4EMGA

Crystal structure of splsm3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
71
Chain Sequence
EPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTTIRKHYEMLFVRGDSVILIAPPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm3
total genus 16
structure length 71
sequence length 85
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emgA00
3JCMh 3JB9J 2FB7A 4MMKA 5GAN4 2YHTA 3QSUA 3V8KA 5GAOr 1D3BB 1BIBA 1M5Q1 2DXTA 1KQ2A 3L1AA 4F7UF 3JCMP 2DTHA 5LJ3d 5LJ5f 4M7DD 4C92E 4M75A 5GAMg 2QTXA 4JRKA 4M7AG 4F7UG 2YLCA 3HFOA 1WNLA 4C92D 4M7AC 1B34A 3QHSA 4XU2A 2RM4A 3JCMc 1I81A 3FJPA 4M78C 4X9CA 4C8QG 4PJOG 2Y90A 2DTIA 4PJOD 3L2ZA 4M78D 4X9DA 4C8QF 2VC8A 4HT9A 4V2SA 3SWNB 2DJZA 5LJ5g 3BFMA 4M75C 3JCMe 4F7UB 4M7DG 4C8QA 2E65A 5GANe 2I2LA 2DEQA 1LJOA 2DZCA 4JRIA 1KQ1A 5GANg 4M7DF 3RIRA 3JB9F 2EJ9A 2EWNA 1N9SA 3AHUA 2E64A 1JBMA 3EFSA 3PGGA 1U1TA 4J5YA 3JCMQ 4PNOA 4M78G 4M75E 4C8QC 4NL2A 4C92F 4A53A 3JCMg 5LJ5h 1M8VA 1LNXA 4M75G 4M78E 4NL3A 1B34B 5GANf 5DY9A 4M77B 1YCYA 4C92B 3JCMb 5GAMh 2DXUA 5LJ5j 1BIAA 2YLBA 1I5LA 1I4K1 1TH7A 4Y91A 3JCMV 4C92A 5GMKh 4HT8A 4PJOC 1Y96B 2E1HA 3RUXA 4M7DA 3V8JA 5GAMf 1I8FA 4EMHA 4M7DE 1Y96A 4M77D 4XU3A 5GAN7 4M7DB 4JUVA 2VXFA 4MMLA 5GAOq 4C8QB 4J6YA 2E41A 1HK9A 4XTYA 2DKGA 5LJ3g 3JB9D 3V7CA 4M78F 4C8QD 5LJ3f 1JRIA 4NOYA 5LJ5e 4PJOE 4C92C 4M78B 4OP0A 4C8QE 3GIBA 1U1SA 5GMKj 5GMKi 3RKYA 1X01A 2HNIA 4XU1A 2DZ9A 5GAMe 5GAOl 3V7RA 4QVDA 3SB2A 2ZGWA 4F7UE 5GAMj 4M7AE 5GMKe 4C92G 4XTZA 4JLIA 1MGQA 3BDUA 4N0AC 4XTUA 5CAIA 5GAOm 4XTWA 4M7AD 3V7SA 1LOJA 3JCMJ 4PJOF 5GANh 2VXEA 3VU3C 4EMGA 4J6WA 4M77E 3RESA 4XQ3A 5GMKl 4HA8A 3V8LA 4M78A 3JCMf 4A54A 3EFRA 4M77F 5LJ5d 5GAN5 2EAYA 5GAN2 4RCCA 3SWNC 3JB9G 3RKWA 4WF2A 3JCMW 5GAMd 3RKXA 4N0AA 5LJ3j 1D3BA 2RD1A 3QUIA 3JB9I 1WPYA 5GANd 4M7AF 2E10A 2K57A 4M77A 3M4GA 4J6XA 4EMKB 2CGHA 5GAN6 5I21A 4M75B 4PJOA 3SWNA 4DQ2A 4M7DC 3FB9A 1WQ7A 4EMKA 3HSBA 2FYKA 3INZA 2EJFA 1HXDA 4F7UA 2EJGA 4QVCA 5LJ3e 3JCMd 2DVEA 3FIFA 3BW1A 4M75F 1WQWA 4RCBA 3HFNA 3JB9H 5GAOp 2RA2A 4M75D 4M7AB 1N9RA 5LJ3h 4M77C 4XU0A 5GAN8 5GANj 1H641 2DTOA 4XTVA 3JCMX 3RERA 3BY7A 3QO3A 5GMKm 4M7AA 5GAN3 2RB6A 4EMKC 2JN0A 5GAOn 4PJOB 4XTXA 4M77G
chains in the Genus database with same CATH superfamily
1UB4A 2NUZA 2DXTA 1QKWA 3L1AA 2RI2A 4CI0C 3A8HB 3QJ6A 2EYQA 2QTXA 2DPPB 5IN1A 2XG8D 1O9SA 3PT9A 2DRKA 1SRMA 2HEQA 2RJFA 2FPDA 5DLOA 3RBBB 1ZX6A 1H3HA 4WTOB 3CXCS 1IRXA 2NUPA 2CZ6B 4MZPA 2CREA 4JRIA 4M7DF 3QZ9B 3CMEA 4DOWA 2LJ3A 2CKKA 2OI3A 2EGEA 2A0FB 4M78G 3GBQA 4C8QC 4NL2A 1VQNT 3G71A 4E7HA 1RACB 4QQGA 3L2QA 1YITA 2YUNA 3CCVT 4LD6A 1YI2T 4RTWA 4DBHA 1AOJA 1VQ5T 4L59A 1TTHB 2LX7A 5L8RE 5LJ3g 1D1BA 4DBQA 3UA6A 4JZ3A 2VB6A 1M1KC 4IUUA 2OTLA 2RHZA 2YT6A 2KT1A 1RLPC 4N4IA 4FT2A 1VIFA 4PKCC 1RAHB 5C6SA 5KCHA 2EBPA 1RUWA 1NEBA 2JVVA 3RKXA 3OYAA 2LT1A 4J6XA 2DLPA 5CQYA 5DLQE 1BI2A 3OYBA 1PC0A 1KQSS 2FEIA 4BDZA 4QVCA 5LJ3e 5CO7A 3G71T 1V29B 2JMCA 2ABLA 2LQWA 2P0PA 3PMTA 4E2FB 3UF4A 4M75D 4UC4A 5CK9A 4M7AB 5LJ3h 5KYUA 4ATOA 4FSXA 1G3WA 2FZGB 3GLXA 2PVOB 3FJ5A 2MCNA 4E7LA 3LGLA 4M77G 4C0GA 3VS4A 4YTLA 2OTJQ 3BE3A 3QSUA 4BUGA 3JCMP 2CP5A 3CCSA 5GAMg 3OYMA 5FROA 4EDUA 2JW4A 3JCMc 1TU0B 3OS2A 2EYWA 4PL6A 4II1A 1YJNQ 3FDRA 1TS9A 4GBQA 5A2QE 3PFSA 3P8HA 1PNJA 4J9HA 4Z02A 3LH5A 2BUDA 5FU6B 3QWXX 3ZBDA 3NPFA 2EIFA 1LNXA 3G71Q 2GQVA 2VYTA 1YWOA 3WXMB 2MOXA 4ZGEB 1K73C 2XU8A 2XDPA 1JQQA 1SHGA 4RTYA 4ZN1A 3QWYA 3CCEA 2ZPGB 4XU3A 5GAN7 2LNVA 2M9UA 5GAOq 2C06A 3C12A 1OQKA 1SPKA 1Q82R 1K0SA 1YFNA 1LPLA 1GFDA 1RADB 1JRIA 1KHCA 1AEYA 4ORZA 3JV3A 4PFOA 1AZEA 2K7AA 1PHTA 3PNWC 5I2MA 3CXCA 2V1QA 3REAB 1QVGS 2CZ0B 5J39A 2YWWA 4P5NA 3OQ5A 1G83A 5CVIA 2QQ9A 2ATCB 3SDZA 1KC8C 1VQKT 1I0CA 4WF2A 2CSIA 2RHYA 2FRWA 1WPYA 4M7AF 2E10A 4DA4A 1IGQA 5FU7B 4EMKA 3NFCA 3ZL7C 4L6V5 2QEXA 3CC4Q 1JXOA 1N9RA 1MUZA 1R0CB 1H641 4IUPA 1Q7YC 5FRMA 2RHIA 4DEXA 1YITQ 1M1KR 2Y4YA 3A8GB 3O8VA 1S72T 3MCAB 1YJWA 1AWOA 4DEYA 1VQPT 1BBZA 1M27C 3OW2A 2K3BA 2E6ZA 3PTAA 2DILA 2Y90A 3GOXA 2RQUA 2HL3A 3LW5E 3OMGA 4HT9A 1WA7A 4V2SA 2JXBA 3SWNB 2DJZA 2HBPA 5KYYA 5LJ5g 1YJNA 3PIOA 3SHWA 4Z89A 1B07A 4F7UB 4C8QA 3CCET 2RHXA 1D1AA 1VQ9A 4Z88A 3QJYA 2K6DA 4JJBA 5KE3A 2E64A 4J9EA 2J6FA 4LDXA 1HYOA 2FO0A 4KGXB 5EG2A 5HY6A 1BIAA 4GY5A 3OS1A 1WXTA 4OMQA 2CP0A 4IUTA 4M7DB 4A4FA 2YRDA 4N4HA 4C8QB 3LGFA 1MV0B 2F69A 1H92A 1JXMA 5LJ5e 2BZ8A 4CC3A 1N8RR 5GMKi 1ZUYA 1X01A 2YXYA 1K76A 1WHLA 2H8HA 2C0IA 2RI3A 3J81E 1UJYA 3BDUA 4M7AD 4Y28E 1K8AR 4C5GA 2DNUA 3MP8A 1YHQT 3RMSA 1IHWA 4IURA 3LH0A 2YRCA 2QGFB 3MEVA 2XICA 2M0YA 3TEEA 3VS3A 4EMKB 4J9FA 1M3BA 3UA7A 1D0ZA 1B7TA 3KXTA 2JZ2A 3VV0A 4D6WA 5GAOp 1MHNA 2K9GA 3E1SA 4JRPA 3VJPA 1UDLA 2HKNA 1QCNA 3OYNA 4HKEA 3G4SQ 1ZLMA 2YUPA 4PJMA 2FB7A 4ZN3A 2ECZA 3CD6T 2CP7A 2ED1A 1ZBXA 2VGNA 1WHGA 1OOTA 1G5VA 3HFOA 2DD4A 3EGDA 1K73R 1ZSZB 1UECA 1N27A 1T0HA 2J05A 3G4ST 4MZTA 1CKAA 3OS5A 1QWFA 2RI5A 3H8ZA 1QLYA 1GBRA 1K4US 4CC4B 1RL2A 3TQ7P 3MEAA 2PVDB 1SG5A 1LJOA 3CCLT 4HCCA 4FIBA 1FWZA 4F04B 3EG0A 4QQ6A 4NL3A 1UGRB 2H3JA 2KXDA 2QQSA 1VQ4Q 1I5LA 4PJOC 2KVQG 4IUVA 3HHTB 3VS6A 4M7DA 3V8JA 2COZA 5CKBA 1ACMB 3G6EQ 1YIJT 3G6EA 1HK9A 2KT8A 1W4SA 4J9DA 5KH6A 2LRQA 1JO8A 3TREA 2KDSA 3I55Q 2PVGB 3CCVA 1GBQA 4KT0E 3E19A 2XD0A 2XMFA 4EIKA 4C0FA 1OPLA 2RQRA 1BKBA 1VYVA 4PJOF 1M8MA 3CCUT 3RESA 1X2KA 2XDDA 2D9TA 3JCMW 3HL8A 2DBMA 1I1JA 4N0AA 3TVTA 1WGSA 4FYXB 2PQWA 3VUZA 1UGSB 3JCMd 1VQMQ 2GTJA 3BW1A 2MF2A 1X27A 4RUGA 4LN2A 3CMAT 5CQXA 1QKXA 2K5LA 5GAN8 4BDYA 1D09B 4BI3A 1QQJA 3QO3A 3OW2S 3JB9J 3I56T 2EQJA 2DTHA 2J6KA 2HL5C 3AT1B 4M7AG 4D8KA 3ZFJA 3QHSA 3SEMA 3GNGA 1Z9QA 1ZA1B 3CCMA 4A4KA 3OYHA 1YN8A 2QTVA 4HVVA 4KULA 1C6VX 2FG0A 4M75C 3WVEB 2O9SA 3EG9B 4QQDA 3MPUB 2MAMA 6AT1B 1MV3A 5KCOA 3UATA 2KBTA 1Y71A 4M75E 1K73U 1I07A 3SD4A 2BE9B 2W10A 3CCMQ 2NWMA 3I55A 2QAZA 4X34A 2E3IA 2L3QA 4MZMA 2R58A 1OPKA 1RI9A 5KYXB 1W2BS 3V7CA 2EFIA 4J9GA 1AHJB 3GIBA 1ZHIA 2G6FX 4XU1A 2GTOA 2OTLQ 3KBGA 3SB2A 5GAMj 5GMKe 5GAOm 3MP1A 2F2XA 4CC7A 2K2VA 1BI0A 2HAXA 3CC7Q 2YSQA 5FWCA 5ECAA 4BE0A 2QEXQ 2M16A 3OS0A 2EKOA 1NM7A 2JMAA 5IT9E 2O01E 2MMPA 3M4GA 5IH2A 2CGHA 2PNIA 2RMOA 3VS5A 1UHCA 1JJ2P 3G7ZA 1F1BB 4B9WA 1VQMA 1VQ8Q 3JB9H 4CRIA 2XKOC 4LE9A 3CCRQ 2DL5A 3BY7A 4M7AA 1W70A 5CKEA 1UUEA 4KBMB 1Q86U 2ZPIB 4KH0B 8AT1B 1WYXA 5KYXA 4F7UG 3EG2A 4EPCA 1ZUKA 3O5ZA 1JJ2S 3C95A 1Z9ZA 2JJ9A 2QQAA 3CCJT 1OU8A 2A3LA 1WX6A 2X4WA 2PUOB 4ELZC 1U8RA 2VASA 4BB7A 2JTFA 1NPPA 2V8IA 1TUCA 3DLMA 3JCMg 3ME9A 3RMQA 1M1KU 3CC4A 2L3RA 3NGPA 1YCYA 1VQ4A 1AT1B 4QVZA 1TXQA 3GF5A 3C4SA 5GMKh 2BTTA 5HK0A 4E7KA 1K8AU 2GFAA 2CH4W 2ZPFB 1JU5C 4OB0B 4OVAA 2CUBA 4A4EA 5LJ3f 1TG0A 2YUOA 4B6MA 1U1SA 1BCMA 2FRYA 2L2PA 5L23A 