4C8QA

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
VDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qA00
5GAMh 4PJOA 4M75F 5GAN6 2DZ9A 2DZCA 2EWNA 3JCMV 3JCMP 1X01A 4C92C 4EMGA 4X9DA 1LOJA 3HFOA 5GMKm 5GAN5 1N9RA 1I5LA 3V7CA 4N0AC 2DTHA 2HNIA 4Y91A 4QVCA 4QVDA 3QHSA 1KQ1A 5LJ3h 4EMKB 3RESA 3EFRA 4M75A 3RKYA 4C92E 4M77C 4WF2A 4A54A 4F7UB 4F7UG 2FB7A 4F7UE 3BFMA 2RA2A 1M5Q1 2VXEA 4C8QF 5GMKl 4M7AB 2VXFA 4M77B 4M77G 4PJOF 3SB2A 4M77E 5GAMj 5GAOr 4M7AG 5GMKi 4M7AE 4M7AD 5LJ3e 5GAN8 1D3BB 4XU0A 3FJPA 5LJ3d 4XTXA 3RIRA 1BIBA 3L2ZA 1B34B 4XTUA 4HA8A 4M7DC 1WQWA 4XTVA 1JRIA 1WPYA 4M78C 4EMKA 4XQ3A 5GMKh 5LJ3j 3JCMJ 2QTXA 3JCMW 2DXUA 2EJ9A 2YLBA 4F7UA 1N9SA 2VC8A 3BY7A 5I21A 4M7DG 4M7DE 4M78B 4M78G 4JRKA 3V7SA 4M78E 4MMKA 5LJ3g 4NL3A 4X9CA 5GAN7 3V8KA 4EMHA 1KQ2A 2E64A 1I8FA 4MMLA 3JCMf 4C92B 4C92G 4M7AA 3JB9J 4XU3A 4C92D 3V8LA 4JLIA 5GMKe 1D3BA 4J6XA 3SWNC 2K57A 4NOYA 3RKWA 1YCYA 1U1TA 2DXTA 1B34A 4J5YA 4RCBA 3QUIA 4M77D 3SWNB 5GMKj 5LJ5f 5GAOm 4XU1A 5GAN3 3HSBA 2DJZA 1LNXA 1WNLA 3BW1A 4F7UF 4C8QC 1I4K1 3JCMd 3AHUA 3VU3C 4PJOC 1JBMA 3M4GA 5GANf 4M7AF 4M77F 3V7RA 4OP0A 3FIFA 4C92A 2RB6A 2Y90A 4RCCA 3JB9I 4XTZA 2E1HA 4V2SA 1HXDA 1I81A 5GAOl 4PJOE 4M7DB 4N0AA 5GAOq 4M7DD 3PGGA 4M75C 1BIAA 4M78D 3BDUA 5GAN2 4M77A 1HK9A 3RUXA 3JCMb 1H641 4JRIA 3JCMh 2ZGWA 4A53A 5GANe 2FYKA 3JCMQ 3JB9G 2YHTA 5GANd 4M75B 4M75G 3JCMX 5GAOp 4M75E 4M78F 2EAYA 2RM4A 1WQ7A 3V8JA 1Y96B 3RERA 4C92F 2JN0A 2DTOA 4PNOA 4DQ2A 5GAMf 5LJ5h 4HT9A 2I2LA 2E41A 3JCMe 3GIBA 4HT8A 4M7DA 5DY9A 4M78A 4EMKC 5GANg 4XTWA 4XTYA 3INZA 4JUVA 5GANh 3HFNA 3L1AA 2DTIA 5LJ3f 4C8QB 4C8QG 2E65A 3QSUA 1TH7A 4C8QD 3FB9A 4NL2A 4PJOG 2DEQA 4C8QE 5LJ5e 4PJOB 5GAOn 4M7AC 5GAMe 5GAN4 4PJOD 5LJ5d 1U1SA 4J6WA 5GAMd 2EJFA 3JB9H 4J6YA 1Y96A 3JCMg 3EFSA 3SWNA 2CGHA 2EJGA 5LJ5j 3JB9D 3QO3A 4M7DF 4M75D 2E10A 2RD1A 5CAIA 1M8VA 5LJ5g 5GANj 4XU2A 3JCMc 5GAMg 2DVEA 3JB9F 2DKGA 3RKXA 4C8QA 2YLCA 1MGQA 1LJOA
chains in the Genus database with same CATH superfamily
5GAMh 3PIPA 1JXMA 1JXOA 2VUBA 4J83A 4KBMB 1DJ7B 1KHIA 1GXIE 5KYNA 2KEAA 3CCVQ 3RESA 3EFRA 3M56A 3L2QA 4A54A 2CP2A 4L6V5 4BDYA 3CC2Q 1P92A 3CCVA 4PJOF 3SB2A 3QYHB 3CC2A 4Z02A 1TUCA 3L2ZA 4DBFA 3CBMA 2ECZA 4A4GA 1MV3A 3HL8A 5IHKA 2E6ZA 3HKSA 3H6ZA 4ELYC 3C94A 4N4HA 3RMSA 3QJ6A 1W2BS 2DF6A 1M1KU 1VQOQ 4WCIA 2Y4XA 3G7ZA 1QVGS 2M02A 3G4ST 2H8HA 3E1SA 2RQUA 4F04B 1KC8C 4FIBA 3EGUA 2DJZA 1YJNQ 2EQUA 4AFZC 4F17A 3AT1B 1YJNA 1Q81R 3PMTA 4PJOE 1IGQA 1T3SA 3CBOA 1GBRA 4B9WA 1TG0A 2IPOB 1Q7YR 2KRNA 1VA7A 1QCNA 2CUBA 2K2VA 2F5TX 1WHGA 2K5IA 1LPLA 4DQ2A 5GAMf 3VUBA 5LJ5h 3UDCA 1YI2Q 2PU9B 4IKFA 1D0XA 5GANg 3I56T 2K9GA 4AFQC 3CCRT 2QQBA 2X4XA 2J06A 3CEYA 1YI2A 1FMKA 1TH7A 2EQIA 1EIFA 3LH0A 2X35A 2V8KA 4FYVB 4LNPA 1K9AA 1QCOA 2BZYA 4Y92A 3JCMc 2DVEA 4C8QA 3CCMA 4M75F 2F2VA 4KH1B 4J9GA 3HPWA 3CCLT 5I2MA 5D6XA 3NMZC 2DBMA 3CMET 1TUDA 1Q82U 1PRMC 1RACB 2RI5A 2QTVA 1GCPA 1CKAA 4M7AD 3EAEA 1PG5B 1PWTA 2QG9B 3FJPA 3OYMA 1FXXA 1UGPB 4AT1B 5KYWB 2QEXT 2DYBA 1WQWA 2HDAA 4LDYA 2RJCA 3CPFA 4C0DB 3CD6T 2WSCE 2ZPEB 2YDLA 4M78G 4KULA 4M78E 3CC4Q 3TVTA 2CP5A 2K3YA 3OS0A 1HD3A 2A08A 3OBWA 1SPKA 1VQPQ 3RKWA 1M9SA 1JB0E 1BI1A 2JW4A 5LJ5f 3Q1JA 1VQPA 2XD0A 1PC0A 2E5QA 3C0CA 3OMCA 5DLOA 3MEVA 4OMPA 4A63B 1HXDA 3N5BB 4M7DD 4F16A 1AWJA 3TU4K 5FROA 2CH4W 5GANd 3VS4A 2EAYA 4PLIA 1XJWB 1Y07A 2DFUA 2CZ6B 2X9HA 1B07A 4RTZA 4C5GA 1WXUA 3GLXA 5AYFA 2YUPA 2A7YA 2GTJA 2DAQA 1KIKA 2BIVA 4XTWA 3M0UA 3INZA 4J9HA 3FC3A 2OAUA 1E7OA 2DERA 1HSQA 2R5MA 1VQ5T 4PJOB 5LJ5e 4M7AC 2EGCA 1VQ6T 1QP2A 1UGRB 4J6WA 2D1XA 4CC3A 3JCMg 1ZA2B 3P8HA 3OYYA 4BDZA 2E12A 2RQWA 1V29B 4BD3A 2A0FB 3PE0A 4E7KA 2P0KA 3OA6A 3O8VA 4Q5WA 2RI3A 4DEXA 2BE7D 3RR6A 3PVQA 2DTHA 2HNIA 3OMGA 1IRXA 1ARKA 3QHSA 3NPFA 3L2RA 3BE3A 1OZ2A 2DD4A 5GAN8 1OX9A 4ZGJB 4LDVA 4RTYA 4QW2A 1J3TA 4M7DC 1JRIA 2MF2A 1NM7A 4FYWB 2QTXA 2YLBA 1D1CA 1OEBA 3G1JA 3VV0A 4NL3A 3I5RA 4C92D 2RH2A 1U1TA 1ZUUA 2D9TA 3QUIA 3SWNB 2ESWA 2XIDA 1WNLA 3NHNA 1O9SA 2LDMA 4RTWA 3ZFJA 5A2QE 2JS0A 2L89A 2ZCFB 3I55T 4M75B 4ZNXA 5GAOp 2V26A 2QA4T 1VQOT 1BK2A 1WFWA 4PNOA 2KNBB 1WLPB 3CQTA 4KGZB 1W2BA 5CKDA 3RNJA 3GNFB 4OGEA 1QVGA 1W2BP 4PL6A 2CZ1B 1KC8R 2KXDA 1QVGP 4C8QG 3U23A 4C8QE 4F14A 3QSUA 3DLLA 2DEQA 4E6RA 2AKLA 4RKUE 3OYAA 2JXBA 1SHFA 3X24B 2MIOA 2AIRB 4KUDK 3JB9D 2QI2A 4ORZA 2FRWA 2E10A 1PSFA 1UHCA 5CAIA 1ZBXA 1KD1C 1QCFA 3FDRA 1NJIU 2OI3A 4LDUA 2DZ9A 2EWNA 3I35A 2V1RA 3LLRA 4C92C 2HSPA 4X9DA 2L3PA 3IQLA 1GBQA 2LCCA 2M51A 4FSSA 5KYYB 3BFMA 1UEBA 2HZYA 3L42A 2P4TA 4KGXB 3UF4A 4OMLA 2RMOA 4J9BA 4JLGA 2BE9B 2VB6A 2ZPHB 3G4SQ 3RBBB 2C0IA 4MZPA 1M3CA 1OX8A 1YCYA 1V1CA 5KYWA 3LGLA 3G4SA 2GFUA 1N27A 3OQ5A 4Z8AA 3ER0A 4YTLA 4VUBA 3H41A 3X26B 3DLMA 2WACA 4M7AF 1AWWA 2RB6A 3SEMA 4V2SA 2PUOB 1WXBA 4FW1A 1V76A 3MHXA 3JCMQ 3CC4T 4QKUA 4OMQA 2RM4A 2KT1A 5HK3A 1M1KC 2A36A 2MMPA 1WI7A 2YXYA 4PFZA 3THKA 1MMGA 3RDVA 1Y57A 3UPUA 1NYFA 1I1JA 4EMKC 2OTLT 2O01E 3CMAT 3CCRA 3QDRB 4X1VA 2XU8A 1OU9A 3VS1A 4LDXA 2P84A 2H3JA 5CQXA 2YUQA 3WVEB 4M7DF 2E3HA 4LDWA 4M75D 4IUPA 2RHZA 5FRNA 2EGEA 2GTOA 2ED0A 4QVDA 4PJOA 1WYXA 2EQJA 3PT9A 1T0HA 2JTFA 3CCLQ 1WDXA 2K6DA 4R56A 3EG0A 3CMEQ 2RNAA 4IUQA 1YBYA 4N0AC 1AT1B 3CCLA 1NG2A 2OAWA 2YRVA 4MDXA 1K0XA 2RI2A 1OYXA 2HCKA 3CMEA 4E7HA 3PFSA 5C0MA 3EH2A 2DD5A 3M5AA 3BDLA 4GY5A 4D8DA 2IIMA 4OB1B 3A98A 2QEXQ 1VQNT 1HJDA 1QVFS 2DXBA 2MCNA 4XTXA 3CD6Q 3JSCA 1WPYA 2RN8A 3QZ9B 2FHDA 2QEXA 3UA6A 2DXUA 1NYGA 2DX1A 2FO0A 3CD6A 5I21A 4M7DG 4M7DE 1VQMT 5J39A 1R77A 1FYNA 1UDLA 2JZ2A 2FPEA 2RJEA 3HTRA 2F69A 3SWNC 2CP0A 1MMNA 1Q82C 4LN2A 3R6OA 2AHJB 5GAN3 1YIJT 4F7UF 2MWOA 1TSFA 2KK4A 1RAIB 1IREB 3REBB 3HHTB 4QVZA 1OQKA 2XMFA 1ZSZA 4FYXB 2DE0X 4M75C 1BI3A 3BDUA 3JCMh 5GANe 5FU7C 3MP1A 1K9MU 3CCJT 1IGUA 2BZ8A 1QW1A 1SEMA 2L5QA 2NUPA 4C92F 4J9CA 3GP8A 4HT9A 4IIMA 2I2LA 3S3MA 2KY9A 1RI0A 4JJNK 1YP5A 4M78A 1YWPA 1VQ5Q 5FLXE 1VQ6Q 2LQKA 4L5GA 4IUUA 1B3QA 1VQ5A 1VQ6A 1EFNA 4RG2A 5IXBA 4E7JA 2DL4A 1K76A 1M4ZA 2P4RA 4ZN1A 5I22A 1YJWT 2P0QA 2K79A 3FRNA 1X01A 2HQXA 3LWHA 4QVCA 4C0GA 4JJCA 4C92E 1S72T 2KT8A 2LJ3A 2F1LA 4M7AB 2LZ6B 2G3RA 5FU6C 2DO3A 4CC2A 4FM4B 1B34B 1ZBJA 4HA8A 3HRSA 3JCMJ 2DA9A 1E6GA 5GMKh 3CC7T 1WXTA 2FRYA 2EJ9A 3EG9B 5KYYA 5I2SA 1KD1R 4JRKA 3JCMf 3JB9J 2DJQA 1YJ9Q 2KYBA 4IIOA 5IH2A 4QQDA 2NLUA 2EGAA 5J26A 5I11A 2HBWA 2EKOA 1EX4A 4OVAA 3CCEQ 1PD0A 1N8RU 2AZVA 2HD0A 5CIUA 4DA4A 1Y71A 2JMCA 3M0QA 2DLPA 2VV5A 3VU3C 3CCEA 1UJYA 3MCAB 4RCCA 2EYYA 3I55Q 4M7DB 1IO6A 1R8OB 5CKHA 1O75A 1ZLMA 4PKCC 2QA4Q 4QQ6A 3I55A 3JB9G 2JVVA 2CDTA 2EQMA 2DETA 3GNGA 4C5EA 2QA4A 1RAEB 2HBPA 3CCST 1VQOA 7AT1B 1Q7YU 2EYQA 3JCMe 1BB9A 1VIFA 2RK2A 2FZKB 3M58A 