2EGAA

Solution structure of the first sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSSGSSGLEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 and PX domain-containing protein 2A
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egaA00
3QWXX 2CSQA 3NGPA 4RTUA 1CKBA 1BB9A 3PVQA 4CC2A 2DL3A 4RTTA 2PZ1A 4J9GA 1ZBJA 4J9IA 4RUGA 2ED0A 2DM1A 2DJQA 2J05A 1HJDA 3VRYA 3ULRB 3I5SA 5GJVB 1OPLA 2KYMA 4ORZA 2DL5A 1GCPA 1ZUUA 2SRCA 2RQTA 2KYBA 2CUDA 2DE0X 2DVJA 1UECA 1GBRA 1AWJA 4HXJA 4RTYA 1B3QA 3H0IA 1NYFA 3I35A 1VA7A 1X2QA 2FEIA 1Z9QA 1GFCA 3H0HA 4LN2A 1K76A 4GLMA 2LJ3A 2L0AA 1UFFA 4OMNA 2KT8A 1UE9A 1PHTA 4R0KA 3UA6A 3M0SA 2KRNA 4OMPA 1I0CA 5FWCA 1X6GA 3H0FA 2HDAA 2A37A 3EHRA 4F16A 2K79A 2MIOA 1KSWA 2O2OA 4AFSC 2DF6A 2ENMA 2LJ0A 1T3SA 4J9FA 5IHKA 2K6DA 1V1CA 2J6OA 1PKTA 3GBQA 2RQRA 3EG0A 4K11A 1U06A 2PTKA 4CC4B 1W6XA 3PE0A 1K0XA 1NEGA 1OOTA 1BBZA 5IHNA 5I11A 1WLPB 1WXTA 1JO8A 5HCKA 4ESRA 1LCKA 1H92A 3IQLA 2P4RA 2DL4A 1UDLA 2PNIA 3EGUA 2EPDA 1J3TA 2KEAA 4EIKA 3EHQA 1OPKA 2RNAA 4X1VA 1ABOA 1TUCA 3VS1A 2QDLA 1IO6A 4DEYA 3ZL7C 1TG0A 3UF4A 2DA9A 2YUOA 1XOVA 2NUZA 4AFZC 1AWXA 4M4ZA 3CQTA 1B07A 2A36A 1QLYA 1K1ZA 2FPDA 5IXBA 2KXCA 3NMZC 1AEYA 1SEMA 3NHNA 2EQIA 1RUWA 1YCSB 2BZYA 4Z8AA 2DILA 1U3OA 3M0UA 4E6RA 2FPFA 2J7IA 2E5KA 5GJWB 3VS6A 4Y92A 1W1FA 2LP5A 4OMMA 3SEMA 1G83A 1SRMA 2GQIA 4LNPA 2YUPA 1ZUKA 2HSPA 2AK5A 4FSSA 2ECZA 5IH2A 2KR3A 1SPKA 1M3AA 1WIEA 4D8DA 1RI9A 2VVKA 1T0JA 2F2WA 3C0CA 3UA7A 4LE9A 1QWFA 2KGTA 2CT4A 1VYTA 2ROLA 1U5SA 2B86A 2FO0A 1ZX6A 2W0ZA 4J9BA 4GBQA 3U23A 2AKLA 1AVZC 4HCKA 4HVUA 1RLPC 4AFQC 2K9GA 1UJYA 2EGCA 2JT4A 4ZNXA 2JTEA 2AKKA 1X2KA 2J6KA 3JV3A 3I5RA 1N5ZA 1WX6A 1YWPA 1UUEA 2M0YA 1WA7A 1WI7A 2W10A 2L2PA 1AWWA 1QKWA 3R6NA 1AOJA 1E6HA 2LMJA 2JMAA 1WXUA 3NPFA 1E7OA 1QWEA 2JS0A 4JPBW 5FWBA 4IIOA 2V1QA 2ABLA 2A28A 2KE9A 2CDTA 4RTXA 1NEBA 2EW3A 3THKA 4Z89A 1GFDA 2JM8A 2EGAA 4CC3A 2HCKA 4IIMA 2MCNA 1HSQA 1A0NB 2EYXA 2LX7A 1WFWA 2X3WD 2O9VA 2BZ8A 3O5ZA 3PVLA 5L23A 1YNZA 1VYVA 1M30A 2K3BA 1MV0B 1SRLA 1K9AA 2O9SA 2I0NA 1KJWA 2KBTA 1GCQC 2JM9A 1QKXA 5IXFA 2L3SA 2J06A 4JZ3A 2JW4A 2K7AA 1X27A 5EC7A 2D8HA 3REBB 2H8HA 1PRMC 2BTTA 2FRWA 1WYXA 1AWOA 1X69A 2LQNA 2HBWA 2SEMA 2ED1A 3FJ5A 1EFNA 2OJ2A 2LNHB 4A63B 2CUBA 4JJCA 2EYZA 1WXBA 2BZXA 2L3QA 2DBMA 1CKAA 2FG0A 4AFUC 2CSIA 1YP5A 1ZLMA 2KNBB 3VS0A 2A08A 1NLPC 1SHFA 3M0TA 2DL8A 1GRIA 1W70A 2CT3A 1E6GA 2YUNA 1FYNA 2NWMA 2EGEA 1NLOC 1TUDA 2EYWA 4F14A 2V1RA 2AZVA 3LH5A 2DYBA 2YUQA 2LCSA 4JJDA 2VKNA 3RBBB 1I1JA 2DRKA 1I07A 1H8KA 2KRSA 1JQQA 1Y0MA 4F17A 3TVTA 2J6FA 1X6BA 1M3CA 2OI3A 2EYYA 2KRMA 2RQWA 2CREA 1M3BA 1T3LA 2F2XA 3SHWA 2CH4A 1YN8A 1PRLC 2VWFA 3VS5A 2YSQA 5IHIA 2FPEA 2GGRA 2JS2A 3TSZA 1T0HA 3VS2A 4AG1C 3A98A 4QT7A 2C0TA 3VS7A 4OMOA 1UG1A 5ECAA 2C0OA 4LUEA 4DEXA 3EG2A 2RQUA 1MV3A 1UTIA 1OEBA 2RQVA 1GL5A 1RLQC 1KIKA 2GBQA 4J9EA 1GCQA 2LZ6B 2F2VA 4LUDA 1VYUA 2DNUA 4Z88A 4OMQA 2JMCA 2DL7A 1Y57A 2RN8A 1OV3A 2M51A 1K0SA 2DMOA 2GTOA 3UATA 1AD5A 1CSKA 1PWTA 1KFZA 4OMLA 2O88A 2GTJA 1X43A 4CC7A 1H3HA 1JEGA 2EVRA 1JU5C 2C0IA 2KXDA 1UHCA 1UHFA 2LJ1A 1K4US 3VRZA 4WCIA 2RF0A 4HVWA 2YT6A 1NM7A 1SSHA 3H41A 1NYGA 1UJ0A 3TSWA 4JJBA 3KFVA 4J9DA 1MUZA 1AZGB 2D8JA 2DBKA 1ZSGA 2ESWA 1JXMA 1YWOA 4J9HA 2KT1A 1BK2A 2IIMA 3VS3A 1S1NA 4D8KA 1GBQA 2EBPA 2D0NA 3REAB 5FW9A 1UGVA 1HD3A 3M0PA 3VS4A 2DLPA 2G6FX 3RNJA 2GNCA 3M0RA 1QCFA 4J9CA 4RTWA 2RMOA 2OAWA 4AG2C 2KROA 1PNJA 1BU1A 1JXOA 2ROTA 1NG2A 2EKHA 3M0QA 2DX1A 1FMKA 2LQWA 2MOXA 2HEQA 1AZEA 2FRYA 1Z9ZA 1M27C 2JXBA 2AZSA 2XMFA 1G2BA 5I22A 4JZ4A 1ZUYA 3I9QA 2DRMA 2O31A 1WDXA 1ARKA 1PKSA 2L3PA 2CH4W 2D1XA 4RTVA 1M8MA 3QWYA 4HVVA 2X3XD 1ABQA 4KRTA 1SHGA 3EG3A 2YDLA 3EG1A 2RPNA 2K2MA 4RTZA
chains in the Genus database with same CATH superfamily
3FB9A 2AIRB 3SDZA 1I5LA 3CD6Q 3G7ZA 1BB9A 3L2WA 3CC2Q 3CCUA 3CC2T 1NZ9A 3OYFA 3JRZA 4JRQA 2J05A 2CP0A 3OYCA 1PC0A 3A8MB 1JB0E 4C92C 3HP9A 5CKFA 1Q82C 2DVJA 1GBRA 4HXJA 4RTYA 2E41A 2R57A 1VA7A 3RKWA 2X9HA 2LDMA 1K76A 1YJWT 5GAOn 1TWBA 5GMKl 1Q7YR 2L0AA 1UE9A 1PHTA 3QYGB 3HRUA 1WGSA 2XDBA 2CP6A 4M7AB 3UA6A 4M77D 3CCEQ 3CC4Q 1D3BA 4OMPA 1I0CA 1X6GA 3H0FA 3CCSQ 2HNIA 1OI1A 2P4TA 4AFSC 2DF6A 2ENMA 2LJ0A 1N6AA 1SG5A 4IUUA 3CCQA 2JN0A 3CPWA 2E3HA 4M7AC 1W6XA 3HHTB 4ZGEB 2HMAA 3QDFA 1NEGA 2YLBA 1RAGB 2DXBA 1IHWA 5I11A 1KG1A 2E3IA 3S3MA 4DBRA 1N8RR 1VQKA 4CI0C 1UDLA 4JS5A 1K73R 2ZAEA 4X1VA 4NL2A 1IO6A 1TG0A 1N9RA 2YUOA 2D6FA 1RAHB 3M58A 4M4ZA 2QEXQ 3CQTA 4RCBA 5FU6B 3I55A 4BI8B 1RUWA 2XHCA 4E6RA 4WF2A 2Y4YA 4PFPA 1VQNT 1XNIA 5IT9E 1IZ6A 1D0YA 1XTDA 4QQDA 1TUGB 3PFSA 3VV0A 3SEMA 3LGLA 3RMQA 1G83A 1WHHA 1VQ6Q 2LCCA 2O4XB 2YRCA 2E1HA 4A4HA 4PJOB 5IH2A 4J5YA 4M77A 3QJ6A 4L59A 1T0JA 3MEVA 4OGCA 3UA7A 1LJOA 4C5GA 1QWFA 3CC7Q 4RMOA 4HCCA 4FL6A 3OS1A 1NE8A 2K9GA 3V7RA 3CCRQ 1S72T 2JTEA 3GLXA 1GXIE 3JV3A 2DXTA 1OZ2A 3EH2A 4UC4A 3V8KA 2CZ6B 1UUEA 4JDSA 2JTMA 1VQKQ 3P8HA 2JMAA 4O5VA 3NPFA 5DLOA 2JS0A 2K57A 4RCCA 2JTFA 4KGXB 2A28A 2CDTA 4IUTA 3OA6A 4BY6C 2JM8A 2OTLA 3L1AA 4OB1B 4L5GA 5I21A 2HCKA 4IIMA 2MCNA 1X6OA 1M1GA 1VQ7A 4F04B 1A0NB 4PJOA 2LX7A 4M77B 3JAME 1BIAA 3VYHB 3M5AA 3O5ZA 1QVGP 3PVLA 1YNZA 2FZCB 2KSSA 5GAN5 1K9AA 1VQMA 4XTXA 1KJWA 2JM9A 2L3SA 3HRTA 3QG1A 2L3RA 2JW4A 2YXYA 1Q86R 3L2QA 2QQRA 2ZPEB 2BTTA 2I2LA 4C92E 1AWOA 1X69A 1OX9A 3OQ5A 1I5OB 1YJ9A 3LW5E 4XQ3A 1ZSZB 4E7SA 2PQWA 1EFNA 2QQBA 4QVDA 4M7AA 4JJCA 2EYZA 2ZZDA 1W2BS 3INZA 4M75D 1OU9A 1CKAA 3V8LA 5I2MA 1ZLMA 1VQMT 1SHFA 3M0TA 1QVFS 2YUNA 1B34B 2KY9A 3EFOA 2FHDA 2HBPA 4C0GA 3JCMW 1NLOC 3M9QA 3OW2P 4PJOF 2QTVA 2V1RA 3OYIA 1VUBA 2MYSA 3P8BB 2VKNA 2EAYA 2FL7A 3RBBB 4E2FB 3O8VA 4PJOC 1G8XA 2FZGB 1I07A 2CP5A 1H8KA 1Y0MA 5LJ5d 2QXFA 3URGA 1YIJT 3JCMd 2RQWA 1RAFB 1M90C 4QQ6A 4PJOG 2COYA 3HSBA 1HYOA 1KQ2A 1PRLC 3OS2A 5IHIA 2GGRA 4AG1C 1MMGA 3VS2A 2C0TA 4PJOD 5GAOm 1QQJA 2CS7A 5FU6C 3OSSC 2XU8A 2M9UA 1UG1A 2EJ9A 2X4YA 1VQ8A 2RO0A 2QTXA 2C0OA 5HK0A 3E2UA 4DOWA 4JRPA 4BI4A 1VQ5A 1C0MA 1KIKA 4B6MA 4J6YA 1GCQA 2LZ6B 3HKSA 4CRIA 2DNUA 2F1LA 1K73C 1G3WA 3LWHA 2RN8A 5LL6S 1KC8U 3QDRB 2D0QB 1FMWA 1KHCA 1VIFA 2CYZB 3DB3A 2RI5A 