1WHGA

Solution structure of the cap-gly domain in mouse tubulin specific chaperone b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Tubulin specific chaperone B
publication title Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B
rcsb
source organism Mus musculus
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whgA01
1WHMA 1WHKA 2COYA 2CP5A 2HL3A 2HKNA 3TQ7P 1TXQA 2E4HA 2CP0A 4B6MA 1LPLA 2HQHA 1WHGA 2HL5C 2M02A 1WHJA 2COWA 1WHHA 2MPXC 3E2UA 1IXDA 2CP6A 2CP7A 1TOVA 2COZA 1WHLA 2E3IA 2QK0A 2CP3A 2E3HA 3RDVA 2HKQB 2Z0WA 2CP2A
chains in the Genus database with same CATH superfamily
1TWBA 2EJFA 3LGFA 2LQKA 4E7JA 4PJOD 2KAFA 1YIJQ 2RJCA 2RI2A 1VIFA 3CCJQ 4M7DA 4ATOA 1NZ9A 1UUEA 3VS7A 2YRCA 3SB2A 1VQ5Q 3OYKA 1D0YA 3OYLA 2COZA 1JBMA 2VASA 1AEYA 2LCCA 1QWFA 1SHFA 3HFOA 1OI1A 1X2QA 2PVDB 2CH4W 4M78D 5D6WA 5FU7C 2OTLT 3DLMA 1B3QA 1OPKA 4IKFA 4B6MA 2EQIA 1TS9A 2Y4XA 2PTKA 1IHVA 1S72A 2RHYA 1ZQ1A 2A3LA 1QP3A 2LQ8A 4OB1B 2PNIA 4DBQA 1MV3A 4DQ2A 1K9MR 4KRTA 2OAWA 1QCFA 1OEBA 1T3SA 3CD6T 3CQTA 4AG2C 4PFOA 2CZ7B 4JJDA 3JCMg 4M4ZA 4Z8AA 4FW1A 3VS0A 2DRKA 3R6OA 4VUBA 2V26A 1N9RA 3CXCA 3RNJA 3MHXA 1TG0A 5LJ5e 2HNIA 3EFOB 3NMZC 3M54A 3SDZA 5GAN3 1M27C 2VC8A 3DB3A 2DLPA 1Y57A 1A0NB 3JB9H 1MV0B 5D6YA 4C0FA 3CMET 4O6JA 2YHTA 4OP0A 2D6FA 1HK9A 2O4XB 2F2WA 3ER0A 4M7AC 2VXEA 3A5ZB 4C5HA 3I56Q 1UTIA 5I22A 4J5YA 1M1KR 2E6ZA 1NYFA 1IXDA 5A0LA 4FYVB 1QKWA 3OYDA 4M77D 2P84A 4E7HA 3E9FA 1Q81U 4OF1A 4M7AE 2CP5A 1N6AA 5IHIA 1VYVA 2E5KA 2CP0A 2RPNA 1YITT 3GLXA 2Y90A 3L1AA 1KC8U 1PKSA 2WSEE 5KYXA 4HVWA 1E6GA 2LVMA 2GFAA 2V8KA 1M1KC 2XDBA 1PG5B 2HL5C 2EYQA 2FRWA 2LCLA 4HA8A 2HMAA 3UPUA 1WHJA 5GMKe 3EG9A 1ZUKA 3QJ6A 4FSXA 3JSCA 1M1GA 5AT1B 1BB9A 4OMFB 4M7DD 2EKHA 1B7TA 4GY5A 2J6OA 2C0IA 2O2OA 1OX9A 1V1CA 3G6EA 1JEGA 4PJJA 4BE0A 2HCKA 1UEBA 4XTZA 4RTYA 4BUGA 1YP5A 1IREB 3BDUA 1N8RR 1ZSZB 1K76A 1Y7XA 3JCMf 3CMAT 4CC4B 4J8OA 3TEEA 3NTHA 5GAOm 3I55Q 2CP6A 1I0CA 3JB9F 4LD9K 4FL6A 3OS5A 3OYMA 1OV3A 3X20B 1M2OA 3VS4A 3M56A 2QDLA 1K73R 1WX6A 4EDUA 5FLXE 5A0GA 5I2MA 2K6DA 2JXBA 2L8DA 3H9NA 2X3XD 1R0CB 1BCMA 1VOMA 1ZSGA 1GCQA 4IIOA 1W2BA 1WI7A 3OYJA 4NOYA 4LDVA 2KYMA 1N8RC 2MF2A 4YTLA 2M0YA 3QUIA 1M3CA 4PJOG 4C8QC 3RERA 5KYUA 2OTLQ 4HVUA 1KSWA 5LJ5g 4JRQA 1WFWA 4LDXA 5GAMe 4X34A 1JXOA 1TU0B 3V7CA 2EW3A 3C4SA 5AYFA 3UF4A 4ZGJB 1K73C 4HCBA 5CK9A 4C8QE 4IUVA 1H3HA 2D0QB 3CMEA 3P8HA 1MMAA 4F14A 4M78G 1D3BB 3GBQA 3CCMT 3CD6Q 3JB9I 4LDYA 2X3WD 4NL2A 5LJ5h 2QQAA 4OMQA 3CCRT 1Q81R 1Y71A 1JB0E 3CC7T 4QVDA 7AT1B 3PTAA 1OOTA 4LN2A 1KC8R 1BYMA 2VWFA 1BBZA 2QEXT 4ZGDB 4J83A 2GTOA 4KH0B 1Q7YU 1OQKA 1H3ZA 2RHIA 1WJQA 1QVPA 1U5SA 3CMEQ 4M7AF 5GJWB 2P0QA 4M75A 2DK3A 4FIBA 2NYSA 3JCMd 2KR3A 4PJLA 4XU0A 3HHTB 2CZ0B 3IQLA 2DXTA 2J7IA 4BI3A 2M16A 1NE8A 1Q81C 3OQ5A 2LJ0A 4XAXB 1SRMA 3GP8A 1JJ2P 2QTXA 1ZLMA 1KC8C 2RN8A 1YITQ 4HKEA 4DEXA 3FDRA 1UGSB 4N4GA 1MMDA 2HAXA 5J26A 3EGDA 4D8DA 2RHXA 1KQSS 1HSQA 3CPWP 3CMAA 2WSCE 3RIRA 5GMKh 2PUKB 5ECAA 1AD5A 3PIPA 4DOWA 4WCIA 2RK2A 2FHDA 1D1CA 4F7UG 3OYEA 1IZ6A 1SRLA 3QZ5B 4XK8E 1R77A 1YJNT 4B9XA 1VQ8T 3EFOA 3PT9A 2EWNA 2IPOB 5LJ5f 3CBMA 1CKBA 4BY6B 1M8MA 2DIQA 2L0AA 2NUTB 1O75A 2HKQB 3LH0A 5GMKj 1XTDA 4BB7A 4Q5WA 5D6XA 2O88A 1V29B 1YCSB 4Y28E 1RI9A 2RHZA 2K57A 2JM9A 2IVWA 2BE9B 1G5VA 4M7AB 3CMAQ 2EGCA 1KIKA 5CIUA 5GAOq 4M7DG 3S6WA 1WPYA 1QKXA 1IHWA 5GAMg 4FSSA 2E12A 1E6HA 2XDDA 5IN1A 1W2BP 1G3WA 3MP6A 2GQVA 2EYXA 3QIIA 3CCMA 3OS0A 5A0DA 2XK0A 3OMCA 4PJNA 4RMOA 3CC2A 1VQ4A 3I5SA 2M9UA 4C8QF 2DBMA 4HCKA 5EG2A 2EQUA 2EYZA 1RI0A 3M5AA 3QWYA 2E5QA 4RTXA 5LJ3f 3CCRA 2D0NA 5GAMh 2M1HA 3E19A 3QG1A 3CC7A 2ESWA 4OGCA 2YLCA 2LX7A 4C92A 1QVFP 2QEXA 2JUFA 2DMOA 4KGZB 3UA7A 3HSBA 4JPBW 2LCSA 2RJDA 2X4XA 4M75D 4KT0E 5GAMj 2QQSA 2HQEA 2PZ1A 3CCMQ 2ZPIB 2DNUA 2RI3A 3QBYA 3O5ZA 2V8JA 3FIFA 3H41A 3NPFA 4LDWA 2C0OA 5C6SA 4RTUA 2EQJA 2F2VA 4PLIA 3JCMV 3CCRQ 1GFCA 4NL3A 3CC7Q 2RO0A 2ZPBB 1NJIU 2D9TA 2DL3A 3HL8A 4FYXB 2K4YA 4Z89A 4LNPA 5FRMA 5HKCA 5LJ5d 2FG0A 2GFUA 4GLMA 4HT9A 2QEXQ 2RQUA 1Q7YC 3VJPA 4OMMA 2DO3A 1S72T 1M2VB 3OMGA 3FJ5A 4BDZA 