4QQGA

Crystal structure of an n-terminal htatip fragment
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and histone binding studies of the chromo barrel domain of TIP60.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT5
total genus 10
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qqgA00
4RG2A 2EQUA 3OYNA 3OYFA 3S3NA 4BE0A 2DIGA 2R57A 4NS5A 5KE2A 5KH6A 1MHNA 3L2UA 2GF7A 2RJEA 4B9XA 3OYBA 1KHCA 2RHIA 2O4XA 3P8DA 4IKFA 3MEUA 2FHDA 1OZ2A 4C5HA 2RHUA 3OA6A 2CKKA 3QKJA 4II1A 3UT1A 5C6SA 3LH0A 4C5GA 2EQMA 4QW2A 4X34A 3OYIA 3F70A 2E6NA 2L8DA 2BIVA 4FL6A 3ZEHA 3C4SA 2X4WA 2D9TA 2LRQA 3Q1JA 5J26A 1WJRA 3OYKA 5D6WA 4QQ6A 4OVAA 4A4EA 2O4XB 2RJDA 2R5MA 5KE3A 4N4IA 2IG0A 3H8ZA 2X4YA 4A4GA 2JTFA 3DB4A 4BACA 2RHZA 3LGFA 2EFIA 2M1HA 4GY5A 3OY9A 3OQ5A 2E5QA 2VYTA 3OYAA 3P8HA 3MEWA 3DLMA 3PFSA 4A4HA 3S3MA 2M16A 2DIQA 3O8VA 4E7IA 3L2RA 4PLLA 1G5VA 3M9QA 3OS0A 2LVMA 2LCCA 4IUTA 3OYMA 1WJSA 3GOXA 4HCZA 3OYCA 3NTIA 2JZ2A 2RJFA 2K3XA 4FU6A 4BE2A 3QBYA 4B9WA 2B8AA 3DB3A 4BDYA 3OS2A 5J39A 4IUUA 2MWPA 4C5EA 2L3RA 4LD6A 1WJQA 2LTOA 3OB9A 5IN1A 3L2VA 2YRVA 5KCOA 4ZTFA 2RI2A 2GFUA 3E9GA 5D6XA 2LDMA 2M0OA 3PNWC 2DAQA 3L42A 3MEAA 5KCHA 3OS1A 3S3OA 4UC4A 2RI5A 3OYGA 5FRMA 3OYJA 2F5KA 4N4GA 2HQEA 3ME9A 3MP6A 4BD3A 2RO0A 2RHXA 2RI3A 3LGLA 3OYLA 3ASKA 3E9FA 3MEVA 5M9OA 2X35A 3FDRA 3OMGA 5IAYA 4PL6A 2K3YA 3CEYA 3FEOA 4CRIA 2MWOA 4BE1A 4Z02A 4E7LA 3L2WA 2GFAA 3LX7A 2HQXA 4E7KA 1OI1A 2RJCA 3QIIA 4IURA 4BDZA 1H3ZA 5D6YA 3MO8A 4A4FA 2X4XA 2WACA 4L59A 2R5AA 2EQKA 4Q5WA 4E7JA 1SSFA 2NLUA 3H6ZA 4C5IA 3LYIA 3QJ6A 4PLIA 3BDLA 4EDUA 3PMIA 2PQWA 1N27A 3EAEA 2RHYA 3OYDA 3OYHA 4ZTJA 1OZ3A 4IUQA 4QQDA 2L89A 3OYEA 4IUPA 4E7HA 2EKOA 1OYXA 1WGSA 3FLGA 2G3RA 3S6WA 3NTKA 2XDPA 3FC3A 3META 3L2QA 2P0KA 5FRNA 4QVZA 2QQSA 3NTHA 3OMCA 2R58A 2QQRA 4N4HA 2EQJA 3SD4A 5CIUA 3PMTA 1XNIA 3UWNA 3MP1A 3MP8A 2BUDA 2XK0A 3KUFA 2BKDN 3LLRA 4IUVA 5FROA 4QQGA 5C0MA 1RI0A
chains in the Genus database with same CATH superfamily
1PKTA 2NUTB 4JJCA 1KHCA 4M75B 1W4SA 3E2UA 1NLOC 2K6DA 5GMKj 4PNOA 5IT9E 1BK2A 3JB9J 5CO7A 1D3BA 3QJYA 1JJ2S 3M0QA 2LRQA 1X6OA 1M1FA 4XTUA 1Z9QA 4J9IA 2HBPA 3FIFA 5GANd 5GAN8 2QYZA 2K79A 2M1HA 3OY9A 1Y7XA 2LQ8A 2RK1A 2RF0A 4KUDK 3MEWA 2XKOC 2E70A 4VUBA 1YCYA 3OYCA 2JZ2A 2LJ1A 1KQSP 1JJ2A 1IHVA 4FSXA 2D1XA 3I5RA 3OS2A 1WIEA 1K8AU 2V1RA 4C92A 1QKXA 5LJ5j 5CAIA 1U06A 4UC4A 1X75C 1HD3A 2NWMA 1TS9A 3CC4T 2CP0A 4FYXB 1U5SA 1VQMT 3EG2A 4Y91A 4E7KA 3KFVA 3EFOA 5D6YA 3MO8A 3I55A 1X01A 3RKYA 1YFNA 3QG1A 2GGRA 2CP5A 1RLQC 4DEXA 5GAOr 4E7SA 1M4ZA 4C92F 4ANJA 3HL8A 2QTVA 1UG1A 3FLGA 4OMLA 2P0KA 2A0FB 3CPWS 2DILA 4OB0B 2HL3A 1JBMA 5L8RE 5LL6S 1Q81U 2ZPFB 3QXEB 2BKDN 1GCQC 1QLYA 3M54A 5GMKi 3CCRQ 2QQBA 2MMPA 3S3NA 4J8OA 3QWXX 1Q86U 1KIKA 1C1AA 3JCMb 1YBYA 4JLIA 3JCMV 3CCSA 1W2BA 1VQ6Q 2RHUA 3CBPA 2EYXA 4X9DA 5CKBA 2QEXT 4JJBA 4QKUA 1VQ5T 3F70A 1NEGA 1S72Q 1Q82C 4DQ2A 1VQOQ 4CC3A 4JJDA 1SHGA 1VQ8A 4N4IA 5GAN5 5I2MA 1YJNT 1V1CA 2L2PA 4FSSA 4ZGJB 1IRXA 2J6KA 2E5QA 2KDSA 1K76A 2E64A 4AFZC 3L2RA 1TSFA 1UFFA 1SRLA 2LCCA 3G6ET 1BB9A 1M2OA 2RQUA 4F7UG 1YJ9A 4B9WA 2KT8A 1N9SA 5GAMj 2DXUA 2V8JA 2B86A 3HRTA 5GMKh 5HY6A 1BI1A 1PRLC 2GQIA 4JRIA 4MMKA 1D1CA 3CCQA 3EFSA 3SEMA 4FT2A 3PGGA 4J9FA 4ZN3A 1VQOT 3QUIA 3GNFB 2X3XD 3FJ5A 3VS1A 1W2BP 3EFOB 2I0NA 1IGQA 4CRIA 2VGNA 2MWOA 4Z02A 3M5AA 2LT1A 5I22A 4JJNK 4D6WA 1IHWA 2K2MA 2W10A 2X4XA 2OAWA 3ULRB 3GIBA 3WXMB 3LYIA 2RN8A 2HBWA 2KBTA 2VKNA 1YJNQ 1GXIE 2H3EB 4E47A 2DXCA 1K0XA 2DXBA 1K8AC 1QVFA 3S6WA 2CP6A 1K4US 2R58A 3VUBA 2AT1B 5GMKm 3SDZA 2QEXA 4HVUA 1G3TA 4JZ3A 2XDBA 2BUDA 3KUFA 5FU6C 1PSEA 2DZ9A 2FZCB 3PVQA 1ABOA 3CC4Q 3G1JA 1EX4A 5CQXA 5GAN6 2CSQA 1WA7A 1BIBA 2COYA 2AK5A 4XU0A 2O4XA 1UE9A 3X25B 4BI3A 4C8QE 4HKEA 3UT1A 5C6SA 5CVIA 3LH0A 1HJDA 1AWXA 3HRUA 1JB0E 1MUZA 2E6NA 4C0GA 3CCJT 2K2VA 3JCMJ 1CKAA 1QKWA 1FYNA 1UJ0A 3VUZA 2V8IA 1KQ1A 1Z9ZA 3VRYA 4QQ6A 3SWNC 4DEYA 1B07A 2XD0A 3CPWP 2RQRA 4KT0E 2YUOA 3NTIA 3SFMA 3A8GB 4J9DA 1Q82U 4BDYA 3JB9I 1WHMA 2QAZA 4J7IA 4E7ZA 3MEAA 4WF2A 1I8FA 4C92C 2EJFA 1Q7YU 1VQ6T 1Y71A 1VQ8Q 3R6OA 2EYYA 3C0CA 3CCUQ 4PL6A 1NZ9A 4BDZA 1WXBA 2L3SA 5KYXB 3CCST 3H6ZA 4RTUA 2KYBA 3A5ZB 3AT1B 4R56A 1QCFA 5I21A 3MPUB 4HT9A 1XQHA 4ELYC 2OI3A 4M77D 4E7HA 1G3WA 2VVKA 2D8HA 3UF4A 2CZ6B 4O5VA 4CI0C 2QQSA 3NTHA 3GPLA 2QXFA 4E6RA 1QVFS 4XTXA 4F14A 5CK9A 3G4SA 1KQSS 2XK0A 2YUNA 3G71Q 4C8QA 2QEXQ 3BW1A 1GCQA 5KH6A 1MMNA 5KE2A 1MHNA 1G3SA 2KVQG 2O9VA 2GF7A 1O9SA 1V29B 2EKHA 5I11A 4FYVB 2DL7A 2RHIA 1I5LA 2F5TX 4PJOD 1WDXA 2JTEA 5HCKA 2V1QA 5DY9A 2K57A 2D9TA 3Q1JA 2HL5C 3THKA 4J6WA 1K9MU 1M1KU 1X6GA 1KJWA 2LX7A 2O4XB 4M7DE 1TOVA 2GNCA 1UHFA 2COZA 1UECA 2DM1A 3LGFA 2EFIA 4X1VA 4MZPA 2A7YA 3M53A 3G71T 2F1LA 3QZ9B 5LJ3g 3GOXA 1D0YA 3ZBDA 4RTZA 4JRQA 4BE2A 2A37A 1VQLQ 2E5KA 5CKDA 2DXTA 2KAFA 1Q7YR 1UJYA 1ZSZB 3OS1A 4AMCA 4J9GA 4OF1A 3FRNA 4RMOA 1YNZA 4L6V5 1H92A 2X35A 5IAYA 1YN8A 1N6AA 3VS4A 2RM4A 3VS2A 2IPOB 3QIIA 1W2BS 4J9EA 1PWTA 1AOJA 3PIPA 4J9CA 4C5IA 5A0LA 1W70A 4LDXA 1KG1A 2J6FA 1S72A 1LOJA 4M75A 4PJOA 2JVVA 3OYHA 4ZTJA 2YRDA 2CDTA 2OTJT 1NYFA 1TH7A 1WGSA 3TSWA 1VQ4T 2XDPA 4C0DC 1UEBA 3PE0A 2RA2A 4N4HA 2DTHA 2FVUA 4RTVA 3RKWA 2HD0A 1A0NB 3LLRA 2PU9B 3M0SA 8ATCB 3CCJA 2DLPA 2KSSA 3QYHB 1I4K1 1E6GA 5IH2A 4E2FB 1I81A 2FHDA 3QDFA 3M56A 4M7DB 4X34A 2Y90A 1NLPC 2FZGB 1N8RR 5GAMh 4OMOA 1CSKA 1UGPB 1K1ZA 3SWNA 2W0ZA 3J80E 2HKNA 3RMQA 3A8HB 1B34A 3CPWA 3M4YA 2F2XA 2FB7A 5GAOp 4LDVA 1M9SA 1AZEA 1GBRA 1WJSA 1SF9A 4RUGA 3OSVA 3AHUA 2QDLA 2P0QA 1VQ9Q 4IUUA 2PUKB 5KCOA 3TREA 2GFUA 2FRYA 2RI2A 2KGTA 2DAQA 4IIOA 1X69A 1TUDA 1B3QA 2XI9A 3HKSA 3OYGA 4ZGDB 1TUCA 1GBQA 4RTXA 3X28B 4XTZA 1ZHIA 1VQ7Q 3R6NA 1VQMQ 1WFWA 3CPFA 1YWPA 2XU8A 4C0ZA 2GFAA 1YI2A 3JCMW 2DA9A 3G4ST 3C95A 1M1KC 4HVWA 1R0CB 1TG0A 4F7UA 1K9AA 2PQWA 3I56A 1C0MA 1N27A 1XJWB 4X9CA 5AYFA 4LUDA 5D7UA 3SHWA 3TQ7P 3EHQA 3CCLA 5FLXE 2M51A 2OTJQ 1RL2A 3L1AA 4EMKC 2ZPIB 4J83A 3LH5A 3A98A 5FWCA 1EZZB 2OTLT 1HK9A 3RUXA 2DO3A 4M7AC 2FPEA 4C5GA 4XAXB 4QW2A 3KBGA 5AT1B 1BBZA 5KYYA 2SRCA 1YHQA 3C4SA 2AKLA 1WJRA 1VUBA 4A4EA 2OTLA 2RH2A 2NUZA 3H8ZA 4O6JA 4A4GA 1U3OA 4M77A 1LJOA 2VYTA 1VQPA 1WXTA 2MIOA 3S3MA 2M16A 1VQKA 1YITQ 3CCVT 2ED1A 3CCLT 3RMSA 1OQKA 1X43A 4DBHA 3VS0A 4F04B 3A1PA 4OMFB 2AIRB 4LD6A 2VV5A 3OB9A 1DJ7B 1R8OB 5GANe 5KCHA 2ZAEA 3HSBA 2O88A 2LP5A 4ME7A 1D1BA 3ZFJA 3CMAA 3RR6A 3V7RA 2JMCA 1OI1A 3CCET 4ELZC 2O01E 5KYXA 2Y4XA 4JDSA 4MMLA 3BY7A 4QQDA 2CREA 2GQVA 3WVDB 1ZQ1A 2ZPHB 1YITT 1LNXA 2KRSA 3OMCA 1N9RA 5I2SA 1ZSZC 5CIUA 2PNIA 1HYOA 1EIFA 1ABQA 3MP8A 5GAN7 3RBBB 1OZ2A 3OYNA 4NL3A 3CCEQ 1OEBA 3CBOA 4PJOG 5LJ3j 2E4HA 