2RM4A

Solution structure of the lsm domain of dm edc3 (enhancer of decapping 3)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
GAMGPTDQDWIGCAVSIACDEVLGVFQGLIKQISAEEITIVRAFRNGVPLRKQNAEVVLKCTDIRSIDLIEPAKQDLDGHTAPPPVVNKPTPVKLPHFSNILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG6311-PB
publication title A divergent Sm fold in EDC3 proteins mediates DCP1 binding and P-body targeting
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 9
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rm4A01
4MMKA 4PJOC 4X9DA 1JBMA 4M7DE 1I81A 5LJ5f 4J5YA 3JCMg 4M77C 4F7UE 4J6WA 2DJZA 1U1SA 1BIBA 3BW1A 4M75D 3V7RA 4F7UB 4C8QB 3RUXA 4F7UF 4XU1A 2ZGWA 5GAN2 4XTYA 4C8QF 3QO3A 2VC8A 4XTXA 5GAOm 2DKGA 4PNOA 5LJ5e 4F7UG 4C92E 2DTHA 3RKXA 3V8LA 4M75C 4C8QG 3FB9A 4M78A 4C92B 4N0AC 1LOJA 2DEQA 4JUVA 3RESA 5I21A 4M7DD 4C92F 4V2SA 3JB9J 3L2ZA 1JRIA 1D3BA 5GMKi 5GMKe 2DVEA 5LJ3d 2E65A 1KQ1A 4M7AB 4C92G 3SB2A 3SWNB 5LJ3h 4XTVA 4M7AF 4M7DC 2EJ9A 4M78D 1X01A 3FIFA 1HK9A 3JCMc 1KQ2A 1LJOA 2RM4A 4RCCA 2RA2A 4A53A 2RB6A 1WQ7A 4EMKB 3QSUA 3V8KA 4M7AG 5DY9A 4NL3A 5GMKl 1N9RA 2DTOA 4M7DA 4C8QE 5GAMe 1Y96B 4NOYA 5GANd 4M78C 4F7UA 5GAMd 1I8FA 3VU3C 3RKYA 5GANh 5GAMh 3RIRA 3JB9H 3BDUA 5LJ3f 2E1HA 4Y91A 1I5LA 4HA8A 4WF2A 2FYKA 4C92A 2DZ9A 1WQWA 5GAN6 4QVDA 4XU0A 4HT9A 2EAYA 5LJ5j 4XU3A 4A54A 4C8QD 4QVCA 5LJ3e 3GIBA 1U1TA 4OP0A 4M7AE 1YCYA 4M75G 1M8VA 4HT8A 4XU2A 4EMKC 5GANf 3JCMV 4X9CA 4EMGA 3QHSA 1H641 5GAMf 4JRKA 4M7AA 2E41A 3SWNA 4C92D 4DQ2A 2FB7A 3EFSA 5GMKj 3JCMP 4PJOB 2EWNA 2Y90A 2VXFA 1HXDA 2QTXA 4C8QC 3JB9F 4JLIA 4PJOF 4M77B 1M5Q1 2RD1A 3HFNA 3PGGA 4EMKA 3JCMe 3JCMd 3RERA 5GANe 3JCMJ 4M77F 1N9SA 5LJ5g 3JCMh 4J6YA 3JB9G 4PJOG 4M7AD 4C92C 4C8QA 2HNIA 5GAOl 2JN0A 4M77G 1B34B 3QUIA 3V7CA 4M75E 3JCMQ 4M75B 4M78G 2EJFA 3V7SA 4XQ3A 4M7AC 4M75F 1BIAA 2DXTA 2K57A 3FJPA 5GAN8 2YLCA 3SWNC 3BY7A 3JCMX 3INZA 2VXEA 1WPYA 2CGHA 3L1AA 4XTZA 3JCMf 3AHUA 5GAOn 3BFMA 4J6XA 4M7DB 5GMKm 5LJ3j 4PJOE 3JCMb 5GANg 3HFOA 4EMHA 5GAMg 3RKWA 4M7DF 4JRIA 3M4GA 4M77E 4PJOA 4RCBA 4NL2A 3JB9I 5GAN3 4M7DG 3V8JA 2DZCA 2E64A 4XTUA 2DTIA 2YLBA 4M78E 4M77A 5GAOq 3JCMW 2EJGA 4M78B 5LJ5d 1Y96A 5GAOr 1LNXA 4M78F 5LJ5h 5GAOp 1D3BB 1WNLA 5GANj 3JB9D 5GAMj 4PJOD 5GAN4 1B34A 1TH7A 5GAN5 4XTWA 1I4K1 5LJ3g 4MMLA 5CAIA 4M77D 2E10A 4M75A 1MGQA 4N0AA 2DXUA 2YHTA 5GAN7 5GMKh 3EFRA 3HSBA 2I2LA
chains in the Genus database with same CATH superfamily
3FLGA 3UT1A 2Z0WA 1NLPC 1X69A 3FEOA 2X4WA 4DA4A 1PG5B 2MPXC 3VUBA 1NPRA 4C92B 1OU8A 3OS0A 1EFNA 2DX1A 1NJIC 5GMKi 2HQXA 4M7AB 4RTVA 1Q81R 5FW9A 4M78D 3CCQQ 1O75A 3UATA 2RA2A 1PRLC 2R5AA 1M9SA 1Y96B 1IREB 3TVTA 2GTJA 1N27A 3TREA 3TCJA 2AIRB 2V8KA 3MKDA 4BB7A 4IUVA 1Q7YR 3G71T 3CPWS 4FT2A 2EAYA 4JZ3A 4OP0A 4RTZA 1YCYA 1GXIE 4C0FA 2E5KA 4HT8A 5J26A 2KVQG 5M9OA 1SF9A 4DQ2A 1YITA 2YWWA 1N5ZA 1K76A 5GANe 2XMFA 1R8OB 4E7JA 2RJCA 3RMQA 3SFMA 1W2BA 2D6FA 4AFUC 1CSKA 2EYWA 3V7SA 1RI9A 2RI3A 1MHNA 3CMEQ 1BIAA 2DXBA 4Z8AA 1MMNA 1WJSA 3JCMX 3CXCP 3NTHA 2O88A 3OW2A 2LX9A 3OMCA 3H6ZA 1AEYA 3CPFA 1WFWA 1TSFA 2W10A 3M4GA 5KCHA 1PWTA 2EKHA 3HRSA 2VB6A 1NM7A 1Y57A 2O01E 1Q7YU 4N4IA 1VQ7A 2F2XA 5KYWB 1I07A 3A8HB 5GANj 2AT1B 2HSPA 2ZPEB 3QZ5B 4BD3A 5GAN4 5KE2A 3OYLA 3GNGA 4M75A 2JOYA 2QA4A 2RNAA 1WHGA 2COWA 3HSBA 2DAQA 3MCAB 4M77C 1M30A 4BDZA 1VQLQ 1WJRA 2BIVA 2FL7A 4F7UG 1ZUUA 1VQNQ 3NFCA 2BE7D 3JB9J 3CC7Q 2A3LA 1I5OB 2K5FA 3EH2A 4RCCA 2F2VA 2C0TA 1Z9ZA 3URGA 4FM4B 1UUEA 1K9MR 4F14A 3LGFA 4NOYA 2CP6A 5GAMd 4FSXA 2LDMA 5GANh 1QMCA 1WJQA 3OYIA 2RH2A 3MJXA 2AZSA 4C92A 4F04B 4A54A 4C8QD 4AG1C 1UHCA 2DFUA 4XU2A 1A0NB 3LW5E 4M7AA 3QHSA 2DRMA 1YI2A 3RNJA 4AFQC 3OYKA 2PUKB 1YJNA 2XKOC 1M5Q1 1H8KA 3JCMd 1TXQA 3MP8A 3EHRA 1YHQT 2HAXA 1YFNA 3KFVA 1M3BA 3OW2S 1SKUB 3BE3A 4M77G 1JJ2P 3QUIA 1NYFA 3NGPA 3UA6A 1VYTA 3E9GA 1VQ5A 2LCLA 4LXCA 3ZL7C 3EGXB 5KYYB 2FHDA 2RQTA 4BY6C 4RTWA 3M5AA 4BI8B 3EAEA 4NL2A 2RHXA 2ZPBB 4KH1B 3SEMA 4XTUA 3V8JA 4J9GA 3RMSA 2F5TX 3L2RA 1VQ9Q 5D7UA 1WHJA 5GAOp 1QWFA 2DA9A 1VQ4Q 3MP6A 4FYWB 3VYGA 1S72Q 3CCUQ 2KSSA 2RPNA 4X9DA 1WYXA 1TUCA 1I81A 4PJMA 4JS5A 4N4GA 2ED1A 2HKQB 3UF4A 2RI2A 2ZZDA 3V8LA 3FB9A 5J39A 4RKUE 5FROA 3JCMc 1X01A 2K79A 3OY9A 2M1HA 5DY9A 2M0OA 1Q7YC 2JT4A 1H3HA 2FRWA 2VKNA 2CSQA 1LPLA 3CBMA 2JMCA 1QQJA 2BKDN 5IT9E 1ZSZB 2OI3A 4Q5WA 1SG5A 4PJLA 2AZVA 2DZ9A 4C5EA 5GAN6 2HBWA 4HT9A 3VS7A 2DVJA 1OPKA 2EVRA 1JXMA 1T0JA 1K8AU 3CCSQ 3PMIA 3QWXX 1KG1A 4X9CA 1H641 1VQLT 3MEUA 1OX8A 3EFSA 2W0ZA 4ANJA 1FMKA 2PVDB 1JB0E 1G3SA 3VKIA 3MEVA 4PLIA 1UECA 2F69A 2IIMA 2C0IA 3CCMA 1B34B 3I56T 2X51A 4NS5A 4M75E 5KCOA 4M78G 1KK7A 3QG1A 1BK2A 1SSFA 3KBGA 2WSFE 2DETA 4KGVB 2WSEE 3OSSC 5GAOn 2E6ZA 4AG2C 3C4SA 2EQIA 3CCRT 1ZHIA 1VQKA 4JRIA 4HCKA 3JB9I 2AKLA 1SPKA 3H8ZA 2YLBA 1KJWA 1IZ6A 1Q82U 4QKUA 1VQ6T 3QDFA 1QVGA 2NLUA 4AMCA 4N0AA 3E2UA 4O6JA 2YHTA 1AWXA 1SEMA 2CS7A 4HCZA 2DMOA 4L6V5 3I5RA 1S1NA 4OB3B 1JBMA 4BDYA 3JAME 3EGXA 5KYYA 1VQMT 1BIBA 2WACA 2R57A 5FRMA 4KGZB 2OTJQ 2JTFA 4C92E 3R6NA 3CCLT 1LOJA 1PSEA 3ZEHA 4M7DD 4D6WA 2NWMA 5EC7A 1NLOC 3TSZA 5GMKe 1KD1R 5CCAA 1E6GA 1O9SA 3CMAA 2RM4A 1WXTA 3TU4K 4LE9A 1P92A 3OA6A 4FW1A 1QKWA 3EG2A 1VQ8A 4EPCA 3UA7A 2DERA 1XNIA 1RI0A 3ER0A 3VS5A 5KYXB 4J9DA 1T3SA 2FPFA 1YIJA 2COYA 1VQOA 1BI0A 4FCYA 4QVCA 1MNEA 3G6ET 1I0CA 2VASA 5GMKj 4PJOB 2RMOA 1K0SA 2K6DA 2EQJA 3JCMJ 1SSHA 3GP8A 4J6YA 3PIOA 2RQRA 4C8QA 2HNIA 3X26B 1ZSZA 1NZ9A 5J3BA 1KD1U 2EGEA 1UHFA 2K57A 2EPDA 2L3QA 4XTZA 1VOMA 3AT1B 3QZ9B 3C94A 3LH5A 3JCMb 3GBQA 4ZNXA 1QVGS 5CO7A 4QW2A 2RJEA 1QCFA 4IUUA 4E7SA 3OS2A 1M2OA 1K8AC 1B34A 2BZYA 4KH0B 1H92A 3A98A 2ROTA 2E10A 2DK3A 5GMKh 1WXBA 7AT1B 3QWYA 4RMOA 4PJNA 4M4ZA 1RL2A 4M75D 3V7RA 2A0FB 3VYHB 5CKDA 3CCJA 2A08A 2I0NA 2GF7A 1AZGB 5LJ5e 4QQDA 3J80E 2IG0A 3M54A 1NE8A 2O9VA 2JTEA 4J8OA 2KY9A 5L8RE 3PMTA 2PNIA 3SWNB 3L2WA 1G3YA 5GJWB 3G71Q 3G1JA 5IXFA 1K9AA 3CBPA 4AFZC 4EMKB 4A4GA 1YJ9T 2LCCA 5GAMe 2QI2A 3VS2A 3CD6A 4E47A 8ATCB 2V1QA 4ESRA 1PD1A 2XG8D 5LJ5j 2QQ9A 1EZZB 1T3LA 2NUPA 2VYTA 4HKEA 4C92D 2YT6A 3JCMe 2COZA 2V26A 4LD6A 2DNUA 4M7AD 1OULA 2H8HA 5L23A 2JM8A 2E3HA 2D8JA 2GQIA 1YJWT 4AFSC 3PVQA 1WPYA 1M3AA 3L42A 4J6XA 1M1KU 5FWBA 5GANg 3VRYA 3RKWA 2QGGA 2AHJB 2D0QB 4PJOA 2E6NA 3GOXA 2DZCA 1K4US 2MYSA 2L3RA 4HVUA 2SEMA 1LNXA 4M78F 5LJ5h 1AOJA 4KULA 1YJWA 2B8AA 2QASA 4TVRA 4Z89A 2H3JA 4B9XA 1QVFA 5CR2A 2DXUA 1VQPT 2YUNA 1D1BA 1ZBXA 4CC4B 4C0ZA 2CSIA 2BZ8A 1IB8A 5IHKA 2JTMA 4F7UB 2YRCA 3CC4T 4Y28E 2VVKA 4ATOA 1QP2A 4XTXA 5I2MA 1KD1C 5I11A 1ZX6A 3RKXA 4OMFB 3RESA 4FU6A 2CREA 4J9BA 3OYJA 4YTLA 2YUPA 3A8GB 3G4SA 1D0YA 1UJYA 1RABB 2HMAA 3U23A 4C8QE 4M7DA 1U5SA 1UGRB 3QXEB 4OGCA 1B7TA 2XHCA 3S6WA 1PRMC 4ZN3A 4C0DC 1YHQQ 5FU7C 2PU9B 1UFFA 5LJ3e 1QP3A 4PFZA 