA 3CCLT 1VQ4A 2BKDN 2LT4A 3MKDA 1QKWA 3OYGA 3A8HB 4HXJA 2FVUA 1TSFA 2MWPA 4KBMB 1VA7A 4E7IA 3BDUA 3HRTA 2DJZA 1ZA2B 2RI2A 3G6EQ 2KXCA 2AIRB 3OY9A 4M7DB 4C8QG 4KUIA 5L23A 3H9NA 3E9FA 3KXTA 4OMOA 1O75A 3REAB 2EYXA 6AT1B 5KYXA 4PJOC 1LJOA 3CMEA 2FZKB 4AFSC 3CCUT 2VASA 2KYMA 2CUBA 1AEYA 4C92G 4EMGA 4IUUA 2LMJA 3FEOA 2DJQA 5GAOp 2MOXA 2P0QA 1K73C 5DLOA 2LJ3A 3OSVA 4BDZA 1W4SA 1Q7YC 2JTEA 1AZGB 3EH1A 1UGPB 4MZMA 3TSWA 3JCMV 1WPYA 2FPDA 1M1KC 2E6ZA 1D3BA 4XU0A 2EQKA 1VQ7Q 1EX4A 3SEMA 4Z89A 2D8JA 2ZPFB 3X28B 4PKCC 2ABLA 2JTMA 5KH6A 1HXDA 1VQOT 2X3XD 5LL6S 3QYGB 2HEQA 4JJCA 4M78B 1UFFA 2KSSA 4JPBW 4OB2B 2LP5A 4F14A 3FIFA 3ULRB 4JJDA 2HBWA 3QPHA 5J3BA 1YHQA 1XJWB 3VS4A 4M7DA 4XTYA 2DD5A 4KH0B 4LUDA 2ECZA 1RACB 2RJFA 1VQMT 1WIEA 4AT1B 1ZHIA 5GMKl 3RKXA 2FL7A 1EZZB 2DL4A 2PUOB 2ZGWA 1NJIC 3CC2Q 4PNOA 4EMHA 2VVKA 2MK5A 2JOYA 3HFOA 4CRIA 2MWOA 1M8VA 1IZ6A 3VS2A 2VUBA 3D7SB 4RTTA 4QW2A 3J80E 2RHYA 2K5IA 2CYZB 3OYEA 2CZ6B 4OF1A 2J6KA 1G3TA 5FW9A 1KQ2A 2YUNA 1Q81C 3TREA 4PJLA 1SG5A 4AMCA 1PM3A 1MUZA 5GAN3 1VQ8A 4J5YA 4F7UB 2DE0X 3ZFJA 3I55Q 2CS7A 2RJCA 4HKEA 4CC2A 3CD6Q 1UEBA 3DB3A 1M90C 2RB6A 2PQWA 4DEXA 2GGRA 5CQXA 4PJOG 1PRLC 2RQTA 2MCNA 1S72T 1GFCA 1QQJA 2DYBA 4QQ6A 1JXOA 4AG1C 2RQVA 1T0HA 1QP3A 2ZPHB 1AZEA 4M7AB 3C95A 2M51A 1D1BA 4HCKA 3GP8A 4EMKB 1VQLA 4C5HA 2KVQG 3HHTB 3G71T 2J05A 2DL7A 1VQNA 1SPKA 2DZ9A 1K8AU 2PZ1A 1VQKQ 2RHIA 2DMOA 3OYHA 1JBMA 4JZ3A 1S1NA 5GAN8 1QVFA 3OYDA 2QGFB 2LQWA 2V26A 2OJ2A 2AKLA 2VB6A 4EPCA 2VXEA 1VQPT 2ROLA 1YJ9Q 1J3TA 3L2RA 5KCHA 1UTIA 4AG2C 1FMWA 4F7UA 3C4SA 4HCCA 4ZN1A 5GAMg 5GAN7 2RQWA 1V1CA 2F5TX 3HSBA 2O9VA 1VYTA 2K3XA 2JW4A 1R8OB 5IN1A 4DBRA 1MMDA 1W2BP 1RADB 3QG1A 4P5NA 4M7AA 2A08A 1GCQA 1K1ZA 3EH2A 3G6EA 1YCYA 1I0CA 2X4XA 4EMKA 4OMMA 1N8RC 4JLGA 3JCMe 2FEIA 1VQ9T 2L89A 2W0ZA 1YNZA 4PJJA 3HP9A 1QVFS 1EIFA 2EGAA 5GMKj 3CXCP 2NUZA 2RI3A 9ATCB 4O5VA 1E7OA 3TEEA 2EIFA 1YITT 2L0AA 4F04B 1OX9A 2KY9A 2L3QA 4QVZA 2DBKA 3JCMW 1WHMA 1KC8C 2CP2A 3CCRQ 1WA7A 2E41A 5IXBA 4HCZA 4NL2A 2AHJB 1VQ7A 3OQ5A 2VV5A 2CKKA 4XTUA 5IT9E 2CT3A 2HNIA 1JJ2P 3NPFA 5KYNA 1U8RA 1I1JA 2HMAA 3X26B 3F70A 5CKHA 2KRMA 2V8IA 3OS0A 1X01A 4X34A 3PMTA 1KD1C 2RPNA 3L1AA 2GNCA 3CCSQ 3OS5A 2RH2A 2QQAA 5I21A 3RERA 5I2SA 4J9EA 3URGA 4L59A 1W2BA 2QI2A 4BE2A 3I5RA 3M0UA 1NBEB 4J8OA 3CC2A 4J9DA 3TVTA 1VQ6Q 3LWHA 5M9OA 4IUPA 2VC8A 4M7DD 1JEGA 5GAN2 2K4YA 2E3HA 1WGSA 3RMQA 2QEXT 1UDLA 2RI5A 4JJNK 2RNAA 4FW1A 3OYCA 3CPFA 2F2XA 2OTJQ 2H8HA 3CXCA 4OMQA 4RTXA 4OGEA 2GTOA 3VS3A 2EYQA 3CC4T 3I55A 4A4HA 4BACA 3U23A 4Z8AA 2AK5A 3E19A 3CD6A 5L8RE 2XKOC 1JU5C 2E3IA 2KNBB 5DLQE 3G1JA 3M53A 1WYXA 3PVQA 2R58A 2COZA 1QWFA 4KGZB 4JJBA 5FU7C 4KGVB 3C0CA 4D6WA 1NEGA 5AYFA 1Y57A 3WVEB 1R77A 3OYLA 1WLPB 1W2BS 3M5AA 2HBPA 3MEVA 4CC7A 4LE9A 3HRUA 1Y96B 2YWWA 1VQKA 3M4GA 4M78D 3LGFA 1NLPC 1JB0E 2DL8A 3SFMA 2E64A 1BU1A 3J81E 4ZN3A 1B34B 3RMSA 4M7DC 4FSSA 1BYMA 2QGGA 1NZ9A 1M3CA 1SSFA 1YWOA 3S3OA 2HKNA 2JXBA 1D0ZA 1RL2A 2D0QB 4N4GA 1SRLA 4BB7A 3OYMA 1IGQA 2DPPB 2NWMA 2DILA 2FYKA 4J6XA 1YJ9A 4WCIA 1YJWQ 2K5FA 3I56T 1C1AA 1Y71A 1ZBJA 2KGTA 2KT8A 4PJNA 3CCJT 5GMKm 5GAMf 1OU8A 1BIAA 4E7ZA 5HK3A 4JS4A 1YN8A 3A8OB 1MV0B 2K3YA 1KHIA 3A8LB 4QQGA 2DVJA 2LRQA 5D6XA 3CCMQ 1EFNA 2YLCA 2HAXA 1ZUKA 5CVIA 2K2VA 3QJYA 3KBGA 1UGRB 3OBWA 1ZUYA 4M75E 3VUBA 4BY6B 1TXQA 5HCKA 1PWTA 1YIJT 1UGQB 2HQEA 2HSEB 3CCLQ 1RI9A 4R0KA 4OMLA 1QWEA 1W70A 4RTYA 2DEQA 1K73R 1Y96A 3VKIA 2MI6A 2C0OA 5LJ5e 1B7TA 1N27A 4AFZC 1CKBA 3UA6A 4M7AD 1M1KR 1LNXA 1M30A 2Y4XA 1B34A 1HK9A 2MIOA 2MAMA 5GAMe 2O9SA 2JS0A 2X4JA 2CP7A 2CH4W 3CCRA 2LCCA 1X6GA 3CCUQ 4M75G 2GQVA 2EQMA 3CCEQ 4ZGJB 2QQ9A 4M7AF 3UF4A 3DLMA 2ZPIB 3O5ZA 2RQUA 1QVGS 4BDYA 4OMFB 4XU1A 4C0FA 1PRMC 2B86A 1D09B 3MEAA 3JCMg 2L3PA 1QKXA 3JCMd 3JAME 1WDXA 4Y91A 2EQJA 4LDVA 5GAOl 1QMCA 1YHQT 4C8QE 2X3WD 2X4YA 5GMKh 3EGUA 4HA8A 4M7DG 1WHJA 3X24B 2A0FB 3CCSA 3M58A 1H8KA 2EW3A 3QDRB 5GAMh 2XU8A 4PL6A 4OB3B 5IAYA 1NJIR 3V8LA 1TWBA 1XQHA 4PLLA 2P0PA 2XI9A 1TUDA 1RAGB 2LQ8A 4C92E 4M78E 2VXFA 2HKQB 2JTFA 4LD9K 4LDUA 3L2ZA 1QVPA 3SWNB 5LJ3e 4M7AC 2G6FX 4OP0A 1VQ6A 1GCQC 1D0YA 1PKSA 2KT1A 1Q81R 4EMKC 4Y28E 4A4KA 4M77B 5HK0A 4PFPA 2E4HA 2KAFA 4E7SA 4LN2A 2PU9B 5GAOq 1KG1A 2GFAA 2VGMA 3M4YA 1VQ8T 1M90R 2OTJA 1UHFA 1AWJA 4FYVB 4JRQA 2X9HA 1Q82R 1BKBA 2ATCB 5A0LA 1WJRA 3V7SA 3SHWA 2P0KA 4M78G 4FM4B 1GBQA 2M0YA 3LLRA 3A1PA 2KE9A 2H3EB 2MMPA 2DYIA 1C6VX 5DY9A 2RA2A 2AZVA 2DIQA 1VQNT 4AFUC 3CCVT 3CC7T 5KYWB 1CKAA 4FL6A 2F69A 4JUVA 1UGVA 4RTVA 1KJWA 3RIRA 2YXYA 2QQRA 3NGPA 1KFZA 3G4SQ 1WQ7A 5GJWB 2XMFA 2X35A 1OI1A 1WXTA 5GAOr 1X75C 2K9GA 2L3RA 4J83A 2F2VA 2NUTA 1ZLMA 3SWNA 2QQBA 2EBPA 3INZA 2K5LA 2CSIA 3NHNA 3X25B 1RAFB 2HCKA 1YP5A 4M77A 1KIKA 3M0TA 4FT4A 4KUDK 1ZX6A 4QT7A 2DXTA 5FWCA 1T3LA 2RMOA 4J6YA 2KI7A 2QA4Q 2DXUA 4II1A 2E65A 2GFUA 3PE0A 4F7UG 1JO8A 2LT1A 2WSEE 1QP2A 1YJWA 5FRMA 1Y7XA 4XAXB 2DL3A 4PJOE 3H8ZA 4ELYC 2LNVA 4FYXB 5I22A 1V76A 3G7ZA 3M55A 2I0NA 3VV0A 4M7AG 4RTUA 3AHUA 4JZ4A 1K73U 2PTKA 1TUGB 1MGQA 1X6BA 3CCMA 1W1FA 3JB9J 2MPXC 3OW2P 4FCYA 4B9WA 2A37A 5KYWA 2B8AA 3CCLA 2XIDA 4MMLA 3M0PA 2ESWA 4XQ3A 2LQKA 2CP5A 3H0HA 2KMTA 3ZEHA 4XK8E 1ZSZB 1NYFA 5GAN4 1KC8R 1E6GA 5KE3A 4Y92A 2OTLQ 4XTVA 1WQWA 2IIMA 3CCUA 1PD0A 5CIUA 4L6V5 4LD6A 2ROTA 3CCEA 1Y07A 1KD1R 1C0MA 2ENMA 1AWOA 2WSFE 2QXFA 3CMAT 1NJIU 2QQSA 1KQSP 3JCMf 4LXCA 1M1GA 4IURA 1PCXA 1N9SA 3GLXA 4KGXB 1VYVA 2SRCA 1YJNT 5LJ5g 2A7YA 1I81A 1UB4A 5LJ5d 2IG0A 4OGCA 3FC3A 4YTLA 1Q81U 4IIOA 1WFWA 3SD4A 4KH1B 5CKFA 3JCMJ 3CC2T 4RCBA 3RNJA 4LDYA 1K9MC 2JM9A 5GAMd 2D8HA 2DZCA 3H0FA 4ESRA 1M90U 1ZSZA 3L2QA 5EC7A 1Z9ZA 2YDLA 3OW2A 2PUKB 1M8MA 1D1AA 1BI2A 2K79A 3V7RA 3P8HA 3VS7A 1FX7A 1Q82U 2EWNA 1VUBA 1PD1A 1QCFA 1OULA 2QK0A 2ZPGB 3EG9B 5LJ5j 3CBOA 1XOVA 3ZL7C 5DM7R 4RUGA 4XU2A 2VYTA 2MF2A 1UGSB 2P84A 4JS5A 2PVGB 3GNFB 4MDXA 3MPUB 2WSCE 3H6ZA 3S3NA 1OQKA 4J9FA 5GAMj 4RG2A 1JQQA 1OPLA 1WJQA 2XICA 1X2KA 2CZ1B 1GRIA 2RHUA 2C0IA 5GAN6 1I5LA 2GTJA 1TS9A 1N6AA 2OAWA 3MP8A 4JLIA 1M9SA 4NOYA 3CC4Q 5LJ3g 5LJ3d 1ARKA 4CC4B 2V8KA 4R56A 3JCMh 1KQSA 4LUEA 1VQKT 1H92A 3HTRA 2EJ9A 3G4SA 2K6DA 2DTHA 1YCSB 3RBBB 3FJ5A 2V1RA 3R6NA 2GQIA 1OEBA 3MO8A 5KCOA 4GBQA 3NTKA 1U06A 1QCOA 2A3LA 2R5AA 4HCBA 2WACA 5GJVB 3OMCA 3S6WA 1JRIA 1FXXA 4BY6C 4HVUA 3QYHB 4FSXA 5IHIA 4ELZC 3CBMA 1OV3A 1YBYA 1YJ9T 2NUPB 5LJ3j 3PIOA 2YUOA 3EG9A 3OYJA 