4C8QA

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
VDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qA00
4C92C 3JB9G 1B34A 1U1SA 4NL3A 3RIRA 3VU3C 4X9CA 1LNXA 5GAMf 4XTUA 1WPYA 1WNLA 4X9DA 2DZ9A 3V8LA 3JCMb 3RESA 4JUVA 5LJ3d 2E1HA 5GAN5 4XU2A 1KQ2A 2DJZA 3JCMQ 3BFMA 2YLBA 1MGQA 4C8QD 4EMKB 2EAYA 4EMKA 1I81A 4M75A 5I21A 5GMKe 5GAOr 4J6XA 1JRIA 4NOYA 4C8QE 1KQ1A 4C92G 2E10A 4XQ3A 3JCMg 3JCMX 2DVEA 5GAOq 4RCCA 4M7AD 5CAIA 2YLCA 5LJ3h 5GMKh 4F7UB 5GAN8 2VXEA 1LJOA 2FB7A 3SB2A 2DKGA 2VC8A 2YHTA 5LJ5e 2DXTA 2RB6A 4C8QF 4EMGA 4M7DF 1TH7A 1M5Q1 1B34B 4C92B 4C92A 4J6YA 5GMKm 3V8JA 3JB9I 4JRKA 4A54A 3V7RA 4M75G 5LJ3f 4M7AB 3HSBA 1N9SA 4PJOE 4F7UF 4PJOB 4M75C 2DEQA 3QSUA 3HFNA 4DQ2A 4M7DB 3SWNB 3BDUA 4XU1A 1HXDA 1D3BB 1BIBA 3BW1A 4M77B 4M77E 3SWNA 3JB9J 4PJOA 2RM4A 2CGHA 3FB9A 4JLIA 4NL2A 4M7DD 3JCMV 4PJOD 5GMKi 1I5LA 5GMKl 3FJPA 4C8QG 1N9RA 4J6WA 4M7AC 3EFSA 4M77D 4M77G 2Y90A 4C92D 3JCMW 2DTHA 2FYKA 5GAOn 3V8KA 5GAMh 3QUIA 4C8QC 4F7UA 4F7UE 1BIAA 3EFRA 3FIFA 5GAN4 4M7DC 3INZA 4M78G 4XTZA 1WQ7A 5DY9A 2DTOA 4C92E 2E41A 3JCMh 4M78C 4HT8A 3JB9F 4M75F 3JB9D 4M75D 1JBMA 3RERA 2I2LA 4F7UG 5LJ5d 5GAN3 1HK9A 3BY7A 4N0AC 4OP0A 4Y91A 3JCMe 2QTXA 5GANe 2ZGWA 3PGGA 4M77A 5GAMd 4WF2A 5GANh 4N0AA 4M75E 2K57A 4HA8A 4C8QA 5LJ5g 4QVCA 2DXUA 4JRIA 1X01A 3JCMd 4M7DG 1YCYA 3GIBA 4PJOG 3V7SA 2E64A 2JN0A 3L2ZA 4PNOA 3JB9H 5GANj 3AHUA 4M7AE 4M7AG 2EJ9A 4M78F 4MMLA 5GAMe 1I4K1 5GANd 4M78D 3RKYA 4HT9A 2EJFA 4XTWA 4XU0A 5LJ3j 5GANf 5GAN7 1U1TA 3RKXA 4M7AA 4XTYA 2DTIA 3RKWA 4PJOF 4M78E 4M78B 4C8QB 1D3BA 4C92F 3QO3A 2VXFA 4M77F 4M77C 4XU3A 3SWNC 4A53A 3JCMf 4M7DA 5GANg 4J5YA 4M7AF 1WQWA 4PJOC 3JCMc 5GAOl 1I8FA 5LJ3e 5LJ5j 5GAN6 3L1AA 2RD1A 3M4GA 2E65A 3QHSA 4RCBA 4XTVA 3RUXA 1M8VA 1H641 2EJGA 5LJ5h 5GAOp 2RA2A 4M7DE 3JCMP 3HFOA 4MMKA 2HNIA 4V2SA 5GMKj 4EMHA 5GAMg 5GAN2 5GAOm 2DZCA 4XTXA 4M78A 1LOJA 4M75B 5LJ3g 2EWNA 3V7CA 5GAMj 1Y96A 4EMKC 1Y96B 3JCMJ 5LJ5f 4QVDA
chains in the Genus database with same CATH superfamily
1B34A 3CCUA 1BI1A 4NL3A 1MMAA 2R5AA 2QA4A 2HL5C 1UHCA 2OTJQ 1KD1R 3BFMA 1UHFA 1I81A 1YNZA 4C8QE 1SRLA 1JQQA 3X25B 5GAOq 4Z02A 1PRLC 4J7FA 4E7HA 3O5ZA 2D0NA 4C92B 4RG8A 2CT3A 3CC4T 1GFCA 4FT2A 5LL6S 1BIBA 3OW2A 4Y92A 2YUQA 3RNJA 1W2BA 4C0GA 3JV3A 4E7LA 3Q1JA 2DTHA 1YJWQ 2QXFA 2CP2A 2JTFA 2HAXA 2DBMA 1K9MU 3OYAA 2LT4A 4PJLA 3OYBA 2COWA 4M75D 1NPRA 2CT4A 3CCST 1IZ6A 2MMPA 2E3HA 1VQ7T 4JS5A 1QCNA 1H3ZA 1T3SA 3JCMd 1PC0A 1N8RC 1JJ2S 2LCLA 5IN1A 4IIOA 4BD3A 1QW1A 4RTUA 4ELZC 2QA4T 4RTWA 2EJ9A 5GANd 1VA7A 3LYIA 4J9FA 4HCZA 2E3IA 3MPUB 4FYVB 4E7ZA 3JRZA 2L0AA 2PVDB 1KFZA 3UF4A 2RMOA 2LDMA 2X51A 3QIIA 1BI0A 3CCJQ 3I56Q 4IUPA 2X4XA 4LD6A 2XICA 1D0YA 2Z0WA 4CC4B 5CK9A 1MMDA 2MOXA 2D9TA 4B6MA 1CKBA 2JS2A 3QWXX 4EMKC 3QYHB 2E70A 1BCMA 2P0PA 3G6ET 2COZA 1PKSA 1KJWA 2KSSA 5DLQE 1Q82R 1LPLA 1M1KC 1D0XA 4FCYA 1JRIA 1R8OB 2O9VA 1D1AA 4O6JA 1MUZA 2RO0A 4J9DA 1CKAA 3PMIA 1VQ8Q 4PJNA 2DILA 3D7SB 3RBBB 1BBZA 1K4US 1EX4A 3BW1A 1NJIU 1G3YA 1FXXA 3L2WA 3OMCA 4DBRA 2OJ2A 1GCQC 1P92A 3GP8A 4BE1A 1I07A 4C92D 1KHCA 2NUTB 5FU7B 5GAMh 2QEXT 1ARKA 2RQTA 4C92E 1Q95G 1KK7A 1QMCA 1CSKA 2COYA 3C94A 3OYLA 4E2FB 1J3TA 3ZBDA 2K7AA 1AHJB 2KRSA 1MMNA 1V29B 2KROA 4JJCA 4KH0B 3VS3A 4OB2B 3EGDA 1VIFA 3QDRB 2CREA 1UDLA 3LH5A 2EJFA 3E19A 3RKXA 1S72A 1VQ5T 3GF5A 1AZEA 1RI9A 4M78E 2O4XB 4M77F 1M3CA 2DL8A 2ESWA 2AZVA 4ZN1A 4PKCC 2K5FA 3CCJT 4DBQA 1BB9A 2EQJA 3CC4Q 2LJ3A 1YJ9A 2LZ6B 3UT1A 4EPCA 3PIOA 1V76A 1RABB 1KQSS 2CSIA 5LJ5f 3FRNA 1T0HA 2D8HA 4YTLA 2IIMA 3EG2A 4IUQA 2GQIA 2BTTA 2LX9A 3ER0A 2AIRB 3IQLA 1Q82C 3H6ZA 2DD4A 1VQ7A 3OYMA 2LQKA 4FM4B 3OS1A 3F70A 2LQ8A 1Y57A 2DMOA 4CC7A 5A2QE 2X4YA 5GMKh 1OV3A 1ZBJA 4OVAA 1Q81R 3J7AF 2PQWA 4M7AB 1WDXA 2HCKA 4AFZC 2L3SA 2RQVA 2ABLA 4M77E 1D3BB 2FEIA 1QVGA 1Z9ZA 2RM4A 3MEWA 3THKA 1YWPA 3HPWA 4C0ZA 4C8QG 1ZBXA 2FZCB 3GPLA 1QKXA 2E4HA 1UJYA 2FYKA 3V8KA 3OYHA 1A0NB 3EFRA 3MP1A 1M1FA 4J7IA 1WIEA 4FSXA 2GFAA 4F7UG 2Y4YA 3VS0A 3JCMe 1Q82U 2EYWA 4RKUE 5KYWB 4ANJA 4L6V5 2J7IA 2HKNA 5IHIA 8AT1B 2EYXA 5L8RE 2NUPB 4M78D 1GFDA 4R55A 1EZZB 1UGRB 4ZN3A 3VYGA 1TOVA 2WSFE 3CQTA 2PZ1A 5KYWA 2RK2A 2GTJA 1BK2A 1IXDA 2OTJA 2GGRA 5LJ3e 4CI0C 1SG5A 5KCOA 4RTYA 3QHSA 5KCHA 3DLMA 2KT8A 3J81E 4FW2A 2AT1B 4RTVA 1G5VA 4EIKA 2EWNA 3G1JA 1QP2A 1SF9A 2KY9A 2DM1A 2ROTA 1WNLA 3JCMb 1M3BA 4UC4A 2F2XA 2LCCA 2OTJT 4A4FA 1WHJA 3OYKA 2EAYA 1MV0B 1WXBA 2DRMA 3MCAB 3JCMX 4ZTFA 5LJ5e 1QVFA 1N5ZA 1K0SA 1WI7A 4BY6C 2LT1A 3CPFA 1OPKA 2JOYA 3M53A 3WXMB 3DB4A 1JJ2P 3FB9A 2AK5A 2X35A 4QT7A 3CMET 2K2MA 6AT1B 5DM7R 1RAGB 4QQ6A 4JLGA 2FPEA 3JSCA 3INZA 2GF7A 4Z89A 4BUGA 4J9EA 3JCMh 2OAUA 2KEAA 4M75F 2K5LA 1RACB 3OYEA 1G3TA 2SEMA 2EVRA 1OI1A 1ZSZA 4MDXA 2KBTA 4J83A 1K9MR 3FDRA 2FZGB 2JM8A 2QDYB 1IO6A 3EH1A 4N4HA 4II1A 2QYZA 1KC8U 4OMMA 4D8KA 2RNAA 4RTZA 2L8DA 1AT1B 2YSQA 1RAIB 1WQWA 5GAOl 1I8FA 2LNVA 2HQXA 2BZXA 3CCRA 1UGSB 2QA4Q 2WSEE 1X2KA 5GJWB 2OTLA 3A8MB 2BZYA 2JUFA 3JCMP 2ZZDA 1UEBA 1LOJA 4BY6B 3A8LB 5LJ3g 2LX7A 2VASA 4QKUA 1OX8A 3CXCP 4ME7A 1F1BB 5EC7A 2A28A 1V1CA 1C0MA 4RTXA 3RESA 1VQ8T 1OULA 2M1HA 4JRPA 2CP6A 4EMKA 4ZGDB 5AYFA 1IRXA 1K8AC 5HK0A 1JB0E 4C92G 4LDWA 2DVEA 2K3XA 2EPDA 2GCXA 3QZ5B 4HVWA 3SB2A 2DXTA 2Y4XA 1TH7A 3OA6A 1UE9A 1JXMA 1UG1A 3CC7Q 1ABQA 5D6YA 3BDUA 3NPFA 1N6AA 4LNPA 3RMQA 3TREA 4FU6A 1M1GA 3M9QA 4NL2A 5GMKl 1VQOQ 1TG0A 3CPWP 2LQNA 1WHKA 3H0IA 4LDXA 1IREB 2FVUA 2K9GA 2XG8D 4C5EA 1VQ9Q 3L2VA 4J9CA 3CCVA 4M78G 5FWBA 3L2RA 3JB9D 4AFSC 2ZGWA 2O31A 2HSPA 2XDBA 1ZSZC 5LJ5g 3CCQQ 2EGCA 3G71A 1YCYA 1IHWA 9ATCB 3MJXA 4N4GA 2CP5A 4PNOA 5CQXA 3CCQA 2VVKA 1VQ6A 1VQ9A 1BCOA 5IH2A 4OMNA 1NEGA 2RPNA 2OX7A 4LXCA 3LWIA 3A8HB 1H3HA 2VGMA 1D3BA 3GBQA 4KUDK 3X26B 2RJDA 3JCMf 1OYXA 4HCCA 3CCUQ 2FO0A 1VQPA 3G71Q 3M0RA 4RCBA 4CC2A 1RLQC 4OMLA 2EJGA 1VQNA 2RHUA 4EMHA 5GAN2 2V26A 2MWPA 3CMEQ 2CUBA 2V1RA 1M2VB 2P0QA 5FROA 2XU8A 2LJ1A 3A98A 3PT9A 1VQLT 5GAN5 4XU2A 4J8OA 4K11A 3EGUA 2G6FX 2HD0A 5KE3A 4RMOA 2ZAEA 2DF6A 1YITQ 2KI7A 4A4EA 4AG1C 1OX9A 2XKOC 2FB7A 1M90U 1Q81C 2JMAA 2LCSA 2RQUA 3CCRQ 3L42A 2AKKA 3CPWS 2KXDA 3HFNA 1VQ4A 3SWNB 3M54A 3SD4A 3DB3A 2MI6A 2O9SA 2AHJB 1YITT 1K73C 5CVIA 5CKBA 3EGDB 2P84A 5KYNA 1T0JA 3FIFA 2W0ZA 2J06A 4XTZA 3QJYA 2QEXA 5FRNA 3HRTA 2XMFA 5J39A 1NLPC 2M51A 2QGFB 3VUBA 3CCSQ 4E7KA 2CP3A 2CZ6B 2I2LA 1R77A 1TS9A 4LUEA 4MZTA 2LQWA 4M77A 2NWMA 4WF2A 3VS6A 2E5QA 2K57A 1H8KA 2QQRA 4QVCA 2FRWA 2M02A 4MZPA 1K8AR 3CCMQ 3M0PA 4J9HA 4LUDA 1Q7YR 1NJIR 2QQBA 3CD6Q 1TSFA 3GNFB 4Z8AA 4KBMB 3TQ7P 2CZ7B 3NTIA 1VQKQ 1M30A 3EH2A 2IG0A 2DERA 2CZ0B 1D1BA 2MPXC 1VQMA 1FX7A 3P8DA 5HCKA 1M8VA 1W2BP 3M58A 4KULA 3GNGA 2J6KA 3REBB 4MMKA 3VKIA 2M0YA 2DZCA 4GLMA 