2EGAA

Solution structure of the first sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSSGSSGLEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH3 and PX domain-containing protein 2A
publication title Solution structure of the first SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egaA00
3VRZA 2K6DA 5GJWB 5GJVB 1YWOA 1NEBA 4CC7A 2K79A 1ZUKA 3TSWA 3UATA 3UF4A 3RNJA 4CC2A 2CT4A 2J6FA 1UUEA 2RQUA 4D8KA 2AKLA 2NUZA 2VWFA 4WCIA 1TG0A 3NHNA 1YP5A 1LCKA 2ECZA 2KROA 2OAWA 2SEMA 1VYUA 2G6FX 2KE9A 4LE9A 1G83A 1ABQA 4AFUC 2LQWA 1MUZA 2AKKA 4OMPA 2DL3A 1GBQA 4X1VA 5IHKA 2DL7A 1U3OA 2K3BA 2KYBA 2O88A 4HCKA 4LUEA 1X27A 2KEAA 2D0NA 3EHQA 2YUOA 4GLMA 2GBQA 3UA6A 1X69A 2CSQA 4DEXA 1JXMA 2W0ZA 2LJ0A 1QKWA 3CQTA 5I22A 4IIMA 1ZLMA 2CSIA 4RTYA 1RI9A 2EQIA 2KT1A 5IXFA 4CC3A 2LNHB 3PVQA 1YWPA 2SRCA 2A28A 3O5ZA 2JXBA 2W10A 1I1JA 2C0IA 2LJ1A 4M4ZA 3EG2A 2HDAA 4HVUA 1Y57A 2DYBA 1WX6A 1PNJA 4QT7A 2EVRA 2O31A 3I5RA 2DF6A 3LH5A 2JS0A 1NLPC 2KXCA 2V1QA 2O9VA 3GBQA 3RBBB 5IXBA 2D8JA 3VS2A 3IQLA 2HBWA 4F14A 2J06A 3NMZC 4HVVA 5IH2A 1UJYA 2D1XA 4RTWA 2X3WD 2D8HA 2K2MA 1M30A 2XMFA 2BZYA 1VYVA 2DL5A 1Z9QA 1Y0MA 2H8HA 3M0RA 3UA7A 4OMQA 1WXBA 2AZVA 1JU5C 1NYGA 4RTZA 3H0FA 1T3SA 4JPBW 2PZ1A 1PHTA 2DM1A 4J9GA 2JTEA 1UE9A 1HJDA 2JM8A 2LZ6B 2GTOA 2EGAA 2EGCA 3ULRB 1MV0B 2BZ8A 1TUDA 1QWEA 3TSZA 3I5SA 1WA7A 2DVJA 4J9BA 1X2KA 4K11A 1E6GA 1HSQA 1QCFA 4F17A 1AWXA 2DJQA 5IHIA 1GRIA 2KYMA 3TVTA 1KFZA 2C0TA 4LUDA 3EG3A 3REAB 2F2WA 4RTXA 1AWOA 4LN2A 3KFVA 1X43A 2EPDA 3VS5A 2CUDA 1NYFA 2VVKA 3VS3A 2BTTA 2F2VA 2ROTA 2ED0A 2YUPA 2A08A 1QLYA 3SHWA 4J9IA 2J05A 1ABOA 2DLPA 2YUNA 1NEGA 4J9CA 1SHFA 2IIMA 1NM7A 2EYZA 5ECAA 2O2OA 3NGPA 4A63B 3NPFA 4JZ3A 2YUQA 3JV3A 1J3TA 3I9QA 4HVWA 4JJBA 4Z8AA 5I11A 1IO6A 1AZGB 2KR3A 1BK2A 2A36A 4Y92A 1UHFA 1QWFA 1JQQA 4J9HA 1GCPA 3C0CA 1UFFA 2CREA 2DBKA 1NLOC 1E6HA 1GL5A 1YN8A 1BU1A 3H0IA 4CC4B 1OOTA 1S1NA 3ZL7C 1M3AA 1KIKA 1X6GA 1SRMA 2HSPA 4EIKA 4DEYA 2F2XA 2FRWA 1FYNA 1VA7A 4OMLA 4R0KA 3VS7A 1SEMA 2OI3A 2FEIA 4JJDA 3H0HA 1AWJA 2EKHA 2LP5A 5IHNA 2KBTA 1CKBA 2RQVA 3FJ5A 1CKAA 2CH4W 2DRMA 1I0CA 2VKNA 2PTKA 2RNAA 2X3XD 1PRLC 2MOXA 2K9GA 1MV3A 4J9DA 1UECA 1PWTA 4RTVA 1WI7A 1X2QA 3QWXX 4LNPA 2FPEA 2DBMA 1N5ZA 2J6KA 2E5KA 2A37A 1W6XA 2FPFA 1B07A 3VS4A 5EC7A 4JJCA 2YT6A 1JXOA 2DX1A 2OJ2A 2KT8A 4D8DA 1UTIA 4RTUA 3U23A 2KGTA 2M0YA 2KRNA 1M8MA 2DE0X 1WDXA 2V1RA 2ENMA 1ZUUA 4FSSA 4ORZA 2RQTA 3THKA 2KRMA 2KXDA 1M3BA 2ESWA 3R6NA 1ZBJA 3SEMA 4GBQA 2J7IA 1G2BA 2LCSA 1T0JA 1NG2A 2HEQA 1FMKA 1GFCA 4HXJA 2CT3A 2LX7A 1CSKA 1RLPC 3M0UA 1GCQA 2DA9A 1KSWA 1UGVA 3PVLA 1U06A 2JW4A 5L23A 1K1ZA 4AFSC 1PRMC 2RMOA 2RN8A 1AZEA 4AG2C 2JMAA 3EHRA 2L3SA 5HCKA 2P4RA 1WXUA 2ABLA 3VS0A 4J9FA 1QKXA 1RUWA 1XOVA 4Z89A 1WXTA 2EYXA 1M3CA 2DL8A 1ARKA 2FRYA 4IIOA 5FWCA 1SPKA 1BBZA 2LMJA 1GCQC 1JEGA 4AFZC 1T0HA 2L2PA 2EYYA 4ESRA 4JZ4A 2DNUA 1BB9A 3M0SA 2BZXA 3M0TA 2K7AA 2M51A 1M27C 4Z88A 1SHGA 2CUBA 2L3PA 1PKTA 1A0NB 4OMNA 2EYWA 1OV3A 2O9SA 2HCKA 5FWBA 1TUCA 2JMCA 2LQNA 4E6RA 1AOJA 2CDTA 1JO8A 1W1FA 2MIOA 1K76A 4RUGA 2JS2A 1AEYA 4J9EA 3EG1A 2FO0A 2EBPA 1RLQC 2EW3A 2GTJA 3VS1A 1OPKA 1PKSA 1H8KA 1ZX6A 2C0OA 2DL4A 3M0QA 2GGRA 2FPDA 1YNZA 1AD5A 2LJ3A 1WFWA 2GNCA 1GFDA 1K0XA 2DRKA 2B86A 2CH4A 3A98A 1UDLA 2AZSA 3VRYA 2J6OA 2AK5A 2RQWA 1OEBA 1B3QA 2RF0A 1I07A 3PE0A 4ZNXA 1U5SA 2EGEA 1K9AA 1AWWA 2FG0A 2GQIA 1VYTA 2DILA 1WIEA 1GBRA 3I35A 1Z9ZA 1UG1A 1KJWA 3M0PA 2L0AA 2PNIA 2MCNA 1H92A 2DMOA 3REBB 1K0SA 3QWYA 1W70A 3VS6A 2RQRA 1AVZC 4KRTA 4OMMA 1HD3A 1WYXA 2NWMA 4RTTA 3EG0A 1ZUYA 3EGUA 2YSQA 2ED1A 1ZSGA 4AG1C 1X6BA 2ROLA 1UHCA 1H3HA 1UJ0A 1T3LA 2KRSA 1YCSB 2YDLA 1E7OA 3H41A 1EFNA 5FW9A 2I0NA 4OMOA 1SSHA 2KNBB 2JM9A 1WLPB 2QDLA 1SRLA 1V1CA 2RPNA 4AFQC 4F16A 2L3QA 2JT4A 1OPLA 1K4US
chains in the Genus database with same CATH superfamily
2K6DA 3DLMA 5GJWB 1YWOA 3CXCP 2EAYA 3OS0A 2X35A 3EFOA 3RNJA 2CT4A 1UUEA 2NUZA 4WCIA 2K3YA 2ECZA 2KROA 2OAWA 3SFMA 2G6FX 2KE9A 1G83A 2V8JA 4AFUC 1VQOQ 3CC7T 4UC4A 1BCMA 2RJDA 3FJPA 3EFSA 3CMAT 1VQNT 1M1FA 2KYBA 4PFOA 4LUEA 1X27A 2EJFA 2D0NA 3CBOA 3QO3A 3EHQA 2YUOA 5KYNA 1Q81R 5GMKh 1JXMA 2K5IA 2W0ZA 2F69A 4MMLA 3G71T 2LJ0A 3JAME 1Q86C 2MK5A 2DETA 4F04B 4RTYA 1IZ6A 3HRSA 3OYEA 3QZ9B 2MAMA 3SWNC 1LNXA 1GXIE 1TS9A 1YITQ 2OTJT 1Q82R 3PVQA 1Q7YC 1K9MR 3JCMV 2WSFE 1PNJA 1KC8C 1IHVA 4PJOD 2A0FB 3I5RA 1NLPC 1XQHA 2O9VA 2PUOB 2D8JA 2HBWA 3CCQA 1VQ5A 3CCMQ 3CPFA 2X4YA 3I55T 4F7UF 5I2MA 5J26A 1O75A 2K2MA 1MMGA 2A3LA 2BZYA 1VYVA 2DL5A 4RKUE 3ASKA 1KD1U 5CKBA 1MMDA 4ZGDB 4F7UG 4JPBW 3JB9H 4J9GA 1N8RC 3OSVA 4II1A 1R0CB 2RA2A 4M77B 4F7UE 3TSZA 3M53A 2QEXT 1YIJQ 4JJNK 3V8LA 1MGQA 1QP2A 1X2KA 5GAOp 4K11A 1PD0A 1E6GA 1QCFA 2PVDB 5IHIA 1QMCA 2QTXA 1TU0B 1FWZA 4LD6A 2QQ9A 2QK0A 1KFZA 4X9CA 1Y96A 1X43A 4QQDA 1JJ2A 1NYFA 3CMET 2VVKA 1KC8U 2A08A 1QLYA 3SHWA 3OY9A 3NTHA 3G7ZA 3J81E 1ABOA 4ME7A 4J5YA 3H8ZA 3OMGA 2YLBA 5HK0A 5LJ5g 2E12A 4A63B 3CD6T 3ZFJA 5FU7B 4OMFB 4C92F 3I56Q 4JS4A 1PSFA 2E10A 2KR3A 3A8LB 1BK2A 2QXFA 5GAN2 1UHFA 3NFCA 2EQUA 2XG8D 1JQQA 4C5EA 3P8HA 4C92G 3CCVT 5AT1B 1X6GA 4J8OA 4M78D 2LQKA 4OVAA 2F2XA 2FRWA 4M7AC 5FLXE 2OI3A 4N0AC 4JJDA 1KQSS 1YI2T 3OYAA 3WVDB 4XTYA 2RQVA 2IVWA 3CC2T 1VQPQ 4ELZC 4PFZA 2D9TA 2VKNA 2V8IA 2X3XD 1PRLC 3CC4T 2MOXA 4J9DA 1VQ6T 4RTVA 1TSFA 2HD0A 3M57A 1N5ZA 4BDZA 2QYZA 2A37A 3URGA 4M75D 1K8AR 4JUVA 1IHWA 3G4SA 3VS4A 2KK4A 1V29B 2P4TA 1BI0A 2DX1A 2RH2A 2OTLT 2KT8A 4D8DA 4PJOA 1KK7A 2M0YA 1M8MA 1SKUB 1C1AA 5CAIA 5FRNA 1SF9A 2KRMA 5GMKi 1M3BA 3R6NA 1ZBJA 3SEMA 4GBQA 5KE3A 1G2BA 2LCSA 4C8QD 4QVCA 2R57A 4IUPA 1VQ8Q 3JB9F 4HXJA 2MPXC 2AHJB 3E19A 2XHCA 5CKHA 2ZPGB 3SD4A 5GAN4 3QDRB 1UGRB 1RLPC 2B8AA 4BACA 4MDWA 3JB9G 1U06A 3CCLT 3I56T 5L23A 3CCEQ 3SWNB 4DQ2A 1XNIA 4MDXA 1KQSP 4FW1A 2M16A 4M7DF 5D7UA 1YJNA 4M7AD 2F5TX 1VQ7T 2ABLA 3V8KA 2QTVA 3NTKA 4XU3A 3JRZA 2DTHA 4M7DG 2X51A 2PU9B 4EPCA 3HKSA 4IIOA 1VQ4T 1S72Q 2JTMA 2KQWA 1GCQC 1NZ9A 1JEGA 4BI8B 2P0QA 2KVQG 1T0HA 3SWNA 2L2PA 4IUTA 3LLRA 2O4XA 3CBMA 3M0SA 4Y91A 4BY6C 2BZXA 3M0TA 2M51A 1M27C 3KBGA 4Z88A 2CGHA 1PKTA 3M5AA 2CZ0B 2EYWA 1VUBA 2F5KA 2O9SA 