1WHGA

Solution structure of the cap-gly domain in mouse tubulin specific chaperone b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin specific chaperone B
publication title Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whgA01
2CP2A 4B6MA 3E2UA 1WHGA 2HL3A 2MPXC 2CP7A 2HL5C 1TOVA 3TQ7P 1WHHA 2E4HA 2Z0WA 2COYA 2CP3A 2HQHA 2CP0A 2COWA 2CP6A 1WHLA 1WHMA 1TXQA 2HKQB 2HKNA 2E3IA 1WHKA 2E3HA 2M02A 1WHJA 1LPLA 3RDVA 1IXDA 2CP5A 2COZA 2QK0A
chains in the Genus database with same CATH superfamily
3EGDA 2DFUA 2P0PA 1IHVA 3M55A 2BZ8A 1LVKA 4IUTA 3M53A 2O88A 2D0NA 3CCLT 4PJOF 5CO7A 3H0IA 3TCJA 1KSWA 2JS0A 5CAIA 1VQ5Q 1Q86U 2MAMA 2BKDN 1HD3A 2JW4A 2AIRB 2CSIA 2NWMA 3VS6A 1YJWQ 5CK9A 1ZLMA 2MF2A 4BDZA 4QQGA 2YXYA 4F7UA 1NJIU 2FL7A 1KQSS 1XOVA 4P5NA 2YUNA 2EKHA 2MCNA 2CH4A 4ELYC 2RQWA 4R55A 3RKXA 4HXJA 5KYXA 5D6YA 1RI9A 2O9VA 4A4EA 4C0GA 4HT9A 2ROTA 1W2BS 4M75E 1JBMA 1O9SA 4Z88A 3G4SA 1Q81C 2D0QB 1G3WA 3UF4A 2HNIA 1RAFB 3CCRA 2KDSA 3CC4T 3CCUA 3CCMT 4M7DC 2RJCA 2DETA 2BE7D 4M75C 3GPLA 3CBOA 5FRNA 1MV3A 3JV3A 4O5VA 1WQWA 2LP5A 2MPXC 1UEBA 3UATA 4XTVA 2JMCA 3CQTA 5GANh 3QZ9B 2E65A 4A63B 2KQWA 3ASKA 2X3WD 2QASA 2E6NA 2B8AA 5ECAA 2EQMA 2DEQA 3M0SA 1HYOA 3CC7A 3G4SQ 1QVGS 1YFNA 4C92B 1KQ1A 2RHZA 3QG1A 2FRWA 1R77A 4PJOC 1G8XA 1XJWB 2KSSA 2V8JA 3CXCP 5GAOl 1NG2A 2LRQA 1QCNA 1YI2A 4OB1B 1Q81R 3CD6T 1MMGA 2DAQA 1G3SA 4LD9K 2DE0X 4JS4A 5GAN6 3META 2G6FX 3EFOB 2MWOA 3ZL7C 5GMKi 3URGA 1U5SA 1YWPA 2CP7A 3QHSA 1UECA 3X25B 2V1RA 2ABLA 5HCKA 4EIKA 1AWJA 2RK2A 4C8QD 2YT6A 3JCMJ 1ZQ1A 5CQXA 1JB0E 2JS2A 2Y4XA 2EYWA 1GCPA 2K3BA 4A54A 1Y07A 2VWFA 2XICA 2QQAA 4D6WA 1I5LA 4UC4A 1RAHB 2J05A 1VQ6A 2PUKB 4C8QA 1K76A 1RABB 1I0CA 2QYZA 4J6XA 1NLOC 5EC7A 4DOWA 2ZPHB 1M30A 1SSHA 4Y92A 3OS0A 3M58A 1YJNA 4LDXA 4EMHA 1UJYA 3OBWA 1VQKQ 4FT4A 1B3QA 2BIVA 1QKXA 2PUOB 2SRCA 4J9BA 4JLGA 1NPRA 2NUPB 3I56T 4RUGA 2HMAA 1JO8A 4LNPA 3OMCA 4GLKA 4BI8B 3M0QA 1OYXA 4TVRA 3JCMg 1W1FA 3A8GB 3CCSQ 1HK9A 2RQTA 3VRYA 4EMKC 5GAMj 3QWYA 2X35A 2IVWA 2CZ1B 5IAYA 3OYNA 4C5IA 3S6WA 1S72A 3M0UA 3RDVA 1K8AU 3QUIA 1IREB 2KROA 3SFMA 3VUZA 1NJIC 1ZA1B 3GNFB 3T9NA 1IO6A 1RI0A 2YUPA 2J7IA 5KYUA 4Z8AA 2KXDA 2YLBA 1X69A 3PMIA 2A0FB 3V8LA 4M7AE 4J9EA 4ZTFA 2SEMA 3VV0A 4C5EA 3NTKA 1RADB 5GAN7 4NL3A 2KRNA 1D0XA 2K5FA 1S72Q 2GTJA 4M7AC 5CKEA 1WX6A 2Y4YA 4EDUA 3CCQA 3RKYA 5KE2A 4JLIA 2EW3A 4LDUA 2JXBA 1N8RC 4AG2C 1IGUA 4JRKA 1SRMA 2E3IA 2PVOB 3QDFA 1Q86R 3JCMW 1LOJA 2GTOA 2I0NA 2JZ2A 3EG0A 1M2VB 1FMVA 2E1HA 5GAN2 2XDPA 2O31A 4ATOA 4LDYA 5CKBA 4PJNA 2DKGA 3JCMe 5C6SA 1QVFS 1QKWA 3CC2T 1H92A 1AVZC 3SHWA 2CREA 2RN8A 3V8KA 3CCEQ 2LVMA 2RF0A 1VQ9A 3CCQQ 1AZEA 2F1LA 1FX7A 3KUFA 4CRIA 2KMTA 3JCMX 2DTHA 2ZPBB 2LX7A 1M3CA 1PCXA 3EHRA 1ZSZC 2DJZA 2VXEA 3CCJT 2YUOA 4PLIA 1CKBA 3MO8A 4HCBA 2DVJA 2DEUA 2X4WA 4GLMA 3ZFJA 4MZMA 2L3PA 2VV5A 2QDYB 4Q5WA 2LJ0A 3CPFA 4JZ3A 4ZGJB 2LCLA 2ZPIB 4PFPA 3A1PA 5GAN8 2X4YA 4M78E 1X43A 3IQLA 4M7DD 5KYWA 2DYIA 5GJVB 2CZ6B 3KBGA 1K0SA 5GANg 5GAOn 1I81A 3G6ET 4PJMA 1D1CA 2RQVA 3MP8A 4BE0A 3C94A 4AFQC 2D6FA 5I21A 3CPWA 5GAOm 4QQDA 1YIJA 3ZBDA 2FEIA 1OU9A 4M7DA 4M75A 2EQUA 4J7FA 2HQHA 2AT1B 3RERA 1GFDA 2M16A 1PKSA 1OOTA 2OTJT 3G6EQ 2EQIA 4M78G 3HRSA 4PJOD 2QDLA 3MP1A 1OULA 1VYVA 4J9GA 1EIFA 2IPOB 2K3XA 2LCCA 4DEXA 3L2UA 1VQNA 2E12A 4KH0B 4A4KA 4JRPA 3PMTA 1TTHB 2WSCE 2RI2A 4JRIA 4PJOA 1Z9QA 4HCKA 3OYFA 1C6VX 3J7AF 1N5ZA 3M0RA 1W70A 4C92E 1R0CB 2OTLT 4M4ZA 2KBTA 2YLCA 4J5YA 1D3BB 1ZA2B 4F16A 4BY6B 2OI3A 2K79A 5KYYB 3M54A 2CP6A 2GBQA 4PFZA 2GNCA 2EJFA 4F04B 4J6YA 3EH2A 1K1ZA 1K8AC 1VQMT 1SKUB 2OTLQ 2QXFA 2ED1A 3JB9G 2PTKA 1QQJA 4J6WA 4XU2A 3O8VA 1M9SA 4CC3A 4WF2A 2EAYA 1AWXA 1NYFA 4C92G 4ZN3A 8ATCB 1OEBA 3TU4K 1VQ8A 3VS7A 3CMET 2CP0A 2K3YA 5HKCA 1N27A 2PU9B 2DXTA 2RHXA 4KUDK 2JM8A 3GLXA 3FJ5A 4IUUA 3MJXA 1LJOA 2F2XA 5LJ3j 3LWIA 1UHCA 3V8JA 3OYYA 4FYWB 5LJ5d 2LCSA 2JTFA 2MK5A 1BBZA 3M0TA 5D6XA 2K2VA 2F5TX 3CMEQ 2DILA 2DX1A 5IHIA 2QA4A 1UHFA 4BD3A 1FMWA 2PZ1A 2DZCA 4HA8A 5GAOr 1IRXA 3I55T 2E70A 2HBWA 1OPLA 1K8AR 3QJ6A 2NUTA 3JCMP 2K4YA 1SHGA 2EKOA 