1TS9A

Crystal structure of the archaeal homolog of human rnase p protein rpp29 from archaeoglobus fulgidus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
b'LQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGDLINFRPEDRIKRGLMMLKRAKGVWI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Crystal structure of archaeal ribonuclease P protein aRpp29 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1ts9A00
1TSFA 2ZAEA 1PC0A 1TS9A 1V76A 2KI7A 1OQKA
chains in the Genus database with same CATH superfamily
4EMKA 1N5ZA 1YJNQ 5M9OA 5GAMh 1QVGP 4E7ZA 4JS5A 2DL7A 3SDZA 2DL8A 1PCXA 2HNIA 4PFOA 4M7AE 1VQ9T 4RMOA 5EC7A 2LRQA 1R77A 4M7AC 4D8KA 3JRZA 3VS0A 2FHDA 2EGAA 3CPWS 2LP5A 4ELZC 1IGUA 2K2VA 1G2BA 5D7UA 1GFDA 3OMCA 2D8JA 4E7SA 3CEYA 4DOWA 1VQOA 3V7SA 4M78G 1OPLA 5FRMA 2OI3A 1JXMA 4HCKA 4JLIA 2FL7A 3H6ZA 3BY7A 4DBFA 1I0CA 1VQLA 1H3ZA 4KGVB 4ZNXA 4F7UB 3QWYA 4FT2A 1Q81C 2DRKA 2FZGB 4M7AF 4OMPA 5LJ3f 5FROA 2B8AA 3PNWC 5GANg 2KRNA 3ZL7C 2RHXA 2JM8A 4HVWA 5KYXA 2OTJQ 2KXCA 2EYXA 1M1KR 1QP2A 5D6XA 4HA8A 2VWFA 1C1AA 1O75A 1UGSB 1WDXA 2X4JA 3CXCA 2AIRB 3CCVT 1WXTA 3UATA 2DZCA 5J26A 2CZ7B 2O01E 2X35A 2HQEA 3MKDA 4ATOA 1YJ9Q 4LUEA 3RNJA 3UWNA 1W1FA 2LCSA 4WCIA 3EG9A 3M59A 2V1RA 4BI3A 2ATCB 2C0IA 5J39A 3M5AA 2K3BA 2EQKA 5GAN8 1IO6A 3CC7Q 1AZGB 1YCSB 3L2QA 3EFOA 2QEXQ 5GMKe 3TREA 5KYUB 1M90R 4LDUA 4LDVA 3VV0A 4PJNA 1K8AU 1G5VA 5I11A 1WHHA 2GF7A 1SSFA 1YIJQ 2ZCFB 1QVGS 1PM3A 2AT1B 2P4RA 4C0DB 3V8JA 3C12A 2KK4A 1GBRA 1AZEA 2EQUA 3PIPA 1K73R 2Z0WA 2JTMA 4HKEA 5GAMe 1UEBA 1JJ2A 2KAFA 3OA6A 4RTZA 4JDSA 1VQ7A 4J83A 2IPOB 1HJDA 4CC4B 1VQNQ 3G6ET 4LXCA 3CMAA 4CC2A 2J6FA 5GANj 1GCQA 2M0OA 2D1XA 1OOTA 1BI0A 5IT9E 1FXXA 4E6RA 2KR3A 1UUEA 4NL2A 4M78B 4PLIA 2KGTA 2QQSA 2MIOA 1NLPC 5CK9A 2OAWA 2RD1A 2FPFA 4GY5A 4C92D 5DM7R 3BE3A 1YCYA 3QKJA 1M8MA 2JN0A 4QVDA 3KUFA 3G1JA 4FW1A 4RTVA 4RG8A 3JB9D 4C8QA 1OEBA 4CRIA 5KE3A 2BZXA 3EGDA 2I0NA 1JB0E 2M0YA 2HQHA 3E9GA 2D0NA 3X20B 4PJOB 4N4HA 3C95A 1NE8A 3DB3A 4RKUE 1Q81R 2LZ6B 2E41A 1PKSA 1PHTA 2O2OA 1XQHA 2RI3A 3CCSQ 3M0UA 1RI0A 2HSEB 1KQ1A 4QW2A 1Q7YC 2ZAEA 1TWBA 1VIEA 3CCJQ 2KNBB 3X24B 2V8IA 1I5LA 2E3IA 1QVFS 2FYKA 2X51A 2WACA 4IKFA 1N9SA 3G71T 2DO3A 3CCUA 4A53A 4C5IA 2QQ9A 4OMNA 3H0HA 1NLOC 2GQVA 2QTXA 1QCFA 4OP0A 5GAOp 2RPNA 3HP9A 1YNZA 3JB9F 1NBEB 2JW4A 2DXUA 1Y07A 1OZ2A 3M0PA 4C0DC 2DNUA 1Y96A 1HD3A 1Q82C 1W2BA 2MI6A 1VQ4T 4J5YA 3PIOA 3CCQT 1TG0A 3A8MB 2KDSA 1YFNA 3VU3C 3GOXA 4J6WA 1ZSGA 1N9RA 1SRMA 1H92A 1YJNA 4AFUC 3CCEA 1AWXA 2L3SA 1RLPC 3RMQA 3SFMA 4EMKB 5GAN5 4OB1B 4A4GA 5FRNA 3X28B 4DBHA 3I5SA 2DZ9A 5CKHA 1VYVA 1T0HA 2XI9A 1ABQA 2PNIA 2PVGB 1PC0A 5D6YA 5LJ5j 1HYOA 2EJGA 3OYFA 3GBQA 4PJMA 3LH0A 2K4YA 4DOVA 2DAQA 1RAGB 1BB9A 1HSQA 2EVRA 4M77E 3V7CA 1M8VA 4BY6B 2XG8D 2L3QA 4M77C 1XNIA 4MZPA 3MP8A 4XTZA 5CIUA 2HKQB 3LWIA 1VQ6Q 2X4XA 3RDVA 2KI7A 3FC3A 2DJZA 2RM4A 3I56Q 4HVVA 1PD1A 5FU7B 4J9EA 5CVIA 3JCMc 2KBTA 1WX6A 3OYGA 1FX7A 3CQTA 4IUUA 4J6XA 1KHIA 2ROLA 2CP0A 2DEUA 4ZTFA 1WJSA 3DB4A 2EAYA 3QO3A 3SD4A 2FZKB 1EX4A 2SRCA 2WSEE 3OYHA 4C8QG 2OTJA 3CC4Q 1YN8A 2DILA 4RTYA 2GTJA 1M3AA 2ZPHB 4X9DA 3ZFJA 5GJVB 4M7AG 4M77F 5FWCA 2MWPA 2OTLT 4WF2A 4M75E 2JZ2A 4F7UA 1UTIA 4HT8A 1Q7YR 4MZTA 4M75C 3LWHA 1NZ9A 2ABLA 1VQLQ 4PK4A 1LPLA 1X2QA 4EIKA 4E2FB 4KBMB 1WHJA 3QYHB 3M53A 2CP2A 1YHQT 3CCLT 2DIGA 5GAMg 4N4IA 4F04B 2DLPA 1IB8A 1K76A 2A3LA 3S3OA 2ESWA 1N8RU 3NFCA 2JVVA 1K8AC 4A4HA 1WLPB 2VGMA 1YI2T 2VB6A 1LOJA 4NOYA 1C0MA 1UB4A 1Q82R 3WXMB 2X4WA 5GMKm 1Y57A 5LJ3d 1VQKT 1NYGA 5LJ3h 4OB3B 4M75F 1AEYA 1KQSA 3TEEA 2MF2A 4KUDK 2PU9B 2JMAA 5A0LA 4OMQA 1QWFA 3QBYA 4ZN3A 1D1BA 2EJ9A 3VYHB 1JXOA 2ZPEB 5KYUA 3TQ7P 1SHFA 4FYYB 1Z9ZA 2CT4A 3G6EA 5LJ5d 4BY6C 5GAOm 5GMKi 3OSVA 3VJPA 5CO7A 3HFNA 2QDLA 5FU7C 2EIFA 4M4ZA 1X01A 2X9HA 4XTUA 4OVAA 4PKCC 1D1AA 1M27C 2DL3A 3CBMA 4JRIA 1VQ7Q 2CP6A 2NUZA 1UFFA 2RQWA 3AT1B 3CMAQ 1AT1B 1JBMA 1YJWQ 1PNJA 4M78A 1Y0MA 2CDTA 2IG0A 1KD1U 2YT6A 1M9SA 2E12A 3I5RA 4DBQA 4Q5WA 3MO8A 