4EMGA

Crystal structure of splsm3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
71
Chain Sequence
b'EPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTTIRKHYEMLFVRGDSVILIAPPRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm3
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 16
structure length 71
sequence length 85
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emgA00
2JN0A 4M78A 2HNIA 5LJ3h 4C92E 5GAOq 3VU3C 5GANf 5GAN4 2DZ9A 5LJ3d 4C92D 4M78F 5GANe 5GMKh 5GANg 5GAMf 2FB7A 3FIFA 4XTZA 3V8KA 2CGHA 3BFMA 1KQ1A 4PJOF 5GAMe 5GAMg 4XU1A 5LJ3j 3HFNA 5GAN8 4M7DG 4C8QD 4PJOD 4F7UF 2RD1A 3JCMd 4M7AE 3QUIA 5GMKj 2DKGA 3INZA 4RCCA 4M7DC 3BDUA 1Y96B 2DVEA 4M75E 4N0AA 4M77F 4PNOA 3QSUA 5LJ5f 4M75D 4OP0A 4M77D 3JCMb 2YHTA 5LJ5e 2DXUA 2RA2A 2E41A 2E1HA 2VXEA 1D3BB 4RCBA 4C92A 1H641 2RB6A 2EAYA 4XTVA 3JCMc 4PJOG 3GIBA 3BW1A 3RKXA 4C8QG 4C92F 1U1TA 3JB9F 4F7UG 4PJOA 4C8QA 3JB9D 3EFRA 4XTXA 4A54A 4M78C 4F7UA 5GAN6 5LJ3g 4M7DB 4EMHA 4C8QF 2DTIA 4XU0A 3V7CA 2VXFA 3FB9A 2E64A 4M77G 3SWNA 3JCMf 3JCMJ 1KQ2A 4M7AF 1M8VA 3JCMg 3QO3A 3JCMV 2DZCA 3QHSA 4M77A 3RESA 1WQ7A 4J6XA 4M7AD 1B34B 1LOJA 3L1AA 3RKYA 4WF2A 3JB9J 5GMKi 4M75F 3RUXA 5GAN3 4X9CA 1BIAA 5GANh 1I5LA 2VC8A 3JCMW 3M4GA 4N0AC 5GAMh 4M78B 2DTOA 4C92G 5GANd 3JB9G 2ZGWA 4XU3A 4NOYA 5GAMd 2EJGA 2YLCA 4QVDA 5GANj 5DY9A 3RERA 3FJPA 2DXTA 4C92C 5GAMj 1WQWA 5LJ3f 5GAOl 1N9RA 5LJ3e 4M7AG 1YCYA 3JB9H 4PJOC 5GMKl 4M7DE 4C8QC 1TH7A 3JCMX 5LJ5h 4M7AA 4M77B 2E65A 4EMKA 5GMKe 4M7DD 2DEQA 4M75G 4DQ2A 4X9DA 3AHUA 5LJ5d 3V7SA 3PGGA 1BIBA 4M75A 3RIRA 3JCMe 4V2SA 3JCMP 3SWNC 3EFSA 5LJ5j 3BY7A 1HXDA 4M75C 1WNLA 2FYKA 4JUVA 1N9SA 4M77C 4XQ3A 3SB2A 3V8JA 1U1SA 3V8LA 4C92B 4EMGA 3L2ZA 4QVCA 1LNXA 5GAN7 5GAOp 1I81A 5GAOr 4JRKA 1D3BA 2EWNA 2QTXA 2DTHA 4M78E 2DJZA 1LJOA 1HK9A 4MMLA 4Y91A 1WPYA 3JCMQ 4NL2A 2RM4A 4C8QB 4JLIA 4PJOB 4M78D 4NL3A 4PJOE 4C8QE 4F7UB 3HSBA 3JCMh 4F7UE 5GAOn 1I8FA 4XU2A 5CAIA 4M7AB 3V7RA 5GAN2 5GAN5 4EMKB 4M7DA 4JRIA 4J6WA 1JRIA 1JBMA 3SWNB 3JB9I 5I21A 2EJ9A 4J6YA 4M75B 3RKWA 4M7DF 4HA8A 2E10A 1M5Q1 4M78G 2K57A 3HFOA 4M77E 4MMKA 4HT8A 4XTWA 1MGQA 5GAOm 4XTYA 1I4K1 4M7AC 4EMKC 1B34A 1X01A 2I2LA 1Y96A 4A53A 5GMKm 5LJ5g 4HT9A 4J5YA 2Y90A 4XTUA 2EJFA 2YLBA
chains in the Genus database with same CATH superfamily
4PFOA 3CMAT 3LYIA 2K3XA 4LDXA 5CKEA 1VQ4T 4BI8B 2KSSA 1VYUA 4RKUE 1YIJA 3EGXA 2O4XB 1M1KC 1VA7A 2GNCA 4CC7A 3INZA 1M2VA 5AT1B 3OYYA 1GCQC 2HSEB 4HXJA 5KYUB 3G7ZA 3VV0A 2DFUA 4NS5A 1K73C 5LJ5e 3A5ZB 3OYKA 3H0IA 2ATCB 2VYTA 4FL6A 3J7AF 3HRSA 5D6YA 4C8QA 4XTXA 1KD1C 1W2BP 1FXXA 1Y57A 5J3BA 2ABLA 2AK5A 5GAN6 1SPKA 1P92A 2DL7A 3FEOA 4KGZB 5GJVB 3JCMf 1LCKA 3OYEA 3JCMV 2KY9A 3CCLQ 2QA4Q 4IUQA 1OI1A 2DL4A 3JB9G 4ZNXA 1UDLA 3H6ZA 3EGDB 3JAME 2YLCA 3CCLT 2QA4T 2EQKA 4A4GA 2X9HA 5EC7A 1YCYA 1VQ6Q 4M7DE 5KYWB 7AT1B 4IUVA 5GMKe 4JS5A 3META 2KI7A 3AHUA 4FYYB 1AOJA 2JM8A 1B07A 4FYWB 3L2VA 4KRTA 2D0NA 4KH0B 2FYKA 4XQ3A 1VQ6T 1YBYA 1U1SA 3OBWA 4E7HA 2M0OA 3L2ZA 3CPFA 2GGRA 4OF1A 2MPXC 4PJOB 4PJOE 4M78D 4NL3A 3TQ7P 1UJYA 2RI5A 2ZCFB 4MDXA 2K79A 5IT9E 4BACA 3ZL7C 2LX7A 1BYMA 4M7DF 4J7FA 2XIDA 1G3TA 4R55A 4XTYA 3PE0A 2X4YA 1B7TA 5KCHA 3QIIA 3HRTA 5CKFA 4CI0C 1YWOA 4C92E 2GBQA 1Q82C 1RAEB 5LJ3d 2A0FB 3FIFA 3E9FA 2VV5A 4PJOF 4XU1A 2OJ2A 1UJ0A 4C5HA 2JTEA 3LGFA 2DKGA 1QVFA 3BDUA 3VS2A 1QLYA 2CZ7B 2C0OA 3JCMb 4BDZA 5M9OA 4ORZA 2HBWA 3MJXA 5CIUA 4C92F 3M4YA 1NYFA 2DYIA 4JRPA 2DEUA 3D7SB 1ZSZC 4RTTA 2K7AA 2HCKA 2CP6A 3V7CA 1D0XA 1KQ2A 2K5IA 2DZCA 2KGTA 4PFZA 1XOVA 2H8HA 2X3XD 3QKJA 4J9GA 3C95A 3CC4A 2VC8A 5GAMh 2QDLA 2O01E 5D6XA 4FW1A 2KRNA 2EJGA 2J7IA 4JRQA 2MOXA 1NJIR 1TOVA 2EW3A 2EYXA 2LVMA 4PJNA 5LJ3e 2RMOA 1OYXA 1EZZB 3VS1A 4V2SA 1TG0A 3CC7Q 3MCAB 2DLPA 3LH5A 2YDLA 2LDMA 1MV0B 2YWWA 1BB9A 3I5SA 3OBYA 1X6GA 4M7DA 3CC7T 4JRIA 2QQRA 3CEYA 3SWNB 2L8DA 1ZBJA 4HA8A 4M77E 3PMIA 1M3AA 3E1SA 3UT1A 1ZQ1A 1LVKA 3CC2Q 3I55Q 2C0TA 4QQGA 3LLRA 3KUFA 1WDXA 3RNJA 1YI2Q 3M59A 1X75C 2H3EB 2XDPA 2EQMA 4N4HA 3C94A 5GAMf 2KT1A 2L3SA 4HVVA 3CC2T 3I55T 1U5SA 1MMAA 2ZPFB 1HJDA 2A37A 1PC0A 3PVLA 1GCQA 1YI2T 5I11A 2ZAEA 3OMGA 1C0MA 3CCSQ 3WVEB 4DBHA 2E3HA 2JUFA 4M77F 4ANJA 3BE3A 3CMEQ 4E7JA 2A28A 3H9NA 2J06A 2VXEA 3JV3A 1QP3A 4C92A 3VYGA 3CCST 2P4RA 4JJNK 3JB9D 3EFRA 2E12A 3CMET 1PNJA 2ROTA 1KQSP 2RQWA 1SRLA 3H0FA 8AT1B 4PJJA 1XQHA 2HKNA 1MUZA 2X35A 1N5ZA 3VS3A 5CCAA 2A3LA 1BIAA 1MMNA 2AZVA 1YCSB 2DA9A 3I56A 2FZKB 3JCMW 3L2RA 2ZGWA 2AZSA 2PVGB 5HK0A 1Q95G 2KEAA 5GAMj 2D9TA 4E7IA 5I2SA 2KK4A 1PHTA 1ZA2B 2E5QA 1JB0E 1JO8A 3SDZA 2M9UA 2XK0A 1JJ2P 2LQWA 2E6NA 2CZ1B 3EG9A 2QAZA 2XU8A 1WHHA 2XDDA 5CKDA 1BI2A 2LJ0A 3OY9A 3A98A 1LJOA 4Y91A 1UGRB 4KULA 2EGAA 2VVKA 1K9MU 3HSBA 5IHIA 2LQKA 4PLLA 4A63B 2NWMA 1ZLMA 2EQUA 1UB4A 2WSFE 1UE9A 1VQ5A 4MMKA 1SHFA 1VQ8Q 5KYYB 1ZSGA 1RLPC 5FU7C 2CP0A 1U8RA 2DL8A 2K5LA 5IXFA 3S6WA 2DF6A 1WJRA 1VQ8T 3I56Q 2LRQA 3BFMA 3HRUA 2O88A 4BY6B 3GLXA 3E9GA 4D8KA 1PKSA 3QUIA 2MI6A 3J81E 4HCCA 1K9MC 1NM7A 3CCRA 2CH4W 1WJSA 3L2WA 4L5GA 3I56T 2EBPA 3QSUA 3OW2A 1WYXA 3M0RA 3OB9A 3VS4A 5AYFA 1D3BB 2DO3A 1OQKA 1H641 2RB6A 2F5TX 1M9SA 4F7UG 2JVVA 4EDUA 2DE0X 2DTIA 3MPUB 3CD6A 1M4ZA 2EFIA 2NUPA 2DMOA 1RADB 3QYGB 2EKOA 4C0ZA 1UHCA 4E2FB 1VQPA 1KG1A 3A8LB 2HSPA 1KC8U 1VQ5Q 2QXFA 3GNGA 4IUPA 1BCOA 4KUDK 1WIEA 3EG0A 1YHQA 2FHDA 4FYVB 2ZPGB 3RERA 2A08A 1KHIA 1VQ5T 1Z9QA 4C8QC 2V8JA 3J80E 4M7AA 4ME7A 2DEQA 1OZ2A 2HEQA 1JJ2S 3X28B 2E4HA 4F16A 2EGEA 4JUVA 1TTHB 5KYXA 3OYNA 3VS5A 1SG5A 4JLGA 2B86A 3QWYA 4C5EA 4AMCA 1KC8C 3ZEHA 5GAOn 2V26A 1ABOA 4P5NA 5LL6S 3V7RA 1O9SA 1D09B 3GNFB 4BDYA 2M16A 1JBMA 2KRMA 2A36A 2MCNA 2DERA 1AWOA 2PTKA 4XTWA 2DIGA 4RTWA 1B34A 3N5BB 2RO0A 4E7LA 1J3TA 4J5YA 4FYXB 5IHNA 2QQ9A 5A0GA 4E7ZA 2P0QA 1OX8A 3OA6A 1VQPQ 2K3BA 1YFNA 1YHQQ 1VQPT 2AKKA 2DD5A 2K4YA 3OYDA 4N0AA 5CKBA 2YUOA 2YHTA 3MEAA 1PD1A 3X26B 1YHQT 1X27A 1E7OA 4C8QG 4DEYA 1BBZA 4EMHA 1PRLC 2D6FA 1QVFP 4XU0A 4BE1A 2VXFA 3FB9A 4ELYC 4PFPA 5CQXA 2KVQG 3WVDB 2JTMA 2G6FX 2DL5A 5GANh 1C1AA 2CSQA 2MAMA 4PK4A 4M78B 2X51A 1BCMA 2RN8A 2HMAA 1WQWA 4C0DC 2NUTA 3CMAA 5C6SA 2FZGB 1TH7A 3DKMA 1HD3A 5DLQE 2OI3A 1VQ4A 5FW9A 1X43A 1Q81R 4DOVA 3V7SA 3ZFJA 2IPOB 1BIBA 2CP7A 4X34A 5L23A 1VQOA 2L3QA 1WNLA 1N9SA 1MHNA 1IZ6A 4KGVB 1HK9A 4MMLA 4OGCA 3C0CA 1QVGA 4ZTFA 1D0YA 3M54A 2KBTA 1NE8A 4J6WA 1Q7YU 4J6YA 1JEGA 3RKWA 2CT3A 3UATA 4TVRA 2CP5A 1UHFA 3EH2A 1U06A 1XTDA 1UEBA 4LDWA 5J26A 2DL3A 5GANf 2EQIA 1BI3A 3QZ5B 1TUCA 1WXUA 2HAXA 2VUBA 1C6VX 3CCLA 2YUPA 4IUTA 2QA4A 1M8MA 1H3HA 2LC4A 4OMMA 2QQBA 2JNGA 3I35A 1X69A 4M7DC 3EFOA 4M75E 2DVEA 4KH1B 3OYCA 3QDRB 1Q7YC 2V1RA 2YUQA 1VQMQ 5CR2A 1UFFA 3JCMc 2GCXA 3URGA 3BW1A 1VQOQ 1VQ6A 1IREB 1HYOA 4K11A 4RG2A 4II1A 