4QQGA

Crystal structure of an n-terminal htatip fragment
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and histone binding studies of the chromo barrel domain of TIP60.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT5
total genus 10
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qqgA00
5D6WA 1WJQA 2FHDA 2BIVA 4IUUA 4IUVA 4PL6A 5IAYA 3LX7A 4QW2A 3S3NA 2EFIA 4B9WA 4BACA 3OYAA 4NS5A 4EDUA 3GOXA 3META 4UC4A 4QQDA 5J39A 2QQRA 2LTOA 2DAQA 4E7KA 2DIGA 2EKOA 1OI1A 1WJSA 2X4YA 3S6WA 2RHUA 3QBYA 2L89A 1SSFA 3BDLA 2RHIA 5C6SA 3MEUA 3DB4A 4C5EA 2LDMA 5J26A 4C5IA 2RJCA 3QJ6A 5CIUA 2EQUA 2MWPA 4E7JA 3DB3A 1WGSA 4QQGA 2RI2A 4FL6A 2EQKA 3QIIA 3OYMA 3UWNA 1XNIA 3MP6A 1OYXA 3DLMA 4QVZA 3SD4A 2RJDA 4CRIA 3PMIA 5M9OA 2RHYA 2YRVA 4FU6A 1G5VA 3H8ZA 4OVAA 2K3XA 3OYJA 4BE1A 1KHCA 4II1A 4ZTJA 4BDYA 2X4XA 3MEVA 3OMGA 3NTHA 4BDZA 2RI3A 4IUPA 1RI0A 3FC3A 2CKKA 2R57A 2DIQA 2NLUA 2G3RA 2X35A 3P8DA 3C4SA 4Q5WA 2L8DA 2QQSA 2P0KA 3LLRA 5KH6A 3OY9A 4PLLA 2VYTA 4A4HA 2LCCA 5KE2A 3NTIA 4IURA 5D6XA 4A4EA 3OS0A 4BE0A 2RHZA 2EQMA 5D6YA 4Z02A 1N27A 2MWOA 4A4FA 2X4WA 3F70A 4C5HA 3OYFA 3O8VA 3LH0A 3L42A 3FDRA 2JZ2A 4N4IA 2M1HA 3OYHA 3OQ5A 3E9FA 4QQ6A 4E7LA 3UT1A 3OMCA 3Q1JA 2R5MA 3OYKA 3L2UA 2RHXA 4E7IA 3OYNA 2BUDA 3OYLA 1H3ZA 2RI5A 2K3YA 3OS1A 2EQJA 2GF7A 3M9QA 3MO8A 3CEYA 5FRNA 2RJFA 2R5AA 2GFAA 4C5GA 2HQXA 1MHNA 2M0OA 2PQWA 4L59A 3FEOA 3PNWC 4GY5A 2R58A 3ZEHA 4ZTFA 3L2WA 5KCOA 3OYBA 4HCZA 2M16A 2LVMA 3MEAA 2BKDN 2F5KA 2E5QA 3ME9A 3OYEA 2GFUA 3ASKA 3NTKA 4BE2A 2O4XB 5KE3A 3L2RA 3LGFA 3PFSA 3EAEA 3OYDA 5FRMA 3QKJA 3FLGA 2IG0A 3OS2A 3L2QA 3H6ZA 2D9TA 3S3MA 2RO0A 3LGLA 4X34A 5FROA 4B9XA 1WJRA 3PMTA 2XK0A 5IN1A 3L2VA 4IKFA 4N4HA 4IUQA 3KUFA 3LYIA 4LD6A 2RJEA 3S3OA 3OYGA 4N4GA 2HQEA 3P8HA 3OYIA 3E9GA 3MP8A 1OZ3A 2B8AA 4A4GA 4E7HA 2JTFA 2LRQA 2L3RA 5KCHA 3MEWA 4PLIA 3OA6A 3MP1A 2E6NA 4IUTA 2XDPA 4BD3A 3OB9A 3OYCA 2WACA 2O4XA 4RG2A 5C0MA 1OZ2A
chains in the Genus database with same CATH superfamily
1ZUYA 2CT3A 2JM8A 2E4HA 1QVGA 1UDLA 4LD9K 1PWTA 3EGUA 4FYWB 3EGXB 3CCMA 1OI1A 2W0ZA 2DEQA 2V8JA 3M0RA 3QDRB 3UF4A 1MV3A 1ZA2B 4DBHA 3DKMA 1K73U 5FWCA 2K7AA 2LJ3A 3M57A 4C0DC 2PTKA 4FL6A 2H8HA 4JRQA 1OV3A 1AEYA 2K6DA 3JSCA 3MP6A 2RK2A 3H9NA 3CCMQ 1NPRA 1GFDA 2KGTA 4O6JA 4CRIA 3UA6A 3A98A 4OVAA 3JCMe 2C06A 3NGPA 2BTTA 1RI0A 2HAXA 2YUPA 1KQSS 3RMQA 2A36A 1IGUA 4F17A 2QDYB 2KYBA 4J83A 4BY6C 2V1QA 3OYFA 4CC4B 3FDRA 2A0FB 1YJNQ 3OQ5A 2H3JA 1OOTA 1U1TA 4PFPA 2L3SA 4HT9A 2E70A 2O88A 4XQ3A 2GFAA 3CCRQ 2K3BA 4ELYC 4IIMA 4JJDA 3X28B 2DZ9A 1K4US 1MMAA 1QW1A 1AVZC 2PUKB 1FMVA 3M55A 3GNFB 1KQ1A 2EGCA 2W10A 2D0NA 3PMTA 1E6HA 1KSWA 4ANJA 4IKFA 4HCBA 2K5LA 5IHIA 1AZEA 1NE8A 4A4GA 9ATCB 2DTOA 4NL3A 2JTFA 1NLPC 4JRPA 4Y92A 1VQLQ 2WACA 3CC7A 3ULRB 2FRYA 2VXFA 5IAYA 1PG5B 3HRSA 2AZSA 2I2LA 4UC4A 1V1CA 2C0OA 5C6SA 5DLOA 4KBMB 3CPWA 1TTHB 4DBQA 1RUWA 2DD5A 2DVEA 3H0IA 3OYMA 2XD0A 1C6VX 1RABB 4F7UG 3SD4A 3DLLA 1UGVA 1TSFA 2AKKA 2Y90A 1G5VA 1GRIA 3CBPA 3KXTA 4BDZA 1HK9A 4M78A 3E1SA 4XU0A 3CXCA 5GAN6 1D0YA 2X35A 2V8IA 4OB3B 3ZL7C 3LLRA 4LDVA 2DE0X 1WHJA 3CMAQ 2DL3A 4E7SA 3VS5A 2OTJT 1VQOT 4N4IA 2VUBA 2VC8A 1Y0MA 2R5MA 1UHCA 3OYKA 4XTUA 3M0PA 2M0YA 1I1JA 2LNVA 2JTEA 4C5GA 2YT6A 1S1NA 3JCMX 1QLYA 3FEOA 2ZPHB 4M7DC 5KCOA 3SDZA 4ESRA 2DTIA 1K0SA 1X75C 1YHQA 5KE3A 2DJZA 3URGA 5FRMA 2QA4A 3LW5E 2YUNA 1NJIC 4F7UF 1VQ5Q 1QQJA 3FB9A 1QWFA 3EHRA 1S72Q 4DBFA 2L0AA 4X1VA 5L23A 2NUPB 2LRQA 1AWOA 4PJOB 1Z9QA 2AK5A 3JCMW 4M7AC 1VQLA 3GOXA 3VUBA 3EH1A 1MMGA 5J39A 2MAMA 1M4ZA 3A8LB 1AHJB 2DYBA 1YWOA 5J3BA 2KRNA 2RQRA 2XDDA 1V29B 1K0XA 2VKNA 3FJPA 4M7DD 1T0JA 1PNJA 2CP2A 4LDYA 2RQVA 4C92B 2E10A 2EJ9A 4MMLA 2DD4A 3CCRA 4BE1A 2KXCA 5CQYA 2DMOA 3MEVA 5CAIA 2EBPA 2HD0A 1VQ4Q 5LJ5e 2A7YA 2PNIA 3CC4Q 1IGQA 4J6YA 2HSPA 3JCMc 2HKNA 2LQ8A 5D6YA 4Y91A 1YJ9A 3WXMB 5A0GA 3O8VA 4M7AA 1Q86C 1BI2A 4FT4A 1VQ8Q 5FU7C 2E6ZA 1X27A 4PJOG 2LQWA 1AWWA 1WXTA 1BI0A 5GAMe 2E12A 2F2VA 2KR3A 1UGRB 3HP9A 4PJNA 1SRMA 1MHNA 1OPLA 2KBTA 2FRWA 1K73C 3JRZA 2E3HA 3JB9I 2OAWA 4HCZA 2G6FX 1QVGP 2K5IA 2DL5A 5KYUA 5GAOq 4OB0B 2CZ6B 3FLGA 1JEGA 3MHXA 3QSUA 1UHFA 2SRCA 5IT9E 3RDVA 4AFZC 1E6GA 2HMAA 3RKXA 4OMNA 1YIJA 1B7TA 4TVRA 3JCMQ 1OPKA 4JRKA 1Q81R 2XDPA 4M75D 3OMCA 3CBOA 1HYOA 3PT9A 5KYYB 1M90R 2CZ1B 1D09B 1SF9A 2A08A 2FPFA 2XIDA 3HL8A 2CH4A 4C92F 4C92G 1TS9A 3BDLA 1T3LA 1UE9A 3QWXX 3DB4A 3CCQA 3KBGA 1X6GA 2YUQA 1VQ6Q 1YNZA 3QZ9B 3I56T 2DVJA 1WXUA 3X20B 1OYXA 2LP5A 4OGEA 2A28A 3I35A 4M77G 3QUIA 2RA2A 3HKSA 4JZ3A 5CKHA 4ZGDB 5IH2A 3OMGA 4J9GA 2EYZA 2DIQA 4CC2A 4E2FB 2OJ2A 2G3RA 3H0FA 3J7AF 1ZBXA 4Q5WA 5KH6A 1W2BS 1K76A 4PKCC 3V8KA 2RK1A 4FIBA 3A1PA 4A4FA 4C5HA 3G71T 1TH7A 4O5VA 3TCJA 4MDXA 4JJNK 1KQSP 1PM3A 1FXXA 1ACMB 3MO8A 1TOVA 4PJOA 2QK0A 1HJDA 4OB2B 1I8FA 2FZKB 2LMJA 4M7AG 4ZN1A 4R0KA 1X6OA 3HFOA 2GBQA 3UDCA 3AT1B 3NTKA 2KAFA 2FPEA 4F04B 4M7DF 1ZLMA 2FO0A 3NHNA 4IIOA 1D3BB 1FWZA 2D9TA 3H6ZA 5FWBA 4M77F 5GANe 1UECA 2YSQA 2LZ6B 2HBPA 5GMKj 5KYYA 2DK3A 1HD3A 3CCSA 3RNJA 4M78G 2RB6A 5ECAA 1YIJT 4KGXB 2E6NA 4IUTA 3OYCA 2O4XA 4HVVA 3SWNA 4M4ZA 4C92A 3G6EA 1PD0A 3JB9F 5LL6S 2VXEA 5GAMh 4M7AD 1VYTA 3M0QA 5CKEA 2DBMA 3VJPA 2QQRA 2K9GA 4RTUA 1VQMA 2HL5C 2FZCB 2RHUA 2BZYA 2KK4A 1IRXA 1B34B 1VQ9Q 2J05A 2K5FA 6AT1B 5DM7R 1Y71A 3GLXA 4LNPA 5CIUA 4RMOA 4N0AA 3CXCP 3J80E 4EMKB 4QQGA 1S72A 4EMGA 4AMCA 1VQPA 1I0CA 4ZGEB 1TUDA 2E41A 2K3XA 4C8QA 2XKOC 2X4XA 2K2VA 2R57A 3VRYA 2KT8A 1VQKQ 2IVWA 5GANf 2DRMA 2DLPA 4AG2C 4WF2A 4Y28E 5LJ3h 5EG2A 2VYTA 1RLPC 1IHVA 1VQ9T 3SWNC 4FCYA 3TSZA 1OEBA 3OSVA 2K4YA 2L2PA 2AKLA 2RN8A 3Q1JA 3OW2S 2K3YA 3CXCS 2GF7A 1YHQT 5FRNA 1YWPA 2P0QA 2KDSA 4M75B 2R58A 1IHWA 4P5NA 2E5QA 2JVVA 4XU1A 4KT0E 3RESA 1M1KU 3G4SA 4HCKA 2CT4A 3QWYA 3BDUA 4MMKA 4ELZC 1CKBA 4QT7A 3CMET 1W6XA 3OSSC 1JJ2S 2RPNA 2LNHB 3LH5A 3N5BB 4FW1A 4AFUC 2OAUA 1ZA1B 2PVDB 2OX7A 3CCLQ 2LQNA 2KYMA 4N0AC 4LDUA 4C8QG 1YHQQ 3CCEA 5FLXE 3EFOA 1VQ7Q 2QDLA 4FSSA 4OF1A 2JM9A 1QWEA 1JRIA 1K9MU 5GAOn 4C8QC 1WJSA 1WZOA 1VQ4T 1MV0B 1ZUKA 2JN0A 3MEUA 3M0SA 1UJYA 4C5EA 1MMDA 3G71Q 4KGVB 1VQKA 1Q7YR 4M7DB 4RTTA 3M58A 1WGSA 3QIIA 4PJOC 1JU5C 1O9SA 1SKUB 1WIEA 1U06A 5GANg 1QVFP 5CK9A 3BFMA 4FU6A 1KHIA 1RADB 4J7FA 2M02A 3NTHA 1SEMA 2QYZA 3BY7A 3CCRT 2QQBA 3TREA 1KIKA 4M77D 3C0CA 1JQQA 3H41A 1K9MR 4KRTA 3OY9A 3A8OB 3CCQQ 5GMKe 2K2MA 4VUBA 4OB1B 2PVGB 1LOJA 1V76A 3CCJQ 1EIFA 3L2UA 4E7IA 3GF5A 2BUDA 3JCMV 1H3ZA 2EQJA 3H0HA 1I81A 4KGZB 2RJFA 3MJXA 4J9FA 3THKA 2M0OA 3V8JA 1O75A 5CQXA 1D1BA 2J7IA 3MEAA 5KYXB 2F5KA 5IXFA 2MF2A 3EGXA 3QYHB 1H8KA 3EG2A 2YRDA 5GAOl 4XU2A 4XTYA 4GBQA 1VQ8T 1YJNT 2GCXA 5LJ3g 4LDWA 4K11A 3S3OA 