2VKNA

Yeast sho1 sh3 domain complexed with a peptide from pbs2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
DNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN SSU81
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vknA00
2AKLA 3GBQA 1KSWA 1MUZA 2E5KA 3NPFA 4LUEA 2GNCA 2ECZA 2JT4A 1OV3A 1RI9A 2FG0A 1YN8A 2RQVA 2ED0A 2RQWA 2SEMA 2JS0A 1UHCA 3EHRA 4E6RA 5GJWB 4J9IA 2NWMA 2MIOA 2FRWA 3O5ZA 4JPBW 1NLOC 1UDLA 2OJ2A 2J05A 2EYZA 1ZSGA 4J9DA 2ROLA 2LMJA 2PTKA 4AFSC 4HXJA 4Y92A 1UUEA 2FRYA 2QDLA 2CT4A 4Z88A 1B3QA 2JS2A 4AG2C 2VVKA 5FW9A 1M3CA 1VYUA 4D8DA 2LZ6B 1OEBA 3PVQA 2D1XA 2CREA 2H8HA 3M0RA 1PWTA 2FPDA 1T3LA 4LN2A 3RBBB 2DL4A 3REBB 2EVRA 2DL3A 1VYTA 1ZBJA 2MOXA 1NYFA 2CSIA 1J3TA 2EQIA 2DL7A 3SEMA 1TG0A 3UA7A 1T3SA 2W0ZA 1K1ZA 2NUZA 2OI3A 2KR3A 1RUWA 1AWOA 3THKA 2FPEA 4CC4B 1JQQA 2KRSA 2GTJA 3VRZA 2O88A 2K2MA 2J7IA 2HEQA 1SHGA 1NLPC 4RUGA 2YUOA 2DF6A 4ESRA 4F14A 2RN8A 4RTWA 2GTOA 2CH4W 3QWYA 2D8HA 4KRTA 1ABQA 3VS2A 2HBWA 1T0HA 4WCIA 2DRMA 2RQRA 2CSQA 2KRNA 3I5RA 4JZ4A 1WA7A 2A28A 2BTTA 3NMZC 3ULRB 1M3BA 2F2XA 2O2OA 2K3BA 2G6FX 4JJCA 2A08A 2DILA 3EG0A 2L3QA 1UHFA 2C0OA 1HD3A 2DYBA 2KGTA 2MCNA 2RQUA 1WFWA 4OMMA 2CUDA 1H8KA 1TUCA 3M0TA 5IHIA 2KRMA 2JM8A 1SPKA 1U06A 2ED1A 1HJDA 1BB9A 2L2PA 2DL5A 4RTVA 3TSZA 2J06A 1E6HA 2PZ1A 1U3OA 2DJQA 3PVLA 1AEYA 3I9QA 1MV0B 1QWFA 2BZYA 3NHNA 1AVZC 4A63B 2KXCA 3TSWA 1NEGA 2KEAA 3VS5A 1ZUKA 1NEBA 3IQLA 4CC7A 4J9EA 3VS0A 1BK2A 2J6KA 2O9SA 4LE9A 2CT3A 2YUQA 1M30A 1QKWA 3M0QA 1UTIA 2EGAA 1PRLC 3EG1A 1QWEA 1SRLA 1YWOA 4RTUA 4GLMA 2W10A 2HSPA 4F16A 2RMOA 5IHKA 1UJYA 1JO8A 2HDAA 1UE9A 1WXUA 2ABLA 4J9HA 4R0KA 4M4ZA 4CC2A 2FPFA 4J9GA 3CQTA 1I07A 4AG1C 4X1VA 1YCSB 4HVUA 1GCPA 5GJVB 3PE0A 1M27C 2LCSA 1NM7A 1K76A 4AFUC 4CC3A 1X2KA 1UG1A 4Z8AA 1WI7A 2K7AA 1GBRA 2L3SA 3H0IA 1BBZA 1WX6A 4AFQC 3EHQA 3VS3A 1K0XA 1JEGA 3H0FA 2EGCA 3A98A 1X69A 2EGEA 2AZVA 1ZLMA 2DBKA 1JXMA 4JJBA 1SRMA 4J9CA 2LP5A 1UECA 1WIEA 4OMOA 1G83A 3M0UA 3TVTA 1RLQC 4AFZC 2YDLA 3KFVA 2ENMA 1GFCA 4LUDA 1A0NB 2O9VA 2D0NA 1WLPB 1WXTA 1Y0MA 1V1CA 2LJ0A 2B86A 4RTTA 3QWXX 1X27A 1UFFA 1EFNA 2LQWA 2AKKA 1CSKA 2GBQA 1AWJA 1ABOA 2C0IA 5HCKA 2DMOA 1AD5A 3I35A 2KYMA 1H3HA 1K4US 2J6OA 1I0CA 2DLPA 4LNPA 1G2BA 2GGRA 5I11A 2RQTA 2LJ1A 4HVVA 4D8KA 2YUPA 3REAB 5IXBA 1SHFA 1M8MA 2EW3A 1LCKA 2DM1A 2K9GA 2KBTA 1OOTA 2YT6A 1Y57A 2M51A 1GFDA 4EIKA 1X43A 2BZXA 1WYXA 2P4RA 4OMNA 1VA7A 2K6DA 3LH5A 3UATA 1FMKA 1E6GA 3EGUA 1NG2A 2F2WA 1B07A 1IO6A 3M0PA 5ECAA 2JMCA 1PHTA 2EBPA 1SSHA 2LNHB 1GRIA 1QLYA 1HSQA 2L0AA 2DBMA 3I5SA 2JM9A 4IIOA 1K0SA 4ORZA 2X3WD 2DE0X 2F2VA 3R6NA 1AOJA 2JW4A 1ARKA 1BU1A 1W70A 2KNBB 2KXDA 2DVJA 1Z9ZA 1U5SA 2X3XD 1AZEA 1OPLA 2RNAA 1UGVA 5IXFA 1YP5A 2ESWA 2ROTA 3RNJA 2M0YA 2GQIA 4Z89A 1QKXA 1X2QA 1K9AA 2XMFA 4JZ3A 4OMPA 1GL5A 3UA6A 5I22A 2SRCA 3C0CA 5IH2A 2L3PA 2AK5A 2DA9A 1WDXA 4OMLA 1AWWA 2CUBA 2C0TA 3VS4A 5FWCA 5FWBA 5IHNA 2V1QA 3M0SA 2DL8A 1SEMA 2KT8A 2CDTA 1YNZA 1GBQA 2LQNA 3EG3A 4J9FA 2O31A 4ZNXA 2A36A 1UJ0A 3EG2A 1RLPC 3H0HA 1FYNA 1NYGA 2PNIA 1CKAA 4DEXA 2D8JA 1WXBA 1ZX6A 2A37A 2KT1A 3H41A 1GCQA 4K11A 2OAWA 2AZSA 4GBQA 1Z9QA 1KJWA 3NGPA 2V1RA 1KFZA 1PNJA 4JJDA 4DEYA 4F17A 5L23A 1PKTA 2LX7A 1CKBA 2JMAA 4J9BA 5EC7A 2JXBA 1PKSA 1ZUUA 4RTZA 2RF0A 1GCQC 2JTEA 1M3AA 1E7OA 2CH4A 2DX1A 3UF4A 4HCKA 3VS7A 2BZ8A 2EYXA 3SHWA 3VRYA 1N5ZA 1W1FA 2I0NA 1T0JA 2DNUA 4IIMA 2EYWA 1X6GA 1H92A 1QCFA 1VYVA 4OMQA 2EYYA 3FJ5A 2KE9A 1PRMC 4HVWA 1OPKA 1JU5C 2HCKA 1AZGB 2J6FA 2VWFA 2YUNA 1I1JA 4FSSA 2KYBA 4RTXA 1TUDA 2YSQA 2FEIA 2RPNA 2VKNA 3U23A 3JV3A 1YWPA 3ZL7C 2DRKA 1ZUYA 2FO0A 2KROA 1W6XA 3VS6A 1S1NA 1AWXA 1KIKA 4RTYA 2LJ3A 1JXOA 2K79A 3VS1A 1X6BA 2EKHA 1MV3A 2IIMA 4QT7A 2EPDA 1XOVA
chains in the Genus database with same CATH superfamily
2AKLA 3AT1B 2H3JA 2LRQA 1VOMA 2QQAA 5AYFA 4BY6C 5GANe 2GNCA 3EAEA 1JB0E 3EHRA 3CMEQ 5GJWB 4C5IA 1YI2Q 1KQSS 3CMEA 5LJ3d 4JPBW 1NLOC 1YI2A 3X25B 3CCJT 1IHWA 2BIVA 3CPWP 2OJ2A 2EYZA 1C0MA 3RKXA 4C0DC 3JCMd 4M7AC 2EJFA 1QVGA 2HQEA 3V8LA 5GMKj 3CCVQ 4AFSC 2FYKA 3CCVA 1B34B 4M7DE 2QDLA 3DB4A 2CT4A 2VVKA 3OSSC 5GANg 2XU8A 3PVQA 2D1XA 2CREA 1JRIA 2H8HA 4C5GA 1PWTA 3SWNC 3WVEB 3WXMB 2DL4A 2XDPA 3REBB 4BI8B 1Q82R 4E7HA 4QW2A 2DL3A 4PKCC 2RJEA 2DTOA 3QBYA 1TG0A 3ZEHA 4R55A 2L89A 1T3SA 1K1ZA 1D1AA 3P8DA 3X24B 3FIFA 5FLXE 4A4GA 4CC4B 1JQQA 2KRSA 1VQPQ 1M2OA 3VRZA 2K2MA 4JJNK 1VQPA 2HEQA 4C8QE 4J83A 2K4YA 4BI3A 2DF6A 4ESRA 3CMAQ 2GTOA 2LQKA 2L8DA 2ZPIB 2X9HA 3CMAA 5FU7B 2M16A 4Z02A 4WTOB 1H641 3CPWS 5GAOn 3I5RA 1PG5B 3H6ZA 2BTTA 3HRUA 2X4XA 3N5BB 2LT4A 2K3BA 3PMIA 5GANh 1FXXA 2G6FX 4ZTJA 1MMAA 1VQOQ 4C0GA 1BKBA 4M7DG 1VQOA 2MCNA 2E3IA 2RQUA 4FYWB 1H8KA 2QDYB 3OYAA 3D7SB 5IHIA 3TCJA 1W4SA 2JM8A 1SPKA 1U06A 1PD1A 1R0CB 2ZPFB 2ED1A 5KYXA 1M5Q1 1BB9A 1X01A 4FYYB 3TSZA 3MO8A 1E6HA 2KSSA 3EFSA 3VU3C 4E7SA 1U3OA 1QWFA 1BI1A 4A63B 3HSBA 2KEAA 1ZUKA 3CCJQ 3QDRB 4J9EA 3VS0A 3OB9A 3CCJA 3CCUT 2CP3A 1ZQ1A 1VQNT 4C8QG 5A0GA 4FW2A 5GAMe 1UTIA 2QXFA 1PRLC 3EG1A 3HPWA 1SRLA 3VJPA 4RTUA 2HSPA 3GOXA 1JJ2A 1VQLT 2KAFA 4XTWA 4QQGA 1UGSB 1R8OB 2WSCE 3V8JA 4J9GA 1I07A 3NFCA 4N4GA 4FYVB 2DTIA 4M78E 1TH7A 5GAN6 5GJVB 3INZA 1K76A 3M58A 5GAMg 2HZYA 1NJIR 5DLQE 2DZCA 4PJOF 5LJ5f 2L3SA 2DIQA 3H0IA 3NTKA 4A4FA 5A0LA 4C92A 2RHIA 4M75G 1QMCA 2PVOB 3VS3A 2YHTA 1JEGA 3DKMA 3H0FA 1IGUA 2EGEA 2AZVA 1I5OB 3DB3A 4HCZA 2DBKA 1SRMA 4PFZA 3ZBDA 4KT0E 3S3OA 3HKSA 3E9FA 3JCMV 1MNDA 4J7FA 4RKUE 4ELZC 5LL6S 4M77C 3TVTA 1RLQC 2YDLA 2RHYA 3X28B 3BW1A 4MZPA 1WLPB 1D0XA 2Y90A 5FROA 4M7AF 3OYIA 2LC4A 1WHHA 1X27A 2RJCA 5CVIA 4XTYA 1LJOA 1UFFA 2FL7A 3S6WA 1CSKA 2GBQA 2C0IA 1Q81C 2LT1A 5GAMh 5HCKA 2DMOA 1AD5A 3MP1A 3I35A 3C12A 4M78G 1H3HA 1I0CA 1G2BA 2Y4XA 4A4HA 2RQTA 2GCXA 4KGVB 2PVGB 5IAYA 2KBTA 2YT6A 3CCST 3CCUQ 3EH2A 1GFDA 1RAIB 4XTZA 1VA7A 4FT4A 3CCUA 1VQNQ 2HL3A 2E1HA 3LH5A 1AT1B 3P8HA 1VQNA 1FMKA 3EGUA 4F7UA 3M0PA 1YHQT 1YITQ 2JMCA 2JZ2A 3CCRQ 1YITA 2LVMA 2X51A 1Q81U 2LNHB 1GRIA 3JCMJ 4FSXA 2DBMA 3I5SA 5KYNA 5GAOp 2D6FA 3PGGA 2DE0X 5D6XA 2V26A 3CC4Q 1W70A 3OBYA 3CC4A 1NZ9A 1X75C 1TU0B 1HXDA 1U5SA 4X9CA 3JB9I 2E41A 2AT1B 