1YJ9A 1NPPA 4WTOB 1PSEA 2GCXA 1VQ7T 2PVGB 3L42A 1W4SA 1QCOA 4RTUA 3V7CA 5FU7B 4FT2A 3RESA 5GAN4 3I55Q 4EMKA 1VIEA 2HAXA 4LD6A 2DTIA 3OS2A 4C0DC 2DIQA 4M75F 4F7UB 3OYGA 1WHGA 2HL3A 2QA4Q 3OSVA 1VQ5A 3X28B 2OJ2A 4ANJA 1W2BA 3MEWA 1B34B 1BI1A 1YJWA 1B7TA 2YWWA 1O75A 2ATCB 2QEXQ 1KG1A 5C0MA 3THKA 2ZPFB 1VQLQ 3CCLA 1M8MA 2RK1A 3ER0A 2F2WA 5CVIA 2LX9A 3C0CA 2FVUA 1K4US 4RG2A 3DB4A 5FU6B 4F14A 2RJEA 1H3HA 2R57A 5AYFA 3CXCS 1MGQA 3RIRA 2CSQA 1VYTA 3PVQA 1Y71A 3CPWP 1Y96A 1WHKA 4M7AA 2EBPA 4HVWA 1IXDA 2CH4W 4A4GA 2XK0A 3E2UA 4AFZC 4MMKA 2M9UA 1QVGA 3WXMB 4FYXB 4DOVA 3CCLQ 3UA6A 4J7IA 4OVAA 5LJ5j 1VQOT 4M78B 2NLUA 3EG9A 5CCAA 1H8KA 3PT9A 2YDLA 2DJQA 2RJFA 2KVQG 2RQUA 2COZA 4E7LA 1AT1B 4DEYA 3LGFA 3EGXB 3GF5A 4L59A 1K9MU 1M5Q1 2EGAA 5IN1A 2DK3A 1U3OA 1ZBXA 1TS9A 4O6JA 1MMAA 4PL6A 5KE3A 1ZSZA 2L3RA 4NL2A 4IUVA 1XNIA 2DRMA 2QTVA 3M59A 4X9DA 2KEAA 5IHNA 4RTTA 4R56A 3LWHA 2QQBA 2YHTA 1GBRA 4QKUA 3CC4Q 2LJ1A 5M9OA 3LX7A 3CCMQ 3PIOA 1VYUA 2GQIA 4QQ6A 1KC8U 1OQKA 4ZGDB 5J39A 3CD6A 1PRMC 2VGMA 1YBYA 2QI2A 5CKHA 4PJJA 5GAMd 5FRMA 4V2SA 2CKKA 3PFSA 3CCRT 3G1JA 3QKJA 3M5AA 2XKOC 4IUQA 3U23A 2OAUA 1PHTA 3OS5A 4K11A 2I2LA 4RTYA 4XK8E 3A8OB 1NYGA 2KAFA 3M57A 4RTWA 1IGQA 5HK3A 4JRQA 3CMAT 1SHFA 2QQSA 1G3TA 1T0HA 1UB4A 1V1CA 2DZ9A 2W10A 3HP9A 1WXTA 2E5QA 3Q1JA 2YSQA 1TG0A 4KULA 3VJPA 2FG0A 4OB2B 3CD6Q 1JXOA 2CT4A 3CC7T 2X9HA 1MMDA 3A5ZB 4OMNA 1VQKA 3NFCA 2B86A 5GAMe 3QXEB 1ZHIA 2WSFE 4J9HA 3VUBA 3I5SA 4JPBW 2HD0A 1KFZA 3SWNB 3NPFA 4FYYB 1YI2T 3N5BB 4FYVB 2KRSA 3UDCA 1BK2A 4QT7A 3MP6A 2KR3A 4L5GA 3RKWA 4B9XA 1R8OB 3CCSA 4J8OA 4FW1A 2AZVA 4M7AF 2X4XA 2K2MA 5GJWB 2V8KA 2D8HA 4ME7A 1VQPT 1BKBA 5CQYA 2ECZA 1X27A 3JCMc 3I56A 3E19A 2IG0A 1FWZA 1WHHA 3X24B 3E9FA 4OB0B 5DY9A 5KYUB 2GF7A 2VB6A 1OU8A 2ZAEA 4A4HA 4DBHA 2CZ7B 3EG2A 1VQ6T 1VQPQ 5LL6S 2HCKA 2RD1A 4M77E 3LH5A 1YHQT 2GFAA 2DBMA 5L8RE 4FU6A 2C0TA 3EFOA 3M56A 2X3XD 3JB9I 4OP0A 2KRMA 1YJNT 2HZYA 3EFSA 3REBB 2XU8A 3I56Q 1ABOA 1GL5A 2BTTA 4BACA 1Q86C 5GAN3 1NZ9A 3HTRA 5GMKl 1JJ2A 4PK4A 4CC2A 1M27C 2AKKA 5AT1B 1WA7A 3OY9A 4E6RA 1PRLC 4M77G 4J9FA 1G3YA 3R6NA 3QWXX 1UJ0A 1PC0A 1X6GA 5GAMf 4PLLA 1I4K1 1YN8A 1T3SA 4AMCA 2KXCA 2A37A 1UDLA 2A7YA 4OB3B 1WHJA 1OPKA 4OF1A 3INZA 1TH7A 4J9CA 1T0JA 1TOVA 4N4HA 4M78F 2JOYA 3MPUB 3OSSC 1K9MC 3OYEA 2CUBA 3CCEA 1TXQA 1WGSA 3OYCA 2P4TA 1PSFA 4E7HA 1UUEA 1UGPB 4LDVA 4OMPA 2LMJA 2YRDA 1D1BA 3A8MB 2XD0A 1UGSB 3PE0A 4F7UE 2HSEB 1H3ZA 2J06A 4BB7A 3FRNA 5FU7C 1RUWA 1YWOA 5KH6A 4OMQA 2NUZA 2LNHB 4II1A 1Y0MA 1YNZA 2QGFB 3NHNA 2D8JA 2KK4A 4Z02A 2A28A 3GBQA 1KC8C 1VOMA 2E64A 3UWNA 1RL2A 2F2VA 2DLPA 3OS1A 1W6XA 1JRIA 3MCAB 4E47A 3P8DA 3EFRA 2HL5C 2JVVA 4B9WA 2KI7A 1Y57A 4F7UG 2CP3A 3JB9F 1K9MR 3HSBA 1UFFA 2KT1A 2RHIA 1EX4A 4QW2A 3CC2Q 3EH1A 5FU6C 2DF6A 1VQ4T 5IHKA 4C92F 3OW2A 5CIUA 5GAMh 2DD5A 2O4XA 2E6ZA 4VUBA 2KYBA 3OA6A 1QW1A 3ULRB 3BDUA 3G6EA 3QSUA 4BI3A 2RNAA 2COYA 1Q7YU 2VGNA 3CCJQ 2LTOA 3JB9H 2MOXA 5A0GA 4M75D 2L2PA 3SEMA 2DXBA 1UG1A 4IURA 5LJ3d 3BFMA 2EYQA 3WVEB 1E6GA 1SPKA 5GAOp 4L6V5 1OI1A 1KC8R 3TEEA 5GMKj 2DTOA 1QLYA 4M78C 2OTJA 3M0PA 1CKAA 1NBEB 3E9GA 4YTLA 2K5IA 2F69A 2E41A 1M2VA 4LXCA 1NEGA 1M1KU 3OYJA 2AK5A 2VASA 1SSFA 5CKDA 2EYYA 1AHJB 2QTXA 4X9CA 5FW9A 3RNJA 3C95A 1BI3A 2L3QA 1QWEA 1U1TA 2BZXA 2OTLA 3BDLA 3JCMV 3L2ZA 4Y28E 2DRKA 5LJ3e 4N4IA 2GQVA 2K5LA 2K6DA 2OTJQ 5DM7R 3OYDA 2E3HA 1GXIE 2G3RA 2QK0A 3VRZA 3BW1A 4DBQA 2DYBA 4C8QE 1UGVA 2FRYA 4PNOA 3OYLA 4DA4A 4FM4B 1ARKA 4LN2A 2P4RA 3H0FA 2CZ0B 5GANd 1MV0B 4XU0A 5D6WA 3G71T 4C92C 1JJ2P 3AHUA 4E7KA 2DL3A 2LT4A 3CMEA 1M3BA 1KIKA 4M77B 1VQNT 3BY7A 5IXBA 1WNLA 4NS5A 4BE2A 1GCQC 9ATCB 1HXDA 1G2BA 1RAIB 2FZKB 5IT9E 2GFUA 3G7ZA 6AT1B 5I2MA 4C8QG 3V7RA 2A08A 3FLGA 2LQWA 1K0XA 4E7IA 1YITT 1VQMQ 1NM7A 1X2QA 3CPWS 2WSEE 4Z89A 5FLXE 3GNGA 2AKLA 3QPHA 4XU1A 3I55A 2ZCFB 3RUXA 5HK0A 2EYXA 2FPEA 2OAWA 3EG1A 4KUIA 4MMLA 4MDWA 5GMKh 3NTIA 5GMKm 2J6FA 2A36A 3MEUA 1JEGA 3SWNC 3CXCA 4GBQA 3TSWA 1VQ7A 2HQEA 3EGDB 1VQ8T 2L3SA 2QEXA 5KCHA 1U8RA 1C0MA 1TUDA 4JJCA 5LJ3f 4DQ2A 1VQLA 1RACB 3H9NA 1UGQB 2YUQA 3P8BB 