1TS9A

Crystal structure of the archaeal homolog of human rnase p protein rpp29 from archaeoglobus fulgidus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
LQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGDLINFRPEDRIKRGLMMLKRAKGVWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal ribonuclease P protein aRpp29 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1ts9A00
2KI7A 2ZAEA 1OQKA 1V76A 1PC0A 1TS9A 1TSFA
chains in the Genus database with same CATH superfamily
3QYHB 4C5IA 2AT1B 1JEGA 2O31A 1KD1R 3JB9I 4JUVA 4C92C 4PJNA 3NTKA 3I55T 4FT2A 2OAUA 3EFOB 4BI8B 2EJGA 1VQ6T 1I07A 2LRQA 2RI2A 1RLQC 2EGEA 3M4GA 3LLRA 3PVQA 1G3WA 2KYBA 2L89A 5KYWA 3M0RA 2HBWA 1ABQA 2EFIA 1W4SA 1BIAA 2E6ZA 2KK4A 1O75A 2RK1A 3EHQA 1D3BA 1K9MR 1G2BA 2OJ2A 1T3SA 3OYDA 4PJLA 4A4HA 2D0QB 4IUQA 4OMNA 3VRYA 3VS2A 3CCJA 2YXYA 3UDCA 2IG0A 2GTJA 5CIUA 1BIBA 2LDMA 3CPWP 3FB9A 1YIJQ 3OYKA 4J9GA 2FL7A 3PIPA 1WLPB 3S3OA 3TEEA 1CSKA 2DPPB 1WJSA 1M8VA 2EQMA 1OZ2A 4XTUA 4C8QE 5CK9A 4RTXA 3M59A 3NPFA 4KGZB 4M75C 3OA6A 1ZX6A 3CD6T 2D8HA 1YN8A 1PD1A 4DEYA 3I56A 2A0FB 1T3LA 1Y07A 2DE0X 4LE9A 1I8FA 2DILA 4KGVB 4OB0B 3LGLA 1F1BB 2QA4Q 1RABB 2F2VA 3JCMh 1AWJA 2RF0A 4E7ZA 4JJDA 3GLXA 1B7TA 3OYLA 4ELZC 1WHMA 4JRPA 2OTJA 1FXXA 1NYGA 1IXDA 1GXIE 2K4YA 5KYWB 3BDUA 3EFSA 2A08A 2P4TA 5GANd 1QVFP 4M4ZA 1PSFA 1WHKA 3LGFA 1D0YA 2EJFA 2OTLQ 2L3PA 3EGXB 2COWA 3JRZA 2RQVA 1D09B 2QGGA 4RTTA 1HSQA 1LVKA 1S1NA 4FIBA 2MAMA 3TREA 1KC8R 2L3QA 2F2XA 4JJNK 5LJ5h 3CCRQ 3EFRA 2BE9B 4OB2B 2CT4A 4PJOB 2KBTA 4II1A 1KIKA 5D6YA 5GAMg 3GIBA 5AYFA 5GAOl 2X4JA 2LQ8A 1M1GA 3E9FA 4F17A 2CZ1B 1Y57A 2LCSA 1VUBA 4F16A 1G8XA 5CKBA 1SG5A 1NBEB 1TTHB 2KRSA 5IHKA 4XU2A 4M78B 2DKGA 2DEUA 1Y7XA 3NGPA 2ZPGB 3PVLA 1YWOA 2RPNA 1Y0MA 4FYWB 1M2VB 1SRLA 1KJWA 1QCFA 1QP3A 5HK3A 4J9BA 2QI2A 2Y4YA 2L0AA 1KD1C 2L3RA 3EFOA 1B34A 1UDLA 4HVWA 3V8KA 1VQ8T 1K4US 2YDLA 3THKA 5LJ3d 3JSCA 9ATCB 3QJ6A 2DJZA 4RKUE 3VKIA 1VQ5Q 3VU3C 2DTOA 2X51A 4ZTJA 2V8JA 1IO6A 3H0HA 2FZKB 4LUDA 2LT1A 2V1QA 2XI9A 3LH5A 3R6OA 1TSFA 2ZPFB 2K3BA 1WX6A 4A54A 3CCJQ 1AZEA 2L2PA 3OBYA 2E1HA 3PE0A 2QEXT 1HXDA 3CC4T 5DLQE 3CCLA 3FC3A 4HT9A 2X4WA 1I5OB 2P0PA 2DTHA 2DXBA 3HTRA 1VQ6Q 4DBQA 4E6RA 1PWTA 2K2MA 3WVEB 1M27C 4QVZA 2EGCA 4QW2A 4M78G 4EMHA 1SHGA 3RERA 2E12A 1OULA 4RMOA 1PRMC 1ZLMA 2AHJB 2GBQA 2RHUA 4C0GA 1KHCA 1YJWA 5I22A 2VB6A 2KVQG 4XAXB 3M57A 4C92E 2V8KA 2E3HA 3S3MA 2WACA 4IURA 2J06A 2V26A 1AEYA 4EPCA 2DXUA 4JZ3A 4FSSA 2FG0A 2RB6A 1EX4A 1JO8A 2RHZA 1FWZA 2QQSA 3MKDA 1FX7A 2X3WD 4C5HA 4M77G 3GP8A 3OYAA 4HCBA 1K76A 4PL6A 3FLGA 1VQ5A 2DBKA 1VQOA 2AKKA 2CZ7B 4UC4A 2JOYA 1S72A 4HCCA 1PCXA 3C95A 3OB9A 1SHFA 2XDBA 3ZL7C 2BE7D 3J80E 2OTLT 1PM3A 1BU1A 1GCPA 3L42A 2V1RA 1NLPC 3UATA 3JCMg 4KUIA 2LZ6B 1VQMQ 3CPWA 1QMCA 2CT3A 1YCSB 3C4SA 2X4YA 4J6YA 2EQKA 4O5VA 3ER0A 2BZXA 2COYA 3EG9B 4XTVA 4ZNXA 3QDRB 3GNGA 2DAQA 2LQKA 2PUOB 3SWNB 1IGQA 4DOWA 1N8RC 4DBFA 3OYIA 4EMGA 2YT6A 1KQSA 3PIOA 3A5ZB 1UEBA 2FHDA 3BY7A 2HL5C 1H641 1FMKA 2P0QA 2QTVA 2RA2A 2R57A 3QKJA 4DQ2A 2K2VA 1VQ4Q 4M7AB 2RN8A 2RM4A 1RAFB 1ZSZA 1GFDA 5IHIA 5L8RE 1YIJT 3CMAQ 3OS0A 2XK0A 1AVZC 2DL4A 3OBWA 4D8DA 1ARKA 3UA7A 4OP0A 3LWHA 5GAN5 4QQ6A 2NUPA 4RTVA 2H8HA 4OMFB 4Z8AA 5KYYB 2K79A 4C0FA 3FJ5A 2GCXA 4B6MA 1Z9QA 2EQJA 2NUTB 2E3IA 2QQRA 3M56A 1ZHIA 1E6GA 1HK9A 2NWMA 1OX8A 1NJIU 1KG1A 4M7DD 4L59A 1WXBA 2KY9A 1JJ2P 2W0ZA 1Y96B 1U06A 4A53A 2NUTA 3E19A 1D0ZA 1QW1A 4DBRA 3KFVA 3CBMA 1Q86R 1A0NB 1NG2A 2CKKA 2PUKB 3JCMb 2KI7A 3BFMA 5LJ3g 5IXBA 1MV3A 2WSFE 3CCSQ 3A8HB 2MI6A 1TG0A 1J3TA 2CP7A 1VQKT 2QEXA 1M1KU 1Q95G 2K3XA 4JZ4A 1NPRA 2LP5A 1QKXA 3UF4A 7AT1B 3NFCA 4J8OA 2EPDA 3SFMA 1N9RA 4IUUA 2LJ0A 1E7OA 3HL8A 3G6EA 3KUFA 4WF2A 2J7IA 1Q82R 2K5IA 1PD0A 5C0MA 3DLLA 1ZUUA 4IUVA 1X27A 3VRZA 1RAGB 1M4ZA 3JB9H 3EGDB 3GOXA 3RDVA 3JCMP 1QQJA 3CC2T 5CKFA 2C0TA 5HKCA 3VUBA 2CH4A 1VQ7Q 1M3AA 2PTKA 3FIFA 4ME7A 3EGUA 1M3CA 4MZMA 3SD4A 4AFZC 3M4YA 4GY5A 2R58A 1XTDA 5D6XA 1U1SA 4M7DC 4J83A 