2RM4A

Solution structure of the lsm domain of dm edc3 (enhancer of decapping 3)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
b'GAMGPTDQDWIGCAVSIACDEVLGVFQGLIKQISAEEITIVRAFRNGVPLRKQNAEVVLKCTDIRSIDLIEPAKQDLDGHTAPPPVVNKPTPVKLPHFSNILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG6311-PB
molecule tags Protein binding
source organism Drosophila melanogaster
publication title A divergent Sm fold in EDC3 proteins mediates DCP1 binding and P-body targeting
pubmed doi rcsb
total genus 9
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rm4A01
5LJ5d 1WNLA 3RESA 4Y91A 1JRIA 4HT9A 4M7AC 2RB6A 1HXDA 1BIAA 1Y96A 4M78C 4XTZA 1M5Q1 2EAYA 4EMKC 4F7UF 3JB9D 4HT8A 4WF2A 5LJ3f 1N9RA 5GAN3 2CGHA 3HSBA 3JCMV 5DY9A 4C92B 3EFRA 3VU3C 5GAOn 5GAOq 3JCMJ 4M78G 4M7DB 5LJ5e 3JCMX 4M7DD 5LJ5h 5CAIA 1D3BB 5GMKe 3L1AA 4M77B 1I8FA 1U1SA 3BW1A 1B34A 5GMKh 4M77D 2I2LA 4PJOB 1YCYA 2EJ9A 2VXEA 4C8QB 2DEQA 2DTOA 4QVCA 2RD1A 4JRKA 4NL3A 1I81A 4C92D 4JLIA 4M7AB 5LJ3d 2K57A 2E65A 5GAMd 5GANd 2Y90A 5GAN8 5GAOl 4F7UG 1WQWA 3JB9H 3BFMA 4M75B 3RIRA 3AHUA 3SWNA 3GIBA 3JB9G 4C8QD 3V8KA 4NL2A 2YLBA 5GAMf 3HFOA 1X01A 5GANg 4M78D 5LJ3g 4EMKB 1I5LA 3RKYA 4QVDA 3FB9A 1KQ1A 2VC8A 2ZGWA 4RCCA 4N0AC 5LJ3h 5GMKm 3FIFA 4MMLA 3JCMb 5GAN7 4M7DA 3QO3A 1LNXA 4PJOE 2EJFA 4PNOA 3L2ZA 4XU0A 4M78F 4NOYA 3QHSA 1MGQA 2E1HA 4XU2A 2DZCA 4M78E 4XU3A 3JCMP 4V2SA 2E10A 1LJOA 3BDUA 2YLCA 3RKWA 4C92G 5GMKl 2DXUA 3QUIA 5LJ3j 1N9SA 4C92C 1D3BA 3PGGA 4EMGA 5GAMg 4M7DF 4PJOA 4F7UB 1I4K1 2EWNA 2JN0A 4C92F 4M7AG 4M78A 3RERA 3JCMe 2DXTA 4M7DC 1TH7A 4C92E 5LJ5g 4M7AE 4M75C 2E41A 3JCMh 4C8QA 5GAMh 4M7AD 4C8QG 1B34B 4XTYA 3RUXA 5GAMe 5GANe 5LJ3e 5GAN6 3EFSA 3INZA 5GANh 2DZ9A 1Y96B 4M77F 4XTVA 4F7UE 4XQ3A 4PJOF 3JB9I 4M7DE 4M77E 3JCMg 3JCMc 4M77G 4C92A 4DQ2A 1U1TA 4M75A 4C8QE 3M4GA 4C8QC 1LOJA 3RKXA 5GMKi 2DTHA 4X9DA 5GAOp 4XTUA 4C8QF 3JCMW 3JB9J 2HNIA 1HK9A 3HFNA 5GAN4 2DJZA 5GAOr 4J5YA 3V7CA 4J6YA 4EMHA 4EMKA 4M7AF 3V8JA 2YHTA 4M77A 5LJ5j 3V7SA 4M75G 5GMKj 4M75D 4M75E 4M7DG 2RM4A 5GAOm 5LJ5f 5GANj 5I21A 4J6WA 4M75F 3QSUA 1H641 3JCMQ 2EJGA 5GANf 1BIBA 4X9CA 4A53A 4XU1A 4PJOC 2DVEA 4MMKA 4M77C 3SWNC 4A54A 4JRIA 4M7AA 2DKGA 4N0AA 4HA8A 3JCMf 2QTXA 4JUVA 2RA2A 3V7RA 5GAN2 1WPYA 4OP0A 1M8VA 2DTIA 4PJOG 4XTXA 3SWNB 3FJPA 4PJOD 5GAN5 4F7UA 2FYKA 4RCBA 3JCMd 1WQ7A 3V8LA 4J6XA 1KQ2A 4M78B 4XTWA 3BY7A 5GAMj 2E64A 3SB2A 3JB9F 2VXFA 1JBMA 2FB7A
chains in the Genus database with same CATH superfamily
3RR6A 2D8JA 4HT9A 2EKOA 2CZ7B 3RMSA 3CMEA 4KH0B 4PLLA 3L2QA 4C5GA 2CZ0B 2P4TA 5AYFA 1ZHIA 3JCMX 3M55A 3CCUA 4EIKA 1U1SA 2M02A 3SDZA 2I2LA 2QQBA 3BE3A 1JEGA 3J7AF 3OA6A 1B07A 1M1KC 4E7KA 1K4US 2YUOA 1N27A 4KUDK 2CSIA 1MMDA 1LPLA 5GAOl 3CCJQ 5FU6B 3WVEB 3A8OB 2AK5A 2CP5A 5KH6A 2F2WA 1XJWB 4BE0A 2L5QA 2EGEA 2KYBA 4CC3A 4HVWA 3TREA 1YJNA 2YRDA 3AT1B 1JXOA 1Y7XA 2D8HA 4JJCA 1OU8A 3X26B 4V2SA 3P8BB 3EGUA 1UE9A 3CBPA 4DBHA 2X3XD 1OYXA 1Q81R 2PQWA 3QYHB 1ZUKA 4M7AE 3NTKA 4PJNA 1UGRB 2LJ1A 2O01E 1KHCA 3VYHB 2JMAA 2SRCA 4M77G 1ZSZC 1WHLA 1BI1A 2QEXT 2M9UA 2KXCA 4M7AF 4J7IA 1K73U 2J06A 2QA4Q 1X6BA 2JW4A 1JJ2S 4IKFA 1VQNT 5HY6A 1VQ8T 3I55Q 1X43A 5FWCA 2C0OA 2FVUA 2K3BA 1M9SA 3P8DA 3LX7A 1ZSZB 4OP0A 2A37A 4A4EA 4HCCA 3CC4T 4LDWA 1HJDA 1ZSGA 2BIVA 2CZ1B 1QKXA 3WXMB 4O6JA 4XTWA 2QG9B 3QDRB 3L42A 2DLPA 3M4GA 3META 1SSHA 3VS2A 1SKUB 1M4ZA 2G6FX 2DA9A 1M27C 3DB3A 2EAYA 5CQYA 2GNCA 3JCMJ 2E5KA 1ABQA 1FWZA 1G2BA 3L2VA 3RDVA 2F5TX 3M59A 1OULA 2L0AA 3M0RA 2DX1A 4KGVB 2JZ2A 5IXBA 1UHFA 2ZCFB 3OYJA 3I56A 1UGPB 4BDZA 1K9MC 5A0GA 1WLPB 2ESWA 3GP8A 4II1A 4QQDA 2K4YA 1FX7A 2BZXA 1D1AA 3CMAT 3NFCA 1M2VB 4JJNK 1UUEA 2K3YA 4CRIA 1N9SA 1ZSZA 1D3BA 2DK3A 2JUFA 4J83A 2KRSA 3UA6A 1UGSB 3SFMA 1YJWA 2LT1A 1AWJA 4D6WA 2LNHB 2CP2A 1QW1A 2PTKA 5EC7A 4M4ZA 3TEEA 2KRMA 1Q95G 1NPPA 3VYGA 1QVFS 4KH1B 5CKDA 1TG0A 1GFCA 3OBYA 4BACA 1WX6A 4JZ4A 2CP3A 1VQ4Q 4AG2C 3CQTA 3RNJA 4PJOC 2DVEA 1VQ4A 4HVVA 1YN8A 4F16A 1X69A 4TVRA 2QAZA 4OGEA 2P0KA 2RH2A 2OJ2A 4F7UA 2DBKA 5KYWA 4J6XA 3OW2P 3BY7A 1CKBA 1WDXA 1M3AA 2Y4XA 1C6VX 4M7AC 1Y96A 1FXXA 2BZ8A 5GAN3 3CXCA 3TCJA 5CVIA 3VU3C 1TSFA 2QTVA 4CC7A 1QCOA 2X9HA 3OYCA 1D3BB 3CCSQ 2LVMA 1TWBA 3G6EQ 3R6NA 4RG2A 4WCIA 1ZBJA 4ATOA 2CH4W 1I5OB 2RD1A 1IGQA 1BU1A 5GAN8 2HD0A 1GRIA 3CCET 5FU7B 1VQ7A 2W10A 3AHUA 5GAMf 2AZVA 2ECZA 4LDVA 4JS5A 2DERA 5LJ3g 1WHHA 4LN2A 3GF5A 1V76A 2YRCA 5GMKm 4ZGJB 2OTLA 2JOYA 4L5GA 4OF1A 3BDUA 5GAMg 4ESRA 4F7UB 5KYWB 3LH5A 2NUPB 3ER0A 4N4IA 1UGVA 4JPBW 1TUDA 3NTHA 5GAN6 2DZ9A 4LNPA 1MHNA 1X27A 1VQPT 2EQIA 4LXCA 4DQ2A 3CC2T 3HFNA 4O5VA 1YITQ 4J9HA 1ZA2B 4M75G 4KUIA 1KC8U 2DETA 4VUBA 3A8LB 4M7AA 1D0YA 2M0YA 1PM3A 3NGPA 2DTIA 1Q7YU 5I22A 1D1CA 1UHCA 2KK4A 4CC4B 2WACA 3PFSA 4UC4A 3OS2A 1PRMC 2CP0A 3CD6A 2RI3A 1YI2T 2RI5A 1WFWA 3H8ZA 3KBGA 1N9RA 2DRKA 1K9AA 2ZPHB 1QVPA 4Q5WA 5GAOq 4ZGDB 2GFUA 5IN1A 1TS9A 2VKNA 1GFDA 4PL6A 3H9NA 3TVTA 2NUPA 3JRZA 2YT6A 2DEQA 2J6FA 9ATCB 2JTMA 3G4ST 1NYFA 5GAMd 1OPKA 2A3LA 2Y90A 3O8VA 1VQNQ 4RTTA 3QPHA 2K2MA 1VQNA 1GL5A 1K76A 2LC4A 2GGRA 4HVUA 2F2VA 3I55A 4OB3B 3E19A 1WXBA 3OYIA 2RQUA 1AT1B 3C95A 2KR3A 3LWIA 1LNXA 2VUBA 3EHRA 2ATCB 4RG8A 2VGNA 4XU3A 3OYAA 2E3HA 4DA4A 3RKWA 3CPWA 5LJ3j 1UECA 5CKHA 3CCQA 4M7AG 4LD9K 4RTZA 2L3QA 2QYZA 4C8QG 3S3MA 2KAFA 4M77F 2XDPA 4FU6A 2GTOA 1YJWT 3WVDB 2YUPA 5GAOr 1MNEA 1ZLMA 1XQHA 4BY6B 3OYBA 3OYKA 3CCMQ 2LNVA 3V8JA 1GBQA 3CXCS 4M75E 5GANj 2GFAA 1VQMQ 1PCXA 3H0IA 4A53A 1PSFA 1UJ0A 4MMKA 3A98A 3ZFJA 1EZZB 2WSCE 3VS5A 4RUGA 1D1BA 4AT1B 2VYTA 1YIJQ 4FT4A 2DO3A 3CPWS 3EGXA 1X2KA 3I56T 2JMCA 3TSZA 2RF0A 2M1HA 5LJ3f 3EFRA 3A8MB 4ZTJA 1VQ6T 2RK1A 2FL7A 5CKFA 2PVOB 5GMKe 2C0TA 4B9WA 1WHGA 2GQVA 1S72Q 2MF2A 1M3BA 4BY6C 1TXQA 1R0BG 2EQKA 2V8JA 2DJQA 2KRNA 5FLXE 2PVDB 1AEYA 4PK4A 2PUOB 1G3YA 1KQ1A 3GLXA 3SHWA 4N0AC 1VQ5T 1VQ9T 3CD6Q 1QVGS 5IHNA 4KRTA 1UDLA 2FEIA 3JCMP 4C92G 4BE1A 1FMWA 5IT9E 4RTVA 2QEXA 5KCOA 4PFZA 1EFNA 2RJEA 1X6OA 1VQKA 1VQ9A 2LCLA 2OTJT 3PTAA 1S1NA 1WXUA 2JVVA 3G6ET 1Q7YC 3OYGA 2YDLA 3QDFA 2R57A 2COYA 3LH0A 4C92A 4AMCA 2HDAA 3CCQT 2MAMA 4C8QF 2V26A 3G71T 2EYXA 4HKEA 4ZN3A 4EMKA 4RKUE 4OB1B 2B86A 4CC2A 2FRYA 5KYXA 4OMLA 3LLRA 4LUEA 2HBWA 3MP6A 1YJNT 3VS1A 4A54A 4C0DB 1PKTA 2EYWA 1W2BP 1BCOA 4KBMB 1X6GA 2KY9A 3N5BB 4BI8B 1KJWA 5J39A 4Z02A 3QBYA 2OTLQ 2A7YA 2IVWA 4M78C 1BYMA 2X4WA 2KSSA 2VB6A 2O9SA 1ZUYA 4HCKA 1HD3A 1M90C 3E9GA 2Z0WA 4JDSA 2HCKA 3ZEHA 2C0IA 4ELZC 4IIMA 1K8AU 5FRMA 1B7TA 2E5QA 2VXEA 4JJDA 3OS5A 4KGXB 2ROLA 4RTYA 3CMET 2EQMA 4C0GA 2E12A 3MJXA 5GANd 4BE2A 2CUBA 3CCLQ 1WQWA 2QDYB 1QVGP 2BE9B 1OI1A 3P8HA 3SWNA 3DLMA 1YBYA 4NL2A 2A36A 2KNBB 2K79A 4EMKB 1NZ9A 2LTOA 2MPXC 3PT9A 5KYXB 5IHKA 1YHQQ 2DAQA 2RMOA 1QP2A 3X24B 2I0NA 4XU0A 4ZNXA 4NOYA 4M78E 