2KNBB 2EYZA 1PCXA 1ZA2B 1Q95G 3DLLA 3PIPA 1RAGB 2DO3A 2DJQA 4M78A 2DXCA 3RKWA 1PD1A 1M4ZA 3H41A 5LJ3j 1N6AA 1W6XA 2J6OA 3G4SA 2FPFA 3ULRB 2E12A 4M7DC 2A37A 2X3WD 2XHCA 1WHHA 2EJGA 2ED0A 4RG2A 2DIQA 5D7UA 1PM3A 4XTVA 3CCRT 4BY6C 3I5RA 3OSVA 3CC2T 4AFUC 1VQ9Q 3WVDB 2RQVA 3CC4T 3CBMA 1S72A 1BYMA 1YITT 4QKUA 1U3OA 1EZZB 3VKIA 3DKMA 3QBYA 2DEUA 1E6HA 1Y57A 2VC8A 3UT1A 1Q86R 1LCKA 4XK8E 3VS1A 3M0PA 4AG2C 4LUEA 3RIRA 2EWNA 3OYIA 1KHIA 2MK5A 3EFOA 4AFSC 2D8JA 2B8AA 2GCXA 4FM4B 4C0DC 3OA6A 3OYEA 2RHUA 1VYTA 4Y91A 3KFVA 5CKFA 4B9XA 2HCKA 1MNEA 1YBYA 3MP6A 1YJ9A 2DERA 2QA4T 1K8AC 1X6BA 3OBYA 4XTYA 2HD0A 4VUBA 4R55A 4M78F 5DM7R 2EKHA 1W2BA 3LX7A 1QP2A 4ZGDB 4JLGA 4JJDA 3URGA 4IIMA 4XTUA 4FW1A 2FPEA 1JJ2A 1M2OA 2B86A 2X4JA 3M58A 1AZGB 3VU3C 1Q81R 1Q82C 4FL6A 1FMWA 3EFRA 5LJ5d 2DBKA 4DOVA 3PVQA 1GXIE 3VYHB 1GCQC 1WJRA 4HCZA 3H6ZA 4PJOA 1WHKA 3QDFA 1WJQA 1T3SA 2EJFA 3P8DA 3REBB 3H9NA 3I56A 1VQKA 1MMGA 2DVEA 3FIFA 2OJ2A 2QDLA 4OB3B 4BI4A 1W2BP 1OZ3A 2V1RA 1PRMC 1Q86C 4M77C 4J7IA 3CCRA 4OMOA 1QVFP 4HXJA 4XTXA 4HVUA 2DX1A 5GAN4 2W0ZA 1BIBA 3X25B 4E7JA 5LJ5f 2LCCA 4ANJA 2A7YA 2ZCFB 3EAEA 5J26A 1X2QA 4DBRA 7AT1B 2EW3A 2RJDA 1DJ7B 1SSFA 1KQ1A 5GANg 1VQ7Q 3FEOA 1PKTA 5CKDA 2D8HA 1YP5A 1VQOA 1NEGA 2DIGA 5LJ5h 3CC2A 4F14A 4M75G 1KD1C 5GANf 1I5OB 1UGQB 1SRLA 2PTKA 2WSEE 4AFZC 3UPUA 2QYZA 4PK4A 1JB0E 1EFNA 1M1FA 1PRLC 4M77D 4CC2A 2RJCA 2DM1A 4MMLA 3GP8A 1Y07A 2O88A 1Q81C 5C0MA 2EPDA 1VQ4T 1UEBA 3OY9A 4PJOE 2RQWA 5GAOl 4OF1A 4JS5A 4C92G 2JNGA 4IIOA 2EQMA 1RAEB 4KRTA 3NTIA 5GANh 4AG1C 2BE7D 4L5GA 4EMGA 1YI2A 1CKBA 4OMLA 3CCUA 4M77F 2HSPA 3S3NA 5GAMd 2RD1A 1MNDA 2RO0A 2LNHB 2COWA 1BB9A 3E9GA 2EYYA 1G3SA 1KIKA 3META 4JPBW 2AIRB 3OW2P 2J06A 3CEYA 3JRZA 4PLIA 3CC7A 3A8MB 1VQ5A 4MDWA 3RERA 3X26B 5GAN3 2O9VA 3QPHA 3I9QA 3CMEQ 3CCEQ 4MMKA 5GAOr 1BCOA 2JTMA 2QASA 3CPWA 4C92E 4JRKA 2YLCA 2MYSA 3QIIA 3C0CA 1RI0A 1WZOA 3FJPA 1D1CA 3MO8A 4X9CA 1E7OA 4M78D 1K9MR 1OULA 2QXFA 2DL7A 2ENMA 2F1LA 3BFMA 4AMCA 5AT1B 5FU7C 2LP5A 1QWEA 1VQPQ 1HSQA 3AHUA 4LNPA 4J5YA 4J83A 1TOVA 3QDRB 2AT1B 2LJ0A 1FYNA 4R0KA 2OTLT 2AZSA 1PSFA 5DY9A 3JCMb 5GAMh 2QQBA 2IG0A 3M57A 1VQLA 2VGMA 4PFPA 2E3HA 1PSEA 4D8DA 1NYFA 2DKGA 1M90R 4C8QD 4TVRA 1NYGA 5FW9A 3DB3A 1VQNA 1OZ2A 1G3YA 2LJ1A 4LUDA 4ESRA 4N0AC 2F5KA 4KH1B 4DBFA 2CP2A 1M3AA 4HA8A 2IPOB 2CT3A 1IB8A 2F2VA 2P4TA 2R57A 5GJWB 2EAYA 2QA4A 3JB9I 2X3XD 1SKUB 4M75B 4DQ2A 1WDXA 2HKQB 1H8KA 3CCLQ 1HXDA 1R8OB 2D0QB 2L89A 4O6JA 2RA2A 1Q82U 5IHNA 1X43A 1OYXA 2BZYA 2K3YA 1ZSGA 4EMKC 4PJOB 2CDTA 2CH4A 2COYA 2FL7A 1VQ6A 1M5Q1 4JZ4A 4HCKA 1IHVA 5LJ3d 3CCQQ 4Q5WA 3TU4K 4J9CA 1SF9A 4AT1B 1UE9A 2DD5A 2RPNA 4BI8B 4E6RA 3CC2Q 2GF7A 1UFFA 3HRUA 1GCQA 2M51A 5CKHA 2OTJT 3VUBA 1HJDA 1KC8R 1YIJA 2RJEA 3M0QA 1ZSZC 4J7FA 1T0JA 1U5SA 1X6OA 1QCOA 3CPFA 3CCQA 3ZEHA 4OB1B 1M2VA 3FLGA 4C92F 2D0NA 4A53A 2K5IA 4M78E 3PMIA 3HRTA 4C92B 1WLPB 4EMHA 4M7DE 3X20B 3M55A 3M0SA 2KRSA 2CUDA 3M5AA 2LCLA 4NOYA 2F2WA 1Y0MA 1KFZA 1M1GA 1SSHA 2AKLA 2QI2A 2ROTA 5CAIA 2KI7A 1LVKA 2KEAA 3V7SA 5CR2A 3LWIA 1LOJA 3QYGB 2I0NA 2C0TA 3S6WA 3MEWA 1VQ5Q 3QUIA 4RMOA 1TWBA 1UJ0A 1N5ZA 5GANd 2L3PA 2LVMA 3CCST 1FMVA 1JEGA 4LDWA 2HSEB 2K79A 2RK2A 4M75F 4E47A 3X24B 5GANj 1GRIA 3ASKA 2JN0A 3JCMQ 1C0MA 3V8KA 5CIUA 2RH2A 1W1FA 3EG9A 3MJXA 1B34A 4MDXA 2L3SA 1QVGP 1UHFA 1K1ZA 4C8QF 4Z8AA 3E9FA 5D6XA 2QK0A 4OMFB 5J3BA 4ZNXA 1S72Q 4M7DG 2E65A 2DZCA 1V1CA 8ATCB 3EFSA 2O4XA 2MWOA 3CD6A 4BE2A 3EGUA 2DE0X 2J7IA 4FU6A 1RLQC 2KSSA 1RAFB 3RUXA 2EYXA 1I8FA 2KRNA 2JUFA 2LZ6B 4ELYC 1AD5A 2LT4A 3L42A 3L2VA 3NTHA 2E5QA 2IIMA 1G8XA 2ZZDA 2P0KA 1KSWA 1CSKA 3RKYA 2HNIA 1HD3A 2ZGWA 4F7UE 2HDAA 3EH2A 2HQXA 1VQKQ 1NJIC 3H0FA 1A0NB 2KYMA 2L5QA 4J6WA 4LDVA 4XQ3A 1OI1A 4LDYA 1M30A 2C0OA 1ZBJA 3QKJA 2MIOA 4KGZB 4RCCA 3JB9G 3HRSA 5I22A 4OGEA 4O5VA 1MMDA 3SWNA 5KYYB 3OYFA 3INZA 4AFQC 2BKDN 1KD1R 4F7UA 3OYDA 2DL4A 3L2WA 2SEMA 2KRMA 1X6GA 3JSCA 2GNCA 2VV5A 2RB6A 3S3MA 5I2SA 1YCSB 3R6OA 1D0XA 1O75A 2YHTA 1KQSA 1KQ2A 2KR3A 2OAWA 1Q7YU 3C94A 1BI1A 2P4RA 3CBOA 1WNLA 1NJIU 3CMET 2KE9A 4ZGJB 3IQLA 5AYFA 3I56Q 5I11A 2IVWA 3JAME 3EHRA 1XOVA 3RDVA 3HKSA 2L0AA 1QVGA 2DYBA 2P0QA 2DFUA 5GANe 4C5EA 4GLKA 5FWBA 2DMOA 4PNOA 4KUIA 1RABB 2X35A 2O31A 2WSFE 1G2BA 1K9AA 3M0RA 4GLMA 2CYZB 1I4K1 1NZ9A 3EGXB 1FX7A 3QZ5B 1QW1A 2AKKA 2KYBA 3OSSC 3SFMA 1Y96A 4IUQA 2K3XA 4JUVA 4WCIA 4FYYB 3OYCA 1NLPC 3M9QA 1QVFA 4OMPA 2AK5A 5GJVB 3GPLA 2X4YA 4C92C 1VQ6T 3EFOB 4KGVB 5GAMe 4PJJA 2JTEA 2PU9B 3VS0A 3EG1A 1QCFA 4XTZA 1QMCA 4IKFA 2XIDA 2LDMA 2LQKA 2VXEA 1YJ9T 1M3CA 5GMKl 1KJWA 1R0BG 4JS4A 4KUDK 3JCMf 4N4GA 1VQ7A 3G6ET 3EH1A 3S3OA 2JM8A 2M02A 2QDYB 3H0HA 3M56A 5FU6C 3OMCA 1OX8A 1RAAB 3CC7T 2HBWA 5HK3A 2K57A 2GFUA 5GAN6 2RK1A 2BIVA 1WQ7A 3FB9A 1NBEB 1YWPA 1BU1A 4HCBA 2Y4XA 4FW2A 1M90U 3OYLA 3CQTA 2CP3A 1VYUA 4XU0A 2DTOA 4JDSA 3JCMX 5KYNA 2V26A 3DB4A 1UGVA 3JCMh 3OYYA 1ZUUA 4BD3A 2RN8A 2SRCA 1IXDA 2JOYA 3J80E 2CZ1B 2HQEA 3QG1A 2RM4A 5IAYA 1I81A 4M78C 1XNIA 4FYVB 4C8QG 2R5AA 4PJOG 4X9DA 2KQWA 4A4HA 4BY6B 1WXUA 2RF0A 1OX9A 4OGCA 1SEMA 4ME7A 2I2LA 4M4ZA 2X4XA 4BE1A 2EJ9A 3HP9A 5KE2A 2E70A 2VVKA 5KYWA 3CD6Q 1ABQA 1VQOQ 3EGDB 2QGGA 2ZAEA 1XQHA 2V8JA 4JJCA 2O2OA 2EQIA 3M54A 4LDUA 5FLXE 1C1AA 3JCMV 2LC4A 1D0YA 1Y96B 3VS2A 4OB2B 4RTTA 2CS7A 1KQSP 1M90C 3G1JA 3A5ZB 2EQUA 1KG1A 2DYIA 4JJNK 3H0IA 2YRVA 3I5SA 4OP0A 1EX4A 1VQNQ 5A0DA 4C0ZA 3T9NA 4JLIA 2EVRA 4XTWA 2X9HA 4C5HA 1KC8U 1WI7A 3EHQA 3CBPA 2K2MA 3P8BB 1IO6A 4M77E 2HZYA 4PJLA 2OX7A 1GFCA 3MEUA 3TCJA 3M0UA 3UDCA 2ESWA 2A36A 1FMKA 4K11A 4RG8A 2QG9B 1VQOT 2NLUA 4BACA 1VQPA 3I55T 3VS7A 4E7SA 1WXBA 5KYWB 1VQ7T 4RCBA 3I35A 2FHDA 2P84A 4RTXA 4R56A 2R5MA 3R6NA 5LJ5j 2VWFA 2A28A 1D3BB 1YJNT 1EIFA 4M75A 2DAQA 3CCJQ 2V8KA 1WFWA 1WJSA 2KGTA 1VQ9T 2DTIA 1AWXA 4PJOD 1P92A 3CCQT 3A8OB 2E4HA 4F17A 3U23A 1NLOC 1N8RC 4NS5A 3MKDA 3J7AF 2LQNA 4C5IA 2KMTA 4PLLA 1VUBA 1VQLT 4LXCA 3JB9F 1PWTA 3PGGA 2LTOA 1T3LA 3LLRA 3CCSQ 3D7SB 1UG1A 1M8VA 2XI9A 3L2UA 4M77B 3GNFB 2DXUA 1TUGB 4FT4A 2LX9A 1TH7A 4C92A 1X75C 2DRMA 2E1HA 3FC3A 3CCUQ 5HCKA 1YI2Q 4OMMA 3OYKA 3CPWS 1J3TA 3JB9D 1H3ZA 5GMKj 2K4YA 1VQ6Q 4QVDA 1V76A 2JT4A 3X28B 1QVPA 1TSFA 1K9MC 2KK4A 1ABOA 1IZ6A 1Y7XA 2EGCA 4RKUE 1E6GA 1UGPB 2CP6A 1M2VB 2QQRA 1WHJA 3V8LA 3QXEB 4RTUA 1YIJQ 4A54A 5GAN5 5GAN2 1OEBA 4XAXB 3HTRA 1FXXA 3Q1JA 4PFZA 3OYGA 3NMZC 2LMJA 2ZPHB 2HQHA 4HVWA 2O4XB 4FCYA 2DK3A 1QVFS 5GAOn 1QP3A 2FVUA 2X51A 4F7UF 2CSQA 4M7DD 2NUPB 1VQ8A 4JRQA 4XU2A 1Q81U 4RTZA 3EGXA 3L2ZA 1S1NA 2F5TX 5IXBA 1U06A 5IXFA 2Z0WA 2BZXA 2KY9A 1YJWQ 2JM9A 1VOMA 3OYJA 5LL6S 1M9SA 1AWJA 1PD0A 4ZTJA 3CPWP 2ZPEB 4QW2A 2D6FA 1KD1U 1ZQ1A 1UTIA 2RQTA 1N9SA 4LD9K 5FRNA 3E2UA 2DL8A 3HPWA 3CMAQ 3NHNA 4Y92A 2AHJB 2G3RA 1SHFA 1KK7A 