1TH7A 2CP0A 2XKOC 2Z0WA 1TWBA 1ACMB 1KQ1A 2MYSA 1JXOA 3OYEA 1V76A 2RHYA 4E7JA 4EMKC 3CMEQ 1MUZA 3CCRT 3QG1A 1WFWA 2P4RA 3I9QA 3RMQA 1YHQA 2Y4XA 2J6FA 2LMJA 2PZ1A 3I5SA 4M77A 2OTLA 2RMOA 4OMQA 3HSBA 5CR2A 1SF9A 5J3BA 5M9OA 2DO3A 4A4EA 1OZ3A 1VIFA 3OMCA 2JM8A 1LPLA 4KBMB 2F1LA 1VQ4A 4BUGA 1MNDA 2BZYA 5CVIA 2WSCE 2PVOB 2KXDA 2GF7A 3EGXA 2RJDA 4QVCA 3QZ5B 2HQEA 4J9DA 5GMKi 1RLPC 3MHXA 4RTYA 1VIEA 2BTTA 2DIQA 4OB1B 2QYZA 1WJQA 3CMET 3RKWA 1K1ZA 1HYOA 1YJ9T 3AHUA 4OGCA 1YJWT 2MIOA 2DZ9A 3M0QA 4AMCA 2LNHB 5DM7R 5GANh 3X20B 3CCJT 2DK3A 5KYNA 3VS0A 3OS5A 2KDSA 5A2QE 3VYGA 3G4ST 4BY6B 2HKNA 1VQNA 3OYBA 2YLBA 1JRIA 1P92A 4JRKA 2A3LA 2PNIA 2EYZA 2F5TX 2DF6A 4K11A 1UUEA 3QYGB 2DM1A 1BCOA 2MPXC 2FRYA 4QVDA 2GQVA 2C0OA 4M7AC 1G3YA 2RJEA 1M90C 4D6WA 4PJJA 2LX7A 1UG1A 4GLKA 4M75F 3RBBB 1VQLA 3HKSA 5GMKe 3DB4A 1O9SA 1K0SA 3G71A 3CPWS 3C12A 2YUQA 4N4GA 3OW2A 4BY6C 4LUEA 2M16A 5IT9E 4A4FA 1RI0A 2RI5A 2DD4A 4JDSA 4C92A 1ZBXA 2KYMA 1UE9A 3L1AA 4BB7A 2L3SA 2CDTA 2FPFA 1YIJA 4XU0A 2XICA 4M78A 2QG9B 2M9UA 1K73U 4CC7A 2A7YA 3M58A 1W2BA 1WHLA 4FSXA 2JUFA 1PKSA 1X2KA 2HKQB 1YITA 4XQ3A 4LD6A 1WGSA 3CCQT 3M0TA 1OPLA 3EGDA 1VQ7T 4FM4B 1RAIB 1Q81R 3CCVA 5KCHA 4PJOA 1NEGA 1PG5B 2HD0A 3MP1A 5GAMf 5LJ3j 4M75B 4HVVA 1JQQA 2DETA 2DBMA 4IUTA 4X34A 2DRMA 2C0IA 2ABLA 4PLIA 4LN2A 3I56Q 3MEVA 1AT1B 1ZBJA 8ATCB 1EFNA 2ZGWA 2DA9A 3CC7T 3L2UA 2HSEB 2HQHA 1YITT 3CCMA 1BI0A 1LCKA 1QKWA 4Y28E 1WZOA 1M1KC 5FLXE 2FZGB 4XTWA 1FMWA 5IHNA 2AKLA 5A0DA 1I5LA 4C92G 1OPKA 5LJ5g 4M7AA 2WSEE 1YI2Q 3JB9D 3FRNA 2VVKA 3CC2Q 1KK7A 2QK0A 1BBZA 1TS9A 2DL7A 3JB9J 2FPEA 2E5KA 5KH6A 3P8BB 4MDXA 2F69A 1YP5A 4M75A 1SPKA 4ZGDB 3QHSA 3URGA 3SEMA 4D8KA 3OS1A 1VQKA 4AFQC 1M90U 4QT7A 3QXEB 4C8QF 2ROTA 2PQWA 1RAEB 1WHJA 3V7CA 1WIEA 4KT0E 3DLMA 4M77D 3G7ZA 3CBOA 2DVJA 4HXJA 1VQ9Q 4Z89A 2CP6A 3A1PA 4AG2C 1RADB 4C8QG 1QCOA 1XOVA 4O6JA 2CSIA 4RTZA 2QA4A 2J05A 4IUPA 1YI2T 4PJOE 1YJ9Q 4DOVA 2KMTA 1PC0A 1PRLC 2AZVA 1VQNT 5CKHA 2NLUA 4MDWA 3V7SA 5CKEA 3EG1A 5ECAA 1HJDA 1NJIR 3L2QA 1M90R 3A8OB 5I2MA 1I0CA 4M78E 2CUBA 2LCLA 3QUIA 4Z88A 2RI3A 2X35A 2R5AA 3D7SB 2XMFA 3SHWA 4C0ZA 1C1AA 2ZCFB 4KH1B 4J9HA 3EH1A 1VQLQ 3CCEA 5FROA 2XDDA 3QDFA 1MMAA 2MWPA 5IXFA 1G83A 4L6V5 1N27A 1K8AR 2HQXA 2EYXA 1VQMA 3ZFJA 1PSEA 5AT1B 5DY9A 3L2WA 3CCLT 4EIKA 3C0CA 1RACB 4KGXB 1N8RR 4M75E 3H6ZA 5J26A 3X26B 5CKDA 2YRCA 1S72Q 2O9VA 1VQNQ 1RL2A 1BYMA 1D3BB 3GBQA 4F7UA 1C0MA 3CD6A 1YWPA 1D1BA 3E9GA 1Q82U 1JBMA 2F5KA 4KRTA 1WA7A 1QVFA 4M77C 4X1VA 2LQWA 3X28B 3M9QA 3M0SA 4M7DG 3JV3A 2KEAA 4FYVB 2OX7A 2DNUA 3MPUB 5CAIA 4E7HA 1YBYA 1VYTA 1BKBA 1MHNA 3M5AA 1ZSZC 4J7IA 1VQKQ 3HRUA 5FU6B 2RHIA 1TUCA 1VOMA 2EYYA 3OSSC 1K9AA 4J9IA 2X4XA 2RQTA 1K0XA 4MMLA 3VS4A 1UFFA 3CXCS 1XJWB 1GL5A 3DKMA 3AT1B 4M78C 1WQ7A 4LDWA 4ZGJB 1YI2A 4JLIA 4M75G 2AZSA 2G3RA 2NYSA 2EYWA 2A36A 1KQSS 3A8GB 3F70A 4LDXA 5EC7A 2DJQA 4JJBA 1IB8A 2KROA 2DLPA 1JU5C 2O2OA 4HCZA 5GAMe 1BI1A 1R0CB 4FW1A 1FYNA 4PJOG 3LH0A 2MMPA 2DMOA 2HL3A 4C92F 2CH4W 2QEXQ 4GBQA 2COZA 2KE9A 1UTIA 4J9EA 2SRCA 3G6ET 1UECA 2DD5A 4N0AA 3X24B 3CMAA 4L5GA 2KR3A 1G3TA 3V8LA 1B34B 1MNEA 2HMAA 2SEMA 1OOTA 5LJ5d 1D1AA 4ANJA 2RQWA 3RKXA 3NTHA 3OW2P 1G5VA 2GTOA 1QVPA 4ELYC 5GMKh 2HDAA 2EQIA 1AWWA 1WYXA 3VJPA 2DYBA 2E41A 1Y71A 4J6WA 2EYQA 4E7IA 1B07A 4C92D 3IQLA 2KNBB 4C5EA 4QKUA 2DL8A 2YSQA 5CQYA 4TVRA 2JS2A 2LCCA 4JLGA 3CC4Q 4M7AF 3H0IA 1Q7YR 4VUBA 4F7UB 1OX9A 4F7UF 4C8QB 2KXCA 2L5QA 2CUDA 4B9WA 4PKCC 1XNIA 2CZ6B 2EAYA 1NZ9A 4WCIA 2X3XD 2FEIA 5LJ5j 1KQSP 2RJCA 1FMVA 4M78D 3X25B 3ZEHA 2FZCB 3CCMT 2HCKA 2X9HA 2K6DA 3JB9G 1X75C 2DIGA 3OW2S 1RUWA 4PNOA 3SB2A 3CC2A 1PHTA 3JCMe 1H8KA 3BW1A 2M51A 4PLLA 2EJ9A 4BI4A 3VV0A 5A0GA 2NUZA 3I56T 5KYXA 1K73C 3T9NA 2CZ0B 3H8ZA 3RESA 1AZGB 2A28A 2YLCA 4N4IA 1NEBA 3A98A 1X69A 1QP2A 2QGFB 2VWFA 1X01A 3NHNA 1G3SA 1YJNQ 5GANf 4QQDA 4PJOC 3TU4K 1SKUB 1ABOA 4N0AC 1VQLT 2AK5A 2O88A 5I2SA 2XHCA 1VQPQ 2DFUA 4HKEA 2RQUA 3CCST 1RAHB 3G71T 3PTAA 1YJWQ 1VQ9T 1N8RU 1AWOA 