2L8DA 1M1KU 2JMCA 1RABB 1K76A 1UEBA 3OMCA 4Z02A 2JZ2A 3VS1A 1PKSA 2LCCA 1C6VX 2RI2A 2VYTA 4M78A 4M75B 2RHYA 1OYXA 1K0XA 1RAHB 1I5LA 1B34A 4N4HA 1YHQQ 2CH4A 5KYYA 2MI6A 3VRYA 4XQ3A 1SSFA 2RQWA 1B3QA 1KC8R 4B6MA 2K2VA 2EGEA 4EDUA 3QPHA 1G3SA 1VIEA 2QAZA 5I2SA 1AWWA 5IN1A 4KUDK 3OYIA 4V2SA 3I35A 4M75A 1Z9ZA 1KJWA 3M0PA 5D6XA 2L0AA 1PD1A 3CCSQ 1VQOA 1B7TA 4OP0A 3LX7A 3QWYA 2XDBA 2V8KA 3EH2A 4C8QB 4E7JA 4HT8A 3J80E 2DAQA 2CP6A 2ZCFB 2NWMA 2RD1A 3CCRA 3EGUA 1QQJA 1N8RR 2HQHA 2FZKB 3NTIA 4LDXA 2ED1A 4RCCA 1X6BA 4LDVA 2KRSA 1YCSB 1E7OA 4XAXB 2HL5C 3RKXA 4M7AB 5GAMf 5GAOn 1SSHA 3META 3WXMB 4C8QA 2KNBB 4PJLA 1V1CA 2HL3A 2RPNA 4JRKA 2YRDA 1M9SA 1YITA 2DXCA 1NEBA 4CI0C 3PGGA 1W4SA 3MP1A 2RQUA 1KQ2A 1ZSZA 2HZYA 4HT9A 4PJNA 3UT1A 4C5HA 3FIFA 3G6EQ 2BUDA 4KGZB 3RERA 1QVGA 4M7AA 4RMOA 4BE1A 1K73U 3S3OA 3X26B 2DL3A 3HPWA 2ATCB 1NBEB 5KE2A 2DKGA 4ZN1A 1D1BA 1U1SA 3OW2S 5FRMA 3MEVA 1HK9A 4QVDA 3WVEB 5IAYA 1X69A 4NL2A 1QVFP 2CSQA 4DEXA 2R5AA 2COWA 2E70A 2LX9A 1WHJA 5GAOm 1U1TA 5I22A 3CC7Q 4ZTJA 2CSIA 4DA4A 1WHLA 1RI9A 2EQIA 4FSXA 4PK4A 1YJ9T 2FVUA 4EMKC 3CMAQ 3CPWS 1VQNQ 3JCMf 2RJCA 4L59A 4R55A 2LNHB 4OGEA 2MMPA 2E3HA 1YWPA 2SRCA 2JXBA 4PNOA 3CBPA 1I1JA 2C0IA 2CZ1B 4M4ZA 3G71Q 4HVUA 4A54A 1WZOA 2DYBA 5FU6C 1VQLA 4QT7A 2EVRA 2O31A 4A53A 3JCMW 2KXCA 1VIFA 2DD5A 5IXBA 3IQLA 3QJ6A 3C94A 4PLIA 3T9NA 3L2VA 2J06A 3HHTB 3NMZC 2OTJQ 1UJYA 2D1XA 3EGDA 2JOYA 3E1SA 5GANg 3P8BB 1YJWT 4LD9K 1Z9QA 3M0RA 2H8HA 3UA7A 2AZVA 5LJ3e 4OB2B 3H0FA 1T3SA 3RKYA 2PZ1A 3OA6A 2ZPEB 4NL3A 2JM8A 3LWIA 2EGAA 3EGXB 4RG8A 2EGCA 1Y71A 4BY6B 3QKJA 1TUDA 1QWEA 2MWOA 2CKKA 3I55Q 4M77D 2Y4YA 4DBHA 1WJSA 2ZZDA 1Y07A 1WQ7A 2DVJA 4J9BA 3G4ST 3A8OB 1HSQA 1AWXA 2RHZA 5GAMj 3TVTA 4XU1A 2C0TA 2O01E 4RTXA 5AYFA 2EPDA 3VS5A 1IGQA 1VQPA 3VS3A 2QEXQ 2ED0A 3CPWP 1JB0E 2K5FA 3O8VA 1G3TA 4PJOF 3JCMe 2YUNA 4A4KA 2E6ZA 1NM7A 3BFMA 5KYWB 3MPUB 2EJGA 1KD1C 4PJOG 2M9UA 3JV3A 1VQMT 1EIFA 2QASA 3CMEQ 1WHHA 2A36A 2L89A 3CCUA 1D1CA 1GCPA 5GAN8 1NLOC 1GL5A 1I4K1 1TXQA 2E41A 2VXFA 4CC4B 2P0PA 1S1NA 3MEAA 3OYDA 4FU6A 1UGQB 1KIKA 4E7SA 5KYWA 3CD6Q 4EIKA 1FYNA 3SB2A 3RR6A 2DZCA 1SEMA 5GAN6 2GQVA 5GANh 5GAMd 2LP5A 5IHNA 2ZAEA 1VQKA 2VC8A 2BKDN 4PKCC 4O5VA 2DRMA 1MNEA 1I0CA 1KHCA 3CCVQ 3FB9A 2RI5A 3DB4A 1WJRA 3CXCA 2PQWA 2GCXA 3E2UA 3RKWA 4HCBA 1UECA 4XTWA 1X2QA 3QUIA 3Q1JA 4BD3A 2EFIA 2E5KA 3CCEA 2RJFA 2YWWA 4J6WA 1PG5B 5IT9E 1YI2Q 2QA4A 2P0KA 3MO8A 3OBWA 3CC2Q 2X4JA 1JJ2P 3M58A 1IRXA 2BE9B 3INZA 2XK0A 4RTUA 3CC4Q 1X6OA 3S6WA 2KGTA 3OYFA 1VQ6Q 5GMKl 5HK3A 2DD4A 2KRNA 3JCMJ 1YFNA 2JVVA 1ZUUA 5KCOA 4FSSA 4OB0B 3THKA 3VUBA 2KXDA 3RIRA 2JN0A 5HKCA 3LWHA 3OYCA 2RHIA 2QG9B 1T0JA 1X75C 1NG2A 1RI0A 2CP0A 4HCZA 2OTLQ 4OB1B 3JCMd 4M78F 1MMAA 1G5VA 2FZCB 1ZQ1A 1G3YA 2AIRB 3M0UA 3A8MB 5DM7R 3MHXA 3PVLA 2LRQA 1K1ZA 4BI4A 4M78G 2OAUA 1FX7A 4M77A 2RMOA 2RN8A 4EMKB 1BI3A 4C92C 2R5MA 2JMAA 3VJPA 3S3NA 4QVZA 2EIFA 4XU0A 1R8OB 2HQXA 1RUWA 3RMQA 3PTAA 4HCCA 3JCMQ 1IGUA 1WXTA 3MCAB 4M75F 4X34A 2HKQB 2DYIA 3CCLQ 2DK3A 1ARKA 3VYHB 2NUPB 3UPUA 3A8GB 3GNGA 2COZA 1QP3A 1WGSA 3TCJA 2Z0WA 1VQ7Q 1SHGA 2CUBA 2L3PA 3C4SA 3OS1A 4C92E 4OMNA 2HCKA 5FWBA 1TUCA 2CP2A 1AOJA 2MIOA 1VQ4Q 2JS2A 1AEYA 4PJJA 4C8QF 2EBPA 1KQ1A 1OPKA 4GY5A 5HY6A 1H8KA 1OI1A 2FHDA 2FPDA 1BYMA 3OYJA 3MEWA 3MEUA 1YNZA 1VQ9T 2LJ3A 1WFWA 3TQ7P 1BIAA 4X9DA 4FT2A 2DRKA 2JNGA 2B86A 2FZGB 4XTUA 4C0FA 3PIOA 3GF5A 2YLCA 3A98A 1BIBA 2CYZB 2J6OA 2AK5A 1TUGB 5GAMg 2RF0A 2EWNA 4ZNXA 1U5SA 1C0MA 3A5ZB 4BB7A 2NLUA 2XD0A 2VB6A 2DILA 3BDLA 1GBRA 5GMKe 1UG1A 3HTRA 2PNIA 1H92A 3CCJA 1W70A 2WSCE 4JRPA 4HKEA 1M90U 3VS6A 1AVZC 4KRTA 3ER0A 4OB3B 1M1KC 3HFNA 1OU8A 3OYYA 5DLOA 1WYXA 3RUXA 3QJYA 4IKFA 5LJ5h 2E5QA 1VQLT 3OBYA 1BI1A 2MF2A 2EQMA 1LPLA 4M7DC 4BE0A 4AG1C 1UHCA 1H3HA 3LGLA 4QW2A 3H41A 3CC7A 4ELYC 3SDZA 5FW9A 1WHGA 2XICA 3QYHB 1D3BB 3CMAA 1VQNA 1NPRA 5GMKj 2JT4A 3VRZA 3FDRA 2VXEA 1NJIU 2K79A 3TSWA 3PMTA 2J6FA 2AKLA 4F7UB 3NHNA 2DEQA 3G1JA 4BI3A 1LCKA 4ZGEB 4E7ZA 3RESA 3VV0A 2KI7A 1QVGS 5DLQE 4LE9A 4M7DE 2M02A 5GAOq 2F1LA 2LQWA 2QQRA 2GF7A 4MZPA 2AKKA 2XKOC 2OTJA 1M8VA 5IHKA 4A4EA 2DL7A 3H6ZA 2ZPIB 1OQKA 3RMSA 2K3BA 1KD1R 2DXBA 2O88A 3CEYA 4HCKA 5CIUA 1OU9A 1JBMA 2D6FA 2EQJA 1TTHB 3LYIA 4F7UA 2GBQA 3UA6A 2GFUA 5GAMh 2H3JA 2E1HA 5CKFA 3CQTA 5CKEA 1TWBA 3LH0A 2KT1A 4OGCA 2CS7A 2Y90A 1IREB 3I55A 3HP9A 3E9GA 2A28A 3AHUA 4E47A 4DBRA 4JLGA 5A0GA 1Y57A 4J6YA 4FYYB 3CCUT 5GMKm 1YJ9Q 2V1QA 2LTOA 1F1BB 4C92B 4LDWA 3QZ5B 1QVFS 3JB9I 5IH2A 1K73C 1MMNA 2X3WD 2X4XA 5EG2A 5A2QE 2P84A 4E7HA 3ME9A 1Y0MA 4OMQA 1WXBA 4NS5A 4RTZA 5LL6S 2NUTB 1PHTA 2DM1A 2NYSA 1QVGP 3PFSA 3CMEA 1UE9A 3L2RA 3ULRB 1MV0B 3CCQT 1VQ5T 3TEEA 3VYGA 2YHTA 1EZZB 1YJWQ 1WA7A 2QA4T 5L8RE 1PCXA 1W2BA 2KMTA 4RG2A 3L2UA 1G3WA 4F17A 3CD6A 4YTLA 1K9MU 2YRVA 3EG3A 3EFRA 1AWOA 4LN2A 2YRCA 3QG1A 5LJ3f 4DBFA 2BTTA 2F2VA 2ROTA 2L5QA 2YUPA 2LC4A 4FYXB 5CK9A 4E7LA 3FRNA 2J05A 2VV5A 3G4SQ 1RADB 1NEGA 4J9CA 3JCMb 1SHFA 2EYZA 4N0AA 4J83A 3CCMA 3NGPA 3NPFA 1H3ZA 1BKBA 1YI2A 2RB6A 2YUQA 1J3TA 2I2LA 4HVWA 2LCLA 4Z8AA 1FMWA 3M56A 5D6WA 3CC4A 1VQ6A 3M55A 3C0CA 4L6V5 5KYUB 5M9OA 1E6HA 1BU1A 3H0IA 4AT1B 3QIIA 1SRMA 2L3RA 4C0DC 2H3EB 2HSPA 4PL6A 4DEYA 1VQMQ 3QHSA 1VA7A 4KGXB 4OMLA 4R0KA 2WACA 1YIJA 1RAAB 2FEIA 3H0HA 4M77F 2EKHA 2D0QB 1CKBA 2C06A 2K4YA 1CKAA 3DB3A 1WJQA 3EH1A 3N5BB 4M7DB 5J3BA 3OB9A 3EAEA 4M77G 5KH6A 3QSUA 2K9GA 1PWTA 3C95A 1WI7A 2DXTA 2FPEA 1YJNQ 1UB4A 2K5LA 4JRIA 1N6AA 5KYXB 1OZ2A 5GAN7 3OYHA 1W6XA 1RAIB 1M5Q1 2FPFA 1NJIR 1B07A 1H641 3GNFB 3HL8A 5EC7A 2YT6A 3H9NA 5FU7C 2OJ2A 2CP5A 4BE2A 3LGFA 3MP6A 1UTIA 3M54A 2BIVA 3U23A 4ZTFA 1M2VB 4KUIA 1HXDA 3CCLA 3I56A 2DE0X 1NE8A 2DPPB 1WDXA 8AT1B 2V1RA 1FXXA 4ORZA 2DXUA 1N27A 2J7IA 1WPYA 3PMIA 2DJZA 3GIBA 2HEQA 1FMKA 2JTFA 1GFCA 1M1KR 2CT3A 4Y28E 4B9XA 3L1AA 1CSKA 2VASA 3EFOB 3OSSC 2CP3A 1GCQA 1VQ4A 4PJOC 1UGVA 3V8JA 1JJ2S 3L2ZA 3HFOA 3EGXA 4FIBA 1LVKA 1PRMC 5LJ3j 2HSEB 1AZEA 2RK1A 4AG2C 1JRIA 2HQEA 3CCJT 4EMGA 3BY7A 1K8AU 1WXUA 3VS0A 6AT1B 2K3XA 4ANJA 5GAOr 4E2FB 1D0YA 4Z89A 2EYXA 1M3CA 2K57A 3OS5A 2FRYA 3ZBDA 1SPKA 4MMKA 2LMJA 2DFUA 1XTDA 4PJOE 4XTVA 2E6NA 