3GNGA 2KI7A 1X2QA 3QPHA 4OB1B 1UDLA 3MEUA 1UTIA 1M90C 3CCQT 2KE9A 2DYIA 2LNHB 3CCUT 3HTRA 3M57A 1UGQB 4L5GA 3CCQQ 2JJ9A 5J26A 3TCJA 1WHKA 2ABLA 2X4JA 1YJ9T 1JJ2P 1IO6A 1LCKA 3EG9B 2XIDA 2CH4W 2M9UA 2E10A 4ZGEB 1CKBA 4RTTA 3CCVQ 4OMQA 2WSCE 1VYVA 1MMDA 2YLCA 1IREB 4Z88A 3A8OB 3HFOA 4TVRA 4OGEA 3QBYA 4C92B 4EMGA 2B8AA 4FIBA 2XHCA 1MGQA 3JV3A 4Y28E 2M0OA 1WX6A 1RABB 1S72T 1M27C 3DLLA 1JO8A 1KC8C 2O31A 3OYLA 5LJ3d 3O5ZA 2I2LA 2HSPA 3CC7T 1NBEB 2L0AA 2J06A 1KHIA 4JZ4A 4KGZB 4P5NA 1G8XA 4L59A 1FXXA 3JCMc 2EQKA 4E7JA 4PJOC 1M90U 4PLIA 1I5OB 2J05A 4XTYA 2BE9B 2DL4A 1N5ZA 5A2QE 2L89A 3A8LB 2KROA 2DD5A 3IQLA 4LD9K 1RI9A 1WNLA 2FO0A 3NTKA 3TEEA 2QQRA 4FT4A 1WHJA 1YIJQ 2O2OA 2QGFB 1H641 1IB8A 4RTWA 1WHHA 5FROA 1C6VX 4NL2A 2QDYB 4M78D 3LW5E 4PJLA 4WTOB 3RKXA 2WSEE 1TWBA 4EMKA 1Y96A 1ARKA 4OGCA 3V8KA 3INZA 3HP9A 4FCYA 1I0CA 4Y92A 2XMFA 2BZ8A 1X6BA 3NFCA 4XU1A 5HKCA 3EG0A 1KQ2A 3OYKA 2M02A 2C0IA 3RNJA 4OVAA 1W1FA 1VQPT 3OYYA 2EGEA 3MCAB 3KXTA 2DVJA 4PJJA 3HRSA 9ATCB 4FM4B 3L2ZA 2KMTA 1MNEA 5GANh 4HCKA 2MK5A 3M59A 3EG9A 4HCZA 3G6EA 4EMKB 4PK4A 3DB3A 2V8KA 1PG5B 1J3TA 2JN0A 3J7AF 1QW1A 5GANj 2D0QB 2EVRA 5LJ5d 2F5KA 2RMOA 4LDWA 1T0JA 2HQEA 1Q81C 2JT4A 1LVKA 4F17A 1NYGA 2KK4A 3CEYA 1H8KA 1AHJB 4D8KA 1BCMA 2HQXA 4ESRA 1RADB 2ZZDA 5FWBA 4ATOA 1AWWA 4A4FA 1M8MA 2R5AA 1GFDA 1VQNQ 1B7TA 3JB9G 3HHTB 2X3WD 4EDUA 2K3BA 2RHYA 1OPKA 4PJNA 4C92G 2NUTA 1MV0B 2OJ2A 4QVZA 2VB6A 1D09B 1P92A 1ZA2B 1QVGA 1RAAB 4C92E 2ZGWA 4A4KA 1S1NA 3RERA 1MMGA 4PFZA 3EGDA 2DIGA 4BY6C 3L2UA 3VS3A 1ZA1B 5IHIA 2L5QA 2D6FA 5KYNA 3CD6A 3OA6A 4M78C 3SB2A 1WI7A 3U23A 3M58A 2JOYA 2BIVA 1AD5A 3CQTA 4QVCA 3G7ZA 1QVGS 4B6MA 2RQWA 1SHFA 3JCMe 1OU9A 2JTFA 4BACA 2PTKA 5GAN2 4XK8E 4KBMB 4LDUA 2DE0X 1OULA 4JUVA 1VQKT 1NEBA 1OX8A 4N0AA 2DX1A 5CCAA 2LC4A 5J39A 2D8JA 2XICA 3VS6A 1K0SA 2HEQA 2BZYA 1FMWA 3CCSQ 1VQ6A 1BKBA 2YUPA 3M0PA 2QASA 3MKDA 4C8QF 4PFOA 2A3LA 5CKEA 3MP6A 1PD1A 4J6YA 3QHSA 3LWIA 3M0UA 4EIKA 2PVDB 4ORZA 1U8RA 1OU8A 2WACA 5IXFA 4LE9A 1JRIA 4M7AD 4M7DA 2KYMA 3CCUA 3JCMX 1N8RC 2COWA 3EAEA 5LJ3f 3FJPA 4M78G 2XG8D 1KD1U 2QQAA 2G3RA 3JB9H 3QDRB 1Q95G 4JRKA 3EH2A 3E19A 3JCMQ 1VQNT 5FRNA 4FYYB 1AZGB 1JQQA 4C8QC 4RG8A 5HK3A 4IUVA 1OX9A 5C0MA 1OV3A 2DKGA 1ZBXA 2JXBA 1YHQQ 5GAMe 2PVOB 4LNPA 2QA4A 4M7DF 3OBYA 2OTLQ 1VQ9A 4F7UB 3QKJA 4DOWA 4PJOB 3CCMA 2XDDA 3OYIA 1VQ5A 2C0TA 4Z89A 1QWEA 2P4TA 2X4WA 5FU7B 2DPPB 1VIFA 5D6WA 2MI6A 3VKIA 5GAOq 2R5MA 1ACMB 4C8QD 4J9HA 4OB2B 3DLMA 4A4HA 5GAOl 3RESA 4XU2A 1G5VA 1KSWA 2LJ0A 2LVMA 4K11A 4EMHA 4FU6A 2EW3A 1NJIU 2EIFA 5LJ3e 2D0NA 5ECAA 3CMAQ 3NMZC 1TUGB 3T9NA 5KYUB 4R55A 2DERA 2LTOA 3PNWC 3CD6Q 5GJWB 2JTMA 2RI5A 1AEYA 2HMAA 7AT1B 5FRMA 4R0KA 2RB6A 2JS0A 5M9OA 2OTJA 4PJMA 3I55T 1YJWA 4C8QG 3L2WA 1H3ZA 2LT4A 2QTXA 5GAMf 1V76A 1R77A 1T0HA 2E3HA 3HFNA 2L3QA 3I5SA 4M75C 5GANf 3VS5A 4KUIA 5LJ5f 4JPBW 2VXEA 4PJOE 4AG1C 2KQWA 4JLGA 1VQ4Q 1PD0A 1OYXA 1VIEA 2JW4A 4MDWA 1IXDA 3MJXA 2FPFA 2GCXA 3SD4A 4M77G 3CCMT 3UWNA 2EYWA 1OOTA 1W6XA 4QQGA 3CMEA 2HAXA 4JRPA 4RG2A 1Q81R 1YHQT 2FPDA 2DJQA 4GBQA 3TU4K 4B9XA 4M75D 2EGCA 1OPLA 4IKFA 4AFQC 4M7DD 2DD4A 2RK2A 2YUQA 4FL6A 1YITA 1YJWT 1KD1C 2FG0A 1MV3A 1KC8R 2IG0A 2DZCA 4ZNXA 2RHZA 1UHCA 1ZBJA 1G3YA 2P4RA 2V26A 3O8VA 4AFSC 1JXOA 2BE7D 1R0BG 1PKSA 2CZ7B 5DM7R 3VU3C 5LJ5g 3CXCP 2AKKA 1VQMA 3A8MB 1D0ZA 3UPUA 4BY6B 5IN1A 2MCNA 3E9GA 1BIAA 5GAMg 3V8LA 2E3IA 3OW2A 1VQ5Q 2RQTA 1E7OA 4RTYA 4XTVA 3BFMA 3JB9D 2HZYA 2LQKA 4YTLA 2E6ZA 5GANg 1VQKQ 2YWWA 1T3SA 2NLUA 3GBQA 2K7AA 3TVTA 1WQ7A 1YIJT 1PM3A 1VQLA 1FMVA 1RUWA 3NGPA 3GLXA 3PIOA 1QWFA 2A28A 4OP0A 3MHXA 4LDYA 5CQYA 2JUFA 4F16A 2LCLA 2YHTA 2ROTA 1BU1A 2CSIA 4XQ3A 1ZSZA 3RIRA 1M3AA 2ZPBB 4NOYA 3OSSC 1K73U 1YJWQ 3PT9A 2YDLA 4HA8A 1D1AA 5DLQE 2LQNA 4GLKA 4PFPA 2HNIA 5IHNA 2CYZB 4M75E 4M78F 4HCCA 3JCMP 2ECZA 2HSEB 1RAHB 3ZEHA 2MF2A 6AT1B 3GP8A 2QQ9A 2VC8A 1BYMA 2FRWA 1AVZC 3EH1A 3I35A 1JEGA 1RLPC 2F2WA 1ZUKA 1PNJA 3PFSA 1ZLMA 2K9GA 2K3XA 1I1JA 2AZVA 4XU3A 4MDXA 3L2VA 2EPDA 2AHJB 5D6XA 2LDMA 1KK7A 2VUBA 2GTJA 3VJPA 4N4GA 3EGXB 2X9HA 4BD3A 4HCBA 4C0FA 2RHXA 3EFRA 3G71A 1BI2A 3UATA 3P8BB 3G4SQ 2EYZA 1WQWA 4M77E 4IURA 1K73R 4BI8B 5CR2A 2QA4Q 4QT7A 3VS7A 3CD6T 2OX7A 2ATCB 1VA7A 2QG9B 2KR3A 2VGMA 4BB7A 3EGUA 2IVWA 5GAN4 2YXYA 1UUEA 4KRTA 2EKOA 4KH1B 2BTTA 2KEAA 2FL7A 5LJ5e 3META 3CCEA 5GAMd 4RCCA 4RKUE 3PVLA 4V2SA 2DTOA 3QWYA 2PUOB 4DBRA 2KRNA 1FMKA 1N8RU 3UDCA 1M1GA 4NS5A 1NM7A 1GL5A 1JU5C 2LMJA 2ESWA 5J3BA 4PKCC 3OYBA 3OW2P 2CKKA 4II1A 1M3CA 3M55A 1VYUA 2EQMA 2AZSA 3J81E 2Y4YA 1FX7A 3CCVA 1SKUB 3QZ5B 2E12A 4HXJA 2DL3A 1QVGP 1WLPB 5LJ5h 3CXCA 1PRMC 1M2VA 2CH4A 3DB4A 1QP3A 2DF6A 2QGGA 4BUGA 1M90R 3OQ5A 3G6EQ 2DIQA 3OYMA 3BDUA 3FB9A 3V7CA 4ZN1A 2CT4A 4C92D 5GAN3 3PTAA 1YJNA 2LX9A 4J6XA 2L3RA 5KYWB 1WJQA 2EBPA 1VQ8T 2DBMA 1WHGA 4QVDA 3C12A 1F1BB 3L42A 1YJ9Q 1QMCA 4KH0B 2PZ1A 3H41A 3QSUA 1VOMA 2HDAA 1UGVA 2VWFA 5A0DA 3ME9A 2RO0A 1RACB 3E9FA 4BI4A 2K3YA 5L23A 1QCNA 2J7IA 5HK0A 1NJIC 2DBKA 4J7FA 2DETA 3OW2S 5GAOn 2KT1A 1SEMA 4M78E 1WZOA 1D3BB 1EFNA 1X2KA 1SSFA 2LQWA 3LWHA 2VXFA 2CZ1B 3QJ6A 3I56T 4F7UE 2M0YA 2CUDA 4LXCA 2YLBA 2KY9A 4M77B 3M0RA 3H9NA 1QVFP 5CKFA 2KXCA 2RPNA 2QI2A 4LUEA 2K5FA 1M30A 3EGXA 2EJGA 1TXQA 4M75F 2CP7A 2X51A 1KFZA 1AWOA 4M78B 5GJVB 4DBQA 3OYFA 2G6FX 8AT1B 1KC8U 2MYSA 2R57A 3EG1A 3VYHB 2RJEA 1T3LA 3V8JA 3DKMA 2DNUA 2QA4T 3P8DA 2YT6A 4M7DG 5FU7C 5A0GA 5FU6B 5EG2A 3VRZA 1VQLT 4MZMA 2LCSA 1WPYA 2DL8A 2CP3A 2K5IA 1Y57A 1ZUYA 4GY5A 3QO3A 1Y0MA 4OMNA 3OYAA 1Q7YC 1VQOA 1UGRB 3CBMA 2CT3A 4FW1A 4IUTA 4HT8A 1RAFB 3JAME 2A36A 4OMMA 3JCMg 2P84A 1BCOA 3SWNB 4C5EA 3EG3A 2NYSA 1XOVA 2YSQA 3H0HA 2CP2A 1QP2A 3JCMd 2JS2A 3OYJA 5KYWA 4M7AF 3ASKA 3MEVA 4AG2C 3FDRA 4E7LA 3TSZA 1SSHA 1ZUUA 4AT1B 2RJCA 1PC0A 2DEQA 1WYXA 1YI2T 2DYBA 5CKHA 1GRIA 1G2BA 4Q5WA 3OBWA 2ZCFB 2BZXA 1M8VA 3H0IA 3JCMf 1IZ6A 3CCMQ 3V7SA 4M7DC 2GTOA 4DA4A 3CC2A 2HQHA 1Q86R 3N5BB 3REAB 4EPCA 3UA6A 1LPLA 4M4ZA 1FWZA 3X26B 1NPPA 1M1KR 1D0XA 2E1HA 1RI0A 4FYWB 1H3HA 4XTWA 1YIJA 4BE0A 2DJZA 1NPRA 3I55Q 2CS7A 4J5YA 5KYYB 2EJ9A 3C94A 1UGSB 3CCJQ 2KXDA 2L8DA 3GF5A 2ROLA 1KD1R 3CMAT 1QQJA 1QVPA 5KE3A 2JM8A 2VASA 1M3BA 2JMAA 4A54A 2HKQB 3JSCA 2A08A 1X27A 1HSQA 4LN2A 4MZTA 3BE3A 3VV0A 5IXBA 4E7IA 4AFUC 3CXCS 3M9QA 3VYGA 4CC4B 3OS0A 2EYQA 1Y07A 2NUPB 2K5LA 1YWOA 4M7AE 1E6HA 1RAGB 2ENMA 4A53A 5IHKA 2MWPA 3REBB 2MOXA 1VQ4A 2WSFE 2LJ3A 1VQ7T 4A63B 1BI3A 3S3OA 1IGUA 2ZPEB 2EWNA 1U1SA 1WHLA 4OB3B 1ZX6A 1PHTA 3ZL7C 3I9QA 2F69A 2MAMA 3D7SB 4PJOF 1SPKA 3OMGA 1MNDA 3CC4A 2OAUA 1I07A 2E65A 3LX7A 2C06A 3EGDB 1NG2A 5LJ3h 1BI0A 3HPWA 2DL5A 2LZ6B 4M7AB 2O9SA 3E1SA 4RCBA 1NJIR 3PMIA 