4EMGA

Crystal structure of splsm3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
71
Chain Sequence
EPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNMVLGDAEEIVTTIRKHYEMLFVRGDSVILIAPPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable U6 snRNA-associated Sm-like protein LSm3
publication title Crystal Structures of Lsm3, Lsm4 and Lsm5/6/7 from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 16
structure length 71
sequence length 85
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4emgA00
2EJFA 4XU2A 5LJ5g 4XU1A 5GANf 1B34A 4EMKC 3V7SA 2DEQA 4C92E 4HA8A 1HXDA 5GAOn 2EJ9A 2VXFA 1B34B 5LJ3d 5GMKj 2DTOA 3JCMP 1KQ2A 2RD1A 5LJ5e 3PGGA 4M77A 3V7RA 2RB6A 2I2LA 3INZA 4JRIA 5DY9A 4M77C 3BDUA 4EMHA 3QHSA 4RCBA 5GAOq 5LJ5f 3JCMb 4MMKA 5GAMj 4M75C 5GAOm 2E41A 5GAMh 3FJPA 2DKGA 4C8QF 4C8QA 5GMKm 1I5LA 4M78F 4M78A 5GAMd 3QO3A 4OP0A 4C8QC 3FIFA 4M78C 5LJ3g 5GAN8 3M4GA 1I8FA 1I81A 2FB7A 1Y96A 5GAOr 3JB9J 3JCMX 2YLBA 2DVEA 4M7AE 1WQ7A 3QSUA 3JB9I 1Y96B 4XTZA 3BFMA 3SWNA 3FB9A 4WF2A 1N9RA 5LJ3e 1TH7A 3SWNB 4C8QG 4M7AD 4M78G 3V8JA 3HSBA 5GANj 5GAOp 2E64A 5GMKh 3VU3C 3JCMJ 4C92D 4M7AA 4M7AF 4EMGA 5LJ3f 2RA2A 3EFSA 4M7AB 4NL2A 3RKXA 3RKWA 4C92F 4C92A 5GMKl 3JCMg 3JCMh 3V8LA 4XQ3A 4M7DE 4QVCA 4C92B 3BW1A 4A54A 2VXEA 2EWNA 2YLCA 4NL3A 1M8VA 3JCMd 5GAMg 3JCMc 2YHTA 3L1AA 1BIAA 1KQ1A 4M7DD 4PJOE 3HFNA 2VC8A 4J5YA 5GAN4 4M7AG 4PNOA 3HFOA 3RKYA 5GAMe 4MMLA 1WNLA 1LJOA 4C92G 2CGHA 4PJOD 2QTXA 4M7DB 2DJZA 4JRKA 4RCCA 5CAIA 1U1SA 1LNXA 1M5Q1 4PJOF 4PJOA 5GAMf 3SWNC 3JB9H 1D3BA 3JCMW 2EAYA 1YCYA 4PJOB 4HT8A 3SB2A 4F7UE 1X01A 5GAN7 1D3BB 2Y90A 4XTVA 2E65A 5GANg 5GANh 4XU3A 3RUXA 5I21A 4JUVA 5GAOl 4X9DA 4M7AC 3EFRA 4NOYA 4N0AA 5GANd 2FYKA 5GAN5 3JCMQ 4Y91A 4J6YA 2E10A 4XTYA 4C92C 5GMKe 2E1HA 4PJOG 4F7UF 5LJ3j 4JLIA 3AHUA 2ZGWA 4DQ2A 3GIBA 4F7UB 2HNIA 5LJ5j 1U1TA 2DXTA 2DXUA 3JCMV 4EMKA 1BIBA 4M77E 2DTIA 1LOJA 4QVDA 5LJ5h 3JCMe 4XTUA 1JBMA 1WPYA 4M7DA 4M7DF 4V2SA 4EMKB 3QUIA 5LJ5d 1MGQA 3JB9D 4M75E 4M7DC 3JCMf 4M77D 2JN0A 4X9CA 3JB9F 4F7UG 2DTHA 4M77F 3L2ZA 4C8QE 1WQWA 4M78E 4M75D 4PJOC 1N9SA 1I4K1 2DZ9A 2DZCA 4HT9A 4M77B 5GAN3 4M75F 4M75A 3RERA 1JRIA 4C8QD 3BY7A 3RESA 4M78D 4M7DG 1HK9A 4M75B 4A53A 5GAN6 4J6WA 2EJGA 4XTWA 4N0AC 3V7CA 5GMKi 3JB9G 4J6XA 4C8QB 4F7UA 5GANe 4M78B 5GAN2 4M77G 4XU0A 1H641 5LJ3h 3V8KA 2RM4A 2K57A 3RIRA 4XTXA 4M75G
chains in the Genus database with same CATH superfamily
3CCUT 5LJ5g 5HCKA 4QW2A 1T3SA 3V7SA 2A0FB 3EGDB 3LX7A 4LE9A 3CC7Q 1YI2Q 2F5KA 4X1VA 2R57A 1V76A 3M0TA 5LJ5e 1WI7A 2K5LA 3QZ9B 1I1JA 4L6V5 2DLPA 3QHSA 2JTFA 2LT1A 1PC0A 4ZTJA 2ESWA 5D6YA 1UG1A 2O2OA 3TSZA 4PK4A 3M59A 3GLXA 4KBMB 3OYLA 3CCMT 1PD0A 3X20B 3QPHA 2YUNA 2QXFA 4BDZA 1R77A 1QVGS 4DBRA 4D6WA 2HD0A 2AZVA 5HK0A 4M78G 3PFSA 3CCEQ 3KUFA 2HDAA 1UJ0A 3RKWA 2KXDA 2WSEE 3M53A 3QXEB 1WXTA 2YUOA 2YWWA 2X4WA 2CP3A 2DNUA 3QJ6A 3FRNA 3MHXA 1LNXA 2OTLA 5A2QE 4OMNA 1TUDA 4PJOB 1M1FA 2EYWA 3JV3A 4HKEA 4JUVA 2COWA 1YHQA 1VQ5T 2E70A 2E10A 1G8XA 3A5ZB 1VQLA 3OYJA 2C0IA 3I55T 4E7JA 4DBFA 1X6OA 3QDFA 1LOJA 2HMAA 1WPYA 4PL6A 4JS5A 1ZHIA 3PT9A 5EC7A 3JB9D 2X9HA 2CH4W 1FMKA 1Y07A 3OW2P 2D1XA 3OS2A 2JMCA 1WQWA 3DKMA 1KQSP 5GAN3 2F2WA 2MMPA 1ZBXA 3LYIA 3NTKA 1VYVA 4XU0A 3CCSA 4CC2A 1PKTA 3JSCA 1OV3A 2O9VA 1KQ2A 2RB6A 1T3LA 1YIJT 1I0CA 2EQMA 4AG2C 3JCMb 1QWEA 4FYYB 3CXCP 1SF9A 3OMCA 3OYFA 1YJ9T 3QBYA 1VQKA 4AFZC 4M78C 4RTVA 4XK8E 1T0JA 2E5KA 3CD6T 1VQ6A 2DX1A 4WF2A 1D1AA 4ORZA 2IIMA 3CQTA 4M7AF 3PMTA 1T0HA 1VYTA 2KNBB 3BW1A 4A54A 2EFIA 1TSFA 3CC4A 3CBPA 1X2QA 2ENMA 3I35A 2CP0A 4KH0B 1N8RU 2J05A 3SWNC 1EFNA 4PJNA 3CCUA 2K6DA 3KBGA 3L2WA 5IHKA 4JJNK 4XTVA 1AHJB 2J6KA 1YWPA 2OTJQ 1NJIC 1G3SA 1QVFP 2EQUA 5CKFA 2P84A 2DXUA 4RTUA 4HCZA 4L5GA 4J9FA 2VVKA 1BI2A 2FVUA 1UFFA 1WFWA 1RLQC 5CO7A 2D8JA 4J9CA 3M58A 3CEYA 3SDZA 3GNFB 4ELZC 3EFOA 3CPWS 3RERA 2Y4XA 2CP7A 2AKLA 4O5VA 3KFVA 3OW2A 4CC7A 3VUBA 5J26A 1KQSA 4OB1B 3MEUA 1N8RR 3OS0A 3EAEA 4IIMA 3RR6A 1NYGA 3RIRA 5LJ3d 2QA4A 3PNWC 3MP1A 2ZPHB 2FHDA 4FCYA 2C0TA 5GMKj 5C0MA 1X6GA 3CCLQ 4FYXB 5CKBA 3ZL7C 1VQOT 2I2LA 4M77C 4KT0E 2A08A 2HSEB 2NLUA 2RO0A 2NYSA 5FW9A 4A63B 5GAMj 4M75C 2K79A 3RNJA 2RJCA 1K9MU 1H3ZA 2QEXA 4RG2A 3CBMA 1VQ5A 1BU1A 4GLMA 3CXCA 1PM3A 1NYFA 3JB9I 2OJ2A 1QW1A 1K4US 3VS5A 2LNHB 1O9SA 1YJNA 2X3XD 2QASA 2B86A 3REAB 1PSFA 1JJ2P 2EWNA 1VQ4Q 2XU8A 3OYIA 1NEGA 2HQXA 5DLQE 2CYZB 2DIGA 4LXCA 1XQHA 4PJOF 3OSVA 5FWCA 3JAME 1G83A 5IHIA 3C0CA 4YTLA 3CMAQ 4P5NA 4D8KA 1UDLA 3P8DA 1PRLC 1BBZA 3I56T 1NE8A 2K5IA 1K9MR 1C0MA 1UECA 1YIJA 5D7UA 4JLIA 3H0IA 2HBWA 2EYQA 3MEVA 4OB2B 1B07A 4Z8AA 1MGQA 3M4YA 3E19A 1QVFA 4IUTA 2VGMA 2NUPA 3CD6A 2V1QA 1YNZA 2FPFA 3OMGA 3EFOB 3TU4K 4M7DG 1I5OB 3THKA 3MEAA 3X28B 2RQUA 3CMEQ 4E7HA 4J6XA 4C8QB 1M2VA 4C5IA 4XU1A 1VA7A 4KGXB 2EJ9A 2RI2A 4PLLA 6AT1B 1MMAA 1IO6A 4JRIA 4FL6A 4FW1A 1N5ZA 2CH4A 2E3HA 1JEGA 4MMKA 2LC4A 2E41A 1QQJA 5EG2A 3OYBA 2KK4A 3FLGA 5GAMd 4OGCA 1AWOA 1EIFA 4ANJA 3VKIA 3L2UA 1ZUKA 4MDXA 5CVIA 4M7AE 4ME7A 3HTRA 2QQSA 5GANj 3NFCA 1Q7YC 1UJYA 1WIEA 2MWPA 5LJ3f 3CCJQ 3G4SQ 2LJ3A 2IPOB 1FMVA 4GLKA 3M57A 1BK2A 3MCAB 1X69A 4K11A 3JCMc 2IVWA 2RHUA 5HY6A 2RK1A 2CUDA 2O9SA 2QGFB 1VQ7T 1P92A 4R56A 2DYBA 1OPKA 4C92G 4ZNXA 3X25B 1Y0MA 3G6ET 2WACA 1SPKA 2RPNA 1D3BA 1MV3A 4JS4A 3LWHA 2E6NA 2J06A 1FXXA 1WHHA 3NGPA 2HKNA 3WXMB 4NOYA 1VQOA 2BE9B 4C5GA 2DXBA 1PNJA 5FRMA 2RJFA 5IN1A 2QAZA 2HKQB 4J9DA 2KYBA 1JBMA 3CCLT 5DLOA 4M7DC 5KYXA 2JN0A 1FWZA 1WJRA 2K2VA 3OS5A 1IGUA 2L2PA 1PD1A 1Y57A 2KR3A 3OYEA 1X27A 2PZ1A 2RNAA 2QYZA 2EJFA 2FL7A 1M1KC 1VQ8T 9ATCB 4C0DC 4LDWA 2DA9A 5IT9E 1H3HA 2A7YA 1OZ3A 3V7RA 5DY9A 4ELYC 3FDRA 1GFCA 5CR2A 2ED1A 4B9WA 3OYDA 2FZKB 3M0RA 3P8BB 2L3RA 3FIFA 4IUVA 1U8RA 1E6GA 2HQHA 4DBHA 1WQ7A 3SWNA 1Y71A 3ASKA 2E3IA 3X26B 3QYHB 3C4SA 4DOWA 1AWXA 1Q81C 5GMKh 4C92D 1UHFA 2LJ1A 1VQMQ 3JCMh 3BE3A 2YLCA 1UGQB 4OMOA 1AT1B 2J6OA 2KT1A 2X4XA 4HCBA 4PJOE 3TEEA 1KC8C 1M5Q1 2MCNA 5GAMf 2YXYA 2AK5A 1VQNQ 1D3BB 3CMET 1NLOC 4AFSC 1RI9A 3GNGA 2VKNA 4AFUC 2LCSA 3SHWA 2ZGWA 1U1TA 4MZPA 5D6XA 4XTUA 3NHNA 2V8IA 1VQ9T 5KYXB 2JZ2A 2HSPA 1RAAB 1IHWA 2BUDA 4M75A 4ZN3A 3BY7A 4R0KA 4J6WA 2EJGA 2OTJA 5AT1B 2K3XA 4M78B 3PMIA 2JS0A 2KY9A 1JJ2S 3T9NA 3OYGA 1VQ7A 2DTOA 5GJVB 1J3TA 2LRQA 4AMCA 4DBQA 3NTHA 3OA6A 1CKBA 1RLPC 1KK7A 4DEXA 3CC4T 5KCOA 2HAXA 2ZPIB 4J9IA 3ZFJA 3HRTA 3JB9J 5KYNA 3JCMX 4MZMA 1M1GA 2RF0A 3CCRQ 3QWYA 3SWNB 3V8JA 2EQKA 3HSBA 4FT2A 4FU6A 2PUOB 3CCLA 2A37A 2BTTA 5ECAA 3JRZA 1TG0A 2XDPA 1YP5A 3OYNA 3H0HA 5FU6C 2LNVA 1M8VA 3H0FA 4C5HA 2L3PA 3OYHA 3HFNA 1KJWA 1O75A 1JU5C 4M7AG 1AOJA 1OI1A 1Y7XA 2LQKA 2DJZA 1OULA 2ROTA 2RI3A 3OS1A 4F16A 1VQ8A 4LUEA 5GANh 1QMCA 2R5MA 3GPLA 1S72Q 1K73C 1LVKA 2KI7A 1VQ4A 3LW5E 2QA4T 