1QWFA 3PTAA 1VQMT 3CPWP 3M0SA 2XHCA 3P8HA 1WXTA 1VQOT 4R0KA 3EG1A 3FC3A 3SD4A 4RTZA 2O2OA 2BUDA 4M75F 1WJQA 4X9CA 3CCMQ 1NG2A 2PUKB 3VKIA 4C0DB 2DTOA 1F1BB 3KBGA 2M02A 9ATCB 3M58A 2DM1A 3PVQA 5GANj 3CCQQ 3FJPA 4L59A 4C92C 1UGQB 2EPDA 2DRKA 5I2MA 3CCMT 1OU9A 2C0IA 4O5VA 4X9DA 3NTIA 2YRCA 2HQEA 3M56A 3CCQT 1ZX6A 1Q86R 2M1HA 2COWA 3S3OA 5IAYA 2NYSA 3GP8A 2M0YA 5HCKA 5FWBA 1SF9A 1NEBA 2RJDA 2RHIA 3QJ6A 5CAIA 1WHJA 1X2KA 2LQNA 1VQLQ 4OMOA 1M1KR 3EG3A 2GFAA 1IB8A 2L3RA 1UTIA 1IXDA 3X24B 2KDSA 3CCEQ 2CYZB 1Y96A 1Q82U 1IGQA 4IUUA 1WXBA 3OS5A 1VYVA 4VUBA 1SSHA 1D0ZA 1Y0MA 2IVWA 4MZTA 3QG1A 2KMTA 4XTZA 3CCET 1KD1R 2LT1A 4C8QD 2X3WD 3ER0A 1AZEA 3KXTA 2K6DA 5CK9A 3CXCA 1YJ9Q 1TSFA 3GIBA 3JB9F 2C06A 2FPFA 5A0DA 1VQKQ 1N6AA 1QVPA 1YJ9T 3OW2P 3CC7A 1WQ7A 4IKFA 1S72Q 3A8HB 1HSQA 1M90U 1WA7A 1VQKT 4LNPA 2DBKA 2GTJA 1WHMA 1S72T 2YT6A 4A4FA 4LN2A 1W2BS 3ASKA 4ELZC 2MYSA 5LJ5h 1UGVA 1V1CA 3CC2A 3P8BB 4N4IA 4A4KA 3CCJA 3I55A 1N8RU 4DBQA 4CRIA 1YI2A 4KT0E 2V8IA 2RNAA 5KYNA 1YITA 5FU6C 3KFVA 2EYZA 1M90C 2BTTA 2KROA 3Q1JA 3QDFA 1FMWA 3CCSA 1VQ7A 1SSFA 2QGFB 1UGPB 3GF5A 4X1VA 3CMEA 2EIFA 2EJ9A 1TUGB 2H3JA 2W10A 4HT8A 3OMCA 3OYAA 4M7AC 3EG9B 3PT9A 3H41A 1BK2A 4J9EA 3VYHB 1ACMB 5GMKm 1KJWA 1K8AU 1GBRA 1N8RC 1T0JA 3OS1A 5CO7A 5GMKh 3A8MB 2FB7A 2AHJB 2RI2A 1E6HA 1YN8A 2JS2A 5KYWA 2LZ6B 3RMQA 5LJ5f 1RAHB 1YNZA 2HDAA 1NLPC 1AD5A 3CCJQ 2E1HA 4JJBA 1MV3A 4M4ZA 2RQRA 1U1TA 4PJOA 3TREA 4OB2B 4WTOB 1K8AC 3G71Q 4LD9K 2SRCA 3RBBB 4J9HA 2D1XA 1YITQ 2HBPA 1G3YA 3CCJT 1GFCA 2CREA 3JCMJ 1D1AA 1NZ9A 3JCMg 1I07A 3I5RA 1VQ7Q 3JB9J 3G71T 1G8XA 4HVWA 3LW5E 5GAN3 1YITT 5CVIA 4N0AC 2XKOC 3VS6A 4LDUA 2O9SA 1W6XA 1ZSZB 1MMGA 2LCSA 2EKHA 3MHXA 1RAFB 5KE3A 2R58A 1VQ7T 1OPLA 2FZCB 2MWOA 1OX9A 3I9QA 4CC3A 4M7AG 4J9DA 2KRSA 2NUPB 2F2VA 3MP1A 3OYGA 1VQ8A 2HQHA 4EMKA 3PNWC 4M7DD 2DXCA 5EG2A 4B9WA 1A0NB 3PGGA 4BUGA 5FLXE 5FU6B 4UC4A 2E5KA 5LJ5j 2R5AA 1QCNA 4HKEA 1AT1B 3V8LA 1RUWA 4PL6A 3JCMQ 2PU9B 2GQVA 3TSZA 1TUDA 4OMNA 1W2BA 4M7AB 1SKUB 2I0NA 1RAGB 3VS0A 1OULA 2CH4A 4JPBW 1MMDA 4GLKA 1NBEB 2OX7A 2JOYA 1IHWA 2FRWA 1M3CA 5LJ3h 2QI2A 3M0PA 2LJ3A 3RMSA 1QVGP 2CKKA 2JS0A 2V1QA 4LUDA 4C92D 3OYHA 2PNIA 2FVUA 3TCJA 5GMKj 2JT4A 3QYHB 2Z0WA 2LQ8A 2DXUA 4RUGA 2ECZA 4XAXB 1W4SA 2ZZDA 4L6V5 4FT2A 4LD6A 4C0FA 3X25B 1M30A 3MKDA 2KXCA 2DYBA 3JRZA 4LE9A 3UDCA 3SWNA 4OMQA 3QWXX 4M77A 1LOJA 3SHWA 4FW2A 2KE9A 2X4XA 1I5LA 1PRMC 1PSFA 4YTLA 3NGPA 4OMPA 2QK0A 4MDWA 1LPLA 5LJ3f 3UWNA 1KQSS 2D8HA 2LT4A 1JU5C 4BI4A 2R57A 3RIRA 5DM7R 1PKTA 4AFZC 2XD0A 1H92A 1O75A 2QEXA 1FMVA 4QVCA 1LNXA 1OZ3A 3DB4A 4C5GA 1QQJA 1AVZC 3QZ9B 4F7UB 1Y07A 5IN1A 3SEMA 4F7UE 2JZ2A 2LCCA 4MZPA 1G3WA 2ED0A 2K5FA 1K9MR 1MGQA 1RABB 5LJ5g 2RI3A 4CC2A 5ECAA 2Y90A 4HVUA 2MWPA 5J39A 4J8OA 2HNIA 2X4WA 2J6KA 2DAQA 2LJ1A 1N27A 4OMFB 3V8KA 5GAMg 5LJ3j 4F7UF 2EGCA 1G83A 3NHNA 3WXMB 4IIMA 1EIFA 1M27C 5FU7B 3L2UA 3OYIA 3FDRA 5IHKA 5CQYA 2RJCA 1GBQA 4RCBA 2EAYA 4GY5A 3TEEA 1T3LA 1BKBA 2ESWA 3RKXA 3NTKA 2QEXQ 4A54A 1FYNA 1TS9A 3OYFA 1EX4A 1V29B 3G1JA 3JSCA 3M57A 2DVJA 2X4JA 2JM9A 2VWFA 3PIOA 1M1GA 5FRNA 1KFZA 1RL2A 4AG2C 2RQTA 4M7AD 1R8OB 2QEXT 4WCIA 1KHCA 3RUXA 3VUBA 2DPPB 1I1JA 3OYLA 1WHLA 1ZBXA 2DXTA 1AWXA 3GOXA 2O9VA 4BI3A 2AIRB 3EGXB 2J6FA 1RI0A 5GMKl 1Q81C 1M2VB 4KGXB 4ZN3A 2YRVA 1OV3A 1UUEA 1ZUUA 2K2VA 2W0ZA 1YJWA 4ZGEB 4M75C 4E7KA 1K9AA 3EGUA 5GAOp 1PSEA 2LCLA 1D3BA 1W70A 5HY6A 4M78E 3ULRB 4C8QB 4C8QE 1UG1A 4IURA 2K3YA 4C0GA 2ZPEB 3OSSC 4RTUA 4JDSA 3TSWA 4JZ4A 1PM3A 4OB1B 4R56A 3OQ5A 1AWJA 2VB6A 1VQMA 2D8JA 1RACB 5FRMA 1OU8A 4PJLA 4Z8AA 4XTUA 2FPEA 2P0KA 3CBOA 2VASA 4AFSC 4IIOA 4M78F 3LWIA 4PKCC 2GF7A 2O31A 1GXIE 1H8KA 3A1PA 1BU1A 5I22A 2ZPHB 1V76A 3CCMA 1Y96B 1UECA 2PVDB 2JW4A 2EYQA 2BE7D 3DLLA 2FL7A 2FEIA 1JJ2A 1GCPA 5GJWB 3CCQA 2E41A 1QW1A 1YJWQ 1Y7XA 5D7UA 2RJEA 5LJ3g 4QVZA 3R6NA 2LTOA 1YJWT 2DJQA 3HPWA 2OTLQ 3FJ5A 4J7IA 4OMLA 4J9IA 2DNUA 3THKA 5GAMd 3HL8A 1VQLA 3MP8A 1VQ9Q 2OTLT 1Z9ZA 4PJOC 3M5AA 2DILA 1QVFS 1NEGA 3CCEA 2E65A 2BZ8A 3OYBA 1E6GA 3O5ZA 2PVOB 2D0QB 2RJFA 2AKLA 3EFSA 1VQ9T 1XJWB 2HL5C 4CC4B 1AEYA 5GAN7 1CKBA 3SFMA 4NL2A 5D6WA 3G6EQ 4XU2A 3G4SQ 2RK1A 2CZ0B 2P4TA 3JB9I 1FX7A 5C0MA 3C4SA 2RF0A 4KUIA 4C5IA 1AWWA 4EMKC 2RHUA 3G6ET 4Z88A 3G4ST 2E3IA 1YJ9A 1Q7YR 4F04B 1W1FA 4M78A 1NPRA 2RK2A 3AT1B 1VQKA 2P84A 2F1LA 3E19A 2KXDA 2IIMA 5GAMe 4FT4A 4M7DG 1VQNQ 2RPNA 3TVTA 1S72A 1ZA1B 2L89A 4OGEA 2EYYA 4ZTJA 2ENMA 1VQNT 2RHYA 1K73R 2DIQA 5HKCA 2RQVA 1VQLT 2L5QA 4PJOG 2BZXA 2PZ1A 1PD0A 1X6BA 2WSCE 3M0QA 1VIEA 4M7DB 3PIPA 2DETA 1IRXA 3NMZC 3E2UA 4N4GA 2E64A 1QCOA 4FSSA 3RESA 1YIJQ 4JJDA 3L1AA 3HKSA 1NJIU 2CS7A 1VOMA 4C92G 4BD3A 5FWCA 4NOYA 2SEMA 1WGSA 3S3NA 1YIJT 4QVDA 1WFWA 2GTOA 3MEVA 1N9RA 4RTXA 1IGUA 2A7YA 4ESRA 3CPWS 1DJ7B 4J83A 2KYMA 4DQ2A 5IH2A 1ARKA 4M75A 1NPPA 4B6MA 1R77A 1VIFA 3VS7A 3SWNC 2KNBB 1TXQA 3BY7A 1HXDA 4M77C 3SB2A 1KSWA 3OYJA 3V8JA 1RI9A 4C92B 1JQQA 3CQTA 4HCZA 1CKAA 2RM4A 1NJIC 2NLUA 4AFUC 1I8FA 4EMKB 1UGSB 1AZGB 4DOWA 2O4XA 1M2OA 2RHZA 2E10A 1M5Q1 2K57A 3BDLA 4J9BA 2F2XA 1FMKA 2HZYA 4A4HA 4ZGDB 1PG5B 5KYUA 1CSKA 4PLIA 4PJMA 1X6OA 3G71A 2JXBA 5GAOq 1G5VA 3OSVA 5GANg 1Q82R 1SEMA 1RAIB 2LP5A 1GFDA 5GAN8 3CCVA 2RD1A 4AFQC 3LGLA 1G2BA 3H8ZA 4OB0B 4M75D 4OP0A 6AT1B 1SRMA 3UPUA 2RA2A 2LNHB 3VRZA 2VKNA 2QTVA 2DK3A 3EGDA 2L3PA 4Z02A 2M51A 3U23A 2QQAA 2OTJA 4M77G 3CCUA 4JJCA 2PQWA 1NYGA 3R6OA 3RKYA 1PWTA 5GMKi 3M0TA 2RH2A 2XDBA 2LX9A 1S1NA 3M9QA 5IXBA 4BE2A 1AHJB 1B3QA 2YUNA 1M90R 2DBMA 3M0UA 5L8RE 1ZHIA 4RMOA 4M77B 3OW2S 2HQXA 2QYZA 3CCVQ 1OOTA 3UA6A 4A4EA 2R5MA 2BE9B 1PCXA 4E6RA 2QTXA 1N8RR 2CDTA 1JXMA 1WPYA 2DXBA 3CC4Q 3CCVT 4FIBA 1VYTA 3GBQA 2KT8A 1WHGA 2E6ZA 3RR6A 2JMCA 5FROA 3CPWA 1MNDA 2F5KA 3CC4T 1K0XA 4BY6C 5GAOm 1I4K1 3T9NA 2OTJQ 4HT9A 3CCUQ 2RHXA 2YLBA 2GFUA 2MMPA 4LDYA 4Q5WA 5HK3A 2BZYA 2P0PA 3FRNA 3DB3A 1WZOA 2DZ9A 4J9CA 3UF4A 2CGHA 2K9GA 2OTJT 1K8AR 3QXEB 2HKQB 4PJOD 3CCUT 4M7AE 2FO0A 2JJ9A 4RTVA 4RCCA 3IQLA 1BI0A 5KYXB 2CP2A 3TU4K 2QDYB 1MNEA 1D1CA 4QT7A 3CBPA 3VJPA 4RTYA 4HCKA 1RLQC 2MF2A 4M7AF 4D8DA 1B34B 1Y71A 4WF2A 2EQJA 2MIOA 1T0HA 5GANd 3ZBDA 2DD4A 4XU3A 4EPCA 2DRMA 5CKHA 3EAEA 5DY9A 4BE0A 4E47A 2AT1B 3OYMA 2FRYA 4FCYA 1TU0B 3JB9H 5A0LA 2XG8D 4DA4A 1OEBA 2YSQA 3A8OB 3UA7A 1XNIA 2LMJA 2ROLA 3HP9A 4Y28E 2J05A 4FU6A 1BI1A 2EYWA 2DTHA 2HL3A 4JLIA 1I5OB 2B8AA 3P8DA 3CBMA 4LDVA 1IO6A 3X20B 5I21A 2NUZA 5DLOA 5KE2A 1SHGA 2OAUA 4B9XA 3HFOA 3MEWA 2COZA 2I2LA 3VRYA 2JN0A 2Y4XA 4F17A 3VU3C 3NFCA 2RQUA 2XI9A 1ZSZA 2Y4YA 5GAN4 5GANe 3LWHA 2NUTB 1ABQA 3OS0A 2ED1A 3HFNA 4QQ6A 4J9FA 3JCMd 1H3ZA 2XMFA 2VGNA 2G3RA 4KBMB 4LUEA 1D1BA 4PNOA 4M77D 3NPFA 2J6OA 3OS2A 4HCBA 1QKXA 2VGMA 4QKUA 2FG0A 3C12A 1QVGS 4M78C 2FPDA 2QG9B 5KH6A 4LXCA 