5GAOn 3ME9A 2IPOB 1OU8A 2J6KA 2FVUA 4DA4A 1X43A 3R6NA 3GF5A 3JCMQ 1MGQA 4P5NA 1MMNA 3SWNC 3VS7A 4AT1B 3CCSA 1NM7A 2VGMA 2JJ9A 1HD3A 2OI3A 4R56A 3JCMc 2KQWA 4M77B 2JMCA 1PNJA 1R8OB 2M0OA 2LX9A 1LJOA 1B3QA 2GGRA 1ZSZB 3RUXA 3PT9A 1VQ5T 1N9SA 2CP2A 1DJ7B 4C8QD 1OV3A 2YWWA 2IVWA 3VYHB 3P8DA 2YUNA 2CREA 1KHIA 4JRQA 4B9XA 2D6FA 2DRKA 1IHVA 1V1CA 1QLYA 1BCMA 2FPDA 1TXQA 4JJCA 2M1HA 3LW5E 4C0DB 1T0JA 1ZQ1A 5L23A 5FRNA 3NMZC 4M77E 5I11A 5HY6A 1M30A 1W70A 1V29B 3H41A 5KYXB 4NOYA 2VXEA 2OAWA 1PKTA 4RCCA 3ASKA 3PFSA 4EMKB 2E6NA 3EG0A 1Q81C 4V2SA 3TSZA 3RKYA 2YRVA 3BE3A 1BI3A 4MZTA 5GAMh 4PJOD 1WDXA 4WTOB 4MZPA 3OYHA 4OMPA 4XU3A 1JJ2S 4CC4B 2QDLA 4A4GA 3QZ9B 4Y91A 2YHTA 2QQBA 3CBPA 3UWNA 4BE2A 1VQPT 3HFOA 1IGUA 1W2BP 4ZN1A 2ROLA 2B8AA 1UGRB 2KGTA 3QO3A 3PNWC 1Z9ZA 4C8QA 1N5ZA 2KSSA 3MO8A 3H9NA 4Y92A 3UA6A 5EG2A 4J6XA 2ATCB 3TVTA 8AT1B 1M5Q1 2DXCA 3MEUA 4Q5WA 5KYUB 4CC2A 3I5RA 3OQ5A 2JM9A 2EKHA 2EIFA 3OYCA 1VQPA 2EVRA 6AT1B 4R55A 2KRNA 3M0UA 2JTEA 3ULRB 3OYMA 3C94A 1LNXA 4C8QC 2MOXA 1MMGA 3VS3A 1MMDA 1YJNA 4M7AE 1C6VX 1LOJA 1IREB 2EW3A 4F7UE 3CCEQ 4J9FA 1ZUYA 3RIRA 3G4SA 3OYYA 2G6FX 5GAMj 2VXFA 2QXFA 2KRMA 2NUPB 3CEYA 2MF2A 4ORZA 1D1CA 1KD1U 4RG2A 3HFNA 4DBHA 2RH2A 4OMOA 2HBPA 1QVGA 2ZPBB 3KBGA 4FYYB 2QAZA 4M7DB 3OYGA 1T0HA 4BDZA 3WXMB 2P0KA 3H0FA 2QA4T 4E7SA 3JCMV 1W2BS 2BIVA 3LX7A 1R77A 2EGAA 4LNPA 3CMAT 1UHCA 2E4HA 2E70A 1Q7YC 2C06A 5GAOm 2CGHA 3V7RA 1RI9A 1VQ4T 1K9MU 2VC8A 2FYKA 3JCMW 1VYVA 2JNGA 3A8MB 3MEAA 1GRIA 4IIMA 2GFAA 3CPFA 1NYFA 2JMAA 1H3ZA 1UJYA 5IAYA 3CC4A 1AD5A 2DZCA 3U23A 2ZPEB 3G6EQ 1VQ6A 3EG9A 1AWXA 1X6BA 5IN1A 5DLOA 4M7DE 5GAN6 2YRDA 3CCET 2I2LA 4MMKA 4EMKA 1WXTA 2DL3A 2JW4A 1AOJA 3MP6A 4OB3B 2K7AA 2J6OA 4ESRA 5GANg 3PMTA 1QWEA 2YUOA 4C0DC 4XU1A 4NL2A 5A0LA 4C92B 2YUPA 2EQUA 3G1JA 4BACA 1IHWA 1VQ7A 1WQWA 3GNFB 4LDYA 2CSQA 4ZN3A 4JS5A 2VYTA 2OTJQ 2M0YA 1OEBA 1Q86U 1YHQQ 2R5MA 2VASA 2I0NA 1QVGP 2O4XB 2D1XA 1TUGB 3E2UA 4OVAA 3O5ZA 2FB7A 3A8LB 1SSHA 3M55A 4ZGEB 4QQGA 4AFUC 1ZUKA 5CCAA 3EG3A 5GAN7 2GNCA 2D9TA 5GAMd 5GAN3 2LNVA 4FL6A 4JS4A 1VQOQ 4KH0B 2DEQA 3EH2A 5GAOp 2DVEA 5FWBA 1YITQ 1K8AC 3L2VA 1CKAA 1EZZB 1I1JA 1S72T 3TCJA 2DL5A 1M2OA 4CI0C 2DTIA 4JRIA 4M77F 1QCNA 3L2ZA 1KFZA 4E47A 2L8DA 4CRIA 3P8HA 3CCVQ 3GPLA 2HSPA 2ENMA 2XDPA 2PU9B 2ZPHB 1Q7YU 5GANj 4ATOA 2ESWA 3BDLA 1ZSGA 1OYXA 3JCMf 1UB4A 4LDUA 3V8JA 5I21A 1H92A 2VUBA 3PGGA 3OYJA 2B86A 5IH2A 2PVDB 4FW2A 3EAEA 1W1FA 3QIIA 3ZBDA 5KE2A 1IRXA 2XD0A 4IKFA 5GJVB 3OS2A 3REBB 5KE3A 2H3JA 4XTZA 5GANe 1YCYA 1YHQT 4E2FB 2MWOA 1WJRA 3CCUQ 4JPBW 4F7UG 3JCMX 1H3HA 2MCNA 4KULA 1Y96A 2LVMA 1X2QA 4FCYA 3CCQQ 3JCMJ 3VUZA 2RJFA 2RNAA 1UGSB 1UGVA 4HA8A 5LJ5f 1SEMA 2FO0A 2K3YA 1WHGA 2LT4A 1X6OA 1M1FA 3J7AF 4GLMA 2H3EB 1VQ9A 1VQ8Q 3I35A 1TOVA 3MJXA 4OMLA 5HCKA 2QDYB 2XU8A 2GFUA 4F14A 4M7DF 5GAN2 4BE1A 1SSFA 2EWNA 1GBQA 5GJWB 3I55Q 4J9CA 5LL6S 1QWFA 5CQXA 2DYIA 3KXTA 1U3OA 4RTWA 3CXCA 1UJ0A 2BUDA 4BE0A 1BI2A 4PJOF 2HNIA 2PVGB 3G4SQ 2V8IA 3M54A 3HPWA 5GAOq 4AG1C 5LJ3f 4PFZA 4R0KA 3UT1A 3FJPA 4LD9K 3CCVT 3REAB 2VV5A 1VQ8A 4J5YA 2ED1A 4F04B 4OF1A 2CP3A 3M0PA 4CC3A 4EDUA 1MV0B 1SRMA 4FT4A 2BKDN 3HRTA 1KQ2A 2XG8D 1RAAB 2LJ1A 4FYXB 3SWNA 3OSVA 4M78F 3O8VA 3J81E 2O9SA 1QVGS 2K9GA 5HK0A 1M3BA 1NLOC 3META 3DB3A 4HCKA 3CCMQ 3OY9A 3MEWA 2ZPIB 4XTXA 5FU6C 2DX1A 3CCRA 3HHTB 4OMMA 3CC7A 1YJNT 3EG2A 4A4KA 2RQRA 3RNJA 5KCOA 3JCMd 5GAOr 2HAXA 4E7LA 5D6WA 3CCUT 3QSUA 3M53A 3OYNA 1OQKA 3Q1JA 4PFPA 3RR6A 3LYIA 2AIRB 2K5LA 2O01E 2EBPA 2JTMA 3OMGA 1GCQC 2KT8A 4BI3A 2CYZB 5LJ3h 4OGEA 4XK8E 1JJ2A 2MK5A 2LQNA 4FU6A 4KUDK 2LC4A 1XQHA 3S3NA 1K73R 3TSWA 2E5QA 3QBYA 1E6HA 4RCBA 5KYYA 2Y90A 2HZYA 1I4K1 1K8AU 2OTJT 3L2RA 4IIOA 2K5FA 2EKOA 5GMKl 3QPHA 2D0NA 1OI1A 2ECZA 4Z02A 3PMIA 2VKNA 1EIFA 5FW9A 2O4XA 5CO7A 1WHHA 1TU0B 5LJ5e 1VYUA 4DEXA 2RO0A 2CS7A 2DXTA 3WVDB 2K57A 3TQ7P 5D7UA 3QWXX 2ZAEA 1ZA1B 1WPYA 1VQOT 1Q86C 4M7AD 1I81A 3CCLQ 2JN0A 4LXCA 2P84A 4RUGA 5J39A 4AFSC 1JXMA 4LDVA 3LWIA 4ZTFA 5LJ3e 