1UDLA 5HKCA 3HRUA 4M7AB 4J9CA 2DYBA 4OMOA 4LD9K 2LQWA 3PMTA 3CCJA 3NTHA 1G3WA 2ZPIB 1SKUB 4B9WA 5IXBA 2DL5A 3EG1A 3PMIA 2HAXA 1UGPB 4IUQA 2QG9B 1PRLC 1K0XA 5CKEA 2MMPA 1VUBA 2XDBA 2QTVA 3G71A 4PJOA 4OGEA 2OJ2A 4FCYA 4MDWA 5L23A 4N4GA 3PT9A 4F7UG 3LGLA 1NYFA 2GNCA 1SHGA 3QIIA 3M54A 3M4YA 4EDUA 2P4TA 3S3NA 3JCMQ 1NJIU 1VQ8T 4F16A 1Q7YU 2RNAA 1DJ7B 2CREA 2GGRA 2C06A 5GANf 1VQ4A 3CCQA 1VOMA 2H8HA 4JJCA 1QQJA 2LX9A 3ZBDA 1K8AR 4FW2A 2KYBA 5KCOA 3J7AF 3RERA 3CCUQ 5LJ3e 1TTHB 1PD0A 3E9FA 2HD0A 3CC2T 2JNGA 1U8RA 4XTYA 1WQWA 1M1FA 2F2XA 3QDRB 5CKBA 2RHIA 4D8DA 5I22A 4M7DE 5GMKh 4J9FA 2FG0A 2RB6A 4M7DC 1MHNA 1NG2A 1RADB 1J3TA 2D6FA 2CP7A 3C4SA 1FMKA 1VQ6A 3CCEQ 1V1CA 3I56A 2RQUA 5GAN6 4JJBA 1U5SA 4FSXA 1U1SA 3HRTA 4FSSA 1UGVA 2BE9B 2L3PA 3VUZA 1YITT 3RIRA 4XU1A 3ME9A 2QQAA 1UG1A 2M1HA 2RHUA 4C8QD 2W10A 2XDPA 2VXFA 3A8LB 3CC4A 2KYMA 4ZN1A 4M7DF 3VS5A 1WXBA 1EZZB 3L2UA 4K11A 2E5QA 1ZHIA 2GFUA 1VQ5A 3M55A 2AKLA 3QXEB 3JAME 1U3OA 4IUVA 4R56A 2QQRA 2X3XD 2CZ0B 2QK0A 3IQLA 2OX7A 2YXYA 2ZPFB 1BCOA 2F5KA 4JRQA 3GPLA 5A0DA 1TOVA 5IHKA 2QA4T 2QXFA 3BDUA 2FZCB 4AG1C 4EMHA 1PG5B 1MMDA 3RKWA 2DJQA 2FVUA 1OV3A 2DVEA 4PJOG 3EFRA 1N8RC 3JV3A 2DTHA 2DERA 2YUNA 1M2OA 2XK0A 4BDZA 3OS2A 2DD4A 4JZ4A 1E7OA 2D0QB 1KQ2A 5GAN3 4RCBA 5LJ5f 1MMNA 1MNEA 1G3TA 1JU5C 2RQVA 1YI2A 3G4ST 1YBYA 1B34B 2AHJB 2WSCE 3BW1A 3REBB 3CCVQ 1QVFP 2PVOB 1R0CB 2V1QA 1ZSZC 4R55A 1BI3A 3VUBA 1ZA1B 2O9SA 2RJDA 2DMOA 1YJ9T 1E6HA 4HXJA 3LYIA 3BFMA 5IHIA 3FIFA 1MUZA 1WHLA 2VYTA 3V8LA 3OBWA 2VXEA 2R5MA 1JO8A 1M3BA 1Z9QA 4A4EA 1HK9A 4XTVA 3J81E 4BD3A 4II1A 3VS3A 2RMOA 3CD6T 3I35A 1FWZA 2YRCA 1WHKA 3UDCA 3M4GA 2KT1A 1KC8C 4N0AC 1UGQB 1F1BB 1RUWA 3C0CA 3L2ZA 2EKOA 3CCRT 2DIQA 5CKDA 4JJDA 4X1VA 1YJWA 4DQ2A 3EGXB 2LC4A 4BI8B 3KXTA 1B07A 1KD1C 1VQNT 4YTLA 3G6EQ 5EG2A 1KIKA 3ER0A 4OGCA 1OX9A 2JTEA 1N27A 2HL5C 2CYZB 4WTOB 2DXBA 2MYSA 3WVDB 2PUKB 1JRIA 2YSQA 2EQIA 1T3SA 4FM4B 2P0KA 1OI1A 3M57A 4C92E 1K9AA 2MPXC 4M77B 4C92C 2CH4A 2XHCA 3JCMd 3LW5E 1QW1A 2RN8A 1ABOA 4HVUA 2R58A 4E7LA 1R8OB 2E6NA 1G83A 1BK2A 4M7AA 4AFQC 2AZVA 1YWOA 3OS5A 5GAOr 2KRMA 3EGUA 4BE2A 4A4KA 8AT1B 3A8OB 1WNLA 2YUOA 1NJIC 1T3LA 3TU4K 1VQ8A 2JMCA 2RHYA 1N8RR 3I55T 4Z8AA 3CMET 4RTWA 3P8DA 1UHCA 3CBPA 3ZEHA 4C92F 1K9MU 2B86A 1PSFA 4LDYA 3G71Q 1MMAA 1XTDA 4B6MA 4M75B 4ZTJA 2HDAA 1M2VB 1RAFB 3F70A 1TXQA 1UJ0A 2DFUA 3RR6A 1H641 2RO0A 2KRSA 3GF5A 1UE9A 5FW9A 2CUDA 1UECA 2DD5A 3JCMJ 4J9IA 1VQ4Q 2RA2A 3CCQQ 2LJ3A 2RI5A 1SG5A 2LX7A 2RF0A 3OW2A 2ECZA 8ATCB 5C6SA 2Y90A 1X27A 4UC4A 4FL6A 1T0JA 1KC8R 3JB9H 3CCMT 2BKDN 1VQPT 2YHTA 3LLRA 3OYLA 1X2KA 2DE0X 2LNVA 3ULRB 1RAHB 5GANd 1VQ9A 2COWA 2V8KA 1NEBA 5KYWB 4V2SA 4M78D 3INZA 2K2MA 3URGA 3A5ZB 3PFSA 1KD1R 1AOJA 4AG2C 2EYQA 2PQWA 3E2UA 2RJFA 2ZZDA 4TVRA 2NUPB 4MZMA 4N0AA 2DBKA 4D6WA 4JLGA 4GLKA 3NTIA 3OYEA 1SRLA 4J8OA 3L2WA 2KVQG 2L5QA 4J9BA 2XDDA 3THKA 4PJOD 2BE7D 2QA4A 1RACB 4IIMA 5AYFA 2KT8A 1TSFA 2LT4A 4CC3A 3CPWA 2EYWA 1VQMT 3OS0A 1VA7A 1QCOA 4CI0C 1VQ5Q 1XJWB 1D0ZA 2F69A 3MPUB 2MK5A 1NJIR 2P84A 3R6NA 3HHTB 1WI7A 5I2SA 1VQOT 1X43A 4DBRA 3CCVA 4C92A 2OTLQ 4Z88A 2YWWA 3CXCS 1OPKA 2EQMA 2E10A 1Q95G 2QI2A 1QVPA 4Y92A 4J6YA 4KGZB 2L0AA 2VASA 4LNPA 1QP3A 2GCXA 2DK3A 2HQXA 2LQKA 2QQBA 2FB7A 4RTXA 1A0NB 3QHSA 2DVJA 5IHNA 2VUBA 4JPBW 2VKNA 2CKKA 1YHQQ 3CCLQ 4LDWA 2CH4W 1OU8A 1CKBA 1BKBA 1B34A 3TVTA 2M9UA 1YI2Q 3CD6A 2P0QA 4VUBA 1X75C 2W0ZA 2O4XB 1V76A 3J80E 5DY9A 2DEQA 1VQKQ 2FO0A 5IAYA 1CSKA 3JCMW 1BIBA 2RK1A 1JJ2S 2MWOA 2EJFA 4E47A 2XMFA 4PFPA 1WJQA 2EWNA 4J7IA 3JCMf 2GBQA 4ANJA 2XU8A 3HRSA 5GANe 5LJ5h 5CR2A 1SF9A 2E5KA 3WVEB 3JB9J 1U06A 2RJEA 3RKXA 6AT1B 1RL2A 1G3YA 2COYA 3SB2A 3UF4A 4E7IA 5GMKj 4M7DB 2HBWA 1KC8U 4C0ZA 1AHJB 3QJYA 3A8HB 1QVGA 3O8VA 1ACMB 1TUGB 2X4YA 2DX1A 4QT7A 3I9QA 1B7TA 3FDRA 1PSEA 2E6ZA 3D7SB 1GL5A 1MMGA 1FMWA 3EGXA 3OSSC 3S6WA 4QVZA 2JXBA 5CQYA 1WZOA 1MGQA 2A37A 3EHQA 5GAMj 2NWMA 2A0FB 2CP5A 1B3QA 4RTTA 1KJWA 2FRYA 2E1HA 2O31A 3A98A 4O6JA 3OYJA 3RUXA 