5C0MA 2QA4A 1ZSGA 3A5ZB 3EFRA 4QVDA 5CR2A 4JRPA 4E7LA 4FT2A 3NTHA 1VQ5Q 1G8XA 3WXMB 4E7KA 3J7AF 4M77D 4J9IA 4ZGEB 2P4RA 1SF9A 2C06A 3LYIA 4F17A 1P92A 2KXDA 2ED1A 5CKDA 3CCQQ 4OB0B 2SEMA 1PSEA 2HDAA 3PTAA 1AT1B 3OYFA 3CPWP 1HJDA 1CSKA 2E5KA 1KC8U 3CCJQ 4J9GA 2JJ9A 2EYYA 1ABOA 3NTIA 4M77F 4X1VA 2OAUA 4KULA 2H3JA 2X51A 4C5IA 3QWXX 2IPOB 3L2VA 2JZ2A 4OMPA 3GNGA 2YT6A 3UWNA 2PVOB 4Z88A 1OU9A 5GANe 1KD1U 1YIJQ 1RI0A 1FYNA 2BTTA 1D0XA 2OTLA 2HD0A 1W6XA 1JJ2A 2NUPA 3HL8A 3QBYA 2R57A 1U5SA 3JCMc 3SWNC 2EPDA 4D8KA 2ZPEB 2FPFA 4M77C 2KBTA 1TG0A 2AT1B 2JM8A 4BI4A 2DA9A 4OVAA 5FU6B 2DK3A 4E6RA 3GOXA 1NM7A 5KE2A 1FWZA 1AD5A 1Q95G 3LX7A 1YI2Q 4XTXA 2DERA 4FYYB 1Q86C 3CXCS 1QCNA 4IUVA 1WX6A 5LJ5f 1OYXA 2GF7A 1OOTA 4PFZA 2JN0A 5IHNA 4C8QF 2EVRA 5HY6A 2XK0A 1U1SA 2OI3A 1VQ4T 2CDTA 1BIBA 1UJ0A 4X9DA 1MNDA 2MYSA 3MHXA 3RR6A 2QTXA 1JJ2S 5IHKA 2DIGA 2RHXA 4BE1A 4O6JA 1PSFA 3T9NA 1M2VB 2YUQA 1LVKA 3JV3A 3Q1JA 3M54A 3CMET 3FDRA 1GXIE 3M59A 5J26A 4F16A 1NPRA 2L8DA 4TVRA 1Q7YR 1QW1A 1M3AA 4J9BA 1UECA 4JRIA 2J7IA 2M1HA 2QASA 1X43A 4M7DE 5HKCA 2RJDA 3EGDA 1KQ1A 1X6OA 4J7FA 2KRSA 4PLIA 1KHCA 4C0GA 5ECAA 2EAYA 1WHKA 3M56A 3CC4A 1R0CB 4PFOA 5LJ3f 2ED0A 2DTOA 5IH2A 4EIKA 3QZ9B 1NYGA 2BZXA 1UG1A 2J06A 3A8GB 2PNIA 3PIPA 4M4ZA 4FYWB 5LJ5h 1IREB 2FB7A 1BCOA 4MZPA 5A0DA 1OZ2A 3HPWA 2CP3A 3VJPA 1B3QA 1PNJA 4M77G 4ZNXA 1T3SA 3QUIA 1BI1A 3CCVQ 3CC7Q 3P8BB 1RUWA 2JS2A 3LH5A 5FROA 4DBQA 3DKMA 3QO3A 1BCMA 3I35A 4DBHA 2COYA 2RM4A 4ME7A 1M2VA 1YJWT 1VQOQ 4XTZA 5CO7A 1ZSZC 2CT4A 3V8KA 2JMAA 3PMIA 4PK4A 2E12A 1WHGA 2BZ8A 2KDSA 3OYNA 2QAZA 1RLPC 1VQ5A 2NUTB 3FLGA 2K3BA 3QZ5B 1G5VA 3EG2A 4B6MA 3I9QA 2DKGA 4PJOF 3L2UA 2CSQA 4MMKA 4RKUE 4BI8B 1VQMQ 4M75B 1IO6A 4C5GA 1A0NB 1F1BB 3L42A 2ZZDA 3CCQA 1N5ZA 2D1XA 4AFQC 2LJ0A 3VUZA 1LOJA 2QG9B 1AVZC 3RESA 3KFVA 1SEMA 2DF6A 2M0OA 3CCJA 2E6NA 3A98A 4V2SA 2D9TA 3FRNA 5GAOn 2Y4YA 1WJSA 2DAQA 2QDYB 1IHWA 2GCXA 1OPKA 2J6FA 3CQTA 1BI3A 4HT8A 1MV3A 5LJ3h 2BZYA 2FRYA 2XHCA 2YLBA 1MHNA 2RK2A 1RAEB 2LJ1A 3IQLA 2L3SA 2QTVA 3META 2LC4A 3PT9A 3MCAB 5I2MA 2R5MA 2KEAA 1YIJA 1VQLT 2O2OA 4RCCA 1E6HA 1RABB 3JB9H 4F7UE 1SSHA 8AT1B 2LVMA 7AT1B 1WNLA 5CKEA 3TSZA 2BE9B 3CCET 4GLMA 3JCMP 1S72Q 4RMOA 1WXBA 3OA6A 1KSWA 3AT1B 3H41A 3GPLA 3ME9A 4L5GA 4M7AE 2JT4A 2LX7A 5AT1B 4C8QB 4E47A 1RAIB 2M02A 3G71Q 1SHFA 3FB9A 1MMAA 2LX9A 1YI2A 3EG1A 2EGCA 5GMKi 2LQNA 2EYZA 2I2LA 1M2OA 2FPEA 4M75A 1G2BA 4DBFA 4OMNA 5D6WA 3TU4K 3E9GA 5CKBA 1K9MR 2K57A 2FHDA 2JMCA 2KYBA 4C92B 3VS6A 4ZTJA 3CMAQ 3EG3A 4J6WA 1M1FA 3QSUA 1AWWA 1I8FA 3VRYA 5GANg 5A2QE 3JSCA 5GANd 1TOVA 1IRXA 4CC3A 4CI0C 3VYGA 1H3HA 4ANJA 1QVFP 2CZ7B 2QYZA 2NLUA 2XG8D 4J9HA 3OYKA 1RLQC 1YJNQ 1JXMA 3QDFA 4GY5A 1K8AC 1VQPQ 1UHCA 1N8RR 3G6ET 4HVWA 1U3OA 1GFDA 5CAIA 1Q7YU 4IIMA 3QIIA 2CZ0B 3QKJA 1M1KU 3HRSA 4FW2A 1IGUA 2DM1A 4E7HA 1TH7A 5GANj 2DBMA 2CUDA 1SKUB 3EHRA 3VS1A 3OBYA 1M27C 2HSPA 3RUXA 3JCMX 3OS1A 1IB8A 3ASKA 4LDWA 4C8QA 4IKFA 2AKKA 5J39A 1VQ9Q 2A28A 2M16A 3BFMA 4QVCA 3OYYA 1VQ7T 2DFUA 2RHZA 2P4TA 1IHVA 3BDLA 3G4ST 3RKYA 3EFOB 4C92A 2DO3A 1FMKA 2COWA 2F5KA 3LWIA 1Q82C 2VKNA 4M78A 1YITQ 3LGLA 3LH0A 2LTOA 3OSSC 1U1TA 3EHQA 2L5QA 2M9UA 3MP6A 3N5BB 4DOWA 2DX1A 2VGNA 1TU0B 2HQXA 2EQIA 1V29B 1ZQ1A 3CC7A 3CCVA 1WXUA 3EFSA 1X27A 5CK9A 2QA4T 2KQWA 1AOJA 1MMNA 1VQOA 4PJOB 3BY7A 2DD4A 2XDPA 2LNHB 4N0AA 4A63B 3HKSA 1M5Q1 2OX7A 1K76A 5I11A 2GBQA 4LDXA 3PGGA 1YFNA 3UA7A 4JDSA 2JNGA 1VQMA 2L2PA 3QJ6A 3EGXB 5KYYB 3GIBA 3EAEA 3MP1A 2EJGA 5A0GA 2K7AA 3I55T 2PVDB 2FZGB 2YRDA 4JRKA 3VRZA 3CD6T 3EFOA 4J7IA 4N4IA 5FU6C 4WTOB 4DEYA 2RN8A 2EQUA 3C94A 5KYUB 2QEXQ 2A36A 3V8JA 2IVWA 2FG0A 1WZOA 3S3MA 1MNEA 1TUCA 2LCSA 3CEYA 4HT9A 4XU3A 2OTLT 3R6OA 1Y0MA 4X9CA 3HFNA 1UE9A 3NMZC 2LDMA 3UT1A 2ZAEA 3ER0A 2HZYA 1OX8A 4ZTFA 1NG2A 3DLLA 3E1SA 4VUBA 2KR3A 2YHTA 4PJOA 1RAAB 4XTWA 1S72A 1LCKA 1ZBXA 4LNPA 3JRZA 1D1CA 2DRMA 3SB2A 3OW2S 3FJPA 1AHJB 4K11A 3OS2A 1Q86R 1K9MU 8ATCB 1O9SA 3CBPA 2D0NA 4RG8A 5C6SA 4DOVA 3G71A 1VOMA 3RKWA 3TCJA 1BK2A 4C0DC 4DQ2A 3JCMb 4Q5WA 2V1QA 5GAOm 2EKOA 3EGXA 5KYYA 4A4FA 2Y90A 3JB9D 1N8RU 3CMAA 2HQHA 2KROA 5GANf 2EGEA 3OYIA 1WHLA 4ORZA 4DA4A 1PHTA 4BI3A 2BIVA 1N9RA 3C12A 1UUEA 1X69A 2LCLA 3QWYA 1K0SA 3P8DA 2F2WA 5KYUA 4RTWA 4BUGA 2EKHA 1YJNA 4M75D 2DTIA 3VS0A 2V8JA 4GLKA 4ATOA 3UDCA 1VQPA 1X2QA 2BE7D 2LZ6B 1K9AA 1VYUA 4PJMA 1KQSS 1NE8A 5EG2A 2DVEA 3JB9F 4OB1B 4QQDA 3I56Q 1TTHB 2DLPA 1VQ4Q 3DB4A 3X20B 3PFSA 2ZPBB 4IUQA 2X4WA 2YRCA 2DETA 4FIBA 1G3SA 2DXBA 1VIFA 4M75F 1SHGA 4Z02A 3VYHB 2J6OA 1GBRA 1I4K1 3GF5A 4A4EA 4HVVA 1QVGP 3O8VA 4R55A 2DRKA 2G3RA 3CCRT 2EJFA 3CMEQ 1VQ9A 2CH4A 5GAN5 3PVLA 1H3ZA 1SRMA 2DL5A 2CP6A 4M7DF 3M0SA 1K0XA 1MMGA 1NEBA 3LW5E 4ZGDB 3BW1A 3BE3A 4C5EA 1PKTA 2E70A 1YITA 3I5SA 4FU6A 2DXCA 4C8QD 3QHSA 3PNWC 1B07A 4M75C 4A54A 4MZTA 2D6FA 2AZSA 3EGDB 1HYOA 4KT0E 2BUDA 5CCAA 3CCST 1PC0A 5GANh 1WHHA 2KK4A 2CP0A 3TQ7P 3ZBDA 1G3WA 4C92D 4NS5A 5FWBA 2RD1A 4BE0A 1M3BA 3VU3C 2JUFA 1ZA1B 4NL3A 1QLYA 4A4GA 2QDLA 3A8MB 2O4XB 1VQ5T 2Z0WA 1Z9QA 2F1LA 4C0ZA 1VQ6T 4B9XA 2XDBA 1YHQQ 1G3YA 1NPPA 1R0BG 2O31A 1VIEA 3CPWA 2XD0A 1UJYA 2RQRA 2O88A 3OMGA 4C92F 1M4ZA 4M78F 3CCQT 2XDDA 2FO0A 1I07A 3REBB 2OTJT 3RDVA 4WF2A 1H641 1IXDA 3L2WA 4KRTA 5FRNA 4IUTA 3UATA 4C0DB 1GL5A 1DJ7B 2NYSA 2VWFA 2KRNA 1K4US 1QVGA 2K2MA 4C8QC 1HSQA 1GCPA 4QKUA 1G83A 3SDZA 3V7CA 4M77E 2QEXA 1NLOC 3OYAA 3M0RA 1XNIA 4J9CA 4A53A 2CGHA 4E7JA 3UPUA 1I5OB 1VQ8Q 2E10A 5D7UA 3OB9A 2W10A 3JCMQ 2YRVA 3QXEB 4C92C 1Q86U 3GBQA 4M78C 1WI7A 2CREA 2DNUA 4EDUA 4UC4A 3MJXA 1ACMB 4E2FB 1XTDA 2EYWA 3JB9G 2YUPA 1BBZA 2RF0A 4F7UF 3CPWS 1OZ3A 5GMKe 2O4XA 2RJEA 3M9QA 1YWPA 1RAHB 4N4HA 3H0IA 1BI0A 3OYBA 1VQLQ 1ZUUA 1KK7A 3JB9I 1T0JA 3VS5A 2HL5C 3E2UA 2C0TA 2DEUA 1YI2T 1FMVA 1VQNQ 5KYXB 2FRWA 1BB9A 3MEWA 3M0QA 4PJOD 1HD3A 1LPLA 4N0AC 2ZCFB 3WVDB 5D6YA 5CQYA 3EG0A
chains in the Genus database with same CATH topology