3CCLQ 5FW9A 1OZ3A 4IUQA 1Q86C 3OYEA 3CMET 5KYUA 4M77F 2DFUA 4OMPA 1HXDA 3X24B 4WCIA 2JM9A 2QK0A 2EQJA 2F2VA 1NE8A 3PMTA 3I56Q 1WXUA 2L3PA 1AT1B 2PVGB 4Z8AA 2CZ0B 2EQIA 2DMOA 3ER0A 3X20B 3JCMh 2EQUA 1TU0B 4M75G 4FW2A 1XTDA 1M2VB 1U1TA 1GFCA 1VQNA 1YP5A 4M78A 5GMKl 2CGHA 4C5HA 2DEUA 1O75A 3NPFA 4D8DA 4M7AA 4CC2A 4DBFA 2GBQA 3JB9F 2KNBB 4KULA 3CC2Q 4F7UF 4M77C 1VQ7A 2RJDA 3H0FA 3NHNA 1QCOA 5DLOA 2KRMA 4DOVA 2X4YA 2ED0A 4C8QB 2C0OA 1TTHB 3P8HA 2DK3A 3CMEQ 4N0AC 5GMKe 1UB4A 4PLLA 1VYTA 1B34B 3M4GA 4JS5A 1M5Q1 3URGA 2MPXC 1K73C 2RJFA 2FYKA 3UA7A 2K4YA 1PSFA 1YCSB 2RQVA 2JNGA 2HCKA 2P0PA 2CUBA 2YRVA 2NUPA 4ZTFA 3CC7A 2E41A 4GLMA 1G83A 2EAYA 2FEIA 1AWJA 4IIMA 2EGAA 1SG5A 3JRZA 2H8HA 2DRMA 2RI3A 2RNAA 3LGLA 2FZKB 2SEMA 1SRMA 3CCRT 3OS5A 3CCRA 4CC7A 3FEOA 4BE1A 1Q82R 1Y96B 2Z0WA 4HVVA 3CC7Q 2RD1A 4JS4A 4KGXB 3WVEB 2ZPGB 1VQ9T 3M0TA 2H3JA 1K8AR 2YRCA 1GCPA 3BDLA 1JXMA 3EHRA 2LNVA 1MMAA 3QYGB 4M7AG 1RAIB 3OYDA 1KQSA 2IIMA 4IUPA 1K9MC 1K9MR 5EC7A 4J9BA 4KGVB 3FC3A 3CC2T 2J6OA 3RDVA 3L2QA 1ZSGA 2DVEA 1PCXA 5GAOm 1XNIA 2DRKA 3MP1A 1VQPQ 1RAEB 4C0DB 1YI2Q 2DTIA
chains in the Genus database with same CATH topology
2KSSA 3RERA 3QYHB 3UDCA 1M1GA 2DIGA 4NS5A 1I4K1 4BY6C 3L2UA 5J3BA 4PKCC 3OYBA 1KHCA 4M75B 2L5QA 2D6FA 1W4SA 1I81A 2FHDA 3CD6A 3OA6A 2CKKA 4II1A 5GMKj 3M55A 4PNOA 5IT9E 2EQMA 3M56A 4M78C 3SB2A 4X34A 4M7DB 2Y90A 3M58A 3JB9J 2JOYA 5CO7A 3J81E 1D3BA 2BIVA 2Y4YA 1FX7A 3QJYA 4QVCA 3G7ZA 1QVGS 5GAMh 3CCVA 1JJ2S 3QZ5B 2LRQA 2E12A 1X6OA 1UGPB 1M1FA 4XTUA 5LJ5h 3CXCA 3JCMe 3SWNA 2HBPA 3FIFA 2JTFA 5GANd 5GAN8 3J80E 3DB4A 1QP3A 3RMQA 4BACA 2M1HA 3A8HB 5GAN2 1Y7XA 2LQ8A 4XK8E 3OQ5A 1B34A 2RK1A 4BUGA 4KBMB 3M4YA 3CPWA 4KUDK 2FB7A 3MEWA 4LDUA 2XKOC 2DIQA 5GAOp 2E70A 4VUBA 1YCYA 4JUVA 4LDVA 1VQKT 1M9SA 3OYMA 1WJSA 4N0AA 3BDUA 3OYCA 3FB9A 2JZ2A 3V7CA 4ZN1A 1JJ2A 3OSVA 4C92D 3AHUA 4FSXA 2P0QA 5GAN3 5CCAA 3PTAA 2LX9A 1YJNA 2LC4A 3OS2A 4J6XA 5J39A 4IUUA 2XICA 1K8AU 2L3RA 1WJQA 4C92A 1VQ8T 2PUKB 5LJ5j 5CAIA 3TREA 5KCOA 2RI2A 2GFUA 4QVDA 1VQ6A 3C12A 1BKBA 2DAQA 3L42A 4UC4A 3QSUA 2XI9A 1X75C 3HKSA 3OYGA 4C8QF 4ZGDB 5A0DA 2A3LA 5CKEA 3ME9A 3MP6A 3X28B 2RO0A 4XTZA 3CC4T 1ZHIA 4J6YA 3QHSA 3E9FA 3LWIA 4BI4A 1VQMT 2K3YA 3CPFA 2PVDB 2XU8A 4C0ZA 4Y91A 5HK0A 1NJIC 2GFAA 4E7KA 1YI2A 1U8RA 4J7FA 3OW2S 5D6YA 3MO8A 5GAOn 3I55A 3JCMW 1X01A 3RKYA 3QG1A 2WACA 3G4ST 4M78E 1JRIA 1D3BB 3C95A 1SSFA 1M1KC 3LWHA 2VXFA 2CZ1B 4M7DA 4M7AD 3CCUA 3QJ6A 3JCMX 3I56T 4F7UA 5GAOr 1N8RC 2PQWA 4F7UE 1M4ZA 3I56A 1N27A 3EAEA 4C92F 3HL8A 5LJ3f 3FJPA 2YLBA 2KY9A 4M77B 4X9CA 5AYFA 4M78G 2XG8D 1KD1U 2QQAA 3FLGA 2G3RA 3JB9H 3QDRB 5CKFA 4JRKA 1VQNT 3E19A 3JCMQ 2P0KA 5FRNA 2QI2A 3CPWS 2K5FA 4OB0B 2EJGA 1JBMA 5L8RE 3CCLA 4C8QC 5LL6S 5FLXE 1Q81U 4M75F 4RG8A 2ZPFB 3QXEB 2BKDN 5HK3A 1RL2A 4IUVA 4M7AE 5C0MA 3M54A 4M78B 2DKGA 3L1AA 5GMKi 1ZBXA 4EMKC 3OYFA 2QQBA 2MMPA 2ZPIB 4J83A 4J8OA 3S3NA 1KC8U 2R57A 3VYHB 1Q86U 2OTLT 2RJEA 2PVOB 5GAMe 3V8JA 2QA4A 4M7DF 3DKMA 1HK9A 3OBYA 3JCMb 3RUXA 2DO3A 2QA4T 1VQ9A 1YBYA 3P8DA 4M7AC 4JLIA 3JCMV 3CCSA 5FU7C 1W2BA 2RHUA 4M7DG 3CBPA 4F7UB 3QKJA 5FU6B 4DOWA 5A0GA 4X9DA 5CKBA 2QEXT 4C5GA 3CCMA 4PJOB 4XAXB 5EG2A 1VQ5T 4QW2A 2XDDA 3KBGA 3OYIA 1VQ5A 3F70A 1VQLT 1Q82C 4DQ2A 1YHQA 4MZMA 2P4TA 3C4SA 2X4WA 5FU7B 2DPPB 1VIFA 1WJRA 1VUBA 5D6WA 2MI6A 1WPYA 3VKIA 5GAOq 1VQ8A 4A4EA 2K5IA 2R5MA 2OTLA 4N4IA 2RH2A 5GAN5 3H8ZA 4O6JA 5I2MA 4M77A 4A4GA 1YJNT 4ZGJB 1LJOA 4C8QD 4GY5A 3QO3A 1Q7YC 3OYAA 2E5QA 2KDSA 2VYTA 4OB2B 1VQPA 3DLMA 4A4HA 2E64A 5GAOl 3S3MA 1VQOA 2M16A 1VQKA 3L2RA 3RESA 4XU2A 3CCVT 1G5VA 1UGRB 3CCLT 2LVMA 3RMSA 2LCCA 3CBMA 4IUTA 4EMHA 3G6ET 4HT8A 4FU6A 1NJIU 4F7UG 2EIFA 3JAME 1YJ9A 4B9WA 5LJ3e 4OMFB 3JCMg 1N9SA 3SWNB 2DXUA 5GAMj 3T9NA 4C5EA 4LD6A 4R55A 2V8JA 2LTOA 2VV5A 3HRTA 3OB9A 1XOVA 1R8OB 1DJ7B 5GANe 5KCHA 3PNWC 5GMKh 5HY6A 1QP2A 2JTMA 1BI1A 3JCMd 2RI5A 4ME7A 3HSBA 5FRMA 4JRIA 4MMKA 3OYJA 3CCQA 3EFSA 2RB6A 4FT2A 3PGGA 4ZN3A 3ZFJA 1VQOT 3QUIA 4M7AF 3ASKA 3GNFB 3MEVA 5M9OA 3CMAA 2OTJA 3FDRA 4CRIA 3I55T 4E7LA 2VGNA 2MWOA 1YJWA 4Z02A 3V7RA 4C8QG 3L2WA 1OI1A 2RJCA 3M5AA 2LT1A 2DEQA 4JJNK 4D6WA 1H3ZA 1YI2T 2LT4A 2QTXA 4ELZC 5CKHA 5GAMf 3CCET 2X4XA 2O01E 4Q5WA 3OBWA 3GIBA 3HFNA 4M75C 3WXMB 2ZCFB 5GANf 1M8VA 3LYIA 4KUIA 5LJ5f 3JCMf 1IZ6A 2VXEA 2Y4XA 4JDSA 4PJOE 3V7SA 1GXIE 4MMLA 4M7DC 3BY7A 4QQDA 2KQWA 4JLGA 2GQVA 4DA4A 3WVDB 4E47A 2DXCA 3CC2A 2DXBA 1OYXA 1VIEA 1K8AC 1QVFA 1ZQ1A 3S6WA 2ZPHB 1YITT 3N5BB 4MDWA 1LNXA 2GCXA 3OMCA 3SD4A 4EPCA 2R58A 1N9RA 3VUBA 5I2SA 5GMKm 4M77G 3SDZA 2QEXA 3CCMT 5CIUA 1G3TA 1FWZA 3UWNA 1EIFA 3X26B 3MP8A 2XDBA 2BUDA 5GAN7 1NPPA 3KUFA 5FU6C 1PSEA 2DZ9A 2HAXA 4QQGA 3CMEA 2E1HA 1OZ2A 1RI0A 4JRPA 4RG2A 3OYNA 4XTWA 4NL3A 1YHQT 1YIJA 3CBOA 4PJOG 5CQXA 5GAN6 4BE0A 2DJZA 5LJ3j 1NPRA 3GNGA 3QPHA 1BIBA 3TU4K 4B9XA 4M75D 4XU0A 2O4XA 4OB1B 2CS7A 4IKFA 3MEUA 3X25B 4BI3A 4J5YA 4HKEA 4C8QE 3CCQT 1M90C 3UT1A 2EJ9A 5CVIA 3LH0A 3C94A 5C6SA 1UGSB 4M7DD 3HRUA 1JB0E 2DD4A 2RK2A 3CCUT 2E6NA 4C0GA 3CCJT 2L8DA 4FL6A 3GF5A 2K2VA 3JCMJ 3M57A 1UGQB 4L5GA 1YJWT 1KD1C 3VUZA 5J26A 2V8IA 1KQ1A 3CMAT 3TCJA 4QQ6A 1QVPA 2X4JA 5KE3A 1YJ9T 2IG0A 2DZCA 4A54A 2RHZA 2XIDA 3JSCA 3SWNC 2M9UA 2E10A 4ZGEB 4MZTA 3VV0A 1G3YA 2XD0A 3O8VA 4E7IA 3CXCS 3M9QA 2WSCE 3VYGA 3OS0A 2EYQA 2YLCA 1IREB 1Y07A 4KT0E 3A8OB 3HFOA 3NTIA 2K5LA 3SFMA 2CZ7B 4TVRA 4OGEA 3A8GB 3VU3C 5LJ5g 5DM7R 3QBYA 4C92B 4EMGA 2B8AA 1Q82U 4BDYA 3JB9I 4FIBA 1VQMA 3A8MB 4A53A 3UPUA 4BY6B 2XHCA 2MWPA 1VQ4A 1MGQA 2WSFE 4J7IA 1VQ7T 5IN1A 4Y28E 3E9GA 1BIAA 1BI3A 2M0OA 3S3OA 3MEAA 4WF2A 2ZPEB 1I8FA 5GAMg 4C92C 1S72T 2EWNA 3DLLA 2EJFA 3V8LA 1U1SA 3OW2A 4OB3B 1KC8C 1Q7YU 1VQ6T 1Y71A 3R6OA 2F69A 3OYLA 2MAMA 4PJOF 5LJ3d 4XTVA 3OMGA 4PL6A 1NZ9A 3CC4A 2OAUA 3BFMA 2E65A 3LX7A 2I2LA 3JB9D 4BDZA 2C06A 3CC7T 2LQKA 4YTLA 2E6ZA 5LJ3h 5GANg 1BI0A 1KHIA 4P5NA 1YITA 3JCMc 4L59A 1FXXA 3CCST 2EQKA 4E7JA 4PJOC 3HPWA 2NLUA 3H6ZA 4M7AB 1M90U 3A5ZB 1WQ7A 4R56A 3E1SA 4PLIA 4RCBA 1YIJT 3PMIA 5I21A 1VQLA 4XTYA 4HT9A 1OZ3A 1XQHA 4IUQA 3GLXA 5A2QE 2L89A 4ELYC 3PIOA 3OYEA 4M77F 3CMET 3A8LB 4M77D 2DD5A 4E7HA 4OP0A 1HXDA 1G3WA 3MHXA 3X24B 4LD9K 1WNLA 3NTKA 4LDYA 2CZ6B 3TEEA 5CQYA 4O5VA 4CI0C 2JUFA 2QQSA 3NTHA 3GPLA 2QQRA 2EQJA 2QXFA 4FT4A 1QVFS 2LCLA 2YHTA 1NE8A 4XTXA 3PMTA 5CK9A 4XQ3A 2PVGB 3G4SA 1KQSS 2CZ0B 2XK0A 3RIRA 1H641 2ZPBB 5FROA 4NOYA 3ER0A 4C8QA 4NL2A 2QDYB 3OSSC 4M78D 3X20B 3JCMh 2EQUA 1K73U 3LW5E 3BW1A 4M75G 3PT9A 5KH6A 5KE2A 3RKXA 1MHNA 2WSEE 1G3SA 1XTDA 2KVQG 4EMKA 1U1TA 1O9SA 2GF7A 1V29B 4HA8A 5DLQE 1Y96A 1VQNA 2RHIA 4GLKA 1I5LA 2HNIA 4M78A 4OGCA 2F5TX 5GMKl 2CGHA 3V8KA 4C5HA 