2VKNA

Yeast sho1 sh3 domain complexed with a peptide from pbs2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
DNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN SSU81
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vknA00
1BK2A 2CT4A 3I5RA 3JV3A 3SEMA 5FWBA 2FRWA 1BBZA 3UF4A 1E7OA 1UUEA 2BTTA 4HVVA 2GGRA 5IHNA 1UG1A 2K6DA 1SHFA 2ROLA 2D1XA 1CSKA 5FWCA 5EC7A 1XOVA 3EG0A 3I35A 2M0YA 2EVRA 4RTWA 3ZL7C 3CQTA 1GBQA 2X3XD 2EGEA 1QKWA 2AZSA 3A98A 1ABQA 2HCKA 2L3PA 5IH2A 3RBBB 2RQUA 3PVQA 1AEYA 1RLPC 1JXMA 2NUZA 2YUPA 2DJQA 2DL7A 4Z89A 4HVUA 3TSWA 2SRCA 1W70A 3PVLA 1M27C 2VKNA 4LE9A 1KIKA 2GTJA 1G83A 1UECA 5IHKA 2O9VA 1T3LA 1K0XA 4JJBA 2D8HA 3KFVA 2EPDA 2A28A 3M0TA 1ZSGA 2ENMA 1K0SA 4ZNXA 2XMFA 4M4ZA 1ZUYA 2P4RA 4OMOA 1OOTA 2LNHB 3VS0A 1FYNA 3M0SA 2W0ZA 2K2MA 4LUDA 2DILA 2V1RA 1H8KA 1W1FA 2K79A 1WX6A 2SEMA 4DEYA 1JU5C 2EYXA 2JW4A 2L0AA 1VYTA 3M0PA 1YWPA 4IIMA 4JPBW 4EIKA 1JO8A 2O31A 4J9BA 1YNZA 4F14A 4J9HA 1ZX6A 4ESRA 1M30A 1WA7A 2KROA 1JXOA 2G6FX 3NMZC 2OI3A 4CC3A 2AZVA 4K11A 1SRMA 2JS2A 3EHRA 1BB9A 2KXDA 4Z88A 1NG2A 4LUEA 1H3HA 3VRZA 1K1ZA 4JJDA 1GCQC 1T0HA 2A08A 2OJ2A 4A63B 2VVKA 2JS0A 2RQWA 3U23A 2LQWA 2V1QA 2KGTA 2FPEA 4LNPA 2RMOA 1W6XA 1I1JA 1MUZA 2K9GA 2JTEA 1SRLA 2DA9A 2EGAA 2MOXA 2W10A 3VS6A 1ABOA 2YSQA 1PKSA 2KT1A 3VS2A 5IXBA 2DLPA 1K76A 3PE0A 4CC4B 2BZYA 3THKA 2EQIA 2YT6A 4J9EA 3ULRB 2LZ6B 4RTXA 1QWEA 1UTIA 1U06A 1RI9A 4GBQA 2KXCA 2GQIA 3QWYA 3EGUA 1SPKA 2OAWA 1M3BA 1E6HA 1PRLC 5ECAA 2MIOA 2FO0A 4ORZA 2DBMA 4D8DA 3H0IA 2LJ0A 2YDLA 1B3QA 2J6KA 3VS1A 1NEGA 1X6GA 4KRTA 1OEBA 4F16A 2PNIA 1AZGB 3EG3A 5GJVB 2ABLA 2GNCA 2J7IA 4J9GA 2KRSA 3QWXX 3M0UA 1X43A 4HCKA 2HDAA 2E5KA 2EBPA 2M51A 1GBRA 1AVZC 1V1CA 1CKAA 1AWXA 2DBKA 2C0TA 3VS4A 1WXUA 5IHIA 2L3QA 2RN8A 1J3TA 2DF6A 2HEQA 2CSIA 2EYZA 1WYXA 2KR3A 1UHCA 1HJDA 1UJ0A 1PHTA 1NLPC 1VYUA 2RNAA 1KJWA 1KFZA 2DRMA 2C0OA 2RQTA 1RLQC 4AG2C 2DNUA 1PRMC 2H8HA 2EW3A 3IQLA 1GL5A 2BZ8A 1FMKA 1JQQA 1U5SA 4OMLA 2DL5A 3VS7A 1PKTA 3I5SA 3EHQA 1SEMA 3EG2A 1M3AA 2PZ1A 2FEIA 1WXBA 2D8JA 1Y0MA 4JZ4A 2GTOA 5I22A 4DEXA 1A0NB 2DL4A 1RUWA 4AFZC 1ARKA 2RPNA 2GBQA 3NPFA 2JXBA 4J9IA 2LX7A 2KE9A 5IXFA 2VWFA 1TUCA 1S1NA 2JM8A 1TUDA 2EYWA 2CUDA 4Z8AA 1KSWA 4J9DA 2KT8A 2LJ3A 1UHFA 5GJWB 2L3SA 2YUNA 4RTYA 1UJYA 2DL3A 5I11A 4JZ3A 1TG0A 1B07A 2RQVA 2FG0A 3TSZA 4RUGA 2YUOA 3NGPA 2DX1A 2DM1A 3REBB 1E6GA 3R6NA 1ZUUA 1MV3A 2C0IA 2CH4A 3C0CA 2L2PA 1T0JA 4RTZA 4CC2A 1SSHA 1UGVA 2JT4A 1NYGA 2CH4W 2F2VA 2MCNA 2LP5A 2F2XA 1WIEA 1M8MA 2ED1A 2AKLA 4OMMA 2CDTA 2EYYA 1ZUKA 3RNJA 4X1VA 2FRYA 1OV3A 1GRIA 4RTTA 3EG1A 1ZLMA 4F17A 2RQRA 3H0HA 2K7AA 4D8KA 1OPLA 4GLMA 2J06A 1Z9ZA 2IIMA 2QDLA 1ZBJA 2LQNA 1NM7A 1PNJA 2F2WA 1H92A 1X2QA 1NEBA 1WDXA 1WFWA 2ESWA 1UE9A 2KRNA 3UATA 1WI7A 4AFUC 2J6OA 1VA7A 4J9FA 3UA7A 1I0CA 3FJ5A 1K4US 3TVTA 2YUQA 1QCFA 2B86A 1I07A 2NWMA 3NHNA 4AG1C 2CREA 2RF0A 1UFFA 2I0NA 4AFQC 2J05A 4WCIA 2ROTA 5HCKA 1Z9QA 1AWJA 1X2KA 1HD3A 2DE0X 1AD5A 1GCPA 4HXJA 4QT7A 2A36A 2EKHA 2LMJA 1PWTA 3LH5A 2KNBB 2A37A 2AK5A 1IO6A 1HSQA 1YWOA 1X69A 4OMQA 1BU1A 3I9QA 2KYMA 4LN2A 3H0FA 1AOJA 4RTUA 1SHGA 1QLYA 3VRYA 2CUBA 1AWWA 2LJ1A 1M3CA 1Y57A 4OMNA 2AKKA 1GFDA 1NLOC 2CSQA 2O88A 2DL8A 1OPKA 3VS3A 2CT3A 2ED0A 4JJCA 2HSPA 1YP5A 2K3BA 1U3OA 2KBTA 2DYBA 1QWFA 3M0RA 4E6RA 3GBQA 4IIOA 2KRMA 1YN8A 3SHWA 2PTKA 3VS5A 1X27A 2DVJA 4RTVA 1MV0B 2DMOA 1X6BA 3M0QA 2J6FA 1LCKA 1WXTA 3UA6A 4HVWA 4R0KA 1CKBA 4J9CA 1QKXA 4CC7A 4OMPA 2JMAA 2BZXA 1WLPB 1AWOA 1UDLA 1N5ZA 4Y92A 4AFSC 1EFNA 2HBWA 2D0NA 1GCQA 2ECZA 5L23A 3H41A 2LCSA 4FSSA 1K9AA 2EGCA 2X3WD 1YCSB 2JM9A 2O9SA 2KEAA 1NYFA 1T3SA 2JMCA 3REAB 1AZEA 5FW9A 2FPDA 2FPFA 2O2OA 1VYVA 2KYBA 3O5ZA 1G2BA 1JEGA 2DRKA 1GFCA
chains in the Genus database with same CATH superfamily
1BK2A 5GAN8 3M59A 4O6JA 2JTMA 3I5RA 3SEMA 2L3RA 1X01A 2QGFB 4C0GA 4CRIA 1BBZA 2M9UA 5FU6B 2BTTA 4IUQA 3RIRA 3CCRA 4HKEA 1UG1A 1KQ1A 5IAYA 2ROLA 1O9SA 2DAQA 3HFNA 4QQDA 4KGVB 4XTZA 5EC7A 1YIJQ 3EG0A 2VUBA 2XD0A 2M0YA 4M7AF 3HTRA 4RTWA 1FX7A 2E64A 3JCMb 5HK3A 3M58A 2LX9A 4MDWA 1G8XA 1QKWA 2EQUA 5GAN6 1UB4A 5GAMf 1YIJA 3NTIA 2QQAA 2RH2A 1S72A 3TSWA 5HK0A 2DXTA 3PVLA 4KUIA 2GTJA 3SWNC 8AT1B 1UECA 1K0XA 3S3OA 1VQOA 1ZSGA 1K0SA 1RAHB 3TREA 4M4ZA 2GF7A 1ZUYA 2P4RA 2DEQA 2LNHB 3A8HB 1BCOA 2OAUA 2I2LA 2V1RA 1DJ7B 2HBPA 1W1FA 4MZTA 1WX6A 2SEMA 4M7DB 3HPWA 4JRIA 1IGQA 1VYTA 1JO8A 4EDUA 5J39A 3OYJA 2L5QA 3G71Q 1WA7A 4IUUA 3JB9H 2ZCFB 1OQKA 3CMEQ 4K11A 1KC8U 2E1HA 2JS2A 3EHRA 3BY7A 3JCMe 1UGSB 3M9QA 4C92G 1WHKA 1GCQC 2EAYA 4PNOA 3G71A 4A63B 4ELZC 1RADB 2DFUA 4M7DF 3R6OA 3CMEA 3MEVA 3RKXA 3EGXB 1N6AA 4A4HA 3U23A 2KGTA 1ZSZC 3EH2A 1I1JA 2DA9A 2W10A 3VS6A 5LJ5d 3HP9A 1W2BP 1PKSA 2LNVA 2K5LA 1K76A 2LCCA 1VQMT 4QKUA 3THKA 5GMKl 2YRCA 3ULRB 5GANh 3V8JA 1OX9A 4RTXA 1UTIA 1VQKQ 1IREB 2KK4A 2LRQA 5ECAA 2MIOA 2FO0A 4XU1A 1G3YA 4JUVA 2FB7A 3CEYA 4ZGDB 2L8DA 3E19A 1M5Q1 1G5VA 1WHHA 4F16A 3M5AA 3FJPA 2LTOA 5GJVB 4RKUE 2ABLA 2GNCA 1VQPA 2COZA 4HCKA 4C5GA 2E5KA 4EMKA 5D6YA 4Y91A 1CKAA 2DBKA 3FC3A 1B7TA 4JS4A 1M2VA 5IHIA 2HEQA 2VXEA 4XTVA 1D1CA 3CCQQ 4LD6A 1PHTA 4WF2A 5KH6A 2A0FB 1NLPC 1K73R 3SB2A 1VYUA 4XTXA 5KYUA 1KJWA 1PM3A 4XQ3A 2BUDA 3G4SQ 1RLQC 1D1AA 2RK1A 3GPLA 2DD4A 4XK8E 3CCQA 5D6WA 3CCMQ 3VV0A 2EW3A 3IQLA 1IRXA 4DBHA 1K73C 1D09B 4A4KA 3H6ZA 4JRPA 2DL5A 5HKCA 3G4SA 1VOMA 1TSFA 5GAOp 1SEMA 3CCMA 4RCBA 2E6ZA 2HNIA 1Y0MA 4DEXA 2ZPFB 3QSUA 1I4K1 1RUWA 4RG8A 3OSVA 4DA4A 3L2VA 2M0OA 4FSXA 2KE9A 1TUCA 2JM8A 1GXIE 1TUDA 1I5LA 2EYWA 4PFOA 3O8VA 5GAN3 1RAGB 3MP1A 4ZN3A 5GMKj 1KQ2A 3JCMQ 3JCMX 4HCBA 2KT8A 2CP0A 5LJ3j 3OYBA 2L3SA 5LL6S 5I11A 1WJRA 3CCJQ 4M7AG 2FG0A 3TSZA 2Z0WA 1VQ9T 2KY9A 1YJNT 3QZ5B 3X24B 3URGA 3REBB 1OX8A 2RD1A 3C0CA 2F5KA 2L2PA 4RTZA 1SSHA 2RB6A 2F5TX 4FYYB 2CH4W 4P5NA 2LP5A 4J6XA 4ZGJB 3CXCA 2ED1A 2YLCA 4OMMA 3G6EA 2AHJB 4X1VA 3PIPA 1MNEA 2QTVA 3EG1A 1QVFA 3LH0A 1ZLMA 3H0HA 1V76A 5GAMe 1OPLA 4GLMA 2J06A 2QI2A 2EJFA 2IIMA 1VQ7T 1ZBJA 3MJXA 3ME9A 1YJWA 3CPFA 1X2QA 5KYXB 1WFWA 1UE9A 2KRNA 3CXCS 2X9HA 1WI7A 3UA7A 1WQ7A 3FJ5A 2JOYA 4C5IA 2JN0A 2EIFA 1QCFA 4DOVA 2YRVA 1I07A 4F7UE 