3CMEQ

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cmeQ00
1Q86R 1KC8R 1VQ4Q 3CCVQ 1Q7YR 3CPWP 3CCEQ 3I56Q 1YJNQ 3G6EQ 1VQKQ 1VQPQ 1S72Q 3CMEQ 1VQMQ 1VQOQ 3CCQQ 1W2BP 3CD6Q 3CCLQ 1YJWQ 1VQ5Q 3G71Q 3CCRQ 3I55Q 1YIJQ 3CMAQ 1Q81R 1N8RR 3CC4Q 1KD1R 2QA4Q 1M90R 1JJ2P 1YHQQ 1VQ7Q 1VQ9Q 1NJIR 1VQ6Q 2OTJQ 1VQNQ 1YITQ 3CCSQ 3OW2P 1VQLQ 1QVGP 3CXCP 2OTLQ 1KQSP 1K8AR 3G4SQ 3CCJQ 3CC2Q 1YJ9Q 2QEXQ 1K9MR 3CCMQ 1Q82R 3CC7Q 1M1KR 1YI2Q 1VQ8Q 1QVFP 3CCUQ 1K73R
chains in the Genus database with same CATH superfamily
2X51A 2FYKA 2RJEA 2F2XA 2XG8D 2AZSA 3SD4A 1M8MA 4HT9A 2KT8A 1KD1R 1UDLA 3V7SA 1Q81U 1AEYA 2K57A 2HD0A 1YNZA 1VQ8Q 2R58A 3G6ET 4PJNA 2FZCB 4RTZA 1PD1A 2RK1A 2HCKA 3CPWP 1QKXA 4C5HA 4KGXB 3CC4T 4N4HA 1WLPB 3C12A 2VYTA 3H0IA 1JJ2P 1VQ7Q 3SWNC 2F69A 2H3EB 3LLRA 2ZAEA 2KROA 3M53A 3OYDA 4LN2A 3EG0A 3ASKA 1W4SA 4C0DB 4M77D 4RTUA 1U3OA 2P0PA 3RNJA 2LQNA 4BI4A 2EGCA 3CCQA 2B86A 5CQYA 3OS1A 1I5OB 5CO7A 1VQNT 1EFNA 2LCCA 5CVIA 3OYJA 2XKOC 3CCMT 1VQLQ 1YI2T 1BIBA 1UGRB 3CXCP 4PLIA 2KSSA 4M77C 1YJ9Q 1K9MR 5GMKm 2L89A 2DBMA 4M7DG 3LH5A 2EGAA 3HL8A 3VUZA 2R5AA 3BDUA 1G2BA 2M1HA 3HRUA 4MMLA 1VQ5Q 3V7CA 3A8GB 2LC4A 3SEMA 1GFDA 1LNXA 1QVGP 4XK8E 1WFWA 2DK3A 1IGUA 4BDZA 3PTAA 2CP6A 4BD3A 1TUCA 1VQOT 1NYFA 2F2WA 4IKFA 1X75C 2GGRA 4E7SA 2A08A 2F5KA 3I35A 4IUPA 3EHRA 2J06A 2JUFA 2DPPB 3MJXA 4XU3A 1H3ZA 1OI1A 2DZ9A 1RI0A 2DRMA 1MUZA 4C92E 1WA7A 2HSPA 1D0YA 1M2OA 3OYFA 1BI0A 1QKWA 2Y90A 3RUXA 1M90C 5GAN8 1S72Q 4P5NA 3UDCA 3M56A 7AT1B 3S3NA 3EFOB 1ZA1B 3CCSQ 2F1LA 2OI3A 2X4JA 4RTTA 4F7UF 5FW9A 2WSCE 3EH1A 4L59A 4IUQA 1QP2A 2BUDA 5AT1B 3BFMA 5GANf 3DLLA 3J80E 2KI7A 4Z8AA 1ZHIA 5CKBA 3FC3A 1UB4A 4QQ6A 2KRMA 4C92A 4NOYA 4LDUA 4BE1A 3QZ9B 3JCMg 1SRMA 5KYYA 5GAMj 3NPFA 2OTLA 4C92B 2L3QA 1G3WA 4FYXB 3CXCS 2VGNA 2ESWA 1VQ8T 1X01A 2MYSA 4KULA 2RQVA 5L8RE 4WF2A 3CCVA 1MNDA 3ZL7C 2QQRA 4E7IA 2FPEA 2MI6A 2YUQA 4ZGDB 4AMCA 1Q7YU 2HBPA 1RAFB 3QIIA 3SB2A 4OB2B 1Y57A 4CC7A 4KGZB 1SRLA 1QVGS 2ZGWA 4FW2A 5D7UA 3E9FA 3G1JA 1BCOA 3RESA 3KBGA 2ZPIB 2RNAA 2FEIA 2DETA 2CP0A 2PU9B 1VQPA 3CMET 1K1ZA 2COWA 2RMOA 3CCRT 2RF0A 5GAMg 4JRIA 1NJIC 1VQ6A 3MEAA 3EGUA 3VS5A 3JCMe 3JRZA 3VU3C 3LX7A 3CC7T 5GMKe 1MV3A 2YWWA 5FWBA 1NLPC 2JW4A 3DLMA 4PJJA 1VQ4A 1UUEA 3QDFA 1D3BA 5LJ3d 3GF5A 5GAN4 1SSFA 3THKA 3CD6T 2RJDA 2CH4W 2K4YA 4PLLA 4JZ3A 1KIKA 3M55A 1U1TA 3JCMc 1QVFS 2JOYA 1K8AR 4HCCA 2D0NA 2L3SA 2XDBA 4RTYA 5FRNA 1Y96A 2LNHB 2J05A 2PVOB 5GAMe 2J6FA 4Q5WA 1Y96B 2DLPA 2RQWA 4OGEA 3URGA 5A0LA 3RKWA 1QVPA 1KD1U 3VS2A 2PUKB 2ZPGB 5KCHA 4JJNK 2DO3A 3NFCA 2YUOA 1YWOA 4E7KA 3QJYA 1GCQC 1KC8R 5FU6B 2VUBA 1H641 1AZGB 1MV0B 2H3JA 2RQRA 4LD9K 1C6VX 3KXTA 3J7AF 2X4YA 3HRTA 3CCST 1YIJQ 1A0NB 2EPDA 4PL6A 