2RM4A

Solution structure of the lsm domain of dm edc3 (enhancer of decapping 3)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
GAMGPTDQDWIGCAVSIACDEVLGVFQGLIKQISAEEITIVRAFRNGVPLRKQNAEVVLKCTDIRSIDLIEPAKQDLDGHTAPPPVVNKPTPVKLPHFSNILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A divergent Sm fold in EDC3 proteins mediates DCP1 binding and P-body targeting
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
molecule keywords CG6311-PB
total genus 9
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rm4A01
2RB6A 4M78C 4M78B 2Y90A 2ZGWA 4C8QA 4JRIA 4XU2A 2VXEA 5GMKl 5GANe 4QVDA 2DJZA 1KQ1A 2E41A 4M78A 4F7UB 4JRKA 3JCMQ 5GAMh 4M7AG 4PJOA 3V8LA 1HK9A 3HFNA 3FB9A 2DTOA 4C8QE 3JCMh 5GAN8 2VC8A 4XTXA 3JB9D 3RUXA 3JCMX 5LJ5j 2RD1A 5GAN4 4M7AD 2EWNA 4M7AF 1H641 5LJ5d 4PJOE 3V7RA 1D3BB 4RCBA 2FYKA 4EMHA 4F7UE 4M7DF 4XU1A 3QO3A 4C92D 5GMKe 5GANf 3BDUA 4PJOB 4HT8A 3JCMb 2E65A 1B34B 2YHTA 4J6WA 4M75F 1BIBA 5GAMj 5GAMe 5LJ3f 3L2ZA 1WPYA 2K57A 3RKWA 3JB9G 2E64A 1U1TA 2EJGA 3SWNC 4F7UF 1Y96A 5CAIA 4NL2A 4C92G 4F7UA 3JB9J 5GAN6 1M8VA 2FB7A 4C8QC 2QTXA 5GAOn 4MMLA 2DXUA 4XQ3A 1TH7A 2RM4A 5GMKm 5GANh 4V2SA 4M75C 4J6XA 3JCMd 1Y96B 4C8QF 5LJ3j 4C8QD 5LJ3e 4WF2A 5GAMf 3JB9F 4M7DC 2YLBA 3RERA 5DY9A 4OP0A 4J6YA 2RA2A 2JN0A 4XTVA 1LOJA 5GAN3 4N0AA 2E10A 5GAMg 5GANj 4M7AC 2DXTA 4M75A 2EJFA 3FIFA 5GMKi 3AHUA 2DKGA 1MGQA 4EMGA 4X9DA 1I5LA 3V7CA 4C8QG 1N9RA 4EMKB 4N0AC 1BIAA 5LJ5f 3FJPA 4M75B 3HFOA 1I8FA 4DQ2A 1B34A 1LNXA 1I4K1 2EJ9A 3EFSA 2I2LA 4X9CA 4C92E 4M75E 5LJ3g 4M7DB 4M7DG 4EMKA 1WQ7A 4C8QB 4HT9A 2DTHA 4MMKA 3QHSA 4M7AB 2E1HA 5GAOp 4M77B 3V7SA 4M78G 4C92B 4M7DE 4PJOG 3V8JA 5GMKj 4XTUA 3SWNA 3V8KA 4M7AE 4XTWA 4NOYA 1JRIA 4JUVA 3SWNB 4A54A 3BW1A 4C92A 4F7UG 4M77D 3RKYA 4M77G 3EFRA 4M78D 4RCCA 4M7DD 1U1SA 4PJOD 4PJOF 4JLIA 4M7DA 5LJ5g 3QUIA 3PGGA 1WNLA 4M77E 3RESA 4C92C 2DZ9A 5GAMd 1JBMA 4M7AA 4PNOA 5I21A 1WQWA 2DTIA 5GANg 4PJOC 4XU3A 5GAN2 4J5YA 3BFMA 4A53A 2HNIA 5LJ5e 3BY7A 4M77F 3JCMg 4QVCA 5GAOr 1M5Q1 1X01A 3INZA 3RIRA 3JCMf 5LJ5h 4Y91A 5GAN5 4NL3A 5GAOm 4HA8A 4M77A 3SB2A 1LJOA 2DVEA 3JCMe 2EAYA 3JCMP 5LJ3d 3JCMV 4M75D 3L1AA 4EMKC 3VU3C 3JCMJ 5GAOq 3JCMc 1KQ2A 1HXDA 3JCMW 2YLCA 4M75G 4M77C 3QSUA 5GMKh 3RKXA 1N9SA 2CGHA 4XTYA 4XTZA 4XU0A 2VXFA 3GIBA 1D3BA 2DZCA 2DEQA 4M78F 1YCYA 4M78E 5LJ3h 5GANd 5GAN7 5GAOl 3HSBA 4C92F 1I81A 3JB9H 3JB9I 3M4GA
chains in the Genus database with same CATH superfamily
2CP5A 2RB6A 1WJSA 3OW2A 3LX7A 3MKDA 3LGFA 5IXFA 2MWPA 3NTHA 2RQTA 3M9QA 1AD5A 4PJMA 4LUEA 2JT4A 3C0CA 1OYXA 5KCHA 3PNWC 1WHKA 2YXYA 3RUXA 2ROLA 1OX9A 4OGEA 2XK0A 5CO7A 3TEEA 4CI0C 2FEIA 1T0JA 2O9VA 2DETA 1E6HA 3M54A 1BIBA 1BCMA 2HL3A 1S72Q 4BDYA 4FIBA 1VQ6T 2M0OA 2LDMA 3NPFA 5HY6A 3OYJA 2EGEA 1YJWA 1B7TA 3C4SA 1G3SA 1G5VA 3PIOA 5LJ3j 1DJ7B 1X6BA 5GAMf 1M90C 1BCOA 1V1CA 2LT1A 1M2OA 4BY6B 2DKGA 2JMCA 2XDDA 4MZPA 4M75B 5D6WA 3CXCS 1VQ5A 1SKUB 4RTTA 1QVPA 1QVFA 3U23A 3OS1A 4CC2A 2JW4A 3OS5A 3V7SA 4F04B 1VQOT 2ECZA 1KQSP 2NUPA 1LVKA 3CCLQ 4DEYA 1VIEA 4LDUA 1RABB 2LP5A 3CPWP 2O88A 4M7DD 2XKOC 4PJOF 1KD1U 3M53A 4DBRA 3HRTA 5GANg 1KG1A 3RIRA 2LRQA 3OBYA 1AZGB 3G4SQ 3SB2A 2A0FB 3EGXA 2K7AA 4M75D 4EMKC 1QMCA 1ZSZA 5A2QE 2QQAA 4PK4A 4XTYA 2OTLT 2DD5A 4VUBA 2RHIA 2LX9A 4A4EA 2RI3A 4JS4A 3CD6Q 5KH6A 4DOVA 2L3RA 3GP8A 4QQDA 2ZGWA 2DK3A 3QXEB 2L3PA 2JM9A 1UHCA 3CCST 2C0IA 3PE0A 4FYXB 3I56A 1W4SA 3DKMA 2DTOA 3JCMh 2VC8A 4XTXA 2HQHA 4D6WA 2VGMA 3QJYA 4AMCA 1VQ8A 1D0ZA 4BACA 3CCUQ 1VQ9Q 1YHQQ 2KT8A 4HCKA 3OYDA 3VS6A 1AOJA 3QDFA 3I55T 4KULA 4C8QC 3CCMT 3LWHA 1OPKA 1OX8A 3I35A 4C8QD 4PJNA 4BY6C 3RERA 2CUBA 2D6FA 4J6YA 3CD6T 2E10A 5GAMg 2CP0A 3TSWA 1OULA 3AHUA 2Z0WA 2MOXA 2VUBA 4C8QG 4TVRA 2D8HA 2BTTA 1PHTA 3X24B 1B34A 1LNXA 2C06A 2XDBA 3QHSA 5DLOA 3G6EA 2K5IA 1VQ7Q 4C92A 5KYUA 3DB3A 2ABLA 4EPCA 1NLOC 1JBMA 5I21A 2V26A 2DERA 1U3OA 4M77F 2P84A 1PWTA 1M1FA 1G3YA 1U06A 2K2MA 3CCEQ 5GAOm 3LYIA 5I2SA 3VRZA 1GCQC 3OMGA 1TUGB 2RPNA 2K3XA 1QCFA 1YJNQ 5FROA 2LQKA 3J81E 1RI9A 1K8AR 1OZ3A 2DLPA 1WHHA 1X2QA 2QQRA 3S3MA 5GMKl 1OU8A 1SG5A 1KHIA 2V8JA 1Q86R 4JLGA 2FRWA 1YIJT 4PKCC 3JV3A 3EH1A 2E6NA 5D7UA 2AZSA 2QASA 1SF9A 3I5RA 2JTEA 2HEQA 3OW2S 3F70A 5LJ5d 2DM1A 4WTOB 4PJOE 4RTWA 2QEXQ 3QO3A 1G3WA 2YHTA 5GAMj 2DNUA 5LJ3f 3QKJA 2KE9A 2CYZB 5CAIA 4NL2A 4OB3B 2F2WA 2QTXA 1VQ7A 2EYXA 3CCJT 1K4US 3CCRA 1VQNQ 4IKFA 2YLBA 1VQPA 1SPKA 4CRIA 2CT3A 2GFUA 1IHVA 2HKNA 3CMAA 4E6RA 5C6SA 2NYSA 5GJVB 2RQUA 1I8FA 3G71T 3QZ5B 5L23A 3A8MB 2BE9B 5CKDA 1BU1A 2ZZDA 1W70A 1VOMA 2QDYB 2QQSA 3AT1B 1OI1A 2OAWA 2PVGB 4DBQA 3P8DA 3OB9A 2X3WD 5I22A 5HCKA 4RCCA 4JLIA 3QUIA 1PKTA 2OX7A 2PZ1A 2XU8A 1MV3A 4R56A 3BFMA 3OSVA 1UDLA 2CSIA 1OOTA 2BZ8A 3GBQA 5A0GA 1WHMA 1OQKA 3KUFA 4IIMA 1YP5A 3VU3C 5GAOq 4WCIA 1C6VX 4M75G 1VUBA 3A8HB 2VWFA 4J9FA 3E2UA 5GAN7 4CC4B 1VQNT 1M90R 1OU9A 3CCQQ 2MK5A 2RI2A 4C8QB 2KQWA 3A5ZB 3PMIA 1NE8A 4HCZA 1AWJA 3A8OB 2ZPIB 1SRLA 2COYA 3JCMQ 1ABOA 4J9DA 2M9UA 5FW9A 1IO6A 3EG2A 1Z9QA 3V7RA 4AG1C 1RADB 2OTJQ 1KSWA 3FLGA 3EH2A 2SRCA 2KAFA 2D0NA 4M75F 3CEYA 1VQLT 1GFCA 1UGRB 3L2UA 1ZBJA 1U1TA 4F7UF 2KVQG 4ELZC 3MP6A 4MMLA 1TH7A 3JCMd 4J6XA 2NUPB 2EFIA 1PD1A 5CQXA 2E6ZA 4OP0A 4D8DA 1AHJB 2ED0A 3WVDB 2YUPA 4DBFA 1VQLQ 5CKFA 1IB8A 2LCCA 4X9DA 3CCUA 3TSZA 3PTAA 1W1FA 2FPFA 4XK8E 5A0LA 2CSQA 3TREA 1H8KA 4C92E 2QYZA 4C0DC 1M2VB 5GAOp 1K73R 2HQXA 2EGCA 4IURA 5CQYA 4L59A 2DO3A 2QEXA 5FWCA 1OEBA 5ECAA 1NZ9A 1U1SA 2AK5A 1RL2A 1UJYA 1PSFA 4A53A 2KROA 1W6XA 1QVGP 5GAN5 1X6OA 4KT0E 1R8OB 1LJOA 2DVEA 3VS4A 4FYWB 2KY9A 2DXBA 4N4HA 3REBB 1Y0MA 1Y07A 2AT1B 3GIBA 2DZCA 3QZ9B 4LD6A 4C92F 3VJPA 2EQKA 1FMWA 2JNGA 1YJNT 4JRIA 2F5TX 1WHGA 1S72A 4QVDA 2DJZA 1KQ1A 1XJWB 4M78A 4LD9K 3KXTA 4AT1B 2C0TA 1YHQT 4Y28E 4ZGDB 1MNEA 3M0SA 2LTOA 3CCVT 3UPUA 1D3BB 4EMHA 4F7UE 4A4KA 3J7AF 4C92D 3CCVQ 1I5OB 2OAUA 2RK1A 3JCMb 3C94A 1B34B 2DAQA 3A8LB 2YSQA 3CMEQ 2FB7A 1WXBA 1MHNA 2FVUA 2E5KA 2DILA 3BE3A 4FW1A 2JN0A 2KMTA 4E7ZA 2KBTA 2LNVA 2GQVA 1I0CA 1SHFA 4LE9A 5LJ5f 2QEXT 2EJ9A 3CPWS 4D8KA 3QWXX 2L3SA 1K1ZA 1MMAA 4M75E 4E7HA 1JEGA 3ZEHA 4PJOG 3SWNA 5KYYA 1KD1R 2O4XA 2V1QA 4UC4A 5KYXA 1J3TA 2JZ2A 3CCUT 4KRTA 1VQMT 2RQWA 1M1KU 1FWZA 2BE7D 1RLPC 2QDLA 1VQOQ 1FMKA 2PUOB 5GJWB 2CS7A 2CKKA 3QJ6A 1Q81R 1WDXA 4R55A 1JB0E 4MZTA 3JCMV 1WI7A 2CP2A 3QSUA 1VQLA 4OMMA 3RKXA 2LJ0A 1Y57A 8ATCB 3E9FA 3REAB 3HSBA 2O01E 1RI0A 1XQHA 1TSFA 3MEVA 1XNIA 4ZGEB 1RAIB 5M9OA 2KDSA 1ZLMA 1PRLC 2LQ8A 3QBYA 5HKCA 2QQ9A 1B3QA 1S72T 2P0PA 5IH2A 2KXDA 3CC4Q 2VB6A 1AWWA 3O8VA 4PLIA 4C8QE 3CC7T 3OYMA 5I2MA 4BI3A 5GAN4 3CC2Q 2RHZA 2CT4A 2RQRA 2BIVA 3MHXA 1VYTA 3A1PA 3MP1A 2K57A 3OBWA 2E64A 3JB9J 2NWMA 2X3XD 4F7UA 3UF4A 1R0CB 4QKUA 2NUZA 5GMKm 2BZXA 4NS5A 5FRNA 3TVTA 2RA2A 4E47A 4M7AC 