3MEWA

Crystal structure of novel tudor domain-containing protein sgf29
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
157
Chain Sequence
TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 157
sequence length 159
ec nomenclature
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mewA02
2VYTA 4FU6A 2RJDA 4BDYA 5C6SA 3OYHA 3OYCA 3L2VA 1H3ZA 2M16A 2DIQA 4E7IA 3MP8A 2P0KA 4IURA 3L2WA 3LLRA 3BDLA 2LTOA 3S6WA 2RHYA 1RI0A 2BKDN 3PMTA 1WGSA 4QW2A 2L89A 2LVMA 3OYNA 4BACA 4BE0A 3MEAA 4C5IA 4BE1A 3H6ZA 4X34A 3FEOA 4IUPA 3GOXA 3P8HA 2X4XA 2IG0A 5CIUA 4ZTFA 4QQGA 3M9QA 2RO0A 4NS5A 3QKJA 2F5KA 3S3MA 2EFIA 3MP6A 4A4EA 5D6XA 2K3YA 2QQRA 2M1HA 3QIIA 1WJSA 3LX7A 2EKOA 5KCOA 4N4GA 2JZ2A 4PL6A 4A4FA 2HQXA 3OYEA 4OVAA 4Q5WA 5KH6A 2R58A 2O4XB 4BD3A 4ZTJA 2HQEA 3E9GA 1KHCA 3MEWA 5FRNA 5IAYA 3PNWC 2XDPA 3OB9A 1SSFA 4IUVA 4HCZA 2MWOA 2B8AA 2NLUA 2GFAA 2BIVA 2RJFA 2X35A 3QBYA 2X4YA 4E7LA 4C5EA 3OS0A 2DAQA 5M9OA 1OI1A 3OMCA 3PMIA 4QQDA 3ME9A 4N4IA 4C5HA 5FRMA 2L3RA 2O4XA 3OYDA 3OA6A 3OQ5A 5J26A 5KE2A 4IUUA 2EQMA 3Q1JA 3LH0A 2RI5A 4N4HA 3OYMA 4E7KA 3F70A 2FHDA 1OZ2A 2RI3A 3L2QA 5KCHA 1WJQA 4IUTA 1N27A 1G5VA 4QVZA 3MEVA 3LGFA 2GF7A 3LGLA 4FL6A 2WACA 3OYFA 1OZ3A 2LRQA 2YRVA 3NTKA 2EQUA 3ASKA 3UT1A 2LCCA 2XK0A 1OYXA 4E7HA 2X4WA 2PQWA 4QQ6A 4EDUA 4BDZA 5J39A 3LYIA 1MHNA 2BUDA 3KUFA 2RI2A 4UC4A 5D6YA 3OMGA 2MWPA 5FROA 4PLLA 2QQSA 4PLIA 3NTIA 5KE3A 2RJCA 2D9TA 3FLGA 3ZEHA 3OS1A 2R5AA 4C5GA 3S3NA 3PFSA 3OY9A 3OYGA 3OYJA 3UWNA 3OYKA 3L2RA 3MP1A 5D6WA 2RJEA 4L59A 4A4HA 2R57A 4GY5A 3OS2A 3OYIA 4RG2A 3OYAA 3OYLA 4BE2A 4A4GA 3DB4A 4E7JA 5C0MA 1XNIA 3OYBA 2EQKA 2K3XA 3SD4A 3L2UA 3O8VA 2JTFA 2RHXA 3MEUA 3META 4LD6A 2GFUA 3DLMA 2G3RA 3P8DA 2RHUA 4II1A 2E5QA 2EQJA 3L42A 5IN1A 4B9WA 3S3OA 2RHIA 4CRIA 3FC3A 2R5MA 4IUQA 4IKFA 2RHZA 2LDMA 3NTHA 2E6NA 3C4SA 3DB3A 2M0OA 2DIGA 2L8DA 4Z02A 1WJRA 3E9FA 4B9XA 2CKKA 3EAEA 3FDRA 3CEYA 3QJ6A 3H8ZA 3MO8A
chains in the Genus database with same CATH superfamily
3TQ7P 2EYXA 2CS7A 2M16A 3CMEA 3VV0A 4O6JA 2K9GA 2HMAA 1VQ6A 1Q86R 1WGSA 1QVGA 4BACA 4R56A 4C5IA 3RDVA 3FEOA 4ZGDB 2IG0A 1K9MR 1SF9A 1ABOA 2E65A 3CMAA 3QIIA 3PIOA 2JJ9A 3I5SA 4WF2A 1N8RC 3CCLA 1MNEA 4JZ4A 2YUNA 1X6GA 2LQWA 3H0IA 2DJQA 3CCLQ 2AIRB 2K7AA 2MWOA 2DKGA 2P84A 2XMFA 2GFAA 5LJ3g 2DD4A 2JS0A 3OS0A 2JUFA 2EGCA 2ROLA 1FMWA 3CCVT 2DPPB 4L6V5 2LX9A 2K5FA 2DX1A 1AZGB 1ZBJA 5GAOn 1VQ7T 1HYOA 2HKNA 4PJOB 3CCMT 1YI2T 1VQOA 3CC4T 1ZUYA 4N0AA 2F69A 2K3BA 1JXMA 1NG2A 1VQOQ 2DK3A 1ZBXA 3R6OA 2LJ3A 2KRMA 9ATCB 2A3LA 4PJOA 2F5TX 2X3XD 2W10A 3NTIA 3JCMJ 1WDXA 3UA6A 3PFSA 4JS5A 3OYJA 4RTVA 5I22A 4L59A 1W6XA 3REBB 1K0XA 2R57A 4ME7A 4RG8A 1WHMA 3X25B 1GCPA 3O8VA 1JBMA 2EYQA 3NPFA 4M7AC 2R5MA 1ZA1B 1M2VB 3G7ZA 1VQPT 1KQ2A 1KIKA 2VYTA 1S1NA 4M75C 3JCMX 3D7SB 3L2VA 1JJ2S 2WSFE 1QVFP 3G6EA 1SKUB 5LJ3j 1M2VA 1IB8A 1UGPB 3G6EQ 3G4SA 1HD3A 4F7UF 2OTJA 3G4SQ 3G71T 1JU5C 2QA4A 5HK3A 2OTJQ 3CCUQ 4HCKA 4B6MA 2QA4Q 4YTLA 5KCOA 4AFUC 2X9HA 5I11A 2GTOA 1U3OA 1C0MA 2E5KA 2QI2A 1AOJA 2C06A 3JCMh 4HCZA 4AG1C 2NLUA 2CP0A 3EGUA 5GANg 4C5EA 4ELYC 3AT1B 1TSFA 1UTIA 1D0XA 1G3TA 2E3HA 3ME9A 5I2SA 4DEYA 1N9SA 4KGZB 5J26A 4M7DC 4IUUA 3LH5A 3Q1JA 2EJFA 3A8MB 4M7AB 1FMKA 3JB9F 3VU3C 1FXXA 2FZCB 3EG9B 3TVTA 3EG3A 1QKWA 4M75B 1D3BB 4E7HA 2PQWA 2HL5C 4M7AA 2JMCA 3KFVA 1QW1A 1OU9A 2Y90A 2BUDA 5KYYB 2XDBA 2HNIA 2YDLA 1Q86C 1YWPA 3EG9A 4M75A 1D3BA 4J9IA 4KUDK 1QVPA 2L5QA 1BB9A 4MZTA 1XOVA 1JXOA 3L2RA 2JMAA 1G3SA 2JTMA 2CGHA 3C94A 5KYYA 3SWNA 4GY5A 4F16A 4BE2A 3DB4A 1U5SA 2EQKA 4LUEA 2HDAA 4FYVB 2DXCA 3RERA 2DRKA 2KK4A 4TVRA 1N5ZA 1RAEB 3IQLA 1YITA 1S72A 3VUBA 2EVRA 1OX8A 3M58A 3M4YA 3OYHA 4FYYB 5GAMd 4QT7A 1OPKA 1RAGB 1ZUKA 2E1HA 2V8JA 2O88A 4M7DB 4LN2A 3M0TA 3JCMW 1QLYA 1A0NB 5GANj 1WYXA 4M78E 4OMMA 3EGXB 2FZKB 3OS5A 3EG0A 2VXEA 4DEXA 2XDDA 3CPWS 4J9EA 3QDFA 4M77G 2KQWA 2K6DA 4M7DA 2RD1A 2VUBA 1UECA 5D6XA 2QQRA 3EGXA 2QQBA 3GF5A 4RTXA 2C0OA 4PJLA 5KYNA 3GIBA 2O01E 4AFZC 3GPLA 1KG1A 2E41A 5GAN3 2EGAA 1YP5A 5IHNA 2NYSA 3OW2S 2W0ZA 3CC7A 4IUVA 3BDUA 2X4YA 4E7ZA 4CC4B 2KSSA 2DEUA 2EBPA 4PJJA 1WQ7A 2A08A 2XU8A 1W4SA 4FW1A 1ZUUA 2YRCA 5GAMg 3P8BB 4Y91A 2F2VA 2EQUA 4Z8AA 2PVGB 2NWMA 4C92F 2COYA 3RMSA 5LJ3h 4UC4A 3C12A 2ECZA 5KYXB 1BI2A 1AT1B 4C5GA 2QK0A 1HSQA 1MV3A 3CCJQ 2VGNA 4M4ZA 4XU2A 2EW3A 2P0QA 2HSEB 3HFOA 1K0SA 5KYXA 3CCEQ 4L5GA 1I07A 1NLPC 4LD6A 2NUZA 1PSEA 1N8RU 1QCNA 3VRZA 2P0PA 5IH2A 3FB9A 2QAZA 3H8ZA 3I55A 1VQMQ 2E4HA 3CCRQ 3RKXA 4PJOD 4BY6C 1E6HA 1R77A 5A0GA 1VQKT 3VS5A 1IRXA 1YJ9T 1OQKA 3H6ZA 4JJBA 1KQ1A 1JRIA 3VS0A 1VQ8T 5GMKe 3S3MA 1RLQC 1OV3A 3CBPA 2O9VA 1WJSA 5GAN7 3BFMA 5GAMj 3M5AA 2HQXA 2KDSA 1UJYA 3FJPA 2DLPA 3M0RA 1Q7YU 3VS1A 2RJFA 2DVJA 1NPRA 4E7LA 2CT4A 4LDYA 4EMKC 1YWOA 5HY6A 2D1XA 1VQ4Q 2DL5A 3RUXA 2QYZA 1M3BA 1JEGA 1WPYA 1LVKA 2ZPIB 3VS6A 3UDCA 1N6AA 1KQSA 1AD5A 2PUKB 2A28A 5ECAA 1PRLC 1PNJA 3A8OB 5GAN4 4BY6B 1R8OB 5LJ3f 2RJCA 3HRSA 4AG2C 3M56A 5FW9A 2HBPA 3VS3A 2EJGA 1XNIA 2JXBA 3MEUA 2J7IA 4FT4A 1JB0E 1I81A 2RHUA 2E5QA 4MDWA 4M78C 2DTHA 4PFPA 5FU7C 3RNJA 2CZ0B 4OF1A 3CCJT 5LJ5d 1WJRA 1WHKA 2JVVA 4M7AD 2CZ7B 4EMKB 4BDYA 3CCET 4D6WA 1SG5A 3E2UA 1GFDA 4F7UG 4M75D 4NL3A 3L2WA 1WNLA 3CCQA 1RI0A 4FYXB 4C8QG 4EMGA 5GMKi 4EMKA 2CZ6B 3CCQQ 1M8VA 4C0ZA 2OAUA 5DY9A 3P8HA 2V8IA 3BY7A 1VQMT 3CCRT 5GJVB 2CUBA 2M1HA 2DEQA 3R6NA 4BB7A 3AHUA 2AHJB 1O75A 4A53A 2F1LA 4DBHA 1SRLA 3A8HB 2MOXA 1F1BB 1W70A 3JRZA 1Q7YR 1M3AA 5LL6S 2BIVA 2L2PA 4PNOA 4RCCA 2DF6A 1M1KU 2QDYB 3OYYA 2AZVA 2KT1A 1K76A 2JM8A 1K9MU 4MMLA 4Y92A 3VS4A 2MF2A 4M78B 2SRCA 5FU7B 5LJ5g 4M77F 2IVWA 4IUTA 4M7DD 2DMOA 4JRQA 1UJ0A 3LGLA 1N9RA 4J83A 1QVFS 2RQTA 2AT1B 3WXMB 5GAN5 4M78A 1VQ4T 2RMOA 1AVZC 4BDZA 4PJMA 3FIFA 2YUQA 3KUFA 2OJ2A 2RI2A 2HAXA 1OEBA 2BE9B 3OMGA 2MWPA 3RBBB 1BU1A 2DO3A 1AWXA 4PLIA 2BE7D 1KSWA 2ED1A 5KYWB 2JOYA 2ZZDA 5GAOp 3L1AA 2A37A 4OMOA 4JZ3A 2QGFB 4E47A 4OGEA 2LZ6B 1IREB 5KYWA 1C1AA 5GAMh 1M4ZA 3URGA 4HA8A 1BKBA 3P8DA 3VJPA 2RHIA 3MJXA 2VKNA 4OB0B 1YCSB 1MMDA 2ZPHB 2DIGA 1CSKA 3QJYA 2E10A 4Y28E 1UE9A 2NUTB 1NYFA 1SHGA 1YIJQ 1FX7A 3CXCP 3LLRA 3KBGA 4OB2B 3PMTA 3EGDB 2LVMA 1SSHA 1NM7A 1TH7A 1UGSB 2NUTA 2LJ0A 1RAFB 1Z9QA 2EFIA 5LJ5j 2B86A 3EGDA 1R0CB 4ESRA 2EKOA 2DYIA 2DFUA 4C0DC 4PL6A 3UF4A 1JJ2A 2O4XB 1KK7A 1KHCA 3CMEQ 1VYUA 2D8HA 2XDPA 2JN0A 3TREA 1VQ6Q 3A98A 2HQHA 2DAQA 1M1KR 1W1FA 4EPCA 2F2XA 2O4XA 3OA6A 2PVDB 2DBMA 1D0ZA 4N4HA 4OMLA 5GMKl 2CSQA 2DERA 4C92G 2LCSA 2XKOC 4FSSA 3CMAQ 2DL3A 1BCOA 3LGFA 4OB1B 5DM7R 2LJ1A 4J9DA 1X27A 2EWNA 3GBQA 1OX9A 2DBKA 3EHRA 5J39A 1VQNA 1MHNA 1WIEA 2QEXA 5A0LA 4KUIA 4AMCA 4QVCA 2RPNA 3ZEHA 3S3NA 3G1JA 2ED0A 4IIMA 2K2VA 