3CMEQ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cmeQ00
3G6EQ 1VQ5Q 3CC2Q 3I56Q 1VQKQ 2OTLQ 3CMAQ 1N8RR 3OW2P 1YJ9Q 3CPWP 1QVGP 3CCVQ 1K9MR 3G71Q 3CC4Q 1JJ2P 1YITQ 1VQLQ 3CCEQ 3CCLQ 3CCSQ 1Q82R 1NJIR 1M90R 2QA4Q 2QEXQ 3CCUQ 1VQ9Q 3CC7Q 1QVFP 3CCRQ 3CCJQ 1K8AR 3CD6Q 3G4SQ 1W2BP 1YJNQ 2OTJQ 1KQSP 1S72Q 1YI2Q 1YHQQ 3I55Q 1KC8R 1VQ7Q 1VQOQ 1Q86R 1VQPQ 1VQ4Q 1YIJQ 3CCMQ 1YJWQ 1Q7YR 1KD1R 1VQ8Q 1VQMQ 1M1KR 1K73R 1VQNQ 3CXCP 1VQ6Q 3CMEQ 3CCQQ 1Q81R
chains in the Genus database with same CATH superfamily
5FU6C 2GQVA 1WYXA 3CCRT 4XTUA 1NEGA 2LX7A 4KH1B 4B9WA 1D09B 4RTVA 5GAMj 2IG0A 1SRMA 2KY9A 2FRWA 4XTYA 2PVGB 4X34A 1VQ7A 3PE0A 1I5OB 4BUGA 1QWEA 4LDVA 3OYDA 1VUBA 4Z02A 4DEXA 2YWWA 3J80E 4M77B 1M90C 2RHUA 3HRUA 3X20B 4P5NA 3UT1A 4HCZA 2DXTA 5DLOA 2K3XA 3CCLQ 4PJOC 1RAAB 2QTVA 3NPFA 4OB1B 2BZYA 3M55A 3H41A 4IUTA 4FCYA 1OZ2A 1JEGA 2E4HA 4FL6A 2DTOA 1HYOA 2QEXA 4M75C 2MWPA 4F04B 1OX9A 1YHQA 3L2UA 1VQKQ 2NLUA 2OI3A 4JJDA 3OYMA 2V8IA 3S3MA 4A54A 5HKCA 3L2WA 4A4HA 3EHRA 1WQWA 3E19A 4D8KA 2DL7A 3OYAA 4OB2B 5IXFA 5IAYA 1WHKA 3QWYA 3A1PA 3MEAA 5FU7B 5LJ5e 1GCPA 3EG0A 4BD3A 1NE8A 2FG0A 4R55A 3UA6A 2P0KA 3RKWA 4C0DB 2D1XA 2PVDB 4NL3A 3PVLA 4PJOF 3OQ5A 4E47A 1VIFA 1D1CA 3OSSC 5GAN6 1KD1C 2HDAA 4QVDA 1R8OB 4FIBA 4DBRA 1OI1A 5C0MA 2Z0WA 1RAIB 2X4JA 1WGSA 1JQQA 4OF1A 4ZTFA 1B3QA 2KYBA 2QQAA 3FJPA 3VRZA 3KUFA 2EFIA 4JPBW 1GXIE 3H6ZA 1EZZB 5HCKA 3PNWC 4PNOA 2FEIA 2FZGB 2DBMA 2V26A 5IT9E 1BYMA 4AMCA 4PLLA 4B9XA 1KJWA 2PVOB 2EBPA 2NWMA 1HXDA 1Z9ZA 3OS1A 5FROA 2EPDA 2F2VA 1FMVA 1M2VB 5GAMh 1NLOC 1UHFA 2LRQA 2P84A 4J9CA 2RI5A 2H3EB 1IB8A 4O5VA 4IUQA 1VYTA 1B34A 2VGNA 2XDBA 2DXBA 2ZAEA 5I21A 3QYHB 2JM9A 5CAIA 2L3SA 4BE2A 3L42A 3FDRA 2HL3A 4DBQA 3UATA 4ELYC 2PU9B 2ZPIB 1AOJA 2JW4A 4GY5A 3JCMW 3CCJA 2L89A 2EQUA 2CZ1B 4CC4B 1QKXA 5KYWB 3CCLA 3CCJT 1X27A 2A7YA 2VC8A 4A4KA 3OW2S 1VQ9Q 3CCRQ 3CD6Q 2LQKA 2EYQA 1VQPT 3M4GA 1WPYA 4DBHA 1JJ2A 1YWOA 1SG5A 3Q1JA 1JB0E 2F5TX 2ZPBB 1QCFA 1RI0A 4N4GA 2KBTA 2JN0A 3QO3A 1V1CA 2QK0A 3EGUA 5I22A 1UB4A 3C95A 1Q82U 4OMQA 5J39A 1NG2A 2I0NA 1YJNQ 1QVPA 1AWJA 1WNLA 2E1HA 3L2VA 1FMWA 4E6RA 2NUPA 1VQ6T 5HK0A 4FW1A 1TH7A 4B6MA 2DZCA 4A63B 3VU3C 1N8RC 5I2SA 2EWNA 1IRXA 3OYHA 1DJ7B 2LZ6B 3CCVQ 1YITQ 2H3JA 2RHIA 3CC2T 4IUPA 1I5LA 4OMOA 4HCBA 4M7DB 3OYCA 4O6JA 3OYKA 2LJ1A 5LJ3j 2MK5A 5LJ5h 1WA7A 4BDYA 3I55T 1K73R 1M3AA 4MZMA 2RK2A 2QQSA 3CMAQ 2QG9B 1E6GA 4A53A 1AD5A 1RL2A 3E9FA 4M78C 3CC4T 3M53A 3SFMA 3P8HA 3OYLA 2ZPGB 2NYSA 1BI0A 3PT9A 3X28B 4XAXB 5FU7C 2SEMA 5IXBA 4NOYA 4GLMA 2V8JA 4ATOA 4DOVA 3OYEA 2ENMA 2LQNA 1I8FA 1YIJT 3BFMA 1C1AA 2DERA 2VWFA 5KYXA 3QZ5B 1QVGS 3NHNA 4M7AA 1JU5C 1ZQ1A 2A3LA 2EAYA 3RERA 5J26A 1JXMA 1M4ZA 1Y96B 2DZ9A 2O2OA 1NYFA 1KD1R 2L3QA 2QDLA 2E41A 4XU0A 4M75G 3VS5A 1HK9A 2VV5A 3CD6T 4JZ4A 3MPUB 2GFUA 3C0CA 5I2MA 1S72T 2DIGA 1VQ9T 2OTJQ 2HMAA 1RLPC 3EH1A 5A0GA 2ECZA 4OB0B 2RH2A 3PMIA 2XD0A 3TCJA 2DA9A 4C5HA 2PTKA 2KAFA 3RKYA 3UWNA 3I56T 2CSQA 5CKEA 3I35A 3T9NA 3PVQA 3X26B 5KCOA 4J8OA 3CCUQ 3KBGA 1U1SA 3N5BB 1KQSA 3BW1A 2MI6A 2M02A 2KQWA 5LJ3d 1M8VA 3JCMf 2EYZA 3M0UA 3CXCS 4E7SA 1VA7A 4HVUA 4IUUA 1N6AA 3A8GB 2DTHA 2KMTA 1YI2A 1RLQC 4L5GA 2XICA 1JRIA 1BIAA 1YI2T 3EAEA 1K8AC 4C8QE 2O01E 3M58A 1K8AU 4C92B 2C06A 1KC8U 1IGQA 1UE9A 5KYWA 3QZ9B 4M75F 4F16A 2M0YA 2C0OA 5IHNA 1K0SA 2HSEB 4X9DA 1IXDA 1X6BA 3VS0A 4KUIA 3AHUA 1G3WA 5GAMg 5FLXE 1T3SA 4Z8AA 4F7UG 2JTMA 4LE9A 2K5FA 2YUQA 3CC4A 5GANe 3OYYA 3CCEA 1Y07A 2FYKA 2G6FX 4J83A 2H8HA 1VQ5A 1YIJQ 3HL8A 1YJNT 2KVQG 1FMKA 2EQIA 3CQTA 1UGSB 3LGLA 3QWXX 2YLBA 5GAMf 2CS7A 1N8RU 2J6OA 3JB9J 1VQLT 4DOWA 4RG2A 4QQ6A 2MWOA 1PRLC 1VIEA 1W70A 3DLLA 5D6XA 2FRYA 2W10A 1KG1A 1D3BB 1ZSZB 3GIBA 1U8RA 4MZTA 1KSWA 5LJ3h 1T3LA 3QXEB 3RUXA 2EYYA 3RMSA 1ZA2B 2PZ1A 4Z88A 2L3RA 1YHQQ 1T0HA 4JRKA 3JCMb 3EH2A 2M9UA 3URGA 3CMET 4X9CA 1YCYA 1WXBA 2PUKB 3I5RA 3A8HB 1UTIA 3G1JA 1YJ9Q 4M75D 3CMAA 3RIRA 2JTFA 3TREA 3HKSA 2ED1A 2K6DA 1JO8A 3V7SA 2IIMA 2EQKA 2COWA 3M56A 3L2RA 2RHYA 2HCKA 3VV0A 1G8XA 3E9GA 4LDYA 2CUBA 1Q81U 2O88A 1Q81R 2DL3A 2KRNA 4NL2A 4JJCA 3WVEB 4C0GA 9ATCB 7AT1B 4N4HA 3HRTA 2E6NA 3C94A 4XU3A 3HHTB 3OMCA 5CVIA 4M7AE 2KGTA 2YHTA 