4QQGA

Crystal structure of an n-terminal htatip fragment
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT5
publication title Structural and histone binding studies of the chromo barrel domain of TIP60.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qqgA00
3DB3A 2RJFA 2K3XA 3OS0A 3OYEA 2LDMA 2R5AA 4B9WA 2R58A 2R57A 3PMTA 3L2RA 3NTHA 1OYXA 2RHZA 3P8HA 3PFSA 2WACA 5KCHA 5FRMA 2MWPA 4BE1A 2BIVA 2M0OA 2RI3A 3FDRA 3LX7A 3META 4C5EA 2LVMA 2M1HA 4BDZA 2XDPA 3FEOA 2DIQA 3LYIA 4A4GA 1N27A 4PLLA 2DIGA 4LD6A 2P0KA 3L42A 3MP6A 5IN1A 4E7HA 1OI1A 3MP8A 4IUQA 3NTKA 4PLIA 4A4FA 4NS5A 2EQKA 5KE3A 2BKDN 2RHIA 2DAQA 1WJRA 3E9GA 2M16A 2X4XA 3KUFA 5FRNA 3EAEA 2QQSA 2GF7A 3OYCA 3OQ5A 3DB4A 3S6WA 2CKKA 2G3RA 2NLUA 2BUDA 3QKJA 3OYHA 2FHDA 3QBYA 3OB9A 3SD4A 3ME9A 2L8DA 2JZ2A 3OMCA 4ZTFA 1WJSA 2E6NA 2X4WA 2LTOA 2O4XB 2RJEA 4L59A 3FLGA 2RHXA 3LLRA 2GFUA 2LRQA 2RHUA 4N4IA 4IKFA 2EKOA 4B9XA 5D6WA 3MEUA 3S3MA 3Q1JA 2F5KA 4Q5WA 4QQDA 1WJQA 5KCOA 3OYJA 4QQGA 4E7JA 3OYKA 3OS1A 1OZ3A 2MWOA 5J26A 1WGSA 4QVZA 5C0MA 4RG2A 2RJCA 2RHYA 3FC3A 3MEWA 5D6XA 4BE2A 5C6SA 4A4EA 4IUUA 4QQ6A 2YRVA 3ASKA 3DLMA 2PQWA 3PNWC 1MHNA 2JTFA 4HCZA 2O4XA 2EQUA 2HQEA 3O8VA 4Z02A 3NTIA 4BDYA 3OYMA 3P8DA 3E9FA 4PL6A 3LGLA 4CRIA 2B8AA 4UC4A 4N4HA 2QQRA 3LGFA 4BACA 1H3ZA 4C5IA 2X4YA 3OYBA 3MEVA 3OYIA 3UT1A 3OYAA 3MP1A 4IUTA 1OZ2A 4OVAA 3UWNA 4IURA 2GFAA 3F70A 4BE0A 5D6YA 2EQMA 4QW2A 3OMGA 3OY9A 2L3RA 2D9TA 2RO0A 4FU6A 3OYLA 3L2VA 3S3NA 3OS2A 2L89A 3BDLA 1KHCA 3C4SA 2VYTA 5J39A 2EFIA 3OYFA 2HQXA 4N4GA 4X34A 3OA6A 2E5QA 4C5HA 3L2QA 1G5VA 5CIUA 5KH6A 5M9OA 2RJDA 3QIIA 4ZTJA 4IUVA 3QJ6A 2LCCA 4FL6A 3OYGA 1XNIA 2EQJA 2K3YA 4GY5A 3S3OA 2XK0A 3GOXA 4EDUA 3L2UA 3MO8A 1SSFA 3LH0A 4E7IA 2X35A 5IAYA 3H8ZA 3MEAA 4BD3A 3OYNA 2IG0A 2RI5A 3M9QA 2RI2A 3H6ZA 4II1A 4A4HA 3OYDA 4E7LA 3CEYA 5FROA 4E7KA 4C5GA 1RI0A 2R5MA 5KE2A 4IUPA 3ZEHA 3PMIA 3L2WA
chains in the Genus database with same CATH superfamily
2L2PA 1E7OA 2KDSA 1MNEA 3CCJQ 3URGA 2E1HA 4EPCA 1FX7A 2BIVA 4OMFB 4VUBA 1K73R 2CS7A 4BDZA 3LH5A 1PWTA 5FU7B 3PVLA 1S1NA 2LT1A 3NTKA 1VQ6T 4PFOA 2HKQB 3E9GA 2KR3A 3M58A 1TU0B 4HXJA 2EPDA 3QO3A 1OX8A 2CKKA 2G3RA 3G4SQ 1JXMA 3SD4A 1LNXA 2FZCB 4MZTA 2P0QA 4PNOA 3CCQT 2CT4A 2AZSA 2QGFB 1AZGB 2EVRA 2OX7A 5D7UA 3M4YA 5J26A 3ZFJA 3FC3A 2QI2A 1QQJA 4AT1B 3CMET 3O5ZA 2EQUA 4PJNA 4Z02A 4AFSC 2EGEA 1B7TA 4E6RA 1ZHIA 2DBKA 1FMVA 1YIJA 2MAMA 4DBQA 1OZ2A 4OVAA 1JU5C 4M7DE 2VVKA 1WXBA 2RO0A 4C8QC 4BI8B 2PUKB 2ZAEA 5J39A 2OTLA 3X28B 4X34A 4F7UE 4KGXB 1B34B 2MI6A 5IXFA 1NJIR 4AMCA 3MO8A 2VWFA 3A8LB 2FZGB 3A98A 1TXQA 2ABLA 3VRYA 1NE8A 1N6AA 3CMAQ 2RQWA 1PKSA 4PJOD 2DVJA 3WXMB 1WPYA 4XTVA 4B9WA 2R58A 2K5IA 1TH7A 2DTOA 5KCHA 2NYSA 3C12A 2KRMA 2O9VA 2AZVA 1JJ2A 3RBBB 2QGGA 4KRTA 1JQQA 4LD6A 1T3LA 4D6WA 1Q7YU 1N9RA 2A36A 1VQMA 4HKEA 4WF2A 4JRPA 3I55Q 5GAMd 1GCQA 1LOJA 2E5KA 4LDXA 3JCMJ 2X3XD 2LRQA 3RMQA 2RN8A 2DTIA 2F5KA 3CCLA 1OZ3A 3M54A 2GCXA 3CXCP 4IIOA 4B6MA 2J06A 2HNIA 2A37A 2CP6A 3R6OA 3OW2A 1B07A 1RLPC 1U3OA 2KROA 2EYWA 4OB1B 4FM4B 2CGHA 1A0NB 2YLCA 4BUGA 2JXBA 1S72A 3OYAA 1QKWA 1X69A 2YUQA 1TOVA 4M77F 5LJ3e 1ZLMA 2D9TA 3I56Q 3G6EA 4FW2A 3RKXA 5EG2A 3OS2A 2OTJA 4MMLA 1Y07A 4RTYA 2A0FB 2E5QA 1I8FA 3L2QA 1KQSA 2QXFA 4J9GA 1IZ6A 3CC2T 2K79A 1KJWA 3CBOA 2NWMA 1WI7A 3MEAA 2DTHA 4II1A 4J8OA 2QQBA 5GAN8 4BY6B 3VS0A 3QXEB 4RKUE 2ED1A 2OI3A 3P8HA 1YCYA 4M7DC 1XTDA 4M7DG 1MMDA 4A4GA 1VYUA 2RPNA 4M78C 2JM9A 1OQKA 1I07A 4F7UG 3CCRA 2RHIA 1XOVA 1PCXA 3SWNC 1K8AU 5KYWA 4C0GA 3VS1A 1VQNT 3I5SA 1NJIC 1M8MA 3HFNA 4C92G 2LTOA 1ZUKA 1VQ8T 2GFUA 2YUOA 4OGCA 1BU1A 3C95A 3CCVT 1VIEA 3CCUA 5C0MA 2HKNA 4KULA 1KQSP 4M75A 2ATCB 1M4ZA 1GCPA 2ROLA 4EMKC 2RQVA 2LJ1A 1VQ7T 1GL5A 1RI9A 5LJ3h 4Y91A 1N8RU 3A8OB 2M0YA 1R0CB 2MPXC 3IQLA 1QP2A 3A5ZB 1YN8A 2EJGA 3CPWS 2E64A 2BZYA 4TVRA 1AHJB 1ZSZC 4LUDA 3OYLA 4Y92A 1ARKA 3EG3A 4PFZA 1SG5A 1SKUB 2SEMA 2QA4Q 2VYTA 3P8BB 3FJPA 2YRCA 3OA6A 4C5HA 2ZPIB 2E41A 3HRSA 2LQKA 3T9NA 3UF4A 1VQ8Q 1BBZA 2X9HA 1TWBA 3QWYA 2D1XA 2GBQA 2KGTA 3L2UA 1Q82U 1AVZC 2A7YA 3H6ZA 2EW3A 2ZPEB 4WCIA 3CCMA 1UG1A 2QEXA 2CZ1B 4HCKA 2DL3A 3L2WA 1KG1A 1YJWT 4DOVA 1HSQA 1VQ7Q 2EYXA 1KIKA 1JEGA 3EG2A 4BE1A 4C92D 5KYYA 2DL4A 2XDPA 2LCLA 3EGUA 1VQ5Q 5CVIA 3EFOB 3LWIA 2LQWA 5IN1A 1U1SA 4M77A 2NUPB 5GAOp 4PLIA 2YUNA 1WJRA 2O01E 2X4XA 4LDUA 3UATA 3HRTA 2JTEA 3M59A 3JB9G 1JJ2S 2QG9B 1Z9ZA 1K9AA 3G71A 1QVPA 1H8KA 1KC8R 3UPUA 1SRLA 2KQWA 2RMOA 2CUBA 3THKA 2LT4A 2PNIA 1UE9A 1EIFA 1T0HA 2VKNA 4M75B 3MCAB 3QZ9B 3QG1A 2F5TX 3CC7A 3NTIA 2W10A 3M0TA 4JJCA 3HKSA 2MF2A 2V1RA 1BCMA 4MMKA 1U8RA 1NPRA 2YDLA 5HK0A 4IURA 3CD6Q 1D3BB 2W0ZA 2VXEA 1UGPB 4M7AA 1SRMA 1VQOQ 3JCMb 4GLKA 3CCST 3OW2S 4Z8AA 3LW5E 2KT8A 1TTHB 3HP9A 2K2MA 1YHQT 1YI2A 5KH6A 1UGVA 1YWPA 4FL6A 2DEUA 2A08A 1YJ9A 3M0QA 1RAAB 1JRIA 4RTUA 1D0XA 1M2OA 2HD0A 2RI5A 1YJNQ 4FT4A 4DBRA 3VRZA 1MGQA 5GAMe 4ORZA 1PRMC 1YITT 5CR2A 4CC7A 5GAOr 4PJOE 2P0KA 2DVEA 4MDWA 1U5SA 4RTWA 4NS5A 5CCAA 2LJ3A 2VV5A 3I35A 1Q86U 1E6GA 3KUFA 4AG1C 1IGUA 1RAHB 5LJ5j 4OB2B 1O9SA 4PK4A 4ESRA 3OMCA 8ATCB 1K73U 1HXDA 4FYXB 1FMWA 4J7IA 1YHQQ 4X1VA 3LLRA 2LX9A 4JJDA 2D0QB 2MYSA 4DEYA 3Q1JA 3CC4T 3BY7A 3N5BB 2MCNA 2F1LA 4KBMB 2L5QA 4L5GA 5CKEA 1K0XA 2ED0A 3NFCA 4J9EA 4EMGA 2JTFA 1QVGS 2EYQA 2CZ0B 3P8DA 3E9FA 1N5ZA 1OOTA 3FIFA 3CCET 1VQ4T 4MDXA 4JRIA 1VQLQ 4IUTA 1WYXA 2ROTA 2RQUA 4EIKA 1YBYA 3BDLA 3G1JA 1KC8C 1UHCA 3CCJT 2GQIA 1FYNA 4C8QB 2AKKA 2RM4A 1MNDA 2EWNA 3OYGA 2X51A 5GAMh 3VJPA 2P4TA 2COZA 4ELZC 2V8IA 4FSSA 1WQ7A 2IG0A 3SHWA 2JVVA 1IB8A 2QK0A 2E3HA 3AHUA 1ZX6A 2RHZA 4FYYB 1HD3A 2WACA 4KH1B 3VU3C 1IXDA 2KRNA 3H0HA 1WZOA 1SF9A 3FEOA 2F2VA 2LMJA 5CKFA 6AT1B 3GIBA 1IHWA 1TSFA 3CPFA 2DMOA 2CSIA 4M78A 2XDDA 2CP3A 1BCOA 1M90R 1WHGA 3VS6A 3NHNA 3D7SB 5LJ5f 3OBWA 3JCMd 3EAEA 5A0DA 2QQSA 1GFCA 4DBFA 1Q81U 5KYXB 1GRIA 2BUDA 3GNGA 2D8HA 4DBHA 4XU3A 2YT6A 1KD1U 1AD5A 2LZ6B 1VQKA 1UTIA 1UDLA 1M1KR 5GJWB 1V29B 4B9XA 2QASA 3S3MA 4RG8A 3U23A 4PJOC 2DZCA 3FJ5A 1PD1A 4PJOG 1YP5A 5GANf 5GAN4 5GMKi 4LNPA 1VYTA 1UGSB 1VQ9A 1I81A 3KFVA 1G3TA 4M75D 2X4JA 3BDUA 3CPWA 3OMGA 3CMAT 1ZSGA 2AT1B 1W2BS 4RUGA 3S3NA 2BZXA 2CSQA 4A4KA 2KE9A 2EFIA 1M3AA 2DYBA 1UHFA 4F04B 3HFOA 4OMQA 5LJ3f 1JXOA 2BE7D 1X2KA 5IAYA 4A4HA 2HL3A 1H92A 2XU8A 4CC2A 2XICA 1RUWA 3RNJA 1VQPA 2OTLQ 1BI3A 4J6XA 3I55T 2CDTA 3PIOA 1UGQB 5FRMA 2J05A 2I0NA 2F2XA 3LYIA 2VB6A 3CBMA 4QKUA 4M7DB 2XDBA 2KYMA 2FPDA 2LJ0A 3OBYA 2HL5C 5I2SA 1VQ6A 1BK2A 5KE3A 4LN2A 4C92E 4ZNXA 3H0IA 4M78B 3ZL7C 3QUIA 3OYCA 2CP2A 2VGMA 4A54A 3QKJA 4M75F 3CPWP 1PRLC 3SWNB 3TCJA 3QYGB 3GPLA 2RHXA 4M77D 2HSPA 3CCQA 3M0UA 4IKFA 3L2ZA 5GMKj 