3M57A 5GAMj 5CAIA 1Q7YU 3KUFA 2O01E 4RG2A 1W2BS 1WJQA 2XICA 3M5AA 2CZ1B 3QIIA 4MDWA 4BD3A 3MEUA 2HBPA 2RHUA 3MEVA 2CZ0B 5GAN6 1I5LA 3HRUA 3QKJA 1Y96B 1M1KU 2E1HA 1D3BB 3HRSA 1N6AA 1VQKA 3MP8A 4JLIA 3NFCA 3M4GA 1M9SA 4M78D 4NOYA 2RO0A 4E7HA 3LGFA 1TH7A 5FU7B 5GANj 1JB0E 3SFMA 2E64A 3CCMT 5FLXE 5LJ3g 3J81E 5LJ3d 4ZN3A 2JVVA 1B34B 3RMSA 4M7DC 1BYMA 2V8KA 3OBYA 2EFIA 2RK1A 3JCMh 4R56A 1KQSA 3RUXA 3JCMX 2E5QA 1VQKT 1NZ9A 2EJ9A 3I56A 3CCLT 1VQ4A 2BKDN 3G4SA 3OS1A 3ASKA 1SSFA 2LT4A 4LDWA 2DTHA 4C8QA 3S3OA 1RL2A 2D0QB 4N4GA 4IKFA 3OYGA 3A8HB 4BB7A 3OYMA 3MO8A 5KCOA 2FVUA 3NTKA 2DPPB 2FYKA 5J39A 2M16A 4J6XA 3BFMA 2MWPA 4QVCA 1YJ9A 3OYYA 4KBMB 4E7IA 1VQ7T 3BDUA 2A3LA 2R5AA 2RHZA 4HCBA 2WACA 3HRTA 2P4TA 2DJZA 2K5FA 3OMCA 3I56T 2RI2A 1Y71A 3BDLA 3S6WA 1JRIA 1FXXA 3G4ST 3OY9A 4M7DB 4C8QG 4KUIA 3RKYA 4BY6C 3QYHB 4FSXA 3CCJT 4C92A 5GMKm 2DO3A 2F5KA 5GAMf 3LWIA 4ELZC 3E9FA 3CBMA 1Q82C 1BIAA 3KXTA 5HK3A 4M78A 4JS4A 1O75A 3LGLA 3A8OB 1YBYA 2LTOA 3LH0A 1U1TA 3OSSC 1YJ9T 5LJ3j 3PIOA 4PJOC 2K3YA 3OYJA 1LJOA 1KHIA 2L5QA 2M9UA 3A8LB 3MP6A 3N5BB 4QQGA 4DOWA 5C0MA 3CMEA 3CCUT 2LRQA 2QA4A 2VGNA 3A5ZB 3EFRA 5D6XA 4QVDA 5CR2A 2YLCA 4C92G 2HQXA 4JRPA 5CVIA 4EMGA 4E7LA 2K2VA 2HAXA 4FT2A 4IUUA 1V29B 1ZQ1A 3FEOA 3QJYA 3CC7A 5GAOp 3CCVA 3KBGA 1UGRB 3OBWA 4M75E 3NTHA 3VUBA 2P0QA 4BY6B 3EFSA 1K73C 3WXMB 5DLOA 1YIJT 1UGQB 2HQEA 4E7KA 3J7AF 3OSVA 4M77D 4BDZA 1W4SA 5CK9A 4ZGEB 1Q7YC 2QA4T 2KQWA 1UGPB 4MZMA 2C06A 3LYIA 1P92A 3JCMV 1WPYA 1VQOA 2DEQA 1Y96A 4PJOB 1M1KC 3BY7A 2DD4A 2E6ZA 2MI6A 3VKIA 1D3BA 4XU0A 5LJ5e 2XDPA 5CKDA 2EQKA 1N27A 4OB0B 1PSEA 3PTAA 3OYFA 4M7AD 4N0AA 3HKSA 1M5Q1 1KC8U 1LNXA 2ZPFB 3X28B 4PKCC 2Y4XA 2JTMA 1B34A 5KH6A 4LDXA 1HXDA 1VQOT 1HK9A 3PGGA 3NTIA 4M77F 2MAMA 4JDSA 5GAMe 2JNGA 2OAUA 2X4JA 5LL6S 3QYGB 1Q86C 4KULA 3CCRA 2LCCA 4M78B 2H3JA 4C5IA 1VQMA 2KSSA 4OB2B 3QJ6A 3FIFA 4M75G 3GIBA 2GQVA 2EQMA 2JZ2A 3L2VA 4ZGJB 3GNGA 5J3BA 3EAEA 2QQ9A 3MP1A 3QPHA 1YHQA 3UWNA 2EJGA 5A0GA 2PVOB 4M7AF 3I55T 5GANe 1KD1U 2PVDB 3DLMA 1RI0A 2ZPIB 4M7DA 4JRKA 4XTYA 3CD6T 2DD5A 1QVGS 4BDYA 4PJOA 4J7IA 4OMFB 4N4IA 4XU1A 5FU6C 2RJFA 1VQMT 4C0FA 2OTLA 1ZHIA 5GMKl 3RKXA 2HD0A 2EQUA 3MEAA 3C94A 3JCMg 3JCMd 1JJ2A 2FL7A 3HL8A 3QBYA 3JAME 2R57A 4Y91A 2EQJA 2PUOB 2ZGWA 4LDVA 3JCMc 3V8JA 2IVWA 5GAOl 1YHQT 4C8QE 1NJIC 4PNOA 4EMHA 3SWNC 2X4YA 5GMKh 3S3MA 4HA8A 4M7DG 3X24B 2JOYA 3HFOA 3CCSA 4CRIA 3CEYA 3M58A 3QDRB 5GAMh 2MWOA 2XU8A 4HT9A 4PL6A 4OB3B 1M8VA 4XU3A 5IAYA 2OTLT 2ZPEB 3R6OA 1IZ6A 4X9CA 3HFNA 4M77C 2VUBA 3V8LA 1XQHA 2LDMA 4QW2A 3UT1A 4BI4A 3J80E 4PLLA 2RHYA 2K5IA 2CYZB 2P0PA 2XI9A 4OVAA 5FU6B 2DK3A 3ER0A 2LQ8A 3OYEA 3GOXA 2CZ6B 4OF1A 5KE2A 1FWZA 1G3TA 4C92E 4ZTFA 3LX7A 1KQ2A 3DLLA 3E1SA 4M78E 4XTXA 3TREA 4VUBA 2VXFA 3TU4K 2YHTA 2JTFA 3CXCS 1Q81C 4XTWA 1S72A 4IUVA 4LDUA 4LD9K 3L2ZA 1QVPA 3SWNB 5LJ3e 4M7AC 1ZBXA 4OP0A 3JRZA 3OW2S 1VQ6A 3SB2A 5LJ5f 5GAN3 3FJPA 1OYXA 1AHJB 2GF7A 4J5YA 3OS2A 1VQ8A 4F7UB 3ZFJA 2CS7A 4EMKC 2JN0A 2RJCA 4HKEA 4Y28E 1K9MU 4A4KA 4M77B 5HK0A 1UEBA 4C8QF 3DB3A 1M90C 1O9SA 2RB6A 2PQWA 2KAFA 3CBPA 2XK0A 5HY6A 1U1SA 5CQXA 4PJOG 1VQ4T 2PU9B 4RG8A 1S72T 5C6SA 5GAOq 1KG1A 2GFAA 4DOVA 3G71A 3RKWA 2VGMA 3M4YA 1BIBA 4QQ6A 1VQ8T 3CC4T 3TCJA 2OTJA 4C0DC 4DQ2A 3JCMb 1QP3A 2ZPHB 4Q5WA 4M7AB 3C95A 4X9DA 5GAOm 2EKOA 4JRQA 4A4FA 2Y90A 3MHXA 3GP8A 4EMKB 1BKBA 5A0LA 3JB9D 4C5HA 3CMAA 1WJRA 1N8RU 2KVQG 2QTXA 1JJ2S 3HHTB 3G71T 2DIGA 2RHXA 5GANf 4BE1A 3V7SA 4O6JA 1VQNA 2P0KA 2DZ9A 4M78G 3OYIA 1PSFA 3T9NA 4FM4B 4DA4A 1K8AU 4BI3A 2BIVA 1N9RA 3C12A 3LLRA 3Q1JA 1VQLA 2RHIA 2LCLA 2MMPA 3OYHA 3M54A 3P8DA 4BUGA 3FDRA 1JBMA 3CMET 1YJNA 4M75D 1GXIE 2DTIA 3M59A 5J26A 5DY9A 2RA2A 1NPRA 2V8JA 2L8DA 4TVRA 2DIQA 4GLKA 5GAN8 4ATOA 3UDCA 1VQPA 1QVFA 1VQNT 3OYDA 3CCVT 3CC7T 1QW1A 4FL6A 2F69A 1KQSS 1NE8A 4JUVA 5EG2A 2DVEA 3JB9F 4OB1B 4QQDA 3RIRA 2QQRA 4JRIA 2M1HA 1WQ7A 4EPCA 3DB4A 4M7DE 5HKCA 3X20B 2RJDA 3PFSA 2ZPBB 1KQ1A 2X35A 1X6OA 4IUQA 1OI1A 2VXEA 2X4WA 4J7FA 4PLIA 1KHCA 1VQPT 4C0GA 5GAOr 1X75C 2EAYA 2L3RA 4FIBA 4J83A 1G3SA 3M56A 2DXBA 1VIFA 3SWNA 3L2RA 4M75F 2QQBA 3CC4A 3INZA 2K5LA 5LJ3f 5KCHA 2DTOA 4Z02A 3VYHB 3X25B 4F7UA 3C4SA 3QZ9B 4HCCA 4ZN1A 1I4K1 3GF5A 5GAMg 5GAN7 4M77A 4A4EA 2F5TX 3HSBA 4FT4A 4KUDK 2K3XA 3O8VA 3A8GB 1R8OB 3PIPA 5IN1A 4R55A 2DXTA 4J6YA 5LJ5h 1IREB 2G3RA 2FB7A 3CCRT 4MZPA 5A0DA 2EJFA 1OZ2A 2DXUA 3HPWA 1VQ9A 3QG1A 4II1A 2E65A 2GFUA 4P5NA 3VJPA 4F7UG 5GAN5 1H3ZA 2LT1A 2WSEE 1QP2A 1YJWA 5FRMA 1Y7XA 4M77G 4XAXB 4M7AA 4M7DF 4PJOE 3QUIA 3G6EA 1BI1A 1YCYA 3P8BB 3H8ZA 4ELYC 3LW5E 2X4XA 2LNVA 4EMKA 4ZGDB 5FROA 3BW1A 1N8RC 4JLGA 4C5EA 3DKMA 3QO3A 3G7ZA 3M55A 2E70A 3JCMe 1YITA 1VQ9T 3VV0A 4FU6A 4C8QD 2DXCA 2L89A 4ME7A 2RM4A 3QHSA 1YJWT 4M7AG 3HP9A 4XTZA 5CO7A 1QVFS 1EIFA 3PNWC 3V8KA 3AHUA 5GMKj 4M75C 3PMIA 4A54A 1K73U 4MZTA 2E12A 2D6FA 1MGQA 2RI3A 4KT0E 3CCMA 3JB9J 2BUDA 2KDSA 3OYNA 5CCAA 4O5VA 3TEEA 3CCST 5GANh 2KK4A 2EIFA 1YITT 4B9WA 1VQ5A 3ZBDA 2KY9A 3FLGA 1G3WA 4C92D 2B8AA 3CCLA 3QZ5B 1G5VA 2XIDA 4MMLA 4NS5A 4QVZA 4XQ3A 3JCMW 2DKGA 2LQKA 4PJOF 2RD1A 1KC8C 2KMTA 4BE0A 3L2UA 3VU3C 3ZEHA 4XK8E 4MMKA 4RKUE 2E41A 2JUFA 4M75B 4BI8B 4C5GA 4NL3A 3L42A 4HCZA 4NL2A 2AHJB 1VQ7A 2ZZDA 4A4GA 5GAN4 3A8MB 2O4XB 3CCQA 1VQ5T 4C0ZA 3OQ5A 3VUZA 2VV5A 1LOJA 3RESA 4B9XA 1VQ6T 1G3YA 2XDBA 5KE3A 2CKKA 2M0OA 4XTUA 3CCJA 1NPPA 5IT9E 2HNIA 3CPWA 1VIEA 2XD0A 2E6NA 4V2SA 2D9TA 3FRNA 5GAOn 1U8RA 3OMGA 2Y4YA 4C92F 3X26B 1WJSA 2DAQA 2QDYB 1M4ZA 3F70A 4XTVA 5CKHA 2V8IA 2GCXA 3OS0A 4M78F 3CCQT 1X01A 1BI3A 1WQWA 4X34A 2XDDA 3PMTA 4HT8A 1KD1C 3CCUA 5LJ3h 2XHCA 2YLBA 1MHNA 2RK2A 3L1AA 4L6V5 4WF2A 5CIUA 2OTJT 1H641 4LD6A 3L2WA 5FRNA 3CCEA 1Y07A 2LC4A 3META 3MCAB 3PT9A 4IUTA 2R5MA 5I2MA 3OS5A 4C0DB 2RH2A 1DJ7B 1YIJA 2QQAA 2WSFE 1VQLT 2QXFA 3CMAT 4RCCA 5I21A 1NJIU 2QQSA 1QVGA 3RERA 4C8QC 3JB9H 4F7UE 5I2SA 3SDZA 3V7CA 3URGA 2LVMA 3JCMf 1WNLA 4L59A 4M77E 5CKEA 1M1GA 2QEXA 3OYAA 3CCET 4IURA 1W2BA 2QI2A 4BE2A 1N9SA 1XNIA 4J8OA 3JCMP 3GLXA 3CC2A 4A53A 4RMOA 2CGHA 4E7JA 1YJNT 5LJ5g 3UPUA 2A7YA 1I81A 1UB4A 5LJ5d 2E10A 2IG0A 4OGCA 5M9OA 3OA6A 3LWHA 3OB9A 3FC3A 3JCMQ 4IUPA 2YRVA 3QXEB 4YTLA 4C92C 3GPLA 2VC8A 3ME9A 4L5GA 1Q81U 1Q86U 4M7DD 4M7AE 4M78C 2K4YA 3SD4A 1WGSA 3RMQA 5GAN2 2QEXT 4C8QB 2RI5A 4E47A 4JJNK 5CKFA 3JCMJ 3CC2T 4RCBA 3OYCA 3CPFA 3FB9A 4EDUA 4LDYA 1K9MC 2LX9A 1YI2A 4UC4A 5GAMd 5GMKi 2I2LA 3CXCA 2DZCA 1XTDA 1M90U 3JB9G 3L2QA 4M75A 4OGEA 3CPWS 4F7UF 3OW2A 2EYQA 1OZ3A 2PUKB 2O4XA 5D6WA 5GMKe 3E9GA 1BI2A 3V7RA 2RJEA 3P8HA 5CKBA 4A4HA 3I55A 2K57A 3M9QA 4BACA 4N4HA 2FHDA 4C92B 1BI0A 1FX7A 3E19A 3OYBA 4ZTJA 5L8RE 3JB9I 2XKOC 1Q82U 3CD6A 1M1FA 1VUBA 2EWNA 4J6WA 3QSUA 1I8FA 5GANg 5A2QE 3JSCA 1YI2T 5GANd 5DLQE 2ZPGB 4CI0C 5LJ5j 3VYGA 3CBOA 3M53A 1XOVA 5DM7R 2R58A 3MEWA 2CZ7B 4XU2A 2XG8D 2NLUA 3OYKA 4PJOD 2VYTA 2MF2A 