4QVCA 1M1KC 1MMDA 3RMQA 2RNAA 1FWZA 1X6OA 5IXFA 1YP5A 3OMCA 3LLRA 4BE2A 4OMPA 1N8RC 4J6XA 1GL5A 1ZA1B 1VQ6T 4IUTA 2VUBA 2L3PA 2DA9A 1AWWA 4E47A 3LGLA 3GNFB 1M1GA 5FWCA 4M78C 2V1QA 3M0SA 3X20B 1SEMA 3VUBA 2LQNA 4J9FA 1V76A 4L59A 1OU8A 3EG9A 1UJ0A 3EG2A 1FYNA 5CKEA 4DEXA 4JS4A 2D8JA 3OS2A 2EQUA 1Y7XA 1M1KU 3H41A 2DZ9A 1G3SA 4ZGJB 4GBQA 3BY7A 1Y71A 1KJWA 1VQ4T 1N8RU 4JS5A 2HQHA 2COZA 3I55T 1PNJA 4C92E 5L23A 1PM3A 1PKTA 2LX7A 2R5MA 5HY6A 4HA8A 5EC7A 3OY9A 2K5LA 2OTLT 1RL2A 4ZGDB 2FVUA 1E7OA 2CH4A 2DX1A 3M59A 3G7ZA 3TU4K 3CBPA 2MWPA 2M9UA 3LWHA 2YRVA 1N5ZA 3MKDA 4M77D 4OB1B 5CQYA 4M75B 2E65A 1YJ9T 1YCYA 3FJ5A 3A8MB 4M7DF 4KUIA 3CCSQ 2NUTB 4HKEA 1OPKA 4HVWA 3FC3A 1JU5C 3CCSA 3F70A 3VV0A 1OU9A 4EMHA 2LCCA 2KYBA 4RTXA 1G5VA 5GANj 2YSQA 2MMPA 2RPNA 2LDMA 1TS9A 3MJXA 2QGGA 1YHQQ 3JV3A 1O75A 1KC8R 2O4XB 2FO0A 3GPLA 2KROA 5KYYB 1YHQA 2GQVA 1WQWA 1M4ZA 1ZSZB 4VUBA 4A53A 2HKQB 1QQJA 3NPFA 3EFOB 2PQWA 1Q82C 2ECZA 3M4YA 2MF2A 2RQVA 3FDRA 4F04B 4M77F 2RQWA 5FU6C 4C92G 3T9NA 2MIOA 1B7TA 2YRDA 1WJQA 4F7UE 1VQ6Q 1SF9A 2XD0A 4DA4A 2F5TX 1ZSGA 1Y96A 4J9DA 1VQ6A 3QIIA 1YI2T 3L2UA 4L6V5 4Z88A 1B3QA 2R5AA 3J7AF 2QQ9A 3CCVT 3LYIA 2R57A 4D8DA 1Q82U 1G8XA 3TQ7P 2LQ8A 4C0ZA 1Q7YR 1DJ7B 2DTHA 1VQ4Q 3I56Q 2QAZA 4LDXA 1VQ4A 3UA7A 3I56A 3I55Q 2QA4Q 2OI3A 2F69A 3I55A 2KR3A 1AWOA 3L2VA 1VQMQ 3FB9A 2OTLQ 1VQMA 2IPOB 2OTLA 3CCMQ 1NLPC 3JB9D 3CCMA 1FMVA 2GFUA 2RN8A 1UGQB 3JCMP 4ZTFA 2RK1A 4KRTA 2EQMA 2K2VA 1T0HA 3C95A 4WCIA 1MMNA 3CMAT 1EIFA 2RQRA 2DPPB 2KRNA 1NPRA 4JZ4A 4F7UG 4N4IA 4PL6A 4N0AC 2CZ6B 3QYGB 5FU7C 2X4WA 4JJCA 3EG0A 4XU3A 4LXCA 2L3RA 4IUPA 4JRKA 2L3QA 2O4XA 2C0OA 4KGXB 1HD3A 2KGTA 1WFWA 4OMMA 4JLGA 4M78F 4PJOC 1G3WA 1ZHIA 4X9DA 1TUCA 3M0TA 3SDZA 2M02A 2CZ1B 1BI0A 4P5NA 3JCMX 5GAMj 5CO7A 3OYHA 3JB9F 8AT1B 4EMKC 1AEYA 2ZGWA 1MV0B 2BZYA 3NHNA 3QJYA 3E1SA 4KH1B 2KXCA 3TSWA 1NEGA 2D0QB 1NEBA 5CIUA 2CP5A 4EDUA 1NBEB 1NJIC 1BK2A 4J6WA 1RABB 3CCLQ 2J6KA 2O9SA 2YLCA 3CCLA 2DIGA 1QVFA 1M30A 1KQ2A 3M0QA 3A8HB 4E7JA 3QHSA 2EAYA 2EYQA 3J80E 4F16A 2RMOA 3MEAA 5IHKA 2MAMA 2V8JA 4ELYC 1JO8A 1UEBA 1MMGA 1RACB 3MEWA 1WXUA 2ABLA 3A8LB 4J9HA 1XNIA 2LX9A 3GF5A 2CZ7B 4AMCA 5GAOr 3CQTA 4PJMA 1HK9A 1NJIU 2EQJA 1R0BG 5I2SA 1RAHB 3TEEA 2YXYA 1N6AA 4AT1B 4AFUC 4CC3A 3QPHA 1QVGP 1UG1A 1GBRA 1BBZA 3EGXA 1N9RA 2CP7A 1WX6A 3EHQA 1K8AR 2E64A 1UB4A 4C92B 2ZCFB 4CRIA 1ZBXA 3MP6A 3V7RA 2FZKB 1VIEA 3GNGA 2XG8D 4ME7A 2LP5A 2CYZB 4QKUA 1WHLA 1PCXA 1JBMA 1WIEA 1D0ZA 3G1JA 4JRIA 4ANJA 4EMGA 4LUDA 2O9VA 3C94A 2HBPA 1V1CA 4RTTA 2B86A 3URGA 2DETA 3QWXX 4YTLA 1M1FA 3UWNA 2NLUA 4KH0B 1NPPA 2F5KA 1M2VB 4E7IA 1PD0A 3TREA 1WPYA 1XTDA 1SG5A 4PLLA 4BD3A 3BDLA 2E12A 4BE0A 3M5AA 2KYMA 3BDUA 4M75E 1QVGS 3L2RA 5CAIA 2DLPA 4LNPA 4PJJA 5KYWA 3OYFA 2GGRA 3UT1A 5I11A 1KK7A 3MEVA 2ZPGB 5IXBA 1M8MA 2DM1A 1IB8A 4MDWA 1H3ZA 4KULA 5GANf 2BZXA 2P4RA 5J3BA 4O5VA 4PJOD 2BE9B 4JLIA 2PVDB 2QGFB 4BY6B 2AHJB 1WHMA 1E6GA 1WJRA 1D0YA 1YIJQ 2F2WA 1B07A 4UC4A 5ECAA 4GLKA 2IG0A 1YIJA 2DXBA 3MPUB 2EBPA 1SSHA 4F7UB 3GP8A 1QLYA 1M9SA 2JM9A 2VXEA 1YITT 1K0SA 3CCRT 4FYXB 2F2VA 3M57A 2H3EB 1ARKA 1SSFA 2DVJA 5KCOA 2COWA 1Z9ZA 2VGMA 2VYTA 1OX9A 3CC4T 1K73R 4IUQA 2NUPB 2MYSA 2FHDA 2ROTA 2M0YA 2GQIA 4Z89A 4M7DC 4M7AD 2E6ZA 3RKYA 3UA6A 1IZ6A 2SRCA 1WHJA 3OYYA 3C0CA 4BI4A 1WDXA 4OMLA 1P92A 1W2BA 5J39A 3OBWA 2KT8A 4XTXA 2CDTA 1JJ2P 1WZOA 4C0FA 2A36A 2CS7A 1U1SA 4RG8A 5DY9A 3CD6Q 3EG9B 1BI3A 2KT1A 1MGQA 2RK2A 1GCQA 4K11A 2OAWA 2AZSA 4DBRA 1Z9QA 4IUVA 3PFSA 3JCMc 1FX7A 4C8QC 4O6JA 1KFZA 4JJDA 4DEYA 1KC8C 1IREB 2DERA 1LPLA 2JMAA 3H9NA 2RF0A 1M3AA 3L2QA 1M2VA 3V7CA 3LW5E 3UF4A 4PJLA 4QVDA 3ME9A 3VS7A 3FRNA 3OA6A 4DOVA 2BZ8A 1K9MC 3VRYA 4RMOA 1W1FA 2ZPHB 2DNUA 4IIMA 2EYWA 1X6GA 1O9SA 1QCFA 3EGDA 3G6EQ 2EYYA 2KE9A 4Y28E 5GANd 2RB6A 3OS1A 1AZGB 1KC8U 3LGFA 4A54A 1EZZB 4CI0C 2E4HA 1JJ2S 2VKNA 4FL6A 4M75C 1LNXA 1AWXA 3OYMA 2JTFA 1MV3A 5GAMf 2EPDA 4BDZA 3CCRA 1S72T 4LD9K 2Z0WA 4M7AA 1RAEB 3GBQA 2NYSA 3CXCA 5A0DA 1KSWA 2E5KA 2LTOA 2EJ9A 2WSFE 2JT4A 1Q7YC 2QQRA 4IUUA 3CC2T 4XTVA 1YN8A 1ZSZC 4Q5WA 1WHGA 1OZ3A 2HKNA 1FMWA 3L2ZA 4LDWA 4E6RA 1BCMA 2NUPA 2NWMA 4BB7A 3G4ST 3O5ZA 1QCNA 3SWNA 1UDLA 4QQDA 4B9XA 4J6YA 2LMJA 2PTKA 4HXJA 2DXCA 1Y96B 5KE2A 5GAN8 3OYLA 2JS2A 4AG2C 3EH1A 1M3CA 3SFMA 1KQ1A 1OEBA 3CCQT 1Q7YU 3M0RA 5J26A 1HYOA 4LN2A 2E70A 2ZAEA 2EVRA 4KGZB 5KH6A 4FM4B 4M7DD 1VYTA 3JCMW 3E2UA 2MOXA 5LJ3e 2EQIA 1IHVA 3M56A 3JCMe 4PJNA 2W0ZA 4PFPA 2XKOC 2NUZA 1LVKA 3I56T 4HCBA 4A4KA 3SD4A 2QA4T 2O88A 1VQ8T 2J7IA 4IURA 3PT9A 4EPCA 1SHGA 2CGHA 1VQMT 2QG9B 4F14A 5GAN3 4RTWA 3QWYA 5CKDA 1ABQA 3CCMT 3PTAA 3M53A 3RMSA 2X35A 5LJ3g 3VS2A 2HBWA 2DEUA 3JCMg 4C8QD 2CSQA 4QQ6A 3ULRB 1M3BA 2F2XA 2O2OA 1VQKT 1KHCA 2DJZA 1UHFA 4MZTA 2DYBA 2CUDA 1GXIE 4OB0B 2KRMA 2A7YA 5GAMd 3Q1JA 1S72Q 2RI3A 1IXDA 4FCYA 1S72A 3VUZA 1ACMB 1HJDA 3OW2A 5FRMA 2J06A 3CC2Q 2PZ1A 2XI9A 4XTUA 3PVLA 2EFIA 1K9MR 3CC2A 1AVZC 4GY5A 3VS5A 2DD4A 5GAOq 3G4SQ 2KDSA 3HFNA 4CC7A 4C8QF 3G4SA 5HKCA 2ZPBB 4LDVA 1OQKA 3OMGA 2EQKA 3DLMA 3CC7T 3NTIA 5LJ3h 1QKWA 2EGAA 3JCMh 3CCLT 1K8AC 2OTJT 2XDBA 1YWOA 4JUVA 3CCQQ 1TXQA 4GLMA 2W10A 3CCQA 1UJYA 2JN0A 4LD6A 4E2FB 2VB6A 1YJWT 3PIOA 4OF1A 2E10A 3QDFA 3MHXA 5CR2A 2QASA 3OS0A 4X1VA 2C06A 1YCSB 2M1HA 1GCPA 2X4YA 1NM7A 5GMKi 5CCAA 4FW1A 2EWNA 3CEYA 1X2KA 4Z8AA 4M75F 3OQ5A 3OYEA 1K8AU 1VQ8Q 5D6WA 3PMTA 2QA4A 4M78D 4C5HA 1VQ8A 4AFQC 1G3YA 3EGXB 4M77A 5GAOm 4E7ZA 3BE3A 2VV5A 3A98A 1X69A 2YLBA 4MDXA 3CPFA 1KQSA 1I8FA 2RM4A 4J9CA 2HQXA 1UECA 4C92C 2COYA 4OMOA 2F1LA 1WHKA 3M0UA 1ZA2B 3RESA 2YRCA 1VQKQ 2ENMA 1GFCA 3SB2A 2D0NA 1VQKA 1WXTA 3OYCA 4ZN1A 2DEQA 5GAN5 1WGSA 2A0FB 1U8RA 1EFNA 2K3YA 3O8VA 2LQWA 1PSEA 1AWJA 1ABOA 3MCAB 3CBMA 1YBYA 4J7IA 3HRSA 1WNLA 3S3NA 1KD1R 2EJGA 2CZ0B 2J6OA 3DLLA 4HVVA 4D8KA 4N4HA 2DYIA 5KYWB 2I2LA 1SHFA 1C1AA 2EW3A 1K73C 2K9GA 3CC7Q 5KE3A 1WYXA 4OMNA 4DBFA 4E7KA 3CC7A 2HMAA 3OS5A 1SKUB 3V8KA 4BACA 1NG2A 3J81E 2OTJQ 3CPWA 4QVZA 4FIBA 4IKFA 2OTJA 1HSQA 2RI5A 1YIJT 2L0AA 1R77A 4ORZA 3RDVA 1YJWQ 3EFRA 3R6NA 1AOJA 2CP2A 3OYBA 1YJWA 3VYHB 1BU1A 2KXDA 1K73U 2BKDN 4M78A 1I5LA 4WF2A 2RA2A 4BE1A 