4DOVA 4ESRA 4JZ4A 1OZ3A 1I5OB 4KULA 4FM4B 2HKNA 4JLIA 1YJNT 1KHIA 3CCRQ 4ZGJB 2AT1B 2COYA 2LQNA 4E6RA 1NPPA 2CDTA 3JCMX 1W1FA 4FYWB 4C0ZA 5CQXA 4RUGA 3OYMA 5J39A 5D6YA 2VGNA 3OW2A 1VQ8A 2RHUA 4JDSA 1RLQC 2RK2A 2EW3A 3M0QA 1ZX6A 2GFAA 4NOYA 9ATCB 2LDMA 4MZMA 5LJ3d 3JB9J 2BE7D 3OYKA 3CPWA 4C5GA 4XU2A 4IUQA 2EQKA 3GLXA 3BW1A 1D1AA 2AZSA 4TVRA 1WHKA 2DEUA 1OEBA 1K9AA 2CP7A 4XTZA 1VQ9Q 2DVEA 3P8DA 2GQIA 1QCOA 1VYTA 4B9WA 2Y4XA 3X28B 1G8XA 1S72A 3JSCA 1K73R 4M78C 3REBB 1K0SA 2ZPHB 1WNLA 1HYOA 1PM3A 2PVOB 2RQRA 3MJXA 4XTXA 2X9HA 3EG9B 1VOMA 1RAGB 1Y7XA 4RTTA 3X24B 1DJ7B 3EG0A 3QXEB 1BCOA 1ZUYA 1Y96B 4E7KA 3PT9A 2ZGWA 4QQ6A 1YBYA 3KUFA 3UDCA 5GAN3 3VU3C 1Q86U 2ROLA 3QDFA 2G3RA 2YDLA 1EFNA 1RAFB 4C0DB 4D6WA 4M75C 4OMOA 2E64A 1VQOT 2JM9A 1WLPB 2QDLA 1SRLA 4F16A 1Q7YU 3EG9A 2L3QA 4M78E 4GLKA 1VQLQ 2VUBA 1OPLA 1K4US 5GJVB 1M2OA 5KCHA 2DIGA 2EKOA 4CC7A 2FL7A 1ZUKA 2JUFA 3UATA 1QVPA 5FU6B 3BE3A 3UF4A 3CCRT 1I81A 4CC2A 4D8KA 1YHQA 2VWFA 1TG0A 4FT4A 1YP5A 5GANf 2SEMA 1VYUA 2E65A 2QGFB 3PIPA 4M75G 1YJ9A 4EMKA 1ABQA 2QQSA 1MUZA 2E4HA 4OMPA 1GBQA 4C0GA 1I8FA 4X1VA 1M90C 4C8QC 4M75E 1U3OA 1YITT 3CCSA 3OYNA 2KEAA 1RAEB 4FL6A 1AHJB 4GLMA 1RL2A 4BUGA 2NUPA 3F70A 1N8RU 4J6XA 2CZ7B 1ZSZC 1QKWA 4IIMA 1ZLMA 2HAXA 4IUUA 5A0LA 1D0ZA 1R77A 1M4ZA 5IXFA 4CC3A 3QBYA 2RM4A 4C8QG 3VKIA 5A0DA 3CCMT 1WQWA 4O6JA 2WSEE 1YJWA 2R58A 2ZPBB 2HMAA 2IG0A 3O5ZA 2W10A 1NJIC 2LJ1A 4C8QE 3EG2A 2YXYA 2HDAA 4PJOB 1OX8A 1WX6A 1ZBXA 4M7AF 5GAOl 4R56A 2DTIA 2DF6A 3LH5A 2JS0A 2PUKB 3GBQA 3RBBB 4DOWA 1Q95G 3VS2A 4WF2A 4WTOB 4F14A 2M0OA 4M7AG 4PLLA 2HNIA 4C92D 4HVVA 3X20B 2KDSA 3A8HB 4CRIA 5LJ3g 4RTWA 3D7SB 4MZTA 3G6EA 3UWNA 2D8HA 1YIJT 3A1PA 1M30A 5CR2A 2XMFA 4M7AE 1JU5C 1NYGA 1WHMA 1MNDA 4J7IA 3CCUQ 1SG5A 5GANe 2JTEA 2FYKA 1HJDA 2LZ6B 2GTOA 4BDYA 4RCBA 4ATOA 1IB8A 2BZ8A 4N4GA 3JCMc 2KAFA 3I5SA 1W2BS 2VGMA 1VQKQ 4KH0B 1N9RA 2DJQA 1GRIA 2KYMA 1VQMA 1LOJA 4LUDA 4PJMA 3REAB 2F2WA 3GOXA 3KFVA 3JCMg 2QQAA 2CUDA 4KGVB 3OYGA 2LVMA 3G71A 3CCQQ 1VQ5Q 3E9FA 4KBMB 1XJWB 2O4XB 1OX9A 4J9IA 2QA4Q 5GANj 2DLPA 4P5NA 3AT1B 1EX4A 2IIMA 2PVGB 5ECAA 2O2OA 1D3BA 3TU4K 4FYVB 4JZ3A 2V26A 3M59A 3FLGA 3DLLA 2LQ8A 3I9QA 4JJBA 4QQGA 5I11A 1IO6A 1M1GA 1FMVA 1AZGB 4A4HA 4Y92A 7AT1B 3KXTA 1Q81C 1QWFA 4L5GA 4IUVA 4J9HA 4C5IA 1VQPT 3DKMA 1UFFA 2CREA 2DBKA 1YN8A 1OOTA 3JB9D 4M78B 3ZL7C 4HA8A 1M3AA 1YCYA 1ACMB 5LJ3h 3M4YA 1B34B 2OX7A 3VS7A 5DY9A 1Q82C 1K9MC 1AWJA 1D09B 5KYYB 2KBTA 5CO7A 1KQSA 2E3IA 3FJ5A 4KH1B 1Q86R 2CH4W 1AT1B 2PTKA 1P92A 2RNAA 4M7DD 1MV3A 2RI3A 2DERA 3QWXX 1W2BP 4LNPA 5LJ5f 2XI9A 2DBMA 2EJ9A 2J6KA 5GANd 2QEXA 1Q7YR 4XK8E 5I21A 2XDDA 4JJCA 2HBPA 1UGSB 1JXOA 1VQKT 1VQ8T 2MYSA 1KG1A 2LT4A 3PNWC 3JCMh 1Q81U 2ENMA 1O9SA 4C92A 3OYBA 2RQTA 1ZA2B 3TREA 2ESWA 5C0MA 2QGGA 3CCET 3ZEHA 3HRTA 2M1HA 1LJOA 2RJEA 3GPLA 1IXDA 2LX7A 3OS2A 1Q82U 2XU8A 3OQ5A 3GP8A 2QI2A 3L2WA 2NUTA 5CVIA 3RDVA 1ZSZB 1KSWA 2DA9A 1D0XA 4A4FA 2IPOB 1RACB 3V7RA 3L2QA 2JW4A 4LXCA 4ZN3A 4AFSC 1S72T 3CCVA 5GAN5 1BI2A 2XIDA 3MP8A 3EHRA 2L3SA 4EMHA 5HCKA 1TH7A 2P4RA 3J7AF 4LDUA 4J9FA 1QKXA 1XOVA 4A4GA 5C6SA 3V7CA 2DL8A 3CC2A 5FWCA 2X4WA 1BBZA 3QYGB 4AFZC 5LJ5e 2ZPFB 2FB7A 2EYYA 3CCJQ 1VQ9A 2DNUA 1BB9A 4M77C 3OYLA 2DTOA 2K7AA 2KSSA 5CCAA 4JRQA 1R0BG 1OULA 1QCNA 3LW5E 1M90R 1QW1A 3L42A 3JCMP 1A0NB 2XDPA 1ZHIA 3M4GA 2CZ6B 1OV3A 4J7FA 2MWPA 3VUZA 3HSBA 1PC0A 1JO8A 1YHQT 2OTLA 4J9EA 3EG1A 2FO0A 2GTJA 3CXCS 2C0OA 2DL4A 3HRUA 5KYUA 2GGRA 4FCYA 1V76A 2A7YA 1AD5A 2GNCA 1GFDA 3X25B 5LJ5j 3FEOA 1K8AC 3EGDB 4M77E 5FROA 5CQYA 4DBQA 3CCST 4N4IA 1UDLA 1UGPB 1I07A 3PE0A 4FW2A 3C12A 1TOVA 4M7DA 2LT1A 2JJ9A 1MHNA 2FG0A 4QKUA 1WIEA 5GAMe 1QVFA 4AMCA 2MCNA 5KYXA 3S3MA 2DMOA 8ATCB 2DIQA 2LNVA 4E7IA 3M9QA 4PFPA 1VQ7A 4OMMA 3MKDA 1HD3A 2RHXA 2EYQA 4OF1A 5CKDA 2KY9A 4KT0E 1PSEA 2DO3A 1M2VA 2YSQA 4VUBA 2QDYB 3R6OA 1ZSGA 3BDUA 4IURA 3FC3A 1UJ0A 1T3LA 4LDYA 4Q5WA 2I0NA 3G6ET 1U8RA 2RO0A 1X01A 5LJ5d 4JS5A 3OW2P 1N9SA 4AFQC 1ZA1B 2DZ9A 3V7SA 2QQBA
chains in the Genus database with same CATH topology
3VRZA 2K6DA 5GJWB 5GJVB 1YWOA 1NEBA 4CC7A 2K79A 1ZUKA 3TSWA 3UATA 3UF4A 3RNJA 4CC2A 2CT4A 2J6FA 1UUEA 2RQUA 4D8KA 2AKLA 2NUZA 2VWFA 4WCIA 1TG0A 3NHNA 1YP5A 1LCKA 2ECZA 2KROA 2OAWA 2SEMA 1VYUA 2G6FX 2KE9A 4LE9A 1G83A 1ABQA 4AFUC 2LQWA 1MUZA 2AKKA 4OMPA 2DL3A 1GBQA 4X1VA 5IHKA 2DL7A 1U3OA 2K3BA 2KYBA 2O88A 4HCKA 4LUEA 1X27A 2KEAA 2D0NA 3EHQA 2YUOA 4GLMA 2GBQA 3UA6A 1X69A 2CSQA 4DEXA 1JXMA 2W0ZA 2LJ0A 1QKWA 3CQTA 5I22A 4IIMA 1ZLMA 2CSIA 4RTYA 1RI9A 2EQIA 2KT1A 5IXFA 4CC3A 2LNHB 3PVQA 1YWPA 2SRCA 2A28A 3O5ZA 2JXBA 2W10A 1I1JA 2C0IA 2LJ1A 4M4ZA 3EG2A 2HDAA 4HVUA 1Y57A 2DYBA 1WX6A 1PNJA 4QT7A 2EVRA 2O31A 3I5RA 2DF6A 3LH5A 2JS0A 1NLPC 2KXCA 2V1QA 2O9VA 3GBQA 3RBBB 5IXBA 2D8JA 3VS2A 3IQLA 2HBWA 4F14A 2J06A 3NMZC 4HVVA 5IH2A 1UJYA 2D1XA 4RTWA 2X3WD 2D8HA 2K2MA 1M30A 2XMFA 2BZYA 1VYVA 2DL5A 1Z9QA 1Y0MA 2H8HA 3M0RA 3UA7A 4OMQA 1WXBA 2AZVA 1JU5C 1NYGA 4RTZA 3H0FA 1T3SA 4JPBW 2PZ1A 1PHTA 2DM1A 4J9GA 2JTEA 1UE9A 1HJDA 2JM8A 2LZ6B 2GTOA 2EGAA 2EGCA 3ULRB 1MV0B 2BZ8A 1TUDA 1QWEA 3TSZA 3I5SA 1WA7A 2DVJA 4J9BA 1X2KA 4K11A 1E6GA 1HSQA 1QCFA 4F17A 1AWXA 2DJQA 5IHIA 1GRIA 2KYMA 3TVTA 1KFZA 2C0TA 4LUDA 3EG3A 3REAB 2F2WA 4RTXA 1AWOA 4LN2A 3KFVA 1X43A 2EPDA 3VS5A 2CUDA 1NYFA 2VVKA 3VS3A 2BTTA 2F2VA 2ROTA 2ED0A 2YUPA 2A08A 1QLYA 3SHWA 4J9IA 2J05A 1ABOA 2DLPA 2YUNA 1NEGA 4J9CA 1SHFA 2IIMA 1NM7A 2EYZA 5ECAA 2O2OA 3NGPA 4A63B 3NPFA 4JZ3A 2YUQA 3JV3A 1J3TA 3I9QA 4HVWA 4JJBA 4Z8AA 5I11A 1IO6A 1AZGB 2KR3A 1BK2A 2A36A 4Y92A 1UHFA 1QWFA 1JQQA 4J9HA 1GCPA 3C0CA 1UFFA 2CREA 2DBKA 1NLOC 1E6HA 1GL5A 1YN8A 1BU1A 3H0IA 4CC4B 1OOTA 1S1NA 3ZL7C 1M3AA 1KIKA 1X6GA 1SRMA 2HSPA 4EIKA 4DEYA 2F2XA 2FRWA 1FYNA 1VA7A 4OMLA 4R0KA 3VS7A 1SEMA 2OI3A 2FEIA 4JJDA 3H0HA 1AWJA 2EKHA 2LP5A 5IHNA 2KBTA 1CKBA 2RQVA 3FJ5A 1CKAA 2CH4W 2DRMA 1I0CA 2VKNA 2PTKA 2RNAA 2X3XD 1PRLC 2MOXA 2K9GA 1MV3A 4J9DA 1UECA 1PWTA 4RTVA 1WI7A 1X2QA 3QWXX 4LNPA 2FPEA 2DBMA 1N5ZA 2J6KA 2E5KA 2A37A 1W6XA 2FPFA 1B07A 3VS4A 5EC7A 4JJCA 2YT6A 1JXOA 2DX1A 2OJ2A 2KT8A 4D8DA 1UTIA 4RTUA 3U23A 2KGTA 2M0YA 2KRNA 1M8MA 