4QVZA 2A36A 1WJQA 1VYTA 2FPFA 1T0HA 3U23A 4UC4A 2LP5A 1ZA2B 3QUIA 2RI5A 4J9GA 3FB9A 2COZA 3WXMB 4TVRA 2YLBA 3OW2A 1UG1A 1W2BP 2L3PA 4JRQA 1SHFA 2FZKB 3QDRB 3PNWC 1M1GA 5FU7B 4M77A 1RAIB 2MF2A 5KH6A 2AKLA 2BE7D 1X6GA 2MIOA 4J9DA 2O9VA 1ZBJA 4J9BA 1K9MU 1NEBA 3VV0A 1F1BB 3FLGA 1MMNA 1V1CA 1HD3A 2GQVA 3QG1A 5DY9A 3CCEA 2QA4A 3HKSA 4BDYA 4A4FA 1NZ9A 1ZBXA 3LWIA 4JJBA 3OS2A 3GNGA 2CSIA 5GAOq 2F2VA 1Q86C 1N6AA 5LJ5d 4A4HA 5GAOl 4M7DF 3M0PA 2DIGA 3I56Q 4J6XA 4C8QG 2KNBB 2HSEB 2HKNA 2KVQG 2YLCA 3MP8A 4M4ZA 4JRPA 2A28A 1WHKA 2V8KA 3C4SA 4EMKA 2RJFA 3P8DA 2EW3A 4E2FB 2GFUA 5J26A 2KMTA 2HKQB 2LDMA 4PJOE 4EMKB 1SG5A 1CSKA 2RD1A 5D6YA 2QK0A 3WVEB 1B7TA 2RK2A 4J9FA 3G71T 1N8RC 3E2UA 2MMPA 3VYGA 3OYGA 3MKDA 4HVUA 2BE9B 3CCLQ 1H92A 3JCMb 3PMIA 4CI0C 2Y4XA 2C0TA 3JAME 1OULA 4II1A 1UGPB 4Y92A 5LJ3f 2A7YA 5I2MA 1WXBA 2YRVA 4J83A 2V8IA 1HSQA 2RHXA 2AK5A 3LW5E 4QKUA 3VS6A 1UHCA 4Z89A 4M7DD 3G6EQ 1ZX6A 3CMAT 4JLGA 4PJOB 1G3TA 4ELZC 3NTIA 4AFQC 2CZ0B 1FWZA 1YHQQ 1KK7A 4JLIA 4F14A 1OOTA 4DOWA 3LGLA 2AT1B 4OP0A 4ZGJB 2FRWA 4Y91A 4M7DC 1YJWT 3D7SB 1YIJT 3CC4A 3OYLA 1RAHB 2A37A 2JM9A 2E6NA 1AVZC 3L2QA 1YCSB 3GPLA 3CCMQ 5GAOr 1YI2Q 4IIMA 3VUBA 4RMOA 3M0UA 2G3RA 2C0IA 4XTWA 3JCMX 5IHKA 1BCMA 3UT1A 1FMWA 1M1FA 1QCOA 1RUWA 1JU5C 3GIBA 1TTHB 2OTJT 1VQNA 4E47A 3M0RA 2I0NA 3CPFA 1YP5A 4OVAA 4F7UA 3CC2A 2O88A 1VIEA 4VUBA 4N4GA 3JCMh 1HYOA 2DXBA 1OQKA 3OYKA 4DEYA 2P4TA 3M54A 4F7UB 1M5Q1 5GMKh 1VQKT 2HL3A 1I81A 2ABLA 1U1SA 4MZMA 2P4RA 2DVEA 4K11A 1VQ9Q 2O01E 4OMFB 3G4SA 2KQWA 2M0YA 2KXDA 2CSQA 1UE9A 1ZLMA 2YRCA 1K8AU 4HKEA 4BE2A 2E3IA 2YUPA 2JMAA 4E7JA 1WJSA 1VQOA 3OYMA 3QBYA 3CBOA 1QWFA 5GAMh 2CS7A 4O5VA 2ZZDA 4XTXA 3CPWA 2L3RA 2KGTA 1GCQA 1UFFA 4J6WA 5LJ5f 3A8HB 3OYAA 3CEYA 2BZ8A 4FW1A 1JJ2A 1OV3A 1KC8U 4X34A 3CCLT 4IURA 3I55A 4IIOA 4X9DA 1UGQB 1Q95G 4NS5A 4ZTFA 5KCOA 1M30A 2QTXA 2QDYB 1N9SA 3CCUA 2QAZA 2QEXQ 1BB9A 1KQ1A 3VS3A 4JS4A 2JT4A 4PKCC 3OY9A 5GAN7 3PMTA 2DKGA 1LPLA 4M7AE 1Y0MA 1YHQT 3CXCA 5CKHA 2ROLA 2JMCA 2EYYA 1VQ8A 1IREB 4AG2C 1YN8A 4J6YA 6AT1B 2O9SA 8ATCB 3QSUA 1IXDA 4F17A 2DERA 1NE8A 5IT9E 3OYHA 3J81E 2QQ9A 1W70A 1VQ7A 1EX4A 3CMEQ 1VQMQ 1QVGA 1YITT 1I0CA 1JXOA 4JJDA 3L2WA 3CCRQ 2QDLA 3P8BB 4M7AA 1M90R 4B6MA 2DYIA 2HNIA 3QWYA 2CGHA 2NUTA 3UA7A 1GBQA 2XDDA 4M78D 4M7AB 3CC7Q 2CT4A 4JPBW 2PVDB 2JM8A 1NEGA 4D6WA 4DOVA 1BI3A 4LDXA 4R55A 3X28B 4PJLA 3CD6Q 1VQLA 3V7RA 1JO8A 4CRIA 1YJ9A 2DMOA 5GANg 4BE0A 4M78C 1SPKA 1K73C 4JZ4A 3SHWA 1OU8A 4HXJA 2M02A 3OSVA 3I5RA 1G5VA 4LDVA 4DBHA 1VQ5A 4AT1B 4C8QF 2M16A 3VRZA 1VQ9T 4L5GA 2GBQA 3GNFB 5GAMd 2L2PA 2PVGB 1K9AA 3QKJA 1RL2A 3HFOA 3VS1A 2DTOA 4J8OA 2JTMA 5GMKj 3MHXA 4A4KA 4QVDA 2NUPA 2QYZA 2O31A 3S3MA 1D0XA 4XTZA 1VOMA 5GAN6 