3HRSA 1U1TA 1W6XA 1UHFA 2BZ8A 3CQTA 1KSWA 3QJYA 1AHJB 2CP5A 1M9SA 1TUDA 3CD6Q 4HT8A 3JB9F 3JAME 1NE8A 5GAN8 2FRWA 5GMKm 5GAN4 3CXCP 1BB9A 1NPPA 2HEQA 2JTFA 2D8JA 3S6WA 5FU7C 4BD3A 1NJIC 1QVFS 2E10A 4X9DA 1M8MA 4C5GA 4HVUA 4RG8A 3I55A 1GBRA 4A63B 1VA7A 1Q81U 1D0XA 1VQMT 4M7AG 1GCQA 4E7KA 1YFNA 1ZA2B 2KT1A 4PK4A 1M1KR 4NL3A 2JVVA 1K9MC 2QTXA 3EHRA 3VS5A 1N6AA 4PFOA 2W10A 5KYUA 2IIMA 3UPUA 5FRMA 2ZZDA 2RK2A 4XTYA 2DERA 1U8RA 2QQ9A 4YTLA 2ED0A 3INZA 4BDYA 1CKBA 3SDZA 2JS0A 1YJ9A 5FU7B 1KC8U 3CC7Q 1WI7A 4NS5A 2JXBA 3CMEA 2F2WA 3N5BB 3G71Q 1IZ6A 3VS6A 3MP8A 1OU9A 3FDRA 3VS1A 3E1SA 1YNZA 1KC8C 1Q82C 4N4HA 1M2VA 2JT4A 2QQAA 1WNLA 3RMSA 3NTIA 2GQIA 4X9CA 2VGNA 4M7DA 2E65A 2JZ2A 1JB0E 2KAFA 3CCQA 3MCAB 3FEOA 1BK2A 5FWCA 1WXUA 2LTOA 4RTUA 1R0BG 2A37A 4M75D 3OYFA 2M02A 4PJMA 2XIDA 2RD1A 3CCUA 1UGQB 1U5SA 1X6GA 4J7FA 1UGPB 2E64A 5C6SA 3HP9A 2RHXA 3QWYA 2QASA 5GMKj 2LJ3A 1GFCA
chains in the Genus database with same CATH topology
2KI7A 2ZAEA 1OQKA 1V76A 1PC0A 1TS9A 1TSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 A;  2ZAE A;  1OQK A;  1V76 A;  1PC0 A;  1TS9 A;  1TSF A; 
#chains in the Genus database with same CATH topology
 3QYH B;  4C5I A;  2AT1 B;  1JEG A;  2O31 A;  1KD1 R;  3JB9 I;  4JUV A;  4C92 C;  4PJN A;  3NTK A;  3I55 T;  4FT2 A;  2OAU A;  3EFO B;  4BI8 B;  2EJG A;  1VQ6 T;  1I07 A;  2LRQ A;  2RI2 A;  1RLQ C;  2EGE A;  3M4G A;  3LLR A;  3PVQ A;  1G3W A;  2KYB A;  2L89 A;  5KYW A;  3M0R A;  2HBW A;  1ABQ A;  2EFI A;  1W4S A;  1BIA A;  2E6Z A;  2KK4 A;  1O75 A;  2RK1 A;  3EHQ A;  1D3B A;  1K9M R;  1G2B A;  2OJ2 A;  1T3S A;  3OYD A;  4PJL A;  4A4H A;  2D0Q B;  4IUQ A;  4OMN A;  3VRY A;  3VS2 A;  3CCJ A;  2YXY A;  3UDC A;  2IG0 A;  2GTJ A;  5CIU A;  1BIB A;  2LDM A;  3CPW P;  3FB9 A;  1YIJ Q;  3OYK A;  4J9G A;  2FL7 A;  3PIP A;  1WLP B;  3S3O A;  3TEE A;  1CSK A;  2DPP B;  1WJS A;  1M8V A;  2EQM A;  1OZ2 A;  4XTU A;  4C8Q E;  5CK9 A;  4RTX A;  3M59 A;  3NPF A;  4KGZ B;  4M75 C;  3OA6 A;  1ZX6 A;  3CD6 T;  2D8H A;  1YN8 A;  1PD1 A;  4DEY A;  3I56 A;  2A0F B;  1T3L A;  1Y07 A;  2DE0 X;  4LE9 A;  1I8F A;  2DIL A;  4KGV B;  4OB0 B;  3LGL A;  1F1B B;  2QA4 Q;  1RAB B;  2F2V A;  3JCM h;  1AWJ A;  2RF0 A;  4E7Z A;  4JJD A;  3GLX A;  1B7T A;  3OYL A;  4ELZ C;  1WHM A;  4JRP A;  2OTJ A;  1FXX A;  1NYG A;  1IXD A;  1GXI E;  2K4Y A;  5KYW B;  3BDU A;  3EFS A;  2A08 A;  2P4T A;  5GAN d;  1QVF P;  4M4Z A;  1PSF A;  1WHK A;  3LGF A;  1D0Y A;  2EJF A;  2OTL Q;  2L3P A;  3EGX B;  2COW A;  3JRZ A;  2RQV A;  1D09 B;  2QGG A;  4RTT A;  1HSQ A;  1LVK A;  1S1N A;  4FIB A;  2MAM A;  3TRE A;  1KC8 R;  2L3Q A;  2F2X A;  4JJN K;  5LJ5 h;  3CCR Q;  3EFR A;  2BE9 B;  4OB2 B;  2CT4 A;  4PJO B;  2KBT A;  4II1 A;  1KIK A;  5D6Y A;  5GAM g;  3GIB A;  5AYF A;  5GAO l;  2X4J A;  2LQ8 A;  1M1G A;  3E9F A;  4F17 A;  2CZ1 B;  1Y57 A;  2LCS A;  1VUB A;  4F16 A;  1G8X A;  5CKB A;  1SG5 A;  1NBE B;  1TTH B;  2KRS A;  5IHK A;  4XU2 A;  4M78 B;  2DKG A;  2DEU A;  1Y7X A;  3NGP A;  2ZPG B;  3PVL A;  1YWO A;  2RPN A;  1Y0M A;  4FYW B;  1M2V B;  1SRL A;  1KJW A;  1QCF A;  1QP3 A;  5HK3 A;  4J9B A;  2QI2 A;  2Y4Y A;  2L0A A;  1KD1 C;  2L3R A;  3EFO A;  1B34 A;  1UDL A;  4HVW A;  3V8K A;  1VQ8 T;  1K4U S;  2YDL A;  3THK A;  5LJ3 d;  3JSC A;  9ATC B;  3QJ6 A;  2DJZ A;  4RKU E;  3VKI A;  1VQ5 Q;  3VU3 C;  2DTO A;  2X51 A;  4ZTJ A;  2V8J A;  1IO6 A;  3H0H A;  2FZK B;  4LUD A;  2LT1 A;  2V1Q A;  2XI9 A;  3LH5 A;  3R6O A;  1TSF A;  2ZPF B;  2K3B A;  1WX6 A;  4A54 A;  3CCJ Q;  1AZE A;  2L2P A;  3OBY A;  2E1H A;  3PE0 A;  2QEX T;  1HXD A;  3CC4 T;  5DLQ E;  3CCL A;  3FC3 A;  4HT9 A;  2X4W A;  1I5O B;  2P0P A;  2DTH A;  2DXB A;  3HTR A;  1VQ6 Q;  4DBQ A;  4E6R A;  1PWT A;  2K2M A;  3WVE B;  1M27 C;  4QVZ A;  2EGC A;  4QW2 A;  4M78 G;  4EMH A;  1SHG A;  3RER A;  2E12 A;  1OUL A;  4RMO A;  1PRM C;  1ZLM A;  2AHJ B;  2GBQ A;  2RHU A;  4C0G A;  1KHC A;  1YJW A;  