2DE0X 1WDXA 2V1RA 2ENMA 1ZUUA 4FSSA 4ORZA 2RQTA 3THKA 2KRMA 2KXDA 1M3BA 2ESWA 3R6NA 1ZBJA 3SEMA 4GBQA 2J7IA 1G2BA 2LCSA 1T0JA 1NG2A 2HEQA 1FMKA 1GFCA 4HXJA 2CT3A 2LX7A 1CSKA 1RLPC 3M0UA 1GCQA 2DA9A 1KSWA 1UGVA 3PVLA 1U06A 2JW4A 5L23A 1K1ZA 4AFSC 1PRMC 2RMOA 2RN8A 1AZEA 4AG2C 2JMAA 3EHRA 2L3SA 5HCKA 2P4RA 1WXUA 2ABLA 3VS0A 4J9FA 1QKXA 1RUWA 1XOVA 4Z89A 1WXTA 2EYXA 1M3CA 2DL8A 1ARKA 2FRYA 4IIOA 5FWCA 1SPKA 1BBZA 2LMJA 1GCQC 1JEGA 4AFZC 1T0HA 2L2PA 2EYYA 4ESRA 4JZ4A 2DNUA 1BB9A 3M0SA 2BZXA 3M0TA 2K7AA 2M51A 1M27C 4Z88A 1SHGA 2CUBA 2L3PA 1PKTA 1A0NB 4OMNA 2EYWA 1OV3A 2O9SA 2HCKA 5FWBA 1TUCA 2JMCA 2LQNA 4E6RA 1AOJA 2CDTA 1JO8A 1W1FA 2MIOA 1K76A 4RUGA 2JS2A 1AEYA 4J9EA 3EG1A 2FO0A 2EBPA 1RLQC 2EW3A 2GTJA 3VS1A 1OPKA 1PKSA 1H8KA 1ZX6A 2C0OA 2DL4A 3M0QA 2GGRA 2FPDA 1YNZA 1AD5A 2LJ3A 1WFWA 2GNCA 1GFDA 1K0XA 2DRKA 2B86A 2CH4A 3A98A 1UDLA 2AZSA 3VRYA 2J6OA 2AK5A 2RQWA 1OEBA 1B3QA 2RF0A 1I07A 3PE0A 4ZNXA 1U5SA 2EGEA 1K9AA 1AWWA 2FG0A 2GQIA 1VYTA 2DILA 1WIEA 1GBRA 3I35A 1Z9ZA 1UG1A 1KJWA 3M0PA 2L0AA 2PNIA 2MCNA 1H92A 2DMOA 3REBB 1K0SA 3QWYA 1W70A 3VS6A 2RQRA 1AVZC 4KRTA 4OMMA 1HD3A 1WYXA 2NWMA 4RTTA 3EG0A 1ZUYA 3EGUA 2YSQA 2ED1A 1ZSGA 4AG1C 1X6BA 2ROLA 1UHCA 1H3HA 1UJ0A 1T3LA 2KRSA 1YCSB 2YDLA 1E7OA 3H41A 1EFNA 5FW9A 2I0NA 4OMOA 1SSHA 2KNBB 2JM9A 1WLPB 2QDLA 1SRLA 1V1CA 2RPNA 4AFQC 4F16A 2L3QA 2JT4A 1OPLA 1K4US
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRZ A;  2K6D A;  5GJW B;  5GJV B;  1YWO A;  1NEB A;  4CC7 A;  2K79 A;  1ZUK A;  3TSW A;  3UAT A;  3UF4 A;  3RNJ A;  4CC2 A;  2CT4 A;  2J6F A;  1UUE A;  2RQU A;  4D8K A;  2AKL A;  2NUZ A;  2VWF A;  4WCI A;  1TG0 A;  3NHN A;  1YP5 A;  1LCK A;  2ECZ A;  2KRO A;  2OAW A;  2SEM A;  1VYU A;  2G6F X;  2KE9 A;  4LE9 A;  1G83 A;  1ABQ A;  4AFU C;  2LQW A;  1MUZ A;  2AKK A;  4OMP A;  2DL3 A;  1GBQ A;  4X1V A;  5IHK A;  2DL7 A;  1U3O A;  2K3B A;  2KYB A;  2O88 A;  4HCK A;  4LUE A;  1X27 A;  2KEA A;  2D0N A;  3EHQ A;  2YUO A;  4GLM A;  2GBQ A;  3UA6 A;  1X69 A;  2CSQ A;  4DEX A;  1JXM A;  2W0Z A;  2LJ0 A;  1QKW A;  3CQT A;  5I22 A;  4IIM A;  1ZLM A;  2CSI A;  4RTY A;  1RI9 A;  2EQI A;  2KT1 A;  5IXF A;  4CC3 A;  2LNH B;  3PVQ A;  1YWP A;  2SRC A;  2A28 A;  3O5Z A;  2JXB A;  2W10 A;  1I1J A;  2C0I A;  2LJ1 A;  4M4Z A;  3EG2 A;  2HDA A;  4HVU A;  1Y57 A;  2DYB A;  1WX6 A;  1PNJ A;  4QT7 A;  2EVR A;  2O31 A;  3I5R A;  2DF6 A;  3LH5 A;  2JS0 A;  1NLP C;  2KXC A;  2V1Q A;  2O9V A;  3GBQ A;  3RBB B;  5IXB A;  2D8J A;  3VS2 A;  3IQL A;  2HBW A;  4F14 A;  2J06 A;  3NMZ C;  4HVV A;  5IH2 A;  1UJY A;  2D1X A;  4RTW A;  2X3W D;  2D8H A;  2K2M A;  1M30 A;  2XMF A;  2BZY A;  1VYV A;  2DL5 A;  1Z9Q A;  1Y0M A;  2H8H A;  3M0R A;  3UA7 A;  4OMQ A;  1WXB A;  2AZV A;  1JU5 C;  1NYG A;  4RTZ A;  3H0F A;  1T3S A;  4JPB W;  2PZ1 A;  1PHT A;  2DM1 A;  4J9G A;  2JTE A;  1UE9 A;  1HJD A;  2JM8 A;  2LZ6 B;  2GTO A;  2EGA A;  2EGC A;  3ULR B;  1MV0 B;  2BZ8 A;  1TUD A;  1QWE A;  3TSZ A;  3I5S A;  1WA7 A;  2DVJ A;  4J9B A;  1X2K A;  4K11 A;  1E6G A;  1HSQ A;  1QCF A;  4F17 A;  1AWX A;  2DJQ A;  5IHI A;  1GRI A;  2KYM A;  3TVT A;  1KFZ A;  2C0T A;  4LUD A;  3EG3 A;  3REA B;  2F2W A;  4RTX A;  1AWO A;  4LN2 A;  3KFV A;  1X43 A;  2EPD A;  3VS5 A;  2CUD A;  1NYF A;  2VVK A;  3VS3 A;  2BTT A;  2F2V A;  2ROT A;  2ED0 A;  2YUP A;  2A08 A;  1QLY A;  3SHW A;  4J9I A;  2J05 A;  1ABO A;  2DLP A;  2YUN A;  1NEG A;  4J9C A;  1SHF A;  2IIM A;  1NM7 A;  2EYZ A;  5ECA A;  2O2O A;  3NGP A;  4A63 B;  3NPF A;  4JZ3 A;  2YUQ A;  3JV3 A;  1J3T A;  3I9Q A;  4HVW A;  4JJB A;  4Z8A A;  5I11 A;  1IO6 A;  1AZG B;  2KR3 A;  1BK2 A;  2A36 A;  4Y92 A;  1UHF A;  1QWF A;  1JQQ A;  4J9H A;  1GCP A;  3C0C A;  1UFF A;  2CRE A;  2DBK A;  1NLO C;  1E6H A;  1GL5 A;  1YN8 A;  1BU1 A;  3H0I A;  4CC4 B;  1OOT A;  1S1N A;  3ZL7 C;  1M3A A;  1KIK A;  1X6G A;  1SRM A;  2HSP A;  4EIK A;  4DEY A;  2F2X A;  2FRW A;  1FYN A;  1VA7 A;  4OML A;  4R0K A;  3VS7 A;  1SEM A;  2OI3 A;  2FEI A;  4JJD A;  3H0H A;  1AWJ A;  2EKH A;  2LP5 A;  5IHN A;  2KBT A;  1CKB A;  2RQV A;  3FJ5 A;  1CKA A;  2CH4 W;  2DRM A;  1I0C A;  2VKN A;  2PTK A;  2RNA A;  2X3X D;  1PRL C;  2MOX A;  2K9G A;  1MV3 A;  4J9D A;  1UEC A;  1PWT A;  4RTV A;  1WI7 A;  1X2Q A;  3QWX X;  4LNP A;  2FPE A;  2DBM A;  1N5Z A;  2J6K A;  2E5K A;  2A37 A;  1W6X A;  2FPF A;  1B07 A;  3VS4 A;  5EC7 A;  4JJC A;  2YT6 A;  1JXO A;  2DX1 A;  2OJ2 A;  2KT8 A;  4D8D A;  1UTI A;  4RTU A;  3U23 A;  2KGT A;  2M0Y A;  2KRN A;  1M8M A;  2DE0 X;  1WDX A;  2V1R A;  2ENM A;  1ZUU A;  4FSS A;  4ORZ A;  2RQT A;  3THK A;  2KRM A;  2KXD A;  1M3B A;  2ESW A;  3R6N A;  1ZBJ A;  3SEM A;  4GBQ A;  2J7I A;  1G2B A;  2LCS A;  1T0J A;  1NG2 A;  2HEQ A;  1FMK A;  1GFC A;  4HXJ A;  2CT3 A;  2LX7 A;  1CSK A;  1RLP C;  3M0U A;  1GCQ A;  2DA9 A;  1KSW A;  1UGV A;  3PVL A;  1U06 A;  2JW4 A;  5L23 A;  1K1Z A;  4AFS C;  1PRM C;  2RMO A;  2RN8 A;  1AZE A;  4AG2 C;  2JMA A;  3EHR A;  2L3S A;  5HCK A;  2P4R A;  1WXU A;  2ABL A;  3VS0 A;  4J9F A;  1QKX A;  1RUW A;  1XOV A;  4Z89 A;  1WXT A;  2EYX A;  1M3C A;  2DL8 A;  1ARK A;  2FRY A;  4IIO A;  5FWC A;  1SPK A;  1BBZ A;  2LMJ A;  1GCQ C;  1JEG A;  4AFZ C;  1T0H A;  2L2P A;  2EYY A;  4ESR A;  4JZ4 A;  2DNU A;  1BB9 A;  3M0S A;  2BZX A;  3M0T A;  2K7A A;  2M51 A;  1M27 C;  4Z88 A;  1SHG A;  2CUB A;  2L3P A;  1PKT A;  1A0N B;  4OMN A;  2EYW A;  1OV3 A;  2O9S A;  2HCK A;  5FWB A;  1TUC A;  2JMC A;  2LQN A;  4E6R A;  1AOJ A;  2CDT A;  1JO8 A;  1W1F A;  2MIO A;  1K76 A;  4RUG A;  2JS2 A;  1AEY A;  4J9E A;  3EG1 A;  2FO0 A;  2EBP A;  1RLQ C;  2EW3 A;  2GTJ A;  3VS1 A;  1OPK A;  1PKS A;  1H8K A;  1ZX6 A;  2C0O A;  2DL4 A;  3M0Q A;  2GGR A;  2FPD A;  1YNZ A;  1AD5 A;  2LJ3 A;  1WFW A;  2GNC A;  1GFD A;  1K0X A;  2DRK A;  2B86 A;  2CH4 A;  3A98 A;  1UDL A;  2AZS A;  3VRY A;  2J6O A;  2AK5 A;  2RQW A;  1OEB A;  1B3Q A;  2RF0 A;  1I07 A;  3PE0 A;  4ZNX A;  1U5S A;  2EGE A;  1K9A A;  1AWW A;  2FG0 A;  2GQI A;  1VYT A;  2DIL A;  1WIE A;  1GBR A;  3I35 A;  1Z9Z A;  1UG1 A;  1KJW A;  3M0P A;  2L0A A;  2PNI A;  2MCN A;  1H92 A;  2DMO A;  3REB B;  1K0S A;  3QWY A;  1W70 A;  3VS6 A;  2RQR A;  1AVZ C;  4KRT A;  4OMM A;  1HD3 A;  1WYX A;  2NWM A;  4RTT A;  3EG0 A;  1ZUY A;  3EGU A;  2YSQ A;  2ED1 A;  1ZSG A;  4AG1 C;  1X6B A;  2ROL A;  1UHC A;  1H3H A;  1UJ0 A;  1T3L A;  2KRS A;  1YCS B;  2YDL A;  1E7O A;  3H41 A;  1EFN A;  5FW9 A;  2I0N A;  4OMO A;  1SSH A;  2KNB B;  2JM9 A;  1WLP B;  2QDL A;  1SRL A;  1V1C A;  2RPN A;  4AFQ C;  4F16 A;  2L3Q A;  2JT4 A;  1OPL A;  1K4U S; 
