1WHGA

Solution structure of the cap-gly domain in mouse tubulin specific chaperone b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin specific chaperone B
publication title Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whgA01
2E3HA 2CP2A 1LPLA 2MPXC 2COZA 3RDVA 2HL3A 2HQHA 1WHJA 2Z0WA 1WHLA 2CP7A 2COWA 2CP6A 4B6MA 2M02A 2E4HA 2HL5C 1WHGA 2CP5A 3TQ7P 2CP0A 2COYA 1TXQA 2HKQB 1WHHA 2E3IA 2CP3A 1WHMA 1WHKA 3E2UA 1TOVA 2HKNA 1IXDA 2QK0A
chains in the Genus database with same CATH superfamily
1OEBA 1SF9A 1X69A 4MZTA 4E7LA 1BCOA 1WDXA 2PU9B 1ZQ1A 4Q5WA 4PJOB 2EYQA 4C92A 2RO0A 3VS6A 1RAAB 4AG2C 5HY6A 2CP0A 2P4RA 2FRYA 2I2LA 1VIEA 3JCMg 4Z88A 5GANg 1RLPC 1N5ZA 1YITT 1VQ5A 3G1JA 3I55A 3JAME 5GJWB 2ED1A 1WHJA 1ZSZA 2KT1A 4JZ4A 1NG2A 1VQOQ 3KUFA 3CCLQ 2DX1A 1VQ6T 1BYMA 1B3QA 5M9OA 2BZYA 5KE3A 4FYWB 4EIKA 4M7DC 4Z8AA 4BE2A 4M77C 5GAOr 2RHXA 3G6ET 2VGNA 4E7HA 1K73C 2A28A 2KRNA 3C0CA 1N8RU 1X6BA 2DL3A 2EGCA 4PK4A 2DMOA 4RTUA 1D1AA 2VWFA 4M78F 1VQ9A 5KYYA 4RTZA 2DZ9A 4IUTA 2CGHA 1E6GA 3MP8A 2JMCA 3VS7A 4M75C 1T3SA 3PVLA 4EMKB 2QG9B 4XU0A 1QCNA 2DD4A 2Y4YA 5KYWA 1D1BA 3EHQA 2R58A 2VB6A 3CCET 2M9UA 4FSSA 5ECAA 2DO3A 3CBPA 3ZL7C 2MI6A 2DJZA 3QZ9B 2BTTA 5GMKh 2QTVA 3QJ6A 3HRUA 1WJQA 1U8RA 2ZCFB 4M78A 1TSFA 3CMAT 4C92C 1W2BP 2AT1B 2LTOA 4C8QF 1VQLT 4J9DA 4M7AB 2EPDA 3M4GA 1PRMC 1KQ2A 2PTKA 3VS4A 1DJ7B 3FEOA 1QVGS 2HBPA 2QEXA 4PFOA 2YRCA 1ZSZC 4OGCA 4OB3B 4IURA 1S1NA 4IKFA 3M57A 4BY6C 2LDMA 2ZPFB 2RA2A 3JCMe 2EJFA 2L5QA 1Z9ZA 1JBMA 4BD3A 1SPKA 5GANe 1YJWQ 3PNWC 3QJYA 3X24B 4C5GA 3M4YA 1QWEA 5CQYA 3GPLA 2CSQA 2ZPEB 2P0QA 1QVFS 1FXXA 3CPFA 3E2UA 2LQWA 4CC4B 2ENMA 1PC0A 2JW4A 2COZA 1QQJA 4XU2A 4JRIA 1MV0B 4BI3A 3NTHA 3OYEA 2DXBA 3JB9G 4J7IA 2YUOA 4K11A 2EKHA 3VS2A 1K9MR 4PKCC 5LJ3h 4E6RA 1K9AA 2D6FA 2QK0A 2DXTA 5GMKl 2CT4A 3OYYA 1KIKA 1IHWA 2YXYA 1M90R 3CD6Q 3G6EA 1UFFA 2J7IA 1AT1B 5LJ5h 1VQKQ 3EG9A 3GLXA 5DLQE 4M78C 2L2PA 4A4HA 3QBYA 2KNBB 3CCQT 3OSVA 2H3EB 1SHGA 1ARKA 2J6KA 2EKOA 4QVCA 4LNPA 2JNGA 3SWNA 1C6VX 4Y91A 2DL4A 1G3SA 1O75A 2DYIA 5CO7A 3OYNA 4MMLA 2RHYA 1ZUUA 1NPRA 3L2QA 4ANJA 1NLPC 3BY7A 5J3BA 1QKWA 4KBMB 1AZEA 3M53A 3CCRQ 1IO6A 4JLIA 1W4SA 5DY9A 2DRMA 3CC7T 2BKDN 5GMKj 4JPBW 3PMIA 2ZPGB 5CAIA 1ABQA 2RI5A 2MYSA 5GAN6 2XI9A 2C0IA 1M1KR 3CMAA 2G6FX 1MNEA 4OMNA 2L3SA 4QQDA 1TU0B 4ZGEB 3A8MB 1D09B 1I5LA 1NZ9A 1KD1R 1OPLA 2O9SA 2XKOC 1GFDA 2D8HA 4BDZA 4GY5A 5KYUB 1H641 4J6XA 8ATCB 1EX4A 3DB4A 2EYYA 3OYJA 4X1VA 1PD1A 2BIVA 2LZ6B 2CZ7B 1R77A 4CI0C 1BK2A 1YBYA 4XTWA 4B6MA 2K6DA 1RABB 2IVWA 3M56A 2PVOB 3RKYA 4O6JA 4ZN3A 4J9HA 1JJ2P 2QEXQ 1OOTA 1BI2A 2ATCB 1AWOA 2GTOA 4F7UG 2VV5A 4J6WA 1VYUA 4RG2A 1X6GA 4ELYC 4JJBA 1UGPB 1D1CA 2M0OA 2OTJQ 2A37A 5D6YA 2LX7A 3OSSC 2YLCA 1KQSA 5CQXA 2GCXA 4HCBA 1K8AC 1X43A 3BDUA 3SWNC 3LGFA 2D0QB 2E10A 4EDUA 2JN0A 1V1CA 3TSWA 3A8HB 5I11A 3RUXA 2DBMA 4FT4A 3CCLT 3GIBA 3M5AA 4Z89A 2F5KA 2DILA 1M1GA 4DBFA 1GXIE 1CKAA 4A63B 2L89A 3OY9A 3ZBDA 1MV3A 1M2VB 2O88A 4FU6A 4HVWA 2HNIA 2LC4A 1Q95G 4C0DC 5GANd 2E3HA 2D1XA 2RHZA 1OQKA 2HZYA 1WZOA 1W6XA 1G83A 1GBRA 3QIIA 4OF1A 1GRIA 1SRMA 5A0LA 1UG1A 2RJDA 1YIJQ 1YI2T 1NEGA 4LUDA 4RCCA 4E7KA 4M7DD 4OMLA 4M77D 3A8OB 1UE9A 3MEVA 5LJ5d 3JSCA 1XOVA 2FPEA 4FM4B 2X3XD 1U06A 2RJFA 1M27C 4M7DE 3NPFA 3HHTB 1ZUKA 3V8KA 4M77E 2ECZA 1NJIC 2F5TX 1VQMQ 3NGPA 5GAMh 3QG1A 4R56A 2QI2A 1GCQA 3HTRA 2RHUA 4ZNXA 1K73R 2MOXA 1M3AA 2DFUA 2FZGB 1TG0A 2LVMA 4IUVA 2XDBA 5KYNA 2MAMA 3LGLA 3JCMf 2GFAA 2O4XB 2XD0A 4E47A 5GANf 2LCCA 3P8HA 1QMCA 3FDRA 3OMCA 5GJVB 2LT1A 4BI8B 4DEXA 3OBWA 1PNJA 4RTTA 1Q82U 2KEAA 4N0AA 4DBRA 5GAOn 2RQUA 5J26A 3OYHA 1M3BA 3PIPA 1VQPT 2DKGA 2K9GA 4RCBA 3UWNA 2LJ1A 2K4YA 4C92D 3JV3A 4KGVB 3CC2T 1YJNA 2RJEA 1PG5B 3LH0A 4C92E 4JS4A 3OYIA 3VV0A 3SEMA 1TOVA 4J9BA 2DEQA 4IIMA 2NUTA 1QVGA 3SD4A 2GQIA 3G71T 4PLLA 4JDSA 3KXTA 4J9EA 2DTOA 1ZUYA 5CIUA 1D0YA 3X25B 4FYVB 1OPKA 2QQRA 2QGFB 1QP3A 2CYZB 2XG8D 2YLBA 3JRZA 3CC4Q 3H9NA 2RQRA 4C5HA 3EGDB 2LX9A 2NUPB 2F2XA 2V1RA 5CKEA 3J7AF 2OTLT 4N4GA 1QVFA 5FW9A 3X26B 5CKBA 1SKUB 1WFWA 2L0AA 3EG0A 1BI3A 