1YI2Q 4C92C 1VQKT 1PKSA 1NYGA 4RTXA 5HK0A 5KCHA 1RACB 4M7DC 4M75C 4C8QA 4BDYA 1H92A 1LOJA 2FG0A 3M0PA 1BBZA 2MK5A 3FC3A 4M77A 3CBMA 4E7HA 1YHQA 2OAUA 2ZPGB 2NWMA 2YUQA 4OB0B 4XK8E 2DMOA 2L89A 1GCQC 1QVGA 1YJ9T 3V7RA 3LW5E 1OX9A 3HPWA 1M8VA 5L23A 1RI9A 2O9VA 4PJOD 3JCMd 4DOVA 1VQLA 1VQ7T 3CCUQ 1B34A 2VXFA 5LJ5d 1YNZA 1GCPA 3QJ6A 2E70A 2O88A 1PWTA 2QQSA 3OYNA 1K9MR 5ECAA 1D0XA 2HL5C 5J3BA 5LJ5h 5CAIA 2QQAA 2MWOA 3EHQA 5KE3A 1K9MU 4R55A 1AWWA 4C92D 5I2MA 3DLLA 3I9QA 1JB0E 3M57A 2XDDA 1OZ2A 4X34A 4M75B 2YXYA 3R6OA 4C0DC 3V8KA 2X35A 1WZOA 3M5AA 4IUUA 1VQPA 3CC2A 3RKYA 3BDLA 2W0ZA 1BI0A 4QVDA 2PNIA 1YIJT 1H8KA 4M7DA 5IH2A 2JS0A 4K11A 1PHTA 1W1FA 3VS4A 3QUIA 2NUTA 1KG1A 3OB9A 3A8GB 3HRUA 4E6RA 1TH7A 4PKCC 2RQTA 1Q86R 3VRZA 2CH4A 3F70A 5GANe 2HKNA 4XQ3A 2OTJA 1C0MA 3ULRB 2CT4A 4KT0E 3OW2S 3MEAA 1W6XA 4E7JA 1K1ZA 2LQ8A 2M16A 1UB4A 1JO8A 4F14A 3DKMA 3OMCA 3CCRQ 2LQWA 2LQKA 2DF6A 4J6WA 2DM1A 2FPEA 3QXEB 3LGFA 2L3SA 3JCMQ 3PVLA 4J9IA 1Q81C 2XG8D 2FZCB 4JLGA 2DKGA 5HK3A 3X20B 1VQ5Q 2F2XA 2LMJA 1Y57A 4XTXA 1E7OA 2JM8A 4F17A 3ZL7C 3REAB 3VRYA 2J6KA 2LCCA 2PU9B 1SEMA 4MDXA 2KI7A 5KE2A 1YCSB 4R0KA 1JRIA 1PC0A 2EYZA 3EG9A 1G83A 2L8DA 3CCST 2DYBA 2CSQA 4M78G 3EG2A 3CCQQ 1YCYA 3CCRA 3EFOA 5C6SA 4JJBA 4QVZA 4JRKA 1WHJA 1AWOA 4D8KA 3NHNA 3E1SA 1YJNQ 1EIFA 4C8QD 2KE9A 3CEYA 1YI2A 3HFOA 1UFFA 3NPFA 3MP8A 4M78D 1M8MA 2LRQA 3VKIA 1P92A 2X4JA 1OU9A 5D6YA 2XDBA 3KFVA 4E47A 2XMFA 1Q86C 2H8HA 4MMLA 6AT1B 5GAN7 5CKBA 3NMZC 1RABB 3MEUA 2DIGA 1X75C 2YLCA 2KT1A 2BUDA 4IUPA 2QQ9A 4XAXB 1MNDA 3S3NA 3UA7A 3E2UA 1Q81U 1AD5A 4GBQA 1UG1A 1VUBA 1W2BS 1VYUA 1PSEA 1GXIE 5GAOp 3CMEQ 3RKXA 3CPWP 4X9DA 4J7FA 1UJYA 1GBRA 1IB8A 1HK9A 2R5AA 5DLQE 5GAN4 3X28B 1IZ6A 2ED0A 4FCYA 4ME7A 4EMHA 1WA7A 2LDMA 3CCMA 3G4SA 1RAIB 2QK0A 4BI4A 2QEXQ 1N8RC 1OEBA 3CCEA 2EQUA 4JUVA 5CK9A 2KVQG 3I55T 1EX4A 3QZ5B 3V8LA 4AFSC 3ME9A 3OY9A 2ZPBB 2QGGA 5CO7A 2XIDA 1RAEB 1ZUUA 3RESA 3Q1JA 4XTZA 4EMKC 4HT8A 2K5IA 5IHIA 1RAGB 2V1RA 1MUZA 4DBQA 1U5SA 2L2PA 2L3PA 3LGLA 1PG5B 2O2OA 1S72A 3BW1A 2EPDA 2XI9A 2QDLA 4C5HA 1RI0A 1YITA 1H3ZA 1K0XA 3MO8A 2M51A 1F1BB 2E4HA 3OYYA 1V1CA 1I81A 2YSQA 4CI0C 1VQ4T 3CCSA 4RTWA 1MV0B 5D6WA 1AZEA 1QWFA 2E6ZA 2MMPA 2R5MA 2KROA 2EGAA 1YJ9A 2KQWA 2KDSA 4BB7A 1I0CA 2FHDA 2KBTA 2VASA 2D0NA 4AFUC 4JRPA 3QO3A 1WYXA 2KYMA 1VQ7Q 3UF4A 4M78F 3MP1A 4XU2A 1IHVA 2FRWA 5GMKl 1VQOA 2HSEB 2J7IA 1M1KU 4C92F 3JCMe 1VQOT 1QCNA 3I5RA 5GAMe 3HL8A 4XTVA 5AT1B 4QT7A 2DL8A 3QZ9B 2QXFA 2EGCA 1SRLA 2JTFA 1XTDA 3JCMW 2DTHA 4M7DE 1JQQA 2ZPEB 5I2SA 3S3OA 5HKCA 2RN8A 5CR2A 1YWPA 1ZBXA 5GMKj 2NUZA 2GBQA 4E7ZA 4XU1A 1RLPC 1WGSA 2QTXA 5A2QE 2X4YA 1M90R 4A4KA 3CCLA 5L8RE 1BB9A 4FW2A 4PJMA 1Y71A 2DL4A 1CKAA 3PE0A 3GOXA 1BIAA 1PRLC 1VQ6A 4F7UF 1TU0B 2KGTA 1W2BA 1Q82R 3QIIA 4AFZC 4IURA 3VS6A 2DVJA 5GMKh 3M58A 4FL6A 1TUGB 2EVRA 2V8IA 1M30A 3M0TA 3QWXX 2DL5A 2E65A 3FJ5A 3BFMA 3RIRA 1JXMA 3JB9G 3I5SA 2YLBA 3CCEQ 3J80E 1Q7YR 2EFIA 4OMPA 4A4FA 2HZYA 3OS0A 2K9GA 3A1PA 2E1HA 1AWXA 2HKQB 2COWA 1IO6A 2HSPA 3UWNA 2YUNA 2J05A 1SF9A 2K3XA 5GJVB 2K5FA 5LJ5g 3C12A 1VQLQ 4FYWB 4LE9A 3G71Q 1SSFA 4M77E 3JCMg 1VIFA 1G3SA 4QQGA 4HCZA 1T0HA 1WHKA 4J6YA 1B3QA 1QP3A 1XNIA 4FSXA 4A63B 3CCJT 1HSQA 4Z8AA 3HRSA 3OYMA 4ZTFA 4N0AA 3M53A 2DEUA 3FJPA 5GAN5 1KQ2A 2ZPFB 3EG0A 3C4SA 5CIUA 1OOTA 2ZAEA 2HL3A 2RB6A 1HXDA 4PFPA 5FU7C 3JB9D 3G1JA 4B6MA 1OX8A 1KQSP 2H3JA 2RJFA 5DY9A 1FMVA 2R58A 2DILA 1M2VA 4LDXA 3A8HB 1QKWA 2VV5A 1MMGA 3TU4K 4JS4A 3L2RA 3M56A 2P0QA 2AZSA 1SRMA 3UDCA 3JAME 3E9FA 4M7AB 2BKDN 2MOXA 1VQMT 3JB9H 1Q86U 4J9DA 2C06A 1YHQT 4WTOB 5GANg 5KYNA 4LUDA 2CS7A 5M9OA 3ZBDA 1KIKA 2P0PA 1A0NB 1M90U 1VQKQ 2EJFA 3L2ZA 1Q82U 3OYFA 1NEGA 2DZCA 4ANJA 2E10A 5FRNA 5IAYA 7AT1B 1H3HA 1KK7A 2G3RA 2RHYA 2CP7A 3GBQA 2LP5A 3KUFA 1MMNA 1UEBA 2BZYA 5GAMh 1KQSS 2GCXA 3RUXA 1Y96B 2LZ6B 2O31A 3JB9I 3OSSC 3IQLA 4BD3A 1K8AC 1VIEA 3EH2A 3PVQA 4J9FA 1HYOA 3V7CA 4YTLA 5GJWB 4MDWA 2EQJA 1RUWA 1NPRA 5I21A 2OI3A 1M1KR 1H641 2EBPA 4X9CA 3M54A 2JNGA 4EPCA 2IG0A 2WSEE 2RQWA 5GAN2 2EKHA 1K73C 4R56A 3UPUA 3CPFA 1QLYA 2VVKA 3FRNA 5HCKA 4Z88A 5IXFA 3U23A 2E6NA 2OX7A 2B8AA 3I56Q 3JCMV 2EYYA 1VQOQ 2OTJQ 2MYSA 5GAOn 5J26A 5LJ5e 2HEQA 4GY5A 4B9XA 4M77D 1NEBA 2EJ9A 2F5KA 1G3TA 2CT3A 2QASA 4DOWA 1RAFB 2XK0A 5C0MA 4F7UG 1D09B 2BTTA 4OVAA 5D7UA 1WI7A 5KYUA 1ZX6A 2ED1A 2VGMA 2QGFB 2RI2A 1QVFA 4FM4B 1AOJA 4F04B 2DD4A 3G7ZA 1SG5A 4E7IA 3QHSA 1MGQA 2XD0A 2DRMA 1ZQ1A 3UATA 2XICA 1VQ9Q 2ABLA 2MIOA 4M7DF 4MZMA 1OPLA 3OYDA 1I4K1 1N5ZA 3REBB 2JN0A 3T9NA 1AZGB 1V29B 4M7AD 4C5EA 1M1GA 4IUTA 5GANh 3ASKA 1IHWA 1BKBA 1O9SA 4PJOF 5A0LA 3M0SA 5KYYA 3JCMc 1G3WA 4C8QE 1SHGA 3JB9J 1BCMA 4XTUA 1I5LA 2HNIA 2KMTA 3VS0A 2IIMA 1NE8A 2RQVA 2D1XA 4HCBA 3QSUA 3THKA 2EJGA 1WJRA 2QA4T 4QW2A 4E7LA 1D0ZA 1VQ8Q 5D6XA 3VS7A 4PJOG 3LYIA 4Y28E 2FYKA 5KYUB 4OMMA 1LVKA 4HXJA 5GAMj 2X3WD 3VV0A 4PFOA 1OV3A 2WSFE 2V1QA 2FB7A 2J6OA 4QQ6A 4WF2A 3C0CA 4C92B 3D7SB 4BUGA 2E3IA 1VQLT 2HQXA 2KT8A 3URGA 3M0UA 1OQKA 4J9BA 1AHJB 2IPOB 1I8FA 4A4HA 1IREB 1VYTA 3VS3A 4ORZA 2D6FA 1NG2A 3H6ZA 1BI3A 1VQPQ 3CC2Q 3TQ7P 1N6AA 2AIRB 1JU5C 4LDUA 1M2OA 5KYYB 1ABOA 4ZN1A 1VQ8A 3CCJA 3RBBB 1XOVA 1YJ9Q 3QWYA 3EG1A 3FDRA 3FIFA 3MPUB 4PJOE 2DIQA 1BK2A 1K73R 3CC7A 4PJJA 2RHXA 2LJ3A 4DBRA 3OMGA 1G5VA 2DXUA 1E6GA 1I1JA 2MWPA 2QQRA 3CC7T 2EWNA 3EGXB 1NM7A 3RERA 2RHZA 2M0OA 2DYIA 1OZ3A 3L2UA 2CDTA 3EFSA 3INZA 4IUQA 3HP9A 1T3LA 1KD1C 2A08A 2CZ6B 1K8AR 1PD1A 2GQIA 5CKEA 4J9GA 2DJZA 3TSWA 3GNGA 5A0DA 1YWOA 2YHTA 1N8RU 1C1AA 1M1FA 1RL2A 4M75D 4M7DG 5LJ5f 3OS1A 1ACMB 3OYEA 4M75F 1TUCA 3CMAA 1BIBA 1NLPC 2KEAA 1WJSA 2Y4YA 4A4GA 3JCMf 4HA8A 2DXBA 2RA2A 2QI2A 1K0SA 5CQXA 1WXTA 4C0ZA 4RCBA 2RK2A 3FLGA 1SPKA 1KFZA 1Z9ZA 3CCVQ 3SB2A 1VQ6Q 1NJIR 2F1LA 3X25B 1KSWA 2CGHA 2ZZDA 1PD0A 4OB2B 3VUZA 1RAAB 1S72T 4QKUA 4M77B 4OMOA 2QA4A 1YJWQ 2KXDA 3QJYA 3MEWA 4KGZB 4QVCA 1T0JA 1W70A 4NL3A 4JLIA 5LJ3d 2K57A 2RJDA 3CCMT 2FPDA 2AKLA 2DL3A 4J8OA 3KXTA 2MI6A 2SEMA 2CREA 1W4SA 2RO0A 4LDYA 4OGCA 1NJIC 3CD6T 4FW1A 3EGDA 2VC8A 3H0FA 3PMIA 3JCMb 4N4HA 4ELYC 1PNJA 4E2FB 1IXDA 1TOVA 3O5ZA 3A5ZB 1KQSA 1LJOA 2ENMA 3GPLA 2A28A 2PZ1A 2K7AA 3EAEA 4EDUA 5CCAA 1R8OB 5FROA 2DFUA 4RMOA 1NJIU 2FZKB 1T3SA 3DB4A 3JCMh 1IGUA 2JJ9A 1YP5A 2O4XB 3MEVA 4MZPA 2BE7D 4RTUA 1Z9QA 4GLMA 2DXCA 4M75A 2DE0X 2CYZB 4C8QC 3CCVA 4D8DA 2LCSA 3EG3A 2OAWA 1CSKA 2RM4A 1YITT 1VYVA 4M77C 3CCRT 1Y07A 1QCFA 3CXCP 2K2VA 2XU8A 2EIFA 2GTJA 2OTLT 1WPYA 3SWNB 2LJ0A 3QG1A 1GCQA 1KD1U 2YRVA 1VQMA 3J81E 3EGDB 1AVZC 1E6HA 1WNLA 3EH1A 1FYNA 4Y91A 4AFQC 1JJ2P 4DEYA 2YWWA 1U06A 4M7DD 1BI2A 2DBMA 4Y92A 3PIPA 2V8KA 1QWEA 4LD6A 3SEMA 1J3TA 3SD4A 5DLOA 4N4GA 3CCLT 4C8QB 1JJ2A 2DNUA 2DTOA 4BI3A 2D0QB 4AG1C 8AT1B 1Y0MA 2JM9A 1VOMA 2VWFA 1R77A 2O4XA 5FW9A 