1TS9A

Crystal structure of the archaeal homolog of human rnase p protein rpp29 from archaeoglobus fulgidus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
LQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGDLINFRPEDRIKRGLMMLKRAKGVWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Crystal structure of archaeal ribonuclease P protein aRpp29 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1ts9A00
1V76A 1TS9A 1PC0A 1TSFA 2ZAEA 1OQKA 2KI7A
chains in the Genus database with same CATH superfamily
1BI3A 2VB6A 3CXCS 3H0HA 1NYFA 1N6AA 4M77G 3HRTA 2ABLA 2YHTA 1AWXA 2BZYA 2JW4A 4XK8E 2QASA 4C5IA 1PM3A 5IXFA 1NJIU 2XICA 3QBYA 1VQ9T 2CP6A 5EC7A 3JB9I 2K3BA 1X43A 4MZPA 2JTEA 3A8LB 1RABB 4KUIA 2DM1A 1RAGB 4X1VA 3PGGA 3JCMd 4XQ3A 4PLLA 2DX1A 1PNJA 3RERA 3SHWA 1EX4A 1ABQA 4M78G 3ZL7C 3MO8A 2EW3A 3RKYA 1HD3A 3BDUA 4FYVB 4ORZA 4IUVA 1W1FA 4HCZA 1K73U 2KYBA 5HCKA 2DJZA 5LJ3d 5GMKi 1QWFA 2AK5A 3A8HB 1OX9A 3JCMW 1VQ8T 4OMOA 4C92F 4IIMA 4QVDA 3L2QA 3NHNA 1FXXA 1JJ2A 2LT1A 3REAB 2OTLT 1Z9ZA 2PQWA 5D6WA 3HPWA 4CI0C 4LUDA 4LD9K 1S72T 4HCKA 2X51A 4JLIA 2EQUA 3I9QA 2RK2A 1VA7A 2QQRA 3NFCA 2YUQA 3MP1A 2V1QA 1BK2A 1WNLA 3CBPA 1M90U 5L8RE 4A63B 4IIOA 5GMKh 2CP2A 1WJSA 4BUGA 4OMMA 1VQ9Q 5FU6B 3VS6A 2ZAEA 1SRLA 1J3TA 3FLGA 2A36A 4FCYA 2OAWA 2J6OA 2ZCFB 2LMJA 1KD1R 4C0FA 4J7FA 3M0RA 1GRIA 3FIFA 1YWOA 2Z0WA 1AHJB 4C0GA 4HCBA 2YDLA 4PFOA 3OYGA 1MNDA 4L59A 2X35A 2VYTA 1MGQA 5KCOA 1PD1A 1VQPA 4XTVA 3NTIA 1VQ8Q 3M0SA 3CXCA 2NLUA 2R5MA 2BZXA 4KBMB 3CCMT 2COWA 3VRYA 3LH5A 2HCKA 5EG2A 5IHKA 4AFZC 2RI2A 2OTLQ 2DZCA 4X34A 4PFPA 4RTTA 3TQ7P 7AT1B 1FWZA 4XU1A 5CQYA 4M75E 2MI6A 3RKXA 3M58A 5GAMe 3BDLA 2LP5A 4M4ZA 1X6GA 1MV3A 1ZSZC 3GNFB 1Y96B 4MMLA 3JCMc 2HNIA 3M54A 3REBB 1KD1C 3V8LA 2HQXA 2DTHA 5CKFA 1YI2A 1FMWA 1MMNA 4HA8A 4ZGJB 3G6EA 2XHCA 2H8HA 5KYWA 2QEXT 3RMSA 1RAIB 3VYGA 1ZQ1A 5GANf 2NUTB 5J3BA 2EQMA 1GCPA 1SSFA 3JCMJ 4M77A 4BI8B 5CKEA 2O31A 1N8RU 1I5LA 3OYLA 5AYFA 2JM9A 3G4SA 3PMIA 3V8JA 3I56T 4Z89A 3CCMQ 2DERA 5CO7A 4A53A 2AKKA 1H8KA 4QW2A 4NS5A 4C8QF 2Y4YA 2ATCB 1Q86R 3FJ5A 2EQKA 2RK1A 2EGEA 4FSXA 3MCAB 1OU8A 1JB0E 1T3LA 1B34A 1X6OA 1M1KC 1IGUA 1B7TA 1VQ4T 4JRPA 3H41A 3EFOA 1UTIA 3SWNA 2QEXQ 3JAME 3JB9D 1WPYA 3V7SA 4JJNK 3VJPA 1UGQB 1U1SA 1Y71A 5A2QE 4FW1A 4ANJA 4D8DA 5DLQE 1QKWA 1G5VA 3HKSA 3EG9A 4OMFB 4J9BA 1HYOA 1P92A 2O9SA 2K5LA 1D1CA 1BCMA 4DBRA 1XQHA 1WHJA 3CC4A 2QTVA 4JJBA 2LT4A 1KHIA 2XDBA 2FHDA 4M77C 1RACB 2QTXA 3I56Q 3U23A 4RTZA 1VQ6T 1PHTA 2DL8A 2J6KA 1TS9A 3LGFA 2ED1A 2LQKA 1YITT 2YRVA 5CKHA 1YWPA 3OY9A 1Q7YU 3CC7A 3E1SA 4KRTA 1BI0A 5DM7R 3EGDB 3M0PA 2IPOB 4C8QE 4CRIA 1XTDA 1WXUA 1ZBXA 3RIRA 4QVZA 5LJ3e 1KQSP 1W70A 2QQSA 2O88A 1VQ4Q 1YJ9A 1IREB 3ZBDA 2XI9A 2LQ8A 1IXDA 1SHFA 2WSFE 1VIFA 3THKA 1BI1A 2KNBB 1WJQA 4JLGA 3CMEA 4A4HA 3Q1JA 4E6RA 3TSWA 4JRKA 4BI3A 1YJWT 3L42A 3SWNC 2E65A 1AZEA 4V2SA 3BE3A 4JZ3A 5CKBA 1RAEB 4QKUA 3JCMb 1VQ7A 1AZGB 2KGTA 2MPXC 1NLPC 2B86A 5IT9E 2DETA 1R0BG 4KGZB 1VQ6Q 1X2QA 1MV0B 2CH4A 4M7DG 2OTJT 1BU1A 2JM8A 1YITQ 1Y0MA 1WXTA 1UDLA 4E7LA 4RUGA 1XOVA 3SEMA 2CREA 1KG1A 5FWBA 2ZPHB 4ME7A 1HSQA 3J7AF 2KR3A 3C4SA 2V8KA 3ULRB 5ECAA 1YCYA 2KSSA 4MMKA 1W6XA 4LXCA 2EYZA 1PWTA 3OMGA 3QJYA 3HRSA 2RQVA 3GNGA 5LJ5e 3UPUA 1YJWQ 4CC4B 1ZSZB 2DL5A 3G71T 2ESWA 2QQAA 3E9GA 1RUWA 1UHCA 2CDTA 1WHKA 2RJFA 3MEWA 3CCUA 1AOJA 3EGUA 4C5HA 1Y96A 2KDSA 1RI9A 4M7AB 3HSBA 4LE9A 2OTJQ 2ZZDA 2AZVA 2D1XA 1RLQC 2M0OA 1U8RA 3VS1A 1MMDA 4DBQA 4FSSA 3JCMX 4F7UF 2BKDN 2Y4XA 2FB7A 2RI5A 2XD0A 1CSKA 1VQKT 5FU6C 3ZEHA 4BI4A 2NUTA 2L0AA 3C95A 3JCMh 3PMTA 5IHIA 1VQ5T 1G3SA 2PNIA 2K57A 2YT6A 1NJIR 4FM4B 1EFNA 3PIOA 1GXIE 2LQWA 1YFNA 5LJ3h 1WHHA 3NTKA 4RCCA 2XIDA 1PKSA 1E6HA 2FPFA 4J6YA 3H0FA 1N27A 5FROA 4XTZA 1IHVA 4DQ2A 2VUBA 2DXUA 3G71Q 4DOWA 2CSQA 3NPFA 3QWYA 2CP5A 1K73R 2QAZA 2PTKA 3VS2A 1Z9QA 4PJOG 5FLXE 3C12A 1E6GA 2YUNA 4CC2A 4O5VA 4F17A 1RADB 1VQOA 5GAMd 3OS2A 4Y28E 5GAN8 2FZCB 5HKCA 4JJDA 1K1ZA 1D0XA 4L6V5 3DB4A 3QWXX 3CMAA 