2YUOA 5GAMj 3OBWA 2KQWA 3QZ9B 1YHQT 2A7YA 2KYMA 1TUCA 1T3LA 4X9CA 1X75C 2BE7D 3PNWC 1KC8C 2K4YA 3WVEB 2YDLA 4IUUA 1UJ0A 4O5VA 3VV0A 2QQ9A 5FLXE 1TWBA 2RQWA 1K9MC 2EYZA 4NS5A 4FYYB 1FYNA 3OW2S 2L2PA 1ZLMA 1RAFB 1WFWA 2F69A 3S3OA 1M1KU 2DXCA 1Q7YU 1M90C 4PJOB 3PTAA 4DQ2A 1X27A 3CCEA 2DX1A 1AEYA 3JB9J 2JW4A 3MP8A 3EHQA 1M2OA 1QWEA 1S72Q 4IIMA 4M77G 3H0FA 2L5QA 2HL3A 2E41A 2DE0X 4HT8A 1E6GA 2HEQA 2P4RA 3M4YA 4F04B 1OEBA 3HKSA 4RG2A 3UA6A 1W2BS 2V8JA 3CEYA 4E7IA 1VQ4T 5CKFA 2E64A 1RAAB 2R5MA 3CCLA 2YWWA 5GANj 2D8JA 2H8HA 2DL5A 2KMTA 2ED0A 2DA9A 2ED1A 3RDVA 2EQKA 3C4SA 3VUZA 3A5ZB 3EAEA 1UGQB 3SWNC 4M7DA 4DOVA 2F2VA 1Y07A 1YCSB 4GY5A 2JM9A 2LVMA 1IB8A 4XTXA 2DIGA 2L3PA 1VQ7Q 1TTHB 2CH4A 2BE9B 4AFQC 3ZL7C 2RHZA 2IVWA 5GAMf 3EGXA 2K2VA 5KYUA 3V8LA 5LJ3d 3CCJA 2DRKA 3HRSA 2YUNA 2DJZA 1Z9QA 4J9BA 2BIVA 2FZKB 4J6XA 5A0DA 1KHIA 4PLLA 4M7AD 1PM3A 1VQNQ 2DXBA 1HYOA 1B7TA 1QCOA 2H3EB 1GRIA 3JB9I 3VS5A 1GXIE 4D8DA 4M75C 3I5RA 4PJMA 1HXDA 1M9SA 3CD6T 4M7DD 4PK4A 1W70A 2KT1A 1NYGA 4M7AC 1VQ8A 3UDCA 1VUBA 2PTKA 3CCMT 2A37A 4X34A 2AKLA 4QQDA 3QKJA 4JJDA 7AT1B 2KAFA 4LN2A 3OS2A 4V2SA 2A3LA 2PUOB 2E5KA 5GAMd 4N0AA 4M75E 2JS0A 4JRIA 2ZPHB 1Y0MA 4PJOG 1QCFA 2KXCA 3L2ZA 2QEXQ 1SKUB 1BI3A 4M7AE 4MMLA 4M4ZA 2OAWA 4HT9A 3H9NA 1NG2A 3I35A 5GAN7 2OTLQ 2HSEB 1Q86U 1WLPB 3CCLT 1NEBA 1JEGA 3META 1YJ9Q 2RHIA 4FT4A 4LDUA 4DBFA 1YJWA 3M0TA 1QVGP 2EQMA 3RUXA 1H641 2J6FA 5CKEA 1YIJQ 5ECAA 2L3RA 4M7DE 2X3XD 3HFOA 1YI2Q 3GLXA 2NUPA 4B9XA 2D0QB 3CC7A 2EGEA 3JCMJ 1W1FA 1K76A 1U1SA 3RIRA 2ZPFB 2F5KA 2NYSA 1WGSA 2RJEA 4A4HA 5J3BA 1KQ2A 4OMQA 1JXOA 2MIOA 1QKWA 1TUDA 3CCET 3QBYA 2JXBA 2XK0A 1AOJA 3OBYA 1S72T 4XQ3A 1KQSA 3EG3A 4ZNXA 2CP7A 2KDSA 1U8RA 2X4WA 4EMGA 2EKOA 3VRYA 5I2SA 1UB4A 3LLRA 2P4TA 2J05A 5HK3A 1RAEB 3I55A 3VJPA 2M9UA 1PCXA 4JRQA 1B3QA 2Y90A 2YT6A 2QAZA 3KFVA 4C5HA 1BIAA 4LD9K 4ZGJB 3NMZC 4BE0A 1KD1U 4HXJA 3OYFA 1QVPA 3HHTB 4QVZA 1ZA2B 3CBPA 5KYYB 4HA8A 4OGCA 2DYIA 3LH0A 2ZPBB 1KD1C 5KYXA 4LE9A 3VS4A 1G8XA 3JAME 3NHNA 3CBMA 3RKWA 4C5IA 4M77C 1Q86R 4JZ4A 3OQ5A 2CP0A 3ME9A 1YJNT 4DA4A 3M0UA 3MO8A 3G7ZA 1JJ2A 1RAHB 2CS7A 2GQVA 4Z88A 4DEXA 4ZTJA 4A63B 1VQKT 5C6SA 5FU6B 1YI2T 3M57A 4D6WA 4OF1A 1LCKA 4C92C 2OI3A 3OYIA 1JO8A 4AFUC 1WPYA 2K3BA 1WXUA 4JPBW 3J80E 2F5TX 1PKTA 3DKMA 3DLLA 1N8RR 4C0FA 3G4ST 2QTVA 4RCCA 2LMJA 1HJDA 2RI2A 1LJOA 3I5SA 2DKGA 1C6VX 2DJQA 2L89A 1PNJA 3L2UA 1UECA 1WHHA 4PFPA 2A08A 1LVKA 1OZ2A 1N9SA 1VIEA 4F7UF 1UGVA 2A0FB 4TVRA 3EG9B 4XAXB 2FHDA 4M77B 2O88A 4PJOA 5KE2A 1VQOA 4J6WA 3P8BB 2HQHA 3CCSA 4M77D 3UATA 3H0HA 3JCMW 2EKHA 4MDWA 4F7UA 5GAN4 1K9AA 4M7DC 1WQ7A 4M78C 3L2QA 2MF2A 3N5BB 1SSFA 1NPPA 1I5OB 1JBMA 1PHTA 3G4SA 4Y91A 2RQRA 3O8VA 5GANe 4HCBA 1WHGA 1UUEA 4HVUA 4A4KA 2KVQG 2DXUA 3GIBA 5D6XA 1PSEA 1RL2A 1I0CA 1WYXA 3ZEHA 2QQAA 3AHUA 4FSSA 4OMPA 3FJ5A 1U1TA 3PFSA 3CC2Q 5M9OA 2FG0A 3HTRA 3ULRB 4M78B 3U23A 2K79A 1XQHA 2DPPB 1BKBA 2PVGB 3G71T 5A0LA 2K5IA 2MK5A 2RJFA 1VQMT 2VV5A 4WCIA 1ZX6A 1B07A 1WHLA 2EBPA 1WJRA 1NM7A 2X9HA 3KUFA 3TEEA 1M5Q1 3CBOA 3JB9G 2YUPA 3M59A 3QDFA 1VQPQ 4OB0B 1ABOA 4X9DA 4E47A 1FWZA 2LNHB 2E1HA 2FRYA 3EG9A 1ACMB 1YP5A 2VUBA 2VB6A 3EG0A 2SRCA 3I55T 3QXEB 4ELYC 2KE9A 1Y7XA 3URGA 2RHYA 2ZPIB 2LC4A 4C92A 4J6YA 2DAQA 3S3NA 1M2VA 4M75G 4P5NA 2KRMA 3PMTA 2DEQA 1M27C 1YITA 2DL3A 1FMWA 2X3WD 4KGZB 5KYXB 4PJJA 2RHXA 3EHRA 4FYWB 3EFSA 1QP3A 2QI2A 2RN8A 2C0TA 4FL6A 5CKHA 4C8QC 3NGPA 1R0BG 2KNBB 2DNUA 4HCKA 4J9GA 1G3WA 1SHGA 3CC7T 3JB9F 1WXTA 2PU9B 5IHNA 3T9NA 4ESRA 1HK9A 2C06A 5HY6A 2E6NA 3R6NA 1QVGS 3QWYA 1X43A 2OTLT 2M16A 5A0GA 4M7DG 3NTKA 1NYFA 2E12A 2EIFA 3LX7A 1D09B 3KBGA 3OSVA 1ZHIA 2VWFA 2XI9A 4F17A 1Q7YC 5FU7C 1ZA1B 1JU5C 5DLOA 4XU0A 2HDAA 3OYJA 3SFMA 2MAMA 3OW2P 2VXFA 2JZ2A 3QYGB 3CCQT 3H41A 1VQNT 5KYYA 4JZ3A 2HZYA 5LJ5j 1G3SA 1AD5A 2KRNA 2JT4A 2EFIA 2E65A 4BDZA 3E9FA 5LJ5h 1ZSGA 3HL8A 5GAMg 2DVJA 2LTOA 2VGNA 3V7CA 2F2WA 5IAYA 3G4SQ 4PFOA 1Y96A 5D6WA 1Y96B 2DETA 3CC2A 3M56A 4ZGEB 1LNXA 4C0DB 1VQPT 2RH2A 4JUVA 4VUBA 1ZSZB 1YIJT 2XD0A 4EMKB 1MGQA 3OMGA 2B86A 2ZCFB 3QG1A 3REAB 2DBKA 1ZQ1A 2CYZB 1NZ9A 3TSWA 3MHXA 5I21A 3CCEQ 2DL7A 2E10A 2ROLA 1WX6A 3VRZA 5LJ3h 5GAN8 1O75A 1AWWA 1VYUA 3MEAA 1ZUKA 2R58A 3WVDB 3HSBA 1AWOA 1MHNA 3CMEA 4KT0E 3QSUA 4M7DB 2PNIA 1EIFA 1XTDA 1BU1A 4N4IA 1TU0B 3E1SA 1PWTA 2J6OA 2JTEA 2QGGA 2WACA 1VQ4Q 1R0CB 2YRVA 2KR3A 2EW3A 1AZGB 5DY9A 1WZOA 2DTOA 2EYYA 2BKDN 2BZ8A 1BYMA 1QWFA 2G3RA 3EGXB 5KYUB 1XOVA 3E9GA 4KGXB 1EFNA 2DIQA 1M1KR 8ATCB 5CCAA 1XNIA 2LP5A 3CCVQ 1X69A 3I56A 4JJNK 3ASKA 2DO3A 1VQKA 5GANf 2JJ9A 2JVVA 1N27A 3BDLA 1KSWA 4PJOF 1GL5A 3R6OA 3TVTA 4GLKA 5FU6C 5GANg 4PJOC 2QK0A 5GJVB 1SHFA 1GCQA 2RD1A 1IGUA 3EFOB 1AVZC 3G6EQ 1O9SA 4C5GA 1M3AA 4F16A 1GBQA 5GAOm 2M0OA 2E6ZA 4M75B 1VQ6Q 1OZ3A 1WHMA 2V8KA 3M0QA 3VU3C 1SPKA 2CSQA 2EGAA 2EYQA 2RF0A 4FYXB 4IKFA 2W10A 4XK8E 3QJ6A 1K73R 5IXBA 4HVVA 3GOXA 1KQ1A 1N8RU 4RTTA 1DJ7B 4R0KA 2XHCA 1GBRA 2DL4A 2QQSA 1KG1A 5GMKm 3LW5E 3FC3A 3MEVA 3V7RA 4PJOE 1OPLA 4WTOB 2XDDA 1H92A 4E7SA 3OB9A 2MCNA 5FWCA 4A4GA 2HQEA 2DLPA 1YHQQ 1UFFA 2YRDA 2FPFA 4OGEA 3VS2A 5KH6A 1YHQA 3EG1A 4IUTA 1VOMA 5LJ5d 5GAN3 3PGGA 1PD0A 5GANh 1K0XA 4C8QA 3OYYA 1D1CA 4KGVB 2ZPGB 3KXTA 2C0IA 2RI3A 3FEOA 5J26A 1X6BA 5GAMe 1MV3A 1YI2A 3PE0A 4XTWA 5CQYA 1W6XA 2EQUA 1UGPB 2A36A 3SHWA 3BE3A 4C8QB 4E6RA 3LGLA 1E7OA 1I1JA 1HD3A 1YJWT 4M7AF 1S1NA 3JCMc 1OU9A 1NE8A 3L1AA 1RADB 3M4GA 5CIUA 2HBPA 4B9WA 4AMCA 2ATCB 2XDPA 2GNCA 3OS5A 1GCPA 4RUGA 4BI3A 4M78A 2CDTA 1VQ6T 4BB7A 3A8GB 4LDVA 4OB1B 3CCLQ 2KK4A 4QVDA 3HP9A 1X2QA 4Y28E 1WJQA 5I11A 4XTUA 4L59A 4DOWA 1VQMQ 2V1QA 1Q81U 5HKCA 1PRMC 1RLPC 1NBEB 5CKDA 4C8QD 5GMKe 4BE2A 1G2BA 3I55Q 1NJIC 4DBHA 3CMAT 3JCMg 1K1ZA 4OMOA 2YLCA 2I0NA 4F7UB 4DEYA 2RB6A 3I56T 2O4XA 1KIKA 1BI2A 1TUGB 5LJ3f 3I9QA 1VQLQ 4BDYA 4XU1A 2XIDA 2CGHA 4JLIA 5GMKi 3FJPA 4KRTA 3A1PA 3CMAQ 2ECZA 1YBYA 3P8HA 1PD1A 3M55A 4CRIA 1YFNA 3RERA 1FMKA 2FL7A 3BY7A 4N0AC 3M5AA 3OSSC 4R56A 2D6FA 1K73U 1U06A 1M90R 5EG2A 2FPDA 2VYTA 4IURA 3C0CA 2GFUA 1HSQA 3OS0A 4M78F 4JDSA 2NUTA 1I4K1 1QVFP 5LJ3j 3NFCA 3LWHA 1KQSP 4M7AA 2LRQA 4XTYA 2DTIA 4IUVA 2CUDA 3RMSA 3QO3A 1X6GA 1YJNQ 1ZUUA 1YIJA 3TU4K 2X4JA 4KUIA 1SRMA 4JS4A 2EQIA 4XTVA 3X28B 4E7JA 4OB3B 3OY9A 1U3OA 2CKKA 4QW2A 4L5GA 3VYHB 1UTIA 2DD5A 5IT9E 3SEMA 3MKDA 2P0KA 2RI5A 2LJ0A 2GTOA 1TXQA 3OYGA 4MZMA 1YJNA 1PSFA 1KC8R 1ZUYA 1NLOC 3EFOA 2K3YA 1MMGA 3JCMQ 4NOYA 4AT1B 4LDYA 4FW1A 5CAIA 1C1AA 1XJWB 1OOTA 1VQ9T 4BI8B 2YHTA 3OYDA 1QQJA 4C8QF 3V8JA 3E2UA 1M4ZA 3H8ZA 2CZ1B 5IHKA 3SWNA 1RUWA 3C12A 4PJOD 1I5LA 2CH4W 3AT1B 2RJCA 1AWJA 3UWNA 4F14A 4JJBA 2DK3A 3QUIA 4F7UE 3CXCA 3HRUA 4PLIA 3CCUT 3CXCS 1OQKA 1SEMA 2JMCA 1U5SA 1Y71A 4AG2C 