5I22 A;  2VB6 A;  2KVQ G;  4XAX B;  3M57 A;  4C92 E;  2V8K A;  2E3H A;  3S3M A;  2WAC A;  4IUR A;  2J06 A;  2V26 A;  1AEY A;  4EPC A;  2DXU A;  4JZ3 A;  4FSS A;  2FG0 A;  2RB6 A;  1EX4 A;  1JO8 A;  2RHZ A;  1FWZ A;  2QQS A;  3MKD A;  1FX7 A;  2X3W D;  4C5H A;  4M77 G;  3GP8 A;  3OYA A;  4HCB A;  1K76 A;  4PL6 A;  3FLG A;  1VQ5 A;  2DBK A;  1VQO A;  2AKK A;  2CZ7 B;  4UC4 A;  2JOY A;  1S72 A;  4HCC A;  1PCX A;  3C95 A;  3OB9 A;  1SHF A;  2XDB A;  3ZL7 C;  2BE7 D;  3J80 E;  2OTL T;  1PM3 A;  1BU1 A;  1GCP A;  3L42 A;  2V1R A;  1NLP C;  3UAT A;  3JCM g;  4KUI A;  2LZ6 B;  1VQM Q;  3CPW A;  1QMC A;  2CT3 A;  1YCS B;  3C4S A;  2X4Y A;  4J6Y A;  2EQK A;  4O5V A;  3ER0 A;  2BZX A;  2COY A;  3EG9 B;  4XTV A;  4ZNX A;  3QDR B;  3GNG A;  2DAQ A;  2LQK A;  2PUO B;  3SWN B;  1IGQ A;  4DOW A;  1N8R C;  4DBF A;  3OYI A;  4EMG A;  2YT6 A;  1KQS A;  3PIO A;  3A5Z B;  1UEB A;  2FHD A;  3BY7 A;  2HL5 C;  1H64 1;  1FMK A;  2P0Q A;  2QTV A;  2RA2 A;  2R57 A;  3QKJ A;  4DQ2 A;  2K2V A;  1VQ4 Q;  4M7A B;  2RN8 A;  2RM4 A;  1RAF B;  1ZSZ A;  1GFD A;  5IHI A;  5L8R E;  1YIJ T;  3CMA Q;  3OS0 A;  2XK0 A;  1AVZ C;  2DL4 A;  3OBW A;  4D8D A;  1ARK A;  3UA7 A;  4OP0 A;  3LWH A;  5GAN 5;  4QQ6 A;  2NUP A;  4RTV A;  2H8H A;  4OMF B;  4Z8A A;  5KYY B;  2K79 A;  4C0F A;  3FJ5 A;  2GCX A;  4B6M A;  1Z9Q A;  2EQJ A;  2NUT B;  2E3I A;  2QQR A;  3M56 A;  1ZHI A;  1E6G A;  1HK9 A;  2NWM A;  1OX8 A;  1NJI U;  1KG1 A;  4M7D D;  4L59 A;  1WXB A;  2KY9 A;  1JJ2 P;  2W0Z A;  1Y96 B;  1U06 A;  4A53 A;  2NUT A;  3E19 A;  1D0Z A;  1QW1 A;  4DBR A;  3KFV A;  3CBM A;  1Q86 R;  1A0N B;  1NG2 A;  2CKK A;  2PUK B;  3JCM b;  2KI7 A;  3BFM A;  5LJ3 g;  5IXB A;  1MV3 A;  2WSF E;  3CCS Q;  3A8H B;  2MI6 A;  1TG0 A;  1J3T A;  2CP7 A;  1VQK T;  2QEX A;  1M1K U;  1Q95 G;  2K3X A;  4JZ4 A;  1NPR A;  2LP5 A;  1QKX A;  3UF4 A;  7AT1 B;  3NFC A;  4J8O A;  2EPD A;  3SFM A;  1N9R A;  4IUU A;  2LJ0 A;  1E7O A;  3HL8 A;  3G6E A;  3KUF A;  4WF2 A;  2J7I A;  1Q82 R;  2K5I A;  1PD0 A;  5C0M A;  3DLL A;  1ZUU A;  4IUV A;  1X27 A;  3VRZ A;  1RAG B;  1M4Z A;  3JB9 H;  3EGD B;  3GOX A;  3RDV A;  3JCM P;  1QQJ A;  3CC2 T;  5CKF A;  2C0T A;  5HKC A;  3VUB A;  2CH4 A;  1VQ7 Q;  1M3A A;  2PTK A;  3FIF A;  4ME7 A;  3EGU A;  1M3C A;  4MZM A;  3SD4 A;  4AFZ C;  3M4Y A;  4GY5 A;  2R58 A;  1XTD A;  5D6X A;  1U1S A;  4M7D C;  4J83 A;  1TH7 A;  2CP0 A;  2XKO C;  2Z0W A;  1TWB A;  1ACM B;  1KQ1 A;  2MYS A;  1JXO A;  3OYE A;  1V76 A;  2RHY A;  4E7J A;  4EMK C;  3CME Q;  1MUZ A;  3CCR T;  3QG1 A;  1WFW A;  2P4R A;  3I9Q A;  3RMQ A;  1YHQ A;  2Y4X A;  2J6F A;  2LMJ A;  2PZ1 A;  3I5S A;  4M77 A;  2OTL A;  2RMO A;  4OMQ A;  3HSB A;  5CR2 A;  1SF9 A;  5J3B A;  5M9O A;  2DO3 A;  4A4E A;  1OZ3 A;  1VIF A;  3OMC A;  2JM8 A;  1LPL A;  4KBM B;  2F1L A;  1VQ4 A;  4BUG A;  1MND A;  2BZY A;  5CVI A;  2WSC E;  2PVO B;  2KXD A;  2GF7 A;  3EGX A;  2RJD A;  4QVC A;  3QZ5 B;  2HQE A;  4J9D A;  5GMK i;  1RLP C;  3MHX A;  4RTY A;  1VIE A;  2BTT A;  2DIQ A;  4OB1 B;  2QYZ A;  1WJQ A;  3CME T;  3RKW A;  1K1Z A;  1HYO A;  1YJ9 T;  3AHU A;  4OGC A;  1YJW T;  2MIO A;  2DZ9 A;  3M0Q A;  4AMC A;  2LNH B;  5DM7 R;  5GAN h;  3X20 B;  3CCJ T;  2DK3 A;  5KYN A;  3VS0 A;  3OS5 A;  2KDS A;  5A2Q E;  3VYG A;  3G4S T;  4BY6 B;  2HKN A;  1VQN A;  3OYB A;  2YLB A;  1JRI A;  1P92 A;  4JRK A;  2A3L A;  2PNI A;  2EYZ A;  2F5T X;  2DF6 A;  4K11 A;  1UUE A;  3QYG B;  2DM1 A;  1BCO A;  2MPX C;  2FRY A;  4QVD A;  2GQV A;  2C0O A;  4M7A C;  1G3Y A;  2RJE A;  1M90 C;  4D6W A;  4PJJ A;  2LX7 A;  1UG1 A;  4GLK A;  4M75 F;  3RBB B;  1VQL A;  3HKS A;  5GMK e;  3DB4 A;  1O9S A;  1K0S A;  3G71 A;  3CPW S;  3C12 A;  2YUQ A;  4N4G A;  3OW2 A;  4BY6 C;  4LUE A;  2M16 A;  5IT9 E;  4A4F A;  1RI0 A;  2RI5 A;  2DD4 A;  4JDS A;  4C92 A;  1ZBX A;  2KYM A;  1UE9 A;  3L1A A;  4BB7 A;  2L3S A;  2CDT A;  2FPF A;  1YIJ A;  4XU0 A;  2XIC A;  4M78 A;  2QG9 