1WHGA

Solution structure of the cap-gly domain in mouse tubulin specific chaperone b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin specific chaperone B
publication title Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whgA01
2CP7A 1WHJA 2CP2A 2COYA 1LPLA 2M02A 1TXQA 2MPXC 2COWA 1WHMA 2HL3A 3E2UA 2COZA 1IXDA 2CP3A 4B6MA 2E4HA 2HQHA 2CP6A 1WHKA 2CP0A 2HKQB 2E3HA 2HKNA 2CP5A 3TQ7P 1WHGA 1WHLA 2HL5C 1WHHA 2QK0A 2Z0WA 2E3IA 3RDVA 1TOVA
chains in the Genus database with same CATH superfamily
2KGTA 4JLIA 1AWJA 3M0SA 3H0HA 2VGNA 4M75G 2DLPA 3CCST 1OV3A 2JTFA 2GNCA 4PFPA 1M9SA 2A36A 2CREA 4BE1A 3QZ9B 4AG1C 4EMKA 1IGQA 3EG1A 3H41A 1ACMB 1NM7A 3RDVA 3A8OB 1AWWA 2ATCB 4RTTA 1YITQ 2LQKA 3ASKA 1VQ5A 4JS4A 2Y4YA 4PLIA 5FWCA 1Q82R 2IG0A 1BCMA 2FHDA 3OB9A 2RI5A 4JJNK 1M1KU 1R0BG 3CXCP 1PKSA 4N0AA 1NPPA 3OS1A 1QKXA 3NMZC 2KROA 2EPDA 5LJ3g 2PVGB 3V7SA 2ABLA 2OTLQ 2DF6A 4E7IA 2DEUA 1N9RA 1WI7A 3VS3A 1FX7A 4HA8A 4HCKA 1TWBA 1VQKT 1W1FA 2E5QA 2FO0A 4MZMA 4A4KA 5GMKi 1QMCA 1LOJA 2KQWA 3MEAA 4M77D 4N4HA 5HK3A 3CPWP 5HK0A 2DYBA 3EG9A 3RKXA 3C12A 2ZPHB 1Z9QA 4JZ3A 4PJNA 4F7UF 4ZN3A 1OPLA 3JCMd 2KDSA 3M57A 3CBMA 2K9GA 1RAEB 5GAMh 1KD1R 4BDZA 4KBMB 3G6ET 1TH7A 4OMMA 1YI2Q 2H3JA 2JS2A 2ECZA 2SRCA 3JRZA 2E3IA 2PZ1A 1VQOQ 1S72Q 1TOVA 4IKFA 2RK2A 6AT1B 5GAMe 3CXCA 1D1BA 4LDXA 3UATA 3CD6A 1B7TA 2P0KA 2XK0A 3JCMf 3QBYA 4X9CA 2RN8A 2KRSA 5GANh 3EG9B 1VQMA 1SF9A 1YBYA 2LCCA 2ED1A 3BE3A 5KE2A 2XD0A 5GANe 3L2ZA 3VJPA 3E19A 2DTIA 2AT1B 3CPWA 3EFOA 5LJ5g 1RAIB 2A08A 2KVQG 2RQTA 2EW3A 1WJSA 4B9WA 1ZQ1A 3CCVA 3INZA 4XU0A 3OS0A 3CCEA 2QA4A 2OTJQ 4PJOA 4M7DC 3UT1A 2COYA 2FZGB 3QKJA 5FU6C 1VQ7Q 2IIMA 4GBQA 4NOYA 4C8QF 4AFUC 1WDXA 2X4JA 2OI3A 3OQ5A 3QIIA 3CCLA 1GCQC 4MDXA 2LCLA 5CO7A 1U06A 4F04B 3OYEA 2AKKA 1ARKA 1WXBA 2R5MA 3SWNA 5D6YA 3V8LA 1R8OB 5KCOA 3M4YA 4ZN1A 1QCNA 3LX7A 4PLLA 4C92F 1WGSA 1YIJQ 1RLQC 2QGFB 1Q7YU 1ZUUA 2O9SA 4CC2A 3MEUA 2DIGA 1YITT 3JCMc 1PNJA 4A4HA 3JCMQ 4LD9K 3A8MB 3I5SA 5LJ3e 1PRMC 2JZ2A 4L6V5 2LDMA 3OW2S 4BY6B 1SKUB 4QQDA 1T0HA 4AT1B 3V8JA 1G8XA 1WX6A 2KYBA 3V8KA 5GAN4 2L0AA 4LXCA 4QVDA 2LMJA 5CK9A 1N8RR 4FW1A 4O6JA 4L59A 2OTLT 4CI0C 2VV5A 3PFSA 4PJOG 3SDZA 1Q86C 1B34A 3MEVA 2MIOA 1N9SA 2VVKA 2J6OA 4J7FA 2MMPA 4LDUA 1R0CB 4FT4A 1M4ZA 3WXMB 2F2VA 4M77A 4X1VA 1XJWB 1SRLA 2PU9B 2KY9A 1NG2A 4J6WA 4X9DA 4M7AA 3I9QA 2YSQA 3MKDA 1ZBXA 2RJEA 3RMSA 2D0QB 1YHQA 5FRMA 2DL5A 4BI4A 3OYDA 2RJFA 1WHHA 4LDWA 4XTVA 4C8QD 2K6DA 2D8HA 1YI2T 3NTKA 1UFFA 3BW1A 1VQOT 1S72T 2J6FA 2QTVA 4C8QE 3SFMA 1KQ1A 3CCMQ 4A54A 5LJ5h 4M77B 3EG2A 3EG0A 4NL3A 3PTAA 4RCBA 1E6GA 4OGEA 2W0ZA 5GAOq 1IRXA 5FU7B 4M4ZA 5LJ5e 2EJ9A 5J39A 4C92D 1AWOA 5FRNA 2WACA 1WNLA 4FU6A 3M5AA 3I55A 4XK8E 1QLYA 3VU3C 2DPPB 2KT8A 1VQ9Q 2XDDA 1WIEA 2V1QA 1VQ6Q 1D0XA 1VYVA 3BY7A 1NEGA 1N5ZA 2NUTA 1ZA2B 3OY9A 2VYTA 2XICA 1X6OA 3OYAA 2DD4A 2MYSA 1UHCA 2O31A 3OYKA 3QWYA 4OMNA 3G4SA 4E7LA 4M7AG 3GP8A 2OTJT 5KCHA 4Y92A 3OYCA 1G2BA 2KYMA 5DLQE 2VC8A 1VQ7T 2SEMA 2ZCFB 1D3BB 2R5AA 4FYYB 1U3OA 3GNFB 1M1KR 1MV3A 8ATCB 4J9FA 4KH1B 1AOJA 1C0MA 4M75E 2P4RA 2A37A 2CSQA 1O9SA 2JJ9A 2NUTB 4DEXA 5IHNA 1VQ4Q 2CH4W 4F7UA 1QW1A 2EAYA 1JJ2P 1YJNT 2NYSA 2HMAA 1RAAB 4A4EA 1YIJT 2FPEA 1YJWQ 3CCQT 3CC7Q 3CCSA 4HCBA 5GAOm 4JUVA 3VS1A 1RABB 3QXEB 3P8BB 2K7AA 3TU4K 2YT6A 4ESRA 1M5Q1 2GQIA 3I56T 2E3HA 3QUIA 5DLOA 3JCMb 3OYGA 4E7HA 2YWWA 1RAFB 1WXTA 3FB9A 1AWXA 3CCUQ 3UA6A 1UGVA 4F7UB 4C5HA 1FYNA 4PKCC 4MZPA 1VA7A 1F1BB 2ENMA 1OI1A 1V29B 1GBQA 1IHWA 1KQSS 1FWZA 2X4WA 1G3SA 3RMQA 3PMIA 3CC4Q 4M7DA 2XDBA 4GY5A 2WSCE 4M78F 1GXIE 3NTHA 4ZTFA 2FVUA 1TXQA 3DB4A 1YJ9T 5ECAA 1BIBA 1IGUA 5KYYA 4J9GA 4F7UG 5J26A 1U1SA 3M53A 3M58A 4BI3A 3CMET 2RQUA 3QPHA 1HJDA 2QG9B 3NPFA 2O4XB 1D0ZA 4KUDK 2CH4A 3X24B 2D9TA 4JLGA 3CCMT 3OYHA 3LWIA 1VYUA 2CZ1B 4C0FA 5GAN2 1K0XA 1UGPB 3G6EA 1PM3A 1G3YA 7AT1B 1KK7A 1GL5A 3HKSA 3VUBA 1GRIA 2PUOB 2KI7A 4D6WA 1IO6A 5KYUA 3HP9A 3VS0A 2E70A 2K3BA 5I2SA 3DKMA 3P8HA 1QVFS 4BY6C 2QQ9A 4C8QB 1BB9A 2DK3A 1G3WA 3S6WA 5KYXB 1VQ9T 2K2MA 4BUGA 1VQ8A 2K5LA 2YUOA 3MP1A 3DLMA 5KYNA 