1VQKQ 4RTYA 2QXFA 4LDUA 1YJNT 3META 3S6WA 1VQLA 3LGLA 1UGSB 1X6BA 1NZ9A 2MCNA 1PCXA 1M90R 3CPWS 1VQ5Q 3JCMg 3CCVA 3QDRB 1PSEA 4F7UE 3CCQA 3S3MA 5FU7B 4II1A 4AFSC 2ENMA 4PJMA 2CT3A 3TREA 3LLRA 2E3IA 1UECA 2FPDA 1PD0A 2RPNA 3J80E 2GTOA 5KYYB 2LC4A 4OMLA 4M78B 4JRQA 3EFRA 5LJ5h 3OA6A 3EGDA 1K9MU 2LCLA 3X20B 3CC2T 2MWOA 1B34B 2IG0A 2QDYB 2JMCA 4RG8A 1JJ2P 2DPPB 2KMTA 3GBQA 1OI1A 3LYIA 1H3HA 2LJ0A 3HFNA 4C92B 5M9OA 2VKNA 3JB9F 2X3XD 2B8AA 1TG0A 1YJNQ 3N5BB 2F5KA 2GTJA 2L3SA 3L2RA 4AMCA 4N0AA 2HEQA 4HT9A 2DIGA 2I0NA 4E7ZA 3RR6A 4CC7A 2KAFA 1C0MA 3DKMA 2XDDA 2XMFA 1HJDA 1JU5C 2A0FB 3UF4A 1RL2A 2J6FA 2DAQA 2CT4A 1BI2A 1UHFA 4FYXB 3M57A 2YWWA 2V26A 4JZ4A 3UT1A 4FL6A 2DILA 1GFDA 3QUIA 2HKQB 5J26A 1N8RR 3JV3A 3MEUA 2DF6A 2JN0A 3CXCP 2DLPA 2DE0X 2LRQA 1K8AC 3CC2Q 1PRLC 2K4YA 1YIJA 5CR2A 4PLIA 3EHRA 2AHJB 2RMOA 3C0CA 3CPWA 2ZGWA 2PVGB 1QKXA 3JCMf 5GANj 4AFUC 3RNJA 4MZTA 4DA4A 1VQNT 3MJXA 4AT1B 1FYNA 3HTRA 5GANg 4M75F 4EPCA 1NM7A 2EPDA 1OX8A 5KYNA 3OW2A 2BE7D 5C0MA 4M75G 1WDXA 4C92G 4ZTFA 3G7ZA 1OU9A 3NTHA 4J9EA 1ZSZA 4JUVA 1C1AA 3OBWA 1YHQA 2X4YA 1V1CA 2CZ0B 2O2OA 4N0AC 2YSQA 1UJ0A 1OQKA 4QQ6A 3QZ9B 3MKDA 3FJPA 4OVAA 1BB9A 2C0OA 4M7AA 2DEUA 2RQRA 4LUEA 1FMKA 3OQ5A 1SHGA 1M30A 3QYHB 3A1PA 4R56A 5I11A 4OMPA 2RJCA 2OTLA 3ME9A 3PIPA 1PC0A 2BE9B 2L89A 2D8HA 2K3XA 2E5QA 1G3YA 1GFCA 2LTOA 1Q7YR 2KI7A 3TEEA 4M77E 1VQNQ 2EBPA 2JXBA 2P4TA 2X4WA 1IO6A 4XTYA 4KUDK 1G2BA 2HAXA 2BUDA 1UGPB 3I55A 1UFFA 4J83A 2WSEE 5KH6A 1KQ2A 5LJ5d 3SFMA 2HSPA 3RBBB 3L2VA 3CD6A 2CZ1B 1S72Q 3H9NA 3TVTA 4XU3A 5GAN3 3CEYA 5GMKj 1YI2T 5D6YA 4EDUA 3DB3A 1TU0B 3G6ET 2P84A 1G3WA 2CP3A 4M7AC 1IHWA 2HMAA 1Q7YC 3V7CA 4J5YA 2HBWA 4QQDA 5J39A 5KYUB 2E70A 2DL4A 3OYDA 4YTLA 4C0DB 2AKLA 3UWNA 2GFAA 1UB4A 2M51A 1ABOA 4Y92A 4JS4A 4B6MA 2HD0A 1KJWA 3G4ST 1VYUA 1OPLA 2MK5A 1H641 2E5KA 1Q95G 2L3QA 4ZN1A 4M7AD 1SG5A 1M8MA 2HKNA 3OS5A 2CS7A 2KRSA 1I4K1 1LNXA 3OMCA 4IUUA 3VYHB 1D0ZA 1SSHA 2QGFB 2GQIA 5KYYA 4C8QG 1GCQA 3A8MB 4B9XA 4M78A 2NYSA 2DNUA 8AT1B 3CCJA 2DK3A 1GBQA 1YI2Q 1VUBA 2RQTA 2AIRB 3G6EQ 2EKHA 5AT1B 3I56A 3URGA 4C92A 3ER0A 2FG0A 2RQUA 5CAIA 2H3JA 2DKGA 3LWIA 2L8DA 1D09B 1Q81U 5FRNA 4BB7A 4FIBA 4E2FB 3WVEB 3G4SQ 2E6ZA 4J7IA 2VGNA 4FT2A 2J06A 4J6WA 2KYMA 1Q86C 5GAN4 4M7DB 2D0NA 3S3OA 1QLYA 1QVFS 2O4XB 1VQ4A 4PJLA 2CP0A 2DRMA 5FU7C 3H6ZA 1K0SA 2LNVA 2VGMA 1NYGA 1ARKA 2I2LA 3FDRA 2X4XA 2VV5A 1V29B 1WI7A 2WSCE 5IHNA 3CBMA 4LN2A 1R77A 2DL3A 1X69A 3JSCA 1KC8U 1YJ9T 2EYYA 1GCQC 3ZFJA 4M77D 4M78C 4ATOA 2MMPA 1AVZC 2VC8A 1ZA2B 4O6JA 2DD4A 1KFZA 1M9SA 4OF1A 3GPLA 2HQHA 3FRNA 5GAMh 4IURA 1LVKA 4BD3A 2RHZA 1YITA 1UEBA 4C92C 1FMVA 1ZUKA 1JBMA 2DMOA 2E64A 2RO0A 4M78D 2W10A 5GAOr 4EMKB 1GBRA 2RN8A 2P0KA 3M0QA 4AG2C 4KULA 4TVRA 2F69A 2K9GA 1KSWA 2QK0A 2Y90A 3QIIA 2BZ8A 2KXCA 4A4GA 2O01E 3EHQA 3ASKA 2HQEA 4MDWA 1YJWA 3OYJA 2YXYA 1NEBA 5IN1A 1BIAA 1ZLMA 1YJ9Q 5HK0A 1QVGS 4HKEA 4F16A 3CCST 2A7YA 2RD1A 2GQVA 2ZPBB 1M1KU 3AHUA 1R0CB 2ZPIB 1C6VX 4PNOA 5GAMj 3QXEB 4NOYA 3X24B 1AWJA 4ZNXA 1QVPA 1WYXA 1D0YA 4FT4A 2GCXA 3GF5A 4E7KA 2LVMA 2K5IA 5GAMg 1OV3A 3KBGA 4C5GA 2RM4A 3MP8A 3JCMP 2G3RA 1QVFA 4OMQA 2J05A 1K9MR 2CZ6B 1DJ7B 4JJCA 2MWPA 3IQLA 2OX7A 3CCUT 2E3HA 2OI3A 4PJOB 2AZSA 2L2PA 2PVDB 2YLBA 1Q82U 5A0GA 1QP3A 2CSIA 3HHTB 3HRUA 1W2BS 3H0IA 3OYKA 2DIQA 4D8KA 1BIBA 1ZBJA 1D3BB 5C6SA 2EJGA 2XK0A 1VQMT 3R6NA 2HL3A 4PKCC 5CVIA 3JCMV 1LJOA 3P8HA 3PVLA 1WQ7A 4WCIA 1UJYA 5KE3A 5KYUA 3EGXB 2DFUA 5IXBA 1LCKA 4J6XA 2C06A 4F7UG 3CCSQ 1JXOA 2JVVA 3G71A 4BE0A 1K9MC 2P0PA 4J9CA 2QA4T 3QSUA 2FO0A 5FWCA 4OB0B 1M2VB 4X9CA 3TCJA 2GNCA 5CCAA 3JB9J 5D6XA 2LX9A 3H8ZA 4GLMA 4M7DE 1PG5B 2DXTA 1M1GA 2EVRA 4DEYA 4XAXB 1TUGB 3CCEA 1GL5A 4NL2A 3GLXA 3CCUQ 2RQWA 3SD4A 1VQKA 3OYMA 1QW1A 4ELZC 3FEOA 2YRDA 1LPLA 4IUTA 4N4GA 2KXDA 1JXMA 1UGVA 1QVGA 1KK7A 4F04B 4WF2A 4BY6B 1VQMQ 5IH2A 1KIKA 2MOXA 4JDSA 2CGHA 3M59A 4OB2B 2M02A 4KH0B 1VQLT 2DBKA 3BY7A 2K5FA 3VS0A 1NJIC 3M5AA 3E9FA 2JUFA 2RI3A 3VS4A 2JS0A 5GAMf 3KUFA 1MMGA 