3MKDA 1D3BA 4JDSA 2O2OA 1KQSA 4IIOA 2ZGWA 1Y96B 5KYYA 2XMFA 3C12A 2GGRA 1M1GA 5FROA 2P84A 2O01E 4KGZB 2QG9B 5LJ5e 1LPLA 1SF9A 4KGVB 5CKFA 3FJPA 4E7ZA 4QVDA 3V7SA 1Y7XA 1R0BG 4KH1B 3L2VA 2E5KA 1VQ7Q 2DNUA 2P0QA 3OW2P 2R58A 2JUFA 5KYXB 1WXUA 5GANj 1GFCA 4AG1C 1YJ9T 1K9AA 1WDXA 5I11A 1WJRA 1BU1A 4M7AD 3FDRA 1GRIA 3M4YA 1Q7YC 1AOJA 1J3TA 1Z9ZA 3KXTA 1TSFA 3CCVT 2HQXA 3UT1A 4ZN1A 4FL6A 3I5RA 1BIAA 4HVVA 1VQOA 1VQ5T 3JB9J 2FHDA 2KNBB 2LT1A 1KQ2A 1YJWT 2MI6A 3DLMA 2LQNA 2D1XA 2DD4A 1BYMA 4CI0C 2BE9B 5J3BA 1RLPC 3CCVQ 1RAEB 1M1KC 4MDXA 2LNVA 4OMLA 4CC4B 1FYNA 3WVDB 4RCBA 3VS3A 3HRUA 1NLPC 3L1AA 1OZ3A 1OV3A 5LJ3h 2ENMA 3VYHB 1LNXA 2K57A 2JJ9A 2R5AA 3SDZA 4HCCA 1M8VA 3HL8A 1AZGB 3H6ZA 3CC4A 1D09B 2CDTA 4FSSA 3CCMA 3EAEA 5GAMg 4RTXA 5FWCA 2XIDA 3O5ZA 1VQOQ 2KYMA 5LJ5f 5HY6A 1Q7YR 1B34A 2JT4A 1X2KA 4ZGEB 4PFOA 2HKQB 2J6KA 2YRVA 3LYIA 2XHCA 1M90U 2E10A 4JUVA 4E2FB 5IH2A 3J80E 2CT3A 4M7DE 4N4GA 4LUEA 7AT1B 3TQ7P 2AHJB 4JJBA 4BUGA 1VIFA 4AT1B 3TVTA 2DBKA 1KD1U 1ABQA 3J81E 1D0ZA 4EMGA 4KGXB 3GP8A 1M1KR 2M0OA 2JTMA 4RMOA 4RTZA 3X20B 1PKTA 1N8RU 2C0OA 4M78D 3TSZA 4JJDA 4D8DA 3L2WA 1RAGB 1ZBJA 5FWBA 3G4ST 2KT8A 3SD4A 1D1AA 1ZSGA 5DLOA 4IUPA 5GAOq 2FB7A 3I9QA 4C8QB 1IB8A 3QYHB 2MYSA 3FEOA 3OYHA 2VYTA 5IXFA 3CCUT 3CMAA 2QAZA 3DB3A 3MHXA 4PJLA 4M7DG 1XTDA 3HFNA 4M75G 2LQ8A 2VUBA 8AT1B 4PJOE 3VS2A 3CBPA 4M78A 2EYZA 1U1SA 1OX8A 1PM3A 4FIBA 4M77F 5KYNA 2RI5A 1WZOA 4EPCA 2LDMA 2X51A 2M1HA 5GAN5 2KE9A 1Q82U 3CCRQ 3HFOA 3CCUQ 1H641 2H3JA 1WIEA 5A0LA 4LE9A 3EGXA 3EHQA 3S3OA 1PNJA 3NGPA 4HT8A 3M4GA 1V29B 1V76A 4PJOG 4RTVA 3JB9D 2FZCB 5LJ5h 3CMAQ 3MEVA 1WLPB 4FSXA 3HPWA 1YP5A 2RO0A 1VQPA 1KQSP 2CS7A 2Z0WA 3QJYA 4C92D 1VUBA 2P0KA 3PVLA 3CC7Q 2RHUA 3JCMb 1WQ7A 4F17A 1UGRB 4XTZA 2WACA 1M2OA 3JAME 4GY5A 1NEBA 3EGUA 2JNGA 3L2QA 4B6MA 1W2BP 1YI2Q 4OMMA 4C92A 4BI4A 3PGGA 1YHQA 1VQKT 3MEAA 1ACMB 1M1FA 2RQRA 4WCIA 3RMSA 1WHLA 1MNDA 4PKCC 1GCQA 2RB6A 1EFNA 1PD1A 5I22A 2EPDA 1KK7A 4F7UF 1SEMA 1C1AA 4BY6C 3CCST 1BCOA 2JTEA 2DL5A 1U06A 2L89A 1ZUUA 1PD0A 4C0DB 1X6OA 2YRCA 5D7UA 2MIOA 4M77C 1HJDA 2KY9A 1WPYA 1TUGB 1SRLA 4LDWA 2ESWA 1MNEA 3AT1B 4QVZA 1VQ6Q 3SB2A 1YHQQ 2H8HA 1QVGP 1QVFA 1HSQA 1P92A 3S3MA 2EQJA 1WYXA 1I1JA 3P8HA 3LGLA 3SWNA 4XQ3A 2M51A 1WI7A 3PTAA 1GBQA 4QVCA 3LH0A 3X26B 4KBMB 1YJNQ 3GIBA 2XG8D 2RH2A 3R6OA 3E1SA 1RLQC 3GOXA 4N0AC 3QBYA 4FCYA 2C06A 1QMCA 1ZUYA 2VVKA 4LUDA 3L2RA 1OX9A 3OYMA 1WJQA 4HKEA 1QP3A 2DXCA 3UA7A 1S72T 1AEYA 3OYIA 2PVDB 3HKSA 4ORZA 2JM9A 2O4XB 2NUPA 1M90C 3JCMd 1BB9A 1MHNA 4CC7A 4XU3A 2QGGA 3CC2A 1WJSA 2RI3A 3H0HA 3KFVA 2DL8A 2C0IA 1K73U 1KD1C 4FW2A 5KYWB 1YCSB 5GMKe 2O9SA 2FO0A 1AWWA 1JXMA 2D9TA 1ZUKA 2DO3A 5KCOA 2BUDA 1F1BB 2FYKA 3CCJA 5DLQE 5LJ3g 2QQ9A 3CCET 4M7AG 4XTWA 1WFWA 1PG5B 3EG3A 1VQ4A 4R0KA 3CCQT 2DVEA 2PNIA 4M7DB 3VYGA 4M75B 4D8KA 1A0NB 2QQRA 1NJIR 3VKIA 3LW5E 2V26A 1AD5A 3FIFA 4IKFA 1TWBA 1B07A 2CUDA 3F70A 1JJ2S 3QYGB 2VXFA 2EQKA 2ED0A 2EGCA 4C8QF 1FMKA 1Q82C 1M90R 2EVRA 4BE1A 2R5MA 5A2QE 1KHIA 1IHWA 3ZEHA 2E4HA 2HSPA 1BIBA 2OX7A 1E7OA 1G83A 4DBRA 1ZX6A 1PWTA 3VS1A 1KD1R 1NE8A 1TUCA 4PJOB 3CBMA 1VQ4Q 2HKNA 1VQ9T 4Y91A 4A53A 1N8RR 2V8IA 1I07A 1BI2A 3JCMQ 3NTHA 2L8DA 3VU3C 1N9RA 3OYAA 3TREA 1S1NA 2A3LA 1QWFA 4J9IA 5CR2A 2EWNA 3I35A 2JMAA 2RJDA 1VQ9Q 1MUZA 3VS4A 4MZTA 1TU0B 4DBFA 2Y90A 3QDRB 4OMFB 3JRZA 2M02A 4ZTJA 1X01A 4C5GA 5A0DA 4BDYA 2EGEA 2PQWA 1DJ7B 1Q82R 2VC8A 2ZZDA 4XTUA 4RG8A 2M0YA 3HHTB 2H3EB 4ESRA 2RPNA 4C0ZA 1G5VA 2FPDA 2AZSA 1YCYA 2MWPA 2RM4A 4HVUA 2XI9A 1YIJT 1EZZB 4JZ4A 1BCMA 3BE3A 5EG2A 3H41A 1BI0A 3QIIA 3G71A 2CP5A 1SG5A 1MMNA 3JCMf 4ELZC 4MZPA 2DIGA 4A4FA 4E7JA 1VQMA 2EIFA 1QVPA 5LJ5g 1X75C 2K7AA 1XQHA 2DPPB 3D7SB 1Q81U 2ZPEB 2MMPA 1Q95G 1UE9A 3QO3A 3OW2S 1QVFP 3A98A 3OB9A 1YIJQ 4JJNK 4C8QC 4KT0E 1LCKA 4IIMA 1RAAB 2CGHA 2NUTB 4AFSC 2RA2A 1M3AA 2K9GA 2EJGA 2ROLA 2HBPA 1YITA 2L0AA 2BZYA 2KGTA 2J6OA 1QCFA 4C5HA 3FB9A 3C4SA 2COWA 3QZ5B 2HDAA 3G71Q 1QP2A 4J9DA 4EMKB 1N6AA 1N9SA 2XDBA 2V1QA 1IZ6A 3H8ZA 2DXUA 1VQNQ 1OZ2A 3RBBB 1JU5C 2FZGB 3VS5A 1E6HA 1CSKA 5GANe 1I5OB 1T3LA 