2D8JA 2CUDA 1PCXA 3EGDB 3MP8A 2ROTA 1BKBA 1W1FA 4M77E 5IHKA 2LT4A 5GAMd 2F2WA 1NEBA 4RG2A 3CPWS 5D6WA 1LVKA 3A8MB 3I55A 2YHTA 3SFMA 1X2KA 1RAEB 4RUGA 3META 1SPKA 4C0ZA 2K79A 1WPYA 2ATCB 3S6WA 4J5YA 1KG1A 1M1KC 1ZHIA 2KI7A 2DL8A 3CCUQ 4E7JA 1D1CA 3CMAT 3C94A 1WXBA 2PU9B 3CCSQ 2RJDA 2Y4YA 3PMIA 1QVGS 1M1KR 2D8HA 2BZXA 2F2XA 3OYJA 2KEAA 3HRUA 4BDYA 1N6AA 1R0BG 2CKKA 2WSEE 5LJ3d 2NLUA 3EG9B 1PD1A 3A8HB 2ZPGB 1VQ6A 3TU4K 1VYUA 2L8DA 1M3BA 4DBRA 4DOWA 1H641 2RHZA 2EQMA 3REAB 2MWOA 1I4K1 2JJ9A 3I56Q 3CC2A 1UFFA 1VQMT 4OMQA 3GPLA 3E9FA 1D0ZA 1IREB 5D7UA 1UUEA 2HBWA 2E3IA 2R5AA 1QCFA 3REBB 3CC7T 3PVQA 3I5RA 3QHSA 1XJWB 2IG0A 2K57A 5GAN2 1PRLC 1LJOA 2EJGA 4X34A 2EIFA 1BU1A 1G3YA 2V1RA 3PIOA 2CH4W 4LD6A 2RJEA 1I5LA 2L3QA 5GJWB 3OYIA 1M8VA 1TUCA 3BW1A 3EFRA 5KCHA 1N8RU 2LX9A 5GANj 3L2WA 3O5ZA 2SEMA 4M77B 4BACA 4NS5A 4FW2A 2JXBA 1YFNA 1QP2A 1N9SA 4MZTA 2J06A 3JB9J 2NYSA 3DB3A 3CCVT 1M27C 1VUBA 3HRTA 4QVZA 3L2ZA 3CCLA 2YRVA 2QI2A 3E19A 5AYFA 2DXBA 3QDFA 2EGEA 3QG1A 3ZBDA 4XTWA 1SHGA 3FC3A 5KYWB 4M77C 2MOXA 4BI3A 3D7SB 1QMCA 2YWWA 4MZMA 2JMAA 4PJLA 1E7OA 2RNAA 3QJYA 1W2BP 2I0NA 4QVCA 3KFVA 1WHGA 3SB2A 4E7LA 3UT1A 1VYVA 3CC2Q 3OYLA 2IIMA 4XTVA 3CEYA 5L8RE 4C8QE 3CCLT 2L3PA 3MPUB 4MDWA 1BIBA 1Y96A 4JPBW 4L59A 2WSFE 2CDTA 2LVMA 1I07A 4BE2A 3L2RA 1G83A 8AT1B 4HA8A 4M7DE 2EAYA 2GQIA 1YJNA 1WQ7A 1WJRA 1MMNA 4BI4A 5GANd 3KUFA 4RTYA 3VU3C 1W4SA 1YITQ 2EYYA 4F7UE 2JT4A 2VB6A 3EG3A 2F1LA 4J9EA 4C92E 3CC2T 1TG0A 2LT1A 4OMOA 4DOVA 1D0XA 4PL6A 4RTVA 3MKDA 3S3NA 2YUOA 3VS6A 3OYAA 4EDUA 2OTLT 4QQDA 1QVFA 2LTOA 4E7KA 3QBYA 1RAHB 4M7AB 1YI2Q 3PGGA 4JRIA 5J26A 3FRNA 2EJFA 3WVEB 4DA4A 2KXDA 1WI7A 4HT8A 2V8KA 4PJMA 3RKYA 2PZ1A 4KUDK 1M90U 2KROA 2NUTB 4LDXA 4EMKA 2XG8D 1X43A 3CPFA 1GBQA 1WHHA 2RI3A 1M2VB 1B07A 1UB4A 4E7ZA 3SHWA 2AZVA 1KC8C 2LCCA 1TWBA 3RR6A 1GCQC 2RD1A 3F70A 3EHQA 1UG1A 4LXCA 4XAXB 2M1HA 4R55A 1QP3A 3G1JA 1QKXA 5CR2A 1M5Q1 2HNIA 1LPLA 1VQLT 2FL7A 3M59A 1YCSB 4OGCA 1UJ0A 4J9BA 4LN2A 1JJ2A 2KMTA 3CMAA 2P4TA 1R77A 3ASKA 2XDBA 4KUIA 1D3BA 1Q7YC 1NLOC 3RBBB 2RO0A 4ZGJB 2DNUA 4N4HA 3HHTB 3TVTA 1MNEA 2QA4T 4LUDA 4EMHA 3EGDA 1C1AA 4F7UA 4M7DG 2ZPBB 3VS4A 4M75C 1N8RC 1ARKA 3JV3A 4X9CA 5HCKA 1YN8A 5GAN4 2DM1A 2EKHA 2KRMA 4F7UB 2MK5A 2DETA 5KYUB 4Z88A 2DAQA 2EKOA 4M78E 3T9NA 3CCEQ 2M51A 1FMKA 5FU7B 3X24B 5HK3A 3JB9G 3QJ6A 2DKGA 2QTVA 2FEIA 3UWNA 5A2QE 3PVLA 1MNDA 3RIRA 2CSIA 1VQNQ 3UA7A 1YCYA 3HTRA 1VQ4A 4CC7A 1QKWA 4C92C 4J7IA 2EYWA 3CCUT 2FVUA 2QQSA 3AHUA 3I9QA 4EMKC 2PUOB 5D6XA 1ZSZA 1JO8A 5AT1B 1N27A 1R8OB 1RAIB 4XTZA 1FMWA 3X25B 1QCOA 2HZYA 3CD6A 2MYSA 1X2QA 1K1ZA 1SG5A 4Z8AA 3RERA 1GCQA 3M9QA 4XTXA 1PRMC 1VQNT 3VYHB 5GAMf 1YJ9Q 3OYBA 2CS7A 2JMCA 3ME9A 5HY6A 1VQ7T 1LCKA 1NM7A 2ECZA 1PSEA 4OMFB 3OYDA 1VQ8A 3G4SQ 1M9SA 1AD5A 2AIRB 4E47A 3VS1A 2KE9A 1Q95G 3OS5A 1OX8A 2QASA 1BIAA 1M30A 3OBYA 2X51A 3P8BB 3CCVQ 2A3LA 2YLCA 3OB9A 2EQKA 2X3WD 4RTXA 5C0MA 1ZQ1A 4IUVA 4GLKA 2B86A 4QW2A 1JJ2P 2RQTA 3VS3A 4FM4B 2RH2A 1NZ9A 3C12A 1G8XA 2X4YA 4J9HA 2QGGA 2E64A 2GNCA 2LDMA 2LC4A 2DX1A 3VS0A 3G4ST 4C5IA 1HXDA 3OYYA 5FW9A 5I2SA 1PHTA 4OMPA 8ATCB 2GTJA 2CREA 2F5TX 2Z0WA 2ZCFB 3PE0A 4Z89A 1M2OA 3M54A 4M75A 4IUPA 4C0FA 4KULA 2XICA 1JXMA 1XTDA 3P8DA 1GL5A 5LJ5h 4RCBA 1VQ9A 1ZSZB 1Q7YU 1WA7A 3EH2A 5GMKh 4FYVB 3JCMg 5CKBA 1BK2A 2QA4Q 2FZGB 1IXDA 2XI9A 3G6EQ 2RHXA 1LNXA 3OW2A 2JW4A 2HDAA 3V7RA 1WHLA 2LX7A 3PNWC 2QEXT 2VGNA 1YP5A 2EPDA 3EFOB 2X4JA 3GBQA 4CI0C 5GMKi 2DILA 1ABQA 3S3MA 1YBYA 2HL3A 3M4GA 4JLGA 5I11A 3FIFA 3LYIA 1U1SA 5HKCA 1UEBA 4CC3A 2J6OA 1AWJA 3M56A 1AT1B 2P84A 4M77A 3G6ET 2JS0A 2DO3A 3MP1A 2KVQG 2DL4A 4A4KA 4NOYA 2FHDA 1HSQA 4HVWA 4IUUA 3GNGA 2FB7A 4PFZA 2KY9A 4ME7A 1DJ7B 2CP3A 2YLBA 5CKDA 5GAN3 1VQOA 3UATA 3I55Q 2EYXA 2ZPEB 2L89A 2RHIA 2CZ7B 3SEMA 1YITT 3ER0A 1G3SA 2E5KA 2OTJQ 1NJIU 2RJCA 1H3HA 3CMEQ 1NEGA 2DF6A 4C0GA 3I56A 4J9IA 4OMLA 4ZN3A 5CKFA 4M75F 1TUGB 1SSHA 2OTLQ 1KHCA 3JCMP 1J3TA 1ZUUA 3IQLA 5A0DA 4RTZA 1GCPA 4NL2A 3C4SA 4ZNXA 2P0KA 3G71A 4AG1C 3I55T 2O9VA 4C0DB 4JS4A 2J6KA 5FU6B 1QVPA 1VQ6T 2KRSA 5A0LA 4LE9A 2O9SA 2VVKA 5KYNA 1JB0E 1VIEA 3OS1A 2KT1A 4GLMA 2HQXA 2D6FA 2X9HA 4A54A 1IO6A 4GY5A 4M78B 1YITA 3TQ7P 1AOJA 2M16A 3VV0A 1GBRA 4PJOE 4PNOA 4M78F 1F1BB 2ZPIB 3NFCA 2O4XB 2NUTA 2COZA 4WCIA 1WHMA 5HK0A 5EC7A 1OQKA 4F16A 3L2QA 4C8QB 4PJJA 3CCQT 1X01A 2CP0A 4PK4A 5GAN8 4FYXB 1CSKA 2AHJB 3C95A 5GAOp 1W2BA 2B8AA 4BUGA 3TSWA 3CCJT 1PSFA 3MEWA 3QO3A 2DZCA 2H3EB 3OA6A 1UTIA 1ZX6A 1VQ7A 3JCMJ 2VGMA 1M1GA 5LJ3e 2GQVA 1Q82R 4L5GA 1ZBJA 1TU0B 1VIFA 3MCAB 3CC4T 2HEQA 1C0MA 4DEXA 4E6RA 5CO7A 2DIGA 3BE3A 2RQWA 1VQ5A 2ROLA 2JOYA 3GIBA 2YXYA 1N8RR 2EQUA 1K73R 1M1FA 2RMOA 2NUZA 4RCCA 2O31A 1M3CA 2RI2A 2LCSA 2QTXA 2NWMA 3VRZA 5I22A 3QXEB 3FJ5A 1SHFA 1XQHA 3G7ZA 1YIJQ 4ZTJA 1I5OB 2ZGWA 1WQWA 2QEXQ 4JDSA 2EWNA 4JZ4A 4X9DA 3VYGA 3JCMd 4KH0B 1YJ9T 3EFSA 4PLLA 1KD1R 3OS0A 2HSEB 4Z02A 7AT1B 4A63B 2X4WA 5IXBA 2ED0A 3QZ5B 3V8LA 4R56A 1T3SA 1WDXA 1AZGB 1P92A 2JZ2A 4J8OA 1Q81U 2CYZB 2P0PA 3EG0A 4QQ6A 4J9DA 2VASA 5CCAA 5LJ5g 3NPFA 1K8AC 3OYNA 2CP7A 2MI6A 3LWIA 2JTMA 4EIKA 1RAAB 1BYMA 4PJOD 2BKDN 3EG9A 3WVDB 4YTLA 1SRLA 1VQKT 1WYXA 3QKJA 3CCJA 3CPWP 2BE9B 2Y4XA 1M8MA 4XU3A 1K9MC 1K8AU 4M7AE 1WLPB 2RM4A 2XK0A 5GAN5 2ZZDA 1KQ2A 3RMSA 2CSQA 4RTWA 2KNBB 1VQMQ 1OZ3A 2PVOB 3HPWA 5I2MA 2ENMA 4XK8E 2L3RA 4BD3A 1BBZA 4BI8B 3R6OA 1Q82C 2GGRA 5LJ3f 1BCMA 1YJWQ 3JAME 1B34A 1SSFA 2X3XD 1Q86R 2LJ1A 4BY6B 1JXOA 5LJ5f 3TEEA 1X6BA 1RACB 1XOVA 1YJWA 1ZSZC 1BI1A 2QQ9A 1XNIA 1OU9A 2MPXC 1M3AA 3GP8A 5GMKl 1NJIR 3DLMA 5M9OA 2BZ8A 1VQPQ 3CD6T 4II1A 1U5SA 2L5QA 3CBMA 4D6WA 3VKIA 2YRCA 2XHCA 3OW2P 1T0HA 4FSXA 3CCUA 1BCOA 1OU8A 4KH1B 4BE0A 4M7AF 1RI9A 1YJWT 1FYNA 2JNGA 3CCMT 1Q82U 3OYHA 1R0CB 3I5SA 3L1AA 1RAGB 4C8QD 4WTOB 4JJCA 1N5ZA 2JS2A 3M0TA 5GJVB 4QKUA 1VQPT 3CD6Q 2OTLA 2ED1A 1A0NB 4F14A 1CKAA 1KK7A 2DFUA 4C8QF 3PFSA 4HVUA 2F69A 2CP6A 3M5AA 1RAFB 1KC8R 2QAZA 1UGSB 1VA7A 1Y07A 4IUQA 1GXIE 2MCNA 3P8HA 5DLQE 2E1HA 2DXCA 1W70A 1NPPA 1U3OA 4ORZA 2A37A 2D0QB 1RL2A 2DJQA 1EZZB 2P4RA 3HFNA 4PLIA 2RF0A 1OZ2A 1PC0A 2ESWA 1MUZA 4PJOF 2QEXA 3LX7A 3X26B 2EFIA 4A53A 4B9WA 4D8DA 1VQNA 1X69A 1QVFS 1MGQA 1RLQC 3CQTA 4JUVA 1GFCA 3V7SA 2COYA 5IHNA 1NBEB 4HXJA 2C0IA 3QPHA 4OMMA 5FU6C 4M7DA 2RQUA 5GAOm 1Q81C 2MWPA 4RG8A 5GAN7 2ZAEA 1EX4A 1U8RA 4L6V5 3EG1A 1G3TA 1UGQB 2RHYA 1KD1C 4JLIA 2FYKA 5CVIA 2VWFA 1K8AR 3CC7Q 3JCMh 5DY9A 3CCET 2M9UA 3INZA 4D8KA 1IZ6A 3PIPA 1WNLA 3JB9D 3R6NA 5KE2A 1OX9A 4IURA 3M0UA 4JS5A 2CGHA 3M4YA 1YI2T 2QQAA 1Z9ZA 2CUBA 3L42A 1K9AA 4J6XA 1KD1U 2C0TA 1VQ5T 3CC4A 4JJBA 3M53A 1NG2A 2COWA 2J6FA 2EGAA 1Y57A 2WSCE 3RUXA 1M90C 3JB9H 