4EMGA

Crystal structure of splsm3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
71
Chain Sequence
EPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTTIRKHYEMLFVRGDSVILIAPPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm3
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 16
structure length 71
sequence length 85
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emgA00
2DTOA 5GANf 1D3BA 3JCMX 4M75A 3BDUA 4C8QA 5GANg 2E65A 3AHUA 3JCMh 1WNLA 4EMKB 2DJZA 1I4K1 1WPYA 5LJ3e 2HNIA 2VXFA 3JCMb 1HK9A 4JRKA 3RKXA 3JCMQ 5GAMh 3JB9H 4N0AA 1LOJA 4HA8A 5GAMj 3JB9F 3QHSA 4M77A 3RKYA 4PJOD 4V2SA 4A53A 4M75E 4C8QE 1I5LA 4F7UG 5GAOn 2VXEA 1KQ1A 5GMKh 4XU0A 3JB9D 4M78B 1BIAA 3L2ZA 2K57A 3V8LA 4EMGA 3FB9A 1LNXA 2I2LA 5GMKj 4M7DG 1JBMA 4M77E 3V8KA 4C92B 3PGGA 1YCYA 2RM4A 4QVCA 2DKGA 1X01A 4PJOE 3RESA 4M78G 1WQ7A 4M75F 2E10A 2E64A 2QTXA 3JCMg 4C8QF 4EMHA 5GAMf 3QSUA 3FIFA 4F7UA 2DXTA 3V7RA 1B34B 4C92G 2RA2A 5I21A 5GAMg 4M75D 5GAMd 4HT8A 4C8QD 5GAN4 3HFOA 4M7DA 4NL3A 4M77F 2E41A 4M75C 2EJ9A 1WQWA 4C8QC 1HXDA 4PJOF 5GAN8 4M7AG 3M4GA 5LJ5d 3JCMe 3BFMA 4F7UE 4M77D 4XU1A 4XTVA 4N0AC 4QVDA 4J6WA 4M77C 4C92A 4NOYA 3L1AA 5GANe 1LJOA 5LJ5h 4PJOC 5CAIA 5LJ5j 1Y96A 4XTUA 1N9RA 2YLCA 3JCMV 4MMKA 4XU3A 4X9DA 1N9SA 4M7AA 4F7UF 4J5YA 2VC8A 4X9CA 4A54A 1M5Q1 4WF2A 3JCMJ 3RERA 3QUIA 1KQ2A 1TH7A 3SWNC 4M7DF 4XTYA 4EMKA 3JB9G 4M7AE 5LJ3h 5GAN2 4M7DD 4XQ3A 2RD1A 4MMLA 3RIRA 4Y91A 5LJ3j 3RUXA 5LJ5f 5GAOr 4PJOA 3JCMW 1U1TA 4M7DC 1U1SA 1D3BB 4J6YA 4PNOA 4M75B 4NL2A 5LJ5g 5GAN7 4C8QB 5GAOp 2EWNA 4M78A 3JB9I 4XTXA 5GAMe 5GAN3 4C92D 3JB9J 4M7AF 5GMKl 3JCMP 4M75G 2CGHA 2ZGWA 4M77B 4C92C 3GIBA 4M7DE 3HSBA 4PJOB 4M7AD 2YHTA 3V7CA 5GMKe 5GAOq 4M78E 5GAOm 4HT9A 5LJ3f 1B34A 4M7AC 5GMKi 5LJ3g 5LJ3d 3JCMc 4C92E 2RB6A 3FJPA 4PJOG 2JN0A 2YLBA 2Y90A 4XTZA 1M8VA 3INZA 2EAYA 4JUVA 1JRIA 3QO3A 3SWNB 4EMKC 5GAN5 5GANd 2FB7A 5GMKm 2EJGA 3EFRA 4M78F 5GAOl 1MGQA 4F7UB 3RKWA 4JLIA 2EJFA 1H641 2FYKA 1I81A 4M78D 4C92F 4XU2A 1I8FA 4M7DB 3HFNA 5GANh 3BW1A 2DTHA 4XTWA 4RCBA 3V8JA 2DVEA 3EFSA 4J6XA 4M78C 4OP0A 5GANj 2E1HA 5GAN6 1BIBA 4DQ2A 2DZ9A 4JRIA 4C8QG 5LJ5e 2DXUA 3BY7A 3SB2A 3V7SA 3JCMf 2DTIA 2DEQA 3SWNA 1Y96B 5DY9A 3JCMd 4M77G 4RCCA 4M7AB 3VU3C 2DZCA
chains in the Genus database with same CATH superfamily
4JJNK 3HKSA 5GANf 1GFCA 4B9XA 3MPUB 4EMKB 1Q86C 2O9SA 3QZ5B 4BD3A 1KFZA 2A3LA 3A8MB 1U5SA 2GTOA 2DIQA 2EIFA 1SF9A 2XU8A 4M7DG 2GQIA 2LJ1A 1M90C 2VKNA 4ZGDB 3M5AA 1KQSP 2LP5A 4C92G 5DLQE 4IUUA 3C94A 1N8RU 1NG2A 4M77F 5FLXE 1K8AR 2DRMA 3CCLT 3LW5E 1YWPA 5CK9A 3M0QA 3G4SA 2KYMA 2RK1A 1QVGP 1Y96A 4M7AA 4LE9A 2ESWA 1SHGA 2G6FX 2J7IA 3URGA 4BE1A 3TCJA 3SWNC 3CCUA 1ZSZB 4F14A 1YI2Q 2FPDA 1IRXA 2J05A 4M7DC 3TSZA 1SEMA 2EWNA 1VQ5A 2AIRB 3CXCS 1AHJB 4J9FA 2RHUA 4M75G 1YN8A 4C92C 1SRMA 1VA7A 2YHTA 2HAXA 4HT9A 5HK0A 5LJ3g 3OSSC 3O5ZA 2JN0A 3EG9A 2FG0A 2FZGB 4PFOA 1MGQA 3E19A 1I8FA 1XQHA 5D6YA 5FU6C 3SB2A 3V7SA 2C0OA 4WCIA 1MMNA 4HVWA 3CCMA 2PUOB 4C0FA 3BDUA 4BY6B 4BE2A 1YHQQ 3AHUA 2ROLA 1FXXA 5KH6A 3E2UA 3QHSA 4E7HA 3NHNA 2QQ9A 2V8IA 3JB9D 1TG0A 1G83A 4EMGA 2DA9A 3MKDA 4ME7A 1VIFA 2F2VA 1EX4A 5GAMf 7AT1B 1Q82U 3VKIA 1YNZA 3L2RA 3OW2A 2HDAA 2XD0A 2OJ2A 4OMFB 1QVGS 2FZKB 2CP0A 2KRMA 1QP3A 3CCRQ 3FLGA 1LJOA 5CAIA 1VQOQ 1NEGA 2C0TA 2HL5C 5FWBA 4AG1C 1M3CA 2NUTA 2LQKA 4ORZA 1JJ2S 2L3PA 3M0UA 3WXMB 6AT1B 2QQBA 2P0KA 4P5NA 1X43A 3I55A 5GAOr 1UECA 3VV0A 3T9NA 5FWCA 1OI1A 2X51A 5IT9E 2C06A 2DBKA 3M0TA 4OB2B 3V7CA 2F2XA 2QA4Q 2E5KA 3CC7A 3NPFA 4KGVB 1AWXA 1JXOA 2AHJB 3JCMc 3FJPA 2GGRA 1Q86U 4A4HA 4EMKC 3HRUA 3GOXA 5GAOl 1M2OA 2SRCA 3QWXX 4N4HA 2LT4A 3V8JA 4OP0A 1VQKT 3DB4A 1K73R 2DNUA 4OMMA 5L8RE 1M90U 2FL7A 5KE3A 1VYTA 4RTZA 1UE9A 1PKTA 4BDZA 3SWNA 2D1XA 3JCMd 3OYHA 1UTIA 1X75C 1TTHB 2D9TA 3PVQA 2VGNA 2LCLA 1AVZC 3QYGB 2JT4A 4PJOD 3RKYA 3VS7A 1Y07A 5A0DA 5GAOn 2LCSA 2CP5A 4M78B 3S3MA 2JVVA 3PGGA 3A8OB 3RESA 1BBZA 4TVRA 1YIJA 3MO8A 1ZHIA 2CT3A 1ZSZC 4JJCA 1SSFA 5I21A 2EYXA 3EGXB 1M9SA 1WHMA 3VUZA 1HXDA 4HVUA 1VQ4A 3OYJA 1GL5A 4IIOA 2KT8A 1W2BP 2MF2A 3OYNA 1LPLA 2ENMA 1M5Q1 2A37A 3JCMJ 2K2MA 2OTLA 3IQLA 1S72Q 2X4WA 4FW1A 1E6GA 1U06A 2CUBA 1VQ9A 4C5GA 3WVEB 2R5AA 2EQMA 3JCMP 2P0PA 1R77A 2G3RA 1PD1A 3I56Q 2PZ1A 4PJOG 3OS0A 4BY6C 3L42A 1BK2A 2EJGA 2DYIA 1RABB 5IXFA 3CC2T 1I81A 4M78D 5KE2A 2DK3A 1UHFA 4J6XA 1VQ8Q 3BDLA 3TREA 1VQ4Q 3EAEA 4FIBA 1YJWA 3VS2A 3CC4Q 2DILA 2EGAA 5FRNA 2K4YA 1VQ7T 1OV3A 4OB0B 1G2BA 2FHDA 2D8HA 2K7AA 2RK2A 4LDVA 5D7UA 1BCMA 2FRYA 2JUFA 2E70A 1TOVA 1IGQA 1PWTA 3PMIA 3FB9A 2PQWA 1TXQA 2YUNA 3EGDB 3QG1A 1PHTA 1VQ9Q 3J7AF 1X01A 2JJ9A 1UG1A 3FIFA 1VQNQ 3F70A 2HD0A 1V1CA 1WA7A 3RMSA 3CCJA 1RAFB 3ER0A 3CCVQ 1IREB 3EHQA 1VQMT 1W2BS 2RH2A 5CKFA 3OY9A 2E3IA 3OYEA 4LDWA 3CMEA 4DEYA 2PVDB 4LDXA 4RG2A 2KXDA 4X9CA 2QQAA 4GBQA 4M7DF 1X6OA 2KK4A 2M0OA 1NYFA 5IHIA 1OU9A 2RD1A 3GBQA 1IO6A 2OAUA 4MZPA 3JCMW 1U1SA 4PNOA 3A5ZB 2DX1A 3U23A 4C8QB 2XG8D 3VS4A 4A4FA 2AKLA 2GCXA 3OS1A 5CO7A 2KAFA 2OTJQ 2HMAA 4FYYB 4N4GA 1VQ6A 1ABOA 2CSQA 1BCOA 4J9EA 4FYWB 2MWOA 4WTOB 4BDYA 1RAIB 2Y90A 2YLBA 4QQDA 1I0CA 2JMCA 2DE0X 1RLQC 3SEMA 4F04B 3H0HA 4F7UB 1WXBA 1BKBA 5CQYA 4KULA 2RQRA 1TU0B 2GBQA 4M78C 2KXCA 2RF0A 2LZ6B 3H9NA 1N8RR 2DD4A 2EQJA 2QEXA 2DEQA 1VOMA 5KCHA 4JZ4A 4KUIA 3ULRB 2LC4A 1EIFA 3JB9H 2GFAA 3QKJA 4M77A 3DLMA 2HSEB 2HBWA 1BIAA 3CPFA 4B9WA 1VIEA 3L2VA 4PKCC 4C92B 3OYYA 2RM4A 5J39A 1YITT 3CPWA 4RTYA 4AFUC 5GAMd 4C8QD 5GAN4 3HFOA 3OQ5A 1PSFA 3SD4A 1UB4A 4HCKA 1TWBA 5KYWB 4RTTA 4J9IA 3EH2A 5LJ5h 1QKWA 2MCNA 3SHWA 3X26B 3MJXA 2L5QA 1X2QA 2EFIA 3VS0A 1VQLT 1YJNT 2YRCA 3CMAA 5GAN2 4XQ3A 3X25B 2COZA 4M75B 1M1FA 8ATCB 3JB9I 1X27A 1VUBA 1K9MU 1MNDA 1IHWA 1WJSA 4JDSA 3CCST 1HD3A 3R6NA 2RI2A 1W4SA 1B34A 4IUTA 2EQUA 2RB6A 3QZ9B 4RKUE 1AEYA 3QPHA 1A0NB 3OYDA 2EYQA 1ABQA 1B7TA 3H0IA 1WHHA 3HP9A 3M0RA 4E7SA 4ZGJB 2DVEA 4OMQA 4A4EA 3M0PA 1QP2A 1JQQA 1OQKA 4JRIA 4C8QG 3CXCP 5LJ5e 2DXUA 2EPDA 1MUZA 2MK5A 4A4KA 1RI9A 4C5HA 1LVKA 2DZCA 2MYSA 2IIMA 3CCQQ 4EDUA 3HRSA 1ZUUA 3M55A 5KYYB 4N0AA 2JW4A 1NYGA 3JB9F 2M51A 4D8DA 2PVGB 3PE0A 3S3OA 4F7UG 2RI5A 1IGUA 2XHCA 5HK3A 1H3ZA 3HL8A 3REAB 1I07A 1GCQC 2DKGA 1YI2A 4BI8B 1G3YA 4EMHA 3OYAA 1UGVA 2W10A 3EG2A 3OYCA 2P4RA 3PTAA 4M75D 4HT8A 2LJ3A 4F17A 2ZPGB 4BE0A 3VS1A 4LNPA 4C8QC 3LH5A 5L23A 3JCMe 2BE7D 1UUEA 3CBPA 1UDLA 1Q86R 1QVPA 2FPFA 5FRMA 1GCPA 1V76A 4XTUA 2O9VA 3META 5KYXB 3G4ST 1VQLQ 3VS3A 4PL6A 2ED1A 1GXIE 2ZPHB 1VQPQ 3RIRA 5EG2A 1ZQ1A 3CD6T 4ZTFA 2PNIA 2JTMA 2Y4XA 3M58A 1XOVA 1YJ9Q 4QKUA 1KC8U 1UFFA 1T3SA 2F69A 1J3TA 2GFUA 4M78E 3L2UA 4JS5A 5GMKi 1CKAA 1K8AC 2X4YA 1YHQA 2QDYB 1M8VA 2MI6A 3OBWA 4JPBW 1JJ2P 2H8HA 1UGQB 2QGGA 2NUPB 5GANh 4RCBA 5DLOA 1F1BB 3L2QA 1UGPB 