2JOYA 4D8KA 4QQGA 1OULA 3PE0A 1PNJA 2AKLA 2IIMA 3OS1A 2PQWA 3RESA 5I21A 4GLKA 1ZSZC 2BIVA 4D6WA 1PSFA 5GANe 3MJXA 1ZA2B 2L2PA 2F5TX 3M59A 1VQ7T 1VQMT 2ZPGB 1QVGA 1UDLA 1KK7A 2YT6A 2WACA 2LQWA 2EJGA 2QGGA 4E6RA 3EG2A 3MKDA 1WXUA 2LTOA 4PJOE 1KD1U 2KNBB 2GQIA 3BFMA 1U3OA 2E70A 5GAN5 1T3LA 4JRPA 1GRIA 4HCZA 3SWNC 1W6XA 2OX7A 3CCVT 2MWOA 2VKNA 4RG2A 2L3RA 3NTKA 2LT4A 2OTJT 1GBRA 2F1LA 4AFQC 2AIRB 4A4FA 1PD0A 2EQKA 2DXCA 1XNIA 2HQXA 1YJNQ 3REBB 4JRKA 1QWEA 1UB4A 1VQ8Q 2FZKB 2CP7A 2K5IA 2YUPA 4KUIA 3MPUB 3ZEHA 1KHIA 5IXBA 3JCMJ 2YRDA 1T0HA 4RCCA 4DOVA 3C0CA 4EPCA 1M3AA 1OU9A 1I8FA 4F7UA 1YI2A 3CCLA 3H6ZA 4C0ZA 2BZ8A 4JDSA 1QLYA 5FU6C 2NUPB 2VVKA 2RHUA 4XTXA 3A8GB 3EFSA 4C92D 2DRMA 2G6FX 3LYIA 4JLGA 3A8HB 5KH6A 2E3HA 3KXTA 1TTHB 2EPDA 3VS3A 3DKMA 1VQOT 5GMKl 3PMIA 1SG5A 2DIGA 4OB3B 2RA2A 3WXMB 3X28B 4BD3A 4QVCA 3GIBA 4C5IA 1Q82R 2KXCA 4IUQA 3ULRB 1VUBA 4M77C 4ELYC 3LX7A 3G6ET 2KGTA 1OZ3A 3L42A 3LWIA 2P4TA 3R6NA 2H8HA 4LD6A 1NJIR 1TUDA 1SHGA 4FYYB 4M77E 1MHNA 1FMVA 2K9GA 2VYTA 2XHCA 1KQ1A 3FC3A 2DM1A 3ZL7C 5CKFA 4MDXA 5GAMd 4N0AC 2JTFA 3DLLA 2ZGWA 3LWHA 4FCYA 2LQNA 2DA9A 3INZA 4WF2A 1OX8A 4ELZC 1Q82C 1OZ2A 3N5BB 3EGXB 1M8VA 1X6BA 4QQDA 3EFRA 4MDWA 1G3TA 2FRYA 3M0PA 5GANg 3OYFA 1LPLA 4E7SA 4M7AA 1NJIC 1VQ7A 1VQMA 5LL6S 4OMNA 2QDYB 4M75G 1M4ZA 4KULA 1WQWA 3M0RA 3OSSC 4BY6C 4IUPA 4X9CA 4E7ZA 1S72Q 3JCMh 2GNCA 2EKOA 4M7DE 4CI0C 1LCKA 5GAOp 2CSQA 5GAOr 5GANh 1HXDA 2FVUA 2NUZA 3TREA 1ZUYA 1K8AU 2RK1A 3CCVA 2O31A 3J7AF 3PIOA 4PJOF 1RAHB 4J9BA 4RTZA 4F16A 2YUOA 5DLOA 2X4YA 1W1FA 2OTJA 1SSHA 4OVAA 3X25B 1YFNA 1VQ7Q 1VQMQ 2JZ2A 3PFSA 5GAN7 2IG0A 2I0NA 3NTIA 1EX4A 3I5RA 4RTWA 1MNDA 3G4ST 3GPLA 2K2MA 4A63B 3AHUA 1U8RA 1WLPB 2KT8A 2KT1A 3CC4T 2AT1B 5LJ3e 3RDVA 3CCVQ 1Q86U 1GL5A 1JU5C 2DVJA 3PVLA 4BACA 2XMFA 1IB8A 1XOVA 1M30A 4JLIA 1YJ9A 1UECA 3VUZA 2OTJQ 3QJYA 1WZOA 4ORZA 2ZPHB 1JJ2S 1VQOA 3HPWA 3KFVA 1X75C 1ZA1B 3P8DA 1DJ7B 1VQLT 2F69A 3HRUA 1E7OA 2K5FA 2CSIA 4PLLA 1WDXA 1BCOA 1B34A 2QYZA 5KYYA 1VA7A 5KYWA 3DB4A 4PFZA 1X27A 3TQ7P 3VRYA 2H3EB 3CPWS 1SPKA 2L89A 1EZZB 3NFCA 3P8BB 2XD0A 4IURA 3MEAA 3EGUA 1TOVA 5GANf 4PJOB 3VS6A 4C8QA 4DBHA 1VQOQ 4KBMB 3G7ZA 2M0OA 4ME7A 3QO3A 4M77F 2E4HA 4LE9A 3KBGA 1RLPC 2DKGA 2LJ1A 2HQHA 8ATCB 1M1FA 2EYWA 3J80E 2PU9B 4C92G 2HBWA 1C6VX 5DLQE 4CC7A 4PKCC 3A8MB 4ZNXA 2E6NA 3G6EQ 4M78B 1HYOA 4A54A 2JNGA 3SWNB 1Y96A 1Y07A 4GBQA 3KUFA 1K1ZA 1BI0A 1VYUA 1P92A 1I5LA 1PSEA 2ED1A 2FB7A 2ZCFB 2RNAA 4QKUA 5I2SA 1W2BS 4P5NA 1K8AR 3E1SA 3I35A 4CC2A 2E41A 4BDYA 3CXCP 2G3RA 2CYZB 3CC2T 8AT1B 3OW2S 4M7DF 4A53A 2JS0A 1VQ4T 3LH5A 1O9SA 3WVDB 1YN8A 3T9NA 1SSFA 5I11A 4C5GA 5FU6B 2O01E 4IIMA 1ACMB 2DVEA 3H0HA 2D8JA 1QVFS 1WHLA 3MEVA 1WJRA 4KUDK 4J9DA 3G4SA 4C0GA 5LJ5j 2PUOB 4E47A 2RQVA 2JTEA 1K8AC 2DZ9A 3CC4A 2ECZA 2HZYA 2GF7A 4M77B 5LJ3g 2J05A 2DX1A 3TCJA 2RMOA 3CPFA 1FWZA 5GANd 4JJBA 3EG3A 2BE7D 3QZ9B 2DL4A 2EAYA 1VQLA 2JTMA 2V1QA 2KROA 4L5GA 5LJ3h 3CCQT 2ROLA 2MI6A 3G4SQ 1OU8A 1X6OA 5CKHA 2WSFE 3OYBA 5GAN2 3CC4Q 1D0ZA 1K4US 5L23A 1KQSA 3EGXA 3EH1A 2KEAA 3M0QA 5J3BA 1TUCA 2C06A 1WHGA 4C8QD 5LJ3j 1V76A 2DERA 4M7DB 2RD1A 4MZTA 2EIFA 4ANJA 2CUDA 1MGQA 3V8LA 1MUZA 2KI7A 2KVQG 1VQLQ 2K3YA 1XQHA 2MIOA 5IH2A 1LNXA 1ZBXA 2P0PA 1X69A 4M75E 1JRIA 1LJOA 3EG1A 1SKUB 3I9QA 1K0XA 1BI2A 3RMSA 4F04B 2JMCA 2O4XA 5GAN6 1KJWA 2R5MA 2KSSA 3OYIA 4PL6A 3HP9A 2HEQA 1RAFB 1UGPB 2JT4A 3JCMQ 1WA7A 1NBEB 2RJFA 1EFNA 2P4RA 1JO8A 3SD4A 1YBYA 3PNWC 3OY9A 4XU1A 1LOJA 1Q95G 2FPFA 3HTRA 4II1A 2LRQA 1AT1B 2EYYA 4WTOB 4XTYA 5GAN8 1YI2T 2VB6A 3CCLT 4OMPA 4OGEA 5GMKm 2RF0A 3RBBB 2DJZA 2RH2A 1R8OB 3META 2E64A 1Q7YR 1M5Q1 4NS5A 1VQKT 2BUDA 4LUDA 4M7AG 2FZGB 3QYHB 3RKXA 1RAAB 3M0SA 2CP3A 1I07A 1M3BA 1PM3A 1RACB 2Z0WA 3M53A 1BIBA 4FM4B 4E2FB 2YUQA 2X4JA 3CC2Q 1VQ4Q 2MK5A 4RUGA 1VQNT 2YLBA 1S1NA 1YWPA 3TU4K 1M9SA 3L2WA 1NEBA 1ZSZA 5KYXB 4PJMA 2XDPA 4QT7A 2CKKA 4ZGEB 3OYGA 3CCQA 3EAEA 2QQRA 4RKUE 3V8JA 3JCMW 1I4K1 1K0SA 2F5KA 1ABQA 3CCST 2JS2A 2YUNA 2MAMA 3HRSA 2DYBA 3RR6A 5L8RE 4PK4A 3EG9B 4XU3A 2SEMA 1WXBA 5CR2A 3VYGA 4L59A 2HSPA 3SWNA 4R56A 2E3IA 