2ZCFB 4Q5WA 3TVTA 1VQMQ 2FO0A 1WXTA 2C0IA 3G6ET 3JCMQ 1X75C 5GMKl 4JZ4A 3I56T 1LCKA 4J9IA 3CMEA 2BZ8A 5KYUA 2XD0A 1QKXA 4BDYA 1NYGA 4E7ZA 4EMKB 2B8AA 1M1FA 1M90C 3EHRA 2RA2A 3MEVA 3V8KA 3PVQA 2P0PA 3A8HB 4JJNK 4BE0A 3V7SA 3HL8A 5DLQE 1OX9A 4A63B 1NM7A 2LC4A 3L2VA 3QDFA 4AFZC 2E3IA 4XU1A 1M1KC 1D09B 1SEMA 1ZSZB 4DOWA 1YCSB 1V76A 4ZTJA 1U06A 1S72Q 3QJ6A 4C0DC 2ZPHB 4XTWA 1HK9A 3GOXA 2LCSA 4EDUA 5GAN5 3V8JA 3CCRT 3JRZA 3C94A 4M7AD 1BB9A 1MV0B 5CO7A 1JJ2P 3G6EQ 1RI0A 1ZUUA 5KE2A 3QSUA 2OTJQ 4Z88A 2QAZA 3NPFA 3WVDB 1RAEB 2V26A 5FLXE 4F16A 1C6VX 4E2FB 3VYGA 4FT2A 3JCMP 1WDXA 2C0OA 2PVGB 1UECA 4X9DA 4D8DA 4IUQA 1MV3A 1HYOA 4LDYA 3RR6A 4FSXA 3WVEB 2CT3A 2GTJA 4HA8A 2DL7A 1BIAA 2O9SA 1BYMA 1VIFA 2FHDA 2L8DA 2JOYA 2JZ2A 4ELYC 3EFOA 2LQ8A 2O4XB 2KVQG 2NUPA 2QDLA 2NUZA 3ULRB 1F1BB 3OW2P 5D6WA 4QQDA 3VYHB 3CBPA 3CCRQ 4NL2A 2MWOA 3OSSC 4QVZA 1GXIE 2RHYA 2G6FX 1N9SA 1NG2A 2VXFA 5C6SA 1E6HA 1UB4A 4HVUA 1AOJA 3JB9I 1K76A 3DLMA 3GLXA 1WLPB 3HSBA 4XQ3A 2QA4T 4C92C 5LJ5g 2HQEA 1QVGA 4XTZA 3JSCA 4M7AF 4PL6A 1X43A 4J9HA 4XU0A 5KYUB 5CQXA 1PSFA 4QT7A 1OULA 4C8QF 3CCUQ 3CCMT 2MIOA 3F70A 4JS4A 5D6YA 2CP7A 2XG8D 4IIMA 4ZGEB 1G83A 1QCOA 1ZQ1A 5GAN3 2K7AA 4A53A 5DY9A 3M56A 1K9MC 2KXDA 5M9OA 1PC0A 4AFUC 5GANg 3TQ7P 4GY5A 4JRKA 1VQ5T 3QPHA 2LX7A 4O6JA 3CC2A 2EGAA 2CH4W 1D3BA 4D8KA 3H8ZA 3OYNA 3VS5A 1WX6A 1QCNA 2SRCA 4E7KA 2MOXA 2FPEA 2A28A 2AK5A 2Z0WA 4FCYA 1OYXA 3JCMe 2MWPA 2RQRA 2IPOB 3LX7A 3JB9H 2LVMA 2M1HA 4J9BA 5J3BA 3REAB 2COYA 4X9CA 1U1TA 1PD0A 1AEYA 2YXYA 4HCCA 3VS7A 2OAWA 3CCMQ 2QEXQ 1QVGP 4HT9A 5GAMf 2DFUA 2EQKA 3EGXA 3GF5A 3E19A 3H9NA 3I5RA 1BI0A 3M53A 3OQ5A 2EGCA 5GAN7 1VQNA 2NLUA 3OB9A 3SEMA 4FYVB 1BI2A 4M78D 1NZ9A 5L23A 2XKOC 4N4IA 2M02A 3QWXX 5CQYA 2XIDA 4Z89A 1NLOC 1WIEA 3OS1A 1H3HA 3JAME 3CCVA 2RJCA 3CD6T 4RCBA 3X25B 1RABB 3JV3A 1FWZA 4HVVA 1VQOT 1VYVA 2RQTA 1K0SA 1TUDA 1QWFA 3VS4A 3H0FA 4JS5A 3G71Q 2L3SA 4RCCA 1K4US 3LGFA 1X6GA 2KBTA 2FZKB 3X20B 4KT0E 1WNLA 4LDVA 3TREA 4KGZB 2JMAA 1YJNT 2K6DA 3J81E 2K57A 1W2BA 5FWCA 1KSWA 2EJ9A 2CP0A 3VS2A 4M75E 3PGGA 1YFNA 2RJDA 1XNIA 2QQ9A 3JCMh 4HT8A 1NEBA 2RH2A 4DEXA 4M7DF 1OV3A 4XTXA 5HKCA 2EIFA 4JRQA 1QCFA 3DB3A 2RJFA 2XI9A 4RTXA 4M78F 1AWOA 1YJWA 2AKLA 5LJ5d 1YI2Q 1JO8A 1Q7YC 2M0OA 3FDRA 4C5EA 3EG9B 4C8QA 1N8RR 1V1CA 5GAOl 1KHIA 1YJ9Q 2JM8A 4KUIA 4HVWA 2K4YA 1ZUYA 4AG2C 3L42A 4XK8E 2HBWA 1IRXA 3RDVA 1G3WA 1X6OA 1WFWA 3PIPA 3EGXB 2CZ7B 1M1GA 4NOYA 2HAXA 1RLQC 2X4WA 5GANd 1T3SA 1W2BP 4R56A 2ESWA 1Q82R 1G3SA 1QP3A 2DL5A 1OU8A 2EKOA 1GBRA 4LUEA 1VQLT 1G2BA 1UJYA 5KYXA 1SHGA 4JDSA 1I1JA 4M77E 4ZN1A 3QYHB 3TSZA 2NUTA 1G8XA 5FWBA 4PJOB 2KT1A 1M8VA 2JTMA 2DZ9A 2FPFA 2RB6A 5IXBA 2DO3A 3OYIA 2C06A 4ATOA 1X2QA 4FYWB 3C0CA 1W70A 3UWNA 4ME7A 1ABQA 4QW2A 3SDZA 2EQIA 1PNJA 4OF1A 3BFMA 1KQ1A 2JW4A 2M51A 3CCSA 4N4GA 3VKIA 5GANj 4NL3A 2LCCA 2EQJA 3GNFB 1GFDA 3PE0A 3ZBDA 4E7IA 3H41A 1ZBXA 2PU9B 3FRNA 5FU6C 4FW1A 1QVFA 5FROA 2K9GA 4LDWA 3RIRA 1TUGB 1QWEA 3EG0A 1BIBA 2DNUA 1W4SA 4OMOA 1OEBA 3ER0A 4M7AE 4Y28E 1W1FA 1WXUA 2MMPA 1K8AC 4PLLA 1YITA 2ZPGB 5GAN6 4C8QE 5LJ3j 3CQTA 4A4FA 4M75G 2V8JA 8AT1B 9ATCB 2DAQA 2KAFA 1RAIB 1UJ0A 3S6WA 2B86A 2GTOA 1KK7A 3ME9A 3VS3A 1BI1A 2E6NA 2KYBA 2DL8A 4M7DA 3TU4K 3MEUA 1NJIU 3E1SA 2EJFA 4OMNA 3CC4A 1RADB 4R0KA 4RG2A 5LL6S 3HRUA 1X27A 5HCKA 4BE2A 1N8RC 2ZPBB 3MKDA 4AFQC 2YSQA 1XJWB 2EAYA 1M30A 2F69A 3SWNA 1RL2A 1WHHA 4FIBA 3O8VA 2L3PA 1VQKQ 2DM1A 4J9FA 2NUTB 2LQNA 2QQRA 2FEIA 2QYZA 1P92A 3CCEA 1VQ4A 1YIJT 4J9DA 3EH1A 4GLMA 5GAN2 5IT9E 3J7AF 3OY9A 1Q86R 1B3QA 2DXTA 3EGDA 3RKYA 2OTLT 2GGRA 2LNHB 1Q82C 2J6OA 4EMKA 5IHNA 1VA7A 1KQ2A 4K11A 2H3EB 3LWHA 3CCJA 1VQ9Q 4OGEA 2IVWA 3QIIA 4M77C 4PJJA 4IUVA 2JN0A 2M9UA 1ACMB 2WSEE 4M77G 4PJLA 1MMGA 3GP8A 2LNVA 1YNZA 1I5LA 3OYDA 4C0DB 1M2VB 4C5GA 1Y96A 2Y4XA 5L8RE 2YUPA 3A1PA 2BE9B 3L2RA 3PTAA 1ZSZA 1Y7XA 3G4SA 5I21A 4ZN3A 1YIJQ 1VQMT 4J5YA 4MZPA 1VQPQ 2QDYB 1FMKA 3M5AA 2CUDA 1TG0A 2GF7A 1X01A 1AZEA 1MMAA 3OYHA 1QW1A 4N0AC 4E7SA 2RJEA 4L59A 2JUFA 2DPPB 2YLBA 2DYIA 1JBMA 4C0FA 3CCLT 4GBQA 5KCOA 4E7JA 1VQ6Q 4M7AC 2ECZA 4LE9A 1WGSA 4R55A 3X26B 3MEWA 4M7AG 1IO6A 4A4EA 2OJ2A 4IUUA 4QQ6A 3M57A 3SB2A 2WSFE 4F7UB 2E10A 1VUBA 1LPLA 4M78E 2DA9A 1Z9QA 4C8QG 4HCZA 2O4XA 3CXCA 2CYZB 3LGLA 1K1ZA 1MUZA 4UC4A 3CCQQ 4N4HA 1TS9A 4BACA 1S72T 4XAXB 1H3ZA 4O5VA 4C92B 4J7FA 3UT1A 1K9MR 4E47A 3EFRA 3JB9J 2EQMA 2HBPA 2QQAA 3UA6A 3UA7A 2OTJT 3CMAA 1Q81R 4LXCA 3CMEQ 1NPPA 3MPUB 2DRMA 3EGDB 2D6FA 2WSCE 1KD1R 1G5VA 4ZGDB 2COWA 5LJ5e 4YTLA 2RD1A 1PHTA 7AT1B 2K3YA 1NYFA 3S3OA 2KI7A 3R6NA 3CCLQ 3JCMX 3M9QA 2O31A 2RI2A 1ZBJA 3QDRB 4M4ZA 3ZEHA 1O75A 3OS0A 2LDMA 5FU7C 2R57A 1Y96B 3PMTA 4PKCC 1JB0E 3I55A 2HSEB 3M0SA 2VGNA 3BW1A 3M0PA 1OPLA 1Q86C 5GANe 2DIGA 1UFFA 3OYYA 2J6KA 2DILA 3JCMf 1BKBA 1QVFS 3NMZC 2DERA 1Y71A 3OSVA 1K73C 4LD9K 3I9QA 2F2WA 1MMNA 1X6BA 4C8QD 4MZMA 3L1AA 1AWXA 2HZYA 3VUBA 2GNCA 1EFNA 4JLGA 3JCMV 4PJOF 3RESA 1RAFB 4JUVA 5GMKm 1UUEA 2Y90A 1WQWA 3CCUT 5CKHA 3OYJA 1C1AA 4J9CA 4OP0A 5GAMj 1EZZB 5I11A 4RTVA 4HCBA 3ASKA 3I56A 1MHNA 1I5OB 1ABOA 4OB3B 3KXTA 3RKWA 2A3LA 2DXUA 2EYYA 3VV0A 3MP1A 1UGRB 5LJ5h 2I2LA 4KGVB 2PUOB 1SPKA 2KXCA 2HMAA 2L3RA 5IHKA 4FU6A 2K5FA 5A0LA 1D1BA 2RNAA 1YWOA 1H641 5CIUA 3QHSA 1EX4A 1KFZA 2YWWA 3JCMc 5A2QE 2PZ1A 2XK0A 2D8JA 3X24B 2AHJB 2X35A 1KC8U 4M78G 1Q7YR 2IIMA 2QEXT 5FW9A 3CEYA 3RMSA 2R5MA 4CC4B 5GAOq 1D1CA 5GANh 2GQVA 2ZPFB 4J83A 5I22A 1WHLA 4XTUA 3META 1OPKA 1QMCA 3EHQA 4RMOA 2ZZDA 2KEAA 5CKBA 1M3CA 3CC2Q 1N27A 2KMTA 5CAIA 2V1QA 5I2MA 1Q81C 2KK4A 4JLIA 3AT1B 2PTKA 2BKDN 1OU9A 2DD4A 1KD1C 2H8HA 5ECAA 5CK9A 2KY9A 1UEBA 4OMPA 3DB4A 1WHMA 3EG9A 2VC8A 2DXBA 3QBYA 2MK5A 2FRWA 4ZTFA 2E70A 2H3JA 3G71T 4JPBW 5GJVB 2CZ6B 1T0JA 2FVUA 3V8LA 1IHVA 2RF0A 1I0CA 2FRYA 2CREA 2HQHA 4DA4A 2PVOB 1WHKA 3HTRA 4BB7A 5LJ3g 1PKTA 2FG0A 5D6XA 3E2UA 5HY6A 2KSSA 1VQNQ 3CC7T 1Y57A 3EH2A 1PM3A 5IHIA 4V2SA 1GBQA 1SHFA 4M7DD 1AWWA 1I4K1 2QA4A 2O88A 2K5LA 3TEEA 1AT1B 2ZGWA 4L6V5 2YHTA 1VQ8A 3OYBA 2JS0A 5A0GA 1WHJA 3CCVQ 4OB0B 2GFAA 1CSKA 3EFSA 3PT9A 3M0RA 1HJDA 4PJOA 3SFMA 2DKGA 1D0YA 3EG1A 1VQ7A 4EMHA 2RK2A 2EBPA 1YI2T 5DLOA 3CXCS 1CKAA 1YJ9T 3FB9A 4BY6C 2PVDB 1IREB 2DLPA 1VQ5A 1SSFA 2DETA 1CKBA 1M9SA 4F14A 2D0NA 4IUPA 1R8OB 3PMIA 5GMKe 1K8AR 1ZA2B 2QTVA 2V8KA 3REBB 3CC7Q 5FU6B 2ENMA 2VASA 5KYWB 2JNGA 5DM7R 2RI3A 2K2VA 3OS5A 4JJBA 1Y0MA 3A8GB 5AT1B 1WA7A 1XQHA 2DIQA 1M27C 4E7HA 1OI1A 3BE3A 4CC3A 4RTZA 4OMLA 1ZA1B 2JT4A 1YJWQ 5FRNA 1GCQC 5IH2A 2DEQA 4F7UF 2X3WD 1NLPC 4OMMA 3FLGA 4N0AA 2RHUA 1M5Q1 2EKHA 1R77A 2L3QA 2Y4YA 5GAOn 4QQGA 3M55A 4C92F 5HK3A 1NBEB 4XTYA 2DJQA 3CD6A 3JCMg 1IGQA 4C0ZA 4QVCA 2DRKA 