1YP5A 4GLMA 1RLQC 3EHQA 4EMGA 4CC3A 3SWNA 3WXMB 1R77A 4X1VA 2Y90A 3OS1A 4M77B 3HFNA 1Q86U 4EMKA 3EH1A 2GGRA 2DEUA 4J7IA 2EKOA 1AVZC 1YITT 5GAOl 1RAAB 2E5QA 1FYNA 1BI1A 4XQ3A 2J6FA 3T9NA 2QEXA 3FJPA 5CKEA 2EBPA 3BY7A 2ZPFB 4F17A 4BI4A 2ABLA 4B6MA 2KRMA 4P5NA 5LJ3j 3M4YA 4Z88A 2QQAA 5IHIA 1NEGA 2X35A 1QVFS 2K5LA 1UG1A 1TS9A 3E9FA 4LUDA 4QQGA 4KBMB 4J9EA 3JB9D 1IHVA 5GAN5 2K7AA 4RTUA 5CAIA 1PHTA 1VQ7T 1MUZA 3OYCA 1X2QA 2ROLA 5GAN7 2GTOA 1MMDA 3HPWA 1W1FA 4LUEA 5KYUB 1U06A 3CXCS 2QA4T 2JZ2A 4FIBA 2FO0A 4HCCA 4MDXA 4C8QF 4C5HA 3GPLA 4OMPA 2QQRA 2OTLT 2O4XA 4EDUA 3NPFA 5I22A 3VS1A 1RADB 1WHKA 1HD3A 2E65A 3RBBB 1M1KC 1OZ3A 5LJ3h 1C6VX 4JJDA 1G83A 5ECAA 2L89A 3CCMQ 2OTLA 4J83A 1RLPC 4BY6B 5IAYA 2NUTB 4F7UA 1YCSB 2L5QA 3Q1JA 1BU1A 5AYFA 3LH0A 3UDCA 2CP3A 1AWOA 1OEBA 2RQUA 1X75C 2EIFA 4MZMA 4M75G 3I56Q 5GANf 4FYXB 2RHYA 2V1RA 1AHJB 1MV0B 2FB7A 1AZEA 4IIOA 1DJ7B 2VXFA 4JLIA 3KUFA 4WCIA 2KNBB 2Y4YA 4BI3A 3P8BB 1YI2T 1CKAA 4IUPA 1YJNT 4PKCC 1QCNA 3CCRQ 5CKFA 3LX7A 3CC2A 2BTTA 3L2VA 1ARKA 3FRNA 1OV3A 3CCVA 1M1GA 5IN1A 2VXEA 2DPPB 1QKXA 1VQ6Q 2B86A 3X20B 1UGSB 1VQ5T 2ZPHB 1WIEA 2H3EB 2JMAA 3EG1A 5GAOq 4M77A 5GJVB 1IGUA 2RK1A 1Y96A 1VQMQ 4FSSA 2LVMA 1M2VB 2LP5A 2CH4A 1ZUKA 1ABOA 1WLPB 5CKBA 1KSWA 1NPPA 1W2BP 3UPUA 3CCLQ 1UGQB 1Z9QA 1Q86C 2LJ3A 2RO0A 4M7DE 2JNGA 2D9TA 4J5YA 4J6WA 2J6OA 3C95A 5LL6S 3RUXA 1WI7A 1TG0A 3OYHA 2VC8A 2LQNA 5IXBA 2KK4A 3REBB 3I55T 3SB2A 2FZCB 4XTVA 2KE9A 4J9FA 2RQWA 3QSUA 1K8AR 2XK0A 3PTAA 3JRZA 5KYUA 2HZYA 5GMKl 1V1CA 3P8DA 3WVEB 3CCQA 4M78C 2CZ0B 2RHZA 3G6EQ 3I55A 2LQ8A 1I5LA 4BUGA 2VWFA 2P84A 1BI2A 5KYWA 3ZBDA 2E3IA 2BZXA 2L3SA 1PC0A 4OB0B 2J7IA 2CZ1B 1F1BB 2FPEA 1VYVA 2DLPA 2NUTA 2PQWA 4IUQA 2KYBA 3A8MB 1Q82R 2HSEB 1RACB 2EQKA 2O9SA 2M0YA 4JRPA 3CCMT 2KT8A 3INZA 3A5ZB 2HBPA 3JV3A 3P8HA 2JJ9A 3CMEA 1FX7A 3A1PA 1KQSA 4EMHA 4M7DF 3EGDB 1D1AA 2YRDA 4RG8A 1GFCA 2JS0A 2KT1A 1UTIA 2ZPIB 1VQKT 1LVKA 2A36A 2FVUA 4AT1B 4R56A 4PJOD 4XTWA 3FJ5A 1WX6A 4A4FA 4QQ6A 3EFRA 2K3XA 3M57A 3S3OA 4BE1A 1EX4A 3QJYA 1FMVA 2CZ7B 4F7UE 1HSQA 1GCQA 3IQLA 4ZTFA 2DRKA 4XTYA 4IUTA 3MHXA 3TQ7P 1YJ9Q 4JUVA 2DIQA 1XQHA 2GNCA 1Y0MA 2K3YA 1VQNA 2PVOB 3CC7A 1JEGA 4A53A 1QW1A 3CBOA 2DXCA 2LJ0A 1N9RA 3CMAT 5GANd 1YBYA 1I8FA 3RKYA 2K9GA 4R0KA 1PSFA 3OSVA 1VQ8T 4ME7A 4QVDA 1PNJA 3GIBA 2MCNA 2CDTA 4M7AE 4KGXB 2MAMA 1OQKA 4JRKA 2CUBA 1YIJT 1VQOT 1AWJA 2EWNA 4C8QC 1YJWQ 4FT4A 1ZSZC 2DD5A 4DOVA 1ACMB 2JN0A 1W70A 1QLYA 1BI3A 1WZOA 3PFSA 1WGSA 2ZAEA 1KQSS 2J06A 2EQUA 4M75F 5CQXA 1XJWB 3BDLA 2MF2A 4R55A 1ZA2B 3EG9B 3HFOA 2P0PA 2JM9A 2D8HA 2GFUA 2LT1A 4OVAA 3A8OB 2EQMA 2PTKA 1VQPQ 4JJBA 2DTIA 2RHIA 2QXFA 3NHNA 3CC4Q 2VGMA 4JS4A 1TH7A 2G3RA 4XAXB 3H9NA 3NTKA 1VQ9A 1S72A 3CCUA 1VIFA 3SHWA 3ZFJA 3M0SA 2BE9B 3EGDA 1NYGA 1Y7XA 4L59A 3D7SB 2VV5A 3EFOB 2NYSA 4C8QG 2KEAA 3CCJT 4V2SA 3VS0A 4C92F 5HY6A 3H41A 4ORZA 3HRTA 3OB9A 1JXOA 4IKFA 4JJNK 5A0LA 1ZBJA 4M7AF 1B07A 4PFOA 1RAHB 1U3OA 4FYYB 3EG3A 4DOWA 3M59A 3LWIA 5A0DA 2KXDA 3CQTA 5CQYA 4LDYA 4RTYA 2J05A 4KUDK 3GNFB 4HXJA 4HA8A 2QQSA 3CD6T 5FU6C 2LQWA 2HQEA 1YITQ 1YN8A 1X43A 2CP2A 1WA7A 2DL7A 2ESWA 1M1FA 1KHCA 1IO6A 1OX9A 4E7HA 5DLQE 1Q82C 1M1KR 1UGVA 1R0CB 1EIFA 1UB4A 1RAFB 2QK0A 2LRQA 2XDPA 3M0UA 4OB1B 2CP0A 5CVIA 5D6XA 2DXTA 1AD5A 1YWOA 2DO3A 4RG2A 3SD4A 2MI6A 4DBHA 5FWCA 1G3WA 1VQ7Q 4DEYA 2D0NA 2LZ6B 3QPHA 2K2MA 4CC2A 1M90U 2QYZA 4LDUA 1X6OA 2QA4Q 2EYXA 2FEIA 3GF5A 5GAMj 2HD0A 5KYXA 4C0DB 4M77D 1D09B 1CKBA 4IURA 2RHUA 2OTLQ 1GL5A 2MOXA 3FC3A 1SRLA 2L8DA 4ZN1A 5LJ5f 2DJZA 2L0AA 2RK2A 3EG9A 4ZGJB 1BB9A 2QAZA 2R5MA 5HK0A 1WHHA 2GBQA 3ASKA 4KUIA 2OTJA 3F70A 1W4SA 2DM1A 5CKHA 4M7DC 1HK9A 1IRXA 3V8KA 4B9WA 1FXXA 4NL3A 2DTOA 3QDRB 4J9CA 3PE0A 2JXBA 2DL3A 4OMLA 5A0GA 1Q86R 4PK4A 5KE3A 5GAMh 2MWOA 3JB9H 3G4ST 2CUDA 3HP9A 2EYZA 3CXCA 3M9QA 2WSCE 3MEWA 1YI2Q 1YJNQ 2X3WD 2LNVA 2M02A 4LDWA 4A63B 4EMKC 1K73U 3JCMV 1TWBA 5DM7R 2DD4A 4QVZA 3JB9F 4BE2A 1M4ZA 4X34A 5HCKA 3JCMh 2MMPA 3LYIA 3QIIA 3MP1A 3A8LB 1QWEA 2RJFA 1VQ5Q 2C06A 3OBWA 2LCSA 4DBFA 3M55A 1C1AA 1XTDA 4FL6A 2CGHA 3VUZA 3AHUA 1TOVA 1BCMA 4XK8E 1PKSA 2QEXT 1OI1A 2BUDA 4JZ4A 4M7DG 5IH2A 5GAOr 1WDXA 4A4KA 2HL5C 4OMNA 1K0XA 1UJ0A 2IVWA 4KT0E 1KFZA 4F16A 2KMTA 3ULRB 1MV3A 4JLGA 2P4TA 3I55Q 3C12A 1FMWA 3RR6A 1RAIB 2J6KA 2FZKB 3PNWC 3CPWP 3OYYA 4M75C 4E7ZA 1MMAA 2DL4A 2DEQA 3CEYA 1RUWA 2X3XD 3EG0A 1KQ1A 3MO8A 1UDLA 4VUBA 1R0BG 6AT1B 1QVFP 2ED0A 4J7FA 3PT9A 1M90C 3THKA 1JJ2A 3SDZA 3G71A 2XDBA 3VU3C 2KRSA 3M53A 4RTTA 1HJDA 5LJ3f 3X28B 3I5SA 2E1HA 3I9QA 1KHIA 2E12A 4K11A 2FPDA 3CCET 2M16A 1Q81U 4BE0A 3M58A 1U1TA 3L2UA 3DLMA 3O8VA 1AWWA 2P0KA 2DBKA 3HRUA 3JCMP 2RN8A 1J3TA 2P0QA 4CC7A 3VS3A 5EG2A 2XI9A 1KC8R 3META 4C92C 2F5KA 3CCEA 3TSWA 1VIEA 4ELZC 1V29B 3V7CA 3OYAA 2KRNA 4M7AC 3C0CA 1BCOA 3CC2T 3HHTB 3J81E 1VQKQ 3L1AA 3CCVT 4RUGA 3LLRA 1T0HA 3H0HA 4PJOE 4ZGDB 1AT1B 3NMZC 2JUFA 4HVWA 2L2PA 2E64A 2YUOA 2KYMA 2MIOA 2EJGA 4M78B 1ZSGA 4KRTA 3OMGA 5LJ5d 3H0IA 3REAB 1V76A 1K73C 1MGQA 1N8RR 3JCMW 1ZUYA 4MMKA 5C6SA 1NEBA 1U1SA 1Q95G 1KC8U 1UEBA 1VUBA 1VA7A 4JDSA 3J7AF 2EYYA 4PL6A 5GAN2 1SRMA 2KXCA 2F1LA 2XIDA 3RDVA 2VGNA 3CMAQ 4CRIA 1RAEB 3X24B 1JJ2S 4C92G 2F2WA 2OAUA 5HK3A 2KR3A 4PJJA 3QJ6A 2Y4XA 3FIFA 1G5VA 1W2BS 1VQ8Q 4PLLA 4M7AG 3DB3A 2QG9B 1OZ2A 3OYMA 2ZCFB 3VV0A 4DBQA 3PIPA 3OW2P 2PZ1A 2KQWA 2V8IA 2KDSA 9ATCB 2KAFA 2K2VA 2KROA 1YIJQ 3M56A 2MK5A 1VQOQ 4MDWA 4A4HA 1H3ZA 2EYQA 4Y91A 8AT1B 2A28A 3CCQT 5D6WA 1N8RU 1I1JA 3VS6A 2YXYA 4LNPA 3LWHA 3WVDB 5FLXE 1YHQA 2E41A 1K9MU 3OYBA 3HKSA 1MMGA 1PD0A 1RAGB 2QTXA 3L2QA 4E7LA 2G6FX 2IPOB 4PJOF 2CT3A 3RERA 3I35A 1N9SA 1X6GA 3O5ZA 2OAWA 4Z02A 1ZLMA 3OYGA 2VUBA 3OS5A 2M51A 2JVVA 1WHLA 4LD9K 2OX7A 1OYXA 4A4EA 1X6BA 3CMET 4HCBA 2ENMA 1Q81C 4LDXA 4L5GA 2RJDA 1WNLA 1GCPA 3ME9A 1D0ZA 1TUGB 2K3BA 2YUQA 3M0PA 2YSQA 3OYNA 2GCXA 3CCJQ 1GCQC 2DYIA 1PKTA 2QDLA 2CT4A 1OU9A 4C8QB 4D8KA 2LMJA 1JU5C 2DKGA 4PNOA 2DTHA 2RI5A 2A7YA 3JSCA 4M78A 4N0AC 2FG0A 3M0TA 4MZPA 3HL8A 4QT7A 5KH6A 2DVEA 1ABQA 5LJ3d 2PUOB 3G7ZA 2DL5A 2EJ9A 1KQ2A 1BYMA 1E7OA 3CD6Q 1WQ7A 2HKNA 4O5VA 1VQNT 2HQHA 2XICA 3CC7T 4ZTJA 4BACA 4OMOA 2FYKA 1WQWA 1VQLA 4XU0A 5AT1B 2K4YA 2LT4A 1M2VA 1M8VA 3S3MA 1QCOA 1YWPA 1UGPB 2AKKA 1KC8C 2KBTA 3QBYA 3QYHB 5IHNA 3I56A 5LJ5g 3JB9G 1GRIA 4J9IA 1K1ZA 2EGCA 2LQKA 2XDDA 4GLKA 2GFAA 3OYFA 2R58A 1GBQA 2CH4W 3E1SA 4C5IA 5DLOA 2YLCA 4OMQA 5GAN8 3CCRA 2GQVA 2L3PA 2LTOA 2YRVA 3KXTA 2EW3A 2LNHB 5GAMg 4M77E 2RQVA 1VQ6A 2EGAA 2D1XA 5GAN3 5CIUA 3GLXA 4II1A 3OQ5A 2JS2A 4OB2B 1N8RC 4FW2A 1D3BB 2ECZA 2ZPGB 3LGLA 4GBQA 1I4K1 2LX7A 2NUPB 2KGTA 2M9UA 1K9MC 4E6RA 4ZGEB 1VQMA 5FU6B 1B3QA 1IXDA 2HEQA 2HL3A 3HTRA 3JCMg 1VQ9T 1VQ4T 3CCLA 4F7UF 1LCKA 4XU1A 5GAOm 1JO8A 1S72T 1KQSP 3CCUT 4PFPA 3DB4A 2AK5A 