1WPYA 2XIDA 2HSPA 4L5GA 1IHVA 3CMAT 1FMVA 4OMLA 2EFIA 2D8HA 5HCKA 4QQ6A 4ME7A 3SHWA 5KH6A 2KROA 1IXDA 4HCZA 1YWPA 3PGGA 3PVLA 4CC7A 4M77A 2MAMA 2O9VA 4EPCA 3E1SA 3H0IA 3GP8A 5FWBA 2JOYA 4BE1A 3CMEA 1K9MC 2DTIA 5CCAA 3HL8A 4IUTA 5CKFA 5L8RE 1TH7A 3OYKA 2F2WA 2L2PA 1D09B 3VRZA 5KYNA 2G6FX 1GFCA 2E70A 2HZYA 3NHNA 4PL6A 4ZGEB 1M5Q1 3OS1A 2X3WD 4OMMA 4C92G 1ZX6A 2FPEA 5IXFA 4JRKA 4LE9A 3P8HA 5HK3A 3MEUA 2H3EB 3SWNB 3JB9G 1M4ZA 3VKIA 1VQ8Q 4RG2A 2RI2A 2RH2A 2YDLA 1W2BS 3HKSA 4Y28E 2F5TX 5IN1A 4J9GA 2J06A 4KGXB 1S1NA 5GJWB 1QVFA 5J3BA 4M75A 1ZUYA 4LD6A 4XTXA 1M2VA 5DLOA 5D6WA 3QWXX 4BACA 1MV3A 1RABB 1ZSZB 3QPHA 1OULA 2F1LA 3CC2Q 1NEGA 3META 2HKNA 3LGFA 1SPKA 2PUOB 4IURA 3A8GB 2YUQA 1KQSP 5LJ5e 2LJ0A 2PZ1A 2K3YA 4OB0B 1GCQC 4R0KA 4X9CA 1E6GA 1I5OB 1WIEA 5GAOq 2GFAA 3TSZA 1S72T 4OB2B 1P92A 2ROTA 1YJNT 1AWOA 2DKGA 3OYBA 3X26B 2C0OA 5GAMd 4XU0A 5KYWA 3VS6A 3NMZC 2KY9A 3OB9A 4C8QE 1VQ9Q 4ZGJB 1YITQ 5KYYB 1ZA2B 3MCAB 2LNHB 4C8QC 3JCMX 3O5ZA 4M7AD 4AT1B 4AMCA 2PTKA 1I1JA 2LDMA 2NUPA 4KH1B 4HCCA 4A54A 1KFZA 4J9DA 1BU1A 3MP6A 1AD5A 1VQMA 4A4FA 1LNXA 2IVWA 1RLQC 2LT1A 2M16A 4LN2A 2OTLA 1WJRA 2LCLA 2YLBA 3VS1A 1TS9A 4KULA 4RTUA 1WYXA 3TCJA 4M77G 4C92B 2FRWA 1K9MR 2K5FA 2Y4XA 3MEVA 3MEWA 2JT4A 1QCNA 5FU6C 5CAIA 3SWNC 1D3BB 4KT0E 3OYMA 2RJCA 2QA4Q 4PLLA 4C8QF 3VS7A 1YHQA 3CCLA 3OYCA 1GCPA 1VYUA 1G3SA 4EMGA 4X34A 2R57A 4BDYA 4GLMA 4F17A 2BUDA 4IUPA 4ESRA 5CQXA 2OTJT 1ARKA 3FJ5A 2FPDA 3H9NA 4NS5A 2LCCA 3M0RA 2HBPA 2YUPA 1VQKA 1LCKA 3RKYA 2AKKA 1I81A 3G4SQ 2P0PA 4C0FA 2J7IA 2EYYA 2XD0A 9ATCB 4A63B 1KQSS 1BI2A 1X6OA 4F14A 1RI9A 2ZPGB 2DETA 2NUTB 3H8ZA 3T9NA 4M75G 5GAN4 3UA6A 2L8DA 2C0TA 4MMKA 3R6OA 1AWJA 2NLUA 2SEMA 5KCHA 3CC7T 2QEXT 1PWTA 1ZBXA 2DM1A 5DLQE 3M0SA 2O4XA 1YIJT 1Y7XA 4HCBA 3PE0A 3CD6Q 2QDYB 1SSHA 4J9HA 2M51A 3FRNA 4QQGA 2QYZA 1AVZC 3RBBB 2LVMA 2BIVA 3RMSA 2CP3A 3N5BB 2JUFA 4XQ3A 2F2VA 2HEQA 3CCRQ 1LJOA 2WSFE 1M3CA 5HK0A 4IIOA 3DLMA 4JS4A 2K7AA 4M7DA 2JS0A 4E7HA 3UA7A 1D1CA 2CZ1B 4GBQA 3P8BB 3M9QA 4JRPA 3GNGA 3OYNA 3MEAA 5A2QE 1TUCA 1I4K1 2CT3A 4XK8E 2DXCA 3JB9I 3JCMh 2KE9A 1M1GA 2ED0A 4F7UE 1X6GA 1KSWA 2KQWA 1RAIB 1GRIA 5LJ3g 1ZUKA 1OYXA 3G7ZA 3JSCA 1QLYA 5GAN2 1WGSA 4FYWB 1U1TA 4HT9A 3L2VA 1OZ3A 2J6OA 3OMGA 2HMAA 3CCST 2R5AA 3M0TA 4LDXA 2J6KA 5LJ5g 3CCJT 3NTKA 4KUIA 2HCKA 4XAXB 3I55Q 3CMEQ 3SEMA 1ZUUA 1Q86C 1W6XA 2VVKA 3CBOA 3BDLA 3LX7A 1OX8A 2VC8A 1H3HA 3CXCP 2EW3A 4L6V5 4F7UF 1OQKA 1JEGA 3CC2A 4B9XA 3HTRA 3UT1A 3SWNA 5I21A 2CSIA 2CGHA 5GMKl 1MV0B 4DEYA 3GIBA 1IGQA 5GAOn 2CS7A 3AHUA 3L1AA 2DPPB 1M1KU 5GAMf 2YRDA 2E4HA 1IHWA 5IH2A 4BI4A 1BI1A 3GNFB 3VS4A 2JJ9A 1MNDA 1TUDA 3V7RA 2COZA 1RAEB 2ENMA 1ZSZA 2EYZA 3TSWA 2Y4YA 3JCMV 3M56A 1S72A 3OY9A 2RQRA 1R0BG 3MHXA 2QASA 2A7YA 5GAOl 5LJ3j 2LMJA 3QUIA 2K5IA 1YITA 2EPDA 5GANh 3CCMQ 2NYSA 3QZ5B 1D0YA 1VQPQ 3M58A 3E19A 4E7JA 2K3XA 1JJ2P 4AFZC 4QKUA 1LVKA 4M78E 2MOXA 3MJXA 4KRTA 4BB7A 4FIBA 1M90U 2AK5A 2CZ6B 1WHMA 1JQQA 2OAUA 4AFSC 2QAZA 1XOVA 4M78C 2QGGA 3VYGA 1WFWA 3X25B 4BE0A 3PTAA 4Z89A 3UPUA 3EAEA 4M7DG 1QKXA 2DRMA 1BCMA 3KFVA 7AT1B 1N6AA 2V26A 1Y71A 4M77D 1K73U 3QYGB 1UGRB 4JZ3A 1VQ6T 2M02A 3JCMe 2JM9A 4P5NA 3I56T 3V8KA 1ZQ1A 5KYYA 1NM7A 1W70A 3Q1JA 3EFSA 2HL3A 1K0SA 4PJOE 3FB9A 1C6VX 1W4SA 4PJOC 2EQJA 2ED1A 3VS2A 2PVDB 3GLXA 1EFNA 4M78F 3QDFA 1CKAA 3CC4T 1QWEA 1NPRA 3L2RA 1VQMQ 3PVQA 1AWWA 3FEOA 3FLGA 2LQNA 3U23A 2A28A 1QMCA 1VQ5T 3JCMP 5I2MA 1KHCA 4Z02A 3OYIA 3G4SA 5KYXB 1VQOQ 1PRMC 1KK7A 1D3BA 4M75D 4RCCA 1VQLT 4J7FA 2DA9A 2K57A 5LL6S 1Q86R 2G3RA 2I2LA 1YJ9A 4QQDA 3OYDA 4LUDA 1Q81U 4PJOF 4XTWA 2DXTA 2CSQA 4PNOA 2D9TA 5C0MA 3EG9B 2GQIA 1VYTA 3CC7A 2QEXA 2RK2A 2YRVA 1YIJA 1W2BP 3EFOB 1I07A 5HY6A 2KEAA 2NUTA 3JCMb 3DKMA 4EMKC 2LTOA 1BIAA 4FT4A 3CCRA 1QKWA 1GXIE 2RQTA 2BZ8A 2EGCA 3OW2P 2YLCA 3REAB 3MP1A 2O88A 1K4US 1YP5A 2H3JA 1VQNA 1IREB 2XKOC 3S3MA 1D0XA 2KMTA 2DBMA 2ZGWA 3HPWA 3QJ6A 2KSSA 3HSBA 3H41A 2K5LA 2LQ8A 1SEMA 2EBPA 3OBYA 3M0QA 1H8KA 4OF1A 3QSUA 2IIMA 5A0GA 3DLLA 