3PE0A 2DVJA 3CCLA 1NG2A 1Q7YR 4A63B 2VXFA 1VA7A 3M59A 2PZ1A 2E41A 4J6YA 1NJIR 2D1XA 5KYUB 2MI6A 3CCJA 3FRNA 1BI3A 1YHQA 1YHQQ 2CZ7B 4M78B 5D6YA 2DZ9A 1TUDA 3MHXA 5HKCA 1MGQA 3VRZA 3EG3A 1YJ9Q 3JCMJ 5D6WA 1OU9A 3M0TA 4J9IA 1MMNA 2LQ8A 1PKSA 2GQIA 3PVLA 3OBWA 2DA9A 4RTVA 4PJNA 3CCVQ 3A1PA 1XJWB 2ROLA 3LWHA 1WIEA 3M53A 1VQLQ 1YNZA 1XTDA 1WQWA 2OAUA 2E6NA 3VYGA 1X69A 2VUBA 2A08A 2JS0A 3ER0A 5GMKm 4C0DB 2XK0A 2VKNA 2L8DA 3BDLA 2NYSA 3A8LB 4J9BA 3TSWA 2YUQA 1MMAA 3THKA 5A0LA 2YDLA 2EGAA 4C92D 4M7AC 1B3QA 5CCAA 9ATCB 2ZPBB 1ZSZA 4ZTFA 4E7ZA 3TSZA 3UWNA 2WACA 2GGRA 3JCMe 2OTJA 3N5BB 2XDBA 1VQMT 1YJWT 2KAFA 2DEQA 1VQ8T 3NTKA 4FSSA 1NE8A 2RNAA 1JBMA 1U1TA 2FZKB 2WSCE 2H3EB 1GL5A 1B34B 1WHMA 2GBQA 1VIEA 4QT7A 2YLBA 5A0GA 2E5KA 4HT8A 1ARKA 2QEXT 5GAMf 5EC7A 1IREB 2MWPA 2KXCA 2HMAA 5IHIA 2FZCB 1GCPA 3LYIA 1R77A 2AZVA 2MPXC 1K9MU 4C8QE 2NUTB 2DXBA 3V7RA 1RAIB 2KROA 4M7AE 2PUKB 1PG5B 3QYHB 4E7IA 3RNJA 2DETA 3KUFA 4OMNA 2QA4Q 1K0XA 3SWNC 2JS2A 3L2RA 1OV3A 1IGUA 2DL3A 5IHKA 1D3BA 3CMAA 1BK2A 2M1HA 3M4YA 1N8RU 2LCSA 4M77A 1NPRA 1AWWA 5I21A 4FYWB 1AVZC 3F70A 3HSBA 2FYKA 2K5FA 2NUTA 3CCMT 4X1VA 2CT4A 5M9OA 4J8OA 3CXCP 3HFNA 2DF6A 3RR6A 2M0OA 3A98A 4F16A 1G3TA 3VRYA 2EQKA 4A4GA 3OB9A
chains in the Genus database with same CATH topology
3JCMh 3OYYA 3JB9J 4MMKA 3I56T 1UB4A 2EQJA 4BD3A 5GAOr 2DXTA 3L1AA 2JOYA 2JTMA 2DTHA 2RI2A 3A8HB 3QJ6A 4C92E 4CI0C 3J80E 2EYQA 2QTXA 2DPPB 4JRKA 2XG8D 5IN1A 1O9SA 2CZ1B 2HQEA 2YLCA 3PT9A 4M7AG 3QIIA 3ZFJA 3QG1A 3QHSA 1RI0A 2RM4A 3GNGA 5IAYA 1I81A 3FJPA 1XNIA 4M78C 3MO8A 4X9CA 2R5AA 2RJFA 4PJOG 4C8QG 5DLOA 3CCMA 4M78D 4X9DA 4A4KA 3CXCS 2KQWA 3OYHA 4A4HA 4BY6B 2QXFA 4KULA 3BFMA 4M75C 3WVEB 2CZ6B 4OGCA 4MZPA 4ME7A 2I2LA 4JRIA 5FU7C 4M7DF 3QZ9B 2X4XA 3CMEA 4QQDA 4BE1A 2MAMA 5KCOA 4DOWA 2EJ9A 3HP9A 5KE2A 3AHUA 2E70A 4J5YA 4J83A 1Y71A 2CKKA 4M78G 4M75E 4C8QC 1K73U 3QDRB 3SD4A 4NL2A 2OTLT 1VQNT 3G71A 4E7HA 1XQHA 1PSFA 2V8JA 4QQGA 5DY9A 3M54A 4LDUA 5FLXE 3JCMb 5GAMh 3I55A 2QQBA 4X34A 3L2QA 2IG0A 3M57A 1YITA 4MZMA 3JCMV 2LC4A 1VQLA 2R58A 3CCVT 1Y96B 2VGMA 4OB2B 4LD6A 1YI2T 2CS7A 1PSEA 1M90C 3A5ZB 1VQ5T 2DKGA 4L59A 1W2BS 5L8RE 2EQUA 5LJ3g 1KG1A 4JJNK 3V7CA 4C8QD 2EFIA 4TVRA 2YRVA 3DB3A 1AHJB 1M1KC 4OP0A 3GIBA 1ZHIA 4IUUA 1OZ2A 2OTLA 1G3YA 2RHZA 4XU1A 1VQNA 3KBGA 3SB2A 5A0DA 4C0ZA 5GAMj 3T9NA 4N4IA 5GMKe 4JLIA 4N0AC 5GAOm 2F5KA 4FT2A 1VIFA 3MP1A 4XTWA 4C5HA 4PKCC 1KC8U 2K2VA 1BI0A 3CBPA 5C6SA 3P8BB 2HAXA 5KCHA 4M77E 4HA8A 4BE0A 3MEUA 3TCJA 2M16A 2P4TA 2R57A 3UDCA 2EAYA 3OS0A 2QA4A 2EKOA 2JVVA 3RKXA 3JB9I 5IT9E 4RG8A 2O01E 3OYAA 2LT1A 1VQOT 2MMPA 3M4GA 4J6XA 2NLUA 5CQYA 5DLQE 2CGHA 1BI2A 3OYBA 4BACA 4M75B 4DQ2A 1VQPA 3I55T 1KQSS 4BDZA 1HXDA 3G7ZA 4QVCA 4B9WA 1R8OB 2D0QB 2L89A 5CO7A 5LJ3e 1V29B 4RCBA 3G71T 2P0PA 3PMTA 1VQMA 3JB9H 4O6JA 2RA2A 1Q82U 4M75D 4UC4A 5CK9A 4M7AB 5LJ3h 1OYXA 4ATOA 2K3YA 4FSXA 1G3WA 2FHDA 2XKOC 4CRIA 3GLXA 3BY7A 2R5MA 4R56A 4M7AA 4EMKC 2PVOB 5CKEA 4PJOB 4KBMB 1Q86U 5LJ5j 3LGLA 4M77G 2ZPIB 4C0GA 4YTLA 4E7LA 3QSUA 3CPWA 1D3BB 2FL7A 1M5Q1 1YJNT 1VQ6A 1EIFA 4BUGA 3JCMP 5LJ3d 3TU4K 4Q5WA 3CCSA 4M75A 5GAMg 5FROA 3OYMA 4EDUA 2DAQA 4F7UG 2V8KA 4EPCA 1JJ2S 1WJSA 1VQ9T 3JCMc 3OS2A 2DD5A 3C95A 4II1A 4PL6A 2DTIA 4BI8B 4PJOD 1P92A 3CCQT 3A8OB 2QQAA 3CCJT 2A3LA 2GF7A 3FDRA 1N8RC 3HRUA 5CKHA 4NS5A 5A2QE 3J7AF 3PFSA 2X4WA 3VUBA 2OTJT 4C5IA 2KMTA 3P8HA 1VUBA 4PLLA 1VQLT 2PUOB 4ELZC 1YIJA 1U8RA 2RJEA 4Z02A 4BB7A 3JB9F 2JTFA 1NPPA 4J7FA 3PGGA 2LTOA 1X6OA 3LLRA 2BUDA 3CPFA 2V8IA 5FU6B 3CCQA 3ZEHA 4OB1B 3FLGA 4C92F 3ZBDA 4A53A 2EIFA 3DLMA 2K5IA 3JCMg 1LNXA 2XI9A 1M8VA 3ME9A 4M78E 3RMQA 3L2UA 1M1KU 3PMIA 2GQVA 2L3RA 3HRTA 2VYTA 1YCYA 4M77B 3WXMB 3GNFB 2DXUA 4C92B 1VQ4A 4FT4A 4QVZA 2LX9A 1TH7A 3GF5A 4ZGEB 1K73C 3C4SA 4C92A 1X75C 2XU8A 5GMKh 2E1HA 5HK0A 3FC3A 4E7KA 2XDPA 1K8AU 4ZN1A 2GFAA 4EMHA 2ZPFB 3X20B 2ZPGB 3M55A 4XU3A 3CCEA 5GAN7 4M7DE 2LNVA 4OB0B 2M9UA 3M5AA 5GAOq 3C12A 2C06A 2LCLA 3OYKA 4OVAA 3CPWS 4A4EA 3JB9D 5LJ3f 3OW2S 1JRIA 1KHCA 4NOYA 1H3ZA 1U1SA 5GMKj 1M1GA 2K4YA 3PNWC 5I2MA 4QVDA 2QI2A 3X28B 1QVPA 3CXCA 1K9MC 2KK4A 5CAIA 1IZ6A 1Y7XA 1QVGS 2CZ0B 5J39A 3V7SA 5CR2A 3LWIA 1LOJA 4RKUE 1UGPB 4P5NA 3OQ5A 2QQRA 3QYGB 3DLLA 3PIPA 5CVIA 3V8LA 2QQ9A 2DO3A 3QXEB 4M78A 3SDZA 3S6WA 4A54A 1KC8C 1VQKT 5GAN5 2DXCA 5GAN2 3MEWA 4WF2A 3RKWA 1M4ZA 2RHYA 5LJ3j 1N6AA 3QUIA 4RMOA 1WPYA 5GANd 3G4SA 4XAXB 2E10A 4M7AF 4DA4A 5FU7B 2LVMA 2E12A 1FXXA 3CCST 4M7DC 4EMKA 3Q1JA 2XHCA 3NFCA 4LDWA 2EJGA 2RK2A 3OYGA 4RG2A 2ZPHB 4M75F 4E47A 2DIQA 4L6V5 2QEXA 3X24B 1N9RA 5GANj 1H641 4IUPA 1Q7YC 5FRMA 4XTVA 2O4XB 2RHIA 2Y4YA 2DK3A 3A8GB 3ASKA 3CCRT 1QVFS 2JN0A 5GAOn 3O8VA 1S72T 4BY6C 3OSVA 3JCMQ 3CC2T 3MCAB 3WVDB 1YJWA 3CC4T 1QP3A 2FVUA 3CBMA 3V8KA 1S72A 4F7UF 4M7DD 1YITT 1VQPT 3OW2A 5CIUA 1BYMA 2E6ZA 2RH2A 3VKIA 1VQ8A 3DKMA 1B34A 4XU2A 3PTAA 4JRQA 1Q81U 4MDXA 3QBYA 2Y90A 3GOXA 3LW5E 3L2ZA 4C8QF 3OMGA 2F5TX 2VC8A 4HT9A 4V2SA 3E9FA 5D6XA 3SWNB 2DJZA 2HBPA 1YJNA 5LJ5g 3PIOA 2KY9A 4OMFB 5J3BA 3UT1A 3OYJA 4XK8E 4F7UB 5LL6S 1M9SA 4C8QA 2E65A 4M7DG 3CCET 2RHXA 2DZCA 4ZTJA 2ZPEB 4QW2A 3RIRA 1KD1U 1ZQ1A 3QJYA 1VQ9A 2D6FA 2EWNA 5KE3A 1N9SA 4LD9K 2E64A 3EFSA 3OYIA 5FRNA 1KHIA 2O4XA 2MWOA 3HPWA 4BE2A 3CD6A 4LDXA 2B8AA 2AHJB 2GCXA 4FM4B 2G3RA 4C0DC 3OA6A 3OYEA 4FU6A 5EG2A 5HY6A 2KSSA 1BIAA 2RHUA 4Y91A 3CCLA 3RUXA 5CKFA 4GY5A 4B9XA 3OS1A 1YBYA 3MP6A 1I8FA 3CC4A 1YJ9A 4IUTA 4M7DB 2QA4T 2JUFA 4A4FA 1K8AC 2VXFA 3OBYA 4N4HA 3M59A 4C8QB 4J6YA 2E41A 2F69A 2LT4A 3LGFA 4XTYA 4ELYC 2MI6A 3L42A 2HD0A 3NTHA 4VUBA 3L2VA 3CCJA 3FRNA 4R55A 1BI3A 2E5QA 4M78F 1YHQA 5LJ5e 2ZZDA 5DM7R 2CZ7B 4M78B 2P0KA 5GMKi 5D6YA 1X01A 2HNIA 3RKYA 2DZ9A 1W2BA 3LX7A 1QP2A 2ZGWA 4F7UE 3MHXA 4ZGDB 4JLGA 2HQXA 2RI3A 3J81E 3URGA 1MGQA 3BDUA 4XTUA 5HKCA 1NJIC 4M7AD 3JCMJ 4Y28E 2X4JA 3M58A 1JJ2A 2L5QA 5D6WA 3VU3C 4J6WA 4C5GA 4LDVA 4XQ3A 1OI1A 3MP8A 4LDYA 1YHQT 3RMSA 1Q82C 4IURA 4FL6A 3EFRA 3LH0A 2LQ8A 5LJ5d 3QKJA 4RCCA 4DOVA 3OBWA 3JB9G 3MEVA 3HRSA 1GXIE 3VYHB 4OGEA 2XICA 1VQ7T 3TEEA 4EMKB 1WJRA 4O5VA 4HCZA 3H6ZA 3SWNA 3OYFA 4PJOA 1WJQA 3LWHA 3M53A 3INZA 2EJFA 2BKDN 3P8DA 3KXTA 4F7UA 3I56A 2JZ2A 1XTDA 3VV0A 3OYDA 2DVEA 3FIFA 3L2WA 1VQKA 4BI4A 3JSCA 1WQWA 4OB3B 4D6WA 2OAUA 1OZ3A 5GAOp 1MHNA 2E6NA 3E1SA 3VYGA 4JRPA 3VJPA 1Q86C 4M77C 2VUBA 4J7IA 3CCRA 5GMKm 3ER0A 3OYNA 2VV5A 2RB6A 3S3MA 5I2SA 4C0DB 4HKEA 2XK0A 3R6OA 4XTXA 2L8DA 3BDLA 2FB7A 4ZN3A 1O75A 2YHTA 3A8LB 5GAN4 1KQSA 1BIBA 1KQ2A 3CD6T 3X25B 4E7JA 1Q7YU 1ZBXA 2VGNA 3C94A 5LJ5f 5A0LA 1BI1A 3CBOA 2LCCA 3HFOA 1WNLA 2A7YA 4C92D 1G5VA 2DD4A 4M7AC 1NJIU 2ZCFB 3CMET 3EAEA 4ZGJB 5J26A 1N27A 5AYFA 3G4ST 5CCAA 4MZTA 2IVWA 2ZPBB 4ZTFA 3OS5A 2RI5A 3H8ZA 3JAME 1XOVA 