4C8QA

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
b'VDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qA00
2ZGWA 3VU3C 4M75B 4XTUA 3SWNB 4F7UB 5GAN7 4A53A 3JCMg 4M7AD 4M7AA 4J6WA 4XU1A 1JRIA 3FJPA 4MMKA 3QUIA 4J6YA 2I2LA 4JLIA 4PJOB 3JCMP 3V8JA 5CAIA 1I4K1 5LJ5e 4M7DA 4PJOE 2DTHA 2DXTA 1B34A 1M5Q1 4C8QF 4Y91A 1I5LA 4HT8A 3BFMA 3JB9H 4C92G 2DVEA 3EFSA 4M77F 4M78F 5I21A 3JCMW 2JN0A 3L1AA 3JB9G 4JRKA 4C92B 2E65A 2QTXA 2DZ9A 3V8LA 3JB9I 3HFOA 3V7SA 4M7AF 2E41A 2RA2A 5LJ5d 5LJ3h 3PGGA 3RERA 1I8FA 4C8QB 1H641 4EMKB 4XU2A 3BW1A 4C8QE 5GAMg 4QVCA 4M7DC 5LJ3f 3BY7A 4M77B 4M78B 4XTXA 4M77E 4M78E 4X9CA 4M75C 3L2ZA 3SWNC 2DJZA 5GMKh 4PJOG 1WPYA 2EJ9A 3RKXA 4C92A 4A54A 3JCMJ 5LJ5j 5GAOr 5LJ5g 2E10A 5GAN3 3V8KA 4M7DD 4J6XA 4M7AE 3JCMh 1KQ1A 1X01A 4N0AC 1Y96B 4XTYA 4XQ3A 5GAOn 4PJOC 5GAOq 1I81A 4XTWA 1WQ7A 3HFNA 3JCMf 1JBMA 1HXDA 3INZA 5GMKl 4NL3A 4M75D 4M75A 3SWNA 2EWNA 3FB9A 4F7UA 4OP0A 5GMKm 5GAN8 1M8VA 4NL2A 4RCBA 3BDUA 4J5YA 5GMKe 4X9DA 3HSBA 4C92C 2VC8A 4C8QG 4V2SA 1BIAA 4MMLA 2K57A 2YLBA 2FYKA 2VXFA 2YLCA 4NOYA 4N0AA 4PNOA 4XU0A 3JCMc 1WNLA 4PJOA 2E1HA 1N9SA 4M77G 1D3BB 2DTOA 4M78G 4HT9A 1Y96A 3JCMV 5GANh 4C8QC 4EMKC 2EJGA 4JUVA 5GAN6 4JRIA 2E64A 3SB2A 4M7DF 5GANf 4M77C 4M78C 3RKWA 1KQ2A 2DZCA 3RIRA 5GAMh 4M7AG 2DXUA 4C92D 4WF2A 3EFRA 4XU3A 4QVDA 3M4GA 3RESA 3JB9D 4M75F 4M7AB 5GAMf 4F7UF 5LJ3j 2YHTA 3AHUA 5LJ3e 2RM4A 4C8QD 2FB7A 5DY9A 1WQWA 4C8QA 4EMKA 3JCMd 3JCMQ 5GAOp 5GANe 1U1SA 5GMKj 4M77D 4M77A 2EAYA 4M78D 4M78A 3V7RA 1B34B 4M7DE 5GAN5 5GAOl 3GIBA 5GAOm 3RKYA 3JCMX 2Y90A 1LOJA 4HA8A 4M75E 1LNXA 3V7CA 1HK9A 4F7UE 2RB6A 4PJOD 3JCMe 5GAN2 5LJ3d 4C92F 4RCCA 2CGHA 3FIFA 4DQ2A 5GANd 3JB9F 2DTIA 1LJOA 2EJFA 4XTVA 3JB9J 5GAMd 1N9RA 1MGQA 5GAN4 5LJ3g 4XTZA 3QO3A 2RD1A 4M7AC 2VXEA 4M7DG 5GANj 3QSUA 5GANg 2DEQA 1D3BA 4C92E 2DKGA 3JCMb 1U1TA 3RUXA 1TH7A 2HNIA 5LJ5h 4M7DB 4EMHA 1BIBA 5GMKi 4PJOF 4EMGA 1YCYA 5GAMj 4M75G 5LJ5f 4F7UG 3QHSA 5GAMe
chains in the Genus database with same CATH superfamily
1M30A 2AT1B 2QDYB 1LCKA 2DIQA 1YJ9A 2DL7A 3S3OA 1JRIA 3EHQA 2I2LA 1G2BA 3QJ6A 1K73U 4PFZA 2BIVA 3I56T 3QKJA 2F2XA 2DJQA 1NEGA 1VQ4Q 1UGVA 2RK1A 2Y4XA 3JB9G 1WA7A 4HCKA 4RTVA 4M7AF 3QZ5B 2P0KA 4EMKB 1ZUYA 4ATOA 1IRXA 1BKBA 2GGRA 2EW3A 3HHTB 1VQPT 2EQJA 1YITA 3HFNA 1JBMA 1M9SA 2NYSA 3A1PA 4LNPA 4K11A 4OMQA 1OX8A 1UECA 2O01E 1M1GA 2BE7D 2YLCA 1Q95G 4N0AA 1WNLA 1W6XA 1R0BG 1OZ3A 2RHZA 1KQSA 2K3YA 3CMEA 4E7JA 1YJ9Q 2K5IA 4OMNA 2XDBA 2PZ1A 4F7UF 1YP5A 4KT0E 2RI5A 2OTJT 5DY9A 1PC0A 2XKOC 1R77A 4M7DE 4FU6A 2YUNA 2KROA 2X3XD 3SFMA 3WXMB 3GIBA 5J39A 2EBPA 4E7IA 4J9IA 1EZZB 4BE1A 1PKTA 3TSZA 3QWXX 3VRZA 3CD6T 2A3LA 2DX1A 1VQ9A 2A0FB 2R5AA 2J6KA 3EFOB 1X69A 1QVGA 3DLLA 3RUXA 1YITQ 2D0QB 1WYXA 4M75G 3H0FA 3RMSA 5GAN7 2QA4A 2GTOA 3EG0A 1RAEB 4J6WA 3QDRB 1Y57A 2E70A 2KDSA 2VVKA 1PWTA 4HCBA 1C6VX 1CKBA 1V76A 2COWA 4IIOA 3R6OA 4RTXA 4M78F 3JCMW 3PT9A 1H92A 2ZPEB 2X3WD 2QTVA 4M4ZA 1UDLA 3RERA 1MMNA 1CKAA 1VQ8A 2M51A 4JDSA 4M75C 2KYBA 2DJZA 3MEAA 4DOVA 1IHWA 1X01A 4PJOC 4RG8A 3KBGA 4FL6A 4Z89A 5KYXB 1BB9A 4FW2A 2YSQA 1NYFA 2LX9A 4MMLA 4PNOA 4XU0A 1EX4A 3NTHA 2XHCA 1NPRA 3CC2Q 2NUPA 4DEYA 2QA4Q 2RQTA 4CC4B 3IQLA 4J9FA 2DRMA 2MK5A 3I56A 1GCQA 1M90U 1OPKA 1WXBA 3VJPA 4BB7A 2MPXC 3H0IA 3J7AF 1LOJA 2EQUA 2HCKA 4FT4A 2MOXA 2R58A 1M3AA 1VQ8Q 3ULRB 3M0RA 5GAMd 1WI7A 3L2RA 3CC7T 4E7KA 4IIMA 1Y07A 4OMMA 3VYGA 4M7DG 4LD9K 3JCMb 1Q81C 1M27C 1BI3A 2DERA 3E9GA 4FT2A 5GAMe 1JB0E 4KGVB 2B8AA 3JCMg 2LRQA 2M1HA 2KSSA 2FG0A 1G3WA 3ME9A 2YXYA 3U23A 3JCMP 1M2VA 2LP5A 4M7DA 5HK3A 1SRLA 2LQNA 1I5LA 1UGRB 2YRCA 2KEAA 2LTOA 2OTJA 2K6DA 3HFOA 3I56Q 2YWWA 4M7DC 3PGGA 1QMCA 2EGCA 3E1SA 1R0CB 4BD3A 2DE0X 3JCMJ 1YI2T 3CD6A 1UE9A 2X4XA 2DL8A 2NUZA 1NEBA 1QCNA 2CP3A 2O9SA 2FHDA 2YRVA 1NJIR 3SWNA 1ZQ1A 3OSVA 4KULA 4NL2A 3CXCP 3BDUA 3I55T 2ED0A 2V8JA 1VQPQ 2X9HA 1RAIB 1TUDA 2HD0A 2QK0A 4HT9A 1K73C 1UHCA 3FRNA 5EC7A 4D8KA 3VS2A 4M78C 2IVWA 5GJWB 3M4GA 3A8LB 1K0SA 2E12A 3G6ET 4BUGA 4JRPA 4BDZA 1OQKA 2OTJQ 5CKFA 1SSHA 4C92F 3GBQA 1JJ2S 2XI9A 1O9SA 3H6ZA 3JB9J 1YIJT 4C0DB 3PFSA 2DBKA 2DL3A 4XTZA 3CD6Q 4GLMA 1YWOA 2XU8A 3CCVA 2ROTA 1ARKA 5DLOA 3EGDA 1OOTA 2K9GA 3HPWA 1ZUUA 2J6OA 1U5SA 4J6YA 1WGSA 2LX7A 6AT1B 1MV0B 5KYUA 5CAIA 3OYHA 1G8XA 1VQ5T 3D7SB 2XG8D 2DTHA 1M5Q1 1S1NA 1ZA2B 2HQHA 4HT8A 4C0ZA 4ANJA 3QZ9B 2F1LA 1F1BB 3M4YA 3PMIA 1GL5A 2EQKA 3C4SA 1ACMB 5HCKA 3MP8A 1Z9QA 4M77E 5CKHA 5KH6A 2OAWA 2YUOA 1VQ4T 3QPHA 3HKSA 1PSFA 1UB4A 1AHJB 5A2QE 2D8JA 3GLXA 2RQWA 1QP2A 1ZSGA 2LQWA 3AT1B 1JXOA 3INZA 2KRNA 2EWNA 2ESWA 4OP0A 3A5ZB 2VXFA 4JRQA 2JVVA 2VKNA 2ED1A 4EMKC 2KY9A 4WCIA 3CCQT 2DXUA 2FRWA 4XU3A 1UTIA 3M58A 4M7AB 2DXBA 2RI2A 1KSWA 2DFUA 1NPPA 2PNIA 2KRSA 4HCZA 2IPOB 3UT1A 2D9TA 3MP1A 2XICA 4UC4A 1U8RA 2VGNA 2M9UA 3O8VA 4PJOD 2LQKA 2RB6A 2JTMA 2L8DA 4AFUC 2F5KA 1WHHA 2CZ7B 2EYXA 4J9GA 4LDVA 1Q86R 2DXCA 2FO0A 2K3XA 1VYUA 1WX6A 1YI2A 5GAN4 2EGAA 2KYMA 1CSKA 1M3CA 5C0MA 1S72T 1JO8A 2NUTA 2GCXA 5GMKi 1WIEA 3CC7Q 4F7UB 1T3LA 4M7AD 2RN8A 1BI2A 1JJ2A 3FJPA 2V8KA 2KR3A 1IO6A 4A4GA 1RACB 2A7YA 3HRSA 2YUQA 1KC8R 2J6FA 5KYYB 2L5QA 3EFSA 2JJ9A 1AEYA 1RL2A 1VQNT 1NLPC 2QI2A 4B9WA 4ELZC 2E41A 3G6EA 3GNGA 2DM1A 4C8QB 2LDMA 1WFWA 1BYMA 1MNDA 3DB3A 3BY7A 4QVZA 5FU6B 3PNWC 3CMET 2HZYA 2KVQG 4J9EA 3RKXA 1GFCA 2PTKA 1TUCA 4EIKA 4J7IA 2LCLA 3VUBA 4XTWA 4PJJA 1YIJA 5KCHA 1YI2Q 1GCPA 3FLGA 2E5QA 2WSEE 1NYGA 4MZMA 2OX7A 4JS5A 1UGPB 4M77G 1D3BB 1Q82R 4JRIA 2JW4A 4A63B 2KT8A 3PTAA 4HCCA 3I55Q 1VQ9T 3ZFJA 3NFCA 4WF2A 5KYXA 4XAXB 2E3IA 2YHTA 5IHIA 1VQ5A 3QDFA 3AHUA 4C8QD 4RTUA 2AKKA 2RI3A 4PLLA 2JS2A 4M77A 4OB0B 3LGLA 4ZGDB 1JXMA 2CDTA 3OYBA 2W0ZA 5L8RE 2MAMA 3JCMX 3MHXA 1JU5C 1PD1A 2RQRA 2SEMA 2E6NA 2ZPGB 3G6EQ 2RQUA 4P5NA 4KH1B 2ZPHB 1RAHB 2V8IA 2EJFA 3CQTA 3M55A 1PRMC 2ZPBB 3EGXB 2CZ6B 2FEIA 3M0PA 4IURA 1IGUA 2GQIA 1IZ6A 3L42A 1YIJQ 2VWFA 2C06A 1QCOA 3G4ST 1YN8A 3HRUA 2RPNA 4QQ6A 1Y71A 2WSFE 4LE9A 5HK0A 2CSQA 4PJOE 4LXCA 2PVOB 5CCAA 1XJWB 3GP8A 4BY6B 5IT9E 3BFMA 3X24B 2MYSA 2QQ9A 4CC2A 4MDXA 4Z88A 1AOJA 2EKOA 1VQ5Q 3V7SA 3LWIA 1SRMA 1X75C 5GAMg 2J7IA 1FMVA 1SF9A 5LJ3f 2KXCA 5FLXE 7AT1B 1M8MA 4O6JA 2BE9B 2RHXA 1TTHB 1VQLT 4N4GA 4M7AE 1KQ1A 4LUEA 1PRLC 5GMKm 3CC4A 3CXCA 1I5OB 4X9DA 3VYHB 1S72A 5FROA 2YLBA 1HJDA 1AWXA 2V1QA 2BZXA 4ZN3A 5HY6A 3WVDB 3NTKA 2EJGA 3HRTA 3REAB 2DILA 3LGFA 2QXFA 2ATCB 1MMAA 4F04B 1BBZA 4BACA 2X4JA 3TSWA 3JCMQ 1ZLMA 5KYWB 3S3MA 3CCQQ 2KE9A 2L0AA 1B34B 1FXXA 3VKIA 1VQNA 3LH5A 3OB9A 5D6YA 2EYQA 3OYIA 2LCCA 1TUGB 4F7UE 4AT1B 4RCCA 4BDYA 2OTLT 1RAAB 2WSCE 1LJOA 3CCET 3OS2A 1VIEA 3OW2S 3DKMA 3M0QA 4VUBA 3UDCA 2E3HA 3QJYA 1BCMA 2JUFA 3CC4Q 3ZL7C 3OA6A 4BE2A 2CT3A 4RTYA 