4OP0A 3SDZA 5CR2A 2HMAA 1VQ5Q 2D1XA 2QG9B 3G6EA 3RR6A 5C0MA 4EDUA 3C95A 2JN0A 5FRMA 1WA7A 3JB9H 3X20B 4M7AG 3VS7A 5CO7A 4OMFB 3RKYA 2JNGA 2O01E 2DFUA 3CC2T 3CMAA 2R57A 4QQGA 3MP6A 4C92F 2ZPEB 3LGFA 3X24B 2YXYA 4XU3A 4A53A 4J5YA 1YJ9T 5FW9A 2AZSA 2MYSA 2QASA 2PVOB 5GAN6 1IHVA 3CPWA 1YWOA 3CCRT 2WSCE 4J9IA 4FIBA 5GAOp 1MNDA 1YN8A 5GMKj 3QPHA 5D7UA 1D0ZA 2DZ9A 1RI0A 3A8OB 1IGQA 5I2MA 2NLUA 2YLBA 5GAOr 2YRCA 2DEUA 4M75A 2JTMA 2BUDA 2DYBA 2VXEA 2VC8A 4M7DF 2L3QA 4HKEA 1B34B 3S6WA 1WJSA 4CC3A 4JRKA 4A54A 1G83A 3PIPA 4PFZA 3CCVT 2RK1A 2V8IA 2IPOB 2KGTA 3FLGA 3VS1A 1Q86C 2C0OA 4ORZA 3NTHA 4X1VA 3JCMV 1QLYA 3CC4A 1N9RA 1W4SA 1MNEA 3CD6A 2QDLA 2B8AA 1VYVA 1X6OA 3TCJA 2HBWA 3CCMA 5I22A 1QVFS 5L23A 3S3MA 5AT1B 3OYCA 3PVLA 3TSZA 3ZFJA 1VQOT 2QTXA 4PL6A 2NUZA 4Q5WA 3UPUA 1VQLA 2PUKB 1X01A 2MWOA 3V7SA 3PVQA 1VYTA 1E6HA 2GBQA 4BACA 2VKNA 1OU8A 2ENMA 4BI4A 1M8MA 4C0DC 2K6DA 3UA7A 3M0SA 5IXFA 2KYBA 2HKQB 1SSHA 1PG5B 4KH1B 2F1LA 2O2OA 2RA2A 1VQ5A 2HNIA 4GBQA 3OYNA 1AWXA 3MEUA 1K8AU 4ATOA 5GAOn 2H3JA 1FMVA
chains in the Genus database with same CATH topology
1B34A 3CCUA 1U1SA 1BI1A 4NL3A 3RIRA 3VU3C 2ZPFB 2F5KA 2R5AA 2EYQA 2QA4A 4IKFA 3RESA 1WGSA 2RJEA 4A4HA 1VQ8T 5J3BA 1KQ2A 4XK8E 3QJ6A 2M1HA 4JRPA 3BFMA 4ZGDB 4EMKA 5GAOr 1I81A 5AYFA 3CCET 3QBYA 1K8AC 4C8QE 3GOXA 5HK0A 1KQ1A 2XK0A 1N8RU 1JB0E 3OBYA 3X25B 4XQ3A 4C92G 4LDWA 5GAOq 2DVEA 1S72T 1DJ7B 1KQSA 2K3XA 4Z02A 2KDSA 2GCXA 2XHCA 3QZ5B 2X4WA 4J7FA 3SB2A 1U8RA 2DXTA 4EMGA 2Y4XA 2EKOA 2QQSA 1TH7A 3OA6A 4E7HA 4C92B 1KG1A 4RG8A 5GMKm 3LW5E 3FC3A 3MEVA 3V7RA 5I2SA 1UB4A 3LLRA 3CC4T 4PJOE 2P4TA 4FT2A 5LL6S 5HK3A 5D6YA 3BDUA 2XDDA 3I55A 1BIBA 1N6AA 3RMQA 3TREA 3OW2A 4FU6A 1M1GA 3M9QA 3OB9A 2M9UA 4NL2A 3VJPA 1W2BA 5GMKl 4JRQA 4A4GA 4C0GA 2HQEA 4E7LA 2Y90A 3Q1JA 2DTHA 2QXFA 4LDXA 1IREB 2FVUA 4C5EA 2XG8D 2JTFA 4C5HA 2HAXA 1BIAA 3L2VA 4LD9K 3CCVA 4M78G 4ZGJB 1K9MU 4OGEA 5KH6A 1YHQA 4BE0A 3OYAA 1KD1U 2LT4A 3OYBA 3L2RA 3JB9D 1KD1C 4M75D 1NPRA 4IUTA 3OYFA 3CCST 5LJ5d 5GAN3 1QVPA 1IZ6A 2MMPA 2ZGWA 3HHTB 3PGGA 5GANh 2OTJA 4QVZA 1VQ7T 4JS5A 3CBPA 2XDBA 4HA8A 3OYYA 4C8QA 5LJ5g 1H3ZA 3JCMd 1N8RC 3G71A 1YCYA 4OGCA 1JJ2S 2ZPGB 3KXTA 3LH0A 2LCLA 2ZPBB 4N4GA 5IN1A 4BD3A 2RI3A 3FEOA 4PNOA 5CQXA 1QW1A 4ELZC 5J26A 3CCQA 2QA4T 1VQ6A 2EJ9A 5GAMe 1VQ9A 5GANd 3JCMJ 1YI2A 3LYIA 4HCZA 4XTWA 3JAME 3JRZA 5CQYA 2PVDB 3CBMA 3RKWA 2EQUA 3LWIA 1UGPB 3A8HB 4C5IA 4C8QB 2LDMA 1D3BA 2VGMA 4KUDK 3LGLA 4M77C 3X26B 2RJDA 3JCMf 3QIIA 1BI0A 1OYXA 3OQ5A 1YJWT 4HCCA 3JCMc 4M7AF 3ME9A 1NE8A 1YJNT 4IUPA 3L1AA 4DA4A 3MO8A 3G7ZA 2X4XA 3M4GA 4LD6A 2XICA 5CIUA 1VQPA 2HBPA 4RCBA 4B9WA 1JJ2A 2EJGA 2CS7A 1VQNA 2GQVA 4ZTJA 2XDPA 3OS5A 5CK9A 2RHUA 4EMHA 5GAN2 1VQKT 5C6SA 2MWPA 4M78A 5FU6B 4BI3A 1YI2T 2D9TA 1VQ6T 4BB7A 3A8GB 4LDVA 4OB1B 4EMKC 3M57A 2P0QA 2KK4A 4OF1A 4D6WA 4QVDA 4C92C 3HP9A 3QYHB 5FROA 3OYIA 2XU8A 2E70A 4Y28E 1WJQA 4XTUA 1WPYA 4L59A 3PT9A 4DOWA 2P0PA 3G6ET 1Q81U 1VQLT 5GAN5 4XU2A 4J8OA 5HKCA 2KSSA 3J80E 2F5TX 3DKMA 5DLQE 5CKDA 4C8QD 1M1KC 5KE3A 2HD0A 5GMKe 3DLLA 4BE2A 1JRIA 4RMOA 1NJIC 1R8OB 3CMAT 4C0FA 3JCMg 3G4ST 4O6JA 4A4EA 4RCCA 2YLCA 2XKOC 2RI2A 2RO0A 1LJOA 2FB7A 4F7UB 1M90U 2DKGA 2RB6A 3I56T 1Q81C 2O4XA 2L89A 3PMIA 3L2UA 1BI2A 5LJ3f 1OZ2A 3L42A 1N9SA 1VIEA 4F7UF 3CPWS 4TVRA 3HFNA 1VQ4A 4XAXB 4XU1A 3SWNB 4BDYA 2FHDA 3BW1A 4M77B 1G3YA 1FXXA 1NJIU 2XIDA 4PJOA 3M54A 2CGHA 5KE2A 4JLIA 3SD4A 3L2WA 3OMCA 1VQOA 5GMKi 3DB3A 2MI6A 1P92A 3FJPA 4J6WA 2AHJB 3P8BB 1YITT 3CCSA 4M77D 3GP8A 1YBYA 4BE1A 1K73C 5CVIA 4C92D 3P8HA 1KHCA 3JCMW 5FU7B 4MDWA 5CKBA 5GAMh 4F7UA 5GAN4 2QEXT 3FIFA 4M7DC 4XTZA 3QJYA 2QEXA 1WQ7A 5FRNA 3HRTA 4C92E 3M55A 4M78C 4CRIA 3L2QA 2MF2A 5J39A 3VUBA 1SSFA 1NPPA 3N5BB 1JBMA 2CZ6B 4E7KA 2I2LA 3RERA 3G4SA 4MZTA 2FL7A 3BY7A 4N0AC 3M5AA 4Y91A 3C94A 3O8VA 3OSSC 4M77A 5GANe 4R56A 2D6FA 4WF2A 1K73U 4HCBA 2E5QA 4A4KA 3OYLA 2K57A 5EG2A 2KVQG 2QQRA 2DXUA 2VYTA 4IURA 4MZPA 3ZBDA 1AHJB 4QVCA 3GIBA 5D6XA 1PSEA 1RL2A 2GFUA 1V29B 3ZEHA 2QQAA 4OB2B 3AHUA 1VIFA 3QDRB 3OS0A 4M78F 4JDSA 1I4K1 2EJFA 5LJ3j 3NFCA 3LWHA 2QQBA 3E19A 1U1TA 3PFSA 3RKXA 2LRQA 1S72A 1VQ5T 3GNFB 4M7AA 4KBMB 4XTYA 3GF5A 2DTIA 2CZ7B 4IUVA 5M9OA 4M78E 4M78B 3NTIA 3RMSA 2O4XB 3QO3A 4M77F 1XQHA 2DPPB 1BKBA 2PVGB 2IG0A 4ZN1A 2CZ0B 4PKCC 2K5FA 3CCJT 1YIJA 3TU4K 1VQMA 1FX7A 2X4JA 3P8DA 4KUIA 3G71T 5A0LA 2K5IA 2EQJA 4C92F 4JS4A 2RJFA 4XTVA 3X28B 1VQMT 2VV5A 1M8VA 3M58A 4KULA 4E7JA 1YJ9A 4OB3B 3GNGA 3OY9A 4MMKA 3UT1A 2CKKA 1WJRA 3VKIA 4QW2A 4EPCA 2DZCA 3PIOA 3KUFA 4L5GA 3VYHB 3TEEA 1KQSS 5GAMj 2DD5A 3OBWA 1M5Q1 2KQWA 3CBOA 3QZ9B 5IT9E 1YHQT 5LJ5f 2A7YA 3JB9G 2P0KA 3M59A 2RI5A 3FRNA 4X9CA 4OB0B 1X75C 3PNWC 1KC8C 4X9DA 4YTLA 2K4YA 3WVEB 4IUUA 4E47A 1FWZA 4IUQA 3OYGA 4MZMA 4O5VA 3VV0A 1PSFA 2E1HA 1YJNA 2QQ9A 5FLXE 2LX9A 3ER0A 1Q82C 3H6ZA 2K3YA 2VUBA 3JCMQ 2DD4A 1K9MC 4NS5A 1VQ7A 3I55T 3OYMA 3QXEB 2LQKA 4NOYA 3OW2S 4FM4B 4ELYC 3OS1A 3F70A 4LDYA 2LQ8A 2F69A 1M1KU 3S3OA 5CAIA 5A2QE 2X4YA 1Y7XA 5GMKh 2DXCA 3URGA 1VQ9T 2RHYA 4BI8B 2YHTA 3OYDA 4OVAA 2ZPIB 4C8QF 2LC4A 4C92A 3J7AF 4J6YA 2DAQA 1Q7YU 3V8JA 2PQWA 3S3NA 4M75G 1M90C 4M7AB 4P5NA 1M4ZA 3H8ZA 3PMTA 2DEQA 3PTAA 4PJOB 2CZ1B 4DQ2A 3SWNA 4M77E 1D3BB 3CCEA 1QVGA 3JB9J 1YITA 3MP8A 2RM4A 3C12A 3MEWA 3HPWA 4PJOD 4C0ZA 1I5LA 4C8QG 1ZBXA 2RHXA 3GPLA 3EFSA 1QP3A 2QI2A 4M77G 2RJCA 3UWNA 2FYKA 3V8KA 2DK3A 3QUIA 4FL6A 5CKHA 3EFRA 3HRUA 4PLIA 4C8QC 4F7UE 3OYHA 3CXCA 3CXCS 3MP1A 3CCUT 2L5QA 1M1FA 4J7IA 2E41A 1G3WA 4HT8A 3CC7T 3JB9F 3M4YA 3HKSA 2GFAA 2PU9B 4FSXA 4F7UG 2Y4YA 1Y71A 3T9NA 4RG2A 1HK9A 2C06A 3JCMe 4OP0A 5HY6A 3SDZA 2E6NA 2V8JA 5CR2A 1W2BS 1Q82U 3CEYA 1QVGS 4RKUE 2M16A 4E7IA 5A0GA 3G6EA 1VQ4T 2OTLT 4M7DG 3NTKA 5C0MA 4L6V5 2E12A 3C95A 5CKFA 4EDUA 2EIFA 2E64A 3LX7A 2JN0A 5FRMA 2R5MA 3KBGA 1ZHIA 3OSVA 3CCLA 3JB9H 2XI9A 3X20B 5GANj 5L8RE 4M7AG 5CO7A 2KMTA 4M78D 4OMFB 5FU7C 3RKYA 1Q7YC 4R55A 1UGRB 5DLOA 2JNGA 4XU0A 3VYGA 4ZN3A 2O01E 2WSFE 3CC2T 3OYJA 3CMAA 2R57A 2EQKA 3C4SA 3SFMA 3VUZA 4QQGA 3MP6A 2RK2A 2MAMA 2ZPEB 2VXFA 3A5ZB 3EAEA 3LGFA 3X24B 2JZ2A 1UGQB 4XU3A 3QYGB 3SWNC 4A53A 3CCQT 4J5YA 1VQNT 1YJ9T 4M7DA 5LJ3e 5LJ5j 1G3SA 2PVOB 5GAN6 4DOVA 4CI0C 1Y07A 2EFIA 3CPWA 4GY5A 5KCOA 2E65A 3QHSA 3CCRT 2LVMA 5KCHA 4BDZA 3E9FA 2WSCE 5LJ5h 4FIBA 5GAOp 3DLMA 5GMKj 3HL8A 5GAMg 3J81E 4XTXA 2LTOA 1G5VA 2EWNA 2VGNA 3V7CA 2DIGA 5IAYA 1QP2A 1Y96A 1Y96B 2KY9A 3QPHA 5D6WA 3CC2A 3M56A 4ZGEB 1LNXA 2RHZA 2IVWA 4C0DB 5GAMf 1VQPT 2RH2A 1WNLA 2K2VA 2DZ9A 1RI0A 3V8LA 3JCMb 4JUVA 4VUBA 5LJ3d 3CCJA 1YIJT 3HRSA 3A8OB 4UC4A 2LCCA 5I2MA 2OTJT 2DJZA 4A4FA 2XD0A 4EMKB 2NLUA 1MGQA 2YLBA 3OMGA 2EAYA 2ZCFB 1ZQ1A 3MHXA 3QG1A 2CYZB 1NZ9A 2BIVA 4J6XA 