3INZA 1O75A 4PJOD 2CYZB 3HP9A 4M75E 4M7AA 4M78F 4HCCA 3NFCA 4XU1A 5HKCA 3JCMP 3JB9F 4KULA 5DY9A 3ZEHA 2K57A 2MF2A 3GP8A 2D9TA 3Q1JA 1KQ2A 4F7UF 3OYKA 1M1KU 4J6WA 4M77C 1K9MU 1VQ7A 4OVAA 2O4XB 2QQ9A 2RJDA 2VC8A 1BYMA 1VQPT 5DLOA 4DOVA 4M7DE 2X4YA 3OYYA 3LGFA 3MCAB 2EFIA 4C8QB 3KXTA 4MZPA 2A7YA 3M53A 3P8HA 3HRSA 3PFSA 2DK3A 4FM4B 4N0AC 3G71T 3L2ZA 2KMTA 5GMKe 1UB4A 3QZ9B 4PLLA 5LJ3g 5GANh 1B34B 3M4GA 4JS5A 3M59A 3GOXA 1M5Q1 3URGA 1K73C 4HCZA 2RJFA 2K3XA 3ZBDA 4JRQA 3G6EA 4EMKB 4BE2A 2FYKA 3DB3A 2K4YA 1PSFA 2V8KA 4XU3A 2JNGA 4MDXA 2JN0A 5CKDA 2DXTA 2P0PA 1QW1A 5GANj 3J7AF 3L2VA 2AHJB 2KAFA 2YRVA 4ZTFA 3CC7A 5D6XA 2E41A 2LDMA 2D0QB 2EAYA 3OS1A 2VUBA 4OF1A 5LJ5d 3JRZA 3VJPA 2F5KA 3FRNA 4LDWA 4N4GA 2HQEA 1Q81C 4BD3A 4HCBA 4C0FA 2RHXA 4RMOA 2RI3A 3EFRA 1BI2A 3LGLA 3P8BB 4L6V5 3G71A 3CCRT 3OS5A 2X35A 2KK4A 5IAYA 3CCRA 1WQWA 3CEYA 1N6AA 3FEOA 4BE1A 1AHJB 1Y96B 2RM4A 4M77E 2HQXA 2RD1A 3QIIA 4IURA 1W2BS 4BI8B 5CR2A 2ZZDA 4JS4A 4ATOA 4A4FA 3WVEB 2ZPGB 1VQ9T 3CD6T 2R5AA 2H3JA 3PIPA 4C5IA 5A0LA 3JB9G 3HHTB 4LDXA 1KG1A 4EDUA 3BDLA 2VGMA 1S72A 1LOJA 4M75A 4BB7A 2LNVA 2JVVA 3QYGB 4PJOA 4M7AG 2IVWA 2RHYA 3OYDA 5GAN4 3OYHA 4ZTJA 1KQSA 2OTJT 4IUPA 4C92G 1K9MC 2EKOA 1TH7A 1WGSA 1VQ4T 3FC3A 2FL7A 2XDPA 5LJ5e 3CC2T 4C0DC 1UEBA 3META 3CCEA 3L2QA 4QVZA 5GAMd 2DVEA 2RA2A 4N4HA 4RCCA 4RKUE 2DTHA 2FVUA 4V2SA 1P92A 5GAOm 1XNIA 2DTOA 3RKWA 2HD0A 3MP1A 2PUOB 1QVGA 3LLRA 4C0DB 3OY9A 4C92E 2PU9B 2ZGWA 4A4KA 1Q86C 3CCJA 1N8RU 2DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG2 A;  2EQU A;  3OYN A;  3OYF A;  3S3N A;  4BE0 A;  2DIG A;  2R57 A;  4NS5 A;  5KE2 A;  5KH6 A;  1MHN A;  3L2U A;  2GF7 A;  2RJE A;  4B9X A;  3OYB A;  1KHC A;  2RHI A;  2O4X A;  3P8D A;  4IKF A;  3MEU A;  2FHD A;  1OZ2 A;  4C5H A;  2RHU A;  3OA6 A;  2CKK A;  3QKJ A;  4II1 A;  3UT1 A;  5C6S A;  3LH0 A;  4C5G A;  2EQM A;  4QW2 A;  4X34 A;  3OYI A;  3F70 A;  2E6N A;  2L8D A;  2BIV A;  4FL6 A;  3ZEH A;  3C4S A;  2X4W A;  2D9T A;  2LRQ A;  3Q1J A;  5J26 A;  1WJR A;  3OYK A;  5D6W A;  4QQ6 A;  4OVA A;  4A4E A;  2O4X B;  2RJD A;  2R5M A;  5KE3 A;  4N4I A;  2IG0 A;  3H8Z A;  2X4Y A;  4A4G A;  2JTF A;  3DB4 A;  4BAC A;  2RHZ A;  3LGF A;  2EFI A;  2M1H A;  4GY5 A;  3OY9 A;  3OQ5 A;  2E5Q A;  2VYT A;  3OYA A;  3P8H A;  3MEW A;  3DLM A;  3PFS A;  4A4H A;  3S3M A;  2M16 A;  2DIQ A;  3O8V A;  4E7I A;  3L2R A;  4PLL A;  1G5V A;  3M9Q A;  3OS0 A;  2LVM A;  2LCC A;  4IUT A;  3OYM A;  1WJS A;  3GOX A;  4HCZ A;  3OYC A;  3NTI A;  2JZ2 A;  2RJF A;  2K3X A;  4FU6 A;  4BE2 A;  3QBY A;  4B9W A;  2B8A A;  3DB3 A;  4BDY A;  3OS2 A;  5J39 A;  4IUU A;  2MWP A;  4C5E A;  2L3R A;  4LD6 A;  1WJQ A;  2LTO A;  3OB9 A;  5IN1 A;  3L2V A;  2YRV A;  5KCO A;  4ZTF A;  2RI2 A;  2GFU A;  3E9G A;  5D6X A;  2LDM A;  2M0O A;  3PNW C;  2DAQ A;  3L42 A;  3MEA A;  5KCH A;  3OS1 A;  3S3O A;  4UC4 A;  2RI5 A;  3OYG A;  5FRM A;  3OYJ A;  2F5K A;  4N4G A;  2HQE A;  3ME9 A;  3MP6 A;  4BD3 A;  2RO0 A;  2RHX A;  2RI3 A;  3LGL A;  3OYL A;  3ASK A;  3E9F A;  3MEV A;  5M9O A;  2X35 A;  3FDR A;  3OMG A;  5IAY A;  4PL6 A;  2K3Y A;  3CEY A;  3FEO A;  4CRI A;  2MWO A;  4BE1 A;  4Z02 A;  4E7L A;  3L2W A;  2GFA A;  3LX7 A;  2HQX A;  4E7K A;  1OI1 A;  2RJC A;  3QII A;  4IUR A;  4BDZ A;  1H3Z A;  5D6Y A;  3MO8 A;  4A4F A;  2X4X A;  2WAC A;  4L59 A;  2R5A A;  2EQK A;  4Q5W A;  4E7J A;  1SSF A;  2NLU A;  3H6Z A;  4C5I A;  3LYI A;  3QJ6 A;  4PLI A;  3BDL A;  4EDU A;  3PMI A;  2PQW A;  1N27 A;  3EAE A;  2RHY A;  3OYD A;  3OYH A;  4ZTJ A;  1OZ3 A;  4IUQ A;  4QQD A;  2L89 A;  3OYE A;  4IUP A;  4E7H A;  2EKO A;  1OYX A;  1WGS A;  3FLG A;  2G3R A;  3S6W A;  3NTK A;  2XDP A;  3FC3 A;  3MET A;  3L2Q A;  2P0K A;  5FRN A;  4QVZ A;  2QQS A;  3NTH A;  3OMC A;  2R58 A;  2QQR A;  4N4H A;  2EQJ A;  3SD4 A;  5CIU A;  3PMT A;  1XNI A;  3UWN A;  3MP1 A;  3MP8 A;  2BUD A;  2XK0 A;  3KUF A;  2BKD N;  3LLR A;  4IUV A;  5FRO A;  4QQG A;  5C0M A;  1RI0 A; 
#chains in the Genus database with same CATH topology
 1PKT A;  2NUT B;  4JJC A;  1KHC A;  4M75 B;  1W4S A;  3E2U A;  1NLO C;  2K6D A;  5GMK j;  4PNO A;  5IT9 E;  1BK2 A;  3JB9 J;  5CO7 A;  1D3B A;  3QJY A;  1JJ2 S;  3M0Q A;  2LRQ A;  1X6O A;  1M1F A;  4XTU A;  1Z9Q A;  4J9I A;  2HBP A;  3FIF A;  5GAN d;  5GAN 8;  2QYZ A;  2K79 A;  2M1H A;  3OY9 A;  1Y7X A;  2LQ8 A;  2RK1 A;  2RF0 A;  4KUD K;  3MEW A;  2XKO C;  2E70 A;  4VUB A;  1YCY A;  3OYC A;  2JZ2 A;  2LJ1 A;  1KQS P;  1JJ2 A;  1IHV A;  4FSX A;  2D1X A;  3I5R A;  3OS2 A;  1WIE A;  1K8A U;  2V1R A;  4C92 A;  1QKX A;  5LJ5 j;  5CAI A;  1U06 A;  4UC4 A;  1X75 C;  1HD3 A;  2NWM A;  1TS9 A;  3CC4 T;  2CP0 A;  4FYX B;  1U5S A;  1VQM T;  3EG2 A;  4Y91 A;  4E7K A;  3KFV A;  3EFO A;  5D6Y A;  3MO8 A;  3I55 A;  1X01 A;  3RKY A;  1YFN A;  3QG1 A;  2GGR A;  2CP5 A;  1RLQ C;  4DEX A;  5GAO r;  4E7S A;  1M4Z A;  4C92 F;  4ANJ A;  3HL8 A;  2QTV A;  1UG1 A;  3FLG A;  4OML A;  2P0K A;  2A0F B;  3CPW S;  2DIL A;  4OB0 B;  2HL3 A;  1JBM A;  5L8R E;  5LL6 S;  1Q81 U;  2ZPF B;  3QXE B;  2BKD N;  1GCQ C;  1QLY A;  3M54 A;  5GMK i;  3CCR Q;  2QQB A;  2MMP A;  3S3N A;  4J8O A;  3QWX X;  1Q86 U;  1KIK A;  1C1A A;  3JCM b;  1YBY A;  4JLI A;  3JCM V;  3CCS A;  1W2B A;  1VQ6 Q;  2RHU A;  3CBP A;  2EYX A;  4X9D A;  5CKB A;  2QEX T;  4JJB A;  4QKU A;  1VQ5 T;  3F70 A;  1NEG A;  1S72 Q;  1Q82 C;  4DQ2 A;  1VQO Q;  4CC3 A;  4JJD A;  1SHG A;  1VQ8 A;  4N4I A;  5GAN 5;  5I2M A;  1YJN T;  1V1C A;  2L2P A;  4FSS A;  4ZGJ B;  1IRX A;  2J6K A;  2E5Q A;  2KDS A;  1K76 A;  2E64 A;  4AFZ C;  3L2R A;  1TSF A;  1UFF A;  1SRL A;  2LCC A;  3G6E T;  1BB9 A;  1M2O A;  2RQU A;  4F7U G;  1YJ9 A;  4B9W A;  2KT8 A;  1N9S A;  5GAM j;  2DXU A;  2V8J A;  2B86 A;  3HRT A;  5GMK h;  5HY6 A;  1BI1 A;  1PRL C;  2GQI A;  4JRI A;  4MMK A;  1D1C A;  3CCQ A;  3EFS A;  3SEM A;  4FT2 A;  3PGG A;  4J9F A;  4ZN3 A;  1VQO T;  3QUI A;  3GNF B;  2X3X D;  3FJ5 A;  3VS1 A;  1W2B P;  3EFO B;  2I0N A;  1IGQ A;  4CRI A;  2VGN A;  2MWO A;  4Z02 A;  3M5A A;  2LT1 A;  5I22 A;  4JJN K;  4D6W A;  1IHW A;  2K2M A;  2W10 A;  2X4X A;  2OAW A;  3ULR B;  3GIB A;  3WXM B;  3LYI A;  2RN8 A;  2HBW A;  2KBT A;  2VKN A;  1YJN Q;  1GXI E;  2H3E B;  4E47 A;  2DXC A;  1K0X A;  2DXB A;  1K8A C;  1QVF A;  3S6W A;  2CP6 A;  1K4U S;  2R58 A;  3VUB A;  2AT1 B;  5GMK m;  3SDZ A;  2QEX A;  4HVU A;  1G3T A;  4JZ3 A;  2XDB A;  2BUD A;  3KUF A;  5FU6 C;  1PSE A;  2DZ9 A;  2FZC B;  3PVQ A;  1ABO A;  3CC4 Q;  3G1J A;  1EX4 A;  5CQX A;  5GAN 6;  2CSQ A;  1WA7 A;  1BIB A;  2COY A;  2AK5 A;  4XU0 A;  