3MEWA

Crystal structure of novel tudor domain-containing protein sgf29
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
159
structure length
157
Chain Sequence
b'TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
molecule tags Transcription
source organism Homo sapiens
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
total genus 25
structure length 157
sequence length 159
ec nomenclature
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mewA02
1N27A 3LH0A 3OYIA 3PMTA 2BKDN 4A4GA 2VYTA 2E5QA 5J39A 3LX7A 2RO0A 5CIUA 5D6XA 2DIGA 3P8DA 3UT1A 1H3ZA 2K3YA 3META 3OQ5A 3OYAA 4E7JA 4BD3A 4BE0A 2GFAA 5FRNA 3LGFA 4IUVA 2NLUA 3DB4A 2L89A 4C5EA 2HQEA 4PL6A 3OYHA 3FC3A 4E7IA 2WACA 4A4FA 3E9FA 4OVAA 2RI3A 3UWNA 4N4HA 3OY9A 3L2VA 3ME9A 2YRVA 4QVZA 4BDZA 3OYNA 2K3XA 3OYDA 3PFSA 4A4EA 3ASKA 2LVMA 1MHNA 1XNIA 3MP1A 3OA6A 3PNWC 3QKJA 3MEUA 3L42A 4BACA 1SSFA 3CEYA 3MEAA 2EQKA 2X4YA 2LCCA 3OS2A 4LD6A 3PMIA 5C6SA 3OYFA 2M0OA 4N4GA 3S3MA 4HCZA 2R57A 2L8DA 2LTOA 2MWPA 3FDRA 4C5HA 3MO8A 2RHYA 3F70A 3LYIA 3MP8A 3DLMA 5FROA 2FHDA 4IUTA 5M9OA 4IURA 4E7KA 3MEVA 2LRQA 3ZEHA 3OYGA 3OS1A 2GFUA 1OZ2A 4PLIA 3LLRA 2GF7A 3NTIA 2R58A 5J26A 3H6ZA 2RHUA 3EAEA 3E9GA 2RJEA 4QQDA 3P8HA 4X34A 3S3NA 3FLGA 2JTFA 3L2WA 4IKFA 2F5KA 2XDPA 3NTHA 3DB3A 2P0KA 4BE2A 3BDLA 4QQ6A 4II1A 3S6WA 4A4HA 3OYJA 3GOXA 2HQXA 3L2QA 4B9XA 3QBYA 3OMCA 2RJCA 3OYMA 2O4XA 2CKKA 3QIIA 2X4XA 3SD4A 3MP6A 4BE1A 2RHXA 2X35A 2M16A 2O4XB 5KE3A 4B9WA 4IUPA 2EQUA 2PQWA 3OYLA 2BUDA 3OYCA 2R5MA 3L2UA 4PLLA 2X4WA 3OMGA 4FL6A 1WGSA 2XK0A 5KE2A 3C4SA 2RI2A 3QJ6A 5KCOA 4Q5WA 5D6WA 4Z02A 4CRIA 1OZ3A 3NTKA 4FU6A 3Q1JA 2RJDA 2B8AA 2EFIA 2BIVA 4IUUA 4ZTFA 3MEWA 3H8ZA 2EQJA 2R5AA 3O8VA 4IUQA 4UC4A 5IAYA 3OB9A 1RI0A 2DIQA 3LGLA 4QW2A 4RG2A 5KCHA 5KH6A 4C5GA 5C0MA 4QQGA 2EKOA 2G3RA 2EQMA 4E7LA 1G5VA 4GY5A 3L2RA 1OI1A 2D9TA 3KUFA 5D6YA 2JZ2A 3OYKA 4L59A 2RJFA 2RI5A 1OYXA 4BDYA 4E7HA 4C5IA 4EDUA 5IN1A 3S3OA 5FRMA 3OS0A 4N4IA 1KHCA 2QQSA 3OYEA 2E6NA 2MWOA 1WJRA 2LDMA 3M9QA 2RHZA 2IG0A 3OYBA 2L3RA 1WJQA 2QQRA 2M1HA 2RHIA 3FEOA 4ZTJA 4NS5A 1WJSA 2DAQA
chains in the Genus database with same CATH superfamily
5GANg 5I21A 2VYTA 5IHNA 3OW2A 5GAOn 2K3YA 1YI2A 3CD6A 2JM9A 1Z9ZA 3BY7A 3JCMf 2P4RA 3G7ZA 3CMEA 1AWXA 3FC3A 1HD3A 2DF6A 2ZPIB 4E7IA 1ZSZC 3E9FA 1MMAA 3M55A 3HRTA 3QJYA 4EMKC 4A63B 2K3XA 5CCAA 2FPEA 4D8DA 1MMGA 2X4YA 3C94A 1K73C 5CKBA 1U8RA 2OTLQ 5L23A 1K9MC 3EHRA 2LP5A 1UHFA 3CC4T 2Y4YA 2EYZA 2CP3A 2DYIA 2Y90A 4PLIA 3HHTB 2R58A 3CMAT 4PJJA 1GFDA 1VQOA 2QXFA 1KC8C 1Y96B 2ZPGB 4ZGDB 4XTYA 4OP0A 2JMAA 2GNCA 3OYMA 4OGEA 2HQHA 1OPLA 4C8QE 3ZFJA 4JS5A 2LQNA 5LJ5j 1C1AA 2KT8A 2PQWA 1RLPC 2HCKA 4J6WA 1D0ZA 3QZ5B 1VQ8Q 2FB7A 3HKSA 1K76A 4Q5WA 5D6WA 2LQ8A 1VQ5A 1NYGA 1ARKA 2XHCA 4ESRA 3MEWA 2RPNA 2H3EB 3EG9A 1ZBJA 2QDYB 4PK4A 2E10A 3H41A 3G6ET 2YSQA 2E65A 2VVKA 2NUPA 4MDXA 3DLLA 2NUPB 1NJIC 1FMWA 3PVLA 4XU3A 1VIEA 2ZPEB 2XDPA 4DA4A 1H8KA 1VQ9A 2PTKA 4A4GA 1Y0MA 5EC7A 4C8QA 1NE8A 2D8JA 2VV5A 4Z88A 4ZN1A 3OQ5A 4M7AF 2HNIA 4FYXB 3RMSA 2HQEA 2L5QA 1G3YA 3QSUA 2RI3A 5KYWA 5GAOp 1M1KU 3ME9A 4PFPA 4JJDA 2BE9B 2EWNA 4NOYA 3T9NA 1M3BA 5KYUB 3ASKA 4KUIA 1IO6A 3QYGB 4HVWA 3V8JA 3CCST 1VQ8T 2AHJB 2HBWA 4ELYC 2DXBA 3EFOA 2M51A 1JJ2P 2JN0A 1VQKA 1M2VB 3OSSC 1B7TA 3CCQQ 3JRZA 3EGDB 1IB8A 4LDYA 1RAAB 4QVCA 4IKFA 1WNLA 4KUDK 3VV0A 4QQ6A 2CS7A 1YIJA 2KAFA 3OMCA 4PJOA 3THKA 2VC8A 3PIPA 2ZPHB 3JCMg 1K9AA 2EJGA 2R5MA 1ZSZB 2DBMA 1Q81R 1PRMC 2E12A 3NMZC 2HKNA 4MZPA 3V7RA 2L2PA 1YHQT 4M7DC 1NZ9A 5GMKl 2B8AA 4RTZA 4M7DA 5GJVB 2E1HA 1YITA 2OAWA 4FCYA 1QLYA 2OTLT 2KNBB 1VIFA 4M78D 2NUTA 3L2RA 3VKIA 1VQ6T 2YUOA 3H0FA 2QA4T 3KXTA 4F17A 2MWOA 4DQ2A 3HRUA 4R55A 4LUDA 1PRLC 2M1HA 1G8XA 3JAME 2P0QA 4F7UA 2RM4A 4J9DA 5A0GA 2AK5A 4Y92A 4XTXA 1NYFA 2EAYA 1IGQA 1E6HA 1LVKA 1X2KA 2EKHA 4C5EA 1ZX6A 3R6NA 1PG5B 4N4HA 2FEIA 3SEMA 4M7DD 3OYDA 3H0HA 2KVQG 1XNIA 4M75F 1YJNT 1M90R 3MEUA 2GBQA 4ZGEB 4A53A 4OMQA 1YCSB 2K2VA 3G6EQ 1Z9QA 2RHYA 1Q82R 1WXBA 2RQUA 3MP8A 4ZN3A 1BIAA 3HRSA 1GBRA 2VXFA 3MEVA 5KYXB 1HK9A 3LLRA 3M0TA 4C8QD 2ZCFB 3E9GA 2LNHB 2ZGWA 2DE0X 4XU2A 1WXTA 3CCMQ 4EMGA 1IXDA 2GTJA 1UE9A 1MGQA 2PZ1A 3JCMe 3JB9J 2AZVA 2JW4A 2J6KA 4M7AG 4PKCC 5LJ3g 2MIOA 1WXUA 1VYTA 4M7AE 2O88A 1IHWA 5GMKj 2EVRA 1YJWQ 4M75C 4BI3A 3CCRT 2R5AA 1LCKA 4M75A 4RTWA 1QCNA 3OB9A 2ROTA 4ELZC 2JS2A 3FIFA 1OEBA 4L6V5 1VQPT 1H3HA 3V8LA 2K5IA 5D6YA 4LDVA 1WHLA 2RJFA 1T0HA 2QAZA 1WHMA 2DM1A 4CC2A 1QVFA 1BU1A 1CKBA 2LDMA 3CBOA 1KSWA 4NS5A 1W2BS 1BI1A 5CKDA 3JCMQ 2HBPA 2RO0A 1GCQC 5FWCA 1PD1A 1WFWA 3VS1A 1NM7A 3A8OB 4C92D 5A0LA 3EGDA 3G4SA 4EMHA 3QYHB 3CCJA 3CCVA 2ED1A 1VQ7T 3X20B 3INZA 4ZNXA 3WVEB 5GAMe 3EG0A 1KK7A 3MKDA 3PE0A 1PM3A 4LUEA 1OPKA 1KHIA 2K7AA 1N8RR 4XTZA 3CCMA 3JCMV 3MPUB 4FW2A 2E64A 2D0QB 1R77A 4B9XA 1QCOA 3VJPA 1UG1A 1JBMA 2MOXA 3M58A 2DEUA 4C92C 1WHHA 3BE3A 3SD4A 1KQSP 2FZKB 4QVDA 4RG8A 1M4ZA 4XTUA 4JS4A 2E4HA 3G1JA 3CC4A 4BB7A 2V8KA 1CSKA 2AKKA 3O8VA 2RNAA 4DBHA 1MV3A 1NG2A 4BY6C 2K5FA 3E19A 3G71T 2DL8A 3OYYA 1ZHIA 3UDCA 3KUFA 3OYKA 2M0YA 1SKUB 2NUZA 2LCSA 4BDYA 5I2MA 1V1CA 2CZ0B 4JJCA 3CC2A 3SHWA 4O5VA 1YJ9T 2RQWA 2XIDA 3M4YA 2CH4A 1D0XA 3LH0A 1BB9A 3PMTA 4FT4A 2DIGA 4J9FA 1AEYA 5CQXA 3A8LB 1TWBA 2V8JA 3I56A 2IVWA 2M02A 3CCQA 1UDLA 3UWNA 5GANh 1TXQA 5GAN8 3OYNA 4E7ZA 1YITQ 2HAXA 1KQ1A 2V1RA 3MP1A 3OA6A 1MHNA 3PNWC 3CD6T 4MZTA 4O6JA 4LN2A 2AIRB 1YIJQ 2X9HA 3MO8A 1SEMA 5GAN2 4IUTA 2I2LA 2FPFA 1VQNQ 3X24B 1KQSS 3X26B 2GTOA 1IREB 5HCKA 3H6ZA 1TUGB 1NPPA 3GF5A 3PTAA 1BIBA 2HL3A 2KYMA 4M7DE 1ZSZA 1O75A 4FW1A 3VYHB 1IRXA 2EW3A 2HMAA 1PC0A 2AKLA 3V7SA 2CP0A 3A98A 5LJ3j 3H9NA 3QBYA 4HT9A 2XKOC 3QIIA 1P92A 1RL2A 5CQYA 2RK2A 2YHTA 1KD1C 2D0NA 1VQKQ 1TUDA 4OMLA 3EH2A 2CSQA 1YFNA 1B34B 1M2OA 1M3AA 2X4WA 2CDTA 3KFVA 3CCEQ 2YWWA 5EG2A 2FL7A 4XU0A 3GNFB 4R0KA 4N0AC 3GPLA 4BI8B 1RUWA 1TH7A 1OX8A 2DERA 4EIKA 4LDXA 4C92A 2D6FA 2GCXA 3IQLA 2D9TA 3PT9A 1JO8A 2QGFB 7AT1B 1DJ7B 4J8OA 4Z89A 2XDDA 1WJQA 4WTOB 1Q86C 4JZ3A 1N5ZA 3M0UA 5CVIA 2BKDN 2ABLA 1M27C 4XTWA 5J39A 4M78A 1S72Q 2BZXA 3OYAA 1X69A 1I8FA 2C0TA 4EMKA 1ZUUA 3SWNB 3QWYA 2L0AA 1NJIU 3JSCA 4B6MA 2JTMA 4PJOD 1VQ5T 1NEGA 3HTRA 4A4EA 1YN8A 1EZZB 2WSCE 5LL6S 3QG1A 2RN8A 1VQ5Q 3PMIA 1Q82C 4WF2A 3CC7A 3RMQA 1U06A 2LMJA 2X3XD 4J83A 4C5HA 3F70A 4C8QC 2KBTA 1S1NA 1PCXA 3SDZA 2LJ0A 1Q86U 1VQPQ 1W2BP 3EGXB 2CH4W 3RUXA 1AWWA 4J7IA 1C0MA 4Z8AA 2JTFA 2DVJA 4FYWB 3WXMB 4FM4B 2A37A 1UHCA 2RF0A 2ZAEA 1YJNA 2O9VA 1X6BA 2A3LA 1AHJB 4XQ3A 2O4XB 2K4YA 3CC4Q 2DETA 2RD1A 9ATCB 2RMOA 4M75D 2KRNA 3OMGA 1BCMA 2F69A 5KE2A 4M7DF 2EJ9A 1RAGB 2EFIA 3CD6Q 1EX4A 3M5AA 4AFSC 1QVGA 5GAMf 1RI0A 1RLQC 2PNIA 