2L0AA 4J6WA 2CH4A 2EYZA 2YRVA 1DJ7B 1VQOA 3RERA 2E4HA 4ZGJB 4CRIA 4ANJA 3M4GA 1D0ZA 3A8MB 4C5IA 2X4YA 3J80E 3MJXA 3INZA 1VOMA 3VUZA 2P4RA 2DF6A 4PJMA 1M90U 2HEQA 1YJNA 2YRDA 3TSWA 3JB9D 2HDAA 2HQXA 2J6FA 2XHCA 5GMKh 1KQSS 2E6ZA 5KYYB 2O2OA 2FB7A 3UDCA 3G7ZA 3DLLA 1M1KU 2JS2A 4E7LA 4M77B 5LJ3d 2JMCA 3QJYA 2KNBB 2C0TA 5GAOm 1W6XA 3CCSQ 2K3XA 3OYEA 2R5AA 4CI0C 1AWJA 3NTHA 3PFSA 5EC7A 2P84A 3RUXA 4QVDA 3DKMA 2OAUA 4P5NA 2DE0X 1YHQA 1PSEA 2HCKA 3MP6A 2J7IA 1RAGB 3MP8A 1M2VA 2QTXA 2AIRB 2M16A 3V7CA 1LJOA 4WTOB 4KH0B 1FXXA 2FYKA 2KRSA 4F17A 3NGPA 4RTTA 2DJZA 5AYFA 1WJSA 1VQKT 3HHTB 1YITQ 2XMFA 1M3BA 1J3TA 3HPWA 2DX1A 2LP5A 3JB9F 1WJQA 1SSHA 4M75C 3V7RA 3OYKA 2K3BA 4JZ3A 1VQLA 2RK1A 1R0BG 3KBGA 1QLYA 4KUDK 2FL7A 4XU2A 4M7AB 2PQWA 3PNWC 2VUBA 2DD5A 3OYMA 3MHXA 1VQ9T 3GBQA 2E65A 3QZ5B 3CC4Q 1Q95G 1G3YA 5KYNA 1RACB 5CKDA 4BI3A 4F7UA 2DK3A 4PFPA 4DQ2A 2CP5A 5GAMg 2L89A 1B34A 1KHCA 3C4SA 3OYFA 3G4ST 1TUCA 4J6YA 1QVFP 2BTTA 2JJ9A 3CCEQ 1VQ4Q 1LVKA 4C92A 1PG5B 1NEGA 4BI4A 2DBMA 2E12A 3LH0A 1C0MA 1K9MU 3JCMW 4BD3A 1VQPT 2DXCA 1D1AA
chains in the Genus database with same CATH topology
1O75A 3OS0A 2LDMA 1MGQA 5FU7C 2R57A 1Y96B 3PMTA 1OYXA 2KDSA 4PKCC 3JCMe 1JB0E 3I55A 2MWPA 5GAMe 3URGA 2E1HA 4EPCA 1FX7A 2BIVA 4OMFB 3LX7A 4VUBA 3JB9H 2LVMA 2M1HA 2CS7A 5J3BA 4X9CA 4BDZA 2VGNA 1U1TA 3BW1A 5FU7B 1YITT 5CR2A 1Q86C 5GANe 5GAOr 2DIGA 4PJOE 2P0KA 3OYYA 4HCCA 2DVEA 4MDWA 2LT1A 3JCMf 4HT9A 1BKBA 3NTKA 1VQ6T 5GAMf 1QVFS 4NS5A 2EQKA 5CCAA 1Y71A 3OSVA 1K73C 4LD9K 3GF5A 2VV5A 3E9GA 3E19A 3M58A 1Q86U 3KUFA 4C8QD 1BI0A 3QO3A 4MZMA 3L1AA 3M53A 3OQ5A 3VUBA 5LJ5j 2CKKA 5GAN7 2G3RA 2NLUA 1VQNA 4OB2B 1O9SA 3OB9A 4JLGA 3SD4A 3OMCA 1K73U 1HXDA 1LNXA 4J7IA 4MZTA 3JCMV 2P0QA 4PNOA 4PJOF 3RESA 3LLRA 3CCQT 2LX9A 1BI2A 4M78D 1NZ9A 4JUVA 2XKOC 2D0QB 4N4IA 5GMKm 5CQYA 2XIDA 2Y90A 3Q1JA 1WQWA 3CC4T 5CKHA 3OYJA 3CCUT 3OS1A 3M4YA 3BY7A 5J26A 3N5BB 3JAME 3ZFJA 3CCVA 2RJCA 3FC3A 3CD6T 4KBMB 4OP0A 4RCBA 2L5QA 2QI2A 5GAMj 4L5GA 3X25B 1FWZA 5CKEA 1VQOT 4HCBA 3NFCA 3ASKA 3I56A 3CMET 4EMGA 1MHNA 2JTFA 1QVGS 2EYQA 2EQUA 2CZ0B 4JS5A 4Z02A 3P8DA 3E9FA 3FIFA 4RCCA 3CCET 1VQ4T 3LGFA 1ZHIA 4OB3B 3KXTA 3RKWA 2A3LA 4M7AB 2DXUA 3VV0A 4MDXA 4JRIA 1YIJA 3X20B 3MP1A 4IUTA 2MAMA 4KT0E 1OZ2A 1UGRB 4OVAA 1WNLA 5LJ5h 2I2LA 4LDVA 3TREA 2PUOB 4M7DE 1YJNT 2L3RA 3J81E 2K57A 2RO0A 4FU6A 1W2BA 2K5FA 4C8QC 2EJ9A 1YBYA 4BI8B 2PUKB 3BDLA 5A0LA 5J39A 2OTLA 1KC8C 3X28B 3CCJT 1H641 4X34A 4F7UE 4M75E 5CIUA 1B34B 2MI6A 3PGGA 3QHSA 2RJDA 4C8QB 2RM4A 2EWNA 3OYGA 1XNIA 2QQ9A 3JCMc 3JCMh 5A2QE 2XK0A 3X24B 4HT8A 5GAMh 2AHJB 3MO8A 3VJPA 3A8LB 2P4TA 2X35A 1KC8U 4M78G 4ELZC 2RH2A 4M7DF 2V8IA 1WQ7A 2IG0A 2QEXT 4XTXA 5HKCA 3CEYA 3RMSA 1NE8A 1N6AA 2JVVA 2R5MA 5GAOq 2EIFA 5GANh 4JRQA 4PJOD 3WXMB 1WPYA 3DB3A 2RJFA 2GQVA 2XI9A 4XTVA 4B9WA 2R58A 2ZPFB 4M78F 3AHUA 1YJWA 2RHZA 4J83A 2K5IA 2WACA 1TH7A 2DTOA 5KCHA 4XTUA 3VU3C 3C12A 5LJ5d 1Q7YC 2M0OA 3FDRA 4C5EA 3META 4C8QA 1JJ2A 4RMOA 2ZZDA 5GAOl 1KHIA 3FEOA 5CKFA 5CKBA 4KUIA 1N27A 2K4YA 3GIBA 2KMTA 3CPFA 4LD6A 4D6WA 5CAIA 3L42A 5I2MA 1Q81C 4XK8E 2KK4A 1Q7YU 4M78A 4JLIA 1N9RA 1KQSS 2XDDA 1G3WA 1VQMA 2BKDN 1X6OA 4HKEA 2DD4A 1KD1C 5LJ5f 3OBWA 5CK9A 3EAEA 2KY9A 4WF2A 2QQSA 5A0DA 1UEBA 3JCMd 5GAMd 3PIPA 4JRPA 1Q81U 3DB4A 2VC8A 2CZ7B 2BUDA 3GNGA 1LOJA 1M1GA 2DXBA 3QBYA 4NOYA 2HAXA 4XU3A 4ZTFA 4LDXA 2X4WA 2E70A 2H3JA 5GANd 1KD1U 3G71T 3JCMJ 2CZ6B 1VQKA 4R56A 2LRQA 3RMQA 1G3SA 1QP3A 2FVUA 3V8LA 1V29B 2EKOA 4B9XA 4DA4A 3S3MA 4RG8A 2DTIA 2F5KA 3CCLA 1VQLT 2PVOB 1OZ3A 3M54A 4BB7A 2GCXA 5LJ3g 5D6XA 4PJOC 2DZCA 2HNIA 5HY6A 2KSSA 4JDSA 4M77E 3R6OA 4PJOG 4ZN1A 3OW2A 3CC7T 3QYHB 5GANf 5GAN4 4V2SA 4M7DD 5GMKi 1I4K1 4PJOB 4OB1B 2QA4A 4FM4B 2K5LA 1UGSB 1M8VA 2CGHA 3TEEA 2ZGWA 2YLCA 2JTMA 1VQ9A 4L6V5 2DZ9A 4BUGA 1I81A 2RB6A 2YHTA 1S72A 1VQ8A 3OYBA 1G3TA 2DO3A 5A0GA 3OYAA 3OYIA 2C06A 4M75D 2X4JA 4ATOA 3BDUA 4OB0B 3UWNA 2GFAA 3CPWA 4ME7A 4QW2A 3OMGA 3SDZA 3CMAT 4M77F 5LJ3e 3EFSA 3PT9A 2D9TA 4OF1A 3G6EA 3S3NA 1W2BS 3RKXA 3BFMA 5EG2A 3OS2A 1KQ1A 2OTJA 4PJOA 4A4KA 3CCSA 3SFMA 2DKGA 4MMLA 2EFIA 1Y07A 1VQ7A 4N4GA 2RK2A 3VKIA 4EMHA 2E5QA 1YI2T 1I8FA 5DLOA 3L2QA 3CXCS 5GANj 1KQSA 2QXFA 4NL3A 1YJ9T 3FB9A 2LCCA 3HFOA 4BY6C 2EQJA 2PVDB 1IZ6A 3CC2T 1IREB 5LJ3f 3GNFB 3ZBDA 1VQ5A 4E7IA 1SSFA 3CBOA 5IAYA 1M9SA 1ZBXA 3MEAA 2DTHA 2PU9B 3FRNA 4II1A 2QQBA 4J8OA 5FU6C 4A4HA 5GAN8 1QVFA 2XU8A 2XICA 5FROA 4LDWA 4BY6B 3RIRA 4IUPA 1R8OB 3PMIA 3QXEB 5GMKe 1VQPA 4RKUE 2V8KA 1BI3A 4J6XA 3P8HA 3I55T 1YCYA 5FU6B 3PIOA 1UGQB 4M7DC 1BIBA 2JNGA 5FRMA 1XTDA 5DM7R 2RI3A 2K2VA 3OS5A 1W4SA 3ER0A 4M7DG 3A8GB 1XQHA 4Y28E 4M7AE 2DIQA 3LYIA 4A4GA 2MMPA 1K8AC 3CBMA 4M78C 4PLLA 1YITA 2ZPGB 4M7DB 5GAN6 2XDBA 4E7HA 1OI1A 4C8QE 5LJ3j 3OBYA 4A4FA 4F7UG 5I2SA 3CCRA 5KE3A 4M75G 2V8JA 1VQ6A 4C92E 2RHIA 4M78B 2DAQA 1XOVA 3SWNC 1K8AU 2KAFA 5FRNA 3QUIA 4C0GA 1VQNT 3OYCA 3S6WA 2VGMA 4A54A 3QKJA 1NJIC 2DEQA 4F7UF 4M75F 3ME9A 1BI1A 3SWNB 3HFNA 4C92G 2E6NA 3TCJA 2LTOA 3QYGB 3GPLA 4M7DA 1VQ8T 3FLGA 2RHXA 4M77D 3TU4K 4N0AA 2GFUA 2RHUA 1M5Q1 3CCQA 4OGCA 4IKFA 3L2ZA 3MEUA 1NJIU 5GMKj 2Y4YA 2EJFA 2ZCFB 3C95A 3E1SA 4Q5WA 4QQGA 3M55A 5GAOn 4C92F 1VIEA 3CCUA 3CCVT 3CC4A 5C0MA 4RG2A 3G6ET 4KULA 4M75A 3HRUA 5LL6S 1M4ZA 4XTYA 1X75C 3JCMQ 4BE2A 1N8RC 3JCMg 4C0ZA 4QVCA 2ZPBB 5GMKl 4EMKC 3CD6A 3I56T 4J6WA 2YRVA 2EAYA 1DJ7B 1VQ7T 2F69A 1VQOA 3SWNA 3CMEA 3RERA 1RL2A 4FIBA 3O8VA 2XD0A 4BDYA 4ZGJB 4Y91A 5LJ3h 4CRIA 1N8RU 3A8OB 2B8AA 4EMKB 2QQRA 1M1FA 1M90C 1P92A 3CCEA 1VQ4A 3M4GA 1YIJT 3A8MB 4C5IA 2RA2A 2X4YA 3MEVA 3V8KA 5GAN2 1QP2A 3A5ZB 3J80E 2EJGA 3CPWS 2P0PA 3A8HB 4JJNK 5IT9E 3INZA 3J7AF 2E64A 3VUZA 3V7SA 4BE0A 4TVRA 3OY9A 3HL8A 1AHJB 5DLQE 1M90U 1YJNA 3OYLA 3L2VA 2DXTA 2LC4A 4XU1A 3RKYA 2OTLT 3JB9D 1Q82C 1M1KC 2VYTA 3P8BB 2HQXA 3FJPA 4EMKA 1KQ2A 3OA6A 4C5HA 2XHCA 2ZPIB 2E41A 5GMKh 3LWHA 4DOWA 3CCJA 2E6ZA 2IVWA 3HRSA 2LQKA 4OGEA 3QIIA 4M77C 3T9NA 4ZTJA 2FB7A 3QJ6A 4IUVA 3UDCA 2JN0A 4C0DC 3G7ZA 2ZPHB 4XTWA 1HK9A 3JB9I 2M9UA 3GOXA 3DLLA 4EDUA 2WSEE 5GAN5 4M77G 3L2UA 1Q82U 3GP8A 1M1KU 2LNVA 2A7YA 3V8JA 3CCRT 3JRZA 3C94A 4M7AD 4E7LA 1I5LA 3H6ZA 2ZPEB 4M77B 3OYDA 5CO7A 5LJ3d 3CCMA 4C0DB 4C5GA 1RI0A 1Y96A 2CZ1B 3QJYA 2Y4XA 5KE2A 2QEXA 3QSUA 5L8RE 3L2WA 5GAOm 1KG1A 2K3XA 3WVDB 3OYEA 4DOVA 2R5AA 4CI0C 3L2RA 4E7JA 1YJWT 3NTHA 3PFSA 3PTAA 5FLXE 3RUXA 4QVDA 4C92D 4BE1A 1Y7XA 3DKMA 3G4SA 2XDPA 2LCLA 2OAUA 5I21A 4P5NA 3VYGA 1YHQA 5CVIA 4FT2A 4ZN3A 3LWIA 1PSEA 3JCMP 2PVGB 3MP6A 5IN1A 1U1SA 4M77A 4X9DA 3MP8A 5GAOp 4IUQA 4PLIA 1VQMT 4J5YA 4MZPA 2QDYB 2QTXA 1WJRA 4LDYA 3WVEB 2M16A 4FSXA 2O01E 2X4XA 1LJOA 4LDUA 