2BTTA 2P4RA 3OYCA 2QA4Q 3CCQT 2YRCA 4KT0E 4OP0A 1WHMA 1AWOA 3MPUB 1IB8A 4M7DA 2JMAA 4C0DC 5LJ3j 2EKOA 3A8GB 5CQXA 4CC3A 1W2BA 3M4GA 4EMGA 3L1AA 4LD6A 1OPKA 2O4XA 1K73C 2L3PA 2OJ2A 1M2OA 1OZ3A 3OW2S 2EIFA 5GAOm 2QI2A 4DEXA 5GAN6 1XNIA 5LJ3g 1VIEA 2DA9A 2LX7A 3MEVA 3CPWP 2C0IA 1YJNA 1FX7A 3RUXA 1TSFA 3CCLT 3I35A 5GMKe 2R5AA 2P0QA 4GBQA 2E6NA 2ED0A 3JRZA 4OB3B 2PUKB 1SPKA 1MNEA 3OW2P 3PFSA 2LZ6B 2O9VA 4QQGA 1G3TA 2CUBA 1QP2A 2KT8A 3EG1A 3GIBA 1YCSB 3CCRT 1M90C 4ZTJA 1D1AA 1WA7A 1VQLQ 4M75B 3M0TA 4BE1A 2YLCA 4ZGEB 2KRMA 3VS3A 4FU6A 2RH2A 3OSVA 3JB9G 3VKIA 3OB9A 2BIVA 3CCQQ 1WHGA 1TOVA 5I22A 2KK4A 5GMKm 4Q5WA 4EMKA 1JRIA 5CIUA 1K76A 1WLPB 1WGSA 3X28B 4XU2A 2QG9B 1QWEA 4LNPA 4Z88A 2L5QA 1I5OB 2V1RA 1O9SA 4M7DC 2D6FA 3QJ6A 4WTOB 1AD5A 1N9RA 2X9HA 5A0LA 4M7AE 1SEMA 2IIMA 2OAUA 5LJ5j 2X3WD 2DTOA 4NL3A 3NGPA 3CCLQ 1YP5A 2EGAA 4PJNA 3BW1A 1F1BB 1IRXA 1YIJT 2M0YA 2E12A 3VUZA 4M77F 4HVUA 5I2MA 5LJ5g 2LCSA 2JT4A 4M7DD 1H92A 4E47A 1RI0A 3CCRQ 5LL6S 2DYBA 4R0KA 3DLLA 2HL5C 4A4KA 1E7OA 2CZ7B 3MP6A 1MMAA 3RDVA 1AWWA 1YN8A 1G8XA 3PVQA 4BE2A 1VQ9A 4M78F 1RLPC 2KRNA 1YHQT 4X9DA 3I5RA 4B9WA 2FYKA 3OYEA 1HXDA 5LJ3f 1N5ZA 1U1TA 4PJOA 4IUQA 1RAAB 1X27A 2EYWA 3HFOA 3V7RA 2DXBA 2F2XA 1N8RC 1D3BA 4EMKC 2VASA 2L3RA 3MEAA 4XU0A 2EJ9A 5GAOn 1Q81R 1VQNA 3D7SB 4UC4A 1VQ8A 2QDLA 3OYHA 2FPEA 2V8JA 3PE0A 5GJWB 1YIJQ 3CBOA 3EGXA 2D9TA 4J9DA 5GAN7 3M55A 2JZ2A 5I2SA 4P5NA 4PJJA 1ZA1B 2K2MA 1S72A 2K79A 2QGGA 2A28A 2XKOC 4VUBA 1VQPT 1M2VA 2QYZA 2AT1B 4XTXA 4LDWA 3VV0A 1UGRB 2HZYA 6AT1B 3VS7A 3L2WA 3I55T 3M9QA 4C8QB 1NBEB 2RB6A 1YHQQ 1KC8R 1JEGA 3CD6T 1Q81C 2COYA 1BBZA 2RF0A 2G6FX 2R58A 3OS1A 3FB9A 3QPHA 2K2VA 5KE2A 4PJOC 4M78E 4J9HA 2ROTA 4KH1B 5LJ5f 2V8IA 3X26B 9ATCB 3QZ5B 2JJ9A 2NUZA 1M8VA 1MHNA 3UATA 4N4IA 4DOVA 3CCMA 4BDZA 1Y57A 4JRIA 1K8AU 2DZ9A 2PVOB 2LCCA 4C92E 1BKBA 2A08A 1BYMA 3G1JA 3UDCA 4PJOD 4J9IA 3EG2A 1KC8C 2LDMA 2EAYA 1VQPQ 2JTMA 1UG1A 2GGRA 3M0UA 3E19A 4MZMA 2QQ9A 5D7UA 2YUPA 5GANd 1ZX6A 2A37A 4KGXB 4RTVA 3I55Q 4LDXA 5DLOA 5HY6A 1A0NB 4FYYB 3FC3A 3BFMA 3CD6Q 1M1KR 3M53A 2QEXA 3J81E 1O75A 2WACA 3VRZA 2SEMA 3CCJT 4EMHA 2NUPA 5GJVB 2DJQA 1U06A 2RHUA 1WJRA 4N4HA 1AT1B 2GBQA 1X75C 4J9FA 1HK9A 1TXQA 2E10A 4D6WA 2H3EB 4ZN3A 4M75A 1EIFA 2FRWA 4L5GA 4BY6C 1Q82R 1W4SA 4ELYC 1RAFB 5A0DA 3TU4K 3VUBA 2FZGB 4LDVA 1XJWB 1H3ZA 3RESA 3C94A 3DLMA 1M5Q1 1U5SA 3CC4T 3SB2A 1T0JA 1WX6A 5GAN2 3OYYA 2XU8A 3QDFA 4JPBW 4RTUA 1SF9A 1PKTA 3UA6A 4OGEA 2LNHB 1X01A 2GF7A 2HBPA 3AT1B 3CC7T 2DBMA 5KYXB 4BDYA 3LH0A 2DVEA 2FRYA 3CCJQ 3HP9A 4Y91A 1QCFA 2M16A 4E7SA 1KQ1A 2DEQA 3WXMB 1I1JA 4LDYA 4OB1B 1Q82C 5I21A 1QVFP 8ATCB 1KD1U 4RTWA 1OOTA 2JNGA 4DBHA 3X25B 2R57A 3CMET 1ZHIA 5FRMA 2XDPA 1KQSS 3EH2A 2MAMA 2VWFA 3JCMe 3L2UA 1VQ6A 1V76A 5GAOp 3EFSA 4XTWA 3LWHA 2D0QB 1R8OB 2FL7A 3OBYA 1CKAA 4E7HA 1VYTA 1I8FA 2KT1A 2KVQG 1TH7A 4M75C 4RCBA 2LJ1A 4EIKA 1VQ7T 3CC4Q 1T3SA 4K11A 2DRKA 2LJ3A 1KHCA 1WFWA 3WVDB 4Z8AA 4QVCA 4GY5A 2E1HA 2ZPGB 2D8JA 1UUEA 2CKKA 1QMCA 3PNWC 3MHXA 3CC7Q 1QCNA 1S1NA 1M1FA 4M75D 5CKDA 5GAN5 4C92D 3QHSA 4HCCA 5KCHA 1WHLA 3L2ZA 4RG2A 4F7UB 1VOMA 1CKBA 1PSFA 1YNZA 4FYWB 3A8OB 2CUDA 2F2WA 4F14A 4RKUE 2CP7A 2YUOA 1IZ6A 3M4YA 5GAOq 4M7DF 2ROLA 3GOXA 3R6OA 2EQJA 2JS2A 2PU9B 3TSZA 3CMEQ 4J9GA 3A5ZB 4OMNA 1OYXA 4KGVB 2EWNA 1SKUB 1OEBA 2KE9A 2OTJA 2FVUA 3O8VA 4C8QA 4E7JA 2ECZA 2KEAA 2VXFA 2VXEA 3LW5E 1QVGP 5GAOl 1TWBA 3OYIA 1VQ7Q 1WIEA 4HVWA 1Q86U 2HDAA 1TTHB 3CCSA 3O5ZA 3OYFA 2RJEA 2K3YA 2A3LA 1QCOA 3KFVA 1G83A 3NMZC 4FW2A 2RJDA 4J8OA 2JTFA 1NPRA 3LX7A 1KQSA 1K4US 3A98A 4PK4A 3RMQA 2W0ZA 3PT9A 1NE8A 2X4JA 3T9NA 1WZOA 3QG1A 2F2VA 4DBFA 1W2BP 3EG3A 3UA7A 4BACA 1MUZA 3EAEA 3OS0A 3GP8A 1LOJA 1VYVA 1NLOC 4HT8A 3F70A 2ZPFB 3OSSC 2PZ1A 5GANe 4IUPA 1I0CA 2EQIA 4A4EA 5GMKl 2DYIA 1SRMA 1PRMC 2DD5A 3INZA 1ZUYA 3RKWA 4AFQC 3CCET 1U3OA 2M1HA 1VQMA 3QO3A 1N9SA 4QT7A 2DXCA 2EFIA 2RHIA 2EYQA 4C8QC 3OYAA 1OZ2A 1K0XA 4PFZA 4Z02A 2QA4A 3I5SA 1YBYA 1TUDA 4MDXA 3KXTA 1VQOT 3OYBA 