4PFOA 1M9SA 3LGLA 4QT7A 3V7CA 2JVVA 3HFOA 4J9GA 3CC7A 1N6AA 2J6FA 1BI1A 2YUNA 1ZA2B 1U8RA 4HKEA 1YBYA 4HT9A 5LL6S 5EC7A 3CQTA 4M7DE 5KYWA 4ZN3A 4M7AE 1GL5A 4FSXA 2GTJA 1JRIA 1CSKA 4M77D 3OYIA 2HCKA 4M77G 1T3SA 2HQEA 2R5AA 3S6WA 4M77E 2KEAA 2MPXC 2LZ6B 1M2VA 1WXTA 3DLLA 1JQQA 4KUDK 2SEMA 1VQ9A 2V1RA 3JRZA 4RTUA 1LCKA 2CZ1B 3OYNA 4FYVB 2MCNA 2YLCA 4B9XA 2P0QA 1HSQA 5GMKh 4XTZA 2J05A 4HVVA 1ZSZC 4AFZC 1PKSA 1D09B 2HMAA 3M4GA 4DBHA 1YFNA 2A3LA 4JS5A 2IVWA 2VXEA 5GANe 1N8RR 4E7LA 3QYHB 2VGNA 2KNBB 1IGUA 3HFNA 3MEAA 1A0NB 5IHNA 3TU4K 1E7OA 1M4ZA 3FEOA 2DPPB 1GCQA 3NTIA 1QWFA 1PD0A 4E7KA 3VUZA 2KI7A 3M0UA 4DOWA 2P4TA 3MEUA 2COWA 3OYLA 3GNGA 1QVGS 1YIJQ 4BUGA 4K11A 4OB0B 3SDZA 4ZTJA 4XQ3A 1K8AC 2RM4A 4V2SA 2AHJB 1Y96B 4OVAA 5FU6C 4FT2A 2NLUA 5GAN3 1LOJA 1K0XA 1X43A 3MPUB 1XTDA 1M3BA 1Q7YR 2H8HA 2GF7A 4PFPA 1RAGB 2IPOB 2RHYA 1B07A 3UA6A 1YHQA 2LCLA 1V29B 1HJDA 4EMKA 3SFMA 1VA7A 2FPEA 2XG8D 4M78G 2GGRA 1QWEA 1YJNA 2DFUA 3VRYA 3L2VA 1MV0B 2R5MA 2PUKB 3EGUA 2PNIA 3PGGA 1VQPT 2EYYA 4C92C 3C95A 2FHDA 3HPWA 1UE9A 2HNIA 1BB9A 1VQ7T 1M5Q1 5L8RE 4M77A 3CCMA 5DLQE 1AWOA 4JRPA 1SHGA 3G4SA 4BE0A 1Q81U 2PVOB 3OYCA 1D3BA 4LXCA 4A4FA 1GFDA 4IIOA 3FC3A 1C1AA 4M78C 4C5HA 4C8QA 3R6OA 3H8ZA 3UWNA 2P0KA 2XICA 3L2QA 2QQBA 2XIDA 4JJBA 3ZBDA 2O31A 4F17A 3SD4A 3QWYA 4N4GA 1QW1A 3Q1JA 3BDUA 1EX4A 4C0GA 4C0ZA 3ULRB 3R6NA 1BI3A 4J9IA 3CCEA 2FRYA 1PCXA 2ZAEA 2YRVA 1VQ9T 1SSFA 1WFWA 2QGGA 3CCET 4C5GA 1NG2A 1TG0A 2XI9A 4AFSC 5GANj 1NLPC 2DRKA 1JXOA 3QPHA 2KT1A 3PVLA 1R0BG 2H3EB 4OMQA 3DLMA 1WIEA 2XD0A 2DTHA 5FRMA 1S1NA 2HZYA 3MCAB 4N4IA 1G83A 2X4WA 5CKEA 1WZOA 3CCRQ 1VQNA 1AT1B 1RAEB 1WJRA 3M56A 1MNDA 2MI6A 4PJOD 1Q95G 3CD6A 3L2RA 1QQJA 1QVGA 2DTIA 3G4ST 2K4YA 4PJOC 1K76A 3FJ5A 3RMSA 3BY7A 5D6XA 2L89A 3CC4T 3M4YA 4NL3A 1WLPB 3EGDA 3JCMe 4KGVB 2LQNA 3I55Q 4Z02A 4FW2A 3JSCA 5HK3A 1BBZA 2DL3A 2EGAA 4L5GA 4M4ZA 3NGPA 2V8IA 2HAXA 2CGHA 5KYNA 3OW2P 1MMGA 2W10A 2DEQA 1YCYA 2LMJA 1BK2A 2GTOA 4JRQA 4AG2C 7AT1B 1ZUKA 4F7UB 1E6GA 4OMOA 3G71A 1OPLA 3I9QA 4M7AF 2CZ6B 1PG5B 4M7DF 3GNFB 2DA9A 1O75A 2M1HA 1RAAB 2CDTA 4GLKA 1M8VA 4KGXB 3A98A 3OYGA 2EKHA 1XOVA 3LH5A 5GAOn 2X4YA 4C8QF 1KFZA 4RMOA 2E4HA 5DY9A 1KQSA 1VQ4T 3WVEB 1KJWA 4FL6A 1I07A 2F69A 1HYOA 5AYFA 4PL6A 1VQKA 3X25B 2DF6A 3QIIA 1Q7YU 4Z89A 2RNAA 4OMFB 2E1HA 1IRXA 2F1LA 3OSSC 3PMTA 4XTUA 1MMNA 4JJDA 1VQPQ 4JUVA 3SWNB 5KYYB 2DMOA 2XDPA 2O4XB 2GCXA 2RK2A 3EFRA 5KYUB 1OV3A 4R0KA 4J9BA 2WSEE 1PNJA 2DD4A 2JJ9A 2RF0A 1UGVA 5IXBA 1M3CA 1VQ6A 1RAHB 1YNZA 2DL5A 5LJ5h 2RH2A 1YI2T 3CBOA 1M1KR 2MYSA 2MWOA 2RO0A 3CXCA 4LUDA 2KGTA 4XU0A 3KBGA 1GCPA 4M78E 2K5LA 5GANd 2EKOA 2MF2A 3TQ7P 2QG9B 4C5EA 4HCCA 2ZCFB 1M1GA 3EFOB 4M7AG 2JTFA 3J80E 2ENMA 1QLYA 2K5FA 2FYKA 3CMAQ 1JXMA 3TCJA 3NHNA 1G2BA 4HT8A 2JS0A 2WSFE 1Q86C 2HDAA 3VYHB 1JJ2A 1M8MA 1WX6A 4MDXA 2F2XA 2HD0A 3T9NA 5FU7B 3VKIA 2EYWA 5GANh 1WA7A 5CVIA 4M7DC 1UTIA 3ME9A 5CCAA 1UUEA 4N0AA 2QI2A 4J9HA 4M75A 3OS0A 2J06A 3H6ZA 3E19A 3CC7Q 4EMGA 5FU7C 3EAEA 1K73U 1N9RA 4MDWA 1I4K1 1D0XA 1U5SA 2EBPA 2AKKA 2I2LA 2DRMA 4ZTFA 2QA4A 2DL7A 3HRUA 4M77B 2DJQA 1ZHIA 3M55A 3RDVA 3CBMA 3V8JA 3CCSA 2DX1A 2ED1A 1X69A 2K6DA 2BZYA 4II1A 4F7UG 1TS9A 1IHWA 2FO0A 2K3BA 1SRMA 1NEGA 3FRNA 1GRIA 4ZN1A 1AVZC 4HXJA 4OF1A 5LJ5e 2E3IA 2W0ZA 1M30A 4BI4A 1KIKA 4JZ3A 3GF5A 2O2OA 1CKAA 1YWOA 3L1AA 1VQMQ 1Q82R 2L2PA 6AT1B 3OYKA 2EQMA 1ZUYA 3JCMW 3LW5E 1EFNA 2LCSA 1VQMA 1G8XA 1YWPA 5GAOl 4MZMA 2DL8A 4QQGA 2D1XA 1FX7A 1NPPA 3QYGB 3VS7A 4LDYA 2YT6A 1D1AA 2X35A 2DXCA 4JRKA 4PJOA 1NJIU 1R77A 1C0MA 1M3AA 1PSEA 2CH4W 3JB9D 4DA4A 1N8RU 4FSSA 5IN1A 1H641 3NFCA 2ZPGB 2CP3A 3H9NA 3A8GB 2E65A 3MO8A 4Y92A 5GAMe 3URGA 1VQ5Q 1FYNA 8AT1B 2YRCA 3LH0A 4ZGJB 2E3HA 3S3OA 1IGQA 1N5ZA 5GMKi 5KCOA 3CCVA 3KFVA 2J6OA 4KGZB 2JS2A 1I5LA 4N0AC 1VQ4Q 3HTRA 2F2VA 4E2FB 2FZCB 2DEUA 2JOYA 4JPBW 4C0FA 4JJNK 4Z8AA 1KQSS 3EGDB 3MJXA 4C92B 4HCBA 3X26B 4GBQA 1PC0A 3OY9A 2B86A 2RN8A 1K0SA 2FG0A 1GBQA 1PM3A 3CCRT 4PNOA 3CC2T 3CCJA 1YJ9Q 4XU3A 2FZGB 3CCMQ 2J6KA 3H0HA 3PIPA 1VYVA 3OA6A 2RI5A 2OJ2A 2QAZA 1KD1C 1D0YA 2J7IA 2D8JA 1YJWQ 1N8RC 1N9SA 3EG0A 4PJJA 1AWXA 5KE3A 3UDCA 1VQ8Q 2YDLA 5IT9E 2ROTA 1ARKA 1WXUA 4F14A 5A0DA 1YIJA 2YRDA 3RMQA 2E41A 3M58A 2XHCA 3I56Q 2VYTA 4PFZA 2V8KA 1QVFP 5C0MA 5CKHA 4BD3A 3VS3A 2RD1A 1TU0B 2RJDA 2M51A 3OQ5A 4LDWA 2EWNA 5J3BA 2CZ0B 2LJ3A 3ASKA 4J7IA 3OYAA 1GBRA 2LC4A 3CBPA 5GANf 3L2WA 3EFOA 1AEYA 2VVKA 2OTLA 2YWWA 2R57A 2JUFA 1FXXA 1QKXA 1TXQA 3PFSA 1KK7A 3UATA 2DIGA 4B9WA 4OMLA 3H0IA 4FU6A 3MEWA 1O9SA 1TWBA 2NUTB 3JB9F 3GOXA 2L8DA 2OTJA 2CP7A 3EG9B 4YTLA 1FMVA 3C12A 4IUVA 3WXMB 3OS2A 4BE2A 1BIAA 3MP8A 3OYHA 3VUBA 2K3YA 2A28A 1GXIE 4M7DB 4M7DG 4M7AB 1D1CA 2VKNA 2QK0A 1JU5C 3O5ZA 2DIQA 1ACMB 3EG3A 4A4GA 3CCSQ 1X27A 2X51A 3BW1A 3RKYA 2C0OA 1RACB 3EG1A 4XAXB 4LDVA 1RLQC 5KYXB 2EYZA 3JCMg 4RG8A 1M27C 1H92A 2JMAA 4X34A 3I55A 3HP9A 1YJWT 4QQ6A 4ZNXA 1I1JA 1YN8A 3DB4A 9ATCB 1MUZA 3JCMP 1T3LA 2A37A 2M02A 2K2VA 1KC8C 1KQ2A 3SHWA 4M77C 1K9MU 3OMCA 3CC2A 2EQIA 1ABQA 3VS0A 5CR2A 2FPDA 1I81A 1Q82U 4BDZA 4RKUE 4A4HA 4KBMB 4HVUA 3X20B 4E7SA 1UECA 2LQWA 1WJQA 4GLMA 3RNJA 5GAMh 3V8LA 2CREA 2H3JA 2ZPHB 3P8BB 5FU6B 4RTZA 1WGSA 5I11A 4RTVA 3G6EQ 2CH4A 2VASA 3CPWA 4A63B 3JCMX 1Q86U 3CMAT 2JXBA 1HD3A 1CKBA 3QG1A 1NJIR 1X75C 3CCJQ 4PLLA 1UFFA 4KUIA 4PJOB 1JO8A 3NTKA 4RTXA 2DYBA 3JB9G 1VIFA 3SWNC 3D7SB 2JM8A 1BI2A 5GAN6 3L42A 3X28B 2DXUA 2FL7A 2Y4YA 3RR6A 3CCQT 2KRSA 4XTVA 1W2BS 5CIUA 2DXTA 3FIFA 4J9CA 3QDRB 2MMPA 1VQKQ 1MGQA 3FJPA 4JJCA 2D0QB 4GY5A 5LJ3g 1WQ7A 4C5IA 2ZPFB 3OYFA 2EYQA 3M59A 4EIKA 3M0RA 1QP2A 5KYWB 5DM7R 2A08A 2LNHB 1WNLA 2LVMA 5GAMd 1JJ2P 3CCQA 2OTJT 3HL8A 1X6GA 1ZQ1A 5GAOr 4X1VA 1BKBA 1N27A 3JCMf 3EGXB 2I0NA 1UGSB 2RHXA 4CC3A 1ZSZB 3CCLA 1K73C 2G6FX 4FM4B 3HHTB 1QP3A 1NPRA 3JB9I 4M78B 4B6MA 2EPDA 2Y90A 2BUDA 2EVRA 2L3QA 4XU2A 4KH0B 2F5KA 1Q81C 3G6ET 2CUDA 4IUQA 3META 3BDLA 3OYEA 1YITT 3M0QA 2G3RA 2HKQB 4IUTA 1UGQB 3VS5A 1NJIC 3CPFA 3VV0A 2XMFA 2ZPEB 4XU1A 5GMKe 2DYIA 1EZZB 2KXCA 4FYYB 4OB2B 3RKWA 2EJGA 4ANJA 4QW2A 4C92G 3SEMA 3VS2A 4DEXA 2RJFA 4WF2A 2RMOA 5J39A 1VQ8T 1UG1A 3G71Q 4AFQC 3G1JA 2L5QA 1NEBA 1TOVA 1Z9ZA 1Q82C 4JDSA 5EG2A 3EFSA 3I56T 1V76A 1QCNA 4X9CA 2KRNA 2NUTA 2QXFA 1YITA 2JTMA 2QGFB 3EG9A 2PQWA 3N5BB 1UB4A 3I5SA 3V8KA 3GLXA 3PVQA 4XTWA 2O9SA 1ZA1B 2HL5C 4FCYA 4LDXA 3IQLA 1D1BA 2E5QA 1WYXA 4E7JA 4M7DA 5LJ5g 2KYMA 3G7ZA 4M7AA 1BYMA 2EQUA 3THKA 2LJ1A 4ESRA 4QVCA 3ER0A 4BI8B 2PVDB 1X01A 2A7YA 4Y91A 4KH1B 2X4JA 2AKLA 1YJ9T 1Y71A 2RHUA 2RJCA 2X9HA 3UA7A 1IREB 1K8AU 1KC8U 3JCMJ 4IUPA 3JCMc 1YI2Q 2IIMA 3EHRA 5AT1B 2GBQA 4OGCA 1K9AA 1KC8R 4J8OA 1RUWA 5LJ3h 1RAFB 1KHCA 1W2BA 2KK4A 2CZ7B 1WHJA 1K9MR 1UHFA 4J7FA 1VQOA 2RJEA 2WACA 2E70A 2KRMA 2L0AA 2BKDN 