3HSBA 1WX6A 1M2VA 1TXQA 2EQIA 1Y96B 5KYXA 2MIOA 2DPPB 2EVRA 3ZFJA 4DEYA 2LCLA 3OYEA 1KFZA 3VS7A 2NUPA 3LGFA 1PKSA 1FX7A 3UPUA 2FPDA 4LUEA 3LGLA 4B9XA 2DEUA 4HKEA 3L2VA 2DRKA 2D1XA 2VV5A 2O2OA 4N4GA 5KYWA 1PKTA 2E65A 1ZSGA 1JBMA 3LWHA 4AFSC 4FYYB 1B3QA 4J6WA 4HCCA 1QCNA 1Y7XA 2AT1B 2DXUA 2O01E 4PFOA 1WFWA 2EW3A 2QGFB 4M78D 3OYGA 2HKQB 1G2BA 1WJQA 3A5ZB 2BIVA 4M75E 3CMEA 3VUZA 3A8GB 4B6MA 2KQWA 2DA9A 4QVDA 2XU8A 3U23A 2V26A 1H92A 1S72T 2MMPA 2DERA 1AWXA 4BB7A 1G3WA 5GMKm 1EFNA 2IPOB 2EYQA 5GAMj 5LJ5d 2CP5A 3JCMf 2DXTA 1VOMA 2FG0A 2LJ0A 3NMZC 3H8ZA 1BB9A 3J81E 2KSSA 4EPCA 4C92D 5I21A 2BE7D 2LQKA 1D1AA 5GANh 4AT1B 5GAMg 4A4HA 3NTIA 2GTOA 4A4EA 3VS2A 4MZPA 4M78C 1BI3A 3LH0A 1NYGA 1ABOA 5LJ5j 1NYFA 2DL7A 3QYGB 4FT2A 2DTHA 4OP0A 2RI5A 3PTAA 3CCVA 5LJ3j 2QG9B 4AFQC 4DQ2A 2PQWA 3ZEHA 4ATOA 4ZTFA 2GFUA 3E2UA 1KJWA 2HCKA 1UGPB 2HQHA 3EAEA 4V2SA 3OS2A 1WHKA 1N9RA 5FROA 5IN1A 2JUFA 2CZ0B 4J9CA 4M75G 2DBKA 1IB8A 3V7CA 2HQEA 1VQOQ 2ZPFB 2YDLA 3RKWA 2OI3A 3E9GA 3OBWA 5GAOr 3SWNB 2ABLA 4E7HA 3CCST 2DYIA 2QXFA 2XMFA 4RKUE 1KC8U 1Q86U 1KQSA 2OTJA 3JCMb 1YI2A 1OULA
chains in the Genus database with same CATH topology
2VGMA 3SWNA 4DOVA 4C92A 3G6EA 1M1GA 4PL6A 3JB9F 5LL6S 5LJ3e 2GQVA 2VXEA 5GAMh 4L5GA 3S3NA 1QVGA 4M7AD 3OYAA 4LD9K 4EDUA 2OTLT 4QQDA 1VIFA 3MCAB 5CKEA 3VJPA 3CC4T 2QQRA 2LTOA 4E7KA 1QVFA 5CO7A 2DIGA 1VQMA 3CCMA 1OI1A 2DEQA 2RHUA 3QBYA 4M7AB 2V8JA 1VQ5A 2KK4A 1B34B 3PGGA 3QDRB 4JRIA 5J26A 2K5FA 2JOYA 3GIBA 3FRNA 2EJFA 3DKMA 3WVEB 1Y71A 3GLXA 5DM7R 4DA4A 1K73U 5CIUA 4RMOA 4N0AA 3M57A 4HT8A 4C0DC 2EQUA 3J80E 1M1FA 4EMKB 2V8KA 4QQGA 1S72A 4RCCA 2RI2A 4FL6A 4EMGA 4JRQA 2QTXA 3JSCA 3MP6A 2RK2A 1NPRA 3QXEB 3RKYA 1VQPA 4KUDK 4O6JA 4CRIA 1M90U 4LDXA 4EMKA 4ZGEB 1XQHA 2E41A 2K3XA 2XG8D 3G7ZA 4OVAA 3JCMe 3CPFA 4C8QA 2XKOC 4ZTJA 2ZGWA 1WQWA 2X4XA 2C06A 4JDSA 2EWNA 2RI3A 2K2VA 1RI0A 2HAXA 2R57A 1KQSS 3RMQA 1UB4A 4X9DA 2IVWA 3VYGA 5GANf 3JCMd 1KC8C 4WF2A 4Y28E 5LJ3h 5EG2A 1YJ9T 2QDYB 3EFSA 4PLLA 2VYTA 4J83A 2LCCA 3OS0A 4BY6C 4Z02A 2RD1A 2X4WA 3F70A 3QZ5B 3OYFA 3SWNC 1VQ9T 3V8LA 4R56A 3OSVA 4XAXB 1P92A 3FDRA 2JZ2A 4J8OA 1Q81U 2CYZB 2K4YA 2M1HA 4R55A 1QP3A 2P0PA 5CR2A 3OQ5A 1M5Q1 2HNIA 4QQ6A 2H3JA 5CCAA 3Q1JA 1U1TA 5LJ5g 1K8AC 4HT9A 3OW2S 1VQLT 3OYNA 2E70A 2FL7A 2K3YA 3CXCS 2GF7A 2MI6A 1YHQT 5FRNA 4XQ3A 3M59A 3LWIA 2P0QA 4OGCA 2GFAA 2JTMA 4ELYC 2KDSA 3X28B 4M75B 2R58A 2DZ9A 1BYMA 4PJOD 4P5NA 1JJ2A 2BKDN 2KMTA 3CMAA 2E5QA 2P4TA 1QW1A 2JVVA 3ASKA 3WVDB 2PUKB 2XDBA 4XU1A 4YTLA 1VQKT 4KT0E 4KUIA 3RESA 1M1KU 3G4SA 1D3BA 1Q7YC 3QKJA 3M55A 3CCJA 3BDUA 3GNFB 4MMKA 1KQ1A 2RO0A 4ELZC 2Y4XA 3PMTA 4XU3A 4ZGJB 3CMET 1K8AU 3OSSC 2XK0A 2RM4A 5GAN5 1K9MC 4M7AE 4IKFA 1JJ2S 2ZZDA 4N4HA 1KQ2A 3HHTB 4HCBA 3RMSA 2K5LA 3N5BB 1NE8A 1OZ3A 2OAUA 2PVOB 3HPWA 5I2MA 2PVDB 4A4GA 2QA4T 2DTOA 4XK8E 4EMHA 2JTFA 4NL3A 4JRPA 4F7UA 2L3RA 4M7DG 2ZPBB 4N0AC 4M75C 4LDUA 1N8RC 4BD3A 4C8QG 2WACA 3CC7A 4X9CA 4BI8B 3CCEA 5FLXE 5GAN4 2VXFA 5IAYA 3R6OA 4F7UB 1Q82C 3HRSA 2I2LA 4OF1A 4UC4A 1JRIA 2DAQA 1K9MU 5LJ3f 5GAOn 2EKOA 4C8QC 1WJSA 4M78E 3T9NA 3JAME 1VQ4T 1B34A 1SSFA 2JN0A 5C6SA 5FU7B 5DLOA 3MEUA 3X24B 4C5EA 4KBMB 3CPWA 5HK3A 3JB9G 2DD5A 3QJ6A 1VQKA 2DVEA 4BY6B 4M7DB 5LJ5f 3M58A 3TEEA 2DKGA 1XOVA 1WGSA 3OYMA 2XD0A 3QIIA 1YJWA 4PJOC 3UWNA 1O9SA 1BI1A 2QQ9A 1XNIA 5A2QE 3GP8A 5GANg 5GMKl 5CK9A 4F7UG 3DLMA 3SD4A 3RIRA 3DLLA 3BFMA 5M9OA 2Y90A 4FU6A 1KHIA 1G5VA 3CD6T 1YCYA 4J7FA 4II1A 3CBPA 2L5QA 3CBMA 3NTHA 3KXTA 4BDZA 1HK9A 4M78A 3E1SA 4XU0A 1VQ4A 4D6WA 3VKIA 3BY7A 3CCRT 2QQBA 3TREA 3CXCA 2XHCA 4C92C 5GAN6 4M77D 2X35A 2V8IA 4J7IA 4OB3B 4FSXA 3CCUA 3CCUT 2FVUA 2QQSA 3LLRA 4LDVA 3OY9A 4EMKC 3A8OB 3AHUA 2PUOB 4BE0A 4M7AF 5D6XA 1YJWT 1N27A 1R8OB 4XTZA 5GMKe 2JNGA 4VUBA 4OB1B 2PVGB 3X25B 2OTJT 1VQOT 3CCMT 4N4IA 1LOJA 3CD6A 1Q82U 3OYHA 2VUBA 1EIFA 2VC8A 2R5MA 3OYKA 3L2UA 4E7IA 3GF5A 4XTUA 3L1AA 2BUDA 3JCMV 3RERA 1H3ZA 4C8QD 2EQJA 3M9QA 1I81A 2LNVA 4XTXA 2RJFA 4C5GA 1VQNT 3VYHB 1VQPT 5GAMf 2M0OA 3JCMX 2OTLA 3FEOA 1O75A 2ZPHB 3V8JA 5CQXA 4M7DC 5KCOA 3OYBA 2CS7A 3SDZA 3MEAA 2DTIA 2F5KA 3ME9A 5HY6A 1X75C 2MF2A 3QYHB 1VQ7T 1YHQA 4C8QF 5GAOl 5KE3A 2DJZA 3PFSA 3URGA 1PSEA 4OMFB 2F69A 4XU2A 3LW5E 4XTYA 3OYDA 2QA4A 5FRMA 1NJIC 3M5AA 1VQ8T 1VQ8A 1YJNT 1M9SA 4E47A 4F7UF 2GCXA 5LJ3g 1UGSB 4LDWA 1Y07A 3FB9A 4IUQA 1GXIE 3OS5A 3S3OA 3P8HA 5DLQE 2E1HA 2DXCA 3MP8A 1BIAA 1NPPA 1BKBA 2D0QB 1RL2A 2LRQA 4M77E 3OBYA 3P8BB 3HFNA 4PLIA 4PJOB 2A3LA 2YLCA 2LT4A 3OB9A 5GAMd 2EQKA 3CPWS 4RG2A 5C0MA 3JCMW 1ZQ1A 1OZ2A 5D6WA 4PJOF 4IUVA 4GLKA 4M7AC 3A8MB 3LX7A 2YHTA 3I55A 4QW2A 3SFMA 2QEXA 3X26B 1VQLA 2EFIA 4A53A 4B9WA 1VQNA 3GOXA 3VUBA 3META 4FM4B 2RH2A 1NZ9A 5J39A 1QVFS 4C0ZA 2MAMA 1MGQA 1WPYA 1M4ZA 3C12A 4JUVA 3A8LB 3S6WA 2X4YA 1AHJB 3V7SA 4J5YA 1KG1A 5J3BA 2E64A 1M1KC 3QPHA 1ZHIA 2LDMA 2LC4A 5FU6C 3G4ST 2XDDA 1V29B 4C5IA 1HXDA 4M7DA 3OYYA 5I2SA 5GAOm 1Q81C 3FJPA 2MWPA 4RG8A 5GAN7 4E7JA 4M7DD 3CMAT 3C94A 1U8RA 4L6V5 1G3TA 2PU9B 4LDYA 2F5TX 1UGQB 4C92B 2E10A 2EJ9A 2RJDA 2Y4YA 2ZCFB 3PMIA 2DD4A 2RHYA 4MMLA 1QVGS 1KD1C 3M54A 3OYJA 4JLIA 2FYKA 3CCRA 4BE1A 5CVIA 3HRUA 4BDYA 5CQYA 3MEVA 4M75A 5CAIA 2HD0A 1N6AA 4IUPA 3JCMh 4C0FA 4KULA 2CKKA 2WSEE 2XICA 2M9UA 2NLUA 5DY9A 5LJ3d 3INZA 5LJ5e 3CCET 1IZ6A 3PIPA 1XTDA 2A7YA 3A8HB 2ZPGB 3P8DA 1WNLA 1VQ6A 5LJ5h 2L8DA 3TU4K 4J6YA 4RCBA 3JB9D 1VQ9A 1Q7YU 4DOWA 3JCMc 5KE2A 1H641 4IURA 4JS5A 2LQ8A 2CGHA 2RHZA 5GMKh 2EQMA 5D6YA 2MWOA 3M4YA 1YI2T 2QQAA 4Y91A 1I4K1 3JCMg 1YJ9A 3WXMB 5A0GA 3O8VA 5CKBA 3CC2A 4M7AA 1Q86C 1BI2A 3L42A 4FT4A 1VQMT 4J6XA 5FU7C 2E6ZA 1KD1U 3GPLA 1VQ5T 3E9FA 3CC4A 3M53A 1IREB 2XI9A 4PJOG 2RHXA 1LNXA 3OW2A 1BI0A 5GAMe 2WSCE 3RUXA 1M90C 2E12A 2R5AA 1UGRB 3HP9A 3V7RA 3JB9H 3HSBA 1MHNA 1K73C 3JRZA 3PNWC 1Y96B 3JB9I 2DPPB 2QEXT 2VGNA 3ZFJA 4HCZA 3CC7T 2X4JA 2LCLA 2K5IA 3OYEA 4CI0C 5GMKi 3QHSA 3LGFA 5GAOq 4OB0B 1FX7A 2CZ6B 3FLGA 2IG0A 2K57A 5GAN2 3UPUA 3S3MA 1YBYA 3MHXA 1LJOA 2EJGA 3LGLA 3M4GA 4X34A 2EIFA 4B9XA 3QSUA 4JLGA 4HKEA 1G3YA 3L2VA 3FIFA 5IT9E 3PIOA 3LYIA 4LD6A 2RJEA 2VV5A 3RKXA 1I5LA 4N4GA 1U1SA 5HKCA 1UEBA 2E65A 3OYIA 1YIJA 4TVRA 1M8VA 3M56A 1JBMA 3LWHA 3JCMQ 3BW1A 3EFRA 4M77A 4J6WA 5KCHA 3G6ET 1N8RU 2LX9A 4HCCA 1Y7XA 2DO3A 2DXUA 2O01E 5GANj 3MP1A 4JRKA 2KVQG 2XDPA 4M78D 3OYGA 4M75D 4A4KA 3OMCA 3CBOA 1WJQA 3A5ZB 2FHDA 2BIVA 4NOYA 3L2WA 4IUUA 4M75E 3GNGA 3CMEA 4M77B 2FB7A 3PT9A 3VUZA 2KY9A 4ME7A 2CZ1B 1DJ7B 4NS5A 4BACA 2YLBA 5CKDA 5GAN3 2XIDA 3A8GB 3HL8A 2KQWA 4C92F 1VQOA 1QP2A 2ZPEB 4C92G 4QVDA 2L89A 1N9SA 3BDLA 2XU8A 2RHIA 2CZ7B 3CCQA 3DB4A 1YITT 3ER0A 1G3SA 3KBGA 1S72T 2MMPA 1NJIU 2RJCA 4BB7A 1G3WA 