1VQ5A 2K7AA 3QYGB 3EG0A 1NEGA 2QQBA 2VVKA 1TUCA 1M3BA 1ACMB 1B3QA 2FEIA 3CMAT 2JOYA 4C8QD 2EJFA 2SRCA 5FW9A 2MYSA 1M27C 2NWMA 4PJOF 3QKJA 3JB9H 2RNAA 3S3NA 2F5TX 3M56A 2EYXA 3CCVT 3P8BB 2KY9A 1K9AA 2KQWA 4M7AF 4ESRA 5IAYA 3SDZA 3CCEQ 2M9UA 4M7AG 2RHXA 2LQNA 2ZPEB 4A54A 1ZSGA 4HXJA 5KYWB 3HL8A 5KYXA 2CYZB 2XG8D 2CH4W 1D1BA 1B07A 3JCMQ 2DVJA 4M77B 3CQTA 5CK9A 5L23A 1X2KA 4OGCA 1VQOQ 2NUPB 4XTUA 4A4FA 2HSEB 2F1LA 1IGQA 2MIOA 3VS5A 4IKFA 1Y07A 1JQQA 2FZKB 3E2UA 3CMAQ 1JJ2S 2KBTA 2EGCA 1NPPA 3CPFA 2RA2A 1Y7XA 5HK3A 4HVVA 1NG2A 4JS5A 4R55A 1ZUUA 2PUOB 3OYNA 2C0TA 2IVWA 3EH1A 1WXBA 3CCVQ 2KROA 2DTIA 3CCLA 3VU3C 2GFUA 2DO3A 2K6DA 3PTAA 1I81A 2J7IA 3CC2A 1T0HA 4PJOE 4PL6A 4C5EA 3EFOB 5GANh 1BCOA 3SWNB 1K8AR 3CCRA 1M4ZA 1OULA 1EZZB 1I07A 1RAHB 4ZGDB 4GLKA 4RMOA 1M3CA 2COZA 4F7UA 1AEYA 4C0ZA 3P8DA 1UE9A 2RHYA 1QQJA 3EG9B 2DL7A 4AG1C 1M3AA 2MF2A 2E4HA 1WQWA 4RTXA 1JO8A 5DY9A 3V8KA 2E41A 4E7IA
chains in the Genus database with same CATH topology
1V76A 1TS9A 1PC0A 1TSFA 2ZAEA 1OQKA 2KI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V76 A;  1TS9 A;  1PC0 A;  1TSF A;  2ZAE A;  1OQK A;  2KI7 A; 
#chains in the Genus database with same CATH topology
 1BI3 A;  2VB6 A;  3CXC S;  3H0H A;  1NYF A;  1N6A A;  4M77 G;  3HRT A;  2ABL A;  2YHT A;  1AWX A;  2BZY A;  2JW4 A;  4XK8 E;  2QAS A;  4C5I A;  1PM3 A;  5IXF A;  1NJI U;  2XIC A;  3QBY A;  1VQ9 T;  2CP6 A;  5EC7 A;  3JB9 I;  2K3B A;  1X43 A;  4MZP A;  2JTE A;  3A8L B;  1RAB B;  4KUI A;  2DM1 A;  1RAG B;  4X1V A;  3PGG A;  3JCM d;  4XQ3 A;  4PLL A;  2DX1 A;  1PNJ A;  3RER A;  3SHW A;  1EX4 A;  1ABQ A;  4M78 G;  3ZL7 C;  3MO8 A;  2EW3 A;  3RKY A;  1HD3 A;  3BDU A;  4FYV B;  4ORZ A;  4IUV A;  1W1F A;  4HCZ A;  1K73 U;  2KYB A;  5HCK A;  2DJZ A;  5LJ3 d;  5GMK i;  1QWF A;  2AK5 A;  3A8H B;  1OX9 A;  3JCM W;  1VQ8 T;  4OMO A;  4C92 F;  4IIM A;  4QVD A;  3L2Q A;  3NHN A;  1FXX A;  1JJ2 A;  2LT1 A;  3REA B;  2OTL T;  1Z9Z A;  2PQW A;  5D6W A;  3HPW A;  4CI0 C;  4LUD A;  4LD9 K;  1S72 T;  4HCK A;  2X51 A;  4JLI A;  2EQU A;  3I9Q A;  2RK2 A;  1VA7 A;  2QQR A;  3NFC A;  2YUQ A;  3MP1 A;  2V1Q A;  1BK2 A;  1WNL A;  3CBP A;  1M90 U;  5L8R E;  4A63 B;  4IIO A;  5GMK h;  2CP2 A;  1WJS A;  4BUG A;  4OMM A;  1VQ9 Q;  5FU6 B;  3VS6 A;  2ZAE A;  1SRL A;  1J3T A;  3FLG A;  2A36 A;  4FCY A;  2OAW A;  2J6O A;  2ZCF B;  2LMJ A;  1KD1 R;  4C0F A;  4J7F A;  3M0R A;  1GRI A;  3FIF A;  1YWO A;  2Z0W A;  1AHJ B;  4C0G A;  4HCB A;  2YDL A;  4PFO A;  3OYG A;  1MND A;  4L59 A;  2X35 A;  2VYT A;  1MGQ A;  5KCO A;  1PD1 A;  1VQP A;  4XTV A;  3NTI A;  1VQ8 Q;  3M0S A;  3CXC A;  2NLU A;  2R5M A;  2BZX A;  4KBM B;  3CCM T;  2COW A;  3VRY A;  3LH5 A;  2HCK A;  5EG2 A;  5IHK A;  4AFZ C;  2RI2 A;  2OTL Q;  2DZC A;  4X34 A;  4PFP A;  4RTT A;  3TQ7 P;  7AT1 B;  1FWZ A;  4XU1 A;  5CQY A;  4M75 E;  2MI6 A;  3RKX A;  3M58 A;  5GAM e;  3BDL A;  2LP5 A;  4M4Z A;  1X6G A;  1MV3 A;  1ZSZ C;  3GNF B;  1Y96 B;  4MML A;  3JCM c;  2HNI A;  3M54 A;  3REB B;  1KD1 C;  3V8L A;  2HQX A;  2DTH A;  5CKF A;  1YI2 A;  1FMW A;  1MMN A;  4HA8 A;  4ZGJ B;  3G6E A;  2XHC A;  2H8H A;  5KYW A;  2QEX T;  3RMS A;  1RAI B;  3VYG A;  1ZQ1 A;  5GAN f;  2NUT B;  5J3B A;  2EQM A;  1GCP A;  1SSF A;  3JCM J;  4M77 A;  4BI8 B;  5CKE A;  2O31 A;  1N8R U;  1I5L A;  3OYL A;  5AYF A;  2JM9 A;  3G4S A;  3PMI A;  3V8J A;  3I56 T;  4Z89 A;  3CCM Q;  2DER A;  5CO7 A;  4A53 A;  2AKK A;  1H8K A;  4QW2 A;  4NS5 A;  4C8Q F;  2Y4Y A;  2ATC B;  1Q86 R;  3FJ5 A;  2EQK A;  2RK1 A;  2EGE A;  4FSX A;  3MCA B;  1OU8 A;  1JB0 E;  1T3L A;  1B34 A;  1X6O A;  1M1K C;  1IGU A;  1B7T A;  1VQ4 T;  4JRP A;  3H41 A;  3EFO A;  1UTI A;  3SWN A;  2QEX Q;  3JAM E;  3JB9 D;  1WPY A;  3V7S A;  4JJN K;  3VJP A;  1UGQ B;  1U1S A;  1Y71 A;  5A2Q E;  4FW1 A;  4ANJ A;  4D8D A;  5DLQ E;  1QKW A;  1G5V A;  3HKS A;  3EG9 A;  4OMF B;  4J9B A;  1HYO A;  1P92 A;  2O9S A;  2K5L A;  1D1C A;  1BCM