1TS9A

Crystal structure of the archaeal homolog of human rnase p protein rpp29 from archaeoglobus fulgidus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
LQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGDLINFRPEDRIKRGLMMLKRAKGVWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Crystal structure of archaeal ribonuclease P protein aRpp29 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1ts9A00
1TSFA 1OQKA 2KI7A 1V76A 1TS9A 2ZAEA 1PC0A
chains in the Genus database with same CATH superfamily
1BBZA 1Q81R 2L3RA 2OJ2A 1K73R 2YRVA 2CYZB 1RAGB 2FRYA 3TCJA 1KQSS 1M9SA 1GBQA 2KSSA 2EYWA 2ZCFB 5D7UA 1V1CA 1M1GA 1I81A 4ZGJB 1QKXA 4UC4A 2D6FA 2L8DA 2XD0A 3HSBA 3R6NA 3V8LA 1KQ2A 3CD6T 2X4WA 1RAEB 5CVIA 5KCOA 2ZPFB 3EG9A 3FIFA 1VQ8T 4FW1A 2I2LA 2MWOA 1RUWA 2VASA 1G3SA 2VVKA 1UHCA 3VRYA 3CC7A 4A4EA 2F2XA 1WXUA 3M5AA 1PG5B 2IIMA 3CBOA 3I55T 5FRNA 4C0ZA 4Z02A 3CMAA 3BFMA 2ZPHB 4ZN3A 3CCRT 2QQRA 2ECZA 2HBWA 1ZBXA 1ZSZB 3CCVT 2XICA 2RHIA 2NLUA 1U3OA 1RI0A 2GTOA 4OMOA 1QCFA 1YP5A 3M56A 1X01A 3TVTA 1Y96A 1PKTA 2E10A 4JJDA 1YCYA 4KH1B 3M53A 3GNGA 2RHZA 1R77A 5LJ5j 2QQ9A 3CCSA 1M3BA 3SWNB 1QP2A 2FEIA 1F1BB 1NG2A 4M78C 1K76A 2HCKA 3C0CA 3CCSQ 3OMGA 3MCAB 3EFSA 4MDXA 3JCMe 2YSQA 2F5TX 1JJ2A 1M2VA 2QA4A 5ECAA 2E41A 3I35A 5CK9A 1WJQA 2DVJA 2KDSA 2QA4Q 2NUPB 1YIJT 2K7AA 4EMHA 2DD5A 2DXTA 2WSFE 5A0GA 2F2VA 4OMQA 2PVDB 3TQ7P 2YUNA 1TS9A 2V26A 3PVLA 4F17A 2DD4A 1FMKA 1JQQA 3RMQA 3V7RA 3OYCA 4X9CA 3UA7A 2JS2A 4DEXA 5FWCA 2VXEA 3VUZA 1I5LA 2KYMA 3KXTA 4C5HA 3CCRA 4M75G 2ZPGB 4OMNA 1U5SA 3VU3C 5GAMg 3QHSA 3CCVA 3MP8A 3RNJA 2NUTB 3A5ZB 1NJIC 4HXJA 1YITA 1WHKA 3CXCS 4GLMA 1AWWA 1QQJA 2FZCB 1VQNA 5FU6B 1MMAA 3G6ET 4E7LA 1YITQ 1IHWA 2OAUA 2D0NA 1WHLA 3E2UA 2YRDA 3UT1A 3LLRA 3JCMd 4KBMB 1VQNQ 1GXIE 3M0UA 1B3QA 3M0PA 2H8HA 4M75D 4BE2A 2CP5A 5A2QE 3L2ZA 2RJEA 2QTXA 2DBKA 4C8QA 3H6ZA 2HSEB 3E1SA 1R0CB 4LUEA 2M9UA 4HKEA 1WA7A 4NL3A 4KULA 1YJ9A 1S72T 4C92B 4EIKA 1WJSA 1NYGA 4QVCA 2AZSA 4GY5A 2CREA 1YJ9Q 1O9SA 1M30A 5CKFA 4OB2B 3SHWA 2DTOA 1M1FA 3ZBDA 4BD3A 1Y96B 2AKKA 1PCXA 4PJLA 1ZHIA 4XTZA 2DTHA 4PJMA 4HA8A 1OZ3A 1VYVA 2KQWA 2MYSA 4QQGA 4CC3A 1YHQQ 3RERA 1PWTA 3VS7A 2DJZA 2CT4A 2GGRA 4XQ3A 3J7AF 2RQVA 1FMWA 1N27A 1VUBA 3HKSA 3GIBA 4JRKA 3M58A 1OOTA 3L2QA 3ZFJA 2YUPA 3H9NA 2KRSA 4PFOA 2E70A 4Z8AA 3JB9G 2QK0A 3QSUA 4E7KA 3TU4K 4C8QD 5HK3A 2EVRA 3VS5A 5CO7A 2DKGA 1N8RC 1M2VB 5GAN2 4JJNK 1PSFA 1N5ZA 4QVZA 1QWEA 1UDLA 1AZEA 3P8HA 2V1QA 3OYDA 1WPYA 1VIEA 2KROA 2FVUA 2QEXQ 1OULA 5D6YA 3I9QA 1QP3A 4KGZB 5IXBA 2EYZA 4MZPA 4N0AC 2WSEE 3JB9D 1FMVA 3BDLA 3M4YA 3CC4T 3QO3A 4M75F 1WYXA 4EDUA 5GANg 1BCMA 2PUKB 3LGLA 3OYAA 4HCZA 2OTJA 2VV5A 4AFUC 5KYWB 4HVWA 3Q1JA 3BW1A 1U06A 2AIRB 2L89A 1IHVA 1YJWT 2OTJQ 3I56A 2BKDN 3OYLA 1NJIR 3FDRA 4B6MA 1M8MA 3CXCP 1H641 3I56Q 2DM1A 3VS1A 4JJCA 3A8HB 2PNIA 3EH2A 3A8LB 1E6GA 1PSEA 4E7ZA 1VQPQ 3QWYA 3VV0A 5LJ3j 4X9DA 4M7DA 4XTVA 2V1RA 3WVEB 3DB4A 3URGA 2H3JA 3PIOA 1JU5C 2K6DA 1XQHA 3HFNA 3JCMb 3CCEA 1Q7YU 1NJIU 4ZN1A 4C8QB 1K8AC 5D6XA 2VGMA 4EMKA 2OTLT 1T3LA 1VYTA 2ABLA 3P8BB 1Q86C 3CCEQ 1VQ6T 2KY9A 1VQMA 2J06A 4M77A 2RMOA 2CP2A 1UB4A 2EAYA 4JPBW 2JW4A 9ATCB 3GBQA 4M7DG 5LJ5h 2ZPIB 4C8QF 4FT2A 1KIKA 3LGFA 3CCUA 2DBMA 2V8KA 4FL6A 3CCJT 2DZCA 2KAFA 2A28A 2KXCA 4FYYB 2KXDA 2XK0A 1PD0A 2RNAA 5HCKA 1JXOA 2L3QA 2QAZA 4EMGA 1QVFP 5KYNA 1BK2A 2L2PA 4PFPA 2RQRA 3OYFA 3QZ9B 4M77G 4R56A 4AFZC 4JRPA 4BDYA 2VYTA 3JB9F 2MWPA 2XDDA 1EIFA 1NLOC 3OS2A 1SKUB 4M7DD 1YI2Q 1BIAA 3A1PA 4N4GA 4FSXA 1RLPC 3QZ5B 1KSWA 2RPNA 3CMET 1D1CA 1NLPC 2LQ8A 1PC0A 2DL4A 1AZGB 1U1TA 1OV3A 3OYBA 1N8RR 2DLPA 1Y07A 3ME9A 4A54A 2M1HA 4DBRA 4RTTA 4E6RA 1K9MC 4J9BA 4M77D 1W2BP 4RTVA 1IGQA 1EZZB 2RK1A 4C0DC 4CRIA 3EGXA 1YN8A 2GTJA 2YUOA 5KE3A 2GFUA 3F70A 2EJFA 1NE8A 2LNHB 2ESWA 3SD4A 5LJ5e 2COWA 3EHQA 3H0IA 1N8RU 1QWFA 2K4YA 3A8MB 3RMSA 4FU6A 3L1AA 1ZA2B 1E6HA 5IT9E 4M4ZA 2HAXA 2A7YA 1KC8C 4PJOA 2BTTA 2DL5A 4J9FA 5FROA 4XTUA 2BIVA 1VQOA 1QVGA 2FPEA 2Z0WA 