1EFNA 4RMOA 2JS2A 1XTDA 5IXFA 2FZGB 4AT1B 4MZMA 2K5LA 2CT3A 4RTYA 1RAAB 1MMNA 2CP2A 2JNGA 4C0DB 4IIOA 5GAMf 2YRDA 1Q82R 2IIMA 2JTEA 2EQJA 4A4KA 4IUQA 2RHZA 2EJ9A 5DLOA 1Q7YC 3FDRA 2LT4A 2EGEA 1TG0A 2DIQA 2ESWA 4RTTA 2KYMA 4DA4A 1EZZB 3DKMA 1FWZA 4D8KA 2EQIA 2LQ8A 1UFFA 2EYYA 2X4XA 1YJWA 2ENMA 3SDZA 1U8RA 1SRMA 4LDVA 2ZCFB 1YIJT 3OSVA 1D1BA 3TEEA 1SHFA 1X2QA 4C0FA 1QCOA 2AZSA 2IPOB 1D1AA 3UPUA 4DBFA 3HSBA 3PNWC 3FRNA 2CDTA 2L0AA 4XU3A 5L8RE 3J80E 4JLIA 3OMCA 3EFOB 3CPWA 2LQKA 4C8QF 1WHJA 2OX7A 3QZ5B 5I2MA 2KAFA 4DOVA 2KMTA 3TCJA 5CO7A 3CMET 1X6OA 3JCMe 3EFOA 1VQ6T 3CQTA 2GF7A 4FL6A 3CPFA 1YFNA 4A63B 1UB4A 5CVIA 3OW2A 2M9UA 3I5RA 1IGUA 3WVDB 7AT1B 4E6RA 3LYIA 2FVUA 4XQ3A 1I0CA 1YJNA 2EYWA 1UG1A 2KBTA 1QP2A 3QWXX 1NEBA 1YJNQ 3CMAT 2A36A 3GP8A 4M7AG 1GFCA 2AKLA 3CCLT 4OMNA 5LJ5h 2RM4A 1W2BP 2X4JA 5L23A 4E7JA 3ZBDA 3L2UA 2FPDA 4JJDA 3GLXA 2FPEA 1U06A 4CRIA 4IKFA 1H3HA 4WTOB 4KT0E 1BYMA 4JJCA 4M78D 2CUDA 4EIKA 1M1KC 4KH1B 5GAOl 3MP8A 2P0KA 1K9MC 1VQOT 4M77C 2BKDN 2KI7A 3M0UA 3OYNA 1TXQA 1BIAA 4X34A 3JB9D 5CKHA 5CIUA 4FT2A 4F7UE 2RO0A 2K5IA 2E64A 4C8QE 3V8LA 1OPLA 1TU0B 1YITQ 1BI0A 1S72Q 1UHCA 4N4GA 4A4FA 6AT1B 2HL3A 3HL8A 1BK2A 4ZTJA 3E9GA 1QCFA 2P4RA 4Z88A 3QBYA 2KRNA 2X35A 2CP3A 2LX7A 1WFWA 2L3RA 3M0PA 3QDRB 1KFZA 1GRIA 1X75C 1M5Q1 1PHTA 4J8OA 3QO3A 3G6ET 2DL8A 5FLXE 2FEIA 4QVZA 2D6FA 2DNUA 1WI7A 3OYFA 3ASKA 3EG1A 2H3JA 1VQ9A 1PWTA 3G4ST 4BI8B 3OSSC 2A0FB 3CC7Q 2OTJT 3CCUT 4LNPA 4LUDA 4FW2A 2QA4T 4XK8E 2CYZB 4LXCA 3FJ5A 2JW4A 2MIOA 4RCBA 2A7YA 1BBZA 5CCAA 5LJ5f 5LJ3e 4PFOA 3PGGA 1PD0A 2K3XA 4E2FB 3SD4A 1TUDA 3QYGB 2KXDA 4JRIA 2G6FX 1VYTA 3EH1A 5IN1A 4KRTA 2E6NA 2XI9A 4F14A 2M0OA 4Z02A 1VQLA 1ZQ1A 1NYGA 3MO8A 2CP6A 2FYKA 3REAB 4J9BA 5C6SA 4LDXA 3LWHA 1AZEA 2HEQA 1YN8A 3JCMV 2RQUA 2RHYA 4O5VA 4FCYA 2FB7A 4BE0A 4PJOF 2RF0A 4OP0A 5IHIA 2VV5A 1X01A 1M1GA 3MPUB 3M9QA 2Y4XA 4KGVB 3UA7A 1QMCA 2X3WD 2PNIA 1GL5A 1RADB 1PKSA 1M1FA 2FRWA 4KULA 4J6XA 1OU8A 3H0HA 4XTZA 1QVGP 3TSWA 3I55Q 1E6GA 3ER0A 1MMGA 2CZ1B 4ORZA 4BD3A 1YHQA 2RQVA 5GAOm 1YHQQ 2ZPBB 3CC2A 2GQIA 1ZSZC 2GTJA 4HT9A 1GBRA 1XJWB 1YITT 3VS7A 1S72T 4XU0A 1Y07A 1VOMA 5KE2A 2YLCA 1E7OA 3A8GB 2MYSA 1PM3A 2COZA 2RI5A 1UHFA 3M53A 4PJNA 3CCSA 2KGTA 2KE9A 2K57A 1UDLA 2F2WA 4ZN1A 2MK5A 3CXCS 2LMJA 3ULRB 3I56A 1H641 5A0DA 4C92E 2EKHA 4MMKA 4NOYA 3I56Q 2QTXA 1UGRB 3E1SA 5CKDA 4FSXA 4AFSC 1D1CA 3OY9A 1ZSGA 3V7RA 3OYKA 3HRUA 1OULA 4VUBA 2MMPA 2OTLA 3OS2A 4RG2A 2V1QA 3CD6A 2FRYA 5C0MA 2OTLQ 5GANe 1QVFA 4EMHA 3HP9A 2DETA 4BI4A 2G3RA 4RTUA 3PVQA 1VQ5A 2YUPA 5J3BA 2BZYA 1EIFA 5CKEA 4ZGJB 3M57A 2PTKA 2ZGWA 3RESA 3E9FA 4B9XA 1ZSZB 2M0YA 4C8QC 1M3CA 1Z9ZA 2L3SA 5CKFA 1MV0B 3RKWA 4AFQC 1WHLA 2RQRA 2XICA 1V1CA 4RTZA 4M7AF 4CC3A 4FIBA 1KD1R 1O9SA 1WX6A 1LNXA 4M75F 4QQGA 3QKJA 3M59A 5AYFA 1VIEA 3MP6A 4DOWA 2MPXC 2MCNA 2KYBA 2PZ1A 3QXEB 3JCMd 4CI0C 4OVAA 1OOTA 2DA9A 1ZX6A 1V76A 5IAYA 4J6WA 1G3WA 2YSQA 1SSFA 1WLPB 2HBWA 2DYBA 2FL7A 4HVUA 4QQDA 1B3QA 1Q81R 2HZYA 3I55T 4R55A 1MUZA 1IXDA 1GBQA 4F7UB 5EC7A 4C8QB 2X4WA 2YLBA 1LCKA 2LC4A 3JB9I 1U1TA 4F7UA 4JPBW 4C8QA 4J7FA 1PKTA 1IZ6A 4PKCC 1P92A 3INZA 4A4GA 5HCKA 1VUBA 1QQJA 2YUOA 2LNHB 2DRMA 3NTHA 2LDMA 3DB3A 3CCVA 2J6OA 4OB3B 3THKA 3LWIA 2H8HA 1NJIU 5D7UA 3JSCA 5GAMe 1FMVA 2O31A 3MHXA 2L3QA 2LQNA 1VQ7A 4RTWA 1TUCA 2XIDA 3CCMA 1YI2A 1VQ7Q 1T3SA 3CC4A 3MEAA 1NPPA 2ZPGB 1Q82U 1BIBA 1KC8R 4XTXA 2F5KA 1I1JA 2QASA 2EYZA 2P4TA 3EFSA 3LX7A 2BZ8A 1X43A 3I35A 3RIRA 1TS9A 1D09B 1K73R 4ATOA 3HHTB 4J9FA 2KR3A 2B8AA 1W2BS 1RLPC 2FO0A 2KT8A 1RUWA 2ATCB 3PMIA 3I9QA 4C92C 4X9CA 5FRMA 3JAME 1VQPA 3M0SA 1I5LA 4QVDA 4J9GA 5KCHA 1PC0A 4M77E 5GAN8 4HCBA 4ZGEB 2QQAA 3CCQT 2LRQA 3V8JA 1PG5B 3LW5E 4N0AC 2NUPB 4QQ6A 2FPFA 5DLQE 1AEYA 1UGVA 4BUGA 2CSIA 2DE0X 2WSEE 2QQSA 2DILA 3G71A 3FLGA 1Y96B 1KD1C 3GNFB 2GBQA 2NUPA 3G71Q 3TSZA 1AWJA 4RUGA 5D6WA 4J7IA 2V8KA 4WCIA 2OI3A 4A54A 1Y96A 2YWWA 2YHTA 3A5ZB 3VKIA 4ZNXA 1I5OB 8AT1B 3JCMQ 3EFRA 3NHNA 1VQNQ 1C6VX 2QEXQ 2CKKA 3EAEA 3QJ6A 1CKBA 2RB6A 3H0FA 1RACB 3C0CA 1NJIR 1H3ZA 2I0NA 2PVOB 3BE3A 1PCXA 2Y4YA 4C92B 1Q81C 4PJOG 4E7IA 2FG0A 2LTOA 2J05A 4C92A 1M8MA 4XTUA 4PK4A 3WVEB 4FM4B 5GAN2 1I8FA 1Y7XA 3ZFJA 3H41A 3HRTA 3OYEA 2DXBA 4Q5WA 1J3TA 3EH2A 2GNCA 4OMPA 1H92A 4J5YA 1G8XA 2AKKA 3X28B 5GAN6 5IXBA 1YNZA 3PT9A 3JB9H 2VWFA 1WQWA 1RL2A 4C5HA 1NBEB 2CH4W 3T9NA 2E3IA 1YJWQ 1PRMC 2ZAEA 3OYMA 2RA2A 2RI3A 2DL7A 1LJOA 3QZ9B 1M27C 3U23A 2HD0A 2WACA 5GANd 4HCCA 3NGPA 4K11A 4V2SA 3HPWA 2V26A 3M0QA 3PVLA 2RK1A 1M9SA 1LOJA 5KE3A 2VXFA 4GLMA 4HKEA 4OMQA 1KQSP 3CBMA 3MCAB 1KC8C 3L2ZA 3SWNC 2CREA 2DM1A 1K8AU 1QVGS 2C0IA 5AT1B 3DLLA 2RQWA 4E7SA 1K73C 2QXFA 3CCUA 3FC3A 2AK5A 1WA7A 5LJ5e 3M55A 4LDUA 2RJDA 3OYCA 2XD0A 3PIPA 1D0YA 4HXJA 2GCXA 3UATA 4LD9K 3BDLA 3OBWA 4M78F 4R0KA 4M75G 4C8QD 5GMKm 2L89A 1VQNT 2QEXT 3M4GA 4CC7A 4DBRA 2DZCA 4NS5A 1WHGA 3QG1A 2QG9B 1G2BA 5HKCA 3VYHB 2LNVA 1M30A 1AHJB 2VASA 3ZL7C 4ZN3A 1PD1A 3MEWA 2CP7A 3OB9A 4JJNK 2QDLA 4XTWA 4DBQA 1QWEA 1ARKA 4ANJA 2KNBB 2YT6A 3SWNB 3M54A 5GMKj 3VYGA 3H9NA 3OQ5A 1G83A 3VS2A 2EQMA 4E7KA 3F70A 1V29B 3L2QA 1HXDA 4F17A 1JQQA 1N27A 1G5VA 4M7DG 3EHQA 2MI6A 1UUEA 3CBOA 1VQKA 2RNAA 1OYXA 3NMZC 2HSPA 1NJIC 1M90U 2DXUA 4P5NA 1R0BG 1YJ9A 1YJWT 1VQKQ 1VQ8A 5D6YA 1HJDA 1YJ9Q 2BTTA 1VQ8Q 2R5AA 1TUGB 1X6BA 1Q82C 1ACMB 2QQ9A 3E19A 1K8AR 3OYLA 1VIFA 5CQYA 2LP5A 2RHXA 4J9CA 2GFUA 3CXCA 1IHVA 2KXCA 3L42A 1VQ9Q 2O9SA 4X1VA 4JDSA 4KBMB 4M77B 3KXTA 1UGQB 2QTVA 1RAIB 4MDXA 2ZPEB 4FU6A 4MZPA 3HKSA 3HFNA 5FU6C 2ZPFB 2KY9A 3X24B 2JT4A 1ZLMA 2QGGA 4LE9A 4M77A 1K1ZA 3JCMc 5GAOq 3S6WA 4Z89A 2GGRA 2V1RA 4JUVA 2L3PA 2VB6A 3JCMf 1RAHB 1TTHB 4IUPA 1NEGA 3GOXA 4C0GA 4GBQA 1YJNT 5IHKA 2D8JA 3N5BB 4A4EA 2K3YA 4JLGA 2KRSA 4OGCA 5HK0A 2D0NA 1MGQA 1I4K1 2JZ2A 2VVKA 3TU4K 1VQLQ 2R58A 1EX4A 2DXTA 1ZA2B 1B07A 5FRNA 2LT1A 3SB2A 1KD1U 1IO6A 3PTAA 2KROA 1QWFA 2HKQB 5M9OA 2K4YA 1MMAA 3CCJA 4HT8A 1JJ2P 2YXYA 1K9AA 3LH0A 3QWYA 2PUOB 4C92D 3CCEA 1OZ2A 4RKUE 1VYVA 1WHHA 2XK0A 2DJZA 5FU6B 1M90R 4XU1A 1MNDA 1KJWA 3SHWA 2E12A 1T0JA 5FROA 2RN8A 2O2OA 4PLLA 5CQXA 5CAIA 1VQMA 1Q81U 3CCRA 3CC2Q 2J6KA 1HK9A 2X51A 2D9TA 3OS1A 1BCMA 3OYGA 1H8KA 1KHIA 1NLOC 4QKUA 4HVVA 1XQHA 1B7TA 3OYIA 3JCMP 1WXTA 4DQ2A 3CCSQ 2COWA 3HTRA 1WZOA 3OYBA 2RH2A 4JRPA 5FWBA 4KGXB 3DLMA 2M51A 4II1A 5CK9A 3S3OA 5IT9E 1M2OA 4JS4A 2EIFA 1RABB 4F04B 3CEYA 1FYNA 1Y57A 2M02A 1TOVA 4D8DA 5GMKh 4XTYA 4XAXB 4IURA 4XTVA 3OBYA 3RKYA 1VQ9T 1TWBA 3CC7T 4QW2A 5FWCA 2KEAA 2EAYA 2LCLA 3JCMb 1WXBA 3CD6Q 1VQ4A 2VGMA 1SPKA 2Z0WA 4PJOE 2EPDA 4ZTFA 1GCQC 1VQ5Q 3J81E 3EG2A 1T3LA 1QP3A 5KH6A 1AWOA 2RK2A 3QYHB 2DTIA 4GLKA 2JM9A 1YBYA 