4QVCA 1VQ7T 1TU0B 2VV5A 2DTOA 2ZPBB 4L59A 2A08A 1UHFA 1WXUA 3EG3A 1YJWT 3KBGA 1IRXA 1RAAB 3EH2A 4O5VA 4DEXA 3H0FA 1NPPA 1UJYA 1G8XA 4JUVA 4C8QB 2J05A 4ELYC 1OU9A 4ZGDB 2K9GA 3EGDB 2V8JA 3OYYA 2DYIA 4FYXB 2QGFB 3NPFA 3I55A 4Y91A 2L89A 3CCSA 2BZYA 3OYAA 3CPWP 1WQ7A 2KXDA 2A36A 1X69A 2K79A 4BUGA 4PJLA 2E65A 1VIFA 2DF6A 1V29B 1FYNA 3C94A 3LH5A 3VRYA 1O9SA 2EKHA 3EH1A 4RUGA 5FU6B 4FYVB 2BTTA 3CPFA 4ORZA 4C0GA 2JS2A 1M1KC 2DL4A 3QG1A 4OMFB 4PFZA 4E7KA 2LJ1A 4C5GA 1IZ6A 1HXDA 2RHZA 2VGNA 3FJPA 2JTFA 4JJNK 1Q86U 1K1ZA 3ASKA 5AT1B 2CUBA 3EHRA 1WHGA 1Y96B 3L42A 2MCNA 3CCUT 3OW2S 4XU2A 1X6BA 1ZLMA 1KG1A 3CCMA 2GTOA 1VQPA 5FLXE 3EG2A 1M30A 4NL3A 1I8FA 2XICA 2AZSA 1BBZA 1WA7A 1GBQA 2K6DA 4XU3A 3JCMg 4KH0B 1EIFA 2E3HA 2EGEA 3RESA 2FEIA 1ZBJA 5KE2A 1M90C 4M7DD 4PJJA 3A1PA 4FU6A 3EG0A 3HFOA 3QZ9B 2L3RA 1Q82U 4C5EA 1BYMA 2E64A 4MMLA 4MDXA 3OQ5A 1PKTA 4DA4A 5ECAA 3NGPA 1K73C 3CCET 4C5HA 5GAN7 1S72Q
chains in the Genus database with same CATH topology
1TSFA 2ZAEA 1PC0A 1TS9A 1V76A 2KI7A 1OQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSF A;  2ZAE A;  1PC0 A;  1TS9 A;  1V76 A;  2KI7 A;  1OQK A; 
#chains in the Genus database with same CATH topology
 4EMK A;  1N5Z A;  1YJN Q;  5M9O A;  5GAM h;  1QVG P;  4E7Z A;  4JS5 A;  2DL7 A;  3SDZ A;  2DL8 A;  1PCX A;  2HNI A;  4PFO A;  4M7A E;  1VQ9 T;  4RMO A;  5EC7 A;  2LRQ A;  1R77 A;  4M7A C;  4D8K A;  3JRZ A;  3VS0 A;  2FHD A;  2EGA A;  3CPW S;  2LP5 A;  4ELZ C;  1IGU A;  2K2V A;  1G2B A;  5D7U A;  1GFD A;  3OMC A;  2D8J A;  4E7S A;  3CEY A;  4DOW A;  1VQO A;  3V7S A;  4M78 G;  1OPL A;  5FRM A;  2OI3 A;  1JXM A;  4HCK A;  4JLI A;  2FL7 A;  3H6Z A;  3BY7 A;  4DBF A;  1I0C A;  1VQL A;  1H3Z A;  4KGV B;  4ZNX A;  4F7U B;  3QWY A;  4FT2 A;  1Q81 C;  2DRK A;  2FZG B;  4M7A F;  4OMP A;  5LJ3 f;  5FRO A;  2B8A A;  3PNW C;  5GAN g;  2KRN A;  3ZL7 C;  2RHX A;  2JM8 A;  4HVW A;  5KYX A;  2OTJ Q;  2KXC A;  2EYX A;  1M1K R;  1QP2 A;  5D6X A;  4HA8 A;  2VWF A;  1C1A A;  1O75 A;  1UGS B;  1WDX A;  2X4J A;  3CXC A;  2AIR B;  3CCV T;  1WXT A;  3UAT A;  2DZC A;  5J26 A;  2CZ7 B;  2O01 E;  2X35 A;  2HQE A;  3MKD A;  4ATO A;  1YJ9 Q;  4LUE A;  3RNJ A;  3UWN A;  1W1F A;  2LCS A;  4WCI A;  3EG9 A;  3M59 A;  2V1R A;  4BI3 A;  2ATC B;  2C0I A;  5J39 A;  3M5A A;  2K3B A;  2EQK A;  5GAN 8;  1IO6 A;  3CC7 Q;  1AZG B;  1YCS B;  3L2Q A;  3EFO A;  2QEX Q;  5GMK e;  3TRE A;  5KYU B;  1M90 R;  4LDU A;  4LDV A;  3VV0 A;  4PJN A;  1K8A U;  1G5V A;  5I11 A;  1WHH A;  2GF7 A;  1SSF A;  1YIJ Q;  2ZCF B;  1QVG S;  1PM3 A;  2AT1 B;  2P4R A;  4C0D B;  3V8J A;  3C12 A;  2KK4 A;  1GBR A;  1AZE A;  2EQU A;  3PIP A;  1K73 R;  2Z0W A;  2JTM A;  4HKE A;  5GAM e;  1UEB A;  1JJ2 A;  2KAF A;  3OA6 A;  4RTZ A;  4JDS A;  1VQ7 A;  4J83 A;  2IPO B;  1HJD A;  4CC4 B;  1VQN Q;  3G6E T;  4LXC A;  3CMA A;  4CC2 A;  2J6F A;  5GAN j;  1GCQ A;  2M0O A;  2D1X A;  1OOT A;  1BI0 A;  5IT9 E;  1FXX A;  4E6R A;  2KR3 A;  1UUE A;  4NL2 A;  4M78 B;  4PLI A;  2KGT A;  2QQS A;  2MIO A;  1NLP C;  5CK9 A;  2OAW A;  2RD1 A;  2FPF A;  4GY5 A;  4C92 D;  5DM7 R;  3BE3 A;  1YCY A;  3QKJ A;  1M8M A;  2JN0 A;  4QVD A;  3KUF A;  3G1J A;  4FW1 A;  4RTV A;  4RG8 A;  3JB9 D;  4C8Q A;  1OEB A;  4CRI A;  5KE3 A;  2BZX A;  3EGD A;  2I0N A;  1JB0 E;  2M0Y A;  2HQH A;  3E9G A;  2D0N A;  3X20 B;  4PJO B;  4N4H A;  3C95 A;  1NE8 A;  3DB3 A;  4RKU E;  1Q81 R;  2LZ6 B;  2E41 A;  1PKS A;  1PHT A;  2O2O A;  1XQH A;  2RI3 A;  3CCS Q;  3M0U A;  1RI0 A;  2HSE B;  1KQ1 A;  4QW2 A;  1Q7Y C;  2ZAE A;  1TWB A;  1VIE A;  3CCJ Q;  2KNB B;  3X24 B;  2V8I A;  1I5L A;  2E3I A;  1QVF S;  2FYK A;  2X51 A;  2WAC A;  4IKF A;  1N9S A;  3G71 T;  2DO3 A;  3CCU A;  4A53 A;  4C5I A;  2QQ9 A;  4OMN A;  3H0H A;  1NLO C;  2GQV A;  2QTX A;  1QCF A;  4OP0 A;  5GAO p;  2RPN A;  3HP9 A;  1YNZ A;  3JB9 F;  1NBE B;  2JW4 A;  2DXU A;  1Y07 A;  1OZ2 A;  3M0P A;  4C0D C;  2DNU A;  1Y96 A;  1HD3 A;  1Q82 