2X3XD 1AZEA 1OPLA 2M0OA 5CK9A 1QVFP 1RADB 1QKXA 1X2QA 1K9AA 2KY9A 2XMFA 3UDCA 5D7UA 5I22A 4PK4A 2KQWA 5IH2A 1VQ5Q 2MPXC 4J8OA 1VQ5A 4JDSA 1U1TA 3QJ6A 1YNZA 2QQSA 3EG3A 3RR6A 5I2MA 2VC8A 2FZCB 1NYGA 2PNIA 1CKAA 3FLGA 1WQ7A 1I4K1 5LJ5e 1WJSA 4OGCA 1EX4A 4MZMA 1UGPB 3CD6T 2QTXA 3NGPA 2RI2A 1TOVA 5C6SA 4PLIA 2XICA 3LWIA 4M77E 3QZ5B 2EKOA 1PKSA 1ZUUA 4RTZA 1OX8A 4JRQA 4KBMB 5CKHA 1MHNA 3VYGA 4NL2A 1D3BB 2RO0A 3JSCA 4C92D 1M90R 2I0NA 1QVFS 1T0JA 1PC0A 3HL8A 5LJ5g 3QSUA 2DD5A 2XK0A 4PJOB 4OMQA 4NS5A 1BYMA 1IGQA 3EGDB 1PRMC 2K5IA 2HCKA 2VWFA 3G6ET 2YUNA 1I1JA 4FSSA 1OYXA 2P84A 4HT9A 4JRPA 9ATCB 3QO3A 3ZL7C 4EMKB 3QXEB 3V7SA 2GF7A 4L5GA 1S1NA 1KIKA 4Y91A 2K79A 2DFUA 4R56A 1N9SA 1QP3A 4XU1A 4QT7A 1RAGB 5GAOl 4XU2A 4C5EA 3H8ZA 5GMKl 5CKBA 4B6MA 5IT9E 1PSFA 3MP8A 1MUZA 4LUEA 4C0DB 4M7AB 1OV3A 4C92F 1RI9A 2FG0A 2GFAA 2FZGB 3LX7A 3OYJA 3JB9H 2ED0A 3UPUA 2SEMA 2JS0A 1UHCA 3L1AA 2O01E 1OULA 7AT1B 2HL5C 2RHUA 3QZ9B 4J9IA 1F1BB 1RAFB 3HTRA 2FRWA 2Y4YA 4M77G 4XU0A 2EIFA 2J05A 2MK5A 1NE8A 5LJ5h 4NL3A 2ROLA 1B34A 3SWNB 5LJ3j 3AHUA 4Y92A 3S3MA 1UUEA 2FRYA 2BUDA 2JVVA 3ZFJA 4ATOA 5FW9A 1M8VA 2G3RA 1VYUA 2LZ6B 2DVEA 2V8KA 2FPDA 2VASA 1T3LA 2XDDA 3RBBB 3X26B 2HAXA 4II1A 1ZBJA 1NYFA 3L42A 2CSIA 2XIDA 1J3TA 5GMKe 2DL7A 3SEMA 3CD6A 4OMFB 2LNVA 3WVDB 2K57A 1RUWA 2HSEB 3THKA 2FPEA 1W2BP 2OX7A 4FU6A 1VIFA 2GTJA 2PUKB 2V8IA 1OZ2A 3HP9A 2YUOA 4RUGA 2X4JA 4N0AA 3META 1VQ9T 1V29B 2R58A 2CH4W 1D3BA 1TWBA 2D8HA 4LDUA 3JRZA 2PU9B 1RI0A 3P8BB 2DRMA 1LOJA 4F7UF 4PJOA 2QI2A 3OSVA 3A1PA 3RERA 3RKWA 1WA7A 2A28A 4ZGEB 3NMZC 3G6EA 2A08A 3QYHB 2DILA 5KCHA 4EMKA 1IRXA 3BFMA 5DLOA 2DXTA 2KMTA 1BIBA 3GLXA 1Q86C 4X34A 2DAQA 4XQ3A 2DKGA 2BE7D 4OB3B 1K9MU 2L2PA 2DL5A 4RTVA 3OYKA 2HD0A 2DJQA 1W2BS 3I9QA 2ZZDA 3JB9G 1BCOA 2KVQG 4DOWA 3IQLA 4HCCA 3R6OA 4NOYA 1YFNA 4RCBA 4LE9A 3RIRA 2CT3A 1XJWB 2YUQA 5FRNA 1D1CA 5GMKh 1Q86U 4BDYA 1OI1A 2HNIA 5KYUB 1VQLQ 4A4EA 1QWEA 2A3LA 5D6YA 8ATCB 3QKJA 1VQLA 4M7DB 3CXCP 2VGNA 3M54A 2QK0A 1AHJB 2HDAA 4BUGA 1UE9A 2OAUA 2RJFA 2JTMA 4R0KA 3MEUA 4M4ZA 4CC2A 2FPFA 2RD1A 3A8OB 4AG1C 5LJ5d 4HVUA 5GAN2 4FT2A 3PE0A 1M27C 2LCSA 3GIBA 2P0QA 1WI7A 1QW1A 3KXTA 2K7AA 3C4SA 4V2SA 4PNOA 2KI7A 4LDYA 2QEXT 3JAME 2RJDA 2D9TA 1VQ9Q 1K0XA 3CBOA 1VQ7T 4C8QB 2EGCA 4M77B 1VQ9A 1ZLMA 3HRTA 1JXMA 1KD1C 4JJBA 2YWWA 4RG2A 1QP2A 5AT1B 3KBGA 3VKIA 3M9QA 2QTVA 5GAN7 1G83A 2JNGA 4OP0A 4OVAA 2B8AA 4AFZC 4XAXB 3KFVA 3RUXA 1A0NB 3CXCS 1Y0MA 2LJ0A 3QUIA 4KUDK 4B9WA 2JOYA 3JCMb 1BIAA 2JUFA 3PNWC 2AKKA 1KD1U 4DBQA 2K5FA 1UGRB 2KK4A 4DQ2A 4PJOE 1K4US 2QYZA 1VUBA 2LJ1A 3CCET 2YUPA 3REAB 5CQXA 3G71T 3JB9J 1LCKA 5L8RE 1OOTA 2MI6A 2PUOB 1Y57A 2M51A 4EIKA 1X43A 4PFOA 1MNEA 4M75D 1D1BA 2K6DA 2AIRB 4MMLA 3UATA 4XK8E 2P0KA 1IO6A 2ZPEB 1PHTA 2RHXA 5KYUA 2FB7A 4IIOA 3OW2P 4M7DA 2WSEE 3HHTB 1YJNT 1Q81R 2X3WD 1Q86R 1BI2A 2JW4A 4DBHA 4M7AE 5IN1A 2E3HA 2RHZA 1TSFA 2CKKA 2KNBB 3A5ZB 1QCOA 1QVPA 3M55A 1C6VX 4M78B 2P4TA 1UGVA 5HK0A 6AT1B 4OGEA 2ESWA 3RNJA 2MWOA 3CMET 3OYNA 4JZ3A 5LJ3f 5LJ5j 2QEXQ 3KUFA 1D09B 2P0PA 2IVWA 4HT8A 1I81A 3JCMf 2AK5A 2QEXA 2CUBA 2C0TA 3VS4A 1VQ7Q 5FWBA 5IHNA 2DL8A 5M9OA 5C0MA 1VQ7A 3OYDA 4PJOG 1GBQA 2DK3A 4OB2B 4C8QA 1VQ5T 3NTHA 2O31A 4ZNXA 1M90C 2E5QA 4TVRA 3JCMQ 2L5QA 1RLPC 1G3TA 3H0HA 5GMKm 2DXUA 3LH0A 1WXBA 1XQHA 1ZX6A 5A2QE 2A37A 5GAN4 3ER0A 1Y07A 1M1KR 5I21A 3M4GA 4E7LA 5HK3A 3ASKA 3OW2S 2V1RA 4RCCA 4F17A 1CKBA 1N8RR 3OYGA 2RH2A 4J9BA 2DO3A 5CKFA 1RAAB 2CP6A 3PIPA 2JXBA 3FEOA 4ZN3A 1KG1A 2VXFA 2E6NA 2JJ9A 1GCQC 1VQPT 3E19A 1M90U 2JTEA 1KQSP 4M7AG 2QQBA 4HCKA 1YJ9Q 2LCLA 2EYXA 3SHWA 4M75A 4MMKA 1YJ9A 1H92A 2XHCA 1TUGB 1VYVA 3L2WA 3CCEQ 2NUTA 3G71Q 1TTHB 3CCEA 3QG1A 3G71A 5DM7R 1Q95G 2J6FA 1KHIA 2WACA 1TUDA 5KYYA 2FEIA 3U23A 4D6WA 1YWPA 5EG2A 2DRKA 3E9GA 1ZUYA 2ATCB 3HFOA 1VQOT 1W6XA 3VS6A 1ZSZA 4RTYA 2LJ3A 1JXOA 1N27A 2CP0A 3FJPA 3VS1A 1X6BA 2EKHA 4J5YA 1YJNQ 5FU6B 2IIMA 2K3XA 1XOVA 1YJNA 3A8GB 5KYXB 3EFOA
chains in the Genus database with same CATH topology
2AKLA 3GBQA 1KSWA 1MUZA 2E5KA 3NPFA 4LUEA 2GNCA 2ECZA 2JT4A 1OV3A 1RI9A 2FG0A 1YN8A 2RQVA 2ED0A 2RQWA 2SEMA 2JS0A 1UHCA 3EHRA 4E6RA 5GJWB 4J9IA 2NWMA 2MIOA 2FRWA 3O5ZA 4JPBW 1NLOC 1UDLA 2OJ2A 2J05A 2EYZA 1ZSGA 4J9DA 2ROLA 2LMJA 2PTKA 4AFSC 4HXJA 4Y92A 1UUEA 2FRYA 2QDLA 2CT4A 4Z88A 1B3QA 2JS2A 4AG2C 2VVKA 5FW9A 1M3CA 1VYUA 4D8DA 2LZ6B 1OEBA 3PVQA 2D1XA 2CREA 2H8HA 3M0RA 1PWTA 2FPDA 1T3LA 4LN2A 3RBBB 2DL4A 3REBB 2EVRA 2DL3A 1VYTA 1ZBJA 2MOXA 1NYFA 2CSIA 1J3TA 2EQIA 2DL7A 3SEMA 1TG0A 3UA7A 1T3SA 2W0ZA 1K1ZA 2NUZA 2OI3A 2KR3A 1RUWA 1AWOA 3THKA 2FPEA 4CC4B 1JQQA 2KRSA 2GTJA 3VRZA 2O88A 2K2MA 2J7IA 2HEQA 1SHGA 1NLPC 4RUGA 2YUOA 2DF6A 4ESRA 4F14A 2RN8A 4RTWA 2GTOA 2CH4W 3QWYA 2D8HA 4KRTA 1ABQA 3VS2A 2HBWA 1T0HA 4WCIA 2DRMA 2RQRA 2CSQA 2KRNA 3I5RA 4JZ4A 1WA7A 2A28A 2BTTA 3NMZC 3ULRB 1M3BA 2F2XA 2O2OA 2K3BA 2G6FX 4JJCA 2A08A 2DILA 3EG0A 2L3QA 1UHFA 2C0OA 1HD3A 2DYBA 2KGTA 2MCNA 2RQUA 1WFWA 4OMMA 2CUDA 1H8KA 1TUCA 3M0TA 5IHIA 2KRMA 2JM8A 1SPKA 1U06A 2ED1A 1HJDA 1BB9A 2L2PA 2DL5A 4RTVA 3TSZA 2J06A 1E6HA 2PZ1A 1U3OA 2DJQA 3PVLA 1AEYA 3I9QA 1MV0B 1QWFA 2BZYA 3NHNA 1AVZC 4A63B 2KXCA 3TSWA 1NEGA 2KEAA 3VS5A 1ZUKA 1NEBA 3IQLA 4CC7A 4J9EA 3VS0A 1BK2A 2J6KA 2O9SA 4LE9A 2CT3A 2YUQA 1M30A 1QKWA 3M0QA 1UTIA 2EGAA 1PRLC 3EG1A 1QWEA 1SRLA 1YWOA 4RTUA 4GLMA 2W10A 2HSPA 4F16A 2RMOA 5IHKA 1UJYA 1JO8A 2HDAA 1UE9A 1WXUA 2ABLA 4J9HA 4R0KA 4M4ZA 4CC2A 2FPFA 4J9GA 3CQTA 1I07A 4AG1C 4X1VA 1YCSB 4HVUA 1GCPA 5GJVB 3PE0A 1M27C 2LCSA 1NM7A 1K76A 4AFUC 4CC3A 1X2KA 1UG1A 4Z8AA 1WI7A 2K7AA 1GBRA 2L3SA 3H0IA 1BBZA 1WX6A 4AFQC 3EHQA 3VS3A 1K0XA 1JEGA 3H0FA 2EGCA 3A98A 1X69A 2EGEA 2AZVA 1ZLMA 2DBKA 1JXMA 4JJBA 1SRMA 4J9CA 2LP5A 1UECA 1WIEA 4OMOA 1G83A 3M0UA 3TVTA 1RLQC 4AFZC 2YDLA 3KFVA 2ENMA 1GFCA 4LUDA 1A0NB 2O9VA 2D0NA 1WLPB 1WXTA 1Y0MA 1V1CA 2LJ0A 2B86A 4RTTA 3QWXX 1X27A 1UFFA 1EFNA 2LQWA 2AKKA 1CSKA 2GBQA 1AWJA 1ABOA 2C0IA 5HCKA 2DMOA 1AD5A 3I35A 2KYMA 1H3HA 1K4US 2J6OA 1I0CA 2DLPA 4LNPA 1G2BA 2GGRA 5I11A 2RQTA 2LJ1A 4HVVA 4D8KA 2YUPA 3REAB 5IXBA 1SHFA 1M8MA 2EW3A 1LCKA 2DM1A 2K9GA 2KBTA 1OOTA 2YT6A 