#chains in the Genus database with same CATH topology
 2K6D A;  3DLM A;  5GJW B;  1YWO A;  3CXC P;  2EAY A;  3OS0 A;  2X35 A;  3EFO A;  3RNJ A;  2CT4 A;  1UUE A;  2NUZ A;  4WCI A;  2K3Y A;  2ECZ A;  2KRO A;  2OAW A;  3SFM A;  2G6F X;  2KE9 A;  1G83 A;  2V8J A;  4AFU C;  1VQO Q;  3CC7 T;  4UC4 A;  1BCM A;  2RJD A;  3FJP A;  3EFS A;  3CMA T;  1VQN T;  1M1F A;  2KYB A;  4PFO A;  4LUE A;  1X27 A;  2EJF A;  2D0N A;  3CBO A;  3QO3 A;  3EHQ A;  2YUO A;  5KYN A;  1Q81 R;  5GMK h;  1JXM A;  2K5I A;  2W0Z A;  2F69 A;  4MML A;  3G71 T;  2LJ0 A;  3JAM E;  1Q86 C;  2MK5 A;  2DET A;  4F04 B;  4RTY A;  1IZ6 A;  3HRS A;  3OYE A;  3QZ9 B;  2MAM A;  3SWN C;  1LNX A;  1GXI E;  1TS9 A;  1YIT Q;  2OTJ T;  1Q82 R;  3PVQ A;  1Q7Y C;  1K9M R;  3JCM V;  2WSF E;  1PNJ A;  1KC8 C;  1IHV A;  4PJO D;  2A0F B;  3I5R A;  1NLP C;  1XQH A;  2O9V A;  2PUO B;  2D8J A;  2HBW A;  3CCQ A;  1VQ5 A;  3CCM Q;  3CPF A;  2X4Y A;  3I55 T;  4F7U F;  5I2M A;  5J26 A;  1O75 A;  2K2M A;  1MMG A;  2A3L A;  2BZY A;  1VYV A;  2DL5 A;  4RKU E;  3ASK A;  1KD1 U;  5CKB A;  1MMD A;  4ZGD B;  4F7U G;  4JPB W;  3JB9 H;  4J9G A;  1N8R C;  3OSV A;  4II1 A;  1R0C B;  2RA2 A;  4M77 B;  4F7U E;  3TSZ A;  3M53 A;  2QEX T;  1YIJ Q;  4JJN K;  3V8L A;  1MGQ A;  1QP2 A;  1X2K A;  5GAO p;  4K11 A;  1PD0 A;  1E6G A;  1QCF A;  2PVD B;  5IHI A;  1QMC A;  2QTX A;  1TU0 B;  1FWZ A;  4LD6 A;  2QQ9 A;  2QK0 A;  1KFZ A;  4X9C A;  1Y96 A;  1X43 A;  4QQD A;  1JJ2 A;  1NYF A;  3CME T;  2VVK A;  1KC8 U;  2A08 A;  1QLY A;  3SHW A;  3OY9 A;  3NTH A;  3G7Z A;  3J81 E;  1ABO A;  4ME7 A;  4J5Y A;  3H8Z A;  3OMG A;  2YLB A;  5HK0 A;  5LJ5 g;  2E12 A;  4A63 B;  3CD6 T;  3ZFJ A;  5FU7 B;  4OMF B;  4C92 F;  3I56 Q;  4JS4 A;  1PSF A;  2E10 A;  2KR3 A;  3A8L B;  1BK2 A;  2QXF A;  5GAN 2;  1UHF A;  3NFC A;  2EQU A;  2XG8 D;  1JQQ A;  4C5E A;  3P8H A;  4C92 G;  3CCV T;  5AT1 B;  1X6G A;  4J8O A;  4M78 D;  2LQK A;  4OVA A;  2F2X A;  2FRW A;  4M7A C;  5FLX E;  2OI3 A;  4N0A C;  4JJD A;  1KQS S;  1YI2 T;  3OYA A;  3WVD B;  4XTY A;  2RQV A;  2IVW A;  3CC2 T;  1VQP Q;  4ELZ C;  4PFZ A;  2D9T A;  2VKN A;  2V8I A;  2X3X D;  1PRL C;  3CC4 T;  2MOX A;  4J9D A;  1VQ6 T;  4RTV A;  1TSF A;  2HD0 A;  3M57 A;  1N5Z A;  4BDZ A;  2QYZ A;  2A37 A;  3URG A;  4M75 D;  1K8A R;  4JUV A;  1IHW A;  3G4S A;  3VS4 A;  2KK4 A;  1V29 B;  2P4T A;  1BI0 A;  2DX1 A;  2RH2 A;  2OTL T;  2KT8 A;  4D8D A;  4PJO A;  1KK7 A;  2M0Y A;  1M8M A;  1SKU B;  1C1A A;  5CAI A;  5FRN A;  1SF9 A;  2KRM A;  5GMK i;  1M3B A;  3R6N A;  1ZBJ A;  3SEM A;  4GBQ A;  5KE3 A;  1G2B A;  2LCS A;  4C8Q D;  4QVC A;  2R57 A;  4IUP A;  1VQ8 Q;  3JB9 F;  4HXJ A;  2MPX C;  2AHJ B;  3E19 A;  2XHC A;  5CKH A;  2ZPG B;  3SD4 A;  5GAN 4;  3QDR B;  1UGR B;  1RLP C;  2B8A A;  4BAC A;  4MDW A;  3JB9 G;  1U06 A;  3CCL T;  3I56 T;  5L23 A;  3CCE Q;  3SWN B;  4DQ2 A;  1XNI A;  4MDX A;  1KQS P;  4FW1 A;  2M16 A;  4M7D F;  5D7U A;  1YJN A;  4M7A D;  2F5T X;  1VQ7 T;  2ABL A;  3V8K A;  2QTV A;  3NTK A;  4XU3 A;  3JRZ A;  2DTH A;  4M7D G;  2X51 A;  2PU9 B;  4EPC A;  3HKS A;  4IIO A;  1VQ4 T;  1S72 Q;  2JTM A;  2KQW A;  1GCQ C;  1NZ9 A;  1JEG A;  4BI8 B;  2P0Q A;  2KVQ G;  1T0H A;  3SWN A;  2L2P A;  4IUT A;  3LLR A;  2O4X A;  3CBM A;  3M0S A;  4Y91 A;  4BY6 C;  2BZX A;  3M0T A;  2M51 A;  1M27 C;  3KBG A;  4Z88 A;  2CGH A;  1PKT A;  3M5A A;  2CZ0 B;  2EYW A;  1VUB A;  2F5K A;  2O9S A;  2L8D A;  1M1K U;  2JMC A;  1RAB B;  1K76 A;  1UEB A;  3OMC A;  4Z02 A;  2JZ2 A;  3VS1 A;  1PKS A;  2LCC A;  1C6V X;  2RI2 A;  2VYT A;  4M78 A;  4M75 B;  2RHY A;  1OYX A;  1K0X A;  1RAH B;  1I5L A;  1B34 A;  4N4H A;  1YHQ Q;  2CH4 A;  5KYY A;  2MI6 A;  3VRY A;  4XQ3 A;  1SSF A;  2RQW A;  1B3Q A;  1KC8 R;  4B6M A;  2K2V A;  2EGE A;  4EDU A;  3QPH A;  1G3S A;  1VIE A;  2QAZ A;  5I2S A;  1AWW A;  5IN1 A;  4KUD K;  3OYI A;  4V2S A;  3I35 A;  4M75 A;  1Z9Z A;  1KJW A;  3M0P A;  5D6X A;  2L0A A;  1PD1 A;  3CCS Q;  1VQO A;  1B7T A;  4OP0 A;  3LX7 A;  3QWY A;  2XDB A;  2V8K A;  3EH2 A;  4C8Q B;  4E7J A;  4HT8 A;  3J80 E;  2DAQ A;  2CP6 A;  2ZCF B;  2NWM A;  2RD1 A;  3CCR A;  3EGU A;  1QQJ A;  1N8R R;  2HQH A;  2FZK B;  3NTI A;  4LDX A;  2ED1 A;  4RCC A;  1X6B A;  4LDV A;  2KRS A;  1YCS B;  1E7O A;  4XAX B;  2HL5 C;  3RKX A;  4M7A B;  5GAM f;  5GAO n;  1SSH A;  3MET A;  3WXM B;  4C8Q A;  2KNB B;  4PJL A;  1V1C A;  2HL3 A;  2RPN A;  4JRK A;  2YRD A;  1M9S A;  1YIT A;  2DXC A;  1NEB A;  4CI0 C;  3PGG A;  1W4S A;  3MP1 A;  2RQU A;  1KQ2 A;  1ZSZ A;  2HZY A;  4HT9 A;  4PJN A;  3UT1 A;  4C5H A;  3FIF A;  3G6E Q;  2BUD A;  4KGZ B;  3RER A;  1QVG A;  4M7A A;  4RMO A;  4BE1 A;  1K73 U;  3S3O A;  3X26 B;  2DL3 A;  3HPW A;  2ATC B;  1NBE B;  5KE2 A;  2DKG A;  4ZN1 A;  1D1B A;  1U1S A;  3OW2 S;  5FRM A;  3MEV A;  1HK9 A;  4QVD A;  3WVE B;  5IAY A;  1X69 A;  4NL2 A;  1QVF P;  2CSQ A;  4DEX A;  2R5A A;  2COW A;  2E70 A;  2LX9 A;  1WHJ A;  5GAO m;  1U1T A;  5I22 A;  3CC7 Q;  4ZTJ A;  2CSI A;  4DA4 A;  1WHL A;  1RI9 A;  2EQI A;  4FSX A;  4PK4 A;  1YJ9 T;  2FVU A;  4EMK C;  3CMA Q;  3CPW S;  1VQN Q;  3JCM f;  2RJC A;  4L59 A;  4R55 A;  2LNH B;  4OGE A;  2MMP A;  2E3H A;  1YWP A;  2SRC A;  2JXB A;  4PNO A;  3CBP A;  1I1J A;  2C0I A;  2CZ1 B;  4M4Z A;  3G71 Q;  4HVU A;  4A54 A;  1WZO A;  2DYB A;  5FU6 C;  1VQL A;  4QT7 A;  2EVR A;  2O31 A;  4A53 A;  3JCM W;  2KXC A;  1VIF A;  2DD5 A;  5IXB A;  3IQL A;  3QJ6 A;  3C94 A;  4PLI A;  3T9N A;  3L2V A;  2J06 A;  3HHT B;  3NMZ C;  2OTJ Q;  1UJY A;  2D1X A;  