4AFQC 4E7JA 2BIVA 1FMKA 1Q7YR 4M7DG 1FXXA 1FMVA 1Q82C 4C92B 3TSWA 2ROLA 5D7UA 4Q5WA 5KYUB 2KBTA 2FRYA 4E47A 1KG1A 4QVCA 2AK5A 1NJIU 4XTZA 1KQSP 2VXEA 5GAOr 1X43A 2IVWA 2NUZA 1E6HA 2LQNA 4HT9A 1TS9A 2DO3A 1W2BS 3GNGA 3M0QA 3G71A 2JS0A 3L2RA 2AHJB 1KJWA 4M78E 4F16A 4E2FB 5FROA 1YJWT 2K57A 4WCIA 3CC7T 3C94A 4HKEA 2ZZDA 4M77C 5L8RE 3ZBDA 3PVQA 1UGSB 3CCRA 2P0QA 3FJPA 1N6AA 2H3EB 3M0PA 1O75A 3M56A 1U1TA 3PT9A 1KD1C 3EGDB 3RKYA 2ZPEB 1H3ZA 2F5TX 3A5ZB 5DM7R 2CGHA 2V1RA 1BK2A 2HZYA 2EKHA 3OYLA 1X2QA 4BE0A 3H0FA 3CCUT 2BZYA 1KQSA 3C4SA 4F17A 1VQPA 2V26A 1BIAA 4ME7A 2GTOA 5KYWB 2DD5A 1ZUYA 2HQEA 3JB9D 2F5KA 2EYZA 3JCMg 2DXTA 4PFOA 4C5IA 1JQQA 3TREA 3CC4T 4OB1B 4C5EA 1WXUA 1VOMA 2QXFA 2AZSA 2EGCA 2E4HA 3KXTA 1KC8C 2EGEA 5GAMd 1ZA1B 2E10A 1X75C 2V8IA 4FYXB 3L2QA 1K4US 1RAHB 1QWFA 4PJJA 2JTEA 1Q86U 3CMAA 4JRIA 4J9CA 1TUGB 4QQ6A 3Q1JA 5GAMf 2LX9A 5GMKh 2RQWA 2K5IA 2YLBA 5GANd 3FRNA 2DMOA 2JMAA 1MUZA 2V8JA 4LE9A 5GMKe 2JXBA 1QVFA 2DL3A 1VQ5Q 3L2WA 5CR2A 1ZSZB 3UA7A 1VQOA 3MO8A 2CZ0B 2DVEA 2QAZA 1K9MR 2L5QA 2Y4XA 4JRQA 3CQTA 3JCMW 5GANf 2QEXQ 1M2VB 4WF2A 2EQUA 1YN8A 3VKIA 1AHJB 3A1PA 1X01A 2QQSA 3REBB 2OJ2A 2HL5C 2E12A 4LUEA 4E6RA 2VXFA 1EZZB 1QWEA 1KHIA 4LN2A 4XQ3A 4DOVA 3JSCA 5CAIA 1RL2A 1XTDA 1M1FA 2MWOA 3U23A 3SB2A 4KGZB 1WZOA 1TSFA 3BDLA 4UC4A 2E5KA 3SHWA 2BZXA 2PTKA 2KXCA 1UE9A 1N8RC 1W2BA 3MHXA 2L2PA 1ABQA 2DJQA 3GIBA 2OTJA 1K9AA 1WLPB 2BE7D 2COWA 4IIOA 1WQWA 1Z9ZA 2M0OA 4JJDA 2CP3A 3FJ5A 3VS2A 1K8AC 2VWFA 2F69A 3HPWA 4PNOA 3HSBA 1JRIA 4MMLA 4XTWA 4BI8B 4RTZA 3CD6Q 5KH6A 2RB6A 2VB6A 4RTYA 5GAN3 5LJ3f 1BI1A 3NGPA 2PQWA 2EYYA 3OS2A 4FL6A 1YJNA 1RACB 2ROTA 2LQWA 2DETA 3URGA 1VQMQ 2DKGA 1ABOA 2HDAA 1YIJA 3CCQA 1PC0A 1T0JA 2HBWA 4C8QC 4BD3A 2DA9A 5GAOp 3I5RA 1C6VX 4RCCA 3QZ5B 1Y07A 2XDPA 5CQYA 1QVGS 2D0NA 4EPCA 3I56A 5GAN6 5LJ3h 4A4FA 3CCVQ 5FW9A 2D1XA 3H6ZA 3CCEQ 2A3LA 3LW5E 4DBQA 1X69A 4C92C 1Y96A 3META 2LT1A 4CRIA 1TG0A 3LLRA 2NUPB 4BACA 1Y7XA 4TVRA 1MMAA 2P0PA 3CCLQ 1LJOA 2D8JA 5IAYA 3OYBA 1KFZA 3PGGA 1D09B 3HFOA 2KRNA 5LJ5d 4FSXA 2RK1A 3CEYA 1T3SA 2KR3A 1Q81U 1YJ9A 2YDLA 4OB0B 5I11A 4M75F 2PNIA 1LCKA 2GBQA 4DEYA 1JXMA 1Y96B 1H92A 2FG0A 5CIUA 4AFZC 2X51A 1SSHA 3CMEA 1H8KA 2A0FB 1NJIR 2LNHB 5LJ5f 2E1HA 1YNZA 4X34A 1WHKA 2K3YA 1PD1A 2EBPA 3HFNA 4PK4A 1EIFA 3CCMA 1PG5B 4PJMA 1K73U 2QEXT 4E7SA 3RERA 3FIFA 4WTOB 3M4GA 2HNIA 3EH2A 5KE3A 4QW2A 2DRMA 3JB9G 3CC2A 3OYNA 4OMPA 1VQNA 1RLPC 1X2KA 1JXOA 1UEBA 2CP0A 4R56A 2CZ7B 2O9VA 2RJCA 2RHYA 4M7DE 2JNGA 5CCAA 1PSEA 3OYIA 2PVOB 1DJ7B 2BKDN 4NL2A 2CDTA 3HRUA 4OP0A 5FLXE 3X28B 2K4YA 4L5GA 4V2SA 5GAN7 1D3BA 1QP2A 2YRCA 1VQLQ 2CP6A 3RUXA 3TEEA 4CC3A 2D6FA 2OAUA 3OYYA 5I22A 1EX4A 3OA6A 1I5LA 3OW2P 2QK0A 1WJRA 1I5OB 2L89A 2LNVA 3LYIA 4JS5A 1OU8A 4OB3B 4M77G 3OMCA 1W6XA 2EFIA 3JB9I 2YHTA 3CD6T 2C0OA 3M0UA 2B8AA 1MMGA 2PVDB 3HL8A 3LWHA 4J83A 1LNXA 1D1CA 4RG8A 4M75D 4MZTA 1ZSZC 5AYFA 1P92A 1VQMT 2MAMA 1YJWA 2CP7A 5C0MA 1OX9A 3GPLA 1QVGA 4OGCA 3VS6A 4EMGA 1Q86R 2FB7A 1B3QA 2KEAA 1M90U 2C0TA 3VS5A 2DBMA 1YP5A 1NPRA 4JRKA 4XTYA 2YXYA 4Z88A 1M3CA 4OVAA 3JB9H 1X6GA 1U8RA 3UPUA 4C0GA 3OW2A 3CCET 4QQGA 2L3RA 2ZPIB 1ZUKA 1AEYA 1UJYA 2CS7A 2RHIA 2JT4A 4Y28E 2KSSA 4J5YA 4XU2A 2FPFA 3RNJA 1S1NA 4C5GA 1AT1B 2X4YA 3VUZA 2DL7A 1NLOC 4OF1A 3QWXX 1Q7YC 4OMFB 1MNEA 3VYHB 4ORZA 3ER0A 4AG2C 2LQ8A 2AZVA 2G3RA 2QASA 4A63B 3OSVA 3TSZA 2ZPGB 2E65A 2AKLA 1XOVA 1KQ2A 2O4XA 3QJYA 3VS4A 2LZ6B 4MDWA 2NWMA 1KC8U 1RI9A 2J6KA 3EGUA 3O5ZA 3BDUA 1V76A 2FYKA 2K3XA 4IUTA 3SD4A 1VQKA 3R6OA 1U5SA 4M78C 2WSEE 3A98A 2GQVA 4C8QA 4ZTJA 3L2UA 5GJWB 5KYXA 1MHNA 2FZCB 5IHKA 3EH1A 1UB4A 2GGRA 3NHNA 1NYGA 3OMGA 5L23A 2QDYB 4J9IA 3EGXB 5GAOl 3RIRA 2EYWA 4DA4A 4C92A 5CKFA 2DAQA 1TU0B 2W10A 4GLKA 2FRWA 4PJOF 2GFAA 2EVRA 2MI6A 3RESA 2DERA 2XU8A 4GLMA 1RI0A 2XI9A 1VQLT 1WFWA 2BUDA 2XIDA 2DZ9A 3HHTB 2DXCA 1VQ6T 2LVMA 3QYHB 1GCPA 4Z02A 2NLUA 4Y91A 1WYXA 3OS5A 1J3TA 3JV3A 1QVPA 2QQAA 2L3QA 2GFUA 2HEQA 2DNUA 4LUDA 1WHJA 2MWPA 2HQXA 5EG2A 2RHUA 2I0NA 1SRMA 2FPDA 1W70A 2E6NA 4AFSC 4E7KA 1VYTA 4IURA 2RO0A 2RQRA 4J9HA 4C8QG 