3M5AA 3V7CA 4HA8A 2GF7A 3HRTA 1FXXA 1X01A 1BIAA 2FYKA 1BYMA 1VIFA 2FHDA 3OYHA 2DJZA 1QW1A 3M59A 3JB9G 2L8DA 2JOYA 2JZ2A 4N0AC 5AYFA 4ELYC 1JJ2S 1WJSA 1VQKT 3HHTB 2LQ8A 2O4XB 2RJEA 4L59A 2KVQG 2JUFA 2DPPB 2YLBA 3G71A 1QVPA 1JBMA 4C0FA 3UPUA 3CCLT 3HPWA 5D6WA 2KQWA 4QQDA 3VYHB 1WJQA 2LT4A 3CBPA 4M75C 3V7RA 5KCOA 3OYKA 4NL2A 2MWOA 3OSSC 4M7AC 1WGSA 4QVZA 4R55A 1VQLA 1GXIE 3X26B 2RHYA 2RK1A 3MEWA 1EIFA 1N9SA 4M7AG 2VXFA 4A4EA 4IUUA 3KBGA 4QQ6A 5C6SA 4KUDK 2FL7A 1UB4A 3M57A 3SB2A 2WSFE 4F7UB 4XU2A 2E10A 3MCAB 4M75B 3QZ9B 1VUBA 2F5TX 3DLMA 3GLXA 2PQWA 3QG1A 3PNWC 4M78E 4C8QG 4XQ3A 3CC7A 4C92C 2QA4T 4HCZA 2O4XA 3HSBA 5LJ5g 2VUBA 2HQEA 1QVGA 3NTIA 4XTZA 2DD5A 3JSCA 3MHXA 2CYZB 4PL6A 3LGLA 3OYMA 3CXCA 4M7AF 1VQ9T 4UC4A 2E65A 3HKSA 4N4HA 4XU0A 2MF2A 3JB9F 5CQXA 4BACA 1S72T 4XAXB 1H3ZA 4O5VA 3QZ5B 1PSFA 4C8QF 4MMKA 4C92B 4J7FA 1U8RA 1NPRA 3UT1A 3CCMT 4E47A 3EFRA 1G3YA 3JB9J 5HK0A 4IURA 5CKDA 3F70A 4JS4A 1D3BB 5D6YA 2VXEA 2EQMA 4BI3A 4F7UA 2XG8D 2DK3A 2HBPA 1UGPB 4ZGEB 4M7AA 2QQAA 2OTJT 4DQ2A 3CMAA 3JCMb 4GLKA 3CCST 1ZQ1A 1NPPA 5GAN3 5GAMg 3OW2S 3LW5E 2L89A 1B34A 1KHCA 4A53A 3C4SA 3OYFA 3HP9A 3G4ST 5DY9A 3M56A 1K9MC 4J6YA 2D6FA 2WSCE 1G5VA 4ZGDB 1YHQT 1YI2A 5LJ5e 5KH6A 5M9OA 5GANg 4YTLA 4C92A 2RD1A 4FL6A 4GY5A 2K3YA 1YJ9A 4JRKA 4BI4A 3S3OA 1VQ5T 3QPHA 1JRIA 4O6JA 3CC2A 2E12A 3LH0A 3JCMX 1D3BA 3H8ZA 1K9MU 3JCMW 4BD3A 3OYNA 2HD0A 2RI5A 3M9QA 2RI2A 4E7KA 3QDRB 1VQPT 2DXCA 4FT4A 3ZEHA 5HK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB3 A;  2RJF A;  2K3X A;  3OS0 A;  3OYE A;  2LDM A;  2R5A A;  4B9W A;  2R58 A;  2R57 A;  3PMT A;  3L2R A;  3NTH A;  1OYX A;  2RHZ A;  3P8H A;  3PFS A;  2WAC A;  5KCH A;  5FRM A;  2MWP A;  4BE1 A;  2BIV A;  2M0O A;  2RI3 A;  3FDR A;  3LX7 A;  3MET A;  4C5E A;  2LVM A;  2M1H A;  4BDZ A;  2XDP A;  3FEO A;  2DIQ A;  3LYI A;  4A4G A;  1N27 A;  4PLL A;  2DIG A;  4LD6 A;  2P0K A;  3L42 A;  3MP6 A;  5IN1 A;  4E7H A;  1OI1 A;  3MP8 A;  4IUQ A;  3NTK A;  4PLI A;  4A4F A;  4NS5 A;  2EQK A;  5KE3 A;  2BKD N;  2RHI A;  2DAQ A;  1WJR A;  3E9G A;  2M16 A;  2X4X A;  3KUF A;  5FRN A;  3EAE A;  2QQS A;  2GF7 A;  3OYC A;  3OQ5 A;  3DB4 A;  3S6W A;  2CKK A;  2G3R A;  2NLU A;  2BUD A;  3QKJ A;  3OYH A;  2FHD A;  3QBY A;  3OB9 A;  3SD4 A;  3ME9 A;  2L8D A;  2JZ2 A;  3OMC A;  4ZTF A;  1WJS A;  2E6N A;  2X4W A;  2LTO A;  2O4X B;  2RJE A;  4L59 A;  3FLG A;  2RHX A;  3LLR A;  2GFU A;  2LRQ A;  2RHU A;  4N4I A;  4IKF A;  2EKO A;  4B9X A;  5D6W A;  3MEU A;  3S3M A;  3Q1J A;  2F5K A;  4Q5W A;  4QQD A;  1WJQ A;  5KCO A;  3OYJ A;  4QQG A;  4E7J A;  3OYK A;  3OS1 A;  1OZ3 A;  2MWO A;  5J26 A;  1WGS A;  4QVZ A;  5C0M A;  4RG2 A;  2RJC A;  2RHY A;  3FC3 A;  3MEW A;  5D6X A;  4BE2 A;  5C6S A;  4A4E A;  4IUU A;  4QQ6 A;  2YRV A;  3ASK A;  3DLM A;  2PQW A;  3PNW C;  1MHN A;  2JTF A;  4HCZ A;  2O4X A;  2EQU A;  2HQE A;  3O8V A;  4Z02 A;  3NTI A;  4BDY A;  3OYM A;  3P8D A;  3E9F A;  4PL6 A;  3LGL A;  4CRI A;  2B8A A;  4UC4 A;  4N4H A;  2QQR A;  3LGF A;  4BAC A;  1H3Z A;  4C5I A;  2X4Y A;  3OYB A;  3MEV A;  3OYI A;  3UT1 A;  3OYA A;  3MP1 A;  4IUT A;  1OZ2 A;  4OVA A;  3UWN A;  4IUR A;  2GFA A;  3F70 A;  4BE0 A;  5D6Y A;  2EQM A;  4QW2 A;  3OMG A;  3OY9 A;  2L3R A;  2D9T A;  2RO0 A;  4FU6 A;  3OYL A;  3L2V A;  3S3N A;  3OS2 A;  2L89 A;  3BDL A;  1KHC A;  3C4S A;  2VYT A;  5J39 A;  2EFI A;  3OYF A;  2HQX A;  4N4G A;  4X34 A;  3OA6 A;  2E5Q A;  4C5H A;  3L2Q A;  1G5V A;  5CIU A;  5KH6 A;  5M9O A;  2RJD A;  3QII A;  4ZTJ A;  4IUV A;  3QJ6 A;  2LCC A;  4FL6 A;  3OYG A;  1XNI A;  2EQJ A;  2K3Y A;  4GY5 A;  3S3O A;  2XK0 A;  3GOX A;  4EDU A;  3L2U A;  3MO8 A;  1SSF A;  3LH0 A;  4E7I A;  2X35 A;  5IAY A;  3H8Z A;  3MEA A;  4BD3 A;  3OYN A;  2IG0 A;  2RI5 A;  3M9Q A;  2RI2 A;  3H6Z A;  4II1 A;  4A4H A;  3OYD A;  4E7L A;  3CEY A;  5FRO A;  4E7K A;  4C5G A;  1RI0 A;  2R5M A;  5KE2 A;  4IUP A;  3ZEH A;  3PMI A;  3L2W A; 
#chains in the Genus database with same CATH topology
 2L2P A;  1E7O A;  2KDS A;  1MNE A;  3CCJ Q;  3URG A;  2E1H A;  4EPC A;  1FX7 A;  2BIV A;  4OMF B;  4VUB A;  1K73 R;  2CS7 A;  4BDZ A;  3LH5 A;  1PWT A;  5FU7 B;  3PVL A;  1S1N A;  2LT1 A;  3NTK A;  1VQ6 T;  4PFO A;  2HKQ B;  3E9G A;  2KR3 A;  3M58 A;  1TU0 B;  4HXJ A;  2EPD A;  3QO3 A;  1OX8 A;  2CKK A;  2G3R A;  3G4S Q;  1JXM A;  3SD4 A;  1LNX A;  2FZC B;  4MZT A;  2P0Q A;  4PNO A;  3CCQ T;  2CT4 A;  2AZS A;  2QGF B;  1AZG B;  2EVR A;  2OX7 A;  5D7U A;  3M4Y A;  5J26 A;  3ZFJ A;  3FC3 A;  2QI2 A;  1QQJ A;  4AT1 B;  3CME T;  3O5Z A;  2EQU A;  4PJN A;  4Z02 A;  4AFS C;  2EGE A;  1B7T A;  4E6R A;  1ZHI A;  2DBK A;  1FMV A;  1YIJ A;  2MAM A;  4DBQ A;  1OZ2 A;  4OVA A;  1JU5 C;  4M7D E;  2VVK A;  1WXB A;  2RO0 A;  4C8Q C;  4BI8 B;  2PUK B;  2ZAE A;  5J39 A;  2OTL A;  3X28 B;  4X34 A;  4F7U E;  4KGX B;  1B34 B;  2MI6 A;  5IXF A;  1NJI R;  4AMC A;  3MO8 A;  2VWF A;  3A8L B;  2FZG B;  3A98 A;  1TXQ A;  2ABL A;  3VRY A;  1NE8 A;  1N6A A;  3CMA Q;  2RQW A;  1PKS A;  4PJO D;  2DVJ A;  3WXM B;  1WPY A;  4XTV A;  4B9W A;  2R58 A;  2K5I A;  1TH7 A;  2DTO A;  5KCH A;  2NYS A;  3C12 A;  2KRM A;  2O9V A;  2AZV A;  1JJ2 A;  3RBB B;  2QGG A;  4KRT A;  1JQQ A;  4LD6 A;  1T3L A;  4D6W A;  1Q7Y U;  1N9R A;  2A36 A;  1VQM A;  4HKE A;  4WF2 A;  4JRP A;  3I55 Q;  5GAM d;  1GCQ A;  1LOJ A;  2E5K A;  4LDX A;  3JCM J;  2X3X D;  2LRQ A;  3RMQ A;  2RN8 A;  2DTI A;  2F5K A;  3CCL A;  1OZ3 A;  3M54 A;  2GCX A;  3CXC P;  4IIO A;  4B6M A;  2J06 A;  2HNI A;  2A37 A;  2CP6 A;  3R6O A;  3OW2 A;  1B07 A;  1RLP C;  1U3O A;  2KRO A;  2EYW A;  4OB1 B;  4FM4 B;  2CGH A;  1A0N B;  2YLC A;  4BUG A;  2JXB A;  1S72 A;  3OYA A;  1QKW A;  1X69 A;  2YUQ A;  1TOV A;  4M77 F;  5LJ3 e;  1ZLM A;  2D9T A;  3I56 Q;  3G6E A;  4FW2 A;  3RKX A;  5EG2 A;  3OS2 A;  2OTJ A;  4MML A;  1Y07 A;  4RTY A;  2A0F B;  2E5Q A;  1I8F A;  3L2Q A;  1KQS A;  2QXF A;  4J9G A;  1IZ6 A;  3CC2 T;  2K79 A;  1KJW A;  3CBO A;  2NWM A;  1WI7 A;  3MEA A;  2DTH A;  4II1 A;  4J8O A;  2QQB A;  5GAN 8;  4BY6 B;  3VS0 A;  3QXE B;  4RKU E;  2ED1 A;  2OI3 A;  3P8H A;  1YCY A;  4M7D C;  1XTD A;  4M7D G;  1MMD A;  4A4G A;  1VYU A;  2RPN A;  4M78 C;  2JM9 A;  1OQK A;  1I07 A;  4F7U G;  3CCR A;  2RHI A;  1XOV A;  1PCX A;  3SWN C;  1K8A U;  5KYW A;  4C0G A;  3VS1 A;  1VQN T;  3I5S A;  1NJI C;  1M8M A;  3HFN A;  4C92 G;  2LTO A;  1ZUK A;  1VQ8 T;  2GFU A;  2YUO A;  4OGC A;  1BU1 A;  3C95 A;  3CCV T;  1VIE A;  3CCU A;  5C0M A;  2HKN A;  4KUL A;  1KQS P;  4M75 A;  2ATC B;  1M4Z A;  1GCP A;  2ROL A;  4EMK C;  