2VXFA 3HHTB 1TWBA 2NWMA 2P84A 8ATCB 3I55A 4AG1C 3DB4A 1N27A 1K8AR 2OTLQ 1RACB 2QASA 2ROTA 1YHQQ 2PVOB 3EFRA 1R0CB 2HKNA 2EYQA 1AD5A 4HXJA 2A36A 1VQ7Q 3JCMd 3CC4Q 1KG1A 1IO6A 1HSQA 3CCLQ 2RJDA 1BU1A 2JVVA 3JB9I 4R55A 4M7DG 1YHQA 1N8RC 1VQ4A 3SWNB 1NLOC 2P4TA 3RESA 3CCST 3CD6Q 3PNWC 4EPCA 1QCNA 1YI2Q 3JB9F 4HCCA 1EZZB 2ED0A 2HSPA 1YP5A 2K3BA 4FT2A 1U3OA 1XQHA 4C0ZA 3E1SA 2HQXA 4IIOA 2PTKA 4RTVA 3BDLA 2BE7D 2LDMA 1W4SA 4M78D 3M0QA 2QQ9A 4M78A 2DETA 1PG5B 2DXUA 2E5QA 5GAN2 5KYWA 1QKXA 4M77A 4OMPA 3CCUT 1UGRB 2BZXA 1WLPB 4XU2A 1BKBA 3ZFJA 2A3LA 2K2VA 2BIVA 1D0YA 4E7IA 2D9TA 3JCMW 3I56Q 2OTJQ 2LCSA 2ZPGB 1WZOA 4FSSA 2EGCA 4A53A 2EQKA 3REAB 5FW9A 2NUTA 2O2OA 2HAXA 3MHXA 1VYVA 2KYBA 1RAIB 2CKKA 1VQ5T 3RMQA 1LNXA 1ZSZB 4E7ZA 1JEGA 3I56A 1ZHIA 1NPRA 5LJ3g 2FZGB 1ZA1B 4F7UB 2CT4A 2P0KA 3JV3A 5GANf 5FWBA 3LW5E 1KHIA 1KC8R 3QHSA 2K6DA 1Y7XA 1VQ6Q 4Y28E 2D1XA 5GAOm 3KUFA 1CSKA 4M75D 5FWCA 1XOVA 3CCEA 4M75A 4X9DA 4WTOB 2KMTA 3I35A 2ATCB 3MP6A 1AT1B 4C8QC 3CQTA 3OYCA 2DD5A 4F7UF 1OU8A 5LJ5j 2X3XD 2AZSA 3A98A 5IH2A 2HCKA 4BACA 1VQ8T 2RQUA 4XTYA 4C8QG 1JXMA 2NUZA 2C06A 2DJQA 3GOXA 3FIFA 1M2VB 3INZA 1M27C 4A54A 1FXXA 1KIKA 1VQNA 3X28B 3RUXA 1JB0E 4JJBA 1YJ9T 2RJCA 1W2BA 2E12A 4RCCA 3CXCP 4N0AC 2ENMA 2EFIA 3CC2Q 4OMOA 4RG2A 1FYNA 4AT1B 4LUDA 3CMAT 2DILA 4BI8B 1M1KC 2RK2A 3MO8A 1H8KA 3V7SA 3X25B 2M1HA 4DEYA 3LX7A 5AYFA 2L0AA 2LT1A 1YWPA 2O31A 1YNZA 2YXYA 2QQBA 4J9HA 4ESRA 2QEXQ 2X4XA 4NL2A 3SFMA 2OI3A 3SDZA 2AZVA 4GY5A 1M4ZA 4OGEA 1YJ9Q 1BB9A 2RHUA 2YLBA 3PTAA 4ANJA 2DZ9A 1NJIR 2NYSA 4HT8A 4J5YA 1Q82R 4KGXB 2R58A 5GAMd 5KYYA 4FIBA 4L59A 2RQWA 1H641 1X6OA 1LVKA 2COYA 2ZGWA 1NJIC 1W6XA 1Q82C 1MUZA 3WVDB 2FHDA 2MOXA 3RMSA 1FMWA 1ABOA 4LXCA 1TS9A 2KT1A 4E7JA 1I8FA 3OS5A 5IXBA 1N8RU 3GP8A 4CC4B 2EQIA 4J9EA 1HK9A 1JRIA 3QDFA 2LZ6B 4V2SA 2CZ0B 3VJPA 4GBQA 1U06A 2KXCA 2WSCE 4BUGA 4ORZA 4D8DA 5CK9A 5GAOn 4PL6A 3V8LA 1NEGA 3EFOA 1M2OA 1G3TA 4PJOD 4M77E 1Q81C 4PJOA 4IKFA 1WGSA 3BFMA 2XIDA 4J8OA 4MMLA 3VUZA 4MDXA 3GLXA 5GAOq 4BDYA 1X43A 4FCYA 4XU0A 2XKOC 4BE1A 2E65A 1GBRA 1QCOA 4QQ6A 4Z02A 1V1CA 1AWXA 3JB9G 1C6VX 1B34A 3VS4A 1C1AA 2E10A 1J3TA 5FRMA 3MP8A 5EG2A 2EYZA 2KR3A 1UHCA 4LDVA 4MMKA 4KT0E 5L8RE 1ACMB 1WHJA 2RNAA 4C0DC 1KFZA 2DRMA 2C0OA 2RQTA 4AG2C 4DOWA 1D3BA 1JBMA 3P8BB 2RHIA 4OF1A 2MF2A 2H3JA 2WSFE 1EX4A 2BZ8A 3QKJA 1FMKA 4OB2B 2JTFA 5LJ5g 4J7IA 1I81A 4KH1B 3NFCA 4XU3A 4QVDA 3T9NA 2BE9B 1TOVA 4A4EA 1UGQB 4MZMA 2R5MA 3OYGA 1Q95G 4AFZC 4BI3A 4C8QE 2KI7A 3OYLA 2RPNA 5M9OA 2FYKA 2GBQA 1M1GA 2JXBA 4J9IA 5C0MA 5IXFA 5GAN5 2VWFA 3VYGA 2FVUA 4ZTJA 2CUDA 2DTOA 1QVGA 2V8KA 2PVDB 4J9DA 5CKHA 1R8OB 3CBPA 1UJYA 3OYEA 2DL3A 4C92D 1TG0A 3G7ZA 4C92A 4PLLA 3V8KA 3QYGB 2DX1A 1E6GA 2H3EB 2AIRB 3R6NA 4F7UG 2C0IA 3QJYA 2CH4A 2XI9A 3X26B 5KCOA 1QVGS 2K3YA 1WQWA 4DQ2A 1KK7A 2JT4A 1NYGA 2F2VA 5AT1B 2MCNA 1BIAA 1M1KU 1BI2A 2CDTA 2DPPB 1ZUKA 4QW2A 1KD1R 1VQKA 2QTXA 3C95A 2PUKB 1MMGA 2WACA 4F17A 2X4YA 4D8KA 4EMKC 3UT1A 2RI3A 3E9GA 1Z9ZA 2QDLA 1KD1C 1NM7A 3EGDA 3OS0A 1PD0A 4A4FA 1H92A 1VQMQ 2PUOB 2DEUA 2YHTA 1C0MA 2RJEA 3PMIA 3OYAA 3OMGA 1I0CA 4FL6A 2QAZA 1K4US 5CO7A 3CCVT 2YUQA 4FM4B 3OW2S 2DZCA 1ZQ1A 4PJLA 1IGUA 1YITT 1NJIU 2I0NA 3JCMJ 1Q82U 5IN1A 3C12A 4C8QB 1X2KA 1HD3A 1NPPA 2EKHA 4XTUA 2A37A 2MPXC 2AK5A 4OMQA 2CP2A 1Y96B 3H0FA 4RTUA 1QLYA 2CUBA 1AWWA 2LJ1A 1QW1A 2AKKA 1GFDA 2COWA 2CSQA 2O88A 1Y71A 3OY9A 2X4WA 3V7RA 4B9XA 1Q81U 1I5OB 3M57A 4HA8A 1YITQ 3D7SB 4C8QF 4F04B 1WHLA 3EG9B 2KBTA 3VKIA 3S3NA 1YN8A 3VS5A 5J26A 2QDYB 9ATCB 4KGZB 3G6ET 5FROA 2V8JA 3UA6A 4R0KA 3LYIA 1XTDA 2P0PA 1UDLA 3OYKA 5GMKh 5GMKi 3HL8A 1YJWT 5LJ3h 2D0NA 2F1LA 4J7FA 2EWNA 1NZ9A 2ECZA 6AT1B 3H41A 2O4XA 3M4YA 3CCJA 2X3WD 3M56A 2O9SA 2JM9A 4M7AD 2JMCA 2FPFA 4ZTFA 2XK0A 1N9SA 2DO3A 1OZ3A 3JCMg 2DRKA 3I55T 2PVGB 4PKCC 1G3WA 3UF4A 1E7OA 1UUEA 4HVVA 2GGRA 1YJNQ 1VQ9Q 5IHNA 2CP3A 2X4JA 5GAMj 3KXTA 4FW1A 4JRQA 1QVGP 3QPHA 2EVRA 1YJNA 1VQ9A 3ASKA 4Q5WA 2OX7A 2L3PA 3RBBB 1RI0A 3HRTA 3PVQA 2YUPA 1N8RR 4Z89A 4HVUA 4BD3A 1PD1A 1BCMA 2VKNA 1VQLT 4C5EA 4E47A 3LWIA 2O9VA 2OTLA 3QXEB 2GFUA 2D8HA 4ZN1A 4KUDK 2A28A 3M0TA 4TVRA 4C5HA 1R77A 4ZNXA 2XMFA 4R56A 1VQ7A 2HZYA 1QP2A 3CC4A 3VS0A 3OW2P 3CCLA 2ZZDA 1G3SA 1TUGB 5CIUA 2W0ZA 5I2MA 2YRDA 1RABB 4M7DD 4C0DB 2KQWA 2QQRA 4FYWB 4M7DA 1JU5C 2EYXA 3CC7T 3M0PA 4JPBW 4M78C 4EIKA 4PJMA 1KD1U 3CD6A 4BE0A 4F14A 2NLUA 1YI2A 1ZX6A 1M30A 1MMAA 5GAOl 1TU0B 2DTIA 4M77C 1JXOA 3QIIA 1Q86C 2G6FX 3SD4A 2E41A 2KXDA 3MEWA 4Z88A 1H3HA 4M77G 1WPYA 2A08A 3CCSQ 3MCAB 7AT1B 2JJ9A 4MZPA 5HY6A 5A0GA 2JS0A 3EGXA 4N4HA 3FRNA 2V1QA 1KHCA 2F69A 2K9GA 1SRLA 2EGAA 3OB9A 2QG9B 1JJ2S 3VS2A 5CKEA 2JUFA 2WSEE 2O01E 2OTJA 1QWEA 1RI9A 3JAME 1XNIA 3QWYA 2G3RA 3EGUA 3LGLA 3A5ZB 3CCUQ 3E2UA 1E6HA 4M75C 2DBMA 4B9WA 2LJ0A 1B3QA 3VS1A 2LVMA 1SKUB 1VQNT 4OB3B 3S6WA 3CBMA 2PNIA 4O5VA 1AZGB 3CCUA 4FT4A 4GLKA 5CVIA 4IUTA 3QUIA 4C0FA 4J9GA 3OYNA 2KRSA 2XHCA 1VQ6A 3OYMA 1VQ5Q 4BDZA 3TU4K 3OBYA 2MAMA 1AVZC 4EMKB 3JCMP 3M4GA 2X35A 1OI1A 1WXUA 2QA4T 2DF6A 3OS1A 1VQ5A 5LJ5h 2Y90A 4FYVB 1Q7YC 4IUVA 5GAMg 1M1KR 4PFPA 4E2FB 3QDRB 4C8QD 5KYUB 3FDRA 2DNUA 3NTKA 1PRMC 2H8HA 1MHNA 2IG0A 1TH7A 5FLXE 3QBYA 1R0BG 1JQQA 1K9MC 3VS7A 1PKTA 4IURA 3BW1A 3I5SA 2MI6A 3CC2A 1VQ8Q 2GQVA 3EG2A 3L2UA 4E7KA 2HL5C 1M1FA 2PZ1A 3EFSA 2K5IA 2A7YA 4JDSA 1WXBA 2D8JA 4JZ4A 5I22A 1ZA2B 2CZ1B 2RO0A 1VQ8A 4AMCA 3MKDA 3NPFA 5J3BA 3QJ6A 3OMCA 3PMTA 1FWZA 3OSSC 1FMVA 3RKYA 2DIQA 2ZPIB 3RR6A 2QEXA 4FW2A 4FU6A 4LDUA 3CMAQ 1YJ9A 3DB3A 2ZPEB 3CCRT 1UEBA 4BY6C 2FZKB 1RAFB 1PSFA 5GJWB 1RAEB 4BI4A 2MYSA 5GAOr 1HYOA 1B07A 3AT1B 1OULA 2CZ6B 5I2SA 3JB9J 3TQ7P 2VGNA 1D0XA 2QK0A 1U1SA 2DM1A 5DY9A 1ZUUA 2NUPA 1AHJB 5LJ3f 1YIJT 4CC2A 2KDSA 1Q81R 1UGVA 2O4XB 1LPLA 2EJ9A 4PJOC 1NBEB 1WIEA 2F2XA 1S72T 1SSFA 4M78E 3M54A 2EYYA 5A0LA 1X75C 2QQSA 1GRIA 4RTTA 1VQOT 2HMAA 2K7AA 2HL3A 4J6YA 3ER0A 3OA6A 4EMGA 3J80E 1Q86U 4L6V5 5KYXA 1JJ2P 1WDXA 4XTWA 2ESWA 1D1BA 3UATA 4AFUC 1NE8A 1VA7A 3CPWS 3PGGA 1S72Q 3QG1A 1HXDA 3JSCA 2DK3A 3V7CA 3VYHB 2RF0A 1UFFA 2K57A 3JB9D 3A1PA 4AFQC 2J05A 5HCKA 1VQOQ 3N5BB 1AWJA 3S3MA 2DE0X 4QT7A 3EAEA 1PWTA 