C;  1W2B A;  2MI6 A;  1VQ4 T;  4J5Y A;  3PIO A;  3CCQ T;  1TG0 A;  3A8M B;  2KDS A;  1YFN A;  3VU3 C;  3GOX A;  4J6W A;  1ZSG A;  1N9R A;  1SRM A;  1H92 A;  1YJN A;  4AFU C;  3CCE A;  1AWX A;  2L3S A;  1RLP C;  3RMQ A;  3SFM A;  4EMK B;  5GAN 5;  4OB1 B;  4A4G A;  5FRN A;  3X28 B;  4DBH A;  3I5S A;  2DZ9 A;  5CKH A;  1VYV A;  1T0H A;  2XI9 A;  1ABQ A;  2PNI A;  2PVG B;  1PC0 A;  5D6Y A;  5LJ5 j;  1HYO A;  2EJG A;  3OYF A;  3GBQ A;  4PJM A;  3LH0 A;  2K4Y A;  4DOV A;  2DAQ A;  1RAG B;  1BB9 A;  1HSQ A;  2EVR A;  4M77 E;  3V7C A;  1M8V A;  4BY6 B;  2XG8 D;  2L3Q A;  4M77 C;  1XNI A;  4MZP A;  3MP8 A;  4XTZ A;  5CIU A;  2HKQ B;  3LWI A;  1VQ6 Q;  2X4X A;  3RDV A;  2KI7 A;  3FC3 A;  2DJZ A;  2RM4 A;  3I56 Q;  4HVV A;  1PD1 A;  5FU7 B;  4J9E A;  5CVI A;  3JCM c;  2KBT A;  1WX6 A;  3OYG A;  1FX7 A;  3CQT A;  4IUU A;  4J6X A;  1KHI A;  2ROL A;  2CP0 A;  2DEU A;  4ZTF A;  1WJS A;  3DB4 A;  2EAY A;  3QO3 A;  3SD4 A;  2FZK B;  1EX4 A;  2SRC A;  2WSE E;  3OYH A;  4C8Q G;  2OTJ A;  3CC4 Q;  1YN8 A;  2DIL A;  4RTY A;  2GTJ A;  1M3A A;  2ZPH B;  4X9D A;  3ZFJ A;  5GJV B;  4M7A G;  4M77 F;  5FWC A;  2MWP A;  2OTL T;  4WF2 A;  4M75 E;  2JZ2 A;  4F7U A;  1UTI A;  4HT8 A;  1Q7Y R;  4MZT A;  4M75 C;  3LWH A;  1NZ9 A;  2ABL A;  1VQL Q;  4PK4 A;  1LPL A;  1X2Q A;  4EIK A;  4E2F B;  4KBM B;  1WHJ A;  3QYH B;  3M53 A;  2CP2 A;  1YHQ T;  3CCL T;  2DIG A;  5GAM g;  4N4I A;  4F04 B;  2DLP A;  1IB8 A;  1K76 A;  2A3L A;  3S3O A;  2ESW A;  1N8R U;  3NFC A;  2JVV A;  1K8A C;  4A4H A;  1WLP B;  2VGM A;  1YI2 T;  2VB6 A;  1LOJ A;  4NOY A;  1C0M A;  1UB4 A;  1Q82 R;  3WXM B;  2X4W A;  5GMK m;  1Y57 A;  5LJ3 d;  1VQK T;  1NYG A;  5LJ3 h;  4OB3 B;  4M75 F;  1AEY A;  1KQS A;  3TEE A;  2MF2 A;  4KUD K;  2PU9 B;  2JMA A;  5A0L A;  4OMQ A;  1QWF A;  3QBY A;  4ZN3 A;  1D1B A;  2EJ9 A;  3VYH B;  1JXO A;  2ZPE B;  5KYU A;  3TQ7 P;  1SHF A;  4FYY B;  1Z9Z A;  2CT4 A;  3G6E A;  5LJ5 d;  4BY6 C;  5GAO m;  5GMK i;  3OSV A;  3VJP A;  5CO7 A;  3HFN A;  2QDL A;  5FU7 C;  2EIF A;  4M4Z A;  1X01 A;  2X9H A;  4XTU A;  4OVA A;  4PKC C;  1D1A A;  1M27 C;  2DL3 A;  3CBM A;  4JRI A;  1VQ7 Q;  2CP6 A;  2NUZ A;  1UFF A;  2RQW A;  3AT1 B;  3CMA Q;  1AT1 B;  1JBM A;  1YJW Q;  1PNJ A;  4M78 A;  1Y0M A;  2CDT A;  2IG0 A;  1KD1 U;  2YT6 A;  1M9S A;  2E12 A;  3I5R A;  4DBQ A;  4Q5W A;  3MO8 A;  1UDL A;  5HKC A;  3HRU A;  4M7A B;  4J9C A;  2DYB A;  4OMO A;  4LD9 K;  2LQW A;  3PMT A;  3CCJ A;  3NTH A;  1G3W A;  2ZPI B;  1SKU B;  4B9W A;  5IXB A;  2DL5 A;  3EG1 A;  3PMI A;  2HAX A;  1UGP B;  4IUQ A;  2QG9 B;  1PRL C;  1K0X A;  5CKE A;  2MMP A;  1VUB A;  2XDB A;  2QTV A;  3G71 A;  4PJO A;  4OGE A;  2OJ2 A;  4FCY A;  4MDW A;  5L23 A;  4N4G A;  3PT9 A;  4F7U G;  3LGL A;  1NYF A;  2GNC A;  1SHG A;  3QII A;  3M54 A;  3M4Y A;  4EDU A;  2P4T A;  3S3N A;  3JCM Q;  1NJI U;  1VQ8 T;  4F16 A;  1Q7Y U;  2RNA A;  1DJ7 B;  2CRE A;  2GGR A;  2C06 A;  5GAN f;  1VQ4 A;  3CCQ A;  1VOM A;  2H8H A;  4JJC A;  1QQJ A;  2LX9 A;  3ZBD A;  1K8A R;  4FW2 A;  2KYB A;  5KCO A;  3J7A F;  3RER A;  3CCU Q;  5LJ3 e;  1TTH B;  1PD0 A;  3E9F A;  2HD0 A;  3CC2 T;  2JNG A;  1U8R A;  4XTY A;  1WQW A;  1M1F A;  2F2X A;  3QDR B;  5CKB A;  2RHI A;  4D8D A;  5I22 A;  4M7D E;  5GMK h;  4J9F A;  2FG0 A;  2RB6 A;  4M7D C;  1MHN A;  1NG2 A;  1RAD B;  1J3T A;  2D6F A;  2CP7 A;  3C4S A;  1FMK A;  1VQ6 A;  3CCE Q;  1V1C A;  3I56 A;  2RQU A;  5GAN 6;  4JJB A;  1U5S A;  4FSX A;  1U1S A;  3HRT A;  4FSS A;  1UGV A;  2BE9 B;  2L3P A;  3VUZ A;  1YIT T;  3RIR A;  4XU1 A;  3ME9 A;  2QQA A;  1UG1 A;  2M1H A;  2RHU A;  4C8Q D;  2W10 A;  2XDP A;  2VXF A;  3A8L B;  3CC4 A;  2KYM A;  4ZN1 A;  4M7D F;  3VS5 A;  1WXB A;  1EZZ B;  3L2U A;  4K11 A;  2E5Q A;  1ZHI A;  2GFU A;  1VQ5 A;  3M55 A;  2AKL A;  3QXE B;  3JAM E;  1U3O A;  4IUV A;  4R56 A;  2QQR A;  2X3X D;  2CZ0 B;  2QK0 A;  3IQL A;  2OX7 A;  2YXY A;  2ZPF B;  1BCO A;  2F5K A;  