B;  2M9U A;  1K73 U;  4CC7 A;  2A7Y A;  3M58 A;  1W2B A;  1WHL A;  4FSX A;  2JUF A;  1PKS A;  1X2K A;  2HKQ B;  1YIT A;  4XQ3 A;  4LD6 A;  1WGS A;  3CCQ T;  3M0T A;  1OPL A;  3EGD A;  1VQ7 T;  4FM4 B;  1RAI B;  1Q81 R;  3CCV A;  5KCH A;  4PJO A;  1NEG A;  1PG5 B;  2HD0 A;  3MP1 A;  5GAM f;  5LJ3 j;  4M75 B;  4HVV A;  1JQQ A;  2DET A;  2DBM A;  4IUT A;  4X34 A;  2DRM A;  2C0I A;  2ABL A;  4PLI A;  4LN2 A;  3I56 Q;  3MEV A;  1AT1 B;  1ZBJ A;  8ATC B;  1EFN A;  2ZGW A;  2DA9 A;  3CC7 T;  3L2U A;  2HSE B;  2HQH A;  1YIT T;  3CCM A;  1BI0 A;  1LCK A;  1QKW A;  4Y28 E;  1WZO A;  1M1K C;  5FLX E;  2FZG B;  4XTW A;  1FMW A;  5IHN A;  2AKL A;  5A0D A;  1I5L A;  4C92 G;  1OPK A;  5LJ5 g;  4M7A A;  2WSE E;  1YI2 Q;  3JB9 D;  3FRN A;  2VVK A;  3CC2 Q;  1KK7 A;  2QK0 A;  1BBZ A;  1TS9 A;  2DL7 A;  3JB9 J;  2FPE A;  2E5K A;  5KH6 A;  3P8B B;  4MDX A;  2F69 A;  1YP5 A;  4M75 A;  1SPK A;  4ZGD B;  3QHS A;  3URG A;  3SEM A;  4D8K A;  3OS1 A;  1VQK A;  4AFQ C;  1M90 U;  4QT7 A;  3QXE B;  4C8Q F;  2ROT A;  2PQW A;  1RAE B;  1WHJ A;  3V7C A;  1WIE A;  4KT0 E;  3DLM A;  4M77 D;  3G7Z A;  3CBO A;  2DVJ A;  4HXJ A;  1VQ9 Q;  4Z89 A;  2CP6 A;  3A1P A;  4AG2 C;  1RAD B;  4C8Q G;  1QCO A;  1XOV A;  4O6J A;  2CSI A;  4RTZ A;  2QA4 A;  2J05 A;  4IUP A;  1YI2 T;  4PJO E;  1YJ9 Q;  4DOV A;  2KMT A;  1PC0 A;  1PRL C;  2AZV A;  1VQN T;  5CKH A;  2NLU A;  4MDW A;  3V7S A;  5CKE A;  3EG1 A;  5ECA A;  1HJD A;  1NJI R;  3L2Q A;  1M90 R;  3A8O B;  5I2M A;  1I0C A;  4M78 E;  2CUB A;  2LCL A;  3QUI A;  4Z88 A;  2RI3 A;  2X35 A;  2R5A A;  3D7S B;  2XMF A;  3SHW A;  4C0Z A;  1C1A A;  2ZCF B;  4KH1 B;  4J9H A;  3EH1 A;  1VQL Q;  3CCE A;  5FRO A;  2XDD A;  3QDF A;  1MMA A;  2MWP A;  5IXF A;  1G83 A;  4L6V 5;  1N27 A;  1K8A R;  2HQX A;  2EYX A;  1VQM A;  3ZFJ A;  1PSE A;  5AT1 B;  5DY9 A;  3L2W A;  3CCL T;  4EIK A;  3C0C A;  1RAC B;  4KGX B;  1N8R R;  4M75 E;  3H6Z A;  5J26 A;  3X26 B;  5CKD A;  2YRC A;  1S72 Q;  2O9V A;  1VQN Q;  1RL2 A;  1BYM A;  1D3B B;  3GBQ A;  4F7U A;  1C0M A;  3CD6 A;  1YWP A;  1D1B A;  3E9G A;  1Q82 U;  1JBM A;  2F5K A;  4KRT A;  1WA7 A;  1QVF A;  4M77 C;  4X1V A;  2LQW A;  3X28 B;  3M9Q A;  3M0S A;  4M7D G;  3JV3 A;  2KEA A;  4FYV B;  2OX7 A;  2DNU A;  3MPU B;  5CAI A;  4E7H A;  1YBY A;  1VYT A;  1BKB A;  1MHN A;  3M5A A;  1ZSZ C;  4J7I A;  1VQK Q;  3HRU A;  5FU6 B;  2RHI A;  1TUC A;  1VOM A;  2EYY A;  3OSS C;  1K9A A;  4J9I A;  2X4X A;  2RQT A;  1K0X A;  4MML A;  3VS4 A;  1UFF A;  3CXC S;  1XJW B;  1GL5 A;  3DKM A;  3AT1 B;  4M78 C;  1WQ7 A;  4LDW A;  4ZGJ B;  1YI2 A;  4JLI A;  4M75 G;  2AZS A;  2G3R A;  2NYS A;  2EYW A;  2A36 A;  1KQS S;  3A8G B;  3F70 A;  4LDX A;  5EC7 A;  2DJQ A;  4JJB A;  1IB8 A;  2KRO A;  2DLP A;  1JU5 C;  2O2O A;  4HCZ A;  5GAM e;  1BI1 A;  1R0C B;  4FW1 A;  1FYN A;  4PJO G;  3LH0 A;  2MMP A;  2DMO A;  2HL3 A;  4C92 F;  2CH4 W;  2QEX Q;  4GBQ A;  2COZ A;  2KE9 A;  1UTI A;  4J9E A;  2SRC A;  3G6E T;  1UEC A;  2DD5 A;  4N0A A;  3X24 B;  3CMA A;  4L5G A;  2KR3 A;  1G3T A;  3V8L A;  1B34 B;  1MNE A;  2HMA A;  2SEM A;  1OOT A;  5LJ5 d;  1D1A A;  4ANJ A;  2RQW A;  3RKX A;  3NTH A;  3OW2 P;  1G5V A;  2GTO A;  1QVP A;  4ELY C;  5GMK h;  2HDA A;  2EQI A;  1AWW A;  1WYX A;  3VJP A;  2DYB A;  2E41 A;  1Y71 A;  4J6W A;  2EYQ A;  4E7I A;  1B07 A;  4C92 D;  3IQL A;  2KNB B;  4C5E A;  4QKU A;  2DL8 A;  2YSQ A;  5CQY A;  4TVR A;  2JS2 A;  2LCC A;  4JLG A;  3CC4 Q;  4M7A F;  3H0I A;  1Q7Y R;  4VUB A;  4F7U B;  1OX9 A;  4F7U F;  4C8Q B;  2KXC A;  2L5Q A;  2CUD A;  4B9W A;  4PKC C;  1XNI A;  2CZ6 B;  2EAY A;  1NZ9 A;  4WCI A;  2X3X D;  2FEI A;  5LJ5 j;  1KQS P;  2RJC A;  1FMV A;  4M78 D;  3X25 B;  3ZEH A;  2FZC B;  3CCM T;  2HCK A;  2X9H A;  2K6D A;  3JB9 G;  1X75 C;  2DIG A;  3OW2 S;  1RUW A;  4PNO A;  3SB2 A;  3CC2 A;  1PHT A;  3JCM e;  1H8K A;  3BW1 A;  2M51 A;  4PLL A;  2EJ9 A;  4BI4 A;  3VV0 A;  5A0G A;  2NUZ A;  