2HKNA 1S72Q 1OEBA 2DO3A 4PKCC 2RJCA 2L3QA 4C5EA 2AKLA 4FW1A 4C8QF 4EDUA 4DBHA 1M1FA 2GFAA 3EG9A 4C0DC 1UJYA 3T9NA 1N5ZA 4GLKA 4C92B 5IHKA 1OYXA 1H3ZA 2ECZA 1H8KA 2VUBA 5AT1B 1PKSA 1VQNQ 1NE8A 4M78E 5IN1A 4PJLA 1JJ2P 1ABOA 1WJSA 4PJOG 4D6WA 2FPDA 4R55A 1TWBA 4J6XA 4XTYA 3NPFA 1W70A 4NL3A 5GMKl 3CMEQ 4M75A 3FB9A 2CT4A 2EPDA 4J5YA 2BKDN 3CCMT 5FU7B 3M57A 2KRMA 1YWPA 4PJOA 1VUBA 2KGTA 1Y7XA 2L3PA 2QQSA 5GANf 3G4SA 4M7AG 4C92D 4QVDA 5KCOA 5IXFA 1X6BA 2MWOA 3CCVT 1UUEA 5GANe 1C1AA 1VQ9Q 1KC8C 2EAYA 2AZSA 2C0TA 1KD1R 2CUBA 4Y28E 3RKYA 3CCRA 3V7CA 1LNXA 1XTDA 1BI0A 4ZTFA 2L3RA 1RABB 3URGA 8ATCB 3FIFA 3PVQA 3SDZA 2HKQB 4QKUA 3OYEA 4LDUA 2G6FX 2CZ1B 1VQLA 3CCJA 1RAGB 3OYKA 4M7AC 4MZTA 3SD4A 5FWBA 3HL8A 1IHVA 4F7UG 2I0NA 5KE2A 2GTJA 1TG0A 3MPUB 4JZ4A 2XMFA 4BE0A 1M1KR 2YRDA 1QVPA 3M54A 4QW2A 1ZX6A 3JSCA 3OMGA 4JLIA 2EQIA 3HP9A 3CMAT 4ESRA 2O4XB 1Q82C 3TREA 3G4SQ 2JNGA 1E6HA 2LJ3A 1VQ6T 1G83A 2RHYA 3H8ZA 1M1KU 1AWWA 1NZ9A 2KT1A 4OB3B 4Q5WA 4OMOA 4WTOB 2YDLA 4DBRA 4QVCA 1NM7A 2HQEA 1D1BA 1WPYA 5J26A 3M0SA 2OTLA 1H3HA 2P84A 4XQ3A 3CCEA 4C0GA 2QQAA 1PSEA 1VQLQ 3FEOA 4A4FA 4A4KA 1BIAA 5I21A 2QG9B 4RKUE 2E1HA 4M78G 2DTOA 1R8OB 2COZA 2K4YA 4C8QC 2OI3A 4CRIA 1IXDA 4MZPA 5FU6C 4ME7A 3GOXA 2QASA 2RK2A 2W10A 4L6V5 1VIFA 1FYNA 2AIRB 4OGCA 1SPKA 1V29B 4M78A 3V7RA 2L89A 5GAN5 5FRNA 3UF4A 5CO7A 3ZEHA 4HA8A 2JM9A 1YHQT 4BI3A 3FC3A 2LJ0A 4RUGA 2M02A 1NJIU 2KNBB 4E7LA 1ABQA 1NBEB 2FZCB 3RR6A 4CI0C 2HBPA 1JEGA 2OTLQ 2DK3A 4C92E 2JM8A 1TH7A 4JZ3A 2JZ2A 4IUQA 4LDWA 4EMGA 3CCEQ 1YCYA 2F2VA 3P8BB 4J9BA 4NS5A 3TVTA 3E19A 3CCMA 1RI0A 5D6XA 4KRTA 2MI6A 2GQVA 4BI4A 4KUIA 5LL6S 4II1A 2HSEB 1UGSB 4AFSC 4QQGA 2HAXA 2QTXA 3KXTA 1B7TA 4FYYB 2PQWA 3OBWA 5LJ3h 1I8FA 1T0HA 3C95A 1KK7A 4C0FA 2K79A 4Z8AA 1B3QA 1N8RR 2GF7A 1W2BS 2MF2A 1QVFP 3CEYA 4AG1C 3CPWS 4MDWA 2GFUA 3DLMA 4JJDA 4JS4A 1OU8A 1WHKA 4BY6C 2H3EB 2RQVA 1K9MR 3HSBA 2GBQA 5A0GA 3CCLT 1N9SA 3TEEA 3LH0A 4AMCA 3L2UA 2LJ1A 3OMCA 4FCYA 1UFFA 3OYMA 3CCMQ 3RKWA 1X2KA 1K9MU 1SEMA 1PHTA 3CCUT 1NLOC 3M56A 2CP2A 3RESA 1PD0A 2CREA 5LJ3j 2NWMA 1LVKA 2RM4A 3CMAA 4EMKA 1WXTA 2KBTA 1VQ6A 1RI9A 4OMFB 2YT6A 5KYNA 3WVEB 3O5ZA 5CQYA 3CCVQ 2C0IA 3J81E 4AG2C 4DQ2A 1T3SA 1TXQA 2PVGB 2EIFA 2DTIA 1UJ0A 2VYTA 2V1RA 1ZUKA 5CIUA 1VQKT 2O9VA 3LWHA 5C6SA 2VXEA 3CCSA 4HXJA 2RNAA 1AZGB 3OYDA 1E6GA 2RF0A 5HKCA 3QHSA 2IIMA 3OS0A 2PU9B 2P4RA 5CVIA 2D0NA 4KUDK 1YNZA 1XNIA 5FW9A 4Z02A 3ASKA 4PLIA 1I1JA 2CH4W 4FM4B 3CC4T 4C92G 1AD5A 3BE3A 2NUPB 1QQJA 2HL5C 1RLPC 1G3TA 3CMAQ 1K8AR 2O2OA 1VA7A 2VV5A 1Q86U 3MCAB 3H41A 1VQ6Q 2XDPA 1KD1C 2LNHB 2EVRA 3VS6A 2DD4A 1YHQA 3EFOA 4C92A 4ELYC 3VS4A 4QT7A 1K8AU 4E47A 3NHNA 1B07A 1IB8A 3JAME 3OW2P 3JCMf 3RBBB 1MHNA 2VGMA 5GMKe 2EYZA 1AWOA 4RMOA 4C92C 4V2SA 1WJQA 3MKDA 1M4ZA 1K4US 3VS1A 1KC8U 5GANh 1WZOA 1ZSZB 1SHGA 4IUPA 3QBYA 1WHMA 2KMTA 1VQ7T 3Q1JA 4PFOA 1M1KC 4JJNK 3L2QA 3E2UA 2PVDB 2X51A 1X6GA 2LMJA 1M2VB 3TCJA 4Y92A 1K0XA 2YUPA 4LDXA 5GAOm 3META 2KAFA 4HVWA 5FU7C 2LZ6B 1YCSB 3JB9F 1VOMA 4GY5A 1YJNA 1GRIA 2H3JA 1YHQQ 1MGQA 4E7SA 3CPFA 5GANj 4OMPA 5GANg 1Q82U 4FYWB 4PK4A 2P0QA 1OZ2A 3C12A 2WACA 1BK2A 3ER0A 2CS7A 5LJ5f 1G5VA 2ZGWA 3VU3C 4YTLA 3SWNB 4RTWA 4A53A 3CCLA 3EH1A 2QQRA 1VYTA 3LW5E 3V8JA 5LJ5e 4ZTJA 1PG5B 2MWPA 1QVFS 1Q81R 4PJMA 1RAFB 5I11A 3CCUA 3JB9H 3KUFA 3CBOA 2V26A 3QYHB 1QP3A 3PE0A 2CYZB 3ZBDA 3OYGA 2J06A 1X43A 3JB9I 1U06A 4DBFA 3EHRA 3OYYA 3QYGB 1NJIC 2HL3A 1TU0B 4DA4A 4X9CA 3CBMA 4RTTA 2RMOA 4A54A 5GAOr 2PUOB 5GAN3 2J05A 1Y96B 4FSSA 2FPFA 3VS0A 1I81A 1YJNQ 2HEQA 5EG2A 1QVGS 3HTRA 1VQKA 3CCRT 2QQBA 5CKBA 4JUVA 1EIFA 2LC4A 1Z9ZA 2XD0A 1QKXA 2MMPA 3A8GB 2OAUA 4E7HA 3EGDB 3CCJT 3CCLQ 4M75F 1GFDA 2LVMA 2MCNA 5LJ3e 4OB1B 2FB7A 3RMQA 1QWFA 5KYUB 3CCUQ 2BZYA 3X20B 2HDAA 4CC7A 1D0ZA 5GAOl 1YJWT 1YBYA 1KHCA 3VS7A 5GAN2 1TS9A 2SRCA 2LQ8A 1X6OA 3I9QA 2DYBA 4E2FB 1N8RC 4LD6A 3I5RA 2JS0A 3LLRA 3QSUA 1MMDA 2ZCFB 2M16A 4KBMB 2HBWA 2FPEA 1VQKQ 4E6RA 4XTUA 1SG5A 1K9MC 4ZGJB 2CSIA 3QUIA 3QXEB 1YFNA 3OYFA 3OYLA 3NTIA 1WDXA 2DXTA 1VQ7A 2FRYA 2L2PA 4Y91A 3L1AA 3MP6A 4JRKA 2XIDA 2DYIA 5A0DA 2CKKA 5CQXA 4F14A 4FIBA 3L2WA 2DETA 4XU2A 4C8QE 2DVJA 5KE3A 1QW1A 1AT1B 4JJBA 1QVFA 2E10A 4IKFA 2D8HA 4L5GA 1D0YA 2XDDA 3QWYA 1VQOT 4N0AC 3OS5A 1MMGA 2DRKA 5GAOq 1E7OA 1WXUA 3N5BB 4C5GA 2DNUA 3PMTA 1UGQB 3M9QA 3VUZA 2DPPB 2VC8A 4LN2A 1K1ZA 3JCMc 2Z0WA 2DL4A 3G7ZA 2NUTB 5GAN6 2VB6A 4M7DF 2DZCA 2EKHA 1C0MA 1ZBJA 2HQXA 1GBRA 2DAQA 3J80E 2FL7A 5A0LA 3VRYA 2AK5A 4RG2A 1W4SA 3MEWA 5GAOp 3PIPA 1GBQA 3EG2A 3TU4K 1Q86C 1U1SA 2A28A 1VQ7Q 2X35A 1KG1A 4LUDA 3THKA 5IAYA 3CC2A 1Q7YR 2E4HA 3UATA 1PM3A 1K8AC 3UPUA 1FMKA 1OV3A 5GANd 1W2BP 3H0HA 5CKDA 1OULA 3OYCA 3CPWP 2RO0A 1Q7YU 2IG0A 1WLPB 5ECAA 2VASA 1W1FA 3MJXA 1D1CA 2HNIA 5FRMA 3E9FA 4B9XA 1J3TA 1P92A 3OY9A 4M7AA 1I0CA 4XU1A 4MMKA 4IUUA 2BZ8A 5I2MA 1KD1U 4J83A 1MNEA 4JJCA 3OBYA 2JTFA 2JN0A 2K7AA 3UA7A 2DZ9A 3V8LA 3PIOA 2JMCA 1I07A 5CR2A 2BUDA 1H641 2KI7A 4A4EA 1YJWA 2DA9A 4M77B 1M90R 4KH0B 5GMKh 3I5SA 2KQWA 1TSFA 2LCSA 2EJ9A 2DF6A 2CP6A 4J9DA 3JCMh 5GAOn 3OW2A 3OS1A 2H8HA 3A8MB 4F7UA 4GBQA 1M8VA 5D7UA 2JMAA 5IH2A 4C8QG 1WHLA 2FYKA 3RDVA 1UEBA 1RADB 3VV0A 3JCMV 1G3YA 2COYA 5KYYA 1VYVA 1GCQC 3S3NA 3CCRQ 4J9HA 2C0OA 1QWEA 3VS5A 5GAMf 3M0TA 3OYJA 3CCST 3P8DA 1VQPA 3R6NA 4C8QA 2ZPIB 2RJDA 2EYYA 1MV3A 4IUTA 5GMKj 1WHJA 1ZSZA 4M77D 2R5MA 1V1CA 3CCJQ 2F69A 4OVAA 2DL5A 2QYZA 4LDYA 4KGZB 3OYAA 4HVVA 5IXBA 3MO8A 1YJWQ 1ZSZC 3MEVA 5M9OA 4DOWA 3OSSC 4XTVA 3PVLA 1G3SA 3LYIA 2E6ZA 2K2MA 5I22A 2RD1A 1VQOA 2ABLA 4CC3A 4C5HA 1D3BA 1OX9A 1U1TA 3GF5A 5LJ5h 1FX7A 8AT1B 1D1AA 2AHJB 2B86A 2JOYA 2CP0A 1EFNA 2CH4A 3MEUA 2D6FA 3OYNA 2DEUA 3BDLA 4ORZA 4F16A 1RLQC 1QCFA 5J3BA 2EQMA 4X34A 3X26B 5CK9A 1SKUB 2O31A 1K76A 3EGXA 4XTXA 2Y4YA 2ROLA 2FVUA 3SWNC 1ZHIA 2PUKB 2ZAEA 2RHUA 4E7ZA 5LJ5j 1M2OA 5LJ5g 3V8KA 9ATCB 1KIKA 1HXDA 2M0YA 3JV3A 4FSXA 2L3SA 2ENMA 3UA6A 1VQOQ 5GJVB 3L2VA 1Y96A 2G3RA 2FZKB 1NG2A 1YJNT 1KQSP 4DBQA 4ZN1A 2X4YA 3JB9D 1VQMT 2LT4A 2QEXT 1N6AA 1ZA1B 4FYXB 1WQWA 2K5LA 3EH2A 4FYVB 1N8RU 4OGEA 3EG9B 2A36A 2Y90A 3NMZC 1HK9A 4EPCA 2BTTA 2KXDA 3FJ5A 5L23A 4BI8B 1U3OA 2GNCA 3G71T 1KFZA 5LJ3g 2NLUA 3GNFB 2KK4A 1QVGP 2DKGA 5IHNA 1QKWA 4A4HA 1OI1A 1RUWA 4AFQC 2JT4A 3M53A 1XQHA 2F5TX 4M75B 2O88A 2EFIA 1BU1A 5DM7R 4AFZC 2QGFB 1HSQA 2K2VA 1HD3A 3EG1A 5KYWA 2JTEA 4PJOB 1GXIE 1IREB 1B34A 3C0CA 3I35A 5DLQE 4PJNA 4M77F 3CC7A 4TVRA 3S6WA 4X1VA 4J8OA 1FWZA 2LT1A 4N4IA 1X27A 2CZ0B 3BW1A 2DBMA 2RH2A 1ZBXA 5D6WA 3EGUA 1Q7YC 2K5FA 3QG1A 4C5IA 2E5KA 1AVZC 3EG3A 1WQ7A 4M75D 1BCOA 1OPLA 2D1XA 1FMWA 1A0NB 1Y0MA 2ZPFB 3VS3A 2CP5A 2K57A 2X4WA 2QDLA 1YJ9T 1QLYA 2A37A 2E64A 3SB2A 4ZGEB 2K3BA 2P0PA 1JQQA 3A8HB 3H9NA 