3LH5A 3G71T 2KNBB 1YWOA 4M75E 4VUBA 2KYMA 1AOJA 3CMET 5GAN7 3L42A 3RDVA 3WVEB 1SHGA 2E6NA 3VRYA 3C94A 1TXQA 3SWNA 1Y57A 2HSEB 1IXDA 4IUPA 2CYZB 4J6WA 4OB1B 3C4SA 2RHXA 3E9FA 4PK4A 2LQKA 2PQWA 3L2ZA 4LDWA 1M8VA 3UWNA 2DYBA 3GBQA 2IVWA 2EKOA 2KRMA 3QO3A 3OBWA 2DVJA 4X9CA 1X6BA 4C92C 2J6FA 2XICA 4JRKA 4M78B 5CR2A 4J9CA 1VQKT 2E3IA 5KYWB 4CC7A 4M77B 4OGCA 5GANe 1AWOA 1VQPT 1N5ZA 4Y92A 1Q7YU 4QQGA 1M90R 3CBOA 3JCMh 4AFSC 2GFAA 3TEEA 2HBWA 1GCQA 3H9NA 5L23A 5GANj 4DBQA 5FU7C 3ZBDA 1K9AA 1IHVA 2X51A 2XU8A 1NYFA 1M90C 1QVPA 1T3SA 2MWPA 3MPUB 1AZEA 2FPDA 1K9MU 4PJJA 4M78F 1U1TA 3A8GB 2NUTB 3O5ZA 1ZSZA 3J81E 2RM4A 1OYXA 3OW2A 4M77F 4F7UA 1Y07A 3PT9A 2DIGA 2FRWA 1MNDA 1SG5A 3CCQT 4OMFB 1VQPQ 5KCHA 1KQSA 3NTHA 1UGPB 3L2WA 1SHFA 2RJFA 3FLGA 3G4ST 4M75B 1TTHB 1QP3A 3CCMT 4FYXB 3ZL7C 1VQMA 4A4GA 1GBQA 2EGEA 1ABQA 3M55A 5KE3A 3JRZA 1AEYA 2AT1B 1RLPC 1KQSS 4PFZA 4D6WA 4JS5A 2DL7A 2SRCA 1W70A 2FZCB 4LE9A 2XDBA 4PJOE 2DXCA 1M9SA 2DVEA 1G83A 5IHKA 1T3LA 2V26A 4M75F 5LJ5f 3LLRA 2GCXA 3KFVA 1RL2A 2EPDA 4LD9K 3VUBA 2EQMA 5GMKm 1PCXA 3OYYA 3A8OB 4JLGA 4ME7A 3CPWP 3CCVQ 1OOTA 4PJNA 1WJSA 2VV5A 3M0SA 2IPOB 2K2MA 2VC8A 3RERA 2HKQB 2K79A 1LOJA 2DTHA 2JW4A 2XG8D 3Q1JA 4OP0A 3FEOA 5DLQE 3CCVA 4IIMA 4J9BA 2V8IA 3CCJT 3J7AF 1MMNA 2KROA 1YITA 1BYMA 3WXMB 3NMZC 3QYHB 4CC3A 2KAFA 3UDCA 5CQXA 1SRMA 1XJWB 2Y4YA 4YTLA 5GMKe 1NG2A 4LUEA 3P8DA 3VRZA 1K1ZA 4JJDA 1T0HA 5LJ3e 3UPUA 2OJ2A 4XAXB 3A8LB 2PU9B 3L1AA 5KYYB 2VVKA 4M7AC 2LQWA 4BE2A 2FPEA 4LNPA 2RMOA 3EH1A 2JTEA 1QMCA 4J83A 5CKFA 5CKDA 3G1JA 3M53A 4E7HA 4M7AA 4PLIA 1BIBA 2RA2A 5DM7R 2YSQA 4BY6B 2L89A 4RMOA 2DLPA 5FU6C 3PE0A 2BZYA 3G6EQ 2YT6A 4ELYC 2NUPB 3BE3A 2GQIA 1SPKA 2K3XA 2OAWA 1M3BA 1N9RA 1PRLC 2HQEA 3JCMc 3H0IA 2DKGA 2YDLA 2J6KA 3PFSA 1X6GA 2RI2A 1YJWQ 3EFOB 5I21A 4KULA 4KRTA 1WNLA 1OEBA 4C92E 2OTLT 4N4GA 5GANg 4PJOB 1YHQT 3EG3A 2J7IA 4DBRA 3GIBA 1YCYA 2DJZA 3QWXX 1BI1A 1VQ4T 3CC4T 3M0UA 4LDYA 3CCLT 1WHMA 2HDAA 5GAMh 2EBPA 2HD0A 2M51A 3I55Q 1VIEA 2VGMA 2C0TA 1B34B 2L3QA 2RN8A 3HSBA 2CSIA 3CD6T 1WYXA 3HRUA 1QVFS 1HJDA 2FL7A 1UJ0A 1YI2T 1MMDA 4PJOF 2KVQG 5FRNA 3JCMV 3TCJA 4HCZA 4KBMB 1M90U 2DYIA 3RKWA 2ZPBB 1RAAB 4M7DC 5KE2A 3GF5A 5DLOA 1D3BB 1VQ4Q 1GL5A 1IZ6A 1WJQA 5GANd 2RI5A 1U5SA 1K8AC 1OU9A 4OMLA 2CS7A 4E7LA 2EJGA 3META 1Q86R 3EHQA 4N4IA 2LCLA 2YWWA 1MGQA 2ZAEA 4EMHA 1P92A 1KQSP 1M3AA 3LWHA 2FEIA 1F1BB 3X20B 3HFOA 2CP5A 4B6MA 2GTOA 3OYIA 2LC4A 1VQLQ 1A0NB 5C6SA 2DL4A 4M78G 2XDDA 4E7SA 4ZGEB 3GNFB 1ARKA 3I56T 5GAN4 5CQYA 1JJ2A 2OTJT 2LX7A 2RHZA 1S1NA 2JZ2A 1VQLA 2E4HA 4Z8AA 1BI3A 1KSWA 2LJ3A 1UHFA 3OQ5A 2YUNA 4RTYA 4M77D 4II1A 3CC7Q 2R5AA 4JZ3A 3CCET 2P0QA 3CCSA 4OB0B 2RQVA 4C92B 3HKSA 1YBYA 4RUGA 2YUOA 3L2QA 3NGPA 3MEAA 3DLLA 2VB6A 1VQ6T 3VU3C 1PC0A 3JCMf 4ATOA 1MV3A 2VASA 3CC7A 1O75A 2QYZA 1YFNA 1T0JA 2M16A 4HT9A 1K73U 1M8MA 3HRSA 2AKLA 1BI0A 3MEUA 5CKBA 2MK5A 3RNJA 2FRYA 1QQJA 5FU7B 4DBFA 1OV3A 4M75G 4C92F 4OVAA 1IHWA 2RQRA 3OS2A 2QGGA 3CCEQ 5A2QE 2BKDN 2KSSA 2LQNA 2M02A 3EGDB 3OYFA 1PNJA 2F2WA 5CCAA 1NEBA 3H8ZA 4CI0C 1Q7YR 2J6OA 4J9FA 5LJ5e 4M7AE 1KC8C 3CC2T 4BB7A 1EIFA 5IT9E 3TVTA 5CAIA 2E70A 2B86A 2LT4A 1LJOA 3NHNA 2CREA 3BDUA 1PSEA 1VQNQ 3FB9A 2D6FA 1K9MR 4QVZA 4WCIA 2R57A 1Z9QA 4C8QA 4LDXA 2E3HA 4JJNK 1GCPA 2HQHA 4NL3A 2LMJA 2QEXT 3ZEHA 2DERA 1X69A 3I9QA 5LJ3d 1Y96A 4UC4A 3OYHA 4LN2A 5D7UA 2MWOA 3P8HA 1M3CA 2QA4Q 1ZBXA 4OMNA 3GNGA 1H3ZA 1U8RA 3F70A 1QVFP 4N0AA 2DL8A 1OPKA 2Y4XA 3VS3A 2CGHA 1V29B 2CT3A 2XDPA 1D0ZA 3DLMA 3PIOA 1VIFA 4JJCA 2QA4A 3EG9A 4L5GA 1SF9A 5KYNA 2ZPHB 1OZ2A 3M0RA 1QWFA 4E6RA 3QZ9B 3SHWA 1W2BS 1X27A 3A8MB 3AHUA 1MV0B 2DMOA 2K5FA 1LCKA 1WXTA 2JNGA 3L2RA 4HVWA 2RHYA 1IB8A 1CKBA 2CP7A 2JMAA 4QVCA 4NS5A 4KH0B 3CMAA 4M7DE 3DKMA 4X34A 2DXBA 4JLIA 1EFNA 2QXFA 2K4YA 2CZ7B 5A0DA 3OYDA 4NOYA 1YCSB 2D0QB 1VUBA 2EQJA 2KEAA 2MMPA 1K8AU 2LQ8A 4M7AB 2VYTA 3KBGA 1G2BA 2B8AA 3LGFA 3CPWA 1WHGA 5D6XA 3CCRQ 1GFCA 2CP6A 4PJOG
chains in the Genus database with same CATH topology
1BK2A 2CT4A 3I5RA 3JV3A 3SEMA 5FWBA 2FRWA 1BBZA 3UF4A 1E7OA 1UUEA 2BTTA 4HVVA 2GGRA 5IHNA 1UG1A 2K6DA 1SHFA 2ROLA 2D1XA 1CSKA 5FWCA 5EC7A 1XOVA 3EG0A 3I35A 2M0YA 2EVRA 4RTWA 3ZL7C 3CQTA 1GBQA 2X3XD 2EGEA 1QKWA 2AZSA 3A98A 1ABQA 2HCKA 2L3PA 5IH2A 3RBBB 2RQUA 3PVQA 1AEYA 1RLPC 1JXMA 2NUZA 2YUPA 2DJQA 2DL7A 4Z89A 4HVUA 3TSWA 2SRCA 1W70A 3PVLA 1M27C 2VKNA 4LE9A 1KIKA 2GTJA 1G83A 1UECA 5IHKA 2O9VA 1T3LA 1K0XA 4JJBA 2D8HA 3KFVA 2EPDA 2A28A 3M0TA 1ZSGA 2ENMA 1K0SA 4ZNXA 2XMFA 4M4ZA 1ZUYA 2P4RA 4OMOA 1OOTA 2LNHB 3VS0A 1FYNA 3M0SA 2W0ZA 2K2MA 4LUDA 2DILA 2V1RA 1H8KA 1W1FA 2K79A 1WX6A 2SEMA 4DEYA 1JU5C 2EYXA 2JW4A 2L0AA 1VYTA 3M0PA 1YWPA 4IIMA 4JPBW 4EIKA 1JO8A 2O31A 4J9BA 1YNZA 4F14A 4J9HA 1ZX6A 4ESRA 1M30A 1WA7A 2KROA 1JXOA 2G6FX 3NMZC 2OI3A 4CC3A 2AZVA 4K11A 1SRMA 2JS2A 3EHRA 1BB9A 2KXDA 4Z88A 1NG2A 4LUEA 1H3HA 3VRZA 1K1ZA 4JJDA 1GCQC 1T0HA 2A08A 2OJ2A 4A63B 2VVKA 2JS0A 2RQWA 3U23A 2LQWA 2V1QA 2KGTA 2FPEA 4LNPA 2RMOA 1W6XA 1I1JA 1MUZA 2K9GA 2JTEA 1SRLA 2DA9A 2EGAA 2MOXA 2W10A 3VS6A 1ABOA 2YSQA 1PKSA 2KT1A 3VS2A 5IXBA 2DLPA 1K76A 3PE0A 4CC4B 2BZYA 3THKA 2EQIA 2YT6A 4J9EA 3ULRB 2LZ6B 4RTXA 1QWEA 1UTIA 1U06A 1RI9A 4GBQA 2KXCA 2GQIA 3QWYA 3EGUA 1SPKA 2OAWA 1M3BA 1E6HA 1PRLC 5ECAA 2MIOA 2FO0A 4ORZA 2DBMA 4D8DA 3H0IA 2LJ0A 2YDLA 1B3QA 2J6KA 3VS1A 1NEGA 1X6GA 4KRTA 1OEBA 4F16A 2PNIA 1AZGB 3EG3A 5GJVB 2ABLA 2GNCA 2J7IA 4J9GA 2KRSA 3QWXX 3M0UA 1X43A 4HCKA 2HDAA 2E5KA 2EBPA 2M51A 1GBRA 1AVZC 1V1CA 1CKAA 1AWXA 2DBKA 2C0TA 3VS4A 1WXUA 5IHIA 2L3QA 2RN8A 1J3TA 2DF6A 2HEQA 2CSIA 2EYZA 1WYXA 2KR3A 1UHCA 1HJDA 1UJ0A 1PHTA 1NLPC 1VYUA 2RNAA 1KJWA 1KFZA 2DRMA 2C0OA 2RQTA 1RLQC 4AG2C 2DNUA 1PRMC 2H8HA 2EW3A 3IQLA 1GL5A 2BZ8A 1FMKA 1JQQA 1U5SA 4OMLA 2DL5A 3VS7A 1PKTA 3I5SA 3EHQA 1SEMA 3EG2A 1M3AA 2PZ1A 2FEIA 1WXBA 2D8JA 1Y0MA 4JZ4A 2GTOA 5I22A 4DEXA 1A0NB 2DL4A 1RUWA 4AFZC 1ARKA 2RPNA 2GBQA 3NPFA 2JXBA 4J9IA 2LX7A 2KE9A 5IXFA 2VWFA 1TUCA 1S1NA 2JM8A 1TUDA 2EYWA 2CUDA 4Z8AA 1KSWA 4J9DA 2KT8A 2LJ3A 1UHFA 5GJWB 2L3SA 2YUNA 4RTYA 1UJYA 2DL3A 5I11A 4JZ3A 1TG0A 1B07A 2RQVA 2FG0A 3TSZA 4RUGA 2YUOA 