1GCQC 1JU5C 2RMOA 1K4US 4PFZA 4TVRA 1KQSP 5A2QE 2VKNA 3I5SA 4D6WA 4M7AG 3L2ZA 2XMFA 3EHRA 1UEBA 4M75F 1VQ4T 2E65A 4M7DB 4PJJA 5FU6C 4F7UA 2MCNA 2RM4A 2FPDA 3CBMA 4AFSC 1Y96A 1RADB 1PSEA 1YI2A 1FMKA 3VYHB 1X01A 3M59A 3CCRT 3CXCS 4MMKA 2E4HA 4N0AC 4J8OA 2RPNA 1VQ7Q 4OVAA 5FU7C 1NLOC 4PLIA 3NHNA 4M78D 2MIOA 3BE3A 5GMKm 3SB2A 3UATA 3J80E 2DIGA 1QP2A 4M78E 1KJWA 2MK5A 2A36A 1KK7A 1WGSA 3NMZC 3OYLA 2JS2A 1H3ZA 2EQKA 1SSFA 1B34A 2E12A 1ZBJA 2FEIA 1WHGA 4N4IA 1LVKA 2F2VA 3FJ5A 4JJDA 3I56Q 3OBYA 2KXCA 2BZ8A 4MZPA 2YRDA 2JT4A 3GP8A 4CC2A 5CKDA 2L8DA 2E41A 4C92B 3OS1A 3CCST 2LJ0A 1VQNT 3META 1MMGA 1VQPA 2FZCB 3UPUA 2VASA 3RNJA 4C8QD 4ELZC 4RUGA 1YJ9A 3CC2A 4FT2A 2AHJB 2KMTA 4C8QE 4JUVA 5HK3A 1AOJA 2ESWA 4LUEA 1OYXA 2AKKA 2EYXA 5EC7A 3ZEHA 2C0OA 4KGXB 4XTVA 2DXCA 4JLGA 5LJ3g 3G71A 1HXDA 1ZBXA 2FO0A 2DL5A 3R6OA 2DEUA 5HK0A 2EBPA 1KHIA 4Y92A 2DTIA 3RIRA 1UTIA 2YUNA 1UHCA 3QXEB 2CZ1B 2CREA 2OJ2A 4NS5A 1B07A 1V29B 3PTAA 5LJ5g 1JXMA 4MZMA 4A4FA 2O2OA 2OTLA 1S72A 1D3BB 3M54A 4KRTA 2YSQA 1N8RC 5I2SA 5I22A 2WSCE 2XK0A 3UA6A 5KYWB 1PCXA 2HD0A 2GTJA 3M0UA 2V8IA 1QVGP 2GQVA 2MPXC 3V8LA 3VS3A 3INZA 3EFSA 1HSQA 1SRLA 2LJ3A 1QCOA 1YHQQ 2COWA 1WXUA 1K8AR 2AZSA 2EGEA 2YT6A 3GF5A 1Q7YU 2DF6A 1YP5A 2KDSA 1YIJT 1Q86U 4RTWA 3ULRB 3LWHA 1M1FA 4PNOA 3VU3C 4LE9A 2V26A 4A4GA 2YHTA 4OMFB 2QQAA 4BE0A 1NM7A 3DB3A 1VQMT 1ABOA 3CCVT 2KK4A 1RAFB 5IHNA 2CP5A 2VYTA 3G4ST 2E5KA 2M51A 1PM3A 1SHFA 1XQHA 5D7UA 1BU1A 2KT8A 2LMJA 2RQVA 3HFNA 5HCKA 3THKA 2LNVA 2DNUA 1RAEB 2PZ1A 3OYCA 4FYXB 2VC8A 4C8QB 4E2FB 1Q81U 3CCSA 1VQNA 3GOXA 3LH5A 2EYZA 3CCUQ 3H41A 2MF2A 3HKSA 4OB0B 5GMKi 2EJGA 3CMET 4DA4A 4M7AA 2E64A 2SRCA 4HVVA 2FG0A 2VGMA 2DBKA 4A4KA 3QWYA 2YUQA 5LJ3e 1UB4A 3CCJT 4LDXA 4UC4A 1G2BA 1T0JA 1NJIR 1MMDA 3HPWA 1JEGA 1ZA1B 2KYBA 1I4K1 3VUBA 1T3LA 1YITA 3IQLA 2EGAA 2NWMA 1K76A 5LJ5e 1KC8U 1W2BS 5A0GA 1W70A 1MNDA 2W0ZA 5GAN4 4NL3A 3WXMB 4EMGA 3EFOB 1RI9A 3EG9B 1VQ6A 3OMGA 1VQ5Q 1OULA 3I55Q 3UF4A 3CC4T 5IXFA 3WVEB 2JTFA 1BCMA 4IUQA 2CUDA 3A5ZB 4HT8A 2ZZDA 1H8KA 1AZGB 3SWNB 1WXBA 3CPWS 2KI7A 1G3YA 2HSPA 1NEBA 3RR6A 1TS9A 4AFQC 4C0FA 2OAUA 1VQ8T 2KVQG 1KFZA 1HD3A 5IH2A 2ZPIB 4DBHA 3VRYA 4KULA 2GBQA 6AT1B 4EMKC 3HL8A 4GBQA 1SEMA 2H8HA 4J7FA 1M3CA 1M8VA 2CZ0B 3L42A 1VQ9Q 1UGVA 3RKWA 3RMQA 4P5NA 1TWBA 3CCEA 4A54A 5DLOA 1IZ6A 1UGQB 4BB7A 3M0SA 1SG5A 5KE2A 1G8XA 4AFZC 5FLXE 4D8KA 1VQ7T 1H3HA 5DM7R 5GAMg 4LXCA 1OV3A 4IIOA 4HT9A 4M7AC 1VQLA 3SDZA 4ZTJA 3CCVA 4FL6A 3CEYA 2LT4A 2HKQB 1ZHIA 2RK2A 2VVKA 3G4SA 2C06A 2JUFA 2HQXA 4LDYA 1TH7A 1YCSB 4DEYA 3MKDA 2D0NA 1WQ7A 3KFVA 2P0KA 2QA4T 3VYGA 2DRKA 3MEWA 3CCMT 4LDWA 4J9FA 4GLKA 4XTYA 3REAB 3CXCA 2KBTA 3E9FA 3VS0A 1K1ZA 5AT1B 5CVIA 2QDYB 1LPLA 4QVZA 4YTLA 4A53A 1OI1A 1QLYA 2X51A 3CCJA 3EGUA 2DXUA 4RKUE 3ER0A 3S3MA 5KYUA 2K79A 2NYSA 3AHUA 1UGRB 2F1LA 2ROLA 2HSEB 5KYXB 2FL7A 1XTDA 2HMAA 3EAEA 1VQOT 3EGXB 3PT9A 1AWWA 1UUEA 3QHSA 3WVDB 3T9NA 5GANj 4KT0E 1N6AA 3E1SA 2BE7D 2OI3A 2B86A 4XU3A 3GNGA 3C12A 1NYFA 3GNFB 3VRZA 1Y0MA 1I8FA 3JB9F 2BZXA 2E6ZA 3OYDA 4ZGDB 2KXDA 1VQ8A 2DM1A 3CCQA 2XICA 5FROA 4DOVA 3JCMP 2PVGB 2LNHB 2CH4A 2QAZA 3M0TA 3OYGA 3G6EQ 2B8AA 1JJ2S 5LJ3d 3TQ7P 5GAOl 3RKXA 3JB9H 4BUGA 3PVQA 3JB9J 1G3TA 1UGSB 5GAMe 2ZGWA 4R0KA 4FCYA 1KHCA 2KY9A 3O8VA 1SSHA 2IIMA 3ME9A 2ZPBB 2AIRB 3X28B 2A0FB 4F7UE 3CC7A 2J6OA 2E1HA 4KUDK 4E7ZA 4B9WA 1GCPA 2KRSA 1MHNA 2RHIA 2JMAA 1OU8A 1FMWA 1Z9QA 1VYTA 1Y7XA 2GNCA 4PJOG 4J83A 1B7TA 5IAYA 1WX6A 3M58A 5CR2A 1A0NB 5I21A 2CKKA 4RTYA 4M75D 2K5FA 3V7RA 2JM8A 1N8RR 2K3YA 2WSEE 3CMAQ 1BBZA 4M75E 5J39A 2RH2A 2E5QA 1WHHA 2QDLA 2RB6A 2QA4A 2M0YA 1UECA 5LJ3f 3CCMA 4LD9K 4J9IA 2LCSA 1ZLMA 1YJWT 3QYGB 5IHIA 1Q82C 1AHJB 1M90U 1CKBA 2QTXA 1J3TA 3QDFA 1PD0A 3TSZA 2NUTB 2HAXA 5LJ5f 1TXQA 3DKMA 4BE1A 2O4XA 2RQTA 2EFIA 4XTUA 4CC7A 1WHMA 2HKNA 4IUPA 4QQ6A 2FHDA 3O5ZA 2JZ2A 1O9SA 3OYAA 5KCHA 2HQEA 1ZSGA 4JRKA 1PWTA 5GAOq 1MGQA 4DBQA 3A8LB 4BDYA 1OZ2A 1TTHB 1VQOA 1QCFA 3DLLA 1X75C 1OU9A 3CCLA 4F7UF 1PHTA 1BIAA 4MDXA 3CXCP 3M0QA 1M8MA 3CD6T 4MDWA 4F16A 3MO8A 2NLUA 1K0SA 4JJNK 3SHWA 5GAN5 1VQKT 