4WTOB 4QVZA 3RKYA 3MP6A 3E19A 4X9DA 3I56T 1TTHB 1X43A 4CC7A 1H3HA 2EVRA 2R5MA 1BIBA 1V76A 1D1CA 1OZ3A 3VRZA 1FXXA 4WCIA 4HVWA 2YT6A 1NM7A 3X25B 1VQPT 3KFVA 2JOYA 4O6JA 1LNXA 3G71T 1FWZA 3JCMf 1ZSGA 2ESWA 2IIMA 2RI2A 3AT1B 4D8KA 3C4SA 3OYHA 5LJ5h 4FT2A 4R55A 1N8RU 2D0NA 1HD3A 3M0PA 4DOVA 4RG8A 2DLPA 2G6FX 1BI3A 2RHIA 3QYHB 1QCFA 4RTWA 4D6WA 2RMOA 1BU1A 1JXOA 3CBOA 4DBFA 3H9NA 3A8GB 2EKHA 3M0QA 2NLUA 1VQ7Q 2QGFB 2LQWA 2MOXA 2HEQA 5LJ5f 1O9SA 2FRYA 3PMTA 1M27C 4NL3A 3CMAA 2JXBA 4BB7A 1ZUYA 5CCAA 4MZMA 4ZGDB 3AHUA 4N0AA 1M8MA 3M55A 1VQ4T 2MF2A 4ZTFA 1ABQA 1TXQA 1D0XA 3JB9F 2MWOA 1YIJA 4IURA 2K2MA 2EYWA 2EQMA 4E7ZA 1OX8A 3QWXX 3NGPA 3T9NA 4RTUA 1YJWQ 4M7DA 5M9OA 4CC2A 4C8QE 2GF7A 1SF9A 4MZPA 2K5FA 5IN1A 2AT1B 2RM4A 2R58A 4J9IA 1ZSZA 3VRYA 3I5SA 5GJVB 1OPLA 3VYGA 2KYMA 2DL5A 4MDXA 2SRCA 3S6WA 4KBMB 4FIBA 3WVEB 2CZ0B 4ZTJA 1X2QA 2QA4A 1Z9QA 1F1BB 3E9GA 2WSEE 1TS9A 1YJNQ 1MNEA 2IG0A 4OMNA 4LDVA 3CC2A 4R0KA 4LDUA 2DIGA 4HKEA 1Y96A 5FWCA 3RR6A 4MMLA 4M7AG 5J3BA 4M75E 2ZPIB 4F16A 1M1KU 2MIOA 2Y4XA 3C94A 4J9FA 2K6DA 4M7DB 2FVUA 1YIJQ 2OTJT 1PKTA 1QVPA 3GBQA 2WSCE 2RQRA 2EFIA 4K11A 1U06A 3L2UA 3QIIA 1LPLA 1VIEA 4P5NA 1OOTA 4F7UF 4NS5A 2E4HA 5IHNA 5HCKA 4ESRA 3CPFA 1H92A 3E9FA 2DYIA 3OYEA 2DL4A 3I56A 3TEEA 2EPDA 2DD4A 1QMCA 3JCMV 4A4EA 1OU8A 5D6XA 1ABOA 5J26A 1C1AA 1TUCA 2NYSA 4FYXB 2QDLA 3VS1A 1MGQA 2BIVA 4DEYA 3ZL7C 2XG8D 4EMKB 3TCJA 2MWPA 4F7UG 2CZ7B 5EG2A 1AWXA 2IPOB 3LGFA 4J6WA 1X75C 3KXTA 3JCMJ 4ZN3A 4LD6A 1SEMA 2BZYA 3ME9A 2K5IA 4KT0E 3WXMB 3G6ET 1C6VX 4FYVB 1VQ8T 4C8QA 3VS6A 2ZPGB 3A8LB 3M54A 4PJMA 1O75A 3MJXA 2L8DA 2DEQA 4J6XA 4OMMA 3S3NA 3TREA 2E6NA 1SRMA 2OTJQ 1YI2Q 5A2QE 4FSSA 4PJJA 3QKJA 4A54A 1SPKA 1UEBA 1M3AA 1WQWA 1RI9A 5FROA 3EGDB 3C0CA 2X51A 1LOJA 5GAOr 4LE9A 4PJLA 2B86A 3BFMA 1U5SA 3OMGA 1ZHIA 2DIQA 4PL6A 2M16A 3CCUQ 4LDXA 2VYTA 2DXUA 1AHJB 2L89A 1AVZC 3OYBA 4IUPA 1Y7XA 2EGCA 1OULA 4ZNXA 2LT1A 1X2KA 1WJSA 1QCNA 2M0YA 3M4GA 3UT1A 1AWWA 4M78D 3CXCP 3RIRA 1E6HA 4E7LA 3J7AF 5IAYA 1WXUA 5GAMf 3VUZA 4J83A 1QWEA 1YJNA 3JB9I 1YHQQ 4IIOA 4PLLA 2DXCA 4M75B 5KYUB 2KE9A 1D09B 2HKNA 5CKBA 1Y07A 1GFDA 4LDWA 1W2BA 5GAMj 1ACMB 3X26B 5GAOp 2KK4A 3HL8A 1YCYA 5LJ5e 1FX7A 4B9XA 1WFWA 1SKUB 2X3WD 2A7YA 3PIOA 3QPHA 1UGRB 2E10A 2QQSA 2QEXA 5DM7R 1VQLA 3DB4A 1SRLA 5LJ5j 2I0NA 2E64A 2PVDB 1GCQC 2DZ9A 4IUVA 3CD6T 1QKXA 4JZ3A 3GF5A 5CQXA 1W4SA 1X27A 3MCAB 1UGSB 2HQHA 2NUTA 3REBB 4XU1A 2OTLQ 1G3YA 3FJ5A 2LNHB 4M78G 1KQSS 3JB9H 2RHXA 1YP5A 1NLPC 2GCXA 2DL8A 2CT3A 1E6GA 2LRQA 1FYNA 2VXFA 2NWMA 2QYZA 4LDYA 5GAMe 4FYYB 2GQVA 5GMKe 2YRVA 1M2VA 4F14A 3UDCA 3R6OA 5KYYB 1S72A 2DYBA 1AT1B 1Q7YC 1I1JA 5HK3A 3OBWA 2A0FB 5GANe 2FB7A 2J6FA 1M3CA 2EYYA 4FM4B 1Q82R 3D7SB 5GAN8 1T3LA 2F2XA 3SHWA 2CH4A 1H641 2YSQA 4KUIA 2FPEA 2CKKA 3JCMb 1I8FA 2FYKA 3MO8A 4QT7A 2QQAA 1Y71A 5CVIA 2COWA 2V26A 4C0DB 4QQGA 3EG2A 3M4YA 3MP1A 5AT1B 3OB9A 4OMFB 8ATCB 1YITQ 1N8RC 2VXEA 3MP8A 4C8QB 1VQOA 5D6YA 3CCRT 3CBPA 2V8IA 3PNWC 3EGXA 4XAXB 4OMQA 2JMCA 4X9CA 1D1AA 1OV3A 4C92B 5KYWA 2M51A 5KYYA 2LVMA 3GPLA 1K0SA 3QUIA 5FU7C 4IKFA 3DLMA 1MNDA 3JCMe 5KCHA 1JEGA 2K4YA 2C0IA 1PD0A 2RK1A 2LJ1A 4HCBA 2XDDA 1K4US 5KE3A 2RF0A 4OB0B 3LYIA 2LT4A 1UJ0A 1JJ2P 3CMET 1QP2A 2LQKA 7AT1B 4A4GA 1YWOA 3A8OB 1KD1R 1QP3A 4M78E 4YTLA 3GP8A 1GBQA 4EMGA 5LJ3f 5FW9A 1UGVA 2PUOB 4C8QG 4BE1A 2OX7A 2DPPB 4J9CA 5KYUA 3OS0A 2OAWA 4AG2C 1PNJA 5DLQE 2PVOB 3C12A 2DX1A 3FDRA 4NOYA 1QVFA 1HK9A 2M0OA 2RHYA 2A3LA 2C06A 1WHMA 1WDXA 1I81A 1PKSA 2CH4W 4RTVA 3P8DA 3QWYA 2X3XD 4OVAA 1PD1A 5CK9A 4QVCA 1B34A 1VQ9T 3CCST 1VQ9Q 2X4JA 3EG1A 3VU3C 4RTZA 1H3ZA 5KE2A 2ZPHB 3JSCA 2MMPA 2DTIA 2CSQA 2QGGA 4JRIA 3SB2A 5CKDA 3CCQQ 4MDWA 3A1PA 3J81E 2X4WA 3X28B 2PZ1A 2F69A 2CZ1B 4DQ2A 4BDYA 5GAMg 2KQWA 4N0AC 1NJIU 2DFUA 2RJDA 2QQ9A 2ZGWA 3CXCA 4M77G 5GAMh 1ZUUA 2E5QA 1JJ2S 2KYBA 2CUDA 3JCMc 2DE0X 4A53A 1AWJA 4A4KA 1B3QA 3I35A 4N4IA 4BD3A 1GFCA 4II1A 1KK7A 1ZBXA 1UGPB 1Q86C 1N27A 4PNOA 2LJ3A 1M2VB 3H6ZA 2KT8A 3VJPA 2LQ8A 4FU6A 3M0SA 1RAIB 4J7FA 3SWNC 2XK0A 2X4XA 2HDAA 2A37A 3ZBDA 2K79A 2O2OA 2QASA 3L2ZA 1T3SA 4KGZB 1U8RA 4LD9K 1V1CA 1UB4A 4BI3A 1VQ6T 2QA4Q 2BUDA 3BE3A 2QA4T 4CC4B 3PE0A 2X35A 4JJNK 1K0XA 1VQ9A 3CPWS 2RD1A 1YJNT 1BBZA 1D0ZA 3RKXA 1WLPB 1WXTA 1WHJA 3G6EQ 1JO8A 1LCKA 4M75C 3SWNB 1WZOA 4M7DE 3PGGA 2PNIA 5GANf 5HY6A 1R77A 1J3TA 2CP2A 4EPCA 1TSFA 2RB6A 3EHQA 4EIKA 1OPKA 3L2RA 2RNAA 3CC7T 2VUBA 1SSFA 1Q82U 3UF4A 2DA9A 3JCMh 1D1BA 1S72Q 1VQ5Q 3CCET 1ZQ1A 4C92A 1KQ1A 3JB9G 1B07A 4PFOA 3UPUA 2A36A 1QLYA 1K1ZA 1TH7A 3JCMg 3NHNA 4J7IA 2EQIA 1QVFP 3ZFJA 4XTUA 3JB9D 1U3OA 5I2SA 2E5KA 4OF1A 3CCMT 3FRNA 3MEUA 3QZ5B 5GAMd 4Y92A 4DA4A 4BE0A 2DO3A 3SD4A 4ZN1A 1WJRA 2WSFE 3QXEB 4Y28E 3KUFA 2CGHA 1MMDA 2HSPA 4C5IA 2KR3A 3H8ZA 1ZA2B 3DKMA 1LVKA 2VVKA 2YRDA 5LJ3g 4XTZA 3G4SA 2CT4A 2ROLA 2ATCB 2O4XA 2ZPFB 1BI1A 4GBQA 5LJ3h 4KGVB 4HCKA 4HVUA 1UJYA 1EIFA 4JLGA 3CCRA 2JT4A 3VKIA 1Q81C 5GANj 2J6KA 4Z02A 1QVGS 3NTIA 2CP7A 3I5RA 1U1SA 1M1KR 2KAFA 3CCLQ 3CCJT 1WI7A 3CCLT 1V29B 2JJ9A 3FLGA 5GAN3 3R6NA 3JCMX 2HQEA 1G3SA 5LJ3e 2LMJA 5A0DA 1YHQA 2DTOA 4JPBW 4N4GA 5FWBA 2V1QA 3MEAA 2ABLA 3OYNA 5D6WA 4KULA 1NEBA 2DK3A 4MMKA 5D7UA 3THKA 4AMCA 3OYKA 3EH1A 5GMKh 3GNGA 3CCVA 2RJFA 2LNVA 5C0MA 1VQ4Q 5FU7B 1KQSP 3J80E 2EKOA 3RESA 1KD1C 2BZ8A 1YBYA 1B7TA 3TU4K 2RJCA 4QW2A 1MV0B 1QCOA 3CC7A 1RL2A 3LLRA 3EFRA 1PCXA 5IXFA 5DY9A 1YITT 3OYDA 3OMCA 5EC7A 2D8HA 1PRMC 4XU0A 2PUKB 4C5EA 4ATOA 3QSUA 4DBQA 1PG5B 3C95A 2HBWA 1K9MC 3FJPA 2ED1A 1QVGA 3VUBA 2OJ2A 2CUBA 2EQJA 2COZA 2GFUA 2L3QA 4EMKA 1BCMA 2DBMA 2FG0A 4AFUC 2DZCA 2M1HA 4Y91A 4PFZA 4MZTA 1GRIA 4PJNA 1M2OA 6AT1B 2VV5A 1TUDA 1FMVA 1R8OB 5CIUA 5AYFA 4X34A 3BDUA 4XTYA 3L2VA 4M77C 2AZVA 3LH5A 2YUQA 1VQLT 4JJDA 4C5HA 2MAMA 3OYLA 3WVDB 3EFOB 1VQ4A 3META 5FRMA 1JBMA 3TVTA 2OI3A 4M75F 2KRMA 4BY6B 1IGQA 1YHQT 1K8AC 1Q7YU 3EGDA 3KBGA 2E70A 4FW1A 2VWFA 3VS5A 5LJ5g 2JS2A 3CCLA 3MHXA 4FYWB 3OSVA 4OMOA 1RABB 3EG9A 4PKCC 2VGMA 1RAEB 4LUEA 4DEXA 4E47A 2RQUA 1MV3A 2K3YA 5L8RE 1OEBA 3G1JA 3OW2S 1WPYA 4E7IA 3PT9A 1GL5A 2FZKB 1KC8C 1RLQC 1Q86U 2QG9B 1WHLA 3G4ST 1D3BB 4C8QD 2QAZA 4LUDA 