2RQV A;  2LJ1 A;  1VQ7 T;  1GL5 A;  1RI9 A;  5LJ3 h;  4Y91 A;  1N8R U;  3A8O B;  2M0Y A;  1R0C B;  2MPX C;  3IQL A;  1QP2 A;  3A5Z B;  1YN8 A;  2EJG A;  3CPW S;  2E64 A;  2BZY A;  4TVR A;  1AHJ B;  1ZSZ C;  4LUD A;  3OYL A;  4Y92 A;  1ARK A;  3EG3 A;  4PFZ A;  1SG5 A;  1SKU B;  2SEM A;  2QA4 Q;  2VYT A;  3P8B B;  3FJP A;  2YRC A;  3OA6 A;  4C5H A;  2ZPI B;  2E41 A;  3HRS A;  2LQK A;  3T9N A;  3UF4 A;  1VQ8 Q;  1BBZ A;  2X9H A;  1TWB A;  3QWY A;  2D1X A;  2GBQ A;  2KGT A;  3L2U A;  1Q82 U;  1AVZ C;  2A7Y A;  3H6Z A;  2EW3 A;  2ZPE B;  4WCI A;  3CCM A;  1UG1 A;  2QEX A;  2CZ1 B;  4HCK A;  2DL3 A;  3L2W A;  1KG1 A;  1YJW T;  4DOV A;  1HSQ A;  1VQ7 Q;  2EYX A;  1KIK A;  1JEG A;  3EG2 A;  4BE1 A;  4C92 D;  5KYY A;  2DL4 A;  2XDP A;  2LCL A;  3EGU A;  1VQ5 Q;  5CVI A;  3EFO B;  3LWI A;  2LQW A;  5IN1 A;  1U1S A;  4M77 A;  2NUP B;  5GAO p;  4PLI A;  2YUN A;  1WJR A;  2O01 E;  2X4X A;  4LDU A;  3UAT A;  3HRT A;  2JTE A;  3M59 A;  3JB9 G;  1JJ2 S;  2QG9 B;  1Z9Z A;  1K9A A;  3G71 A;  1QVP A;  1H8K A;  1KC8 R;  3UPU A;  1SRL A;  2KQW A;  2RMO A;  2CUB A;  3THK A;  2LT4 A;  2PNI A;  1UE9 A;  1EIF A;  1T0H A;  2VKN A;  4M75 B;  3MCA B;  3QZ9 B;  3QG1 A;  2F5T X;  3CC7 A;  3NTI A;  2W10 A;  3M0T A;  4JJC A;  3HKS A;  2MF2 A;  2V1R A;  1BCM A;  4MMK A;  1U8R A;  1NPR A;  2YDL A;  5HK0 A;  4IUR A;  3CD6 Q;  1D3B B;  2W0Z A;  2VXE A;  1UGP B;  4M7A A;  1SRM A;  1VQO Q;  3JCM b;  4GLK A;  3CCS T;  3OW2 S;  4Z8A A;  3LW5 E;  2KT8 A;  1TTH B;  3HP9 A;  2K2M A;  1YHQ T;  1YI2 A;  5KH6 A;  1UGV A;  1YWP A;  4FL6 A;  2DEU A;  2A08 A;  1YJ9 A;  3M0Q A;  1RAA B;  1JRI A;  4RTU A;  1D0X A;  1M2O A;  2HD0 A;  2RI5 A;  1YJN Q;  4FT4 A;  4DBR A;  3VRZ A;  1MGQ A;  5GAM e;  4ORZ A;  1PRM C;  1YIT T;  5CR2 A;  4CC7 A;  5GAO r;  4PJO E;  2P0K A;  2DVE A;  4MDW A;  1U5S A;  4RTW A;  4NS5 A;  5CCA A;  2LJ3 A;  2VV5 A;  3I35 A;  1Q86 U;  1E6G A;  3KUF A;  4AG1 C;  1IGU A;  1RAH B;  5LJ5 j;  4OB2 B;  1O9S A;  4PK4 A;  4ESR A;  3OMC A;  8ATC B;  1K73 U;  1HXD A;  4FYX B;  1FMW A;  4J7I A;  1YHQ Q;  4X1V A;  3LLR A;  2LX9 A;  4JJD A;  2D0Q B;  2MYS A;  4DEY A;  3Q1J A;  3CC4 T;  3BY7 A;  3N5B B;  2MCN A;  2F1L A;  4KBM B;  2L5Q A;  4L5G A;  5CKE A;  1K0X A;  2ED0 A;  3NFC A;  4J9E A;  4EMG A;  2JTF A;  1QVG S;  2EYQ A;  2CZ0 B;  3P8D A;  3E9F A;  1N5Z A;  1OOT A;  3FIF A;  3CCE T;  1VQ4 T;  4MDX A;  4JRI A;  1VQL Q;  4IUT A;  1WYX A;  2ROT A;  2RQU A;  4EIK A;  1YBY A;  3BDL A;  3G1J A;  1KC8 C;  1UHC A;  3CCJ T;  2GQI A;  1FYN A;  4C8Q B;  2AKK A;  2RM4 A;  1MND A;  2EWN A;  3OYG A;  2X51 A;  5GAM h;  3VJP A;  2P4T A;  2COZ A;  4ELZ C;  2V8I A;  4FSS A;  1WQ7 A;  2IG0 A;  3SHW A;  2JVV A;  1IB8 A;  2QK0 A;  2E3H A;  3AHU A;  1ZX6 A;  2RHZ A;  4FYY B;  1HD3 A;  2WAC A;  4KH1 B;  3VU3 C;  1IXD A;  2KRN A;  3H0H A;  1WZO A;  1SF9 A;  3FEO A;  2F2V A;  2LMJ A;  5CKF A;  6AT1 B;  3GIB A;  1IHW A;  1TSF A;  3CPF A;  2DMO A;  2CSI A;  4M78 A;  2XDD A;  2CP3 A;  1BCO A;  1M90 R;  1WHG A;  3VS6 A;  3NHN A;  3D7S B;  5LJ5 f;  3OBW A;  3JCM d;  3EAE A;  5A0D A;  2QQS A;  1GFC A;  4DBF A;  1Q81 U;  5KYX B;  1GRI A;  2BUD A;  3GNG A;  2D8H A;  4DBH A;  4XU3 A;  2YT6 A;  1KD1 U;  1AD5 A;  2LZ6 B;  1VQK A;  1UTI A;  1UDL A;  1M1K R;  5GJW B;  1V29 B;  4B9X A;  2QAS A;  3S3M A;  4RG8 A;  3U23 A;  4PJO C;  2DZC A;  3FJ5 A;  1PD1 A;  4PJO G;  1YP5 A;  5GAN f;  5GAN 4;  5GMK i;  4LNP A;  1VYT A;  1UGS B;  1VQ9 A;  1I81 A;  3KFV A;  1G3T A;  4M75 D;  2X4J A;  3BDU A;  3CPW A;  3OMG A;  3CMA T;  1ZSG A;  2AT1 B;  1W2B S;  4RUG A;  3S3N A;  2BZX A;  2CSQ A;  4A4K A;  2KE9 A;  2EFI A;  1M3A A;  2DYB A;  1UHF A;  4F04 B;  3HFO A;  4OMQ A;  5LJ3 f;  1JXO A;  2BE7 D;  1X2K A;  5IAY A;  4A4H A;  2HL3 A;  1H92 A;  2XU8 A;  4CC2 A;  2XIC A;  1RUW A;  3RNJ A;  1VQP A;  2OTL Q;  1BI3 A;  4J6X A;  3I55 T;  2CDT A;  3PIO A;  1UGQ B;  5FRM A;  2J05 A;  2I0N A;  2F2X A;  3LYI A;  2VB6 A;  3CBM A;  4QKU A;  4M7D B;  2XDB A;  2KYM A;  2FPD A;  2LJ0 A;  3OBY A;  2HL5 C;  5I2S A;  1VQ6 A;  1BK2 A;  5KE3 A;  4LN2 A;  4C92 E;  4ZNX A;  3H0I A;  4M78 B;  3ZL7 C;  3QUI A;  3OYC A;  2CP2 A;  2VGM A;  4A54 A;  3QKJ A;  4M75 F;  3CPW P;  1PRL C;  3SWN B;  3TCJ A;  3QYG B;  3GPL A;  2RHX A;  4M77 D;  2HSP A;  3CCQ A;  3M0U A;  4IKF A;  3L2Z A;  5GMK j;  2ZCF B;  4Q5W A;  3TVT A;  1VQM Q;  2FO0 A;  1WXT A;  2C0I A;  3G6E T;  3JCM Q;  1X75 C;  5GMK l;  4JZ4 A;  3I56 T;  1LCK A;  4J9I A;  3CME A;  2BZ8 A;  5KYU A;  2XD0 A;  1QKX A;  4BDY A;  1NYG A;  4E7Z A;  4EMK B;  2B8A A;  1M1F A;  1M90 C;  3EHR A;  2RA2 A;  3MEV A;  3V8K A;  3PVQ A;  2P0P A;  3A8H B;  4JJN K;  4BE0 A;  3V7S A;  3HL8 A;  5DLQ E;  1OX9 A;  4A63 B;  1NM7 A;  2LC4 A;  3L2V A;  3QDF A;  4AFZ C;  2E3I A;  4XU1 A;  1M1K C;  1D09 B;  1SEM A;  1ZSZ B;  4DOW A;  1YCS B;  1V76 A;  4ZTJ A;  1U06 A;  1S72 Q;  3QJ6 A;  4C0D C;  2ZPH B;  4XTW A;  1HK9 A;  3GOX A;  2LCS A;  4EDU A;  5GAN 5;  3V8J A;  3CCR T;  3JRZ A;  3C94 A;  4M7A D;  1BB9 A;  1MV0 B;  5CO7 A;  1JJ2 P;  3G6E Q;  1RI0 A;  1ZUU A;  5KE2 A;  3QSU A;  2OTJ Q;  4Z88 A;  2QAZ A;  3NPF A;  3WVD B;  1RAE B;  2V26 A;  5FLX E;  4F16 A;  1C6V X;  4E2F B;  3VYG A;  4FT2 A;  3JCM P;  1WDX A;  2C0O A;  2PVG B;  1UEC A;  4X9D A;  4D8D A;  4IUQ A;  1MV3 A;  1HYO A;  4LDY A;  3RR6 A;  4FSX A;  3WVE B;  2CT3 A;  2GTJ A;  4HA8 A;  2DL7 A;  1BIA A;  2O9S A;  1BYM A;  1VIF A;  2FHD A;  2L8D A;  2JOY A;  2JZ2 A;  4ELY C;  3EFO A;  2LQ8 A;  2O4X B;  2KVQ G;  2NUP A;  2QDL A;  2NUZ A;  3ULR B;  1F1B B;  3OW2 P;  5D6W A;  4QQD A;  3VYH B;  3CBP A;  3CCR Q;  4NL2 A;  2MWO A;  3OSS C;  4QVZ A;  1GXI E;  2RHY A;  2G6F X;  1N9S A;  1NG2 A;  2VXF A;  5C6S A;  1E6H A;  1UB4 A;  4HVU A;  1AOJ A;  3JB9 I;  1K76 A;  3DLM A;  3GLX A;  1WLP B;  3HSB A;  4XQ3 A;  2QA4 T;  4C92 C;  5LJ5 g;  2HQE A;  1QVG A;  4XTZ A;  3JSC A;  4M7A F;  4PL6 A;  1X43 A;  4J9H A;  4XU0 A;  5KYU B;  5CQX A;  1PSF A;  4QT7 A;  1OUL A;  4C8Q F;  3CCU Q;  3CCM T;  2MIO A;  3F70 A;  4JS4 A;  5D6Y A;  2CP7 A;  2XG8 D;  4IIM A;  4ZGE B;  1G83 A;  1QCO A;  1ZQ1 A;  5GAN 3;  2K7A A;  4A53 A;  5DY9 A;  3M56 A;  1K9M C;  2KXD A;  5M9O A;  1PC0 A;  4AFU C;  5GAN g;  3TQ7 P;  4GY5 A;  4JRK A;  1VQ5 T;  3QPH A;  2LX7 A;  4O6J A;  3CC2 A;  2EGA A;  2CH4 W;  1D3B A;  4D8K A;  3H8Z A;  3OYN A;  3VS5 A;  1WX6 A;  1QCN A;  2SRC A;  4E7K A;  2MOX A;  2FPE A;  2A28 A;  2AK5 A;  2Z0W A;  4FCY A;  1OYX A;  3JCM e;  2MWP A;  2RQR A;  2IPO B;  3LX7 A;  3JB9 H;  2LVM A;  2M1H A;  4J9B A;  5J3B A;  