4AMCA 3MCAB 5FRMA 1M1KU 1GFCA 3TREA 2VXEA 2A7YA 4WTOB 2RD1A 1KD1U 2KQWA 2P84A 2LCLA 1FYNA 3L2UA 5IT9E 4HCZA 2PUKB 1MMNA 4M77B 4XAXB 1W2BA 3CQTA 2KGTA 3N5BB 1VQ9T 1G5VA 3P8BB 2MWPA 1WLPB 1PKSA 3EGDA 4HA8A 4L6V5 1MMAA 5IHKA 2CT3A 5GAN3 3OB9A 3OS5A 3QUIA 3EH2A 4C8QG 4DQ2A 2DA9A 1ACMB 3MHXA 1TUCA 3VUZA 3PIOA 4M75B 3DLMA 3EG2A 3CPWA 2K5LA 4EMHA 3HP9A 4KGZB 3E9GA 3FB9A 1WJSA 2CP7A 2E70A 1U3OA 2KR3A 1UDLA 3URGA 3QZ5B 3MEUA 1YN8A 2HL5C 3PE0A 4Y28E 3MEAA 1LJOA 4PFPA 2CP3A 1FX7A 3QYHB 1EFNA 3P8DA 1JO8A 1RI0A 2RNAA 4JRPA 3ZFJA 2CP2A 4WF2A 2QASA 2HBWA 3FC3A 3TVTA 2KRMA 3V7SA 1YJWA 4PJOF 2JOYA 3EH1A 1K0XA 5GAMd 1WPYA 1E6HA 2QEXT 1X2KA 3FRNA 4C5EA 5CCAA 1ZSZB 4QW2A 3TU4K 2SEMA 2QQSA 2EQUA 4BY6B 2OTJT 5L8RE 2YDLA 3OW2S 2HL3A 4WCIA 3UT1A 4ZN1A 3KBGA 1YJNQ 1WYXA 1M5Q1 5GAN7 1IREB 1IHVA 1HYOA 2COYA 2XHCA 3VS1A 5GAN8 5GAOp 4PJOA 3D7SB 2HEQA 3LX7A 3BW1A 3EG3A 3JCMX 2GF7A 5KYYB 1N9RA 3CD6A 1QKXA 1X6OA 2OAWA 4HKEA 2IPOB 3OA6A 3QPHA 3RBBB 3TCJA 1WA7A 2Y90A 1VQKA 1C1AA 2FYKA 4OMQA 2YWWA 4R55A 1UJ0A 2EWNA 5GAMf 2MMPA 3H6ZA 3JB9I 3S3NA 4OMPA 1K73U 1VOMA 3EG1A 1GBQA 4J9GA 2XDDA 2L3PA 1VUBA 3FLGA 4HXJA 5GMKe 2D8JA 2K57A 1VQ4A 3RERA 2L3QA 1JRIA 1X2QA 3C4SA 2EW3A 4OMOA 2IG0A 3ASKA 3OS0A 2DVJA 5FWCA 1RAGB 4M78B 1E7OA 1RACB 2I0NA 2PNIA 4PJMA 3CCRA 3HFOA 4JJCA 2FB7A 1Q7YC 3X20B 1Q86C 1D3BA 2AZVA 2WSFE 1M9SA 3H0IA 4NOYA 3HSBA 4KH0B 1LNXA 1G3WA 1QVFP 8AT1B 4EPCA 2K2MA 4M7AF 3RESA 1YI2Q 2LQNA 5IN1A 1CSKA 2KSSA 4EMKA 9ATCB 1JJ2A 4XU1A 2BE9B 2DJQA 1WNLA 1QW1A 1JXOA 1I81A 4BACA 4FYYB 1WJRA 3I9QA 5GAN2 1IB8A 1AWXA 3MP6A 2VXFA 2P0PA 4F17A 3QWXX 2K7AA 4FSXA 5GAOm 4PJOC 2J06A 2K3BA 1Q81C 3JCMJ 1QVPA 3FIFA 1YCYA 3HRSA 2RQWA 2O31A 2JXBA 2DL7A 1W1FA 1TUDA 3CPWP 2GFUA 3REBB 3L2RA 1IXDA 4D8DA 3M55A 3G7ZA 1C0MA 2FRWA 5D6WA 2OTJA 2EVRA 1VQPQ 3H0FA 3PGGA 4QKUA 4IUUA 2PQWA 1YJ9Q 3CBOA 4C8QA 3CC2Q 2KAFA 2JM9A 1ZA2B 1M30A 1WXTA 3FJPA 1JB0E 1TUGB 5CKHA 1KC8C 3JCMh 5IXBA 1HK9A 4RTXA 5GANh 2V8KA 2D9TA 4O5VA 3LWIA 1XJWB 2K5IA 1PKTA 5CKFA 1NE8A 1V76A 1QWFA 2A08A 3G71Q 2ROTA 1BI1A 3V7CA 3OYBA 1Q82R 2NUZA 3JCMc 3OYMA 4GLMA 3S3OA 4LDVA 2EYWA 2JVVA 1XNIA 4ZTFA 2OTLQ 2HCKA 3M9QA 1S72Q 3EFOA 2JTMA 4XTZA 3M0PA 4RMOA 2KYMA 3NFCA 4JRQA 2A3LA 3C94A 4C0DB 1YIJA 5A0DA 4C5IA 1BIBA 1MUZA 1R0CB 1VQ4Q 1X27A 1H92A 3JB9D 2DIQA 3QSUA 4X9DA 2P4TA 2O01E 1VQMA 2RN8A 3OQ5A 3U23A 4ME7A 1WIEA 2KE9A 2O9VA 2LQ8A 4X34A 3UA7A 1R8OB 2H3JA 3JCMb 4XK8E 1IGQA 3HRTA 3AT1B 4CRIA 4LDUA 3I56T 2LRQA 2E6NA 4OB2B 4C8QC 2XDPA 1T0HA 4E7JA 1AWJA 4L5GA 4RG8A 2M02A 2RK1A 1FMVA 3OYKA 2CDTA 1U1SA 2EJ9A 4JS5A 2M16A 2R5MA 1Y57A 1RLQC 2X4XA 3CMEA 2L3RA 2YUPA 3GBQA 1NYGA 3L2VA 3CCSQ 3NTIA 1VQNQ 2DTHA 2X4YA 4LN2A 2JTEA 2QQ9A 1IRXA 2EAYA 2MWOA 2DZCA 2CS7A 4PJNA 3M0RA 1YJNT 1RL2A 2AKLA 4B9XA 4M7DG 1R0BG 4M77G 3V8JA 1K8AU 2FVUA 2RJCA 2JJ9A 4FW2A 3JCMQ 3F70A 4OMMA 1YITQ 1U1TA 4C0GA 4PL6A 3JCMW 2V1QA 1M4ZA 2VUBA 3A1PA 3CC4A 4RTVA 1Y07A 4LD6A 1WHKA 4AG1C 3UDCA 2Y4XA 1I5OB 5LJ3j 1N27A 1OZ3A 1VIFA 3OYFA 1VQ6Q 2FPFA 4M75G 3A98A 1IGUA 2DL8A 4FW1A 2QXFA 1OX9A 2XU8A 5KYXA 3OW2A 2KROA 1BB9A 3L2WA 1KQ1A 3EGXA 2DPPB 5LJ5j 3LLRA 2BUDA 4CC3A 1AVZC 3BDLA 3JCMd 2RI3A 1YHQT 1GL5A 4ATOA 2X3WD 4F14A 2QQBA 2HQHA 2W10A 4F04B 1M2VA 4DOWA 3MPUB 4C92G 4NL2A 2DVEA 5D6XA 2DYBA 3LYIA 1VQ7A 2AK5A 1D0ZA 1EZZB 4QQGA 4XQ3A 2DD5A 5EG2A 1JQQA 4OGEA 5FU6B 4ESRA 3CCEQ 2EQMA 1UHFA 1N9SA 3Q1JA 5L23A 2LP5A 4XTXA 1UJYA 1NJIU 4J6YA 1WQWA 4JZ3A 5C0MA 3H0HA 5FU7B 1ZX6A 4OP0A 3I56A 1YNZA 1VQLQ 3TEEA 3CCVQ 1K9MU 3S6WA 2DE0X 4J5YA 5AYFA 4E7IA 3G4SQ 1K9MC 1NPPA 2R57A 2RF0A 3CCUT 2R5AA 3VKIA 4M4ZA 2FZKB 3MP1A 2V8JA 1EIFA 2DAQA 4N4HA 1Q7YR 3EFRA 1Q86R 1HJDA 3R6NA 3E19A 1M90C 3QKJA 2X4JA 2EIFA 1NBEB 2CZ6B 3C95A 1FWZA 2ZPHB 2X35A 4X9CA 1YFNA 4BI4A 4FIBA 1WI7A 4KH1B 2F69A 3PMTA 3CMEQ 1Y71A 2K2VA 1KG1A 4VUBA 3MJXA 3PFSA 1YJ9T 2ED0A 3CCJQ 3L1AA 4HCKA 1BI0A 4PJOD 2QGGA 2GGRA 1AD5A 4HCCA 1PSFA 1BKBA 1VQ5T 5FRNA 3I55T 2G3RA 3LW5E 1I0CA 3I35A 2F2WA 2PUOB 2DLPA 4M78G 4PJOE 2EQIA 3RMSA 4ORZA 3QDRB 1LOJA 5I2MA 3NTKA 1Q81R 5CK9A 2Z0WA 1WHLA 5HKCA 3VJPA 5C6SA 