2LCLA 3CCVT 1ZUKA 1IHVA 2GQIA 1SPKA 4FIBA 1VQ4A 2J6OA 4N4IA 3UF4A 2E6NA 4LD9K 1G3TA 1WJSA 4C92E 4M4ZA 1U1SA 4XU1A 4M77G 3LX7A 2EGAA 4NL2A 1JQQA 4FYVB 4C92G 4DBQA 1VOMA 2EYYA 3TU4K 3URGA 2O01E 3VS7A 1W4SA 2FZGB 2RA2A 2BZYA 1M2VA 2QASA 1H92A 3QUIA 2F2XA 1YITT 1OU8A 2A08A 3MEAA 5GAOm 2LCCA 1UECA 4RTXA 4HVVA 4EPCA 2JS0A 2LRQA 1PHTA 3OYGA 1AZGB 4M77F 1AWJA 2DXUA 4M75E 4X1VA 4XTVA 4F04B 1M9SA 1YJWT 3BDLA 3EHQA 4BY6B 2LZ6B 8ATCB 3VYGA 1PKTA 1RAFB 2RQVA 3C0CA 1I81A 4C8QB 5IHKA 2COWA 4OMPA 1X6GA 2RHXA 5LJ5h 2LNVA 4PJOB 2W0ZA 2EQUA 2VGNA 2V26A 1X43A 1I0CA 2D8HA 2ESWA 1QKWA 4PJOG 1N9SA 1K8AR 3V7CA 2KY9A 5KYXA 3Q1JA 2CP5A 2O2OA 2RJDA 2VB6A 3BFMA 4IUQA 1J3TA 2X4JA 4QW2A 5KCHA 4M7DB 4J9CA 3M54A 4GY5A 2EIFA 1WDXA 1OYXA 4E7HA 3H0IA 4EDUA 3CCLA 2JXBA 2C0OA 1S72A 2QEXA 1I1JA 2DO3A 5CK9A 1N27A 2LX9A 3WVDB 2KGTA 2K57A 5CIUA 1N9RA 2QEXQ 1I5LA 1H3ZA 3RERA 2EQIA 5GMKe 1X01A 1FWZA 2GGRA 2L89A 3A8GB 4AMCA 2K3BA 3N5BB 4JUVA 4CI0C 1QP3A 1ZA2B 2E6ZA 2BE7D 4LXCA 4BACA 1SSFA 3OS2A 3O5ZA 3QHSA 2L8DA 2NYSA 2QYZA 1X27A 4OMNA 5GMKi 4M78E 5FROA 4DEXA 3OW2P 1XOVA 5GAN6 1PSFA 5J26A 3P8HA 2AT1B 4M77D 1MV0B 1VYUA 3SWNC 2F5KA 3JB9D 1WI7A 4AT1B 3QXEB 2HSEB 2WSFE 2J06A 3QWXX 4J6XA 1QVFP 2RJCA 4BUGA 2MF2A 3JCMP 1M1KR 3CCUA 2X4XA 1VQLA 2DL3A 2KSSA 4GLMA 2M16A 3J81E 2DD5A 5KE3A 1YI2T 5GAMg 4RTTA 3OYCA 2HD0A 5GAOr 2L3QA 1UGRB 1VQ9T 5CR2A 1A0NB 4ME7A 1ACMB 4IIMA 2A28A 1KQ2A 5FU7C 2YUPA 2QA4A 1OZ3A 2KMTA 4XAXB 2A0FB 4JJBA 4IUUA 4HA8A 2DKGA 4X9CA 4M7AA 2DYBA 2DIQA 2YRCA 4PFOA 2PUKB 4X9DA 1WHKA 2QQ9A 1WZOA 1KIKA 2K6DA 4N0AA 3QO3A 4C5IA 5FU6B 3OS5A 3JB9I 2COYA 2L3RA 5FU6C 2RHIA 4VUBA 3EG3A 3QZ9B 3GNGA 1KC8R 2OTJT 5FRNA 3R6OA 3QPHA 3LGFA 2EBPA 1K73U 4IUVA 1OULA 2MK5A 2QA4Q 2WACA 2RQRA 2MPXC 2KYBA 2OAUA 4RTYA 1EFNA 4JRQA 3JCMX 2JMCA 1Q86R 3CC7T 3GIBA 1GXIE 3EFRA 3I56T 2KE9A 4AFZC 4PJOF 2CYZB 2R57A 1VQ4T 3M57A 2DPPB 1Y71A 1R0BG 2P84A 4ANJA 3LWHA 2IIMA 1KQSA 3LH5A 5GAOq 4FSSA 1Y57A 4A4HA 2XU8A 4ORZA 5GAOl 2K9GA 2OJ2A 2DBKA 4OMOA 2DL7A 3D7SB 2OTJA 1GRIA 3CBMA 2BUDA 4FL6A 2COZA 4M75G 2ENMA 2V8IA 4LE9A 1PNJA 1TTHB 2BIVA 5GJWB 2EQJA 1ZBXA 4M75B 3FRNA 4PJLA 5KH6A 1YP5A 4RG2A 2SRCA 1OX9A 4KGXB 5C0MA 2J7IA 2EQMA 1NPRA 2FRYA 2OI3A 4KBMB 1JXMA 3M0RA 2YDLA 3HL8A 3BW1A 2VGMA 3VS0A 4ZTJA 4CRIA 4OMMA 5DLOA 1K0SA 2OTLA 3BDUA 2XDBA 1TU0B 1SG5A 1SHGA 3SFMA 1B34A 2NLUA 2RK1A 2E5KA 4ZGJB 2D1XA 1M5Q1 3OYHA 1W6XA 4IIOA 3VU3C 2DRKA 1NLOC 1R0CB 4RMOA 5CAIA 5HK0A 1Q81C 1CKAA 2J05A 4HCCA 2EQKA 2YT6A 4LD6A 3E1SA 2FYKA 4LNPA 4KH1B 4N4GA 4Y91A 3HPWA 2LTOA 2MWPA 2DMOA 4M78B 3EG1A 4QKUA 1OV3A 3CXCS 4M78C 1QWEA 3ULRB 4M78G 1VQNA 3P8BB 4RTUA 1OZ2A 2PU9B 1T0JA 4C0DB 2RJEA 1VQ6Q 4AFUC 3G71A 3JCMd 2XI9A 5GAMh 1K8AU 1Q7YR 1TSFA 2HQXA 3M53A 5KYYA 1D3BB 2O4XA 2CGHA 2CP2A 2YRDA 3MP6A 4BE1A 4KT0E 2HEQA 1IZ6A 4JRKA 3OSVA 2MYSA 3RKXA 1QVGS 3G6EA 2CT3A 1FMKA 2HL5C 3CPFA 5FWBA 3I55T 2VWFA 4HKEA 2LX7A 1LNXA 4FU6A 1C6VX 1W1FA 3RIRA 4M7DG 3I56Q 2F2WA 1GCQA 4UC4A 1VQOT 4LDUA 1M90C 1QMCA 4HCKA 2B86A 2I0NA 2QG9B 1N8RU 2EYXA 1VQ7Q 2OX7A 1KJWA 3RKYA 5IN1A 1ZLMA 1QKXA 1YJNQ 2NWMA 1M30A 4M7AB 2DFUA 1QVFS 4HXJA 1TOVA 1W2BA 3P8DA 1WHGA 2QEXT 1OOTA 3CPWA 3G4ST 3AT1B 2VKNA 2C0IA 3PGGA 1D1BA 1RAHB 2L3PA 4OVAA 1MNEA 4EMKB 4J5YA 1VYVA 4KH0B 5I11A 5LJ5f 1VUBA 1YJ9Q 4A4KA 2QQBA 3GLXA 3PFSA 2LVMA 1AOJA 5FW9A 3VRZA 5LJ5e 2FVUA 5C6SA 1S72T 1Q7YC 4J9BA 3M0QA 4HCZA 2F5TX 3CCVQ 2NUTB 1XJWB 2MCNA 1AT1B 3QDFA 1WQWA 1VQPA 3CXCA 5GAN7 2RHUA 3VUBA 2KDSA 3HSBA 3S3NA 1ZSGA 2J6FA 5I22A 3CCRQ 4OF1A 3EFSA 3NTHA 2MMPA 1Y07A 1BI2A 1Y7XA 3OYJA 3GOXA 3JB9G 1VQ6A 4JRIA 2KXDA 3CPWP 3C95A 2E70A 1VQMA 1MMNA 4FYYB 3REAB 5DY9A 3I5RA 1GCPA 1VQMT 3X28B 1JJ2A 2XMFA 8AT1B 2AZSA 1ZUYA 2LQKA 4F7UB 4F14A 1YBYA 2BZ8A 3CCQT 1G3WA 1IGUA 2QGGA 1FX7A 3HFOA 4K11A 3FJ5A 4QQGA 4M77E 1TS9A 2DTHA 1LOJA 1K73R 5GMKm 3OW2S 2YXYA 3CCUT 1VQLT 4MZMA 2RH2A 2HDAA 1LJOA 2LT1A 4J6YA 2H3JA 1WJRA 3OYBA 1HXDA 2QQRA 3VS5A 3CMAQ 3TSWA 3CCSA 4C0DC 2DD4A 4JLIA 1Q95G 1F1BB 5GAMj 3CMAA 3META 1UFFA 4E7JA 2YUNA 5GAN3 1G3SA 4RTVA 2F2VA 4C92B 4CC4B 2KXCA 1G83A 1M3CA 4MMLA 1RABB 2YRVA 4PNOA 4C0FA 2ZZDA 3UATA 5DM7R 2IPOB 5CKHA 1UB4A 1VQMQ 3JCMJ 3L2ZA 1KFZA 5A2QE 1Q81U 2G6FX 3EH1A 3OYFA 3I55Q 3RKWA 2ECZA 3OBYA 2JT4A 3FDRA 1K1ZA 4NL3A 1K0XA 5LJ5d 3FB9A 4KGVB 2H8HA 4C8QF 1NEBA 2VASA 1RAEB 1NJIR 1D1AA 3S6WA 1QQJA 1JRIA 3ER0A 4CC3A 4C92F 4Y28E 1ABQA 2XG8D 2E41A 4HT8A 4B9WA 1QCFA 2EGCA 3UA7A 1VQ7A 3OYLA 5DLQE 2DILA 3ZBDA 1I5OB 3C4SA 4KULA 2V1QA 1QP2A 5HY6A 1U1TA 4R56A 2Z0WA 3HFNA 5A0DA 2ED0A 1D1CA 1M90U 1VQNT 1T3SA 1N8RC 1YNZA 2JUFA 5FRMA 1KHCA 1Q82U 1T3LA 3HP9A 1AZEA 3U23A 1MNDA 5IAYA 2DAQA 2JTEA 2E5QA 3CC7Q 5L8RE 4BD3A 1UUEA 2GFAA 2KEAA 5CKEA 4LDWA 1BI3A 4A4FA 3L1AA 2HKQB 1GL5A 3TSZA 1W70A 3CCJQ 3UA6A 1RAIB 4BDZA 1KD1R 4PJNA 4BI4A 3CPWS 3PIOA 1X6OA 5IT9E 1TG0A 2A7YA 2ATCB 1QVPA 5GMKh 3QKJA 4RCBA 4DOWA 1AVZC 1UEBA 2PVDB 4JJNK 1BI0A 3CCET 3JCMb 1Q7YU 2KRMA 2MI6A 5LJ3h 5IH2A 5HKCA 2JJ9A 5GANf 1SF9A 2CUBA 4E7SA 1WX6A 3CCUQ 3TCJA 1VQLQ 4OGCA 3NTIA 4CC7A 4QQDA 3EAEA 2E3HA 5LJ3f 1UGQB 1I4K1 2DEQA 2X3WD 3L2WA 3DB3A 4GLKA 3M59A 3X25B 3I55A 1WIEA 2LQWA 3L2QA 4M77C 6AT1B 4DBFA 1JU5C 2PUOB 1BYMA 3CCLT 1YJWA 5GANj 4MMKA 2JM8A 3CCEA 4RKUE 3MCAB 4PJMA 3L2UA 2O9SA 4AG1C 4M7AC 4PJOC 2BTTA 1BKBA 1K8AC 1YIJT 4OMFB 1B07A 1U3OA 2DTIA 3NTKA 1X2QA 2ROLA 3I5SA 3CC2T 2M9UA 4GBQA 1MMDA 4C5GA 3CCSQ 2QI2A 3A5ZB 3ZL7C 5GANe 2DVEA 2JZ2A 3AHUA 5D7UA 3A8HB 1RACB 2VXEA 1JEGA 1FXXA 2CZ1B 3OYEA 4RUGA 5CO7A 3M9QA 2RHZA 2IG0A 5AYFA 3TEEA 2LT4A 1M1KC 1BBZA 2QTXA 4MDWA 2RQTA 1FMVA 2KK4A 4FT2A 3EFOB 1I07A 1QVGP 3M0PA 4BE0A 2ZPFB 1K9MR 1UGVA 1WQ7A 3A1PA 3DB4A 4F7UE 4PL6A 2CUDA 2KROA 3L2VA 3OY9A 1VQ8A 4ATOA 3RNJA 4HVUA 4QVZA 1GBQA 3KBGA 3CMET 1RI9A 2OTJQ 2HZYA 1WHJA 1X75C 1M1FA 1Y96A 2SEMA 3VS3A 2JVVA 2YUQA 2DX1A 4A54A 1HYOA 5M9OA 4IURA 4JRPA 1BK2A 3C12A 1YHQA 3CC2Q 1H641 4E7KA 3OS1A 2DNUA 2WSEE 3I35A 3DKMA 4DEYA 2EYWA 2P0KA 4II1A 1YCYA 2F1LA 5KYUA 1KG1A 1D09B 4PFZA 1VQOQ 2KT1A 4J9GA 4P5NA 2CSIA 3EG2A 1FYNA 3EG9B 2FO0A 1MUZA 4OB3B 2LC4A 3VS4A 1D0YA 2GQVA 2QDLA 3JV3A 1RADB 1GFCA 3EGUA 4L5GA 4PLLA 1WGSA 2XK0A 3MHXA 2FPDA 4J7FA 3CMEQ 2ZPBB 2LJ1A 4D6WA 3GBQA 3CCJT 1PSEA 2CREA 3RBBB 3CCMT 3LGLA 3NPFA 1QWFA 4KRTA 2EKOA 4AFQC 4E7LA 3JB9H 1OQKA 1OI1A 2FRWA 4WCIA 4C8QG 2DRMA 4PJOE 3OS0A 4TVRA 3OBWA 3JCMh 3LWIA 2KRSA 2EPDA 2LJ3A 3OYIA 4HCBA 1V76A 2DL4A 5IXBA 5D6XA 5ECAA 2DA9A 2RB6A 1ABOA 4M77B 1E7OA 3EGXA 3G4SQ 1TUCA 2HSPA 1YWPA 2DXCA 3L42A 3CXCP 3NGPA 2DLPA 2KI7A 4E2FB 1VQ9Q 4V2SA 3G71Q 3A8MB 3LYIA 1JB0E 3DLMA 1UGPB 2KR3A 4OB2B 2CZ6B 1R8OB 3ZEHA 4OB1B 5LJ3e 2GF7A 3J7AF 1HSQA 2C06A 4X34A 1SRLA 1KC8U 3PVQA 5KYNA 4BE2A 