2VKNA

Yeast sho1 sh3 domain complexed with a peptide from pbs2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
b'DNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN SSU81
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vknA00
2DX1A 3M0UA 1TG0A 1GCQC 2ABLA 2FRYA 4JJBA 3NGPA 3VS2A 1AWWA 2ED0A 5I11A 2LNHB 2ECZA 3M0RA 2M0YA 5IHKA 1M27C 2MCNA 1SPKA 2GTJA 2YT6A 4RTVA 2HEQA 4F14A 1Y57A 1UG1A 1MV0B 1JXMA 1YNZA 4Y92A 2D8JA 2EW3A 2ENMA 3REAB 3UATA 3ZL7C 2CDTA 1ARKA 4GLMA 2F2XA 1PNJA 4Z88A 5IHIA 1UGVA 2FPFA 2RF0A 3VS5A 2AKLA 1AWJA 1IO6A 1K0SA 2X3XD 3KFVA 1KFZA 2KRSA 2YSQA 3THKA 1MV3A 2JTEA 4WCIA 2CH4A 1T3LA 3QWYA 1XOVA 1LCKA 1JEGA 4GBQA 2SEMA 1VA7A 2A36A 3NMZC 3EHQA 2F2WA 1YN8A 2GTOA 2DL5A 4RTYA 3U23A 4F17A 1UE9A 2LJ0A 2F2VA 3ULRB 3C0CA 2LX7A 2DYBA 1AZGB 1FYNA 1WXTA 4OMOA 2DA9A 2G6FX 4AFUC 4RTZA 4J9EA 1S1NA 1VYUA 2AZVA 1GCQA 2MIOA 1JXOA 1I0CA 1UDLA 1BB9A 1YCSB 4K11A 4CC3A 3I35A 4J9BA 1W6XA 5L23A 1WIEA 2J7IA 1TUCA 2W10A 2FPEA 2X3WD 1UFFA 1GBRA 2KXDA 1AD5A 4J9IA 3EHRA 3I5RA 4RTXA 1T0HA 2FO0A 3M0PA 1SHGA 2MOXA 2CUDA 2DE0X 2O88A 2KRNA 3LH5A 4LUEA 1NLPC 1M3CA 4HCKA 2DNUA 3VS1A 2L3SA 2L3PA 2O31A 2NUZA 4HVWA 4HXJA 1K0XA 2VKNA 2D8HA 2GQIA 1WI7A 2YDLA 1Z9ZA 2EQIA 1GCPA 2FRWA 3EG1A 4DEYA 2AKKA 4J9HA 4JJCA 1RUWA 1PHTA 2LQNA 1H8KA 1TUDA 2DMOA 2DL8A 2EGAA 4HVVA 1GBQA 1W70A 1K76A 1WLPB 2BZXA 2GGRA 2JS0A 1GFCA 2EYXA 2O9SA 4OMQA 1AVZC 1JQQA 2A08A 2KGTA 1NLOC 1ZBJA 1UECA 2DBKA 2C0TA 2DJQA 4FSSA 5IXFA 2K6DA 1CKBA 5I22A 1PRLC 1WX6A 2J06A 2DM1A 3M0QA 2O9VA 4J9DA 2VVKA 2FG0A 1SRMA 1UUEA 1ZX6A 2NWMA 1WDXA 2W0ZA 1VYVA 2DL3A 2HSPA 2L0AA 1AWXA 2DRMA 1T0JA 4RTTA 1JO8A 3EG2A 2V1QA 2LQWA 5HCKA 3EG3A 1GRIA 1YWOA 4KRTA 2DLPA 4HVUA 2CUBA 2EGEA 2RQTA 1WFWA 1SRLA 3PVLA 3I9QA 3QWXX 2JM8A 1KIKA 2K9GA 2LJ1A 2OJ2A 1VYTA 1E7OA 2OI3A 1A0NB 1K9AA 1U06A 2PTKA 1X27A 2CT4A 2A28A 1UJYA 2KYMA 2K3BA 5GJVB 1Y0MA 2SRCA 4D8KA 4JPBW 4M4ZA 2KYBA 5IXBA 1U3OA 4LUDA 4OMPA 2ROTA 4D8DA 2KE9A 2JM9A 2EYYA 3VRZA 1ZUUA 2KROA 3EG0A 4EIKA 4J9CA 2LJ3A 5FWBA 3VS7A 3NPFA 2B86A 1B3QA 2YUOA 3M0TA 1UJ0A 1V1CA 4AFQC 1PKSA 3VS3A 1UHFA 2ESWA 1SHFA 1ZUYA 2FPDA 2XMFA 4LE9A 3VS4A 1X2QA 3VS0A 1AEYA 4JJDA 1HSQA 1X43A 2JT4A 2YUPA 4IIMA 1K4US 2HDAA 1KSWA 1QKWA 2AZSA 2DBMA 2IIMA 3SHWA 2OAWA 1KJWA 1NYGA 3FJ5A 2YUQA 4DEXA 1RI9A 1HJDA 5ECAA 3VS6A 2RN8A 2GNCA 1M3AA 2AK5A 2DF6A 5FW9A 4RTWA 1H92A 3UF4A 2EYZA 2BTTA 3TSWA 4CC7A 1BU1A 2RQVA 4A63B 1M3BA 4CC2A 2CH4W 1YWPA 1BK2A 1M30A 1OOTA 2EPDA 2JS2A 1JU5C 1WYXA 2V1RA 3RNJA 2JMCA 3H0HA 2KT8A 2KR3A 5IH2A 1NYFA 2J05A 1OPLA 2H8HA 3TSZA 1PRMC 3UA7A 3PE0A 4J9FA 1ABQA 1G83A 1J3TA 1W1FA 2PNIA 2KXCA 1EFNA 1GL5A 1E6HA 2JXBA 2BZ8A 1K1ZA 2KT1A 1UTIA 2KBTA 1H3HA 2ROLA 1U5SA 3M0SA 1X6GA 1SEMA 5IHNA 1N5ZA 2L2PA 2GBQA 2EVRA 2HCKA 2PZ1A 2YUNA 3H41A 3IQLA 3NHNA 2KEAA 1NM7A 3I5SA 2ED1A 2RMOA 4IIOA 4QT7A 1AZEA 1ZLMA 2DL4A 2EYWA 3JV3A 1ABOA 5FWCA 2K2MA 1QWFA 4F16A 2KRMA 4RUGA 1X6BA 2JMAA 2P4RA 2DILA 2LMJA 2RNAA 2E5KA 1QKXA 4X1VA 3RBBB 1QCFA 2FEIA 4ESRA 4JZ4A 2CT3A 1OV3A 1E6GA 1PWTA 1BBZA 1FMKA 1QWEA 4AG1C 4Z8AA 1B07A 4Z89A 1I1JA 2D0NA 2JW4A 4JZ3A 3EGUA 4OMMA 2HBWA 2D1XA 2EKHA 3PVQA 4AFSC 1RLQC 1Z9QA 2LCSA 2EGCA 1HD3A 1UHCA 1ZSGA 4CC4B 1AOJA 2L3QA 2J6FA 2J6OA 3H0FA 4ZNXA 2LP5A 4OMLA 2VWFA 2C0IA 1SSHA 4R0KA 2DL7A 1CKAA 1NG2A 1WXUA 2CSQA 3VRYA 1RLPC 1OEBA 2RQWA 1G2BA 1WA7A 4J9GA 3CQTA 4AFZC 1YP5A 2C0OA 4RTUA 2BZYA 5EC7A 4E6RA 1NEGA 2LZ6B 4OMNA 4AG2C 4LN2A 1I07A 3H0IA 1X69A 3O5ZA 2RPNA 2K79A 1AWOA 3TVTA 1X2KA 2DRKA 4ORZA 2O2OA 2CREA 1T3SA 2J6KA 3A98A 1GFDA 5GJWB 2QDLA 3UA6A 2KNBB 1CSKA 1WXBA 1ZUKA 3SEMA 1MUZA 2I0NA 1PKTA 2DVJA 4LNPA 1M8MA 2CSIA 3R6NA 1OPKA 3GBQA 1QLYA 2RQRA 2RQUA 2K7AA 3REBB 2EBPA 2M51A 2A37A 1NEBA
chains in the Genus database with same CATH superfamily
3V8JA 3JCMg 5KYXA 3MEVA 3VS2A 4PL6A 1AWWA 1WHMA 3C95A 2EKOA 1QVFP 2E4HA 1V29B 2V26A 5CO7A 2M9UA 3GOXA 2YT6A 4RTVA 1W2BS 5AT1B 1JJ2P 2F1LA 3RMQA 5HY6A 2CDTA 4OB2B 5IT9E 1PNJA 1TUGB 4XK8E 5J39A 4IURA 1D0XA 1UGVA 2FPFA 1AWJA 1BIAA 3N5BB 2X9HA 2X3XD 3KFVA 1KFZA 1IREB 2KRSA 1KHCA 4DOVA 1FMVA 2CH4A 3OQ5A 5C0MA 2CP7A 1XOVA 3OW2S 1OZ2A 1QW1A 1VA7A 5LJ3d 3WXMB 3EHQA 5GAOl 3SWNC 1C1AA 1NPRA 2Y4YA 2QASA 4OB0B 4F17A 1UE9A 2E6NA 2F2VA 4EMKA 1QCOA 5LJ5h 1AZGB 1WXTA 1YCYA 2NUPB 4AFUC 3I55Q 4RTZA 2B8AA 1EIFA 2XK0A 4J9EA 1I8FA 3M56A 1GCQA 3QPHA 2QEXA 2MIOA 1XTDA 3J81E 3QDFA 2WSEE 4K11A 3I35A 4J9BA 1M2VB 1LVKA 4EMGA 3RIRA 2W10A 3RKXA 4M7DA 4ZGDB 2X3WD 2HKQB 2IG0A 1AD5A 5CKFA 3EHRA 3CCSA 3D7SB 1H3ZA 1UGQB 1M1KR 1SHGA 1RL2A 2YLBA 1SKUB 4C5EA 3PGGA 4B6MA 3LH5A 3RMSA 3PIPA 4M77B 3JCMf 2E5QA 3VS1A 1UGSB 2NUZA 4HVWA 3GLXA 4HXJA 4PJOF 2GQIA 1WI7A 5FRMA 1Z9ZA 1OZ3A 2EQIA 1NE8A 1R8OB 4C8QA 5CQYA 4C5GA 4DEYA 4J9HA 1PSFA 4A4FA 1KC8C 1TUDA 2DMOA 4XTVA 2EGAA 2PVOB 1VQ8T 1IRXA 2EJGA 2G3RA 5KYWB 3OYDA 1NLOC 1ZBJA 1UECA 3LH0A 2DBKA 4BUGA 2R5AA 2DJQA 4JS5A 5IXFA 3ZEHA 2VYTA 1CKBA 2J06A 1YIJT 1YHQA 3OS1A 2K57A 3NTIA 2FG0A 1UUEA 4MDWA 4C0DC 3G4SQ 1QVGA 2BUDA 1VYVA 1F1BB 2DL3A 4M7DG 1SF9A 1YI2T 1ZSZA 4PJOD 3HRSA 1JO8A 4Y91A 3EG2A 5HCKA 1O75A 4PJOE 1YWOA 3M55A 2CUBA 5KCHA 2V8JA 2E41A 1WFWA 2E1HA 1VQ6T 1VOMA 1VQPT 5GAN6 2DETA 1HXDA 1M90U 4PLLA 3JB9F 4PJLA 4M78F 2K9GA 1VYTA 3P8DA 4EMHA 1KD1U 1YJNQ 1I5LA 5GAOm 1X6OA 2E64A 2A28A 3G71T 2RJCA 5IXBA 1NPPA 3FIFA 5GAMg 4OMPA 2JM9A 2EYYA 4B9WA 1VIFA 4LDVA 3EH1A 4EIKA 3GIBA 1I4K1 2RA2A 1BYMA 3JCMQ 2OTLT 3NPFA 4FU6A 4E7JA 4M75C 5J3BA 3M0TA 1UJ0A 2O4XA 1O9SA 4OVAA 1BI0A 4P5NA 4AFQC 1UHFA 4KGXB 2ESWA 3CXCP 1JB0E 2VASA 5CIUA 4JJDA 4IIMA 3JCMV 4ME7A 4M78E 1KC8R 1QKWA 3KUFA 1R77A 1W2BP 1VQ5T 3QBYA 3SHWA 3OYYA 2I2LA 3CMAT 1HJDA 1UGRB 1U8RA 2LRQA 1YJ9A 5LJ5j 3V7SA 3VJPA 1WZOA 3CCRQ 3ZFJA 3E2UA 3G1JA 2KAFA 1SG5A 1BIBA 3OW2P 3MEUA 2CP0A 4NL2A 4HT8A 2F69A 3C4SA 2BTTA 4CC7A 2P4TA 2P0KA 3I56A 3MKDA 4CC2A 1WJSA 1IHVA 1YWPA 1OOTA 4OGEA 5CKBA 1VQKA 3M5AA 1WYXA 3QSUA 4M7AC 2DTIA 8ATCB 2KT8A 2XD0A 2J05A 3L2UA 1D1AA 2E12A 5CR2A 2CZ6B 3PE0A 1RAGB 1W1FA 4J6WA 2RHYA 3EG9A 2R5MA 4LD6A 3UDCA 1MGQA 1YITA 1H3HA 1U5SA 3M0SA 4M77D 1N5ZA 3G6EA 4M77E 2PZ1A 3IQLA 1TXQA 3I5SA 4EMKB 4ELYC 1AZEA 