2W0ZA 1WJRA 2DXUA 1NJIR 3M0QA 1J3TA 4AFUC 3UATA 2LCSA 1X2KA 2MAMA 1OPKA 5GANe 1QQJA 4OB3B 2RO0A 4FYYB 3ZEHA 1QVFP 4GLMA 2OAUA 3ER0A 3QPHA 4M7DA 2ED0A 4C0ZA 3DB4A 1S72A 4OMQA 3QJ6A 2V1QA 2Z0WA 4N4IA 1X43A 4C8QD 2P0KA 3CCSA 1QW1A 4KH0B 4M75E 3MO8A 3OS5A 2QEXT 1W1FA 4DBRA 3RR6A 3FRNA 2PUOB 5KYYB 2DZCA 2CYZB 2FB7A 1JQQA 5KE3A 4J9HA 2EYXA 4ZGEB 3MEUA 2K5LA 1GL5A 4V2SA 4RG8A 4EDUA 1D1BA 4C8QC 3HFNA 1WDXA 2FHDA 4C5IA 1WX6A 2P84A 2VWFA 4CC3A 5CR2A 5ECAA 4M75A 3H41A 1Y07A 3CCJQ 3JB9G 4Z88A 4M75B 2CP5A 3EFSA 4E7ZA 1BIAA 3CCQT 1VQMT 2K3XA 3O8VA 4B9WA 1V76A 1VUBA 2VVKA 1H8KA 1OX8A 1YBYA 2L8DA 4FU6A 4RTXA 1WHHA 1FMVA 4YTLA 4N0AA 3JCMV 3VRYA 2EKHA 1I1JA 5IH2A 2E5KA 1R0BG 2KR3A 2QASA 1MMDA 3M5AA 3H0HA 4ATOA 3LWHA 1IHVA 1D3BB 3G71Q 1GXIE 2GNCA 2EYZA 2CDTA 3TEEA 5HY6A 1T3LA 1KHCA 4AFSC 4EIKA 4EPCA 2JJ9A 1RAAB 2MWOA 2X3WD 3R6OA 1PWTA 2JS2A 2LMJA 3V8JA 1ZUKA 4HT8A 4KBMB 2D1XA 3CBMA 4PFPA 2K2MA 5A0DA 1QP3A 3CMAQ 5I22A 2EBPA 4QW2A 5CKEA 4M78G 3HTRA 1GCPA 2EGEA 3M0SA 3OYIA 3WVDB 2EIFA 2XU8A 2XMFA 2K2VA 3A5ZB 3VKIA 1Q86R 1W2BA 2QGFB 2E3HA 1K0SA 3PIPA 2KEAA 3H9NA 4HA8A 2L0AA 1YJWQ 2R57A 3SWNA 1E6GA 1AWWA 4KGVB 5GJVB 2ROTA 4M77E 4QQDA 2FRYA 2EQIA 3CBPA 3M4GA 1Q82C 4MDXA 2QQBA 3PVQA 3SWNB 4E6RA 2CREA 2MK5A 3VS0A 1WHJA 2GFAA 2NYSA 3QXEB 2RPNA 3FJPA 2CZ6B 1KFZA 1WQ7A 3JB9I 2ZPFB 1WPYA 5FROA 3L2VA 1YIJA 1CKBA 2MWPA 4GLKA 3QZ5B 3TREA 2CUDA 1N8RR 4OB0B 2EQJA 3RDVA 2OTJQ 1OEBA 1M1KC 1M90U 2J7IA 2WSEE 3NGPA 4ORZA 9ATCB 4B9XA 3CCVT 2KBTA 2KT1A 3AT1B 4Z02A 5FWCA 3JV3A 1JEGA 4M77B 1NG2A 2RHYA 1VQKQ 2EJFA 1AHJB 4WTOB 2V26A 5LJ3g 3QYGB 4C0DC 1WXTA 2KAFA 2QQSA 4OGCA 3CCJT 1X6BA 2JN0A 3OA6A 2XICA 1DJ7B 2GF7A 4PJOG 1IHWA 4HVWA 1OYXA 3O5ZA 4KUIA 2ZPBB 2DM1A 1VQ6T 3PE0A 3RKXA 5EG2A 2V8JA 1V29B 1B34A 1SKUB 1TWBA 4KH1B 5KYNA 1TOVA 1C1AA 2DTIA 1GRIA 1B34B 1VQ4T 3E19A 2B8AA 3NTKA 2E10A 2C0OA 1MHNA 3I56A 2DD5A 1EIFA 5I2SA 1M27C 5IHIA 1Q81C 2DYBA 3EHQA 1HK9A 2AKKA 1PM3A 2K7AA 5KYWA 5D6XA 2HMAA 5LJ3e 5C0MA 1NJIU 3QO3A 2RH2A 3SFMA 1BI2A 2DAQA 5GANh 5CK9A 1T3SA 1PC0A 3CCLA 1XTDA 3X24B 3JSCA 4RTVA 5IXBA 4BI3A 1QCNA 3SDZA 2HEQA 2H8HA 4OB1B 1X6OA 2FPDA 1K4US 4XU1A 2VXFA 1R0CB 2MPXC 3MP6A 3OYEA 1OU9A 2OX7A 3OB9A 2LQWA 1K0XA 2CUBA 4LUDA 3I5SA 2RQUA 3OBYA 1D09B 4A53A 1ZSZC 4PNOA 3G6EA 1S1NA 4FIBA 4F04B 3OSSC 4C8QA 1YHQA 4C92D 4FYWB 3RKYA 4FM4B 1WGSA 2SRCA 4RCBA 5GAOn 4F7UE 3OYCA 1YITQ 2QQAA 4AFZC 2HL5C 2LQKA 1UGSB 1TSFA 2E12A 4OMLA 5GAN5 3EG1A 4RTWA 2QI2A 2HQHA 4BUGA 2HAXA 4QT7A 4C92C 3L2UA 4A4EA 2RN8A 4A4GA 5LJ5g 2PNIA 3CCMA 1YI2A 1RACB 4LXCA 2DE0X 3NMZC 1PCXA 2OJ2A 1AZEA 3T9NA 4X9CA 1WHLA 1QMCA 3OYNA 3JB9F 2K79A 4Y28E 1YFNA 4CC2A 4IUUA 4RCCA 5DLQE 4NL3A 1T0JA 4BACA 2KK4A 3CCET 2AZVA 2QA4T 4OMNA 