3HFNA 3OS5A 1WIEA 1TUGB 3X20B 1ABQA 4PJOG 5EC7A 3M54A 4JPBW 2K3BA 2KBTA 5LL6S 2L3SA 2K5FA 2NUTB 2QQ9A 4RG8A 2DL3A 1VQ8Q 1G2BA 3JAME 5GAN6 1RADB 2VWFA 4FT4A 1M1KR 3HFOA 5IAYA 3A8OB 4PK4A 2CH4A 3OSSC 3JB9I 1VQ8A 1QKWA 5HCKA 4LD9K 4F7UB 2AT1B 2GF7A 2GNCA 2DYIA 3EGXB 3AHUA 2RHUA 1X6GA 2VXEA 3M0SA 5GAMj 2VYTA 2QXFA 1WA7A 2L3RA 1KHCA 2CP7A 3RIRA 1YITT 4PJMA 4AMCA 4HCBA 2HSEB 2LT1A 2MPXC 5KCOA 4HXJA 3H8ZA 1NJIC 1N9SA 5LJ3g 1G83A 2F5KA 4J9EA 5DLQE 4EIKA 1VQLT 4C92B 3URGA 1Q86U 5GMKe 1W4SA 2FEIA 2ZPGB 1AWXA 2E70A 1OI1A 2QASA 5IHIA 3PVLA 2QK0A 2RPNA 3H0FA 4P5NA 1LNXA 3OYFA 1I4K1 4E7IA 4LUDA 4M77F 3V7RA 3X28B 2QQAA 3LYIA 1IHWA 1BCMA 1NEGA 2CYZB 3TREA 3X25B 2A3LA 1QVFA 4HKEA 1PHTA 1D0ZA 2DBKA 3E9GA 3RUXA 2RK1A 4BACA 4JRIA 4OB2B 2GCXA 1QVFP 3E9FA 4M75G 3CC4A 4M75E 3OYIA 4OGCA 3V8JA 2M16A 2CKKA 2HEQA 3RERA 1M2VB 2OTLQ 2QAZA 3GIBA 3CMAQ 4HCZA 2QGFB 2O88A 1Q82R 1X27A 1RAGB 2OTLA 4B9XA 5FWBA 4JZ3A 3CMAA 1NBEB 3M9QA 2O31A 2JS2A 1OZ3A 4EPCA 2CP3A 2CGHA 2E6NA 5LJ5j 2JTMA 3EFOB 1QWEA 3OBYA 1BU1A 2LQWA 1ZUKA 4RTXA 8ATCB 2KSSA 2JNGA 4JJBA 2DKGA 3RKXA 4XU0A 1OOTA 4ZGDB 5J3BA 1GCQC 2KXCA 2FVUA 5GMKm 1LCKA 3OYDA 4ESRA 1ZA1B 4EMKB 1KQ1A 3MKDA 1ZX6A 3OYJA 2J05A 1BYMA 4K11A 1VQNQ 1M3BA 3M0PA 2OTJT 5LJ3d 2YRCA 1VQNA 4XTUA 2YUOA 2EYXA 5CVIA 4XTVA 4A4KA 2D6FA 5D6YA 1UB4A 1GL5A 1VQMQ 2YRDA 3SFMA 4JDSA 3VRZA 4ANJA 3KUFA 2FG0A 3V8KA 4M7AA 3H0IA 1VQMA 1KFZA 2ZPFB 2XDBA 2BTTA 3QXEB 3EH1A 3SHWA 1YIJQ 1B34A 4OMNA 2H3EB 3EG9A 2A37A 2QDLA 1YIJA 2V8JA 1K73U 1OPKA 3LGFA 4UC4A 1M8MA 4FW2A 5KE2A 1OULA 2O2OA 4ZTFA 2F2XA 2VVKA 1ZUYA 2ZPIB 1NLOC 3CCJQ 1K8AU 2L3QA 1H641 3WXMB 1PSEA 1RI9A 3OY9A 2JUFA 1Z9ZA 1KK7A 3CCJA 1YJ9T 2K5LA 2I0NA 2LCLA 2KAFA 2MI6A 3CBPA 3EGDB 3CCET 1WHJA 3E2UA 4M7DA 2NWMA 1N6AA 2PUKB 4XAXB 2CUDA 4CC4B 4R0KA 1IXDA 1D09B 1M2OA 1XNIA 2C06A 1M1FA 1VQ9T 1FMVA 1K9MC 1YJWQ 1TOVA 1G3YA 5FU7B 5GAMg 2KRMA 1M30A 1I5OB 1YJWA 2RF0A 1S72Q 1PNJA 3FJ5A 1W70A 3RMQA 4C5IA 2ROLA 1S72A 2OJ2A 4M77B 2ENMA 2ED1A 3UATA 1D3BB 3J80E 1MNEA 2R57A 3CC7Q 4BUGA 1NPRA 3NTIA 2VGMA 3CC7A 2YSQA 4KH0B 4BI4A 5CR2A 4F7UA 1VQ8T 3EGXA 2YUNA 1AD5A 3GPLA 5GJVB 2KE9A 3VRYA 2DMOA 2G6FX 1RUWA 4DOWA 2AKKA 3H0HA 3C4SA 4FU6A 2M0YA 1M90U 2EFIA 5FU6B 4C92A 2LJ1A 3EHQA 3HRTA 3REAB 3UWNA 3OYBA 3PTAA 5IT9E 2GFAA 3VYGA 2CT3A 1BIAA 3MP8A 2HL3A 1NJIR 2L8DA 3CCSQ 3TSWA 1RABB 4CI0C 3VS3A 3H9NA 3G6ET 5FW9A 3OYEA 2RJFA 1UGQB 3OYCA 3CCSA 2E4HA 1N8RC 1WJQA 4QQGA 1VUBA 3L2UA 2B8AA 2HMAA 4JUVA 5GANh 4CRIA 1VQ7T 1JQQA 2KGTA 3FB9A 3META 1IZ6A 3ASKA 5CKBA 1U1SA 1U06A 1FWZA 5GAMd 2EJFA 4CC7A 4J6YA 3DKMA 1YHQT 1M2VA 4ELZC 1RLQC 3QO3A 3VS5A 4J9IA 3FLGA 1Z9QA 2LRQA 1WGSA 2GBQA 2YLCA 1LJOA 4JRQA 5M9OA 3JCMP 1Q7YC 1X2KA 2HKQB 1M27C 1EZZB 1H92A 1WZOA 2NUZA 4L59A 5LJ3h 3EFOA 3A8GB 1SG5A 3VKIA 5L8RE 3D7SB 1D1AA 2EW3A 4M7AG 4M7AE 2PTKA 1XOVA 1YITQ 3MEUA 1KQSS 1YITA 4EMKA 4BE1A 1JO8A 4XK8E 2DNUA 1X75C 1VQLQ 2VC8A 2K3XA 3CCUT 5IN1A 4MMLA 2K7AA 1VQLA 3VS7A 3QZ5B 1NPPA 2DXTA 4M77D 3LWIA 2FZGB 1YFNA 2CS7A 3M4GA 5GANf 1JJ2A 2Y90A 2M9UA 2E1HA 1I81A 4N0AA 4BY6C 4JS5A 2V8IA 2J6KA 1G8XA 1UHFA 1UFFA 1Q86C 2RJDA 1K1ZA 2PVGB 1WQ7A 4RTTA 1WJRA 2DTOA 2D0NA 3M53A 2E41A 3L2VA 1QKXA 3ZEHA 1FX7A 5LJ3f 4NL2A 5GAN4 4FSXA 3M4YA 1XTDA 3SWNA 2QDYB 4M4ZA 3SD4A 1H3HA 5D7UA 1C6VX 2JMAA 2COWA 3VUZA 4AFUC 3CXCS 3MEWA 4AG2C 3JCMV 3TQ7P 4A4FA 1OPLA 4II1A 1QLYA 3V7CA 3DB3A 2DILA 4M75A 4M77C 4J7FA 2HKNA 2V1QA 2O4XB 4WF2A 4F7UG 4F7UE 1ZQ1A 4IUTA 2RA2A 1M5Q1 5GMKl 2OTJQ 2LNVA 3JRZA 5FWCA 5A0DA 1MMDA 4TVRA 5LJ3e 2KRSA 1UG1A 2L2PA 1LVKA 2OTJA 1YWOA 5HKCA 1QWFA 3G71T 5CQYA 1K9MR 1B7TA 1VQKT 3OW2S 3V7SA 1PM3A 4FYYB 3OS1A 4PFOA 2E64A 3KBGA 4C92G 4MZTA 5HK0A 4KT0E 1D3BA 2MWPA 2KDSA 2W0ZA 4FCYA 2QGGA 5KYUB 1TU0B 3QKJA 3EG3A 4IURA 4AG1C 2AZSA 4RCBA 4IUVA 5GAOm 3CPWS 2D8HA 1QQJA 2MYSA 4WTOB 2CZ0B 2KROA 1Q95G 1SRLA 1X43A 2J6OA 3CCQT 2R58A 2RQTA 3QDFA 2YHTA 2PVDB 2DIGA 2ZPBB 3S6WA 3QWXX 5CCAA 1Y96B 1YJ9A 1MNDA 3QYGB 4LXCA 3NFCA 2EQKA 1H3ZA 1VYUA 1WJSA 5DY9A 2GQVA 4HCCA 2DTIA 1K73C 4ZGEB 2WSEE 4QT7A 4C8QD 4JJDA 3QJYA 3M59A 4ZN3A 2VGNA 3JB9H 1VQ9Q 1TWBA 4Z89A 3DB4A 1Q81U 1CSKA 4J9FA 3E19A 1K8AC 1E6HA 2RD1A 4BB7A 1VQ9A 1VQ4T 2J7IA 2DK3A 1KJWA 1ACMB 1UECA 3EG1A 5GAN5 1KG1A 1I5LA 1MMAA 3J7AF 2DEUA 2RHIA 1N8RR 3RKYA 1MHNA 4ATOA 2JJ9A 9ATCB 5GAOr 4KRTA 2LCSA 1D1BA 1BI2A 2R5AA 1QP3A 2LT4A 3S3NA 4LD6A 3TSZA 4AFSC 2HL5C 1U8RA 1GRIA 4JLIA 1H8KA 5KYXB 5FRMA 1NLPC 2DRMA 5GMKj 3MPUB 1Y0MA 4C8QC 3VJPA 2DPPB 2AK5A 2E5KA 2LQNA 3TEEA 1YNZA 2PZ1A 5GAOq 2HQEA 1KQSA 3G6EQ 3CCMQ 4M78F 1KQSP 3PMIA 2C0OA 1FMWA 2EVRA 3G6EA 2M0OA 2QYZA 5EG2A 1D0YA 2DL7A 1VQ7Q 2WSFE 4KUIA 2LQ8A 1AWOA 1VYTA 3ME9A 1VQ7A 2CSQA 2E65A 1M90C 2DM1A 1JEGA 1K4US 1YCSB 5GAMe 1YHQQ 3HRUA 3M0TA 2XKOC 1M1GA 1RAHB 3PIOA 2JT4A 4JRPA 2A28A 4JS4A 3KXTA 5CO7A 1SRMA 1BI0A 1YHQA 2QQSA 1MUZA 2CSIA 5ECAA 4ZTJA 2EKHA 2L0AA 1AZEA 2MAMA 3WVDB 3C95A 2YWWA 1MGQA 1YN8A 4E7ZA 1A0NB 1Q86R 2RHXA 3MP6A 2J6FA 4PLLA 3S3OA 1TS9A 5GJWB 5CK9A 2D8JA 2VASA 2ZZDA 3LX7A 3QG1A 3VS6A 4M77G 2RO0A 4M77E 3EG2A 1W6XA 1Y7XA 2KVQG 8AT1B 1QVPA 4GLKA 1T0JA 2LX7A 1NEBA 3I5SA 1PRLC 2O4XA 2ZAEA 3CCUQ 1TTHB 1UE9A 5A0LA 4MMKA 1UGSB 4RMOA 1G3TA 3CXCA 3A8LB 1I8FA 1K0SA 3CCUA 4OF1A 4J6XA 3CXCP 1JJ2S 2K57A 2X4WA 3EHRA 2PVOB 4B6MA 4XU1A 3BW1A 5KH6A 1GCQA 1N5ZA 4N4GA 4OP0A 5CKFA 1X69A 1G3WA 3MO8A 1PKTA 4XTZA 5KYUA 1ZHIA 1HK9A 1WX6A 3UT1A 2HAXA 1U5SA 1SHGA 2XICA 2DL5A 3JCMX 1SSFA 4PJJA 2LMJA 3QWYA 3OW2A 3MJXA 2X3WD 2E3IA 2LX9A 3OW2P 4HT8A 3OYLA 1IB8A 2KYMA 4XTYA 4GLMA 3QPHA 3JV3A 2DIQA 1PCXA 1OU8A 2CT4A 4BE2A 3ZBDA 2JOYA 2LVMA 1I0CA 3NGPA 3CPWA 3VYHB 4GBQA 4C0FA 1Y96A 3CPWP 2DL8A 2SEMA 4D6WA 2EJGA 4BY6B 3A8HB 2D0QB 2IG0A 3ZL7C 1AEYA 2BZXA 2KI7A 5DM7R 2K4YA 3A1PA 4PJLA 4OB3B 3MEAA 5IHNA 2FB7A 1ZSZB 3CCVT 1KC8U 1K73R 4C8QF 2VXFA 1RL2A 3CC2T 5GMKi 5IXFA 2LJ0A 4E2FB 3G71Q 4FT2A 1BIBA 2NUPB 3VS0A 4X34A 1AZGB 1VQKQ 1SF9A 1K8AR 4C0ZA 1HYOA 3G71A 2XK0A 5AT1B 4M78B 1VQKA 4LUEA 4X9CA 4EMHA 1KQ2A 2NUTA 3V8LA 5CKEA 2FPFA 2O9VA 1BBZA 1I07A 2VKNA 5KCHA 2FL7A 2DXCA 1PKSA 4E7LA 3JCMd 4MZMA 2GGRA 1R0BG 1JBMA 4DBQA 5D6WA 1XQHA 1YJNT 1X2QA 1WHKA 3M57A 3GBQA 1NZ9A 3A8MB 4E7SA 3CCQQ 5GAOl 5KYXA 1CKBA 5GAN2 4PJNA 2LTOA 3CCQA 1VIEA 2FYKA 4DOVA 4EDUA 1VOMA 1T3LA 2X4YA 2EIFA 5C6SA 2PNIA 2F2WA 1YI2T 1ABOA 2XI9A 1BCOA 4KGVB 2BKDN 3OYKA 2X51A 4PJOD 4HVUA 5GAOn 4HVVA 4JZ4A 3R6NA 3EFSA 1GFCA 4A4EA 1VQ4Q 3PNWC 4C0DC 5LJ5g 4LE9A 3CCMT 2Z0WA 1VQ4A 2DRKA 4OMMA 2DZCA 1RAAB 2XDPA 1WHHA 4ME7A 4Y91A 5GAN7 1UUEA 2KMTA 4E47A 2CREA 4NS5A 1AHJB 4C5HA 2X3XD 2RHYA 5HY6A 4BI8B 1M90R 2PQWA 1Q81C 2MK5A 2COZA 2YT6A 4O6JA 2CP6A 2ATCB 3NTKA 1C0MA 5KE3A 2LNHB 2X4JA 1U3OA 4DEYA 4RTVA 4J9DA 1VYVA 1WHMA 