3CMET 3H0FA 1VQ5T 3FB9A 5GAN8 4BE1A 2IG0A 1ZBXA 5LJ5j 2K79A 3E1SA 2DBMA 3JAME 2Y4XA 5D6YA 4RCBA 1NM7A 2ATCB 1T0HA 2MAMA 4QVZA 4PJLA 4J6WA 1OZ2A 1VQ6Q 3L2ZA 3H41A 2QTVA 2HBPA 3VYGA 4M75C 1TUCA 4Z88A 4OMPA 2E12A 1Q7YC 4ORZA 2DVJA 2WSCE 4ELYC 2HSEB 1JJ2S 3PT9A 5J26A 1QKWA 4CC7A 4DQ2A 2GNCA 4OB1B 4MMKA 2LX7A 4BB7A 2P4RA 3M57A 5HK0A 5GMKj 4ME7A 4NOYA 5FWBA 2YUQA 5KE2A 3M0PA 2KSSA 2FZKB 2M16A 2HBWA 4RUGA 2D9TA 5CKBA 1P92A 3E9GA 2OI3A 1ZSGA 2YUOA 1W2BP 2ZPBB 2GQIA 2PU9B 3INZA 1SSHA 1K9MC 4IUUA 5IHIA 5LJ3d 5FLXE 1M90U 5CK9A 3CC4A 1NBEB 2PTKA 2VXFA 2EW3A 4HVWA 3LLRA 1TTHB 5IAYA 2VV5A 1X2KA 1QVFS 4RG2A 1UGPB 4Q5WA 2OTLQ 4JZ4A 1YITQ 3CMEA 2M0YA 2COZA 3UT1A 4RTYA 2CP6A 3OYYA 4J9EA 4EDUA 1HK9A 1NYGA 1MMDA 5IHKA 4M7AD 3OYBA 1ZUUA 1AZEA 2ESWA 2LT4A 2DL4A 3EHQA 4C0DB 1VYUA 4LN2A 1WPYA 2B8AA 1YJ9A 1Y96A 3CCLT 2GFAA 4J83A 1YI2A 2HSPA 3ZFJA 3S3NA 2KYBA 5LJ3e 1H3HA 3ZL7C 1F1BB 1IZ6A 2DBKA 2EJFA 2MIOA 3VS1A 3LWIA 1TUDA 1M1KC 1ZX6A 4EMKB 1G3TA 2A36A 2EQJA 1UEBA 4ATOA 4O6JA 2QA4T 3CXCP 2AIRB 1UJ0A 2K9GA 4FT4A 4P5NA 4E7IA 3P8HA 2KR3A 4A54A 2DE0X 3M5AA 1VQKT 1EIFA 3M0TA 4M78D 2R58A 4OMNA 3FDRA 2X4XA 3NMZC 3RBBB 3RESA 2DZ9A 1QCOA 1WQWA 4F16A 5GAN2 1VQ4A 4J5YA 2QA4Q 1IXDA 1WHLA 1YCSB 4AFUC 4L6V5 2AZVA 4HA8A 2EAYA 1BI0A 1NYFA 3GPLA 1Y7XA 1H3ZA 2EIFA 1HXDA 3HKSA 3HRSA 1LPLA 4LNPA 4O5VA 4M78F 3JB9H 1SEMA 2RQVA 1PRMC
chains in the Genus database with same CATH topology
2RB6A 1WJSA 4JRQA 2EQKA 3LX7A 3OW2A 2JNGA 4RKUE 4A4HA 1YJNT 4JRIA 2F5TX 3LGFA 4KBMB 3X20B 2MWPA 3NTHA 4QVDA 2DJZA 1S72A 1KQ1A 4F7UB 4M78A 4LD9K 3M9QA 3KXTA 1WJQA 5GAMh 3V8LA 2H3JA 2ZPHB 1YHQT 3P8BB 5FU6B 1OYXA 1WGSA 5KCHA 4Y28E 4ZGDB 3PNWC 3CPWA 3RUXA 3JCMX 2LTOA 3G71A 1Q86U 3CMAT 3CCVT 4M7AF 3QG1A 4OGEA 2XK0A 3UPUA 2CZ6B 1D3BB 1X75C 5CO7A 4EMHA 4F7UE 4M7DF 3GNFB 3TEEA 4A4KA 4CI0C 3J7AF 4PLLA 4C92D 1O75A 4KUIA 4PJOB 2OAUA 2RK1A 3JCMb 3C94A 3M54A 1B34B 2M1HA 1BIBA 2DAQA 3NTKA 3A8LB 4BDYA 3JB9G 1VIFA 3SWNC 4GLKA 1M8VA 4FIBA 1BI2A 5GAN6 3L42A 3X28B 3OYGA 2FB7A 1XOVA 2M0OA 1VQ6T 2LDMA 1MHNA 5GAOn 5HY6A 2DXUA 3OYJA 2FVUA 1YJWA 3C4SA 2FL7A 2Y4YA 2X4YA 1G3SA 4C8QF 3PIOA 5LJ3j 1G5VA 3CCQT 1DJ7B 5GAMf 4RMOA 1M90C 5DY9A 1KQSA 4XTVA 1VQ4T 2JN0A 5CIUA 1W2BS 3WVEB 2KMTA 4FL6A 2LNVA 2DXTA 3FIFA 3QDRB 2F69A 2MMPA 2GQVA 2LT1A 4BY6B 2DKGA 1MGQA 5AYFA 2XDDA 4MZPA 5LJ5f 3FJPA 4M75B 4PL6A 5D6WA 2QEXT 2EJ9A 1VQKA 3CPWS 3X25B 3CXCS 1VQ5A 2D0QB 4GY5A 1QVPA 4M75E 5LJ3g 1QVFA 3QIIA 1Q7YU 1WQ7A 4OMFB 3OS1A 4E7HA 2E1HA 3OS5A 3V7SA 3ZEHA 4C5IA 1VQOT 3OSSC 4PJOG 3PMTA 2ZPFB 4XTUA 3SWNA 3OYFA 2EYQA 2O4XA 4JUVA 3M59A 3SWNB 1VIEA 4LDUA 2XDPA 2O4XB 4UC4A 2GCXA 1QP2A 2RK2A 5DM7R 3EFRA 2JZ2A 3CCUT 4M7DD 2XKOC 4PJOF 1VQMT 1KD1U 3M53A 1WNLA 2LVMA 5GAMd 1M1KU 3CCQA 2OTJT 1FWZA 3HRTA 5GANg 2WSEE 3HL8A 1KG1A 2DD4A 1ZQ1A 2PUOB 5GAOr 1VQ6A 2CS7A 3RIRA 2CKKA 3QJ6A 1BKBA 1N27A 2RH2A 3JCMf 2LRQA 5LJ5h 1YI2T 3OBYA 3CBOA 3SB2A 1UGSB 2RHXA 4R55A 1JB0E 4MZTA 3JCMV 3CCLA 1K73C 4FM4B 2MWOA 4M75D 2RO0A 4EMKC 3HHTB 3CXCA 5A2QE 3QSUA 1VQLA 2QQAA 3RKXA 4XTYA 1QP3A 4XU0A 2OTLT 3KBGA 2DD5A 4VUBA 2RHIA 3E9FA 4M78E 2K5LA 5GANd 2LX9A 3HSBA 4A4EA 2O01E 2RI3A 1NPRA 3JB9I 4JS4A 2MF2A 2EKOA 1RI0A 4HCCA 4C5EA 1XQHA 4M78B 4DOVA 2Y90A 1XNIA 2BUDA 2L3RA 3MEVA 2ZGWA 4QQDA 4ZGEB 2DK3A 2KDSA 3QXEB 5M9OA 4XU2A 2ZCFB 2LQ8A 2F5KA 1Q81C 3QBYA 3G6ET 5HKCA 2QQ9A 3CCST 1M1GA 4IUQA 4M7AG 3META 3BDLA 3GP8A 1S72T 2P0PA 2JTFA 3OYEA 3J80E 1YITT 2G3RA 3I56A 4IUTA 1W4SA 3DKMA 2DTOA 3O8VA 1UGQB 4PLIA 3JCMh 4C8QE 3OYMA 2VC8A 3CC7T 4XTXA 5I2MA 4BI3A 5GAN4 4D6WA 2VGMA 1NJIC 3QJYA 2K5FA 2FYKA 3CPFA 2RHZA 3VV0A 1VQ8A 2ZPEB 4XU1A 3TCJA 2BIVA 3MHXA 5GMKe 4BACA 4HT8A 2WSFE 1Q86C 3VYHB 3MP1A 1JJ2A 2K57A 3OBWA 4OB2B 3RKWA 3OYDA 2E64A 2EJGA 3JB9J 4MDXA 4QW2A 4C92G 4F7UA 3I55T 2HD0A 4KULA 3T9NA 4C8QC 3CCMT 5FU7B 3LWHA 3VKIA 5GMKm 5GANh 4NS5A 5FRNA 2RJFA 4C8QD 5CVIA 4WF2A 4M7DC 3ME9A 4BY6C 3RERA 2D6FA 4J6YA 2RA2A 4E47A 5CCAA 5J39A 3CD6T 4N0AA 2E10A 2QI2A 5GAMg 1VQ8T 4M75A 3OS0A 1M9SA 3AHUA 3H6ZA 3E19A 2L5QA 3LGLA 4EMGA 2VUBA 5FU7C 3EAEA 3V7CA 4TVRA 1N9RA 4C8QG 1Q82C 1K73U 2JVVA 3HFOA 4JDSA 5EG2A 1B34A 1LNXA 1I4K1 1N6AA 4MDWA 3EFSA 3X24B 3I56T 2I2LA 4X9CA 2C06A 1BI1A 4ZTFA 2QA4A 2QXFA 4HKEA 1U8RA 1YBYA 2XDBA 4HT9A 1YITA 3HRUA 3QHSA 5LL6S 2JTMA 4M77B 3M55A 1ZHIA 5DLOA 3G6EA 4M7DE 3CBMA 2PQWA 3V8JA 3CCSA 3N5BB 1UB4A 2K5IA 3V8KA 4ZN3A 4M7AE 3GLXA 4FSXA 4XTWA 1JRIA 4LDXA 4II1A 4C92A 4F7UG 3DB3A 4M77D 3OYIA 4M77G 2E5QA 4EPCA 2HQEA 2R5AA 3S6WA 4E7JA 4M7DA 5LJ5g 4M77E 3G7ZA 4M7AA 1JBMA 3FRNA 5I21A 3DLLA 1BYMA 2EQUA 4ZN1A 4OF1A 4QVCA 4M77F 3ER0A 4BI8B 2PVDB 5LJ5e 4KUDK 4M7AC 1M1FA 1G3YA 1VQ9A 1X01A 2A7YA 3JRZA 4Y91A 4BI4A 2X4JA 3GF5A 1YJ9T 5GAOm 3LYIA 1Y71A 2RHUA 2RJCA 5I2SA 2CZ1B 1IREB 3OMGA 3L1AA 1K8AU 3OYNA 1KC8U 3JCMJ 4IUPA 3JCMc 3JAME 2EQMA 3OYKA 3JCMW 2YLCA 2K3XA 3LW5E 2P0QA 4B9XA 5GMKh 1VQMA 4XTZA 4OGCA 5FROA 2LQKA 4J8OA 5GAOl 3J81E 5LJ3h 4MZMA 1KHCA 1W2BA 4QQGA 1OZ3A 3M4GA 1FX7A 1NPPA 2KK4A 2CZ7B 2A3LA 2QQRA 3S3MA 3QYGB 4JS5A 2IVWA 4LDYA 2VXEA 4J7FA 2RJEA 5GMKl 1VQOA 2X35A 5GANe 2WACA 1KHIA 2E70A 2V8JA 2DXCA 4JLGA 4JRKA 4E7LA 4PJOA 3QYHB 1NJIU 2BKDN 2VGNA 3CMET 1YIJT 1PSEA 1VQ5T 3HFNA 3FB9A 3MEAA 4PKCC 2E6NA 5GAN8 4BE1A 3TU4K 3JB9D 4DA4A 2IG0A 1ZBXA 1M4ZA 5LJ5j 3E1SA 1N8RU 3OW2S 3FEOA 2DPPB 1H641 2Y4XA 3F70A 5D6YA 5IN1A 3NTIA 3NFCA 4RCBA 5LJ5d 4PJOE 2ZPGB 3QO3A 1G3WA 2MAMA 3A8GB 4QVZA 4E7KA 2E65A 2YHTA 1OZ2A 3MO8A 4J6WA 3VUZA 4DOWA 2P4TA 3URGA 3MEUA 3QKJA 3L2ZA 5LJ3f 5GAMe 3OYLA 2CYZB 3GNGA 1QVGS 5CAIA 4BUGA 4NL2A 4OB0B 4OB3B 3SDZA 4ZTJA 2QTXA 3LH0A 1VQ7A 2HBPA 4XQ3A 1K8AC 2RM4A 3VYGA 4V2SA 4M75C 2AHJB 1Y96B 3CCJT 4ZGJB 2E12A 4OVAA 5FU6C 4FT2A 3CCRA 4IKFA 2YLBA 2NLUA 1Q7YC 1VQPA 5GAMj 5GAN3 4CRIA 1LOJA 3S3OA 2GFUA 5GMKi 2WSCE 1XTDA 4ELYC 5KCOA 3CCVA 1JJ2S 3CMAA 3PT9A 1I5LA 5J26A 5C6SA 4N0AC 2GF7A 1I8FA 4DQ2A 2RHYA 3G71T 3QZ5B 1YHQA 2LCLA 1V29B 2JOYA 4EMKA 3A8MB 4C0FA 3SFMA 4JJNK 4OB1B 4MMKA 4BB7A 5CKDA 3M57A 2XG8D 1KQSS 4C92B 2ZZDA 4M78G 5HK0A 3X26B 4HCBA 5GMKj 4ME7A 2QDYB 4NOYA 2QQSA 5KE2A 1OI1A 3OY9A 2PVGB 2KSSA 3P8DA 1YJNA 3OB9A 3L2VA 2M16A 2R5MA 4RCCA 2PUKB 4JLIA 3QUIA 3PGGA 1VQPT 4C92C 3CCRT 3C95A 2D9TA 4PNOA 5CKBA 2FHDA 1P92A 2XU8A 3E9GA 3CCJA 3CC2T 4R56A 3HPWA 4XU3A 3BFMA 3OSVA 2HNIA 1VQ7T 2ZPBB 2PU9B 1M5Q1 3INZA 1K9MC 5L8RE 3PIPA 4IUUA 4M77A 3OA6A 5DLQE 3CCMA 5A0GA 2RI5A 5LJ3d 3KUFA 5FLXE 4JRPA 1KD1C 1M90U 5CK9A 3G4SA 3CC4A 3VU3C 4BE0A 5GAOq 4M75G 1Q81U 1VUBA 2PVOB 1N9SA 3A8HB 1N8RC 3OYCA 2VXFA 1D3BA 4A4FA 3LLRA 5GAN7 5KE3A 1VQNT 5IAYA 3UDCA 2VV5A 2RI2A 4C8QB 2KQWA 3FC3A 5IT9E 3A5ZB 4M78C 1UGPB 4RG2A 4C5HA 1QVFS 3PMIA 4Q5WA 4C8QA 3R6OA 1NE8A 5A0DA 3H8ZA 3RMQA 3CMEA 4HCZA 1YIJA 3A8OB 3UT1A 2ZPIB 2P0KA 3UWNA 