1Y57A 2M51A 1GFDA 4EIKA 1X43A 2BZXA 1WYXA 2P4RA 4OMNA 1VA7A 2K6DA 3LH5A 3UATA 1FMKA 1E6GA 3EGUA 1NG2A 2F2WA 1B07A 1IO6A 3M0PA 5ECAA 2JMCA 1PHTA 2EBPA 1SSHA 2LNHB 1GRIA 1QLYA 1HSQA 2L0AA 2DBMA 3I5SA 2JM9A 4IIOA 1K0SA 4ORZA 2X3WD 2DE0X 2F2VA 3R6NA 1AOJA 2JW4A 1ARKA 1BU1A 1W70A 2KNBB 2KXDA 2DVJA 1Z9ZA 1U5SA 2X3XD 1AZEA 1OPLA 2RNAA 1UGVA 5IXFA 1YP5A 2ESWA 2ROTA 3RNJA 2M0YA 2GQIA 4Z89A 1QKXA 1X2QA 1K9AA 2XMFA 4JZ3A 4OMPA 1GL5A 3UA6A 5I22A 2SRCA 3C0CA 5IH2A 2L3PA 2AK5A 2DA9A 1WDXA 4OMLA 1AWWA 2CUBA 2C0TA 3VS4A 5FWCA 5FWBA 5IHNA 2V1QA 3M0SA 2DL8A 1SEMA 2KT8A 2CDTA 1YNZA 1GBQA 2LQNA 3EG3A 4J9FA 2O31A 4ZNXA 2A36A 1UJ0A 3EG2A 1RLPC 3H0HA 1FYNA 1NYGA 2PNIA 1CKAA 4DEXA 2D8JA 1WXBA 1ZX6A 2A37A 2KT1A 3H41A 1GCQA 4K11A 2OAWA 2AZSA 4GBQA 1Z9QA 1KJWA 3NGPA 2V1RA 1KFZA 1PNJA 4JJDA 4DEYA 4F17A 5L23A 1PKTA 2LX7A 1CKBA 2JMAA 4J9BA 5EC7A 2JXBA 1PKSA 1ZUUA 4RTZA 2RF0A 1GCQC 2JTEA 1M3AA 1E7OA 2CH4A 2DX1A 3UF4A 4HCKA 3VS7A 2BZ8A 2EYXA 3SHWA 3VRYA 1N5ZA 1W1FA 2I0NA 1T0JA 2DNUA 4IIMA 2EYWA 1X6GA 1H92A 1QCFA 1VYVA 4OMQA 2EYYA 3FJ5A 2KE9A 1PRMC 4HVWA 1OPKA 1JU5C 2HCKA 1AZGB 2J6FA 2VWFA 2YUNA 1I1JA 4FSSA 2KYBA 4RTXA 1TUDA 2YSQA 2FEIA 2RPNA 2VKNA 3U23A 3JV3A 1YWPA 3ZL7C 2DRKA 1ZUYA 2FO0A 2KROA 1W6XA 3VS6A 1S1NA 1AWXA 1KIKA 4RTYA 2LJ3A 1JXOA 2K79A 3VS1A 1X6BA 2EKHA 1MV3A 2IIMA 4QT7A 2EPDA 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKL A;  3GBQ A;  1KSW A;  1MUZ A;  2E5K A;  3NPF A;  4LUE A;  2GNC A;  2ECZ A;  2JT4 A;  1OV3 A;  1RI9 A;  2FG0 A;  1YN8 A;  2RQV A;  2ED0 A;  2RQW A;  2SEM A;  2JS0 A;  1UHC A;  3EHR A;  4E6R A;  5GJW B;  4J9I A;  2NWM A;  2MIO A;  2FRW A;  3O5Z A;  4JPB W;  1NLO C;  1UDL A;  2OJ2 A;  2J05 A;  2EYZ A;  1ZSG A;  4J9D A;  2ROL A;  2LMJ A;  2PTK A;  4AFS C;  4HXJ A;  4Y92 A;  1UUE A;  2FRY A;  2QDL A;  2CT4 A;  4Z88 A;  1B3Q A;  2JS2 A;  4AG2 C;  2VVK A;  5FW9 A;  1M3C A;  1VYU A;  4D8D A;  2LZ6 B;  1OEB A;  3PVQ A;  2D1X A;  2CRE A;  2H8H A;  3M0R A;  1PWT A;  2FPD A;  1T3L A;  4LN2 A;  3RBB B;  2DL4 A;  3REB B;  2EVR A;  2DL3 A;  1VYT A;  1ZBJ A;  2MOX A;  1NYF A;  2CSI A;  1J3T A;  2EQI A;  2DL7 A;  3SEM A;  1TG0 A;  3UA7 A;  1T3S A;  2W0Z A;  1K1Z A;  2NUZ A;  2OI3 A;  2KR3 A;  1RUW A;  1AWO A;  3THK A;  2FPE A;  4CC4 B;  1JQQ A;  2KRS A;  2GTJ A;  3VRZ A;  2O88 A;  2K2M A;  2J7I A;  2HEQ A;  1SHG A;  1NLP C;  4RUG A;  2YUO A;  2DF6 A;  4ESR A;  4F14 A;  2RN8 A;  4RTW A;  2GTO A;  2CH4 W;  3QWY A;  2D8H A;  4KRT A;  1ABQ A;  3VS2 A;  2HBW A;  1T0H A;  4WCI A;  2DRM A;  2RQR A;  2CSQ A;  2KRN A;  3I5R A;  4JZ4 A;  1WA7 A;  2A28 A;  2BTT A;  3NMZ C;  3ULR B;  1M3B A;  2F2X A;  2O2O A;  2K3B A;  2G6F X;  4JJC A;  2A08 A;  2DIL A;  3EG0 A;  2L3Q A;  1UHF A;  2C0O A;  1HD3 A;  2DYB A;  2KGT A;  2MCN A;  2RQU A;  1WFW A;  4OMM A;  2CUD A;  1H8K A;  1TUC A;  3M0T A;  5IHI A;  2KRM A;  2JM8 A;  1SPK A;  1U06 A;  2ED1 A;  1HJD A;  1BB9 A;  2L2P A;  2DL5 A;  4RTV A;  3TSZ A;  2J06 A;  1E6H A;  2PZ1 A;  1U3O A;  2DJQ A;  3PVL A;  1AEY A;  3I9Q A;  1MV0 B;  1QWF A;  2BZY A;  3NHN A;  1AVZ C;  4A63 B;  2KXC A;  3TSW A;  1NEG A;  2KEA A;  3VS5 A;  1ZUK A;  1NEB A;  3IQL A;  4CC7 A;  4J9E A;  3VS0 A;  1BK2 A;  2J6K A;  2O9S A;  4LE9 A;  2CT3 A;  2YUQ A;  1M30 A;  1QKW A;  3M0Q A;  1UTI A;  2EGA A;  1PRL C;  3EG1 A;  1QWE A;  1SRL A;  1YWO A;  4RTU A;  4GLM A;  2W10 A;  2HSP A;  4F16 A;  2RMO A;  5IHK A;  1UJY A;  1JO8 A;  2HDA A;  1UE9 A;  1WXU A;  2ABL A;  4J9H A;  4R0K A;  4M4Z A;  4CC2 A;  2FPF A;  4J9G A;  3CQT A;  1I07 A;  4AG1 C;  4X1V A;  1YCS B;  4HVU A;  1GCP A;  5GJV B;  3PE0 A;  1M27 C;  2LCS A;  1NM7 A;  1K76 A;  4AFU C;  4CC3 A;  1X2K A;  1UG1 A;  4Z8A A;  1WI7 A;  2K7A A;  1GBR A;  2L3S A;  3H0I A;  1BBZ A;  1WX6 A;  4AFQ C;  3EHQ A;  3VS3 A;  1K0X A;  1JEG A;  3H0F A;  2EGC A;  3A98 A;  1X69 A;  2EGE A;  2AZV A;  1ZLM A;  2DBK A;  1JXM A;  4JJB A;  1SRM A;  4J9C A;  2LP5 A;  1UEC A;  1WIE A;  4OMO A;  1G83 A;  3M0U A;  3TVT A;  1RLQ C;  4AFZ C;  2YDL A;  3KFV A;  2ENM A;  1GFC A;  4LUD A;  1A0N B;  2O9V A;  2D0N A;  1WLP B;  1WXT A;  1Y0M A;  1V1C A;  2LJ0 A;  2B86 A;  4RTT A;  3QWX X;  1X27 A;  1UFF A;  1EFN A;  2LQW A;  2AKK A;  1CSK A;  2GBQ A;  1AWJ A;  1ABO A;  2C0I A;  5HCK A;  2DMO A;  1AD5 A;  3I35 A;  2KYM A;  1H3H A;  1K4U S;  2J6O A;  1I0C A;  2DLP A;  4LNP A;  1G2B A;  2GGR A;  5I11 A;  2RQT A;  2LJ1 A;  4HVV A;  4D8K A;  2YUP A;  3REA B;  5IXB A;  1SHF A;  1M8M A;  2EW3 A;  1LCK A;  2DM1 A;  2K9G A;  2KBT A;  1OOT A;  2YT6 A;  1Y57 A;  2M51 A;  1GFD A;  4EIK A;  1X43 A;  2BZX A;  1WYX A;  2P4R A;  4OMN A;  1VA7 A;  2K6D A;  3LH5 A;  3UAT A;  1FMK A;  1E6G A;  3EGU A;  1NG2 A;  2F2W A;  1B07 A;  1IO6 A;  3M0P A;  5ECA A;  2JMC A;  1PHT A;  2EBP A;  1SSH A;  2LNH B;  1GRI A;  1QLY A;  1HSQ A;  2L0A A;  2DBM A;  3I5S A;  2JM9 A;  4IIO A;  1K0S A;  4ORZ A;  2X3W D;  2DE0 X;  2F2V A;  3R6N A;  1AOJ A;  2JW4 A;  1ARK A;  1BU1 A;  1W70 A;  2KNB B;  2KXD A;  2DVJ A;  1Z9Z A;  1U5S A;  2X3X D;  1AZE A;  1OPL A;  2RNA A;  1UGV A;  5IXF A;  1YP5 A;  2ESW A;  2ROT A;  3RNJ A;  2M0Y A;  2GQI A;  4Z89 A;  1QKX A;  1X2Q A;  1K9A A;  2XMF A;  4JZ3 A;  4OMP A;  1GL5 A;  3UA6 A;  5I22 A;  2SRC A;  3C0C A;  5IH2 A;  2L3P A;  2AK5 A;  2DA9 A;  1WDX A;  4OML A;  1AWW A;  2CUB A;  2C0T A;  3VS4 A;  5FWC A;  5FWB A;  5IHN A;  2V1Q A;  3M0S A;  2DL8 A;  1SEM A;  2KT8 A;  2CDT A;  1YNZ A;  1GBQ A;  2LQN A;  3EG3 A;  4J9F A;  2O31 A;  4ZNX A;  2A36 A;  1UJ0 A;  3EG2 A;  1RLP C;  3H0H A;  1FYN A;  1NYG A;  2PNI A;  1CKA A;  4DEX A;  2D8J A;  1WXB A;  1ZX6 A;  2A37 A;  2KT1 A;  3H41 A;  1GCQ A;  4K11 A;  2OAW A;  2AZS A;  4GBQ A;  1Z9Q A;  1KJW A;  3NGP A;  2V1R A;  1KFZ A;  1PNJ A;  4JJD A;  4DEY A;  4F17 A;  5L23 A;  1PKT A;  2LX7 A;  1CKB A;  2JMA A;  4J9B A;  5EC7 A;  2JXB A;  1PKS A;  1ZUU A;  4RTZ A;  2RF0 A;  1GCQ C;  2JTE A;  1M3A A;  1E7O A;  2CH4 A;  2DX1 A;  3UF4 A;  4HCK A;  3VS7 A;  2BZ8 A;  2EYX A;  3SHW A;  3VRY A;  1N5Z A;  1W1F A;  2I0N A;  1T0J A;  2DNU A;  4IIM A;  2EYW A;  1X6G A;  1H92 A;  1QCF A;  1VYV A;  4OMQ A;  2EYY A;  3FJ5 A;  2KE9 A;  1PRM C;  4HVW A;  1OPK A;  1JU5 C;  2HCK A;  1AZG B;  2J6F A;  2VWF A;  2YUN A;  1I1J A;  4FSS A;  2KYB A;  4RTX A;  1TUD A;  2YSQ A;  2FEI A;  2RPN A;  2VKN A;  3U23 A;  3JV3 A;  1YWP A;  3ZL7 C;  2DRK A;  1ZUY A;  2FO0 A;  2KRO A;  1W6X A;  3VS6 A;  1S1N A;  1AWX A;  1KIK A;  4RTY A;  2LJ3 A;  1JXO A;  2K79 A;  3VS1 A;  1X6B A;  2EKH A;  1MV3 A;  2IIM A;  4QT7 A;  2EPD A;  1XOV A; 
#chains in the Genus database with same CATH topology
 2AKL A;  3AT1 B;  2H3J A;  2LRQ A;  1VOM A;  2QQA A;  5AYF A;  4BY6 C;  5GAN e;  2GNC A;  3EAE A;  1JB0 E;  3EHR A;  3CME Q;  5GJW B;  4C5I A;  1YI2 Q;  1KQS S;  3CME A;  5LJ3 d;  4JPB W;  1NLO C;  1YI2 A;  3X25 B;  3CCJ T;  1IHW A;  2BIV A;  3CPW P;  2OJ2 A;  2EYZ A;  1C0M A;  3RKX A;  4C0D C;  3JCM d;  4M7A C;  2EJF A;  1QVG A;  2HQE A;  3V8L A;  5GMK j;  3CCV Q;  4AFS C;  2FYK A;  3CCV A;  1B34 B;  4M7D E;  2QDL A;  3DB4 A;  2CT4 A;  2VVK A;  3OSS C;  5GAN g;  2XU8 A;  3PVQ A;  2D1X A;  2CRE A;  1JRI A;  2H8H A;  4C5G A;  1PWT A;  3SWN C;  3WVE B;  3WXM B;  2DL4 A;  2XDP A;  3REB B;  4BI8 B;  1Q82 R;  4E7H A;  4QW2 A;  2DL3 A;  4PKC C;  2RJE A;  2DTO A;  3QBY A;  1TG0 A;  3ZEH A;  4R55 A;  2L89 A;  1T3S A;  1K1Z A;  1D1A A;  3P8D A;  3X24 B;  3FIF A;  5FLX E;  4A4G A;  4CC4 B;  1JQQ A;  2KRS A;  1VQP Q;  1M2O A;  3VRZ A;  2K2M A;  4JJN K;  1VQP A;  2HEQ A;  4C8Q E;  4J83 A;  2K4Y A;  4BI3 A;  2DF6 A;  4ESR A;  3CMA Q;  2GTO A;  2LQK A;  2L8D A;  2ZPI B;  2X9H A;  3CMA A;  5FU7 B;  2M16 A;  4Z02 A;  4WTO B;  1H64 1;  3CPW S;  5GAO n;  3I5R A;  1PG5 B;  3H6Z A;  2BTT A;  3HRU A;  2X4X A;  3N5B B;  2LT4 A;  2K3B A;  3PMI A;  5GAN h;  1FXX A;  2G6F X;  4ZTJ A;  1MMA A;  1VQO Q;  4C0G A;  1BKB A;  4M7D G;  1VQO A;  2MCN A;  2E3I A;  2RQU A;  4FYW B;  1H8K A;  2QDY B;  3OYA A;  3D7S B;  5IHI A;  3TCJ A;  1W4S A;  2JM8 A;  1SPK A;  1U06 A;  1PD1 A;  1R0C B;  2ZPF B;  2ED1 A;  5KYX A;  1M5Q 1;  1BB9 A;  1X01 A;  4FYY B;  3TSZ A;  3MO8 A;  1E6H A;  2KSS A;  3EFS A;  3VU3 C;  4E7S A;  1U3O A;  1QWF A;  1BI1 A;  4A63 B;  3HSB A;  2KEA A;  1ZUK A;  3CCJ Q;  3QDR B;  4J9E A;  3VS0 A;  3OB9 A;  3CCJ A;  3CCU T;  2CP3 A;  1ZQ1 A;  1VQN T;  4C8Q G;  5A0G A;  4FW2 A;  5GAM e;  1UTI A;  2QXF A;  1PRL C;  3EG1 A;  3HPW A;  1SRL A;  3VJP A;  4RTU A;  2HSP A;  3GOX A;  1JJ2 A;  1VQL T;  2KAF A;  4XTW A;  4QQG A;  1UGS B;  1R8O B;  2WSC E;  3V8J A;  4J9G A;  1I07 A;  3NFC A;  4N4G A;  4FYV B;  2DTI A;  4M78 E;  1TH7 A;  5GAN 6;  5GJV B;  3INZ A;  1K76 A;  3M58 A;  5GAM g;  2HZY A;  1NJI R;  5DLQ E;  2DZC A;  4PJO F;  5LJ5 f;  2L3S A;  2DIQ A;  3H0I A;  3NTK A;  4A4F A;  5A0L A;  4C92 A;  2RHI A;  4M75 G;  1QMC A;  2PVO B;  3VS3 A;  2YHT A;  1JEG A;  3DKM A;  3H0F A;  1IGU A;  2EGE A;  2AZV A;  1I5O B;  3DB3 A;  4HCZ A;  2DBK A;  1SRM A;  4PFZ A;  3ZBD A;  4KT0 E;  3S3O A;  3HKS A;  3E9F A;  3JCM V;  1MND A;  4J7F A;  4RKU E;  4ELZ C;  5LL6 S;  4M77 C;  3TVT A;  1RLQ C;  2YDL A;  2RHY A;  3X28 B;  3BW1 A;  4MZP A;  1WLP B;  1D0X A;  2Y90 A;  5FRO A;  4M7A F;  3OYI A;  2LC4 A;  1WHH A;  1X27 A;  2RJC A;  5CVI A;  4XTY A;  1LJO A;  1UFF A;  2FL7 A;  3S6W A;  1CSK A;  2GBQ A;  2C0I A;  1Q81 C;  2LT1 A;  5GAM h;  5HCK A;  2DMO A;  1AD5 A;  3MP1 A;  3I35 A;  3C12 A;  4M78 G;  1H3H A;  1I0C A;  1G2B A;  2Y4X A;  4A4H A;  2RQT A;  2GCX A;  4KGV B;  2PVG B;  5IAY A;  2KBT A;  2YT6 A;  3CCS T;  3CCU Q;  3EH2 A;  1GFD A;  1RAI B;  4XTZ A;  1VA7 A;  4FT4 A;  3CCU A;  1VQN Q;  2HL3 A;  2E1H A;  3LH5 A;  1AT1 B;  3P8H A;  1VQN A;  1FMK A;  3EGU A;  4F7U A;  3M0P A;  1YHQ T;  1YIT Q;  2JMC A;  2JZ2 A;  3CCR Q;  1YIT A;  2LVM A;  2X51 A;  1Q81 U;  2LNH B;  1GRI A;  3JCM J;  4FSX A;  2DBM A;  3I5S A;  5KYN A;  5GAO p;  2D6F A;  3PGG A;  2DE0 X;  5D6X A;  2V26 A;  3CC4 Q;  1W70 A;  3OBY A;  3CC4 A;  1NZ9 A;  1X75 C;  1TU0 B;  1HXD A;  1U5S A;  4X9C A;  3JB9 I;  2E41 A;  2AT1 B;  4QVC A;  1M1K C;  1MMD A;  3RMQ A;  2RNA A;  1FWZ A;  1X6O A;  5IXF A;  1YP5 A;  3OMC A;  3LLR A;  4BE2 A;  4OMP A;  1N8R C;  4J6X A;  1GL5 A;  1ZA1 B;  1VQ6 T;  4IUT A;  2VUB A;  2L3P A;  2DA9 A;  1AWW A;  4E47 A;  3LGL A;  3GNF B;  1M1G A;  5FWC A;  4M78 C;  2V1Q A;  3M0S A;  3X20 B;  1SEM A;  3VUB A;  2LQN A;  4J9F A;  1V76 A;  4L59 A;  1OU8 A;  3EG9 A;  1UJ0 A;  3EG2 A;  1FYN A;  5CKE A;  4DEX A;  4JS4 A;  2D8J A;  3OS2 A;  2EQU A;  1Y7X A;  1M1K U;  3H41 A;  2DZ9 A;  1G3S A;  4ZGJ B;  4GBQ A;  3BY7 A;  1Y71 A;  1KJW A;  1VQ4 T;  1N8R U;  4JS5 A;  2HQH A;  2COZ A;  3I55 T;  1PNJ A;  4C92 E;  5L23 A;  1PM3 A;  1PKT A;  2LX7 A;  2R5M A;  5HY6 A;  4HA8 A;  5EC7 A;  3OY9 A;  2K5L A;  2OTL T;  1RL2 A;  4ZGD B;  2FVU A;  1E7O A;  2CH4 A;  2DX1 A;  3M59 A;  3G7Z A;  3TU4 K;  3CBP A;  2MWP A;  2M9U A;  3LWH A;  2YRV A;  1N5Z A;  3MKD A;  4M77 D;  4OB1 B;  5CQY A;  4M75 B;  2E65 A;  1YJ9 T;  1YCY A;  3FJ5 A;  3A8M B;  4M7D F;  4KUI A;  3CCS Q;  2NUT B;  4HKE A;  1OPK A;  4HVW A;  3FC3 A;  1JU5 C;  3CCS A;  3F70 A;  3VV0 A;  1OU9 A;  4EMH A;  2LCC A;  2KYB A;  4RTX A;  1G5V A;  5GAN j;  2YSQ A;  2MMP A;  2RPN A;  2LDM A;  1TS9 A;  3MJX A;  2QGG A;  1YHQ Q;  3JV3 A;  1O75 A;  1KC8 R;  2O4X B;  2FO0 A;  3GPL A;  2KRO A;  5KYY B;  1YHQ A;  2GQV A;  1WQW A;  1M4Z A;  1ZSZ B;  4VUB A;  4A53 A;  2HKQ B;  1QQJ A;  3NPF A;  3EFO B;  2PQW A;  1Q82 C;  2ECZ A;  3M4Y A;  2MF2 A;  2RQV A;  3FDR A;  4F04 B;  4M77 F;  2RQW A;  5FU6 C;  4C92 G;  3T9N A;  2MIO A;  1B7T A;  2YRD A;  1WJQ A;  4F7U E;  1VQ6 Q;  1SF9 A;  2XD0 A;  4DA4 A;  2F5T X;  1ZSG A;  1Y96 A;  4J9D A;  1VQ6 A;  3QII A;  1YI2 T;  3L2U A;  4L6V 5;  4Z88 A;  1B3Q A;  2R5A A;  3J7A F;  2QQ9 A;  3CCV T;  3LYI A;  2R57 A;  4D8D A;  1Q82 U;  1G8X A;  3TQ7 P;  2LQ8 A;  4C0Z A;  1Q7Y R;  1DJ7 B;  2DTH A;  1VQ4 Q;  3I56 Q;  2QAZ A;  4LDX A;  1VQ4 A;  3UA7 A;  3I56 A;  3I55 Q;  2QA4 Q;  2OI3 A;  2F69 A;  3I55 A;  2KR3 A;  1AWO A;  3L2V A;  1VQM Q;  3FB9 A;  2OTL Q;  1VQM A;  2IPO