3REA B;  2COY A;  4X9C A;  1U1T A;  1PD0 A;  1AEY A;  2YXY A;  4HCC A;  3VS7 A;  2OAW A;  3CCM Q;  2QEX Q;  1QVG P;  4HT9 A;  5GAM f;  2DFU A;  2EQK A;  3EGX A;  3GF5 A;  3E19 A;  3H9N A;  3I5R A;  1BI0 A;  3M53 A;  3OQ5 A;  2EGC A;  5GAN 7;  1VQN A;  2NLU A;  3OB9 A;  3SEM A;  4FYV B;  1BI2 A;  4M78 D;  1NZ9 A;  5L23 A;  2XKO C;  4N4I A;  2M02 A;  3QWX X;  5CQY A;  2XID A;  4Z89 A;  1NLO C;  1WIE A;  3OS1 A;  1H3H A;  3JAM E;  3CCV A;  2RJC A;  3CD6 T;  4RCB A;  3X25 B;  1RAB B;  3JV3 A;  1FWZ A;  4HVV A;  1VQO T;  1VYV A;  2RQT A;  1K0S A;  1TUD A;  1QWF A;  3VS4 A;  3H0F A;  4JS5 A;  3G71 Q;  2L3S A;  4RCC A;  1K4U S;  3LGF A;  1X6G A;  2KBT A;  2FZK B;  3X20 B;  4KT0 E;  1WNL A;  4LDV A;  3TRE A;  4KGZ B;  2JMA A;  1YJN T;  2K6D A;  3J81 E;  2K57 A;  1W2B A;  5FWC A;  1KSW A;  2EJ9 A;  2CP0 A;  3VS2 A;  4M75 E;  3PGG A;  1YFN A;  2RJD A;  1XNI A;  2QQ9 A;  3JCM h;  4HT8 A;  1NEB A;  2RH2 A;  4DEX A;  4M7D F;  1OV3 A;  4XTX A;  5HKC A;  2EIF A;  4JRQ A;  1QCF A;  3DB3 A;  2RJF A;  2XI9 A;  4RTX A;  4M78 F;  1AWO A;  1YJW A;  2AKL A;  5LJ5 d;  1YI2 Q;  1JO8 A;  1Q7Y C;  2M0O A;  3FDR A;  4C5E A;  3EG9 B;  4C8Q A;  1N8R R;  1V1C A;  5GAO l;  1KHI A;  1YJ9 Q;  2JM8 A;  4KUI A;  4HVW A;  2K4Y A;  1ZUY A;  4AG2 C;  3L42 A;  4XK8 E;  2HBW A;  1IRX A;  3RDV A;  1G3W A;  1X6O A;  1WFW A;  3PIP A;  3EGX B;  2CZ7 B;  1M1G A;  4NOY A;  2HAX A;  1RLQ C;  2X4W A;  5GAN d;  1T3S A;  1W2B P;  4R56 A;  2ESW A;  1Q82 R;  1G3S A;  1QP3 A;  2DL5 A;  1OU8 A;  2EKO A;  1GBR A;  4LUE A;  1VQL T;  1G2B A;  1UJY A;  5KYX A;  1SHG A;  4JDS A;  1I1J A;  4M77 E;  4ZN1 A;  3QYH B;  3TSZ A;  2NUT A;  1G8X A;  5FWB A;  4PJO B;  2KT1 A;  1M8V A;  2JTM A;  2DZ9 A;  2FPF A;  2RB6 A;  5IXB A;  2DO3 A;  3OYI A;  2C06 A;  4ATO A;  1X2Q A;  4FYW B;  3C0C A;  1W70 A;  3UWN A;  4ME7 A;  1ABQ A;  4QW2 A;  3SDZ A;  2EQI A;  1PNJ A;  4OF1 A;  3BFM A;  1KQ1 A;  2JW4 A;  2M51 A;  3CCS A;  4N4G A;  3VKI A;  5GAN j;  4NL3 A;  2LCC A;  2EQJ A;  3GNF B;  1GFD A;  3PE0 A;  3ZBD A;  4E7I A;  3H41 A;  1ZBX A;  2PU9 B;  3FRN A;  5FU6 C;  4FW1 A;  1QVF A;  5FRO A;  2K9G A;  4LDW A;  3RIR A;  1TUG B;  1QWE A;  3EG0 A;  1BIB A;  2DNU A;  1W4S A;  4OMO A;  1OEB A;  3ER0 A;  4M7A E;  4Y28 E;  1W1F A;  1WXU A;  2MMP A;  1K8A C;  4PLL A;  1YIT A;  2ZPG B;  5GAN 6;  4C8Q E;  5LJ3 j;  3CQT A;  4A4F A;  4M75 G;  2V8J A;  8AT1 B;  9ATC B;  2DAQ A;  2KAF A;  1RAI B;  1UJ0 A;  3S6W A;  2B86 A;  2GTO A;  1KK7 A;  3ME9 A;  3VS3 A;  1BI1 A;  2E6N A;  2KYB A;  2DL8 A;  4M7D A;  3TU4 K;  3MEU A;  1NJI U;  3E1S A;  2EJF A;  4OMN A;  3CC4 A;  1RAD B;  4R0K A;  4RG2 A;  5LL6 S;  3HRU A;  1X27 A;  5HCK A;  4BE2 A;  1N8R C;  2ZPB B;  3MKD A;  4AFQ C;  2YSQ A;  1XJW B;  2EAY A;  1M30 A;  2F69 A;  3SWN A;  1RL2 A;  1WHH A;  4FIB A;  3O8V A;  2L3P A;  1VQK Q;  2DM1 A;  4J9F A;  2NUT B;  2LQN A;  2QQR A;  2FEI A;  2QYZ A;  1P92 A;  3CCE A;  1VQ4 A;  1YIJ T;  4J9D A;  3EH1 A;  4GLM A;  5GAN 2;  5IT9 E;  3J7A F;  3OY9 A;  1Q86 R;  1B3Q A;  2DXT A;  3EGD A;  3RKY A;  2OTL T;  2GGR A;  2LNH B;  1Q82 C;  2J6O A;  4EMK A;  5IHN A;  1VA7 A;  1KQ2 A;  4K11 A;  2H3E B;  3LWH A;  3CCJ A;  1VQ9 Q;  4OGE A;  2IVW A;  3QII A;  4M77 C;  4PJJ A;  4IUV A;  2JN0 A;  2M9U A;  1ACM B;  2WSE E;  4M77 G;  4PJL A;  1MMG A;  3GP8 A;  2LNV A;  1YNZ A;  1I5L A;  3OYD A;  4C0D B;  1M2V B;  4C5G A;  1Y96 A;  2Y4X A;  5L8R E;  2YUP A;  3A1P A;  2BE9 B;  3L2R A;  3PTA A;  1ZSZ A;  1Y7X A;  3G4S A;  5I21 A;  4ZN3 A;  1YIJ Q;  1VQM T;  4J5Y A;  4MZP A;  1VQP Q;  2QDY B;  1FMK A;  3M5A A;  2CUD A;  1TG0 A;  2GF7 A;  1X01 A;  1AZE A;  1MMA A;  3OYH A;  1QW1 A;  4N0A C;  4E7S A;  2RJE A;  4L59 A;  2JUF A;  2DPP B;  2YLB A;  2DYI A;  1JBM A;  4C0F A;  3CCL T;  4GBQ A;  5KCO A;  4E7J A;  1VQ6 Q;  4M7A C;  2ECZ A;  4LE9 A;  1WGS A;  4R55 A;  3X26 B;  3MEW A;  4M7A G;  1IO6 A;  4A4E A;  2OJ2 A;  4IUU A;  4QQ6 A;  3M57 A;  3SB2 A;  2WSF E;  4F7U B;  2E10 A;  1VUB A;  1LPL A;  4M78 E;  2DA9 A;  1Z9Q A;  4C8Q G;  4HCZ A;  2O4X A;  3CXC A;  2CYZ B;  3LGL A;  1K1Z A;  1MUZ A;  4UC4 A;  3CCQ Q;  4N4H A;  1TS9 A;  4BAC A;  1S72 T;  4XAX B;  1H3Z A;  4O5V A;  4C92 B;  4J7F A;  3UT1 A;  1K9M R;  4E47 A;  3EFR A;  3JB9 J;  2EQM A;  2HBP A;  2QQA A;  3UA6 A;  3UA7 A;  2OTJ T;  3CMA A;  1Q81 R;  4LXC A;  3CME Q;  1NPP A;  3MPU B;  2DRM A;  3EGD B;  2D6F A;  2WSC E;  1KD1 R;  1G5V A;  4ZGD B;  2COW A;  5LJ5 e;  4YTL A;  2RD1 A;  1PHT A;  7AT1 B;  2K3Y A;  1NYF A;  3S3O A;  2KI7 A;  3R6N A;  3CCL Q;  3JCM X;  3M9Q A;  2O31 A;  2RI2 A;  1ZBJ A;  3QDR B;  4M4Z A;  3ZEH A;  1O75 A;  3OS0 A;  2LDM A;  5FU7 C;  2R57 A;  1Y96 B;  3PMT A;  4PKC C;  1JB0 E;  3I55 A;  2HSE B;  3M0S A;  2VGN A;  3BW1 A;  3M0P A;  1OPL A;  1Q86 C;  5GAN e;  2DIG A;  1UFF A;  3OYY A;  2J6K A;  2DIL A;  3JCM f;  1BKB A;  1QVF S;  3NMZ C;  2DER A;  1Y71 A;  3OSV A;  1K73 C;  4LD9 K;  3I9Q A;  2F2W A;  1MMN A;  1X6B A;  4C8Q D;  4MZM A;  3L1A A;  1AWX A;  2HZY A;  3VUB A;  2GNC A;  1EFN A;  4JLG A;  3JCM V;  4PJO F;  3RES A;  1RAF B;  4JUV A;  5GMK m;  1UUE A;  2Y90 A;  1WQW A;  3CCU T;  5CKH A;  3OYJ A;  1C1A A;  4J9C A;  4OP0 A;  5GAM j;  1EZZ B;  5I11 A;  4RTV A;  4HCB A;  3ASK A;  3I56 A;  1MHN A;  1I5O B;  1ABO A;  4OB3 B;  3KXT A;  3RKW A;  2A3L A;  2DXU A;  2EYY A;  3VV0 A;  3MP1 A;  1UGR B;  5LJ5 h;  2I2L A;  4KGV B;  2PUO B;  1SPK A;  2KXC A;  2HMA A;  2L3R A;  5IHK A;  4FU6 A;  2K5F A;  5A0L A;  1D1B A;  2RNA A;  1YWO A;  1H64 1;  5CIU A;  3QHS A;  1EX4 A;  1KFZ A;  2YWW A;  3JCM c;  5A2Q E;  2PZ1 A;  2XK0 A;  2D8J A;  3X24 B;  2AHJ B;  2X35 A;  1KC8 U;  4M78 G;  1Q7Y R;  2IIM A;  2QEX T;  5FW9 A;  3CEY A;  3RMS A;  2R5M A;  4CC4 B;  5GAO q;  1D1C A;  5GAN h;  2GQV A;  2ZPF B;  4J83 A;  5I22 A;  1WHL A;  4XTU A;  3MET A;  1OPK A;  1QMC A;  3EHQ A;  4RMO A;  2ZZD A;  2KEA A;  5CKB A;  1M3C A;  3CC2 Q;  1N27 A;  2KMT A;  5CAI A;  2V1Q A;  5I2M A;  1Q81 C;  2KK4 A;  4JLI A;  3AT1 B;  2PTK A;  2BKD N;  1OU9 A;  2DD4 A;  1KD1 C;  2H8H A;  5ECA A;  5CK9 A;  2KY9 A;  1UEB A;  4OMP A;  3DB4 A;  1WHM A;  3EG9 A;  2VC8 A;  2DXB A;  3QBY A;  2MK5 A;  2FRW A;  4ZTF A;  2E70 A;  2H3J A;  3G71 T;  4JPB W;  5GJV B;  2CZ6 B;  1T0J A;  2FVU A;  3V8L A;  1IHV A;  2RF0 A;  1I0C A;  2FRY A;  2CRE A;  2HQH A;  4DA4 A;  2PVO B;  1WHK A;  3HTR A;  4BB7 A;  5LJ3 g;  1PKT A;  2FG0 A;  5D6X A;  3E2U A;  5HY6 A;  2KSS A;  1VQN Q;  3CC7 T;  1Y57 A;  3EH2 A;  1PM3 A;  5IHI A;  4V2S A;  1GBQ A;  1SHF A;  4M7D D;  1AWW A;  1I4K 1;  