2RM4A

Solution structure of the lsm domain of dm edc3 (enhancer of decapping 3)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
GAMGPTDQDWIGCAVSIACDEVLGVFQGLIKQISAEEITIVRAFRNGVPLRKQNAEVVLKCTDIRSIDLIEPAKQDLDGHTAPPPVVNKPTPVKLPHFSNILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CG6311-PB
publication title A divergent Sm fold in EDC3 proteins mediates DCP1 binding and P-body targeting
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 9
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rm4A01
1HK9A 4EMKA 1I5LA 4QVDA 1WQ7A 4C8QE 5CAIA 4C8QD 1LOJA 1N9RA 3QHSA 3AHUA 1TH7A 2QTXA 4NL3A 4M7AD 4PJOA 3JCMX 5GAOn 4M78E 4M78G 3BY7A 4HA8A 4J5YA 1I81A 5GMKi 5GAN4 3RERA 1Y96A 4M77F 4M75D 1D3BB 5LJ3e 4QVCA 4HT8A 3JCMP 3HSBA 4M7DE 3RESA 3JB9H 1JRIA 2I2LA 4C92F 2RB6A 3FB9A 3JB9I 2DZCA 4JLIA 5GAN3 4M7DD 4PJOE 3HFOA 2RA2A 2VC8A 4PJOG 4Y91A 2E41A 4M77B 5LJ5d 3BFMA 5GAOp 3SB2A 5DY9A 3JCMh 4M78A 3RIRA 1KQ1A 2RD1A 4JRIA 2RM4A 3SWNB 1HXDA 2FB7A 5GANd 5LJ5j 1LNXA 2YLBA 4C92B 4EMGA 5LJ5h 3JB9D 3JB9G 3PGGA 4M7DB 1B34B 2DXUA 3RUXA 5GANj 4XTZA 5GANh 5GMKe 2EJ9A 2E64A 4J6WA 3GIBA 1X01A 5GAOm 4M77C 4RCCA 4J6XA 5GMKm 3QUIA 4MMLA 1WQWA 2VXEA 5GAOq 4M78D 3INZA 3JCMc 3SWNC 4F7UF 3BW1A 3JCMV 4C92C 4NL2A 2VXFA 3RKXA 3HFNA 3VU3C 4C8QB 3JCMQ 2DTIA 3V8KA 5LJ3j 5GAMg 4HT9A 2E10A 3FJPA 2CGHA 4M7AB 3RKWA 5LJ3h 3V7CA 4DQ2A 5GAMf 3JCMd 3QSUA 4A53A 2YHTA 4M7DF 1LJOA 4MMKA 3L1AA 4PJOD 4F7UB 4M75B 3V8LA 5I21A 1YCYA 2EJFA 2EJGA 4RCBA 4XU1A 4C92A 4EMKB 5GAN5 4C8QC 1N9SA 4N0AC 4XU0A 4XTWA 3JCMJ 4M7AC 3FIFA 4XTXA 4PJOB 2FYKA 1H641 4C8QF 3JCMW 4M77E 1U1SA 4JRKA 3M4GA 4M77G 1KQ2A 4M7AF 1I8FA 2ZGWA 4M75C 4V2SA 1WPYA 1Y96B 1BIBA 2DKGA 3QO3A 5GAOr 2EWNA 4EMKC 5GAMe 1M8VA 4X9DA 1D3BA 3EFRA 5LJ3d 2E1HA 4C92G 4C92E 4EMHA 4M75F 2DJZA 4XTUA 1U1TA 4XQ3A 5GAN7 4A54A 2DTHA 4M7DC 3V7RA 5GAOl 4JUVA 3RKYA 5GMKl 4F7UA 4M77A 4M78B 3JCMg 5GAN2 4PJOF 1M5Q1 4WF2A 3JCMf 2Y90A 5GANe 2HNIA 4NOYA 5LJ5g 3SWNA 3EFSA 4XTYA 1WNLA 3JB9J 2JN0A 4C8QG 5LJ5f 3JB9F 2DXTA 4M7DA 4M7AE 4M7AG 1I4K1 1B34A 5GANg 2K57A 4XTVA 1MGQA 3V8JA 5GANf 4M78C 4F7UE 4M75E 4OP0A 4PNOA 4M77D 4M75G 4XU3A 4F7UG 5GMKj 5GAMd 5GMKh 5GAN8 1JBMA 2DZ9A 4M78F 4XU2A 4C92D 3V7SA 2DVEA 4C8QA 5LJ3g 5GAMj 2EAYA 3JCMb 5GAMh 4M7DG 2DEQA 4N0AA 5LJ3f 3JCMe 4M7AA 4PJOC 2DTOA 2YLCA 3BDUA 5GAN6 5LJ5e 2E65A 3L2ZA 4M75A 1BIAA 4X9CA 4J6YA
chains in the Genus database with same CATH superfamily
2CP6A 4EMKA 2K4YA 3UF4A 2C06A 2XICA 4PJMA 3VS7A 4HA8A 3S3NA 3OB9A 1F1BB 1YITT 1YI2A 2A28A 1K73U 1C1AA 4IIOA 4JDSA 3CC7Q 1JO8A 3DLMA 3S3MA 2LT1A 2EQUA 1YNZA 4A4FA 1VQ4Q 1YCSB 4J7IA 4M7DB 1IGQA 1VQ6Q 4LDUA 4M77C 4RTZA 3NPFA 1RI0A 1YJWT 1MMAA 1IREB 3QBYA 1JQQA 2E3HA 2KK4A 1G83A 4E7IA 3R6OA 1MMDA 3M5AA 4JJCA 2IG0A 2DMOA 3OYFA 3OYGA 3ZBDA 1VQOQ 2KDSA 1MMNA 4C8QC 3OMCA 2DEUA 3LW5E 1VYTA 3C12A 3I9QA 2L2PA 2D8JA 2RQUA 4FT4A 1BYMA 1PRMC 3A8GB 2DETA 2EWNA 2P0KA 3C94A 5LJ3d 1NBEB 1G3WA 3H8ZA 2KNBB 1WJRA 1R0BG 1FX7A 3PNWC 2ENMA 2AK5A 2A08A 3QDFA 2QGGA 2FPEA 4M77A 2GTJA 3CC4A 2HCKA 4NOYA 3I5RA 1W70A 3UT1A 5LJ5f 2CDTA 2K79A 1VQ5Q 2PUKB 3CCJT 2LC4A 4IKFA 1JXMA 1Z9QA 4MZTA 4M77D 1UHCA 1BI0A 3DB3A 5GAN8 4L59A 1PG5B 2DVEA 2KVQG 4C8QA 4M7DE 1ZSZC 3VKIA 5ECAA 2DAQA 5FRNA 2R5AA 1WQ7A 4FU6A 4C8QD 3BE3A 3AHUA 2FPFA 1Q86R 1W2BA 1I07A 3NTKA 2BZXA 3BY7A 1UJ0A 4HT8A 3OW2S 1VYVA 2HQEA 5HKCA 4LE9A 4ZN1A 1NJIR 2K2VA 3AT1B 4E7LA 2K6DA 1YJ9Q 3CPFA 4PJLA 3TQ7P 2LQNA 2EGCA 1X2KA 1HXDA 5LJ5j 1PRLC 4E7SA 5EC7A 1KC8C 3RUXA 2H8HA 2EYYA 2HSPA 1M90U 2LMJA 1QP3A 1TTHB 1NM7A 2ECZA 4NL2A 1SSFA 4C5HA 2AZSA 3HPWA 1WA7A 3JSCA 2JS2A 4Q5WA 4ESRA 2RHYA 2QDLA 3ASKA 2L3RA 1YP5A 4LDXA 2K5LA 5KCHA 2LCLA 1H641 2DL4A 2BKDN 2P84A 2OI3A 1KQ2A 4QQ6A 1M27C 4QT7A 2VASA 3EG1A 3CMAA 3EGDB 1YI2Q 2O9SA 2OTLT 1QKXA 4GLKA 1RLQC 1IO6A 1Y57A 2JZ2A 1K8AC 1ZBJA 2A7YA 3OA6A 3OYEA 2P0QA 5LJ5g 1M1KC 1WNLA 1Y7XA 1PKTA 3VS6A 1SHFA 1KHIA 4ZTFA 2RHZA 3HTRA 1UUEA 2BE7D 4PNOA 1D0ZA 3A1PA 2JTEA 1TUGB 3A5ZB 2XG8D 3OYMA 3MEWA 2JM9A 1BCMA 3REBB 5GAN6 1R0CB 2B86A 3M58A 4RG2A 3OSSC 2RNAA 1K73R 4JJDA 1AHJB 3LH0A 3JCMP 2LTOA 2F5TX 2DZCA 4JLIA 1D09B 3IQLA 1SKUB 1WGSA 1IHVA 1YIJQ 3CCVT 2FB7A 1VQ9T 1VQNT 2LQKA 1B3QA 1T0JA 3NHNA 1I5OB 3QWXX 5GMKe 3ER0A 5CIUA 4C5IA 2ZPEB 3JCMc 1VQMA 1QVGP 2O2OA 1VQLT 3PIPA 3Q1JA 4L5GA 4JJBA 3WVDB 3J80E 2D1XA 4FYWB 4E7ZA 2VGMA 3A8MB 5I21A 3OBYA 2K2MA 5KYYB 2GNCA 4XTWA 1JJ2S 1X75C 2DK3A 1NPPA 2XK0A 1WXUA 3CCLT 1C6VX 2KXCA 5CR2A 1Y96B 2DKGA 5GAOr 4R56A 4PLLA 3EFRA 1RL2A 3FDRA 4OB3B 2X3WD 2YRDA 2E3IA 3QPHA 2Y4YA 4CC3A 3CCEA 3CCSA 2EYQA 2ZPGB 4ORZA 1K9MU 2DILA 1BI2A 2PVGB 3ZFJA 2K57A 3G71A 2QQSA 2JJ9A 1UGRB 1GRIA 4JS4A 3WXMB 2GTOA 3V7SA 1UDLA 4KH0B 5LJ3f 4EIKA 1YWPA 3CMET 1O9SA 1QVFP 1WLPB 1WJSA 1VQKT 3GF5A 4PJOA 1UGPB 4D6WA 4M78G 4J5YA 3E9FA 2LCCA 2QQRA 4C92F 1M90R 2MYSA 2F2WA 2RQRA 2F5KA 4PKCC 1UGSB 3BFMA 2LX7A 4TVRA 4ANJA 3LGLA 5KYUB 2CP5A 2QASA 4J6XA 4J8OA 3CD6T 4J7FA 2M0YA 5LJ3j 1WJQA 4WCIA 3I55T 3CPWS 4D8KA 1QQJA 4F7UB 4J9GA 3S3OA 1YCYA 2LRQA 3M0SA 4AFQC 2L3QA 3G7ZA 4LD6A 1U8RA 3EFOA 4PK4A 2V8IA 4M77E 4JRKA 4V2SA 2DIQA 2LVMA 4LN2A 1YBYA 1Q82U 4C92G 3CCRT 4XTUA 2M51A 1QCOA 3META 3LH5A 4FYXB 2CZ6B 1ZA2B 1UGQB 4IUQA 3OYBA 3QZ9B 3JB9J 5KCOA 2ATCB 1IRXA 2KY9A 3VUZA 2V26A 2QI2A 1PD1A 4M78C 4P5NA 4CRIA 2AZVA 4KBMB 3GP8A 4RTWA 1VQMQ 1Y71A 1G3YA 3O5ZA 4PJNA 5LJ3g 1N8RC 2GQIA 2VUBA 1NJIC 2J6OA 2FEIA 9ATCB 2LNHB 1BIAA 3MKDA 5CQYA 2C0IA 4BE0A 5J3BA 2E6ZA 2EPDA 1AEYA 4R55A 2KRSA 2VV5A 5IXBA 4KT0E 3CCQA 1RAHB 2LCSA 1OPLA 3MP1A 1RABB 2RA2A 1D0XA 2ROTA 4M78A 2JS0A 2RD1A 1GXIE 1AWJA 2AKKA 4L6V5 3CCEQ 3QJYA 3O8VA 3OYDA 2QA4Q 4PL6A 1KD1C 2OAUA 1UHFA 2KEAA 2KROA 4J6WA 2NYSA 1RUWA 2LDMA 4AMCA 5D6YA 1UB4A 3OS5A 4MDWA 4M78D 3INZA 4FCYA 2SRCA 4C92C 5DM7R 3MEAA 5A0DA 3CC7T 2O4XB 3QYGB 1Q7YR 3QSUA 1QMCA 3OW2P 1VQ4T 1ZUYA 2EW3A 3X20B 4Y28E 1VQ6T 1Q86U 4OMLA 4RCBA 1QKWA 2CUDA 4IUTA 2V1RA 1I1JA 5C0MA 2LQ8A 3CCMA 4C8QF 3VS5A 3P8DA 1WPYA 2DL8A 1K9MR 1D3BA 2WSFE 1AWXA 5FWBA 2CS7A 2EGAA 1Z9ZA 2BE9B 2K9GA 3PTAA 3QZ5B 1RAGB 2ZPFB 2KT1A 1W2BS 1YJNA 2GQVA 5I22A 4XTVA 2KE9A 3SDZA 5CQXA 1M2OA 1MNEA 2VVKA 1U5SA 5GMKh 2RPNA 5C6SA 2KR3A 1PM3A 3ULRB 1GL5A 4C5GA 4C92D 2X4YA 2K5IA 3OS2A 2SEMA 5CO7A 1ZUKA 3FEOA 3JCMb 4X34A 1M3BA 4QVDA 4GBQA 1OX8A 4A4GA 5FU7C 4ZGEB 3JCMX 3QYHB 5I11A 1ZUUA 2J06A 3L42A 2HEQA 1WIEA 1YITA 2HBWA 1H8KA 1QW1A 1YWOA 2VWFA 3HFOA 5IAYA 3X25B 3LWIA 2K5FA 1WHJA 3KXTA 1LNXA 3M0UA 4IUPA 4AFUC 2DXBA 1X01A 5CKDA 1IB8A 1FXXA 4MMLA 2M9UA 2W0ZA 1Q81C 1VQPT 2DO3A 3CBMA 1YJ9T 3P8HA 1QP2A 1YJWA 1ZHIA 2YSQA 5IN1A 4HT9A 1SRLA 2E10A 5HK3A 2LJ0A 4A53A 4OGEA 1BI3A 4BD3A 3M0TA 2V8KA 3D7SB 1Q82R 2O31A 3OS0A 3M53A 4XU1A 3OQ5A 2L3PA 3L2VA 3HRUA 3CCQQ 5GJVB 3VYHB 4A4HA 