B;  2OTL A;  3CCM Q;  1NLP C;  3JB9 D;  3CCM A;  1FMV A;  2GFU A;  2RN8 A;  1UGQ B;  3JCM P;  4ZTF A;  2RK1 A;  4KRT A;  2EQM A;  2K2V A;  1T0H A;  3C95 A;  4WCI A;  1MMN A;  3CMA T;  1EIF A;  2RQR A;  2DPP B;  2KRN A;  1NPR A;  4JZ4 A;  4F7U G;  4N4I A;  4PL6 A;  4N0A C;  2CZ6 B;  3QYG B;  5FU7 C;  2X4W A;  4JJC A;  3EG0 A;  4XU3 A;  4LXC A;  2L3R A;  4IUP A;  4JRK A;  2L3Q A;  2O4X A;  2C0O A;  4KGX B;  1HD3 A;  2KGT A;  1WFW A;  4OMM A;  4JLG A;  4M78 F;  4PJO C;  1G3W A;  1ZHI A;  4X9D A;  1TUC A;  3M0T A;  3SDZ A;  2M02 A;  2CZ1 B;  1BI0 A;  4P5N A;  3JCM X;  5GAM j;  5CO7 A;  3OYH A;  3JB9 F;  8AT1 B;  4EMK C;  1AEY A;  2ZGW A;  1MV0 B;  2BZY A;  3NHN A;  3QJY A;  3E1S A;  4KH1 B;  2KXC A;  3TSW A;  1NEG A;  2D0Q B;  1NEB A;  5CIU A;  2CP5 A;  4EDU A;  1NBE B;  1NJI C;  1BK2 A;  4J6W A;  1RAB B;  3CCL Q;  2J6K A;  2O9S A;  2YLC A;  3CCL A;  2DIG A;  1QVF A;  1M30 A;  1KQ2 A;  3M0Q A;  3A8H B;  4E7J A;  3QHS A;  2EAY A;  2EYQ A;  3J80 E;  4F16 A;  2RMO A;  3MEA A;  5IHK A;  2MAM A;  2V8J A;  4ELY C;  1JO8 A;  1UEB A;  1MMG A;  1RAC B;  3MEW A;  1WXU A;  2ABL A;  3A8L B;  4J9H A;  1XNI A;  2LX9 A;  3GF5 A;  2CZ7 B;  4AMC A;  5GAO r;  3CQT A;  4PJM A;  1HK9 A;  1NJI U;  2EQJ A;  1R0B G;  5I2S A;  1RAH B;  3TEE A;  2YXY A;  1N6A A;  4AT1 B;  4AFU C;  4CC3 A;  3QPH A;  1QVG P;  1UG1 A;  1GBR A;  1BBZ A;  3EGX A;  1N9R A;  2CP7 A;  1WX6 A;  3EHQ A;  1K8A R;  2E64 A;  1UB4 A;  4C92 B;  2ZCF B;  4CRI A;  1ZBX A;  3MP6 A;  3V7R A;  2FZK B;  1VIE A;  3GNG A;  2XG8 D;  4ME7 A;  2LP5 A;  2CYZ B;  4QKU A;  1WHL A;  1PCX A;  1JBM A;  1WIE A;  1D0Z A;  3G1J A;  4JRI A;  4ANJ A;  4EMG A;  4LUD A;  2O9V A;  3C94 A;  2HBP A;  1V1C A;  4RTT A;  2B86 A;  3URG A;  2DET A;  3QWX X;  4YTL A;  1M1F A;  3UWN A;  2NLU A;  4KH0 B;  1NPP A;  2F5K A;  1M2V B;  4E7I A;  1PD0 A;  3TRE A;  1WPY A;  1XTD A;  1SG5 A;  4PLL A;  4BD3 A;  3BDL A;  2E12 A;  4BE0 A;  3M5A A;  2KYM A;  3BDU A;  4M75 E;  1QVG S;  3L2R A;  5CAI A;  2DLP A;  4LNP A;  4PJJ A;  5KYW A;  3OYF A;  2GGR A;  3UT1 A;  5I11 A;  1KK7 A;  3MEV A;  2ZPG B;  5IXB A;  1M8M A;  2DM1 A;  1IB8 A;  4MDW A;  1H3Z A;  4KUL A;  5GAN f;  2BZX A;  2P4R A;  5J3B A;  4O5V A;  4PJO D;  2BE9 B;  4JLI A;  2PVD B;  2QGF B;  4BY6 B;  2AHJ B;  1WHM A;  1E6G A;  1WJR A;  1D0Y A;  1YIJ Q;  2F2W A;  1B07 A;  4UC4 A;  5ECA A;  4GLK A;  2IG0 A;  1YIJ A;  2DXB A;  3MPU B;  2EBP A;  1SSH A;  4F7U B;  3GP8 A;  1QLY A;  1M9S A;  2JM9 A;  2VXE A;  1YIT T;  1K0S A;  3CCR T;  4FYX B;  2F2V A;  3M57 A;  2H3E B;  1ARK A;  1SSF A;  2DVJ A;  5KCO A;  2COW A;  1Z9Z A;  2VGM A;  2VYT A;  1OX9 A;  3CC4 T;  1K73 R;  4IUQ A;  2NUP B;  2MYS A;  2FHD A;  2ROT A;  2M0Y A;  2GQI A;  4Z89 A;  4M7D C;  4M7A D;  2E6Z A;  3RKY A;  3UA6 A;  1IZ6 A;  2SRC A;  1WHJ A;  3OYY A;  3C0C A;  4BI4 A;  1WDX A;  4OML A;  1P92 A;  1W2B A;  5J39 A;  3OBW A;  2KT8 A;  4XTX A;  2CDT A;  1JJ2 P;  1WZO A;  4C0F A;  2A36 A;  2CS7 A;  1U1S A;  4RG8 A;  5DY9 A;  3CD6 Q;  3EG9 B;  1BI3 A;  2KT1 A;  1MGQ A;  2RK2 A;  1GCQ A;  4K11 A;  2OAW A;  2AZS A;  4DBR A;  1Z9Q A;  4IUV A;  3PFS A;  3JCM c;  1FX7 A;  4C8Q C;  4O6J A;  1KFZ A;  4JJD A;  4DEY A;  1KC8 C;  1IRE B;  2DER A;  1LPL A;  2JMA A;  3H9N A;  2RF0 A;  1M3A A;  3L2Q A;  1M2V A;  3V7C A;  3LW5 E;  3UF4 A;  4PJL A;  4QVD A;  3ME9 A;  3VS7 A;  3FRN A;  3OA6 A;  4DOV A;  2BZ8 A;  1K9M C;  3VRY A;  4RMO A;  1W1F A;  2ZPH B;  2DNU A;  4IIM A;  2EYW A;  1X6G A;  1O9S A;  1QCF A;  3EGD A;  3G6E Q;  2EYY A;  2KE9 A;  4Y28 E;  5GAN d;  2RB6 A;  3OS1 A;  1AZG B;  1KC8 U;  3LGF A;  4A54 A;  1EZZ B;  4CI0 C;  2E4H A;  1JJ2 S;  2VKN A;  4FL6 A;  4M75 C;  1LNX A;  1AWX A;  3OYM A;  2JTF A;  1MV3 A;  5GAM f;  2EPD A;  4BDZ A;  3CCR A;  1S72 T;  4LD9 K;  2Z0W A;  4M7A A;  1RAE B;  3GBQ A;  2NYS A;  3CXC A;  5A0D A;  1KSW A;  2E5K A;  2LTO A;  2EJ9 A;  2WSF E;  2JT4 A;  1Q7Y C;  2QQR A;  4IUU A;  3CC2 T;  4XTV A;  1YN8 A;  1ZSZ C;  4Q5W A;  1WHG A;  1OZ3 A;  2HKN A;  1FMW A;  3L2Z A;  4LDW A;  4E6R A;  1BCM A;  2NUP A;  2NWM A;  4BB7 A;  3G4S T;  3O5Z A;  1QCN A;  3SWN A;  1UDL A;  4QQD A;  4B9X A;  4J6Y A;  2LMJ A;  2PTK A;  4HXJ A;  2DXC A;  1Y96 B;  5KE2 A;  5GAN 8;  3OYL A;  2JS2 A;  4AG2 C;  3EH1 A;  1M3C A;  3SFM A;  1KQ1 A;  1OEB A;  3CCQ T;  1Q7Y U;  3M0R A;  5J26 A;  1HYO A;  4LN2 A;  2E70 A;  2ZAE A;  2EVR A;  4KGZ B;  5KH6 A;  4FM4 B;  4M7D D;  1VYT A;  3JCM W;  3E2U A;  2MOX A;  5LJ3 e;  2EQI A;  1IHV A;  3M56 A;  3JCM e;  4PJN A;  2W0Z A;  4PFP A;  2XKO C;  2NUZ A;  1LVK A;  3I56 T;  4HCB A;  4A4K A;  3SD4 A;  2QA4 T;  2O88 A;  1VQ8 T;  2J7I A;  4IUR A;  3PT9 A;  4EPC A;  1SHG A;  2CGH A;  1VQM T;  2QG9 B;  4F14 A;  5GAN 3;  4RTW A;  3QWY A;  5CKD A;  1ABQ A;  3CCM T;  3PTA A;  3M53 A;  3RMS A;  2X35 A;  5LJ3 g;  3VS2 A;  2HBW A;  2DEU A;  3JCM g;  4C8Q D;  2CSQ A;  4QQ6 A;  3ULR B;  1M3B A;  2F2X A;  2O2O A;  1VQK T;  1KHC A;  2DJZ A;  1UHF A;  4MZT A;  2DYB A;  2CUD A;  1GXI E;  4OB0 B;  2KRM A;  2A7Y A;  5GAM d;  3Q1J A;  1S72 Q;  2RI3 A;  1IXD A;  4FCY A;  1S72 A;  3VUZ A;  1ACM B;  1HJD A;  3OW2 A;  5FRM A;  2J06 A;  3CC2 Q;  2PZ1 A;  2XI9 A;  4XTU A;  3PVL A;  2EFI A;  1K9M R;  3CC2 A;  1AVZ C;  4GY5 A;  3VS5 A;  2DD4 A;  5GAO q;  3G4S Q;  2KDS A;  3HFN A;  4CC7 A;  4C8Q F;  3G4S A;  5HKC A;  2ZPB B;  4LDV A;  1OQK A;  3OMG A;  2EQK A;  3DLM A;  3CC7 T;  3NTI A;  5LJ3 h;  1QKW A;  2EGA A;  3JCM h;  3CCL T;  1K8A C;  2OTJ T;  2XDB A;  1YWO A;  4JUV A;  3CCQ Q;  1TXQ A;  4GLM A;  2W10 A;  3CCQ A;  1UJY A;  2JN0 A;  4LD6 A;  4E2F B;  2VB6 A;  1YJW T;  3PIO A;  4OF1 A;  2E10 A;  3QDF A;  3MHX A;  5CR2 A;  2QAS A;  3OS0 A;  4X1V A;  2C06 A;  1YCS B;  2M1H A;  1GCP A;  2X4Y A;  1NM7 A;  5GMK i;  5CCA A;  4FW1 A;  2EWN A;  3CEY A;  1X2K A;  4Z8A A;  4M75 F;  3OQ5 A;  3OYE A;  1K8A U;  1VQ8 Q;  5D6W A;  3PMT A;  2QA4 A;  4M78 D;  4C5H A;  1VQ8 A;  4AFQ C;  1G3Y A;  3EGX B;  4M77 A;  5GAO m;  4E7Z A;  3BE3 A;  2VV5 A;  3A98 A;  1X69 A;  2YLB A;  4MDX