3QUIA 1WHJA 1QVPA 2K2MA 3S6WA 2KRMA 4XAXB 4E7SA 3X24B 2E5KA 1QKXA 4X1VA 2RK1A 4FL6A 3P8BB 1SSFA 3CD6Q 5LL6S 1PWTA 4IUUA 2RH2A 2CS7A 4OF1A 5CKEA 4Z89A 1PC0A 1ZA1B 1Q86R 3HKSA 2JW4A 4OMMA 4N4IA 4ZN1A 4WF2A 3CCVT 3GNGA 1QVGS 4AFSC 1ZA2B 1Z9QA 2EGCA 1PM3A 1D0YA 1FXXA 4C8QB 4BDYA 1UHCA 2CGHA 3OYKA 3AT1B 4KBMB 2C0IA 1SSHA 2DO3A 2DL7A 1CKAA 3L2QA 1TOVA 2QI2A 1LPLA 3CMET 3VRYA 2NUPA 1G2BA 4J9GA 4AFZC 3QDRB 3CC2Q 1VQ4T 2FVUA 1NEGA 4OB3B 4PJNA 3O8VA 1VQMT 4LDUA 2OAUA 4XTWA 2XHCA 4PKCC 4AG2C 1M8VA 1M2VA 3L2VA 3QHSA 2RPNA 5GAMe 4PJJA 3CCQQ 1S72Q 2A7YA 3TVTA 2DRKA 1MMAA 2ZGWA 3OA6A 4NS5A 1FWZA 3T9NA 1GFDA 2ZPGB 4C92A 2COZA 3JSCA 3JB9I 2WSCE 1DJ7B 3SEMA 4GLKA 2QDYB 2QA4Q 3OYMA 2FHDA 5LJ5f 4M77A 4IUQA 5GMKh 2CSIA 1OPKA 3HFNA 1QLYA 3CPFA 2RQRA 2RQUA 2K7AA 4DQ2A 3REBB 2HD0A 4R56A 4OMFB 2V8KA 1Q82U 1BCMA 3OSVA 2EQUA 5FU7C 3G6ET 2ABLA 3CCUQ 5GANe 3NGPA 3M4YA 2DZ9A 1VQ9Q 2ED0A 5KYWA 2YRDA 2M0YA 2LCCA 4JUVA 4E7ZA 1B34B 1BI2A 4CRIA 3CCEQ 4FYYB 4ZTJA 1YNZA 1JXMA 2CP3A 2EW3A 3UATA 2MK5A 4Z88A 3VS5A 2A0FB 2AKLA 2QTVA 4MMLA 2YSQA 1MV3A 2JTEA 1LCKA 1VQLT 4GBQA 1LJOA 2O4XB 3NMZC 3CCJT 4M77G 3MJXA 5IAYA 3GNFB 4QVZA 2DL5A 3LGFA 3X25B 4PJOC 2X4WA 4M7DF 5CQXA 1Q81R 3ULRB 3C0CA 2LX7A 1OQKA 1FYNA 4OMOA 2G6FX 3Q1JA 2VXFA 3OYAA 3OSSC 3RKYA 1UDLA 3CC7Q 2DERA 4OGCA 1YCSB 4CC3A 2XIDA 5L23A 2VB6A 4C8QF 1UFFA 1IXDA 2LCLA 1VQNQ 3CCLQ 5M9OA 3CC4Q 2FO0A 2QQAA 1RAHB 1D3BA 3LYIA 2MOXA 3INZA 2CUDA 2DE0X 2KRNA 1NJIR 3QJYA 1M3CA 2DNUA 2MF2A 1JRIA 3DLMA 2VKNA 2KI7A 1YJWT 3M57A 1GCPA 2AKKA 4JJCA 2LQNA 1H8KA 2HZYA 4M7DE 2DL8A 3UPUA 5LJ3h 2GGRA 5FLXE 2ZCFB 2KMTA 5DLQE 2HQXA 2OTJQ 2KGTA 3LWHA 4M78C 3OS2A 3OYBA 2FYKA 1VQ8A 4FSSA 2FZGB 2K6DA 2DXBA 2EJFA 5I22A 4C8QD 5CAIA 4C8QE 4J9DA 2CP2A 3OYNA 1ZX6A 2GCXA 3WVDB 3PMIA 1YIJA 4DBFA 2HSPA 2DZCA 2L0AA 4BB7A 2XICA 4LDYA 1T0JA 4F04B 3M58A 4DBRA 2LVMA 2PUOB 2V1QA 2V8IA 1GRIA 2DPPB 4KRTA 1YI2A 2K2VA 2RQTA 3A8LB 5GMKj 3PT9A 3AHUA 5GAMd 3I9QA 4BDZA 2P84A 3QWXX 1VQOT 1WGSA 5GAOn 2OJ2A 4MDXA 1A0NB 3CBOA 1H641 3OS5A 1N8RC 1VQ6A 1VQPA 2CT4A 5KE3A 2KYMA 4II1A 1PG5B 5GJVB 5KH6A 2KSSA 2SRCA 2C06A 1PSEA 3JCMP 3EFSA 2KE9A 4J8OA 3VRZA 1R0CB 1ZUUA 3G71A 2KROA 4QVDA 4J9CA 2JJ9A 5GANd 2LJ3A 4BE2A 3CCMT 1B3QA 2LT1A 1Q7YU 3RESA 1V1CA 1OX8A 3J80E 1PKSA 1KQSP 3CPWA 2FPDA 4C92B 2QEXQ 2OTLA 1YFNA 2AHJB 4LE9A 3VS0A 4KUDK 1AEYA 1Y7XA 1HSQA 2EQMA 2YUPA 1G3TA 4DBHA 2HDAA 2YLCA 2JOYA 3A8GB 1PCXA 2DBMA 3CCSQ 2H3JA 3MHXA 3SWNB 1KJWA 2YUQA 4HCZA 2E65A 3VS6A 2PQWA 4JS4A 2RN8A 2GNCA 3M53A 1VQ5A 2DF6A 3CMAA 4RTWA 1H92A 3TSWA 4VUBA 1X01A 2LNVA 3ER0A 3QYGB 2CH4W 2M1HA 1M30A 2EPDA 2DFUA 2JMCA 1OX9A 2KR3A 1NYFA 2H8HA 4PJMA 1AHJB 2LC4A 2E3IA 1ABQA 5KYYB 2PNIA 1G3SA 1YHQQ 1GL5A 4RG8A 2BZ8A 3JCMX 3A5ZB 1UTIA 4JRQA 2ROLA 1YBYA 5A0GA 1UB4A 2M02A 2MMPA 2L2PA 5LJ3j 3H41A 1N8RR 3NHNA 4BY6C 1NM7A 2JN0A 3BFMA 1TTHB 4QT7A 4O5VA 1ZLMA 2DL4A 2EYWA 4C8QG 2CZ0B 1JJ2A 1ABOA 1Y71A 4BI4A 2JNGA 4F16A 3RDVA 5KE2A 2DILA 3EH2A 1B34A 3VYHB 1N9RA 1QMCA 1YJNA 3RBBB 3JCMe 1QCFA 3MP6A 2FEIA 4L59A 2CT3A 3I55T 4KH1B 1G8XA 4JDSA 5GANj 3UWNA 1KQ1A 3OYLA 1QWEA 5KCOA 1EX4A 1XQHA 4EDUA 4C0DB 4AG1C 2WACA 4N0AC 3A8MB 1D3BB 2DYIA 3DB3A 2OX7A 1FX7A 3M54A 2XDDA 2NUTA 4ZTFA 2D1XA 4ZGEB 2K5FA 1P92A 2MAMA 4J5YA 1ZSGA 4CC4B 1AOJA 2L3QA 2J6FA 3H0FA 2LP5A 3CCVA 4OMLA 2R57A 3CBMA 2VWFA 3VUBA 4R0KA 4TVRA 3UT1A 2PU9B 4O6JA 4C92F 1OEBA 2RQWA 1K73U 2RHUA 2PVDB 3E9GA 3CQTA 2C0OA 4IUTA 3C12A 4RTUA 5C6SA 1XJWB 4M77F 1M9SA 3FEOA 3RUXA 1M90C 1RADB 3OB9A 3CMEA 1I07A 3H0IA 3O5ZA 1AWOA 3MP1A 4ORZA 2O2OA 1VQ4A 1KD1C 1K9MU 2ZPIB 1VQMA 2CREA 3JB9H 3GPLA 1M1GA 1PD0A 3A98A 2HQEA 4OP0A 3M4GA 4JRIA 2KNBB 1YJ9Q 2EFIA 4C5IA 2ZZDA 2HNIA 4M75B 4EMKC 3PMTA 4C0ZA 4C0FA 4J83A 4EPCA 2A37A 1NEBA 4PK4A 1C0MA 3I56Q 3M0UA 1TG0A 1GCQC 3H6ZA 2WSFE 2FRYA 1VQKQ 4C92D 3EGXB 4C92E 3EFOA 5I11A 1V76A 2LNHB 3M0RA 5IHKA 3OMCA 4M7DC 1M27C 2XDBA 2FL7A 4HCBA 2A3LA 5GAN8 1I5OB 1SPKA 5LJ5g 4FW2A 2HEQA 4F14A 1OU9A 2RD1A 1YJNT 1UG1A 2CP5A 4Y92A 3EAEA 3REAB 4A4EA 2JVVA 1YITQ 3VUZA 5A0DA 2DK3A 4PLIA 4GLMA 4FM4B 5IHIA 2QQ9A 4C8QC 3RKWA 2RHIA 2HL5C 3NTHA 1Y96A 1T3LA 3QWYA 2QQSA 2VC8A 1JEGA 5FU6C 3PTAA 2A36A 2RHZA 5FROA 2F2WA 4YTLA 4CI0C 3FB9A 3MCAB 2GTOA 3U23A 1R0BG 1VQLA 2LJ0A 2LX9A 5L8RE 4F7UA 3CCJA 3MO8A 4E7LA 4DBQA 2EIFA 4R55A 4V2SA 1WPYA 3VYGA 2DIQA 2CZ7B 2NLUA 1I0CA 1JXOA 1BB9A 1IHWA 2DXCA 1WIEA 1M90R 1ZSZC 2HQHA 2EYQA 1GBRA 2KXDA 9ATCB 1KD1R 3ASKA 3CXCA 2E6ZA 1MMNA 2O88A 1D1BA 1VQ7Q 4HCKA 3OY9A 2L3SA 2L3PA 2O31A 1MMGA 3OYFA 4KH0B 3QO3A 1K0XA 1W2BA 2YDLA 3JCMd 2FRWA 3H9NA 4GY5A 2DTHA 2GF7A 3OYGA 3V7RA 5DLOA 3HL8A 4DA4A 2K3XA 1TSFA 1NZ9A 3JCMJ 2BE9B 2DEQA 1W70A 1WNLA 1WLPB 1YJWA 2EYXA 2O9SA 4OMQA 1AT1B 3SWNA 2X4JA 2R58A 4C0GA 3OW2A 3GP8A 4F7UG 4A4HA 2QGFB 2QTXA 2D6FA 5GAOq 3JRZA 3HRTA 2M0OA 3E19A 2DM1A 1W4SA 3M0QA 2O9VA 2DAQA 2VVKA 1QCNA 2HL3A 4IUPA 3QZ9B 1BKBA 5CKHA 1ZQ1A 5HK3A 5I2SA 4QVCA 2MWOA 3PFSA 2MWPA 1EZZB 2DRMA 1KHIA 4RTTA 2DXUA 5GAN2 7AT1B 4MZPA 2LQWA 2E10A 3EG3A 5GMKi 2DLPA 1IGUA 3OYJA 5KYYA 3CD6T 2EGEA 4FCYA 3G7ZA 5D6WA 4FYVB 1IB8A 4C92G 2NUTB 1KIKA 1E7OA 2OI3A 3QIIA 2YRCA 4E7IA 3TEEA 4JLIA 1K9AA 2QYZA 4E2FB 2ZPHB 4M75D 2PTKA 4RMOA 1M1KU 4E7KA 1UJYA 3MEAA 1IGQA 2K3BA 1VQOA 1Y0MA 5IN1A 2FZKB 2KYBA 4BACA 1D1CA 1U3OA 2NYSA 5D6YA 3H8ZA 2MI6A 3V8KA 4J6XA 5EG2A 1Q82C 3DKMA 5LJ5e 5GAN7 4QQDA 2K5LA 4DOWA 5FWBA 1VUBA 5A0LA 3FC3A 2RI3A 2VGNA 2K4YA 3VS7A 3CC2T 2IVWA 2YUOA 2HSEB 3VS3A 1SHFA 1RABB 2XMFA 4MZMA 3CCQT 1S72T 1LNXA 1MNEA 3CCMA 1X2QA 2VXEA 2JT4A 3WVEB 4E7HA 3LWIA 2DIGA 2AZSA 2QGGA 1K8AU 2QA4T 2K5IA 3TU4K 2OAWA 4KGVB 1NYGA 3FJ5A 1RI9A 5GAMh 5ECAA 1G3WA 2L5QA 3CEYA 5KYNA 4M7AD 2F5KA 4BD3A 3TREA 3HFOA 1G3YA 5J26A 1M3AA 2JZ2A 1QP3A 2AK5A 4PFPA 5FW9A 3JB9J 3EFOB 3HTRA 2XU8A 2CYZB 1KQ2A 3CCUT 2E70A 1BU1A 2XI9A 2RQVA 3X26B 2JTMA 8AT1B 2DTOA 4L5GA 2Y4XA 2JS2A 1JU5C 2DD5A 4QW2A 3OYHA 3RNJA 3QXEB 4BE1A 3CCET 2XKOC 5GANh 4LXCA 3UA7A 1U1SA 2COWA 1VQ8Q 4J9FA 1QVGP 1G83A 4J7IA 4XU2A 4ATOA 2DD4A 4M75A 1Y96B 1E6HA 2JXBA 5DY9A 5I2MA 3EGDA 5HK0A 3CXCS 1X6GA 1SEMA 5IHNA 3HHTB 1YIJQ 2GBQA 2EVRA 2HCKA 1Y07A 2H3EB 1QP2A 