2VKNA

Yeast sho1 sh3 domain complexed with a peptide from pbs2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
DNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords PROTEIN SSU81
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vknA00
2KRSA 1ZLMA 1GBQA 1GL5A 4EIKA 2PZ1A 2AZSA 2YSQA 3H0IA 3REAB 4RTUA 1X2QA 1K4US 1X69A 1YCSB 2EVRA 1Z9QA 2VVKA 2DJQA 2CT3A 2DA9A 1VYTA 2FG0A 1M3BA 3TSWA 2DL5A 1VYUA 1RI9A 2HBWA 2J05A 1LCKA 4JJCA 2A37A 4LUEA 2DM1A 2ESWA 2A08A 2BTTA 1JO8A 1OPKA 2L2PA 4OMLA 2F2XA 4OMNA 3A98A 1B07A 3I5RA 3M0SA 2J06A 4F17A 1I07A 2KE9A 4GLMA 1A0NB 4DEYA 1CSKA 1JXOA 3EHQA 1AVZC 2EGCA 2FPFA 1E6GA 1SEMA 2HSPA 2MCNA 1AWOA 4LE9A 5FW9A 1AD5A 4D8KA 2KT8A 5IXBA 4HXJA 2LP5A 1GFCA 1AWJA 2LCSA 5L23A 2KBTA 3VS3A 1X6GA 2EPDA 2YDLA 2DE0X 1ARKA 1MV3A 1W1FA 2C0OA 1PKSA 1ABQA 4J9IA 1JU5C 2M0YA 1E7OA 2DILA 2RQUA 2OI3A 3ZL7C 1RLQC 1XOVA 1Y0MA 4RTWA 1PNJA 3NGPA 1H3HA 4OMQA 3O5ZA 2PTKA 1I0CA 2K9GA 1GCQA 2KRMA 2CUBA 3THKA 1K0SA 2CDTA 1UHCA 2CSQA 2E5KA 2FRYA 3M0UA 1UJ0A 2FO0A 2RNAA 1PKTA 1ZBJA 2EYZA 2YT6A 5EC7A 4DEXA 3VS6A 1G2BA 4D8DA 1FYNA 1WFWA 3VS5A 3UATA 2X3XD 1NEGA 1YWOA 4J9FA 1YP5A 5IHKA 1KFZA 2L0AA 3EGUA 1G83A 1K76A 1GFDA 2NWMA 1WDXA 1N5ZA 2W10A 5HCKA 3I5SA 4AFQC 1SHFA 2O9SA 2J6KA 1QWEA 2RQVA 1UG1A 4JJBA 1BB9A 2BZXA 2L3QA 4IIMA 2JS0A 2JMCA 1T0HA 1VA7A 1YN8A 3GBQA 2DL8A 2EBPA 1UJYA 3UA7A 2O31A 3PVQA 2FRWA 1WXBA 2DL4A 2XMFA 1W70A 2GTJA 1UDLA 5I11A 4HVVA 1PWTA 2LQWA 4RTVA 2K79A 2LX7A 2KYBA 2AZVA 2LJ0A 1GBRA 1I1JA 2IIMA 1T0JA 2L3PA 2RQTA 4ZNXA 1X43A 2HEQA 5IH2A 4HCKA 1GCPA 2W0ZA 1U3OA 5IXFA 2RPNA 4F14A 1M8MA 2L3SA 4AFZC 2O88A 5FWBA 5IHNA 1WXUA 3H0HA 1S1NA 1B3QA 1X27A 2O9VA 1M3CA 2J6OA 3VRYA 2GTOA 4OMPA 3CQTA 3EHRA 1PRMC 2EGEA 4RUGA 4J9BA 1AZGB 4ESRA 1K0XA 1M30A 2CT4A 4JJDA 2F2VA 1IO6A 2CREA 2D8HA 2ENMA 1E6HA 3UF4A 4Z88A 2HCKA 2GBQA 2KGTA 2VWFA 1NYGA 2NUZA 4ORZA 4AFSC 4CC7A 2X3WD 1YWPA 2A36A 5GJVB 2M51A 4CC3A 4M4ZA 2KYMA 1ABOA 2ROLA 4FSSA 1JQQA 1U06A 3M0PA 1M3AA 4HVUA 2LZ6B 2DVJA 3VS1A 3VS4A 2LJ1A 4J9CA 4Y92A 3LH5A 2KXCA 1SRMA 2RF0A 2DLPA 2JT4A 3H41A 1TG0A 2YUPA 4RTXA 1ZUUA 2DRKA 4QT7A 2MIOA 1AOJA 1WX6A 1VYVA 1QKXA 1K1ZA 1OEBA 1WI7A 1WIEA 4WCIA 3VRZA 2DNUA 3UA6A 2A28A 1WYXA 2HDAA 3EG1A 4LUDA 2RQWA 2RN8A 3M0QA 4F16A 1RLPC 3REBB 3M0RA 2KNBB 2AKKA 3TSZA 1MUZA 1UGVA 2JW4A 2DMOA 2LMJA 1Y57A 3NMZC 4E6RA 1UE9A 1NEBA 3PE0A 4X1VA 2LQNA 1NLPC 1BBZA 4LN2A 1UECA 2FPEA 2K3BA 1AZEA 1GRIA 1WA7A 1UTIA 2D1XA 1KSWA 2LNHB 2O2OA 4CC2A 3H0FA 3PVLA 2KROA 2C0TA 1UUEA 1BU1A 2JM8A 2YUQA 2YUNA 2DRMA 3NHNA 4J9GA 4LNPA 1CKBA 3RNJA 1QKWA 2EKHA 2VKNA 2MOXA 2OJ2A 4J9EA 4R0KA 2JTEA 2EQIA 3NPFA 1QLYA 1KJWA 2B86A 2D8JA 2JM9A 1T3LA 1WLPB 2QDLA 3QWXX 2RQRA 3FJ5A 1NYFA 1TUDA 2DYBA 2JXBA 2V1RA 2ED1A 2AKLA 2C0IA 2J6FA 2FPDA 4Z8AA 1JXMA 1ZX6A 2D0NA 3M0TA 2PNIA 2SEMA 2ECZA 3C0CA 1EFNA 2J7IA 4HVWA 2EYXA 1PRLC 2GGRA 1SSHA 2EW3A 5GJWB 1SRLA 2I0NA 4AFUC 1CKAA 5I22A 3ULRB 1UHFA 2KR3A 4RTTA 3R6NA 4OMMA 3U23A 2AK5A 4GBQA 3VS7A 2CSIA 4JZ3A 2EGAA 3IQLA 1KIKA 1WXTA 2DBMA 2FEIA 3RBBB 2CUDA 2JMAA 2CH4W 3EG3A 3VS2A 2EYWA 1NM7A 1U5SA 2G6FX 1ZUKA 4RTZA 1QWFA 2K7AA 4J9DA 2DX1A 4OMOA 3EG0A 2K2MA 2F2WA 2ED0A 1YNZA 2H8HA 3VS0A 5ECAA 4IIOA 2JS2A 3TVTA 1T3SA 2KXDA 1HD3A 1QCFA 1HJDA 1M27C 1RUWA 1HSQA 2DL7A 2GQIA 3I9QA 2KEAA 3EG2A 4RTYA 1OV3A 5FWCA 1AEYA 1V1CA 2V1QA 2YUOA 1NLOC 1Z9ZA 4JPBW 1X2KA 2P4RA 4CC4B 1K9AA 3KFVA 3I35A 1H8KA 4AG1C 2CH4A 2KRNA 1GCQC 1ZUYA 1JEGA 4AG2C 3JV3A 1OPLA 4Z89A 1AWXA 2SRCA 1OOTA 2K6DA 4K11A 2ABLA 3SHWA 4KRTA 1PHTA 2EYYA 1UFFA 1X6BA 1H92A 2BZYA 1TUCA 1SPKA 2DBKA 2RMOA 2LJ3A 4JZ4A 3SEMA 1BK2A 1J3TA 2ROTA 1AWWA 1W6XA 4A63B 1NG2A 2OAWA 2DF6A 2GNCA 4J9HA 1SHGA 1MV0B 2BZ8A 3QWYA 5IHIA 1FMKA 2KT1A 1ZSGA 2DL3A
chains in the Genus database with same CATH superfamily
4EIKA 4C0GA 2AZSA 4IUVA 3D7SB 4RG2A 4II1A 3H0IA 4RTUA 1K4US 1X69A 3GNFB 2DTHA 1VYTA 3FEOA 4PJOE 2XD0A 1VQ7T 2QDYB 3JAME 3TSWA 1BIBA 4KH1B 2JTMA 2Z0WA 4X34A 4PJOF 3O8VA 3LGFA 5DM7R 4JJCA 4LUEA 4FSXA 4B9XA 2BTTA 4PJJA 2EQKA 3PMTA 2RK2A 1B07A 2EIFA 3M0SA 4LXCA 4OMFB 1SF9A 1I07A 1C1AA 4FL6A 1K73R 2WSCE 2XDDA 3QHSA 4OGEA 2LC4A 3JCMh 3VKIA 3JB9I 2QGGA 4B9WA 3OYLA 2E41A 2VASA 2EGCA 1S72Q 2FPFA 3QO3A 1LPLA 3EGXA 2KMTA 3PIOA 3VYGA 2KT8A 1YI2T 5IXBA 3UT1A 2CP0A 4C8QD 1VQPT 1U1TA 3HRSA 1YHQQ 1MMGA 1W2BP 3JSCA 3EG9A 5LL6S 1RAIB 1X6GA 3CD6T 2EPDA 4FW1A 1ARKA 3WXMB 4C0ZA 3EG9B 1XJWB 1MV3A 3OYKA 1W1FA 1VQ7A 4J9IA 3CCEQ 4M75B 2DTIA 1M9SA 2DILA 3ZL7C 1RLQC 3G4SA 1Y0MA 3E19A 3MEUA 1PNJA 3NGPA 1PSFA 2IVWA 2RJDA 3O5ZA 4M75F 2HSEB 3L2VA 4M7AF 3G1JA 3FDRA 3CPWP 2KRMA 2EAYA 2RO0A 1UHCA 4X9DA 2CSQA 2VUBA 2OX7A 1VQNA 2FRYA 5D7UA 3ZBDA 4JUVA 1PKTA 4TVRA 1ZBJA 2EYZA 4DEXA 3HP9A 3LW5E 5IN1A 1FYNA 4OB2B 1WFWA 3VS5A 4OGCA 4FM4B 3BFMA 5CKHA 1NEGA 5FU7B 3RDVA 1YBYA 3JCMb 1YP5A 2MMPA 5IHKA 1GFDA 3CPWS 2NLUA 2NWMA 1WDXA 1VQOT 4XU0A 1K8AR 1FWZA 5GAOl 3H9NA 4AFQC 1VQKT 1KQ1A 1YJ9Q 2O9SA 2RQVA 2PUOB 2F69A 1VQ6Q 3X24B 1Q7YC 1WQWA 4PLIA 1FMWA 2JMCA 1IREB 1VA7A 1YN8A 4E7SA 5GAN8 2K3YA 3H8ZA 2EBPA 2CKKA 3UA7A 1RAGB 4BD3A 1OX9A 2P0KA 1WXBA 2Y4XA 2XMFA 5FRMA 1UDLA 1PWTA 3AT1B 2VXEA 2RHUA 1KG1A 2KYBA 2AZVA 3MHXA 3L2WA 2IIMA 2L3PA 3G71Q 3OS1A 4HCKA 3SWNB 1VIEA 4QVZA 1M8MA 3CD6A 1XTDA 3T9NA 5IHNA 1WXUA 1S1NA 1U1SA 3VRYA 3CD6Q 4J9BA 3MP6A 1M30A 1OZ2A 2D8HA 1E6HA 1YJNA 3SFMA 3L2UA 3CCET 2VWFA 2RI5A 4AFSC 2XK0A 2F5TX 2EKOA 2A36A 2VYTA 5GJVB 2M51A 4C92A 2HMAA 3OW2A 3DB4A 1KQSA 3CCSA 1MGQA 5GAOq 2K3XA 2FZCB 2FZGB 3M0PA 1M3AA 2RI3A 4BE0A 4PJMA 1OI1A 1FMVA 3PMIA 3CXCS 3VS4A 4J9CA 4RMOA 1O75A 5FLXE 1SRMA 2XIDA 4RTXA 1ZUUA 1YJWT 4PFOA 3LWHA 4WCIA 1WIEA 3M59A 3UPUA 1BYMA 1WYXA 3EG1A 4M7AA 1RLPC 1YFNA 3REBB 5KYWA 4JRIA 3HRTA 4KULA 2LMJA 4XTZA 4DBQA 3OS5A 4JRQA 2LT1A 2LRQA 3PE0A 2LQNA 3X25B 4NL3A 1JRIA 3HTRA 2LTOA 2HKNA 2YLBA 2D1XA 1KSWA 2ZPBB 2LNHB 1Q82U 2C0TA 1UUEA 4QQGA 2CP7A 5I2MA 2LNVA 2PQWA 4FYVB 4BI4A 1CKBA 1UGSB 2VXFA 4M77A 2ZCFB 4CI0C 2ZPIB 2JM9A 1I4K1 1NPRA 4IUUA 1T3LA 4M7DG 4KUDK 1UB4A 2ZAEA 2LT4A 2O4XA 2X4WA 2NUPA 2QDLA 3QWXX 5C0MA 3JCMe 3JB9F 2AKLA 1D0ZA 2C0IA 2J6FA 2COYA 3UWNA 2SEMA 1IXDA 3L2QA 2JTFA 