4M75A 1KHIA 5A0DA 5I21A 2JTMA 2BUDA 3MCAB 2E10A 4PLLA 3JCMX 4M7AD 5LJ3h 4ZTFA 5GAN8 2VXEA 1O75A 2VC8A 5LJ5e 2DXBA 4M7DF 1QVFA 3MEAA 4HKEA 1B34B 3OYKA 3S6WA 4BY6C 1WJSA 3JB9I 2LT1A 4JRKA 4A54A 3PIPA 3CCVT 2R58A 3CPFA 1GXIE 3WVDB 3HSBA 2RK1A 1MHNA 2V8IA 4M75C 3CMEA 4KT0E 3QSUA 4M7DB 2JOYA 3M53A 1HXDA 3WXMB 1M9SA 3DB4A 3CD6T 3FLGA 1EIFA 1XTDA 3FB9A 1Q86C 2X35A 4M7DD 3NTHA 3JCMV 3CMET 4N4IA 3CC4A 1N9RA 5DM7R 1W4SA 3E1SA 4M7AC 3CD6A 1VQ8A 4QQ6A 3UDCA 1VUBA 4JLGA 3CCMT 2WACA 2YRVA 3JSCA 3INZA 2GF7A 2B8AA 4X34A 5DY9A 4BUGA 2DTOA 1X6OA 3JCMh 3TCJA 3CCMA 2BKDN 2OAUA 1QVFS 4QQDA 3QKJA 4M75F 2K5LA 3S3MA 3OYCA 3OYEA 2KAFA 1G3TA 3OS2A 4V2SA 2A3LA 2PUOB 3ZFJA 2QTXA 1VQOT 4PL6A 5GAMd 1BYMA 1OI1A 2G3RA 4N0AA 4M75E 4MDXA 4Q5WA 3UPUA 1VQLA 2PUKB 1XOVA 4JRIA 1X01A 3E9GA 2MWOA 2ZPHB 4PJOG 2DIQA 4J83A 3V7SA 5CCAA 1XNIA 3L2ZA 3FDRA 1BI3A 4M7AE 3I56A 4BACA 4JJNK 3ASKA 2DO3A 2QDYB 4MMLA 4BI4A 4N4HA 4HT9A 1VQKA 4II1A 4C0DC 5GAN7 5GANf 1KC8U 2JVVA 1N27A 3BDLA 4PJOF 2L8DA 1Q86U 3R6OA 4GLKA 5FU6C 5GANg 3CCLT 1WQWA 4PJOC 5GAOl 1I8FA 3META 2RHIA 2LNVA 2HQXA 4FT4A 4LDUA 1UGSB 2RD1A 3CCRA 1YJWA 2WSEE 2EQMA 2OTLA 3RUXA 1O9SA 4C5GA 1H641 3A8MB 5CKEA 2JUFA 2L3RA 2RA2A 1VQ5A 4M7DE 3JCMP 3HFOA 2HNIA 5GAOm 2M0OA 2ZZDA 2E6ZA 3OYNA 3GLXA 1UEBA 1LOJA 4M75B 3A8LB 4B9XA 4BY6B 5LJ3g 1OZ3A 2D0QB 3CC7A 3MEUA 1K8AU 2V8KA 4ATOA 5GAOn 4ME7A 2H3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 C;  3JB9 G;  1B34 A;  1U1S A;  4NL3 A;  3RIR A;  3VU3 C;  4X9C A;  1LNX A;  5GAM f;  4XTU A;  1WPY A;  1WNL A;  4X9D A;  2DZ9 A;  3V8L A;  3JCM b;  3RES A;  4JUV A;  5LJ3 d;  2E1H A;  5GAN 5;  4XU2 A;  1KQ2 A;  2DJZ A;  3JCM Q;  3BFM A;  2YLB A;  1MGQ A;  4C8Q D;  4EMK B;  2EAY A;  4EMK A;  1I81 A;  4M75 A;  5I21 A;  5GMK e;  5GAO r;  4J6X A;  1JRI A;  4NOY A;  4C8Q E;  1KQ1 A;  4C92 G;  2E10 A;  4XQ3 A;  3JCM g;  3JCM X;  2DVE A;  5GAO q;  4RCC A;  4M7A D;  5CAI A;  2YLC A;  5LJ3 h;  5GMK h;  4F7U B;  5GAN 8;  2VXE A;  1LJO A;  2FB7 A;  3SB2 A;  2DKG A;  2VC8 A;  2YHT A;  5LJ5 e;  2DXT A;  2RB6 A;  4C8Q F;  4EMG A;  4M7D F;  1TH7 A;  1M5Q 1;  1B34 B;  4C92 B;  4C92 A;  4J6Y A;  5GMK m;  3V8J A;  3JB9 I;  4JRK A;  4A54 A;  3V7R A;  4M75 G;  5LJ3 f;  4M7A B;  3HSB A;  1N9S A;  4PJO E;  4F7U F;  4PJO B;  4M75 C;  2DEQ A;  3QSU A;  3HFN A;  4DQ2 A;  4M7D B;  3SWN B;  3BDU A;  4XU1 A;  1HXD A;  1D3B B;  1BIB A;  3BW1 A;  4M77 B;  4M77 E;  3SWN A;  3JB9 J;  4PJO A;  2RM4 A;  2CGH A;  3FB9 A;  4JLI A;  4NL2 A;  4M7D D;  3JCM V;  4PJO D;  5GMK i;  1I5L A;  5GMK l;  3FJP A;  4C8Q G;  1N9R A;  4J6W A;  4M7A C;  3EFS A;  4M77 D;  4M77 G;  2Y90 A;  4C92 D;  3JCM W;  2DTH A;  2FYK A;  5GAO n;  3V8K A;  5GAM h;  3QUI A;  4C8Q C;  4F7U A;  4F7U E;  1BIA A;  3EFR A;  3FIF A;  5GAN 4;  4M7D C;  3INZ A;  4M78 G;  4XTZ A;  1WQ7 A;  5DY9 A;  2DTO A;  4C92 E;  2E41 A;  3JCM h;  4M78 C;  4HT8 A;  3JB9 F;  4M75 F;  3JB9 D;  4M75 D;  1JBM A;  3RER A;  2I2L A;  4F7U G;  5LJ5 d;  5GAN 3;  1HK9 A;  3BY7 A;  4N0A C;  4OP0 A;  4Y91 A;  3JCM e;  2QTX A;  5GAN e;  2ZGW A;  3PGG A;  4M77 A;  5GAM d;  4WF2 A;  5GAN h;  4N0A A;  4M75 E;  2K57 A;  4HA8 A;  4C8Q A;  5LJ5 g;  4QVC A;  2DXU A;  4JRI A;  1X01 A;  3JCM d;  4M7D G;  1YCY A;  3GIB A;  4PJO G;  3V7S A;  2E64 A;  2JN0 A;  3L2Z A;  4PNO A;  3JB9 H;  5GAN j;  3AHU A;  4M7A E;  4M7A G;  2EJ9 A;  4M78 F;  4MML A;  5GAM e;  1I4K 1;  5GAN d;  4M78 D;  3RKY A;  4HT9 A;  2EJF A;  4XTW A;  4XU0 A;  5LJ3 j;  5GAN f;  5GAN 7;  1U1T A;  3RKX A;  4M7A A;  4XTY A;  2DTI A;  3RKW A;  4PJO F;  4M78 E;  4M78 B;  4C8Q B;  1D3B A;  4C92 F;  3QO3 A;  2VXF A;  4M77 F;  4M77 C;  4XU3 A;  3SWN C;  4A53 A;  3JCM f;  4M7D A;  5GAN g;  4J5Y A;  4M7A F;  1WQW A;  4PJO C;  3JCM c;  5GAO l;  1I8F A;  5LJ3 e;  5LJ5 j;  5GAN 6;  3L1A A;  2RD1 A;  3M4G A;  2E65 A;  3QHS A;  4RCB A;  4XTV A;  3RUX A;  1M8V A;  1H64 1;  2EJG A;  5LJ5 h;  5GAO p;  2RA2 A;  4M7D E;  3JCM P;  3HFO A;  4MMK A;  2HNI A;  4V2S A;  5GMK j;  4EMH A;  5GAM g;  5GAN 2;  5GAO m;  2DZC A;  4XTX A;  4M78 A;  1LOJ A;  4M75 B;  5LJ3 g;  2EWN A;  3V7C A;  5GAM j;  1Y96 A;  4EMK C;  1Y96 B;  3JCM J;  5LJ5 f;  4QVD A; 
#chains in the Genus database with same CATH topology
 1B34 A;  3CCU A;  1BI1 A;  4NL3 A;  1MMA A;  2R5A A;  2QA4 A;  2HL5 C;  1UHC A;  2OTJ Q;  1KD1 R;  3BFM A;  1UHF A;  1I81 A;  1YNZ A;  4C8Q E;  1SRL A;  1JQQ A;  3X25 B;  5GAO q;  4Z02 A;  1PRL C;  4J7F A;  4E7H A;  3O5Z A;  2D0N A;  4C92 B;  4RG8 A;  2CT3 A;  3CC4 T;  1GFC A;  4FT2 A;  5LL6 S;  1BIB A;  3OW2 A;  4Y92 A;  2YUQ A;  3RNJ A;  1W2B A;  4C0G A;  3JV3 A;  4E7L A;  3Q1J A;  2DTH A;  1YJW Q;  2QXF A;  2CP2 A;  2JTF A;  2HAX A;  2DBM A;  1K9M U;  3OYA A;  2LT4 A;  4PJL A;  3OYB A;  2COW A;  4M75 D;  1NPR A;  2CT4 A;  3CCS T;  1IZ6 A;  2MMP A;  2E3H A;  1VQ7 T;  4JS5 A;  1QCN A;  1H3Z A;  1T3S A;  3JCM d;  1PC0 A;  1N8R C;  1JJ2 S;  2LCL A;  5IN1 A;  4IIO A;  4BD3 A;  1QW1 A;  4RTU A;  4ELZ C;  2QA4 T;  4RTW A;  2EJ9 A;  5GAN d;  1VA7 A;  3LYI A;  4J9F A;  4HCZ A;  2E3I A;  3MPU B;  4FYV B;  4E7Z A;  3JRZ A;  2L0A A;  2PVD B;  1KFZ A;  3UF4 A;  2RMO A;  2LDM A;  2X51 A;  3QII A;  1BI0 A;  3CCJ Q;  3I56 Q;  4IUP A;  2X4X A;  4LD6 A;  2XIC A;  1D0Y A;  2Z0W A;  4CC4 B;  5CK9 A;  1MMD A;  2MOX A;  2D9T A;  4B6M A;  1CKB A;  2JS2 A;  3QWX X;  4EMK C;  3QYH B;  2E70 A;  1BCM A;  2P0P A;  3G6E T;  2COZ A;  1PKS A;  1KJW A;  2KSS A;  5DLQ E;  1Q82 R;  1LPL A;  1M1K C;  1D0X A;  4FCY A;  1JRI A;  1R8O B;  2O9V A;  1D1A A;  4O6J A;  1MUZ A;  2RO0 A;  4J9D A;  1CKA A;  3PMI A;  1VQ8 Q;  4PJN A;  2DIL A;  3D7S B;  3RBB B;  1BBZ A;  1K4U S;  1EX4 A;  3BW1 A;  1NJI U;  1G3Y A;  1FXX A;  3L2W A;  3OMC A;  4DBR A;  2OJ2 A;  1GCQ C;  1P92 A;  3GP8 A;  4BE1 A;  1I07 A;  4C92 D;  1KHC A;  2NUT B;  5FU7 B;  5GAM h;  2QEX T;  1ARK A;  2RQT A;  4C92 E;  1Q95 G;  1KK7 A;  1QMC A;  1CSK A;  2COY A;  3C94 A;  3OYL A;  4E2F B;  1J3T A;  3ZBD A;  2K7A A;  1AHJ B;  2KRS A;  1MMN A;  1V29 B;  2KRO A;  4JJC A;  4KH0 B;  3VS3 A;  4OB2 B;  3EGD A;  1VIF A;  3QDR B;  2CRE A;  1UDL A;  3LH5 A;  2EJF A;  3E19 A;  3RKX A;  1S72 A;  1VQ5 T;  3GF5 A;  1AZE A;  1RI9 A;  4M78 E;  2O4X B;  4M77 F;  1M3C A;  2DL8 A;  2ESW A;  2AZV A;  4ZN1 A;  4PKC C;  2K5F A;  3CCJ T;  4DBQ A;  1BB9 A;  2EQJ A;  3CC4 Q;  2LJ3 A;  1YJ9 A;  2LZ6 B;  3UT1 A;  4EPC A;  3PIO A;  1V76 A;  1RAB B;  1KQS S;  2CSI A;  5LJ5 f;  3FRN A;  1T0H A;  2D8H A;  4YTL A;  2IIM A;  3EG2 A;  4IUQ A;  2GQI A;  2BTT A;  2LX9 A;  3ER0 A;  2AIR B;  3IQL A;  1Q82 C;  3H6Z A;  2DD4 A;  1VQ7 A;  3OYM A;  