1LPLA 1UJ0A 1JJ2S 2PVGB 2FG0A 1QW1A 4DBRA 2EGEA 2X35A 3CCLQ 1ZQ1A 1WYXA 2DZCA 1D3BA 1UTIA 4XK8E 1YHQQ 5KYYB 4F16A 1HJDA 2CZ7B 2JNGA 1WLPB 3VS2A 3CBPA 3TVTA 1O9SA 1VQKT 3QJ6A 4D8KA 3VS6A 2JOYA 1VA7A 1SSHA 5LJ5g 5IXFA 3NHNA 1M8VA 1G2BA 4M78F 1M8MA 4OB0B 5KYWB 2G3RA 1G5VA 3M56A 3CCRA 2CP7A 1XTDA 2RI5A 4J9EA 3RR6A 3CQTA 1OU9A 2QQSA 3GP8A 4E47A 3FEOA 5GAN4 1KD1U 1PD0A 3TREA 4RCCA 5FU7B 3VRYA 3UT1A 4DOVA 3SB2A 4JZ4A 4F7UG 1K4US 3V8KA 3JCMW 5IHIA 1YJ9A 1M1GA 2DJZA 3LW5E 4JDSA 2CP6A 3RESA 1YWOA 4JPBW 5FLXE 3JCMc 2XD0A 1E6GA 1UJYA 3M4GA 2FZCB 1NLPC 1B3QA 3CEYA 4C0ZA 1YI2Q 2PVOB 4E6RA 2M0OA 2YLCA 5LJ3d 1EIFA 3S3MA 2YLBA 4AG2C 1UGSB 5GAN5 4J9IA 3UPUA 4KGZB 2FHDA 5GANd 2L3SA 2GFUA 2E3IA 1AD5A 4J9HA 3VUZA 2EJFA 3FLGA 2QK0A 1PWTA 2DK3A 3SWNA 3I9QA 2A36A 2O31A 2K5LA 4C0GA 2DTOA 4F7UF 2QTVA 3E2UA 2CKKA 5HK3A 5J3BA 5CKFA 5AT1B 2MAMA 4M7AD 1PKSA 3MJXA 4IUPA 1NBEB 2P0PA 2Y4XA 1JXOA 4M77A 1V29B 4JLGA 2XICA 4YTLA 1SHFA 2RI2A 5KCOA 5I2SA 4Z02A 2K2MA 2DXTA 3QDRB 2X51A 4ZTFA 3H8ZA 3NFCA 5GAMd 3REBB 3J80E 2QQAA 2W10A 1BCOA 1WPYA 3RDVA 2EYQA 4FSXA 1N6AA 3M0SA 3TQ7P 1XQHA 3FJPA 1SRMA 4L59A 1K9MU 2DJQA 3S3OA 2DZ9A 2DL5A 2K79A 2P4TA 1VQ4Q 2KQWA 3JB9F 2VUBA 4QT7A 2CT4A 1AWOA 1U5SA 1ZA1B 1WA7A
chains in the Genus database with same CATH topology
3LH0A 3PMTA 5GANg 4FT4A 5I21A 2VYTA 2E5QA 3GNGA 2DIGA 3OW2A 5GAOn 2K3YA 2OTJT 5CQXA 1YI2A 5L8RE 3A8LB 2V8JA 4BD3A 3I56A 3CD6A 5FRNA 2GFAA 3BY7A 3LGFA 3QPHA 3R6OA 5CKEA 2IVWA 3JCMf 4IUVA 4LDWA 1K73U 3CCQA 3G7ZA 3CMEA 3FC3A 2ZPIB 1BI3A 4E7IA 2WACA 4A4FA 3E9FA 3L1AA 3UWNA 5GANh 2OAUA 3M55A 3HRTA 4BDZA 3QJYA 4EMKC 4JRQA 5GAN8 3OYNA 4BI4A 3JCMX 3CPWS 2K3XA 1KQ1A 3PIOA 2HAXA 1X6OA 3MP1A 3OA6A 1MHNA 5IT9E 2A7YA 3CC7T 3EFRA 3PNWC 1QVPA 3I56T 5CCAA 3QKJA 4MZTA 5GMKh 3CD6T 4O6JA 4RCBA 4DOWA 2X4YA 1UEBA 2PVDB 3C94A 4PJOF 4JJNK 1BI0A 1K73C 5CKBA 3CCET 1U8RA 3JCMb 1Q7YU 1K9MC 2CYZB 2R57A 1VQ4T 3M57A 2MI6A 3MO8A 5LJ3h 2DPPB 5HKCA 1Y71A 5GAN2 3CC4T 2Y4YA 4IUTA 5GANf 3LWHA 2I2LA 3X24B 1KQSS 3X26B 3TCJA 2Y90A 4PLIA 4OGCA 3HHTB 3NTIA 1IREB 2R58A 3H6ZA 3EAEA 4QQDA 3CMAT 1NPPA 3GF5A 5LJ3f 3PTAA 1VQOA 1BIBA 1UGQB 2QXFA 1I4K1 2DEQA 1KQSA 1O75A 3L2WA 4M7DE 1KC8C 1Y96B 3VYHB 5GAOq 3DB3A 4GLKA 3M59A 3V7SA 2ZPGB 3X25B 4A4HA 4XTYA 4ZGDB 3I55A 2XU8A 4OP0A 3L2QA 5LJ3j 4M77C 5GAOl 3QBYA 4HT9A 2PUOB 1BYMA 3OYMA 2XKOC 4OGEA 3QIIA 3CCLT 1P92A 1YJWA 1RL2A 5GANj 5CQYA 4C8QE 3ZFJA 4MMKA 4JS5A 5LJ5j 2RK2A 2YHTA 3CCEA 1KD1C 2OTJA 4RKUE 3MCAB 2PQWA 3CBMA 2BUDA 4J6WA 3L2UA 1B34B 4M7AC 3QZ5B 4PJOC 2X4WA 2FB7A 4FL6A 1BKBA 3HKSA 1K8AC 1YIJT 5EG2A 4Q5WA 4M75G 2LQ8A 2DTIA 2FL7A 4OMFB 5D6WA 1VQ5A 3NTKA 3GNFB 4XU0A 2V8IA 3CC2T 2M9UA 2BIVA 2XHCA 3MEWA 2EQJA 4N0AC 1ZBXA 3GPLA 4M75B 3FRNA 2QDYB 4BI8B 5KH6A 2E10A 4RG2A 1TH7A 4C5GA 5C0MA 4LDXA 2EQMA 4C92A 3G6ET 2QI2A 2D6FA 3A5ZB 1NPRA 2E65A 2GCXA 2D9TA 2DVEA 5GANe 2JZ2A 4MDXA 3AHUA 3PT9A 3DLLA 4KBMB 3A8HB 1NJIC 2VXEA 1FXXA 3HL8A 2CZ1B 1DJ7B 4XU3A 3OYEA 1VIEA 5CO7A 4J8OA 3M9QA 2RHZA 2IG0A 3BW1A 5AYFA 3TEEA 1WJQA 2VGMA 2XDDA 1Q86C 4ZTJA 2LT4A 1M1KC 2ZPEB 4CRIA 2XDPA 2QTXA 4MDWA 4DA4A 5DLOA 5CVIA 1VQ9A 2BKDN 2OTLA 3BDUA 4A4GA 4C8QA 2KK4A 1NE8A 2XDBA 2VV5A 5J39A 4FT2A 4XTWA 4M78A 4ZN1A 3OQ5A 3OYAA 4EMKA 1I8FA 3SWNB 4M7AF 2HNIA 4BE0A 1NJIU 2ZPFB 3JSCA 3SFMA 1B34A 3RMSA 2NLUA 1WQ7A 2RK1A 3DB4A 4F7UE 4ZGJB 1M5Q1 2HQEA 2L5QA 4PL6A 3OYHA 1G3YA 3QSUA 2JTMA 2RI3A 4PJOD 3VU3C 5GAOp 3OY9A 3L2VA 3ME9A 1M1KU 1VQ5T 1VQ8A 4ATOA 4QVZA 2EWNA 3KBGA 3CMET 4NOYA 3T9NA 4A4EA 5CAIA 3ASKA 5HK0A 4RMOA 1Q81C 4KUIA 1X75C 3QYGB 4HCCA 2WSCE 1M1FA 1Y96A 2EQKA 5LL6S 3V8JA 3QG1A 4LD6A 3E1SA 3PMIA 2FYKA 1Q82C 4N4GA 4WF2A 4Y91A 2JVVA 3CC7A 3RMQA 3CCST 1VQ8T 2AHJB 3HPWA 2LTOA 2MWPA 4J83A 4ELYC 2DXBA 4M78B 4C5HA 3F70A 4C8QC 4A54A 2JN0A 3CXCS 4M78C 3SDZA 4IURA 5M9OA 3C12A 4JRPA 1YHQA 1VQKA 3OSSC 1H641 4M78G 4E7KA 1Q86U 1VQNA 3P8BB 3OS1A 3JRZA 1OZ2A 2PU9B 3RUXA 2WSEE 4LDYA 4C0DB 2RJEA 4J7IA 3DKMA 4QVCA 2JTFA 4IKFA 3G71A 3JCMd 1WNLA 2XI9A 2P0KA 5GAMh 1K8AU 3WXMB 3VV0A 4KUDK 4FM4B 4II1A 4QQ6A 1YCYA 2CS7A 1YIJA 2HQXA 3M53A 1KG1A 2KAFA 3OMCA 4PJOA 4P5NA 1YJNA 1D3BB 2A3LA 2O4XA 2CGHA 1AHJB 2VC8A 3PIPA 2ZPHB 3MP6A 4XQ3A 4BE1A 4KT0E 1IZ6A 2O4XB 2K4YA 4OB3B 3JCMg 2LC4A 4JRKA 2GQVA 3OSVA 3RKXA 2RD1A 2EJGA 2R5MA 3G6EA 1QVGS 4L5GA 1VQLA 4M75D 4PLLA 3OMGA 1WGSA 2E12A 2F69A 2XK0A 3CPFA 4MZPA 3V7RA 3MHXA 5KE2A 4J7FA 3I55T 4M7DF 2EJ9A 1YHQT 4M7DC 2ZPBB 4HKEA 4D6WA 1NZ9A 1LNXA 4FU6A 5GMKl 3RIRA 3CCJT 2B8AA 4M7DA 2EFIA 4M7DG 1PSEA 4UC4A 3M5AA 1VQOT 3CCMT 1QVGA 5GAMf 1RI0A 3LGLA 2E1HA 4LDUA 1YITA 1M90C 2EKOA 4E7LA 2OTLT 3JB9H 1VIFA 1N8RU 2LCLA 4M78D 1OI1A 3L2RA 3CCVT 3VKIA 1VQ6T 4C8QG 4PJOE 2QA4T 4FIBA 1VQ4A 3RKYA 5IN1A 3KXTA 3OS0A 4N4IA 4TVRA 3OBWA 2E6NA 2MWOA 4DQ2A 3JCMh 3HRUA 4M7AB 4R55A 4LD9K 2M1HA 1G3TA 3LWIA 1QVFS 1WJSA 4C92E 3JAME 3OYIA 4HCBA 1U1SA 2P0QA 4F7UA 4XU1A 2RM4A 4M77G 3LX7A 4NL2A 5D6XA 5A0GA 1W2BA 3P8DA 4XTXA 2QEXT 2EAYA 4C92G 2RB6A 3CPWA 3G4ST 4M77B 3TU4K 3URGA 3PGGA 4C5EA 2O01E 1W4SA 4OVAA 4EMKB 4J5YA 4N4HA 2RA2A 4M7DD 5LJ5f 1VUBA 3QUIA 4A4KA 2QQBA 3OYDA 3GLXA 3PFSA 2DXCA 1XNIA 2KVQG 2LVMA 4M75F 1YITT 1YJNT 3MEUA 3L42A 3MEAA 5LJ5e 2FVUA 5GAOm 2LCCA 4ZGEB 5C6SA 1S72T 1Q7YC 4A53A 4HCZA 4V2SA 2F5TX 2K2VA 2RHYA 3A8MB 3LYIA 1JB0E 3DLMA 1UGPB 3MP8A 4ZN3A 1BIAA 4OB2B 3HRSA 2CZ6B 1R8OB 4EPCA 1WQWA 2VXFA 2LRQA 3MEVA 3ZEHA 3OYGA 1VQPA 3GIBA 3CXCA 1GXIE 1HK9A 4OB1B 3LLRA 5LJ3e 4M77F 2GF7A 2DXUA 4M75E 2ZCFB 4XTVA 2RHUA 3VUBA 3E9GA 2KDSA 5GAN7 2C06A 4X34A 3S3NA 3HSBA 1KC8U 4OF1A 2ZGWA 3EFSA 3NTHA 1M9SA 1YJWT 4BE2A 3BDLA 4BY6B 2MMPA 1Y07A 1BI2A 1Y7XA 4XU2A 3OYJA 3GOXA 3VYGA 3JB9G 1VQ6A 4JRIA 4EMGA 2PVGB 1JJ2S 1I81A 1QW1A 4C8QB 1MGQA 2RHXA 2X35A 5LJ5h 3C95A 2E70A 3JCMe 1ZQ1A 1VQMA 2DZCA 2LNVA 1D3BA 3JB9J 4XK8E 4PJOB 2EQUA 4M7AG 2VGNA 4PKCC 2CZ7B 2JNGA 5DY9A 5LJ3g 1VQMT 3CBPA 4PJOG 3X28B 1JJ2A 1N9SA 1O9SA 3V7CA 1VQKT 4M7AE 2KY9A 3QJ6A 5GMKj 2JOYA 3Q1JA 2LQKA 2RJDA 4M75C 4BI3A 4F7UB 5LJ5g 1YBYA 3CCRT 2R5AA 3CCQT 4M75A 3BFMA 1G3WA 4IUQA 4C8QD 1M8VA 1FX7A 3HFOA 2X4JA 3OB9A 4M78F 4QW2A 4OB0B 5KCHA 4M7DB 4ELZC 3FIFA 4QQGA 2G3RA 1VQPT 4L6V5 4M77E 1G5VA 3M54A 3M56A 3CCRA 4GY5A 2K5IA 3V8LA 5D6YA 2DTHA 2EIFA 4LDVA 2RJFA 1LOJA 1XTDA 2RI5A 1OYXA 5GMKm 4E7HA 3OW2S 4EDUA 1KD1U 3CCLA 3CCUT 1VQLT 2RH2A 2QQSA 4MZMA 1LJOA 2LT1A 1QVFA 4J6YA 2H3JA 1WJRA 2LDMA 3CBOA 3OYBA 3GP8A 1HXDA 2QQRA 4E47A 1S72A 3FEOA 2QEXA 4NS5A 5GAN4 2DO3A 5CK9A 3CCSA 1W2BS 4C0DC 2DD4A 1BI1A 1N27A 2LX9A 4JLIA 4RCCA 3TREA 5FU7B 3WVDB 5CKDA 3JCMQ 5GAMj 2HBPA 2K57A 2RO0A 1N9RA 5CIUA 3CMAA 3UT1A 1I5LA 4DOVA 1H3ZA 3META 3RERA 3SB2A 4E7JA 4F7UG 3V8KA 5GMKe 1X01A 5GAN3 1G3SA 