2OX7A 3I9QA 4BI3A 2B86A 4BE0A 4RUGA 3OS2A 4J5YA 1VQPT 1NE8A 4J8OA 1UTIA 3I56Q 3QIIA 2LP5A 3CCRQ 3OYNA 2KQWA 4PJOC 2W10A 4OMOA 3I56A 3HP9A 4D8KA 3PGGA 4M78D 2XDDA 2EBPA 2JTEA 2QQRA 3JCMb 4A53A 4N4IA 1X6OA 1WHLA 1C1AA 2HQHA 2SRCA 3QBYA 2JN0A 2EYWA 1AVZC 1X6BA 2Y4YA 1QMCA 3T9NA 2NYSA 2P0PA 3UA7A 4PFPA 4FL6A 1F1BB 1JJ2P 4C8QB 4Y28E 2DVJA 2JM9A 1IHVA 5LJ5d 4R55A 3M0RA 2EYZA 2JM8A 3A5ZB 6AT1B 3OYHA 2CZ7B 1JU5C 3LW5E 1M8VA 2C0TA 5GANj 2GQIA 1SKUB 1TXQA 2KR3A 4EMGA 1LOJA 3P8BB 1UGVA 1N9RA 1SSHA 2RQVA 2ABLA 1ZSZC 2RQRA 4O5VA 3F70A 2XG8D 3O5ZA 3VS2A 3EGDA 2BUDA 4OMFB 4HVWA 2FPDA 4MDWA 4M78C 2XHCA 4XQ3A 5LJ3j 2O9SA 4RTUA 3FEOA 3JCMW 4DBHA 3BY7A 3SDZA 1G5VA 2EPDA 5A0GA 1PD1A 1R0CB 4XU3A 1RAFB 3C12A 4NOYA 4J7IA 1S1NA 3P8DA 3NTHA 1RLPC 3HSBA 1GFDA 4A4HA 2K2MA 4DBRA 1OV3A 1AOJA 3FIFA 1KSWA 1BKBA 3OB9A 2M1HA 4M77A 1W1FA 3GOXA 1ZSGA 2ZGWA 3J81E 1MV0B 1KD1U 2LC4A 3ULRB 2FZCB 3M55A 1M3AA 2ROTA 1UJ0A 3KFVA 2MOXA 3LH5A 3L1AA 3TCJA 3L2WA 3OSVA 3OYGA 4HCKA 4OB0B 1G3SA 4Z88A 5L23A 2COYA 2IVWA 4XU2A 3JB9F 3GF5A
chains in the Genus database with same CATH topology
5GAMh 4PJOA 3PIPA 2EQJA 3PT9A 2VUBA 2JTFA 4J83A 1YJWA 4KBMB 1DJ7B 2RHXA 1KHIA 3MP6A 4PLLA 1GXIE 3S3OA 4R56A 4IUQA 1YBYA 4N0AC 5CK9A 3RESA 3EFRA 3M56A 3L2QA 3CCLA 2YRVA 4A54A 4MDXA 3RMQA 2RI2A 1OYXA 2ZZDA 3LX7A 4L6V5 4C5IA 3CMEA 1P92A 3PFSA 5C0MA 4BDYA 4E7HA 1S72A 3QG1A 2DD5A 3M5AA 3BDLA 4GY5A 3CCVA 4M77B 4M77G 4PJOF 3SB2A 2RO0A 4M77E 4OB1B 3QYHB 1Y7XA 1VQNT 1D3BB 3J80E 4Z02A 3CC2A 2KVQG 2R57A 1QVFS 1QVPA 2DXBA 4GLKA 4XTXA 4BUGA 3L2ZA 1NPRA 3CBMA 3JSCA 1WPYA 4A4GA 3QZ9B 2FHDA 3HL8A 3NTIA 2E6ZA 2VGMA 3HKSA 2QEXA 2DXUA 4HT9A 3CC7A 2O4XA 3H6ZA 4ELYC 3C94A 4BI4A 5CR2A 4F7UA 3CD6A 5I21A 1VQ8T 4M7DG 4M7DE 5A0LA 1VQMT 4MMKA 1UGSB 5J39A 1G3TA 4RMOA 3A8LB 3CXCA 3GPLA 1I8FA 4N4HA 2JZ2A 3QJ6A 3RMSA 3CCUA 2RJEA 4OF1A 1W2BS 1M1KU 2F69A 4J6XA 2Y4XA 3SWNC 3G7ZA 1QVGS 2K57A 2X4WA 1JJ2S 3G4ST 1Q82C 2PVOB 3E1SA 3R6OA 1KC8C 4FIBA 2AHJB 4XU1A 5GAN3 2DJZA 4DOWA 3GF5A 1YIJT 4F7UF 3BW1A 2MWOA 2EQUA 5KH6A 3C4SA 4FU6A 2KK4A 1M90U 2EFIA 4OP0A 4N4GA 5FU6B 4C92A 5CKFA 1IREB 3HRTA 3UWNA 3HHTB 3OYBA 3PTAA 1YJNA 1G3WA 4QVZA 3MO8A 3PMTA 4XTZA 4PJOE 5IT9E 2GFAA 3CBOA 3VYGA 1ZHIA 4M75C 1BI3A 1BIAA 3BDUA 4B9WA 1HK9A 3MP8A 3UT1A 3JCMh 5GANe 2HAXA 2XICA 2L8DA 3MP1A 5FU7C 3CCJT 1K9MU 3JCMX 1QW1A 1SSFA 4CI0C 2L5QA 2K2VA 2F5TX 3G6ET 3OW2A 4C92F 3OYEA 2RJFA 2K5IA 4DQ2A 1UGQB 5GAMf 3VUBA 5LJ5h 3OYCA 3UDCA 3GP8A 2I2LA 2LX9A 3CCSA 3S3MA 1N8RC 1WJQA 1RI0A 2KY9A 2PU9B 4JJNK 4QQGA 1VUBA 3OYLA 4HT8A 4IKFA 4M78A 5GANg 3I56T 3L2UA 4XTYA 5FLXE 2B8AA 3QPHA 4JUVA 5GANh 3CCRT 2DIQA 2QQBA 2X4XA 4CRIA 4BE2A 3ZBDA 2LQKA 2JOYA 4L5GA 1VQ7T 3CEYA 2LVMA 4IUUA 1YI2A 1TH7A 3FB9A 3META 3CPWA 1IZ6A 1VQ5A 3ASKA 1EIFA 1U1SA 5CKBA 1FWZA 5GAMd 2EJFA 3LH0A 2X35A 4J6YA 1Y96A 3VYHB 4C0FA 2V8KA 1VQ6A 3DKMA 1YHQT 4RG2A 4D6WA 2EJGA 4E7JA 4BY6B 4ELZC 3QO3A 1M4ZA 3FLGA 3A8HB 2LRQA 1WGSA 4ZN1A 2D0QB 3JCMc 2DVEA 2IG0A 2YLCA 4C8QA 1LJOA 3CCMA 2P0QA 1YJWT 4M75F 4JRQA 3FRNA 5M9OA 3JCMP 1Q7YC 1X01A 2HQXA 3LWHA 5DM7R 2K4YA 3HPWA 4QVCA 3CCLT 4L59A 5I2MA 5LJ3h 4C0GA 5D6XA 4C92E 3CMET 1Q82U 3A8GB 4OB3B 1S72T 3MEAA 3VKIA 5L8RE 2FB7A 3CCVT 1KC8U 4C8QF 2RI5A 4M7AB 2VXFA 4M7AG 4M7AE 1RL2A 4M7AD 3CC2T 3EAEA 2G3RA 1XOVA 5GMKi 5FU6C 2DO3A 3FJPA 3OYMA 1FXXA 3MEUA 1UGPB 4FM4B 4FT2A 1BIBA 2QEXT 1B34B 4HA8A 3HRSA 1KQSS 1WQWA 4LDYA 4X34A 5GMKh 2RJCA 4EMKA 3JCMJ 1YITA 3CC7T 4BE1A 4XK8E 3CPFA 4C0DB 1X75C 2EJ9A 2WSCE 4C0ZA 3CD6T 3G71A 2XK0A 2VC8A 5I2SA 2ZPEB 2K3XA 4M78B 4M78G 4JRKA 4KULA 4M78E 1VQKA 4X9CA 3CCUT 4EMHA 2K3YA 5IN1A 3JCMf 4MMLA 3OS0A 1KQ2A 3JB9J 3V8LA 5CKEA 1VQLA 3OBWA 4QQDA 3RKWA 3QZ5B 2NLUA 5J26A 1NPPA 5KCHA 2DXTA 1M9SA 1JB0E 2EKOA 2FL7A 4OVAA 1BI1A 1N8RU 2DXCA 3Q1JA 4M77D 5LJ5f 3LWIA 1VQPA 2HD0A 5CIUA 4DA4A 2XD0A 1Y71A 2E5QA 4E7LA 3JCMd 2VV5A 4MZMA 3VU3C 2CS7A 1JBMA 3M4GA 5GANf 3CCEA 1JJ2A 5D6WA 1XQHA 1YJNT 3MCAB 3M57A 3OMCA 5DLOA 2Y90A 2M9UA 4RCCA 3MEVA 1NZ9A 3A8MB 2E1HA 1HXDA 1I81A 5GAOl 4M7DB 4N0AA 3N5BB 4BY6C 4JS5A 4M7DD 2V8IA 5GAN2 1R8OB 2LTOA 5CKHA 1O75A 3TU4K 4PKCC 5FROA 3CCQA 4QQ6A 1VIEA 2FYKA 4DOVA 3I55A 3JB9G 4EDUA 5GANd 2JVVA 1Q86C 2EAYA 4PLIA 2RJDA 2PVGB 2EQMA 1Y07A 1WQ7A 2CZ6B 1WJRA 3GNGA 4C5EA 4C5GA 3CCST 2HBPA 2QA4A 2X4YA 2DTOA 2EIFA 1VQOA 1Q7YU 3GLXA 2EYQA 3M53A 5AYFA 2E41A 2A7YA 3JCMe 3L2VA 2DAQA 5C6SA 3ZEHA 1VIFA 2RK2A 2BIVA 4XTWA 3INZA 3M58A 3HFNA 3FC3A 3OS5A 1YI2T 1FX7A 2OAUA 3X20B 2XI9A 5LJ3f 2R5MA 3OYKA 2BKDN 1VQ5T 4PJOB 4NL2A 4PJOG 5LJ5e 4PJOD 5GAOn 4M7AC 5GAN4 1VQ6T 4FSXA 3M4YA 1XTDA 3M54A 1QP2A 1UGRB 4J6WA 5LL6S 3JCMg 3EFSA 3SWNA 2QDYB 2K5FA 4A4EA 3SD4A 3P8HA 3OYYA 4BDZA 2E12A 3PNWC 2QQ9A 3VUZA 1V29B 4BD3A 4C0DC 5LJ5g 3CXCS 3MEWA 3CCMT 2P0KA 3OA6A 4E7KA 4RG8A 1VQ4A 3O8VA 4Q5WA 3JAME 5GAN6 2DZCA 3JCMV 2RI3A 4A4FA 4FT4A 4II1A 3HFOA 5IAYA 2XDPA 3V7CA 3A8OB 1VQ8A 3OSSC 3DB3A 4ME7A 2DTHA 2HNIA 3OMGA 4Y91A 5GAN7 2KMTA 3QHSA 3JB9I 4M75A 4E47A 4M77C 4J7FA 4WF2A 2O4XB 4NS5A 4LD9K 1AHJB 4F7UB 4C5HA 4F7UG 4F7UE 2GF7A 1ZQ1A 2RHYA 3L2RA 4IUTA 2RA2A 1M5Q1 2RHUA 2VXEA 5HY6A 5GMKl 3AHUA 4BI8B 2LNVA 3JRZA 5GAMj 2VYTA 5A0DA 1OZ2A 2DD4A 2L3RA 2PQWA 2QXFA 1KHCA 4TVRA 5LJ3e 5GAN8 1Q81C 4ZGJB 4LDVA 2OTJA 3RIRA 1YITT 4QW2A 4O6JA 4M7DC 5HKCA 1JRIA 2MF2A 3NTKA 4HCBA 2LT1A 2QTXA 5CQYA 5KCOA 3G71T 2YLBA 1NJIC 3H8ZA 1N9SA 1VQKT 5KE3A 3OW2S 3V7SA 3VV0A 2X4JA 5LJ3g 5DLQE 2F5KA 4NL3A 3OS1A 2E64A 3KBGA 1VQLT 4C92B 4C92G 3URGA 4MZTA 4C92D 5GMKe 1W4SA 1Q86U 2ZPGB 4KT0E 1D3BA 5HK0A 2E70A 2KDSA 2MWPA 2RH2A 4BI3A 4BE0A 1OI1A 1U1TA 3QKJA 3OS2A 4IURA 4J5YA 1VQPT 2D9TA 4RCBA 1NE8A 3QUIA 4IUVA 4J8OA 3SWNB 2XIDA 5GAOm 3CPWS 3QIIA 4P5NA 1LNXA 1WNLA 3OYNA 3OYFA 1O9SA 1I4K1 2KQWA 4E7IA 4PJOC 2LDMA 4M77F 3V7RA 2CZ0B 3I56A 3HP9A 2QQAA 3X28B 3LYIA 3ZFJA 5A2QE 2CYZB 3TREA 2L89A 3PGGA 3X25B 2A3LA 2ZCFB 4M78D 1QVFA 4HKEA 3CCQT 3I55T 3E9GA 3RUXA 2R58A 2QQRA 2XDDA 2RK1A 3JCMb 4JRIA 4OB2B 4A53A 4N4IA 4BACA 2GCXA 1X6OA 2YHTA 3E9FA 2PVDB 4M75B 2DIGA 2ZPBB 4M75G 4M75E 3S6WA 5GAOp 3CC4A 3OYIA 2QA4T 1VQOT 4OGCA 3V8JA 2M16A 5CCAA 1Y96B 2CKKA 1YJ9A 3QBYA 3RERA 2JN0A 3QYGB 4PNOA 3NFCA 1W2BA 2EQKA 2Y4YA 3GIBA 4HCZA 5CKDA 1H3ZA 1WJSA 3GNFB 4OGEA 5DY9A 2P0PA 3T9NA 1QVGA 2GQVA 4PL6A 4HCCA 4FL6A 2DTIA 2CZ1B 1K73C 4ZGEB 2OTLA 2WSEE 4B9XA 4C8QB 4C8QG 3CMAA 4Y28E 4C8QE 4C8QD 3QSUA 3DLLA 2DEQA 3QJYA 3M59A 4ZN3A 4RKUE 3OYAA 2VGNA 3M9QA 5LJ5d 4R55A 3X24B 1OZ3A 3JB9H 4EPCA 2CGHA 3DB4A 2E6NA 1Q81U 5LJ5j 2JTMA 4KUDK 3JB9D 3A5ZB 3E19A 1K8AC 3OBYA 2QI2A 2E10A 2RD1A 3OYHA 1PSFA 2CZ7B 5CAIA 1ZBXA 4BB7A 3LW5E 1VQ9A 1KD1C 1M8VA 2KSSA 1VQ4T 5GANj 2DK3A 2JNGA 3FDRA 2DKGA 3RKXA 1NJIU 4XU0A 4ZGDB 4LDUA 5J3BA 