4EMGA

Crystal structure of splsm3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
71
Chain Sequence
EPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTTIRKHYEMLFVRGDSVILIAPPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm3
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 16
structure length 71
sequence length 85
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emgA00
4M78G 4M77C 5LJ3j 4C92C 4M78F 3INZA 2RM4A 5GMKe 5GAOm 1BIAA 1HK9A 5CAIA 5LJ5g 4HT8A 1I4K1 4M78B 4C92D 5GANe 1JRIA 3JCMW 5GAMe 4XU0A 4XTVA 3RESA 3V8KA 2EJFA 5LJ5e 5GAOr 1MGQA 1U1TA 3JCMQ 2DZ9A 3JCMf 4M7DC 5LJ3h 5LJ3d 4M7AG 2RD1A 3JCMc 3L2ZA 5GAN3 5GMKl 3SWNA 4NL3A 4C8QA 2I2LA 4WF2A 4F7UG 2HNIA 4M7DD 4M7AF 4EMGA 4V2SA 3V7CA 4F7UF 5GAN7 4M7AB 2DEQA 4M77G 3RKYA 1WPYA 2VXFA 4C92G 4EMHA 4M75E 5GMKi 5LJ5f 3QO3A 4M77F 4C8QE 2DVEA 4F7UB 4C92F 2EAYA 4NL2A 1D3BB 3PGGA 4M77B 4PJOA 4C92B 1N9RA 3L1AA 5GAOq 5GANg 1YCYA 4XU2A 3BFMA 4RCBA 2RA2A 5GAMg 5GMKm 3EFSA 3QSUA 4Y91A 1I8FA 4M77D 4PJOE 2DXTA 4JRIA 4N0AA 5GMKj 5GAN8 4M7DG 2DJZA 4EMKC 3V7RA 4M7DF 3HSBA 4XTYA 4M7DB 4A53A 4QVCA 5LJ5j 5LJ3g 3JB9D 4M7AA 3HFNA 3QHSA 4M75A 3JCMP 4MMLA 3JCMh 2E41A 2FB7A 4F7UA 3JCMd 5GANf 2QTXA 3SWNC 3JB9H 1JBMA 4J6XA 1Y96A 5GAMf 4M7AE 3JCMV 3FB9A 3FIFA 5LJ3e 4C92A 3JCMX 4XTWA 4F7UE 4JUVA 2VC8A 4RCCA 4HA8A 1B34B 1N9SA 4C92E 3JCMJ 2YLCA 4M78A 1WQ7A 4X9CA 2ZGWA 3QUIA 4XTXA 4PJOC 2E64A 4QVDA 2EJ9A 3JB9G 5GAOp 2DTOA 3JB9F 4XU1A 4M78E 3JB9I 4EMKB 3BY7A 3RUXA 5DY9A 4J6WA 4XQ3A 5GANh 2RB6A 5GANj 1WQWA 2E10A 4J5YA 5GAMj 2FYKA 4XTUA 5GAOl 5GAN5 1KQ2A 4HT9A 3HFOA 5GAN6 3JB9J 3EFRA 1M5Q1 4JRKA 3RIRA 3SWNB 3JCMg 4M75C 1TH7A 5GMKh 4C8QC 1B34A 1D3BA 2DKGA 2EWNA 4M77A 4PJOG 3RKXA 4DQ2A 2DXUA 4M75D 1U1SA 2Y90A 1LJOA 3BDUA 4OP0A 4PJOF 4C8QD 2DZCA 2YHTA 3JCMe 5GAMh 5GANd 1X01A 5GAMd 4PNOA 4M77E 4NOYA 5LJ5h 4PJOB 5LJ5d 2VXEA 4EMKA 3GIBA 5I21A 4M78C 1BIBA 4MMKA 1I81A 5LJ3f 2E65A 4PJOD 2DTIA 4M78D 3V8LA 4M7DA 2K57A 1H641 5GAOn 4N0AC 3RERA 1KQ1A 3JCMb 2YLBA 4J6YA 5GAN2 4JLIA 3VU3C 4M75G 3V7SA 4M7DE 4C8QG 3M4GA 1LOJA 4XU3A 3SB2A 1I5LA 4M75F 4C8QF 1HXDA 3V8JA 3RKWA 3AHUA 1M8VA 4XTZA 2CGHA 4A54A 4M75B 4M7AC 4C8QB 2E1HA 1WNLA 5GAN4 2JN0A 4X9DA 1Y96B 1LNXA 3BW1A 2DTHA 4M7AD 3FJPA 2EJGA
chains in the Genus database with same CATH superfamily
2KNBB 4R55A 2ESWA 2KY9A 2EW3A 2JS0A 2GGRA 5LJ5g 2FEIA 1KD1C 2I0NA 3CCMA 2RQUA 2YRVA 3CMET 3FC3A 1VQPA 2P0KA 4LD6A 1KD1R 1VQOA 3JSCA 4PJJA 2PZ1A 2L89A 2DMOA 1YIJT 4C92B 1VQ6T 2QQAA 2EQMA 4XU2A 2RA2A 4Y91A 4RG2A 4N0AA 5FU6C 2DNUA 3NPFA 3CMAQ 4M7DF 3CPWP 1FWZA 3GNFB 4ME7A 1S1NA 2D8JA 2EYZA 4JJBA 2LT4A 5FROA 4IUPA 4ZGEB 3EH2A 4AMCA 1TSFA 2CT4A 1K9MC 1MUZA 1K4US 2XD0A 2L8DA 3JCMV 3HL8A 1PNJA 1NEGA 1T3LA 2BUDA 1MMGA 1BI1A 1YJNA 3MJXA 5CVIA 4XTXA 1KQSA 1K9MR 1S72Q 4PFPA 2FZGB 2EGAA 2FG0A 1M30A 3NHNA 1NZ9A 3EGDB 1AWOA 2EBPA 4HCKA 5CQYA 2JTEA 5GMKh 1VQ9Q 2DF6A 3LH5A 7AT1B 1E6HA 1RACB 3X25B 3C94A 3PIPA 1ZSZB 4JLGA 5FWCA 4PJOD 4OB0B 3CPWA 1KQSS 2FZKB 1WFWA 2FO0A 1PC0A 2YXYA 2JN0A 2BZYA 4OMQA 4M77C 4DEXA 5LJ3j 1UJ0A 4FYYB 2L3QA 3QIIA 2ZPIB 1UFFA 2RQVA 3CBMA 1WXUA 1RAIB 2EJFA 4IUUA 1I0CA 1AEYA 2RD1A 5KE3A 1Q82C 2HNIA 1RI9A 2E70A 3CPWS 4M77G 5GMKi 3CCQA 3EHRA 4XK8E 4OMPA 2FRYA 1NM7A 5KYYB 3CCUA 1UTIA 1Q81R 3MP6A 3OYIA 4R56A 1YJ9A 4MZTA 2D6FA 4HVUA 4BI4A 5GMKj 2RMOA 3CXCP 4RMOA 3CCVA 1QWFA 1SEMA 3JCMh 3I55Q 2KXCA 1JBMA 2HCKA 3PE0A 2DETA 1SHGA 1Q81U 4GLKA 1VYTA 3VYHB 8ATCB 2OJ2A 1U06A 1T3SA 3CC4Q 1PHTA 4OF1A 1JB0E 5D6XA 1FMWA 2A28A 3C4SA 3DKMA 4J6WA 5CK9A 3JAME 3SHWA 3CC7T 4JRKA 4OMFB 4ELYC 2EWNA 3RMQA 2DXUA 1ZX6A 2KYMA 1VOMA 5GAMh 3VS7A 1SG5A 4FT4A 2DBMA 2SEMA 2VXEA 3VYGA 3QPHA 1K8AC 3NGPA 4MMKA 4A4KA 1G2BA 3PNWC 2CZ1B 4K11A 3TQ7P 1Q7YC 3V7SA 2P84A 2OI3A 3I56A 4A54A 1TTHB 3PVLA 4KUDK 2QK0A 5CCAA 2DIQA 1PM3A 3BW1A 3HPWA 1LCKA 2DAQA 2YRCA 5L23A 3C0CA 3CCST 4HVVA 1UGVA 2R57A 4IUTA 2J6FA 3X28B 5GANe 2ZZDA 2C0TA 2MI6A 1BBZA 3RESA 1U3OA 5GAOr 1MGQA 1X2QA 2CP7A 2KAFA 2O4XA 1QVPA 3QDRB 3SWNA 2RNAA 4C0FA 4M7AF 2HL5C 3UWNA 2W10A 1WPYA 1IREB 3UATA 1UB4A 1M27C 1VQKT 1OPLA 5FU7C 4M77D 5GAN8 3CCRQ 2YT6A 3EHQA 2IIMA 1KK7A 1VQ7Q 3REAB 2MMPA 4A53A 3FDRA 5LJ3g 4M7AA 1WHMA 4LN2A 3VS2A 3EG9B 4J6XA 2MCNA 3DB3A 2QEXT 3LX7A 3HRUA 3J80E 3TCJA 2E64A 2DTOA 4PLIA 4EMKB 4B6MA 2YUNA 3C95A 1N6AA 3IQLA 5GAN6 3EG3A 1JEGA 2KT1A 1AWJA 2CP2A 1PCXA 1NPPA 4OMLA 1PKSA 1WIEA 1KC8R 1YI2A 3EG1A 2BE9B 2V8IA 3UT1A 4EDUA 2BTTA 1ZA1B 2LCLA 2MAMA 3OMCA 4C5IA 1NJIR 1YJNT 3T9NA 5KH6A 2OTJA 3ZBDA 1OZ2A 3JV3A 5GAN2 4R0KA 2VWFA 5CKDA 3M0SA 1IO6A 3CPFA 4DOVA 1HXDA 2YRDA 1K0XA 1VQMA 2OTLA 1X69A 2L3PA 1KC8U 1YHQQ 1I1JA 3FJPA 1IRXA 3CQTA 1NJIU 2DYBA 1P92A 3P8DA 3FRNA 2QTVA 4M78B 2CP5A 1JRIA 1K73C 4XU0A 1X6BA 1UGSB 2RJFA 4QQ6A 2GCXA 1IZ6A 4F7UF 1YIJA 4C8QE 1C6VX 1VQ6A 2AK5A 5CKEA 3PGGA 1N9RA 4E7ZA 3OSSC 2RI3A 3GF5A 2QG9B 2EQUA 1YNZA 1GBQA 2VB6A 5KCHA 3S3OA 2RF0A 3KFVA 3M0TA 4F7UA 1TUCA 3JCMd 2DLPA 1K76A 1Y96A 3G6EA 1FMKA 1Y57A 3CCEQ 2VV5A 2VKNA 4X9CA 3CCQT 3BE3A 2MPXC 2XG8D 3CCUT 4M78E 1R0BG 4BY6B 4L59A 1ABOA 2MWOA 2KSSA 4FYXB 5GANj 3OYEA 4XTUA 3M9QA 3CCJQ 4BACA 4X1VA 1IB8A 2JNGA 4C8QC 3CCVT 1N8RR 2DL3A 1KFZA 1B34A 2DBKA 1U1SA 3EGXA 3M59A 5GAMd 2LVMA 4PJOB 3OYJA 3MEVA 5I21A 1X43A 3SEMA 5LJ3f 1Q86C 5I11A 3A8GB 1HD3A 6AT1B 4C8QG 1OU9A 1N8RU 2JZ2A 1Q86R 1VQNA 2QQSA 1M8VA 4M75B 3OYBA 5GJWB 1QQJA 2A7YA 3PTAA 2KE9A 3EGUA 2KI7A 2HEQA 2JTMA 3MHXA 1ZUKA 2QQ9A 4HVWA 4LDYA 1PWTA 1K1ZA 2K5FA 4OGEA 3L2ZA 5GMKl 3TEEA 2QI2A 4M7DD 2L2PA 1EZZB 2E3IA 2ZAEA 2NUTA 2RK2A 4N4GA 2J06A 4C92F 2YUOA 4MDXA 2NUPA 4KBMB 4BE1A 4OVAA 4E47A 2AZSA 3ZFJA 4PJOE 1AZGB 2P0PA 1M90U 3I9QA 3M0QA 1G5VA 4OMOA 3QZ9B 1PSFA 2E3HA 4WCIA 5M9OA 4B9WA 2EYWA 2LDMA 2CH4W 2E41A 2FB7A 3SWNC 3FB9A 1X6OA 2E6ZA 4C92A 3L2UA 4J9GA 2QGFB 3LW5E 4Q5WA 2LJ1A 2CP3A 3CCLT 1T0JA 3VS1A 5HY6A 5FU6B 5J39A 1OEBA 3OS0A 4PKCC 1UHCA 2EGCA 3G7ZA 1M1KC 1UUEA 2LNVA 3X24B 4FSXA 4ORZA 4LNPA 2P4TA 1PG5B 2K7AA 1GBRA 2EKHA 3ME9A 1YN8A 1M1KR 4ESRA 3RKXA 2RQTA 1D0YA 2JMCA 2QASA 4QQDA 1X01A 2X4XA 3VS4A 1BYMA 3GIBA 4ATOA 1M9SA 2JJ9A 4BDZA 3UA7A 4DEYA 5GAOn 1R8OB 3E19A 1NBEB 2E5QA 5FRMA 3ASKA 4DBFA 2X3WD 2QA4T 2K9GA 3OYDA 2E12A 3OQ5A 4JDSA 1XJWB 2G6FX 4JPBW 5GMKe 2HZYA 1HK9A 1GL5A 1ZSZA 2KVQG 4JS4A 3EFOA 3HHTB 2JW4A 3VS6A 2WSCE 2L3RA 1VQMQ 1NEBA 2X51A 5KYXB 2SRCA 3QKJA 3OS1A 3QO3A 4PFOA 1V29B 2EGEA 2ENMA 4NL2A 4M77B 1VQLT 3CC2T 1YCYA 2EIFA 3CMEQ 4ZTFA 1KQSP 1WI7A 1UG1A 1X75C 1EIFA 5A0GA 2X3XD 5FWBA 2K79A 3OMGA 4RUGA 4C5EA 2DILA 1M2VB 4XAXB 1WZOA 1QKXA 3HFNA 2QEXA 4MMLA 2JT4A 4JRPA 2QYZA 3FIFA 4JUVA 1M3CA 3CBOA 1N9SA 2DVJA 1C0MA 4BUGA 1G8XA 3VRYA 2DO3A 5I2MA 3NMZC 4AFZC 2J6KA 5GAOl 5GAN5 3DLMA 2LX9A 1M8MA 2HSEB 3URGA 1D3BA 1W70A 