2BZYA 3OYKA 2ZCFB 2YT6A 1FX7A 1OU8A 2QQSA 3M57A 2K6DA 1M2VB 4OMPA 1WXTA 4E7KA 2QTVA 3UF4A 2DJZA 3CCRA 3RKXA 2WACA 3CCMT 1VQOA 2H3JA 1B3QA 2DXBA 3TU4K 4KRTA 4XU0A 1K0SA 1UHCA 3GPLA 2MPXC 2KE9A 3V8KA 3J81E 4QVZA 3MEUA 1P92A 3J80E 1M1KU 3GNFB 3MEAA 1WX6A 1BYMA 2K2VA 2JM9A 3FDRA 3HPWA 1UEBA 1Y71A 3HHTB 4RTWA 4E47A 2E41A 4M75C 1ARKA 4DBHA 3TVTA 4MDWA 2LJ0A 1KIKA 4XTVA 2QA4A 3QJYA 2LQNA 2HKNA 5GANe 4LD9K 1WIEA 1RLPC 4FSXA 1OZ3A 1N9RA 3PIPA 4KGXB 3LWHA 1N9SA 1Q81U 3H8ZA 2O31A 3QUIA 1D0XA 2O4XA 1GFDA 2D6FA 2KT1A 1OYXA 4A63B 4PJNA 2R58A 5KYNA 2CUDA 2P0QA 3CCLQ 5GAN7 2KRNA 2GF7A 3I55T 2VUBA 3EG0A 2AT1B 1D1CA 2M16A 4PJOB 2HSPA 2KR3A 5LJ3f 5IXBA 2L3QA 3EFOA 1EZZB 2LNHB 5KYUB 1NZ9A 3EG1A 4XTZA 5FU7B 3CC7T 2VVKA 2DIGA 4OB1B 3THKA 1WHJA 4M78F 4IKFA 1TS9A 3LGFA 2QK0A 1QVFP 4O5VA 4OGCA 4XK8E 1FWZA 3TEEA 2ZAEA 1Z9QA 2K5IA 1G3WA 1ZBXA 2ROTA 2DMOA 4FYVB 1ZA2B 1PG5B 1RL2A 1KSWA 1SPKA 3A98A 3L2WA 2JXBA 1MMAA 3JCMX 3P8DA 2JOYA 2D8JA 1RADB 1PRLC 2VXFA 5GAMh 3E9FA 4C8QE 5GMKh 3FJ5A 3R6OA 2RQTA 3X28B 1JBMA 4OF1A 4BACA 5M9OA 1M27C 5D6WA 3C95A 2E10A 1S72A 5D6XA 2NUZA 4K11A 2O88A 1AWOA 2JS0A 4DBFA 3C4SA 4FCYA 3G6ET 3DLLA 1U3OA 2WSEE 4X34A 4M7DA 3QXEB 1K73C 1YIJT 2DF6A 4HXJA 4RTVA 4F7UE 2L3RA 1AZEA 3VRZA 2ZPEB 4C92A 1X69A 2LDMA 3I56A 4IUPA 1K8AU 5LJ5j 4Q5WA 3JCMV 1WXUA 4MMKA 4X9DA 5CKDA 2KI7A 2LCCA 1TUCA 3OYFA 3RERA 2RHZA 1MV3A 2KBTA 5AT1B 1BI2A 3RR6A 2EKHA 4CC2A 2DRKA 4MMLA 5KYWA 1VQ8A 2K3YA 2OTLT 5GAMe 2DYBA 1QQJA 1WI7A 4M7DE 3D7SB 5KCOA 3GIBA 3CC4A 2C0IA 2RJDA 5GMKe 1PNJA 2M02A 3M0SA 4C92E 3EH1A 1OX9A 4QT7A 2EAYA 1QVFS 1NEBA 2FB7A 1WYXA 3OA6A 4ZN1A 3A8HB 2COYA 4Z02A 1H641 1PRMC 4L6V5 2V1QA 4Z88A 2DL5A 1KG1A 1SG5A 3M53A 4A4GA 5J3BA 4CI0C 1C1AA 2CYZB 1VQNA 1Q7YR 1Y96B 2X35A 5DY9A 2AZVA 4DOWA 5I2SA 4RCCA 3QDFA 4M7AB 2XDDA 3CCVA 4OGEA 1D3BA 3MP6A 1YJWT 1WNLA 1NM7A 3CCET 4QQGA 3DB3A 1KQSA 1LOJA 3CPWS 3ME9A 1BU1A 1KHCA 3OYLA 4M75E 1RAHB 1VQKQ 2QQRA 1D0ZA 2K57A 2BZ8A 3ZFJA 1YBYA 2VV5A 5CKEA 2E3HA 1NJIR 3A1PA 5HY6A 1H3HA 4IUQA 4C8QF 3S3NA 1QVGA 1RAGB 3V7RA 1K9MR 3G6EQ 2LQ8A 4J9GA 2OTJA 4MZMA 1RUWA 3TQ7P 1Y7XA 4Y28E 3E1SA 3CCJT 4PJOC 1KHIA 4F7UF 1YCSB 5FU7C 1R8OB 2FRWA 3RDVA 2L0AA 3RMQA 3CMET 4EMKA 2CH4A 3MP1A 2V8JA 3JAME 1KD1R 5GAOp 5LJ5g 4NL2A 4DOVA 3I5SA 2FEIA 4M4ZA 2A08A 3NMZC 3M4YA 3QIIA 4LUDA 5A2QE 4M7AD 5GAOm 1VQ7A 1PCXA 1FYNA 2CDTA 1VQ6T 2RHIA 2MOXA 1N27A 1WZOA 4KH1B 1M1GA 1AT1B 3REBB 4C92F 2KY9A 3OS5A 5GANj 2E1HA 2E4HA 3M54A 1ZSZA 4LDYA 2DTOA 3OB9A 4L5GA 2NUTB 4LN2A 2QEXT 1W70A 1UJ0A 5CIUA 3CC2Q 1HK9A 1QW1A 4FT4A 2FZCB 3MP8A 2DXCA 4RG8A 1MV0B 4NS5A 4UC4A 3QBYA 4Z89A 3MEWA 2QYZA 2DERA 1WQ7A 3X24B 4M75F 2E64A 2KGTA 5CKBA 1XNIA 2XKOC 1KC8R 2DPPB 2PVOB 1D09B 1VQ7Q 2VWFA 2A28A 2YWWA 4M7AG 1N8RC 4RTUA 1K0XA 4XU1A 2GTJA 2KYBA 2XI9A 2QASA 1H92A 4XU3A 2VGMA 3OW2P 4JZ3A 2VC8A 2BTTA 2YXYA 2OX7A 3LWIA 3JRZA 2X4JA 2K3BA 2M1HA 1UJYA 2LX7A 3M59A 2BUDA 2JS2A 1VQMQ 1IB8A 1ZA1B 3P8BB 2YSQA 2E5QA 1DJ7B 4AFSC 4M7AC 3CCQA 3EHRA 5LJ3d 1PC0A 3LH0A 5CCAA 1OEBA 3OMGA 1LCKA 4AT1B 4ZGEB 3AT1B 3BE3A 1M1KR 4PJOA 1MMGA 2KROA 1NBEB 5KYUA 2VYTA 4PJJA 1K76A 1VYUA 2DLPA 1YWOA 3OYGA 3NTKA 1E7OA 2CZ1B 4FSSA 5GANg 2KVQG 2NLUA 4DA4A 4DBRA 3OSVA 3JCMh 3G71T 4HCCA 2HNIA 1Q81R 1R0BG 3G1JA 1X2KA 5GAMj 2DL3A 1WHGA 1KQ1A 2VXEA 3LYIA 3PIOA 1VQLA 1Q82R 3V8LA 5GMKj 2I2LA 1EFNA 2XIDA 2K5LA 1VQPA 4PJOE 3OBYA 1B07A 4EIKA 1IZ6A 1W2BA 2QI2A 1YJ9A 1YI2T 4RUGA 2WSFE 3BFMA 4KUDK 1BI3A 2R5MA 1D1AA 2DAQA 4J6WA 4DEXA 1BI1A 3OW2S 2SEMA 4AMCA 3QYHB 4LD6A 1YITQ 2I0NA 5EC7A 1ACMB 1FMKA 1TH7A 2QAZA 3FEOA 4ZN3A 2K3XA 4M78A 2YDLA 5LL6S 2EQKA 2LRQA 1AZGB 5C0MA 3PVLA 2HQHA 2YRVA 1M30A 4BB7A 4D8KA 1VYVA 1QMCA 1FMWA 3EGXA 1YJNQ 1OZ2A 2KEAA 2L3SA 1WHLA 2RNAA 4FM4B 5GMKm 2DO3A 1M90R 1YHQT 2XDBA 2M0YA 4CC7A 3CQTA 3CCUT 3RBBB 2CS7A 4XAXB 2OAWA 1JB0E 1RAEB 2O01E 2MWPA 4DQ2A 4OVAA 3CCSQ 3H6ZA 2DZ9A 2QDLA 4GY5A 4OMLA 1VQ5T 1R0CB 3VU3C 4L59A 1HSQA 4BI4A 2FPEA 2HEQA 3G71Q 3NTIA 4CC4B 4J9DA 3JCMQ 2EQIA 2DM1A 1GRIA 2RHYA 5IHKA 1O9SA 2YUPA 4A53A 3UT1A 4D6WA 2R57A 3CCRT 1SHFA 2OI3A 1G3TA 3E9GA 2L2PA 5IHNA 4C5IA 1VQOT 1QWEA 1QWFA 1K1ZA 1WJRA 1PD0A 4QVCA 5A0GA 2F2WA 2KNBB 2P84A 4QQ6A 8AT1B 3CD6A 3CCLA 2DXTA 4JJDA 5GAMg 2RA2A 1N5ZA 3Q1JA 4E7ZA 2B86A 2EJ9A 3I35A 4PJOF 5CVIA 3JV3A 4C5EA 3LX7A 4QVDA 4R56A 3C12A 2L89A 2RJCA 2HBPA 2QA4T 2LT1A 2HZYA 5IN1A 2E6ZA 3QDRB 2D0QB 3HRTA 4M7AE 2YRDA 2F5KA 3VYGA 4CC3A 3CBOA 2IG0A 1PM3A 4Z8AA 3EGDA 3JB9J 4YTLA 1ZUYA 2AZSA 2CGHA 4M77B 4FW2A 1WDXA 2EVRA 5GAOq 2HCKA 3LLRA 2EBPA 4OMNA 3G4SQ 1W1FA 4GLMA 4JRPA 2V1RA 3P8HA 4QW2A 2IVWA 2LVMA 1M3BA 2ABLA 3CCUQ 5CKHA 3CD6Q 4J9HA 2ZPIB 2RO0A 4BI3A 3HFNA 2KMTA 1GBRA 5C6SA 4E2FB 1KJWA 1C6VX 4J9BA 1VQ5Q 1GCQA 1T3LA 1KQSS 2JNGA 2CREA 4IUVA 2MIOA 2WSCE 4LXCA 2QG9B 1TSFA 3N5BB 4C8QA 4AFQC 1QCOA 5FW9A 3JCMb 3X20B 4JRKA 3O8VA 1NPRA 4FT2A 5J26A 2CP6A 2BZXA 1TUGB 3G7ZA 4F7UA 1Y0MA 1B34B 3VS5A 4PLIA 1D1BA 3SFMA 4DBQA 2KRSA 4NL3A 3KFVA 1AD5A 1S72T 5LJ5d 3CCMQ 2CH4W 4Y92A 4M77D 4KGZB 2KSSA 1Q95G 3WVDB 1K9AA 3CPWP 1HJDA 3I56T 1SSHA 1KQ2A 4PFZA 1WLPB 3ZL7C 4XTYA 1YFNA 4LUEA 3NFCA 3JB9G 3GNGA 5LJ3h 3A8GB 4KT0E 2JMAA 2RPNA 3CEYA 5CQXA 4AFZC 2YUQA 1JU5C 1AWWA 4XTXA 1VQ8T 2A36A 4M7AF 2E6NA 2DL8A 4J7FA 1VQ4T 2HQXA 2DJQA 4ATOA 4J83A 3CC4T 2ZPBB 3CXCA 4E7IA 1JXMA 2EYWA 4JUVA 3QO3A 3EFRA 1VQKA 2RJFA 3NTHA 4J7IA 4XU2A 2VB6A 3BW1A 3VS6A 4HCZA 3EFSA 3H0FA 5FROA 3I55Q 3ZBDA 2J06A 3HTRA 3OS2A 1G8XA 2X3WD 2A7YA 2F5TX 3G6EA 1VQ9T 4RTXA 1Y57A 4M77G 2A0FB 3CC7Q 1VQNT 2E12A 3VJPA 4M75A 1MHNA 3UPUA 4B6MA 2V8KA 3MHXA 2CP2A 5LJ3e 5DM7R 1X6BA 3CCVT 2CKKA 4V2SA 4ELZC 2PTKA 4J9CA 2Y4YA 3OYMA 1LNXA 1OX8A 4RMOA 2QTXA 1MMDA 3QSUA 5ECAA 4II1A 2BKDN 2ZPFB 2ZZDA 3NGPA 1K4US 2CZ7B 4ZTJA 3M56A 3ASKA 1Q7YC 4M77C 2OTJT 2NWMA 3L1AA 3UA7A 1BI0A 2O2OA 1H8KA 4J5YA 2X4XA 2PU9B 3I9QA 1PKSA 2GQVA 2LNVA 5KYYA 4ELYC 2EGEA 2RJEA 1YIJQ 2QGFB 2RQWA 3RUXA 1QKXA 3EG9B 1G5VA 3KBGA 3LGLA 2DBMA 1NJIC 1JJ2A 2JTEA 2L8DA 5HKCA 2ZGWA 2RHXA 4F16A 1YP5A 1K9MC 9ATCB 1T0HA 5GJVB 2YUOA 1S1NA 1TUDA 3CCEA 1SRLA 2CZ6B 1HYOA 1UGRB 3CC2A 1WJQA 5GANd 4JLGA 2W0ZA 1I5OB 2EJFA 1ZX6A 5I11A 4N4IA 2OTLQ 1ZLMA 4PFPA 2LX9A 2AK5A 4J8OA 4FYXB 3JSCA 5KYXA 1KK7A 5GAN6 1AOJA 5HCKA 4MDXA 2BE9B 2PUKB 2DL7A 2LQWA 4C0ZA 4KH0B 1O75A 2LTOA 3GP8A 1KD1C 3RNJA 2E65A 2O4XB 1OULA 4E7JA 1I4K1 2DVJA 3QJ6A 4ANJA 1NLPC 1CSKA 4R55A 3GF5A 3PMTA 1I5LA 4GLKA 1PSEA 3L2ZA 3OYBA 4C0DB 1ZUKA 2ECZA 4X1VA 1YCYA 1I1JA 3PT9A 3KUFA 4M78G 4PJMA 3JCMg 3PFSA 1K73U 3I5RA 3EFOB 4LDUA 1YJWQ 1VQMA 3S6WA 2NUPA 3CCEQ 4JJBA 4MZTA 4KBMB 4PLLA 2K9GA 4N0AC 4HCBA 3QWYA 4AG2C 5A0LA 2BIVA 2CT4A 2YLCA 1M2VA 2EYYA 4FU6A 4E7LA 1WFWA 2RI3A 2DEUA 2P4TA 3VYHB 5LJ5f 1C0MA 1U1TA 1Z9ZA 2CP7A 2EW3A 4VUBA 2RQUA 1XJWB 