2J6FA 1ZSZA 1LPLA 5GANh 1KC8U 1K8AC 2DTOA 1BI3A 4N4IA 1U1SA 3QUIA 1VQLT 4LDWA 2KVQG 2FHDA 3VRYA 5CKBA 2WSCE 1WJQA 8ATCB 1K73U 2GQVA 3MEVA 2XG8D 3O5ZA 1OZ3A 2DVEA 2YRVA 2K2MA 3NTKA 2XHCA 4KH0B 1Q95G 2LCCA 3CPWP 3A1PA 5I21A 4EDUA 1W2BA 2H3EB 1NZ9A 4JRKA 1N8RR 1VA7A 3C95A 2I2LA 4HVWA 1Y71A 1GXIE 5GJWB 2RJEA 1K4US 1UEBA 3OW2P 4A4HA 1SEMA 1YHQT 3OYAA 5A2QE 2HCKA 4NL2A 1NE8A 2J06A 2C0TA 2D0QB 3MKDA 1PSFA 3CC2T 2DZ9A 1DJ7B 1IHWA 1GCQA 4M7DF 4M78G 1QKXA 2CH4A 3CCST 1X2KA 2VC8A 4OMFB 2BZXA 1G3YA 3JCMg 2CP5A 1Q86U 1CKAA 2E70A 3SFMA 5GAOr 4J6YA 3X20B 3QPHA 1T0HA 1ZHIA 4M7AE 3I56T 4BE1A 3SEMA 3JB9G 3V8KA 4M75E 4X9DA 3VUZA 1Y0MA 4ELZC 1M90C 3PE0A 2SEMA 3CCVQ 1KQSS 2OTLT 3A8LB 3RR6A 4PFZA 3CD6T 2HQEA 4BI3A 3JV3A 1VQ5T 3CCMQ 2OAWA 1IGQA 1YI2Q 4M77D 3CC4Q 1WXUA 1OI1A 3NFCA 5KYUB 5GANf 2ROTA 3OYDA 1YCYA 1X69A 1B34B 4CC2A 3V7CA 3QHSA 5KYUA 5EG2A 1ABQA 2K79A 2MAMA 3UT1A 5CR2A 1B34A 3RMQA 1JO8A 2E6ZA 3X26B 4M7DE 1YIJA 1RI9A 2DD5A 3GNGA 3UWNA 3MP1A 4J9HA 1VQPQ 4FYWB 3V7SA 5LJ3d 3J7AF 2PU9B 2ABLA 2JTFA 3QSUA 2DL4A 3META 3BW1A 1BI1A 3JB9J 4B9WA 3C4SA 1AWWA 4PJOC 2L8DA
chains in the Genus database with same CATH topology
4LDUA 2RJDA 2FYKA 4EMKB 2CS7A 5C6SA 4BDYA 3OYCA 3CCET 4LDXA 3LWHA 2XD0A 2M16A 4D6WA 3CMEA 4M7AD 3PIPA 2GCXA 3VV0A 4O6JA 4F7UG 4M75D 3JCMV 4NL3A 4LD9K 3L2WA 1VQ6A 3BDLA 3OBWA 4M78F 4C8QD 4M75G 1WNLA 2RHYA 5GMKm 3CCQA 1RI0A 4C8QG 4EMGA 1WGSA 5GMKi 4O5VA 2L89A 1QVGA 4BACA 4EMKA 2FB7A 4R56A 2CZ6B 4C5IA 4PJOF 4OP0A 4BE0A 1VQNT 2QEXT 3FEOA 3M4GA 2OAUA 5DY9A 4C0ZA 3P8HA 2VV5A 1M8VA 2V8IA 2IG0A 4ZGDB 1X01A 1M1GA 2DZCA 3BY7A 2Y4XA 3M9QA 4NS5A 1VQMT 3CCRT 2E65A 2M1HA 3CMAA 2DEQA 3QIIA 3PIOA 1M1FA 3QG1A 4BB7A 3AHUA 4KULA 4J6XA 4WF2A 2AHJB 5HKCA 4XTZA 1O75A 3VYHB 4A53A 1N8RC 3CCLA 2LNVA 3ER0A 1AHJB 2CZ1B 4ZN3A 1YHQA 4BD3A 3A8HB 3MEWA 3JRZA 3OB9A 5GAOm 5LL6S 2MWOA 5LJ3g 2DKGA 2ZPBB 2GFAA 2BIVA 2DD4A 4JJNK 4XTWA 3CC2A 4PNOA 3OS0A 4HT9A 4RCCA 1M1KU 3SWNB 2JUFA 3M54A 5GMKj 2QDYB 1YITT 3OYYA 1S72T 4XU0A 1Y07A 3VYGA 3CCVT 2DPPB 3OQ5A 4MMLA 4L6V5 5KE2A 1K9MU 2LX9A 2YLCA 2MF2A 2EQMA 3A8GB 2K5FA 2RI5A 4E7KA 4M78B 3F70A 5FU7B 5LJ5g 1V29B 3M53A 4M77F 2IVWA 5GAOn 3L2QA 1HXDA 3CCSA 1VQ7T 1VQ6T 4IUTA 1N27A 4M7DD 4JRQA 4PJOB 1G5VA 2K57A 4M7DG 3LGLA 3CCMT 1YI2T 1VQOA 1N9RA 2MI6A 4J83A 3CC4T 1QVFS 3CBOA 2F69A 4N0AA 4ZN1A 1VQKA 3WXMB 5GAN5 3CXCS 1OYXA 4M78A 1VQ4T 1NJIC 3I56A 1H641 5A0DA 1M90U 4C92E 2DK3A 2DXUA 1ZBXA 3FIFA 3R6OA 4P5NA 4BDZA 1YJ9A 3KUFA 1YJWT 2RI2A 2HAXA 4MMKA 4NOYA 5D6YA 1VQ8A 2A3LA 2QTXA 1UGRB 3OMGA 2F5TX 2MWPA 2DO3A 4PJOA 3E1SA 4PLIA 3NTIA 4FSXA 5CKDA 2JOYA 2ZZDA 5GAOp 2R5AA 3JCMJ 3PFSA 4JS5A 3OY9A 1Q82C 3OYJA 3L1AA 3V7RA 3OYKA 3HRUA 2QQ9A 4VUBA 4L59A 2R57A 2MMPA 2OTLA 3E19A 4ME7A 4RG2A 3OS2A 4E47A 4OGEA 3OYLA 3CD6A 1IREB 4RG8A 3X25B 5C0MA 1VIFA 5CQYA 5GANe 5GAMh 1M4ZA 3O8VA 3URGA 1QVFA 4HA8A 2RHXA 4EMHA 1BKBA 3HP9A 2GFUA 4BI4A 3CXCA 1JBMA 2G3RA 3P8DA 3VJPA 3L42A 5J3BA 1VQ5A 2EYQA 2RHIA 4M7AC 2R5MA 1EIFA 4JDSA 4OB0B 4KBMB 5CKEA 4M77B 2ZPHB 4ZGJB 3G7ZA 2DIGA 3M57A 1UGQB 3KXTA 1VQPT 2ZGWA 3RESA 3E9FA 4B9XA 1KQ2A 4MDXA 2ZPEB 2E10A 3QJYA 2VYTA 4FU6A 4M75C 4MZPA 4Y28E 3HKSA 3JCMX 3HFNA 4C8QC 5FU6C 3L2VA 2ZPFB 2KY9A 1JJ2S 5CKFA 3X24B 3RKWA 2WSFE 1FX7A 3G6EA 2XICA 3JCMc 4M77A 5LJ3j 5GAOq 3LLRA 1UGPB 3KBGA 3S6WA 4M7AF 4OB2B 3PMTA 2LVMA 4FIBA 4JUVA 1O9SA 3JCMf 1TH7A 1UGSB 3G4SA 4IUPA 3GOXA 4F7UF 4C0GA 1LNXA 2OTJA 1YJNT 4M75F 4QQGA 3QKJA 3G71T 2QA4A 3M59A 3N5BB 5AYFA 5HK3A 2EFIA 1VIEA 3MP6A 4A4EA 4DOWA 5LJ5j 2K3YA 4JLGA 4OGCA 5HK0A 2EKOA 4YTLA 5KCOA 3QXEB 3JCMd 1MGQA 1I4K1 2JZ2A 4PL6A 4C0DC 4CI0C 3TU4K 4OVAA 1JJ2A 2R58A 2DXTA 2O4XB 1KHCA 2QI2A 5IAYA 5FRNA 4J6WA 1G3WA 2C06A 2XDPA 1SSFA 3JCMh 2JN0A 4HCZA 2LT1A 3SB2A 3TREA 2NLUA 1KD1U 3PTAA 5GANg 4C5EA 4ELYC 2DAQA 2FL7A 5M9OA 1G3TA 4QQDA 3ME9A 2K4YA 4EPCA 5I2SA 3CCJA 2O4XA 3OA6A 4HT8A 1N9SA 5J26A 2PVDB 4IUUA 3I55T 4R55A 4M7DC 3Q1JA 3LH0A 4N4HA 2PUOB 2EJFA 3A8MB 4M7AB 4C92D 5GMKl 3CCEA 1OZ2A 3JB9F 3VU3C 4C92G 2XKOC 4RKUE 1FXXA 5DM7R 3LGFA 4OB1B 4F7UB 2EWNA 4M75B 2XK0A 4C8QB 1D3BB 2DJZA 5FU6B 4E7HA 2X4WA 2PQWA 2YLBA 4XU1A 4M7AA 1QW1A 5J39A 1VQNA 1MHNA 2BUDA 2Y90A 2QEXA 5A0LA 4KUIA 4QVCA 2E12A 2HNIA 2XDBA 5FROA 2LC4A 5CQXA 4PLLA 1U1TA 4F7UA 5CAIA 3JB9I 3CCRA 1VQMA 1Q81U 1HK9A 2D9TA 4M75A 3ZEHA 3OS1A 3S3NA 4C8QA 1D3BA 4J7FA 2K2VA 4RMOA 3OYGA 1XTDA 1QVPA 2L5QA 4KUDK 4MZTA 1XOVA 1KHIA 4MZMA 3L2RA 1G3SA 2JTMA 2K5LA 2CGHA 3C94A 1IZ6A 1XQHA 3SWNA 4GY5A 3OYIA 3JCMP 2JNGA 4PKCC 1P92A 3INZA 4A4GA 3DB4A 4DQ2A 4BE2A 3OYBA 2EQKA 1K73C 2RH2A 4JRPA 1VUBA 4C0DB 5GAMf 3DLMA 2DXCA 4II1A 2EQJA 5CK9A 3RERA 3S3OA 2KK4A 4TVRA 4A4KA 4IUQA 2RHZA 2LDMA 2EJ9A 3NTHA 5DLOA 5IT9E 3DB3A 1YITA 1S72A 1Q7YC 4JS4A 3CCVA 4OB3B 2EIFA 3FDRA 3VUBA 2LT4A 3CEYA 3LWIA 3M58A 3M4YA 3OYHA 5GMKh 1NJIU 5GAMd 2DIQA 3JSCA 5GAMe 3MHXA 1VQ7A 4XTYA 2XIDA 4XAXB 4IURA 2E1HA 2V8JA 4XTVA 3OBYA 4M7DB 3CCMA 3JCMW 1YI2A 3RKYA 3DKMA 4DA4A 1FWZA 5GANj 1VQ9T 4M78E 4QW2A 3CC4A 3CC7T 2EAYA 2LCLA 3JCMb 2LQ8A 3MEAA 1NPPA 2ZPGB 2VGMA 3OS5A 1VQ4A 2VXEA 1Q82U 1BIBA 2XDDA 2X4XA 3CPWS 3SDZA 4M77G 4ZTFA 1YJWA 1VQLA 4PJOE 1U8RA 2KQWA 4XTXA 2F5KA 4LDVA 2ZCFB 4M7DA 3J81E 1YIJT 2RD1A 2VUBA 2P4TA 5D6XA 3OSVA 2QQRA 3TEEA 3EFSA 3LX7A 3RIRA 2QQBA 3GF5A 4C0FA 1QP3A 3GIBA 2O01E 5KH6A 2RK2A 1KG1A 3GPLA 3QYHB 2DTIA 3UPUA 4ATOA 4GLKA 2E41A 3HHTB 5GAN3 3HSBA 1YBYA 3OW2S 3CC7A 3PNWC 3FRNA 4IUVA 3BDUA 2B8AA 1W2BS 2X4YA 4XU3A 5L8RE 3J80E 4JLIA 3OMCA 3PMIA 5GANh 1KC8U 3CPWA 1K8AC 2KSSA 2DTOA 1BI3A 4N4IA 2LQKA 1U1SA 4X9CA 4C92C 5FRMA 4C8QF 3QUIA 1VQLT 3QZ5B 3JAME 1VQPA 5I2MA 1WQ7A 4LDWA 2KVQG 2KAFA 4DOVA 2KMTA 3TCJA 1I5LA 2FHDA 5CO7A 3CMET 2XU8A 5CKBA 4QVDA 5KCHA 2WSCE 1W4SA 1WJQA 1X6OA 3JCMe 4M77E 5GAN8 1K73U 4HCBA 2GQVA 2QQAA 3MEVA 2GF7A 2XG8D 4FL6A 4ZGEB 3P8BB 5GAMg 4Y91A 3CCQT 1OZ3A 2DVEA 2LRQA 2YRVA 2EQUA 3CPFA 3NTKA 2XHCA 3V8JA 3LW5E 2LCCA 2PVGB 1UB4A 4N0AC 5CVIA 3OW2A 2M9UA 4C92F 4QQ6A 5DLQE 5I21A 4EDUA 3RMSA 3WVDB 1W2BA 3LYIA 2FVUA 4XQ3A 5LJ3h 1NZ9A 4UC4A 4JRKA 3C12A 4BUGA 1YJNA 3C95A 2WSEE 2QQSA 1BI2A 2I2LA 1QP2A 3G71A 3FLGA 1Y71A 1Y96B 3GNFB 4C5GA 1KD1C 3CMAT 1GXIE 4M7AG 3GP8A 2VGNA 4XU2A 5D6WA 3CCLT 2P0QA 2RJEA 1UEBA 4J7IA 2V8KA 4A4HA 5LJ5h 3HFOA 2RM4A 1YHQT 4L5GA 5A2QE 2X4JA 3OYAA 4NL2A 4E7JA 4A54A 1Y96A 3ZBDA 1NE8A 3L2UA 2YHTA 3A5ZB 2D0QB 4LD6A 1PSFA 3CC2T 2DZ9A 3VKIA 1DJ7B 3GLXA 4CRIA 4IKFA 4M7DF 1PSEA 4KT0E 3JCMQ 1N8RU 3EFRA 1BYMA 2P0PA 4M78D 3FB9A 2CKKA 3EAEA 3QJ6A 4M78G 3H8ZA 3I55A 2RB6A 3RKXA 1Q86C 3CCST 1H3ZA 1M1KC 4PJOD 2PVOB 4BY6C 2VC8A 2Y4YA 4C92B 1Q81C 4PJOG 5GAOl 4E7IA 3MP8A 4OMFB 2P0KA 1K9MC 1VQOT 1G3YA 2LTOA 