2FO0A 1I07A 3QKJA 1Q82C 3OBWA 2RNAA 3G4SQ 2CUDA 4FIBA 4MZTA 1VA7A 1KD1R 4L59A 2JXBA 4P5NA 3OYHA 2XHCA 3VJPA 5I11A 3FB9A 3NTIA 4RCCA 4DBFA 5LJ3h 4OMNA 3EG9B 3CC4A 2AKKA 5LL6S 3CC4Q 2NYSA 1RAHB 3G6EA 4FYYB 3OW2A 3PGGA 2RJCA 4PJOA 1UTIA 3JV3A 3EFOB 2DXTA 4C92E 2RPNA 1LCKA 4FT2A 4JRQA 3MKDA 2PUKB 1B34B 4XTYA 3H41A 5GMKi 2LQNA 2GF7A 2FPFA 3S6WA 4J5YA 8ATCB 3OYLA 2F69A 5DM7R 2HAXA 2HBPA 3MCAB 2ZPIB 3V7SA 2CKKA 5GAOm 4FSSA 2X51A 4NS5A 5GANf 5FU6C 1RLQC 3C94A 2HQHA 5FWBA 2DL7A 4JRIA 1QMCA 4J9EA 1ZA1B 3HHTB 2RHIA 2JT4A 3CCUT 3M9QA 1VQ5A 1KC8C 1WQ7A 3M0QA 4M78B 1G8XA 4KULA 3CMAQ 2L3RA 2DD5A 3JB9F 2PVGB 3CC7Q 4OMFB 1TTHB 4M7DB 1M5Q1 3HSBA 1NLOC 1KC8R 3HKSA 3H0HA 2DPPB 2MCNA 2NUTB 2CP6A 2ROTA 3L1AA 2AT1B 4PJOB 3PMTA 4ZGEB 2JS2A 1IRXA 2K5LA 2EW3A 4Z89A 4JZ3A 2D9TA 2RHUA 4PJLA 2H3EB 2COZA 3GIBA 5EG2A 2A0FB 1X01A 1RADB 3CBOA 3FEOA 4FYXB 1NBEB 2ZGWA 2EYQA 2LX7A 3G71A 3CCVT 4PLIA 4PNOA 3QYGB 2JTEA 2AHJB 1MV3A 1R0CB 1U8RA 3UT1A 1N8RR 4J9CA 4EMGA 1WHMA 1X2QA 1DJ7B 1YFNA 3OQ5A 1KHIA 4M78A 2FZGB 3L2WA 2E41A 3I35A 5LJ3e 1ARKA 3RMQA 4F7UE 2P84A 2K6DA 1U1TA 4L6V5 4E7SA 1M3CA 4DEXA 3HRTA 4OMQA 1O75A 5LJ5j 3OSVA 2LX9A 4X1VA 4GLKA 3JSCA 1FMKA 3VUBA 4C5IA 1U3OA 3M4YA 3GNFB 3SWNC 4IUVA 1UGQB 2NLUA 4IIOA 1QQJA 4C0FA 1SHFA 3PIOA 3PNWC 2HMAA 4FYVB 2X4XA 2LT4A 3LWHA 3HTRA 3MHXA 1WJQA 2XKOC 2RQRA 1QVFP 1WIEA 1YIJA 2P4RA 2E64A 2HQEA 1MMAA 1JBMA
chains in the Genus database with same CATH topology
5CO7A 2XIDA 3RESA 3Q1JA 4HT9A 4XTZA 4QQ6A 2EKOA 2CZ7B 3RMSA 4EMKC 3CMEA 2M1HA 4PLLA 4WF2A 5LJ3f 3L2QA 4HT8A 2K5IA 4C92B 4BUGA 4C5GA 3EFRA 1VQLT 2CZ0B 3A8MB 4ZTJA 1VQ6T 2HQXA 2P4TA 2RK1A 5AYFA 2FL7A 3URGA 3LGLA 1ZHIA 5CKFA 2PVOB 3JCMX 3M55A 5GMKe 3CCUA 1AHJB 4B9WA 1I8FA 1U1SA 2GQVA 3BW1A 3SDZA 1IREB 2I2LA 4A4HA 2QQBA 1S72A 2XI9A 4C5HA 3J7AF 2D6FA 1RI0A 3H6ZA 2MF2A 3OA6A 1BI3A 1M1KC 1YITA 1H3ZA 4E7KA 3MO8A 1N6AA 1N27A 3OYYA 4KUDK 1I81A 4BY6C 4LDUA 5GAOl 4CI0C 1VQ4T 5FU6B 3CCSA 3WVEB 2EQKA 2V8JA 3A8OB 5D6WA 4ZN1A 5FLXE 3CCJA 2PVDB 5KH6A 1VQ8A 1XOVA 4BE0A 2L5QA 2E6ZA 2MMPA 2PUOB 2R5MA 1YJ9A 1G3YA 3TREA 2KQWA 2KDSA 4BB7A 1KQ1A 3GLXA 2FHDA 1YJNA 3FDRA 4N0AC 3FIFA 1VQ5T 1VQ9T 4JRPA 3QO3A 1Y7XA 4PJOE 2DIQA 1QVGS 4M78F 3MP1A 4XU2A 3JCMP 3CC7A 2RHXA 3X26B 3P8BB 4V2SA 3OMGA 4C92G 5GMKl 4BE1A 1G5VA 2DXUA 3CBPA 5IT9E 2QEXA 1VQOA 1OYXA 2MWPA 2QQRA 5KCOA 3CC7T 2EWNA 1M1KU 2PQWA 3QYHB 4C92F 2RJEA 3RERA 3JCMe 2RHZA 4M7AE 1VQOT 1X6OA 1VQKA 3NTKA 2LCLA 2M0OA 1VQ9A 2OTJT 1UGRB 1OZ3A 5GAMe 2O01E 3PTAA 3L2UA 2JVVA 3G6ET 1Q7YC 3EFSA 3INZA 4IUQA 3HL8A 3HP9A 1KHCA 4XTVA 3VYHB 3OYGA 1KD1C 4M77G 2R57A 2QXFA 3LH0A 2CZ6B 3QZ9B 4C92A 2JTFA 1XTDA 3CCQT 3JCMW 2DTHA 2MAMA 4M7DE 4C8QF 5CKEA 1BI1A 3G71T 2DJZA 2ZPEB 3GNGA 5I2SA 2QEXT 2M9UA 4HKEA 4ZN3A 4EMKA 5A0DA 3S3OA 5HKCA 4RKUE 2YHTA 4OB1B 4J7IA 4M7AF 1K73U 5CR2A 1N8RU 1ZBXA 5GMKj 1M1FA 1RL2A 4M75D 4M7DG 5LJ5f 3LLRA 3OS1A 3OYEA 4M75F 1JJ2S 4IKFA 1VQNT 3CMAA 5HY6A 1VQ8T 1BIBA 4XU1A 3MP6A 1YJNT 1WJSA 4A54A 2Y4YA 4A4GA 4C0DB 3JCMf 1WGSA 2FVUA 4HA8A 1M9SA 2DXBA 2QTXA 2RA2A 3P8DA 5A2QE 2QI2A 2X4YA 3LX7A 4KBMB 4OP0A 3N5BB 2KY9A 5CQXA 4A4EA 4HCCA 4A4KA 4C0ZA 3CC4T 4LDWA 4BI8B 3CCLA 2BIVA 2CZ1B 4RCBA 3WXMB 2RK2A 4O6JA 3FLGA 5L8RE 4XTWA 5J39A 1Y71A 3QDRB 3QBYA 4Z02A 3L42A 3SB2A 3M4GA 2A7YA 3GOXA 3META 2IVWA 1M4ZA 3X25B 4M78C 1BIAA 1BYMA 3DB3A 2EAYA 4F7UF 2X4WA 1VQ6A 5CQYA 2KSSA 2CGHA 2ZZDA 1W2BA 4OB2B 3QIIA 1M90C 4IURA 3VUZA 3E9GA 3JCMJ 1S72T 4JDSA 3ZEHA 1FWZA 4ELZC 4M77B 3L2VA 5GMKh 3M58A 1K8AU 5FRMA 4FL6A 2QA4A 2E5QA 2VXEA 2F5TX 2V8IA 3QJYA 3OS5A 3M59A 3MEWA 4QVCA 3CMET 2EQMA 4NL3A 4C0GA 2E12A 2JZ2A 4JLIA 2E65A 2K57A 2RJDA 5LJ3d 5GANd 4BE2A 3CCMT 2ZCFB 3OYJA 3I56A 1WQWA 2QDYB 1UGPB 3BFMA 1OI1A 3P8HA 4J8OA 3RIRA 4BDZA 3SWNA 3KXTA 1K9MC 2MI6A 5A0GA 3DLMA 1YBYA 4NL2A 2YLBA 3JB9G 1W4SA 2RO0A 4LDYA 3J80E 4OGCA 3GP8A 4EMKB 1NJIC 4II1A 1NZ9A 4QQDA 3CD6T 2LTOA 2K4YA 3PT9A 2EFIA 2VC8A 2DAQA 1QP2A 3X24B 3PMIA 1FX7A 4A4FA 4N4HA 4ELYC 3JCMb 3CMAT 4XU0A 3NFCA 3A5ZB 4NOYA 3OS0A 2E1HA 4M78E 1KQSA 1LJOA 4JJNK 3GPLA 2K3YA 4CRIA 1N9SA 3EAEA 1D3BA 4C92C 4EDUA 5CCAA 2DK3A 2JUFA 1VQKT 4J83A 5HK0A 1R8OB 5FROA 3UWNA 4RMOA 2K3XA 2K5FA 5KCHA 4M7DC 1NJIU 5LJ5g 1UGSB 3SFMA 3DB4A 4M75C 3JCMh 4C8QA 4BDYA 1YJWA 3C12A 2LT1A 4D6WA 1SSFA 2O4XB 3MEVA 1QW1A 4MZPA 4M77E 3JCMg 1VIFA 1G3SA 3TEEA 4M75A 2DXCA 4C8QC 3CCVA 1LOJA 2CYZB 1NPPA 4QQGA 4HCZA 3VYGA 1QVFS 5CKDA 4BACA 3OBYA 3FC3A 4J6YA 4M77A 3CBMA 1QP3A 1XNIA 2RM4A 4FSXA 4E7HA 1YHQA 2OAUA 2ZPGB 3CCJT 4OB0B 4XK8E 1YITT 3HRSA 3OYMA 2L89A 4PJOC 2DVEA 1VQ4A 4M77C 1QVGA 3CCRT 4ZTFA 1Y07A 4N0AA 1YJ9T 2K2VA 3M53A 3V7RA 2XU8A 2EIFA 3LW5E 4TVRA 3HPWA 1WPYA 2OTLT 1M8VA 3SWNB 3FJPA 2P0KA 2RH2A 4OGEA 4F7UA 3QG1A 3JCMd 5GAN5 4PJOD 1KD1U 4DOVA 4J6XA 1VQLA 1KQ2A 2ZPFB 3BY7A 2YRVA 3C4SA 1VQMA 1VQ7T 5CIUA 3J81E 2Y4XA 2VXFA 1B34A 5LJ5d 1WNLA 4Y91A 4M7AC 2RB6A 1HXDA 1Y96A 3QJ6A 1FXXA 5FU7C 2E70A 3JB9D 4M7DD 5GAN3 2H3JA 2QQSA 2RJFA 5CVIA 5DY9A 1BI2A 3TCJA 3OYNA 3CXCA 3VU3C 2R58A 4LDXA 3A8HB 3PIPA 2V8KA 2VV5A 4LD6A 5J3BA 5LJ5h 5CAIA 1D3BB 3OYCA 3TU4K 2LVMA 4JS4A 2QQAA 3SD4A 2MWOA 3L2RA 4RG2A 5DLOA 4N4GA 3CCLT 3M56A 2P0QA 5KE3A 4C8QB 1JJ2A 4ATOA 2DTOA 4BI3A 3UDCA 1K9MU 2D0QB 4R55A 3JAME 2RD1A 3E9FA 4C92D 5I2MA 4M7AB 5GAN8 2O4XA 2BKDN 2HD0A 3DLLA 1JB0E 3M57A 5FU7B 2XDDA 3CCET 3QKJA 1VQMT 1VQ7A 3JB9H 1OZ2A 4X34A 4M75B 1Q82C 3OBWA 3R6OA 1Q86U 3AHUA 2C06A 4C0DC 1YHQT 5GAMf 3V8KA 2X35A 4FIBA 4LDVA 4MZTA 4JS5A 3M5AA 4L59A 5GANg 5LJ3g 4IUUA 4P5NA 2XHCA 3OYHA 1VQPA 3CC2A 3RKYA 3BDLA 3VJPA 1BI0A 4QVDA 3FB9A 3GF5A 2CS7A 1YIJT 5M9OA 3NTIA 4RCCA 5GMKm 5LJ3h 3ZBDA 4ZGJB 4M7DA 3CC4A 2P0PA 1M90U 2EJFA 2OTLA 3L2ZA 1Q82U 2JOYA 4L5GA 4OF1A 5LL6S 3OYFA 2DZCA 2E10A 5FRNA 3BDUA 5IAYA 3G6EA 3QUIA 3OW2A 1KG1A 3OB9A 3PGGA 5GAMg 2RJCA 4PJOA 4F7UB 2G3RA 2RHYA 3A8GB 2DXTA 3HRUA 1TH7A 3KUFA 1UEBA 4PKCC 3ER0A 4C92E 5GAMh 4N4IA 4FT2A 2GCXA 1KQSS 4JRQA 2PUKB 1B34B 4XTYA 3F70A 3NTHA 3RUXA 5GANe 5GAN6 2DZ9A 1Y96B 3JB9I 4XQ3A 3OSSC 2OTJA 1MHNA 1VQPT 3CC2T 4DQ2A 4BD3A 4KT0E 5GMKi 3OW2S 1K8AC 1VIEA 3MEAA 2GF7A 3S6WA 3HFNA 4E7JA 2LQ8A 2M16A 4J5YA 4O5VA 3V7CA 4YTLA 2F69A 5DM7R 1UB4A 3OYLA 2HBPA 2HAXA 3MCAB 2ZPIB 4MDWA 3V7SA 4M75G 3DKMA 3OMCA 4KUIA 2EQJA 2CKKA 2LQKA 1NPRA 5GAOm 1KC8U 5I21A 4J6WA 4NS5A 1H641 3QXEB 3LGFA 3JCMQ 4VUBA 3C94A 4X9CA 3A8LB 5FU6C 5GANf 1Q81C 3M54A 2JNGA 2XG8D 4JRIA 4JLGA 2DKGA 4M7AA 4EPCA 2IG0A 2WSEE 3HHTB 5HK3A 2RHIA 3X20B 5GAN2 3CCUT 3M9QA 1K73C 1Q7YU 4R56A 2DTIA 3UPUA 4XTXA 3CPFA 1VQ5A 1KC8C 2KK4A 1WQ7A 2WACA 4M78B 3PFSA 4KULA 3FRNA 4UC4A 3OS2A 3CD6A 2L3RA 2DD5A 2LCCA 2PU9B 3JB9F 4MDXA 2E6NA 2PVGB 5KE2A 2RI3A 1JRIA 2B8AA 4OMFB 1YI2T 2RI5A 4M7DB 3H8ZA 1M5Q1 2L8DA 3KBGA 1N9RA 3HSBA 3CCST 3JCMV 3HKSA 5GAOn 