2P84A 2RHXA 3A8GB 4OMQA 2CSIA 2EJGA 3OYMA 3P8DA 1XQHA 1ZSGA 3REAB 3CCJQ 3C95A 1BI2A 3VV0A 2K79A 3EGDA 1VQ8Q 1YFNA 4M78D 3CXCS 1K8AU 1T3LA 2KE9A 2LCSA 1X6BA 1VQ4T 1AZGB 3IQLA 1Q81R 1HK9A 3FEOA 2MCNA 4DBRA 3ZL7C 3GF5A 1WHMA 3L2VA 3N5BB 1UGQB 4C92G 4ELYC 2KNBB 4M75B 5CKDA 2LRQA 5KYWA 3DB3A 1VIEA 2DRKA 1K9MC 4KGVB 2RI3A 1KHCA 5GJVB 1AVZC 4CC7A 3JB9J 3E9GA 1K73R 2KAFA 2RA2A 3QYGB 1RAGB 3X25B 2M02A 4RTVA 3CPWS 2DFUA 4M7AF 2LJ3A 2ED0A 1IREB 4RMOA 1YITA 1PRLC 2EGAA 5A0LA 3S3NA 1OOTA 2DXUA 4DQ2A 2FL7A 3G71Q 2RMOA 1QVFP 2JM9A 2ZPBB 2O01E 2LP5A 2HSPA 4PJOE 2KRMA 2WSFE 3S3MA 5HCKA 4C0DB 1UDLA 5GAMj 4J9DA 4FYVB 4HCZA 3EFRA 2QGGA 2CKKA 2OTLA 3H0IA 1IXDA 4RG2A 1OU9A 2VASA 4KGXB 4ZGEB 3CCRQ 5AT1B 4YTLA 1UJ0A 1ZSZA 2JW4A 2RM4A 4VUBA 1OZ2A 4IUPA 1JBMA 5GANj 1M2VA 2YUPA 3TCJA 3M54A 3PIPA 2CUBA 3JCMX 4J8OA 1VQPQ 3EAEA 3QDFA 2QQRA 3NTIA 2QEXA 1WJQA 2JUFA 3I35A 3OYJA 2RI2A 3DLLA 2IPOB 1W2BP 4PL6A 3MP8A 3UDCA 3QO3A 4PJLA 3TVTA 4KH0B 3A8LB 1YI2A 4EMKB 1C1AA 2M1HA 3GLXA 2YLCA 2VUBA 1S72A 2JN0A 4ZGDB 2DTOA 4A4GA 1AZEA 5GMKm 1V1CA 1PWTA 5M9OA 1M90R 4BE2A 4RUGA 1FMWA 1OULA 4FIBA 2Z0WA 5IXBA 5GAN8 1NEBA 3CMAQ 2CT3A 3JCMV 3UWNA 3LGLA 4M7AD 2HD0A 4HXJA 2EJFA 5CVIA 4ATOA 4M77E 2MF2A 4M7AE 4XU1A 1M2OA 2E6ZA 5A0DA 4DBHA 2HKNA 5CKEA 3JCMP 2EYXA 1M1GA 2EQMA 4BB7A 5LJ3j 1GFCA 3PVLA 1UUEA 2A7YA 4LNPA 4M78A 2LT4A 3HRSA 3EFSA 3KUFA 2RD1A 3CCJT 3QDRB 5LJ3d 3LH0A 4D8KA 1VQ8T 2HBPA 1SPKA 2YRVA 1VQ7A 2C06A 3ZEHA 4J6YA 3FLGA 2DL4A 5FWBA 2LC4A 2QQBA 4J9EA 4QVZA 5IHIA 2X3XD 1SHFA 1NJIC 1KC8R 1A0NB 4DBFA 5CQXA 4IIMA 1Q95G 2MPXC 3WVDB 4DOWA 5I21A 1BCOA 4IUVA 1JEGA 1VIFA 3VYGA 3PMTA 4FT2A 4M78B 3JCMh 3FDRA 4M7DF 4EDUA 2DXBA 2DYIA 3FC3A 2NUPA 2X9HA 2CP5A 4KRTA 1WQ7A 2KK4A 5GMKl 3JCMe 2GF7A 5GAN5 3KFVA 2M51A 3MP6A 4XTXA 2F2XA 3G71T 3M55A 1I0CA 1AD5A 2LTOA 4P5NA 3PE0A 2XG8D 3A8HB 3VRZA 5HY6A 2M9UA 4JPBW 3EFOB 2DZCA 1OZ3A 2QYZA 2QA4Q 1WHLA 2G6FX 1IZ6A 4R0KA 1M8VA 3OYFA 1R77A 3CCRT 2JOYA 4M78G 1YJNQ 1OYXA 2CP2A 1H641 2DX1A 5LJ5j 1W4SA 3OSSC 1M30A 4PJOB 3CCQQ 1CSKA 2X3WD 4F7UE 2KT1A 4N4IA 3H9NA 1QCFA 4LDYA 4N4GA 3BFMA 1I07A 2XMFA 2RPNA 3G1JA 3UF4A 1NYFA 1VQPT 1G83A 2J7IA 3I56Q 5CKHA 1LPLA 4Z8AA 4IUUA 5J3BA 3SWNB 2GTJA 1MMDA 1JB0E 3RR6A 4M75C 1M1KC 1UG1A 1VQ5T 2QI2A 3JAME 1YCSB 2FZKB 1NBEB 4NS5A 3MJXA 2VKNA 2DIQA 1YWOA 2L3PA 1ZLMA 3PIOA 1JU5C 1BI0A 1K8AR 4KULA 5HKCA 3LGFA 5IT9E 4LDVA 4HT8A 4M7DD 4RKUE 3RBBB 3CMAT 3EHQA 1YJ9Q 3ME9A 1VQLA 1JJ2S 2RQVA 1PHTA 3VRYA 2F2WA 4K11A 4O5VA 1VQ9A 2VGMA 2JM8A 1UECA 3WVEB 2YRDA 1D1AA 2RF0A 4C0DC 1G3TA 1VQ6A 3CMEQ 3M0TA 1QVGP 1UTIA 2DILA 2C0IA 1YWPA 4B9XA 1B34B 3MEWA 2HCKA 1IHVA 3X20B 3L42A 1YHQQ 2OAWA 1ZHIA 2I2LA 1QKWA 2PUKB 1CKBA 4PFZA 3G7ZA 1PKTA 4M7AB 3HTRA 3PNWC 1PD0A 4EMHA 1GBRA 5IH2A 4JJBA 3CC2Q 2DJZA 1Q82U 1VQNQ 3S3OA 2DBKA 1OQKA 2LX7A 3H8ZA 5D6XA 1M3AA 3E2UA 2COZA 2EQKA 3GBQA 9ATCB 4B6MA 4C92E 3QHSA 4XAXB 4OMOA 1QCOA 4Z89A 2RH2A 1VQ4A 2OX7A 3TQ7P 4J6XA 4EMKC 1PCXA 4EIKA 2XKOC 1MMNA 3E9FA 3C0CA 3ZFJA 3CC7A 3I55Q 4IUQA 1GFDA 5A2QE 3QJ6A 1KSWA 1B07A 2DTHA 3LH5A 1X27A 3KBGA 1SHGA 2HSEB 1Y0MA 4QT7A 2AIRB 3X26B 3CCVT 1K9MU 1SSFA 3OBYA 4N0AC 2O2OA 3G4SQ 1BKBA 1MV0B 3CCUA 2QA4T 1HD3A 2RNAA 2V8KA 4J9BA 1KD1U 2EWNA 4C0ZA 2J06A 4FYWB 1UHFA 3RKWA 1WA7A 3GOXA 4MMKA 1N27A 2FEIA 2RHZA 2YUQA 1QQJA 3CCLT 4ZGJB 2DEQA 4II1A 4ELZC 2DL8A 3CC4A 2O88A 5DY9A 3M0RA 4XU3A 3SEMA 4XTUA 2GCXA 4QKUA 2E64A 4LD6A 2EIFA 2K5FA 3J80E 1PSFA 4FCYA 2HQHA 2BE9B 3QSUA 1NE8A 1RUWA 2BTTA 3CCSQ 2DVJA 3EGXA 2F1LA 1OEBA 4HVUA 2R57A 4F14A 5C6SA 3V7RA 1I8FA 2CZ6B 2M0YA 1SG5A 1K76A 3AHUA 1JO8A 3MCAB 1BI3A 1NLPC 2HAXA 2B86A 1H3HA 4FW2A 1Q81C 1SEMA 4E7ZA 2R58A 1JJ2A 3E1SA 1WPYA 2X4XA 2M16A 1M27C 1YCYA 2L8DA 1GCQA 4A53A 2KXDA 1KIKA 2DM1A 3M59A 2HL3A 2EKOA 3CPFA 4RTUA 3THKA 4JJCA 3V7CA 4JDSA 1K73C 4FSSA 4KUIA 4RTXA 2ESWA 1G5VA 1HXDA 1RADB 3T9NA 1VQKQ 1YHQT 3J81E 4M7DB 2LJ0A 2DE0X 2YUNA 3MPUB 5FU6B 4JZ4A 4PJOC 1XNIA 3L1AA 1QP3A 5LL6S 3QG1A 1OX8A 3M9QA 5GAOn 3CC2T 2QDLA 1M8MA 1Y71A 2L3SA 2JVVA 2CT4A 2H8HA 1VQNT 1TUDA 1ZX6A 4OB2B 5KYYB 1HSQA 3AT1B 1MGQA 