3EGD A;  2JOY A;  3E1S A;  5GAN g;  3P8B B;  1YJW T;  4LD9 K;  1Z9Q A;  3M0R A;  2H8H A;  3UA7 A;  2AZV A;  5LJ3 e;  4OB2 B;  3H0F A;  1T3S A;  3RKY A;  2PZ1 A;  3OA6 A;  2ZPE B;  4NL3 A;  2JM8 A;  3LWI A;  2EGA A;  3EGX B;  4RG8 A;  2EGC A;  1Y71 A;  4BY6 B;  3QKJ A;  1TUD A;  1QWE A;  2MWO A;  2CKK A;  3I55 Q;  4M77 D;  2Y4Y A;  4DBH A;  1WJS A;  2ZZD A;  1Y07 A;  1WQ7 A;  2DVJ A;  4J9B A;  3G4S T;  3A8O B;  1HSQ A;  1AWX A;  2RHZ A;  5GAM j;  3TVT A;  4XU1 A;  2C0T A;  2O01 E;  4RTX A;  5AYF A;  2EPD A;  3VS5 A;  1IGQ A;  1VQP A;  3VS3 A;  2QEX Q;  2ED0 A;  3CPW P;  1JB0 E;  2K5F A;  3O8V A;  1G3T A;  4PJO F;  3JCM e;  2YUN A;  4A4K A;  2E6Z A;  1NM7 A;  3BFM A;  5KYW B;  3MPU B;  2EJG A;  1KD1 C;  4PJO G;  2M9U A;  3JV3 A;  1VQM T;  1EIF A;  2QAS A;  3CME Q;  1WHH A;  2A36 A;  2L89 A;  3CCU A;  1D1C A;  1GCP A;  5GAN 8;  1NLO C;  1GL5 A;  1I4K 1;  1TXQ A;  2E41 A;  2VXF A;  4CC4 B;  2P0P A;  1S1N A;  3MEA A;  3OYD A;  4FU6 A;  1UGQ B;  1KIK A;  4E7S A;  5KYW A;  3CD6 Q;  4EIK A;  1FYN A;  3SB2 A;  3RR6 A;  2DZC A;  1SEM A;  5GAN 6;  2GQV A;  5GAN h;  5GAM d;  2LP5 A;  5IHN A;  2ZAE A;  1VQK A;  2VC8 A;  2BKD N;  4PKC C;  4O5V A;  2DRM A;  1MNE A;  1I0C A;  1KHC A;  3CCV Q;  3FB9 A;  2RI5 A;  3DB4 A;  1WJR A;  3CXC A;  2PQW A;  2GCX A;  3E2U A;  3RKW A;  4HCB A;  1UEC A;  4XTW A;  1X2Q A;  3QUI A;  3Q1J A;  4BD3 A;  2EFI A;  2E5K A;  3CCE A;  2RJF A;  2YWW A;  4J6W A;  1PG5 B;  5IT9 E;  1YI2 Q;  2QA4 A;  2P0K A;  3MO8 A;  3OBW A;  3CC2 Q;  2X4J A;  1JJ2 P;  3M58 A;  1IRX A;  2BE9 B;  3INZ A;  2XK0 A;  4RTU A;  3CC4 Q;  1X6O A;  3S6W A;  2KGT A;  3OYF A;  1VQ6 Q;  5GMK l;  5HK3 A;  2DD4 A;  2KRN A;  3JCM J;  1YFN A;  2JVV A;  1ZUU A;  5KCO A;  4FSS A;  4OB0 B;  3THK A;  3VUB A;  2KXD A;  3RIR A;  2JN0 A;  5HKC A;  3LWH A;  3OYC A;  2RHI A;  2QG9 B;  1T0J A;  1X75 C;  1NG2 A;  1RI0 A;  2CP0 A;  4HCZ A;  2OTL Q;  4OB1 B;  3JCM d;  4M78 F;  1MMA A;  1G5V A;  2FZC B;  1ZQ1 A;  1G3Y A;  2AIR B;  3M0U A;  3A8M B;  5DM7 R;  3MHX A;  3PVL A;  2LRQ A;  1K1Z A;  4BI4 A;  4M78 G;  2OAU A;  1FX7 A;  4M77 A;  2RMO A;  2RN8 A;  4EMK B;  1BI3 A;  4C92 C;  2R5M A;  2JMA A;  3VJP A;  3S3N A;  4QVZ A;  2EIF A;  4XU0 A;  1R8O B;  2HQX A;  1RUW A;  3RMQ A;  3PTA A;  4HCC A;  3JCM Q;  1IGU A;  1WXT A;  3MCA B;  4M75 F;  4X34 A;  2HKQ B;  2DYI A;  3CCL Q;  2DK3 A;  1ARK A;  3VYH B;  2NUP B;  3UPU A;  3A8G B;  3GNG A;  2COZ A;  1QP3 A;  1WGS A;  3TCJ A;  2Z0W A;  1VQ7 Q;  1SHG A;  2CUB A;  2L3P A;  3C4S A;  3OS1 A;  4C92 E;  4OMN A;  2HCK A;  5FWB A;  1TUC A;  2CP2 A;  1AOJ A;  2MIO A;  1VQ4 Q;  2JS2 A;  1AEY A;  4PJJ A;  4C8Q F;  2EBP A;  1KQ1 A;  1OPK A;  4GY5 A;  5HY6 A;  1H8K A;  1OI1 A;  2FHD A;  2FPD A;  1BYM A;  3OYJ A;  3MEW A;  3MEU A;  1YNZ A;  1VQ9 T;  2LJ3 A;  1WFW A;  3TQ7 P;  1BIA A;  4X9D A;  4FT2 A;  2DRK A;  2JNG A;  2B86 A;  2FZG B;  4XTU A;  4C0F A;  3PIO A;  3GF5 A;  2YLC A;  3A98 A;  1BIB A;  2CYZ B;  2J6O A;  2AK5 A;  1TUG B;  5GAM g;  2RF0 A;  2EWN A;  4ZNX A;  1U5S A;  1C0M A;  3A5Z B;  4BB7 A;  2NLU A;  2XD0 A;  2VB6 A;  2DIL A;  3BDL A;  1GBR A;  5GMK e;  1UG1 A;  3HTR A;  2PNI A;  1H92 A;  3CCJ A;  1W70 A;  2WSC E;  4JRP A;  4HKE A;  1M90 U;  3VS6 A;  1AVZ C;  4KRT A;  3ER0 A;  4OB3 B;  1M1K C;  3HFN A;  1OU8 A;  3OYY A;  5DLO A;  1WYX A;  3RUX A;  3QJY A;  4IKF A;  5LJ5 h;  2E5Q A;  1VQL T;  3OBY A;  1BI1 A;  2MF2 A;  2EQM A;  1LPL A;  4M7D C;  4BE0 A;  4AG1 C;  1UHC A;  1H3H A;  3LGL A;  4QW2 A;  3H41 A;  3CC7 A;  4ELY C;  3SDZ A;  5FW9 A;  1WHG A;  2XIC A;  3QYH B;  1D3B B;  3CMA A;  1VQN A;  1NPR A;  5GMK j;  2JT4 A;  3VRZ A;  3FDR A;  2VXE A;  1NJI U;  2K79 A;  3TSW A;  3PMT A;  2J6F A;  2AKL A;  4F7U B;  3NHN A;  2DEQ A;  3G1J A;  4BI3 A;  1LCK A;  4ZGE B;  4E7Z A;  3RES A;  3VV0 A;  2KI7 A;  1QVG S;  5DLQ E;  4LE9 A;  4M7D E;  2M02 A;  5GAO q;  2F1L A;  2LQW A;  2QQR A;  2GF7 A;  4MZP A;  2AKK A;  2XKO C;  2OTJ A;  1M8V A;  5IHK A;  4A4E A;  2DL7 A;  3H6Z A;  2ZPI B;  1OQK A;  3RMS A;  2K3B A;  1KD1 R;  2DXB A;  2O88 A;  3CEY A;  4HCK A;  5CIU A;  1OU9 A;  1JBM A;  2D6F A;  2EQJ A;  1TTH B;  3LYI A;  4F7U A;  2GBQ A;  3UA6 A;  2GFU A;  5GAM h;  2H3J A;  2E1H A;  5CKF A;  3CQT A;  5CKE A;  1TWB A;  3LH0 A;  2KT1 A;  4OGC A;  2CS7 A;  2Y90 A;  1IRE B;  3I55 A;  3HP9 A;  3E9G A;  2A28 A;  3AHU A;  4E47 A;  4DBR A;  4JLG A;  5A0G A;  1Y57 A;  4J6Y A;  4FYY B;  3CCU T;  5GMK m;  1YJ9 Q;  2V1Q A;  2LTO A;  1F1B B;  4C92 B;  4LDW A;  3QZ5 B;  1QVF S;  3JB9 I;  5IH2 A;  1K73 C;  1MMN A;  2X3W D;  2X4X A;  5EG2 A;  5A2Q E;  2P84 A;  4E7H A;  3ME9 A;  1Y0M A;  4OMQ A;  1WXB A;  4NS5 A;  4RTZ A;  5LL6 S;  2NUT B;  1PHT A;  2DM1 A;  2NYS A;  1QVG P;  3PFS A;  3CME A;  1UE9 A;  3L2R A;  3ULR B;  1MV0 B;  3CCQ T;  1VQ5 T;  3TEE A;  3VYG A;  2YHT A;  1EZZ B;  1YJW Q;  1WA7 A;  2QA4 T;  5L8R E;  1PCX A;  1W2B A;  2KMT A;  4RG2 A;  3L2U A;  1G3W A;  4F17 A;  3CD6 A;  4YTL A;  1K9M U;  2YRV A;  3EG3 A;  3EFR A;  1AWO A;  4LN2 A;  2YRC A;  3QG1 A;  5LJ3 f;  4DBF A;  2BTT A;  2F2V A;  2ROT A;  2L5Q A;  2YUP A;  2LC4 A;  4FYX B;  5CK9 A;  4E7L A;  3FRN A;  2J05 A;  2VV5 A;  3G4S Q;  1RAD B;  1NEG A;  4J9C A;  3JCM b;  1SHF A;  2EYZ A;  4N0A A;  4J83 A;  3CCM A;  3NGP A;  3NPF A;  1H3Z A;  1BKB A;  1YI2 A;  2RB6 A;  2YUQ A;  1J3T A;  2I2L A;  4HVW A;  2LCL A;  4Z8A A;  1FMW A;  3M56 A;  5D6W A;  3CC4 A;  1VQ6 A;  3M55 A;  3C0C A;  4L6V 5;  5KYU B;  5M9O A;  1E6H A;  1BU1 A;  3H0I A;  4AT1 B;  3QII A;  1SRM A;  2L3R A;  4C0D C;  2H3E B;  2HSP A;  4PL6 A;  4DEY A;  1VQM Q;  3QHS A;  1VA7 A;  4KGX B;  4OML A;  4R0K A;  2WAC A;  1YIJ A;  1RAA B;  2FEI A;  3H0H A;  4M77 F;  2EKH A;  2D0Q B;  1CKB A;  2C06 A;  2K4Y A;  1CKA A;  3DB3 A;  1WJQ A;  3EH1 A;  3N5B B;  4M7D B;  5J3B A;  3OB9 A;  3EAE A;  4M77 G;  5KH6 A;  3QSU A;  2K9G A;  1PWT A;  3C95 A;  1WI7 A;  2DXT A;  2FPE A;  1YJN Q;  1UB4 A;  2K5L A;  4JRI A;  1N6A A;  5KYX B;  1OZ2 A;  5GAN 7;  3OYH A;  1W6X A;  1RAI B;  1M5Q 1;  2FPF A;  1NJI