2ZPHB 1QVPA 4Q5WA 2DPPB 5J26A 4ZGDB 5GAOq 2GFUA 5IN1A 4M78G 5LJ5e 4GY5A 3L1AA 4B9XA 4PL6A 4PJOB 4M77D 3PMTA 4ZGEB 1YCYA 3CCRA 2EJ9A 5C6SA 2F5KA 3JRZA 1G3TA 2DEQA 4QVZA 2K5LA 4JRKA 2JTMA 3G4ST 4DOWA 5GAMd 2A3LA 2XK0A 2Y90A 3O8VA 5C0MA 4F7UG 3QPHA 4OVAA 2D9TA 2RHUA 1VQNA 3E1SA 3GIBA 1EIFA 4C8QD 3CEYA 2VGMA 5EG2A 1YI2A 2LC4A 3HFOA 1X01A 4M78D 3MP8A 3VKIA 2LRQA 3I55A 3CBOA 3FEOA 2RI2A 1P92A 4OB3B 3E19A 2X4JA 1QVFA 2XDBA 5D6YA 3OYIA 4FM4B 2ZGWA 2EYQA 4E47A 2DD4A 3C95A 3G71A 1Q86C 4MMLA 5GAN7 3G7ZA 3LWIA 3CCVT 1LNXA 2VUBA 4PLIA 4PNOA 5CKBA 4E7IA 3QYGB 4RG8A 2VGNA 1MGQA 3QHSA 2AHJB 4XU3A 3OYAA 2XD0A 1ZQ1A 4DA4A 3MEUA 2DIGA 1X75C 2YLCA 3RKWA 2XICA 3CPWA 1U8RA 3UT1A 5LJ3j 2BUDA 4IUPA 4EMGA 4M7DF 4MZMA 1DJ7B 2QQ9A 3OYDA 1I4K1 4XAXB 5CKHA 3S3NA 3OQ5A 2JN0A 1KHIA 3CCQA 3T9NA 4LD9K 4M78A 3L2WA 4M7AG 1V29B 2E41A 1Q81U 4M7AD 4C8QG 4C5EA 5LJ3e 1M1GA 3S3MA 4IUTA 5GANh 2KAFA 3ASKA 4M77F 3RMQA 1BKBA 1VUBA 1O9SA 2XDPA 4FU6A 4PJOF 4F7UE 5A0LA 1YJWT 3JCMc 1W2BS 1G3WA 1PSEA 1GXIE 1U1TA 4L6V5 3WVDB 4C8QE 5GAOp 3RKXA 3JB9J 4X9DA 4J7FA 4XTUA 1I5LA 2HNIA 1HK9A 2R5AA 5DLQE 5GAN4 2KMTA 3X28B 1IZ6A 5GAOr 1XQHA 4BY6B 3OYBA 3HRTA 4ME7A 1O75A 2LNVA 1NE8A 4EMHA 3V8JA 5LJ5j 3OYKA 3OSVA 2LX9A 2LDMA 3CCMA 3CXCS 4M75E 4HCBA 3G4SA 5GANj 4GLKA 3QSUA 3JSCA 4BI4A 2GFAA 3VUBA 4C5IA 2EJGA 4A53A 1PSFA 3M4YA 1WJRA 4MMKA 3GNFB 3ZFJA 3SWNC 2WSCE 1UGQB 2NLUA 4IUVA 2QA4T 1N8RC 4QW2A 3CCEA 4C0FA 2EQUA 3PIOA 4JUVA 4E7LA 3PNWC 2X4XA 2KVQG 2LT4A 2VYTA 5D6XA 4PJOG 5CK9A 3I55T 3LWHA 3MHXA 3LYIA 1WJQA 4Y28E 2FYKA 2XKOC 4FT4A 2DO3A 3QZ5B 3V8LA 3CPWS 3ME9A 1YIJA 3OY9A 5GAMj 2E64A 3VV0A 3I56T 2HQEA 2ZPBB 2WSFE 1JBMA 2FB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 d;  1WNL A;  3RES A;  4Y91 A;  1JRI A;  4HT9 A;  4M7A C;  2RB6 A;  1HXD A;  1BIA A;  1Y96 A;  4M78 C;  4XTZ A;  1M5Q 1;  2EAY A;  4EMK C;  4F7U F;  3JB9 D;  4HT8 A;  4WF2 A;  5LJ3 f;  1N9R A;  5GAN 3;  2CGH A;  3HSB A;  3JCM V;  5DY9 A;  4C92 B;  3EFR A;  3VU3 C;  5GAO n;  5GAO q;  3JCM J;  4M78 G;  4M7D B;  5LJ5 e;  3JCM X;  4M7D D;  5LJ5 h;  5CAI A;  1D3B B;  5GMK e;  3L1A A;  4M77 B;  1I8F A;  1U1S A;  3BW1 A;  1B34 A;  5GMK h;  4M77 D;  2I2L A;  4PJO B;  1YCY A;  2EJ9 A;  2VXE A;  4C8Q B;  2DEQ A;  2DTO A;  4QVC A;  2RD1 A;  4JRK A;  4NL3 A;  1I81 A;  4C92 D;  4JLI A;  4M7A B;  5LJ3 d;  2K57 A;  2E65 A;  5GAM d;  5GAN d;  2Y90 A;  5GAN 8;  5GAO l;  4F7U G;  1WQW A;  3JB9 H;  3BFM A;  4M75 B;  3RIR A;  3AHU A;  3SWN A;  3GIB A;  3JB9 G;  4C8Q D;  3V8K A;  4NL2 A;  2YLB A;  5GAM f;  3HFO A;  1X01 A;  5GAN g;  4M78 D;  5LJ3 g;  4EMK B;  1I5L A;  3RKY A;  4QVD A;  3FB9 A;  1KQ1 A;  2VC8 A;  2ZGW A;  4RCC A;  4N0A C;  5LJ3 h;  5GMK m;  3FIF A;  4MML A;  3JCM b;  5GAN 7;  4M7D A;  3QO3 A;  1LNX A;  4PJO E;  2EJF A;  4PNO A;  3L2Z A;  4XU0 A;  4M78 F;  4NOY A;  3QHS A;  1MGQ A;  2E1H A;  4XU2 A;  2DZC A;  4M78 E;  4XU3 A;  3JCM P;  4V2S A;  2E10 A;  1LJO A;  3BDU A;  2YLC A;  3RKW A;  4C92 G;  5GMK l;  2DXU A;  3QUI A;  5LJ3 j;  1N9S A;  4C92 C;  1D3B A;  3PGG A;  4EMG A;  5GAM g;  4M7D F;  4PJO A;  4F7U B;  1I4K 1;  2EWN A;  2JN0 A;  4C92 F;  4M7A G;  4M78 A;  3RER A;  3JCM e;  2DXT A;  4M7D C;  1TH7 A;  4C92 E;  5LJ5 g;  4M7A E;  4M75 C;  2E41 A;  3JCM h;  4C8Q A;  5GAM h;  4M7A D;  4C8Q G;  1B34 B;  4XTY A;  3RUX A;  5GAM e;  5GAN e;  5LJ3 e;  5GAN 6;  3EFS A;  3INZ A;  5GAN h;  2DZ9 A;  1Y96 B;  4M77 F;  4XTV A;  4F7U E;  4XQ3 A;  4PJO F;  3JB9 I;  4M7D E;  4M77 E;  3JCM g;  3JCM c;  4M77 G;  4C92 A;  4DQ2 A;  1U1T A;  4M75 A;  4C8Q E;  3M4G A;  4C8Q C;  1LOJ A;  3RKX A;  5GMK i;  2DTH A;  4X9D A;  5GAO p;  4XTU A;  4C8Q F;  3JCM W;  3JB9 J;  2HNI A;  1HK9 A;  3HFN A;  5GAN 4;  2DJZ A;  5GAO r;  4J5Y A;  3V7C A;  4J6Y A;  4EMH A;  4EMK A;  4M7A F;  3V8J A;  2YHT A;  4M77 A;  5LJ5 j;  3V7S A;  4M75 G;  5GMK j;  4M75 D;  4M75 E;  4M7D G;  2RM4 A;  5GAO m;  5LJ5 f;  5GAN j;  5I21 A;  4J6W A;  4M75 F;  3QSU A;  1H64 1;  3JCM Q;  2EJG A;  5GAN f;  1BIB A;  4X9C A;  4A53 A;  4XU1 A;  4PJO C;  2DVE A;  4MMK A;  4M77 C;  3SWN C;  4A54 A;  4JRI A;  4M7A A;  2DKG A;  4N0A A;  4HA8 A;  3JCM f;  2QTX A;  4JUV A;  2RA2 A;  3V7R A;  5GAN 2;  1WPY A;  4OP0 A;  1M8V A;  2DTI A;  4PJO G;  4XTX A;  3SWN B;  3FJP A;  4PJO D;  5GAN 5;  4F7U A;  2FYK A;  4RCB A;  3JCM d;  1WQ7 A;  3V8L A;  4J6X A;  1KQ2 A;  4M78 B;  4XTW A;  3BY7 A;  5GAM j;  2E64 A;  3SB2 A;  3JB9 F;  2VXF A;  1JBM A;  2FB7 A; 
#chains in the Genus database with same CATH topology
 3RR6 A;  2D8J A;  4HT9 A;  2EKO A;  2CZ7 B;  3RMS A;  3CME A;  4KH0 B;  4PLL A;  3L2Q A;  4C5G A;  2CZ0 B;  2P4T A;  5AYF A;  1ZHI A;  3JCM X;  3M55 A;  3CCU A;  4EIK A;  1U1S A;  2M02 A;  3SDZ A;  2I2L A;  2QQB A;  3BE3 A;  1JEG A;  3J7A F;  3OA6 A;  1B07 A;  1M1K C;  4E7K A;  1K4U S;  2YUO A;  1N27 A;  4KUD K;  2CSI A;  1MMD A;  1LPL A;  5GAO l;  3CCJ Q;  5FU6 B;  3WVE B;  3A8O B;  2AK5 A;  2CP5 A;  5KH6 A;  2F2W A;  1XJW B;  4BE0 A;  2L5Q A;  2EGE A;  2KYB A;  4CC3 A;  4HVW A;  3TRE A;  1YJN A;  2YRD A;  3AT1 B;  1JXO A;  1Y7X A;  2D8H A;  4JJC A;  1OU8 A;  3X26 B;  4V2S A;  3P8B B;  3EGU A;  1UE9 A;  3CBP A;  4DBH A;  2X3X D;  1OYX A;  1Q81 R;  2PQW A;  3QYH B;  1ZUK A;  4M7A E;  3NTK A;  4PJN A;  1UGR B;  2LJ1 A;  2O01 E;  1KHC A;  3VYH B;  2JMA A;  2SRC A;  4M77 G;  1ZSZ C;  1WHL A;  1BI1 A;  2QEX T;  2M9U A;  2KXC A;  4M7A F;  4J7I A;  1K73 U;  2J06 A;  2QA4 Q;  1X6B A;  2JW4 A;  1JJ2 S;  4IKF A;  1VQN T;  5HY6 A;  1VQ8 T;  3I55 Q;  1X43 A;  5FWC A;  2C0O A;  2FVU A;  2K3B A;  1M9S A;  3P8D A;  3LX7 A;  1ZSZ B;  4OP0 A;  2A37 A;  4A4E A;  4HCC A;  3CC4 T;  4LDW A;  1HJD A;  1ZSG A;  2BIV A;  2CZ1 B;  1QKX A;  3WXM B;  4O6J A;  4XTW A;  2QG9 B;  3QDR B;  3L42 A;  2DLP A;  3M4G A;  3MET A;  1SSH A;  3VS2 A;  1SKU B;  1M4Z A;  2G6F X;  2DA9 A;  1M27 C;  3DB3 A;  2EAY A;  5CQY A;  2GNC A;  3JCM J;  2E5K A;  1ABQ A;  1FWZ A;  1G2B A;  3L2V A;  3RDV A;  2F5T X;  3M59 A;  1OUL A;  2L0A A;  3M0R A;  2DX1 A;  4KGV B;  2JZ2 A;  5IXB A;  1UHF A;  2ZCF B;  3OYJ A;  3I56 A;  1UGP B;  4BDZ A;  1K9M C;  5A0G A;  1WLP B;  2ESW A;  3GP8 A;  4II1 A;  4QQD A;  2K4Y A;  1FX7 A;  2BZX A;  1D1A A;  3CMA T;  3NFC A;  1M2V B;  4JJN K;  1UUE A;  2K3Y A;  4CRI A;  1N9S A;  1ZSZ A;  1D3B A;  2DK3 A;  2JUF A;  4J83 A;  2KRS A;  3UA6 A;  1UGS B;  3SFM A;  1YJW A;  2LT1 A;  1AWJ A;  4D6W A;  2LNH B;  2CP2 A;  1QW1 A;  2PTK A;  5EC7 A;  4M4Z A;  3TEE A;  2KRM A;  1Q95 G;  1NPP A;  3VYG A;  1QVF S;  4KH1 B;  5CKD A;  1TG0 A;  1GFC A;  3OBY A;  4BAC A;  1WX6 A;  4JZ4 A;  2CP3 A;  1VQ4 Q;  4AG2 C;  3CQT A;  3RNJ A;  4PJO C;  2DVE A;  1VQ4 A;  