3UWNA 2AZVA 3JCMd 1DJ7B 1D09B 3SEMA 1TOVA 2EYWA 2HSPA 1AZEA 3I55A 3P8HA 3CCSQ 1N27A 1OU9A 3JCMe 2F2WA 3LX7A 2CGHA 1LPLA 2LNVA 2OJ2A 1W2BA 1D0XA 1YITT 1M90C 3CBPA 3CPWA 1BI1A 1O75A 1N9RA 1HYOA 3FDRA 2DIGA 4DEXA 4PL6A 3M5AA 3SHWA 4R0KA 4M7DB 1BIBA 3CXCS 4J7FA 1M3BA 2RJEA 4J9CA 4HVUA 3OQ5A 4L59A 3KFVA 2QGGA 1I4K1 3QIIA 3F70A 2DD5A 4R56A 3A98A 2DVEA 3NGPA 1VQMA 4B6MA 2QEXA 1WJRA 2E65A 1UHFA 1PCXA 2QAZA 2RA2A 3TQ7P 5LJ5d 2RJFA 3C94A 3M0UA 4JPBW 1T0JA 2P4TA 4M78B 3L2ZA 4XK8E 3X25B 5I2SA 1KQSS 4RTZA 2HMAA 4M7DD 2M0OA 1SHFA 4OMLA 5CKEA 2DLPA 1KJWA 2EGEA 3G71A 1IGQA 5GAN8 1SSFA 4RCBA 3CC2T 3GPLA 2QA4T 1UG1A 4NOYA 2R57A 1MUZA 3DB4A 1Q81U 1WHGA 2O4XA 1K9AA 4HKEA 4M77C 4OB2B 2DMOA 1KQ2A 3RIRA 5GAMh 1VQ4A 3EFRA 2CP7A 2JXBA 3G1JA 4OF1A 2RHIA 1X2QA 4D8DA 1PNJA 3X28B 3RNJA 3JRZA 4M78D 1VQ8T 1VQMQ 2QEXQ 2FZGB 4M75E 2MIOA 5LJ3d 4KGXB 4QQDA 2ZZDA 1AWJA 1XOVA 3REBB 4F17A 3CCQA 4JLGA 4IUVA 2CUDA 4ZNXA 3EAEA 4PFPA 5FWCA 3QO3A 2XK0A 2DEQA 1KHIA 2A08A 5AYFA 4EMHA 1K73R 4PJOF 3A8OB 5GAMj 3G71Q 3M59A 4O5VA 4N4HA
chains in the Genus database with same CATH topology
3CCMA 4B9XA 4F7UB 1RI0A 2QDYB 5D6XA 1P92A 3OY9A 4M7AA 4M7AD 1BI2A 2DIQA 4XU1A 2MI6A 2GQVA 1JRIA 3FJPA 2V8KA 4KUIA 4MMKA 4BI4A 3S3OA 4IUUA 2I2LA 5I2MA 3QJ6A 1K73U 4A4GA 2A7YA 5LL6S 1KD1U 2BIVA 4J83A 3HRSA 3QKJA 3I56T 4II1A 1UGSB 3OBYA 2L5QA 2JTFA 3EFSA 2JN0A 2HAXA 2RK1A 2Y4XA 4QQGA 3JB9G 1RL2A 1VQNT 2QTXA 3KXTA 2DZ9A 3V8LA 2QI2A 3PIOA 2PQWA 4B9WA 4ELZC 4M7AF 2E41A 3OBWA 2P0KA 3QZ5B 3GNGA 5LJ3h 5CR2A 1I8FA 2BUDA 1H641 4C8QB 4EMKB 1G5VA 2LDMA 4A4EA 3C95A 1YJWA 4C0FA 3DB3A 1BYMA 3BY7A 4M77B 4QVZA 4ATOA 5FU6B 5GMKh 3PNWC 2KQWA 1BKBA 3CMET 2KVQG 2GF7A 2EJ9A 2MF2A 3RKXA 1W2BS 4J7IA 3CEYA 3HHTB 1VQPT 2LCLA 2EQJA 3JCMh 3CPWS 3VUBA 5GAOn 1YITA 3OW2A 4MDWA 3OS1A 4XTWA 2GFUA 3HFNA 3DLMA 1JBMA 4JS4A 1YIJA 1M9SA 3A8MB 4BY6C 4F7UA 1M8VA 5KCHA 3HSBA 3FLGA 2O01E 2E5QA 2WSEE 4C8QG 4MZMA 1M1GA 2FYKA 2YLCA 4N0AA 5A0GA 3CCLT 4JS5A 1WNLA 1UGPB 1UEBA 1N9SA 4M77G 1D3BB 3VV0A 3JCMV 3TEEA 1G3YA 3LH0A 3S3NA 4JRIA 3L2UA 3OMCA 1OZ3A 3OYMA 3PTAA 2RHZA 3RKWA 1VQ9T 1KQSA 3ZFJA 1K9MU 3CCUT 2K3YA 3NFCA 3M56A 4WF2A 3CMEA 4E7JA 2K5IA 3RESA 4XAXB 5GAMf 2XDBA 4F7UF 5LJ3j 2YHTA 3OYJA 3CCST 3P8DA 4KT0E 1VQPA 1VQ5A 2RI5A 2RM4A 4C8QD 5DY9A 4C8QA 4EMKA 3CMAA 2ZPIB 3AHUA 2RJDA 2OTJT 2RI3A 4PLLA 4IUTA 5GMKj 4M77D 2XKOC 4M77A 4OB0B 4OMFB 3LGLA 4FU6A 2R5MA 4ZGDB 1YJ9A 3SFMA 3WXMB 4M7DE 3OYBA 5L8RE 2F69A 3GIBA 5J39A 2MAMA 4OVAA 3JCMX 3MHXA 3WVEB 4E7IA 3CC7A 4BE1A 4LDYA 5CQYA 2E6NA 2ZPGB 3J81E 3OYAA 3CD6T 2A3LA 4P5NA 3MO8A 4DQ2A 2PVGB 2ZPHB 2EIFA 3MEVA 2DTIA 4DOWA 2V8IA 2EJFA 5M9OA 3OSSC 1VQ9A 2R5AA 2ZPBB 3M55A 4XTVA 2VYTA 1G3SA 3LYIA 2CZ6B 5CIUA 2E6ZA 1VQKT 3LWHA 5C6SA 2RD1A 1VQOA 2VXEA 3CCSA 4C5HA 4IURA 1QVGA 1D3BA 3DLLA 1U1TA 3GF5A 3RUXA 5LJ5h 2D0QB 1IZ6A 3OYDA 1FX7A 3L42A 4M75G 2C06A 5HKCA 3QHSA 3RMSA 5GAN7 3OS0A 2QA4A 2AHJB 2PU9B 3G4ST 4J6WA 2JOYA 3HRUA 4QQ6A 5CVIA 1Y71A 2WSFE 4KUDK 1XNIA 3QDRB 3MEUA 2E70A 2KDSA 5HK0A 4HCBA 4Z02A 4IKFA 4PJOE 2D6FA 3OYNA 3BDLA 3ASKA 4PLIA 2PVOB 5CCAA 3GP8A 4BY6B 4FM4B 3BFMA 3CC4T 4C92G 3R6OA 5IT9E 4M78F 3JCMW 3X24B 2QQ9A 3PT9A 4MDXA 2ZPEB 5J3BA 2EKOA 2EQMA 1G3TA 3V7SA 3LWIA 1X75C 2VV5A 4X34A 5LJ5f 3X26B 3MCAB 5GAMg 1Q86U 3RERA 2XDPA 5CK9A 1VQ8A 1KD1C 5LJ3f 4JDSA 5FLXE 4XTXA 2Y4YA 2DD4A 2FVUA 4M75C 1ZHIA 2DJZA 2PUKB 3MEAA 4O6JA 3SWNC 4DOVA 1YHQA 2RHXA 2RHUA 4C92A 4ELYC 1VQLT 5LJ5j 5LJ5g 1K8AU 4N4GA 3V8KA 4M7AE 1KQ1A 1X01A 4PJOC 4E47A 3JAME 4RG8A 3KBGA 3JCMf 1HXDA 5GMKm 3CC4A 4FL6A 1MHNA 2VGMA 4FSXA 5GMKe 3CXCA 4X9DA 4RMOA 3VYHB 4C92C 1S72A 4V2SA 1WJQA 2LX9A 4MMLA 4PNOA 2YLBA 1M4ZA 4XU0A 5FROA 3NTHA 1KC8U 3L2VA 1Y96A 5GANh 4ZN3A 2XHCA 2G3RA 5HY6A 3WVDB 3NTKA 2EJGA 1NPRA 3HRTA 4IUPA 3QBYA 1YJNT 3LGFA 2KMTA 1VQ7T 3Q1JA 4ZN1A 2QXFA 1M1KC 4JJNK 2X4YA 3JB9D 1VQMT 3L2QA 2LT4A 2QEXT 2PVDB 1N6AA 4BACA 2X4JA 3JCMQ 1WQWA 3I56A 3OA6A 3S3MA 2K5LA 1M90U 4BB7A 3VJPA 3TCJA 1B34B 1N8RU 1FXXA 3VKIA 4LDXA 4OGEA 1VQNA 5GAOm 3J7AF 3META 3OB9A 5D6YA 2EYQA 2KAFA 2Y90A 3OYIA 5FU7C 1LOJA 2EQUA 2LCCA 4EPCA 1HK9A 4F7UE 4RCCA 4FT4A 2R58A 4BDYA 4GY5A 2OTLT 3JB9F 2WSCE 1LJOA 3CCET 4BI8B 1YJNA 3OS2A 5GAMd 1VIEA 2H3JA 3L2RA 3G71T 3CC7T 4E7KA 1MGQA 5LJ3g 3OW2S 3DKMA 1Y07A 2NLUA 3GNFB 2KK4A 3VYGA 3CPFA 4VUBA 5GANg 5GANj 4LD9K 4M7DG 3UDCA 2DKGA 3JCMb 3QJYA 1Q81C 1Q82U 1BI3A 4A4HA 2P0QA 1OI1A 1OZ2A 2JUFA 2WACA 3C12A 3E9GA 2CS7A 3ER0A 3M53A 4FT2A 1JB0E 1XQHA 2F5TX 2ZGWA 3VU3C 4YTLA 4M75B 3SWNB 2B8AA 4BE2A 2EFIA 4A53A 3JCMg 5DM7R 2LRQA 2K2VA 2DO3A 2M1HA 4PKCC 2KSSA 3CCLA 1G3WA 2RJCA 3ME9A 2QQRA 3LW5E 4C5EA 3JCMP 3V8JA 4PJOB 5LJ5e 4ZTJA 4M7DA 2MWPA 1GXIE 5HK3A 1IREB 1QVFS 1B34A 4C8QF 4EDUA 5DLQE 3CCUA 1I5LA 3JB9H 1M1FA 1UGRB 2GFAA 3CBOA 3KUFA 3QYHB 1QP3A 4M77F 2CYZB 4TVRA 3T9NA 3ZBDA 4C0DC 3OYGA 4GLKA 3S6WA 4C92B 2LTOA 2OTJA 4J8OA 3JB9I 1OYXA 3HFOA 1H3ZA 1FWZA 4M7DC 3PGGA 3OYYA 2LT1A 3QYGB 4N4IA 1NJIC 2CZ0B 2VUBA 3BW1A 3E1SA 2RH2A 4DA4A 1NE8A 1ZBXA 4M78E 4X9CA 5D6WA 5IN1A 1Q7YC 2K5FA 3CBMA 1WJSA 3QG1A 4PJOG 4D6WA 4BD3A 4A54A 4C5IA 3JCMJ 5GAOr 2PUOB 1YI2T 2X4XA 5GAN3 4R55A 3CD6A 4J6XA 4XTYA 1Y96B 2FHDA 1I81A 2YRVA 1WQ7A 4NL3A 5GMKl 5EG2A 4M75D 4M75A 3SWNA 1ZQ1A 3FB9A 3OSVA 4KULA 1QVGS 1VQKA 4NL2A 3BDUA 4J5YA 2BKDN 3I55T 3CCMT 3CCRT 2V8JA 5FU7B 2ZPFB 3M57A 2K57A 2X4WA 1YJ9T 2HD0A 2QQBA 4PJOA 4HT9A 1K73C 1VUBA 3FRNA 5CKBA 1Y7XA 4JUVA 3SB2A 2E64A 2QQSA 1EIFA 2LC4A 4ZGEB 4M78C 5GANf 3G4SA 2XD0A 2IVWA 2MMPA 2P0PA 2OAUA 3A8GB 4E7HA 4C92D 4M7AG 4QVDA 3M4GA 5KCOA 3CCJT 4M75F 3A8LB 2LVMA 3A8HB 2E12A 3UWNA 5LJ3e 3JCMd 4OB1B 2FB7A 2MWOA 1DJ7B 3RMQA 3CCVT 5GANe 3G6ET 4BUGA 1KC8C 2EAYA 4JRPA 3X20B 4BDZA 5GAOl 4Y28E 1YJWT 3RKYA 3CCRA 3I55A 1YBYA 3P8HA 3V7CA 1N27A 1LNXA 5CKFA 1KHCA 1XTDA 3JCMe 1BI0A 5GAN2 3G6EA 4C92F 4ZTFA 2L3RA 3URGA 3LX7A 2CGHA 2LNVA 3FIFA 1W2BA 1JJ2S 2LQ8A 3SDZA 2XI9A 1O9SA 3H6ZA 1YITT 1X6OA 1M90C 3CBPA 3CPWA 3JB9J 1YIJT 1BI1A 4C0DB 1O75A 1N9RA 3PFSA 4LDUA 2CZ1B 4LD6A 3OYEA 3CCJA 1N8RC 1VQLA 4XTZA 3FDRA 3LLRA 3OYKA 4M7AC 2DIGA 3QSUA 4PL6A 4MZTA 3SD4A 2XU8A 3M5AA 2ZCFB 3CCVA 4M7DB 1BIBA 2M16A 3CXCS 4KBMB 4O5VA 3HL8A 4J7FA 4F7UG 5KE2A 5DLOA 4XTUA 1K9MC 2RJEA 4ZGJB 4BE0A 3HPWA 3OQ5A 1QVPA 4L59A 3M54A 3QUIA 3QXEB 4J6YA 1WGSA 4QW2A 3OMGA 3JSCA 4JLIA 3OYFA 3OYLA 3HP9A 1I4K1 3NTIA 3QIIA 5CAIA 3OYHA 1VQ5T 2XG8D 2DTHA 2DXTA 3CMAT 1M5Q1 2O4XB 3F70A 1Q82C 2DD5A 3TREA 1VQ7A 4Y91A 4C0ZA 2JNGA 4R56A 4HT8A 1VQ6T 2DVEA 2RHYA 3H8ZA 1VQMA 1M1KU 3L1AA 3MP6A 3QZ9B 2QEXA 1NZ9A 1WJRA 4JRKA 2E65A 2XIDA 4OB3B 3M4YA 4Q5WA 3PMIA 5A0DA 2RA2A 2CKKA 5CQXA 2EQKA 2RJFA 4FIBA 5LJ5d 3C4SA 3L2WA 1VQ6A 4XU2A 4C8QE 3C94A 4QVCA 2P4TA 3MP8A 4M78B 