1PSEA 1AOJA 4GY5A 2F1LA 3JCMe 5HK3A 3G6ET 4M77E 4NOYA 3HKSA 1AWXA 2OX7A 1BIBA 3PMTA 1M2OA 3H9NA 4M7DA 5CR2A 3M57A 3NTIA 2CSQA 2JXBA 1GFCA 3E9GA 4HXJA 1D0XA 2HQXA 3O5ZA 4HCZA 5GAN4 4M7AD 4IKFA 2KBTA 4C0DC 1RI0A 5KYWB 2NWMA 3HTRA 4BI3A 2XU8A 3E9FA 4PJLA 5GAMe 1VQ4A 3VS3A 5AYFA 2FRWA 1RADB 5KYUB 4EMGA 4VUBA 5CIUA 4MZMA 1WJQA 1YJWQ 4LUEA 3NFCA 1VQNT 1AZEA 2RHIA 5GMKm 1VQ9T 4E6RA 2RHYA 1I8FA 1X2KA 3OYFA 2DJQA 4C0ZA 2AZVA 2X4WA 4KH1B 3ZL7C 2WACA 4C5GA 2GFUA 2RJCA 2J7IA 1H92A 2BE7D 2PQWA 1SPKA 3KUFA 3MPUB 4KGXB 4O6JA 5GANf 3M0PA 3X20B 1Q81C 3MEAA 2YUQA 1WX6A 3FJ5A 3M53A 2HDAA 1BB9A 4D6WA 1WQ7A 2YWWA 5FU7B 4RG8A 2M1HA 2BKDN 1KIKA 4XU1A 4XQ3A 2PVDB 2B86A 5HCKA 2IPOB 2RB6A 1R0CB 2C06A 2CZ7B 1VQ5A 4E7KA 3EAEA 4KGZB 1UE9A 1QLYA 1GCQA 2YHTA 3P8HA 1E7OA 4EMKA 3QWXX 4UC4A 3EH1A 1LVKA 2LNHB 4BI8B 3CC7Q 2AHJB 4QW2A 3RERA 2XHCA 2JM9A 1SHFA 3VU3C 1BCOA 3V8JA 2M0YA 1WNLA 1LNXA 4YTLA 3I5RA 3I55T 3L2RA 2AT1B 4M78F 4OGCA 2ZPHB 1Y7XA 3AT1B 1VQ8A 1CSKA 1W4SA 1D1AA 3OYYA 1U1TA 1VYVA 4Z02A 2GF7A 1UHFA 4OB3B 3JCMc 3DLLA 1G3TA 1X27A 4WF2A 4FCYA 1V76A 3CCSQ 3G4SQ 1J3TA 3M55A 4KUIA 4IUQA 2DL8A 3L1AA 3TSWA 2RHZA 2RJEA 1AD5A 2W0ZA 2AIRB 3V7RA 4RTYA 4KULA 3CD6Q 4BB7A 4E7JA 1YITA 1VQKQ 3EG0A 1M1GA 4AT1B 4PLLA 4F04B 1WA7A 2J05A 1HSQA 4MDWA 1QWEA 3CCLA 1UGRB 2F5TX 2CT3A 2KGTA 3CCMQ 3JB9F 1RABB 1GRIA 3BY7A 3OA6A 1VQPQ 2E10A 4ELZC 5CO7A 2YUPA 5GAMj 4RTZA 4PFZA 1VQOQ 1GFDA 2ROTA 3LYIA 1RAEB 2RHUA 2A08A 2V8JA 2EQIA 4WTOB 4PJOF 2LT1A 2K2VA 2DX1A 3LGLA 3L2WA 1YWPA 1TS9A 2E6NA 1I81A 1MV0B 2E65A 2HBPA 4N0AC 2EFIA 4EIKA 2QA4A 1SRMA 1UGQB 2DL7A 3CCRT 2O31A 4M75F 1KC8C 3RKWA 1KHIA 2EVRA 1QCFA 4QVZA 4C8QB 1NJIC 3O8VA 1YJNQ 2EJGA 3WVEB 1W2BA 3INZA 4PL6A 4J7FA 4HT8A 4C92D 2O2OA 3QWYA 2D1XA 1FXXA 2KT8A 3LH0A 3THKA 1FYNA 4ANJA 4D8DA 4M7DC 1UJYA 2VGMA 3M5AA 2DD4A 1BK2A 3G71A 1VQLA 3CC2A 2KYBA 1UECA 5GAOq 2DIGA 2HAXA 1C1AA 1Z9QA 4M7DG 2GTJA 1W2BS 3FLGA 2DXBA 4FL6A 9ATCB 3OYLA 1VQ4T 4FU6A 3GLXA 4E7LA 2C0OA 2X9HA 2HD0A 1OPKA 4D8KA 1HJDA 1XOVA 1ZBXA 1WJRA 2JM8A 3RNJA 1GCPA 2ZGWA 3QUIA 4J8OA 2M51A 3QJ6A 4ZGJB 1XNIA 3PVQA 1YHQT 3KXTA 4PJNA 1MNEA 1WLPB 2CDTA 1MNDA 4II1A 2A36A 4J5YA 2BZXA 1G83A 1WHGA 2O4XB 2KMTA 3CCQQ 3SWNB 3JCMg 3HRSA 2XICA 4QQGA 3OSVA 1CKBA 3CCUQ 4O5VA 4DQ2A 1LJOA 2DD5A 1YJ9Q 3L42A 3E2UA 1WXTA 5LJ5h 2K4YA 4TVRA 1QCNA 4C0GA 1VIFA 4LE9A 2KDSA 3A5ZB 3OBYA 3PT9A 2Z0WA 3CCVQ 2RI5A 3A98A 1N8RC 2YLBA 3CMAA 1WJSA 1SSHA 2XDBA 2R5AA 1QVGA 1OI1A 2PVOB 1VQ5T 1GCQC 3QG1A 4JZ4A 1I4K1 2K5IA 3VS5A 2CKKA 3QZ5B 1OX9A 1S72A 3I35A 3Q1JA 2LZ6B 4GBQA 1PRMC 5GAN7 2A3LA 2QDYB 1X6GA 4AG1C 4M77F 4RTTA 2O01E 1VQ9A 4RTXA 4RCBA 1QVGS 3GP8A 1G3WA 1Q95G 2CZ0B 2XDDA 3NTHA 1UGPB 3H0HA 4AG2C 1VQ8T 4QVCA 1N27A 2R5MA 2NYSA 5KYXA 1M3AA 5CKFA 5LJ5j 3I56Q 3UDCA 1M90R 3QHSA 3JCMP 1YBYA 4M7AE 2K3XA 3S6WA 4FT2A 4XTWA 2VC8A 1FX7A 2P0QA 2FVUA 4LDUA 1OULA 2ED0A 2COWA 4QVDA 3VJPA 2GTOA 1AWWA 3ZEHA 3JB9I 3J81E 3BDLA 3QJYA 2ZPFB 4LDWA 3M56A 2RJDA 4KT0E 1F1BB 2E4HA 2JS2A 2LCCA 1TUGB 2DRKA 4J9EA 4ZN1A 1RLPC 2E5KA 2P4RA 4L5GA 3QYHB 2VVKA 5EC7A 1YITT 4AFQC 2DM1A 2K3BA 1ZA2B 2HKNA 5AT1B 1OOTA 4RKUE 1JO8A 1U8RA 3ER0A 2F2VA 2FL7A 4F14A 4JZ3A 3M4GA 3SB2A 5KYNA 1JXOA 5J26A 4M7AC 3I55A 1Y96B 2DYIA 2COYA 2DPPB 3CC4A 2JTFA 2QQRA 1Z9ZA 2KRMA 1JJ2A 3JCMf 2GQIA 4LXCA 3EGDA 2Y4YA 4M7AG 2V8KA 5GAN3 2EQKA 1RL2A 3FEOA 3U23A 1ZQ1A 1OU8A 4M4ZA 2R58A 1TU0B 3V7CA 4EMHA 2V26A 2K2MA 2LRQA 5KYWA 1YI2Q 1YP5A 4C0DB 5GANg 3EGXB 5FRNA 3OS2A 2OTJQ 2DA9A 1CKAA 5J3BA 4CC3A 1ABQA 3GOXA 1WXBA 2OTLQ 1MMNA 3JB9H 4GLMA 4RTUA 5GAMf 2KROA 2LTOA 4E2FB 3JCMX 1JJ2S 4F7UE 2EYYA 3PIOA 5EG2A 3G71T 1OX8A 1HYOA 1Y0MA 3JCMJ 1ZHIA 5GAOp 4FM4B 1D09B 1SSFA 1O75A 2AKKA 2QGGA 1YIJQ 4DBQA 1VA7A 3EFRA 2ATCB 1VQ6Q 2NUTB 3META 2M9UA 5KYYA 4OB1B 2L0AA 2BZ8A 1DJ7B 2NUPB 3OB9A 3OYHA 2ABLA 5LJ5d 2KQWA 4F16A 4E7IA 1OYXA 2YDLA 4M78D 2K57A 3CCRA 2LQWA 3WXMB 1IXDA 1VQ7A 3G6EQ 1TG0A 1D1BA 2MOXA 1XQHA 4E7HA 4A4EA 1W6XA 1QKWA 3H41A 3LWHA 4DOWA 4RTVA 1RUWA 2IVWA 1BI2A 5IXFA 3M4YA 2RQWA 5IHKA 1NPRA 3OS5A 1QMCA 1KD1U 2DZ9A 5LJ3h 1JQQA 1NLPC 1QVFP 3NTKA 4F7UG 2JMAA 3CMAT 3QSUA 2RO0A 4KH0B 5IN1A 2DVEA 2EAYA 1NLOC 2O9VA 4A4FA 4F17A 1PD0A 2XK0A 4FSSA 1H3ZA 3UPUA 4CI0C 1KSWA 1QP2A 3A8HB 3RDVA 2PTKA 2LC4A 3JB9D 1VQNQ 1GXIE 1K9AA 2RN8A 1S72T 2FPDA 2C0IA 2L5QA 3GNGA 4A4GA 1K9MU 1UEBA 2GBQA 3OYKA 3X26B 3QXEB 4J7IA 4C92E 1YHQA 1BCMA 3M58A 2CREA 3S3MA 2LJ3A 1ARKA 2RPNA 3EFOB 4HKEA 1G3YA 5KE2A 4IUVA 1SRLA 3HRTA 2H8HA 2PU9B 2JVVA 1QVFA 1KHCA 2HQEA 2AKLA 3I5SA 4JJDA 5L8RE 2H3JA 1A0NB 1B7TA 4M75D 5IH2A 1WHKA 2DZCA 1OV3A 4PNOA 1MV3A 1YJWT 1BI0A 2HSPA 4E7SA 3RMSA 3V8LA 1H641 2CYZB 2DERA 1XTDA 3EG9A 1I5LA 4C8QF 5D7UA 2CUBA 4ZNXA 3KBGA 5GJVB 4FW1A 2RQRA 2CH4A 1QVFS 2QAZA 1Q82R 4C92C 3QDFA 2DXCA 3OYMA 2KRNA 3CCEA 5A2QE 4BDYA 3A1PA 1V1CA 3V8KA 3M54A 3JCMQ 1EFNA 2VUBA 3MO8A 2BIVA 4V2SA 4C8QA 4NS5A 3HSBA 4IIMA 2VXFA 4C92G 1SF9A 4J9DA 3CCJA 5LJ5f 1Q82U 2DE0X 2ZPBB 1D3BB 2F2WA 2RI2A 2NUZA 1H3HA 2CS7A 2FPFA 3MEWA 2G3RA 2EYXA 2A0FB 1Y71A 4M7DB 3CC4T 4ZTJA 4CRIA 2OAWA 1D0ZA 1E6GA 2EQJA 2L3SA 2LMJA 3UA6A 2YLCA 4M78A 2FZCB 1WDXA 3OYGA 1W1FA 1IGUA 1ZSZC 4AFSC 5DY9A 1IGQA 3TSZA 3CXCA 4A4HA 3RR6A 2FYKA 4OMMA 3ULRB 1K8AR 3HFOA 1ZUUA 2RH2A 3RIRA 1M5Q1 2DKGA 3UF4A 1Q7YR 2MF2A 5FLXE 3SDZA 3BDUA 5IAYA 4B9XA 1W2BP 5IXBA 2D0QB 5CKBA 3G4ST 4J9BA 1VUBA 2IG0A 2MWPA 1BKBA 1K8AU 2F2XA 4BD3A 1IHWA 3JCMb 4J6YA 2QEXQ 4M7DE 4XU3A 5FW9A 3E1SA 2DL4A 1Q7YU 2WSFE 4Y92A 4XTZA 1I07A 2E1HA 3CXCS 3CD6T 1TWBA 3JRZA 2XMFA 2RM4A 2Y4XA 5GAOm 2LQKA 1YCSB 2B8AA 1YFNA 3VUZA 3OBWA 2YSQA 1ZBJA 3JCMW 5KCOA 5LJ5e 3R6OA 5LJ3d 3L2QA 4FIBA 3CCMT 2MK5A 4NL3A 2I2LA 3RBBB 1VQPT 2DEQA 3H6ZA 1VQ7T 2DFUA 2NLUA 1VQOT 4ZGDB 4PJOA 4FW2A 1VYUA 4DA4A 3QBYA 1M4ZA 1AHJB 4L6V5 4JRIA 4ZN3A 5DLQE 1PKTA 1ZUYA 4BE0A 2FHDA 1N5ZA 4PK4A 2PUOB 2CSIA 2J6OA 1I5OB 5IHNA 4M75A 3QYGB 2QTXA 2ZCFB 1EX4A 1OZ3A 4HA8A 4BE2A 1SKUB 3J7AF 2ZPGB 2EJ9A 2M02A 3VRZA 3MP1A 2LQNA 1VQ4Q 4J9FA 1WYXA 1WQWA 4EPCA 3MKDA 4HT9A 4FYVB 3JB9J 4CC2A 2PVGB 1QVGP 4JJNK 3LLRA 5GANh 5HKCA 3PMIA 3MEUA 1QP3A 4HCBA 1Y07A 2HMAA 2V1RA 4A63B 3M0UA 8AT1B 2GQVA 2ECZA 3CMEA 3H0FA 2DTIA 2M0OA 2D9TA 2KXDA 1NE8A 4Y28E 2HL3A 1MHNA 3M0RA 2F69A 1QW1A 3CEYA 4CC4B 3DB4A 1K73R 2XIDA 3AHUA 4X9DA 2D0NA 1ACMB 1T0HA 2GFAA 4CC7A 2KRSA 1UDLA 5HK0A 5CAIA 2O88A 3HP9A 3SD4A 2LJ0A 1NYFA 3WVDB 2LP5A 2K3YA 1NG2A 1K73U 3OYAA 2LCSA 1VQ5Q 4P5NA 4J9HA 3OYNA 4M7AB 3F70A 1AT1B 1WHLA 3GBQA 5I22A 4JRQA 3BFMA 5GAMg 3G1JA 3EFSA 2HKQB 2JOYA 1BI3A 1YJ9T 4EMKC 4Z8AA 5C6SA 3GPLA 3CCET 5LL6S 2O9SA 2EPDA 2MIOA 2HQHA 2D8HA 4J9IA 2XKOC 1O9SA 2MYSA 2ROLA 5D6YA 1K0SA 1TOVA 3CCJT 3A8LB 1D1CA 3A8OB 1VQ8Q 1M90C 3H0IA 2HBWA 5A0LA 4Z89A 3RUXA 1B07A 5A0DA 4N4IA 1RAHB 