4HVV A;  1YN8 A;  4F16 A;  1X69 A;  4TVR A;  2QAZ A;  4OGE A;  2P0K A;  2RH2 A;  2OJ2 A;  4F7U A;  2DBK A;  5KYW A;  4J6X A;  3OW2 P;  3BY7 A;  1CKB A;  1WDX A;  1M3A A;  2Y4X A;  1C6V X;  4M7A C;  1Y96 A;  1FXX A;  2BZ8 A;  5GAN 3;  3CXC A;  3TCJ A;  5CVI A;  3VU3 C;  1TSF A;  2QTV A;  4CC7 A;  1QCO A;  2X9H A;  3OYC A;  1D3B B;  3CCS Q;  2LVM A;  1TWB A;  3G6E Q;  3R6N A;  4RG2 A;  4WCI A;  1ZBJ A;  4ATO A;  2CH4 W;  1I5O B;  2RD1 A;  1IGQ A;  1BU1 A;  5GAN 8;  2HD0 A;  1GRI A;  3CCE T;  5FU7 B;  1VQ7 A;  2W10 A;  3AHU A;  5GAM f;  2AZV A;  2ECZ A;  4LDV A;  4JS5 A;  2DER A;  5LJ3 g;  1WHH A;  4LN2 A;  3GF5 A;  1V76 A;  2YRC A;  5GMK m;  4ZGJ B;  2OTL A;  2JOY A;  4L5G A;  4OF1 A;  3BDU A;  5GAM g;  4ESR A;  4F7U B;  5KYW B;  3LH5 A;  2NUP B;  3ER0 A;  4N4I A;  1UGV A;  4JPB W;  1TUD A;  3NTH A;  5GAN 6;  2DZ9 A;  4LNP A;  1MHN A;  1X27 A;  1VQP T;  2EQI A;  4LXC A;  4DQ2 A;  3CC2 T;  3HFN A;  4O5V A;  1YIT Q;  4J9H A;  1ZA2 B;  4M75 G;  4KUI A;  1KC8 U;  2DET A;  4VUB A;  3A8L B;  4M7A A;  1D0Y A;  2M0Y A;  1PM3 A;  3NGP A;  2DTI A;  1Q7Y U;  5I22 A;  1D1C A;  1UHC A;  2KK4 A;  4CC4 B;  2WAC A;  3PFS A;  4UC4 A;  3OS2 A;  1PRM C;  2CP0 A;  3CD6 A;  2RI3 A;  1YI2 T;  2RI5 A;  1WFW A;  3H8Z A;  3KBG A;  1N9R A;  2DRK A;  1K9A A;  2ZPH B;  1QVP A;  4Q5W A;  5GAO q;  4ZGD B;  2GFU A;  5IN1 A;  1TS9 A;  2VKN A;  1GFD A;  4PL6 A;  3H9N A;  3TVT A;  2NUP A;  3JRZ A;  2YT6 A;  2DEQ A;  2J6F A;  9ATC B;  2JTM A;  3G4S T;  1NYF A;  5GAM d;  1OPK A;  2A3L A;  2Y90 A;  3O8V A;  1VQN Q;  4RTT A;  3QPH A;  2K2M A;  1VQN A;  1GL5 A;  1K76 A;  2LC4 A;  2GGR A;  4HVU A;  2F2V A;  3I55 A;  4OB3 B;  3E19 A;  1WXB A;  3OYI A;  2RQU A;  1AT1 B;  3C95 A;  2KR3 A;  3LWI A;  1LNX A;  2VUB A;  3EHR A;  2ATC B;  4RG8 A;  2VGN A;  4XU3 A;  3OYA A;  2E3H A;  4DA4 A;  3RKW A;  3CPW A;  5LJ3 j;  1UEC A;  5CKH A;  3CCQ A;  4M7A G;  4LD9 K;  4RTZ A;  2L3Q A;  2QYZ A;  4C8Q G;  3S3M A;  2KAF A;  4M77 F;  2XDP A;  4FU6 A;  2GTO A;  1YJW T;  3WVD B;  2YUP A;  5GAO r;  1MNE A;  1ZLM A;  1XQH A;  4BY6 B;  3OYB A;  3OYK A;  3CCM Q;  2LNV A;  3V8J A;  1GBQ A;  3CXC S;  4M75 E;  5GAN j;  2GFA A;  1VQM Q;  1PCX A;  3H0I A;  4A53 A;  1PSF A;  1UJ0 A;  4MMK A;  3A98 A;  3ZFJ A;  1EZZ B;  2WSC E;  3VS5 A;  4RUG A;  1D1B A;  4AT1 B;  2VYT A;  1YIJ Q;  4FT4 A;  2DO3 A;  3CPW S;  3EGX A;  1X2K A;  3I56 T;  2JMC A;  3TSZ A;  2RF0 A;  2M1H A;  5LJ3 f;  3EFR A;  3A8M B;  4ZTJ A;  1VQ6 T;  2RK1 A;  2FL7 A;  5CKF A;  2PVO B;  5GMK e;  2C0T A;  4B9W A;  1WHG A;  2GQV A;  1S72 Q;  2MF2 A;  1M3B A;  4BY6 C;  1TXQ A;  1R0B G;  2EQK A;  2V8J A;  2DJQ A;  2KRN A;  5FLX E;  2PVD B;  1AEY A;  4PK4 A;  2PUO B;  1G3Y A;  1KQ1 A;  3GLX A;  3SHW A;  4N0A C;  1VQ5 T;  1VQ9 T;  3CD6 Q;  1QVG S;  5IHN A;  4KRT A;  1UDL A;  2FEI A;  3JCM P;  4C92 G;  4BE1 A;  1FMW A;  5IT9 E;  4RTV A;  2QEX A;  5KCO A;  4PFZ A;  1EFN A;  2RJE A;  1X6O A;  1VQK A;  1VQ9 A;  2LCL A;  2OTJ T;  3PTA A;  1S1N A;  1WXU A;  2JVV A;  3G6E T;  1Q7Y C;  3OYG A;  2YDL A;  3QDF A;  2R57 A;  2COY A;  3LH0 A;  4C92 A;  4AMC A;  2HDA A;  3CCQ T;  2MAM A;  4C8Q F;  2V26 A;  3G71 T;  2EYX A;  4HKE A;  4ZN3 A;  4EMK A;  4RKU E;  4OB1 B;  2B86 A;  4CC2 A;  2FRY A;  5KYX A;  4OML A;  3LLR A;  4LUE A;  2HBW A;  3MP6 A;  1YJN T;  3VS1 A;  4A54 A;  4C0D B;  1PKT A;  2EYW A;  1W2B P;  1BCO A;  4KBM B;  1X6G A;  2KY9 A;  3N5B B;  4BI8 B;  1KJW A;  5J39 A;  4Z02 A;  3QBY A;  2OTL Q;  2A7Y A;  2IVW A;  4M78 C;  1BYM A;  2X4W A;  2KSS A;  2VB6 A;  2O9S A;  1ZUY A;  4HCK A;  1HD3 A;  1M90 C;  3E9G A;  2Z0W A;  4JDS A;  2HCK A;  3ZEH A;  2C0I A;  4ELZ C;  4IIM A;  1K8A U;  5FRM A;  1B7T A;  2E5Q A;  2VXE A;  4JJD A;  3OS5 A;  4KGX B;  2ROL A;  4RTY A;  3CME T;  2EQM A;  4C0G A;  2E12 A;  3MJX A;  5GAN d;  4BE2 A;  2CUB A;  3CCL Q;  1WQW A;  2QDY B;  1QVG P;  2BE9 B;  1OI1 A;  3P8H A;  3SWN A;  3DLM A;  1YBY A;  4NL2 A;  2A36 A;  2KNB B;  2K79 A;  4EMK B;  1NZ9 A;  2LTO A;  2MPX C;  3PT9 A;  5KYX B;  5IHK A;  1YHQ Q;  2DAQ A;  2RMO A;  1QP2 A;  3X24 B;  2I0N A;  4XU0 A;  4ZNX A;  4NOY A;  4M78 E;  1YI2 Q;  4C92 C;  1VQK T;  1PKS A;  1NYG A;  4RTX A;  5HK0 A;  5KCH A;  1RAC B;  4M7D C;  4M75 C;  4C8Q A;  4BDY A;  1H92 A;  1LOJ A;  2FG0 A;  3M0P A;  1BBZ A;  2MK5 A;  3FC3 A;  4M77 A;  3CBM A;  4E7H A;  1YHQ A;  2OAU A;  2ZPG B;  2NWM A;  2YUQ A;  4OB0 B;  4XK8 E;  2DMO A;  2L89 A;  1GCQ C;  1QVG A;  1YJ9 T;  3V7R A;  3LW5 E;  1OX9 A;  3HPW A;  1M8V A;  5L23 A;  1RI9 A;  2O9V A;  4PJO D;  3JCM d;  4DOV A;  1VQL A;  1VQ7 T;  3CCU Q;  1B34 A;  2VXF A;  5LJ5 d;  1YNZ A;  1GCP A;  3QJ6 A;  2E70 A;  2O88 A;  1PWT A;  2QQS A;  3OYN A;  1K9M R;  5ECA A;  1D0X A;  2HL5 C;  5J3B A;  5LJ5 h;  5CAI A;  2QQA A;  2MWO A;  3EHQ A;  5KE3 A;  1K9M U;  4R55 A;  1AWW A;  4C92 D;  5I2M A;  3DLL A;  3I9Q A;  1JB0 E;  3M57 A;  2XDD A;  1OZ2 A;  4X34 A;  4M75 B;  2YXY A;  3R6O A;  4C0D C;  3V8K A;  2X35 A;  1WZO A;  3M5A A;  4IUU A;  1VQP A;  3CC2 A;  3RKY A;  3BDL A;  2W0Z A;  1BI0 A;  4QVD A;  2PNI A;  1YIJ T;  1H8K A;  4M7D A;  5IH2 A;  2JS0 A;  4K11 A;  1PHT A;  1W1F A;  3VS4 A;  3QUI A;  2NUT A;  1KG1 A;  3OB9 A;  3A8G B;  3HRU A;  4E6R A;  1TH7 A;  4PKC C;  2RQT A;  1Q86 R;  3VRZ A;  2CH4 A;  3F70 A;  5GAN e;  2HKN A;  4XQ3 A;  2OTJ A;  1C0M A;  3ULR B;  2CT4 A;  4KT0 E;  3OW2 S;  3MEA A;  1W6X A;  4E7J A;  1K1Z A;  2LQ8 A;  2M16 A;  1UB4 A;  1JO8 A;  4F14 A;  3DKM A;  3OMC A;  3CCR Q;  2LQW A;  2LQK A;  2DF6 A;  4J6W A;  2DM1 A;  2FPE A;  3QXE B;  3LGF A;  2L3S A;  3JCM Q;  3PVL A;  4J9I A;  1Q81 C;  2XG8 D;  2FZC B;  4JLG A;  2DKG A;  5HK3 A;  3X20 B;  1VQ5 Q;  2F2X A;  2LMJ A;  1Y57 A;  4XTX A;  1E7O A;  2JM8 A;  4F17 A;  3ZL7 C;  3REA B;  3VRY A;  2J6K A;  2LCC A;  2PU9 B;  1SEM A;  4MDX A;  2KI7 A;  5KE2 A;  1YCS B;  4R0K A;  1JRI A;  1PC0 A;  2EYZ A;  3EG9 A;  1G83 A;  2L8D A;  3CCS T;  2DYB A;  2CSQ A;  4M78 G;  3EG2 A;  3CCQ Q;  1YCY A;  3CCR A;  3EFO A;  5C6S A;  4JJB A;  4QVZ A;  4JRK A;  1WHJ A;  1AWO A;  4D8K A;  3NHN A;  3E1S A;  1YJN Q;  1EIF A;  4C8Q D;  2KE9 A;  3CEY A;  1YI2 A;  3HFO A;  1UFF A;  3NPF A;  3MP8 A;  4M78 D;  1M8M A;  2LRQ A;  3VKI A;  1P92 A;  2X4J A;  1OU9 A;  5D6Y A;  2XDB A;  3KFV A;  4E47 A;  2XMF A;  1Q86 C;  2H8H A;  4MML A;  6AT1 B;  5GAN 7;  5CKB A;  3NMZ C;  1RAB B;  3MEU A;  2DIG A;  1X75 C;  2YLC A;  2KT1 A;  2BUD A;  4IUP A;  2QQ9 A;  4XAX B;  1MND A;  3S3N A;  3UA7 A;  3E2U A;  1Q81 U;  1AD5 A;  4GBQ A;  1UG1 A;  1VUB A;  1W2B S;  1VYU A;  1PSE A;  1GXI E;  5GAO p;  3CME Q;  3RKX A;  3CPW P;  4X9D A;  4J7F A;  1UJY A;  1GBR A;  1IB8 A;  