1FWZA 2L89A 3A8OB 3JCMW 4C92D 3A8GB 4C92B 1YJ9A 1M1GA 2DJZA 3LW5E 4JDSA 5A0LA 3RESA 3N5BB 4JUVA 4MMLA 3G4SA 2YRVA 4C0FA 4PNOA 5FLXE 2ZZDA 1QP3A 3QYHB 4EMHA 4CI0C 3JCMc 5DM7R 3CCJA 3CCVA 2XD0A 5CKHA 2E6ZA 1UB4A 3M4GA 1VQ7T 3JCMJ 3L2ZA 5A2QE 3X20B 3INZA 1Q81U 4BACA 1SSFA 3WVEB 3CEYA 4C0ZA 2PVOB 5GAMe 3OS2A 3OYFA 3RKWA 2M0OA 2YLCA 5LJ3d 1EIFA 3OBYA 3S3MA 3QHSA 2L8DA 2YLBA 3FDRA 1UGSB 5GAN5 4NL3A 3UPUA 5GMKi 4M78E 5FROA 5LJ5d 2FHDA 5GANd 1KHIA 3FB9A 1XOVA 2GFUA 4XTZA 5GAN6 1PSFA 5J26A 3VUZA 2EJFA 3P8HA 4M77D 4C8QF 3CCMA 3FLGA 3SWNC 2F5KA 3JB9D 3JCMV 2E64A 2DK3A 3SWNA 3QXEB 2D0QB 3S6WA 2WSFE 1JRIA 3ER0A 4B9XA 2K5LA 3VJPA 4J6XA 2DTOA 4C0GA 4F7UF 2RJCA 4BUGA 1JBMA 2MF2A 3M58A 4C92F 3JCMP 2CKKA 4C92C 2X4XA 4Y28E 5CKFA 5J3BA 2MAMA 3SD4A 5HK3A 2KSSA 3CCUA 2XG8D 4M7AD 2E41A 2M16A 3J81E 2DD5A 5KE3A 4HT8A 4B9WA 4IUPA 4QVDA 1YI2T 4RG8A 1VQ7A 5GAMg 3OYLA 3OYCA 1M4ZA 4XTUA 2P0PA 2Y4XA 4JS4A 2HD0A 4M77A 5GAOr 1UGRB 1V29B 5DLQE 4JLGA 2XICA 3ZBDA 5CR2A 1VQ9T 4ME7A 3J7AF 3CC4A 4YTLA 3C4SA 4KULA 1KQ2A 2RI2A 5FU7C 5KCOA 2QA4A 5I2SA 4Z02A 1OZ3A 1QP2A 2DXTA 2KMTA 4XAXB 1U1TA 2V8KA 3QDRB 5HY6A 4BB7A 4IUUA 4ZTFA 3H8ZA 3NFCA 4HA8A 5GAMd 4R56A 3O8VA 3J80E 2DKGA 2QQAA 3HFNA 4X9CA 4M7AA 5A0DA 4BY6C 2DIQA 2K5FA 3E19A 3G71T 1WPYA 2EYQA 1M90U 4FSXA 1VQNT 3OYYA 1N6AA 2PUKB 4X9DA 1XQHA 1ZHIA 3UDCA 1N8RC 2QQ9A 3KUFA 3FJPA 3OYKA 4L59A 1K9MU 2JUFA 4N0AA 4BDYA 3QO3A 5I2MA 4C5IA 2CZ0B 3S3OA 5FRMA 2DZ9A 2P4TA 1KHCA 5FU6B 1Q82U 3OS5A 3JB9I 3CC2A 2KQWA 3JB9F 3HP9A 2VUBA 4O5VA 1YJ9T 2XIDA 2L3RA 5FU6C 3M4YA 2RHIA 4VUBA 5IAYA 3QZ9B 2DAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N27 A;  3LH0 A;  3OYI A;  3PMT A;  2BKD N;  4A4G A;  2VYT A;  2E5Q A;  5J39 A;  3LX7 A;  2RO0 A;  5CIU A;  5D6X A;  2DIG A;  3P8D A;  3UT1 A;  1H3Z A;  2K3Y A;  3MET A;  3OQ5 A;  3OYA A;  4E7J A;  4BD3 A;  4BE0 A;  2GFA A;  5FRN A;  3LGF A;  4IUV A;  2NLU A;  3DB4 A;  2L89 A;  4C5E A;  2HQE A;  4PL6 A;  3OYH A;  3FC3 A;  4E7I A;  2WAC A;  4A4F A;  3E9F A;  4OVA A;  2RI3 A;  3UWN A;  4N4H A;  3OY9 A;  3L2V A;  3ME9 A;  2YRV A;  4QVZ A;  4BDZ A;  3OYN A;  2K3X A;  3OYD A;  3PFS A;  4A4E A;  3ASK A;  2LVM A;  1MHN A;  1XNI A;  3MP1 A;  3OA6 A;  3PNW C;  3QKJ A;  3MEU A;  3L42 A;  4BAC A;  1SSF A;  3CEY A;  3MEA A;  2EQK A;  2X4Y A;  2LCC A;  3OS2 A;  4LD6 A;  3PMI A;  5C6S A;  3OYF A;  2M0O A;  4N4G A;  3S3M A;  4HCZ A;  2R57 A;  2L8D A;  2LTO A;  2MWP A;  3FDR A;  4C5H A;  3MO8 A;  2RHY A;  3F70 A;  3LYI A;  3MP8 A;  3DLM A;  5FRO A;  2FHD A;  4IUT A;  5M9O A;  4IUR A;  4E7K A;  3MEV A;  2LRQ A;  3ZEH A;  3OYG A;  3OS1 A;  2GFU A;  1OZ2 A;  4PLI A;  3LLR A;  2GF7 A;  3NTI A;  2R58 A;  5J26 A;  3H6Z A;  2RHU A;  3EAE A;  3E9G A;  2RJE A;  4QQD A;  3P8H A;  4X34 A;  3S3N A;  3FLG A;  2JTF A;  3L2W A;  4IKF A;  2F5K A;  2XDP A;  3NTH A;  3DB3 A;  2P0K A;  4BE2 A;  3BDL A;  4QQ6 A;  4II1 A;  3S6W A;  4A4H A;  3OYJ A;  3GOX A;  2HQX A;  3L2Q A;  4B9X A;  3QBY A;  3OMC A;  2RJC A;  3OYM A;  2O4X A;  2CKK A;  3QII A;  2X4X A;  3SD4 A;  3MP6 A;  4BE1 A;  2RHX A;  2X35 A;  2M16 A;  2O4X B;  5KE3 A;  4B9W A;  4IUP A;  2EQU A;  2PQW A;  3OYL A;  2BUD A;  3OYC A;  2R5M A;  3L2U A;  4PLL A;  2X4W A;  3OMG A;  4FL6 A;  1WGS A;  2XK0 A;  5KE2 A;  3C4S A;  2RI2 A;  3QJ6 A;  5KCO A;  4Q5W A;  5D6W A;  4Z02 A;  4CRI A;  1OZ3 A;  3NTK A;  4FU6 A;  3Q1J A;  2RJD A;  2B8A A;  2EFI A;  2BIV A;  4IUU A;  4ZTF A;  3MEW A;  3H8Z A;  2EQJ A;  2R5A A;  3O8V A;  4IUQ A;  4UC4 A;  5IAY A;  3OB9 A;  1RI0 A;  2DIQ A;  3LGL A;  4QW2 A;  4RG2 A;  5KCH A;  5KH6 A;  4C5G A;  5C0M A;  4QQG A;  2EKO A;  2G3R A;  2EQM A;  4E7L A;  1G5V A;  4GY5 A;  3L2R A;  1OI1 A;  2D9T A;  3KUF A;  5D6Y A;  2JZ2 A;  3OYK A;  4L59 A;  2RJF A;  2RI5 A;  1OYX A;  4BDY A;  4E7H A;  4C5I A;  4EDU A;  5IN1 A;  3S3O A;  5FRM A;  3OS0 A;  4N4I A;  1KHC A;  2QQS A;  3OYE A;  2E6N A;  2MWO A;  1WJR A;  2LDM A;  3M9Q A;  2RHZ A;  2IG0 A;  3OYB A;  2L3R A;  1WJQ A;  2QQR A;  2M1H A;  2RHI A;  3FEO A;  4ZTJ A;  4NS5 A;  1WJS A;  2DAQ A; 
#chains in the Genus database with same CATH topology
 5GAN g;  5I21 A;  2VYT A;  5IHN A;  3OW2 A;  5GAO n;  2K3Y A;  1YI2 A;  3CD6 A;  2JM9 A;  1Z9Z A;  3BY7 A;  3JCM f;  2P4R A;  3G7Z A;  3CME A;  1AWX A;  3FC3 A;  1HD3 A;  2DF6 A;  2ZPI B;  4E7I A;  1ZSZ C;  3E9F A;  1MMA A;  3M55 A;  3HRT A;  3QJY A;  4EMK C;  4A63 B;  2K3X A;  5CCA A;  2FPE A;  4D8D A;  1MMG A;  2X4Y A;  3C94 A;  1K73 C;  5CKB A;  1U8R A;  2OTL Q;  5L23 A;  1K9M C;  3EHR A;  2LP5 A;  1UHF A;  3CC4 T;  2Y4Y A;  2EYZ A;  2CP3 A;  2DYI A;  2Y90 A;  4PLI A;  3HHT B;  2R58 A;  3CMA T;  4PJJ A;  1GFD A;  1VQO A;  2QXF A;  1KC8 C;  1Y96 B;  2ZPG B;  4ZGD B;  4XTY A;  4OP0 A;  2JMA A;  2GNC A;  3OYM A;  4OGE A;  2HQH A;  1OPL A;  4C8Q E;  3ZFJ A;  4JS5 A;  2LQN A;  5LJ5 j;  1C1A A;  2KT8 A;  2PQW A;  1RLP C;  2HCK A;  4J6W A;  1D0Z A;  3QZ5 B;  1VQ8 Q;  2FB7 A;  3HKS A;  1K76 A;  4Q5W A;  5D6W A;  2LQ8 A;  1VQ5 A;  1NYG A;  1ARK A;  2XHC A;  4ESR A;  3MEW A;  2RPN A;  2H3E B;  3EG9 A;  1ZBJ A;  2QDY B;  4PK4 A;  2E10 A;  3H41 A;  3G6E T;  2YSQ A;  2E65 A;  2VVK A;  2NUP A;  4MDX A;  3DLL A;  2NUP B;  1NJI C;  1FMW A;  3PVL A;  4XU3 A;  1VIE A;  2ZPE B;  2XDP A;  4DA4 A;  1H8K A;  1VQ9 A;  2PTK A;  4A4G A;  1Y0M A;  5EC7 A;  4C8Q A;  1NE8 A;  2D8J A;  2VV5 A;  4Z88 A;  4ZN1 A;  3OQ5 A;  4M7A F;  2HNI A;  4FYX B;  3RMS A;  2HQE A;  2L5Q A;  1G3Y A;  3QSU A;  2RI3 A;  5KYW A;  5GAO p;  1M1K U;  3ME9 A;  4PFP A;  4JJD A;  2BE9 B;  2EWN A;  4NOY A;  3T9N A;  1M3B A;  5KYU B;  3ASK A;  4KUI A;  1IO6 A;  3QYG B;  4HVW A;  3V8J A;  3CCS T;  1VQ8 T;  2AHJ B;  2HBW A;  4ELY C;  2DXB A;  3EFO A;  2M51 A;  1JJ2 P;  2JN0 A;  1VQK A;  1M2V B;  3OSS C;  1B7T A;  3CCQ Q;  3JRZ A;  3EGD B;  1IB8 A;  4LDY A;  1RAA B;  4QVC A;  4IKF A;  1WNL A;  4KUD K;  3VV0 A;  4QQ6 A;  2CS7 A;  1YIJ A;  2KAF A;  3OMC A;  4PJO A;  3THK A;  2VC8 A;  3PIP A;  2ZPH B;  3JCM g;  1K9A A;  2EJG A;  2R5M A;  1ZSZ B;  2DBM A;  1Q81 R;  1PRM C;  2E12 A;  3NMZ C;  2HKN A;  4MZP A;  3V7R A;  2L2P A;  1YHQ T;  4M7D C;  1NZ9 A;  5GMK l;  2B8A A;  4RTZ A;  4M7D A;  5GJV B;  2E1H A;  1YIT A;  2OAW A;  4FCY A;  1QLY A;  2OTL T;  2KNB B;  1VIF A;  4M78 D;  2NUT A;  3L2R A;  3VKI A;  1VQ6 T;  2YUO A;  3H0F A;  2QA4 T;  3KXT A;  4F17 A;  2MWO A;  4DQ2 A;  3HRU A;  4R55 A;  4LUD A;  1PRL C;  2M1H A;  1G8X A;  3JAM E;  2P0Q A;  4F7U A;  2RM4 A;  4J9D A;  5A0G A;  2AK5 A;  4Y92 A;  4XTX A;  1NYF A;  2EAY A;  1IGQ A;  1E6H A;  1LVK A;  1X2K A;  2EKH A;  4C5E A;  