2CP3A 4Y92A 1T3SA 1X2QA 3NTHA 4OB3B 4QW2A 3QHSA 4RG8A 4J6XA 4ATOA 1K0SA 2OAWA 2V8KA 1RAAB 5A2QE 4JS4A 2YXYA 3CCRQ 3VUZA 3M55A 2JTFA 1M3BA 3QPHA 1Q81U 3MEUA 3RDVA 1K1ZA 1FWZA 1YWPA 3CCRT 3JCMX 2KQWA 3REBB 4DBFA 3EFOB 3PFSA 2ZPBB 4DEXA 3L42A 3JCMe 4AG1C 2LNVA 3CD6Q 1G3SA 4AT1B 4E7SA 3CXCP 2IG0A 3FLGA 5KYYA 2DJZA 1NLOC 2BKDN 8ATCB 4OVAA 3CD6T 1K4US 2QQSA 3L2QA 5GAN5 1R0CB 4XK8E 1KC8R 3GPLA 3O8VA 1ZUKA 4O6JA 4D6WA 3EHQA 3ME9A 2MK5A 4A53A 2EJFA 4M78G 4GLMA 5KCOA 3QJYA 1JXOA 2PUOB 3REAB 2E70A 4Z89A 2COYA 2CSIA 1EFNA 1KQ1A 2L2PA 2BIVA 1KQSA 3DLMA 1YJNA 1I0CA 2OTLA 4F14A 2EVRA 4FM4B 2JMAA 3LH0A 2WSEE 2CUDA 1WLPB 2F2WA 3EH1A 3H0HA 4FSXA 4XTVA 1VQ9A 2KR3A 1QKWA 4BB7A 3MO8A 2QASA 2XICA 4F7UA 4C8QF 4JZ3A 4GBQA 1QMCA 3QBYA 3S3MA 1M8VA 2K2MA 3QO3A 4DBRA 2KAFA 3LX7A 2DX1A 2HD0A 1YP5A 1TWBA 2CT4A 1KK7A 3M4GA 4MZMA 4QQDA 3G6EA 2CZ6B 3G4SA 3MP6A 2ZPIB 1QWEA 1Q86U 1WHKA 5GAOl 3M53A 3EHRA 1GRIA 4ZN1A 4M75G 5LJ5d 2QGGA 3JCMP 4EIKA 1QP2A 3CXCS 3A8GB 1QCFA 1YJNQ 4EMGA 3EG2A 1I81A 5GAOr 4JRKA 2EWNA 1IHVA 1M1KU 3HTRA 1VQNA 3HHTB 1KIKA 3PMTA 1R0BG 1GL5A 1VUBA 2YRDA 3JCMh 1WI7A 1YJNT 5GAN2 1OPKA 1ZUYA 1K73U 4ZGJB 1JRIA 1U3OA 3F70A 4M75B 2F69A 2KYBA 3CMAQ 1Q86C 2GQIA 1K76A 2L0AA 1X01A 2WACA 1VQ4Q 1KD1U 2CUBA 1WX6A 1M1FA
chains in the Genus database with same CATH topology
3G71A 2P0QA 5LJ3h 3OA6A 2QI2A 5GAOq 1G5VA 3CMAT 3LYIA 3OSVA 3RMSA 2CKKA 4C92D 2K3XA 5GANg 4LDXA 3OYHA 5CKEA 1VQ4T 4BI8B 2KSSA 5GAN8 4RKUE 3CCVA 1YIJA 2O4XB 2RD1A 1M1KC 3LGLA 2FVUA 3TCJA 5GMKj 1VQPT 3INZA 3OYYA 2DD5A 3H8ZA 2K4YA 4OB0B 3OYDA 3QYHB 4N0AA 3G7ZA 3VV0A 4NS5A 2LQ8A 4M75D 4OP0A 5CKBA 1K73C 2YHTA 5LJ5e 3A5ZB 3MEAA 3UPUA 2DXUA 3X26B 3OYKA 2RA2A 4XAXB 1YHQT 1W4SA 2ZZDA 4L6V5 4C8QG 4FT2A 2VYTA 4FL6A 3J7AF 3HRSA 5D6YA 4C8QA 4LD6A 4XTXA 2DK3A 3X25B 4C0FA 1KD1C 1FXXA 5GAN6 5J3BA 4EMHA 4Z02A 2D6FA 2QQAA 4XU0A 1P92A 4BE1A 3FEOA 2OTJA 3JRZA 3UDCA 2VXFA 3FB9A 4M77G 3SWNA 3JCMf 4ELYC 3CCUA 3OYEA 5CQXA 3JCMV 4M77A 2PQWA 3R6OA 2KVQG 1LOJA 2KY9A 2JTMA 3RKYA 3WVDB 5GMKi 4IUQA 2X4XA 5GANh 1I5LA 1OI1A 1PSFA 2MAMA 2RH2A 4M78B 4YTLA 3JB9G 2XDBA 2LX9A 3H6ZA 3M9QA 4MDWA 3JAME 2YLCA 3CCLT 4BE2A 1AHJB 2QA4T 1WQWA 4C0DC 2EQKA 5LJ3f 3UWNA 4A4GA 1KQSS 3CMAA 5C6SA 1YCYA 5L8RE 4M7DE 1TH7A 1ZHIA 2LT4A 4IUVA 3DKMA 4RMOA 4M77B 5DLQE 5GMKe 4JS5A 1VQ4A 1VQ6T 3META 3AHUA 4DOVA 3V7SA 2HQXA 3ZFJA 4BI4A 1BIBA 2R57A 3RIRA 3OW2S 5DM7R 4X34A 3L2VA 1VQOA 2XD0A 1WNLA 2FYKA 4XQ3A 1N9SA 1O75A 4A4EA 1MHNA 1YBYA 1U1SA 3OBWA 2R5MA 2M0OA 3L2ZA 4QVCA 1OZ3A 1LNXA 4E7HA 3DB4A 3CPFA 1IZ6A 4C5GA 2QTXA 4OF1A 3QZ9B 1HK9A 4MMLA 4PJOB 1WPYA 2DXBA 3CCVT 4FIBA 4M78D 4NL3A 4PJOE 4F7UB 1Y07A 4OGCA 5IN1A 4F7UE 2RI5A 1QVGA 2JZ2A 2ZCFB 4ZTFA 2LCCA 4MDXA 3M54A 5IT9E 4BACA 2E6ZA 1NE8A 4J6WA 1G3WA 4MZPA 5FROA 1Q7YU 1BYMA 4J6YA 4M7DF 3CPWA 3RKWA 4J7FA 2K5FA 2F5KA 3CC4T 4BY6C 2XIDA 1G3TA 1MGQA 5GAOm 4XTYA 1I4K1 3T9NA 4R55A 2QEXA 2X4YA 5KCHA 5LJ5g 2RI3A 4TVRA 4HT9A 2Y90A 3HRTA 3QIIA 5CKFA 2MWPA 2RHXA 2YLBA 4CI0C 2GFUA 5J39A 2MMPA 4LDYA 4Q5WA 5HK3A 4J8OA 2HNIA 1XTDA 1UEBA 2P0PA 2X4WA 3FRNA 4LDWA 5J26A 2DAQA 4C92E 5GANf 3DB3A 1Q82C 1JJ2S 1BI3A 2DZ9A 5LJ3d 3QZ5B 3FIFA 1N27A 3E9FA 4OMFB 3V8KA 2CGHA 2VV5A 2OTJT 4PJOF 5GAMg 3QXEB 4XU1A 2HAXA 5LJ3j 4PJOD 3CCUT 2VUBA 4F7UF 4C5HA 3CCLA 3LGFA 4M7AE 4IUTA 2QA4A 2DKGA 1QVFA 4RCCA 2LC4A 3WXMB 2QQBA 2JNGA 1EIFA 4M7DC 3BDUA 5FU7B 4M75E 2DVEA 3L2UA 3OYIA 3FDRA 2CZ7B 3JCMb 1BI0A 3OYCA 3QDRB 5CQYA 3TU4K 1Q7YC 4BDZA 2RJCA 5M9OA 4RCBA 5CR2A 5CIUA 2EAYA 2GCXA 4GY5A 3TEEA 3JCMc 1BKBA 3URGA 3BW1A 3RKXA 1VQ6A 2QDYB 4C92F 3NTKA 1IREB 4A54A 3M4YA 3OYFA 4RG2A 4JRPA 1V29B 3JSCA 3M57A 2X4JA 3CBPA 4II1A 3VJPA 3PIOA 1M1GA 5FRNA 3PTAA 1VQMT 3V7CA 2XHCA 3P8HA 1KQ2A 1RL2A 2MF2A 4M7AF 2K5IA 1VQOT 2DZCA 4M7AD 3FC3A 1R8OB 1XOVA 1B34B 3SD4A 2QEXT 1KHCA 1Y71A 3QKJA 2BUDA 2EQJA 4M75F 4WF2A 3RUXA 1WJQA 4X9CA 3VUBA 3C95A 2DPPB 3CC4A 3OYLA 2PUKB 2VC8A 3VKIA 4C0DB 5GAMh 2DTOA 3KBGA 2O01E 5GANd 3ZBDA 2DD4A 5D6XA 4XU3A 3M58A 4EPCA 2EJGA 5CKHA 5GANj 4JRQA 3EAEA 5DY9A 3FJPA 1ZBXA 2DXTA 4L59A 4C92C 3GOXA 4BE0A 1UGQB 4E47A 4BI3A 3LWIA 3OYMA 5I2MA 5LJ3e 2LVMA 3CCMT 3JB9H 1RI0A 5GMKl 5A0LA 1OYXA 1Q81C 4O5VA 2XG8D 4ZN3A 4DA4A 4X9DA 3NTIA 2HQEA 3M56A 3CCQT 2YRVA 4V2SA 2K2VA 3A8OB 2M1HA 1XNIA 1YJWA 3S3OA 4ZGEB 5IAYA 3HP9A 4M75C 4Y28E 3GP8A 4E7KA 4FU6A 3MCAB 5GAOp 1BI1A 1PSEA 2LCLA 1D3BA 5HY6A 2DTHA 4M78E 2LDMA 3QJ6A 2RJDA 2RHIA 4C8QB 4JLIA 4C8QE 4IURA 2K3YA 2B8AA 4C0GA 2ZPEB 3OBYA 3OSSC 3P8DA 5CAIA 4M7DA 4JDSA 3CC7T 4JRIA 2QQRA 3CEYA 3CBMA 3SWNB 2L8DA 4LDVA 3X20B 5I21A 5DLOA 5KE2A 2OAUA 2GFAA 2L3RA 4HA8A 4B9XA 3HFOA 4M77E 4OB1B 3MEWA 3OQ5A 3PMIA 4R56A 3X24B 1VQMA 3E1SA 2KDSA 3UT1A 2CYZB 1ZQ1A 2I2LA 1Y96A 1Q82U 5FRMA 4QQGA 3LLRA 2P0KA 4XTUA 4IUUA 3KUFA 3CBOA 3OS5A 2JN0A 3M59A 1X75C 2Y4XA 3VU3C 3NFCA 4VUBA 2XI9A 2XDPA 2EQMA 2IVWA 2Y4YA 4MZTA 4N4HA 5GAN4 4M78F 5GANe 3C94A 4PKCC 5GAMf 3LWHA 3QG1A 2KMTA 4XTZA 2GF7A 3CCET 3CC2T 1GXIE 3OS0A 3I55T 3HFNA 2ZPFB 2LT1A 4C8QD 4QQ6A 3JCMd 1H3ZA 1YI2T 2VGNA 3ER0A 3OMGA 2ZPHB 3CCMA 2G3RA 4KBMB 3WVEB 1Y96B 2JUFA 2PVDB 4M77F 4PNOA 2EYQA 4E7JA 4M77D 1JJ2A 3KXTA 2FL7A 3DLLA 3OS2A 5CK9A 2E41A 3CXCA 2VXEA 3CCQA 1QW1A 4HCBA 1QP3A 4C92A 3VYGA 4M7AA 2VGMA 3CCST 3C12A 3GIBA 3JB9F 4JJNK 1Y7XA 1QVGS 3JB9D 3EFRA 2E12A 4M78C 3CMET 5A0DA 2C06A 2RJEA 5LJ3g 4QVZA 5KH6A 1XQHA 1N6AA 1QVPA 2LTOA 3NTHA 4OB3B 4QW2A 2X35A 1YJ9T 1YJWT 3QHSA 4RG8A 3CC7A 1WQ7A 4J6XA 4IKFA 4ATOA 3A8HB 5CCAA 2V8KA 2A3LA 5A2QE 1BIAA 4JS4A 3HPWA 1M90U 1VQKT 3VUZA 4J7IA 3I56A 3JCMW 3L2RA 3M55A 2JTFA 2ZGWA 2PVGB 3QPHA 5GAMd 3HL8A 5HK0A 1Q81U 1S72T 3MEUA 1VQLA 4A4FA 3MP8A 5GAMj 2D9TA 1W2BS 1FWZA 4E7IA 2OTLT 3CCRT 5I2SA 3ASKA 4PJOC 3M5AA 1QVFS 4ELZC 2KK4A 3JCMX 5LJ5h 3CCEA 2E5QA 2KQWA 1JB0E 2E65A 3CC2A 3P8BB 4N4IA 4A4KA 3OYBA 3I55A 3PFSA 2ZPBB 3CCJA 1N8RU 2PVOB 3L42A 3JCMe 3SDZA 2LNVA 2D0QB 2M9UA 1G3SA 2RJFA 2XK0A 4CRIA 1YI2A 3EFSA 4KT0E 1VQ9T 2V8IA 2E6NA 2CZ1B 2XU8A 5GAN7 2IG0A 3FLGA 2XDDA 5CKDA 1YITA 1BI2A 3OY9A 3SFMA 5FU6C 2DJZA 1LJOA 4Y91A 1UGRB 4KULA 2BKDN 4NL2A 4OVAA 5D6WA 1M90C 1K9MU 3CD6T 3HSBA 3Q1JA 2LQKA 4PLLA 2QQSA 3L2QA 4XU2A 3CCSA 1VQ7A 1SSFA 2EQUA 5GAN5 1UB4A 2RK1A 1UGPB 4XK8E 2CZ0B 2P4TA 3JB9I 1FX7A 3GF5A 5C0MA 3O8VA 3GPLA 4O6JA 3C4SA 2EIFA 2EJ9A 2H3JA 4D6WA 3CMEA 2WSFE 4KUIA 1VQ5A 4HT8A 4MMKA 3OMCA 4C5IA 3OYAA 3ME9A 4M7AC 4EMKC 2RHUA 3PT9A 3G6ET 4A53A 3VYHB 5GMKm 3G4ST 1YJ9A 1K8AU 2EJFA 4M78G 5FU7C 1N8RC 5KCOA 1U8RA 3OS1A 2K5LA 4M78A 5CO7A 3QJYA 2PUOB 1NPRA 2RK2A 3S6WA 1VQKA 1WJRA 2E70A 5GMKh 3A8MB 1VQ8T 2FB7A 2AHJB 2LRQA 2RI2A 1KQ1A 3BFMA 3E19A 3HRUA 5GAMe 4FT4A 4M7DG 4BY6B 3GLXA 3E9GA 2BIVA 1S72A 1KQSA 3QUIA 2MI6A 3J81E 4HCCA 3DLMA 1YJNA 2L89A 1K9MC 2OTLA 