3CCSA 1VYUA 4Z88A 3QZ9B 3MKDA 3L42A 4ANJA 2DL7A 2JZ2A 1VQPA 3CC4A 1OYXA 5LJ3j 2DMOA 2E12A 2GTOA 1AD5A 2RHZA 5GANh 1KFZA 2XIDA 1WQ7A 3I56Q 1K73U 1BI2A 1JU5C 2KXDA 1UHFA 3GOXA 5CR2A 1EX4A 2EQUA 4C8QC 2HL5C 1SSHA 1VQPQ 4JJBA 2PU9B 4JS4A 4J9DA 4TVRA 1MUZA 2PVGB 5GAOq 2VGNA 4C8QF 2XICA 3FC3A 3G71Q 5LJ3d 3ER0A 3PIPA 4J9HA 1BK2A 2KT1A 3VS3A 8AT1B 2Z0WA 3OYGA 3A5ZB 3CC4T 2H3JA 1P92A 1XQHA 3REAB 4RG2A 3EAEA 1IXDA 3CCJQ 3VS4A 2R5AA 2GNCA 3M0RA 3N5BB 3G4SQ 3A8HB 2ROTA 1NG2A 1FMKA 1AZEA 3RUXA 2RK2A 4ZGJB 3QJYA 1KHIA 2LX9A 4N4HA 2AZSA 2XMFA 4F7UA 5I22A 4JZ4A 4C92D 2DAQA 3I9QA 2DRMA 2O31A 2RA2A 1ARKA 5A0GA 2NUPB 2XDPA 3F70A 2RH2A 3OY9A 1VQ6A 1OQKA 3E1SA 4XTVA 3OS5A 4HT9A 4KRTA 1SHGA 2EIFA 4A4FA 2RPNA 4BDZA 1VQOT 3BDLA 3FEOA 3OBYA 2XI9A 2YHTA 1CKBA 2EQKA 3CD6A 3PVQA 2DL3A 4RTTA 2VC8A 4HT8A 4J9GA 1Q81R 1ZBJA 4RUGA 2ED0A 2DM1A 2CP3A 2DJQA 3DLLA 4EDUA 2QEXT 1HJDA 4OB3B 3ASKA 3ULRB 1VQKT 1IGUA 4ORZA 3JCMQ 1GCPA 4LXCA 2RQTA 4OP0A 1TU0B 4EMHA 1UECA 1NJIC 4J8OA 3H0IA 4M7DD 1NYFA 4C0ZA 5GAN6 2FEIA 2P0KA 3H0HA 4EMKC 1Y96B 4ME7A 4KH1B 4LN2A 5GAN7 4M7DG 2XKOC 3CCQT 4GLMA 2L5QA 3QBYA 5CKHA 1UFFA 4FW2A 5KYXB 2NUPA 3RERA 1VQOQ 2KRNA 4XTWA 1YITA 5GMKm 4M7DC 2EJGA 2M02A 3OYYA 3EHRA 1M90R 4C0FA 2YWWA 5KYWB 1KSWA 1WHKA 4XU2A 4M7DF 5IHKA 1YJWA 1KC8R 2J6OA 2P0QA 2Y90A 3EG0A 4M7AE 2K5LA 2PTKA 1PM3A 4GY5A 2KI7A 4JUVA 1IB8A 1R0CB 3CCVT 4QKUA 3EG9B 1K9MR 1MMNA 3M59A 2BKDN 1K8AU 3CPWP 1PSFA 2OAUA 3IQLA 2P4RA 3UWNA 3EGUA 1M1FA 1MHNA 2XD0A 2KEAA 1WHGA 2JUFA 3MPUB 2QDYB 5GANd 3CCUT 2DKGA 2MPXC 3CCJA 1XOVA 2NUZA 5KH6A 1IREB 2DTHA 4AFZC 2HAXA 1VQLQ 3JCMP 2FPDA 5IXBA 5GMKj 2KXCA 3NMZC 1AEYA 2DERA 4PJOE 1YCSB 4Z8AA 3CMEA 2DILA 3M0UA 1UGQB 2FPFA 1K8AR 2J7IA 3LX7A 5GJWB 1W1FA 2LP5A 4FT4A 3HPWA 2GQIA 4LNPA 5A0LA 2YUPA 1ZUKA 1VQNA 2B8AA 2AK5A 2DVEA 2ECZA 1KQSA 1WIEA 4E7KA 4D8DA 2F2WA 5KYNA 4DBHA 1U1TA 1IHVA 1G3TA 2KGTA 1I4K1 5KCOA 1VYTA 4FCYA 3CCMA 2FO0A 1ZX6A 2DD5A 2W0ZA 4J9BA 4RKUE 4HCZA 2EWNA 3U23A 1KD1U 5C6SA 2AKLA 1RADB 1RLPC 4AFQC 9ATCB 3LWIA 3GIBA 1N9SA 2AKKA 3OYMA 1R0BG 4KH0B 2DETA 2K2VA 3RMSA 3EFSA 1N5ZA 1WX6A 4F7UB 1YWPA 3MEWA 2W10A 4M78A 1WA7A 5CAIA 3NTKA 2L2PA 1WNLA 4M7AF 1QKWA 1EZZB 4M77F 1AOJA 2QI2A 3CBMA 1Q81U 2MI6A 5CKEA 1G5VA 3CMAQ 1E7OA 2KMTA 3S3OA 4RTXA 1JRIA 2EW3A 4Z89A 2RJEA 2IVWA 4BE2A 2ZCFB 3M57A 2EGAA 3PMIA 4CC3A 1YJ9Q 4Q5WA 5CO7A 4HA8A 1M9SA 1HSQA 1RI0A 4M75A 3CEYA 2EYXA 3TQ7P 3M53A 2H3EB 2O9VA 3QHSA 4M78F 3QO3A 2HQXA 4M7AD 2HSEB 5GAOl 2NUTB 5L23A 3PTAA 1VYVA 1M30A 2K3BA 3V7CA 2O9SA 5FRNA 1VQMQ 1IRXA 1MMAA 2KBTA 1RAAB 5HKCA 1JJ2A 4PLIA 2J06A 2K7AA 1BCOA 1YFNA 2LC4A 2YLCA 2VB6A 1NPRA 4M77E 2LTOA 2H8HA 3CCMQ 2FRWA 1WYXA 1PSEA 2MK5A 2LQNA 3SWNA 3OYJA 4M78B 2SEMA 4XU3A 4B9WA 1M8VA 5KYXA 3OW2A 4M78C 4ELYC 5GMKi 4E7HA 4A63B 2LCLA 1WXBA 1BYMA 2BZXA 3CMAT 2O01E 2EJFA 1YJ9T 1K9MU 1M4ZA 2CSIA 1W2BP 2KNBB 3VS0A 2A08A 2DEUA 2K3XA 1W70A 2EGEA 4V2SA 4C92F 1NBEB 1DJ7B 2LCSA 2ZPBB 4L6V5 1BKBA 1QW1A 4PK4A 3CXCS 2DRKA 3BY7A 1NJIR 2KRSA 1JQQA 4F17A 3G71A 5CQYA 1X6BA 1VQ7T 2P0PA 1VQNQ 1ZA1B 1TOVA 3Q1JA 3RDVA 2CREA 4JRKA 2OTLT 1M3BA 2G3RA 5FLXE 1YN8A 3HRSA 1BI0A 3TSZA 1T0HA 4M75G 2D9TA 1ZSZC 3A98A 2DJZA 4BACA 2E65A 3VS7A 3I55Q 2F5KA 2HZYA 5ECAA 3HFOA 4C92G 4ELZC 5GANg 1UTIA 2RQVA 3FIFA 4FSXA 2HKQB 3HFNA 2RI3A 1VOMA 2BE9B 5J39A 2GBQA 1VQ5T 4J9EA 2F2VA 3CCEA 3HTRA 3OYAA 1Y57A 2JVVA 3X24B 2P84A 4R56A 1M5Q1 2F5TX 4OB2B 2V8JA 3UATA 1CSKA 3CCVQ 1PWTA 2EYQA 1YI2T 4VUBA 1M90U 2BE7D 4OMLA 3V8JA 2O88A 3EGXB 2GTJA 1YI2A 1UHCA 1HXDA 3G6EA 2RHUA 3H41A 2JNGA 1NYGA 3TSWA 2HD0A 1X01A 2V8KA 1AZGB 2D8JA 4IUQA 2DBKA 1WJQA 1JXMA 2HL3A 4BUGA 4OGEA 2WACA 4AT1B 1S1NA 2EBPA 3NTHA 2VASA 4KUDK 3I55T 3NFCA 3V7SA 3LH0A 3ZEHA 4C0DC 3RNJA 3SFMA 3JB9J 4F7UE 1RACB 2KROA 2GFAA 1VQ8Q 2QK0A 2AHJB 3BW1A 3GNFB 5GAN2 3M56A 1Z9ZA 2KDSA 4E7JA 4XK8E 3X20B 5GAN4 1G2BA 2KVQG 4JLIA 2L3PA 2D1XA 1M1KC 1NPPA 2OTJA 1XJWB 4HVVA 4GLKA 3EG3A 2YDLA 3CMEQ 1Q95G 2E6ZA
chains in the Genus database with same CATH topology
3QWXX 2CSQA 3NGPA 4RTUA 1CKBA 1BB9A 3PVQA 4CC2A 2DL3A 4RTTA 2PZ1A 4J9GA 1ZBJA 4J9IA 4RUGA 2ED0A 2DM1A 2DJQA 2J05A 1HJDA 3VRYA 3ULRB 3I5SA 5GJVB 1OPLA 2KYMA 4ORZA 2DL5A 1GCPA 1ZUUA 2SRCA 2RQTA 2KYBA 2CUDA 2DE0X 2DVJA 1UECA 1GBRA 1AWJA 4HXJA 4RTYA 1B3QA 3H0IA 1NYFA 3I35A 1VA7A 1X2QA 2FEIA 1Z9QA 1GFCA 3H0HA 4LN2A 1K76A 4GLMA 2LJ3A 2L0AA 1UFFA 4OMNA 2KT8A 1UE9A 1PHTA 4R0KA 3UA6A 3M0SA 2KRNA 4OMPA 1I0CA 5FWCA 1X6GA 3H0FA 2HDAA 2A37A 3EHRA 4F16A 2K79A 2MIOA 1KSWA 2O2OA 4AFSC 2DF6A 2ENMA 2LJ0A 1T3SA 4J9FA 5IHKA 2K6DA 1V1CA 2J6OA 1PKTA 3GBQA 2RQRA 3EG0A 4K11A 1U06A 2PTKA 4CC4B 1W6XA 3PE0A 1K0XA 1NEGA 1OOTA 1BBZA 5IHNA 5I11A 1WLPB 1WXTA 1JO8A 5HCKA 4ESRA 1LCKA 1H92A 3IQLA 2P4RA 2DL4A 1UDLA 2PNIA 3EGUA 2EPDA 1J3TA 2KEAA 4EIKA 3EHQA 1OPKA 2RNAA 4X1VA 1ABOA 1TUCA 3VS1A 2QDLA 1IO6A 4DEYA 3ZL7C 1TG0A 3UF4A 2DA9A 2YUOA 1XOVA 2NUZA 4AFZC 1AWXA 4M4ZA 3CQTA 1B07A 2A36A 1QLYA 1K1ZA 2FPDA 5IXBA 2KXCA 3NMZC 1AEYA 1SEMA 3NHNA 2EQIA 1RUWA 1YCSB 2BZYA 4Z8AA 2DILA 1U3OA 3M0UA 4E6RA 2FPFA 2J7IA 2E5KA 5GJWB 3VS6A 4Y92A 1W1FA 2LP5A 4OMMA 3SEMA 1G83A 1SRMA 2GQIA 4LNPA 2YUPA 1ZUKA 2HSPA 2AK5A 4FSSA 2ECZA 5IH2A 2KR3A 1SPKA 1M3AA 1WIEA 4D8DA 1RI9A 2VVKA 1T0JA 2F2WA 3C0CA 3UA7A 4LE9A 1QWFA 2KGTA 2CT4A 1VYTA 2ROLA 1U5SA 2B86A 2FO0A 1ZX6A 2W0ZA 4J9BA 4GBQA 3U23A 2AKLA 1AVZC 4HCKA 4HVUA 1RLPC 4AFQC 2K9GA 1UJYA 2EGCA 2JT4A 4ZNXA 2JTEA 2AKKA 1X2KA 2J6KA 3JV3A 3I5RA 1N5ZA 1WX6A 1YWPA 1UUEA 2M0YA 1WA7A 1WI7A 2W10A 2L2PA 1AWWA 1QKWA 3R6NA 1AOJA 1E6HA 2LMJA 2JMAA 1WXUA 3NPFA 1E7OA 1QWEA 2JS0A 4JPBW 5FWBA 4IIOA 2V1QA 2ABLA 2A28A 2KE9A 2CDTA 4RTXA 1NEBA 2EW3A 3THKA 4Z89A 1GFDA 2JM8A 2EGAA 4CC3A 2HCKA 4IIMA 2MCNA 1HSQA 1A0NB 2EYXA 2LX7A 1WFWA 2X3WD 2O9VA 2BZ8A 3O5ZA 3PVLA 5L23A 1YNZA 1VYVA 1M30A 2K3BA 1MV0B 1SRLA 1K9AA 2O9SA 2I0NA 1KJWA 2KBTA 1GCQC 2JM9A 1QKXA 5IXFA 2L3SA 2J06A 4JZ3A 2JW4A 2K7AA 1X27A 5EC7A 2D8HA 3REBB 2H8HA 1PRMC 2BTTA 2FRWA 1WYXA 1AWOA 1X69A 2LQNA 2HBWA 2SEMA 2ED1A 3FJ5A 1EFNA 2OJ2A 2LNHB 4A63B 2CUBA 4JJCA 2EYZA 1WXBA 2BZXA 2L3QA 2DBMA 1CKAA 2FG0A 4AFUC 2CSIA 1YP5A 1ZLMA 2KNBB 3VS0A 