2HQEA 5KE3A 4M77E 1QW1A 5CKHA 3L2ZA 5KH6A 4XK8E 1VQ4T 3QPHA 3X25B 1WPYA 5J26A 1QVFA 5I2SA 3HKSA 1PSFA 1UB4A 1AHJB 2E10A 5A2QE 1KQSS 4L5GA 3GLXA 2XDDA 2OTLA 1VQOT 4M7DD 4N0AC 3OS5A 4XQ3A 1QP2A 2M0OA 5CKEA 3CCEA 4C0GA 5GAOq 2QQAA 3INZA 3N5BB 4C5GA 3G71A 2EWNA 3PMTA 1UGQB 4OP0A 3M9QA 1SSFA 5GAN8 1PSEA 4RCBA 3VUZA 2DPPB 3CC2T 3FEOA 3GPLA 2QA4T 3A5ZB 4HCCA 2VC8A 4A4FA 4A4KA 1BIAA 5I21A 4NOYA 2VXFA 2R57A 3JCMc 4RKUE 3DB4A 2JVVA 2E1HA 4M78G 4JRQA 2DTOA 3G7ZA 1Q81U 1R8OB 2K4YA 2O4XA 4C8QC 4EMKC 2KY9A 5GAN6 5GAMe 4M7DF 4CRIA 4HKEA 4M77C 4OB2B 3CCQT 1KQ2A 2DZCA 2HQXA 4MZPA 5FU6C 2DXUA 3RIRA 5GAMh 1VQ4A 3EFRA 2DAQA 4XU3A 2FL7A 3J80E 5A0LA 4ME7A 3M58A 4OF1A 4M7AB 3GOXA 2RHIA 2RK2A 2DXBA 2RI2A 3X28B 4RG2A 1W4SA 3MEWA 1NPPA 4L6V5 5GAOp 1VIFA 3PIPA 1Q86C 3TU4K 4OGCA 1U1SA 3JRZA 1V29B 4M78D 4M78A 3V7RA 2L89A 2X35A 5GAN5 5FRNA 4HCZA 1KG1A 3UT1A 2D9TA 3MP1A 2XICA 1VQ8T 5IAYA 3CC2A 5CO7A 4UC4A 3ZEHA 2VGNA 2M9UA 3O8VA 1U8RA 4HA8A 4M75E 1YHQT 4PJOD 2LQKA 4BI3A 2RB6A 3FC3A 1K8AC 2JTMA 5LJ3d 2L8DA 3UPUA 2F5KA 2CZ7B 4QQDA 2ZZDA 5GANd 1NJIU 5CKDA 4LDVA 1JJ2A 1XOVA 3OYCA 4E7LA 3CCQA 2DXCA 2RO0A 4JLGA 4IUVA 2IG0A 2K3XA 4CI0C 1Q7YU 2HBPA 3EAEA 1YI2A 5GAN4 3QO3A 2XK0A 2DK3A 2DEQA 4C92E 5C0MA 1S72T 1TH7A 1KHIA 2HNIA 5AYFA 4EMHA 5GMKi 2GCXA 2JZ2A 4IUQA 4LDWA 4PJOF 1YCYA 4EMGA 5FRMA 3A8OB 5GAMj 3P8BB 3E9FA 4NS5A 3M59A 3E19A 4N4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGW A;  3VU3 C;  4M75 B;  4XTU A;  3SWN B;  4F7U B;  5GAN 7;  4A53 A;  3JCM g;  4M7A D;  4M7A A;  4J6W A;  4XU1 A;  1JRI A;  3FJP A;  4MMK A;  3QUI A;  4J6Y A;  2I2L A;  4JLI A;  4PJO B;  3JCM P;  3V8J A;  5CAI A;  1I4K 1;  5LJ5 e;  4M7D A;  4PJO E;  2DTH A;  2DXT A;  1B34 A;  1M5Q 1;  4C8Q F;  4Y91 A;  1I5L A;  4HT8 A;  3BFM A;  3JB9 H;  4C92 G;  2DVE A;  3EFS A;  4M77 F;  4M78 F;  5I21 A;  3JCM W;  2JN0 A;  3L1A A;  3JB9 G;  4JRK A;  4C92 B;  2E65 A;  2QTX A;  2DZ9 A;  3V8L A;  3JB9 I;  3HFO A;  3V7S A;  4M7A F;  2E41 A;  2RA2 A;  5LJ5 d;  5LJ3 h;  3PGG A;  3RER A;  1I8F A;  4C8Q B;  1H64 1;  4EMK B;  4XU2 A;  3BW1 A;  4C8Q E;  5GAM g;  4QVC A;  4M7D C;  5LJ3 f;  3BY7 A;  4M77 B;  4M78 B;  4XTX A;  4M77 E;  4M78 E;  4X9C A;  4M75 C;  3L2Z A;  3SWN C;  2DJZ A;  5GMK h;  4PJO G;  1WPY A;  2EJ9 A;  3RKX A;  4C92 A;  4A54 A;  3JCM J;  5LJ5 j;  5GAO r;  5LJ5 g;  2E10 A;  5GAN 3;  3V8K A;  4M7D D;  4J6X A;  4M7A E;  3JCM h;  1KQ1 A;  1X01 A;  4N0A C;  1Y96 B;  4XTY A;  4XQ3 A;  5GAO n;  4PJO C;  5GAO q;  1I81 A;  4XTW A;  1WQ7 A;  3HFN A;  3JCM f;  1JBM A;  1HXD A;  3INZ A;  5GMK l;  4NL3 A;  4M75 D;  4M75 A;  3SWN A;  2EWN A;  3FB9 A;  4F7U A;  4OP0 A;  5GMK m;  5GAN 8;  1M8V A;  4NL2 A;  4RCB A;  3BDU A;  4J5Y A;  5GMK e;  4X9D A;  3HSB A;  4C92 C;  2VC8 A;  4C8Q G;  4V2S A;  1BIA A;  4MML A;  2K57 A;  2YLB A;  2FYK A;  2VXF A;  2YLC A;  4NOY A;  4N0A A;  4PNO A;  4XU0 A;  3JCM c;  1WNL A;  4PJO A;  2E1H A;  1N9S A;  4M77 G;  1D3B B;  2DTO A;  4M78 G;  4HT9 A;  1Y96 A;  3JCM V;  5GAN h;  4C8Q C;  4EMK C;  2EJG A;  4JUV A;  5GAN 6;  4JRI A;  2E64 A;  3SB2 A;  4M7D F;  5GAN f;  4M77 C;  4M78 C;  3RKW A;  1KQ2 A;  2DZC A;  3RIR A;  5GAM h;  4M7A G;  2DXU A;  4C92 D;  4WF2 A;  3EFR A;  4XU3 A;  4QVD A;  3M4G A;  3RES A;  3JB9 D;  4M75 F;  4M7A B;  5GAM f;  4F7U F;  5LJ3 j;  2YHT A;  3AHU A;  5LJ3 e;  2RM4 A;  4C8Q D;  2FB7 A;  5DY9 A;  1WQW A;  4C8Q A;  4EMK A;  3JCM d;  3JCM Q;  5GAO p;  5GAN e;  1U1S A;  5GMK j;  4M77 D;  4M77 A;  2EAY A;  4M78 D;  4M78 A;  3V7R A;  1B34 B;  4M7D E;  5GAN 5;  5GAO l;  3GIB A;  5GAO m;  3RKY A;  3JCM X;  2Y90 A;  1LOJ A;  4HA8 A;  4M75 E;  1LNX A;  3V7C A;  1HK9 A;  4F7U E;  2RB6 A;  4PJO D;  3JCM e;  5GAN 2;  5LJ3 d;  4C92 F;  4RCC A;  2CGH A;  3FIF A;  4DQ2 A;  5GAN d;  3JB9 F;  2DTI A;  1LJO A;  2EJF A;  4XTV A;  3JB9 J;  5GAM d;  1N9R A;  1MGQ A;  5GAN 4;  5LJ3 g;  4XTZ A;  3QO3 A;  2RD1 A;  4M7A C;  2VXE A;  4M7D G;  5GAN j;  3QSU A;  5GAN g;  2DEQ A;  1D3B A;  4C92 E;  2DKG A;  3JCM b;  1U1T A;  3RUX A;  1TH7 A;  2HNI A;  5LJ5 h;  4M7D B;  4EMH A;  1BIB A;  5GMK i;  4PJO F;  4EMG A;  1YCY A;  5GAM j;  4M75 G;  5LJ5 f;  4F7U G;  3QHS A;  5GAM e; 
#chains in the Genus database with same CATH topology
 1M30 A;  2AT1 B;  2QDY B;  1LCK A;  2DIQ A;  1YJ9 A;  2DL7 A;  3S3O A;  1JRI A;  3EHQ A;  2I2L A;  1G2B A;  3QJ6 A;  1K73 U;  4PFZ A;  2BIV A;  3I56 T;  3QKJ A;  2F2X A;  2DJQ A;  1NEG A;  1VQ4 Q;  1UGV A;  2RK1 A;  2Y4X A;  3JB9 G;  1WA7 A;  4HCK A;  4RTV A;  4M7A F;  3QZ5 B;  2P0K A;  4EMK B;  1ZUY A;  4ATO A;  1IRX A;  1BKB A;  2GGR A;  2EW3 A;  3HHT B;  1VQP T;  2EQJ A;  1YIT A;  3HFN A;  1JBM A;  1M9S A;  2NYS A;  3A1P A;  4LNP A;  4K11 A;  4OMQ A;  1OX8 A;  1UEC A;  2O01 E;  1M1G A;  2BE7 D;  2YLC A;  1Q95 G;  4N0A A;  1WNL A;  1W6X A;  1R0B G;  1OZ3 A;  2RHZ A;  1KQS A;  2K3Y A;  3CME A;  4E7J A;  1YJ9 Q;  2K5I A;  4OMN A;  2XDB A;  2PZ1 A;  4F7U F;  1YP5 A;  4KT0 E;  2RI5 A;  2OTJ T;  5DY9 A;  1PC0 A;  2XKO C;  1R77 A;  4M7D E;  4FU6 A;  2YUN A;  2KRO A;  2X3X D;  3SFM A;  3WXM B;  3GIB A;  5J39 A;  2EBP A;  4E7I A;  4J9I A;  1EZZ B;  4BE1 A;  1PKT A;  3TSZ A;  3QWX X;  3VRZ A;  3CD6 T;  2A3L A;  2DX1 A;  1VQ9 A;  2A0F B;  2R5A A;  2J6K A;  3EFO B;  1X69 A;  1QVG A;  3DLL A;  3RUX A;  1YIT Q;  2D0Q B;  1WYX A;  4M75 G;  3H0F A;  3RMS A;  5GAN 7;  2QA4 A;  2GTO A;  3EG0 A;  1RAE B;  4J6W A;  3QDR B;  1Y57 A;  2E70 A;  2KDS A;  2VVK A;  1PWT A;  4HCB A;  1C6V X;  1CKB A;  1V76 A;  2COW A;  4IIO A;  3R6O A;  4RTX A;  4M78 F;  3JCM W;  3PT9 A;  1H92 A;  2ZPE B;  2X3W D;  2QTV A;  4M4Z A;  1UDL A;  3RER A;  1MMN A;  1CKA A;  1VQ8 A;  2M51 A;  4JDS A;  4M75 C;  2KYB A;  2DJZ A;  3MEA A;  4DOV A;  1IHW A;  1X01 A;  4PJO C;  4RG8 A;  3KBG A;  4FL6 A;  4Z89 A;  5KYX B;  1BB9 A;  4FW2 A;  2YSQ A;  1NYF A;  2LX9 A;  4MML A;  4PNO A;  4XU0 A;  1EX4 A;  3NTH A;  2XHC A;  1NPR A;  3CC2 Q;  2NUP A;  4DEY A;  2QA4 Q;  2RQT A;  4CC4 B;  3IQL A;  4J9F A;  2DRM A;  2MK5 A;  3I56 A;  1GCQ A;  1M90 U;  1OPK A;  1WXB A;  3VJP A;  4BB7 A;  2MPX C;  3H0I A;  3J7A F;  1LOJ A;  2EQU A;  2HCK A;  4FT4 A;  2MOX A;  2R58 A;  1M3A A;  1VQ8 Q;  3ULR B;  3M0R A;  5GAM d;  1WI7 A;  3L2R A;  3CC7 T;  4E7K A;  4IIM A;  1Y07 A;  4OMM A;  3VYG A;  4M7D G;  4LD9 K;  3JCM b;  1Q81 C;  1M27 C;  1BI3 A;  2DER A;  3E9G A;  4FT2 A;  5GAM e;  1JB0 E;  4KGV B;  2B8A A;  3JCM g;  2LRQ A;  2M1H A;  2KSS A;  2FG0 A;  1G3W A;  3ME9 A;  2YXY A;  3U23 A;  3JCM P;  1M2V A;  2LP5 A;  4M7D A;  5HK3 A;  1SRL A;  2LQN A;  1I5L A;  1UGR B;  2YRC A;  2KEA A;  2LTO A;  2OTJ A;  