2X35A 4FM4B 3CCJA 4OMLA 1I4K1 3JB9F 4ANJA 5CKBA 3G6EQ 1I1JA 4M75A 3SWNC 1N8RU 5I2MA 4HCCA 2A28A 2J05A 3F70A 2ZAEA 5D6WA 2CUDA 5A0GA 2MK5A 3D7SB 4CC4B 2K2VA 1CKAA 3CBPA 1BBZA 2KMTA 3I55T 3VS7A 1TTHB 2XHCA 1VUBA 3J7AF 3EG3A 2JMCA 1HYOA 2MOXA 2ZGWA 5IXFA 4D8DA 4RTWA 2E41A 3OBWA 1MNDA 1K1ZA 1BYMA 1Y57A 1EFNA 1IB8A 2EQJA 4ZNXA 5GAMg 4AMCA 4KT0E 4R55A 4BDYA 4HVWA 1NZ9A 2Y90A 1TUCA 2HKQB 3JCMJ 3G4ST 1WHGA 2EQIA 4HVVA 3O8VA 2JTMA 1K0SA 2CYZB 2BZ8A 8AT1B 3NFCA 1M3BA 5GMKj 2LJ1A 3ULRB 1E7OA 1M90C 4M77F 2ZPFB 2EYQA 1UGRB 4J7IA 1LVKA 5EC7A 5GANg 3CBOA 1I81A 3EHRA 3HRTA 3R6NA 1OPKA 2P4TA 2QTXA 1BU1A 2RJDA 4PJOD 4M7AC 5IN1A 1D0YA 4JRPA 5FU7C 1ZBJA
chains in the Genus database with same CATH topology
2CP7A 1WHJA 2CP2A 2COYA 1LPLA 2M02A 1TXQA 2MPXC 2COWA 1WHMA 2HL3A 3E2UA 2COZA 1IXDA 2CP3A 4B6MA 2E4HA 2HQHA 2CP6A 1WHKA 2CP0A 2HKQB 2E3HA 2HKNA 2CP5A 3TQ7P 1WHGA 1WHLA 2HL5C 1WHHA 2QK0A 2Z0WA 2E3IA 3RDVA 1TOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP7 A;  1WHJ A;  2CP2 A;  2COY A;  1LPL A;  2M02 A;  1TXQ A;  2MPX C;  2COW A;  1WHM A;  2HL3 A;  3E2U A;  2COZ A;  1IXD A;  2CP3 A;  4B6M A;  2E4H A;  2HQH A;  2CP6 A;  1WHK A;  2CP0 A;  2HKQ B;  2E3H A;  2HKN A;  2CP5 A;  3TQ7 P;  1WHG A;  1WHL A;  2HL5 C;  1WHH A;  2QK0 A;  2Z0W A;  2E3I A;  3RDV A;  1TOV A; 
#chains in the Genus database with same CATH topology
 2KGT A;  4JLI A;  1AWJ A;  3M0S A;  3H0H A;  2VGN A;  4M75 G;  2DLP A;  3CCS T;  1OV3 A;  2JTF A;  2GNC A;  4PFP A;  1M9S A;  2A36 A;  2CRE A;  4BE1 A;  3QZ9 B;  4AG1 C;  4EMK A;  1IGQ A;  3EG1 A;  3H41 A;  1ACM B;  1NM7 A;  3RDV A;  3A8O B;  1AWW A;  2ATC B;  4RTT A;  1YIT Q;  2LQK A;  3ASK A;  1VQ5 A;  4JS4 A;  2Y4Y A;  4PLI A;  5FWC A;  1Q82 R;  2IG0 A;  1BCM A;  2FHD A;  3OB9 A;  2RI5 A;  4JJN K;  1M1K U;  1R0B G;  3CXC P;  1PKS A;  4N0A A;  1NPP A;  3OS1 A;  1QKX A;  3NMZ C;  2KRO A;  2EPD A;  5LJ3 g;  2PVG B;  3V7S A;  2ABL A;  2OTL Q;  2DF6 A;  4E7I A;  2DEU A;  1N9R A;  1WI7 A;  3VS3 A;  1FX7 A;  4HA8 A;  4HCK A;  1TWB A;  1VQK T;  1W1F A;  2E5Q A;  2FO0 A;  4MZM A;  4A4K A;  5GMK i;  1QMC A;  1LOJ A;  2KQW A;  3MEA A;  4M77 D;  4N4H A;  5HK3 A;  3CPW P;  5HK0 A;  2DYB A;  3EG9 A;  3RKX A;  3C12 A;  2ZPH B;  1Z9Q A;  4JZ3 A;  4PJN A;  4F7U F;  4ZN3 A;  1OPL A;  3JCM d;  2KDS A;  3M57 A;  3CBM A;  2K9G A;  1RAE B;  5GAM h;  1KD1 R;  4BDZ A;  4KBM B;  3G6E T;  1TH7 A;  4OMM A;  1YI2 Q;  2H3J A;  2JS2 A;  2ECZ A;  2SRC A;  3JRZ A;  2E3I A;  2PZ1 A;  1VQO Q;  1S72 Q;  1TOV A;  4IKF A;  2RK2 A;  6AT1 B;  5GAM e;  3CXC A;  1D1B A;  4LDX A;  3UAT A;  3CD6 A;  1B7T A;  2P0K A;  2XK0 A;  3JCM f;  3QBY A;  4X9C A;  2RN8 A;  2KRS A;  5GAN h;  3EG9 B;  1VQM A;  1SF9 A;  1YBY A;  2LCC A;  2ED1 A;  3BE3 A;  5KE2 A;  2XD0 A;  5GAN e;  3L2Z A;  3VJP A;  3E19 A;  2DTI A;  2AT1 B;  3CPW A;  3EFO A;  5LJ5 g;  1RAI B;  2A08 A;  2KVQ G;  2RQT A;  2EW3 A;  1WJS A;  4B9W A;  1ZQ1 A;  3CCV A;  3INZ A;  4XU0 A;  3OS0 A;  3CCE A;  2QA4 A;  2OTJ Q;  4PJO A;  4M7D C;  3UT1 A;  2COY A;  2FZG B;  3QKJ A;  5FU6 C;  1VQ7 Q;  2IIM A;  4GBQ A;  4NOY A;  4C8Q F;  4AFU C;  1WDX A;  2X4J A;  2OI3 A;  3OQ5 A;  3QII A;  3CCL A;  1GCQ C;  4MDX A;  2LCL A;  5CO7 A;  1U06 A;  4F04 B;  3OYE A;  2AKK A;  1ARK A;  1WXB A;  2R5M A;  3SWN A;  5D6Y A;  3V8L A;  1R8O B;  5KCO A;  3M4Y A;  4ZN1 A;  1QCN A;  3LX7 A;  4PLL A;  4C92 F;  1WGS A;  1YIJ Q;  1RLQ C;  2QGF B;  1Q7Y U;  1ZUU A;  2O9S A;  4CC2 A;  3MEU A;  2DIG A;  1YIT T;  3JCM c;  1PNJ A;  4A4H A;  3JCM Q;  4LD9 K;  3A8M B;  3I5S A;  5LJ3 e;  1PRM C;  2JZ2 A;  4L6V 5;  2LDM A;  3OW2 S;  4BY6 B;  1SKU B;  4QQD A;  1T0H A;  4AT1 B;  3V8J A;  1G8X A;  1WX6 A;  2KYB A;  3V8K A;  5GAN 4;  2L0A A;  4LXC A;  4QVD A;  2LMJ A;  5CK9 A;  1N8R R;  4FW1 A;  4O6J A;  4L59 A;  2OTL T;  4CI0 C;  2VV5 A;  3PFS A;  4PJO G;  3SDZ A;  1Q86 C;  1B34 A;  3MEV A;  2MIO A;  1N9S A;  2VVK A;  2J6O A;  4J7F A;  2MMP A;  4LDU A;  1R0C B;  4FT4 A;  1M4Z A;  3WXM B;  2F2V A;  4M77 A;  4X1V A;  1XJW B;  