2QEXQ 1MV3A 3SEMA 2L5QA 2DTHA 2RI3A 5GAN7 2FZGB 2NLUA 4Z02A 2EKHA 3VYGA 2D9TA 4A4KA 2L0AA 2Y90A 1RLPC 1X6GA 2HNIA 1VOMA 2DF6A 2YXYA 4ZGJB 2MCNA 3TREA 2EKOA 3QG1A 2C0TA 3RR6A 5GANf 2JVVA 4HKEA 3JAME 1JJ2P 2FHDA 1XOVA 3CCJA 2XI9A 1M8MA 5HCKA 5KYWB 5GAMd 2HL3A 2E4HA 2F69A 2RJEA 3E9GA 5GAMh 4DBQA 1M90C 4J9EA 2RK2A 1J3TA 2LNVA 4HVVA 1SRMA 1RACB 4LNPA 1LOJA 1WHMA 3KFVA 4NL3A 2P0PA 2MI6A 2DRMA 1VQ8Q 1YHQT 3RERA 3I5SA 1QVGA 2YT6A 4OVAA 4DA4A 2A3LA 1JRIA 2WACA 2RB6A 3CC2T 4OB1B 1LPLA 2XKOC 5GAN3 1XTDA 1MUZA 5GAOp 1H3ZA 3JCMh 3SWNB 5FROA 2DA9A 3MEVA 1B34B 2EYZA 5GANj 2ED0A 2LZ6B 1M2VB 1RI9A 3FC3A 4J9IA 1YIJT 3HFNA 2CH4A 3E19A 2CGHA 2IIMA 3I56T 5CK9A 1A0NB 4D8DA 2EJGA 3EG9A 4HCKA 1I0CA 2Y4XA 2ZGWA 1LVKA 3LYIA 4HVWA 4X9DA 4QKUA 1D1CA 4IUUA 1YITQ 1WHKA 2XDPA 4VUBA 3RKYA 2OTLA 4F7UA 3VRZA 5GAN2 3G4ST 4PJOF 3N5BB 2ZZDA 4ME7A 2RHUA 3CPWP 1GFCA 2C0OA 5KYXA 1NZ9A 4M7AG 5GANg 1QVFA 1OQKA 5D6WA 1SG5A 2RJCA 5KE3A 3OYLA 2OJ2A 4M75G 2KAFA 2DL7A 2K3BA 3GOXA 4XU2A 2X3XD 4AFZC 5FLXE 1VYUA 4OMPA 4BDYA 1B7TA 2H3JA 4ZGDB 4KH1B 4J9FA 4FSSA 1GFDA 2HKQB 4HCCA 2AHJB 5AYFA 2R58A 1E7OA 3KBGA 5GAOn 4M78E 3HSBA 2E12A 1O75A 4N4HA 2JW4A 1WI7A 4XK8E 2J6KA 2YUPA 5I2SA 4PJOG 1HYOA 2L3SA 1T3SA 2FRYA 2RM4A 2PUOB 1W4SA 4LXCA 4BY6B 4IUVA 3CCVA 2DD4A 1VQ9A 1VQNA 2NUTB 5L23A 1FMKA 3HRTA 1PSEA 2CZ1B 4B6MA 3FLGA 4OMFB 3J7AF 2AKLA 3CCJQ 1ABQA 1VQ7T 2D6FA 3JCMV 5FWCA 1X27A 3CBPA 3JCMQ 3V8KA 3X28B 4ZNXA 3RKWA 1GCPA 2OTJT 1KC8U 1VQLA 1LJOA 4Y92A 2F2VA 3CC4Q 4EMKB 1XNIA 1X69A 1C0MA 1DJ7B 2GBQA 1NG2A 4M7AC 4YTLA 4C0DC 1NLPC 4M75C 6AT1B 3QO3A 2VKNA 3CCLA 4C92E 2E1HA 2M0OA 1T3LA 2KRMA 4KGVB 5GAOl 4C5EA 1XJWB 4JPBW 3HL8A 1V76A 2YUOA 2RF0A 4QQDA 3MCAB 3QDRB 1KIKA 2PTKA 2ZCFB 2MAMA 3CCUT 4J9HA 2QDYB 1Q7YU 3HRSA 4RG8A 2X4JA 1K8AU 3X24B 4M78F 1FWZA 3H0HA 5L8RE 4E7JA 3SD4A 4IURA 1GBQA 3DKMA 4M7AA 3UA7A 4PJOC 2MWOA 3CQTA 5FU6C 4DOVA 3CXCS 4M75A 2XHCA 1AD5A 4O5VA 5FRMA 2K3YA 1W2BP 2RJFA 1KQSA 2KXDA 4M7AD 4LDYA 3CMEA 3LWHA 3FJ5A 1QCNA 2D0QB 3OYYA 5GAN4 2VB6A 1MNDA 1VQKA 1IZ6A 3PMTA 4M75D 2D0NA 2JM8A 1G3TA 5DLOA 1AOJA 4HCBA 4FL6A 1JXOA 4M77B 3OW2A 2HQHA 2OTLQ 3S6WA 3RIRA 1KQ1A 2AT1B 2PVOB 4BE2A 2RHIA 2YUNA 3EG0A 3E1SA 3SHWA 1X6BA 5GAOm 2CKKA 5DLQE 3QJ6A 1VIFA 1OYXA 4C8QB 3CMAQ 3CD6A 3FJPA 2E5KA 2RQWA 2EQMA 2EYXA 4RUGA 2QA4T 4PJOD 2YUQA 3VUBA 2ROLA 3OYNA 2R57A 3I55A 3NMZC 2XDBA 4LUDA 4BI4A 4FYYB 5AT1B 1QCFA 4KUDK 8AT1B 5A0LA 2J05A 5GAMe 2MMPA 2KT8A 3G6ET 4XQ3A 1UGVA 3A98A 3V7RA 3CCRA 1Q95G 3PE0A 4JUVA 4NS5A 1S72T 2F1LA 1XQHA 2JN0A 3CCVQ 1ACMB 4E6RA 2OAWA 4M7DA 4A63B 2K3XA 1G8XA 3WVEB 1ZSZB 1VQ9Q 1VQNQ 2KGTA 1E6GA 3DB4A 1SHGA 4JZ3A 4BUGA 2DL3A 1OI1A 1HD3A 2D8HA 1EX4A 4BACA 2EAYA 1PHTA 4DBRA 1BU1A 4KULA 3JCMe 2QQ9A 2FVUA 1VQLQ 1D1BA 4WF2A 3JB9G 1HK9A 4LDVA 1NYGA 4PFZA 1K0XA 4C8QE 1WYXA 1TUCA 2QTXA 1MHNA 1Q86C 4F14A 2EQJA 1I81A 3HP9A 4QVCA 1BB9A 2X4WA 3CCLQ 4JJNK 1U3OA 2MF2A 4ZTJA 2X4XA 5LJ5d 2DRKA 1D1AA 1WDXA 4F17A 1CKAA 4QQGA 2YLBA 2MK5A 5LJ5h 3TEEA 4JLGA 1KC8R 2EGEA 3OYJA 1PKSA 2A0FB 3OYAA 2EVRA 4MZMA 3GIBA 2M16A 1SF9A 4IIMA 1UECA 4MDXA 1UG1A 1WQWA 1G5VA 2VXEA 3EHRA 3C4SA 2GCXA 2CUBA 1RAEB 1OZ2A 2LX9A 3PT9A 2M1HA 3RNJA 1WXTA 3CC7A 2EJFA 1UE9A 2J7IA 1VQ4A 3CCSQ 1VQ6A 1AWOA 2FG0A 2FYKA 3G71Q 1U1SA 3CMEQ 4KGXB 1H92A 3NGPA 3M0PA 1VQKQ 2EQKA 1JJ2A 5HY6A 4EMHA 2W10A 4OF1A 2GFUA 2X51A 5GMKl 1TWBA 1K8AR 4MZPA 5IH2A 1BBZA 1M1GA 2RH2A 2JUFA 3UA6A 1EIFA 1IXDA 1I4K1 3VRYA 2QEXT 7AT1B 2DVJA 4OP0A 4BDZA 2RJDA 2QGFB 4LUEA 2P4RA 1X43A 3C95A 3EAEA 4KRTA 4HCZA 1AZGB 4O6JA 1VQOT 4JZ4A 1G2BA 5HK0A 3SFMA 4KUIA 4X9CA 4J6YA 1B07A 3I55Q 3OMGA 1K73C 5LL6S 2HMAA 2HAXA 1UTIA 3MP8A 4KGZB 5IXFA 3EGDA 4FT2A 4RTTA 3RESA 2DNUA 2YRVA 3FB9A 4HVUA 3PVLA 4JRQA 2PQWA 3J81E 3CCRQ 2M02A 4C0DB 4RTVA 1K76A 1ZQ1A 1VQ5T 2X9HA 3JB9D 1VQ8T 2DPPB 1H3HA 4F04B 1V29B 2FZCB 2PZ1A 4K11A 4OMQA 4RCCA 5GMKm 3QUIA 5GAOq 2LJ3A 4F7UF 2CZ7B 4CI0C 1N6AA 2DTIA 1VQPA 1YJ9A 2CP0A 2JXBA 1KD1U 3QXEB 3V8LA 4N4IA 2PU9B 1LCKA 1UFFA 5CKHA 4BI3A 1RAFB 2LJ1A 4GY5A 4PJOB 4FW1A 4LDWA 2DE0X 4C0ZA 2DJQA 2KI7A 1BIBA 2FL7A 2V8JA 2BIVA 2EIFA 1WFWA 1X2QA 3RDVA 2DBKA 2RMOA 3PMIA 3ME9A 2KYBA 1S1NA 2HZYA 2DXTA 4M7AE 2WSEE 1MMGA 2AIRB 2GFAA 2DX1A 4M75E 4F7UG 1PSFA 4FM4B 1Y0MA 2CSQA 2NUZA 1X6OA 1D0YA 1WZOA 5M9OA 4A4EA 3FRNA 2FRWA 2F2XA 2QAZA 1I5LA 3L2RA 5KYYA 3EFOB 2MIOA 1N9RA 4E7HA 1NE8A 1MV0B 2COWA 2H3EB 1YI2T 5CKEA 3M0RA 1EZZB 1OU9A 1BI1A 1Y96A 4AT1B 1V1CA 1YHQA 3JB9H 2IPOB 3P8BB 2ABLA 1M30A 4PJOE 3C0CA 4OMMA 3GNGA 3CC2A 5DY9A 4Z89A 4JRIA 2XU8A 1IGUA 3CXCP 4XTZA 5IHNA 4B9WA 3CCMQ 2COYA 3CBOA 4EDUA 1ZLMA 4EPCA 3VS0A 4E7KA 2VXFA 1NEGA 3GPLA 5LJ3h 1SPKA 3THKA 2BZYA 2FZKB 3JCMd 1YIJA 4MMKA 3EGXB 2DL5A 3I56A 2RQTA 1Q81U 1PCXA 1YJNQ 1OPKA 3EHQA 4XU0A 2XD0A 1QLYA 2J6FA 5A2QE 3RMQA 3MO8A 4M7AF 2JTMA 1GBRA 1SEMA 4Z8AA 2HD0A 4BI8B 4M75F 1BKBA 2G3RA 3CC4T 5KE2A 4OMNA 1KQSS 2CP3A 4M78B 4OB0B 5GANe 1OOTA 3G4SA 1ZA1B 1MGQA 3V8JA 5KYUA 5CVIA 2NUPB 3L2QA 2JOYA 1N8RR 2NWMA 3M54A 2LQWA 3UPUA 1VQPQ 1E6HA 1M4ZA 5LJ5e 2E70A 4CC7A 3L2ZA 2BUDA 1WXBA 1JEGA 4ELYC 2KBTA 3UATA 2KSSA 4B9XA 1WHLA 4FSXA 3OBWA 1ZSZA 5CKFA 1NEBA 2L8DA 2PVDB 3H41A 2L89A 3M56A 3JRZA 5GJWB 1D3BB 2EYWA 3TVTA 1K1ZA 1YJWQ 3ZL7C 3VS4A 1K4US 1TG0A 4CC2A 2VC8A 4FIBA 2QXFA 2FO0A 2DIGA 4C92B 2O01E 5D7UA 1KD1R 5KH6A 2ZPBB 2HBPA 4E2FB 2E64A 4PFOA 2YWWA 2B8AA 3VU3C 3RKXA 3TSZA 3F70A 1VQ7A 2CYZB 4RTUA 1KFZA 1Q7YC 2DBMA 3UWNA 4M7DF 4PLIA 4N4GA 2OTJA 4E47A 5IHKA 1IHWA 3A8LB 3OYHA 1N9SA 4JRPA 3MJXA 2DM1A 2RHXA 4XTXA 3X26B 3CMAT 1CKBA 2RN8A 1K9MC 1YHQQ 3E2UA 3VV0A 2Z0WA 1TS9A 3CC2Q 1M5Q1 3M55A 2O9VA 5EG2A 4ATOA 2CT4A 1SSHA 3I35A 4XU3A 3CCUA 5GMKj 3VS3A 1KK7A 3CEYA 4CC4B 1M3CA 4DOWA 4M7DG 2O4XA 1BCOA 2EFIA 5FU7B 1KG1A 3I56Q 5KYNA 3MP6A 2RI5A 2CZ0B 1P92A 4M4ZA 5CAIA 4DEYA 4C0FA 1OU8A 2V1QA 2BTTA 2QTVA 4RTXA 5IT9E 4OMOA 4PJJA 3H9NA 2XMFA 4X1VA 1RAIB 1G3SA 3H0FA 2QK0A 2WSCE 3GBQA 2K7AA 2QQBA 3M57A 2EBPA 2O88A 1M1KU 3JB9I 3PVQA 1EFNA 2QYZA 3M4YA 3DLLA 1ZSGA 3TU4K 2MWPA 5J39A 4EMGA 3G4SQ 2ZPHB 2OX7A 4ELZC 1AWWA 2EJ9A 1VQMT 1Q81R 1M3AA 1FMWA 2KQWA 1ZBXA 2DYIA 1K0SA 4DQ2A 1PWTA 3LX7A 5GAMf 5IHIA 2JTFA 3EH2A 1Q82C 2QA4A 1UJYA 5GAN5 4II1A 2YDLA 3MHXA 4LD9K 4PFPA 1GCQC 1YFNA 3M4GA 4ZN3A 1M8VA 1N27A 1R8OB 2GF7A 1RADB 4M7DC 2A37A 2KRNA 3RMSA 3CCST 3CCET 3G6EA 2JMCA 3HHTB 3JCMf 4QVZA 3G71T 1S72A 3EFSA 4XTYA 2JT4A 1TUDA 3JB9F 2HDAA 1PD0A 1OV3A 5CKBA 4BB7A 1U06A 2DXCA 1CSKA 2LT4A 1JBMA 2DZ9A 2E6NA 2GGRA 5GAMj 3PIOA 1VQ7Q 3OY9A 2QG9B 3HKSA 3G1JA 2YLCA 1GCQA 4OB2B 2IVWA 2ZAEA 3LLRA 3EG9B 1FMVA 4F16A 1RAAB 2OTJQ 1NLOC 1ABOA 2VYTA 4DEXA 1K9AA 4RMOA 1OX9A 3QHSA 1VIEA 2I0NA 1TH7A 1WHHA 2CSIA 3UDCA 2ZPIB 3TCJA 5GMKi 3VS1A 5LJ3e 2RK1A 5A0GA 3NFCA 2X35A 4M7DD 1PC0A 2EQIA 3MPUB 4Y91A 2E41A 