2K6D A;  3HFO A;  3I56 Q;  2YWW A;  4M7D C;  3PGG A;  1QMC A;  2EGC A;  3E1S A;  1R0C B;  4BD3 A;  2DE0 X;  3JCM J;  1YI2 T;  3CD6 A;  1UE9 A;  2X4X A;  2DL8 A;  2NUZ A;  1NEB A;  1QCN A;  2CP3 A;  2O9S A;  2FHD A;  2YRV A;  1NJI R;  3SWN A;  1ZQ1 A;  3OSV A;  4KUL A;  4NL2 A;  3CXC P;  3BDU A;  3I55 T;  2ED0 A;  2V8J A;  1VQP Q;  2X9H A;  1RAI B;  1TUD A;  2HD0 A;  2QK0 A;  4HT9 A;  1K73 C;  1UHC A;  3FRN A;  5EC7 A;  4D8K A;  3VS2 A;  4M78 C;  2IVW A;  5GJW B;  3M4G A;  3A8L B;  1K0S A;  2E12 A;  3G6E T;  4BUG A;  4JRP A;  4BDZ A;  1OQK A;  2OTJ Q;  5CKF A;  1SSH A;  4C92 F;  3GBQ A;  1JJ2 S;  2XI9 A;  1O9S A;  3H6Z A;  3JB9 J;  1YIJ T;  4C0D B;  3PFS A;  2DBK A;  2DL3 A;  4XTZ A;  3CD6 Q;  4GLM A;  1YWO A;  2XU8 A;  3CCV A;  2ROT A;  1ARK A;  5DLO A;  3EGD A;  1OOT A;  2K9G A;  3HPW A;  1ZUU A;  2J6O A;  1U5S A;  4J6Y A;  1WGS A;  2LX7 A;  6AT1 B;  1MV0 B;  5KYU A;  5CAI A;  3OYH A;  1G8X A;  1VQ5 T;  3D7S B;  2XG8 D;  2DTH A;  1M5Q 1;  1S1N A;  1ZA2 B;  2HQH A;  4HT8 A;  4C0Z A;  4ANJ A;  3QZ9 B;  2F1L A;  1F1B B;  3M4Y A;  3PMI A;  1GL5 A;  2EQK A;  3C4S A;  1ACM B;  5HCK A;  3MP8 A;  1Z9Q A;  4M77 E;  5CKH A;  5KH6 A;  2OAW A;  2YUO A;  1VQ4 T;  3QPH A;  3HKS A;  1PSF A;  1UB4 A;  1AHJ B;  5A2Q E;  2D8J A;  3GLX A;  2RQW A;  1QP2 A;  1ZSG A;  2LQW A;  3AT1 B;  1JXO A;  3INZ A;  2KRN A;  2EWN A;  2ESW A;  4OP0 A;  3A5Z B;  2VXF A;  4JRQ A;  2JVV A;  2VKN A;  2ED1 A;  4EMK C;  2KY9 A;  4WCI A;  3CCQ T;  2DXU A;  2FRW A;  4XU3 A;  1UTI A;  3M58 A;  4M7A B;  2DXB A;  2RI2 A;  1KSW A;  2DFU A;  1NPP A;  2PNI A;  2KRS A;  4HCZ A;  2IPO B;  3UT1 A;  2D9T A;  3MP1 A;  2XIC A;  4UC4 A;  1U8R A;  2VGN A;  2M9U A;  3O8V A;  4PJO D;  2LQK A;  2RB6 A;  2JTM A;  2L8D A;  4AFU C;  2F5K A;  1WHH A;  2CZ7 B;  2EYX A;  4J9G A;  4LDV A;  1Q86 R;  2DXC A;  2FO0 A;  2K3X A;  1VYU A;  1WX6 A;  1YI2 A;  5GAN 4;  2EGA A;  2KYM A;  1CSK A;  1M3C A;  5C0M A;  1S72 T;  1JO8 A;  2NUT A;  2GCX A;  5GMK i;  1WIE A;  3CC7 Q;  4F7U B;  1T3L A;  4M7A D;  2RN8 A;  1BI2 A;  1JJ2 A;  3FJP A;  2V8K A;  2KR3 A;  1IO6 A;  4A4G A;  1RAC B;  2A7Y A;  3HRS A;  2YUQ A;  1KC8 R;  2J6F A;  5KYY B;  2L5Q A;  3EFS A;  2JJ9 A;  1AEY A;  1RL2 A;  1VQN T;  1NLP C;  2QI2 A;  4B9W A;  4ELZ C;  2E41 A;  3G6E A;  3GNG A;  2DM1 A;  4C8Q B;  2LDM A;  1WFW A;  1BYM A;  1MND A;  3DB3 A;  3BY7 A;  4QVZ A;  5FU6 B;  3PNW C;  3CME T;  2HZY A;  2KVQ G;  4J9E A;  3RKX A;  1GFC A;  2PTK A;  1TUC A;  4EIK A;  4J7I A;  2LCL A;  3VUB A;  4XTW A;  4PJJ A;  1YIJ A;  5KCH A;  1YI2 Q;  1GCP A;  3FLG A;  2E5Q A;  2WSE E;  1NYG A;  4MZM A;  2OX7 A;  4JS5 A;  1UGP B;  4M77 G;  1D3B B;  1Q82 R;  4JRI A;  2JW4 A;  4A63 B;  2KT8 A;  3PTA A;  4HCC A;  3I55 Q;  1VQ9 T;  3ZFJ A;  3NFC A;  4WF2 A;  5KYX A;  4XAX B;  2E3I A;  2YHT A;  5IHI A;  1VQ5 A;  3QDF A;  3AHU A;  4C8Q D;  4RTU A;  2AKK A;  2RI3 A;  4PLL A;  2JS2 A;  4M77 A;  4OB0 B;  3LGL A;  4ZGD B;  1JXM A;  2CDT A;  3OYB A;  2W0Z A;  5L8R E;  2MAM A;  3JCM X;  3MHX A;  1JU5 C;  1PD1 A;  2RQR A;  2SEM A;  2E6N A;  2ZPG B;  3G6E Q;  2RQU A;  4P5N A;  4KH1 B;  2ZPH B;  1RAH B;  2V8I A;  2EJF A;  3CQT A;  3M55 A;  1PRM C;  2ZPB B;  3EGX B;  2CZ6 B;  2FEI A;  3M0P A;  4IUR A;  1IGU A;  2GQI A;  1IZ6 A;  3L42 A;  1YIJ Q;  2VWF A;  2C06 A;  1QCO A;  3G4S T;  1YN8 A;  3HRU A;  2RPN A;  4QQ6 A;  1Y71 A;  2WSF E;  4LE9 A;  5HK0 A;  2CSQ A;  4PJO E;  4LXC A;  2PVO B;  5CCA A;  1XJW B;  3GP8 A;  4BY6 B;  5IT9 E;  3BFM A;  3X24 B;  2MYS A;  2QQ9 A;  4CC2 A;  4MDX A;  4Z88 A;  1AOJ A;  2EKO A;  1VQ5 Q;  3V7S A;  3LWI A;  1SRM A;  1X75 C;  5GAM g;  2J7I A;  1FMV A;  1SF9 A;  5LJ3 f;  2KXC A;  5FLX E;  7AT1 B;  1M8M A;  4O6J A;  2BE9 B;  2RHX A;  1TTH B;  1VQL T;  4N4G A;  4M7A E;  1KQ1 A;  4LUE A;  1PRL C;  5GMK m;  3CC4 A;  3CXC A;  1I5O B;  4X9D A;  3VYH B;  1S72 A;  5FRO A;  2YLB A;  1HJD A;  1AWX A;  2V1Q A;  2BZX A;  4ZN3 A;  5HY6 A;  3WVD B;  3NTK A;  2EJG A;  3HRT A;  3REA B;  2DIL A;  3LGF A;  2QXF A;  2ATC B;  1MMA A;  4F04 B;  1BBZ A;  4BAC A;  2X4J A;  3TSW A;  3JCM Q;  1ZLM A;  5KYW B;  3S3M A;  3CCQ Q;  2KE9 A;  2L0A A;  1B34 B;  1FXX A;  3VKI A;  1VQN A;  3LH5 A;  3OB9 A;  5D6Y A;  2EYQ A;  3OYI A;  2LCC A;  1TUG B;  4F7U E;  4AT1 B;  4RCC A;  4BDY A;  2OTL T;  1RAA B;  2WSC E;  1LJO A;  3CCE T;  3OS2 A;  1VIE A;  3OW2 S;  3DKM A;  3M0Q A;  4VUB A;  3UDC A;  2E3H A;  3QJY A;  1BCM A;  2JUF A;  3CC4 Q;  3ZL7 C;  3OA6 A;  4BE2 A;  2CT3 A;  4RTY A;  2HKN A;  1S72 Q;  1OEB A;  2DO3 A;  4PKC C;  2RJC A;  2L3Q A;  4C5E A;  2AKL A;  4FW1 A;  4C8Q F;  4EDU A;  4DBH A;  1M1F A;  2GFA A;  3EG9 A;  4C0D C;  1UJY A;  3T9N A;  1N5Z A;  4GLK A;  4C92 B;  5IHK A;  1OYX A;  1H3Z A;  2ECZ A;  1H8K A;  2VUB A;  5AT1 B;  1PKS A;  1VQN Q;  1NE8 A;  4M78 E;  5IN1 A;  4PJL A;  1JJ2 P;  1ABO A;  1WJS A;  4PJO G;  4D6W A;  2FPD A;  4R55 A;  1TWB A;  4J6X A;  4XTY A;  3NPF A;  1W70 A;  4NL3 A;  5GMK l;  3CME Q;  4M75 A;  3FB9 A;  2CT4 A;  2EPD A;  4J5Y A;  2BKD N;  3CCM T;  5FU7 B;  3M57 A;  2KRM A;  1YWP A;  4PJO A;  1VUB A;  2KGT A;  1Y7X A;  2L3P A;  2QQS A;  5GAN f;  3G4S A;  4M7A G;  4C92 D;  4QVD A;  5KCO A;  5IXF A;  1X6B A;  2MWO A;  3CCV T;  1UUE A;  5GAN e;  1C1A A;  1VQ9 Q;  1KC8 C;  2EAY A;  2AZS A;  2C0T A;  1KD1 R;  2CUB A;  4Y28 E;  3RKY A;  3CCR A;  3V7C A;  1LNX A;  1XTD A;  1BI0 A;  4ZTF A;  2L3R A;  1RAB B;  3URG A;  8ATC B;  3FIF A;  3PVQ A;  3SDZ A;  2HKQ B;  4QKU A;  3OYE A;  4LDU A;  2G6F X;  2CZ1 B;  1VQL A;  3CCJ A;  1RAG B;  3OYK A;  4M7A C;  4MZT A;  3SD4 A;  5FWB A;  3HL8 A;  1IHV A;  4F7U G;  2I0N A;  5KE2 A;  2GTJ A;  1TG0 A;  3MPU B;  4JZ4 A;  2XMF A;  4BE0 A;  1M1K R;  2YRD A;  1QVP A;  3M54 A;  4QW2 A;  1ZX6 A;  3JSC A;  3OMG A;  4JLI A;  2EQI A;  3HP9 A;  3CMA T;  4ESR A;  2O4X B;  1Q82 C;  3TRE A;  3G4S Q;  2JNG A;  1E6H A;  2LJ3 A;  1VQ6 T;  1G83 A;  2RHY A;  3H8Z A;  1M1K U;  1AWW A;  1NZ9 A;  2KT1 A;  4OB3 B;  4Q5W A;  4OMO A;  4WTO B;  2YDL A;  4DBR A;  4QVC A;  1NM7 A;  2HQE A;  1D1B A;  1WPY A;  5J26 A;  3M0S A;  2OTL A;  1H3H A;  2P84 A;  4XQ3 A;  3CCE A;  4C0G A;  2QQA A;  1PSE A;  1VQL Q;  3FEO A;  4A4F A;  4A4K A;  1BIA A;  5I21 A;  2QG9 B;  4RKU E;  2E1H A;  4M78 G;  2DTO A;  1R8O B;  2COZ A;  2K4Y A;  4C8Q C;  2OI3 A;  4CRI A;  1IXD A;  4MZP A;  5FU6 C;  4ME7 A;  3GOX A;  2QAS A;  2RK2 A;  2W10 A;  4L6V 5;  1VIF A;  1FYN A;  2AIR B;  4OGC A;  1SPK A;  1V29 B;  4M78 A;  3V7R A;  2L89 A;  5GAN 5;  5FRN A;  3UF4 A;  5CO7 A;  3ZEH A;  4HA8 A;  2JM9 A;  1YHQ T;  4BI3 A;  3FC3 A;  2LJ0 A;  4RUG A;  