2DZ9A 2EWNA 2FVUA 3LLRA 4C92C 4EMGA 4X9DA 1LOJA 5GMKm 3P8BB 5GAN5 1N9RA 1KG1A 1I5LA 3OYDA 3J7AF 2LCCA 2RHIA 1KQ1A 3F70A 4O5VA 4EMKB 3RKYA 2XG8D 3OYJA 1MHNA 1BYMA 4ATOA 3BFMA 1UEBA 5GAOr 3L42A 2P4TA 2BUDA 4OMFB 2OTJT 5LJ3d 1BI2A 1VQNA 2R5AA 4XTUA 5CVIA 4MDWA 4XTVA 4M78C 4A4KA 2D6FA 2XHCA 4XQ3A 1UB4A 1QP3A 5D6YA 3FEOA 5LJ3j 3JCMW 2LT4A 4JLGA 3S3NA 3SFMA 3BY7A 4JDSA 4LD6A 3SDZA 5A0GA 1G5VA 3KUFA 3V8KA 4M7AA 1VQMA 2ZPHB 1U8RA 4XU3A 4JLIA 2ZPFB 4MZPA 2XDBA 3C12A 4NOYA 4J7IA 1YCYA 3QXEB 3LGLA 3P8DA 1B34A 3G4SA 2GFUA 5FRMA 1N27A 3NTHA 3OQ5A 5GMKj 3ER0A 4YTLA 3HSBA 4VUBA 3X26B 3DLMA 4C8QC 1YIJA 2WACA 3VJPA 2DPPB 2V8JA 4A4HA 1K73U 3LGFA 4UC4A 4M7AF 3FIFA 2RB6A 3TEEA 5KE2A 1BKBA 3OB9A 4ZTFA 4V2SA 2M1HA 2PUOB 5GAOq 2ZPIB 2HQEA 4M77A 1K8AU 3GOXA 3MHXA 1H641 3WXMB 2ZGWA 1KQSA 1PSEA 3JCMQ 3J81E 3CC4T 3OY9A 2JUFA 1KD1U 4M78F 2RM4A 5HK3A 1M1KC 3CCJA 1YJ9T 2K5LA 2MMPA 3PMIA 2LC4A 2LCLA 2KAFA 3G6EA 3M55A 2M0OA 2MI6A 3CBPA 5EG2A 3CCET 3UPUA 4M7DA 4EMKC 2WSFE 4KUIA 2OTLT 1N6AA 2LQ8A 2O01E 3CMAT 3L1AA 3ME9A 3CCRA 2PUKB 4XAXB 3QDRB 2E65A 1VQ7A 1M90C 2XU8A 3TCJA 3L2WA 5GAMe 3OSVA 3HRUA 2XKOC 1M1GA 4LDXA 3PIOA 4JRPA 2H3JA 4JS4A 3KXTA 3OYGA 5CO7A 5CQXA 1BI0A 3WVEB 1XNIA 2QQSA 1YHQA 2C06A 4M7DF 1M1FA 4ZTJA 1VQ9T 4LDWA 4M75D 4OB0B 1G3SA 2MAMA 4IUPA 1K9MC 2RHZA 5FRNA 2IVWA 4XU2A 1G3YA 5FU7B 3WVDB 5GAMg 3JB9F 4QVDA 3C95A 1MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM h;  4PJO A;  4M75 F;  5GAN 6;  2DZ9 A;  2DZC A;  2EWN A;  3JCM V;  3JCM P;  1X01 A;  4C92 C;  4EMG A;  4X9D A;  1LOJ A;  3HFO A;  5GMK m;  5GAN 5;  1N9R A;  1I5L A;  3V7C A;  4N0A C;  2DTH A;  2HNI A;  4Y91 A;  4QVC A;  4QVD A;  3QHS A;  1KQ1 A;  5LJ3 h;  4EMK B;  3RES A;  3EFR A;  4M75 A;  3RKY A;  4C92 E;  4M77 C;  4WF2 A;  4A54 A;  4F7U B;  4F7U G;  2FB7 A;  4F7U E;  3BFM A;  2RA2 A;  1M5Q 1;  2VXE A;  4C8Q F;  5GMK l;  4M7A B;  2VXF A;  4M77 B;  4M77 G;  4PJO F;  3SB2 A;  4M77 E;  5GAM j;  5GAO r;  4M7A G;  5GMK i;  4M7A E;  4M7A D;  5LJ3 e;  5GAN 8;  1D3B B;  4XU0 A;  3FJP A;  5LJ3 d;  4XTX A;  3RIR A;  1BIB A;  3L2Z A;  1B34 B;  4XTU A;  4HA8 A;  4M7D C;  1WQW A;  4XTV A;  1JRI A;  1WPY A;  4M78 C;  4EMK A;  4XQ3 A;  5GMK h;  5LJ3 j;  3JCM J;  2QTX A;  3JCM W;  2DXU A;  2EJ9 A;  2YLB A;  4F7U A;  1N9S A;  2VC8 A;  3BY7 A;  5I21 A;  4M7D G;  4M7D E;  4M78 B;  4M78 G;  4JRK A;  3V7S A;  4M78 E;  4MMK A;  5LJ3 g;  4NL3 A;  4X9C A;  5GAN 7;  3V8K A;  4EMH A;  1KQ2 A;  2E64 A;  1I8F A;  4MML A;  3JCM f;  4C92 B;  4C92 G;  4M7A A;  3JB9 J;  4XU3 A;  4C92 D;  3V8L A;  4JLI A;  5GMK e;  1D3B A;  4J6X A;  3SWN C;  2K57 A;  4NOY A;  3RKW A;  1YCY A;  1U1T A;  2DXT A;  1B34 A;  4J5Y A;  4RCB A;  3QUI A;  4M77 D;  3SWN B;  5GMK j;  5LJ5 f;  5GAO m;  4XU1 A;  5GAN 3;  3HSB A;  2DJZ A;  1LNX A;  1WNL A;  3BW1 A;  4F7U F;  4C8Q C;  1I4K 1;  3JCM d;  3AHU A;  3VU3 C;  4PJO C;  1JBM A;  3M4G A;  5GAN f;  4M7A F;  4M77 F;  3V7R A;  4OP0 A;  3FIF A;  4C92 A;  2RB6 A;  2Y90 A;  4RCC A;  3JB9 I;  4XTZ A;  2E1H A;  4V2S A;  1HXD A;  1I81 A;  5GAO l;  4PJO E;  4M7D B;  4N0A A;  5GAO q;  4M7D D;  3PGG A;  4M75 C;  1BIA A;  4M78 D;  3BDU A;  5GAN 2;  4M77 A;  1HK9 A;  3RUX A;  3JCM b;  1H64 1;  4JRI A;  3JCM h;  2ZGW A;  4A53 A;  5GAN e;  2FYK A;  3JCM Q;  3JB9 G;  2YHT A;  5GAN d;  4M75 B;  4M75 G;  3JCM X;  5GAO p;  4M75 E;  4M78 F;  2EAY A;  2RM4 A;  1WQ7 A;  3V8J A;  1Y96 B;  3RER A;  4C92 F;  2JN0 A;  2DTO A;  4PNO A;  4DQ2 A;  5GAM f;  5LJ5 h;  4HT9 A;  2I2L A;  2E41 A;  3JCM e;  3GIB A;  4HT8 A;  4M7D A;  5DY9 A;  4M78 A;  4EMK C;  5GAN g;  4XTW A;  4XTY A;  3INZ A;  4JUV A;  5GAN h;  3HFN A;  3L1A A;  2DTI A;  5LJ3 f;  4C8Q B;  4C8Q G;  2E65 A;  3QSU A;  1TH7 A;  4C8Q D;  3FB9 A;  4NL2 A;  4PJO G;  2DEQ A;  4C8Q E;  5LJ5 e;  4PJO B;  5GAO n;  4M7A C;  5GAM e;  5GAN 4;  4PJO D;  5LJ5 d;  1U1S A;  4J6W A;  5GAM d;  2EJF A;  3JB9 H;  4J6Y A;  1Y96 A;  3JCM g;  3EFS A;  3SWN A;  2CGH A;  2EJG A;  5LJ5 j;  3JB9 D;  3QO3 A;  4M7D F;  4M75 D;  2E10 A;  2RD1 A;  5CAI A;  1M8V A;  5LJ5 g;  5GAN j;  4XU2 A;  3JCM c;  5GAM g;  2DVE A;  3JB9 F;  2DKG A;  3RKX A;  4C8Q A;  2YLC A;  1MGQ A;  1LJO A; 
#chains in the Genus database with same CATH topology
 5GAM h;  3PIP A;  1JXM A;  1JXO A;  2VUB A;  4J83 A;  4KBM B;  1DJ7 B;  1KHI A;  1GXI E;  5KYN A;  2KEA A;  3CCV Q;  3RES A;  3EFR A;  3M56 A;  3L2Q A;  4A54 A;  2CP2 A;  4L6V 5;  4BDY A;  3CC2 Q;  1P92 A;  3CCV A;  4PJO F;  3SB2 A;  3QYH B;  3CC2 A;  4Z02 A;  1TUC A;  3L2Z A;  4DBF A;  3CBM A;  2ECZ A;  4A4G A;  1MV3 A;  3HL8 A;  5IHK A;  2E6Z A;  3HKS A;  3H6Z A;  4ELY C;  3C94 A;  4N4H A;  3RMS A;  3QJ6 A;  1W2B S;  2DF6 A;  1M1K U;  1VQO Q;  4WCI A;  2Y4X A;  3G7Z A;  1QVG S;  2M02 A;  3G4S T;  2H8H A;  3E1S A;  2RQU A;  4F04 B;  1KC8 C;  4FIB A;  3EGU A;  2DJZ A;  1YJN Q;  2EQU A;  4AFZ C;  4F17 A;  3AT1 B;  1YJN A;  1Q81 R;  3PMT A;  4PJO E;  1IGQ A;  1T3S A;  3CBO A;  1GBR A;  4B9W A;  1TG0 A;  2IPO B;  1Q7Y R;  2KRN A;  1VA7 A;  1QCN A;  2CUB A;  2K2V A;  2F5T X;  1WHG A;  2K5I A;  1LPL A;  4DQ2 A;  5GAM f;  3VUB A;  5LJ5 h;  3UDC A;  1YI2 Q;  2PU9 B;  4IKF A;  1D0X A;  5GAN g;  3I56 T;  2K9G A;  4AFQ C;  3CCR T;  2QQB A;  2X4X A;  2J06 A;  3CEY A;  1YI2 A;  1FMK A;  1TH7 A;  2EQI A;  1EIF A;  3LH0 A;  2X35 A;  2V8K A;  4FYV B;  4LNP A;  1K9A A;  1QCO A;  2BZY A;  4Y92 A;  3JCM c;  2DVE A;  4C8Q A;  3CCM A;  4M75 F;  2F2V A;  4KH1 B;  4J9G A;  3HPW A;  3CCL T;  5I2M A;  5D6X A;  3NMZ C;  2DBM A;  3CME T;  1TUD A;  1Q82 U;  1PRM C;  1RAC B;  2RI5 A;  2QTV A;  1GCP A;  1CKA A;  4M7A D;  3EAE A;  1PG5 B;  1PWT A;  2QG9 B;  3FJP A;  3OYM A;  1FXX A;  1UGP B;  4AT1 B;  5KYW B;  2QEX T;  2DYB A;  1WQW A;  2HDA A;  4LDY A;  2RJC A;  3CPF A;  4C0D B;  3CD6 T;  2WSC E;  2ZPE B;  2YDL A;  4M78 G;  4KUL A;  4M78 E;  3CC4 Q;  3TVT A;  2CP5 A;  2K3Y A;  3OS0 A;  1HD3 A;  2A08 A;  3OBW A;  1SPK A;  1VQP Q;  3RKW A;  1M9S A;  1JB0 E;  1BI1 A;  2JW4 A;  5LJ5 f;  3Q1J A;  1VQP A;  2XD0 A;  1PC0 A;  2E5Q A;  3C0C A;  3OMC A;  5DLO A;  3MEV A;  4OMP A;  4A63 B;  1HXD A;  3N5B B;  4M7D D;  4F16 A;  1AWJ A;  3TU4 K;  5FRO A;  2CH4 W;  5GAN d;  3VS4 A;  2EAY A;  4PLI A;  1XJW B;  1Y07 A;  2DFU A;  2CZ6 B;  2X9H A;  1B07 A;  4RTZ A;  4C5G A;  1WXU A;  3GLX A;  5AYF A;  2YUP A;  2A7Y A;  2GTJ A;  2DAQ A;  1KIK A;  2BIV A;  4XTW A;  3M0U A;  3INZ A;  4J9H A;  3FC3 A;  2OAU A;  1E7O A;  2DER A;  1HSQ A;  2R5M A;  1VQ5 T;  4PJO B;  5LJ5 e;  4M7A C;  2EGC A;  1VQ6 T;  1QP2 A;  1UGR B;  4J6W A;  2D1X A;  4CC3 A;  3JCM g;  1ZA2 B;  3P8H A;  3OYY A;  