3NGPA 2DX1A 2DM1A 3REBB 1E6GA 3R6NA 1ZUUA 1MV3A 2C0IA 2CH4A 3C0CA 2L2PA 1T0JA 4RTZA 4CC2A 1SSHA 1UGVA 2JT4A 1NYGA 2CH4W 2F2VA 2MCNA 2LP5A 2F2XA 1WIEA 1M8MA 2ED1A 2AKLA 4OMMA 2CDTA 2EYYA 1ZUKA 3RNJA 4X1VA 2FRYA 1OV3A 1GRIA 4RTTA 3EG1A 1ZLMA 4F17A 2RQRA 3H0HA 2K7AA 4D8KA 1OPLA 4GLMA 2J06A 1Z9ZA 2IIMA 2QDLA 1ZBJA 2LQNA 1NM7A 1PNJA 2F2WA 1H92A 1X2QA 1NEBA 1WDXA 1WFWA 2ESWA 1UE9A 2KRNA 3UATA 1WI7A 4AFUC 2J6OA 1VA7A 4J9FA 3UA7A 1I0CA 3FJ5A 1K4US 3TVTA 2YUQA 1QCFA 2B86A 1I07A 2NWMA 3NHNA 4AG1C 2CREA 2RF0A 1UFFA 2I0NA 4AFQC 2J05A 4WCIA 2ROTA 5HCKA 1Z9QA 1AWJA 1X2KA 1HD3A 2DE0X 1AD5A 1GCPA 4HXJA 4QT7A 2A36A 2EKHA 2LMJA 1PWTA 3LH5A 2KNBB 2A37A 2AK5A 1IO6A 1HSQA 1YWOA 1X69A 4OMQA 1BU1A 3I9QA 2KYMA 4LN2A 3H0FA 1AOJA 4RTUA 1SHGA 1QLYA 3VRYA 2CUBA 1AWWA 2LJ1A 1M3CA 1Y57A 4OMNA 2AKKA 1GFDA 1NLOC 2CSQA 2O88A 2DL8A 1OPKA 3VS3A 2CT3A 2ED0A 4JJCA 2HSPA 1YP5A 2K3BA 1U3OA 2KBTA 2DYBA 1QWFA 3M0RA 4E6RA 3GBQA 4IIOA 2KRMA 1YN8A 3SHWA 2PTKA 3VS5A 1X27A 2DVJA 4RTVA 1MV0B 2DMOA 1X6BA 3M0QA 2J6FA 1LCKA 1WXTA 3UA6A 4HVWA 4R0KA 1CKBA 4J9CA 1QKXA 4CC7A 4OMPA 2JMAA 2BZXA 1WLPB 1AWOA 1UDLA 1N5ZA 4Y92A 4AFSC 1EFNA 2HBWA 2D0NA 1GCQA 2ECZA 5L23A 3H41A 2LCSA 4FSSA 1K9AA 2EGCA 2X3WD 1YCSB 2JM9A 2O9SA 2KEAA 1NYFA 1T3SA 2JMCA 3REAB 1AZEA 5FW9A 2FPDA 2FPFA 2O2OA 1VYVA 2KYBA 3O5ZA 1G2BA 1JEGA 2DRKA 1GFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BK2 A;  2CT4 A;  3I5R A;  3JV3 A;  3SEM A;  5FWB A;  2FRW A;  1BBZ A;  3UF4 A;  1E7O A;  1UUE A;  2BTT A;  4HVV A;  2GGR A;  5IHN A;  1UG1 A;  2K6D A;  1SHF A;  2ROL A;  2D1X A;  1CSK A;  5FWC A;  5EC7 A;  1XOV A;  3EG0 A;  3I35 A;  2M0Y A;  2EVR A;  4RTW A;  3ZL7 C;  3CQT A;  1GBQ A;  2X3X D;  2EGE A;  1QKW A;  2AZS A;  3A98 A;  1ABQ A;  2HCK A;  2L3P A;  5IH2 A;  3RBB B;  2RQU A;  3PVQ A;  1AEY A;  1RLP C;  1JXM A;  2NUZ A;  2YUP A;  2DJQ A;  2DL7 A;  4Z89 A;  4HVU A;  3TSW A;  2SRC A;  1W70 A;  3PVL A;  1M27 C;  2VKN A;  4LE9 A;  1KIK A;  2GTJ A;  1G83 A;  1UEC A;  5IHK A;  2O9V A;  1T3L A;  1K0X A;  4JJB A;  2D8H A;  3KFV A;  2EPD A;  2A28 A;  3M0T A;  1ZSG A;  2ENM A;  1K0S A;  4ZNX A;  2XMF A;  4M4Z A;  1ZUY A;  2P4R A;  4OMO A;  1OOT A;  2LNH B;  3VS0 A;  1FYN A;  3M0S A;  2W0Z A;  2K2M A;  4LUD A;  2DIL A;  2V1R A;  1H8K A;  1W1F A;  2K79 A;  1WX6 A;  2SEM A;  4DEY A;  1JU5 C;  2EYX A;  2JW4 A;  2L0A A;  1VYT A;  3M0P A;  1YWP A;  4IIM A;  4JPB W;  4EIK A;  1JO8 A;  2O31 A;  4J9B A;  1YNZ A;  4F14 A;  4J9H A;  1ZX6 A;  4ESR A;  1M30 A;  1WA7 A;  2KRO A;  1JXO A;  2G6F X;  3NMZ C;  2OI3 A;  4CC3 A;  2AZV A;  4K11 A;  1SRM A;  2JS2 A;  3EHR A;  1BB9 A;  2KXD A;  4Z88 A;  1NG2 A;  4LUE A;  1H3H A;  3VRZ A;  1K1Z A;  4JJD A;  1GCQ C;  1T0H A;  2A08 A;  2OJ2 A;  4A63 B;  2VVK A;  2JS0 A;  2RQW A;  3U23 A;  2LQW A;  2V1Q A;  2KGT A;  2FPE A;  4LNP A;  2RMO A;  1W6X A;  1I1J A;  1MUZ A;  2K9G A;  2JTE A;  1SRL A;  2DA9 A;  2EGA A;  2MOX A;  2W10 A;  3VS6 A;  1ABO A;  2YSQ A;  1PKS A;  2KT1 A;  3VS2 A;  5IXB A;  2DLP A;  1K76 A;  3PE0 A;  4CC4 B;  2BZY A;  3THK A;  2EQI A;  2YT6 A;  4J9E A;  3ULR B;  2LZ6 B;  4RTX A;  1QWE A;  1UTI A;  1U06 A;  1RI9 A;  4GBQ A;  2KXC A;  2GQI A;  3QWY A;  3EGU A;  1SPK A;  2OAW A;  1M3B A;  1E6H A;  1PRL C;  5ECA A;  2MIO A;  2FO0 A;  4ORZ A;  2DBM A;  4D8D A;  3H0I A;  2LJ0 A;  2YDL A;  1B3Q A;  2J6K A;  3VS1 A;  1NEG A;  1X6G A;  4KRT A;  1OEB A;  4F16 A;  2PNI A;  1AZG B;  3EG3 A;  5GJV B;  2ABL A;  2GNC A;  2J7I A;  4J9G A;  2KRS A;  3QWX X;  3M0U A;  1X43 A;  4HCK A;  2HDA A;  2E5K A;  2EBP A;  2M51 A;  1GBR A;  1AVZ C;  1V1C A;  1CKA A;  1AWX A;  2DBK A;  2C0T A;  3VS4 A;  1WXU A;  5IHI A;  2L3Q A;  2RN8 A;  1J3T A;  2DF6 A;  2HEQ A;  2CSI A;  2EYZ A;  1WYX A;  2KR3 A;  1UHC A;  1HJD A;  1UJ0 A;  1PHT A;  1NLP C;  1VYU A;  2RNA A;  1KJW A;  1KFZ A;  2DRM A;  2C0O A;  2RQT A;  1RLQ C;  4AG2 C;  2DNU A;  1PRM C;  2H8H A;  2EW3 A;  3IQL A;  1GL5 A;  2BZ8 A;  1FMK A;  1JQQ A;  1U5S A;  4OML A;  2DL5 A;  3VS7 A;  1PKT A;  3I5S A;  3EHQ A;  1SEM A;  3EG2 A;  1M3A A;  2PZ1 A;  2FEI A;  1WXB A;  2D8J A;  1Y0M A;  4JZ4 A;  2GTO A;  5I22 A;  4DEX A;  1A0N B;  2DL4 A;  1RUW A;  4AFZ C;  1ARK A;  2RPN A;  2GBQ A;  3NPF A;  2JXB A;  4J9I A;  2LX7 A;  2KE9 A;  5IXF A;  2VWF A;  1TUC A;  1S1N A;  2JM8 A;  1TUD A;  2EYW A;  2CUD A;  4Z8A A;  1KSW A;  4J9D A;  2KT8 A;  2LJ3 A;  1UHF A;  5GJW B;  2L3S A;  2YUN A;  4RTY A;  1UJY A;  2DL3 A;  5I11 A;  4JZ3 A;  1TG0 A;  1B07 A;  2RQV A;  2FG0 A;  3TSZ A;  4RUG A;  2YUO A;  3NGP A;  2DX1 A;  2DM1 A;  3REB B;  1E6G A;  3R6N A;  1ZUU A;  1MV3 A;  2C0I A;  2CH4 A;  3C0C A;  2L2P A;  1T0J A;  4RTZ A;  4CC2 A;  1SSH A;  1UGV A;  2JT4 A;  1NYG A;  2CH4 W;  2F2V A;  2MCN A;  2LP5 A;  2F2X A;  1WIE A;  1M8M A;  2ED1 A;  2AKL A;  4OMM A;  2CDT A;  2EYY A;  1ZUK A;  3RNJ A;  4X1V A;  2FRY A;  1OV3 A;  1GRI A;  4RTT A;  3EG1 A;  1ZLM A;  4F17 A;  2RQR A;  3H0H A;  2K7A A;  4D8K A;  1OPL A;  4GLM A;  2J06 A;  1Z9Z A;  2IIM A;  2QDL A;  1ZBJ A;  2LQN A;  1NM7 A;  1PNJ A;  2F2W A;  1H92 A;  1X2Q A;  1NEB A;  1WDX A;  1WFW A;  2ESW A;  1UE9 A;  2KRN A;  3UAT A;  1WI7 A;  4AFU C;  2J6O A;  1VA7 A;  4J9F A;  3UA7 A;  1I0C A;  3FJ5 A;  1K4U S;  3TVT A;  2YUQ A;  1QCF A;  2B86 A;  1I07 A;  2NWM A;  3NHN A;  4AG1 C;  2CRE A;  2RF0 A;  1UFF A;  2I0N A;  4AFQ C;  2J05 A;  4WCI A;  2ROT A;  5HCK A;  1Z9Q A;  1AWJ A;  1X2K A;  1HD3 A;  2DE0 X;  1AD5 A;  1GCP A;  4HXJ A;  4QT7 A;  2A36 A;  2EKH A;  2LMJ A;  1PWT A;  3LH5 A;  2KNB B;  2A37 A;  2AK5 A;  1IO6 A;  1HSQ A;  1YWO A;  1X69 A;  4OMQ A;  1BU1 A;  3I9Q A;  2KYM A;  4LN2 A;  3H0F A;  1AOJ A;  4RTU A;  1SHG A;  1QLY A;  3VRY A;  2CUB A;  1AWW A;  2LJ1 A;  1M3C A;  1Y57 A;  4OMN A;  2AKK A;  1GFD A;  1NLO C;  2CSQ A;  2O88 A;  2DL8 A;  1OPK A;  3VS3 A;  2CT3 A;  2ED0 A;  4JJC A;  2HSP A;  1YP5 A;  2K3B A;  1U3O A;  2KBT A;  2DYB A;  1QWF A;  3M0R A;  4E6R A;  3GBQ A;  4IIO A;  2KRM A;  1YN8 A;  3SHW A;  2PTK A;  3VS5 A;  1X27 A;  2DVJ A;  4RTV A;  1MV0 B;  2DMO A;  1X6B A;  3M0Q A;  2J6F A;  1LCK A;  1WXT A;  3UA6 A;  4HVW A;  4R0K A;  1CKB A;  4J9C A;  1QKX A;  4CC7 A;  4OMP A;  2JMA A;  2BZX A;  1WLP B;  1AWO A;  1UDL A;  1N5Z A;  4Y92 A;  4AFS C;  1EFN A;  2HBW A;  2D0N A;  1GCQ A;  2ECZ A;  5L23 A;  3H41 A;  2LCS A;  4FSS A;  1K9A A;  2EGC A;  2X3W D;  1YCS B;  2JM9 A;  2O9S A;  2KEA A;  1NYF A;  1T3S A;  2JMC A;  3REA B;  1AZE A;  5FW9 A;  2FPD A;  2FPF A;  2O2O A;  1VYV A;  2KYB A;  3O5Z A;  1G2B A;  1JEG A;  2DRK A;  1GFC A; 