3CCRA 1WJSA 3L2WA 4L5GA 3RMQA 4OGEA 3I56T 4FM4B 3QSUA 3OW2A 4ZTJA 5LJ5f 3LH0A 2WSEE 3OB9A 1VQNT 2RHYA 2E1HA 5AYFA 1D3BB 2DIQA 2DO3A 5HKCA 4FSXA 1VQLT 1H641 2L5QA 2RB6A 4XTVA 1VQ9A 4PJOG 2F5TX 4BB7A 1M9SA 1U1TA 4F7UG 4PJOA 3TREA 4OB2B 2WSCE 1K8AC 2JVVA 1VIEA 3MO8A 2XICA 4EDUA 4F7UA 4LD9K 4M7DB 3PIPA 2HBPA 4C8QF 1G3YA 3CCJT 2DTIA 3CD6A 4N4GA 1M4ZA 2EFIA 3QBYA 3JCMJ 2E64A 1NZ9A 3S3MA 1M8VA 3JCMg 3QO3A 2EKOA 3QYGB 4C0ZA 3RESA 2KAFA 3JB9J 3L1AA 3G71T 3HKSA 3LX7A 3A8LB 1VQPA 2HD0A 1KG1A 1NJIU 3LW5E 5GAN3 2CS7A 1YITT 5CVIA 1KC8U 2QXFA 3GNGA 3M4GA 4IUPA 2XKOC 4N0AC 4LDUA 4MZMA 4QQDA 4C92G 4BD3A 3G6EA 2CZ6B 4KUDK 3G4SA 3MP6A 2ZPIB 1WGSA 4NOYA 3S3NA 3MHXA 4QVDA 5KE3A 1YIJT 2R58A 1YHQA 2FHDA 1VQ7T 2ZPGB 3RERA 3MEVA 2MWOA 1Q86U 5GAOl 1KHIA 1N9RA 3M53A 1VQ5T 4M7AG 3MP1A 4C8QC 2A7YA 2V8JA 4ZN1A 3J80E 3OYGA 3CPWS 4EMKA 1VQ8A 1DJ7B 3PNWC 4ME7A 4J83A 4M7DD 2DEQA 2DXCA 4M75G 5EG2A 4B9WA 1OZ2A 4DQ2A 5LJ5d 3PGGA 4M75A 1NPPA 4BUGA 5FLXE 1VIFA 5FU6B 3X28B 3JCMP 4UC4A 3SWNC 1QP2A 3CXCS 5LJ5j 2R5AA 3A8GB 1HXDA 3BY7A 4M77C 4JUVA 3SB2A 4HKEA 4EMGA 3V8JA 3OYJA 3V8LA 4C92B 3OYNA 1I81A 5GAOr 4JRKA 2EWNA 4PL6A 1M1KU 4HCZA 1VQNA 3HHTB 3JCMQ 3PMTA 2RM4A 1NJIC 2PU9B 2NLUA 4JLGA 1VUBA 4C5EA 2GQVA 1KC8C 3JCMh 3ZEHA 5GAOn 1I8FA 4P5NA 1YJNT 1W2BA 4M7AB 5LL6S 3V7RA 5GAN2 4EMKB 1O9SA 1UGSB 3GNFB 4BDYA 1K73U 2M16A 4ZGJB 1JRIA 1JBMA 3F70A 4DOWA 2O4XA 4M75B 2F69A 2RHZA 2E10A 1M5Q1 2K57A 4GLKA 1Q86C 4XTWA 3BDLA 2DIGA 2JOYA 1B34A 1X01A 3N5BB 2RO0A 4A4HA 2WACA 4ZGDB 4E7LA 4J5YA 1KD1U 4PLIA 2QQ9A 5A0GA 1M1FA 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN0 A;  4M78 A;  2HNI A;  5LJ3 h;  4C92 E;  5GAO q;  3VU3 C;  5GAN f;  5GAN 4;  2DZ9 A;  5LJ3 d;  4C92 D;  4M78 F;  5GAN e;  5GMK h;  5GAN g;  5GAM f;  2FB7 A;  3FIF A;  4XTZ A;  3V8K A;  2CGH A;  3BFM A;  1KQ1 A;  4PJO F;  5GAM e;  5GAM g;  4XU1 A;  5LJ3 j;  3HFN A;  5GAN 8;  4M7D G;  4C8Q D;  4PJO D;  4F7U F;  2RD1 A;  3JCM d;  4M7A E;  3QUI A;  5GMK j;  2DKG A;  3INZ A;  4RCC A;  4M7D C;  3BDU A;  1Y96 B;  2DVE A;  4M75 E;  4N0A A;  4M77 F;  4PNO A;  3QSU A;  5LJ5 f;  4M75 D;  4OP0 A;  4M77 D;  3JCM b;  2YHT A;  5LJ5 e;  2DXU A;  2RA2 A;  2E41 A;  2E1H A;  2VXE A;  1D3B B;  4RCB A;  4C92 A;  1H64 1;  2RB6 A;  2EAY A;  4XTV A;  3JCM c;  4PJO G;  3GIB A;  3BW1 A;  3RKX A;  4C8Q G;  4C92 F;  1U1T A;  3JB9 F;  4F7U G;  4PJO A;  4C8Q A;  3JB9 D;  3EFR A;  4XTX A;  4A54 A;  4M78 C;  4F7U A;  5GAN 6;  5LJ3 g;  4M7D B;  4EMH A;  4C8Q F;  2DTI A;  4XU0 A;  3V7C A;  2VXF A;  3FB9 A;  2E64 A;  4M77 G;  3SWN A;  3JCM f;  3JCM J;  1KQ2 A;  4M7A F;  1M8V A;  3JCM g;  3QO3 A;  3JCM V;  2DZC A;  3QHS A;  4M77 A;  3RES A;  1WQ7 A;  4J6X A;  4M7A D;  1B34 B;  1LOJ A;  3L1A A;  3RKY A;  4WF2 A;  3JB9 J;  5GMK i;  4M75 F;  3RUX A;  5GAN 3;  4X9C A;  1BIA A;  5GAN h;  1I5L A;  2VC8 A;  3JCM W;  3M4G A;  4N0A C;  5GAM h;  4M78 B;  2DTO A;  4C92 G;  5GAN d;  3JB9 G;  2ZGW A;  4XU3 A;  4NOY A;  5GAM d;  2EJG A;  2YLC A;  4QVD A;  5GAN j;  5DY9 A;  3RER A;  3FJP A;  2DXT A;  4C92 C;  5GAM j;  1WQW A;  5LJ3 f;  5GAO l;  1N9R A;  5LJ3 e;  4M7A G;  1YCY A;  3JB9 H;  4PJO C;  5GMK l;  4M7D E;  4C8Q C;  1TH7 A;  3JCM X;  5LJ5 h;  4M7A A;  4M77 B;  2E65 A;  4EMK A;  5GMK e;  4M7D D;  2DEQ A;  4M75 G;  4DQ2 A;  4X9D A;  3AHU A;  5LJ5 d;  3V7S A;  3PGG A;  1BIB A;  4M75 A;  3RIR A;  3JCM e;  4V2S A;  3JCM P;  3SWN C;  3EFS A;  5LJ5 j;  3BY7 A;  1HXD A;  4M75 C;  1WNL A;  2FYK A;  4JUV A;  1N9S A;  4M77 C;  4XQ3 A;  3SB2 A;  3V8J A;  1U1S A;  3V8L A;  4C92 B;  4EMG A;  3L2Z A;  4QVC A;  1LNX A;  5GAN 7;  5GAO p;  1I81 A;  5GAO r;  4JRK A;  1D3B A;  2EWN A;  2QTX A;  2DTH A;  4M78 E;  2DJZ A;  1LJO A;  1HK9 A;  4MML A;  4Y91 A;  1WPY A;  3JCM Q;  4NL2 A;  2RM4 A;  4C8Q B;  4JLI A;  4PJO B;  4M78 D;  4NL3 A;  4PJO E;  4C8Q E;  4F7U B;  3HSB A;  3JCM h;  4F7U E;  5GAO n;  1I8F A;  4XU2 A;  5CAI A;  4M7A B;  3V7R A;  5GAN 2;  5GAN 5;  4EMK B;  4M7D A;  4JRI A;  4J6W A;  1JRI A;  1JBM A;  3SWN B;  3JB9 I;  5I21 A;  2EJ9 A;  4J6Y A;  4M75 B;  3RKW A;  4M7D F;  4HA8 A;  2E10 A;  1M5Q 1;  4M78 G;  2K57 A;  3HFO A;  4M77 E;  4MMK A;  4HT8 A;  4XTW A;  1MGQ A;  5GAO m;  4XTY A;  1I4K 1;  4M7A C;  4EMK C;  1B34 A;  1X01 A;  2I2L A;  1Y96 A;  4A53 A;  5GMK m;  5LJ5 g;  4HT9 A;  4J5Y A;  2Y90 A;  4XTU A;  2EJF A;  2YLB A; 
#chains in the Genus database with same CATH topology
 4PFO A;  3CMA T;  3LYI A;  2K3X A;  4LDX A;  5CKE A;  1VQ4 T;  4BI8 B;  2KSS A;  1VYU A;  4RKU E;  1YIJ A;  3EGX A;  2O4X B;  1M1K C;  1VA7 A;  2GNC A;  4CC7 A;  3INZ A;  1M2V A;  5AT1 B;  3OYY A;  1GCQ C;  2HSE B;  4HXJ A;  5KYU B;  3G7Z A;  3VV0 A;  2DFU A;  4NS5 A;  1K73 C;  5LJ5 e;  3A5Z B;  3OYK A;  3H0I A;  2ATC B;  2VYT A;  4FL6 A;  3J7A F;  3HRS A;  5D6Y A;  4C8Q A;  4XTX A;  1KD1 C;  1W2B P;  1FXX A;  1Y57 A;  5J3B A;  2ABL A;  2AK5 A;  5GAN 6;  1SPK A;  1P92 A;  2DL7 A;  3FEO A;  4KGZ B;  5GJV B;  3JCM f;  1LCK A;  3OYE A;  3JCM V;  2KY9 A;  3CCL Q;  2QA4 Q;  4IUQ A;  1OI1 A;  2DL4 A;  3JB9 G;  4ZNX A;  1UDL A;  3H6Z A;  3EGD B;  3JAM E;  2YLC A;  3CCL T;  2QA4 T;  2EQK A;  4A4G A;  2X9H A;  5EC7 A;  1YCY A;  1VQ6 Q;  4M7D E;  5KYW B;  7AT1 B;  4IUV A;  5GMK e;  4JS5 A;  3MET A;  2KI7 A;  3AHU A;  4FYY B;  1AOJ A;  2JM8 A;  1B07 A;  4FYW B;  3L2V A;  4KRT A;  2D0N A;  4KH0 B;  2FYK A;  4XQ3 A;  1VQ6 T;  1YBY A;  1U1S A;  3OBW A;  4E7H A;  2M0O A;  3L2Z A;  3CPF A;  2GGR A;  4OF1 A;  2MPX C;  4PJO B;  4PJO E;  4M78 D;  4NL3 A;  3TQ7 P;  1UJY A;  2RI5 A;  2ZCF B;  4MDX A;  2K79 A;  5IT9 E;  4BAC A;  3ZL7 C;  2LX7 A;  1BYM A;  4M7D F;  4J7F A;  2XID A;  1G3T A;  4R55 A;  4XTY A;  3PE0 A;  2X4Y A;  1B7T A;  5KCH A;  3QII A;  3HRT A;  5CKF A;  4CI0 C;  1YWO A;  4C92 E;  2GBQ A;  1Q82 C;  1RAE B;  5LJ3 d;  2A0F B;  3FIF A;  3E9F A;  2VV5 A;  4PJO F;  4XU1 A;  2OJ2 A;  1UJ0 A;  4C5H A;  2JTE A;  3LGF A;  2DKG A;  1QVF A;  3BDU A;  3VS2 A;  1QLY A;  2CZ7 B;  2C0O A;  3JCM b;  4BDZ A;  5M9O A;  4ORZ A;  2HBW A;  3MJX A;  5CIU A;  4C92 F;  3M4Y A;  1NYF A;  2DYI A;  4JRP A;  2DEU A;  3D7S B;  1ZSZ C;  4RTT A;  2K7A A;  2HCK A;  2CP6 A;  3V7C A;  1D0X A;  1KQ2 A;  2K5I A;  2DZC A;  2KGT A;  4PFZ A;  1XOV A;  2H8H A;  2X3X D;  3QKJ A;  4J9G A;  3C95 A;  3CC4 A;  2VC8 A;  5GAM h;  2QDL A;  2O01 E;  5D6X A;  4FW1 A;  2KRN A;  2EJG A;  2J7I A;  4JRQ A;  2MOX A;  1NJI R;  1TOV A;  2EW3 A;  2EYX A;  2LVM A;  4PJN A;  5LJ3 e;  2RMO A;  1OYX A;  1EZZ B;  3VS1 A;  4V2S A;  1TG0 A;  3CC7 Q;  3MCA B;  2DLP A;  3LH5 A;  2YDL A;  2LDM A;  1MV0 B;  2YWW A;  1BB9 A;  3I5S A;  3OBY A;  1X6G A;  4M7D A;  3CC7 