5KH6A 2E41A 2XICA 3M58A 2XHCA 2VYTA 3JCMQ 3L2QA 3OYYA 2V8KA 4EDUA 1HK9A 2QQBA 2XIDA 5C0MA 5CKHA 4BD3A 2M9UA 3ZBDA 2RD1A 2RJDA 5J3BA 3OQ5A 4LDWA 2EWNA 4M7AD 2CZ0B 3OYBA 3SD4A 3V7RA 3ASKA 4J7IA 4N4GA 1QW1A 3OYAA 2LC4A 3FLGA 3CBPA 3Q1JA 2LT4A 5GANf 3BDUA 3L2WA 3CC7A 4C0GA 2KAFA 4C0DB 4C0ZA 2OTLA 4M75F 2R57A 3CEYA 2JUFA 1VQLT 1BI3A 1FXXA 3CCEA 1WPYA 1UGRB 3L2UA 2B8AA 1U1TA 1YJ9A 4F7UF 1Y96A 3PFSA 2KVQG 3CCLT 2YRVA 1VQ9T 1SSFA 4ELZC 2DIGA 2GFAA 3MP6A 4MMLA 4B9WA 1TH7A 4J83A 1YI2A 3CCET 4C5GA 4FU6A 4J6XA 3JCMd 3ZFJA 3S3NA 3MEWA 1O9SA 2EFIA 5CQXA 5LJ3e 3JB9F 2E6ZA 3GOXA 4OP0A 2L8DA 1AHJB 3WVDB 2XI9A 5GANj 1IZ6A 2OTJA 2EJFA 4YTLA 3C12A 5CKFA 4IUVA 2LCCA 3WXMB 3LWIA 4X9DA 3CCUA 3OS2A 1M1KC 4EMKB 3PTAA 1BIAA 1G3TA 4XK8E 3MP8A 3QPHA 3OYHA 4BE2A 5A0LA 3VUBA 3TREA 2K3YA 2EQJA 1UEBA 4C92E 3DLMA 4M7DB 4M7DG 1GXIE 2XD0A 4C0DC 2DTHA 4M7AB 5GAOp 5FRMA 4ATOA 4O6JA 2HQXA 2QA4T 3MCAB 4IURA 2DIQA 4FT4A 4P5NA 5CQYA 4N4IA 4E7IA 2X4WA 5CKEA 4A4GA 4L59A 3P8HA 2DO3A 4A54A 3BW1A 3M5AA 1VQNA 3RKYA 1WJRA 2QEXA 1VQKT 1EIFA 4M78D 3M56A 1NZ9A 2R58A 1U1SA 2MI6A 4PJOD 3FDRA 2X4XA 3CD6A 3RESA 3L2RA 1RL2A 4XAXB 2DZ9A 4LDVA 1QVGA 1WQWA 1PSFA 2DTIA 3G4ST 2K4YA 4PJOC 5GAN2 1VQ4A 4J5YA 4A53A 3RMSA 3BY7A 3JCMg 4RG8A 5D6XA 2L89A 4L6V5 3CC4T 4X34A 3M4YA 3I55A 5GAN5 4NL3A 3HP9A 1YJWT 1X6OA 4KT0E 4QQ6A 4HA8A 1R8OB 1LJOA 3DB4A 2DVEA 3JCMe 2EAYA 3JCMP 1BI0A 4Z02A 3JSCA 5HK3A 3GPLA 1Y7XA 4L5GA 2K2VA 2KY9A 1KC8C 2DXBA 4N4HA 2EIFA 1KQ2A 1HXDA 3HKSA 1H3ZA 2V8IA 4M77C 1Y07A 3HRSA 3OMCA 1K9MU 2HAXA 2CGHA 3CC2A 4O5VA 3GIBA 2DZCA 2DEQA 4M78F 1YCYA 5CR2A 3JB9H 3QZ9B 4LD6A 1I81A 4C92F 1Q82U 3VJPA 4BDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RB6 A;  4M78 C;  4M78 B;  2Y90 A;  2ZGW A;  4C8Q A;  4JRI A;  4XU2 A;  2VXE A;  5GMK l;  5GAN e;  4QVD A;  2DJZ A;  1KQ1 A;  2E41 A;  4M78 A;  4F7U B;  4JRK A;  3JCM Q;  5GAM h;  4M7A G;  4PJO A;  3V8L A;  1HK9 A;  3HFN A;  3FB9 A;  2DTO A;  4C8Q E;  3JCM h;  5GAN 8;  2VC8 A;  4XTX A;  3JB9 D;  3RUX A;  3JCM X;  5LJ5 j;  2RD1 A;  5GAN 4;  4M7A D;  2EWN A;  4M7A F;  1H64 1;  5LJ5 d;  4PJO E;  3V7R A;  1D3B B;  4RCB A;  2FYK A;  4EMH A;  4F7U E;  4M7D F;  4XU1 A;  3QO3 A;  4C92 D;  5GMK e;  5GAN f;  3BDU A;  4PJO B;  4HT8 A;  3JCM b;  2E65 A;  1B34 B;  2YHT A;  4J6W A;  4M75 F;  1BIB A;  5GAM j;  5GAM e;  5LJ3 f;  3L2Z A;  1WPY A;  2K57 A;  3RKW A;  3JB9 G;  2E64 A;  1U1T A;  2EJG A;  3SWN C;  4F7U F;  1Y96 A;  5CAI A;  4NL2 A;  4C92 G;  4F7U A;  3JB9 J;  5GAN 6;  1M8V A;  2FB7 A;  4C8Q C;  2QTX A;  5GAO n;  4MML A;  2DXU A;  4XQ3 A;  1TH7 A;  2RM4 A;  5GMK m;  5GAN h;  4V2S A;  4M75 C;  4J6X A;  3JCM d;  1Y96 B;  4C8Q F;  5LJ3 j;  4C8Q D;  5LJ3 e;  4WF2 A;  5GAM f;  3JB9 F;  4M7D C;  2YLB A;  3RER A;  5DY9 A;  4OP0 A;  4J6Y A;  2RA2 A;  2JN0 A;  4XTV A;  1LOJ A;  5GAN 3;  4N0A A;  2E10 A;  5GAM g;  5GAN j;  4M7A C;  2DXT A;  4M75 A;  2EJF A;  3FIF A;  5GMK i;  3AHU A;  2DKG A;  1MGQ A;  4EMG A;  4X9D A;  1I5L A;  3V7C A;  4C8Q G;  1N9R A;  4EMK B;  4N0A C;  1BIA A;  5LJ5 f;  3FJP A;  4M75 B;  3HFO A;  1I8F A;  4DQ2 A;  1B34 A;  1LNX A;  1I4K 1;  2EJ9 A;  3EFS A;  2I2L A;  4X9C A;  4C92 E;  4M75 E;  5LJ3 g;  4M7D B;  4M7D G;  4EMK A;  1WQ7 A;  4C8Q B;  4HT9 A;  2DTH A;  4MMK A;  3QHS A;  4M7A B;  2E1H A;  5GAO p;  4M77 B;  3V7S A;  4M78 G;  4C92 B;  4M7D E;  4PJO G;  3V8J A;  5GMK j;  4XTU A;  3SWN A;  3V8K A;  4M7A E;  4XTW A;  4NOY A;  1JRI A;  4JUV A;  3SWN B;  4A54 A;  3BW1 A;  4C92 A;  4F7U G;  4M77 D;  3RKY A;  4M77 G;  3EFR A;  4M78 D;  4RCC A;  4M7D D;  1U1S A;  4PJO D;  4PJO F;  4JLI A;  4M7D A;  5LJ5 g;  3QUI A;  3PGG A;  1WNL A;  4M77 E;  3RES A;  4C92 C;  2DZ9 A;  5GAM d;  1JBM A;  4M7A A;  4PNO A;  5I21 A;  1WQW A;  2DTI A;  5GAN g;  4PJO C;  4XU3 A;  5GAN 2;  4J5Y A;  3BFM A;  4A53 A;  2HNI A;  5LJ5 e;  3BY7 A;  4M77 F;  3JCM g;  4QVC A;  5GAO r;  1M5Q 1;  1X01 A;  3INZ A;  3RIR A;  3JCM f;  5LJ5 h;  4Y91 A;  5GAN 5;  4NL3 A;  5GAO m;  4HA8 A;  4M77 A;  3SB2 A;  1LJO A;  2DVE A;  3JCM e;  2EAY A;  3JCM P;  5LJ3 d;  3JCM V;  4M75 D;  3L1A A;  4EMK C;  3VU3 C;  3JCM J;  5GAO q;  3JCM c;  1KQ2 A;  1HXD A;  3JCM W;  2YLC A;  4M75 G;  4M77 C;  3QSU A;  5GMK h;  3RKX A;  1N9S A;  2CGH A;  4XTY A;  4XTZ A;  4XU0 A;  2VXF A;  3GIB A;  1D3B A;  2DZC A;  2DEQ A;  4M78 F;  1YCY A;  4M78 E;  5LJ3 h;  5GAN d;  5GAN 7;  5GAO l;  3HSB A;  4C92 F;  1I81 A;  3JB9 H;  3JB9 I;  3M4G A; 
#chains in the Genus database with same CATH topology
 2CP5 A;  2RB6 A;  1WJS A;  3OW2 A;  3LX7 A;  3MKD A;  3LGF A;  5IXF A;  2MWP A;  3NTH A;  2RQT A;  3M9Q A;  1AD5 A;  4PJM A;  4LUE A;  2JT4 A;  3C0C A;  1OYX A;  5KCH A;  3PNW C;  1WHK A;  2YXY A;  3RUX A;  2ROL A;  1OX9 A;  4OGE A;  2XK0 A;  5CO7 A;  3TEE A;  4CI0 C;  2FEI A;  1T0J A;  2O9V A;  2DET A;  1E6H A;  3M54 A;  1BIB A;  1BCM A;  2HL3 A;  1S72 Q;  4BDY A;  4FIB A;  1VQ6 T;  2M0O A;  2LDM A;  3NPF A;  5HY6 A;  3OYJ A;  2EGE A;  1YJW A;  1B7T A;  3C4S A;  1G3S A;  1G5V A;  3PIO A;  5LJ3 j;  1DJ7 B;  1X6B A;  5GAM f;  1M90 C;  1BCO A;  1V1C A;  2LT1 A;  1M2O A;  4BY6 B;  2DKG A;  2JMC A;  2XDD A;  4MZP A;  4M75 B;  5D6W A;  3CXC S;  1VQ5 A;  1SKU B;  4RTT A;  1QVP A;  1QVF A;  3U23 A;  3OS1 A;  4CC2 A;  2JW4 A;  3OS5 A;  3V7S A;  4F04 B;  1VQO T;  2ECZ A;  1KQS P;  2NUP A;  1LVK A;  3CCL Q;  4DEY A;  1VIE A;  4LDU A;  1RAB B;  2LP5 A;  3CPW P;  2O88 A;  4M7D D;  2XKO C;  4PJO F;  1KD1 U;  3M53 A;  4DBR A;  3HRT A;  5GAN g;  1KG1 A;  3RIR A;  2LRQ A;  3OBY A;  1AZG B;  3G4S Q;  3SB2 A;  2A0F B;  3EGX A;  2K7A A;  4M75 D;  4EMK C;  1QMC A;  1ZSZ A;  5A2Q E;  2QQA A;  4PK4 A;  4XTY A;  2OTL T;  2DD5 A;  4VUB A;  2RHI A;  2LX9 A;  4A4E A;  2RI3 A;  4JS4 A;  3CD6 Q;  5KH6 A;  4DOV A;  2L3R A;  3GP8 A;  4QQD A;  2ZGW A;  2DK3 A;  3QXE B;  2L3P A;  2JM9 A;  1UHC A;  3CCS T;  2C0I A;  3PE0 A;  4FYX B;  3I56 A;  1W4S A;  3DKM A;  2DTO A;  3JCM h;  2VC8 A;  4XTX A;  2HQH A;  4D6W A;  2VGM A;  3QJY A;  4AMC A;  1VQ8 A;  1D0Z A;  4BAC A;  3CCU Q;  1VQ9 Q;  1YHQ Q;  2KT8 A;  4HCK A;  3OYD A;  3VS6 A;  1AOJ A;  3QDF A;  3I55 T;  4KUL A;  4C8Q C;  3CCM T;  3LWH A;  1OPK A;  1OX8 A;  3I35 A;  4C8Q D;  4PJN A;  4BY6 C;  3RER A;  2CUB A;  2D6F A;  4J6Y A;  3CD6 T;  2E10 A;  5GAM g;  2CP0 A;  3TSW A;  1OUL A;  3AHU A;  2Z0W A;  2MOX A;  2VUB A;  4C8Q G;  4TVR A;  2D8H A;  2BTT A;  1PHT A;  3X24 B;  1B34 A;  1LNX A;  2C06 A;  2XDB A;  3QHS A;  5DLO A;  3G6E A;  2K5I A;  1VQ7 Q;  4C92 A;  5KYU A;  3DB3 A;  2ABL A;  4EPC A;  1NLO C;  1JBM A;  5I21 A;  2V26 A;  2DER A;  1U3O A;  4M77 F;  2P84 A;  1PWT A;  1M1F A;  1G3Y A;  1U06 A;  2K2M A;  3CCE