A;  3CPF A;  1KQS A;  1I8F A;  2RM4 A;  4J9C A;  2HQX A;  1UEC A;  4C92 C;  2COY A;  4OMO A;  2F1L A;  1WHK A;  3M0U A;  1ZA2 B;  3RES A;  2YRC A;  1VQK Q;  2ENM A;  1GFC A;  3SB2 A;  2D0N A;  1VQK A;  1WXT A;  3OYC A;  4ZN1 A;  2DEQ A;  5GAN 5;  1WGS A;  2A0F B;  1U8R A;  1EFN A;  2K3Y A;  3O8V A;  2LQW A;  1PSE A;  1AWJ A;  1ABO A;  3MCA B;  3CBM A;  1YBY A;  4J7I A;  3HRS A;  1WNL A;  3S3N A;  1KD1 R;  2EJG A;  2CZ0 B;  2J6O A;  3DLL A;  4HVV A;  4D8K A;  4N4H A;  2DYI A;  5KYW B;  2I2L A;  1SHF A;  1C1A A;  2EW3 A;  1K73 C;  2K9G A;  3CC7 Q;  5KE3 A;  1WYX A;  4OMN A;  4DBF A;  4E7K A;  3CC7 A;  2HMA A;  3OS5 A;  1SKU B;  3V8K A;  4BAC A;  1NG2 A;  3J81 E;  2OTJ Q;  3CPW A;  4QVZ A;  4FIB A;  4IKF A;  2OTJ A;  1HSQ A;  2RI5 A;  1YIJ T;  2L0A A;  1R77 A;  4ORZ A;  3RDV A;  1YJW Q;  3EFR A;  3R6N A;  1AOJ A;  2CP2 A;  3OYB A;  1YJW A;  3VYH B;  1BU1 A;  2KXD A;  1K73 U;  2BKD N;  4M78 A;  1I5L A;  4WF2 A;  2RA2 A;  4BE1 A;  2X3X D;  1AZE A;  1OPL A;  2M0O A;  5CK9 A;  1QVF P;  1RAD B;  1QKX A;  1X2Q A;  1K9A A;  2KY9 A;  2XMF A;  3UDC A;  5D7U A;  5I22 A;  4PK4 A;  2KQW A;  5IH2 A;  1VQ5 Q;  2MPX C;  4J8O A;  1VQ5 A;  4JDS A;  1U1T A;  3QJ6 A;  1YNZ A;  2QQS A;  3EG3 A;  3RR6 A;  5I2M A;  2VC8 A;  2FZC B;  1NYG A;  2PNI A;  1CKA A;  3FLG A;  1WQ7 A;  1I4K 1;  5LJ5 e;  1WJS A;  4OGC A;  1EX4 A;  4MZM A;  1UGP B;  3CD6 T;  2QTX A;  3NGP A;  2RI2 A;  1TOV A;  5C6S A;  4PLI A;  2XIC A;  3LWI A;  4M77 E;  3QZ5 B;  2EKO A;  1PKS A;  1ZUU A;  4RTZ A;  1OX8 A;  4JRQ A;  4KBM B;  5CKH A;  1MHN A;  3VYG A;  4NL2 A;  1D3B B;  2RO0 A;  3JSC A;  4C92 D;  1M90 R;  2I0N A;  1QVF S;  1T0J A;  1PC0 A;  3HL8 A;  5LJ5 g;  3QSU A;  2DD5 A;  2XK0 A;  4PJO B;  4OMQ A;  4NS5 A;  1BYM A;  1IGQ A;  3EGD B;  1PRM C;  2K5I A;  2HCK A;  2VWF A;  3G6E T;  2YUN A;  1I1J A;  4FSS A;  1OYX A;  2P84 A;  4HT9 A;  4JRP A;  9ATC B;  3QO3 A;  3ZL7 C;  4EMK B;  3QXE B;  3V7S A;  2GF7 A;  4L5G A;  1S1N A;  1KIK A;  4Y91 A;  2K79 A;  2DFU A;  4R56 A;  1N9S A;  1QP3 A;  4XU1 A;  4QT7 A;  1RAG B;  5GAO l;  4XU2 A;  4C5E A;  3H8Z A;  5GMK l;  5CKB A;  4B6M A;  5IT9 E;  1PSF A;  3MP8 A;  1MUZ A;  4LUE A;  4C0D B;  4M7A B;  1OV3 A;  4C92 F;  1RI9 A;  2FG0 A;  2GFA A;  2FZG B;  3LX7 A;  3OYJ A;  3JB9 H;  2ED0 A;  3UPU A;  2SEM A;  2JS0 A;  1UHC A;  3L1A A;  2O01 E;  1OUL A;  7AT1 B;  2HL5 C;  2RHU A;  3QZ9 B;  4J9I A;  1F1B B;  1RAF B;  3HTR A;  2FRW A;  2Y4Y A;  4M77 G;  4XU0 A;  2EIF A;  2J05 A;  2MK5 A;  1NE8 A;  5LJ5 h;  4NL3 A;  2ROL A;  1B34 A;  3SWN B;  5LJ3 j;  3AHU A;  4Y92 A;  3S3M A;  1UUE A;  2FRY A;  2BUD A;  2JVV A;  3ZFJ A;  4ATO A;  5FW9 A;  1M8V A;  2G3R A;  1VYU A;  2LZ6 B;  2DVE A;  2V8K A;  2FPD A;  2VAS A;  1T3L A;  2XDD A;  3RBB B;  3X26 B;  2HAX A;  4II1 A;  1ZBJ A;  1NYF A;  3L42 A;  2CSI A;  2XID A;  1J3T A;  5GMK e;  2DL7 A;  3SEM A;  3CD6 A;  4OMF B;  2LNV A;  3WVD B;  2K57 A;  1RUW A;  2HSE B;  3THK A;  2FPE A;  1W2B P;  2OX7 A;  4FU6 A;  1VIF A;  2GTJ A;  2PUK B;  2V8I A;  1OZ2 A;  3HP9 A;  2YUO A;  4RUG A;  2X4J A;  4N0A A;  3MET A;  1VQ9 T;  1V29 B;  2R58 A;  2CH4 W;  1D3B A;  1TWB A;  2D8H A;  4LDU A;  3JRZ A;  2PU9 B;  1RI0 A;  3P8B B;  2DRM A;  1LOJ A;  4F7U F;  4PJO A;  2QI2 A;  3OSV A;  3A1P A;  3RER A;  3RKW A;  1WA7 A;  2A28 A;  4ZGE B;  3NMZ C;  3G6E A;  2A08 A;  3QYH B;  2DIL A;  5KCH A;  4EMK A;  1IRX A;  3BFM A;  5DLO A;  2DXT A;  2KMT A;  1BIB A;  3GLX A;  1Q86 C;  4X34 A;  2DAQ A;  4XQ3 A;  2DKG A;  2BE7 D;  4OB3 B;  1K9M U;  2L2P A;  2DL5 A;  4RTV A;  3OYK A;  2HD0 A;  2DJQ A;  1W2B S;  3I9Q A;  2ZZD A;  3JB9 G;  1BCO A;  2KVQ G;  4DOW A;  3IQL A;  4HCC A;  3R6O A;  4NOY A;  1YFN A;  4RCB A;  4LE9 A;  3RIR A;  2CT3 A;  1XJW B;  2YUQ A;  5FRN A;  1D1C A;  5GMK h;  1Q86 U;  4BDY A;  1OI1 A;  2HNI A;  5KYU B;  1VQL Q;  4A4E A;  1QWE A;  2A3L A;  5D6Y A;  8ATC B;  3QKJ A;  1VQL A;  4M7D B;  3CXC P;  2VGN A;  3M54 A;  2QK0 A;  1AHJ B;  2HDA A;  4BUG A;  1UE9 A;  2OAU A;  2RJF A;  2JTM A;  4R0K A;  3MEU A;  4M4Z A;  4CC2 A;  2FPF A;  2RD1 A;  3A8O B;  4AG1 C;  5LJ5 d;  4HVU A;  5GAN 2;  4FT2 A;  3PE0 A;  1M27 C;  2LCS A;  3GIB A;  2P0Q A;  1WI7 A;  1QW1 A;  3KXT A;  2K7A A;  3C4S A;  4V2S A;  4PNO A;  2KI7 A;  4LDY A;  2QEX T;  3JAM E;  2RJD A;  2D9T A;  1VQ9 Q;  1K0X A;  3CBO A;  1VQ7 T;  4C8Q B;  2EGC A;  4M77 B;  1VQ9 A;  1ZLM A;  3HRT A;  1JXM A;  1KD1 C;  4JJB A;  2YWW A;  4RG2 A;  1QP2 A;  5AT1 B;  3KBG A;  3VKI A;  3M9Q A;  2QTV A;  5GAN 7;  1G83 A;  2JNG A;  4OP0 A;  4OVA A;  2B8A A;  4AFZ C;  4XAX B;  3KFV A;  3RUX A;  1A0N B;  3CXC S;  1Y0M A;  2LJ0 A;  3QUI A;  4KUD K;  4B9W A;  2JOY A;  3JCM b;  1BIA A;  2JUF A;  3PNW C;  2AKK A;  1KD1 U;  4DBQ A;  2K5F A;  1UGR B;  2KK4 A;  4DQ2 A;  4PJO E;  1K4U S;  2QYZ A;  1VUB A;  2LJ1 A;  3CCE T;  2YUP A;  3REA B;  5CQX A;  3G71 T;  3JB9 J;  1LCK A;  5L8R E;  1OOT A;  2MI6 A;  2PUO B;  1Y57 A;  2M51 A;  4EIK A;  1X43 A;  4PFO A;  1MNE A;  4M75 D;  1D1B A;  2K6D A;  2AIR B;  4MML A;  3UAT A;  4XK8 E;  2P0K A;  1IO6 A;  2ZPE B;  1PHT A;  2RHX A;  5KYU A;  2FB7 A;  4IIO A;  3OW2 P;  4M7D A;  2WSE E;  3HHT B;  1YJN T;  1Q81 R;  2X3W D;  1Q86 R;  1BI2 A;  2JW4 A;  4DBH A;  4M7A E;  5IN1 A;  2E3H A;  2RHZ A;  1TSF A;  2CKK A;  2KNB B;  3A5Z B;  1QCO A;  1QVP A;  3M55 A;  1C6V X;  4M78 B;  2P4T A;  1UGV A;  5HK0 A;  6AT1 B;  4OGE A;  2ESW A;  3RNJ A;  2MWO A;  3CME T;  3OYN A;  4JZ3 A;  5LJ3 f;  5LJ5 j;  2QEX Q;  3KUF A;  1D09 B;  2P0P A;  2IVW A;  4HT8 A;  1I81 A;  3JCM f;  2AK5 A;  2QEX A;  2CUB A;  2C0T A;  3VS4 A;  1VQ7 Q;  5FWB A;  5IHN A;  2DL8 A;  5M9O A;  5C0M A;  1VQ7 A;  3OYD A;  4PJO G;  1GBQ A;  2DK3 A;  4OB2 B;  4C8Q A;  1VQ5 T;  3NTH A;  2O31 A;  4ZNX A;  1M90 C;  2E5Q A;  4TVR A;  3JCM Q;  2L5Q A;  1RLP C;  1G3T A;  3H0H A;  5GMK m;  2DXU A;  3LH0 A;  1WXB A;  1XQH A;  1ZX6 A;  5A2Q E;  2A37 A;  5GAN 4;  3ER0 A;  1Y07 A;  1M1K R;  5I21 A;  3M4G A;  4E7L A;  5HK3 A;  3ASK A;  3OW2 S;  2V1R A;  4RCC A;  4F17 A;  1CKB A;  1N8R R;  3OYG A;  2RH2 A;  4J9B A;  2DO3 A;  5CKF A;  1RAA B;  2CP6 A;  3PIP A;  2JXB A;  3FEO A;  4ZN3 A;  1KG1 A;  2VXF A;  2E6N A;  2JJ9 A;  1GCQ C;  1VQP T;  3E19 A;  1M90 U;  2JTE A;  1KQS P;  4M7A G;  2QQB A;  4HCK A;  1YJ9 Q;  2LCL A;  2EYX A;  3SHW A;  4M75 A;  4MMK A;  1YJ9 A;  1H92 A;  2XHC A;  1TUG B;  1VYV A;  3L2W A;  3CCE Q;  2NUT A;  3G71 Q;  1TTH B;  3CCE A;  3QG1 A;  3G71 A;  5DM7 R;  1Q95 G;  2J6F A;  1KHI A;  2WAC A;  1TUD A;  5KYY A;  2FEI A;  3U23 A;  4D6W A;  1YWP A;  5EG2 A;  2DRK A;  3E9G A;  1ZUY A;  2ATC B;  3HFO A;  1VQO T;  1W6X A;  3VS6 A;  1ZSZ A;  4RTY A;  2LJ3 A;  1JXO A;  1N27 A;  2CP0 A;  3FJP A;  3VS1 A;  1X6B A;  2EKH A;  4J5Y A;  1YJN Q;  5FU6 B;  2IIM A;  2K3X A;  1XOV A;  1YJN A;  3A8G B;  5KYX B;  3EFO A; 