3N5BB 4FYVB 3JCMQ 4LN2A 3L2ZA 2O31A 3G4SQ 1X2KA 2FRYA 2NUZA 1VQ4A 1LJOA 1NJIR 2CYZB 2QGFB 1BKBA 1U8RA 3OYEA 1MNDA 2HDAA 2X4JA 1UE9A 3BDUA 2DBMA 2DE0X 3VRZA 2JW4A 2XU8A 1HYOA 4ELYC 2V8JA 2LC4A 3M0QA 4WF2A 5HKCA 1Y71A 3G6EA 1C0MA 4XU3A 1G8XA 1Y07A 3E19A 4C5GA 2QTVA 2X4XA 2A37A 1QVGP 2E4HA 2DL8A 1VYUA 4JPBW 4WTOB 4E7IA 2KI7A 2RD1A 4E2FB 1GFDA 4M77F 2QEXQ 3CCST 1NBEB 1M90R 1NG2A 3QYGB 1D0XA 3S3NA 3M0RA 3PVLA 1NJIU 3BFMA 1E6HA 4UC4A 4M7DB 5A2QE 2DJQA 2K5IA 2YDLA 3NTIA 3MEAA 3CCSA 1M27C 4M78E 2FZGB 2DIGA 2PVGB 1OOTA 1ZQ1A 1OPLA 5LJ3g 4MMLA 2HCKA 4PJOC 1N6AA 2LJ1A 1PM3A 2O2OA 3BW1A 1WXUA 4OF1A 3OYDA 4C0GA 2ZGWA 3QO3A 1SHGA 5D6YA 2CP5A 4HVVA 3FDRA 5I21A 1TTHB 3VS4A 1D1CA 3VJPA 2CKKA 1JRIA 1D3BA 1ZA1B 1XOVA 5FU7B 1YJ9A 1WHMA 5C0MA 4CI0C 2OTJT 2RB6A 3CCEQ 1K73R 3EGUA 2QDYB 1X27A 2CP7A 4GY5A 3RIRA 3TEEA 4MZTA 4OMMA 2XD0A 3DKMA 2C0OA 3R6OA 4Y92A 3QKJA 2DF6A 2DYBA 1G3TA 5CK9A 3UWNA 4IIMA 5GAMf 4JRQA 1SHFA 4D8DA 2ATCB 1GBRA 3CPWA 1IHWA 1HXDA 1G2BA 2SRCA 3CC2Q 1BBZA 3PGGA 2O4XB 3CCVQ 2OJ2A 2DILA 4PJOG 5I2SA 4OGEA 3X25B 4E7KA 2QQBA 4M75B 2EJFA 1KIKA 3DLLA 3EFOA 4RTXA 3SWNC 1TUDA 2X4YA 2CZ6B 3JCMf 1PCXA 5KYNA 2MWPA 4DBRA 1YNZA 2P4RA 4JJCA 5GMKm 1FWZA 1IGQA 3OBYA 4J9HA 3H0FA 4RCBA 1M3CA 4DEXA 1M8MA 4EIKA 1TU0B 3MPUB 1W6XA 2RF0A 4LDVA 1VQPA 5FRNA 2X9HA 1JQQA 2EFIA 2E70A 4N4HA 1QVPA 3CC4A 2I2LA
chains in the Genus database with same CATH topology
3M57A 3FLGA 4MMKA 3UT1A 3S3OA 5C6SA 4BE1A 3QJYA 2CZ7B 4F7UE 1RL2A 3FEOA 1U1SA 2X4WA 4M75D 3V7RA 1KC8U 1UEBA 1VUBA 4DA4A 4JDSA 3VYHB 5CKDA 3J7AF 3CCJA 4PL6A 5GAN2 3VUBA 4XTYA 4ZTFA 4IUTA 3MHXA 2GF7A 5LJ5e 4QQDA 1NPRA 4C92B 3J80E 2IG0A 4JUVA 3M54A 2DIQA 3OS0A 2XIDA 1YJWA 1NJIC 2VGNA 1NE8A 4CRIA 5GMKi 2HQXA 3X24B 1XQHA 1JJ2S 4C92G 4J8OA 4M7AB 2KY9A 2OAUA 5HK3A 5L8RE 3PMTA 3SWNB 2K3YA 3L2WA 3QJ6A 2Y4XA 2PVOB 1G3YA 4M78D 1VQNA 3FIFA 3CC7A 1O75A 1G5VA 1W2BS 2RA2A 1QW1A 4A53A 3CBPA 3CBOA 4PLLA 3DB3A 4EMKB 2DXCA 1OZ2A 4A4GA 3OYMA 2ZCFB 4M7AG 1YJ9T 3VV0A 3PIPA 2LCCA 1N9RA 2R5AA 1M9SA 2KQWA 5GAMe 1Y96B 2V8IA 2KDSA 2QI2A 1YBYA 5GANd 1IREB 3CMAT 1I8FA 2KAFA 2K2VA 3RKYA 4E47A 3CD6A 3M56A 1N27A 4MDWA 3TREA 4A4HA 3TCJA 1H3ZA 2V8KA 4BB7A 2EYQA 4IUVA 4Y91A 3G71T 3CCQT 1PSFA 3CPWS 3OSVA 1VQ8T 4ME7A 4FT2A 2XG8D 5D6WA 4QVDA 1N8RU 2EAYA 5LJ5j 2QQ9A 3GIBA 4M7AE 4OP0A 1YCYA 1GXIE 4C0FA 4HT8A 2MAMA 5J26A 2KVQG 3WVDB 5FLXE 5M9OA 2VYTA 3LWHA 4HKEA 4JRKA 1YHQA 2E41A 1YIJT 1K9MU 4C92D 4DQ2A 3OYBA 1VQOT 3HKSA 2EWNA 4C8QC 2QTXA 1YITA 3L2QA 4E7LA 4PJOF 3JCMe 4LD6A 4FT4A 3RERA 5GANe 2DD5A 1N9SA 4DOVA 4M7AD 1R8OB 4E7JA 2RJCA 2JN0A 4Z02A 3RMQA 3SFMA 1W2BA 2D6FA 1BI3A 3OYGA 2VUBA 3PFSA 3OS5A 1WGSA 3V7SA 2RI3A 1KQSS 1MHNA 2EQUA 4M75F 1BIAA 5CQXA 3BDLA 2DXBA 2JVVA 1YJWT 2MF2A 1WJSA 3JCMX 4R55A 3NTHA 1WPYA 4LD9K 3OW2A 2LX9A 3OMCA 3L42A 4J6XA 3H6ZA 1OYXA 3CPFA 1M1KU 5GANg 3HFOA 3RKWA 2P0PA 2LT1A 2GFUA 4OVAA 4A4EA 2AHJB 2D0QB 3M4GA 3A8OB 2EQMA 5KCHA 4PJOA 2E6NA 3HRSA 3GOXA 2DZCA 3JCMW 2DTIA 2RHIA 3CMET 2O01E 2L3RA 1Q7YU 4HCBA 2QXFA 4N4IA 1Q81C 1VQ7A 4LDXA 4L5GA 1LNXA 4M78F 5LJ5h 2RJDA 4KULA 1WNLA 2VGMA 2B8AA 2ZPEB 3A8HB 3QZ5B 4TVRA 4BD3A 5GAN4 1TH7A 2H3JA 3ME9A 2G3RA 5KE2A 4XAXB 4B9XA 3OYLA 1QVFA 3GNGA 4M75A 5CR2A 3NTKA 2JOYA 1VQ9A 2DXUA 2QA4A 1VQPT 3OYNA 2GCXA 1ZBXA 3HSBA 4C0ZA 1S72A 2DAQA 3CCUA 3MCAB 4M77C 1VIFA 2JTMA 3ZFJA 4F7UB 3CC4T 4Y28E 4BDZA 4C8QB 5GANj 4ATOA 1QP2A 4XTXA 5I2MA 1WJRA 2BIVA 2DKGA 1Y7XA 4PNOA 2FL7A 1KD1C 4L59A 4F7UG 2VV5A 2DTHA 2RI5A 3RKXA 4C8QG 4OMFB 2A7YA 3JSCA 4M78A 4N0AC 3RESA 3NFCA 3CCJT 4C92F 5HY6A 4V2SA 3JB9J 4MZPA 2A3LA 3HRTA 3OB9A 3HL8A 2K5FA 5KH6A 2DVEA 5LJ3d 4IKFA 4JJNK 4FU6A 3OYJA 2PUOB 3G7ZA 5A0LA 4M7AF 2EJ9A 4YTLA 1KQ2A 1BYMA 4RCCA 1WQ7A 4DOWA 3A8GB 4O5VA 3M59A 3G4SA 3LWIA 3URGA 4FM4B 1VQNT 5A0DA 4M7DA 4C8QE 2XICA 3LGFA 4NOYA 3CC7T 5GAMd 1UGRB 4FSXA 4ZTJA 2LDMA 5GANh 3QXEB 5CQYA 4BACA 4LDYA 3OYIA 1WJQA 4OGCA 4KUDK 3GNFB 2RH2A 2XHCA 3S6WA 4HA8A 4ZN3A 2QQSA 4C0DC 2FYKA 4C92A 3CD6T 1WQWA 1VQLA 4XU0A 5FU7C 2PU9B 2K4YA 2LT4A 5FU6C 4A54A 4C8QD 5LJ3e 1QP3A 2HQEA 1M8VA 3S3MA 4XU2A 3LW5E 1UGPB 4EMGA 3QHSA 1KC8C 4M7AA 1M1FA 1YI2A 3SWNA 3WXMB 3QBYA 3OYKA 1YJNA 2PUKB 2Y90A 2XKOC 3OS1A 1KHCA 3QYHB 4E7HA 1KG1A 4M77B 1M5Q1 3HFNA 5DLQE 4EMKA 3I56A 3JCMd 1Q82C 1Q86U 3MP8A 1YHQT 2HAXA 4J7IA 5LJ5g 3JB9G 1EIFA 1UB4A 2EKOA 3OW2S 1YITT 5GAOl 2LQKA 4M77G 2XDDA 3QUIA 2E5QA 2LRQA 2XDPA 4GLKA 4OB1B 2GFAA 3OYFA 1BI1A 2R58A 4XQ3A 5CVIA 5D6XA 2DXTA 3T9NA 2QEXA 3E1SA 3FJPA 2DO3A 2YLCA 3E9GA 5CKEA 2LCLA 3BY7A 2ZPFB 4C5IA 2GQVA 4RG2A 3SD4A 3CCRA 1VQ5A 2LTOA 2YRVA 2MI6A 4BI4A 3KXTA 4P5NA 5LJ3j 2FHDA 1G3WA 3M4YA 4BY6C 5GAMg 2QQAA 3M5AA 4BI8B 2X35A 3EAEA 4M77E 1VQ6A 4NL2A 3QPHA 1QVFS 2K5LA 2RHXA 2ZPBB 3GLXA 5CIUA 4XTUA 3V8JA 3E9FA 5GAN3 4II1A 3OQ5A 3RMSA 2F5TX 1M90U 4OB2B 4LDUA 3L2RA 1N8RC 1X6OA 4QQGA 4KBMB 5GAOp 1D3BB 2ZPGB 3GF5A 3LGLA 5GAMj 3JB9D 3CC4A 3MP6A 2HD0A 5GAN5 1I4K1 3VYGA 4C0DB 5CAIA 5GAN8 4M77D 1VQ7T 2KSSA 3OYCA 2M9UA 1K9MC 4IURA 4ZGEB 2RHUA 1VQMA 5FU6B 5GAN7 3FC3A 3HPWA 4X9DA 2L8DA 1I81A 4ZN1A 5LJ5f 3JCMg 1VQ9T 3CXCS 2QA4T 2DJZA 2JZ2A 1VQ4T 2RK2A 4FIBA 3CCLA 4F7UF 4ZGJB 4HCCA 4XU1A 5GAOm 4JS5A 1S72T 4C8QF 4C5HA 2R5MA 4N4GA 5HK0A 3DB4A 3GPLA 3CCUT 4MDXA 2QQRA 2OTLT 2O4XA 2RI2A 2ZZDA 3N5BB 3V8LA 4EDUA 3JCMQ 3ASKA 3FB9A 5J39A 4KUIA 3L2ZA 4RKUE 2OTJA 3F70A 1W4SA 2E65A 1M1KC 1OZ3A 5FROA 5LJ3h 5CKHA 4M7DC 3JCMc 1X01A 1HK9A 1VQ4A 1LJOA 3OY9A 2L89A 2CYZB 1BKBA 2M1HA 3V8KA 4B9WA 5DY9A 1U8RA 1FXXA 2M0OA 3OYEA 4NL3A 1Q7YC 2OTLA 2DTOA 4J83A 4BY6B 3QDRB 5IAYA 2X4JA 4F7UA 3CBMA 5IT9E 2BKDN 5A0GA 2L5QA 5KE3A 3Q1JA 2MWOA 3BDUA 5GAMh 3G4ST 3JB9H 5AYFA 3LH0A 3UDCA 2XU8A 4Q5WA 4ELYC 2V8JA 3HP9A 2LC4A 3CXCA 3M9QA 2WSCE 4WF2A 3MEWA 2DZ9A 4C5EA 5GAN6 1Y71A 5HKCA 3G6EA 4HT9A 1X75C 2EIFA 4XU3A 5DLOA 4MZMA 4M75G 1K8AU 1Y07A 2LNVA 4LDWA 3E19A 3PMIA 4EMKC 5GANf 3JCMV 4X9CA 4C5GA 1K73U 1H641 2RHYA 2X4XA 3MEUA 1VQLT 5DM7R 1AHJB 2FB7A 3EFSA 2DD4A 1DJ7B 4E7IA 2VXFA 4QVZA 3JB9F 4JLIA 3KUFA 2PVDB 2RD1A 1JB0E 1G3SA 3VKIA 2Y4YA 3MEVA 4BI3A 1M4ZA 3P8BB 4PLIA 4M77F 4X34A 4BE2A 4IUPA 3JCMh 1YI2T 2MMPA 3LYIA 1YJNT 4PKCC 3QIIA 3MP1A 3A8LB 2RJFA 2F69A 3CCMA 3CCST 1B34B 5CKFA 3LX7A 4NS5A 3I56T 2C06A 3CC2A 3L2VA 4M75E 3OBWA 5KCOA 3FRNA 3CCVA 4M78G 3QG1A 3M55A 1SSFA 1M1GA 3KBGA 2WSFE 3QYGB 5IN1A 1XTDA 4FL6A 2VXEA 3S3NA 2CGHA 3VUZA 2WSEE 2DPPB 1NJIU 3OSSC 5GAOn 3BFMA 2E6ZA 3AHUA 4XK8E 4UC4A 4M7DB 2QEXT 3X20B 1OI1A 1UGSB 2BUDA 3C4SA 3CCRT 1VQ5T 5A2QE 2ZPHB 1ZHIA 2K5IA 1VQKA 4JRIA 3NTIA 3MEAA 3JB9I 3CCSA 4JS4A 4M7DG 3H8ZA 5GAOq 2YLBA 4M77A 4M78E 2RK1A 1IZ6A 1Q82U 1Y96A 2DIGA 5GAOr 1VQ6T 2LVMA 4A4KA 2PVGB 1ZQ1A 5LJ3g 2IVWA 4MMLA 5CKBA 1QVGA 1NPPA 4KT0E 2NLUA 4N0AA 4O6JA 2YHTA 3UPUA 2CS7A 4HCZA 