1PRLC 2QQAA 4OF1A 4Z02A 5GJWB 1SRLA 2OAUA 3QBYA 4OB0B 2I0NA 4AFUC 3L2RA 1CKAA 1JJ2S 4A4GA 5LJ3f 4M7AB 2KR3A 4RTTA 1VQ7Q 3R6NA 3NTIA 1VQ4T 3U23A 4GBQA 4RKUE 2V26A 3AHUA 5LJ3d 2OTLQ 2DBMA 1I5OB 1VQ4A 2LX9A 2CH4W 4XAXB 3CCLQ 3EG3A 1QQJA 1Y7XA 1U5SA 4PKCC 4RTZA 1QWFA 3A5ZB 4N4HA 2DX1A 2NYSA 4C8QE 4OMOA 2DXBA 1YNZA 3CC7T 1WHHA 2DPPB 2H8HA 4F7UB 4PL6A 1KC8C 5ECAA 2MI6A 3DKMA 4IIOA 2RHYA 2VGNA 2ZPHB 3WVEB 1T3SA 1HD3A 1M27C 3OMGA 2NUTA 2IPOB 3P8HA 4X9CA 4RTYA 2RI2A 4FIBA 4KGVB 5GAN7 2HNIA 1K73U 4JPBW 2JUFA 5J39A 2DVEA 1K9AA 4AG1C 1K9MR 4FYXB 2QASA 3META 5CAIA 2CGHA 3RKYA 2SRCA 4K11A 5DY9A 3CPWA 3EH2A 2HQEA 2VC8A 3SHWA 1PHTA 2B8AA 2RMOA 2LJ3A 4RCBA 1WQ7A 1WHJA 4XQ3A 4JZ4A 1J3TA 5CKEA 4M7AD 2MYSA 3BDUA 4J7IA 3MO8A 2OAWA 1FX7A 3DLMA 4XTWA 2DF6A 4JRKA 4GLKA 4PJOG 2EFIA 2MWPA 3HHTB 3CCMA 1QVFA 1OU9A 1RABB 2BZ8A 5IHIA 2DEQA 2XU8A 2QG9B 4J6YA 3FJPA 4KGXB 2FL7A 4FYWB 2CZ6B 2EQUA 3REAB 5GANf 1RAEB 2QK0A 1YJ9T 1VQLT 1YCSB 2EVRA 2VVKA 3CC2Q 3TCJA 2DJQA 4EPCA 5LJ5d 3CCUT 2DA9A 1QCNA 3E2UA 4E7IA 2JVVA 3JB9H 3JCMc 1D1CA 1RI9A 4A4KA 2HBWA 4BDZA 2J05A 1YITT 5LJ5f 3CC2T 2A37A 2DM1A 4JDSA 3CC4T 2K4YA 3OB9A 1BI3A 1JO8A 3M53A 1K8AU 4WTOB 3VYHB 3LYIA 2L2PA 5AYFA 2F2XA 1YJ9A 4V2SA 3JCMQ 4F17A 1A0NB 4DEYA 1CSKA 2GFUA 1YJNT 2BKDN 3A8GB 1B34B 2XG8D 2MCNA 1AWOA 1BIAA 2MPXC 3GOXA 1B7TA 4HXJA 1R8OB 3F70A 5KE2A 3ASKA 1AWJA 2LCSA 1SG5A 3P8BB 3VS3A 1IZ6A 2DE0X 4ZN3A 4JS4A 3S6WA 4C8QB 3JCMd 1OQKA 5GANh 1JU5C 5KYUB 1E7OA 3OW2P 2RQUA 3INZA 1KQSP 4E7LA 2DERA 2P0QA 4C5HA 4A4FA 1OZ3A 4F7UG 5CQXA 4F04B 1D3BA 1I0CA 2K9GA 2QQRA 2XICA 3QJ6A 1Q82C 1AT1B 1NJIU 3THKA 3HPWA 2MWOA 4VUBA 2JOYA 2CYZB 2RNAA 4C5GA 4OVAA 2YT6A 3CMAA 3CCQA 1IGQA 2X4YA 2X35A 1D3BB 5EG2A 3PT9A 2KSSA 1N8RC 2KDSA 3MKDA 3RKXA 3CBMA 1RI0A 4P5NA 2L0AA 1K76A 3CMEQ 1NPPA 3A8HB 1EIFA 3CCVQ 2W10A 3J7AF 1BCOA 1M1GA 2J6KA 3S3NA 1BB9A 3QPHA 1IHVA 3CPFA 1VQOQ 3Q1JA 1QVPA 2JS0A 3CCVT 4ATOA 3EGDB 2FYKA 1MNEA 5GMKh 1QVGS 4C5EA 5HK3A 2DK3A 5GAMh 2O31A 4PJOC 1Y07A 2M02A 2COWA 2D0QB 2DL4A 4M75E 2LQWA 4RTVA 2K79A 2O4XB 3L1AA 3JCMV 3ZEHA 2RHIA 2RQTA 3CCJA 4ZNXA 4A53A 3JCMJ 2W0ZA 1U3OA 3A8LB 3H6ZA 4D6WA 3OYMA 4F14A 4AFZC 1M90U 4M77D 2O88A 3CCQQ 5FWBA 4HT8A 2L3RA 1B3QA 1X27A 2O9VA 5GAOn 3MEWA 2ZPGB 4OMPA 3CQTA 1GXIE 2DXUA 4ESRA 5GAOm 2E12A 4JJDA 1IO6A 2ENMA 4FU6A 2YWWA 2NUTB 2GBQA 4XU2A 1Q86U 4ORZA 4CC7A 1EZZB 1NBEB 1TUGB 4KUIA 1N9SA 4M4ZA 2QQ9A 4M7DB 4L5GA 1ABOA 3RIRA 2ROLA 3BDLA 4LDYA 2CP6A 1C6VX 3PGGA 1JQQA 2ZZDA 3R6OA 2H3EB 3KUFA 2KVQG 1VQ6T 1JB0E 2QGFB 2KXCA 1M1FA 3HFOA 4J83A 5KYNA 2DXTA 2CZ7B 2RF0A 2DLPA 1R0CB 2JT4A 3H41A 2ZPEB 1XQHA 3MCAB 3CCRT 2BUDA 1AOJA 1LVKA 4FYYB 1VQ6A 1WJRA 1H641 1WI7A 3VRZA 3UA6A 2HDAA 4LUDA 2GF7A 2RHXA 4OP0A 2PU9B 3M0RA 1TTHB 4N4GA 3TSZA 1UGVA 3G71T 2JW4A 4PJLA 1Y57A 1O9SA 1NEBA 5GMKi 5D6XA 4C92C 1BBZA 4AMCA 4L6V5 1UECA 1AZEA 2E3IA 3OYGA 1WA7A 1PCXA 4IKFA 4FT2A 3CC2A 1F1BB 2P4TA 3HFNA 1WHMA 1BI0A 2YUQA 1I81A 2DRMA 3NHNA 2DZCA 5HKCA 1WPYA 2YRDA 1VQMT 2OJ2A 4BY6B 5GMKl 9ATCB 4N0AA 4M75A 3NPFA 1QLYA 1KJWA 2OTJQ 4OB1B 2WACA 1I5LA 3CCUA 5GMKe 5KCHA 3NFCA 1QVFP 2QXFA 1RAFB 3I56T 2JXBA 2V1RA 4MDXA 2FPDA 2D0NA 2ECZA 1EFNA 2J7IA 4HVWA 2EYXA 1G5VA 1IRXA 2GGRA 2X51A 3FC3A 4HCCA 5FRNA 3X28B 1YJWA 2RHZA 3EFSA 2R58A 1YIJT 2PVDB 3GNGA 3V7CA 4OMMA 2QQBA 2HAXA 2CSIA 4RG8A 5GMKj 4JZ3A 3JCMX 1Q86C 2EGAA 1KIKA 1X01A 4CRIA 3EGDA 2X4JA 1YIJQ 1TS9A 3VS2A 3X20B 5GAOp 1NM7A 2K5LA 1VQ9Q 2R5MA 4M75G 3M58A 4J9DA 1ZQ1A 1D1AA 2AHJB 4M7DA 2R57A 3CCLT 2CZ0B 3JRZA 4ME7A 1HJDA 4DBRA 1HSQA 1M90R 4C8QC 1ACMB 2YXYA 3EG2A 4ELZC 1AEYA 3SWNC 5LJ5g 4MZPA 1BI1A 4BI8B 2G3RA 5CKBA 3JB9J 2YUOA 2V1QA 1M1KR 1M8VA 4A4EA 1JJ2A 1PG5B 3QZ5B 3M55A 2P4RA 4CC4B 1LJOA 3I35A 1ZSZB 1VQ5T 3RMSA 1ZUYA 3MEAA 1AWXA 4M77F 3G6EA 1TU0B 4HCBA 1H92A 2BZYA 4AT1B 2DBKA 1RACB 4M77E 4XTYA 1R77A 3QIIA 2DD4A 4BE2A 3VUBA 4FW2A 1BK2A 4M7AG 5GAN2 1W6XA 1K8AC 3FB9A 4PJOD 5GAN4 4N0AC 3M57A 4LDVA 4J9HA 1YHQA 1MV0B 1IHWA 3BE3A 2HKQB 5D6WA 5LJ5j 1Q95G 5I21A 2DFUA 3G7ZA 2RJCA 1G3YA 1YITQ 5FU7C 3HSBA 3C12A 3M5AA 2YSQA 3OYJA 4M78C 1X2QA 5M9OA 1YITA 1NZ9A 3OY9A 1Z9QA 2HQHA 4E7JA 1M3BA 3CCJT 2DL5A 2AIRB 1Q81U 4DQ2A 1S72T 1ZBXA 2QI2A 2QAZA 3RR6A 5HY6A 3CCVA 2E1HA 2VGMA 1OPKA 3CBPA 4OMLA 5KYYA 4OMNA 2VB6A 5LJ5h 5CIUA 2J06A 1VQ9T 4M7DF 2KE9A 4GLMA 2EQJA 4WF2A 1QVGA 1AVZC 2KK4A 5AT1B 1PSEA 1E6GA 1SEMA 2HSPA 3PFSA 2GQVA 4LE9A 3CBOA 3CXCA 4F7UF 1N6AA 5LJ3j 4MZMA 5IT9E 1TXQA 2WSEE 2HL3A 1WHGA 5FU6C 3OA6A 5L23A 2JNGA 2YDLA 1WJQA 2KQWA 1PM3A 2C0OA 2QYZA 3QG1A 1VQKA 2E3HA 3HL8A 1X75C 3CMAT 1M4ZA 1YI2Q 1H3HA 3P8DA 3CCEA 3OBYA 1YHQT 1G3TA 2QTVA 4LDXA 1GCQA 5J3BA 1G8XA 2RA2A 2CDTA 1AHJB 3G71A 2E5KA 2LCCA 3TREA 3M0UA 2RJFA 1UJ0A 2E6NA 4DOWA 3CCMT 5L8RE 3MP1A 3S3OA 5EC7A 1KHCA 2F1LA 3V7SA 3VS6A 1Y96B 1G2BA 4D8DA 4Q5WA 1VQNQ 3QDFA 2GFAA 2X3XD 1OYXA 3QSUA 3I55A 1KC8R 1YWOA 4KH0B 4DBHA 4J9FA 5KE3A 4OB3B 4HT9A 4XTUA 5HK0A 1KFZA 1KD1R 1RADB 1G83A 2K5IA 5IAYA 1OX8A 1N5ZA 2RB6A 4C92F 5KCOA 2E64A 5HCKA 3I5SA 2HQXA 3M54A 4O6JA 1M1KC 4BB7A 1QWEA 3HKSA 4JJBA 4XK8E 2BZXA 3M56A 4IIMA 1I8FA 3GBQA 4M7DC 3M4GA 4ZN1A 2EJGA 2FB7A 2YRCA 1YI2A 2ZGWA 2BE7D 2FRWA 5A0LA 1W70A 4ZGEB 3QYHB 4M7AE 2LX7A 2CS7A 2LJ0A 4PJNA 1T0JA 5DLQE 1X43A 3V8LA 3WVDB 1GCPA 4M77G 2RPNA 2XKOC 2L3SA 4M78F 1MMNA 4A54A 5FU6B 1FXXA 1M3CA 3EHRA 1PRMC 3EH1A 1MNDA 5LJ3g 4F7UA 1AZGB 3SDZA 2CT4A 2F2VA 2FHDA 1W2BS 3NTKA 5LJ5e 3A1PA 3ZFJA 2HCKA 1NJIC 2KGTA 2EQMA 1NYGA 3G6ET 3OW2S 1YWPA 2DETA 3CMAQ 2KYMA 4C92D 1EX4A 5GAN3 3GPLA 4HVUA 1KK7A 3G6EQ 3UDCA 2DVJA 2H3JA 3MEVA 3VS1A 5GMKm 2K5FA 2LJ1A 3MJXA 4XU1A 1TG0A 2YUPA 4QW2A 1QCOA 2DRKA 4QT7A 3V8JA 1WX6A 1QKXA 1K1ZA 2K57A 4M78B 2DNUA 2A28A 3JCMP 1M1KU 2RQWA 2RN8A 1VQ8A 5GAN6 4J7FA 1Q7YU 2KNBB 1VQLA 1MUZA 2A7YA 5GAMe 4J5YA 4ELYC 1JJ2P 2DMOA 2EJFA 4E6RA 3E9FA 4X1VA 1QVFS 1NLPC 3OS0A 3CC7A 3CCQT 2FPEA 2K3BA 4M77C 1GRIA 2DEUA 2O2OA 4BACA 3PVLA 2MK5A 2KROA 3OYEA 3N5BB 4IUQA 1PD1A 3I56Q 2CP5A 2YUNA 2RH2A 5D6YA 4J9GA 4LNPA 1Q82R 2E10A 2EKHA 2VKNA 4PFZA 2KY9A 4R0KA 4BI3A 5KYUA 1Q7YR 2D8JA 3QXEB 3BY7A 1ZSZC 3PIPA 1WLPB 1KD1U 3FIFA 2DYBA 1JBMA 1N8RR 2RD1A 