2LQK A;  4FM4 B;  3OS1 A;  3F70 A;  2LQ8 A;  1Y57 A;  2DMO A;  4CC7 A;  5A2Q E;  2X4Y A;  5GMK h;  1OV3 A;  1ZBJ A;  4OVA A;  1Q81 R;  3J7A F;  2PQW A;  4M7A B;  1WDX A;  2HCK A;  4AFZ C;  2L3S A;  2RQV A;  2ABL A;  4M77 E;  1D3B B;  2FEI A;  1QVG A;  1Z9Z A;  2RM4 A;  3MEW A;  3THK A;  1YWP A;  3HPW A;  4C0Z A;  4C8Q G;  1ZBX A;  2FZC B;  3GPL A;  1QKX A;  2E4H A;  1UJY A;  2FYK A;  3V8K A;  3OYH A;  1A0N B;  3EFR A;  3MP1 A;  1M1F A;  4J7I A;  1WIE A;  4FSX A;  2GFA A;  4F7U G;  2Y4Y A;  3VS0 A;  3JCM e;  1Q82 U;  2EYW A;  4RKU E;  5KYW B;  4ANJ A;  4L6V 5;  2J7I A;  2HKN A;  5IHI A;  8AT1 B;  2EYX A;  5L8R E;  2NUP B;  4M78 D;  1GFD A;  4R55 A;  1EZZ B;  1UGR B;  4ZN3 A;  3VYG A;  1TOV A;  2WSF E;  3CQT A;  2PZ1 A;  5KYW A;  2RK2 A;  2GTJ A;  1BK2 A;  1IXD A;  2OTJ A;  2GGR A;  5LJ3 e;  4CI0 C;  1SG5 A;  5KCO A;  4RTY A;  3QHS A;  5KCH A;  3DLM A;  2KT8 A;  3J81 E;  4FW2 A;  2AT1 B;  4RTV A;  1G5V A;  4EIK A;  2EWN A;  3G1J A;  1QP2 A;  1SF9 A;  2KY9 A;  2DM1 A;  2ROT A;  1WNL A;  3JCM b;  1M3B A;  4UC4 A;  2F2X A;  2LCC A;  2OTJ T;  4A4F A;  1WHJ A;  3OYK A;  2EAY A;  1MV0 B;  1WXB A;  2DRM A;  3MCA B;  3JCM X;  4ZTF A;  5LJ5 e;  1QVF A;  1N5Z A;  1K0S A;  1WI7 A;  4BY6 C;  2LT1 A;  3CPF A;  1OPK A;  2JOY A;  3M53 A;  3WXM B;  3DB4 A;  1JJ2 P;  3FB9 A;  2AK5 A;  2X35 A;  4QT7 A;  3CME T;  2K2M A;  6AT1 B;  5DM7 R;  1RAG B;  4QQ6 A;  4JLG A;  2FPE A;  3JSC A;  3INZ A;  2GF7 A;  4Z89 A;  4BUG A;  4J9E A;  3JCM h;  2OAU A;  2KEA A;  4M75 F;  2K5L A;  1RAC B;  3OYE A;  1G3T A;  2SEM A;  2EVR A;  1OI1 A;  1ZSZ A;  4MDX A;  2KBT A;  4J83 A;  1K9M R;  3FDR A;  2FZG B;  2JM8 A;  2QDY B;  1IO6 A;  3EH1 A;  4N4H A;  4II1 A;  2QYZ A;  1KC8 U;  4OMM A;  4D8K A;  2RNA A;  4RTZ A;  2L8D A;  1AT1 B;  2YSQ A;  1RAI B;  1WQW A;  5GAO l;  1I8F A;  2LNV A;  2HQX A;  2BZX A;  3CCR A;  1UGS B;  2QA4 Q;  2WSE E;  1X2K A;  5GJW B;  2OTL A;  3A8M B;  2BZY A;  2JUF A;  3JCM P;  2ZZD A;  1UEB A;  1LOJ A;  4BY6 B;  3A8L B;  5LJ3 g;  2LX7 A;  2VAS A;  4QKU A;  1OX8 A;  3CXC P;  4ME7 A;  1F1B B;  5EC7 A;  2A28 A;  1V1C A;  1C0M A;  4RTX A;  3RES A;  1VQ8 T;  1OUL A;  2M1H A;  4JRP A;  2CP6 A;  4EMK A;  4ZGD B;  5AYF A;  1IRX A;  1K8A C;  5HK0 A;  1JB0 E;  4C92 G;  4LDW A;  2DVE A;  2K3X A;  2EPD A;  2GCX A;  3QZ5 B;  4HVW A;  3SB2 A;  2DXT A;  2Y4X A;  1TH7 A;  3OA6 A;  1UE9 A;  1JXM A;  1UG1 A;  3CC7 Q;  1ABQ A;  5D6Y A;  3BDU A;  3NPF A;  1N6A A;  4LNP A;  3RMQ A;  3TRE A;  4FU6 A;  1M1G A;  3M9Q A;  4NL2 A;  5GMK l;  1VQO Q;  1TG0 A;  3CPW P;  2LQN A;  1WHK A;  3H0I A;  4LDX A;  1IRE B;  2FVU A;  2K9G A;  2XG8 D;  4C5E A;  1VQ9 Q;  3L2V A;  4J9C A;  3CCV A;  4M78 G;  5FWB A;  3L2R A;  3JB9 D;  4AFS C;  2ZGW A;  2O31 A;  2HSP A;  2XDB A;  1ZSZ C;  5LJ5 g;  3CCQ Q;  2EGC A;  3G71 A;  1YCY A;  1IHW A;  9ATC B;  3MJX A;  4N4G A;  2CP5 A;  4PNO A;  5CQX A;  3CCQ A;  2VVK A;  1VQ6 A;  1VQ9 A;  1BCO A;  5IH2 A;  4OMN A;  1NEG A;  2RPN A;  2OX7 A;  4LXC A;  3LWI A;  3A8H B;  1H3H A;  2VGM A;  1D3B A;  3GBQ A;  4KUD K;  3X26 B;  2RJD A;  3JCM f;  1OYX A;  4HCC A;  3CCU Q;  2FO0 A;  1VQP A;  3G71 Q;  3M0R A;  4RCB A;  4CC2 A;  1RLQ C;  4OML A;  2EJG A;  1VQN A;  2RHU A;  4EMH A;  5GAN 2;  2V26 A;  2MWP A;  3CME Q;  2CUB A;  2V1R A;  1M2V B;  2P0Q A;  5FRO A;  2XU8 A;  2LJ1 A;  3A98 A;  3PT9 A;  1VQL T;  5GAN 5;  4XU2 A;  4J8O A;  4K11 A;  3EGU A;  2G6F X;  2HD0 A;  5KE3 A;  4RMO A;  2ZAE A;  2DF6 A;  1YIT Q;  2KI7 A;  4A4E A;  4AG1 C;  1OX9 A;  2XKO C;  2FB7 A;  1M90 U;  1Q81 C;  2JMA A;  2LCS A;  2RQU A;  3CCR Q;  3L42 A;  2AKK A;  3CPW S;  2KXD A;  3HFN A;  1VQ4 A;  3SWN B;  3M54 A;  3SD4 A;  3DB3 A;  2MI6 A;  2O9S A;  2AHJ B;  1YIT T;  1K73 C;  5CVI A;  5CKB A;  3EGD B;  2P84 A;  5KYN A;  1T0J A;  3FIF A;  2W0Z A;  2J06 A;  4XTZ A;  3QJY A;  2QEX A;  5FRN A;  3HRT A;  2XMF A;  5J39 A;  1NLP C;  2M51 A;  2QGF B;  3VUB A;  3CCS Q;  4E7K A;  2CP3 A;  2CZ6 B;  2I2L A;  1R77 A;  1TS9 A;  4LUE A;  4MZT A;  2LQW A;  4M77 A;  2NWM A;  4WF2 A;  3VS6 A;  2E5Q A;  2K57 A;  1H8K A;  2QQR A;  4QVC A;  2FRW A;  2M02 A;  4MZP A;  1K8A R;  3CCM Q;  3M0P A;  4J9H A;  4LUD A;  1Q7Y R;  1NJI R;  2QQB A;  3CD6 Q;  1TSF A;  3GNF B;  4Z8A A;  4KBM B;  3TQ7 P;  2CZ7 B;  3NTI A;  1VQK Q;  1M30 A;  3EH2 A;  2IG0 A;  2DER A;  2CZ0 B;  1D1B A;  2MPX C;  1VQM A;  1FX7 A;  3P8D A;  5HCK A;  1M8V A;  1W2B P;  3M58 A;  4KUL A;  3GNG A;  2J6K A;  3REB B;  4MMK A;  3VKI A;  2M0Y A;  2DZC A;  4GLM A;  2YUO A;  5GAM j;  3OBW A;  2KQW A;  3QZ9 B;  1YHQ T;  2A7Y A;  2KYM A;  1TUC A;  1T3L A;  4X9C A;  1X75 C;  2BE7 D;  3PNW C;  1KC8 C;  2K4Y A;  3WVE B;  2YDL A;  4IUU A;  1UJ0 A;  4O5V A;  3VV0 A;  2QQ9 A;  5FLX E;  1TWB A;  2RQW A;  1K9M C;  2EYZ A;  4NS5 A;  4FYY B;  1FYN A;  3OW2 S;  2L2P A;  1ZLM A;  1RAF B;  1WFW A;  2F69 A;  3S3O A;  1M1K U;  2DXC A;  1Q7Y U;  1M90 C;  4PJO B;  3PTA A;  4DQ2 A;  1X27 A;  3CCE A;  2DX1 A;  1AEY A;  3JB9 J;  2JW4 A;  3MP8 A;  3EHQ A;  1M2O A;  1QWE A;  1S72 Q;  4IIM A;  4M77 G;  3H0F A;  2L5Q A;  2HL3 A;  2E41 A;  2DE0 X;  4HT8 A;  1E6G A;  2HEQ A;  2P4R A;  3M4Y A;  4F04 B;  1OEB A;  3HKS A;  4RG2 A;  3UA6 A;  1W2B S;  2V8J A;  3CEY A;  4E7I A;  1VQ4 T;  5CKF A;  2E64 A;  1RAA B;  2R5M A;  3CCL A;  2YWW A;  5GAN j;  2D8J A;  2H8H A;  2DL5 A;  2KMT A;  2ED0 A;  2DA9 A;  2ED1 A;  3RDV A;  2EQK A;  3C4S A;  3VUZ A;  3A5Z B;  3EAE A;  1UGQ B;  3SWN C;  4M7D A;  4DOV A;  2F2V A;  1Y07 A;  1YCS B;  4GY5 A;  2JM9 A;  2LVM A;  1IB8 A;  4XTX A;  2DIG A;  2L3P A;  1VQ7 Q;  1TTH B;  2CH4 A;  2BE9 B;  4AFQ C;  3ZL7 C;  2RHZ A;  2IVW A;  5GAM f;  3EGX A;  2K2V A;  5KYU A;  3V8L A;  5LJ3 d;  3CCJ A;  2DRK A;  3HRS A;  2YUN A;  2DJZ A;  1Z9Q A;  4J9B A;  2BIV A;  2FZK B;  4J6X A;  5A0D A;  1KHI A;  4PLL A;  4M7A D;  1PM3 A;  1VQN Q;  2DXB A;  1HYO A;  1B7T A;  1QCO A;  2H3E B;  1GRI A;  3JB9 I;  3VS5 A;  1GXI E;  4D8D A;  4M75 C;  3I5R A;  4PJM A;  1HXD A;  1M9S A;  3CD6 T;  4M7D D;  4PK4 A;  1W70 A;  2KT1 A;  1NYG A;  4M7A C;  1VQ8 A;  3UDC A;  1VUB A;  2PTK A;  3CCM T;  2A37 A;  4X34 A;  2AKL A;  4QQD A;  3QKJ A;  4JJD A;  7AT1 B;  2KAF A;  4LN2 A;  3OS2 A;  4V2S A;  2A3L A;  2PUO B;  2E5K A;  5GAM d;  4N0A A;  4M75 E;  2JS0 A;  4JRI A;  2ZPH B;  1Y0M A;  4PJO G;  1QCF A;  2KXC A;  3L2Z A;  2QEX Q;  1SKU B;  1BI3 A;  4M7A E;  4MML A;  4M4Z A;  2OAW A;  4HT9 A;  3H9N A;  1NG2 A;  3I35 A;  5GAN 7;  2OTL Q;  2HSE B;  1Q86 U;  1WLP B;  3CCL T;  1NEB A;  1JEG A;  3MET A;  1YJ9 Q;  2RHI A;  4FT4 A;  4LDU A;  4DBF A;  1YJW A;  3M0T A;  1QVG P;  2EQM