#chains in the Genus database with same CATH topology
 1BK2 A;  5GAN 8;  3M59 A;  4O6J A;  2JTM A;  3I5R A;  3SEM A;  2L3R A;  1X01 A;  2QGF B;  4C0G A;  4CRI A;  1BBZ A;  2M9U A;  5FU6 B;  2BTT A;  4IUQ A;  3RIR A;  3CCR A;  4HKE A;  1UG1 A;  1KQ1 A;  5IAY A;  2ROL A;  1O9S A;  2DAQ A;  3HFN A;  4QQD A;  4KGV B;  4XTZ A;  5EC7 A;  1YIJ Q;  3EG0 A;  2VUB A;  2XD0 A;  2M0Y A;  4M7A F;  3HTR A;  4RTW A;  1FX7 A;  2E64 A;  3JCM b;  5HK3 A;  3M58 A;  2LX9 A;  4MDW A;  1G8X A;  1QKW A;  2EQU A;  5GAN 6;  1UB4 A;  5GAM f;  1YIJ A;  3NTI A;  2QQA A;  2RH2 A;  1S72 A;  3TSW A;  5HK0 A;  2DXT A;  3PVL A;  4KUI A;  2GTJ A;  3SWN C;  8AT1 B;  1UEC A;  1K0X A;  3S3O A;  1VQO A;  1ZSG A;  1K0S A;  1RAH B;  3TRE A;  4M4Z A;  2GF7 A;  1ZUY A;  2P4R A;  2DEQ A;  2LNH B;  3A8H B;  1BCO A;  2OAU A;  2I2L A;  2V1R A;  1DJ7 B;  2HBP A;  1W1F A;  4MZT A;  1WX6 A;  2SEM A;  4M7D B;  3HPW A;  4JRI A;  1IGQ A;  1VYT A;  1JO8 A;  4EDU A;  5J39 A;  3OYJ A;  2L5Q A;  3G71 Q;  1WA7 A;  4IUU A;  3JB9 H;  2ZCF B;  1OQK A;  3CME Q;  4K11 A;  1KC8 U;  2E1H A;  2JS2 A;  3EHR A;  3BY7 A;  3JCM e;  1UGS B;  3M9Q A;  4C92 G;  1WHK A;  1GCQ C;  2EAY A;  4PNO A;  3G71 A;  4A63 B;  4ELZ C;  1RAD B;  2DFU A;  4M7D F;  3R6O A;  3CME A;  3MEV A;  3RKX A;  3EGX B;  1N6A A;  4A4H A;  3U23 A;  2KGT A;  1ZSZ C;  3EH2 A;  1I1J A;  2DA9 A;  2W10 A;  3VS6 A;  5LJ5 d;  3HP9 A;  1W2B P;  1PKS A;  2LNV A;  2K5L A;  1K76 A;  2LCC A;  1VQM T;  4QKU A;  3THK A;  5GMK l;  2YRC A;  3ULR B;  5GAN h;  3V8J A;  1OX9 A;  4RTX A;  1UTI A;  1VQK Q;  1IRE B;  2KK4 A;  2LRQ A;  5ECA A;  2MIO A;  2FO0 A;  4XU1 A;  1G3Y A;  4JUV A;  2FB7 A;  3CEY A;  4ZGD B;  2L8D A;  3E19 A;  1M5Q 1;  1G5V A;  1WHH A;  4F16 A;  3M5A A;  3FJP A;  2LTO A;  5GJV B;  4RKU E;  2ABL A;  2GNC A;  1VQP A;  2COZ A;  4HCK A;  4C5G A;  2E5K A;  4EMK A;  5D6Y A;  4Y91 A;  1CKA A;  2DBK A;  3FC3 A;  1B7T A;  4JS4 A;  1M2V A;  5IHI A;  2HEQ A;  2VXE A;  4XTV A;  1D1C A;  3CCQ Q;  4LD6 A;  1PHT A;  4WF2 A;  5KH6 A;  2A0F B;  1NLP C;  1K73 R;  3SB2 A;  1VYU A;  4XTX A;  5KYU A;  1KJW A;  1PM3 A;  4XQ3 A;  2BUD A;  3G4S Q;  1RLQ C;  1D1A A;  2RK1 A;  3GPL A;  2DD4 A;  4XK8 E;  3CCQ A;  5D6W A;  3CCM Q;  3VV0 A;  2EW3 A;  3IQL A;  1IRX A;  4DBH A;  1K73 C;  1D09 B;  4A4K A;  3H6Z A;  4JRP A;  2DL5 A;  5HKC A;  3G4S A;  1VOM A;  1TSF A;  5GAO p;  1SEM A;  3CCM A;  4RCB A;  2E6Z A;  2HNI A;  1Y0M A;  4DEX A;  2ZPF B;  3QSU A;  1I4K 1;  1RUW A;  4RG8 A;  3OSV A;  4DA4 A;  3L2V A;  2M0O A;  4FSX A;  2KE9 A;  1TUC A;  2JM8 A;  1GXI E;  1TUD A;  1I5L A;  2EYW A;  4PFO A;  3O8V A;  5GAN 3;  1RAG B;  3MP1 A;  4ZN3 A;  5GMK j;  1KQ2 A;  3JCM Q;  3JCM X;  4HCB A;  2KT8 A;  2CP0 A;  5LJ3 j;  3OYB A;  2L3S A;  5LL6 S;  5I11 A;  1WJR A;  3CCJ Q;  4M7A G;  2FG0 A;  3TSZ A;  2Z0W A;  1VQ9 T;  2KY9 A;  1YJN T;  3QZ5 B;  3X24 B;  3URG A;  3REB B;  1OX8 A;  2RD1 A;  3C0C A;  2F5K A;  2L2P A;  4RTZ A;  1SSH A;  2RB6 A;  2F5T X;  4FYY B;  2CH4 W;  4P5N A;  2LP5 A;  4J6X A;  4ZGJ B;  3CXC A;  2ED1 A;  2YLC A;  4OMM A;  3G6E A;  2AHJ B;  4X1V A;  3PIP A;  1MNE A;  2QTV A;  3EG1 A;  1QVF A;  3LH0 A;  1ZLM A;  3H0H A;  1V76 A;  5GAM e;  1OPL A;  4GLM A;  2J06 A;  2QI2 A;  2EJF A;  2IIM A;  1VQ7 T;  1ZBJ A;  3MJX A;  3ME9 A;  1YJW A;  3CPF A;  1X2Q A;  5KYX B;  1WFW A;  1UE9 A;  2KRN A;  3CXC S;  2X9H A;  1WI7 A;  3UA7 A;  1WQ7 A;  3FJ5 A;  2JOY A;  4C5I A;  2JN0 A;  2EIF A;  1QCF A;  4DOV A;  2YRV A;  1I07 A;  4F7U E;  2VXF A;  3HHT B;  1TWB A;  2NWM A;  2P84 A;  8ATC B;  3I55 A;  4AG1 C;  3DB4 A;  1N27 A;  1K8A R;  2OTL Q;  1RAC B;  2QAS A;  2ROT A;  1YHQ Q;  2PVO B;  3EFR A;  1R0C B;  2HKN A;  2EYQ A;  1AD5 A;  4HXJ A;  2A36 A;  1VQ7 Q;  3JCM d;  3CC4 Q;  1KG1 A;  1IO6 A;  1HSQ A;  3CCL Q;  2RJD A;  1BU1 A;  2JVV A;  3JB9 I;  4R55 A;  4M7D G;  1YHQ A;  1N8R C;  1VQ4 A;  3SWN B;  1NLO C;  2P4T A;  3RES A;  3CCS T;  3CD6 Q;  3PNW C;  4EPC A;  1QCN A;  1YI2 Q;  3JB9 F;  4HCC A;  1EZZ B;  2ED0 A;  2HSP A;  1YP5 A;  2K3B A;  4FT2 A;  1U3O A;  1XQH A;  4C0Z A;  3E1S A;  2HQX A;  4IIO A;  2PTK A;  4RTV A;  3BDL A;  2BE7 D;  2LDM A;  1W4S A;  4M78 D;  3M0Q A;  2QQ9 A;  4M78 A;  2DET A;  1PG5 B;  2DXU A;  2E5Q A;  5GAN 2;  5KYW A;  1QKX A;  4M77 A;  4OMP A;  3CCU T;  1UGR B;  2BZX A;  1WLP B;  4XU2 A;  1BKB A;  3ZFJ A;  2A3L A;  2K2V A;  2BIV A;  1D0Y A;  4E7I A;  2D9T A;  3JCM W;  3I56 Q;  2OTJ Q;  2LCS A;  2ZPG B;  1WZO A;  4FSS A;  2EGC A;  4A53 A;  2EQK A;  3REA B;  5FW9 A;  2NUT A;  2O2O A;  2HAX A;  3MHX A;  1VYV A;  2KYB A;  1RAI B;  2CKK A;  1VQ5 T;  3RMQ A;  1LNX A;  1ZSZ B;  4E7Z A;  1JEG A;  3I56 A;  1ZHI A;  1NPR A;  5LJ3 g;  2FZG B;  1ZA1 B;  4F7U B;  2CT4 A;  2P0K A;  3JV3 A;  5GAN f;  5FWB A;  3LW5 E;  1KHI A;  1KC8 R;  3QHS A;  2K6D A;  1Y7X A;  1VQ6 Q;  4Y28 E;  2D1X A;  5GAO m;  3KUF A;  1CSK A;  4M75 D;  5FWC A;  1XOV A;  3CCE A;  4M75 A;  4X9D A;  4WTO B;  2KMT A;  3I35 A;  2ATC B;  3MP6 A;  1AT1 B;  4C8Q C;  3CQT A;  3OYC A;  2DD5 A;  4F7U F;  1OU8 A;  5LJ5 j;  2X3X D;  2AZS A;  3A98 A;  5IH2 A;  2HCK A;  4BAC A;  1VQ8 T;  2RQU A;  4XTY A;  4C8Q G;  1JXM A;  2NUZ A;  2C06 A;  2DJQ A;  3GOX A;  3FIF A;  1M2V B;  3INZ A;  1M27 C;  4A54 A;  1FXX A;  1KIK A;  1VQN A;  3X28 B;  3RUX A;  1JB0 E;  4JJB A;  1YJ9 T;  2RJC A;  1W2B A;  2E12 A;  4RCC A;  3CXC P;  4N0A C;  2ENM A;  2EFI A;  3CC2 Q;  4OMO A;  4RG2 A;  1FYN A;  4AT1 B;  4LUD A;  3CMA T;  2DIL A;  4BI8 B;  1M1K C;  2RK2 A;  3MO8 A;  1H8K A;  3V7S A;  3X25 B;  2M1H