2QA4 A;  2O88 A;  2K5L A;  3TEE A;  1AT1 B;  2ZGW A;  4L6V 5;  2YHT A;  1VQ8 A;  3OYB A;  2JS0 A;  5A0G A;  1WHJ A;  3CCV Q;  4OB0 B;  2GFA A;  1CSK A;  3EFS A;  3PT9 A;  3M0R A;  1HJD A;  4PJO A;  3SFM A;  2DKG A;  1D0Y A;  3EG1 A;  1VQ7 A;  4EMH A;  2RK2 A;  2EBP A;  1YI2 T;  5DLO A;  3CXC S;  1CKA A;  1YJ9 T;  3FB9 A;  4BY6 C;  2PVD B;  1IRE B;  2DLP A;  1VQ5 A;  1SSF A;  2DET A;  1CKB A;  1M9S A;  4F14 A;  2D0N A;  4IUP A;  1R8O B;  3PMI A;  5GMK e;  1K8A R;  1ZA2 B;  2QTV A;  2V8K A;  3REB B;  3CC7 Q;  5FU6 B;  2ENM A;  2VAS A;  5KYW B;  2JNG A;  5DM7 R;  2RI3 A;  2K2V A;  3OS5 A;  4JJB A;  1Y0M A;  3A8G B;  5AT1 B;  1WA7 A;  1XQH A;  2DIQ A;  1M27 C;  4E7H A;  1OI1 A;  3BE3 A;  4CC3 A;  4RTZ A;  4OML A;  1ZA1 B;  2JT4 A;  1YJW Q;  5FRN A;  1GCQ C;  5IH2 A;  2DEQ A;  4F7U F;  2X3W D;  1NLP C;  4OMM A;  3FLG A;  4N0A A;  2RHU A;  1M5Q 1;  2EKH A;  1R77 A;  2L3Q A;  2Y4Y A;  5GAO n;  4QQG A;  3M55 A;  4C92 F;  5HK3 A;  1NBE B;  4XTY A;  2DJQ A;  3CD6 A;  3JCM g;  1IGQ A;  4C0Z A;  4QVC A;  2DRK A;  2L0A A;  4J6W A;  2CH4 A;  2EYZ A;  2YRV A;  1DJ7 B;  1VQO A;  3RER A;  2E4H A;  4ZGJ B;  4CRI A;  4ANJ A;  3M4G A;  1D0Z A;  3A8M B;  4C5I A;  2X4Y A;  3J80 E;  3MJX A;  3INZ A;  1VOM A;  3VUZ A;  2P4R A;  2DF6 A;  4PJM A;  1M90 U;  2HEQ A;  1YJN A;  2YRD A;  3TSW A;  3JB9 D;  2HDA A;  2HQX A;  2J6F A;  2XHC A;  5GMK h;  1KQS S;  2E6Z A;  5KYY B;  2O2O A;  2FB7 A;  3UDC A;  3G7Z A;  3DLL A;  1M1K U;  2JS2 A;  4E7L A;  4M77 B;  5LJ3 d;  2JMC A;  3QJY A;  2KNB B;  2C0T A;  5GAO m;  1W6X A;  3CCS Q;  2K3X A;  3OYE A;  2R5A A;  4CI0 C;  1AWJ A;  3NTH A;  3PFS A;  5EC7 A;  2P84 A;  3RUX A;  4QVD A;  3DKM A;  2OAU A;  4P5N A;  2DE0 X;  1YHQ A;  1PSE A;  2HCK A;  3MP6 A;  2J7I A;  1RAG B;  3MP8 A;  1M2V A;  2QTX A;  2AIR B;  2M16 A;  3V7C A;  1LJO A;  4WTO B;  4KH0 B;  1FXX A;  2FYK A;  2KRS A;  4F17 A;  3NGP A;  4RTT A;  2DJZ A;  5AYF A;  1WJS A;  1VQK T;  3HHT B;  1YIT Q;  2XMF A;  1M3B A;  1J3T A;  3HPW A;  2DX1 A;  2LP5 A;  3JB9 F;  1WJQ A;  1SSH A;  4M75 C;  3V7R A;  3OYK A;  2K3B A;  4JZ3 A;  1VQL A;  2RK1 A;  1R0B G;  3KBG A;  1QLY A;  4KUD K;  2FL7 A;  4XU2 A;  4M7A B;  2PQW A;  3PNW C;  2VUB A;  2DD5 A;  3OYM A;  3MHX A;  1VQ9 T;  3GBQ A;  2E65 A;  3QZ5 B;  3CC4 Q;  1Q95 G;  1G3Y A;  5KYN A;  1RAC B;  5CKD A;  4BI3 A;  4F7U A;  2DK3 A;  4PFP A;  4DQ2 A;  2CP5 A;  5GAM g;  2L89 A;  1B34 A;  1KHC A;  3C4S A;  3OYF A;  3G4S T;  1TUC A;  4J6Y A;  1QVF P;  2BTT A;  2JJ9 A;  3CCE Q;  1VQ4 Q;  1LVK A;  4C92 A;  1PG5 B;  1NEG A;  4BI4 A;  2DBM A;  2E12 A;  3LH0 A;  1C0M A;  1K9M U;  3JCM W;  4BD3 A;  1VQP T;  2DXC A;  1D1A A; 
#chains in the Genus database with same CATH homology
 1O75 A;  3OS0 A;  2LDM A;  1MGQ A;  5FU7 C;  2R57 A;  1Y96 B;  3PMT A;  1OYX A;  2KDS A;  4PKC C;  3JCM e;  1JB0 E;  3I55 A;  2MWP A;  5GAM e;  3URG A;  2E1H A;  4EPC A;  1FX7 A;  2BIV A;  4OMF B;  3LX7 A;  4VUB A;  3JB9 H;  2LVM A;  2M1H A;  2CS7 A;  5J3B A;  4X9C A;  4BDZ A;  2VGN A;  1U1T A;  3BW1 A;  5FU7 B;  1YIT T;  5CR2 A;  1Q86 C;  5GAN e;  5GAO r;  2DIG A;  4PJO E;  2P0K A;  3OYY A;  4HCC A;  2DVE A;  4MDW A;  2LT1 A;  3JCM f;  4HT9 A;  1BKB A;  3NTK A;  1VQ6 T;  5GAM f;  1QVF S;  4NS5 A;  2EQK A;  5CCA A;  1Y71 A;  3OSV A;  1K73 C;  4LD9 K;  3GF5 A;  2VV5 A;  3E9G A;  3E19 A;  3M58 A;  1Q86 U;  3KUF A;  4C8Q D;  1BI0 A;  3QO3 A;  4MZM A;  3L1A A;  3M53 A;  3OQ5 A;  3VUB A;  5LJ5 j;  2CKK A;  5GAN 7;  2G3R A;  2NLU A;  1VQN A;  4OB2 B;  1O9S A;  3OB9 A;  4JLG A;  3SD4 A;  3OMC A;  1K73 U;  1HXD A;  1LNX A;  4J7I A;  4MZT A;  3JCM V;  2P0Q A;  4PNO A;  4PJO F;  3RES A;  3LLR A;  3CCQ T;  2LX9 A;  1BI2 A;  4M78 D;  1NZ9 A;  4JUV A;  2XKO C;  2D0Q B;  4N4I A;  5GMK m;  5CQY A;  2XID A;  2Y90 A;  3Q1J A;  1WQW A;  3CC4 T;  5CKH A;  3OYJ A;  3CCU T;  3OS1 A;  3M4Y A;  3BY7 A;  5J26 A;  3N5B B;  3JAM E;  3ZFJ A;  3CCV A;  2RJC A;  3FC3 A;  3CD6 T;  4KBM B;  4OP0 A;  4RCB A;  2L5Q A;  2QI2 A;  5GAM j;  4L5G A;  3X25 B;  1FWZ A;  5CKE A;  1VQO T;  4HCB A;  3NFC A;  3ASK A;  3I56 A;  3CME T;  4EMG A;  1MHN A;  2JTF A;  1QVG S;  2EYQ A;  2EQU A;  2CZ0 B;  4JS5 A;  4Z02 A;  3P8D A;  3E9F A;  3FIF A;  4RCC A;  3CCE T;  1VQ4 T;  3LGF A;  1ZHI A;  4OB3 B;  3KXT A;  3RKW A;  2A3L A;  4M7A B;  2DXU A;  3VV0 A;  4MDX A;  4JRI A;  1YIJ A;  3X20 B;  3MP1 A;  4IUT A;  2MAM A;  4KT0 E;  1OZ2 A;  1UGR B;  4OVA A;  1WNL A;  5LJ5 h;  2I2L A;  4LDV A;  3TRE A;  2PUO B;  4M7D E;  1YJN T;  2L3R A;  3J81 E;  2K57 A;  2RO0 A;  4FU6 A;  1W2B A;  2K5F A;  4C8Q C;  2EJ9 A;  1YBY A;  4BI8 B;  2PUK B;  3BDL A;  5A0L A;  5J39 A;  2OTL A;  1KC8 C;  3X28 B;  3CCJ T;  1H64 1;  4X34 A;  4F7U E;  4M75 E;  5CIU A;  1B34 B;  2MI6 A;  3PGG A;  3QHS A;  2RJD A;  4C8Q B;  2RM4 A;  2EWN A;  3OYG A;  1XNI A;  2QQ9 A;  3JCM c;  3JCM h;  5A2Q E;  2XK0 A;  3X24 B;  4HT8 A;  5GAM h;  2AHJ B;  3MO8 A;  3VJP A;  3A8L B;  2P4T A;  2X35 A;  1KC8 U;  4M78 G;  4ELZ C;  2RH2 A;  4M7D F;  2V8I A;  1WQ7 A;  2IG0 A;  2QEX T;  4XTX A;  5HKC A;  3CEY A;  3RMS A;  1NE8 A;  1N6A A;  2JVV A;  2R5M A;  5GAO q;  2EIF A;  5GAN h;  4JRQ A;  4PJO D;  3WXM B;  1WPY A;  3DB3 A;  2RJF A;  2GQV A;  2XI9 A;  4XTV A;  4B9W A;  2R58 A;  2ZPF B;  4M78 F;  3AHU A;  1YJW A;  2RHZ A;  4J83 A;  2K5I A;  2WAC A;  1TH7 A;  2DTO A;  5KCH A;  4XTU A;  3VU3 C;  3C12 A;  5LJ5 d;  1Q7Y C;  2M0O A;  3FDR A;  4C5E A;  3MET A;  4C8Q A;  1JJ2 A;  4RMO A;  2ZZD A;  5GAO l;  1KHI A;  3FEO A;  5CKF A;  5CKB A;  4KUI A;  1N27 A;  2K4Y A;  3GIB A;  2KMT A;  3CPF A;  4LD6 A;  4D6W A;  5CAI A;  3L42 A;  5I2M A;  1Q81 C;  4XK8 E;  2KK4 A;  1Q7Y U;  4M78 A;  4JLI A;  1N9R A;  1KQS S;  2XDD A;  1G3W A;  1VQM A;  2BKD N;  1X6O A;  4HKE A;  2DD4 A;  1KD1 C;  5LJ5 f;  3OBW A;  5CK9 A;  3EAE A;  2KY9 A;  4WF2 A;  2QQS A;  5A0D A;  1UEB A;  3JCM d;  5GAM d;  3PIP A;  4JRP A;  1Q81 U;  3DB4 A;  2VC8 A;  2CZ7 B;  2BUD A;  3GNG A;  1LOJ A;  1M1G A;  2DXB A;  3QBY A;  4NOY A;  2HAX A;  4XU3 A;  4ZTF A;  4LDX A;  2X4W A;  2E70 A;  2H3J A;  5GAN d;  1KD1 U;  3G71 T;  3JCM J;  2CZ6 B;  1VQK A;  4R56 A;  2LRQ A;  3RMQ A;  1G3S A;  1QP3 A;  2FVU A;  3V8L A;  1V29 B;  2EKO A;  4B9X A;  4DA4 A;  3S3M A;  4RG8 A;  2DTI A;  2F5K A;  3CCL A;  1VQL T;  2PVO B;  1OZ3 A;  3M54 A;  4BB7 A;  2GCX A;  5LJ3 g;  5D6X A;  4PJO C;  2DZC A;  2HNI A;  5HY6 A;  2KSS A;  4JDS A;  4M77 E;  3R6O A;  4PJO G;  4ZN1 A;  3OW2 A;  3CC7 T;  3QYH B;  5GAN f;  5GAN 4;  4V2S A;  4M7D D;  5GMK i;  1I4K 1;  4PJO B;  4OB1 