4L6V5 2KMTA 1UGQB 1Q86C 4OB3B 4PJOC 2RO0A 1JBMA 1N6AA 4M7DE 4BDYA 2JNGA 4JLGA 2D9TA 4J5YA 2P4TA 3JAME 1VQMT 4J6WA 1BIBA 3BW1A 2WACA 3C95A 4OF1A 3C12A 4C0GA 5LL6S 3RUXA 3OYDA 2ZGWA 2R57A 3QO3A 2VC8A 5D6YA 3OYHA 3PNWC 5FRMA 2JTFA 4C92E 3FDRA 3OYYA 4M75C 5I21A 3CCLT 1LOJA 1PSEA 2DEQA 3ZEHA 3CEYA 4D6WA 4M7DD 3VJPA 2KK4A 2CKKA 1JRIA 1D3BA 3I55T 5GMKe 1KQ1A 1XOVA 3MO8A 4VUBA 3SB2A 5CCAA 5FU7B 1YJ9A 4XTVA 1O9SA 5C0MA 3CMAA 2RM4A 4CI0C 3QSUA 2OTJT 2RB6A 2XK0A 3JRZA 4J7FA 3PTAA 3TU4K 1P92A 3PT9A 5GMKl 3OA6A 3P8DA 1M90C 3WVEB 1JJ2A 2QDYB 3SDZA 3G71A 3CCQA 2XDBA 4M78C 2CZ0B 2RHZA 3VU3C 1VQ8A 4EPCA 3M53A 4GY5A 3RIRA 3TEEA 4MZTA 1XNIA 5LJ3f 3X28B 1RI0A 3ER0A 3I55A 2LQ8A 2E1HA 1I5LA 2XD0A 4BUGA 1KHIA 2E12A 3DKMA 3R6OA 3QKJA 3CCET 2M16A 1BI2A 4BE0A 1Q81U 1G3TA 1YIJA 3M58A 3ZBDA 1VQOA 1BI0A 3UWNA 4QVCA 5CK9A 1U1TA 3L2UA 3DLMA 3O8VA 2P0KA 5GAMf 4JRQA 3HRUA 3G6ET 5GMKj 3JCMP 4PJOB 4OB0B 3CPWA 1HXDA 2EQJA 2P0QA 3PGGA 2O4XB 2CZ1B 3JCMJ 5EG2A 2XI9A 3GP8A 4J6YA 4PJOG 3META 5I2SA 3PIOA 4C92C 2F5KA 3CCEA 4C8QA 2HNIA 4OGEA 1VIEA 2PQWA 3X25B 4E7KA 4ELZC 4IUQA 1V29B 3V7CA 3A8MB 3X26B 2QQBA 3OYAA 1NZ9A 4M75B 2EJFA 5J3BA 1KD1U 3DLLA 4M7AC 2EQKA 2K57A 4JRPA 3CCMT 3SWNC 3CC2T 3HHTB 3INZA 3J81E 3A5ZB 2X4YA 2HBPA 2CZ6B 3L1AA 4XTZA 3JCMf 3CCVT 3QZ9B 3LLRA 2MWPA 3P8HA 3CMEA 5GMKm 1FWZA 1FX7A 4PJOE 3C94A 3JCMb 1KQSA 4EMHA 4M7DF 4ZGDB 3OBYA 4RG8A 4RCBA 2JUFA 1QVGS 5CO7A 2E64A 4QW2A 2EJGA 4M78B 2RJEA 3OMGA 5LJ5d 2ZPIB 1VQKT 4IUUA 4LDVA 1VQPA 3OS2A 5FRNA 2FVUA 4R56A 1K8AC 4PJOD 1B34A 2EFIA 4XTWA 1K73C 4A4FA 2E10A 2DK3A 1MGQA 2E70A 4N4HA 1QVPA 4QQ6A 5GMKh 3EFRA 2K3XA 4RMOA 2I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMK A;  4PJO C;  4X9D A;  1JBM A;  4M7D E;  1I81 A;  5LJ5 f;  4J5Y A;  3JCM g;  4M77 C;  4F7U E;  4J6W A;  2DJZ A;  1U1S A;  1BIB A;  3BW1 A;  4M75 D;  3V7R A;  4F7U B;  4C8Q B;  3RUX A;  4F7U F;  4XU1 A;  2ZGW A;  5GAN 2;  4XTY A;  4C8Q F;  3QO3 A;  2VC8 A;  4XTX A;  5GAO m;  2DKG A;  4PNO A;  5LJ5 e;  4F7U G;  4C92 E;  2DTH A;  3RKX A;  3V8L A;  4M75 C;  4C8Q G;  3FB9 A;  4M78 A;  4C92 B;  4N0A C;  1LOJ A;  2DEQ A;  4JUV A;  3RES A;  5I21 A;  4M7D D;  4C92 F;  4V2S A;  3JB9 J;  3L2Z A;  1JRI A;  1D3B A;  5GMK i;  5GMK e;  2DVE A;  5LJ3 d;  2E65 A;  1KQ1 A;  4M7A B;  4C92 G;  3SB2 A;  3SWN B;  5LJ3 h;  4XTV A;  4M7A F;  4M7D C;  2EJ9 A;  4M78 D;  1X01 A;  3FIF A;  1HK9 A;  3JCM c;  1KQ2 A;  1LJO A;  2RM4 A;  4RCC A;  2RA2 A;  4A53 A;  2RB6 A;  1WQ7 A;  4EMK B;  3QSU A;  3V8K A;  4M7A G;  5DY9 A;  4NL3 A;  5GMK l;  1N9R A;  2DTO A;  4M7D A;  4C8Q E;  5GAM e;  1Y96 B;  4NOY A;  5GAN d;  4M78 C;  4F7U A;  5GAM d;  1I8F A;  3VU3 C;  3RKY A;  5GAN h;  5GAM h;  3RIR A;  3JB9 H;  3BDU A;  5LJ3 f;  2E1H A;  4Y91 A;  1I5L A;  4HA8 A;  4WF2 A;  2FYK A;  4C92 A;  2DZ9 A;  1WQW A;  5GAN 6;  4QVD A;  4XU0 A;  4HT9 A;  2EAY A;  5LJ5 j;  4XU3 A;  4A54 A;  4C8Q D;  4QVC A;  5LJ3 e;  3GIB A;  1U1T A;  4OP0 A;  4M7A E;  1YCY A;  4M75 G;  1M8V A;  4HT8 A;  4XU2 A;  4EMK C;  5GAN f;  3JCM V;  4X9C A;  4EMG A;  3QHS A;  1H64 1;  5GAM f;  4JRK A;  4M7A A;  2E41 A;  3SWN A;  4C92 D;  4DQ2 A;  2FB7 A;  3EFS A;  5GMK j;  3JCM P;  4PJO B;  2EWN A;  2Y90 A;  2VXF A;  1HXD A;  2QTX A;  4C8Q C;  3JB9 F;  4JLI A;  4PJO F;  4M77 B;  1M5Q 1;  2RD1 A;  3HFN A;  3PGG A;  4EMK A;  3JCM e;  3JCM d;  3RER A;  5GAN e;  3JCM J;  4M77 F;  1N9S A;  5LJ5 g;  3JCM h;  4J6Y A;  3JB9 G;  4PJO G;  4M7A D;  4C92 C;  4C8Q A;  2HNI A;  5GAO l;  2JN0 A;  4M77 G;  1B34 B;  3QUI A;  3V7C A;  4M75 E;  3JCM Q;  4M75 B;  4M78 G;  2EJF A;  3V7S A;  4XQ3 A;  4M7A C;  4M75 F;  1BIA A;  2DXT A;  2K57 A;  3FJP A;  5GAN 8;  2YLC A;  3SWN C;  3BY7 A;  3JCM X;  3INZ A;  2VXE A;  1WPY A;  2CGH A;  3L1A A;  4XTZ A;  3JCM f;  3AHU A;  5GAO n;  3BFM A;  4J6X A;  4M7D B;  5GMK m;  5LJ3 j;  4PJO E;  3JCM b;  5GAN g;  3HFO A;  4EMH A;  5GAM g;  3RKW A;  4M7D F;  4JRI A;  3M4G A;  4M77 E;  4PJO A;  4RCB A;  4NL2 A;  3JB9 I;  5GAN 3;  4M7D G;  3V8J A;  2DZC A;  2E64 A;  4XTU A;  2DTI A;  2YLB A;  4M78 E;  4M77 A;  5GAO q;  3JCM W;  2EJG A;  4M78 B;  5LJ5 d;  1Y96 A;  5GAO r;  1LNX A;  4M78 F;  5LJ5 h;  5GAO p;  1D3B B;  1WNL A;  5GAN j;  3JB9 D;  5GAM j;  4PJO D;  5GAN 4;  1B34 A;  1TH7 A;  5GAN 5;  4XTW A;  1I4K 1;  5LJ3 g;  4MML A;  5CAI A;  4M77 D;  2E10 A;  4M75 A;  1MGQ A;  4N0A A;  2DXU A;  2YHT A;  5GAN 7;  5GMK h;  3EFR A;  3HSB A;  2I2L A; 
#chains in the Genus database with same CATH topology
 3FLG A;  3UT1 A;  2Z0W A;  1NLP C;  1X69 A;  3FEO A;  2X4W A;  4DA4 A;  1PG5 B;  2MPX C;  3VUB A;  1NPR A;  4C92 B;  1OU8 A;  3OS0 A;  1EFN A;  2DX1 A;  1NJI C;  5GMK i;  2HQX A;  4M7A B;  4RTV A;  1Q81 R;  5FW9 A;  4M78 D;  3CCQ Q;  1O75 A;  3UAT A;  2RA2 A;  1PRL C;  2R5A A;  1M9S A;  1Y96 B;  1IRE B;  3TVT A;  2GTJ A;  1N27 A;  3TRE A;  3TCJ A;  2AIR B;  2V8K A;  3MKD A;  4BB7 A;  4IUV A;  1Q7Y R;  3G71 T;  3CPW S;  4FT2 A;  2EAY A;  4JZ3 A;  4OP0 A;  4RTZ A;  1YCY A;  1GXI E;  4C0F A;  2E5K A;  4HT8 A;  5J26 A;  2KVQ G;  5M9O A;  1SF9 A;  4DQ2 A;  1YIT A;  2YWW A;  1N5Z A;  1K76 A;  5GAN e;  2XMF A;  1R8O B;  4E7J A;  2RJC A;  3RMQ A;  3SFM A;  1W2B A;  2D6F A;  4AFU C;  1CSK A;  2EYW A;  3V7S A;  1RI9 A;  2RI3 A;  1MHN A;  3CME Q;  1BIA A;  2DXB A;  4Z8A A;  1MMN A;  1WJS A;  3JCM X;  3CXC P;  3NTH A;  2O88 A;  3OW2 A;  2LX9 A;  3OMC A;  3H6Z A;  1AEY A;  3CPF A;  1WFW A;  1TSF A;  2W10 A;  3M4G A;  5KCH A;  1PWT A;  2EKH A;  3HRS A;  2VB6 A;  1NM7 A;  1Y57 A;  2O01 E;  1Q7Y U;  4N4I A;  1VQ7 A;  2F2X A;  5KYW B;  1I07 A;  3A8H B;  5GAN j;  2AT1 B;  2HSP A;  2ZPE B;  3QZ5 B;  4BD3 A;  5GAN 4;  5KE2 A;  3OYL A;  3GNG A;  4M75 A;  2JOY A;  2QA4 A;  2RNA A;  1WHG A;  2COW A;  3HSB A;  2DAQ A;  3MCA B;  4M77 C;  1M30 A;  4BDZ A;  1VQL Q;  1WJR A;  2BIV A;  2FL7 A;  4F7U G;  1ZUU A;  1VQN Q;  3NFC A;  2BE7 D;  3JB9 J;  3CC7 Q;  2A3L A;  1I5O B;  2K5F A;  3EH2 A;  4RCC A;  2F2V A;  2C0T A;  1Z9Z A;  3URG A;  4FM4 B;  1UUE A;  1K9M R;  4F14 A;  3LGF A;  4NOY A;  2CP6 A;  5GAM d;  4FSX A;  2LDM A;  5GAN h;  1QMC A;  1WJQ A;  3OYI A;  2RH2 A;  3MJX A;  2AZS A;  4C92 A;  4F04 B;  4A54 A;  4C8Q D;  4AG1 C;  1UHC A;  2DFU A;  4XU2 A;  1A0N B;  3LW5 E;  4M7A A;  3QHS A;  2DRM A;  1YI2 A;  3RNJ A;  4AFQ C;  3OYK A;  2PUK B;  1YJN A;  2XKO C;  1M5Q 1;  1H8K A;  3JCM d;  1TXQ A;  3MP8 A;  3EHR A;  1YHQ T;  2HAX A;  1YFN A;  3KFV A;  1M3B A;  3OW2 S;  1SKU B;  3BE3 A;  4M77 G;  1JJ2 P;  3QUI A;  1NYF A;  3NGP A;  3UA6 A;  1VYT A;  3E9G A;  1VQ5 A;  2LCL A;  4LXC A;  3ZL7 C;  3EGX B;  5KYY B;  2FHD A;  2RQT A;  4BY6 C;  4RTW A;  3M5A A;  4BI8 B;  3EAE