1VQKT 1KJWA 4IUUA 1WFWA 4HVUA 3V8JA 4KRTA 1VQOQ 3OS1A 3QG1A 2CH4W 4WCIA 2C06A 4DBFA 3S3MA 4O5VA 3THKA 2R5MA 1QLYA 3MEUA 3REBB 1TTHB 2EBPA 3CQTA 3EFOB 3JCMW 1OZ2A 1RABB 1VYUA 1SPKA 2EQJA 2JM9A 5IXFA 4J9IA 1VQLQ 5CKBA 4Y28E 3OW2P 1KFZA 1ZSZC 1WHGA 3ZL7C 3VS3A 3GPLA 3OBYA 4J6WA 3LWIA 4EMKB 1D09B 1K8AR 3CMEA 4BE0A 2EYYA 4ELZC 2HQHA 1PD1A 2E5QA 1ABOA 2BZXA 2JT4A 4M7DF 1Q86R 1V76A 1KG1A 4DQ2A 5LJ5d 2EGAA 3G4SA 4LXCA 2DPPB 4LD6A 1WXTA 4PJOD 2E4HA 4BY6C 5J39A 2ROLA 3J81E 5C6SA 1K8AU 3CC7T 2K2VA 3G4SQ 1KD1U 1DJ7B 4FYXB 4XTYA 4M77F 5KCHA 2BZYA 2GF7A 4PJNA 3CMAT 2JN0A 1TUDA 2LCSA 1Q86U 2XU8A 2K5LA 3JCMP 2BUDA 3GP8A 4HT9A 1LJOA 2K5IA 3OYEA 2SEMA 3I5RA 3X26B 2CGHA 2JJ9A 3JCMJ 1MMGA 4RCCA 3NTHA 4BI4A 3VKIA 2ZPEB 3OS0A 1ZUKA 5LJ5f 1RAHB 2K3BA 3FB9A 4CC2A 2LJ3A 2LQNA 4OP0A 4D8DA 3CCST 1QCOA 3OA6A 3H0HA 4L6V5 2DXBA 1T3SA 3GNFB 5KYYB 2NUTA 1AWJA 3JCMV 3QDFA 1RLQC 8AT1B 1K9MR 2EFIA 4F7UA 2A36A 3EGXB 1YBYA 2E12A 1NEGA 4IKFA 4M78E 2LQKA 5GAN3 2QA4T 2LCLA 3HL8A 1NZ9A 2KNBB 3M59A 2YDLA 1NBEB 2K9GA 1I07A 5CKDA 1Q81U 2CSIA 1ZQ1A 1K0SA 1I8FA 2PVGB 2D1XA 1K9MU 1K73U 4ATOA 2JTFA 3GF5A 2DXCA 4F7UG 4PJOB 1X75C 5LJ3h 1KC8R 4IUPA 1FYNA 4DOVA 3RKWA 4PNOA 5GMKm 2HMAA 3NHNA 3NTKA 2HEQA 3HRSA 3A8GB 3DB3A 5GAOr 3VS4A 1G3TA 4XU3A 2RQWA 2XDPA 4C92A 1JJ2P 1JO8A 4A4KA 2EGCA 4PJOF 1K9AA 1T0JA 4RTZA 4FT4A 4LDVA 3J80E 3SEMA 1O75A 4RTXA 1MV3A 2X4JA 2KT8A 4M7AA 4MMKA 1IGUA 3E9GA 2JOYA 2GBQA 3CPWA 3M0SA 1YITT 1SEMA 3OYKA 1VQNT 2E3IA 1EFNA 2H3EB 2LVMA 1MNEA 4C92G 1XTDA 1WHMA 4JDSA 3M0RA 4F14A 2HL5C 8ATCB 2O31A 4C0GA 1HJDA 1BI3A 2X9HA 2FYKA 4II1A 1G3WA 5GJWB 2JMCA 2AKLA 3JCMX 1HSQA 1X27A 5GAN7 2DJQA 1K4US 2K5FA 3C12A 1YJ9T 5LJ3e 1VQ4A 7AT1B 1H8KA 1H3ZA 4BB7A 4C92D 2RN8A 1PRLC 1VQ4Q 4IIMA 2NWMA 3REAB 1OU9A 5GMKl 4M75C 4M7AD 3ER0A 4HT8A 2RHUA 5CKHA 4E7JA 1ZX6A 4XTXA 2EJGA 4RUGA 4J6XA 2KK4A 5CQYA 5DY9A 5KYWA 4D6WA 1UE9A 3QUIA 3DLLA 2VXFA 3OYIA 2ZGWA 2KMTA 2DL8A 4F7UB 1NM7A 1X6GA 2K57A 3QPHA 2E3HA 1G83A 4XAXB 2C0OA 4OMPA 1M3AA 1JB0E 2HD0A 3I55Q 3MHXA 4KT0E 4L5GA 2O2OA 1Y57A 5GAMj 2QEXT 4EPCA 1AOJA 1TUGB 3VRZA 1OU8A 3WXMB 4OMLA 3JB9J 3MEVA 4B9WA 4F7UF 1D1BA 2KBTA 1CKAA 2DF6A 2RH2A 1W4SA 3META 1N6AA 2K3YA 1WQ7A 1NEBA 3M0QA 2JXBA 2OI3A 5LJ3d 3HFOA 1UJYA 1M3CA 1NPPA 5CAIA 5IHIA 4XK8E 1YJNA 3A98A 3CPFA 2O9VA 1UHFA 2B86A 1YJNQ 4A4FA 2L3PA 2OTJT 4E7SA 3CCMA 4PL6A 5KE2A 3L2WA 2JVVA 3VJPA 1VA7A 4MZMA 1WNLA 1TSFA 4M7AB 4C5EA 2JTEA 4C8QG 1YHQA 2Y4XA 3I56T 3CCMQ 5GANf 2DZ9A 1QVFS 2DRKA 4E7HA 4C92F 2EW3A 3EAEA 1GFCA 1GRIA 3V7CA 1B7TA 5LJ3f 4M7AF 2RI3A 2CZ7B 4A63B 3MEAA 1M8VA 1GBRA 1SHGA 1KQSA 5D6WA 1WHJA 1IREB 2V8JA 3CCET 4FIBA 2RD1A 3R6OA 2X4YA 3PNWC 2DXUA 4OGEA 1VQ5A 3MO8A 3C4SA 4M78B 4XU0A 5CKEA 1VQMT 4VUBA 2W0ZA 2HL3A 2QEXA 1VQ5Q 3PTAA 4DEYA 2GFAA 5GAN5 4ZGEB 1W2BS 5FW9A 1BB9A 3H8ZA 5EG2A 3CCUT 2AZVA 2DFUA 4NL2A 4A4HA 1BYMA 4J7IA 2HNIA 3CC2Q 2KEAA 1G5VA 1R8OB 2VC8A 4LDUA 3G6EQ 2QYZA 4N0AA 1TXQA 3RESA 4HCKA 3HPWA 4LDWA 1R0BG 2KRNA 5FU7C 4OMFB 4PFZA 2FZGB 2QGFB 3N5BB 2D8JA 2VUBA 4OGCA 4KGXB 4ESRA 1GCQA 3JCMg 1VQPA 3MPUB 3NPFA 5GANj 2ED1A 1IRXA 1D3BB 4ZTJA 2FZKB 1IB8A 1RAAB 1X2KA 2QQSA 4QW2A 2ZAEA 1M2OA 1OX8A 3EFOA 2X3WD 3JB9H 3OW2S 2KGTA 3V8KA 4HVVA 3O8VA 2FB7A 2WSCE 3L42A 2ATCB 2DYIA 2E1HA 4WTOB 1B34A 4M7DC 5GMKj 3AHUA 3HHTB 1BI0A 2P4RA 4HCBA 2DA9A 1ZUYA 1G2BA 1UFFA 1VQ9A 3G71A 4LD9K 3FJPA 3D7SB 1SSFA 1VQ9Q 2MMPA 3G71Q 1VQOT 2RJDA 4M77C 3PMTA 4PJJA 4GLKA 1PKSA 2V8IA 2EGEA 5AT1B 1AD5A 1UTIA 1M5Q1 4LDYA 4MDWA 4J9HA 2FHDA 2M0OA 5IHKA 5GJVB 1GL5A 3OYGA 3LW5E 1GCPA 1VQLT 3ASKA 3EH1A 3ZEHA 3G1JA 1E7OA 1YI2A 4ZTFA 3VS2A 5L23A 1CSKA 4QT7A 1SG5A 2F5KA 1MHNA 2F2WA 2VB6A 2O88A 1QVGP 4IUVA 1KQ1A 5GMKi 5HY6A 4J5YA 1Z9ZA 3BY7A 1X6OA 3JV3A 2XI9A 1WHHA 5AYFA 2IVWA 3HP9A 2XKOC 1D0XA 5I22A 1HYOA 2A0FB 1I0CA 1RACB 3QWXX 3EGDA 4J9DA 5KYYA 5CCAA 3G4ST 3TSWA 2E5KA 1YJWQ 1JXMA 4J7FA 4KH0B 1BKBA 2LDMA 3RR6A 1VQ7A 1TWBA 4BDZA 2EYXA 1WX6A 2YXYA 3PT9A 2AHJB 3KBGA 4OB3B 2GNCA 3DKMA 5I2MA 1OPLA 1VQ7Q 