5I22A 1M3AA 3CCJQ 5GMKl 1QVFA 1OPKA 2J6KA 3UATA 3HSBA 1U8RA 1M4ZA 1KC8C 4HVVA 4OMOA 1M8MA 1BB9A 4PK4A 1SKUB 3OMCA 1N6AA 2FO0A 3CMEQ 3INZA 1E6HA 3M9QA 1WHKA 2AKKA 2ATCB 3SWNB 3VUBA 5GAN5 2JZ2A 1FMVA 3EGUA 3CCQT 2COWA 2RN8A 4JLIA 2VASA 2H3EB 2FYKA 4M7DB 2DTHA 2KQWA 4XTWA 4BUGA 3CMAT 2DFUA 3OYIA 1OPLA 1UGSB 1BIBA 1V29B 2J6FA 3BY7A 1XTDA 1G3SA 2GNCA 1WGSA 3JCMf 2DTIA 1JEGA 2J6OA 3TSWA 4JRQA 2DETA 1VQ6Q 2EKOA 4ZNXA 3VRYA 3DKMA 2RMOA 2XICA 2HL3A 1QCFA 1Q7YU 1WPYA 2ED0A 3H41A 3UWNA 2HQEA 3ZEHA 2V26A 4HA8A 2MAMA 2JM8A 1RAAB 2K79A 1YITA 1ZBJA 3UDCA 2QXFA 2CZ0B 4IURA 2D0NA 4M77E 5FU6B 4OB3B 1W6XA 1JO8A 2XK0A 3A8LB 4HKEA 2XMFA 2MMPA 2B8AA 1M1KC 1X6GA 3CBMA 4R0KA 2QEXQ 2HKQB 2JTFA 1VQPT 3UA6A 1NPPA 1WQWA 5IH2A 1NJIU 5GAN8 3M4GA 3MEVA 1QLYA 4NOYA 1YJ9T 1RACB 1YJNA 2M9UA 3FC3A 1CKBA 1NLOC 4PJLA 1NE8A 1MNEA 5AYFA 1D0YA 2X9HA 4A54A 4WF2A 1T0JA 4EPCA 1Q81C 1RI0A 4C0GA 2F1LA 5CR2A 2NYSA 5GJWB 1ZSGA 2IPOB 1IXDA 4M7DD 4Y91A 2LMJA 3EG3A 5LJ3j 1Q82C 4IIMA 2CSIA 2CP3A 1D3BB 4J6YA 2EYZA 3CCSA 4E6RA 4ESRA 3KXTA 5GAN3 4C92D 3GLXA 3SDZA 2Z0WA 2DL4A 1IHVA 1KD1U 2X3XD 3G71A 1QCNA 3C0CA 4O6JA 1GBQA 4CRIA 1AWJA 1JRIA 3FRNA 4FL6A 3RKWA 1OOTA 2K5FA 5IAYA 2EGCA 3CMAQ 4JS4A 2DD5A 3MCAB 2KDSA 4C0DC 5I2MA 3PNWC 2FVUA 2XDPA 2RQVA
chains in the Genus database with same CATH topology
3CCVA 4JJNK 4OGEA 3HKSA 5GANf 1D3BA 3MP6A 3N5BB 4KUIA 4C8QA 1YJWT 1WNLA 4B9XA 3CCET 4QQGA 4EMKB 1Q86C 2LC4A 3QZ5B 1EIFA 4JRKA 3X20B 3JCMb 4BD3A 3O8VA 3DB3A 3JB9H 1NPRA 1LOJA 3CPWS 2GFAA 1KQSA 3QKJA 4M77A 4FT2A 3DLMA 3ME9A 3OYLA 1KHCA 4M75E 2A3LA 2QQRA 3A8MB 2DIQA 1BIAA 2EIFA 2K57A 2XU8A 3CPFA 4M7DG 3ZFJA 4B9WA 1VIEA 5J26A 4PKCC 4C92B 3OYYA 2RM4A 5J39A 1YBYA 3L2VA 2VV5A 5CKEA 1YITT 1M90C 5HY6A 4IUQA 4C8QF 3S3NA 3CPWA 4ZGDB 1QVGA 3G7ZA 3M5AA 4F7UA 3V7RA 1B34B 4C92G 5DLQE 4IUUA 4PLIA 3SFMA 5GAMd 4C8QD 5GAN4 3C94A 2LQ8A 3HFOA 1N8RU 3OQ5A 4NL3A 4M77F 2OTJA 1PSFA 3SD4A 5FLXE 1S72T 1UB4A 4MZMA 5LJ5d 3CCLT 3LW5E 4M77D 4PJOE 5CK9A 1Y7XA 2KSSA 4Y28E 3G4SA 3E1SA 3WVDB 3CCJT 5LJ5h 4PJOC 2RK1A 1Y96A 3X26B 4M7AA 1KHIA 2L5QA 4F7UF 2EFIA 5FU7C 1R8OB 3URGA 3I56T 4BE1A 1KQ2A 3TCJA 1VQLT 3SWNC 3CCUA 1YJNT 3RMQA 4XTYA 3CMET 4EMKA 3NFCA 3JB9G 3MP1A 3CMAA 3GNGA 5LJ3h 5GAN2 2V8JA 4XQ3A 3A8GB 4KT0E 3X25B 3CEYA 3JAME 4M7DC 5GAOp 5CQXA 4M75B 4NL2A 1M1FA 5LJ5g 2EWNA 4DOVA 3JB9I 1VQ5A 3CXCS 4XTXA 1AHJB 1VUBA 1VQ8T 1K9MU 4M7AF 2E6NA 2RHUA 1WJSA 3M4YA 4M75G 4JDSA 3QIIA 4C92C 3CCST 2RI2A 5A2QE 2YHTA 5GAOm 1VQ7A 2HAXA 4HT9A 1W4SA 4J7FA 5HK0A 4M7AD 1VQ4T 1B34A 2HQXA 5LJ3g 3OSSC 4IUTA 2EQUA 2RB6A 1VQ6T 3QZ9B 2JN0A 4J83A 3CC4T 4ATOA 2ZPBB 3CXCA 4E7IA 2RHIA 4RKUE 4JUVA 3QO3A 1N27A 3QPHA 3EFRA 1VQKA 1MGQA 2RJFA 3NTHA 3OYDA 2EYQA 3E19A 1M1GA 4J7IA 4C92F 3HP9A 4XU2A 1I8FA 2KY9A 3BW1A 4ZGJB 3OS5A 4HCZA 2DVEA 1XQHA 3EFSA 5GANj 5FROA 2E1HA 4A4EA 3ZBDA 1QP2A 5D6YA 4JRIA 3OS2A 4C8QG 5FU6C 5LJ5e 2DXUA 2A7YA 3SB2A 2F5TX 3G6EA 3V7SA 1VQ9T 3M54A 4A4KA 4M77G 4LDYA 4C5HA 2DZCA 2DTOA 3OB9A 4L5GA 2PUOB 3CCMA 1VQNT 2E12A 3VJPA 4C0FA 4M75A 3BDUA 4BY6B 2QEXT 1MHNA 4BE2A 3UPUA 3AHUA 2V8KA 4EDUA 1FXXA 3HRSA 3M55A 3MHXA 5CIUA 5LJ3e 5DM7R 1HK9A 1QW1A 5KH6A 4FT4A 3CCVT 2CKKA 4N0AA 3JB9F 3QHSA 2PVGB 4V2SA 4E7HA 3MP8A 2DXCA 2QQ9A 2V8IA 4RG8A 2RI5A 2XHCA 4ELZC 4F7UG 4NS5A 5HK3A 3S3OA 3JB9D 1H3ZA 2Y4YA 3HL8A 4EMGA 3OYMA 4UC4A 1LNXA 3QBYA 4RMOA 4ME7A 3MEWA 2DKGA 1VIFA 1WQ7A 3X24B 4M75F 2E64A 2QTXA 4BI8B 1G3YA 4EMHA 3OYAA 5GAMf 1YI2A 3QSUA 3OYCA 5CKBA 1Q82U 3VKIA 3PTAA 1XNIA 2XKOC 4M75D 2DPPB 2PVOB 2BKDN 4II1A 3L2RA 2ZPFB 3OW2A 4HT8A 2ZPGB 2ZZDA 4BE0A 4C8QC 2XD0A 4M7AG 3JCMe 1N8RC 2CZ7B 4ZTJA 4XU1A 4OMFB 3CBPA 3M56A 3ASKA 1Q7YC 1QVGS 4M77C 2OTJT 1QP3A 3FLGA 3L1AA 1QVPA 1LJOA 5FRMA 2XI9A 5CAIA 1BI0A 4XTUA 3META 4XU3A 2VGMA 3G4ST 4J5YA 2X4XA 2VC8A 2LQKA 2PU9B 4PL6A 1JJ2S 3WXMB 1GXIE 2GQVA 3LWIA 2ZPHB 2QQBA 2LNVA 2X4JA 3JRZA 2P0KA 2M1HA 4ELYC 2RJEA 3RIRA 4P5NA 3RUXA 3I55A 3M59A 5EG2A 5GAOr 1ZQ1A 1G5VA 2BUDA 3KBGA 3CD6T 4ZTFA 3LGLA 3VV0A 2JTMA 2Y4XA 3M58A 3T9NA 1NJIC 1OI1A 1XOVA 1JJ2A 5IT9E 2L8DA 1KC8U 2C06A 3P8BB 5HKCA 2ZGWA 4OB2B 2F69A 2RHXA 1K9MC 2GFUA 3V7CA 4M78E 3L2UA 4JS5A 3CC7A 2E5QA 1DJ7B 4M7AC 5GMKi 3CCEA 3CCQA 1K8AC 2AHJB 2X4YA 5LJ3d 3JCMc 1YHQA 2CZ6B 2QDYB 3FJPA 1UGRB 3LH0A 3CC2A 1Q86U 1M8VA 2MI6A 1WJQA 5CCAA 4A4HA 3OBWA 4EMKC 5GANd 3HRUA 3OMGA 4JLGA 3GOXA 5GAOl 2EJFA 4ZGEB 1UGQB 4N4HA 4N4IA 2LT4A 5GANh 4PJOA 2LX9A 4RCBA 3V8JA 5DLOA 4OP0A 4J8OA 3JSCA 3L2QA 1VQKT 3DB4A 5GAN6 1UGPB 5L8RE 3OYKA 1M90U 4MDXA 2ZCFB 2FL7A 2VYTA 5KE3A 2PUKB 4BDZA 1FX7A 2QQSA 3M57A 3SWNA 4C0ZA 1O75A 2LTOA 3JCMd 3OYHA 3GP8A 1KD1C 3OYGA 3NTKA 1X75C 2D9TA 2CZ1B 4E7KA 5GANg 2KVQG 2E65A 2NLUA 2O4XB 3OSVA 3JCMh 3G71T 4E7JA 4DA4A 2DJZA 2LCLA 1I4K1 2VGNA 3CCRA 2HNIA 4HCCA 3RKXA 2WACA 3QJ6A 3CCMT 1VQOA 4R55A 2H3JA 3GF5A 3PMTA 3QYGB 2DXBA 3RKYA 5GAMj 3TU4K 1Y07A 5A0DA 4PJOD 1I5LA 5GAOn 2VXEA 1KQ1A 4GLKA 3LYIA 4XU0A 3PIOA 1VQLA 4M78B 1PSEA 3V8LA 3L2ZA 5GMKj 3OYBA 3GPLA 3S3MA 2I2LA 2JVVA 4C0DB 3V8KA 3J81E 4QVZA 3PGGA 1YCYA 3MEUA 2XIDA 1P92A 2K5LA 3A8OB 3PT9A 3RESA 3KUFA 4M78G 3J80E 4TVRA 3GNFB 3MEAA 3OBYA 1YIJA 3MO8A 1M1KU 3JCMg 1ZHIA 3PFSA 1IZ6A 1W2BA 1BYMA 1K73U 5I21A 1SSFA 2QI2A 2K2VA 3FDRA 4LDUA 1VQMA 3HPWA 1UEBA 1M9SA 1Y71A 3HHTB 3S6WA 4E47A 2E41A 4M75C 1YJ9A 3VUZA 1YI2T 1HXDA 2WSFE 4MDWA 3BFMA 4KBMB 4MZTA 4KUDK 4PLLA 1VQ4A 4XTVA 4N0AC 1BI3A 2R5MA 2DAQA 3OYJA 3QJYA 4J6WA 2QA4A 4HCBA 1BI1A 5GANe 3OW2S 5A0LA 4LD9K 2BIVA 2MF2A 4FSXA 1OZ3A 1N9RA 2YLCA 3PIPA 3QYHB 3LWHA 1Q81U 1N9SA 4LD6A 3OYNA 3H8ZA 1M5Q1 4FU6A 4E7LA 3JCMJ 3QUIA 1TH7A 2O4XA 2RI3A 2OTLA 2P4TA 2D6FA 3FEOA 1OYXA 4ZN3A 2R58A 3VYHB 5LJ5f 2P0QA 1U1TA 2X4WA 5GAN7 4VUBA 2K3XA 4M78A 1VQ9A 5LL6S 2EQKA 4C5GA 2GF7A 2LRQA 3WVEB 2R5AA 5C0MA 2EQMA 5GMKl 3I55T 2VUBA 3JCMP 1QVFA 2P0PA 2YRVA 2M16A 3HSBA 4PJOB 1U8RA 1M4ZA 1KC8C 4M7DA 4BB7A 5LJ3f 2G3RA 3OMCA 1N6AA 1NZ9A 1OZ2A 4XTZA 5FU7B 4PJOG 3INZA 3OS0A 4BY6C 3M9QA 3VUBA 3L42A 3SWNB 5GAN5 3CC7T 2DIGA 4FM4B 4OB1B 2JZ2A 5GMKm 2EJGA 2DO3A 4M78F 3CCQT 4IKFA 1YHQT 3LGFA 4JLIA 4O5VA 2XDBA 4OGCA 4XK8E 1FWZA 2FYKA 3CCUT 1I81A 4M78D 3TEEA 3CC2T 2CS7A 5KE2A 4M7DB 2DK3A 2DTHA 2KQWA 4XAXB 4XTWA 4BUGA 3CMAT 2K5IA 4J6XA 3OYIA 1UGSB 1JB0E 2O01E 2MWPA 1BIBA 1G3WA 4OVAA 4DQ2A 3H6ZA 1ZBXA 2DZ9A 1V29B 4GY5A 3BDLA 3TREA 3BY7A 1XTDA 1G3SA 1VQ5T 1WGSA 3JCMf 2DTIA 3EAEA 4FIBA 1RL2A 1YJWA 3L2WA 4JRQA 3VU3C 4L59A 2EKOA 4BI4A 3DKMA 5FRNA 2K4YA 3JCMX 1VQ7T 2XICA 3NTIA 3P8DA 2FHDA 2JOYA 4OB0B 1Q7YU 2RK2A 4LDVA 1WPYA 3JCMQ 2VXFA 3UWNA 5GAMh 2HQEA 3ZEHA 3E9FA 4HA8A 2MAMA 2RHYA 2JUFA 1O9SA 4A53A 3UT1A 1YITA 4C8QE 2E70A 3UDCA 2QXFA 4D6WA 5GMKh 2R57A 2CZ0B 3R6OA 4IURA 3CCRT 3PMIA 4C5IA 1G3TA 3E9GA 3FB9A 2PQWA 1VQOT 3X28B 