2LT4A 2ED1A 3EGXA 4Y28E 4F7UB 1D0ZA 1K8AC 3JV3A 5FWCA 3L1AA 3TQ7P 3PIOA 1QWFA 3S3NA 4J7FA 3X28B 1X6BA 2LQ8A 4M78B 4BI8B 1YI2Q 1PD1A 4C92C 1Q82R 3HPWA 4ESRA 4JZ4A 3NTKA 1OV3A 3SB2A 1KC8U 4M77C 4B9XA 3CC7T 1VQ6Q 2HMAA 1FMKA 1VQPQ 2D9TA 3I55A 1B07A 1VQNT 4JZ3A 3CCLT 4JRKA 5CVIA 3EGUA 3CC4T 3PNWC 4M7AA 5FRNA 2HBWA 3QYHB 2KVQG 1TU0B 3OYCA 3G71Q 3KBGA 3LGLA 3P8HA 5GMKl 1OU8A 1HD3A 4M75G 1MNDA 3GF5A 2J6OA 4ZNXA 3BDUA 5KYUA 1WXUA 2CSQA 4A4GA 1WA7A 2BZYA 2OTLQ 4IUVA 2LZ6B 2Y90A 2GFUA 4OMNA 3F70A 4LN2A 5CK9A 2QQBA 3DLLA 2OTJT 4IKFA 2COYA 1X2KA 5GAOr 4LDWA 1M5Q1 2J6KA 3OYEA 5GJWB 2QDLA 3UA6A 2LTOA 1CSKA 1WXBA 1ZBXA 1ZUKA 2I0NA 2DVJA 3CBPA 1X75C 1VQ5Q 2O01E 2RJDA 3HRUA 1M8MA 2DVEA 1D09B 3CMAQ 1WQ7A 3R6NA 2JTFA 2XG8D 3M9QA 4KUIA 5LJ5d 4FIBA 2EBPA 2X35A 2PUKB 4M7AG 2EQKA 3QJ6A 2DX1A 3G4SA 1Q95G 4JJBA 1Q7YC 5GAMj 4E47A 3VU3C 2ECZA 5A2QE 4C5HA 1QVFA 3OMGA 3OS0A 4ZN3A 1K8AR 2MCNA 3LW5E 1Q86U 2BIVA 2GTJA 1MHNA 2GQVA 5GAOp 1WJRA 4KT0E 1Y57A 1MV0B 4HT9A 2D8JA 2QK0A 2ENMA 3ZL7C 3SDZA 1N27A 1ARKA 2DXTA 2BKDN 2F2XA 1WHGA 2RF0A 4KGZB 1IO6A 1B7TA 1K0SA 3LX7A 4F7UF 3THKA 4WCIA 1I81A 4XTUA 4RCCA 2X51A 1G5VA 3KXTA 2SEMA 4D6WA 2RHXA 1YN8A 1OI1A 4RTYA 2CZ1B 3DB4A 4OB1B 3OBWA 2QEXT 2DYBA 3C94A 2KK4A 3R6OA 2DA9A 2ZAEA 1S1NA 1VYUA 2AZVA 2PVGB 3HSBA 5LJ3g 5GMKm 1QQJA 4BY6B 3CCST 4HKEA 4MZTA 3BE3A 2DKGA 4LD9K 1W6XA 4FW1A 2CP6A 3A8HB 1OYXA 1FMWA 2J7IA 4NL3A 1TUCA 2FPEA 3URGA 1M2OA 2QQRA 3HP9A 4J9IA 3I5RA 4JLGA 4RTXA 1Q86C 1KQSA 1T0HA 3M0PA 2BE7D 4F7UE 3JCMb 4KULA 3CCVQ 3L2ZA 2X4XA 3X20B 2HBPA 3JB9D 4LUEA 4M78D 4L6V5 3CCRA 1NLPC 3S3OA 5GANg 5DM7R 3J7AF 3JAME 2D8HA 3EG1A 1M4ZA 1WHKA 3CMEQ 1RUWA 1PHTA 3FLGA 4N4GA 4HVVA 1GBQA 5KYXB 3G4ST 1K76A 1VQ4Q 2BZXA 2JS0A 1GFCA 1VQMQ 4FT2A 1AVZC 3EGDB 1JQQA 4RKUE 1Q7YR 2A08A 1YHQT 2XDPA 3L2RA 4FYXB 5GMKe 1BCOA 4PJOA 2VV5A 4Q5WA 2C0TA 3BDLA 3VV0A 1PRLC 1WX6A 3CPWS 1N6AA 2RM4A 2VGMA 5AYFA 1SRMA 2NWMA 3MPUB 3SFMA 1WDXA 4QKUA 2W0ZA 4HA8A 1BI3A 2ZPBB 4BE0A 4A4KA 1Q81U 1RACB 5GAN5 4XU0A 1AWXA 4XTYA 3A1PA 1BI1A 3M59A 1K73C 3SD4A 3JCMW 1M1FA 4QQGA 4PNOA 5GAMf 3TCJA 3G6EQ 1HK9A 4HVUA 3ZBDA 4UC4A 2D0QB 2QXFA 1SRLA 3FDRA 3PVLA 5LJ3f 2HAXA 1UEBA 3BY7A 1K9MC 4M7AB 2JM8A 2X4YA 3JCMh 2LJ1A 3CD6A 5GAN4 1KK7A 2EAYA 4N4HA 3QKJA 2EQJA 1U06A 3QZ5B 1X27A 2P0QA 2MPXC 2LDMA 3FJPA 5HKCA 2DJZA 1NJIU 4D8KA 1RAFB 4JPBW 4M4ZA 2E3HA 5KYUB 2EJ9A 4LUDA 2ROTA 1TS9A 3A8OB 4D8DA 4PJOG 4M7DB 5GANf 2L89A 4M78A 2YXYA 4XTXA 2RI2A 1TH7A 3EG0A 3L42A 3RR6A 1RAIB 2Z0WA 4PFZA 5GAN3 1VQLQ 4ELZC 2QG9B 1QVFS 2YWWA 3CCJQ 2HKNA 3EFRA 2B86A 2FB7A 3CCRT 6AT1B 4NOYA 2MYSA 1ZUYA 3S3MA 4ZGJB 1RAAB 2KY9A 1Q81C 1MMDA 3CC2A 1JJ2S 2AIRB 3VS4A 3E9FA 2EWNA 1X43A 2FZCB 4AT1B 2QAZA 1K4US 1YJ9T 5FU6B 1KSWA 4MMKA 3CCQA 1S72A 1VQ7A 2M16A 3OYIA 2IIMA 1XNIA 2ZPFB 4DEXA 2KDSA 2RJEA 1VIEA 4FT4A 1KG1A 2QA4A 3L2WA 2RB6A 2DEUA 1NBEB 3I56T 3UF4A 1LOJA 2EYZA 2K3YA 1VQKT 4XU1A 3E1SA 1RI0A 5LJ3e 2ZPEB 1WJQA 4M75F 5CCAA 1NJIC 4A63B 1M3BA 2AT1B 3META 5D7UA 3BW1A 1BK2A 3JB9G 1YJWQ 4FSXA 4M78G 3CCUA 3JCMc 1ZSZB 2V1RA 4A53A 3H0HA 1VQ9A 3LLRA 5IH2A 3TSZA 1OPLA 1OULA 1K73R 1PRMC 1N9SA 1YITT 1J3TA 1WHHA 2KXCA 1EFNA 1ZHIA 3CCEA 1KQSS 1K1ZA 2KT1A 3QG1A 2KBTA 1C6VX 1K9MR 4RCBA 2YUNA 1WQWA 3OBYA 2KEAA 2RJFA 3FRNA 3VKIA 2RMOA 4IIOA 2L3RA 1UGPB 3MEWA 2LQKA 2RI5A 5D6XA 4RUGA 4JJNK 2JMAA 2P4RA 2LMJA 4AMCA 4M75E 1RAEB 4HCCA 2RNAA 4M7AF 4X34A 5FU7B 4RG2A 1E6GA 1BBZA 3V8LA 4PFOA 4FYWB 2KQWA 1HYOA 4QQ6A 4Z8AA 1VQOQ 4XTZA 2JUFA 1I1JA 2D0NA 3CC7A 3V7CA 2RK2A 2EKHA 1WHLA 5CKDA 3PVQA 3CPWP 1RLQC 2LCSA 1VQNA 2YHTA 3CCLA 1VQ7T 3CC4A 2IPOB 2F5TX 2VUBA 2GFAA 1NG2A 4LDXA 4XQ3A 4X9CA 1ACMB 1RLPC 1YP5A 1TWBA 5EC7A 4E6RA 3CCMQ 4M7AE 4PJOB 4Z02A 3ME9A 1IZ6A 1X69A 4J6YA 4XU3A 1GXIE 2K79A 3NFCA 2L8DA 3RERA 2CKKA 4BI3A 1M1KC 1T3SA 4ANJA 2OTJA 4WTOB 1N8RU 1VQ9T 4M7DD 1MUZA 1PKTA 4LNPA 3EG9B 4A54A 2YRVA 3GBQA 1U1TA 4X9DA 3MP8A 1JBMA 4JRPA 4N0AA 2M51A 2RO0A 5I21A 2ATCB 2P0PA
chains in the Genus database with same CATH topology
2DX1A 3M0UA 1TG0A 1GCQC 2ABLA 2FRYA 4JJBA 3NGPA 3VS2A 1AWWA 2ED0A 5I11A 2LNHB 2ECZA 3M0RA 2M0YA 5IHKA 1M27C 2MCNA 1SPKA 2GTJA 2YT6A 4RTVA 2HEQA 4F14A 1Y57A 1UG1A 1MV0B 1JXMA 1YNZA 4Y92A 2D8JA 2EW3A 2ENMA 3REAB 3UATA 3ZL7C 2CDTA 1ARKA 4GLMA 2F2XA 1PNJA 4Z88A 5IHIA 1UGVA 2FPFA 2RF0A 3VS5A 2AKLA 1AWJA 1IO6A 1K0SA 2X3XD 3KFVA 1KFZA 2KRSA 2YSQA 3THKA 1MV3A 2JTEA 4WCIA 2CH4A 1T3LA 3QWYA 1XOVA 1LCKA 1JEGA 4GBQA 2SEMA 1VA7A 2A36A 3NMZC 3EHQA 2F2WA 1YN8A 2GTOA 2DL5A 4RTYA 3U23A 4F17A 1UE9A 2LJ0A 2F2VA 3ULRB 3C0CA 2LX7A 2DYBA 1AZGB 1FYNA 1WXTA 4OMOA 2DA9A 2G6FX 4AFUC 4RTZA 4J9EA 1S1NA 1VYUA 2AZVA 1GCQA 2MIOA 1JXOA 1I0CA 1UDLA 1BB9A 1YCSB 4K11A 4CC3A 3I35A 4J9BA 1W6XA 5L23A 1WIEA 2J7IA 1TUCA 2W10A 2FPEA 2X3WD 1UFFA 1GBRA 2KXDA 1AD5A 4J9IA 3EHRA 3I5RA 4RTXA 1T0HA 2FO0A 3M0PA 1SHGA 2MOXA 2CUDA 2DE0X 2O88A 2KRNA 3LH5A 4LUEA 1NLPC 1M3CA 4HCKA 2DNUA 3VS1A 2L3SA 2L3PA 2O31A 2NUZA 4HVWA 4HXJA 1K0XA 2VKNA 2D8HA 2GQIA 1WI7A 2YDLA 1Z9ZA 2EQIA 1GCPA 2FRWA 3EG1A 4DEYA 2AKKA 4J9HA 4JJCA 1RUWA 1PHTA 2LQNA 1H8KA 1TUDA 2DMOA 2DL8A 2EGAA 4HVVA 1GBQA 1W70A 1K76A 1WLPB 2BZXA 2GGRA 2JS0A 1GFCA 2EYXA 2O9SA 4OMQA 1AVZC 1JQQA 2A08A 2KGTA 1NLOC 1ZBJA 1UECA 2DBKA 2C0TA 2DJQA 4FSSA 5IXFA 2K6DA 1CKBA 5I22A 1PRLC 1WX6A 2J06A 2DM1A 3M0QA 2O9VA 4J9DA 2VVKA 2FG0A 1SRMA 1UUEA 1ZX6A 2NWMA 1WDXA 2W0ZA 1VYVA 2DL3A 2HSPA 2L0AA 1AWXA 2DRMA 1T0JA 4RTTA 1JO8A 3EG2A 2V1QA 2LQWA 5HCKA 3EG3A 1GRIA 1YWOA 4KRTA 2DLPA 4HVUA 2CUBA 2EGEA 2RQTA 1WFWA 1SRLA 3PVLA 3I9QA 3QWXX 2JM8A 1KIKA 2K9GA 2LJ1A 2OJ2A 1VYTA 1E7OA 2OI3A 1A0NB 1K9AA 1U06A 2PTKA 1X27A 2CT4A 2A28A 1UJYA 2KYMA 2K3BA 5GJVB 1Y0MA 2SRCA 4D8KA 4JPBW 4M4ZA 2KYBA 5IXBA 1U3OA 4LUDA 4OMPA 2ROTA 4D8DA 2KE9A 2JM9A 2EYYA 3VRZA 1ZUUA 2KROA 3EG0A 4EIKA 4J9CA 2LJ3A 5FWBA 3VS7A 3NPFA 2B86A 1B3QA 2YUOA 3M0TA 1UJ0A 1V1CA 4AFQC 1PKSA 3VS3A 1UHFA 2ESWA 1SHFA 1ZUYA 2FPDA 2XMFA 4LE9A 3VS4A 1X2QA 3VS0A 1AEYA 4JJDA 1HSQA 1X43A 2JT4A 2YUPA 4IIMA 1K4US 2HDAA 1KSWA 1QKWA 2AZSA 2DBMA 2IIMA 3SHWA 2OAWA 1KJWA 1NYGA 3FJ5A 2YUQA 4DEXA 1RI9A 1HJDA 5ECAA 3VS6A 2RN8A 2GNCA 1M3AA 2AK5A 2DF6A 