3OBYA 4F7UB 1C1AA 1BIBA 1W2BP 2YRCA 5LJ5h 1BB9A 4CI0C 2F5TX 2CSQA 1GFDA 1K8AC 2FG0A 2DE0X 4J8OA 4N4IA 7AT1B 2KVQG 4M77B 1R8OB 2FRWA 1YBYA 2MF2A 2QEXT 4M75B 1GBQA 1IZ6A 4EIKA 1Q81R 3LWIA 2JM9A 4PLIA 1SEMA 3QYGB 3J81E 2KGTA 1VOMA 2FZCB 1R0CB 1WHKA 2FZGB 1QP3A 4LDYA 3PVLA 1H92A 4Q5WA 1YJNT 1UGPB 3X24B 1X6BA 3UT1A 1PG5B 2QQBA 2K7AA 4BE1A 2L89A 4HCCA 4MZTA 5GMKm 3CMEA 1BYMA 3HHTB 4JZ3A 1IB8A 1YITQ 1I8FA 1Q86U 4XTZA 2OX7A 3ER0A 2ATCB 1RAEB 3VYHB 4M7AD 4ATOA 4J9BA 2K4YA 2HL3A 2YUQA 3QG1A 1F1BB 2I0NA 1G3YA 2VASA 1VQ9A 2JMAA 4JLGA 4ZN1A 4XQ3A 3HP9A 1DJ7B 2KMTA 1Z9ZA 3A8GB 4MMLA 2DERA 2M16A 1NM7A 5KYWB 2LT4A 3JB9H 2P0QA 3WVEB 2HL5C 2ZPGB 4EDUA 1KHCA 1IGQA 1YJWQ 4MDWA 2EVRA 4J6YA 2E1HA 1QCNA 4PJOG 1Q86R 1OX9A 4J7FA 2G3RA 2NUZA 2RI5A 4ZGJB 4X34A 1W4SA 3VV0A 4C8QE 4OVAA 1W2BA 4IUPA 2HEQA 1ZA1B 5L8RE 2V8KA 2DM1A 1K0SA 3CCQT 1EZZB 4RUGA 2YDLA 1M2OA 3CCRT 1H641 2H3JA 1K8AU 2LVMA 2J7IA 2K57A 3CC7T 5J3BA 1YI2T 4IURA 1PHTA 8ATCB 2CS7A 2DEQA 1M3CA 4OB0B 3LGFA 8AT1B 1WX6A 2XI9A 2OAUA 3EGUA 3INZA 2LX7A 2QK0A 2GGRA 2RHYA 4BACA 1WHGA 4JPBW 2KAFA 2E12A 2RK2A 4C8QA 2MI6A 3VS7A 3I9QA 4CC4B 1HJDA 5CK9A 1VQPQ 2FO0A 1K73R 3CC2Q 3CCET 2P0PA 3QDRB 1IHVA 1ZSGA 1ZSZC 2BIVA 3C95A 3E9FA 3JCMJ 4OB3B 4E7LA 1BCOA 2RQVA 1M90C 2M51A 2OI3A 2EGCA 1K8AR 1CKAA 2YSQA 1KQ1A 4QQGA 3HFOA 2MIOA 3GBQA 3P8HA 4BUGA 4PJOD 4M7DB 1GRIA 3OYCA 3Q1JA 3REBB 2KDSA 2VV5A 1YCYA 1G3WA 3A8MB 2F69A 2DYIA 2Y90A 2E65A 3GP8A 5GAOl 3EFRA 3M5AA 1NEBA 3JCMQ 4F7UF 1RAHB 2QQRA 2WSCE 1ZBJA 1KHIA 2LJ0A 1JXMA 4LUDA 4OF1A 2DVJA 2YT6A 1ZQ1A 1RABB 2MWOA 2DRMA 4C0DB 3RBBB 1U3OA 3EH1A 3M56A 4M77F 1I4K1 4M75F 2HZYA 3LGLA 4LDVA 1NLPC 1JXOA 2FRYA 5HK3A 5IHNA 5LL6S 2RQRA 2NUTB 1AZEA 5A0DA 3V8KA 2RJDA 4QT7A 1B34A 3G71Q 1WA7A 2OTLQ 2EKHA 5IXBA 2RHXA 2EIFA 1KD1C 1NJIU 4J9EA 1KIKA 5HKCA 2DO3A 4KUIA 3L2VA 3H9NA 3SD4A 1OOTA 1UUEA 1VQLQ 3QO3A 4N4HA 5LJ3g 5GAN8 2PUKB 1V29B 3EH2A 1QP2A 4IIOA 5LJ3e 5GAOp 2W10A 4OMLA 2IG0A 2DL7A 3V8LA 3HL8A 4QVCA 4NL3A 1RAGB 3JCMd 1QVGP 1QVPA 3CCQA 1TWBA 4OGEA 4R55A 2CZ7B 3CCRA 2BE7D 1U1SA 1NJIR 1WYXA 2KROA 4E7KA 3CC7A 3JCMW 1YI2A 2EAYA 2QG9B 1M3BA 3SB2A 5GAN7 2OTJT 1YCSB 4BB7A 2RMOA 5I21A 3OW2S 1AVZC 1VQKQ 1GXIE 1VIEA 2GFUA 1KQSS 1D09B 2JNGA 3TSWA 5D6WA 2HNIA 1WJQA 1RAIB 5LJ5j 5KYYA 4L59A 2AHJB 2CZ6B 1CSKA 3META 4PKCC 1WHLA 1HD3A 1PCXA 4Z88A 1M3AA 4M78E 1RAFB 3VS6A 1JRIA 3CCEA 1WHMA 2JTEA 4PJLA 2PNIA 3EHRA 4C0GA 3CXCS 3QSUA 4XU2A 1OPLA 2LMJA 4QVZA 4EMKC 3DLMA 2PVDB 2VXFA 1B34B 3CCUQ 2SEMA 3EGXA 2D0NA 3NPFA 4F14A 2PVGB 2EGEA 3BDUA 4A4FA 1RL2A 3QWXX 5FU6B 2VYTA 2M02A 4M78A 2XK0A 2AKKA 2V26A 5FRNA 1SRLA 2FB7A 1KD1U 2PVOB 3QZ5B 2DVEA 3CCMQ 1FYNA 4UC4A 4JJDA 2COYA 1YFNA 3EG3A 1YWOA 4LNPA 2MPXC 5A0LA 1TXQA 1AWJA 3TCJA 1VQ4T 2EW3A 2ZZDA 2A36A 2K2MA 3JCMg 5GAMg 3OYAA 2X4YA 3OBWA 4J5YA 2M0OA 1BI3A 2QDYB 5GAMe 4PFPA 3CMAT 4JRKA 4RCCA 1QVFS 1QVGA 3A98A 1E7OA 2A28A 1FX7A 2ZPFB 4Z89A 1WLPB 4F7UE 3EG1A 2BZYA 1NZ9A 5C6SA 4RTZA 3UF4A 5GANd 4E47A 1UGSB 2A3LA 4C92C 3RDVA 3UA6A 3DLLA 1KD1R 1VQ5Q 2JS2A 4DQ2A 3CCVQ 3GIBA 2CZ1B 3JCMV 1D1CA 2FEIA 4M77E 1Q7YU 5KYYB 5LJ5d 3I55Q 4M75E 3JCMf 2CT3A 3LH5A 3G1JA 2L0AA 3VJPA 4C8QD 3RESA 4II1A 3EG9A 1N6AA 2RN8A 3M9QA 5FLXE 2LCCA 4F7UA 1BKBA 1PRMC 1M27C 2SRCA 4GY5A 4OMPA 3HRSA 1QCFA 3CPWP 1WZOA 4HA8A 4ZGDB 2ECZA 2DL5A 2XDBA 4FYWB 2MK5A 3FEOA 4CC3A 2RD1A 2R58A 3PGGA 4M77A 1RADB 3EGXB 3QJYA 1ZA2B 4EMHA 4J83A 3R6NA 1NPPA 1M30A 1Q95G 4C8QF 1I5LA 2LQWA 1Q7YR 1QKXA 3OYKA 2LX9A 1I81A 2O4XB 1YJ9Q 2LDMA 3MPUB 1G2BA 4FIBA 4BD3A 5GJWB 1KG1A 2COZA 2EGAA 2PTKA 3CCJT 3G4ST 4FYVB 2E64A 3VU3C 1K0XA 3ME9A 3RKXA 2L8DA 4KGVB 2JJ9A 1M1KU 2XHCA 3UWNA 1SSFA 1VYUA 4J9HA 2CSIA 2GFAA 1TUCA 2QTXA 4FT4A 1UE9A 2XKOC 3CC2A 2W0ZA 3DB3A 2QQ9A 4D8DA 5GANg 4C5EA 4XU3A 4LD9K 2KT8A 1SHGA 4Y91A 2BKDN 3MKDA 2C06A 3TQ7P 2EYZA 1B7TA 3A8OB 2DTIA 1Q81U 1MMDA 2HBPA 5KYWA 3ZEHA 4OMQA 2XD0A 4A4GA 3H41A 3L2ZA 2DZ9A 3TREA 3TVTA 2ED0A 2ZPBB 1M1KR 3CPFA 3EG2A 4A53A 2DF6A 1SHFA 1BI1A 4N0AC 3EG9B 1KC8U 1IXDA 1ACMB 3UDCA 5GAN2 5DM7R 2DD5A 3F70A 1RACB 4XTXA 1OU9A 5GANf 2JW4A 2P4TA 2EPDA 4Y28E 3VRZA 4HVUA 1LPLA 5FU7C 1ZSZB 1N8RC 3CMAA 3CPWA 5CCAA 5LJ5f 1VQOQ 2O01E 5GAOm 4IKFA 5I2SA 4OMFB 1RUWA 1X75C 1KFZA 1OX8A 4RG8A 5GAOr 2E6ZA 2KRMA 1QWFA 5I2MA 3G71A 2G6FX 2ZPEB 4DOVA 1UEBA 1VQMT 3MEWA 4JDSA 1MMNA 2DBKA 2H3EB 2LQ8A 3EFSA 1KC8R 2AIRB 3CCVT 4M7DE 1SKUB 2OAWA 1ABQA 3HPWA 1X43A 1AWWA 2JM8A 2GBQA 2KE9A 1WNLA 1LJOA 2XMFA 1NBEB 2MOXA 3L2RA 1XNIA 1VQNT 1PKSA 1C6VX 3SEMA 1TS9A 4M4ZA 2LP5A 4HT8A 2RJEA 4B9XA 3FC3A 1K1ZA 1OU8A 4M7AC 1M8MA 3LH0A 1D1BA 2QGGA 3O5ZA 2K3YA 2KSSA 1SRMA 4BY6C 5LJ3j 3I56Q 4QKUA 4EMKA 1VUBA 1WJSA 4QVDA 4M7DA 3HKSA 2X35A 2YRVA 1K9MC 2F2XA 2DL8A 3JB9F 4A4EA 4F7UG 2DPPB 3M55A 3U23A 4HT9A 2GQVA 5AYFA 1UGRB 1V1CA 3ZBDA 1D0ZA 3G4SA 4M78D 3CCJA 5IAYA 2DILA 2BZ8A 4XTWA 1IREB 2CT4A 4PFOA 4M77G 3M0QA 1G5VA 2QI2A 3E2UA 2RM4A 1GBRA 4M75G 4KULA 1RI0A 4C92E 1HXDA 2XICA 2MYSA 4E2FB 3EHQA 2MAMA 4QQDA 1M9SA 1K73U 4WCIA 2GTOA 2VGNA 2ZAEA 2BZXA 2DBMA 2NWMA 3FJPA 4M78F 2RQWA 2DK3A 2NUTA 2EYXA 1XJWB 2LZ6B 3OYMA 1XOVA 1Y96A 4QQ6A 2M0YA 3BFMA 2F2VA 2JTMA 2HCKA 2DETA 2P0KA 2K9GA 4DA4A 1IRXA 3UA7A 1BCMA 4F04B 1BI0A 4AFQC 5CKDA 4C92A 4RKUE 4J9GA 2DAQA 2CP5A 4HCKA 3L1AA 2Y4YA 4CRIA 4JJCA 5L23A 3S3MA 3I5RA 3M54A 1A0NB 4PNOA 4HVWA 2CGHA 2K5FA 1NG2A 3PIPA 3CCMA 1U5SA 5A0GA 5CAIA 1VQ7Q 5CIUA 3UATA 5J39A 5KE2A 1UB4A 3G6EQ 1K9AA 3GOXA 1S72T 2XDDA 1WGSA 3URGA 4J7IA 5FWBA 4XTYA 1SSHA 3M0PA 1GCQC 2GTJA 3ULRB 1GL5A 5KE3A 2KRNA 3HRUA 1AEYA 4EMKB 2RQTA 4M77D 3QIIA 3I5SA 2J6FA 2DL3A 2Z0WA 4M75D 4PJOC 1N9SA 3MO8A 2VUBA 1ZX6A 4A4KA 3O8VA 1ZUUA 1VQMA 1B3QA 2H8HA 2D9TA 3V7CA 1WXBA 3CCVA 4VUBA 3GF5A 2C0OA 2DEUA 3H8ZA 1QCOA 4JZ4A 3E1SA 3I55A 3R6OA 3MP8A 1MV0B 1VQ8Q 3J7AF 2DRKA 2O31A 1VQNA 3IQLA 3VS4A 4A4HA 1X2KA 2LQNA 1M4ZA 4BI8B 1YITT 4RTTA 2AZSA 2DXCA 4AG1C 4FM4B 1WHJA 2X3WD 2YLBA 1Y96B 4HVVA 1QKWA 4BE0A 1MMGA 3FB9A 4GBQA 1TH7A 5CQXA 4FSXA 2ZCFB 4EMGA 2JUFA 1YHQQ 4NL2A 5GMKl 4C92B 3G7ZA 2VXEA 2JT4A 2YHTA 1BIAA 4DEYA 2DMOA 3J80E 2QDLA 2L5QA 1N27A 2X4JA 1YJ9A 4PJMA 4B6MA 4ESRA 3L2QA 2D6FA 3MJXA 4PFZA 5FROA 5CQYA 1W2BS 1YJWT 1U06A 5I22A 1ABOA 3RUXA 5IXFA 4N0AA 2XIDA 4BI4A 2EYYA 3E9GA 1UTIA 1WXUA 3CCSQ 1HSQA 2DXTA 1Q82C 2GNCA 2EBPA 3M0UA 4F17A 2YRDA 2LCLA 3RMSA 4LDUA 4X9CA 4FSSA 1M90U 4KH1B 1VQ9Q 4OMMA 1MNEA 3UPUA 3A8HB 1PWTA 1W1FA 5KH6A 3SFMA 3VRYA 4HXJA 5LJ3h 4NS5A 3OB9A 2QQAA 4AT1B 4Z02A 1VQ6Q 2DFUA 5GAOn 1W70A 1JQQA 1QLYA 1H8KA 5IH2A 3AT1B 2EKOA 2PU9B 3PE0A 1PSEA 1G3TA 1E6HA 1OZ2A 1VQPT 4LD6A 1S72A 1EX4A 2CKKA 3RMQA 3OY9A 3CC4Q 4BDYA 2CREA 2JXBA 3CC2T 1JJ2A 1NPRA 1M90R 4E7IA 1KSWA 4C8QG 2F1LA 3H6ZA 3OYYA 4LN2A 1TUGB 2O88A 2EQIA 4M7AA 3C94A 3NTIA 2RA2A 5KYUA 1SG5A 3OQ5A 