A;  4DEY A;  3LX7 A;  5AYF A;  2L0A A;  2LT1 A;  1YWP A;  2O31 A;  1YNZ A;  2YXY A;  2QQB A;  4J9H A;  4ESR A;  2QEX Q;  2X4X A;  4NL2 A;  3SFM A;  2OI3 A;  3SDZ A;  2AZV A;  4GY5 A;  1M4Z A;  4OGE A;  1YJ9 Q;  1BB9 A;  2RHU A;  2YLB A;  3PTA A;  4ANJ A;  2DZ9 A;  1NJI R;  2NYS A;  4HT8 A;  4J5Y A;  1Q82 R;  4KGX B;  2R58 A;  5GAM d;  5KYY A;  4FIB A;  4L59 A;  2RQW A;  1H64 1;  1X6O A;  1LVK A;  2COY A;  2ZGW A;  1NJI C;  1W6X A;  1Q82 C;  1MUZ A;  3WVD B;  2FHD A;  2MOX A;  3RMS A;  1FMW A;  1ABO A;  4LXC A;  1TS9 A;  2KT1 A;  4E7J A;  1I8F A;  3OS5 A;  5IXB A;  1N8R U;  3GP8 A;  4CC4 B;  2EQI A;  4J9E A;  1HK9 A;  1JRI A;  3QDF A;  2LZ6 B;  4V2S A;  2CZ0 B;  3VJP A;  4GBQ A;  1U06 A;  2KXC A;  2WSC E;  4BUG A;  4ORZ A;  4D8D A;  5CK9 A;  5GAO n;  4PL6 A;  3V8L A;  1NEG A;  3EFO A;  1M2O A;  1G3T A;  4PJO D;  4M77 E;  1Q81 C;  4PJO A;  4IKF A;  1WGS A;  3BFM A;  2XID A;  4J8O A;  4MML A;  3VUZ A;  4MDX A;  3GLX A;  5GAO q;  4BDY A;  1X43 A;  4FCY A;  4XU0 A;  2XKO C;  4BE1 A;  2E65 A;  1GBR A;  1QCO A;  4QQ6 A;  4Z02 A;  1V1C A;  1AWX A;  3JB9 G;  1C6V X;  1B34 A;  3VS4 A;  1C1A A;  2E10 A;  1J3T A;  5FRM A;  3MP8 A;  5EG2 A;  2EYZ A;  2KR3 A;  1UHC A;  4LDV A;  4MMK A;  4KT0 E;  5L8R E;  1ACM B;  1WHJ A;  2RNA A;  4C0D C;  1KFZ A;  2DRM A;  2C0O A;  2RQT A;  4AG2 C;  4DOW A;  1D3B A;  1JBM A;  3P8B B;  2RHI A;  4OF1 A;  2MF2 A;  2H3J A;  2WSF E;  1EX4 A;  2BZ8 A;  3QKJ A;  1FMK A;  4OB2 B;  2JTF A;  5LJ5 g;  4J7I A;  1I81 A;  4KH1 B;  3NFC A;  4XU3 A;  4QVD A;  3T9N A;  2BE9 B;  1TOV A;  4A4E A;  1UGQ B;  4MZM A;  2R5M A;  3OYG A;  1Q95 G;  4AFZ C;  4BI3 A;  4C8Q E;  2KI7 A;  3OYL A;  2RPN A;  5M9O A;  2FYK A;  2GBQ A;  1M1G A;  2JXB A;  4J9I A;  5C0M A;  5IXF A;  5GAN 5;  2VWF A;  3VYG A;  2FVU A;  4ZTJ A;  2CUD A;  2DTO A;  1QVG A;  2V8K A;  2PVD B;  4J9D A;  5CKH A;  1R8O B;  3CBP A;  1UJY A;  3OYE A;  2DL3 A;  4C92 D;  1TG0 A;  3G7Z A;  4C92 A;  4PLL A;  3V8K A;  3QYG B;  2DX1 A;  1E6G A;  2H3E B;  2AIR B;  3R6N A;  4F7U G;  2C0I A;  3QJY A;  2CH4 A;  2XI9 A;  3X26 B;  5KCO A;  1QVG S;  2K3Y A;  1WQW A;  4DQ2 A;  1KK7 A;  2JT4 A;  1NYG A;  2F2V A;  5AT1 B;  2MCN A;  1BIA A;  1M1K U;  1BI2 A;  2CDT A;  2DPP B;  1ZUK A;  4QW2 A;  1KD1 R;  1VQK A;  2QTX A;  3C95 A;  2PUK B;  1MMG A;  2WAC A;  4F17 A;  2X4Y A;  4D8K A;  4EMK C;  3UT1 A;  2RI3 A;  3E9G A;  1Z9Z A;  2QDL A;  1KD1 C;  1NM7 A;  3EGD A;  3OS0 A;  1PD0 A;  4A4F A;  1H92 A;  1VQM Q;  2PUO B;  2DEU A;  2YHT A;  1C0M A;  2RJE A;  3PMI A;  3OYA A;  3OMG A;  1I0C A;  4FL6 A;  2QAZ A;  1K4U S;  5CO7 A;  3CCV T;  2YUQ A;  4FM4 B;  3OW2 S;  2DZC A;  1ZQ1 A;  4PJL A;  1IGU A;  1YIT T;  1NJI U;  2I0N A;  3JCM J;  1Q82 U;  5IN1 A;  3C12 A;  4C8Q B;  1X2K A;  1HD3 A;  1NPP A;  2EKH A;  4XTU A;  2A37 A;  2MPX C;  2AK5 A;  4OMQ A;  2CP2 A;  1Y96 B;  3H0F A;  4RTU A;  1QLY A;  2CUB A;  1AWW A;  2LJ1 A;  1QW1 A;  2AKK A;  1GFD A;  2COW A;  2CSQ A;  2O88 A;  1Y71 A;  3OY9 A;  2X4W A;  3V7R A;  4B9X A;  1Q81 U;  1I5O B;  3M57 A;  4HA8 A;  1YIT Q;  3D7S B;  4C8Q F;  4F04 B;  1WHL A;  3EG9 B;  2KBT A;  3VKI A;  3S3N A;  1YN8 A;  3VS5 A;  5J26 A;  2QDY B;  9ATC B;  4KGZ B;  3G6E T;  5FRO A;  2V8J A;  3UA6 A;  4R0K A;  3LYI A;  1XTD A;  2P0P A;  1UDL A;  3OYK A;  5GMK h;  5GMK i;  3HL8 A;  1YJW T;  5LJ3 h;  2D0N A;  2F1L A;  4J7F A;  2EWN A;  1NZ9 A;  2ECZ A;  6AT1 B;  3H41 A;  2O4X A;  3M4Y A;  3CCJ A;  2X3W D;  3M56 A;  2O9S A;  2JM9 A;  4M7A D;  2JMC A;  2FPF A;  4ZTF A;  2XK0 A;  1N9S A;  2DO3 A;  1OZ3 A;  3JCM g;  2DRK A;  3I55 T;  2PVG B;  4PKC C;  1G3W A;  3UF4 A;  1E7O A;  1UUE A;  4HVV A;  2GGR A;  1YJN Q;  1VQ9 Q;  5IHN A;  2CP3 A;  2X4J A;  5GAM j;  3KXT A;  4FW1 A;  4JRQ A;  1QVG P;  3QPH A;  2EVR A;  1YJN A;  1VQ9 A;  3ASK A;  4Q5W A;  2OX7 A;  2L3P A;  3RBB B;  1RI0 A;  3HRT A;  3PVQ A;  2YUP A;  1N8R R;  4Z89 A;  4HVU A;  4BD3 A;  1PD1 A;  1BCM A;  2VKN A;  1VQL T;  4C5E A;  4E47 A;  3LWI A;  2O9V A;  2OTL A;  3QXE B;  2GFU A;  2D8H A;  4ZN1 A;  4KUD K;  2A28 A;  3M0T A;  4TVR A;  4C5H A;  1R77 A;  4ZNX A;  2XMF A;  4R56 A;  1VQ7 A;  2HZY A;  1QP2 A;  3CC4 A;  3VS0 A;  3OW2 P;  3CCL A;  2ZZD A;  1G3S A;  1TUG B;  5CIU A;  2W0Z A;  5I2M A;  2YRD A;  1RAB B;  4M7D D;  4C0D B;  2KQW A;  2QQR A;  4FYW B;  4M7D A;  1JU5 C;  2EYX A;  3CC7 T;  3M0P A;  4JPB W;  4M78 C;  4EIK A;  4PJM A;  1KD1 U;  3CD6 A;  4BE0 A;  4F14 A;  2NLU A;  1YI2 A;  1ZX6 A;  1M30 A;  1MMA A;  5GAO l;  1TU0 B;  2DTI A;  4M77 C;  1JXO A;  3QII A;  1Q86 C;  2G6F X;  3SD4 A;  2E41 A;  2KXD A;  3MEW A;  4Z88 A;  1H3H A;  4M77 G;  1WPY A;  2A08 A;  3CCS Q;  3MCA B;  7AT1 B;  2JJ9 A;  4MZP A;  5HY6 A;  5A0G A;  2JS0 A;  3EGX A;  4N4H A;  3FRN A;  2V1Q A;  1KHC A;  2F69 A;  2K9G A;  1SRL A;  2EGA A;  3OB9 A;  2QG9 B;  1JJ2 S;  3VS2 A;  5CKE A;  2JUF A;  2WSE E;  2O01 E;  2OTJ A;  1QWE A;  1RI9 A;  3JAM E;  1XNI A;  3QWY A;  2G3R A;  3EGU A;  3LGL A;  3A5Z B;  3CCU Q;  3E2U A;  1E6H A;  4M75 C;  2DBM A;  4B9W A;  2LJ0 A;  1B3Q A;  3VS1 A;  2LVM A;  1SKU B;  1VQN T;  4OB3 B;  3S6W A;  3CBM A;  2PNI A;  4O5V A;  1AZG B;  3CCU A;  4FT4 A;  4GLK A;  5CVI A;  4IUT A;  3QUI A;  4C0F A;  4J9G A;  3OYN A;  2KRS A;  2XHC A;  1VQ6 A;  3OYM A;  1VQ5 Q;  4BDZ A;  3TU4 K;  3OBY A;  2MAM A;  1AVZ C;  4EMK B;  3JCM P;  3M4G A;  2X35 A;  1OI1 A;  1WXU A;  2QA4 T;  2DF6 A;  3OS1 A;  1VQ5 A;  5LJ5 h;  2Y90 A;  4FYV B;  1Q7Y C;  4IUV A;  5GAM g;  1M1K R;  4PFP A;  4E2F B;  3QDR B;  4C8Q D;  5KYU B;  3FDR A;  2DNU A;  3NTK A;  1PRM C;  2H8H A;  1MHN A;  2IG0 A;  1TH7 A;  5FLX E;  3QBY A;  1R0B G;  1JQQ A;  1K9M C;  3VS7 A;  1PKT A;  4IUR A;  3BW1 A;  3I5S A;  2MI6 A;  3CC2 A;  1VQ8 Q;  2GQV A;  3EG2 A;  3L2U A;  4E7K A;  2HL5 C;  1M1F A;  2PZ1 A;  3EFS A;  2K5I A;  2A7Y A;  4JDS A;  1WXB A;  2D8J A;  4JZ4 A;  5I22 A;  1ZA2 B;  2CZ1 B;  2RO0 A;  1VQ8 A;  4AMC A;  3MKD A;  3NPF A;  5J3B A;  3QJ6 A;  3OMC A;  3PMT A;  1FWZ A;  3OSS C;  1FMV A;  3RKY A;  2DIQ A;  2ZPI B;  3RR6 A;  