5FW9A 4RTWA 1H92A 3UF4A 2EYZA 2BTTA 3TSWA 4CC7A 1BU1A 2RQVA 4A63B 1M3BA 4CC2A 2CH4W 1YWPA 1BK2A 1M30A 1OOTA 2EPDA 2JS2A 1JU5C 1WYXA 2V1RA 3RNJA 2JMCA 3H0HA 2KT8A 2KR3A 5IH2A 1NYFA 2J05A 1OPLA 2H8HA 3TSZA 1PRMC 3UA7A 3PE0A 4J9FA 1ABQA 1G83A 1J3TA 1W1FA 2PNIA 2KXCA 1EFNA 1GL5A 1E6HA 2JXBA 2BZ8A 1K1ZA 2KT1A 1UTIA 2KBTA 1H3HA 2ROLA 1U5SA 3M0SA 1X6GA 1SEMA 5IHNA 1N5ZA 2L2PA 2GBQA 2EVRA 2HCKA 2PZ1A 2YUNA 3H41A 3IQLA 3NHNA 2KEAA 1NM7A 3I5SA 2ED1A 2RMOA 4IIOA 4QT7A 1AZEA 1ZLMA 2DL4A 2EYWA 3JV3A 1ABOA 5FWCA 2K2MA 1QWFA 4F16A 2KRMA 4RUGA 1X6BA 2JMAA 2P4RA 2DILA 2LMJA 2RNAA 2E5KA 1QKXA 4X1VA 3RBBB 1QCFA 2FEIA 4ESRA 4JZ4A 2CT3A 1OV3A 1E6GA 1PWTA 1BBZA 1FMKA 1QWEA 4AG1C 4Z8AA 1B07A 4Z89A 1I1JA 2D0NA 2JW4A 4JZ3A 3EGUA 4OMMA 2HBWA 2D1XA 2EKHA 3PVQA 4AFSC 1RLQC 1Z9QA 2LCSA 2EGCA 1HD3A 1UHCA 1ZSGA 4CC4B 1AOJA 2L3QA 2J6FA 2J6OA 3H0FA 4ZNXA 2LP5A 4OMLA 2VWFA 2C0IA 1SSHA 4R0KA 2DL7A 1CKAA 1NG2A 1WXUA 2CSQA 3VRYA 1RLPC 1OEBA 2RQWA 1G2BA 1WA7A 4J9GA 3CQTA 4AFZC 1YP5A 2C0OA 4RTUA 2BZYA 5EC7A 4E6RA 1NEGA 2LZ6B 4OMNA 4AG2C 4LN2A 1I07A 3H0IA 1X69A 3O5ZA 2RPNA 2K79A 1AWOA 3TVTA 1X2KA 2DRKA 4ORZA 2O2OA 2CREA 1T3SA 2J6KA 3A98A 1GFDA 5GJWB 2QDLA 3UA6A 2KNBB 1CSKA 1WXBA 1ZUKA 3SEMA 1MUZA 2I0NA 1PKTA 2DVJA 4LNPA 1M8MA 2CSIA 3R6NA 1OPKA 3GBQA 1QLYA 2RQRA 2RQUA 2K7AA 3REBB 2EBPA 2M51A 2A37A 1NEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX1 A;  3M0U A;  1TG0 A;  1GCQ C;  2ABL A;  2FRY A;  4JJB A;  3NGP A;  3VS2 A;  1AWW A;  2ED0 A;  5I11 A;  2LNH B;  2ECZ A;  3M0R A;  2M0Y A;  5IHK A;  1M27 C;  2MCN A;  1SPK A;  2GTJ A;  2YT6 A;  4RTV A;  2HEQ A;  4F14 A;  1Y57 A;  1UG1 A;  1MV0 B;  1JXM A;  1YNZ A;  4Y92 A;  2D8J A;  2EW3 A;  2ENM A;  3REA B;  3UAT A;  3ZL7 C;  2CDT A;  1ARK A;  4GLM A;  2F2X A;  1PNJ A;  4Z88 A;  5IHI A;  1UGV A;  2FPF A;  2RF0 A;  3VS5 A;  2AKL A;  1AWJ A;  1IO6 A;  1K0S A;  2X3X D;  3KFV A;  1KFZ A;  2KRS A;  2YSQ A;  3THK A;  1MV3 A;  2JTE A;  4WCI A;  2CH4 A;  1T3L A;  3QWY A;  1XOV A;  1LCK A;  1JEG A;  4GBQ A;  2SEM A;  1VA7 A;  2A36 A;  3NMZ C;  3EHQ A;  2F2W A;  1YN8 A;  2GTO A;  2DL5 A;  4RTY A;  3U23 A;  4F17 A;  1UE9 A;  2LJ0 A;  2F2V A;  3ULR B;  3C0C A;  2LX7 A;  2DYB A;  1AZG B;  1FYN A;  1WXT A;  4OMO A;  2DA9 A;  2G6F X;  4AFU C;  4RTZ A;  4J9E A;  1S1N A;  1VYU A;  2AZV A;  1GCQ A;  2MIO A;  1JXO A;  1I0C A;  1UDL A;  1BB9 A;  1YCS B;  4K11 A;  4CC3 A;  3I35 A;  4J9B A;  1W6X A;  5L23 A;  1WIE A;  2J7I A;  1TUC A;  2W10 A;  2FPE A;  2X3W D;  1UFF A;  1GBR A;  2KXD A;  1AD5 A;  4J9I A;  3EHR A;  3I5R A;  4RTX A;  1T0H A;  2FO0 A;  3M0P A;  1SHG A;  2MOX A;  2CUD A;  2DE0 X;  2O88 A;  2KRN A;  3LH5 A;  4LUE A;  1NLP C;  1M3C A;  4HCK A;  2DNU A;  3VS1 A;  2L3S A;  2L3P A;  2O31 A;  2NUZ A;  4HVW A;  4HXJ A;  1K0X A;  2VKN A;  2D8H A;  2GQI A;  1WI7 A;  2YDL A;  1Z9Z A;  2EQI A;  1GCP A;  2FRW A;  3EG1 A;  4DEY A;  2AKK A;  4J9H A;  4JJC A;  1RUW A;  1PHT A;  2LQN A;  1H8K A;  1TUD A;  2DMO A;  2DL8 A;  2EGA A;  4HVV A;  1GBQ A;  1W70 A;  1K76 A;  1WLP B;  2BZX A;  2GGR A;  2JS0 A;  1GFC A;  2EYX A;  2O9S A;  4OMQ A;  1AVZ C;  1JQQ A;  2A08 A;  2KGT A;  1NLO C;  1ZBJ A;  1UEC A;  2DBK A;  2C0T A;  2DJQ A;  4FSS A;  5IXF A;  2K6D A;  1CKB A;  5I22 A;  1PRL C;  1WX6 A;  2J06 A;  2DM1 A;  3M0Q A;  2O9V A;  4J9D A;  2VVK A;  2FG0 A;  1SRM A;  1UUE A;  1ZX6 A;  2NWM A;  1WDX A;  2W0Z A;  1VYV A;  2DL3 A;  2HSP A;  2L0A A;  1AWX A;  2DRM A;  1T0J A;  4RTT A;  1JO8 A;  3EG2 A;  2V1Q A;  2LQW A;  5HCK A;  3EG3 A;  1GRI A;  1YWO A;  4KRT A;  2DLP A;  4HVU A;  2CUB A;  2EGE A;  2RQT A;  1WFW A;  1SRL A;  3PVL A;  3I9Q A;  3QWX X;  2JM8 A;  1KIK A;  2K9G A;  2LJ1 A;  2OJ2 A;  1VYT A;  1E7O A;  2OI3 A;  1A0N B;  1K9A A;  1U06 A;  2PTK A;  1X27 A;  2CT4 A;  2A28 A;  1UJY A;  2KYM A;  2K3B A;  5GJV B;  1Y0M A;  2SRC A;  4D8K A;  4JPB W;  4M4Z A;  2KYB A;  5IXB A;  1U3O A;  4LUD A;  4OMP A;  2ROT A;  4D8D A;  2KE9 A;  2JM9 A;  2EYY A;  3VRZ A;  1ZUU A;  2KRO A;  3EG0 A;  4EIK A;  4J9C A;  2LJ3 A;  5FWB A;  3VS7 A;  3NPF A;  2B86 A;  1B3Q A;  2YUO A;  3M0T A;  1UJ0 A;  1V1C A;  4AFQ C;  1PKS A;  3VS3 A;  1UHF A;  2ESW A;  1SHF A;  1ZUY A;  2FPD A;  2XMF A;  4LE9 A;  3VS4 A;  1X2Q A;  3VS0 A;  1AEY A;  4JJD A;  1HSQ A;  1X43 A;  2JT4 A;  2YUP A;  4IIM A;  1K4U S;  2HDA A;  1KSW A;  1QKW A;  2AZS A;  2DBM A;  2IIM A;  3SHW A;  2OAW A;  1KJW A;  1NYG A;  3FJ5 A;  2YUQ A;  4DEX A;  1RI9 A;  1HJD A;  5ECA A;  3VS6 A;  2RN8 A;  2GNC A;  1M3A A;  2AK5 A;  2DF6 A;  5FW9 A;  4RTW A;  1H92 A;  3UF4 A;  2EYZ A;  2BTT A;  3TSW A;  4CC7 A;  1BU1 A;  2RQV A;  4A63 B;  1M3B A;  4CC2 A;  2CH4 W;  1YWP A;  1BK2 A;  1M30 A;  1OOT A;  2EPD A;  2JS2 A;  1JU5 C;  1WYX A;  2V1R A;  3RNJ A;  2JMC A;  3H0H A;  2KT8 A;  2KR3 A;  5IH2 A;  1NYF A;  2J05 A;  1OPL A;  2H8H A;  3TSZ A;  1PRM C;  3UA7 A;  3PE0 A;  4J9F A;  1ABQ A;  1G83 A;  1J3T A;  1W1F A;  2PNI A;  2KXC A;  1EFN A;  1GL5 A;  1E6H A;  2JXB A;  2BZ8 A;  1K1Z A;  2KT1 A;  1UTI A;  2KBT A;  1H3H A;  2ROL A;  1U5S A;  3M0S A;  1X6G A;  1SEM A;  5IHN A;  1N5Z A;  2L2P A;  2GBQ A;  2EVR A;  2HCK A;  2PZ1 A;  2YUN A;  3H41 A;  3IQL A;  3NHN A;  2KEA A;  1NM7 A;  3I5S A;  2ED1 A;  2RMO A;  4IIO A;  4QT7 A;  1AZE A;  1ZLM A;  2DL4 A;  2EYW A;  3JV3 A;  1ABO A;  5FWC A;  2K2M A;  1QWF A;  4F16 A;  2KRM A;  4RUG A;  1X6B A;  2JMA A;  2P4R A;  2DIL A;  2LMJ A;  2RNA A;  2E5K A;  1QKX A;  4X1V A;  3RBB B;  1QCF A;  2FEI A;  4ESR A;  4JZ4 A;  2CT3 A;  1OV3 A;  1E6G A;  1PWT A;  1BBZ A;  1FMK A;  1QWE A;  4AG1 C;  4Z8A A;  1B07 A;  4Z89 A;  1I1J A;  2D0N A;  2JW4 A;  4JZ3 A;  3EGU A;  4OMM A;  2HBW A;  2D1X A;  2EKH A;  3PVQ A;  4AFS C;  1RLQ C;  1Z9Q A;  2LCS A;  2EGC A;  1HD3 A;  1UHC A;  1ZSG A;  4CC4 B;  1AOJ A;  2L3Q A;  2J6F A;  2J6O A;  3H0F A;  4ZNX A;  2LP5 A;  4OML A;  2VWF A;  2C0I A;  1SSH A;  4R0K A;  2DL7 A;  1CKA A;  1NG2 A;  1WXU A;  2CSQ A;  3VRY A;  1RLP C;  1OEB A;  2RQW A;  1G2B A;  1WA7 A;  4J9G A;  3CQT A;  4AFZ C;  1YP5 A;  2C0O A;  4RTU A;  2BZY A;  5EC7 A;  4E6R A;  1NEG A;  2LZ6 B;  4OMN A;  4AG2 C;  4LN2 A;  1I07 A;  3H0I A;  1X69 A;  3O5Z A;  2RPN A;  2K79 A;  1AWO A;  3TVT A;  1X2K A;  2DRK A;  4ORZ A;  2O2O A;  2CRE A;  1T3S A;  2J6K A;  3A98 A;  1GFD A;  5GJW B;  2QDL A;  3UA6 A;  2KNB B;  1CSK A;  1WXB A;  1ZUK A;  3SEM A;  1MUZ A;  2I0N A;  1PKT A;  2DVJ A;  4LNP A;  1M8M A;  2CSI A;  3R6N A;  1OPK A;  3GBQ A;  1QLY A;  2RQR A;  2RQU A;  2K7A A;  3REB B;  2EBP A;  2M51 A;  2A37 A;  1NEB A; 