2A08A 1NLPC 1SHFA 3M0TA 2DL8A 1GRIA 1W70A 2CT3A 1E6GA 2YUNA 1FYNA 2NWMA 2EGEA 1NLOC 1TUDA 2EYWA 4F14A 2V1RA 2AZVA 3LH5A 2DYBA 2YUQA 2LCSA 4JJDA 2VKNA 3RBBB 1I1JA 2DRKA 1I07A 1H8KA 2KRSA 1JQQA 1Y0MA 4F17A 3TVTA 2J6FA 1X6BA 1M3CA 2OI3A 2EYYA 2KRMA 2RQWA 2CREA 1M3BA 1T3LA 2F2XA 3SHWA 2CH4A 1YN8A 1PRLC 2VWFA 3VS5A 2YSQA 5IHIA 2FPEA 2GGRA 2JS2A 3TSZA 1T0HA 3VS2A 4AG1C 3A98A 4QT7A 2C0TA 3VS7A 4OMOA 1UG1A 5ECAA 2C0OA 4LUEA 4DEXA 3EG2A 2RQUA 1MV3A 1UTIA 1OEBA 2RQVA 1GL5A 1RLQC 1KIKA 2GBQA 4J9EA 1GCQA 2LZ6B 2F2VA 4LUDA 1VYUA 2DNUA 4Z88A 4OMQA 2JMCA 2DL7A 1Y57A 2RN8A 1OV3A 2M51A 1K0SA 2DMOA 2GTOA 3UATA 1AD5A 1CSKA 1PWTA 1KFZA 4OMLA 2O88A 2GTJA 1X43A 4CC7A 1H3HA 1JEGA 2EVRA 1JU5C 2C0IA 2KXDA 1UHCA 1UHFA 2LJ1A 1K4US 3VRZA 4WCIA 2RF0A 4HVWA 2YT6A 1NM7A 1SSHA 3H41A 1NYGA 1UJ0A 3TSWA 4JJBA 3KFVA 4J9DA 1MUZA 1AZGB 2D8JA 2DBKA 1ZSGA 2ESWA 1JXMA 1YWOA 4J9HA 2KT1A 1BK2A 2IIMA 3VS3A 1S1NA 4D8KA 1GBQA 2EBPA 2D0NA 3REAB 5FW9A 1UGVA 1HD3A 3M0PA 3VS4A 2DLPA 2G6FX 3RNJA 2GNCA 3M0RA 1QCFA 4J9CA 4RTWA 2RMOA 2OAWA 4AG2C 2KROA 1PNJA 1BU1A 1JXOA 2ROTA 1NG2A 2EKHA 3M0QA 2DX1A 1FMKA 2LQWA 2MOXA 2HEQA 1AZEA 2FRYA 1Z9ZA 1M27C 2JXBA 2AZSA 2XMFA 1G2BA 5I22A 4JZ4A 1ZUYA 3I9QA 2DRMA 2O31A 1WDXA 1ARKA 1PKSA 2L3PA 2CH4W 2D1XA 4RTVA 1M8MA 3QWYA 4HVVA 2X3XD 1ABQA 4KRTA 1SHGA 3EG3A 2YDLA 3EG1A 2RPNA 2K2MA 4RTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWX X;  2CSQ A;  3NGP A;  4RTU A;  1CKB A;  1BB9 A;  3PVQ A;  4CC2 A;  2DL3 A;  4RTT A;  2PZ1 A;  4J9G A;  1ZBJ A;  4J9I A;  4RUG A;  2ED0 A;  2DM1 A;  2DJQ A;  2J05 A;  1HJD A;  3VRY A;  3ULR B;  3I5S A;  5GJV B;  1OPL A;  2KYM A;  4ORZ A;  2DL5 A;  1GCP A;  1ZUU A;  2SRC A;  2RQT A;  2KYB A;  2CUD A;  2DE0 X;  2DVJ A;  1UEC A;  1GBR A;  1AWJ A;  4HXJ A;  4RTY A;  1B3Q A;  3H0I A;  1NYF A;  3I35 A;  1VA7 A;  1X2Q A;  2FEI A;  1Z9Q A;  1GFC A;  3H0H A;  4LN2 A;  1K76 A;  4GLM A;  2LJ3 A;  2L0A A;  1UFF A;  4OMN A;  2KT8 A;  1UE9 A;  1PHT A;  4R0K A;  3UA6 A;  3M0S A;  2KRN A;  4OMP A;  1I0C A;  5FWC A;  1X6G A;  3H0F A;  2HDA A;  2A37 A;  3EHR A;  4F16 A;  2K79 A;  2MIO A;  1KSW A;  2O2O A;  4AFS C;  2DF6 A;  2ENM A;  2LJ0 A;  1T3S A;  4J9F A;  5IHK A;  2K6D A;  1V1C A;  2J6O A;  1PKT A;  3GBQ A;  2RQR A;  3EG0 A;  4K11 A;  1U06 A;  2PTK A;  4CC4 B;  1W6X A;  3PE0 A;  1K0X A;  1NEG A;  1OOT A;  1BBZ A;  5IHN A;  5I11 A;  1WLP B;  1WXT A;  1JO8 A;  5HCK A;  4ESR A;  1LCK A;  1H92 A;  3IQL A;  2P4R A;  2DL4 A;  1UDL A;  2PNI A;  3EGU A;  2EPD A;  1J3T A;  2KEA A;  4EIK A;  3EHQ A;  1OPK A;  2RNA A;  4X1V A;  1ABO A;  1TUC A;  3VS1 A;  2QDL A;  1IO6 A;  4DEY A;  3ZL7 C;  1TG0 A;  3UF4 A;  2DA9 A;  2YUO A;  1XOV A;  2NUZ A;  4AFZ C;  1AWX A;  4M4Z A;  3CQT A;  1B07 A;  2A36 A;  1QLY A;  1K1Z A;  2FPD A;  5IXB A;  2KXC A;  3NMZ C;  1AEY A;  1SEM A;  3NHN A;  2EQI A;  1RUW A;  1YCS B;  2BZY A;  4Z8A A;  2DIL A;  1U3O A;  3M0U A;  4E6R A;  2FPF A;  2J7I A;  2E5K A;  5GJW B;  3VS6 A;  4Y92 A;  1W1F A;  2LP5 A;  4OMM A;  3SEM A;  1G83 A;  1SRM A;  2GQI A;  4LNP A;  2YUP A;  1ZUK A;  2HSP A;  2AK5 A;  4FSS A;  2ECZ A;  5IH2 A;  2KR3 A;  1SPK A;  1M3A A;  1WIE A;  4D8D A;  1RI9 A;  2VVK A;  1T0J A;  2F2W A;  3C0C A;  3UA7 A;  4LE9 A;  1QWF A;  2KGT A;  2CT4 A;  1VYT A;  2ROL A;  1U5S A;  2B86 A;  2FO0 A;  1ZX6 A;  2W0Z A;  4J9B A;  4GBQ A;  3U23 A;  2AKL A;  1AVZ C;  4HCK A;  4HVU A;  1RLP C;  4AFQ C;  2K9G A;  1UJY A;  2EGC A;  2JT4 A;  4ZNX A;  2JTE A;  2AKK A;  1X2K A;  2J6K A;  3JV3 A;  3I5R A;  1N5Z A;  1WX6 A;  1YWP A;  1UUE A;  2M0Y A;  1WA7 A;  1WI7 A;  2W10 A;  2L2P A;  1AWW A;  1QKW A;  3R6N A;  1AOJ A;  1E6H A;  2LMJ A;  2JMA A;  1WXU A;  3NPF A;  1E7O A;  1QWE A;  2JS0 A;  4JPB W;  5FWB A;  4IIO A;  2V1Q A;  2ABL A;  2A28 A;  2KE9 A;  2CDT A;  4RTX A;  1NEB A;  2EW3 A;  3THK A;  4Z89 A;  1GFD A;  2JM8 A;  2EGA A;  4CC3 A;  2HCK A;  4IIM A;  2MCN A;  1HSQ A;  1A0N B;  2EYX A;  2LX7 A;  1WFW A;  2X3W D;  2O9V A;  2BZ8 A;  3O5Z A;  3PVL A;  5L23 A;  1YNZ A;  1VYV A;  1M30 A;  2K3B A;  1MV0 B;  1SRL A;  1K9A A;  2O9S A;  2I0N A;  1KJW A;  2KBT A;  1GCQ C;  2JM9 A;  1QKX A;  5IXF A;  2L3S A;  2J06 A;  4JZ3 A;  2JW4 A;  2K7A A;  1X27 A;  5EC7 A;  2D8H A;  3REB B;  2H8H A;  1PRM C;  2BTT A;  2FRW A;  1WYX A;  1AWO A;  1X69 A;  2LQN A;  2HBW A;  2SEM A;  2ED1 A;  3FJ5 A;  1EFN A;  2OJ2 A;  2LNH B;  4A63 B;  2CUB A;  4JJC A;  2EYZ A;  1WXB A;  2BZX A;  2L3Q A;  2DBM A;  1CKA A;  2FG0 A;  4AFU C;  2CSI A;  1YP5 A;  1ZLM A;  2KNB B;  3VS0 A;  2A08 A;  1NLP C;  1SHF A;  3M0T A;  2DL8 A;  1GRI A;  1W70 A;  2CT3 A;  1E6G A;  2YUN A;  1FYN A;  2NWM A;  2EGE A;  1NLO C;  1TUD A;  2EYW A;  4F14 A;  2V1R A;  2AZV A;  3LH5 A;  2DYB A;  2YUQ A;  2LCS A;  4JJD A;  2VKN A;  3RBB B;  1I1J A;  2DRK A;  1I07 A;  1H8K A;  2KRS A;  1JQQ A;  1Y0M A;  4F17 A;  3TVT A;  2J6F A;  1X6B A;  1M3C A;  2OI3 A;  2EYY A;  2KRM A;  2RQW A;  2CRE A;  1M3B A;  1T3L A;  2F2X A;  3SHW A;  2CH4 A;  1YN8 A;  1PRL C;  2VWF A;  3VS5 A;  2YSQ A;  5IHI A;  2FPE A;  2GGR A;  2JS2 A;  3TSZ A;  1T0H A;  3VS2 A;  4AG1 C;  3A98 A;  4QT7 A;  2C0T A;  3VS7 A;  4OMO A;  1UG1 A;  5ECA A;  2C0O A;  4LUE A;  4DEX A;  3EG2 A;  2RQU A;  1MV3 A;  1UTI A;  1OEB A;  2RQV A;  1GL5 A;  1RLQ C;  1KIK A;  2GBQ A;  4J9E A;  1GCQ A;  2LZ6 B;  2F2V A;  4LUD A;  1VYU A;  2DNU A;  4Z88 A;  4OMQ A;  2JMC A;  2DL7 A;  1Y57 A;  2RN8 A;  1OV3 A;  2M51 A;  1K0S A;  2DMO A;  2GTO A;  3UAT A;  1AD5 A;  1CSK A;  1PWT A;  1KFZ A;  4OML A;  2O88 A;  2GTJ A;  1X43 A;  4CC7 A;  1H3H A;  1JEG A;  2EVR A;  1JU5 C;  2C0I A;  2KXD A;  1UHC A;  1UHF A;  2LJ1 A;  1K4U S;  3VRZ A;  4WCI A;  2RF0 A;  4HVW A;  2YT6 A;  1NM7 A;  1SSH A;  3H41 A;  1NYG A;  1UJ0 A;  3TSW A;  4JJB A;  3KFV A;  4J9D A;  1MUZ A;  1AZG B;  2D8J A;  2DBK A;  1ZSG A;  2ESW A;  1JXM A;  1YWO A;  4J9H A;  2KT1 A;  1BK2 A;  2IIM A;  3VS3 A;  1S1N A;  4D8K A;  1GBQ A;  2EBP A;  2D0N A;  3REA B;  5FW9 A;  1UGV A;  1HD3 A;  3M0P A;  3VS4 A;  2DLP A;  2G6F X;  3RNJ A;  2GNC A;  3M0R A;  1QCF A;  4J9C A;  4RTW A;  2RMO A;  2OAW A;  4AG2 C;  2KRO A;  1PNJ A;  1BU1 A;  1JXO A;  2ROT A;  1NG2 A;  2EKH A;  3M0Q A;  2DX1 A;  1FMK A;  2LQW A;  2MOX A;  2HEQ A;  1AZE A;  2FRY A;  1Z9Z A;  1M27 C;  2JXB A;  2AZS A;  2XMF A;  1G2B A;  5I22 A;  4JZ4 A;  1ZUY A;  3I9Q A;  2DRM A;  2O31 A;  1WDX A;  1ARK A;  1PKS A;  2L3P A;  2CH4 W;  2D1X A;  4RTV A;  1M8M A;  3QWY A;  4HVV A;  2X3X D;  1ABQ A;  4KRT A;  1SHG A;  3EG3 A;  2YDL A;  3EG1 A;  2RPN A;  2K2M A;  4RTZ A; 