2JTEA 4LUEA 3JB9J 4QQGA 2CZ1B 4EMHA 2IIMA 3EGXA 3RBBB 1VA7A 3P8HA 3ULRB 2XHCA 1LJOA 2LVMA 2COYA 4FYVB 5HCKA 1YJNQ 3ZFJA 1B3QA 3EAEA 1VQ9A 5IN1A 3TSZA 1K76A 2CH4A 5LJ5e 1D1CA 4E7LA 1AWOA 4FT2A 2LJ1A 1TG0A 2RQTA 2W10A 3RERA 4F16A 3JB9D 1Q86U 2MCNA 4QVCA 1U8RA 2YT6A 1ZUYA 1HXDA 1H3HA 3DKMA 3LYIA 1PSEA 3NTHA 3JCMW 4LDYA 4M78F 2IVWA 1KJWA 2GQIA 2RHIA 2VB6A 2XDPA 5EC7A 3UA6A 1KQSP 4OMPA 3R6NA 1Q7YC 3GLXA 3HHTB 3EGDA 1UECA 1WQWA 1K73R 2DL3A 5CCAA 1GBRA 3MEVA 1IRXA 2C06A 3UF4A 3OS0A 1OPLA 4HCBA 4MMKA 3EGDB 3VS4A 4XTYA 1NPRA 2BIVA 1FMKA 2BTTA 2CT3A 5HKCA 2X4WA 4FCYA 2QEXA 1W6XA 2K6DA 1N8RU 1EZZB 4BI8B 5FU6C 5GANj 2KDSA 2DEUA 1E7OA 3M4YA 2M0OA 2VC8A 3LGFA 4ZTJA 2ED1A 2XK0A 2JS0A 4LNPA 3CCQQ 1VIFA 3G7ZA 2RB6A 1UJ0A 3M0TA 2LNVA 1FXXA 3JCMd 2QXFA 2NUTB 2YDLA 3FDRA 3FJ5A 1WZOA 5GAN2 3OQ5A 3CMEA 1VQMA 3CCRA 2RI3A 3E1SA 4PFZA 5FU7C 4ZN3A 2AIRB 4DBQA 5J39A 3CC2T 4RKUE 2DF6A 3CC7A 1M4ZA 2DTHA 1B07A 2BZXA 4CC4B 1ABOA 1N9RA 1PG5B 1UHFA 4C0FA 4C0GA 4PJOF 3H0FA 2CP7A 2RJCA 2JXBA 5I11A 3CD6A 5GJWB 4C92G 1KD1C 5GAN3 5DM7R 1QCFA 2DJZA 3UWNA 3G4ST 1QVFA 1M2VA 1IGQA 5HK0A 2DJQA 1KHIA 1ZQ1A 2YUNA 3E9GA 1KQSS 1CKAA 3OMCA 4PJMA 5CKFA 5KYXA 5LJ3h 4M7DE 1M2VB 2VGMA 2RM4A 1YJNT 2DD4A 2EWNA 4GBQA 5KYXB 2G6FX 3TU4K 2DRKA 4J5YA 1TUGB 1TXQA 4HCKA 1PKSA 2NUPB 3ME9A 3PGGA 2PQWA 1WYXA 2ZCFB 4EMKC 5CAIA 4M75G 4JS5A 2LX7A 4J7FA 3UPUA 5CKDA 1ZSZA 2X4XA 1ABQA 1RLQC 2D9TA 3CPWS 3QYHB 1BK2A 3Q1JA 1TH7A 2DVJA 4PJOD 1SF9A 1ZSZB 3EFOA 2CP2A 3I55T 1JJ2S 3NHNA 3VS7A 2DEQA 1LCKA 3KFVA 1LVKA 4KT0E 4M7DB 4ME7A 3L1AA 1K9MC 4ZNXA 3GBQA 1OZ3A 3HRSA 3CCUT 2OTLQ 1HJDA 3BW1A 5L23A 1VYVA 4BY6C 3GOXA 2DL5A 1KQ2A 1ARKA 4PJOC 3CCVQ 1IZ6A 2KE9A 5A0GA 5GAOm 2K5FA 3AHUA 4XU0A 2M51A 4DBFA 1MMAA 1WHMA 2GTOA 4C5GA 4LD6A 1I4K1 1D0ZA 2KYBA 4MZTA 2M9UA 2PZ1A 1AT1B 3A8OB 4O6JA 2SEMA 2K3YA 2WSFE 1RADB 1KG1A 1IO6A 1JB0E 4HVVA 2DXCA 2FO0A 1VQ7T 1ZSGA 3F70A 2D0QB 3BE3A 1VQPQ 3EFRA 4ELYC 2LJ3A 1WHGA 4OF1A 1RLPC 1PD0A 1UGVA 1VQ6Q 3OMGA 3CCJA 5C6SA 1NYGA 3I9QA 1Q82R 3EG3A 4J7IA 4JJCA 1VQ4Q 4XAXB 1AWXA 1JRIA 3EG2A 4L6V5 2X9HA 1Z9QA 1VQLT 3C94A 4FSSA 1YJ9T 4KUDK 4DEXA 2X35A 5DLOA 2VKNA 2OAWA 3JCMf 2D6FA 2O4XA 3CQTA 2O2OA 3QHSA 5GAOp 1M1KR 5LJ5h 4JRKA 3MPUB 1WXUA 2YXYA 4OMOA 2O4XB 2VASA 1VQ5T 1BKBA 3G71A 2CP3A 1QWEA 1I5LA 1RAEB 1N27A 3MEWA 2HQXA 2DXTA 2FL7A 2Y4YA 4M77G 3M58A 5GMKl 2EQMA 3GP8A 3PIOA 3QWXX 2KYMA 1Y71A 1MNEA 2LRQA 3JCMQ 1PSFA 4OMMA 5J3BA 3TCJA 1K73U 3CMAA 2WACA 2E5QA 2FZGB 4M7AF 2K5IA 5GAMf 2ENMA 5LJ3j 2FVUA 5KYUA 3X26B 1UEBA 2E70A 3BY7A 1M9SA 2DNUA 2DX1A 3FIFA 3H8ZA 4ZN1A 4XQ3A 1S72T 1KSWA 5KYUB 2ATCB 1YJWA 5FRMA 1MGQA 1OX9A 2LT4A 1PKTA 1Q81R 4M78E 1XNIA 5GMKi 2OTLT 1FX7A 1JXMA 1O9SA 2KRNA 1PRMC 2BZYA 1UJYA 