Q;  5GAO m;  3LYI A;  5I2S A;  3VRZ A;  1GCQ C;  3OMG A;  1TUG B;  2RPN A;  2K3X A;  1QCF A;  1YJN Q;  5FRO A;  2LQK A;  3J81 E;  1RI9 A;  1K8A R;  1OZ3 A;  2DLP A;  1WHH A;  1X2Q A;  2QQR A;  3S3M A;  5GMK l;  1OU8 A;  1SG5 A;  1KHI A;  2V8J A;  1Q86 R;  4JLG A;  2FRW A;  1YIJ T;  4PKC C;  3JV3 A;  3EH1 A;  2E6N A;  5D7U A;  2AZS A;  2QAS A;  1SF9 A;  3I5R A;  2JTE A;  2HEQ A;  3OW2 S;  3F70 A;  5LJ5 d;  2DM1 A;  4WTO B;  4PJO E;  4RTW A;  2QEX Q;  3QO3 A;  1G3W A;  2YHT A;  5GAM j;  2DNU A;  5LJ3 f;  3QKJ A;  2KE9 A;  2CYZ B;  5CAI A;  4NL2 A;  4OB3 B;  2F2W A;  2QTX A;  1VQ7 A;  2EYX A;  3CCJ T;  1K4U S;  3CCR A;  1VQN Q;  4IKF A;  2YLB A;  1VQP A;  1SPK A;  4CRI A;  2CT3 A;  2GFU A;  1IHV A;  2HKN A;  3CMA A;  4E6R A;  5C6S A;  2NYS A;  5GJV B;  2RQU A;  1I8F A;  3G71 T;  3QZ5 B;  5L23 A;  3A8M B;  2BE9 B;  5CKD A;  1BU1 A;  2ZZD A;  1W70 A;  1VOM A;  2QDY B;  2QQS A;  3AT1 B;  1OI1 A;  2OAW A;  2PVG B;  4DBQ A;  3P8D A;  3OB9 A;  2X3W D;  5I22 A;  5HCK A;  4RCC A;  4JLI A;  3QUI A;  1PKT A;  2OX7 A;  2PZ1 A;  2XU8 A;  1MV3 A;  4R56 A;  3BFM A;  3OSV A;  1UDL A;  2CSI A;  1OOT A;  2BZ8 A;  3GBQ A;  5A0G A;  1WHM A;  1OQK A;  3KUF A;  4IIM A;  1YP5 A;  3VU3 C;  5GAO q;  4WCI A;  1C6V X;  4M75 G;  1VUB A;  3A8H B;  2VWF A;  4J9F A;  3E2U A;  5GAN 7;  4CC4 B;  1VQN T;  1M90 R;  1OU9 A;  3CCQ Q;  2MK5 A;  2RI2 A;  4C8Q B;  2KQW A;  3A5Z B;  3PMI A;  1NE8 A;  4HCZ A;  1AWJ A;  3A8O B;  2ZPI B;  1SRL A;  2COY A;  3JCM Q;  1ABO A;  4J9D A;  2M9U A;  5FW9 A;  1IO6 A;  3EG2 A;  1Z9Q A;  3V7R A;  4AG1 C;  1RAD B;  2OTJ Q;  1KSW A;  3FLG A;  3EH2 A;  2SRC A;  2KAF A;  2D0N A;  4M75 F;  3CEY A;  1VQL T;  1GFC A;  1UGR B;  3L2U A;  1ZBJ A;  1U1T A;  4F7U F;  2KVQ G;  4ELZ C;  3MP6 A;  4MML A;  1TH7 A;  3JCM d;  4J6X A;  2NUP B;  2EFI A;  1PD1 A;  5CQX A;  2E6Z A;  4OP0 A;  4D8D A;  1AHJ B;  2ED0 A;  3WVD B;  2YUP A;  4DBF A;  1VQL Q;  5CKF A;  1IB8 A;  2LCC A;  4X9D A;  3CCU A;  3TSZ A;  3PTA A;  1W1F A;  2FPF A;  4XK8 E;  5A0L A;  2CSQ A;  3TRE A;  1H8K A;  4C92 E;  2QYZ A;  4C0D C;  1M2V B;  5GAO p;  1K73 R;  2HQX A;  2EGC A;  4IUR A;  5CQY A;  4L59 A;  2DO3 A;  2QEX A;  5FWC A;  1OEB A;  5ECA A;  1NZ9 A;  1U1S A;  2AK5 A;  1RL2 A;  1UJY A;  1PSF A;  4A53 A;  2KRO A;  1W6X A;  1QVG P;  5GAN 5;  1X6O A;  4KT0 E;  1R8O B;  1LJO A;  2DVE A;  3VS4 A;  4FYW B;  2KY9 A;  2DXB A;  4N4H A;  3REB B;  1Y0M A;  1Y07 A;  2AT1 B;  3GIB A;  2DZC A;  3QZ9 B;  4LD6 A;  4C92 F;  3VJP A;  2EQK A;  1FMW A;  2JNG A;  1YJN T;  4JRI A;  2F5T X;  1WHG A;  1S72 A;  4QVD A;  2DJZ A;  1KQ1 A;  1XJW B;  4M78 A;  4LD9 K;  3KXT A;  4AT1 B;  2C0T A;  1YHQ T;  4Y28 E;  4ZGD B;  1MNE A;  3M0S A;  2LTO A;  3CCV T;  3UPU A;  1D3B B;  4EMH A;  4F7U E;  4A4K A;  3J7A F;  4C92 D;  3CCV Q;  1I5O B;  2OAU A;  2RK1 A;  3JCM b;  3C94 A;  1B34 B;  2DAQ A;  3A8L B;  2YSQ A;  3CME Q;  2FB7 A;  1WXB A;  1MHN A;  2FVU A;  2E5K A;  2DIL A;  3BE3 A;  4FW1 A;  2JN0 A;  2KMT A;  4E7Z A;  2KBT A;  2LNV A;  2GQV A;  1I0C A;  1SHF A;  4LE9 A;  5LJ5 f;  2QEX T;  2EJ9 A;  3CPW S;  4D8K A;  3QWX X;  2L3S A;  1K1Z A;  1MMA A;  4M75 E;  4E7H A;  1JEG A;  3ZEH A;  4PJO G;  3SWN A;  5KYY A;  1KD1 R;  2O4X A;  2V1Q A;  4UC4 A;  5KYX A;  1J3T A;  2JZ2 A;  3CCU T;  4KRT A;  1VQM T;  2RQW A;  1M1K U;  1FWZ A;  2BE7 D;  1RLP C;  2QDL A;  1VQO Q;  1FMK A;  2PUO B;  5GJW B;  2CS7 A;  2CKK A;  3QJ6 A;  1Q81 R;  1WDX A;  4R55 A;  1JB0 E;  4MZT A;  3JCM V;  1WI7 A;  2CP2 A;  3QSU A;  1VQL A;  4OMM A;  3RKX A;  2LJ0 A;  1Y57 A;  8ATC B;  3E9F A;  3REA B;  3HSB A;  2O01 E;  1RI0 A;  1XQH A;  1TSF A;  3MEV A;  1XNI A;  4ZGE B;  1RAI B;  5M9O A;  2KDS A;  1ZLM A;  1PRL C;  2LQ8 A;  3QBY A;  5HKC A;  2QQ9 A;  1B3Q A;  1S72 T;  2P0P A;  5IH2 A;  2KXD A;  3CC4 Q;  2VB6 A;  1AWW A;  3O8V A;  4PLI A;  4C8Q E;  3CC7 T;  3OYM A;  5I2M A;  4BI3 A;  5GAN 4;  3CC2 Q;  2RHZ A;  2CT4 A;  2RQR A;  2BIV A;  3MHX A;  1VYT A;  3A1P A;  3MP1 A;  2K57 A;  3OBW A;  2E64 A;  3JB9 J;  2NWM A;  2X3X D;  4F7U A;  3UF4 A;  1R0C B;  4QKU A;  2NUZ A;  5GMK m;  2BZX A;  4NS5 A;  5FRN A;  3TVT A;  2RA2 A;  4E47 A;  4M7A C;  4PFO A;  1M9S A;  3LGL A;  4QT7 A;  3V7C A;  2JVV A;  3HFO A;  4J9G A;  3CC7 A;  1N6A A;  2J6F A;  1BI1 A;  2YUN A;  1ZA2 B;  1U8R A;  4HKE A;  1YBY A;  4HT9 A;  5LL6 S;  5EC7 A;  3CQT A;  4M7D E;  5KYW A;  4ZN3 A;  4M7A E;  1GL5 A;  4FSX A;  2GTJ A;  1JRI A;  1CSK A;  4M77 D;  3OYI A;  2HCK A;  4M77 G;  1T3S A;  2HQE A;  2R5A A;  3S6W A;  4M77 E;  2KEA A;  2MPX C;  2LZ6 B;  1M2V A;  1WXT A;  3DLL A;  1JQQ A;  4KUD K;  2SEM A;  1VQ9 A;  2V1R A;  3JRZ A;  4RTU A;  1LCK A;  2CZ1 B;  3OYN A;  4FYV B;  2MCN A;  2YLC A;  4B9X A;  2P0Q A;  1HSQ A;  5GMK h;  4XTZ A;  2J05 A;  4HVV A;  1ZSZ C;  4AFZ C;  1PKS A;  1D09 B;  2HMA A;  3M4G A;  4DBH A;  1YFN A;  2A3L A;  4JS5 A;  2IVW A;  2VXE A;  5GAN e;  1N8R R;  4E7L A;  3QYH B;  2VGN A;  2KNB B;  1IGU A;  3HFN A;  3MEA A;  1A0N B;  5IHN A;  3TU4 K;  1E7O A;  1M4Z A;  3FEO A;  2DPP B;  1GCQ A;  3NTI A;  1QWF A;  1PD0 A;  4E7K A;  3VUZ A;  2KI7 A;  3M0U A;  4DOW A;  2P4T A;  3MEU A;  2COW A;  3OYL A;  3GNG A;  1QVG S;  1YIJ Q;  4BUG A;  4K11 A;  4OB0 B;  3SDZ A;  4ZTJ A;  4XQ3 A;  1K8A C;  2RM4 A;  4V2S A;  2AHJ B;  1Y96 B;  4OVA A;  5FU6 C;  4FT2 A;  2NLU A;  5GAN 3;  1LOJ A;  1K0X A;  1X43 A;  3MPU B;  1XTD A;  1M3B A;  1Q7Y R;  2H8H A;  2GF7 A;  4PFP A;  1RAG B;  2IPO B;  2RHY A;  1B07 A;  3UA6 A;  1YHQ A;  2LCL A;  1V29 B;  1HJD A;  4EMK A;  3SFM A;  1VA7 A;  2FPE A;  2XG8 D;  4M78 G;  2GGR A;  1QWE A;  1YJN A;  2DFU A;  3VRY A;  3L2V A;  1MV0 B;  2R5M A;  2PUK B;  3EGU A;  2PNI A;  3PGG A;  1VQP T;  2EYY A;  4C92 C;  3C95 A;  2FHD A;  3HPW A;  1UE9 A;  2HNI A;  1BB9 A;  1VQ7 T;  1M5Q 1;  5L8R E;  4M77 A;  3CCM A;  5DLQ E;  1AWO A;  4JRP A;  1SHG A;  3G4S A;  4BE0 A;  1Q81 U;  2PVO B;  3OYC A;  1D3B A;  4LXC A;  4A4F A;  1GFD A;  4IIO A;  3FC3 A;  1C1A A;  4M78 C;  4C5H A;  4C8Q A;  3R6O A;  3H8Z A;  3UWN A;  2P0K A;  2XIC A;  3L2Q A;  2QQB A;  2XID A;  4JJB A;  3ZBD A;  2O31 A;  4F17 A;  3SD4 A;  3QWY A;  4N4G A;  1QW1 A;  3Q1J A;  3BDU A;  1EX4 A;  4C0G A;  4C0Z A;  3ULR B;  3R6N A;  1BI3 A;  4J9I A;  3CCE A;  2FRY A;  1PCX A;  2ZAE A;  2YRV A;  1VQ9 T;  1SSF A;  1WFW A;  2QGG A;  3CCE T;  4C5G A;  1NG2 A;  1TG0 A;  2XI9 A;  4AFS C;  5GAN j;  1NLP C;  2DRK A;  1JXO A;  3QPH A;  2KT1 A;  3PVL A;  1R0B G;  2H3E B;  4OMQ A;  3DLM A;  1WIE A;  2XD0 A;  2DTH A;  5FRM A;  1S1N A;  2HZY A;  3MCA B;  4N4I A;  1G83 A;  2X4W A;  5CKE A;  1WZO A;  3CCR Q;  1VQN A;  1AT1 B;  1RAE B;  1WJR A;  3M56 A;  1MND