1SRL A;  2PU9 B;  2KY9 A;  1NG2 A;  4J6W A;  4X9D A;  4M7A A;  3I9Q A;  2YSQ A;  3MKD A;  1ZBX A;  2RJE A;  3RMS A;  2D0Q B;  1YHQ A;  5FRM A;  2DL5 A;  4BI4 A;  3OYD A;  2RJF A;  1WHH A;  4LDW A;  4XTV A;  4C8Q D;  2K6D A;  2D8H A;  1YI2 T;  3NTK A;  1UFF A;  3BW1 A;  1VQO T;  1S72 T;  2J6F A;  2QTV A;  4C8Q E;  3SFM A;  1KQ1 A;  3CCM Q;  4A54 A;  5LJ5 h;  4M77 B;  3EG2 A;  3EG0 A;  4NL3 A;  3PTA A;  4RCB A;  1E6G A;  4OGE A;  2W0Z A;  5GAO q;  1IRX A;  5FU7 B;  4M4Z A;  5LJ5 e;  2EJ9 A;  5J39 A;  4C92 D;  1AWO A;  5FRN A;  2WAC A;  1WNL A;  4FU6 A;  3M5A A;  3I55 A;  4XK8 E;  1QLY A;  3VU3 C;  2DPP B;  2KT8 A;  1VQ9 Q;  2XDD A;  1WIE A;  2V1Q A;  1VQ6 Q;  1D0X A;  1VYV A;  3BY7 A;  1NEG A;  1N5Z A;  2NUT A;  1ZA2 B;  3OY9 A;  2VYT A;  2XIC A;  1X6O A;  3OYA A;  2DD4 A;  2MYS A;  1UHC A;  2O31 A;  3OYK A;  3QWY A;  4OMN A;  3G4S A;  4E7L A;  4M7A G;  3GP8 A;  2OTJ T;  5KCH A;  4Y92 A;  3OYC A;  1G2B A;  2KYM A;  5DLQ E;  2VC8 A;  1VQ7 T;  2SEM A;  2ZCF B;  1D3B B;  2R5A A;  4FYY B;  1U3O A;  3GNF B;  1M1K R;  1MV3 A;  8ATC B;  4J9F A;  4KH1 B;  1AOJ A;  1C0M A;  4M75 E;  2P4R A;  2A37 A;  2CSQ A;  1O9S A;  2JJ9 A;  2NUT B;  4DEX A;  5IHN A;  1VQ4 Q;  2CH4 W;  4F7U A;  1QW1 A;  2EAY A;  1JJ2 P;  1YJN T;  2NYS A;  2HMA A;  1RAA B;  4A4E A;  1YIJ T;  2FPE A;  1YJW Q;  3CCQ T;  3CC7 Q;  3CCS A;  4HCB A;  5GAO m;  4JUV A;  3VS1 A;  1RAB B;  3QXE B;  3P8B B;  2K7A A;  3TU4 K;  2YT6 A;  4ESR A;  1M5Q 1;  2GQI A;  3I56 T;  2E3H A;  3QUI A;  5DLO A;  3JCM b;  3OYG A;  4E7H A;  2YWW A;  1RAF B;  1WXT A;  3FB9 A;  1AWX A;  3CCU Q;  3UA6 A;  1UGV A;  4F7U B;  4C5H A;  1FYN A;  4PKC C;  4MZP A;  1VA7 A;  1F1B B;  2ENM A;  1OI1 A;  1V29 B;  1GBQ A;  1IHW A;  1KQS S;  1FWZ A;  2X4W A;  1G3S A;  3RMQ A;  3PMI A;  3CC4 Q;  4M7D A;  2XDB A;  4GY5 A;  2WSC E;  4M78 F;  1GXI E;  3NTH A;  4ZTF A;  2FVU A;  1TXQ A;  3DB4 A;  1YJ9 T;  5ECA A;  1BIB A;  1IGU A;  5KYY A;  4J9G A;  4F7U G;  5J26 A;  1U1S A;  3M53 A;  3M58 A;  4BI3 A;  3CME T;  2RQU A;  3QPH A;  1HJD A;  2QG9 B;  3NPF A;  2O4X B;  1D0Z A;  4KUD K;  2CH4 A;  3X24 B;  2D9T A;  4JLG A;  3CCM T;  3OYH A;  3LWI A;  1VYU A;  2CZ1 B;  4C0F A;  5GAN 2;  1K0X A;  1UGP B;  3G6E A;  1PM3 A;  1G3Y A;  7AT1 B;  1KK7 A;  1GL5 A;  3HKS A;  3VUB A;  1GRI A;  2PUO B;  2KI7 A;  4D6W A;  1IO6 A;  5KYU A;  3HP9 A;  3VS0 A;  2E70 A;  2K3B A;  5I2S A;  3DKM A;  3P8H A;  1QVF S;  4BY6 C;  2QQ9 A;  4C8Q B;  1BB9 A;  2DK3 A;  1G3W A;  3S6W A;  5KYX B;  1VQ9 T;  2K2M A;  4BUG A;  1VQ8 A;  2K5L A;  2YUO A;  3MP1 A;  3DLM A;  5KYN A;  4AFQ C;  4E7J A;  2BIV A;  1FMK A;  1Q7Y R;  4M7D G;  1FXX A;  1FMV A;  1Q82 C;  4C92 B;  3TSW A;  2ROL A;  5D7U A;  4Q5W A;  5KYU B;  2KBT A;  2FRY A;  4E47 A;  1KG1 A;  4QVC A;  2AK5 A;  1NJI U;  4XTZ A;  1KQS P;  2VXE A;  5GAO r;  1X43 A;  2IVW A;  2NUZ A;  1E6H A;  2LQN A;  4HT9 A;  1TS9 A;  2DO3 A;  1W2B S;  3GNG A;  3M0Q A;  3G71 A;  2JS0 A;  3L2R A;  2AHJ B;  1KJW A;  4M78 E;  4F16 A;  4E2F B;  5FRO A;  1YJW T;  2K57 A;  4WCI A;  3CC7 T;  3C94 A;  4HKE A;  2ZZD A;  4M77 C;  5L8R E;  3ZBD A;  3PVQ A;  1UGS B;  3CCR A;  2P0Q A;  3FJP A;  1N6A A;  2H3E B;  3M0P A;  1O75 A;  3M56 A;  1U1T A;  3PT9 A;  1KD1 C;  3EGD B;  3RKY A;  2ZPE B;  1H3Z A;  2F5T X;  3A5Z B;  5DM7 R;  2CGH A;  2V1R A;  1BK2 A;  2HZY A;  2EKH A;  3OYL A;  1X2Q A;  4BE0 A;  3H0F A;  3CCU T;  2BZY A;  1KQS A;  3C4S A;  4F17 A;  1VQP A;  2V26 A;  1BIA A;  4ME7 A;  2GTO A;  5KYW B;  2DD5 A;  1ZUY A;  2HQE A;  3JB9 D;  2F5K A;  2EYZ A;  3JCM g;  2DXT A;  4PFO A;  4C5I A;  1JQQ A;  3TRE A;  3CC4 T;  4OB1 B;  4C5E A;  1WXU A;  1VOM A;  2QXF A;  2AZS A;  2EGC A;  2E4H A;  3KXT A;  1KC8 C;  2EGE A;  5GAM d;  1ZA1 B;  2E10 A;  1X75 C;  2V8I A;  4FYX B;  3L2Q A;  1K4U S;  1RAH B;  1QWF A;  4PJJ A;  2JTE A;  1Q86 U;  3CMA A;  4JRI A;  4J9C A;  1TUG B;  4QQ6 A;  3Q1J A;  5GAM f;  2LX9 A;  5GMK h;  2RQW A;  2K5I A;  2YLB A;  5GAN d;  3FRN A;  2DMO A;  2JMA A;  1MUZ A;  2V8J A;  4LE9 A;  