1JBMA 3QG1A 4M77E 1WJRA 4QVCA 5FU6B 5A0GA 4OF1A 1X01A 2XK0A 4OB3B 5M9OA 4BACA 3J7AF 5D6WA 3A8LB 3C95A 2E10A 4QQ6A 4HKEA 1S72A 5D6XA 3CD6A 3FIFA 3CCLA 2MMPA 2DXTA 3F70A 2B8AA 2RA2A 5GAMg 1M1KC 3CBMA 3C4SA 2HD0A 3Q1JA 2JTFA 3RMSA 4X34A 2WSEE 3G6ET 3DLLA 3QXEB 3CCJA 1YIJT 2EJ9A 1NPPA 1WQWA 1K73C 1NJIU 3ER0A 4PJOF 5GAN8 3M4GA 3MEVA 1IREB 5CVIA 4F7UE 1VQPA 2L3RA 4C5EA 3LX7A 4QVDA 1VQMT 1W2BS 2RH2A 2ZPEB 5CKFA 4C92A 4R56A 2LDMA 3C12A 4NOYA 2L89A 3I56A 3OY9A 1YJ9T 2RJCA 4IUPA 1YJNA 5LJ5j 1K8AU 2M9UA 4Q5WA 4LDWA 3OYEA 3FC3A 3CMEA 3JCMV 2HBPA 4MMKA 2PVDB 4X9DA 4LDXA 4RG2A 2QA4T 2LT1A 1NE8A 5CKDA 5AYFA 4X9CA 4A54A 2QQAA 2LCCA 5IN1A 3OYFA 4WF2A 2E6ZA 3RERA 2RHZA 4EPCA 1Q81C 3QDRB 1RI0A 1X6OA 2KK4A 4M7DF 4C0GA 2M0OA 1BI2A 2D0QB 5CR2A 3HRTA 4M7AE 4M7DD 2RD1A 4MMLA 1VQ8A 4Y91A 5LJ3j 1Q82C 2OAUA 4MZPA 3JCMW 2F5KA 1U1SA 1D3BB 4J6YA 4PNOA 3A5ZB 3CBOA 2K3YA 3VYGA 4C8QB 3CCSA 2XG8D 4A4FA 3KXTA 2IG0A 2GCXA 3OS1A 2OTLT 5CO7A 2KAFA 5GAMe 4C92D 5GAN3 3GLXA 3JB9J 4YTLA 3SDZA 4M7DE 2CGHA 4M77B 5KCOA 4N4GA 1VQ6A 3GIBA 3CC4A 1KD1U 2RJDA 5GMKe 5GAOq 3LLRA 3G71A 2MWOA 4O6JA 4JRPA 4C92E 4BDYA 4CRIA 2Y90A 2YLBA 4QQDA 3P8HA 2EAYA 1QVFS 1JRIA 4QW2A 2IVWA 2FB7A 2LVMA 3OA6A 3FRNA 4F7UB 4FL6A 1BKBA 3A8HB 5CQYA 3RKWA 4ZN1A 4KULA 1H641 5CKHA 4Z02A 2K5FA 5IAYA 2ZPIB 2RO0A 4L6V5 4BI3A 4JS4A 3HFNA 2KMTA 4M78C 5C6SA 2DD5A 1KG1A 4A4GA 3M53A 3MCAB 5J3BA 4CI0C 2KDSA 4C0DC 1VQPT 2CYZB 2DD4A 5I2MA 1VQNA 2EQJA 3PNWC 1KQSS 2JNGA 2QEXA 2DEQA 2FVUA 1Y96B 2X35A 5DY9A 4IUVA 2XDPA 4DOWA 2WSCE 4RCCA 5I2SA 4M7AB 5KCHA 2XDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  5GAN f;  1D3B A;  3JCM X;  4M75 A;  3BDU A;  4C8Q A;  5GAN g;  2E65 A;  3AHU A;  3JCM h;  1WNL A;  4EMK B;  2DJZ A;  1I4K 1;  1WPY A;  5LJ3 e;  2HNI A;  2VXF A;  3JCM b;  1HK9 A;  4JRK A;  3RKX A;  3JCM Q;  5GAM h;  3JB9 H;  4N0A A;  1LOJ A;  4HA8 A;  5GAM j;  3JB9 F;  3QHS A;  4M77 A;  3RKY A;  4PJO D;  4V2S A;  4A53 A;  4M75 E;  4C8Q E;  1I5L A;  4F7U G;  5GAO n;  2VXE A;  1KQ1 A;  5GMK h;  4XU0 A;  3JB9 D;  4M78 B;  1BIA A;  3L2Z A;  2K57 A;  3V8L A;  4EMG A;  3FB9 A;  1LNX A;  2I2L A;  5GMK j;  4M7D G;  1JBM A;  4M77 E;  3V8K A;  4C92 B;  3PGG A;  1YCY A;  2RM4 A;  4QVC A;  2DKG A;  1X01 A;  4PJO E;  3RES A;  4M78 G;  1WQ7 A;  4M75 F;  2E10 A;  2E64 A;  2QTX A;  3JCM g;  4C8Q F;  4EMH A;  5GAM f;  3QSU A;  3FIF A;  4F7U A;  2DXT A;  3V7R A;  1B34 B;  4C92 G;  2RA2 A;  5I21 A;  5GAM g;  4M75 D;  5GAM d;  4HT8 A;  4C8Q D;  5GAN 4;  3HFO A;  4M7D A;  4NL3 A;  4M77 F;  2E41 A;  4M75 C;  2EJ9 A;  1WQW A;  4C8Q C;  1HXD A;  4PJO F;  5GAN 8;  4M7A G;  3M4G A;  5LJ5 d;  3JCM e;  3BFM A;  4F7U E;  4M77 D;  4XU1 A;  4XTV A;  4N0A C;  4QVD A;  4J6W A;  4M77 C;  4C92 A;  4NOY A;  3L1A A;  5GAN e;  1LJO A;  5LJ5 h;  4PJO C;  5CAI A;  5LJ5 j;  1Y96 A;  4XTU A;  1N9R A;  2YLC A;  3JCM V;  4MMK A;  4XU3 A;  4X9D A;  1N9S A;  4M7A A;  4F7U F;  4J5Y A;  2VC8 A;  4X9C A;  4A54 A;  1M5Q 1;  4WF2 A;  3JCM J;  3RER A;  3QUI A;  1KQ2 A;  1TH7 A;  3SWN C;  4M7D F;  4XTY A;  4EMK A;  3JB9 G;  4M7A E;  5LJ3 h;  5GAN 2;  4M7D D;  4XQ3 A;  2RD1 A;  4MML A;  3RIR A;  4Y91 A;  5LJ3 j;  3RUX A;  5LJ5 f;  5GAO r;  4PJO A;  3JCM W;  1U1T A;  4M7D C;  1U1S A;  1D3B B;  4J6Y A;  4PNO A;  4M75 B;  4NL2 A;  5LJ5 g;  5GAN 7;  4C8Q B;  5GAO p;  2EWN A;  4M78 A;  3JB9 I;  4XTX A;  5GAM e;  5GAN 3;  4C92 D;  3JB9 J;  4M7A F;  5GMK l;  3JCM P;  4M75 G;  2CGH A;  2ZGW A;  4M77 B;  4C92 C;  3GIB A;  4M7D E;  3HSB A;  4PJO B;  4M7A D;  2YHT A;  3V7C A;  5GMK e;  5GAO q;  4M78 E;  5GAO m;  4HT9 A;  5LJ3 f;  1B34 A;  4M7A C;  5GMK i;  5LJ3 g;  5LJ3 d;  3JCM c;  4C92 E;  2RB6 A;  3FJP A;  4PJO G;  2JN0 A;  2YLB A;  2Y90 A;  4XTZ A;  1M8V A;  3INZ A;  2EAY A;  4JUV A;  1JRI A;  3QO3 A;  3SWN B;  4EMK C;  5GAN 5;  5GAN d;  2FB7 A;  5GMK m;  2EJG A;  3EFR A;  4M78 F;  5GAO l;  1MGQ A;  4F7U B;  3RKW A;  4JLI A;  2EJF A;  1H64 1;  2FYK A;  1I81 A;  4M78 D;  4C92 F;  4XU2 A;  1I8F A;  4M7D B;  3HFN A;  5GAN h;  3BW1 A;  2DTH A;  4XTW A;  4RCB A;  3V8J A;  2DVE A;  3EFS A;  4J6X A;  4M78 C;  4OP0 A;  5GAN j;  2E1H A;  5GAN 6;  1BIB A;  4DQ2 A;  2DZ9 A;  4JRI A;  4C8Q G;  5LJ5 e;  2DXU A;  3BY7 A;  3SB2 A;  3V7S A;  3JCM f;  2DTI A;  2DEQ A;  3SWN A;  1Y96 B;  5DY9 A;  3JCM d;  4M77 G;  4RCC A;  4M7A B;  3VU3 C;  2DZC A; 
#chains in the Genus database with same CATH topology
 4JJN K;  3HKS A;  5GAN f;  1GFC A;  4B9X A;  3MPU B;  4EMK B;  1Q86 C;  2O9S A;  3QZ5 B;  4BD3 A;  1KFZ A;  2A3L A;  3A8M B;  1U5S A;  2GTO A;  2DIQ A;  2EIF A;  1SF9 A;  2XU8 A;  4M7D G;  2GQI A;  2LJ1 A;  1M90 C;  2VKN A;  4ZGD B;  3M5A A;  1KQS P;  2LP5 A;  4C92 G;  5DLQ E;  4IUU A;  3C94 A;  1N8R U;  1NG2 A;  4M77 F;  5FLX E;  1K8A R;  2DRM A;  3CCL T;  3LW5 E;  1YWP A;  5CK9 A;  3M0Q A;  3G4S A;  2KYM A;  2RK1 A;  1QVG P;  1Y96 A;  4M7A A;  4LE9 A;  2ESW A;  1SHG A;  2G6F X;  2J7I A;  3URG A;  4BE1 A;  3TCJ A;  3SWN C;  3CCU A;  1ZSZ B;  4F14 A;  1YI2 Q;  2FPD A;  1IRX A;  2J05 A;  4M7D C;  3TSZ A;  1SEM A;  2EWN A;  1VQ5 A;  2AIR B;  3CXC S;  1AHJ B;  4J9F A;  2RHU A;  4M75 G;  1YN8 A;  4C92 C;  1SRM A;  1VA7 A;  2YHT A;  2HAX A;  4HT9 A;  5HK0 A;  5LJ3 g;  3OSS C;  3O5Z A;  2JN0 A;  3EG9 A;  2FG0 A;  2FZG B;  4PFO A;  1MGQ A;  3E19 A;  1I8F A;  1XQH A;  5D6Y A;  5FU6 C;  3SB2 A;  3V7S A;  2C0O A;  4WCI A;  1MMN A;  4HVW A;  3CCM A;  2PUO B;  4C0F A;  3BDU A;  4BY6 B;  4BE2 A;  1YHQ Q;  3AHU A;  2ROL A;  1FXX A;  5KH6 A;  3E2U A;  3QHS A;  4E7H A;  3NHN A;  2QQ9 A;  2V8I A;  3JB9 D;  1TG0 A;  1G83 A;  4EMG A;  2DA9 A;  3MKD A;  4ME7 A;  1VIF A;  2F2V A;  1EX4 A;  5GAM f;  7AT1 B;  1Q82 U;  3VKI A;  1YNZ A;  3L2R A;  3OW2 A;  2HDA A;  2XD0 A;  2OJ2 A;  4OMF B;  1QVG S;  2FZK B;  2CP0 A;  2KRM A;  1QP3 A;  3CCR Q;  3FLG A;  1LJO A;  5CAI A;  1VQO Q;  1NEG A;  2C0T A;  2HL5 C;  5FWB A;  4AG1 C;  1M3C A;  2NUT A;  2LQK A;  4ORZ A;  1JJ2 S;  2L3P A;  3M0U A;  3WXM B;  6AT1 B;  2QQB A;  2P0K A;  4P5N A;  1X43 A;  3I55 A;  5GAO r;  1UEC A;  3VV0 A;  3T9N A;  5FWC A;  1OI1 A;  2X51 A;  5IT9 E;  2C06 A;  2DBK A;  3M0T A;  4OB2 B;  3V7C A;  2F2X A;  2QA4 Q;  2E5K A;  3CC7 A;  3NPF A;  4KGV B;  1AWX A;  1JXO A;  2AHJ B;  3JCM c;  3FJP A;  2GGR A;  1Q86 U;  4A4H A;  4EMK C;  3HRU A;  3GOX A;  5GAO l;  1M2O A;  2SRC A;  3QWX X;  4N4H A;  2LT4 A;  3V8J A;  4OP0 A;  1VQK T;  3DB4 A;  1K73 R;  2DNU A;  4OMM A;  5L8R E;  1M90 U;  2FL7 A;  5KE3 A;  1VYT A;  4RTZ A;  1UE9 A;  1PKT A;  4BDZ A;  3SWN A;  2D1X A;  3JCM d;  3OYH A;  1UTI A;  1X75 C;  1TTH B;  2D9T A;  3PVQ A;  2VGN A;  2LCL A;  1AVZ C;  3QYG B;  