4M77C 3JCMg 5A0GA 1Q86U 2E70A 3SFMA 1VQKT 5GAOr 2BKDN 4J6YA 3QPHA 3X20B 1ZHIA 4M7AE 3OYNA 3I56T 4BE1A 1YJ9T 1BIAA 3H6ZA 4X34A 1KQ1A 3JB9D 1JRIA 1VQ8T 4C92A 5CKHA 4XTUA 5CIUA 4FT2A 4F7UE 3JB9G 2RO0A 2K5IA 3WVEB 2E64A 5GMKe 4FM4B 3V8KA 3S3MA 4M75E 4X9DA 3VUZA 4C8QE 3CBPA 3V8LA 4ELZC 5GAN2 1I8FA 1M90C 1Y7XA 1WJSA 1BI0A 5GAN7 3BFMA 3ZFJA 5GAMj 4N4GA 3M5AA 3HRTA 4A4FA 1KQSS 2HQXA 2KDSA 3OYEA 2DXBA 4Q5WA 2OTLT 3FJPA 3A8LB 3HL8A 3CD6T 4ZTJA 2HQEA 3E9GA 4BI3A 4J5YA 1Q7YU 3X28B 5GAN6 3QBYA 2RJFA 2X35A 1VQ5T 1NPRA 3PT9A 4E7LA 4LDYA 4EMKC 4M77D 5HY6A 3JB9H 1OI1A 3NFCA 1WQWA 1RL2A 5GANf 4C5HA 2L3RA 3T9NA 3OYDA 3RUXA 1YCYA 3QDRB 1B34B 1X75C 3OYMA 1WPYA 1M5Q1 4J8OA 2RA2A 2RI3A 2ZPIB 3QO3A 1LJOA 3V7CA 3G6ET 3QHSA 3QZ9B 5FLXE 5EG2A 3UDCA 1N6AA 1KQSA 4QVZA 2D6FA 2HD0A 2PUKB 2WACA 3OYFA 5GANd 4HCCA 3ASKA 2MAMA 2H3JA 1VQ9A 3UT1A 5CR2A 1B34A 4V2SA 3G4ST 3RMQA 4BI8B 3A8OB 3OSSC 4BY6B 5GAN4 3HPWA 2E6ZA 2OTJT 1R8OB 3X26B 3CCUT 5LJ3f 4M7DE 2RK1A 2QA4T 1M9SA 4XK8E 1LOJA 2CYZB 5KE3A 2RJCA 1YIJA 2VXFA 4HKEA 3HRSA 4RCBA 3CBMA 3MCAB 2A7YA 2DD5A 3GNGA 3M56A 3MP1A 3UWNA 1KC8C 3L2ZA 3V7SA 2HBPA 5CCAA 3SWNC 2EJGA 5LJ3d 5LJ5f 1K8AU 5LJ3e 2PU9B 3J7AF 1QVGS 3PGGA 1XNIA 3DLLA 2K3XA 3SD4A 3QYGB 2JTFA 3MEUA 3QSUA 4JRIA 3META 3BW1A 4FT4A 1JB0E 1BI1A 3JB9J 2RHUA 1I81A 2E5QA 4MDWA 4M78C 5IN1A 4B9WA 2QXFA 2DTHA 3CCUA 5FU7C 3FC3A 2CZ0B 4OF1A 2E6NA 2XI9A 3CCJT 3C4SA 2M0OA 4PJOC 2L8DA 4Z02A 5LJ5d 1WJRA 2JVVA 5LJ5e 1ZQ1A 2CZ7B 3MO8A 3M55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  4FU6 A;  2RJD A;  4BDY A;  5C6S A;  3OYH A;  3OYC A;  3L2V A;  1H3Z A;  2M16 A;  2DIQ A;  4E7I A;  3MP8 A;  2P0K A;  4IUR A;  3L2W A;  3LLR A;  3BDL A;  2LTO A;  3S6W A;  2RHY A;  1RI0 A;  2BKD N;  3PMT A;  1WGS A;  4QW2 A;  2L89 A;  2LVM A;  3OYN A;  4BAC A;  4BE0 A;  3MEA A;  4C5I A;  4BE1 A;  3H6Z A;  4X34 A;  3FEO A;  4IUP A;  3GOX A;  3P8H A;  2X4X A;  2IG0 A;  5CIU A;  4ZTF A;  4QQG A;  3M9Q A;  2RO0 A;  4NS5 A;  3QKJ A;  2F5K A;  3S3M A;  2EFI A;  3MP6 A;  4A4E A;  5D6X A;  2K3Y A;  2QQR A;  2M1H A;  3QII A;  1WJS A;  3LX7 A;  2EKO A;  5KCO A;  4N4G A;  2JZ2 A;  4PL6 A;  4A4F A;  2HQX A;  3OYE A;  4OVA A;  4Q5W A;  5KH6 A;  2R58 A;  2O4X B;  4BD3 A;  4ZTJ A;  2HQE A;  3E9G A;  1KHC A;  3MEW A;  5FRN A;  5IAY A;  3PNW C;  2XDP A;  3OB9 A;  1SSF A;  4IUV A;  4HCZ A;  2MWO A;  2B8A A;  2NLU A;  2GFA A;  2BIV A;  2RJF A;  2X35 A;  3QBY A;  2X4Y A;  4E7L A;  4C5E A;  3OS0 A;  2DAQ A;  5M9O A;  1OI1 A;  3OMC A;  3PMI A;  4QQD A;  3ME9 A;  4N4I A;  4C5H A;  5FRM A;  2L3R A;  2O4X A;  3OYD A;  3OA6 A;  3OQ5 A;  5J26 A;  5KE2 A;  4IUU A;  2EQM A;  3Q1J A;  3LH0 A;  2RI5 A;  4N4H A;  3OYM A;  4E7K A;  3F70 A;  2FHD A;  1OZ2 A;  2RI3 A;  3L2Q A;  5KCH A;  1WJQ A;  4IUT A;  1N27 A;  1G5V A;  4QVZ A;  3MEV A;  3LGF A;  2GF7 A;  3LGL A;  4FL6 A;  2WAC A;  3OYF A;  1OZ3 A;  2LRQ A;  2YRV A;  3NTK A;  2EQU A;  3ASK A;  3UT1 A;  2LCC A;  2XK0 A;  1OYX A;  4E7H A;  2X4W A;  2PQW A;  4QQ6 A;  4EDU A;  4BDZ A;  5J39 A;  3LYI A;  1MHN A;  2BUD A;  3KUF A;  2RI2 A;  4UC4 A;  5D6Y A;  3OMG A;  2MWP A;  5FRO A;  4PLL A;  2QQS A;  4PLI A;  3NTI A;  5KE3 A;  2RJC A;  2D9T A;  3FLG A;  3ZEH A;  3OS1 A;  2R5A A;  4C5G A;  3S3N A;  3PFS A;  3OY9 A;  3OYG A;  3OYJ A;  3UWN A;  3OYK A;  3L2R A;  3MP1 A;  5D6W A;  2RJE A;  4L59 A;  4A4H A;  2R57 A;  4GY5 A;  3OS2 A;  3OYI A;  4RG2 A;  3OYA A;  3OYL A;  4BE2 A;  4A4G A;  3DB4 A;  4E7J A;  5C0M A;  1XNI A;  3OYB A;  2EQK A;  2K3X A;  3SD4 A;  3L2U A;  3O8V A;  2JTF A;  2RHX A;  3MEU A;  3MET A;  4LD6 A;  2GFU A;  3DLM A;  2G3R A;  3P8D A;  2RHU A;  4II1 A;  2E5Q A;  2EQJ A;  3L42 A;  5IN1 A;  4B9W A;  3S3O A;  2RHI A;  4CRI A;  3FC3 A;  2R5M A;  4IUQ A;  4IKF A;  2RHZ A;  2LDM A;  3NTH A;  2E6N A;  3C4S A;  3DB3 A;  2M0O A;  2DIG A;  2L8D A;  4Z02 A;  1WJR A;  3E9F A;  4B9X A;  2CKK A;  3EAE A;  3FDR A;  3CEY A;  3QJ6 A;  3H8Z A;  3MO8 A; 
#chains in the Genus database with same CATH topology
 3TQ7 P;  2EYX A;  2CS7 A;  2M16 A;  3CME A;  3VV0 A;  4O6J A;  2K9G A;  2HMA A;  1VQ6 A;  1Q86 R;  1WGS A;  1QVG A;  4BAC A;  4R56 A;  4C5I A;  3RDV A;  3FEO A;  4ZGD B;  2IG0 A;  1K9M R;  1SF9 A;  1ABO A;  2E65 A;  3CMA A;  3QII A;  3PIO A;  2JJ9 A;  3I5S A;  4WF2 A;  1N8R C;  3CCL A;  1MNE A;  4JZ4 A;  2YUN A;  1X6G A;  2LQW A;  3H0I A;  2DJQ A;  3CCL Q;  2AIR B;  2K7A A;  2MWO A;  2DKG A;  2P84 A;  2XMF A;  2GFA A;  5LJ3 g;  2DD4 A;  2JS0 A;  3OS0 A;  2JUF A;  2EGC A;  2ROL A;  1FMW A;  3CCV T;  2DPP B;  4L6V 5;  2LX9 A;  2K5F A;  2DX1 A;  1AZG B;  1ZBJ A;  5GAO n;  1VQ7 T;  1HYO A;  2HKN A;  4PJO B;  3CCM T;  1YI2 T;  1VQO A;  3CC4 T;  1ZUY A;  4N0A A;  2F69 A;  2K3B A;  1JXM A;  1NG2 A;  1VQO Q;  2DK3 A;  1ZBX A;  3R6O A;  2LJ3 A;  2KRM A;  9ATC B;  2A3L A;  4PJO A;  2F5T X;  2X3X D;  2W10 A;  3NTI A;  3JCM J;  1WDX A;  3UA6 A;  3PFS A;  4JS5 A;  3OYJ A;  4RTV A;  5I22 A;  4L59 A;  1W6X A;  3REB B;  1K0X A;  2R57 A;  4ME7 A;  4RG8 A;  1WHM A;  3X25 B;  1GCP A;  3O8V A;  1JBM A;  2EYQ A;  3NPF A;  4M7A C;  2R5M A;  1ZA1 B;  1M2V B;  3G7Z A;  1VQP T;  1KQ2 A;  1KIK A;  2VYT A;  1S1N A;  4M75 C;  3JCM X;  3D7S B;  3L2V A;  1JJ2 S;  2WSF E;  1QVF P;  3G6E A;  1SKU B;  5LJ3 j;  1M2V A;  1IB8 A;  1UGP B;  3G6E Q;  3G4S A;  1HD3 A;  4F7U F;  2OTJ A;  3G4S Q;  3G71 T;  1JU5 C;  2QA4 A;  5HK3 A;  2OTJ Q;  3CCU Q;  4HCK A;  4B6M A;  2QA4 Q;  4YTL A;  5KCO A;  4AFU C;  2X9H A;  5I11 A;  2GTO A;  1U3O A;  1C0M A;  2E5K A;  2QI2 A;  1AOJ A;  2C06 A;  3JCM h;  4HCZ A;  4AG1 C;  2NLU A;  2CP0 A;  3EGU A;  5GAN g;  4C5E A;  4ELY C;  3AT1 B;  1TSF A;  1UTI A;  1D0X A;  1G3T A;  2E3H A;  3ME9 A;  5I2S A;  4DEY A;  1N9S A;  4KGZ B;  5J26 A;  4M7D C;  4IUU A;  3LH5 A;  3Q1J A;  2EJF A;  3A8M B;  4M7A B;  1FMK A;  3JB9 F;  3VU3 C;  1FXX A;  2FZC B;  3EG9 B;  3TVT A;  3EG3 A;  1QKW A;  4M75 B;  1D3B B;  4E7H A;  2PQW A;  2HL5 C;  4M7A A;  2JMC A;  3KFV A;  1QW1 A;  1OU9 A;  2Y90 A;  2BUD A;  5KYY B;  2XDB A;  2HNI A;  2YDL A;  1Q86 C;  1YWP A;  3EG9 A;  4M75 A;  1D3B A;  4J9I A;  4KUD K;  1QVP A;  2L5Q A;  1BB9 A;  4MZT A;  1XOV A;  1JXO A;  3L2R A;  2JMA A;  1G3S A;  2JTM A;  2CGH A;  3C94 A;  5KYY A;  3SWN A;  4GY5 A;  4F16 A;  4BE2 A;  3DB4 A;  1U5S A;  2EQK A;  4LUE A;  2HDA A;  4FYV B;  2DXC A;  3RER A;  2DRK A;  2KK4 A;  4TVR A;  1N5Z A;  1RAE B;  3IQL A;  1YIT A;  1S72 A;  3VUB A;  2EVR A;  1OX8 A;  3M58 A;  3M4Y A;  3OYH A;  4FYY B;  5GAM d;  4QT7 A;  1OPK A;  1RAG B;  1ZUK A;  2E1H A;  2V8J A;  2O88 A;  4M7D