A;  4DBR A;  1XQH A;  1WHJ A;  3CC4 A;  2QTV A;  4JJB A;  2LT4 A;  1KHI A;  2XDB A;  2FHD A;  4M77 C;  1RAC B;  2QTX A;  3I56 Q;  3U23 A;  4RTZ A;  1VQ6 T;  1PHT A;  2DL8 A;  2J6K A;  1TS9 A;  3LGF A;  2ED1 A;  2LQK A;  1YIT T;  2YRV A;  5CKH A;  1YWP A;  3OY9 A;  1Q7Y U;  3CC7 A;  3E1S A;  4KRT A;  1BI0 A;  5DM7 R;  3EGD B;  3M0P A;  2IPO B;  4C8Q E;  4CRI A;  1XTD A;  1WXU A;  1ZBX A;  3RIR A;  4QVZ A;  5LJ3 e;  1KQS P;  1W70 A;  2QQS A;  2O88 A;  1VQ4 Q;  1YJ9 A;  1IRE B;  3ZBD A;  2XI9 A;  2LQ8 A;  1IXD A;  1SHF A;  2WSF E;  1VIF A;  3THK A;  1BI1 A;  2KNB B;  1WJQ A;  4JLG A;  3CME A;  4A4H A;  3Q1J A;  4E6R A;  3TSW A;  4JRK A;  4BI3 A;  1YJW T;  3L42 A;  3SWN C;  2E65 A;  1AZE A;  4V2S A;  3BE3 A;  4JZ3 A;  5CKB A;  1RAE B;  4QKU A;  3JCM b;  1VQ7 A;  1AZG B;  2KGT A;  2MPX C;  1NLP C;  2B86 A;  5IT9 E;  2DET A;  1R0B G;  4KGZ B;  1VQ6 Q;  1X2Q A;  1MV0 B;  2CH4 A;  4M7D G;  2OTJ T;  1BU1 A;  2JM8 A;  1YIT Q;  1Y0M A;  1WXT A;  1UDL A;  4E7L A;  4RUG A;  1XOV A;  3SEM A;  2CRE A;  1KG1 A;  5FWB A;  2ZPH B;  4ME7 A;  1HSQ A;  3J7A F;  2KR3 A;  3C4S A;  2V8K A;  3ULR B;  5ECA A;  1YCY A;  2KSS A;  4MMK A;  1W6X A;  4LXC A;  2EYZ A;  1PWT A;  3OMG A;  3QJY A;  3HRS A;  2RQV A;  3GNG A;  5LJ5 e;  3UPU A;  1YJW Q;  4CC4 B;  1ZSZ B;  2DL5 A;  3G71 T;  2ESW A;  2QQA A;  3E9G A;  1RUW A;  1UHC A;  2CDT A;  1WHK A;  2RJF A;  3MEW A;  3CCU A;  1AOJ A;  3EGU A;  4C5H A;  1Y96 A;  2KDS A;  1RI9 A;  4M7A B;  3HSB A;  4LE9 A;  2OTJ Q;  2ZZD A;  2AZV A;  2D1X A;  1RLQ C;  2M0O A;  1U8R A;  3VS1 A;  1MMD A;  4DBQ A;  4FSS A;  3JCM X;  4F7U F;  2BKD N;  2Y4X A;  2FB7 A;  2RI5 A;  2XD0 A;  1CSK A;  1VQK T;  5FU6 C;  3ZEH A;  4BI4 A;  2NUT A;  2L0A A;  3C95 A;  3JCM h;  3PMT A;  5IHI A;  1VQ5 T;  1G3S A;  2PNI A;  2K57 A;  2YT6 A;  1NJI R;  4FM4 B;  1EFN A;  3PIO A;  1GXI E;  2LQW A;  1YFN A;  5LJ3 h;  1WHH A;  3NTK A;  4RCC A;  2XID A;  1PKS A;  1E6H A;  2FPF A;  4J6Y A;  3H0F A;  1N27 A;  5FRO A;  4XTZ A;  1IHV A;  4DQ2 A;  2VUB A;  2DXU A;  3G71 Q;  4DOW A;  2CSQ A;  3NPF A;  3QWY A;  2CP5 A;  1K73 R;  2QAZ A;  2PTK A;  3VS2 A;  1Z9Q A;  4PJO G;  5FLX E;  3C12 A;  1E6G A;  2YUN A;  4CC2 A;  4O5V A;  4F17 A;  1RAD B;  1VQO A;  5GAM d;  3OS2 A;  4Y28 E;  5GAN 8;  2FZC B;  5HKC A;  4JJD A;  1K1Z A;  1D0X A;  4L6V 5;  3DB4 A;  3QWX X;  3CMA A;  1VQK Q;  4RTY A;  2QXF A;  4LDU A;  1YJN T;  3MET A;  3S6W A;  1VQL A;  3LGL A;  1UGS B;  1X6B A;  1NZ9 A;  2MCN A;  1PCX A;  1M90 R;  3CPW S;  1VQ5 Q;  3JCM g;  3CCV A;  3QDR B;  1PSE A;  4F7U E;  3CCQ A;  3S3M A;  5FU7 B;  4II1 A;  4AFS C;  2ENM A;  4PJM A;  2CT3 A;  3TRE A;  3LLR A;  2E3I A;  1UEC A;  2FPD A;  1PD0 A;  2RPN A;  3J80 E;  2GTO A;  5KYY B;  2LC4 A;  4OML A;  4M78 B;  4JRQ A;  3EFR A;  5LJ5 h;  3OA6 A;  3EGD A;  1K9M U;  2LCL A;  3X20 B;  3CC2 T;  2MWO A;  1B34 B;  2IG0 A;  2QDY B;  2JMC A;  4RG8 A;  1JJ2 P;  2DPP B;  2KMT A;  3GBQ A;  1OI1 A;  3LYI A;  1H3H A;  2LJ0 A;  3HFN A;  4C92 B;  5M9O A;  2VKN A;  3JB9 F;  2X3X D;  2B8A A;  1TG0 A;  1YJN Q;  3N5B B;  2F5K A;  2GTJ A;  2L3S A;  3L2R A;  4AMC A;  4N0A A;  2HEQ A;  4HT9 A;  2DIG A;  2I0N A;  4E7Z A;  3RR6 A;  4CC7 A;  2KAF A;  1C0M A;  3DKM A;  2XDD A;  2XMF A;  1HJD A;  1JU5 C;  2A0F B;  3UF4 A;  1RL2 A;  2J6F A;  2DAQ A;  2CT4 A;  1BI2 A;  1UHF A;  4FYX B;  3M57 A;  2YWW A;  2V26 A;  4JZ4 A;  3UT1 A;  4FL6 A;  2DIL A;  1GFD A;  3QUI A;  2HKQ B;  5J26 A;  1N8R R;  3JV3 A;  3MEU A;  2DF6 A;  2JN0 A;  3CXC P;  2DLP A;  2DE0 X;  2LRQ A;  1K8A C;  3CC2 Q;  1PRL C;  2K4Y A;  1YIJ A;  5CR2 A;  4PLI A;  3EHR A;  2AHJ B;  2RMO A;  3C0C A;  3CPW A;  2ZGW A;  2PVG B;  1QKX A;  3JCM f;  5GAN j;  4AFU C;  3RNJ A;  4MZT A;  4DA4 A;  1VQN T;  3MJX A;  4AT1 B;  1FYN A;  3HTR A;  5GAN g;  4M75 F;  4EPC A;  1NM7 A;  2EPD A;  1OX8 A;  5KYN A;  3OW2 A;  2BE7 D;  5C0M A;  4M75 G;  1WDX A;  4C92 G;  4ZTF A;  3G7Z A;  1OU9 A;  3NTH