2QEX A;  4FW2 A;  4FU6 A;  4LDU A;  3CMA Q;  1YJ9 A;  3DB3 A;  2ZPE B;  3CCR T;  1UEB A;  4BY6 C;  2FZK B;  1RAF B;  1PSF A;  5GJW B;  1RAE B;  4BI4 A;  2MYS A;  5GAO r;  1HYO A;  1B07 A;  3AT1 B;  1OUL A;  2CZ6 B;  5I2S A;  3JB9 J;  3TQ7 P;  2VGN A;  1D0X A;  2QK0 A;  1U1S A;  2DM1 A;  5DY9 A;  1ZUU A;  2NUP A;  1AHJ B;  5LJ3 f;  1YIJ T;  4CC2 A;  2KDS A;  1Q81 R;  1UGV A;  2O4X B;  1LPL A;  2EJ9 A;  4PJO C;  1NBE B;  1WIE A;  2F2X A;  1S72 T;  1SSF A;  4M78 E;  3M54 A;  2EYY A;  5A0L A;  1X75 C;  2QQS A;  1GRI A;  4RTT A;  1VQO T;  2HMA A;  2K7A A;  2HL3 A;  4J6Y A;  3ER0 A;  3OA6 A;  4EMG A;  3J80 E;  1Q86 U;  4L6V 5;  5KYX A;  1JJ2 P;  1WDX A;  4XTW A;  2ESW A;  1D1B A;  3UAT A;  4AFU C;  1NE8 A;  1VA7 A;  3CPW S;  3PGG A;  1S72 Q;  3QG1 A;  1HXD A;  3JSC A;  2DK3 A;  3V7C A;  3VYH B;  2RF0 A;  1UFF A;  2K57 A;  3JB9 D;  3A1P A;  4AFQ C;  2J05 A;  5HCK A;  1VQO Q;  3N5B B;  1AWJ A;  3S3M A;  2DE0 X;  4QT7 A;  3EAE A;  1PWT A;  3LH5 A;  3G71 T;  2KNB B;  1YWO A;  4M75 E;  4VUB A;  2KYM A;  1AOJ A;  3CME T;  5GAN 7;  3L42 A;  3RDV A;  3WVE B;  1SHG A;  2E6N A;  3VRY A;  3C94 A;  1TXQ A;  3SWN A;  1Y57 A;  2HSE B;  1IXD A;  4IUP A;  2CYZ B;  4J6W A;  4OB1 B;  3C4S A;  2RHX A;  3E9F A;  4PK4 A;  2LQK A;  2PQW A;  3L2Z A;  4LDW A;  1M8V A;  3UWN A;  2DYB A;  3GBQ A;  2IVW A;  2EKO A;  2KRM A;  3QO3 A;  3OBW A;  2DVJ A;  4X9C A;  1X6B A;  4C92 C;  2J6F A;  2XIC A;  4JRK A;  4M78 B;  5CR2 A;  4J9C A;  1VQK T;  2E3I A;  5KYW B;  4CC7 A;  4M77 B;  4OGC A;  5GAN e;  1AWO A;  1VQP T;  1N5Z A;  4Y92 A;  1Q7Y U;  4QQG A;  1M90 R;  3CBO A;  3JCM h;  4AFS C;  2GFA A;  3TEE A;  2HBW A;  1GCQ A;  3H9N A;  5L23 A;  5GAN j;  4DBQ A;  5FU7 C;  3ZBD A;  1K9A A;  1IHV A;  2X51 A;  2XU8 A;  1NYF A;  1M90 C;  1QVP A;  1T3S A;  2MWP A;  3MPU B;  1AZE A;  2FPD A;  1K9M U;  4PJJ A;  4M78 F;  1U1T A;  3A8G B;  2NUT B;  3O5Z A;  1ZSZ A;  3J81 E;  2RM4 A;  1OYX A;  3OW2 A;  4M77 F;  4F7U A;  1Y07 A;  3PT9 A;  2DIG A;  2FRW A;  1MND A;  1SG5 A;  3CCQ T;  4OMF B;  1VQP Q;  5KCH A;  1KQS A;  3NTH A;  1UGP B;  3L2W A;  1SHF A;  2RJF A;  3FLG A;  3G4S T;  4M75 B;  1TTH B;  1QP3 A;  3CCM T;  4FYX B;  3ZL7 C;  1VQM A;  4A4G A;  1GBQ A;  2EGE A;  1ABQ A;  3M55 A;  5KE3 A;  3JRZ A;  1AEY A;  2AT1 B;  1RLP C;  1KQS S;  4PFZ A;  4D6W A;  4JS5 A;  2DL7 A;  2SRC A;  1W70 A;  2FZC B;  4LE9 A;  2XDB A;  4PJO E;  2DXC A;  1M9S A;  2DVE A;  1G83 A;  5IHK A;  1T3L A;  2V26 A;  4M75 F;  5LJ5 f;  3LLR A;  2GCX A;  3KFV A;  1RL2 A;  2EPD A;  4LD9 K;  3VUB A;  2EQM A;  5GMK m;  1PCX A;  3OYY A;  3A8O B;  4JLG A;  4ME7 A;  3CPW P;  3CCV Q;  1OOT A;  4PJN A;  1WJS A;  2VV5 A;  3M0S A;  2IPO B;  2K2M A;  2VC8 A;  3RER A;  2HKQ B;  2K79 A;  1LOJ A;  2DTH A;  2JW4 A;  2XG8 D;  3Q1J A;  4OP0 A;  3FEO A;  5DLQ E;  3CCV A;  4IIM A;  4J9B A;  2V8I A;  3CCJ T;  3J7A F;  1MMN A;  2KRO A;  1YIT A;  1BYM A;  3WXM B;  3NMZ C;  3QYH B;  4CC3 A;  2KAF A;  3UDC A;  5CQX A;  1SRM A;  1XJW B;  2Y4Y A;  4YTL A;  5GMK e;  1NG2 A;  4LUE A;  3P8D A;  3VRZ A;  1K1Z A;  4JJD A;  1T0H A;  5LJ3 e;  3UPU A;  2OJ2 A;  4XAX B;  3A8L B;  2PU9 B;  3L1A A;  5KYY B;  2VVK A;  4M7A C;  2LQW A;  4BE2 A;  2FPE A;  4LNP A;  2RMO A;  3EH1 A;  2JTE A;  1QMC A;  4J83 A;  5CKF A;  5CKD A;  3G1J A;  3M53 A;  4E7H A;  4M7A A;  4PLI A;  1BIB A;  2RA2 A;  5DM7 R;  2YSQ A;  4BY6 B;  2L89 A;  4RMO A;  2DLP A;  5FU6 C;  3PE0 A;  2BZY A;  3G6E Q;  2YT6 A;  4ELY C;  2NUP B;  3BE3 A;  2GQI A;  1SPK A;  2K3X A;  2OAW A;  1M3B A;  1N9R A;  1PRL C;  2HQE A;  3JCM c;  3H0I A;  2DKG A;  2YDL A;  2J6K A;  3PFS A;  1X6G A;  2RI2 A;  1YJW Q;  3EFO B;  5I21 A;  4KUL A;  4KRT A;  1WNL A;  1OEB A;  4C92 E;  2OTL T;  4N4G A;  5GAN g;  4PJO B;  1YHQ T;  3EG3 A;  2J7I A;  4DBR A;  3GIB A;  1YCY A;  2DJZ A;  3QWX X;  1BI1 A;  1VQ4 T;  3CC4 T;  3M0U A;  4LDY A;  3CCL T;  1WHM A;  2HDA A;  5GAM h;  2EBP A;  2HD0 A;  2M51 A;  3I55 Q;  1VIE A;  2VGM A;  2C0T A;  1B34 B;  2L3Q A;  2RN8 A;  3HSB A;  2CSI A;  3CD6 T;  1WYX A;  3HRU A;  1QVF S;  1HJD A;  2FL7 A;  1UJ0 A;  1YI2 T;  1MMD A;  4PJO F;  2KVQ G;  5FRN A;  3JCM V;  3TCJ A;  4HCZ A;  4KBM B;  1M90 U;  2DYI A;  3RKW A;  2ZPB B;  1RAA B;  4M7D C;  5KE2 A;  3GF5 A;  5DLO A;  1D3B B;  1VQ4 Q;  1GL5 A;  1IZ6 A;  1WJQ A;  5GAN d;  2RI5 A;  1U5S A;  1K8A C;  1OU9 A;  4OML A;  2CS7 A;  4E7L A;  2EJG A;  3MET A;  1Q86 R;  3EHQ A;  4N4I A;  2LCL A;  2YWW A;  1MGQ A;  2ZAE A;  4EMH A;  1P92 A;  1KQS P;  1M3A A;  3LWH A;  2FEI A;  1F1B B;  3X20 B;  3HFO A;  2CP5 A;  4B6M A;  2GTO A;  3OYI A;  2LC4 A;  1VQL Q;  1A0N B;  5C6S A;  2DL4 A;  4M78 G;  2XDD A;  4E7S A;  4ZGE B;  3GNF B;  1ARK A;  3I56 T;  5GAN 4;  5CQY A;  1JJ2 A;  2OTJ T;  2LX7 A;  2RHZ A;  1S1N A;  2JZ2 A;  1VQL A;  2E4H A;  4Z8A A;  1BI3 A;  1KSW A;  2LJ3 A;  1UHF A;  3OQ5 A;  2YUN A;  4RTY A;  4M77 D;  4II1 A;  3CC7 Q;  2R5A A;  4JZ3 A;  3CCE T;  2P0Q A;  3CCS A;  4OB0 B;  2RQV A;  4C92 B;  3HKS A;  1YBY A;  4RUG A;  2YUO A;  3L2Q A;  3NGP A;  3MEA A;  3DLL A;  2VB6 A;  1VQ6 T;  3VU3 C;  1PC0 A;  3JCM f;  4ATO A;  1MV3 A;  2VAS A;  3CC7 A;  1O75 A;  2QYZ A;  1YFN A;  1T0J A;  2M16 A;  4HT9 A;  1K73 U;  1M8M A;  3HRS A;  2AKL A;  1BI0 A;  3MEU A;  5CKB A;  2MK5 A;  3RNJ A;  2FRY A;  1QQJ A;  5FU7 B;  4DBF A;  1OV3 A;  4M75 G;  4C92 F;  4OVA A;  1IHW A;  2RQR A;  3OS2 A;  2QGG A;  3CCE Q;  5A2Q E;  2BKD N;  2KSS A;  2LQN A;  2M02 A;  3EGD B;  3OYF A;  1PNJ A;  2F2W A;  5CCA A;  1NEB A;  3H8Z A;  4CI0 C;  1Q7Y R;  2J6O A;  4J9F A;  5LJ5 e;  4M7A E;  1KC8 C;  3CC2 T;  4BB7 A;  1EIF A;  5IT9 E;  3TVT A;  5CAI A;  2E70 A;  2B86 A;  2LT4 A;  1LJO A;  3NHN A;  2CRE A;  3BDU A;  1PSE A;  1VQN Q;  3FB9 A;  2D6F A;  1K9M R;  4QVZ A;  4WCI A;  2R57 A;  1Z9Q A;  4C8Q A;  4LDX A;  2E3H A;  4JJN K;  1GCP A;  2HQH A;  4NL3 A;  2LMJ A;  2QEX T;  3ZEH A;  2DER A;  1X69 A;  3I9Q A;  5LJ3 d;  1Y96 A;  4UC4 A;  3OYH A;  4LN2 A;  5D7U A;  2MWO A;  3P8H A;  1M3C A;  2QA4 Q;  1ZBX A;  4OMN A;  3GNG A;  1H3Z A;  1U8R A;  3F70 A;  1QVF P;  4N0A A;  2DL8 A;  1OPK A;  2Y4X A;  3VS3 A;  2CGH A;  1V29 B;  2CT3 A;  2XDP A;  1D0Z A;  3DLM A;  3PIO A;  1VIF A;  4JJC A;  2QA4 A;  3EG9 A;  4L5G A;  1SF9 A;  5KYN A;  2ZPH B;  1OZ2 A;  3M0R A;  1QWF A;  4E6R A;  3QZ9 B;  3SHW A;  1W2B S;  1X27 A;  3A8M B;  3AHU A;  1MV0 B;  2DMO A;  2K5F A;  1LCK A;  1WXT A;  2JNG A;  3L2R A;  4HVW A;  2RHY A;  1IB8 A;  1CKB A;  2CP7 A;  2JMA A;  4QVC A;  4NS5 A;  4KH0 B;  3CMA A;  4M7D E;  3DKM A;  4X34 A;  2DXB A;  4JLI A;  1EFN A;  2QXF A;  2K4Y A;  2CZ7 B;  5A0D A;  3OYD A;  4NOY A;  1YCS B;  2D0Q B;  1VUB A;  2EQJ A;  2KEA A;  2MMP A;  1K8A U;  2LQ8 A;  4M7A B;  2VYT A;  3KBG A;  1G2B A;  2B8A A;  3LGF A;  3CPW A;  1WHG A;  5D6X A;  3CCR Q;  1GFC A;  2CP6 A;  4PJO G; 
#chains in the Genus database with same CATH homology
 1BK2 A;  2CT4 A;  3I5R A;  3JV3 A;  3SEM A;  5FWB A;  2FRW A;  1BBZ A;  3UF4 A;  1E7O A;  1UUE A;  2BTT A;  4HVV A;  2GGR A;  5IHN A;  1UG1 A;  2K6D A;  1SHF A;  2ROL A;  2D1X A;  1CSK A;  5FWC A;  5EC7 A;  1XOV A;  3EG0 A;  3I35 A;  2M0Y A;  2EVR A;  4RTW A;  3ZL7 C;  3CQT A;  1GBQ A;  2X3X D;  2EGE A;  1QKW A;  2AZS A;  3A98 A;  1ABQ A;  2HCK A;  2L3P A;  5IH2 A;  3RBB B;  2RQU A;  3PVQ A;  1AEY A;  1RLP C;  1JXM A;  2NUZ A;  2YUP A;  2DJQ A;  2DL7 A;  4Z89 A;  4HVU A;  3TSW A;  2SRC A;  1W70 A;  3PVL A;  1M27 C;  2VKN A;  4LE9 A;  1KIK A;  2GTJ A;  1G83 A;  1UEC A;  5IHK A;  2O9V A;  1T3L A;  1K0X A;  4JJB A;  2D8H A;  3KFV A;  2EPD A;  2A28 A;  3M0T A;  1ZSG A;  2ENM A;  1K0S A;  4ZNX A;  2XMF A;  4M4Z A;  1ZUY A;  2P4R A;  4OMO A;  1OOT A;  2LNH B;  3VS0 A;  1FYN A;  3M0S A;  2W0Z A;  2K2M A;  4LUD A;  2DIL A;  2V1R A;  1H8K A;  1W1F A;  2K79 A;  1WX6 A;  2SEM A;  4DEY A;  1JU5 C;  2EYX A;  2JW4 A;  2L0A A;  1VYT A;  3M0P A;  1YWP A;  4IIM A;  4JPB W;  4EIK A;  1JO8 A;  2O31 A;  4J9B A;  1YNZ A;  4F14 A;  4J9H A;  1ZX6 A;  4ESR A;  1M30 A;  1WA7 A;  2KRO A;  1JXO A;  2G6F X;  3NMZ C;  2OI3 A;  4CC3 A;  2AZV A;  4K11 A;  1SRM A;  2JS2 A;  3EHR A;  1BB9 A;  2KXD A;  4Z88 A;  1NG2 A;  4LUE A;  1H3H A;  3VRZ A;  1K1Z A;  4JJD A;  1GCQ C;  1T0H A;  2A08 A;  2OJ2 A;  4A63 B;  2VVK A;  2JS0 A;  2RQW A;  3U23 A;  2LQW A;  2V1Q A;  2KGT A;  2FPE A;  4LNP A;  2RMO A;  1W6X A;  1I1J A;  1MUZ A;  2K9G A;  2JTE A;  1SRL A;  2DA9 A;  2EGA A;  2MOX A;  2W10 A;  3VS6 A;  1ABO A;  2YSQ A;  1PKS A;  2KT1 A;  3VS2 A;  5IXB A;  2DLP A;  1K76 A;  3PE0 A;  4CC4 B;  2BZY A;  3THK A;  2EQI A;  2YT6 A;  4J9E A;  3ULR B;  2LZ6 B;  4RTX A;  1QWE A;  1UTI A;  1U06 A;  1RI9 A;  4GBQ A;  2KXC A;  2GQI A;  3QWY A;  3EGU A;  1SPK A;  2OAW A;  1M3B A;  1E6H A;  1PRL C;  5ECA A;  2MIO A;  2FO0 A;  4ORZ A;  2DBM A;  4D8D A;  3H0I A;  2LJ0 A;  2YDL A;  1B3Q A;  2J6K A;  3VS1 A;  1NEG A;  1X6G A;  4KRT A;  1OEB A;  4F16 A;  2PNI A;  1AZG B;  3EG3 A;  5GJV B;  2ABL A;  2GNC A;  2J7I A;  4J9G A;  2KRS A;  3QWX X;  3M0U A;  1X43 A;  4HCK A;  2HDA A;  2E5K A;  2EBP A;  2M51 A;  1GBR A;  1AVZ C;  1V1C A;  1CKA A;  1AWX A;  2DBK A;  2C0T A;  3VS4 A;  1WXU A;  5IHI A;  2L3Q A;  2RN8 A;  1J3T A;  2DF6 A;  2HEQ A;  2CSI A;  2EYZ A;  1WYX A;  2KR3 A;  1UHC A;  1HJD A;  1UJ0 A;  1PHT A;  1NLP C;  1VYU A;  2RNA A;  1KJW A;  1KFZ A;  2DRM A;  2C0O A;  2RQT A;  1RLQ C;  4AG2 C;  2DNU A;  1PRM C;  2H8H A;  2EW3 A;  3IQL A;  1GL5 A;  2BZ8 A;  1FMK A;  1JQQ A;  1U5S A;  4OML A;  2DL5 A;  3VS7 A;  1PKT A;  3I5S A;  3EHQ A;  1SEM A;  3EG2 A;  1M3A A;  2PZ1 A;  2FEI A;  1WXB A;  2D8J A;  1Y0M A;  4JZ4 A;  2GTO A;  5I22 A;  4DEX A;  1A0N B;  2DL4 A;  1RUW A;  4AFZ C;  1ARK A;  2RPN A;  2GBQ A;  3NPF A;  2JXB A;  4J9I A;  2LX7 A;  2KE9 A;  5IXF A;  2VWF A;  1TUC A;  1S1N A;  2JM8 A;  1TUD A;  2EYW A;  2CUD A;  4Z8A A;  1KSW A;  4J9D A;  2KT8 A;  2LJ3 A;  1UHF A;  5GJW B;  2L3S A;  2YUN A;  4RTY A;  1UJY A;  2DL3 A;  5I11 A;  4JZ3 A;  1TG0 A;  1B07 A;  2RQV A;  2FG0 A;  3TSZ A;  4RUG A;  2YUO A;  3NGP A;  2DX1 A;  2DM1 A;  3REB B;  1E6G A;  3R6N A;  1ZUU A;  1MV3 A;  2C0I A;  2CH4 A;  3C0C A;  2L2P A;  1T0J A;  4RTZ A;  4CC2 A;  1SSH A;  1UGV A;  2JT4 A;  1NYG A;  2CH4 W;  2F2V A;  2MCN A;  2LP5 A;  2F2X A;  1WIE A;  1M8M A;  2ED1 A;  2AKL A;  4OMM A;  2CDT A;  2EYY A;  1ZUK A;  3RNJ A;  4X1V A;  2FRY A;  1OV3 A;  1GRI A;  4RTT A;  3EG1 A;  1ZLM A;  4F17 A;  2RQR A;  3H0H A;  2K7A A;  4D8K A;  1OPL A;  4GLM A;  2J06 A;  1Z9Z A;  2IIM A;  2QDL A;  1ZBJ A;  2LQN A;  1NM7 A;  1PNJ A;  2F2W A;  1H92 A;  1X2Q A;  1NEB A;  1WDX A;  1WFW A;  2ESW A;  1UE9 A;  2KRN A;  3UAT A;  1WI7 A;  4AFU C;  2J6O A;  1VA7 A;  4J9F A;  3UA7 A;  1I0C A;  3FJ5 A;  1K4U S;  3TVT A;  2YUQ A;  1QCF A;  2B86 A;  1I07 A;  2NWM A;  3NHN A;  4AG1 C;  2CRE A;  2RF0 A;  1UFF A;  2I0N A;  4AFQ C;  2J05 A;  4WCI A;  2ROT A;  5HCK A;  1Z9Q A;  1AWJ A;  1X2K A;  1HD3 A;  2DE0 X;  1AD5 A;  1GCP A;  4HXJ A;  4QT7 A;  2A36 A;  2EKH A;  2LMJ A;  1PWT A;  3LH5 A;  2KNB B;  2A37 A;  2AK5 A;  1IO6 A;  1HSQ A;  1YWO A;  1X69 A;  4OMQ A;  1BU1 A;  3I9Q A;  2KYM A;  4LN2 A;  3H0F A;  1AOJ A;  4RTU A;  1SHG A;  1QLY A;  3VRY A;  2CUB A;  1AWW A;  2LJ1 A;  1M3C A;  1Y57 A;  4OMN A;  2AKK A;  1GFD A;  1NLO C;  2CSQ A;  2O88 A;  2DL8 A;  1OPK A;  3VS3 A;  2CT3 A;  2ED0 A;  4JJC A;  2HSP A;  1YP5 A;  2K3B A;  1U3O A;  2KBT A;  2DYB A;  1QWF A;  3M0R A;  4E6R A;  3GBQ A;  4IIO A;  2KRM A;  1YN8 A;  3SHW A;  2PTK A;  3VS5 A;  1X27 A;  2DVJ A;  4RTV A;  1MV0 B;  2DMO A;  1X6B A;  3M0Q A;  2J6F A;  1LCK A;  1WXT A;  3UA6 A;  4HVW A;  4R0K A;  1CKB A;  4J9C A;  1QKX A;  4CC7 A;  4OMP A;  2JMA A;  2BZX A;  1WLP B;  1AWO A;  1UDL A;  1N5Z A;  4Y92 A;  4AFS C;  1EFN A;  2HBW A;  2D0N A;  1GCQ A;  2ECZ A;  5L23 A;  3H41 A;  2LCS A;  4FSS A;  1K9A A;  2EGC A;  2X3W D;  1YCS B;  2JM9 A;  2O9S A;  2KEA A;  1NYF A;  1T3S A;  2JMC A;  3REA B;  1AZE A;  5FW9 A;  2FPD A;  2FPF A;  2O2O A;  1VYV A;  2KYB A;  3O5Z A;  1G2B A;  1JEG A;  2DRK A;  1GFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...