2O4X A;  1UE9 A;  3X25 B;  4BI3 A;  4C8Q E;  4HKE A;  3UT1 A;  5C6S A;  5CVI A;  3LH0 A;  1HJD A;  1AWX A;  3HRU A;  1JB0 E;  1MUZ A;  2E6N A;  4C0G A;  3CCJ T;  2K2V A;  3JCM J;  1CKA A;  1QKW A;  1FYN A;  1UJ0 A;  3VUZ A;  2V8I A;  1KQ1 A;  1Z9Z A;  3VRY A;  4QQ6 A;  3SWN C;  4DEY A;  1B07 A;  2XD0 A;  3CPW P;  2RQR A;  4KT0 E;  2YUO A;  3NTI A;  3SFM A;  3A8G B;  4J9D A;  1Q82 U;  4BDY A;  3JB9 I;  1WHM A;  2QAZ A;  4J7I A;  4E7Z A;  3MEA A;  4WF2 A;  1I8F A;  4C92 C;  2EJF A;  1Q7Y U;  1VQ6 T;  1Y71 A;  1VQ8 Q;  3R6O A;  2EYY A;  3C0C A;  3CCU Q;  4PL6 A;  1NZ9 A;  4BDZ A;  1WXB A;  2L3S A;  5KYX B;  3CCS T;  3H6Z A;  4RTU A;  2KYB A;  3A5Z B;  3AT1 B;  4R56 A;  1QCF A;  5I21 A;  3MPU B;  4HT9 A;  1XQH A;  4ELY C;  2OI3 A;  4M77 D;  4E7H A;  1G3W A;  2VVK A;  2D8H A;  3UF4 A;  2CZ6 B;  4O5V A;  4CI0 C;  2QQS A;  3NTH A;  3GPL A;  2QXF A;  4E6R A;  1QVF S;  4XTX A;  4F14 A;  5CK9 A;  3G4S A;  1KQS S;  2XK0 A;  2YUN A;  3G71 Q;  4C8Q A;  2QEX Q;  3BW1 A;  1GCQ A;  5KH6 A;  1MMN A;  5KE2 A;  1MHN A;  1G3S A;  2KVQ G;  2O9V A;  2GF7 A;  1O9S A;  1V29 B;  2EKH A;  5I11 A;  4FYV B;  2DL7 A;  2RHI A;  1I5L A;  2F5T X;  4PJO D;  1WDX A;  2JTE A;  5HCK A;  2V1Q A;  5DY9 A;  2K57 A;  2D9T A;  3Q1J A;  2HL5 C;  3THK A;  4J6W A;  1K9M U;  1M1K U;  1X6G A;  1KJW A;  2LX7 A;  2O4X B;  4M7D E;  1TOV A;  2GNC A;  1UHF A;  2COZ A;  1UEC A;  2DM1 A;  3LGF A;  2EFI A;  4X1V A;  4MZP A;  2A7Y A;  3M53 A;  3G71 T;  2F1L A;  3QZ9 B;  5LJ3 g;  3GOX A;  1D0Y A;  3ZBD A;  4RTZ A;  4JRQ A;  4BE2 A;  2A37 A;  1VQL Q;  2E5K A;  5CKD A;  2DXT A;  2KAF A;  1Q7Y R;  1UJY A;  1ZSZ B;  3OS1 A;  4AMC A;  4J9G A;  4OF1 A;  3FRN A;  4RMO A;  1YNZ A;  4L6V 5;  1H92 A;  2X35 A;  5IAY A;  1YN8 A;  1N6A A;  3VS4 A;  2RM4 A;  3VS2 A;  2IPO B;  3QII A;  1W2B S;  4J9E A;  1PWT A;  1AOJ A;  3PIP A;  4J9C A;  4C5I A;  5A0L A;  1W70 A;  4LDX A;  1KG1 A;  2J6F A;  1S72 A;  1LOJ A;  4M75 A;  4PJO A;  2JVV A;  3OYH A;  4ZTJ A;  2YRD A;  2CDT A;  2OTJ T;  1NYF A;  1TH7 A;  1WGS A;  3TSW A;  1VQ4 T;  2XDP A;  4C0D C;  1UEB A;  3PE0 A;  2RA2 A;  4N4H A;  2DTH A;  2FVU A;  4RTV A;  3RKW A;  2HD0 A;  1A0N B;  3LLR A;  2PU9 B;  3M0S A;  8ATC B;  3CCJ A;  2DLP A;  2KSS A;  3QYH B;  1I4K 1;  1E6G A;  5IH2 A;  4E2F B;  1I81 A;  2FHD A;  3QDF A;  3M56 A;  4M7D B;  4X34 A;  2Y90 A;  1NLP C;  2FZG B;  1N8R R;  5GAM h;  4OMO A;  1CSK A;  1UGP B;  1K1Z A;  3SWN A;  2W0Z A;  3J80 E;  2HKN A;  3RMQ A;  3A8H B;  1B34 A;  3CPW A;  3M4Y A;  2F2X A;  2FB7 A;  5GAO p;  4LDV A;  1M9S A;  1AZE A;  1GBR A;  1WJS A;  1SF9 A;  4RUG A;  3OSV A;  3AHU A;  2QDL A;  2P0Q A;  1VQ9 Q;  4IUU A;  2PUK B;  5KCO A;  3TRE A;  2GFU A;  2FRY A;  2RI2 A;  2KGT A;  2DAQ A;  4IIO A;  1X69 A;  1TUD A;  1B3Q A;  2XI9 A;  3HKS A;  3OYG A;  4ZGD B;  1TUC A;  1GBQ A;  4RTX A;  3X28 B;  4XTZ A;  1ZHI A;  1VQ7 Q;  3R6N A;  1VQM Q;  1WFW A;  3CPF A;  1YWP A;  2XU8 A;  4C0Z A;  2GFA A;  1YI2 A;  3JCM W;  2DA9 A;  3G4S T;  3C95 A;  1M1K C;  4HVW A;  1R0C B;  1TG0 A;  4F7U A;  1K9A A;  2PQW A;  3I56 A;  1C0M A;  1N27 A;  1XJW B;  4X9C A;  5AYF A;  4LUD A;  5D7U A;  3SHW A;  3TQ7 P;  3EHQ A;  3CCL A;  5FLX E;  2M51 A;  2OTJ Q;  1RL2 A;  3L1A A;  4EMK C;  2ZPI B;  4J83 A;  3LH5 A;  3A98 A;  5FWC A;  1EZZ B;  2OTL T;  1HK9 A;  3RUX A;  2DO3 A;  4M7A C;  2FPE A;  4C5G A;  4XAX B;  4QW2 A;  3KBG A;  5AT1 B;  1BBZ A;  5KYY A;  2SRC A;  1YHQ A;  3C4S A;  2AKL A;  1WJR A;  1VUB A;  4A4E A;  2OTL A;  2RH2 A;  2NUZ A;  3H8Z A;  4O6J A;  4A4G A;  1U3O A;  4M77 A;  1LJO A;  2VYT A;  1VQP A;  1WXT A;  2MIO A;  3S3M A;  2M16 A;  1VQK A;  1YIT Q;  3CCV T;  2ED1 A;  3CCL T;  3RMS A;  1OQK A;  1X43 A;  4DBH A;  3VS0 A;  4F04 B;  3A1P A;  4OMF B;  2AIR B;  4LD6 A;  2VV5 A;  3OB9 A;  1DJ7 B;  1R8O B;  5GAN e;  5KCH A;  2ZAE A;  3HSB A;  2O88 A;  2LP5 A;  4ME7 A;  1D1B A;  3ZFJ A;  3CMA A;  3RR6 A;  3V7R A;  2JMC A;  1OI1 A;  3CCE T;  4ELZ C;  2O01 E;  5KYX A;  2Y4X A;  4JDS A;  4MML A;  3BY7 A;  4QQD A;  2CRE A;  2GQV A;  3WVD B;  1ZQ1 A;  2ZPH B;  1YIT T;  1LNX A;  2KRS A;  3OMC A;  1N9R A;  5I2S A;  1ZSZ C;  5CIU A;  2PNI A;  1HYO A;  1EIF A;  1ABQ A;  3MP8 A;  5GAN 7;  3RBB B;  1OZ2 A;  3OYN A;  4NL3 A;  3CCE Q;  1OEB A;  3CBO A;  4PJO G;  5LJ3 j;  2E4H A;  3GNG A;  2KI7 A;  1X2Q A;  3QPH A;  4OB1 B;  1UDL A;  3MEU A;  1UTI A;  1M90 C;  3CCQ T;  2KE9 A;  2DYI A;  2LNH B;  3CCU T;  3HTR A;  3M57 A;  1UGQ B;  4L5G A;  3CCQ Q;  2JJ9 A;  5J26 A;  3TCJ A;  1WHK A;  2ABL A;  2X4J A;  1YJ9 T;  1JJ2 P;  1IO6 A;  1LCK A;  3EG9 B;  2XID A;  2CH4 W;  2M9U A;  2E10 A;  4ZGE B;  1CKB A;  4RTT A;  3CCV Q;  4OMQ A;  2WSC E;  1VYV A;  1MMD A;  2YLC A;  1IRE B;  4Z88 A;  3A8O B;  3HFO A;  4TVR A;  4OGE A;  3QBY A;  4C92 B;  4EMG A;  2B8A A;  4FIB A;  2XHC A;  1MGQ A;  3JV3 A;  4Y28 E;  2M0O A;  1WX6 A;  1RAB B;  1S72 T;  1M27 C;  3DLL A;  1JO8 A;  1KC8 C;  2O31 A;  3OYL A;  5LJ3 d;  3O5Z A;  2I2L A;  2HSP A;  3CC7 T;  1NBE B;  2L0A A;  2J06 A;  1KHI A;  4JZ4 A;  4KGZ B;  4P5N A;  1G8X A;  4L59 A;  1FXX A;  3JCM c;  2EQK A;  4E7J A;  4PJO C;  1M90 U;  4PLI A;  1I5O B;  2J05 A;  4XTY A;  2BE9 B;  2DL4 A;  1N5Z A;  5A2Q E;  2L89 A;  3A8L B;  2KRO A;  2DD5 A;  3IQL A;  4LD9 K;  1RI9 A;  1WNL A;  2FO0 A;  3NTK A;  3TEE A;  2QQR A;  4FT4 A;  1WHJ A;  1YIJ Q;  2O2O A;  2QGF B;  1H64 1;  1IB8 A;  4RTW A;  1WHH A;  5FRO A;  1C6V X;  4NL2 A;  2QDY B;  4M78 D;  3LW5 E;  4PJL A;  4WTO B;  3RKX A;  2WSE E;  1TWB A;  4EMK A;  1Y96 A;  1ARK A;  4OGC A;  3V8K A;  3INZ A;  3HP9 A;  4FCY A;  1I0C A;  4Y92 A;  2XMF A;  2BZ8 A;  1X6B A;  3NFC A;  4XU1 A;  5HKC A;  3EG0 A;  1KQ2 A;  3OYK A;  2M02 A;  2C0I A;  3RNJ A;  4OVA A;  1W1F A;  1VQP T;  3OYY A;  2EGE A;  3MCA B;  3KXT A;  2DVJ A;  4PJJ A;  3HRS A;  9ATC B;  4FM4 B;  3L2Z A;  2KMT A;  1MNE A;  5GAN h;  4HCK A;  2MK5 A;  3M59 A;  3EG9 A;  4HCZ A;  3G6E A;  4EMK B;  4PK4 A;  3DB3 A;  2V8K A;  1PG5 B;  1J3T A;  2JN0 A;  3J7A F;  1QW1 A;  5GAN j;  2D0Q B;  2EVR A;  5LJ5 d;  2F5K A;  2RMO A;  4LDW A;  1T0J A;  2HQE A;  1Q81 C;  2JT4 A;  1LVK A;  4F17 A;  1NYG A;  2KK4 A;  3CEY A;  1H8K A;  1AHJ B;  4D8K A;  1BCM A;  2HQX A;  4ESR A;  1RAD B;  2ZZD A;  5FWB A;  4ATO A;  1AWW A;  4A4F A;  1M8M A;  2R5A A;  1GFD A;  1VQN Q;  1B7T A;  3JB9 G;  3HHT B;  2X3W D;  4EDU A;  2K3B A;  2RHY A;  1OPK A;  4PJN A;  4C92 G;  2NUT A;  1MV0 B;  2OJ2 A;  4QVZ A;  2VB6 A;  1D09 B;  1P92 A;  1ZA2 B;  1QVG A;  1RAA B;  4C92 E;  2ZGW A;  4A4K A;  1S1N A;  3RER A;  1MMG A;  4PFZ A;  3EGD A;  2DIG A;  4BY6 C;  3L2U A;  3VS3 A;  1ZA1 B;  5IHI A;  2L5Q A;  2D6F A;  5KYN A;  3CD6 A;  3OA6 A;  4M78 C;  3SB2 A;  1WI7 A;  3U23 A;  3M58 A;  2JOY A;  2BIV A;  1AD5 A;  3CQT A;  4QVC A;  3G7Z A;  1QVG S;  4B6M A;  2RQW A;  1SHF A;  3JCM e;  1OU9 A;  2JTF A;  4BAC A;  2PTK A;  5GAN 2;  4XK8 E;  4KBM B;  4LDU A;  2DE0 X;  1OUL A;  4JUV A;  1VQK T;  1NEB A;  1OX8 A;  4N0A A;  2DX1 A;  5CCA A;  2LC4 A;  5J39 A;  2D8J A;  2XIC A;  3VS6 A;  1K0S A;  2HEQ A;  2BZY A;  1FMW A;  3CCS Q;  1VQ6 A;  1BKB A;  2YUP A;  3M0P A;  2QAS A;  3MKD A;  4C8Q F;  4PFO A;  2A3L A;  5CKE A;  3MP6 A;  1PD1 A;  4J6Y A;  3QHS A;  3LWI A;  3M0U A;  4EIK A;  2PVD B;  4ORZ A;  1U8R A;  1OU8 A;  2WAC A;  5IXF A;  4LE9 A;  1JRI A;  4M7A D;  4M7D A;  2KYM A;  3CCU A;  3JCM X;  1N8R C;  2COW A;  3EAE A;  5LJ3 f;  3FJP A;  4M78 G;  2XG8 D;  1KD1 U;  2QQA A;  2G3R A;  3JB9 H;  3QDR B;  1Q95 G;  4JRK A;  3EH2 A;  3E19 A;  3JCM Q;  1VQN T;  5FRN A;  4FYY B;  1AZG B;  1JQQ A;  4C8Q C;  4RG8 A;  5HK3 A;  4IUV A;  1OX9 A;  5C0M A;  1OV3 A;  2DKG A;  1ZBX A;  2JXB A;  1YHQ Q;  5GAM e;  2PVO B;  4LNP A;  2QA4 A;  4M7D F;  3OBY A;  2OTL Q;  1VQ9 A;  4F7U B;  3QKJ A;  4DOW A;  4PJO B;  3CCM A;  2XDD A;  3OYI A;  1VQ5 A;  2C0T A;  4Z89 A;  1QWE A;  2P4T A;  2X4W A;  5FU7 B;  2DPP B;  1VIF A;  5D6W A;  2MI6 A;  3VKI A;  5GAO q;  2R5M A;  1ACM B;  4C8Q D;  4J9H A;  4OB2 B;  3DLM A;  4A4H A;  5GAO l;  3RES A;  4XU2 A;  1G5V A;  1KSW A;  2LJ0 A;  2LVM A;  4K11 A;  4EMH A;  4FU6 A;  2EW3 A;  1NJI U;  2EIF A;  5LJ3 e;  2D0N A;  5ECA A;  3CMA Q;  3NMZ C;  1TUG B;  3T9N A;  5KYU B;  4R55 A;  2DER A;  2LTO A;  3PNW C;  3CD6 Q;  5GJW B;  2JTM A;  2RI5 A;  1AEY A;  2HMA A;  7AT1 B;  5FRM A;  4R0K A;  2RB6 A;  2JS0 A;  5M9O A;  2OTJ A;  4PJM A;  3I55 T;  1YJW A;  4C8Q G;  3L2W A;  1H3Z A;  2LT4 A;  2QTX A;  5GAM f;  1V76 A;  1R77 A;  1T0H A;  2E3H A;  3HFN A;  2L3Q A;  3I5S A;  4M75 C;  5GAN f;  3VS5 A;  4KUI A;  5LJ5 f;  4JPB W;  2VXE A;  4PJO E;  4AG1 C;  2KQW A;  4JLG A;  1VQ4 Q;  1PD0 A;  1OYX A;  1VIE A;  2JW4 A;  4MDW A;  1IXD A;  3MJX A;  2FPF A;  2GCX A;  3SD4 A;  4M77 G;  3CCM T;  3UWN A;  2EYW A;  1OOT A;  1W6X A;  4QQG A;  3CME A;  2HAX A;  4JRP A;  4RG2 A;  1Q81 R;  1YHQ T;  2FPD A;  2DJQ A;  4GBQ A;  3TU4 K;  4B9X A;  4M75 D;  2EGC A;  1OPL A;  4IKF A;  4AFQ C;  4M7D D;  2DD4 A;  2RK2 A;  2YUQ A;  4FL6 A;  1YIT A;  1YJW T;  1KD1 C;  2FG0 A;  1MV3 A;  1KC8 R;  2IG0 A;  2DZC A;  4ZNX A;  2RHZ A;  1UHC A;  1ZBJ A;  1G3Y A;  2P4R A;  2V26 A;  3O8V A;  4AFS C;  1JXO A;  2BE7 D;  1R0B G;  1PKS A;  2CZ7 B;  5DM7 R;  3VU3 C;  5LJ5 g;  3CXC P;  2AKK A;  1VQM A;  3A8M B;  1D0Z A;  3UPU A;  4BY6 B;  5IN1 A;  2MCN A;  3E9G A;  1BIA A;  5GAM g;  3V8L A;  2E3I A;  3OW2 A;  1VQ5 Q;  2RQT A;  1E7O A;  4RTY A;  4XTV A;  3BFM A;  3JB9 D;  2HZY A;  2LQK A;  4YTL A;  2E6Z A;  5GAN g;  1VQK Q;  2YWW A;  1T3S A;  2NLU A;  3GBQ A;  2K7A A;  3TVT A;  1WQ7 A;  1YIJ T;  1PM3 A;  1VQL A;  1FMV A;  1RUW A;  3NGP A;  3GLX A;  3PIO A;  1QWF A;  2A28 A;  4OP0 A;  3MHX A;  4LDY A;  5CQY A;  2JUF A;  4F16 A;  2LCL A;  2YHT A;  2ROT A;  1BU1 A;  2CSI A;  4XQ3 A;  1ZSZ A;  3RIR A;  1M3A A;  2ZPB B;  4NOY A;  3OSS C;  1K73 U;  1YJW Q;  3PT9 A;  2YDL A;  4HA8 A;  1D1A A;  5DLQ E;  2LQN A;  4GLK A;  4PFP A;  2HNI A;  5IHN A;  2CYZ B;  4M75 E;  4M78 F;  4HCC A;  3JCM P;  2ECZ A;  2HSE B;  1RAH B;  3ZEH A;  2MF2 A;  6AT1 B;  3GP8 A;  2QQ9 A;  2VC8 A;  1BYM A;  2FRW A;  1AVZ C;  3EH1 A;  3I35 A;  1JEG A;  1RLP C;  2F2W A;  1ZUK A;  1PNJ A;  3PFS A;  1ZLM A;  2K9G A;  2K3X A;  1I1J A;  2AZV A;  4XU3 A;  4MDX A;  3L2V A;  2EPD A;  2AHJ B;  5D6X A;  2LDM A;  1KK7 A;  2VUB A;  2GTJ A;  3VJP A;  4N4G A;  3EGX B;  2X9H A;  4BD3 A;  4HCB A;  4C0F A;  2RHX A;  3EFR A;  3G71 A;  1BI2 A;  3UAT A;  3P8B B;  3G4S Q;  2EYZ A;  1WQW A;  4M77 E;  4IUR A;  1K73 R;  4BI8 B;  5CR2 A;  2QA4 Q;  4QT7 A;  3VS7 A;  3CD6 T;  2OX7 A;  2ATC B;  1VA7 A;  2QG9 B;  2KR3 A;  2VGM A;  4BB7 A;  3EGU A;  2IVW A;  5GAN 4;  2YXY A;  1UUE A;  4KRT A;  2EKO A;  4KH1 B;  2BTT A;  2KEA A;  2FL7 A;  5LJ5 e;  3MET A;  3CCE A;  5GAM d;  4RCC A;  4RKU E;  3PVL A;  4V2S A;  2DTO A;  3QWY A;  2PUO B;  4DBR A;  2KRN A;  1FMK A;  1N8R U;  3UDC A;  1M1G A;  4NS5 A;  1NM7 A;  1GL5 A;  1JU5 C;  2LMJ A;  2ESW A;  5J3B A;  4PKC C;  3OYB A;  3OW2 P;  2CKK A;  4II1 A;  1M3C A;  3M55 A;  1VYU A;  2EQM A;  2AZS A;  3J81 E;  2Y4Y A;  1FX7 A;  3CCV A;  1SKU B;  3QZ5 B;  2E12 A;  4HXJ A;  2DL3 A;  1QVG P;  1WLP B;  5LJ5 h;  3CXC A;  1PRM C;  1M2V A;  2CH4 A;  3DB4 A;  1QP3 A;  2DF6 A;  2QGG A;  4BUG A;  1M90 R;  3OQ5 A;  3G6E Q;  2DIQ A;  3OYM A;  3BDU A;  3FB9 A;  3V7C A;  4ZN1 A;  2CT4 A;  4C92 D;  5GAN 3;  3PTA A;  1YJN A;  2LX9 A;  4J6X A;  2L3R A;  5KYW B;  1WJQ A;  2EBP A;  1VQ8 T;  2DBM A;  1WHG A;  4QVD A;  3C12 A;  1F1B B;  3L42 A;  1YJ9 Q;  1QMC A;  4KH0 B;  2PZ1 A;  3H41 A;  3QSU A;  1VOM A;  2HDA A;  1UGV A;  2VWF A;  5A0D A;  3ME9 A;  2RO0 A;  1RAC B;  3E9F A;  4BI4 A;  2K3Y A;  5L23 A;  1QCN A;  2J7I A;  5HK0 A;  1NJI C;  2DBK A;  4J7F A;  2DET A;  3OW2 S;  5GAO n;  2KT1 A;  1SEM A;  4M78 E;  1WZO A;  1D3B B;  1EFN A;  1X2K A;  1SSF A;  2LQW A;  3LWH A;  2VXF A;  2CZ1 B;  3QJ6 A;  3I56 T;  4F7U E;  2M0Y A;  2CUD A;  4LXC A;  2YLB A;  2KY9 A;  4M77 B;  3M0R A;  3H9N A;  1QVF P;  5CKF A;  2KXC A;  2RPN A;  2QI2 A;  4LUE A;  2K5F A;  1M30 A;  3EGX A;  2EJG A;  1TXQ A;  4M75 F;  2CP7 A;  2X51 A;  1KFZ A;  1AWO A;  4M78 B;  5GJV B;  4DBQ A;  3OYF A;  2G6F X;  8AT1 B;  1KC8 U;  2MYS A;  2R57 A;  3EG1 A;  3VYH B;  2RJE A;  1T3L A;  3V8J A;  3DKM A;  2DNU A;  2QA4 T;  3P8D A;  2YT6 A;  4M7D G;  5FU7 C;  5A0G A;  5FU6 B;  5EG2 A;  3VRZ A;  1VQL T;  4MZM A;  2LCS A;  1WPY A;  2DL8 A;  2CP3 A;  2K5I A;  1Y57 A;  1ZUY A;  4GY5 A;  3QO3 A;  1Y0M A;  4OMN A;  3OYA A;  1Q7Y C;  1VQO A;  1UGR B;  3CBM A;  2CT3 A;  4FW1 A;  4IUT A;  4HT8 A;  1RAF B;  3JAM E;  2A36 A;  4OMM A;  3JCM g;  2P84 A;  1BCO A;  3SWN B;  4C5E A;  3EG3 A;  2NYS A;  1XOV A;  2YSQ A;  3H0H A;  2CP2 A;  1QP2 A;  3JCM d;  2JS2 A;  3OYJ A;  5KYW A;  4M7A F;  3ASK A;  3MEV A;  4AG2 C;  3FDR A;  4E7L A;  3TSZ A;  1SSH A;  1ZUU A;  4AT1 B;  2RJC A;  1PC0 A;  2DEQ A;  1WYX A;  1YI2 T;  2DYB A;  5CKH A;  1GRI A;  1G2B A;  4Q5W A;  3OBW A;  2ZCF B;  2BZX A;  1M8V A;  3H0I A;  3JCM f;  1IZ6 A;  3CCM Q;  3V7S A;  4M7D C;  2GTO A;  4DA4 A;  3CC2 A;  2HQH A;  1Q86 R;  3N5B B;  3REA B;  4EPC A;  3UA6 A;  1LPL A;  4M4Z A;  1FWZ A;  3X26 B;  1NPP A;  1M1K R;  1D0X A;  2E1H A;  1RI0 A;  4FYW B;  1H3H A;  4XTW A;  1YIJ A;  4BE0 A;  2DJZ A;  1NPR A;  3I55 Q;  2CS7 A;  4J5Y A;  5KYY B;  2EJ9 A;  3C94 A;  1UGS B;  3CCJ Q;  2KXD A;  2L8D A;  3GF5 A;  2ROL A;  1KD1 R;  3CMA T;  1QQJ A;  1QVP A;  5KE3 A;  2JM8 A;  2VAS A;  1M3B A;  2JMA A;  4A54 A;  2HKQ B;  3JSC A;  2A08 A;  1X27 A;  1HSQ A;  4LN2 A;  4MZT A;  3BE3 A;  3VV0 A;  5IXB A;  4E7I A;  4AFU C;  3CXC S;  3M9Q A;  3VYG A;  4CC4 B;  3OS0 A;  2EYQ A;  1Y07 A;  2NUP B;  2K5L A;  1YWO A;  4M7A E;  1E6H A;  1RAG B;  2ENM A;  4A53 A;  5IHK A;  2MWP A;  3REB B;  2MOX A;  1VQ4 A;  2WSF E;  2LJ3 A;  1VQ7 T;  4A63 B;  1BI3 A;  3S3O A;  1IGU A;  2ZPE B;  2EWN A;  1U1S A;  1WHL A;  4OB3 B;  1ZX6 A;  1PHT A;  3ZL7 C;  3I9Q A;  2F69 A;  2MAM A;  3D7S B;  4PJO F;  1SPK A;  3OMG A;  1MND A;  3CC4 A;  2OAU A;  1I07 A;  2E65 A;  3LX7 A;  2C06 A;  3EGD B;  1NG2 A;  5LJ3 h;  1BI0 A;  3HPW A;  2DL5 A;  2LZ6 B;  4M7A B;  2O9S A;  3E1S A;  4RCB A;  1NJI R;  3PMI A;  3CCL Q;  5FW9 A;  1OZ3 A;  4IUQ A;  1Q86 C;  3OYE A;  3CME T;  5KYU A;  4M77 F;  2DFU A;  4OMP A;  1HXD A;  3X24 B;  4WCI A;  2JM9 A;  2QK0 A;  2EQJ A;  2F2V A;  1NE8 A;  3PMT A;  3I56 Q;  1WXU A;  2L3P A;  1AT1 B;  2PVG B;  4Z8A A;  2CZ0 B;  2EQI A;  2DMO A;  3ER0 A;  3X20 B;  3JCM h;  2EQU A;  1TU0 B;  4M75 G;  4FW2 A;  1XTD A;  1M2V B;  1U1T A;  1GFC A;  1VQN A;  1YP5 A;  4M78 A;  5GMK l;  2CGH A;  4C5H A;  2DEU A;  1O75 A;  3NPF A;  4D8D A;  4M7A A;  4CC2 A;  4DBF A;  2GBQ A;  3JB9 F;  2KNB B;  4KUL A;  3CC2 Q;  4F7U F;  4M77 C;  1VQ7 A;  2RJD A;  3H0F A;  3NHN A;  1QCO A;  5DLO A;  2KRM A;  4DOV A;  2X4Y A;  2ED0 A;  4C8Q B;  2C0O A;  1TTH B;  3P8H A;  2DK3 A;  3CME Q;  4N0A C;  5GMK e;  1UB4 A;  4PLL A;  1VYT A;  1B34 B;  3M4G A;  4JS5 A;  1M5Q 1;  3URG A;  2MPX C;  1K73 C;  2RJF A;  2FYK A;  3UA7 A;  2K4Y A;  1PSF A;  1YCS B;  2RQV A;  2JNG A;  2HCK A;  2P0P A;  2CUB A;  2YRV A;  2NUP A;  4ZTF A;  3CC7 A;  2E41 A;  4GLM A;  1G83 A;  2EAY A;  2FEI A;  1AWJ A;  4IIM A;  2EGA A;  1SG5 A;  3JRZ A;  2H8H A;  2DRM A;  2RI3 A;  2RNA A;  3LGL A;  2FZK B;  2SEM A;  1SRM A;  3CCR T;  3OS5 A;  3CCR A;  4CC7 A;  3FEO A;  4BE1 A;  1Q82 R;  1Y96 B;  2Z0W A;  4HVV A;  3CC7 Q;  2RD1 A;  4JS4 A;  4KGX B;  3WVE B;  2ZPG B;  1VQ9 T;  3M0T A;  2H3J A;  1K8A R;  2YRC A;  1GCP A;  3BDL A;  1JXM A;  3EHR A;  2LNV A;  1MMA A;  3QYG B;  4M7A G;  1RAI B;  3OYD A;  1KQS A;  2IIM A;  4IUP A;  1K9M C;  1K9M R;  5EC7 A;  4J9B A;  4KGV B;  3FC3 A;  3CC2 T;  2J6O A;  3RDV A;  3L2Q A;  1ZSG A;  2DVE A;  1PCX A;  5GAO m;  1XNI A;  2DRK A;  3MP1 A;  1VQP Q;  1RAE B;  4C0D B;  1YI2 Q;  2DTI A; 
#chains in the Genus database with same CATH homology
 2KSS A;  3RER A;  3QYH B;  3UDC A;  1M1G A;  2DIG A;  4NS5 A;  1I4K 1;  4BY6 C;  3L2U A;  5J3B A;  4PKC C;  3OYB A;  1KHC A;  4M75 B;  2L5Q A;  2D6F A;  1W4S A;  1I81 A;  2FHD A;  3CD6 A;  3OA6 A;  2CKK A;  4II1 A;  5GMK j;  3M55 A;  4PNO A;  5IT9 E;  2EQM A;  3M56 A;  4M78 C;  3SB2 A;  4X34 A;  4M7D B;  2Y90 A;  3M58 A;  3JB9 J;  2JOY A;  5CO7 A;  3J81 E;  1D3B A;  2BIV A;  2Y4Y A;  1FX7 A;  3QJY A;  4QVC A;  3G7Z A;  1QVG S;  5GAM h;  3CCV A;  1JJ2 S;  3QZ5 B;  2LRQ A;  2E12 A;  1X6O A;  1UGP B;  1M1F A;  4XTU A;  5LJ5 h;  3CXC A;  3JCM e;  3SWN A;  2HBP A;  3FIF A;  2JTF A;  5GAN d;  5GAN 8;  3J80 E;  3DB4 A;  1QP3 A;  3RMQ A;  4BAC A;  2M1H A;  3A8H B;  5GAN 2;  1Y7X A;  2LQ8 A;  4XK8 E;  3OQ5 A;  1B34 A;  2RK1 A;  4BUG A;  4KBM B;  3M4Y A;  3CPW A;  4KUD K;  2FB7 A;  3MEW A;  4LDU A;  2XKO C;  2DIQ A;  5GAO p;  2E70 A;  4VUB A;  1YCY A;  4JUV A;  4LDV A;  1VQK T;  1M9S A;  3OYM A;  1WJS A;  4N0A A;  3BDU A;  3OYC A;  3FB9 A;  2JZ2 A;  3V7C A;  4ZN1 A;  1JJ2 A;  3OSV A;  4C92 D;  3AHU A;  4FSX A;  2P0Q A;  5GAN 3;  5CCA A;  3PTA A;  2LX9 A;  1YJN A;  2LC4 A;  3OS2 A;  4J6X A;  5J39 A;  4IUU A;  2XIC A;  1K8A U;  2L3R A;  1WJQ A;  4C92 A;  1VQ8 T;  2PUK B;  5LJ5 j;  5CAI A;  3TRE A;  5KCO A;  2RI2 A;  2GFU A;  4QVD A;  1VQ6 A;  3C12 A;  1BKB A;  2DAQ A;  3L42 A;  4UC4 A;  3QSU A;  2XI9 A;  1X75 C;  3HKS A;  3OYG A;  4C8Q F;  4ZGD B;  5A0D A;  2A3L A;  5CKE A;  3ME9 A;  3MP6 A;  3X28 B;  2RO0 A;  4XTZ A;  3CC4 T;  1ZHI A;  4J6Y A;  3QHS A;  3E9F A;  3LWI A;  4BI4 A;  1VQM T;  2K3Y A;  3CPF A;  2PVD B;  2XU8 A;  4C0Z A;  4Y91 A;  5HK0 A;  1NJI C;  2GFA A;  4E7K A;  1YI2 A;  1U8R A;  4J7F A;  3OW2 S;  5D6Y A;  3MO8 A;  5GAO n;  3I55 A;  3JCM W;  1X01 A;  3RKY A;  3QG1 A;  2WAC A;  3G4S T;  4M78 E;  1JRI A;  1D3B B;  3C95 A;  1SSF A;  1M1K C;  3LWH A;  2VXF A;  2CZ1 B;  4M7D A;  4M7A D;  3CCU A;  3QJ6 A;  3JCM X;  3I56 T;  4F7U A;  5GAO r;  1N8R C;  2PQW A;  4F7U E;  1M4Z A;  3I56 A;  1N27 A;  3EAE A;  4C92 F;  3HL8 A;  5LJ3 f;  3FJP A;  2YLB A;  2KY9 A;  4M77 B;  4X9C A;  5AYF A;  4M78 G;  2XG8 D;  1KD1 U;  2QQA A;  3FLG A;  2G3R A;  3JB9 H;  3QDR B;  5CKF A;  4JRK A;  1VQN T;  3E19 A;  3JCM Q;  2P0K A;  5FRN A;  2QI2 A;  3CPW S;  2K5F A;  4OB0 B;  2EJG A;  1JBM A;  5L8R E;  3CCL A;  4C8Q C;  5LL6 S;  5FLX E;  1Q81 U;  4M75 F;  4RG8 A;  2ZPF B;  3QXE B;  2BKD N;  5HK3 A;  1RL2 A;  4IUV A;  4M7A E;  5C0M A;  3M54 A;  4M78 B;  2DKG A;  3L1A A;  5GMK i;  1ZBX A;  4EMK C;  3OYF A;  2QQB A;  2MMP A;  2ZPI B;  4J83 A;  4J8O A;  3S3N A;  1KC8 U;  2R57 A;  3VYH B;  1Q86 U;  2OTL T;  2RJE A;  2PVO B;  5GAM e;  3V8J A;  2QA4 A;  4M7D F;  3DKM A;  1HK9 A;  3OBY A;  3JCM b;  3RUX A;  2DO3 A;  2QA4 T;  1VQ9 A;  1YBY A;  3P8D A;  4M7A C;  4JLI A;  3JCM V;  3CCS A;  5FU7 C;  1W2B A;  2RHU A;  4M7D G;  3CBP A;  4F7U B;  3QKJ A;  5FU6 B;  4DOW A;  5A0G A;  4X9D A;  5CKB A;  2QEX T;  4C5G A;  3CCM A;  4PJO B;  4XAX B;  5EG2 A;  1VQ5 T;  4QW2 A;  2XDD A;  3KBG A;  3OYI A;  1VQ5 A;  3F70 A;  1VQL T;  1Q82 C;  4DQ2 A;  1YHQ A;  4MZM A;  2P4T A;  3C4S A;  2X4W A;  5FU7 B;  2DPP B;  1VIF A;  1WJR A;  1VUB A;  5D6W A;  2MI6 A;  1WPY A;  3VKI A;  5GAO q;  1VQ8 A;  4A4E A;  2K5I A;  2R5M A;  2OTL A;  4N4I A;  2RH2 A;  5GAN 5;  3H8Z A;  4O6J A;  5I2M A;  4M77 A;  4A4G A;  1YJN T;  4ZGJ B;  1LJO A;  4C8Q D;  4GY5 A;  3QO3 A;  1Q7Y C;  3OYA A;  2E5Q A;  2KDS A;  2VYT A;  4OB2 B;  1VQP A;  3DLM A;  4A4H A;  2E64 A;  5GAO l;  3S3M A;  1VQO A;  2M16 A;  1VQK A;  3L2R A;  3RES A;  4XU2 A;  3CCV T;  1G5V A;  1UGR B;  3CCL T;  2LVM A;  3RMS A;  2LCC A;  3CBM A;  4IUT A;  4EMH A;  3G6E T;  4HT8 A;  4FU6 A;  1NJI U;  4F7U G;  2EIF A;  3JAM E;  1YJ9 A;  4B9W A;  5LJ3 e;  4OMF B;  3JCM g;  1N9S A;  3SWN B;  2DXU A;  