A;  3RUX A;  1H64 1;  2J6F A;  5CKE A;  1YIJ Q;  5ECA A;  2L3R A;  4M7D E;  2X3X D;  3HFO A;  1YI2 Q;  3GLX A;  2NUP A;  4B9X A;  2D0Q B;  3CC7 A;  2EGE A;  3JCM J;  1W1F A;  1K76 A;  1U1S A;  3RIR A;  2ZPF B;  2F5K A;  2NYS A;  1WGS A;  2RJE A;  4A4H A;  5J3B A;  1KQ2 A;  4OMQ A;  1JXO A;  2MIO A;  1QKW A;  1TUD A;  3CCE T;  3QBY A;  2JXB A;  2XK0 A;  1AOJ A;  3OBY A;  1S72 T;  4XQ3 A;  1KQS A;  3EG3 A;  4ZNX A;  2CP7 A;  2KDS A;  1U8R A;  2X4W A;  4EMG A;  2EKO A;  3VRY A;  5I2S A;  1UB4 A;  3LLR A;  2P4T A;  2J05 A;  5HK3 A;  1RAE B;  3I55 A;  3VJP A;  2M9U A;  1PCX A;  4JRQ A;  1B3Q A;  2Y90 A;  2YT6 A;  2QAZ A;  3KFV A;  4C5H A;  1BIA A;  4LD9 K;  4ZGJ B;  3NMZ C;  4BE0 A;  1KD1 U;  4HXJ A;  3OYF A;  1QVP A;  3HHT B;  4QVZ A;  1ZA2 B;  3CBP A;  5KYY B;  4HA8 A;  4OGC A;  2DYI A;  3LH0 A;  2ZPB B;  1KD1 C;  5KYX A;  4LE9 A;  3VS4 A;  1G8X A;  3JAM E;  3NHN A;  3CBM A;  3RKW A;  4C5I A;  4M77 C;  1Q86 R;  4JZ4 A;  3OQ5 A;  2CP0 A;  3ME9 A;  1YJN T;  4DA4 A;  3M0U A;  3MO8 A;  3G7Z A;  1JJ2 A;  1RAH B;  2CS7 A;  2GQV A;  4Z88 A;  4DEX A;  4ZTJ A;  4A63 B;  1VQK T;  5C6S A;  5FU6 B;  1YI2 T;  3M57 A;  4D6W A;  4OF1 A;  1LCK A;  4C92 C;  2OI3 A;  3OYI A;  1JO8 A;  4AFU C;  1WPY A;  2K3B A;  1WXU A;  4JPB W;  3J80 E;  2F5T X;  1PKT A;  3DKM A;  3DLL A;  1N8R R;  4C0F A;  3G4S T;  2QTV A;  4RCC A;  2LMJ A;  1HJD A;  2RI2 A;  1LJO A;  3I5S A;  2DKG A;  1C6V X;  2DJQ A;  2L89 A;  1PNJ A;  3L2U A;  1UEC A;  1WHH A;  4PFP A;  2A08 A;  1LVK A;  1OZ2 A;  1N9S A;  1VIE A;  4F7U F;  1UGV A;  2A0F B;  4TVR A;  3EG9 B;  4XAX B;  2FHD A;  4M77 B;  2O88 A;  4PJO A;  5KE2 A;  1VQO A;  4J6W A;  3P8B B;  2HQH A;  3CCS A;  4M77 D;  3UAT A;  3H0H A;  3JCM W;  2EKH A;  4MDW A;  4F7U A;  5GAN 4;  1K9A A;  4M7D C;  1WQ7 A;  4M78 C;  3L2Q A;  2MF2 A;  3N5B B;  1SSF A;  1NPP A;  1I5O B;  1JBM A;  1PHT A;  3G4S A;  4Y91 A;  2RQR A;  3O8V A;  5GAN e;  4HCB A;  1WHG A;  1UUE A;  4HVU A;  4A4K A;  2KVQ G;  2DXU A;  3GIB A;  5D6X A;  1PSE A;  1RL2 A;  1I0C A;  1WYX A;  3ZEH A;  2QQA A;  3AHU A;  4FSS A;  4OMP A;  3FJ5 A;  1U1T A;  3PFS A;  3CC2 Q;  5M9O A;  2FG0 A;  3HTR A;  3ULR B;  4M78 B;  3U23 A;  2K79 A;  1XQH A;  2DPP B;  1BKB A;  2PVG B;  3G71 T;  5A0L A;  2K5I A;  2MK5 A;  2RJF A;  1VQM T;  2VV5 A;  4WCI A;  1ZX6 A;  1B07 A;  1WHL A;  2EBP A;  1WJR A;  1NM7 A;  2X9H A;  3KUF A;  3TEE A;  1M5Q 1;  3CBO A;  3JB9 G;  2YUP A;  3M59 A;  3QDF A;  1VQP Q;  4OB0 B;  1ABO A;  4X9D A;  4E47 A;  1FWZ A;  2LNH B;  2E1H A;  2FRY A;  3EG9 A;  1ACM B;  1YP5 A;  2VUB A;  2VB6 A;  3EG0 A;  2SRC A;  3I55 T;  3QXE B;  4ELY C;  2KE9 A;  1Y7X A;  3URG A;  2RHY A;  2ZPI B;  2LC4 A;  4C92 A;  4J6Y A;  2DAQ A;  3S3N A;  1M2V A;  4M75 G;  4P5N A;  2KRM A;  3PMT A;  2DEQ A;  1M27 C;  1YIT A;  2DL3 A;  1FMW A;  2X3W D;  4KGZ B;  5KYX B;  4PJJ A;  2RHX A;  3EHR A;  4FYW B;  3EFS A;  1QP3 A;  2QI2 A;  2RN8 A;  2C0T A;  4FL6 A;  5CKH A;  4C8Q C;  3NGP A;  1R0B G;  2KNB B;  2DNU A;  4HCK A;  4J9G A;  1G3W A;  1SHG A;  3CC7 T;  3JB9 F;  1WXT A;  2PU9 B;  5IHN A;  3T9N A;  4ESR A;  1HK9 A;  2C06 A;  5HY6 A;  2E6N A;  3R6N A;  1QVG S;  3QWY A;  1X43 A;  2OTL T;  2M16 A;  5A0G A;  4M7D G;  3NTK A;  1NYF A;  2E12 A;  2EIF A;  3LX7 A;  1D09 B;  3KBG A;  3OSV A;  1ZHI A;  2VWF A;  2XI9 A;  4F17 A;  1Q7Y C;  5FU7 C;  1ZA1 B;  1JU5 C;  5DLO A;  4XU0 A;  2HDA A;  3OYJ A;  3SFM A;  2MAM A;  3OW2 P;  2VXF A;  2JZ2 A;  3QYG B;  3CCQ T;  3H41 A;  1VQN T;  5KYY A;  4JZ3 A;  2HZY A;  5LJ5 j;  1G3S A;  1AD5 A;  2KRN A;  2JT4 A;  2EFI A;  2E65 A;  4BDZ A;  3E9F A;  5LJ5 h;  1ZSG A;  3HL8 A;  5GAM g;  2DVJ A;  2LTO A;  2VGN A;  3V7C A;  2F2W A;  5IAY A;  3G4S Q;  4PFO A;  1Y96 A;  5D6W A;  1Y96 B;  2DET A;  3CC2 A;  3M56 A;  4ZGE B;  1LNX A;  4C0D B;  1VQP T;  2RH2 A;  4JUV A;  4VUB A;  1ZSZ B;  1YIJ T;  2XD0 A;  4EMK B;  1MGQ A;  3OMG A;  2B86 A;  2ZCF B;  3QG1 A;  3REA B;  2DBK A;  1ZQ1 A;  2CYZ B;  1NZ9 A;  3TSW A;  3MHX A;  5I21 A;  3CCE Q;  2DL7 A;  2E10 A;  2ROL A;  1WX6 A;  3VRZ A;  5LJ3 h;  5GAN 8;  1O75 A;  1AWW A;  1VYU A;  3MEA A;  1ZUK A;  2R58 A;  3WVD B;  3HSB A;  1AWO A;  1MHN A;  3CME A;  4KT0 E;  3QSU A;  4M7D B;  2PNI A;  1EIF A;  1XTD A;  1BU1 A;  4N4I A;  1TU0 B;  3E1S A;  1PWT A;  2J6O A;  2JTE A;  2QGG A;  2WAC A;  1VQ4 Q;  1R0C B;  2YRV A;  2KR3 A;  2EW3 A;  1AZG B;  5DY9 A;  1WZO A;  2DTO A;  2EYY A;  2BKD N;  2BZ8 A;  1BYM A;  1QWF A;  2G3R A;  3EGX B;  5KYU B;  1XOV A;  3E9G A;  4KGX B;  1EFN A;  2DIQ A;  1M1K R;  8ATC B;  5CCA A;  1XNI A;  2LP5 A;  3CCV Q;  1X69 A;  3I56 A;  4JJN K;  3ASK A;  2DO3 A;  1VQK A;  5GAN f;  2JJ9 A;  2JVV A;  1N27 A;  3BDL A;  1KSW A;  4PJO F;  1GL5 A;  3R6O A;  3TVT A;  4GLK A;  5FU6 C;  5GAN g;  4PJO C;  2QK0 A;  5GJV B;  1SHF A;  1GCQ A;  2RD1 A;  1IGU A;  3EFO B;  1AVZ C;  3G6E Q;  1O9S A;  4C5G A;  1M3A A;  4F16 A;  1GBQ A;  5GAO m;  2M0O A;  2E6Z A;  4M75 B;  1VQ6 Q;  1OZ3 A;  1WHM A;  2V8K A;  3M0Q A;  3VU3 C;  1SPK A;  2CSQ A;  2EGA A;  2EYQ A;  2RF0 A;  4FYX B;  4IKF A;  2W10 A;  4XK8 E;  3QJ6 A;  1K73 R;  5IXB A;  4HVV A;  3GOX A;  1KQ1 A;  1N8R U;  4RTT A;  1DJ7 B;  4R0K A;  2XHC A;  1GBR A;  2DL4 A;  2QQS A;  1KG1 A;  5GMK m;  3LW5 E;  3FC3 A;  3MEV A;  3V7R A;  4PJO E;  1OPL A;  4WTO B;  2XDD A;  1H92 A;  4E7S A;  3OB9 A;  2MCN A;  5FWC A;  4A4G A;  2HQE A;  2DLP A;  1YHQ Q;  1UFF A;  2YRD A;  2FPF A;  4OGE A;  3VS2 A;  5KH6 A;  1YHQ A;  3EG1 A;  4IUT A;  1VOM A;  5LJ5 d;  5GAN 3;  3PGG A;  1PD0 A;  5GAN h;  1K0X A;  4C8Q A;  3OYY A;  1D1C A;  4KGV B;  2ZPG B;  3KXT A;  2C0I A;  2RI3 A;  3FEO A;  5J26 A;  1X6B A;  5GAM e;  1MV3 A;  1YI2 A;  3PE0 A;  4XTW A;  5CQY A;  1W6X A;  2EQU A;  1UGP B;  2A36 A;  3SHW A;  3BE3 A;  4C8Q B;  4E6R A;  3LGL A;  1E7O A;  1I1J A;  1HD3 A;  1YJW T;  4M7A F;  1S1N A;  3JCM c;  1OU9 A;  1NE8 A;  3L1A A;  1RAD B;  3M4G A;  5CIU A;  2HBP A;  4B9W A;  4AMC A;  2ATC B;  2XDP A;  2GNC A;  3OS5 A;  1GCP A;  4RUG A;  4BI3 A;  4M78 A;  2CDT A;  1VQ6 T;  4BB7 A;  3A8G B;  4LDV A;  4OB1 B;  3CCL Q;  2KK4 A;  4QVD A;  3HP9 A;  1X2Q A;  4Y28 E;  1WJQ A;  5I11 A;  4XTU A;  4L59 A;  4DOW A;  1VQM Q;  2V1Q A;  1Q81 U;  5HKC A;  1PRM C;  1RLP C;  1NBE B;  5CKD A;  4C8Q D;  5GMK e;  4BE2 A;  1G2B A;  3I55 Q;  1NJI C;  4DBH A;  3CMA T;  3JCM g;  1K1Z A;  4OMO A;  2YLC A;  2I0N A;  4F7U B;  4DEY A;  2RB6 A;  3I56 T;  2O4X A;  1KIK A;  1BI2 A;  1TUG B;  5LJ3 f;  3I9Q A;  1VQL Q;  4BDY A;  4XU1 A;  2XID A;  2CGH A;  4JLI A;  5GMK i;  3FJP A;  4KRT A;  3A1P A;  3CMA Q;  2ECZ A;  1YBY A;  3P8H