#chains in the Genus database with same CATH topology
 3FB9 A;  2AIR B;  3SDZ A;  1I5L A;  3CD6 Q;  3G7Z A;  1BB9 A;  3L2W A;  3CC2 Q;  3CCU A;  3CC2 T;  1NZ9 A;  3OYF A;  3JRZ A;  4JRQ A;  2J05 A;  2CP0 A;  3OYC A;  1PC0 A;  3A8M B;  1JB0 E;  4C92 C;  3HP9 A;  5CKF A;  1Q82 C;  2DVJ A;  1GBR A;  4HXJ A;  4RTY A;  2E41 A;  2R57 A;  1VA7 A;  3RKW A;  2X9H A;  2LDM A;  1K76 A;  1YJW T;  5GAO n;  1TWB A;  5GMK l;  1Q7Y R;  2L0A A;  1UE9 A;  1PHT A;  3QYG B;  3HRU A;  1WGS A;  2XDB A;  2CP6 A;  4M7A B;  3UA6 A;  4M77 D;  3CCE Q;  3CC4 Q;  1D3B A;  4OMP A;  1I0C A;  1X6G A;  3H0F A;  3CCS Q;  2HNI A;  1OI1 A;  2P4T A;  4AFS C;  2DF6 A;  2ENM A;  2LJ0 A;  1N6A A;  1SG5 A;  4IUU A;  3CCQ A;  2JN0 A;  3CPW A;  2E3H A;  4M7A C;  1W6X A;  3HHT B;  4ZGE B;  2HMA A;  3QDF A;  1NEG A;  2YLB A;  1RAG B;  2DXB A;  1IHW A;  5I11 A;  1KG1 A;  2E3I A;  3S3M A;  4DBR A;  1N8R R;  1VQK A;  4CI0 C;  1UDL A;  4JS5 A;  1K73 R;  2ZAE A;  4X1V A;  4NL2 A;  1IO6 A;  1TG0 A;  1N9R A;  2YUO A;  2D6F A;  1RAH B;  3M58 A;  4M4Z A;  2QEX Q;  3CQT A;  4RCB A;  5FU6 B;  3I55 A;  4BI8 B;  1RUW A;  2XHC A;  4E6R A;  4WF2 A;  2Y4Y A;  4PFP A;  1VQN T;  1XNI A;  5IT9 E;  1IZ6 A;  1D0Y A;  1XTD A;  4QQD A;  1TUG B;  3PFS A;  3VV0 A;  3SEM A;  3LGL A;  3RMQ A;  1G83 A;  1WHH A;  1VQ6 Q;  2LCC A;  2O4X B;  2YRC A;  2E1H A;  4A4H A;  4PJO B;  5IH2 A;  4J5Y A;  4M77 A;  3QJ6 A;  4L59 A;  1T0J A;  3MEV A;  4OGC A;  3UA7 A;  1LJO A;  4C5G A;  1QWF A;  3CC7 Q;  4RMO A;  4HCC A;  4FL6 A;  3OS1 A;  1NE8 A;  2K9G A;  3V7R A;  3CCR Q;  1S72 T;  2JTE A;  3GLX A;  1GXI E;  3JV3 A;  2DXT A;  1OZ2 A;  3EH2 A;  4UC4 A;  3V8K A;  2CZ6 B;  1UUE A;  4JDS A;  2JTM A;  1VQK Q;  3P8H A;  2JMA A;  4O5V A;  3NPF A;  5DLO A;  2JS0 A;  2K57 A;  4RCC A;  2JTF A;  4KGX B;  2A28 A;  2CDT A;  4IUT A;  3OA6 A;  4BY6 C;  2JM8 A;  2OTL A;  3L1A A;  4OB1 B;  4L5G A;  5I21 A;  2HCK A;  4IIM A;  2MCN A;  1X6O A;  1M1G A;  1VQ7 A;  4F04 B;  1A0N B;  4PJO A;  2LX7 A;  4M77 B;  3JAM E;  1BIA A;  3VYH B;  3M5A A;  3O5Z A;  1QVG P;  3PVL A;  1YNZ A;  2FZC B;  2KSS A;  5GAN 5;  1K9A A;  1VQM A;  4XTX A;  1KJW A;  2JM9 A;  2L3S A;  3HRT A;  3QG1 A;  2L3R A;  2JW4 A;  2YXY A;  1Q86 R;  3L2Q A;  2QQR A;  2ZPE B;  2BTT A;  2I2L A;  4C92 E;  1AWO A;  1X69 A;  1OX9 A;  3OQ5 A;  1I5O B;  1YJ9 A;  3LW5 E;  4XQ3 A;  1ZSZ B;  4E7S A;  2PQW A;  1EFN A;  2QQB A;  4QVD A;  4M7A A;  4JJC A;  2EYZ A;  2ZZD A;  1W2B S;  3INZ A;  4M75 D;  1OU9 A;  1CKA A;  3V8L A;  5I2M A;  1ZLM A;  1VQM T;  1SHF A;  3M0T A;  1QVF S;  2YUN A;  1B34 B;  2KY9 A;  3EFO A;  2FHD A;  2HBP A;  4C0G A;  3JCM W;  1NLO C;  3M9Q A;  3OW2 P;  4PJO F;  2QTV A;  2V1R A;  3OYI A;  1VUB A;  2MYS A;  3P8B B;  2VKN A;  2EAY A;  2FL7 A;  3RBB B;  4E2F B;  3O8V A;  4PJO C;  1G8X A;  2FZG B;  1I07 A;  2CP5 A;  1H8K A;  1Y0M A;  5LJ5 d;  2QXF A;  3URG A;  1YIJ T;  3JCM d;  2RQW A;  1RAF B;  1M90 C;  4QQ6 A;  4PJO G;  2COY A;  3HSB A;  1HYO A;  1KQ2 A;  1PRL C;  3OS2 A;  5IHI A;  2GGR A;  4AG1 C;  1MMG A;  3VS2 A;  2C0T A;  4PJO D;  5GAO m;  1QQJ A;  2CS7 A;  5FU6 C;  3OSS C;  2XU8 A;  2M9U A;  1UG1 A;  2EJ9 A;  2X4Y A;  1VQ8 A;  2RO0 A;  2QTX A;  2C0O A;  5HK0 A;  3E2U A;  4DOW A;  4JRP A;  4BI4 A;  1VQ5 A;  1C0M A;  1KIK A;  4B6M A;  4J6Y A;  1GCQ A;  2LZ6 B;  3HKS A;  4CRI A;  2DNU A;  2F1L A;  1K73 C;  1G3W A;  3LWH A;  2RN8 A;  5LL6 S;  1KC8 U;  3QDR B;  2D0Q B;  1FMW A;  1KHC A;  1VIF A;  2CYZ B;  3DB3 A;  2RI5 A;  4WTO B;  4QVZ A;  3RKY A;  3MP6 A;  3E19 A;  4X9D A;  3I56 T;  1TTH B;  1X43 A;  4CC7 A;  1H3H A;  2EVR A;  2R5M A;  1BIB A;  1V76 A;  1D1C A;  1OZ3 A;  3VRZ A;  1FXX A;  4WCI A;  4HVW A;  2YT6 A;  1NM7 A;  3X25 B;  1VQP T;  3KFV A;  2JOY A;  4O6J A;  1LNX A;  3G71 T;  1FWZ A;  3JCM f;  1ZSG A;  2ESW A;  2IIM A;  2RI2 A;  3AT1 B;  4D8K A;  3C4S A;  3OYH A;  5LJ5 h;  4FT2 A;  4R55 A;  1N8R U;  2D0N A;  1HD3 A;  3M0P A;  4DOV A;  4RG8 A;  2DLP A;  2G6F X;  1BI3 A;  2RHI A;  3QYH B;  1QCF A;  4RTW A;  4D6W A;  2RMO A;  1BU1 A;  1JXO A;  3CBO A;  4DBF A;  3H9N A;  3A8G B;  2EKH A;  3M0Q A;  2NLU A;  1VQ7 Q;  2QGF B;  2LQW A;  2MOX A;  2HEQ A;  5LJ5 f;  1O9S A;  2FRY A;  3PMT A;  1M27 C;  4NL3 A;  3CMA A;  2JXB A;  4BB7 A;  1ZUY A;  5CCA A;  4MZM A;  4ZGD B;  3AHU A;  4N0A A;  1M8M A;  3M55 A;  1VQ4 T;  2MF2 A;  4ZTF A;  1ABQ A;  1TXQ A;  1D0X A;  3JB9 F;  2MWO A;  1YIJ A;  4IUR A;  2K2M A;  2EYW A;  2EQM A;  4E7Z A;  1OX8 A;  3QWX X;  3NGP A;  3T9N A;  4RTU A;  1YJW Q;  4M7D A;  5M9O A;  4CC2 A;  4C8Q E;  2GF7 A;  1SF9 A;  4MZP A;  2K5F A;  5IN1 A;  2AT1 B;  2RM4 A;  2R58 A;  4J9I A;  1ZSZ A;  3VRY A;  3I5S A;  5GJV B;  1OPL A;  3VYG A;  2KYM A;  2DL5 A;  4MDX A;  2SRC A;  3S6W A;  4KBM B;  4FIB A;  3WVE B;  2CZ0 B;  4ZTJ A;  1X2Q A;  2QA4 A;  1Z9Q A;  1F1B B;  3E9G A;  2WSE E;  1TS9 A;  1YJN Q;  1MNE A;  2IG0 A;  4OMN A;  4LDV A;  3CC2 A;  4R0K A;  4LDU A;  2DIG A;  4HKE A;  1Y96 A;  5FWC A;  3RR6 A;  4MML A;  4M7A G;  5J3B A;  4M75 E;  2ZPI B;  4F16 A;  1M1K U;  2MIO A;  2Y4X A;  3C94 A;  4J9F A;  2K6D A;  4M7D B;  2FVU A;  1YIJ Q;  2OTJ T;  1PKT A;  1QVP A;  3GBQ A;  2WSC E;  2RQR A;  2EFI A;  4K11 A;  1U06 A;  3L2U A;  3QII A;  1LPL A;  1VIE A;  4P5N A;  1OOT A;  4F7U F;  4NS5 A;  2E4H A;  5IHN A;  5HCK A;  4ESR A;  3CPF A;  1H92 A;  3E9F A;  2DYI A;  3OYE A;  2DL4 A;  3I56 A;  3TEE A;  2EPD A;  2DD4 A;  1QMC A;  3JCM V;  4A4E A;  1OU8 A;  5D6X A;  1ABO A;  5J26 A;  1C1A A;  1TUC A;  2NYS A;  4FYX B;  2QDL A;  3VS1 A;  1MGQ A;  2BIV A;  4DEY A;  3ZL7 C;  2XG8 D;  4EMK B;  3TCJ A;  2MWP A;  4F7U G;  2CZ7 B;  5EG2 A;  1AWX A;  2IPO B;  3LGF A;  4J6W A;  1X75 C;  3KXT A;  3JCM J;  4ZN3 A;  4LD6 A;  1SEM A;  2BZY A;  3ME9 A;  2K5I A;  4KT0 E;  3WXM B;  3G6E T;  1C6V X;  4FYV B;  1VQ8 T;  4C8Q A;  3VS6 A;  2ZPG B;  3A8L B;  3M54 A;  4PJM A;  1O75 A;  3MJX A;  2L8D A;  2DEQ A;  4J6X A;  4OMM A;  3S3N A;  3TRE A;  2E6N A;  1SRM A;  2OTJ Q;  1YI2 Q;  5A2Q E;  4FSS A;  4PJJ A;  3QKJ A;  4A54 A;  1SPK A;  1UEB A;  1M3A A;  1WQW A;  1RI9 A;  5FRO A;  3EGD B;  3C0C A;  2X51 A;  1LOJ A;  5GAO r;  4LE9 A;  4PJL A;  2B86 A;  3BFM A;  1U5S A;  3OMG A;  1ZHI A;  2DIQ A;  4PL6 A;  2M16 A;  3CCU Q;  4LDX A;  2VYT A;  2DXU A;  1AHJ B;  2L89 A;  1AVZ C;  3OYB A;  4IUP A;  1Y7X A;  2EGC A;  1OUL A;  4ZNX A;  2LT1 A;  1X2K A;  1WJS A;  1QCN A;  2M0Y A;  3M4G A;  3UT1 A;  1AWW A;  4M78 D;  3CXC P;  3RIR A;  1E6H A;  4E7L A;  3J7A F;  5IAY A;  1WXU A;  5GAM f;  3VUZ A;  4J83 A;  1QWE A;  1YJN A;  3JB9 I;  1YHQ Q;  4IIO A;  4PLL A;  2DXC A;  4M75 B;  5KYU B;  2KE9 A;  1D09 B;  2HKN A;  5CKB A;  1Y07 A;  1GFD A;  4LDW A;  1W2B A;  5GAM j;  1ACM B;  3X26 B;  5GAO p;  2KK4 A;  3HL8 A;  1YCY A;  5LJ5 e;  1FX7 A;  4B9X A;  1WFW A;  1SKU B;  2X3W D;  2A7Y A;  3PIO A;  3QPH A;  1UGR B;  2E10 A;  2QQS A;  2QEX A;  5DM7 R;  1VQL A;  3DB4 A;  1SRL A;  5LJ5 j;  2I0N A;  2E64 A;  2PVD B;  1GCQ C;  2DZ9 A;  4IUV A;  3CD6 T;  1QKX A;  4JZ3 A;  3GF5 A;  5CQX A;  1W4S A;  1X27 A;  3MCA B;  1UGS B;  2HQH A;  2NUT A;  3REB B;  4XU1 A;  2OTL Q;  1G3Y A;  3FJ5 A;  2LNH B;  4M78 G;  1KQS S;  3JB9 H;  2RHX A;  1YP5 A;  1NLP C;  2GCX A;  2DL8 A;  2CT3 A;  1E6G A;  2LRQ A;  1FYN A;  2VXF A;  2NWM A;  2QYZ A;  4LDY A;  5GAM e;  4FYY B;  2GQV A;  5GMK e;  2YRV A;  1M2V A;  4F14 A;  3UDC A;  3R6O A;  5KYY B;  1S72 A;  2DYB A;  1AT1 B;  1Q7Y C;  1I1J A;  5HK3 A;  3OBW A;  2A0F B;  5GAN e;  2FB7 A;  2J6F A;  1M3C A;  2EYY A;  4FM4 B;  1Q82 R;  3D7S B;  5GAN 8;  1T3L A;  2F2X A;  3SHW A;  2CH4 A;  1H64 1;  2YSQ A;  4KUI A;  2FPE A;  2CKK A;  3JCM b;  1I8F A;  2FYK A;  3MO8 A;  4QT7 A;  2QQA A;  1Y71 A;  5CVI A;  2COW A;  2V26 A;  4C0D B;  4QQG A;  3EG2 A;  3M4Y A;  3MP1 A;  5AT1 B;  3OB9 A;  4OMF B;  8ATC B;  1YIT Q;  1N8R C;  2VXE A;  3MP8 A;  4C8Q B;  1VQO A;  5D6Y A;  3CCR T;  3CBP A;  2V8I A;  3PNW C;  3EGX A;  4XAX B;  4OMQ A;  2JMC A;  4X9C A;  1D1A A;  1OV3 A;  4C92 B;  5KYW A;  2M51 A;  5KYY A;  2LVM A;  3GPL A;  1K0S A;  3QUI A;  5FU7 C;  4IKF A;  3DLM A;  1MND A;  3JCM e;  5KCH A;  1JEG A;  2K4Y A;  2C0I A;  1PD0 A;  2RK1 A;  2LJ1 A;  4HCB A;  2XDD A;  1K4U S;  5KE3 A;  2RF0 A;  4OB0 B;  3LYI A;  2LT4 A;  1UJ0 A;  1JJ2 P;  3CME T;  1QP2 A;  2LQK A;  7AT1 B;  4A4G A;  1YWO A;  3A8O B;  1KD1 R;  1QP3 A;  4M78 E;  4YTL A;  3GP8 A;  1GBQ A;  4EMG A;  5LJ3 f;  5FW9 A;  1UGV A;  2PUO B;  4C8Q G;  4BE1 A;  2OX7 A;  2DPP B;  4J9C A;  5KYU A;  3OS0 A;  2OAW A;  4AG2 C;  1PNJ A;  5DLQ E;  2PVO B;  3C12 A;  2DX1 A;  3FDR A;  4NOY A;  1QVF A;  1HK9 A;  2M0O A;  2RHY A;  2A3L A;  2C06 A;  1WHM A;  1WDX A;  1I81 A;  1PKS A;  2CH4 W;  4RTV A;  3P8D A;  3QWY A;  2X3X D;  4OVA A;  1PD1 A;  5CK9 A;  4QVC A;  1B34 A;  1VQ9 T;  3CCS T;  1VQ9 Q;  2X4J A;  3EG1 A;  3VU3 C;  4RTZ A;  1H3Z A;  5KE2 A;  2ZPH B;  3JSC A;  2MMP A;  2DTI A;  2CSQ A;  2QGG A;  4JRI A;  3SB2 A;  5CKD A;  3CCQ Q;  4MDW A;  3A1P A;  3J81 E;  2X4W A;  3X28 B;  2PZ1 A;  2F69 A;  2CZ1 B;  4DQ2 A;  4BDY A;  5GAM g;  2KQW A;  4N0A C;  1NJI U;  2DFU A;  2RJD A;  2QQ9 A;  2ZGW A;  3CXC A;  4M77 G;  5GAM h;  1ZUU A;  2E5Q A;  1JJ2 S;  2KYB A;  2CUD A;  3JCM c;  2DE0 X;  4A53 A;  1AWJ A;  4A4K A;  1B3Q A;  3I35 A;  4N4I A;  4BD3 A;  1GFC A;  4II1 A;  1KK7 A;  1ZBX A;  1UGP B;  1Q86 C;  1N27 A;  4PNO A;  2LJ3 A;  1M2V B;  3H6Z A;  2KT8 A;  3VJP A;  2LQ8 A;  4FU6 A;  3M0S A;  1RAI B;  4J7F A;  3SWN C;  2XK0 A;  2X4X A;  2HDA A;  2A37 A;  3ZBD A;  2K79 A;  2O2O A;  2QAS A;  3L2Z A;  1T3S A;  4KGZ B;  1U8R A;  4LD9 K;  1V1C A;  1UB4 A;  4BI3 A;  1VQ6 T;  2QA4 Q;  2BUD A;  3BE3 A;  2QA4 T;  4CC4 B;  3PE0 A;  2X35 A;  4JJN K;  1K0X A;  1VQ9 A;  3CPW S;  2RD1 A;  1YJN T;  1BBZ A;  1D0Z A;  3RKX A;  1WLP B;  1WXT A;  1WHJ A;  3G6E Q;  1JO8 A;  1LCK A;  4M75 C;  3SWN B;  1WZO A;  4M7D E;  3PGG A;  2PNI A;  5GAN f;  5HY6 A;  1R77 A;  1J3T A;  2CP2 A;  4EPC A;  1TSF A;  2RB6 A;  3EHQ A;  4EIK A;  1OPK A;  3L2R A;  2RNA A;  3CC7 T;  2VUB A;  1SSF A;  1Q82 U;  3UF4 A;  2DA9 A;  3JCM h;  1D1B A;  1S72 Q;  1VQ5 Q;  3CCE T;  1ZQ1 A;  4C92 A;  1KQ1 A;  3JB9 G;  1B07 A;  4PFO A;  3UPU A;  2A36 A;  1QLY A;  1K1Z A;  1TH7 A;  3JCM g;  3NHN A;  4J7I A;  2EQI A;  1QVF P;  3ZFJ A;  4XTU A;  3JB9 D;  1U3O A;  5I2S A;  2E5K A;  4OF1 A;  3CCM T;  3FRN A;  3MEU A;  3QZ5 B;  5GAM d;  4Y92 A;  4DA4 A;  4BE0 A;  2DO3 A;  3SD4 A;  4ZN1 A;  1WJR A;  2WSF E;  3QXE B;  4Y28 E;  3KUF A;  2CGH A;  1MMD A;  2HSP A;  4C5I A;  2KR3 A;  3H8Z A;  1ZA2 B;  3DKM A;  1LVK A;  2VVK A;  2YRD A;  5LJ3 g;  4XTZ A;  3G4S A;  2CT4 A;  2ROL A;  2ATC B;  2O4X A;  2ZPF B;  1BI1 A;  4GBQ A;  5LJ3 h;  4KGV B;  4HCK A;  4HVU A;  1UJY A;  1EIF A;  4JLG A;  3CCR A;  2JT4 A;  3VKI A;  1Q81 C;  5GAN j;  2J6K A;  4Z02 A;  1QVG S;  3NTI A;  2CP7 A;  3I5R A;  1U1S A;  1M1K R;  2KAF A;  3CCL Q;  3CCJ T;  1WI7 A;  3CCL T;  1V29 B;  2JJ9 A;  3FLG A;  5GAN 3;  3R6N A;  3JCM X;  2HQE A;  1G3S A;  5LJ3 e;  2LMJ A;  5A0D A;  1YHQ A;  2DTO A;  4JPB W;  4N4G A;  5FWB A;  2V1Q A;  3MEA A;  2ABL A;  3OYN A;  5D6W A;  4KUL A;  1NEB A;  2DK3 A;  4MMK A;  5D7U A;  3THK A;  4AMC A;  3OYK A;  3EH1 A;  5GMK h;  3GNG A;  3CCV A;  2RJF A;  2LNV A;  5C0M A;  1VQ4 Q;  5FU7 B;  1KQS P;  3J80 E;  2EKO A;  3RES A;  1KD1 C;  2BZ8 A;  1YBY A;  1B7T A;  3TU4 K;  2RJC A;  4QW2 A;  1MV0 B;  1QCO A;  3CC7 A;  1RL2 A;  3LLR A;  3EFR A;  1PCX A;  5IXF A;  5DY9 A;  1YIT T;  3OYD A;  3OMC A;  5EC7 A;  2D8H A;  1PRM C;  4XU0 A;  2PUK B;  4C5E A;  4ATO A;  3QSU A;  4DBQ A;  1PG5 B;  3C95 