#chains in the Genus database with same CATH topology
 3V8J A;  3JCM g;  5KYX A;  3MEV A;  3VS2 A;  4PL6 A;  1AWW A;  1WHM A;  3C95 A;  2EKO A;  1QVF P;  2E4H A;  1V29 B;  2V26 A;  5CO7 A;  2M9U A;  3GOX A;  2YT6 A;  4RTV A;  1W2B S;  5AT1 B;  1JJ2 P;  2F1L A;  3RMQ A;  5HY6 A;  2CDT A;  4OB2 B;  5IT9 E;  1PNJ A;  1TUG B;  4XK8 E;  5J39 A;  4IUR A;  1D0X A;  1UGV A;  2FPF A;  1AWJ A;  1BIA A;  3N5B B;  2X9H A;  2X3X D;  3KFV A;  1KFZ A;  1IRE B;  2KRS A;  1KHC A;  4DOV A;  1FMV A;  2CH4 A;  3OQ5 A;  5C0M A;  2CP7 A;  1XOV A;  3OW2 S;  1OZ2 A;  1QW1 A;  1VA7 A;  5LJ3 d;  3WXM B;  3EHQ A;  5GAO l;  3SWN C;  1C1A A;  1NPR A;  2Y4Y A;  2QAS A;  4OB0 B;  4F17 A;  1UE9 A;  2E6N A;  2F2V A;  4EMK A;  1QCO A;  5LJ5 h;  1AZG B;  1WXT A;  1YCY A;  2NUP B;  4AFU C;  3I55 Q;  4RTZ A;  2B8A A;  1EIF A;  2XK0 A;  4J9E A;  1I8F A;  3M56 A;  1GCQ A;  3QPH A;  2QEX A;  2MIO A;  1XTD A;  3J81 E;  3QDF A;  2WSE E;  4K11 A;  3I35 A;  4J9B A;  1M2V B;  1LVK A;  4EMG A;  3RIR A;  2W10 A;  3RKX A;  4M7D A;  4ZGD B;  2X3W D;  2HKQ B;  2IG0 A;  1AD5 A;  5CKF A;  3EHR A;  3CCS A;  3D7S B;  1H3Z A;  1UGQ B;  1M1K R;  1SHG A;  1RL2 A;  2YLB A;  1SKU B;  4C5E A;  3PGG A;  4B6M A;  3LH5 A;  3RMS A;  3PIP A;  4M77 B;  3JCM f;  2E5Q A;  3VS1 A;  1UGS B;  2NUZ A;  4HVW A;  3GLX A;  4HXJ A;  4PJO F;  2GQI A;  1WI7 A;  5FRM A;  1Z9Z A;  1OZ3 A;  2EQI A;  1NE8 A;  1R8O B;  4C8Q A;  5CQY A;  4C5G A;  4DEY A;  4J9H A;  1PSF A;  4A4F A;  1KC8 C;  1TUD A;  2DMO A;  4XTV A;  2EGA A;  2PVO B;  1VQ8 T;  1IRX A;  2EJG A;  2G3R A;  5KYW B;  3OYD A;  1NLO C;  1ZBJ A;  1UEC A;  3LH0 A;  2DBK A;  4BUG A;  2R5A A;  2DJQ A;  4JS5 A;  5IXF A;  3ZEH A;  2VYT A;  1CKB A;  2J06 A;  1YIJ T;  1YHQ A;  3OS1 A;  2K57 A;  3NTI A;  2FG0 A;  1UUE A;  4MDW A;  4C0D C;  3G4S Q;  1QVG A;  2BUD A;  1VYV A;  1F1B B;  2DL3 A;  4M7D G;  1SF9 A;  1YI2 T;  1ZSZ A;  4PJO D;  3HRS A;  1JO8 A;  4Y91 A;  3EG2 A;  5HCK A;  1O75 A;  4PJO E;  1YWO A;  3M55 A;  2CUB A;  5KCH A;  2V8J A;  2E41 A;  1WFW A;  2E1H A;  1VQ6 T;  1VOM A;  1VQP T;  5GAN 6;  2DET A;  1HXD A;  1M90 U;  4PLL A;  3JB9 F;  4PJL A;  4M78 F;  2K9G A;  1VYT A;  3P8D A;  4EMH A;  1KD1 U;  1YJN Q;  1I5L A;  5GAO m;  1X6O A;  2E64 A;  2A28 A;  3G71 T;  2RJC A;  5IXB A;  1NPP A;  3FIF A;  5GAM g;  4OMP A;  2JM9 A;  2EYY A;  4B9W A;  1VIF A;  4LDV A;  3EH1 A;  4EIK A;  3GIB A;  1I4K 1;  2RA2 A;  1BYM A;  3JCM Q;  2OTL T;  3NPF A;  4FU6 A;  4E7J A;  4M75 C;  5J3B A;  3M0T A;  1UJ0 A;  2O4X A;  1O9S A;  4OVA A;  1BI0 A;  4P5N A;  4AFQ C;  1UHF A;  4KGX B;  2ESW A;  3CXC P;  1JB0 E;  2VAS A;  5CIU A;  4JJD A;  4IIM A;  3JCM V;  4ME7 A;  4M78 E;  1KC8 R;  1QKW A;  3KUF A;  1R77 A;  1W2B P;  1VQ5 T;  3QBY A;  3SHW A;  3OYY A;  2I2L A;  3CMA T;  1HJD A;  1UGR B;  1U8R A;  2LRQ A;  1YJ9 A;  5LJ5 j;  3V7S A;  3VJP A;  1WZO A;  3CCR Q;  3ZFJ A;  3E2U A;  3G1J A;  2KAF A;  1SG5 A;  1BIB A;  3OW2 P;  3MEU A;  2CP0 A;  4NL2 A;  4HT8 A;  2F69 A;  3C4S A;  2BTT A;  4CC7 A;  2P4T A;  2P0K A;  3I56 A;  3MKD A;  4CC2 A;  1WJS A;  1IHV A;  1YWP A;  1OOT A;  4OGE A;  5CKB A;  1VQK A;  3M5A A;  1WYX A;  3QSU A;  4M7A C;  2DTI A;  8ATC B;  2KT8 A;  2XD0 A;  2J05 A;  3L2U A;  1D1A A;  2E12 A;  5CR2 A;  2CZ6 B;  3PE0 A;  1RAG B;  1W1F A;  4J6W A;  2RHY A;  3EG9 A;  2R5M A;  4LD6 A;  3UDC A;  1MGQ A;  1YIT A;  1H3H A;  1U5S A;  3M0S A;  4M77 D;  1N5Z A;  3G6E A;  4M77 E;  2PZ1 A;  3IQL A;  1TXQ A;  3I5S A;  4EMK B;  4ELY C;  1AZE A;  3QUI A;  1WHJ A;  1QVP A;  2K2M A;  3S6W A;  2KRM A;  4XAX B;  4E7S A;  3X24 B;  2E5K A;  1QKX A;  4X1V A;  2RK1 A;  4FL6 A;  3P8B B;  1SSF A;  3CD6 Q;  5LL6 S;  1PWT A;  4IUU A;  2RH2 A;  2CS7 A;  4OF1 A;  5CKE A;  4Z89 A;  1PC0 A;  1ZA1 B;  1Q86 R;  3HKS A;  2JW4 A;  4OMM A;  4N4I A;  4ZN1 A;  4WF2 A;  3CCV T;  3GNG A;  1QVG S;  4AFS C;  1ZA2 B;  1Z9Q A;  2EGC A;  1PM3 A;  1D0Y A;  1FXX A;  4C8Q B;  4BDY A;  1UHC A;  2CGH A;  3OYK A;  3AT1 B;  4KBM B;  2C0I A;  1SSH A;  2DO3 A;  2DL7 A;  1CKA A;  3L2Q A;  1TOV A;  2QI2 A;  1LPL A;  3CME T;  3VRY A;  2NUP A;  1G2B A;  4J9G A;  4AFZ C;  3QDR B;  3CC2 Q;  1VQ4 T;  2FVU A;  1NEG A;  4OB3 B;  4PJN A;  3O8V A;  1VQM T;  4LDU A;  2OAU A;  4XTW A;  2XHC A;  4PKC C;  4AG2 C;  1M8V A;  1M2V A;  3L2V A;  3QHS A;  2RPN A;  5GAM e;  4PJJ A;  3CCQ Q;  1S72 Q;  2A7Y A;  3TVT A;  2DRK A;  1MMA A;  2ZGW A;  3OA6 A;  4NS5 A;  1FWZ A;  3T9N A;  1GFD A;  2ZPG B;  4C92 A;  2COZ A;  3JSC A;  3JB9 I;  2WSC E;  1DJ7 B;  3SEM A;  4GLK A;  2QDY B;  2QA4 Q;  3OYM A;  2FHD A;  5LJ5 f;  4M77 A;  4IUQ A;  5GMK h;  2CSI A;  1OPK A;  3HFN A;  1QLY A;  3CPF A;  2RQR A;  2RQU A;  2K7A A;  4DQ2 A;  3REB B;  2HD0 A;  4R56 A;  4OMF B;  2V8K A;  1Q82 U;  1BCM A;  3OSV A;  2EQU A;  5FU7 C;  3G6E T;  2ABL A;  3CCU Q;  5GAN e;  3NGP A;  3M4Y A;  2DZ9 A;  1VQ9 Q;  2ED0 A;  5KYW A;  2YRD A;  2M0Y A;  2LCC A;  4JUV A;  4E7Z A;  1B34 B;  1BI2 A;  4CRI A;  3CCE Q;  4FYY B;  4ZTJ A;  1YNZ A;  1JXM A;  2CP3 A;  2EW3 A;  3UAT A;  2MK5 A;  4Z88 A;  3VS5 A;  2A0F B;  2AKL A;  2QTV A;  4MML A;  2YSQ A;  1MV3 A;  2JTE A;  1LCK A;  1VQL T;  4GBQ A;  1LJO A;  2O4X B;  3NMZ C;  3CCJ T;  4M77 G;  3MJX A;  5IAY A;  3GNF B;  4QVZ A;  2DL5 A;  3LGF A;  3X25 B;  4PJO C;  2X4W A;  4M7D F;  5CQX A;  1Q81 R;  3ULR B;  3C0C A;  2LX7 A;  1OQK A;  1FYN A;  4OMO A;  2G6F X;  3Q1J A;  2VXF A;  3OYA A;  3OSS C;  3RKY A;  1UDL A;  3CC7 Q;  2DER A;  4OGC A;  1YCS B;  4CC3 A;  2XID A;  5L23 A;  2VB6 A;  4C8Q F;  1UFF A;  1IXD A;  2LCL