3RMQA 3RERA 5GAMd 1WGSA 5KYXA 3C0CA 2DAQA 2X4XA 2OTLT 2CZ1B 4C92G 1SSHA 4ZTJA 4E7KA 3SD4A 2YHTA 2BE9B 1VQOA 1G3SA 4FT4A 5I22A 3ULRB 2HBPA 4M78D 2Y4YA 5GANe 1K73C 3MPUB 5LJ3e 4EMKB 3CC7Q 3VS7A 2PVGB 1IB8A 3EFOB 3CCLA 1WZOA 5KYXB 2BIVA 1RAHB 4DA4A 2QA4T 1DJ7B 4NL2A 3RBBB 2CUDA 4M75D 2EYWA 1QVGP 2G6FX 4ZGDB 2M9UA 4PK4A 3EG0A 2K2MA 3L42A 3JCMg 2F2WA 1QP2A 3DB3A 5DLOA 2XDPA 4Y91A 3OYIA 4IURA 3BW1A 3J81E 3FLGA 1RUWA 2DL7A 4MMKA 3PTAA 7AT1B 2P84A 2EWNA 1TOVA 3JB9G 4B6MA 1C0MA 2E6ZA 1OV3A 5FWCA 2LQKA 5GAMg 1H3ZA 1V1CA 4BUGA 4PLLA 5A2QE 1S72A 1Z9ZA 2KI7A 1X2KA 4M75C 3QZ9B 1H8KA 1ZA2B 3RESA 4AG2C 2D6FA 4Z89A 2E5QA 1OOTA 3SWNA 1ZHIA 3GF5A 3M9QA 4KRTA 2EYYA 1UFFA 4EMKA 2L89A 1TUCA 4KBMB 2ZPFB 5LJ3h 5I2SA 3SEMA 1U8RA 2DZ9A 2ROTA 1AWWA 1MHNA 3QJYA 4A63B 3CCMQ 1NG2A 1M2VA 1KQ2A 1D0YA 4C92B 1TH7A 5CKDA 5GAN5 1UGPB 1N9RA 3E1SA 3OYDA 1SHGA 4M78G 2KT1A 1WJSA 1KHIA 2EJ9A 2KRSA 4RCCA 1ZLMA 1GBQA 1GL5A 4NOYA 2M16A 2PZ1A 4HKEA 2IG0A 1D0XA 1YIJA 4DOVA 1PC0A 4GY5A 2CT3A 2FG0A 1TWBA 1VOMA 1YJNQ 2DD5A 1VYUA 2E70A 3OYCA 1VQ5A 1LCKA 2ATCB 5GAMj 2ESWA 3VJPA 4M7AC 2A08A 2QA4Q 1R0BG 4O5VA 3VV0A 3A98A 3I5RA 1VQ5Q 4EDUA 4R55A 2RK1A 3TQ7P 3EAEA 4C0DB 1JXOA 3EHQA 2JJ9A 4QKUA 1VQPQ 1QP3A 1KQSS 4M7DE 4L59A 5FW9A 1AD5A 4D8KA 1W4SA 2DKGA 3OYNA 2LP5A 1HK9A 1GFCA 1VQ8Q 1MMAA 2KBTA 4C8QG 4KT0E 3LLRA 3QUIA 1Q81C 4J8OA 1PKSA 1ABQA 2M0YA 3OYHA 2OI3A 1V76A 2V8JA 1XOVA 4RTWA 4OMQA 1M90C 2PTKA 1VQNT 3I55T 4JRPA 4PJOB 3CEYA 2FZKB 2CUBA 3G4ST 1K0SA 2DJZA 2M1HA 1SKUB 2AT1B 1IGUA 3CMET 1YCYA 5CKFA 2QQSA 3EFRA 2FO0A 2A0FB 2Y90A 4LDUA 5KYWB 3UATA 1LNXA 2D9TA 8ATCB 2LVMA 2CP3A 4A4HA 1VQPA 3JCMW 1OU8A 4MDWA 1HXDA 4HCZA 4UC4A 3EGUA 3CC4A 2E4HA 2L5QA 4LDWA 4MZTA 1RAAB 1SHFA 4YTLA 3KXTA 3GIBA 1UG1A 4ZTFA 2E65A 2L3QA 2LDMA 3ER0A 1SSFA 3SB2A 1T0HA 1VQ8T 2DL8A 4MMLA 4N4IA 4LD6A 2O01E 3GLXA 3LX7A 1UJYA 3PVQA 1XNIA 5CO7A 1K9MU 2RM4A 4EMHA 1UEBA 2GTJA 3RKWA 3E9GA 4HVVA 5I11A 1UGRB 2JZ2A 3V7RA 1GBRA 2HZYA 1I1JA 3LGLA 1Y71A 1BCMA 2HEQA 5IH2A 3FRNA 2DIGA 3RUXA 5IXFA 1X6OA 3G4SQ 4KGZB 3KBGA 5KYYB 3H0HA 4M78E 2PUKB 2J6OA 2GTOA 4IUPA 1Q86R 2EGEA 4RUGA 3OSVA 1K0XA 1W2BA 2CREA 3CMEA 2X9HA 4E7ZA 3UF4A 1M5Q1 4Z88A 2VV5A 2YRVA 1N8RU 5GAOr 2NUZA 2X3WD 4C92E 4LD9K 1M2OA 2JN0A 4CC3A 1V29B 4JS5A 4NS5A 3TEEA 4XU3A 5CCAA 2YLCA 3I55Q 4FSSA 1U06A 2LZ6B 1HYOA 3OQ5A 4Y92A 4M78A 2LQ8A 3LH5A 1WHLA 3A8MB 1MMDA 4FCYA 5J26A 3EGXB 5KH6A 4IUTA 3URGA 2MIOA 3OYAA 1VYVA 1RL2A 1B34A 1VUBA 1OEBA 2QTXA 5A0GA 2C06A 4EMKC 1K9MC 2OTLA 1QW1A 3M0QA 5CK9A 4F16A 4R56A 3CCRA 1VQ4Q 3VUZA 5CVIA 2AKKA 4QQ6A 2DXCA 2XI9A 3JCMf 4J6XA 2QEXT 4XTXA 3NMZC 2NUPB 1YJWQ 1VQKQ 3OBWA 1PD0A 3CCRQ 1UE9A 3C95A 5GANd 2RJEA 4LN2A 1Q81R 2OTJT 1UTIA 4BE1A 4C5IA 1Y96A 3PNWC 4CC2A 3H0FA 1KD1C 4Y28E 2MF2A 4C0FA 2P0PA 1BU1A 2JM8A 2CP2A 5A0DA 5CR2A 1WNLA 1VQ9A 3C94A 1P92A 3RNJA 1QKWA 2DIQA 2V8KA 2MOXA 2HD0A 4J9EA 4M77B 4ANJA 2JTEA 2EQIA 2B86A 6AT1B 4JLGA 4C8QA 1D1BA 4M7DD 4ZGJB 5GAMf 3OYBA 4E7HA 2RQRA 3FJ5A 1NYFA 1TUDA 2XHCA 2ED1A 3CCST 4E2FB 1QMCA 1VIFA 1D09B 4Z8AA 1VQMQ 1BKBA 1JXMA 1ZX6A 3M0TA 2PNIA 3ME9A 4QQDA 3CXCP 2EW3A 1ZA1B 2R5AA 3OMCA 3VU3C 1NE8A 2A3LA 1UHFA 3QYGB 2F5KA 2LCLA 2PVOB 2AK5A 2FVUA 3C4SA 3IQLA 3OSSC 4JJNK 1WXTA 4HA8A 2FEIA 1BI2A 2JMAA 4EMGA 4C8QF 3GP8A 4XTVA 3HRUA 1ZUKA 4JLIA 2K7AA 4PJOA 2COZA 3M4YA 2EYQA 2ED0A 5CQYA 4DBFA 2WSFE 2OTJA 2I2LA 3L2ZA 3VS0A 3CCUQ 1N27A 4QVCA 2JS2A 3TVTA 3NTHA 2KXDA 2QA4A 3TU4K 2QEXA 1QCFA 3JB9D 2L8DA 2GQIA 3I9QA 3QDRB 3I56A 1OULA 2KEAA 4BY6C 1G3WA 2GCXA 3OS2A 1VQMA 2QEXQ 3CC4Q 3DLLA 3LH0A 3QKJA 4J6WA 8AT1B 3OYYA 1NLOC 2DO3A 3CCSQ 1NJIR 3KFVA 2V8IA 2XDBA 3OYFA 1KC8U 2CH4A 2KRNA 1GCQC 3MP8A 3X26B 4BDYA 1JEGA 3JV3A 1OPLA 4PNOA 1M2VB 2K6DA 3EFOA 4E47A 2ABLA 2HL5C 2K2VA 4C0DC 1X6BA 1UGQB 1WHKA 1SPKA 5C6SA 4QVDA 3J80E 1ZSZA 5GANg 5GANj 3V8KA 4F7UE 2M0OA 4PFPA 2DTOA 3A8OB 5FROA 2GNCA 2KAFA 3S3MA 1TSFA 3CCJQ 2MAMA 1LOJA 1VQLQ 3QWYA 1FMKA 3LWIA 2DYIA 1ZSGA 2DL3A
chains in the Genus database with same CATH topology
2KRSA 1ZLMA 1GBQA 1GL5A 4EIKA 2PZ1A 2AZSA 2YSQA 3H0IA 3REAB 4RTUA 1X2QA 1K4US 1X69A 1YCSB 2EVRA 1Z9QA 2VVKA 2DJQA 2CT3A 2DA9A 1VYTA 2FG0A 1M3BA 3TSWA 2DL5A 1VYUA 1RI9A 2HBWA 2J05A 1LCKA 4JJCA 2A37A 4LUEA 2DM1A 2ESWA 2A08A 2BTTA 1JO8A 1OPKA 2L2PA 4OMLA 2F2XA 4OMNA 3A98A 1B07A 3I5RA 3M0SA 2J06A 4F17A 1I07A 2KE9A 4GLMA 1A0NB 4DEYA 1CSKA 1JXOA 3EHQA 1AVZC 2EGCA 2FPFA 1E6GA 1SEMA 2HSPA 2MCNA 1AWOA 4LE9A 5FW9A 1AD5A 4D8KA 2KT8A 5IXBA 4HXJA 2LP5A 1GFCA 1AWJA 2LCSA 5L23A 2KBTA 3VS3A 1X6GA 2EPDA 2YDLA 2DE0X 1ARKA 1MV3A 1W1FA 2C0OA 1PKSA 1ABQA 4J9IA 1JU5C 2M0YA 1E7OA 2DILA 2RQUA 2OI3A 3ZL7C 1RLQC 1XOVA 1Y0MA 4RTWA 1PNJA 3NGPA 1H3HA 4OMQA 3O5ZA 2PTKA 1I0CA 2K9GA 1GCQA 2KRMA 2CUBA 3THKA 1K0SA 2CDTA 1UHCA 2CSQA 2E5KA 2FRYA 3M0UA 1UJ0A 2FO0A 2RNAA 1PKTA 1ZBJA 2EYZA 2YT6A 5EC7A 4DEXA 3VS6A 1G2BA 4D8DA 1FYNA 1WFWA 3VS5A 3UATA 2X3XD 1NEGA 1YWOA 4J9FA 1YP5A 5IHKA 1KFZA 2L0AA 3EGUA 1G83A 1K76A 1GFDA 2NWMA 1WDXA 1N5ZA 2W10A 5HCKA 3I5SA 4AFQC 1SHFA 2O9SA 2J6KA 1QWEA 2RQVA 1UG1A 4JJBA 1BB9A 2BZXA 2L3QA 4IIMA 2JS0A 2JMCA 1T0HA 1VA7A 1YN8A 3GBQA 2DL8A 2EBPA 1UJYA 3UA7A 2O31A 3PVQA 2FRWA 1WXBA 2DL4A 2XMFA 1W70A 2GTJA 1UDLA 5I11A 4HVVA 1PWTA 2LQWA 4RTVA 2K79A 2LX7A 2KYBA 2AZVA 2LJ0A 1GBRA 1I1JA 2IIMA 1T0JA 2L3PA 2RQTA 4ZNXA 1X43A 2HEQA 5IH2A 4HCKA 1GCPA 2W0ZA 1U3OA 5IXFA 2RPNA 4F14A 1M8MA 2L3SA 4AFZC 2O88A 5FWBA 5IHNA 1WXUA 3H0HA 1S1NA 1B3QA 1X27A 2O9VA 1M3CA 2J6OA 3VRYA 2GTOA 4OMPA 3CQTA 3EHRA 1PRMC 2EGEA 4RUGA 4J9BA 1AZGB 4ESRA 1K0XA 1M30A 2CT4A 4JJDA 2F2VA 1IO6A 2CREA 2D8HA 2ENMA 1E6HA 3UF4A 4Z88A 2HCKA 2GBQA 2KGTA 2VWFA 1NYGA 2NUZA 4ORZA 4AFSC 4CC7A 2X3WD 1YWPA 2A36A 5GJVB 2M51A 4CC3A 4M4ZA 2KYMA 1ABOA 2ROLA 4FSSA 1JQQA 1U06A 3M0PA 1M3AA 4HVUA 2LZ6B 2DVJA 3VS1A 3VS4A 2LJ1A 4J9CA 4Y92A 3LH5A 2KXCA 1SRMA 2RF0A 2DLPA 2JT4A 3H41A 1TG0A 2YUPA 4RTXA 1ZUUA 2DRKA 4QT7A 2MIOA 1AOJA 1WX6A 1VYVA 1QKXA 1K1ZA 1OEBA 1WI7A 1WIEA 4WCIA 3VRZA 2DNUA 3UA6A 2A28A 1WYXA 2HDAA 3EG1A 4LUDA 2RQWA 2RN8A 3M0QA 4F16A 1RLPC 3REBB 3M0RA 2KNBB 2AKKA 3TSZA 1MUZA 1UGVA 2JW4A 2DMOA 2LMJA 1Y57A 3NMZC 4E6RA 1UE9A 