1YWPA 1LCKA 3BFMA 2JS0A 2C0TA 2QYZA 1PRLC 4E7SA 2DETA 2X4WA 4F7UB 1M1KC 2E3IA 1P92A 3JCMV 1RUWA 4M7DF 1Y96B 1M2OA 4M77F 3SFMA 1KD1C 1S72T 4QT7A 2DERA 2WACA 1YHQA 4OB1B 1VQ8Q 3CCQQ 2CP6A 2NUPA 1RAHB 2ABLA 1VYVA 1OX8A 2OX7A 2X9HA 2CH4W 2K3XA 1KC8R 2EQJA 7AT1B 4A4EA 3OS2A 2J6FA 2M1HA 3VS5A 4II1A 2RI2A 1B34B 1D0XA 3RDVA 4C0ZA 1KSWA 1VA7A 2CUBA 2ZAEA 5KCOA 4M7DA 4V2SA 4M77A 3I5RA 4KUIA 5FWBA 3CC7Q 3OW2P 4AFUC 3QO3A 1AEYA 3A8GB 1I07A 2LQKA 1YWOA 4QVDA 2J05A 5GAMj 4AT1B 4C92F 2XIDA 4L59A 3H8ZA 2CSIA 2YRVA 5KH6A 4Z02A 4PJLA 4M75A 4ZGJB 1KQSS 2DK3A 4J9CA 3CCUA 4HVUA 1RAIB 3J81E 4M7AD 1F1BB 1I1JA 5LL6S 1U5SA 2QA4Q 2HDAA 3CCMQ 4M7AE 2PVDB
chains in the Genus database with same CATH topology
2E3HA 2CP2A 1LPLA 2MPXC 2COZA 3RDVA 2HL3A 2HQHA 1WHJA 2Z0WA 1WHLA 2CP7A 2COWA 2CP6A 4B6MA 2M02A 2E4HA 2HL5C 1WHGA 2CP5A 3TQ7P 2CP0A 2COYA 1TXQA 2HKQB 1WHHA 2E3IA 2CP3A 1WHMA 1WHKA 3E2UA 1TOVA 2HKNA 1IXDA 2QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3H A;  2CP2 A;  1LPL A;  2MPX C;  2COZ A;  3RDV A;  2HL3 A;  2HQH A;  1WHJ A;  2Z0W A;  1WHL A;  2CP7 A;  2COW A;  2CP6 A;  4B6M A;  2M02 A;  2E4H A;  2HL5 C;  1WHG A;  2CP5 A;  3TQ7 P;  2CP0 A;  2COY A;  1TXQ A;  2HKQ B;  1WHH A;  2E3I A;  2CP3 A;  1WHM A;  1WHK A;  3E2U A;  1TOV A;  2HKN A;  1IXD A;  2QK0 A; 
#chains in the Genus database with same CATH topology
 1OEB A;  1SF9 A;  1X69 A;  4MZT A;  4E7L A;  1BCO A;  1WDX A;  2PU9 B;  1ZQ1 A;  4Q5W A;  4PJO B;  2EYQ A;  4C92 A;  2RO0 A;  3VS6 A;  1RAA B;  4AG2 C;  5HY6 A;  2CP0 A;  2P4R A;  2FRY A;  2I2L A;  1VIE A;  3JCM g;  4Z88 A;  5GAN g;  1RLP C;  1N5Z A;  1YIT T;  1VQ5 A;  3G1J A;  3I55 A;  3JAM E;  5GJW B;  2ED1 A;  1WHJ A;  1ZSZ A;  2KT1 A;  4JZ4 A;  1NG2 A;  1VQO Q;  3KUF A;  3CCL Q;  2DX1 A;  1VQ6 T;  1BYM A;  1B3Q A;  5M9O A;  2BZY A;  5KE3 A;  4FYW B;  4EIK A;  4M7D C;  4Z8A A;  4BE2 A;  4M77 C;  5GAO r;  2RHX A;  3G6E T;  2VGN A;  4E7H A;  1K73 C;  2A28 A;  2KRN A;  3C0C A;  1N8R U;  1X6B A;  2DL3 A;  2EGC A;  4PK4 A;  2DMO A;  4RTU A;  1D1A A;  2VWF A;  4M78 F;  1VQ9 A;  5KYY A;  4RTZ A;  2DZ9 A;  4IUT A;  2CGH A;  1E6G A;  3MP8 A;  2JMC A;  3VS7 A;  4M75 C;  1T3S A;  3PVL A;  4EMK B;  2QG9 B;  4XU0 A;  1QCN A;  2DD4 A;  2Y4Y A;  5KYW A;  1D1B A;  3EHQ A;  2R58 A;  2VB6 A;  3CCE T;  2M9U A;  4FSS A;  5ECA A;  2DO3 A;  3CBP A;  3ZL7 C;  2MI6 A;  2DJZ A;  3QZ9 B;  2BTT A;  5GMK h;  2QTV A;  3QJ6 A;  3HRU A;  1WJQ A;  1U8R A;  2ZCF B;  4M78 A;  1TSF A;  3CMA T;  4C92 C;  1W2B P;  2AT1 B;  2LTO A;  4C8Q F;  1VQL T;  4J9D A;  4M7A B;  2EPD A;  3M4G A;  1PRM C;  1KQ2 A;  2PTK A;  3VS4 A;  1DJ7 B;  3FEO A;  1QVG S;  2HBP A;  2QEX A;  4PFO A;  2YRC A;  1ZSZ C;  4OGC A;  4OB3 B;  4IUR A;  1S1N A;  4IKF A;  3M57 A;  4BY6 C;  2LDM A;  2ZPF B;  2RA2 A;  3JCM e;  2EJF A;  2L5Q A;  1Z9Z A;  1JBM A;  4BD3 A;  1SPK A;  5GAN e;  1YJW Q;  3PNW C;  3QJY A;  3X24 B;  4C5G A;  3M4Y A;  1QWE A;  5CQY A;  3GPL A;  2CSQ A;  2ZPE B;  2P0Q A;  1QVF S;  1FXX A;  3CPF A;  3E2U A;  2LQW A;  4CC4 B;  2ENM A;  1PC0 A;  2JW4 A;  2COZ A;  1QQJ A;  4XU2 A;  4JRI A;  1MV0 B;  4BI3 A;  3NTH A;  3OYE A;  2DXB A;  3JB9 G;  4J7I A;  2YUO A;  4K11 A;  2EKH A;  3VS2 A;  1K9M R;  4PKC C;  5LJ3 h;  4E6R A;  1K9A A;  2D6F A;  2QK0 A;  2DXT A;  5GMK l;  2CT4 A;  3OYY A;  1KIK A;  1IHW A;  2YXY A;  1M90 R;  3CD6 Q;  3G6E A;  1UFF A;  2J7I A;  1AT1 B;  5LJ5 h;  1VQK Q;  3EG9 A;  3GLX A;  5DLQ E;  4M78 C;  2L2P A;  4A4H A;  3QBY A;  2KNB B;  3CCQ T;  3OSV A;  2H3E B;  1SHG A;  1ARK A;  2J6K A;  2EKO A;  4QVC A;  4LNP A;  2JNG A;  3SWN A;  1C6V X;  4Y91 A;  2DL4 A;  1G3S A;  1O75 A;  2DYI A;  5CO7 A;  3OYN A;  4MML A;  2RHY A;  1ZUU A;  1NPR A;  3L2Q A;  4ANJ A;  1NLP C;  3BY7 A;  5J3B A;  1QKW A;  4KBM B;  1AZE A;  3M53 A;  3CCR Q;  1IO6 A;  4JLI A;  1W4S A;  5DY9 A;  2DRM A;  3CC7 T;  2BKD N;  5GMK j;  4JPB W;  3PMI A;  2ZPG B;  5CAI A;  1ABQ A;  2RI5 A;  2MYS A;  5GAN 6;  2XI9 A;  2C0I A;  1M1K R;  3CMA A;  2G6F X;  1MNE A;  4OMN A;  2L3S