B;  2QA4 A;  4FM4 B;  2K5L A;  1UGS B;  1M8V A;  2CGH A;  3TEE A;  2ZGW A;  2YLC A;  2JTM A;  1VQ9 A;  4L6V 5;  2DZ9 A;  4BUG A;  1I81 A;  2RB6 A;  2YHT A;  1S72 A;  1VQ8 A;  3OYB A;  1G3T A;  2DO3 A;  5A0G A;  3OYA A;  3OYI A;  2C06 A;  4M75 D;  2X4J A;  4ATO A;  3BDU A;  4OB0 B;  3UWN A;  2GFA A;  3CPW A;  4ME7 A;  4QW2 A;  3OMG A;  3SDZ A;  3CMA T;  4M77 F;  5LJ3 e;  3EFS A;  3PT9 A;  2D9T A;  4OF1 A;  3G6E A;  3S3N A;  1W2B S;  3RKX A;  3BFM A;  5EG2 A;  3OS2 A;  1KQ1 A;  2OTJ A;  4PJO A;  4A4K A;  3CCS A;  3SFM A;  2DKG A;  4MML A;  2EFI A;  1Y07 A;  1VQ7 A;  4N4G A;  2RK2 A;  3VKI A;  4EMH A;  2E5Q A;  1YI2 T;  1I8F A;  5DLO A;  3L2Q A;  3CXC S;  5GAN j;  1KQS A;  2QXF A;  4NL3 A;  1YJ9 T;  3FB9 A;  2LCC A;  3HFO A;  4BY6 C;  2EQJ A;  2PVD B;  1IZ6 A;  3CC2 T;  1IRE B;  5LJ3 f;  3GNF B;  3ZBD A;  1VQ5 A;  4E7I A;  1SSF A;  3CBO A;  5IAY A;  1M9S A;  1ZBX A;  3MEA A;  2DTH A;  2PU9 B;  3FRN A;  4II1 A;  2QQB A;  4J8O A;  5FU6 C;  4A4H A;  5GAN 8;  1QVF A;  2XU8 A;  2XIC A;  5FRO A;  4LDW A;  4BY6 B;  3RIR A;  4IUP A;  1R8O B;  3PMI A;  3QXE B;  5GMK e;  1VQP A;  4RKU E;  2V8K A;  1BI3 A;  4J6X A;  3P8H A;  3I55 T;  1YCY A;  5FU6 B;  3PIO A;  1UGQ B;  4M7D C;  1BIB A;  2JNG A;  5FRM A;  1XTD A;  5DM7 R;  2RI3 A;  2K2V A;  3OS5 A;  1W4S A;  3ER0 A;  4M7D G;  3A8G B;  1XQH A;  4Y28 E;  4M7A E;  2DIQ A;  3LYI A;  4A4G A;  2MMP A;  1K8A C;  3CBM A;  4M78 C;  4PLL A;  1YIT A;  2ZPG B;  4M7D B;  5GAN 6;  2XDB A;  4E7H A;  1OI1 A;  4C8Q E;  5LJ3 j;  3OBY A;  4A4F A;  4F7U G;  5I2S A;  3CCR A;  5KE3 A;  4M75 G;  2V8J A;  1VQ6 A;  4C92 E;  2RHI A;  4M78 B;  2DAQ A;  1XOV A;  3SWN C;  1K8A U;  2KAF A;  5FRN A;  3QUI A;  4C0G A;  1VQN T;  3OYC A;  3S6W A;  2VGM A;  4A54 A;  3QKJ A;  1NJI C;  2DEQ A;  4F7U F;  4M75 F;  3ME9 A;  1BI1 A;  3SWN B;  3HFN A;  4C92 G;  2E6N A;  3TCJ A;  2LTO A;  3QYG B;  3GPL A;  4M7D A;  1VQ8 T;  3FLG A;  2RHX A;  4M77 D;  3TU4 K;  4N0A A;  2GFU A;  2RHU A;  1M5Q 1;  3CCQ A;  4OGC A;  4IKF A;  3L2Z A;  3MEU A;  1NJI U;  5GMK j;  2Y4Y A;  2EJF A;  2ZCF B;  3C95 A;  3E1S A;  4Q5W A;  4QQG A;  3M55 A;  5GAO n;  4C92 F;  1VIE A;  3CCU A;  3CCV T;  3CC4 A;  5C0M A;  4RG2 A;  3G6E T;  4KUL A;  4M75 A;  3HRU A;  5LL6 S;  1M4Z A;  4XTY A;  1X75 C;  3JCM Q;  4BE2 A;  1N8R C;  3JCM g;  4C0Z A;  4QVC A;  2ZPB B;  5GMK l;  4EMK C;  3CD6 A;  3I56 T;  4J6W A;  2YRV A;  2EAY A;  1DJ7 B;  1VQ7 T;  2F69 A;  1VQO A;  3SWN A;  3CME A;  3RER A;  1RL2 A;  4FIB A;  3O8V A;  2XD0 A;  4BDY A;  4ZGJ B;  4Y91 A;  5LJ3 h;  4CRI A;  1N8R U;  3A8O B;  2B8A A;  4EMK B;  2QQR A;  1M1F A;  1M90 C;  1P92 A;  3CCE A;  1VQ4 A;  3M4G A;  1YIJ T;  3A8M B;  4C5I A;  2RA2 A;  2X4Y A;  3MEV A;  3V8K A;  5GAN 2;  1QP2 A;  3A5Z B;  3J80 E;  2EJG A;  3CPW S;  2P0P A;  3A8H B;  4JJN K;  5IT9 E;  3INZ A;  3J7A F;  2E64 A;  3VUZ A;  3V7S A;  4BE0 A;  4TVR A;  3OY9 A;  3HL8 A;  1AHJ B;  5DLQ E;  1M90 U;  1YJN A;  3OYL A;  3L2V A;  2DXT A;  2LC4 A;  4XU1 A;  3RKY A;  2OTL T;  3JB9 D;  1Q82 C;  1M1K C;  2VYT A;  3P8B B;  2HQX A;  3FJP A;  4EMK A;  1KQ2 A;  3OA6 A;  4C5H A;  2XHC A;  2ZPI B;  2E41 A;  5GMK h;  3LWH A;  4DOW A;  3CCJ A;  2E6Z A;  2IVW A;  3HRS A;  2LQK A;  4OGE A;  3QII A;  4M77 C;  3T9N A;  4ZTJ A;  2FB7 A;  3QJ6 A;  4IUV A;  3UDC A;  2JN0 A;  4C0D C;  3G7Z A;  2ZPH B;  4XTW A;  1HK9 A;  3JB9 I;  2M9U A;  3GOX A;  3DLL A;  4EDU A;  2WSE E;  5GAN 5;  4M77 G;  3L2U A;  1Q82 U;  3GP8 A;  1M1K U;  2LNV A;  2A7Y A;  3V8J A;  3CCR T;  3JRZ A;  3C94 A;  4M7A D;  4E7L A;  1I5L A;  3H6Z A;  2ZPE B;  4M77 B;  3OYD A;  5CO7 A;  5LJ3 d;  3CCM A;  4C0D B;  4C5G A;  1RI0 A;  1Y96 A;  2CZ1 B;  3QJY A;  2Y4X A;  5KE2 A;  2QEX A;  3QSU A;  5L8R E;  3L2W A;  5GAO m;  1KG1 A;  2K3X A;  3WVD B;  3OYE A;  4DOV A;  2R5A A;  4CI0 C;  3L2R A;  4E7J A;  1YJW T;  3NTH A;  3PFS A;  3PTA A;  5FLX E;  3RUX A;  4QVD A;  4C92 D;  4BE1 A;  1Y7X A;  3DKM A;  3G4S A;  2XDP A;  2LCL A;  2OAU A;  5I21 A;  4P5N A;  3VYG A;  1YHQ A;  5CVI A;  4FT2 A;  4ZN3 A;  3LWI A;  1PSE A;  3JCM P;  2PVG B;  3MP6 A;  5IN1 A;  1U1S A;  4M77 A;  4X9D A;  3MP8 A;  5GAO p;  4IUQ A;  4PLI A;  1VQM T;  4J5Y A;  4MZP A;  2QDY B;  2QTX A;  1WJR A;  4LDY A;  3WVE B;  2M16 A;  4FSX A;  2O01 E;  2X4X A;  1LJO A;  4LDU A;  3M5A A;  3V7C A;  4HA8 A;  2GF7 A;  3HRT A;  1FXX A;  1X01 A;  1BIA A;  2FYK A;  1BYM A;  1VIF A;  2FHD A;  3OYH A;  2DJZ A;  1QW1 A;  3M59 A;  3JB9 G;  2L8D A;  2JOY A;  2JZ2 A;  4N0A C;  5AYF A;  4ELY C;  1JJ2 S;  1WJS A;  1VQK T;  3HHT B;  2LQ8 A;  2O4X B;  2RJE A;  4L59 A;  2KVQ G;  2JUF A;  2DPP B;  2YLB A;  3G71 A;  1QVP A;  1JBM A;  4C0F A;  3UPU A;  3CCL T;  3HPW A;  5D6W A;  2KQW A;  4QQD A;  3VYH B;  1WJQ A;  2LT4 A;  3CBP A;  4M75 C;  3V7R A;  5KCO A;  3OYK A;  4NL2 A;  2MWO A;  3OSS C;  4M7A C;  1WGS A;  4QVZ A;  4R55 A;  1VQL A;  1GXI E;  3X26 B;  2RHY A;  2RK1 A;  3MEW A;  1EIF A;  1N9S A;  4M7A G;  2VXF A;  4A4E A;  4IUU A;  3KBG A;  4QQ6 A;  5C6S A;  4KUD K;  2FL7 A;  1UB4 A;  3M57 A;  3SB2 A;  2WSF E;  4F7U B;  4XU2 A;  2E10 A;  3MCA B;  4M75 B;  3QZ9 B;  1VUB A;  2F5T X;  3DLM A;  3GLX A;  2PQW A;  3QG1 A;  3PNW C;  4M78 E;  4C8Q G;  4XQ3 A;  3CC7 A;  4C92 C;  2QA4 T;  4HCZ A;  2O4X A;  3HSB A;  5LJ5 g;  2VUB A;  2HQE A;  1QVG A;  3NTI A;  4XTZ A;  2DD5 A;  3JSC A;  3MHX A;  2CYZ B;  4PL6 A;  3LGL A;  3OYM A;  3CXC A;  4M7A F;  1VQ9 T;  4UC4 A;  2E65 A;  3HKS A;  4N4H A;  4XU0 A;  2MF2 A;  3JB9 F;  5CQX A;  4BAC A;  1S72 T;  4XAX B;  1H3Z A;  4O5V A;  3QZ5 B;  1PSF A;  4C8Q F;  4MMK A;  4C92 B;  4J7F A;  1U8R A;  1NPR A;  3UT1 A;  3CCM T;  4E47 A;  3EFR A;  1G3Y A;  3JB9 J;  5HK0 A;  4IUR A;  5CKD A;  3F70 A;  4JS4 A;  1D3B B;  5D6Y A;  2VXE A;  2EQM A;  4BI3 A;  4F7U A;  2XG8 D;  2DK3 A;  2HBP A;  1UGP B;  4ZGE B;  4M7A A;  2QQA A;  2OTJ T;  4DQ2 A;  3CMA A;  3JCM b;  4GLK A;  3CCS T;  1ZQ1 A;  1NPP A;  5GAN 3;  5GAM g;  3OW2 S;  3LW5 E;  2L89 A;  1B34 A;  1KHC A;  4A53 A;  3C4S A;  3OYF A;  3HP9 A;  3G4S T;  5DY9 A;  3M56 A;  1K9M C;  4J6Y A;  2D6F A;  2WSC E;  1G5V A;  4ZGD B;  1YHQ T;  1YI2 A;  5LJ5 e;  5KH6 A;  5M9O A;  5GAN g;  4YTL A;  4C92 A;  2RD1 A;  4FL6 A;  4GY5 A;  2K3Y A;  1YJ9 A;  4JRK A;  4BI4 A;  3S3O A;  1VQ5 T;  3QPH A;  1JRI A;  4O6J A;  3CC2 A;  2E12 A;  3LH0 A;  3JCM X;  1D3B A;  3H8Z A;  1K9M U;  3JCM W;  4BD3 A;  3OYN A;  2HD0 A;  2RI5 A;  3M9Q A;  2RI2 A;  4E7K A;  3QDR B;  1VQP T;  2DXC A;  4FT4 A;  3ZEH A;  5HK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...