2CZ6B 4J9CA 3R6NA 5CQXA 2EYQA 4FYWB 3VS0A 4JS5A 1VIEA 4M77A 4KGVB 4OP0A 2LQ8A 1YJWA 2A37A 1M3BA 2COZA 2PUKB 1H8KA 1OQKA 4DBHA 4M78C 1U5SA 1AVZC 2RK1A 5ECAA 2PNIA 2VGNA 1M2VA 4J83A 2OAUA 1KQ1A 1Q86U 1JJ2P 1YITQ 4JLIA 4MZPA 5D6WA 2DL5A 3MP8A 1KJWA 4LDXA 1PRLC 3A8MB 1RAFB 2LX7A 3CCLQ 4IIOA 3I56T 2K5LA 2ED1A 4DBRA 2GNCA 4M78G 2X35A 3OW2P 1BIAA 2KK4A 3LGFA 3H8ZA 3VV0A 4XTVA 1RLQC 2FPEA 3EG2A 3REBB 1ZLMA 2XI9A 2WSEE 4C5HA 2DEUA 4OMNA 3RKYA 2K6DA 4M75E 5CKHA 2XDPA 4F7UB 2KR3A 3P8BB 3OY9A 3S3NA 2DRMA 1B3QA 2DXTA 2RHXA 4KRTA 4QKUA 2M16A 2DJZA 4BY6C 1PD1A 4IURA 4XTYA 2QA4Q 3TU4K 3CC7A 1ZSGA 5I2SA 1QCOA 2QDLA 4HCCA 1WHHA 1MMAA 1IHVA 4RTWA 3MCAB 5C0MA 5IT9E 5LJ3e 3VKIA 1RAAB 1BU1A 2X4YA 4RCCA 1B34B 4LD9K 1FMVA 2QXFA 4PJOC 3D7SB 5DM7R 1JU5C 3OW2A 1TXQA 1KG1A 1WGSA 3JB9G 1JXMA 3TREA 1YWOA 3VUBA 4OB2B 1RAGB 2X4JA 1WHJA 4N4HA 5KYUA 1KQ2A 3G71Q 3SFMA 4PJMA 1M1KU 1VQLQ 4AFUC 3CC2Q 4M75C 1TH7A 2CP6A 2ZPEB 4LUDA 4PJOG 2VYTA 3CCSA 1G3SA 2Y90A 5GANd 4C8QD 4Z88A 3L2VA 3G4SA 2F5KA 2VASA 3CBPA 2DK3A 2H3EB 1YI2T 2EKOA 4LDVA 5IHIA 3LWIA 3C12A 1R77A 3N5BB 1MMDA 4JJCA 2CP0A 5DLOA 2V1QA 3OW2S 2CUDA 2OTJT 1TUDA 4M75G 1LOJA 3PFSA 3CD6A 1LPLA 3TVTA 4QT7A 2CGHA 2JUFA 2QQBA 1M1FA 3OYCA 2KEAA 4X34A 1VQMT 1VQKA 2OTLT 2DTHA 1NYGA
chains in the Genus database with same CATH topology
4R55A 1W2BA 2JTMA 1QVFS 3MHXA 4C92C 2KY9A 3INZA 4PL6A 2DXCA 2QQ9A 3OYMA 4J7FA 5LJ5g 3CCEA 4HT8A 5A2QE 4C92D 4BDYA 4LDYA 1KD1C 1FXXA 3V8KA 3CCMA 3LH0A 2YRVA 2K5FA 4OGEA 3M54A 3JCMQ 4M7DC 3CMET 2VUBA 3FC3A 3MO8A 2BIVA 3L2ZA 1VQPA 2VGMA 5GMKl 2P0KA 2QI2A 4NS5A 4LD6A 3TEEA 4C8QA 4M7DD 4V2SA 1VQOA 3M5AA 2DD4A 3HSBA 3G71A 2RK2A 2VXFA 3JSCA 4C92G 3CCJA 1Q82U 4N4GA 5LJ5f 1VQLA 3CC2A 4C92F 2L89A 4MDXA 2ZPBB 1D3BB 4KBMB 4BE1A 1YIJT 4C92B 4OVAA 5GAOq 1VQ6T 2QQAA 2DIGA 2EQMA 2RI2A 4XU2A 4E47A 2HAXA 2RA2A 2CS7A 3ZFJA 4Y91A 3MEWA 4PJOE 2P0PA 4RG2A 4N0AA 5FU6C 4M7DG 1M90U 2G3RA 1W2BS 4M7DF 1G5VA 1FWZA 3GNFB 4ME7A 3FLGA 2DXBA 1Y71A 4FL6A 4M7DB 3QZ9B 3CC4T 2LT4A 5FROA 1PSFA 4IUPA 5M9OA 4B9WA 4ZGEB 3OYLA 2LDMA 1VQ4T 2E41A 2FB7A 3GLXA 4FU6A 4E7LA 1K9MC 3SWNC 2XD0A 2L8DA 4CRIA 4ZTJA 3JCMV 3FB9A 1X6OA 2E6ZA 2HD0A 3HL8A 4C92A 3L2UA 2BUDA 3LW5E 1XOVA 1BI1A 1ZBXA 1WJRA 4Q5WA 2EQJA 1YJNA 2YLCA 4M78A 5CVIA 2ZGWA 3QUIA 4J8OA 4XTXA 1KQSA 3CCLT 3QJ6A 4ZGJB 1XNIA 3OYGA 5HY6A 5FU6B 1YHQT 5J39A 3OS0A 3KXTA 5DY9A 4PKCC 4II1A 3CXCA 3G7ZA 4A4HA 1M1KC 4J5YA 2LNVA 2FYKA 3X24B 1NZ9A 4FSXA 2O4XB 2KMTA 3HFOA 2RH2A 3RIRA 1M5Q1 3SWNB 5CQYA 3JCMg 2P4TA 3HRSA 2XICA 5GMKh 4QQGA 3OSVA 3ME9A 4O5VA 2DKGA 2MF2A 3RKXA 4DQ2A 5FLXE 1LJOA 2DD5A 3SDZA 3BDUA 5IAYA 3L42A 4B9XA 4QQDA 1X01A 2X4XA 2D0QB 5CKBA 5LJ5h 1BYMA 2K4YA 3X25B 3G4ST 1VUBA 3GIBA 4ATOA 2IG0A 1M9SA 3C94A 4TVRA 4C0GA 3PIPA 1VIFA 1M8VA 4BDZA 2KDSA 2MWPA 3A5ZB 3OBYA 4JLGA 1BKBA 4PJOD 3PT9A 4OB0B 3CPWA 5GAOn 1K8AU 2RI5A 1R8OB 3E19A 4BD3A 1N8RC 3JCMb 2YLBA 4J6YA 2E5QA 3CMAA 1KQSS 1WJSA 5FRMA 4M7DE 4XU3A 3ASKA 3E1SA 2XDBA 2R5AA 1Q7YU 2QA4T 2WSFE 4XTZA 1QVGA 2E1HA 1OI1A 3OYDA 3CXCS 2E12A 3CD6T 2JN0A 2PVOB 3OQ5A 4JDSA 1VQ5T 4M77C 5LJ3j 3JRZA 3QG1A 2RM4A 2Y4XA 5GMKe 5GAOm 1HK9A 2LQKA 2KVQG 1I4K1 2B8AA 2K5IA 3QIIA 3VUZA 2CKKA 3OBWA 4JS4A 2ZPIB 3QZ5B 3HHTB 3CBMA 3JCMW 5KCOA 2WSCE 2EJFA 5LJ5e 1S72A 2L3RA 4IUUA 3R6OA 3Q1JA 5LJ3d 3L2QA 2RD1A 4FIBA 3CCMT 5KE3A 4NL3A 1Q82C 2I2LA 2HNIA 2E70A 5GAN7 2A3LA 2QDYB 2DEQA 3QKJA 4M77G 5GMKi 3H6ZA 3CPWS 1VQPT 1VQ7T 3OS1A 2NLUA 3QO3A 4M77F 3CCQA 1VQOT 1V29B 4NL2A 4ZGDB 4XK8E 4M77B 1VQLT 4PJOA 2O01E 1VQ9A 3CCUA 3CC2T 1YCYA 2EIFA 4DA4A 4RCBA 3MP6A 3QBYA 4R56A 1M4ZA 1AHJB 4MZTA 3OYIA 4ZTFA 1YJ9A 4L6V5 4BI4A 1X75C 1QVGS 1EIFA 4JRIA 5GMKj 3GP8A 1G3WA 4ZN3A 5A0GA 2CZ0B 5DLQE 2XDDA 3NTHA 1UGPB 4BE0A 3OMGA 2FHDA 4C5EA 1VQ8T 4QVCA 1N27A 4XAXB 2R5MA 4RMOA 5LJ5j 5CKFA 2PUOB 3UDCA 3CCVA 3HFNA 3QHSA 4M75A 2QEXA 4MMLA 3JCMh 1YBYA 3JCMP 3QYGB 2QTXA 1JBMA 4JRPA 4M7AE 2ZCFB 3FIFA 2K3XA 3S6WA 4FT2A 1OZ3A 4XTWA 1Q81U 4JUVA 2VC8A 1FX7A 4GLKA 4HA8A 2P0QA 3VYHB 4BE2A 2FVUA 3CBOA 4LDUA 1N9SA 3J7AF 4QVDA 2ZPGB 3VJPA 2EJ9A 4OF1A 3MP1A 4BUGA 1JB0E 5D6XA 3ZEHA 3JB9I 3J81E 3BDLA 3DKMA 2ZPFB 3C4SA 3QJYA 4J6WA 4LDWA 2DO3A 5CK9A 3M56A 5I2MA 2RJDA 3JAME 1WQWA 4EPCA 4KT0E 2LCCA 5GAOl 5GAN5 3DLMA 4HT9A 2LX9A 3JB9J 4ZN1A 3CC7T 4JRKA 4OMFB 4ELYC 4L5GA 3QYHB 2PVGB 3URGA 4JJNK 3LLRA 1D3BA 2EWNA 1YITT 3RMQA 5GANh 1PSEA 2DXUA 4GY5A 5HKCA 3PMIA 3JCMe 3MEUA 5GAMh 1QP3A 5HK3A 1Y07A 4HCBA 4FT4A 4M77E 4NOYA 3G6ET 3HKSA 2VXEA 3VYGA 3QPHA 1K8AC 1BIBA 2GQVA 3PMTA 4MMKA 3CMEA 4RKUE 4A4KA 2DTIA 4M7DA 1U8RA 2M0OA 2D9TA 5CR2A 3M57A 1NE8A 3PNWC 2CZ1B 3ER0A 3NTIA 4Y28E 1Q7YC 2FL7A 1MHNA 2F69A 3V7SA 1QW1A 3CEYA 3M4GA 3E9GA 3SB2A 3DB4A 2HQXA 2XIDA 3I56A 4HCZA 3AHUA 5J26A 4A54A 4M7AC 4KUDK 5CCAA 5GAN4 3I55A 4X9DA 1Y96B 2DIQA 3BW1A 4M7AD 4IKFA 3HPWA 2D6FA 4C0DC 2DAQA 1RI0A 2GFAA 5HK0A 5CAIA 3CCST 2R57A 3HP9A 3SD4A 3WVDB 4IUTA 3X28B 5GANe 2ZZDA 2DPPB 2MI6A 2JTFA 2XU8A 3E9FA 2QQRA 4BI3A 5GAMe 3CC4A 3RESA 2K3YA 5GAOr 1MGQA 1VQ4A 1K73U 1JJ2A 3JCMf 3OYAA 2KAFA 2O4XA 5AYFA 2Y4YA 4M7AG 2V8KA 5GAN3 1QVPA 2EQKA 1RL2A 3QDRB 3FEOA 4P5NA 3SWNA 1ZQ1A 4C0FA 4M7AF 4EMGA 3OYNA 2R58A 4VUBA 5CIUA 3V7CA 4M7AB 3UWNA 3F70A 1WPYA 4MZMA 1WJQA 4EMHA 3NFCA 2LRQA 4JRQA 1VQNT 1IREB 4C0DB 5GANg 5FRNA 1UB4A 3BFMA 5GAMg 1VQKT 2RHIA 5FU7C 3EFSA 5GMKm 1VQ9T 2RHYA 1I8FA 4M77D 3OS2A 3OYFA 4C0ZA 2JOYA 1BI3A 5GAN8 2X4WA 1YJ9T 5J3BA 2WACA 4EMKC 4C5GA 5C6SA 3GPLA 2GFUA 3CCET 2RJCA 5LL6S 3GOXA 2MMPA 4A53A 3FDRA 5LJ3g 4M7AA 2PQWA 3JB9H 3KUFA 4O6JA 5GANf 3X20B 1Q81C 2XKOC 4J6XA 1O9SA 3MEAA 5GAMf 2LTOA 3DB3A 3JCMX 2QEXT 1JJ2S 3M53A 5D6YA 4F7UE 3PIOA 5EG2A 3G71T 3LX7A 3CCJT 4D6WA 3A8LB 3JCMJ 3A8OB 3HRUA 3J80E 1WQ7A 3TCJA 5FU7B 1ZHIA 4RG8A 2E64A 2M1HA 1M90C 2BKDN 5GAOp 2DTOA 5A0LA 4XU1A 4FM4B 4PLIA 4EMKB 3RUXA 4XQ3A 2PVDB 2RB6A 1SSFA 3C95A 1O75A 5A0DA 2C06A 1N6AA 4N4IA 2CZ6B 2CZ7B 5GAN6 3EFRA 5CQXA 1VQ5A 2EYQA 4E7KA 3EAEA 4JS5A 1VIEA 4M77A 1NPPA 3META 2M9UA 4OP0A 2LQ8A 4OB1B 1YJWA 2YHTA 1DJ7B 3P8HA 1YI2A 3OB9A 2PUKB 3OYHA 5LJ5d 3UT1A 2V8IA 4EDUA 4EMKA 4M78C 4UC4A 2KQWA 4E7IA 2RK1A 1OYXA 2LCLA 2MAMA 3OMCA 4BI8B 4C5IA 1YJNT 3T9NA 2AHJB 4M78D 4QW2A 3ZBDA 2K57A 5KH6A 2VGNA 1OZ2A 2OTJA 3RERA 4J83A 3CCRA 2OAUA 1KQ1A 1Q86U 5GAN2 2XHCA 4JLIA 4MZPA 3WXMB 5D6WA 3VU3C 5CKDA 1VQ7A 3MP8A 4LDXA 3CPFA 4DOVA 1HXDA 3V8JA 1VQMA 2OTLA 3A8MB 1WNLA 1KC8U 4E7HA 1XQHA 3I56T 2K5LA 1LNXA 4A4EA 3FJPA 4YTLA 4M78G 2X35A 3I55T 3L2RA 1NJIU 4M78F 3LWHA 1P92A 3P8DA 1BIAA 3FRNA 4DOWA 4OGCA 2KK4A 2ZPHB 4M78B 1Y7XA 3LGFA 1VQ8A 1JRIA 2IVWA 1BI2A 3M4YA 1K73C 3H8ZA 4XU0A 4XTVA 3VV0A 1W4SA 1NPRA 3OS5A 3OYYA 1UGSB 2RJFA 1U1TA 1KD1U 2DZ9A 4QQ6A 4Z02A 5LJ3h 2GCXA 2GF7A 4OB3B 3JCMc 3DLLA 3NTKA 1G3TA 4WF2A 