2RJDA 3UWNA 3HKSA 1QVGA 1DJ7B 1RL2A 2WACA 2OTJA 3JCMe 3N5BB 2XDBA 2P0QA 3MEAA 1VQMT 1YJWT 1SSFA 2PVDB 5GANe 2KAFA 4C5EA 2DEQA 1LJOA 1KQ1A 5GANg 3CCLT 4E7IA 1VQ8T 4FIBA 4HCCA 3NTKA 1FWZA 3FEOA 1NE8A 4GLKA 1JBMA 1U1TA 4PNOA 4KUIA 5CKDA 2WSCE 2X35A 1VQOA 2DIGA 2WSFE 4QQ6A 5LJ5h 3CC2A 4M75G 4NL3A 1KD1C 1B34B 1UGRB 5GANf 2H3JA 1VIEA 1UGQB 2CYZB 2QQSA 2YLBA 2WSEE 1I5LA 1I4K1 1NZ9A 1FX7A 3UPUA 3QZ5B 5A0GA 4HT8A 2KVQG 4IUVA 1JB0E 1QW1A 3HHTB 4M7DA 4PJOC 3V8JA 2QEXT 1M1FA 5GAMf 3OSSC 5CKBA 3SFMA 1Y96A 4M77D 1IREB 2RJCA 4IUQA 2K3XA 2MWPA 4JUVA 3OYCA 4MMLA 3GP8A 1YIJT 3G6EA 1HK9A 1Y07A 3M9QA 1QVFA 3LYIA 1Q81C 5C0MA 1VQ4T 3GPLA 1W4SA 1UEBA 2X4YA 3OY9A 4C92C 5KH6A 1K9MU 4PJOE 4C8QE 1VQ6T 2LRQA 5GAOl 3TREA 2KDSA 4OF1A 5GAMe 4JS5A 2PVGB 3CCVA 2PU9B 2DXBA 3V7RA 4KT0E 3E19A 2XD0A 4M7AE 4C92G 4XTZA 4C0FA 2JNGA 2PUKB 4IKFA 1BKBA 2EQMA 2XIDA 2LDMA 3QYHB 4PJOF 2LQKA 2VXEA 3NTIA 4L5GA 5GANh 4EMGA 3CCUT 1YI2A 3RESA 1YJ9T 5GMKl 4JS4A 3KUFA 3CCUA 4KUDK 3JCMf 4N4GA 1VQ7A 4M77F 2XDDA 3G6ET 3S3OA 2QDYB 3SWNC 2D9TA 3M56A 5FU6C 3HL8A 3OMCA 3L2RA 5GAMd 3JCMW 3S3NA 4N0AA 3CMAA 1D3BA 2RD1A 3CC7T 5HK3A 2M1HA 2RO0A 3M4YA 1N8RU 2K57A 1NPRA 4M77A 3E9GA 2GFUA 5GAN6 1WGSA 2RK1A 1G3SA 2PQWA 3VUZA 3META 5I21A 1UGSB 2BIVA 1WQ7A 3F70A 3FB9A 3HSBA 2FYKA 2K5FA 4HCBA 3CCMT 2Y4XA 5M9OA 3JCMd 3CEYA 3BW1A 3JRZA 4J8OA 3HFNA 2MF2A 4PLIA 3OYLA 1M90U 3CC7A 3CMAT 2M0OA 5CQXA 2K5LA 4XU0A 5GAN8 3A8MB 4BDYA 4BI3A 2DTOA 1VQ5A 4JDSA 4MDWA 3JCMX 3RERA 3X26B 3QO3A 5GAN3 1G3TA 3DB4A 2EQKA 4A4GA 3QPHA 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM h;  3JB9 J;  2FB7 A;  4MMK A;  5GAN 4;  2YHT A;  3QSU A;  3V8K A;  5GAO r;  1D3B B;  1BIB A;  1M5Q 1;  2DXT A;  1KQ2 A;  3L1A A;  4F7U F;  3JCM P;  2DTH A;  5LJ3 d;  5LJ5 f;  4M7D D;  4C92 E;  4M75 A;  5GAM g;  2QTX A;  4JRK A;  4M7A G;  4F7U G;  2YLC A;  3HFO A;  1WNL A;  4C92 D;  4M7A C;  1B34 A;  3QHS A;  4XU2 A;  2RM4 A;  3JCM c;  1I81 A;  3FJP A;  4M78 C;  4X9C A;  4C8Q G;  4PJO G;  2Y90 A;  2DTI A;  4PJO D;  3L2Z A;  4M78 D;  4X9D A;  4C8Q F;  2VC8 A;  4HT9 A;  4V2S A;  3SWN B;  2DJZ A;  5LJ5 g;  3BFM A;  4M75 C;  3JCM e;  4F7U B;  4M7D G;  4C8Q A;  2E65 A;  5GAN e;  2I2L A;  2DEQ A;  1LJO A;  2DZC A;  4JRI A;  1KQ1 A;  5GAN g;  4M7D F;  3RIR A;  3JB9 F;  2EJ9 A;  2EWN A;  1N9S A;  3AHU A;  2E64 A;  1JBM A;  3EFS A;  3PGG A;  1U1T A;  4J5Y A;  3JCM Q;  4PNO A;  4M78 G;  4M75 E;  4C8Q C;  4NL2 A;  4C92 F;  4A53 A;  3JCM g;  5LJ5 h;  1M8V A;  1LNX A;  4M75 G;  4M78 E;  4NL3 A;  1B34 B;  5GAN f;  5DY9 A;  4M77 B;  1YCY A;  4C92 B;  3JCM b;  5GAM h;  2DXU A;  5LJ5 j;  1BIA A;  2YLB A;  1I5L A;  1I4K 1;  1TH7 A;  4Y91 A;  3JCM V;  4C92 A;  5GMK h;  4HT8 A;  4PJO C;  1Y96 B;  2E1H A;  3RUX A;  4M7D A;  3V8J A;  5GAM f;  1I8F A;  4EMH A;  4M7D E;  1Y96 A;  4M77 D;  4XU3 A;  5GAN 7;  4M7D B;  4JUV A;  2VXF A;  4MML A;  5GAO q;  4C8Q B;  4J6Y A;  2E41 A;  1HK9 A;  4XTY A;  2DKG A;  5LJ3 g;  3JB9 D;  3V7C A;  4M78 F;  4C8Q D;  5LJ3 f;  1JRI A;  4NOY A;  5LJ5 e;  4PJO E;  4C92 C;  4M78 B;  4OP0 A;  4C8Q E;  3GIB A;  1U1S A;  5GMK j;  5GMK i;  3RKY A;  1X01 A;  2HNI A;  4XU1 A;  2DZ9 A;  5GAM e;  5GAO l;  3V7R A;  4QVD A;  3SB2 A;  2ZGW A;  4F7U E;  5GAM j;  4M7A E;  5GMK e;  4C92 G;  4XTZ A;  4JLI A;  1MGQ A;  3BDU A;  4N0A C;  4XTU A;  5CAI A;  5GAO m;  4XTW A;  4M7A D;  3V7S A;  1LOJ A;  3JCM J;  4PJO F;  5GAN h;  2VXE A;  3VU3 C;  4EMG A;  4J6W A;  4M77 E;  3RES A;  4XQ3 A;  5GMK l;  4HA8 A;  3V8L A;  4M78 A;  3JCM f;  4A54 A;  3EFR A;  4M77 F;  5LJ5 d;  5GAN 5;  2EAY A;  5GAN 2;  4RCC A;  3SWN C;  3JB9 G;  3RKW A;  4WF2 A;  3JCM W;  5GAM d;  3RKX A;  4N0A A;  5LJ3 j;  1D3B A;  2RD1 A;  3QUI A;  3JB9 I;  1WPY A;  5GAN d;  4M7A F;  2E10 A;  2K57 A;  4M77 A;  3M4G A;  4J6X A;  4EMK B;  2CGH A;  5GAN 6;  5I21 A;  4M75 B;  4PJO A;  3SWN A;  4DQ2 A;  4M7D C;  3FB9 A;  1WQ7 A;  4EMK A;  3HSB A;  2FYK A;  3INZ A;  2EJF A;  1HXD A;  4F7U A;  2EJG A;  4QVC A;  5LJ3 e;  3JCM d;  2DVE A;  3FIF A;  3BW1 A;  4M75 F;  1WQW A;  4RCB A;  3HFN A;  3JB9 H;  5GAO p;  2RA2 A;  4M75 D;  4M7A B;  1N9R A;  5LJ3 h;  4M77 C;  4XU0 A;  5GAN 8;  5GAN j;  1H64 1;  2DTO A;  4XTV A;  3JCM X;  3RER A;  3BY7 A;  3QO3 A;  5GMK m;  4M7A A;  5GAN 3;  2RB6 A;  4EMK C;  2JN0 A;  5GAO n;  4PJO B;  4XTX A;  4M77 G; 
#chains in the Genus database with same CATH topology
 1UB4 A;  2NUZ A;  2DXT A;  1QKW A;  3L1A A;  2RI2 A;  4CI0 C;  3A8H B;  3QJ6 A;  2EYQ A;  2QTX A;  2DPP B;  5IN1 A;  2XG8 D;  1O9S A;  3PT9 A;  2DRK A;  1SRM A;  2HEQ A;  2RJF A;  2FPD A;  5DLO A;  3RBB B;  1ZX6 A;  1H3H A;  4WTO B;  3CXC S;  1IRX A;  2NUP A;  2CZ6 B;  4MZP A;  2CRE A;  4JRI A;  4M7D F;  3QZ9 B;  3CME A;  4DOW A;  2LJ3 A;  2CKK A;  2OI3 A;  2EGE A;  2A0F B;  4M78 G;  3GBQ A;  4C8Q C;  4NL2 A;  1VQN T;  3G71 A;  4E7H A;  1RAC B;  4QQG A;  3L2Q A;  1YIT A;  2YUN A;  3CCV T;  4LD6 A;  1YI2 T;  4RTW A;  4DBH A;  1AOJ A;  1VQ5 T;  4L59 A;  1TTH B;  2LX7 A;  5L8R E;  5LJ3 g;  1D1B A;  4DBQ A;  3UA6 A;  4JZ3 A;  2VB6 A;  1M1K C;  4IUU A;  2OTL A;  2RHZ A;  2YT6 A;  2KT1 A;  1RLP C;  4N4I A;  4FT2 A;  1VIF A;  4PKC C;  1RAH B;  5C6S A;  5KCH A;  2EBP A;  1RUW A;  1NEB A;  2JVV A;  3RKX A;  3OYA A;  2LT1 A;  4J6X A;  2DLP A;  5CQY A;  5DLQ E;  1BI2 A;  3OYB A;  1PC0 A;  1KQS S;  2FEI A;  4BDZ A;  4QVC A;  5LJ3 e;  5CO7 A;  3G71 T;  1V29 B;  2JMC A;  2ABL A;  2LQW A;  2P0P A;  3PMT A;  4E2F B;  3UF4 A;  4M75 D;  4UC4 A;  5CK9 A;  4M7A B;  5LJ3 h;  5KYU A;  4ATO A;  4FSX A;  1G3W A;  2FZG B;  3GLX A;  2PVO B;  3FJ5 A;  2MCN A;  4E7L A;  3LGL A;  4M77 G;  4C0G A;  3VS4 A;  4YTL A;  2OTJ Q;  3BE3 A;  3QSU A;  4BUG A;  3JCM P;  2CP5 A;  3CCS A;  5GAM g;  3OYM A;  5FRO A;  4EDU A;  2JW4 A;  3JCM c;  1TU0 B;  3OS2 A;  2EYW A;  4PL6 A;  4II1 A;  1YJN Q;  3FDR A;  1TS9 A;  4GBQ A;  5A2Q E;  3PFS A;  3P8H A;  1PNJ A;  4J9H A;  4Z02 A;  3LH5 A;  2BUD A;  5FU6 B;  3QWX X;  3ZBD A;  3NPF A;  2EIF A;  1LNX A;  3G71 Q;  2GQV A;  2VYT A;  1YWO A;  3WXM B;  2MOX A;  4ZGE B;  1K73 C;  2XU8 A;  2XDP A;  1JQQ A;  1SHG A;  4RTY A;  4ZN1 A;  3QWY A;  3CCE A;  2ZPG B;  4XU3 A;  5GAN 7;  2LNV A;  2M9U A;  5GAO q;  2C06 A;  3C12 A;  1OQK A;  1SPK A;  1Q82 R;  1K0S A;  1YFN A;  1LPL A;  1GFD A;  1RAD B;  1JRI A;  1KHC A;  1AEY A;  4ORZ A;  3JV3 A;  4PFO A;  1AZE A;  2K7A A;  1PHT A;  3PNW C;  5I2M A;  3CXC A;  2V1Q A;  3REA B;  1QVG S;  2CZ0 B;  5J39 A;  2YWW A;  4P5N A;  3OQ5 A;  1G83 A;  5CVI A;  2QQ9 A;  2ATC B;  3SDZ A;  1KC8 C;  1VQK T;  1I0C A;  4WF2 A;  2CSI A;  2RHY A;  2FRW A;  1WPY A;  4M7A F;  2E10 A;  4DA4 A;  1IGQ A;  5FU7 B;  4EMK A;  3NFC A;  3ZL7 C;  4L6V 5;  2QEX A;  3CC4 Q;  1JXO A;  1N9R A;  1MUZ A;  1R0C B;  1H64 1;  4IUP A;  1Q7Y C;  5FRM A;  2RHI A;  4DEX A;  1YIT Q;  1M1K R;  2Y4Y A;  3A8G B;  3O8V A;  1S72 T;  3MCA B;  1YJW A;  1AWO A;  4DEY A;  1VQP T;  1BBZ A;  1M27 C;  3OW2 A;  2K3B A;  2E6Z A;  3PTA A;  2DIL A;  2Y90 A;  3GOX A;  2RQU A;  2HL3 A;  3LW5 E;  3OMG A;  4HT9 A;  1WA7 A;  4V2S A;  2JXB A;  3SWN B;  2DJZ A;  2HBP A;  5KYY A;  5LJ5 g;  1YJN A;  3PIO A;  3SHW A;  4Z89 A;  1B07 A;  4F7U B;  4C8Q A;  3CCE T;  2RHX A;  1D1A A;  1VQ9 A;  4Z88 A;  3QJY A;  2K6D A;  4JJB A;  5KE3 A;  2E64 A;  4J9E A;  2J6F A;  4LDX A;  1HYO A;  2FO0 A;  4KGX B;  5EG2 A;  5HY6 A;  1BIA A;  4GY5 A;  3OS1 A;  1WXT A;  4OMQ A;  2CP0 A;  4IUT A;  4M7D B;  4A4F A;  2YRD A;  4N4H A;  4C8Q B;  3LGF A;  1MV0 B;  2F69 A;  1H92 A;  1JXM A;  5LJ5 e;  2BZ8 A;  4CC3 A;  1N8R R;  5GMK i;  1ZUY A;  1X01 A;  2YXY A;  1K76 A;  1WHL A;  2H8H A;  2C0I A;  2RI3 A;  3J81 E;  1UJY A;  3BDU A;  4M7A D;  4Y28 E;  1K8A R;  4C5G A;  2DNU A;  3MP8 A;  1YHQ T;  3RMS A;  1IHW A;  4IUR A;  3LH0 A;  2YRC A;  2QGF B;  3MEV A;  2XIC A;  2M0Y A;  3TEE A;  3VS3 A;  4EMK B;  4J9F A;  1M3B A;  3UA7 A;  1D0Z A;  1B7T A;  3KXT A;  2JZ2 A;  3VV0 A;  4D6W A;  5GAO p;  1MHN A;  2K9G A;  3E1S A;  4JRP A;  3VJP A;  1UDL A;  2HKN A;  1QCN A;  3OYN A;  4HKE A;  3G4S Q;  1ZLM A;  2YUP A;  4PJM A;  2FB7 A;  4ZN3 A;  2ECZ A;  3CD6 T;  2CP7 A;  2ED1 A;  1ZBX A;  2VGN A;  1WHG A;  1OOT A;  1G5V A;  3HFO A;  2DD4 A;  3EGD A;  1K73 R;  1ZSZ B;  1UEC A;  1N27 A;  1T0H A;  2J05 A;  3G4S T;  4MZT A;  1CKA A;  3OS5 A;  1QWF A;  2RI5 A;  3H8Z A;  1QLY A;  1GBR A;  1K4U S;  4CC4 B;  1RL2 A;  3TQ7 P;  3MEA A;  2PVD B;  1SG5 A;  1LJO A;  3CCL T;  4HCC A;  4FIB A;  1FWZ A;  4F04 B;  3EG0 A;  4QQ6 A;  4NL3 A;  1UGR B;  2H3J A;  2KXD A;  2QQS A;  1VQ4 Q;  1I5L A;  4PJO C;  2KVQ G;  4IUV A;  3HHT B;  3VS6 A;  4M7D A;  3V8J A;  2COZ A;  5CKB A;  1ACM B;  3G6E Q;  1YIJ T;  3G6E A;  1HK9 A;  2KT8 A;  1W4S A;  4J9D A;  5KH6 A;  2LRQ A;  1JO8 A;  3TRE A;  2KDS A;  3I55 Q;  2PVG B;  3CCV A;  1GBQ A;  4KT0 E;  3E19 A;  2XD0 A;  2XMF A;  4EIK A;  4C0F A;  1OPL A;  2RQR A;  1BKB A;  1VYV A;  4PJO F;  1M8M A;  3CCU T;  3RES A;  1X2K A;  2XDD A;  2D9T A;  3JCM W;  3HL8 A;  2DBM A;  1I1J A;  4N0A A;  3TVT A;  1WGS A;  4FYX B;  2PQW A;  3VUZ A;  1UGS B;  3JCM d;  1VQM Q;  2GTJ A;  3BW1 A;  2MF2 A;  1X27 A;  4RUG A;  4LN2 A;  3CMA T;  5CQX A;  1QKX A;  2K5L A;  5GAN 8;  4BDY A;  1D09 B;  4BI3 A;  1QQJ A;  3QO3 A;  3OW2 S;  3JB9 J;  3I56 T;  2EQJ A;  2DTH A;  2J6K A;  2HL5 C;  3AT1 B;  4M7A G;  4D8K A;  3ZFJ A;  3QHS A;  3SEM A;  3GNG A;  1Z9Q A;  1ZA1 B;  3CCM A;  4A4K A;  3OYH A;  1YN8 A;  2QTV A;  4HVV A;  4KUL A;  1C6V X;  2FG0 A;  4M75 C;  3WVE B;  2O9S A;  3EG9 B;  4QQD A;  3MPU B;  2MAM A;  6AT1 B;  1MV3 A;  5KCO A;  3UAT A;  2KBT A;  1Y71 A;  4M75 E;  1K73 U;  1I07 A;  3SD4 A;  2BE9 B;  2W10 A;  3CCM Q;  2NWM A;  3I55 A;  2QAZ A;  4X34 A;  2E3I A;  2L3Q A;  4MZM A;  2R58 A;  1OPK A;  1RI9 A;  5KYX B;  1W2B S;  3V7C A;  2EFI A;  4J9G A;  1AHJ B;  3GIB A;  1ZHI A;  2G6F X;  4XU1 A;  2GTO A;  2OTL Q;  3KBG A;  3SB2 A;  5GAM j;  5GMK e;  5GAO m;  3MP1 A;  2F2X A;  4CC7 A;  2K2V A;  1BI0 A;  2HAX A;  3CC7 Q;  2YSQ A;  5FWC A;  5ECA A;  4BE0 A;  2QEX Q;  2M16 A;  3OS0 A;  2EKO A;  1NM7 A;  2JMA A;  5IT9 E;  2O01 E;  2MMP A;  3M4G A;  5IH2 A;  2CGH A;  2PNI A;  2RMO A;  3VS5 A;  1UHC A;  1JJ2 P;  3G7Z A;  1F1B B;  4B9W A;  1VQM A;  1VQ8 Q;  3JB9 H;  4CRI A;  2XKO C;  4LE9 A;  3CCR Q;  2DL5 A;  3BY7 A;  4M7A A;  1W70 A;  5CKE A;  1UUE A;  4KBM B;  1Q86 U;  2ZPI B;  4KH0 B;  8AT1 B;  1WYX A;  5KYX A;  4F7U G;  3EG2 A;  4EPC A;  1ZUK A;  3O5Z A;  1JJ2 S;  3C95 A;  1Z9Z A;  2JJ9 A;  2QQA A;  3CCJ T;  1OU8 A;  2A3L A;  1WX6 A;  2X4W A;  2PUO B;  4ELZ C;  1U8R A;  2VAS A;  4BB7 A;  2JTF A;  1NPP A;  2V8I A;  1TUC A;  3DLM A;  3JCM g;  3ME9 A;  3RMQ A;  1M1K U;  3CC4 A;  2L3R A;  3NGP A;  1YCY A;  1VQ4 A;  1AT1 B;  4QVZ A;  1TXQ A;  3GF5 A;  3C4S A;  5GMK h;  2BTT A;  5HK0 A;  4E7K A;  1K8A U;  2GFA A;  2CH4 W;  2ZPF B;  1JU5 C;  4OB0 B;  4OVA A;  2CUB A;  4A4E A;  5LJ3 f;  1TG0 A;  2YUO A;  4B6M A;  1U1S A;  1BCM A;  2FRY A;  2L2P A;  5L23 A;  2KNB B;  2EYZ A;  1PCX A;  1ZA2 B;  1Q95 G;  3DLL A;  3PIP A;  1RAG B;  2DO3 A;  2DJQ A;  4M78 A;  2DXC A;  3RKW A;  1PD1 A;  1M4Z A;  3H41 A;  5LJ3 j;  1N6A A;  1W6X A;  2J6O A;  3G4S A;  2FPF A;  3ULR B;  2E12 A;  4M7D C;  2A37 A;  2X3W D;  2XHC A;  1WHH A;  2EJG A;  2ED0 A;  4RG2 A;  2DIQ A;  5D7U A;  1PM3 A;  4XTV A;  3CCR T;  4BY6 C;  3I5R A;  3OSV A;  3CC2 T;  4AFU C;  1VQ9 Q;  3WVD B;  2RQV A;  3CC4 T;  3CBM A;  1S72 A;  1BYM A;  1YIT T;  4QKU A;  1U3O A;  1EZZ B;  3VKI A;  3DKM A;  3QBY A;  2DEU A;  1E6H A;  1Y57 A;  2VC8 A;  3UT1 A;  1Q86 R;  1LCK A;  4XK8 E;  3VS1 A;  3M0P A;  4AG2 C;  4LUE A;  3RIR A;  2EWN A;  3OYI A;  1KHI A;  2MK5 A;  3EFO A;  4AFS C;  2D8J A;  2B8A A;  2GCX A;  4FM4 B;  4C0D C;  3OA6 A;  3OYE A;  2RHU A;  1VYT A;  4Y91 A;  3KFV A;  5CKF A;  4B9X A;  2HCK A;  1MNE A;  1YBY A;  3MP6 A;  1YJ9 A;  2DER A;  2QA4 T;  1K8A C;  1X6B A;  3OBY A;  4XTY A;  2HD0 A;  4VUB A;  4R55 A;  4M78 F;  5DM7 R;  2EKH A;  1W2B A;  3LX7 A;  1QP2 A;  4ZGD B;  4JLG A;  4JJD A;  3URG A;  4IIM A;  4XTU A;  4FW1 A;  2FPE A;  1JJ2 A;  1M2O A;  2B86 A;  2X4J A;  3M58 A;  1AZG B;  3VU3 C;  1Q81 R;  1Q82 C;  4FL6 A;  1FMW A;  3EFR A;  5LJ5 d;  2DBK A;  4DOV A;  3PVQ A;  1GXI E;  3VYH B;  1GCQ C;  1WJR A;  4HCZ A;  3H6Z A;  4PJO A;  1WHK A;  3QDF A;  1WJQ A;  1T3S A;  2EJF A;  3P8D A;  3REB B;  3H9N A;  3I56 A;  1VQK A;  1MMG A;  2DVE A;  3FIF A;  2OJ2 A;  2QDL A;  4OB3 B;  4BI4 A;  1W2B P;  1OZ3 A;  2V1R A;  1PRM C;  1Q86 C;  4M77 C;  4J7I A;  3CCR A;  4OMO A;  1QVF P;  4HXJ A;  4XTX A;  4HVU A;  2DX1 A;  5GAN 4;  2W0Z A;  1BIB A;  3X25 B;  4E7J A;  5LJ5 f;  2LCC A;  4ANJ A;  2A7Y A;  2ZCF B;  3EAE A;  5J26 A;  1X2Q A;  4DBR A;  7AT1 B;  2EW3 A;  2RJD A;  1DJ7 B;  1SSF A;  1KQ1 A;  5GAN g;  1VQ7 Q;  3FEO A;  1PKT A;  5CKD A;  2D8H A;  1YP5 A;  1VQO A;  1NEG A;  2DIG A;  5LJ5 h;  3CC2 A;  4F14 A;  4M75 G;  1KD1 C;  5GAN f;  1I5O B;  1UGQ B;  1SRL A;  2PTK A;  2WSE E;  4AFZ C;  3UPU A;  2QYZ A;  4PK4 A;  1JB0 E;  1EFN A;  1M1F A;  1PRL C;  4M77 D;  4CC2 A;  2RJC A;  2DM1 A;  4MML A;  3GP8 A;  1Y07 A;  2O88 A;  1Q81 C;  5C0M A;  2EPD A;  1VQ4 T;  1UEB A;  3OY9 A;  4PJO E;  2RQW A;  5GAO l;  4OF1 A;  4JS5 A;  4C92 G;  2JNG A;  4IIO A;  2EQM A;  1RAE B;  4KRT A;  3NTI A;  5GAN h;  4AG1 