1OQKA 3N5BB 3NMZC 2CUBA 4JRPA 4ZTFA 1TU0B 4M7DD 1UHCA 2O4XA 2D0QB 2YUPA 3S6WA 3KXTA 3FJ5A 2P4RA 3RKYA 1JB0E 4C0ZA 2GCXA 4ZGEB 2JOYA 2GF7A 4KUDK 1X01A 2KQWA 2NUPB 3PIOA 5CKHA 4N4GA 1GCPA 5GMKe 1WDXA 3VS0A 1AD5A 1MHNA 2KBTA 2VWFA 2KYMA 3JCMe 4JRQA 1M2VB 2QA4Q 1YITA 4M7DF 1MNDA 2ABLA 2PQWA 4RTXA 5FU7B 2DTHA 4BE2A 1LCKA 5CKEA 3VS2A 3S3NA 2LTOA 1OYXA 1ZUYA 1Q82U 3QKJA 5GAN6 2V8JA 5M9OA 3A1PA 3I56A 1AZGB 2QEXQ 3G71T 2OTLT 1UGVA 2RHIA 3EGDA 2L3QA 2M9UA 1K76A 2GQIA 1I07A 1ARKA 4BI3A 4FW2A 4IUUA 1YHQT 2M1HA 3JCMP 4JJBA 4E7SA 3PTAA 1YJNQ 2D8HA 4RCBA 5GAOq 1VQLT 4RMOA 2DIQA 3VS1A 1YJWA 5GAMh 2DKGA 2XG8D 4O6JA 1ZLMA 2ROLA 2JVVA 4C8QC 4OP0A 4Y92A 2RH2A 3M4GA 4EPCA 3VS3A 2KEAA 2VB6A 4PJJA 1N9RA 1ZSZA 4XAXB 5KCHA 2DL4A 1FMWA 1Q82R 3LLRA 1D0XA 4E6RA 1JO8A 4C92F 1TTHB 4KGZB 4M7AB 3S3OA 3L42A 3CCST 2K3BA 1GCQA 1R0BG 4C0FA 5KYUB 4BY6B 3A8LB 3DB4A 1YIJQ 2VC8A 5GAN4 2FPDA 2DJQA 1Z9QA 2EQJA 4PJOA 2CDTA 3C12A 1OEBA 1MUZA 4KRTA 3CD6Q 3OSSC 1VQKT 2CP2A 2RHZA 4X9DA 2FYKA 2QTVA 5GAN5 2CZ0B 2WSFE 3BDLA 4IUQA 2CP6A 1VIFA 1HYOA 2E4HA 2HQEA 3AHUA 1VQ6T 3CBOA 3EG0A 3MP6A 1D0YA 1TOVA 2L3SA 5I11A 2KRSA 1VQPA 4V2SA 3QUIA 2B8AA 2E5QA 2KXCA 1Q86C 4RTYA 1YN8A 2X51A 3VYGA 2AT1B 1XTDA 3G6EA 2DZCA 4LDXA 3M0SA 4TVRA 1S1NA 3PVQA 4RTWA 1HK9A 2R5AA 3D7SB 1W6XA 3WVDB 5GMKi 3JB9G 3CCQQ 5GANe 2FPEA 4WTOB 4E7ZA 3VUZA 2V1RA 2DD4A
chains in the Genus database with same CATH topology
2EJFA 2FL7A 5LJ5g 3CCUT 4QW2A 1B34A 1M1KC 4KULA 3V7SA 1RI0A 4C92E 1VQ8T 1HXDA 2XICA 3LX7A 4C0DC 4LDWA 2F5KA 2RHXA 2MAMA 5IT9E 4QQDA 2A7YA 2R57A 2EIFA 1OZ3A 1M9SA 5LJ5e 2K5LA 1K73U 3V7RA 1KD1C 3QZ9B 4L6V5 1NJIU 5DY9A 4ELYC 2VGNA 4IKFA 3FDRA 3QHSA 5CR2A 2JTFA 2LT1A 4ZTJA 5HKCA 4B9WA 2DO3A 4KUIA 5D6YA 3OYDA 3L2VA 3P8BB 3FJPA 3SD4A 4M78F 2L3RA 3M59A 2DK3A 3GLXA 3QO3A 4KBMB 3FIFA 3OYLA 4N4HA 3CCMT 3OYMA 3X20B 1XOVA 3QPHA 2QXFA 4IUVA 5LJ3g 5GAN8 1Y96A 4BDZA 1U8RA 2PUKB 4QQ6A 1V29B 1WQ7A 3SWNA 3BFMA 1QP2A 1QVGS 1Y71A 3ASKA 4D6WA 2HD0A 3X26B 3QYHB 5LJ3e 5HK0A 2JTMA 4M78G 2P0KA 3C4SA 3PFSA 4DA4A 4DOWA 5GAOp 1Q81C 5GMKh 4C92D 3KUFA 1BI0A 2IG0A 3RKWA 4C92A 5CKDA 4RKUE 3JCMh 3V8LA 2DAQA 3HL8A 4QVCA 4NL3A 2YLCA 1UGQB 2WSEE 3JCMd 3M53A 3L1AA 2Y4YA 1QVPA 3QXEB 4CRIA 2X4XA 4HCBA 4PJOE 3S3MA 3CCQA 3M54A 4PNOA 3TEEA 2X4WA 4OGEA 4R55A 1KC8C 2CZ7B 2CGHA 3QJ6A 2K5FA 3PIPA 3CCMA 3FRNA 5A0GA 5CAIA 3CCRA 1U1SA 3MHXA 1LNXA 1M5Q1 2OTLA 5CIUA 5GAMf 5A2QE 4E7KA 3CC7A 3JCMW 5J39A 5KE2A 2EAYA 1YI2A 4PJOB 1UB4A 3SB2A 1M1FA 3GOXA 5GAN7 1D3BB 1S72T 3CMET 4HKEA 2OTJT 4BB7A 5I21A 4JUVA 2XDDA 1WGSA 1YHQA 3URGA 1VQ5T 4J7IA 3OW2S 2E70A 3GNGA 2E10A 4XTYA 1GXIE 3A5ZB 1VIEA 2GFUA 1KQSS 2JNGA 2ZGWA 1VQLA 5D6WA 5KE3A 2HNIA 1WJQA 5LJ5j 3OYJA 1U1TA 3I55T 4E7JA 1X6OA 1LOJA 3HRUA 4MZPA 5D6XA 4XTUA 4L59A 1WPYA 4PL6A 2AHJB 2CZ6B 4EMKB 1ZHIA 3PT9A 4JS5A 3JB9D 2V8IA 3META 4M77D 3QIIA 1Y07A 4PKCC 1VQ9T 3OS2A 2JZ2A 1WQWA 3DKMA 4M78E 4M75D 1N9SA 4PJOC 3MO8A 2VUBA 5GAN3 2BUDA 4A4KA 4M75A 3O8VA 1JRIA 4ZN3A 3CCEA 3BY7A 1VQMA 2MMPA 1ZBXA 3LYIA 4J6WA 2EJGA 2OTJA 2D9TA 3V7CA 3NTKA 2K3XA 4M78B 4XU0A 3PMIA 4C0GA 3CCVA 4VUBA 3CCSA 2KY9A 1JJ2S 3GF5A 3CXCS 3QSUA 3JSCA 4XU2A 4QVZA 3H8ZA 3T9NA 4EMKC 3DLMA 2PVDB 3E1SA 3R6OA 2VXFA 1B34B 3I55A 3OYGA 1VQ7A 2DTOA 3MP8A 2LRQA 1KQ2A 2RB6A 3J7AF 2PVGB 3NTHA 3OA6A 1YIJT 2EQMA 3BDUA 1VQNA 3JCMb 4A4FA 1RL2A 5FU6B 4A4HA 3CC4T 4BI8B 1M4ZA 2VYTA 3OMCA 5KCOA 4M78A 2XK0A 3OYFA 3QBYA 2ZPIB 1YITT 2DXCA 1YJ9T 4FM4B 1VQKA 4M78C 3ZFJA 5FRNA 3HRTA 4XK8E 2FB7A 1KD1U 3JB9J 2PVOB 3JCMX 2YLBA 2DVEA 3QZ5B 4MZMA 1M1GA 1Y96B 4UC4A 3CD6T 1VQ6A 4BE0A 3FB9A 4WF2A 1TH7A 3SWNB 3V8JA 2EQKA 5A0LA 3HSBA 4FT2A 5CQXA 4FU6A 2PUOB 4FSXA 3CCLA 2ZCFB 4M7AF 3PMTA 4EMGA 2JUFA 3TCJA 1VQ4T 2ZZDA 4NL2A 5GMKl 3JRZA 2XDPA 3OYNA 3JCMg 5FU6C 2LNVA 3BW1A 3G7ZA 2VXEA 2EFIA 4A54A 4C92B 1M8VA 5GAMg 2YHTA 4C5HA 1BIAA 3OYAA 2X4YA 3OYHA 3OBWA 3HFNA 4J5YA 1O75A 3J80E 2M0OA 3CC4A 3CBPA 4M7AG 1BI3A 2L5QA 1N27A 2QDYB 2X4JA 1OI1A 5GAMe 1YJ9A 3L2QA 1Y7XA 2LQKA 1N8RU 2DJZA 3CMAT 2D6FA 4JRKA 4RCCA 5FROA 5CQYA 1QVGA 1QVFS 3SWNC 1FX7A 3CCUA 2RI3A 3OS1A 1W2BS 3KBGA 2ZPFB 3L2WA 1YJWT 4F7UE 4JJNK 4XTVA 1VQ8A 5GANh 1AHJB 3RUXA 1NZ9A 5C6SA 2R5MA 2XIDA 4N0AA 4E47A 5GANd 1UGSB 2A3LA 4BI4A 3GPLA 1K73C 4C92C 1NJIC 1G3SA 3E9GA 3DLLA 1VQ4A 3LW5E 2QA4T 2EQUA 4DQ2A 3OBYA 3GIBA 4F7UB 2CZ1B 5CKFA 3JCMV 2DXTA 2DXUA 1BIBA 4M77E 4HCZA 5LJ5h 4L5GA 1Q82C 1BI2A 1Q7YU 2FVUA 5LJ5d 4M75E 4CI0C 3JCMf 2F5TX 5CO7A 2LCLA 3RMSA 4LDUA 4X9CA 3M58A 1K8AC 3CEYA 4J8OA 3SDZA 1M90U 3GNFB 4N4IA 4ELZC 2KVQG 3VJPA 4M77B 3CPWS 1R8OB 2Y4XA 3RERA 4C8QD 4O5VA 3UPUA 3RESA 1YBYA 3A8HB 2MF2A 4II1A 4M75B 2QEXT 1N6AA 3M9QA 5FLXE 5KH6A 3OW2A 1IZ6A 3SFMA 3VUBA 2LCCA 5J26A 4F7UA 1BKBA 3LWIA 1KQSA 4PLIA 3J81E 3QYGB 4OB1B 5LJ3h 3MEUA 3OS0A 3EAEA 4NS5A 3OB9A 4GY5A 3RIRA 2QQAA 5LJ3d 3HRSA 2QA4A 3PNWC 3MP1A 1QP3A 4LDYA 4Z02A 4HA8A 2ZPHB 2FHDA 4ZGDB 5GAOn 4Q5WA 5GMKj 1YJNT 2XDBA 5C0MA 1UGPB 3FEOA 3X24B 2RD1A 2R58A 3PGGA 4M77A 5CKBA 1VQOT 2I2LA 3UT1A 3QJYA 4M77C 2QQBA 4EMHA 4KT0E 4BE1A 2EKOA 2PU9B 2NLUA 2RO0A 4J83A 5GAMj 1NPPA 4M75C 2L89A 1PSEA 4HCCA 1G3TA 1OZ2A 4MZTA 4C8QF 5GMKm 4LD6A 1VQPT 1S72A 3CMEA 1I5LA 2RJCA 1K9MU 1BYMA 2QEXA 4RG2A 3HHTB 2CKKA 3CBMA 3RMQA 3OY9A 1VQ5A 3OYKA 4BDYA 2LX9A 1I81A 1I8FA 2O4XB 1Q86U 3CC2T 1JJ2A 2LDMA 3CXCA 1NPRA 4FIBA 4BD3A 4XTZA 3JB9I 4E7IA 3ER0A 1KG1A 3VYHB 3CCJT 1QW1A 4C8QG 3G4ST 4M7AD 4ATOA 3H6ZA 2K4YA 3OYYA 3QG1A 2E64A 3VU3C 4M7AA 1O9SA 3C94A 1YJNA 1G3YA 3ME9A 2RA2A 3NTIA 3RKXA 1VQ9A 3OQ5A 3N5BB 4JLGA 4ZN1A 1PSFA 4XQ3A 3HP9A 2L8DA 2EWNA 1M1KU 2XHCA 4JRPA 2XU8A 4ZTFA 3OYIA 3UWNA 1SSFA 1DJ7B 2HQXA 4M7DD 5DLQE 2O4XA 2D0QB 2KMTA 3S6WA 3KXTA 2CYZB 3A8GB 2DIGA 3RKYA 2GFAA 4MMLA 1JB0E 2M16A 2QTXA 4FT4A 1XQHA 4C0ZA 4PJOF 2GCXA 2XKOC 3OSVA 4ZGEB 3CC2A 2LT4A 3JAME 3JB9H 4YTLA 3DB3A 2P0QA 2JOYA 3WVEB 4P5NA 2QQ9A 2GF7A 4KUDK 3P8DA 1X01A 2KQWA 5GANg 4C5EA 4XU3A 4EDUA 2ZPGB 3PIOA 5CKHA 1KHCA 4LD9K 4N4GA 3I56T 1NE8A 2K5IA 4MDWA 4Y91A 4J6YA 5GMKe 2BKDN 2E1HA 4PJOG 1YIJA 4JLIA 1MHNA 2C06A 4J7FA 2G3RA 2EYQA 3MEVA 4OB2B 3JCMe 4JRQA 3A8OB 2DTIA 2RI5A 1YITA 4M7DF 1Q81U 1MGQA 2HBPA 3M4YA 3ZEHA 3E19A 4ZGJB 1QVFA 2PQWA 4IUTA 4X34A 5FU7B 1W4SA 4A4GA 2DTHA 3VV0A 2XD0A 3L2ZA 4C8QE 2VGMA 4OVAA 1W2BA 4IUPA 4BE2A 3CD6A 2DZ9A 5CKEA 3TREA 5L8RE 2V8KA 3OMGA 2ZPBB 3TU4K 3S3NA 2LTOA 1OYXA 3CPFA 3CCQT 4M7DG 4A53A 1Q82U 3QKJA 5GAN6 3MEAA 3X28B 2V8JA 1BI1A 5M9OA 4E7HA 4N0AC 1KC8U 3UDCA 4J6XA 4C8QB 5GAN2 3I56A 3CCRT 1H641 2H3JA 5DM7R 3G71T 2OTLT 1K8AU 2DD5A 2LVMA 3F70A 4C5IA 2RHIA 2K57A 4XTXA 3CC7T 5J3BA 5GANf 1YI2T 2P4TA 4XU1A 4IURA 2M9UA 2CS7A 2DEQA 4OB0B 4Y28E 2EJ9A 3LGFA 4BI3A 2RI2A 5FU7C 4IUUA 1YHQT 2M1HA 1H3ZA 3JCMP 2XI9A 2OAUA 4PLLA 1N8RC 3PTAA 3INZA 4JRIA 