4Z88A 5GAMh 2O4XB 1OX9A 3PGGA 4Q5WA 2CT3A 2X3XD 1OQKA 2HQEA 2CP7A 4RG2A 4PJOC 2EQUA 1JJ2S 2Y90A 1WLPB 2PVOB 4E2FB 4F16A 1VQLA 2DO3A 3RIRA 2VGNA 2EJ9A 1UG1A 4PJOG 1V29B 2PTKA 4JLGA 2JNGA 3QYGB 4KGVB 2QXFA 2EWNA 2X35A 5KYUA 3QKJA 1B34B 4KUDK 4ORZA 5I11A 1OPKA 2MI6A 2LZ6B 3CCQA 4MZTA 5CIUA 3EG1A 4J8OA 2G3RA 3JAME 4HCCA 3CCQQ 4JUVA 2ENMA 3SWNC 3A8OB 4IUTA 3X24B 1WDXA 3HRTA 1M90C 2EYQA 2LT4A 3MJXA 2RK2A 1LVKA 2NUZA 5GAMe 1W1FA 3M9QA 1Q95G 1TOVA 1UUEA 4QQDA 4N4HA 4J9EA 3KFVA 1UGVA 4O6JA 3JCMc 1C6VX 1TH7A 2EQKA 2EPDA 2XHCA 1BU1A 3RUXA 2LTOA 1RADB 2KYBA 2C0TA 2OX7A 1OEBA 2E6ZA 1TU0B 2PZ1A 2VKNA 1I1JA 3WVDB 3QJ6A 4J9GA 2DL7A 3TSZA 4AG1C 4V2SA 4AFSC 3X25B 2WACA 1WQWA 4TVRA 3S3OA 4AFQC 5IAYA 2E65A 3EGDB 3OYNA 2QDLA 3JB9I 2J6KA 4J9CA 1VQKQ 3EG3A 2RQTA 3CPWP 1WZOA 1WIEA 2A37A 4XU2A 1ABQA 3OMCA 3HRUA 3FLGA 4LE9A 1VQ4T 2D8HA 1AEYA 1HD3A 5GANh 4L59A 5FU6C 5IH2A 3GOXA 3OBWA 2CH4A 5GAMd 2MK5A 2IG0A 2GQVA 2CKKA 1UGRB 3S6WA 2J7IA 1Z9QA 1PRMC 1ZLMA 2BE7D 1M27C 2JZ2A 2AK5A 1A0NB 2KE9A 4BACA 3RBBB 2W10A 5DLQE 4BE1A 2F69A 3JCMh 1D0ZA 4M75E 5GMKh 3NGPA 1RAFB 3JCMQ 3BDUA 2RJCA 3ULRB 2M0YA 4WF2A 4JRIA 3H41A 3X28B 4C92C 2ED0A 3V7SA 1KC8U 5GAN8 3C94A 1ZSGA 3DLMA 3OYYA 1CKBA 1NPRA 3MP6A 2C0IA 1PNJA 1TUCA 3QIIA 1PHTA 2RA2A 2RI5A 5KYUB 2L3SA 4IIOA 4M7AC 5LL6S 1OI1A 2E6NA 2K2MA 5GAN4 3M55A 5GAMf 3CC7Q 1QVPA 4FYVB 4JS5A 4X34A 1I4K1 5LJ5g 4ANJA 2P0QA 1ACMB 1K1ZA 1N9SA 3CMAQ 2EKHA 3CCLA 2YLBA 4M7AG 4OMMA 3M57A 4OB1B 2IPOB 3CCLQ 5GANe 3E19A 1S1NA 4M78A 2JUFA 1M90R 1YJNT 2CSQA 1SRLA 4RCBA 3T9NA 4C5GA 3BE3A 2RHYA 2DEUA 4BY6B 3TREA 3VYHB 2CDTA 3CCMT 2JMAA 2HSPA 1WJRA 2DEQA 3L2UA 4C8QE 1T0HA 1K0XA 1MNDA 2CUBA 2LJ1A 3OS5A 2E64A 2GQIA 5GMKe 2LP5A 1YHQT 3QDRB 1IZ6A 4M78G 2GCXA 1M90U 1KK7A 2COZA 4OVAA 1X69A 3CD6A 4FSSA 1RAIB 4M75A 2KI7A 2JM8A 2DRMA 1C0MA 4PKCC 1UJ0A 2SRCA 1BI2A 1VQ8A 2K79A 2FL7A 3CD6Q 3H0FA 2YLCA 2KR3A 5CQXA 1X43A 1VQ8Q 1QMCA 3I55A 2DYBA 3VS6A 1VQ5T 1D3BA 3P8DA 5L8RE 2FG0A 4M78D 4CI0C 2XIDA 3OYMA 2DERA 5GANd 3CCRQ 1Q7YC 1YWPA 3O5ZA 4LNPA 4ME7A 2CP6A 3OY9A 3CCVQ 4A4GA 2F1LA 1SRMA 3CC2T 1AWXA 1C1AA 1KQSP 2QTVA 2BZ8A 1AHJB 4RMOA 3FEOA 2KRMA 2KT1A 3OYHA 1BI1A 1G8XA 2K3XA 1Y71A 1VOMA 1AWOA 4OB0B 1AT1B 2YRCA 4C8QC 1MUZA 2Y4YA 4QKUA 2DL3A 1RL2A 1B07A 2HKNA 3EG9B 1VIFA 2RQUA 1YNZA 1UECA 4DBQA 3OYJA 2RB6A 1IXDA 1FX7A 5FLXE 3QJYA 3G7ZA 4CC4B 1Y0MA 4RTYA 2HBPA 1VQPT 1MMNA 2CS7A 3NTIA 2RF0A 3RDVA 1YIJA 4E7IA 3CBMA 2P84A 3LH0A 2M16A 2LRQA 1YIJQ 3JCMf 1QVGS 4R55A 2X4XA 2JTMA 4NOYA 1U1SA 1ARKA 1AVZC 2DE0X 1H92A 4F04B 5A0DA 2CP0A 1MGQA 4Y91A 1X2QA 2P0KA 1VQ9T 3INZA 3G71T 2YHTA 4M7DE 4X1VA 3E9FA 1WI7A 2ROTA 2XDBA 2QG9B 3OQ5A 3S3NA 2DILA 3CC2A 1UEBA 4M78F 1HXDA 1SF9A 4CC7A 2RHXA 3I5SA 2X51A 3UF4A 1I5OB 3FRNA 3G6EA 2L5QA 1HK9A 1U8RA 4YTLA 2MF2A 2RM4A 3IQLA 4C0FA 1IO6A 4M77E 4JZ3A 4P5NA 1QW1A 5KYXA 4M75B 2LCCA 4BI3A 2O9SA 4N4IA 1BCOA 2DMOA 4RKUE 2HQXA 1N9RA 3FC3A 3M0TA 4B9XA 1YI2T 2O4XA 4LUDA 3QXEB 3UATA 2DAQA 1YFNA 2ZZDA 3PVQA 5EC7A 3LYIA 2FRWA 4RG8A 1M1KC 3RKXA 4A53A 1S72A 1WXBA 1FWZA 2FO0A 2OAWA 3OSSC 5I2SA 4XU1A 3UWNA 1S72Q 4AMCA 5LJ3g 1GCQC 1FXXA 2R5AA 1WGSA 3OB9A 2YT6A 1Q7YR 3CBPA 3U23A 4ZNXA 3RKYA 2DX1A 2CUDA 2YWWA 4PLIA 1NYFA 3C95A 1UGSB 2EQMA 2EIFA 4FYWB 4RTUA 3NMZC 2PUOB 2J05A 2RI2A 1LNXA 2QQBA 4C5IA 1VQ7T 2DETA 4EMKC 3JSCA 1J3TA 5IN1A 4J83A 2DIGA 3X20B 5A0LA 4DBHA 5GAOp 2QQAA 2G6FX 3LH5A 3HTRA 2A3LA 2DK3A 3UPUA 1KD1C 2HDAA 3PIPA 2KVQG 4IUQA 5CR2A 2MIOA 5GAOm 4LN2A 4FW2A 2NYSA 3LX7A 4JJBA 3CEYA 2DTIA 1QKWA 2M02A 4GBQA 3VYGA 2YUQA 1Q82C 1LCKA 1MMDA 1VQMQ 3QYHB 3PMIA 4PJOE 2RJFA 2J6FA 2QASA 3MEWA 3CXCA 2LT1A 4IURA 1PM3A 4MMLA 4DOWA 3CCUQ 3FJ5A 5IHNA 2EQIA 3CC4A 2P4TA 1D1AA 3LWHA 4BI8B 2M51A 1ZBJA 5M9OA 2MPXC 5FWBA 2LJ0A 3CC4Q 4D8KA 1JRIA 3CCQT 2LNVA 4XTWA 2PQWA 1W6XA 2D0QB 1YJWA 3VS0A 2A08A 2CZ0B 2QI2A 2MAMA 3M4GA 3JRZA 1JEGA 3CPWS 4QQ6A 4LDXA 3GLXA 2AT1B 4Y92A 1XNIA 2FPDA 1EX4A 1ZA1B 6AT1B 1Q81C 1KHIA 4RTWA 1K73C 2QGGA 5KYXB 3SFMA 4QVDA 2XG8D 