C;  2BE7 D;  4L5G A;  4EMG A;  1YI2 A;  1CKB A;  4OML A;  3CCU A;  4M77 F;  2HSP A;  3S3N A;  5GAM d;  2RD1 A;  1MND A;  2RO0 A;  2LNH B;  2COW A;  1BB9 A;  3E9G A;  2EYY A;  1G3S A;  1KIK A;  3MET A;  4JPB W;  2AIR B;  3OW2 P;  2J06 A;  3CEY A;  3JRZ A;  4PLI A;  3CC7 A;  3A8M B;  1VQ5 A;  4MDW A;  3RER A;  3X26 B;  5GAN 3;  2O9V A;  3QPH A;  3I9Q A;  3CME Q;  3CCE Q;  4MMK A;  5GAO r;  1BCO A;  2JTM A;  2QAS A;  3CPW A;  4C92 E;  4JRK A;  2YLC A;  2MYS A;  3QII A;  3C0C A;  1RI0 A;  1WZO A;  3FJP A;  1D1C A;  3MO8 A;  4X9C A;  1E7O A;  4M78 D;  1K9M R;  1OUL A;  2QXF A;  2DL7 A;  2ENM A;  2F1L A;  3BFM A;  4AMC A;  5AT1 B;  5FU7 C;  2LP5 A;  1QWE A;  1VQP Q;  1HSQ A;  3AHU A;  4LNP A;  4J5Y A;  4J83 A;  1TOV A;  3QDR B;  2AT1 B;  2LJ0 A;  1FYN A;  4R0K A;  2OTL T;  2AZS A;  1PSF A;  5DY9 A;  3JCM b;  5GAM h;  2QQB A;  2IG0 A;  3M57 A;  1VQL A;  2VGM A;  4PFP A;  2E3H A;  1PSE A;  4D8D A;  1NYF A;  2DKG A;  1M90 R;  4C8Q D;  4TVR A;  1NYG A;  5FW9 A;  3DB3 A;  1VQN A;  1OZ2 A;  1G3Y A;  2LJ1 A;  4LUD A;  4ESR A;  4N0A C;  2F5K A;  4KH1 B;  4DBF A;  2CP2 A;  1M3A A;  4HA8 A;  2IPO B;  2CT3 A;  1IB8 A;  2F2V A;  2P4T A;  2R57 A;  5GJW B;  2EAY A;  2QA4 A;  3JB9 I;  2X3X D;  1SKU B;  4M75 B;  4DQ2 A;  1WDX A;  2HKQ B;  1H8K A;  3CCL Q;  1HXD A;  1R8O B;  2D0Q B;  2L89 A;  4O6J A;  2RA2 A;  1Q82 U;  5IHN A;  1X43 A;  1OYX A;  2BZY A;  2K3Y A;  1ZSG A;  4EMK C;  4PJO B;  2CDT A;  2CH4 A;  2COY A;  2FL7 A;  1VQ6 A;  1M5Q 1;  4JZ4 A;  4HCK A;  1IHV A;  5LJ3 d;  3CCQ Q;  4Q5W A;  3TU4 K;  4J9C A;  1SF9 A;  4AT1 B;  1UE9 A;  2DD5 A;  2RPN A;  4BI8 B;  4E6R A;  3CC2 Q;  2GF7 A;  1UFF A;  3HRU A;  1GCQ A;  2M51 A;  5CKH A;  2OTJ T;  3VUB A;  1HJD A;  1KC8 R;  1YIJ A;  2RJE A;  3M0Q A;  1ZSZ C;  4J7F A;  1T0J A;  1U5S A;  1X6O A;  1QCO A;  3CPF A;  3CCQ A;  3ZEH A;  4OB1 B;  1M2V A;  3FLG A;  4C92 F;  2D0N A;  4A53 A;  2K5I A;  4M78 E;  3PMI A;  3HRT A;  4C92 B;  1WLP B;  4EMH A;  4M7D E;  3X20 B;  3M55 A;  3M0S A;  2KRS A;  2CUD A;  3M5A A;  2LCL A;  4NOY A;  2F2W A;  1Y0M A;  1KFZ A;  1M1G A;  1SSH A;  2AKL A;  2QI2 A;  2ROT A;  5CAI A;  2KI7 A;  1LVK A;  2KEA A;  3V7S A;  5CR2 A;  3LWI A;  1LOJ A;  3QYG B;  2I0N A;  2C0T A;  3S6W A;  3MEW A;  1VQ5 Q;  3QUI A;  4RMO A;  1TWB A;  1UJ0 A;  1N5Z A;  5GAN d;  2L3P A;  2LVM A;  3CCS T;  1FMV A;  1JEG A;  4LDW A;  2HSE B;  2K79 A;  2RK2 A;  4M75 F;  4E47 A;  3X24 B;  5GAN j;  1GRI A;  3ASK A;  2JN0 A;  3JCM Q;  1C0M A;  3V8K A;  5CIU A;  2RH2 A;  1W1F A;  3EG9 A;  3MJX A;  1B34 A;  4MDX A;  2L3S A;  1QVG P;  1UHF A;  1K1Z A;  4C8Q F;  4Z8A A;  3E9F A;  5D6X A;  2QK0 A;  4OMF B;  5J3B A;  4ZNX A;  1S72 Q;  4M7D G;  2E65 A;  2DZC A;  1V1C A;  8ATC B;  3EFS A;  2O4X A;  2MWO A;  3CD6 A;  4BE2 A;  3EGU A;  2DE0 X;  2J7I A;  4FU6 A;  1RLQ C;  2KSS A;  1RAF B;  3RUX A;  2EYX A;  1I8F A;  2KRN A;  2JUF A;  2LZ6 B;  4ELY C;  1AD5 A;  2LT4 A;  3L42 A;  3L2V A;  3NTH A;  2E5Q A;  2IIM A;  1G8X A;  2ZZD A;  2P0K A;  1KSW A;  1CSK A;  3RKY A;  2HNI A;  1HD3 A;  2ZGW A;  4F7U E;  2HDA A;  3EH2 A;  2HQX A;  1VQK Q;  1NJI C;  3H0F A;  1A0N B;  2KYM A;  2L5Q A;  4J6W A;  4LDV A;  4XQ3 A;  1OI1 A;  4LDY A;  1M30 A;  2C0O A;  1ZBJ A;  3QKJ A;  2MIO A;  4KGZ B;  4RCC A;  3JB9 G;  3HRS A;  5I22 A;  4OGE A;  4O5V A;  1MMD A;  3SWN A;  5KYY B;  3OYF A;  3INZ A;  4AFQ C;  2BKD N;  1KD1 R;  4F7U A;  3OYD A;  2DL4 A;  3L2W A;  2SEM A;  2KRM A;  1X6G A;  3JSC A;  2GNC A;  2VV5 A;  2RB6 A;  3S3M A;  5I2S A;  1YCS B;  3R6O A;  1D0X A;  1O75 A;  2YHT A;  1KQS A;  1KQ2 A;  2KR3 A;  2OAW A;  1Q7Y U;  3C94 A;  1BI1 A;  2P4R A;  3CBO A;  1WNL A;  1NJI U;  3CME T;  2KE9 A;  4ZGJ B;  3IQL A;  5AYF A;  3I56 Q;  5I11 A;  2IVW A;  3JAM E;  3EHR A;  1XOV A;  3RDV A;  3HKS A;  2L0A A;  1QVG A;  2DYB A;  2P0Q A;  2DFU A;  5GAN e;  4C5E A;  4GLK A;  5FWB A;  2DMO A;  4PNO A;  4KUI A;  1RAB B;  2X35 A;  2O31 A;  2WSF E;  1G2B A;  1K9A A;  3M0R A;  4GLM A;  2CYZ B;  1I4K 1;  1NZ9 A;  3EGX B;  1FX7 A;  3QZ5 B;  1QW1 A;  2AKK A;  2KYB A;  3OSS C;  3SFM A;  1Y96 A;  4IUQ A;  2K3X A;  4JUV A;  4WCI A;  4FYY B;  3OYC A;  1NLP C;  3M9Q A;  1QVF A;  4OMP A;  2AK5 A;  5GJV B;  3GPL A;  2X4Y A;  4C92 C;  1VQ6 T;  3EFO B;  4KGV B;  5GAM e;  4PJJ A;  2JTE A;  2PU9 B;  3VS0 A;  3EG1 A;  1QCF A;  4XTZ A;  1QMC A;  4IKF A;  2XID A;  2LDM A;  2LQK A;  2VXE A;  1YJ9 T;  1M3C A;  5GMK l;  1KJW A;  1R0B G;  4JS4 A;  4KUD K;  3JCM f;  4N4G A;  1VQ7 A;  3G6E T;  3EH1 A;  3S3O A;  2JM8 A;  2M02 A;  2QDY B;  3H0H A;  3M56 A;  5FU6 C;  3OMC A;  1OX8 A;  1RAA B;  3CC7 T;  2HBW A;  5HK3 A;  2K57 A;  2GFU A;  5GAN 6;  2RK1 A;  2BIV A;  1WQ7 A;  3FB9 A;  1NBE B;  1YWP A;  1BU1 A;  4HCB A;  2Y4X A;  4FW2 A;  1M90 U;  3OYL A;  3CQT A;  2CP3 A;  1VYU A;  4XU0 A;  2DTO A;  4JDS A;  3JCM X;  5KYN A;  2V26 A;  3DB4 A;  1UGV A;  3JCM h;  3OYY A;  1ZUU A;  4BD3 A;  2RN8 A;  2SRC A;  1IXD A;  2JOY A;  3J80 E;  2CZ1 B;  2HQE A;  3QG1 A;  2RM4 A;  5IAY A;  1I81 A;  4M78 C;  1XNI A;  4FYV B;  4C8Q G;  2R5A A;  4PJO G;  4X9D A;  2KQW A;  4A4H A;  4BY6 B;  1WXU A;  2RF0 A;  1OX9 A;  4OGC A;  1SEM A;  4ME7 A;  2I2L A;  4M4Z A;  2X4X A;  4BE1 A;  2EJ9 A;  3HP9 A;  5KE2 A;  2E70 A;  2VVK A;  5KYW A;  3CD6 Q;  1ABQ A;  1VQO Q;  3EGD B;  2QGG A;  2ZAE A;  1XQH A;  2V8J A;  4JJC A;  2O2O A;  2EQI A;  3M54 A;  4LDU A;  5FLX E;  1C1A A;  3JCM V;  2LC4 A;  1D0Y A;  1Y96 B;  3VS2 A;  4OB2 B;  4RTT A;  2CS7 A;  1KQS P;  1M90 C;  3G1J A;  3A5Z B;  2EQU A;  1KG1 A;  2DYI A;  4JJN K;  3H0I A;  2YRV A;  3I5S A;  4OP0 A;  1EX4 A;  1VQN Q;  5A0D A;  4C0Z A;  3T9N A;  4JLI A;  2EVR A;  4XTW A;  2X9H A;  4C5H A;  1KC8 U;  1WI7 A;  3EHQ A;  3CBP A;  2K2M A;  3P8B B;  1IO6 A;  4M77 E;  2HZY A;  4PJL A;  2OX7 A;  1GFC A;  3MEU A;  3TCJ A;  3M0U A;  3UDC A;  2ESW A;  2A36 A;  1FMK A;  4K11 A;  4RG8 A;  2QG9 B;  1VQO T;  2NLU A;  4BAC A;  1VQP A;  3I55 T;  3VS7 A;  4E7S A;  1WXB A;  5KYW B;  1VQ7 T;  4RCB A;  3I35 A;  2FHD A;  2P84 A;  4RTX A;  4R56 A;  2R5M A;  3R6N A;  5LJ5 j;  2VWF A;  2A28 A;  1D3B B;  1YJN T;  1EIF A;  4M75 A;  2DAQ A;  3CCJ Q;  2V8K A;  1WFW A;  1WJS A;  2KGT A;  1VQ9 T;  2DTI A;  1AWX A;  4PJO D;  1P92 A;  3CCQ T;  3A8O B;  2E4H A;  4F17 A;  3U23 A;  1NLO C;  1N8R C;  4NS5 A;  3MKD A;  3J7A F;  2LQN A;  4C5I A;  2KMT A;  4PLL A;  1VUB A;  1VQL T;  4LXC A;  3JB9 F;  1PWT A;  3PGG A;  2LTO A;  1T3L A;  3LLR A;  3CCS Q;  3D7S B;  1UG1 A;  1M8V A;  2XI9 A;  3L2U A;  4M77 B;  3GNF B;  2DXU A;  1TUG B;  4FT4 A;  2LX9 A;  1TH7 A;  4C92 A;  1X75 C;  2DRM A;  2E1H A;  3FC3 A;  3CCU