1NEBA 3PE0A 4X1VA 2LQNA 1NLPC 1BBZA 4LN2A 1UECA 2FPEA 2K3BA 1AZEA 1GRIA 1WA7A 1UTIA 2D1XA 1KSWA 2LNHB 2O2OA 4CC2A 3H0FA 3PVLA 2KROA 2C0TA 1UUEA 1BU1A 2JM8A 2YUQA 2YUNA 2DRMA 3NHNA 4J9GA 4LNPA 1CKBA 3RNJA 1QKWA 2EKHA 2VKNA 2MOXA 2OJ2A 4J9EA 4R0KA 2JTEA 2EQIA 3NPFA 1QLYA 1KJWA 2B86A 2D8JA 2JM9A 1T3LA 1WLPB 2QDLA 3QWXX 2RQRA 3FJ5A 1NYFA 1TUDA 2DYBA 2JXBA 2V1RA 2ED1A 2AKLA 2C0IA 2J6FA 2FPDA 4Z8AA 1JXMA 1ZX6A 2D0NA 3M0TA 2PNIA 2SEMA 2ECZA 3C0CA 1EFNA 2J7IA 4HVWA 2EYXA 1PRLC 2GGRA 1SSHA 2EW3A 5GJWB 1SRLA 2I0NA 4AFUC 1CKAA 5I22A 3ULRB 1UHFA 2KR3A 4RTTA 3R6NA 4OMMA 3U23A 2AK5A 4GBQA 3VS7A 2CSIA 4JZ3A 2EGAA 3IQLA 1KIKA 1WXTA 2DBMA 2FEIA 3RBBB 2CUDA 2JMAA 2CH4W 3EG3A 3VS2A 2EYWA 1NM7A 1U5SA 2G6FX 1ZUKA 4RTZA 1QWFA 2K7AA 4J9DA 2DX1A 4OMOA 3EG0A 2K2MA 2F2WA 2ED0A 1YNZA 2H8HA 3VS0A 5ECAA 4IIOA 2JS2A 3TVTA 1T3SA 2KXDA 1HD3A 1QCFA 1HJDA 1M27C 1RUWA 1HSQA 2DL7A 2GQIA 3I9QA 2KEAA 3EG2A 4RTYA 1OV3A 5FWCA 1AEYA 1V1CA 2V1QA 2YUOA 1NLOC 1Z9ZA 4JPBW 1X2KA 2P4RA 4CC4B 1K9AA 3KFVA 3I35A 1H8KA 4AG1C 2CH4A 2KRNA 1GCQC 1ZUYA 1JEGA 4AG2C 3JV3A 1OPLA 4Z89A 1AWXA 2SRCA 1OOTA 2K6DA 4K11A 2ABLA 3SHWA 4KRTA 1PHTA 2EYYA 1UFFA 1X6BA 1H92A 2BZYA 1TUCA 1SPKA 2DBKA 2RMOA 2LJ3A 4JZ4A 3SEMA 1BK2A 1J3TA 2ROTA 1AWWA 1W6XA 4A63B 1NG2A 2OAWA 2DF6A 2GNCA 4J9HA 1SHGA 1MV0B 2BZ8A 3QWYA 5IHIA 1FMKA 2KT1A 1ZSGA 2DL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRS A;  1ZLM A;  1GBQ A;  1GL5 A;  4EIK A;  2PZ1 A;  2AZS A;  2YSQ A;  3H0I A;  3REA B;  4RTU A;  1X2Q A;  1K4U S;  1X69 A;  1YCS B;  2EVR A;  1Z9Q A;  2VVK A;  2DJQ A;  2CT3 A;  2DA9 A;  1VYT A;  2FG0 A;  1M3B A;  3TSW A;  2DL5 A;  1VYU A;  1RI9 A;  2HBW A;  2J05 A;  1LCK A;  4JJC A;  2A37 A;  4LUE A;  2DM1 A;  2ESW A;  2A08 A;  2BTT A;  1JO8 A;  1OPK A;  2L2P A;  4OML A;  2F2X A;  4OMN A;  3A98 A;  1B07 A;  3I5R A;  3M0S A;  2J06 A;  4F17 A;  1I07 A;  2KE9 A;  4GLM A;  1A0N B;  4DEY A;  1CSK A;  1JXO A;  3EHQ A;  1AVZ C;  2EGC A;  2FPF A;  1E6G A;  1SEM A;  2HSP A;  2MCN A;  1AWO A;  4LE9 A;  5FW9 A;  1AD5 A;  4D8K A;  2KT8 A;  5IXB A;  4HXJ A;  2LP5 A;  1GFC A;  1AWJ A;  2LCS A;  5L23 A;  2KBT A;  3VS3 A;  1X6G A;  2EPD A;  2YDL A;  2DE0 X;  1ARK A;  1MV3 A;  1W1F A;  2C0O A;  1PKS A;  1ABQ A;  4J9I A;  1JU5 C;  2M0Y A;  1E7O A;  2DIL A;  2RQU A;  2OI3 A;  3ZL7 C;  1RLQ C;  1XOV A;  1Y0M A;  4RTW A;  1PNJ A;  3NGP A;  1H3H A;  4OMQ A;  3O5Z A;  2PTK A;  1I0C A;  2K9G A;  1GCQ A;  2KRM A;  2CUB A;  3THK A;  1K0S A;  2CDT A;  1UHC A;  2CSQ A;  2E5K A;  2FRY A;  3M0U A;  1UJ0 A;  2FO0 A;  2RNA A;  1PKT A;  1ZBJ A;  2EYZ A;  2YT6 A;  5EC7 A;  4DEX A;  3VS6 A;  1G2B A;  4D8D A;  1FYN A;  1WFW A;  3VS5 A;  3UAT A;  2X3X D;  1NEG A;  1YWO A;  4J9F A;  1YP5 A;  5IHK A;  1KFZ A;  2L0A A;  3EGU A;  1G83 A;  1K76 A;  1GFD A;  2NWM A;  1WDX A;  1N5Z A;  2W10 A;  5HCK A;  3I5S A;  4AFQ C;  1SHF A;  2O9S A;  2J6K A;  1QWE A;  2RQV A;  1UG1 A;  4JJB A;  1BB9 A;  2BZX A;  2L3Q A;  4IIM A;  2JS0 A;  2JMC A;  1T0H A;  1VA7 A;  1YN8 A;  3GBQ A;  2DL8 A;  2EBP A;  1UJY A;  3UA7 A;  2O31 A;  3PVQ A;  2FRW A;  1WXB A;  2DL4 A;  2XMF A;  1W70 A;  2GTJ A;  1UDL A;  5I11 A;  4HVV A;  1PWT A;  2LQW A;  4RTV A;  2K79 A;  2LX7 A;  2KYB A;  2AZV A;  2LJ0 A;  1GBR A;  1I1J A;  2IIM A;  1T0J A;  2L3P A;  2RQT A;  4ZNX A;  1X43 A;  2HEQ A;  5IH2 A;  4HCK A;  1GCP A;  2W0Z A;  1U3O A;  5IXF A;  2RPN A;  4F14 A;  1M8M A;  2L3S A;  4AFZ C;  2O88 A;  5FWB A;  5IHN A;  1WXU A;  3H0H A;  1S1N A;  1B3Q A;  1X27 A;  2O9V A;  1M3C A;  2J6O A;  3VRY A;  2GTO A;  4OMP A;  3CQT A;  3EHR A;  1PRM C;  2EGE A;  4RUG A;  4J9B A;  1AZG B;  4ESR A;  1K0X A;  1M30 A;  2CT4 A;  4JJD A;  2F2V A;  1IO6 A;  2CRE A;  2D8H A;  2ENM A;  1E6H A;  3UF4 A;  4Z88 A;  2HCK A;  2GBQ A;  2KGT A;  2VWF A;  1NYG A;  2NUZ A;  4ORZ A;  4AFS C;  4CC7 A;  2X3W D;  1YWP A;  2A36 A;  5GJV B;  2M51 A;  4CC3 A;  4M4Z A;  2KYM A;  1ABO A;  2ROL A;  4FSS A;  1JQQ A;  1U06 A;  3M0P A;  1M3A A;  4HVU A;  2LZ6 B;  2DVJ A;  3VS1 A;  3VS4 A;  2LJ1 A;  4J9C A;  4Y92 A;  3LH5 A;  2KXC A;  1SRM A;  2RF0 A;  2DLP A;  2JT4 A;  3H41 A;  1TG0 A;  2YUP A;  4RTX A;  1ZUU A;  2DRK A;  4QT7 A;  2MIO A;  1AOJ A;  1WX6 A;  1VYV A;  1QKX A;  1K1Z A;  1OEB A;  1WI7 A;  1WIE A;  4WCI A;  3VRZ A;  2DNU A;  3UA6 A;  2A28 A;  1WYX A;  2HDA A;  3EG1 A;  4LUD A;  2RQW A;  2RN8 A;  3M0Q A;  4F16 A;  1RLP C;  3REB B;  3M0R A;  2KNB B;  2AKK A;  3TSZ A;  1MUZ A;  1UGV A;  2JW4 A;  2DMO A;  2LMJ A;  1Y57 A;  3NMZ C;  4E6R A;  1UE9 A;  1NEB A;  3PE0 A;  4X1V A;  2LQN A;  1NLP C;  1BBZ A;  4LN2 A;  1UEC A;  2FPE A;  2K3B A;  1AZE A;  1GRI A;  1WA7 A;  1UTI A;  2D1X A;  1KSW A;  2LNH B;  2O2O A;  4CC2 A;  3H0F A;  3PVL A;  2KRO A;  2C0T A;  1UUE A;  1BU1 A;  2JM8 A;  2YUQ A;  2YUN A;  2DRM A;  3NHN A;  4J9G A;  4LNP A;  1CKB A;  3RNJ A;  1QKW A;  2EKH A;  2VKN A;  2MOX A;  2OJ2 A;  4J9E A;  4R0K A;  2JTE A;  2EQI A;  3NPF A;  1QLY A;  1KJW A;  2B86 A;  2D8J A;  2JM9 A;  1T3L A;  1WLP B;  2QDL A;  3QWX X;  2RQR A;  3FJ5 A;  1NYF A;  1TUD A;  2DYB A;  2JXB A;  2V1R A;  2ED1 A;  2AKL A;  2C0I A;  2J6F A;  2FPD A;  4Z8A A;  1JXM A;  1ZX6 A;  2D0N A;  3M0T A;  2PNI A;  2SEM A;  2ECZ A;  3C0C A;  1EFN A;  2J7I A;  4HVW A;  2EYX A;  1PRL C;  2GGR A;  1SSH A;  2EW3 A;  5GJW B;  1SRL A;  2I0N A;  4AFU C;  1CKA A;  5I22 A;  3ULR B;  1UHF A;  2KR3 A;  4RTT A;  3R6N A;  4OMM A;  3U23 A;  2AK5 A;  4GBQ A;  3VS7 A;  2CSI A;  4JZ3 A;  2EGA A;  3IQL A;  1KIK A;  1WXT A;  2DBM A;  2FEI A;  3RBB B;  2CUD A;  2JMA A;  2CH4 W;  3EG3 A;  3VS2 A;  2EYW A;  1NM7 A;  1U5S A;  2G6F X;  1ZUK A;  4RTZ A;  1QWF A;  2K7A A;  4J9D A;  2DX1 A;  4OMO A;  3EG0 A;  2K2M A;  2F2W A;  2ED0 A;  1YNZ A;  2H8H A;  3VS0 A;  5ECA A;  4IIO A;  2JS2 A;  3TVT A;  1T3S A;  2KXD A;  1HD3 A;  1QCF A;  1HJD A;  1M27 C;  1RUW A;  1HSQ A;  2DL7 A;  2GQI A;  3I9Q A;  2KEA A;  3EG2 A;  4RTY A;  1OV3 A;  5FWC A;  1AEY A;  1V1C A;  2V1Q A;  2YUO A;  1NLO C;  1Z9Z A;  4JPB W;  1X2K A;  2P4R A;  4CC4 B;  1K9A A;  3KFV A;  3I35 A;  1H8K A;  4AG1 C;  2CH4 A;  2KRN A;  1GCQ C;  1ZUY A;  1JEG A;  4AG2 C;  3JV3 A;  1OPL A;  4Z89 A;  1AWX A;  2SRC A;  1OOT A;  2K6D A;  4K11 A;  2ABL A;  3SHW A;  4KRT A;  1PHT A;  2EYY A;  1UFF A;  1X6B A;  1H92 A;  2BZY A;  1TUC A;  1SPK A;  2DBK A;  2RMO A;  2LJ3 A;  4JZ4 A;  3SEM A;  1BK2 A;  1J3T A;  2ROT A;  1AWW A;  1W6X A;  4A63 B;  1NG2 A;  2OAW A;  2DF6 A;  2GNC A;  4J9H A;  1SHG A;  1MV0 B;  2BZ8 A;  3QWY A;  5IHI A;  1FMK A;  2KT1 A;  1ZSG A;  2DL3 A; 