3R6NA 3SB2A 4J9DA 2R5MA 3EH1A 1TU0B 2DLPA 5GANd 5KYXB 5D6XA 2CP7A 5GANh 1WHGA 3NTHA 2MPXC 3L2WA 2CT3A 3CCUQ 3SWNC 3H0IA 5KYWA 3BW1A 3ZEHA 1OEBA 1VUBA 3M59A 5GAMg 1HSQA 1T0HA 1OZ3A 2CREA 4N0AC 2RO0A 3FIFA 2G6FX 4J83A 5CCAA 3U23A 3JCMW 1I8FA 5J26A 4AFSC 1U1TA 3KUFA 2ESWA 2BZ8A 1KJWA 3EGXA 3JCMg 3EG2A 1ZX6A 3SWNA 1AZEA 2DERA 4C0GA 1TXQA 3OYKA 2E5QA 1B34A 4OGCA 4F7UE 1M2VA 4WTOB 1JB0E 1N5ZA 2QEXA 1NPRA 1Y07A 1QWEA 1PNJA 4N0AA 1M1FA 2RI2A 4DBHA 1W1FA 2ED1A 2P4TA 1BK2A 4R0KA 1QVPA 2E65A 2KMTA 2HSEB 1VQOA 4Z88A 1KHCA 1M1KR 2YRCA 1KQSP 1HJDA 3A8HB 3EGUA 4HXJA 3CXCA 3NTIA 4BE1A 1OULA 3CCQT 1QVGS 3OYCA 2CH4W 4UC4A 2HKNA 2NUPA 4M77F 2PNIA 1QWFA 3H6ZA 2VGNA 3BDLA 3PFSA 1W6XA 2I2LA 3CD6Q 3G6EQ 2COZA 1M9SA 2LP5A 1S72Q 3PGGA 1VQ5A 2DXUA 3M0QA 3T9NA 4FYVB 3A8OB 1VQ8A 1N8RU 1YN8A 4XAXB 3VS2A 1NJIU 2JMAA 4QW2A 4BY6C 1KSWA 4AG1C 3V7CA 4M7AB 4RTYA 2YHTA 4RKUE 3OS1A 2DD5A 3L1AA 1UEBA 2A36A 2FPDA 4M75B 3VJPA 3GNFB 2XIDA 1JU5C 4C92A 3CCMT 3EG3A 4FW2A 3JCMJ 2KYMA 1ARKA 3RBBB 3QKJA 4M77G 3QIIA 5FW9A 3JV3A 8ATCB 2XDDA 3REAB 4EMKC 2MOXA 1NYFA 2DJZA 3URGA 1AT1B 3LGFA 4A54A 4AG2C 2DFUA 1VA7A 1YJNT 2HQXA 4GLMA 4J9BA 1QVFS 4JS5A 1AVZC 2RQVA 3L2UA 2JNGA 3GLXA 3QWYA 4C8QG 3OSVA 3CPWA 2QQAA 5I2MA 2NUTA 5FU6B 1TSFA 1WX6A 3TSWA 1TOVA 1R77A 2DYBA 4J9CA 4DBFA 3MEUA 2HL5C 2DEQA 1FYNA 2DTOA 3M9QA 3BDUA 2CP2A 3OYIA
chains in the Genus database with same CATH topology
4ELYC 5FRMA 2KSSA 4EMKA 4B9XA 2K3YA 4FSXA 5CQYA 2RJFA 1KQSA 3OBWA 2K4YA 5J3BA 4BE0A 2E6ZA 5CKFA 4M7AD 2C06A 2L8DA 4LDYA 2PVDB 2XICA 4R55A 2L89A 3CMEA 3M56A 2VV5A 2D0QB 3OYYA 3LWHA 3JRZA 4HA8A 3OB9A 5GAN4 3S3NA 1VQKA 4KT0E 3CCQA 1IZ6A 1YITT 3PMTA 4M75D 1D3BB 1YI2A 1G3TA 3MP1A 1K73U 5DLOA 4JDSA 4HCBA 4FL6A 2RA2A 2VC8A 4M77B 3OW2A 4FIBA 2QXFA 3S6WA 3DLMA 4M78A 3RIRA 1KQ1A 2RD1A 3S3MA 2DIGA 2PVOB 1GXIE 4BE2A 2LT1A 2RHIA 4L6V5 4C92B 3QJYA 2EQUA 2O01E 4A4FA 3O8VA 4J7IA 3OYDA 4PL6A 2ZPBB 5KH6A 2OAUA 1KD1C 4M7DB 2HBPA 3E1SA 2E64A 4J6WA 4LDUA 5GAOm 4M77C 2LDMA 2CKKA 5D6YA 1RI0A 1UB4A 3OS5A 5DLQE 1YJWT 1IREB 3QJ6A 3QBYA 4MDWA 1VIFA 4M78D 3INZA 2B8AA 4C92C 1OYXA 5DM7R 3VU3C 3RKXA 3MEAA 4C8QB 5A0DA 3CC7T 2KK4A 3F70A 4E7IA 1VQ7A 3CD6A 3FJPA 3R6OA 2O4XB 3QYGB 2CYZB 3M5AA 3QSUA 1Q7YC 1VQ4T 2EQMA 2IG0A 3UWNA 4M7DF 2QA4T 3OYFA 4PLIA 4PJOD 3VUBA 3OYGA 4N4GA 3ZBDA 3X20B 3OYNA 4E47A 4Y28E 1VQ6T 2OTJA 2R57A 3I55A 1Q86U 4RCBA 2KDSA 3A8LB 4IUTA 3OYHA 4C8QC 2XDBA 5C0MA 1N9SA 4JRPA 3OMCA 4BI4A 2LQ8A 3LW5E 2RHXA 3C12A 4XTXA 3X26B 3CCMA 4FT4A 4C8QF 4KUDK 1BYMA 3CMAT 5A0LA 3P8DA 3A8GB 1WPYA 2EWNA 5GAMe 2MMPA 2P0KA 3C94A 1D3BA 5LJ3d 2WSFE 1G3WA 3H8ZA 1K9MC 1WJRA 2CS7A 3G6ET 4XQ3A 1FX7A 3PNWC 3VV0A 3V7RA 3CCRA 3PTAA 3QZ5B 4JUVA 4NS5A 1S72T 4M77A 2ZPFB 3CC4A 1M5Q1 1W2BS 1YJNA 3M55A 4NOYA 1XQHA 2JN0A 3UT1A 5LJ5f 2GQVA 4M7DA 2K3XA 2PUKB 3WVEB 4XTVA 3CCJT 2LC4A 4IKFA 5EG2A 4ATOA 3SDZA 4MZTA 3DB4A 5CQXA 4M77D 4XU3A 4BUGA 3CCUA 5GMKj 1BI0A 3DB3A 5GMKh 5GAN8 3CEYA 5C6SA 1OI1A 4L59A 4DOWA 4C5GA 4C92D 2DVEA 2KVQG 2X4YA 4C8QA 2EAYA 4BACA 4M7DG 2K5IA 4M7DE 3JCMe 4KULA 2O4XA 2QQ9A 3OS2A 2FVUA 2EFIA 3VKIA 5FU7B 5CO7A 3FEOA 1KG1A 4WF2A 2DAQA 3JCMb 3JB9G 4X34A 5FRNA 1HK9A 2RI5A 3MP6A 2CZ0B 4LDVA 2R5AA 4QVDA 1P92A 1WQ7A 4C8QE 5CAIA 4FU6A 4C8QD 4C0FA 3AHUA 2QTXA 1MHNA 4A4GA 1W2BA 3NTKA 5FU7C 4ZGEB 3JCMX 1Q86C 2EQJA 5IT9E 3BY7A 1I81A 3QYHB 3HP9A 4HT8A 4QVCA 1G3SA 2X4WA 3OW2S 2WSCE 2HQEA 3L42A 2QQBA 3M57A 5HKCA 1YITA 4ZN1A 1QW1A 1M1KU 3JB9I 4JJNK 2K2VA 2MF2A 4E7LA 3HFOA 5IAYA 4ZTJA 2X4XA 3CPFA 3X25B 5LJ5d 3LWIA 3M4YA 3DLLA 2K5FA 3TU4K 3KXTA 1HXDA 2MWPA 4QQGA 1LNXA 2YLBA 5J39A 4EMGA 3TEEA 4JLGA 5LJ5h 5LJ5j 4IUPA 2ZPHB 4ELZC 3OYJA 1KC8C 2DXBA 3OYAA 3RUXA 2EJ9A 1VQMT 4MZMA 1X01A 3GIBA 2M16A 5CKDA 1FXXA 1M90U 4MDXA 1QP3A 1WQWA 2M9UA 2VXEA 4MMLA 1Q81C 1G5VA 3C4SA 2GCXA 1VQPT 2KQWA 1ZBXA 2DO3A 3CBMA 1YJ9T 3P8HA 4NL2A 1SSFA 1OZ2A 1QP2A 1ZHIA 2LX9A 4C5HA 1YJWA 5IN1A 4HT9A 2E10A 3PT9A 4DQ2A 2M1HA 5HK3A 3HPWA 3JSCA 3LX7A 5GAMf 4A53A 4OGEA 1BI3A 3CC7A 4BD3A 4Q5WA 2JTFA 2V8KA 2RHYA 2EJFA 3ASKA 1Q82C 1VQ4A 3OS0A 3M53A 4XU1A 2QA4A 2L3RA 4LDXA 3OQ5A 2K5LA 3MHXA 4II1A 5GAN5 4LD9K 1VQ6A 5KCHA 2LCLA 2FYKA 1H641 2BKDN 1U1SA 3M4GA 1KQ2A 4QQ6A 3L2VA 3HRUA 2EQKA 4ZN3A 5HY6A 1JJ2A 1M8VA 1N27A 4EMHA 3CMAA 4OF1A 2GFUA 3VYHB 1R8OB 4A4HA 2GF7A 5GAN7 2L5QA 2DTHA 2RI3A 2OTLT 4M7DC 2NLUA 3RMSA 4Z02A 3CCST 3CCET 4GLKA 4M75A 3VYGA 5GMKl 3G6EA 2D9TA 4MZPA 2JZ2A 4A4KA 3HHTB 3JCMf 2A7YA 2Y90A 3OA6A 1K8AC 3OYEA 1M1GA 2P0QA 2HNIA 4QVZA 5LJ5g 3G71T 1S72A 3EFSA 4XTYA 1WNLA 2RH2A 2JUFA 1M1KC 1Y7XA 4ZGJB 1EIFA 3JB9F 1I4K1 1KHIA 3TREA 2EKOA 3QG1A 5GANf 2RHZA 4ZTFA 2JVVA 4HKEA 2QEXT 3JAME 4OP0A 4PNOA 2FHDA 5CKBA 4BB7A 1XOVA 2RJDA 2XI9A 3CCJA 5GAMd 4BDZA 2DXCA 2LT4A 1JBMA 2DZ9A 2E6NA 3C95A 3EAEA 3A5ZB 2F69A 2RJEA 3E9GA 5GAMj 4HCZA 5GAMh 2XG8D 3PIOA 1M90C 3OY9A 3OYMA 3HKSA 4O6JA 2RK2A 2YLCA 4OB2B 3MEWA 1VQOT 5HK0A 2IVWA 5GAN6 3LLRA 2LNVA 3SFMA 4KUIA 4X9CA 3M58A 4J6YA 4RG2A 3OSSC 2VYTA 3OMGA 4RMOA 1AHJB 1K73C 5LL6S 1LOJA 3QHSA 1VIEA 1TH7A 4NL3A 2HAXA 2P0PA 2MI6A 3UDCA 2ZPIB 3MP8A 3TCJA 1YHQT 5GMKi 3RERA 3LH0A 5LJ3e 3JCMP 2RK1A 2LTOA 5A0GA 1QVGA 4FT2A 4OVAA 3NFCA 3RESA 4DA4A 2A3LA 1JRIA 2X35A 2F5TX 2WACA 2RB6A 2YRVA 3CC2T 3FB9A 4OB1B 2XKOC 2DZCA 4JLIA 4JRQA 2PQWA 5GAN3 4M7DD 3J81E 1XTDA 4Y91A 4C0DB 2E41A 1WGSA 5GAOp 3SB2A 3CCVT 1H3ZA 3JCMh 1ZQ1A 2R5MA 1VQ5T 3SWNB 2FB7A 5GANd 1VQ9T 5FROA 3JB9D 1VQ8T 2LQKA 2DPPB 5D6XA 1VQNT 3MEVA 1B34B 5GANj 5GANh 1V29B 5GMKe 3ER0A 5CIUA 3NTHA 4M7AE 4RCCA 4C5IA 5GMKm 3L2WA 3QUIA 2ZPEB 5GAOq 3JCMc 1VQMA 3SWNC 4F7UF 2CZ7B 3BW1A 3ZEHA 4CI0C 3FC3A 1YIJT 1VUBA 3HFNA 3E19A 1N6AA 2DTIA 3M59A 5GAMg 1VQPA 1VQLT 2CGHA 3PIPA 3Q1JA 1YJ9A 4L5GA 1KD1U 3I56T 3WVDB 3J80E 2VGMA 3QXEB 3A8MB 3V8LA 4N4IA 1OZ3A 5CK9A 3OBYA 2PU9B 5I21A 2EJGA 5CKHA 4BI3A 4N0AC 2RO0A 4XTWA 1X75C 1JJ2S 2DK3A 1NPPA 3FIFA 4GY5A 4PJOB 4J83A 2XK0A 2Y4XA 5CCAA 3CCLT 3JCMW 4LDWA 1I8FA 2ZGWA 4C0ZA 5CR2A 1Y96B 1BIBA 2DKGA 2FL7A 3LYIA 5J26A 4R56A 5GAOr 4PLLA 3EFRA 1RL2A 4X9DA 2V8JA 1U1TA 3KUFA 3FDRA 2BIVA 4IUUA 2EIFA 4OB3B 2XDPA 4VUBA 3QPHA 3RKYA 2OTLA 4F7UA 3PMIA 3JCMg 5GAN2 3G4ST 4PJOF 2Y4YA 3N5BB 2ZZDA 3ME9A 3CCEA 3CCSA 2EYQA 4ME7A 2RHUA 3SWNA 2ZPGB 1NZ9A 4C0GA 1K9MU 2DXTA 3OYKA 1BI2A 2E5QA 2PVGB 2WSEE 1B34A 4OGCA 2K57A 3ZFJA 5GANg 5D6WA 3G71A 1QVFA 3L2ZA 2QQSA 2GFAA 2RJCA 5KE3A 3OYLA 4F7UE 1UGRB 4M75E 4F7UG 4M75G 2KAFA 4JS4A 1PSFA 4FM4B 3WXMB 1JB0E 1X6OA 3GOXA 2QEXA 4XU2A 1NPRA 1Y07A 1VQKT 3V7SA 5FLXE 4N0AA 1M1FA 5LJ3f 2RI2A 4A4EA 5M9OA 4BDYA 3FRNA 2P4TA 2H3JA 4ZGDB 1QVPA 2KMTA 2E65A 1VQOA 1KHCA 1I5LA 3L2RA 3A8HB 3CMET 3CXCA 1O9SA 4HCCA 1N9RA 2AHJB 2R58A 3NTIA 1WJSA 5AYFA 3CCQT 1NE8A 3GF5A 4BE1A 4E7HA 3KBGA 3OYCA 1QVGS 4PJOA 1UGPB 