1ZX6 A;  3R6N A;  1PG5 B;  4N4H A;  2FEI A;  3SEM A;  4M7D D;  3OYD A;  3H0H A;  2KVQ G;  1XNI A;  4M75 F;  1YJN T;  1M90 R;  3MEU A;  2GBQ A;  4ZGE B;  4A53 A;  4OMQ A;  1YCS B;  2K2V A;  3G6E Q;  1Z9Q A;  2RHY A;  1Q82 R;  1WXB A;  2RQU A;  3MP8 A;  4ZN3 A;  1BIA A;  3HRS A;  1GBR A;  2VXF A;  3MEV A;  5KYX B;  1HK9 A;  3LLR A;  3M0T A;  4C8Q D;  2ZCF B;  3E9G A;  2LNH B;  2ZGW A;  2DE0 X;  4XU2 A;  1WXT A;  3CCM Q;  4EMG A;  1IXD A;  2GTJ A;  1UE9 A;  1MGQ A;  2PZ1 A;  3JCM e;  3JB9 J;  2AZV A;  2JW4 A;  2J6K A;  4M7A G;  4PKC C;  5LJ3 g;  2MIO A;  1WXU A;  1VYT A;  4M7A E;  2O88 A;  1IHW A;  5GMK j;  2EVR A;  1YJW Q;  4M75 C;  4BI3 A;  3CCR T;  2R5A A;  1LCK A;  4M75 A;  4RTW A;  1QCN A;  3OB9 A;  2ROT A;  4ELZ C;  2JS2 A;  3FIF A;  1OEB A;  4L6V 5;  1VQP T;  1H3H A;  3V8L A;  2K5I A;  5D6Y A;  4LDV A;  1WHL A;  2RJF A;  1T0H A;  2QAZ A;  1WHM A;  2DM1 A;  4CC2 A;  1QVF A;  1BU1 A;  1CKB A;  2LDM A;  3CBO A;  1KSW A;  4NS5 A;  1W2B S;  1BI1 A;  5CKD A;  3JCM Q;  2HBP A;  2RO0 A;  1GCQ C;  5FWC A;  1PD1 A;  1WFW A;  3VS1 A;  1NM7 A;  3A8O B;  4C92 D;  5A0L A;  3EGD A;  3G4S A;  4EMH A;  3QYH B;  3CCJ A;  3CCV A;  2ED1 A;  1VQ7 T;  3X20 B;  3INZ A;  4ZNX A;  3WVE B;  5GAM e;  3EG0 A;  1KK7 A;  3MKD A;  3PE0 A;  1PM3 A;  4LUE A;  1OPK A;  1KHI A;  2K7A A;  1N8R R;  4XTZ A;  3CCM A;  3JCM V;  3MPU B;  4FW2 A;  2E64 A;  2D0Q B;  1R77 A;  4B9X A;  1QCO A;  3VJP A;  1UG1 A;  1JBM A;  2MOX A;  3M58 A;  2DEU A;  4C92 C;  1WHH A;  3BE3 A;  3SD4 A;  1KQS P;  2FZK B;  4QVD A;  4RG8 A;  1M4Z A;  4XTU A;  4JS4 A;  2E4H A;  3G1J A;  3CC4 A;  4BB7 A;  2V8K A;  1CSK A;  2AKK A;  3O8V A;  2RNA A;  4DBH A;  1MV3 A;  1NG2 A;  4BY6 C;  2K5F A;  3E19 A;  3G71 T;  2DL8 A;  3OYY A;  1ZHI A;  3UDC A;  3KUF A;  3OYK A;  2M0Y A;  1SKU B;  2NUZ A;  2LCS A;  4BDY A;  5I2M A;  1V1C A;  2CZ0 B;  4JJC A;  3CC2 A;  3SHW A;  4O5V A;  1YJ9 T;  2RQW A;  2XID A;  3M4Y A;  2CH4 A;  1D0X A;  3LH0 A;  1BB9 A;  3PMT A;  4FT4 A;  2DIG A;  4J9F A;  1AEY A;  5CQX A;  3A8L B;  1TWB A;  2V8J A;  3I56 A;  2IVW A;  2M02 A;  3CCQ A;  1UDL A;  3UWN A;  5GAN h;  1TXQ A;  5GAN 8;  3OYN A;  4E7Z A;  1YIT Q;  2HAX A;  1KQ1 A;  2V1R A;  3MP1 A;  3OA6 A;  1MHN A;  3PNW C;  3CD6 T;  4MZT A;  4O6J A;  4LN2 A;  2AIR B;  1YIJ Q;  2X9H A;  3MO8 A;  1SEM A;  5GAN 2;  4IUT A;  2I2L A;  2FPF A;  1VQN Q;  3X24 B;  1KQS S;  3X26 B;  2GTO A;  1IRE B;  5HCK A;  3H6Z A;  1TUG B;  1NPP A;  3GF5 A;  3PTA A;  1BIB A;  2HL3 A;  2KYM A;  4M7D E;  1ZSZ A;  1O75 A;  4FW1 A;  3VYH B;  1IRX A;  2EW3 A;  2HMA A;  1PC0 A;  2AKL A;  3V7S A;  2CP0 A;  3A98 A;  5LJ3 j;  3H9N A;  3QBY A;  4HT9 A;  2XKO C;  3QII A;  1P92 A;  1RL2 A;  5CQY A;  2RK2 A;  2YHT A;  1KD1 C;  2D0N A;  1VQK Q;  1TUD A;  4OML A;  3EH2 A;  2CSQ A;  1YFN A;  1B34 B;  1M2O A;  1M3A A;  2X4W A;  2CDT A;  3KFV A;  3CCE Q;  2YWW A;  5EG2 A;  2FL7 A;  4XU0 A;  3GNF B;  4R0K A;  4N0A C;  3GPL A;  4BI8 B;  1RUW A;  1TH7 A;  1OX8 A;  2DER A;  4EIK A;  4LDX A;  4C92 A;  2D6F A;  2GCX A;  3IQL A;  2D9T A;  3PT9 A;  1JO8 A;  2QGF B;  7AT1 B;  1DJ7 B;  4J8O A;  4Z89 A;  2XDD A;  1WJQ A;  4WTO B;  1Q86 C;  4JZ3 A;  1N5Z A;  3M0U A;  5CVI A;  2BKD N;  2ABL A;  1M27 C;  4XTW A;  5J39 A;  4M78 A;  1S72 Q;  2BZX A;  3OYA A;  1X69 A;  1I8F A;  2C0T A;  4EMK A;  1ZUU A;  3SWN B;  3QWY A;  2L0A A;  1NJI U;  3JSC A;  4B6M A;  2JTM A;  4PJO D;  1VQ5 T;  1NEG A;  3HTR A;  4A4E A;  1YN8 A;  1EZZ B;  2WSC E;  5LL6 S;  3QG1 A;  2RN8 A;  1VQ5 Q;  3PMI A;  1Q82 C;  4WF2 A;  3CC7 A;  3RMQ A;  1U06 A;  2LMJ A;  2X3X D;  4J83 A;  4C5H A;  3F70 A;  4C8Q C;  2KBT A;  1S1N A;  1PCX A;  3SDZ A;  2LJ0 A;  1Q86 U;  1VQP Q;  1W2B P;  3EGX B;  2CH4 W;  3RUX A;  1AWW A;  4J7I A;  1C0M A;  4Z8A A;  2JTF A;  2DVJ A;  4FYW B;  3WXM B;  4FM4 B;  2A37 A;  1UHC A;  2RF0 A;  2ZAE A;  1YJN A;  2O9V A;  1X6B A;  2A3L A;  1AHJ B;  4XQ3 A;  2O4X B;  2K4Y A;  3CC4 Q;  2DET A;  2RD1 A;  9ATC B;  2RMO A;  4M75 D;  2KRN A;  3OMG A;  1BCM A;  2F69 A;  5KE2 A;  4M7D F;  2EJ9 A;  1RAG B;  2EFI A;  3CD6 Q;  1EX4 A;  3M5A A;  4AFS C;  1QVG A;  5GAM f;  1RI0 A;  1RLQ C;  2PNI A;  2LCL A;  3CCV T;  1ZUK A;  1IHV A;  2GQI A;  1SPK A;  4FIB A;  1VQ4 A;  2J6O A;  4N4I A;  3UF4 A;  2E6N A;  4LD9 K;  1G3T A;  1WJS A;  4C92 E;  4M4Z A;  1U1S A;  4XU1 A;  4M77 G;  3LX7 A;  2EGA A;  4NL2 A;  1JQQ A;  4FYV B;  4C92 G;  4DBQ A;  1VOM A;  2EYY A;  3TU4 K;  3URG A;  2O01 E;  3VS7 A;  1W4S A;  2FZG B;  2RA2 A;  2BZY A;  1M2V A;  2QAS A;  1H92 A;  3QUI A;  2F2X A;  1YIT T;  1OU8 A;  2A08 A;  3MEA A;  5GAO m;  2LCC A;  1UEC A;  4RTX A;  4HVV A;  4EPC A;  2JS0 A;  2LRQ A;  1PHT A;  3OYG A;  1AZG B;  4M77 F;  1AWJ A;  2DXU A;  4M75 E;  4X1V A;  4XTV A;  4F04 B;  1M9S A;  1YJW T;  3BDL A;  3EHQ A;  4BY6 B;  2LZ6 B;  8ATC B;  3VYG A;  1PKT A;  1RAF B;  2RQV A;  3C0C A;  1I81 A;  4C8Q B;  5IHK A;  2COW A;  4OMP A;  1X6G A;  2RHX A;  5LJ5 h;  2LNV A;  4PJO B;  2W0Z A;  2EQU A;  2VGN A;  2V26 A;  1X43 A;  1I0C A;  2D8H A;  2ESW A;  1QKW A;  4PJO G;  1N9S A;  1K8A R;  3V7C A;  2KY9 A;  5KYX A;  3Q1J A;  2CP5 A;  2O2O A;  2RJD A;  2VB6 A;  3BFM A;  4IUQ A;  1J3T A;  2X4J A;  4QW2 A;  5KCH A;  4M7D B;  4J9C A;  3M54 A;  4GY5 A;  2EIF A;  1WDX A;  1OYX A;  4E7H A;  3H0I A;  4EDU A;  3CCL A;  2JXB A;  2C0O A;  1S72 A;  2QEX A;  1I1J A;  2DO3 A;  5CK9 A;  1N27 A;  2LX9 A;  3WVD B;  2KGT A;  2K57 A;  5CIU A;  1N9R A;  2QEX Q;  1I5L A;  1H3Z A;  3RER A;  2EQI A;  5GMK e;  1X01 A;  1FWZ A;  2GGR A;  2L89 A;  3A8G B;  4AMC A;  2K3B A;  3N5B B;  4JUV A;  4CI0 C;  1QP3 A;  1ZA2 B;  2E6Z A;  2BE7 D;  4LXC A;  4BAC A;  1SSF A;  3OS2 A;  3O5Z A;  3QHS A;  2L8D A;  2NYS A;  2QYZ A;  1X27 A;  4OMN A;  5GMK i;  4M78 E;  5FRO A;  4DEX A;  3OW2 P;  1XOV A;  5GAN 6;  1PSF A;  5J26 A;  3P8H A;  2AT1 B;  4M77 D;  1MV0 B;  1VYU A;  3SWN C;  2F5K A;  3JB9 D;  1WI7 A;  4AT1 B;  3QXE B;  2HSE B;  2WSF E;  2J06 A;  3QWX X;  4J6X A;  1QVF P;  2RJC A;  4BUG A;  2MF2 A;  3JCM P;  1M1K R;  3CCU A;  2X4X A;  1VQL A;  2DL3 A;  2KSS A;  4GLM A;  2M16 A;  3J81 E;  2DD5 A;  5KE3 A;  1YI2 T;  5GAM g;  4RTT A;  3OYC A;  2HD0 A;  5GAO r;  2L3Q A;  1UGR B;  1VQ9 T;  5CR2 A;  1A0N B;  4ME7 A;  1ACM B;  4IIM A;  2A28 A;  1KQ2 A;  5FU7 C;  2YUP A;  2QA4 A;  1OZ3 A;  2KMT A;  4XAX B;  2A0F B;  4JJB A;  4IUU A;  4HA8 A;  2DKG A;  4X9C A;  4M7A A;  2DYB A;  2DIQ A;  2YRC A;  4PFO A;  2PUK B;  4X9D A;  1WHK A;  2QQ9 A;  1WZO A;  1KIK A;  2K6D A;  4N0A A;  3QO3 A;  4C5I A;  5FU6 B;  3OS5 A;  3JB9 I;  2COY A;  2L3R