A;  2MI6 A;  4PJO D;  1Q95 G;  3CD6 A;  3L2R A;  1QQJ A;  1QVG A;  2DTI A;  3G4S T;  2K4Y A;  4PJO C;  1K76 A;  3FJ5 A;  3RMS A;  3BY7 A;  5D6X A;  2L89 A;  3CC4 T;  3M4Y A;  4NL3 A;  1WLP B;  3EGD A;  3JCM e;  4KGV B;  2LQN A;  3I55 Q;  4Z02 A;  4FW2 A;  3JSC A;  5HK3 A;  1BBZ A;  2DL3 A;  2EGA A;  4L5G A;  4M4Z A;  3NGP A;  2V8I A;  2HAX A;  2CGH A;  5KYN A;  3OW2 P;  1MMG A;  2W10 A;  2DEQ A;  1YCY A;  2LMJ A;  1BK2 A;  2GTO A;  4JRQ A;  4AG2 C;  7AT1 B;  1ZUK A;  4F7U B;  1E6G A;  4OMO A;  3G71 A;  1OPL A;  3I9Q A;  4M7A F;  2CZ6 B;  1PG5 B;  4M7D F;  3GNF B;  2DA9 A;  1O75 A;  2M1H A;  1RAA B;  2CDT A;  4GLK A;  1M8V A;  4KGX B;  3A98 A;  3OYG A;  2EKH A;  1XOV A;  3LH5 A;  5GAO n;  2X4Y A;  4C8Q F;  1KFZ A;  4RMO A;  2E4H A;  5DY9 A;  1KQS A;  1VQ4 T;  3WVE B;  1KJW A;  4FL6 A;  1I07 A;  2F69 A;  1HYO A;  5AYF A;  4PL6 A;  1VQK A;  3X25 B;  2DF6 A;  3QII A;  1Q7Y U;  4Z89 A;  2RNA A;  4OMF B;  2E1H A;  1IRX A;  2F1L A;  3OSS C;  3PMT A;  4XTU A;  1MMN A;  4JJD A;  1VQP Q;  4JUV A;  3SWN B;  5KYY B;  2DMO A;  2XDP A;  2O4X B;  2GCX A;  2RK2 A;  3EFR A;  5KYU B;  1OV3 A;  4R0K A;  4J9B A;  2WSE E;  1PNJ A;  2DD4 A;  2JJ9 A;  2RF0 A;  1UGV A;  5IXB A;  1M3C A;  1VQ6 A;  1RAH B;  1YNZ A;  2DL5 A;  5LJ5 h;  2RH2 A;  1YI2 T;  3CBO A;  1M1K R;  2MYS A;  2MWO A;  2RO0 A;  3CXC A;  4LUD A;  2KGT A;  4XU0 A;  3KBG A;  1GCP A;  4M78 E;  2K5L A;  5GAN d;  2EKO A;  2MF2 A;  3TQ7 P;  2QG9 B;  4C5E A;  4HCC A;  2ZCF B;  1M1G A;  3EFO B;  4M7A G;  2JTF A;  3J80 E;  2ENM A;  1QLY A;  2K5F A;  2FYK A;  3CMA Q;  1JXM A;  3TCJ A;  3NHN A;  1G2B A;  4HT8 A;  2JS0 A;  2WSF E;  1Q86 C;  2HDA A;  3VYH B;  1JJ2 A;  1M8M A;  1WX6 A;  4MDX A;  2F2X A;  2HD0 A;  3T9N A;  5FU7 B;  3VKI A;  2EYW A;  5GAN h;  1WA7 A;  5CVI A;  4M7D C;  1UTI A;  3ME9 A;  5CCA A;  1UUE A;  4N0A A;  2QI2 A;  4J9H A;  4M75 A;  3OS0 A;  2J06 A;  3H6Z A;  3E19 A;  3CC7 Q;  4EMG A;  5FU7 C;  3EAE A;  1K73 U;  1N9R A;  4MDW A;  1I4K 1;  1D0X A;  1U5S A;  2EBP A;  2AKK A;  2I2L A;  2DRM A;  4ZTF A;  2QA4 A;  2DL7 A;  3HRU A;  4M77 B;  2DJQ A;  1ZHI A;  3M55 A;  3RDV A;  3CBM A;  3V8J A;  3CCS A;  2DX1 A;  2ED1 A;  1X69 A;  2K6D A;  2BZY A;  4II1 A;  4F7U G;  1TS9 A;  1IHW A;  2FO0 A;  2K3B A;  1SRM A;  1NEG A;  3FRN A;  1GRI A;  4ZN1 A;  1AVZ C;  4HXJ A;  4OF1 A;  5LJ5 e;  2E3I A;  2W0Z A;  1M30 A;  4BI4 A;  1KIK A;  4JZ3 A;  3GF5 A;  2O2O A;  1CKA A;  1YWO A;  3L1A A;  1VQM Q;  1Q82 R;  2L2P A;  6AT1 B;  3OYK A;  2EQM A;  1ZUY A;  3JCM W;  3LW5 E;  1EFN A;  2LCS A;  1VQM A;  1G8X A;  1YWP A;  5GAO l;  4MZM A;  2DL8 A;  4QQG A;  2D1X A;  1FX7 A;  1NPP A;  3QYG B;  3VS7 A;  4LDY A;  2YT6 A;  1D1A A;  2X35 A;  2DXC A;  4JRK A;  4PJO A;  1NJI U;  1R77 A;  1C0M A;  1M3A A;  1PSE A;  2CH4 W;  3JB9 D;  4DA4 A;  1N8R U;  4FSS A;  5IN1 A;  1H64 1;  3NFC A;  2ZPG B;  2CP3 A;  3H9N A;  3A8G B;  2E65 A;  3MO8 A;  4Y92 A;  5GAM e;  3URG A;  1VQ5 Q;  1FYN A;  8AT1 B;  2YRC A;  3LH0 A;  4ZGJ B;  2E3H A;  3S3O A;  1IGQ A;  1N5Z A;  5GMK i;  5KCO A;  3CCV A;  3KFV A;  2J6O A;  4KGZ B;  2JS2 A;  1I5L A;  4N0A C;  1VQ4 Q;  3HTR A;  2F2V A;  4E2F B;  2FZC B;  2DEU A;  2JOY A;  4JPB W;  4C0F A;  4JJN K;  4Z8A A;  1KQS S;  3EGD B;  3MJX A;  4C92 B;  4HCB A;  3X26 B;  4GBQ A;  1PC0 A;  3OY9 A;  2B86 A;  2RN8 A;  1K0S A;  2FG0 A;  1GBQ A;  1PM3 A;  3CCR T;  4PNO A;  3CC2 T;  3CCJ A;  1YJ9 Q;  4XU3 A;  2FZG B;  3CCM Q;  2J6K A;  3H0H A;  3PIP A;  1VYV A;  3OA6 A;  2RI5 A;  2OJ2 A;  2QAZ A;  1KD1 C;  1D0Y A;  2J7I A;  2D8J A;  1YJW Q;  1N8R C;  1N9S A;  3EG0 A;  4PJJ A;  1AWX A;  5KE3 A;  3UDC A;  1VQ8 Q;  2YDL A;  5IT9 E;  2ROT A;  1ARK A;  1WXU A;  4F14 A;  5A0D A;  1YIJ A;  2YRD A;  3RMQ A;  2E41 A;  3M58 A;  2XHC A;  3I56 Q;  2VYT A;  4PFZ A;  2V8K A;  1QVF P;  5C0M A;  5CKH A;  4BD3 A;  3VS3 A;  2RD1 A;  1TU0 B;  2RJD A;  2M51 A;  3OQ5 A;  4LDW A;  2EWN A;  5J3B A;  2CZ0 B;  2LJ3 A;  3ASK A;  4J7I A;  3OYA A;  1GBR A;  2LC4 A;  3CBP A;  5GAN f;  3L2W A;  3EFO A;  1AEY A;  2VVK A;  2OTL A;  2YWW A;  2R57 A;  2JUF A;  1FXX A;  1QKX A;  1TXQ A;  3PFS A;  1KK7 A;  3UAT A;  2DIG A;  4B9W A;  4OML A;  3H0I A;  4FU6 A;  3MEW A;  1O9S A;  1TWB A;  2NUT B;  3JB9 F;  3GOX A;  2L8D A;  2OTJ A;  2CP7 A;  3EG9 B;  4YTL A;  1FMV A;  3C12 A;  4IUV A;  3WXM B;  3OS2 A;  4BE2 A;  1BIA A;  3MP8 A;  3OYH A;  3VUB A;  2K3Y A;  2A28 A;  1GXI E;  4M7D B;  4M7D G;  4M7A B;  1D1C A;  2VKN A;  2QK0 A;  1JU5 C;  3O5Z A;  2DIQ A;  1ACM B;  3EG3 A;  4A4G A;  3CCS Q;  1X27 A;  2X51 A;  3BW1 A;  3RKY A;  2C0O A;  1RAC B;  3EG1 A;  4XAX B;  4LDV A;  1RLQ C;  5KYX B;  2EYZ A;  3JCM g;  4RG8 A;  1M27 C;  1H92 A;  2JMA A;  4X34 A;  3I55 A;  3HP9 A;  1YJW T;  4QQ6 A;  4ZNX A;  1I1J A;  1YN8 A;  3DB4 A;  9ATC B;  1MUZ A;  3JCM P;  1T3L A;  2A37 A;  2M02 A;  2K2V A;  1KC8 C;  1KQ2 A;  3SHW A;  4M77 C;  1K9M U;  3OMC A;  3CC2 A;  2EQI A;  1ABQ A;  3VS0 A;  5CR2 A;  2FPD A;  1I81 A;  1Q82 U;  4BDZ A;  4RKU E;  4A4H A;  4KBM B;  4HVU A;  3X20 B;  4E7S A;  1UEC A;  2LQW A;  1WJQ A;  4GLM A;  3RNJ A;  5GAM h;  3V8L A;  2CRE A;  2H3J A;  2ZPH B;  3P8B B;  5FU6 B;  4RTZ A;  1WGS A;  5I11 A;  4RTV A;  3G6E Q;  2CH4 A;  2VAS A;  3CPW A;  4A63 B;  3JCM X;  1Q86 U;  3CMA T;  2JXB A;  1HD3 A;  1CKB A;  3QG1 A;  1NJI R;  1X75 C;  3CCJ Q;  4PLL A;  1UFF A;  4KUI A;  4PJO B;  1JO8 A;  3NTK A;  4RTX A;  2DYB A;  3JB9 G;  1VIF A;  3SWN C;  3D7S B;  2JM8 A;  1BI2 A;  5GAN 6;  3L42 A;  3X28 B;  2DXU A;  2FL7 A;  2Y4Y A;  3RR6 A;  3CCQ T;  2KRS A;  4XTV A;  1W2B S;  5CIU A;  2DXT A;  3FIF A;  4J9C A;  3QDR B;  2MMP A;  1VQK Q;  1MGQ A;  3FJP A;  4JJC A;  2D0Q B;  4GY5 A;  5LJ3 g;  1WQ7 A;  4C5I A;  2ZPF B;  3OYF A;  2EYQ A;  3M59 A;  4EIK A;  3M0R A;  1QP2 A;  5KYW B;  5DM7 R;  2A08 A;  2LNH B;  1WNL A;  2LVM A;  5GAM d;  1JJ2 P;  3CCQ A;  2OTJ T;  3HL8 A;  1X6G A;  1ZQ1 A;  5GAO r;  4X1V A;  1BKB A;  1N27 A;  3JCM f;  3EGX B;  2I0N A;  1UGS B;  2RHX A;  4CC3 A;  1ZSZ B;  3CCL A;  1K73 C;  2G6F X;  4FM4 B;  3HHT B;  1QP3 A;  1NPR A;  3JB9 I;  4M78 B;  4B6M A;  2EPD A;  2Y90 A;  2BUD A;  2EVR A;  2L3Q A;  4XU2 A;  4KH0 B;  2F5K A;  1Q81 C;  3G6E T;  2CUD A;  4IUQ A;  3MET A;  3BDL A;  3OYE A;  1YIT T;  3M0Q A;  2G3R A;  2HKQ B;  4IUT A;  1UGQ B;  3VS5 A;  1NJI C;  3CPF A;  3VV0 A;  2XMF A;  2ZPE B;  4XU1 A;  5GMK e;  2DYI A;  1EZZ B;  2KXC A;  4FYY B;  4OB2 B;  3RKW A;  2EJG A;  4ANJ A;  4QW2 A;  4C92 G;  3SEM A;  3VS2 A;  4DEX A;  2RJF A;  4WF2 A;  2RMO A;  5J39 A;  1VQ8 T;  1UG1 A;  3G71 Q;  4AFQ C;  3G1J A;  2L5Q A;  1NEB A;  1TOV A;  1Z9Z A;  1Q82 C;  4JDS A;  5EG2 A;  