Q;  5HCK A;  1YI2 Q;  4OMM A;  3OYK A;  3CPW S;  1J3T A;  3JB9 D;  1H3Z A;  5GMK j;  2K4Y A;  1VQ6 Q;  4QVD A;  1V76 A;  2JT4 A;  3X28 B;  1QVP A;  1TSF A;  1K9M C;  2KK4 A;  1ABO A;  1IZ6 A;  1Y7X A;  2EGC A;  4RKU E;  1E6G A;  1UGP B;  2CP6 A;  1M2V B;  2QQR A;  1WHJ A;  3V8L A;  3QXE B;  4RTU A;  1YIJ Q;  4A54 A;  5GAN 5;  5GAN 2;  1OEB A;  4XAX B;  3HTR A;  1FXX A;  3Q1J A;  4PFZ A;  3OYG A;  3NMZ C;  2LMJ A;  2ZPH B;  2HQH A;  4HVW A;  2O4X B;  4FCY A;  2DK3 A;  1QVF S;  5GAO n;  1QP3 A;  2FVU A;  2X51 A;  4F7U F;  2CSQ A;  4M7D D;  2NUP B;  1VQ8 A;  4JRQ A;  4XU2 A;  1Q81 U;  4RTZ A;  3EGX A;  3L2Z A;  1S1N A;  2F5T X;  5IXB A;  1U06 A;  5IXF A;  2Z0W A;  2BZX A;  2KY9 A;  1YJW Q;  2JM9 A;  1VOM A;  3OYJ A;  5LL6 S;  1M9S A;  1AWJ A;  1PD0 A;  4ZTJ A;  3CPW P;  2ZPE B;  4QW2 A;  2D6F A;  1KD1 U;  1ZQ1 A;  1UTI A;  2RQT A;  1N9S A;  4LD9 K;  5FRN A;  3E2U A;  2DL8 A;  3HPW A;  3CMA Q;  3NHN A;  4Y92 A;  2AHJ B;  2G3R A;  1SHF A;  1KK7 A;  3PE0 A;  2DVJ A;  3CCL A;  1NG2 A;  1Q7Y R;  4A63 B;  2VXF A;  1VA7 A;  3M59 A;  2PZ1 A;  2E41 A;  4J6Y A;  1NJI R;  2D1X A;  5KYU B;  2MI6 A;  3CCJ A;  3FRN A;  1BI3 A;  1YHQ A;  1YHQ Q;  2CZ7 B;  4M78 B;  5D6Y A;  2DZ9 A;  1TUD A;  3MHX A;  5HKC A;  1MGQ A;  3VRZ A;  3EG3 A;  1YJ9 Q;  3JCM J;  5D6W A;  1OU9 A;  3M0T A;  4J9I A;  1MMN A;  2LQ8 A;  1PKS A;  2GQI A;  3PVL A;  3OBW A;  2DA9 A;  4RTV A;  4PJN A;  3CCV Q;  3A1P A;  1XJW B;  2ROL A;  3LWH A;  1WIE A;  3M53 A;  1VQL Q;  1YNZ A;  1XTD A;  1WQW A;  2OAU A;  2E6N A;  3VYG A;  1X69 A;  2VUB A;  2A08 A;  2JS0 A;  3ER0 A;  5GMK m;  4C0D B;  2XK0 A;  2VKN A;  2L8D A;  3BDL A;  2NYS A;  3A8L B;  4J9B A;  3TSW A;  2YUQ A;  1MMA A;  3THK A;  5A0L A;  2YDL A;  2EGA A;  4C92 D;  4M7A C;  1B3Q A;  5CCA A;  9ATC B;  2ZPB B;  1ZSZ A;  4ZTF A;  4E7Z A;  3TSZ A;  3UWN A;  2WAC A;  2GGR A;  3JCM e;  2OTJ A;  3N5B B;  2XDB A;  1VQM T;  1YJW T;  2KAF A;  2DEQ A;  1VQ8 T;  3NTK A;  4FSS A;  1NE8 A;  2RNA A;  1JBM A;  1U1T A;  2FZK B;  2WSC E;  2H3E B;  1GL5 A;  1B34 B;  1WHM A;  2GBQ A;  1VIE A;  4QT7 A;  2YLB A;  5A0G A;  2E5K A;  4HT8 A;  1ARK A;  2QEX T;  5GAM f;  5EC7 A;  1IRE B;  2MWP A;  2KXC A;  2HMA A;  5IHI A;  2FZC B;  1GCP A;  3LYI A;  1R77 A;  2AZV A;  2MPX C;  1K9M U;  4C8Q E;  2NUT B;  2DXB A;  3V7R A;  1RAI B;  2KRO A;  4M7A E;  2PUK B;  1PG5 B;  3QYH B;  4E7I A;  3RNJ A;  2DET A;  3KUF A;  4OMN A;  2QA4 Q;  1K0X A;  3SWN C;  2JS2 A;  3L2R A;  1OV3 A;  1IGU A;  2DL3 A;  5IHK A;  1D3B A;  3CMA A;  1BK2 A;  2M1H A;  3M4Y A;  1N8R U;  2LCS A;  4M77 A;  1NPR A;  1AWW A;  5I21 A;  4FYW B;  1AVZ C;  3F70 A;  3HSB A;  2FYK A;  2K5F A;  2NUT A;  3CCM T;  4X1V A;  2CT4 A;  5M9O A;  4J8O A;  3CXC P;  3HFN A;  2DF6 A;  3RR6 A;  2M0O A;  3A98 A;  4F16 A;  1G3T A;  3VRY A;  2EQK A;  4A4G A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 3JCM h;  3OYY A;  3JB9 J;  4MMK A;  3I56 T;  1UB4 A;  2EQJ A;  4BD3 A;  5GAO r;  2DXT A;  3L1A A;  2JOY A;  2JTM A;  2DTH A;  2RI2 A;  3A8H B;  3QJ6 A;  4C92 E;  4CI0 C;  3J80 E;  2EYQ A;  2QTX A;  2DPP B;  4JRK A;  2XG8 D;  5IN1 A;  1O9S A;  2CZ1 B;  2HQE A;  2YLC A;  3PT9 A;  4M7A G;  3QII A;  3ZFJ A;  3QG1 A;  3QHS A;  1RI0 A;  2RM4 A;  3GNG A;  5IAY A;  1I81 A;  3FJP A;  1XNI A;  4M78 C;  3MO8 A;  4X9C A;  2R5A A;  2RJF A;  4PJO G;  4C8Q G;  5DLO A;  3CCM A;  4M78 D;  4X9D A;  4A4K A;  3CXC S;  2KQW A;  3OYH A;  4A4H A;  4BY6 B;  2QXF A;  4KUL A;  3BFM A;  4M75 C;  3WVE B;  2CZ6 B;  4OGC A;  4MZP A;  4ME7 A;  2I2L A;  4JRI A;  5FU7 C;  4M7D F;  3QZ9 B;  2X4X A;  3CME A;  4QQD A;  4BE1 A;  2MAM A;  5KCO A;  4DOW A;  2EJ9 A;  3HP9 A;  5KE2 A;  3AHU A;  2E70 A;  4J5Y A;  4J83 A;  1Y71 A;  2CKK A;  4M78 G;  4M75 E;  4C8Q C;  1K73 U;  3QDR B;  3SD4 A;  4NL2 A;  2OTL T;  1VQN T;  3G71 A;  4E7H A;  1XQH A;  1PSF A;  2V8J A;  4QQG A;  5DY9 A;  3M54 A;  4LDU A;  5FLX E;  3JCM b;  5GAM h;  3I55 A;  2QQB A;  4X34 A;  3L2Q A;  2IG0 A;  3M57 A;  1YIT A;  4MZM A;  3JCM V;  2LC4 A;  1VQL A;  2R58 A;  3CCV T;  1Y96 B;  2VGM A;  4OB2 B;  4LD6 A;  1YI2 T;  2CS7 A;  1PSE A;  1M90 C;  3A5Z B;  1VQ5 T;  2DKG A;  4L59 A;  1W2B S;  5L8R E;  2EQU A;  5LJ3 g;  1KG1 A;  4JJN K;  3V7C A;  4C8Q D;  2EFI A;  4TVR A;  2YRV A;  3DB3 A;  1AHJ B;  1M1K C;  4OP0 A;  3GIB A;  1ZHI A;  4IUU A;  1OZ2 A;  2OTL A;  1G3Y A;  2RHZ A;  4XU1 A;  1VQN A;  3KBG A;  3SB2 A;  5A0D A;  4C0Z A;  5GAM j;  3T9N A;  4N4I A;  5GMK e;  4JLI A;  4N0A C;  5GAO m;  2F5K A;  4FT2 A;  1VIF A;  3MP1 A;  4XTW A;  4C5H A;  4PKC C;  1KC8 U;  2K2V A;  1BI0 A;  3CBP A;  5C6S A;  3P8B B;  2HAX A;  5KCH A;  4M77 E;  4HA8 A;  4BE0 A;  3MEU A;  3TCJ A;  2M16 A;  2P4T A;  2R57 A;  3UDC A;  2EAY A;  3OS0 A;  2QA4 A;  2EKO A;  2JVV A;  3RKX A;  3JB9 I;  5IT9 E;  4RG8 A;  2O01 E;  3OYA A;  2LT1 A;  1VQO T;  2MMP A;  3M4G A;  4J6X A;  2NLU A;  5CQY A;  5DLQ E;  2CGH A;  1BI2 A;  3OYB A;  4BAC A;  4M75 B;  4DQ2 A;  1VQP A;  3I55 T;  1KQS S;  4BDZ A;  1HXD A;  3G7Z A;  4QVC A;  4B9W A;  1R8O B;  2D0Q B;  2L89 A;  5CO7 A;  5LJ3 e;  1V29 B;  4RCB A;  3G71 T;  2P0P A;  3PMT A;  1VQM A;  3JB9 H;  4O6J A;  2RA2 A;  1Q82 U;  4M75 D;  4UC4 A;  5CK9 A;  4M7A B;  5LJ3 h;  1OYX A;  4ATO A;  2K3Y A;  4FSX A;  1G3W A;  2FHD A;  2XKO C;  4CRI A;  3GLX A;  3BY7 A;  2R5M A;  4R56 A;  4M7A A;  4EMK C;  2PVO B;  5CKE A;  4PJO B;  4KBM B;  1Q86 U;  5LJ5 j;  3LGL A;  4M77 G;  2ZPI B;  4C0G A;  4YTL A;  4E7L A;  3QSU A;  3CPW A;  1D3B B;  2FL7 A;  1M5Q 1;  1YJN T;  1VQ6 A;  1EIF A;  4BUG A;  3JCM P;  5LJ3 d;  3TU4 K;  4Q5W A;  3CCS A;  4M75 A;  5GAM g;  5FRO A;  3OYM A;  4EDU A;  2DAQ A;  4F7U G;  2V8K A;  4EPC A;  1JJ2 S;  1WJS A;  1VQ9 T;  3JCM c;  3OS2 A;  2DD5 A;  3C95 A;  4II1 A;  4PL6 A;  2DTI A;  4BI8 B;  4PJO D;  1P92 A;  3CCQ T;  3A8O B;  2QQA A;  3CCJ T;  2A3L A;  2GF7 A;  3FDR A;  1N8R C;  3HRU A;  5CKH A;  4NS5 A;  5A2Q E;  3J7A F;  3PFS A;  2X4W A;  3VUB A;  2OTJ T;  4C5I A;  2KMT A;  3P8H A;  1VUB A;  4PLL A;  1VQL T;  2PUO B;  4ELZ C;  1YIJ A;  1U8R A;  2RJE A;  4Z02 A;  4BB7 A;  3JB9 F;  2JTF A;  1NPP A;  4J7F A;  3PGG A;  2LTO A;  1X6O A;  3LLR A;  2BUD A;  3CPF A;  2V8I A;  5FU6 B;  3CCQ A;  3ZEH A;  4OB1 B;  3FLG A;  4C92 F;  3ZBD A;  4A53 A;  2EIF A;  3DLM A;  2K5I A;  3JCM g;  1LNX A;  2XI9 A;  1M8V A;  3ME9 A;  4M78 E;  3RMQ A;  3L2U A;  1M1K U;  3PMI A;  2GQV A;  2L3R A;  3HRT A;  2VYT A;  1YCY A;  4M77 B;  3WXM B;  3GNF B;  2DXU A;  4C92 B;  1VQ4 A;  4FT4 A;  4QVZ A;  2LX9 A;  1TH7 A;  3GF5 A;  4ZGE B;  1K73 C;  3C4S A;  4C92 A;  1X75 C;  2XU8 A;  5GMK h;  2E1H A;  5HK0 A;  