R;  1B07 A;  1H64 1;  3GNF B;  3HL8 A;  5EC7 A;  2YT6 A;  3H9N A;  5FU7 C;  2OJ2 A;  2CP5 A;  4BE2 A;  3LGF A;  3MP6 A;  1UTI A;  3M54 A;  2BIV A;  3U23 A;  4ZTF A;  1M2V B;  4KUI A;  1HXD A;  3CCL A;  3I56 A;  2DE0 X;  1NE8 A;  2DPP B;  1WDX A;  8AT1 B;  2V1R A;  1FXX A;  4ORZ A;  2DXU A;  1N27 A;  2J7I A;  1WPY A;  3PMI A;  2DJZ A;  3GIB A;  2HEQ A;  1FMK A;  2JTF A;  1GFC A;  1M1K R;  2CT3 A;  4Y28 E;  4B9X A;  3L1A A;  1CSK A;  2VAS A;  3EFO B;  3OSS C;  2CP3 A;  1GCQ A;  1VQ4 A;  4PJO C;  1UGV A;  3V8J A;  1JJ2 S;  3L2Z A;  3HFO A;  3EGX A;  4FIB A;  1LVK A;  1PRM C;  5LJ3 j;  2HSE B;  1AZE A;  2RK1 A;  4AG2 C;  1JRI A;  2HQE A;  3CCJ T;  4EMG A;  3BY7 A;  1K8A U;  1WXU A;  3VS0 A;  6AT1 B;  2K3X A;  4ANJ A;  5GAO r;  4E2F B;  1D0Y A;  4Z89 A;  2EYX A;  1M3C A;  2K57 A;  3OS5 A;  2FRY A;  3ZBD A;  1SPK A;  4MMK A;  2LMJ A;  2DFU A;  1XTD A;  4PJO E;  4XTV A;  2E6N A;  4DOV A;  4ESR A;  4JZ4 A;  1OZ3 A;  1I5O B;  4KUL A;  4FM4 B;  2HKN A;  4JLI A;  1YJN T;  1KHI A;  3CCR Q;  4ZGJ B;  2AT1 B;  2COY A;  2LQN A;  4E6R A;  1NPP A;  2CDT A;  3JCM X;  1W1F A;  4FYW B;  4C0Z A;  5CQX A;  4RUG A;  3OYM A;  5J39 A;  5D6Y A;  2VGN A;  3OW2 A;  1VQ8 A;  2RHU A;  4JDS A;  1RLQ C;  2RK2 A;  2EW3 A;  3M0Q A;  1ZX6 A;  2GFA A;  4NOY A;  9ATC B;  2LDM A;  4MZM A;  5LJ3 d;  3JB9 J;  2BE7 D;  3OYK A;  3CPW A;  4C5G A;  4XU2 A;  4IUQ A;  2EQK A;  3GLX A;  3BW1 A;  1D1A A;  2AZS A;  4TVR A;  1WHK A;  2DEU A;  1OEB A;  1K9A A;  2CP7 A;  4XTZ A;  1VQ9 Q;  2DVE A;  3P8D A;  2GQI A;  1QCO A;  1VYT A;  4B9W A;  2Y4X A;  3X28 B;  1G8X A;  1S72 A;  3JSC A;  1K73 R;  4M78 C;  3REB B;  1K0S A;  2ZPH B;  1WNL A;  1HYO A;  1PM3 A;  2PVO B;  2RQR A;  3MJX A;  4XTX A;  2X9H A;  3EG9 B;  1VOM A;  1RAG B;  1Y7X A;  4RTT A;  3X24 B;  1DJ7 B;  3EG0 A;  3QXE B;  1BCO A;  1ZUY A;  1Y96 B;  4E7K A;  3PT9 A;  2ZGW A;  4QQ6 A;  1YBY A;  3KUF A;  3UDC A;  5GAN 3;  3VU3 C;  1Q86 U;  2ROL A;  3QDF A;  2G3R A;  2YDL A;  1EFN A;  1RAF B;  4C0D B;  4D6W A;  4M75 C;  4OMO A;  2E64 A;  1VQO T;  2JM9 A;  1WLP B;  2QDL A;  1SRL A;  4F16 A;  1Q7Y U;  3EG9 A;  2L3Q A;  4M78 E;  4GLK A;  1VQL Q;  2VUB A;  1OPL A;  1K4U S;  5GJV B;  1M2O A;  5KCH A;  2DIG A;  2EKO A;  4CC7 A;  2FL7 A;  1ZUK A;  2JUF A;  3UAT A;  1QVP A;  5FU6 B;  3BE3 A;  3UF4 A;  3CCR T;  1I81 A;  4CC2 A;  4D8K A;  1YHQ A;  2VWF A;  1TG0 A;  4FT4 A;  1YP5 A;  5GAN f;  2SEM A;  1VYU A;  2E65 A;  2QGF B;  3PIP A;  4M75 G;  1YJ9 A;  4EMK A;  1ABQ A;  2QQS A;  1MUZ A;  2E4H A;  4OMP A;  1GBQ A;  4C0G A;  1I8F A;  4X1V A;  1M90 C;  4C8Q C;  4M75 E;  1U3O A;  1YIT T;  3CCS A;  3OYN A;  2KEA A;  1RAE B;  4FL6 A;  1AHJ B;  4GLM A;  1RL2 A;  4BUG A;  2NUP A;  3F70 A;  1N8R U;  4J6X A;  2CZ7 B;  1ZSZ C;  1QKW A;  4IIM A;  1ZLM A;  2HAX A;  4IUU A;  5A0L A;  1D0Z A;  1R77 A;  1M4Z A;  5IXF A;  4CC3 A;  3QBY A;  2RM4 A;  4C8Q G;  3VKI A;  5A0D A;  3CCM T;  1WQW A;  4O6J A;  2WSE E;  1YJW A;  2R58 A;  2ZPB B;  2HMA A;  2IG0 A;  3O5Z A;  2W10 A;  1NJI C;  2LJ1 A;  4C8Q E;  3EG2 A;  2YXY A;  2HDA A;  4PJO B;  1OX8 A;  1WX6 A;  1ZBX A;  4M7A F;  5GAO l;  4R56 A;  2DTI A;  2DF6 A;  3LH5 A;  2JS0 A;  2PUK B;  3GBQ A;  3RBB B;  4DOW A;  1Q95 G;  3VS2 A;  4WF2 A;  4WTO B;  4F14 A;  2M0O A;  4M7A G;  4PLL A;  2HNI A;  4C92 D;  4HVV A;  3X20 B;  2KDS A;  3A8H B;  4CRI A;  5LJ3 g;  4RTW A;  3D7S B;  4MZT A;  3G6E A;  3UWN A;  2D8H A;  1YIJ T;  3A1P A;  1M30 A;  5CR2 A;  2XMF A;  4M7A E;  1JU5 C;  1NYG A;  1WHM A;  1MND A;  4J7I A;  3CCU Q;  1SG5 A;  5GAN e;  2JTE A;  2FYK A;  1HJD A;  2LZ6 B;  2GTO A;  4BDY A;  4RCB A;  4ATO A;  1IB8 A;  2BZ8 A;  4N4G A;  3JCM c;  2KAF A;  3I5S A;  1W2B S;  2VGM A;  1VQK Q;  4KH0 B;  1N9R A;  2DJQ A;  1GRI A;  2KYM A;  1VQM A;  1LOJ A;  4LUD A;  4PJM A;  3REA B;  2F2W A;  3GOX A;  3KFV A;  3JCM g;  2QQA A;  2CUD A;  4KGV B;  3OYG A;  2LVM A;  3G71 A;  3CCQ Q;  1VQ5 Q;  3E9F A;  4KBM B;  1XJW B;  2O4X B;  1OX9 A;  4J9I A;  2QA4 Q;  5GAN j;  2DLP A;  4P5N A;  3AT1 B;  1EX4 A;  2IIM A;  2PVG B;  5ECA A;  2O2O A;  1D3B A;  3TU4 K;  4FYV B;  4JZ3 A;  2V26 A;  3M59 A;  3FLG A;  3DLL A;  2LQ8 A;  3I9Q A;  4JJB A;  4QQG A;  5I11 A;  1IO6 A;  1M1G A;  1FMV A;  1AZG B;  4A4H A;  4Y92 A;  7AT1 B;  3KXT A;  1Q81 C;  1QWF A;  4L5G A;  4IUV A;  4J9H A;  4C5I A;  1VQP T;  3DKM A;  1UFF A;  2CRE A;  2DBK A;  1YN8 A;  1OOT A;  3JB9 D;  4M78 B;  3ZL7 C;  4HA8 A;  1M3A A;  1YCY A;  1ACM B;  5LJ3 h;  3M4Y A;  1B34 B;  2OX7 A;  3VS7 A;  5DY9 A;  1Q82 C;  1K9M C;  1AWJ A;  1D09 B;  5KYY B;  2KBT A;  5CO7 A;  1KQS A;  2E3I A;  3FJ5 A;  4KH1 B;  1Q86 R;  2CH4 W;  1AT1 B;  2PTK A;  1P92 A;  2RNA A;  4M7D D;  1MV3 A;  2RI3 A;  2DER A;  3QWX X;  1W2B P;  4LNP A;  5LJ5 f;  2XI9 A;  2DBM A;  2EJ9 A;  2J6K A;  5GAN d;  2QEX A;  1Q7Y R;  4XK8 E;  5I21 A;  2XDD A;  4JJC A;  2HBP A;  1UGS B;  1JXO A;  1VQK T;  1VQ8 T;  2MYS A;  1KG1 A;  2LT4 A;  3PNW C;  3JCM h;  1Q81 U;  2ENM A;  1O9S A;  4C92 A;  3OYB A;  2RQT A;  1ZA2 B;  3TRE A;  2ESW A;  5C0M A;  2QGG A;  3CCE T;  3ZEH A;  3HRT A;  2M1H A;  1LJO A;  2RJE A;  3GPL A;  1IXD A;  2LX7 A;  3OS2 A;  1Q82 U;  2XU8 A;  3OQ5 A;  3GP8 A;  2QI2 A;  3L2W A;  2NUT A;  5CVI A;  3RDV A;  1ZSZ B;  1KSW A;  2DA9 A;  1D0X A;  4A4F A;  2IPO B;  1RAC B;  3V7R A;  3L2Q A;  2JW4 A;  4LXC A;  4ZN3 A;  4AFS C;  1S72 T;  3CCV A;  5GAN 5;  1BI2 A;  2XID A;  3MP8 A;  3EHR A;  2L3S A;  4EMH A;  5HCK A;  1TH7 A;  2P4R A;  3J7A F;  4LDU A;  4J9F A;  1QKX A;  1XOV A;  4A4G A;  5C6S A;  3V7C A;  2DL8 A;  3CC2 A;  5FWC A;  2X4W A;  1BBZ A;  3QYG B;  4AFZ C;  5LJ5 e;  2ZPF B;  2FB7 A;  2EYY A;  3CCJ Q;  1VQ9 A;  2DNU A;  1BB9 A;  4M77 C;  3OYL A;  2DTO A;  2K7A A;  2KSS A;  5CCA A;  4JRQ A;  1R0B G;  1OUL A;  1QCN A;  3LW5 E;  1M90 R;  1QW1 A;  3L42 A;  3JCM P;  1A0N B;  2XDP A;  1ZHI A;  3M4G A;  2CZ6 B;  1OV3 A;  4J7F A;  2MWP A;  3VUZ A;  3HSB A;  1PC0 A;  1JO8 A;  1YHQ T;  2OTL A;  4J9E A;  3EG1 A;  2FO0 A;  2GTJ A;  3CXC S;  2C0O A;  2DL4 A;  3HRU A;  5KYU A;  2GGR A;  4FCY A;  1V76 A;  2A7Y A;  1AD5 A;  2GNC A;  1GFD A;  3X25 B;  5LJ5 j;  3FEO A;  1K8A C;  3EGD B;  4M77 E;  5FRO A;  5CQY A;  4DBQ A;  3CCS T;  4N4I A;  1UDL A;  1UGP B;  1I07 A;  3PE0 A;  4FW2 A;  3C12 A;  1TOV A;  4M7D A;  2LT1 A;  2JJ9 A;  1MHN A;  2FG0 A;  4QKU A;  1WIE A;  5GAM e;  1QVF A;  4AMC A;  2MCN A;  5KYX A;  3S3M A;  2DMO A;  8ATC B;  2DIQ A;  2LNV A;  4E7I A;  3M9Q A;  4PFP A;  1VQ7 A;  4OMM A;  3MKD A;  1HD3 A;  2RHX A;  2EYQ A;  4OF1 A;  5CKD A;  2KY9 A;  4KT0 E;  1PSE A;  2DO3 A;  1M2V A;  2YSQ A;  4VUB A;  2QDY B;  3R6O A;  1ZSG A;  3BDU A;  4IUR A;  3FC3 A;  1UJ0 A;  1T3L A;  4LDY A;  4Q5W A;  2I0N A;  3G6E T;  1U8R A;  2RO0 A;  1X01 A;  5LJ5 d;  4JS5 A;  3OW2 P;  1N9S A;  4AFQ C;  1ZA1 B;  2DZ9 A;  3V7S A;  2QQB A; 