B;  4LN2 A;  3M0T A;  3JCM W;  1QLY A;  1A0N B;  5GAN j;  1WYX A;  4M78 E;  4OMM A;  3EGX B;  2FZK B;  3OS5 A;  3EG0 A;  2VXE A;  4DEX A;  2XDD A;  3CPW S;  4J9E A;  3QDF A;  4M77 G;  2KQW A;  2K6D A;  4M7D A;  2RD1 A;  2VUB A;  1UEC A;  5D6X A;  2QQR A;  3EGX A;  2QQB A;  3GF5 A;  4RTX A;  2C0O A;  4PJL A;  5KYN A;  3GIB A;  2O01 E;  4AFZ C;  3GPL A;  1KG1 A;  2E41 A;  5GAN 3;  2EGA A;  1YP5 A;  5IHN A;  2NYS A;  3OW2 S;  2W0Z A;  3CC7 A;  4IUV A;  3BDU A;  2X4Y A;  4E7Z A;  4CC4 B;  2KSS A;  2DEU A;  2EBP A;  4PJJ A;  1WQ7 A;  2A08 A;  2XU8 A;  1W4S A;  4FW1 A;  1ZUU A;  2YRC A;  5GAM g;  3P8B B;  4Y91 A;  2F2V A;  2EQU A;  4Z8A A;  2PVG B;  2NWM A;  4C92 F;  2COY A;  3RMS A;  5LJ3 h;  4UC4 A;  3C12 A;  2ECZ A;  5KYX B;  1BI2 A;  1AT1 B;  4C5G A;  2QK0 A;  1HSQ A;  1MV3 A;  3CCJ Q;  2VGN A;  4M4Z A;  4XU2 A;  2EW3 A;  2P0Q A;  2HSE B;  3HFO A;  1K0S A;  5KYX A;  3CCE Q;  4L5G A;  1I07 A;  1NLP C;  4LD6 A;  2NUZ A;  1PSE A;  1N8R U;  1QCN A;  3VRZ A;  2P0P A;  5IH2 A;  3FB9 A;  2QAZ A;  3H8Z A;  3I55 A;  1VQM Q;  2E4H A;  3CCR Q;  3RKX A;  4PJO D;  4BY6 C;  1E6H A;  1R77 A;  5A0G A;  1VQK T;  3VS5 A;  1IRX A;  1YJ9 T;  1OQK A;  3H6Z A;  4JJB A;  1KQ1 A;  1JRI A;  3VS0 A;  1VQ8 T;  5GMK e;  3S3M A;  1RLQ C;  1OV3 A;  3CBP A;  2O9V A;  1WJS A;  5GAN 7;  3BFM A;  5GAM j;  3M5A A;  2HQX A;  2KDS A;  1UJY A;  3FJP A;  2DLP A;  3M0R A;  1Q7Y U;  3VS1 A;  2RJF A;  2DVJ A;  1NPR A;  4E7L A;  2CT4 A;  4LDY A;  4EMK C;  1YWO A;  5HY6 A;  2D1X A;  1VQ4 Q;  2DL5 A;  3RUX A;  2QYZ A;  1M3B A;  1JEG A;  1WPY A;  1LVK A;  2ZPI B;  3VS6 A;  3UDC A;  1N6A A;  1KQS A;  1AD5 A;  2PUK B;  2A28 A;  5ECA A;  1PRL C;  1PNJ A;  3A8O B;  5GAN 4;  4BY6 B;  1R8O B;  5LJ3 f;  2RJC A;  3HRS A;  4AG2 C;  3M56 A;  5FW9 A;  2HBP A;  3VS3 A;  2EJG A;  1XNI A;  2JXB A;  3MEU A;  2J7I A;  4FT4 A;  1JB0 E;  1I81 A;  2RHU A;  2E5Q A;  4MDW A;  4M78 C;  2DTH A;  4PFP A;  5FU7 C;  3RNJ A;  2CZ0 B;  4OF1 A;  3CCJ T;  5LJ5 d;  1WJR A;  1WHK A;  2JVV A;  4M7A D;  2CZ7 B;  4EMK B;  4BDY A;  3CCE T;  4D6W A;  1SG5 A;  3E2U A;  1GFD A;  4F7U G;  4M75 D;  4NL3 A;  3L2W A;  1WNL A;  3CCQ A;  1RI0 A;  4FYX B;  4C8Q G;  4EMG A;  5GMK i;  4EMK A;  2CZ6 B;  3CCQ Q;  1M8V A;  4C0Z A;  2OAU A;  5DY9 A;  3P8H A;  2V8I A;  3BY7 A;  1VQM T;  3CCR T;  5GJV B;  2CUB A;  2M1H A;  2DEQ A;  3R6N A;  4BB7 A;  3AHU A;  2AHJ B;  1O75 A;  4A53 A;  2F1L A;  4DBH A;  1SRL A;  3A8H B;  2MOX A;  1F1B B;  1W70 A;  3JRZ A;  1Q7Y R;  1M3A A;  5LL6 S;  2BIV A;  2L2P A;  4PNO A;  4RCC A;  2DF6 A;  1M1K U;  2QDY B;  3OYY A;  2AZV A;  2KT1 A;  1K76 A;  2JM8 A;  1K9M U;  4MML A;  4Y92 A;  3VS4 A;  2MF2 A;  4M78 B;  2SRC A;  5FU7 B;  5LJ5 g;  4M77 F;  2IVW A;  4IUT A;  4M7D D;  2DMO A;  4JRQ A;  1UJ0 A;  3LGL A;  1N9R A;  4J83 A;  1QVF S;  2RQT A;  2AT1 B;  3WXM B;  5GAN 5;  4M78 A;  1VQ4 T;  2RMO A;  1AVZ C;  4BDZ A;  4PJM A;  3FIF A;  2YUQ A;  3KUF A;  2OJ2 A;  2RI2 A;  2HAX A;  1OEB A;  2BE9 B;  3OMG A;  2MWP A;  3RBB B;  1BU1 A;  2DO3 A;  1AWX A;  4PLI A;  2BE7 D;  1KSW A;  2ED1 A;  5KYW B;  2JOY A;  2ZZD A;  5GAO p;  3L1A A;  2A37 A;  4OMO A;  4JZ3 A;  2QGF B;  4E47 A;  4OGE A;  2LZ6 B;  1IRE B;  5KYW A;  1C1A A;  5GAM h;  1M4Z A;  3URG A;  4HA8 A;  1BKB A;  3P8D A;  3VJP A;  2RHI A;  3MJX A;  2VKN A;  4OB0 B;  1YCS B;  1MMD A;  2ZPH B;  2DIG A;  1CSK A;  3QJY A;  2E10 A;  4Y28 E;  1UE9 A;  2NUT B;  1NYF A;  1SHG A;  1YIJ Q;  1FX7 A;  3CXC P;  3LLR A;  3KBG A;  4OB2 B;  3PMT A;  3EGD B;  2LVM A;  1SSH A;  1NM7 A;  1TH7 A;  1UGS B;  2NUT A;  2LJ0 A;  1RAF B;  1Z9Q A;  2EFI A;  5LJ5 j;  2B86 A;  3EGD A;  1R0C B;  4ESR A;  2EKO A;  2DYI A;  2DFU A;  4C0D C;  4PL6 A;  3UF4 A;  1JJ2 A;  2O4X B;  1KK7 A;  1KHC A;  3CME Q;  1VYU A;  2D8H A;  2XDP A;  2JN0 A;  3TRE A;  1VQ6 Q;  3A98 A;  2HQH A;  2DAQ A;  1M1K R;  1W1F A;  4EPC A;  2F2X A;  2O4X A;  3OA6 A;  2PVD B;  2DBM A;  1D0Z A;  4N4H A;  4OML A;  5GMK l;  2CSQ A;  2DER A;  4C92 G;  2LCS A;  2XKO C;  4FSS A;  3CMA Q;  2DL3 A;  1BCO A;  3LGF A;  4OB1 B;  5DM7 R;  2LJ1 A;  4J9D A;  1X27 A;  2EWN A;  3GBQ A;  1OX9 A;  2DBK A;  3EHR A;  5J39 A;  1VQN A;  1MHN A;  1WIE A;  2QEX A;  5A0L A;  4KUI A;  4AMC A;  4QVC A;  2RPN A;  3ZEH A;  3S3N A;  3G1J A;  2ED0 A;  4IIM A;  2K2V A;  1EFN A;  4RMO A;  2JS2 A;  1XTD A;  5IXF A;  2FZG B;  4AT1 B;  4MZM A;  2K5L A;  2CT3 A;  4RTY A;  1RAA B;  1MMN A;  2CP2 A;  2JNG A;  4C0D B;  4IIO A;  5GAM f;  2YRD A;  1Q82 R;  2IIM A;  2JTE A;  2EQJ A;  4A4K A;  4IUQ A;  2RHZ A;  2EJ9 A;  5DLO A;  1Q7Y C;  3FDR A;  2LT4 A;  2EGE A;  1TG0 A;  2DIQ A;  2ESW A;  4RTT A;  2KYM A;  4DA4 A;  1EZZ B;  3DKM A;  1FWZ A;  4D8K A;  2EQI A;  2LQ8 A;  1UFF A;  2EYY A;  2X4X A;  1YJW A;  2ENM A;  3SDZ A;  1U8R A;  1SRM A;  4LDV A;  2ZCF B;  1YIJ T;  3OSV A;  1D1B A;  3TEE A;  1SHF A;  1X2Q A;  4C0F A;  1QCO A;  2AZS A;  2IPO B;  1D1A A;  3UPU A;  4DBF A;  3HSB A;  3PNW C;  3FRN A;  2CDT A;  2L0A A;  4XU3 A;  5L8R E;  3J80 E;  4JLI A;  3OMC A;  3EFO B;  3CPW A;  2LQK A;  4C8Q F;  1WHJ A;  2OX7 A;  3QZ5 B;  5I2M A;  2KAF A;  4DOV A;  2KMT A;  3TCJ A;  5CO7 A;  3CME T;  1X6O A;  3JCM e;  3EFO A;  1VQ6 T;  3CQT A;  2GF7 A;  4FL6 A;  3CPF A;  1YFN A;  4A63 B;  1UB4 A;  5CVI A;  3OW2 A;  2M9U A;  3I5R A;  1IGU A;  3WVD B;  7AT1 B;  4E6R A;  3LYI A;  2FVU A;  4XQ3 A;  1I0C A;  1YJN A;  2EYW A;  1UG1 A;  2KBT A;  1QP2 A;  3QWX X;  1NEB A;  1YJN Q;  3CMA T;  2A36 A;  3GP8 A;  4M7A G;  1GFC A;  2AKL A;  3CCL T;  4OMN A;  5LJ5 h;  2RM4 A;  1W2B P;  2X4J A;  5L23 A;  4E7J A;  3ZBD A;  3L2U A;  2FPD A;  4JJD A;  3GLX A;  2FPE A;  1U06 A;  4CRI A;  4IKF A;  1H3H A;  4WTO B;  4KT0 E;  1BYM A;  4JJC A;  4M78 D;  2CUD A;  4EIK A;  1M1K C;  4KH1 B;  5GAO l;  3MP8 A;  2P0K A;  1K9M C;  1VQO T;  4M77 C;  2BKD N;  2KI7 A;  3M0U A;  3OYN A;  1TXQ A;  1BIA A;  4X34 A;  3JB9 D;  5CKH A;  5CIU A;  4FT2 A;  4F7U E;  2RO0 A;  2K5I A;  2E64 A;  4C8Q E;  3V8L A;  1OPL A;  1TU0 B;  1YIT Q;  1BI0 A;  1S72 Q;  1UHC A;  4N4G A;  4A4F A;  6AT1 B;  2HL3 A;  3HL8 A;  1BK2 A;  4ZTJ A;  3E9G A;  1QCF A;  2P4R A;  4Z88 A;  3QBY A;  2KRN A;  2X35 A;  2CP3 A;  2LX7 A;  1WFW A;  2L3R A;  3M0P A;  3QDR B;  1KFZ A;  1GRI A;  1X75 C;  1M5Q 1;  1PHT A;  4J8O A;  3QO3 A;  3G6E T;  2DL8 A;  5FLX E;  2FEI A;  4QVZ A;  2D6F A;  2DNU A;  1WI7 A;  3OYF A;  3ASK A;  3EG1 A;  2H3J A;  1VQ9 A;  1PWT A;  3G4S T;  4BI8 B;  3OSS C;  2A0F B;  3CC7 Q;  2OTJ T;  3CCU T;  4LNP A;  4LUD A;  4FW2 A;  2QA4 T;  4XK8 E;  2CYZ B;  4LXC A;  