T;  4JRI A;  2QQR A;  3CEY A;  3SWN B;  2L8D A;  1ZBJ A;  4HA8 A;  4M77 E;  3PMI A;  1M3A A;  3E1S A;  3UT1 A;  1ZQ1 A;  1LVK A;  3CC2 Q;  3I55 Q;  2C0T A;  4QQG A;  3LLR A;  3KUF A;  1WDX A;  3RNJ A;  1YI2 Q;  3M59 A;  1X75 C;  2H3E B;  2XDP A;  2EQM A;  4N4H A;  3C94 A;  5GAM f;  2KT1 A;  2L3S A;  4HVV A;  3CC2 T;  3I55 T;  1U5S A;  1MMA A;  2ZPF B;  1HJD A;  2A37 A;  1PC0 A;  3PVL A;  1GCQ A;  1YI2 T;  5I11 A;  2ZAE A;  3OMG A;  1C0M A;  3CCS Q;  3WVE B;  4DBH A;  2E3H A;  2JUF A;  4M77 F;  4ANJ A;  3BE3 A;  3CME Q;  4E7J A;  2A28 A;  3H9N A;  2J06 A;  2VXE A;  3JV3 A;  1QP3 A;  4C92 A;  3VYG A;  3CCS T;  2P4R A;  4JJN K;  3JB9 D;  3EFR A;  2E12 A;  3CME T;  1PNJ A;  2ROT A;  1KQS P;  2RQW A;  1SRL A;  3H0F A;  8AT1 B;  4PJJ A;  1XQH A;  2HKN A;  1MUZ A;  2X35 A;  1N5Z A;  3VS3 A;  5CCA A;  2A3L A;  1BIA A;  1MMN A;  2AZV A;  1YCS B;  2DA9 A;  3I56 A;  2FZK B;  3JCM W;  3L2R A;  2ZGW A;  2AZS A;  2PVG B;  5HK0 A;  1Q95 G;  2KEA A;  5GAM j;  2D9T A;  4E7I A;  5I2S A;  2KK4 A;  1PHT A;  1ZA2 B;  2E5Q A;  1JB0 E;  1JO8 A;  3SDZ A;  2M9U A;  2XK0 A;  1JJ2 P;  2LQW A;  2E6N A;  2CZ1 B;  3EG9 A;  2QAZ A;  2XU8 A;  1WHH A;  2XDD A;  5CKD A;  1BI2 A;  2LJ0 A;  3OY9 A;  3A98 A;  1LJO A;  4Y91 A;  1UGR B;  4KUL A;  2EGA A;  2VVK A;  1K9M U;  3HSB A;  5IHI A;  2LQK A;  4PLL A;  4A63 B;  2NWM A;  1ZLM A;  2EQU A;  1UB4 A;  2WSF E;  1UE9 A;  1VQ5 A;  4MMK A;  1SHF A;  1VQ8 Q;  5KYY B;  1ZSG A;  1RLP C;  5FU7 C;  2CP0 A;  1U8R A;  2DL8 A;  2K5L A;  5IXF A;  3S6W A;  2DF6 A;  1WJR A;  1VQ8 T;  3I56 Q;  2LRQ A;  3BFM A;  3HRU A;  2O88 A;  4BY6 B;  3GLX A;  3E9G A;  4D8K A;  1PKS A;  3QUI A;  2MI6 A;  3J81 E;  4HCC A;  1K9M C;  1NM7 A;  3CCR A;  2CH4 W;  1WJS A;  3L2W A;  4L5G A;  3I56 T;  2EBP A;  3QSU A;  3OW2 A;  1WYX A;  3M0R A;  3OB9 A;  3VS4 A;  5AYF A;  1D3B B;  2DO3 A;  1OQK A;  1H64 1;  2RB6 A;  2F5T X;  1M9S A;  4F7U G;  2JVV A;  4EDU A;  2DE0 X;  2DTI A;  3MPU B;  3CD6 A;  1M4Z A;  2EFI A;  2NUP A;  2DMO A;  1RAD B;  3QYG B;  2EKO A;  4C0Z A;  1UHC A;  4E2F B;  1VQP A;  1KG1 A;  3A8L B;  2HSP A;  1KC8 U;  1VQ5 Q;  2QXF A;  3GNG A;  4IUP A;  1BCO A;  4KUD K;  1WIE A;  3EG0 A;  1YHQ A;  2FHD A;  4FYV B;  2ZPG B;  3RER A;  2A08 A;  1KHI A;  1VQ5 T;  1Z9Q A;  4C8Q C;  2V8J A;  3J80 E;  4M7A A;  4ME7 A;  2DEQ A;  1OZ2 A;  2HEQ A;  1JJ2 S;  3X28 B;  2E4H A;  4F16 A;  2EGE A;  4JUV A;  1TTH B;  5KYX A;  3OYN A;  3VS5 A;  1SG5 A;  4JLG A;  2B86 A;  3QWY A;  4C5E A;  4AMC A;  1KC8 C;  3ZEH A;  5GAO n;  2V26 A;  1ABO A;  4P5N A;  5LL6 S;  3V7R A;  1O9S A;  1D09 B;  3GNF B;  4BDY A;  2M16 A;  1JBM A;  2KRM A;  2A36 A;  2MCN A;  2DER A;  1AWO A;  2PTK A;  4XTW A;  2DIG A;  4RTW A;  1B34 A;  3N5B B;  2RO0 A;  4E7L A;  1J3T A;  4J5Y A;  4FYX B;  5IHN A;  2QQ9 A;  5A0G A;  4E7Z A;  2P0Q A;  1OX8 A;  3OA6 A;  1VQP Q;  2K3B A;  1YFN A;  1YHQ Q;  1VQP T;  2AKK A;  2DD5 A;  2K4Y A;  3OYD A;  4N0A A;  5CKB A;  2YUO A;  2YHT A;  3MEA A;  1PD1 A;  3X26 B;  1YHQ T;  1X27 A;  1E7O A;  4C8Q G;  4DEY A;  1BBZ A;  4EMH A;  1PRL C;  2D6F A;  1QVF P;  4XU0 A;  4BE1 A;  2VXF A;  3FB9 A;  4ELY C;  4PFP A;  5CQX A;  2KVQ G;  3WVD B;  2JTM A;  2G6F X;  2DL5 A;  5GAN h;  1C1A A;  2CSQ A;  2MAM A;  4PK4 A;  4M78 B;  2X51 A;  1BCM A;  2RN8 A;  2HMA A;  1WQW A;  4C0D C;  2NUT A;  3CMA A;  5C6S A;  2FZG B;  1TH7 A;  3DKM A;  1HD3 A;  5DLQ E;  2OI3 A;  1VQ4 A;  5FW9 A;  1X43 A;  1Q81 R;  4DOV A;  3V7S A;  3ZFJ A;  2IPO B;  1BIB A;  2CP7 A;  4X34 A;  5L23 A;  1VQO A;  2L3Q A;  1WNL A;  1N9S A;  1MHN A;  1IZ6 A;  4KGV B;  1HK9 A;  4MML A;  4OGC A;  3C0C A;  1QVG A;  4ZTF A;  1D0Y A;  3M54 A;  2KBT A;  1NE8 A;  4J6W A;  1Q7Y U;  4J6Y A;  1JEG A;  3RKW A;  2CT3 A;  3UAT A;  4TVR A;  2CP5 A;  1UHF A;  3EH2 A;  1U06 A;  1XTD A;  1UEB A;  4LDW A;  5J26 A;  2DL3 A;  5GAN f;  2EQI A;  1BI3 A;  3QZ5 B;  1TUC A;  1WXU A;  2HAX A;  2VUB A;  1C6V X;  3CCL A;  2YUP A;  4IUT A;  2QA4 A;  1M8M A;  1H3H A;  2LC4 A;  4OMM A;  2QQB A;  2JNG A;  3I35 A;  1X69 A;  4M7D C;  3EFO A;  4M75 E;  2DVE A;  4KH1 B;  3OYC A;  3QDR B;  1Q7Y C;  2V1R A;  2YUQ A;  1VQM Q;  5CR2 A;  1UFF A;  3JCM c;  2GCX A;  3URG A;  3BW1 A;  1VQO Q;  1VQ6 A;  1IRE B;  1HYO A;  4K11 A;  4RG2 A;  4II1 A;  1QWF A;  3PTA A;  1VQM T;  3CPW P;  3M0S A;  2XHC A;  3P8H A;  1WXT A;  1VQO T;  4R0K A;  3EG1 A;  3FC3 A;  3SD4 A;  4RTZ A;  2O2O A;  2BUD A;  4M75 F;  1WJQ A;  4X9C A;  3CCM Q;  1NG2 A;  2PUK B;  3VKI A;  4C0D B;  2DTO A;  1F1B B;  3KBG A;  2M02 A;  9ATC B;  3M58 A;  2DM1 A;  3PVQ A;  5GAN j;  3CCQ Q;  3FJP A;  4L59 A;  4C92 C;  1UGQ B;  2EPD A;  2DRK A;  5I2M A;  3CCM T;  1OU9 A;  2C0I A;  4O5V A;  4X9D A;  3NTI A;  2YRC A;  2HQE A;  3M56 A;  3CCQ T;  1ZX6 A;  1Q86 R;  2M1H A;  2COW A;  3S3O A;  5IAY A;  2NYS A;  3GP8 A;  2M0Y A;  5HCK A;  5FWB A;  1SF9 A;  1NEB A;  2RJD A;  2RHI A;  3QJ6 A;  5CAI A;  1WHJ A;  1X2K A;  2LQN A;  1VQL Q;  4OMO A;  1M1K R;  3EG3 A;  2GFA A;  1IB8 A;  2L3R A;  1UTI A;  1IXD A;  3X24 B;  2KDS A;  3CCE Q;  2CYZ B;  1Y96 A;  1Q82 U;  1IGQ A;  4IUU A;  1WXB A;  3OS5 A;  1VYV A;  4VUB A;  1SSH A;  1D0Z A;  1Y0M A;  2IVW A;  4MZT A;  3QG1 A;  2KMT A;  4XTZ A;  3CCE T;  1KD1 R;  2LT1 A;  4C8Q D;  2X3W D;  3ER0 A;  1AZE A;  3KXT A;  2K6D A;  5CK9 A;  3CXC A;  1YJ9 Q;  1TSF A;  3GIB A;  3JB9 F;  2C06 A;  2FPF A;  5A0D A;  1VQK Q;  1N6A A;  1QVP A;  1YJ9 T;  3OW2 P;  3CC7 A;  1WQ7 A;  4IKF A;  1S72 Q;  3A8H B;  1HSQ A;  1M90 U;  1WA7 A;  1VQK T;  4LNP A;  2DBK A;  2GTJ A;  1WHM A;  1S72 T;  2YT6 A;  4A4F A;  4LN2 A;  1W2B S;  3ASK A;  4ELZ C;  2MYS A;  5LJ5 h;  1UGV A;  1V1C A;  3CC2 A;  3P8B B;  4N4I A;  4A4K A;  3CCJ A;  3I55 A;  1N8R U;  4DBQ A;  4CRI A;  1YI2 A;  4KT0 E;  2V8I A;  2RNA A;  5KYN A;  1YIT A;  5FU6 C;  3KFV A;  2EYZ A;  1M90 C;  2BTT A;  2KRO A;  3Q1J A;  3QDF A;  1FMW A;  3CCS A;  1VQ7 A;  1SSF A;  2QGF B;  1UGP B;  3GF5 A;  4X1V A;  3CME A;  2EIF A;  2EJ9 A;  1TUG B;  2H3J A;  2W10 A;  4HT8 A;  3OMC A;  3OYA A;  4M7A C;  3EG9 B;  3PT9 A;  3H41 A;  1BK2 A;  4J9E A;  3VYH B;  1ACM B;  5GMK m;  1KJW A;  1K8A U;  1GBR A;  1N8R C;  1T0J A;  3OS1 A;  5CO7 A;  5GMK h;  3A8M B;  2FB7 A;  2AHJ B;  2RI2 A;  1E6H A;  1YN8 A;  2JS2 A;  5KYW A;  2LZ6 B;  3RMQ A;  5LJ5 f;  1RAH B;  1YNZ A;  2HDA A;  1NLP C;  1AD5 A;  3CCJ Q;  2E1H A;  4JJB A;  1MV3 A;  4M4Z A;  2RQR A;  1U1T A;  4PJO A;  3TRE A;  4OB2 B;  4WTO B;  1K8A C;  3G71 Q;  4LD9 K;  2SRC A;  3RBB B;  4J9H A;  2D1X A;  1YIT Q;  2HBP A;  1G3Y A;  3CCJ T;  1GFC A;  2CRE A;  3JCM J;  1D1A A;  1NZ9 A;  3JCM g;  1I07 A;  3I5R A;  1VQ7 Q;  3JB9 