3FC3 A;  4E7K A;  2XDP A;  1K8A U;  4ZN1 A;  2GFA A;  4EMH A;  2ZPF B;  3X20 B;  2ZPG B;  3M55 A;  4XU3 A;  3CCE A;  5GAN 7;  4M7D E;  2LNV A;  4OB0 B;  2M9U A;  3M5A A;  5GAO q;  3C12 A;  2C06 A;  2LCL A;  3OYK A;  4OVA A;  3CPW S;  4A4E A;  3JB9 D;  5LJ3 f;  3OW2 S;  1JRI A;  1KHC A;  4NOY A;  1H3Z A;  1U1S A;  5GMK j;  1M1G A;  2K4Y A;  3PNW C;  5I2M A;  4QVD A;  2QI2 A;  3X28 B;  1QVP A;  3CXC A;  1K9M C;  2KK4 A;  5CAI A;  1IZ6 A;  1Y7X A;  1QVG S;  2CZ0 B;  5J39 A;  3V7S A;  5CR2 A;  3LWI A;  1LOJ A;  4RKU E;  1UGP B;  4P5N A;  3OQ5 A;  2QQR A;  3QYG B;  3DLL A;  3PIP A;  5CVI A;  3V8L A;  2QQ9 A;  2DO3 A;  3QXE B;  4M78 A;  3SDZ A;  3S6W A;  4A54 A;  1KC8 C;  1VQK T;  5GAN 5;  2DXC A;  5GAN 2;  3MEW A;  4WF2 A;  3RKW A;  1M4Z A;  2RHY A;  5LJ3 j;  1N6A A;  3QUI A;  4RMO A;  1WPY A;  5GAN d;  3G4S A;  4XAX B;  2E10 A;  4M7A F;  4DA4 A;  5FU7 B;  2LVM A;  2E12 A;  1FXX A;  3CCS T;  4M7D C;  4EMK A;  3Q1J A;  2XHC A;  3NFC A;  4LDW A;  2EJG A;  2RK2 A;  3OYG A;  4RG2 A;  2ZPH B;  4M75 F;  4E47 A;  2DIQ A;  4L6V 5;  2QEX A;  3X24 B;  1N9R A;  5GAN j;  1H64 1;  4IUP A;  1Q7Y C;  5FRM A;  4XTV A;  2O4X B;  2RHI A;  2Y4Y A;  2DK3 A;  3A8G B;  3ASK A;  3CCR T;  1QVF S;  2JN0 A;  5GAO n;  3O8V A;  1S72 T;  4BY6 C;  3OSV A;  3JCM Q;  3CC2 T;  3MCA B;  3WVD B;  1YJW A;  3CC4 T;  1QP3 A;  2FVU A;  3CBM A;  3V8K A;  1S72 A;  4F7U F;  4M7D D;  1YIT T;  1VQP T;  3OW2 A;  5CIU A;  1BYM A;  2E6Z A;  2RH2 A;  3VKI A;  1VQ8 A;  3DKM A;  1B34 A;  4XU2 A;  3PTA A;  4JRQ A;  1Q81 U;  4MDX A;  3QBY A;  2Y90 A;  3GOX A;  3LW5 E;  3L2Z A;  4C8Q F;  3OMG A;  2F5T X;  2VC8 A;  4HT9 A;  4V2S A;  3E9F A;  5D6X A;  3SWN B;  2DJZ A;  2HBP A;  1YJN A;  5LJ5 g;  3PIO A;  2KY9 A;  4OMF B;  5J3B A;  3UT1 A;  3OYJ A;  4XK8 E;  4F7U B;  5LL6 S;  1M9S A;  4C8Q A;  2E65 A;  4M7D G;  3CCE T;  2RHX A;  2DZC A;  4ZTJ A;  2ZPE B;  4QW2 A;  3RIR A;  1KD1 U;  1ZQ1 A;  3QJY A;  1VQ9 A;  2D6F A;  2EWN A;  5KE3 A;  1N9S A;  4LD9 K;  2E64 A;  3EFS A;  3OYI A;  5FRN A;  1KHI A;  2O4X A;  2MWO A;  3HPW A;  4BE2 A;  3CD6 A;  4LDX A;  2B8A A;  2AHJ B;  2GCX A;  4FM4 B;  2G3R A;  4C0D C;  3OA6 A;  3OYE A;  4FU6 A;  5EG2 A;  5HY6 A;  2KSS A;  1BIA A;  2RHU A;  4Y91 A;  3CCL A;  3RUX A;  5CKF A;  4GY5 A;  4B9X A;  3OS1 A;  1YBY A;  3MP6 A;  1I8F A;  3CC4 A;  1YJ9 A;  4IUT A;  4M7D B;  2QA4 T;  2JUF A;  4A4F A;  1K8A C;  2VXF A;  3OBY A;  4N4H A;  3M59 A;  4C8Q B;  4J6Y A;  2E41 A;  2F69 A;  2LT4 A;  3LGF A;  4XTY A;  4ELY C;  2MI6 A;  3L42 A;  2HD0 A;  3NTH A;  4VUB A;  3L2V A;  3CCJ A;  3FRN A;  4R55 A;  1BI3 A;  2E5Q A;  4M78 F;  1YHQ A;  5LJ5 e;  2ZZD A;  5DM7 R;  2CZ7 B;  4M78 B;  2P0K A;  5GMK i;  5D6Y A;  1X01 A;  2HNI A;  3RKY A;  2DZ9 A;  1W2B A;  3LX7 A;  1QP2 A;  2ZGW A;  4F7U E;  3MHX A;  4ZGD B;  4JLG A;  2HQX A;  2RI3 A;  3J81 E;  3URG A;  1MGQ A;  3BDU A;  4XTU A;  5HKC A;  1NJI C;  4M7A D;  3JCM J;  4Y28 E;  2X4J A;  3M58 A;  1JJ2 A;  2L5Q A;  5D6W A;  3VU3 C;  4J6W A;  4C5G A;  4LDV A;  4XQ3 A;  1OI1 A;  3MP8 A;  4LDY A;  1YHQ T;  3RMS A;  1Q82 C;  4IUR A;  4FL6 A;  3EFR A;  3LH0 A;  2LQ8 A;  5LJ5 d;  3QKJ A;  4RCC A;  4DOV A;  3OBW A;  3JB9 G;  3MEV A;  3HRS A;  1GXI E;  3VYH B;  4OGE A;  2XIC A;  1VQ7 T;  3TEE A;  4EMK B;  1WJR A;  4O5V A;  4HCZ A;  3H6Z A;  3SWN A;  3OYF A;  4PJO A;  1WJQ A;  3LWH A;  3M53 A;  3INZ A;  2EJF A;  2BKD N;  3P8D A;  3KXT A;  4F7U A;  3I56 A;  2JZ2 A;  1XTD A;  3VV0 A;  3OYD A;  2DVE A;  3FIF A;  3L2W A;  1VQK A;  4BI4 A;  3JSC A;  1WQW A;  4OB3 B;  4D6W A;  2OAU A;  1OZ3 A;  5GAO p;  1MHN A;  2E6N A;  3E1S A;  3VYG A;  4JRP A;  3VJP A;  1Q86 C;  4M77 C;  2VUB A;  4J7I A;  3CCR A;  5GMK m;  3ER0 A;  3OYN A;  2VV5 A;  2RB6 A;  3S3M A;  5I2S A;  4C0D B;  4HKE A;  2XK0 A;  3R6O A;  4XTX A;  2L8D A;  3BDL A;  2FB7 A;  4ZN3 A;  1O75 A;  2YHT A;  3A8L B;  5GAN 4;  1KQS A;  1BIB A;  1KQ2 A;  3CD6 T;  3X25 B;  4E7J A;  1Q7Y U;  1ZBX A;  2VGN A;  3C94 A;  5LJ5 f;  5A0L A;  1BI1 A;  3CBO A;  2LCC A;  3HFO A;  1WNL A;  2A7Y A;  4C92 D;  1G5V A;  2DD4 A;  4M7A C;  1NJI U;  2ZCF B;  3CME T;  3EAE A;  4ZGJ B;  5J26 A;  1N27 A;  5AYF A;  3G4S T;  5CCA A;  4MZT A;  2IVW A;  2ZPB B;  4ZTF A;  3OS5 A;  2RI5 A;  3H8Z A;  3JAM E;  1XOV A;  2RJD A;  3UWN A;  3HKS A;  1QVG A;  1DJ7 B;  1RL2 A;  2WAC A;  2OTJ A;  3JCM e;  3N5B B;  2XDB A;  2P0Q A;  3MEA A;  1VQM T;  1YJW T;  1SSF A;  2PVD B;  5GAN e;  2KAF A;  4C5E A;  2DEQ A;  1LJO A;  1KQ1 A;  5GAN g;  3CCL T;  4E7I A;  1VQ8 T;  4FIB A;  4HCC A;  3NTK A;  1FWZ A;  3FEO A;  1NE8 A;  4GLK A;  1JBM A;  1U1T A;  4PNO A;  4KUI A;  5CKD A;  2WSC E;  2X35 A;  1VQO A;  2DIG A;  2WSF E;  4QQ6 A;  5LJ5 h;  3CC2 A;  4M75 G;  4NL3 A;  1KD1 C;  1B34 B;  1UGR B;  5GAN f;  2H3J A;  1VIE A;  1UGQ B;  2CYZ B;  2QQS A;  2YLB A;  2WSE E;  1I5L A;  1I4K 1;  1NZ9 A;  1FX7 A;  3UPU A;  3QZ5 B;  5A0G A;  4HT8 A;  2KVQ G;  4IUV A;  1JB0 E;  1QW1 A;  3HHT B;  4M7D A;  4PJO C;  3V8J A;  2QEX T;  1M1F A;  5GAM f;  3OSS C;  5CKB A;  3SFM A;  1Y96 A;  4M77 D;  1IRE B;  2RJC A;  4IUQ A;  2K3X A;  2MWP A;  4JUV A;  3OYC A;  4MML A;  3GP8 A;  1YIJ T;  3G6E A;  1HK9 A;  1Y07 A;  3M9Q A;  1QVF A;  3LYI A;  1Q81 C;  5C0M A;  1VQ4 T;  3GPL A;  1W4S A;  1UEB A;  2X4Y A;  3OY9 A;  4C92 C;  5KH6 A;  1K9M U;  4PJO E;  4C8Q E;  1VQ6 T;  2LRQ A;  5GAO l;  3TRE A;  2KDS A;  4OF1 A;  5GAM e;  4JS5 A;  2PVG B;  3CCV A;  2PU9 B;  2DXB A;  3V7R A;  4KT0 E;  3E19 A;  2XD0 A;  4M7A E;  4C92 G;  4XTZ A;  4C0F A;  2JNG A;  2PUK B;  4IKF A;  1BKB A;  2EQM A;  2XID A;  2LDM A;  3QYH B;  4PJO F;  2LQK A;  2VXE A;  3NTI A;  4L5G A;  5GAN h;  4EMG A;  3CCU T;  1YI2 A;  3RES A;  1YJ9 T;  5GMK l;  4JS4 A;  3KUF A;  3CCU A;  4KUD K;  3JCM f;  4N4G A;  1VQ7 A;  4M77 F;  2XDD A;  3G6E T;  3S3O A;  2QDY B;  3SWN C;  2D9T A;  3M56 A;  5FU6 C;  3HL8 A;  3OMC A;  3L2R A;  5GAM d;  3JCM W;  3S3N A;  4N0A A;  3CMA A;  1D3B A;  2RD1 A;  3CC7 T;  5HK3 A;  2M1H A;  2RO0 A;  3M4Y A;  1N8R U;  2K57 A;  1NPR A;  4M77 A;  3E9G A;  2GFU A;  5GAN 6;  1WGS A;  2RK1 A;  1G3S A;  2PQW A;  3VUZ A;  3MET A;  5I21 A;  1UGS B;  2BIV A;  1WQ7 A;  3F70 A;  3FB9 A;  3HSB A;  2FYK A;  2K5F A;  4HCB A;  3CCM T;  2Y4X A;  5M9O A;  3JCM d;  3CEY A;  3BW1 A;  3JRZ A;  4J8O A;  3HFN A;  2MF2 A;  4PLI A;  3OYL A;  1M90 U;  3CC7 A;  3CMA T;  2M0O A;  5CQX A;  2K5L A;  4XU0 A;  5GAN 8;  3A8M B;  4BDY A;  4BI3 A;  2DTO A;  1VQ5 A;  4JDS A;  4MDW A;  3JCM X;  3RER A;  3X26 B;  3QO3 A;  5GAN 3;  1G3T A;  3DB4 A;  2EQK A;  4A4G A;  3QPH A;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...