1UGSB 4JS5A 2PVGB 2ZCFB 3GNFB 4N0AC 5FU7C 4MDXA 2WSCE 3WVDB 5D6YA 4D6WA 3H6ZA 5AYFA 4GY5A 3WVEB 5CQYA 1K8AC 3S3NA 3OYLA 3G6ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHI A;  3NTI A;  3OYH A;  3OQ5 A;  3P8D A;  4B9X A;  3FDR A;  3KUF A;  4RG2 A;  1WJQ A;  5KE3 A;  3QII A;  2LCC A;  2CKK A;  2M0O A;  5J26 A;  4BD3 A;  3MEU A;  2RHU A;  4C5I A;  3MEV A;  2L8D A;  2DIQ A;  3QKJ A;  2E6N A;  3QJ6 A;  3OYD A;  2D9T A;  3OMG A;  1WJS A;  2DAQ A;  3MP8 A;  2EQM A;  2JZ2 A;  3F70 A;  4FL6 A;  3L2V A;  3OS0 A;  3EAE A;  3MP1 A;  2RO0 A;  4QQD A;  3UWN A;  4X34 A;  4E7H A;  3LGF A;  2QQR A;  3PMT A;  2M1H A;  3DLM A;  1RI0 A;  5CIU A;  1MHN A;  3DB4 A;  2RJD A;  3PFS A;  4BDY A;  4LD6 A;  2X35 A;  4N4I A;  3L2W A;  2RJF A;  4IUQ A;  1OI1 A;  4PLI A;  2X4W A;  1KHC A;  5FRN A;  2EFI A;  3MET A;  4IUT A;  2R5M A;  2EQU A;  3MEA A;  2E5Q A;  2L3R A;  2BKD N;  3QBY A;  3OS1 A;  2R57 A;  3ASK A;  2EQJ A;  1SSF A;  3L2R A;  3S3O A;  5KCH A;  2QQS A;  4N4G A;  4Z02 A;  4IKF A;  3OYG A;  2X4Y A;  3S3M A;  3OYM A;  3MO8 A;  5KCO A;  3C4S A;  4CRI A;  3CEY A;  3NTK A;  2MWO A;  5J39 A;  2M16 A;  2LVM A;  4PL6 A;  2MWP A;  4A4E A;  4L59 A;  5IAY A;  4E7I A;  3OYA A;  2R5A A;  2RHZ A;  4IUR A;  2WAC A;  2K3X A;  3O8V A;  4BE2 A;  2LDM A;  1XNI A;  3OMC A;  4QW2 A;  5IN1 A;  3UT1 A;  2RI2 A;  2RHY A;  3BDL A;  4PLL A;  3S6W A;  4OVA A;  3OY9 A;  4E7J A;  2G3R A;  3OYE A;  3GOX A;  1OZ2 A;  2IG0 A;  5KE2 A;  2F5K A;  5M9O A;  4II1 A;  2GFU A;  3OB9 A;  3OA6 A;  3E9F A;  3FC3 A;  4ZTF A;  4IUP A;  3LX7 A;  1H3Z A;  2YRV A;  3LGL A;  3ME9 A;  5FRM A;  2JTF A;  3LH0 A;  2LTO A;  4IUV A;  3SD4 A;  1WGS A;  2RI5 A;  2K3Y A;  3H8Z A;  3OYJ A;  5C0M A;  2X4X A;  3MP6 A;  4QQG A;  1OYX A;  2GF7 A;  3OS2 A;  5FRO A;  2LRQ A;  3OYC A;  4C5E A;  4EDU A;  5D6X A;  2RJC A;  4UC4 A;  2HQX A;  4E7L A;  4FU6 A;  3DB3 A;  4IUU A;  2L89 A;  2PQW A;  3FEO A;  3L2Q A;  2XK0 A;  3NTH A;  3PNW C;  1OZ3 A;  5C6S A;  2O4X A;  3PMI A;  2HQE A;  3E9G A;  5D6W A;  4E7K A;  2GFA A;  2RJE A;  3P8H A;  4A4H A;  4BAC A;  3M9Q A;  4BDZ A;  2RI3 A;  4N4H A;  2FHD A;  4QQ6 A;  3OYB A;  2BUD A;  3OYN A;  4ZTJ A;  3LYI A;  4Q5W A;  4B9W A;  2EKO A;  3FLG A;  4A4F A;  2B8A A;  2XDP A;  2EQK A;  1G5V A;  1N27 A;  2R58 A;  4NS5 A;  4QVZ A;  3MEW A;  1WJR A;  4C5H A;  3OYF A;  2NLU A;  3OYK A;  2DIG A;  2VYT A;  2RHX A;  4BE0 A;  3L2U A;  4BE1 A;  2P0K A;  3ZEH A;  3OYI A;  5D6Y A;  3H6Z A;  5KH6 A;  4GY5 A;  4C5G A;  2BIV A;  3L42 A;  4HCZ A;  3LLR A;  3S3N A;  3OYL A;  4A4G A;  3Q1J A;  2O4X B; 
#chains in the Genus database with same CATH topology
 3M57 A;  3THK A;  1PG5 B;  3KUF A;  2O01 E;  5IXF A;  4MDW A;  4BD3 A;  1K8A R;  2HL3 A;  3MEU A;  2E1H A;  1D3B B;  1ABQ A;  3NFC A;  2RO0 A;  5FU7 B;  2YSQ A;  3CCM T;  5FLX E;  2FZC B;  2JVV A;  1AWX A;  2EFI A;  2RK1 A;  2E5Q A;  4D8D A;  3I56 A;  4RTZ A;  3CCL T;  1VQ4 A;  2BKD N;  2LT4 A;  3MKD A;  1QKW A;  3OYG A;  3A8H B;  4HXJ A;  2FVU A;  1TSF A;  2MWP A;  4KBM B;  1VA7 A;  4E7I A;  3BDU A;  3HRT A;  2DJZ A;  1ZA2 B;  2RI2 A;  3G6E Q;  2KXC A;  2AIR B;  3OY9 A;  4M7D B;  4C8Q G;  4KUI A;  5L23 A;  3H9N A;  3E9F A;  3KXT A;  4OMO A;  1O75 A;  3REA B;  2EYX A;  6AT1 B;  5KYX A;  4PJO C;  1LJO A;  3CME A;  2FZK B;  4AFS C;  3CCU T;  2VAS A;  2KYM A;  2CUB A;  1AEY A;  4C92 G;  4EMG A;  4IUU A;  2LMJ A;  3FEO A;  2DJQ A;  5GAO p;  2MOX A;  2P0Q A;  1K73 C;  5DLO A;  2LJ3 A;  3OSV A;  4BDZ A;  1W4S A;  1Q7Y C;  2JTE A;  1AZG B;  3EH1 A;  1UGP B;  4MZM A;  3TSW A;  3JCM V;  1WPY A;  2FPD A;  1M1K C;  2E6Z A;  1D3B A;  4XU0 A;  2EQK A;  1VQ7 Q;  1EX4 A;  3SEM A;  4Z89 A;  2D8J A;  2ZPF B;  3X28 B;  4PKC C;  2ABL A;  2JTM A;  5KH6 A;  1HXD A;  1VQO T;  2X3X D;  5LL6 S;  3QYG B;  2HEQ A;  4JJC A;  4M78 B;  1UFF A;  2KSS A;  4JPB W;  4OB2 B;  2LP5 A;  4F14 A;  3FIF A;  3ULR B;  4JJD A;  2HBW A;  3QPH A;  5J3B A;  1YHQ A;  1XJW B;  3VS4 A;  4M7D A;  4XTY A;  2DD5 A;  4KH0 B;  4LUD A;  2ECZ A;  1RAC B;  2RJF A;  1VQM T;  1WIE A;  4AT1 B;  1ZHI A;  5GMK l;  3RKX A;  2FL7 A;  1EZZ B;  2DL4 A;  2PUO B;  2ZGW A;  1NJI C;  3CC2 Q;  4PNO A;  4EMH A;  2VVK A;  2MK5 A;  2JOY A;  3HFO A;  4CRI A;  2MWO A;  1M8V A;  1IZ6 A;  3VS2 A;  2VUB A;  3D7S B;  4RTT A;  4QW2 A;  3J80 E;  2RHY A;  2K5I A;  2CYZ B;  3OYE A;  2CZ6 B;  4OF1 A;  2J6K A;  1G3T A;  5FW9 A;  1KQ2 A;  2YUN A;  1Q81 C;  3TRE A;  4PJL A;  1SG5 A;  4AMC A;  1PM3 A;  1MUZ A;  5GAN 3;  1VQ8 A;  4J5Y A;  4F7U B;  2DE0 X;  3ZFJ A;  3I55 Q;  2CS7 A;  2RJC A;  4HKE A;  4CC2 A;  3CD6 Q;  1UEB A;  3DB3 A;  1M90 C;  2RB6 A;  2PQW A;  4DEX A;  2GGR A;  5CQX A;  4PJO G;  1PRL C;  2RQT A;  2MCN A;  1S72 T;  1GFC A;  1QQJ A;  2DYB A;  4QQ6 A;  1JXO A;  4AG1 C;  2RQV A;  1T0H A;  1QP3 A;  2ZPH B;  1AZE A;  4M7A B;  3C95 A;  2M51 A;  1D1B A;  4HCK A;  3GP8 A;  4EMK B;  1VQL A;  4C5H A;  2KVQ G;  3HHT B;  3G71 T;  2J05 A;  2DL7 A;  1VQN A;  1SPK A;  2DZ9 A;  1K8A U;  2PZ1 A;  1VQK Q;  2RHI A;  2DMO A;  3OYH A;  1JBM A;  4JZ3 A;  1S1N A;  5GAN 8;  1QVF A;  3OYD A;  2QGF B;  2LQW A;  2V26 A;  2OJ2 A;  2AKL A;  2VB6 A;  4EPC A;  2VXE A;  1VQP T;  2ROL A;  1YJ9 Q;  1J3T A;  3L2R A;  5KCH A;  1UTI A;  4AG2 C;  1FMW A;  4F7U A;  3C4S A;  4HCC A;  4ZN1 A;  5GAM g;  5GAN 7;  2RQW A;  1V1C A;  2F5T X;  3HSB A;  2O9V A;  1VYT A;  2K3X A;  2JW4 A;  1R8O B;  5IN1 A;  4DBR A;  1MMD A;  1W2B P;  1RAD B;  3QG1 A;  4P5N A;  4M7A A;  2A08 A;  1GCQ A;  1K1Z A;  3EH2 A;  3G6E A;  1YCY A;  1I0C A;  2X4X A;  4EMK A;  4OMM A;  1N8R C;  4JLG A;  3JCM e;  2FEI A;  1VQ9 T;  2L89 A;  2W0Z A;  1YNZ A;  4PJJ A;  3HP9 A;  1QVF S;  1EIF A;  2EGA A;  5GMK j;  3CXC P;  2NUZ A;  2RI3 A;  9ATC B;  4O5V A;  1E7O A;  3TEE A;  2EIF A;  1YIT T;  2L0A A;  4F04 B;  1OX9 A;  2KY9 A;  2L3Q A;  4QVZ A;  2DBK A;  3JCM W;  1WHM A;  1KC8 C;  2CP2 A;  3CCR Q;  1WA7 A;  2E41 A;  5IXB A;  4HCZ A;  4NL2 A;  2AHJ B;  1VQ7 A;  3OQ5 A;  2VV5 A;  2CKK A;  4XTU A;  5IT9 E;  2CT3 A;  2HNI A;  1JJ2 P;  3NPF A;  5KYN A;  1U8R A;  1I1J A;  2HMA A;  3X26 B;  3F70 A;  5CKH A;  2KRM A;  2V8I A;  3OS0 A;  1X01 A;  4X34 A;  3PMT A;  1KD1 C;  2RPN A;  3L1A A;  2GNC A;  3CCS Q;  3OS5 A;  2RH2 A;  2QQA A;  5I21 A;  3RER A;  5I2S A;  4J9E A;  3URG