4JRQ A;  3GPL A;  5A0D A;  1TOV A;  5IHK A;  2QA4 T;  2QXF A;  3BDU A;  2FZC B;  4AG1 C;  4EMH A;  1PG5 B;  1MMD A;  3RKW A;  2DJQ A;  2FVU A;  1OV3 A;  2DVE A;  4PJO G;  3EFR A;  1N8R C;  3JV3 A;  2DTH A;  2DER A;  2YUN A;  1M2O A;  2XK0 A;  4BDZ A;  3OS2 A;  2DD4 A;  4JZ4 A;  1E7O A;  2D0Q B;  1KQ2 A;  5GAN 3;  4RCB A;  5LJ5 f;  1MMN A;  1MNE A;  1G3T A;  1JU5 C;  2RQV A;  1YI2 A;  3G4S T;  1YBY A;  1B34 B;  2AHJ B;  2WSC E;  3BW1 A;  3REB B;  3CCV Q;  1QVF P;  2PVO B;  1R0C B;  2V1Q A;  1ZSZ C;  4R55 A;  1BI3 A;  3VUB A;  1ZA1 B;  2O9S A;  2RJD A;  2DMO A;  1YJ9 T;  1E6H A;  4HXJ A;  3LYI A;  3BFM A;  5IHI A;  3FIF A;  1MUZ A;  1WHL A;  2VYT A;  3V8L A;  3OBW A;  2VXE A;  2R5M A;  1JO8 A;  1M3B A;  1Z9Q A;  4A4E A;  1HK9 A;  4XTV A;  3J81 E;  4BD3 A;  4II1 A;  3VS3 A;  2RMO A;  3CD6 T;  3I35 A;  1FWZ A;  2YRC A;  1WHK A;  3UDC A;  3M4G A;  2KT1 A;  1KC8 C;  4N0A C;  1UGQ B;  1F1B B;  1RUW A;  3C0C A;  3L2Z A;  2EKO A;  3CCR T;  2DIQ A;  5CKD A;  4JJD A;  4X1V A;  1YJW A;  4DQ2 A;  3EGX B;  2LC4 A;  4BI8 B;  3KXT A;  1B07 A;  1KD1 C;  1VQN T;  4YTL A;  3G6E Q;  5EG2 A;  1KIK A;  3ER0 A;  4OGC A;  1OX9 A;  2JTE A;  1N27 A;  2HL5 C;  2CYZ B;  4WTO B;  2DXB A;  2MYS A;  3WVD B;  2PUK B;  1JRI A;  2YSQ A;  2EQI A;  1T3S A;  4FM4 B;  2P0K A;  1OI1 A;  3M57 A;  4C92 E;  1K9A A;  2MPX C;  4M77 B;  4C92 C;  2CH4 A;  2XHC A;  3JCM d;  3LW5 E;  1QW1 A;  2RN8 A;  1ABO A;  4HVU A;  2R58 A;  4E7L A;  1R8O B;  2E6N A;  1G83 A;  1BK2 A;  4M7A A;  4AFQ C;  2AZV A;  1YWO A;  3OS5 A;  5GAO r;  2KRM A;  3EGU A;  4BE2 A;  4A4K A;  8AT1 B;  3A8O B;  1WNL A;  2YUO A;  1NJI C;  1T3L A;  3TU4 K;  1VQ8 A;  2JMC A;  2RHY A;  1N8R R;  3I55 T;  4Z8A A;  3CME T;  4RTW A;  3P8D A;  1UHC A;  3CBP A;  3ZEH A;  4C92 F;  1K9M U;  2B86 A;  1PSF A;  4LDY A;  3G71 Q;  1MMA A;  1XTD A;  4B6M A;  4M75 B;  4ZTJ A;  2HDA A;  1M2V B;  1RAF B;  3F70 A;  1TXQ A;  1UJ0 A;  2DFU A;  3RR6 A;  1H64 1;  2RO0 A;  2KRS A;  3GF5 A;  1UE9 A;  5FW9 A;  2CUD A;  1UEC A;  2DD5 A;  3JCM J;  4J9I A;  1VQ4 Q;  2RA2 A;  3CCQ Q;  2LJ3 A;  2RI5 A;  1SG5 A;  2LX7 A;  2RF0 A;  3OW2 A;  2ECZ A;  8ATC B;  5C6S A;  2Y90 A;  1X27 A;  4UC4 A;  4FL6 A;  1T0J A;  1KC8 R;  3JB9 H;  3CCM T;  2BKD N;  1VQP T;  2YHT A;  3LLR A;  3OYL A;  1X2K A;  2DE0 X;  2LNV A;  3ULR B;  1RAH B;  5GAN d;  1VQ9 A;  2COW A;  2V8K A;  1NEB A;  5KYW B;  4V2S A;  4M78 D;  3INZ A;  2K2M A;  3URG A;  3A5Z B;  3PFS A;  1KD1 R;  1AOJ A;  4AG2 C;  2EYQ A;  2PQW A;  3E2U A;  2RJF A;  2ZZD A;  4TVR A;  2NUP B;  4MZM A;  4N0A A;  2DBK A;  4D6W A;  4JLG A;  4GLK A;  3NTI A;  3OYE A;  1SRL A;  4J8O A;  3L2W A;  2KVQ G;  2L5Q A;  4J9B A;  2XDD A;  3THK A;  4PJO D;  2BE7 D;  2QA4 A;  1RAC B;  4IIM A;  5AYF A;  2KT8 A;  1TSF A;  2LT4 A;  4CC3 A;  3CPW A;  2EYW A;  1VQM T;  3OS0 A;  1VA7 A;  1QCO A;  4CI0 C;  1VQ5 Q;  1XJW B;  1D0Z A;  2F69 A;  3MPU B;  2MK5 A;  1NJI R;  2P84 A;  3R6N A;  3HHT B;  1WI7 A;  5I2S A;  1VQO T;  1X43 A;  4DBR A;  3CCV A;  4C92 A;  2OTL Q;  4Z88 A;  2YWW A;  3CXC S;  1OPK A;  2EQM A;  2E10 A;  1Q95 G;  2QI2 A;  1QVP A;  4Y92 A;  4J6Y A;  4KGZ B;  2L0A A;  2VAS A;  4LNP A;  1QP3 A;  2GCX A;  2DK3 A;  2HQX A;  2LQK A;  2QQB A;  2FB7 A;  4RTX A;  1A0N B;  3QHS A;  2DVJ A;  5IHN A;  2VUB A;  4JPB W;  2VKN A;  2CKK A;  1YHQ Q;  3CCL Q;  4LDW A;  2CH4 W;  1OU8 A;  1CKB A;  1BKB A;  1B34 A;  3TVT A;  2M9U A;  1YI2 Q;  3CD6 A;  2P0Q A;  4VUB A;  1X75 C;  2W0Z A;  2O4X B;  1V76 A;  3J80 E;  5DY9 A;  2DEQ A;  1VQK Q;  2FO0 A;  5IAY A;  1CSK A;  3JCM W;  1BIB A;  2RK1 A;  1JJ2 S;  2MWO A;  2EJF A;  4E47 A;  2XMF A;  4PFP A;  1WJQ A;  2EWN A;  4J7I A;  3JCM f;  2GBQ A;  4ANJ A;  2XU8 A;  3HRS A;  5GAN e;  5LJ5 h;  5CR2 A;  1SF9 A;  2E5K A;  3WVE B;  3JB9 J;  1U06 A;  2RJE A;  3RKX A;  6AT1 B;  1RL2 A;  1G3Y A;  2COY A;  3SB2 A;  3UF4 A;  4E7I A;  5GMK j;  4M7D B;  2HBW A;  1KC8 U;  4C0Z A;  1AHJ B;  