4MZTA 5GMKm 3JB9J 3DB3A 4C0GA 3CCVT 3QZ9B 1VUBA 3I56T 3I56A 2EYQA 5GAMj 5LJ5d 3X20B 1OYXA 4OGEA 4ZN3A 3HRTA 3JCMf 4M77G 4QVZA 5CKFA 4M75F 3L2ZA 3QUIA 2DXTA 3CCLA 2RA2A 2YRVA 3HKSA 2QI2A 3E19A 3H8ZA 5AYFA 2DXBA 5CKHA 3J81E 1KHCA 4ZGDB 3JCMP 2KSSA 4EPCA 3OMGA 3QG1A 3ZBDA 5A0DA 4XTWA 4C92D 3FC3A 5I21A 2DIQA 2G3RA 2LQKA 5GANh 3J7AF 4NL2A 1ZBXA 3C4SA 4M77C 4Q5WA 5GAMg 4BI3A 5KH6A 2P0KA 3G71A 1W2BS 4A4HA 3I55T 3NTIA 4MZMA 4PKCC 4A4EA 3V8KA 2RK1A 4C0DB 4FIBA 4JS4A 4MZPA 4A4FA 3QJYA 5FU6B 1QVPA 4M78C 4C5HA 1BI3A 3G71T 1TH7A 3LH0A 4O5VA 5LJ5j 1VQ6T 5A0LA 3TCJA 4QVCA 4MDXA 3SB2A 4JJNK 4E7LA 3QYGB 4FT2A 3UT1A 2DTHA 1JB0E 4OP0A 3OYLA 1VIEA 1FXXA 2RI5A 3OS1A 3PTAA 4XTVA 3MO8A 4PJOA 3CEYA 5L8RE 4C8QE 3CCVA 5LJ3j 4OB2B 2HQXA 3CCLT 1BIBA 1Y96A 4L59A 2PQWA 1I8FA 4MDWA 4A54A 4DQ2A 2D6FA 4M7AG 4GY5A 3ZEHA 4ZN1A 4ATOA 4M78B 4ZTFA 2WSFE 1YITA 1X6OA 2M16A 2LVMA 3VV0A 3HFOA 2GFUA 4PJOE 4M78F 2ZPIB 4PNOA 3UDCA 3NTKA 4BE2A 2KAFA 2O4XB 3NFCA 3L2RA 1UGPB 3EAEA 4HA8A 4M7DF 5HK0A 4V2SA 4M7DE 3L2QA 3OS2A 2EAYA 4C8QB 1D3BB 1FWZA 2D9TA 3H6ZA 1N9RA 1WQ7A 3CCQT 4M77F 1X01A 5FROA 5GANe 1WJRA 1YJNA 4BI4A 5IN1A 2JUFA 2CZ0B 4M75G 5GANd 3KUFA 2HBPA 5GMKj 5GAN8 3VU3C 1W4SA 2AHJB 2DK3A 2HQEA 3C95A 2ZPFB 3V7CA 3RKWA 3E9GA 3OBWA 5GAOp 2B8AA 4BUGA 1W2BA 5GAOr 3SWNB 4E7HA 3CCJT 3CCST 4F7UE 2QXFA 4RKUE 3CCSA 1KC8U 1Q86U 1KQSA 1PSFA 4M78G 3MEWA 2OTJA 2RB6A 3QO3A 2DZCA 4C92E 3OA6A 1YIJT 3CC2T 2E6NA 4IUTA 3JCMb 3OYCA 1VQ7A 2O4XA 1YI2A 3JCMJ 2LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6W A;  1WJQ A;  2FHD A;  2BIV A;  4IUU A;  4IUV A;  4PL6 A;  5IAY A;  3LX7 A;  4QW2 A;  3S3N A;  2EFI A;  4B9W A;  4BAC A;  3OYA A;  4NS5 A;  4EDU A;  3GOX A;  3MET A;  4UC4 A;  4QQD A;  5J39 A;  2QQR A;  2LTO A;  2DAQ A;  4E7K A;  2DIG A;  2EKO A;  1OI1 A;  1WJS A;  2X4Y A;  3S6W A;  2RHU A;  3QBY A;  2L89 A;  1SSF A;  3BDL A;  2RHI A;  5C6S A;  3MEU A;  3DB4 A;  4C5E A;  2LDM A;  5J26 A;  4C5I A;  2RJC A;  3QJ6 A;  5CIU A;  2EQU A;  2MWP A;  4E7J A;  3DB3 A;  1WGS A;  4QQG A;  2RI2 A;  4FL6 A;  2EQK A;  3QII A;  3OYM A;  3UWN A;  1XNI A;  3MP6 A;  1OYX A;  3DLM A;  4QVZ A;  3SD4 A;  2RJD A;  4CRI A;  3PMI A;  5M9O A;  2RHY A;  2YRV A;  4FU6 A;  1G5V A;  3H8Z A;  4OVA A;  2K3X A;  3OYJ A;  4BE1 A;  1KHC A;  4II1 A;  4ZTJ A;  4BDY A;  2X4X A;  3MEV A;  3OMG A;  3NTH A;  4BDZ A;  2RI3 A;  4IUP A;  1RI0 A;  3FC3 A;  2CKK A;  2R57 A;  2DIQ A;  2NLU A;  2G3R A;  2X35 A;  3P8D A;  3C4S A;  4Q5W A;  2L8D A;  2QQS A;  2P0K A;  3LLR A;  5KH6 A;  3OY9 A;  4PLL A;  2VYT A;  4A4H A;  2LCC A;  5KE2 A;  3NTI A;  4IUR A;  5D6X A;  4A4E A;  3OS0 A;  4BE0 A;  2RHZ A;  2EQM A;  5D6Y A;  4Z02 A;  1N27 A;  2MWO A;  4A4F A;  2X4W A;  3F70 A;  4C5H A;  3OYF A;  3O8V A;  3LH0 A;  3L42 A;  3FDR A;  2JZ2 A;  4N4I A;  2M1H A;  3OYH A;  3OQ5 A;  3E9F A;  4QQ6 A;  4E7L A;  3UT1 A;  3OMC A;  3Q1J A;  2R5M A;  3OYK A;  3L2U A;  2RHX A;  4E7I A;  3OYN A;  2BUD A;  3OYL A;  1H3Z A;  2RI5 A;  2K3Y A;  3OS1 A;  2EQJ A;  2GF7 A;  3M9Q A;  3MO8 A;  3CEY A;  5FRN A;  2RJF A;  2R5A A;  2GFA A;  4C5G A;  2HQX A;  1MHN A;  2M0O A;  2PQW A;  4L59 A;  3FEO A;  3PNW C;  4GY5 A;  2R58 A;  3ZEH A;  4ZTF A;  3L2W A;  5KCO A;  3OYB A;  4HCZ A;  2M16 A;  2LVM A;  3MEA A;  2BKD N;  2F5K A;  2E5Q A;  3ME9 A;  3OYE A;  2GFU A;  3ASK A;  3NTK A;  4BE2 A;  2O4X B;  5KE3 A;  3L2R A;  3LGF A;  3PFS A;  3EAE A;  3OYD A;  5FRM A;  3QKJ A;  3FLG A;  2IG0 A;  3OS2 A;  3L2Q A;  3H6Z A;  2D9T A;  3S3M A;  2RO0 A;  3LGL A;  4X34 A;  5FRO A;  4B9X A;  1WJR A;  3PMT A;  2XK0 A;  5IN1 A;  3L2V A;  4IKF A;  4N4H A;  4IUQ A;  3KUF A;  3LYI A;  4LD6 A;  2RJE A;  3S3O A;  3OYG A;  4N4G A;  2HQE A;  3P8H A;  3OYI A;  3E9G A;  3MP8 A;  1OZ3 A;  2B8A A;  4A4G A;  4E7H A;  2JTF A;  2LRQ A;  2L3R A;  5KCH A;  3MEW A;  4PLI A;  3OA6 A;  3MP1 A;  2E6N A;  4IUT A;  2XDP A;  4BD3 A;  3OB9 A;  3OYC A;  2WAC A;  2O4X A;  4RG2 A;  5C0M A;  1OZ2 A; 
#chains in the Genus database with same CATH topology
 1ZUY A;  2CT3 A;  2JM8 A;  2E4H A;  1QVG A;  1UDL A;  4LD9 K;  1PWT A;  3EGU A;  4FYW B;  3EGX B;  3CCM A;  1OI1 A;  2W0Z A;  2DEQ A;  2V8J A;  3M0R A;  3QDR B;  3UF4 A;  1MV3 A;  1ZA2 B;  4DBH A;  3DKM A;  1K73 U;  5FWC A;  2K7A A;  2LJ3 A;  3M57 A;  4C0D C;  2PTK A;  4FL6 A;  2H8H A;  4JRQ A;  1OV3 A;  1AEY A;  2K6D A;  3JSC A;  3MP6 A;  2RK2 A;  3H9N A;  3CCM Q;  1NPR A;  1GFD A;  2KGT A;  4O6J A;  4CRI A;  3UA6 A;  3A98 A;  4OVA A;  3JCM e;  2C06 A;  3NGP A;  2BTT A;  1RI0 A;  2HAX A;  2YUP A;  1KQS S;  3RMQ A;  2A36 A;  1IGU A;  4F17 A;  2QDY B;  2KYB A;  4J83 A;  4BY6 C;  2V1Q A;  3OYF A;  4CC4 B;  3FDR A;  2A0F B;  1YJN Q;  3OQ5 A;  2H3J A;  1OOT A;  1U1T A;  4PFP A;  2L3S A;  4HT9 A;  2E70 A;  2O88 A;  4XQ3 A;  2GFA A;  3CCR Q;  2K3B A;  4ELY C;  4IIM A;  4JJD A;  3X28 B;  2DZ9 A;  1K4U S;  1MMA A;  1QW1 A;  1AVZ C;  2PUK B;  1FMV A;  3M55 A;  3GNF B;  1KQ1 A;  2EGC A;  2W10 A;  2D0N A;  3PMT A;  1E6H A;  1KSW A;  4ANJ A;  4IKF A;  4HCB A;  2K5L A;  5IHI A;  1AZE A;  1NE8 A;  4A4G A;  9ATC B;  2DTO A;  4NL3 A;  2JTF A;  1NLP C;  4JRP A;  4Y92 A;  1VQL Q;  2WAC A;  3CC7 A;  3ULR B;  2FRY A;  2VXF A;  5IAY A;  1PG5 B;  3HRS A;  2AZS A;  2I2L A;  4UC4 A;  1V1C A;  2C0O A;  5C6S A;  5DLO A;  4KBM B;  3CPW A;  1TTH B;  4DBQ A;  1RUW A;  2DD5 A;  2DVE A;  3H0I A;  3OYM A;  2XD0 A;  1C6V X;  1RAB B;  4F7U G;  3SD4 A;  3DLL A;  1UGV A;  1TSF A;  2AKK A;  2Y90 A;  1G5V A;  1GRI A;  3CBP A;  3KXT A;  4BDZ A;  1HK9 A;  4M78 A;  3E1S A;  4XU0 A;  3CXC A;  5GAN 6;  1D0Y A;  2X35 A;  2V8I A;  4OB3 B;  3ZL7 C;  3LLR A;  4LDV A;  2DE0 X;  1WHJ A;  3CMA Q;  2DL3 A;  4E7S A;  3VS5 A;  2OTJ T;  1VQO T;  4N4I A;  2VUB A;  2VC8 A;  1Y0M A;  2R5M A;  1UHC A;  3OYK A;  4XTU A;  3M0P A;  2M0Y A;  1I1J A;  2LNV A;  2JTE A;  4C5G A;  2YT6 A;  1S1N A;  3JCM X;  1QLY A;  3FEO A;  2ZPH B;  4M7D C;  5KCO A;  3SDZ A;  4ESR A;  2DTI A;  1K0S A;  1X75 C;  1YHQ A;  5KE3 A;  2DJZ A;  3URG A;  5FRM A;  2QA4 A;  3LW5 E;  2YUN A;  1NJI C;  4F7U F;  1VQ5 Q;  1QQJ A;  3FB9 A;  1QWF A;  3EHR A;  1S72 Q;  4DBF A;  2L0A A;  4X1V A;  5L23 A;  2NUP B;  2LRQ A;  1AWO A;  4PJO B;  1Z9Q A;  2AK5 A;  3JCM W;  4M7A C;  1VQL A;  3GOX A;  3VUB A;  3EH1 A;  1MMG A;  5J39 A;  2MAM A;  1M4Z A;  3A8L B;  1AHJ B;  2DYB A;  1YWO A;  5J3B A;  2KRN A;  2RQR A;  2XDD A;  1V29 B;  1K0X A;  2VKN A;  3FJP A;  4M7D D;  1T0J A;  1PNJ A;  2CP2 A;  4LDY A;  2RQV A;  4C92 B;  2E10 A;  2EJ9 A;  4MML A;  2DD4 A;  3CCR A;  4BE1 A;  2KXC A;  5CQY A;  2DMO A;  