1PHTA 1C0MA 1IB8A 3TVTA 2YHTA 1VYUA 1X27A 2HBWA 2CZ7B 3PT9A 1N5ZA 3JCMP 1FYNA 1RABB 3FEOA 3OYYA 2RA2A 1D1AA 1LOJA 4ANJA 3M57A 4WCIA 2OTJA 2DL7A 3VYHB 2IPOB 3CCEQ 2QA4Q 1K8AC 2KY9A 1AOJA 2HQEA 1AD5A 1MMGA 1JBMA 5HK3A 1X69A 4M7AD 4M78A 2QGGA 3DB3A 4HCZA 4R0KA 2LJ0A 1G8XA 3M9QA 3S3OA 4IUVA 2EJ9A 4M78B 4A54A 4JUVA 2LQ8A 1VQKA 2NWMA 2GTJA 1VQPT 4KRTA 2EKOA 2EYWA 2HZYA 1BU1A 5CQXA 3TQ7P 5AYFA 2A0FB 2E41A 2EAYA 2DBKA 4M7AC 5LL6S 4E7HA 3OW2P 3EH2A 2DFUA 5M9OA 1PNJA 1RI9A 3OBWA 1KC8C 4ESRA 2NLUA 1UTIA 1R8OB 2EVRA 2E1HA 3A1PA 3TSWA 2L5QA 4C92F 2EQKA 4FL6A 2F5TX 1OZ2A 1TU0B 3N5BB 2D8HA 1GFCA 4IUTA 3OYBA 3ZBDA 5KYWB 3PFSA 1M3BA 2LCLA 1WNLA 1BYMA 4C8QE 1TUDA 3L2RA 1G3YA 2BKDN 1I07A 5D6WA 2DL8A 3LH0A 2PTKA 1M8VA 4RUGA 1E6HA 4MDWA 3PVLA 4F7UG 4M75F 3VJPA 4AG1C 8AT1B 1BBZA 5LJ5j 3C95A 2AHJB 4PJOA 5A2QE 4NL2A 2J6OA 2HDAA 4LDWA 3A8LB 5IAYA 4BY6B 1W2BS 2LTOA 2LZ6B 2LT1A 3L42A 2NUZA 3CC4Q 3EG9A 2JZ2A 2A3LA 3L2ZA 4J9IA 4RG2A 4C8QB 1G83A 3REAB 2QTVA 2EJGA 4BB7A 3EG9B 1I8FA 1X2QA 2DIQA 2JVVA 4J9EA 4FT4A 2KRSA 3IQLA 2D8JA 4MZPA 2RHUA 3C0CA 3KUFA 5IHNA 4C5EA 2K3BA 3RIRA 1YITA 3X20B 1NBEB 2ZPEB 3OW2S 3BDLA 5I21A 3RMSA 1VQNQ 2ZPHB 1G3SA 3V8LA 1PRLC 4M75D 3CC2Q 4X1VA 1R77A 1BI1A 2EQUA 1NPPA 1Y7XA 1Q82U 2QG9B 2XIDA 2E64A 1QLYA 1Q7YR 3HP9A 5FLXE 4PK4A 1NM7A 1U5SA 1M3AA 2VV5A 2YRDA 2EFIA 2V1RA 3RMQA 4R56A 4XTUA 1RAGB 2DL4A 2KXCA 4FSXA 5IXFA 4M75C 4GY5A 4DA4A 1M3CA 4LE9A 5CIUA 3G4SQ 2FG0A 3REBB 4A63B 1WI7A 1AWJA 1YCYA 2IG0A 4EMGA 1M1KU 4D8DA 3JB9H 2CKKA 2E4HA 2E65A 2E6ZA 2JNGA 3EGXB 2YSQA 1ACMB 3H6ZA 1XOVA 1YWPA 1NLOC 4D8KA 3X25B 1O75A 3INZA 1VQOQ 3MP1A 1SHGA 1KQSA 2MOXA 2VXEA 5KE2A 1ZUUA 4J9CA 1SEMA 2RI2A 1XQHA 3JCMJ 3M59A 2K9GA 1XJWB 1SSHA 3A98A 3S6WA 4N0AC 4DQ2A 1P92A 2DILA 3I56T 2XI9A 1YJNA 2XD0A 5GANd 3A8MB 4JDSA 1U06A 3META 2P0QA 2RHZA 1TS9A 2EYQA 2ECZA 2LX9A 2J6KA 3I55Q 4XU2A 4M7AG 3V8KA 1WIEA 4PFOA 2GCXA 2DA9A 3MCAB 2X3XD 4XTVA 2JTFA 3HPWA 4M77F 2I2LA 3HSBA 2R5MA 1Z9ZA 3CCUQ
chains in the Genus database with same CATH topology
1Q86R 1KC8R 1VQ4Q 3CCVQ 1Q7YR 3CPWP 3CCEQ 3I56Q 1YJNQ 3G6EQ 1VQKQ 1VQPQ 1S72Q 3CMEQ 1VQMQ 1VQOQ 3CCQQ 1W2BP 3CD6Q 3CCLQ 1YJWQ 1VQ5Q 3G71Q 3CCRQ 3I55Q 1YIJQ 3CMAQ 1Q81R 1N8RR 3CC4Q 1KD1R 2QA4Q 1M90R 1JJ2P 1YHQQ 1VQ7Q 1VQ9Q 1NJIR 1VQ6Q 2OTJQ 1VQNQ 1YITQ 3CCSQ 3OW2P 1VQLQ 1QVGP 3CXCP 2OTLQ 1KQSP 1K8AR 3G4SQ 3CCJQ 3CC2Q 1YJ9Q 2QEXQ 1K9MR 3CCMQ 1Q82R 3CC7Q 1M1KR 1YI2Q 1VQ8Q 1QVFP 3CCUQ 1K73R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 R;  1KC8 R;  1VQ4 Q;  3CCV Q;  1Q7Y R;  3CPW P;  3CCE Q;  3I56 Q;  1YJN Q;  3G6E Q;  1VQK Q;  1VQP Q;  1S72 Q;  3CME Q;  1VQM Q;  1VQO Q;  3CCQ Q;  1W2B P;  3CD6 Q;  3CCL Q;  1YJW Q;  1VQ5 Q;  3G71 Q;  3CCR Q;  3I55 Q;  1YIJ Q;  3CMA Q;  1Q81 R;  1N8R R;  3CC4 Q;  1KD1 R;  2QA4 Q;  1M90 R;  1JJ2 P;  1YHQ Q;  1VQ7 Q;  1VQ9 Q;  1NJI R;  1VQ6 Q;  2OTJ Q;  1VQN Q;  1YIT Q;  3CCS Q;  3OW2 P;  1VQL Q;  1QVG P;  3CXC P;  2OTL Q;  1KQS P;  1K8A R;  3G4S Q;  3CCJ Q;  3CC2 Q;  1YJ9 Q;  2QEX Q;  1K9M R;  3CCM Q;  1Q82 R;  3CC7 Q;  1M1K R;  1YI2 Q;  1VQ8 Q;  1QVF P;  3CCU Q;  1K73 R; 