A;  4L59 A;  1W2B A;  2QI2 A;  4BE2 A;  3I5R A;  3M0U A;  1NBE B;  4J8O A;  3CC2 A;  4J9D A;  3TVT A;  1VQ6 Q;  3LWH A;  5M9O A;  4IUP A;  2VC8 A;  4M7D D;  1JEG A;  5GAN 2;  2K4Y A;  2E3H A;  1WGS A;  3RMQ A;  2QEX T;  1UDL A;  2RI5 A;  4JJN K;  2RNA A;  4FW1 A;  3OYC A;  3CPF A;  2F2X A;  2OTJ Q;  2H8H A;  3CXC A;  4OMQ A;  4RTX A;  4OGE A;  2GTO A;  3VS3 A;  2EYQ A;  3CC4 T;  3I55 A;  4A4H A;  4BAC A;  3U23 A;  4Z8A A;  2AK5 A;  3E19 A;  3CD6 A;  5L8R E;  2XKO C;  1JU5 C;  2E3I A;  2KNB B;  5DLQ E;  3G1J A;  3M53 A;  1WYX A;  3PVQ A;  2R58 A;  2COZ A;  1QWF A;  4KGZ B;  4JJB A;  5FU7 C;  4KGV B;  3C0C A;  4D6W A;  1NEG A;  5AYF A;  1Y57 A;  3WVE B;  1R77 A;  3OYL A;  1WLP B;  1W2B S;  3M5A A;  2HBP A;  3MEV A;  4CC7 A;  4LE9 A;  3HRU A;  1Y96 B;  2YWW A;  1VQK A;  3M4G A;  4M78 D;  3LGF A;  1NLP C;  1JB0 E;  2DL8 A;  3SFM A;  2E64 A;  1BU1 A;  3J81 E;  4ZN3 A;  1B34 B;  3RMS A;  4M7D C;  4FSS A;  1BYM A;  2QGG A;  1NZ9 A;  1M3C A;  1SSF A;  1YWO A;  3S3O A;  2HKN A;  2JXB A;  1D0Z A;  1RL2 A;  2D0Q B;  4N4G A;  1SRL A;  4BB7 A;  3OYM A;  1IGQ A;  2DPP B;  2NWM A;  2DIL A;  2FYK A;  4J6X A;  1YJ9 A;  4WCI A;  1YJW Q;  2K5F A;  3I56 T;  1C1A A;  1Y71 A;  1ZBJ A;  2KGT A;  2KT8 A;  4PJN A;  3CCJ T;  5GMK m;  5GAM f;  1OU8 A;  1BIA A;  4E7Z A;  5HK3 A;  4JS4 A;  1YN8 A;  3A8O B;  1MV0 B;  2K3Y A;  1KHI A;  3A8L B;  4QQG A;  2DVJ A;  2LRQ A;  5D6X A;  3CCM Q;  1EFN A;  2YLC A;  2HAX A;  1ZUK A;  5CVI A;  2K2V A;  3QJY A;  3KBG A;  1UGR B;  3OBW A;  1ZUY A;  4M75 E;  3VUB A;  4BY6 B;  1TXQ A;  5HCK A;  1PWT A;  1YIJ T;  1UGQ B;  2HQE A;  2HSE B;  3CCL Q;  1RI9 A;  4R0K A;  4OML A;  1QWE A;  1W70 A;  4RTY A;  2DEQ A;  1K73 R;  1Y96 A;  3VKI A;  2MI6 A;  2C0O A;  5LJ5 e;  1B7T A;  1N27 A;  4AFZ C;  1CKB A;  3UA6 A;  4M7A D;  1M1K R;  1LNX A;  1M30 A;  2Y4X A;  1B34 A;  1HK9 A;  2MIO A;  2MAM A;  5GAM e;  2O9S A;  2JS0 A;  2X4J A;  2CP7 A;  2CH4 W;  3CCR A;  2LCC A;  1X6G A;  3CCU Q;  4M75 G;  2GQV A;  2EQM A;  3CCE Q;  4ZGJ B;  2QQ9 A;  4M7A F;  3UF4 A;  3DLM A;  2ZPI B;  3O5Z A;  2RQU A;  1QVG S;  4BDY A;  4OMF B;  4XU1 A;  4C0F A;  1PRM C;  2B86 A;  1D09 B;  3MEA A;  3JCM g;  2L3P A;  1QKX A;  3JCM d;  3JAM E;  1WDX A;  4Y91 A;  2EQJ A;  4LDV A;  5GAO l;  1QMC A;  1YHQ T;  4C8Q E;  2X3W D;  2X4Y A;  5GMK h;  3EGU A;  4HA8 A;  4M7D G;  1WHJ A;  3X24 B;  2A0F B;  3CCS A;  3M58 A;  1H8K A;  2EW3 A;  3QDR B;  5GAM h;  2XU8 A;  4PL6 A;  4OB3 B;  5IAY A;  1NJI R;  3V8L A;  1TWB A;  1XQH A;  4PLL A;  2P0P A;  2XI9 A;  1TUD A;  1RAG B;  2LQ8 A;  4C92 E;  4M78 E;  2VXF A;  2HKQ B;  2JTF A;  4LD9 K;  4LDU A;  3L2Z A;  1QVP A;  3SWN B;  5LJ3 e;  4M7A C;  2G6F X;  4OP0 A;  1VQ6 A;  1GCQ C;  1D0Y A;  1PKS A;  2KT1 A;  1Q81 R;  4EMK C;  4Y28 E;  4A4K A;  4M77 B;  5HK0 A;  4PFP A;  2E4H A;  2KAF A;  4E7S A;  4LN2 A;  2PU9 B;  5GAO q;  1KG1 A;  2GFA A;  2VGM A;  3M4Y A;  1VQ8 T;  1M90 R;  2OTJ A;  1UHF A;  1AWJ A;  4FYV B;  4JRQ A;  2X9H A;  1Q82 R;  1BKB A;  2ATC B;  5A0L A;  1WJR A;  3V7S A;  3SHW A;  2P0K A;  4M78 G;  4FM4 B;  1GBQ A;  2M0Y A;  3LLR A;  3A1P A;  2KE9 A;  2H3E B;  2MMP A;  2DYI A;  1C6V X;  5DY9 A;  2RA2 A;  2AZV A;  2DIQ A;  1VQN T;  4AFU C;  3CCV T;  3CC7 T;  5KYW B;  1CKA A;  4FL6 A;  2F69 A;  4JUV A;  1UGV A;  4RTV A;  1KJW A;  3RIR A;  2YXY A;  2QQR A;  3NGP A;  1KFZ A;  3G4S Q;  1WQ7 A;  5GJW B;  2XMF A;  2X35 A;  1OI1 A;  1WXT A;  5GAO r;  1X75 C;  2K9G A;  2L3R A;  4J83 A;  2F2V A;  2NUT A;  1ZLM A;  3SWN A;  2QQB A;  2EBP A;  3INZ A;  2K5L A;  2CSI A;  3NHN A;  3X25 B;  1RAF B;  2HCK A;  1YP5 A;  4M77 A;  1KIK A;  3M0T A;  4FT4 A;  4KUD K;  1ZX6 A;  4QT7 A;  2DXT A;  5FWC A;  1T3L A;  2RMO A;  4J6Y A;  2KI7 A;  2QA4 Q;  2DXU A;  4II1 A;  2E65 A;  2GFU A;  3PE0 A;  4F7U G;  1JO8 A;  2LT1 A;  2WSE E;  1QP2 A;  1YJW A;  5FRM A;  1Y7X A;  4XAX B;  2DL3 A;  4PJO E;  3H8Z A;  4ELY C;  2LNV A;  4FYX B;  5I22 A;  1V76 A;  3G7Z A;  3M55 A;  2I0N A;  3VV0 A;  4M7A G;  4RTU A;  3AHU A;  4JZ4 A;  1K73 U;  2PTK A;  1TUG B;  1MGQ A;  1X6B A;  3CCM A;  1W1F A;  3JB9 J;  2MPX C;  3OW2 P;  4FCY A;  4B9W A;  2A37 A;  5KYW A;  2B8A A;  3CCL A;  2XID A;  4MML A;  3M0P A;  2ESW A;  4XQ3 A;  2LQK A;  2CP5 A;  3H0H A;  2KMT A;  3ZEH A;  4XK8 E;  1ZSZ B;  1NYF A;  5GAN 4;  1KC8 R;  1E6G A;  5KE3 A;  4Y92 A;  2OTL Q;  4XTV A;  1WQW A;  2IIM A;  3CCU A;  1PD0 A;  5CIU A;  4L6V 5;  4LD6 A;  2ROT A;  3CCE A;  1Y07 A;  1KD1 R;  1C0M A;  2ENM A;  1AWO A;  2WSF E;  2QXF A;  3CMA T;  1NJI U;  2QQS A;  1KQS P;  3JCM f;  4LXC A;  1M1G A;  4IUR A;  1PCX A;  1N9S A;  3GLX A;  4KGX B;  1VYV A;  2SRC A;  1YJN T;  5LJ5 g;  2A7Y A;  1I81 A;  1UB4 A;  5LJ5 d;  2IG0 A;  4OGC A;  3FC3 A;  4YTL A;  1Q81 U;  4IIO A;  1WFW A;  3SD4 A;  4KH1 B;  5CKF A;  3JCM J;  3CC2 T;  4RCB A;  3RNJ A;  4LDY A;  1K9M C;  2JM9 A;  5GAM d;  2D8H A;  2DZC A;  3H0F A;  4ESR A;  1M90 U;  1ZSZ A;  3L2Q A;  5EC7 A;  1Z9Z A;  2YDL A;  3OW2 A;  2PUK B;  1M8M A;  1D1A A;  1BI2 A;  2K79 A;  3V7R A;  3P8H A;  3VS7 A;  1FX7 A;  1Q82 U;  2EWN A;  1VUB A;  1PD1 A;  1QCF A;  1OUL A;  2QK0 A;  2ZPG B;  3EG9 B;  5LJ5 j;  3CBO A;  1XOV A;  3ZL7 C;  5DM7 R;  4RUG A;  4XU2 A;  2VYT A;  2MF2 A;  1UGS B;  2P84 A;  4JS5 A;  2PVG B;  3GNF B;  4MDX A;  3MPU B;  2WSC E;  3H6Z A;  3S3N A;  1OQK A;  4J9F A;  5GAM j;  4RG2 A;  1JQQ A;  1OPL A;  1WJQ A;  2XIC A;  1X2K A;  2CZ1 B;  1GRI A;  2RHU A;  2C0I A;  5GAN 6;  1I5L A;  2GTJ A;  1TS9 A;  1N6A A;  2OAW A;  3MP8 A;  4JLI A;  1M9S A;  4NOY A;  3CC4 Q;  5LJ3 g;  5LJ3 d;  1ARK A;  4CC4 B;  2V8K A;  4R56 A;  3JCM h;  1KQS A;  4LUE A;  1VQK T;  1H92 A;  3HTR A;  2EJ9 A;  3G4S A;  2K6D A;  2DTH A;  1YCS B;  3RBB B;  3FJ5 A;  2V1R A;  3R6N A;  2GQI A;  1OEB A;  3MO8 A;  5KCO A;  4GBQ A;  3NTK A;  1U06 A;  1QCO A;  2A3L A;  2R5A A;  4HCB A;  2WAC A;  5GJV B;  3OMC A;  3S6W A;  1JRI A;  1FXX A;  4BY6 C;  4HVU A;  3QYH B;  4FSX A;  5IHI A;  4ELZ C;  3CBM A;  1OV3 A;  1YBY A;  1YJ9 T;  2NUP B;  5LJ3 j;  3PIO A;  2YUO A;  3EG9 A;  3OYJ A;  5C0M A;  2QA4 A;  1ZSG A;  3A5Z B;  3EFR A;  4QVD A;  5CR2 A;  4JRP A;  4E7L A;  4FT2 A;  3NTH A;  1VQ5 Q;  1G8X A;  3WXM B;  4E7K A;  3J7A F;  4M77 D;  4J9I A;  4ZGE B;  2P4R A;  1SF9 A;  2C06 A;  3LYI A;  