4C92F 1U1TA 2IVWA 3JCMc 4RTUA 3CPWP 1ABQA 3CCSA 1A0NB 1VQOA 1AWWA 3QDRB 1UGVA 2KT1A 1VQOT 2RNAA 4N4IA 2HKNA 3OYGA 3CCRA 5LJ5j 4IKFA 3LH5A 1ZX6A 2LCSA 3CXCP 4EMGA 4BE0A 2RHZA 3G71T 1IHWA 1M3CA 2ZGWA 1YP5A 3OBWA 2XG8D 2DLPA 2RI3A 4KULA 2EJFA 3QSUA 1YI2Q 1JJ2S 2E3HA 1VQ4Q 1X6OA 1VQ8Q 2A28A 2DYIA 4PJOB 3VUZA 1K9AA 3ER0A 1ACMB 5CKHA 1X43A 4C0DC 3JCMP 2DBKA 3MEVA 4M77C 4PJOG 4M75E 1LNXA 4FU6A 2QEXT 2YDLA 2X4YA 4E7HA 1Y0MA 4MDWA 2KE9A 4J9BA 5IN1A 1Q7YR 4J9HA 3CEYA 3META 1BU1A 1U06A 3LH0A 3JCMh 2KT8A 3G6EQ 1CKAA 2AKKA 1QVFS 2DO3A 3CBOA 1RAEB 1PHTA 1LOJA 1IGUA 2OAWA 1AVZC 1FYNA 1O75A 1D1BA 2JNGA 3J7AF 2HEQA 2DIQA 3G7ZA 2WSFE 2K3YA 1G2BA 2E6ZA 1YITT 1WHMA 1M5Q1 4WCIA 5LJ3g 4M7AF 2X51A 4C5GA 3CCJQ 1N9RA 2AZSA 2CP5A 5CKBA 4D8DA 1VQPQ 1U5SA 4ZN3A 2CH4W 5M9OA 2IPOB 3LLRA 1OV3A 1YCSB 2J6KA 3QJ6A 1YWPA 5IH2A 2EYWA 2RJCA 1WJSA 3INZA 1YJ9T 1AHJB 1VQ7T 1D3BA 3ZL7C 1VQOQ 1MV3A 2DVJA 1QP3A 1N9SA 2NUPB 2C0IA 1YBYA 1M2VA 4AFQC 3CCLT 4Z89A 4A4FA 1SSFA 2NUTA 3EG9A 2GTOA 2WACA 3VJPA 1BIBA 4OGCA 2EYXA 4BACA 2CREA 2YRCA 4FSXA 1FXXA 2M51A 2DRMA 1BCOA 3G71A 2RJDA 4E7IA 3M0PA 3O8VA 4F7UA 4E7LA 1WJQA 4QQGA 1VQ8T 1E6HA 2DFUA 3QG1A 2EKHA 4FSSA 3MO8A 4E2FB 2FZKB 2Y4XA 1XNIA 2KDSA 3CC4Q 2CT4A 2M16A 2I2LA 2LMJA 2LT1A 5GMKi 2BE9B 4QVZA 4A4GA 2ROLA 3TU4K 1ABOA 3FJ5A 2EGEA 3GF5A 2AT1B 1Q86R 2XKOC 4M7DA 3CCMQ 3DLMA 1LVKA 2G3RA 4OMLA 2RN8A 1VQ8A 4M7DF 1G83A 1ZHIA 3A8MB 1QKWA 2VGMA 1M27C 2E64A 5KYXB 1VQMA 1RAHB 3X24B 1TWBA 5GAN2 2RQUA 2CKKA 4KH0B 2RPNA 2FL7A 3V7RA 3V8KA 4PJLA 5LJ5d 2FO0A 1ZUYA 3HTRA 2L0AA 4XTVA 1PM3A 4MMLA 3G6EA 3H0HA 1QVGP 4R0KA 3VKIA 2F1LA 2GGRA 4II1A 1X01A 1PC0A 1ARKA 2V1QA 2BIVA 2KYMA 4ZGJB 1EIFA 1S72Q 2JOYA 3RESA 2E3IA 2CP2A 4FYXB 2HSPA 4LXCA 2XI9A 1K9MC 1V29B 4ZN1A 4RTWA 2ZPFB 1AT1B 4RKUE 2HNIA 3WVDB 4J9EA 1HJDA 2EKOA 5CK9A 4PJJA 2RQTA 1NPRA 4C8QD 3OYNA 1MV0B 1KC8R 1TTHB 1LCKA 3QYGB 4J9FA 1Q7YC 5CCAA 1FWZA 3HFNA 2EGAA 3P8DA 1VQNQ 2NUTB 3EG9B 4JS5A 5C6SA 1SHGA 2V8KA 3THKA 1E7OA 1RAFB 1PD1A 3FLGA 3FC3A 4M77F 4M77A 3EG3A 2RA2A 5LJ3f 4EMKA 3CC7T 4L6V5 5FRMA 3OYFA 2JVVA 1TG0A 4CC3A 3QKJA 2E70A 1VQ9A 4OMFB 1MHNA 4C92D 4BY6C 1W4SA 2CZ0B 3R6OA 5GMKe 2DD4A 1Q82R 3X25B 1PNJA 4EIKA 4J6WA 4CRIA 4CI0C 1X2QA 3M57A 2CZ6B 3QJYA 5GAN7 3S6WA 1W2BA 3EHQA 2MYSA 2F5KA 4M4ZA 3MP1A 4J7FA 2DXCA 3R6NA 1HSQA 2JZ2A 3GNGA 2LX9A 2WSCE 3PMTA 1XTDA 4JDSA 2CYZB 4OGEA 2FZCB 1UFFA 3RR6A 3SD4A 4J5YA 1OX8A 3FEOA 1OULA 3REAB 1BK2A 2RK1A 2A0FB 1UGQB 1GCQA 1NLPC 2OTLA 1UHCA 1M1KC 2P4TA 1ZSZA 1QCOA 3PIPA 1QLYA 3S3OA 1MUZA 3EGXB 3GBQA 3JSCA 4C8QF 3JCMd 4JJNK 3QUIA 1YJWT 3M0QA 3ZBDA 5GAOp 3MJXA 1C6VX 2CP0A 1KHIA 3PFSA 5IHKA 4PJOD 5KYUB 2QA4T 3I55Q 2RMOA 3REBB 4AT1B 1K4US 3G4SA 1ZBJA 1WI7A 2VVKA 5GJWB 4XU1A 2J05A 3CCET 1VYUA 1Y71A 3SWNB 3CMEQ 4M7AD 4MMKA 2D6FA 1JBMA 2K4YA 3CPWS 1GL5A 2L8DA 1I0CA 1BI3A 2D0NA 4JJBA 2LNVA 2M0OA 3CCUA 5KYUA 3JCMg 4M78A 3ASKA 4M7DE 1K8AR 3SHWA 2BUDA 2LQ8A 5D7UA 1ZBXA 2EIFA 1IZ6A 3SWNA 3PGGA 3CCQA 1VOMA 2MOXA 1Q7YU 4RG8A 4HA8A 3CBPA 3A8LB 1VQ6Q 3CCQQ 4EMKC 4ZGDB 4PFOA 4EMKB 4J6XA 4J9DA 2VYTA 2RJFA 5HK3A 2K7AA 2QYZA 5D6WA 3OSVA 1VQ5T 2BZXA 2K9GA 2RO0A 2BTTA 1WQ7A 5D6YA 1AWXA 1SF9A 2AHJB 1XJWB 2DL8A 2HQEA 4C8QG 1QVFA 2KR3A 3CMAT 3EGDA 2KI7A 2OX7A 3M9QA 2COZA 4ZTJA 2DD5A 2D9TA 3CPWA 2O4XA 1WX6A 4HCKA 1UDLA 1QWFA 4KGZB 4BI3A 2E5QA 1K9MU 2DILA 5FWCA 2CP7A 2ABLA 1SHFA 2YLCA 3RNJA 5KCHA 1WHJA 5FRNA 2JUFA 5GANh 4PFPA 4VUBA 2VASA 4RMOA 1MGQA 2YT6A 5EG2A 3NTIA 3M54A 4V2SA 3TVTA 4M77D 3O5ZA 1WHHA 2DF6A 3OS2A 2MPXC 2K5LA 2D8HA 2X35A 5GANd 3G71Q 2QQBA 3M4YA 4C92G 2DX1A 5FWBA 3VS3A 5KE3A 1NJIU 2ESWA 3EFOB 2K5IA 3G4SQ 4AG1C 3TSZA 5I11A 4LD9K 3RMQA 3I9QA 2FPEA 3JB9G 2AKLA 4C5IA 3VS4A 1G3SA 5KYYB 2K2VA 4DQ2A 4E7JA 2CZ7B 3CCST 1QCNA 2LJ3A 2XDDA 4OB3B 2LT4A 1Y96A 2JMAA 2OJ2A 2F2WA 1PSFA 4RCCA 4ELZC 1Q86C 4LDUA 1QVFP 3M59A 5AT1B 1SEMA 2EVRA 2OTJT 2ZPHB 3JB9F 2P0PA 1W6XA 2SRCA 2EQJA 2RQVA 3OMGA 2HQHA 2AK5A 4M75A 5KYYA 3VUBA 2M1HA 2MMPA 2DEQA 4K11A 1Y7XA 1B07A 4M78B 1Q82C 3V8JA 1G3TA 2AZVA 1RADB 4C8QB 1M90U 3UA7A 2CT3A 2JS0A 2JM8A 1W1FA 1BBZA 1KD1U 1YJNA 2K57A 1M1KU 4D6WA 4OMPA 3DB4A 5GAOm 4IIOA 4QKUA 4ZNXA 3JCMX 2DETA 3CCQT 4FYWB 