2XI9A 4F7UG 2WSEE 1IZ6A 4C5HA 3CMAT 3QSUA 4F7UF 3RKYA 2RO0A 1YIJA 4M75E 5CKHA 2XDPA 5IN1A 4C8QE 2DVEA 3M55A 3P8BB 4F7UB 1VQ6A 2EAYA 4KUIA 5CKEA 4IUQA 3PGGA 1N9RA 3L1AA 4A4FA 3OY9A 2RHZA 2XK0A 3S3NA 3OSSC 2RJEA 2RI3A 1H3ZA 3UPUA 2DXTA 2RHXA 2M16A 4CI0C 3GF5A 2DJZA 1QP2A 3A8HB 4BY6C 3V7RA 4IURA 4XTYA 3TU4K 2EQUA 4KULA 3CC7A 4BB7A 4E7JA 5I2SA 2LC4A 5KCHA 3JB9D 3S3OA 4HCCA 1GXIE 1S72T 1YITA 4F7UA 3JCMd 1Y96A 3MCAB 5C0MA 5IT9E 1M1GA 5LJ3e 3VKIA 2L5QA 3G6EA 3GNGA 4A4GA 4PLLA 1K9MU 1UEBA 2X4YA 4RCCA 4MDWA 3OYKA 3X26B 3CCLA 2VV5A 1B34B 3QXEB 4J7IA 4C92E 1YHQA 4LD9K 1UGRB 2QXFA 3M58A 4X9CA 5DM7R 3CCQT 3OW2A 4PJOC 1KG1A 3S3MA 1WGSA 2F5TX 2XG8D 3JB9G 3TREA 3CCUT 3JB9F 4M78E 3BY7A 3VUBA 4BY6B 3OA6A 4L59A 4OB2B 4HKEA 2X4JA 1G3YA 2MWOA 2KSSA 5KE2A 4IUVA 5GANj 3OYEA 2E10A 4ELZC 4N4HA 5CO7A 5GAMj 3HRTA 4XTUA 2PU9B 1KQ2A 3M9QA 2JVVA 3SFMA 3CCSA 1KHCA 1M1KU 4BACA 1QVFA 2HQEA 3LYIA 1TH7A 4M75C 2JNGA 4C8QC 3CCVT 2ZPEB 2RHUA 5L8RE 1B34A 2H3JA 4PJOG 2VYTA 2V8JA 1G3SA 4M75D 1U1SA 2Y90A 5GANd 4C8QD 4PJOF 3L2VA 3G4SA 2DZCA 3M59A 2F5KA 2LT1A 5GAMd 2K2VA 3CBPA 4PNOA 2LVMA 4PJOB 3OYJA 3L2WA 3LGLA 3MEVA 1YJWT 1BI0A 2DK3A 5I21A 1YI2T 2EKOA 4LDVA 3LWIA 3RMSA 2E6NA 1I81A 3C12A 3N5BB 2E65A 5LJ3f 1Q86C 2HBPA 3V8LA 1H641 4N0AC 3A8GB 5DLOA 2CYZB 3OW2S 2EFIA 2OTJT 2QA4A 4M75G 1UGQB 4C8QG 1LOJA 3CCRT 1XTDA 1N8RU 3PFSA 4M75F 1KC8C 2JZ2A 4C8QF 1I5LA 2OTLT 3CD6A 3RKWA 1VQNA 1KHIA 2CGHA 2QQSA 4M75B 2JUFA 3OYBA 4QVZA 4C8QB 2QQBA 2A7YA 3KBGA 3PTAA 1M1FA 3OYCA 4X34A 1VQMT 1NJIC 3O8VA 1VQKA 2DTHA 2EJGA 3WVEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 G;  4M77 C;  5LJ3 j;  4C92 C;  4M78 F;  3INZ A;  2RM4 A;  5GMK e;  5GAO m;  1BIA A;  1HK9 A;  5CAI A;  5LJ5 g;  4HT8 A;  1I4K 1;  4M78 B;  4C92 D;  5GAN e;  1JRI A;  3JCM W;  5GAM e;  4XU0 A;  4XTV A;  3RES A;  3V8K A;  2EJF A;  5LJ5 e;  5GAO r;  1MGQ A;  1U1T A;  3JCM Q;  2DZ9 A;  3JCM f;  4M7D C;  5LJ3 h;  5LJ3 d;  4M7A G;  2RD1 A;  3JCM c;  3L2Z A;  5GAN 3;  5GMK l;  3SWN A;  4NL3 A;  4C8Q A;  2I2L A;  4WF2 A;  4F7U G;  2HNI A;  4M7D D;  4M7A F;  4EMG A;  4V2S A;  3V7C A;  4F7U F;  5GAN 7;  4M7A B;  2DEQ A;  4M77 G;  3RKY A;  1WPY A;  2VXF A;  4C92 G;  4EMH A;  4M75 E;  5GMK i;  5LJ5 f;  3QO3 A;  4M77 F;  4C8Q E;  2DVE A;  4F7U B;  4C92 F;  2EAY A;  4NL2 A;  1D3B B;  3PGG A;  4M77 B;  4PJO A;  4C92 B;  1N9R A;  3L1A A;  5GAO q;  5GAN g;  1YCY A;  4XU2 A;  3BFM A;  4RCB A;  2RA2 A;  5GAM g;  5GMK m;  3EFS A;  3QSU A;  4Y91 A;  1I8F A;  4M77 D;  4PJO E;  2DXT A;  4JRI A;  4N0A A;  5GMK j;  5GAN 8;  4M7D G;  2DJZ A;  4EMK C;  3V7R A;  4M7D F;  3HSB A;  4XTY A;  4M7D B;  4A53 A;  4QVC A;  5LJ5 j;  5LJ3 g;  3JB9 D;  4M7A A;  3HFN A;  3QHS A;  4M75 A;  3JCM P;  4MML A;  3JCM h;  2E41 A;  2FB7 A;  4F7U A;  3JCM d;  5GAN f;  2QTX A;  3SWN C;  3JB9 H;  1JBM A;  4J6X A;  1Y96 A;  5GAM f;  4M7A E;  3JCM V;  3FB9 A;  3FIF A;  5LJ3 e;  4C92 A;  3JCM X;  4XTW A;  4F7U E;  4JUV A;  2VC8 A;  4RCC A;  4HA8 A;  1B34 B;  1N9S A;  4C92 E;  3JCM J;  2YLC A;  4M78 A;  1WQ7 A;  4X9C A;  2ZGW A;  3QUI A;  4XTX A;  4PJO C;  2E64 A;  4QVD A;  2EJ9 A;  3JB9 G;  5GAO p;  2DTO A;  3JB9 F;  4XU1 A;  4M78 E;  3JB9 I;  4EMK B;  3BY7 A;  3RUX A;  5DY9 A;  4J6W A;  4XQ3 A;  5GAN h;  2RB6 A;  5GAN j;  1WQW A;  2E10 A;  4J5Y A;  5GAM j;  2FYK A;  4XTU A;  5GAO l;  5GAN 5;  1KQ2 A;  4HT9 A;  3HFO A;  5GAN 6;  3JB9 J;  3EFR A;  1M5Q 1;  4JRK A;  3RIR A;  3SWN B;  3JCM g;  4M75 C;  1TH7 A;  5GMK h;  4C8Q C;  1B34 A;  1D3B A;  2DKG A;  2EWN A;  4M77 A;  4PJO G;  3RKX A;  4DQ2 A;  2DXU A;  4M75 D;  1U1S A;  2Y90 A;  1LJO A;  3BDU A;  4OP0 A;  4PJO F;  4C8Q D;  2DZC A;  2YHT A;  3JCM e;  5GAM h;  5GAN d;  1X01 A;  5GAM d;  4PNO A;  4M77 E;  4NOY A;  5LJ5 h;  4PJO B;  5LJ5 d;  2VXE A;  4EMK A;  3GIB A;  5I21 A;  4M78 C;  1BIB A;  4MMK A;  1I81 A;  5LJ3 f;  2E65 A;  4PJO D;  2DTI A;  4M78 D;  3V8L A;  4M7D A;  2K57 A;  1H64 1;  5GAO n;  4N0A C;  3RER A;  1KQ1 A;  3JCM b;  2YLB A;  4J6Y A;  5GAN 2;  4JLI A;  3VU3 C;  4M75 G;  3V7S A;  4M7D E;  4C8Q G;  3M4G A;  1LOJ A;  4XU3 A;  3SB2 A;  1I5L A;  4M75 F;  4C8Q F;  1HXD A;  3V8J A;  3RKW A;  3AHU A;  1M8V A;  4XTZ A;  2CGH A;  4A54 A;  4M75 B;  4M7A C;  4C8Q B;  2E1H A;  1WNL A;  5GAN 4;  2JN0 A;  4X9D A;  1Y96 B;  1LNX A;  3BW1 A;  2DTH A;  4M7A D;  3FJP A;  2EJG A; 
#chains in the Genus database with same CATH topology
 2KNB B;  4R55 A;  2ESW A;  2KY9 A;  2EW3 A;  2JS0 A;  2GGR A;  5LJ5 g;  2FEI A;  1KD1 C;  2I0N A;  3CCM A;  2RQU A;  2YRV A;  3CME T;  3FC3 A;  1VQP A;  2P0K A;  4LD6 A;  1KD1 R;  1VQO A;  3JSC A;  4PJJ A;  2PZ1 A;  2L89 A;  2DMO A;  1YIJ T;  4C92 B;  1VQ6 T;  2QQA A;  2EQM A;  4XU2 A;  2RA2 A;  4Y91 A;  4RG2 A;  4N0A A;  5FU6 C;  2DNU A;  3NPF A;  3CMA Q;  4M7D F;  3CPW P;  1FWZ A;  3GNF B;  4ME7 A;  1S1N A;  2D8J A;  2EYZ A;  4JJB A;  2LT4 A;  5FRO A;  4IUP A;  4ZGE B;  3EH2 A;  4AMC A;  1TSF A;  2CT4 A;  1K9M C;  1MUZ A;  1K4U S;  2XD0 A;  2L8D A;  3JCM V;  3HL8 A;  1PNJ A;  1NEG A;  1T3L A;  2BUD A;  1MMG A;  1BI1 A;  1YJN A;  3MJX A;  5CVI A;  4XTX A;  1KQS A;  1K9M R;  1S72 Q;  4PFP A;  2FZG B;  2EGA A;  2FG0 A;  1M30 A;  3NHN A;  1NZ9 A;  3EGD B;  1AWO A;  2EBP A;  4HCK A;  5CQY A;  2JTE A;  5GMK h;  1VQ9 Q;  2DF6 A;  3LH5 A;  7AT1 B;  1E6H A;  1RAC B;  3X25 B;  3C94 A;  3PIP A;  1ZSZ B;  4JLG A;  5FWC A;  4PJO D;  4OB0 B;  3CPW A;  1KQS S;  2FZK B;  1WFW A;  2FO0 A;  1PC0 A;  2YXY A;  2JN0 A;  2BZY A;  4OMQ A;  4M77 C;  4DEX A;  5LJ3 j;  1UJ0 A;  4FYY B;  2L3Q A;  3QII A;  2ZPI B;  1UFF A;  2RQV A;  3CBM A;  1WXU A;  1RAI B;  2EJF A;  4IUU A;  1I0C A;  1AEY A;  2RD1 A;  5KE3 A;  1Q82 C;  2HNI A;  1RI9 A;  2E70 A;  3CPW S;  4M77 G;  5GMK i;  3CCQ A;  3EHR A;  4XK8 E;  4OMP A;  2FRY A;  1NM7 A;  5KYY B;  3CCU A;  1UTI A;  1Q81 R;  3MP6 A;  3OYI A;  4R56 A;  1YJ9 A;  4MZT A;  2D6F A;  4HVU A;  4BI4 A;  5GMK j;  2RMO A;  3CXC P;  4RMO A;  3CCV A;  1QWF A;  1SEM A;  3JCM h;  3I55 Q;  2KXC A;  1JBM A;  2HCK A;  3PE0 A;  2DET A;  1SHG A;  1Q81 U;  4GLK A;  1VYT A;  3VYH B;  8ATC B;  2OJ2 A;  1U06 A;  1T3S A;  3CC4 Q;  1PHT A;  4OF1 A;  1JB0 E;  5D6X A;  1FMW A;  2A28 A;  3C4S A;  3DKM A;  4J6W A;  5CK9 A;  3JAM E;  3SHW A;  3CC7 T;  4JRK A;  4OMF B;  4ELY C;  2EWN A;  3RMQ A;  2DXU A;  1ZX6 A;  2KYM A;  1VOM A;  5GAM h;  3VS7 A;  1SG5 A;  4FT4 A;  2DBM A;  2SEM A;  2VXE A;  3VYG A;  3QPH A;  1K8A C;  3NGP A;  4MMK A;  4A4K A;  1G2B A;  3PNW C;  2CZ1 B;  4K11 A;  3TQ7 P;  1Q7Y C;  3V7S A;  2P84 A;  2OI3 A;  3I56 A;  4A54 A;  1TTH B;  3PVL A;  4KUD K;  2QK0 A;  5CCA A;  2DIQ A;  1PM3 A;  3BW1 A;  