A;  4NL2 A;  2RHX A;  2ZPB B;  4KH1 B;  3SEM A;  4XTU A;  3V8J A;  4J9G A;  3RMS A;  2F5T X;  3L2R A;  1VQ9 Q;  5D7U A;  1WHJ A;  5GAO p;  1QWF A;  2DA9 A;  1VQ4 Q;  3MP6 A;  4FYW B;  3VYG A;  1S72 Q;  3CCU Q;  2KSS A;  2RPN A;  4X9D A;  1WYX A;  1TUC A;  1I81 A;  4PJM A;  4JS5 A;  4N4G A;  2ED1 A;  2HKQ B;  3UF4 A;  2RI2 A;  2ZZD A;  3V8L A;  3FB9 A;  5J39 A;  4RKU E;  5FRO A;  3JCM c;  1X01 A;  2K79 A;  3OY9 A;  2M1H A;  5DY9 A;  2M0O A;  1Q7Y C;  2JT4 A;  1H3H A;  2FRW A;  2VKN A;  2CSQ A;  1LPL A;  3CBM A;  2JMC A;  1QQJ A;  2BKD N;  5IT9 E;  1ZSZ B;  2OI3 A;  4Q5W A;  1SG5 A;  4PJL A;  2AZV A;  2DZ9 A;  4C5E A;  5GAN 6;  2HBW A;  4HT9 A;  3VS7 A;  2DVJ A;  1OPK A;  2EVR A;  1JXM A;  1T0J A;  1K8A U;  3CCS Q;  3PMI A;  3QWX X;  1KG1 A;  4X9C A;  1H64 1;  1VQL T;  3MEU A;  1OX8 A;  3EFS A;  2W0Z A;  4ANJ A;  1FMK A;  2PVD B;  1JB0 E;  1G3S A;  3VKI A;  3MEV A;  4PLI A;  1UEC A;  2F69 A;  2IIM A;  2C0I A;  3CCM A;  1B34 B;  3I56 T;  2X51 A;  4NS5 A;  4M75 E;  5KCO A;  4M78 G;  1KK7 A;  3QG1 A;  1BK2 A;  1SSF A;  3KBG A;  2WSF E;  2DET A;  4KGV B;  2WSE E;  3OSS C;  5GAO n;  2E6Z A;  4AG2 C;  3C4S A;  2EQI A;  3CCR T;  1ZHI A;  1VQK A;  4JRI A;  4HCK A;  3JB9 I;  2AKL A;  1SPK A;  3H8Z A;  2YLB A;  1KJW A;  1IZ6 A;  1Q82 U;  4QKU A;  1VQ6 T;  3QDF A;  1QVG A;  2NLU A;  4AMC A;  4N0A A;  3E2U A;  4O6J A;  2YHT A;  1AWX A;  1SEM A;  2CS7 A;  4HCZ A;  2DMO A;  4L6V 5;  3I5R A;  1S1N A;  4OB3 B;  1JBM A;  4BDY A;  3JAM E;  3EGX A;  5KYY A;  1VQM T;  1BIB A;  2WAC A;  2R57 A;  5FRM A;  4KGZ B;  2OTJ Q;  2JTF A;  4C92 E;  3R6N A;  3CCL T;  1LOJ A;  1PSE A;  3ZEH A;  4M7D D;  4D6W A;  2NWM A;  5EC7 A;  1NLO C;  3TSZ A;  5GMK e;  1KD1 R;  5CCA A;  1E6G A;  1O9S A;  3CMA A;  2RM4 A;  1WXT A;  3TU4 K;  4LE9 A;  1P92 A;  3OA6 A;  4FW1 A;  1QKW A;  3EG2 A;  1VQ8 A;  4EPC A;  3UA7 A;  2DER A;  1XNI A;  1RI0 A;  3ER0 A;  3VS5 A;  5KYX B;  4J9D A;  1T3S A;  2FPF A;  1YIJ A;  2COY A;  1VQO A;  1BI0 A;  4FCY A;  4QVC A;  1MNE A;  3G6E T;  1I0C A;  2VAS A;  5GMK j;  4PJO B;  2RMO A;  1K0S A;  2K6D A;  2EQJ A;  3JCM J;  1SSH A;  3GP8 A;  4J6Y A;  3PIO A;  2RQR A;  4C8Q A;  2HNI A;  3X26 B;  1ZSZ A;  1NZ9 A;  5J3B A;  1KD1 U;  2EGE A;  1UHF A;  2K57 A;  2EPD A;  2L3Q A;  4XTZ A;  1VOM A;  3AT1 B;  3QZ9 B;  3C94 A;  3LH5 A;  3JCM b;  3GBQ A;  4ZNX A;  1QVG S;  5CO7 A;  4QW2 A;  2RJE A;  1QCF A;  4IUU A;  4E7S A;  3OS2 A;  1M2O A;  1K8A C;  1B34 A;  2BZY A;  4KH0 B;  1H92 A;  3A98 A;  2ROT A;  2E10 A;  2DK3 A;  5GMK h;  1WXB A;  7AT1 B;  3QWY A;  4RMO A;  4PJN A;  4M4Z A;  1RL2 A;  4M75 D;  3V7R A;  2A0F B;  3VYH B;  5CKD A;  3CCJ A;  2A08 A;  2I0N A;  2GF7 A;  1AZG B;  5LJ5 e;  4QQD A;  3J80 E;  2IG0 A;  3M54 A;  1NE8 A;  2O9V A;  2JTE A;  4J8O A;  2KY9 A;  5L8R E;  3PMT A;  2PNI A;  3SWN B;  3L2W A;  1G3Y A;  5GJW B;  3G71 Q;  3G1J A;  5IXF A;  1K9A A;  3CBP A;  4AFZ C;  4EMK B;  4A4G A;  1YJ9 T;  2LCC A;  5GAM e;  2QI2 A;  3VS2 A;  3CD6 A;  4E47 A;  8ATC B;  2V1Q A;  4ESR A;  1PD1 A;  2XG8 D;  5LJ5 j;  2QQ9 A;  1EZZ B;  1T3L A;  2NUP A;  2VYT A;  4HKE A;  4C92 D;  2YT6 A;  3JCM e;  2COZ A;  2V26 A;  4LD6 A;  2DNU A;  4M7A D;  1OUL A;  2H8H A;  5L23 A;  2JM8 A;  2E3H A;  2D8J A;  2GQI A;  1YJW T;  4AFS C;  3PVQ A;  1WPY A;  1M3A A;  3L42 A;  4J6X A;  1M1K U;  5FWB A;  5GAN g;  3VRY A;  3RKW A;  2QGG A;  2AHJ B;  2D0Q B;  4PJO A;  2E6N A;  3GOX A;  2DZC A;  1K4U S;  2MYS A;  2L3R A;  4HVU A;  2SEM A;  1LNX A;  4M78 F;  5LJ5 h;  1AOJ A;  4KUL A;  1YJW A;  2B8A A;  2QAS A;  4TVR A;  4Z89 A;  2H3J A;  4B9X A;  1QVF A;  5CR2 A;  2DXU A;  1VQP T;  2YUN A;  1D1B A;  1ZBX A;  4CC4 B;  4C0Z A;  2CSI A;  2BZ8 A;  1IB8 A;  5IHK A;  2JTM A;  4F7U B;  2YRC A;  3CC4 T;  4Y28 E;  2VVK A;  4ATO A;  1QP2 A;  4XTX A;  5I2M A;  1KD1 C;  5I11 A;  1ZX6 A;  3RKX A;  4OMF B;  3RES A;  4FU6 A;  2CRE A;  4J9B A;  3OYJ A;  4YTL A;  2YUP A;  3A8G B;  3G4S A;  1D0Y A;  1UJY A;  1RAB B;  2HMA A;  3U23 A;  4C8Q E;  4M7D A;  1U5S A;  1UGR B;  3QXE B;  4OGC A;  1B7T A;  2XHC A;  3S6W A;  1PRM C;  4ZN3 A;  4C0D C;  1YHQ Q;  5FU7 C;  2PU9 B;  1UFF A;  5LJ3 e;  1QP3 A;  4PFZ A;  1YP5 A;  4GLM A;  1RLQ C;  3EHQ A;  4EMG A;  4CC3 A;  3SWN A;  3WXM B;  1R77 A;  4X1V A;  2Y90 A;  3OS1 A;  4M77 B;  3HFN A;  1Q86 U;  4EMK A;  3EH1 A;  2GGR A;  2DEU A;  4J7I A;  2EKO A;  1AVZ C;  1YIT T;  5GAO l;  1RAA B;  2E5Q A;  1FYN A;  1BI1 A;  4XQ3 A;  2J6F A;  3T9N A;  2QEX A;  3FJP A;  5CKE A;  2EBP A;  3BY7 A;  2ZPF B;  4F17 A;  4BI4 A;  2ABL A;  4B6M A;  2KRM A;  4P5N A;  5LJ3 j;  3M4Y A;  4Z88 A;  2QQA A;  5IHI A;  1NEG A;  2X35 A;  1QVF S;  2K5L A;  1UG1 A;  1TS9 A;  3E9F A;  4LUD A;  4QQG A;  4KBM B;  4J9E A;  3JB9 D;  1IHV A;  5GAN 5;  2K7A A;  4RTU A;  5CAI A;  1PHT A;  1VQ7 T;  1MUZ A;  3OYC A;  1X2Q A;  2ROL A;  5GAN 7;  2GTO A;  1MMD A;  3HPW A;  1W1F A;  4LUE A;  5KYU B;  1U06 A;  3CXC S;  2QA4 T;  2JZ2 A;  4FIB A;  2FO0 A;  4HCC A;  4MDX A;  4C8Q F;  4C5H A;  3GPL A;  4OMP A;  2QQR A;  2OTL T;  2O4X A;  4EDU A;  3NPF A;  5I22 A;  3VS1 A;  1RAD B;  1WHK A;  1HD3 A;  2E65 A;  3RBB B;  1M1K C;  1OZ3 A;  5LJ3 h;  1C6V X;  4JJD A;  1G83 A;  5ECA A;  2L89 A;  3CCM Q;  2OTL A;  4J83 A;  1RLP C;  4BY6 B;  5IAY A;  2NUT B;  4F7U A;  1YCS B;  2L5Q A;  3Q1J A;  1BU1 A;  5AYF A;  3LH0 A;  3UDC A;  2CP3 A;  1AWO A;  1OEB A;  2RQU A;  1X75 C;  2EIF A;  4MZM A;  4M75 G;  3I56 Q;  5GAN f;  4FYX B;  2RHY A;  2V1R A;  1AHJ B;  1MV0 B;  2FB7 A;  1AZE A;  4IIO A;  1DJ7 B;  2VXF A;  4JLI A;  3KUF A;  4WCI A;  2KNB B;  2Y4Y A;  4BI3 A;  3P8B B;  1YI2 T;  1CKA A;  4IUP A;  1YJN T;  4PKC C;  1QCN A;  3CCR Q;  5CKF A;  3LX7 A;  3CC2 A;  2BTT A;  3L2V A;  1ARK A;  3FRN A;  1OV3 A;  3CCV A;  1M1G A;  5IN1 A;  2VXE A;  2DPP B;  1QKX A;  1VQ6 Q;  2B86 A;  3X20 B;  1UGS B;  1VQ5 T;  2ZPH B;  1WIE A;  2H3E B;  2JMA A;  3EG1 A;  5GAO q;  4M77 A;  5GJV B;  1IGU A;  2RK1 A;  1Y96 A;  1VQM Q;  4FSS A;  2LVM A;  1M2V B;  2LP5 A;  2CH4 A;  1ZUK A;  1ABO A;  1WLP B;  5CKB A;  1KSW A;  1NPP A;  1W2B P;  3UPU A;  3CCL Q;  1UGQ B;  1Z9Q A;  1Q86 C;  2LJ3 A;  2RO0 A;  4M7D E;  2JNG A;  2D9T A;  4J5Y A;  4J6W A;  2J6O A;  3C95 A;  5LL6 S;  3RUX A;  1WI7 A;  1TG0 A;  3OYH A;  2VC8 A;  2LQN A;  5IXB A;  2KK4 A;  3REB B;  3I55 T;  3SB2 A;  2FZC B;  4XTV A;  2KE9 A;  4J9F A;  2RQW A;  3QSU A;  1K8A R;  2XK0 A;  3PTA A;  3JRZ A;  5KYU A;  2HZY A;  5GMK l;  1V1C A;  3P8D A;  3WVE B;  3CCQ A;  4M78 C;  2CZ0 B;  2RHZ A;  3G6E Q;  3I55 A;  2LQ8 A;  1I5L A;  4BUG A;  2VWF A;  2P84 A;  1BI2 A;  5KYW A;  3ZBD A;  2E3I A;  2BZX A;  2L3S A;  1PC0 A;  4OB0 B;  