#chains in the Genus database with same CATH topology
 2X51 A;  2FYK A;  2RJE A;  2F2X A;  2XG8 D;  2AZS A;  3SD4 A;  1M8M A;  4HT9 A;  2KT8 A;  1KD1 R;  1UDL A;  3V7S A;  1Q81 U;  1AEY A;  2K57 A;  2HD0 A;  1YNZ A;  1VQ8 Q;  2R58 A;  3G6E T;  4PJN A;  2FZC B;  4RTZ A;  1PD1 A;  2RK1 A;  2HCK A;  3CPW P;  1QKX A;  4C5H A;  4KGX B;  3CC4 T;  4N4H A;  1WLP B;  3C12 A;  2VYT A;  3H0I A;  1JJ2 P;  1VQ7 Q;  3SWN C;  2F69 A;  2H3E B;  3LLR A;  2ZAE A;  2KRO A;  3M53 A;  3OYD A;  4LN2 A;  3EG0 A;  3ASK A;  1W4S A;  4C0D B;  4M77 D;  4RTU A;  1U3O A;  2P0P A;  3RNJ A;  2LQN A;  4BI4 A;  2EGC A;  3CCQ A;  2B86 A;  5CQY A;  3OS1 A;  1I5O B;  5CO7 A;  1VQN T;  1EFN A;  2LCC A;  5CVI A;  3OYJ A;  2XKO C;  3CCM T;  1VQL Q;  1YI2 T;  1BIB A;  1UGR B;  3CXC P;  4PLI A;  2KSS A;  4M77 C;  1YJ9 Q;  1K9M R;  5GMK m;  2L89 A;  2DBM A;  4M7D G;  3LH5 A;  2EGA A;  3HL8 A;  3VUZ A;  2R5A A;  3BDU A;  1G2B A;  2M1H A;  3HRU A;  4MML A;  1VQ5 Q;  3V7C A;  3A8G B;  2LC4 A;  3SEM A;  1GFD A;  1LNX A;  1QVG P;  4XK8 E;  1WFW A;  2DK3 A;  1IGU A;  4BDZ A;  3PTA A;  2CP6 A;  4BD3 A;  1TUC A;  1VQO T;  1NYF A;  2F2W A;  4IKF A;  1X75 C;  2GGR A;  4E7S A;  2A08 A;  2F5K A;  3I35 A;  4IUP A;  3EHR A;  2J06 A;  2JUF A;  2DPP B;  3MJX A;  4XU3 A;  1H3Z A;  1OI1 A;  2DZ9 A;  1RI0 A;  2DRM A;  1MUZ A;  4C92 E;  1WA7 A;  2HSP A;  1D0Y A;  1M2O A;  3OYF A;  1BI0 A;  1QKW A;  2Y90 A;  3RUX A;  1M90 C;  5GAN 8;  1S72 Q;  4P5N A;  3UDC A;  3M56 A;  7AT1 B;  3S3N A;  3EFO B;  1ZA1 B;  3CCS Q;  2F1L A;  2OI3 A;  2X4J A;  4RTT A;  4F7U F;  5FW9 A;  2WSC E;  3EH1 A;  4L59 A;  4IUQ A;  1QP2 A;  2BUD A;  5AT1 B;  3BFM A;  5GAN f;  3DLL A;  3J80 E;  2KI7 A;  4Z8A A;  1ZHI A;  5CKB A;  3FC3 A;  1UB4 A;  4QQ6 A;  2KRM A;  4C92 A;  4NOY A;  4LDU A;  4BE1 A;  3QZ9 B;  3JCM g;  1SRM A;  5KYY A;  5GAM j;  3NPF A;  2OTL A;  4C92 B;  2L3Q A;  1G3W A;  4FYX B;  3CXC S;  2VGN A;  2ESW A;  1VQ8 T;  1X01 A;  2MYS A;  4KUL A;  2RQV A;  5L8R E;  4WF2 A;  3CCV A;  1MND A;  3ZL7 C;  2QQR A;  4E7I A;  2FPE A;  2MI6 A;  2YUQ A;  4ZGD B;  4AMC A;  1Q7Y U;  2HBP A;  1RAF B;  3QII A;  3SB2 A;  4OB2 B;  1Y57 A;  4CC7 A;  4KGZ B;  1SRL A;  1QVG S;  2ZGW A;  4FW2 A;  5D7U A;  3E9F A;  3G1J A;  1BCO A;  3RES A;  3KBG A;  2ZPI B;  2RNA A;  