A;  5FU6 C;  2RHI A;  4VUB A;  3EG3 A;  3QZ9 B;  3GNG A;  1KC8 R;  2OTJ T;  5FRN A;  3R6O A;  3QPH A;  3LGF A;  2EBP A;  1K73 U;  4IUV A;  1OUL A;  2MK5 A;  2QA4 Q;  2WAC A;  2RQR A;  2MPX C;  2KYB A;  2OAU A;  4RTY A;  1EFN A;  4JRQ A;  3JCM X;  2JMC A;  1Q86 R;  3CC7 T;  3GIB A;  1GXI E;  3EFR A;  3I56 T;  2KE9 A;  4AFZ C;  4PJO F;  2CYZ B;  2R57 A;  1VQ4 T;  3M57 A;  2DPP B;  1Y71 A;  1R0B G;  2P84 A;  4ANJ A;  3LWH A;  2IIM A;  1KQS A;  3LH5 A;  5GAO q;  4FSS A;  1Y57 A;  4A4H A;  2XU8 A;  4ORZ A;  5GAO l;  2K9G A;  2OJ2 A;  2DBK A;  4OMO A;  2DL7 A;  3D7S B;  2OTJ A;  1GRI A;  3CBM A;  2BUD A;  4FL6 A;  2COZ A;  4M75 G;  2ENM A;  2V8I A;  4LE9 A;  1PNJ A;  1TTH B;  2BIV A;  5GJW B;  2EQJ A;  1ZBX A;  4M75 B;  3FRN A;  4PJL A;  5KH6 A;  1YP5 A;  4RG2 A;  2SRC A;  1OX9 A;  4KGX B;  5C0M A;  2J7I A;  2EQM A;  1NPR A;  2FRY A;  2OI3 A;  4KBM B;  1JXM A;  3M0R A;  2YDL A;  3HL8 A;  3BW1 A;  2VGM A;  3VS0 A;  4ZTJ A;  4CRI A;  4OMM A;  5DLO A;  1K0S A;  2OTL A;  3BDU A;  2XDB A;  1TU0 B;  1SG5 A;  1SHG A;  3SFM A;  1B34 A;  2NLU A;  2RK1 A;  2E5K A;  4ZGJ B;  2D1X A;  1M5Q 1;  3OYH A;  1W6X A;  4IIO A;  3VU3 C;  2DRK A;  1NLO C;  1R0C B;  4RMO A;  5CAI A;  5HK0 A;  1Q81 C;  1CKA A;  2J05 A;  4HCC A;  2EQK A;  2YT6 A;  4LD6 A;  3E1S A;  2FYK A;  4LNP A;  4KH1 B;  4N4G A;  4Y91 A;  3HPW A;  2LTO A;  2MWP A;  2DMO A;  4M78 B;  3EG1 A;  4QKU A;  1OV3 A;  3CXC S;  4M78 C;  1QWE A;  3ULR B;  4M78 G;  1VQN A;  3P8B B;  4RTU A;  1OZ2 A;  2PU9 B;  1T0J A;  4C0D B;  2RJE A;  1VQ6 Q;  4AFU C;  3G71 A;  3JCM d;  2XI9 A;  5GAM h;  1K8A U;  1Q7Y R;  1TSF A;  2HQX A;  3M53 A;  5KYY A;  1D3B B;  2O4X A;  2CGH A;  2CP2 A;  2YRD A;  3MP6 A;  4BE1 A;  4KT0 E;  2HEQ A;  1IZ6 A;  4JRK A;  3OSV A;  2MYS A;  3RKX A;  1QVG S;  3G6E A;  2CT3 A;  1FMK A;  2HL5 C;  3CPF A;  5FWB A;  3I55 T;  2VWF A;  4HKE A;  2LX7 A;  1LNX A;  4FU6 A;  1C6V X;  1W1F A;  3RIR A;  4M7D G;  3I56 Q;  2F2W A;  1GCQ A;  4UC4 A;  1VQO T;  4LDU A;  1M90 C;  1QMC A;  4HCK A;  2B86 A;  2I0N A;  2QG9 B;  1N8R U;  2EYX A;  1VQ7 Q;  2OX7 A;  1KJW A;  3RKY A;  5IN1 A;  1ZLM A;  1QKX A;  1YJN Q;  2NWM A;  1M30 A;  4M7A B;  2DFU A;  1QVF S;  4HXJ A;  1TOV A;  1W2B A;  3P8D A;  1WHG A;  2QEX T;  1OOT A;  3CPW A;  3G4S T;  3AT1 B;  2VKN A;  2C0I A;  3PGG A;  1D1B A;  1RAH B;  2L3P A;  4OVA A;  1MNE A;  4EMK B;  4J5Y A;  1VYV A;  4KH0 B;  5I11 A;  5LJ5 f;  1VUB A;  1YJ9 Q;  4A4K A;  2QQB A;  3GLX A;  3PFS A;  2LVM A;  1AOJ A;  5FW9 A;  3VRZ A;  5LJ5 e;  2FVU A;  5C6S A;  1S72 T;  1Q7Y C;  4J9B A;  3M0Q A;  4HCZ A;  2F5T X;  3CCV Q;  2NUT B;  1XJW B;  2MCN A;  1AT1 B;  3QDF A;  1WQW A;  1VQP A;  3CXC A;  5GAN 7;  2RHU A;  3VUB A;  2KDS A;  3HSB A;  3S3N A;  1ZSG A;  2J6F A;  5I22 A;  3CCR Q;  4OF1 A;  3EFS A;  3NTH A;  2MMP A;  1Y07 A;  1BI2 A;  1Y7X A;  3OYJ A;  3GOX A;  3JB9 G;  1VQ6 A;  4JRI A;  2KXD A;  3CPW P;  3C95 A;  2E70 A;  1VQM A;  1MMN A;  4FYY B;  3REA B;  5DY9 A;  3I5R A;  1GCP A;  1VQM T;  3X28 B;  1JJ2 A;  2XMF A;  8AT1 B;  2AZS A;  1ZUY A;  2LQK A;  4F7U B;  4F14 A;  1YBY A;  2BZ8 A;  3CCQ T;  1G3W A;  1IGU A;  2QGG A;  1FX7 A;  3HFO A;  4K11 A;  3FJ5 A;  4QQG A;  4M77 E;  1TS9 A;  2DTH A;  1LOJ A;  1K73 R;  5GMK m;  3OW2 S;  2YXY A;  3CCU T;  1VQL T;  4MZM A;  2RH2 A;  2HDA A;  1LJO A;  2LT1 A;  4J6Y A;  2H3J A;  1WJR A;  3OYB A;  1HXD A;  2QQR A;  3VS5 A;  3CMA Q;  3TSW A;  3CCS A;  4C0D C;  2DD4 A;  4JLI A;  1Q95 G;  1F1B B;  5GAM j;  3CMA A;  3MET A;  1UFF A;  4E7J A;  2YUN A;  5GAN 3;  1G3S A;  4RTV A;  2F2V A;  4C92 B;  4CC4 B;  2KXC A;  1G83 A;  1M3C A;  4MML A;  1RAB B;  2YRV A;  4PNO A;  4C0F A;  2ZZD A;  3UAT A;  5DM7 R;  2IPO B;  5CKH A;  1UB4 A;  1VQM Q;  3JCM J;  3L2Z A;  1KFZ A;  5A2Q E;  1Q81 U;  2G6F X;  3EH1 A;  3OYF A;  3I55 Q;  3RKW A;  2ECZ A;  3OBY A;  2JT4 A;  3FDR A;  1K1Z A;  4NL3 A;  1K0X A;  5LJ5 d;  3FB9 A;  4KGV B;  2H8H A;  4C8Q F;  1NEB A;  2VAS A;  1RAE B;  1NJI R;  1D1A A;  3S6W A;  1QQJ A;  1JRI A;  3ER0 A;  4CC3 A;  4C92 F;  4Y28 E;  1ABQ A;  2XG8 D;  2E41 A;  4HT8 A;  4B9W A;  1QCF A;  2EGC A;  3UA7 A;  1VQ7 A;  3OYL A;  5DLQ E;  2DIL A;  3ZBD A;  1I5O B;  3C4S A;  4KUL A;  2V1Q A;  1QP2 A;  5HY6 A;  1U1T A;  4R56 A;  2Z0W A;  3HFN A;  5A0D A;  2ED0 A;  1D1C A;  1M90 U;  1VQN T;  1T3S A;  1N8R C;  1YNZ A;  2JUF A;  5FRM A;  1KHC A;  1Q82 U;  1T3L A;  3HP9 A;  1AZE A;  3U23 A;  1MND A;  5IAY A;  2DAQ A;  2JTE A;  2E5Q A;  3CC7 Q;  5L8R E;  4BD3 A;  1UUE A;  2GFA A;  2KEA A;  5CKE A;  4LDW A;  1BI3 A;  4A4F A;  3L1A A;  2HKQ B;  1GL5 A;  3TSZ A;  1W70 A;  3CCJ Q;  3UA6 A;  1RAI B;  4BDZ A;  1KD1 R;  4PJN A;  4BI4 A;  3CPW S;  3PIO A;  1X6O A;  5IT9 E;  1TG0 A;  2A7Y A;  2ATC B;  1QVP A;  5GMK h;  3QKJ A;  4RCB A;  4DOW A;  1AVZ C;  1UEB A;  2PVD B;  4JJN K;  1BI0 A;  3CCE T;  3JCM b;  1Q7Y U;  2KRM A;  2MI6 A;  5LJ3 h;  5IH2 A;  5HKC A;  2JJ9 A;  5GAN f;  1SF9 A;  2CUB A;  4E7S A;  1WX6 A;  3CCU Q;  3TCJ A;  1VQL Q;  4OGC A;  3NTI A;  4CC7 A;  4QQD A;  3EAE A;  2E3H A;  5LJ3 f;  1UGQ B;  1I4K 1;  2DEQ A;  2X3W D;  3L2W A;  3DB3 A;  4GLK A;  3M59 A;  3X25 B;  3I55 A;  1WIE A;  2LQW A;  3L2Q A;  4M77 C;  6AT1 B;  4DBF A;  1JU5 C;  2PUO B;  1BYM A;  3CCL T;  1YJW A;  5GAN j;  4MMK A;  2JM8 A;  3CCE A;  4RKU E;  3MCA B;  4PJM A;  3L2U A;  2O9S A;  4AG1 C;  4M7A C;  4PJO C;  2BTT A;  1BKB A;  1K8A C;  1YIJ T;  4OMF B;  1B07 A;  1U3O A;  2DTI A;  3NTK A;  1X2Q A;  2ROL A;  3I5S A;  3CC2 T;  2M9U A;  4GBQ A;  1MMD A;  4C5G A;  3CCS Q;  2QI2 A;  3A5Z B;  3ZL7 C;  5GAN e;  2DVE A;  2JZ2 A;  3AHU A;  5D7U A;  3A8H B;  1RAC B;  2VXE A;  1JEG A;  1FXX A;  2CZ1 B;  3OYE A;  4RUG A;  5CO7 A;  3M9Q A;  2RHZ A;  2IG0 A;  5AYF A;  3TEE A;  2LT4 A;  1M1K C;  1BBZ A;  2QTX A;  4MDW A;  2RQT A;  1FMV A;  2KK4 A;  4FT2 A;  3EFO B;  1I07 A;  1QVG P;  3M0P A;  4BE0 A;  2ZPF B;  1K9M R;  1UGV A;  1WQ7 A;  3A1P A;  3DB4 A;  4F7U E;  4PL6 A;  2CUD A;  2KRO A;  3L2V A;  3OY9 A;  1VQ8 A;  4ATO A;  3RNJ A;  4HVU A;  4QVZ A;  1GBQ A;  3KBG A;  3CME T;  1RI9 A;  2OTJ Q;  2HZY A;  1WHJ A;  1X75 C;  1M1F A;  1Y96 A;  2SEM A;  3VS3 A;  2JVV A;  2YUQ A;  2DX1 A;  4A54 A;  1HYO A;  5M9O A;  4IUR A;  4JRP A;  1BK2 A;  3C12 A;  1YHQ A;  3CC2 Q;  1H64 1;  4E7K A;  3OS1 A;  2DNU A;  2WSE E;  3I35 A;  3DKM A;  4DEY A;  2EYW A;  2P0K A;  4II1 A;  1YCY A;  2F1L A;  5KYU A;  1KG1 A;  1D09 B;  4PFZ A;  1VQO Q;  2KT1 A;  4J9G A;  4P5N A;  2CSI A;  3EG2 A;  1FYN A;  3EG9 B;  2FO0 A;  1MUZ A;  4OB3 B;  2LC4 A;  3VS4 A;  1D0Y A;  2GQV A;  2QDL