#chains in the Genus database with same CATH topology
 4EIK A;  4C0G A;  2AZS A;  4IUV A;  3D7S B;  4RG2 A;  4II1 A;  3H0I A;  4RTU A;  1K4U S;  1X69 A;  3GNF B;  2DTH A;  1VYT A;  3FEO A;  4PJO E;  2XD0 A;  1VQ7 T;  2QDY B;  3JAM E;  3TSW A;  1BIB A;  4KH1 B;  2JTM A;  2Z0W A;  4X34 A;  4PJO F;  3O8V A;  3LGF A;  5DM7 R;  4JJC A;  4LUE A;  4FSX A;  4B9X A;  2BTT A;  4PJJ A;  2EQK A;  3PMT A;  2RK2 A;  1B07 A;  2EIF A;  3M0S A;  4LXC A;  4OMF B;  1SF9 A;  1I07 A;  1C1A A;  4FL6 A;  1K73 R;  2WSC E;  2XDD A;  3QHS A;  4OGE A;  2LC4 A;  3JCM h;  3VKI A;  3JB9 I;  2QGG A;  4B9W A;  3OYL A;  2E41 A;  2VAS A;  2EGC A;  1S72 Q;  2FPF A;  3QO3 A;  1LPL A;  3EGX A;  2KMT A;  3PIO A;  3VYG A;  2KT8 A;  1YI2 T;  5IXB A;  3UT1 A;  2CP0 A;  4C8Q D;  1VQP T;  1U1T A;  3HRS A;  1YHQ Q;  1MMG A;  1W2B P;  3JSC A;  3EG9 A;  5LL6 S;  1RAI B;  1X6G A;  3CD6 T;  2EPD A;  4FW1 A;  1ARK A;  3WXM B;  4C0Z A;  3EG9 B;  1XJW B;  1MV3 A;  3OYK A;  1W1F A;  1VQ7 A;  4J9I A;  3CCE Q;  4M75 B;  2DTI A;  1M9S A;  2DIL A;  3ZL7 C;  1RLQ C;  3G4S A;  1Y0M A;  3E19 A;  3MEU A;  1PNJ A;  3NGP A;  1PSF A;  2IVW A;  2RJD A;  3O5Z A;  4M75 F;  2HSE B;  3L2V A;  4M7A F;  3G1J A;  3FDR A;  3CPW P;  2KRM A;  2EAY A;  2RO0 A;  1UHC A;  4X9D A;  2CSQ A;  2VUB A;  2OX7 A;  1VQN A;  2FRY A;  5D7U A;  3ZBD A;  4JUV A;  1PKT A;  4TVR A;  1ZBJ A;  2EYZ A;  4DEX A;  3HP9 A;  3LW5 E;  5IN1 A;  1FYN A;  4OB2 B;  1WFW A;  3VS5 A;  4OGC A;  4FM4 B;  3BFM A;  5CKH A;  1NEG A;  5FU7 B;  3RDV A;  1YBY A;  3JCM b;  1YP5 A;  2MMP A;  5IHK A;  1GFD A;  3CPW S;  2NLU A;  2NWM A;  1WDX A;  1VQO T;  4XU0 A;  1K8A R;  1FWZ A;  5GAO l;  3H9N A;  4AFQ C;  1VQK T;  1KQ1 A;  1YJ9 Q;  2O9S A;  2RQV A;  2PUO B;  2F69 A;  1VQ6 Q;  3X24 B;  1Q7Y C;  1WQW A;  4PLI A;  1FMW A;  2JMC A;  1IRE B;  1VA7 A;  1YN8 A;  4E7S A;  5GAN 8;  2K3Y A;  3H8Z A;  2EBP A;  2CKK A;  3UA7 A;  1RAG B;  4BD3 A;  1OX9 A;  2P0K A;  1WXB A;  2Y4X A;  2XMF A;  5FRM A;  1UDL A;  1PWT A;  3AT1 B;  2VXE A;  2RHU A;  1KG1 A;  2KYB A;  2AZV A;  3MHX A;  3L2W A;  2IIM A;  2L3P A;  3G71 Q;  3OS1 A;  4HCK A;  3SWN B;  1VIE A;  4QVZ A;  1M8M A;  3CD6 A;  1XTD A;  3T9N A;  5IHN A;  1WXU A;  1S1N A;  1U1S A;  3VRY A;  3CD6 Q;  4J9B A;  3MP6 A;  1M30 A;  1OZ2 A;  2D8H A;  1E6H A;  1YJN A;  3SFM A;  3L2U A;  3CCE T;  2VWF A;  2RI5 A;  4AFS C;  2XK0 A;  2F5T X;  2EKO A;  2A36 A;  2VYT A;  5GJV B;  2M51 A;  4C92 A;  2HMA A;  3OW2 A;  3DB4 A;  1KQS A;  3CCS A;  1MGQ A;  5GAO q;  2K3X A;  2FZC B;  2FZG B;  3M0P A;  1M3A A;  2RI3 A;  4BE0 A;  4PJM A;  1OI1 A;  1FMV A;  3PMI A;  3CXC S;  3VS4 A;  4J9C A;  4RMO A;  1O75 A;  5FLX E;  1SRM A;  2XID A;  4RTX A;  1ZUU A;  1YJW T;  4PFO A;  3LWH A;  4WCI A;  1WIE A;  3M59 A;  3UPU A;  1BYM A;  1WYX A;  3EG1 A;  4M7A A;  1RLP C;  1YFN A;  3REB B;  5KYW A;  4JRI A;  3HRT A;  4KUL A;  2LMJ A;  4XTZ A;  4DBQ A;  3OS5 A;  4JRQ A;  2LT1 A;  2LRQ A;  3PE0 A;  2LQN A;  3X25 B;  4NL3 A;  1JRI A;  3HTR A;  2LTO A;  2HKN A;  2YLB A;  2D1X A;  1KSW A;  2ZPB B;  2LNH B;  1Q82 U;  2C0T A;  1UUE A;  4QQG A;  2CP7 A;  5I2M A;  2LNV A;  2PQW A;  4FYV B;  4BI4 A;  1CKB A;  1UGS B;  2VXF A;  4M77 A;  2ZCF B;  4CI0 C;  2ZPI B;  2JM9 A;  1I4K 1;  1NPR A;  4IUU A;  1T3L A;  4M7D G;  4KUD K;  1UB4 A;  2ZAE A;  2LT4 A;  2O4X A;  2X4W A;  2NUP A;  2QDL A;  3QWX X;  5C0M A;  3JCM e;  3JB9 F;  2AKL A;  1D0Z A;  2C0I A;  2J6F A;  2COY A;  3UWN A;  2SEM A;  1IXD A;  3L2Q A;  2JTF A;  1PRL C;  2QQA A;  4OF1 A;  4Z02 A;  5GJW B;  1SRL A;  2OAU A;  3QBY A;  4OB0 B;  2I0N A;  4AFU C;  3L2R A;  1CKA A;  1JJ2 S;  4A4G A;  5LJ3 f;  4M7A B;  2KR3 A;  4RTT A;  1VQ7 Q;  3R6N A;  3NTI A;  1VQ4 T;  3U23 A;  4GBQ A;  4RKU E;  2V26 A;  3AHU A;  5LJ3 d;  2OTL Q;  2DBM A;  1I5O B;  1VQ4 A;  2LX9 A;  2CH4 W;  4XAX B;  3CCL Q;  3EG3 A;  1QQJ A;  1Y7X A;  1U5S A;  4PKC C;  4RTZ A;  1QWF A;  3A5Z B;  4N4H A;  2DX1 A;  2NYS A;  4C8Q E;  4OMO A;  2DXB A;  1YNZ A;  3CC7 T;  1WHH A;  2DPP B;  2H8H A;  4F7U B;  4PL6 A;  1KC8 C;  5ECA A;  2MI6 A;  3DKM A;  4IIO A;  2RHY A;  2VGN A;  2ZPH B;  3WVE B;  1T3S A;  1HD3 A;  1M27 C;  3OMG A;  2NUT A;  2IPO B;  3P8H A;  4X9C A;  4RTY A;  2RI2 A;  4FIB A;  4KGV B;  5GAN 7;  2HNI A;  1K73 U;  4JPB W;  2JUF A;  5J39 A;  2DVE A;  1K9A A;  4AG1 C;  1K9M R;  4FYX B;  2QAS A;  3MET A;  5CAI A;  2CGH A;  3RKY A;  2SRC A;  4K11 A;  5DY9 A;  3CPW A;  3EH2 A;  2HQE A;  2VC8 A;  3SHW A;  1PHT A;  2B8A A;  2RMO A;  2LJ3 A;  4RCB A;  1WQ7 A;  1WHJ A;  4XQ3 A;  4JZ4 A;  1J3T A;  5CKE A;  4M7A D;  2MYS A;  3BDU A;  4J7I A;  3MO8 A;  2OAW A;  1FX7 A;  3DLM A;  4XTW A;  2DF6 A;  4JRK A;  4GLK A;  4PJO G;  2EFI A;  2MWP A;  3HHT B;  3CCM A;  1QVF A;  1OU9 A;  1RAB B;  2BZ8 A;  5IHI A;  2DEQ A;  2XU8 A;  2QG9 B;  4J6Y A;  3FJP A;  4KGX B;  2FL7 A;  4FYW B;  2CZ6 B;  2EQU A;  3REA B;  5GAN f;  1RAE B;  2QK0 A;  1YJ9 T;  1VQL T;  1YCS B;  2EVR A;  2VVK A;  3CC2 Q;  3TCJ A;  2DJQ A;  4EPC A;  5LJ5 d;  3CCU T;  2DA9 A;  1QCN A;  3E2U A;  4E7I A;  2JVV A;  3JB9 H;  3JCM c;  1D1C A;  1RI9 A;  4A4K A;  2HBW A;  4BDZ A;  2J05 A;  1YIT T;  5LJ5 f;  3CC2 T;  2A37 A;  2DM1 A;  4JDS A;  3CC4 T;  2K4Y A;  3OB9 A;  1BI3 A;  1JO8 A;  3M53 A;  1K8A U;  4WTO B;  3VYH B;  3LYI A;  2L2P A;  5AYF A;  2F2X A;  1YJ9 A;  4V2S A;  3JCM Q;  4F17 A;  1A0N B;  4DEY A;  1CSK A;  2GFU A;  1YJN T;  2BKD N;  3A8G B;  1B34 B;  2XG8 D;  2MCN A;  1AWO A;  1BIA A;  2MPX C;  3GOX A;  1B7T A;  4HXJ A;  1R8O B;  3F70 A;  5KE2 A;  3ASK A;  