A;  1PD1 A;  3M55 A;  4CRI A;  1YFN A;  3RER A;  1FMK A;  2FL7 A;  3BY7 A;  4N0A C;  3M5A A;  3OSS C;  4R56 A;  2D6F A;  1K73 U;  1U06 A;  1M90 R;  5EG2 A;  2FPD A;  2VYT A;  4IUR A;  3C0C A;  2GFU A;  1HSQ A;  3OS0 A;  4M78 F;  4JDS A;  2NUT A;  1I4K 1;  1QVF P;  5LJ3 j;  3NFC A;  3LWH A;  1KQS P;  4M7A A;  2LRQ A;  4XTY A;  2DTI A;  4IUV A;  2CUD A;  3RMS A;  3QO3 A;  1X6G A;  1YJN Q;  1ZUU A;  1YIJ A;  3TU4 K;  2X4J A;  4KUI A;  1SRM A;  4JS4 A;  2EQI A;  4XTV A;  3X28 B;  4E7J A;  4OB3 B;  3OY9 A;  1U3O A;  2CKK A;  4QW2 A;  4L5G A;  3VYH B;  1UTI A;  2DD5 A;  5IT9 E;  3SEM A;  3MKD A;  2P0K A;  2RI5 A;  2LJ0 A;  2GTO A;  1TXQ A;  3OYG A;  4MZM A;  1YJN A;  1PSF A;  1KC8 R;  1ZUY A;  1NLO C;  3EFO A;  2K3Y A;  1MMG A;  3JCM Q;  4NOY A;  4AT1 B;  4LDY A;  4FW1 A;  5CAI A;  1C1A A;  1XJW B;  1OOT A;  1VQ9 T;  4BI8 B;  2YHT A;  3OYD A;  1QQJ A;  4C8Q F;  3V8J A;  3E2U A;  1M4Z A;  3H8Z A;  2CZ1 B;  5IHK A;  3SWN A;  1RUW A;  3C12 A;  4PJO D;  1I5L A;  2CH4 W;  3AT1 B;  2RJC A;  1AWJ A;  3UWN A;  4F14 A;  4JJB A;  2DK3 A;  3QUI A;  4F7U E;  3CXC A;  3HRU A;  4PLI A;  3CCU T;  3CXC S;  1OQK A;  1SEM A;  2JMC A;  1U5S A;  1Y71 A;  4AG2 C;  4OP0 A;  3SDZ A;  5CR2 A;  2HMA A;  1VQ5 Q;  2D1X A;  2QG9 B;  3G6E A;  3RR6 A;  5C0M A;  4EDU A;  3C95 A;  2JN0 A;  5FRM A;  1WA7 A;  3JB9 H;  3X20 B;  4M7A G;  3VS7 A;  5CO7 A;  4OMF B;  3RKY A;  2JNG A;  2O01 E;  2DFU A;  3CC2 T;  3CMA A;  2R57 A;  4QQG A;  3MP6 A;  4C92 F;  2ZPE B;  3LGF A;  3X24 B;  2YXY A;  4XU3 A;  4A53 A;  4J5Y A;  1YJ9 T;  5FW9 A;  2AZS A;  2MYS A;  2QAS A;  2PVO B;  5GAN 6;  1IHV A;  3CPW A;  1YWO A;  3CCR T;  2WSC E;  4J9I A;  4FIB A;  5GAO p;  1MND A;  1YN8 A;  5GMK j;  3QPH A;  5D7U A;  1D0Z A;  2DZ9 A;  1RI0 A;  3A8O B;  1IGQ A;  5I2M A;  2NLU A;  2YLB A;  5GAO r;  2YRC A;  2DEU A;  4M75 A;  2JTM A;  2BUD A;  2DYB A;  2VXE A;  2VC8 A;  4M7D F;  2L3Q A;  4HKE A;  1B34 B;  3S6W A;  1WJS A;  4CC3 A;  4JRK A;  4A54 A;  1G83 A;  3PIP A;  4PFZ A;  3CCV T;  2RK1 A;  2V8I A;  2IPO B;  2KGT A;  3FLG A;  3VS1 A;  1Q86 C;  2C0O A;  4ORZ A;  3NTH A;  4X1V A;  3JCM V;  1QLY A;  3CC4 A;  1N9R A;  1W4S A;  1MNE A;  3CD6 A;  2QDL A;  2B8A A;  1VYV A;  1X6O A;  3TCJ A;  2HBW A;  3CCM A;  5I22 A;  1QVF S;  5L23 A;  3S3M A;  5AT1 B;  3OYC A;  3PVL A;  3TSZ A;  3ZFJ A;  1VQO T;  2QTX A;  4PL6 A;  2NUZ A;  4Q5W A;  3UPU A;  1VQL A;  2PUK B;  1X01 A;  2MWO A;  3V7S A;  3PVQ A;  1VYT A;  1E6H A;  2GBQ A;  4BAC A;  2VKN A;  1OU8 A;  2ENM A;  4BI4 A;  1M8M A;  4C0D C;  2K6D A;  3UA7 A;  3M0S A;  5IXF A;  2KYB A;  2HKQ B;  1SSH A;  1PG5 B;  4KH1 B;  2F1L A;  2O2O A;  2RA2 A;  1VQ5 A;  2HNI A;  4GBQ A;  3OYN A;  1AWX A;  3MEU A;  1K8A U;  4ATO A;  5GAO n;  2H3J A;  1FMV A; 
#chains in the Genus database with same CATH homology
 1B34 A;  3CCU A;  1U1S A;  1BI1 A;  4NL3 A;  3RIR A;  3VU3 C;  2ZPF B;  2F5K A;  2R5A A;  2EYQ A;  2QA4 A;  4IKF A;  3RES A;  1WGS A;  2RJE A;  4A4H A;  1VQ8 T;  5J3B A;  1KQ2 A;  4XK8 E;  3QJ6 A;  2M1H A;  4JRP A;  3BFM A;  4ZGD B;  4EMK A;  5GAO r;  1I81 A;  5AYF A;  3CCE T;  3QBY A;  1K8A C;  4C8Q E;  3GOX A;  5HK0 A;  1KQ1 A;  2XK0 A;  1N8R U;  1JB0 E;  3OBY A;  3X25 B;  4XQ3 A;  4C92 G;  4LDW A;  5GAO q;  2DVE A;  1S72 T;  1DJ7 B;  1KQS A;  2K3X A;  4Z02 A;  2KDS A;  2GCX A;  2XHC A;  3QZ5 B;  2X4W A;  4J7F A;  3SB2 A;  1U8R A;  2DXT A;  4EMG A;  2Y4X A;  2EKO A;  2QQS A;  1TH7 A;  3OA6 A;  4E7H A;  4C92 B;  1KG1 A;  4RG8 A;  5GMK m;  3LW5 E;  3FC3 A;  3MEV A;  3V7R A;  5I2S A;  1UB4 A;  3LLR A;  3CC4 T;  4PJO E;  2P4T A;  4FT2 A;  5LL6 S;  5HK3 A;  5D6Y A;  3BDU A;  2XDD A;  3I55 A;  1BIB A;  1N6A A;  3RMQ A;  3TRE A;  3OW2 A;  4FU6 A;  1M1G A;  3M9Q A;  3OB9 A;  2M9U A;  4NL2 A;  3VJP A;  1W2B A;  5GMK l;  4JRQ A;  4A4G A;  4C0G A;  2HQE A;  4E7L A;  2Y90 A;  3Q1J A;  2DTH A;  2QXF A;  4LDX A;  1IRE B;  2FVU A;  4C5E A;  2XG8 D;  2JTF A;  4C5H A;  2HAX A;  1BIA A;  3L2V A;  4LD9 K;  3CCV A;  4M78 G;  4ZGJ B;  1K9M U;  4OGE A;  5KH6 A;  1YHQ A;  4BE0 A;  3OYA A;  1KD1 U;  2LT4 A;  3OYB A;  3L2R A;  3JB9 D;  1KD1 C;  4M75 D;  1NPR A;  4IUT A;  3OYF A;  3CCS T;  5LJ5 d;  5GAN 3;  1QVP A;  1IZ6 A;  2MMP A;  2ZGW A;  3HHT B;  3PGG A;  5GAN h;  2OTJ A;  4QVZ A;  1VQ7 T;  4JS5 A;  3CBP A;  2XDB A;  4HA8 A;  3OYY A;  4C8Q A;  5LJ5 g;  1H3Z A;  3JCM d;  1N8R C;  3G71 A;  1YCY A;  4OGC A;  1JJ2 S;  2ZPG B;  3KXT A;  3LH0 A;  2LCL A;  2ZPB B;  4N4G A;  5IN1 A;  4BD3 A;  2RI3 A;  3FEO A;  4PNO A;  5CQX A;  1QW1 A;  4ELZ C;  5J26 A;  3CCQ A;  2QA4 T;  1VQ6 A;  2EJ9 A;  5GAM e;  1VQ9 A;  5GAN d;  3JCM J;  1YI2 A;  3LYI A;  4HCZ A;  4XTW A;  3JAM E;  3JRZ A;  5CQY A;  2PVD B;  3CBM A;  3RKW A;  2EQU A;  3LWI A;  1UGP B;  3A8H B;  4C5I A;  4C8Q B;  2LDM A;  1D3B A;  2VGM A;  4KUD K;  3LGL A;  4M77 C;  3X26 B;  2RJD A;  3JCM f;  3QII A;  1BI0 A;  1OYX A;  3OQ5 A;  1YJW T;  4HCC A;  3JCM c;  4M7A F;  3ME9 A;  1NE8 A;  1YJN T;  4IUP A;  3L1A A;  4DA4 A;  3MO8 A;  3G7Z A;  2X4X A;  3M4G A;  4LD6 A;  2XIC A;  5CIU A;  1VQP A;  2HBP A;  4RCB A;  4B9W A;  1JJ2 A;  2EJG A;  2CS7 A;  1VQN A;  2GQV A;  4ZTJ A;  2XDP A;  3OS5 A;  5CK9 A;  2RHU A;  4EMH A;  5GAN 2;  1VQK T;  5C6S A;  2MWP A;  4M78 A;  5FU6 B;  4BI3 A;  1YI2 T;  2D9T A;  1VQ6 T;  4BB7 A;  3A8G B;  4LDV A;  4OB1 B;  4EMK C;  3M57 A;  2P0Q A;  2KK4 A;  4OF1 A;  4D6W A;  4QVD A;  4C92 C;  3HP9 A;  3QYH B;  5FRO A;  3OYI A;  2XU8 A;  2E70 A;  4Y28 E;  1WJQ A;  4XTU A;  1WPY A;  4L59 A;  3PT9 A;  4DOW A;  2P0P A;  3G6E T;  1Q81 U;  1VQL T;  5GAN 5;  4XU2 A;  4J8O A;  5HKC A;  2KSS A;  3J80 E;  2F5T X;  3DKM A;  5DLQ E;  5CKD A;  4C8Q D;  1M1K C;  5KE3 A;  2HD0 A;  5GMK e;  3DLL A;  4BE2 A;  1JRI A;  4RMO A;  1NJI C;  1R8O B;  3CMA T;  4C0F A;  3JCM g;  3G4S T;  4O6J A;  4A4E A;  4RCC A;  2YLC A;  2XKO C;  2RI2 A;  2RO0 A;  1LJO A;  2FB7 A;  4F7U B;  1M90 U;  2DKG A;  2RB6 A;  3I56 T;  1Q81 C;  2O4X A;  2L89 A;  3PMI A;  3L2U A;  1BI2 A;  5LJ3 f;  1OZ2 A;  3L42 A;  1N9S A;  1VIE A;  4F7U F;  3CPW S;  4TVR A;  3HFN A;  1VQ4 A;  4XAX B;  4XU1 A;  3SWN B;  4BDY A;  2FHD A;  3BW1 A;  4M77 B;  1G3Y A;  1FXX A;  1NJI U;  2XID A;  4PJO A;  3M54 A;  2CGH A;  5KE2 A;  4JLI A;  3SD4 A;  3L2W A;  3OMC A;  1VQO A;  5GMK i;  3DB3 A;  2MI6 A;  1P92 A;  3FJP A;  4J6W A;  2AHJ B;  3P8B B;  1YIT T;  3CCS A;  4M77 D;  3GP8 A;  1YBY A;  4BE1 A;  1K73 C;  5CVI A;  4C92 D;  3P8H A;  1KHC A;  3JCM W;  5FU7 B;  4MDW A;  5CKB A;  5GAM h;  4F7U A;  5GAN 4;  2QEX T;  3FIF A;  4M7D C;  4XTZ A;  3QJY A;  2QEX A;  1WQ7 A;  5FRN