3CMAA 4FL6A 3CPWA 5CCAA 2RHYA 4RCBA 5LJ5f 5GAOq 1VQLT 4RMOA 4MMKA 4BACA 2DIQA 2LC4A 2O01E 5GAOm 2E41A 5I2SA 1YJWA 4OMFB 5GAMh 5EG2A 2DKGA 2KAFA 2E12A 2KK4A 2RK2A 2XG8D 2MI6A 4C8QA 3OYBA 4O6JA 3FLGA 5GAMd 2JVVA 4C8QC 1X75C 4OP0A 4OGCA 5CK9A 2RH2A 3M4GA 4RG8A 1EIFA 2E6ZA 3VKIA 4EPCA 3L2UA 5I2MA 5CVIA 5GAOr 4MDXA 4M7AE 4ME7A 3G71A 2ZPEB 4DOVA 3CCET 1N9RA 2QQSA 1UEBA 2P0PA 3QDRB 4XAXB 5KCHA 1VQMT 5GANj 2BIVA 3C95A 3NFCA 3E9FA 1Q7YC 3MEWA 4JDSA 3JCMJ 2MWPA 3LLRA 5LJ3f 2LQ8A 4C92F 3EFSA 4M7AB 3S3OA 4OB3B 3L42A 4E7LA 3CCVT 4GLKA 3CCST 3M57A 1M90C 4M7DE 4C0FA 3MCAB 4BY6B 3A8LB 3DB4A 3JCMc 2IVWA 2RHUA 3HPWA 5HY6A 2RK1A 1KQ1A 4QQGA 2VC8A 5GAN4 1VQ7T 1P92A 3HFOA 4R56A 1WNLA 1LJOA 4C92G 3P8HA 3X25B 4BUGA 4PJOD 2HAXA 4M7DB 3G6ET 3L2RA 2EQJA 3OYCA 1XNIA 4PJOA 3Q1JA 1VQNT 2WACA 2KDSA 2VV5A 1D3BA 1YCYA 3C12A 4JS4A 1G3WA 2E6NA 3A8MB 3OSSC 2F69A 3LWHA 2RJEA 4HT8A 1FXXA 2Y90A 2E65A 4B9XA 3FC3A 3GP8A 1VQKT 5GAOl 2RHZA 3WXMB 4X9DA 4M7AC 3EFRA 3M5AA 4NOYA 3LH0A 2FYKA 5GAN5 3JCMQ 2CZ0B 2WSFE 3BDLA 4IUQA 1VQOA 4C5GA 2DXBA 2K3YA 2KSSA 4BY6C 4F7UF 5LJ3j 1VIFA 5FRMA 2QQRA 2WSCE 2RJFA 2HQEA 3AHUA 5IN1A 3CBOA 1VQ6T 1KHIA 4EMKA 3MP6A 1VUBA 1WJSA 4QVDA 4OF1A 1VQPA 1JBMA 4M7DA 3HKSA 3CCLT 2X35A 4V2SA 3QUIA 2YRVA 1ZQ1A 2MWOA 5DLOA 4M7DC 1K9MC 4C0DB 2B8AA 2E5QA 2JN0A 3JB9F 3M56A 4A4EA 4F7UG 1FWZA 1WJRA 2DPPB 4M77F 1Q86C 2K2VA 3M55A 3VYGA 1XTDA 3G6EA 1I4K1 2DZCA 3OS5A 4LDXA 4HT9A 2GQVA 4M75F 4TVRA 5AYFA 1UGRB 3ZBDA 3CCJA 3G4SA 3LGLA 4LDVA 4M78D 5IAYA 1HK9A 2R5AA 5HK3A 4XTWA 3WVDB 5GMKi 1IREB 3JB9G 5LL6S 5GANe 4M77G 1G5VA 2QI2A 3OYEA 5A0DA 3V8KA 2RM4A 3VUZA 2DD4A 2RJDA 4M75G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJF A;  4XU2 A;  5LJ5 g;  4XU1 A;  5GAN f;  1B34 A;  4EMK C;  3V7S A;  2DEQ A;  4C92 E;  4HA8 A;  1HXD A;  5GAO n;  2EJ9 A;  2VXF A;  1B34 B;  5LJ3 d;  5GMK j;  2DTO A;  3JCM P;  1KQ2 A;  2RD1 A;  5LJ5 e;  3PGG A;  4M77 A;  3V7R A;  2RB6 A;  2I2L A;  3INZ A;  4JRI A;  5DY9 A;  4M77 C;  3BDU A;  4EMH A;  3QHS A;  4RCB A;  5GAO q;  5LJ5 f;  3JCM b;  4MMK A;  5GAM j;  4M75 C;  5GAO m;  2E41 A;  5GAM h;  3FJP A;  2DKG A;  4C8Q F;  4C8Q A;  5GMK m;  1I5L A;  4M78 F;  4M78 A;  5GAM d;  3QO3 A;  4OP0 A;  4C8Q C;  3FIF A;  4M78 C;  5LJ3 g;  5GAN 8;  3M4G A;  1I8F A;  1I81 A;  2FB7 A;  1Y96 A;  5GAO r;  3JB9 J;  3JCM X;  2YLB A;  2DVE A;  4M7A E;  1WQ7 A;  3QSU A;  3JB9 I;  1Y96 B;  4XTZ A;  3BFM A;  3SWN A;  3FB9 A;  4WF2 A;  1N9R A;  5LJ3 e;  1TH7 A;  3SWN B;  4C8Q G;  4M7A D;  4M78 G;  3V8J A;  3HSB A;  5GAN j;  5GAO p;  2E64 A;  5GMK h;  3VU3 C;  3JCM J;  4C92 D;  4M7A A;  4M7A F;  4EMG A;  5LJ3 f;  2RA2 A;  3EFS A;  4M7A B;  4NL2 A;  3RKX A;  3RKW A;  4C92 F;  4C92 A;  5GMK l;  3JCM g;  3JCM h;  3V8L A;  4XQ3 A;  4M7D E;  4QVC A;  4C92 B;  3BW1 A;  4A54 A;  2VXE A;  2EWN A;  2YLC A;  4NL3 A;  1M8V A;  3JCM d;  5GAM g;  3JCM c;  2YHT A;  3L1A A;  1BIA A;  1KQ1 A;  4M7D D;  4PJO E;  3HFN A;  2VC8 A;  4J5Y A;  5GAN 4;  4M7A G;  4PNO A;  3HFO A;  3RKY A;  5GAM e;  4MML A;  1WNL A;  1LJO A;  4C92 G;  2CGH A;  4PJO D;  2QTX A;  4M7D B;  2DJZ A;  4JRK A;  4RCC A;  5CAI A;  1U1S A;  1LNX A;  1M5Q 1;  4PJO F;  4PJO A;  5GAM f;  3SWN C;  3JB9 H;  1D3B A;  3JCM W;  2EAY A;  1YCY A;  4PJO B;  4HT8 A;  3SB2 A;  4F7U E;  1X01 A;  5GAN 7;  1D3B B;  2Y90 A;  4XTV A;  2E65 A;  5GAN g;  5GAN h;  4XU3 A;  3RUX A;  5I21 A;  4JUV A;  5GAO l;  4X9D A;  4M7A C;  3EFR A;  4NOY A;  4N0A A;  5GAN d;  2FYK A;  5GAN 5;  3JCM Q;  4Y91 A;  4J6Y A;  2E10 A;  4XTY A;  4C92 C;  5GMK e;  2E1H A;  4PJO G;  4F7U F;  5LJ3 j;  4JLI A;  3AHU A;  2ZGW A;  4DQ2 A;  3GIB A;  4F7U B;  2HNI A;  5LJ5 j;  1U1T A;  2DXT A;  2DXU A;  3JCM V;  4EMK A;  1BIB A;  4M77 E;  2DTI A;  1LOJ A;  4QVD A;  5LJ5 h;  3JCM e;  4XTU A;  1JBM A;  1WPY A;  4M7D A;  4M7D F;  4V2S A;  4EMK B;  3QUI A;  5LJ5 d;  1MGQ A;  3JB9 D;  4M75 E;  4M7D C;  3JCM f;  4M77 D;  2JN0 A;  4X9C A;  3JB9 F;  4F7U G;  2DTH A;  4M77 F;  3L2Z A;  4C8Q E;  1WQW A;  4M78 E;  4M75 D;  4PJO C;  1N9S A;  1I4K 1;  2DZ9 A;  2DZC A;  4HT9 A;  4M77 B;  5GAN 3;  4M75 F;  4M75 A;  3RER A;  1JRI A;  4C8Q D;  3BY7 A;  3RES A;  4M78 D;  4M7D G;  1HK9 A;  4M75 B;  4A53 A;  5GAN 6;  4J6W A;  2EJG A;  4XTW A;  4N0A C;  3V7C A;  5GMK i;  3JB9 G;  4J6X A;  4C8Q B;  4F7U A;  5GAN e;  4M78 B;  5GAN 2;  4M77 G;  4XU0 A;  1H64 1;  5LJ3 h;  3V8K A;  2RM4 A;  2K57 A;  3RIR A;  4XTX A;  4M75 G; 
#chains in the Genus database with same CATH topology
 3CCU T;  5LJ5 g;  5HCK A;  4QW2 A;  1T3S A;  3V7S A;  2A0F B;  3EGD B;  3LX7 A;  4LE9 A;  3CC7 Q;  1YI2 Q;  2F5K A;  4X1V A;  2R57 A;  1V76 A;  3M0T A;  5LJ5 e;  1WI7 A;  2K5L A;  3QZ9 B;  1I1J A;  4L6V 5;  2DLP A;  3QHS A;  2JTF A;  2LT1 A;  1PC0 A;  4ZTJ A;  2ESW A;  5D6Y A;  1UG1 A;  2O2O A;  3TSZ A;  4PK4 A;  3M59 A;  3GLX A;  4KBM B;  3OYL A;  3CCM T;  1PD0 A;  3X20 B;  3QPH A;  2YUN A;  2QXF A;  4BDZ A;  1R77 A;  1QVG S;  4DBR A;  4D6W A;  2HD0 A;  2AZV A;  5HK0 A;  4M78 G;  3PFS A;  3CCE Q;  3KUF A;  2HDA A;  1UJ0 A;  3RKW A;  2KXD A;  2WSE E;  3M53 A;  3QXE B;  1WXT A;  2YUO A;  2YWW A;  2X4W A;  2CP3 A;  2DNU A;  3QJ6 A;  3FRN A;  3MHX A;  1LNX A;  2OTL A;  5A2Q E;  4OMN A;  1TUD A;  4PJO B;  1M1F A;  2EYW A;  3JV3 A;  4HKE A;  4JUV A;  2COW A;  1YHQ A;  1VQ5 T;  2E70 A;  2E10 A;  1G8X A;  3A5Z B;  1VQL A;  3OYJ A;  2C0I A;  3I55 T;  4E7J A;  4DBF A;  1X6O A;  3QDF A;  1LOJ A;  2HMA A;  1WPY A;  4PL6 A;  4JS5 A;  1ZHI A;  3PT9 A;  5EC7 A;  3JB9 D;  2X9H A;  2CH4 W;  1FMK A;  1Y07 A;  3OW2 P;  2D1X A;  3OS2 A;  2JMC A;  1WQW A;  3DKM A;  1KQS P;  5GAN 3;  2F2W A;  2MMP A;  1ZBX A;  3LYI A;  3NTK A;  1VYV A;  4XU0 A;  3CCS A;  4CC2 A;  1PKT A;  3JSC A;  1OV3 A;  2O9V A;  1KQ2 A;  2RB6 A;  1T3L A;  1YIJ T;  1I0C A;  2EQM A;  4AG2 C;  3JCM b;  1QWE A;  4FYY B;  3CXC P;  1SF9 A;  3OMC A;  3OYF A;  1YJ9 T;  3QBY A;  1VQK A;  4AFZ C;  4M78 C;  4RTV A;  4XK8 E;  1T0J A;  2E5K A;  3CD6 T;  1VQ6 A;  2DX1 A;  4WF2 A;  1D1A A;  4ORZ A;  2IIM A;  3CQT A;  4M7A F;  3PMT A;  1T0H A;  1VYT A;  2KNB B;  3BW1 A;  4A54 A;  2EFI A;  1TSF A;  3CC4 A;  3CBP A;  1X2Q A;  2ENM A;  3I35 A;  2CP0 A;  4KH0 B;  1N8R U;  2J05 A;  3SWN C;  1EFN A;  4PJN A;  3CCU A;  2K6D A;  3KBG A;  3L2W A;  5IHK A;  4JJN K;  4XTV A;  1AHJ B;  2J6K A;  1YWP A;  2OTJ Q;  1NJI C;  1G3S A;  1QVF P;  2EQU A;  5CKF A;  2P84 A;  2DXU A;  4RTU A;  4HCZ A;  4L5G A;  4J9F A;  2VVK A;  1BI2 A;  2FVU A;  1UFF A;  1WFW A;  1RLQ C;  5CO7 A;  2D8J A;  4J9C A;  3M58 A;  3CEY A;  3SDZ A;  3GNF B;  4ELZ C;  3EFO A;  3CPW S;  3RER A;  2Y4X A;  2CP7 A;  2AKL A;  4O5V A;  3KFV A;  3OW2 A;  