1YI2T 5CKEA 4UC4A 4M78E 4D6WA 5GAOn 4M78G 4J5YA 3E9FA 1BI1A 1Y96A 4M77F 3HSBA 2E12A 1O75A 4N4HA 3H6ZA 1YHQA 2VGNA 3BDLA 3PFSA 4XK8E 2LCCA 3JB9H 2QQRA 2I2LA 4C92F 5I2SA 3P8BB 4PJOE 2F5KA 4PJOG 4PKCC 3GNGA 1UGSB 3CC2A 3BFMA 4TVRA 5DY9A 4JRIA 2RM4A 1M9SA 2PUOB 1W4SA 2XU8A 4BY6B 3LGLA 4IUVA 3CCVA 2DD4A 3PGGA 1VQ5A 2DXUA 3T9NA 1VQ9A 4XTZA 1VQNA 3A8OB 1VQ8A 1N8RU 4B9WA 3HRTA 4XAXB 1PSEA 2CZ1B 4J6XA 1NJIU 3FLGA 4J8OA 4OMFB 3J7AF 3CBOA 4EDUA 1VQ7T 3CD6T 4QW2A 3JCMV 4BY6C 4J7FA 4EPCA 2VXFA 4E7KA 2D6FA 3CBPA 3JCMQ 3V8KA 5LJ3j 3GPLA 3X28B 5LJ3h 3V7CA 3RKWA 4M7AB 2OTJT 1WJQA 3JCMd 1YIJA 1KC8U 3I55T 3CPWS 2YHTA 4RKUE 3OS1A 1VQLA 1LJOA 4MMKA 2DD5A 3L1AA 1UEBA 4F7UB 4M75B 3VJPA 3S3OA 3GNFB 1YCYA 3I56A 2LRQA 1Q81U 2XIDA 3G7ZA 1XNIA 4LD6A 4C92A 4EMKB 3CCMT 4XU0A 1DJ7B 1U8RA 3JCMJ 4M7AC 2XD0A 4YTLA 3QKJA 2V8IA 4M77E 3RMQA 5A2QE 4M77G 4JRKA 3MO8A 4C0DC 4M7AF 3QIIA 2JTMA 4M75C 4V2SA 2XDDA 2DIQA 2LVMA 3QO3A 1YBYA 4EMKC 3CCLA 4C92E 1Q82U 2E1HA 2HD0A 4BI8B 4C92G 4M75F 2DJZA 4XTUA 2M0OA 1BKBA 2G3RA 3CCRT 3URGA 3LGFA 4A54A 3META 3CC4T 1YJNT 5KE2A 5GAOl 2HQXA 4C5EA 1KQSS 4M78B 3HL8A 4OB0B 2CZ6B 1QVFS 4JS5A 4M7AG 1UGQB 4IUQA 5GANe 3OYBA 3L2UA 2JNGA 3QZ9B 3G4SA 3GLXA 3MCAB 3QDRB 4QQDA 2KY9A 3OSVA 4C8QG 5KCOA 3CPWA 3JB9J 2ZCFB 3VUZA 2QI2A 2QQAA 5I2MA 2MAMA 3CCUT 1MGQA 3V8JA 5FU6B 4M78C 4P5NA 2QDYB 5CVIA 4KBMB 4CRIA 3HRSA 1Q7YU 4RG8A 3L2QA 2X4JA 3GP8A 1K8AU 3X24B 2JOYA 4M78F 1FWZA 1G3YA 1Y71A 3M54A 3MEUA 5L8RE 4E7JA 5LJ3g 1N8RC 3SD4A 2VUBA 4IURA 3UPUA 2DEQA 3DKMA 1NJIC 4M7AA 4PJOC 2MWOA 2DTOA 5FU6C 4DOVA 3M9QA 3BDUA 1M4ZA 3OYIA 5LJ5e 2E70A 3CXCS 2BUDA 2XHCA 1BIAA 4O5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  4EMK A;  1I5L A;  4QVD A;  1WQ7 A;  4C8Q E;  5CAI A;  4C8Q D;  1LOJ A;  1N9R A;  3QHS A;  3AHU A;  1TH7 A;  2QTX A;  4NL3 A;  4M7A D;  4PJO A;  3JCM X;  5GAO n;  4M78 E;  4M78 G;  3BY7 A;  4HA8 A;  4J5Y A;  1I81 A;  5GMK i;  5GAN 4;  3RER A;  1Y96 A;  4M77 F;  4M75 D;  1D3B B;  5LJ3 e;  4QVC A;  4HT8 A;  3JCM P;  3HSB A;  4M7D E;  3RES A;  3JB9 H;  1JRI A;  2I2L A;  4C92 F;  2RB6 A;  3FB9 A;  3JB9 I;  2DZC A;  4JLI A;  5GAN 3;  4M7D D;  4PJO E;  3HFO A;  2RA2 A;  2VC8 A;  4PJO G;  4Y91 A;  2E41 A;  4M77 B;  5LJ5 d;  3BFM A;  5GAO p;  3SB2 A;  5DY9 A;  3JCM h;  4M78 A;  3RIR A;  1KQ1 A;  2RD1 A;  4JRI A;  2RM4 A;  3SWN B;  1HXD A;  2FB7 A;  5GAN d;  5LJ5 j;  1LNX A;  2YLB A;  4C92 B;  4EMG A;  5LJ5 h;  3JB9 D;  3JB9 G;  3PGG A;  4M7D B;  1B34 B;  2DXU A;  3RUX A;  5GAN j;  4XTZ A;  5GAN h;  5GMK e;  2EJ9 A;  2E64 A;  4J6W A;  3GIB A;  1X01 A;  5GAO m;  4M77 C;  4RCC A;  4J6X A;  5GMK m;  3QUI A;  4MML A;  1WQW A;  2VXE A;  5GAO q;  4M78 D;  3INZ A;  3JCM c;  3SWN C;  4F7U F;  3BW1 A;  3JCM V;  4C92 C;  4NL2 A;  2VXF A;  3RKX A;  3HFN A;  3VU3 C;  4C8Q B;  3JCM Q;  2DTI A;  3V8K A;  5LJ3 j;  5GAM g;  4HT9 A;  2E10 A;  3FJP A;  2CGH A;  4M7A B;  3RKW A;  5LJ3 h;  3V7C A;  4DQ2 A;  5GAM f;  3JCM d;  3QSU A;  4A53 A;  2YHT A;  4M7D F;  1LJO A;  4MMK A;  3L1A A;  4PJO D;  4F7U B;  4M75 B;  3V8L A;  5I21 A;  1YCY A;  2EJF A;  2EJG A;  4RCB A;  4XU1 A;  4C92 A;  4EMK B;  5GAN 5;  4C8Q C;  1N9S A;  4N0A C;  4XU0 A;  4XTW A;  3JCM J;  4M7A C;  3FIF A;  4XTX A;  4PJO B;  2FYK A;  1H64 1;  4C8Q F;  3JCM W;  4M77 E;  1U1S A;  4JRK A;  3M4G A;  4M77 G;  1KQ2 A;  4M7A F;  1I8F A;  2ZGW A;  4M75 C;  4V2S A;  1WPY A;  1Y96 B;  1BIB A;  2DKG A;  3QO3 A;  5GAO r;  2EWN A;  4EMK C;  5GAM e;  1M8V A;  4X9D A;  1D3B A;  3EFR A;  5LJ3 d;  2E1H A;  4C92 G;  4C92 E;  4EMH A;  4M75 F;  2DJZ A;  4XTU A;  1U1T A;  4XQ3 A;  5GAN 7;  4A54 A;  2DTH A;  4M7D C;  3V7R A;  5GAO l;  4JUV A;  3RKY A;  5GMK l;  4F7U A;  4M77 A;  4M78 B;  3JCM g;  5GAN 2;  4PJO F;  1M5Q 1;  4WF2 A;  3JCM f;  2Y90 A;  5GAN e;  2HNI A;  4NOY A;  5LJ5 g;  3SWN A;  3EFS A;  4XTY A;  1WNL A;  3JB9 J;  2JN0 A;  4C8Q G;  5LJ5 f;  3JB9 F;  2DXT A;  4M7D A;  4M7A E;  4M7A G;  1I4K 1;  1B34 A;  5GAN g;  2K57 A;  4XTV A;  1MGQ A;  3V8J A;  5GAN f;  4M78 C;  4F7U E;  4M75 E;  4OP0 A;  4PNO A;  4M77 D;  4M75 G;  4XU3 A;  4F7U G;  5GMK j;  5GAM d;  5GMK h;  5GAN 8;  1JBM A;  2DZ9 A;  4M78 F;  4XU2 A;  4C92 D;  3V7S A;  2DVE A;  4C8Q A;  5LJ3 g;  5GAM j;  2EAY A;  3JCM b;  5GAM h;  4M7D G;  2DEQ A;  4N0A A;  5LJ3 f;  3JCM e;  4M7A A;  4PJO C;  2DTO A;  2YLC A;  3BDU A;  5GAN 6;  5LJ5 e;  2E65 A;  3L2Z A;  4M75 A;  1BIA A;  4X9C A;  4J6Y A; 
#chains in the Genus database with same CATH topology
 2CP6 A;  4EMK A;  2K4Y A;  3UF4 A;  2C06 A;  2XIC A;  4PJM A;  3VS7 A;  4HA8 A;  3S3N A;  3OB9 A;  1F1B B;  1YIT T;  1YI2 A;  2A28 A;  1K73 U;  1C1A A;  4IIO A;  4JDS A;  3CC7 Q;  1JO8 A;  3DLM A;  3S3M A;  2LT1 A;  2EQU A;  1YNZ A;  4A4F A;  1VQ4 Q;  1YCS B;  4J7I A;  4M7D B;  1IGQ A;  1VQ6 Q;  4LDU A;  4M77 C;  4RTZ A;  3NPF A;  1RI0 A;  1YJW T;  1MMA A;  1IRE B;  3QBY A;  1JQQ A;  2E3H A;  2KK4 A;  1G83 A;  4E7I A;  3R6O A;  1MMD A;  3M5A A;  4JJC A;  2IG0 A;  2DMO A;  3OYF A;  3OYG A;  3ZBD A;  1VQO Q;  2KDS A;  1MMN A;  4C8Q C;  3OMC A;  2DEU A;  3LW5 E;  1VYT A;  3C12 A;  3I9Q A;  2L2P A;  2D8J A;  2RQU A;  4FT4 A;  1BYM A;  1PRM C;  3A8G B;  2DET A;  2EWN A;  2P0K A;  3C94 A;  5LJ3 d;  1NBE B;  1G3W A;  3H8Z A;  2KNB B;  1WJR A;  1R0B G;  1FX7 A;  3PNW C;  2ENM A;  2AK5 A;  2A08 A;  3QDF A;  2QGG A;  2FPE A;  4M77 A;  2GTJ A;  3CC4 A;  2HCK A;  4NOY A;  3I5R A;  1W70 A;  3UT1 A;  5LJ5 f;  2CDT A;  2K79 A;  1VQ5 Q;  2PUK B;  3CCJ T;  2LC4 A;  4IKF A;  1JXM A;  1Z9Q A;  4MZT A;  4M77 D;  1UHC A;  1BI0 A;  3DB3 A;  5GAN 8;  4L59 A;  1PG5 B;  2DVE A;  2KVQ G;  4C8Q A;  4M7D E;  1ZSZ C;  3VKI A;  5ECA A;  2DAQ A;  5FRN A;  2R5A A;  1WQ7 A;  4FU6 A;  4C8Q D;  3BE3 A;  3AHU A;  2FPF A;  1Q86 R;  1W2B A;  1I07 A;  3NTK A;  2BZX A;  3BY7 A;  1UJ0 A;  4HT8 A;  3OW2 S;  1VYV A;  2HQE A;  5HKC A;  4LE9 A;  4ZN1 A;  1NJI R;  2K2V A;  3AT1 B;  4E7L A;  2K6D A;  1YJ9 Q;  3CPF A;  4PJL A;  3TQ7 P;  2LQN A;  2EGC A;  1X2K A;  1HXD A;  5LJ5 j;  1PRL C;  4E7S A;  5EC7 A;  1KC8 C;  3RUX A;  2H8H A;  2EYY A;  2HSP A;  1M90 U;  2LMJ A;  1QP3 A;  1TTH B;  1NM7 A;  2ECZ A;  4NL2 A;  1SSF A;  4C5H A;  2AZS A;  3HPW A;  1WA7 A;  3JSC A;  2JS2 A;  4Q5W A;  4ESR A;  2RHY A;  2QDL A;  3ASK A;  2L3R A;  1YP5 A;  4LDX A;  2K5L A;  5KCH A;  2LCL A;  1H64 1;  2DL4 A;  2BKD N;  2P84 A;  2OI3 A;  1KQ2 A;  4QQ6 A;  1M27 C;  4QT7 A;  2VAS A;  3EG1 A;  3CMA A;  3EGD B;  1YI2 Q;  2O9S A;  2OTL T;  1QKX A;  4GLK A;  1RLQ C;  1IO6 A;  1Y57 A;  2JZ2 A;  1K8A C;  1ZBJ A;  2A7Y A;  3OA6 A;  3OYE A;  2P0Q A;  5LJ5 g;  1M1K C;  1WNL A;  1Y7X A;  1PKT A;  3VS6 A;  1SHF A;  1KHI