2K3BA 5LJ5f 5GAN5 3PIOA 4LUDA 5GAN8 2COYA 2GNCA 4M7AG 4FT4A 3NMZC 4M78E 1OU9A 3OBYA 1GRIA 2X3XD 3NTHA 3VS7A 3JCMJ 4F7UF 4LD6A 1RABB 3L2ZA 1TU0B 2XHCA 4KUDK 4RTYA 2KSSA 4Y92A 4KBMB 4HCCA 2R5AA 3VRYA 2CUDA 1RUWA 3GPLA 1RI9A 1N27A 2JS2A 2LCLA 1K76A 3JCMe 2L5QA 2DEUA 5KE2A 3S3NA 1K9MR 3C4SA 2DRKA 4J7IA 4RTZA 1H3ZA 4BDZA 1I81A 5IHIA 1YHQT 2QQ9A 2DL4A 6AT1B 1KHCA 2YUOA 3QBYA 1KQSS 3J81E 4J9IA 3MP6A 3IQLA 1MMGA 1AZEA 1WHGA 1GFDA 3TQ7P 1XOVA 2XDPA 1K1ZA 2FHDA 4ANJA 4BI4A 2HKQB 1UEBA 2KRSA 1ZSZC 4C0FA 1CSKA 3GNFB 1QW1A 2FPFA 2R58A 5CQXA 8AT1B 1W2BP 2RB6A 4N0AC 2AIRB 2R5MA 4JRPA 3BE3A 2DE0X 1H8KA 2DNUA 3M0TA 3LGFA 5CIUA 3PTAA 4JLIA 5LL6S 4HT9A 4PFZA 1D0ZA 3RBBB 1YJ9A 2LP5A 4MZPA 3GP8A 4JUVA 3E1SA 4TVRA 3ME9A 1IREB 2RF0A 2E12A 3A98A 2QI2A 5GAOr 4WTOB 1R77A 4EMHA 2LTOA 4Y28E 4C0ZA 1X69A 1KK7A 2DK3A 4ME7A 4DBFA 4R56A 1U3OA 1OPKA 1X75C 3JB9D 3NTKA 5KH6A 2HBWA 2MF2A 2QTXA 1NM7A 2VUBA 1FX7A 3JCMV 1N8RR 2E10A 2HBPA 1JJ2P 1ZA1B 4FM4B 4BY6B 3OA6A 4A4EA 2JT4A 1PCXA 3U23A 2GQIA 1NYGA 2NUZA 2LCCA 1LPLA 1I1JA 3VS6A 1PD0A 4M78F 1O9SA 3OYBA 2YRVA 1Q81C 4OMMA 3JRZA 2DAQA 4LUEA 4F7UE 5HY6A 2F69A 5LJ5g 3CC2Q 2B8AA 2X9HA 4FT2A 1D0XA 3CCSQ 3CCVT 1M3BA 1KIKA 1TOVA 4CC2A 3CC7Q 3AT1B 3H0IA 2KROA 2XU8A 1YFNA 3CCVA 4M78G 1UGRB 3CPFA 1WLPB 1TUGB 4XTXA 1M1FA 2PQWA 1MNEA 1OOTA 1KQ1A 1V76A 1GBRA 3LWIA 1D1AA 4F7UB 3KXTA 4Y91A 1R0BG 3H8ZA 3DB3A 1OEBA 2KK4A 3KFVA 3QHSA 4IIMA 3OY9A 5GAOn 3LW5E 1VQ6A 3G6ET 4JRQA 4ZGEB 2VXFA 2DMOA 1TSFA 1YITA 5KYNA 4FYYB 3RKXA 1VQKA 5CO7A 1NPPA 2PNIA 2YRDA 3FIFA 4X1VA 2GBQA 1BB9A 3WXMB 3JB9I 5ECAA 1GCQC 2F2XA 1N5ZA 2MIOA 3VS2A 1M8MA 2X3WD 4J9GA 3UDCA 1PG5B 1OZ3A 1Z9QA 2EJ9A 4F17A 4JS4A 4HVVA 4C8QA 1BCMA 2ZZDA 2GTJA 3LX7A 1VQMT 5L23A 5A0DA 1VQKT 2QXFA 3EGDB 2OTLQ 3SB2A 2RQRA 3ZEHA 4F14A 2QEXQ 4XK8E 1B34B 3SEMA 4WF2A 4AFSC 4XTZA 4KT0E 2ZCFB 1WXUA 1K73U 2KXDA 4RCBA 3BDLA 1CKBA 3P8BB 2HAXA 1P92A 3I55A 4M77G 4YTLA 5EC7A 3GLXA 1M9SA 3JCMQ 3H0FA 1UGPB 1VYVA 1TXQA 1W2BS 2KNBB 5CKDA 4IUVA 2DJZA 2RJEA 1WIEA 2YUNA 4NS5A 1BI2A 2LQWA 2D8JA 1BI1A 3CC7A 4LDWA 2DL5A 2W0ZA 4N0AA 2XMFA 2J7IA 8ATCB 1AWOA 1ZUKA 2VKNA 1G5VA 3HFOA 3CD6A 2QGGA 2O9SA 4C5EA 5GAMd 2MCNA 2RQWA 1S72A 4M7DD 1IO6A 1Q86U 1KC8C 1S1NA 3VYHB 2E65A 3MCAB 3QPHA 2YXYA 4E7KA 1M1KR 2DJQA 2DVEA 2HL5C 3I56A 2ATCB 2PUOB 1SPKA 1OQKA 1UJYA 3SWNC 5GANj 3CXCA 2DPPB 3OS5A 3MEWA 1UG1A 4RUGA 4HT8A 3CCMT 2HZYA 1JXOA 4LN2A 1UECA 4C92E 2YUPA 1WHLA 4M7DC 1H3HA 3CC2A 2RM4A 4FW2A 4M78D 2KRMA 1YN8A 1VQPA 4GBQA 3TSWA 1MNDA 4GLKA 4HXJA 4LNPA 4FYVB 5GAOq 1GBQA 1G3YA 2RI2A 1QMCA 1WJRA 2DTIA 3BDUA 3G4ST 2LNHB 2LC4A 2E5KA 2K79A 1MMNA 4PJMA 4LDXA 2V1RA 4BB7A 3M0SA 1RACB 4JLGA 5DLQE 1SSHA 1LJOA 1M1GA 4MDXA 2QA4A 5GAN3 4BI8B 2OTLT 4XU2A 5DY9A 4PKCC 2YSQA 2FVUA 2X4WA 1YNZA 1I4K1 1NZ9A 1YIJA 3QIIA 2JMCA 2B86A 2KEAA 1KQSP 1OYXA 3NGPA 1VQNA 2C0TA 3NFCA 2EQMA 3V7CA 3JB9H 3EFSA 2D0QB 4UC4A 3OW2P 5GAN4 4IURA 5GAMe 3JAME 1QQJA 1WXTA 3EFOA 4XTWA 1VQNT 1SRLA 3EFRA 2OAUA 1NJIC 2P0QA 1ZSGA 1PRMC 2LDMA 2GCXA 3OYIA 5GANg 1GFCA 2RD1A 1RAGB 5GMKl 4M7AC 4HKEA 3M5AA 1X2KA 2XK0A 4ESRA 4DEYA 4QVCA 1TUCA 5GJVB 3MP8A 1VQLA 2O31A 4AFUC 2J6FA 3D7SB 3SDZA 4RTTA 4JRIA 3HPWA 2MAMA 1D0YA 1OU8A 3L1AA 2FB7A 2FPDA 2HQXA 1K73C 3OW2A 3FB9A 5FW9A 5GMKm 1NBEB 5CKFA 1VQ4A 2BZ8A 4CC7A 1M30A 1T0JA 3EG1A 3MEUA 3OB9A 4M7DG 3MHXA 3CCMA 1I07A 1J3TA 3OS0A 5AYFA 4J6YA 5A2QE 2QASA 4M7AB 1Q95G 5GAOl 2XIDA 4AG2C 3F70A 3QDFA 2WSEE 1PKSA 2O9VA 2EGCA 1PKTA 4PJOA 1M2OA 3EGXA 1H641 1MMDA 1WFWA 1VQ4T 2QGFB 2CGHA 2QQRA 3EG2A 1SKUB 1R0CB 2DM1A 5CQYA 5GMKh 4KGVB 2GFAA 2JXBA 3DKMA 1YJWQ 4C8QC 2L3PA 3HSBA 3MKDA 3ULRB 1IHVA 4EDUA 1B7TA 3UPUA 1YJWA 2JJ9A 2CP3A 4OVAA 3RDVA 2CDTA 5DM7R 1AEYA 1UUEA 2QA4Q 2Y4YA 1KFZA 1EFNA 1TS9A 1X6GA 4L59A 1QP2A 2CSIA 5CR2A 1ZLMA 4PL6A 2VB6A 4AFZC 2QAZA 1XQHA 3UF4A 4PJOE 2ROTA 2Y90A 3FRNA 4RTXA 2OTJA 3L2QA 4C92A 3LYIA 4JZ3A 3CCUT 3VYGA 3C12A 4M75B 2VXEA 2X4XA 2LJ0A 4PJNA 4Q5WA 4ORZA 1MMAA 2L2PA 3HP9A 1WDXA 1H92A 5GANf 2A37A 5J3BA 1BKBA 2JTEA 1KQ2A 4BE1A 3GOXA 1VQ5Q 3LWHA 2BE7D 4DA4A 1F1BB 3BY7A 1AZGB 1M90R 5A0LA 1PSEA 2O4XB 4KRTA 3JV3A 2DYBA 1C0MA 3E2UA 1Y57A 2J06A 4E7ZA 2DKGA 2QDYB 5LJ3e 3I56Q 2GF7A 3CCEQ 3H9NA 5FU6B 4PK4A 2BKDN 1NJIR 2KXCA 2CP6A 3CBMA 3M0RA 2R57A 4QT7A 2P4RA 3HRSA 1VQ7Q 1ZUUA 1UJ0A 4EPCA 2K2MA 2DXUA 2LVMA 4HVWA 4C92C 1OPLA 2RHXA 4OP0A 4PLIA 2A08A 2CH4A 4QQDA 3V8LA 1PWTA 2EW3A 2ED0A 1VQLQ 3CMEA 3OYJA 1EX4A 2A36A 1HD3A 3A8OB 4QW2A 1NEBA 4XQ3A 4KGXB 5L8RE 2ZPEB 5GMKj 1WZOA 3A5ZB 1K0XA 3ZFJA 1QVGA 3TEEA 2EJGA 4M77E 1VQMQ 3I5SA 1TUDA 3VS1A 4OMNA 2HD0A