1HK9 A;  2R5A A;  5DLQ E;  5GAN 4;  3X28 B;  1IZ6 A;  2ED0 A;  4FCY A;  4ME7 A;  4EMH A;  1WA7 A;  2LDM A;  3CCM A;  3G4S A;  1RAI B;  2QK0 A;  4BI4 A;  2QEX Q;  1N8R C;  1OEB A;  3CCE A;  2EQU A;  4JUV A;  5CK9 A;  2KVQ G;  3I55 T;  1EX4 A;  3QZ5 B;  3V8L A;  4AFS C;  3ME9 A;  3OY9 A;  2ZPB B;  2QGG A;  5CO7 A;  2XID A;  1RAE B;  1ZUU A;  3RES A;  3Q1J A;  4XTZ A;  4EMK C;  4HT8 A;  2K5I A;  5IHI A;  1RAG B;  2V1R A;  1MUZ A;  4DBQ A;  1U5S A;  2L2P A;  2L3P A;  3LGL A;  1PG5 B;  2O2O A;  1S72 A;  3BW1 A;  2EPD A;  2XI9 A;  2QDL A;  4C5H A;  1RI0 A;  1YIT A;  1H3Z A;  1K0X A;  3MO8 A;  2M51 A;  1F1B B;  2E4H A;  3OYY A;  1V1C A;  1I81 A;  2YSQ A;  4CI0 C;  1VQ4 T;  3CCS A;  4RTW A;  1MV0 B;  5D6W A;  1AZE A;  1QWF A;  2E6Z A;  2MMP A;  2R5M A;  2KRO A;  2EGA A;  1YJ9 A;  2KQW A;  2KDS A;  4BB7 A;  1I0C A;  2FHD A;  2KBT A;  2VAS A;  2D0N A;  4AFU C;  4JRP A;  3QO3 A;  1WYX A;  2KYM A;  1VQ7 Q;  3UF4 A;  4M78 F;  3MP1 A;  4XU2 A;  1IHV A;  2FRW A;  5GMK l;  1VQO A;  2HSE B;  2J7I A;  1M1K U;  4C92 F;  3JCM e;  1VQO T;  1QCN A;  3I5R A;  5GAM e;  3HL8 A;  4XTV A;  5AT1 B;  4QT7 A;  2DL8 A;  3QZ9 B;  2QXF A;  2EGC A;  1SRL A;  2JTF A;  1XTD A;  3JCM W;  2DTH A;  4M7D E;  1JQQ A;  2ZPE B;  5I2S A;  3S3O A;  5HKC A;  2RN8 A;  5CR2 A;  1YWP A;  1ZBX A;  5GMK j;  2NUZ A;  2GBQ A;  4E7Z A;  4XU1 A;  1RLP C;  1WGS A;  2QTX A;  5A2Q E;  2X4Y A;  1M90 R;  4A4K A;  3CCL A;  5L8R E;  1BB9 A;  4FW2 A;  4PJM A;  1Y71 A;  2DL4 A;  1CKA A;  3PE0 A;  3GOX A;  1BIA A;  1PRL C;  1VQ6 A;  4F7U F;  1TU0 B;  2KGT A;  1W2B A;  1Q82 R;  3QII A;  4AFZ C;  4IUR A;  3VS6 A;  2DVJ A;  5GMK h;  3M58 A;  4FL6 A;  1TUG B;  2EVR A;  2V8I A;  1M30 A;  3M0T A;  3QWX X;  2DL5 A;  2E65 A;  3FJ5 A;  3BFM A;  3RIR A;  1JXM A;  3JB9 G;  3I5S A;  2YLB A;  3CCE Q;  3J80 E;  1Q7Y R;  2EFI A;  4OMP A;  4A4F A;  2HZY A;  3OS0 A;  2K9G A;  3A1P A;  2E1H A;  1AWX A;  2HKQ B;  2COW A;  1IO6 A;  2HSP A;  3UWN A;  2YUN A;  2J05 A;  1SF9 A;  2K3X A;  5GJV B;  2K5F A;  5LJ5 g;  3C12 A;  1VQL Q;  4FYW B;  4LE9 A;  3G71 Q;  1SSF A;  4M77 E;  3JCM g;  1VIF A;  1G3S A;  4QQG A;  4HCZ A;  1T0H A;  1WHK A;  4J6Y A;  1B3Q A;  1QP3 A;  1XNI A;  4FSX A;  4A63 B;  3CCJ T;  1HSQ A;  4Z8A A;  3HRS A;  3OYM A;  4ZTF A;  4N0A A;  3M53 A;  2DEU A;  3FJP A;  5GAN 5;  1KQ2 A;  2ZPF B;  3EG0 A;  3C4S A;  5CIU A;  1OOT A;  2ZAE A;  2HL3 A;  2RB6 A;  1HXD A;  4PFP A;  5FU7 C;  3JB9 D;  3G1J A;  4B6M A;  1OX8 A;  1KQS P;  2H3J A;  2RJF A;  5DY9 A;  1FMV A;  2R58 A;  2DIL A;  1M2V A;  4LDX A;  3A8H B;  1QKW A;  2VV5 A;  1MMG A;  3TU4 K;  4JS4 A;  3L2R A;  3M56 A;  2P0Q A;  2AZS A;  1SRM A;  3UDC A;  3JAM E;  3E9F A;  4M7A B;  2BKD N;  2MOX A;  1VQM T;  3JB9 H;  1Q86 U;  4J9D A;  2C06 A;  1YHQ T;  4WTO B;  5GAN g;  5KYN A;  4LUD A;  2CS7 A;  5M9O A;  3ZBD A;  1KIK A;  2P0P A;  1A0N B;  1M90 U;  1VQK Q;  2EJF A;  3L2Z A;  1Q82 U;  3OYF A;  1NEG A;  2DZC A;  4ANJ A;  2E10 A;  5FRN A;  5IAY A;  7AT1 B;  1H3H A;  1KK7 A;  2G3R A;  2RHY A;  2CP7 A;  3GBQ A;  2LP5 A;  3KUF A;  1MMN A;  1UEB A;  2BZY A;  5GAM h;  1KQS S;  2GCX A;  3RUX A;  1Y96 B;  2LZ6 B;  2O31 A;  3JB9 I;  3OSS C;  3IQL A;  4BD3 A;  1K8A C;  1VIE A;  3EH2 A;  3PVQ A;  4J9F A;  1HYO A;  3V7C A;  4YTL A;  5GJW B;  4MDW A;  2EQJ A;  1RUW A;  1NPR A;  5I21 A;  2OI3 A;  1M1K R;  1H64 1;  2EBP A;  4X9C A;  3M54 A;  2JNG A;  4EPC A;  2IG0 A;  2WSE E;  2RQW A;  5GAN 2;  2EKH A;  1K73 C;  4R56 A;  3UPU A;  3CPF A;  1QLY A;  2VVK A;  3FRN A;  5HCK A;  4Z88 A;  5IXF A;  3U23 A;  2E6N A;  2OX7 A;  2B8A A;  3I56 Q;  3JCM V;  2EYY A;  1VQO Q;  2OTJ Q;  2MYS A;  5GAO n;  5J26 A;  5LJ5 e;  2HEQ A;  4GY5 A;  4B9X A;  4M77 D;  1NEB A;  2EJ9 A;  2F5K A;  1G3T A;  2CT3 A;  2QAS A;  4DOW A;  1RAF B;  2XK0 A;  5C0M A;  4F7U G;  1D09 B;  2BTT A;  4OVA A;  5D7U A;  1WI7 A;  5KYU A;  1ZX6 A;  2ED1 A;  2VGM A;  2QGF B;  2RI2 A;  1QVF A;  4FM4 B;  1AOJ A;  4F04 B;  2DD4 A;  3G7Z A;  1SG5 A;  4E7I A;  3QHS A;  1MGQ A;  2XD0 A;  2DRM A;  1ZQ1 A;  3UAT A;  2XIC A;  1VQ9 Q;  2ABL A;  2MIO A;  4M7D F;  4MZM A;  1OPL A;  3OYD A;  1I4K 1;  1N5Z A;  3REB B;  2JN0 A;  3T9N A;  1AZG B;  1V29 B;  4M7A D;  4C5E A;  1M1G A;  4IUT A;  5GAN h;  3ASK A;  1IHW A;  1BKB A;  1O9S A;  4PJO F;  5A0L A;  3M0S A;  5KYY A;  3JCM c;  1G3W A;  4C8Q E;  1SHG A;  3JB9 J;  1BCM A;  4XTU A;  1I5L A;  2HNI A;  2KMT A;  3VS0 A;  2IIM A;  1NE8 A;  2RQV A;  2D1X A;  4HCB A;  3QSU A;  3THK A;  2EJG A;  1WJR A;  2QA4 T;  4QW2 A;  4E7L A;  1D0Z A;  1VQ8 Q;  5D6X A;  3VS7 A;  4PJO G;  3LYI A;  4Y28 E;  2FYK A;  5KYU B;  4OMM A;  1LVK A;  4HXJ A;  5GAM j;  2X3W D;  3VV0 A;  4PFO A;  1OV3 A;  2WSF E;  2V1Q A;  2FB7 A;  2J6O A;  4QQ6 A;  4WF2 A;  3C0C A;  4C92 B;  3D7S B;  4BUG A;  2E3I A;  1VQL T;  2HQX A;  2KT8 A;  3URG A;  3M0U A;  1OQK A;  4J9B A;  1AHJ B;  2IPO B;  1I8F A;  4A4H A;  1IRE B;  1VYT A;  3VS3 A;  4ORZ A;  2D6F A;  1NG2 A;  3H6Z A;  1BI3 A;  1VQP Q;  3CC2 Q;  3TQ7 P;  1N6A A;  2AIR B;  1JU5 C;  4LDU A;  1M2O A;  5KYY B;  1ABO A;  4ZN1 A;  1VQ8 A;  3CCJ A;  3RBB B;  1XOV A;  1YJ9 Q;  3QWY A;  3EG1 A;  3FDR A;  3FIF A;  3MPU B;  4PJO E;  2DIQ A;  1BK2 A;  1K73 R;  3CC7 A;  4PJJ A;  2RHX A;  2LJ3 A;  4DBR A;  3OMG A;  1G5V A;  2DXU A;  1E6G A;  1I1J A;  2MWP A;  2QQR A;  3CC7 T;  2EWN A;  3EGX B;  1NM7 A;  3RER A;  2RHZ A;  2M0O A;  2DYI A;  1OZ3 A;  3L2U A;  2CDT A;  3EFS A;  3INZ A;  4IUQ A;  3HP9 A;  1T3L A;  1KD1 C;  2A08 A;  2CZ6 B;  1K8A R;  1PD1 A;  2GQI A;  5CKE A;  4J9G A;  2DJZ A;  3TSW A;  3GNG A;  5A0D A;  1YWO A;  2YHT A;  1N8R U;  1C1A A;  1M1F A;  1RL2 A;  4M75 D;  4M7D G;  5LJ5 f;  3OS1 A;  1ACM B;  3OYE A;  4M75 F;  1TUC A;  3CMA A;  1BIB A;  1NLP C;  2KEA A;  1WJS A;  2Y4Y A;  4A4G A;  3JCM f;  4HA8 A;  2DXB A;  2RA2 A;  2QI2 A;  1K0S A;  5CQX A;  1WXT A;  4C0Z A;  4RCB A;  2RK2 A;  3FLG A;  1SPK A;  1KFZ A;  1Z9Z A;  3CCV Q;  3SB2 A;  1VQ6 Q;  1NJI R;  2F1L A;  3X25 B;  1KSW A;  2CGH A;  2ZZD A;  1PD0 A;  4OB2 B;  3VUZ A;  1RAA B;  1S72 T;  4QKU A;  4M77 B;  4OMO A;  2QA4 A;  1YJW Q;  2KXD A;  3QJY A;  3MEW A;  4KGZ B;  4QVC A;  1T0J A;  1W70 A;  4NL3 A;  4JLI A;  5LJ3 d;  2K57 A;  2RJD A;  3CCM T;  2FPD A;  2AKL A;  2DL3 A;  4J8O A;  3KXT A;  2MI6 A;  2SEM A;  2CRE A;  1W4S A;  2RO0 A;  4LDY A;  4OGC A;  1NJI C;  3CD6 T;  4FW1 A;  3EGD A;  2VC8 A;  3H0F A;  3PMI A;  3JCM b;  4N4H A;  4ELY C;  1PNJ A;  4E2F B;  1IXD A;  1TOV A;  3O5Z A;  3A5Z B;  1KQS A;  1LJO A;  2ENM A;  3GPL A;  2A28 A;  2PZ1 A;  2K7A A;  3EAE A;  4EDU A;  5CCA A;  1R8O B;  5FRO A;  2DFU A;  4RMO A;  1NJI U;  2FZK B;  1T3S A;  3DB4 