3MP1A 2XMFA 4NS5A 4OF1A 3SB2A 1TG0A 1QVFA 1M4ZA 4BUGA 2OTLA 2HZYA 5GAOl 4FM4B 5KH6A 4Z89A 1D0YA 1VQ6A 1UGPB 5FU7B 2OTLQ 1LOJA 3TEEA 1M1KR 2HKQB 5C0MA 4KUIA 1KHCA 4PK4A 1VQ6Q 3MKDA 5GAOn 4K11A 2MOXA 1ZUUA 2L0AA 2MCNA 1W70A 2LX9A 3EG2A 3CCJA 1BIBA 5DM7R 4R0KA 1GFDA 3EFRA 3CCJQ 2CP3A 1M1KU 5HKCA 5DLOA 2ZPBB 1UGQB 1ZSZA 4ZGDB 1W2BA 2DNUA 2P0PA 1H3HA 3UA6A 4JRQA 4JZ4A 4M7DB 2VWFA 4FCYA 4JLIA 2J6OA 3L2RA 3NFCA 4E47A 4F7UE 2CZ1B 5GAOq 4ELYC 3UDCA 1SSHA 4AG2C 1RI9A 5GAN6 1KD1R 3SDZA 3SWNA 4M77B 3EGUA 2BE9B 3CMEQ 4JS4A 1Q82R 1QCNA 2B8AA 2JS0A 2R57A 3KUFA 1P92A 1LPLA 4DA4A 2DIQA 1Y7XA 5FRMA 1SHFA 2LQWA 1YWOA 1XJWB 2D9TA 3PFSA 3EG0A 4C92E 2DVEA 2NUPA 3OSVA 2LMJA 1X6BA 5HK0A 1Q82U 2LC4A 2COYA 2I0NA 3OW2A 3CCLT 4M7AE 2EKOA 3L2VA 2QDYB 3QBYA 4AT1B 1VQKA 5I21A 1OYXA 2LX7A 1MV0B 1G3YA 2PU9B 2FPFA 1YCSB 2RO0A 3PE0A 3M54A 5J3BA 5J26A 4PLLA 2O01E 2R58A 1JBMA 3EHRA 4J6YA 3VUBA 4C0DB 3AT1B 1XOVA 2CZ6B
chains in the Genus database with same CATH topology
1TSFA 1OQKA 2KI7A 1V76A 1TS9A 2ZAEA 1PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSF A;  1OQK A;  2KI7 A;  1V76 A;  1TS9 A;  2ZAE A;  1PC0 A; 
#chains in the Genus database with same CATH topology
 1BBZ A;  1Q81 R;  2L3R A;  2OJ2 A;  1K73 R;  2YRV A;  2CYZ B;  1RAG B;  2FRY A;  3TCJ A;  1KQS S;  1M9S A;  1GBQ A;  2KSS A;  2EYW A;  2ZCF B;  5D7U A;  1V1C A;  1M1G A;  1I81 A;  4ZGJ B;  1QKX A;  4UC4 A;  2D6F A;  2L8D A;  2XD0 A;  3HSB A;  3R6N A;  3V8L A;  1KQ2 A;  3CD6 T;  2X4W A;  1RAE B;  5CVI A;  5KCO A;  2ZPF B;  3EG9 A;  3FIF A;  1VQ8 T;  4FW1 A;  2I2L A;  2MWO A;  1RUW A;  2VAS A;  1G3S A;  2VVK A;  1UHC A;  3VRY A;  3CC7 A;  4A4E A;  2F2X A;  1WXU A;  3M5A A;  1PG5 B;  2IIM A;  3CBO A;  3I55 T;  5FRN A;  4C0Z A;  4Z02 A;  3CMA A;  3BFM A;  2ZPH B;  4ZN3 A;  3CCR T;  2QQR A;  2ECZ A;  2HBW A;  1ZBX A;  1ZSZ B;  3CCV T;  2XIC A;  2RHI A;  2NLU A;  1U3O A;  1RI0 A;  2GTO A;  4OMO A;  1QCF A;  1YP5 A;  3M56 A;  1X01 A;  3TVT A;  1Y96 A;  1PKT A;  2E10 A;  4JJD A;  1YCY A;  4KH1 B;  3M53 A;  3GNG A;  2RHZ A;  1R77 A;  5LJ5 j;  2QQ9 A;  3CCS A;  1M3B A;  3SWN B;  1QP2 A;  2FEI A;  1F1B B;  1NG2 A;  4M78 C;  1K76 A;  2HCK A;  3C0C A;  3CCS Q;  3OMG A;  3MCA B;  3EFS A;  4MDX A;  3JCM e;  2YSQ A;  2F5T X;  1JJ2 A;  1M2V A;  2QA4 A;  5ECA A;  2E41 A;  3I35 A;  5CK9 A;  1WJQ A;  2DVJ A;  2KDS A;  2QA4 Q;  2NUP B;  1YIJ T;  2K7A A;  4EMH A;  2DD5 A;  2DXT A;  2WSF E;  5A0G A;  2F2V A;  4OMQ A;  2PVD B;  3TQ7 P;  2YUN A;  1TS9 A;  2V26 A;  3PVL A;  4F17 A;  2DD4 A;  1FMK A;  1JQQ A;  3RMQ A;  3V7R A;  3OYC A;  4X9C A;  3UA7 A;  2JS2 A;  4DEX A;  5FWC A;  2VXE A;  3VUZ A;  1I5L A;  2KYM A;  3KXT A;  4C5H A;  3CCR A;  4M75 G;  2ZPG B;  4OMN A;  1U5S A;  3VU3 C;  5GAM g;  3QHS A;  3CCV A;  3MP8 A;  3RNJ A;  2NUT B;  3A5Z B;  1NJI C;  4HXJ A;  1YIT A;  1WHK A;  3CXC S;  4GLM A;  1AWW A;  1QQJ A;  2FZC B;  1VQN A;  5FU6 B;  1MMA A;  3G6E T;  4E7L A;  1YIT Q;  1IHW A;  2OAU A;  2D0N A;  1WHL A;  3E2U A;  2YRD A;  3UT1 A;  3LLR A;  3JCM d;  4KBM B;  1VQN Q;  1GXI E;  3M0U A;  1B3Q A;  3M0P A;  2H8H A;  4M75 D;  4BE2 A;  2CP5 A;  5A2Q E;  3L2Z A;  2RJE A;  2QTX A;  2DBK A;  4C8Q A;  3H6Z A;  2HSE B;  3E1S A;  1R0C B;  4LUE A;  2M9U A;  4HKE A;  1WA7 A;  4NL3 A;  4KUL A;  1YJ9 A;  1S72 T;  4C92 B;  4EIK A;  1WJS A;  1NYG A;  4QVC A;  2AZS A;  4GY5 A;  2CRE A;  1YJ9 Q;  1O9S A;  1M30 A;  5CKF A;  4OB2 B;  3SHW A;  2DTO A;  1M1F A;  3ZBD A;  4BD3 A;  1Y96 B;  2AKK A;  1PCX A;  4PJL A;  1ZHI A;  4XTZ A;  2DTH A;  4PJM A;  4HA8 A;  1OZ3 A;  1VYV A;  2KQW A;  2MYS A;  4QQG A;  4CC3 A;  1YHQ Q;  3RER A;  1PWT A;  3VS7 A;  2DJZ A;  2CT4 A;  2GGR A;  4XQ3 A;  3J7A F;  2RQV A;  1FMW A;  1N27 A;  1VUB A;  3HKS A;  3GIB A;  4JRK A;  3M58 A;  1OOT A;  3L2Q A;  3ZFJ A;  2YUP A;  3H9N A;  2KRS A;  4PFO A;  2E70 A;  4Z8A A;  3JB9 G;  2QK0 A;  3QSU A;  4E7K A;  3TU4 K;  4C8Q D;  5HK3 A;  2EVR A;  3VS5 