A;  4QQD A;  1TU0 B;  4ZGE B;  3A8M B;  1D09 B;  1I5L A;  1NZ9 A;  1KD1 R;  1OPL A;  2O9S A;  2XKO C;  1GFD A;  2D8H A;  4BDZ A;  4GY5 A;  5KYU B;  1H64 1;  4J6X A;  8ATC B;  1EX4 A;  3DB4 A;  2EYY A;  3OYJ A;  4X1V A;  1PD1 A;  2BIV A;  2LZ6 B;  2CZ7 B;  1R77 A;  4CI0 C;  1BK2 A;  1YBY A;  4XTW A;  4B6M A;  2K6D A;  1RAB B;  2IVW A;  3M56 A;  2PVO B;  3RKY A;  4O6J A;  4ZN3 A;  4J9H A;  1JJ2 P;  2QEX Q;  1OOT A;  1BI2 A;  2ATC B;  1AWO A;  2GTO A;  4F7U G;  2VV5 A;  4J6W A;  1VYU A;  4RG2 A;  1X6G A;  4ELY C;  4JJB A;  1UGP B;  1D1C A;  2M0O A;  2OTJ Q;  2A37 A;  5D6Y A;  2LX7 A;  3OSS C;  2YLC A;  1KQS A;  5CQX A;  2GCX A;  4HCB A;  1K8A C;  1X43 A;  3BDU A;  3SWN C;  3LGF A;  2D0Q B;  2E10 A;  4EDU A;  2JN0 A;  1V1C A;  3TSW A;  3A8H B;  5I11 A;  3RUX A;  2DBM A;  4FT4 A;  3CCL T;  3GIB A;  3M5A A;  4Z89 A;  2F5K A;  2DIL A;  1M1G A;  4DBF A;  1GXI E;  1CKA A;  4A63 B;  2L89 A;  3OY9 A;  3ZBD A;  1MV3 A;  1M2V B;  2O88 A;  4FU6 A;  4HVW A;  2HNI A;  2LC4 A;  1Q95 G;  4C0D C;  5GAN d;  2E3H A;  2D1X A;  2RHZ A;  1OQK A;  2HZY A;  1WZO A;  1W6X A;  1G83 A;  1GBR A;  3QII A;  4OF1 A;  1GRI A;  1SRM A;  5A0L A;  1UG1 A;  2RJD A;  1YIJ Q;  1YI2 T;  1NEG A;  4LUD A;  4RCC A;  4E7K A;  4M7D D;  4OML A;  4M77 D;  3A8O B;  1UE9 A;  3MEV A;  5LJ5 d;  3JSC A;  1XOV A;  2FPE A;  4FM4 B;  2X3X D;  1U06 A;  2RJF A;  1M27 C;  4M7D E;  3NPF A;  3HHT B;  1ZUK A;  3V8K A;  4M77 E;  2ECZ A;  1NJI C;  2F5T X;  1VQM Q;  3NGP A;  5GAM h;  3QG1 A;  4R56 A;  2QI2 A;  1GCQ A;  3HTR A;  2RHU A;  4ZNX A;  1K73 R;  2MOX A;  1M3A A;  2DFU A;  2FZG B;  1TG0 A;  2LVM A;  4IUV A;  2XDB A;  5KYN A;  2MAM A;  3LGL A;  3JCM f;  2GFA A;  2O4X B;  2XD0 A;  4E47 A;  5GAN f;  2LCC A;  3P8H A;  1QMC A;  3FDR A;  3OMC A;  5GJV B;  2LT1 A;  4BI8 B;  4DEX A;  3OBW A;  1PNJ A;  4RTT A;  1Q82 U;  2KEA A;  4N0A A;  4DBR A;  5GAO n;  2RQU A;  5J26 A;  3OYH A;  1M3B A;  3PIP A;  1VQP T;  2DKG A;  2K9G A;  4RCB A;  3UWN A;  2LJ1 A;  2K4Y A;  4C92 D;  3JV3 A;  4KGV B;  3CC2 T;  1YJN A;  2RJE A;  1PG5 B;  3LH0 A;  4C92 E;  4JS4 A;  3OYI A;  3VV0 A;  3SEM A;  1TOV A;  4J9B A;  2DEQ A;  4IIM A;  2NUT A;  1QVG A;  3SD4 A;  2GQI A;  3G71 T;  4PLL A;  4JDS A;  3KXT A;  4J9E A;  2DTO A;  1ZUY A;  5CIU A;  1D0Y A;  3X25 B;  4FYV B;  1OPK A;  2QQR A;  2QGF B;  1QP3 A;  2CYZ B;  2XG8 D;  2YLB A;  3JRZ A;  3CC4 Q;  3H9N A;  2RQR A;  4C5H A;  3EGD B;  2LX9 A;  2NUP B;  2F2X A;  2V1R A;  5CKE A;  3J7A F;  2OTL T;  4N4G A;  1QVF A;  5FW9 A;  3X26 B;  5CKB A;  1SKU B;  1WFW A;  2L0A A;  3EG0 A;  1BI3 A;  1GCQ C;  1JU5 C;  2RMO A;  1K4U S;  4PFZ A;  4TVR A;  1KQS P;  5A2Q E;  2VKN A;  3I5S A;  4D6W A;  4M7A G;  3L2Z A;  2XMF A;  3EHR A;  1UEB A;  4M75 F;  1VQ4 T;  2E65 A;  4M7D B;  4PJJ A;  5FU6 C;  4F7U A;  2MCN A;  2RM4 A;  2FPD A;  3CBM A;  4AFS C;  1Y96 A;  1RAD B;  1PSE A;  1YI2 A;  1FMK A;  3VYH B;  1X01 A;  3M59 A;  3CCR T;  3CXC S;  4MMK A;  2E4H A;  4N0A C;  4J8O A;  2RPN A;  1VQ7 Q;  4OVA A;  5FU7 C;  1NLO C;  4PLI A;  3NHN A;  4M78 D;  2MIO A;  3BE3 A;  5GMK m;  3SB2 A;  3UAT A;  3J80 E;  2DIG A;  1QP2 A;  4M78 E;  1KJW A;  2MK5 A;  2A36 A;  1KK7 A;  1WGS A;  3NMZ C;  3OYL A;  2JS2 A;  1H3Z A;  2EQK A;  1SSF A;  1B34 A;  2E12 A;  1ZBJ A;  2FEI A;  1WHG A;  4N4I A;  1LVK A;  2F2V A;  3FJ5 A;  4JJD A;  3I56 Q;  3OBY A;  2KXC A;  2BZ8 A;  4MZP A;  2YRD A;  2JT4 A;  3GP8 A;  4CC2 A;  5CKD A;  2L8D A;  2E41 A;  4C92 B;  3OS1 A;  3CCS T;  2LJ0 A;  1VQN T;  3MET A;  1MMG A;  1VQP A;  2FZC B;  3UPU A;  2VAS A;  3RNJ A;  4C8Q D;  4ELZ C;  4RUG A;  1YJ9 A;  3CC2 A;  4FT2 A;  2AHJ B;  2KMT A;  4C8Q E;  4JUV A;  5HK3 A;  1AOJ A;  2ESW A;  4LUE A;  1OYX A;  2AKK A;  2EYX A;  5EC7 A;  3ZEH A;  2C0O A;  4KGX B;  4XTV A;  2DXC A;  4JLG A;  5LJ3 g;  3G71 A;  1HXD A;  1ZBX A;  2FO0 A;  2DL5 A;  3R6O A;  2DEU A;  5HK0 A;  2EBP A;  1KHI A;  4Y92 A;  2DTI A;  3RIR A;  1UTI A;  2YUN A;  1UHC A;  3QXE B;  2CZ1 B;  2CRE A;  2OJ2 A;  4NS5 A;  1B07 A;  1V29 B;  3PTA