2JT4 A;  4PJO D;  3RKY A;  3VS7 A;  1Y07 A;  5A0D A;  5GAO n;  2LCS A;  2CP5 A;  4M78 B;  3S3M A;  2JVV A;  3PGG A;  3A8O B;  3RES A;  1BBZ A;  4TVR A;  1YIJ A;  3MO8 A;  1ZHI A;  2CT3 A;  1ZSZ C;  4JJC A;  1SSF A;  5I21 A;  2EYX A;  3EGX B;  1M9S A;  1WHM A;  3VUZ A;  1HXD A;  4HVU A;  1VQ4 A;  3OYJ A;  1GL5 A;  4IIO A;  2KT8 A;  1W2B P;  2MF2 A;  3OYN A;  1LPL A;  2ENM A;  1M5Q 1;  2A37 A;  3JCM J;  2K2M A;  2OTL A;  3IQL A;  1S72 Q;  2X4W A;  4FW1 A;  1E6G A;  1U06 A;  2CUB A;  1VQ9 A;  4C5G A;  3WVE B;  2R5A A;  2EQM A;  3JCM P;  2P0P A;  1R77 A;  2G3R A;  1PD1 A;  3I56 Q;  2PZ1 A;  4PJO G;  3OS0 A;  4BY6 C;  3L42 A;  1BK2 A;  2EJG A;  2DYI A;  1RAB B;  5IXF A;  3CC2 T;  1I81 A;  4M78 D;  5KE2 A;  2DK3 A;  1UHF A;  4J6X A;  1VQ8 Q;  3BDL A;  3TRE A;  1VQ4 Q;  3EAE A;  4FIB A;  1YJW A;  3VS2 A;  3CC4 Q;  2DIL A;  2EGA A;  5FRN A;  2K4Y A;  1VQ7 T;  1OV3 A;  4OB0 B;  1G2B A;  2FHD A;  2D8H A;  2K7A A;  2RK2 A;  4LDV A;  5D7U A;  1BCM A;  2FRY A;  2JUF A;  2E70 A;  1TOV A;  1IGQ A;  1PWT A;  3PMI A;  3FB9 A;  2PQW A;  1TXQ A;  2YUN A;  3EGD B;  3QG1 A;  1PHT A;  1VQ9 Q;  3J7A F;  1X01 A;  2JJ9 A;  1UG1 A;  3FIF A;  1VQN Q;  3F70 A;  2HD0 A;  1V1C A;  1WA7 A;  3RMS A;  3CCJ A;  1RAF B;  3ER0 A;  3CCV Q;  1IRE B;  3EHQ A;  1VQM T;  1W2B S;  2RH2 A;  5CKF A;  3OY9 A;  2E3I A;  3OYE A;  4LDW A;  3CME A;  4DEY A;  2PVD B;  4LDX A;  4RG2 A;  2KXD A;  4X9C A;  2QQA A;  4GBQ A;  4M7D F;  1X6O A;  2KK4 A;  2M0O A;  1NYF A;  5IHI A;  1OU9 A;  2RD1 A;  3GBQ A;  1IO6 A;  2OAU A;  4MZP A;  3JCM W;  1U1S A;  4PNO A;  3A5Z B;  2DX1 A;  3U23 A;  4C8Q B;  2XG8 D;  3VS4 A;  4A4F A;  2AKL A;  2GCX A;  3OS1 A;  5CO7 A;  2KAF A;  2OTJ Q;  2HMA A;  4FYY B;  4N4G A;  1VQ6 A;  1ABO A;  2CSQ A;  1BCO A;  4J9E A;  4FYW B;  2MWO A;  4WTO B;  4BDY A;  1RAI B;  2Y90 A;  2YLB A;  4QQD A;  1I0C A;  2JMC A;  2DE0 X;  1RLQ C;  3SEM A;  4F04 B;  3H0H A;  4F7U B;  1WXB A;  1BKB A;  5CQY A;  4KUL A;  2RQR A;  1TU0 B;  2GBQ A;  4M78 C;  2KXC A;  2RF0 A;  2LZ6 B;  3H9N A;  1N8R R;  2DD4 A;  2EQJ A;  2QEX A;  2DEQ A;  1VOM A;  5KCH A;  4JZ4 A;  4KUI A;  3ULR B;  2LC4 A;  1EIF A;  3JB9 H;  2GFA A;  3QKJ A;  4M77 A;  3DLM A;  2HSE B;  2HBW A;  1BIA A;  3CPF A;  4B9W A;  1VIE A;  3L2V A;  4PKC C;  4C92 B;  3OYY A;  2RM4 A;  5J39 A;  1YIT T;  3CPW A;  4RTY A;  4AFU C;  5GAM d;  4C8Q D;  5GAN 4;  3HFO A;  3OQ5 A;  1PSF A;  3SD4 A;  1UB4 A;  4HCK A;  1TWB A;  5KYW B;  4RTT A;  4J9I A;  3EH2 A;  5LJ5 h;  1QKW A;  2MCN A;  3SHW A;  3X26 B;  3MJX A;  2L5Q A;  1X2Q A;  2EFI A;  3VS0 A;  1VQL T;  1YJN T;  2YRC A;  3CMA A;  5GAN 2;  4XQ3 A;  3X25 B;  2COZ A;  4M75 B;  1M1F A;  8ATC B;  3JB9 I;  1X27 A;  1VUB A;  1K9M U;  1MND A;  1IHW A;  1WJS A;  4JDS A;  3CCS T;  1HD3 A;  3R6N A;  2RI2 A;  1W4S A;  1B34 A;  4IUT A;  2EQU A;  2RB6 A;  3QZ9 B;  4RKU E;  1AEY A;  3QPH A;  1A0N B;  3OYD A;  2EYQ A;  1ABQ A;  1B7T A;  3H0I A;  1WHH A;  3HP9 A;  3M0R A;  4E7S A;  4ZGJ B;  2DVE A;  4OMQ A;  4A4E A;  3M0P A;  1QP2 A;  1JQQ A;  1OQK A;  4JRI A;  4C8Q G;  3CXC P;  5LJ5 e;  2DXU A;  2EPD A;  1MUZ A;  2MK5 A;  4A4K A;  1RI9 A;  4C5H A;  1LVK A;  2DZC A;  2MYS A;  2IIM A;  3CCQ Q;  4EDU A;  3HRS A;  1ZUU A;  3M55 A;  5KYY B;  4N0A A;  2JW4 A;  1NYG A;  3JB9 F;  2M51 A;  4D8D A;  2PVG B;  3PE0 A;  3S3O A;  4F7U G;  2RI5 A;  1IGU A;  2XHC A;  5HK3 A;  1H3Z A;  3HL8 A;  3REA B;  1I07 A;  1GCQ C;  2DKG A;  1YI2 A;  4BI8 B;  1G3Y A;  4EMH A;  3OYA A;  1UGV A;  2W10 A;  3EG2 A;  3OYC A;  2P4R A;  3PTA A;  4M75 D;  4HT8 A;  2LJ3 A;  4F17 A;  2ZPG B;  4BE0 A;  3VS1 A;  4LNP A;  4C8Q C;  3LH5 A;  5L23 A;  3JCM e;  2BE7 D;  1UUE A;  3CBP A;  1UDL A;  1Q86 R;  1QVP A;  2FPF A;  5FRM A;  1GCP A;  1V76 A;  4XTU A;  2O9V A;  3MET A;  5KYX B;  3G4S T;  1VQL Q;  3VS3 A;  4PL6 A;  2ED1 A;  1GXI E;  2ZPH B;  1VQP Q;  3RIR A;  5EG2 A;  1ZQ1 A;  3CD6 T;  4ZTF A;  2PNI A;  2JTM A;  2Y4X A;  3M58 A;  1XOV A;  1YJ9 Q;  4QKU A;  1KC8 U;  1UFF A;  1T3S A;  2F69 A;  1J3T A;  2GFU A;  4M78 E;  3L2U A;  4JS5 A;  5GMK i;  1CKA A;  1K8A C;  2X4Y A;  1YHQ A;  2QDY B;  1M8V A;  2MI6 A;  3OBW A;  4JPB W;  1JJ2 P;  2H8H A;  1UGQ B;  2QGG A;  2NUP B;  5GAN h;  4RCB A;  5DLO A;  1F1B B;  3L2Q A;  1UGP B;  2BZY A;  3OYK A;  2ZCF B;  2YT6 A;  1FX7 A;  1OU8 A;  2QQS A;  3M57 A;  2K6D A;  1M2V B;  4OMP A;  1WXT A;  4E7K A;  2QTV A;  3UF4 A;  2DJZ A;  3CCR A;  3RKX A;  2WAC A;  3CCM T;  1VQO A;  2H3J A;  1B3Q A;  2DXB A;  3TU4 K;  4KRT A;  4XU0 A;  1K0S A;  1UHC A;  3GPL A;  2MPX C;  2KE9 A;  3V8K A;  3J81 E;  4QVZ A;  3MEU A;  1P92 A;  3J80 E;  1M1K U;  3GNF B;  3MEA A;  1WX6 A;  1BYM A;  2K2V A;  2JM9 A;  3FDR A;  3HPW A;  1UEB A;  1Y71 A;  3HHT B;  4RTW A;  4E47 A;  2E41 A;  4M75 C;  1ARK A;  4DBH A;  3TVT A;  4MDW A;  2LJ0 A;  1KIK A;  4XTV A;  2QA4 A;  3QJY A;  2LQN A;  2HKN A;  5GAN e;  4LD9 K;  1WIE A;  1RLP C;  4FSX A;  1OZ3 A;  1N9R A;  3PIP A;  4KGX B;  3LWH A;  1N9S A;  1Q81 U;  3H8Z A;  2O31 A;  3QUI A;  1D0X A;  2O4X A;  1GFD A;  2D6F A;  2KT1 A;  1OYX A;  4A63 B;  4PJN A;  2R58 A;  5KYN A;  2CUD A;  2P0Q A;  3CCL Q;  5GAN 7;  2KRN A;  2GF7 A;  3I55 T;  2VUB A;  3EG0 A;  2AT1 B;  1D1C A;  2M16 A;  4PJO B;  2HSP A;  2KR3 A;  5LJ3 f;  5IXB A;  2L3Q A;  3EFO A;  1EZZ B;  2LNH B;  5KYU B;  1NZ9 A;  3EG1 A;  4XTZ A;  5FU7 B;  3CC7 T;  2VVK A;  2DIG A;  4OB1 B;  3THK A;  1WHJ A;  4M78 F;  4IKF A;  1TS9 A;  3LGF A;  2QK0 A;  1QVF P;  4O5V A;  4OGC A;  4XK8 E;  1FWZ A;  3TEE A;  2ZAE A;  1Z9Q A;  2K5I A;  1G3W A;  1ZBX A;  2ROT A;  2DMO A;  4FYV B;  1ZA2 B;  1PG5 B;  1RL2 A;  1KSW A;  1SPK A;  3A98 A;  3L2W A;  2JXB A;  1MMA A;  3JCM X;  3P8D A;  2JOY A;  2D8J A;  1RAD B;  1PRL C;  2VXF A;  5GAM h;  3E9F A;  4C8Q E;  5GMK h;  3FJ5 A;  3R6O A;  2RQT A;  3X28 B;  1JBM A;  4OF1 A;  4BAC A;  5M9O A;  1M27 C;  5D6W A;  3C95 A;  2E10 A;  1S72 A;  5D6X A;  2NUZ A;  4K11 A;  2O88 A;  1AWO A;  2JS0 A;  4DBF A;  3C4S A;  4FCY A;  3G6E T;  3DLL A;  1U3O A;  2WSE E;  4X34 A;  4M7D A;  3QXE B;  1K73 C;  1YIJ T;  2DF6 A;  4HXJ A;  4RTV A;  4F7U E;  2L3R A;  1AZE A;  3VRZ A;  2ZPE B;  4C92 A;  1X69 A;  2LDM A;  3I56 A;  4IUP A;  1K8A U;  5LJ5 j;  4Q5W A;  3JCM V;  1WXU A;  4MMK A;  4X9D A;  5CKD A;  2KI7 A;  2LCC A;  1TUC A;  3OYF A;  3RER A;  2RHZ A;  1MV3 A;  2KBT A;  5AT1 B;  1BI2 A;  3RR6 A;  2EKH A;  4CC2 A;  2DRK A;  4MML A;  5KYW A;  1VQ8 A;  2K3Y A;  2OTL T;  5GAM e;  2DYB A;  1QQJ A;  1WI7 A;  4M7D E;  3D7S B;  5KCO A;  3GIB A;  3CC4 A;  2C0I A;  2RJD A;  5GMK e;  1PNJ A;  2M02 A;  3M0S A;  4C92 E;  3EH1 A;  1OX9 A;  4QT7 A;  2EAY A;  