4RCCA 2FPFA 4OGEA 2X4JA 3CEYA 1UTIA 4RKUE 3ME9A 2JN0A 4J83A 1YITQ 2EJ9A 2DA9A 4X34A 3NMZC 4HCZA 5I2SA 1VA7A 4C0FA 2NYSA 2DL4A 3OYKA 5J26A 2EFIA 2L5QA 4M77D 4XAXB 1K73C 3DLLA 3OBYA 2LJ3A 4NOYA 4ZNXA 2DERA 3A8HB 3OYBA 1WHMA 3UPUA 3JSCA 3JCMh 2RMOA 4M7AB 1FXXA 5L23A 1VQ8Q 3OMGA 4OGCA 4M77A 4AFUC 2CP2A 2LQKA 2QA4T 2LZ6B 3RR6A 2F5KA 1I8FA 1KHCA 3EG9B 2DL7A 3VS0A 1KJWA 4OMOA 2QEXT 4E7SA 3REAB 1VQLT 1AWOA 2ZPGB 3CCVA 3PNWC 2LC4A 3OQ5A 3LLRA 2W0ZA 4M7DF 3DKMA 4XTYA 2CYZB 4XTXA 3FC3A 2RHYA 4X1VA 3A8LB 2DMOA 2XDDA 4KRTA 4N0AA 4JS5A 1D0YA 2HEQA 1M4ZA 2DM1A 1K73R 1WXBA 1X6BA 3S3NA 2VKNA 1YJ9Q 1JQQA 1ZSZB 2IIMA 5GANf 3HRTA 3M9QA 3RMQA 3PIPA
chains in the Genus database with same CATH topology
2CP2A 4B6MA 3E2UA 1WHGA 2HL3A 2MPXC 2CP7A 2HL5C 1TOVA 3TQ7P 1WHHA 2E4HA 2Z0WA 2COYA 2CP3A 2HQHA 2CP0A 2COWA 2CP6A 1WHLA 1WHMA 1TXQA 2HKQB 2HKNA 2E3IA 1WHKA 2E3HA 2M02A 1WHJA 1LPLA 3RDVA 1IXDA 2CP5A 2COZA 2QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP2 A;  4B6M A;  3E2U A;  1WHG A;  2HL3 A;  2MPX C;  2CP7 A;  2HL5 C;  1TOV A;  3TQ7 P;  1WHH A;  2E4H A;  2Z0W A;  2COY A;  2CP3 A;  2HQH A;  2CP0 A;  2COW A;  2CP6 A;  1WHL A;  1WHM A;  1TXQ A;  2HKQ B;  2HKN A;  2E3I A;  1WHK A;  2E3H A;  2M02 A;  1WHJ A;  1LPL A;  3RDV A;  1IXD A;  2CP5 A;  2COZ A;  2QK0 A; 
#chains in the Genus database with same CATH topology
 3EGD A;  2DFU A;  2P0P A;  1IHV A;  3M55 A;  2BZ8 A;  1LVK A;  4IUT A;  3M53 A;  2O88 A;  2D0N A;  3CCL T;  4PJO F;  5CO7 A;  3H0I A;  3TCJ A;  1KSW A;  2JS0 A;  5CAI A;  1VQ5 Q;  1Q86 U;  2MAM A;  2BKD N;  1HD3 A;  2JW4 A;  2AIR B;  2CSI A;  2NWM A;  3VS6 A;  1YJW Q;  5CK9 A;  1ZLM A;  2MF2 A;  4BDZ A;  4QQG A;  2YXY A;  4F7U A;  1NJI U;  2FL7 A;  1KQS S;  1XOV A;  4P5N A;  2YUN A;  2EKH A;  2MCN A;  2CH4 A;  4ELY C;  2RQW A;  4R55 A;  3RKX A;  4HXJ A;  5KYX A;  5D6Y A;  1RI9 A;  2O9V A;  4A4E A;  4C0G A;  4HT9 A;  2ROT A;  1W2B S;  4M75 E;  1JBM A;  1O9S A;  4Z88 A;  3G4S A;  1Q81 C;  2D0Q B;  1G3W A;  3UF4 A;  2HNI A;  1RAF B;  3CCR A;  2KDS A;  3CC4 T;  3CCU A;  3CCM T;  4M7D C;  2RJC A;  2DET A;  2BE7 D;  4M75 C;  3GPL A;  3CBO A;  5FRN A;  1MV3 A;  3JV3 A;  4O5V A;  1WQW A;  2LP5 A;  2MPX C;  1UEB A;  3UAT A;  4XTV A;  2JMC A;  3CQT A;  5GAN h;  3QZ9 B;  2E65 A;  4A63 B;  2KQW A;  3ASK A;  2X3W D;  2QAS A;  2E6N A;  2B8A A;  5ECA A;  2EQM A;  2DEQ A;  3M0S A;  1HYO A;  3CC7 A;  3G4S Q;  1QVG S;  1YFN A;  4C92 B;  1KQ1 A;  2RHZ A;  3QG1 A;  2FRW A;  1R77 A;  4PJO C;  1G8X A;  1XJW B;  2KSS A;  2V8J A;  3CXC P;  5GAO l;  1NG2 A;  2LRQ A;  1QCN A;  1YI2 A;  4OB1 B;  1Q81 R;  3CD6 T;  1MMG A;  2DAQ A;  1G3S A;  4LD9 K;  2DE0 X;  4JS4 A;  5GAN 6;  3MET A;  2G6F X;  3EFO B;  2MWO A;  3ZL7 C;  5GMK i;  3URG A;  1U5S A;  1YWP A;  2CP7 A;  3QHS A;  1UEC A;  3X25 B;  2V1R A;  2ABL A;  5HCK A;  4EIK A;  1AWJ A;  2RK2 A;  4C8Q D;  2YT6 A;  3JCM J;  1ZQ1 A;  5CQX A;  1JB0 E;  2JS2 A;  2Y4X A;  2EYW A;  1GCP A;  2K3B A;  4A54 A;  1Y07 A;  2VWF A;  2XIC A;  2QQA A;  4D6W A;  1I5L A;  4UC4 A;  1RAH B;  2J05 A;  1VQ6 A;  2PUK B;  4C8Q A;  1K76 A;  1RAB B;  1I0C A;  2QYZ A;  4J6X A;  1NLO C;  5EC7 A;  4DOW A;  2ZPH B;  1M30 A;  1SSH A;  4Y92 A;  3OS0 A;  3M58 A;  1YJN A;  4LDX A;  4EMH A;  1UJY A;  3OBW A;  1VQK Q;  4FT4 A;  1B3Q A;  2BIV A;  1QKX A;  2PUO B;  2SRC A;  4J9B A;  4JLG A;  1NPR A;  2NUP B;  3I56 T;  4RUG A;  2HMA A;  1JO8 A;  4LNP A;  3OMC A;  4GLK A;  4BI8 B;  3M0Q A;  1OYX A;  4TVR A;  3JCM g;  1W1F A;  3A8G B;  3CCS Q;  1HK9 A;  2RQT A;  3VRY A;  4EMK C;  5GAM j;  3QWY A;  2X35 A;  2IVW A;  2CZ1 B;  5IAY A;  3OYN A;  4C5I A;  3S6W A;  1S72 A;  3M0U A;  3RDV A;  1K8A U;  3QUI A;  1IRE B;  2KRO A;  3SFM A;  3VUZ A;  1NJI C;  1ZA1 B;  3GNF B;  3T9N A;  1IO6 A;  1RI0 A;  2YUP A;  2J7I A;  5KYU A;  4Z8A A;  2KXD A;  2YLB A;  1X69 A;  3PMI A;  2A0F B;  3V8L A;  4M7A E;  4J9E A;  4ZTF A;  2SEM A;  3VV0 A;  4C5E A;  3NTK A;  1RAD B;  5GAN 7;  4NL3 A;  2KRN A;  1D0X A;  2K5F A;  1S72 Q;  2GTJ A;  4M7A