A;  1VQN Q;  3CCL Q;  5M9O A;  3CC4 Q;  2FO0 A;  2QQA A;  1RAH B;  1D3B A;  3LYI A;  2MOX A;  3INZ A;  2CUD A;  2DE0 X;  2KRN A;  1NJI R;  3QJY A;  1M3C A;  2DNU A;  2MF2 A;  1JRI A;  3DLM A;  2VKN A;  2KI7 A;  1YJW T;  3M57 A;  1GCP A;  2AKK A;  4JJC A;  2LQN A;  1H8K A;  2HZY A;  4M7D E;  2DL8 A;  3UPU A;  5LJ3 h;  2GGR A;  5FLX E;  2ZCF B;  2KMT A;  5DLQ E;  2HQX A;  2OTJ Q;  2KGT A;  3LWH A;  4M78 C;  3OS2 A;  3OYB A;  2FYK A;  1VQ8 A;  4FSS A;  2FZG B;  2K6D A;  2DXB A;  2EJF A;  5I22 A;  4C8Q D;  5CAI A;  4C8Q E;  4J9D A;  2CP2 A;  3OYN A;  1ZX6 A;  2GCX A;  3WVD B;  3PMI A;  1YIJ A;  4DBF A;  2HSP A;  2DZC A;  2L0A A;  4BB7 A;  2XIC A;  4LDY A;  1T0J A;  4F04 B;  3M58 A;  4DBR A;  2LVM A;  2PUO B;  2V1Q A;  2V8I A;  1GRI A;  2DPP B;  4KRT A;  1YI2 A;  2K2V A;  2RQT A;  3A8L B;  5GMK j;  3PT9 A;  3AHU A;  5GAM d;  3I9Q A;  4BDZ A;  2P84 A;  3QWX X;  1VQO T;  1WGS A;  5GAO n;  2OJ2 A;  4MDX A;  1A0N B;  3CBO A;  1H64 1;  3OS5 A;  1N8R C;  1VQ6 A;  1VQP A;  2CT4 A;  5KE3 A;  2KYM A;  4II1 A;  1PG5 B;  5GJV B;  5KH6 A;  2KSS A;  2SRC A;  2C06 A;  1PSE A;  3JCM P;  3EFS A;  2KE9 A;  4J8O A;  3VRZ A;  1R0C B;  1ZUU A;  3G71 A;  2KRO A;  4QVD A;  4J9C A;  2JJ9 A;  5GAN d;  2LJ3 A;  4BE2 A;  3CCM T;  1B3Q A;  2LT1 A;  1Q7Y U;  3RES A;  1V1C A;  1OX8 A;  3J80 E;  1PKS A;  1KQS P;  3CPW A;  2FPD A;  4C92 B;  2QEX Q;  2OTL A;  1YFN A;  2AHJ B;  4LE9 A;  3VS0 A;  4KUD K;  1AEY A;  1Y7X A;  1HSQ A;  2EQM A;  2YUP A;  1G3T A;  4DBH A;  2HDA A;  2YLC A;  2JOY A;  3A8G B;  1PCX A;  2DBM A;  3CCS Q;  2H3J A;  3MHX A;  3SWN B;  1KJW A;  2YUQ A;  4HCZ A;  2E65 A;  3VS6 A;  2PQW A;  4JS4 A;  2RN8 A;  2GNC A;  3M53 A;  1VQ5 A;  2DF6 A;  3CMA A;  4RTW A;  1H92 A;  3TSW A;  4VUB A;  1X01 A;  2LNV A;  3ER0 A;  3QYG B;  2CH4 W;  2M1H A;  1M30 A;  2EPD A;  2DFU A;  2JMC A;  1OX9 A;  2KR3 A;  1NYF A;  2H8H A;  4PJM A;  1AHJ B;  2LC4 A;  2E3I A;  1ABQ A;  5KYY B;  2PNI A;  1G3S A;  1YHQ Q;  1GL5 A;  4RG8 A;  2BZ8 A;  3JCM X;  3A5Z B;  1UTI A;  4JRQ A;  2ROL A;  1YBY A;  5A0G A;  1UB4 A;  2M02 A;  2MMP A;  2L2P A;  5LJ3 j;  3H41 A;  1N8R R;  3NHN A;  4BY6 C;  1NM7 A;  2JN0 A;  3BFM A;  1TTH B;  4QT7 A;  4O5V A;  1ZLM A;  2DL4 A;  2EYW A;  4C8Q G;  2CZ0 B;  1JJ2 A;  1ABO A;  1Y71 A;  4BI4 A;  2JNG A;  4F16 A;  3RDV A;  5KE2 A;  2DIL A;  3EH2 A;  1B34 A;  3VYH B;  1N9R A;  1QMC A;  1YJN A;  3RBB B;  3JCM e;  1QCF A;  3MP6 A;  2FEI A;  4L59 A;  2CT3 A;  3I55 T;  4KH1 B;  1G8X A;  4JDS A;  5GAN j;  3UWN A;  1KQ1 A;  3OYL A;  1QWE A;  5KCO A;  1EX4 A;  1XQH A;  4EDU A;  4C0D B;  4AG1 C;  2WAC A;  4N0A C;  3A8M B;  1D3B B;  2DYI A;  3DB3 A;  2OX7 A;  1FX7 A;  3M54 A;  2XDD A;  2NUT A;  4ZTF A;  2D1X A;  4ZGE B;  2K5F A;  1P92 A;  2MAM A;  4J5Y A;  1ZSG A;  4CC4 B;  1AOJ A;  2L3Q A;  2J6F A;  3H0F A;  2LP5 A;  3CCV A;  4OML A;  2R57 A;  3CBM A;  2VWF A;  3VUB A;  4R0K A;  4TVR A;  3UT1 A;  2PU9 B;  4O6J A;  4C92 F;  1OEB A;  2RQW A;  1K73 U;  2RHU A;  2PVD B;  3E9G A;  3CQT A;  2C0O A;  4IUT A;  3C12 A;  4RTU A;  5C6S A;  1XJW B;  4M77 F;  1M9S A;  3FEO A;  3RUX A;  1M90 C;  1RAD B;  3OB9 A;  3CME A;  1I07 A;  3H0I A;  3O5Z A;  1AWO A;  3MP1 A;  4ORZ A;  2O2O A;  1VQ4 A;  1KD1 C;  1K9M U;  2ZPI B;  1VQM A;  2CRE A;  3JB9 H;  3GPL A;  1M1G A;  1PD0 A;  3A98 A;  2HQE A;  4OP0 A;  3M4G A;  4JRI A;  2KNB B;  1YJ9 Q;  2EFI A;  4C5I A;  2ZZD A;  2HNI A;  4M75 B;  4EMK C;  3PMT A;  4C0Z A;  4C0F A;  4J83 A;  4EPC A;  2A37 A;  1NEB A;  4PK4 A;  1C0M A;  3I56 Q;  3M0U A;  1TG0 A;  1GCQ C;  3H6Z A;  2WSF E;  2FRY A;  1VQK Q;  4C92 D;  3EGX B;  4C92 E;  3EFO A;  5I11 A;  1V76 A;  2LNH B;  3M0R A;  5IHK A;  3OMC A;  4M7D C;  1M27 C;  2XDB A;  2FL7 A;  4HCB A;  2A3L A;  5GAN 8;  1I5O B;  1SPK A;  5LJ5 g;  4FW2 A;  2HEQ A;  4F14 A;  1OU9 A;  2RD1 A;  1YJN T;  1UG1 A;  2CP5 A;  4Y92 A;  3EAE A;  3REA B;  4A4E A;  2JVV A;  1YIT Q;  3VUZ A;  5A0D A;  2DK3 A;  4PLI A;  4GLM A;  4FM4 B;  5IHI A;  2QQ9 A;  4C8Q C;  3RKW A;  2RHI A;  2HL5 C;  3NTH A;  1Y96 A;  1T3L A;  3QWY A;  2QQS A;  2VC8 A;  1JEG A;  5FU6 C;  3PTA A;  2A36 A;  2RHZ A;  5FRO A;  2F2W A;  4YTL A;  4CI0 C;  3FB9 A;  3MCA B;  2GTO A;  3U23 A;  1R0B G;  1VQL A;  2LJ0 A;  2LX9 A;  5L8R E;  4F7U A;  3CCJ A;  3MO8 A;  4E7L A;  4DBQ A;  2EIF A;  4R55 A;  4V2S A;  1WPY A;  3VYG A;  2DIQ A;  2CZ7 B;  2NLU A;  1I0C A;  1JXO A;  1BB9 A;  1IHW A;  2DXC A;  1WIE A;  1M90 R;  1ZSZ C;  2HQH A;  2EYQ A;  1GBR A;  2KXD A;  9ATC B;  1KD1 R;  3ASK A;  3CXC A;  2E6Z A;  1MMN A;  2O88 A;  1D1B A;  1VQ7 Q;  4HCK A;  3OY9 A;  2L3S A;  2L3P A;  2O31 A;  1MMG A;  3OYF A;  4KH0 B;  3QO3 A;  1K0X A;  1W2B A;  2YDL A;  3JCM d;  2FRW A;  3H9N A;  4GY5 A;  2DTH A;  2GF7 A;  3OYG A;  3V7R A;  5DLO A;  3HL8 A;  4DA4 A;  2K3X A;  1TSF A;  1NZ9 A;  3JCM J;  2BE9 B;  2DEQ A;  1W70 A;  1WNL A;  1WLP B;  1YJW A;  2EYX A;  2O9S A;  4OMQ A;  1AT1 B;  3SWN A;  2X4J A;  2R58 A;  4C0G A;  3OW2 A;  3GP8 A;  4F7U G;  4A4H A;  2QGF B;  2QTX A;  2D6F A;  5GAO q;  3JRZ A;  3HRT A;  2M0O A;  3E19 A;  2DM1 A;  1W4S A;  3M0Q A;  2O9V A;  2DAQ A;  2VVK A;  1QCN A;  2HL3 A;  4IUP A;  3QZ9 B;  1BKB A;  5CKH A;  1ZQ1 A;  5HK3 A;  5I2S A;  4QVC A;  2MWO A;  3PFS A;  2MWP A;  1EZZ B;  2DRM A;  1KHI A;  4RTT A;  2DXU A;  5GAN 2;  7AT1 B;  4MZP A;  2LQW A;  2E10 A;  3EG3 A;  5GMK i;  2DLP A;  1IGU A;  3OYJ A;  5KYY A;  3CD6 T;  2EGE A;  4FCY A;  3G7Z A;  5D6W A;  4FYV B;  1IB8 A;  4C92 G;  2NUT B;  1KIK A;  1E7O A;  2OI3 A;  3QII A;  2YRC A;  4E7I A;  3TEE A;  4JLI A;  1K9A A;  2QYZ A;  4E2F B;  2ZPH B;  4M75 D;  2PTK A;  4RMO A;  1M1K U;  4E7K A;  1UJY A;  3MEA A;  1IGQ A;  2K3B A;  1VQO A;  1Y0M A;  5IN1 A;  2FZK B;  2KYB A;  4BAC A;  1D1C A;  1U3O A;  2NYS A;  5D6Y A;  3H8Z A;  2MI6 A;  3V8K A;  4J6X A;  5EG2 A;  1Q82 C;  3DKM A;  5LJ5 e;  5GAN 7;  4QQD A;  2K5L A;  4DOW A;  5FWB A;  1VUB A;  5A0L A;  3FC3 A;  2RI3 A;  2VGN A;  2K4Y A;  3VS7 A;  3CC2 T;  2IVW A;  2YUO A;  2HSE B;  3VS3 A;  1SHF A;  1RAB B;  