chains in the Genus database with same CATH topology
3G6EQ 1VQ5Q 3CC2Q 3I56Q 1VQKQ 2OTLQ 3CMAQ 1N8RR 3OW2P 1YJ9Q 3CPWP 1QVGP 3CCVQ 1K9MR 3G71Q 3CC4Q 1JJ2P 1YITQ 1VQLQ 3CCEQ 3CCLQ 3CCSQ 1Q82R 1NJIR 1M90R 2QA4Q 2QEXQ 3CCUQ 1VQ9Q 3CC7Q 1QVFP 3CCRQ 3CCJQ 1K8AR 3CD6Q 3G4SQ 1W2BP 1YJNQ 2OTJQ 1KQSP 1S72Q 1YI2Q 1YHQQ 3I55Q 1KC8R 1VQ7Q 1VQOQ 1Q86R 1VQPQ 1VQ4Q 1YIJQ 3CCMQ 1YJWQ 1Q7YR 1KD1R 1VQ8Q 1VQMQ 1M1KR 1K73R 1VQNQ 3CXCP 1VQ6Q 3CMEQ 3CCQQ 1Q81R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  1VQ5 Q;  3CC2 Q;  3I56 Q;  1VQK Q;  2OTL Q;  3CMA Q;  1N8R R;  3OW2 P;  1YJ9 Q;  3CPW P;  1QVG P;  3CCV Q;  1K9M R;  3G71 Q;  3CC4 Q;  1JJ2 P;  1YIT Q;  1VQL Q;  3CCE Q;  3CCL Q;  3CCS Q;  1Q82 R;  1NJI R;  1M90 R;  2QA4 Q;  2QEX Q;  3CCU Q;  1VQ9 Q;  3CC7 Q;  1QVF P;  3CCR Q;  3CCJ Q;  1K8A R;  3CD6 Q;  3G4S Q;  1W2B P;  1YJN Q;  2OTJ Q;  1KQS P;  1S72 Q;  1YI2 Q;  1YHQ Q;  3I55 Q;  1KC8 R;  1VQ7 Q;  1VQO Q;  1Q86 R;  1VQP Q;  1VQ4 Q;  1YIJ Q;  3CCM Q;  1YJW Q;  1Q7Y R;  1KD1 R;  1VQ8 Q;  1VQM Q;  1M1K R;  1K73 R;  1VQN Q;  3CXC P;  1VQ6 Q;  3CME Q;  3CCQ Q;  1Q81 R; 
#chains in the Genus database with same CATH topology
 5FU6 C;  2GQV A;  1WYX A;  3CCR T;  4XTU A;  1NEG A;  2LX7 A;  4KH1 B;  4B9W A;  1D09 B;  4RTV A;  5GAM j;  2IG0 A;  1SRM A;  2KY9 A;  2FRW A;  4XTY A;  2PVG B;  4X34 A;  1VQ7 A;  3PE0 A;  1I5O B;  4BUG A;  1QWE A;  4LDV A;  3OYD A;  1VUB A;  4Z02 A;  4DEX A;  2YWW A;  3J80 E;  4M77 B;  1M90 C;  2RHU A;  3HRU A;  3X20 B;  4P5N A;  3UT1 A;  4HCZ A;  2DXT A;  5DLO A;  2K3X A;  3CCL Q;  4PJO C;  1RAA B;  2QTV A;  3NPF A;  4OB1 B;  2BZY A;  3M55 A;  3H41 A;  4IUT A;  4FCY A;  1OZ2 A;  1JEG A;  2E4H A;  4FL6 A;  2DTO A;  1HYO A;  2QEX A;  4M75 C;  2MWP A;  4F04 B;  1OX9 A;  1YHQ A;  3L2U A;  1VQK Q;  2NLU A;  2OI3 A;  4JJD A;  3OYM A;  2V8I A;  3S3M A;  4A54 A;  5HKC A;  3L2W A;  4A4H A;  3EHR A;  1WQW A;  3E19 A;  4D8K A;  2DL7 A;  3OYA A;  4OB2 B;  5IXF A;  5IAY A;  1WHK A;  3QWY A;  3A1P A;  3MEA A;  5FU7 B;  5LJ5 e;  1GCP A;  3EG0 A;  4BD3 A;  1NE8 A;  2FG0 A;  4R55 A;  3UA6 A;  2P0K A;  3RKW A;  4C0D B;  2D1X A;  2PVD B;  4NL3 A;  3PVL A;  4PJO F;  3OQ5 A;  4E47 A;  1VIF A;  1D1C A;  3OSS C;  5GAN 6;  1KD1 C;  2HDA A;  4QVD A;  1R8O B;  4FIB A;  4DBR A;  1OI1 A;  5C0M A;  2Z0W A;  1RAI B;  2X4J A;  1WGS A;  1JQQ A;  4OF1 A;  4ZTF A;  1B3Q A;  2KYB A;  2QQA A;  3FJP A;  3VRZ A;  3KUF A;  2EFI A;  4JPB W;  1GXI E;  3H6Z A;  1EZZ B;  5HCK A;  3PNW C;  4PNO A;  2FEI A;  2FZG B;  2DBM A;  2V26 A;  5IT9 E;  1BYM A;  4AMC A;  4PLL A;  4B9X A;  1KJW A;  2PVO B;  2EBP A;  2NWM A;  1HXD A;  1Z9Z A;  3OS1 A;  5FRO A;  2EPD A;  2F2V A;  1FMV A;  1M2V B;  5GAM h;  1NLO C;  1UHF A;  2LRQ A;  2P84 A;  4J9C A;  2RI5 A;  2H3E B;  1IB8 A;  4O5V A;  4IUQ A;  1VYT A;  1B34 A;  2VGN A;  2XDB A;  2DXB A;  2ZAE A;  5I21 A;  3QYH B;  2JM9 A;  5CAI A;  2L3S A;  4BE2 A;  3L42 A;  3FDR A;  2HL3 A;  4DBQ A;  3UAT A;  4ELY C;  2PU9 B;  2ZPI B;  1AOJ A;  2JW4 A;  4GY5 A;  3JCM W;  3CCJ A;  2L89 A;  2EQU A;  2CZ1 B;  4CC4 B;  1QKX A;  5KYW B;  3CCL A;  3CCJ T;  1X27 A;  2A7Y A;  2VC8 A;  4A4K A;  3OW2 S;  1VQ9 Q;  3CCR Q;  3CD6 Q;  2LQK A;  2EYQ A;  1VQP T;  3M4G A;  1WPY A;  4DBH A;  1JJ2 A;  1YWO A;  1SG5 A;  3Q1J A;  1JB0 E;  2F5T X;  2ZPB B;  1QCF A;  1RI0 A;  4N4G A;  2KBT A;  2JN0 A;  3QO3 A;  1V1C A;  2QK0 A;  3EGU A;  5I22 A;  1UB4 A;  3C95 A;  1Q82 U;  4OMQ A;  5J39 A;  1NG2 A;  2I0N A;  1YJN Q;  1QVP A;  1AWJ A;  1WNL A;  2E1H A;  3L2V A;  1FMW A;  4E6R A;  2NUP A;  1VQ6 T;  5HK0 A;  4FW1 A;  1TH7 A;  4B6M A;  2DZC A;  4A63 B;  3VU3 C;  1N8R C;  5I2S A;  2EWN A;  1IRX A;  3OYH A;  1DJ7 B;  2LZ6 B;  3CCV Q;  1YIT Q;  2H3J A;  