C;  5CKE A;  1WX6 A;  2Y4Y A;  4EDU A;  3CCQ A;  3RKY A;  5KE2 A;  4JLI A;  2EW3 A;  4LDU A;  2JXB A;  1N8R C;  4AG2 C;  1IGU A;  4JRK A;  1SRM A;  2E3I A;  2PVO B;  3QDF A;  1Q86 R;  3JCM W;  1LOJ A;  2GTO A;  2I0N A;  2JZ2 A;  3EG0 A;  1M2V B;  1FMV A;  2E1H A;  5GAN 2;  2XDP A;  2O31 A;  4ATO A;  4LDY A;  5CKB A;  4PJN A;  2DKG A;  3JCM e;  5C6S A;  1QVF S;  1QKW A;  3CC2 T;  1H92 A;  1AVZ C;  3SHW A;  2CRE A;  2RN8 A;  3V8K A;  3CCE Q;  2LVM A;  2RF0 A;  1VQ9 A;  3CCQ Q;  1AZE A;  2F1L A;  1FX7 A;  3KUF A;  4CRI A;  2KMT A;  3JCM X;  2DTH A;  2ZPB B;  2LX7 A;  1M3C A;  1PCX A;  3EHR A;  1ZSZ C;  2DJZ A;  2VXE A;  3CCJ T;  2YUO A;  4PLI A;  1CKB A;  3MO8 A;  4HCB A;  2DVJ A;  2DEU A;  2X4W A;  4GLM A;  3ZFJ A;  4MZM A;  2L3P A;  2VV5 A;  2QDY B;  4Q5W A;  2LJ0 A;  3CPF A;  4JZ3 A;  4ZGJ B;  2LCL A;  2ZPI B;  4PFP A;  3A1P A;  5GAN 8;  2X4Y A;  4M78 E;  1X43 A;  3IQL A;  4M7D D;  5KYW A;  2DYI A;  5GJV B;  2CZ6 B;  3KBG A;  1K0S A;  5GAN g;  5GAO n;  1I81 A;  3G6E T;  4PJM A;  1D1C A;  2RQV A;  3MP8 A;  4BE0 A;  3C94 A;  4AFQ C;  2D6F A;  5I21 A;  3CPW A;  5GAO m;  4QQD A;  1YIJ A;  3ZBD A;  2FEI A;  1OU9 A;  4M7D A;  4M75 A;  2EQU A;  4J7F A;  2HQH A;  2AT1 B;  3RER A;  1GFD A;  2M16 A;  1PKS A;  1OOT A;  2OTJ T;  3G6E Q;  2EQI A;  4M78 G;  3HRS A;  4PJO D;  2QDL A;  3MP1 A;  1OUL A;  1VYV A;  4J9G A;  1EIF A;  2IPO B;  2K3X A;  2LCC A;  4DEX A;  3L2U A;  1VQN A;  2E12 A;  4KH0 B;  4A4K A;  4JRP A;  3PMT A;  1TTH B;  2WSC E;  2RI2 A;  4JRI A;  4PJO A;  1Z9Q A;  4HCK A;  3OYF A;  1C6V X;  3J7A F;  1N5Z A;  3M0R A;  1W70 A;  4C92 E;  1R0C B;  2OTL T;  4M4Z A;  2KBT A;  2YLC A;  4J5Y A;  1D3B B;  1ZA2 B;  4F16 A;  4BY6 B;  2OI3 A;  2K79 A;  5KYY B;  3M54 A;  2CP6 A;  2GBQ A;  4PFZ A;  2GNC A;  2EJF A;  4F04 B;  4J6Y A;  3EH2 A;  1K1Z A;  1K8A C;  1VQM T;  1SKU B;  2OTL Q;  2QXF A;  2ED1 A;  3JB9 G;  2PTK A;  1QQJ A;  4J6W A;  4XU2 A;  3O8V A;  1M9S A;  4CC3 A;  4WF2 A;  2EAY A;  1AWX A;  1NYF A;  4C92 G;  4ZN3 A;  8ATC B;  1OEB A;  3TU4 K;  1VQ8 A;  3VS7 A;  3CME T;  2CP0 A;  2K3Y A;  5HKC A;  1N27 A;  2PU9 B;  2DXT A;  2RHX A;  4KUD K;  2JM8 A;  3GLX A;  3FJ5 A;  4IUU A;  3MJX A;  1LJO A;  2F2X A;  5LJ3 j;  3LWI A;  1UHC A;  3V8J A;  3OYY A;  4FYW B;  5LJ5 d;  2LCS A;  2JTF A;  2MK5 A;  1BBZ A;  3M0T A;  5D6X A;  2K2V A;  2F5T X;  3CME Q;  2DIL A;  2DX1 A;  5IHI A;  2QA4 A;  1UHF A;  4BD3 A;  1FMW A;  2PZ1 A;  2DZC A;  4HA8 A;  5GAO r;  1IRX A;  3I55 T;  2E70 A;  2HBW A;  1OPL A;  1K8A R;  3QJ6 A;  2NUT A;  3JCM P;  2K4Y A;  1SHG A;  2EKO A;  1YJ9 A;  1NPP A;  4WTO B;  1PSE A;  2GCX A;  1VQ7 T;  2PVG B;  3L42 A;  1W4S A;  1QCO A;  4RTU A;  3V7C A;  5FU7 B;  4FT2 A;  3RES A;  5GAN 4;  3I55 Q;  4EMK A;  1VIE A;  2HAX A;  4LD6 A;  2DTI A;  3OS2 A;  4C0D C;  2DIQ A;  4M75 F;  4F7U B;  3OYG A;  1WHG A;  2HL3 A;  2QA4 Q;  3OSV A;  1VQ5 A;  3X28 B;  2OJ2 A;  4ANJ A;  1W2B A;  3MEW A;  1B34 B;  1BI1 A;  1YJW A;  1B7T A;  2YWW A;  1O75 A;  2ATC B;  2QEX Q;  1KG1 A;  5C0M A;  3THK A;  2ZPF B;  1VQL Q;  3CCL A;  1M8M A;  2RK1 A;  3ER0 A;  2F2W A;  5CVI A;  2LX9 A;  3C0C A;  2FVU A;  1K4U S;  4RG2 A;  3DB4 A;  5FU6 B;  4F14 A;  2RJE A;  1H3H A;  2R57 A;  5AYF A;  3CXC S;  1MGQ A;  3RIR A;  2CSQ A;  1VYT A;  3PVQ A;  1Y71 A;  3CPW P;  1Y96 A;  1WHK A;  4M7A A;  2EBP A;  4HVW A;  1IXD A;  2CH4 W;  4A4G A;  2XK0 A;  3E2U A;  4AFZ C;  4MMK A;  2M9U A;  1QVG A;  3WXM B;  4FYX B;  4DOV A;  3CCL Q;  3UA6 A;  4J7I A;  4OVA A;  5LJ5 j;  1VQO T;  4M78 B;  2NLU A;  3EG9 A;  5CCA A;  1H8K A;  3PT9 A;  2YDL A;  2DJQ A;  2RJF A;  2KVQ G;  2RQU A;  2COZ A;  4E7L A;  1AT1 B;  4DEY A;  3LGF A;  3EGX B;  3GF5 A;  4L59 A;  1K9M U;  1M5Q 1;  2EGA A;  5IN1 A;  2DK3 A;  1U3O A;  1ZBX A;  1TS9 A;  4O6J A;  1MMA A;  4PL6 A;  5KE3 A;  1ZSZ A;  2L3R A;  4NL2 A;  4IUV A;  1XNI A;  2DRM A;  2QTV A;  3M59 A;  4X9D A;  2KEA A;  5IHN A;  4RTT A;  4R56 A;  3LWH A;  2QQB A;  2YHT A;  1GBR A;  4QKU A;  3CC4 Q;  2LJ1 A;  5M9O A;  3LX7 