A;  2HBW A;  1K9M C;  3FJP A;  2ED1 A;  1QVG A;  3VUB A;  2OJ2 A;  2CUB A;  2EQJ A;  2COZ A;  2GFU A;  2L3Q A;  4EMK A;  1BCM A;  2DBM A;  2FG0 A;  4AFU C;  2DZC A;  2M1H A;  4Y91 A;  4PFZ A;  4MZT A;  1GRI A;  4PJN A;  1M2O A;  6AT1 B;  2VV5 A;  1TUD A;  1FMV A;  1R8O B;  5CIU A;  5AYF A;  4X34 A;  3BDU A;  4XTY A;  3L2V A;  4M77 C;  2AZV A;  3LH5 A;  2YUQ A;  1VQL T;  4JJD A;  4C5H A;  2MAM A;  3OYL A;  3WVD B;  3EFO B;  1VQ4 A;  3MET A;  5FRM A;  1JBM A;  3TVT A;  2OI3 A;  4M75 F;  2KRM A;  4BY6 B;  1IGQ A;  1YHQ T;  1K8A C;  1Q7Y U;  3EGD A;  3KBG A;  2E70 A;  4FW1 A;  2VWF A;  3VS5 A;  5LJ5 g;  2JS2 A;  3CCL A;  3MHX A;  4FYW B;  3OSV A;  4OMO A;  1RAB B;  3EG9 A;  4PKC C;  2VGM A;  1RAE B;  4LUE A;  4DEX A;  4E47 A;  2RQU A;  1MV3 A;  2K3Y A;  5L8R E;  1OEB A;  3G1J A;  3OW2 S;  1WPY A;  4E7I A;  3PT9 A;  1GL5 A;  2FZK B;  1KC8 C;  1RLQ C;  1Q86 U;  2QG9 B;  1WHL A;  3G4S T;  1D3B B;  4C8Q D;  2QAZ A;  4LUD A;  3CCS A;  1VYU A;  4Z88 A;  3QZ9 B;  3MKD A;  3L42 A;  4ANJ A;  2DL7 A;  2JZ2 A;  1VQP A;  3CC4 A;  1OYX A;  5LJ3 j;  2DMO A;  2E12 A;  2GTO A;  1AD5 A;  2RHZ A;  5GAN h;  1KFZ A;  2XID A;  1WQ7 A;  3I56 Q;  1K73 U;  1BI2 A;  1JU5 C;  2KXD A;  1UHF A;  3GOX A;  5CR2 A;  1EX4 A;  2EQU A;  4C8Q C;  2HL5 C;  1SSH A;  1VQP Q;  4JJB A;  2PU9 B;  4JS4 A;  4J9D A;  4TVR A;  1MUZ A;  2PVG B;  5GAO q;  2VGN A;  4C8Q F;  2XIC A;  3FC3 A;  3G71 Q;  5LJ3 d;  3ER0 A;  3PIP A;  4J9H A;  1BK2 A;  2KT1 A;  3VS3 A;  8AT1 B;  2Z0W A;  3OYG A;  3A5Z B;  3CC4 T;  2H3J A;  1P92 A;  1XQH A;  3REA B;  4RG2 A;  3EAE A;  1IXD A;  3CCJ Q;  3VS4 A;  2R5A A;  2GNC A;  3M0R A;  3N5B B;  3G4S Q;  3A8H B;  2ROT A;  1NG2 A;  1FMK A;  1AZE A;  3RUX A;  2RK2 A;  4ZGJ B;  3QJY A;  1KHI A;  2LX9 A;  4N4H A;  2AZS A;  2XMF A;  4F7U A;  5I22 A;  4JZ4 A;  4C92 D;  2DAQ A;  3I9Q A;  2DRM A;  2O31 A;  2RA2 A;  1ARK A;  5A0G A;  2NUP B;  2XDP A;  3F70 A;  2RH2 A;  3OY9 A;  1VQ6 A;  1OQK A;  3E1S A;  4XTV A;  3OS5 A;  4HT9 A;  4KRT A;  1SHG A;  2EIF A;  4A4F A;  2RPN A;  4BDZ A;  1VQO T;  3BDL A;  3FEO A;  3OBY A;  2XI9 A;  2YHT A;  1CKB A;  2EQK A;  3CD6 A;  3PVQ A;  2DL3 A;  4RTT A;  2VC8 A;  4HT8 A;  4J9G A;  1Q81 R;  1ZBJ A;  4RUG A;  2ED0 A;  2DM1 A;  2CP3 A;  2DJQ A;  3DLL A;  4EDU A;  2QEX T;  1HJD A;  4OB3 B;  3ASK A;  3ULR B;  1VQK T;  1IGU A;  4ORZ A;  3JCM Q;  1GCP A;  4LXC A;  2RQT A;  4OP0 A;  1TU0 B;  4EMH A;  1UEC A;  1NJI C;  4J8O A;  3H0I A;  4M7D D;  1NYF A;  4C0Z A;  5GAN 6;  2FEI A;  2P0K A;  3H0H A;  4EMK C;  1Y96 B;  4ME7 A;  4KH1 B;  4LN2 A;  5GAN 7;  4M7D G;  2XKO C;  3CCQ T;  4GLM A;  2L5Q A;  3QBY A;  5CKH A;  1UFF A;  4FW2 A;  5KYX B;  2NUP A;  3RER A;  1VQO Q;  2KRN A;  4XTW A;  1YIT A;  5GMK m;  4M7D C;  2EJG A;  2M02 A;  3OYY A;  3EHR A;  1M90 R;  4C0F A;  2YWW A;  5KYW B;  1KSW A;  1WHK A;  4XU2 A;  4M7D F;  5IHK A;  1YJW A;  1KC8 R;  2J6O A;  2P0Q A;  2Y90 A;  3EG0 A;  4M7A E;  2K5L A;  2PTK A;  1PM3 A;  4GY5 A;  2KI7 A;  4JUV A;  1IB8 A;  1R0C B;  3CCV T;  4QKU A;  3EG9 B;  1K9M R;  1MMN A;  3M59 A;  2BKD N;  1K8A U;  3CPW P;  1PSF A;  2OAU A;  3IQL A;  2P4R A;  3UWN A;  3EGU A;  1M1F A;  1MHN A;  2XD0 A;  2KEA A;  1WHG A;  2JUF A;  3MPU B;  2QDY B;  5GAN d;  3CCU T;  2DKG A;  2MPX C;  3CCJ A;  1XOV A;  2NUZ A;  5KH6 A;  1IRE B;  2DTH A;  4AFZ C;  2HAX A;  1VQL Q;  3JCM P;  2FPD A;  5IXB A;  5GMK j;  2KXC A;  3NMZ C;  1AEY A;  2DER A;  4PJO E;  1YCS B;  4Z8A A;  3CME A;  2DIL A;  3M0U A;  1UGQ B;  2FPF A;  1K8A R;  2J7I A;  3LX7 A;  5GJW B;  1W1F A;  2LP5 A;  4FT4 A;  3HPW A;  2GQI A;  4LNP A;  5A0L A;  2YUP A;  1ZUK A;  1VQN A;  2B8A A;  2AK5 A;  2DVE A;  2ECZ A;  1KQS A;  1WIE A;  4E7K A;  4D8D A;  2F2W A;  5KYN A;  4DBH A;  1U1T A;  1IHV A;  1G3T A;  2KGT A;  1I4K 1;  5KCO A;  1VYT A;  4FCY A;  3CCM A;  2FO0 A;  1ZX6 A;  2DD5 A;  2W0Z A;  4J9B A;  4RKU E;  4HCZ A;  2EWN A;  3U23 A;  1KD1 U;  5C6S A;  2AKL A;  1RAD B;  1RLP C;  4AFQ C;  9ATC B;  3LWI A;  3GIB A;  1N9S A;  2AKK A;  3OYM A;  1R0B G;  4KH0 B;  2DET A;  2K2V A;  3RMS A;  3EFS A;  1N5Z A;  1WX6 A;  4F7U B;  1YWP A;  3MEW A;  2W10 A;  4M78 A;  1WA7 A;  5CAI A;  3NTK A;  2L2P A;  1WNL A;  4M7A F;  1QKW A;  1EZZ B;  4M77 F;  1AOJ A;  2QI2 A;  3CBM A;  1Q81 U;  2MI6 A;  5CKE A;  1G5V A;  3CMA Q;  1E7O A;  2KMT A;  3S3O A;  4RTX A;  1JRI A;  2EW3 A;  4Z89 A;  2RJE A;  2IVW A;  4BE2 A;  2ZCF B;  3M57 A;  2EGA A;  3PMI A;  4CC3 A;  1YJ9 Q;  4Q5W A;  5CO7 A;  4HA8 A;  1M9S A;  1HSQ A;  1RI0 A;  4M75 A;  3CEY A;  2EYX A;  3TQ7 P;  3M53 A;  2H3E B;  2O9V A;  3QHS A;  4M78 F;  3QO3 A;  2HQX A;  4M7A D;  2HSE B;  5GAO l;  2NUT B;  5L23 A;  3PTA A;  1VYV A;  1M30 A;  2K3B A;  3V7C A;  2O9S A;  5FRN A;  1VQM Q;  1IRX A;  1MMA A;  2KBT A;  1RAA B;  5HKC A;  1JJ2 A;  4PLI A;  2J06 A;  2K7A A;  1BCO A;  1YFN A;  2LC4 A;  2YLC A;  2VB6 A;  1NPR A;  4M77 E;  2LTO A;  2H8H A;  3CCM Q;  2FRW A;  1WYX A;  1PSE A;  2MK5 A;  2LQN A;  3SWN A;  3OYJ A;  4M78 B;  2SEM A;  4XU3 A;  4B9W A;  1M8V A;  5KYX A;  3OW2 A;  4M78 C;  4ELY C;  5GMK i;  4E7H A;  4A63 B;  2LCL A;  1WXB A;  1BYM A;  2BZX A;  3CMA T;  2O01 E;  2EJF A;  1YJ9 T;  1K9M U;  1M4Z A;  2CSI A;  1W2B P;  2KNB B;  3VS0 A;  2A08 A;  2DEU A;  2K3X A;  1W70 A;  2EGE A;  4V2S A;  4C92 F;  1NBE B;  1DJ7 B;  2LCS A;  2ZPB B;  4L6V 5;  1BKB A;  1QW1 A;  4PK4 A;  3CXC S;  2DRK A;  3BY7 A;  1NJI R;  2KRS A;  1JQQ A;  4F17 A;  3G71 A;  5CQY A;  1X6B A;  1VQ7 T;  2P0P A;  1VQN Q;  1ZA1 B;  1TOV A;  3Q1J A;  3RDV A;  2CRE A;  4JRK A;  2OTL T;  1M3B A;  2G3R A;  5FLX E;  1YN8 A;  3HRS A;  1BI0 A;  3TSZ A;  1T0H A;  4M75 G;  2D9T A;  1ZSZ C;  3A98 A;  2DJZ A;  4BAC A;  2E65 A;  3VS7 A;  3I55 Q;  2F5K A;  2HZY A;  5ECA A;  3HFO A;  4C92 G;  4ELZ C;  5GAN g;  1UTI A;  2RQV A;  3FIF A;  4FSX A;  2HKQ B;  3HFN A;  2RI3 A;  1VOM A;  2BE9 B;  5J39 A;  2GBQ A;  1VQ5 T;  4J9E A;  2F2V A;  3CCE A;  3HTR A;  3OYA A;  1Y57 A;  2JVV A;  3X24 B;  2P84 A;  4R56 A;  1M5Q 1;  2F5T X;  4OB2 B;  2V8J A;  3UAT A;  1CSK A;  3CCV Q;  1PWT A;  2EYQ A;  1YI2 T;  4VUB A;  1M90 U;  2BE7 D;  4OML A;  3V8J A;  2O88 A;  3EGX B;  2GTJ A;  1YI2 A;  1UHC A;  1HXD A;  3G6E A;  2RHU A;  3H41 A;  2JNG A;  1NYG A;  3TSW A;  2HD0 A;  1X01 A;  2V8K A;  1AZG B;  2D8J A;  4IUQ A;  2DBK A;  1WJQ A;  1JXM A;  2HL3 A;  4BUG A;  4OGE A;  2WAC A;  4AT1 B;  1S1N A;  2EBP A;  3NTH A;  2VAS A;  4KUD K;  3I55 T;  3NFC A;  3V7S A;  3LH0 A;  3ZEH A;  4C0D C;  3RNJ A;  3SFM A;  3JB9 J;  4F7U E;  1RAC B;  2KRO A;  2GFA A;  1VQ8 Q;  2QK0 A;  2AHJ B;  3BW1 A;  3GNF B;  5GAN 2;  3M56 A;  1Z9Z A;  2KDS A;  4E7J A;  4XK8 E;  3X20 B;  5GAN 4;  1G2B A;  2KVQ G;  4JLI A;  2L3P A;  2D1X A;  1M1K C;  1NPP A;  2OTJ A;  1XJW B;  4HVV A;  4GLK A;  3EG3 A;  2YDL A;  3CME Q;  1Q95 G;  2E6Z A; 