A;  3HRT A;  4C92 E;  3M55 A;  4M78 C;  4CRI A;  3L2Q A;  2MF2 A;  5J39 A;  3VUB A;  1SSF A;  1NPP A;  3N5B B;  1JBM A;  2CZ6 B;  4E7K A;  2I2L A;  3RER A;  3G4S A;  4MZT A;  2FL7 A;  3BY7 A;  4N0A C;  3M5A A;  4Y91 A;  3C94 A;  3O8V A;  3OSS C;  4M77 A;  5GAN e;  4R56 A;  2D6F A;  4WF2 A;  1K73 U;  4HCB A;  2E5Q A;  4A4K A;  3OYL A;  2K57 A;  5EG2 A;  2KVQ G;  2QQR A;  2DXU A;  2VYT A;  4IUR A;  4MZP A;  3ZBD A;  1AHJ B;  4QVC A;  3GIB A;  5D6X A;  1PSE A;  1RL2 A;  2GFU A;  1V29 B;  3ZEH A;  2QQA A;  4OB2 B;  3AHU A;  1VIF A;  3QDR B;  3OS0 A;  4M78 F;  4JDS A;  1I4K 1;  2EJF A;  5LJ3 j;  3NFC A;  3LWH A;  2QQB A;  3E19 A;  1U1T A;  3PFS A;  3RKX A;  2LRQ A;  1S72 A;  1VQ5 T;  3GNF B;  4M7A A;  4KBM B;  4XTY A;  3GF5 A;  2DTI A;  2CZ7 B;  4IUV A;  5M9O A;  4M78 E;  4M78 B;  3NTI A;  3RMS A;  2O4X B;  3QO3 A;  4M77 F;  1XQH A;  2DPP B;  1BKB A;  2PVG B;  2IG0 A;  4ZN1 A;  2CZ0 B;  4PKC C;  2K5F A;  3CCJ T;  1YIJ A;  3TU4 K;  1VQM A;  1FX7 A;  2X4J A;  3P8D A;  4KUI A;  3G71 T;  5A0L A;  2K5I A;  2EQJ A;  4C92 F;  4JS4 A;  2RJF A;  4XTV A;  3X28 B;  1VQM T;  2VV5 A;  1M8V A;  3M58 A;  4KUL A;  4E7J A;  1YJ9 A;  4OB3 B;  3GNG A;  3OY9 A;  4MMK A;  3UT1 A;  2CKK A;  1WJR A;  3VKI A;  4QW2 A;  4EPC A;  2DZC A;  3PIO A;  3KUF A;  4L5G A;  3VYH B;  3TEE A;  1KQS S;  5GAM j;  2DD5 A;  3OBW A;  1M5Q 1;  2KQW A;  3CBO A;  3QZ9 B;  5IT9 E;  1YHQ T;  5LJ5 f;  2A7Y A;  3JB9 G;  2P0K A;  3M59 A;  2RI5 A;  3FRN A;  4X9C A;  4OB0 B;  1X75 C;  3PNW C;  1KC8 C;  4X9D A;  4YTL A;  2K4Y A;  3WVE B;  4IUU A;  4E47 A;  1FWZ A;  4IUQ A;  3OYG A;  4MZM A;  4O5V A;  3VV0 A;  1PSF A;  2E1H A;  1YJN A;  2QQ9 A;  5FLX E;  2LX9 A;  3ER0 A;  1Q82 C;  3H6Z A;  2K3Y A;  2VUB A;  3JCM Q;  2DD4 A;  1K9M C;  4NS5 A;  1VQ7 A;  3I55 T;  3OYM A;  3QXE B;  2LQK A;  4NOY A;  3OW2 S;  4FM4 B;  4ELY C;  3OS1 A;  3F70 A;  4LDY A;  2LQ8 A;  2F69 A;  1M1K U;  3S3O A;  5CAI A;  5A2Q E;  2X4Y A;  1Y7X A;  5GMK h;  2DXC A;  3URG A;  1VQ9 T;  2RHY A;  4BI8 B;  2YHT A;  3OYD A;  4OVA A;  2ZPI B;  4C8Q F;  2LC4 A;  4C92 A;  3J7A F;  4J6Y A;  2DAQ A;  1Q7Y U;  3V8J A;  2PQW A;  3S3N A;  4M75 G;  1M90 C;  4M7A B;  4P5N A;  1M4Z A;  3H8Z A;  3PMT A;  2DEQ A;  3PTA A;  4PJO B;  2CZ1 B;  4DQ2 A;  3SWN A;  4M77 E;  1D3B B;  3CCE A;  1QVG A;  3JB9 J;  1YIT A;  3MP8 A;  2RM4 A;  3C12 A;  3MEW A;  3HPW A;  4PJO D;  4C0Z A;  1I5L A;  4C8Q G;  1ZBX A;  2RHX A;  3GPL A;  3EFS A;  1QP3 A;  2QI2 A;  4M77 G;  2RJC A;  3UWN A;  2FYK A;  3V8K A;  2DK3 A;  3QUI A;  4FL6 A;  5CKH A;  3EFR A;  3HRU A;  4PLI A;  4C8Q C;  4F7U E;  3OYH A;  3CXC A;  3CXC S;  3MP1 A;  3CCU T;  2L5Q A;  1M1F A;  4J7I A;  2E41 A;  1G3W A;  4HT8 A;  3CC7 T;  3JB9 F;  3M4Y A;  3HKS A;  2GFA A;  2PU9 B;  4FSX A;  4F7U G;  2Y4Y A;  1Y71 A;  3T9N A;  4RG2 A;  1HK9 A;  2C06 A;  3JCM e;  4OP0 A;  5HY6 A;  3SDZ A;  2E6N A;  2V8J A;  5CR2 A;  1W2B S;  1Q82 U;  3CEY A;  1QVG S;  4RKU E;  2M16 A;  4E7I A;  5A0G A;  3G6E A;  1VQ4 T;  2OTL T;  4M7D G;  3NTK A;  5C0M A;  4L6V 5;  2E12 A;  3C95 A;  5CKF A;  4EDU A;  2EIF A;  2E64 A;  3LX7 A;  2JN0 A;  5FRM A;  2R5M A;  3KBG A;  1ZHI A;  3OSV A;  3CCL A;  3JB9 H;  2XI9 A;  3X20 B;  5GAN j;  5L8R E;  4M7A G;  5CO7 A;  2KMT A;  4M78 D;  4OMF B;  5FU7 C;  3RKY A;  1Q7Y C;  4R55 A;  1UGR B;  5DLO A;  2JNG A;  4XU0 A;  3VYG A;  4ZN3 A;  2O01 E;  2WSF E;  3CC2 T;  3OYJ A;  3CMA A;  2R57 A;  2EQK A;  3C4S A;  3SFM A;  3VUZ A;  4QQG A;  3MP6 A;  2RK2 A;  2MAM A;  2ZPE B;  2VXF A;  3A5Z B;  3EAE A;  3LGF A;  3X24 B;  2JZ2 A;  1UGQ B;  4XU3 A;  3QYG B;  3SWN C;  4A53 A;  3CCQ T;  4J5Y A;  1VQN T;  1YJ9 T;  4M7D A;  5LJ3 e;  5LJ5 j;  1G3S A;  2PVO B;  5GAN 6;  4DOV A;  4CI0 C;  1Y07 A;  2EFI A;  3CPW A;  4GY5 A;  5KCO A;  2E65 A;  3QHS A;  3CCR T;  2LVM A;  5KCH A;  4BDZ A;  3E9F A;  2WSC E;  5LJ5 h;  4FIB A;  5GAO p;  3DLM A;  5GMK j;  3HL8 A;  5GAM g;  3J81 E;  4XTX A;  2LTO A;  1G5V A;  2EWN A;  2VGN A;  3V7C A;  2DIG A;  5IAY A;  1QP2 A;  1Y96 A;  1Y96 B;  2KY9 A;  3QPH A;  5D6W A;  3CC2 A;  3M56 A;  4ZGE B;  1LNX A;  2RHZ A;  2IVW A;  4C0D B;  5GAM f;  1VQP T;  2RH2 A;  1WNL A;  2K2V A;  2DZ9 A;  1RI0 A;  3V8L A;  3JCM b;  4JUV A;  4VUB A;  5LJ3 d;  3CCJ A;  1YIJ T;  3HRS A;  3A8O B;  4UC4 A;  2LCC A;  5I2M A;  2OTJ T;  2DJZ A;  4A4F A;  2XD0 A;  4EMK B;  2NLU A;  1MGQ A;  2YLB A;  3OMG A;  2EAY A;  2ZCF B;  1ZQ1 A;  3MHX A;  3QG1 A;  2CYZ B;  1NZ9 A;  2BIV A;  4J6X A;  4M75 A;  1KHI A;  5A0D A;  5I21 A;  2JTM A;  2BUD A;  3MCA B;  2E10 A;  4PLL A;  3JCM X;  4M7A D;  5LJ3 h;  4ZTF A;  5GAN 8;  2VXE A;  1O75 A;  2VC8 A;  5LJ5 e;  2DXB A;  4M7D F;  1QVF A;  3MEA A;  4HKE A;  1B34 B;  3OYK A;  3S6W A;  4BY6 C;  1WJS A;  3JB9 I;  2LT1 A;  4JRK A;  4A54 A;  3PIP A;  3CCV T;  2R58 A;  3CPF A;  1GXI E;  3WVD B;  3HSB A;  2RK1 A;  1MHN A;  2V8I A;  4M75 C;  3CME A;  4KT0 E;  3QSU A;  4M7D B;  2JOY A;  3M53 A;  1HXD A;  3WXM B;  1M9S A;  3DB4 A;  3CD6 T;  3FLG A;  1EIF A;  1XTD A;  3FB9 A;  1Q86 C;  2X35 A;  4M7D D;  3NTH A;  3JCM V;  3CME T;  4N4I A;  3CC4 A;  1N9R A;  5DM7 R;  1W4S A;  3E1S A;  4M7A C;  3CD6 A;  1VQ8 A;  4QQ6 A;  3UDC A;  1VUB A;  4JLG A;  3CCM T;  2WAC A;  2YRV A;  3JSC A;  3INZ A;  2GF7 A;  2B8A A;  4X34 A;  5DY9 A;  4BUG A;  2DTO A;  1X6O A;  3JCM h;  3TCJ A;  3CCM A;  2BKD N;  2OAU A;  1QVF S;  4QQD A;  3QKJ A;  4M75 F;  2K5L A;  3S3M A;  3OYC A;  3OYE A;  2KAF A;  1G3T A;  3OS2 A;  4V2S A;  2A3L A;  2PUO B;  3ZFJ A;  2QTX A;  1VQO T;  4PL6 A;  5GAM d;  1BYM A;  1OI1 A;  2G3R A;  4N0A A;  4M75 E;  4MDX A;  4Q5W A;  3UPU A;  1VQL A;  2PUK B;  1XOV A;  4JRI A;  1X01 A;  3E9G A;  2MWO A;  2ZPH B;  4PJO G;  2DIQ A;  4J83 A;  3V7S A;  5CCA A;  1XNI A;  3L2Z A;  3FDR A;  1BI3 A;  4M7A E;  3I56 A;  4BAC A;  4JJN K;  3ASK A;  2DO3 A;  2QDY B;  4MML A;  4BI4 A;  4N4H A;  4HT9 A;  1VQK A;  4II1 A;  4C0D C;  5GAN 7;  5GAN f;  1KC8 U;  2JVV A;  1N27 A;  3BDL A;  4PJO F;  2L8D A;  1Q86 U;  3R6O A;  4GLK A;  5FU6 C;  5GAN g;  3CCL T;  1WQW A;  4PJO C;  5GAO l;  1I8F A;  3MET A;  2RHI A;  2LNV A;  2HQX A;  4FT4 A;  4LDU A;  1UGS B;  2RD1 A;  3CCR A;  1YJW A;  2WSE E;  2EQM A;  2OTL A;  3RUX A;  1O9S A;  4C5G A;  1H64 1;  3A8M B;  5CKE A;  2JUF A;  2L3R A;  2RA2 A;  1VQ5 A;  4M7D E;  3JCM P;  3HFO A;  2HNI A;  5GAO m;  2M0O A;  2ZZD A;  2E6Z A;  3OYN A;  3GLX A;  1UEB A;  1LOJ A;  4M75 B;  3A8L B;  4B9X A;  4BY6 B;  5LJ3 g;  1OZ3 A;  2D0Q B;  3CC7 A;  3MEU A;  1K8A U;  2V8K A;  4ATO A;  5GAO n;  4ME7 A;  2H3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...