4CC7 A;  3VUB A;  5J26 A;  1KQS A;  4OB1 B;  3MEU A;  1N8R R;  3OS0 A;  3EAE A;  4IIM A;  3RR6 A;  1NYG A;  3RIR A;  5LJ3 d;  2QA4 A;  3PNW C;  3MP1 A;  2ZPH B;  2FHD A;  4FCY A;  2C0T A;  5GMK j;  5C0M A;  1X6G A;  3CCL Q;  4FYX B;  5CKB A;  3ZL7 C;  1VQO T;  2I2L A;  4M77 C;  4KT0 E;  2A08 A;  2HSE B;  2NLU A;  2RO0 A;  2NYS A;  5FW9 A;  4A63 B;  5GAM j;  4M75 C;  2K79 A;  3RNJ A;  2RJC A;  1K9M U;  1H3Z A;  2QEX A;  4RG2 A;  3CBM A;  1VQ5 A;  1BU1 A;  4GLM A;  3CXC A;  1PM3 A;  1NYF A;  3JB9 I;  2OJ2 A;  1QW1 A;  1K4U S;  3VS5 A;  2LNH B;  1O9S A;  1YJN A;  2X3X D;  2QAS A;  2B86 A;  3REA B;  1PSF A;  1JJ2 P;  2EWN A;  1VQ4 Q;  2XU8 A;  3OYI A;  1NEG A;  2HQX A;  5DLQ E;  2CYZ B;  2DIG A;  4LXC A;  1XQH A;  4PJO F;  3OSV A;  5FWC A;  3JAM E;  1G83 A;  5IHI A;  3C0C A;  4YTL A;  3CMA Q;  4P5N A;  4D8K A;  1UDL A;  3P8D A;  1PRL C;  1BBZ A;  3I56 T;  1NE8 A;  2K5I A;  1K9M R;  1C0M A;  1UEC A;  1YIJ A;  5D7U A;  4JLI A;  3H0I A;  2HBW A;  2EYQ A;  3MEV A;  4OB2 B;  1B07 A;  4Z8A A;  1MGQ A;  3M4Y A;  3E19 A;  1QVF A;  4IUT A;  2VGM A;  2NUP A;  3CD6 A;  2V1Q A;  1YNZ A;  2FPF A;  3OMG A;  3EFO B;  3TU4 K;  4M7D G;  1I5O B;  3THK A;  3MEA A;  3X28 B;  2RQU A;  3CME Q;  4E7H A;  4J6X A;  4C8Q B;  1M2V A;  4C5I A;  4XU1 A;  1VA7 A;  4KGX B;  2EJ9 A;  2RI2 A;  4PLL A;  6AT1 B;  1MMA A;  1IO6 A;  4JRI A;  4FL6 A;  4FW1 A;  1N5Z A;  2CH4 A;  2E3H A;  1JEG A;  4MMK A;  2LC4 A;  2E41 A;  1QQJ A;  5EG2 A;  3OYB A;  2KK4 A;  3FLG A;  5GAM d;  4OGC A;  1AWO A;  1EIF A;  4ANJ A;  3VKI A;  3L2U A;  1ZUK A;  4MDX A;  5CVI A;  4M7A E;  4ME7 A;  3HTR A;  2QQS A;  5GAN j;  3NFC A;  1Q7Y C;  1UJY A;  1WIE A;  2MWP A;  5LJ3 f;  3CCJ Q;  3G4S Q;  2LJ3 A;  2IPO B;  1FMV A;  4GLK A;  3M57 A;  1BK2 A;  3MCA B;  1X69 A;  4K11 A;  3JCM c;  2IVW A;  2RHU A;  5HY6 A;  2RK1 A;  2CUD A;  2O9S A;  2QGF B;  1VQ7 T;  1P92 A;  4R56 A;  2DYB A;  1OPK A;  4C92 G;  4ZNX A;  3X25 B;  1Y0M A;  3G6E T;  2WAC A;  1SPK A;  2RPN A;  1D3B A;  1MV3 A;  4JS4 A;  3LWH A;  2E6N A;  2J06 A;  1FXX A;  1WHH A;  3NGP A;  2HKN A;  3WXM B;  4NOY A;  1VQO A;  2BE9 B;  4C5G A;  2DXB A;  1PNJ A;  5FRM A;  2RJF A;  5IN1 A;  2QAZ A;  2HKQ B;  4J9D A;  2KYB A;  1JBM A;  3CCL T;  5DLO A;  4M7D C;  5KYX A;  2JN0 A;  1FWZ A;  1WJR A;  2K2V A;  3OS5 A;  1IGU A;  2L2P A;  1PD1 A;  1Y57 A;  2KR3 A;  3OYE A;  1X27 A;  2PZ1 A;  2RNA A;  2QYZ A;  2EJF A;  2FL7 A;  1M1K C;  1VQ8 T;  9ATC B;  4C0D C;  4LDW A;  2DA9 A;  5IT9 E;  1H3H A;  2A7Y A;  1OZ3 A;  3V7R A;  5DY9 A;  4ELY C;  3FDR A;  1GFC A;  5CR2 A;  2ED1 A;  4B9W A;  3OYD A;  2FZK B;  3M0R A;  3P8B B;  2L3R A;  3FIF A;  4IUV A;  1U8R A;  1E6G A;  2HQH A;  4DBH A;  1WQ7 A;  3SWN A;  1Y71 A;  3ASK A;  2E3I A;  3X26 B;  3QYH B;  3C4S A;  4DOW A;  1AWX A;  1Q81 C;  5GMK h;  4C92 D;  1UHF A;  2LJ1 A;  1VQM Q;  3JCM h;  3BE3 A;  2YLC A;  1UGQ B;  4OMO A;  1AT1 B;  2J6O A;  2KT1 A;  2X4X A;  4HCB A;  4PJO E;  3TEE A;  1KC8 C;  1M5Q 1;  2MCN A;  5GAM f;  2YXY A;  2AK5 A;  1VQN Q;  1D3B B;  3CME T;  1NLO C;  4AFS C;  1RI9 A;  3GNG A;  2VKN A;  4AFU C;  2LCS A;  3SHW A;  2ZGW A;  1U1T A;  4MZP A;  5D6X A;  4XTU A;  3NHN A;  2V8I A;  1VQ9 T;  5KYX B;  2JZ2 A;  2HSP A;  1RAA B;  1IHW A;  2BUD A;  4M75 A;  4ZN3 A;  3BY7 A;  4R0K A;  4J6W A;  2EJG A;  2OTJ A;  5AT1 B;  2K3X A;  4M78 B;  3PMI A;  2JS0 A;  2KY9 A;  1JJ2 S;  3T9N A;  3OYG A;  1VQ7 A;  2DTO A;  5GJV B;  1J3T A;  2LRQ A;  4AMC A;  4DBQ A;  3NTH A;  3OA6 A;  1CKB A;  1RLP C;  1KK7 A;  4DEX A;  3CC4 T;  5KCO A;  2HAX A;  2ZPI B;  4J9I A;  3ZFJ A;  3HRT A;  3JB9 J;  5KYN A;  3JCM X;  4MZM A;  1M1G A;  2RF0 A;  3CCR Q;  3QWY A;  3SWN B;  3V8J A;  2EQK A;  3HSB A;  4FT2 A;  4FU6 A;  2PUO B;  3CCL A;  2A37 A;  2BTT A;  5ECA A;  3JRZ A;  1TG0 A;  2XDP A;  1YP5 A;  3OYN A;  3H0H A;  5FU6 C;  2LNV A;  1M8V A;  3H0F A;  4C5H A;  2L3P A;  3OYH A;  3HFN A;  1KJW A;  1O75 A;  1JU5 C;  4M7A G;  1AOJ A;  1OI1 A;  1Y7X A;  2LQK A;  2DJZ A;  1OUL A;  2ROT A;  2RI3 A;  3OS1 A;  4F16 A;  1VQ8 A;  4LUE A;  5GAN h;  1QMC A;  2R5M A;  3GPL A;  1S72 Q;  1K73 C;  1LVK A;  2KI7 A;  1VQ4 A;  3LW5 E;  2QA4 T;  3OBY A;  4F7U B;  1C1A A;  1BIB A;  1W2B P;  2YRC A;  5LJ5 h;  1BB9 A;  4CI0 C;  2F5T X;  2CSQ A;  1GFD A;  1K8A C;  2FG0 A;  2DE0 X;  4J8O A;  4N4I A;  7AT1 B;  2KVQ G;  4M77 B;  1R8O B;  2FRW A;  1YBY A;  2MF2 A;  2QEX T;  4M75 B;  1GBQ A;  1IZ6 A;  4EIK A;  1Q81 R;  3LWI A;  2JM9 A;  4PLI A;  1SEM A;  3QYG B;  3J81 E;  2KGT A;  1VOM A;  2FZC B;  1R0C B;  1WHK A;  2FZG B;  1QP3 A;  4LDY A;  3PVL A;  1H92 A;  4Q5W A;  1YJN T;  1UGP B;  3X24 B;  1X6B A;  3UT1 A;  1PG5 B;  2QQB A;  2K7A A;  4BE1 A;  2L89 A;  4HCC A;  4MZT A;  5GMK m;  3CME A;  1BYM A;  3HHT B;  4JZ3 A;  1IB8 A;  1YIT Q;  1I8F A;  1Q86 U;  4XTZ A;  2OX7 A;  3ER0 A;  2ATC B;  1RAE B;  3VYH B;  4M7A D;  4ATO A;  4J9B A;  2K4Y A;  2HL3 A;  2YUQ A;  3QG1 A;  1F1B B;  2I0N A;  1G3Y A;  2VAS A;  1VQ9 A;  2JMA A;  4JLG A;  4ZN1 A;  4XQ3 A;  3HP9 A;  1DJ7 B;  2KMT A;  1Z9Z A;  3A8G B;  4MML A;  2DER A;  2M16 A;  1NM7 A;  5KYW B;  2LT4 A;  3JB9 H;  2P0Q A;  3WVE B;  2HL5 C;  2ZPG B;  4EDU A;  1KHC A;  1IGQ A;  1YJW Q;  4MDW A;  2EVR A;  4J6Y A;  2E1H A;  1QCN A;  4PJO G;  1Q86 R;  1OX9 A;  4J7F A;  2G3R A;  2NUZ A;  2RI5 A;  4ZGJ B;  4X34 A;  1W4S A;  3VV0 A;  4C8Q E;  4OVA A;  1W2B A;  4IUP A;  2HEQ A;  1ZA1 B;  5L8R E;  2V8K A;  2DM1 A;  1K0S A;  3CCQ T;  1EZZ B;  4RUG A;  2YDL A;  1M2O A;  3CCR T;  1H64 1;  2H3J A;  1K8A U;  2LVM A;  2J7I A;  2K57 A;  3CC7 T;  5J3B A;  1YI2 T;  4IUR A;  1PHT A;  8ATC B;  2CS7 A;  2DEQ A;  1M3C A;  4OB0 B;  3LGF A;  8AT1 B;  1WX6 A;  2XI9 A;  2OAU A;  3EGU A;  3INZ A;  2LX7 A;  2QK0 A;  2GGR A;  2RHY A;  4BAC A;  1WHG A;  4JPB W;  2KAF A;  2E12 A;  2RK2 A;  4C8Q A;  2MI6 A;  3VS7 A;  3I9Q A;  4CC4 B;  1HJD A;  5CK9 A;  1VQP Q;  2FO0 A;  1K73 R;  3CC2 Q;  3CCE T;  2P0P A;  3QDR B;  1IHV A;  1ZSG A;  1ZSZ C;  2BIV A;  3C95 A;  3E9F A;  3JCM J;  4OB3 B;  4E7L A;  1BCO A;  2RQV A;  1M90 C;  2M51 A;  2OI3 A;  2EGC A;  1K8A R;  1CKA A;  2YSQ A;  1KQ1 A;  4QQG A;  3HFO A;  2MIO A;  3GBQ A;  3P8H A;  4BUG A;  4PJO D;  4M7D B;  1GRI A;  3OYC A;  3Q1J A;  3REB B;  2KDS A;  2VV5 A;  1YCY A;  1G3W A;  3A8M B;  2F69 A;  2DYI A;  2Y90 A;  2E65 A;  3GP8 A;  5GAO l;  3EFR A;  3M5A A;  1NEB A;  3JCM Q;  4F7U F;  1RAH B;  2QQR A;  2WSC E;  1ZBJ A;  1KHI A;  2LJ0 A;  1JXM A;  4LUD A;  4OF1 A;  2DVJ A;  2YT6 A;  1ZQ1 A;  1RAB B;  2MWO A;  2DRM A;  4C0D B;  3RBB B;  1U3O A;  3EH1 A;  3M56 A;  4M77 F;  1I4K 1;  4M75 F;  2HZY A;  3LGL A;  4LDV A;  1NLP C;  1JXO