4N4IA 1WJSA 4C92E 3OYYA 4PJOC 5EC7A 1G3SA 4JS4A 2LT1A 3QYGB 3A1PA 5CQXA 4EMGA 1X43A 2DTIA 2BKDN 2CS7A 1K9MU 3CCET 2CH4A 1KQSP 3CCQQ 1IO6A 3I56T 3QKJA 5J39A 5CQYA 2ABLA 2MPXC 2QI2A 3QPHA 2C0TA 4MZPA 2L3SA 4JJNK 3TSZA 4CC3A 4M78C 2MCNA 2MMPA 1ZUUA 2VXFA 2GCXA 4RTVA 1D3BA 3JCMP 4ZTJA 5LJ3d 2DTHA 4M75F 1NLPC 2DD5A 4LXCA 1M90U 1NG2A 2K2VA 1U1TA 3PGGA 4M78E 3OYHA 3SEMA 2CGHA 3ZBDA 1MMGA 2KYBA 2DF6A 2YRVA 3QDFA 2LP5A 1UE9A 2P0KA 3U23A 1R0BG 3D7SB 3BW1A 3A98A 3V8KA 1ARKA 1QMCA 3MCAB 5KYUB 4Y91A 4X9DA 1VIEA 2HL3A 4C8QG 5FWCA 2A36A 1UJ0A 4M77A 2BTTA 3E9GA 4MZMA 3UA6A 3BY7A 2R5AA 1VYTA 1YJ9T 3FJPA 1YIJA 4EMKC 3JCMX 4AFSC 4XQ3A 3EHRA 3CEYA 1VQPT 4ESRA 1H8KA 4J9EA 3OBWA 3REAB 1VQKA 4C0DB 1PD1A 3GF5A 1ABOA 4AFUC 1FYNA 4N0AA 2HD0A 4XU2A 1BK2A 1RABB 2EJ9A 1VQNA 3MP1A 4A4KA 2XG8D 1YI2Q 1NPRA 3CCLQ 2LZ6B 4L6V5 3O8VA 1N5ZA 4OMLA 1C0MA 2COYA 4LUEA 3EH2A 2DAQA 2DL7A 3GNFB 3L2RA 4M75B 1OPLA 4RTTA 4KH1B 2R58A 2PVGB 2CZ6B 3MO8A 1VQKQ 3GOXA 1RLQC 4JRIA 3CCSA 2AHJB 2JMAA 3URGA 3VS1A 4F7UE 2NUTA 3VS5A 3VV0A 1N8RU 2DXBA 2LMJA 3VUBA 2KRNA 4JZ4A 1VQNQ 2R57A 2W0ZA 4ZTFA 2QAZA 1Z9QA 2X35A 4M7DC 2ATCB 2FPEA 1WYXA 3WVEB 3EGDB 1KQ2A 1RAEB 3JCMb 1K73U 2GTJA 2CT3A 2AZVA 1KD1R 2W10A 3CCEA 4MMLA 4C92F 1X6GA 2SRCA 3I56A 4J9CA 1PC0A 2KE9A 3BDLA 2FYKA 3M0UA 2B8AA 3CCSQ 2A08A 5D7UA 2AZSA 3CXCS 3L2QA 5FROA 2DEQA 1QVGP 2HDAA 2JVVA 2OJ2A 3GNGA 4AFZC 2VGMA 1M90R 3SFMA 4HXJA 5KCOA 3C12A 1H641 4J7FA 1PWTA 1RAGB 2KK4A 3G71T 1I1JA 1UJYA 4OB2B 1WHKA 2OAUA 2K5LA 1K9MC 5FW9A 5GANj 3H8ZA 1OYXA 1KD1C 3CCEQ 5KE2A 4M78F 3JB9D 2ROTA 5M9OA 2E1HA 2L3QA 1YCYA 4JZ3A 4OB0B 1MMNA 1FXXA 2FL7A 1M90C 3UDCA 2X9HA 4LDUA 5GAOn 5HK3A 2H3JA 2DXUA 1X2KA 4J6XA 1WQ7A 2KXDA 1YJWT 2PVOB 3VRZA 2RI5A 2KRSA 1FMKA 4R0KA 1NPPA 2X4WA 1MNEA 1VQPA 4B9WA 2BZYA 5HCKA 1JJ2A 2BZXA 3EHQA 1YWOA 4J9IA 4XTUA 3HRTA 2JJ9A 5CKEA 1HD3A 1M2VA 1AOJA 3JCMc 3L2ZA 3VYHB 3A8OB 3ME9A 1YHQT 3M57A 3I55A 4C92B 2J6FA 2V8IA 1XJWB 2XKOC 3JB9J 3CPWA 3Q1JA 1YJ9Q 4F17A 1RUWA 3M55A 4QW2A 2QA4T 4RG8A 5IXFA 1JQQA 2EBPA 1VQPQ 1UGQB 2VUBA 1WHMA 2VGNA 1GBQA 1BKBA 2EFIA 3ZFJA 1UGRB 1Y0MA 2ZPFB 2OTLA 3CCUT 3FLGA 1H92A 5A2QE 3CBPA 2VV5A 4M7AD 2M51A 1VQ9T 4N4HA 2ENMA 4F7UF 4J9HA 4PNOA 2KBTA 3A8LB 4JUVA 4Z02A 2QXFA 4XTVA 4V2SA 1X01A 1FMWA 4E7KA 3CD6A 2YWWA 1G8XA 4OMOA 1PHTA 2A37A 2EQMA 4PFPA 5IHKA 3MEWA 1WIEA 2JM8A 2QASA 2NLUA 3MP8A 3THKA 4AMCA 1C1AA 4A4GA 1D09B 1AWXA 2CREA 1K9AA 2KY9A 5IAYA 3OW2A 2F2XA 5DY9A 3LGLA 1AWJA 2A0FB 3G71A 2DD4A 2YDLA 2O9SA 4FYWB 2NUPA 1VQ6T 2XU8A 2RQWA 2QQBA 3NGPA 1UHCA 1GCQC 4HT8A 4EMKB 2V1RA 1QVFA 2CT4A 3MEUA 2I2LA 2K79A 2DFUA 3M0TA 4UC4A 5FRNA 5C0MA 4BE2A 2HKNA 3J81E 1D1AA 4CRIA 1Q86R 1TH7A 2XICA 1RL2A 5GAN4 1I81A 5KYNA 2OI3A 2ED0A 1G83A 3F70A 9ATCB 2AK5A 2FZCB 2DTOA 4IUTA 1YITA 3G71Q 1YJWA 1GXIE 2RQRA 2HSEB 2LC4A 2CP2A 1BI1A 3HKSA 5HY6A 3RUXA 1KHCA 1NLOC 4F7UB 4C0DC 2D1XA 4DA4A 1NYGA 4FT2A 5FWBA 1WGSA 3HFNA 3FEOA 3FB9A 1YHQA 2DEUA 2DZCA 1Q86C 3JV3A 5FU7B 3M9QA 3S3NA 1UFFA 4R55A 2LNVA 3QHSA 2LJ3A 3JB9G 1YJWQ 5KCHA 4M75C 2JW4A 2QA4A 3L2VA 5CKDA 4J9FA 2K3BA 3QDRB 1WHHA 2HBPA 4KGVB 1BI3A 1PRLC 2DE0X 3NHNA 4M77G 2Y4YA 1GFDA 3M4GA 4QQ6A 1AWWA 3PVQA 2QG9B 3JRZA 1QCNA 3ASKA 3CCUA 3M4YA 1YHQQ 1G3YA 2DBKA 4Y92A 1TSFA 1VQ9A 2E10A 1RADB 4ZN3A 4JS5A 2DPPB 1QW1A 2L5QA 5GAOl 1KFZA 2K3XA 3FRNA 3G1JA 4TVRA 3V7RA 3OS2A 2QA4Q 6AT1B 1QP2A 2QTVA 3CBOA 2DL5A 2X51A 1BU1A 3UT1A 2FEIA 3VS2A 2D8HA 4E7IA 1W4SA 3RKWA 5GJVB 2A7YA 3CCUQ 1FX7A 1ZHIA 4A4HA 4DBRA 3PMTA 4AT1B 3S3MA 1VQ9Q 1KG1A 4RCBA 2KMTA 2GGRA 3H0IA 1VQ6A 2EGAA 1W70A 3L2UA 1TXQA 1YIJT 2LX9A 3CCJT 1UGVA 2YXYA 1VQ5T 4KGXB 1NEGA 3BE3A 2MYSA 1NM7A 3OW2P 3OA6A 4AG1C 1AZGB 2YSQA 2DL8A 1GCPA 5KE3A 2KRMA 2RQTA 1B07A 4J9GA 4XTWA 3OBYA 3EG0A 3OYAA 2RJEA 4EIKA 3C95A 2NWMA 4FW2A 2FPDA 4MMKA 2L3PA 4DBFA 1VQ6Q 3OYCA 1IRXA 1D1BA 2XIDA 4X1VA 4E7LA 4PJOA 3JAME 2ZZDA 1Q82U 2AKKA 2O9VA 1SEMA 5GMKi 2GBQA 3C94A 4DEYA 2E65A 3QWXX 1PKTA 2DJQA 4J7IA 4C92C 4BI4A 2LNHB 4K11A 2ZAEA 4FU6A 3OB9A 4M78A 2K7AA 4O5VA 2QK0A 3VU3C 3S3OA 5DM7R 1B34B 1YNZA 5KYYB 5KYWB 3X24B 3TVTA 4Z88A 1PRMC 