2RHI A;  3CC2 T;  4IUP A;  1I5L A;  4OMO A;  4HCB A;  4M7D B;  3OYC A;  4O6J A;  3OYK A;  2LJ1 A;  5LJ3 j;  2MK5 A;  5LJ5 h;  1WA7 A;  4BDY A;  3I55 T;  1K73 R;  1M3A A;  4MZM A;  2RK2 A;  2QQS A;  3CMA Q;  2QG9 B;  1E6G A;  4A53 A;  1AD5 A;  1RL2 A;  3E9F A;  4M78 C;  3CC4 T;  3M53 A;  3SFM A;  3P8H A;  3OYL A;  2ZPG B;  2NYS A;  1BI0 A;  3PT9 A;  3X28 B;  4XAX B;  5FU7 C;  2SEM A;  5IXB A;  4NOY A;  4GLM A;  2V8J A;  4ATO A;  4DOV A;  3OYE A;  2ENM A;  2LQN A;  1I8F A;  1YIJ T;  3BFM A;  1C1A A;  2DER A;  2VWF A;  5KYX A;  3QZ5 B;  1QVG S;  3NHN A;  4M7A A;  1JU5 C;  1ZQ1 A;  2A3L A;  2EAY A;  3RER A;  5J26 A;  1JXM A;  1M4Z A;  1Y96 B;  2DZ9 A;  2O2O A;  1NYF A;  1KD1 R;  2L3Q A;  2QDL A;  2E41 A;  4XU0 A;  4M75 G;  3VS5 A;  1HK9 A;  2VV5 A;  3CD6 T;  4JZ4 A;  3MPU B;  2GFU A;  3C0C A;  5I2M A;  1S72 T;  2DIG A;  1VQ9 T;  2OTJ Q;  2HMA A;  1RLP C;  3EH1 A;  5A0G A;  2ECZ A;  4OB0 B;  2RH2 A;  3PMI A;  2XD0 A;  3TCJ A;  2DA9 A;  4C5H A;  2PTK A;  2KAF A;  3RKY A;  3UWN A;  3I56 T;  2CSQ A;  5CKE A;  3I35 A;  3T9N A;  3PVQ A;  3X26 B;  5KCO A;  4J8O A;  3CCU Q;  3KBG A;  1U1S A;  3N5B B;  1KQS A;  3BW1 A;  2MI6 A;  2M02 A;  2KQW A;  5LJ3 d;  1M8V A;  3JCM f;  2EYZ A;  3M0U A;  3CXC S;  4E7S A;  1VA7 A;  4HVU A;  4IUU A;  1N6A A;  3A8G B;  2DTH A;  2KMT A;  1YI2 A;  1RLQ C;  4L5G A;  2XIC A;  1JRI A;  1BIA A;  1YI2 T;  3EAE A;  1K8A C;  4C8Q E;  2O01 E;  3M58 A;  1K8A U;  4C92 B;  2C06 A;  1KC8 U;  1IGQ A;  1UE9 A;  5KYW A;  3QZ9 B;  4M75 F;  4F16 A;  2M0Y A;  2C0O A;  5IHN A;  1K0S A;  2HSE B;  4X9D A;  1IXD A;  1X6B A;  3VS0 A;  4KUI A;  3AHU A;  1G3W A;  5GAM g;  5FLX E;  1T3S A;  4Z8A A;  4F7U G;  2JTM A;  4LE9 A;  2K5F A;  2YUQ A;  3CC4 A;  5GAN e;  3OYY A;  3CCE A;  1Y07 A;  2FYK A;  2G6F X;  4J83 A;  2H8H A;  1VQ5 A;  1YIJ Q;  3HL8 A;  1YJN T;  2KVQ G;  1FMK A;  2EQI A;  3CQT A;  1UGS B;  3LGL A;  3QWX X;  2YLB A;  5GAM f;  2CS7 A;  1N8R U;  2J6O A;  3JB9 J;  1VQL T;  4DOW A;  4RG2 A;  4QQ6 A;  2MWO A;  1PRL C;  1VIE A;  1W70 A;  3DLL A;  5D6X A;  2FRY A;  2W10 A;  1KG1 A;  1D3B B;  1ZSZ B;  3GIB A;  1U8R A;  4MZT A;  1KSW A;  5LJ3 h;  1T3L A;  3QXE B;  3RUX A;  2EYY A;  3RMS A;  1ZA2 B;  2PZ1 A;  4Z88 A;  2L3R A;  1YHQ Q;  1T0H A;  4JRK A;  3JCM b;  3EH2 A;  2M9U A;  3URG A;  3CME T;  4X9C A;  1YCY A;  1WXB A;  2PUK B;  3I5R A;  3A8H B;  1UTI A;  3G1J A;  1YJ9 Q;  4M75 D;  3CMA A;  3RIR A;  2JTF A;  3TRE A;  3HKS A;  2ED1 A;  2K6D A;  1JO8 A;  3V7S A;  2IIM A;  2EQK A;  2COW A;  3M56 A;  3L2R A;  2RHY A;  2HCK A;  3VV0 A;  1G8X A;  3E9G A;  4LDY A;  2CUB A;  1Q81 U;  2O88 A;  1Q81 R;  2DL3 A;  2KRN A;  4NL2 A;  4JJC A;  3WVE B;  4C0G A;  9ATC B;  7AT1 B;  4N4H A;  3HRT A;  2E6N A;  3C94 A;  4XU3 A;  3HHT B;  3OMC A;  5CVI A;  4M7A E;  2KGT A;  2YHT A;  4C92 F;  1U1T A;  2IVW A;  3JCM c;  4RTU A;  3CPW P;  1ABQ A;  3CCS A;  1A0N B;  1VQO A;  1AWW A;  3QDR B;  1UGV A;  2KT1 A;  1VQO T;  2RNA A;  4N4I A;  2HKN A;  3OYG A;  3CCR A;  5LJ5 j;  4IKF A;  3LH5 A;  1ZX6 A;  2LCS A;  3CXC P;  4EMG A;  4BE0 A;  2RHZ A;  3G71 T;  1IHW A;  1M3C A;  2ZGW A;  1YP5 A;  3OBW A;  2XG8 D;  2DLP A;  2RI3 A;  4KUL A;  2EJF A;  3QSU A;  1YI2 Q;  1JJ2 S;  2E3H A;  1VQ4 Q;  1X6O A;  1VQ8 Q;  2A28 A;  2DYI A;  4PJO B;  3VUZ A;  1K9A A;  3ER0 A;  1ACM B;  5CKH A;  1X43 A;  4C0D C;  3JCM P;  2DBK A;  3MEV A;  4M77 C;  4PJO G;  4M75 E;  1LNX A;  4FU6 A;  2QEX T;  2YDL A;  2X4Y A;  4E7H A;  1Y0M A;  4MDW A;  2KE9 A;  4J9B A;  5IN1 A;  1Q7Y R;  4J9H A;  3CEY A;  3MET A;  1BU1 A;  1U06 A;  3LH0 A;  3JCM h;  2KT8 A;  3G6E Q;  1CKA A;  2AKK A;  1QVF S;  2DO3 A;  3CBO A;  1RAE B;  1PHT A;  1LOJ A;  1IGU A;  2OAW A;  1AVZ C;  1FYN A;  1O75 A;  1D1B A;  2JNG A;  3J7A F;  2HEQ A;  2DIQ A;  3G7Z A;  2WSF E;  2K3Y A;  1G2B A;  2E6Z A;  1YIT T;  1WHM A;  1M5Q 1;  4WCI A;  5LJ3 g;  4M7A F;  2X51 A;  4C5G A;  3CCJ Q;  1N9R A;  2AZS A;  2CP5 A;  5CKB A;  4D8D A;  1VQP Q;  1U5S A;  4ZN3 A;  2CH4 W;  5M9O A;  2IPO B;  3LLR A;  1OV3 A;  1YCS B;  2J6K A;  3QJ6 A;  1YWP A;  5IH2 A;  2EYW A;  2RJC A;  1WJS A;  3INZ A;  