J;  3G71 T;  1G8X A;  4HVW A;  3LW5 E;  5GAN 3;  1YIT T;  5CVI A;  4N0A C;  2XKO C;  3VS6 A;  4LDU A;  2O9S A;  1W6X A;  1ZSZ B;  1MMG A;  2LCS A;  2EKH A;  3MHX A;  1RAF B;  5KE3 A;  2R58 A;  1VQ7 T;  1OPL A;  2FZC B;  2MWO A;  1OX9 A;  3I9Q A;  4CC3 A;  4M7A G;  4J9D A;  2KRS A;  2NUP B;  2F2V A;  3MP1 A;  3OYG A;  1VQ8 A;  2HQH A;  4EMK A;  3PNW C;  4M7D D;  2DXC A;  5EG2 A;  4B9W A;  1A0N B;  3PGG A;  4BUG A;  5FLX E;  5FU6 B;  4UC4 A;  2E5K A;  5LJ5 j;  2R5A A;  1QCN A;  4HKE A;  1AT1 B;  3V8L A;  1RUW A;  4PL6 A;  3JCM Q;  2PU9 B;  2GQV A;  3TSZ A;  1TUD A;  4OMN A;  1W2B A;  4M7A B;  1SKU B;  2I0N A;  1RAG B;  3VS0 A;  1OUL A;  2CH4 A;  4JPB W;  1MMD A;  4GLK A;  1NBE B;  2OX7 A;  2JOY A;  1IHW A;  2FRW A;  1M3C A;  5LJ3 h;  2QI2 A;  3M0P A;  2LJ3 A;  3RMS A;  1QVG P;  2CKK A;  2JS0 A;  2V1Q A;  4LUD A;  4C92 D;  3OYH A;  2PNI A;  2FVU A;  3TCJ A;  5GMK j;  2JT4 A;  3QYH B;  2Z0W A;  2LQ8 A;  2DXU A;  4RUG A;  2ECZ A;  4XAX B;  1W4S A;  2ZZD A;  4L6V 5;  4FT2 A;  4LD6 A;  4C0F A;  3X25 B;  1M30 A;  3MKD A;  2KXC A;  2DYB A;  3JRZ A;  4LE9 A;  3UDC A;  3SWN A;  4OMQ A;  3QWX X;  4M77 A;  1LOJ A;  3SHW A;  4FW2 A;  2KE9 A;  2X4X A;  1I5L A;  1PRM C;  1PSF A;  4YTL A;  3NGP A;  4OMP A;  2QK0 A;  4MDW A;  1LPL A;  5LJ3 f;  3UWN A;  1KQS S;  2D8H A;  2LT4 A;  1JU5 C;  4BI4 A;  2R57 A;  3RIR A;  5DM7 R;  1PKT A;  4AFZ C;  2XD0 A;  1H92 A;  1O75 A;  2QEX A;  1FMV A;  4QVC A;  1LNX A;  1OZ3 A;  3DB4 A;  4C5G A;  1QQJ A;  1AVZ C;  3QZ9 B;  4F7U B;  1Y07 A;  5IN1 A;  3SEM A;  4F7U E;  2JZ2 A;  2LCC A;  4MZP A;  1G3W A;  2ED0 A;  2K5F A;  1K9M R;  1MGQ A;  1RAB B;  5LJ5 g;  2RI3 A;  4CC2 A;  5ECA A;  2Y90 A;  4HVU A;  2MWP A;  5J39 A;  4J8O A;  2HNI A;  2X4W A;  2J6K A;  2DAQ A;  2LJ1 A;  1N27 A;  4OMF B;  3V8K A;  5GAM g;  5LJ3 j;  4F7U F;  2EGC A;  1G83 A;  3NHN A;  3WXM B;  4IIM A;  1EIF A;  1M27 C;  5FU7 B;  3L2U A;  3OYI A;  3FDR A;  5IHK A;  5CQY A;  2RJC A;  1GBQ A;  4RCB A;  2EAY A;  4GY5 A;  3TEE A;  1T3L A;  1BKB A;  2ESW A;  3RKX A;  3NTK A;  2QEX Q;  4A54 A;  1FYN A;  1TS9 A;  3OYF A;  1EX4 A;  1V29 B;  3G1J A;  3JSC A;  3M57 A;  2DVJ A;  2X4J A;  2JM9 A;  2VWF A;  3PIO A;  1M1G A;  5FRN A;  1KFZ A;  1RL2 A;  4AG2 C;  2RQT A;  4M7A D;  1R8O B;  2QEX T;  4WCI A;  1KHC A;  3RUX A;  3VUB A;  2DPP B;  1I1J A;  3OYL A;  1WHL A;  1ZBX A;  2DXT A;  1AWX A;  3GOX A;  2O9V A;  4BI3 A;  2AIR B;  3EGX B;  2J6F A;  1RI0 A;  5GMK l;  1Q81 C;  1M2V B;  4KGX B;  4ZN3 A;  2YRV A;  1OV3 A;  1UUE A;  1ZUU A;  2K2V A;  2W0Z A;  1YJW A;  4ZGE B;  4M75 C;  4E7K A;  1K9A A;  3EGU A;  5GAO p;  1PSE A;  2LCL A;  1D3B A;  1W70 A;  5HY6 A;  4M78 E;  3ULR B;  4C8Q B;  4C8Q E;  1UG1 A;  4IUR A;  2K3Y A;  4C0G A;  2ZPE B;  3OSS C;  4RTU A;  4JDS A;  3TSW A;  4JZ4 A;  1PM3 A;  4OB1 B;  4R56 A;  3OQ5 A;  1AWJ A;  2VB6 A;  1VQM A;  2D8J A;  1RAC B;  5FRM A;  1OU8 A;  4PJL A;  4Z8A A;  4XTU A;  2FPE A;  2P0K A;  3CBO A;  2VAS A;  4AFS C;  4IIO A;  4M78 F;  3LWI A;  4PKC C;  2GF7 A;  2O31 A;  1GXI E;  1H8K A;  3A1P A;  1BU1 A;  5I22 A;  2ZPH B;  1V76 A;  3CCM A;  1Y96 B;  1UEC A;  2PVD B;  2JW4 A;  2EYQ A;  2BE7 D;  3DLL A;  2FL7 A;  2FEI A;  1JJ2 A;  1GCP A;  5GJW B;  3CCQ A;  2E41 A;  1QW1 A;  1YJW Q;  1Y7X A;  5D7U A;  2RJE A;  5LJ3 g;  4QVZ A;  3R6N A;  2LTO A;  1YJW T;  2DJQ A;  3HPW A;  2OTL Q;  3FJ5 A;  4J7I A;  4OML A;  4J9I A;  2DNU A;  3THK A;  5GAM d;  3HL8 A;  1VQL A;  3MP8 A;  1VQ9 Q;  2OTL T;  1Z9Z A;  4PJO C;  3M5A A;  2DIL A;  1QVF S;  1NEG A;  3CCE A;  2E65 A;  2BZ8 A;  3OYB A;  1E6G A;  3O5Z A;  2PVO B;  2D0Q B;  2RJF A;  2AKL A;  3EFS A;  1VQ9 T;  1XJW B;  2HL5 C;  4CC4 B;  1AEY A;  5GAN 7;  1CKB A;  3SFM A;  4NL2 A;  5D6W A;  3G6E Q;  4XU2 A;  3G4S Q;  2RK1 A;  2CZ0 B;  2P4T A;  3JB9 I;  1FX7 A;  5C0M A;  3C4S A;  2RF0 A;  4KUI A;  4C5I A;  1AWW A;  4EMK C;  2RHU A;  3G6E T;  4Z88 A;  3G4S T;  2E3I A;  1YJ9 A;  1Q7Y R;  4F04 B;  1W1F A;  4M78 A;  1NPR A;  2RK2 A;  3AT1 B;  1VQK A;  2P84 A;  2F1L A;  3E19 A;  2KXD A;  2IIM A;  5GAM e;  4FT4 A;  4M7D G;  1VQN Q;  2RPN A;  3TVT A;  1S72 A;  1ZA1 B;  2L89 A;  4OGE A;  2EYY A;  4ZTJ A;  2ENM A;  1VQN T;  2RHY A;  1K73 R;  2DIQ A;  5HKC A;  2RQV A;  1VQL T;  2L5Q A;  4PJO G;  2BZX A;  2PZ1 A;  1PD0 A;  1X6B A;  2WSC E;  3M0Q A;  1VIE A;  4M7D B;  3PIP A;  2DET A;  1IRX A;  3NMZ C;  3E2U A;  4N4G A;  2E64 A;  1QCO A;  4FSS A;  3RES A;  1YIJ Q;  4JJD A;  3L1A A;  3HKS A;  1NJI U;  2CS7 A;  1VOM A;  4C92 G;  4BD3 A;  5FWC A;  4NOY A;  2SEM A;  1WGS A;  3S3N A;  1YIJ T;  4QVD A;  1WFW A;  2GTO A;  3MEV A;  1N9R A;  4RTX A;  1IGU A;  2A7Y A;  4ESR A;  3CPW S;  1DJ7 B;  4J83 A;  2KYM A;  4DQ2 A;  5IH2 A;  1ARK A;  4M75 A;  1NPP A;  4B6M A;  1R77 A;  1VIF A;  3VS7 A;  3SWN C;  2KNB B;  1TXQ A;  3BY7 A;  1HXD A;  4M77 C;  3SB2 A;  1KSW A;  3OYJ A;  3V8J A;  1RI9 A;  4C92 B;  1JQQ A;  3CQT A;  4HCZ A;  1CKA A;  2RM4 A;  1NJI C;  2NLU A;  4AFU C;  1I8F A;  4EMK B;  1UGS B;  1AZG B;  4DOW A;  2O4X A;  1M2O A;  2RHZ A;  2E10 A;  1M5Q 1;  2K57 A;  3BDL A;  4J9B A;  2F2X A;  1FMK A;  2HZY A;  4A4H A;  4ZGD B;  1PG5 B;  5KYU A;  1CSK A;  4PLI A;  4PJM A;  1X6O A;  3G71 A;  2JXB A;  5GAO q;  1G5V A;  3OSV A;  5GAN g;  1Q82 R;  1SEM A;  1RAI B;  2LP5 A;  1GFD A;  5GAN 8;  3CCV A;  2RD1 A;  4AFQ C;  3LGL A;  1G2B A;  3H8Z A;  4OB0 B;  4M75 D;  4OP0 A;  6AT1 B;  1SRM A;  3UPU A;  2RA2 A;  2LNH B;  3VRZ A;  2VKN A;  2QTV A;  2DK3 A;  3EGD A;  2L3P A;  4Z02 A;  2M51 A;  3U23 A;  2QQA A;  2OTJ A;  4M77 G;  3CCU A;  4JJC A;  2PQW A;  1NYG A;  3R6O A;  3RKY A;  1PWT A;  5GMK i;  3M0T A;  2RH2 A;  2XDB A;  2LX9 A;  1S1N A;  3M9Q A;  5IXB A;  4BE2 A;  1AHJ B;  1B3Q A;  2YUN A;  1M90 R;  2DBM A;  3M0U A;  5L8R E;  1ZHI A;  4RMO A;  4M77 B;  3OW2 S;  2HQX A;  2QYZ A;  3CCV Q;  1OOT A;  3UA6 A;  4A4E A;  2R5M A;  2BE9 B;  1PCX A;  4E6R A;  2QTX A;  1N8R R;  2CDT A;  1JXM A;  1WPY A;  2DXB A;  3CC4 Q;  3CCV T;  4FIB A;  1VYT A;  3GBQ A;  2KT8 A;  1WHG A;  2E6Z A;  3RR6 A;  2JMC A;  5FRO A;  3CPW A;  1MND A;  2F5K A;  3CC4 T;  1K0X A;  4BY6 C;  5GAO m;  1I4K 1;  3T9N A;  2OTJ Q;  4HT9 A;  3CCU Q;  2RHX A;  2YLB A;  2GFU A;  2MMP A;  4LDY A;  4Q5W A;  5HK3 A;  2BZY A;  2P0P A;  3FRN A;  3DB3 A;  1WZO A;  2DZ9 A;  4J9C A;  3UF4 A;  2CGH A;  2K9G A;  2OTJ T;  1K8A R;  3QXE B;  2HKQ B;  4PJO D;  3CCU T;  4M7A E;  2FO0 A;  2JJ9 A;  4RTV A;  4RCC A;  3IQL A;  1BI0 A;  5KYX B;  2CP2 A;  3TU4 K;  2QDY B;  1MNE A;  1D1C A;  4QT7 A;  3CBP A;  3VJP A;  4RTY A;  4HCK A;  1RLQ C;  2MF2 A;  4M7A F;  4D8D A;  1B34 B;  1Y71 A;  4WF2 A;  