3HPW A;  1LCK A;  2DAQ A;  2YRC A;  5L23 A;  3C0C A;  3CCS T;  4HVV A;  1UGV A;  2R57 A;  4IUT A;  2J6F A;  3X28 B;  5GAN e;  2ZZD A;  2C0T A;  2MI6 A;  1BBZ A;  3RES A;  1U3O A;  5GAO r;  1MGQ A;  1X2Q A;  2CP7 A;  2KAF A;  2O4X A;  1QVP A;  3QDR B;  3SWN A;  2RNA A;  4C0F A;  4M7A F;  2HL5 C;  3UWN A;  2W10 A;  1WPY A;  1IRE B;  3UAT A;  1UB4 A;  1M27 C;  1VQK T;  1OPL A;  5FU7 C;  4M77 D;  5GAN 8;  3CCR Q;  2YT6 A;  3EHQ A;  2IIM A;  1KK7 A;  1VQ7 Q;  3REA B;  2MMP A;  4A53 A;  3FDR A;  5LJ3 g;  4M7A A;  1WHM A;  4LN2 A;  3VS2 A;  3EG9 B;  4J6X A;  2MCN A;  3DB3 A;  2QEX T;  3LX7 A;  3HRU A;  3J80 E;  3TCJ A;  2E64 A;  2DTO A;  4PLI A;  4EMK B;  4B6M A;  2YUN A;  3C95 A;  1N6A A;  3IQL A;  5GAN 6;  3EG3 A;  1JEG A;  2KT1 A;  1AWJ A;  2CP2 A;  1PCX A;  1NPP A;  4OML A;  1PKS A;  1WIE A;  1KC8 R;  1YI2 A;  3EG1 A;  2BE9 B;  2V8I A;  3UT1 A;  4EDU A;  2BTT A;  1ZA1 B;  2LCL A;  2MAM A;  3OMC A;  4C5I A;  1NJI R;  1YJN T;  3T9N A;  5KH6 A;  2OTJ A;  3ZBD A;  1OZ2 A;  3JV3 A;  5GAN 2;  4R0K A;  2VWF A;  5CKD A;  3M0S A;  1IO6 A;  3CPF A;  4DOV A;  1HXD A;  2YRD A;  1K0X A;  1VQM A;  2OTL A;  1X69 A;  2L3P A;  1KC8 U;  1YHQ Q;  1I1J A;  3FJP A;  1IRX A;  3CQT A;  1NJI U;  2DYB A;  1P92 A;  3P8D A;  3FRN A;  2QTV A;  4M78 B;  2CP5 A;  1JRI A;  1K73 C;  4XU0 A;  1X6B A;  1UGS B;  2RJF A;  4QQ6 A;  2GCX A;  1IZ6 A;  4F7U F;  1YIJ A;  4C8Q E;  1C6V X;  1VQ6 A;  2AK5 A;  5CKE A;  3PGG A;  1N9R A;  4E7Z A;  3OSS C;  2RI3 A;  3GF5 A;  2QG9 B;  2EQU A;  1YNZ A;  1GBQ A;  2VB6 A;  5KCH A;  3S3O A;  2RF0 A;  3KFV A;  3M0T A;  4F7U A;  1TUC A;  3JCM d;  2DLP A;  1K76 A;  1Y96 A;  3G6E A;  1FMK A;  1Y57 A;  3CCE Q;  2VV5 A;  2VKN A;  4X9C A;  3CCQ T;  3BE3 A;  2MPX C;  2XG8 D;  3CCU T;  4M78 E;  1R0B G;  4BY6 B;  4L59 A;  1ABO A;  2MWO A;  2KSS A;  4FYX B;  5GAN j;  3OYE A;  4XTU A;  3M9Q A;  3CCJ Q;  4BAC A;  4X1V A;  1IB8 A;  2JNG A;  4C8Q C;  3CCV T;  1N8R R;  2DL3 A;  1KFZ A;  1B34 A;  2DBK A;  1U1S A;  3EGX A;  3M59 A;  5GAM d;  2LVM A;  4PJO B;  3OYJ A;  3MEV A;  5I21 A;  1X43 A;  3SEM A;  5LJ3 f;  1Q86 C;  5I11 A;  3A8G B;  1HD3 A;  6AT1 B;  4C8Q G;  1OU9 A;  1N8R U;  2JZ2 A;  1Q86 R;  1VQN A;  2QQS A;  1M8V A;  4M75 B;  3OYB A;  5GJW B;  1QQJ A;  2A7Y A;  3PTA A;  2KE9 A;  3EGU A;  2KI7 A;  2HEQ A;  2JTM A;  3MHX A;  1ZUK A;  2QQ9 A;  4HVW A;  4LDY A;  1PWT A;  1K1Z A;  2K5F A;  4OGE A;  3L2Z A;  5GMK l;  3TEE A;  2QI2 A;  4M7D D;  2L2P A;  1EZZ B;  2E3I A;  2ZAE A;  2NUT A;  2RK2 A;  4N4G A;  2J06 A;  4C92 F;  2YUO A;  4MDX A;  2NUP A;  4KBM B;  4BE1 A;  4OVA A;  4E47 A;  2AZS A;  3ZFJ A;  4PJO E;  1AZG B;  2P0P A;  1M90 U;  3I9Q A;  3M0Q A;  1G5V A;  4OMO A;  3QZ9 B;  1PSF A;  2E3H A;  4WCI A;  5M9O A;  4B9W A;  2EYW A;  2LDM A;  2CH4 W;  2E41 A;  2FB7 A;  3SWN C;  3FB9 A;  1X6O A;  2E6Z A;  4C92 A;  3L2U A;  4J9G A;  2QGF B;  3LW5 E;  4Q5W A;  2LJ1 A;  2CP3 A;  3CCL T;  1T0J A;  3VS1 A;  5HY6 A;  5FU6 B;  5J39 A;  1OEB A;  3OS0 A;  4PKC C;  1UHC A;  2EGC A;  3G7Z A;  1M1K C;  1UUE A;  2LNV A;  3X24 B;  4FSX A;  4ORZ A;  4LNP A;  2P4T A;  1PG5 B;  2K7A A;  1GBR A;  2EKH A;  3ME9 A;  1YN8 A;  1M1K R;  4ESR A;  3RKX A;  2RQT A;  1D0Y A;  2JMC A;  2QAS A;  4QQD A;  1X01 A;  2X4X A;  3VS4 A;  1BYM A;  3GIB A;  4ATO A;  1M9S A;  2JJ9 A;  4BDZ A;  3UA7 A;  4DEY A;  5GAO n;  1R8O B;  3E19 A;  1NBE B;  2E5Q A;  5FRM A;  3ASK A;  4DBF A;  2X3W D;  2QA4 T;  2K9G A;  3OYD A;  2E12 A;  3OQ5 A;  4JDS A;  1XJW B;  2G6F X;  4JPB W;  5GMK e;  2HZY A;  1HK9 A;  1GL5 A;  1ZSZ A;  2KVQ G;  4JS4 A;  3EFO A;  3HHT B;  2JW4 A;  3VS6 A;  2WSC E;  2L3R A;  1VQM Q;  1NEB A;  2X51 A;  5KYX B;  2SRC A;  3QKJ A;  3OS1 A;  3QO3 A;  4PFO A;  1V29 B;  2EGE A;  2ENM A;  4NL2 A;  4M77 B;  1VQL T;  3CC2 T;  1YCY A;  2EIF A;  3CME Q;  4ZTF A;  1KQS P;  1WI7 A;  1UG1 A;  1X75 C;  1EIF A;  5A0G A;  2X3X D;  5FWB A;  2K79 A;  3OMG A;  4RUG A;  4C5E A;  2DIL A;  1M2V B;  4XAX B;  1WZO A;  1QKX A;  3HFN A;  2QEX A;  4MML A;  2JT4 A;  4JRP A;  2QYZ A;  3FIF A;  4JUV A;  1M3C A;  3CBO A;  1N9S A;  2DVJ A;  1C0M A;  4BUG A;  1G8X A;  3VRY A;  2DO3 A;  5I2M A;  3NMZ C;  4AFZ C;  2J6K A;  5GAO l;  5GAN 5;  3DLM A;  2LX9 A;  1M8M A;  2HSE B;  3URG A;  1D3B A;  1W70 A;  1PSE A;  1AOJ A;  4GY5 A;  2F1L A;  3JCM e;  5HK3 A;  3G6E T;  4M77 E;  4NOY A;  3HKS A;  1AWX A;  2OX7 A;  1BIB A;  3PMT A;  1M2O A;  3H9N A;  4M7D A;  5CR2 A;  3M57 A;  3NTI A;  2CSQ A;  2JXB A;  1GFC A;  3E9G A;  4HXJ A;  1D0X A;  2HQX A;  3O5Z A;  4HCZ A;  5GAN 4;  4M7A D;  4IKF A;  2KBT A;  4C0D C;  1RI0 A;  5KYW B;  2NWM A;  3HTR A;  4BI3 A;  2XU8 A;  3E9F A;  4PJL A;  5GAM e;  1VQ4 A;  3VS3 A;  5AYF A;  2FRW A;  1RAD B;  5KYU B;  4EMG A;  4VUB A;  5CIU A;  4MZM A;  1WJQ A;  1YJW Q;  4LUE A;  3NFC A;  1VQN T;  1AZE A;  2RHI A;  5GMK m;  1VQ9 T;  4E6R A;  2RHY A;  1I8F A;  1X2K A;  3OYF A;  2DJQ A;  4C0Z A;  2AZV A;  2X4W A;  4KH1 B;  3ZL7 C;  2WAC A;  4C5G A;  2GFU A;  2RJC A;  2J7I A;  1H92 A;  2BE7 D;  2PQW A;  1SPK A;  3KUF A;  3MPU B;  4KGX B;  4O6J A;  5GAN f;  3M0P A;  3X20 B;  1Q81 C;  3MEA A;  2YUQ A;  1WX6 A;  3FJ5 A;  3M53 A;  2HDA A;  1BB9 A;  4D6W A;  1WQ7 A;  2YWW A;  5FU7 B;  4RG8 A;  2M1H A;  2BKD N;  1KIK A;  4XU1 A;  4XQ3 A;  2PVD B;  2B86 A;  5HCK A;  2IPO B;  2RB6 A;  1R0C B;  2C06 A;  2CZ7 B;  1VQ5 A;  4E7K A;  3EAE A;  4KGZ B;  1UE9 A;  1QLY A;  1GCQ A;  2YHT A;  3P8H A;  1E7O A;  4EMK A;  3QWX X;  4UC4 A;  3EH1 A;  1LVK A;  2LNH B;  4BI8 B;  3CC7 Q;  2AHJ B;  4QW2 A;  3RER A;  2XHC A;  2JM9 A;  1SHF A;  3VU3 C;  1BCO A;  3V8J A;  2M0Y A;  1WNL A;  1LNX A;  4YTL A;  3I5R A;  3I55 T;  3L2R A;  2AT1 B;  4M78 F;  4OGC A;  2ZPH B;  1Y7X A;  3AT1 B;  1VQ8 A;  1CSK A;  1W4S A;  1D1A A;  3OYY A;  1U1T A;  1VYV A;  4Z02 A;  2GF7 A;  1UHF A;  4OB3 B;  3JCM c;  3DLL A;  1G3T A;  1X27 A;  4WF2 A;  4FCY A;  1V76 A;  3CCS Q;  3G4S Q;  1J3T A;  3M55 A;  4KUI A;  4IUQ A;  2DL8 A;  3L1A A;  3TSW A;  2RHZ A;  2RJE A;  1AD5 A;  2W0Z A;  2AIR B;  3V7R A;  4RTY A;  4KUL A;  3CD6 Q;  4BB7 A;  4E7J A;  1YIT A;  1VQK Q;  3EG0 A;  1M1G A;  4AT1 B;  4PLL A;  4F04 B;  1WA7 A;  2J05 A;  1HSQ A;  4MDW A;  1QWE A;  3CCL A;  1UGR B;  2F5T X;  2CT3 A;  2KGT A;  3CCM Q;  3JB9 F;  1RAB B;  1GRI A;  3BY7 A;  3OA6 A;  1VQP Q;  2E10 A;  4ELZ C;  5CO7 A;  2YUP A;  5GAM j;  4RTZ A;  4PFZ A;  1VQO Q;  1GFD A;  2ROT A;  3LYI A;  1RAE B;  2RHU A;  2A08 A;  2V8J A;  2EQI A;  4WTO B;  4PJO F;  2LT1 A;  2K2V A;  2DX1 A;  3LGL A;  3L2W A;  1YWP A;  1TS9 A;  2E6N A;  1I81 A;  1MV0 B;  2E65 A;  2HBP A;  4N0A C;  2EFI A;  4EIK A;  2QA4 A;  