5HK0A 2CUBA 5CO7A 2M02A 1F1BB 3JCMe 2COWA 1IGQA 3LW5E 1SF9A 2KQWA 2DETA 1QVGS 3RMQA 4BE1A 4JJCA 5IT9E 4C8QB 1CSKA 2J06A 1YJNA 2A28A 1VQ8A 1UHFA 1JXMA 2EVRA 1BIAA 1I5OB 4C5EA 1AWOA 4IUUA 2QQ9A 1AZEA 1PCXA 1N9SA 5GAMf 2LDMA 1RAIB 1LVKA 5CKBA 2DYIA 2RM4A 2DILA 1EIFA 1N27A 1J3TA 4EMKA 1QCOA 1WXTA 1Y96B 2ZPEB 2FO0A 3UATA 1AVZC 2EGEA 4J6YA 4BI8B 5CCAA 3M58A 4HVVA 1Z9ZA 1CKAA 3V7SA 3H0FA 2RB6A 1M1KU 1ZBJA 3OSVA 1UG1A 2J6KA 3E2UA 3VKIA 2KDSA 1HJDA 1T0JA 3SHWA 1ZX6A 3TSWA 4FT4A 3CCJA 4QVZA 2QGFB 4ZN1A 4A4EA 4J6WA 1QQJA 1VQ5A 3QXEB 2XI9A 5CVIA 5IHNA 2MOXA 3LLRA 2CDTA 3UWNA 1AHJB 3RKYA 5CAIA 3AT1B 2CZ1B 1TUGB 3I55T 1D0XA 2MWPA 4HCCA 1WNLA 1G2BA 1IGUA 4EMHA 1U06A 3X26B 1U1SA 3QSUA 2JN0A 3OYNA 2B86A
chains in the Genus database with same CATH topology
1WHMA 1WHKA 2COYA 2CP5A 2HL3A 2HKNA 3TQ7P 1TXQA 2E4HA 2CP0A 4B6MA 1LPLA 2HQHA 1WHGA 2HL5C 2M02A 1WHJA 2COWA 1WHHA 2MPXC 3E2UA 1IXDA 2CP6A 2CP7A 1TOVA 2COZA 1WHLA 2E3IA 2QK0A 2CP3A 2E3HA 3RDVA 2HKQB 2Z0WA 2CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHM A;  1WHK A;  2COY A;  2CP5 A;  2HL3 A;  2HKN A;  3TQ7 P;  1TXQ A;  2E4H A;  2CP0 A;  4B6M A;  1LPL A;  2HQH A;  1WHG A;  2HL5 C;  2M02 A;  1WHJ A;  2COW A;  1WHH A;  2MPX C;  3E2U A;  1IXD A;  2CP6 A;  2CP7 A;  1TOV A;  2COZ A;  1WHL A;  2E3I A;  2QK0 A;  2CP3 A;  2E3H A;  3RDV A;  2HKQ B;  2Z0W A;  2CP2 A; 
#chains in the Genus database with same CATH topology
 1TWB A;  2EJF A;  3LGF A;  2LQK A;  4E7J A;  4PJO D;  2KAF A;  1YIJ Q;  2RJC A;  2RI2 A;  1VIF A;  3CCJ Q;  4M7D A;  4ATO A;  1NZ9 A;  1UUE A;  3VS7 A;  2YRC A;  3SB2 A;  1VQ5 Q;  3OYK A;  1D0Y A;  3OYL A;  2COZ A;  1JBM A;  2VAS A;  1AEY A;  2LCC A;  1QWF A;  1SHF A;  3HFO A;  1OI1 A;  1X2Q A;  2PVD B;  2CH4 W;  4M78 D;  5D6W A;  5FU7 C;  2OTL T;  3DLM A;  1B3Q A;  1OPK A;  4IKF A;  4B6M A;  2EQI A;  1TS9 A;  2Y4X A;  2PTK A;  1IHV A;  1S72 A;  2RHY A;  1ZQ1 A;  2A3L A;  1QP3 A;  2LQ8 A;  4OB1 B;  2PNI A;  4DBQ A;  1MV3 A;  4DQ2 A;  1K9M R;  4KRT A;  2OAW A;  1QCF A;  1OEB A;  1T3S A;  3CD6 T;  3CQT A;  4AG2 C;  4PFO A;  2CZ7 B;  4JJD A;  3JCM g;  4M4Z A;  4Z8A A;  4FW1 A;  3VS0 A;  2DRK A;  3R6O A;  4VUB A;  2V26 A;  1N9R A;  3CXC A;  3RNJ A;  3MHX A;  1TG0 A;  5LJ5 e;  2HNI A;  3EFO B;  3NMZ C;  3M54 A;  3SDZ A;  5GAN 3;  1M27 C;  2VC8 A;  3DB3 A;  2DLP A;  1Y57 A;  1A0N B;  3JB9 H;  1MV0 B;  5D6Y A;  4C0F A;  3CME T;  4O6J A;  2YHT A;  4OP0 A;  2D6F A;  1HK9 A;  2O4X B;  2F2W A;  3ER0 A;  4M7A C;  2VXE A;  3A5Z B;  4C5H A;  3I56 Q;  1UTI A;  5I22 A;  4J5Y A;  1M1K R;  2E6Z A;  1NYF A;  1IXD A;  5A0L A;  4FYV B;  1QKW A;  3OYD A;  4M77 D;  2P84 A;  4E7H A;  3E9F A;  1Q81 U;  4OF1 A;  4M7A E;  2CP5 A;  1N6A A;  5IHI A;  1VYV A;  2E5K A;  2CP0 A;  2RPN A;  1YIT T;  3GLX A;  2Y90 A;  3L1A A;  1KC8 U;  1PKS A;  2WSE E;  5KYX A;  4HVW A;  1E6G A;  2LVM A;  2GFA A;  2V8K A;  1M1K C;  2XDB A;  1PG5 B;  2HL5 C;  2EYQ A;  2FRW A;  2LCL A;  4HA8 A;  2HMA A;  3UPU A;  1WHJ A;  5GMK e;  3EG9 A;  1ZUK A;  3QJ6 A;  4FSX A;  3JSC A;  1M1G A;  5AT1 B;  1BB9 A;  4OMF B;  4M7D D;  2EKH A;  1B7T A;  4GY5 A;  2J6O A;  2C0I A;  2O2O A;  1OX9 A;  1V1C A;  3G6E A;  1JEG A;  4PJJ A;  4BE0 A;  2HCK A;  1UEB A;  4XTZ A;  4RTY A;  4BUG A;  1YP5 A;  1IRE B;  3BDU A;  1N8R R;  1ZSZ B;  1K76 A;  1Y7X A;  3JCM f;  3CMA T;  4CC4 B;  4J8O A;  3TEE A;  3NTH A;  5GAO m;  3I55 Q;  2CP6 A;  1I0C A;  3JB9 F;  4LD9 K;  4FL6 A;  3OS5 A;  3OYM A;  1OV3 A;  3X20 B;  1M2O A;  3VS4 A;  3M56 A;  2QDL A;  1K73 R;  1WX6 A;  4EDU A;  5FLX E;  5A0G A;  5I2M A;  2K6D A;  2JXB A;  2L8D A;  3H9N A;  2X3X D;  1R0C B;  1BCM A;  1VOM A;  1ZSG A;  1GCQ A;  4IIO A;  1W2B A;  1WI7 A;  3OYJ A;  4NOY A;  4LDV A;  2KYM A;  1N8R C;  2MF2 A;  4YTL A;  2M0Y A;  3QUI A;  1M3C A;  4PJO G;  4C8Q C;  3RER A;  5KYU A;  2OTL Q;  4HVU A;  1KSW A;  5LJ5 g;  4JRQ A;  1WFW A;  4LDX A;  5GAM e;  4X34 A;  1JXO A;  1TU0 B;  3V7C A;  2EW3 A;  3C4S A;  5AYF A;  3UF4 A;  4ZGJ B;  1K73 C;  4HCB A;  5CK9 A;  4C8Q E;  4IUV A;  1H3H