A;  5LJ5 g;  1JXM A;  4MZM A;  4A4F A;  2O2O A;  2OTL A;  1S72 A;  1D3B B;  3M54 A;  4KRT A;  2YSQ A;  1N8R C;  5I2S A;  5I22 A;  2WSC E;  2XK0 A;  3UA6 A;  5KYW B;  1PCX A;  2HD0 A;  2GTJ A;  3M0U A;  2V8I A;  1QVG P;  2GQV A;  2MPX C;  3V8L A;  3VS3 A;  3INZ A;  3EFS A;  1HSQ A;  1SRL A;  2LJ3 A;  1QCO A;  1YHQ Q;  2COW A;  1WXU A;  1K8A R;  2AZS A;  2EGE A;  2YT6 A;  3GF5 A;  1Q7Y U;  2DF6 A;  1YP5 A;  2KDS A;  1YIJ T;  1Q86 U;  4RTW A;  3ULR B;  3LWH A;  1M1F A;  4PNO A;  3VU3 C;  4LE9 A;  2V26 A;  4A4G A;  2YHT A;  4OMF B;  2QQA A;  4BE0 A;  1NM7 A;  3DB3 A;  1VQM T;  1ABO A;  3CCV T;  2KK4 A;  1RAF B;  5IHN A;  2CP5 A;  2VYT A;  3G4S T;  2E5K A;  2M51 A;  1PM3 A;  1SHF A;  1XQH A;  5D7U A;  1BU1 A;  2KT8 A;  2LMJ A;  2RQV A;  3HFN A;  5HCK A;  3THK A;  2LNV A;  2DNU A;  1RAE B;  2PZ1 A;  3OYC A;  4FYX B;  2VC8 A;  4C8Q B;  4E2F B;  1Q81 U;  3CCS A;  1VQN A;  3GOX A;  3LH5 A;  2EYZ A;  3CCU Q;  3H41 A;  2MF2 A;  3HKS A;  4OB0 B;  5GMK i;  2EJG A;  3CME T;  4DA4 A;  4M7A A;  2E64 A;  2SRC A;  4HVV A;  2FG0 A;  2VGM A;  2DBK A;  4A4K A;  3QWY A;  2YUQ A;  5LJ3 e;  1UB4 A;  3CCJ T;  4LDX A;  4UC4 A;  1G2B A;  1T0J A;  1NJI R;  1MMD A;  3HPW A;  1JEG A;  1ZA1 B;  2KYB A;  1I4K 1;  3VUB A;  1T3L A;  1YIT A;  3IQL A;  2EGA A;  2NWM A;  1K76 A;  5LJ5 e;  1KC8 U;  1W2B S;  5A0G A;  1W70 A;  1MND A;  2W0Z A;  5GAN 4;  4NL3 A;  3WXM B;  4EMG A;  3EFO B;  1RI9 A;  3EG9 B;  1VQ6 A;  3OMG A;  1VQ5 Q;  1OUL A;  3I55 Q;  3UF4 A;  3CC4 T;  5IXF A;  3WVE B;  2JTF A;  1BCM A;  4IUQ A;  2CUD A;  3A5Z B;  4HT8 A;  2ZZD A;  1H8K A;  1AZG B;  3SWN B;  1WXB A;  3CPW S;  2KI7 A;  1G3Y A;  2HSP A;  1NEB A;  3RR6 A;  1TS9 A;  4AFQ C;  4C0F A;  2OAU A;  1VQ8 T;  2KVQ G;  1KFZ A;  1HD3 A;  5IH2 A;  2ZPI B;  4DBH A;  3VRY A;  4KUL A;  2GBQ A;  6AT1 B;  4EMK C;  3HL8 A;  4GBQ A;  1SEM A;  2H8H A;  4J7F A;  1M3C A;  1M8V A;  2CZ0 B;  3L42 A;  1VQ9 Q;  1UGV A;  3RKW A;  3RMQ A;  4P5N A;  1TWB A;  3CCE A;  4A54 A;  5DLO A;  1IZ6 A;  1UGQ B;  4BB7 A;  3M0S A;  1SG5 A;  5KE2 A;  1G8X A;  4AFZ C;  5FLX E;  4D8K A;  1VQ7 T;  1H3H A;  5DM7 R;  5GAM g;  4LXC A;  1OV3 A;  4IIO A;  4HT9 A;  4M7A C;  1VQL A;  3SDZ A;  4ZTJ A;  3CCV A;  4FL6 A;  3CEY A;  2LT4 A;  2HKQ B;  1ZHI A;  2RK2 A;  2VVK A;  3G4S A;  2C06 A;  2JUF A;  2HQX A;  4LDY A;  1TH7 A;  1YCS B;  4DEY A;  3MKD A;  2D0N A;  1WQ7 A;  3KFV A;  2P0K A;  2QA4 T;  3VYG A;  2DRK A;  3MEW A;  3CCM T;  4LDW A;  4J9F A;  4GLK A;  4XTY A;  3REA B;  3CXC A;  2KBT A;  3E9F A;  3VS0 A;  1K1Z A;  5AT1 B;  5CVI A;  2QDY B;  1LPL A;  4QVZ A;  4YTL A;  4A53 A;  1OI1 A;  1QLY A;  2X51 A;  3CCJ A;  3EGU A;  2DXU A;  4RKU E;  3ER0 A;  3S3M A;  5KYU A;  2K79 A;  2NYS A;  3AHU A;  1UGR B;  2F1L A;  2ROL A;  2HSE B;  5KYX B;  2FL7 A;  1XTD A;  2HMA A;  3EAE A;  1VQO T;  3EGX B;  3PT9 A;  1AWW A;  1UUE A;  3QHS A;  3WVD B;  3T9N A;  5GAN j;  4KT0 E;  1N6A A;  3E1S A;  2BE7 D;  2OI3 A;  2B86 A;  4XU3 A;  3GNG A;  3C12 A;  1NYF A;  3GNF B;  3VRZ A;  1Y0M A;  1I8F A;  3JB9 F;  2BZX A;  2E6Z A;  3OYD A;  4ZGD B;  2KXD A;  1VQ8 A;  2DM1 A;  3CCQ A;  2XIC A;  5FRO A;  4DOV A;  3JCM P;  2PVG B;  2LNH B;  2CH4 A;  2QAZ A;  3M0T A;  3OYG A;  3G6E Q;  2B8A A;  1JJ2 S;  5LJ3 d;  3TQ7 P;  5GAO l;  3RKX A;  3JB9 H;  4BUG A;  3PVQ A;  3JB9 J;  1G3T A;  1UGS B;  5GAM e;  2ZGW A;  4R0K A;  4FCY A;  1KHC A;  2KY9 A;  3O8V A;  1SSH A;  2IIM A;  3ME9 A;  2ZPB B;  2AIR B;  3X28 B;  2A0F B;  4F7U E;  3CC7 A;  2J6O A;  2E1H A;  4KUD K;  4E7Z A;  4B9W A;  1GCP A;  2KRS A;  1MHN A;  2RHI A;  2JMA A;  1OU8 A;  1FMW A;  1Z9Q A;  1VYT A;  1Y7X A;  2GNC A;  4PJO G;  4J83 A;  1B7T A;  5IAY A;  1WX6 A;  3M58 A;  5CR2 A;  1A0N B;  5I21 A;  2CKK A;  4RTY A;  4M75 D;  2K5F A;  3V7R A;  2JM8 A;  1N8R R;  2K3Y A;  2WSE E;  3CMA Q;  1BBZ A;  4M75 E;  5J39 A;  2RH2 A;  2E5Q A;  1WHH A;  2QDL A;  2RB6 A;  2QA4 A;  2M0Y A;  1UEC A;  5LJ3 f;  3CCM A;  4LD9 K;  4J9I A;  2LCS A;  1ZLM A;  1YJW T;  3QYG B;  5IHI A;  1Q82 C;  1AHJ B;  1M90 U;  1CKB A;  2QTX A;  1J3T A;  3QDF A;  1PD0 A;  3TSZ A;  2NUT B;  2HAX A;  5LJ5 f;  1TXQ A;  3DKM A;  4BE1 A;  2O4X A;  2RQT A;  2EFI A;  4XTU A;  4CC7 A;  1WHM A;  2HKN A;  4IUP A;  4QQ6 A;  2FHD A;  3O5Z A;  2JZ2 A;  1O9S A;  3OYA A;  5KCH A;  2HQE A;  1ZSG A;  4JRK A;  1PWT A;  5GAO q;  1MGQ A;  4DBQ A;  3A8L B;  4BDY A;  1OZ2 A;  1TTH B;  1VQO A;  1QCF A;  3DLL A;  1X75 C;  1OU9 A;  3CCL A;  4F7U F;  1PHT A;  1BIA A;  4MDX A;  3CXC P;  3M0Q A;  1M8M A;  3CD6 T;  4MDW A;  4F16 A;  3MO8 A;  2NLU A;  1K0S A;  4JJN K;  3SHW A;  5GAN 5;  1VQK T;  4AMC A;  3MCA B;  5FRM A;  1M1K U;  1GFC A;  3TRE A;  2VXE A;  2A7Y A;  4WTO B;  2RD1 A;  1KD1 U;  2KQW A;  2P84 A;  2LCL A;  1FYN A;  3L2U A;  5IT9 E;  4HCZ A;  2PUK B;  1MMN A;  4M77 B;  4XAX B;  1W2B A;  3CQT A;  2KGT A;  3N5B B;  1VQ9 T;  1G5V A;  3P8B B;  2MWP A;  1WLP B;  1PKS A;  3EGD A;  4HA8 A;  4L6V 5;  1MMA A;  5IHK A;  2CT3 A;  5GAN 3;  3OB9 A;  3OS5 A;  3QUI A;  3EH2 A;  4C8Q G;  4DQ2 A;  2DA9 A;  1ACM B;  3MHX A;  1TUC A;  3VUZ A;  3PIO A;  4M75 B;  3DLM A;  3EG2 A;  3CPW A;  2K5L A;  4EMH A;  3HP9 A;  4KGZ B;  3E9G A;  3FB9 A;  1WJS A;  2CP7 A;  2E70 A;  1U3O A;  2KR3 A;  1UDL A;  3URG A;  3QZ5 B;  3MEU A;  1YN8 A;  2HL5 C;  3PE0 A;  4Y28 E;  3MEA A;  1LJO A;  4PFP A;  2CP3 A;  1FX7 A;  3QYH B;  1EFN A;  3P8D A;  1JO8 A;  1RI0 A;  2RNA A;  4JRP A;  3ZFJ A;  2CP2 A;  4WF2 A;  2QAS A;  2HBW A;  3FC3 A;  3TVT A;  2KRM A;  3V7S A;  1YJW A;  4PJO F;  2JOY A;  3EH1 A;  1K0X A;  5GAM d;  1WPY A;  1E6H A;  2QEX T;  1X2K A;  3FRN A;  4C5E A;  5CCA A;  1ZSZ B;  4QW2 A;  3TU4 K;  2SEM A;  2QQS A;  2EQU A;  4BY6 B;  2OTJ T;  5L8R E;  2YDL A;  3OW2 S;  2HL3 A;  4WCI A;  3UT1 A;  4ZN1 A;  3KBG A;  1YJN Q;  1WYX A;  1M5Q 1;  5GAN 7;  1IRE B;  1IHV A;  1HYO A;  2COY A;  2XHC A;  3VS1 A;  5GAN 8;  5GAO p;  4PJO A;  3D7S B;  2HEQ A;  3LX7 A;  3BW1 A;  3EG3 A;  3JCM X;  2GF7 A;  5KYY B;  1N9R A;  3CD6 A;  1QKX A;  1X6O A;  2OAW A;  4HKE A;  2IPO B;  3OA6 A;  3QPH A;  3RBB B;  3TCJ A;  1WA7 A;  2Y90 A;  1VQK A;  1C1A A;  2FYK A;  4OMQ A;  2YWW A;  4R55 A;  1UJ0 A;  2EWN A;  5GAM f;  2MMP A;  3H6Z A;  3JB9 I;  3S3N A;  4OMP A;  1K73 U;  1VOM A;  3EG1 A;  1GBQ A;  4J9G A;  2XDD A;  2L3P A;  1VUB A;  3FLG A;  4HXJ A;  5GMK e;  2D8J A;  2K57 A;  1VQ4 A;  3RER A;  2L3Q A;  1JRI A;  1X2Q A;  3C4S A;  2EW3 A;  4OMO A;  2IG0 A;  3ASK A;  3OS0 A;  2DVJ A;  5FWC A;  1RAG B;  4M78 B;  1E7O A;  1RAC B;  2I0N A;  2PNI A;  4PJM A;  3CCR A;  3HFO A;  4JJC A;  2FB7 A;  1Q7Y C;  3X20 B;  1Q86 C;  1D3B A;  2AZV A;  2WSF E;  1M9S A;  3H0I A;  4NOY A;  3HSB A;  4KH0 B;  1LNX A;  1G3W A;  1QVF P;  8AT1 B;  4EPC A;  2K2M A;  4M7A F;  3RES A;  1YI2 Q;  2LQN A;  5IN1 A;  1CSK A;  2KSS A;  4EMK A;  9ATC B;  1JJ2 A;  4XU1 A;  2BE9 B;  2DJQ A;  1WNL A;  1QW1 A;  1JXO A;  1I81 A;  4BAC A;  4FYY B;  1WJR A;  3I9Q A;  5GAN 2;  1IB8 A;  1AWX A;  3MP6 A;  2VXF A;  2P0P A;  4F17 A;  3QWX X;  2K7A A;  4FSX A;  5GAO m;  4PJO C;  2J06 A;  2K3B A;  1Q81 C;  3JCM J;  1QVP A;  3FIF A;  1YCY A;  3HRS A;  2RQW A;  2O31 A;  2JXB A;  2DL7 A;  1W1F A;  1TUD A;  3CPW P;  2GFU A;  3REB B;  3L2R A;  1IXD A;  4D8D A;  3M55 A;  3G7Z A;  1C0M A;  2FRW A;  5D6W A;  2OTJ A;  2EVR A;  1VQP Q;  3H0F A;  3PGG A;  4QKU A;  4IUU A;  2PQW A;  1YJ9 Q;  3CBO A;  4C8Q A;  3CC2 Q;  2KAF A;  2JM9 A;  1ZA2 B;  1M30 A;  1WXT A;  3FJP A;  1JB0 E;  1TUG B;  5CKH A;  1KC8 C;  3JCM h;  5IXB A;  1HK9 A;  4RTX A;  5GAN h;  2V8K A;  2D9T A;  4O5V A;  3LWI A;  1XJW B;  2K5I A;  1PKT A;  5CKF A;  1NE8 A;  1V76 A;  1QWF A;  2A08 A;  3G71 Q;  2ROT A;  1BI1 A;  3V7C A;  3OYB A;  1Q82 R;  2NUZ A;  3JCM c;  3OYM A;  4GLM A;  3S3O A;  4LDV A;  2EYW A;  2JVV A;  1XNI A;  4ZTF A;  2OTL Q;  2HCK A;  3M9Q A;  1S72 Q;  3EFO A;  2JTM A;  4XTZ A;  3M0P A;  4RMO A;  2KYM A;  3NFC A;  4JRQ A;  2A3L A;  3C94 A;  4C0D B;  1YIJ A;  5A0D A;  4C5I A;  1BIB A;  1MUZ A;  1R0C B;  1VQ4 Q;  1X27 A;  1H92 A;  3JB9 D;  2DIQ A;  3QSU A;  4X9D