A;  4J9E A;  1ZSZ A;  4JUV A;  1C1A A;  3OBW A;  1YHQ A;  2X4Y A;  1V1C A;  2CZ0 B;  2O2O A;  4N0A C;  2YSQ A;  1UJ0 A;  1OQK A;  4QQ6 A;  3QZ9 B;  3MKD A;  3FJP A;  4OVA A;  1BB9 A;  2C0O A;  4M7A A;  2DEU A;  2RQR A;  4LUE A;  1FMK A;  3OQ5 A;  1SHG A;  1M30 A;  3QYH B;  3A1P A;  4R56 A;  5I11 A;  4OMP A;  2RJC A;  2OTL A;  3ME9 A;  3PIP A;  1PC0 A;  2BE9 B;  2L89 A;  2D8H A;  2K3X A;  2E5Q A;  1G3Y A;  1GFC A;  2LTO A;  1Q7Y R;  2KI7 A;  3TEE A;  4M77 E;  1VQN Q;  2EBP A;  2JXB A;  2P4T A;  2X4W A;  1IO6 A;  4XTY A;  4KUD K;  1G2B A;  2HAX A;  2BUD A;  1UGP B;  3I55 A;  1UFF A;  4J83 A;  2WSE E;  5KH6 A;  1KQ2 A;  5LJ5 d;  3SFM A;  2HSP A;  3RBB B;  3L2V A;  3CD6 A;  2CZ1 B;  1S72 Q;  3H9N A;  3TVT A;  4XU3 A;  5GAN 3;  3CEY A;  5GMK j;  1YI2 T;  5D6Y A;  4EDU A;  3DB3 A;  1TU0 B;  3G6E T;  2P84 A;  1G3W A;  2CP3 A;  4M7A C;  1IHW A;  2HMA A;  1Q7Y C;  3V7C A;  4J5Y A;  2HBW A;  4QQD A;  5J39 A;  5KYU B;  2E70 A;  2DL4 A;  3OYD A;  4YTL A;  4C0D B;  2AKL A;  3UWN A;  2GFA A;  1UB4 A;  2M51 A;  1ABO A;  4Y92 A;  4JS4 A;  4B6M A;  2HD0 A;  1KJW A;  3G4S T;  1VYU A;  1OPL A;  2MK5 A;  1H64 1;  2E5K A;  1Q95 G;  2L3Q A;  4ZN1 A;  4M7A D;  1SG5 A;  1M8M A;  2HKN A;  3OS5 A;  2CS7 A;  2KRS A;  1I4K 1;  1LNX A;  3OMC A;  4IUU A;  3VYH B;  1D0Z A;  1SSH A;  2QGF B;  2GQI A;  5KYY A;  4C8Q G;  1GCQ A;  3A8M B;  4B9X A;  4M78 A;  2NYS A;  2DNU A;  8AT1 B;  3CCJ A;  2DK3 A;  1GBQ A;  1YI2 Q;  1VUB A;  2RQT A;  2AIR B;  3G6E Q;  2EKH A;  5AT1 B;  3I56 A;  3URG A;  4C92 A;  3ER0 A;  2FG0 A;  2RQU A;  5CAI A;  2H3J A;  2DKG A;  3LWI A;  2L8D A;  1D09 B;  1Q81 U;  5FRN A;  4BB7 A;  4FIB A;  4E2F B;  3WVE B;  3G4S Q;  2E6Z A;  4J7I A;  2VGN A;  4FT2 A;  2J06 A;  4J6W A;  2KYM A;  1Q86 C;  5GAN 4;  4M7D B;  2D0N A;  3S3O A;  1QLY A;  1QVF S;  2O4X B;  1VQ4 A;  4PJL A;  2CP0 A;  2DRM A;  5FU7 C;  3H6Z A;  1K0S A;  2LNV A;  2VGM A;  1NYG A;  1ARK A;  2I2L A;  3FDR A;  2X4X A;  2VV5 A;  1V29 B;  1WI7 A;  2WSC E;  5IHN A;  3CBM A;  4LN2 A;  1R77 A;  2DL3 A;  1X69 A;  3JSC A;  1KC8 U;  1YJ9 T;  2EYY A;  1GCQ C;  3ZFJ A;  4M77 D;  4M78 C;  4ATO A;  2MMP A;  1AVZ C;  2VC8 A;  1ZA2 B;  4O6J A;  2DD4 A;  1KFZ A;  1M9S A;  4OF1 A;  3GPL A;  2HQH A;  3FRN A;  5GAM h;  4IUR A;  1LVK A;  4BD3 A;  2RHZ A;  1YIT A;  1UEB A;  4C92 C;  1FMV A;  1ZUK A;  1JBM A;  2DMO A;  2E64 A;  2RO0 A;  4M78 D;  2W10 A;  5GAO r;  4EMK B;  1GBR A;  2RN8 A;  2P0K A;  3M0Q A;  4AG2 C;  4KUL A;  4TVR A;  2F69 A;  2K9G A;  1KSW A;  2QK0 A;  2Y90 A;  3QII A;  2BZ8 A;  2KXC A;  4A4G A;  2O01 E;  3EHQ A;  3ASK A;  2HQE A;  4MDW A;  1YJW A;  3OYJ A;  2YXY A;  1NEB A;  5IN1 A;  1BIA A;  1ZLM A;  1YJ9 Q;  5HK0 A;  1QVG S;  4HKE A;  4F16 A;  3CCS T;  2A7Y A;  2RD1 A;  2GQV A;  2ZPB B;  1M1K U;  3AHU A;  1R0C B;  2ZPI B;  1C6V X;  4PNO A;  5GAM j;  3QXE B;  4NOY A;  3X24 B;  1AWJ A;  4ZNX A;  1QVP A;  1WYX A;  1D0Y A;  4FT4 A;  2GCX A;  3GF5 A;  4E7K A;  2LVM A;  2K5I A;  5GAM g;  1OV3 A;  3KBG A;  4C5G A;  2RM4 A;  3MP8 A;  3JCM P;  2G3R A;  1QVF A;  4OMQ A;  2J05 A;  1K9M R;  2CZ6 B;  1DJ7 B;  4JJC A;  2MWP A;  3IQL A;  2OX7 A;  3CCU T;  2E3H A;  2OI3 A;  4PJO B;  2AZS A;  2L2P A;  2PVD B;  2YLB A;  1Q82 U;  5A0G A;  1QP3 A;  2CSI A;  3HHT B;  3HRU A;  1W2B S;  3H0I A;  3OYK A;  2DIQ A;  4D8K A;  1BIB A;  1ZBJ A;  1D3B B;  5C6S A;  2EJG A;  2XK0 A;  1VQM T;  3R6N A;  2HL3 A;  4PKC C;  5CVI A;  3JCM V;  1LJO A;  3P8H A;  3PVL A;  1WQ7 A;  4WCI A;  1UJY A;  5KE3 A;  5KYU A;  3EGX B;  2DFU A;  5IXB A;  1LCK A;  4J6X A;  2C06 A;  4F7U G;  3CCS Q;  1JXO A;  2JVV A;  3G71 A;  4BE0 A;  1K9M C;  2P0P A;  4J9C A;  2QA4 T;  3QSU A;  2FO0 A;  5FWC A;  4OB0 B;  1M2V B;  4X9C A;  3TCJ A;  2GNC A;  5CCA A;  3JB9 J;  5D6X A;  2LX9 A;  3H8Z A;  4GLM A;  4M7D E;  1PG5 B;  2DXT A;  1M1G A;  2EVR A;  4DEY A;  4XAX B;  1TUG B;  3CCE A;  1GL5 A;  4NL2 A;  3GLX A;  3CCU Q;  2RQW A;  