3FJ5 A;  2JW4 A;  2MIO A;  4RCB A;  2A7Y A;  1BBZ A;  5CCA A;  5LJ5 f;  5LJ3 e;  4PFO A;  3PGG A;  1PD0 A;  2K3X A;  4E2F B;  3SD4 A;  1TUD A;  3QYG B;  2KXD A;  4JRI A;  2G6F X;  1VYT A;  3EH1 A;  5IN1 A;  4KRT A;  2E6N A;  2XI9 A;  4F14 A;  2M0O A;  4Z02 A;  1VQL A;  1ZQ1 A;  1NYG A;  3MO8 A;  2CP6 A;  2FYK A;  3REA B;  4J9B A;  5C6S A;  4LDX A;  3LWH A;  1AZE A;  2HEQ A;  1YN8 A;  3JCM V;  2RQU A;  2RHY A;  4O5V A;  4FCY A;  2FB7 A;  4BE0 A;  4PJO F;  2RF0 A;  4OP0 A;  5IHI A;  2VV5 A;  1X01 A;  1M1G A;  3MPU B;  3M9Q A;  2Y4X A;  4KGV B;  3UA7 A;  1QMC A;  2X3W D;  2PNI A;  1GL5 A;  1RAD B;  1PKS A;  1M1F A;  2FRW A;  4KUL A;  4J6X A;  1OU8 A;  3H0H A;  4XTZ A;  1QVG P;  3TSW A;  3I55 Q;  1E6G A;  3ER0 A;  1MMG A;  2CZ1 B;  4ORZ A;  4BD3 A;  1YHQ A;  2RQV A;  5GAO m;  1YHQ Q;  2ZPB B;  3CC2 A;  2GQI A;  1ZSZ C;  2GTJ A;  4HT9 A;  1GBR A;  1XJW B;  1YIT T;  3VS7 A;  1S72 T;  4XU0 A;  1Y07 A;  1VOM A;  5KE2 A;  2YLC A;  1E7O A;  3A8G B;  2MYS A;  1PM3 A;  2COZ A;  2RI5 A;  1UHF A;  3M53 A;  4PJN A;  3CCS A;  2KGT A;  2KE9 A;  2K57 A;  1UDL A;  2F2W A;  4ZN1 A;  2MK5 A;  3CXC S;  2LMJ A;  3ULR B;  3I56 A;  1H64 1;  5A0D A;  4C92 E;  2EKH A;  4MMK A;  4NOY A;  3I56 Q;  2QTX A;  1UGR B;  3E1S A;  5CKD A;  4FSX A;  4AFS C;  1D1C A;  3OY9 A;  1ZSG A;  3V7R A;  3OYK A;  3HRU A;  1OUL A;  4VUB A;  2MMP A;  2OTL A;  3OS2 A;  4RG2 A;  2V1Q A;  3CD6 A;  2FRY A;  5C0M A;  2OTL Q;  5GAN e;  1QVF A;  4EMH A;  3HP9 A;  2DET A;  4BI4 A;  2G3R A;  4RTU A;  3PVQ A;  1VQ5 A;  2YUP A;  5J3B A;  2BZY A;  1EIF A;  5CKE A;  4ZGJ B;  3M57 A;  2PTK A;  2ZGW A;  3RES A;  3E9F A;  4B9X A;  1ZSZ B;  2M0Y A;  4C8Q C;  1M3C A;  1Z9Z A;  2L3S A;  5CKF A;  1MV0 B;  3RKW A;  4AFQ C;  1WHL A;  2RQR A;  2XIC A;  1V1C A;  4RTZ A;  4M7A F;  4CC3 A;  4FIB A;  1KD1 R;  1O9S A;  1WX6 A;  1LNX A;  4M75 F;  4QQG A;  3QKJ A;  3M59 A;  5AYF A;  1VIE A;  3MP6 A;  4DOW A;  2MPX C;  2MCN A;  2KYB A;  2PZ1 A;  3QXE B;  3JCM d;  4CI0 C;  4OVA A;  1OOT A;  2DA9 A;  1ZX6 A;  1V76 A;  5IAY A;  4J6W A;  1G3W A;  2YSQ A;  1SSF A;  1WLP B;  2HBW A;  2DYB A;  2FL7 A;  4HVU A;  4QQD A;  1B3Q A;  1Q81 R;  2HZY A;  3I55 T;  4R55 A;  1MUZ A;  1IXD A;  1GBQ A;  4F7U B;  5EC7 A;  4C8Q B;  2X4W A;  2YLB A;  1LCK A;  2LC4 A;  3JB9 I;  1U1T A;  4F7U A;  4JPB W;  4C8Q A;  4J7F A;  1PKT A;  1IZ6 A;  4PKC C;  1P92 A;  3INZ A;  4A4G A;  5HCK A;  1VUB A;  1QQJ A;  2YUO A;  2LNH B;  2DRM A;  3NTH A;  2LDM A;  3DB3 A;  3CCV A;  2J6O A;  4OB3 B;  3THK A;  3LWI A;  2H8H A;  1NJI U;  5D7U A;  3JSC A;  5GAM e;  1FMV A;  2O31 A;  3MHX A;  2L3Q A;  2LQN A;  1VQ7 A;  4RTW A;  1TUC A;  2XID A;  3CCM A;  1YI2 A;  1VQ7 Q;  1T3S A;  3CC4 A;  3MEA A;  1NPP A;  2ZPG B;  1Q82 U;  1BIB A;  1KC8 R;  4XTX A;  2F5K A;  1I1J A;  2QAS A;  2EYZ A;  2P4T A;  3EFS A;  3LX7 A;  2BZ8 A;  1X43 A;  3I35 A;  3RIR A;  1TS9 A;  1D09 B;  1K73 R;  4ATO A;  3HHT B;  4J9F A;  2KR3 A;  2B8A A;  1W2B S;  1RLP C;  2FO0 A;  2KT8 A;  1RUW A;  2ATC B;  3PMI A;  3I9Q A;  4C92 C;  4X9C A;  5FRM A;  3JAM E;  1VQP A;  3M0S A;  1I5L A;  4QVD A;  4J9G A;  5KCH A;  1PC0 A;  4M77 E;  5GAN 8;  4HCB A;  4ZGE B;  2QQA A;  3CCQ T;  2LRQ A;  3V8J A;  1PG5 B;  3LW5 E;  4N0A C;  2NUP B;  4QQ6 A;  2FPF A;  5DLQ E;  1AEY A;  1UGV A;  4BUG A;  2CSI A;  2DE0 X;  2WSE E;  2QQS A;  2DIL A;  3G71 A;  3FLG A;  1Y96 B;  1KD1 C;  3GNF B;  2GBQ A;  2NUP A;  3G71 Q;  3TSZ A;  1AWJ A;  4RUG A;  5D6W A;  4J7I A;  2V8K A;  4WCI A;  2OI3 A;  4A54 A;  1Y96 A;  2YWW A;  2YHT A;  3A5Z B;  3VKI A;  4ZNX A;  1I5O B;  8AT1 B;  3JCM Q;  3EFR A;  3NHN A;  1VQN Q;  1C6V X;  2QEX Q;  2CKK A;  3EAE A;  3QJ6 A;  1CKB A;  2RB6 A;  3H0F A;  1RAC B;  3C0C A;  1NJI R;  1H3Z A;  2I0N A;  2PVO B;  3BE3 A;  1PCX A;  2Y4Y A;  4C92 B;  1Q81 C;  4PJO G;  4E7I A;  2FG0 A;  2LTO A;  2J05 A;  4C92 A;  1M8M A;  4XTU A;  4PK4 A;  3WVE B;  4FM4 B;  5GAN 2;  1I8F A;  1Y7X A;  3ZFJ A;  3H41 A;  3HRT A;  3OYE A;  2DXB A;  4Q5W A;  1J3T A;  3EH2 A;  2GNC A;  4OMP A;  1H92 A;  4J5Y A;  1G8X A;  2AKK A;  3X28 B;  5GAN 6;  5IXB A;  1YNZ A;  3PT9 A;  3JB9 H;  2VWF A;  1WQW A;  1RL2 A;  4C5H A;  1NBE B;  2CH4 W;  3T9N A;  2E3I A;  1YJW Q;  1PRM C;  2ZAE A;  3OYM A;  2RA2 A;  2RI3 A;  2DL7 A;  1LJO A;  3QZ9 B;  1M27 C;  3U23 A;  2HD0 A;  2WAC A;  5GAN d;  4HCC A;  3NGP A;  4K11 A;  4V2S A;  3HPW A;  2V26 A;  3M0Q A;  3PVL A;  2RK1 A;  1M9S A;  1LOJ A;  5KE3 A;  2VXF A;  4GLM A;  4HKE A;  4OMQ A;  1KQS P;  3CBM A;  3MCA B;  1KC8 C;  3L2Z A;  3SWN C;  2CRE A;  2DM1 A;  1K8A U;  1QVG S;  2C0I A;  5AT1 B;  3DLL A;  2RQW A;  4E7S A;  1K73 C;  2QXF A;  3CCU A;  3FC3 A;  2AK5 A;  1WA7 A;  5LJ5 e;  3M55 A;  4LDU A;  2RJD A;  3OYC A;  2XD0 A;  3PIP A;  1D0Y A;  4HXJ A;  2GCX A;  3UAT A;  4LD9 K;  3BDL A;  3OBW A;  4M78 F;  4R0K A;  4M75 G;  4C8Q D;  5GMK m;  2L89 A;  1VQN T;  2QEX T;  3M4G A;  4CC7 A;  4DBR A;  2DZC A;  4NS5 A;  1WHG A;  3QG1 A;  2QG9 B;  1G2B A;  5HKC A;  3VYH B;  2LNV A;  1M30 A;  1AHJ B;  2VAS A;  3ZL7 C;  4ZN3 A;  1PD1 A;  3MEW A;  2CP7 A;  3OB9 A;  4JJN K;  2QDL A;  4XTW A;  4DBQ A;  1QWE A;  1ARK A;  4ANJ A;  2KNB B;  2YT6 A;  3SWN B;  3M54 A;  5GMK j;  3VYG A;  3H9N A;  3OQ5 A;  1G83 A;  3VS2 A;  2EQM A;  4E7K A;  3F70 A;  1V29 B;  3L2Q A;  1HXD A;  4F17 A;  1JQQ A;  1N27 A;  1G5V A;  4M7D G;  3EHQ A;  2MI6 A;  1UUE A;  3CBO A;  1VQK A;  2RNA A;  1OYX A;  3NMZ C;  2HSP A;  1NJI C;  1M90 U;  2DXU A;  4P5N A;  1R0B G;  1YJ9 A;  1YJW T;  1VQK Q;  1VQ8 A;  5D6Y A;  1HJD A;  1YJ9 Q;  2BTT A;  1VQ8 Q;  2R5A A;  1TUG B;  1X6B A;  1Q82 C;  1ACM B;  2QQ9 A;  3E19 A;  1K8A R;  3OYL A;  1VIF A;  5CQY A;  2LP5 A;  2RHX A;  4J9C A;  2GFU A;  3CXC A;  1IHV A;  2KXC A;  3L42 A;  1VQ9 Q;  2O9S A;  4X1V A;  4JDS A;  4KBM B;  4M77 B;  3KXT A;  1UGQ B;  2QTV A;  1RAI B;  4MDX A;  2ZPE B;  4FU6 A;  4MZP A;  3HKS A;  3HFN A;  5FU6 C;  2ZPF B;  2KY9 A;  3X24 B;  2JT4 A;  1ZLM A;  2QGG A;  4LE9 A;  4M77 A;  1K1Z A;  3JCM c;  5GAO q;  3S6W A;  4Z89 A;  2GGR A;  2V1R A;  4JUV A;  2L3P A;  2VB6 A;  3JCM f;  1RAH B;  1TTH B;  4IUP A;  1NEG A;  3GOX A;  4C0G A;  4GBQ A;  1YJN T;  5IHK A;  2D8J A;  3N5B B;  4A4E A;  2K3Y A;  4JLG A;  2KRS A;  4OGC A;  5HK0 A;  2D0N A;  1MGQ A;  1I4K 1;  2JZ2 A;  2VVK A;  3TU4 K;  1VQL Q;  2R58 A;  1EX4 A;  2DXT A;  1ZA2 B;  1B07 A;  5FRN A;  2LT1 A;  3SB2 A;  1KD1 U;  1IO6 A;  3PTA A;  2KRO A;  1QWF A;  2HKQ B;  5M9O A;  2K4Y A;  1MMA A;  3CCJ A;  4HT8 A;  1JJ2 P;  2YXY A;  1K9A A;  3LH0 A;  3QWY A;  2PUO B;  