A;  2D0Q B;  3CME A;  3P8H A;  1MMA A;  4F14 A;  4M78 G;  1D3B B;  3GBQ A;  3CCM T;  3CD6 Q;  3JB9 I;  4LDY A;  2X3W D;  4NL2 A;  5LJ5 h;  2QQA A;  4OMQ A;  3CCR T;  1Q81 R;  1Y71 A;  1JB0 E;  3CC7 T;  4QVD A;  7AT1 B;  3PTA A;  1OOT A;  4LN2 A;  1KC8 R;  1BYM A;  2VWF A;  1BBZ A;  2QEX T;  4ZGD B;  4J83 A;  2GTO A;  4KH0 B;  1Q7Y U;  1OQK A;  1H3Z A;  2RHI A;  1WJQ A;  1QVP A;  1U5S A;  3CME Q;  4M7A F;  5GJW B;  2P0Q A;  4M75 A;  2DK3 A;  4FIB A;  2NYS A;  3JCM d;  2KR3 A;  4PJL A;  4XU0 A;  3HHT B;  2CZ0 B;  3IQL A;  2DXT A;  2J7I A;  4BI3 A;  2M16 A;  1NE8 A;  1Q81 C;  3OQ5 A;  2LJ0 A;  4XAX B;  1SRM A;  3GP8 A;  1JJ2 P;  2QTX A;  1ZLM A;  1KC8 C;  2RN8 A;  1YIT Q;  4HKE A;  4DEX A;  3FDR A;  1UGS B;  4N4G A;  1MMD A;  2HAX A;  5J26 A;  3EGD A;  4D8D A;  2RHX A;  1KQS S;  1HSQ A;  3CPW P;  3CMA A;  2WSC E;  3RIR A;  5GMK h;  2PUK B;  5ECA A;  1AD5 A;  3PIP A;  4DOW A;  4WCI A;  2RK2 A;  2FHD A;  1D1C A;  4F7U G;  3OYE A;  1IZ6 A;  1SRL A;  3QZ5 B;  4XK8 E;  1R77 A;  1YJN T;  4B9X A;  1VQ8 T;  3EFO A;  3PT9 A;  2EWN A;  2IPO B;  5LJ5 f;  3CBM A;  1CKB A;  4BY6 B;  1M8M A;  2DIQ A;  2L0A A;  2NUT B;  1O75 A;  2HKQ B;  3LH0 A;  5GMK j;  1XTD A;  4BB7 A;  4Q5W A;  5D6X A;  2O88 A;  1V29 B;  1YCS B;  4Y28 E;  1RI9 A;  2RHZ A;  2K57 A;  2JM9 A;  2IVW A;  2BE9 B;  1G5V A;  4M7A B;  3CMA Q;  2EGC A;  1KIK A;  5CIU A;  5GAO q;  4M7D G;  3S6W A;  1WPY A;  1QKX A;  1IHW A;  5GAM g;  4FSS A;  2E12 A;  1E6H A;  2XDD A;  5IN1 A;  1W2B P;  1G3W A;  3MP6 A;  2GQV A;  2EYX A;  3QII A;  3CCM A;  3OS0 A;  5A0D A;  2XK0 A;  3OMC A;  4PJN A;  4RMO A;  3CC2 A;  1VQ4 A;  3I5S A;  2M9U A;  4C8Q F;  2DBM A;  4HCK A;  5EG2 A;  2EQU A;  2EYZ A;  1RI0 A;  3M5A A;  3QWY A;  2E5Q A;  4RTX A;  5LJ3 f;  3CCR A;  2D0N A;  5GAM h;  2M1H A;  3E19 A;  3QG1 A;  3CC7 A;  2ESW A;  4OGC A;  2YLC A;  2LX7 A;  4C92 A;  1QVF P;  2QEX A;  2JUF A;  2DMO A;  4KGZ B;  3UA7 A;  3HSB A;  4JPB W;  2LCS A;  2RJD A;  2X4X A;  4M75 D;  4KT0 E;  5GAM j;  2QQS A;  2HQE A;  2PZ1 A;  3CCM Q;  2ZPI B;  2DNU A;  2RI3 A;  3QBY A;  3O5Z A;  2V8J A;  3FIF A;  3H41 A;  3NPF A;  4LDW A;  2C0O A;  5C6S A;  4RTU A;  2EQJ A;  2F2V A;  4PLI A;  3JCM V;  3CCR Q;  1GFC A;  4NL3 A;  3CC7 Q;  2RO0 A;  2ZPB B;  1NJI U;  2D9T A;  2DL3 A;  3HL8 A;  4FYX B;  2K4Y A;  4Z89 A;  4LNP A;  5FRM A;  5HKC A;  5LJ5 d;  2FG0 A;  2GFU A;  4GLM A;  4HT9 A;  2QEX Q;  2RQU A;  1Q7Y C;  3VJP A;  4OMM A;  2DO3 A;  1S72 T;  1M2V B;  3OMG A;  3FJ5 A;  4BDZ A;  2JOY A;  4D8K A;  4QQG A;  1OUL A;  3PE0 A;  1PNJ A;  2AKL A;  2IIM A;  3OS1 A;  2PQW A;  3RES A;  5I21 A;  4GLK A;  1ZSZ C;  2BIV A;  4D6W A;  1PSF A;  5GAN e;  3MJX A;  1ZA2 B;  2L2P A;  2F5T X;  3M59 A;  1VQ7 T;  1VQM T;  2ZPG B;  1QVG A;  1UDL A;  1KK7 A;  2YT6 A;  2WAC A;  2LQW A;  2EJG A;  2QGG A;  4E6R A;  3EG2 A;  3MKD A;  1WXU A;  2LTO A;  4PJO E;  1KD1 U;  2KNB B;  2GQI A;  3BFM A;  1U3O A;  2E70 A;  5GAN 5;  1T3L A;  4JRP A;  1GRI A;  4HCZ A;  3SWN C;  1W6X A;  2OX7 A;  3CCV T;  2MWO A;  2VKN A;  4RG2 A;  2L3R A;  3NTK A;  2LT4 A;  2OTJ T;  1GBR A;  2F1L A;  4AFQ C;  2AIR B;  4A4F A;  1PD0 A;  2EQK A;  2DXC A;  1XNI A;  2HQX A;  1YJN Q;  3REB B;  4JRK A;  1QWE A;  1UB4 A;  1VQ8 Q;  2FZK B;  2CP7 A;  2K5I A;  2YUP A;  4KUI A;  3MPU B;  3ZEH A;  1KHI A;  5IXB A;  3JCM J;  2YRD A;  1T0H A;  4RCC A;  4DOV A;  3C0C A;  4EPC A;  1M3A A;  1OU9 A;  1I8F A;  4F7U A;  1YI2 A;  3CCL A;  3H6Z A;  4C0Z A;  2BZ8 A;  4JDS A;  1QLY A;  5FU6 C;  2NUP B;  2VVK A;  2RHU A;  4XTX A;  3A8G B;  3EFS A;  4C92 D;  2DRM A;  2G6F X;  3LYI A;  4JLG A;  3A8H B;  5KH6 A;  2E3H A;  3KXT A;  1TTH B;  2EPD A;  3VS3 A;  3DKM A;  1VQO T;  5GMK l;  3PMI A;  1SG5 A;  2DIG A;  4OB3 B;  2RA2 A;  3WXM B;  3X28 B;  4BD3 A;  4QVC A;  3GIB A;  4C5I A;  1Q82 R;  2KXC A;  4IUQ A;  3ULR B;  1VUB A;  4M77 C;  4ELY C;  3LX7 A;  3G6E T;  2KGT A;  1OZ3 A;  3L42 A;  3LWI A;  2P4T A;  3R6N A;  2H8H A;  4LD6 A;  1NJI R;  1TUD A;  1SHG A;  4FYY B;  4M77 E;  1MHN A;  1FMV A;  