3SD4 A;  1VQK A;  3OYM A;  1QW1 A;  4ELZ C;  3FEO A;  2YRD A;  1LPL A;  4IUT A;  4N4G A;  2KXD A;  1JXM A;  1UGV A;  1QVG A;  1KK7 A;  4F04 B;  4WF2 A;  4BY6 B;  1VQM Q;  5IH2 A;  1KIK A;  2MOX A;  4JDS A;  2CGH A;  3M59 A;  4OB2 B;  2M02 A;  4KH0 B;  1VQL T;  2DBK A;  3BY7 A;  2K5F A;  3VS0 A;  1NJI C;  3M5A A;  3E9F A;  2JUF A;  2RI3 A;  3VS4 A;  2JS0 A;  5GAM f;  3KUF A;  1MMG A;  2BTT A;  2P4R A;  3OYC A;  2QA4 Q;  3CCQ T;  2YRC A;  4KT0 E;  4OP0 A;  1WHM A;  1AWO A;  3MPU B;  1IB8 A;  4M7D A;  2JMA A;  4C0D C;  5LJ3 j;  2EKO A;  3A8G B;  5CQX A;  4CC3 A;  1W2B A;  3M4G A;  4EMG A;  3L1A A;  4LD6 A;  1OPK A;  2O4X A;  1K73 C;  2L3P A;  2OJ2 A;  1M2O A;  1OZ3 A;  3OW2 S;  2EIF A;  5GAO m;  2QI2 A;  4DEX A;  5GAN 6;  1XNI A;  5LJ3 g;  1VIE A;  2DA9 A;  2LX7 A;  3MEV A;  3CPW P;  2C0I A;  1YJN A;  1FX7 A;  3RUX A;  1TSF A;  3CCL T;  3I35 A;  5GMK e;  2R5A A;  2P0Q A;  4GBQ A;  2E6N A;  2ED0 A;  3JRZ A;  4OB3 B;  2PUK B;  1SPK A;  1MNE A;  3OW2 P;  3PFS A;  2LZ6 B;  2O9V A;  4QQG A;  1G3T A;  2CUB A;  1QP2 A;  2KT8 A;  3EG1 A;  3GIB A;  1YCS B;  3CCR T;  1M90 C;  4ZTJ A;  1D1A A;  1WA7 A;  1VQL Q;  4M75 B;  3M0T A;  4BE1 A;  2YLC A;  4ZGE B;  2KRM A;  3VS3 A;  4FU6 A;  2RH2 A;  3OSV A;  3JB9 G;  3VKI A;  3OB9 A;  2BIV A;  3CCQ Q;  1WHG A;  1TOV A;  5I22 A;  2KK4 A;  5GMK m;  4Q5W A;  4EMK A;  1JRI A;  5CIU A;  1K76 A;  1WLP B;  1WGS A;  3X28 B;  4XU2 A;  2QG9 B;  1QWE A;  4LNP A;  4Z88 A;  2L5Q A;  1I5O B;  2V1R A;  1O9S A;  4M7D C;  2D6F A;  3QJ6 A;  4WTO B;  1AD5 A;  1N9R A;  2X9H A;  5A0L A;  4M7A E;  1SEM A;  2IIM A;  2OAU A;  5LJ5 j;  2X3W D;  2DTO A;  4NL3 A;  3NGP A;  3CCL Q;  1YP5 A;  2EGA A;  4PJN A;  3BW1 A;  1F1B B;  1IRX A;  1YIJ T;  2M0Y A;  2E12 A;  3VUZ A;  4M77 F;  4HVU A;  5I2M A;  5LJ5 g;  2LCS A;  2JT4 A;  4M7D D;  1H92 A;  4E47 A;  1RI0 A;  3CCR Q;  5LL6 S;  2DYB A;  4R0K A;  3DLL A;  2HL5 C;  4A4K A;  1E7O A;  2CZ7 B;  3MP6 A;  1MMA A;  3RDV A;  1AWW A;  1YN8 A;  1G8X A;  3PVQ A;  4BE2 A;  1VQ9 A;  4M78 F;  1RLP C;  2KRN A;  1YHQ T;  4X9D A;  3I5R A;  4B9W A;  2FYK A;  3OYE A;  1HXD A;  5LJ3 f;  1N5Z A;  1U1T A;  4PJO A;  4IUQ A;  1RAA B;  1X27 A;  2EYW A;  3HFO A;  3V7R A;  2DXB A;  2F2X A;  1N8R C;  1D3B A;  4EMK C;  2VAS A;  2L3R A;  3MEA A;  4XU0 A;  2EJ9 A;  5GAO n;  1Q81 R;  1VQN A;  3D7S B;  4UC4 A;  1VQ8 A;  2QDL A;  3OYH A;  2FPE A;  2V8J A;  3PE0 A;  5GJW B;  1YIJ Q;  3CBO A;  3EGX A;  2D9T A;  4J9D A;  5GAN 7;  3M55 A;  2JZ2 A;  5I2S A;  4P5N A;  4PJJ A;  1ZA1 B;  2K2M A;  1S72 A;  2K79 A;  2QGG A;  2A28 A;  2XKO C;  4VUB A;  1VQP T;  1M2V A;  2QYZ A;  2AT1 B;  4XTX A;  4LDW A;  3VV0 A;  1UGR B;  2HZY A;  6AT1 B;  3VS7 A;  3L2W A;  3I55 T;  3M9Q A;  4C8Q B;  1NBE B;  2RB6 A;  1YHQ Q;  1KC8 R;  1JEG A;  3CD6 T;  1Q81 C;  2COY A;  1BBZ A;  2RF0 A;  2G6F X;  2R58 A;  3OS1 A;  3FB9 A;  3QPH A;  2K2V A;  5KE2 A;  4PJO C;  4M78 E;  4J9H A;  2ROT A;  4KH1 B;  5LJ5 f;  2V8I A;  3X26 B;  9ATC B;  3QZ5 B;  2JJ9 A;  2NUZ A;  1M8V A;  1MHN A;  3UAT A;  4N4I A;  4DOV A;  3CCM A;  4BDZ A;  1Y57 A;  4JRI A;  1K8A U;  2DZ9 A;  2PVO B;  2LCC A;  4C92 E;  1BKB A;  2A08 A;  1BYM A;  3G1J A;  3UDC A;  4PJO D;  4J9I A;  3EG2 A;  1KC8 C;  2LDM A;  2EAY A;  1VQP Q;  2JTM A;  1UG1 A;  2GGR A;  3M0U A;  3E19 A;  4MZM A;  2QQ9 A;  5D7U A;  2YUP A;  5GAN d;  1ZX6 A;  2A37 A;  4KGX B;  4RTV A;  3I55 Q;  4LDX A;  5DLO A;  5HY6 A;  1A0N B;  4FYY B;  3FC3 A;  3BFM A;  3CD6 Q;  1M1K R;  3M53 A;  2QEX A;  3J81 E;  1O75 A;  2WAC A;  3VRZ A;  2SEM A;  3CCJ T;  4EMH A;  2NUP A;  5GJV B;  2DJQ A;  1U06 A;  2RHU A;  1WJR A;  4N4H A;  1AT1 B;  2GBQ A;  1X75 C;  4J9F A;  1HK9 A;  1TXQ A;  2E10 A;  4D6W A;  2H3E B;  4ZN3 A;  4M75 A;  1EIF A;  2FRW A;  4L5G A;  4BY6 C;  1Q82 R;  1W4S A;  4ELY C;  1RAF B;  5A0D A;  3TU4 K;  3VUB A;  2FZG B;  4LDV A;  1XJW B;  1H3Z A;  3RES A;  3C94 A;  3DLM A;  1M5Q 1;  1U5S A;  3CC4 T;  