4F17 A;  1P92 A;  2KXD A;  2ED1 A;  5CKD A;  3CCQ Q;  4OB0 B;  2SEM A;  1PSE A;  2HDA A;  3PTA A;  1AT1 B;  3OYF A;  3CPW P;  1HJD A;  1CSK A;  2E5K A;  1KC8 U;  3CCJ Q;  4J9G A;  2JJ9 A;  2EYY A;  1ABO A;  3NTI A;  4M77 F;  4X1V A;  2OAU A;  4KUL A;  2H3J A;  2X51 A;  4C5I A;  3QWX X;  2IPO B;  3L2V A;  2JZ2 A;  4OMP A;  3GNG A;  2YT6 A;  3UWN A;  2PVO B;  4Z88 A;  1OU9 A;  5GAN e;  1KD1 U;  1YIJ Q;  1RI0 A;  1FYN A;  2BTT A;  1D0X A;  2OTL A;  2HD0 A;  1W6X A;  1JJ2 A;  2NUP A;  3HL8 A;  3QBY A;  2R57 A;  1U5S A;  3JCM c;  3SWN C;  2EPD A;  4D8K A;  2ZPE B;  2FPF A;  4M77 C;  2KBT A;  1TG0 A;  2AT1 B;  2JM8 A;  4BI4 A;  2DA9 A;  4OVA A;  5FU6 B;  2DK3 A;  4E6R A;  3GOX A;  1NM7 A;  5KE2 A;  1FWZ A;  1AD5 A;  1Q95 G;  3LX7 A;  1YI2 Q;  4XTX A;  2DER A;  4FYY B;  1Q86 C;  3CXC S;  1QCN A;  4IUV A;  1WX6 A;  5LJ5 f;  1OYX A;  2GF7 A;  1OOT A;  4PFZ A;  2JN0 A;  5IHN A;  4C8Q F;  2EVR A;  5HY6 A;  2XK0 A;  1U1S A;  2OI3 A;  1VQ4 T;  2CDT A;  1BIB A;  1UJ0 A;  4X9D A;  1MND A;  2MYS A;  3MHX A;  3RR6 A;  2QTX A;  1JJ2 S;  5IHK A;  2DIG A;  2RHX A;  4BE1 A;  4O6J A;  1PSF A;  3T9N A;  1M2V B;  2YUQ A;  1LVK A;  3JV3 A;  3Q1J A;  3M54 A;  3CME T;  3FDR A;  1GXI E;  3M59 A;  5J26 A;  4F16 A;  1NPR A;  2L8D A;  4TVR A;  1Q7Y R;  1QW1 A;  1M3A A;  4J9B A;  1UEC A;  4JRI A;  2J7I A;  2M1H A;  2QAS A;  1X43 A;  4M7D E;  5HKC A;  2RJD A;  3EGD A;  1KQ1 A;  1X6O A;  4J7F A;  2KRS A;  4PLI A;  1KHC A;  4C0G A;  5ECA A;  2EAY A;  1WHK A;  3M56 A;  3CC4 A;  1R0C B;  4PFO A;  5LJ3 f;  2ED0 A;  2DTO A;  5IH2 A;  4EIK A;  3QZ9 B;  1NYG A;  2BZX A;  1UG1 A;  2J06 A;  3A8G B;  2PNI A;  3PIP A;  4M4Z A;  4FYW B;  5LJ5 h;  1IRE B;  2FB7 A;  1BCO A;  4MZP A;  5A0D A;  1OZ2 A;  3HPW A;  2CP3 A;  3VJP A;  1B3Q A;  1PNJ A;  4M77 G;  4ZNX A;  1T3S A;  3QUI A;  1BI1 A;  3CCV Q;  3CC7 Q;  3P8B B;  1RUW A;  2JS2 A;  3LH5 A;  5FRO A;  4DBQ A;  3DKM A;  3QO3 A;  1BCM A;  3I35 A;  4DBH A;  2COY A;  2RM4 A;  4ME7 A;  1M2V A;  1YJW T;  1VQO Q;  4XTZ A;  5CO7 A;  1ZSZ C;  2CT4 A;  3V8K A;  2JMA A;  3PMI A;  4PK4 A;  2E12 A;  1WHG A;  2BZ8 A;  2KDS A;  3OYN A;  2QAZ A;  1RLP C;  1VQ5 A;  2NUT B;  3FLG A;  2K3B A;  3QZ5 B;  1G5V A;  3EG2 A;  4B6M A;  3I9Q A;  2DKG A;  4PJO F;  3L2U A;  2CSQ A;  4MMK A;  4RKU E;  4BI8 B;  1VQM Q;  4M75 B;  1IO6 A;  4C5G A;  1A0N B;  1F1B B;  3L42 A;  2ZZD A;  3CCQ A;  1N5Z A;  2D1X A;  4AFQ C;  2LJ0 A;  3VUZ A;  1LOJ A;  2QG9 B;  1AVZ C;  3RES A;  3KFV A;  1SEM A;  2DF6 A;  2M0O A;  3CCJ A;  2E6N A;  3A98 A;  4V2S A;  2D9T A;  3FRN A;  5GAO n;  2Y4Y A;  1WJS A;  2DAQ A;  2QDY B;  1IHW A;  2GCX A;  1OPK A;  2J6F A;  3CQT A;  1BI3 A;  4HT8 A;  1MV3 A;  5LJ3 h;  2BZY A;  2FRY A;  2XHC A;  2YLB A;  1MHN A;  2RK2 A;  1RAE B;  2LJ1 A;  3IQL A;  2L3S A;  2QTV A;  3MET A;  2LC4 A;  3PT9 A;  3MCA B;  5I2M A;  2R5M A;  2KEA A;  1YIJ A;  1VQL T;  2O2O A;  4RCC A;  1E6H A;  1RAB B;  3JB9 H;  4F7U E;  1SSH A;  8AT1 B;  2LVM A;  7AT1 B;  1WNL A;  5CKE A;  3TSZ A;  2BE9 B;  3CCE T;  4GLM A;  3JCM P;  1S72 Q;  4RMO A;  1WXB A;  3OA6 A;  1KSW A;  3AT1 B;  3H41 A;  3GPL A;  3ME9 A;  4L5G A;  4M7A E;  2JT4 A;  2LX7 A;  5AT1 B;  4C8Q B;  4E47 A;  1RAI B;  2M02 A;  3G71 Q;  1SHF A;  3FB9 A;  1MMA A;  2LX9 A;  1YI2 A;  3EG1 A;  2EGC A;  5GMK i;  2LQN A;  2EYZ A;  2I2L A;  1M2O A;  2FPE A;  4M75 A;  1G2B A;  4DBF A;  4OMN A;  5D6W A;  3TU4 K;  3E9G A;  5CKB A;  1K9M R;  2K57 A;  2FHD A;  2JMC A;  2KYB A;  4C92 B;  3VS6 A;  4ZTJ A;  3CMA Q;  3EG3 A;  4J6W A;  1M1F A;  3QSU A;  1AWW A;  1I8F A;  3VRY A;  5GAN g;  5A2Q E;  3JSC A;  5GAN d;  1TOV A;  1IRX A;  4CC3 A;  4CI0 C;  3VYG A;  1H3H A;  4ANJ A;  1QVF P;  2CZ7 B;  2QYZ A;  2NLU A;  2XG8 D;  4J9H A;  3OYK A;  1RLQ C;  1YJN Q;  1JXM A;  3QDF A;  4GY5 A;  1K8A C;  1VQP Q;  1UHC A;  1N8R R;  3G6E T;  4HVW A;  1U3O A;  1GFD A;  5CAI A;  1Q7Y U;  4IIM A;  3QII A;  2CZ0 B;  3QKJ A;  1M1K U;  3HRS A;  4FW2 A;  1IGU A;  2DM1 A;  4E7H A;  1TH7 A;  5GAN j;  2DBM A;  2CUD A;  1SKU B;  3EHR A;  3VS1 A;  3OBY A;  1M27 C;  2HSP A;  3RUX A;  3JCM X;  3OS1 A;  1IB8 A;  3ASK A;  4LDW A;  4C8Q A;  4IKF A;  2AKK A;  5J39 A;  1VQ9 Q;  2A28 A;  2M16 A;  3BFM A;  4QVC A;  3OYY A;  1VQ7 T;  2DFU A;  2RHZ A;  2P4T A;  1IHV A;  3BDL A;  3G4S T;  3RKY A;  3EFO B;  4C92 A;  2DO3 A;  1FMK A;  2COW A;  2F5K A;  3LWI A;  1Q82 C;  2VKN A;  4M78 A;  1YIT Q;  3LGL A;  3LH0 A;  2LTO A;  3OSS C;  1U1T A;  3EHQ A;  2L5Q A;  2M9U A;  3MP6 A;  3N5B B;  4DOW A;  2DX1 A;  2VGN A;  1TU0 B;  2HQX A;  2EQI A;  1V29 B;  1ZQ1 A;  3CC7 A;  3CCV A;  1WXU A;  3EFS A;  1X27 A;  5CK9 A;  2QA4 T;  2KQW A;  1AOJ A;  1MMN A;  1VQO A;  4PJO B;  3BY7 A;  2DD4 A;  2XDP A;  2LNH B;  4N0A A;  4A63 B;  3HKS A;  1M5Q 1;  2OX7 A;  1K76 A;  5I11 A;  2GBQ A;  4LDX A;  3PGG A;  1YFN A;  3UA7 A;  4JDS A;  2JNG A;  1VQM A;  2L2P A;  3QJ6 A;  3EGX B;  5KYY B;  3GIB A;  3EAE A;  3MP1 A;  2EJG A;  5A0G A;  2K7A A;  3I55 T;  2PVD B;  2FZG B;  2YRD A;  4JRK A;  3VRZ A;  3CD6 T;  3EFO A;  4J7I A;  4N4I A;  5FU6 C;  4WTO B;  4DEY A;  2RN8 A;  2EQU A;  3C94 A;  5KYU B;  2QEX Q;  2A36 A;  3V8J A;  2IVW A;  2FG0 A;  1WZO A;  3S3M A;  1MNE A;  1TUC A;  2LCS A;  3CEY A;  4HT9 A;  4XU3 A;  2OTL T;  3R6O A;  1Y0M A;  4X9C A;  3HFN A;  1UE9 A;  3NMZ C;  2LDM A;  3UT1 A;  2ZAE A;  3ER0 A;  2HZY A;  1OX8 A;  4ZTF A;  1NG2 A;  3DLL A;  3E1S A;  4VUB A;  2KR3 A;  2YHT A;  4PJO A;  1RAA B;  4XTW A;  1S72 A;  1LCK A;  1ZBX A;  4LNP A;  3JRZ A;  1D1C A;  2DRM A;  3SB2 A;  3OW2 S;  3FJP A;  1AHJ B;  4K11 A;  3OS2 A;  1Q86 R;  1K9M U;  8ATC B;  1O9S A;  3CBP A;  2D0N A;  4RG8 A;  5C6S A;  4DOV A;  3G71 A;  1VOM A;  3RKW A;  3TCJ A;  1BK2 A;  4C0D C;  4DQ2 A;  3JCM b;  4Q5W A;  2V1Q A;  5GAO m;  2EKO A;  3EGX A;  5KYY A;  4A4F A;  2Y90 A;  3JB9 D;  1N8R U;  3CMA A;  2HQH A;  2KRO A;  5GAN f;  2EGE A;  3OYI A;  1WHL A;  4ORZ A;  4DA4 A;  1PHT A;  4BI3 A;  2BIV A;  1N9R A;  3C12 A;  1UUE A;  1X69 A;  2LCL A;  3QWY A;  1K0S A;  3P8D A;  2F2W A;  5KYU A;  4RTW A;  4BUG A;  2EKH A;  1YJN A;  4M75 D;  2DTI A;  3VS0 A;  2V8J A;  4GLK A;  4ATO A;  3UDC A;  1VQP A;  1X2Q A;  2BE7 D;  2LZ6 B;  1K9A A;  1VYU A;  4PJM A;  1KQS S;  1NE8 A;  5EG2 A;  2DVE A;  3JB9 F;  4OB1 B;  4QQD