3QJY A;  3A8H B;  1QVG A;  3O8V A;  1ACM B;  1TUG B;  2X4Y A;  2DX1 A;  4QT7 A;  3I9Q A;  1B7T A;  3FDR A;  1PSE A;  2E6Z A;  3D7S B;  1GL5 A;  1MMG A;  1FMW A;  3EGX A;  3OSS C;  3S6W A;  4QVZ A;  2JXB A;  5CQY A;  1WZO A;  1MGQ A;  2A37 A;  3EHQ A;  5GAM j;  2NWM A;  2A0F B;  2CP5 A;  1B3Q A;  4RTT A;  1KJW A;  2FRY A;  2E1H A;  2O31 A;  3A98 A;  4O6J A;  3OYJ A;  3RUX A;  1WPY A;  2XID A;  2HSP A;  4L5G A;  1IHV A;  3CMA T;  1FMV A;  4OML A;  2EFI A;  2D8H A;  5HCK A;  4QQ6 A;  4ME7 A;  3SHW A;  5KH6 A;  2KRO A;  1IXD A;  4HCZ A;  1YWP A;  3PGG A;  3PVL A;  4CC7 A;  4M77 A;  2MAM A;  2O9V A;  4EPC A;  3E1S A;  3H0I A;  3GP8 A;  5FWB A;  2JOY A;  4BE1 A;  3CME A;  1K9M C;  2DTI A;  5CCA A;  3HL8 A;  4IUT A;  5CKF A;  5L8R E;  1TH7 A;  3OYK A;  2F2W A;  2L2P A;  1D09 B;  3VRZ A;  5KYN A;  2G6F X;  1GFC A;  2E70 A;  2HZY A;  3NHN A;  4PL6 A;  4ZGE B;  1M5Q 1;  3OS1 A;  2X3W D;  4OMM A;  4C92 G;  1ZX6 A;  2FPE A;  5IXF A;  4JRK A;  4LE9 A;  3P8H A;  5HK3 A;  3MEU A;  2H3E B;  3SWN B;  3JB9 G;  1M4Z A;  3VKI A;  1VQ8 Q;  4RG2 A;  2RI2 A;  2RH2 A;  2YDL A;  1W2B S;  3HKS A;  4Y28 E;  2F5T X;  5IN1 A;  4J9G A;  2J06 A;  4KGX B;  1S1N A;  5GJW B;  1QVF A;  5J3B A;  4M75 A;  1ZUY A;  4LD6 A;  4XTX A;  1M2V A;  5DLO A;  5D6W A;  3QWX X;  4BAC A;  1MV3 A;  1RAB B;  1ZSZ B;  3QPH A;  1OUL A;  2F1L A;  3CC2 Q;  1NEG A;  3MET A;  2HKN A;  3LGF A;  1SPK A;  2PUO B;  4IUR A;  3A8G B;  2YUQ A;  1KQS P;  5LJ5 e;  2LJ0 A;  2PZ1 A;  2K3Y A;  4OB0 B;  1GCQ C;  4R0K A;  4X9C A;  1E6G A;  1I5O B;  1WIE A;  5GAO q;  2GFA A;  3TSZ A;  1S72 T;  4OB2 B;  1P92 A;  2ROT A;  1YJN T;  1AWO A;  2DKG A;  3OYB A;  3X26 B;  2C0O A;  5GAM d;  4XU0 A;  5KYW A;  3VS6 A;  3NMZ C;  2KY9 A;  3OB9 A;  4C8Q E;  1VQ9 Q;  4ZGJ B;  1YIT Q;  5KYY B;  1ZA2 B;  3MCA B;  2LNH B;  4C8Q C;  3JCM X;  3O5Z A;  4M7A D;  4AT1 B;  4AMC A;  2PTK A;  1I1J A;  2LDM A;  2NUP A;  4KH1 B;  4HCC A;  4A54 A;  1KFZ A;  4J9D A;  1BU1 A;  3MP6 A;  1AD5 A;  1VQM A;  4A4F A;  1LNX A;  2IVW A;  1RLQ C;  2LT1 A;  2M16 A;  4LN2 A;  2OTL A;  1WJR A;  2LCL A;  2YLB A;  3VS1 A;  1TS9 A;  4KUL A;  4RTU A;  1WYX A;  3TCJ A;  4M77 G;  4C92 B;  2FRW A;  1K9M R;  2K5F A;  2Y4X A;  3MEV A;  3MEW A;  2JT4 A;  1QCN A;  5FU6 C;  5CAI A;  3SWN C;  1D3B B;  4KT0 E;  3OYM A;  2RJC A;  2QA4 Q;  4PLL A;  4C8Q F;  3VS7 A;  1YHQ A;  3CCL A;  3OYC A;  1GCP A;  1VYU A;  1G3S A;  4EMG A;  4X34 A;  2R57 A;  4BDY A;  4GLM A;  4F17 A;  2BUD A;  4IUP A;  4ESR A;  5CQX A;  2OTJ T;  1ARK A;  3FJ5 A;  2FPD A;  3H9N A;  4NS5 A;  2LCC A;  3M0R A;  2HBP A;  2YUP A;  1VQK A;  1LCK A;  3RKY A;  2AKK A;  1I81 A;  3G4S Q;  2P0P A;  4C0F A;  2J7I A;  2EYY A;  2XD0 A;  9ATC B;  4A63 B;  1KQS S;  1BI2 A;  1X6O A;  4F14 A;  1RI9 A;  2ZPG B;  2DET A;  2NUT B;  3H8Z A;  3T9N A;  4M75 G;  5GAN 4;  3UA6 A;  2L8D A;  2C0T A;  4MMK A;  3R6O A;  1AWJ A;  2NLU A;  2SEM A;  5KCH A;  3CC7 T;  2QEX T;  1PWT A;  1ZBX A;  2DM1 A;  5DLQ E;  3M0S A;  2O4X A;  1YIJ T;  1Y7X A;  4HCB A;  3PE0 A;  3CD6 Q;  2QDY B;  1SSH A;  4J9H A;  2M51 A;  3FRN A;  4QQG A;  2QYZ A;  1AVZ C;  3RBB B;  2LVM A;  2BIV A;  3RMS A;  2CP3 A;  3N5B B;  2JUF A;  4XQ3 A;  2F2V A;  2HEQ A;  3CCR Q;  1LJO A;  2WSF E;  1M3C A;  5HK0 A;  4IIO A;  3DLM A;  4JS4 A;  2K7A A;  4M7D A;  2JS0 A;  4E7H A;  3UA7 A;  1D1C A;  2CZ1 B;  4GBQ A;  3P8B B;  3M9Q A;  4JRP A;  3GNG A;  3OYN A;  3MEA A;  5A2Q E;  1TUC A;  1I4K 1;  2CT3 A;  4XK8 E;  2DXC A;  3JB9 I;  3JCM h;  2KE9 A;  1M1G A;  2ED0 A;  4F7U E;  1X6G A;  1KSW A;  2KQW A;  1RAI B;  1GRI A;  5LJ3 g;  1ZUK A;  1OYX A;  3G7Z A;  3JSC A;  1QLY A;  5GAN 2;  1WGS A;  4FYW B;  1U1T A;  4HT9 A;  3L2V A;  1OZ3 A;  2J6O A;  3OMG A;  2HMA A;  3CCS T;  2R5A A;  3M0T A;  4LDX A;  2J6K A;  5LJ5 g;  3CCJ T;  3NTK A;  4KUI A;  2HCK A;  4XAX B;  3I55 Q;  3CME Q;  3SEM A;  1ZUU A;  1Q86 C;  1W6X A;  2VVK A;  3CBO A;  3BDL A;  3LX7 A;  