1QVF S;  1NEB A;  2FB7 A;  1WYX A;  3OA6 A;  4ZN1 A;  3A8H B;  2COY A;  4Z02 A;  1H64 1;  1PRM C;  4L6V 5;  2V1Q A;  4Z88 A;  2DL5 A;  1KG1 A;  1SG5 A;  3M53 A;  4A4G A;  5J3B A;  4CI0 C;  1C1A A;  2CYZ B;  1VQN A;  1Q7Y R;  1Y96 B;  2X35 A;  5DY9 A;  2AZV A;  4DOW A;  5I2S A;  4RCC A;  3QDF A;  4M7A B;  2XDD A;  3CCV A;  4OGE A;  1D3B A;  3MP6 A;  1YJW T;  1WNL A;  1NM7 A;  3CCE T;  4QQG A;  3DB3 A;  1KQS A;  1LOJ A;  3CPW S;  3ME9 A;  1BU1 A;  1KHC A;  3OYL A;  4M75 E;  1RAH B;  1VQK Q;  2QQR A;  1D0Z A;  2K57 A;  2BZ8 A;  3ZFJ A;  1YBY A;  2VV5 A;  5CKE A;  2E3H A;  1NJI R;  3A1P A;  5HY6 A;  1H3H A;  4IUQ A;  4C8Q F;  3S3N A;  1QVG A;  1RAG B;  3V7R A;  1K9M R;  3G6E Q;  2LQ8 A;  4J9G A;  2OTJ A;  4MZM A;  1RUW A;  3TQ7 P;  1Y7X A;  4Y28 E;  3E1S A;  3CCJ T;  4PJO C;  1KHI A;  4F7U F;  1YCS B;  5FU7 C;  1R8O B;  2FRW A;  3RDV A;  2L0A A;  3RMQ A;  3CME T;  4EMK A;  2CH4 A;  3MP1 A;  2V8J A;  3JAM E;  1KD1 R;  5GAO p;  5LJ5 g;  4NL2 A;  4DOV A;  3I5S A;  2FEI A;  4M4Z A;  2A08 A;  3NMZ C;  3M4Y A;  3QII A;  4LUD A;  5A2Q E;  4M7A D;  5GAO m;  1VQ7 A;  1PCX A;  1FYN A;  2CDT A;  1VQ6 T;  2RHI A;  2MOX A;  1N27 A;  1WZO A;  4KH1 B;  1M1G A;  1AT1 B;  3REB B;  4C92 F;  2KY9 A;  3OS5 A;  5GAN j;  2E1H A;  2E4H A;  3M54 A;  1ZSZ A;  4LDY A;  2DTO A;  3OB9 A;  4L5G A;  2NUT B;  4LN2 A;  2QEX T;  1W70 A;  1UJ0 A;  5CIU A;  3CC2 Q;  1HK9 A;  1QW1 A;  4FT4 A;  2FZC B;  3MP8 A;  2DXC A;  4RG8 A;  1MV0 B;  4NS5 A;  4UC4 A;  3QBY A;  4Z89 A;  3MEW A;  2QYZ A;  2DER A;  1WQ7 A;  3X24 B;  4M75 F;  2E64 A;  2KGT A;  5CKB A;  1XNI A;  2XKO C;  1KC8 R;  2DPP B;  2PVO B;  1D09 B;  1VQ7 Q;  2VWF A;  2A28 A;  2YWW A;  4M7A G;  1N8R C;  4RTU A;  1K0X A;  4XU1 A;  2GTJ A;  2KYB A;  2XI9 A;  2QAS A;  1H92 A;  4XU3 A;  2VGM A;  3OW2 P;  4JZ3 A;  2VC8 A;  2BTT A;  2YXY A;  2OX7 A;  3LWI A;  3JRZ A;  2X4J A;  2K3B A;  2M1H A;  1UJY A;  2LX7 A;  3M59 A;  2BUD A;  2JS2 A;  1VQM Q;  1IB8 A;  1ZA1 B;  3P8B B;  2YSQ A;  2E5Q A;  1DJ7 B;  4AFS C;  4M7A C;  3CCQ A;  3EHR A;  5LJ3 d;  1PC0 A;  3LH0 A;  5CCA A;  1OEB A;  3OMG A;  1LCK A;  4AT1 B;  4ZGE B;  3AT1 B;  3BE3 A;  1M1K R;  4PJO A;  1MMG A;  2KRO A;  1NBE B;  5KYU A;  2VYT A;  4PJJ A;  1K76 A;  1VYU A;  2DLP A;  1YWO A;  3OYG A;  3NTK A;  1E7O A;  2CZ1 B;  4FSS A;  5GAN g;  2KVQ G;  2NLU A;  4DA4 A;  4DBR A;  3OSV A;  3JCM h;  3G71 T;  4HCC A;  2HNI A;  1Q81 R;  1R0B G;  3G1J A;  1X2K A;  5GAM j;  2DL3 A;  1WHG A;  1KQ1 A;  2VXE A;  3LYI A;  3PIO A;  1VQL A;  1Q82 R;  3V8L A;  5GMK j;  2I2L A;  1EFN A;  2XID A;  2K5L A;  1VQP A;  4PJO E;  3OBY A;  1B07 A;  4EIK A;  1IZ6 A;  1W2B A;  2QI2 A;  1YJ9 A;  1YI2 T;  4RUG A;  2WSF E;  3BFM A;  4KUD K;  1BI3 A;  2R5M A;  1D1A A;  2DAQ A;  4J6W A;  4DEX A;  1BI1 A;  3OW2 S;  2SEM A;  4AMC A;  3QYH B;  4LD6 A;  1YIT Q;  2I0N A;  5EC7 A;  1ACM B;  1FMK A;  1TH7 A;  2QAZ A;  3FEO A;  4ZN3 A;  2K3X A;  4M78 A;  2YDL A;  5LL6 S;  2EQK A;  2LRQ A;  1AZG B;  5C0M A;  3PVL A;  2HQH A;  2YRV A;  1M30 A;  4BB7 A;  4D8K A;  1VYV A;  1QMC A;  1FMW A;  3EGX A;  1YJN Q;  1OZ2 A;  2KEA A;  2L3S A;  1WHL A;  2RNA A;  4FM4 B;  5GMK m;  2DO3 A;  1M90 R;  1YHQ T;  2XDB A;  2M0Y A;  4CC7 A;  3CQT A;  3CCU T;  3RBB B;  2CS7 A;  4XAX B;  2OAW A;  1JB0 E;  1RAE B;  2O01 E;  2MWP A;  4DQ2 A;  4OVA A;  3CCS Q;  3H6Z A;  2DZ9 A;  2QDL A;  4GY5 A;  4OML A;  1VQ5 T;  1R0C B;  3VU3 C;  4L59 A;  1HSQ A;  4BI4 A;  2FPE A;  2HEQ A;  3G71 Q;  3NTI A;  4CC4 B;  4J9D A;  3JCM Q;  2EQI A;  2DM1 A;  1GRI A;  2RHY A;  5IHK A;  1O9S A;  2YUP A;  4A53 A;  3UT1 A;  4D6W A;  2R57 A;  3CCR T;  1SHF A;  2OI3 A;  1G3T A;  3E9G A;  2L2P A;  5IHN A;  4C5I A;  1VQO T;  1QWE A;  1QWF A;  1K1Z A;  1WJR A;  1PD0 A;  4QVC A;  5A0G A;  2F2W A;  2KNB B;  2P84 A;  4QQ6 A;  8AT1 B;  3CD6 A;  3CCL A;  2DXT A;  4JJD A;  5GAM g;  2RA2 A;  1N5Z A;  3Q1J A;  4E7Z A;  2B86 A;  2EJ9 A;  3I35 A;  4PJO F;  5CVI A;  3JV3 A;  4C5E A;  3LX7 A;  4QVD A;  4R56 A;  3C12 A;  2L89 A;  2RJC A;  2HBP A;  2QA4 T;  2LT1 A;  2HZY A;  5IN1 A;  2E6Z A;  3QDR B;  2D0Q B;  3HRT A;  4M7A E;  2YRD A;  2F5K A;  3VYG A;  4CC3 A;  3CBO A;  2IG0 A;  1PM3 A;  4Z8A A;  3EGD A;  3JB9 J;  4YTL A;  1ZUY A;  2AZS A;  2CGH A;  4M77 B;  4FW2 A;  1WDX A;  2EVR A;  5GAO q;  2HCK A;  3LLR A;  2EBP A;  4OMN A;  3G4S Q;  1W1F A;  4GLM A;  4JRP A;  2V1R A;  3P8H A;  4QW2 A;  2IVW A;  2LVM A;  1M3B A;  2ABL A;  3CCU Q;  5CKH A;  3CD6 Q;  4J9H A;  2ZPI B;  2RO0 A;  4BI3 A;  3HFN A;  2KMT A;  1GBR A;  5C6S A;  4E2F B;  1KJW A;  1C6V X;  4J9B A;  1VQ5 Q;  1GCQ A;  1T3L A;  1KQS S;  2JNG A;  2CRE A;  4IUV A;  2MIO A;  2WSC E;  4LXC A;  2QG9 B;  1TSF A;  3N5B B;  4C8Q A;  4AFQ C;  1QCO A;  5FW9 A;  3JCM b;  3X20 B;  4JRK A;  3O8V A;  1NPR A;  4FT2 A;  5J26 A;  2CP6 A;  2BZX A;  1TUG B;  3G7Z A;  4F7U A;  1Y0M A;  1B34 B;  3VS5 A;  4PLI A;  1D1B A;  3SFM A;  4DBQ A;  2KRS A;  4NL3 A;  3KFV A;  1AD5 A;  1S72 T;  5LJ5 d;  3CCM Q;  2CH4 W;  4Y92 A;  4M77 D;  4KGZ B;  2KSS A;  1Q95 G;  3WVD B;  1K9A A;  3CPW P;  1HJD A;  3I56 T;  1SSH A;  1KQ2 A;  4PFZ A;  1WLP B;  3ZL7 C;  4XTY A;  1YFN A;  4LUE A;  3NFC A;  3JB9 G;  3GNG A;  5LJ3 h;  3A8G B;  4KT0 E;  2JMA A;  2RPN A;  3CEY A;  5CQX A;  4AFZ C;  2YUQ A;  1JU5 C;  1AWW A;  4XTX A;  1VQ8 T;  2A36 A;  4M7A F;  2E6N A;  2DL8 A;  4J7F A;  1VQ4 T;  2HQX A;  2DJQ A;  4ATO A;  4J83 A;  3CC4 T;  2ZPB B;  3CXC A;  4E7I A;  1JXM A;  2EYW A;  4JUV A;  3QO3 A;  3EFR A;  1VQK A;  2RJF A;  3NTH A;  4J7I A;  4XU2 A;  2VB6 A;  3BW1 A;  3VS6 A;  4HCZ A;  3EFS A;  3H0F A;  5FRO A;  3I55 Q;  3ZBD A;  2J06 A;  3HTR A;  3OS2 A;  1G8X A;  2X3W D;  2A7Y A;  2F5T X;  3G6E A;  1VQ9 T;  4RTX A;  1Y57 A;  4M77 G;  2A0F B;  3CC7 Q;  1VQN T;  2E12 A;  3VJP A;  4M75 A;  1MHN A;  3UPU A;  4B6M A;  2V8K A;  3MHX A;  2CP2 A;  5LJ3 e;  5DM7 R;  1X6B A;  3CCV T;  2CKK A;  4V2S A;  4ELZ C;  2PTK A;  4J9C A;  2Y4Y A;  3OYM A;  1LNX A;  1OX8 A;  4RMO A;  2QTX A;  1MMD A;  3QSU A;  5ECA A;  4II1 A;  2BKD N;  2ZPF B;  2ZZD A;  3NGP A;  1K4U S;  2CZ7 B;  4ZTJ A;  3M56 A;  3ASK A;  1Q7Y C;  4M77 C;  2OTJ T;  2NWM A;  3L1A A;  3UA7 A;  1BI0 A;  2O2O A;  1H8K A;  4J5Y A;  2X4X A;  2PU9 B;  3I9Q A;  1PKS A;  2GQV A;  2LNV A;  5KYY A;  4ELY C;  2EGE A;  2RJE A;  1YIJ Q;  2QGF B;  2RQW A;  3RUX A;  1QKX A;  3EG9 B;  1G5V A;  3KBG A;  3LGL A;  2DBM A;  1NJI C;  1JJ2 A;  2JTE A;  2L8D A;  5HKC A;  2ZGW A;  2RHX A;  4F16 A;  1YP5 A;  1K9M C;  9ATC B;  1T0H A;  5GJV B;  2YUO A;  1S1N A;  1TUD A;  3CCE A;  1SRL A;  2CZ6 B;  1HYO A;  1UGR B;  3CC2 A;  1WJQ A;  5GAN d;  4JLG A;  