A;  3I56 Q;  1TTH B;  2DLP A;  1VQ4 Q;  3DB4 A;  3X20 B;  3PFS A;  2ZPB B;  4IUQ A;  2X4W A;  2YRC A;  2DET A;  4FIB A;  1G3S A;  2DXB A;  1VIF A;  4M75 F;  1SHG A;  4Z02 A;  3VYH B;  2J6O A;  1GBR A;  1I4K 1;  3GF5 A;  4A4E A;  4HVV A;  1QVG P;  3O8V A;  4R55 A;  2DRK A;  2G3R A;  3CCR T;  2EJF A;  3CME Q;  1VQ9 A;  2CH4 A;  5GAN 5;  3PVL A;  1H3Z A;  1SRM A;  2DL5 A;  2CP6 A;  4M7D F;  3M0S A;  1K0X A;  1MMG A;  1NEB A;  3LW5 E;  4ZGD B;  3BW1 A;  3BE3 A;  4C5E A;  1PKT A;  2E70 A;  1YIT A;  3I5S A;  4FU6 A;  2DXC A;  4C8Q D;  3QHS A;  3PNW C;  1B07 A;  4M75 C;  4A54 A;  4MZT A;  2D6F A;  2AZS A;  3EGD B;  1HYO A;  4KT0 E;  2BUD A;  5CCA A;  3CCS T;  1PC0 A;  5GAN h;  1WHH A;  2KK4 A;  2CP0 A;  3TQ7 P;  3ZBD A;  1G3W A;  4C92 D;  4NS5 A;  5FWB A;  2RD1 A;  4BE0 A;  1M3B A;  3VU3 C;  2JUF A;  1ZA1 B;  4NL3 A;  1QLY A;  4A4G A;  2QDL A;  3A8M B;  2O4X B;  1VQ5 T;  2Z0W A;  1Z9Q A;  2F1L A;  4C0Z A;  1VQ6 T;  4B9X A;  2XDB A;  1YHQ Q;  1G3Y A;  1NPP A;  1R0B G;  2O31 A;  1VIE A;  3CPW A;  2XD0 A;  1UJY A;  2RQR A;  2O88 A;  3OMG A;  4C92 F;  1M4Z A;  4M78 F;  3CCQ T;  2XDD A;  2FO0 A;  1I07 A;  3REB B;  2OTJ T;  3RDV A;  4WF2 A;  1H64 1;  1IXD A;  3L2W A;  4KRT A;  5FRN A;  4IUT A;  3UAT A;  4C0D B;  1GL5 A;  1DJ7 B;  2NYS A;  2VWF A;  2KRN A;  1K4U S;  1QVG A;  2K2M A;  4C8Q C;  1HSQ A;  1GCP A;  4QKU A;  1G83 A;  3SDZ A;  3V7C A;  4M77 E;  2QEX A;  1NLO C;  3OYA A;  3M0R A;  1XNI A;  4J9C A;  4A53 A;  2CGH A;  4E7J A;  3UPU A;  1I5O B;  1VQ8 Q;  2E10 A;  5D7U A;  3OB9 A;  2W10 A;  3JCM Q;  2YRV A;  3QXE B;  4C92 C;  1Q86 U;  3GBQ A;  4M78 C;  1WI7 A;  2CRE A;  2DNU A;  4EDU A;  4UC4 A;  3MJX A;  1ACM B;  4E2F B;  1XTD A;  2EYW A;  3JB9 G;  2YUP A;  1BBZ A;  2RF0 A;  4F7U F;  3CPW S;  1OZ3 A;  5GMK e;  2O4X A;  2RJE A;  3M9Q A;  1YWP A;  1RAH B;  4N4H A;  3H0I A;  1BI0 A;  3OYB A;  1VQL Q;  1ZUU A;  1KK7 A;  3JB9 I;  1T0J A;  3VS5 A;  2HL5 C;  3E2U A;  2C0T A;  2DEU A;  1YI2 T;  1FMV A;  1VQN Q;  5KYX B;  2FRW A;  1BB9 A;  3MEW A;  3M0Q A;  4PJO D;  1HD3 A;  1LPL A;  4N0A C;  2ZCF B;  3WVD B;  5D6Y A;  5CQY A;  3EG0 A; 
#chains in the Genus database with same CATH homology
 3M57 A;  5GAM j;  5CAI A;  1Q7Y U;  3KUF A;  2O01 E;  4RG2 A;  1W2B S;  1WJQ A;  2XIC A;  3M5A A;  2CZ1 B;  3QII A;  4MDW A;  4BD3 A;  3MEU A;  2HBP A;  2RHU A;  3MEV A;  2CZ0 B;  5GAN 6;  1I5L A;  3HRU A;  3QKJ A;  1Y96 B;  1M1K U;  2E1H A;  1D3B B;  3HRS A;  1N6A A;  1VQK A;  3MP8 A;  4JLI A;  3NFC A;  3M4G A;  1M9S A;  4M78 D;  4NOY A;  2RO0 A;  4E7H A;  3LGF A;  1TH7 A;  5FU7 B;  5GAN j;  1JB0 E;  3SFM A;  2E64 A;  3CCM T;  5FLX E;  5LJ3 g;  3J81 E;  5LJ3 d;  4ZN3 A;  2JVV A;  1B34 B;  3RMS A;  4M7D C;  1BYM A;  2V8K A;  3OBY A;  2EFI A;  2RK1 A;  3JCM h;  4R56 A;  1KQS A;  3RUX A;  3JCM X;  2E5Q A;  1VQK T;  1NZ9 A;  2EJ9 A;  3I56 A;  3CCL T;  1VQ4 A;  2BKD N;  3G4S A;  3OS1 A;  3ASK A;  1SSF A;  2LT4 A;  4LDW A;  2DTH A;  4C8Q A;  3S3O A;  1RL2 A;  2D0Q B;  4N4G A;  4IKF A;  3OYG A;  3A8H B;  4BB7 A;  3OYM A;  3MO8 A;  5KCO A;  2FVU A;  3NTK A;  2DPP B;  2FYK A;  5J39 A;  2M16 A;  4J6X A;  3BFM A;  2MWP A;  4QVC A;  1YJ9 A;  3OYY A;  4KBM B;  4E7I A;  1VQ7 T;  3BDU A;  2A3L A;  2R5A A;  2RHZ A;  4HCB A;  2WAC A;  3HRT A;  2P4T A;  2DJZ A;  2K5F A;  3OMC A;  3I56 T;  2RI2 A;  1Y71 A;  3BDL A;  3S6W A;  1JRI A;  1FXX A;  3G4S T;  3OY9 A;  4M7D B;  4C8Q G;  4KUI A;  3RKY A;  4BY6 C;  3QYH B;  4FSX A;  3CCJ T;  4C92 A;  5GMK m;  2DO3 A;  2F5K A;  5GAM f;  3LWI A;  4ELZ C;  3E9F A;  3CBM A;  1Q82 C;  1BIA A;  3KXT A;  5HK3 A;  4M78 A;  4JS4 A;  1O75 A;  3LGL A;  3A8O B;  1YBY A;  2LTO A;  3LH0 A;  1U1T A;  3OSS C;  1YJ9 T;  5LJ3 j;  3PIO A;  4PJO C;  2K3Y A;  3OYJ A;  1LJO A;  1KHI A;  2L5Q A;  2M9U A;  3A8L B;  3MP6 A;  3N5B B;  4QQG A;  4DOW A;  5C0M A;  3CME A;  3CCU T;  2LRQ A;  2QA4 A;  2VGN A;  3A5Z B;  3EFR A;  5D6X A;  4QVD A;  5CR2 A;  2YLC A;  4C92 G;  2HQX A;  4JRP A;  5CVI A;  4EMG A;  4E7L A;  2K2V A;  2HAX A;  4FT2 A;  4IUU A;  1V29 B;  1ZQ1 A;  3FEO A;  3QJY A;  3CC7 A;  5GAO p;  3CCV A;  3KBG A;  1UGR B;  3OBW A;  4M75 E;  3NTH A;  3VUB A;  2P0Q A;  4BY6 B;  3EFS A;  1K73 C;  3WXM B;  5DLO A;  1YIJ T;  1UGQ B;  2HQE A;  4E7K A;  3J7A F;  3OSV A;  4M77 D;  4BDZ A;  1W4S A;  5CK9 A;  4ZGE B;  1Q7Y C;  2QA4 T;  2KQW A;  1UGP B;  4MZM A;  2C06 A;  3LYI A;  1P92 A;  3JCM V;  1WPY A;  1VQO A;  2DEQ A;  1Y96 A;  4PJO B;  1M1K C;  3BY7 A;  2DD4 A;  2E6Z A;  2MI6 A;  3VKI A;  1D3B A;  4XU0 A;  5LJ5 e;  2XDP A;  5CKD A;  2EQK A;  1N27 A;  4OB0 B;  1PSE A;  3PTA A;  3OYF A;  4M7A D;  4N0A A;  3HKS A;  1M5Q 1;  1KC8 U;  1LNX A;  2ZPF B;  3X28 B;  4PKC C;  2Y4X A;  2JTM A;  1B34 A;  5KH6 A;  4LDX A;  1HXD A;  1VQO T;  1HK9 A;  3PGG A;  3NTI A;  4M77 F;  2MAM A;  4JDS A;  5GAM e;  2JNG A;  2OAU A;  2X4J A;  5LL6 S;  3QYG B;  1Q86 C;  4KUL A;  3CCR A;  2LCC A;  4M78 B;  2H3J A;  4C5I A;  1VQM A;  2KSS A;  4OB2 B;  3QJ6 A;  3FIF A;  4M75 G;  3GIB A;  2GQV A;  2EQM A;  2JZ2 A;  3L2V A;  4ZGJ B;  3GNG A;  5J3B A;  3EAE A;  2QQ9 A;  3MP1 A;  3QPH A;  1YHQ A;  3UWN A;  2EJG A;  5A0G A;  2PVO B;  4M7A F;  3I55 T;  5GAN e;  1KD1 U;  2PVD B;  3DLM A;  1RI0 A;  2ZPI B;  4M7D A;  4JRK A;  4XTY A;  3CD6 T;  2DD5 A;  1QVG S;  4BDY A;  4PJO A;  4J7I A;  4OMF B;  4N4I A;  4XU1 A;  5FU6 C;  2RJF A;  1VQM T;  4C0F A;  2OTL A;  1ZHI A;  5GMK l;  3RKX A;  2HD0 A;  2EQU A;  3MEA A;  3C94 A;  3JCM g;  3JCM d;  1JJ2 A;  2FL7 A;  3HL8 A;  3QBY A;  3JAM E;  2R57 A;  4Y91 A;  2EQJ A;  2PUO B;  2ZGW A;  4LDV A;  3JCM c;  3V8J A;  2IVW A;  5GAO l;  1YHQ T;  4C8Q E;  1NJI C;  4PNO A;  4EMH A;  3SWN C;  2X4Y A;  5GMK h;  3S3M A;  4HA8 A;  4M7D G;  3X24 B;  2JOY A;  3HFO A;  3CCS A;  4CRI A;  3CEY A;  3M58 A;  3QDR B;  5GAM h;  2MWO A;  2XU8 A;  4HT9 A;  4PL6 A;  4OB3 B;  1M8V A;  4XU3 A;  5IAY A;  2OTL T;  2ZPE B;  3R6O A;  1IZ6 A;  4X9C A;  3HFN A;  4M77 C;  2VUB A;  3V8L A;  1XQH A;  2LDM A;  4QW2 A;  3UT1 A;  4BI4 A;  3J80 E;  4PLL A;  2RHY A;  2K5I A;  2CYZ B;  2P0P A;  2XI9 A;  4OVA A;  5FU6 B;  2DK3 A;  3ER0 A;  2LQ8 A;  3OYE A;  3GOX A;  2CZ6 B;  4OF1 A;  5KE2 A;  1FWZ A;  1G3T A;  4C92 E;  4ZTF A;  3LX7 A;  1KQ2 A;  3DLL A;  3E1S A;  4M78 E;  4XTX A;  