A;  2P4T A;  2O01 E;  1VQM A;  2RN8 A;  3OQ5 A;  3U23 A;  4ME7 A;  1WIE A;  2KE9 A;  2O9V A;  2LQ8 A;  4X34 A;  3UA7 A;  1R8O B;  2H3J A;  3JCM b;  4XK8 E;  1IGQ A;  3HRT A;  3AT1 B;  4CRI A;  4LDU A;  3I56 T;  2LRQ A;  2E6N A;  4OB2 B;  4C8Q C;  2XDP A;  1T0H A;  4E7J A;  1AWJ A;  4L5G A;  4RG8 A;  2M02 A;  2RK1 A;  1FMV A;  3OYK A;  2CDT A;  1U1S A;  2EJ9 A;  4JS5 A;  2M16 A;  2R5M A;  1Y57 A;  1RLQ C;  2X4X A;  3CME A;  2L3R A;  2YUP A;  3GBQ A;  1NYG A;  3L2V A;  3CCS Q;  3NTI A;  1VQN Q;  2DTH A;  2X4Y A;  4LN2 A;  2JTE A;  2QQ9 A;  1IRX A;  2EAY A;  2MWO A;  2DZC A;  2CS7 A;  4PJN A;  3M0R A;  1YJN T;  1RL2 A;  2AKL A;  4B9X A;  4M7D G;  1R0B G;  4M77 G;  3V8J A;  1K8A U;  2FVU A;  2RJC A;  2JJ9 A;  4FW2 A;  3JCM Q;  3F70 A;  4OMM A;  1YIT Q;  1U1T A;  4C0G A;  4PL6 A;  3JCM W;  2V1Q A;  1M4Z A;  2VUB A;  3A1P A;  3CC4 A;  4RTV A;  1Y07 A;  4LD6 A;  1WHK A;  4AG1 C;  3UDC A;  2Y4X A;  1I5O B;  5LJ3 j;  1N27 A;  1OZ3 A;  1VIF A;  3OYF A;  1VQ6 Q;  2FPF A;  4M75 G;  3A98 A;  1IGU A;  2DL8 A;  4FW1 A;  2QXF A;  1OX9 A;  2XU8 A;  5KYX A;  3OW2 A;  2KRO A;  1BB9 A;  3L2W A;  1KQ1 A;  3EGX A;  2DPP B;  5LJ5 j;  3LLR A;  2BUD A;  4CC3 A;  1AVZ C;  3BDL A;  3JCM d;  2RI3 A;  1YHQ T;  1GL5 A;  4ATO A;  2X3W D;  4F14 A;  2QQB A;  2HQH A;  2W10 A;  4F04 B;  1M2V A;  4DOW A;  3MPU B;  4C92 G;  4NL2 A;  2DVE A;  5D6X A;  2DYB A;  3LYI A;  1VQ7 A;  2AK5 A;  1D0Z A;  1EZZ B;  4QQG A;  4XQ3 A;  2DD5 A;  5EG2 A;  1JQQ A;  4OGE A;  5FU6 B;  4ESR A;  3CCE Q;  2EQM A;  1UHF A;  1N9S A;  3Q1J A;  5L23 A;  2LP5 A;  4XTX A;  1UJY A;  1NJI U;  4J6Y A;  1WQW A;  4JZ3 A;  5C0M A;  3H0H A;  5FU7 B;  1ZX6 A;  4OP0 A;  3I56 A;  1YNZ A;  1VQL Q;  3TEE A;  3CCV Q;  1K9M U;  3S6W A;  2DE0 X;  4J5Y A;  5AYF A;  4E7I A;  3G4S Q;  1K9M C;  1NPP A;  2R57 A;  2RF0 A;  3CCU T;  2R5A A;  3VKI A;  4M4Z A;  2FZK B;  3MP1 A;  2V8J A;  1EIF A;  2DAQ A;  4N4H A;  1Q7Y R;  3EFR A;  1Q86 R;  1HJD A;  3R6N A;  3E19 A;  1M90 C;  3QKJ A;  2X4J A;  2EIF A;  1NBE B;  2CZ6 B;  3C95 A;  1FWZ A;  2ZPH B;  2X35 A;  4X9C A;  1YFN A;  4BI4 A;  4FIB A;  1WI7 A;  4KH1 B;  2F69 A;  3PMT A;  3CME Q;  1Y71 A;  2K2V A;  1KG1 A;  4VUB A;  3MJX A;  3PFS A;  1YJ9 T;  2ED0 A;  3CCJ Q;  3L1A A;  4HCK A;  1BI0 A;  4PJO D;  2QGG A;  2GGR A;  1AD5 A;  4HCC A;  1PSF A;  1BKB A;  1VQ5 T;  5FRN A;  3I55 T;  2G3R A;  3LW5 E;  1I0C A;  3I35 A;  2F2W A;  2PUO B;  2DLP A;  4M78 G;  4PJO E;  2EQI A;  3RMS A;  4ORZ A;  3QDR B;  1LOJ A;  5I2M A;  3NTK A;  1Q81 R;  5CK9 A;  2Z0W A;  1WHL A;  5HKC A;  3VJP A;  5C6S A;  1YWP A;  1LCK A;  3BFM A;  2JS0 A;  2C0T A;  2QYZ A;  1PRL C;  4E7S A;  2DET A;  2X4W A;  4F7U B;  1M1K C;  2E3I A;  1P92 A;  3JCM V;  1RUW A;  4M7D F;  1Y96 B;  1M2O A;  4M77 F;  3SFM A;  1KD1 C;  1S72 T;  4QT7 A;  2DER A;  2WAC A;  1YHQ A;  4OB1 B;  1VQ8 Q;  3CCQ Q;  2CP6 A;  2NUP A;  1RAH B;  2ABL A;  1VYV A;  1OX8 A;  2OX7 A;  2X9H A;  2CH4 W;  2K3X A;  1KC8 R;  2EQJ A;  7AT1 B;  4A4E A;  3OS2 A;  2J6F A;  2M1H A;  3VS5 A;  4II1 A;  2RI2 A;  1B34 B;  1D0X A;  3RDV A;  4C0Z A;  1KSW A;  1VA7 A;  2CUB A;  2ZAE A;  5KCO A;  4M7D A;  4V2S A;  4M77 A;  3I5R A;  4KUI A;  5FWB A;  3CC7 Q;  3OW2 P;  4AFU C;  3QO3 A;  1AEY A;  3A8G B;  1I07 A;  2LQK A;  1YWO A;  4QVD A;  2J05 A;  5GAM j;  4AT1 B;  4C92 F;  2XID A;  4L59 A;  3H8Z A;  2CSI A;  2YRV A;  5KH6 A;  4Z02 A;  4PJL A;  4M75 A;  4ZGJ B;  1KQS S;  2DK3 A;  4J9C A;  3CCU A;  4HVU A;  1RAI B;  3J81 E;  4M7A D;  1F1B B;  1I1J A;  5LL6 S;  1U5S A;  2QA4 Q;  2HDA A;  3CCM Q;  4M7A E;  2PVD B; 
#chains in the Genus database with same CATH homology
 2E3H A;  2CP2 A;  1LPL A;  2MPX C;  2COZ A;  3RDV A;  2HL3 A;  2HQH A;  1WHJ A;  2Z0W A;  1WHL A;  2CP7 A;  2COW A;  2CP6 A;  4B6M A;  2M02 A;  2E4H A;  2HL5 C;  1WHG A;  2CP5 A;  3TQ7 P;  2CP0 A;  2COY A;  1TXQ A;  2HKQ B;  1WHH A;  2E3I A;  2CP3 A;  1WHM A;  1WHK A;  3E2U A;  1TOV A;  2HKN A;  1IXD A;  2QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...