2K9G A;  2VYT A;  2XHC A;  1KQ1 A;  3FC3 A;  2DM1 A;  3ZL7 C;  5CKF A;  4MDX A;  5GAM d;  4N0A C;  2JTF A;  3DLL A;  2ZGW A;  3LWH A;  4FCY A;  2LQN A;  2DA9 A;  3INZ A;  4WF2 A;  1OX8 A;  4ELZ C;  1Q82 C;  1OZ2 A;  3N5B B;  3EGX B;  1M8V A;  1X6B A;  4QQD A;  3EFR A;  4MDW A;  1G3T A;  2FRY A;  3M0P A;  5GAN g;  3OYF A;  1LPL A;  4E7S A;  4M7A A;  1NJI C;  1VQ7 A;  1VQM A;  5LL6 S;  4OMN A;  2QDY B;  4M75 G;  1M4Z A;  4KUL A;  1WQW A;  3M0R A;  3OSS C;  4BY6 C;  4IUP A;  4X9C A;  4E7Z A;  1S72 Q;  3JCM h;  2GNC A;  2EKO A;  4M7D E;  4CI0 C;  1LCK A;  5GAO p;  2CSQ A;  5GAO r;  5GAN h;  1HXD A;  2FVU A;  2NUZ A;  3TRE A;  1ZUY A;  1K8A U;  2RK1 A;  3CCV A;  2O31 A;  3J7A F;  3PIO A;  4PJO F;  1RAH B;  4J9B A;  4RTZ A;  4F16 A;  2YUO A;  5DLO A;  2X4Y A;  1W1F A;  2OTJ A;  1SSH A;  4OVA A;  3X25 B;  1YFN A;  1VQ7 Q;  1VQM Q;  2JZ2 A;  3PFS A;  5GAN 7;  2IG0 A;  2I0N A;  3NTI A;  1EX4 A;  3I5R A;  4RTW A;  1MND A;  3G4S T;  3GPL A;  2K2M A;  4A63 B;  3AHU A;  1U8R A;  1WLP B;  2KT8 A;  2KT1 A;  3CC4 T;  2AT1 B;  5LJ3 e;  3RDV A;  3CCV Q;  1Q86 U;  1GL5 A;  1JU5 C;  2DVJ A;  3PVL A;  4BAC A;  2XMF A;  1IB8 A;  1XOV A;  1M30 A;  4JLI A;  1YJ9 A;  1UEC A;  3VUZ A;  2OTJ Q;  3QJY A;  1WZO A;  4ORZ A;  2ZPH B;  1JJ2 S;  1VQO A;  3HPW A;  3KFV A;  1X75 C;  1ZA1 B;  3P8D A;  1DJ7 B;  1VQL T;  2F69 A;  3HRU A;  1E7O A;  2K5F A;  2CSI A;  4PLL A;  1WDX A;  1BCO A;  1B34 A;  2QYZ A;  5KYY A;  1VA7 A;  5KYW A;  3DB4 A;  4PFZ A;  1X27 A;  3TQ7 P;  3VRY A;  2H3E B;  3CPW S;  1SPK A;  2L89 A;  1EZZ B;  3NFC A;  3P8B B;  2XD0 A;  4IUR A;  3MEA A;  3EGU A;  1TOV A;  5GAN f;  4PJO B;  3VS6 A;  4C8Q A;  4DBH A;  1VQO Q;  4KBM B;  3G7Z A;  2M0O A;  4ME7 A;  3QO3 A;  4M77 F;  2E4H A;  4LE9 A;  3KBG A;  1RLP C;  2DKG A;  2LJ1 A;  2HQH A;  8ATC B;  1M1F A;  2EYW A;  3J80 E;  2PU9 B;  4C92 G;  2HBW A;  1C6V X;  5DLQ E;  4CC7 A;  4PKC C;  3A8M B;  4ZNX A;  2E6N A;  3G6E Q;  4M78 B;  1HYO A;  4A54 A;  2JNG A;  3SWN B;  1Y96 A;  1Y07 A;  4GBQ A;  3KUF A;  1K1Z A;  1BI0 A;  1VYU A;  1P92 A;  1I5L A;  1PSE A;  2ED1 A;  2FB7 A;  2ZCF B;  2RNA A;  4QKU A;  5I2S A;  1W2B S;  4P5N A;  1K8A R;  3E1S A;  3I35 A;  4CC2 A;  2E41 A;  4BDY A;  3CXC P;  2G3R A;  2CYZ B;  3CC2 T;  8AT1 B;  3OW2 S;  4M7D F;  4A53 A;  2JS0 A;  1VQ4 T;  3LH5 A;  1O9S A;  3WVD B;  1YN8 A;  3T9N A;  1SSF A;  5I11 A;  4C5G A;  5FU6 B;  2O01 E;  4IIM A;  1ACM B;  2DVE A;  3H0H A;  2D8J A;  1QVF S;  1WHL A;  3MEV A;  1WJR A;  4KUD K;  4J9D A;  3G4S A;  4C0G A;  5LJ5 j;  2PUO B;  4E47 A;  2RQV A;  2JTE A;  1K8A C;  2DZ9 A;  3CC4 A;  2ECZ A;  2HZY A;  2GF7 A;  4M77 B;  5LJ3 g;  2J05 A;  2DX1 A;  3TCJ A;  2RMO A;  3CPF A;  1FWZ A;  5GAN d;  4JJB A;  3EG3 A;  2BE7 D;  3QZ9 B;  2DL4 A;  2EAY A;  1VQL A;  2JTM A;  2V1Q A;  2KRO A;  4L5G A;  5LJ3 h;  3CCQ T;  2ROL A;  2MI6 A;  3G4S Q;  1OU8 A;  1X6O A;  5CKH A;  2WSF E;  3OYB A;  5GAN 2;  3CC4 Q;  1D0Z A;  1K4U S;  5L23 A;  1KQS A;  3EGX A;  3EH1 A;  2KEA A;  3M0Q A;  5J3B A;  1TUC A;  2C06 A;  1WHG A;  4C8Q D;  5LJ3 j;  1V76 A;  2DER A;  4M7D B;  2RD1 A;  4MZT A;  2EIF A;  4ANJ A;  2CUD A;  1MGQ A;  3V8L A;  1MUZ A;  2KI7 A;  2KVQ G;  1VQL Q;  2K3Y A;  1XQH A;  2MIO A;  5IH2 A;  1LNX A;  1ZBX A;  2P0P A;  1X69 A;  4M75 E;  1JRI A;  1LJO A;  3EG1 A;  1SKU B;  3I9Q A;  1K0X A;  1BI2 A;  3RMS A;  4F04 B;  2JMC A;  2O4X A;  5GAN 6;  1KJW A;  2R5M A;  2KSS A;  3OYI A;  4PL6 A;  3HP9 A;  2HEQ A;  1RAF B;  1UGP B;  2JT4 A;  3JCM Q;  1WA7 A;  1NBE B;  2RJF A;  1EFN A;  2P4R A;  1JO8 A;  3SD4 A;  1YBY A;  3PNW C;  3OY9 A;  4XU1 A;  1LOJ A;  1Q95 G;  2FPF A;  3HTR A;  4II1 A;  2LRQ A;  1AT1 B;  2EYY A;  4WTO B;  4XTY A;  5GAN 8;  1YI2 T;  2VB6 A;  3CCL T;  4OMP A;  4OGE A;  5GMK m;  2RF0 A;  3RBB B;  2DJZ A;  2RH2 A;  1R8O B;  3MET A;  2E64 A;  1Q7Y R;  1M5Q 1;  4NS5 A;  1VQK T;  2BUD A;  4LUD A;  4M7A G;  2FZG B;  3QYH B;  3RKX A;  1RAA B;  3M0S A;  2CP3 A;  1I07 A;  1M3B A;  1PM3 A;  1RAC B;  2Z0W A;  3M53 A;  1BIB A;  4FM4 B;  