3SB2 A;  1T0J A;  1WX6 A;  5GAN 2;  3OYY A;  2XU8 A;  3QDF A;  4JPB W;  4RTU A;  1SF9 A;  1PKT A;  3UA6 A;  4OGE A;  2LNH B;  1X01 A;  2GF7 A;  2HBP A;  3AT1 B;  3CC7 T;  2DBM A;  5KYX B;  4BDY A;  3LH0 A;  2DVE A;  2FRY A;  3CCJ Q;  3HP9 A;  4Y91 A;  1QCF A;  2M16 A;  4E7S A;  1KQ1 A;  2DEQ A;  3WXM B;  1I1J A;  4LDY A;  4OB1 B;  1Q82 C;  5I21 A;  1QVF P;  8ATC B;  1KD1 U;  4RTW A;  1OOT A;  2JNG A;  4DBH A;  3X25 B;  2R57 A;  3CME T;  1ZHI A;  5FRM A;  2XDP A;  1KQS S;  3EH2 A;  2MAM A;  2VWF A;  3JCM e;  3L2U A;  1VQ6 A;  1V76 A;  5GAO p;  3EFS A;  4XTW A;  3LWH A;  2D0Q B;  1R8O B;  2FL7 A;  3OBY A;  1CKA A;  4E7H A;  1VYT A;  1I8F A;  2KT1 A;  2KVQ G;  1TH7 A;  4M75 C;  4RCB A;  2LJ1 A;  4EIK A;  1VQ7 T;  3CC4 Q;  1T3S A;  4K11 A;  2DRK A;  2LJ3 A;  1KHC A;  1WFW A;  3WVD B;  4Z8A A;  4QVC A;  4GY5 A;  2E1H A;  2ZPG B;  2D8J A;  1UUE A;  2CKK A;  1QMC A;  3PNW C;  3MHX A;  3CC7 Q;  1QCN A;  1S1N A;  1M1F A;  4M75 D;  5CKD A;  5GAN 5;  4C92 D;  3QHS A;  4HCC A;  5KCH A;  1WHL A;  3L2Z A;  4RG2 A;  4F7U B;  1VOM A;  1CKB A;  1PSF A;  1YNZ A;  4FYW B;  3A8O B;  2CUD A;  2F2W A;  4F14 A;  4RKU E;  2CP7 A;  2YUO A;  1IZ6 A;  3M4Y A;  5GAO q;  4M7D F;  2ROL A;  3GOX A;  3R6O A;  2EQJ A;  2JS2 A;  2PU9 B;  3TSZ A;  3CME Q;  4J9G A;  3A5Z B;  4OMN A;  1OYX A;  4KGV B;  2EWN A;  1SKU B;  1OEB A;  2KE9 A;  2OTJ A;  2FVU A;  3O8V A;  4C8Q A;  4E7J A;  2ECZ A;  2KEA A;  2VXF A;  2VXE A;  3LW5 E;  1QVG P;  5GAO l;  1TWB A;  3OYI A;  1VQ7 Q;  1WIE A;  4HVW A;  1Q86 U;  2HDA A;  1TTH B;  3CCS A;  3O5Z A;  3OYF A;  2RJE A;  2K3Y A;  2A3L A;  1QCO A;  3KFV A;  1G83 A;  3NMZ C;  4FW2 A;  2RJD A;  4J8O A;  2JTF A;  1NPR A;  3LX7 A;  1KQS A;  1K4U S;  3A98 A;  4PK4 A;  3RMQ A;  2W0Z A;  3PT9 A;  1NE8 A;  2X4J A;  3T9N A;  1WZO A;  3QG1 A;  2F2V A;  4DBF A;  1W2B P;  3EG3 A;  3UA7 A;  4BAC A;  1MUZ A;  3EAE A;  3OS0 A;  3GP8 A;  1LOJ A;  1VYV A;  1NLO C;  4HT8 A;  3F70 A;  2ZPF B;  3OSS C;  2PZ1 A;  5GAN e;  4IUP A;  1I0C A;  2EQI A;  4A4E A;  5GMK l;  2DYI A;  1SRM A;  1PRM C;  2DD5 A;  3INZ A;  1ZUY A;  3RKW A;  4AFQ C;  3CCE T;  1U3O A;  2M1H A;  1VQM A;  3QO3 A;  1N9S A;  4QT7 A;  2DXC A;  2EFI A;  2RHI A;  2EYQ A;  4C8Q C;  3OYA A;  1OZ2 A;  1K0X A;  4PFZ A;  4Z02 A;  2QA4 A;  3I5S A;  1YBY A;  1TUD A;  4MDX A;  3KXT A;  1VQO T;  3OYB A;  1VQ5 A;  2K7A A;  3QYG B;  3EG0 A;  1NEG A;  2QQB A;  2VVK A;  1TUC A;  1M3B A;  1ACM B;  1B3Q A;  2FEI A;  3CMA T;  2JOY A;  4C8Q D;  2EJF A;  2SRC A;  5FW9 A;  2MYS A;  1M27 C;  2NWM A;  4PJO F;  3QKJ A;  3JB9 H;  2RNA A;  3S3N A;  2F5T X;  3M56 A;  2EYX A;  3CCV T;  3P8B B;  2KY9 A;  1K9A A;  2KQW A;  4M7A F;  4ESR A;  5IAY A;  3SDZ A;  3CCE Q;  2M9U A;  4M7A G;  2RHX A;  2LQN A;  2ZPE B;  4A54 A;  1ZSG A;  4HXJ A;  5KYW B;  3HL8 A;  5KYX A;  2CYZ B;  2XG8 D;  2CH4 W;  1D1B A;  1B07 A;  3JCM Q;  2DVJ A;  4M77 B;  3CQT A;  5CK9 A;  5L23 A;  1X2K A;  4OGC A;  1VQO Q;  2NUP B;  4XTU A;  4A4F A;  2HSE B;  2F1L A;  1IGQ A;  2MIO A;  3VS5 A;  4IKF A;  1Y07 A;  1JQQ A;  2FZK B;  3E2U A;  3CMA Q;  1JJ2 S;  2KBT A;  2EGC A;  1NPP A;  3CPF A;  2RA2 A;  1Y7X A;  5HK3 A;  4HVV A;  1NG2 A;  4JS5 A;  4R55 A;  1ZUU A;  2PUO B;  3OYN A;  2C0T A;  2IVW A;  3EH1 A;  1WXB A;  3CCV Q;  2KRO A;  2DTI A;  3CCL A;  3VU3 C;  2GFU A;  2DO3 A;  2K6D A;  3PTA A;  1I81 A;  2J7I A;  3CC2 A;  1T0H A;  4PJO E;  4PL6 A;  4C5E A;  3EFO B;  5GAN h;  1BCO A;  3SWN B;  1K8A R;  3CCR A;  1M4Z A;  1OUL A;  1EZZ B;  1I07 A;  1RAH B;  4ZGD B;  4GLK A;  4RMO A;  1M3C A;  2COZ A;  4F7U A;  1AEY A;  4C0Z A;  3P8D A;  1UE9 A;  2RHY A;  1QQJ A;  3EG9 B;  2DL7 A;  4AG1 C;  1M3A A;  2MF2 A;  2E4H A;  1WQW A;  4RTX A;  1JO8 A;  5DY9 A;  3V8K A;  2E41 A;  4E7I A; 
#chains in the Genus database with same CATH homology
 1V76 A;  1TS9 A;  1PC0 A;  1TSF A;  2ZAE A;  1OQK A;  2KI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...