2M02 A;  1NJI U;  2KNB B;  4E7L A;  1ABQ A;  1NBE B;  2FZC B;  3RR6 A;  4CI0 C;  2HBP A;  1JEG A;  2OTL Q;  2DK3 A;  4C92 E;  2JM8 A;  1TH7 A;  4JZ3 A;  2JZ2 A;  4IUQ A;  4LDW A;  4EMG A;  3CCE Q;  1YCY A;  2F2V A;  3P8B B;  4J9B A;  4NS5 A;  3TVT A;  3E19 A;  3CCM A;  1RI0 A;  5D6X A;  4KRT A;  2MI6 A;  2GQV A;  4BI4 A;  4KUI A;  5LL6 S;  4II1 A;  2HSE B;  1UGS B;  4AFS C;  4QQG A;  2HAX A;  2QTX A;  3KXT A;  1B7T A;  4FYY B;  2PQW A;  3OBW A;  5LJ3 h;  1I8F A;  1T0H A;  3C95 A;  1KK7 A;  4C0F A;  2K79 A;  4Z8A A;  1B3Q A;  1N8R R;  2GF7 A;  1W2B S;  2MF2 A;  1QVF P;  3CEY A;  4AG1 C;  3CPW S;  4MDW A;  2GFU A;  3DLM A;  4JJD A;  4JS4 A;  1OU8 A;  1WHK A;  4BY6 C;  2H3E B;  2RQV A;  1K9M R;  3HSB A;  2GBQ A;  5A0G A;  3CCL T;  1N9S A;  3TEE A;  3LH0 A;  4AMC A;  3L2U A;  2LJ1 A;  3OMC A;  4FCY A;  1UFF A;  3OYM A;  3CCM Q;  3RKW A;  1X2K A;  1K9M U;  1SEM A;  1PHT A;  3CCU T;  1NLO C;  3M56 A;  2CP2 A;  3RES A;  1PD0 A;  2CRE A;  5LJ3 j;  2NWM A;  1LVK A;  2RM4 A;  3CMA A;  4EMK A;  1WXT A;  2KBT A;  1VQ6 A;  1RI9 A;  4OMF B;  2YT6 A;  5KYN A;  3WVE B;  3O5Z A;  5CQY A;  3CCV Q;  2C0I A;  3J81 E;  4AG2 C;  4DQ2 A;  1T3S A;  1TXQ A;  2PVG B;  2EIF A;  2DTI A;  1UJ0 A;  2VYT A;  2V1R A;  1ZUK A;  5CIU A;  1VQK T;  2O9V A;  3LWH A;  5C6S A;  2VXE A;  3CCS A;  4HXJ A;  2RNA A;  1AZG B;  3OYD A;  1E6G A;  2RF0 A;  5HKC A;  3QHS A;  2IIM A;  3OS0 A;  2PU9 B;  2P4R A;  5CVI A;  2D0N A;  4KUD K;  1YNZ A;  1XNI A;  5FW9 A;  4Z02 A;  3ASK A;  4PLI A;  1I1J A;  2CH4 W;  4FM4 B;  3CC4 T;  4C92 G;  1AD5 A;  3BE3 A;  2NUP B;  1QQJ A;  2HL5 C;  1RLP C;  1G3T A;  3CMA Q;  1K8A R;  2O2O A;  1VA7 A;  2VV5 A;  1Q86 U;  3MCA B;  3H41 A;  1VQ6 Q;  2XDP A;  1KD1 C;  2LNH B;  2EVR A;  3VS6 A;  2DD4 A;  1YHQ A;  3EFO A;  4C92 A;  4ELY C;  3VS4 A;  4QT7 A;  1K8A U;  4E47 A;  3NHN A;  1B07 A;  1IB8 A;  3JAM E;  3OW2 P;  3JCM f;  3RBB B;  1MHN A;  2VGM A;  5GMK e;  2EYZ A;  1AWO A;  4RMO A;  4C92 C;  4V2S A;  1WJQ A;  3MKD A;  1M4Z A;  1K4U S;  3VS1 A;  1KC8 U;  5GAN h;  1WZO A;  1ZSZ B;  1SHG A;  4IUP A;  3QBY A;  1WHM A;  2KMT A;  1VQ7 T;  3Q1J A;  4PFO A;  1M1K C;  4JJN K;  3L2Q A;  3E2U A;  2PVD B;  2X51 A;  1X6G A;  2LMJ A;  1M2V B;  3TCJ A;  4Y92 A;  1K0X A;  2YUP A;  4LDX A;  5GAO m;  3MET A;  2KAF A;  4HVW A;  5FU7 C;  2LZ6 B;  1YCS B;  3JB9 F;  1VOM A;  4GY5 A;  1YJN A;  1GRI A;  2H3J A;  1YHQ Q;  1MGQ A;  4E7S A;  3CPF A;  5GAN j;  4OMP A;  5GAN g;  1Q82 U;  4FYW B;  4PK4 A;  2P0Q A;  1OZ2 A;  3C12 A;  2WAC A;  1BK2 A;  3ER0 A;  2CS7 A;  5LJ5 f;  1G5V A;  2ZGW A;  3VU3 C;  4YTL A;  3SWN B;  4RTW A;  4A53 A;  3CCL A;  3EH1 A;  2QQR A;  1VYT A;  3LW5 E;  3V8J A;  5LJ5 e;  4ZTJ A;  1PG5 B;  2MWP A;  1QVF S;  1Q81 R;  4PJM A;  1RAF B;  5I11 A;  3CCU A;  3JB9 H;  3KUF A;  3CBO A;  2V26 A;  3QYH B;  1QP3 A;  3PE0 A;  2CYZ B;  3ZBD A;  3OYG A;  2J06 A;  1X43 A;  3JB9 I;  1U06 A;  4DBF A;  3EHR A;  3OYY A;  3QYG B;  1NJI C;  2HL3 A;  1TU0 B;  4DA4 A;  4X9C A;  3CBM A;  4RTT A;  2RMO A;  4A54 A;  5GAO r;  2PUO B;  5GAN 3;  2J05 A;  1Y96 B;  4FSS A;  2FPF A;  3VS0 A;  1I81 A;  1YJN Q;  2HEQ A;  5EG2 A;  1QVG S;  3HTR A;  1VQK A;  3CCR T;  2QQB A;  5CKB A;  4JUV A;  1EIF A;  2LC4 A;  1Z9Z A;  2XD0 A;  1QKX A;  2MMP A;  3A8G B;  2OAU A;  4E7H A;  3EGD B;  3CCJ T;  3CCL Q;  4M75 F;  1GFD A;  2LVM A;  2MCN A;  5LJ3 e;  4OB1 B;  2FB7 A;  3RMQ A;  1QWF A;  5KYU B;  3CCU Q;  2BZY A;  3X20 B;  2HDA A;  4CC7 A;  1D0Z A;  5GAO l;  1YJW T;  1YBY A;  1KHC A;  3VS7 A;  5GAN 2;  1TS9 A;  2SRC A;  2LQ8 A;  1X6O A;  3I9Q A;  2DYB A;  4E2F B;  1N8R C;  4LD6 A;  3I5R A;  2JS0 A;  3LLR A;  3QSU A;  1MMD A;  2ZCF B;  2M16 A;  4KBM B;  2HBW A;  2FPE A;  1VQK Q;  4E6R A;  4XTU A;  1SG5 A;  1K9M C;  4ZGJ B;  2CSI A;  3QUI A;  3QXE B;  1YFN A;  3OYF A;  3OYL A;  3NTI A;  1WDX A;  2DXT A;  1VQ7 A;  2FRY A;  2L2P A;  4Y91 A;  3L1A A;  3MP6 A;  4JRK A;  2XID A;  2DYI A;  5A0D A;  2CKK A;  5CQX A;  4F14 A;  4FIB A;  3L2W A;  2DET A;  4XU2 A;  4C8Q E;  2DVJ A;  5KE3 A;  1QW1 A;  1AT1 B;  4JJB A;  1QVF A;  2E10 A;  4IKF A;  2D8H A;  4L5G A;  1D0Y A;  2XDD A;  3QWY A;  1VQO T;  4N0A C;  3OS5 A;  1MMG A;  2DRK A;  5GAO q;  1E7O A;  1WXU A;  3N5B B;  4C5G A;  2DNU A;  3PMT A;  1UGQ B;  3M9Q A;  3VUZ A;  2DPP B;  2VC8 A;  4LN2 A;  1K1Z A;  3JCM c;  2Z0W A;  2DL4 A;  3G7Z A;  2NUT B;  5GAN 6;  2VB6 A;  4M7D F;  2DZC A;  2EKH A;  1C0M A;  1ZBJ A;  2HQX A;  1GBR A;  2DAQ A;  3J80 E;  2FL7 A;  5A0L A;  3VRY A;  2AK5 A;  4RG2 A;  1W4S A;  3MEW A;  5GAO p;  3PIP A;  1GBQ A;  3EG2 A;  3TU4 K;  1Q86 C;  1U1S A;  2A28 A;  1VQ7 Q;  2X35 A;  1KG1 A;  4LUD A;  3THK A;  5IAY A;  3CC2 A;  1Q7Y R;  2E4H A;  3UAT A;  1PM3 A;  1K8A C;  3UPU A;  1FMK A;  1OV3 A;  5GAN d;  1W2B P;  3H0H A;  5CKD A;  1OUL A;  3OYC A;  3CPW P;  2RO0 A;  1Q7Y U;  2IG0 A;  1WLP B;  5ECA A;  2VAS A;  1W1F A;  3MJX A;  1D1C A;  2HNI A;  5FRM A;  3E9F A;  4B9X A;  1J3T A;  1P92 A;  3OY9 A;  4M7A A;  1I0C A;  4XU1 A;  4MMK A;  4IUU A;  2BZ8 A;  5I2M A;  1KD1 U;  4J83 A;  1MNE A;  4JJC A;  3OBY A;  2JTF A;  2JN0 A;  2K7A A;  3UA7 A;  2DZ9 A;  3V8L A;  3PIO A;  2JMC A;  1I07 A;  5CR2 A;  2BUD A;  1H64 1;  2KI7 A;  4A4E A;  1YJW A;  2DA9 A;  4M77 B;  1M90 R;  4KH0 B;  5GMK h;  3I5S A;  2KQW A;  1TSF A;  2LCS A;  2EJ9 A;  2DF6 A;  2CP6 A;  4J9D A;  3JCM h;  5GAO n;  3OW2 A;  3OS1 A;  2H8H A;  3A8M B;  4F7U A;  4GBQ A;  1M8V A;  5D7U A;  2JMA A;  5IH2 A;  4C8Q G;  1WHL A;  2FYK A;  3RDV A;  1UEB A;  1RAD B;  3VV0 A;  3JCM V;  1G3Y A;  2COY A;  5KYY A;  1VYV A;  1GCQ C;  3S3N A;  3CCR Q;  4J9H A;  2C0O A;  1QWE A;  3VS5 A;  5GAM f;  3M0T A;  3OYJ A;  3CCS T;  3P8D A;  1VQP A;  3R6N A;  4C8Q A;  2ZPI B;  2RJD A;  2EYY A;  1MV3 A;  4IUT A;  5GMK j;  1WHJ A;  1ZSZ A;  4M77 D;  2R5M A;  1V1C A;  3CCJ Q;  2F69 A;  4OVA A;  2DL5 A;  2QYZ A;  4LDY A;  4KGZ B;  3OYA A;  4HVV A;  5IXB A;  3MO8 A;  1YJW Q;  1ZSZ C;  3MEV A;  5M9O A;  4DOW A;  3OSS C;  4XTV A;  3PVL A;  1G3S A;  3LYI A;  2E6Z A;  2K2M A;  5I22 A;  2RD1 A;  1VQO A;  2ABL A;  4CC3 A;  4C5H A;  1D3B A;  1OX9 A;  1U1T A;  3GF5 A;  5LJ5 h;  1FX7 A;  8AT1 B;  1D1A A;  2AHJ B;  2B86 A;  2JOY A;  2CP0 A;  1EFN A;  2CH4 A;  3MEU A;  2D6F A;  3OYN A;  2DEU A;  3BDL A;  4ORZ A;  4F16 A;  1RLQ C;  1QCF A;  5J3B A;  2EQM A;  4X34 A;  3X26 B;  5CK9 A;  1SKU B;  2O31 A;  1K76 A;  3EGX A;  4XTX A;  2Y4Y A;  2ROL A;  2FVU A;  3SWN C;  1ZHI A;  2PUK B;  2ZAE A;  2RHU A;  4E7Z A;  5LJ5 j;  1M2O A;  5LJ5 g;  3V8K A;  9ATC B;  1KIK A;  1HXD A;  2M0Y A;  3JV3 A;  4FSX A;  2L3S