3EFS A;  3I56 T;  1V76 A;  1QCN A;  4X9C A;  2KRN A;  2NUT A;  2QXF A;  1YIT A;  2JTM A;  2QGF B;  3EG9 A;  2PQW A;  3N5B B;  1UB4 A;  3I5S A;  3V8K A;  3GLX A;  3PVQ A;  4XTW A;  2O9S A;  1ZA1 B;  2HL5 C;  4FCY A;  4LDX A;  3IQL A;  1D1B A;  2E5Q A;  1WYX A;  4E7J A;  4M7D A;  5LJ5 g;  2KYM A;  3G7Z A;  4M7A A;  1BYM A;  2EQU A;  3THK A;  2LJ1 A;  4ESR A;  4QVC A;  3ER0 A;  4BI8 B;  2PVD B;  1X01 A;  2A7Y A;  4Y91 A;  4KH1 B;  2X4J A;  2AKL A;  1YJ9 T;  1Y71 A;  2RHU A;  2RJC A;  2X9H A;  3UA7 A;  1IRE B;  1K8A U;  1KC8 U;  3JCM J;  4IUP A;  3JCM c;  1YI2 Q;  2IIM A;  3EHR A;  5AT1 B;  2GBQ A;  4OGC A;  1K9A A;  1KC8 R;  4J8O A;  1RUW A;  5LJ3 h;  1RAF B;  1KHC A;  1W2B A;  2KK4 A;  2CZ7 B;  1WHJ A;  1K9M R;  1UHF A;  4J7F A;  1VQO A;  2RJE A;  2WAC A;  2E70 A;  2KRM A;  2L0A A;  2BKD N;  3CME T;  3H0F A;  1VQ5 T;  3FB9 A;  5GAN 8;  4BE1 A;  2IG0 A;  1ZBX A;  5LJ5 j;  2K79 A;  3E1S A;  2DBM A;  3JAM E;  2Y4X A;  5D6Y A;  4RCB A;  1NM7 A;  2ATC B;  1T0H A;  2MAM A;  4QVZ A;  4PJL A;  4J6W A;  1OZ2 A;  1VQ6 Q;  3L2Z A;  3H41 A;  2QTV A;  2HBP A;  3VYG A;  4M75 C;  1TUC A;  4Z88 A;  4OMP A;  2E12 A;  1Q7Y C;  4ORZ A;  2DVJ A;  2WSC E;  4ELY C;  2HSE B;  1JJ2 S;  3PT9 A;  5J26 A;  1QKW A;  4CC7 A;  4DQ2 A;  2GNC A;  4OB1 B;  4MMK A;  2LX7 A;  4BB7 A;  2P4R A;  3M57 A;  5HK0 A;  5GMK j;  4ME7 A;  4NOY A;  5FWB A;  2YUQ A;  5KE2 A;  3M0P A;  2KSS A;  2FZK B;  2M16 A;  2HBW A;  4RUG A;  2D9T A;  5CKB A;  1P92 A;  3E9G A;  2OI3 A;  1ZSG A;  2YUO A;  1W2B P;  2ZPB B;  2GQI A;  2PU9 B;  3INZ A;  1SSH A;  1K9M C;  4IUU A;  5IHI A;  5LJ3 d;  5FLX E;  1M90 U;  5CK9 A;  3CC4 A;  1NBE B;  2PTK A;  2VXF A;  2EW3 A;  4HVW A;  3LLR A;  1TTH B;  5IAY A;  2VV5 A;  1X2K A;  1QVF S;  4RG2 A;  1UGP B;  4Q5W A;  2OTL Q;  4JZ4 A;  1YIT Q;  3CME A;  2M0Y A;  2COZ A;  3UT1 A;  4RTY A;  2CP6 A;  3OYY A;  4J9E A;  4EDU A;  1HK9 A;  1NYG A;  1MMD A;  5IHK A;  4M7A D;  3OYB A;  1ZUU A;  1AZE A;  2ESW A;  2LT4 A;  2DL4 A;  3EHQ A;  4C0D B;  1VYU A;  4LN2 A;  1WPY A;  2B8A A;  1YJ9 A;  1Y96 A;  3CCL T;  2GFA A;  4J83 A;  1YI2 A;  2HSP A;  3ZFJ A;  3S3N A;  2KYB A;  5LJ3 e;  1H3H A;  3ZL7 C;  1F1B B;  1IZ6 A;  2DBK A;  2EJF A;  2MIO A;  3VS1 A;  3LWI A;  1TUD A;  1M1K C;  1ZX6 A;  4EMK B;  1G3T A;  2A36 A;  2EQJ A;  1UEB A;  4ATO A;  4O6J A;  2QA4 T;  3CXC P;  2AIR B;  1UJ0 A;  2K9G A;  4FT4 A;  4P5N A;  4E7I A;  3P8H A;  2KR3 A;  4A54 A;  2DE0 X;  3M5A A;  1VQK T;  1EIF A;  3M0T A;  4M78 D;  2R58 A;  4OMN A;  3FDR A;  2X4X A;  3NMZ C;  3RBB B;  3RES A;  2DZ9 A;  1QCO A;  1WQW A;  4F16 A;  5GAN 2;  1VQ4 A;  4J5Y A;  2QA4 Q;  1IXD A;  1WHL A;  1YCS B;  4AFU C;  4L6V 5;  2AZV A;  4HA8 A;  2EAY A;  1BI0 A;  1NYF A;  3GPL A;  1Y7X A;  1H3Z A;  2EIF A;  1HXD A;  3HKS A;  3HRS A;  1LPL A;  4LNP A;  4O5V A;  4M78 F;  3JB9 H;  1SEM A;  2RQV A;  1PRM C; 
#chains in the Genus database with same CATH homology
 2RB6 A;  1WJS A;  4JRQ A;  2EQK A;  3LX7 A;  3OW2 A;  2JNG A;  4RKU E;  4A4H A;  1YJN T;  4JRI A;  2F5T X;  3LGF A;  4KBM B;  3X20 B;  2MWP A;  3NTH A;  4QVD A;  2DJZ A;  1S72 A;  1KQ1 A;  4F7U B;  4M78 A;  4LD9 K;  3M9Q A;  3KXT A;  1WJQ A;  5GAM h;  3V8L A;  2H3J A;  2ZPH B;  1YHQ T;  3P8B B;  5FU6 B;  1OYX A;  1WGS A;  5KCH A;  4Y28 E;  4ZGD B;  3PNW C;  3CPW A;  3RUX A;  3JCM X;  2LTO A;  3G71 A;  1Q86 U;  3CMA T;  3CCV T;  4M7A F;  3QG1 A;  4OGE A;  2XK0 A;  3UPU A;  2CZ6 B;  1D3B B;  1X75 C;  5CO7 A;  4EMH A;  4F7U E;  4M7D F;  3GNF B;  3TEE A;  4A4K A;  4CI0 C;  3J7A F;  4PLL A;  4C92 D;  1O75 A;  4KUI A;  4PJO B;  2OAU A;  2RK1 A;  3JCM b;  3C94 A;  3M54 A;  1B34 B;  2M1H A;  1BIB A;  2DAQ A;  3NTK A;  3A8L B;  4BDY A;  3JB9 G;  1VIF A;  3SWN C;  4GLK A;  1M8V A;  4FIB A;  1BI2 A;  5GAN 6;  3L42 A;  3X28 B;  3OYG A;  2FB7 A;  1XOV A;  2M0O A;  1VQ6 T;  2LDM A;  1MHN A;  5GAO n;  5HY6 A;  2DXU A;  3OYJ A;  2FVU A;  1YJW A;  3C4S A;  2FL7 A;  2Y4Y A;  2X4Y A;  1G3S A;  4C8Q F;  3PIO A;  5LJ3 j;  1G5V A;  3CCQ T;  1DJ7 B;  5GAM f;  4RMO A;  1M90 C;  5DY9 A;  1KQS A;  4XTV A;  1VQ4 T;  2JN0 A;  5CIU A;  1W2B S;  3WVE B;  2KMT A;  4FL6 A;  2LNV A;  2DXT A;  3FIF A;  3QDR B;  2F69 A;  2MMP A;  2GQV A;  2LT1 A;  4BY6 B;  2DKG A;  1MGQ A;  5AYF A;  2XDD A;  4MZP A;  5LJ5 f;  3FJP A;  4M75 B;  4PL6 A;  5D6W A;  2QEX T;  2EJ9 A;  1VQK A;  3CPW S;  3X25 B;  3CXC S;  1VQ5 A;  2D0Q B;  4GY5 A;  1QVP A;  4M75 E;  5LJ3 g;  1QVF A;  3QII A;  1Q7Y U;  1WQ7 A;  4OMF B;  3OS1 A;  4E7H A;  2E1H A;  3OS5 A;  3V7S A;  3ZEH A;  4C5I A;  1VQO T;  3OSS C;  4PJO G;  3PMT A;  2ZPF B;  4XTU A;  3SWN A;  3OYF A;  2EYQ A;  2O4X A;  4JUV A;  3M59 A;  3SWN B;  1VIE A;  4LDU A;  2XDP A;  2O4X B;  4UC4 A;  2GCX A;  1QP2 A;  2RK2 A;  5DM7 R;  3EFR A;  2JZ2 A;  3CCU T;  4M7D D;  2XKO C;  4PJO F;  1VQM T;  1KD1 U;  3M53 A;  1WNL A;  2LVM A;  5GAM d;  1M1K U;  3CCQ A;  2OTJ T;  1FWZ A;  3HRT A;  5GAN g;  2WSE E;  3HL8 A;  1KG1 A;  2DD4 A;  1ZQ1 A;  2PUO B;  5GAO r;  1VQ6 A;  2CS7 A;  3RIR A;  2CKK A;  3QJ6 A;  1BKB A;  1N27 A;  2RH2 A;  3JCM f;  2LRQ A;  5LJ5 h;  1YI2 T;  3OBY A;  3CBO A;  3SB2 A;  1UGS B;  2RHX A;  4R55 A;  1JB0 E;  4MZT A;  3JCM V;  3CCL A;  1K73 C;  4FM4 B;  2MWO A;  4M75 D;  2RO0 A;  4EMK C;  3HHT B;  3CXC A;  5A2Q E;  3QSU A;  1VQL A;  2QQA A;  3RKX A;  4XTY A;  1QP3 A;  4XU0 A;  2OTL T;  3KBG A;  2DD5 A;  4VUB A;  2RHI A;  3E9F A;  4M78 E;  2K5L A;  5GAN d;  2LX9 A;  3HSB A;  4A4E A;  2O01 E;  2RI3 A;  1NPR A;  3JB9 I;  4JS4 A;  2MF2 A;  2EKO A;  1RI0 A;  4HCC A;  4C5E A;  1XQH A;  4M78 B;  4DOV A;  2Y90 A;  1XNI A;  2BUD A;  2L3R A;  3MEV A;  2ZGW A;  4QQD A;  4ZGE B;  2DK3 A;  2KDS A;  3QXE B;  5M9O A;  4XU2 A;  2ZCF B;  2LQ8 A;  2F5K A;  1Q81 C;  3QBY A;  3G6E T;  5HKC A;  2QQ9 A;  3CCS T;  1M1G A;  4IUQ A;  4M7A G;  3MET A;  3BDL A;  3GP8 A;  1S72 T;  2P0P A;  2JTF A;  3OYE A;  3J80 E;  1YIT T;  2G3R A;  3I56 A;  4IUT A;  1W4S A;  3DKM A;  2DTO A;  3O8V A;  1UGQ B;  4PLI A;  3JCM h;  4C8Q E;  3OYM A;  2VC8 A;  3CC7 T;  4XTX A;  5I2M A;  4BI3 A;  5GAN 4;  4D6W A;  2VGM A;  1NJI C;  3QJY A;  2K5F A;  2FYK A;  3CPF A;  2RHZ A;  3VV0 A;  1VQ8 A;  2ZPE B;  4XU1 A;  3TCJ A;  2BIV A;  3MHX A;  5GMK e;  4BAC A;  4HT8 A;  2WSF E;  1Q86 C;  3VYH B;  3MP1 A;  1JJ2 A;  2K57 A;  3OBW A;  4OB2 B;  3RKW A;  3OYD A;  2E64 A;  2EJG A;  3JB9 J;  4MDX A;  4QW2 A;  4C92 G;  4F7U A;  3I55 T;  2HD0 A;  4KUL A;  3T9N A;  4C8Q C;  3CCM T;  5FU7 B;  3LWH A;  3VKI A;  5GMK m;  5GAN h;  4NS5 A;  5FRN A;  2RJF A;  4C8Q D;  5CVI A;  4WF2 A;  4M7D C;  3ME9 A;  4BY6 C;  3RER A;  2D6F A;  4J6Y A;  2RA2 A;  4E47 A;  5CCA A;  