A;  3CCM Q;  3PIO A;  1VYU A;  2GQI A;  4QQ6 A;  1KC8 U;  1OQK A;  4ZGD B;  5J39 A;  3CD6 A;  1PRM C;  2VGM A;  1YBY A;  2QI2 A;  5CKH A;  4PJJ A;  5GAM d;  5FRM A;  4V2S A;  2CKK A;  3PFS A;  3CCR T;  3G1J A;  3QKJ A;  3M5A A;  2XKO C;  4IUQ A;  3U23 A;  2OAU A;  1PHT A;  3OS5 A;  4K11 A;  2I2L A;  4RTY A;  4XK8 E;  3A8O B;  1NYG A;  2KAF A;  3M57 A;  4RTW A;  1IGQ A;  5HK3 A;  4JRQ A;  3CMA T;  1SHF A;  2QQS A;  1G3T A;  1T0H A;  1UB4 A;  1V1C A;  2DZ9 A;  2W10 A;  3HP9 A;  1WXT A;  2E5Q A;  3Q1J A;  2YSQ A;  1TG0 A;  4KUL A;  3VJP A;  2FG0 A;  4OB2 B;  3CD6 Q;  1JXO A;  2CT4 A;  3CC7 T;  2X9H A;  1MMD A;  3A5Z B;  4OMN A;  1VQK A;  3NFC A;  2B86 A;  5GAM e;  3QXE B;  1ZHI A;  2WSF E;  4J9H A;  3VUB A;  3I5S A;  4JPB W;  2HD0 A;  1KFZ A;  3SWN B;  3NPF A;  4FYY B;  1YI2 T;  3N5B B;  4FYV B;  2KRS A;  3UDC A;  1BK2 A;  4QT7 A;  3MP6 A;  2KR3 A;  4L5G A;  3RKW A;  4B9X A;  1R8O B;  3CCS A;  4J8O A;  4FW1 A;  2AZV A;  4M7A F;  2X4X A;  2K2M A;  5GJW B;  2V8K A;  2D8H A;  4ME7 A;  1VQP T;  1BKB A;  5CQY A;  2ECZ A;  1X27 A;  3JCM c;  3I56 A;  3E19 A;  2IG0 A;  1FWZ A;  1WHH A;  3X24 B;  3E9F A;  4OB0 B;  5DY9 A;  5KYU B;  2GF7 A;  2VB6 A;  1OU8 A;  2ZAE A;  4A4H A;  4DBH A;  2CZ7 B;  3EG2 A;  1VQ6 T;  1VQP Q;  5LL6 S;  2HCK A;  2RD1 A;  4M77 E;  3LH5 A;  1YHQ T;  2GFA A;  2DBM A;  5L8R E;  4FU6 A;  2C0T A;  3EFO A;  3M56 A;  2X3X D;  3JB9 I;  4OP0 A;  2KRM A;  1YJN T;  2HZY A;  3EFS A;  3REB B;  2XU8 A;  3I56 Q;  1ABO A;  1GL5 A;  2BTT A;  4BAC A;  1Q86 C;  5GAN 3;  1NZ9 A;  3HTR A;  5GMK l;  1JJ2 A;  4PK4 A;  4CC2 A;  1M27 C;  2AKK A;  5AT1 B;  1WA7 A;  3OY9 A;  4E6R A;  1PRL C;  4M77 G;  4J9F A;  1G3Y A;  3R6N A;  3QWX X;  1UJ0 A;  1PC0 A;  1X6G A;  5GAM f;  4PLL A;  1I4K 1;  1YN8 A;  1T3S A;  4AMC A;  2KXC A;  2A37 A;  1UDL A;  2A7Y A;  4OB3 B;  1WHJ A;  1OPK A;  4OF1 A;  3INZ A;  1TH7 A;  4J9C A;  1T0J A;  1TOV A;  4N4H A;  4M78 F;  2JOY A;  3MPU B;  3OSS C;  1K9M C;  3OYE A;  2CUB A;  3CCE A;  1TXQ A;  1WGS A;  3OYC A;  2P4T A;  1PSF A;  4E7H A;  1UUE A;  1UGP B;  4LDV A;  4OMP A;  2LMJ A;  2YRD A;  1D1B A;  3A8M B;  2XD0 A;  1UGS B;  3PE0 A;  4F7U E;  2HSE B;  1H3Z A;  2J06 A;  4BB7 A;  3FRN A;  5FU7 C;  1RUW A;  1YWO A;  5KH6 A;  4OMQ A;  2NUZ A;  2LNH B;  4II1 A;  1Y0M A;  1YNZ A;  2QGF B;  3NHN A;  2D8J A;  2KK4 A;  4Z02 A;  2A28 A;  3GBQ A;  1KC8 C;  1VOM A;  2E64 A;  3UWN A;  1RL2 A;  2F2V A;  2DLP A;  3OS1 A;  1W6X A;  1JRI A;  3MCA B;  4E47 A;  3P8D A;  3EFR A;  2HL5 C;  2JVV A;  4B9W A;  2KI7 A;  1Y57 A;  4F7U G;  2CP3 A;  3JB9 F;  1K9M R;  3HSB A;  1UFF A;  2KT1 A;  2RHI A;  1EX4 A;  4QW2 A;  3CC2 Q;  3EH1 A;  5FU6 C;  2DF6 A;  1VQ4 T;  5IHK A;  4C92 F;  3OW2 A;  5CIU A;  5GAM h;  2DD5 A;  2O4X A;  2E6Z A;  4VUB A;  2KYB A;  3OA6 A;  1QW1 A;  3ULR B;  3BDU A;  3G6E A;  3QSU A;  4BI3 A;  2RNA A;  2COY A;  1Q7Y U;  2VGN A;  3CCJ Q;  2LTO A;  3JB9 H;  2MOX A;  5A0G A;  4M75 D;  2L2P A;  3SEM A;  2DXB A;  1UG1 A;  4IUR A;  5LJ3 d;  3BFM A;  2EYQ A;  3WVE B;  1E6G A;  1SPK A;  5GAO p;  4L6V 5;  1OI1 A;  1KC8 R;  3TEE A;  5GMK j;  2DTO A;  1QLY A;  4M78 C;  2OTJ A;  3M0P A;  1CKA A;  1NBE B;  3E9G A;  4YTL A;  2K5I A;  2F69 A;  2E41 A;  1M2V A;  4LXC A;  1NEG A;  1M1K U;  3OYJ A;  2AK5 A;  2VAS A;  1SSF A;  5CKD A;  2EYY A;  1AHJ B;  2QTX A;  4X9C A;  5FW9 A;  3RNJ A;  3C95 A;  1BI3 A;  2L3Q A;  1QWE A;  1U1T A;  2BZX A;  2OTL A;  3BDL A;  3JCM V;  3L2Z A;  4Y28 E;  2DRK A;  5LJ3 e;  4N4I A;  2GQV A;  2K5L A;  2K6D A;  2OTJ Q;  5DM7 R;  3OYD A;  2E3H A;  1GXI E;  2G3R A;  2QK0 A;  3VRZ A;  3BW1 A;  4DBQ A;  2DYB A;  4C8Q E;  1UGV A;  2FRY A;  4PNO A;  3OYL A;  4DA4 A;  4FM4 B;  1ARK A;  4LN2 A;  2P4R A;  3H0F A;  2CZ0 B;  5GAN d;  1MV0 B;  4XU0 A;  5D6W A;  3G71 T;  4C92 C;  1JJ2 P;  3AHU A;  4E7K A;  2DL3 A;  2LT4 A;  3CME A;  1M3B A;  1KIK A;  4M77 B;  1VQN T;  3BY7 A;  5IXB A;  1WNL A;  4NS5 A;  4BE2 A;  1GCQ C;  9ATC B;  1HXD A;  1G2B A;  1RAI B;  2FZK B;  5IT9 E;  2GFU A;  3G7Z