4BDZ A;  2E12 A;  2RQW A;  1V29 B;  4BD3 A;  2A0F B;  3PE0 A;  4E7K A;  2P0K A;  3OA6 A;  3O8V A;  4Q5W A;  2RI3 A;  4DEX A;  2BE7 D;  3RR6 A;  3PVQ A;  2DTH A;  2HNI A;  3OMG A;  1IRX A;  1ARK A;  3QHS A;  3NPF A;  3L2R A;  3BE3 A;  1OZ2 A;  2DD4 A;  5GAN 8;  1OX9 A;  4ZGJ B;  4LDV A;  4RTY A;  4QW2 A;  1J3T A;  4M7D C;  1JRI A;  2MF2 A;  1NM7 A;  4FYW B;  2QTX A;  2YLB A;  1D1C A;  1OEB A;  3G1J A;  3VV0 A;  4NL3 A;  3I5R A;  4C92 D;  2RH2 A;  1U1T A;  1ZUU A;  2D9T A;  3QUI A;  3SWN B;  2ESW A;  2XID A;  1WNL A;  3NHN A;  1O9S A;  2LDM A;  4RTW A;  3ZFJ A;  5A2Q E;  2JS0 A;  2L89 A;  2ZCF B;  3I55 T;  4M75 B;  4ZNX A;  5GAO p;  2V26 A;  2QA4 T;  1VQO T;  1BK2 A;  1WFW A;  4PNO A;  2KNB B;  1WLP B;  3CQT A;  4KGZ B;  1W2B A;  5CKD A;  3RNJ A;  3GNF B;  4OGE A;  1QVG A;  1W2B P;  4PL6 A;  2CZ1 B;  1KC8 R;  2KXD A;  1QVG P;  4C8Q G;  3U23 A;  4C8Q E;  4F14 A;  3QSU A;  3DLL A;  2DEQ A;  4E6R A;  2AKL A;  4RKU E;  3OYA A;  2JXB A;  1SHF A;  3X24 B;  2MIO A;  2AIR B;  4KUD K;  3JB9 D;  2QI2 A;  4ORZ A;  2FRW A;  2E10 A;  1PSF A;  1UHC A;  5CAI A;  1ZBX A;  1KD1 C;  1QCF A;  3FDR A;  1NJI U;  2OI3 A;  4LDU A;  2DZ9 A;  2EWN A;  3I35 A;  2V1R A;  3LLR A;  4C92 C;  2HSP A;  4X9D A;  2L3P A;  3IQL A;  1GBQ A;  2LCC A;  2M51 A;  4FSS A;  5KYY B;  3BFM A;  1UEB A;  2HZY A;  3L42 A;  2P4T A;  4KGX B;  3UF4 A;  4OML A;  2RMO A;  4J9B A;  4JLG A;  2BE9 B;  2VB6 A;  2ZPH B;  3G4S Q;  3RBB B;  2C0I A;  4MZP A;  1M3C A;  1OX8 A;  1YCY A;  1V1C A;  5KYW A;  3LGL A;  3G4S A;  2GFU A;  1N27 A;  3OQ5 A;  4Z8A A;  3ER0 A;  4YTL A;  4VUB A;  3H41 A;  3X26 B;  3DLM A;  2WAC A;  4M7A F;  1AWW A;  2RB6 A;  3SEM A;  4V2S A;  2PUO B;  1WXB A;  4FW1 A;  1V76 A;  3MHX A;  3JCM Q;  3CC4 T;  4QKU A;  4OMQ A;  2RM4 A;  2KT1 A;  5HK3 A;  1M1K C;  2A36 A;  2MMP A;  1WI7 A;  2YXY A;  4PFZ A;  3THK A;  1MMG A;  3RDV A;  1Y57 A;  3UPU A;  1NYF A;  1I1J A;  4EMK C;  2OTL T;  2O01 E;  3CMA T;  3CCR A;  3QDR B;  4X1V A;  2XU8 A;  1OU9 A;  3VS1 A;  4LDX A;  2P84 A;  2H3J A;  5CQX A;  2YUQ A;  3WVE B;  4M7D F;  2E3H A;  4LDW A;  4M75 D;  4IUP A;  2RHZ A;  5FRN A;  2EGE A;  2GTO A;  2ED0 A;  4QVD A;  4PJO A;  1WYX A;  2EQJ A;  3PT9 A;  1T0H A;  2JTF A;  3CCL Q;  1WDX A;  2K6D A;  4R56 A;  3EG0 A;  3CME Q;  2RNA A;  4IUQ A;  1YBY A;  4N0A C;  1AT1 B;  3CCL A;  1NG2 A;  2OAW A;  2YRV A;  4MDX A;  1K0X A;  2RI2 A;  1OYX A;  2HCK A;  3CME A;  4E7H A;  3PFS A;  5C0M A;  3EH2 A;  2DD5 A;  3M5A A;  3BDL A;  4GY5 A;  4D8D A;  2IIM A;  4OB1 B;  3A98 A;  2QEX Q;  1VQN T;  1HJD A;  1QVF S;  2DXB A;  2MCN A;  4XTX A;  3CD6 Q;  3JSC A;  1WPY A;  2RN8 A;  3QZ9 B;  2FHD A;  2QEX A;  3UA6 A;  2DXU A;  1NYG A;  2DX1 A;  2FO0 A;  3CD6 A;  5I21 A;  4M7D G;  4M7D E;  1VQM T;  5J39 A;  1R77 A;  1FYN A;  1UDL A;  2JZ2 A;  2FPE A;  2RJE A;  3HTR A;  2F69 A;  3SWN C;  2CP0 A;  1MMN A;  1Q82 C;  4LN2 A;  3R6O A;  2AHJ B;  5GAN 3;  1YIJ T;  4F7U F;  2MWO A;  1TSF A;  2KK4 A;  1RAI B;  1IRE B;  3REB B;  3HHT B;  4QVZ A;  1OQK A;  2XMF A;  1ZSZ A;  4FYX B;  2DE0 X;  4M75 C;  1BI3 A;  3BDU A;  3JCM h;  5GAN e;  5FU7 C;  3MP1 A;  1K9M U;  3CCJ T;  1IGU A;  2BZ8 A;  1QW1 A;  1SEM A;  2L5Q A;  2NUP A;  4C92 F;  4J9C A;  3GP8 A;  4HT9 A;  4IIM A;  2I2L A;  3S3M A;  2KY9 A;  1RI0 A;  4JJN K;  1YP5 A;  4M78 A;  1YWP A;  1VQ5 Q;  5FLX E;  1VQ6 Q;  2LQK A;  4L5G A;  4IUU A;  1B3Q A;  1VQ5 A;  1VQ6 A;  1EFN A;  4RG2 A;  5IXB A;  4E7J A;  2DL4 A;  1K76 A;  1M4Z A;  2P4R A;  4ZN1 A;  5I22 A;  1YJW T;  2P0Q A;  2K79 A;  3FRN A;  1X01 A;  2HQX A;  3LWH A;  4QVC A;  4C0G A;  4JJC A;  4C92 E;  1S72 T;  2KT8 A;  2LJ3 A;  2F1L A;  4M7A B;  2LZ6 B;  2G3R A;  5FU6 C;  2DO3 A;  4CC2 A;  4FM4 B;  1B34 B;  1ZBJ A;  4HA8 A;  3HRS A;  3JCM J;  2DA9 A;  1E6G A;  5GMK h;  3CC7 T;  1WXT A;  2FRY A;  2EJ9 A;  3EG9 B;  5KYY A;  5I2S A;  1KD1 R;  4JRK A;  3JCM f;  3JB9 J;  2DJQ A;  1YJ9 Q;  2KYB A;  4IIO A;  5IH2 A;  4QQD A;  2NLU A;  2EGA A;  5J26 A;  5I11 A;  2HBW A;  2EKO A;  1EX4 A;  4OVA A;  3CCE Q;  1PD0 A;  1N8R U;  2AZV A;  2HD0 A;  5CIU A;  4DA4 A;  1Y71 A;  2JMC A;  3M0Q A;  2DLP A;  2VV5 A;  3VU3 C;  3CCE A;  1UJY A;  3MCA B;  4RCC A;  2EYY A;  3I55 Q;  4M7D B;  1IO6 A;  1R8O B;  5CKH A;  1O75 A;  1ZLM A;  4PKC C;  2QA4 Q;  4QQ6 A;  3I55 A;  3JB9 G;  2JVV A;  2CDT A;  2EQM A;  2DET A;  3GNG A;  4C5E A;  2QA4 A;  1RAE B;  2HBP A;  3CCS T;  1VQO A;  7AT1 B;  1Q7Y U;  2EYQ A;  3JCM e;  1BB9 A;  1VIF A;  2RK2 A;  2FZK B;  3M58 A;  3HFN A;  3OS5 A;  1WIE A;  1TUG B;  3X20 B;  1ABQ A;  4PJO G;  5EC7 A;  3M54 A;  4JPB W;  2K3B A;  2KBT A;  5LL6 S;  2L3S A;  2K5F A;  2NUT B;  2QQ9 A;  4RG8 A;  2DL3 A;  1VQ8 Q;  1G2B A;  3JAM E;  5GAN 6;  1RAD B;  2VWF A;  4FT4 A;  1M1K R;  3HFO A;  5IAY A;  3A8O B;  4PK4 A;  2CH4 A;  3OSS C;  3JB9 I;  1VQ8 A;  1QKW A;  5HCK A;  4LD9 K;  4F7U B;  2AT1 B;  2GF7 A;  2GNC A;  2DYI A;  3EGX B;  3AHU A;  2RHU A;  1X6G A;  2VXE A;  3M0S A;  5GAM j;  2VYT A;  2QXF A;  1WA7 A;  2L3R A;  1KHC A;  2CP7 A;  3RIR A;  1YIT T;  4PJM A;  4AMC A;  4HCB A;  2HSE B;  2LT1 A;  2MPX C;  5KCO A;  4HXJ A;  3H8Z A;  1NJI C;  1N9S A;  5LJ3 g;  1G83 A;  2F5K A;  4J9E A;  5DLQ E;  4EIK A;  1VQL T;  4C92 B;  3URG A;  1Q86 U;  5GMK e;  1W4S A;  2FEI A;  2ZPG B;  1AWX A;  2E70 A;  1OI1 A;  2QAS A;  5IHI A;  3PVL A;  2QK0 A;  2RPN A;  3H0F A;  4P5N A;  1LNX A;  3OYF A;  1I4K 1;  4E7I A;  4LUD A;  4M77 F;  3V7R A;  3X28 B;  2QQA A;  3LYI A;  1IHW A;  1BCM A;  1NEG A;  2CYZ B;  3TRE A;  3X25 B;  2A3L A;  1QVF A;  4HKE A;  1PHT A;  1D0Z A;  2DBK A;  3E9G A;  3RUX A;  2RK1 A;  4BAC A;  4JRI A;  4OB2 B;  2GCX A;  1QVF P;  3E9F A;  4M75 G;  3CC4 A;  4M75 E;  3OYI A;  4OGC A;  3V8J A;  2M16 A;  2CKK A;  2HEQ A;  3RER A;  1M2V B;  2OTL Q;  2QAZ A;  3GIB A;  3CMA Q;  4HCZ A;  2QGF B;  2O88 A;  1Q82 R;  1X27 A;  1RAG B;  2OTL A;  4B9X A;  5FWB A;  4JZ3 A;  3CMA A;  1NBE B;  3M9Q A;  2O31 A;  2JS2 A;  1OZ3 A;  4EPC A;  2CP3 A;  2CGH A;  2E6N A;  5LJ5 j;  2JTM A;  3EFO B;  1QWE A;  3OBY A;  1BU1 A;  2LQW A;  1ZUK A;  4RTX A;  8ATC B;  2KSS A;  2JNG A;  4JJB A;  2DKG A;  3RKX A;  4XU0 A;  1OOT A;  4ZGD B;  5J3B A;  1GCQ C;  2KXC A;  2FVU A;  5GMK m;  1LCK A;  3OYD A;  4ESR A;  1ZA1 B;  4EMK B;  1KQ1 A;  3MKD A;  1ZX6 A;  3OYJ A;  2J05 A;  1BYM A;  4K11 A;  1VQN Q;  1M3B A;  3M0P A;  2OTJ T;  5LJ3 d;  2YRC A;  1VQN A;  4XTU A;  2YUO A;  2EYX A;  5CVI A;  4XTV A;  4A4K A;  2D6F A;  5D6Y A;  1UB4 A;  1GL5 A;  1VQM Q;  2YRD A;  3SFM A;  4JDS A;  3VRZ A;  4ANJ A;  3KUF A;  2FG0 A;  3V8K A;  4M7A A;  3H0I A;  1VQM