5GMK e;  2JXB A;  1QVF A;  2DL3 A;  1VQ5 Q;  3L2W A;  5CR2 A;  1ZSZ B;  3UA7 A;  1VQO A;  3MO8 A;  2CZ0 B;  2DVE A;  2QAZ A;  1K9M R;  2L5Q A;  2Y4X A;  4JRQ A;  3CQT A;  3JCM W;  5GAN f;  2QEX Q;  1M2V B;  4WF2 A;  2EQU A;  1YN8 A;  3VKI A;  1AHJ B;  3A1P A;  1X01 A;  2QQS A;  3REB B;  2OJ2 A;  2HL5 C;  2E12 A;  4LUE A;  4E6R A;  2VXF A;  1EZZ B;  1QWE A;  1KHI A;  4LN2 A;  4XQ3 A;  4DOV A;  3JSC A;  5CAI A;  1RL2 A;  1XTD A;  1M1F A;  2MWO A;  3U23 A;  3SB2 A;  4KGZ B;  1WZO A;  1TSF A;  3BDL A;  4UC4 A;  2E5K A;  3SHW A;  2BZX A;  2PTK A;  2KXC A;  1UE9 A;  1N8R C;  1W2B A;  3MHX A;  2L2P A;  1ABQ A;  2DJQ A;  3GIB A;  2OTJ A;  1K9A A;  1WLP B;  2BE7 D;  2COW A;  4IIO A;  1WQW A;  1Z9Z A;  2M0O A;  4JJD A;  2CP3 A;  3FJ5 A;  3VS2 A;  1K8A C;  2VWF A;  2F69 A;  3HPW A;  4PNO A;  3HSB A;  1JRI A;  4MML A;  4XTW A;  4BI8 B;  4RTZ A;  3CD6 Q;  5KH6 A;  2RB6 A;  2VB6 A;  4RTY A;  5GAN 3;  5LJ3 f;  1BI1 A;  3NGP A;  2PQW A;  2EYY A;  3OS2 A;  4FL6 A;  1YJN A;  1RAC B;  2ROT A;  2LQW A;  2DET A;  3URG A;  1VQM Q;  2DKG A;  1ABO A;  2HDA A;  1YIJ A;  3CCQ A;  1PC0 A;  1T0J A;  2HBW A;  4C8Q C;  4BD3 A;  2DA9 A;  5GAO p;  3I5R A;  1C6V X;  4RCC A;  3QZ5 B;  1Y07 A;  2XDP A;  5CQY A;  1QVG S;  2D0N A;  4EPC A;  3I56 A;  5GAN 6;  5LJ3 h;  4A4F A;  3CCV Q;  5FW9 A;  2D1X A;  3H6Z A;  3CCE Q;  2A3L A;  3LW5 E;  4DBQ A;  1X69 A;  4C92 C;  1Y96 A;  3MET A;  2LT1 A;  4CRI A;  1TG0 A;  3LLR A;  2NUP B;  4BAC A;  1Y7X A;  4TVR A;  1MMA A;  2P0P A;  3CCL Q;  1LJO A;  2D8J A;  5IAY A;  3OYB A;  1KFZ A;  3PGG A;  1D09 B;  3HFO A;  2KRN A;  5LJ5 d;  4FSX A;  2RK1 A;  3CEY A;  1T3S A;  2KR3 A;  1Q81 U;  1YJ9 A;  2YDL A;  4OB0 B;  5I11 A;  4M75 F;  2PNI A;  1LCK A;  2GBQ A;  4DEY A;  1JXM A;  1Y96 B;  1H92 A;  2FG0 A;  5CIU A;  4AFZ C;  2X51 A;  1SSH A;  3CME A;  1H8K A;  2A0F B;  1NJI R;  2LNH B;  5LJ5 f;  2E1H A;  1YNZ A;  4X34 A;  1WHK A;  2K3Y A;  1PD1 A;  2EBP A;  3HFN A;  4PK4 A;  1EIF A;  3CCM A;  1PG5 B;  4PJM A;  1K73 U;  2QEX T;  4E7S A;  3RER A;  3FIF A;  4WTO B;  3M4G A;  2HNI A;  3EH2 A;  5KE3 A;  4QW2 A;  2DRM A;  3JB9 G;  3CC2 A;  3OYN A;  4OMP A;  1VQN A;  1RLP C;  1X2K A;  1JXO A;  1UEB A;  2CP0 A;  4R56 A;  2CZ7 B;  2O9V A;  2RJC A;  2RHY A;  4M7D E;  2JNG A;  5CCA A;  1PSE A;  3OYI A;  2PVO B;  1DJ7 B;  2BKD N;  4NL2 A;  2CDT A;  3HRU A;  4OP0 A;  5FLX E;  3X28 B;  2K4Y A;  4L5G A;  4V2S A;  5GAN 7;  1D3B A;  1QP2 A;  2YRC A;  1VQL Q;  2CP6 A;  3RUX A;  3TEE A;  4CC3 A;  2D6F A;  2OAU A;  3OYY A;  5I22 A;  1EX4 A;  3OA6 A;  1I5L A;  3OW2 P;  2QK0 A;  1WJR A;  1I5O B;  2L89 A;  2LNV A;  3LYI A;  4JS5 A;  1OU8 A;  4OB3 B;  4M77 G;  3OMC A;  1W6X A;  2EFI A;  3JB9 I;  2YHT A;  3CD6 T;  2C0O A;  3M0U A;  2B8A A;  1MMG A;  2PVD B;  3HL8 A;  3LWH A;  4J83 A;  1LNX A;  1D1C A;  4RG8 A;  4M75 D;  4MZT A;  1ZSZ C;  5AYF A;  1P92 A;  1VQM T;  2MAM A;  1YJW A;  2CP7 A;  5C0M A;  1OX9 A;  3GPL A;  1QVG A;  4OGC A;  3VS6 A;  4EMG A;  1Q86 R;  2FB7 A;  1B3Q A;  2KEA A;  1M90 U;  2C0T A;  3VS5 A;  2DBM A;  1YP5 A;  1NPR A;  4JRK A;  4XTY A;  2YXY A;  4Z88 A;  1M3C A;  4OVA A;  3JB9 H;  1X6G A;  1U8R A;  3UPU A;  4C0G A;  3OW2 A;  3CCE T;  4QQG A;  2L3R A;  2ZPI B;  1ZUK A;  1AEY A;  1UJY A;  2CS7 A;  2RHI A;  2JT4 A;  4Y28 E;  2KSS A;  4J5Y A;  4XU2 A;  2FPF A;  3RNJ A;  1S1N A;  4C5G A;  1AT1 B;  2X4Y A;  3VUZ A;  2DL7 A;  1NLO C;  4OF1 A;  3QWX X;  1Q7Y C;  4OMF B;  1MNE A;  3VYH B;  4ORZ A;  3ER0 A;  4AG2 C;  2LQ8 A;  2AZV A;  2G3R A;  2QAS A;  4A63 B;  3OSV A;  3TSZ A;  2ZPG B;  2E65 A;  2AKL A;  1XOV A;  1KQ2 A;  2O4X A;  3QJY A;  3VS4 A;  2LZ6 B;  4MDW A;  2NWM A;  1KC8 U;  1RI9 A;  2J6K A;  3EGU A;  3O5Z A;  3BDU A;  1V76 A;  2FYK A;  2K3X A;  4IUT A;  3SD4 A;  1VQK A;  3R6O A;  1U5S A;  4M78 C;  2WSE E;  3A98 A;  2GQV A;  4C8Q A;  4ZTJ A;  3L2U A;  5GJW B;  5KYX A;  1MHN A;  2FZC B;  5IHK A;  3EH1 A;  1UB4 A;  2GGR A;  3NHN A;  1NYG A;  3OMG A;  5L23 A;  2QDY B;  4J9I A;  3EGX B;  5GAO l;  3RIR