1AWJ A;  2LCS A;  1SG5 A;  3P8B B;  3VS3 A;  1IZ6 A;  2DE0 X;  4ZN3 A;  4JS4 A;  3S6W A;  4C8Q B;  3JCM d;  1OQK A;  5GAN h;  1JU5 C;  5KYU B;  1E7O A;  3OW2 P;  2RQU A;  3INZ A;  1KQS P;  4E7L A;  2DER A;  2P0Q A;  4C5H A;  4A4F A;  1OZ3 A;  4F7U G;  5CQX A;  4F04 B;  1D3B A;  1I0C A;  2K9G A;  2QQR A;  2XIC A;  3QJ6 A;  1Q82 C;  1AT1 B;  1NJI U;  3THK A;  3HPW A;  2MWO A;  4VUB A;  2JOY A;  2CYZ B;  2RNA A;  4C5G A;  4OVA A;  2YT6 A;  3CMA A;  3CCQ A;  1IGQ A;  2X4Y A;  2X35 A;  1D3B B;  5EG2 A;  3PT9 A;  2KSS A;  1N8R C;  2KDS A;  3MKD A;  3RKX A;  3CBM A;  1RI0 A;  4P5N A;  2L0A A;  1K76 A;  3CME Q;  1NPP A;  3A8H B;  1EIF A;  3CCV Q;  2W10 A;  3J7A F;  1BCO A;  1M1G A;  2J6K A;  3S3N A;  1BB9 A;  3QPH A;  1IHV A;  3CPF A;  1VQO Q;  3Q1J A;  1QVP A;  2JS0 A;  3CCV T;  4ATO A;  3EGD B;  2FYK A;  1MNE A;  5GMK h;  1QVG S;  4C5E A;  5HK3 A;  2DK3 A;  5GAM h;  2O31 A;  4PJO C;  1Y07 A;  2M02 A;  2COW A;  2D0Q B;  2DL4 A;  4M75 E;  2LQW A;  4RTV A;  2K79 A;  2O4X B;  3L1A A;  3JCM V;  3ZEH A;  2RHI A;  2RQT A;  3CCJ A;  4ZNX A;  4A53 A;  3JCM J;  2W0Z A;  1U3O A;  3A8L B;  3H6Z A;  4D6W A;  3OYM A;  4F14 A;  4AFZ C;  1M90 U;  4M77 D;  2O88 A;  3CCQ Q;  5FWB A;  4HT8 A;  2L3R A;  1B3Q A;  1X27 A;  2O9V A;  5GAO n;  3MEW A;  2ZPG B;  4OMP A;  3CQT A;  1GXI E;  2DXU A;  4ESR A;  5GAO m;  2E12 A;  4JJD A;  1IO6 A;  2ENM A;  4FU6 A;  2YWW A;  2NUT B;  2GBQ A;  4XU2 A;  1Q86 U;  4ORZ A;  4CC7 A;  1EZZ B;  1NBE B;  1TUG B;  4KUI A;  1N9S A;  4M4Z A;  2QQ9 A;  4M7D B;  4L5G A;  1ABO A;  3RIR A;  2ROL A;  3BDL A;  4LDY A;  2CP6 A;  1C6V X;  3PGG A;  1JQQ A;  2ZZD A;  3R6O A;  2H3E B;  3KUF A;  2KVQ G;  1VQ6 T;  1JB0 E;  2QGF B;  2KXC A;  1M1F A;  3HFO A;  4J83 A;  5KYN A;  2DXT A;  2CZ7 B;  2RF0 A;  2DLP A;  1R0C B;  2JT4 A;  3H41 A;  2ZPE B;  1XQH A;  3MCA B;  3CCR T;  2BUD A;  1AOJ A;  1LVK A;  4FYY B;  1VQ6 A;  1WJR A;  1H64 1;  1WI7 A;  3VRZ A;  3UA6 A;  2HDA A;  4LUD A;  2GF7 A;  2RHX A;  4OP0 A;  2PU9 B;  3M0R A;  1TTH B;  4N4G A;  3TSZ A;  1UGV A;  3G71 T;  2JW4 A;  4PJL A;  1Y57 A;  1O9S A;  1NEB A;  5GMK i;  5D6X A;  4C92 C;  1BBZ A;  4AMC A;  4L6V 5;  1UEC A;  1AZE A;  2E3I A;  3OYG A;  1WA7 A;  1PCX A;  4IKF A;  4FT2 A;  3CC2 A;  1F1B B;  2P4T A;  3HFN A;  1WHM A;  1BI0 A;  2YUQ A;  1I81 A;  2DRM A;  3NHN A;  2DZC A;  5HKC A;  1WPY A;  2YRD A;  1VQM T;  2OJ2 A;  4BY6 B;  5GMK l;  9ATC B;  4N0A A;  4M75 A;  3NPF A;  1QLY A;  1KJW A;  2OTJ Q;  4OB1 B;  2WAC A;  1I5L A;  3CCU A;  5GMK e;  5KCH A;  3NFC A;  1QVF P;  2QXF A;  1RAF B;  3I56 T;  2JXB A;  2V1R A;  4MDX A;  2FPD A;  2D0N A;  2ECZ A;  1EFN A;  2J7I A;  4HVW A;  2EYX A;  1G5V A;  1IRX A;  2GGR A;  2X51 A;  3FC3 A;  4HCC A;  5FRN A;  3X28 B;  1YJW A;  2RHZ A;  3EFS A;  2R58 A;  1YIJ T;  2PVD B;  3GNG A;  3V7C A;  4OMM A;  2QQB A;  2HAX A;  2CSI A;  4RG8 A;  5GMK j;  4JZ3 A;  3JCM X;  1Q86 C;  2EGA A;  1KIK A;  1X01 A;  4CRI A;  3EGD A;  2X4J A;  1YIJ Q;  1TS9 A;  3VS2 A;  3X20 B;  5GAO p;  1NM7 A;  2K5L A;  1VQ9 Q;  2R5M A;  4M75 G;  3M58 A;  4J9D A;  1ZQ1 A;  1D1A A;  2AHJ B;  4M7D A;  2R57 A;  3CCL T;  2CZ0 B;  3JRZ A;  4ME7 A;  1HJD A;  4DBR A;  1HSQ A;  1M90 R;  4C8Q C;  1ACM B;  2YXY A;  3EG2 A;  4ELZ C;  1AEY A;  3SWN C;  5LJ5 g;  4MZP A;  1BI1 A;  4BI8 B;  2G3R A;  5CKB A;  3JB9 J;  2YUO A;  2V1Q A;  1M1K R;  1M8V A;  4A4E A;  1JJ2 A;  1PG5 B;  3QZ5 B;  3M55 A;  2P4R A;  4CC4 B;  1LJO A;  3I35 A;  1ZSZ B;  1VQ5 T;  3RMS A;  1ZUY A;  3MEA A;  1AWX A;  4M77 F;  3G6E A;  1TU0 B;  4HCB A;  1H92 A;  2BZY A;  4AT1 B;  2DBK A;  1RAC B;  4M77 E;  4XTY A;  1R77 A;  3QII A;  2DD4 A;  4BE2 A;  3VUB A;  4FW2 A;  1BK2 A;  4M7A G;  5GAN 2;  1W6X A;  1K8A C;  3FB9 A;  4PJO D;  5GAN 4;  4N0A C;  3M57 A;  4LDV A;  4J9H A;  1YHQ A;  1MV0 B;  1IHW A;  3BE3 A;  2HKQ B;  5D6W A;  5LJ5 j;  1Q95 G;  5I21 A;  2DFU A;  3G7Z A;  2RJC A;  1G3Y A;  1YIT Q;  5FU7 C;  3HSB A;  3C12 A;  3M5A A;  2YSQ A;  3OYJ A;  4M78 C;  1X2Q A;  5M9O A;  1YIT A;  1NZ9 A;  3OY9 A;  1Z9Q A;  2HQH A;  4E7J A;  1M3B A;  3CCJ T;  2DL5 A;  2AIR B;  1Q81 U;  4DQ2 A;  1S72 T;  1ZBX A;  2QI2 A;  2QAZ A;  3RR6 A;  5HY6 A;  3CCV A;  2E1H A;  2VGM A;  1OPK A;  3CBP A;  4OML A;  5KYY A;  4OMN A;  2VB6 A;  5LJ5 h;  5CIU A;  2J06 A;  1VQ9 T;  4M7D F;  2KE9 A;  4GLM A;  2EQJ A;  4WF2 A;  1QVG A;  1AVZ C;  2KK4 A;  5AT1 B;  1PSE A;  1E6G A;  1SEM A;  2HSP A;  3PFS A;  2GQV A;  4LE9 A;  3CBO A;  3CXC A;  4F7U F;  1N6A A;  5LJ3 j;  4MZM A;  5IT9 E;  1TXQ A;  2WSE E;  2HL3 A;  1WHG A;  5FU6 C;  3OA6 A;  5L23 A;  2JNG A;  2YDL A;  1WJQ A;  2KQW A;  1PM3 A;  2C0O A;  2QYZ A;  3QG1 A;  1VQK A;  2E3H A;  3HL8 A;  1X75 C;  3CMA T;  1M4Z A;  1YI2 Q;  1H3H A;  3P8D A;  3CCE A;  3OBY A;  1YHQ T;  1G3T A;  2QTV A;  4LDX A;  1GCQ A;  5J3B A;  1G8X A;  2RA2 A;  2CDT A;  1AHJ B;  3G71 A;  2E5K A;  2LCC A;  3TRE A;  3M0U A;  2RJF A;  1UJ0 A;  2E6N A;  4DOW A;  3CCM T;  5L8R E;  3MP1 A;  3S3O A;  5EC7 A;  1KHC A;  2F1L A;  3V7S A;  3VS6 A;  1Y96 B;  1G2B A;  4D8D A;  4Q5W A;  1VQN Q;  3QDF A;  2GFA A;  2X3X D;  1OYX A;  3QSU A;  3I55 A;  1KC8 R;  1YWO A;  4KH0 B;  4DBH A;  4J9F A;  5KE3 A;  4OB3 B;  4HT9 A;  4XTU A;  5HK0 A;  1KFZ A;  1KD1 R;  1RAD B;  1G83 A;  2K5I A;  5IAY A;  1OX8 A;  1N5Z A;  2RB6 A;  4C92 F;  5KCO A;  2E64 A;  5HCK A;  3I5S A;  2HQX A;  3M54 A;  4O6J A;  1M1K C;  4BB7 A;  1QWE A;  3HKS A;  4JJB A;  4XK8 E;  2BZX A;  3M56 A;  4IIM A;  1I8F A;  3GBQ A;  4M7D C;  3M4G A;  4ZN1 A;  2EJG A;  2FB7 A;  2YRC A;  1YI2 A;  2ZGW A;  2BE7 D;  2FRW A;  5A0L A;  1W70 A;  4ZGE B;  3QYH B;  4M7A E;  2LX7 A;  2CS7 A;  2LJ0 A;  4PJN A;  1T0J A;  5DLQ E;  1X43 A;  3V8L A;  3WVD B;  1GCP A;  4M77 G;  2RPN A;  2XKO C;  2L3S A;  4M78 F;  1MMN A;  4A54 A;  5FU6 B;  1FXX A;  1M3C A;  3EHR A;  1PRM C;  3EH1 A;  1MND A;  5LJ3 g;  4F7U A;  1AZG B;  3SDZ A;  2CT4 A;  2F2V A;  2FHD A;  1W2B S;  3NTK A;  5LJ5 e;  3A1P A;  3ZFJ A;  2HCK A;  1NJI C;  2KGT A;  2EQM A;  1NYG A;  3G6E T;  3OW2 S;  1YWP