1SRM A;  1UGQ B;  2DL7 A;  3CCR T;  2O31 A;  4M75 F;  1KC8 C;  3RKW A;  1KHI A;  2EVR A;  1QCF A;  4QVZ A;  4C8Q B;  1NJI C;  3O8V A;  1YJN Q;  2EJG A;  3WVE B;  1W2B A;  3INZ A;  4PL6 A;  4J7F A;  4HT8 A;  4C92 D;  2O2O A;  3QWY A;  2D1X A;  1FXX A;  2KT8 A;  3LH0 A;  3THK A;  1FYN A;  4ANJ A;  4D8D A;  4M7D C;  1UJY A;  2VGM A;  3M5A A;  2DD4 A;  1BK2 A;  3G71 A;  1VQL A;  3CC2 A;  2KYB A;  1UEC A;  5GAO q;  2DIG A;  2HAX A;  1C1A A;  1Z9Q A;  4M7D G;  2GTJ A;  1W2B S;  3FLG A;  2DXB A;  4FL6 A;  9ATC B;  3OYL A;  1VQ4 T;  4FU6 A;  3GLX A;  4E7L A;  2C0O A;  2X9H A;  2HD0 A;  1OPK A;  4D8K A;  1HJD A;  1XOV A;  1ZBX A;  1WJR A;  2JM8 A;  3RNJ A;  1GCP A;  2ZGW A;  3QUI A;  4J8O A;  2M51 A;  3QJ6 A;  4ZGJ B;  1XNI A;  3PVQ A;  1YHQ T;  3KXT A;  4PJN A;  1MNE A;  1WLP B;  2CDT A;  1MND A;  4II1 A;  2A36 A;  4J5Y A;  2BZX A;  1G83 A;  1WHG A;  2O4X B;  2KMT A;  3CCQ Q;  3SWN B;  3JCM g;  3HRS A;  2XIC A;  4QQG A;  3OSV A;  1CKB A;  3CCU Q;  4O5V A;  4DQ2 A;  1LJO A;  2DD5 A;  1YJ9 Q;  3L42 A;  3E2U A;  1WXT A;  5LJ5 h;  2K4Y A;  4TVR A;  1QCN A;  4C0G A;  1VIF A;  4LE9 A;  2KDS A;  3A5Z B;  3OBY A;  3PT9 A;  2Z0W A;  3CCV Q;  2RI5 A;  3A98 A;  1N8R C;  2YLB A;  3CMA A;  1WJS A;  1SSH A;  2XDB A;  2R5A A;  1QVG A;  1OI1 A;  2PVO B;  1VQ5 T;  1GCQ C;  3QG1 A;  4JZ4 A;  1I4K 1;  2K5I A;  3VS5 A;  2CKK A;  3QZ5 B;  1OX9 A;  1S72 A;  3I35 A;  3Q1J A;  2LZ6 B;  4GBQ A;  1PRM C;  5GAN 7;  2A3L A;  2QDY B;  1X6G A;  4AG1 C;  4M77 F;  4RTT A;  2O01 E;  1VQ9 A;  4RTX A;  4RCB A;  1QVG S;  3GP8 A;  1G3W A;  1Q95 G;  2CZ0 B;  2XDD A;  3NTH A;  1UGP B;  3H0H A;  4AG2 C;  1VQ8 T;  4QVC A;  1N27 A;  2R5M A;  2NYS A;  5KYX A;  1M3A A;  5CKF A;  5LJ5 j;  3I56 Q;  3UDC A;  1M90 R;  3QHS A;  3JCM P;  1YBY A;  4M7A E;  2K3X A;  3S6W A;  4FT2 A;  4XTW A;  2VC8 A;  1FX7 A;  2P0Q A;  2FVU A;  4LDU A;  1OUL A;  2ED0 A;  2COW A;  4QVD A;  3VJP A;  2GTO A;  1AWW A;  3ZEH A;  3JB9 I;  3J81 E;  3BDL A;  3QJY A;  2ZPF B;  4LDW A;  3M56 A;  2RJD A;  4KT0 E;  1F1B B;  2E4H A;  2JS2 A;  2LCC A;  1TUG B;  2DRK A;  4J9E A;  4ZN1 A;  1RLP C;  2E5K A;  2P4R A;  4L5G A;  3QYH B;  2VVK A;  5EC7 A;  1YIT T;  4AFQ C;  2DM1 A;  2K3B A;  1ZA2 B;  2HKN A;  5AT1 B;  1OOT A;  4RKU E;  1JO8 A;  1U8R A;  3ER0 A;  2F2V A;  2FL7 A;  4F14 A;  4JZ3 A;  3M4G A;  3SB2 A;  5KYN A;  1JXO A;  5J26 A;  4M7A C;  3I55 A;  1Y96 B;  2DYI A;  2COY A;  2DPP B;  3CC4 A;  2JTF A;  2QQR A;  1Z9Z A;  2KRM A;  1JJ2 A;  3JCM f;  2GQI A;  4LXC A;  3EGD A;  2Y4Y A;  4M7A G;  2V8K A;  5GAN 3;  2EQK A;  1RL2 A;  3FEO A;  3U23 A;  1ZQ1 A;  1OU8 A;  4M4Z A;  2R58 A;  1TU0 B;  3V7C A;  4EMH A;  2V26 A;  2K2M A;  2LRQ A;  5KYW A;  1YI2 Q;  1YP5 A;  4C0D B;  5GAN g;  3EGX B;  5FRN A;  3OS2 A;  2OTJ Q;  2DA9 A;  1CKA A;  5J3B A;  4CC3 A;  1ABQ A;  3GOX A;  1WXB A;  2OTL Q;  1MMN A;  3JB9 H;  4GLM A;  4RTU A;  5GAM f;  2KRO A;  2LTO A;  4E2F B;  3JCM X;  1JJ2 S;  4F7U E;  2EYY A;  3PIO A;  5EG2 A;  3G71 T;  1OX8 A;  1HYO A;  1Y0M A;  3JCM J;  1ZHI A;  5GAO p;  4FM4 B;  1D09 B;  1SSF A;  1O75 A;  2AKK A;  2QGG A;  1YIJ Q;  4DBQ A;  1VA7 A;  3EFR A;  2ATC B;  1VQ6 Q;  2NUT B;  3MET A;  2M9U A;  5KYY A;  4OB1 B;  2L0A A;  2BZ8 A;  1DJ7 B;  2NUP B;  3OB9 A;  3OYH A;  2ABL A;  5LJ5 d;  2KQW A;  4F16 A;  4E7I A;  1OYX A;  2YDL A;  4M78 D;  2K57 A;  3CCR A;  2LQW A;  3WXM B;  1IXD A;  1VQ7 A;  3G6E Q;  1TG0 A;  1D1B A;  2MOX A;  1XQH A;  4E7H A;  4A4E A;  1W6X A;  1QKW A;  3H41 A;  3LWH A;  4DOW A;  4RTV A;  1RUW A;  2IVW A;  1BI2 A;  5IXF A;  3M4Y A;  2RQW A;  5IHK A;  1NPR A;  3OS5 A;  1QMC A;  1KD1 U;  2DZ9 A;  5LJ3 h;  1JQQ A;  1NLP C;  1QVF P;  3NTK A;  4F7U G;  2JMA A;  3CMA T;  3QSU A;  2RO0 A;  4KH0 B;  5IN1 A;  2DVE A;  2EAY A;  1NLO C;  2O9V A;  4A4F A;  4F17 A;  1PD0 A;  2XK0 A;  4FSS A;  1H3Z A;  3UPU A;  4CI0 C;  1KSW A;  1QP2 A;  3A8H B;  3RDV A;  2PTK A;  2LC4 A;  3JB9 D;  1VQN Q;  1GXI E;  1K9A A;  2RN8 A;  1S72 T;  2FPD A;  2C0I A;  2L5Q A;  3GNG A;  4A4G A;  1K9M U;  1UEB A;  2GBQ A;  3OYK A;  3X26 B;  3QXE B;  4J7I A;  4C92 E;  1YHQ A;  1BCM A;  3M58 A;  2CRE A;  3S3M A;  2LJ3 A;  1ARK A;  2RPN A;  3EFO B;  4HKE A;  1G3Y A;  5KE2 A;  4IUV A;  1SRL A;  3HRT A;  2H8H A;  2PU9 B;  2JVV A;  1QVF A;  1KHC A;  2HQE A;  2AKL A;  3I5S A;  4JJD A;  5L8R E;  2H3J A;  1A0N B;  1B7T A;  4M75 D;  5IH2 A;  1WHK A;  2DZC A;  1OV3 A;  4PNO A;  1MV3 A;  1YJW T;  1BI0 A;  2HSP A;  4E7S A;  3RMS A;  3V8L A;  1H64 1;  2CYZ B;  2DER A;  1XTD A;  3EG9 A;  1I5L A;  4C8Q F;  5D7U A;  2CUB A;  4ZNX A;  3KBG A;  5GJV B;  4FW1 A;  2RQR A;  2CH4 A;  1QVF S;  2QAZ A;  1Q82 R;  4C92 C;  3QDF A;  2DXC A;  3OYM A;  2KRN A;  3CCE A;  5A2Q E;  4BDY A;  3A1P A;  1V1C A;  3V8K A;  3M54 A;  3JCM Q;  1EFN A;  2VUB A;  3MO8 A;  2BIV A;  4V2S A;  4C8Q A;  4NS5 A;  3HSB A;  4IIM A;  2VXF A;  4C92 G;  1SF9 A;  4J9D A;  3CCJ A;  5LJ5 f;  1Q82 U;  2DE0 X;  2ZPB B;  1D3B B;  2F2W A;  2RI2 A;  2NUZ A;  1H3H A;  2CS7 A;  2FPF A;  3MEW A;  2G3R A;  2EYX A;  2A0F B;  1Y71 A;  4M7D B;  3CC4 T;  4ZTJ A;  4CRI A;  2OAW A;  1D0Z A;  1E6G A;  2EQJ A;  2L3S A;  2LMJ A;  3UA6 A;  2YLC A;  4M78 A;  2FZC B;  1WDX A;  3OYG A;  1W1F A;  1IGU A;  1ZSZ C;  4AFS C;  5DY9 A;  1IGQ A;  3TSZ A;  3CXC A;  4A4H A;  3RR6 A;  2FYK A;  4OMM A;  3ULR B;  1K8A R;  3HFO A;  1ZUU A;  2RH2 A;  3RIR A;  1M5Q 1;  2DKG A;  3UF4 A;  1Q7Y R;  2MF2 A;  5FLX E;  3SDZ A;  3BDU A;  5IAY A;  4B9X A;  1W2B P;  5IXB A;  2D0Q B;  5CKB A;  3G4S T;  4J9B A;  1VUB A;  2IG0 A;  2MWP A;  1BKB A;  1K8A U;  2F2X A;  4BD3 A;  1IHW A;  3JCM b;  4J6Y A;  2QEX Q;  4M7D E;  4XU3 A;  5FW9 A;  3E1S A;  2DL4 A;  1Q7Y U;  2WSF E;  4Y92 A;  4XTZ A;  1I07 A;  2E1H A;  3CXC S;  3CD6 T;  1TWB A;  3JRZ A;  2XMF A;  2RM4 A;  2Y4X A;  5GAO m;  2LQK A;  1YCS B;  2B8A A;  1YFN A;  3VUZ A;  3OBW A;  2YSQ A;  1ZBJ A;  3JCM W;  5KCO A;  5LJ5 e;  3R6O A;  5LJ3 d;  3L2Q A;  4FIB A;  3CCM T;  2MK5 A;  4NL3 A;  2I2L A;  3RBB B;  1VQP T;  2DEQ A;  3H6Z A;  1VQ7 T;  2DFU A;  2NLU A;  1VQO T;  4ZGD B;  4PJO A;  4FW2 A;  1VYU A;  4DA4 A;  3QBY A;  1M4Z A;  1AHJ B;  4L6V 5;  4JRI A;  4ZN3 A;  5DLQ E;  1PKT A;  1ZUY A;  4BE0 A;  2FHD A;  1N5Z A;  4PK4 A;  2PUO B;  2CSI A;  2J6O A;  1I5O B;  5IHN A;  4M75 A;  3QYG B;  2QTX A;  2ZCF B;  1EX4 A;  1OZ3 A;  4HA8 A;  4BE2 A;  1SKU B;  3J7A F;  2ZPG B;  2EJ9 A;  2M02 A;  3VRZ A;  3MP1 A;  2LQN A;  1VQ4 Q;  4J9F A;  1WYX A;  1WQW A;  4EPC A;  3MKD A;  4HT9 A;  4FYV B;  3JB9 J;  4CC2 A;  2PVG B;  1QVG P;  4JJN K;  3LLR A;  5GAN h;  5HKC A;  3PMI A;  3MEU A;  1QP3 A;  4HCB A;  1Y07 A;  