3MEV A;  5CAI A;  2EBP A;  2HD0 A;  1VQ4 Q;  5LJ5 e;  2A7Y A;  2PNI A;  3CC4 Q;  1IGQ A;  4J6Y A;  2HSP A;  3JCM c;  2HKN A;  2LQ8 A;  5D6Y A;  4Y91 A;  1YJ9 A;  3WXM B;  5A0G A;  3O8V A;  4M7A A;  1Q86 C;  1BI2 A;  4FT4 A;  1VQ8 Q;  5FU7 C;  2E6Z A;  1X27 A;  4PJO G;  2LQW A;  1AWW A;  1WXT A;  1BI0 A;  5GAM e;  2E12 A;  2F2V A;  2KR3 A;  1UGR B;  3HP9 A;  4PJN A;  1SRM A;  1MHN A;  1OPL A;  2KBT A;  2FRW A;  1K73 C;  3JRZ A;  2E3H A;  3JB9 I;  2OAW A;  4HCZ A;  2G6F X;  1QVG P;  2K5I A;  2DL5 A;  5KYU A;  5GAO q;  4OB0 B;  2CZ6 B;  3FLG A;  1JEG A;  3MHX A;  3QSU A;  1UHF A;  2SRC A;  5IT9 E;  3RDV A;  4AFZ C;  1E6G A;  2HMA A;  3RKX A;  4OMN A;  1YIJ A;  1B7T A;  4TVR A;  3JCM Q;  1OPK A;  4JRK A;  1Q81 R;  2XDP A;  4M75 D;  3OMC A;  3CBO A;  1HYO A;  3PT9 A;  5KYY B;  1M90 R;  2CZ1 B;  1D09 B;  1SF9 A;  2A08 A;  2FPF A;  2XID A;  3HL8 A;  2CH4 A;  4C92 F;  4C92 G;  1TS9 A;  3BDL A;  1T3L A;  1UE9 A;  3QWX X;  3DB4 A;  3CCQ A;  3KBG A;  1X6G A;  2YUQ A;  1VQ6 Q;  1YNZ A;  3QZ9 B;  3I56 T;  2DVJ A;  1WXU A;  3X20 B;  1OYX A;  2LP5 A;  4OGE A;  2A28 A;  3I35 A;  4M77 G;  3QUI A;  2RA2 A;  3HKS A;  4JZ3 A;  5CKH A;  4ZGD B;  5IH2 A;  3OMG A;  4J9G A;  2EYZ A;  2DIQ A;  4CC2 A;  4E2F B;  2OJ2 A;  2G3R A;  3H0F A;  3J7A F;  1ZBX A;  4Q5W A;  5KH6 A;  1W2B S;  1K76 A;  4PKC C;  3V8K A;  2RK1 A;  4FIB A;  3A1P A;  4A4F A;  4C5H A;  3G71 T;  1TH7 A;  4O5V A;  3TCJ A;  4MDX A;  4JJN K;  1KQS P;  1PM3 A;  1FXX A;  1ACM B;  3MO8 A;  1TOV A;  4PJO A;  2QK0 A;  1HJD A;  4OB2 B;  1I8F A;  2FZK B;  2LMJ A;  4M7A G;  4ZN1 A;  4R0K A;  1X6O A;  3HFO A;  2GBQ A;  3UDC A;  3AT1 B;  3NTK A;  2KAF A;  2FPE A;  4F04 B;  4M7D F;  1ZLM A;  2FO0 A;  3NHN A;  4IIO A;  1D3B B;  1FWZ A;  2D9T A;  3H6Z A;  5FWB A;  4M77 F;  5GAN e;  1UEC A;  2YSQ A;  2LZ6 B;  2HBP A;  5GMK j;  5KYY A;  2DK3 A;  1HD3 A;  3CCS A;  3RNJ A;  4M78 G;  2RB6 A;  5ECA A;  1YIJ T;  4KGX B;  2E6N A;  4IUT A;  3OYC A;  2O4X A;  4HVV A;  3SWN A;  4M4Z A;  4C92 A;  3G6E A;  1PD0 A;  3JB9 F;  5LL6 S;  2VXE A;  5GAM h;  4M7A D;  1VYT A;  3M0Q A;  5CKE A;  2DBM A;  3VJP A;  2QQR A;  2K9G A;  4RTU A;  1VQM A;  2HL5 C;  2FZC B;  2RHU A;  2BZY A;  2KK4 A;  1IRX A;  1B34 B;  1VQ9 Q;  2J05 A;  2K5F A;  6AT1 B;  5DM7 R;  1Y71 A;  3GLX A;  4LNP A;  5CIU A;  4RMO A;  4N0A A;  3CXC P;  3J80 E;  4EMK B;  4QQG A;  1S72 A;  4EMG A;  4AMC A;  1VQP A;  1I0C A;  4ZGE B;  1TUD A;  2E41 A;  2K3X A;  4C8Q A;  2XKO C;  2X4X A;  2K2V A;  2R57 A;  3VRY A;  2KT8 A;  1VQK Q;  2IVW A;  5GAN f;  2DRM A;  2DLP A;  4AG2 C;  4WF2 A;  4Y28 E;  5LJ3 h;  5EG2 A;  2VYT A;  1RLP C;  1IHV A;  1VQ9 T;  3SWN C;  4FCY A;  3TSZ A;  1OEB A;  3OSV A;  2K4Y A;  2L2P A;  2AKL A;  2RN8 A;  3Q1J A;  3OW2 S;  2K3Y A;  3CXC S;  2GF7 A;  1YHQ T;  5FRN A;  1YWP A;  2P0Q A;  2KDS A;  4M75 B;  2R58 A;  1IHW A;  4P5N A;  2E5Q A;  2JVV A;  4XU1 A;  4KT0 E;  3RES A;  1M1K U;  3G4S A;  4HCK A;  2CT4 A;  3QWY A;  3BDU A;  4MMK A;  4ELZ C;  1CKB A;  4QT7 A;  3CME T;  1W6X A;  3OSS C;  1JJ2 S;  2RPN A;  2LNH B;  3LH5 A;  3N5B B;  4FW1 A;  4AFU C;  2OAU A;  1ZA1 B;  2PVD B;  2OX7 A;  3CCL Q;  2LQN A;  2KYM A;  4N0A C;  4LDU A;  4C8Q G;  1YHQ Q;  3CCE A;  5FLX E;  3EFO A;  1VQ7 Q;  2QDL A;  4FSS A;  4OF1 A;  2JM9 A;  1QWE A;  1JRI A;  1K9M U;  5GAO n;  4C8Q C;  1WJS A;  1WZO A;  1VQ4 T;  1MV0 B;  1ZUK A;  2JN0 A;  3MEU A;  3M0S A;  1UJY A;  4C5E A;  1MMD A;  3G71 Q;  4KGV B;  1VQK A;  1Q7Y R;  4M7D B;  4RTT A;  3M58 A;  1WGS A;  3QII A;  4PJO C;  1JU5 C;  1O9S A;  1SKU B;  1WIE A;  1U06 A;  5GAN g;  1QVF P;  5CK9 A;  3BFM A;  4FU6 A;  1KHI A;  1RAD B;  4J7F A;  2M02 A;  3NTH A;  1SEM A;  2QYZ A;  3BY7 A;  3CCR T;  2QQB A;  3TRE A;  1KIK A;  4M77 D;  3C0C A;  1JQQ A;  3H41 A;  1K9M R;  4KRT A;  3OY9 A;  3A8O B;  3CCQ Q;  5GMK e;  2K2M A;  4VUB A;  4OB1 B;  2PVG B;  1LOJ A;  1V76 A;  3CCJ Q;  1EIF A;  3L2U A;  4E7I A;  3GF5 A;  2BUD A;  3JCM V;  1H3Z A;  2EQJ A;  3H0H A;  1I81 A;  4KGZ B;  2RJF A;  3MJX A;  4J9F A;  3THK A;  2M0O A;  3V8J A;  1O75 A;  5CQX A;  1D1B A;  2J7I A;  3MEA A;  5KYX B;  2F5K A;  5IXF A;  2MF2 A;  3EGX A;  3QYH B;  1H8K A;  3EG2 A;  2YRD A;  5GAO l;  4XU2 A;  4XTY A;  4GBQ A;  1VQ8 T;  1YJN T;  2GCX A;  5LJ3 g;  4LDW A;  4K11 A;  3S3O A;  2D8J A;  2CUD A;  1PCX A;  3EGD B;  3MP8 A;  2ROT A;  1BKB A;  1W1F A;  4M77 E;  5IHK A;  2LT4 A;  5GAM d;  2F2W A;  1NEB A;  4RG2 A;  3CPW S;  5D6W A;  1LVK A;  3A8M B;  3I55 A;  2YHT A;  3SFM A;  1X2K A;  1RAE B;  4RUG A;  3MET A;  1SPK A;  4C0Z A;  2K79 A;  1WPY A;  2ATC B;  3S6W A;  4J5Y A;  1KG1 A;  1M1K C;  1ZHI A;  2KI7 A;  2DL8 A;  3CCU Q;  4E7J A;  1D1C A;  3CMA T;  3C94 A;  1WXB A;  2PU9 B;  3CCS Q;  2RJD A;  2Y4Y A;  3PMI A;  1QVG S;  1M1K R;  2D8H A;  2BZX A;  2F2X A;  3OYJ A;  2KEA A;  3HRU A;  4BDY A;  1N6A A;  1R0B G;  2CKK A;  2WSE E;  5LJ3 d;  2NLU A;  3EG9 B;  1PD1 A;  3A8H B;  2ZPG B;  1VQ6 A;  3TU4 K;  1VYU A;  2L8D A;  1M3B A;  4DBR A;  4DOW A;  1H64 1;  2RHZ A;  2EQM A;  3REA B;  2MWO A;  1I4K 1;  2JJ9 A;  3I56 Q;  3CC2 A;  1UFF A;  1VQM T;  4OMQ A;  3GPL A;  3E9F A;  1D0Z A;  1IRE B;  5D7U A;  1UUE A;  2HBW A;  2E3I A;  2R5A A;  1QCF A;  3REB B;  3CC7 T;  3PVQ A;  3I5R A;  3QHS A;  1XJW B;  2IG0 A;  2K57 A;  5GAN 2;  1PRL C;  1LJO A;  2EJG A;  4X34 A;  2EIF A;  1BU1 A;  1G3Y A;  2V1R A;  3PIO A;  2CH4 W;  4LD6 A;  2RJE A;  1I5L A;  2L3Q A;  5GJW B;  3OYI A;  1M8V A;  1TUC A;  3BW1 A;  3EFR A;  5KCH A;  1N8R U;  2LX9 A;  5GAN j;  3L2W A;  3O5Z A;  2SEM A;  4M77 B;  4BAC A;  4NS5 A;  4FW2 A;  2JXB A;  1YFN A;  1QP2 A;  1N9S A;  4MZT A;  2J06 A;  3JB9 J;  2NYS A;  3DB3 A;  3CCV T;  1M27 C;  1VUB A;  3HRT A;  4QVZ A;  3L2Z A;  3CCL A;  2YRV A;  2QI2 A;  3E19 A;  5AYF A;  2DXB A;  3QDF A;  2EGE A;  3QG1 A;  3ZBD A;  4XTW A;  1SHG A;  3FC3 A;  5KYW B;  4M77 C;  2MOX A;  4BI3 A;  3D7S B;  1QMC A;  2YWW A;  4MZM A;  2JMA A;  4PJL A;  1E7O A;  2RNA A;  3QJY A;  1W2B P;  2I0N A;  4QVC A;  3KFV A;  1WHG A;  3SB2 A;  4E7L A;  3UT1 A;  1VYV A;  3CC2 Q;  3OYL A;  2IIM A;  4XTV A;  3CEY A;  5L8R E;  4C8Q E;  3CCL T;  2L3P A;  3MPU B;  4MDW A;  1BIB A;  1Y96 A;  4JPB W;  4L59 A;  2WSF E;  2CDT A;  2LVM A;  1I07 A;  4BE2 A;  3L2R A;  1G83 A;  8AT1 B;  4HA8 A;  4M7D E;  2EAY A;  2GQI A;  1YJN A;  1WQ7 A;  1WJR A;  1MMN A;  4BI4 A;  5GAN d;  3KUF A;  4RTY A;  3VU3 C;  1W4S A;  1YIT Q;  2EYY A;  4F7U E;  2JT4 A;  2VB6 A;  3EG3 A;  2F1L A;  4J9E A;  4C92 E;  3CC2 T;  1TG0 A;  2LT1 A;  4OMO A;  4DOV A;  1D0X A;  4PL6 