3I56 T;  5KYX A;  1K73 C;  3T9N A;  2CZ0 B;  3H8Z A;  3RES A;  1AZG B;  2A28 A;  2YLC A;  4N4I A;  1NEB A;  3A98 A;  1X69 A;  1QP2 A;  2QGF B;  2VWF A;  1X01 A;  3NHN A;  1G3S A;  1YJN Q;  5GAN f;  4QQD A;  4PJO C;  3TU4 K;  1SKU B;  1ABO A;  4N0A C;  1VQL T;  2AK5 A;  2O88 A;  5I2S A;  2XHC A;  1VQP Q;  2DFU A;  4HKE A;  2RQU A;  3CCS T;  1RAH B;  3G71 T;  3PTA A;  1YJW Q;  1VQ9 T;  1N8R U;  1AWO A;  5GAO n;  3ME9 A;  2IPO B;  1OU8 A;  2J6K A;  2FVU A;  4DA4 A;  1X43 A;  3R6N A;  3GF5 A;  3JCM Q;  1MGQ A;  4P5N A;  1MMN A;  3SWN C;  3VS7 A;  4AT1 B;  3CCS A;  1NM7 A;  2VGM A;  2JJ9 A;  1HD3 A;  2OI3 A;  4R56 A;  3JCM c;  2KQW A;  4M77 B;  2JMC A;  1PNJ A;  1R8O B;  2M0O A;  2LX9 A;  1LJO A;  1B3Q A;  2GGR A;  1ZSZ B;  3RUX A;  3PT9 A;  1VQ5 T;  1N9S A;  2CP2 A;  1DJ7 B;  4C8Q D;  1OV3 A;  2YWW A;  2IVW A;  3VYH B;  3P8D A;  2YUN A;  2CRE A;  1KHI A;  4JRQ A;  4B9X A;  2D6F A;  2DRK A;  1IHV A;  1V1C A;  1QLY A;  1BCM A;  2FPD A;  1TXQ A;  4JJC A;  2M1H A;  3LW5 E;  4C0D B;  1T0J A;  1ZQ1 A;  5L23 A;  5FRN A;  3NMZ C;  4M77 E;  5I11 A;  5HY6 A;  1M30 A;  1W70 A;  1V29 B;  3H41 A;  5KYX B;  4NOY A;  2VXE A;  2OAW A;  1PKT A;  4RCC A;  3ASK A;  3PFS A;  4EMK B;  2E6N A;  3EG0 A;  1Q81 C;  4V2S A;  3TSZ A;  3RKY A;  2YRV A;  3BE3 A;  1BI3 A;  4MZT A;  5GAM h;  4PJO D;  1WDX A;  4WTO B;  4MZP A;  3OYH A;  4OMP A;  4XU3 A;  1JJ2 S;  4CC4 B;  2QDL A;  4A4G A;  3QZ9 B;  4Y91 A;  2YHT A;  2QQB A;  3CBP A;  3UWN A;  4BE2 A;  1VQP T;  3HFO A;  1IGU A;  1W2B P;  4ZN1 A;  2ROL A;  2B8A A;  1UGR B;  2KGT A;  3QO3 A;  3PNW C;  1Z9Z A;  4C8Q A;  1N5Z A;  2KSS A;  3MO8 A;  3H9N A;  4Y92 A;  3UA6 A;  5EG2 A;  4J6X A;  2ATC B;  3TVT A;  8AT1 B;  1M5Q 1;  2DXC A;  3MEU A;  4Q5W A;  5KYU B;  4CC2 A;  3I5R A;  3OQ5 A;  2JM9 A;  2EKH A;  2EIF A;  3OYC A;  1VQP A;  2EVR A;  6AT1 B;  4R55 A;  2KRN A;  3M0U A;  2JTE A;  3ULR B;  3OYM A;  3C94 A;  1LNX A;  4C8Q C;  2MOX A;  1MMG A;  3VS3 A;  1MMD A;  1YJN A;  4M7A E;  1C6V X;  1LOJ A;  1IRE B;  2EW3 A;  4F7U E;  3CCE Q;  4J9F A;  1ZUY A;  3RIR A;  3G4S A;  3OYY A;  2G6F X;  5GAM j;  2VXF A;  2QXF A;  2KRM A;  2NUP B;  3CEY A;  2MF2 A;  4ORZ A;  1D1C A;  1KD1 U;  4RG2 A;  3HFN A;  4DBH A;  2RH2 A;  4OMO A;  2HBP A;  1QVG A;  2ZPB B;  3KBG A;  4FYY B;  2QAZ A;  4M7D B;  3OYG A;  1T0H A;  4BDZ A;  3WXM B;  2P0K A;  3H0F A;  2QA4 T;  4E7S A;  3JCM V;  1W2B S;  2BIV A;  3LX7 A;  1R77 A;  2EGA A;  4LNP A;  3CMA T;  1UHC A;  2E4H A;  2E70 A;  1Q7Y C;  2C06 A;  5GAO m;  2CGH A;  3V7R A;  1RI9 A;  1VQ4 T;  1K9M U;  2VC8 A;  2FYK A;  3JCM W;  1VYV A;  2JNG A;  3A8M B;  3MEA A;  1GRI A;  4IIM A;  2GFA A;  3CPF A;  1NYF A;  2JMA A;  1H3Z A;  1UJY A;  5IAY A;  3CC4 A;  1AD5 A;  2DZC A;  3U23 A;  2ZPE B;  3G6E Q;  1VQ6 A;  3EG9 A;  1AWX A;  1X6B A;  5IN1 A;  5DLO A;  4M7D E;  5GAN 6;  2YRD A;  3CCE T;  2I2L A;  4MMK A;  4EMK A;  1WXT A;  2DL3 A;  2JW4 A;  1AOJ A;  3MP6 A;  4OB3 B;  2K7A A;  2J6O A;  4ESR A;  5GAN g;  3PMT A;  1QWE A;  2YUO A;  4C0D C;  4XU1 A;  4NL2 A;  5A0L A;  4C92 B;  2YUP A;  2EQU A;  3G1J A;  4BAC A;  1IHW A;  1VQ7 A;  1WQW A;  3GNF B;  4LDY A;  2CSQ A;  4ZN3 A;  4JS5 A;  2VYT A;  2OTJ Q;  2M0Y A;  1OEB A;  1Q86 U;  1YHQ Q;  2R5M A;  2VAS A;  2I0N A;  1QVG P;  2O4X B;  2D1X A;  1TUG B;  3E2U A;  4OVA A;  3O5Z A;  2FB7 A;  3A8L B;  1SSH A;  3M55 A;  4ZGE B;  4QQG A;  4AFU C;  1ZUK A;  5CCA A;  3EG3 A;  5GAN 7;  2GNC A;  2D9T A;  5GAM d;  5GAN 3;  2LNV A;  4FL6 A;  4JS4 A;  1VQO Q;  4KH0 B;  2DEQ A;  3EH2 A;  5GAO p;  2DVE A;  5FWB A;  1YIT Q;  1K8A C;  3L2V A;  1CKA A;  1EZZ B;  1I1J A;  1S72 T;  3TCJ A;  2DL5 A;  1M2O A;  4CI0 C;  2DTI A;  4JRI A;  4M77 F;  1QCN A;  3L2Z A;  1KFZ A;  4E47 A;  2L8D A;  4CRI A;  3P8H A;  3CCV Q;  3GPL A;  2HSP A;  2ENM A;  2XDP A;  2PU9 B;  2ZPH B;  1Q7Y U;  5GAN j;  4ATO A;  2ESW A;  3BDL A;  1ZSG A;  1OYX A;  3JCM f;  1UB4 A;  4LDU A;  3V8J