3TRE A;  4VUB A;  2VXF A;  3TU4 K;  2YHT A;  2JTF A;  3CXC S;  1Q81 C;  4XTW A;  1S72 A;  4IUV A;  4LDU A;  4LD9 K;  3L2Z A;  1QVP A;  3SWN B;  5LJ3 e;  4M7A C;  1ZBX A;  4OP0 A;  3JRZ A;  3OW2 S;  1VQ6 A;  3SB2 A;  5LJ5 f;  5GAN 3;  3FJP A;  1OYX A;  1AHJ B;  2GF7 A;  4J5Y A;  3OS2 A;  1VQ8 A;  4F7U B;  3ZFJ A;  2CS7 A;  4EMK C;  2JN0 A;  2RJC A;  4HKE A;  4Y28 E;  1K9M U;  4A4K A;  4M77 B;  5HK0 A;  1UEB A;  4C8Q F;  3DB3 A;  1M90 C;  1O9S A;  2RB6 A;  2PQW A;  2KAF A;  3CBP A;  2XK0 A;  5HY6 A;  1U1S A;  5CQX A;  4PJO G;  1VQ4 T;  2PU9 B;  4RG8 A;  1S72 T;  5C6S A;  5GAO q;  1KG1 A;  2GFA A;  4DOV A;  3G71 A;  3RKW A;  2VGM A;  3M4Y A;  1BIB A;  4QQ6 A;  1VQ8 T;  3CC4 T;  3TCJ A;  2OTJ A;  4C0D C;  4DQ2 A;  3JCM b;  1QP3 A;  2ZPH B;  4Q5W A;  4M7A B;  3C95 A;  4X9D A;  5GAO m;  2EKO A;  4JRQ A;  4A4F A;  2Y90 A;  3MHX A;  3GP8 A;  4EMK B;  1BKB A;  5A0L A;  3JB9 D;  4C5H A;  3CMA A;  1WJR A;  1N8R U;  2KVQ G;  2QTX A;  1JJ2 S;  3HHT B;  3G71 T;  2DIG A;  2RHX A;  5GAN f;  4BE1 A;  3V7S A;  4O6J A;  1VQN A;  2P0K A;  2DZ9 A;  4M78 G;  3OYI A;  1PSF A;  3T9N A;  4FM4 B;  4DA4 A;  1K8A U;  4BI3 A;  2BIV A;  1N9R A;  3C12 A;  3LLR A;  3Q1J A;  1VQL A;  2RHI A;  2LCL A;  2MMP A;  3OYH A;  3M54 A;  3P8D A;  4BUG A;  3FDR A;  1JBM A;  3CME T;  1YJN A;  4M75 D;  1GXI E;  2DTI A;  3M59 A;  5J26 A;  5DY9 A;  2RA2 A;  1NPR A;  2V8J A;  2L8D A;  4TVR A;  2DIQ A;  4GLK A;  5GAN 8;  4ATO A;  3UDC A;  1VQP A;  1QVF A;  1VQN T;  3OYD A;  3CCV T;  3CC7 T;  1QW1 A;  4FL6 A;  2F69 A;  1KQS S;  1NE8 A;  4JUV A;  5EG2 A;  2DVE A;  3JB9 F;  4OB1 B;  4QQD A;  3RIR A;  2QQR A;  4JRI A;  2M1H A;  1WQ7 A;  4EPC A;  3DB4 A;  4M7D E;  5HKC A;  3X20 B;  2RJD A;  3PFS A;  2ZPB B;  1KQ1 A;  2X35 A;  1X6O A;  4IUQ A;  1OI1 A;  2VXE A;  2X4W A;  4J7F A;  4PLI A;  1KHC A;  1VQP T;  4C0G A;  5GAO r;  1X75 C;  2EAY A;  2L3R A;  4FIB A;  4J83 A;  1G3S A;  3M56 A;  2DXB A;  1VIF A;  3SWN A;  3L2R A;  4M75 F;  2QQB A;  3CC4 A;  3INZ A;  2K5L A;  5LJ3 f;  5KCH A;  2DTO A;  4Z02 A;  3VYH B;  3X25 B;  4F7U A;  3C4S A;  3QZ9 B;  4HCC A;  4ZN1 A;  1I4K 1;  3GF5 A;  5GAM g;  5GAN 7;  4M77 A;  4A4E A;  2F5T X;  3HSB A;  4FT4 A;  4KUD K;  2K3X A;  3O8V A;  3A8G B;  1R8O B;  3PIP A;  5IN1 A;  4R55 A;  2DXT A;  4J6Y A;  5LJ5 h;  1IRE B;  2G3R A;  2FB7 A;  3CCR T;  4MZP A;  5A0D A;  2EJF A;  1OZ2 A;  2DXU A;  3HPW A;  1VQ9 A;  3QG1 A;  4II1 A;  2E65 A;  2GFU A;  4P5N A;  3VJP A;  4F7U G;  5GAN 5;  1H3Z A;  2LT1 A;  2WSE E;  1QP2 A;  1YJW A;  5FRM A;  1Y7X A;  4M77 G;  4XAX B;  4M7A A;  4M7D F;  4PJO E;  3QUI A;  3G6E A;  1BI1 A;  1YCY A;  3P8B B;  3H8Z A;  4ELY C;  3LW5 E;  2X4X A;  2LNV A;  4EMK A;  4ZGD B;  5FRO A;  3BW1 A;  1N8R C;  4JLG A;  4C5E A;  3DKM A;  3QO3 A;  3G7Z A;  3M55 A;  2E70 A;  3JCM e;  1YIT A;  1VQ9 T;  3VV0 A;  4FU6 A;  4C8Q D;  2DXC A;  2L89 A;  4ME7 A;  2RM4 A;  3QHS A;  1YJW T;  4M7A G;  3HP9 A;  4XTZ A;  5CO7 A;  1QVF S;  1EIF A;  3PNW C;  3V8K A;  3AHU A;  5GMK j;  4M75 C;  3PMI A;  4A54 A;  1K73 U;  4MZT A;  2E12 A;  2D6F A;  1MGQ A;  2RI3 A;  4KT0 E;  3CCM A;  3JB9 J;  2BUD A;  2KDS A;  3OYN A;  5CCA A;  4O5V A;  3TEE A;  3CCS T;  5GAN h;  2KK4 A;  2EIF A;  1YIT T;  4B9W A;  1VQ5 A;  3ZBD A;  2KY9 A;  3FLG A;  1G3W A;  4C92 D;  2B8A A;  3CCL A;  3QZ5 B;  1G5V A;  2XID A;  4MML A;  4NS5 A;  4QVZ A;  4XQ3 A;  3JCM W;  2DKG A;  2LQK A;  4PJO F;  2RD1 A;  1KC8 C;  2KMT A;  4BE0 A;  3L2U A;  3VU3 C;  3ZEH A;  4XK8 E;  4MMK A;  4RKU E;  2E41 A;  2JUF A;  4M75 B;  4BI8 B;  4C5G A;  4NL3 A;  3L42 A;  4HCZ A;  4NL2 A;  2AHJ B;  1VQ7 A;  2ZZD A;  4A4G A;  5GAN 4;  3A8M B;  2O4X B;  3CCQ A;  1VQ5 T;  4C0Z A;  3OQ5 A;  3VUZ A;  2VV5 A;  1LOJ A;  3RES A;  4B9X A;  1VQ6 T;  1G3Y A;  2XDB A;  5KE3 A;  2CKK A;  2M0O A;  4XTU A;  3CCJ A;  1NPP A;  5IT9 E;  2HNI A;  3CPW A;  1VIE A;  2XD0 A;  2E6N A;  4V2S A;  2D9T A;  3FRN A;  5GAO n;  1U8R A;  3OMG A;  2Y4Y A;  4C92 F;  3X26 B;  1WJS A;  2DAQ A;  2QDY B;  1M4Z A;  3F70 A;  4XTV A;  5CKH A;  2V8I A;  2GCX A;  3OS0 A;  4M78 F;  3CCQ T;  1X01 A;  1BI3 A;  1WQW A;  4X34 A;  2XDD A;  3PMT A;  4HT8 A;  1KD1 C;  3CCU A;  5LJ3 h;  2XHC A;  2YLB A;  1MHN A;  2RK2 A;  3L1A A;  4L6V 5;  4WF2 A;  5CIU A;  2OTJ T;  1H64 1;  4LD6 A;  3L2W A;  5FRN A;  3CCE A;  1Y07 A;  2LC4 A;  3MET A;  3MCA B;  3PT9 A;  4IUT A;  2R5M A;  5I2M A;  3OS5 A;  4C0D B;  2RH2 A;  1DJ7 B;  1YIJ A;  2QQA A;  2WSF E;  1VQL T;  2QXF A;  3CMA T;  4RCC A;  5I21 A;  1NJI U;  2QQS A;  1QVG A;  3RER A;  4C8Q C;  3JB9 H;  4F7U E;  5I2S A;  3SDZ A;  3V7C A;  3URG A;  2LVM A;  3JCM f;  1WNL A;  4L59 A;  4M77 E;  5CKE A;  1M1G A;  2QEX A;  3OYA A;  3CCE T;  4IUR A;  1W2B A;  2QI2 A;  4BE2 A;  1N9S A;  1XNI A;  4J8O A;  3JCM P;  3GLX A;  3CC2 A;  4A53 A;  4RMO A;  2CGH A;  4E7J A;  1YJN T;  5LJ5 g;  3UPU A;  2A7Y A;  1I81 A;  1UB4 A;  5LJ5 d;  2E10 A;  2IG0 A;  4OGC A;  5M9O A;  3OA6 A;  3LWH A;  3OB9 A;  3FC3 A;  3JCM Q;  4IUP A;  2YRV A;  3QXE B;  4YTL A;  4C92 C;  3GPL A;  2VC8 A;  3ME9 A;  4L5G A;  1Q81 U;  1Q86 U;  4M7D D;  4M7A E;  4M78 C;  2K4Y A;  3SD4 A;  1WGS A;  3RMQ A;  5GAN 2;  2QEX T;  4C8Q B;  2RI5 A;  4E47 A;  4JJN K;  5CKF A;  3JCM J;  3CC2 T;  4RCB A;  3OYC A;  3CPF A;  3FB9 A;  4EDU A;  4LDY A;  1K9M C;  2LX9 A;  1YI2 A;  4UC4 A;  5GAM d;  5GMK i;  2I2L A;  3CXC A;  2DZC A;  1XTD A;  1M90 U;  3JB9 G;  3L2Q A;  4M75 A;  4OGE A;  3CPW S;  4F7U F;  3OW2 A;  2EYQ A;  1OZ3 A;  2PUK B;  2O4X A;  5D6W A;  5GMK e;  3E9G A;  1BI2 A;  3V7R A;  2RJE A;  3P8H A;  5CKB A;  4A4H A;  3I55 A;  2K57 A;  3M9Q A;  4BAC A;  4N4H A;  2FHD A;  4C92 B;  1BI0 A;  1FX7 A;  3E19 A;  3OYB A;  4ZTJ A;  5L8R E;  3JB9 I;  2XKO C;  1Q82 U;  3CD6 A;  1M1F A;  1VUB A;  2EWN A;  4J6W A;  3QSU A;  1I8F A;  5GAN g;  5A2Q E;  3JSC A;  1YI2 T;  5GAN d;  5DLQ E;  2ZPG B;  4CI0 C;  5LJ5 j;  3VYG A;  3CBO A;  3M53 A;  1XOV A;  5DM7 R;  2R58 A;  3MEW A;  2CZ7 B;  4XU2 A;  2XG8 D;  2NLU A;  3OYK A;  4PJO D;  2VYT A;  2MF2 A;  1UGS B;  4JS5 A;  2PVG B;  2ZCF B;  3GNF B;  4N0A C;  5FU7 C;  4MDX A;  2WSC E;  3WVD B;  5D6Y A;  4D6W A;  3H6Z A;  5AYF A;  4GY5 A;  3WVE B;  5CQY A;  1K8A C;  3S3N A;  3OYL A;  3G6E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...