A;  4ZTF A;  2RHZ A;  3HTR A;  1UUE A;  2BE7 D;  4PNO A;  1D0Z A;  3A1P A;  2JTE A;  1TUG B;  3A5Z B;  2XG8 D;  3OYM A;  3MEW A;  2JM9 A;  1BCM A;  3REB B;  5GAN 6;  1R0C B;  2B86 A;  3M58 A;  4RG2 A;  3OSS C;  2RNA A;  1K73 R;  4JJD A;  1AHJ B;  3LH0 A;  3JCM P;  2LTO A;  2F5T X;  2DZC A;  4JLI A;  1D09 B;  3IQL A;  1SKU B;  1WGS A;  1IHV A;  1YIJ Q;  3CCV T;  2FB7 A;  1VQ9 T;  1VQN T;  2LQK A;  1B3Q A;  1T0J A;  3NHN A;  1I5O B;  3QWX X;  5GMK e;  3ER0 A;  5CIU A;  4C5I A;  2ZPE B;  3JCM c;  1VQM A;  1QVG P;  2O2O A;  1VQL T;  3PIP A;  3Q1J A;  4L5G A;  4JJB A;  3WVD B;  3J80 E;  2D1X A;  4FYW B;  4E7Z A;  2VGM A;  3A8M B;  5I21 A;  3OBY A;  2K2M A;  5KYY B;  2GNC A;  4XTW A;  1JJ2 S;  1X75 C;  2DK3 A;  1NPP A;  2XK0 A;  1WXU A;  3CCL T;  1C6V X;  2KXC A;  5CR2 A;  1Y96 B;  2DKG A;  5GAO r;  4R56 A;  4PLL A;  3EFR A;  1RL2 A;  3FDR A;  4OB3 B;  2X3W D;  2YRD A;  2E3I A;  3QPH A;  2Y4Y A;  4CC3 A;  3CCE A;  3CCS A;  2EYQ A;  2ZPG B;  4ORZ A;  1K9M U;  2DIL A;  1BI2 A;  2PVG B;  3ZFJ A;  2K57 A;  3G71 A;  2QQS A;  2JJ9 A;  1UGR B;  1GRI A;  4JS4 A;  3WXM B;  2GTO A;  3V7S A;  1UDL A;  4KH0 B;  5LJ3 f;  4EIK A;  1YWP A;  3CME T;  1O9S A;  1QVF P;  1WLP B;  1WJS A;  1VQK T;  3GF5 A;  4PJO A;  1UGP B;  4D6W A;  4M78 G;  4J5Y A;  3E9F A;  2LCC A;  2QQR A;  4C92 F;  1M90 R;  2MYS A;  2F2W A;  2RQR A;  2F5K A;  4PKC C;  1UGS B;  3BFM A;  2LX7 A;  4TVR A;  4ANJ A;  3LGL A;  5KYU B;  2CP5 A;  2QAS A;  4J6X A;  4J8O A;  3CD6 T;  4J7F A;  2M0Y A;  5LJ3 j;  1WJQ A;  4WCI A;  3I55 T;  3CPW S;  4D8K A;  1QQJ A;  4F7U B;  4J9G A;  3S3O A;  1YCY A;  2LRQ A;  3M0S A;  4AFQ C;  2L3Q A;  3G7Z A;  4LD6 A;  1U8R A;  3EFO A;  4PK4 A;  2V8I A;  4M77 E;  4JRK A;  4V2S A;  2DIQ A;  2LVM A;  4LN2 A;  1YBY A;  1Q82 U;  4C92 G;  3CCR T;  4XTU A;  2M51 A;  1QCO A;  3MET A;  3LH5 A;  4FYX B;  2CZ6 B;  1ZA2 B;  1UGQ B;  4IUQ A;  3OYB A;  3QZ9 B;  3JB9 J;  5KCO A;  2ATC B;  1IRX A;  2KY9 A;  3VUZ A;  2V26 A;  2QI2 A;  1PD1 A;  4M78 C;  4P5N A;  4CRI A;  2AZV A;  4KBM B;  3GP8 A;  4RTW A;  1VQM Q;  1Y71 A;  1G3Y A;  3O5Z A;  4PJN A;  5LJ3 g;  1N8R C;  2GQI A;  2VUB A;  1NJI C;  2J6O A;  2FEI A;  9ATC B;  2LNH B;  1BIA A;  3MKD A;  5CQY A;  2C0I A;  4BE0 A;  5J3B A;  2E6Z A;  2EPD A;  1AEY A;  4R55 A;  2KRS A;  2VV5 A;  5IXB A;  4KT0 E;  3CCQ A;  1RAH B;  2LCS A;  1OPL A;  3MP1 A;  1RAB B;  2RA2 A;  1D0X A;  2ROT A;  4M78 A;  2JS0 A;  2RD1 A;  1GXI E;  1AWJ A;  2AKK A;  4L6V 5;  3CCE Q;  3QJY A;  3O8V A;  3OYD A;  2QA4 Q;  4PL6 A;  1KD1 C;  2OAU A;  1UHF A;  2KEA A;  2KRO A;  4J6W A;  2NYS A;  1RUW A;  2LDM A;  4AMC A;  5D6Y A;  1UB4 A;  3OS5 A;  4MDW A;  4M78 D;  3INZ A;  4FCY A;  2SRC A;  4C92 C;  5DM7 R;  3MEA A;  5A0D A;  3CC7 T;  2O4X B;  3QYG B;  1Q7Y R;  3QSU A;  1QMC A;  3OW2 P;  1VQ4 T;  1ZUY A;  2EW3 A;  3X20 B;  4Y28 E;  1VQ6 T;  1Q86 U;  4OML A;  4RCB A;  1QKW A;  2CUD A;  4IUT A;  2V1R A;  1I1J A;  5C0M A;  2LQ8 A;  3CCM A;  4C8Q F;  3VS5 A;  3P8D A;  1WPY A;  2DL8 A;  1K9M R;  1D3B A;  2WSF E;  1AWX A;  5FWB A;  2CS7 A;  2EGA A;  1Z9Z A;  2BE9 B;  2K9G A;  3PTA A;  3QZ5 B;  1RAG B;  2ZPF B;  2KT1 A;  1W2B S;  1YJN A;  2GQV A;  5I22 A;  4XTV A;  2KE9 A;  3SDZ A;  5CQX A;  1M2O A;  1MNE A;  2VVK A;  1U5S A;  5GMK h;  2RPN A;  5C6S A;  2KR3 A;  1PM3 A;  3ULR B;  1GL5 A;  4C5G A;  4C92 D;  2X4Y A;  2K5I A;  3OS2 A;  2SEM A;  5CO7 A;  1ZUK A;  3FEO A;  3JCM b;  4X34 A;  1M3B A;  4QVD A;  4GBQ A;  1OX8 A;  4A4G A;  5FU7 C;  4ZGE B;  3JCM X;  3QYH B;  5I11 A;  1ZUU A;  2J06 A;  3L42 A;  2HEQ A;  1WIE A;  1YIT A;  2HBW A;  1H8K A;  1QW1 A;  1YWO A;  2VWF A;  3HFO A;  5IAY A;  3X25 B;  3LWI A;  2K5F A;  1WHJ A;  3KXT A;  1LNX A;  3M0U A;  4IUP A;  4AFU C;  2DXB A;  1X01 A;  5CKD A;  1IB8 A;  1FXX A;  4MML A;  2M9U A;  2W0Z A;  1Q81 C;  1VQP T;  2DO3 A;  3CBM A;  1YJ9 T;  3P8H A;  1QP2 A;  1YJW A;  1ZHI A;  2YSQ A;  5IN1 A;  4HT9 A;  1SRL A;  2E10 A;  5HK3 A;  2LJ0 A;  4A53 A;  4OGE A;  1BI3 A;  4BD3 A;  3M0T A;  2V8K A;  3D7S B;  1Q82 R;  2O31 A;  3OS0 A;  3M53 A;  4XU1 A;  3OQ5 A;  2L3P A;  3L2V A;  3HRU A;  3CCQ Q;  5GJV B;  3VYH B;  4A4H A;  2QEX Q;  1MV3 A;  3SEM A;  2L5Q A;  2DTH A;  2RI3 A;  5GAN 7;  2FZG B;  2NLU A;  4Z02 A;  2EKH A;  3VYG A;  2D9T A;  4A4K A;  2L0A A;  2Y90 A;  1RLP C;  1X6G A;  2HNI A;  1VOM A;  2DF6 A;  2YXY A;  4ZGJ B;  2MCN A;  3TRE A;  2EKO A;  3QG1 A;  2C0T A;  3RR6 A;  5GAN f;  2JVV A;  4HKE A;  3JAM E;  1JJ2 P;  2FHD A;  1XOV A;  3CCJ A;  2XI9 A;  1M8M A;  5HCK A;  5KYW B;  5GAM d;  2HL3 A;  2E4H A;  2F69 A;  2RJE A;  3E9G A;  5GAM h;  4DBQ A;  1M90 C;  4J9E A;  2RK2 A;  1J3T A;  2LNV A;  4HVV A;  1SRM A;  1RAC B;  4LNP A;  1LOJ A;  1WHM A;  3KFV A;  4NL3 A;  2P0P A;  2MI6 A;  2DRM A;  1VQ8 Q;  1YHQ T;  3RER A;  3I5S A;  1QVG A;  2YT6 A;  4OVA A;  4DA4 A;  2A3L A;  1JRI A;  2WAC A;  2RB6 A;  3CC2 T;  4OB1 B;  1LPL A;  2XKO C;  5GAN 3;  1XTD A;  1MUZ A;  5GAO p;  1H3Z A;  3JCM h;  3SWN B;  5FRO A;  2DA9 A;  3MEV A;  1B34 B;  2EYZ A;  5GAN j;  2ED0 A;  2LZ6 B;  1M2V B;  1RI9 A;  3FC3 A;  4J9I A;  1YIJ T;  3HFN A;  2CH4 A;  3E19 A;  2CGH A;  2IIM A;  3I56 T;  5CK9 A;  1A0N B;  4D8D A;  2EJG A;  3EG9 A;  4HCK A;  1I0C A;  2Y4X A;  2ZGW A;  1LVK A;  3LYI A;  4HVW A;  4X9D A;  4QKU A;  1D1C A;  4IUU A;  1YIT Q;  1WHK A;  2XDP A;  4VUB A;  3RKY A;  2OTL A;  4F7U A;  3VRZ A;  5GAN 2;  3G4S T;  4PJO F;  3N5B B;  2ZZD A;  4ME7 A;  2RHU A;  3CPW P;  1GFC A;  2C0O A;  5KYX A;  1NZ9 A;  4M7A G;  5GAN g;  1QVF A;  1OQK A;  5D6W A;  1SG5 A;  2RJC A;  5KE3 A;  3OYL A;  2OJ2 A;  4M75 G;  2KAF A;  2DL7 A;  2K3B A;  3GOX A;  4XU2 A;  2X3X D;  4AFZ C;  5FLX E;  1VYU A;  4OMP A;  4BDY A;  1B7T A;  2H3J A;  4ZGD B;  4KH1 B;  4J9F A;  4FSS A;  1GFD A;  2HKQ B;  4HCC A;  2AHJ B;  5AYF A;  2R58 A;  1E7O A;  3KBG A;  5GAO n;  4M78 E;  3HSB A;  2E12 A;  1O75 A;  4N4H A;  2JW4 A;  1WI7 A;  4XK8 E;  2J6K A;  2YUP A;  5I2S A;  4PJO G;  1HYO A;  2L3S A;  1T3S A;  2FRY A;  2RM4 A;  2PUO B;  1W4S A;  4LXC A;  4BY6 B;  4IUV A;  3CCV A;  2DD4 A;  1VQ9 A;  1VQN A;  2NUT B;  5L23 A;  1FMK A;  3HRT A;  1PSE A;  2CZ1 B;  4B6M A;  3FLG A;  4OMF B;  3J7A F;  2AKL A;  3CCJ Q;  1ABQ A;  1VQ7 T;  2D6F A;  3JCM V;  5FWC A;  1X27 A;  3CBP A;  3JCM Q;  3V8K A;  3X28 B;  4ZNX A;  3RKW A;  1GCP A;  2OTJ T;  1KC8 U;  1VQL A;  1LJO A;  4Y92 A;  2F2V A;  3CC4 Q;  4EMK B;  1XNI A;  1X69 A;  1C0M A;  1DJ7 B;  2GBQ A;  1NG2 A;  4M7A C;  4YTL A;  4C0D C;  1NLP C;  4M75 C;  6AT1 B;  3QO3 A;  2VKN A;  3CCL A;  4C92 E;  2E1H A;  2M0O A;  1T3L A;  2KRM A;  4KGV B;  5GAO l;  4C5E A;  1XJW B;  4JPB W;  