A;  2EYW A;  4DA4 A;  4C92 A;  5CKF A;  2DAQ A;  1TU0 B;  2W10 A;  4GLK A;  2FRW A;  4PJO F;  2GFA A;  2EVR A;  2MI6 A;  3RES A;  2DER A;  2XU8 A;  4GLM A;  1RI0 A;  2XI9 A;  1VQL T;  1WFW A;  2BUD A;  2XID A;  2DZ9 A;  3HHT B;  2DXC A;  1VQ6 T;  2LVM A;  3QYH B;  1GCP A;  4Z02 A;  2NLU A;  4Y91 A;  1WYX A;  3OS5 A;  1J3T A;  3JV3 A;  1QVP A;  2QQA A;  2L3Q A;  2GFU A;  2HEQ A;  2DNU A;  4LUD A;  1WHJ A;  2MWP A;  2HQX A;  5EG2 A;  2RHU A;  2I0N A;  1SRM A;  2FPD A;  1W70 A;  2E6N A;  4AFS C;  4E7K A;  1VYT A;  4IUR A;  2RO0 A;  2RQR A;  4J9H A;  4C8Q G;  2P84 A;  2RHX A;  3A8G B;  4OMQ A;  2CSI A;  2EJG A;  3OYM A;  3P8D A;  1XQH A;  1ZSG A;  3REA B;  3CCJ Q;  3C95 A;  1BI2 A;  3VV0 A;  2K79 A;  3EGD A;  1VQ8 Q;  1YFN A;  4M78 D;  3CXC S;  1K8A U;  1T3L A;  2KE9 A;  2LCS A;  1X6B A;  1VQ4 T;  1AZG B;  3IQL A;  1Q81 R;  1HK9 A;  3FEO A;  2MCN A;  4DBR A;  3ZL7 C;  3GF5 A;  1WHM A;  3L2V A;  3N5B B;  1UGQ B;  4C92 G;  4ELY C;  2KNB B;  4M75 B;  5CKD A;  2LRQ A;  5KYW A;  3DB3 A;  1VIE A;  2DRK A;  1K9M C;  4KGV B;  2RI3 A;  1KHC A;  5GJV B;  1AVZ C;  4CC7 A;  3JB9 J;  3E9G A;  1K73 R;  2KAF A;  2RA2 A;  3QYG B;  1RAG B;  3X25 B;  2M02 A;  4RTV A;  3CPW S;  2DFU A;  4M7A F;  2LJ3 A;  2ED0 A;  1IRE B;  4RMO A;  1YIT A;  1PRL C;  2EGA A;  5A0L A;  3S3N A;  1OOT A;  2DXU A;  4DQ2 A;  2FL7 A;  3G71 Q;  2RMO A;  1QVF P;  2JM9 A;  2ZPB B;  2O01 E;  2LP5 A;  2HSP A;  4PJO E;  2KRM A;  2WSF E;  3S3M A;  5HCK A;  4C0D B;  1UDL A;  5GAM j;  4J9D A;  4FYV B;  4HCZ A;  3EFR A;  2QGG A;  2CKK A;  2OTL A;  3H0I A;  1IXD A;  4RG2 A;  1OU9 A;  2VAS A;  4KGX B;  4ZGE B;  3CCR Q;  5AT1 B;  4YTL A;  1UJ0 A;  1ZSZ A;  2JW4 A;  2RM4 A;  4VUB A;  1OZ2 A;  4IUP A;  1JBM A;  5GAN j;  1M2V A;  2YUP A;  3TCJ A;  3M54 A;  3PIP A;  2CUB A;  3JCM X;  4J8O A;  1VQP Q;  3EAE A;  3QDF A;  2QQR A;  3NTI A;  2QEX A;  1WJQ A;  2JUF A;  3I35 A;  3OYJ A;  2RI2 A;  3DLL A;  2IPO B;  1W2B P;  4PL6 A;  3MP8 A;  3UDC A;  3QO3 A;  4PJL A;  3TVT A;  4KH0 B;  3A8L B;  1YI2 A;  4EMK B;  1C1A A;  2M1H A;  3GLX A;  2YLC A;  2VUB A;  1S72 A;  2JN0 A;  4ZGD B;  2DTO A;  4A4G A;  1AZE A;  5GMK m;  1V1C A;  1PWT A;  5M9O A;  1M90 R;  4BE2 A;  4RUG A;  1FMW A;  1OUL A;  4FIB A;  2Z0W A;  5IXB A;  5GAN 8;  1NEB A;  3CMA Q;  2CT3 A;  3JCM V;  3UWN A;  3LGL A;  4M7A D;  2HD0 A;  4HXJ A;  2EJF A;  5CVI A;  4ATO A;  4M77 E;  2MF2 A;  4M7A E;  4XU1 A;  1M2O A;  2E6Z A;  5A0D A;  4DBH A;  2HKN A;  5CKE A;  3JCM P;  2EYX A;  1M1G A;  2EQM A;  4BB7 A;  5LJ3 j;  1GFC A;  3PVL A;  1UUE A;  2A7Y A;  4LNP A;  4M78 A;  2LT4 A;  3HRS A;  3EFS A;  3KUF A;  2RD1 A;  3CCJ T;  3QDR B;  5LJ3 d;  3LH0 A;  4D8K A;  1VQ8 T;  2HBP A;  1SPK A;  2YRV A;  1VQ7 A;  2C06 A;  3ZEH A;  4J6Y A;  3FLG A;  2DL4 A;  5FWB A;  2LC4 A;  2QQB A;  4J9E A;  4QVZ A;  5IHI A;  2X3X D;  1SHF A;  1NJI C;  1KC8 R;  1A0N B;  4DBF A;  5CQX A;  4IIM A;  1Q95 G;  2MPX C;  3WVD B;  4DOW A;  5I21 A;  1BCO A;  4IUV A;  1JEG A;  1VIF A;  3VYG A;  3PMT A;  4FT2 A;  4M78 B;  3JCM h;  3FDR A;  4M7D F;  4EDU A;  2DXB A;  2DYI A;  3FC3 A;  2NUP A;  2X9H A;  2CP5 A;  4KRT A;  1WQ7 A;  2KK4 A;  5GMK l;  3JCM e;  2GF7 A;  5GAN 5;  3KFV A;  2M51 A;  3MP6 A;  4XTX A;  2F2X A;  3G71 T;  3M55 A;  1I0C A;  1AD5 A;  2LTO A;  4P5N A;  3PE0 A;  2XG8 D;  3A8H B;  3VRZ A;  5HY6 A;  2M9U A;  4JPB W;  3EFO B;  2DZC A;  1OZ3 A;  2QYZ A;  2QA4 Q;  1WHL A;  2G6F X;  1IZ6 A;  4R0K A;  1M8V A;  3OYF A;  1R77 A;  3CCR T;  2JOY A;  4M78 G;  1YJN Q;  1OYX A;  2CP2 A;  1H64 1;  2DX1 A;  5LJ5 j;  1W4S A;  3OSS C;  1M30 A;  4PJO B;  3CCQ Q;  1CSK A;  2X3W D;  4F7U E;  2KT1 A;  4N4I A;  3H9N A;  1QCF A;  4LDY A;  4N4G A;  3BFM A;  1I07 A;  2XMF A;  2RPN A;  3G1J A;  3UF4 A;  1NYF A;  1VQP T;  1G83 A;  2J7I A;  3I56 Q;  5CKH A;  1LPL A;  4Z8A A;  4IUU A;  5J3B A;  3SWN B;  2GTJ A;  1MMD A;  1JB0 E;  3RR6 A;  4M75 C;  1M1K C;  1UG1 A;  1VQ5 T;  2QI2 A;  3JAM E;  1YCS B;  2FZK B;  1NBE B;  4NS5 A;  3MJX A;  2VKN A;  2DIQ A;  1YWO