2J7I A;  2CZ1 B;  1F1B B;  2FPE A;  1VYV A;  2DLP A;  2NUT A;  2PQW A;  4IUQ A;  2KYB A;  3A8M B;  1Q82 R;  2HSE B;  1RAC B;  2EQK A;  2O9S A;  2M0Y A;  4JRP A;  3CCM T;  2KT8 A;  3INZ A;  3A5Z B;  2HBP A;  3JV3 A;  3P8H A;  2JJ9 A;  3CME A;  1FX7 A;  3A1P A;  1KQS A;  4EMH A;  4M7D F;  3EGD B;  1D1A A;  2YRD A;  4RG8 A;  1GFC A;  2JS0 A;  2KT1 A;  1UTI A;  2ZPI B;  1VQK T;  1LVK A;  2A36 A;  2FVU A;  4AT1 B;  4R56 A;  4PJO D;  4XTW A;  3FJ5 A;  1WX6 A;  4A4F A;  4QQ6 A;  3EFR A;  2K3X A;  3M57 A;  3S3O A;  4BE1 A;  1EX4 A;  3QJY A;  1FMV A;  2CZ7 B;  4F7U E;  1HSQ A;  1GCQ A;  3IQL A;  4ZTF A;  2DRK A;  4XTY A;  4IUT A;  3MHX A;  3TQ7 P;  1YJ9 Q;  4JUV A;  2DIQ A;  1XQH A;  2GNC A;  1Y0M A;  2K3Y A;  1VQN A;  2PVO B;  3CC7 A;  1JEG A;  4A53 A;  1QW1 A;  3CBO A;  2DXC A;  2LJ0 A;  1N9R A;  3CMA T;  5GAN d;  1YBY A;  1I8F A;  3RKY A;  2K9G A;  4R0K A;  1PSF A;  3OSV A;  1VQ8 T;  4ME7 A;  4QVD A;  1PNJ A;  3GIB A;  2MCN A;  2CDT A;  4M7A E;  4KGX B;  2MAM A;  1OQK A;  4JRK A;  2CUB A;  1YIJ T;  1VQO T;  1AWJ A;  2EWN A;  4C8Q C;  1YJW Q;  4FT4 A;  1ZSZ C;  2DD5 A;  4DOV A;  1ACM B;  2JN0 A;  1W70 A;  1QLY A;  1BI3 A;  1WZO A;  3PFS A;  1WGS A;  2ZAE A;  1KQS S;  2J06 A;  2EQU A;  4M75 F;  5CQX A;  1XJW B;  3BDL A;  2MF2 A;  4R55 A;  1ZA2 B;  3EG9 B;  3HFO A;  2P0P A;  2JM9 A;  2D8H A;  2GFU A;  2LT1 A;  4OVA A;  3A8O B;  2EQM A;  2PTK A;  1VQP Q;  4JJB A;  2DTI A;  2RHI A;  2QXF A;  3NHN A;  3CC4 Q;  2VGM A;  4JS4 A;  1TH7 A;  2G3R A;  4XAX B;  3H9N A;  3NTK A;  1VQ9 A;  1S72 A;  3CCU A;  1VIF A;  3SHW A;  3ZFJ A;  3M0S A;  2BE9 B;  3EGD A;  1NYG A;  1Y7X A;  4L59 A;  3D7S B;  2VV5 A;  3EFO B;  2NYS A;  4C8Q G;  2KEA A;  3CCJ T;  4V2S A;  3VS0 A;  4C92 F;  5HY6 A;  3H41 A;  4ORZ A;  3HRT A;  3OB9 A;  1JXO A;  4IKF A;  4JJN K;  5A0L A;  1ZBJ A;  4M7A F;  1B07 A;  4PFO A;  1RAH B;  1U3O A;  4FYY B;  3EG3 A;  4DOW A;  3M59 A;  3LWI A;  5A0D A;  2KXD A;  3CQT A;  5CQY A;  4LDY A;  4RTY A;  2J05 A;  4KUD K;  3GNF B;  4HXJ A;  4HA8 A;  2QQS A;  3CD6 T;  5FU6 C;  2LQW A;  2HQE A;  1YIT Q;  1YN8 A;  1X43 A;  2CP2 A;  1WA7 A;  2DL7 A;  2ESW A;  1M1F A;  1KHC A;  1IO6 A;  1OX9 A;  4E7H A;  5DLQ E;  1Q82 C;  1M1K R;  1UGV A;  1R0C B;  1EIF A;  1UB4 A;  1RAF B;  2QK0 A;  2LRQ A;  2XDP A;  3M0U A;  4OB1 B;  2CP0 A;  5CVI A;  5D6X A;  2DXT A;  1AD5 A;  1YWO A;  2DO3 A;  4RG2 A;  3SD4 A;  2MI6 A;  4DBH A;  5FWC A;  1G3W A;  1VQ7 Q;  4DEY A;  2D0N A;  2LZ6 B;  3QPH A;  2K2M A;  4CC2 A;  1M90 U;  2QYZ A;  4LDU A;  1X6O A;  2QA4 Q;  2EYX A;  2FEI A;  3GF5 A;  5GAM j;  2HD0 A;  5KYX A;  4C0D B;  4M77 D;  1D09 B;  1CKB A;  4IUR A;  2RHU A;  2OTL Q;  1GL5 A;  2MOX A;  3FC3 A;  1SRL A;  2L8D A;  4ZN1 A;  5LJ5 f;  2DJZ A;  2L0A A;  2RK2 A;  3EG9 A;  4ZGJ B;  1BB9 A;  2QAZ A;  2R5M A;  5HK0 A;  1WHH A;  2GBQ A;  3ASK A;  4KUI A;  2OTJ A;  3F70 A;  1W4S A;  2DM1 A;  5CKH A;  4M7D C;  1HK9 A;  1IRX A;  3V8K A;  4B9W A;  1FXX A;  4NL3 A;  2DTO A;  3QDR B;  4J9C A;  3PE0 A;  2JXB A;  2DL3 A;  4OML A;  5A0G A;  1Q86 R;  4PK4 A;  5KE3 A;  5GAM h;  2MWO A;  3JB9 H;  3G4S T;  2CUD A;  3HP9 A;  2EYZ A;  3CXC A;  3M9Q A;  2WSC E;  3MEW A;  1YI2 Q;  1YJN Q;  2X3W D;  2LNV A;  2M02 A;  4LDW A;  4A63 B;  4EMK C;  1K73 U;  3JCM V;  1TWB A;  5DM7 R;  2DD4 A;  4QVZ A;  3JB9 F;  4BE2 A;  1M4Z A;  4X34 A;  5HCK A;  3JCM h;  2MMP A;  3LYI A;  3QII A;  3MP1 A;  3A8L B;  1QWE A;  2RJF A;  1VQ5 Q;  2C06 A;  3OBW A;  2LCS A;  4DBF A;  3M55 A;  1C1A A;  1XTD A;  4FL6 A;  2CGH A;  3VUZ A;  3AHU A;  1TOV A;  1BCM A;  4XK8 E;  1PKS A;  2QEX T;  1OI1 A;  2BUD A;  4JZ4 A;  4M7D G;  5IH2 A;  5GAO r;  1WDX A;  4A4K A;  2HL5 C;  4OMN A;  1K0X A;  1UJ0 A;  2IVW A;  4KT0 E;  1KFZ A;  4F16 A;  2KMT A;  3ULR B;  1MV3 A;  4JLG A;  2P4T A;  3I55 Q;  3C12 A;  1FMW A;  3RR6 A;  1RAI B;  2J6K A;  2FZK B;  3PNW C;  3CPW P;  3OYY A;  4M75 C;  4E7Z A;  1MMA A;  2DL4 A;  2DEQ A;  3CEY A;  1RUW A;  2X3X D;  3EG0 A;  1KQ1 A;  3MO8 A;  1UDL A;  4VUB A;  1R0B G;  6AT1 B;  1QVF P;  2ED0 A;  4J7F A;  3PT9 A;  1M90 C;  3THK A;  1JJ2 A;  3SDZ A;  3G71 A;  2XDB A;  3VU3 C;  2KRS A;  3M53 A;  4RTT A;  1HJD A;  5LJ3 f;  3X28 B;  3I5S A;  2E1H A;  3I9Q A;  1KHI A;  2E12 A;  4K11 A;  2FPD A;  3CCE T;  2M16 A;  1Q81 U;  4BE0 A;  3M58 A;  1U1T A;  3L2U A;  3DLM A;  3O8V A;  1AWW A;  2P0K A;  2DBK A;  3HRU A;  3JCM P;  2RN8 A;  1J3T A;  2P0Q A;  4CC7 A;  3VS3 A;  5EG2 A;  2XI9 A;  1KC8 R;  3MET A;  4C92 C;  2F5K A;  3CCE A;  3TSW A;  1VIE A;  4ELZ C;  1V29 B;  3V7C A;  3OYA A;  2KRN A;  4M7A C;  3C0C A;  1BCO A;  3CC2 T;  3HHT B;  3J81 E;  1VQK Q;  3L1A A;  3CCV T;  4RUG A;  3LLR A;  1T0H A;  3H0H A;  4PJO E;  4ZGD B;  1AT1 B;  3NMZ C;  2JUF A;  4HVW A;  2L2P A;  2E64 A;  2YUO A;  2KYM A;  2MIO A;  2EJG A;  4M78 B;  1ZSG A;  4KRT A;  3OMG A;  5LJ5 d;  3H0I A;  3REA B;  1V76 A;  1K73 C;  1MGQ A;  1N8R R;  3JCM W;  1ZUY A;  4MMK A;  5C6S A;  1NEB A;  1U1S A;  1Q95 G;  1KC8 U;  1UEB A;  1VUB A;  1VA7 A;  4JDS A;  3J7A F;  2EYY A;  4PL6 A;  5GAN 2;  1SRM A;  2KXC A;  2F1L A;  2XID A;  3RDV A;  2VGN A;  3CMA Q;  4CRI A;  1RAE B;  3X24 B;  1JJ2 S;  4C92 G;  2F2W A;  2OAU A;  5HK3 A;  2KR3 A;  4PJJ A;  3QJ6 A;  2Y4X A;  3FIF A;  1G5V A;  1W2B S;  1VQ8 Q;  4PLL A;  4M7A G;  3DB3 A;  2QG9 B;  1OZ2 A;  3OYM A;  2ZCF B;  3VV0 A;  4DBQ A;  3PIP A;  3OW2 P;  2PZ1 A;  2KQW A;  2V8I A;  2KDS A;  9ATC B;  2KAF A;  2K2V A;  2KRO A;  1YIJ Q;  3M56 A;  2MK5 A;  1VQO Q;  4MDW A;  4A4H A;  1H3Z A;  2EYQ A;  4Y91 A;  8AT1 B;  2A28 A;  3CCQ T;  5D6W A;  1N8R U;  1I1J A;  3VS6 A;  2YXY A;  4LNP A;  3LWH A;  3WVD B;  5FLX E;  1YHQ A;  2E41 A;  1K9M U;  3OYB A;  3HKS A;  1MMG A;  1PD0 A;  1RAG B;  2QTX A;  3L2Q A;  4E7L A;  2G6F X;  2IPO B;  4PJO F;  2CT3 A;  3RER A;  3I35 A;  1N9S A;  1X6G A;  3O5Z A;  2OAW A;  4Z02 A;  1ZLM A;  3OYG A;  2VUB A;  3OS5 A;  2M51 A;  2JVV A;  1WHL A;  4LD9 K;  2OX7 A;  1OYX A;  4A4E A;  1X6B A;  3CME T;  4HCB A;  2ENM A;  1Q81 C;  4LDX A;  4L5G A;  2RJD A;  1WNL A;  1GCP A;  3ME9 A;  1D0Z A;  1TUG B;  2K3B A;  2YUQ A;  3M0P A;  2YSQ A;  3OYN A;  2GCX A;  3CCJ Q;  1GCQ C;  2DYI A;  1PKT A;  2QDL A;  2CT4 A;  1OU9 A;  4C8Q B;  4D8K A;  2LMJ A;  1JU5 C;  2DKG A;  4PNO A;  2DTH A;  2RI5 A;  2A7Y A;  3JSC A;  4M78 A;  4N0A C;  2FG0 A;  3M0T A;  4MZP A;  3HL8 A;  4QT7 A;  5KH6 A;  2DVE A;  1ABQ A;  5LJ3 d;  2PUO B;  3G7Z A;  2DL5 A;  2EJ9 A;  1KQ2 A;  1BYM A;  1E7O A;  3CD6 Q;  1WQ7 A;  2HKN A;  4O5V A;  1VQN T;  2HQH A;  2XIC A;  3CC7 T;  4ZTJ A;  4BAC A;  4OMO A;  2FYK A;  1WQW A;  1VQL A;  4XU0 A;  5AT1 B;  2K4Y A;  2LT4 A;  1M2V