A;  3JV3 A;  1RAD B;  1GFC A;  3EGU A;  4L5G A;  4PLL A;  1WGS A;  2XK0 A;  3MHX A;  2FPD A;  4J7F A;  3CME Q;  2ZPB B;  2LJ1 A;  4D6W A;  3GBQ A;  3CCJ T;  1PSE A;  2CRE A;  3RBB B;  3CCM T;  3LGL A;  3NPF A;  1QWF A;  4KRT A;  2EKO A;  4AFQ C;  4E7L A;  3JB9 H;  1OQK A;  1OI1 A;  2FRW A;  4WCI A;  4C8Q G;  2DRM A;  4PJO E;  3OS0 A;  4TVR A;  3OBW A;  3JCM h;  3LWI A;  2KRS A;  2EPD A;  2LJ3 A;  3OYI A;  4HCB A;  1V76 A;  2DL4 A;  5IXB A;  5D6X A;  5ECA A;  2DA9 A;  2RB6 A;  1ABO A;  4M77 B;  1E7O A;  3EGX A;  3G4S Q;  1TUC A;  2HSP A;  1YWP A;  2DXC A;  3L42 A;  3CXC P;  3NGP A;  2DLP A;  2KI7 A;  4E2F B;  1VQ9 Q;  4V2S A;  3G71 Q;  3A8M B;  3LYI A;  1JB0 E;  3DLM A;  1UGP B;  2KR3 A;  4OB2 B;  2CZ6 B;  1R8O B;  3ZEH A;  4OB1 B;  5LJ3 e;  2GF7 A;  3J7A F;  1HSQ A;  2C06 A;  4X34 A;  1SRL A;  1KC8 U;  3PVQ A;  5KYN A;  4BE2 A;  1LPL A;  1UJ0 A;  1JJ2 S;  2PVG B;  2FG0 A;  1QW1 A;  4DBR A;  2EGE A;  2X35 A;  3CCL Q;  1ZQ1 A;  1WYX A;  2DZC A;  1D3B A;  1UTI A;  4XK8 E;  1YHQ Q;  5KYY B;  4F16 A;  1HJD A;  2CZ7 B;  2JNG A;  1WLP B;  3VS2 A;  3CBP A;  3TVT A;  1O9S A;  1VQK T;  3QJ6 A;  4D8K A;  3VS6 A;  2JOY A;  1VA7 A;  1SSH A;  5LJ5 g;  5IXF A;  3NHN A;  1M8V A;  1G2B A;  4M78 F;  1M8M A;  4OB0 B;  5KYW B;  2G3R A;  1G5V A;  3M56 A;  3CCR A;  2CP7 A;  1XTD A;  2RI5 A;  4J9E A;  3RR6 A;  3CQT A;  1OU9 A;  2QQS A;  3GP8 A;  4E47 A;  3FEO A;  5GAN 4;  1KD1 U;  1PD0 A;  3TRE A;  4RCC A;  5FU7 B;  3VRY A;  3UT1 A;  4DOV A;  3SB2 A;  4JZ4 A;  4F7U G;  1K4U S;  3V8K A;  3JCM W;  5IHI A;  1YJ9 A;  1M1G A;  2DJZ A;  3LW5 E;  4JDS A;  2CP6 A;  3RES A;  1YWO A;  4JPB W;  5FLX E;  3JCM c;  2XD0 A;  1E6G A;  1UJY A;  3M4G A;  2FZC B;  1NLP C;  1B3Q A;  3CEY A;  4C0Z A;  1YI2 Q;  2PVO B;  4E6R A;  2M0O A;  2YLC A;  5LJ3 d;  1EIF A;  3S3M A;  2YLB A;  4AG2 C;  1UGS B;  5GAN 5;  4J9I A;  3UPU A;  4KGZ B;  2FHD A;  5GAN d;  2L3S A;  2GFU A;  2E3I A;  1AD5 A;  4J9H A;  3VUZ A;  2EJF A;  3FLG A;  2QK0 A;  1PWT A;  2DK3 A;  3SWN A;  3I9Q A;  2A36 A;  2O31 A;  2K5L A;  4C0G A;  2DTO A;  4F7U F;  2QTV A;  3E2U A;  2CKK A;  5HK3 A;  5J3B A;  5CKF A;  5AT1 B;  2MAM A;  4M7A D;  1PKS A;  3MJX A;  4IUP A;  1NBE B;  2P0P A;  2Y4X A;  1JXO A;  4M77 A;  1V29 B;  4JLG A;  2XIC A;  4YTL A;  1SHF A;  2RI2 A;  5KCO A;  5I2S A;  4Z02 A;  2K2M A;  2DXT A;  3QDR B;  2X51 A;  4ZTF A;  3H8Z A;  3NFC A;  5GAM d;  3REB B;  3J80 E;  2QQA A;  2W10 A;  1BCO A;  1WPY A;  3RDV A;  2EYQ A;  4FSX A;  1N6A A;  3M0S A;  3TQ7 P;  1XQH A;  3FJP A;  1SRM A;  4L59 A;  1K9M U;  2DJQ A;  3S3O A;  2DZ9 A;  2DL5 A;  2K79 A;  2P4T A;  1VQ4 Q;  2KQW A;  3JB9 F;  2VUB A;  4QT7 A;  2CT4 A;  1AWO A;  1U5S A;  1ZA1 B;  1WA7 A; 
#chains in the Genus database with same CATH homology
 3LH0 A;  3PMT A;  5GAN g;  4FT4 A;  5I21 A;  2VYT A;  2E5Q A;  3GNG A;  2DIG A;  3OW2 A;  5GAO n;  2K3Y A;  2OTJ T;  5CQX A;  1YI2 A;  5L8R E;  3A8L B;  2V8J A;  4BD3 A;  3I56 A;  3CD6 A;  5FRN A;  2GFA A;  3BY7 A;  3LGF A;  3QPH A;  3R6O A;  5CKE A;  2IVW A;  3JCM f;  4IUV A;  4LDW A;  1K73 U;  3CCQ A;  3G7Z A;  3CME A;  3FC3 A;  2ZPI B;  1BI3 A;  4E7I A;  2WAC A;  4A4F A;  3E9F A;  3L1A A;  3UWN A;  5GAN h;  2OAU A;  3M55 A;  3HRT A;  4BDZ A;  3QJY A;  4EMK C;  4JRQ A;  5GAN 8;  3OYN A;  4BI4 A;  3JCM X;  3CPW S;  2K3X A;  1KQ1 A;  3PIO A;  2HAX A;  1X6O A;  3MP1 A;  3OA6 A;  1MHN A;  5IT9 E;  2A7Y A;  3CC7 T;  3EFR A;  3PNW C;  1QVP A;  3I56 T;  5CCA A;  3QKJ A;  4MZT A;  5GMK h;  3CD6 T;  4O6J A;  4RCB A;  4DOW A;  2X4Y A;  1UEB A;  2PVD B;  3C94 A;  4PJO F;  4JJN K;  1BI0 A;  1K73 C;  5CKB A;  3CCE T;  1U8R A;  3JCM b;  1Q7Y U;  1K9M C;  2CYZ B;  2R57 A;  1VQ4 T;  3M57 A;  2MI6 A;  3MO8 A;  5LJ3 h;  2DPP B;  5HKC A;  1Y71 A;  5GAN 2;  3CC4 T;  2Y4Y A;  4IUT A;  5GAN f;  3LWH A;  2I2L A;  3X24 B;  1KQS S;  3X26 B;  3TCJ A;  2Y90 A;  4PLI A;  4OGC A;  3HHT B;  3NTI A;  1IRE B;  2R58 A;  3H6Z A;  3EAE A;  4QQD A;  3CMA T;  1NPP A;  3GF5 A;  5LJ3 f;  3PTA A;  1VQO A;  1BIB A;  1UGQ B;  2QXF A;  1I4K 1;  2DEQ A;  1KQS A;  1O75 A;  3L2W A;  4M7D E;  1KC8 C;  1Y96 B;  3VYH B;  5GAO q;  3DB3 A;  4GLK A;  3M59 A;  3V7S A;  2ZPG B;  3X25 B;  4A4H A;  4XTY A;  4ZGD B;  3I55 A;  2XU8 A;  4OP0 A;  3L2Q A;  5LJ3 j;  4M77 C;  5GAO l;  3QBY A;  4HT9 A;  2PUO B;  1BYM A;  3OYM A;  2XKO C;  4OGE A;  3QII A;  3CCL T;  1P92 A;  1YJW A;  1RL2 A;  5GAN j;  5CQY A;  4C8Q E;  3ZFJ A;  4MMK A;  4JS5 A;  5LJ5 j;  2RK2 A;  2YHT A;  3CCE A;  1KD1 C;  2OTJ A;  4RKU E;  3MCA B;  2PQW A;  3CBM A;  2BUD A;  4J6W A;  3L2U A;  1B34 B;  4M7A C;  3QZ5 B;  4PJO C;  2X4W A;  2FB7 A;  4FL6 A;  1BKB A;  3HKS A;  1K8A C;  1YIJ T;  5EG2 A;  4Q5W A;  4M75 G;  2LQ8 A;  2DTI A;  2FL7 A;  4OMF B;  5D6W A;  1VQ5 A;  3NTK A;  3GNF B;  4XU0 A;  2V8I A;  3CC2 T;  2M9U A;  2BIV A;  2XHC A;  3MEW A;  2EQJ A;  4N0A C;  1ZBX A;  3GPL A;  4M75 B;  3FRN A;  2QDY B;  4BI8 B;  5KH6 A;  2E10 A;  4RG2 A;  1TH7 A;  4C5G A;  5C0M A;  4LDX A;  2EQM A;  4C92 A;  3G6E T;  2QI2 A;  2D6F A;  3A5Z B;  1NPR A;  2E65 A;  2GCX A;  2D9T A;  2DVE A;  5GAN e;  2JZ2 A;  4MDX A;  3AHU A;  3PT9 A;  3DLL A;  4KBM B;  3A8H B;  1NJI C;  2VXE A;  1FXX A;  3HL8 A;  2CZ1 B;  1DJ7 B;  4XU3 A;  3OYE A;  1VIE A;  5CO7 A;  4J8O A;  3M9Q A;  2RHZ A;  2IG0 A;  3BW1 A;  5AYF A;  3TEE A;  1WJQ A;  2VGM A;  2XDD A;  1Q86 C;  4ZTJ A;  2LT4 A;  1M1K C;  2ZPE B;  4CRI A;  2XDP A;  2QTX A;  4MDW A;  4DA4 A;  5DLO A;  5CVI A;  1VQ9 A;  2BKD N;  2OTL A;  3BDU A;  4A4G A;  4C8Q A;  2KK4 A;  1NE8 A;  2XDB A;  2VV5 A;  5J39 A;  4FT2 A;  4XTW A;  4M78 A;  4ZN1 A;  3OQ5 A;  3OYA A;  4EMK A;  1I8F A;  3SWN B;  4M7A F;  2HNI A;  4BE0 A;  1NJI U;  2ZPF B;  3JSC A;  3SFM A;  1B34 A;  3RMS A;  2NLU A;  1WQ7 A;  2RK1 A;  3DB4 A;  4F7U E;  4ZGJ B;  1M5Q 1;  2HQE A;  2L5Q A;  4PL6 A;  3OYH A;  1G3Y A;  3QSU A;  2JTM A;  2RI3 A;  4PJO D;  3VU3 C;  5GAO p;  3OY9 A;  3L2V A;  3ME9 A;  1M1K U;  1VQ5 T;  1VQ8 A;  4ATO A;  4QVZ A;  2EWN A;  3KBG A;  3CME T;  4NOY A;  3T9N A;  4A4E A;  5CAI A;  3ASK A;  5HK0 A;  4RMO A;  1Q81 C;  4KUI A;  1X75 C;  3QYG B;  4HCC A;  2WSC E;  1M1F A;  1Y96 A;  2EQK A;  5LL6 S;  3V8J A;  3QG1 A;  4LD6 A;  3E1S A;  3PMI A;  2FYK A;  1Q82 C;  4N4G A;  4WF2 A;  4Y91 A;  2JVV A;  3CC7 A;  3RMQ A;  3CCS T;  1VQ8 T;  2AHJ B;  3HPW A;  2LTO A;  2MWP A;  4J83 A;  4ELY C;  2DXB A;  4M78 B;  4C5H A;  3F70 A;  4C8Q C;  4A54 A;  2JN0 A;  3CXC S;  4M78 C;  3SDZ A;  4IUR A;  5M9O A;  3C12 A;  4JRP A;  1YHQ A;  1VQK A;  3OSS C;  1H64 1;  4M78 G;  4E7K A;  