A;  2DET A;  3CMA Q;  2KYM A;  4C92 D;  1EX4 A;  5GAN 3;  3GPL A;  4HVU A;  1KK7 A;  3G6E Q;  3UDC A;  2DVJ A;  2H3J A;  3MEV A;  3VS1 A;  5GMK m;  2K5F A;  2LJ1 A;  3MJX A;  4XU1 A;  1TG0 A;  2YUP A;  4QW2 A;  1QCO A;  2DRK A;  4QT7 A;  3V8J A;  1WX6 A;  1QKX A;  1K1Z A;  2K57 A;  4M78 B;  2DNU A;  2A28 A;  3JCM P;  1M1K U;  2RQW A;  2RN8 A;  1VQ8 A;  5GAN 6;  4J7F A;  1Q7Y U;  2KNB B;  1VQL A;  1MUZ A;  2A7Y A;  5GAM e;  4J5Y A;  4ELY C;  1JJ2 P;  2DMO A;  2EJF A;  4E6R A;  3E9F A;  4X1V A;  1QVF S;  1NLP C;  3OS0 A;  3CC7 A;  3CCQ T;  2FPE A;  2K3B A;  4M77 C;  1GRI A;  2DEU A;  2O2O A;  4BAC A;  3PVL A;  2MK5 A;  2KRO A;  3OYE A;  3N5B B;  4IUQ A;  1PD1 A;  3I56 Q;  2CP5 A;  2YUN A;  2RH2 A;  5D6Y A;  4J9G A;  4LNP A;  1Q82 R;  2E10 A;  2EKH A;  2VKN A;  4PFZ A;  2KY9 A;  4R0K A;  4BI3 A;  5KYU A;  1Q7Y R;  2D8J A;  3QXE B;  3BY7 A;  1ZSZ C;  3PIP A;  1WLP B;  1KD1 U;  3FIF A;  2DYB A;  1JBM A;  1N8R R;  2RD1 A;  3RMQ A;  3RER A;  5GAM d;  1WGS A;  5KYX A;  3C0C A;  2DAQ A;  2X4X A;  2OTL T;  2CZ1 B;  4C92 G;  1SSH A;  4ZTJ A;  4E7K A;  3SD4 A;  2YHT A;  2BE9 B;  1VQO A;  1G3S A;  4FT4 A;  5I22 A;  3ULR B;  2HBP A;  4M78 D;  2Y4Y A;  5GAN e;  1K73 C;  3MPU B;  5LJ3 e;  4EMK B;  3CC7 Q;  3VS7 A;  2PVG B;  1IB8 A;  3EFO B;  3CCL A;  1WZO A;  5KYX B;  2BIV A;  1RAH B;  4DA4 A;  2QA4 T;  1DJ7 B;  4NL2 A;  3RBB B;  2CUD A;  4M75 D;  2EYW A;  1QVG P;  2G6F X;  4ZGD B;  2M9U A;  4PK4 A;  3EG0 A;  2K2M A;  3L42 A;  3JCM g;  2F2W A;  1QP2 A;  3DB3 A;  5DLO A;  2XDP A;  4Y91 A;  3OYI A;  4IUR A;  3BW1 A;  3J81 E;  3FLG A;  1RUW A;  2DL7 A;  4MMK A;  3PTA A;  7AT1 B;  2P84 A;  2EWN A;  1TOV A;  3JB9 G;  4B6M A;  1C0M A;  2E6Z A;  1OV3 A;  5FWC A;  2LQK A;  5GAM g;  1H3Z A;  1V1C A;  4BUG A;  4PLL A;  5A2Q E;  1S72 A;  1Z9Z A;  2KI7 A;  1X2K A;  4M75 C;  3QZ9 B;  1H8K A;  1ZA2 B;  3RES A;  4AG2 C;  2D6F A;  4Z89 A;  2E5Q A;  1OOT A;  3SWN A;  1ZHI A;  3GF5 A;  3M9Q A;  4KRT A;  2EYY A;  1UFF A;  4EMK A;  2L89 A;  1TUC A;  4KBM B;  2ZPF B;  5LJ3 h;  5I2S A;  3SEM A;  1U8R A;  2DZ9 A;  2ROT A;  1AWW A;  1MHN A;  3QJY A;  4A63 B;  3CCM Q;  1NG2 A;  1M2V A;  1KQ2 A;  1D0Y A;  4C92 B;  1TH7 A;  5CKD A;  5GAN 5;  1UGP B;  1N9R A;  3E1S A;  3OYD A;  1SHG A;  4M78 G;  2KT1 A;  1WJS A;  1KHI A;  2EJ9 A;  2KRS A;  4RCC A;  1ZLM A;  1GBQ A;  1GL5 A;  4NOY A;  2M16 A;  2PZ1 A;  4HKE A;  2IG0 A;  1D0X A;  1YIJ A;  4DOV A;  1PC0 A;  4GY5 A;  2CT3 A;  2FG0 A;  1TWB A;  1VOM A;  1YJN Q;  2DD5 A;  1VYU A;  2E70 A;  3OYC A;  1VQ5 A;  1LCK A;  2ATC B;  5GAM j;  2ESW A;  3VJP A;  4M7A C;  2A08 A;  2QA4 Q;  1R0B G;  4O5V A;  3VV0 A;  3A98 A;  3I5R A;  1VQ5 Q;  4EDU A;  4R55 A;  2RK1 A;  3TQ7 P;  3EAE A;  4C0D B;  1JXO A;  3EHQ A;  2JJ9 A;  4QKU A;  1VQP Q;  1QP3 A;  1KQS S;  4M7D E;  4L59 A;  5FW9 A;  1AD5 A;  4D8K A;  1W4S A;  2DKG A;  3OYN A;  2LP5 A;  1HK9 A;  1GFC A;  1VQ8 Q;  1MMA A;  2KBT A;  4C8Q G;  4KT0 E;  3LLR A;  3QUI A;  1Q81 C;  4J8O A;  1PKS A;  1ABQ A;  2M0Y A;  3OYH A;  2OI3 A;  1V76 A;  2V8J A;  1XOV A;  4RTW A;  4OMQ A;  1M90 C;  2PTK A;  1VQN T;  3I55 T;  4JRP A;  4PJO B;  3CEY A;  2FZK B;  2CUB A;  3G4S T;  1K0S A;  2DJZ A;  2M1H A;  1SKU B;  2AT1 B;  1IGU A;  3CME T;  1YCY A;  5CKF A;  2QQS A;  3EFR A;  2FO0 A;  2A0F B;  2Y90 A;  4LDU A;  5KYW B;  3UAT A;  1LNX A;  2D9T A;  8ATC B;  2LVM A;  2CP3 A;  4A4H A;  1VQP A;  3JCM W;  1OU8 A;  4MDW A;  1HXD A;  4HCZ A;  4UC4 A;  3EGU A;  3CC4 A;  2E4H A;  2L5Q A;  4LDW A;  4MZT A;  1RAA B;  1SHF A;  4YTL A;  3KXT A;  3GIB A;  1UG1 A;  4ZTF A;  2E65 A;  2L3Q A;  2LDM A;  3ER0 A;  1SSF A;  3SB2 A;  1T0H A;  1VQ8 T;  2DL8 A;  4MML A;  4N4I A;  4LD6 A;  2O01 E;  3GLX A;  3LX7 A;  1UJY A;  3PVQ A;  1XNI A;  5CO7 A;  1K9M U;  2RM4 A;  4EMH A;  1UEB A;  2GTJ A;  3RKW A;  3E9G A;  4HVV A;  5I11 A;  1UGR B;  2JZ2 A;  3V7R A;  1GBR A;  2HZY A;  1I1J A;  3LGL A;  1Y71 A;  1BCM A;  2HEQ A;  5IH2 A;  3FRN A;  2DIG A;  3RUX A;  5IXF A;  1X6O A;  3G4S Q;  4KGZ B;  3KBG A;  5KYY B;  3H0H A;  4M78 E;  2PUK B;  2J6O A;  2GTO A;  4IUP A;  1Q86 R;  2EGE A;  4RUG A;  3OSV A;  1K0X A;  1W2B A;  2CRE A;  3CME A;  2X9H A;  4E7Z A;  3UF4 A;  1M5Q 1;  4Z88 A;  2VV5 A;  2YRV A;  1N8R U;  5GAO r;  2NUZ A;  2X3W D;  4C92 E;  4LD9 K;  1M2O A;  2JN0 A;  4CC3 A;  1V29 B;  4JS5 A;  4NS5 A;  3TEE A;  4XU3 A;  5CCA A;  2YLC A;  3I55 Q;  4FSS A;  1U06 A;  2LZ6 B;  1HYO A;  3OQ5 A;  4Y92 A;  4M78 A;  2LQ8 A;  3LH5 A;  1WHL A;  3A8M B;  1MMD A;  4FCY A;  5J26 A;  3EGX B;  5KH6 A;  4IUT A;  3URG A;  2MIO A;  3OYA A;  1VYV A;  1RL2 A;  1B34 A;  1VUB A;  1OEB A;  2QTX A;  5A0G A;  2C06 A;  4EMK C;  1K9M C;  2OTL A;  1QW1 A;  3M0Q A;  5CK9 A;  4F16 A;  4R56 A;  3CCR A;  1VQ4 Q;  3VUZ A;  5CVI A;  2AKK A;  4QQ6 A;  2DXC A;  2XI9 A;  3JCM f;  4J6X A;  2QEX T;  4XTX A;  3NMZ C;  2NUP B;  1YJW Q;  1VQK Q;  3OBW A;  1PD0 A;  3CCR Q;  1UE9 A;  3C95 A;  5GAN d;  2RJE A;  4LN2 A;  1Q81 R;  2OTJ T;  1UTI A;  4BE1 A;  4C5I A;  1Y96 A;  3PNW C;  4CC2 A;  3H0F A;  1KD1 C;  4Y28 E;  2MF2 A;  4C0F A;  2P0P A;  1BU1 A;  2JM8 A;  2CP2 A;  5A0D A;  5CR2 A;  1WNL A;  1VQ9 A;  3C94 A;  1P92 A;  3RNJ A;  1QKW A;  2DIQ A;  2V8K A;  2MOX A;  2HD0 A;  4J9E A;  4M77 B;  4ANJ A;  2JTE A;  2EQI A;  2B86 A;  6AT1 B;  4JLG A;  4C8Q A;  1D1B A;  4M7D D;  4ZGJ B;  5GAM f;  3OYB A;  4E7H A;  2RQR A;  3FJ5 A;  1NYF A;  1TUD A;  2XHC A;  2ED1 A;  3CCS T;  4E2F B;  1QMC A;  1VIF A;  1D09 B;  4Z8A A;  1VQM Q;  1BKB A;  1JXM A;  1ZX6 A;  3M0T A;  2PNI A;  3ME9 A;  4QQD A;  3CXC P;  2EW3 A;  1ZA1 B;  2R5A A;  3OMC A;  3VU3 C;  1NE8 A;  2A3L A;  1UHF A;  3QYG B;  2F5K A;  2LCL A;  2PVO B;  2AK5 A;  2FVU A;  3C4S A;  3IQL A;  3OSS C;  4JJN K;  1WXT A;  4HA8 A;  2FEI A;  1BI2 A;  2JMA A;  4EMG A;  4C8Q F;  3GP8 A;  4XTV A;  3HRU A;  1ZUK A;  4JLI A;  2K7A A;  4PJO A;  2COZ A;  3M4Y A;  2EYQ A;  2ED0 A;  5CQY A;  4DBF A;  2WSF E;  2OTJ A;  2I2L A;  3L2Z A;  3VS0 A;  3CCU Q;  1N27 A;  4QVC A;  2JS2 A;  3TVT A;  3NTH A;  2KXD A;  2QA4 A;  3TU4 K;  2QEX A;  1QCF A;  3JB9 D;  2L8D A;  2GQI A;  3I9Q A;  3QDR B;  3I56 A;  1OUL A;  2KEA A;  4BY6 C;  1G3W A;  2GCX A;  3OS2 A;  1VQM A;  2QEX Q;  3CC4 Q;  3DLL A;  3LH0 A;  3QKJ A;  4J6W A;  8AT1 B;  3OYY A;  1NLO C;  2DO3 A;  3CCS Q;  1NJI R;  3KFV A;  2V8I A;  2XDB A;  3OYF A;  1KC8 U;  2CH4 A;  2KRN A;  1GCQ C;  3MP8 A;  3X26 B;  4BDY A;  1JEG A;  3JV3 A;  1OPL A;  4PNO A;  1M2V B;  2K6D A;  3EFO A;  4E47 A;  2ABL A;  2HL5 C;  2K2V A;  4C0D C;  1X6B A;  1UGQ B;  1WHK A;  1SPK A;  5C6S A;  4QVD A;  3J80 E;  1ZSZ A;  5GAN g;  5GAN j;  3V8K A;  4F7U E;  2M0O A;  4PFP A;  2DTO A;  3A8O B;  5FRO A;  2GNC A;  2KAF A;  3S3M A;  1TSF A;  3CCJ Q;  2MAM A;  1LOJ A;  1VQL Q;  3QWY A;  1FMK A;  3LWI A;  2DYI A;  1ZSG A;  2DL3 A; 