A;  5CO7 A;  2DKG A;  1N8R C;  1M2V B;  5GAN 2;  4JJN K;  1PSF A;  1N5Z A;  4QVZ A;  1QWE A;  1UDL A;  1AZE A;  3P8H A;  2V1Q A;  3OYD A;  1WPY A;  1VIE A;  2KRO A;  2FVU A;  2QEX Q;  1OUL A;  5D6Y A;  3I9Q A;  1QP3 A;  4KGZ B;  5IXB A;  2EYZ A;  4MZP A;  4N0A C;  2WSE E;  3JB9 D;  1FMV A;  3BDL A;  3M4Y A;  3CC4 T;  3QO3 A;  4M75 F;  1WYX A;  4EDU A;  5GAN g;  1BCM A;  2PUK B;  3LGL A;  3OYA A;  4HCZ A;  2OTJ A;  2VV5 A;  4AFU C;  5KYW B;  4HVW A;  3Q1J A;  3BW1 A;  1U06 A;  2AIR B;  2L89 A;  1IHV A;  1YJW T;  2OTJ Q;  3I56 A;  2BKD N;  3OYL A;  1NJI R;  3FDR A;  4B6M A;  1M8M A;  3CXC P;  1H64 1;  3I56 Q;  2DM1 A;  3VS1 A;  4JJC A;  3A8H B;  2PNI A;  3EH2 A;  3A8L B;  1E6G A;  1PSE A;  4E7Z A;  1VQP Q;  3QWY A;  3VV0 A;  5LJ3 j;  4X9D A;  4M7D A;  4XTV A;  2V1R A;  3WVE B;  3DB4 A;  3URG A;  2H3J A;  3PIO A;  1JU5 C;  2K6D A;  1XQH A;  3HFN A;  3JCM b;  3CCE A;  1Q7Y U;  1NJI U;  4ZN1 A;  4C8Q B;  1K8A C;  5D6X A;  2VGM A;  4EMK A;  2OTL T;  1T3L A;  1VYT A;  2ABL A;  3P8B B;  1Q86 C;  3CCE Q;  1VQ6 T;  2KY9 A;  1VQM A;  2J06 A;  4M77 A;  2RMO A;  2CP2 A;  1UB4 A;  2EAY A;  4JPB W;  2JW4 A;  9ATC B;  3GBQ A;  4M7D G;  5LJ5 h;  2ZPI B;  4C8Q F;  4FT2 A;  1KIK A;  3LGF A;  3CCU A;  2DBM A;  2V8K A;  4FL6 A;  3CCJ T;  2DZC A;  2KAF A;  2A28 A;  2KXC A;  4FYY B;  2KXD A;  2XK0 A;  1PD0 A;  2RNA A;  5HCK A;  1JXO A;  2L3Q A;  2QAZ A;  4EMG A;  1QVF P;  5KYN A;  1BK2 A;  2L2P A;  4PFP A;  2RQR A;  3OYF A;  3QZ9 B;  4M77 G;  4R56 A;  4AFZ C;  4JRP A;  4BDY A;  2VYT A;  3JB9 F;  2MWP A;  2XDD A;  1EIF A;  1NLO C;  3OS2 A;  1SKU B;  4M7D D;  1YI2 Q;  1BIA A;  3A1P A;  4N4G A;  4FSX A;  1RLP C;  3QZ5 B;  1KSW A;  2RPN A;  3CME T;  1D1C A;  1NLP C;  2LQ8 A;  1PC0 A;  2DL4 A;  1AZG B;  1U1T A;  1OV3 A;  3OYB A;  1N8R R;  2DLP A;  1Y07 A;  3ME9 A;  4A54 A;  2M1H A;  4DBR A;  4RTT A;  4E6R A;  1K9M C;  4J9B A;  4M77 D;  1W2B P;  4RTV A;  1IGQ A;  1EZZ B;  2RK1 A;  4C0D C;  4CRI A;  3EGX A;  1YN8 A;  2GTJ A;  2YUO A;  5KE3 A;  2GFU A;  3F70 A;  2EJF A;  1NE8 A;  2LNH B;  2ESW A;  3SD4 A;  5LJ5 e;  2COW A;  3EHQ A;  3H0I A;  1N8R U;  1QWF A;  2K4Y A;  3A8M B;  3RMS A;  4FU6 A;  3L1A A;  1ZA2 B;  1E6H A;  5IT9 E;  4M4Z A;  2HAX A;  2A7Y A;  1KC8 C;  4PJO A;  2BTT A;  2DL5 A;  4J9F A;  5FRO A;  4XTU A;  2BIV A;  1VQO A;  1QVG A;  2FPE A;  2Z0W A;  1VQK T;  1KJW A;  4IUU A;  1WFW A;  4HVU A;  3V8J A;  4KRT A;  1VQO Q;  3OS1 A;  3QG1 A;  2CH4 W;  4WCI A;  2C06 A;  4DBF A;  3S3M A;  4O5V A;  3THK A;  2R5M A;  1QLY A;  3MEU A;  3REB B;  1TTH B;  2EBP A;  3CQT A;  3EFO B;  3JCM W;  1OZ2 A;  1RAB B;  1VYU A;  1SPK A;  2EQJ A;  2JM9 A;  5IXF A;  4J9I A;  1VQL Q;  5CKB A;  4Y28 E;  3OW2 P;  1KFZ A;  1ZSZ C;  1WHG A;  3ZL7 C;  3VS3 A;  3GPL A;  3OBY A;  4J6W A;  3LWI A;  4EMK B;  1D09 B;  1K8A R;  3CME A;  4BE0 A;  2EYY A;  4ELZ C;  2HQH A;  1PD1 A;  2E5Q A;  1ABO A;  2BZX A;  2JT4 A;  4M7D F;  1Q86 R;  1V76 A;  1KG1 A;  4DQ2 A;  5LJ5 d;  2EGA A;  3G4S A;  4LXC A;  2DPP B;  4LD6 A;  1WXT A;  4PJO D;  2E4H A;  4BY6 C;  5J39 A;  2ROL A;  3J81 E;  5C6S A;  1K8A U;  3CC7 T;  2K2V A;  3G4S Q;  1KD1 U;  1DJ7 B;  4FYX B;  4XTY A;  4M77 F;  5KCH A;  2BZY A;  2GF7 A;  4PJN A;  3CMA T;  2JN0 A;  1TUD A;  2LCS A;  1Q86 U;  2XU8 A;  2K5L A;  3JCM P;  2BUD A;  3GP8 A;  4HT9 A;  1LJO A;  2K5I A;  3OYE A;  2SEM A;  3I5R A;  3X26 B;  2CGH A;  2JJ9 A;  3JCM J;  1MMG A;  4RCC A;  3NTH A;  4BI4 A;  3VKI A;  2ZPE B;  3OS0 A;  1ZUK A;  5LJ5 f;  1RAH B;  2K3B A;  3FB9 A;  4CC2 A;  2LJ3 A;  2LQN A;  4OP0 A;  4D8D A;  3CCS T;  1QCO A;  3OA6 A;  3H0H A;  4L6V 5;  2DXB A;  1T3S A;  3GNF B;  5KYY B;  2NUT A;  1AWJ A;  3JCM V;  3QDF A;  1RLQ C;  8AT1 B;  1K9M R;  2EFI A;  4F7U A;  2A36 A;  3EGX B;  1YBY A;  2E12 A;  1NEG A;  4IKF A;  4M78 E;  2LQK A;  5GAN 3;  2QA4 T;  2LCL A;  3HL8 A;  1NZ9 A;  2KNB B;  3M59 A;  2YDL A;  1NBE B;  2K9G A;  1I07 A;  5CKD A;  1Q81 