A;  2FRY A;  5HK3 A;  5IHN A;  5LL6 S;  2RQR A;  2NUT B;  1AZE A;  5A0D A;  3V8K A;  2RJD A;  4QT7 A;  1B34 A;  3G71 Q;  1WA7 A;  2OTL Q;  2EKH A;  5IXB A;  2RHX A;  2EIF A;  1KD1 C;  1NJI U;  4J9E A;  1KIK A;  5HKC A;  2DO3 A;  4KUI A;  3L2V A;  3H9N A;  3SD4 A;  1OOT A;  1UUE A;  1VQL Q;  3QO3 A;  4N4H A;  5LJ3 g;  5GAN 8;  2PUK B;  1V29 B;  3EH2 A;  1QP2 A;  4IIO A;  5LJ3 e;  5GAO p;  2W10 A;  4OML A;  2IG0 A;  2DL7 A;  3V8L A;  3HL8 A;  4QVC A;  4NL3 A;  1RAG B;  3JCM d;  1QVG P;  1QVP A;  3CCQ A;  1TWB A;  4OGE A;  4R55 A;  2CZ7 B;  3CCR A;  2BE7 D;  1U1S A;  1NJI R;  1WYX A;  2KRO A;  4E7K A;  3CC7 A;  3JCM W;  1YI2 A;  2EAY A;  2QG9 B;  1M3B A;  3SB2 A;  5GAN 7;  2OTJ T;  1YCS B;  4BB7 A;  2RMO A;  5I21 A;  3OW2 S;  1AVZ C;  1VQK Q;  1GXI E;  1VIE A;  2GFU A;  1KQS S;  1D09 B;  2JNG A;  3TSW A;  5D6W A;  2HNI A;  1WJQ A;  1RAI B;  5LJ5 j;  5KYY A;  4L59 A;  2AHJ B;  2CZ6 B;  1CSK A;  3MET A;  4PKC C;  1WHL A;  1HD3 A;  1PCX A;  4Z88 A;  1M3A A;  4M78 E;  1RAF B;  3VS6 A;  1JRI A;  3CCE A;  1WHM A;  2JTE A;  4PJL A;  2PNI A;  3EHR A;  4C0G A;  3CXC S;  3QSU A;  4XU2 A;  1OPL A;  2LMJ A;  4QVZ A;  4EMK C;  3DLM A;  2PVD B;  2VXF A;  1B34 B;  3CCU Q;  2SEM A;  3EGX A;  2D0N A;  3NPF A;  4F14 A;  2PVG B;  2EGE A;  3BDU A;  4A4F A;  1RL2 A;  3QWX X;  5FU6 B;  2VYT A;  2M02 A;  4M78 A;  2XK0 A;  2AKK A;  2V26 A;  5FRN A;  1SRL A;  2FB7 A;  1KD1 U;  2PVO B;  3QZ5 B;  2DVE A;  3CCM Q;  1FYN A;  4UC4 A;  4JJD A;  2COY A;  1YFN A;  3EG3 A;  1YWO A;  4LNP A;  2MPX C;  5A0L A;  1TXQ A;  1AWJ A;  3TCJ A;  1VQ4 T;  2EW3 A;  2ZZD A;  2A36 A;  2K2M A;  3JCM g;  5GAM g;  3OYA A;  2X4Y A;  3OBW A;  4J5Y A;  2M0O A;  1BI3 A;  2QDY B;  5GAM e;  4PFP A;  3CMA T;  4JRK A;  4RCC A;  1QVF S;  1QVG A;  3A98 A;  1E7O A;  2A28 A;  1FX7 A;  2ZPF B;  4Z89 A;  1WLP B;  4F7U E;  3EG1 A;  2BZY A;  1NZ9 A;  5C6S A;  4RTZ A;  3UF4 A;  5GAN d;  4E47 A;  1UGS B;  2A3L A;  4C92 C;  3RDV A;  3UA6 A;  3DLL A;  1KD1 R;  1VQ5 Q;  2JS2 A;  4DQ2 A;  3CCV Q;  3GIB A;  2CZ1 B;  3JCM V;  1D1C A;  2FEI A;  4M77 E;  1Q7Y U;  5KYY B;  5LJ5 d;  3I55 Q;  4M75 E;  3JCM f;  2CT3 A;  3LH5 A;  3G1J A;  2L0A A;  3VJP A;  4C8Q D;  3RES A;  4II1 A;  3EG9 A;  1N6A A;  2RN8 A;  3M9Q A;  5FLX E;  2LCC A;  4F7U A;  1BKB A;  1PRM C;  1M27 C;  2SRC A;  4GY5 A;  4OMP A;  3HRS A;  1QCF A;  3CPW P;  1WZO A;  4HA8 A;  4ZGD B;  2ECZ A;  2DL5 A;  2XDB A;  4FYW B;  2MK5 A;  3FEO A;  4CC3 A;  2RD1 A;  2R58 A;  3PGG A;  4M77 A;  1RAD B;  3EGX B;  3QJY A;  1ZA2 B;  4EMH A;  4J83 A;  3R6N A;  1NPP A;  1M30 A;  1Q95 G;  4C8Q F;  1I5L A;  2LQW A;  1Q7Y R;  1QKX A;  3OYK A;  2LX9 A;  1I81 A;  2O4X B;  1YJ9 Q;  2LDM A;  3MPU B;  1G2B A;  4FIB A;  4BD3 A;  5GJW B;  1KG1 A;  2COZ A;  2EGA A;  2PTK A;  3CCJ T;  3G4S T;  4FYV B;  2E64 A;  3VU3 C;  1K0X A;  3ME9 A;  3RKX A;  2L8D A;  4KGV B;  2JJ9 A;  1M1K U;  2XHC A;  3UWN A;  1SSF A;  1VYU A;  4J9H A;  2CSI A;  2GFA A;  1TUC A;  2QTX A;  4FT4 A;  1UE9 A;  2XKO C;  3CC2 A;  2W0Z A;  3DB3 A;  2QQ9 A;  4D8D A;  5GAN g;  4C5E A;  4XU3 A;  4LD9 K;  2KT8 A;  1SHG A;  4Y91 A;  2BKD N;  3MKD A;  2C06 A;  3TQ7 P;  2EYZ A;  1B7T A;  3A8O B;  2DTI A;  1Q81 U;  1MMD A;  2HBP A;  5KYW A;  3ZEH A;  4OMQ A;  2XD0 A;  4A4G A;  3H41 A;  3L2Z A;  2DZ9 A;  3TRE A;  3TVT A;  2ED0 A;  2ZPB B;  1M1K R;  3CPF A;  3EG2 A;  4A53 A;  2DF6 A;  1SHF A;  1BI1 A;  4N0A C;  3EG9 B;  1KC8 U;  1IXD A;  1ACM B;  3UDC A;  5GAN 2;  5DM7 R;  2DD5 A;  3F70 A;  1RAC B;  4XTX A;  1OU9 A;  5GAN f;  2JW4 A;  2P4T A;  2EPD A;  4Y28 E;  3VRZ A;  4HVU A;  1LPL A;  5FU7 C;  1ZSZ B;  1N8R C;  3CMA A;  3CPW A;  5CCA A;  5LJ5 f;  1VQO Q;  2O01 E;  5GAO m;  4IKF A;  5I2S A;  4OMF B;  1RUW A;  1X75 C;  1KFZ A;  1OX8 A;  4RG8 A;  5GAO r;  2E6Z A;  2KRM A;  1QWF A;  5I2M A;  3G71 A;  2G6F X;  2ZPE B;  4DOV A;  1UEB A;  1VQM T;  3MEW A;  4JDS A;  1MMN A;  2DBK A;  2H3E B;  2LQ8 A;  3EFS A;  1KC8 R;  2AIR B;  3CCV T;  4M7D E;  1SKU B;  2OAW A;  1ABQ A;  3HPW A;  1X43 A;  1AWW A;  2JM8 A;  2GBQ A;  2KE9 A;  1WNL A;  1LJO A;  2XMF A;  1NBE B;  2MOX A;  3L2R A;  1XNI A;  1VQN T;  1PKS A;  1C6V X;  3SEM A;  1TS9 A;  4M4Z A;  2LP5 A;  4HT8 A;  2RJE A;  4B9X A;  3FC3 A;  1K1Z A;  1OU8 A;  4M7A C;  1M8M A;  3LH0 A;  1D1B A;  2QGG A;  3O5Z A;  2K3Y A;  2KSS A;  1SRM A;  4BY6 C;  5LJ3 j;  3I56 Q;  4QKU A;  4EMK A;  1VUB A;  1WJS A;  4QVD A;  4M7D A;  3HKS A;  2X35 A;  2YRV A;  1K9M C;  2F2X A;  2DL8 A;  3JB9 F;  4A4E A;  4F7U G;  2DPP B;  3M55 A;  3U23 A;  4HT9 A;  2GQV A;  5AYF A;  1UGR B;  1V1C A;  3ZBD A;  1D0Z A;  3G4S A;  4M78 D;  3CCJ A;  5IAY A;  2DIL A;  2BZ8 A;  4XTW A;  1IRE B;  2CT4 A;  4PFO A;  4M77 G;  3M0Q A;  1G5V A;  2QI2 A;  3E2U A;  2RM4 A;  1GBR A;  4M75 G;  4KUL A;  1RI0 A;  4C92 E;  1HXD A;  2XIC A;  2MYS A;  4E2F B;  3EHQ A;  2MAM A;  4QQD A;  1M9S A;  1K73 U;  4WCI A;  2GTO A;  2VGN A;  2ZAE A;  2BZX A;  2DBM A;  2NWM A;  3FJP A;  4M78 F;  2RQW A;  2DK3 A;  2NUT A;  2EYX A;  1XJW B;  2LZ6 B;  3OYM A;  1XOV A;  1Y96 A;  4QQ6 A;  2M0Y A;  3BFM A;  2F2V A;  2JTM A;  2HCK A;  2DET A;  2P0K A;  2K9G A;  4DA4 A;  1IRX A;  3UA7 A;  1BCM A;  4F04 B;  1BI0 A;  4AFQ C;  5CKD A;  4C92 A;  4RKU E;  4J9G A;  2DAQ A;  2CP5 A;  4HCK A;  3L1A A;  2Y4Y A;  4CRI A;  4JJC A;  5L23 A;  3S3M A;  3I5R A;  3M54 A;  1A0N B;  4PNO A;  4HVW A;  2CGH A;  2K5F A;  1NG2 A;  3PIP A;  3CCM A;  1U5S A;  5A0G A;  5CAI A;  1VQ7 Q;  5CIU A;  3UAT A;  5J39 A;  5KE2 A;  1UB4 A;  3G6E Q;  1K9A A;  3GOX A;  1S72 T;  2XDD A;  1WGS A;  3URG A;  4J7I A;  5FWB A;  4XTY A;  1SSH A;  3M0P A;  1GCQ C;  2GTJ A;  3ULR B;  1GL5 A;  5KE3 A;  2KRN A;  3HRU A;  1AEY A;  4EMK B;  2RQT A;  4M77 D;  3QII A;  3I5S A;  2J6F A;  2DL3 A;  2Z0W A;  4M75 D;  4PJO C;  1N9S A;  3MO8 A;  2VUB A;  1ZX6 A;  4A4K A;  3O8V A;  1ZUU A;  1VQM A;  1B3Q A;  2H8H A;  2D9T A;  3V7C A;  1WXB A;  3CCV A;  4VUB A;  3GF5 A;  2C0O A;  2DEU A;  3H8Z A;  1QCO A;  4JZ4 A;  3E1S A;  3I55 A;  3R6O A;  3MP8 A;  1MV0 B;  1VQ8 Q;  3J7A F;  2DRK A;  2O31 A;  1VQN A;  3IQL A;  3VS4 A;  4A4H A;  1X2K A;  2LQN A;  1M4Z A;  4BI8 B;  1YIT T;  4RTT A;  2AZS A;  2DXC A;  4AG1 C;  4FM4 B;  1WHJ A;  2X3W D;  2YLB A;  1Y96 B;  4HVV A;  1QKW A;  4BE0 A;  1MMG A;  3FB9 A;  4GBQ A;  1TH7 A;  5CQX A;  4FSX A;  2ZCF B;  4EMG A;  2JUF A;  1YHQ Q;  4NL2 A;  5GMK l;  4C92 B;  3G7Z A;  2VXE A;  2JT4 A;  2YHT A;  1BIA A;  4DEY A;  2DMO A;  3J80 E;  2QDL A;  2L5Q A;  1N27 A;  2X4J A;  1YJ9 A;  4PJM A;  4B6M A;  4ESR A;  3L2Q A;  2D6F A;  3MJX A;  4PFZ A;  5FRO A;  5CQY A;  1W2B S;  1YJW T;  1U06 A;  5I22 A;  1ABO A;  3RUX