2W0Z A;  1I5O B;  2EJF A;  1ZX6 A;  5I11 A;  4N4I A;  2OTL Q;  1ZLM A;  4PFP A;  2LX9 A;  2AK5 A;  4J8O A;  4FYX B;  3JSC A;  5KYX A;  1KK7 A;  5GAN 6;  1AOJ A;  5HCK A;  4MDX A;  2BE9 B;  2PUK B;  2DL7 A;  2LQW A;  4C0Z A;  4KH0 B;  1O75 A;  2LTO A;  3GP8 A;  1KD1 C;  3RNJ A;  2E65 A;  2O4X B;  1OUL A;  4E7J A;  1I4K 1;  2DVJ A;  3QJ6 A;  4ANJ A;  1NLP C;  1CSK A;  4R55 A;  3GF5 A;  3PMT A;  1I5L A;  4GLK A;  1PSE A;  3L2Z A;  3OYB A;  4C0D B;  1ZUK A;  2ECZ A;  4X1V A;  1YCY A;  1I1J A;  3PT9 A;  3KUF A;  4M78 G;  4PJM A;  3JCM g;  3PFS A;  1K73 U;  3I5R A;  3EFO B;  4LDU A;  1YJW Q;  1VQM A;  3S6W A;  2NUP A;  3CCE Q;  4JJB A;  4MZT A;  4KBM B;  4PLL A;  2K9G A;  4N0A C;  4HCB A;  3QWY A;  4AG2 C;  5A0L A;  2BIV A;  2CT4 A;  2YLC A;  1M2V A;  2EYY A;  4FU6 A;  4E7L A;  1WFW A;  2RI3 A;  2DEU A;  2P4T A;  3VYH B;  5LJ5 f;  1C0M A;  1U1T A;  1Z9Z A;  2CP7 A;  2EW3 A;  4VUB A;  2RQU A;  1XJW B;  5I22 A;  1M3A A;  3CCJ Q;  5GMK l;  1QVF A;  1OPK A;  2J6K A;  3UAT A;  3HSB A;  1U8R A;  1M4Z A;  1KC8 C;  4HVV A;  4OMO A;  1M8M A;  1BB9 A;  4PK4 A;  1SKU B;  3OMC A;  1N6A A;  2FO0 A;  3CME Q;  3INZ A;  1E6H A;  3M9Q A;  1WHK A;  2AKK A;  2ATC B;  3SWN B;  3VUB A;  5GAN 5;  2JZ2 A;  1FMV A;  3EGU A;  3CCQ T;  2COW A;  2RN8 A;  4JLI A;  2VAS A;  2H3E B;  2FYK A;  4M7D B;  2DTH A;  2KQW A;  4XTW A;  4BUG A;  3CMA T;  2DFU A;  3OYI A;  1OPL A;  1UGS B;  1BIB A;  1V29 B;  2J6F A;  3BY7 A;  1XTD A;  1G3S A;  2GNC A;  1WGS A;  3JCM f;  2DTI A;  1JEG A;  2J6O A;  3TSW A;  4JRQ A;  2DET A;  1VQ6 Q;  2EKO A;  4ZNX A;  3VRY A;  3DKM A;  2RMO A;  2XIC A;  2HL3 A;  1QCF A;  1Q7Y U;  1WPY A;  2ED0 A;  3H41 A;  3UWN A;  2HQE A;  3ZEH A;  2V26 A;  4HA8 A;  2MAM A;  2JM8 A;  1RAA B;  2K79 A;  1YIT A;  1ZBJ A;  3UDC A;  2QXF A;  2CZ0 B;  4IUR A;  2D0N A;  4M77 E;  5FU6 B;  4OB3 B;  1W6X A;  1JO8 A;  2XK0 A;  3A8L B;  4HKE A;  2XMF A;  2MMP A;  2B8A A;  1M1K C;  1X6G A;  3CBM A;  4R0K A;  2QEX Q;  2HKQ B;  2JTF A;  1VQP T;  3UA6 A;  1NPP A;  1WQW A;  5IH2 A;  1NJI U;  5GAN 8;  3M4G A;  3MEV A;  1QLY A;  4NOY A;  1YJ9 T;  1RAC B;  1YJN A;  2M9U A;  3FC3 A;  1CKB A;  1NLO C;  4PJL A;  1NE8 A;  1MNE A;  5AYF A;  1D0Y A;  2X9H A;  4A54 A;  4WF2 A;  1T0J A;  4EPC A;  1Q81 C;  1RI0 A;  4C0G A;  2F1L A;  5CR2 A;  2NYS A;  5GJW B;  1ZSG A;  2IPO B;  1IXD A;  4M7D D;  4Y91 A;  2LMJ A;  3EG3 A;  5LJ3 j;  1Q82 C;  4IIM A;  2CSI A;  2CP3 A;  1D3B B;  4J6Y A;  2EYZ A;  3CCS A;  4E6R A;  4ESR A;  3KXT A;  5GAN 3;  4C92 D;  3GLX A;  3SDZ A;  2Z0W A;  2DL4 A;  1IHV A;  1KD1 U;  2X3X D;  3G71 A;  1QCN A;  3C0C A;  4O6J A;  1GBQ A;  4CRI A;  1AWJ A;  1JRI A;  3FRN A;  4FL6 A;  3RKW A;  1OOT A;  2K5F A;  5IAY A;  2EGC A;  3CMA Q;  4JS4 A;  2DD5 A;  3MCA B;  2KDS A;  4C0D C;  5I2M A;  3PNW C;  2FVU A;  2XDP A;  2RQV A; 
#chains in the Genus database with same CATH homology
 3CCV A;  4JJN K;  4OGE A;  3HKS A;  5GAN f;  1D3B A;  3MP6 A;  3N5B B;  4KUI A;  4C8Q A;  1YJW T;  1WNL A;  4B9X A;  3CCE T;  4QQG A;  4EMK B;  1Q86 C;  2LC4 A;  3QZ5 B;  1EIF A;  4JRK A;  3X20 B;  3JCM b;  4BD3 A;  3O8V A;  3DB3 A;  3JB9 H;  1NPR A;  1LOJ A;  3CPW S;  2GFA A;  1KQS A;  3QKJ A;  4M77 A;  4FT2 A;  3DLM A;  3ME9 A;  3OYL A;  1KHC A;  4M75 E;  2A3L A;  2QQR A;  3A8M B;  2DIQ A;  1BIA A;  2EIF A;  2K57 A;  2XU8 A;  3CPF A;  4M7D G;  3ZFJ A;  4B9W A;  1VIE A;  5J26 A;  4PKC C;  4C92 B;  3OYY A;  2RM4 A;  5J39 A;  1YBY A;  3L2V A;  2VV5 A;  5CKE A;  1YIT T;  1M90 C;  5HY6 A;  4IUQ A;  4C8Q F;  3S3N A;  3CPW A;  4ZGD B;  1QVG A;  3G7Z A;  3M5A A;  4F7U A;  3V7R A;  1B34 B;  4C92 G;  5DLQ E;  4IUU A;  4PLI A;  3SFM A;  5GAM d;  4C8Q D;  5GAN 4;  3C94 A;  2LQ8 A;  3HFO A;  1N8R U;  3OQ5 A;  4NL3 A;  4M77 F;  2OTJ A;  1PSF A;  3SD4 A;  5FLX E;  1S72 T;  1UB4 A;  4MZM A;  5LJ5 d;  3CCL T;  3LW5 E;  4M77 D;  4PJO E;  5CK9 A;  1Y7X A;  2KSS A;  4Y28 E;  3G4S A;  3E1S A;  3WVD B;  3CCJ T;  5LJ5 h;  4PJO C;  2RK1 A;  1Y96 A;  3X26 B;  4M7A A;  1KHI A;  2L5Q A;  4F7U F;  2EFI A;  5FU7 C;  1R8O B;  3URG A;  3I56 T;  4BE1 A;  1KQ2 A;  3TCJ A;  1VQL T;  3SWN C;  3CCU A;  1YJN T;  3RMQ A;  4XTY A;  3CME T;  4EMK A;  3NFC A;  3JB9 G;  3MP1 A;  3CMA A;  3GNG A;  5LJ3 h;  5GAN 2;  2V8J A;  4XQ3 A;  3A8G B;  4KT0 E;  3X25 B;  3CEY A;  3JAM E;  4M7D C;  5GAO p;  5CQX A;  4M75 B;  4NL2 A;  1M1F A;  5LJ5 g;  2EWN A;  4DOV A;  3JB9 I;  1VQ5 A;  3CXC S;  4XTX A;  1AHJ B;  1VUB A;  1VQ8 T;  1K9M U;  4M7A F;  2E6N A;  2RHU A;  1WJS A;  3M4Y A;  4M75 G;  4JDS A;  3QII A;  4C92 C;  3CCS T;  2RI2 A;  5A2Q E;  2YHT A;  5GAO m;  1VQ7 A;  2HAX A;  4HT9 A;  1W4S A;  4J7F A;  5HK0 A;  4M7A D;  1VQ4 T;  1B34 A;  2HQX A;  5LJ3 g;  3OSS C;  4IUT A;  2EQU A;  2RB6 A;  1VQ6 T;  3QZ9 B;  2JN0 A;  4J83 A;  3CC4 T;  4ATO A;  2ZPB B;  3CXC A;  4E7I A;  2RHI A;  4RKU E;  4JUV A;  3QO3 A;  1N27 A;  3QPH A;  3EFR A;  1VQK A;  1MGQ A;  2RJF A;  3NTH A;  3OYD A;  2EYQ A;  3E19 A;  1M1G A;  4J7I A;  4C92 F;  3HP9 A;  4XU2 A;  1I8F A;  2KY9 A;  3BW1 A;  4ZGJ B;  3OS5 A;  4HCZ A;  2DVE A;  1XQH A;  3EFS A;  5GAN j;  5FRO A;  2E1H A;  4A4E A;  3ZBD A;  1QP2 A;  5D6Y A;  4JRI A;  3OS2 A;  4C8Q G;  5FU6 C;  5LJ5 e;  2DXU A;  2A7Y A;  3SB2 A;  2F5T X;  3G6E A;  3V7S A;  1VQ9 T;  3M54 A;  4A4K A;  4M77 G;  4LDY A;  4C5H A;  2DZC A;  2DTO A;  3OB9 A;  4L5G A;  2PUO B;  3CCM A;  1VQN T;  2E12 A;  3VJP A;  4C0F A;  4M75 A;  3BDU A;  4BY6 B;  2QEX T;  1MHN A;  4BE2 A;  3UPU A;  3AHU A;  2V8K A;  4EDU A;  1FXX A;  3HRS A;  3M55 A;  3MHX A;  5CIU A;  5LJ3 e;  5DM7 R;  1HK9 A;  1QW1 A;  5KH6 A;  4FT4 A;  3CCV T;  2CKK A;  4N0A A;  3JB9 F;  3QHS A;  2PVG B;  4V2S A;  4E7H A;  3MP8 A;  2DXC A;  2QQ9 A;  2V8I A;  4RG8 A;  2RI5 A;  2XHC A;  4ELZ C;  4F7U G;  4NS5 A;  5HK3 A;  3S3O A;  3JB9 D;  1H3Z A;  2Y4Y A;  3HL8 A;  4EMG A;  3OYM A;  4UC4 A;  1LNX A;  3QBY A;  4RMO A;  4ME7 A;  3MEW A;  2DKG A;  1VIF A;  1WQ7 A;  3X24 B;  4M75 F;  2E64 A;  2QTX A;  4BI8 B;  1G3Y A;  4EMH A;  3OYA A;  5GAM f;  1YI2 A;  3QSU A;  3OYC A;  5CKB A;  1Q82 U;  3VKI A;  3PTA A;  1XNI A;  2XKO C;  4M75 D;  2DPP B;  2PVO B;  2BKD N;  4II1 A;  3L2R A;  2ZPF B;  3OW2 A;  4HT8 A;  2ZPG B;  2ZZD A;  4BE0 A;  4C8Q C;  2XD0 A;  4M7A G;  3JCM e;  1N8R C;  2CZ7 B;  4ZTJ A;  4XU1 A;  4OMF B;  3CBP A;  3M56 A;  3ASK A;  1Q7Y C;  1QVG S;  4M77 C;  2OTJ T;  1QP3 A;  3FLG A;  3L1A A;  1QVP A;  1LJO A;  5FRM A;  2XI9 A;  5CAI A;  1BI0 A;  4XTU A;  3MET A;  4XU3 A;  2VGM A;  3G4S T;  4J5Y A;  2X4X A;  2VC8 A;  2LQK A;  2PU9 B;  4PL6 A;  1JJ2 S;  3WXM B;  1GXI E;  2GQV A;  3LWI A;  2ZPH B;  2QQB