U;  2CSI A;  1ZQ1 A;  1K0S A;  1I8F A;  2PVG B;  2D1X A;  1K9M U;  1K73 U;  4ATO A;  2JTF A;  3GF5 A;  2DXC A;  4F7U G;  4PJO B;  1X75 C;  5LJ3 h;  1KC8 R;  4IUP A;  1FYN A;  4DOV A;  3RKW A;  4PNO A;  5GMK m;  2HMA A;  3NHN A;  3NTK A;  2HEQ A;  3HRS A;  3A8G B;  3DB3 A;  5GAO r;  3VS4 A;  1G3T A;  4XU3 A;  2RQW A;  2XDP A;  4C92 A;  1JJ2 P;  1JO8 A;  4A4K A;  2EGC A;  4PJO F;  1K9A A;  1T0J A;  4RTZ A;  4FT4 A;  4LDV A;  3J80 E;  3SEM A;  1O75 A;  4RTX A;  1MV3 A;  2X4J A;  2KT8 A;  4M7A A;  4MMK A;  1IGU A;  3E9G A;  2JOY A;  2GBQ A;  3CPW A;  3M0S A;  1YIT T;  1SEM A;  3OYK A;  1VQN T;  2E3I A;  1EFN A;  2H3E B;  2LVM A;  1MNE A;  4C92 G;  1XTD A;  1WHM A;  4JDS A;  3M0R A;  4F14 A;  2HL5 C;  8ATC B;  2O31 A;  4C0G A;  1HJD A;  1BI3 A;  2X9H A;  2FYK A;  4II1 A;  1G3W A;  5GJW B;  2JMC A;  2AKL A;  3JCM X;  1HSQ A;  1X27 A;  5GAN 7;  2DJQ A;  1K4U S;  2K5F A;  3C12 A;  1YJ9 T;  5LJ3 e;  1VQ4 A;  7AT1 B;  1H8K A;  1H3Z A;  4BB7 A;  4C92 D;  2RN8 A;  1PRL C;  1VQ4 Q;  4IIM A;  2NWM A;  3REA B;  1OU9 A;  5GMK l;  4M75 C;  4M7A D;  3ER0 A;  4HT8 A;  2RHU A;  5CKH A;  4E7J A;  1ZX6 A;  4XTX A;  2EJG A;  4RUG A;  4J6X A;  2KK4 A;  5CQY A;  5DY9 A;  5KYW A;  4D6W A;  1UE9 A;  3QUI A;  3DLL A;  2VXF A;  3OYI A;  2ZGW A;  2KMT A;  2DL8 A;  4F7U B;  1NM7 A;  1X6G A;  2K57 A;  3QPH A;  2E3H A;  1G83 A;  4XAX B;  2C0O A;  4OMP A;  1M3A A;  1JB0 E;  2HD0 A;  3I55 Q;  3MHX A;  4KT0 E;  4L5G A;  2O2O A;  1Y57 A;  5GAM j;  2QEX T;  4EPC A;  1AOJ A;  1TUG B;  3VRZ A;  1OU8 A;  3WXM B;  4OML A;  3JB9 J;  3MEV A;  4B9W A;  4F7U F;  1D1B A;  2KBT A;  1CKA A;  2DF6 A;  2RH2 A;  1W4S A;  3MET A;  1N6A A;  2K3Y A;  1WQ7 A;  1NEB A;  3M0Q A;  2JXB A;  2OI3 A;  5LJ3 d;  3HFO A;  1UJY A;  1M3C A;  1NPP A;  5CAI A;  5IHI A;  4XK8 E;  1YJN A;  3A98 A;  3CPF A;  2O9V A;  1UHF A;  2B86 A;  1YJN Q;  4A4F A;  2L3P A;  2OTJ T;  4E7S A;  3CCM A;  4PL6 A;  5KE2 A;  3L2W A;  2JVV A;  3VJP A;  1VA7 A;  4MZM A;  1WNL A;  1TSF A;  4M7A B;  4C5E A;  2JTE A;  4C8Q G;  1YHQ A;  2Y4X A;  3I56 T;  3CCM Q;  5GAN f;  2DZ9 A;  1QVF S;  2DRK A;  4E7H A;  4C92 F;  2EW3 A;  3EAE A;  1GFC A;  1GRI A;  3V7C A;  1B7T A;  5LJ3 f;  4M7A F;  2RI3 A;  2CZ7 B;  4A63 B;  3MEA A;  1M8V A;  1GBR A;  1SHG A;  1KQS A;  5D6W A;  1WHJ A;  1IRE B;  2V8J A;  3CCE T;  4FIB A;  2RD1 A;  3R6O A;  2X4Y A;  3PNW C;  2DXU A;  4OGE A;  1VQ5 A;  3MO8 A;  3C4S A;  4M78 B;  4XU0 A;  5CKE A;  1VQM T;  4VUB A;  2W0Z A;  2HL3 A;  2QEX A;  1VQ5 Q;  3PTA A;  4DEY A;  2GFA A;  5GAN 5;  4ZGE B;  1W2B S;  5FW9 A;  1BB9 A;  3H8Z A;  5EG2 A;  3CCU T;  2AZV A;  2DFU A;  4NL2 A;  4A4H A;  1BYM A;  4J7I A;  2HNI A;  3CC2 Q;  2KEA A;  1G5V A;  1R8O B;  2VC8 A;  4LDU A;  3G6E Q;  2QYZ A;  4N0A A;  1TXQ A;  3RES A;  4HCK A;  3HPW A;  4LDW A;  1R0B G;  2KRN A;  5FU7 C;  4OMF B;  4PFZ A;  2FZG B;  2QGF B;  3N5B B;  2D8J A;  2VUB A;  4OGC A;  4KGX B;  4ESR A;  1GCQ A;  3JCM g;  1VQP A;  3MPU B;  3NPF A;  5GAN j;  2ED1 A;  1IRX A;  1D3B B;  4ZTJ A;  2FZK B;  1IB8 A;  1RAA B;  1X2K A;  2QQS A;  4QW2 A;  2ZAE A;  1M2O A;  1OX8 A;  3EFO A;  2X3W D;  3JB9 H;  3OW2 S;  2KGT A;  3V8K A;  4HVV A;  3O8V A;  2FB7 A;  2WSC E;  3L42 A;  2ATC B;  2DYI A;  2E1H A;  4WTO B;  1B34 A;  4M7D C;  5GMK j;  3AHU A;  3HHT B;  1BI0 A;  2P4R A;  4HCB A;  2DA9 A;  1ZUY A;  1G2B A;  1UFF A;  1VQ9 A;  3G71 A;  4LD9 K;  3FJP A;  3D7S B;  1SSF A;  1VQ9 Q;  2MMP A;  3G71 Q;  1VQO T;  2RJD A;  4M77 C;  3PMT A;  4PJJ A;  4GLK A;  1PKS A;  2V8I A;  2EGE A;  5AT1 B;  1AD5 A;  1UTI A;  1M5Q 1;  4LDY A;  4MDW A;  4J9H A;  2FHD A;  2M0O A;  5IHK A;  5GJV B;  1GL5 A;  3OYG A;  3LW5 E;  1GCP A;  1VQL T;  3ASK A;  3EH1 A;  3ZEH A;  3G1J A;  1E7O A;  1YI2 A;  4ZTF A;  3VS2 A;  5L23 A;  1CSK A;  4QT7 A;  1SG5 A;  2F5K A;  1MHN A;  2F2W A;  2VB6 A;  2O88 A;  1QVG P;  4IUV A;  1KQ1 A;  5GMK i;  5HY6 A;  4J5Y A;  1Z9Z A;  3BY7 A;  1X6O A;  3JV3 A;  2XI9 A;  1WHH A;  5AYF A;  2IVW A;  3HP9 A;  2XKO C;  1D0X A;  5I22 A;  1HYO A;  2A0F B;  1I0C A;  1RAC B;  3QWX X;  3EGD A;  4J9D A;  5KYY A;  5CCA A;  3G4S T;  3TSW A;  2E5K A;  1YJW Q;  1JXM A;  4J7F A;  4KH0 B;  1BKB A;  2LDM A;  3RR6 A;  1VQ7 A;  1TWB A;  4BDZ A;  2EYX A;  1WX6 A;  2YXY A;  3PT9 A;  2AHJ B;  3KBG A;  4OB3 B;  2GNC A;  3DKM A;  5I2M A;  1OPL A;  1VQ7 Q;  4Z88 A;  5GAM h;  2O4X B;  1OX9 A;  3PGG A;  4Q5W A;  2CT3 A;  2X3X D;  1OQK A;  2HQE A;  2CP7 A;  4RG2 A;  4PJO C;  2EQU A;  1JJ2 S;  2Y90 A;  1WLP B;  2PVO B;  4E2F B;  4F16 A;  1VQL A;  2DO3 A;  3RIR A;  2VGN A;  2EJ9 A;  1UG1 A;  4PJO G;  1V29 B;  2PTK A;  4JLG A;  2JNG A;  3QYG B;  4KGV B;  2QXF A;  2EWN A;  2X35 A;  5KYU A;  3QKJ A;  1B34 B;  4KUD K;  4ORZ A;  5I11 A;  1OPK A;  2MI6 A;  2LZ6 B;  3CCQ A;  4MZT A;  5CIU A;  3EG1 A;  4J8O A;  2G3R A;  3JAM E;  4HCC A;  3CCQ Q;  4JUV A;  2ENM A;  3SWN C;  3A8O B;  4IUT A;  3X24 B;  1WDX A;  3HRT A;  1M90 C;  2EYQ A;  2LT4 A;  3MJX A;  2RK2 A;  1LVK A;  2NUZ A;  5GAM e;  1W1F A;  3M9Q A;  1Q95 G;  1TOV A;  1UUE A;  4QQD A;  4N4H A;  4J9E A;  3KFV A;  1UGV A;  4O6J A;  3JCM c;  1C6V X;  1TH7 A;  2EQK A;  2EPD A;  2XHC A;  1BU1 A;  3RUX A;  2LTO A;  1RAD B;  2KYB A;  2C0T A;  2OX7 A;  1OEB A;  2E6Z A;  1TU0 B;  2PZ1 A;  2VKN A;  1I1J A;  3WVD B;  3QJ6 A;  4J9G A;  2DL7 A;  3TSZ A;  4AG1 C;  4V2S A;  4AFS C;  3X25 B;  2WAC A;  1WQW A;  4TVR A;  3S3O A;  4AFQ C;  5IAY A;  2E65 A;  3EGD B;  3OYN A;  2QDL A;  3JB9 I;  2J6K A;  4J9C A;  1VQK Q;  3EG3 A;  2RQT A;  3CPW P;  1WZO A;  1WIE A;  2A37 A;  4XU2 A;  1ABQ A;  3OMC A;  3HRU A;  3FLG A;  4LE9 A;  1VQ4 T;  2D8H A;  1AEY A;  1HD3 A;  5GAN h;  4L59 A;  5FU6 C;  5IH2 A;  3GOX A;  3OBW A;  2CH4 A;  5GAM d;  2MK5 A;  2IG0 A;  2GQV A;  2CKK A;  1UGR B;  3S6W A;  2J7I A;  1Z9Q A;  1PRM C;  1ZLM A;  2BE7 D;  1M27 C;  2JZ2 A;  2AK5 A;  1A0N B;  2KE9 A;  4BAC A;  3RBB B;  2W10 A;  5DLQ E;  4BE1 A;  2F69 A;  3JCM h;  1D0Z A;  4M75 E;  5GMK h;  3NGP A;  1RAF B;  3JCM Q;  3BDU A;  2RJC A;  3ULR B;  2M0Y A;  4WF2 A;  4JRI A;  3H41 A;  3X28 B;  4C92 C;  2ED0 A;  3V7S A;  1KC8 U;  5GAN 8;  3C94 A;  1ZSG A;  3DLM A;  3OYY A;  1CKB A;  1NPR A;  3MP6 A;  2C0I A;  1PNJ A;  1TUC A;  3QII A;  1PHT A;  2RA2 A;  2RI5 A;  5KYU B;  2L3S A;  4IIO A;  4M7A C;  5LL6 S;  1OI1 A;  2E6N A;  2K2M A;  5GAN 4;  3M55 A;  5GAM f;  3CC7 Q;  1QVP A;  4FYV B;  4JS5 A;  4X34 A;  1I4K 1;  5LJ5 g;  4ANJ A;  2P0Q A;  1ACM B;  1K1Z A;  1N9S A;  3CMA Q;  2EKH A;  3CCL A;  2YLB A;  4M7A G;  4OMM A;  3M57 A;  4OB1 B;  2IPO B;  3CCL Q;  5GAN e;  3E19 A;  1S1N A;  4M78 A;  2JUF A;  1M90 R;  1YJN T;  2CSQ A;  1SRL A;  4RCB A;  3T9N A;  4C5G A;  3BE3 A;  2RHY A;  2DEU A;  4BY6 B;  3TRE A;  3VYH B;  2CDT A;  3CCM T;  2JMA A;  2HSP A;  1WJR A;  2DEQ A;  3L2U A;  4C8Q E;  1T0H A;  1K0X A;  1MND A;  2CUB A;  2LJ1 A;  3OS5 A;  2E64 A;  2GQI A;  5GMK e;  2LP5 A;  1YHQ T;  3QDR B;  1IZ6 A;  4M78 G;  2GCX A;  1M90 U;  1KK7 A;  2COZ A;  4OVA A;  1X69 A;  3CD6 A;  4FSS A;  1RAI B;  4M75 A;  2KI7 A;  2JM8 A;  2DRM A;  1C0M A;  4PKC C;  1UJ0 A;  2SRC A;  1BI2 A;  1VQ8 A;  2K79 A;  2FL7 A;  3CD6 Q;  3H0F A;  2YLC A;  2KR3 A;  5CQX A;  1X43 A;  1VQ8 Q;  1QMC A;  3I55 A;  2DYB A;  3VS6 A;  1VQ5 T;  1D3B A;  3P8D A;  5L8R E;  2FG0 A;  4M78 D;  4CI0 C;  2XID A;  3OYM A;  2DER A;  5GAN d;  3CCR Q;  1Q7Y C;  1YWP A;  3O5Z A;  4LNP A;  4ME7 A;  2CP6 A;  3OY9 A;  3CCV Q;  4A4G A;  2F1L A;  1SRM A;  3CC2 T;  1AWX A;  1C1A A;  1KQS P;  2QTV A;  2BZ8 A;  1AHJ B;  4RMO A;  3FEO A;  2KRM A;  2KT1 A;  3OYH A;  1BI1 A;  1G8X A;  2K3X A;  1Y71 A;  1VOM A;  1AWO A;  4OB0 B;  1AT1 B;  2YRC A;  4C8Q C;  1MUZ A;  2Y4Y A;  4QKU A;  2DL3 A;  1RL2 A;  1B07 A;  2HKN A;  3EG9 B;  1VIF A;  2RQU A;  1YNZ A;  1UEC A;  4DBQ A;  3OYJ A;  2RB6 A;  1IXD A;  1FX7 A;  5FLX E;  3QJY A;  3G7Z A;  4CC4 B;  1Y0M A;  4RTY A;  2HBP A;  