A;  1KFZ A;  2ZPF B;  2XDB A;  2BTT A;  3QXE B;  3EH1 A;  3SHW A;  1YIJ Q;  1B34 A;  4OMN A;  2H3E B;  3EG9 A;  2A37 A;  2QDL A;  1YIJ A;  2V8J A;  1K73 U;  1OPK A;  3LGF A;  4UC4 A;  1M8M A;  4FW2 A;  5KE2 A;  1OUL A;  2O2O A;  4ZTF A;  2F2X A;  2VVK A;  1ZUY A;  2ZPI B;  1NLO C;  3CCJ Q;  1K8A U;  2L3Q A;  1H64 1;  3WXM B;  1PSE A;  1RI9 A;  3OY9 A;  2JUF A;  1Z9Z A;  1KK7 A;  3CCJ A;  1YJ9 T;  2K5L A;  2I0N A;  2LCL A;  2KAF A;  2MI6 A;  3CBP A;  3EGD B;  3CCE T;  1WHJ A;  3E2U A;  4M7D A;  2NWM A;  1N6A A;  2PUK B;  4XAX B;  2CUD A;  4CC4 B;  4R0K A;  1IXD A;  1D09 B;  1M2O A;  1XNI A;  2C06 A;  1M1F A;  1VQ9 T;  1FMV A;  1K9M C;  1YJW Q;  1TOV A;  1G3Y A;  5FU7 B;  5GAM g;  2KRM A;  1M30 A;  1I5O B;  1YJW A;  2RF0 A;  1S72 Q;  1PNJ A;  3FJ5 A;  1W70 A;  3RMQ A;  4C5I A;  2ROL A;  1S72 A;  2OJ2 A;  4M77 B;  2ENM A;  2ED1 A;  3UAT A;  1D3B B;  3J80 E;  1MNE A;  2R57 A;  3CC7 Q;  4BUG A;  1NPR A;  3NTI A;  2VGM A;  3CC7 A;  2YSQ A;  4KH0 B;  4BI4 A;  5CR2 A;  4F7U A;  1VQ8 T;  3EGX A;  2YUN A;  1AD5 A;  3GPL A;  5GJV B;  2KE9 A;  3VRY A;  2DMO A;  2G6F X;  1RUW A;  4DOW A;  2AKK A;  3H0H A;  3C4S A;  4FU6 A;  2M0Y A;  1M90 U;  2EFI A;  5FU6 B;  4C92 A;  2LJ1 A;  3EHQ A;  3HRT A;  3REA B;  3UWN A;  3OYB A;  3PTA A;  5IT9 E;  2GFA A;  3VYG A;  2CT3 A;  1BIA A;  3MP8 A;  2HL3 A;  1NJI R;  2L8D A;  3CCS Q;  3TSW A;  1RAB B;  4CI0 C;  3VS3 A;  3H9N A;  3G6E T;  5FW9 A;  3OYE A;  2RJF A;  1UGQ B;  3OYC A;  3CCS A;  2E4H A;  1N8R C;  1WJQ A;  4QQG A;  1VUB A;  3L2U A;  2B8A A;  2HMA A;  4JUV A;  5GAN h;  4CRI A;  1VQ7 T;  1JQQ A;  2KGT A;  3FB9 A;  3MET A;  1IZ6 A;  3ASK A;  5CKB A;  1U1S A;  1U06 A;  1FWZ A;  5GAM d;  2EJF A;  4CC7 A;  4J6Y A;  3DKM A;  1YHQ T;  1M2V A;  4ELZ C;  1RLQ C;  3QO3 A;  3VS5 A;  4J9I A;  3FLG A;  1Z9Q A;  2LRQ A;  1WGS A;  2GBQ A;  2YLC A;  1LJO A;  4JRQ A;  5M9O A;  3JCM P;  1Q7Y C;  1X2K A;  2HKQ B;  1M27 C;  1EZZ B;  1H92 A;  1WZO A;  2NUZ A;  4L59 A;  5LJ3 h;  3EFO A;  3A8G B;  1SG5 A;  3VKI A;  5L8R E;  3D7S B;  1D1A A;  2EW3 A;  4M7A G;  4M7A E;  2PTK A;  1XOV A;  1YIT Q;  3MEU A;  1KQS S;  1YIT A;  4EMK A;  4BE1 A;  1JO8 A;  4XK8 E;  2DNU A;  1X75 C;  1VQL Q;  2VC8 A;  2K3X A;  3CCU T;  5IN1 A;  4MML A;  2K7A A;  1VQL A;  3VS7 A;  3QZ5 B;  1NPP A;  2DXT A;  4M77 D;  3LWI A;  2FZG B;  1YFN A;  2CS7 A;  3M4G A;  5GAN f;  1JJ2 A;  2Y90 A;  2M9U A;  2E1H A;  1I81 A;  4N0A A;  4BY6 C;  4JS5 A;  2V8I A;  2J6K A;  1G8X A;  1UHF A;  1UFF A;  1Q86 C;  2RJD A;  1K1Z A;  2PVG B;  1WQ7 A;  4RTT A;  1WJR A;  2DTO A;  2D0N A;  3M53 A;  2E41 A;  3L2V A;  1QKX A;  3ZEH A;  1FX7 A;  5LJ3 f;  4NL2 A;  5GAN 4;  4FSX A;  3M4Y A;  1XTD A;  3SWN A;  2QDY B;  4M4Z A;  3SD4 A;  1H3H A;  5D7U A;  1C6V X;  2JMA A;  2COW A;  3VUZ A;  4AFU C;  3CXC S;  3MEW A;  4AG2 C;  3JCM V;  3TQ7 P;  4A4F A;  1OPL A;  4II1 A;  1QLY A;  3V7C A;  3DB3 A;  2DIL A;  4M75 A;  4M77 C;  4J7F A;  2HKN A;  2V1Q A;  2O4X B;  4WF2 A;  4F7U G;  4F7U E;  1ZQ1 A;  4IUT A;  2RA2 A;  1M5Q 1;  5GMK l;  2OTJ Q;  2LNV A;  3JRZ A;  5FWC A;  5A0D A;  1MMD A;  4TVR A;  5LJ3 e;  2KRS A;  1UG1 A;  2L2P A;  1LVK A;  2OTJ A;  1YWO A;  5HKC A;  1QWF A;  3G71 T;  5CQY A;  1K9M R;  1B7T A;  1VQK T;  3OW2 S;  3V7S A;  1PM3 A;  4FYY B;  3OS1 A;  4PFO A;  2E64 A;  3KBG A;  4C92 G;  4MZT A;  5HK0 A;  4KT0 E;  1D3B A;  2MWP A;  2KDS A;  2W0Z A;  4FCY A;  2QGG A;  5KYU B;  1TU0 B;  3QKJ A;  3EG3 A;  4IUR A;  4AG1 C;  2AZS A;  4RCB A;  4IUV A;  5GAO m;  3CPW S;  2D8H A;  1QQJ A;  2MYS A;  4WTO B;  2CZ0 B;  2KRO A;  1Q95 G;  1SRL A;  1X43 A;  2J6O A;  3CCQ T;  2R58 A;  2RQT A;  3QDF A;  2YHT A;  2PVD B;  2DIG A;  2ZPB B;  3S6W A;  3QWX X;  5CCA A;  1Y96 B;  1YJ9 A;  1MND A;  3QYG B;  4LXC A;  3NFC A;  2EQK A;  1H3Z A;  1VYU A;  1WJS A;  5DY9 A;  2GQV A;  4HCC A;  2DTI A;  1K73 C;  4ZGE B;  2WSE E;  4QT7 A;  4C8Q D;  4JJD A;  3QJY A;  3M59 A;  4ZN3 A;  2VGN A;  3JB9 H;  1VQ9 Q;  1TWB A;  4Z89 A;  3DB4 A;  1Q81 U;  1CSK A;  4J9F A;  3E19 A;  1K8A C;  1E6H A;  2RD1 A;  4BB7 A;  1VQ9 A;  1VQ4 T;  2J7I A;  2DK3 A;  1KJW A;  1ACM B;  1UEC A;  3EG1 A;  5GAN 5;  1KG1 A;  1I5L A;  1MMA A;  3J7A F;  2DEU A;  2RHI A;  1N8R R;  3RKY A;  1MHN A;  4ATO A;  2JJ9 A;  9ATC B;  5GAO r;  4KRT A;  2LCS A;  1D1B A;  1BI2 A;  2R5A A;  1QP3 A;  2LT4 A;  3S3N A;  4LD6 A;  3TSZ A;  4AFS C;  2HL5 C;  1U8R A;  1GRI A;  4JLI A;  1H8K A;  5KYX B;  5FRM A;  1NLP C;  2DRM A;  5GMK j;  3MPU B;  1Y0M A;  4C8Q C;  3VJP A;  2DPP B;  2AK5 A;  2E5K A;  2LQN A;  3TEE A;  1YNZ A;  2PZ1 A;  5GAO q;  2HQE A;  1KQS A;  3G6E Q;  3CCM Q;  4M78 F;  1KQS P;  3PMI A;  2C0O A;  1FMW A;  2EVR A;  3G6E A;  2M0O A;  2QYZ A;  5EG2 A;  1D0Y A;  2DL7 A;  1VQ7 Q;  2WSF E;  4KUI A;  2LQ8 A;  1AWO A;  1VYT A;  3ME9 A;  1VQ7 A;  2CSQ A;  2E65 A;  1M90 C;  2DM1 A;  1JEG A;  1K4U S;  1YCS B;  5GAM e;  1YHQ Q;  3HRU A;  3M0T A;  2XKO C;  1M1G A;  1RAH B;  3PIO A;  2JT4 A;  4JRP A;  2A28 A;  4JS4 A;  3KXT A;  5CO7 A;  1SRM A;  1BI0 A;  1YHQ A;  2QQS A;  1MUZ A;  2CSI A;  5ECA A;  4ZTJ A;  2EKH A;  2L0A A;  1AZE A;  2MAM A;  3WVD B;  3C95 A;  2YWW A;  1MGQ A;  1YN8 A;  4E7Z A;  1A0N B;  1Q86 R;  2RHX A;  3MP6 A;  2J6F A;  4PLL A;  3S3O A;  1TS9 A;  5GJW B;  5CK9 A;  2D8J A;  2VAS A;  2ZZD A;  3LX7 A;  3QG1 A;  3VS6 A;  4M77 G;  2RO0 A;  4M77 E;  3EG2 A;  1W6X A;  1Y7X A;  2KVQ G;  8AT1 B;  1QVP A;  4GLK A;  1T0J A;  2LX7 A;  1NEB A;  3I5S A;  1PRL C;  2O4X A;  2ZAE A;  3CCU Q;  1TTH B;  1UE9 A;  5A0L A;  4MMK A;  1UGS B;  4RMO A;  1G3T A;  3CXC A;  3A8L B;  1I8F A;  1K0S A;  3CCU A;  4OF1 A;  4J6X A;  3CXC P;  1JJ2 S;  2K57 A;  2X4W A;  3EHR A;  2PVO B;  4B6M A;  4XU1 A;  3BW1 A;  5KH6 A;  1GCQ A;  1N5Z A;  4N4G A;  4OP0 A;  5CKF A;  1X69 A;  1G3W A;  3MO8 A;  1PKT A;  4XTZ A;  5KYU A;  1ZHI A;  1HK9 A;  1WX6 A;  3UT1 A;  2HAX A;  1U5S A;  1SHG A;  2XIC A;  2DL5 A;  3JCM X;  1SSF A;  4PJJ A;  2LMJ A;  3QWY A;  3OW2 A;  3MJX A;  2X3W D;  2E3I A;  2LX9 A;  3OW2 P;  4HT8 A;  3OYL A;  1IB8 A;  2KYM A;  4XTY A;  4GLM A;  3QPH A;  3JV3 A;  2DIQ A;  1PCX A;  1OU8 A;  2CT4 A;  4BE2 A;  3ZBD A;  2JOY A;  2LVM A;  1I0C A;  3NGP A;  3CPW A;  3VYH B;  4GBQ A;  4C0F A;  1Y96 A;  3CPW P;  2DL8 A;  2SEM A;  4D6W A;  2EJG A;  4BY6 B;  3A8H B;  2D0Q B;  2IG0 A;  3ZL7 C;  1AEY A;  2BZX A;  2KI7 A;  5DM7 R;  2K4Y A;  3A1P A;  4PJL A;  4OB3 B;  3MEA A;  5IHN A;  2FB7 A;  1ZSZ B;  3CCV T;  1KC8 U;  1K73 R;  4C8Q F;  2VXF A;  1RL2 A;  3CC2 T;  5GMK i;  5IXF A;  2LJ0 A;  4E2F B;  3G71 Q;  4FT2 A;  1BIB A;  2NUP B;  3VS0 A;  4X34 