2XMF A;  4MZM A;  3CCQ T;  1S72 T;  1LNX A;  1MNE A;  3CCM A;  1X2Q A;  2VXE A;  2JT4 A;  3WVE B;  4E7H A;  3LWI A;  2DIG A;  2AZS A;  2QGG A;  1K8A U;  2QA4 T;  2K5I A;  3TU4 K;  2OAW A;  4KGV B;  1NYG A;  3FJ5 A;  1RI9 A;  5GAM h;  5ECA A;  1G3W A;  2L5Q A;  3CEY A;  5KYN A;  4M7A D;  2F5K A;  4BD3 A;  3TRE A;  3HFO A;  1G3Y A;  5J26 A;  1M3A A;  2JZ2 A;  1QP3 A;  2AK5 A;  4PFP A;  5FW9 A;  3JB9 J;  3EFO B;  3HTR A;  2XU8 A;  2CYZ B;  1KQ2 A;  3CCU T;  2E70 A;  1BU1 A;  2XI9 A;  2RQV A;  3X26 B;  2JTM A;  8AT1 B;  2DTO A;  4L5G A;  2Y4X A;  2JS2 A;  1JU5 C;  2DD5 A;  4QW2 A;  3OYH A;  3RNJ A;  3QXE B;  4BE1 A;  3CCE T;  2XKO C;  5GAN h;  4LXC A;  3UA7 A;  1U1S A;  2COW A;  1VQ8 Q;  4J9F A;  1QVG P;  1G83 A;  4J7I A;  4XU2 A;  4ATO A;  2DD4 A;  4M75 A;  1Y96 B;  1E6H A;  2JXB A;  5DY9 A;  5I2M A;  3EGD A;  5HK0 A;  3CXC S;  1X6G A;  1SEM A;  5IHN A;  3HHT B;  1YIJ Q;  2GBQ A;  2EVR A;  2HCK A;  1Y07 A;  2H3E B;  1QP2 A;  2LT4 A;  2ED1 A;  3EGX A;  4Y28 E;  4F7U B;  1D0Z A;  1K8A C;  3JV3 A;  5FWC A;  3L1A A;  3TQ7 P;  3PIO A;  1QWF A;  3S3N A;  4J7F A;  3X28 B;  1X6B A;  2LQ8 A;  4M78 B;  4BI8 B;  1YI2 Q;  1PD1 A;  4C92 C;  1Q82 R;  3HPW A;  4ESR A;  4JZ4 A;  3NTK A;  1OV3 A;  3SB2 A;  1KC8 U;  4M77 C;  4B9X A;  3CC7 T;  1VQ6 Q;  2HMA A;  1FMK A;  1VQP Q;  2D9T A;  3I55 A;  1B07 A;  1VQN T;  4JZ3 A;  3CCL T;  4JRK A;  5CVI A;  3EGU A;  3CC4 T;  3PNW C;  4M7A A;  5FRN A;  2HBW A;  3QYH B;  2KVQ G;  1TU0 B;  3OYC A;  3G71 Q;  3KBG A;  3LGL A;  3P8H A;  5GMK l;  1OU8 A;  1HD3 A;  4M75 G;  1MND A;  3GF5 A;  2J6O A;  4ZNX A;  3BDU A;  5KYU A;  1WXU A;  2CSQ A;  4A4G A;  1WA7 A;  2BZY A;  2OTL Q;  4IUV A;  2LZ6 B;  2Y90 A;  2GFU A;  4OMN A;  3F70 A;  4LN2 A;  5CK9 A;  2QQB A;  3DLL A;  2OTJ T;  4IKF A;  2COY A;  1X2K A;  5GAO r;  4LDW A;  1M5Q 1;  2J6K A;  3OYE A;  5GJW B;  2QDL A;  3UA6 A;  2LTO A;  1CSK A;  1WXB A;  1ZBX A;  1ZUK A;  2I0N A;  2DVJ A;  3CBP A;  1X75 C;  1VQ5 Q;  2O01 E;  2RJD A;  3HRU A;  1M8M A;  2DVE A;  1D09 B;  3CMA Q;  1WQ7 A;  3R6N A;  2JTF A;  2XG8 D;  3M9Q A;  4KUI A;  5LJ5 d;  4FIB A;  2EBP A;  2X35 A;  2PUK B;  4M7A G;  2EQK A;  3QJ6 A;  2DX1 A;  3G4S A;  1Q95 G;  4JJB A;  1Q7Y C;  5GAM j;  4E47 A;  3VU3 C;  2ECZ A;  5A2Q E;  4C5H A;  1QVF A;  3OMG A;  3OS0 A;  4ZN3 A;  1K8A R;  2MCN A;  3LW5 E;  1Q86 U;  2BIV A;  2GTJ A;  1MHN A;  2GQV A;  5GAO p;  1WJR A;  4KT0 E;  1Y57 A;  1MV0 B;  4HT9 A;  2D8J A;  2QK0 A;  2ENM A;  3ZL7 C;  3SDZ A;  1N27 A;  1ARK A;  2DXT A;  2BKD N;  2F2X A;  1WHG A;  2RF0 A;  4KGZ B;  1IO6 A;  1B7T A;  1K0S A;  3LX7 A;  4F7U F;  3THK A;  4WCI A;  1I81 A;  4XTU A;  4RCC A;  2X51 A;  1G5V A;  3KXT A;  2SEM A;  4D6W A;  2RHX A;  1YN8 A;  1OI1 A;  4RTY A;  2CZ1 B;  3DB4 A;  4OB1 B;  3OBW A;  2QEX T;  2DYB A;  3C94 A;  2KK4 A;  3R6O A;  2DA9 A;  2ZAE A;  1S1N A;  1VYU A;  2AZV A;  2PVG B;  3HSB A;  5LJ3 g;  5GMK m;  1QQJ A;  4BY6 B;  3CCS T;  4HKE A;  4MZT A;  3BE3 A;  2DKG A;  4LD9 K;  1W6X A;  4FW1 A;  2CP6 A;  3A8H B;  1OYX A;  1FMW A;  2J7I A;  4NL3 A;  1TUC A;  2FPE A;  3URG A;  1M2O A;  2QQR A;  3HP9 A;  4J9I A;  3I5R A;  4JLG A;  4RTX A;  1Q86 C;  1KQS A;  1T0H A;  3M0P A;  2BE7 D;  4F7U E;  3JCM b;  4KUL A;  3CCV Q;  3L2Z A;  2X4X A;  3X20 B;  2HBP A;  3JB9 D;  4LUE A;  4M78 D;  4L6V 5;  3CCR A;  1NLP C;  3S3O A;  5GAN g;  5DM7 R;  3J7A F;  3JAM E;  2D8H A;  3EG1 A;  1M4Z A;  1WHK A;  3CME Q;  1RUW A;  1PHT A;  3FLG A;  4N4G A;  4HVV A;  1GBQ A;  5KYX B;  3G4S T;  1K76 A;  1VQ4 Q;  2BZX A;  2JS0 A;  1GFC A;  1VQM Q;  4FT2 A;  1AVZ C;  3EGD B;  1JQQ A;  4RKU E;  1Q7Y R;  2A08 A;  1YHQ T;  2XDP A;  3L2R A;  4FYX B;  5GMK e;  1BCO A;  4PJO A;  2VV5 A;  4Q5W A;  2C0T A;  3BDL A;  3VV0 A;  1PRL C;  1WX6 A;  3CPW S;  1N6A A;  2RM4 A;  2VGM A;  5AYF A;  1SRM A;  2NWM A;  3MPU B;  3SFM A;  1WDX A;  4QKU A;  2W0Z A;  4HA8 A;  1BI3 A;  2ZPB B;  4BE0 A;  4A4K A;  1Q81 U;  1RAC B;  5GAN 5;  4XU0 A;  1AWX A;  4XTY A;  3A1P A;  1BI1 A;  3M59 A;  1K73 C;  3SD4 A;  3JCM W;  1M1F A;  4QQG A;  4PNO A;  5GAM f;  3TCJ A;  3G6E Q;  1HK9 A;  4HVU A;  3ZBD A;  4UC4 A;  2D0Q B;  2QXF A;  1SRL A;  3FDR A;  3PVL A;  5LJ3 f;  2HAX A;  1UEB A;  3BY7 A;  1K9M C;  4M7A B;  2JM8 A;  2X4Y A;  3JCM h;  2LJ1 A;  3CD6 A;  5GAN 4;  1KK7 A;  2EAY A;  4N4H A;  3QKJ A;  2EQJ A;  1U06 A;  3QZ5 B;  1X27 A;  2P0Q A;  2MPX C;  2LDM A;  3FJP A;  5HKC A;  2DJZ A;  1NJI U;  4D8K A;  1RAF B;  4JPB W;  4M4Z A;  2E3H A;  5KYU B;  2EJ9 A;  4LUD A;  2ROT A;  1TS9 A;  3A8O B;  4D8D A;  4PJO G;  4M7D B;  5GAN f;  2L89 A;  4M78 A;  2YXY A;  4XTX A;  2RI2 A;  1TH7 A;  3EG0 A;  3L42 A;  3RR6 A;  1RAI B;  2Z0W A;  4PFZ A;  5GAN 3;  1VQL Q;  4ELZ C;  2QG9 B;  1QVF S;  2YWW A;  3CCJ Q;  2HKN A;  3EFR A;  2B86 A;  2FB7 A;  3CCR T;  6AT1 B;  4NOY A;  2MYS A;  1ZUY A;  3S3M A;  4ZGJ B;  1RAA B;  2KY9 A;  1Q81 C;  1MMD A;  3CC2 A;  1JJ2 S;  2AIR B;  3VS4 A;  3E9F A;  2EWN A;  1X43 A;  2FZC B;  4AT1 B;  2QAZ A;  1K4U S;  1YJ9 T;  5FU6 B;  1KSW A;  4MMK A;  3CCQ A;  1S72 A;  1VQ7 A;  2M16 A;  3OYI A;  2IIM A;  1XNI A;  2ZPF B;  4DEX A;  2KDS A;  2RJE A;  1VIE A;  4FT4 A;  1KG1 A;  2QA4 A;  3L2W A;  2RB6 A;  2DEU A;  1NBE B;  3I56 T;  3UF4 A;  1LOJ A;  2EYZ A;  2K3Y A;  1VQK T;  4XU1 A;  3E1S A;  1RI0 A;  5LJ3 e;  2ZPE B;  1WJQ A;  4M75 F;  5CCA A;  1NJI C;  4A63 B;  1M3B A;  2AT1 B;  3MET A;  5D7U A;  3BW1 A;  1BK2 A;  3JB9 G;  1YJW Q;  4FSX A;  4M78 G;  3CCU A;  3JCM c;  1ZSZ B;  2V1R A;  4A53 A;  3H0H A;  1VQ9 A;  3LLR A;  5IH2 A;  3TSZ A;  1OPL A;  1OUL A;  1K73 R;  1PRM C;  1N9S A;  1YIT T;  1J3T A;  1WHH A;  2KXC A;  1EFN A;  1ZHI A;  3CCE A;  1KQS S;  1K1Z A;  2KT1 A;  3QG1 A;  2KBT A;  1C6V X;  1K9M R;  4RCB A;  2YUN A;  1WQW A;  3OBY A;  2KEA A;  2RJF A;  3FRN A;  3VKI A;  2RMO A;  4IIO A;  2L3R A;  1UGP B;  3MEW A;  2LQK A;  2RI5 A;  5D6X A;  4RUG A;  4JJN K;  2JMA A;  2P4R A;  2LMJ A;  4AMC A;  4M75 E;  1RAE B;  4HCC A;  2RNA A;  4M7A F;  4X34 A;  5FU7 B;  4RG2 A;  1E6G A;  1BBZ A;  3V8L A;  4PFO A;  4FYW B;  2KQW A;  1HYO A;  4QQ6 A;  4Z8A A;  1VQO Q;  4XTZ A;  2JUF A;  1I1J A;  2D0N A;  3CC7 A;  3V7C A;  2RK2 A;  2EKH A;  1WHL A;  5CKD A;  3PVQ A;  3CPW P;  1RLQ C;  2LCS A;  1VQN A;  2YHT A;  3CCL A;  1VQ7 T;  3CC4 A;  2IPO B;  2F5T X;  2VUB A;  2GFA A;  1NG2 A;  4LDX A;  4XQ3 A;  4X9C A;  1ACM B;  1RLP C;  1YP5 A;  1TWB A;  5EC7 A;  4E6R A;  3CCM Q;  4M7A E;  4PJO B;  4Z02 A;  3ME9 A;  1IZ6 A;  1X69 A;  4J6Y A;  4XU3 A;  1GXI E;  2K79 A;  3NFC A;  2L8D A;  3RER A;  2CKK A;  4BI3 A;  1M1K C;  1T3S A;  4ANJ A;  2OTJ A;  4WTO B;  1N8R U;  1VQ9 T;  4M7D D;  1MUZ A;  1PKT A;  4LNP A;  3EG9 B;  4A54 A;  2YRV A;  3GBQ A;  1U1T A;  4X9D A;  3MP8 A;  1JBM A;  4JRP A;  4N0A A;  2M51 A;  2RO0 A;  5I21 A;  2ATC B;  2P0P A; 