3HL8 A;  1V76 A;  2YUO A;  2RF0 A;  4QQD A;  3MCA B;  3QDR B;  1KIK A;  2PTK A;  2ZCF B;  2MAM A;  3CCU T;  4J9H A;  2QDY B;  1Q7Y U;  3HRS A;  4RG8 A;  2X4J A;  1K8A U;  3X24 B;  4M78 F;  1FWZ A;  3H0H A;  5L8R E;  4E7J A;  3SD4 A;  4IUR A;  1GBQ A;  3DKM A;  4M7A A;  3UA7 A;  4PJO C;  2MWO A;  3CQT A;  5FU6 C;  4DOV A;  3CXC S;  4M75 A;  2XHC A;  1AD5 A;  4O5V A;  5FRM A;  2K3Y A;  1W2B P;  2RJF A;  1KQS A;  2KXD A;  4M7A D;  4LDY A;  3CME A;  3LWH A;  3FJ5 A;  1QCN A;  2D0Q B;  3OYY A;  5GAN 4;  2VB6 A;  1MND A;  1VQK A;  1IZ6 A;  3PMT A;  4M75 D;  2D0N A;  2JM8 A;  1G3T A;  5DLO A;  1AOJ A;  4HCB A;  4FL6 A;  1JXO A;  4M77 B;  3OW2 A;  2HQH A;  2OTL Q;  3S6W A;  3RIR A;  1KQ1 A;  2AT1 B;  2PVO B;  4BE2 A;  2RHI A;  2YUN A;  3EG0 A;  3E1S A;  3SHW A;  1X6B A;  5GAO m;  2CKK A;  5DLQ E;  3QJ6 A;  1VIF A;  1OYX A;  4C8Q B;  3CMA Q;  3CD6 A;  3FJP A;  2E5K A;  2RQW A;  2EQM A;  2EYX A;  4RUG A;  2QA4 T;  4PJO D;  2YUQ A;  3VUB A;  2ROL A;  3OYN A;  2R57 A;  3I55 A;  3NMZ C;  2XDB A;  4LUD A;  4BI4 A;  4FYY B;  5AT1 B;  1QCF A;  4KUD K;  8AT1 B;  5A0L A;  2J05 A;  5GAM e;  2MMP A;  2KT8 A;  3G6E T;  4XQ3 A;  1UGV A;  3A98 A;  3V7R A;  3CCR A;  1Q95 G;  3PE0 A;  4JUV A;  4NS5 A;  1S72 T;  2F1L A;  1XQH A;  2JN0 A;  3CCV Q;  1ACM B;  4E6R A;  2OAW A;  4M7D A;  4A63 B;  2K3X A;  1G8X A;  3WVE B;  1ZSZ B;  1VQ9 Q;  1VQN Q;  2KGT A;  1E6G A;  3DB4 A;  1SHG A;  4JZ3 A;  4BUG A;  2DL3 A;  1OI1 A;  1HD3 A;  2D8H A;  1EX4 A;  4BAC A;  2EAY A;  1PHT A;  4DBR A;  1BU1 A;  4KUL A;  3JCM e;  2QQ9 A;  2FVU A;  1VQL Q;  1D1B A;  4WF2 A;  3JB9 G;  1HK9 A;  4LDV A;  1NYG A;  4PFZ A;  1K0X A;  4C8Q E;  1WYX A;  1TUC A;  2QTX A;  1MHN A;  1Q86 C;  4F14 A;  2EQJ A;  1I81 A;  3HP9 A;  4QVC A;  1BB9 A;  2X4W A;  3CCL Q;  4JJN K;  1U3O A;  2MF2 A;  4ZTJ A;  2X4X A;  5LJ5 d;  2DRK A;  1D1A A;  1WDX A;  4F17 A;  1CKA A;  4QQG A;  2YLB A;  2MK5 A;  5LJ5 h;  3TEE A;  4JLG A;  1KC8 R;  2EGE A;  3OYJ A;  1PKS A;  2A0F B;  3OYA A;  2EVR A;  4MZM A;  3GIB A;  2M16 A;  1SF9 A;  4IIM A;  1UEC A;  4MDX A;  1UG1 A;  1WQW A;  1G5V A;  2VXE A;  3EHR A;  3C4S A;  2GCX A;  2CUB A;  1RAE B;  1OZ2 A;  2LX9 A;  3PT9 A;  2M1H A;  3RNJ A;  1WXT A;  3CC7 A;  2EJF A;  1UE9 A;  2J7I A;  1VQ4 A;  3CCS Q;  1VQ6 A;  1AWO A;  2FG0 A;  2FYK A;  3G71 Q;  1U1S A;  3CME Q;  4KGX B;  1H92 A;  3NGP A;  3M0P A;  1VQK Q;  2EQK A;  1JJ2 A;  5HY6 A;  4EMH A;  2W10 A;  4OF1 A;  2GFU A;  2X51 A;  5GMK l;  1TWB A;  1K8A R;  4MZP A;  5IH2 A;  1BBZ A;  1M1G A;  2RH2 A;  2JUF A;  3UA6 A;  1EIF A;  1IXD A;  1I4K 1;  3VRY A;  2QEX T;  7AT1 B;  2DVJ A;  4OP0 A;  4BDZ A;  2RJD A;  2QGF B;  4LUE A;  2P4R A;  1X43 A;  3C95 A;  3EAE A;  4KRT A;  4HCZ A;  1AZG B;  4O6J A;  1VQO T;  4JZ4 A;  1G2B A;  5HK0 A;  3SFM A;  4KUI A;  4X9C A;  4J6Y A;  1B07 A;  3I55 Q;  3OMG A;  1K73 C;  5LL6 S;  2HMA A;  2HAX A;  1UTI A;  3MP8 A;  4KGZ B;  5IXF A;  3EGD A;  4FT2 A;  4RTT A;  3RES A;  2DNU A;  2YRV A;  3FB9 A;  4HVU A;  3PVL A;  4JRQ A;  2PQW A;  3J81 E;  3CCR Q;  2M02 A;  4C0D B;  4RTV A;  1K76 A;  1ZQ1 A;  1VQ5 T;  2X9H A;  3JB9 D;  1VQ8 T;  2DPP B;  1H3H A;  4F04 B;  1V29 B;  2FZC B;  2PZ1 A;  4K11 A;  4OMQ A;  4RCC A;  5GMK m;  3QUI A;  5GAO q;  2LJ3 A;  4F7U F;  2CZ7 B;  4CI0 C;  1N6A A;  2DTI A;  1VQP A;  1YJ9 A;  2CP0 A;  2JXB A;  1KD1 U;  3QXE B;  3V8L A;  4N4I A;  2PU9 B;  1LCK A;  1UFF A;  5CKH A;  4BI3 A;  1RAF B;  2LJ1 A;  4GY5 A;  4PJO B;  4FW1 A;  4LDW A;  2DE0 X;  4C0Z A;  2DJQ A;  2KI7 A;  1BIB A;  2FL7 A;  2V8J A;  2BIV A;  2EIF A;  1WFW A;  1X2Q A;  3RDV A;  2DBK A;  2RMO A;  3PMI A;  3ME9 A;  2KYB A;  1S1N A;  2HZY A;  2DXT A;  4M7A E;  2WSE E;  1MMG A;  2AIR B;  2GFA A;  2DX1 A;  4M75 E;  4F7U G;  1PSF A;  4FM4 B;  1Y0M A;  2CSQ A;  2NUZ A;  1X6O A;  1D0Y A;  1WZO A;  5M9O A;  4A4E A;  3FRN A;  2FRW A;  2F2X A;  2QAZ A;  1I5L A;  3L2R A;  5KYY A;  3EFO B;  2MIO A;  1N9R A;  4E7H A;  1NE8 A;  1MV0 B;  2COW A;  2H3E B;  1YI2 T;  5CKE A;  3M0R A;  1EZZ B;  1OU9 A;  1BI1 A;  1Y96 A;  4AT1 B;  1V1C A;  1YHQ A;  3JB9 H;  2IPO B;  3P8B B;  2ABL A;  1M30 A;  4PJO E;  3C0C A;  4OMM A;  3GNG A;  3CC2 A;  5DY9 A;  4Z89 A;  4JRI A;  2XU8 A;  1IGU A;  3CXC P;  4XTZ A;  5IHN A;  4B9W A;  3CCM Q;  2COY A;  3CBO A;  4EDU A;  1ZLM A;  4EPC A;  3VS0 A;  4E7K A;  2VXF A;  1NEG A;  3GPL A;  5LJ3 h;  1SPK A;  3THK A;  2BZY A;  2FZK B;  3JCM d;  1YIJ A;  4MMK A;  3EGX B;  2DL5 A;  3I56 A;  2RQT A;  1Q81 U;  1PCX A;  1YJN Q;  1OPK A;  3EHQ A;  4XU0 A;  2XD0 A;  1QLY A;  2J6F A;  5A2Q E;  3RMQ A;  3MO8 A;  4M7A F;  2JTM A;  1GBR A;  1SEM A;  4Z8A A;  2HD0 A;  4BI8 B;  4M75 F;  1BKB A;  2G3R A;  3CC4 T;  5KE2 A;  4OMN A;  1KQS S;  2CP3 A;  4M78 B;  4OB0 B;  5GAN e;  1OOT A;  3G4S A;  1ZA1 B;  1MGQ A;  3V8J A;  5KYU A;  5CVI A;  2NUP B;  3L2Q A;  2JOY A;  1N8R R;  2NWM A;  3M54 A;  2LQW A;  3UPU A;  1VQP Q;  1E6H A;  1M4Z A;  5LJ5 e;  2E70 A;  4CC7 A;  3L2Z A;  2BUD A;  1WXB A;  1JEG A;  4ELY C;  2KBT A;  3UAT A;  2KSS A;  4B9X A;  1WHL A;  4FSX A;  3OBW A;  1ZSZ A;  5CKF A;  1NEB A;  2L8D A;  2PVD B;  3H41 A;  2L89 A;  3M56 A;  3JRZ A;  5GJW B;  1D3B B;  2EYW A;  3TVT A;  1K1Z A;  1YJW Q;  3ZL7 C;  3VS4 A;  1K4U S;  1TG0 A;  4CC2 A;  2VC8 A;  4FIB A;  2QXF A;  2FO0 A;  2DIG A;  4C92 B;  2O01 E;  5D7U A;  1KD1 R;  5KH6 A;  2ZPB B;  2HBP A;  4E2F B;  2E64 A;  4PFO A;  2YWW A;  2B8A A;  3VU3 C;  3RKX A;  3TSZ A;  3F70 A;  1VQ7 A;  2CYZ B;  4RTU A;  1KFZ A;  1Q7Y C;  2DBM A;  3UWN A;  4M7D F;  4PLI A;  4N4G A;  2OTJ A;  4E47 A;  5IHK A;  1IHW A;  3A8L B;  3OYH A;  1N9S A;  4JRP A;  3MJX A;  2DM1 A;  2RHX A;  4XTX A;  3X26 B;  3CMA T;  1CKB A;  2RN8 A;  1K9M C;  1YHQ Q;  3E2U A;  3VV0 A;  2Z0W A;  1TS9 A;  3CC2 Q;  1M5Q 1;  3M55 A;  2O9V A;  5EG2 A;  4ATO A;  2CT4 A;  1SSH A;  3I35 A;  4XU3 A;  3CCU A;  5GMK j;  3VS3 A;  1KK7 A;  3CEY A;  4CC4 B;  1M3C A;  4DOW A;  4M7D G;  2O4X A;  1BCO A;  2EFI A;  5FU7 B;  1KG1 A;  3I56 Q;  5KYN A;  3MP6 A;  2RI5 A;  2CZ0 B;  1P92 A;  4M4Z A;  5CAI A;  4DEY A;  4C0F A;  1OU8 A;  2V1Q A;  2BTT A;  2QTV A;  4RTX A;  5IT9 E;  4OMO A;  4PJJ A;  3H9N A;  2XMF A;  4X1V A;  1RAI B;  1G3S A;  3H0F A;  2QK0 A;  2WSC E;  3GBQ A;  2K7A A;  2QQB A;  3M57 A;  2EBP A;  2O88 A;  1M1K U;  3JB9 I;  3PVQ A;  1EFN A;  2QYZ A;  3M4Y A;  3DLL A;  1ZSG A;  3TU4 K;  2MWP A;  5J39 A;  4EMG A;  3G4S Q;  2ZPH B;  2OX7 A;  4ELZ C;  1AWW A;  2EJ9 A;  1VQM T;  1Q81 R;  1M3A A;  1FMW A;  2KQW A;  1ZBX A;  2DYI A;  1K0S A;  4DQ2 A;  1PWT A;  3LX7 A;  5GAM f;  5IHI A;  2JTF A;  3EH2 A;  1Q82 C;  2QA4 A;  1UJY A;  5GAN 5;  4II1 A;  2YDL