A;  5IXF A;  4N0A A;  2XID A;  4BI4 A;  2EYY A;  3E9G A;  1UTI A;  1WXU A;  3CCS Q;  1HSQ A;  2DXT A;  1Q82 C;  2GNC A;  2EBP A;  3M0U A;  4F17 A;  2YRD A;  2LCL A;  3RMS A;  4LDU A;  4X9C A;  4FSS A;  1M90 U;  4KH1 B;  1VQ9 Q;  4OMM A;  1MNE A;  3UPU A;  3A8H B;  1PWT A;  1W1F A;  5KH6 A;  3SFM A;  3VRY A;  4HXJ A;  5LJ3 h;  4NS5 A;  3OB9 A;  2QQA A;  4AT1 B;  4Z02 A;  1VQ6 Q;  2DFU A;  5GAO n;  1W70 A;  1JQQ A;  1QLY A;  1H8K A;  5IH2 A;  3AT1 B;  2EKO A;  2PU9 B;  3PE0 A;  1PSE A;  1G3T A;  1E6H A;  1OZ2 A;  1VQP T;  4LD6 A;  1S72 A;  1EX4 A;  2CKK A;  3RMQ A;  3OY9 A;  3CC4 Q;  4BDY A;  2CRE A;  2JXB A;  3CC2 T;  1JJ2 A;  1NPR A;  1M90 R;  4E7I A;  1KSW A;  4C8Q G;  2F1L A;  3H6Z A;  3OYY A;  4LN2 A;  1TUG B;  2O88 A;  2EQI A;  4M7A A;  3C94 A;  3NTI A;  2RA2 A;  5KYU A;  1SG5 A;  3OQ5 A;  1OQK A;  3N5B B;  3NMZ C;  2CUB A;  4JRP A;  4ZTF A;  1TU0 B;  4M7D D;  1UHC A;  2O4X A;  2D0Q B;  2YUP A;  3S6W A;  3KXT A;  3FJ5 A;  2P4R A;  3RKY A;  1JB0 E;  4C0Z A;  2GCX A;  4ZGE B;  2JOY A;  2GF7 A;  4KUD K;  1X01 A;  2KQW A;  2NUP B;  3PIO A;  5CKH A;  4N4G A;  1GCP A;  5GMK e;  1WDX A;  3VS0 A;  1AD5 A;  1MHN A;  2KBT A;  2VWF A;  2KYM A;  3JCM e;  4JRQ A;  1M2V B;  2QA4 Q;  1YIT A;  4M7D F;  1MND A;  2ABL A;  2PQW A;  4RTX A;  5FU7 B;  2DTH A;  4BE2 A;  1LCK A;  5CKE A;  3VS2 A;  3S3N A;  2LTO A;  1OYX A;  1ZUY A;  1Q82 U;  3QKJ A;  5GAN 6;  2V8J A;  5M9O A;  3A1P A;  3I56 A;  1AZG B;  2QEX Q;  3G71 T;  2OTL T;  1UGV A;  2RHI A;  3EGD A;  2L3Q A;  2M9U A;  1K76 A;  2GQI A;  1I07 A;  1ARK A;  4BI3 A;  4FW2 A;  4IUU A;  1YHQ T;  2M1H A;  3JCM P;  4JJB A;  4E7S A;  3PTA A;  1YJN Q;  2D8H A;  4RCB A;  5GAO q;  1VQL T;  4RMO A;  2DIQ A;  3VS1 A;  1YJW A;  5GAM h;  2DKG A;  2XG8 D;  4O6J A;  1ZLM A;  2ROL A;  2JVV A;  4C8Q C;  4OP0 A;  4Y92 A;  2RH2 A;  3M4G A;  4EPC A;  3VS3 A;  2KEA A;  2VB6 A;  4PJJ A;  1N9R A;  1ZSZ A;  4XAX B;  5KCH A;  2DL4 A;  1FMW A;  1Q82 R;  3LLR A;  1D0X A;  4E6R A;  1JO8 A;  4C92 F;  1TTH B;  4KGZ B;  4M7A B;  3S3O A;  3L42 A;  3CCS T;  2K3B A;  1GCQ A;  1R0B G;  4C0F A;  5KYU B;  4BY6 B;  3A8L B;  3DB4 A;  1YIJ Q;  2VC8 A;  5GAN 4;  2FPD A;  2DJQ A;  1Z9Q A;  2EQJ A;  4PJO A;  2CDT A;  3C12 A;  1OEB A;  1MUZ A;  4KRT A;  3CD6 Q;  3OSS C;  1VQK T;  2CP2 A;  2RHZ A;  4X9D A;  2FYK A;  2QTV A;  5GAN 5;  2CZ0 B;  2WSF E;  3BDL A;  4IUQ A;  2CP6 A;  1VIF A;  1HYO A;  2E4H A;  2HQE A;  3AHU A;  1VQ6 T;  3CBO A;  3EG0 A;  3MP6 A;  1D0Y A;  1TOV A;  2L3S A;  5I11 A;  2KRS A;  1VQP A;  4V2S A;  3QUI A;  2B8A A;  2E5Q A;  2KXC A;  1Q86 C;  4RTY A;  1YN8 A;  2X51 A;  3VYG A;  2AT1 B;  1XTD A;  3G6E A;  2DZC A;  4LDX A;  3M0S A;  4TVR A;  1S1N A;  3PVQ A;  4RTW A;  1HK9 A;  2R5A A;  3D7S B;  1W6X A;  3WVD B;  5GMK i;  3JB9 G;  3CCQ Q;  5GAN e;  2FPE A;  4WTO B;  4E7Z A;  3VUZ A;  2V1R A;  2DD4 A; 
#chains in the Genus database with same CATH homology
 2EJF A;  2FL7 A;  5LJ5 g;  3CCU T;  4QW2 A;  1B34 A;  1M1K C;  4KUL A;  3V7S A;  1RI0 A;  4C92 E;  1VQ8 T;  1HXD A;  2XIC A;  3LX7 A;  4C0D C;  4LDW A;  2F5K A;  2RHX A;  2MAM A;  5IT9 E;  4QQD A;  2A7Y A;  2R57 A;  2EIF A;  1OZ3 A;  1M9S A;  5LJ5 e;  2K5L A;  1K73 U;  3V7R A;  1KD1 C;  3QZ9 B;  4L6V 5;  1NJI U;  5DY9 A;  4ELY C;  2VGN A;  4IKF A;  3FDR A;  3QHS A;  5CR2 A;  2JTF A;  2LT1 A;  4ZTJ A;  5HKC A;  4B9W A;  2DO3 A;  4KUI A;  5D6Y A;  3OYD A;  3L2V A;  3P8B B;  3FJP A;  3SD4 A;  4M78 F;  2L3R A;  3M59 A;  2DK3 A;  3GLX A;  3QO3 A;  4KBM B;  3FIF A;  3OYL A;  4N4H A;  3CCM T;  3OYM A;  3X20 B;  1XOV A;  3QPH A;  2QXF A;  4IUV A;  5LJ3 g;  5GAN 8;  1Y96 A;  4BDZ A;  1U8R A;  2PUK B;  4QQ6 A;  1V29 B;  1WQ7 A;  3SWN A;  3BFM A;  1QP2 A;  1QVG S;  1Y71 A;  3ASK A;  4D6W A;  2HD0 A;  3X26 B;  3QYH B;  5LJ3 e;  5HK0 A;  2JTM A;  4M78 G;  2P0K A;  3C4S A;  3PFS A;  4DA4 A;  4DOW A;  5GAO p;  1Q81 C;  5GMK h;  4C92 D;  3KUF A;  1BI0 A;  2IG0 A;  3RKW A;  4C92 A;  5CKD A;  4RKU E;  3JCM h;  3V8L A;  2DAQ A;  3HL8 A;  4QVC A;  4NL3 A;  2YLC A;  1UGQ B;  2WSE E;  3JCM d;  3M53 A;  3L1A A;  2Y4Y A;  1QVP A;  3QXE B;  4CRI A;  2X4X A;  4HCB A;  4PJO E;  3S3M A;  3CCQ A;  3M54 A;  4PNO A;  3TEE A;  2X4W A;  4OGE A;  4R55 A;  1KC8 C;  2CZ7 B;  2CGH A;  3QJ6 A;  2K5F A;  3PIP A;  3CCM A;  3FRN A;  5A0G A;  5CAI A;  3CCR A;  1U1S A;  3MHX A;  1LNX A;  1M5Q 1;  2OTL A;  5CIU A;  5GAM f;  5A2Q E;  4E7K A;  3CC7 A;  3JCM W;  5J39 A;  5KE2 A;  2EAY A;  1YI2 A;  4PJO B;  1UB4 A;  3SB2 A;  1M1F A;  3GOX A;  5GAN 7;  1D3B B;  1S72 T;  3CME T;  4HKE A;  2OTJ T;  4BB7 A;  5I21 A;  4JUV A;  2XDD A;  1WGS A;  1YHQ A;  3URG A;  1VQ5 T;  4J7I A;  3OW2 S;  2E70 A;  3GNG A;  2E10 A;  4XTY A;  1GXI E;  3A5Z B;  1VIE A;  2GFU A;  1KQS S;  2JNG A;  2ZGW A;  1VQL A;  5D6W A;  5KE3 A;  2HNI A;  1WJQ A;  5LJ5 j;  3OYJ A;  1U1T A;  3I55 T;  4E7J A;  1X6O A;  1LOJ A;  3HRU A;  4MZP A;  5D6X A;  4XTU A;  4L59 A;  1WPY A;  4PL6 A;  2AHJ B;  2CZ6 B;  4EMK B;  1ZHI A;  3PT9 A;  4JS5 A;  3JB9 D;  2V8I A;  3MET A;  4M77 D;  3QII A;  1Y07 A;  4PKC C;  1VQ9 T;  3OS2 A;  2JZ2 A;  1WQW A;  3DKM A;  4M78 E;  4M75 D;  1N9S A;  4PJO C;  3MO8 A;  2VUB A;  5GAN 3;  2BUD A;  4A4K A;  4M75 A;  3O8V A;  1JRI A;  4ZN3 A;  3CCE A;  3BY7 A;  1VQM A;  2MMP A;  1ZBX A;  3LYI A;  4J6W A;  2EJG A;  2OTJ A;  2D9T A;  3V7C A;  3NTK A;  2K3X A;  4M78 B;  4XU0 A;  3PMI A;  4C0G A;  3CCV A;  4VUB A;  3CCS A;  2KY9 A;  1JJ2 S;  3GF5 A;  3CXC S;  3QSU A;  3JSC A;  4XU2 A;  4QVZ A;  3H8Z A;  3T9N A;  4EMK C;  3DLM A;  2PVD B;  3E1S A;  3R6O A;  2VXF A;  1B34 B;  3I55 A;  3OYG A;  1VQ7 A;  2DTO A;  3MP8 A;  2LRQ A;  1KQ2 A;  2RB6 A;  3J7A F;  2PVG B;  3NTH A;  3OA6 A;  1YIJ T;  2EQM A;  3BDU A;  1VQN A;  3JCM b;  4A4F A;  1RL2 A;  5FU6 B;  4A4H A;  3CC4 T;  4BI8 B;  1M4Z A;  2VYT A;  3OMC A;  5KCO A;  4M78 A;  2XK0 A;  3OYF A;  3QBY A;  2ZPI B;  1YIT T;  2DXC A;  1YJ9 T;  4FM4 B;  1VQK A;  4M78 C;  3ZFJ A;  5FRN A;  3HRT A;  4XK8 E;  2FB7 A;  1KD1 U;  3JB9 J;  2PVO B;  3JCM X;  2YLB A;  2DVE A;  3QZ5 B;  4MZM A;  1M1G A;  1Y96 B;  4UC4 A;  3CD6 T;  1VQ6 A;  4BE0 A;  3FB9 A;  4WF2 A;  1TH7 A;  3SWN B;  3V8J A;  2EQK A;  5A0L A;  3HSB A;  4FT2 A;  5CQX A;  4FU6 A;  2PUO B;  4FSX A;  3CCL A;  2ZCF B;  4M7A F;  3PMT A;  4EMG A;  2JUF A;  3TCJ A;  1VQ4 T;  2ZZD A;  4NL2 A;  5GMK l;  3JRZ A;  2XDP A;  3OYN A;  3JCM g;  5FU6 C;  2LNV A;  3BW1 A;  3G7Z A;  2VXE A;  2EFI A;  4A54 A;  4C92 B;  1M8V A;  5GAM g;  2YHT A;  4C5H A;  1BIA A;  3OYA A;  2X4Y A;  3OYH A;  3OBW A;  3HFN A;  4J5Y A;  1O75 A;  3J80 E;  2M0O A;  3CC4 A;  3CBP A;  4M7A G;  1BI3 A;  2L5Q A;  