A;  3JCM h;  1IGU A;  2JJ9 A;  1YP5 A;  2O4X B;  3MEV A;  4MZP A;  2BE7 D;  4RTU A;  1Z9Q A;  4GLM A;  2DXC A;  4M75 A;  2DE0 X;  2CYZ B;  4C8Q C;  3CCV A;  4D8D A;  2LCS A;  3EG3 A;  2OAW A;  1CSK A;  2RM4 A;  1YIT T;  1VYV A;  4M77 C;  3CCR T;  1Y07 A;  1QCF A;  3CXC P;  2K2V A;  2XU8 A;  2EIF A;  2GTJ A;  2OTL T;  1WPY A;  3SWN B;  2LJ0 A;  3QG1 A;  1GCQ A;  1KD1 U;  2YRV A;  1VQM A;  3J81 E;  3EGD B;  1AVZ C;  1E6H A;  1WNL A;  3EH1 A;  1FYN A;  4Y91 A;  4AFQ C;  1JJ2 P;  4DEY A;  2YWW A;  1U06 A;  4M7D D;  1BI2 A;  2DBM A;  4Y92 A;  3PIP A;  2V8K A;  1QWE A;  4LD6 A;  3SEM A;  1J3T A;  3SD4 A;  5DLO A;  4N4G A;  3CCL T;  4C8Q B;  1JJ2 A;  2DNU A;  2DTO A;  4BI3 A;  2D0Q B;  4AG1 C;  8AT1 B;  1Y0M A;  2JM9 A;  1VOM A;  2VWF A;  1R77 A;  2O4X A;  5FW9 A;  2FO0 A;  1I07 A;  3QKJ A;  1Q82 C;  3OBW A;  2RNA A;  3G4S Q;  2CUD A;  4FIB A;  4MZT A;  1VA7 A;  1KD1 R;  4L59 A;  2JXB A;  4P5N A;  3OYH A;  2XHC A;  3VJP A;  5I11 A;  3FB9 A;  3NTI A;  4RCC A;  4DBF A;  5LJ3 h;  4OMN A;  3EG9 B;  3CC4 A;  2AKK A;  5LL6 S;  3CC4 Q;  2NYS A;  1RAH B;  3G6E A;  4FYY B;  3OW2 A;  3PGG A;  2RJC A;  4PJO A;  1UTI A;  3JV3 A;  3EFO B;  2DXT A;  4C92 E;  2RPN A;  1LCK A;  4FT2 A;  4JRQ A;  3MKD A;  2PUK B;  1B34 B;  4XTY A;  3H41 A;  5GMK i;  2LQN A;  2GF7 A;  2FPF A;  3S6W A;  4J5Y A;  8ATC B;  3OYL A;  2F69 A;  5DM7 R;  2HAX A;  2HBP A;  3MCA B;  2ZPI B;  3V7S A;  2CKK A;  5GAO m;  4FSS A;  2X51 A;  4NS5 A;  5GAN f;  5FU6 C;  1RLQ C;  3C94 A;  2HQH A;  5FWB A;  2DL7 A;  4JRI A;  1QMC A;  4J9E A;  1ZA1 B;  3HHT B;  2RHI A;  2JT4 A;  3CCU T;  3M9Q A;  1VQ5 A;  1KC8 C;  1WQ7 A;  3M0Q A;  4M78 B;  1G8X A;  4KUL A;  3CMA Q;  2L3R A;  2DD5 A;  3JB9 F;  2PVG B;  3CC7 Q;  4OMF B;  1TTH B;  4M7D B;  1M5Q 1;  3HSB A;  1NLO C;  1KC8 R;  3HKS A;  3H0H A;  2DPP B;  2MCN A;  2NUT B;  2CP6 A;  2ROT A;  3L1A A;  2AT1 B;  4PJO B;  3PMT A;  4ZGE B;  2JS2 A;  1IRX A;  2K5L A;  2EW3 A;  4Z89 A;  4JZ3 A;  2D9T A;  2RHU A;  4PJL A;  2H3E B;  2COZ A;  3GIB A;  5EG2 A;  2A0F B;  1X01 A;  1RAD B;  3CBO A;  3FEO A;  4FYX B;  1NBE B;  2ZGW A;  2EYQ A;  2LX7 A;  3G71 A;  3CCV T;  4PLI A;  4PNO A;  3QYG B;  2JTE A;  2AHJ B;  1MV3 A;  1R0C B;  1U8R A;  3UT1 A;  1N8R R;  4J9C A;  4EMG A;  1WHM A;  1X2Q A;  1DJ7 B;  1YFN A;  3OQ5 A;  1KHI A;  4M78 A;  2FZG B;  3L2W A;  2E41 A;  3I35 A;  5LJ3 e;  1ARK A;  3RMQ A;  4F7U E;  2P84 A;  2K6D A;  1U1T A;  4L6V 5;  4E7S A;  1M3C A;  4DEX A;  3HRT A;  4OMQ A;  1O75 A;  5LJ5 j;  3OSV A;  2LX9 A;  4X1V A;  4GLK A;  3JSC A;  1FMK A;  3VUB A;  4C5I A;  1U3O A;  3M4Y A;  3GNF B;  3SWN C;  4IUV A;  1UGQ B;  2NLU A;  4IIO A;  1QQJ A;  4C0F A;  1SHF A;  3PIO A;  3PNW C;  2HMA A;  4FYV B;  2X4X A;  2LT4 A;  3LWH A;  3HTR A;  3MHX A;  1WJQ A;  2XKO C;  2RQR A;  1QVF P;  1WIE A;  1YIJ A;  2P4R A;  2E64 A;  2HQE A;  1MMA A;  1JBM A; 
#chains in the Genus database with same CATH homology
 5CO7 A;  2XID A;  3RES A;  3Q1J A;  4HT9 A;  4XTZ A;  4QQ6 A;  2EKO A;  2CZ7 B;  3RMS A;  4EMK C;  3CME A;  2M1H A;  4PLL A;  4WF2 A;  5LJ3 f;  3L2Q A;  4HT8 A;  2K5I A;  4C92 B;  4BUG A;  4C5G A;  3EFR A;  1VQL T;  2CZ0 B;  3A8M B;  4ZTJ A;  1VQ6 T;  2HQX A;  2P4T A;  2RK1 A;  5AYF A;  2FL7 A;  3URG A;  3LGL A;  1ZHI A;  5CKF A;  2PVO B;  3JCM X;  3M55 A;  5GMK e;  3CCU A;  1AHJ B;  4B9W A;  1I8F A;  1U1S A;  2GQV A;  3BW1 A;  3SDZ A;  1IRE B;  2I2L A;  4A4H A;  2QQB A;  1S72 A;  2XI9 A;  4C5H A;  3J7A F;  2D6F A;  1RI0 A;  3H6Z A;  2MF2 A;  3OA6 A;  1BI3 A;  1M1K C;  1YIT A;  1H3Z A;  4E7K A;  3MO8 A;  1N6A A;  1N27 A;  3OYY A;  4KUD K;  1I81 A;  4BY6 C;  4LDU A;  5GAO l;  4CI0 C;  1VQ4 T;  5FU6 B;  3CCS A;  3WVE B;  2EQK A;  2V8J A;  3A8O B;  5D6W A;  4ZN1 A;  5FLX E;  3CCJ A;  2PVD B;  5KH6 A;  1VQ8 A;  1XOV A;  4BE0 A;  2L5Q A;  2E6Z A;  2MMP A;  2PUO B;  2R5M A;  1YJ9 A;  1G3Y A;  3TRE A;  2KQW A;  2KDS A;  4BB7 A;  1KQ1 A;  3GLX A;  2FHD A;  1YJN A;  3FDR A;  4N0A C;  3FIF A;  1VQ5 T;  1VQ9 T;  4JRP A;  3QO3 A;  1Y7X A;  4PJO E;  2DIQ A;  1QVG S;  4M78 F;  3MP1 A;  4XU2 A;  3JCM P;  3CC7 A;  2RHX A;  3X26 B;  3P8B B;  4V2S A;  3OMG A;  4C92 G;  5GMK l;  4BE1 A;  1G5V A;  2DXU A;  3CBP A;  5IT9 E;  2QEX A;  1VQO A;  1OYX A;  2MWP A;  2QQR A;  5KCO A;  3CC7 T;  2EWN A;  1M1K U;  2PQW A;  3QYH B;  4C92 F;  2RJE A;  3RER A;  3JCM e;  2RHZ A;  4M7A E;  1VQO T;  1X6O A;  1VQK A;  3NTK A;  2LCL A;  2M0O A;  1VQ9 A;  2OTJ T;  1UGR B;  1OZ3 A;  5GAM e;  2O01 E;  3PTA A;  3L2U A;  2JVV A;  3G6E T;  1Q7Y C;  3EFS A;  3INZ A;  4IUQ A;  3HL8 A;  3HP9 A;  1KHC A;  4XTV A;  3VYH B;  3OYG A;  1KD1 C;  4M77 G;  2R57 A;  2QXF A;  3LH0 A;  2CZ6 B;  3QZ9 B;  4C92 A;  2JTF A;  1XTD A;  3CCQ T;  3JCM W;  2DTH A;  2MAM A;  4M7D E;  4C8Q F;  5CKE A;  1BI1 A;  3G71 T;  2DJZ A;  2ZPE B;  3GNG A;  5I2S A;  2QEX T;  2M9U A;  4HKE A;  4ZN3 A;  4EMK A;  5A0D A;  3S3O A;  5HKC A;  4RKU E;  2YHT A;  4OB1 B;  4J7I A;  4M7A F;  1K73 U;  5CR2 A;  1N8R U;  1ZBX A;  5GMK j;  1M1F A;  1RL2 A;  4M75 D;  4M7D G;  5LJ5 f;  3LLR A;  3OS1 A;  3OYE A;  4M75 F;  1JJ2 S;  4IKF A;  1VQN T;  3CMA A;  5HY6 A;  1VQ8 T;  1BIB A;  4XU1 A;  3MP6 A;  1YJN T;  1WJS A;  4A54 A;  2Y4Y A;  4A4G A;  4C0D B;  3JCM f;  1WGS A;  2FVU A;  4HA8 A;  1M9S A;  2DXB A;  2QTX A;  2RA2 A;  3P8D A;  5A2Q E;  2QI2 A;  2X4Y A;  3LX7 A;  4KBM B;  4OP0 A;  3N5B B;  2KY9 A;  5CQX A;  4A4E A;  4HCC A;  4A4K A;  4C0Z A;  3CC4 T;  4LDW A;  4BI8 B;  3CCL A;  2BIV A;  2CZ1 B;  4RCB A;  3WXM B;  2RK2 A;  4O6J A;  3FLG A;  5L8R E;  4XTW A;  5J39 A;  1Y71 A;  3QDR B;  3QBY A;  4Z02 A;  3L42 A;  3SB2 A;  3M4G A;  2A7Y A;  3GOX A;  3MET A;  2IVW A;  1M4Z A;  3X25 B;  4M78 C;  1BIA A;  1BYM A;  3DB3 A;  2EAY A;  4F7U F;  2X4W A;  1VQ6 A;  5CQY A;  2KSS A;  2CGH A;  2ZZD A;  1W2B A;  4OB2 B;  3QII A;  1M90 C;  4IUR A;  3VUZ A;  3E9G A;  3JCM J;  1S72 T;  4JDS A;  3ZEH A;  1FWZ A;  4ELZ C;  4M77 B;  3L2V A;  5GMK h;  3M58 A;  1K8A U;  5FRM A;  4FL6 A;  2QA4 A;  2E5Q A;  2VXE A;  2F5T X;  2V8I A;  3QJY A;  3OS5 A;  3M59 A;  3MEW A;  4QVC A;  3CME T;  2EQM A;  4NL3 A;  4C0G A;  2E12 A;  2JZ2 A;  4JLI A;  2E65 A;  2K57 A;  2RJD A;  5LJ3 d;  5GAN d;  4BE2 A;  3CCM T;  2ZCF B;  3OYJ A;  3I56 A;  1WQW A;  2QDY B;  1UGP B;  3BFM A;  1OI1 A;  3P8H A;  4J8O A;  3RIR A;  4BDZ A;  3SWN A;  3KXT A;  1K9M C;  2MI6 A;  5A0G A;  3DLM A;  1YBY A;  4NL2 A;  2YLB A;  3JB9 G;  1W4S A;  2RO0 A;  4LDY A;  3J80 E;  4OGC A;  3GP8 A;  4EMK B;  1NJI C;  4II1 A;  1NZ9 A;  4QQD A;  3CD6 T;  2LTO A;  2K4Y A;  3PT9 A;  2EFI A;  2VC8 A;  2DAQ A;  1QP2 A;  3X24 B;  3PMI A;  1FX7 A;  4A4F A;  4N4H