4E2F B;  2YUQ A;  2X4J A;  3CC2 Q;  1VQ4 Q;  2MK5 A;  4RUG A;  1VQN T;  2YLB A;  1S1N A;  1YWP A;  3TU4 K;  1M9S A;  3L2W A;  1NEB A;  1ZSZ A;  5KYX B;  4PJM A;  2XDP A;  4QT7 A;  2CKK A;  4ZGE B;  3OYG A;  3CCQ A;  3EAE A;  2QQR A;  4RKU E;  3V8J A;  3JCM W;  1I4K 1;  1K0S A;  2F5K A;  1ABQ A;  3CCS T;  2JS2 A;  2YUN A;  2MAM A;  3HRS A;  2DYB A;  3RR6 A;  5L8R E;  4PK4 A;  3EG9 B;  4XU3 A;  2SEM A;  1WXB A;  5CR2 A;  3VYG A;  4L59 A;  2HSP A;  3SWN A;  4R56 A;  2E3I A;  4N4I A;  1WJS A;  4C92 E;  3OYY A;  4PJO C;  5EC7 A;  1G3S A;  4JS4 A;  2LT1 A;  3QYG B;  3A1P A;  5CQX A;  4EMG A;  1X43 A;  2DTI A;  2BKD N;  2CS7 A;  1K9M U;  3CCE T;  2CH4 A;  1KQS P;  3CCQ Q;  1IO6 A;  3I56 T;  3QKJ A;  5J39 A;  5CQY A;  2ABL A;  2MPX C;  2QI2 A;  3QPH A;  2C0T A;  4MZP A;  2L3S A;  4JJN K;  3TSZ A;  4CC3 A;  4M78 C;  2MCN A;  2MMP A;  1ZUU A;  2VXF A;  2GCX A;  4RTV A;  1D3B A;  3JCM P;  4ZTJ A;  5LJ3 d;  2DTH A;  4M75 F;  1NLP C;  2DD5 A;  4LXC A;  1M90 U;  1NG2 A;  2K2V A;  1U1T A;  3PGG A;  4M78 E;  3OYH A;  3SEM A;  2CGH A;  3ZBD A;  1MMG A;  2KYB A;  2DF6 A;  2YRV A;  3QDF A;  2LP5 A;  1UE9 A;  2P0K A;  3U23 A;  1R0B G;  3D7S B;  3BW1 A;  3A98 A;  3V8K A;  1ARK A;  1QMC A;  3MCA B;  5KYU B;  4Y91 A;  4X9D A;  1VIE A;  2HL3 A;  4C8Q G;  5FWC A;  2A36 A;  1UJ0 A;  4M77 A;  2BTT A;  3E9G A;  4MZM A;  3UA6 A;  3BY7 A;  2R5A A;  1VYT A;  1YJ9 T;  3FJP A;  1YIJ A;  4EMK C;  3JCM X;  4AFS C;  4XQ3 A;  3EHR A;  3CEY A;  1VQP T;  4ESR A;  1H8K A;  4J9E A;  3OBW A;  3REA B;  1VQK A;  4C0D B;  1PD1 A;  3GF5 A;  1ABO A;  4AFU C;  1FYN A;  4N0A A;  2HD0 A;  4XU2 A;  1BK2 A;  1RAB B;  2EJ9 A;  1VQN A;  3MP1 A;  4A4K A;  2XG8 D;  1YI2 Q;  1NPR A;  3CCL Q;  2LZ6 B;  4L6V 5;  3O8V A;  1N5Z A;  4OML A;  1C0M A;  2COY A;  4LUE A;  3EH2 A;  2DAQ A;  2DL7 A;  3GNF B;  3L2R A;  4M75 B;  1OPL A;  4RTT A;  4KH1 B;  2R58 A;  2PVG B;  2CZ6 B;  3MO8 A;  1VQK Q;  3GOX A;  1RLQ C;  4JRI A;  3CCS A;  2AHJ B;  2JMA A;  3URG A;  3VS1 A;  4F7U E;  2NUT A;  3VS5 A;  3VV0 A;  1N8R U;  2DXB A;  2LMJ A;  3VUB A;  2KRN A;  4JZ4 A;  1VQN Q;  2R57 A;  2W0Z A;  4ZTF A;  2QAZ A;  1Z9Q A;  2X35 A;  4M7D C;  2ATC B;  2FPE A;  1WYX A;  3WVE B;  3EGD B;  1KQ2 A;  1RAE B;  3JCM b;  1K73 U;  2GTJ A;  2CT3 A;  2AZV A;  1KD1 R;  2W10 A;  3CCE A;  4MML A;  4C92 F;  1X6G A;  2SRC A;  3I56 A;  4J9C A;  1PC0 A;  2KE9 A;  3BDL A;  2FYK A;  3M0U A;  2B8A A;  3CCS Q;  2A08 A;  5D7U A;  2AZS A;  3CXC S;  3L2Q A;  5FRO A;  2DEQ A;  1QVG P;  2HDA A;  2JVV A;  2OJ2 A;  3GNG A;  4AFZ C;  2VGM A;  1M90 R;  3SFM A;  4HXJ A;  5KCO A;  3C12 A;  1H64 1;  4J7F A;  1PWT A;  1RAG B;  2KK4 A;  3G71 T;  1I1J A;  1UJY A;  4OB2 B;  1WHK A;  2OAU A;  2K5L A;  1K9M C;  5FW9 A;  5GAN j;  3H8Z A;  1OYX A;  1KD1 C;  3CCE Q;  5KE2 A;  4M78 F;  3JB9 D;  2ROT A;  5M9O A;  2E1H A;  2L3Q A;  1YCY A;  4JZ3 A;  4OB0 B;  1MMN A;  1FXX A;  2FL7 A;  1M90 C;  3UDC A;  2X9H A;  4LDU A;  5GAO n;  5HK3 A;  2H3J A;  2DXU A;  1X2K A;  4J6X A;  1WQ7 A;  2KXD A;  1YJW T;  2PVO B;  3VRZ A;  2RI5 A;  2KRS A;  1FMK A;  4R0K A;  1NPP A;  2X4W A;  1MNE A;  1VQP A;  4B9W A;  2BZY A;  5HCK A;  1JJ2 A;  2BZX A;  3EHQ A;  1YWO A;  4J9I A;  4XTU A;  3HRT A;  2JJ9 A;  5CKE A;  1HD3 A;  1M2V A;  1AOJ A;  3JCM c;  3L2Z A;  3VYH B;  3A8O B;  3ME9 A;  1YHQ T;  3M57 A;  3I55 A;  4C92 B;  2J6F A;  2V8I A;  1XJW B;  2XKO C;  3JB9 J;  3CPW A;  3Q1J A;  1YJ9 Q;  4F17 A;  1RUW A;  3M55 A;  4QW2 A;  2QA4 T;  4RG8 A;  5IXF A;  1JQQ A;  2EBP A;  1VQP Q;  1UGQ B;  2VUB A;  1WHM A;  2VGN A;  1GBQ A;  1BKB A;  2EFI A;  3ZFJ A;  1UGR B;  1Y0M A;  2ZPF B;  2OTL A;  3CCU T;  3FLG A;  1H92 A;  5A2Q E;  3CBP A;  2VV5 A;  4M7A D;  2M51 A;  1VQ9 T;  4N4H A;  2ENM A;  4F7U F;  4J9H A;  4PNO A;  2KBT A;  3A8L B;  4JUV A;  4Z02 A;  2QXF A;  4XTV A;  4V2S A;  1X01 A;  1FMW A;  4E7K A;  3CD6 A;  2YWW A;  1G8X A;  4OMO A;  1PHT A;  2A37 A;  2EQM A;  4PFP A;  5IHK A;  3MEW A;  1WIE A;  2JM8 A;  2QAS A;  2NLU A;  3MP8 A;  3THK A;  4AMC A;  1C1A