A;  2LNV A;  2X4J A;  3JRZ A;  2P0K A;  2M1H A;  4ELY C;  2RJE A;  3RIR A;  4P5N A;  3RUX A;  3I55 A;  3M59 A;  5EG2 A;  5GAO r;  1ZQ1 A;  1G5V A;  2BUD A;  3KBG A;  3CD6 T;  4ZTF A;  3LGL A;  3VV0 A;  2JTM A;  2Y4X A;  3M58 A;  3T9N A;  1NJI C;  1OI1 A;  1XOV A;  1JJ2 A;  5IT9 E;  2L8D A;  1KC8 U;  2C06 A;  3P8B B;  5HKC A;  2ZGW A;  4OB2 B;  2F69 A;  2RHX A;  1K9M C;  2GFU A;  3V7C A;  4M78 E;  3L2U A;  4JS5 A;  3CC7 A;  2E5Q A;  1DJ7 B;  4M7A C;  5GMK i;  3CCE A;  3CCQ A;  1K8A C;  2AHJ B;  2X4Y A;  5LJ3 d;  3JCM c;  1YHQ A;  2CZ6 B;  2QDY B;  3FJP A;  1UGR B;  3LH0 A;  3CC2 A;  1Q86 U;  1M8V A;  2MI6 A;  1WJQ A;  5CCA A;  4A4H A;  3OBW A;  4EMK C;  5GAN d;  3HRU A;  3OMG A;  4JLG A;  3GOX A;  5GAO l;  2EJF A;  4ZGE B;  1UGQ B;  4N4H A;  4N4I A;  2LT4 A;  5GAN h;  4PJO A;  2LX9 A;  4RCB A;  3V8J A;  5DLO A;  4OP0 A;  4J8O A;  3JSC A;  3L2Q A;  1VQK T;  3DB4 A;  5GAN 6;  1UGP B;  5L8R E;  3OYK A;  1M90 U;  4MDX A;  2ZCF B;  2FL7 A;  2VYT A;  5KE3 A;  2PUK B;  4BDZ A;  1FX7 A;  2QQS A;  3M57 A;  3SWN A;  4C0Z A;  1O75 A;  2LTO A;  3JCM d;  3OYH A;  3GP8 A;  1KD1 C;  3OYG A;  3NTK A;  1X75 C;  2D9T A;  2CZ1 B;  4E7K A;  5GAN g;  2KVQ G;  2E65 A;  2NLU A;  2O4X B;  3OSV A;  3JCM h;  3G71 T;  4E7J A;  4DA4 A;  2DJZ A;  2LCL A;  1I4K 1;  2VGN A;  3CCR A;  2HNI A;  4HCC A;  3RKX A;  2WAC A;  3QJ6 A;  3CCM T;  1VQO A;  4R55 A;  2H3J A;  3GF5 A;  3PMT A;  3QYG B;  2DXB A;  3RKY A;  5GAM j;  3TU4 K;  1Y07 A;  5A0D A;  4PJO D;  1I5L A;  5GAO n;  2VXE A;  1KQ1 A;  4GLK A;  3LYI A;  4XU0 A;  3PIO A;  1VQL A;  4M78 B;  1PSE A;  3V8L A;  3L2Z A;  5GMK j;  3OYB A;  3GPL A;  3S3M A;  2I2L A;  2JVV A;  4C0D B;  3V8K A;  3J81 E;  4QVZ A;  3PGG A;  1YCY A;  3MEU A;  2XID A;  1P92 A;  2K5L A;  3A8O B;  3PT9 A;  3RES A;  3KUF A;  4M78 G;  3J80 E;  4TVR A;  3GNF B;  3MEA A;  3OBY A;  1YIJ A;  3MO8 A;  1M1K U;  3JCM g;  1ZHI A;  3PFS A;  1IZ6 A;  1W2B A;  1BYM A;  1K73 U;  5I21 A;  1SSF A;  2QI2 A;  2K2V A;  3FDR A;  4LDU A;  1VQM A;  3HPW A;  1UEB A;  1M9S A;  1Y71 A;  3HHT B;  3S6W A;  4E47 A;  2E41 A;  4M75 C;  1YJ9 A;  3VUZ A;  1YI2 T;  1HXD A;  2WSF E;  4MDW A;  3BFM A;  4KBM B;  4MZT A;  4KUD K;  4PLL A;  1VQ4 A;  4XTV A;  4N0A C;  1BI3 A;  2R5M A;  2DAQ A;  3OYJ A;  3QJY A;  4J6W A;  2QA4 A;  4HCB A;  1BI1 A;  5GAN e;  3OW2 S;  5A0L A;  4LD9 K;  2BIV A;  2MF2 A;  4FSX A;  1OZ3 A;  1N9R A;  2YLC A;  3PIP A;  3QYH B;  3LWH A;  1Q81 U;  1N9S A;  4LD6 A;  3OYN A;  3H8Z A;  1M5Q 1;  4FU6 A;  4E7L A;  3JCM J;  3QUI A;  1TH7 A;  2O4X A;  2RI3 A;  2OTL A;  2P4T A;  2D6F A;  3FEO A;  1OYX A;  4ZN3 A;  2R58 A;  3VYH B;  5LJ5 f;  2P0Q A;  1U1T A;  2X4W A;  5GAN 7;  4VUB A;  2K3X A;  4M78 A;  1VQ9 A;  5LL6 S;  2EQK A;  4C5G A;  2GF7 A;  2LRQ A;  3WVE B;  2R5A A;  5C0M A;  2EQM A;  5GMK l;  3I55 T;  2VUB A;  3JCM P;  1QVF A;  2P0P A;  2YRV A;  2M16 A;  3HSB A;  4PJO B;  1U8R A;  1M4Z A;  1KC8 C;  4M7D A;  4BB7 A;  5LJ3 f;  2G3R A;  3OMC A;  1N6A A;  1NZ9 A;  1OZ2 A;  4XTZ A;  5FU7 B;  4PJO G;  3INZ A;  3OS0 A;  4BY6 C;  3M9Q A;  3VUB A;  3L42 A;  3SWN B;  5GAN 5;  3CC7 T;  2DIG A;  4FM4 B;  4OB1 B;  2JZ2 A;  5GMK m;  2EJG A;  2DO3 A;  4M78 F;  3CCQ T;  4IKF A;  1YHQ T;  3LGF A;  4JLI A;  4O5V A;  2XDB A;  4OGC A;  4XK8 E;  1FWZ A;  2FYK A;  3CCU T;  1I81 A;  4M78 D;  3TEE A;  3CC2 T;  2CS7 A;  5KE2 A;  4M7D B;  2DK3 A;  2DTH A;  2KQW A;  4XAX B;  4XTW A;  4BUG A;  3CMA T;  2K5I A;  4J6X A;  3OYI A;  1UGS B;  1JB0 E;  2O01 E;  2MWP A;  1BIB A;  1G3W A;  4OVA A;  4DQ2 A;  3H6Z A;  1ZBX A;  2DZ9 A;  1V29 B;  4GY5 A;  3BDL A;  3TRE A;  3BY7 A;  1XTD A;  1G3S A;  1VQ5 T;  1WGS A;  3JCM f;  2DTI A;  3EAE A;  4FIB A;  1RL2 A;  1YJW A;  3L2W A;  4JRQ A;  3VU3 C;  4L59 A;  2EKO A;  4BI4 A;  3DKM A;  5FRN A;  2K4Y A;  3JCM X;  1VQ7 T;  2XIC A;  3NTI A;  3P8D A;  2FHD A;  2JOY A;  4OB0 B;  1Q7Y U;  2RK2 A;  4LDV A;  1WPY A;  3JCM Q;  2VXF A;  3UWN A;  5GAM h;  2HQE A;  3ZEH A;  3E9F A;  4HA8 A;  2MAM A;  2RHY A;  2JUF A;  1O9S A;  4A53 A;  3UT1 A;  1YIT A;  4C8Q E;  2E70 A;  3UDC A;  2QXF A;  4D6W A;  5GMK h;  2R57 A;  2CZ0 B;  3R6O A;  4IUR A;  3CCR T;  3PMI A;  4C5I A;  1G3T A;  3E9G A;  3FB9 A;  2PQW A;  1VQO T;  3X28 B;  1JBM A;  3QG1 A;  4M77 E;  1WJR A;  4QVC A;  5FU6 B;  5A0G A;  4OF1 A;  1X01 A;  2XK0 A;  4OB3 B;  5M9O A;  4BAC A;  3J7A F;  5D6W A;  3A8L B;  3C95 A;  2E10 A;  4QQ6 A;  4HKE A;  1S72 A;  5D6X A;  3CD6 A;  3FIF A;  3CCL A;  2MMP A;  2DXT A;  3F70 A;  2B8A A;  2RA2 A;  5GAM g;  1M1K C;  3CBM A;  3C4S A;  2HD0 A;  3Q1J A;  2JTF A;  3RMS A;  4X34 A;  2WSE E;  3G6E T;  3DLL A;  3QXE B;  3CCJ A;  1YIJ T;  2EJ9 A;  1NPP A;  1WQW A;  1K73 C;  1NJI U;  3ER0 A;  4PJO F;  5GAN 8;  3M4G A;  3MEV A;  1IRE B;  5CVI A;  4F7U E;  1VQP A;  2L3R A;  4C5E A;  3LX7 A;  4QVD A;  1VQM T;  1W2B S;  2RH2 A;  2ZPE B;  5CKF A;  4C92 A;  4R56 A;  2LDM A;  3C12 A;  4NOY A;  2L89 A;  3I56 A;  3OY9 A;  1YJ9 T;  2RJC A;  4IUP A;  1YJN A;  5LJ5 j;  1K8A U;  2M9U A;  4Q5W A;  4LDW A;  3OYE A;  3FC3 A;  3CME A;  3JCM V;  2HBP A;  4MMK A;  2PVD B;  4X9D A;  4LDX A;  4RG2 A;  2QA4 T;  2LT1 A;  1NE8 A;  5CKD A;  5AYF A;  4X9C A;  4A54 A;  2QQA A;  2LCC A;  5IN1 A;  3OYF A;  4WF2 A;  2E6Z A;  3RER A;  2RHZ A;  4EPC A;  1Q81 C;  3QDR B;  1RI0 A;  1X6O A;  2KK4 A;  4M7D F;  4C0G A;  2M0O A;  1BI2 A;  2D0Q B;  5CR2 A;  3HRT A;  4M7A E;  4M7D D;  2RD1 A;  4MML A;  1VQ8 A;  4Y91 A;  5LJ3 j;  1Q82 C;  2OAU A;  4MZP A;  3JCM W;  2F5K A;  1U1S A;  1D3B B;  4J6Y A;  4PNO A;  3A5Z B;  3CBO A;  2K3Y A;  3VYG A;  4C8Q B;  3CCS A;  2XG8 D;  4A4F A;  3KXT A;  2IG0 A;  2GCX A;  3OS1 A;  2OTL T;  5CO7 A;  2KAF A;  5GAM e;  4C92 D;  5GAN 3;  3GLX A;  3JB9 J;  4YTL A;  3SDZ A;  4M7D E;  2CGH A;  4M77 B;  5KCO A;  4N4G A;  1VQ6 A;  3GIB A;  3CC4 A;  1KD1 U;  2RJD A;  5GMK e;  5GAO q;  3LLR A;  3G71 A;  2MWO A;  4O6J A;  4JRP A;  4C92 E;  4BDY A;  4CRI A;  2Y90 A;  2YLB A;  4QQD A;  3P8H A;  2EAY A;  1QVF S;  1JRI A;  4QW2 A;  2IVW A;  2FB7 A;  2LVM A;  3OA6 A;  3FRN A;  4F7U B;  4FL6 A;  1BKB A;  3A8H B;  5CQY A;  3RKW A;  4ZN1 A;  4KUL A;  1H64 1;  5CKH A;  4Z02 A;  2K5F A;  5IAY A;  2ZPI B;  2RO0 A;  4L6V 5;  4BI3 A;  4JS4 A;  3HFN A;  2KMT A;  4M78 C;  5C6S A;  2DD5 A;  1KG1 A;  4A4G A;  3M53 A;  3MCA B;  5J3B A;  4CI0 C;  2KDS A;  4C0D C;  1VQP T;  2CYZ B;  2DD4 A;  5I2M A;  1VQN A;  2EQJ A;  3PNW C;  1KQS S;  2JNG A;  2QEX A;  2DEQ A;  2FVU A;  1Y96 B;  2X35 A;  5DY9 A;  4IUV A;  2XDP A;  4DOW A;  2WSC E;  4RCC A;  5I2S A;  4M7A B;  5KCH A;  2XDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...