1OX8 A;  2VC8 A;  1H3H A;  3CXC P;  2EW3 A;  4L6V 5;  4F7U F;  1OQK A;  1JEG A;  3CC2 A;  4B9X A;  3HTR A;  3UT1 A;  3SWN A;  5I21 A;  2CSI A;  2CGH A;  5GMK l;  1MV0 B;  4DEY A;  3GIB A;  1IGQ A;  5GAO n;  2CS7 A;  3AHU A;  3L1A A;  2DPP B;  1M1K U;  5GAM f;  2YRD A;  2E4H A;  1IHW A;  5IH2 A;  4BI4 A;  1BI1 A;  3GNF B;  3VS4 A;  2JJ9 A;  1MND A;  1TUD A;  3V7R A;  2COZ A;  1RAE B;  2ENM A;  1ZSZ A;  2EYZ A;  3TSW A;  2Y4Y A;  3JCM V;  3M56 A;  1S72 A;  3OY9 A;  2RQR A;  1R0B G;  3MHX A;  2QAS A;  2A7Y A;  5GAO l;  5LJ3 j;  2LMJ A;  3QUI A;  2K5I A;  1YIT A;  2EPD A;  5GAN h;  3CCM Q;  2NYS A;  3QZ5 B;  1D0Y A;  1VQP Q;  3M58 A;  3E19 A;  4E7J A;  2K3X A;  1JJ2 P;  4AFZ C;  4QKU A;  1LVK A;  4M78 E;  2MOX A;  3MJX A;  4KRT A;  4BB7 A;  4FIB A;  1M90 U;  2AK5 A;  2CZ6 B;  1WHM A;  1JQQ A;  2OAU A;  4AFS C;  2QAZ A;  1XOV A;  4M78 C;  2QGG A;  3VYG A;  1WFW A;  3X25 B;  4BE0 A;  3PTA A;  4Z89 A;  3UPU A;  3EAE A;  4M7D G;  1QKX A;  2DRM A;  1BCM A;  3KFV A;  7AT1 B;  1N6A A;  2V26 A;  1Y71 A;  4M77 D;  1K73 U;  3QYG B;  1UGR B;  4JZ3 A;  1VQ6 T;  2M02 A;  3JCM e;  2JM9 A;  4P5N A;  3I56 T;  3V8K A;  1ZQ1 A;  5KYY A;  1NM7 A;  1W70 A;  3Q1J A;  3EFS A;  2HL3 A;  1K0S A;  4PJO E;  3FB9 A;  1C6V X;  1W4S A;  4PJO C;  2EQJ A;  2ED1 A;  3VS2 A;  2PVD B;  3GLX A;  1EFN A;  4M78 F;  3QDF A;  1CKA A;  3CC4 T;  1QWE A;  1NPR A;  3L2R A;  1VQM Q;  3PVQ A;  1AWW A;  3FEO A;  3FLG A;  2LQN A;  3U23 A;  2A28 A;  1QMC A;  1VQ5 T;  3JCM P;  5I2M A;  1KHC A;  4Z02 A;  3OYI A;  3G4S A;  5KYX B;  1VQO Q;  1PRM C;  1KK7 A;  1D3B A;  4M75 D;  4RCC A;  1VQL T;  4J7F A;  2DA9 A;  2K57 A;  5LL6 S;  1Q86 R;  2G3R A;  2I2L A;  1YJ9 A;  4QQD A;  3OYD A;  4LUD A;  1Q81 U;  4PJO F;  4XTW A;  2DXT A;  2CSQ A;  4PNO A;  2D9T A;  5C0M A;  3EG9 B;  2GQI A;  1VYT A;  3CC7 A;  2QEX A;  2RK2 A;  2YRV A;  1YIJ A;  1W2B P;  3EFO B;  1I07 A;  5HY6 A;  2KEA A;  2NUT A;  3JCM b;  3DKM A;  4EMK C;  2LTO A;  1BIA A;  4FT4 A;  3CCR A;  1QKW A;  1GXI E;  2RQT A;  2BZ8 A;  2EGC A;  3OW2 P;  2YLC A;  3REA B;  3MP1 A;  2O88 A;  1K4U S;  1YP5 A;  2H3J A;  1VQN A;  1IRE B;  2XKO C;  3S3M A;  1D0X A;  2KMT A;  2DBM A;  2ZGW A;  3HPW A;  3QJ6 A;  2KSS A;  3HSB A;  3H41 A;  2K5L A;  2LQ8 A;  1SEM A;  2EBP A;  3OBY A;  3M0Q A;  1H8K A;  4OF1 A;  3QSU A;  2IIM A;  5A0G A;  3DLL A;  4QVC A;  1VQ7 T;  1TU0 B;  2VV5 A;  2DTO A;  2ZPB B;  4L59 A;  2A08 A;  1UHF A;  1WXU A;  3EG3 A;  1YJW T;  3KBG A;  1IRX A;  1RAA B;  3EH2 A;  4O5V A;  4DEX A;  3H0F A;  1NPP A;  1UJY A;  1G8X A;  4JUV A;  4C8Q B;  2J05 A;  4ELY C;  1OU9 A;  4ZGD B;  2K9G A;  3EGD B;  2V8J A;  3OYY A;  2DYI A;  4FYX B;  2QGF B;  3NPF A;  3I55 A;  4Y91 A;  2L89 A;  3CCS A;  2BZY A;  3OYA A;  3CPW P;  1WQ7 A;  2KXD A;  2A36 A;  1X69 A;  2K79 A;  4BUG A;  4PJL A;  2E65 A;  1VIF A;  2DF6 A;  1V29 B;  1FYN A;  3C94 A;  3LH5 A;  3VRY A;  1O9S A;  2EKH A;  3EH1 A;  4RUG A;  5FU6 B;  4FYV B;  2BTT A;  3CPF A;  4ORZ A;  4C0G A;  2JS2 A;  1M1K C;  2DL4 A;  3QG1 A;  4OMF B;  4PFZ A;  4E7K A;  2LJ1 A;  4C5G A;  1IZ6 A;  1HXD A;  2RHZ A;  2VGN A;  3FJP A;  2JTF A;  4JJN K;  1Q86 U;  1K1Z A;  3ASK A;  5AT1 B;  2CUB A;  3EHR A;  1WHG A;  1Y96 B;  3L42 A;  2MCN A;  3CCU T;  3OW2 S;  4XU2 A;  1X6B A;  1ZLM A;  1KG1 A;  3CCM A;  2GTO A;  1VQP A;  5FLX E;  3EG2 A;  1M30 A;  4NL3 A;  1I8F A;  2XIC A;  2AZS A;  1BBZ A;  1WA7 A;  1GBQ A;  2K6D A;  4XU3 A;  3JCM g;  4KH0 B;  1EIF A;  2E3H A;  2EGE A;  3RES A;  2FEI A;  1ZBJ A;  5KE2 A;  1M90 C;  4M7D D;  4PJJ A;  3A1P A;  4FU6 A;  3EG0 A;  3HFO A;  3QZ9 B;  2L3R A;  1Q82 U;  4C5E A;  1BYM A;  2E64 A;  4MML A;  4MDX A;  3OQ5 A;  1PKT A;  4DA4 A;  5ECA A;  3NGP A;  1K73 C;  3CCE T;  4C5H A;  5GAN 7;  1S72 Q; 
#chains in the Genus database with same CATH homology
 1TSF A;  2ZAE A;  1PC0 A;  1TS9 A;  1V76 A;  2KI7 A;  1OQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...