1N27 A;  2QDY B;  2X4J A;  1OI1 A;  5GAM e;  1YJ9 A;  3L2Q A;  1Y7X A;  2LQK A;  1N8R U;  2DJZ A;  3CMA T;  2D6F A;  4JRK A;  4RCC A;  5FRO A;  5CQY A;  1QVG A;  1QVF S;  3SWN C;  1FX7 A;  3CCU A;  2RI3 A;  3OS1 A;  1W2B S;  3KBG A;  2ZPF B;  3L2W A;  1YJW T;  4F7U E;  4JJN K;  4XTV A;  1VQ8 A;  5GAN h;  1AHJ B;  3RUX A;  1NZ9 A;  5C6S A;  2R5M A;  2XID A;  4N0A A;  4E47 A;  5GAN d;  1UGS B;  2A3L A;  4BI4 A;  3GPL A;  1K73 C;  4C92 C;  1NJI C;  1G3S A;  3E9G A;  3DLL A;  1VQ4 A;  3LW5 E;  2QA4 T;  2EQU A;  4DQ2 A;  3OBY A;  3GIB A;  4F7U B;  2CZ1 B;  5CKF A;  3JCM V;  2DXT A;  2DXU A;  1BIB A;  4M77 E;  4HCZ A;  5LJ5 h;  4L5G A;  1Q82 C;  1BI2 A;  1Q7Y U;  2FVU A;  5LJ5 d;  4M75 E;  4CI0 C;  3JCM f;  2F5T X;  5CO7 A;  2LCL A;  3RMS A;  4LDU A;  4X9C A;  3M58 A;  1K8A C;  3CEY A;  4J8O A;  3SDZ A;  1M90 U;  3GNF B;  4N4I A;  4ELZ C;  2KVQ G;  3VJP A;  4M77 B;  3CPW S;  1R8O B;  2Y4X A;  3RER A;  4C8Q D;  4O5V A;  3UPU A;  3RES A;  1YBY A;  3A8H B;  2MF2 A;  4II1 A;  4M75 B;  2QEX T;  1N6A A;  3M9Q A;  5FLX E;  5KH6 A;  3OW2 A;  1IZ6 A;  3SFM A;  3VUB A;  2LCC A;  5J26 A;  4F7U A;  1BKB A;  3LWI A;  1KQS A;  4PLI A;  3J81 E;  3QYG B;  4OB1 B;  5LJ3 h;  3MEU A;  3OS0 A;  3EAE A;  4NS5 A;  3OB9 A;  4GY5 A;  3RIR A;  2QQA A;  5LJ3 d;  3HRS A;  2QA4 A;  3PNW C;  3MP1 A;  1QP3 A;  4LDY A;  4Z02 A;  4HA8 A;  2ZPH B;  2FHD A;  4ZGD B;  5GAO n;  4Q5W A;  5GMK j;  1YJN T;  2XDB A;  5C0M A;  1UGP B;  3FEO A;  3X24 B;  2RD1 A;  2R58 A;  3PGG A;  4M77 A;  5CKB A;  1VQO T;  2I2L A;  3UT1 A;  3QJY A;  4M77 C;  2QQB A;  4EMH A;  4KT0 E;  4BE1 A;  2EKO A;  2PU9 B;  2NLU A;  2RO0 A;  4J83 A;  5GAM j;  1NPP A;  4M75 C;  2L89 A;  1PSE A;  4HCC A;  1G3T A;  1OZ2 A;  4MZT A;  4C8Q F;  5GMK m;  4LD6 A;  1VQP T;  1S72 A;  3CME A;  1I5L A;  2RJC A;  1K9M U;  1BYM A;  2QEX A;  4RG2 A;  3HHT B;  2CKK A;  3CBM A;  3RMQ A;  3OY9 A;  1VQ5 A;  3OYK A;  4BDY A;  2LX9 A;  1I81 A;  1I8F A;  2O4X B;  1Q86 U;  3CC2 T;  1JJ2 A;  2LDM A;  3CXC A;  1NPR A;  4FIB A;  4BD3 A;  4XTZ A;  3JB9 I;  4E7I A;  3ER0 A;  1KG1 A;  3VYH B;  3CCJ T;  1QW1 A;  4C8Q G;  3G4S T;  4M7A D;  4ATO A;  3H6Z A;  2K4Y A;  3OYY A;  3QG1 A;  2E64 A;  3VU3 C;  4M7A A;  1O9S A;  3C94 A;  1YJN A;  1G3Y A;  3ME9 A;  2RA2 A;  3NTI A;  3RKX A;  1VQ9 A;  3OQ5 A;  3N5B B;  4JLG A;  4ZN1 A;  1PSF A;  4XQ3 A;  3HP9 A;  2L8D A;  2EWN A;  1M1K U;  2XHC A;  4JRP A;  2XU8 A;  4ZTF A;  3OYI A;  3UWN A;  1SSF A;  1DJ7 B;  2HQX A;  4M7D D;  5DLQ E;  2O4X A;  2D0Q B;  2KMT A;  3S6W A;  3KXT A;  2CYZ B;  3A8G B;  2DIG A;  3RKY A;  2GFA A;  4MML A;  1JB0 E;  2M16 A;  2QTX A;  4FT4 A;  1XQH A;  4C0Z A;  4PJO F;  2GCX A;  2XKO C;  3OSV A;  4ZGE B;  3CC2 A;  2LT4 A;  3JAM E;  3JB9 H;  4YTL A;  3DB3 A;  2P0Q A;  2JOY A;  3WVE B;  4P5N A;  2QQ9 A;  2GF7 A;  4KUD K;  3P8D A;  1X01 A;  2KQW A;  5GAN g;  4C5E A;  4XU3 A;  4EDU A;  2ZPG B;  3PIO A;  5CKH A;  1KHC A;  4LD9 K;  4N4G A;  3I56 T;  1NE8 A;  2K5I A;  4MDW A;  4Y91 A;  4J6Y A;  5GMK e;  2BKD N;  2E1H A;  4PJO G;  1YIJ A;  4JLI A;  1MHN A;  2C06 A;  4J7F A;  2G3R A;  2EYQ A;  3MEV A;  4OB2 B;  3JCM e;  4JRQ A;  3A8O B;  2DTI A;  2RI5 A;  1YIT A;  4M7D F;  1Q81 U;  1MGQ A;  2HBP A;  3M4Y A;  3ZEH A;  3E19 A;  4ZGJ B;  1QVF A;  2PQW A;  4IUT A;  4X34 A;  5FU7 B;  1W4S A;  4A4G A;  2DTH A;  3VV0 A;  2XD0 A;  3L2Z A;  4C8Q E;  2VGM A;  4OVA A;  1W2B A;  4IUP A;  4BE2 A;  3CD6 A;  2DZ9 A;  5CKE A;  3TRE A;  5L8R E;  2V8K A;  3OMG A;  2ZPB B;  3TU4 K;  3S3N A;  2LTO A;  1OYX A;  3CPF A;  3CCQ T;  4M7D G;  4A53 A;  1Q82 U;  3QKJ A;  5GAN 6;  3MEA A;  3X28 B;  2V8J A;  1BI1 A;  5M9O A;  4E7H A;  4N0A C;  1KC8 U;  3UDC A;  4J6X A;  4C8Q B;  5GAN 2;  3I56 A;  3CCR T;  1H64 1;  2H3J A;  5DM7 R;  3G71 T;  2OTL T;  1K8A U;  2DD5 A;  2LVM A;  3F70 A;  4C5I A;  2RHI A;  2K57 A;  4XTX A;  3CC7 T;  5J3B A;  5GAN f;  1YI2 T;  2P4T A;  4XU1 A;  4IUR A;  2M9U A;  2CS7 A;  2DEQ A;  4OB0 B;  4Y28 E;  2EJ9 A;  3LGF A;  4BI3 A;  2RI2 A;  5FU7 C;  4IUU A;  1YHQ T;  2M1H A;  1H3Z A;  3JCM P;  2XI9 A;  2OAU A;  4PLL A;  1N8R C;  3PTA A;  3INZ A;  4JRI A;  3CMA A;  4FL6 A;  3CPW A;  5CCA A;  2RHY A;  4RCB A;  5LJ5 f;  5GAO q;  1VQL T;  4RMO A;  4MMK A;  4BAC A;  2DIQ A;  2LC4 A;  2O01 E;  5GAO m;  2E41 A;  5I2S A;  1YJW A;  4OMF B;  5GAM h;  5EG2 A;  2DKG A;  2KAF A;  2E12 A;  2KK4 A;  2RK2 A;  2XG8 D;  2MI6 A;  4C8Q A;  3OYB A;  4O6J A;  3FLG A;  5GAM d;  2JVV A;  4C8Q C;  1X75 C;  4OP0 A;  4OGC A;  5CK9 A;  2RH2 A;  3M4G A;  4RG8 A;  1EIF A;  2E6Z A;  3VKI A;  4EPC A;  3L2U A;  5I2M A;  5CVI A;  5GAO r;  4MDX A;  4M7A E;  4ME7 A;  3G71 A;  2ZPE B;  4DOV A;  3CCE T;  1N9R A;  2QQS A;  1UEB A;  2P0P A;  3QDR B;  4XAX B;  5KCH A;  1VQM T;  5GAN j;  2BIV A;  3C95 A;  3NFC A;  3E9F A;  1Q7Y C;  3MEW A;  4JDS A;  3JCM J;  2MWP A;  3LLR A;  5LJ3 f;  2LQ8 A;  4C92 F;  3EFS A;  4M7A B;  3S3O A;  4OB3 B;  3L42 A;  4E7L A;  3CCV T;  4GLK A;  3CCS T;  3M57 A;  1M90 C;  4M7D E;  4C0F A;  3MCA B;  4BY6 B;  3A8L B;  3DB4 A;  3JCM c;  2IVW A;  2RHU A;  3HPW A;  5HY6 A;  2RK1 A;  1KQ1 A;  4QQG A;  2VC8 A;  5GAN 4;  1VQ7 T;  1P92 A;  3HFO A;  4R56 A;  1WNL A;  1LJO A;  4C92 G;  3P8H A;  3X25 B;  4BUG A;  4PJO D;  2HAX A;  4M7D B;  3G6E T;  3L2R A;  2EQJ A;  3OYC A;  1XNI A;  4PJO A;  3Q1J A;  1VQN T;  2WAC A;  2KDS A;  2VV5 A;  1D3B A;  1YCY A;  3C12 A;  4JS4 A;  1G3W A;  2E6N A;  3A8M B;  3OSS C;  2F69 A;  3LWH A;  2RJE A;  4HT8 A;  1FXX A;  2Y90 A;  2E65 A;  4B9X A;  3FC3 A;  3GP8 A;  1VQK T;  5GAO l;  2RHZ A;  3WXM B;  4X9D A;  4M7A C;  3EFR A;  3M5A A;  4NOY A;  3LH0 A;  2FYK A;  5GAN 5;  3JCM Q;  2CZ0 B;  2WSF E;  3BDL A;  4IUQ A;  1VQO A;  4C5G A;  2DXB A;  2K3Y A;  2KSS A;  4BY6 C;  4F7U F;  5LJ3 j;  1VIF A;  5FRM A;  2QQR A;  2WSC E;  2RJF A;  2HQE A;  3AHU A;  5IN1 A;  3CBO A;  1VQ6 T;  1KHI A;  4EMK A;  3MP6 A;  1VUB A;  1WJS A;  4QVD A;  4OF1 A;  1VQP A;  1JBM A;  4M7D A;  3HKS A;  3CCL T;  2X35 A;  4V2S A;  3QUI A;  2YRV A;  1ZQ1 A;  2MWO A;  5DLO A;  4M7D C;  1K9M C;  4C0D B;  2B8A A;  2E5Q A;  2JN0 A;  3JB9 F;  3M56 A;  4A4E A;  4F7U G;  1FWZ A;  1WJR A;  2DPP B;  4M77 F;  1Q86 C;  2K2V A;  3M55 A;  3VYG A;  1XTD A;  3G6E A;  1I4K 1;  2DZC A;  3OS5 A;  4LDX A;  4HT9 A;  2GQV A;  4M75 F;  4TVR A;  5AYF A;  1UGR B;  3ZBD A;  3CCJ A;  3G4S A;  3LGL A;  4LDV A;  4M78 D;  5IAY A;  1HK9 A;  2R5A A;  5HK3 A;  4XTW A;  3WVD B;  5GMK i;  1IRE B;  3JB9 G;  5LL6 S;  5GAN e;  4M77 G;  1G5V A;  2QI2 A;  3OYE A;  5A0D A;  3V8K A;  2RM4 A;  3VUZ A;  2DD4 A;  2RJD A;  4M75 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...