A;  3MHX A;  4LD9 K;  4PFP A;  1GCQ C;  1YFN A;  3M4G A;  4ZN3 A;  1M8V A;  1N27 A;  1R8O B;  2GF7 A;  1RAD B;  4M7D C;  2A37 A;  2KRN A;  3RMS A;  3CCS T;  3CCE T;  3G6E A;  2JMC A;  3HHT B;  3JCM f;  4QVZ A;  3G71 T;  1S72 A;  3EFS A;  4XTY A;  2JT4 A;  1TUD A;  3JB9 F;  2HDA A;  1PD0 A;  1OV3 A;  5CKB A;  4BB7 A;  1U06 A;  2DXC A;  1CSK A;  2LT4 A;  1JBM A;  2DZ9 A;  2E6N A;  2GGR A;  5GAM j;  3PIO A;  1VQ7 Q;  3OY9 A;  2QG9 B;  3HKS A;  3G1J A;  2YLC A;  1GCQ A;  4OB2 B;  2IVW A;  2ZAE A;  3LLR A;  3EG9 B;  1FMV A;  4F16 A;  1RAA B;  2OTJ Q;  1NLO C;  1ABO A;  2VYT A;  4DEX A;  1K9A A;  4RMO A;  1OX9 A;  3QHS A;  1VIE A;  2I0N A;  1TH7 A;  1WHH A;  2CSI A;  3UDC A;  2ZPI B;  3TCJ A;  5GMK i;  3VS1 A;  5LJ3 e;  2RK1 A;  5A0G A;  3NFC A;  2X35 A;  4M7D D;  1PC0 A;  2EQI A;  3MPU B;  4Y91 A;  2E41 A;  3R6N A;  3SB2 A;  4J9D A;  2R5M A;  3EH1 A;  1TU0 B;  2DLP A;  5GAN d;  5KYX B;  5D6X A;  2CP7 A;  5GAN h;  1WHG A;  3NTH A;  2MPX C;  3L2W A;  2CT3 A;  3CCU Q;  3SWN C;  3H0I A;  5KYW A;  3BW1 A;  3ZEH A;  1OEB A;  1VUB A;  3M59 A;  5GAM g;  1HSQ A;  1T0H A;  1OZ3 A;  2CRE A;  4N0A C;  2RO0 A;  3FIF A;  2G6F X;  4J83 A;  5CCA A;  3U23 A;  3JCM W;  1I8F A;  5J26 A;  4AFS C;  1U1T A;  3KUF A;  2ESW A;  2BZ8 A;  1KJW A;  3EGX A;  3JCM g;  3EG2 A;  1ZX6 A;  3SWN A;  1AZE A;  2DER A;  4C0G A;  1TXQ A;  3OYK A;  2E5Q A;  1B34 A;  4OGC A;  4F7U E;  1M2V A;  4WTO B;  1JB0 E;  1N5Z A;  2QEX A;  1NPR A;  1Y07 A;  1QWE A;  1PNJ A;  4N0A A;  1M1F A;  2RI2 A;  4DBH A;  1W1F A;  2ED1 A;  2P4T A;  1BK2 A;  4R0K A;  1QVP A;  2E65 A;  2KMT A;  2HSE B;  1VQO A;  4Z88 A;  1KHC A;  1M1K R;  2YRC A;  1KQS P;  1HJD A;  3A8H B;  3EGU A;  4HXJ A;  3CXC A;  3NTI A;  4BE1 A;  1OUL A;  3CCQ T;  1QVG S;  3OYC A;  2CH4 W;  4UC4 A;  2HKN A;  2NUP A;  4M77 F;  2PNI A;  1QWF A;  3H6Z A;  2VGN A;  3BDL A;  3PFS A;  1W6X A;  2I2L A;  3CD6 Q;  3G6E Q;  2COZ A;  1M9S A;  2LP5 A;  1S72 Q;  3PGG A;  1VQ5 A;  2DXU A;  3M0Q A;  3T9N A;  4FYV B;  3A8O B;  1VQ8 A;  1N8R U;  1YN8 A;  4XAX B;  3VS2 A;  1NJI U;  2JMA A;  4QW2 A;  4BY6 C;  1KSW A;  4AG1 C;  3V7C A;  4M7A B;  4RTY A;  2YHT A;  4RKU E;  3OS1 A;  2DD5 A;  3L1A A;  1UEB A;  2A36 A;  2FPD A;  4M75 B;  3VJP A;  3GNF B;  2XID A;  1JU5 C;  4C92 A;  3CCM T;  3EG3 A;  4FW2 A;  3JCM J;  2KYM A;  1ARK A;  3RBB B;  3QKJ A;  4M77 G;  3QII A;  5FW9 A;  3JV3 A;  8ATC B;  2XDD A;  3REA B;  4EMK C;  2MOX A;  1NYF A;  2DJZ A;  3URG A;  1AT1 B;  3LGF A;  4A54 A;  4AG2 C;  2DFU A;  1VA7 A;  1YJN T;  2HQX A;  4GLM A;  4J9B A;  1QVF S;  4JS5 A;  1AVZ C;  2RQV A;  3L2U A;  2JNG A;  3GLX A;  3QWY A;  4C8Q G;  3OSV A;  3CPW A;  2QQA A;  5I2M A;  2NUT A;  5FU6 B;  1TSF A;  1WX6 A;  3TSW A;  1TOV A;  1R77 A;  2DYB A;  4J9C A;  4DBF A;  3MEU A;  2HL5 C;  2DEQ A;  1FYN A;  2DTO A;  3M9Q A;  3BDU A;  2CP2 A;  3OYI A; 
#chains in the Genus database with same CATH homology
 4ELY C;  5FRM A;  2KSS A;  4EMK A;  4B9X A;  2K3Y A;  4FSX A;  5CQY A;  2RJF A;  1KQS A;  3OBW A;  2K4Y A;  5J3B A;  4BE0 A;  2E6Z A;  5CKF A;  4M7A D;  2C06 A;  2L8D A;  4LDY A;  2PVD B;  2XIC A;  4R55 A;  2L89 A;  3CME A;  3M56 A;  2VV5 A;  2D0Q B;  3OYY A;  3LWH A;  3JRZ A;  4HA8 A;  3OB9 A;  5GAN 4;  3S3N A;  1VQK A;  4KT0 E;  3CCQ A;  1IZ6 A;  1YIT T;  3PMT A;  4M75 D;  1D3B B;  1YI2 A;  1G3T A;  3MP1 A;  1K73 U;  5DLO A;  4JDS A;  4HCB A;  4FL6 A;  2RA2 A;  2VC8 A;  4M77 B;  3OW2 A;  4FIB A;  2QXF A;  3S6W A;  3DLM A;  4M78 A;  3RIR A;  1KQ1 A;  2RD1 A;  3S3M A;  2DIG A;  2PVO B;  1GXI E;  4BE2 A;  2LT1 A;  2RHI A;  4L6V 5;  4C92 B;  3QJY A;  2EQU A;  2O01 E;  4A4F A;  3O8V A;  4J7I A;  3OYD A;  4PL6 A;  2ZPB B;  5KH6 A;  2OAU A;  1KD1 C;  4M7D B;  2HBP A;  3E1S A;  2E64 A;  4J6W A;  4LDU A;  5GAO m;  4M77 C;  2LDM A;  2CKK A;  5D6Y A;  1RI0 A;  1UB4 A;  3OS5 A;  5DLQ E;  1YJW T;  1IRE B;  3QJ6 A;  3QBY A;  4MDW A;  1VIF A;  4M78 D;  3INZ A;  2B8A A;  4C92 C;  1OYX A;  5DM7 R;  3VU3 C;  3RKX A;  3MEA A;  4C8Q B;  5A0D A;  3CC7 T;  2KK4 A;  3F70 A;  4E7I A;  1VQ7 A;  3CD6 A;  3FJP A;  3R6O A;  2O4X B;  3QYG B;  2CYZ B;  3M5A A;  3QSU A;  1Q7Y C;  1VQ4 T;  2EQM A;  2IG0 A;  3UWN A;  4M7D F;  2QA4 T;  3OYF A;  4PLI A;  4PJO D;  3VUB A;  3OYG A;  4N4G A;  3ZBD A;  3X20 B;  3OYN A;  4E47 A;  4Y28 E;  1VQ6 T;  2OTJ A;  2R57 A;  3I55 A;  1Q86 U;  4RCB A;  2KDS A;  3A8L B;  4IUT A;  3OYH A;  4C8Q C;  2XDB A;  5C0M A;  1N9S A;  4JRP A;  3OMC A;  4BI4 A;  2LQ8 A;  3LW5 E;  2RHX A;  3C12 A;  4XTX A;  3X26 B;  3CCM A;  4FT4 A;  4C8Q F;  4KUD K;  1BYM A;  3CMA T;  5A0L A;  3P8D A;  3A8G B;  1WPY A;  2EWN A;  5GAM e;  2MMP A;  2P0K A;  3C94 A;  1D3B A;  5LJ3 d;  2WSF E;  1G3W A;  3H8Z A;  1K9M C;  1WJR A;  2CS7 A;  3G6E T;  4XQ3 A;  1FX7 A;  3PNW C;  3VV0 A;  3V7R A;  3CCR A;  3PTA A;  3QZ5 B;  4JUV A;  4NS5 A;  1S72 T;  4M77 A;  2ZPF B;  3CC4 A;  1M5Q 1;  1W2B S;  1YJN A;  3M55 A;  4NOY A;  1XQH A;  2JN0 A;  3UT1 A;  5LJ5 f;  2GQV A;  4M7D A;  2K3X A;  2PUK B;  3WVE B;  4XTV A;  3CCJ T;  2LC4 A;  4IKF A;  5EG2 A;  4ATO A;  3SDZ A;  4MZT A;  3DB4 A;  5CQX A;  4M77 D;  4XU3 A;  4BUG A;  3CCU A;  5GMK j;  1BI0 A;  3DB3 A;  5GMK h;  5GAN 8;  3CEY A;  5C6S A;  1OI1 A;  4L59 A;  4DOW A;  4C5G A;  4C92 D;  2DVE A;  2KVQ G;  2X4Y A;  4C8Q A;  2EAY A;  4BAC A;  4M7D G;  2K5I A;  4M7D E;  3JCM e;  4KUL A;  2O4X A;  2QQ9 A;  3OS2 A;  2FVU A;  2EFI A;  3VKI A;  5FU7 B;  5CO7 A;  3FEO A;  1KG1 A;  4WF2 A;  2DAQ A;  3JCM b;  3JB9 G;  4X34 A;  5FRN A;  1HK9 A;  2RI5 A;  3MP6 A;  2CZ0 B;  4LDV A;  2R5A A;  4QVD A;  1P92 A;  1WQ7 A;  4C8Q E;  5CAI A;  4FU6 A;  4C8Q D;  4C0F A;  3AHU A;  2QTX A;  1MHN A;  4A4G A;  1W2B A;  3NTK A;  5FU7 C;  4ZGE B;  3JCM X;  1Q86 C;  2EQJ A;  5IT9 E;  3BY7 A;  1I81 A;  3QYH B;  3HP9 A;  4HT8 A;  4QVC A;  1G3S A;  2X4W A;  3OW2 S;  2WSC E;  2HQE A;  3L42 A;  2QQB A;  3M57 A;  5HKC A;  1YIT A;  4ZN1 A;  1QW1 A;  1M1K U;  3JB9 I;  4JJN K;  2K2V A;  2MF2 A;  4E7L A;  3HFO A;  5IAY A;  4ZTJ A;  2X4X A;  3CPF A;  3X25 B;  5LJ5 d;  3LWI A;  3M4Y A;  3DLL A;  2K5F A;  3TU4 K;  3KXT A;  1HXD A;  2MWP A;  4QQG A;  1LNX A;  2YLB A;  5J39 A;  4EMG A;  3TEE A;  4JLG A;  5LJ5 h;  5LJ5 j;  4IUP A;  2ZPH B;  4ELZ C;  3OYJ A;  1KC8 C;  2DXB A;  3OYA A;  3RUX A;  2EJ9 A;  1VQM T;  4MZM A;  1X01 A;  3GIB A;  2M16 A;  5CKD A;  1FXX A;  1M90 U;  4MDX A;  1QP3 A;  1WQW A;  2M9U A;  2VXE A;  4MML A;  1Q81 C;  1G5V A;  3C4S A;  2GCX A;  1VQP T;  2KQW A;  1ZBX A;  2DO3 A;  3CBM A;  1YJ9 T;  3P8H A;  4NL2 A;  1SSF A;  1OZ2 A;  1QP2 A;  1ZHI A;  2LX9 A;  4C5H A;  1YJW A;  5IN1 A;  4HT9 A;  2E10 A;  3PT9 A;  