1YJ9 T;  1AHJ B;  1VQ7 T;  1D3B A;  3ZL7 C;  1VQO Q;  1MV3 A;  2DVJ A;  1QP3 A;  1N9S A;  2NUP B;  2C0I A;  1YBY A;  1M2V A;  4AFQ C;  3CCL T;  4Z89 A;  4A4F A;  1SSF A;  2NUT A;  3EG9 A;  2GTO A;  2WAC A;  3VJP A;  1BIB A;  4OGC A;  2EYX A;  4BAC A;  2CRE A;  2YRC A;  4FSX A;  1FXX A;  2M51 A;  2DRM A;  1BCO A;  3G71 A;  2RJD A;  4E7I A;  3M0P A;  3O8V A;  4F7U A;  4E7L A;  1WJQ A;  4QQG A;  1VQ8 T;  1E6H A;  2DFU A;  3QG1 A;  2EKH A;  4FSS A;  3MO8 A;  4E2F B;  2FZK B;  2Y4X A;  1XNI A;  2KDS A;  3CC4 Q;  2CT4 A;  2M16 A;  2I2L A;  2LMJ A;  2LT1 A;  5GMK i;  2BE9 B;  4QVZ A;  4A4G A;  2ROL A;  3TU4 K;  1ABO A;  3FJ5 A;  2EGE A;  3GF5 A;  2AT1 B;  1Q86 R;  2XKO C;  4M7D A;  3CCM Q;  3DLM A;  1LVK A;  2G3R A;  4OML A;  2RN8 A;  1VQ8 A;  4M7D F;  1G83 A;  1ZHI A;  3A8M B;  1QKW A;  2VGM A;  1M27 C;  2E64 A;  5KYX B;  1VQM A;  1RAH B;  3X24 B;  1TWB A;  5GAN 2;  2RQU A;  2CKK A;  4KH0 B;  2RPN A;  2FL7 A;  3V7R A;  3V8K A;  4PJL A;  5LJ5 d;  2FO0 A;  1ZUY A;  3HTR A;  2L0A A;  4XTV A;  1PM3 A;  4MML A;  3G6E A;  3H0H A;  1QVG P;  4R0K A;  3VKI A;  2F1L A;  2GGR A;  4II1 A;  1X01 A;  1PC0 A;  1ARK A;  2V1Q A;  2BIV A;  2KYM A;  4ZGJ B;  1EIF A;  1S72 Q;  2JOY A;  3RES A;  2E3I A;  2CP2 A;  4FYX B;  2HSP A;  4LXC A;  2XI9 A;  1K9M C;  1V29 B;  4ZN1 A;  4RTW A;  2ZPF B;  1AT1 B;  4RKU E;  2HNI A;  3WVD B;  4J9E A;  1HJD A;  2EKO A;  5CK9 A;  4PJJ A;  2RQT A;  1NPR A;  4C8Q D;  3OYN A;  1MV0 B;  1KC8 R;  1TTH B;  1LCK A;  3QYG B;  4J9F A;  1Q7Y C;  5CCA A;  1FWZ A;  3HFN A;  2EGA A;  3P8D A;  1VQN Q;  2NUT B;  3EG9 B;  4JS5 A;  5C6S A;  1SHG A;  2V8K A;  3THK A;  1E7O A;  1RAF B;  1PD1 A;  3FLG A;  3FC3 A;  4M77 F;  4M77 A;  3EG3 A;  2RA2 A;  5LJ3 f;  4EMK A;  3CC7 T;  4L6V 5;  5FRM A;  3OYF A;  2JVV A;  1TG0 A;  4CC3 A;  3QKJ A;  2E70 A;  1VQ9 A;  4OMF B;  1MHN A;  4C92 D;  4BY6 C;  1W4S A;  2CZ0 B;  3R6O A;  5GMK e;  2DD4 A;  1Q82 R;  3X25 B;  1PNJ A;  4EIK A;  4J6W A;  4CRI A;  4CI0 C;  1X2Q A;  3M57 A;  2CZ6 B;  3QJY A;  5GAN 7;  3S6W A;  1W2B A;  3EHQ A;  2MYS A;  2F5K A;  4M4Z A;  3MP1 A;  4J7F A;  2DXC A;  3R6N A;  1HSQ A;  2JZ2 A;  3GNG A;  2LX9 A;  2WSC E;  3PMT A;  1XTD A;  4JDS A;  2CYZ B;  4OGE A;  2FZC B;  1UFF A;  3RR6 A;  3SD4 A;  4J5Y A;  1OX8 A;  3FEO A;  1OUL A;  3REA B;  1BK2 A;  2RK1 A;  2A0F B;  1UGQ B;  1GCQ A;  1NLP C;  2OTL A;  1UHC A;  1M1K C;  2P4T A;  1ZSZ A;  1QCO A;  3PIP A;  1QLY A;  3S3O A;  1MUZ A;  3EGX B;  3GBQ A;  3JSC A;  4C8Q F;  3JCM d;  4JJN K;  3QUI A;  1YJW T;  3M0Q A;  3ZBD A;  5GAO p;  3MJX A;  1C6V X;  2CP0 A;  1KHI A;  3PFS A;  5IHK A;  4PJO D;  5KYU B;  2QA4 T;  3I55 Q;  2RMO A;  3REB B;  4AT1 B;  1K4U S;  3G4S A;  1ZBJ A;  1WI7 A;  2VVK A;  5GJW B;  4XU1 A;  2J05 A;  3CCE T;  1VYU A;  1Y71 A;  3SWN B;  3CME Q;  4M7A D;  4MMK A;  2D6F A;  1JBM A;  2K4Y A;  3CPW S;  1GL5 A;  2L8D A;  1I0C A;  1BI3 A;  2D0N A;  4JJB A;  2LNV A;  2M0O A;  3CCU A;  5KYU A;  3JCM g;  4M78 A;  3ASK A;  4M7D E;  1K8A R;  3SHW A;  2BUD A;  2LQ8 A;  5D7U A;  1ZBX A;  2EIF A;  1IZ6 A;  3SWN A;  3PGG A;  3CCQ A;  1VOM A;  2MOX A;  1Q7Y U;  4RG8 A;  4HA8 A;  3CBP A;  3A8L B;  1VQ6 Q;  3CCQ Q;  4EMK C;  4ZGD B;  4PFO A;  4EMK B;  4J6X A;  4J9D A;  2VYT A;  2RJF A;  5HK3 A;  2K7A A;  2QYZ A;  5D6W A;  3OSV A;  1VQ5 T;  2BZX A;  2K9G A;  2RO0 A;  2BTT A;  1WQ7 A;  5D6Y A;  1AWX A;  1SF9 A;  2AHJ B;  1XJW B;  2DL8 A;  2HQE A;  4C8Q G;  1QVF A;  2KR3 A;  3CMA T;  3EGD A;  2KI7 A;  2OX7 A;  3M9Q A;  2COZ A;  4ZTJ A;  2DD5 A;  2D9T A;  3CPW A;  2O4X A;  1WX6 A;  4HCK A;  1UDL A;  1QWF A;  4KGZ B;  4BI3 A;  2E5Q A;  1K9M U;  2DIL A;  5FWC A;  2CP7 A;  2ABL A;  1SHF A;  2YLC A;  3RNJ A;  5KCH A;  1WHJ A;  5FRN A;  2JUF A;  5GAN h;  4PFP A;  4VUB A;  2VAS A;  4RMO A;  1MGQ A;  2YT6 A;  5EG2 A;  3NTI A;  3M54 A;  4V2S A;  3TVT A;  4M77 D;  3O5Z A;  1WHH A;  2DF6 A;  3OS2 A;  2MPX C;  2K5L A;  2D8H A;  2X35 A;  5GAN d;  3G71 Q;  2QQB A;  3M4Y A;  4C92 G;  2DX1 A;  5FWB A;  3VS3 A;  5KE3 A;  1NJI U;  2ESW A;  3EFO B;  2K5I A;  3G4S Q;  4AG1 C;  3TSZ A;  5I11 A;  4LD9 K;  3RMQ A;  3I9Q A;  2FPE A;  3JB9 G;  2AKL A;  4C5I A;  3VS4 A;  1G3S A;  5KYY B;  2K2V A;  4DQ2 A;  4E7J A;  2CZ7 B;  3CCS T;  1QCN A;  2LJ3 A;  2XDD A;  4OB3 B;  2LT4 A;  1Y96 A;  2JMA A;  2OJ2 A;  2F2W A;  1PSF A;  4RCC A;  4ELZ C;  1Q86 C;  4LDU A;  1QVF P;  3M59 A;  5AT1 B;  1SEM A;  2EVR A;  2OTJ T;  2ZPH B;  3JB9 F;  2P0P A;  1W6X A;  2SRC A;  2EQJ A;  2RQV A;  3OMG A;  2HQH A;  2AK5 A;  4M75 A;  5KYY A;  3VUB A;  2M1H A;  2MMP A;  2DEQ A;  4K11 A;  1Y7X A;  1B07 A;  4M78 B;  1Q82 C;  3V8J A;  1G3T A;  2AZV A;  1RAD B;  4C8Q B;  1M90 U;  3UA7 A;  2CT3 A;  2JS0 A;  2JM8 A;  1W1F A;  1BBZ A;  1KD1 U;  1YJN A;  2K57 A;  1M1K U;  4D6W A;  4OMP A;  3DB4 A;  5GAO m;  4IIO A;  4QKU A;  4ZNX A;  3JCM X;  2DET A;  3CCQ T;  4FYW B;  2K3B A;  5LJ5 f;  5GAN 5;  3PIO A;  4LUD A;  5GAN 8;  2COY A;  2GNC A;  4M7A G;  4FT4 A;  3NMZ C;  4M78 E;  1OU9 A;  3OBY A;  1GRI A;  2X3X D;  3NTH A;  3VS7 A;  3JCM J;  4F7U F;  4LD6 A;  1RAB B;  3L2Z A;  1TU0 B;  2XHC A;  4KUD K;  4RTY A;  2KSS A;  4Y92 A;  4KBM B;  4HCC A;  2R5A A;  3VRY A;  2CUD A;  1RUW A;  3GPL A;  1RI9 A;  1N27 A;  2JS2 A;  2LCL A;  1K76 A;  3JCM e;  2L5Q A;  2DEU A;  5KE2 A;  3S3N A;  1K9M R;  3C4S A;  2DRK A;  4J7I A;  4RTZ A;  1H3Z A;  4BDZ A;  1I81 A;  5IHI A;  1YHQ T;  2QQ9 A;  2DL4 A;  6AT1 B;  1KHC A;  2YUO A;  3QBY A;  1KQS S;  3J81 E;  4J9I A;  3MP6 A;  3IQL A;  1MMG A;  1AZE A;  1WHG A;  1GFD A;  3TQ7 P;  1XOV A;  2XDP A;  1K1Z A;  2FHD A;  4ANJ A;  4BI4 A;  2HKQ B;  1UEB A;  2KRS A;  1ZSZ C;  4C0F A;  1CSK A;  3GNF B;  1QW1 A;  2FPF A;  2R58 A;  5CQX A;  8AT1 B;  1W2B P;  2RB6 A;  4N0A C;  2AIR B;  2R5M A;  4JRP A;  3BE3 A;  2DE0 X;  1H8K A;  2DNU A;  3M0T A;  3LGF A;  5CIU A;  3PTA A;  4JLI A;  5LL6 S;  4HT9 A;  4PFZ A;  1D0Z A;  3RBB B;  1YJ9 A;  2LP5 A;  4MZP A;  3GP8 A;  4JUV A;  3E1S A;  4TVR A;  3ME9 A;  1IRE B;  2RF0 A;  2E12 A;  3A98 A;  2QI2 A;  5GAO r;  4WTO B;  1R77 A;  4EMH A;  2LTO A;  4Y28 E;  4C0Z A;  1X69 A;  1KK7 A;  2DK3 A;  4ME7 A;  4DBF A;  4R56 A;  1U3O A;  1OPK A;  1X75 C;  3JB9 D;  3NTK A;  5KH6 A;  2HBW A;  2MF2 A;  2QTX A;  1NM7 A;  2VUB A;  1FX7 A;  3JCM V;  1N8R R;  2E10 A;  2HBP A;  1JJ2 P;  1ZA1 B;  4FM4 B;  4BY6 B;  3OA6 A;  4A4E A;  2JT4 A;  1PCX A;  3U23 A;  2GQI A;  1NYG A;  2NUZ A;  2LCC A;  1LPL A;  1I1J A;  3VS6 A;  1PD0 A;  4M78 F;  1O9S A;  3OYB A;  2YRV A;  1Q81 C;  4OMM A;  3JRZ A;  2DAQ A;  4LUE A;  4F7U E;  5HY6 A;  2F69 A;  5LJ5 g;  3CC2 Q;  2B8A A;  2X9H A;  4FT2 A;  1D0X A;  3CCS Q;  3CCV T;  1M3B A;  1KIK A;  1TOV A;  4CC2 A;  3CC7 Q;  3AT1 B;  3H0I A;  2KRO A;  2XU8 A;  1YFN A;  3CCV A;  4M78 G;  1UGR B;  3CPF A;  1WLP B;  1TUG B;  4XTX A;  1M1F A;  2PQW A;  1MNE A;  1OOT A;  1KQ1 A;  1V76 A;  1GBR A;  3LWI A;  1D1A A;  4F7U B;  3KXT A;  4Y91 A;  1R0B G;  3H8Z A;  3DB3 A;  1OEB A;  2KK4 A;  3KFV A;  3QHS A;  4IIM A;  3OY9 A;  5GAO n;  3LW5 E;  1VQ6 A;  3G6E T;  4JRQ A;  4ZGE B;  2VXF A;  2DMO A;  1TSF A;  1YIT A;  5KYN A;  4FYY B;  3RKX A;  1VQK A;  5CO7 A;  1NPP A;  2PNI A;  2YRD A;  3FIF A;  4X1V A;  2GBQ A;  1BB9 A;  3WXM B;  3JB9 I;  5ECA A;  1GCQ C;  2F2X A;  1N5Z A;  2MIO A;  3VS2 A;  1M8M A;  2X3W D;  4J9G A;  3UDC A;  1PG5 B;  1OZ3 A;  1Z9Q A;  2EJ9 A;  4F17 A;  4JS4 A;  4HVV A;  4C8Q A;  1BCM A;  2ZZD A;  2GTJ A;  3LX7 A;  1VQM T;  5L23 A;  5A0D A;  1VQK T;  2QXF A;  3EGD B;  2OTL Q;  3SB2 A;  2RQR A;  3ZEH A;  4F14 A;  2QEX Q;  4XK8 E;  1B34 B;  3SEM A;  4WF2 A;  4AFS C;  4XTZ A;  4KT0 E;  2ZCF B;  1WXU A;  1K73 U;  2KXD A;  4RCB A;  3BDL A;  1CKB A;  3P8B B;  2HAX A;  1P92 A;  3I55 A;  4M77 G;  4YTL A;  5EC7 A;  3GLX A;  1M9S A;  3JCM Q;  3H0F A;  1UGP B;  1VYV A;  1TXQ A;  1W2B S;  2KNB B;  5CKD A;  4IUV A;  2DJZ A;  2RJE A;  1WIE A;  2YUN A;  4NS5 A;  1BI2 A;  2LQW A;  2D8J A;  1BI1 A;  3CC7 A;  4LDW A;  2DL5 A;  2W0Z A;  4N0A A;  2XMF A;  2J7I A;  8ATC B;  1AWO A;  1ZUK A;  2VKN A;  1G5V A;  3HFO A;  3CD6 A;  2QGG A;  2O9S A;  4C5E A;  5GAM d;  2MCN A;  2RQW A;  1S72 A;  4M7D D;  1IO6 A;  1Q86 U;  1KC8 C;  1S1N A;  3VYH B;  2E65 A;  3MCA B;  3QPH A;  2YXY A;  4E7K