A;  4RTV A;  3MKD A;  3S3N A;  2YUO A;  3VS6 A;  3OYA A;  4EDU A;  2OTL T;  4QQD A;  1QVF A;  2LTO A;  4E7K A;  3QBY A;  1RAH B;  4M7A B;  1YI2 Q;  3PGG A;  4JRI A;  5J26 A;  3FRN A;  2EJF A;  3WVE B;  4DA4 A;  2KXD A;  1WI7 A;  4HT8 A;  2V8K A;  4PJM A;  3RKY A;  2PZ1 A;  4KUD K;  1M90 U;  2KRO A;  2NUT B;  4LDX A;  4EMK A;  2XG8 D;  1X43 A;  3CPF A;  1GBQ A;  1WHH A;  2RI3 A;  1M2V B;  1B07 A;  1UB4 A;  4E7Z A;  3SHW A;  2AZV A;  1KC8 C;  2LCC A;  1TWB A;  3RR6 A;  1GCQ C;  2RD1 A;  3F70 A;  3EHQ A;  1UG1 A;  4LXC A;  4XAX B;  2M1H A;  4R55 A;  1QP3 A;  3G1J A;  1QKX A;  5CR2 A;  1M5Q 1;  2HNI A;  1LPL A;  1VQL T;  2FL7 A;  3M59 A;  1YCS B;  4OGC A;  1UJ0 A;  4J9B A;  4LN2 A;  1JJ2 A;  2KMT A;  3CMA A;  2P4T A;  1R77 A;  3ASK A;  2XDB A;  4KUI A;  1D3B A;  1Q7Y C;  1NLO C;  3RBB B;  2RO0 A;  4ZGJ B;  2DNU A;  4N4H A;  3HHT B;  3TVT A;  1MNE A;  2QA4 T;  4LUD A;  4EMH A;  3EGD A;  1C1A A;  4F7U A;  4M7D G;  2ZPB B;  3VS4 A;  4M75 C;  1N8R C;  1ARK A;  3JV3 A;  4X9C A;  5HCK A;  1YN8 A;  5GAN 4;  2DM1 A;  2EKH A;  2KRM A;  4F7U B;  2MK5 A;  2DET A;  5KYU B;  4Z88 A;  2DAQ A;  2EKO A;  4M78 E;  3T9N A;  3CCE Q;  2M51 A;  1FMK A;  5FU7 B;  3X24 B;  5HK3 A;  3JB9 G;  3QJ6 A;  2DKG A;  2QTV A;  2FEI A;  3UWN A;  5A2Q E;  3PVL A;  1MND A;  3RIR A;  2CSI A;  1VQN Q;  3UA7 A;  1YCY A;  3HTR A;  1VQ4 A;  4CC7 A;  1QKW A;  4C92 C;  4J7I A;  2EYW A;  3CCU T;  2FVU A;  2QQS A;  3AHU A;  3I9Q A;  4EMK C;  2PUO B;  5D6X A;  1ZSZ A;  1JO8 A;  5AT1 B;  1N27 A;  1R8O B;  1RAI B;  4XTZ A;  1FMW A;  3X25 B;  1QCO A;  2HZY A;  3CD6 A;  2MYS A;  1X2Q A;  1K1Z A;  1SG5 A;  4Z8A A;  3RER A;  1GCQ A;  3M9Q A;  4XTX A;  1PRM C;  1VQN T;  3VYH B;  5GAM f;  1YJ9 Q;  3OYB A;  2CS7 A;  2JMC A;  3ME9 A;  5HY6 A;  1VQ7 T;  1LCK A;  1NM7 A;  2ECZ A;  1PSE A;  4OMF B;  3OYD A;  1VQ8 A;  3G4S Q;  1M9S A;  1AD5 A;  2AIR B;  4E47 A;  3VS1 A;  2KE9 A;  1Q95 G;  3OS5 A;  1OX8 A;  2QAS A;  1BIA A;  1M30 A;  3OBY A;  2X51 A;  3P8B B;  3CCV Q;  2A3L A;  2YLC A;  3OB9 A;  2EQK A;  2X3W D;  4RTX A;  5C0M A;  1ZQ1 A;  4IUV A;  4GLK A;  2B86 A;  4QW2 A;  1JJ2 P;  2RQT A;  3VS3 A;  4FM4 B;  2RH2 A;  1NZ9 A;  3C12 A;  1G8X A;  2X4Y A;  4J9H A;  2QGG A;  2E64 A;  2GNC A;  2LDM A;  2LC4 A;  2DX1 A;  3VS0 A;  3G4S T;  4C5I A;  1HXD A;  3OYY A;  5FW9 A;  5I2S A;  1PHT A;  4OMP A;  8ATC B;  2GTJ A;  2CRE A;  2F5T X;  2Z0W A;  2ZCF B;  3PE0 A;  4Z89 A;  1M2O A;  3M54 A;  4M75 A;  4IUP A;  4C0F A;  4KUL A;  2XIC A;  1JXM A;  1XTD A;  3P8D A;  1GL5 A;  5LJ5 h;  4RCB A;  1VQ9 A;  1ZSZ B;  1Q7Y U;  1WA7 A;  3EH2 A;  5GMK h;  4FYV B;  3JCM g;  5CKB A;  1BK2 A;  2QA4 Q;  2FZG B;  1IXD A;  2XI9 A;  3G6E Q;  2RHX A;  1LNX A;  3OW2 A;  2JW4 A;  2HDA A;  3V7R A;  1WHL A;  2LX7 A;  3PNW C;  2QEX T;  2VGN A;  1YP5 A;  2EPD A;  3EFO B;  2X4J A;  3GBQ A;  4CI0 C;  5GMK i;  2DIL A;  1ABQ A;  3S3M A;  1YBY A;  2HL3 A;  3M4G A;  4JLG A;  5I11 A;  3FIF A;  3LYI A;  1U1S A;  5HKC A;  1UEB A;  4CC3 A;  2J6O A;  1AWJ A;  3M56 A;  1AT1 B;  2P84 A;  4M77 A;  3G6E T;  2JS0 A;  2DO3 A;  3MP1 A;  2KVQ G;  2DL4 A;  4A4K A;  4NOY A;  2FHD A;  1HSQ A;  4HVW A;  4IUU A;  3GNG A;  2FB7 A;  4PFZ A;  2KY9 A;  4ME7 A;  1DJ7 B;  2CP3 A;  2YLB A;  5CKD A;  5GAN 3;  1VQO A;  3UAT A;  3I55 Q;  2EYX A;  2ZPE B;  2L89 A;  2RHI A;  2CZ7 B;  3SEM A;  1YIT T;  3ER0 A;  1G3S A;  2E5K A;  2OTJ Q;  1NJI U;  2RJC A;  1H3H A;  3CME Q;  1NEG A;  2DF6 A;  4C0G A;  3I56 A;  4J9I A;  4OML A;  4ZN3 A;  5CKF A;  4M75 F;  1TUG B;  1SSH A;  2OTL Q;  1KHC A;  3JCM P;  1J3T A;  1ZUU A;  3IQL A;  5A0D A;  4RTZ A;  1GCP A;  4NL2 A;  3C4S A;  4ZNX A;  2P0K A;  3G71 A;  4AG1 C;  3I55 T;  2O9V A;  4C0D B;  4JS4 A;  2J6K A;  5FU6 B;  1QVP A;  1VQ6 T;  2KRS A;  5A0L A;  4LE9 A;  2O9S A;  2VVK A;  5KYN A;  1JB0 E;  1VIE A;  3OS1 A;  2KT1 A;  4GLM A;  2HQX A;  2D6F A;  2X9H A;  4A54 A;  1IO6 A;  4GY5 A;  4M78 B;  1YIT A;  3TQ7 P;  1AOJ A;  2M16 A;  3VV0 A;  1GBR A;  4PJO E;  4PNO A;  4M78 F;  1F1B B;  2ZPI B;  3NFC A;  2O4X B;  2NUT A;  2COZ A;  4WCI A;  1WHM A;  5HK0 A;  5EC7 A;  1OQK A;  4F16 A;  3L2Q A;  4C8Q B;  4PJJ A;  3CCQ T;  1X01 A;  2CP0 A;  4PK4 A;  5GAN 8;  4FYX B;  1CSK A;  2AHJ B;  3C95 A;  5GAO p;  1W2B A;  2B8A A;  4BUG A;  3TSW A;  3CCJ T;  1PSF A;  3MEW A;  3QO3 A;  2DZC A;  2H3E B;  3OA6 A;  1UTI A;  1ZX6 A;  1VQ7 A;  3JCM J;  2VGM A;  1M1G A;  5LJ3 e;  2GQV A;  1Q82 R;  4L5G A;  1ZBJ A;  1TU0 B;  1VIF A;  3MCA B;  3CC4 T;  2HEQ A;  1C0M A;  4DEX A;  4E6R A;  5CO7 A;  2DIG A;  3BE3 A;  2RQW A;  1VQ5 A;  2ROL A;  2JOY A;  3GIB A;  2YXY A;  1N8R R;  2EQU A;  1K73 R;  1M1F A;  2RMO A;  2NUZ A;  4RCC A;  2O31 A;  1M3C A;  2RI2 A;  2LCS A;  2QTX A;  2NWM A;  3VRZ A;  5I22 A;  3QXE B;  3FJ5 A;  1SHF A;  1XQH A;  3G7Z A;  1YIJ Q;  4ZTJ A;  1I5O B;  2ZGW A;  1WQW A;  2QEX Q;  4JDS A;  2EWN A;  4JZ4 A;  4X9D A;  3VYG A;  3JCM d;  4KH0 B;  1YJ9 T;  3EFS A;  4PLL A;  1KD1 R;  3OS0 A;  2HSE B;  4Z02 A;  7AT1 B;  4A63 B;  2X4W A;  5IXB A;  2ED0 A;  3QZ5 B;  3V8L A;  4R56 A;  1T3S A;  1WDX A;  1AZG B;  1P92 A;  2JZ2 A;  4J8O A;  1Q81 U;  2CYZ B;  2P0P A;  3EG0 A;  4QQ6 A;  4J9D A;  2VAS A;  5CCA A;  5LJ5 g;  3NPF A;  1K8A C;  3OYN A;  2CP7 A;  2MI6 A;  3LWI A;  2JTM A;  4EIK A;  1RAA B;  1BYM A;  4PJO D;  2BKD N;  3EG9 A;  3WVD B;  4YTL A;  1SRL A;  1VQK T;  1WYX A;  3QKJ A;  3CCJ A;  3CPW P;  2BE9 B;  2Y4X A;  1M8M A;  4XU3 A;  1K9M C;  1K8A U;  4M7A E;  1WLP B;  2RM4 A;  2XK0 A;  5GAN 5;  2ZZD A;  1KQ2 A;  3RMS A;  2CSQ A;  4RTW A;  2KNB B;  1VQM Q;  1OZ3 A;  2PVO B;  3HPW A;  5I2M A;  2ENM A;  4XK8 E;  2L3R A;  4BD3 A;  1BBZ A;  4BI8 B;  3R6O A;  1Q82 C;  2GGR A;  5LJ3 f;  1BCM A;  1YJW Q;  3JAM E;  1B34 A;  1SSF A;  2X3X D;  1Q86 R;  2LJ1 A;  4BY6 B;  1JXO A;  5LJ5 f;  3TEE A;  1X6B A;  1RAC B;  1XOV A;  1YJW A;  1ZSZ C;  1BI1 A;  2QQ9 A;  1XNI A;  1OU9 A;  2MPX C;  1M3A A;  3GP8 A;  5GMK l;  1NJI R;  3DLM A;  5M9O A;  2BZ8 A;  1VQP Q;  3CD6 T;  4II1 A;  1U5S A;  2L5Q A;  3CBM A;  4D6W A;  3VKI A;  2YRC A;  2XHC A;  3OW2 P;  1T0H A;  4FSX A;  3CCU A;  1BCO A;  1OU8 A;  4KH1 B;  4BE0 A;  4M7A F;  1RI9 A;  1YJW T;  1FYN A;  2JNG A;  3CCM T;  1Q82 U;  3OYH A;  1R0C B;  3I5S A;  3L1A A;  1RAG B;  4C8Q D;  4WTO B;  4JJC A;  1N5Z A;  2JS2 A;  3M0T A;  5GJV B;  4QKU A;  1VQP T;  3CD6 Q;  2OTL A;  2ED1 A;  1A0N B;  4F14 A;  1CKA A;  1KK7 A;  2DFU A;  4C8Q F;  3PFS A;  4HVU A;  2F69 A;  2CP6 A;  3M5A A;  1RAF B;  1KC8 R;  2QAZ A;  1UGS B;  1VA7 A;  1Y07 A;  4IUQ A;  1GXI