2HMA A;  2V1R A;  4A63 B;  3M0U A;  8AT1 B;  2GQV A;  2ECZ A;  3CME A;  3H0F A;  2DTI A;  2M0O A;  2D9T A;  2KXD A;  1NE8 A;  4Y28 E;  2HL3 A;  1MHN A;  3M0R A;  2F69 A;  1QW1 A;  3CEY A;  4CC4 B;  3DB4 A;  1K73 R;  2XID A;  3AHU A;  4X9D A;  2D0N A;  1ACM B;  1T0H A;  2GFA A;  4CC7 A;  2KRS A;  1UDL A;  5HK0 A;  5CAI A;  2O88 A;  3HP9 A;  3SD4 A;  2LJ0 A;  1NYF A;  3WVD B;  2LP5 A;  2K3Y A;  1NG2 A;  1K73 U;  3OYA A;  2LCS A;  1VQ5 Q;  4P5N A;  4J9H A;  3OYN A;  4M7A B;  3F70 A;  1AT1 B;  1WHL A;  3GBQ A;  5I22 A;  4JRQ A;  3BFM A;  5GAM g;  3G1J A;  3EFS A;  2HKQ B;  2JOY A;  1BI3 A;  1YJ9 T;  4EMK C;  4Z8A A;  5C6S A;  3GPL A;  3CCE T;  5LL6 S;  2O9S A;  2EPD A;  2MIO A;  2HQH A;  2D8H A;  4J9I A;  2XKO C;  1O9S A;  2MYS A;  2ROL A;  5D6Y A;  1K0S A;  1TOV A;  3CCJ T;  3A8L B;  1D1C A;  3A8O B;  1VQ8 Q;  1M90 C;  3H0I A;  2HBW A;  5A0L A;  4Z89 A;  3RUX A;  1B07 A;  5A0D A;  4N4I A;  1RAH B;  2CZ6 B;  4J9C A;  3R6N A;  5CQX A;  2EYQ A;  4FYW B;  3VS0 A;  4JS5 A;  1VIE A;  4M77 A;  4KGV B;  4OP0 A;  2LQ8 A;  1YJW A;  2A37 A;  1M3B A;  2COZ A;  2PUK B;  1H8K A;  1OQK A;  4DBH A;  4M78 C;  1U5S A;  1AVZ C;  2RK1 A;  5ECA A;  2PNI A;  2VGN A;  1M2V A;  4J83 A;  2OAU A;  1KQ1 A;  1Q86 U;  1JJ2 P;  1YIT Q;  4JLI A;  4MZP A;  5D6W A;  2DL5 A;  3MP8 A;  1KJW A;  4LDX A;  1PRL C;  3A8M B;  1RAF B;  2LX7 A;  3CCL Q;  4IIO A;  3I56 T;  2K5L A;  2ED1 A;  4DBR A;  2GNC A;  4M78 G;  2X35 A;  3OW2 P;  1BIA A;  2KK4 A;  3LGF A;  3H8Z A;  3VV0 A;  4XTV A;  1RLQ C;  2FPE A;  3EG2 A;  3REB B;  1ZLM A;  2XI9 A;  2WSE E;  4C5H A;  2DEU A;  4OMN A;  3RKY A;  2K6D A;  4M75 E;  5CKH A;  2XDP A;  4F7U B;  2KR3 A;  3P8B B;  3OY9 A;  3S3N A;  2DRM A;  1B3Q A;  2DXT A;  2RHX A;  4KRT A;  4QKU A;  2M16 A;  2DJZ A;  4BY6 C;  1PD1 A;  4IUR A;  4XTY A;  2QA4 Q;  3TU4 K;  3CC7 A;  1ZSG A;  5I2S A;  1QCO A;  2QDL A;  4HCC A;  1WHH A;  1MMA A;  1IHV A;  4RTW A;  3MCA B;  5C0M A;  5IT9 E;  5LJ3 e;  3VKI A;  1RAA B;  1BU1 A;  2X4Y A;  4RCC A;  1B34 B;  4LD9 K;  1FMV A;  2QXF A;  4PJO C;  3D7S B;  5DM7 R;  1JU5 C;  3OW2 A;  1TXQ A;  1KG1 A;  1WGS A;  3JB9 G;  1JXM A;  3TRE A;  1YWO A;  3VUB A;  4OB2 B;  1RAG B;  2X4J A;  1WHJ A;  4N4H A;  5KYU A;  1KQ2 A;  3G71 Q;  3SFM A;  4PJM A;  1M1K U;  1VQL Q;  4AFU C;  3CC2 Q;  4M75 C;  1TH7 A;  2CP6 A;  2ZPE B;  4LUD A;  4PJO G;  2VYT A;  3CCS A;  1G3S A;  2Y90 A;  5GAN d;  4C8Q D;  4Z88 A;  3L2V A;  3G4S A;  2F5K A;  2VAS A;  3CBP A;  2DK3 A;  2H3E B;  1YI2 T;  2EKO A;  4LDV A;  5IHI A;  3LWI A;  3C12 A;  1R77 A;  3N5B B;  1MMD A;  4JJC A;  2CP0 A;  5DLO A;  2V1Q A;  3OW2 S;  2CUD A;  2OTJ T;  1TUD A;  4M75 G;  1LOJ A;  3PFS A;  3CD6 A;  1LPL A;  3TVT A;  4QT7 A;  2CGH A;  2JUF A;  2QQB A;  1M1F A;  3OYC A;  2KEA A;  4X34 A;  1VQM T;  1VQK A;  2OTL T;  2DTH A;  1NYG A; 
#chains in the Genus database with same CATH homology
 4R55 A;  1W2B A;  2JTM A;  1QVF S;  3MHX A;  4C92 C;  2KY9 A;  3INZ A;  4PL6 A;  2DXC A;  2QQ9 A;  3OYM A;  4J7F A;  5LJ5 g;  3CCE A;  4HT8 A;  5A2Q E;  4C92 D;  4BDY A;  4LDY A;  1KD1 C;  1FXX A;  3V8K A;  3CCM A;  3LH0 A;  2YRV A;  2K5F A;  4OGE A;  3M54 A;  3JCM Q;  4M7D C;  3CME T;  2VUB A;  3FC3 A;  3MO8 A;  2BIV A;  3L2Z A;  1VQP A;  2VGM A;  5GMK l;  2P0K A;  2QI2 A;  4NS5 A;  4LD6 A;  3TEE A;  4C8Q A;  4M7D D;  4V2S A;  1VQO A;  3M5A A;  2DD4 A;  3HSB A;  3G71 A;  2RK2 A;  2VXF A;  3JSC A;  4C92 G;  3CCJ A;  1Q82 U;  4N4G A;  5LJ5 f;  1VQL A;  3CC2 A;  4C92 F;  2L89 A;  4MDX A;  2ZPB B;  1D3B B;  4KBM B;  4BE1 A;  1YIJ T;  4C92 B;  4OVA A;  5GAO q;  1VQ6 T;  2QQA A;  2DIG A;  2EQM A;  2RI2 A;  4XU2 A;  4E47 A;  2HAX A;  2RA2 A;  2CS7 A;  3ZFJ A;  4Y91 A;  3MEW A;  4PJO E;  2P0P A;  4RG2 A;  4N0A A;  5FU6 C;  4M7D G;  1M90 U;  2G3R A;  1W2B S;  4M7D F;  1G5V A;  1FWZ A;  3GNF B;  4ME7 A;  3FLG A;  2DXB A;  1Y71 A;  4FL6 A;  4M7D B;  3QZ9 B;  3CC4 T;  2LT4 A;  5FRO A;  1PSF A;  4IUP A;  5M9O A;  4B9W A;  4ZGE B;  3OYL A;  2LDM A;  1VQ4 T;  2E41 A;  2FB7 A;  3GLX A;  4FU6 A;  4E7L A;  1K9M C;  3SWN C;  2XD0 A;  2L8D A;  4CRI A;  4ZTJ A;  3JCM V;  3FB9 A;  1X6O A;  2E6Z A;  2HD0 A;  3HL8 A;  4C92 A;  3L2U A;  2BUD A;  3LW5 E;  1XOV A;  1BI1 A;  1ZBX A;  1WJR A;  4Q5W A;  2EQJ A;  1YJN A;  2YLC A;  4M78 A;  5CVI A;  2ZGW A;  3QUI A;  4J8O A;  4XTX A;  1KQS A;  3CCL T;  3QJ6 A;  4ZGJ B;  1XNI A;  3OYG A;  5HY6 A;  5FU6 B;  1YHQ T;  5J39 A;  3OS0 A;  3KXT A;  5DY9 A;  4PKC C;  4II1 A;  3CXC A;  3G7Z A;  4A4H A;  1M1K C;  4J5Y A;  2LNV A;  2FYK A;  3X24 B;  1NZ9 A;  4FSX A;  2O4X B;  2KMT A;  3HFO A;  2RH2 A;  3RIR A;  1M5Q 1;  3SWN B;  5CQY A;  3JCM g;  2P4T A;  3HRS A;  2XIC A;  5GMK h;  4QQG A;  3OSV A;  3ME9 A;  4O5V A;  2DKG A;  2MF2 A;  3RKX A;  4DQ2 A;  5FLX E;  1LJO A;  2DD5 A;  3SDZ A;  3BDU A;  5IAY A;  3L42 A;  4B9X A;  4QQD A;  1X01 A;  2X4X A;  2D0Q B;  5CKB A;  5LJ5 h;  1BYM A;  2K4Y A;  3X25 B;  3G4S T;  1VUB A;  3GIB A;  4ATO A;  2IG0 A;  1M9S A;  3C94 A;  4TVR A;  4C0G A;  3PIP A;  1VIF A;  1M8V A;  4BDZ A;  2KDS A;  2MWP A;  3A5Z B;  3OBY A;  4JLG A;  1BKB A;  4PJO D;  3PT9 A;  4OB0 B;  3CPW A;  5GAO n;  1K8A U;  2RI5 A;  1R8O B;  3E19 A;  4BD3 A;  1N8R C;  3JCM b;  2YLB A;  4J6Y A;  2E5Q A;  3CMA A;  1KQS S;  1WJS A;  5FRM A;  4M7D E;  4XU3 A;  3ASK A;  3E1S A;  2XDB A;  2R5A A;  1Q7Y U;  2QA4 T;  2WSF E;  4XTZ A;  1QVG A;  2E1H A;  1OI1 A;  3OYD A;  3CXC S;  2E12 A;  3CD6 T;  2JN0 A;  2PVO B;  3OQ5 A;  4JDS A;  1VQ5 T;  4M77 C;  5LJ3 j;  3JRZ A;  3QG1 A;  2RM4 A;  2Y4X A;  5GMK e;  5GAO m;  1HK9 A;  2LQK A;  2KVQ G;  1I4K 1;  2B8A A;  2K5I A;  3QII A;  3VUZ A;  2CKK A;  3OBW A;  4JS4 A;  2ZPI B;  3QZ5 B;  3HHT B;  3CBM A;  3JCM W;  5KCO A;  2WSC E;  2EJF A;  5LJ5 e;  1S72 A;  2L3R A;  4IUU A;  3R6O A;  3Q1J A;  5LJ3 d;  3L2Q A;  2RD1 A;  4FIB A;  3CCM T;  5KE3 A;  4NL3 A;  1Q82 C;  2I2L A;  2HNI A;  2E70 A;  5GAN 7;  2A3L A;  2QDY B;  2DEQ A;  3QKJ A;  4M77 G;  5GMK i;  3H6Z A;  3CPW S;  1VQP T;  1VQ7 T;  3OS1 A;  2NLU A;  3QO3 A;  4M77 F;  3CCQ A;  1VQO T;  1V29 B;  4NL2 A;  4ZGD B;  4XK8 E;  4M77 B;  1VQL T;  4PJO A;  2O01 E;  1VQ9 A;  3CCU A;  3CC2 T;  1YCY A;  2EIF A;  4DA4 A;  4RCB A;  3MP6 A;  3QBY A;  4R56 A;  1M4Z A;  1AHJ B;  4MZT A;  3OYI A;  4ZTF A;  1YJ9 A;  4L6V 5;  4BI4 A;  1X75 C;  1QVG S;  1EIF A;  4JRI A;  5GMK j;  3GP8 A;  1G3W A;  4ZN3 A;  5A0G A;  2CZ0 B;  5DLQ E;  2XDD A;  3NTH A;  1UGP B;  4BE0 A;  3OMG A;  2FHD A;  4C5E A;  1VQ8 T;  4QVC A;  1N27 A;  4XAX B;  2R5M A;  4RMO A;  5LJ5 j;  5CKF A;  2PUO B;  3UDC A;  3CCV A;  3HFN A;  3QHS A;  4M75 A;  2QEX A;  4MML