4C92 D;  3CCE A;  1OZ2 A;  4RKU E;  1VYV A;  1WHH A;  2XK0 A;  2DJZ A;  5FU6 B;  1M90 R;  4XU1 A;  1MND A;  1KJW A;  3SHW A;  2E12 A;  1T0J A;  5FRO A;  2RN8 A;  2O2O A;  4PLL A;  5CQX A;  5CAI A;  1VQM A;  1Q81 U;  3CCR A;  3CC2 Q;  2J6K A;  1HK9 A;  2X51 A;  2D9T A;  3OS1 A;  1BCM A;  3OYG A;  1H8K A;  1KHI A;  1NLO C;  4QKU A;  4HVV A;  1XQH A;  1B7T A;  3OYI A;  3JCM P;  1WXT A;  4DQ2 A;  3CCS Q;  2COW A;  3HTR A;  1WZO A;  3OYB A;  2RH2 A;  4JRP A;  5FWB A;  4KGX B;  3DLM A;  2M51 A;  4II1 A;  5CK9 A;  3S3O A;  5IT9 E;  1M2O A;  4JS4 A;  2EIF A;  1RAB B;  4F04 B;  3CEY A;  1FYN A;  1Y57 A;  2M02 A;  1TOV A;  4D8D A;  5GMK h;  4XTY A;  4XAX B;  4IUR A;  4XTV A;  3OBY A;  3RKY A;  1VQ9 T;  1TWB A;  3CC7 T;  4QW2 A;  5FWC A;  2KEA A;  2EAY A;  2LCL A;  3JCM b;  1WXB A;  3CD6 Q;  1VQ4 A;  2VGM A;  1SPK A;  2Z0W A;  4PJO E;  2EPD A;  4ZTF A;  1GCQ C;  1VQ5 Q;  3J81 E;  3EG2 A;  1T3L A;  1QP3 A;  5KH6 A;  1AWO A;  2RK2 A;  3QYH B;  2DTI A;  4GLK A;  2JM9 A;  1YBY A;  2J6F A;  1ZSZ A;  1LPL A;  5GAN h;  1KC8 U;  1K8A C;  2DTO A;  1BI3 A;  4N4I A;  1U1S A;  3QUI A;  1VQL T;  4LDW A;  2KVQ G;  2FHD A;  3VRY A;  5CKB A;  2WSC E;  1WJQ A;  8ATC B;  1K73 U;  2GQV A;  3MEV A;  2XG8 D;  3O5Z A;  1OZ3 A;  2DVE A;  2YRV A;  2K2M A;  3NTK A;  2XHC A;  4KH0 B;  1Q95 G;  2LCC A;  3CPW P;  3A1P A;  5I21 A;  4EDU A;  1W2B A;  2H3E B;  1NZ9 A;  4JRK A;  1N8R R;  1VA7 A;  3C95 A;  2I2L A;  4HVW A;  1Y71 A;  1GXI E;  5GJW B;  2RJE A;  1K4U S;  1UEB A;  3OW2 P;  4A4H A;  1SEM A;  1YHQ T;  3OYA A;  5A2Q E;  2HCK A;  4NL2 A;  1NE8 A;  2J06 A;  2C0T A;  2D0Q B;  3MKD A;  1PSF A;  3CC2 T;  2DZ9 A;  1DJ7 B;  1IHW A;  1GCQ A;  4M7D F;  4M78 G;  1QKX A;  2CH4 A;  3CCS T;  1X2K A;  2VC8 A;  4OMF B;  2BZX A;  1G3Y A;  3JCM g;  2CP5 A;  1Q86 U;  1CKA A;  2E70 A;  3SFM A;  5GAO r;  4J6Y A;  3X20 B;  3QPH A;  1T0H A;  1ZHI A;  4M7A E;  3I56 T;  4BE1 A;  3SEM A;  3JB9 G;  3V8K A;  4M75 E;  4X9D A;  3VUZ A;  1Y0M A;  4ELZ C;  1M90 C;  3PE0 A;  2SEM A;  3CCV Q;  1KQS S;  2OTL T;  3A8L B;  3RR6 A;  4PFZ A;  3CD6 T;  2HQE A;  4BI3 A;  3JV3 A;  1VQ5 T;  3CCM Q;  2OAW A;  1IGQ A;  1YI2 Q;  4M77 D;  3CC4 Q;  1WXU A;  1OI1 A;  3NFC A;  5KYU B;  5GAN f;  2ROT A;  3OYD A;  1YCY A;  1X69 A;  1B34 B;  4CC2 A;  3V7C A;  3QHS A;  5KYU A;  5EG2 A;  1ABQ A;  2K79 A;  2MAM A;  3UT1 A;  5CR2 A;  1B34 A;  3RMQ A;  1JO8 A;  2E6Z A;  3X26 B;  4M7D E;  1YIJ A;  1RI9 A;  2DD5 A;  3GNG A;  3UWN A;  3MP1 A;  4J9H A;  1VQP Q;  4FYW B;  3V7S A;  5LJ3 d;  3J7A F;  2PU9 B;  2ABL A;  2JTF A;  3QSU A;  2DL4 A;  3MET A;  3BW1 A;  1BI1 A;  3JB9 J;  4B9W A;  3C4S A;  1AWW A;  4PJO C;  2L8D A; 
#chains in the Genus database with same CATH homology
 4LDU A;  2RJD A;  2FYK A;  4EMK B;  2CS7 A;  5C6S A;  4BDY A;  3OYC A;  3CCE T;  4LDX A;  3LWH A;  2XD0 A;  2M16 A;  4D6W A;  3CME A;  4M7A D;  3PIP A;  2GCX A;  3VV0 A;  4O6J A;  4F7U G;  4M75 D;  3JCM V;  4NL3 A;  4LD9 K;  3L2W A;  1VQ6 A;  3BDL A;  3OBW A;  4M78 F;  4C8Q D;  4M75 G;  1WNL A;  2RHY A;  5GMK m;  3CCQ A;  1RI0 A;  4C8Q G;  4EMG A;  1WGS A;  5GMK i;  4O5V A;  2L89 A;  1QVG A;  4BAC A;  4EMK A;  2FB7 A;  4R56 A;  2CZ6 B;  4C5I A;  4PJO F;  4OP0 A;  4BE0 A;  1VQN T;  2QEX T;  3FEO A;  3M4G A;  2OAU A;  5DY9 A;  4C0Z A;  3P8H A;  2VV5 A;  1M8V A;  2V8I A;  2IG0 A;  4ZGD B;  1X01 A;  1M1G A;  2DZC A;  3BY7 A;  2Y4X A;  3M9Q A;  4NS5 A;  1VQM T;  3CCR T;  2E65 A;  2M1H A;  3CMA A;  2DEQ A;  3QII A;  3PIO A;  1M1F A;  3QG1 A;  4BB7 A;  3AHU A;  4KUL A;  4J6X A;  4WF2 A;  2AHJ B;  5HKC A;  4XTZ A;  1O75 A;  3VYH B;  4A53 A;  1N8R C;  3CCL A;  2LNV A;  3ER0 A;  1AHJ B;  2CZ1 B;  4ZN3 A;  1YHQ A;  4BD3 A;  3A8H B;  3MEW A;  3JRZ A;  3OB9 A;  5GAO m;  5LL6 S;  2MWO A;  5LJ3 g;  2DKG A;  2ZPB B;  2GFA A;  2BIV A;  2DD4 A;  4JJN K;  4XTW A;  3CC2 A;  4PNO A;  3OS0 A;  4HT9 A;  4RCC A;  1M1K U;  3SWN B;  2JUF A;  3M54 A;  5GMK j;  2QDY B;  1YIT T;  3OYY A;  1S72 T;  4XU0 A;  1Y07 A;  3VYG A;  3CCV T;  2DPP B;  3OQ5 A;  4MML A;  4L6V 5;  5KE2 A;  1K9M U;  2LX9 A;  2YLC A;  2MF2 A;  2EQM A;  3A8G B;  2K5F A;  2RI5 A;  4E7K A;  4M78 B;  3F70 A;  5FU7 B;  5LJ5 g;  1V29 B;  3M53 A;  4M77 F;  2IVW A;  5GAO n;  3L2Q A;  1HXD A;  3CCS A;  1VQ7 T;  1VQ6 T;  4IUT A;  1N27 A;  4M7D D;  4JRQ A;  4PJO B;  1G5V A;  2K57 A;  4M7D G;  3LGL A;  3CCM T;  1YI2 T;  1VQO A;  1N9R A;  2MI6 A;  4J83 A;  3CC4 T;  1QVF S;  3CBO A;  2F69 A;  4N0A A;  4ZN1 A;  1VQK A;  3WXM B;  5GAN 5;  3CXC S;  1OYX A;  4M78 A;  1VQ4 T;  1NJI C;  3I56 A;  1H64 1;  5A0D A;  1M90 U;  4C92 E;  2DK3 A;  2DXU A;  1ZBX A;  3FIF A;  3R6O A;  4P5N A;  4BDZ A;  1YJ9 A;  3KUF A;  1YJW T;  2RI2 A;  2HAX A;  4MMK A;  4NOY A;  5D6Y A;  1VQ8 A;  2A3L A;  2QTX A;  1UGR B;  3OMG A;  2F5T X;  2MWP A;  2DO3 A;  4PJO A;  3E1S A;  4PLI A;  3NTI A;  4FSX A;  5CKD A;  2JOY A;  2ZZD A;  5GAO p;  2R5A A;  3JCM J;  3PFS A;  4JS5 A;  3OY9 A;  1Q82 C;  3OYJ A;  3L1A A;  3V7R A;  3OYK A;  3HRU A;  2QQ9 A;  4VUB A;  4L59 A;  2R57 A;  2MMP A;  2OTL A;  3E19 A;  4ME7 A;  4RG2 A;  3OS2 A;  4E47 A;  4OGE A;  3OYL A;  3CD6 A;  1IRE B;  4RG8 A;  3X25 B;  5C0M A;  1VIF A;  5CQY A;  5GAN e;  5GAM h;  1M4Z A;  3O8V A;  3URG A;  1QVF A;  4HA8 A;  2RHX A;  4EMH A;  1BKB A;  3HP9 A;  2GFU A;  4BI4 A;  3CXC A;  1JBM A;  2G3R A;  3P8D A;  3VJP A;  3L42 A;  5J3B A;  1VQ5 A;  2EYQ A;  2RHI A;  4M7A C;  2R5M A;  1EIF A;  4JDS A;  4OB0 B;  4KBM B;  5CKE A;  4M77 B;  2ZPH B;  4ZGJ B;  3G7Z A;  2DIG A;  3M57 A;  1UGQ B;  3KXT A;  1VQP T;  2ZGW A;  3RES A;  3E9F A;  4B9X A;  1KQ2 A;  4MDX A;  2ZPE B;  2E10 A;  3QJY A;  2VYT A;  4FU6 A;  4M75 C;  4MZP A;  4Y28 E;  3HKS A;  3JCM X;  3HFN A;  4C8Q C;  5FU6 C;  3L2V A;  2ZPF B;  2KY9 A;  1JJ2 S;  5CKF A;  3X24 B;  3RKW A;  2WSF E;  1FX7 A;  3G6E A;  2XIC A;  3JCM c;  4M77 A;  5LJ3 j;  5GAO q;  3LLR A;  1UGP B;  3KBG A;  3S6W A;  4M7A F;  4OB2 B;  3PMT A;  2LVM A;  4FIB A;  4JUV A;  1O9S A;  3JCM f;  1TH7 A;  1UGS B;  3G4S A;  4IUP A;  3GOX A;  4F7U F;  4C0G A;  1LNX A;  2OTJ A;  1YJN T;  4M75 F;  4QQG A;  3QKJ A;  3G71 T;  2QA4 A;  3M59 A;  3N5B B;  5AYF A;  5HK3 A;  2EFI A;  1VIE A;  3MP6 A;  4A4E A;  4DOW A;  5LJ5 j;  2K3Y A;  4JLG A;  4OGC A;  5HK0 A;  2EKO A;  4YTL A;  5KCO A;  3QXE B;  3JCM d;  1MGQ A;  1I4K 1;  2JZ2 A;  4PL6 A;  4C0D C;  4CI0 C;  3TU4 K;  4OVA A;  1JJ2 A;  2R58 A;  2DXT A;  2O4X B;  1KHC A;  2QI2 A;  5IAY A;  5FRN A;  4J6W A;  1G3W A;  2C06 A;  2XDP A;  1SSF A;  3JCM h;  2JN0 A;  4HCZ A;  2LT1 A;  3SB2 