A;  6AT1 B;  5I2M A;  4C8Q G;  3V7R A;  2A08 A;  3FLG A;  2LQW A;  1K0X A;  4E7I A;  1YIT T;  1VQM Q;  1NM7 A;  1X2Q A;  3CPW S;  2WSE E;  4Z89 A;  5FLX E;  3GNG A;  2AKL A;  3QPH A;  4XU1 A;  3I55 A;  2ZCF B;  3RUX A;  5HK0 A;  2EYX A;  2FPE A;  2OAW A;  3EG1 A;  4KUI A;  4MML A;  4MDW A;  5GMK h;  3NTI A;  5GMK m;  2J6F A;  2A36 A;  3MEU A;  1JEG A;  3SWN C;  3CXC A;  4GBQ A;  3TSW A;  1VQ7 A;  2HQE A;  3EGD B;  1VQ8 T;  2L3S A;  2QEX A;  5KCH A;  1U8R A;  1C0M A;  1TUD A;  4JJC A;  5LJ3 f;  4DQ2 A;  1VQL A;  1RAC B;  3H9N A;  1UGQ B;  2YUQ A;  3P8B B;  3MKD A;  1D3B A;  4JDS A;  2O2O A;  1KQS A;  4IIO A;  2ZGW A;  1Y96 B;  5KYY A;  2XMF A;  3C12 A;  2GGR A;  1M1G A;  5FRO A;  2P84 A;  2O01 E;  4KGZ B;  2QG9 B;  5LJ5 e;  1LPL A;  1SF9 A;  4KGV B;  5CKF A;  3FJP A;  4E7Z A;  4QVD A;  3V7S A;  1Y7X A;  1R0B G;  4KH1 B;  3L2V A;  2E5K A;  1VQ7 Q;  2DNU A;  2P0Q A;  3OW2 P;  2R58 A;  2JUF A;  5KYX B;  1WXU A;  5GAN j;  1GFC A;  4AG1 C;  1YJ9 T;  1K9A A;  1WDX A;  5I11 A;  1WJR A;  1BU1 A;  4M7A D;  3FDR A;  1GRI A;  3M4Y A;  1Q7Y C;  1AOJ A;  1J3T A;  1Z9Z A;  3KXT A;  1TSF A;  3CCV T;  2HQX A;  3UT1 A;  4ZN1 A;  4FL6 A;  3I5R A;  1BIA A;  4HVV A;  1VQO A;  1VQ5 T;  3JB9 J;  2FHD A;  2KNB B;  2LT1 A;  1KQ2 A;  1YJW T;  2MI6 A;  3DLM A;  2LQN A;  2D1X A;  2DD4 A;  1BYM A;  4CI0 C;  2BE9 B;  5J3B A;  1RLP C;  3CCV Q;  1RAE B;  1M1K C;  4MDX A;  2LNV A;  4OML A;  4CC4 B;  1FYN A;  3WVD B;  4RCB A;  3VS3 A;  3HRU A;  1NLP C;  3L1A A;  1OZ3 A;  1OV3 A;  5LJ3 h;  2ENM A;  3VYH B;  1LNX A;  2K57 A;  2JJ9 A;  2R5A A;  3SDZ A;  4HCC A;  1M8V A;  3HL8 A;  1AZG B;  3H6Z A;  3CC4 A;  1D09 B;  2CDT A;  4FSS A;  3CCM A;  3EAE A;  5GAM g;  4RTX A;  5FWC A;  2XID A;  3O5Z A;  1VQO Q;  2KYM A;  5LJ5 f;  5HY6 A;  1Q7Y R;  1B34 A;  2JT4 A;  1X2K A;  4ZGE B;  4PFO A;  2HKQ B;  2J6K A;  2YRV A;  3LYI A;  2XHC A;  1M90 U;  2E10 A;  4JUV A;  4E2F B;  5IH2 A;  3J80 E;  2CT3 A;  4M7D E;  4N4G A;  4LUE A;  7AT1 B;  3TQ7 P;  2AHJ B;  4JJB A;  4BUG A;  1VIF A;  4AT1 B;  3TVT A;  2DBK A;  1KD1 U;  1ABQ A;  3J81 E;  1D0Z A;  4EMG A;  4KGX B;  3GP8 A;  1M1K R;  2M0O A;  2JTM A;  4RMO A;  4RTZ A;  3X20 B;  1PKT A;  1N8R U;  2C0O A;  4M78 D;  3TSZ A;  4JJD A;  4D8D A;  3L2W A;  1RAG B;  1ZBJ A;  5FWB A;  3G4S T;  2KT8 A;  3SD4 A;  1D1A A;  1ZSG A;  5DLO A;  4IUP A;  5GAO q;  2FB7 A;  3I9Q A;  4C8Q B;  1IB8 A;  3QYH B;  2MYS A;  3FEO A;  3OYH A;  2VYT A;  5IXF A;  3CCU T;  3CMA A;  2QAZ A;  3DB3 A;  3MHX A;  4PJL A;  4M7D G;  1XTD A;  3HFN A;  4M75 G;  2LQ8 A;  2VUB A;  8AT1 B;  4PJO E;  3VS2 A;  3CBP A;  4M78 A;  2EYZ A;  1U1S A;  1OX8 A;  1PM3 A;  4FIB A;  4M77 F;  5KYN A;  2RI5 A;  1WZO A;  4EPC A;  2LDM A;  2X51 A;  2M1H A;  5GAN 5;  2KE9 A;  1Q82 U;  3CCR Q;  3HFO A;  3CCU Q;  1H64 1;  2H3J A;  1WIE A;  5A0L A;  4LE9 A;  3EGX A;  3EHQ A;  3S3O A;  1PNJ A;  3NGP A;  4HT8 A;  3M4G A;  1V29 B;  1V76 A;  4PJO G;  4RTV A;  3JB9 D;  2FZC B;  5LJ5 h;  3CMA Q;  3MEV A;  1WLP B;  4FSX A;  3HPW A;  1YP5 A;  2RO0 A;  1VQP A;  1KQS P;  2CS7 A;  2Z0W A;  3QJY A;  4C92 D;  1VUB A;  2P0K A;  3PVL A;  3CC7 Q;  2RHU A;  3JCM b;  1WQ7 A;  4F17 A;  1UGR B;  4XTZ A;  2WAC A;  1M2O A;  3JAM E;  4GY5 A;  1NEB A;  3EGU A;  2JNG A;  3L2Q A;  4B6M A;  1W2B P;  1YI2 Q;  4OMM A;  4C92 A;  4BI4 A;  3PGG A;  1YHQ A;  1VQK T;  3MEA A;  1ACM B;  1M1F A;  2RQR A;  4WCI A;  3RMS A;  1WHL A;  1MND A;  4PKC C;  1GCQ A;  2RB6 A;  1EFN A;  1PD1 A;  5I22 A;  2EPD A;  1KK7 A;  4F7U F;  1SEM A;  1C1A A;  4BY6 C;  3CCS T;  1BCO A;  2JTE A;  2DL5 A;  1U06 A;  2L89 A;  1ZUU A;  1PD0 A;  4C0D B;  1X6O A;  2YRC A;  5D7U A;  2MIO A;  4M77 C;  1HJD A;  2KY9 A;  1WPY A;  1TUG B;  1SRL A;  4LDW A;  2ESW A;  1MNE A;  3AT1 B;  4QVZ A;  1VQ6 Q;  3SB2 A;  1YHQ Q;  2H8H A;  1QVG P;  1QVF A;  1HSQ A;  1P92 A;  3S3M A;  2EQJ A;  1WYX A;  1I1J A;  3P8H A;  3LGL A;  3SWN A;  4XQ3 A;  2M51 A;  1WI7 A;  3PTA A;  1GBQ A;  4QVC A;  3LH0 A;  3X26 B;  4KBM B;  1YJN Q;  3GIB A;  2XG8 