#chains in the Genus database with same CATH homology
 2AKL A;  3GBQ A;  1KSW A;  1MUZ A;  2E5K A;  3NPF A;  4LUE A;  2GNC A;  2ECZ A;  2JT4 A;  1OV3 A;  1RI9 A;  2FG0 A;  1YN8 A;  2RQV A;  2ED0 A;  2RQW A;  2SEM A;  2JS0 A;  1UHC A;  3EHR A;  4E6R A;  5GJW B;  4J9I A;  2NWM A;  2MIO A;  2FRW A;  3O5Z A;  4JPB W;  1NLO C;  1UDL A;  2OJ2 A;  2J05 A;  2EYZ A;  1ZSG A;  4J9D A;  2ROL A;  2LMJ A;  2PTK A;  4AFS C;  4HXJ A;  4Y92 A;  1UUE A;  2FRY A;  2QDL A;  2CT4 A;  4Z88 A;  1B3Q A;  2JS2 A;  4AG2 C;  2VVK A;  5FW9 A;  1M3C A;  1VYU A;  4D8D A;  2LZ6 B;  1OEB A;  3PVQ A;  2D1X A;  2CRE A;  2H8H A;  3M0R A;  1PWT A;  2FPD A;  1T3L A;  4LN2 A;  3RBB B;  2DL4 A;  3REB B;  2EVR A;  2DL3 A;  1VYT A;  1ZBJ A;  2MOX A;  1NYF A;  2CSI A;  1J3T A;  2EQI A;  2DL7 A;  3SEM A;  1TG0 A;  3UA7 A;  1T3S A;  2W0Z A;  1K1Z A;  2NUZ A;  2OI3 A;  2KR3 A;  1RUW A;  1AWO A;  3THK A;  2FPE A;  4CC4 B;  1JQQ A;  2KRS A;  2GTJ A;  3VRZ A;  2O88 A;  2K2M A;  2J7I A;  2HEQ A;  1SHG A;  1NLP C;  4RUG A;  2YUO A;  2DF6 A;  4ESR A;  4F14 A;  2RN8 A;  4RTW A;  2GTO A;  2CH4 W;  3QWY A;  2D8H A;  4KRT A;  1ABQ A;  3VS2 A;  2HBW A;  1T0H A;  4WCI A;  2DRM A;  2RQR A;  2CSQ A;  2KRN A;  3I5R A;  4JZ4 A;  1WA7 A;  2A28 A;  2BTT A;  3NMZ C;  3ULR B;  1M3B A;  2F2X A;  2O2O A;  2K3B A;  2G6F X;  4JJC A;  2A08 A;  2DIL A;  3EG0 A;  2L3Q A;  1UHF A;  2C0O A;  1HD3 A;  2DYB A;  2KGT A;  2MCN A;  2RQU A;  1WFW A;  4OMM A;  2CUD A;  1H8K A;  1TUC A;  3M0T A;  5IHI A;  2KRM A;  2JM8 A;  1SPK A;  1U06 A;  2ED1 A;  1HJD A;  1BB9 A;  2L2P A;  2DL5 A;  4RTV A;  3TSZ A;  2J06 A;  1E6H A;  2PZ1 A;  1U3O A;  2DJQ A;  3PVL A;  1AEY A;  3I9Q A;  1MV0 B;  1QWF A;  2BZY A;  3NHN A;  1AVZ C;  4A63 B;  2KXC A;  3TSW A;  1NEG A;  2KEA A;  3VS5 A;  1ZUK A;  1NEB A;  3IQL A;  4CC7 A;  4J9E A;  3VS0 A;  1BK2 A;  2J6K A;  2O9S A;  4LE9 A;  2CT3 A;  2YUQ A;  1M30 A;  1QKW A;  3M0Q A;  1UTI A;  2EGA A;  1PRL C;  3EG1 A;  1QWE A;  1SRL A;  1YWO A;  4RTU A;  4GLM A;  2W10 A;  2HSP A;  4F16 A;  2RMO A;  5IHK A;  1UJY A;  1JO8 A;  2HDA A;  1UE9 A;  1WXU A;  2ABL A;  4J9H A;  4R0K A;  4M4Z A;  4CC2 A;  2FPF A;  4J9G A;  3CQT A;  1I07 A;  4AG1 C;  4X1V A;  1YCS B;  4HVU A;  1GCP A;  5GJV B;  3PE0 A;  1M27 C;  2LCS A;  1NM7 A;  1K76 A;  4AFU C;  4CC3 A;  1X2K A;  1UG1 A;  4Z8A A;  1WI7 A;  2K7A A;  1GBR A;  2L3S A;  3H0I A;  1BBZ A;  1WX6 A;  4AFQ C;  3EHQ A;  3VS3 A;  1K0X A;  1JEG A;  3H0F A;  2EGC A;  3A98 A;  1X69 A;  2EGE A;  2AZV A;  1ZLM A;  2DBK A;  1JXM A;  4JJB A;  1SRM A;  4J9C A;  2LP5 A;  1UEC A;  1WIE A;  4OMO A;  1G83 A;  3M0U A;  3TVT A;  1RLQ C;  4AFZ C;  2YDL A;  3KFV A;  2ENM A;  1GFC A;  4LUD A;  1A0N B;  2O9V A;  2D0N A;  1WLP B;  1WXT A;  1Y0M A;  1V1C A;  2LJ0 A;  2B86 A;  4RTT A;  3QWX X;  1X27 A;  1UFF A;  1EFN A;  2LQW A;  2AKK A;  1CSK A;  2GBQ A;  1AWJ A;  1ABO A;  2C0I A;  5HCK A;  2DMO A;  1AD5 A;  3I35 A;  2KYM A;  1H3H A;  1K4U S;  2J6O A;  1I0C A;  2DLP A;  4LNP A;  1G2B A;  2GGR A;  5I11 A;  2RQT A;  2LJ1 A;  4HVV A;  4D8K A;  2YUP A;  3REA B;  5IXB A;  1SHF A;  1M8M A;  2EW3 A;  1LCK A;  2DM1 A;  2K9G A;  2KBT A;  1OOT A;  2YT6 A;  1Y57 A;  2M51 A;  1GFD A;  4EIK A;  1X43 A;  2BZX A;  1WYX A;  2P4R A;  4OMN A;  1VA7 A;  2K6D A;  3LH5 A;  3UAT A;  1FMK A;  1E6G A;  3EGU A;  1NG2 A;  2F2W A;  1B07 A;  1IO6 A;  3M0P A;  5ECA A;  2JMC A;  1PHT A;  2EBP A;  1SSH A;  2LNH B;  1GRI A;  1QLY A;  1HSQ A;  2L0A A;  2DBM A;  3I5S A;  2JM9 A;  4IIO A;  1K0S A;  4ORZ A;  2X3W D;  2DE0 X;  2F2V A;  3R6N A;  1AOJ A;  2JW4 A;  1ARK A;  1BU1 A;  1W70 A;  2KNB B;  2KXD A;  2DVJ A;  1Z9Z A;  1U5S A;  2X3X D;  1AZE A;  1OPL A;  2RNA A;  1UGV A;  5IXF A;  1YP5 A;  2ESW A;  2ROT A;  3RNJ A;  2M0Y A;  2GQI A;  4Z89 A;  1QKX A;  1X2Q A;  1K9A A;  2XMF A;  4JZ3 A;  4OMP A;  1GL5 A;  3UA6 A;  5I22 A;  2SRC A;  3C0C A;  5IH2 A;  2L3P A;  2AK5 A;  2DA9 A;  1WDX A;  4OML A;  1AWW A;  2CUB A;  2C0T A;  3VS4 A;  5FWC A;  5FWB A;  5IHN A;  2V1Q A;  3M0S A;  2DL8 A;  1SEM A;  2KT8 A;  2CDT A;  1YNZ A;  1GBQ A;  2LQN A;  3EG3 A;  4J9F A;  2O31 A;  4ZNX A;  2A36 A;  1UJ0 A;  3EG2 A;  1RLP C;  3H0H A;  1FYN A;  1NYG A;  2PNI A;  1CKA A;  4DEX A;  2D8J A;  1WXB A;  1ZX6 A;  2A37 A;  2KT1 A;  3H41 A;  1GCQ A;  4K11 A;  2OAW A;  2AZS A;  4GBQ A;  1Z9Q A;  1KJW A;  3NGP A;  2V1R A;  1KFZ A;  1PNJ A;  4JJD A;  4DEY A;  4F17 A;  5L23 A;  1PKT A;  2LX7 A;  1CKB A;  2JMA A;  4J9B A;  5EC7 A;  2JXB A;  1PKS A;  1ZUU A;  4RTZ A;  2RF0 A;  1GCQ C;  2JTE A;  1M3A A;  1E7O A;  2CH4 A;  2DX1 A;  3UF4 A;  4HCK A;  3VS7 A;  2BZ8 A;  2EYX A;  3SHW A;  3VRY A;  1N5Z A;  1W1F A;  2I0N A;  1T0J A;  2DNU A;  4IIM A;  2EYW A;  1X6G A;  1H92 A;  1QCF A;  1VYV A;  4OMQ A;  2EYY A;  3FJ5 A;  2KE9 A;  1PRM C;  4HVW A;  1OPK A;  1JU5 C;  2HCK A;  1AZG B;  2J6F A;  2VWF A;  2YUN A;  1I1J A;  4FSS A;  2KYB A;  4RTX A;  1TUD A;  2YSQ A;  2FEI A;  2RPN A;  2VKN A;  3U23 A;  3JV3 A;  1YWP A;  3ZL7 C;  2DRK A;  1ZUY A;  2FO0 A;  2KRO A;  1W6X A;  3VS6 A;  1S1N A;  1AWX A;  1KIK A;  4RTY A;  2LJ3 A;  1JXO A;  2K79 A;  3VS1 A;  1X6B A;  2EKH A;  1MV3 A;  2IIM A;  4QT7 A;  2EPD A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...