E;  2MCN A;  3P8H A;  5DLQ E;  2E1H A;  2DXC A;  1W70 A;  1NPP A;  1U3O A;  4ORZ A;  2A37 A;  2D0Q B;  1RL2 A;  2DJQ A;  1EZZ B;  2P4R A;  3HFN A;  4PLI A;  2RF0 A;  1OZ2 A;  1PC0 A;  2ESW A;  1MUZ A;  4PJO F;  2QEX A;  3LX7 A;  3X26 B;  2EFI A;  4A53 A;  4B9W A;  4D8D A;  1VQN A;  1X69 A;  1QVF S;  1MGQ A;  1RLQ C;  3CQT A;  4JUV A;  1GFC A;  3V7S A;  2COY A;  5IHN A;  1NBE B;  4HXJ A;  2C0I A;  3QPH A;  4OMM A;  5FU6 C;  4M7D A;  2RQU A;  5GAO m;  1Q81 C;  2MWP A;  4RG8 A;  5GAN 7;  2ZAE A;  1EX4 A;  1U8R A;  4L6V 5;  3EG1 A;  1G3T A;  1UGQ B;  2RHY A;  1KD1 C;  4JLI A;  2FYK A;  5CVI A;  2VWF A;  1K8A R;  3CC7 Q;  3JCM h;  5DY9 A;  3CCE T;  2M9U A;  3INZ A;  4D8K A;  1IZ6 A;  3PIP A;  1WNL A;  3JB9 D;  3R6N A;  5KE2 A;  1OX9 A;  4IUR A;  3M0U A;  4JS5 A;  2CGH A;  3M4Y A;  1YI2 T;  2QQA A;  1Z9Z A;  2CUB A;  3L42 A;  1K9A A;  4J6X A;  1KD1 U;  2C0T A;  1VQ5 T;  3CC4 A;  4JJB A;  3M53 A;  1NG2 A;  2COW A;  2J6F A;  2EGA A;  1Y57 A;  2WSC E;  3RUX A;  1M90 C;  3JB9 H;  3HSB A;  1WX6 A;  1M2V A;  1TXQ A;  2EQI A;  1Y96 B;  5KYX A;  2MIO A;  2DPP B;  2EVR A;  3ZFJ A;  4DEY A;  2LCL A;  3OYE A;  1KFZ A;  3VS7 A;  2NUP A;  3LGF A;  1PKS A;  1FX7 A;  3UPU A;  2FPD A;  4LUE A;  3LGL A;  4B9X A;  2DEU A;  4HKE A;  3L2V A;  2DRK A;  2D1X A;  2VV5 A;  2O2O A;  4N4G A;  5KYW A;  1PKT A;  2E65 A;  1ZSG A;  1JBM A;  3LWH A;  4AFS C;  4FYY B;  1B3Q A;  4J6W A;  4HCC A;  1QCN A;  1Y7X A;  2AT1 B;  2DXU A;  2O01 E;  4PFO A;  1WFW A;  2EW3 A;  2QGF B;  4M78 D;  3OYG A;  2HKQ B;  1G2B A;  1WJQ A;  3A5Z B;  2BIV A;  4M75 E;  3CME A;  3VUZ A;  3A8G B;  4B6M A;  2KQW A;  2DA9 A;  4QVD A;  2XU8 A;  3U23 A;  2V26 A;  1H92 A;  1S72 T;  2MMP A;  2DER A;  1AWX A;  4BB7 A;  1G3W A;  5GMK m;  1EFN A;  2IPO B;  2EYQ A;  5GAM j;  5LJ5 d;  2CP5 A;  3JCM f;  2DXT A;  1VOM A;  2FG0 A;  2LJ0 A;  3NMZ C;  3H8Z A;  1BB9 A;  3J81 E;  2KSS A;  4EPC A;  4C92 D;  5I21 A;  2BE7 D;  2LQK A;  1D1A A;  5GAN h;  4AT1 B;  5GAM g;  4A4H A;  3NTI A;  2GTO A;  4A4E A;  3VS2 A;  4MZP A;  4M78 C;  1BI3 A;  3LH0 A;  1NYG A;  1ABO A;  5LJ5 j;  1NYF A;  2DL7 A;  3QYG B;  4FT2 A;  2DTH A;  4OP0 A;  2RI5 A;  3PTA A;  3CCV A;  5LJ3 j;  2QG9 B;  4AFQ C;  4DQ2 A;  2PQW A;  3ZEH A;  4ATO A;  4ZTF A;  2GFU A;  3E2U A;  1KJW A;  2HCK A;  1UGP B;  2HQH A;  3EAE A;  4V2S A;  3OS2 A;  1WHK A;  1N9R A;  5FRO A;  5IN1 A;  2JUF A;  2CZ0 B;  4J9C A;  4M75 G;  2DBK A;  1IB8 A;  3V7C A;  2HQE A;  1VQO Q;  2ZPF B;  2YDL A;  3RKW A;  2OI3 A;  3E9G A;  3OBW A;  5GAO r;  3SWN B;  2ABL A;  4E7H A;  3CCS T;  2DYI A;  2QXF A;  2XMF A;  4RKU E;  1KC8 U;  1Q86 U;  1KQS A;  2OTJ A;  3JCM b;  1YI2 A;  1OUL A; 
#chains in the Genus database with same CATH homology
 2VGM A;  3SWN A;  4DOV A;  4C92 A;  3G6E A;  1M1G A;  4PL6 A;  3JB9 F;  5LL6 S;  5LJ3 e;  2GQV A;  2VXE A;  5GAM h;  4L5G A;  3S3N A;  1QVG A;  4M7A D;  3OYA A;  4LD9 K;  4EDU A;  2OTL T;  4QQD A;  1VIF A;  3MCA B;  5CKE A;  3VJP A;  3CC4 T;  2QQR A;  2LTO A;  4E7K A;  1QVF A;  5CO7 A;  2DIG A;  1VQM A;  3CCM A;  1OI1 A;  2DEQ A;  2RHU A;  3QBY A;  4M7A B;  2V8J A;  1VQ5 A;  2KK4 A;  1B34 B;  3PGG A;  3QDR B;  4JRI A;  5J26 A;  2K5F A;  2JOY A;  3GIB A;  3FRN A;  2EJF A;  3DKM A;  3WVE B;  1Y71 A;  3GLX A;  5DM7 R;  4DA4 A;  1K73 U;  5CIU A;  4RMO A;  4N0A A;  3M57 A;  4HT8 A;  4C0D C;  2EQU A;  3J80 E;  1M1F A;  4EMK B;  2V8K A;  4QQG A;  1S72 A;  4RCC A;  2RI2 A;  4FL6 A;  4EMG A;  4JRQ A;  2QTX A;  3JSC A;  3MP6 A;  2RK2 A;  1NPR A;  3QXE B;  3RKY A;  1VQP A;  4KUD K;  4O6J A;  4CRI A;  1M90 U;  4LDX A;  4EMK A;  4ZGE B;  1XQH A;  2E41 A;  2K3X A;  2XG8 D;  3G7Z A;  4OVA A;  3JCM e;  3CPF A;  4C8Q A;  2XKO C;  4ZTJ A;  2ZGW A;  1WQW A;  2X4X A;  2C06 A;  4JDS A;  2EWN A;  2RI3 A;  2K2V A;  1RI0 A;  2HAX A;  2R57 A;  1KQS S;  3RMQ A;  1UB4 A;  4X9D A;  2IVW A;  3VYG A;  5GAN f;  3JCM d;  1KC8 C;  4WF2 A;  4Y28 E;  5LJ3 h;  5EG2 A;  1YJ9 T;  2QDY B;  3EFS A;  4PLL A;  2VYT A;  4J83 A;  2LCC A;  3OS0 A;  4BY6 C;  4Z02 A;  2RD1 A;  2X4W A;  3F70 A;  3QZ5 B;  3OYF A;  3SWN C;  1VQ9 T;  3V8L A;  4R56 A;  3OSV A;  4XAX B;  1P92 A;  3FDR A;  2JZ2 A;  4J8O A;  1Q81 U;  2CYZ B;  2K4Y A;  2M1H A;  4R55 A;  1QP3 A;  2P0P A;  5CR2 A;  3OQ5 A;  1M5Q 1;  2HNI A;  4QQ6 A;  2H3J A;  5CCA A;  3Q1J A;  1U1T A;  5LJ5 g;  1K8A C;  4HT9 A;  3OW2 S;  1VQL T;  3OYN A;  2E70 A;  2FL7 A;  2K3Y A;  3CXC S;  2GF7 A;  2MI6 A;  1YHQ T;  5FRN A;  4XQ3 A;  3M59 A;  3LWI A;  2P0Q A;  4OGC A;  2GFA A;  2JTM A;  4ELY C;  2KDS A;  3X28 B;  4M75 B;  2R58 A;  2DZ9 A;  1BYM A;  4PJO D;  4P5N A;  1JJ2 A;  2BKD N;  2KMT A;  3CMA A;  2E5Q A;  2P4T A;  1QW1 A;  2JVV A;  3ASK A;  3WVD B;  2PUK B;  2XDB A;  4XU1 A;  4YTL A;  1VQK T;  4KT0 E;  4KUI A;  3RES A;  1M1K U;  3G4S A;  1D3B A;  1Q7Y C;  3QKJ A;  3M55 A;  3CCJ A;  3BDU A;  3GNF B;  4MMK A;  1KQ1 A;  2RO0 A;  4ELZ C;  2Y4X A;  3PMT A;  4XU3 A;  4ZGJ B;  3CME T;  1K8A U;  3OSS C;  2XK0 A;  2RM4 A;  5GAN 5;  1K9M C;  4M7A E;  4IKF A;  1JJ2 S;  2ZZD A;  4N4H A;  1KQ2 A;  3HHT B;  4HCB A;  3RMS A;  2K5L A;  3N5B B;  1NE8 A;  1OZ3 A;  2OAU A;  2PVO B;  3HPW A;  5I2M A;  2PVD B;  4A4G A;  2QA4 T;  2DTO A;  4XK8 E;  4EMH A;  2JTF A;  4NL3 A;  4JRP A;  4F7U A;  2L3R A;  4M7D G;  2ZPB B;  4N0A C;  4M75 C;  4LDU A;  1N8R C;  4BD3 A;  4C8Q G;  2WAC A;  3CC7 A;  4X9C A;  4BI8 B;  3CCE A;  5FLX E;  5GAN 4;  2VXF A;  5IAY A;  3R6O A;  4F7U B;  1Q82 C;  3HRS A;  2I2L A;  4OF1 A;  4UC4 A;  1JRI A;  2DAQ A;  1K9M U;  5LJ3 f;  5GAO n;  2EKO A;  4C8Q C;  1WJS A;  4M78 E;  3T9N A;  3JAM E;  1VQ4 T;  1B34 A;  1SSF A;  2JN0 A;  5C6S A;  5FU7 B;  5DLO A;  3MEU A;  3X24 B;  4C5E A;  4KBM B;  3CPW A;  5HK3 A;  3JB9 G;  2DD5 A;  3QJ6 A;  1VQK A;  2DVE A;  4BY6 B;  4M7D B;  5LJ5 f;  3M58 A;  3TEE A;  2DKG A;  1XOV A;  1WGS A;  3OYM A;  2XD0 A;  3QII A;  1YJW A;  4PJO C;  3UWN A;  1O9S A;  1BI1 A;  2QQ9 A;  1XNI A;  5A2Q E;  3GP8 A;  5GAN g;  5GMK l;  5CK9 A;  4F7U G;  3DLM A;  3SD4 A;  3RIR A;  3DLL A;  3BFM A;  5M9O A;  2Y90 A;  4FU6 A;  1KHI A;  1G5V A;  3CD6 T;  1YCY A;  4J7F A;  4II1 A;  3CBP A;  2L5Q A;  3CBM A;  3NTH A;  3KXT A;  4BDZ A;  1HK9 A;  4M78 A;  3E1S A;  4XU0 A;  1VQ4 A;  4D6W A;  3VKI A;  3BY7 A;  3CCR T;  2QQB A;  3TRE A;  3CXC A;  2XHC A;  4C92 C;  5GAN 6;  4M77 D;  2X35 A;  2V8I A;  4J7I A;  4OB3 B;  4FSX A;  3CCU A;  3CCU T;  2FVU A;  2QQS A;  3LLR A;  4LDV A;  3OY9 A;  4EMK C;  3A8O B;  3AHU A;  2PUO B;  4BE0 A;  4M7A F;  5D6X A;  1YJW T;  1N27 A;  1R8O B;  4XTZ A;  