#chains in the Genus database with same CATH homology
 3QWX X;  2CSQ A;  3NGP A;  4RTU A;  1CKB A;  1BB9 A;  3PVQ A;  4CC2 A;  2DL3 A;  4RTT A;  2PZ1 A;  4J9G A;  1ZBJ A;  4J9I A;  4RUG A;  2ED0 A;  2DM1 A;  2DJQ A;  2J05 A;  1HJD A;  3VRY A;  3ULR B;  3I5S A;  5GJV B;  1OPL A;  2KYM A;  4ORZ A;  2DL5 A;  1GCP A;  1ZUU A;  2SRC A;  2RQT A;  2KYB A;  2CUD A;  2DE0 X;  2DVJ A;  1UEC A;  1GBR A;  1AWJ A;  4HXJ A;  4RTY A;  1B3Q A;  3H0I A;  1NYF A;  3I35 A;  1VA7 A;  1X2Q A;  2FEI A;  1Z9Q A;  1GFC A;  3H0H A;  4LN2 A;  1K76 A;  4GLM A;  2LJ3 A;  2L0A A;  1UFF A;  4OMN A;  2KT8 A;  1UE9 A;  1PHT A;  4R0K A;  3UA6 A;  3M0S A;  2KRN A;  4OMP A;  1I0C A;  5FWC A;  1X6G A;  3H0F A;  2HDA A;  2A37 A;  3EHR A;  4F16 A;  2K79 A;  2MIO A;  1KSW A;  2O2O A;  4AFS C;  2DF6 A;  2ENM A;  2LJ0 A;  1T3S A;  4J9F A;  5IHK A;  2K6D A;  1V1C A;  2J6O A;  1PKT A;  3GBQ A;  2RQR A;  3EG0 A;  4K11 A;  1U06 A;  2PTK A;  4CC4 B;  1W6X A;  3PE0 A;  1K0X A;  1NEG A;  1OOT A;  1BBZ A;  5IHN A;  5I11 A;  1WLP B;  1WXT A;  1JO8 A;  5HCK A;  4ESR A;  1LCK A;  1H92 A;  3IQL A;  2P4R A;  2DL4 A;  1UDL A;  2PNI A;  3EGU A;  2EPD A;  1J3T A;  2KEA A;  4EIK A;  3EHQ A;  1OPK A;  2RNA A;  4X1V A;  1ABO A;  1TUC A;  3VS1 A;  2QDL A;  1IO6 A;  4DEY A;  3ZL7 C;  1TG0 A;  3UF4 A;  2DA9 A;  2YUO A;  1XOV A;  2NUZ A;  4AFZ C;  1AWX A;  4M4Z A;  3CQT A;  1B07 A;  2A36 A;  1QLY A;  1K1Z A;  2FPD A;  5IXB A;  2KXC A;  3NMZ C;  1AEY A;  1SEM A;  3NHN A;  2EQI A;  1RUW A;  1YCS B;  2BZY A;  4Z8A A;  2DIL A;  1U3O A;  3M0U A;  4E6R A;  2FPF A;  2J7I A;  2E5K A;  5GJW B;  3VS6 A;  4Y92 A;  1W1F A;  2LP5 A;  4OMM A;  3SEM A;  1G83 A;  1SRM A;  2GQI A;  4LNP A;  2YUP A;  1ZUK A;  2HSP A;  2AK5 A;  4FSS A;  2ECZ A;  5IH2 A;  2KR3 A;  1SPK A;  1M3A A;  1WIE A;  4D8D A;  1RI9 A;  2VVK A;  1T0J A;  2F2W A;  3C0C A;  3UA7 A;  4LE9 A;  1QWF A;  2KGT A;  2CT4 A;  1VYT A;  2ROL A;  1U5S A;  2B86 A;  2FO0 A;  1ZX6 A;  2W0Z A;  4J9B A;  4GBQ A;  3U23 A;  2AKL A;  1AVZ C;  4HCK A;  4HVU A;  1RLP C;  4AFQ C;  2K9G A;  1UJY A;  2EGC A;  2JT4 A;  4ZNX A;  2JTE A;  2AKK A;  1X2K A;  2J6K A;  3JV3 A;  3I5R A;  1N5Z A;  1WX6 A;  1YWP A;  1UUE A;  2M0Y A;  1WA7 A;  1WI7 A;  2W10 A;  2L2P A;  1AWW A;  1QKW A;  3R6N A;  1AOJ A;  1E6H A;  2LMJ A;  2JMA A;  1WXU A;  3NPF A;  1E7O A;  1QWE A;  2JS0 A;  4JPB W;  5FWB A;  4IIO A;  2V1Q A;  2ABL A;  2A28 A;  2KE9 A;  2CDT A;  4RTX A;  1NEB A;  2EW3 A;  3THK A;  4Z89 A;  1GFD A;  2JM8 A;  2EGA A;  4CC3 A;  2HCK A;  4IIM A;  2MCN A;  1HSQ A;  1A0N B;  2EYX A;  2LX7 A;  1WFW A;  2X3W D;  2O9V A;  2BZ8 A;  3O5Z A;  3PVL A;  5L23 A;  1YNZ A;  1VYV A;  1M30 A;  2K3B A;  1MV0 B;  1SRL A;  1K9A A;  2O9S A;  2I0N A;  1KJW A;  2KBT A;  1GCQ C;  2JM9 A;  1QKX A;  5IXF A;  2L3S A;  2J06 A;  4JZ3 A;  2JW4 A;  2K7A A;  1X27 A;  5EC7 A;  2D8H A;  3REB B;  2H8H A;  1PRM C;  2BTT A;  2FRW A;  1WYX A;  1AWO A;  1X69 A;  2LQN A;  2HBW A;  2SEM A;  2ED1 A;  3FJ5 A;  1EFN A;  2OJ2 A;  2LNH B;  4A63 B;  2CUB A;  4JJC A;  2EYZ A;  1WXB A;  2BZX A;  2L3Q A;  2DBM A;  1CKA A;  2FG0 A;  4AFU C;  2CSI A;  1YP5 A;  1ZLM A;  2KNB B;  3VS0 A;  2A08 A;  1NLP C;  1SHF A;  3M0T A;  2DL8 A;  1GRI A;  1W70 A;  2CT3 A;  1E6G A;  2YUN A;  1FYN A;  2NWM A;  2EGE A;  1NLO C;  1TUD A;  2EYW A;  4F14 A;  2V1R A;  2AZV A;  3LH5 A;  2DYB A;  2YUQ A;  2LCS A;  4JJD A;  2VKN A;  3RBB B;  1I1J A;  2DRK A;  1I07 A;  1H8K A;  2KRS A;  1JQQ A;  1Y0M A;  4F17 A;  3TVT A;  2J6F A;  1X6B A;  1M3C A;  2OI3 A;  2EYY A;  2KRM A;  2RQW A;  2CRE A;  1M3B A;  1T3L A;  2F2X A;  3SHW A;  2CH4 A;  1YN8 A;  1PRL C;  2VWF A;  3VS5 A;  2YSQ A;  5IHI A;  2FPE A;  2GGR A;  2JS2 A;  3TSZ A;  1T0H A;  3VS2 A;  4AG1 C;  3A98 A;  4QT7 A;  2C0T A;  3VS7 A;  4OMO A;  1UG1 A;  5ECA A;  2C0O A;  4LUE A;  4DEX A;  3EG2 A;  2RQU A;  1MV3 A;  1UTI A;  1OEB A;  2RQV A;  1GL5 A;  1RLQ C;  1KIK A;  2GBQ A;  4J9E A;  1GCQ A;  2LZ6 B;  2F2V A;  4LUD A;  1VYU A;  2DNU A;  4Z88 A;  4OMQ A;  2JMC A;  2DL7 A;  1Y57 A;  2RN8 A;  1OV3 A;  2M51 A;  1K0S A;  2DMO A;  2GTO A;  3UAT A;  1AD5 A;  1CSK A;  1PWT A;  1KFZ A;  4OML A;  2O88 A;  2GTJ A;  1X43 A;  4CC7 A;  1H3H A;  1JEG A;  2EVR A;  1JU5 C;  2C0I A;  2KXD A;  1UHC A;  1UHF A;  2LJ1 A;  1K4U S;  3VRZ A;  4WCI A;  2RF0 A;  4HVW A;  2YT6 A;  1NM7 A;  1SSH A;  3H41 A;  1NYG A;  1UJ0 A;  3TSW A;  4JJB A;  3KFV A;  4J9D A;  1MUZ A;  1AZG B;  2D8J A;  2DBK A;  1ZSG A;  2ESW A;  1JXM A;  1YWO A;  4J9H A;  2KT1 A;  1BK2 A;  2IIM A;  3VS3 A;  1S1N A;  4D8K A;  1GBQ A;  2EBP A;  2D0N A;  3REA B;  5FW9 A;  1UGV A;  1HD3 A;  3M0P A;  3VS4 A;  2DLP A;  2G6F X;  3RNJ A;  2GNC A;  3M0R A;  1QCF A;  4J9C A;  4RTW A;  2RMO A;  2OAW A;  4AG2 C;  2KRO A;  1PNJ A;  1BU1 A;  1JXO A;  2ROT A;  1NG2 A;  2EKH A;  3M0Q A;  2DX1 A;  1FMK A;  2LQW A;  2MOX A;  2HEQ A;  1AZE A;  2FRY A;  1Z9Z A;  1M27 C;  2JXB A;  2AZS A;  2XMF A;  1G2B A;  5I22 A;  4JZ4 A;  1ZUY A;  3I9Q A;  2DRM A;  2O31 A;  1WDX A;  1ARK A;  1PKS A;  2L3P A;  2CH4 W;  2D1X A;  4RTV A;  1M8M A;  3QWY A;  4HVV A;  2X3X D;  1ABQ A;  4KRT A;  1SHG A;  3EG3 A;  2YDL A;  3EG1 A;  2RPN A;  2K2M A;  4RTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...