A;  5I21 A;  1H92 A;  2VUB A;  3PGG A;  3OYJ A;  2B86 A;  5IH2 A;  2PVD B;  4FW2 A;  3EAE A;  1W1F A;  3QII A;  3ZBD A;  5KE2 A;  1IRX A;  2XD0 A;  4IKF A;  5GJV B;  3OS2 A;  3REB B;  5KE3 A;  2H3J A;  4XTZ A;  5GAN e;  1YCY A;  1YHQ T;  4E2F B;  2MWO A;  1WJR A;  3CCU Q;  4JPB W;  4F7U G;  3JCM X;  1H3H A;  2MCN A;  4KUL A;  1Y96 A;  2LVM A;  1X2Q A;  4FCY A;  3CCQ Q;  3JCM J;  3VUZ A;  2RJF A;  2RNA A;  1UGS B;  1UGV A;  4HA8 A;  5LJ5 f;  1SEM A;  2FO0 A;  2K3Y A;  1WHG A;  2LT4 A;  1X6O A;  1M1F A;  3J7A F;  4GLM A;  2H3E B;  1VQ9 A;  1VQ8 Q;  3I35 A;  1TOV A;  3MJX A;  4OML A;  5HCK A;  2QDY B;  2XU8 A;  2GFU A;  4F14 A;  4M7D F;  5GAN 2;  4BE1 A;  1SSF A;  2EWN A;  1GBQ A;  5GJW B;  3I55 Q;  4J9C A;  5LL6 S;  1QWF A;  5CQX A;  2DYI A;  3KXT A;  1U3O A;  4RTW A;  3CXC A;  1UJ0 A;  2BUD A;  4BE0 A;  1BI2 A;  4PJO F;  2HNI A;  2PVG B;  3G4S Q;  2V8I A;  3M54 A;  3HPW A;  5GAO q;  4AG1 C;  5LJ3 f;  4PFZ A;  4R0K A;  3UT1 A;  3FJP A;  4LD9 K;  3CCV T;  3REA B;  2VV5 A;  1VQ8 A;  4J5Y A;  2ED1 A;  4F04 B;  4OF1 A;  2CP3 A;  3M0P A;  4CC3 A;  4EDU A;  1MV0 B;  1SRM A;  4FT4 A;  2BKD N;  3HRT A;  1KQ2 A;  2XG8 D;  1RAA B;  2LJ1 A;  4FYX B;  3SWN A;  3OSV A;  4M78 F;  3O8V A;  3J81 E;  2O9S A;  1QVG S;  2K9G A;  5HK0 A;  1M3B A;  1NLO C;  3MET A;  3DB3 A;  4HCK A;  3CCM Q;  3OY9 A;  3MEW A;  2ZPI B;  4XTX A;  5FU6 C;  2DX1 A;  3CCR A;  3HHT B;  4OMM A;  3CC7 A;  1YJN T;  3EG2 A;  4A4K A;  2RQR A;  3RNJ A;  5KCO A;  3JCM d;  5GAO r;  2HAX A;  4E7L A;  5D6W A;  3CCU T;  3QSU A;  3M53 A;  3OYN A;  1OQK A;  3Q1J A;  4PFP A;  3RR6 A;  3LYI A;  2AIR B;  2K5L A;  2O01 E;  2EBP A;  2JTM A;  3OMG A;  1GCQ C;  2KT8 A;  4BI3 A;  2CYZ B;  5LJ3 h;  4OGE A;  4XK8 E;  1JJ2 A;  2MK5 A;  2LQN A;  4FU6 A;  4KUD K;  2LC4 A;  1XQH A;  3S3N A;  1K73 R;  3TSW A;  2E5Q A;  3QBY A;  1E6H A;  4RCB A;  5KYY A;  2Y90 A;  2HZY A;  1I4K 1;  1K8A U;  2OTJ T;  3L2R A;  4IIO A;  2K5F A;  2EKO A;  5GMK l;  3QPH A;  2D0N A;  1OI1 A;  2ECZ A;  4Z02 A;  3PMI A;  2VKN A;  1EIF A;  5FW9 A;  2O4X A;  5CO7 A;  1WHH A;  1TU0 B;  5LJ5 e;  1VYU A;  4DEX A;  2RO0 A;  2CS7 A;  2DXT A;  3WVD B;  2K57 A;  3TQ7 P;  5D7U A;  3QWX X;  2ZAE A;  1ZA1 B;  1WPY A;  1VQO T;  1Q86 C;  4M7A D;  1I81 A;  3CCL Q;  2JN0 A;  4LXC A;  2P84 A;  4RUG A;  5J39 A;  4AFS C;  1JXM A;  4LDV A;  3LWI A;  4ZTF A;  5LJ3 e;  3HRS A;  1U1T A;  1W6X A;  1UHF A;  2BZ8 A;  3CQT A;  1KSW A;  3QJY A;  1AHJ B;  2CP5 A;  1M9S A;  1TUD A;  3CD6 Q;  4HT8 A;  3JB9 F;  3JAM E;  1NE8 A;  5GAN 8;  2FRW A;  5GMK m;  5GAN 4;  3CXC P;  1BB9 A;  1NPP A;  2HEQ A;  2JTF A;  2D8J A;  3S6W A;  5FU7 C;  4BD3 A;  1NJI C;  1QVF S;  2E10 A;  4X9D A;  1M8M A;  4C5G A;  4HVU A;  4RG8 A;  3I55 A;  1GBR A;  4A63 B;  1VA7 A;  1Q81 U;  1D0X A;  1VQM T;  4M7A G;  1GCQ A;  4E7K A;  1YFN A;  1ZA2 B;  2KT1 A;  4PK4 A;  1M1K R;  4NL3 A;  2JVV A;  1K9M C;  2QTX A;  3EHR A;  3VS5 A;  1N6A A;  4PFO A;  2W10 A;  5KYU A;  2IIM A;  3UPU A;  5FRM A;  2ZZD A;  2RK2 A;  4XTY A;  2DER A;  1U8R A;  2QQ9 A;  4YTL A;  2ED0 A;  3INZ A;  4BDY A;  1CKB A;  3SDZ A;  2JS0 A;  1YJ9 A;  5FU7 B;  1KC8 U;  3CC7 Q;  1WI7 A;  4NS5 A;  2JXB A;  3CME A;  2F2W A;  3N5B B;  3G71 Q;  1IZ6 A;  3VS6 A;  3MP8 A;  1OU9 A;  3FDR A;  3VS1 A;  3E1S A;  1YNZ A;  1KC8 C;  1Q82 C;  4N4H A;  1M2V A;  2JT4 A;  2QQA A;  1WNL A;  3RMS A;  3NTI A;  2GQI A;  4X9C A;  2VGN A;  4M7D A;  2E65 A;  2JZ2 A;  1JB0 E;  2KAF A;  3CCQ A;  3MCA B;  3FEO A;  1BK2 A;  5FWC A;  1WXU A;  2LTO A;  4RTU A;  1R0B G;  2A37 A;  4M75 D;  3OYF A;  2M02 A;  4PJM A;  2XID A;  2RD1 A;  3CCU A;  1UGQ B;  1U5S A;  1X6G A;  4J7F A;  1UGP B;  2E64 A;  5C6S A;  3HP9 A;  2RHX A;  3QWY A;  2QAS A;  5GMK j;  2LJ3 A;  1GFC A; 
#chains in the Genus database with same CATH homology
 2KI7 A;  2ZAE A;  1OQK A;  1V76 A;  1PC0 A;  1TS9 A;  1TSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...