1VQP T;  1MMN A;  2CS7 A;  3NTI A;  2RF0 A;  3RDV A;  1YIJ A;  4E7I A;  3CBM A;  2P84 A;  3LH0 A;  2M16 A;  2LRQ A;  1YIJ Q;  3JCM f;  1QVG S;  4R55 A;  2X4X A;  2JTM A;  4NOY A;  1U1S A;  1ARK A;  1AVZ C;  2DE0 X;  1H92 A;  4F04 B;  5A0D A;  2CP0 A;  1MGQ A;  4Y91 A;  1X2Q A;  2P0K A;  1VQ9 T;  3INZ A;  3G71 T;  2YHT A;  4M7D E;  4X1V A;  3E9F A;  1WI7 A;  2ROT A;  2XDB A;  2QG9 B;  3OQ5 A;  3S3N A;  2DIL A;  3CC2 A;  1UEB A;  4M78 F;  1HXD A;  1SF9 A;  4CC7 A;  2RHX A;  3I5S A;  2X51 A;  3UF4 A;  1I5O B;  3FRN A;  3G6E A;  2L5Q A;  1HK9 A;  1U8R A;  4YTL A;  2MF2 A;  2RM4 A;  3IQL A;  4C0F A;  1IO6 A;  4M77 E;  4JZ3 A;  4P5N A;  1QW1 A;  5KYX A;  4M75 B;  2LCC A;  4BI3 A;  2O9S A;  4N4I A;  1BCO A;  2DMO A;  4RKU E;  2HQX A;  1N9R A;  3FC3 A;  3M0T A;  4B9X A;  1YI2 T;  2O4X A;  4LUD A;  3QXE B;  3UAT A;  2DAQ A;  1YFN A;  2ZZD A;  3PVQ A;  5EC7 A;  3LYI A;  2FRW A;  4RG8 A;  1M1K C;  3RKX A;  4A53 A;  1S72 A;  1WXB A;  1FWZ A;  2FO0 A;  2OAW A;  3OSS C;  5I2S A;  4XU1 A;  3UWN A;  1S72 Q;  4AMC A;  5LJ3 g;  1GCQ C;  1FXX A;  2R5A A;  1WGS A;  3OB9 A;  2YT6 A;  1Q7Y R;  3CBP A;  3U23 A;  4ZNX A;  3RKY A;  2DX1 A;  2CUD A;  2YWW A;  4PLI A;  1NYF A;  3C95 A;  1UGS B;  2EQM A;  2EIF A;  4FYW B;  4RTU A;  3NMZ C;  2PUO B;  2J05 A;  2RI2 A;  1LNX A;  2QQB A;  4C5I A;  1VQ7 T;  2DET A;  4EMK C;  3JSC A;  1J3T A;  5IN1 A;  4J83 A;  2DIG A;  3X20 B;  5A0L A;  4DBH A;  5GAO p;  2QQA A;  2G6F X;  3LH5 A;  3HTR A;  2A3L A;  2DK3 A;  3UPU A;  1KD1 C;  2HDA A;  3PIP A;  2KVQ G;  4IUQ A;  5CR2 A;  2MIO A;  5GAO m;  4LN2 A;  4FW2 A;  2NYS A;  3LX7 A;  4JJB A;  3CEY A;  2DTI A;  1QKW A;  2M02 A;  4GBQ A;  3VYG A;  2YUQ A;  1Q82 C;  1LCK A;  1MMD A;  1VQM Q;  3QYH B;  3PMI A;  4PJO E;  2RJF A;  2J6F A;  2QAS A;  3MEW A;  3CXC A;  2LT1 A;  4IUR A;  1PM3 A;  4MML A;  4DOW A;  3CCU Q;  3FJ5 A;  5IHN A;  2EQI A;  3CC4 A;  2P4T A;  1D1A A;  3LWH A;  4BI8 B;  2M51 A;  1ZBJ A;  5M9O A;  2MPX C;  5FWB A;  2LJ0 A;  3CC4 Q;  4D8K A;  1JRI A;  3CCQ T;  2LNV A;  4XTW A;  2PQW A;  1W6X A;  2D0Q B;  1YJW A;  3VS0 A;  2A08 A;  2CZ0 B;  2QI2 A;  2MAM A;  3M4G A;  3JRZ A;  1JEG A;  3CPW S;  4QQ6 A;  4LDX A;  3GLX A;  2AT1 B;  4Y92 A;  1XNI A;  2FPD A;  1EX4 A;  1ZA1 B;  6AT1 B;  1Q81 C;  1KHI A;  4RTW A;  1K73 C;  2QGG A;  5KYX B;  3SFM A;  4QVD A;  2XG8 D;  3MP1 A;  2XMF A;  4NS5 A;  4OF1 A;  3SB2 A;  1TG0 A;  1QVF A;  1M4Z A;  4BUG A;  2OTL A;  2HZY A;  5GAO l;  4FM4 B;  5KH6 A;  4Z89 A;  1D0Y A;  1VQ6 A;  1UGP B;  5FU7 B;  2OTL Q;  1LOJ A;  3TEE A;  1M1K R;  2HKQ B;  5C0M A;  4KUI A;  1KHC A;  4PK4 A;  1VQ6 Q;  3MKD A;  5GAO n;  4K11 A;  2MOX A;  1ZUU A;  2L0A A;  2MCN A;  1W70 A;  2LX9 A;  3EG2 A;  3CCJ A;  1BIB A;  5DM7 R;  4R0K A;  1GFD A;  3EFR A;  3CCJ Q;  2CP3 A;  1M1K U;  5HKC A;  5DLO A;  2ZPB B;  1UGQ B;  1ZSZ A;  4ZGD B;  1W2B A;  2DNU A;  2P0P A;  1H3H A;  3UA6 A;  4JRQ A;  4JZ4 A;  4M7D B;  2VWF A;  4FCY A;  4JLI A;  2J6O A;  3L2R A;  3NFC A;  4E47 A;  4F7U E;  2CZ1 B;  5GAO q;  4ELY C;  3UDC A;  1SSH A;  4AG2 C;  1RI9 A;  5GAN 6;  1KD1 R;  3SDZ A;  3SWN A;  4M77 B;  3EGU A;  2BE9 B;  3CME Q;  4JS4 A;  1Q82 R;  1QCN A;  2B8A A;  2JS0 A;  2R57 A;  3KUF A;  1P92 A;  1LPL A;  4DA4 A;  2DIQ A;  1Y7X A;  5FRM A;  1SHF A;  2LQW A;  1YWO A;  1XJW B;  2D9T A;  3PFS A;  3EG0 A;  4C92 E;  2DVE A;  2NUP A;  3OSV A;  2LMJ A;  1X6B A;  5HK0 A;  1Q82 U;  2LC4 A;  2COY A;  2I0N A;  3OW2 A;  3CCL T;  4M7A E;  2EKO A;  3L2V A;  2QDY B;  3QBY A;  4AT1 B;  1VQK A;  5I21 A;  1OYX A;  2LX7 A;  1MV0 B;  1G3Y A;  2PU9 B;  2FPF A;  1YCS B;  2RO0 A;  3PE0 A;  3M54 A;  5J3B A;  5J26 A;  4PLL A;  2O01 E;  2R58 A;  1JBM A;  3EHR A;  4J6Y A;  3VUB A;  4C0D B;  3AT1 B;  1XOV A;  2CZ6 B; 
#chains in the Genus database with same CATH homology
 1TSF A;  1OQK A;  2KI7 A;  1V76 A;  1TS9 A;  2ZAE A;  1PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...