5GAM j;  3T9N A;  4C5E A;  4LD6 A;  4R55 A;  2V8J A;  2LTO A;  2VV5 A;  3HRT A;  3OB9 A;  1XOV A;  1R8O B;  1DJ7 B;  5GAN e;  5KCH A;  3PNW C;  5GMK h;  5HY6 A;  1QP2 A;  2JTM A;  1BI1 A;  3JCM d;  2RI5 A;  4ME7 A;  3HSB A;  5FRM A;  4JRI A;  4MMK A;  3OYJ A;  3CCQ A;  3EFS A;  2RB6 A;  4FT2 A;  3PGG A;  4ZN3 A;  3ZFJ A;  1VQO T;  3QUI A;  4M7A F;  3ASK A;  3GNF B;  3MEV A;  5M9O A;  3CMA A;  2OTJ A;  3FDR A;  4CRI A;  3I55 T;  4E7L A;  2VGN A;  2MWO A;  1YJW A;  4Z02 A;  3V7R A;  4C8Q G;  3L2W A;  1OI1 A;  2RJC A;  3M5A A;  2LT1 A;  2DEQ A;  4JJN K;  4D6W A;  1H3Z A;  1YI2 T;  2LT4 A;  2QTX A;  4ELZ C;  5CKH A;  5GAM f;  3CCE T;  2X4X A;  2O01 E;  4Q5W A;  3OBW A;  3GIB A;  3HFN A;  4M75 C;  3WXM B;  2ZCF B;  5GAN f;  1M8V A;  3LYI A;  4KUI A;  5LJ5 f;  3JCM f;  1IZ6 A;  2VXE A;  2Y4X A;  4JDS A;  4PJO E;  3V7S A;  1GXI E;  4MML A;  4M7D C;  3BY7 A;  4QQD A;  2KQW A;  4JLG A;  2GQV A;  4DA4 A;  3WVD B;  4E47 A;  2DXC A;  3CC2 A;  2DXB A;  1OYX A;  1VIE A;  1K8A C;  1QVF A;  1ZQ1 A;  3S6W A;  2ZPH B;  1YIT T;  3N5B B;  4MDW A;  1LNX A;  2GCX A;  3OMC A;  3SD4 A;  4EPC A;  2R58 A;  1N9R A;  3VUB A;  5I2S A;  5GMK m;  4M77 G;  3SDZ A;  2QEX A;  3CCM T;  5CIU A;  1G3T A;  1FWZ A;  3UWN A;  1EIF A;  3X26 B;  3MP8 A;  2XDB A;  2BUD A;  5GAN 7;  1NPP A;  3KUF A;  5FU6 C;  1PSE A;  2DZ9 A;  2HAX A;  4QQG A;  3CME A;  2E1H A;  1OZ2 A;  1RI0 A;  4JRP A;  4RG2 A;  3OYN A;  4XTW A;  4NL3 A;  1YHQ T;  1YIJ A;  3CBO A;  4PJO G;  5CQX A;  5GAN 6;  4BE0 A;  2DJZ A;  5LJ3 j;  1NPR A;  3GNG A;  3QPH A;  1BIB A;  3TU4 K;  4B9X A;  4M75 D;  4XU0 A;  2O4X A;  4OB1 B;  2CS7 A;  4IKF A;  3MEU A;  3X25 B;  4BI3 A;  4J5Y A;  4HKE A;  4C8Q E;  3CCQ T;  1M90 C;  3UT1 A;  2EJ9 A;  5CVI A;  3LH0 A;  3C94 A;  5C6S A;  1UGS B;  4M7D D;  3HRU A;  1JB0 E;  2DD4 A;  2RK2 A;  3CCU T;  2E6N A;  4C0G A;  3CCJ T;  2L8D A;  4FL6 A;  3GF5 A;  2K2V A;  3JCM J;  3M57 A;  1UGQ B;  4L5G A;  1YJW T;  1KD1 C;  3VUZ A;  5J26 A;  2V8I A;  1KQ1 A;  3CMA T;  3TCJ A;  4QQ6 A;  1QVP A;  2X4J A;  5KE3 A;  1YJ9 T;  2IG0 A;  2DZC A;  4A54 A;  2RHZ A;  2XID A;  3JSC A;  3SWN C;  2M9U A;  2E10 A;  4ZGE B;  4MZT A;  3VV0 A;  1G3Y A;  2XD0 A;  3O8V A;  4E7I A;  3CXC S;  3M9Q A;  2WSC E;  3VYG A;  3OS0 A;  2EYQ A;  2YLC A;  1IRE B;  1Y07 A;  4KT0 E;  3A8O B;  3HFO A;  3NTI A;  2K5L A;  3SFM A;  2CZ7 B;  4TVR A;  4OGE A;  3A8G B;  3VU3 C;  5LJ5 g;  5DM7 R;  3QBY A;  4C92 B;  4EMG A;  2B8A A;  1Q82 U;  4BDY A;  3JB9 I;  4FIB A;  1VQM A;  3A8M B;  4A53 A;  3UPU A;  4BY6 B;  2XHC A;  2MWP A;  1VQ4 A;  1MGQ A;  2WSF E;  4J7I A;  1VQ7 T;  5IN1 A;  4Y28 E;  3E9G A;  1BIA A;  1BI3 A;  2M0O A;  3S3O A;  3MEA A;  4WF2 A;  2ZPE B;  1I8F A;  5GAM g;  4C92 C;  1S72 T;  2EWN A;  3DLL A;  2EJF A;  3V8L A;  1U1S A;  3OW2 A;  4OB3 B;  1KC8 C;  1Q7Y U;  1VQ6 T;  1Y71 A;  3R6O A;  2F69 A;  3OYL A;  2MAM A;  4PJO F;  5LJ3 d;  4XTV A;  3OMG A;  4PL6 A;  1NZ9 A;  3CC4 A;  2OAU A;  3BFM A;  2E65 A;  3LX7 A;  2I2L A;  3JB9 D;  4BDZ A;  2C06 A;  3CC7 T;  2LQK A;  4YTL A;  2E6Z A;  5LJ3 h;  5GAN g;  1BI0 A;  1KHI A;  4P5N A;  1YIT A;  3JCM c;  4L59 A;  1FXX A;  3CCS T;  2EQK A;  4E7J A;  4PJO C;  3HPW A;  2NLU A;  3H6Z A;  4M7A B;  1M90 U;  3A5Z B;  1WQ7 A;  4R56 A;  3E1S A;  4PLI A;  4RCB A;  1YIJ T;  3PMI A;  5I21 A;  1VQL A;  4XTY A;  4HT9 A;  1OZ3 A;  1XQH A;  4IUQ A;  3GLX A;  5A2Q E;  2L89 A;  4ELY C;  3PIO A;  3OYE A;  4M77 F;  3CME T;  3A8L B;  4M77 D;  2DD5 A;  4E7H A;  4OP0 A;  1HXD A;  1G3W A;  3MHX A;  3X24 B;  4LD9 K;  1WNL A;  3NTK A;  4LDY A;  2CZ6 B;  3TEE A;  5CQY A;  4O5V A;  4CI0 C;  2JUF A;  2QQS A;  3NTH A;  3GPL A;  2QQR A;  2EQJ A;  2QXF A;  4FT4 A;  1QVF S;  2LCL A;  2YHT A;  1NE8 A;  4XTX A;  3PMT A;  5CK9 A;  4XQ3 A;  2PVG B;  3G4S A;  1KQS S;  2CZ0 B;  2XK0 A;  3RIR A;  1H64 1;  2ZPB B;  5FRO A;  4NOY A;  3ER0 A;  4C8Q A;  4NL2 A;  2QDY B;  3OSS C;  4M78 D;  3X20 B;  3JCM h;  2EQU A;  1K73 U;  3LW5 E;  3BW1 A;  4M75 G;  3PT9 A;  5KH6 A;  5KE2 A;  3RKX A;  1MHN A;  2WSE E;  1G3S A;  1XTD A;  2KVQ G;  4EMK A;  1U1T A;  1O9S A;  2GF7 A;  1V29 B;  4HA8 A;  5DLQ E;  1Y96 A;  1VQN A;  2RHI A;  4GLK A;  1I5L A;  2HNI A;  4M78 A;  4OGC A;  2F5T X;  5GMK l;  2CGH A;  3V8K A;  4C5H A;  3INZ A;  1O75 A;  4PJO D;  2CYZ B;  3HP9 A;  4M75 E;  4M7A A;  4M78 F;  4HCC A;  3NFC A;  4XU1 A;  5HKC A;  3JCM P;  3JB9 F;  4KUL A;  5DY9 A;  3ZEH A;  2K57 A;  2MF2 A;  3GP8 A;  2D9T A;  3Q1J A;  1KQ2 A;  4F7U F;  3OYK A;  1M1K U;  4J6W A;  4M77 C;  1K9M U;  1VQ7 A;  4OVA A;  2O4X B;  2QQ9 A;  2RJD A;  2VC8 A;  1BYM A;  1VQP T;  5DLO A;  4DOV A;  4M7D E;  2X4Y A;  3OYY A;  3LGF A;  3MCA B;  2EFI A;  4C8Q B;  3KXT A;  4MZP A;  2A7Y A;  3M53 A;  3P8H A;  3HRS A;  3PFS A;  2DK3 A;  4FM4 B;  4N0A C;  3G71 T;  3L2Z A;  2KMT A;  5GMK e;  1UB4 A;  3QZ9 B;  4PLL A;  5LJ3 g;  5GAN h;  1B34 B;  3M4G A;  4JS5 A;  3M59 A;  3GOX A;  1M5Q 1;  3URG A;  1K73 C;  4HCZ A;  2RJF A;  2K3X A;  3ZBD A;  4JRQ A;  3G6E A;  4EMK B;  4BE2 A;  2FYK A;  3DB3 A;  2K4Y A;  1PSF A;  2V8K A;  4XU3 A;  2JNG A;  4MDX A;  2JN0 A;  5CKD A;  2DXT A;  2P0P A;  1QW1 A;  5GAN j;  3J7A F;  3L2V A;  2AHJ B;  2KAF A;  2YRV A;  4ZTF A;  3CC7 A;  5D6X A;  2E41 A;  2LDM A;  2D0Q B;  2EAY A;  3OS1 A;  2VUB A;  4OF1 A;  5LJ5 d;  3JRZ A;  3VJP A;  2F5K A;  3FRN A;  4LDW A;  4N4G A;  2HQE A;  1Q81 C;  4BD3 A;  4HCB A;  4C0F A;  2RHX A;  4RMO A;  2RI3 A;  3EFR A;  1BI2 A;  3LGL A;  3P8B B;  4L6V 5;  3G71 A;  3CCR T;  3OS5 A;  2X35 A;  2KK4 A;  5IAY A;  3CCR A;  1WQW A;  3CEY A;  1N6A A;  3FEO A;  4BE1 A;  1AHJ B;  1Y96 B;  2RM4 A;  4M77 E;  2HQX A;  2RD1 A;  3QII A;  4IUR A;  1W2B S;  4BI8 B;  5CR2 A;  2ZZD A;  4JS4 A;  4ATO A;  4A4F A;  3WVE B;  2ZPG B;  1VQ9 T;  3CD6 T;  2R5A A;  2H3J A;  3PIP A;  4C5I A;  5A0L A;  3JB9 G;  3HHT B;  4LDX A;  1KG1 A;  4EDU A;  3BDL A;  2VGM A;  1S72 A;  1LOJ A;  4M75 A;  4BB7 A;  2LNV A;  2JVV A;  3QYG B;  4PJO A;  4M7A G;  2IVW A;  2RHY A;  3OYD A;  5GAN 4;  3OYH A;  4ZTJ A;  1KQS A;  2OTJ T;  4IUP A;  4C92 G;  1K9M C;  2EKO A;  1TH7 A;  1WGS A;  1VQ4 T;  3FC3 A;  2FL7 A;  2XDP A;  5LJ5 e;  3CC2 T;  4C0D C;  1UEB A;  3MET A;  3CCE A;  3L2Q A;  4QVZ A;  5GAM d;  2DVE A;  2RA2 A;  4N4H A;  4RCC A;  4RKU E;  2DTH A;  2FVU A;  4V2S A;  1P92 A;  5GAO m;  1XNI A;  2DTO A;  3RKW A;  2HD0 A;  3MP1 A;  2PUO B;  1QVG A;  3LLR A;  4C0D B;  3OY9 A;  4C92 E;  2PU9 B;  2ZGW A;  4A4K A;  1Q86 C;  3CCJ A;  1N8R U;  2DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...