4DQ2 A;  2M1H A;  5HK3 A;  3HPW A;  3JSC A;  3LX7 A;  5GAM f;  4A53 A;  4OGE A;  1BI3 A;  3CC7 A;  4BD3 A;  4Q5W A;  2JTF A;  2V8K A;  2RHY A;  2EJF A;  3ASK A;  1Q82 C;  1VQ4 A;  3OS0 A;  3M53 A;  4XU1 A;  2QA4 A;  2L3R A;  4LDX A;  3OQ5 A;  2K5L A;  3MHX A;  4II1 A;  5GAN 5;  4LD9 K;  1VQ6 A;  5KCH A;  2LCL A;  2FYK A;  1H64 1;  2BKD N;  1U1S A;  3M4G A;  1KQ2 A;  4QQ6 A;  3L2V A;  3HRU A;  2EQK A;  4ZN3 A;  5HY6 A;  1JJ2 A;  1M8V A;  1N27 A;  4EMH A;  3CMA A;  4OF1 A;  2GFU A;  3VYH B;  1R8O B;  4A4H A;  2GF7 A;  5GAN 7;  2L5Q A;  2DTH A;  2RI3 A;  2OTL T;  4M7D C;  2NLU A;  3RMS A;  4Z02 A;  3CCS T;  3CCE T;  4GLK A;  4M75 A;  3VYG A;  5GMK l;  3G6E A;  2D9T A;  4MZP A;  2JZ2 A;  4A4K A;  3HHT B;  3JCM f;  2A7Y A;  2Y90 A;  3OA6 A;  1K8A C;  3OYE A;  1M1G A;  2P0Q A;  2HNI A;  4QVZ A;  5LJ5 g;  3G71 T;  1S72 A;  3EFS A;  4XTY A;  1WNL A;  2RH2 A;  2JUF A;  1M1K C;  1Y7X A;  4ZGJ B;  1EIF A;  3JB9 F;  1I4K 1;  1KHI A;  3TRE A;  2EKO A;  3QG1 A;  5GAN f;  2RHZ A;  4ZTF A;  2JVV A;  4HKE A;  2QEX T;  3JAM E;  4OP0 A;  4PNO A;  2FHD A;  5CKB A;  4BB7 A;  1XOV A;  2RJD A;  2XI9 A;  3CCJ A;  5GAM d;  4BDZ A;  2DXC A;  2LT4 A;  1JBM A;  2DZ9 A;  2E6N A;  3C95 A;  3EAE A;  3A5Z B;  2F69 A;  2RJE A;  3E9G A;  5GAM j;  4HCZ A;  5GAM h;  2XG8 D;  3PIO A;  1M90 C;  3OY9 A;  3OYM A;  3HKS A;  4O6J A;  2RK2 A;  2YLC A;  4OB2 B;  3MEW A;  1VQO T;  5HK0 A;  2IVW A;  5GAN 6;  3LLR A;  2LNV A;  3SFM A;  4KUI A;  4X9C A;  3M58 A;  4J6Y A;  4RG2 A;  3OSS C;  2VYT A;  3OMG A;  4RMO A;  1AHJ B;  1K73 C;  5LL6 S;  1LOJ A;  3QHS A;  1VIE A;  1TH7 A;  4NL3 A;  2HAX A;  2P0P A;  2MI6 A;  3UDC A;  2ZPI B;  3MP8 A;  3TCJ A;  1YHQ T;  5GMK i;  3RER A;  3LH0 A;  5LJ3 e;  3JCM P;  2RK1 A;  2LTO A;  5A0G A;  1QVG A;  4FT2 A;  4OVA A;  3NFC A;  3RES A;  4DA4 A;  2A3L A;  1JRI A;  2X35 A;  2F5T X;  2WAC A;  2RB6 A;  2YRV A;  3CC2 T;  3FB9 A;  4OB1 B;  2XKO C;  2DZC A;  4JLI A;  4JRQ A;  2PQW A;  5GAN 3;  4M7D D;  3J81 E;  1XTD A;  4Y91 A;  4C0D B;  2E41 A;  1WGS A;  5GAO p;  3SB2 A;  3CCV T;  1H3Z A;  3JCM h;  1ZQ1 A;  2R5M A;  1VQ5 T;  3SWN B;  2FB7 A;  5GAN d;  1VQ9 T;  5FRO A;  3JB9 D;  1VQ8 T;  2LQK A;  2DPP B;  5D6X A;  1VQN T;  3MEV A;  1B34 B;  5GAN j;  5GAN h;  1V29 B;  5GMK e;  3ER0 A;  5CIU A;  3NTH A;  4M7A E;  4RCC A;  4C5I A;  5GMK m;  3L2W A;  3QUI A;  2ZPE B;  5GAO q;  3JCM c;  1VQM A;  3SWN C;  4F7U F;  2CZ7 B;  3BW1 A;  3ZEH A;  4CI0 C;  3FC3 A;  1YIJ T;  1VUB A;  3HFN A;  3E19 A;  1N6A A;  2DTI A;  3M59 A;  5GAM g;  1VQP A;  1VQL T;  2CGH A;  3PIP A;  3Q1J A;  1YJ9 A;  4L5G A;  1KD1 U;  3I56 T;  3WVD B;  3J80 E;  2VGM A;  3QXE B;  3A8M B;  3V8L A;  4N4I A;  1OZ3 A;  5CK9 A;  3OBY A;  2PU9 B;  5I21 A;  2EJG A;  5CKH A;  4BI3 A;  4N0A C;  2RO0 A;  4XTW A;  1X75 C;  1JJ2 S;  2DK3 A;  1NPP A;  3FIF A;  4GY5 A;  4PJO B;  4J83 A;  2XK0 A;  2Y4X A;  5CCA A;  3CCL T;  3JCM W;  4LDW A;  1I8F A;  2ZGW A;  4C0Z A;  5CR2 A;  1Y96 B;  1BIB A;  2DKG A;  2FL7 A;  3LYI A;  5J26 A;  4R56 A;  5GAO r;  4PLL A;  3EFR A;  1RL2 A;  4X9D A;  2V8J A;  1U1T A;  3KUF A;  3FDR A;  2BIV A;  4IUU A;  2EIF A;  4OB3 B;  2XDP A;  4VUB A;  3QPH A;  3RKY A;  2OTL A;  4F7U A;  3PMI A;  3JCM g;  5GAN 2;  3G4S T;  4PJO F;  2Y4Y A;  3N5B B;  2ZZD A;  3ME9 A;  3CCE A;  3CCS A;  2EYQ A;  4ME7 A;  2RHU A;  3SWN A;  2ZPG B;  1NZ9 A;  4C0G A;  1K9M U;  2DXT A;  3OYK A;  1BI2 A;  2E5Q A;  2PVG B;  2WSE E;  1B34 A;  4OGC A;  2K57 A;  3ZFJ A;  5GAN g;  5D6W A;  3G71 A;  1QVF A;  3L2Z A;  2QQS A;  2GFA A;  2RJC A;  5KE3 A;  3OYL A;  4F7U E;  1UGR B;  4M75 E;  4F7U G;  4M75 G;  2KAF A;  4JS4 A;  1PSF A;  4FM4 B;  3WXM B;  1JB0 E;  1X6O A;  3GOX A;  2QEX A;  4XU2 A;  1NPR A;  1Y07 A;  1VQK T;  3V7S A;  5FLX E;  4N0A A;  1M1F A;  5LJ3 f;  2RI2 A;  4A4E A;  5M9O A;  4BDY A;  3FRN A;  2P4T A;  2H3J A;  4ZGD B;  1QVP A;  2KMT A;  2E65 A;  1VQO A;  1KHC A;  1I5L A;  3L2R A;  3A8H B;  3CME T;  3CXC A;  1O9S A;  4HCC A;  1N9R A;  2AHJ B;  2R58 A;  3NTI A;  1WJS A;  5AYF A;  3CCQ T;  1NE8 A;  3GF5 A;  4BE1 A;  4E7H A;  3KBG A;  3OYC A;  1QVG S;  4PJO A;  1UGP B;  1YI2 T;  5CKE A;  4UC4 A;  4M78 E;  4D6W A;  5GAO n;  4M78 G;  4J5Y A;  3E9F A;  1BI1 A;  1Y96 A;  4M77 F;  3HSB A;  2E12 A;  1O75 A;  4N4H A;  3H6Z A;  1YHQ A;  2VGN A;  3BDL A;  3PFS A;  4XK8 E;  2LCC A;  3JB9 H;  2QQR A;  2I2L A;  4C92 F;  5I2S A;  3P8B B;  4PJO E;  2F5K A;  4PJO G;  4PKC C;  3GNG A;  1UGS B;  3CC2 A;  3BFM A;  4TVR A;  5DY9 A;  4JRI A;  2RM4 A;  1M9S A;  2PUO B;  1W4S A;  2XU8 A;  4BY6 B;  3LGL A;  4IUV A;  3CCV A;  2DD4 A;  3PGG A;  1VQ5 A;  2DXU A;  3T9N A;  1VQ9 A;  4XTZ A;  1VQN A;  3A8O B;  1VQ8 A;  1N8R U;  4B9W A;  3HRT A;  4XAX B;  1PSE A;  2CZ1 B;  4J6X A;  1NJI U;  3FLG A;  4J8O A;  4OMF B;  3J7A F;  3CBO A;  4EDU A;  1VQ7 T;  3CD6 T;  4QW2 A;  3JCM V;  4BY6 C;  4J7F A;  4EPC A;  2VXF A;  4E7K A;  2D6F A;  3CBP A;  3JCM Q;  3V8K A;  5LJ3 j;  3GPL A;  3X28 B;  5LJ3 h;  3V7C A;  3RKW A;  4M7A B;  2OTJ T;  1WJQ A;  3JCM d;  1YIJ A;  1KC8 U;  3I55 T;  3CPW S;  2YHT A;  4RKU E;  3OS1 A;  1VQL A;  1LJO A;  4MMK A;  2DD5 A;  3L1A A;  1UEB A;  4F7U B;  4M75 B;  3VJP A;  3S3O A;  3GNF B;  1YCY A;  3I56 A;  2LRQ A;  1Q81 U;  2XID A;  3G7Z A;  1XNI A;  4LD6 A;  4C92 A;  4EMK B;  3CCM T;  4XU0 A;  1DJ7 B;  1U8R A;  3JCM J;  4M7A C;  2XD0 A;  4YTL A;  3QKJ A;  2V8I A;  4M77 E;  3RMQ A;  5A2Q E;  4M77 G;  4JRK A;  3MO8 A;  4C0D C;  4M7A F;  3QII A;  2JTM A;  4M75 C;  4V2S A;  2XDD A;  2DIQ A;  2LVM A;  3QO3 A;  1YBY A;  4EMK C;  3CCL A;  4C92 E;  1Q82 U;  2E1H A;  2HD0 A;  4BI8 B;  4C92 G;  4M75 F;  2DJZ A;  4XTU A;  2M0O A;  1BKB A;  2G3R A;  3CCR T;  3URG A;  3LGF A;  4A54 A;  3MET A;  3CC4 T;  1YJN T;  5KE2 A;  5GAO l;  2HQX A;  4C5E A;  1KQS S;  4M78 B;  3HL8 A;  4OB0 B;  2CZ6 B;  1QVF S;  4JS5 A;  4M7A G;  1UGQ B;  4IUQ A;  5GAN e;  3OYB A;  3L2U A;  2JNG A;  3QZ9 B;  3G4S A;  3GLX A;  3MCA B;  3QDR B;  4QQD A;  2KY9 A;  3OSV A;  4C8Q G;  5KCO A;  3CPW A;  3JB9 J;  2ZCF B;  3VUZ A;  2QI2 A;  2QQA A;  5I2M A;  2MAM A;  3CCU T;  1MGQ A;  3V8J A;  5FU6 B;  4M78 C;  4P5N A;  2QDY B;  5CVI A;  4KBM B;  4CRI A;  3HRS A;  1Q7Y U;  4RG8 A;  3L2Q A;  2X4J A;  3GP8 A;  1K8A U;  3X24 B;  2JOY A;  4M78 F;  1FWZ A;  1G3Y A;  1Y71 A;  3M54 A;  3MEU A;  5L8R E;  4E7J A;  5LJ3 g;  1N8R C;  3SD4 A;  2VUB A;  4IUR A;  3UPU A;  2DEQ A;  3DKM A;  1NJI C;  4M7A A;  4PJO C;  2MWO A;  2DTO A;  5FU6 C;  4DOV A;  3M9Q A;  3BDU A;  1M4Z A;  3OYI A;  5LJ5 e;  2E70 A;  3CXC S;  2BUD A;  2XHC A;  1BIA A;  4O5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...