#chains in the Genus database with same CATH homology
 3VRZ A;  2K6D A;  5GJW B;  5GJV B;  1YWO A;  1NEB A;  4CC7 A;  2K79 A;  1ZUK A;  3TSW A;  3UAT A;  3UF4 A;  3RNJ A;  4CC2 A;  2CT4 A;  2J6F A;  1UUE A;  2RQU A;  4D8K A;  2AKL A;  2NUZ A;  2VWF A;  4WCI A;  1TG0 A;  3NHN A;  1YP5 A;  1LCK A;  2ECZ A;  2KRO A;  2OAW A;  2SEM A;  1VYU A;  2G6F X;  2KE9 A;  4LE9 A;  1G83 A;  1ABQ A;  4AFU C;  2LQW A;  1MUZ A;  2AKK A;  4OMP A;  2DL3 A;  1GBQ A;  4X1V A;  5IHK A;  2DL7 A;  1U3O A;  2K3B A;  2KYB A;  2O88 A;  4HCK A;  4LUE A;  1X27 A;  2KEA A;  2D0N A;  3EHQ A;  2YUO A;  4GLM A;  2GBQ A;  3UA6 A;  1X69 A;  2CSQ A;  4DEX A;  1JXM A;  2W0Z A;  2LJ0 A;  1QKW A;  3CQT A;  5I22 A;  4IIM A;  1ZLM A;  2CSI A;  4RTY A;  1RI9 A;  2EQI A;  2KT1 A;  5IXF A;  4CC3 A;  2LNH B;  3PVQ A;  1YWP A;  2SRC A;  2A28 A;  3O5Z A;  2JXB A;  2W10 A;  1I1J A;  2C0I A;  2LJ1 A;  4M4Z A;  3EG2 A;  2HDA A;  4HVU A;  1Y57 A;  2DYB A;  1WX6 A;  1PNJ A;  4QT7 A;  2EVR A;  2O31 A;  3I5R A;  2DF6 A;  3LH5 A;  2JS0 A;  1NLP C;  2KXC A;  2V1Q A;  2O9V A;  3GBQ A;  3RBB B;  5IXB A;  2D8J A;  3VS2 A;  3IQL A;  2HBW A;  4F14 A;  2J06 A;  3NMZ C;  4HVV A;  5IH2 A;  1UJY A;  2D1X A;  4RTW A;  2X3W D;  2D8H A;  2K2M A;  1M30 A;  2XMF A;  2BZY A;  1VYV A;  2DL5 A;  1Z9Q A;  1Y0M A;  2H8H A;  3M0R A;  3UA7 A;  4OMQ A;  1WXB A;  2AZV A;  1JU5 C;  1NYG A;  4RTZ A;  3H0F A;  1T3S A;  4JPB W;  2PZ1 A;  1PHT A;  2DM1 A;  4J9G A;  2JTE A;  1UE9 A;  1HJD A;  2JM8 A;  2LZ6 B;  2GTO A;  2EGA A;  2EGC A;  3ULR B;  1MV0 B;  2BZ8 A;  1TUD A;  1QWE A;  3TSZ A;  3I5S A;  1WA7 A;  2DVJ A;  4J9B A;  1X2K A;  4K11 A;  1E6G A;  1HSQ A;  1QCF A;  4F17 A;  1AWX A;  2DJQ A;  5IHI A;  1GRI A;  2KYM A;  3TVT A;  1KFZ A;  2C0T A;  4LUD A;  3EG3 A;  3REA B;  2F2W A;  4RTX A;  1AWO A;  4LN2 A;  3KFV A;  1X43 A;  2EPD A;  3VS5 A;  2CUD A;  1NYF A;  2VVK A;  3VS3 A;  2BTT A;  2F2V A;  2ROT A;  2ED0 A;  2YUP A;  2A08 A;  1QLY A;  3SHW A;  4J9I A;  2J05 A;  1ABO A;  2DLP A;  2YUN A;  1NEG A;  4J9C A;  1SHF A;  2IIM A;  1NM7 A;  2EYZ A;  5ECA A;  2O2O A;  3NGP A;  4A63 B;  3NPF A;  4JZ3 A;  2YUQ A;  3JV3 A;  1J3T A;  3I9Q A;  4HVW A;  4JJB A;  4Z8A A;  5I11 A;  1IO6 A;  1AZG B;  2KR3 A;  1BK2 A;  2A36 A;  4Y92 A;  1UHF A;  1QWF A;  1JQQ A;  4J9H A;  1GCP A;  3C0C A;  1UFF A;  2CRE A;  2DBK A;  1NLO C;  1E6H A;  1GL5 A;  1YN8 A;  1BU1 A;  3H0I A;  4CC4 B;  1OOT A;  1S1N A;  3ZL7 C;  1M3A A;  1KIK A;  1X6G A;  1SRM A;  2HSP A;  4EIK A;  4DEY A;  2F2X A;  2FRW A;  1FYN A;  1VA7 A;  4OML A;  4R0K A;  3VS7 A;  1SEM A;  2OI3 A;  2FEI A;  4JJD A;  3H0H A;  1AWJ A;  2EKH A;  2LP5 A;  5IHN A;  2KBT A;  1CKB A;  2RQV A;  3FJ5 A;  1CKA A;  2CH4 W;  2DRM A;  1I0C A;  2VKN A;  2PTK A;  2RNA A;  2X3X D;  1PRL C;  2MOX A;  2K9G A;  1MV3 A;  4J9D A;  1UEC A;  1PWT A;  4RTV A;  1WI7 A;  1X2Q A;  3QWX X;  4LNP A;  2FPE A;  2DBM A;  1N5Z A;  2J6K A;  2E5K A;  2A37 A;  1W6X A;  2FPF A;  1B07 A;  3VS4 A;  5EC7 A;  4JJC A;  2YT6 A;  1JXO A;  2DX1 A;  2OJ2 A;  2KT8 A;  4D8D A;  1UTI A;  4RTU A;  3U23 A;  2KGT A;  2M0Y A;  2KRN A;  1M8M A;  2DE0 X;  1WDX A;  2V1R A;  2ENM A;  1ZUU A;  4FSS A;  4ORZ A;  2RQT A;  3THK A;  2KRM A;  2KXD A;  1M3B A;  2ESW A;  3R6N A;  1ZBJ A;  3SEM A;  4GBQ A;  2J7I A;  1G2B A;  2LCS A;  1T0J A;  1NG2 A;  2HEQ A;  1FMK A;  1GFC A;  4HXJ A;  2CT3 A;  2LX7 A;  1CSK A;  1RLP C;  3M0U A;  1GCQ A;  2DA9 A;  1KSW A;  1UGV A;  3PVL A;  1U06 A;  2JW4 A;  5L23 A;  1K1Z A;  4AFS C;  1PRM C;  2RMO A;  2RN8 A;  1AZE A;  4AG2 C;  2JMA A;  3EHR A;  2L3S A;  5HCK A;  2P4R A;  1WXU A;  2ABL A;  3VS0 A;  4J9F A;  1QKX A;  1RUW A;  1XOV A;  4Z89 A;  1WXT A;  2EYX A;  1M3C A;  2DL8 A;  1ARK A;  2FRY A;  4IIO A;  5FWC A;  1SPK A;  1BBZ A;  2LMJ A;  1GCQ C;  1JEG A;  4AFZ C;  1T0H A;  2L2P A;  2EYY A;  4ESR A;  4JZ4 A;  2DNU A;  1BB9 A;  3M0S A;  2BZX A;  3M0T A;  2K7A A;  2M51 A;  1M27 C;  4Z88 A;  1SHG A;  2CUB A;  2L3P A;  1PKT A;  1A0N B;  4OMN A;  2EYW A;  1OV3 A;  2O9S A;  2HCK A;  5FWB A;  1TUC A;  2JMC A;  2LQN A;  4E6R A;  1AOJ A;  2CDT A;  1JO8 A;  1W1F A;  2MIO A;  1K76 A;  4RUG A;  2JS2 A;  1AEY A;  4J9E A;  3EG1 A;  2FO0 A;  2EBP A;  1RLQ C;  2EW3 A;  2GTJ A;  3VS1 A;  1OPK A;  1PKS A;  1H8K A;  1ZX6 A;  2C0O A;  2DL4 A;  3M0Q A;  2GGR A;  2FPD A;  1YNZ A;  1AD5 A;  2LJ3 A;  1WFW A;  2GNC A;  1GFD A;  1K0X A;  2DRK A;  2B86 A;  2CH4 A;  3A98 A;  1UDL A;  2AZS A;  3VRY A;  2J6O A;  2AK5 A;  2RQW A;  1OEB A;  1B3Q A;  2RF0 A;  1I07 A;  3PE0 A;  4ZNX A;  1U5S A;  2EGE A;  1K9A A;  1AWW A;  2FG0 A;  2GQI A;  1VYT A;  2DIL A;  1WIE A;  1GBR A;  3I35 A;  1Z9Z A;  1UG1 A;  1KJW A;  3M0P A;  2L0A A;  2PNI A;  2MCN A;  1H92 A;  2DMO A;  3REB B;  1K0S A;  3QWY A;  1W70 A;  3VS6 A;  2RQR A;  1AVZ C;  4KRT A;  4OMM A;  1HD3 A;  1WYX A;  2NWM A;  4RTT A;  3EG0 A;  1ZUY A;  3EGU A;  2YSQ A;  2ED1 A;  1ZSG A;  4AG1 C;  1X6B A;  2ROL A;  1UHC A;  1H3H A;  1UJ0 A;  1T3L A;  2KRS A;  1YCS B;  2YDL A;  1E7O A;  3H41 A;  1EFN A;  5FW9 A;  2I0N A;  4OMO A;  1SSH A;  2KNB B;  2JM9 A;  1WLP B;  2QDL A;  1SRL A;  1V1C A;  2RPN A;  4AFQ C;  4F16 A;  2L3Q A;  2JT4 A;  1OPL A;  1K4U S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...