A;  4A4G A;  1D09 B;  1AWX A;  2CRE A;  1K9A A;  2KY9 A;  5IAY A;  3OW2 A;  2F2X A;  5DY9 A;  3LGL A;  1AWJ A;  2A0F B;  3G71 A;  2DD4 A;  2YDL A;  2O9S A;  4FYW B;  2NUP A;  1VQ6 T;  2XU8 A;  2RQW A;  2QQB A;  3NGP A;  1UHC A;  1GCQ C;  4HT8 A;  4EMK B;  2V1R A;  1QVF A;  2CT4 A;  3MEU A;  2I2L A;  2K79 A;  2DFU A;  3M0T A;  4UC4 A;  5FRN A;  5C0M A;  4BE2 A;  2HKN A;  3J81 E;  1D1A A;  4CRI A;  1Q86 R;  1TH7 A;  2XIC A;  1RL2 A;  5GAN 4;  1I81 A;  5KYN A;  2OI3 A;  2ED0 A;  1G83 A;  3F70 A;  9ATC B;  2AK5 A;  2FZC B;  2DTO A;  4IUT A;  1YIT A;  3G71 Q;  1YJW A;  1GXI E;  2RQR A;  2HSE B;  2LC4 A;  2CP2 A;  1BI1 A;  3HKS A;  5HY6 A;  3RUX A;  1KHC A;  1NLO C;  4F7U B;  4C0D C;  2D1X A;  4DA4 A;  1NYG A;  4FT2 A;  5FWB A;  1WGS A;  3HFN A;  3FEO A;  3FB9 A;  1YHQ A;  2DEU A;  2DZC A;  1Q86 C;  3JV3 A;  5FU7 B;  3M9Q A;  3S3N A;  1UFF A;  4R55 A;  2LNV A;  3QHS A;  2LJ3 A;  3JB9 G;  1YJW Q;  5KCH A;  4M75 C;  2JW4 A;  2QA4 A;  3L2V A;  5CKD A;  4J9F A;  2K3B A;  3QDR B;  1WHH A;  2HBP A;  4KGV B;  1BI3 A;  1PRL C;  2DE0 X;  3NHN A;  4M77 G;  2Y4Y A;  1GFD A;  3M4G A;  4QQ6 A;  1AWW A;  3PVQ A;  2QG9 B;  3JRZ A;  1QCN A;  3ASK A;  3CCU A;  3M4Y A;  1YHQ Q;  1G3Y A;  2DBK A;  4Y92 A;  1TSF A;  1VQ9 A;  2E10 A;  1RAD B;  4ZN3 A;  4JS5 A;  2DPP B;  1QW1 A;  2L5Q A;  5GAO l;  1KFZ A;  2K3X A;  3FRN A;  3G1J A;  4TVR A;  3V7R A;  3OS2 A;  2QA4 Q;  6AT1 B;  1QP2 A;  2QTV A;  3CBO A;  2DL5 A;  2X51 A;  1BU1 A;  3UT1 A;  2FEI A;  3VS2 A;  2D8H A;  4E7I A;  1W4S A;  3RKW A;  5GJV B;  2A7Y A;  3CCU Q;  1FX7 A;  1ZHI A;  4A4H A;  4DBR A;  3PMT A;  4AT1 B;  3S3M A;  1VQ9 Q;  1KG1 A;  4RCB A;  2KMT A;  2GGR A;  3H0I A;  1VQ6 A;  2EGA A;  1W70 A;  3L2U A;  1TXQ A;  1YIJ T;  2LX9 A;  3CCJ T;  1UGV A;  2YXY A;  1VQ5 T;  4KGX B;  1NEG A;  3BE3 A;  2MYS A;  1NM7 A;  3OW2 P;  3OA6 A;  4AG1 C;  1AZG B;  2YSQ A;  2DL8 A;  1GCP A;  5KE3 A;  2KRM A;  2RQT A;  1B07 A;  4J9G A;  4XTW A;  3OBY A;  3EG0 A;  3OYA A;  2RJE A;  4EIK A;  3C95 A;  2NWM A;  4FW2 A;  2FPD A;  4MMK A;  2L3P A;  4DBF A;  1VQ6 Q;  3OYC A;  1IRX A;  1D1B A;  2XID A;  4X1V A;  4E7L A;  4PJO A;  3JAM E;  2ZZD A;  1Q82 U;  2AKK A;  2O9V A;  1SEM A;  5GMK i;  2GBQ A;  3C94 A;  4DEY A;  2E65 A;  3QWX X;  1PKT A;  2DJQ A;  4J7I A;  4C92 C;  4BI4 A;  2LNH B;  4K11 A;  2ZAE A;  4FU6 A;  3OB9 A;  4M78 A;  2K7A A;  4O5V A;  2QK0 A;  3VU3 C;  3S3O A;  5DM7 R;  1B34 B;  1YNZ A;  5KYY B;  5KYW B;  3X24 B;  3TVT A;  4Z88 A;  1PRM C;  5HK0 A;  2CUB A;  5CO7 A;  2M02 A;  1F1B B;  3JCM e;  2COW A;  1IGQ A;  3LW5 E;  1SF9 A;  2KQW A;  2DET A;  1QVG S;  3RMQ A;  4BE1 A;  4JJC A;  5IT9 E;  4C8Q B;  1CSK A;  2J06 A;  1YJN A;  2A28 A;  1VQ8 A;  1UHF A;  1JXM A;  2EVR A;  1BIA A;  1I5O B;  4C5E A;  1AWO A;  4IUU A;  2QQ9 A;  1AZE A;  1PCX A;  1N9S A;  5GAM f;  2LDM A;  1RAI B;  1LVK A;  5CKB A;  2DYI A;  2RM4 A;  2DIL A;  1EIF A;  1N27 A;  1J3T A;  4EMK A;  1QCO A;  1WXT A;  1Y96 B;  2ZPE B;  2FO0 A;  3UAT A;  1AVZ C;  2EGE A;  4J6Y A;  4BI8 B;  5CCA A;  3M58 A;  4HVV A;  1Z9Z A;  1CKA A;  3V7S A;  3H0F A;  2RB6 A;  1M1K U;  1ZBJ A;  3OSV A;  1UG1 A;  2J6K A;  3E2U A;  3VKI A;  2KDS A;  1HJD A;  1T0J A;  3SHW A;  1ZX6 A;  3TSW A;  4FT4 A;  3CCJ A;  4QVZ A;  2QGF B;  4ZN1 A;  4A4E A;  4J6W A;  1QQJ A;  1VQ5 A;  3QXE B;  2XI9 A;  5CVI A;  5IHN A;  2MOX A;  3LLR A;  2CDT A;  3UWN A;  1AHJ B;  3RKY A;  5CAI A;  3AT1 B;  2CZ1 B;  1TUG B;  3I55 T;  1D0X A;  2MWP A;  4HCC A;  1WNL A;  1G2B A;  1IGU A;  4EMH A;  1U06 A;  3X26 B;  1U1S A;  3QSU A;  2JN0 A;  3OYN A;  2B86 A; 
#chains in the Genus database with same CATH homology
 1WHM A;  1WHK A;  2COY A;  2CP5 A;  2HL3 A;  2HKN A;  3TQ7 P;  1TXQ A;  2E4H A;  2CP0 A;  4B6M A;  1LPL A;  2HQH A;  1WHG A;  2HL5 C;  2M02 A;  1WHJ A;  2COW A;  1WHH A;  2MPX C;  3E2U A;  1IXD A;  2CP6 A;  2CP7 A;  1TOV A;  2COZ A;  1WHL A;  2E3I A;  2QK0 A;  2CP3 A;  2E3H A;  3RDV A;  2HKQ B;  2Z0W A;  2CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...