A;  3TRE A;  2NLU A;  1KD1 U;  3PTA A;  5GAN g;  4C5E A;  4ELY C;  2DAQ A;  2FL7 A;  5M9O A;  1G3T A;  4QQD A;  3ME9 A;  2K4Y A;  4EPC A;  5I2S A;  3CCJ A;  2O4X A;  3OA6 A;  4HT8 A;  1N9S A;  5J26 A;  2PVD B;  4IUU A;  3I55 T;  4R55 A;  4M7D C;  3Q1J A;  3LH0 A;  4N4H A;  2PUO B;  2EJF A;  3A8M B;  4M7A B;  4C92 D;  5GMK l;  3CCE A;  1OZ2 A;  3JB9 F;  3VU3 C;  4C92 G;  2XKO C;  4RKU E;  1FXX A;  5DM7 R;  3LGF A;  4OB1 B;  4F7U B;  2EWN A;  4M75 B;  2XK0 A;  4C8Q B;  1D3B B;  2DJZ A;  5FU6 B;  4E7H A;  2X4W A;  2PQW A;  2YLB A;  4XU1 A;  4M7A A;  1QW1 A;  5J39 A;  1VQN A;  1MHN A;  2BUD A;  2Y90 A;  2QEX A;  5A0L A;  4KUI A;  4QVC A;  2E12 A;  2HNI A;  2XDB A;  5FRO A;  2LC4 A;  5CQX A;  4PLL A;  1U1T A;  4F7U A;  5CAI A;  3JB9 I;  3CCR A;  1VQM A;  1Q81 U;  1HK9 A;  2D9T A;  4M75 A;  3ZEH A;  3OS1 A;  3S3N A;  4C8Q A;  1D3B A;  4J7F A;  2K2V A;  4RMO A;  3OYG A;  1XTD A;  1QVP A;  2L5Q A;  4KUD K;  4MZT A;  1XOV A;  1KHI A;  4MZM A;  3L2R A;  1G3S A;  2JTM A;  2K5L A;  2CGH A;  3C94 A;  1IZ6 A;  1XQH A;  3SWN A;  4GY5 A;  3OYI A;  3JCM P;  2JNG A;  4PKC C;  1P92 A;  3INZ A;  4A4G A;  3DB4 A;  4DQ2 A;  4BE2 A;  3OYB A;  2EQK A;  1K73 C;  2RH2 A;  4JRP A;  1VUB A;  4C0D B;  5GAM f;  3DLM A;  2DXC A;  4II1 A;  2EQJ A;  5CK9 A;  3RER A;  3S3O A;  2KK4 A;  4TVR A;  4A4K A;  4IUQ A;  2RHZ A;  2LDM A;  2EJ9 A;  3NTH A;  5DLO A;  5IT9 E;  3DB3 A;  1YIT A;  1S72 A;  1Q7Y C;  4JS4 A;  3CCV A;  4OB3 B;  2EIF A;  3FDR A;  3VUB A;  2LT4 A;  3CEY A;  3LWI A;  3M58 A;  3M4Y A;  3OYH A;  5GMK h;  1NJI U;  5GAM d;  2DIQ A;  3JSC A;  5GAM e;  3MHX A;  1VQ7 A;  4XTY A;  2XID A;  4XAX B;  4IUR A;  2E1H A;  2V8J A;  4XTV A;  3OBY A;  4M7D B;  3CCM A;  3JCM W;  1YI2 A;  3RKY A;  3DKM A;  4DA4 A;  1FWZ A;  5GAN j;  1VQ9 T;  4M78 E;  4QW2 A;  3CC4 A;  3CC7 T;  2EAY A;  2LCL A;  3JCM b;  2LQ8 A;  3MEA A;  1NPP A;  2ZPG B;  2VGM A;  3OS5 A;  1VQ4 A;  2VXE A;  1Q82 U;  1BIB A;  2XDD A;  2X4X A;  3CPW S;  3SDZ A;  4M77 G;  4ZTF A;  1YJW A;  1VQL A;  4PJO E;  1U8R A;  2KQW A;  4XTX A;  2F5K A;  4LDV A;  2ZCF B;  4M7D A;  3J81 E;  1YIJ T;  2RD1 A;  2VUB A;  2P4T A;  5D6X A;  3OSV A;  2QQR A;  3TEE A;  3EFS A;  3LX7 A;  3RIR A;  2QQB A;  3GF5 A;  4C0F A;  1QP3 A;  3GIB A;  2O01 E;  5KH6 A;  2RK2 A;  1KG1 A;  3GPL A;  3QYH B;  2DTI A;  3UPU A;  4ATO A;  4GLK A;  2E41 A;  3HHT B;  5GAN 3;  3HSB A;  1YBY A;  3OW2 S;  3CC7 A;  3PNW C;  3FRN A;  4IUV A;  3BDU A;  2B8A A;  1W2B S;  2X4Y A;  4XU3 A;  5L8R E;  3J80 E;  4JLI A;  3OMC A;  3PMI A;  5GAN h;  1KC8 U;  3CPW A;  1K8A C;  2KSS A;  2DTO A;  1BI3 A;  4N4I A;  2LQK A;  1U1S A;  4X9C A;  4C92 C;  5FRM A;  4C8Q F;  3QUI A;  1VQL T;  3QZ5 B;  3JAM E;  1VQP A;  5I2M A;  1WQ7 A;  4LDW A;  2KVQ G;  2KAF A;  4DOV A;  2KMT A;  3TCJ A;  1I5L A;  2FHD A;  5CO7 A;  3CME T;  2XU8 A;  5CKB A;  4QVD A;  5KCH A;  2WSC E;  1W4S A;  1WJQ A;  1X6O A;  3JCM e;  4M77 E;  5GAN 8;  1K73 U;  4HCB A;  2GQV A;  2QQA A;  3MEV A;  2GF7 A;  2XG8 D;  4FL6 A;  4ZGE B;  3P8B B;  5GAM g;  4Y91 A;  3CCQ T;  1OZ3 A;  2DVE A;  2LRQ A;  2YRV A;  2EQU A;  3CPF A;  3NTK A;  2XHC A;  3V8J A;  3LW5 E;  2LCC A;  2PVG B;  1UB4 A;  4N0A C;  5CVI A;  3OW2 A;  2M9U A;  4C92 F;  4QQ6 A;  5DLQ E;  5I21 A;  4EDU A;  3RMS A;  3WVD B;  1W2B A;  3LYI A;  2FVU A;  4XQ3 A;  5LJ3 h;  1NZ9 A;  4UC4 A;  4JRK A;  3C12 A;  4BUG A;  1YJN A;  3C95 A;  2WSE E;  2QQS A;  1BI2 A;  2I2L A;  1QP2 A;  3G71 A;  3FLG A;  1Y71 A;  1Y96 B;  3GNF B;  4C5G A;  1KD1 C;  3CMA T;  1GXI E;  4M7A G;  3GP8 A;  2VGN A;  4XU2 A;  5D6W A;  3CCL T;  2P0Q A;  2RJE A;  1UEB A;  4J7I A;  2V8K A;  4A4H A;  5LJ5 h;  3HFO A;  2RM4 A;  1YHQ T;  4L5G A;  5A2Q E;  2X4J A;  3OYA A;  4NL2 A;  4E7J A;  4A54 A;  1Y96 A;  3ZBD A;  1NE8 A;  3L2U A;  2YHT A;  3A5Z B;  2D0Q B;  4LD6 A;  1PSF A;  3CC2 T;  2DZ9 A;  3VKI A;  1DJ7 B;  3GLX A;  4CRI A;  4IKF A;  4M7D F;  1PSE A;  4KT0 E;  3JCM Q;  1N8R U;  3EFR A;  1BYM A;  2P0P A;  4M78 D;  3FB9 A;  2CKK A;  3EAE A;  3QJ6 A;  4M78 G;  3H8Z A;  3I55 A;  2RB6 A;  3RKX A;  1Q86 C;  3CCS T;  1H3Z A;  1M1K C;  4PJO D;  2PVO B;  4BY6 C;  2VC8 A;  2Y4Y A;  4C92 B;  1Q81 C;  4PJO G;  5GAO l;  4E7I A;  3MP8 A;  4OMF B;  2P0K A;  1K9M C;  1VQO T;  1G3Y A;  2LTO A;  4M77 C;  3JCM g;  5A0G A;  1Q86 U;  2E70 A;  3SFM A;  1VQK T;  5GAO r;  2BKD N;  4J6Y A;  3QPH A;  3X20 B;  1ZHI A;  4M7A E;  3OYN A;  3I56 T;  4BE1 A;  1YJ9 T;  1BIA A;  3H6Z A;  4X34 A;  1KQ1 A;  3JB9 D;  1JRI A;  1VQ8 T;  4C92 A;  5CKH A;  4XTU A;  5CIU A;  4FT2 A;  4F7U E;  3JB9 G;  2RO0 A;  2K5I A;  3WVE B;  2E64 A;  5GMK e;  4FM4 B;  3V8K A;  3S3M A;  4M75 E;  4X9D A;  3VUZ A;  4C8Q E;  3CBP A;  3V8L A;  4ELZ C;  5GAN 2;  1I8F A;  1M90 C;  1Y7X A;  1WJS A;  1BI0 A;  5GAN 7;  3BFM A;  3ZFJ A;  5GAM j;  4N4G A;  3M5A A;  3HRT A;  4A4F A;  1KQS S;  2HQX A;  2KDS A;  3OYE A;  2DXB A;  4Q5W A;  2OTL T;  3FJP A;  3A8L B;  3HL8 A;  3CD6 T;  4ZTJ A;  2HQE A;  3E9G A;  4BI3 A;  4J5Y A;  1Q7Y U;  3X28 B;  5GAN 6;  3QBY A;  2RJF A;  2X35 A;  1VQ5 T;  1NPR A;  3PT9 A;  4E7L A;  4LDY A;  4EMK C;  4M77 D;  5HY6 A;  3JB9 H;  1OI1 A;  3NFC A;  1WQW A;  1RL2 A;  5GAN f;  4C5H A;  2L3R A;  3T9N A;  3OYD A;  3RUX A;  1YCY A;  3QDR B;  1B34 B;  1X75 C;  3OYM A;  1WPY A;  1M5Q 1;  4J8O A;  2RA2 A;  2RI3 A;  2ZPI B;  3QO3 A;  1LJO A;  3V7C A;  3G6E T;  3QHS A;  3QZ9 B;  5FLX E;  5EG2 A;  3UDC A;  1N6A A;  1KQS A;  4QVZ A;  2D6F A;  2HD0 A;  2PUK B;  2WAC A;  3OYF A;  5GAN d;  4HCC A;  3ASK A;  2MAM A;  2H3J A;  1VQ9 A;  3UT1 A;  5CR2 A;  1B34 A;  4V2S A;  3G4S T;  3RMQ A;  4BI8 B;  3A8O B;  3OSS C;  4BY6 B;  5GAN 4;  3HPW A;  2E6Z A;  2OTJ T;  1R8O B;  3X26 B;  3CCU T;  5LJ3 f;  4M7D E;  2RK1 A;  2QA4 T;  1M9S A;  4XK8 E;  1LOJ A;  2CYZ B;  5KE3 A;  2RJC A;  1YIJ A;  2VXF A;  4HKE A;  3HRS A;  4RCB A;  3CBM A;  3MCA B;  2A7Y A;  2DD5 A;  3GNG A;  3M56 A;  3MP1 A;  3UWN A;  1KC8 C;  3L2Z A;  3V7S A;  2HBP A;  5CCA A;  3SWN C;  2EJG A;  5LJ3 d;  5LJ5 f;  1K8A U;  5LJ3 e;  2PU9 B;  3J7A F;  1QVG S;  3PGG A;  1XNI A;  3DLL A;  2K3X A;  3SD4 A;  3QYG B;  2JTF A;  3MEU A;  3QSU A;  4JRI A;  3MET A;  3BW1 A;  4FT4 A;  1JB0 E;  1BI1 A;  3JB9 J;  2RHU A;  1I81 A;  2E5Q A;  4MDW A;  4M78 C;  5IN1 A;  4B9W A;  2QXF A;  2DTH A;  3CCU A;  5FU7 C;  3FC3 A;  2CZ0 B;  4OF1 A;  2E6N A;  2XI9 A;  3CCJ T;  3C4S A;  2M0O A;  4PJO C;  2L8D A;  4Z02 A;  5LJ5 d;  1WJR A;  2JVV A;  5LJ5 e;  1ZQ1 A;  2CZ7 B;  3MO8 A;  3M55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...