A;  2L3P A;  1ZLM A;  3PIO A;  1JU5 C;  1BI0 A;  1K8A R;  4KUL A;  5HKC A;  3LGF A;  5IT9 E;  4LDV A;  4HT8 A;  4M7D D;  4RKU E;  3RBB B;  3CMA T;  3EHQ A;  1YJ9 Q;  3ME9 A;  1VQL A;  1JJ2 S;  2RQV A;  1PHT A;  3VRY A;  2F2W A;  4K11 A;  4O5V A;  1VQ9 A;  2VGM A;  2JM8 A;  1UEC A;  3WVE B;  2YRD A;  1D1A A;  2RF0 A;  4C0D C;  1G3T A;  1VQ6 A;  3CME Q;  3M0T A;  1QVG P;  1UTI A;  2DIL A;  2C0I A;  1YWP A;  4B9X A;  1B34 B;  3MEW A;  2HCK A;  1IHV A;  3X20 B;  3L42 A;  1YHQ Q;  2OAW A;  1ZHI A;  2I2L A;  1QKW A;  2PUK B;  1CKB A;  4PFZ A;  3G7Z A;  1PKT A;  4M7A B;  3HTR A;  3PNW C;  1PD0 A;  4EMH A;  1GBR A;  5IH2 A;  4JJB A;  3CC2 Q;  2DJZ A;  1Q82 U;  1VQN Q;  3S3O A;  2DBK A;  1OQK A;  2LX7 A;  3H8Z A;  5D6X A;  1M3A A;  3E2U A;  2COZ A;  2EQK A;  3GBQ A;  9ATC B;  4B6M A;  4C92 E;  3QHS A;  4XAX B;  4OMO A;  1QCO A;  4Z89 A;  2RH2 A;  1VQ4 A;  2OX7 A;  3TQ7 P;  4J6X A;  4EMK C;  1PCX A;  4EIK A;  2XKO C;  1MMN A;  3E9F A;  3C0C A;  3ZFJ A;  3CC7 A;  3I55 Q;  4IUQ A;  1GFD A;  5A2Q E;  3QJ6 A;  1KSW A;  1B07 A;  2DTH A;  3LH5 A;  1X27 A;  3KBG A;  1SHG A;  2HSE B;  1Y0M A;  4QT7 A;  2AIR B;  3X26 B;  3CCV T;  1K9M U;  1SSF A;  3OBY A;  4N0A C;  2O2O A;  3G4S Q;  1BKB A;  1MV0 B;  3CCU A;  2QA4 T;  1HD3 A;  2RNA A;  2V8K A;  4J9B A;  1KD1 U;  2EWN A;  4C0Z A;  2J06 A;  4FYW B;  1UHF A;  3RKW A;  1WA7 A;  3GOX A;  4MMK A;  1N27 A;  2FEI A;  2RHZ A;  2YUQ A;  1QQJ A;  3CCL T;  4ZGJ B;  2DEQ A;  4II1 A;  4ELZ C;  2DL8 A;  3CC4 A;  2O88 A;  5DY9 A;  3M0R A;  4XU3 A;  3SEM A;  4XTU A;  2GCX A;  4QKU A;  2E64 A;  4LD6 A;  2EIF A;  2K5F A;  3J80 E;  1PSF A;  4FCY A;  2HQH A;  2BE9 B;  3QSU A;  1NE8 A;  1RUW A;  2BTT A;  3CCS Q;  2DVJ A;  3EGX A;  2F1L A;  1OEB A;  4HVU A;  2R57 A;  4F14 A;  5C6S A;  3V7R A;  1I8F A;  2CZ6 B;  2M0Y A;  1SG5 A;  1K76 A;  3AHU A;  1JO8 A;  3MCA B;  1BI3 A;  1NLP C;  2HAX A;  2B86 A;  1H3H A;  4FW2 A;  1Q81 C;  1SEM A;  4E7Z A;  2R58 A;  1JJ2 A;  3E1S A;  1WPY A;  2X4X A;  2M16 A;  1M27 C;  1YCY A;  2L8D A;  1GCQ A;  4A53 A;  2KXD A;  1KIK A;  2DM1 A;  3M59 A;  2HL3 A;  2EKO A;  3CPF A;  4RTU A;  3THK A;  4JJC A;  3V7C A;  4JDS A;  1K73 C;  4FSS A;  4KUI A;  4RTX A;  2ESW A;  1G5V A;  1HXD A;  1RAD B;  3T9N A;  1VQK Q;  1YHQ T;  3J81 E;  4M7D B;  2LJ0 A;  2DE0 X;  2YUN A;  3MPU B;  5FU6 B;  4JZ4 A;  4PJO C;  1XNI A;  3L1A A;  1QP3 A;  5LL6 S;  3QG1 A;  1OX8 A;  3M9Q A;  5GAO n;  3CC2 T;  2QDL A;  1M8M A;  1Y71 A;  2L3S A;  2JVV A;  2CT4 A;  2H8H A;  1VQN T;  1TUD A;  1ZX6 A;  4OB2 B;  5KYY B;  1HSQ A;  3AT1 B;  1MGQ A;  2X35 A;  4FM4 B;  3CCJ A;  4OML A;  1I4K 1;  3JB9 F;  4ANJ A;  5CKB A;  3G6E Q;  1I1J A;  4M75 A;  3SWN C;  1N8R U;  5I2M A;  4HCC A;  2A28 A;  2J05 A;  3F70 A;  2ZAE A;  5D6W A;  2CUD A;  5A0G A;  2MK5 A;  3D7S B;  4CC4 B;  2K2V A;  1CKA A;  3CBP A;  1BBZ A;  2KMT A;  3I55 T;  3VS7 A;  1TTH B;  2XHC A;  1VUB A;  3J7A F;  3EG3 A;  2JMC A;  1HYO A;  2MOX A;  2ZGW A;  5IXF A;  4D8D A;  4RTW A;  2E41 A;  3OBW A;  1MND A;  1K1Z A;  1BYM A;  1Y57 A;  1EFN A;  1IB8 A;  2EQJ A;  4ZNX A;  5GAM g;  4AMC A;  4KT0 E;  4R55 A;  4BDY A;  4HVW A;  1NZ9 A;  2Y90 A;  1TUC A;  2HKQ B;  3JCM J;  3G4S T;  1WHG A;  2EQI A;  4HVV A;  3O8V A;  2JTM A;  1K0S A;  2CYZ B;  2BZ8 A;  8AT1 B;  3NFC A;  1M3B A;  5GMK j;  2LJ1 A;  3ULR B;  1E7O A;  1M90 C;  4M77 F;  2ZPF B;  2EYQ A;  1UGR B;  4J7I A;  1LVK A;  5EC7 A;  5GAN g;  3CBO A;  1I81 A;  3EHR A;  3HRT A;  3R6N A;  1OPK A;  2P4T A;  2QTX A;  1BU1 A;  2RJD A;  4PJO D;  4M7A C;  5IN1 A;  1D0Y A;  4JRP A;  5FU7 C;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 2CP7 A;  1WHJ A;  2CP2 A;  2COY A;  1LPL A;  2M02 A;  1TXQ A;  2MPX C;  2COW A;  1WHM A;  2HL3 A;  3E2U A;  2COZ A;  1IXD A;  2CP3 A;  4B6M A;  2E4H A;  2HQH A;  2CP6 A;  1WHK A;  2CP0 A;  2HKQ B;  2E3H A;  2HKN A;  2CP5 A;  3TQ7 P;  1WHG A;  1WHL A;  2HL5 C;  1WHH A;  2QK0 A;  2Z0W A;  2E3I A;  3RDV A;  1TOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...