A;  4ELY C;  3JCM b;  3CMA T;  4XU0 A;  3NFC A;  3A5Z B;  4NOY A;  3OS0 A;  2E1H A;  4M78 E;  1KQS A;  1LJO A;  4JJN K;  3GPL A;  2K3Y A;  4CRI A;  1N9S A;  3EAE A;  1D3B A;  4C92 C;  4EDU A;  5CCA A;  2DK3 A;  2JUF A;  1VQK T;  4J83 A;  5HK0 A;  1R8O B;  5FRO A;  3UWN A;  4RMO A;  2K3X A;  2K5F A;  5KCH A;  4M7D C;  1NJI U;  5LJ5 g;  1UGS B;  3SFM A;  3DB4 A;  4M75 C;  3JCM h;  4C8Q A;  4BDY A;  1YJW A;  3C12 A;  2LT1 A;  4D6W A;  1SSF A;  2O4X B;  3MEV A;  1QW1 A;  4MZP A;  4M77 E;  3JCM g;  1VIF A;  1G3S A;  3TEE A;  4M75 A;  2DXC A;  4C8Q C;  3CCV A;  1LOJ A;  2CYZ B;  1NPP A;  4QQG A;  4HCZ A;  3VYG A;  1QVF S;  5CKD A;  4BAC A;  3OBY A;  3FC3 A;  4J6Y A;  4M77 A;  3CBM A;  1QP3 A;  1XNI A;  2RM4 A;  4FSX A;  4E7H A;  1YHQ A;  2OAU A;  2ZPG B;  3CCJ T;  4OB0 B;  4XK8 E;  1YIT T;  3HRS A;  3OYM A;  2L89 A;  4PJO C;  2DVE A;  1VQ4 A;  4M77 C;  1QVG A;  3CCR T;  4ZTF A;  1Y07 A;  4N0A A;  1YJ9 T;  2K2V A;  3M53 A;  3V7R A;  2XU8 A;  2EIF A;  3LW5 E;  4TVR A;  3HPW A;  1WPY A;  2OTL T;  1M8V A;  3SWN B;  3FJP A;  2P0K A;  2RH2 A;  4OGE A;  4F7U A;  3QG1 A;  3JCM d;  5GAN 5;  4PJO D;  1KD1 U;  4DOV A;  4J6X A;  1VQL A;  1KQ2 A;  2ZPF B;  3BY7 A;  2YRV A;  3C4S A;  1VQM A;  1VQ7 T;  5CIU A;  3J81 E;  2Y4X A;  2VXF A;  1B34 A;  5LJ5 d;  1WNL A;  4Y91 A;  4M7A C;  2RB6 A;  1HXD A;  1Y96 A;  3QJ6 A;  1FXX A;  5FU7 C;  2E70 A;  3JB9 D;  4M7D D;  5GAN 3;  2H3J A;  2QQS A;  2RJF A;  5CVI A;  5DY9 A;  1BI2 A;  3TCJ A;  3OYN A;  3CXC A;  3VU3 C;  2R58 A;  4LDX A;  3A8H B;  3PIP A;  2V8K A;  2VV5 A;  4LD6 A;  5J3B A;  5LJ5 h;  5CAI A;  1D3B B;  3OYC A;  3TU4 K;  2LVM A;  4JS4 A;  2QQA A;  3SD4 A;  2MWO A;  3L2R A;  4RG2 A;  5DLO A;  4N4G A;  3CCL T;  3M56 A;  2P0Q A;  5KE3 A;  4C8Q B;  1JJ2 A;  4ATO A;  2DTO A;  4BI3 A;  3UDC A;  1K9M U;  2D0Q B;  4R55 A;  3JAM E;  2RD1 A;  3E9F A;  4C92 D;  5I2M A;  4M7A B;  5GAN 8;  2O4X A;  2BKD N;  2HD0 A;  3DLL A;  1JB0 E;  3M57 A;  5FU7 B;  2XDD A;  3CCE T;  3QKJ A;  1VQM T;  1VQ7 A;  3JB9 H;  1OZ2 A;  4X34 A;  4M75 B;  1Q82 C;  3OBW A;  3R6O A;  1Q86 U;  3AHU A;  2C06 A;  4C0D C;  1YHQ T;  5GAM f;  3V8K A;  2X35 A;  4FIB A;  4LDV A;  4MZT A;  4JS5 A;  3M5A A;  4L59 A;  5GAN g;  5LJ3 g;  4IUU A;  4P5N A;  2XHC A;  3OYH A;  1VQP A;  3CC2 A;  3RKY A;  3BDL A;  3VJP A;  1BI0 A;  4QVD A;  3FB9 A;  3GF5 A;  2CS7 A;  1YIJ T;  5M9O A;  3NTI A;  4RCC A;  5GMK m;  5LJ3 h;  3ZBD A;  4ZGJ B;  4M7D A;  3CC4 A;  2P0P A;  1M90 U;  2EJF A;  2OTL A;  3L2Z A;  1Q82 U;  2JOY A;  4L5G A;  4OF1 A;  5LL6 S;  3OYF A;  2DZC A;  2E10 A;  5FRN A;  3BDU A;  5IAY A;  3G6E A;  3QUI A;  3OW2 A;  1KG1 A;  3OB9 A;  3PGG A;  5GAM g;  2RJC A;  4PJO A;  4F7U B;  2G3R A;  2RHY A;  3A8G B;  2DXT A;  3HRU A;  1TH7 A;  3KUF A;  1UEB A;  4PKC C;  3ER0 A;  4C92 E;  5GAM h;  4N4I A;  4FT2 A;  2GCX A;  1KQS S;  4JRQ A;  2PUK B;  1B34 B;  4XTY A;  3F70 A;  3NTH A;  3RUX A;  5GAN e;  5GAN 6;  2DZ9 A;  1Y96 B;  3JB9 I;  4XQ3 A;  3OSS C;  2OTJ A;  1MHN A;  1VQP T;  3CC2 T;  4DQ2 A;  4BD3 A;  4KT0 E;  5GMK i;  3OW2 S;  1K8A C;  1VIE A;  3MEA A;  2GF7 A;  3S6W A;  3HFN A;  4E7J A;  2LQ8 A;  2M16 A;  4J5Y A;  4O5V A;  3V7C A;  4YTL A;  2F69 A;  5DM7 R;  1UB4 A;  3OYL A;  2HBP A;  2HAX A;  3MCA B;  2ZPI B;  4MDW A;  3V7S A;  4M75 G;  3DKM A;  3OMC A;  4KUI A;  2EQJ A;  2CKK A;  2LQK A;  1NPR A;  5GAO m;  1KC8 U;  5I21 A;  4J6W A;  4NS5 A;  1H64 1;  3QXE B;  3LGF A;  3JCM Q;  4VUB A;  3C94 A;  4X9C A;  3A8L B;  5FU6 C;  5GAN f;  1Q81 C;  3M54 A;  2JNG A;  2XG8 D;  4JRI A;  4JLG A;  2DKG A;  4M7A A;  4EPC A;  2IG0 A;  2WSE E;  3HHT B;  5HK3 A;  2RHI A;  3X20 B;  5GAN 2;  3CCU T;  3M9Q A;  1K73 C;  1Q7Y U;  4R56 A;  2DTI A;  3UPU A;  4XTX A;  3CPF A;  1VQ5 A;  1KC8 C;  2KK4 A;  1WQ7 A;  2WAC A;  4M78 B;  3PFS A;  4KUL A;  3FRN A;  4UC4 A;  3OS2 A;  3CD6 A;  2L3R A;  2DD5 A;  2LCC A;  2PU9 B;  3JB9 F;  4MDX A;  2E6N A;  2PVG B;  5KE2 A;  2RI3 A;  1JRI A;  2B8A A;  4OMF B;  1YI2 T;  2RI5 A;  4M7D B;  3H8Z A;  1M5Q 1;  2L8D A;  3KBG A;  1N9R A;  3HSB A;  3CCS T;  3JCM V;  3HKS A;  5GAO n;  2ZPH B;  1QVP A;  4Q5W A;  2DPP B;  5J26 A;  4ZGD B;  5GAO q;  2GFU A;  5IN1 A;  4M78 G;  5LJ5 e;  4GY5 A;  3L1A A;  4B9X A;  4PL6 A;  4PJO B;  4M77 D;  3PMT A;  4ZGE B;  1YCY A;  3CCR A;  2EJ9 A;  5C6S A;  2F5K A;  3JRZ A;  1G3T A;  2DEQ A;  4QVZ A;  2K5L A;  4JRK A;  2JTM A;  3G4S T;  4DOW A;  5GAM d;  2A3L A;  2XK0 A;  2Y90 A;  3O8V A;  5C0M A;  4F7U G;  3QPH A;  4OVA A;  2D9T A;  2RHU A;  1VQN A;  3E1S A;  3GIB A;  1EIF A;  4C8Q D;  3CEY A;  2VGM A;  5EG2 A;  1YI2 A;  2LC4 A;  3HFO A;  1X01 A;  4M78 D;  3MP8 A;  3VKI A;  2LRQ A;  3I55 A;  3CBO A;  3FEO A;  2RI2 A;  1P92 A;  4OB3 B;  3E19 A;  2X4J A;  1QVF A;  2XDB A;  5D6Y A;  3OYI A;  4FM4 B;  2ZGW A;  2EYQ A;  4E47 A;  2DD4 A;  3C95 A;  3G71 A;  1Q86 C;  4MML A;  5GAN 7;  3G7Z A;  3LWI A;  3CCV T;  1LNX A;  2VUB A;  4PLI A;  4PNO A;  5CKB A;  4E7I A;  3QYG B;  4RG8 A;  2VGN A;  1MGQ A;  3QHS A;  2AHJ B;  4XU3 A;  3OYA A;  2XD0 A;  1ZQ1 A;  4DA4 A;  3MEU A;  2DIG A;  1X75 C;  2YLC A;  3RKW A;  2XIC A;  3CPW A;  1U8R A;  3UT1 A;  5LJ3 j;  2BUD A;  4IUP A;  4EMG A;  4M7D F;  4MZM A;  1DJ7 B;  2QQ9 A;  3OYD A;  1I4K 1;  4XAX B;  5CKH A;  3S3N A;  3OQ5 A;  2JN0 A;  1KHI A;  3CCQ A;  3T9N A;  4LD9 K;  4M78 A;  3L2W A;  4M7A G;  1V29 B;  2E41 A;  1Q81 U;  4M7A D;  4C8Q G;  4C5E A;  5LJ3 e;  1M1G A;  3S3M A;  4IUT A;  5GAN h;  2KAF A;  3ASK A;  4M77 F;  3RMQ A;  1BKB A;  1VUB A;  1O9S A;  2XDP A;  4FU6 A;  4PJO F;  4F7U E;  5A0L A;  1YJW T;  3JCM c;  1W2B S;  1G3W A;  1PSE A;  1GXI E;  1U1T A;  4L6V 5;  3WVD B;  4C8Q E;  5GAO p;  3RKX A;  3JB9 J;  4X9D A;  4J7F A;  4XTU A;  1I5L A;  2HNI A;  1HK9 A;  2R5A A;  5DLQ E;  5GAN 4;  2KMT A;  3X28 B;  1IZ6 A;  5GAO r;  1XQH A;  4BY6 B;  3OYB A;  3HRT A;  4ME7 A;  1O75 A;  2LNV A;  1NE8 A;  4EMH A;  3V8J A;  5LJ5 j;  3OYK A;  3OSV A;  2LX9 A;  2LDM A;  3CCM A;  3CXC S;  4M75 E;  4HCB A;  3G4S A;  5GAN j;  4GLK A;  3QSU A;  3JSC A;  4BI4 A;  2GFA A;  3VUB A;  4C5I A;  2EJG A;  4A53 A;  1PSF A;  3M4Y A;  1WJR A;  4MMK A;  3GNF B;  3ZFJ A;  3SWN C;  2WSC E;  1UGQ B;  2NLU A;  4IUV A;  2QA4 T;  1N8R C;  4QW2 A;  3CCE A;  4C0F A;  2EQU A;  3PIO A;  4JUV A;  4E7L A;  3PNW C;  2X4X A;  2KVQ G;  2LT4 A;  2VYT A;  5D6X A;  4PJO G;  5CK9 A;  3I55 T;  3LWH A;  3MHX A;  3LYI A;  1WJQ A;  4Y28 E;  2FYK A;  2XKO C;  4FT4 A;  2DO3 A;  3QZ5 B;  3V8L A;  3CPW S;  3ME9 A;  1YIJ A;  3OY9 A;  5GAM j;  2E64 A;  3VV0 A;  3I56 T;  2HQE A;  2ZPB B;  2WSF E;  1JBM A;  2FB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...