2EQJ A;  2MIO A;  1T0H A;  5GAN d;  3ZBD A;  2DD4 A;  4XU3 A;  4EPC A;  2DRM A;  5CKH A;  3EAE A;  5DY9 A;  4BE0 A;  4E47 A;  2AT1 B;  3OYM A;  2FRY A;  4FCY A;  1TU0 B;  3JB9 H;  5A0L A;  2XG8 D;  4DA4 A;  1OEB A;  2YSQ A;  3A8O B;  3UA7 A;  1XNI A;  2LMJ A;  2ROL A;  3HP9 A;  4Y28 E;  2J05 A;  4FU6 A;  1BI1 A;  2EYW A;  2DTH A;  2HL3 A;  4JLI A;  1I5O B;  2B8A A;  3P8D A;  3CBM A;  4LDV A;  1IO6 A;  3X20 B;  5I21 A;  2NUZ A;  5DLO A;  5KE2 A;  1SHG A;  2OAU A;  4B9X A;  3HFO A;  3MEW A;  2COZ A;  2I2L A;  3VRY A;  2JN0 A;  2Y4X A;  4F17 A;  3VU3 C;  3NFC A;  2RQU A;  2XI9 A;  1ZSZ A;  2Y4Y A;  5GAN 4;  5GAN e;  3LWH A;  2NUT B;  1ABQ A;  3OS0 A;  2ED1 A;  3HFN A;  4QQ6 A;  4J9F A;  3JCM d;  1H3Z A;  2XMF A;  2VGN A;  2G3R A;  4KBM B;  4LUE A;  1D1B A;  4PNO A;  4M77 D;  3NPF A;  2J6O A;  3OS2 A;  4HCB A;  1QKX A;  2VGM A;  4QKU A;  2FG0 A;  3C12 A;  1QVG S;  4M78 C;  2FPD A;  2QG9 B;  5KH6 A;  4LXC A;  2CP3 A;  4Y92 A;  1T3S A;  1X2Q A;  3NTH A;  4OB3 B;  4QW2 A;  3QHS A;  4RG8 A;  4J6X A;  4ATO A;  1K0S A;  2OAW A;  2V8K A;  1RAA B;  5A2Q E;  4JS4 A;  2YXY A;  3CCR Q;  3VUZ A;  3M55 A;  2JTF A;  1M3B A;  3QPH A;  1Q81 U;  3MEU A;  3RDV A;  1K1Z A;  1FWZ A;  1YWP A;  3CCR T;  3JCM X;  2KQW A;  3REB B;  4DBF A;  3EFO B;  3PFS A;  2ZPB B;  4DEX A;  3L42 A;  3JCM e;  4AG1 C;  2LNV A;  3CD6 Q;  1G3S A;  4AT1 B;  4E7S A;  3CXC P;  2IG0 A;  3FLG A;  5KYY A;  2DJZ A;  1NLO C;  2BKD N;  8ATC B;  4OVA A;  3CD6 T;  1K4U S;  2QQS A;  3L2Q A;  5GAN 5;  1R0C B;  4XK8 E;  1KC8 R;  3GPL A;  3O8V A;  1ZUK A;  4O6J A;  4D6W A;  3EHQ A;  3ME9 A;  2MK5 A;  4A53 A;  2EJF A;  4M78 G;  4GLM A;  5KCO A;  3QJY A;  1JXO A;  2PUO B;  3REA B;  2E70 A;  4Z89 A;  2COY A;  2CSI A;  1EFN A;  1KQ1 A;  2L2P A;  2BIV A;  1KQS A;  3DLM A;  1YJN A;  1I0C A;  2OTL A;  4F14 A;  2EVR A;  4FM4 B;  2JMA A;  3LH0 A;  2WSE E;  2CUD A;  1WLP B;  2F2W A;  3EH1 A;  3H0H A;  4FSX A;  4XTV A;  1VQ9 A;  2KR3 A;  1QKW A;  4BB7 A;  3MO8 A;  2QAS A;  2XIC A;  4F7U A;  4C8Q F;  4JZ3 A;  4GBQ A;  1QMC A;  3QBY A;  3S3M A;  1M8V A;  2K2M A;  3QO3 A;  4DBR A;  2KAF A;  3LX7 A;  2DX1 A;  2HD0 A;  1YP5 A;  1TWB A;  2CT4 A;  1KK7 A;  3M4G A;  4MZM A;  4QQD A;  3G6E A;  2CZ6 B;  3G4S A;  3MP6 A;  2ZPI B;  1QWE A;  1Q86 U;  1WHK A;  5GAO l;  3M53 A;  3EHR A;  1GRI A;  4ZN1 A;  4M75 G;  5LJ5 d;  2QGG A;  3JCM P;  4EIK A;  1QP2 A;  3CXC S;  3A8G B;  1QCF A;  1YJN Q;  4EMG A;  3EG2 A;  1I81 A;  5GAO r;  4JRK A;  2EWN A;  1IHV A;  1M1K U;  3HTR A;  1VQN A;  3HHT B;  1KIK A;  3PMT A;  1R0B G;  1GL5 A;  1VUB A;  2YRD A;  3JCM h;  1WI7 A;  1YJN T;  5GAN 2;  1OPK A;  1ZUY A;  1K73 U;  4ZGJ B;  1JRI A;  1U3O A;  3F70 A;  4M75 B;  2F69 A;  2KYB A;  3CMA Q;  1Q86 C;  2GQI A;  1K76 A;  2L0A A;  1X01 A;  2WAC A;  1VQ4 Q;  1KD1 U;  2CUB A;  1WX6 A;  1M1F A; 
#chains in the Genus database with same CATH homology
 3G71 A;  2P0Q A;  5LJ3 h;  3OA6 A;  2QI2 A;  5GAO q;  1G5V A;  3CMA T;  3LYI A;  3OSV A;  3RMS A;  2CKK A;  4C92 D;  2K3X A;  5GAN g;  4LDX A;  3OYH A;  5CKE A;  1VQ4 T;  4BI8 B;  2KSS A;  5GAN 8;  4RKU E;  3CCV A;  1YIJ A;  2O4X B;  2RD1 A;  1M1K C;  3LGL A;  2FVU A;  3TCJ A;  5GMK j;  1VQP T;  3INZ A;  3OYY A;  2DD5 A;  3H8Z A;  2K4Y A;  4OB0 B;  3OYD A;  3QYH B;  4N0A A;  3G7Z A;  3VV0 A;  4NS5 A;  2LQ8 A;  4M75 D;  4OP0 A;  5CKB A;  1K73 C;  2YHT A;  5LJ5 e;  3A5Z B;  3MEA A;  3UPU A;  2DXU A;  3X26 B;  3OYK A;  2RA2 A;  4XAX B;  1YHQ T;  1W4S A;  2ZZD A;  4L6V 5;  4C8Q G;  4FT2 A;  2VYT A;  4FL6 A;  3J7A F;  3HRS A;  5D6Y A;  4C8Q A;  4LD6 A;  4XTX A;  2DK3 A;  3X25 B;  4C0F A;  1KD1 C;  1FXX A;  5GAN 6;  5J3B A;  4EMH A;  4Z02 A;  2D6F A;  2QQA A;  4XU0 A;  1P92 A;  4BE1 A;  3FEO A;  2OTJ A;  3JRZ A;  3UDC A;  2VXF A;  3FB9 A;  4M77 G;  3SWN A;  3JCM f;  4ELY C;  3CCU A;  3OYE A;  5CQX A;  3JCM V;  4M77 A;  2PQW A;  3R6O A;  2KVQ G;  1LOJ A;  2KY9 A;  2JTM A;  3RKY A;  3WVD B;  5GMK i;  4IUQ A;  2X4X A;  5GAN h;  1I5L A;  1OI1 A;  1PSF A;  2MAM A;  2RH2 A;  4M78 B;  4YTL A;  3JB9 G;  2XDB A;  2LX9 A;  3H6Z A;  3M9Q A;  4MDW A;  3JAM E;  2YLC A;  3CCL T;  4BE2 A;  1AHJ B;  2QA4 T;  1WQW A;  4C0D C;  2EQK A;  5LJ3 f;  3UWN A;  4A4G A;  1KQS S;  3CMA A;  5C6S A;  1YCY A;  5L8R E;  4M7D E;  1TH7 A;  1ZHI A;  2LT4 A;  4IUV A;  3DKM A;  4RMO A;  4M77 B;  5DLQ E;  5GMK e;  4JS5 A;  1VQ4 A;  1VQ6 T;  3MET A;  3AHU A;  4DOV A;  3V7S A;  2HQX A;  3ZFJ A;  4BI4 A;  1BIB A;  2R57 A;  3RIR A;  3OW2 S;  5DM7 R;  4X34 A;  3L2V A;  1VQO A;  2XD0 A;  1WNL A;  2FYK A;  4XQ3 A;  1N9S A;  1O75 A;  4A4E A;  1MHN A;  1YBY A;  1U1S A;  3OBW A;  2R5M A;  2M0O A;  3L2Z A;  4QVC A;  1OZ3 A;  1LNX A;  4E7H A;  3DB4 A;  3CPF A;  1IZ6 A;  4C5G A;  2QTX A;  4OF1 A;  3QZ9 B;  1HK9 A;  4MML A;  4PJO B;  1WPY A;  2DXB A;  3CCV T;  4FIB A;  4M78 D;  4NL3 A;  4PJO E;  4F7U B;  1Y07 A;  4OGC A;  5IN1 A;  4F7U E;  2RI5 A;  1QVG A;  2JZ2 A;  2ZCF B;  4ZTF A;  2LCC A;  4MDX A;  3M54 A;  5IT9 E;  4BAC A;  2E6Z A;  1NE8 A;  4J6W A;  1G3W A;  4MZP A;  5FRO A;  1Q7Y U;  1BYM A;  4J6Y A;  4M7D F;  3CPW A;  3RKW A;  4J7F A;  2K5F A;  2F5K A;  3CC4 T;  4BY6 C;  2XID A;  1G3T A;  1MGQ A;  5GAO m;  4XTY A;  1I4K 1;  3T9N A;  4R55 A;  2QEX A;  2X4Y A;  5KCH A;  5LJ5 g;  2RI3 A;  4TVR A;  4HT9 A;  2Y90 A;  3HRT A;  3QII A;  5CKF A;  2MWP A;  2RHX A;  2YLB A;  4CI0 C;  2GFU A;  5J39 A;  2MMP A;  4LDY A;  4Q5W A;  5HK3 A;  4J8O A;  2HNI A;  1XTD A;  1UEB A;  2P0P A;  2X4W A;  3FRN A;  4LDW A;  5J26 A;  2DAQ A;  4C92 E;  5GAN f;  3DB3 A;  1Q82 C;  1JJ2 S;  1BI3 A;  2DZ9 A;  5LJ3 d;  3QZ5 B;  3FIF A;  1N27 A;  3E9F A;  4OMF B;  3V8K A;  2CGH A;  2VV5 A;  2OTJ T;  4PJO F;  5GAM g;  3QXE B;  4XU1 A;  2HAX A;  5LJ3 j;  4PJO D;  3CCU T;  2VUB A;  4F7U F;  4C5H A;  3CCL A;  3LGF A;  4M7A E;  4IUT A;  2QA4 A;  2DKG A;  1QVF A;  4RCC A;  2LC4 A;  3WXM B;  2QQB A;  2JNG A;  1EIF A;  4M7D C;  3BDU A;  5FU7 B;  4M75 E;  2DVE A;  3L2U A;  3OYI A;  3FDR A;  2CZ7 B;  3JCM b;  1BI0 A;  3OYC A;  3QDR B;  5CQY A;  3TU4 K;  1Q7Y C;  4BDZ A;  2RJC A;  5M9O A;  4RCB A;  5CR2 A;  5CIU A;  2EAY A;  2GCX A;  4GY5 A;  3TEE A;  3JCM c;  1BKB A;  3URG A;  3BW1 A;  3RKX A;  1VQ6 A;  2QDY B;  4C92 F;  3NTK A;  1IRE B;  4A54 A;  3M4Y A;  3OYF A;  4RG2 A;  4JRP A;  1V29 B;  3JSC A;  3M57 A;  2X4J A;  3CBP A;  4II1 A;  3VJP A;  3PIO A;  1M1G A;  5FRN A;  3PTA A;  1VQM T;  3V7C A;  2XHC A;  3P8H A;  1KQ2 A;  1RL2 A;  2MF2 A;  4M7A F;  2K5I A;  1VQO T;  2DZC A;  4M7A D;  3FC3 A;  1R8O B;  1XOV A;  1B34 B;  3SD4 A;  2QEX T;  1KHC A;  1Y71 A;  3QKJ A;  2BUD A;  2EQJ A;  4M75 F;  