A;  3JCM h;  1YBY A;  3JCM P;  3QYG B;  2QTX A;  1JBM A;  4JRP A;  4M7A E;  2ZCF B;  3FIF A;  2K3X A;  3S6W A;  4FT2 A;  1OZ3 A;  4XTW A;  1Q81 U;  4JUV A;  2VC8 A;  1FX7 A;  4GLK A;  4HA8 A;  2P0Q A;  3VYH B;  4BE2 A;  2FVU A;  3CBO A;  4LDU A;  1N9S A;  3J7A F;  4QVD A;  2ZPG B;  3VJP A;  2EJ9 A;  4OF1 A;  3MP1 A;  4BUG A;  1JB0 E;  5D6X A;  3ZEH A;  3JB9 I;  3J81 E;  3BDL A;  3DKM A;  2ZPF B;  3C4S A;  3QJY A;  4J6W A;  4LDW A;  2DO3 A;  5CK9 A;  3M56 A;  5I2M A;  2RJD A;  3JAM E;  1WQW A;  4EPC A;  4KT0 E;  2LCC A;  5GAO l;  5GAN 5;  3DLM A;  4HT9 A;  2LX9 A;  3JB9 J;  4ZN1 A;  3CC7 T;  4JRK A;  4OMF B;  4ELY C;  4L5G A;  3QYH B;  2PVG B;  3URG A;  4JJN K;  3LLR A;  1D3B A;  2EWN A;  1YIT T;  3RMQ A;  5GAN h;  1PSE A;  2DXU A;  4GY5 A;  5HKC A;  3PMI A;  3JCM e;  3MEU A;  5GAM h;  1QP3 A;  5HK3 A;  1Y07 A;  4HCB A;  4FT4 A;  4M77 E;  4NOY A;  3G6E T;  3HKS A;  2VXE A;  3VYG A;  3QPH A;  1K8A C;  1BIB A;  2GQV A;  3PMT A;  4MMK A;  3CME A;  4RKU E;  4A4K A;  2DTI A;  4M7D A;  1U8R A;  2M0O A;  2D9T A;  5CR2 A;  3M57 A;  1NE8 A;  3PNW C;  2CZ1 B;  3ER0 A;  3NTI A;  4Y28 E;  1Q7Y C;  2FL7 A;  1MHN A;  2F69 A;  3V7S A;  1QW1 A;  3CEY A;  3M4G A;  3E9G A;  3SB2 A;  3DB4 A;  2HQX A;  2XID A;  3I56 A;  4HCZ A;  3AHU A;  5J26 A;  4A54 A;  4M7A C;  4KUD K;  5CCA A;  5GAN 4;  3I55 A;  4X9D A;  1Y96 B;  2DIQ A;  3BW1 A;  4M7A D;  4IKF A;  3HPW A;  2D6F A;  4C0D C;  2DAQ A;  1RI0 A;  2GFA A;  5HK0 A;  5CAI A;  3CCS T;  2R57 A;  3HP9 A;  3SD4 A;  3WVD B;  4IUT A;  3X28 B;  5GAN e;  2ZZD A;  2DPP B;  2MI6 A;  2JTF A;  2XU8 A;  3E9F A;  2QQR A;  4BI3 A;  5GAM e;  3CC4 A;  3RES A;  2K3Y A;  5GAO r;  1MGQ A;  1VQ4 A;  1K73 U;  1JJ2 A;  3JCM f;  3OYA A;  2KAF A;  2O4X A;  5AYF A;  2Y4Y A;  4M7A G;  2V8K A;  5GAN 3;  1QVP A;  2EQK A;  1RL2 A;  3QDR B;  3FEO A;  4P5N A;  3SWN A;  1ZQ1 A;  4C0F A;  4M7A F;  4EMG A;  3OYN A;  2R58 A;  4VUB A;  5CIU A;  3V7C A;  4M7A B;  3UWN A;  3F70 A;  1WPY A;  4MZM A;  1WJQ A;  4EMH A;  3NFC A;  2LRQ A;  4JRQ A;  1VQN T;  1IRE B;  4C0D B;  5GAN g;  5FRN A;  1UB4 A;  3BFM A;  5GAM g;  1VQK T;  2RHI A;  5FU7 C;  3EFS A;  5GMK m;  1VQ9 T;  2RHY A;  1I8F A;  4M77 D;  3OS2 A;  3OYF A;  4C0Z A;  2JOY A;  1BI3 A;  5GAN 8;  2X4W A;  1YJ9 T;  5J3B A;  2WAC A;  4EMK C;  4C5G A;  5C6S A;  3GPL A;  2GFU A;  3CCE T;  2RJC A;  5LL6 S;  3GOX A;  2MMP A;  4A53 A;  3FDR A;  5LJ3 g;  4M7A A;  2PQW A;  3JB9 H;  3KUF A;  4O6J A;  5GAN f;  3X20 B;  1Q81 C;  2XKO C;  4J6X A;  1O9S A;  3MEA A;  5GAM f;  2LTO A;  3DB3 A;  3JCM X;  2QEX T;  1JJ2 S;  3M53 A;  5D6Y A;  4F7U E;  3PIO A;  5EG2 A;  3G71 T;  3LX7 A;  3CCJ T;  4D6W A;  3A8L B;  3JCM J;  3A8O B;  3HRU A;  3J80 E;  1WQ7 A;  3TCJ A;  5FU7 B;  1ZHI A;  4RG8 A;  2E64 A;  2M1H A;  1M90 C;  2BKD N;  5GAO p;  2DTO A;  5A0L A;  4XU1 A;  4FM4 B;  4PLI A;  4EMK B;  3RUX A;  4XQ3 A;  2PVD B;  2RB6 A;  1SSF A;  3C95 A;  1O75 A;  5A0D A;  2C06 A;  1N6A A;  4N4I A;  2CZ6 B;  2CZ7 B;  5GAN 6;  3EFR A;  5CQX A;  1VQ5 A;  2EYQ A;  4E7K A;  3EAE A;  4JS5 A;  1VIE A;  4M77 A;  1NPP A;  3MET A;  2M9U A;  4OP0 A;  2LQ8 A;  4OB1 B;  1YJW A;  2YHT A;  1DJ7 B;  3P8H A;  1YI2 A;  3OB9 A;  2PUK B;  3OYH A;  5LJ5 d;  3UT1 A;  2V8I A;  4EDU A;  4EMK A;  4M78 C;  4UC4 A;  2KQW A;  4E7I A;  2RK1 A;  1OYX A;  2LCL A;  2MAM A;  3OMC A;  4BI8 B;  4C5I A;  1YJN T;  3T9N A;  2AHJ B;  4M78 D;  4QW2 A;  3ZBD A;  2K57 A;  5KH6 A;  2VGN A;  1OZ2 A;  2OTJ A;  3RER A;  4J83 A;  3CCR A;  2OAU A;  1KQ1 A;  1Q86 U;  5GAN 2;  2XHC A;  4JLI A;  4MZP A;  3WXM B;  5D6W A;  3VU3 C;  5CKD A;  1VQ7 A;  3MP8 A;  4LDX A;  3CPF A;  4DOV A;  1HXD A;  3V8J A;  1VQM A;  2OTL A;  3A8M B;  1WNL A;  1KC8 U;  4E7H A;  1XQH A;  3I56 T;  2K5L A;  1LNX A;  4A4E A;  3FJP A;  4YTL A;  4M78 G;  2X35 A;  3I55 T;  3L2R A;  1NJI U;  4M78 F;  3LWH A;  1P92 A;  3P8D A;  1BIA A;  3FRN A;  4DOW A;  4OGC A;  2KK4 A;  2ZPH B;  4M78 B;  1Y7X A;  3LGF A;  1VQ8 A;  1JRI A;  2IVW A;  1BI2 A;  3M4Y A;  1K73 C;  3H8Z A;  4XU0 A;  4XTV A;  3VV0 A;  1W4S A;  1NPR A;  3OS5 A;  3OYY A;  1UGS B;  2RJF A;  1U1T A;  1KD1 U;  2DZ9 A;  4QQ6 A;  4Z02 A;  5LJ3 h;  2GCX A;  2GF7 A;  4OB3 B;  3JCM c;  3DLL A;  3NTK A;  1G3T A;  4WF2 A;  2XI9 A;  4F7U G;  2WSE E;  1IZ6 A;  4C5H A;  3CMA T;  3QSU A;  4F7U F;  3RKY A;  2RO0 A;  1YIJ A;  4M75 E;  5CKH A;  2XDP A;  5IN1 A;  4C8Q E;  2DVE A;  3M55 A;  3P8B B;  4F7U B;  1VQ6 A;  2EAY A;  4KUI A;  5CKE A;  4IUQ A;  3PGG A;  1N9R A;  3L1A A;  4A4F A;  3OY9 A;  2RHZ A;  2XK0 A;  3S3N A;  3OSS C;  2RJE A;  2RI3 A;  1H3Z A;  3UPU A;  2DXT A;  2RHX A;  2M16 A;  4CI0 C;  3GF5 A;  2DJZ A;  1QP2 A;  3A8H B;  4BY6 C;  3V7R A;  4IUR A;  4XTY A;  3TU4 K;  2EQU A;  4KUL A;  3CC7 A;  4BB7 A;  4E7J A;  5I2S A;  2LC4 A;  5KCH A;  3JB9 D;  3S3O A;  4HCC A;  1GXI E;  1S72 T;  1YIT A;  4F7U A;  3JCM d;  1Y96 A;  3MCA B;  5C0M A;  5IT9 E;  1M1G A;  5LJ3 e;  3VKI A;  2L5Q A;  3G6E A;  3GNG A;  4A4G A;  4PLL A;  1K9M U;  1UEB A;  2X4Y A;  4RCC A;  4MDW A;  3OYK A;  3X26 B;  3CCL A;  2VV5 A;  1B34 B;  3QXE B;  4J7I A;  4C92 E;  1YHQ A;  4LD9 K;  1UGR B;  2QXF A;  3M58 A;  4X9C A;  5DM7 R;  3CCQ T;  3OW2 A;  4PJO C;  1KG1 A;  3S3M A;  1WGS A;  2F5T X;  2XG8 D;  3JB9 G;  3TRE A;  3CCU T;  3JB9 F;  4M78 E;  3BY7 A;  3VUB A;  4BY6 B;  3OA6 A;  4L59 A;  4OB2 B;  4HKE A;  2X4J A;  1G3Y A;  2MWO A;  2KSS A;  5KE2 A;  4IUV A;  5GAN j;  3OYE A;  2E10 A;  4ELZ C;  4N4H A;  5CO7 A;  5GAM j;  3HRT A;  4XTU A;  2PU9 B;  1KQ2 A;  3M9Q A;  2JVV A;  3SFM A;  3CCS A;  1KHC A;  1M1K U;  4BAC A;  1QVF A;  2HQE A;  3LYI A;  1TH7 A;  4M75 C;  2JNG A;  4C8Q C;  3CCV T;  2ZPE B;  2RHU A;  5L8R E;  1B34 A;  2H3J A;  4PJO G;  2VYT A;  2V8J A;  1G3S A;  4M75 D;  1U1S A;  2Y90 A;  5GAN d;  4C8Q D;  4PJO F;  3L2V A;  3G4S A;  2DZC A;  3M59 A;  2F5K A;  2LT1 A;  5GAM d;  2K2V A;  3CBP A;  4PNO A;  2LVM A;  4PJO B;  3OYJ A;  3L2W A;  3LGL A;  3MEV A;  1YJW T;  1BI0 A;  2DK3 A;  5I21 A;  1YI2 T;  2EKO A;  4LDV A;  3LWI A;  3RMS A;  2E6N A;  1I81 A;  3C12 A;  3N5B B;  2E65 A;  5LJ3 f;  1Q86 C;  2HBP A;  3V8L A;  1H64 1;  4N0A C;  3A8G B;  5DLO A;  2CYZ B;  3OW2 S;  2EFI A;  2OTJ T;  2QA4 A;  4M75 G;  1UGQ B;  4C8Q G;  1LOJ A;  3CCR T;  1XTD A;  1N8R U;  3PFS A;  4M75 F;  1KC8 C;  2JZ2 A;  4C8Q F;  1I5L A;  2OTL T;  3CD6 A;  3RKW A;  1VQN A;  1KHI A;  2CGH A;  2QQS A;  4M75 B;  2JUF A;  3OYB A;  4QVZ A;  4C8Q B;  2QQB A;  2A7Y A;  3KBG A;  3PTA A;  1M1F A;  3OYC A;  4X34 A;  1VQM T;  1NJI C;  3O8V A;  1VQK A;  2DTH A;  2EJG A;  3WVE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...