1Q86 U;  1VQN A;  3P8B B;  3OS1 A;  3JRZ A;  1OZ2 A;  2PU9 B;  3RUX A;  2WSE E;  4LDY A;  4C0D B;  2RJE A;  4J7I A;  3DKM A;  4QVC A;  2JTF A;  4IKF A;  3G71 A;  3JCM d;  1WNL A;  2XI9 A;  2P0K A;  5GAM h;  1K8A U;  3WXM B;  3VV0 A;  4KUD K;  4FM4 B;  4II1 A;  4QQ6 A;  1YCY A;  2CS7 A;  1YIJ A;  2HQX A;  3M53 A;  1KG1 A;  2KAF A;  3OMC A;  4PJO A;  4P5N A;  1YJN A;  1D3B B;  2A3L A;  2O4X A;  2CGH A;  1AHJ B;  2VC8 A;  3PIP A;  2ZPH B;  3MP6 A;  4XQ3 A;  4BE1 A;  4KT0 E;  1IZ6 A;  2O4X B;  2K4Y A;  4OB3 B;  3JCM g;  2LC4 A;  4JRK A;  2GQV A;  3OSV A;  3RKX A;  2RD1 A;  2EJG A;  2R5M A;  3G6E A;  1QVG S;  4L5G A;  1VQL A;  4M75 D;  4PLL A;  3OMG A;  1WGS A;  2E12 A;  2F69 A;  2XK0 A;  3CPF A;  4MZP A;  3V7R A;  3MHX A;  5KE2 A;  4J7F A;  3I55 T;  4M7D F;  2EJ9 A;  1YHQ T;  4M7D C;  2ZPB B;  4HKE A;  4D6W A;  1NZ9 A;  1LNX A;  4FU6 A;  5GMK l;  3RIR A;  3CCJ T;  2B8A A;  4M7D A;  2EFI A;  4M7D G;  1PSE A;  4UC4 A;  3M5A A;  1VQO T;  3CCM T;  1QVG A;  5GAM f;  1RI0 A;  3LGL A;  2E1H A;  4LDU A;  1YIT A;  1M90 C;  2EKO A;  4E7L A;  2OTL T;  3JB9 H;  1VIF A;  1N8R U;  2LCL A;  4M78 D;  1OI1 A;  3L2R A;  3CCV T;  3VKI A;  1VQ6 T;  4C8Q G;  4PJO E;  2QA4 T;  4FIB A;  1VQ4 A;  3RKY A;  5IN1 A;  3KXT A;  3OS0 A;  4N4I A;  4TVR A;  3OBW A;  2E6N A;  2MWO A;  4DQ2 A;  3JCM h;  3HRU A;  4M7A B;  4R55 A;  4LD9 K;  2M1H A;  1G3T A;  3LWI A;  1QVF S;  1WJS A;  4C92 E;  3JAM E;  3OYI A;  4HCB A;  1U1S A;  2P0Q A;  4F7U A;  4XU1 A;  2RM4 A;  4M77 G;  3LX7 A;  4NL2 A;  5D6X A;  5A0G A;  1W2B A;  3P8D A;  4XTX A;  2QEX T;  2EAY A;  4C92 G;  2RB6 A;  3CPW A;  3G4S T;  4M77 B;  3TU4 K;  3URG A;  3PGG A;  4C5E A;  2O01 E;  1W4S A;  4OVA A;  4EMK B;  4J5Y A;  4N4H A;  2RA2 A;  4M7D D;  5LJ5 f;  1VUB A;  3QUI A;  4A4K A;  2QQB A;  3OYD A;  3GLX A;  3PFS A;  2DXC A;  1XNI A;  2KVQ G;  2LVM A;  4M75 F;  1YIT T;  1YJN T;  3MEU A;  3L42 A;  3MEA A;  5LJ5 e;  2FVU A;  5GAO m;  2LCC A;  4ZGE B;  5C6S A;  1S72 T;  1Q7Y C;  4A53 A;  4HCZ A;  4V2S A;  2F5T X;  2K2V A;  2RHY A;  3A8M B;  3LYI A;  1JB0 E;  3DLM A;  1UGP B;  3MP8 A;  4ZN3 A;  1BIA A;  4OB2 B;  3HRS A;  2CZ6 B;  1R8O B;  4EPC A;  1WQW A;  2VXF A;  2LRQ A;  3MEV A;  3ZEH A;  3OYG A;  1VQP A;  3GIB A;  3CXC A;  1GXI E;  1HK9 A;  4OB1 B;  3LLR A;  5LJ3 e;  4M77 F;  2GF7 A;  2DXU A;  4M75 E;  2ZCF B;  4XTV A;  2RHU A;  3VUB A;  3E9G A;  2KDS A;  5GAN 7;  2C06 A;  4X34 A;  3S3N A;  3HSB A;  1KC8 U;  4OF1 A;  2ZGW A;  3EFS A;  3NTH A;  1M9S A;  1YJW T;  4BE2 A;  3BDL A;  4BY6 B;  2MMP A;  1Y07 A;  1BI2 A;  1Y7X A;  4XU2 A;  3OYJ A;  3GOX A;  3VYG A;  3JB9 G;  1VQ6 A;  4JRI A;  4EMG A;  2PVG B;  1JJ2 S;  1I81 A;  1QW1 A;  4C8Q B;  1MGQ A;  2RHX A;  2X35 A;  5LJ5 h;  3C95 A;  2E70 A;  3JCM e;  1ZQ1 A;  1VQM A;  2DZC A;  2LNV A;  1D3B A;  3JB9 J;  4XK8 E;  4PJO B;  2EQU A;  4M7A G;  2VGN A;  4PKC C;  2CZ7 B;  2JNG A;  5DY9 A;  5LJ3 g;  1VQM T;  3CBP A;  4PJO G;  3X28 B;  1JJ2 A;  1N9S A;  1O9S A;  3V7C A;  1VQK T;  4M7A E;  2KY9 A;  3QJ6 A;  5GMK j;  2JOY A;  3Q1J A;  2LQK A;  2RJD A;  4M75 C;  4BI3 A;  4F7U B;  5LJ5 g;  1YBY A;  3CCR T;  2R5A A;  3CCQ T;  4M75 A;  3BFM A;  1G3W A;  4IUQ A;  4C8Q D;  1M8V A;  1FX7 A;  3HFO A;  2X4J A;  3OB9 A;  4M78 F;  4QW2 A;  4OB0 B;  5KCH A;  4M7D B;  4ELZ C;  3FIF A;  4QQG A;  2G3R A;  1VQP T;  4L6V 5;  4M77 E;  1G5V A;  3M54 A;  3M56 A;  3CCR A;  4GY5 A;  2K5I A;  3V8L A;  5D6Y A;  2DTH A;  2EIF A;  4LDV A;  2RJF A;  1LOJ A;  1XTD A;  2RI5 A;  1OYX A;  5GMK m;  4E7H A;  3OW2 S;  4EDU A;  1KD1 U;  3CCL A;  3CCU T;  1VQL T;  2RH2 A;  2QQS A;  4MZM A;  1LJO A;  2LT1 A;  1QVF A;  4J6Y A;  2H3J A;  1WJR A;  2LDM A;  3CBO A;  3OYB A;  3GP8 A;  1HXD A;  2QQR A;  4E47 A;  1S72 A;  3FEO A;  2QEX A;  4NS5 A;  5GAN 4;  2DO3 A;  5CK9 A;  3CCS A;  1W2B S;  4C0D C;  2DD4 A;  1BI1 A;  1N27 A;  2LX9 A;  4JLI A;  4RCC A;  3TRE A;  5FU7 B;  3WVD B;  5CKD A;  3JCM Q;  5GAM j;  2HBP A;  2K57 A;  2RO0 A;  1N9R A;  5CIU A;  3CMA A;  3UT1 A;  1I5L A;  4DOV A;  1H3Z A;  3MET A;  3RER A;  3SB2 A;  4E7J A;  4F7U G;  3V8K A;  5GMK e;  1X01 A;  5GAN 3;  1G3S A;  1FWZ A;  2L89 A;  3A8O B;  3JCM W;  4C92 D;  3A8G B;  4C92 B;  1YJ9 A;  1M1G A;  2DJZ A;  3LW5 E;  4JDS A;  5A0L A;  3RES A;  3N5B B;  4JUV A;  4MML A;  3G4S A;  2YRV A;  4C0F A;  4PNO A;  5FLX E;  2ZZD A;  1QP3 A;  3QYH B;  4EMH A;  4CI0 C;  3JCM c;  5DM7 R;  3CCJ A;  3CCV A;  2XD0 A;  5CKH A;  2E6Z A;  1UB4 A;  3M4G A;  1VQ7 T;  3JCM J;  3L2Z A;  5A2Q E;  3X20 B;  3INZ A;  1Q81 U;  4BAC A;  1SSF A;  3WVE B;  3CEY A;  4C0Z A;  2PVO B;  5GAM e;  3OS2 A;  3OYF A;  3RKW A;  2M0O A;  2YLC A;  5LJ3 d;  1EIF A;  3OBY A;  3S3M A;  3QHS A;  2L8D A;  2YLB A;  3FDR A;  1UGS B;  5GAN 5;  4NL3 A;  3UPU A;  5GMK i;  4M78 E;  5FRO A;  5LJ5 d;  2FHD A;  5GAN d;  1KHI A;  3FB9 A;  1XOV A;  2GFU A;  4XTZ A;  5GAN 6;  1PSF A;  5J26 A;  3VUZ A;  2EJF A;  3P8H A;  4M77 D;  4C8Q F;  3CCM A;  3FLG A;  3SWN C;  2F5K A;  3JB9 D;  3JCM V;  2E64 A;  2DK3 A;  3SWN A;  3QXE B;  2D0Q B;  3S6W A;  2WSF E;  1JRI A;  3ER0 A;  4B9X A;  2K5L A;  3VJP A;  4J6X A;  2DTO A;  4C0G A;  4F7U F;  2RJC A;  4BUG A;  1JBM A;  2MF2 A;  3M58 A;  4C92 F;  3JCM P;  2CKK A;  4C92 C;  2X4X A;  4Y28 E;  5CKF A;  5J3B A;  2MAM A;  3SD4 A;  5HK3 A;  2KSS A;  3CCU A;  2XG8 D;  4M7A D;  2E41 A;  2M16 A;  3J81 E;  2DD5 A;  5KE3 A;  4HT8 A;  4B9W A;  4IUP A;  4QVD A;  1YI2 T;  4RG8 A;  1VQ7 A;  5GAM g;  3OYL A;  3OYC A;  1M4Z A;  4XTU A;  2P0P A;  2Y4X A;  4JS4 A;  2HD0 A;  4M77 A;  5GAO r;  1UGR B;  1V29 B;  5DLQ E;  4JLG A;  2XIC A;  3ZBD A;  5CR2 A;  1VQ9 T;  4ME7 A;  3J7A F;  3CC4 A;  4YTL A;  3C4S A;  4KUL A;  1KQ2 A;  2RI2 A;  5FU7 C;  5KCO A;  2QA4 A;  5I2S A;  4Z02 A;  1OZ3 A;  1QP2 A;  2DXT A;  2KMT A;  4XAX B;  1U1T A;  2V8K A;  3QDR B;  5HY6 A;  4BB7 A;  4IUU A;  4ZTF A;  3H8Z A;  3NFC A;  4HA8 A;  5GAM d;  4R56 A;  3O8V A;  3J80 E;  2DKG A;  2QQA A;  3HFN A;  4X9C A;  4M7A A;  5A0D A;  4BY6 C;  2DIQ A;  2K5F A;  3E19 A;  3G71 T;  1WPY A;  2EYQ A;  1M90 U;  4FSX A;  1VQN T;  3OYY A;  1N6A A;  2PUK B;  4X9D A;  1XQH A;  1ZHI A;  3UDC A;  1N8R C;  2QQ9 A;  3KUF A;  3FJP A;  3OYK A;  4L59 A;  1K9M U;  2JUF A;  4N0A A;  4BDY A;  3QO3 A;  5I2M A;  4C5I A;  2CZ0 B;  3S3O A;  5FRM A;  2DZ9 A;  2P4T A;  1KHC A;  5FU6 B;  1Q82 U;  3OS5 A;  3JB9 I;  3CC2 A;  2KQW A;  3JB9 F;  3HP9 A;  2VUB A;  4O5V A;  1YJ9 T;  2XID A;  2L3R A;  5FU6 C;  3M4Y A;  2RHI A;  4VUB A;  5IAY A;  3QZ9 B;  2DAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...