A;  1M1K R;  2DJQ A;  2DVE A;  2HL5 C;  3I56 A;  2ATC B;  2PUO B;  1SPK A;  1OQK A;  1UJY A;  3SWN C;  5GAN j;  3CXC A;  2DPP B;  3OS5 A;  3MEW A;  1UG1 A;  4RUG A;  4HT8 A;  3CCM T;  2HZY A;  1JXO A;  4LN2 A;  1UEC A;  4C92 E;  2YUP A;  1WHL A;  4M7D C;  1H3H A;  3CC2 A;  2RM4 A;  4FW2 A;  4M78 D;  2KRM A;  1YN8 A;  1VQP A;  4GBQ A;  3TSW A;  1MND A;  4GLK A;  4HXJ A;  4LNP A;  4FYV B;  5GAO q;  1GBQ A;  1G3Y A;  2RI2 A;  1QMC A;  1WJR A;  2DTI A;  3BDU A;  3G4S T;  2LNH B;  2LC4 A;  2E5K A;  2K79 A;  1MMN A;  4PJM A;  4LDX A;  2V1R A;  4BB7 A;  3M0S A;  1RAC B;  4JLG A;  5DLQ E;  1SSH A;  1LJO A;  1M1G A;  4MDX A;  2QA4 A;  5GAN 3;  4BI8 B;  2OTL T;  4XU2 A;  5DY9 A;  4PKC C;  2YSQ A;  2FVU A;  2X4W A;  1YNZ A;  1I4K 1;  1NZ9 A;  1YIJ A;  3QII A;  2JMC A;  2B86 A;  2KEA A;  1KQS P;  1OYX A;  3NGP A;  1VQN A;  2C0T A;  3NFC A;  2EQM A;  3V7C A;  3JB9 H;  3EFS A;  2D0Q B;  4UC4 A;  3OW2 P;  5GAN 4;  4IUR A;  5GAM e;  3JAM E;  1QQJ A;  1WXT A;  3EFO A;  4XTW A;  1VQN T;  1SRL A;  3EFR A;  2OAU A;  1NJI C;  2P0Q A;  1ZSG A;  1PRM C;  2LDM A;  2GCX A;  3OYI A;  5GAN g;  1GFC A;  2RD1 A;  1RAG B;  5GMK l;  4M7A C;  4HKE A;  3M5A A;  1X2K A;  2XK0 A;  4ESR A;  4DEY A;  4QVC A;  1TUC A;  5GJV B;  3MP8 A;  1VQL A;  2O31 A;  4AFU C;  2J6F A;  3D7S B;  3SDZ A;  4RTT A;  4JRI A;  3HPW A;  2MAM A;  1D0Y A;  1OU8 A;  3L1A A;  2FB7 A;  2FPD A;  2HQX A;  1K73 C;  3OW2 A;  3FB9 A;  5FW9 A;  5GMK m;  1NBE B;  5CKF A;  1VQ4 A;  2BZ8 A;  4CC7 A;  1M30 A;  1T0J A;  3EG1 A;  3MEU A;  3OB9 A;  4M7D G;  3MHX A;  3CCM A;  1I07 A;  1J3T A;  3OS0 A;  5AYF A;  4J6Y A;  5A2Q E;  2QAS A;  4M7A B;  1Q95 G;  5GAO l;  2XID A;  4AG2 C;  3F70 A;  3QDF A;  2WSE E;  1PKS A;  2O9V A;  2EGC A;  1PKT A;  4PJO A;  1M2O A;  3EGX A;  1H64 1;  1MMD A;  1WFW A;  1VQ4 T;  2QGF B;  2CGH A;  2QQR A;  3EG2 A;  1SKU B;  1R0C B;  2DM1 A;  5CQY A;  5GMK h;  4KGV B;  2GFA A;  2JXB A;  3DKM A;  1YJW Q;  4C8Q C;  2L3P A;  3HSB A;  3MKD A;  3ULR B;  1IHV A;  4EDU A;  1B7T A;  3UPU A;  1YJW A;  2JJ9 A;  2CP3 A;  4OVA A;  3RDV A;  2CDT A;  5DM7 R;  1AEY A;  1UUE A;  2QA4 Q;  2Y4Y A;  1KFZ A;  1EFN A;  1TS9 A;  1X6G A;  4L59 A;  1QP2 A;  2CSI A;  5CR2 A;  1ZLM A;  4PL6 A;  2VB6 A;  4AFZ C;  2QAZ A;  1XQH A;  3UF4 A;  4PJO E;  2ROT A;  2Y90 A;  3FRN A;  4RTX A;  2OTJ A;  3L2Q A;  4C92 A;  3LYI A;  4JZ3 A;  3CCU T;  3VYG A;  3C12 A;  4M75 B;  2VXE A;  2X4X A;  2LJ0 A;  4PJN A;  4Q5W A;  4ORZ A;  1MMA A;  2L2P A;  3HP9 A;  1WDX A;  1H92 A;  5GAN f;  2A37 A;  5J3B A;  1BKB A;  2JTE A;  1KQ2 A;  4BE1 A;  3GOX A;  1VQ5 Q;  3LWH A;  2BE7 D;  4DA4 A;  1F1B B;  3BY7 A;  1AZG B;  1M90 R;  5A0L A;  1PSE A;  2O4X B;  4KRT A;  3JV3 A;  2DYB A;  1C0M A;  3E2U A;  1Y57 A;  2J06 A;  4E7Z A;  2DKG A;  2QDY B;  5LJ3 e;  3I56 Q;  2GF7 A;  3CCE Q;  3H9N A;  5FU6 B;  4PK4 A;  2BKD N;  1NJI R;  2KXC A;  2CP6 A;  3CBM A;  3M0R A;  2R57 A;  4QT7 A;  2P4R A;  3HRS A;  1VQ7 Q;  1ZUU A;  1UJ0 A;  4EPC A;  2K2M A;  2DXU A;  2LVM A;  4HVW A;  4C92 C;  1OPL A;  2RHX A;  4OP0 A;  4PLI A;  2A08 A;  2CH4 A;  4QQD A;  3V8L A;  1PWT A;  2EW3 A;  2ED0 A;  1VQL Q;  3CME A;  3OYJ A;  1EX4 A;  2A36 A;  1HD3 A;  3A8O B;  4QW2 A;  1NEB A;  4XQ3 A;  4KGX B;  5L8R E;  2ZPE B;  5GMK j;  1WZO A;  3A5Z B;  1K0X A;  3ZFJ A;  1QVG A;  3TEE A;  2EJG A;  4M77 E;  1VQM Q;  3I5S A;  1TUD A;  3VS1 A;  4OMN A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 3G6E Q;  1VQ5 Q;  3CC2 Q;  3I56 Q;  1VQK Q;  2OTL Q;  3CMA Q;  1N8R R;  3OW2 P;  1YJ9 Q;  3CPW P;  1QVG P;  3CCV Q;  1K9M R;  3G71 Q;  3CC4 Q;  1JJ2 P;  1YIT Q;  1VQL Q;  3CCE Q;  3CCL Q;  3CCS Q;  1Q82 R;  1NJI R;  1M90 R;  2QA4 Q;  2QEX Q;  3CCU Q;  1VQ9 Q;  3CC7 Q;  1QVF P;  3CCR Q;  3CCJ Q;  1K8A R;  3CD6 Q;  3G4S Q;  1W2B P;  1YJN Q;  2OTJ Q;  1KQS P;  1S72 Q;  1YI2 Q;  1YHQ Q;  3I55 Q;  1KC8 R;  1VQ7 Q;  1VQO Q;  1Q86 R;  1VQP Q;  1VQ4 Q;  1YIJ Q;  3CCM Q;  1YJW Q;  1Q7Y R;  1KD1 R;  1VQ8 Q;  1VQM Q;  1M1K R;  1K73 R;  1VQN Q;  3CXC P;  1VQ6 Q;  3CME Q;  3CCQ Q;  1Q81 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...