A;  1AZG B;  1VQK Q;  1SF9 A;  1K8A R;  4C0Z A;  1HYO A;  3G71 A;  2XK0 A;  5AT1 B;  4M78 B;  1VQK A;  4LUE A;  4X9C A;  4EMH A;  1KQ2 A;  2NUT A;  3V8L A;  5CKE A;  2FPF A;  2O9V A;  1BBZ A;  1I07 A;  2VKN A;  5KCH A;  2FL7 A;  2DXC A;  1PKS A;  4E7L A;  3JCM d;  4MZM A;  2GGR A;  1R0B G;  1JBM A;  4DBQ A;  5D6W A;  1XQH A;  1YJN T;  1X2Q A;  1WHK A;  3M57 A;  3GBQ A;  1NZ9 A;  3A8M B;  4E7S A;  3CCQ Q;  5GAO l;  5KYX A;  1CKB A;  5GAN 2;  4PJN A;  2LTO A;  3CCQ A;  1VIE A;  2FYK A;  4DOV A;  4EDU A;  1VOM A;  1T3L A;  2X4Y A;  2EIF A;  5C6S A;  2PNI A;  2F2W A;  1YI2 T;  1ABO A;  2XI9 A;  1BCO A;  4KGV B;  2BKD N;  3OYK A;  2X51 A;  4PJO D;  4HVU A;  5GAO n;  4HVV A;  4JZ4 A;  3R6N A;  3EFS A;  1GFC A;  4A4E A;  1VQ4 Q;  3PNW C;  4C0D C;  5LJ5 g;  4LE9 A;  3CCM T;  2Z0W A;  1VQ4 A;  2DRK A;  4OMM A;  2DZC A;  1RAA B;  2XDP A;  1WHH A;  4ME7 A;  4Y91 A;  5GAN 7;  1UUE A;  2KMT A;  4E47 A;  2CRE A;  4NS5 A;  1AHJ B;  4C5H A;  2X3X D;  2RHY A;  5HY6 A;  4BI8 B;  1M90 R;  2PQW A;  1Q81 C;  2MK5 A;  2COZ A;  2YT6 A;  4O6J A;  2CP6 A;  2ATC B;  3NTK A;  1C0M A;  5KE3 A;  2LNH B;  2X4J A;  1U3O A;  4DEY A;  4RTV A;  4J9D A;  1VYV A;  1WHM A;  2OX7 A;  3I9Q A;  4BI3 A;  2B86 A;  4BE0 A;  4RUG A;  3OS2 A;  4J5Y A;  1VQP T;  1NE8 A;  4J8O A;  1UTI A;  3I56 Q;  3QII A;  2LP5 A;  3CCR Q;  3OYN A;  2KQW A;  4PJO C;  2W10 A;  4OMO A;  3I56 A;  3HP9 A;  4D8K A;  3PGG A;  4M78 D;  2XDD A;  2EBP A;  2JTE A;  2QQR A;  3JCM b;  4A53 A;  4N4I A;  1X6O A;  1WHL A;  1C1A A;  2HQH A;  2SRC A;  3QBY A;  2JN0 A;  2EYW A;  1AVZ C;  1X6B A;  2Y4Y A;  1QMC A;  3T9N A;  2NYS A;  2P0P A;  3UA7 A;  4PFP A;  4FL6 A;  1F1B B;  1JJ2 P;  4C8Q B;  4Y28 E;  2DVJ A;  2JM9 A;  1IHV A;  5LJ5 d;  4R55 A;  3M0R A;  2EYZ A;  2JM8 A;  3A5Z B;  6AT1 B;  3OYH A;  2CZ7 B;  1JU5 C;  3LW5 E;  1M8V A;  2C0T A;  5GAN j;  2GQI A;  1SKU B;  1TXQ A;  2KR3 A;  4EMG A;  1LOJ A;  3P8B B;  1UGV A;  1N9R A;  1SSH A;  2RQV A;  2ABL A;  1ZSZ C;  2RQR A;  4O5V A;  3F70 A;  2XG8 D;  3O5Z A;  3VS2 A;  3EGD A;  2BUD A;  4OMF B;  4HVW A;  2FPD A;  4MDW A;  4M78 C;  2XHC A;  4XQ3 A;  5LJ3 j;  2O9S A;  4RTU A;  3FEO A;  3JCM W;  4DBH A;  3BY7 A;  3SDZ A;  1G5V A;  2EPD A;  5A0G A;  1PD1 A;  1R0C B;  4XU3 A;  1RAF B;  3C12 A;  4NOY A;  4J7I A;  1S1N A;  3P8D A;  3NTH A;  1RLP C;  3HSB A;  1GFD A;  4A4H A;  2K2M A;  4DBR A;  1OV3 A;  1AOJ A;  3FIF A;  1KSW A;  1BKB A;  3OB9 A;  2M1H A;  4M77 A;  1W1F A;  3GOX A;  1ZSG A;  2ZGW A;  3J81 E;  1MV0 B;  1KD1 U;  2LC4 A;  3ULR B;  2FZC B;  3M55 A;  1M3A A;  2ROT A;  1UJ0 A;  3KFV A;  2MOX A;  3LH5 A;  3L1A A;  3TCJ A;  3L2W A;  3OSV A;  3OYG A;  4HCK A;  4OB0 B;  1G3S A;  4Z88 A;  5L23 A;  2COY A;  2IVW A;  4XU2 A;  3JB9 F;  3GF5 A; 
#chains in the Genus database with same CATH homology
 5GAM h;  4PJO A;  3PIP A;  2EQJ A;  3PT9 A;  2VUB A;  2JTF A;  4J83 A;  1YJW A;  4KBM B;  1DJ7 B;  2RHX A;  1KHI A;  3MP6 A;  4PLL A;  1GXI E;  3S3O A;  4R56 A;  4IUQ A;  1YBY A;  4N0A C;  5CK9 A;  3RES A;  3EFR A;  3M56 A;  3L2Q A;  3CCL A;  2YRV A;  4A54 A;  4MDX A;  3RMQ A;  2RI2 A;  1OYX A;  2ZZD A;  3LX7 A;  4L6V 5;  4C5I A;  3CME A;  1P92 A;  3PFS A;  5C0M A;  4BDY A;  4E7H A;  1S72 A;  3QG1 A;  2DD5 A;  3M5A A;  3BDL A;  4GY5 A;  3CCV A;  4M77 B;  4M77 G;  4PJO F;  3SB2 A;  2RO0 A;  4M77 E;  4OB1 B;  3QYH B;  1Y7X A;  1VQN T;  1D3B B;  3J80 E;  4Z02 A;  3CC2 A;  2KVQ G;  2R57 A;  1QVF S;  1QVP A;  2DXB A;  4GLK A;  4XTX A;  4BUG A;  3L2Z A;  1NPR A;  3CBM A;  3JSC A;  1WPY A;  4A4G A;  3QZ9 B;  2FHD A;  3HL8 A;  3NTI A;  2E6Z A;  2VGM A;  3HKS A;  2QEX A;  2DXU A;  4HT9 A;  3CC7 A;  2O4X A;  3H6Z A;  4ELY C;  3C94 A;  4BI4 A;  5CR2 A;  4F7U A;  3CD6 A;  5I21 A;  1VQ8 T;  4M7D G;  4M7D E;  5A0L A;  1VQM T;  4MMK A;  1UGS B;  5J39 A;  1G3T A;  4RMO A;  3A8L B;  3CXC A;  3GPL A;  1I8F A;  4N4H A;  2JZ2 A;  3QJ6 A;  3RMS A;  3CCU A;  2RJE A;  4OF1 A;  1W2B S;  1M1K U;  2F69 A;  4J6X A;  2Y4X A;  3SWN C;  3G7Z A;  1QVG S;  2K57 A;  2X4W A;  1JJ2 S;  3G4S T;  1Q82 C;  2PVO B;  3E1S A;  3R6O A;  1KC8 C;  4FIB A;  2AHJ B;  4XU1 A;  5GAN 3;  2DJZ A;  4DOW A;  3GF5 A;  1YIJ T;  4F7U F;  3BW1 A;  2MWO A;  2EQU A;  5KH6 A;  3C4S A;  4FU6 A;  2KK4 A;  1M90 U;  2EFI A;  4OP0 A;  4N4G A;  5FU6 B;  4C92 A;  5CKF A;  1IRE B;  3HRT A;  3UWN A;  3HHT B;  3OYB A;  3PTA A;  1YJN A;  1G3W A;  4QVZ A;  3MO8 A;  3PMT A;  4XTZ A;  4PJO E;  5IT9 E;  2GFA A;  3CBO A;  3VYG A;  1ZHI A;  4M75 C;  1BI3 A;  1BIA A;  3BDU A;  4B9W A;  1HK9 A;  3MP8 A;  3UT1 A;  3JCM h;  5GAN e;  2HAX A;  2XIC A;  2L8D A;  3MP1 A;  5FU7 C;  3CCJ T;  1K9M U;  3JCM X;  1QW1 A;  1SSF A;  4CI0 C;  2L5Q A;  2K2V A;  2F5T X;  3G6E T;  3OW2 A;  4C92 F;  3OYE A;  2RJF A;  2K5I A;  4DQ2 A;  1UGQ B;  5GAM f;  3VUB A;  5LJ5 h;  3OYC A;  3UDC A;  3GP8 A;  2I2L A;  2LX9 A;  3CCS A;  3S3M A;  1N8R C;  1WJQ A;  1RI0 A;  2KY9 A;  2PU9 B;  4JJN K;  4QQG A;  1VUB A;  3OYL A;  4HT8 A;  4IKF A;  4M78 A;  5GAN g;  3I56 T;  3L2U A;  4XTY A;  5FLX E;  2B8A A;  3QPH A;  4JUV A;  5GAN h;  3CCR T;  2DIQ A;  2QQB A;  2X4X A;  4CRI A;  4BE2 A;  3ZBD A;  2LQK A;  2JOY A;  4L5G A;  1VQ7 T;  3CEY A;  2LVM A;  4IUU A;  1YI2 A;  1TH7 A;  3FB9 A;  3MET A;  3CPW A;  1IZ6 A;  1VQ5 A;  3ASK A;  1EIF A;  1U1S A;  5CKB A;  1FWZ A;  5GAM d;  2EJF A;  3LH0 A;  2X35 A;  4J6Y A;  1Y96 A;  3VYH B;  4C0F A;  2V8K A;  1VQ6 A;  3DKM A;  1YHQ T;  4RG2 A;  4D6W A;  2EJG A;  4E7J A;  4BY6 B;  4ELZ C;  3QO3 A;  1M4Z A;  3FLG A;  3A8H B;  2LRQ A;  1WGS A;  4ZN1 A;  2D0Q B;  3JCM c;  2DVE A;  2IG0 A;  2YLC A;  4C8Q A;  1LJO A;  3CCM A;  2P0Q A;  1YJW T;  4M75 F;  4JRQ A;  3FRN A;  5M9O A;  3JCM P;  1Q7Y C;  1X01 A;  2HQX A;  3LWH A;  5DM7 R;  2K4Y A;  3HPW A;  4QVC A;  3CCL T;  4L59 A;  5I2M A;  5LJ3 h;  4C0G A;  5D6X A;  4C92 E;  3CME T;  1Q82 U;  3A8G B;  4OB3 B;  1S72 T;  3MEA A;  3VKI A;  5L8R E;  2FB7 A;  3CCV T;  1KC8 U;  4C8Q F;  2RI5 A;  4M7A B;  2VXF A;  4M7A G;  4M7A E;  1RL2 A;  4M7A D;  3CC2 T;  3EAE A;  2G3R A;  1XOV A;  5GMK i;  5FU6 C;  2DO3 A;  3FJP A;  3OYM A;  1FXX A;  3MEU A;  1UGP B;  4FM4 B;  4FT2 A;  1BIB A;  2QEX T;  1B34 B;  4HA8 A;  3HRS A;  1KQS S;  1WQW A;  4LDY A;  4X34 A;  5GMK h;  2RJC A;  4EMK A;  3JCM J;  1YIT A;  3CC7 T;  4BE1 A;  4XK8 E;  3CPF A;  4C0D B;  1X75 C;  2EJ9 A;  2WSC E;  4C0Z A;  3CD6 T;  3G71 A;  2XK0 A;  2VC8 A;  5I2S A;  2ZPE B;  2K3X A;  4M78 B;  4M78 G;  4JRK A;  4KUL A;  4M78 E;  1VQK A;  4X9C A;  3CCU T;  4EMH A;  2K3Y A;  5IN1 A;  3JCM f;  4MML A;  3OS0 A;  1KQ2 A;  3JB9 J;  3V8L