D;  2RH2 A;  3R6O A;  3E1S A;  1RLQ C;  3GOX A;  4N0A C;  3QBY A;  4FCY A;  2C06 A;  1QMC A;  1ZUY A;  2VVK A;  4LUD A;  3L2R A;  1OX9 A;  3OYM A;  1WJQ A;  4HKE A;  1QP3 A;  2DXC A;  3UA7 A;  1S72 T;  1AEY A;  3OYI A;  2PVD B;  3HKS A;  4ORZ A;  2JM9 A;  2O4X B;  2NUP A;  1M90 C;  3JCM d;  1BB9 A;  1MHN A;  4CC7 A;  4XU3 A;  2QGG A;  3CC2 A;  1WJS A;  2RI3 A;  3H0H A;  3KFV A;  2DL8 A;  2C0I A;  1K73 U;  1KD1 C;  4FW2 A;  5KYW B;  1YCS B;  5GMK e;  2O9S A;  2FO0 A;  1AWW A;  1JXM A;  2D9T A;  1ZUK A;  2DO3 A;  5KCO A;  2BUD A;  1F1B B;  2FYK A;  3CCJ A;  5DLQ E;  5LJ3 g;  2QQ9 A;  3CCE T;  4M7A G;  4XTW A;  1WFW A;  1PG5 B;  3EG3 A;  1VQ4 A;  4R0K A;  3CCQ T;  2DVE A;  2PNI A;  4M7D B;  3VYG A;  4M75 B;  4D8K A;  1A0N B;  2QQR A;  1NJI R;  3VKI A;  3LW5 E;  2V26 A;  1AD5 A;  3FIF A;  4IKF A;  1TWB A;  1B07 A;  2CUD A;  3F70 A;  1JJ2 S;  3QYG B;  2VXF A;  2EQK A;  2ED0 A;  2EGC A;  4C8Q F;  1FMK A;  1Q82 C;  1M90 R;  2EVR A;  4BE1 A;  2R5M A;  5A2Q E;  1KHI A;  1IHW A;  3ZEH A;  2E4H A;  2HSP A;  1BIB A;  2OX7 A;  1E7O A;  1G83 A;  4DBR A;  1ZX6 A;  1PWT A;  3VS1 A;  1KD1 R;  1NE8 A;  1TUC A;  4PJO B;  3CBM A;  1VQ4 Q;  2HKN A;  1VQ9 T;  4Y91 A;  4A53 A;  1N8R R;  2V8I A;  1I07 A;  1BI2 A;  3JCM Q;  3NTH A;  2L8D A;  3VU3 C;  1N9R A;  3OYA A;  3TRE A;  1S1N A;  2A3L A;  1QWF A;  4J9I A;  5CR2 A;  2EWN A;  3I35 A;  2JMA A;  2RJD A;  1VQ9 Q;  1MUZ A;  3VS4 A;  4MZT A;  1TU0 B;  4DBF A;  2Y90 A;  3QDR B;  4OMF B;  3JRZ A;  2M02 A;  4ZTJ A;  1X01 A;  4C5G A;  5A0D A;  4BDY A;  2EGE A;  2PQW A;  1DJ7 B;  1Q82 R;  2VC8 A;  2ZZD A;  4XTU A;  4RG8 A;  2M0Y A;  3HHT B;  2H3E B;  4ESR A;  2RPN A;  4C0Z A;  1G5V A;  2FPD A;  2AZS A;  1YCY A;  2MWP A;  2RM4 A;  4HVU A;  2XI9 A;  1YIJ T;  1EZZ B;  4JZ4 A;  1BCM A;  3BE3 A;  5EG2 A;  3H41 A;  1BI0 A;  3QII A;  3G71 A;  2CP5 A;  1SG5 A;  1MMN A;  3JCM f;  4ELZ C;  4MZP A;  2DIG A;  4A4F A;  4E7J A;  1VQM A;  2EIF A;  1QVP A;  5LJ5 g;  1X75 C;  2K7A A;  1XQH A;  2DPP B;  3D7S B;  1Q81 U;  2ZPE B;  2MMP A;  1Q95 G;  1UE9 A;  3QO3 A;  3OW2 S;  1QVF P;  3A98 A;  3OB9 A;  1YIJ Q;  4JJN K;  4C8Q C;  4KT0 E;  1LCK A;  4IIM A;  1RAA B;  2CGH A;  2NUT B;  4AFS C;  2RA2 A;  1M3A A;  2K9G A;  2EJG A;  2ROL A;  2HBP A;  1YIT A;  2L0A A;  2BZY A;  2KGT A;  2J6O A;  1QCF A;  4C5H A;  3FB9 A;  3C4S A;  2COW A;  3QZ5 B;  2HDA A;  3G71 Q;  1QP2 A;  4J9D A;  4EMK B;  1N6A A;  1N9S A;  2XDB A;  2V1Q A;  1IZ6 A;  3H8Z A;  2DXU A;  1VQN Q;  1OZ2 A;  3RBB B;  1JU5 C;  2FZG B;  3VS5 A;  1E6H A;  1CSK A;  5GAN e;  1I5O B;  1T3L A;  4RCC A;  2FPF A;  4OGE A;  2X4J A;  3CEY A;  1UTI A;  4RKU E;  3ME9 A;  2JN0 A;  4J83 A;  1YIT Q;  2EJ9 A;  2DA9 A;  4X34 A;  3NMZ C;  4HCZ A;  5I2S A;  1VA7 A;  4C0F A;  2NYS A;  2DL4 A;  3OYK A;  5J26 A;  2EFI A;  2L5Q A;  4M77 D;  4XAX B;  1K73 C;  3DLL A;  3OBY A;  2LJ3 A;  4NOY A;  4ZNX A;  2DER A;  3A8H B;  3OYB A;  1WHM A;  3UPU A;  3JSC A;  3JCM h;  2RMO A;  4M7A B;  1FXX A;  5L23 A;  1VQ8 Q;  3OMG A;  4OGC A;  4M77 A;  4AFU C;  2CP2 A;  2LQK A;  2QA4 T;  2LZ6 B;  3RR6 A;  2F5K A;  1I8F A;  1KHC A;  3EG9 B;  2DL7 A;  3VS0 A;  1KJW A;  4OMO A;  2QEX T;  4E7S A;  3REA B;  1VQL T;  1AWO A;  2ZPG B;  3CCV A;  3PNW C;  2LC4 A;  3OQ5 A;  3LLR A;  2W0Z A;  4M7D F;  3DKM A;  4XTY A;  2CYZ B;  4XTX A;  3FC3 A;  2RHY A;  4X1V A;  3A8L B;  2DMO A;  2XDD A;  4KRT A;  4N0A A;  4JS5 A;  1D0Y A;  2HEQ A;  1M4Z A;  2DM1 A;  1K73 R;  1WXB A;  1X6B A;  3S3N A;  2VKN A;  1YJ9 Q;  1JQQ A;  1ZSZ B;  2IIM A;  5GAN f;  3HRT A;  3M9Q A;  3RMQ A;  3PIP A; 
#chains in the Genus database with same CATH homology
 2CP2 A;  4B6M A;  3E2U A;  1WHG A;  2HL3 A;  2MPX C;  2CP7 A;  2HL5 C;  1TOV A;  3TQ7 P;  1WHH A;  2E4H A;  2Z0W A;  2COY A;  2CP3 A;  2HQH A;  2CP0 A;  2COW A;  2CP6 A;  1WHL A;  1WHM A;  1TXQ A;  2HKQ B;  2HKN A;  2E3I A;  1WHK A;  2E3H A;  2M02 A;  1WHJ A;  1LPL A;  3RDV A;  1IXD A;  2CP5 A;  2COZ A;  2QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...