A;  1M8V A;  3S3M A;  1QCO A;  1YWP A;  1UGP B;  2AKK A;  1KC8 C;  2KBT A;  3QBY A;  3QYH B;  5IHN A;  3I56 A;  5LJ5 g;  3JB9 G;  1GRI A;  4J9I A;  1K1Z A;  2EGC A;  2LQK A;  2XDD A;  4GLK A;  2GFA A;  3OYF A;  2R58 A;  1GBQ A;  2CH4 W;  3E1S A;  4C5I A;  5DLO A;  2YLC A;  4OMQ A;  5GAN 8;  3CCR A;  2GQV A;  2L3P A;  2LTO A;  2YRV A;  3KXT A;  2EW3 A;  2LNH B;  5GAM g;  4M77 E;  2RQV A;  1VQ6 A;  2EGA A;  2D1X A;  5GAN 3;  5CIU A;  3GLX A;  4II1 A;  3OQ5 A;  2JS2 A;  4OB2 B;  1N8R C;  4FW2 A;  1D3B B;  2ECZ A;  2ZPG B;  3LGL A;  4GBQ A;  1I4K 1;  2LX7 A;  2NUP B;  2KGT A;  2M9U A;  1K9M C;  4E6R A;  4ZGE B;  1VQM A;  5FU6 B;  1B3Q A;  1IXD A;  2HEQ A;  2HL3 A;  3HTR A;  3JCM g;  1VQ9 T;  1VQ4 T;  3CCL A;  4F7U F;  1LCK A;  4XU1 A;  5GAO m;  1JO8 A;  1S72 T;  1KQS P;  3CCU T;  4PFP A;  3DB4 A;  2AK5 A;  3N5B B;  4FYV B;  3JCM Q;  4LN2 A;  3L2Z A;  2O31 A;  3G4S Q;  1X2K A;  2FRY A;  2NUZ A;  1VQ4 A;  1LJO A;  1NJI R;  2CYZ B;  2QGF B;  1BKB A;  1U8R A;  3OYE A;  1MND A;  2HDA A;  2X4J A;  1UE9 A;  3BDU A;  2DBM A;  2DE0 X;  3VRZ A;  2JW4 A;  2XU8 A;  1HYO A;  4ELY C;  2V8J A;  2LC4 A;  3M0Q A;  4WF2 A;  5HKC A;  1Y71 A;  3G6E A;  1C0M A;  4XU3 A;  1G8X A;  1Y07 A;  3E19 A;  4C5G A;  2QTV A;  2X4X A;  2A37 A;  1QVG P;  2E4H A;  2DL8 A;  1VYU A;  4JPB W;  4WTO B;  4E7I A;  2KI7 A;  2RD1 A;  4E2F B;  1GFD A;  4M77 F;  2QEX Q;  3CCS T;  1NBE B;  1M90 R;  1NG2 A;  3QYG B;  1D0X A;  3S3N A;  3M0R A;  3PVL A;  1NJI U;  3BFM A;  1E6H A;  4UC4 A;  4M7D B;  5A2Q E;  2DJQ A;  2K5I A;  2YDL A;  3NTI A;  3MEA A;  3CCS A;  1M27 C;  4M78 E;  2FZG B;  2DIG A;  2PVG B;  1OOT A;  1ZQ1 A;  1OPL A;  5LJ3 g;  4MML A;  2HCK A;  4PJO C;  1N6A A;  2LJ1 A;  1PM3 A;  2O2O A;  3BW1 A;  1WXU A;  4OF1 A;  3OYD A;  4C0G A;  2ZGW A;  3QO3 A;  1SHG A;  5D6Y A;  2CP5 A;  4HVV A;  3FDR A;  5I21 A;  1TTH B;  3VS4 A;  1D1C A;  3VJP A;  2CKK A;  1JRI A;  1D3B A;  1ZA1 B;  1XOV A;  5FU7 B;  1YJ9 A;  1WHM A;  5C0M A;  4CI0 C;  2OTJ T;  2RB6 A;  3CCE Q;  1K73 R;  3EGU A;  2QDY B;  1X27 A;  2CP7 A;  4GY5 A;  3RIR A;  3TEE A;  4MZT A;  4OMM A;  2XD0 A;  3DKM A;  2C0O A;  3R6O A;  4Y92 A;  3QKJ A;  2DF6 A;  2DYB A;  1G3T A;  5CK9 A;  3UWN A;  4IIM A;  5GAM f;  4JRQ A;  1SHF A;  4D8D A;  2ATC B;  1GBR A;  3CPW A;  1IHW A;  1HXD A;  1G2B A;  2SRC A;  3CC2 Q;  1BBZ A;  3PGG A;  2O4X B;  3CCV Q;  2OJ2 A;  2DIL A;  4PJO G;  5I2S A;  4OGE A;  3X25 B;  4E7K A;  2QQB A;  4M75 B;  2EJF A;  1KIK A;  3DLL A;  3EFO A;  4RTX A;  3SWN C;  1TUD A;  2X4Y A;  2CZ6 B;  3JCM f;  1PCX A;  5KYN A;  2MWP A;  4DBR A;  1YNZ A;  2P4R A;  4JJC A;  5GMK m;  1FWZ A;  1IGQ A;  3OBY A;  4J9H A;  3H0F A;  4RCB A;  1M3C A;  4DEX A;  1M8M A;  4EIK A;  1TU0 B;  3MPU B;  1W6X A;  2RF0 A;  4LDV A;  1VQP A;  5FRN A;  2X9H A;  1JQQ A;  2EFI A;  2E70 A;  4N4H A;  1QVP A;  3CC4 A;  2I2L A; 
#chains in the Genus database with same CATH homology
 3M57 A;  3FLG A;  4MMK A;  3UT1 A;  3S3O A;  5C6S A;  4BE1 A;  3QJY A;  2CZ7 B;  4F7U E;  1RL2 A;  3FEO A;  1U1S A;  2X4W A;  4M75 D;  3V7R A;  1KC8 U;  1UEB A;  1VUB A;  4DA4 A;  4JDS A;  3VYH B;  5CKD A;  3J7A F;  3CCJ A;  4PL6 A;  5GAN 2;  3VUB A;  4XTY A;  4ZTF A;  4IUT A;  3MHX A;  2GF7 A;  5LJ5 e;  4QQD A;  1NPR A;  4C92 B;  3J80 E;  2IG0 A;  4JUV A;  3M54 A;  2DIQ A;  3OS0 A;  2XID A;  1YJW A;  1NJI C;  2VGN A;  1NE8 A;  4CRI A;  5GMK i;  2HQX A;  3X24 B;  1XQH A;  1JJ2 S;  4C92 G;  4J8O A;  4M7A B;  2KY9 A;  2OAU A;  5HK3 A;  5L8R E;  3PMT A;  3SWN B;  2K3Y A;  3L2W A;  3QJ6 A;  2Y4X A;  2PVO B;  1G3Y A;  4M78 D;  1VQN A;  3FIF A;  3CC7 A;  1O75 A;  1G5V A;  1W2B S;  2RA2 A;  1QW1 A;  4A53 A;  3CBP A;  3CBO A;  4PLL A;  3DB3 A;  4EMK B;  2DXC A;  1OZ2 A;  4A4G A;  3OYM A;  2ZCF B;  4M7A G;  1YJ9 T;  3VV0 A;  3PIP A;  2LCC A;  1N9R A;  2R5A A;  1M9S A;  2KQW A;  5GAM e;  1Y96 B;  2V8I A;  2KDS A;  2QI2 A;  1YBY A;  5GAN d;  1IRE B;  3CMA T;  1I8F A;  2KAF A;  2K2V A;  3RKY A;  4E47 A;  3CD6 A;  3M56 A;  1N27 A;  4MDW A;  3TRE A;  4A4H A;  3TCJ A;  1H3Z A;  2V8K A;  4BB7 A;  2EYQ A;  4IUV A;  4Y91 A;  3G71 T;  3CCQ T;  1PSF A;  3CPW S;  3OSV A;  1VQ8 T;  4ME7 A;  4FT2 A;  2XG8 D;  5D6W A;  4QVD A;  1N8R U;  2EAY A;  5LJ5 j;  2QQ9 A;  3GIB A;  4M7A E;  4OP0 A;  1YCY A;  1GXI E;  4C0F A;  4HT8 A;  2MAM A;  5J26 A;  2KVQ G;  3WVD B;  5FLX E;  5M9O A;  2VYT A;  3LWH A;  4HKE A;  4JRK A;  1YHQ A;  2E41 A;  1YIJ T;  1K9M U;  4C92 D;  4DQ2 A;  3OYB A;  1VQO T;  3HKS A;  2EWN A;  4C8Q C;  2QTX A;  1YIT A;  3L2Q A;  4E7L A;  4PJO F;  3JCM e;  4LD6 A;  4FT4 A;  3RER A;  5GAN e;  2DD5 A;  1N9S A;  4DOV A;  4M7A D;  1R8O B;  4E7J A;  2RJC A;  2JN0 A;  4Z02 A;  3RMQ A;  3SFM A;  1W2B A;  2D6F A;  1BI3 A;  3OYG A;  2VUB A;  3PFS A;  3OS5 A;  1WGS A;  3V7S A;  2RI3 A;  1KQS S;  1MHN A;  2EQU A;  4M75 F;  1BIA A;  5CQX A;  3BDL A;  2DXB A;  2JVV A;  1YJW T;  2MF2 A;  1WJS A;  3JCM X;  4R55 A;  3NTH A;  1WPY A;  4LD9 K;  3OW2 A;  2LX9 A;  3OMC A;  3L42 A;  4J6X A;  3H6Z A;  1OYX A;  3CPF A;  1M1K U;  5GAN g;  3HFO A;  3RKW A;  2P0P A;  2LT1 A;  2GFU A;  4OVA A;  4A4E A;  2AHJ B;  2D0Q B;  3M4G A;  3A8O B;  2EQM A;  5KCH A;  4PJO A;  2E6N A;  3HRS A;  3GOX A;  2DZC A;  3JCM W;  2DTI A;  2RHI A;  3CME T;  2O01 E;  2L3R A;  1Q7Y U;  4HCB A;  2QXF A;  4N4I A;  1Q81 C;  1VQ7 A;  4LDX A;  4L5G A;  1LNX A;  4M78 F;  5LJ5 h;  2RJD A;  4KUL A;  1WNL A;  2VGM A;  2B8A A;  2ZPE B;  3A8H B;  3QZ5 B;  4TVR A;  4BD3 A;  5GAN 4;  1TH7 A;  2H3J A;  3ME9 A;  2G3R A;  5KE2 A;  4XAX B;  4B9X A;  3OYL A;  1QVF A;  3GNG A;  4M75 A;  5CR2 A;  3NTK A;  2JOY A;  1VQ9 A;  2DXU A;  2QA4 A;  1VQP T;  3OYN A;  2GCX A;  1ZBX A;  3HSB A;  4C0Z A;  1S72 A;  2DAQ A;  3CCU A;  3MCA B;  4M77 C;  1VIF A;  2JTM A;  3ZFJ A;  4F7U B;  3CC4 T;  4Y28 E;  4BDZ A;  4C8Q B;  5GAN j;  4ATO A;  1QP2 A;  4XTX A;  5I2M A;  1WJR A;  2BIV A;  2DKG A;  1Y7X A;  4PNO A;  2FL7 A;  1KD1 C;  4L59 A;  4F7U G;  2VV5 A;  2DTH A;  2RI5 A;  3RKX A;  4C8Q G;  4OMF B;  2A7Y A;  3JSC A;  4M78 A;  4N0A C;  3RES A;  3NFC A;  3CCJ T;  4C92 F;  5HY6 A;  4V2S A;  3JB9 J;  4MZP A;  2A3L A;  3HRT A;  3OB9 A;  3HL8 A;  2K5F A;  5KH6 A;  2DVE A;  5LJ3 d;  4IKF A;  4JJN K;  4FU6 A;  3OYJ A;  2PUO B;  3G7Z A;  5A0L A;  4M7A F;  2EJ9 A;  4YTL A;  1KQ2 A;  1BYM A;  4RCC A;  1WQ7 A;  4DOW A;  3A8G B;  4O5V A;  3M59 A;  3G4S A;  3LWI A;  3URG A;  4FM4 B;  1VQN T;  5A0D A;  4M7D A;  4C8Q E;  2XIC A;  3LGF A;  4NOY A;  3CC7 T;  5GAM d;  1UGR B;  4FSX A;  4ZTJ A;  2LDM A;  5GAN h;  3QXE B;  5CQY A;  4BAC A;  4LDY A;  3OYI A;  1WJQ A;  4OGC A;  4KUD K;  3GNF B;  2RH2 A;  2XHC A;  