2FEI A;  2DET A;  2CP0 A;  2PU9 B;  1VQP A;  3CME T;  1K1Z A;  2COW A;  2RMO A;  3CCR T;  2RF0 A;  5GAM g;  4JRI A;  1NJI C;  1VQ6 A;  3MEA A;  3EGU A;  3VS5 A;  3JCM e;  3JRZ A;  3VU3 C;  3LX7 A;  3CC7 T;  5GMK e;  1MV3 A;  2YWW A;  5FWB A;  1NLP C;  2JW4 A;  3DLM A;  4PJJ A;  1VQ4 A;  1UUE A;  3QDF A;  1D3B A;  5LJ3 d;  3GF5 A;  5GAN 4;  1SSF A;  3THK A;  3CD6 T;  2RJD A;  2CH4 W;  2K4Y A;  4PLL A;  4JZ3 A;  1KIK A;  3M55 A;  1U1T A;  3JCM c;  1QVF S;  2JOY A;  1K8A R;  4HCC A;  2D0N A;  2L3S A;  2XDB A;  4RTY A;  5FRN A;  1Y96 A;  2LNH B;  2J05 A;  2PVO B;  5GAM e;  2J6F A;  4Q5W A;  1Y96 B;  2DLP A;  2RQW A;  4OGE A;  3URG A;  5A0L A;  3RKW A;  1QVP A;  1KD1 U;  3VS2 A;  2PUK B;  2ZPG B;  5KCH A;  4JJN K;  2DO3 A;  3NFC A;  2YUO A;  1YWO A;  4E7K A;  3QJY A;  1GCQ C;  1KC8 R;  5FU6 B;  2VUB A;  1H64 1;  1AZG B;  1MV0 B;  2H3J A;  2RQR A;  4LD9 K;  1C6V X;  3KXT A;  3J7A F;  2X4Y A;  3HRT A;  3CCS T;  1YIJ Q;  1A0N B;  2EPD A;  4PL6 A;  4QVZ A;  2A36 A;  1WJQ A;  1VYT A;  2FPF A;  1T0H A;  3U23 A;  4UC4 A;  2LP5 A;  1ZA2 B;  3QUI A;  2RI5 A;  4J9G A;  3FB9 A;  2COZ A;  3WXM B;  4TVR A;  2YLB A;  3OW2 A;  1UG1 A;  1W2B P;  2L3P A;  4JRQ A;  1SHF A;  2FZK B;  3QDR B;  3PNW C;  1M1G A;  5FU7 B;  4M77 A;  1RAI B;  2MF2 A;  5KH6 A;  2AKL A;  2BE7 D;  1X6G A;  2MIO A;  4J9D A;  2O9V A;  1ZBJ A;  4J9B A;  1K9M U;  1NEB A;  3VV0 A;  1F1B B;  3FLG A;  1MMN A;  1V1C A;  1HD3 A;  2GQV A;  3QG1 A;  5DY9 A;  3CCE A;  2QA4 A;  3HKS A;  4BDY A;  4A4F A;  1NZ9 A;  1ZBX A;  3LWI A;  4JJB A;  3OS2 A;  3GNG A;  2CSI A;  5GAO q;  2F2V A;  1Q86 C;  1N6A A;  5LJ5 d;  4A4H A;  5GAO l;  4M7D F;  3M0P A;  2DIG A;  3I56 Q;  4J6X A;  4C8Q G;  2KNB B;  2HSE B;  2HKN A;  2KVQ G;  2YLC A;  3MP8 A;  4M4Z A;  4JRP A;  2A28 A;  1WHK A;  2V8K A;  3C4S A;  4EMK A;  2RJF A;  3P8D A;  2EW3 A;  4E2F B;  2GFU A;  5J26 A;  2KMT A;  2HKQ B;  2LDM A;  4PJO E;  4EMK B;  1SG5 A;  1CSK A;  2RD1 A;  5D6Y A;  2QK0 A;  3WVE B;  1B7T A;  2RK2 A;  4J9F A;  3G71 T;  1N8R C;  3E2U A;  2MMP A;  3VYG A;  3OYG A;  3MKD A;  4HVU A;  2BE9 B;  3CCL Q;  1H92 A;  3JCM b;  3PMI A;  4CI0 C;  2Y4X A;  2C0T A;  3JAM E;  1OUL A;  4II1 A;  1UGP B;  4Y92 A;  5LJ3 f;  2A7Y A;  5I2M A;  1WXB A;  2YRV A;  4J83 A;  2V8I A;  1HSQ A;  2RHX A;  2AK5 A;  3LW5 E;  4QKU A;  3VS6 A;  1UHC A;  4Z89 A;  4M7D D;  3G6E Q;  1ZX6 A;  3CMA T;  4JLG A;  4PJO B;  1G3T A;  4ELZ C;  3NTI A;  4AFQ C;  2CZ0 B;  1FWZ A;  1YHQ Q;  1KK7 A;  4JLI A;  4F14 A;  1OOT A;  4DOW A;  3LGL A;  2AT1 B;  4OP0 A;  4ZGJ B;  2FRW A;  4Y91 A;  4M7D C;  1YJW T;  3D7S B;  1YIJ T;  3CC4 A;  3OYL A;  1RAH B;  2A37 A;  2JM9 A;  2E6N A;  1AVZ C;  3L2Q