#chains in the Genus database with same CATH homology
 2DX1 A;  3M0U A;  1TG0 A;  1GCQ C;  2ABL A;  2FRY A;  4JJB A;  3NGP A;  3VS2 A;  1AWW A;  2ED0 A;  5I11 A;  2LNH B;  2ECZ A;  3M0R A;  2M0Y A;  5IHK A;  1M27 C;  2MCN A;  1SPK A;  2GTJ A;  2YT6 A;  4RTV A;  2HEQ A;  4F14 A;  1Y57 A;  1UG1 A;  1MV0 B;  1JXM A;  1YNZ A;  4Y92 A;  2D8J A;  2EW3 A;  2ENM A;  3REA B;  3UAT A;  3ZL7 C;  2CDT A;  1ARK A;  4GLM A;  2F2X A;  1PNJ A;  4Z88 A;  5IHI A;  1UGV A;  2FPF A;  2RF0 A;  3VS5 A;  2AKL A;  1AWJ A;  1IO6 A;  1K0S A;  2X3X D;  3KFV A;  1KFZ A;  2KRS A;  2YSQ A;  3THK A;  1MV3 A;  2JTE A;  4WCI A;  2CH4 A;  1T3L A;  3QWY A;  1XOV A;  1LCK A;  1JEG A;  4GBQ A;  2SEM A;  1VA7 A;  2A36 A;  3NMZ C;  3EHQ A;  2F2W A;  1YN8 A;  2GTO A;  2DL5 A;  4RTY A;  3U23 A;  4F17 A;  1UE9 A;  2LJ0 A;  2F2V A;  3ULR B;  3C0C A;  2LX7 A;  2DYB A;  1AZG B;  1FYN A;  1WXT A;  4OMO A;  2DA9 A;  2G6F X;  4AFU C;  4RTZ A;  4J9E A;  1S1N A;  1VYU A;  2AZV A;  1GCQ A;  2MIO A;  1JXO A;  1I0C A;  1UDL A;  1BB9 A;  1YCS B;  4K11 A;  4CC3 A;  3I35 A;  4J9B A;  1W6X A;  5L23 A;  1WIE A;  2J7I A;  1TUC A;  2W10 A;  2FPE A;  2X3W D;  1UFF A;  1GBR A;  2KXD A;  1AD5 A;  4J9I A;  3EHR A;  3I5R A;  4RTX A;  1T0H A;  2FO0 A;  3M0P A;  1SHG A;  2MOX A;  2CUD A;  2DE0 X;  2O88 A;  2KRN A;  3LH5 A;  4LUE A;  1NLP C;  1M3C A;  4HCK A;  2DNU A;  3VS1 A;  2L3S A;  2L3P A;  2O31 A;  2NUZ A;  4HVW A;  4HXJ A;  1K0X A;  2VKN A;  2D8H A;  2GQI A;  1WI7 A;  2YDL A;  1Z9Z A;  2EQI A;  1GCP A;  2FRW A;  3EG1 A;  4DEY A;  2AKK A;  4J9H A;  4JJC A;  1RUW A;  1PHT A;  2LQN A;  1H8K A;  1TUD A;  2DMO A;  2DL8 A;  2EGA A;  4HVV A;  1GBQ A;  1W70 A;  1K76 A;  1WLP B;  2BZX A;  2GGR A;  2JS0 A;  1GFC A;  2EYX A;  2O9S A;  4OMQ A;  1AVZ C;  1JQQ A;  2A08 A;  2KGT A;  1NLO C;  1ZBJ A;  1UEC A;  2DBK A;  2C0T A;  2DJQ A;  4FSS A;  5IXF A;  2K6D A;  1CKB A;  5I22 A;  1PRL C;  1WX6 A;  2J06 A;  2DM1 A;  3M0Q A;  2O9V A;  4J9D A;  2VVK A;  2FG0 A;  1SRM A;  1UUE A;  1ZX6 A;  2NWM A;  1WDX A;  2W0Z A;  1VYV A;  2DL3 A;  2HSP A;  2L0A A;  1AWX A;  2DRM A;  1T0J A;  4RTT A;  1JO8 A;  3EG2 A;  2V1Q A;  2LQW A;  5HCK A;  3EG3 A;  1GRI A;  1YWO A;  4KRT A;  2DLP A;  4HVU A;  2CUB A;  2EGE A;  2RQT A;  1WFW A;  1SRL A;  3PVL A;  3I9Q A;  3QWX X;  2JM8 A;  1KIK A;  2K9G A;  2LJ1 A;  2OJ2 A;  1VYT A;  1E7O A;  2OI3 A;  1A0N B;  1K9A A;  1U06 A;  2PTK A;  1X27 A;  2CT4 A;  2A28 A;  1UJY A;  2KYM A;  2K3B A;  5GJV B;  1Y0M A;  2SRC A;  4D8K A;  4JPB W;  4M4Z A;  2KYB A;  5IXB A;  1U3O A;  4LUD A;  4OMP A;  2ROT A;  4D8D A;  2KE9 A;  2JM9 A;  2EYY A;  3VRZ A;  1ZUU A;  2KRO A;  3EG0 A;  4EIK A;  4J9C A;  2LJ3 A;  5FWB A;  3VS7 A;  3NPF A;  2B86 A;  1B3Q A;  2YUO A;  3M0T A;  1UJ0 A;  1V1C A;  4AFQ C;  1PKS A;  3VS3 A;  1UHF A;  2ESW A;  1SHF A;  1ZUY A;  2FPD A;  2XMF A;  4LE9 A;  3VS4 A;  1X2Q A;  3VS0 A;  1AEY A;  4JJD A;  1HSQ A;  1X43 A;  2JT4 A;  2YUP A;  4IIM A;  1K4U S;  2HDA A;  1KSW A;  1QKW A;  2AZS A;  2DBM A;  2IIM A;  3SHW A;  2OAW A;  1KJW A;  1NYG A;  3FJ5 A;  2YUQ A;  4DEX A;  1RI9 A;  1HJD A;  5ECA A;  3VS6 A;  2RN8 A;  2GNC A;  1M3A A;  2AK5 A;  2DF6 A;  5FW9 A;  4RTW A;  1H92 A;  3UF4 A;  2EYZ A;  2BTT A;  3TSW A;  4CC7 A;  1BU1 A;  2RQV A;  4A63 B;  1M3B A;  4CC2 A;  2CH4 W;  1YWP A;  1BK2 A;  1M30 A;  1OOT A;  2EPD A;  2JS2 A;  1JU5 C;  1WYX A;  2V1R A;  3RNJ A;  2JMC A;  3H0H A;  2KT8 A;  2KR3 A;  5IH2 A;  1NYF A;  2J05 A;  1OPL A;  2H8H A;  3TSZ A;  1PRM C;  3UA7 A;  3PE0 A;  4J9F A;  1ABQ A;  1G83 A;  1J3T A;  1W1F A;  2PNI A;  2KXC A;  1EFN A;  1GL5 A;  1E6H A;  2JXB A;  2BZ8 A;  1K1Z A;  2KT1 A;  1UTI A;  2KBT A;  1H3H A;  2ROL A;  1U5S A;  3M0S A;  1X6G A;  1SEM A;  5IHN A;  1N5Z A;  2L2P A;  2GBQ A;  2EVR A;  2HCK A;  2PZ1 A;  2YUN A;  3H41 A;  3IQL A;  3NHN A;  2KEA A;  1NM7 A;  3I5S A;  2ED1 A;  2RMO A;  4IIO A;  4QT7 A;  1AZE A;  1ZLM A;  2DL4 A;  2EYW A;  3JV3 A;  1ABO A;  5FWC A;  2K2M A;  1QWF A;  4F16 A;  2KRM A;  4RUG A;  1X6B A;  2JMA A;  2P4R A;  2DIL A;  2LMJ A;  2RNA A;  2E5K A;  1QKX A;  4X1V A;  3RBB B;  1QCF A;  2FEI A;  4ESR A;  4JZ4 A;  2CT3 A;  1OV3 A;  1E6G A;  1PWT A;  1BBZ A;  1FMK A;  1QWE A;  4AG1 C;  4Z8A A;  1B07 A;  4Z89 A;  1I1J A;  2D0N A;  2JW4 A;  4JZ3 A;  3EGU A;  4OMM A;  2HBW A;  2D1X A;  2EKH A;  3PVQ A;  4AFS C;  1RLQ C;  1Z9Q A;  2LCS A;  2EGC A;  1HD3 A;  1UHC A;  1ZSG A;  4CC4 B;  1AOJ A;  2L3Q A;  2J6F A;  2J6O A;  3H0F A;  4ZNX A;  2LP5 A;  4OML A;  2VWF A;  2C0I A;  1SSH A;  4R0K A;  2DL7 A;  1CKA A;  1NG2 A;  1WXU A;  2CSQ A;  3VRY A;  1RLP C;  1OEB A;  2RQW A;  1G2B A;  1WA7 A;  4J9G A;  3CQT A;  4AFZ C;  1YP5 A;  2C0O A;  4RTU A;  2BZY A;  5EC7 A;  4E6R A;  1NEG A;  2LZ6 B;  4OMN A;  4AG2 C;  4LN2 A;  1I07 A;  3H0I A;  1X69 A;  3O5Z A;  2RPN A;  2K79 A;  1AWO A;  3TVT A;  1X2K A;  2DRK A;  4ORZ A;  2O2O A;  2CRE A;  1T3S A;  2J6K A;  3A98 A;  1GFD A;  5GJW B;  2QDL A;  3UA6 A;  2KNB B;  1CSK A;  1WXB A;  1ZUK A;  3SEM A;  1MUZ A;  2I0N A;  1PKT A;  2DVJ A;  4LNP A;  1M8M A;  2CSI A;  3R6N A;  1OPK A;  3GBQ A;  1QLY A;  2RQR A;  2RQU A;  2K7A A;  3REB B;  2EBP A;  2M51 A;  2A37 A;  1NEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...