3S6W A;  4HA8 A;  4ZN3 A;  2QQS A;  4C0D C;  2FYK A;  4C92 A;  3CD6 T;  1WQW A;  1VQL A;  4XU0 A;  5FU7 C;  2PU9 B;  2K4Y A;  2LT4 A;  5FU6 C;  4A54 A;  4C8Q D;  5LJ3 e;  1QP3 A;  2HQE A;  1M8V A;  3S3M A;  4XU2 A;  3LW5 E;  1UGP B;  4EMG A;  3QHS A;  1KC8 C;  4M7A A;  1M1F A;  1YI2 A;  3SWN A;  3WXM B;  3QBY A;  3OYK A;  1YJN A;  2PUK B;  2Y90 A;  2XKO C;  3OS1 A;  1KHC A;  3QYH B;  4E7H A;  1KG1 A;  4M77 B;  1M5Q 1;  3HFN A;  5DLQ E;  4EMK A;  3I56 A;  3JCM d;  1Q82 C;  1Q86 U;  3MP8 A;  1YHQ T;  2HAX A;  4J7I A;  5LJ5 g;  3JB9 G;  1EIF A;  1UB4 A;  2EKO A;  3OW2 S;  1YIT T;  5GAO l;  2LQK A;  4M77 G;  2XDD A;  3QUI A;  2E5Q A;  2LRQ A;  2XDP A;  4GLK A;  4OB1 B;  2GFA A;  3OYF A;  1BI1 A;  2R58 A;  4XQ3 A;  5CVI A;  5D6X A;  2DXT A;  3T9N A;  2QEX A;  3E1S A;  3FJP A;  2DO3 A;  2YLC A;  3E9G A;  5CKE A;  2LCL A;  3BY7 A;  2ZPF B;  4C5I A;  2GQV A;  4RG2 A;  3SD4 A;  3CCR A;  1VQ5 A;  2LTO A;  2YRV A;  2MI6 A;  4BI4 A;  3KXT A;  4P5N A;  5LJ3 j;  2FHD A;  1G3W A;  3M4Y A;  4BY6 C;  5GAM g;  2QQA A;  3M5A A;  4BI8 B;  2X35 A;  3EAE A;  4M77 E;  1VQ6 A;  4NL2 A;  3QPH A;  1QVF S;  2K5L A;  2RHX A;  2ZPB B;  3GLX A;  5CIU A;  4XTU A;  3V8J A;  3E9F A;  5GAN 3;  4II1 A;  3OQ5 A;  3RMS A;  2F5T X;  1M90 U;  4OB2 B;  4LDU A;  3L2R A;  1N8R C;  1X6O A;  4QQG A;  4KBM B;  5GAO p;  1D3B B;  2ZPG B;  3GF5 A;  3LGL A;  5GAM j;  3JB9 D;  3CC4 A;  3MP6 A;  2HD0 A;  5GAN 5;  1I4K 1;  3VYG A;  4C0D B;  5CAI A;  5GAN 8;  4M77 D;  1VQ7 T;  2KSS A;  3OYC A;  2M9U A;  1K9M C;  4IUR A;  4ZGE B;  2RHU A;  1VQM A;  5FU6 B;  5GAN 7;  3FC3 A;  3HPW A;  4X9D A;  2L8D A;  1I81 A;  4ZN1 A;  5LJ5 f;  3JCM g;  1VQ9 T;  3CXC S;  2QA4 T;  2DJZ A;  2JZ2 A;  1VQ4 T;  2RK2 A;  4FIB A;  3CCL A;  4F7U F;  4ZGJ B;  4HCC A;  4XU1 A;  5GAO m;  4JS5 A;  1S72 T;  4C8Q F;  4C5H A;  2R5M A;  4N4G A;  5HK0 A;  3DB4 A;  3GPL A;  3CCU T;  4MDX A;  2QQR A;  2OTL T;  2O4X A;  2RI2 A;  2ZZD A;  3N5B B;  3V8L A;  4EDU A;  3JCM Q;  3ASK A;  3FB9 A;  5J39 A;  4KUI A;  3L2Z A;  4RKU E;  2OTJ A;  3F70 A;  1W4S A;  2E65 A;  1M1K C;  1OZ3 A;  5FRO A;  5LJ3 h;  5CKH A;  4M7D C;  3JCM c;  1X01 A;  1HK9 A;  1VQ4 A;  1LJO A;  3OY9 A;  2L89 A;  2CYZ B;  1BKB A;  2M1H A;  3V8K A;  4B9W A;  5DY9 A;  1U8R A;  1FXX A;  2M0O A;  3OYE A;  4NL3 A;  1Q7Y C;  2OTL A;  2DTO A;  4J83 A;  4BY6 B;  3QDR B;  5IAY A;  2X4J A;  4F7U A;  3CBM A;  5IT9 E;  2BKD N;  5A0G A;  2L5Q A;  5KE3 A;  3Q1J A;  2MWO A;  3BDU A;  5GAM h;  3G4S T;  3JB9 H;  5AYF A;  3LH0 A;  3UDC A;  2XU8 A;  4Q5W A;  4ELY C;  2V8J A;  3HP9 A;  2LC4 A;  3CXC A;  3M9Q A;  2WSC E;  4WF2 A;  3MEW A;  2DZ9 A;  4C5E A;  5GAN 6;  1Y71 A;  5HKC A;  3G6E A;  4HT9 A;  1X75 C;  2EIF A;  4XU3 A;  5DLO A;  4MZM A;  4M75 G;  1K8A U;  1Y07 A;  2LNV A;  4LDW A;  3E19 A;  3PMI A;  4EMK C;  5GAN f;  3JCM V;  4X9C A;  4C5G A;  1K73 U;  1H64 1;  2RHY A;  2X4X A;  3MEU A;  1VQL T;  5DM7 R;  1AHJ B;  2FB7 A;  3EFS A;  2DD4 A;  1DJ7 B;  4E7I A;  2VXF A;  4QVZ A;  3JB9 F;  4JLI A;  3KUF A;  2PVD B;  2RD1 A;  1JB0 E;  1G3S A;  3VKI A;  2Y4Y A;  3MEV A;  4BI3 A;  1M4Z A;  3P8B B;  4PLI A;  4M77 F;  4X34 A;  4BE2 A;  4IUP A;  3JCM h;  1YI2 T;  2MMP A;  3LYI A;  1YJN T;  4PKC C;  3QII A;  3MP1 A;  3A8L B;  2RJF A;  2F69 A;  3CCM A;  3CCS T;  1B34 B;  5CKF A;  3LX7 A;  4NS5 A;  3I56 T;  2C06 A;  3CC2 A;  3L2V A;  4M75 E;  3OBW A;  5KCO A;  3FRN A;  3CCV A;  4M78 G;  3QG1 A;  3M55 A;  1SSF A;  1M1G A;  3KBG A;  2WSF E;  3QYG B;  5IN1 A;  1XTD A;  4FL6 A;  2VXE A;  3S3N A;  2CGH A;  3VUZ A;  2WSE E;  2DPP B;  1NJI U;  3OSS C;  5GAO n;  3BFM A;  2E6Z A;  3AHU A;  4XK8 E;  4UC4 A;  4M7D B;  2QEX T;  3X20 B;  1OI1 A;  1UGS B;  2BUD A;  3C4S A;  3CCR T;  1VQ5 T;  5A2Q E;  2ZPH B;  1ZHI A;  2K5I A;  1VQK A;  4JRI A;  3NTI A;  3MEA A;  3JB9 I;  3CCS A;  4JS4 A;  4M7D G;  3H8Z A;  5GAO q;  2YLB A;  4M77 A;  4M78 E;  2RK1 A;  1IZ6 A;  1Q82 U;  1Y96 A;  2DIG A;  5GAO r;  1VQ6 T;  2LVM A;  4A4K A;  2PVG B;  1ZQ1 A;  5LJ3 g;  2IVW A;  4MML A;  5CKB A;  1QVG A;  1NPP A;  4KT0 E;  2NLU A;  4N0A A;  4O6J A;  2YHT A;  3UPU A;  2CS7 A;  4HCZ A;  4L6V 5;  2KMT A;  1UGQ B;  1Q86 C;  4OB3 B;  4PJO C;  2RO0 A;  1JBM A;  1N6A A;  4M7D E;  4BDY A;  2JNG A;  4JLG A;  2D9T A;  4J5Y A;  2P4T A;  3JAM E;  1VQM T;  4J6W A;  1BIB A;  3BW1 A;  2WAC A;  3C95 A;  4OF1 A;  3C12 A;  4C0G A;  5LL6 S;  3RUX A;  3OYD A;  2ZGW A;  2R57 A;  3QO3 A;  2VC8 A;  5D6Y A;  3OYH A;  3PNW C;  5FRM A;  2JTF A;  4C92 E;  3FDR A;  3OYY A;  4M75 C;  5I21 A;  3CCL T;  1LOJ A;  1PSE A;  2DEQ A;  3ZEH A;  3CEY A;  4D6W A;  4M7D D;  3VJP A;  2KK4 A;  2CKK A;  1JRI A;  1D3B A;  3I55 T;  5GMK e;  1KQ1 A;  1XOV A;  3MO8 A;  4VUB A;  3SB2 A;  5CCA A;  5FU7 B;  1YJ9 A;  4XTV A;  1O9S A;  5C0M A;  3CMA A;  2RM4 A;  4CI0 C;  3QSU A;  2OTJ T;  2RB6 A;  2XK0 A;  3JRZ A;  4J7F A;  3PTA A;  3TU4 K;  1P92 A;  3PT9 A;  5GMK l;  3OA6 A;  3P8D A;  1M90 C;  3WVE B;  1JJ2 A;  2QDY B;  3SDZ A;  3G71 A;  3CCQ A;  2XDB A;  4M78 C;  2CZ0 B;  2RHZ A;  3VU3 C;  1VQ8 A;  4EPC A;  3M53 A;  4GY5 A;  3RIR A;  3TEE A;  4MZT A;  1XNI A;  5LJ3 f;  3X28 B;  1RI0 A;  3ER0 A;  3I55 A;  2LQ8 A;  2E1H A;  1I5L A;  2XD0 A;  4BUG A;  1KHI A;  2E12 A;  3DKM A;  3R6O A;  3QKJ A;  3CCE T;  2M16 A;  1BI2 A;  4BE0 A;  1Q81 U;  1G3T A;  1YIJ A;  3M58 A;  3ZBD A;  1VQO A;  1BI0 A;  3UWN A;  4QVC A;  5CK9 A;  1U1T A;  3L2U A;  3DLM A;  3O8V A;  2P0K A;  5GAM f;  4JRQ A;  3HRU A;  3G6E T;  5GMK j;  3JCM P;  4PJO B;  4OB0 B;  3CPW A;  1HXD A;  2EQJ A;  2P0Q A;  3PGG A;  2O4X B;  2CZ1 B;  3JCM J;  5EG2 A;  2XI9 A;  3GP8 A;  4J6Y A;  4PJO G;  3MET A;  5I2S A;  3PIO A;  4C92 C;  2F5K A;  3CCE A;  4C8Q A;  2HNI A;  4OGE A;  1VIE A;  2PQW A;  3X25 B;  4E7K A;  4ELZ C;  4IUQ A;  1V29 B;  3V7C A;  3A8M B;  3X26 B;  2QQB A;  3OYA A;  1NZ9 A;  4M75 B;  2EJF A;  5J3B A;  1KD1 U;  3DLL A;  4M7A C;  2EQK A;  2K57 A;  4JRP A;  3CCM T;  3SWN C;  3CC2 T;  3HHT B;  3INZ A;  3J81 E;  3A5Z B;  2X4Y A;  2HBP A;  2CZ6 B;  3L1A A;  4XTZ A;  3JCM f;  3CCV T;  3QZ9 B;  3LLR A;  2MWP A;  3P8H A;  3CME A;  5GMK m;  1FWZ A;  1FX7 A;  4PJO E;  3C94 A;  3JCM b;  1KQS A;  4EMH A;  4M7D F;  4ZGD B;  3OBY A;  4RG8 A;  4RCB A;  2JUF A;  1QVG S;  5CO7 A;  2E64 A;  4QW2 A;  2EJG A;  4M78 B;  2RJE A;  3OMG A;  5LJ5 d;  2ZPI B;  1VQK T;  4IUU A;  4LDV A;  1VQP A;  3OS2 A;  5FRN A;  2FVU A;  4R56 A;  1K8A C;  4PJO D;  1B34 A;  2EFI A;  4XTW A;  1K73 C;  4A4F A;  2E10 A;  2DK3 A;  1MGQ A;  2E70 A;  4N4H A;  1QVP A;  4QQ6 A;  5GMK h;  3EFR A;  2K3X A;  4RMO A;  2I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...