5J39 A;  3CD6 T;  4N0A A;  2E10 A;  2QI2 A;  5GAM g;  1VQ8 T;  4M75 A;  3OS0 A;  1M9S A;  3AHU A;  3H6Z A;  3E19 A;  2L5Q A;  3LGL A;  4EMG A;  2VUB A;  5FU7 C;  3EAE A;  3V7C A;  4TVR A;  1N9R A;  4C8Q G;  1Q82 C;  1K73 U;  2JVV A;  3HFO A;  4JDS A;  5EG2 A;  1B34 A;  1LNX A;  1I4K 1;  1N6A A;  4MDW A;  3EFS A;  3X24 B;  3I56 T;  2I2L A;  4X9C A;  2C06 A;  1BI1 A;  4ZTF A;  2QA4 A;  2QXF A;  4HKE A;  1U8R A;  1YBY A;  2XDB A;  4HT9 A;  1YIT A;  3HRU A;  3QHS A;  5LL6 S;  2JTM A;  4M77 B;  3M55 A;  1ZHI A;  5DLO A;  3G6E A;  4M7D E;  3CBM A;  2PQW A;  3V8J A;  3CCS A;  3N5B B;  1UB4 A;  2K5I A;  3V8K A;  4ZN3 A;  4M7A E;  3GLX A;  4FSX A;  4XTW A;  1JRI A;  4LDX A;  4II1 A;  4C92 A;  4F7U G;  3DB3 A;  4M77 D;  3OYI A;  4M77 G;  2E5Q A;  4EPC A;  2HQE A;  2R5A A;  3S6W A;  4E7J A;  4M7D A;  5LJ5 g;  4M77 E;  3G7Z A;  4M7A A;  1JBM A;  3FRN A;  5I21 A;  3DLL A;  1BYM A;  2EQU A;  4ZN1 A;  4OF1 A;  4QVC A;  4M77 F;  3ER0 A;  4BI8 B;  2PVD B;  5LJ5 e;  4KUD K;  4M7A C;  1M1F A;  1G3Y A;  1VQ9 A;  1X01 A;  2A7Y A;  3JRZ A;  4Y91 A;  4BI4 A;  2X4J A;  3GF5 A;  1YJ9 T;  5GAO m;  3LYI A;  1Y71 A;  2RHU A;  2RJC A;  5I2S A;  2CZ1 B;  1IRE B;  3OMG A;  3L1A A;  1K8A U;  3OYN A;  1KC8 U;  3JCM J;  4IUP A;  3JCM c;  3JAM E;  2EQM A;  3OYK A;  3JCM W;  2YLC A;  2K3X A;  3LW5 E;  2P0Q A;  4B9X A;  5GMK h;  1VQM A;  4XTZ A;  4OGC A;  5FRO A;  2LQK A;  4J8O A;  5GAO l;  3J81 E;  5LJ3 h;  4MZM A;  1KHC A;  1W2B A;  4QQG A;  1OZ3 A;  3M4G A;  1FX7 A;  1NPP A;  2KK4 A;  2CZ7 B;  2A3L A;  2QQR A;  3S3M A;  3QYG B;  4JS5 A;  2IVW A;  4LDY A;  2VXE A;  4J7F A;  2RJE A;  5GMK l;  1VQO A;  2X35 A;  5GAN e;  2WAC A;  1KHI A;  2E70 A;  2V8J A;  2DXC A;  4JLG A;  4JRK A;  4E7L A;  4PJO A;  3QYH B;  1NJI U;  2BKD N;  2VGN A;  3CME T;  1YIJ T;  1PSE A;  1VQ5 T;  3HFN A;  3FB9 A;  3MEA A;  4PKC C;  2E6N A;  5GAN 8;  4BE1 A;  3TU4 K;  3JB9 D;  4DA4 A;  2IG0 A;  1ZBX A;  1M4Z A;  5LJ5 j;  3E1S A;  1N8R U;  3OW2 S;  3FEO A;  2DPP B;  1H64 1;  2Y4X A;  3F70 A;  5D6Y A;  5IN1 A;  3NTI A;  3NFC A;  4RCB A;  5LJ5 d;  4PJO E;  2ZPG B;  3QO3 A;  1G3W A;  2MAM A;  3A8G B;  4QVZ A;  4E7K A;  2E65 A;  2YHT A;  1OZ2 A;  3MO8 A;  4J6W A;  3VUZ A;  4DOW A;  2P4T A;  3URG A;  3MEU A;  3QKJ A;  3L2Z A;  5LJ3 f;  5GAM e;  3OYL A;  2CYZ B;  3GNG A;  1QVG S;  5CAI A;  4BUG A;  4NL2 A;  4OB0 B;  4OB3 B;  3SDZ A;  4ZTJ A;  2QTX A;  3LH0 A;  1VQ7 A;  2HBP A;  4XQ3 A;  1K8A C;  2RM4 A;  3VYG A;  4V2S A;  4M75 C;  2AHJ B;  1Y96 B;  3CCJ T;  4ZGJ B;  2E12 A;  4OVA A;  5FU6 C;  4FT2 A;  3CCR A;  4IKF A;  2YLB A;  2NLU A;  1Q7Y C;  1VQP A;  5GAM j;  5GAN 3;  4CRI A;  1LOJ A;  3S3O A;  2GFU A;  5GMK i;  2WSC E;  1XTD A;  4ELY C;  5KCO A;  3CCV A;  1JJ2 S;  3CMA A;  3PT9 A;  1I5L A;  5J26 A;  5C6S A;  4N0A C;  2GF7 A;  1I8F A;  4DQ2 A;  2RHY A;  3G71 T;  3QZ5 B;  1YHQ A;  2LCL A;  1V29 B;  2JOY A;  4EMK A;  3A8M B;  4C0F A;  3SFM A;  4JJN K;  4OB1 B;  4MMK A;  4BB7 A;  5CKD A;  3M57 A;  2XG8 D;  1KQS S;  4C92 B;  2ZZD A;  4M78 G;  5HK0 A;  3X26 B;  4HCB A;  5GMK j;  4ME7 A;  2QDY B;  4NOY A;  2QQS A;  5KE2 A;  1OI1 A;  3OY9 A;  2PVG B;  2KSS A;  3P8D A;  1YJN A;  3OB9 A;  3L2V A;  2M16 A;  2R5M A;  4RCC A;  2PUK B;  4JLI A;  3QUI A;  3PGG A;  1VQP T;  4C92 C;  3CCR T;  3C95 A;  2D9T A;  4PNO A;  5CKB A;  2FHD A;  1P92 A;  2XU8 A;  3E9G A;  3CCJ A;  3CC2 T;  4R56 A;  3HPW A;  4XU3 A;  3BFM A;  3OSV A;  2HNI A;  1VQ7 T;  2ZPB B;  2PU9 B;  1M5Q 1;  3INZ A;  1K9M C;  5L8R E;  3PIP A;  4IUU A;  4M77 A;  3OA6 A;  5DLQ E;  3CCM A;  5A0G A;  2RI5 A;  5LJ3 d;  3KUF A;  5FLX E;  4JRP A;  1KD1 C;  1M90 U;  5CK9 A;  3G4S A;  3CC4 A;  3VU3 C;  4BE0 A;  5GAO q;  4M75 G;  1Q81 U;  1VUB A;  2PVO B;  1N9S A;  3A8H B;  1N8R C;  3OYC A;  2VXF A;  1D3B A;  4A4F A;  3LLR A;  5GAN 7;  5KE3 A;  1VQN T;  5IAY A;  3UDC A;  2VV5 A;  2RI2 A;  4C8Q B;  2KQW A;  3FC3 A;  5IT9 E;  3A5Z B;  4M78 C;  1UGP B;  4RG2 A;  4C5H A;  1QVF S;  3PMI A;  4Q5W A;  4C8Q A;  3R6O A;  1NE8 A;  5A0D A;  3H8Z A;  3RMQ A;  3CME A;  4HCZ A;  1YIJ A;  3A8O B;  3UT1 A;  2ZPI B;  2P0K A;  3UWN A;  5KH6 A;  2E41 A;  2XIC A;  3M58 A;  2XHC A;  2VYT A;  3JCM Q;  3L2Q A;  3OYY A;  2V8K A;  4EDU A;  1HK9 A;  2QQB A;  2XID A;  5C0M A;  5CKH A;  4BD3 A;  2M9U A;  3ZBD A;  2RD1 A;  2RJD A;  5J3B A;  3OQ5 A;  4LDW A;  2EWN A;  4M7A D;  2CZ0 B;  3OYB A;  3SD4 A;  3V7R A;  3ASK A;  4J7I A;  4N4G A;  1QW1 A;  3OYA A;  2LC4 A;  3FLG A;  3CBP A;  3Q1J A;  2LT4 A;  5GAN f;  3BDU A;  3L2W A;  3CC7 A;  4C0G A;  2KAF A;  4C0D B;  4C0Z A;  2OTL A;  4M75 F;  2R57 A;  3CEY A;  2JUF A;  1VQL T;  1BI3 A;  1FXX A;  3CCE A;  1WPY A;  1UGR B;  3L2U A;  2B8A A;  1U1T A;  1YJ9 A;  4F7U F;  1Y96 A;  3PFS A;  2KVQ G;  3CCL T;  2YRV A;  1VQ9 T;  1SSF A;  4ELZ C;  2DIG A;  2GFA A;  3MP6 A;  4MML A;  4B9W A;  1TH7 A;  4J83 A;  1YI2 A;  3CCE T;  4C5G A;  4FU6 A;  4J6X A;  3JCM d;  3ZFJ A;  3S3N A;  3MEW A;  1O9S A;  2EFI A;  5CQX A;  5LJ3 e;  3JB9 F;  2E6Z A;  3GOX A;  4OP0 A;  2L8D A;  1AHJ B;  3WVD B;  2XI9 A;  5GAN j;  1IZ6 A;  2OTJ A;  2EJF A;  4YTL A;  3C12 A;  5CKF A;  4IUV A;  2LCC A;  3WXM B;  3LWI A;  4X9D A;  3CCU A;  3OS2 A;  1M1K C;  4EMK B;  3PTA A;  1BIA A;  1G3T A;  4XK8 E;  3MP8 A;  3QPH A;  3OYH A;  4BE2 A;  5A0L A;  3VUB A;  3TRE A;  2K3Y A;  2EQJ A;  1UEB A;  4C92 E;  3DLM A;  4M7D B;  4M7D G;  1GXI E;  2XD0 A;  4C0D C;  2DTH A;  4M7A B;  5GAO p;  5FRM A;  4ATO A;  4O6J A;  2HQX A;  2QA4 T;  3MCA B;  4IUR A;  2DIQ A;  4FT4 A;  4P5N A;  5CQY A;  4N4I A;  4E7I A;  2X4W A;  5CKE A;  4A4G A;  4L59 A;  3P8H A;  2DO3 A;  4A54 A;  3BW1 A;  3M5A A;  1VQN A;  3RKY A;  1WJR A;  2QEX A;  1VQK T;  1EIF A;  4M78 D;  3M56 A;  1NZ9 A;  2R58 A;  1U1S A;  2MI6 A;  4PJO D;  3FDR A;  2X4X A;  3CD6 A;  3RES A;  3L2R A;  1RL2 A;  4XAX B;  2DZ9 A;  4LDV A;  1QVG A;  1WQW A;  1PSF A;  2DTI A;  3G4S T;  2K4Y A;  4PJO C;  5GAN 2;  1VQ4 A;  4J5Y A;  4A53 A;  3RMS A;  3BY7 A;  3JCM g;  4RG8 A;  5D6X A;  2L89 A;  4L6V 5;  3CC4 T;  4X34 A;  3M4Y A;  3I55 A;  5GAN 5;  4NL3 A;  3HP9 A;  1YJW T;  1X6O A;  4KT0 E;  4QQ6 A;  4HA8 A;  1R8O B;  1LJO A;  3DB4 A;  2DVE A;  3JCM e;  2EAY A;  3JCM P;  1BI0 A;  4Z02 A;  3JSC A;  5HK3 A;  3GPL A;  1Y7X A;  4L5G A;  2K2V A;  2KY9 A;  1KC8 C;  2DXB A;  4N4H A;  2EIF A;  1KQ2 A;  1HXD A;  3HKS A;  1H3Z A;  2V8I A;  4M77 C;  1Y07 A;  3HRS A;  3OMC A;  1K9M U;  2HAX A;  2CGH A;  3CC2 A;  4O5V A;  3GIB A;  2DZC A;  2DEQ A;  4M78 F;  1YCY A;  5CR2 A;  3JB9 H;  3QZ9 B;  4LD6 A;  1I81 A;  4C92 F;  1Q82 U;  3VJP A;  4BDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...