A;  5CKE A;  1VQL A;  3OBW A;  4QQD A;  3RKW A;  3QZ5 B;  2NLU A;  5J26 A;  1NPP A;  5KCH A;  2DXT A;  1M9S A;  1JB0 E;  2EKO A;  2FL7 A;  4OVA A;  1BI1 A;  1N8R U;  2DXC A;  3Q1J A;  4M77 D;  5LJ5 f;  3LWI A;  1VQP A;  2HD0 A;  5CIU A;  4DA4 A;  2XD0 A;  1Y71 A;  2E5Q A;  4E7L A;  3JCM d;  2VV5 A;  4MZM A;  3VU3 C;  2CS7 A;  1JBM A;  3M4G A;  5GAN f;  3CCE A;  1JJ2 A;  5D6W A;  1XQH A;  1YJN T;  3MCA B;  3M57 A;  3OMC A;  5DLO A;  2Y90 A;  2M9U A;  4RCC A;  3MEV A;  1NZ9 A;  3A8M B;  2E1H A;  1HXD A;  1I81 A;  5GAO l;  4M7D B;  4N0A A;  3N5B B;  4BY6 C;  4JS5 A;  4M7D D;  2V8I A;  5GAN 2;  1R8O B;  2LTO A;  5CKH A;  1O75 A;  3TU4 K;  4PKC C;  5FRO A;  3CCQ A;  4QQ6 A;  1VIE A;  2FYK A;  4DOV A;  3I55 A;  3JB9 G;  4EDU A;  5GAN d;  2JVV A;  1Q86 C;  2EAY A;  4PLI A;  2RJD A;  2PVG B;  2EQM A;  1Y07 A;  1WQ7 A;  2CZ6 B;  1WJR A;  3GNG A;  4C5E A;  4C5G A;  3CCS T;  2HBP A;  2QA4 A;  2X4Y A;  2DTO A;  2EIF A;  1VQO A;  1Q7Y U;  3GLX A;  2EYQ A;  3M53 A;  5AYF A;  2E41 A;  2A7Y A;  3JCM e;  3L2V A;  2DAQ A;  5C6S A;  3ZEH A;  1VIF A;  2RK2 A;  2BIV A;  4XTW A;  3INZ A;  3M58 A;  3HFN A;  3FC3 A;  3OS5 A;  1YI2 T;  1FX7 A;  2OAU A;  3X20 B;  2XI9 A;  5LJ3 f;  2R5M A;  3OYK A;  2BKD N;  1VQ5 T;  4PJO B;  4NL2 A;  4PJO G;  5LJ5 e;  4PJO D;  5GAO n;  4M7A C;  5GAN 4;  1VQ6 T;  4FSX A;  3M4Y A;  1XTD A;  3M54 A;  1QP2 A;  1UGR B;  4J6W A;  5LL6 S;  3JCM g;  3EFS A;  3SWN A;  2QDY B;  2K5F A;  4A4E A;  3SD4 A;  3P8H A;  3OYY A;  4BDZ A;  2E12 A;  3PNW C;  2QQ9 A;  3VUZ A;  1V29 B;  4BD3 A;  4C0D C;  5LJ5 g;  3CXC S;  3MEW A;  3CCM T;  2P0K A;  3OA6 A;  4E7K A;  4RG8 A;  1VQ4 A;  3O8V A;  4Q5W A;  3JAM E;  5GAN 6;  2DZC A;  3JCM V;  2RI3 A;  4A4F A;  4FT4 A;  4II1 A;  3HFO A;  5IAY A;  2XDP A;  3V7C A;  3A8O B;  1VQ8 A;  3OSS C;  3DB3 A;  4ME7 A;  2DTH A;  2HNI A;  3OMG A;  4Y91 A;  5GAN 7;  2KMT A;  3QHS A;  3JB9 I;  4M75 A;  4E47 A;  4M77 C;  4J7F A;  4WF2 A;  2O4X B;  4NS5 A;  4LD9 K;  1AHJ B;  4F7U B;  4C5H A;  4F7U G;  4F7U E;  2GF7 A;  1ZQ1 A;  2RHY A;  3L2R A;  4IUT A;  2RA2 A;  1M5Q 1;  2RHU A;  2VXE A;  5HY6 A;  5GMK l;  3AHU A;  4BI8 B;  2LNV A;  3JRZ A;  5GAM j;  2VYT A;  5A0D A;  1OZ2 A;  2DD4 A;  2L3R A;  2PQW A;  2QXF A;  1KHC A;  4TVR A;  5LJ3 e;  5GAN 8;  1Q81 C;  4ZGJ B;  4LDV A;  2OTJ A;  3RIR A;  1YIT T;  4QW2 A;  4O6J A;  4M7D C;  5HKC A;  1JRI A;  2MF2 A;  3NTK A;  4HCB A;  2LT1 A;  2QTX A;  5CQY A;  5KCO A;  3G71 T;  2YLB A;  1NJI C;  3H8Z A;  1N9S A;  1VQK T;  5KE3 A;  3OW2 S;  3V7S A;  3VV0 A;  2X4J A;  5LJ3 g;  5DLQ E;  2F5K A;  4NL3 A;  3OS1 A;  2E64 A;  3KBG A;  1VQL T;  4C92 B;  4C92 G;  3URG A;  4MZT A;  4C92 D;  5GMK e;  1W4S A;  1Q86 U;  2ZPG B;  4KT0 E;  1D3B A;  5HK0 A;  2E70 A;  2KDS A;  2MWP A;  2RH2 A;  4BI3 A;  4BE0 A;  1OI1 A;  1U1T A;  3QKJ A;  3OS2 A;  4IUR A;  4J5Y A;  1VQP T;  2D9T A;  4RCB A;  1NE8 A;  3QUI A;  4IUV A;  4J8O A;  3SWN B;  2XID A;  5GAO m;  3CPW S;  3QII A;  4P5N A;  1LNX A;  1WNL A;  3OYN A;  3OYF A;  1O9S A;  1I4K 1;  2KQW A;  4E7I A;  4PJO C;  2LDM A;  4M77 F;  3V7R A;  2CZ0 B;  3I56 A;  3HP9 A;  2QQA A;  3X28 B;  3LYI A;  3ZFJ A;  5A2Q E;  2CYZ B;  3TRE A;  2L89 A;  3PGG A;  3X25 B;  2A3L A;  2ZCF B;  4M78 D;  1QVF A;  4HKE A;  3CCQ T;  3I55 T;  3E9G A;  3RUX A;  2R58 A;  2QQR A;  2XDD A;  2RK1 A;  3JCM b;  4JRI A;  4OB2 B;  4A53 A;  4N4I A;  4BAC A;  2GCX A;  1X6O A;  2YHT A;  3E9F A;  2PVD B;  4M75 B;  2DIG A;  2ZPB B;  4M75 G;  4M75 E;  3S6W A;  5GAO p;  3CC4 A;  3OYI A;  2QA4 T;  1VQO T;  4OGC A;  3V8J A;  2M16 A;  5CCA A;  1Y96 B;  2CKK A;  1YJ9 A;  3QBY A;  3RER A;  2JN0 A;  3QYG B;  4PNO A;  3NFC A;  1W2B A;  2EQK A;  2Y4Y A;  3GIB A;  4HCZ A;  5CKD A;  1H3Z A;  1WJS A;  3GNF B;  4OGE A;  5DY9 A;  2P0P A;  3T9N A;  1QVG A;  2GQV A;  4PL6 A;  4HCC A;  4FL6 A;  2DTI A;  2CZ1 B;  1K73 C;  4ZGE B;  2OTL A;  2WSE E;  4B9X A;  4C8Q B;  4C8Q G;  3CMA A;  4Y28 E;  4C8Q E;  4C8Q D;  3QSU A;  3DLL A;  2DEQ A;  3QJY A;  3M59 A;  4ZN3 A;  4RKU E;  3OYA A;  2VGN A;  3M9Q A;  5LJ5 d;  4R55 A;  3X24 B;  1OZ3 A;  3JB9 H;  4EPC A;  2CGH A;  3DB4 A;  2E6N A;  1Q81 U;  5LJ5 j;  2JTM A;  4KUD K;  3JB9 D;  3A5Z B;  3E19 A;  1K8A C;  3OBY A;  2QI2 A;  2E10 A;  2RD1 A;  3OYH A;  1PSF A;  2CZ7 B;  5CAI A;  1ZBX A;  4BB7 A;  3LW5 E;  1VQ9 A;  1KD1 C;  1M8V A;  2KSS A;  1VQ4 T;  5GAN j;  2DK3 A;  2JNG A;  3FDR A;  2DKG A;  3RKX A;  1NJI U;  4XU0 A;  4ZGD B;  4LDU A;  5J3B A;  2DZ9 A;  2EWN A;  2FVU A;  3LLR A;  4C92 C;  4EMG A;  4X9D A;  1LOJ A;  5GMK m;  3P8B B;  5GAN 5;  1N9R A;  1KG1 A;  1I5L A;  3OYD A;  3J7A F;  2LCC A;  2RHI A;  1KQ1 A;  3F70 A;  4O5V A;  4EMK B;  3RKY A;  2XG8 D;  3OYJ A;  1MHN A;  1BYM A;  4ATO A;  3BFM A;  1UEB A;  5GAO r;  3L42 A;  2P4T A;  2BUD A;  4OMF B;  2OTJ T;  5LJ3 d;  1BI2 A;  1VQN A;  2R5A A;  4XTU A;  5CVI A;  4MDW A;  4XTV A;  4M78 C;  4A4K A;  2D6F A;  2XHC A;  4XQ3 A;  1UB4 A;  1QP3 A;  5D6Y A;  3FEO A;  5LJ3 j;  3JCM W;  2LT4 A;  4JLG A;  3S3N A;  3SFM A;  3BY7 A;  4JDS A;  4LD6 A;  3SDZ A;  5A0G A;  1G5V A;  3KUF A;  3V8K A;  4M7A A;  1VQM A;  2ZPH B;  1U8R A;  4XU3 A;  4JLI A;  2ZPF B;  4MZP A;  2XDB A;  3C12 A;  4NOY A;  4J7I A;  1YCY A;  3QXE B;  3LGL A;  3P8D A;  1B34 A;  3G4S A;  2GFU A;  5FRM A;  1N27 A;  3NTH A;  3OQ5 A;  5GMK j;  3ER0 A;  4YTL A;  3HSB A;  4VUB A;  3X26 B;  3DLM A;  4C8Q C;  1YIJ A;  2WAC A;  3VJP A;  2DPP B;  2V8J A;  4A4H A;  1K73 U;  3LGF A;  4UC4 A;  4M7A F;  3FIF A;  2RB6 A;  3TEE A;  5KE2 A;  1BKB A;  3OB9 A;  4ZTF A;  4V2S A;  2M1H A;  2PUO B;  5GAO q;  2ZPI B;  2HQE A;  4M77 A;  1K8A U;  3GOX A;  3MHX A;  1H64 1;  3WXM B;  2ZGW A;  1KQS A;  1PSE A;  3JCM Q;  3J81 E;  3CC4 T;  3OY9 A;  2JUF A;  1KD1 U;  4M78 F;  2RM4 A;  5HK3 A;  1M1K C;  3CCJ A;  1YJ9 T;  2K5L A;  2MMP A;  3PMI A;  2LC4 A;  2LCL A;  2KAF A;  3G6E A;  3M55 A;  2M0O A;  2MI6 A;  3CBP A;  5EG2 A;  3CCE T;  3UPU A;  4M7D A;  4EMK C;  2WSF E;  4KUI A;  2OTL T;  1N6A A;  2LQ8 A;  2O01 E;  3CMA T;  3L1A A;  3ME9 A;  3CCR A;  2PUK B;  4XAX B;  3QDR B;  2E65 A;  1VQ7 A;  1M90 C;  2XU8 A;  3TCJ A;  3L2W A;  5GAM e;  3OSV A;  3HRU A;  2XKO C;  1M1G A;  4LDX A;  3PIO A;  4JRP A;  2H3J A;  4JS4 A;  3KXT A;  3OYG A;  5CO7 A;  5CQX A;  1BI0 A;  3WVE B;  1XNI A;  2QQS A;  1YHQ A;  2C06 A;  4M7D F;  1M1F A;  4ZTJ A;  1VQ9 T;  4LDW A;  4M75 D;  4OB0 B;  1G3S A;  2MAM A;  4IUP A;  1K9M C;  2RHZ A;  5FRN A;  2IVW A;  4XU2 A;  1G3Y A;  5FU7 B;  3WVD B;  5GAM g;  3JB9 F;  4QVD A;  3C95 A;  1MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...