A;  2ENM A;  3UA6 A;  1VQO Q;  5GJV B;  3L2V A;  1Y96 A;  2G3R A;  2FZK B;  1NG2 A;  1YJN T;  1KQS P;  4DBQ A;  4ZN1 A;  2X4Y A;  3JB9 D;  1VQM T;  2LT4 A;  2QEX T;  1N6A A;  1ZA1 B;  4FYX B;  1WQW A;  2K5L A;  3EH2 A;  4FYV B;  1N8R U;  4OGE A;  3EG9 B;  2A36 A;  2Y90 A;  3NMZ C;  1HK9 A;  4EPC A;  2BTT A;  2KXD A;  3FJ5 A;  5L23 A;  4BI8 B;  1U3O A;  2GNC A;  3G71 T;  1KFZ A;  5LJ3 g;  2NLU A;  3GNF B;  2KK4 A;  1QVG P;  2DKG A;  5IHN A;  1QKW A;  4A4H A;  1OI1 A;  1RUW A;  4AFQ C;  2JT4 A;  3M53 A;  1XQH A;  2F5T X;  4M75 B;  2O88 A;  2EFI A;  1BU1 A;  5DM7 R;  4AFZ C;  2QGF B;  1HSQ A;  2K2V A;  1HD3 A;  3EG1 A;  5KYW A;  2JTE A;  4PJO B;  1GXI E;  1IRE B;  1B34 A;  3C0C A;  3I35 A;  5DLQ E;  4PJN A;  4M77 F;  3CC7 A;  4TVR A;  3S6W A;  4X1V A;  4J8O A;  1FWZ A;  2LT1 A;  4N4I A;  1X27 A;  2CZ0 B;  3BW1 A;  2DBM A;  2RH2 A;  1ZBX A;  5D6W A;  3EGU A;  1Q7Y C;  2K5F A;  3QG1 A;  4C5I A;  2E5K A;  1AVZ C;  3EG3 A;  1WQ7 A;  4M75 D;  1BCO A;  1OPL A;  2D1X A;  1FMW A;  1A0N B;  1Y0M A;  2ZPF B;  3VS3 A;  2CP5 A;  2K57 A;  2X4W A;  2QDL A;  1YJ9 T;  1QLY A;  2A37 A;  2E64 A;  3SB2 A;  4ZGE B;  2K3B A;  2P0P A;  1JQQ A;  3A8H B;  3H9N A;  3UWN A;  2AZV A;  3JCM d;  1DJ7 B;  1D09 B;  3SEM A;  1TOV A;  2EYW A;  2HSP A;  1AZE A;  3I55 A;  3P8H A;  3CCS Q;  1N27 A;  1OU9 A;  3JCM e;  2F2W A;  3LX7 A;  2CGH A;  1LPL A;  2LNV A;  2OJ2 A;  1W2B A;  1D0X A;  1YIT T;  1M90 C;  3CBP A;  3CPW A;  1BI1 A;  1O75 A;  1N9R A;  1HYO A;  3FDR A;  2DIG A;  4DEX A;  4PL6 A;  3M5A A;  3SHW A;  4R0K A;  4M7D B;  1BIB A;  3CXC S;  4J7F A;  1M3B A;  2RJE A;  4J9C A;  4HVU A;  3OQ5 A;  4L59 A;  3KFV A;  2QGG A;  1I4K 1;  3QII A;  3F70 A;  2DD5 A;  4R56 A;  3A98 A;  2DVE A;  3NGP A;  1VQM A;  4B6M A;  2QEX A;  1WJR A;  2E65 A;  1UHF A;  1PCX A;  2QAZ A;  2RA2 A;  3TQ7 P;  5LJ5 d;  2RJF A;  3C94 A;  3M0U A;  4JPB W;  1T0J A;  2P4T A;  4M78 B;  3L2Z A;  4XK8 E;  3X25 B;  5I2S A;  1KQS S;  4RTZ A;  2HMA A;  4M7D D;  2M0O A;  1SHF A;  4OML A;  5CKE A;  2DLP A;  1KJW A;  2EGE A;  3G71 A;  1IGQ A;  5GAN 8;  1SSF A;  4RCB A;  3CC2 T;  3GPL A;  2QA4 T;  1UG1 A;  4NOY A;  2R57 A;  1MUZ A;  3DB4 A;  1Q81 U;  1WHG A;  2O4X A;  1K9A A;  4HKE A;  4M77 C;  4OB2 B;  2DMO A;  1KQ2 A;  3RIR A;  5GAM h;  1VQ4 A;  3EFR A;  2CP7 A;  2JXB A;  3G1J A;  4OF1 A;  2RHI A;  1X2Q A;  4D8D A;  1PNJ A;  3X28 B;  3RNJ A;  3JRZ A;  4M78 D;  1VQ8 T;  1VQM Q;  2QEX Q;  2FZG B;  4M75 E;  2MIO A;  5LJ3 d;  4KGX B;  4QQD A;  2ZZD A;  1AWJ A;  1XOV A;  3REB B;  4F17 A;  3CCQ A;  4JLG A;  4IUV A;  2CUD A;  4ZNX A;  3EAE A;  4PFP A;  5FWC A;  3QO3 A;  2XK0 A;  2DEQ A;  1KHI A;  2A08 A;  5AYF A;  4EMH A;  1K73 R;  4PJO F;  3A8O B;  5GAM j;  3G71 Q;  3M59 A;  4O5V A;  4N4H A; 
#chains in the Genus database with same CATH homology
 3CCM A;  4B9X A;  4F7U B;  1RI0 A;  2QDY B;  5D6X A;  1P92 A;  3OY9 A;  4M7A A;  4M7A D;  1BI2 A;  2DIQ A;  4XU1 A;  2MI6 A;  2GQV A;  1JRI A;  3FJP A;  2V8K A;  4KUI A;  4MMK A;  4BI4 A;  3S3O A;  4IUU A;  2I2L A;  5I2M A;  3QJ6 A;  1K73 U;  4A4G A;  2A7Y A;  5LL6 S;  1KD1 U;  2BIV A;  4J83 A;  3HRS A;  3QKJ A;  3I56 T;  4II1 A;  1UGS B;  3OBY A;  2L5Q A;  2JTF A;  3EFS A;  2JN0 A;  2HAX A;  2RK1 A;  2Y4X A;  4QQG A;  3JB9 G;  1RL2 A;  1VQN T;  2QTX A;  3KXT A;  2DZ9 A;  3V8L A;  2QI2 A;  3PIO A;  2PQW A;  4B9W A;  4ELZ C;  4M7A F;  2E41 A;  3OBW A;  2P0K A;  3QZ5 B;  3GNG A;  5LJ3 h;  5CR2 A;  1I8F A;  2BUD A;  1H64 1;  4C8Q B;  4EMK B;  1G5V A;  2LDM A;  4A4E A;  3C95 A;  1YJW A;  4C0F A;  3DB3 A;  1BYM A;  3BY7 A;  4M77 B;  4QVZ A;  4ATO A;  5FU6 B;  5GMK h;  3PNW C;  2KQW A;  1BKB A;  3CME T;  2KVQ G;  2GF7 A;  2EJ9 A;  2MF2 A;  3RKX A;  1W2B S;  4J7I A;  3CEY A;  3HHT B;  1VQP T;  2LCL A;  2EQJ A;  3JCM h;  3CPW S;  3VUB A;  5GAO n;  1YIT A;  3OW2 A;  4MDW A;  3OS1 A;  4XTW A;  2GFU A;  3HFN A;  3DLM A;  1JBM A;  4JS4 A;  1YIJ A;  1M9S A;  3A8M B;  4BY6 C;  4F7U A;  1M8V A;  5KCH A;  3HSB A;  3FLG A;  2O01 E;  2E5Q A;  2WSE E;  4C8Q G;  4MZM A;  1M1G A;  2FYK A;  2YLC A;  4N0A A;  5A0G A;  3CCL T;  4JS5 A;  1WNL A;  1UGP B;  1UEB A;  1N9S A;  4M77 G;  1D3B B;  3VV0 A;  3JCM V;  3TEE A;  1G3Y A;  3LH0 A;  3S3N A;  4JRI A;  3L2U A;  3OMC A;  1OZ3 A;  3OYM A;  3PTA A;  2RHZ A;  3RKW A;  1VQ9 T;  1KQS A;  3ZFJ A;  1K9M U;  3CCU T;  2K3Y A;  3NFC A;  3M56 A;  4WF2 A;  3CME A;  4E7J A;  2K5I A;  3RES A;  4XAX B;  5GAM f;  2XDB A;  4F7U F;  5LJ3 j;  2YHT A;  3OYJ A;  3CCS T;  3P8D A;  4KT0 E;  1VQP A;  1VQ5 A;  2RI5 A;  2RM4 A;  4C8Q D;  5DY9 A;  4C8Q A;  4EMK A;  3CMA A;  2ZPI B;  3AHU A;  2RJD A;  2OTJ T;  2RI3 A;  4PLL A;  4IUT A;  5GMK j;  4M77 D;  2XKO C;  4M77 A;  4OB0 B;  4OMF B;  3LGL A;  4FU6 A;  2R5M A;  4ZGD B;  1YJ9 A;  3SFM A;  3WXM B;  4M7D E;  3OYB A;  5L8R E;  2F69 A;  3GIB A;  5J39 A;  2MAM A;  4OVA A;  3JCM X;  3MHX A;  3WVE B;  4E7I A;  3CC7 A;  4BE1 A;  4LDY A;  5CQY A;  2E6N A;  2ZPG B;  3J81 E;  3OYA A;  3CD6 T;  2A3L A;  4P5N A;  3MO8 A;  4DQ2 A;  2PVG B;  2ZPH B;  2EIF A;  3MEV A;  2DTI A;  4DOW A;  2V8I A;  2EJF A;  5M9O A;  3OSS C;  1VQ9 A;  2R5A A;  2ZPB B;  3M55 A;  4XTV A;  2VYT A;  1G3S A;  3LYI A;  2CZ6 B;  5CIU A;  2E6Z A;  1VQK T;  3LWH A;  5C6S A;  2RD1 A;  1VQO A;  2VXE A;  3CCS A;  4C5H A;  4IUR A;  1QVG A;  1D3B A;  3DLL A;  1U1T A;  3GF5 A;  3RUX A;  5LJ5 h;  2D0Q B;  1IZ6 A;  3OYD A;  1FX7 A;  3L42 A;  4M75 G;  2C06 A;  5HKC A;  3QHS A;  3RMS A;  5GAN 7;  3OS0 A;  2QA4 A;  2AHJ B;  2PU9 B;  3G4S T;  4J6W A;  2JOY A;  3HRU A;  4QQ6 A;  5CVI A;  1Y71 A;  2WSF E;  4KUD K;  1XNI A;  3QDR B;  3MEU A;  2E70 A;  2KDS A;  5HK0 A;  4HCB A;  4Z02 A;  4IKF A;  4PJO E;  2D6F A;  3OYN A;  3BDL A;  3ASK A;  4PLI A;  2PVO B;  5CCA A;  3GP8 A;  4BY6 B;  4FM4 B;  3BFM A;  3CC4 T;  4C92 G;  3R6O A;  5IT9 E;  4M78 F;  3JCM W;  3X24 B;  2QQ9 A;  3PT9 A;  4MDX A;  2ZPE B;  5J3B A;  2EKO A;  2EQM A;  1G3T A;  3V7S A;  3LWI A;  1X75 C;  2VV5 A;  4X34 A;  5LJ5 f;  3X26 B;  3MCA B;  5GAM g;  1Q86 U;  3RER A;  2XDP A;  5CK9 A;  1VQ8 A;  1KD1 C;  5LJ3 f;  4JDS A;  5FLX E;  4XTX A;  2Y4Y A;  2DD4 A;  2FVU A;  4M75 C;  1ZHI A;  2DJZ A;  2PUK B;  3MEA A;  4O6J A;  3SWN C;  4DOV A;  1YHQ A;  2RHX A;  2RHU A;  4C92 A;  4ELY C;  1VQL T;  5LJ5 j;  5LJ5 g;  1K8A U;  4N4G A;  3V8K A;  4M7A E;  1KQ1 A;  1X01 A;  4PJO C;  4E47 A;  3JAM E;  4RG8 A;  3KBG A;  3JCM f;  1HXD A;  5GMK m;  3CC4 A;  4FL6 A;  1MHN A;  2VGM A;  4FSX A;  5GMK e;  3CXC A;  4X9D A;  4RMO A;  3VYH B;  4C92 C;  1S72 A;  4V2S A;  1WJQ A;  2LX9 A;  4MML A;  4PNO A;  2YLB A;  1M4Z A;  4XU0 A;  5FRO A;  3NTH A;  1KC8 U;  3L2V A;  1Y96 A;  5GAN h;  4ZN3 A;  2XHC A;  2G3R A;  5HY6 A;  3WVD B;  3NTK A;  2EJG A;  1NPR A;  3HRT A;  4IUP A;  3QBY A;  1YJN T;  3LGF A;  2KMT A;  1VQ7 T;  3Q1J A;  4ZN1 A;  2QXF A;  1M1K C;  4JJN K;  2X4Y A;  3JB9 D;  1VQM T;  3L2Q A;  2LT4 A;  2QEX T;  2PVD B;  1N6A A;  4BAC A;  2X4J A;  3JCM Q;  1WQW A;  3I56 A;  3OA6 A;  3S3M A;  2K5L A;  1M90 U;  4BB7 A;  3VJP A;  3TCJ A;  1B34 B;  1N8R U;  1FXX A;  3VKI A;  4LDX A;  4OGE A;  1VQN A;  5GAO m;  3J7A F;  3MET A;  3OB9 A;  5D6Y A;  2EYQ A;  2KAF A;  2Y90 A;  3OYI A;  5FU7 C;  1LOJ A;  2EQU A;  2LCC A;  4EPC A;  1HK9 A;  4F7U E;  4RCC A;  4FT4 A;  2R58 A;  4BDY A;  4GY5 A;  2OTL T;  3JB9 F;  2WSC E;  1LJO A;  3CCE T;  4BI8 B;  1YJN A;  3OS2 A;  5GAM d;  1VIE A;  2H3J A;  3L2R A;  3G71 T;  3CC7 T;  4E7K A;  1MGQ A;  5LJ3 g;  3OW2 S;  3DKM A;  1Y07 A;  2NLU A;  3GNF B;  2KK4 A;  3VYG A;  3CPF A;  4VUB A;  5GAN g;  5GAN j;  4LD9 K;  4M7D G;  3UDC A;  2DKG A;  3JCM b;  3QJY A;  1Q81 C;  1Q82 U;  1BI3 A;  4A4H A;  2P0Q A;  1OI1 A;  1OZ2 A;  2JUF A;  2WAC A;  3C12 A;  3E9G A;  2CS7 A;  3ER0 A;  3M53 A;  4FT2 A;  1JB0 E;  1XQH A;  2F5T X;  2ZGW A;  3VU3 C;  4YTL A;  4M75 B;  3SWN B;  2B8A A;  4BE2 A;  2EFI A;  4A53 A;  3JCM g;  5DM7 R;  2LRQ A;  2K2V A;  2DO3 A;  2M1H A;  4PKC C;  2KSS A;  3CCL A;  1G3W A;  2RJC A;  3ME9 A;  2QQR A;  3LW5 E;  4C5E A;  3JCM P;  3V8J A;  4PJO B;  5LJ5 e;  4ZTJ A;  4M7D A;  2MWP A;  1GXI E;  5HK3 A;  1IRE B;  1QVF S;  1B34 A;  4C8Q F;  4EDU A;  5DLQ E;  3CCU A;  1I5L A;  3JB9 H;  1M1F A;  1UGR B;  2GFA A;  3CBO A;  3KUF A;  3QYH B;  1QP3 A;  4M77 F;  2CYZ B;  4TVR A;  3T9N A;  3ZBD A;  4C0D C;  3OYG A;  4GLK A;  3S6W A;  4C92 B;  2LTO A;  2OTJ A;  4J8O A;  3JB9 I;  1OYX A;  3HFO A;  1H3Z A;  1FWZ A;  4M7D C;  3PGG A;  3OYY A;  2LT1 A;  3QYG B;  4N4I A;  1NJI C;  2CZ0 B;  2VUB A;  3BW1 A;  3E1S A;  2RH2 A;  4DA4 A;  1NE8 A;  1ZBX A;  4M78 E;  4X9C A;  5D6W A;  5IN1 A;  1Q7Y C;  2K5F A;  3CBM A;  1WJS A;  3QG1 A;  4PJO G;  4D6W A;  4BD3 A;  4A54 A;  4C5I A;  3JCM J;  5GAO r;  2PUO B;  1YI2 T;  2X4X A;  5GAN 3;  4R55 A;  3CD6 A;  4J6X A;  4XTY A;  1Y96 B;  2FHD A;  1I81 A;  2YRV A;  1WQ7 A;  4NL3 A;  5GMK l;  5EG2 A;  4M75 D;  4M75 A;  3SWN A;  1ZQ1 A;  3FB9 A;  3OSV A;  4KUL A;  1QVG S;  1VQK A;  4NL2 A;  3BDU A;  4J5Y A;  2BKD N;  3I55 T;  3CCM T;  3CCR T;  2V8J A;  5FU7 B;  2ZPF B;  3M57 A;  2K57 A;  2X4W A;  1YJ9 T;  2HD0 A;  2QQB A;  4PJO A;  4HT9 A;  1K73 C;  1VUB A;  3FRN A;  5CKB A;  1Y7X A;  4JUV A;  3SB2 A;  2E64 A;  2QQS A;  1EIF A;  2LC4 A;  4ZGE B;  4M78 C;  5GAN f;  3G4S A;  2XD0 A;  2IVW A;  2MMP A;  2P0P A;  2OAU A;  3A8G B;  4E7H A;  4C92 D;  4M7A G;  4QVD A;  3M4G A;  5KCO A;  3CCJ T;  4M75 F;  3A8L B;  2LVM A;  3A8H B;  2E12 A;  3UWN A;  5LJ3 e;  3JCM d;  4OB1 B;  2FB7 A;  2MWO A;  1DJ7 B;  3RMQ A;  3CCV T;  5GAN e;  3G6E T;  4BUG A;  1KC8 C;  2EAY A;  4JRP A;  3X20 B;  4BDZ A;  5GAO l;  4Y28 E;  1YJW T;  3RKY A;  3CCR A;  3I55 A;  1YBY A;  3P8H A;  3V7C A;  1N27 A;  1LNX A;  5CKF A;  1KHC A;  1XTD A;  3JCM e;  1BI0 A;  5GAN 2;  3G6E A;  4C92 F;  4ZTF A;  2L3R A;  3URG A;  3LX7 A;  2CGH A;  2LNV A;  3FIF A;  1W2B A;  1JJ2 S;  2LQ8 A;  3SDZ A;  2XI9 A;  1O9S A;  3H6Z A;  1YIT T;  1X6O A;  1M90 C;  3CBP A;  3CPW A;  3JB9 J;  1YIJ T;  1BI1 A;  4C0D B;  1O75 A;  1N9R A;  3PFS A;  4LDU A;  2CZ1 B;  4LD6 A;  3OYE A;  3CCJ A;  1N8R C;  1VQL A;  4XTZ A;  3FDR A;  3LLR A;  3OYK A;  4M7A C;  2DIG A;  3QSU A;  4PL6 A;  4MZT A;  3SD4 A;  2XU8 A;  3M5A A;  2ZCF B;  3CCV A;  4M7D B;  1BIB A;  2M16 A;  3CXC S;  4KBM B;  4O5V A;  3HL8 A;  4J7F A;  4F7U G;  5KE2 A;  5DLO A;  4XTU A;  1K9M C;  2RJE A;  4ZGJ B;  4BE0 A;  3HPW A;  3OQ5 A;  1QVP A;  4L59 A;  3M54 A;  3QUI A;  3QXE B;  4J6Y A;  1WGS A;  4QW2 A;  3OMG A;  3JSC A;  4JLI A;  3OYF A;  3OYL A;  3HP9 A;  1I4K 1;  3NTI A;  3QII A;  5CAI A;  3OYH A;  1VQ5 T;  2XG8 D;  2DTH A;  2DXT A;  3CMA T;  1M5Q 1;  2O4X B;  3F70 A;  1Q82 C;  2DD5 A;  3TRE A;  1VQ7 A;  4Y91 A;  4C0Z A;  2JNG A;  4R56 A;  4HT8 A;  1VQ6 T;  2DVE A;  2RHY A;  3H8Z A;  1VQM A;  1M1K U;  3L1A A;  3MP6 A;  3QZ9 B;  2QEX A;  1NZ9 A;  1WJR A;  4JRK A;  2E65 A;  2XID A;  4OB3 B;  3M4Y A;  4Q5W A;  3PMI A;  5A0D A;  2RA2 A;  2CKK A;  5CQX A;  2EQK A;  2RJF A;  4FIB A;  5LJ5 d;  3C4S A;  3L2W A;  1VQ6 A;  4XU2 A;  4C8Q E;  3C94 A;  4QVC A;  2P4T A;  3MP8 A;  4M78 B;  2HQE A;  5KE3 A;  4M77 E;  1QW1 A;  5CKH A;  3L2Z A;  5KH6 A;  4XK8 E;  1VQ4 T;  3QPH A;  3X25 B;  1WPY A;  5J26 A;  1QVF A;  5I2S A;  3HKS A;  1PSF A;  1UB4 A;  1AHJ B;  2E10 A;  5A2Q E;  1KQS S;  4L5G A;  3GLX A;  2XDD A;  2OTL A;  1VQO T;  4M7D D;  4N0A C;  3OS5 A;  4XQ3 A;  1QP2 A;  2M0O A;  5CKE A;  3CCE A;  4C0G A;  5GAO q;  2QQA A;  3INZ A;  3N5B B;  4C5G A;  3G71 A;  2EWN A;  3PMT A;  1UGQ B;  4OP0 A;  3M9Q A;  1SSF A;  5GAN 8;  1PSE A;  4RCB A;  3VUZ A;  2DPP B;  3CC2 T;  3FEO A;  3GPL A;  2QA4 T;  3A5Z B;  4HCC A;  2VC8 A;  4A4F A;  4A4K A;  1BIA A;  5I21 A;  4NOY A;  2VXF A;  2R57 A;  3JCM c;  4RKU E;  3DB4 A;  2JVV A;  2E1H A;  4M78 G;  4JRQ A;  2DTO A;  3G7Z A;  1Q81 U;  1R8O B;  2K4Y A;  2O4X A;  4C8Q C;  4EMK C;  2KY9 A;  5GAN 6;  5GAM e;  4M7D F;  4CRI A;  4HKE A;  4M77 C;  4OB2 B;  3CCQ T;  1KQ2 A;  2DZC A;  2HQX A;  4MZP A;  5FU6 C;  2DXU A;  3RIR A;  5GAM h;  1VQ4 A;  3EFR A;  2DAQ A;  4XU3 A;  2FL7 A;  3J80 E;  5A0L A;  4ME7 A;  3M58 A;  4OF1 A;  4M7A B;  3GOX A;  2RHI A;  2RK2 A;  2DXB A;  2RI2 A;  3X28 B;  4RG2 A;  1W4S A;  3MEW A;  1NPP A;  4L6V 5;  5GAO p;  1VIF A;  3PIP A;  1Q86 C;  3TU4 K;  4OGC A;  1U1S A;  3JRZ A;  1V29 B;  4M78 D;  4M78 A;  3V7R A;  2L89 A;  2X35 A;  5GAN 5;  5FRN A;  4HCZ A;  1KG1 A;  3UT1 A;  2D9T A;  3MP1 A;  2XIC A;  1VQ8 T;  5IAY A;  3CC2 A;  5CO7 A;  4UC4 A;  3ZEH A;  2VGN A;  2M9U A;  3O8V A;  1U8R A;  4HA8 A;  4M75 E;  1YHQ T;  4PJO D;  2LQK A;  4BI3 A;  2RB6 A;  3FC3 A;  1K8A C;  2JTM A;  5LJ3 d;  2L8D A;  3UPU A;  2F5K A;  2CZ7 B;  4QQD A;  2ZZD A;  5GAN d;  1NJI U;  5CKD A;  4LDV A;  1JJ2 A;  1XOV A;  3OYC A;  4E7L A;  3CCQ A;  2DXC A;  2RO0 A;  4JLG A;  4IUV A;  2IG0 A;  2K3X A;  4CI0 C;  1Q7Y U;  2HBP A;  3EAE A;  1YI2 A;  5GAN 4;  3QO3 A;  2XK0 A;  2DK3 A;  2DEQ A;  4C92 E;  5C0M A;  1S72 T;  1TH7 A;  1KHI A;  2HNI A;  5AYF A;  4EMH A;  5GMK i;  2GCX A;  2JZ2 A;  4IUQ A;  4LDW A;  4PJO F;  1YCY A;  4EMG A;  5FRM A;  3A8O B;  5GAM j;  3P8B B;  3E9F A;  4NS5 A;  3M59 A;  3E19 A;  4N4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...