4WF2 A;  3RUX A;  1WJQ A;  4X9C A;  3VUB A;  3C95 A;  2DPP B;  3CC4 A;  3OYL A;  2PUK B;  2VC8 A;  3VKI A;  4C0D B;  5GAM h;  2DTO A;  3KBG A;  2O01 E;  5GAN d;  3ZBD A;  2DD4 A;  5D6X A;  4XU3 A;  3M58 A;  4EPC A;  2EJG A;  5CKH A;  5GAN j;  4JRQ A;  3EAE A;  5DY9 A;  3FJP A;  1ZBX A;  2DXT A;  4L59 A;  4C92 C;  3GOX A;  4BE0 A;  1UGQ B;  4E47 A;  4BI3 A;  3LWI A;  3OYM A;  5I2M A;  5LJ3 e;  2LVM A;  3CCM T;  3JB9 H;  1RI0 A;  5GMK l;  5A0L A;  1OYX A;  1Q81 C;  4O5V A;  2XG8 D;  4ZN3 A;  4DA4 A;  4X9D A;  3NTI A;  2HQE A;  3M56 A;  3CCQ T;  2YRV A;  4V2S A;  2K2V A;  3A8O B;  2M1H A;  1XNI A;  1YJW A;  3S3O A;  4ZGE B;  5IAY A;  3HP9 A;  4M75 C;  4Y28 E;  3GP8 A;  4E7K A;  4FU6 A;  3MCA B;  5GAO p;  1BI1 A;  1PSE A;  2LCL A;  1D3B A;  5HY6 A;  2DTH A;  4M78 E;  2LDM A;  3QJ6 A;  2RJD A;  2RHI A;  4C8Q B;  4JLI A;  4C8Q E;  4IUR A;  2K3Y A;  2B8A A;  4C0G A;  2ZPE B;  3OBY A;  3OSS C;  3P8D A;  5CAI A;  4M7D A;  4JDS A;  3CC7 T;  4JRI A;  2QQR A;  3CEY A;  3CBM A;  3SWN B;  2L8D A;  4LDV A;  3X20 B;  5I21 A;  5DLO A;  5KE2 A;  2OAU A;  2GFA A;  2L3R A;  4HA8 A;  4B9X A;  3HFO A;  4M77 E;  4OB1 B;  3MEW A;  3OQ5 A;  3PMI A;  4R56 A;  3X24 B;  1VQM A;  3E1S A;  2KDS A;  3UT1 A;  2CYZ B;  1ZQ1 A;  2I2L A;  1Y96 A;  1Q82 U;  5FRM A;  4QQG A;  3LLR A;  2P0K A;  4XTU A;  4IUU A;  3KUF A;  3CBO A;  3OS5 A;  2JN0 A;  3M59 A;  1X75 C;  2Y4X A;  3VU3 C;  3NFC A;  4VUB A;  2XI9 A;  2XDP A;  2EQM A;  2IVW A;  2Y4Y A;  4MZT A;  4N4H A;  5GAN 4;  4M78 F;  5GAN e;  3C94 A;  4PKC C;  5GAM f;  3LWH A;  3QG1 A;  2KMT A;  4XTZ A;  2GF7 A;  3CCE T;  3CC2 T;  1GXI E;  3OS0 A;  3I55 T;  3HFN A;  2ZPF B;  2LT1 A;  4C8Q D;  4QQ6 A;  3JCM d;  1H3Z A;  1YI2 T;  2VGN A;  3ER0 A;  3OMG A;  2ZPH B;  3CCM A;  2G3R A;  4KBM B;  3WVE B;  1Y96 B;  2JUF A;  2PVD B;  4M77 F;  4PNO A;  2EYQ A;  4E7J A;  4M77 D;  1JJ2 A;  3KXT A;  2FL7 A;  3DLL A;  3OS2 A;  5CK9 A;  2E41 A;  3CXC A;  2VXE A;  3CCQ A;  1QW1 A;  4HCB A;  1QP3 A;  4C92 A;  3VYG A;  4M7A A;  2VGM A;  3CCS T;  3C12 A;  3GIB A;  3JB9 F;  4JJN K;  1Y7X A;  1QVG S;  3JB9 D;  3EFR A;  2E12 A;  4M78 C;  3CME T;  5A0D A;  2C06 A;  2RJE A;  5LJ3 g;  4QVZ A;  5KH6 A;  1XQH A;  1N6A A;  1QVP A;  2LTO A;  3NTH A;  4OB3 B;  4QW2 A;  2X35 A;  1YJ9 T;  1YJW T;  3QHS A;  4RG8 A;  3CC7 A;  1WQ7 A;  4J6X A;  4IKF A;  4ATO A;  3A8H B;  5CCA A;  2V8K A;  2A3L A;  5A2Q E;  1BIA A;  4JS4 A;  3HPW A;  1M90 U;  1VQK T;  3VUZ A;  4J7I A;  3I56 A;  3JCM W;  3L2R A;  3M55 A;  2JTF A;  2ZGW A;  2PVG B;  3QPH A;  5GAM d;  3HL8 A;  5HK0 A;  1Q81 U;  1S72 T;  3MEU A;  1VQL A;  4A4F A;  3MP8 A;  5GAM j;  2D9T A;  1W2B S;  1FWZ A;  4E7I A;  2OTL T;  3CCR T;  5I2S A;  3ASK A;  4PJO C;  3M5A A;  1QVF S;  4ELZ C;  2KK4 A;  3JCM X;  5LJ5 h;  3CCE A;  2E5Q A;  2KQW A;  1JB0 E;  2E65 A;  3CC2 A;  3P8B B;  4N4I A;  4A4K A;  3OYB A;  3I55 A;  3PFS A;  2ZPB B;  3CCJ A;  1N8R U;  2PVO B;  3L42 A;  3JCM e;  3SDZ A;  2LNV A;  2D0Q B;  2M9U A;  1G3S A;  2RJF A;  2XK0 A;  4CRI A;  1YI2 A;  3EFS A;  4KT0 E;  1VQ9 T;  2V8I A;  2E6N A;  2CZ1 B;  2XU8 A;  5GAN 7;  2IG0 A;  3FLG A;  2XDD A;  5CKD A;  1YIT A;  1BI2 A;  3OY9 A;  3SFM A;  5FU6 C;  2DJZ A;  1LJO A;  4Y91 A;  1UGR B;  4KUL A;  2BKD N;  4NL2 A;  4OVA A;  5D6W A;  1M90 C;  1K9M U;  3CD6 T;  3HSB A;  3Q1J A;  2LQK A;  4PLL A;  2QQS A;  3L2Q A;  4XU2 A;  3CCS A;  1VQ7 A;  1SSF A;  2EQU A;  5GAN 5;  1UB4 A;  2RK1 A;  1UGP B;  4XK8 E;  2CZ0 B;  2P4T A;  3JB9 I;  1FX7 A;  3GF5 A;  5C0M A;  3O8V A;  3GPL A;  4O6J A;  3C4S A;  2EIF A;  2EJ9 A;  2H3J A;  4D6W A;  3CME A;  2WSF E;  4KUI A;  1VQ5 A;  4HT8 A;  4MMK A;  3OMC A;  4C5I A;  3OYA A;  3ME9 A;  4M7A C;  4EMK C;  2RHU A;  3PT9 A;  3G6E T;  4A53 A;  3VYH B;  5GMK m;  3G4S T;  1YJ9 A;  1K8A U;  2EJF A;  4M78 G;  5FU7 C;  1N8R C;  5KCO A;  1U8R A;  3OS1 A;  2K5L A;  4M78 A;  5CO7 A;  3QJY A;  2PUO B;  1NPR A;  2RK2 A;  3S6W A;  1VQK A;  1WJR A;  2E70 A;  5GMK h;  3A8M B;  1VQ8 T;  2FB7 A;  2AHJ B;  2LRQ A;  2RI2 A;  1KQ1 A;  3BFM A;  3E19 A;  3HRU A;  5GAM e;  4FT4 A;  4M7D G;  4BY6 B;  3GLX A;  3E9G A;  2BIV A;  1S72 A;  1KQS A;  3QUI A;  2MI6 A;  3J81 E;  4HCC A;  3DLM A;  1YJN A;  2L89 A;  1K9M C;  2OTL A;  3CCR A;  1WJS A;  3L2W A;  4L5G A;  3RMQ A;  4OGE A;  3I56 T;  4FM4 B;  3QSU A;  3OW2 A;  4ZTJ A;  5LJ5 f;  3LH0 A;  2WSE E;  3OB9 A;  1VQN T;  2RHY A;  2E1H A;  5AYF A;  1D3B B;  2DIQ A;  2DO3 A;  5HKC A;  4FSX A;  1VQL T;  1H64 1;  2L5Q A;  2RB6 A;  4XTV A;  1VQ9 A;  4PJO G;  2F5T X;  4BB7 A;  1M9S A;  1U1T A;  4F7U G;  4PJO A;  3TRE A;  4OB2 B;  2WSC E;  1K8A C;  2JVV A;  1VIE A;  3MO8 A;  2XIC A;  4EDU A;  4F7U A;  4LD9 K;  4M7D B;  3PIP A;  2HBP A;  4C8Q F;  1G3Y A;  3CCJ T;  2DTI A;  3CD6 A;  4N4G A;  1M4Z A;  2EFI A;  3QBY A;  3JCM J;  2E64 A;  1NZ9 A;  3S3M A;  1M8V A;  3JCM g;  3QO3 A;  2EKO A;  3QYG B;  4C0Z A;  3RES A;  2KAF A;  3JB9 J;  3L1A A;  3G71 T;  3HKS A;  3LX7 A;  3A8L B;  1VQP A;  2HD0 A;  1KG1 A;  1NJI U;  3LW5 E;  5GAN 3;  2CS7 A;  1YIT T;  5CVI A;  1KC8 U;  2QXF A;  3GNG A;  3M4G A;  4IUP A;  2XKO C;  4N0A C;  4LDU A;  4MZM A;  4QQD A;  4C92 G;  4BD3 A;  3G6E A;  2CZ6 B;  4KUD K;  3G4S A;  3MP6 A;  2ZPI B;  1WGS A;  4NOY A;  3S3N A;  3MHX A;  4QVD A;  5KE3 A;  1YIJ T;  2R58 A;  1YHQ A;  2FHD A;  1VQ7 T;  2ZPG B;  3RER A;  3MEV A;  2MWO A;  1Q86 U;  5GAO l;  1KHI A;  1N9R A;  3M53 A;  1VQ5 T;  4M7A G;  3MP1 A;  4C8Q C;  2A7Y A;  2V8J A;  4ZN1 A;  3J80 E;  3OYG A;  3CPW S;  4EMK A;  1VQ8 A;  1DJ7 B;  3PNW C;  4ME7 A;  4J83 A;  4M7D D;  2DEQ A;  2DXC A;  4M75 G;  5EG2 A;  4B9W A;  1OZ2 A;  4DQ2 A;  5LJ5 d;  3PGG A;  4M75 A;  1NPP A;  4BUG A;  5FLX E;  1VIF A;  5FU6 B;  3X28 B;  3JCM P;  4UC4 A;  3SWN C;  1QP2 A;  3CXC S;  5LJ5 j;  2R5A A;  3A8G B;  1HXD A;  3BY7 A;  4M77 C;  4JUV A;  3SB2 A;  4HKE A;  4EMG A;  3V8J A;  3OYJ A;  3V8L A;  4C92 B;  3OYN A;  1I81 A;  5GAO r;  4JRK A;  2EWN A;  4PL6 A;  1M1K U;  4HCZ A;  1VQN A;  3HHT B;  3JCM Q;  3PMT A;  2RM4 A;  1NJI C;  2PU9 B;  2NLU A;  4JLG A;  1VUB A;  4C5E A;  2GQV A;  1KC8 C;  3JCM h;  3ZEH A;  5GAO n;  1I8F A;  4P5N A;  1YJN T;  1W2B A;  4M7A B;  5LL6 S;  3V7R A;  5GAN 2;  4EMK B;  1O9S A;  1UGS B;  3GNF B;  4BDY A;  1K73 U;  2M16 A;  4ZGJ B;  1JRI A;  1JBM A;  3F70 A;  4DOW A;  2O4X A;  4M75 B;  2F69 A;  2RHZ A;  2E10 A;  1M5Q 1;  2K57 A;  4GLK A;  1Q86 C;  4XTW A;  3BDL A;  2DIG A;  2JOY A;  1B34 A;  1X01 A;  3N5B B;  2RO0 A;  4A4H A;  2WAC A;  4ZGD B;  4E7L A;  4J5Y A;  1KD1 U;  4PLI A;  2QQ9 A;  5A0G A;  1M1F A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...