5GMK e;  2JNG A;  4VUB A;  4OB1 B;  2PVG B;  3X25 B;  2OTJ T;  1VQO T;  3CCM T;  4N4I A;  1LOJ A;  3CD6 A;  1Q82 U;  3OYH A;  2VUB A;  1EIF A;  2VC8 A;  2R5M A;  3OYK A;  3L2U A;  4E7I A;  3GF5 A;  4XTU A;  3L1A A;  2BUD A;  3JCM V;  3RER A;  1H3Z A;  4C8Q D;  2EQJ A;  3M9Q A;  1I81 A;  2LNV A;  4XTX A;  2RJF A;  4C5G A;  1VQN T;  3VYH B;  1VQP T;  5GAM f;  2M0O A;  3JCM X;  2OTL A;  3FEO A;  1O75 A;  2ZPH B;  3V8J A;  5CQX A;  4M7D C;  5KCO A;  3OYB A;  2CS7 A;  3SDZ A;  3MEA A;  2DTI A;  2F5K A;  3ME9 A;  5HY6 A;  1X75 C;  2MF2 A;  3QYH B;  1VQ7 T;  1YHQ A;  4C8Q F;  5GAO l;  5KE3 A;  2DJZ A;  3PFS A;  3URG A;  1PSE A;  4OMF B;  2F69 A;  4XU2 A;  3LW5 E;  4XTY A;  3OYD A;  2QA4 A;  5FRM A;  1NJI C;  3M5A A;  1VQ8 T;  1VQ8 A;  1YJN T;  1M9S A;  4E47 A;  4F7U F;  2GCX A;  5LJ3 g;  1UGS B;  4LDW A;  1Y07 A;  3FB9 A;  4IUQ A;  1GXI E;  3OS5 A;  3S3O A;  3P8H A;  5DLQ E;  2E1H A;  2DXC A;  3MP8 A;  1BIA A;  1NPP A;  1BKB A;  2D0Q B;  1RL2 A;  2LRQ A;  4M77 E;  3OBY A;  3P8B B;  3HFN A;  4PLI A;  4PJO B;  2A3L A;  2YLC A;  2LT4 A;  3OB9 A;  5GAM d;  2EQK A;  3CPW S;  4RG2 A;  5C0M A;  3JCM W;  1ZQ1 A;  1OZ2 A;  5D6W A;  4PJO F;  4IUV A;  4GLK A;  4M7A C;  3A8M B;  3LX7 A;  2YHT A;  3I55 A;  4QW2 A;  3SFM A;  2QEX A;  3X26 B;  1VQL A;  2EFI A;  4A53 A;  4B9W A;  1VQN A;  3GOX A;  3VUB A;  3MET A;  4FM4 B;  2RH2 A;  1NZ9 A;  5J39 A;  1QVF S;  4C0Z A;  2MAM A;  1MGQ A;  1WPY A;  1M4Z A;  3C12 A;  4JUV A;  3A8L B;  3S6W A;  2X4Y A;  1AHJ B;  3V7S A;  4J5Y A;  1KG1 A;  5J3B A;  2E64 A;  1M1K C;  3QPH A;  1ZHI A;  2LDM A;  2LC4 A;  5FU6 C;  3G4S T;  2XDD A;  1V29 B;  4C5I A;  1HXD A;  4M7D A;  3OYY A;  5I2S A;  5GAO m;  1Q81 C;  3FJP A;  2MWP A;  4RG8 A;  5GAN 7;  4E7J A;  4M7D D;  3CMA T;  3C94 A;  1U8R A;  4L6V 5;  1G3T A;  2PU9 B;  4LDY A;  2F5T X;  1UGQ B;  4C92 B;  2E10 A;  2EJ9 A;  2RJD A;  2Y4Y A;  2ZCF B;  3PMI A;  2DD4 A;  2RHY A;  4MML A;  1QVG S;  1KD1 C;  3M54 A;  3OYJ A;  4JLI A;  2FYK A;  3CCR A;  4BE1 A;  5CVI A;  3HRU A;  4BDY A;  5CQY A;  3MEV A;  4M75 A;  5CAI A;  2HD0 A;  1N6A A;  4IUP A;  3JCM h;  4C0F A;  4KUL A;  2CKK A;  2WSE E;  2XIC A;  2M9U A;  2NLU A;  5DY9 A;  5LJ3 d;  3INZ A;  5LJ5 e;  3CCE T;  1IZ6 A;  3PIP A;  1XTD A;  2A7Y A;  3A8H B;  2ZPG B;  3P8D A;  1WNL A;  1VQ6 A;  5LJ5 h;  2L8D A;  3TU4 K;  4J6Y A;  4RCB A;  3JB9 D;  1VQ9 A;  1Q7Y U;  4DOW A;  3JCM c;  5KE2 A;  1H64 1;  4IUR A;  4JS5 A;  2LQ8 A;  2CGH A;  2RHZ A;  5GMK h;  2EQM A;  5D6Y A;  2MWO A;  3M4Y A;  1YI2 T;  2QQA A;  4Y91 A;  1I4K 1;  3JCM g;  1YJ9 A;  3WXM B;  5A0G A;  3O8V A;  5CKB A;  3CC2 A;  4M7A A;  1Q86 C;  1BI2 A;  3L42 A;  4FT4 A;  1VQM T;  4J6X A;  5FU7 C;  2E6Z A;  1KD1 U;  3GPL A;  1VQ5 T;  3E9F A;  3CC4 A;  3M53 A;  1IRE B;  2XI9 A;  4PJO G;  2RHX A;  1LNX A;  3OW2 A;  1BI0 A;  5GAM e;  2WSC E;  3RUX A;  1M90 C;  2E12 A;  2R5A A;  1UGR B;  3HP9 A;  3V7R A;  3JB9 H;  3HSB A;  1MHN A;  1K73 C;  3JRZ A;  3PNW C;  1Y96 B;  3JB9 I;  2DPP B;  2QEX T;  2VGN A;  3ZFJ A;  4HCZ A;  3CC7 T;  2X4J A;  2LCL A;  2K5I A;  3OYE A;  4CI0 C;  5GMK i;  3QHS A;  3LGF A;  5GAO q;  4OB0 B;  1FX7 A;  2CZ6 B;  3FLG A;  2IG0 A;  2K57 A;  5GAN 2;  3UPU A;  3S3M A;  1YBY A;  3MHX A;  1LJO A;  2EJG A;  3LGL A;  3M4G A;  4X34 A;  2EIF A;  4B9X A;  3QSU A;  4JLG A;  4HKE A;  1G3Y A;  3L2V A;  3FIF A;  5IT9 E;  3PIO A;  3LYI A;  4LD6 A;  2RJE A;  2VV5 A;  3RKX A;  1I5L A;  4N4G A;  1U1S A;  5HKC A;  1UEB A;  2E65 A;  3OYI A;  1YIJ A;  4TVR A;  1M8V A;  3M56 A;  1JBM A;  3LWH A;  3JCM Q;  3BW1 A;  3EFR A;  4M77 A;  4J6W A;  5KCH A;  3G6E T;  1N8R U;  2LX9 A;  4HCC A;  1Y7X A;  2DO3 A;  2DXU A;  2O01 E;  5GAN j;  3MP1 A;  4JRK A;  2KVQ G;  2XDP A;  4M78 D;  3OYG A;  4M75 D;  4A4K A;  3OMC A;  3CBO A;  1WJQ A;  3A5Z B;  2FHD A;  2BIV A;  4NOY A;  3L2W A;  4IUU A;  4M75 E;  3GNG A;  3CME A;  4M77 B;  2FB7 A;  3PT9 A;  3VUZ A;  2KY9 A;  4ME7 A;  2CZ1 B;  1DJ7 B;  4NS5 A;  4BAC A;  2YLB A;  5CKD A;  5GAN 3;  2XID A;  3A8G B;  3HL8 A;  2KQW A;  4C92 F;  1VQO A;  1QP2 A;  2ZPE B;  4C92 G;  4QVD A;  2L89 A;  1N9S A;  3BDL A;  2XU8 A;  2RHI A;  2CZ7 B;  3CCQ A;  3DB4 A;  1YIT T;  3ER0 A;  1G3S A;  3KBG A;  1S72 T;  2MMP A;  1NJI U;  2RJC A;  4BB7 A;  1G3W A;  4MZT A;  5GMK m;  3JB9 J;  3DB3 A;  4C0G A;  3CCV T;  3QZ9 B;  1VUB A;  3I56 T;  3I56 A;  2EYQ A;  5GAM j;  5LJ5 d;  3X20 B;  1OYX A;  4OGE A;  4ZN3 A;  3HRT A;  3JCM f;  4M77 G;  4QVZ A;  5CKF A;  4M75 F;  3L2Z A;  3QUI A;  2DXT A;  3CCL A;  2RA2 A;  2YRV A;  3HKS A;  2QI2 A;  3E19 A;  3H8Z A;  5AYF A;  2DXB A;  5CKH A;  3J81 E;  1KHC A;  4ZGD B;  3JCM P;  2KSS A;  4EPC A;  3OMG A;  3QG1 A;  3ZBD A;  5A0D A;  4XTW A;  4C92 D;  3FC3 A;  5I21 A;  2DIQ A;  2G3R A;  2LQK A;  5GAN h;  3J7A F;  4NL2 A;  1ZBX A;  3C4S A;  4M77 C;  4Q5W A;  5GAM g;  4BI3 A;  5KH6 A;  2P0K A;  3G71 A;  1W2B S;  4A4H A;  3I55 T;  3NTI A;  4MZM A;  4PKC C;  4A4E A;  3V8K A;  2RK1 A;  4C0D B;  4FIB A;  4JS4 A;  4MZP A;  4A4F A;  3QJY A;  5FU6 B;  1QVP A;  4M78 C;  4C5H A;  1BI3 A;  3G71 T;  1TH7 A;  3LH0 A;  4O5V A;  5LJ5 j;  1VQ6 T;  5A0L A;  3TCJ A;  4QVC A;  4MDX A;  3SB2 A;  4JJN K;  4E7L A;  3QYG B;  4FT2 A;  3UT1 A;  2DTH A;  1JB0 E;  4OP0 A;  3OYL A;  1VIE A;  1FXX A;  2RI5 A;  3OS1 A;  3PTA A;  4XTV A;  3MO8 A;  4PJO A;  3CEY A;  5L8R E;  4C8Q E;  3CCV A;  5LJ3 j;  4OB2 B;  2HQX A;  3CCL T;  1BIB A;  1Y96 A;  4L59 A;  2PQW A;  1I8F A;  4MDW A;  4A54 A;  4DQ2 A;  2D6F A;  4M7A G;  4GY5 A;  3ZEH A;  4ZN1 A;  4ATO A;  4M78 B;  4ZTF A;  2WSF E;  1YIT A;  1X6O A;  2M16 A;  2LVM A;  3VV0 A;  3HFO A;  2GFU A;  4PJO E;  4M78 F;  2ZPI B;  4PNO A;  3UDC A;  3NTK A;  4BE2 A;  2KAF A;  2O4X B;  3NFC A;  3L2R A;  1UGP B;  3EAE A;  4HA8 A;  4M7D F;  5HK0 A;  4V2S A;  4M7D E;  3L2Q A;  3OS2 A;  2EAY A;  4C8Q B;  1D3B B;  1FWZ A;  2D9T A;  3H6Z A;  1N9R A;  1WQ7 A;  3CCQ T;  4M77 F;  1X01 A;  5FRO A;  5GAN e;  1WJR A;  1YJN A;  4BI4 A;  5IN1 A;  2JUF A;  2CZ0 B;  4M75 G;  5GAN d;  3KUF A;  2HBP A;  5GMK j;  5GAN 8;  3VU3 C;  1W4S A;  2AHJ B;  2DK3 A;  2HQE A;  3C95 A;  2ZPF B;  3V7C A;  3RKW A;  3E9G A;  3OBW A;  5GAO p;  2B8A A;  4BUG A;  1W2B A;  5GAO r;  3SWN B;  4E7H A;  3CCJ T;  3CCS T;  4F7U E;  2QXF A;  4RKU E;  3CCS A;  1KC8 U;  1Q86 U;  1KQS A;  1PSF A;  4M78 G;  3MEW A;  2OTJ A;  2RB6 A;  3QO3 A;  2DZC A;  4C92 E;  3OA6 A;  1YIJ T;  3CC2 T;  2E6N A;  4IUT A;  3JCM b;  3OYC A;  1VQ7 A;  2O4X A;  1YI2 A;  3JCM J;  2LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...