#chains in the Genus database with same CATH homology
 2KRS A;  1ZLM A;  1GBQ A;  1GL5 A;  4EIK A;  2PZ1 A;  2AZS A;  2YSQ A;  3H0I A;  3REA B;  4RTU A;  1X2Q A;  1K4U S;  1X69 A;  1YCS B;  2EVR A;  1Z9Q A;  2VVK A;  2DJQ A;  2CT3 A;  2DA9 A;  1VYT A;  2FG0 A;  1M3B A;  3TSW A;  2DL5 A;  1VYU A;  1RI9 A;  2HBW A;  2J05 A;  1LCK A;  4JJC A;  2A37 A;  4LUE A;  2DM1 A;  2ESW A;  2A08 A;  2BTT A;  1JO8 A;  1OPK A;  2L2P A;  4OML A;  2F2X A;  4OMN A;  3A98 A;  1B07 A;  3I5R A;  3M0S A;  2J06 A;  4F17 A;  1I07 A;  2KE9 A;  4GLM A;  1A0N B;  4DEY A;  1CSK A;  1JXO A;  3EHQ A;  1AVZ C;  2EGC A;  2FPF A;  1E6G A;  1SEM A;  2HSP A;  2MCN A;  1AWO A;  4LE9 A;  5FW9 A;  1AD5 A;  4D8K A;  2KT8 A;  5IXB A;  4HXJ A;  2LP5 A;  1GFC A;  1AWJ A;  2LCS A;  5L23 A;  2KBT A;  3VS3 A;  1X6G A;  2EPD A;  2YDL A;  2DE0 X;  1ARK A;  1MV3 A;  1W1F A;  2C0O A;  1PKS A;  1ABQ A;  4J9I A;  1JU5 C;  2M0Y A;  1E7O A;  2DIL A;  2RQU A;  2OI3 A;  3ZL7 C;  1RLQ C;  1XOV A;  1Y0M A;  4RTW A;  1PNJ A;  3NGP A;  1H3H A;  4OMQ A;  3O5Z A;  2PTK A;  1I0C A;  2K9G A;  1GCQ A;  2KRM A;  2CUB A;  3THK A;  1K0S A;  2CDT A;  1UHC A;  2CSQ A;  2E5K A;  2FRY A;  3M0U A;  1UJ0 A;  2FO0 A;  2RNA A;  1PKT A;  1ZBJ A;  2EYZ A;  2YT6 A;  5EC7 A;  4DEX A;  3VS6 A;  1G2B A;  4D8D A;  1FYN A;  1WFW A;  3VS5 A;  3UAT A;  2X3X D;  1NEG A;  1YWO A;  4J9F A;  1YP5 A;  5IHK A;  1KFZ A;  2L0A A;  3EGU A;  1G83 A;  1K76 A;  1GFD A;  2NWM A;  1WDX A;  1N5Z A;  2W10 A;  5HCK A;  3I5S A;  4AFQ C;  1SHF A;  2O9S A;  2J6K A;  1QWE A;  2RQV A;  1UG1 A;  4JJB A;  1BB9 A;  2BZX A;  2L3Q A;  4IIM A;  2JS0 A;  2JMC A;  1T0H A;  1VA7 A;  1YN8 A;  3GBQ A;  2DL8 A;  2EBP A;  1UJY A;  3UA7 A;  2O31 A;  3PVQ A;  2FRW A;  1WXB A;  2DL4 A;  2XMF A;  1W70 A;  2GTJ A;  1UDL A;  5I11 A;  4HVV A;  1PWT A;  2LQW A;  4RTV A;  2K79 A;  2LX7 A;  2KYB A;  2AZV A;  2LJ0 A;  1GBR A;  1I1J A;  2IIM A;  1T0J A;  2L3P A;  2RQT A;  4ZNX A;  1X43 A;  2HEQ A;  5IH2 A;  4HCK A;  1GCP A;  2W0Z A;  1U3O A;  5IXF A;  2RPN A;  4F14 A;  1M8M A;  2L3S A;  4AFZ C;  2O88 A;  5FWB A;  5IHN A;  1WXU A;  3H0H A;  1S1N A;  1B3Q A;  1X27 A;  2O9V A;  1M3C A;  2J6O A;  3VRY A;  2GTO A;  4OMP A;  3CQT A;  3EHR A;  1PRM C;  2EGE A;  4RUG A;  4J9B A;  1AZG B;  4ESR A;  1K0X A;  1M30 A;  2CT4 A;  4JJD A;  2F2V A;  1IO6 A;  2CRE A;  2D8H A;  2ENM A;  1E6H A;  3UF4 A;  4Z88 A;  2HCK A;  2GBQ A;  2KGT A;  2VWF A;  1NYG A;  2NUZ A;  4ORZ A;  4AFS C;  4CC7 A;  2X3W D;  1YWP A;  2A36 A;  5GJV B;  2M51 A;  4CC3 A;  4M4Z A;  2KYM A;  1ABO A;  2ROL A;  4FSS A;  1JQQ A;  1U06 A;  3M0P A;  1M3A A;  4HVU A;  2LZ6 B;  2DVJ A;  3VS1 A;  3VS4 A;  2LJ1 A;  4J9C A;  4Y92 A;  3LH5 A;  2KXC A;  1SRM A;  2RF0 A;  2DLP A;  2JT4 A;  3H41 A;  1TG0 A;  2YUP A;  4RTX A;  1ZUU A;  2DRK A;  4QT7 A;  2MIO A;  1AOJ A;  1WX6 A;  1VYV A;  1QKX A;  1K1Z A;  1OEB A;  1WI7 A;  1WIE A;  4WCI A;  3VRZ A;  2DNU A;  3UA6 A;  2A28 A;  1WYX A;  2HDA A;  3EG1 A;  4LUD A;  2RQW A;  2RN8 A;  3M0Q A;  4F16 A;  1RLP C;  3REB B;  3M0R A;  2KNB B;  2AKK A;  3TSZ A;  1MUZ A;  1UGV A;  2JW4 A;  2DMO A;  2LMJ A;  1Y57 A;  3NMZ C;  4E6R A;  1UE9 A;  1NEB A;  3PE0 A;  4X1V A;  2LQN A;  1NLP C;  1BBZ A;  4LN2 A;  1UEC A;  2FPE A;  2K3B A;  1AZE A;  1GRI A;  1WA7 A;  1UTI A;  2D1X A;  1KSW A;  2LNH B;  2O2O A;  4CC2 A;  3H0F A;  3PVL A;  2KRO A;  2C0T A;  1UUE A;  1BU1 A;  2JM8 A;  2YUQ A;  2YUN A;  2DRM A;  3NHN A;  4J9G A;  4LNP A;  1CKB A;  3RNJ A;  1QKW A;  2EKH A;  2VKN A;  2MOX A;  2OJ2 A;  4J9E A;  4R0K A;  2JTE A;  2EQI A;  3NPF A;  1QLY A;  1KJW A;  2B86 A;  2D8J A;  2JM9 A;  1T3L A;  1WLP B;  2QDL A;  3QWX X;  2RQR A;  3FJ5 A;  1NYF A;  1TUD A;  2DYB A;  2JXB A;  2V1R A;  2ED1 A;  2AKL A;  2C0I A;  2J6F A;  2FPD A;  4Z8A A;  1JXM A;  1ZX6 A;  2D0N A;  3M0T A;  2PNI A;  2SEM A;  2ECZ A;  3C0C A;  1EFN A;  2J7I A;  4HVW A;  2EYX A;  1PRL C;  2GGR A;  1SSH A;  2EW3 A;  5GJW B;  1SRL A;  2I0N A;  4AFU C;  1CKA A;  5I22 A;  3ULR B;  1UHF A;  2KR3 A;  4RTT A;  3R6N A;  4OMM A;  3U23 A;  2AK5 A;  4GBQ A;  3VS7 A;  2CSI A;  4JZ3 A;  2EGA A;  3IQL A;  1KIK A;  1WXT A;  2DBM A;  2FEI A;  3RBB B;  2CUD A;  2JMA A;  2CH4 W;  3EG3 A;  3VS2 A;  2EYW A;  1NM7 A;  1U5S A;  2G6F X;  1ZUK A;  4RTZ A;  1QWF A;  2K7A A;  4J9D A;  2DX1 A;  4OMO A;  3EG0 A;  2K2M A;  2F2W A;  2ED0 A;  1YNZ A;  2H8H A;  3VS0 A;  5ECA A;  4IIO A;  2JS2 A;  3TVT A;  1T3S A;  2KXD A;  1HD3 A;  1QCF A;  1HJD A;  1M27 C;  1RUW A;  1HSQ A;  2DL7 A;  2GQI A;  3I9Q A;  2KEA A;  3EG2 A;  4RTY A;  1OV3 A;  5FWC A;  1AEY A;  1V1C A;  2V1Q A;  2YUO A;  1NLO C;  1Z9Z A;  4JPB W;  1X2K A;  2P4R A;  4CC4 B;  1K9A A;  3KFV A;  3I35 A;  1H8K A;  4AG1 C;  2CH4 A;  2KRN A;  1GCQ C;  1ZUY A;  1JEG A;  4AG2 C;  3JV3 A;  1OPL A;  4Z89 A;  1AWX A;  2SRC A;  1OOT A;  2K6D A;  4K11 A;  2ABL A;  3SHW A;  4KRT A;  1PHT A;  2EYY A;  1UFF A;  1X6B A;  1H92 A;  2BZY A;  1TUC A;  1SPK A;  2DBK A;  2RMO A;  2LJ3 A;  4JZ4 A;  3SEM A;  1BK2 A;  1J3T A;  2ROT A;  1AWW A;  1W6X A;  4A63 B;  1NG2 A;  2OAW A;  2DF6 A;  2GNC A;  4J9H A;  1SHG A;  1MV0 B;  2BZ8 A;  3QWY A;  5IHI A;  1FMK A;  2KT1 A;  1ZSG A;  2DL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...