A;  1YCS B;  3GPL A;  3CCM Q;  5GAO r;  1YI2 Q;  4IIM A;  3VUB A;  4RMO A;  3M0U A;  2G3R A;  2C0I A;  4XTW A;  3JCM X;  5IHK A;  1BCM A;  3UT1 A;  1FMW A;  1M1F A;  1QCO A;  1RUW A;  1JU5 C;  3GIB A;  1TTH B;  2OTJ T;  1VQN A;  4E47 A;  3M0R A;  2I0N A;  3CPF A;  1YP5 A;  4OVA A;  4F7U A;  3CC2 A;  2O88 A;  1VIE A;  4VUB A;  4N4G A;  3JCM h;  1HYO A;  2DXB A;  1OQK A;  3OYK A;  4DEY A;  2P4T A;  3M54 A;  4F7U B;  1M5Q 1;  5GMK h;  1VQK T;  2HL3 A;  1I81 A;  2ABL A;  1U1S A;  4MZM A;  2P4R A;  2DVE A;  4K11 A;  1VQ9 Q;  2O01 E;  4OMF B;  3G4S A;  2KQW A;  2M0Y A;  2KXD A;  2CSQ A;  1UE9 A;  1ZLM A;  2YRC A;  1K8A U;  4HKE A;  4BE2 A;  2E3I A;  2YUP A;  2JMA A;  4E7J A;  1WJS A;  1VQO A;  3OYM A;  3QBY A;  3CBO A;  1QWF A;  5GAM h;  2CS7 A;  4O5V A;  2ZZD A;  4XTX A;  3CPW A;  2L3R A;  2KGT A;  1GCQ A;  1UFF A;  4J6W A;  5LJ5 f;  3A8H B;  3OYA A;  3CEY A;  2BZ8 A;  4FW1 A;  1JJ2 A;  1OV3 A;  1KC8 U;  4X34 A;  3CCL T;  4IUR A;  3I55 A;  4IIO A;  4X9D A;  1UGQ B;  1Q95 G;  4NS5 A;  4ZTF A;  5KCO A;  1M30 A;  2QTX A;  2QDY B;  1N9S A;  3CCU A;  2QAZ A;  2QEX Q;  1BB9 A;  1KQ1 A;  3VS3 A;  4JS4 A;  2JT4 A;  4PKC C;  3OY9 A;  5GAN 7;  3PMT A;  2DKG A;  1LPL A;  4M7A E;  1Y0M A;  1YHQ T;  3CXC A;  5CKH A;  2ROL A;  2JMC A;  2EYY A;  1VQ8 A;  1IRE B;  4AG2 C;  1YN8 A;  4J6Y A;  6AT1 B;  2O9S A;  8ATC B;  3QSU A;  1IXD A;  4F17 A;  2DER A;  1NE8 A;  5IT9 E;  3OYH A;  3J81 E;  2QQ9 A;  1W70 A;  1VQ7 A;  1EX4 A;  3CME Q;  1VQM Q;  1QVG A;  1YIT T;  1I0C A;  1JXO A;  4JJD A;  3L2W A;  3CCR Q;  2QDL A;  3P8B B;  4M7A A;  1M90 R;  4B6M A;  2DYI A;  2HNI A;  3QWY A;  2CGH A;  2NUT A;  3UA7 A;  1GBQ A;  2XDD A;  4M78 D;  4M7A B;  3CC7 Q;  2CT4 A;  4JPB W;  2PVD B;  2JM8 A;  1NEG A;  4D6W A;  4DOV A;  1BI3 A;  4LDX A;  4R55 A;  3X28 B;  4PJL A;  3CD6 Q;  1VQL A;  3V7R A;  1JO8 A;  4CRI A;  1YJ9 A;  2DMO A;  5GAN g;  4BE0 A;  4M78 C;  1SPK A;  1K73 C;  4JZ4 A;  3SHW A;  1OU8 A;  4HXJ A;  2M02 A;  3OSV A;  3I5R A;  1G5V A;  4LDV A;  4DBH A;  1VQ5 A;  4AT1 B;  4C8Q F;  2M16 A;  3VRZ A;  1VQ9 T;  4L5G A;  2GBQ A;  3GNF B;  5GAM d;  2L2P A;  2PVG B;  1K9A A;  3QKJ A;  1RL2 A;  3HFO A;  3VS1 A;  2DTO A;  4J8O A;  2JTM A;  5GMK j;  3MHX A;  4A4K A;  4QVD A;  2NUP A;  2QYZ A;  2O31 A;  3S3M A;  1D0X A;  4XTZ A;  1VOM A;  5GAN 6;  2W0Z A;  1WJR A;  2DXU A;  1NJI R;  3M0Q A;  1J3T A;  4AFU C;  3UAT A;  2LCS A;  1X2K A;  2MAM A;  1OPK A;  5GAN e;  1QQJ A;  4OB3 B;  2RO0 A;  4FYY B;  3ZEH A;  1QVF P;  4GLM A;  2OAU A;  3ER0 A;  3QPH A;  4M7D A;  2ED0 A;  4C0Z A;  3DB4 A;  1S72 A;  4OMQ A;  3QJ6 A;  2V1Q A;  2Z0W A;  4N4I A;  1X43 A;  4C8Q D;  2P0K A;  3CCS A;  1QW1 A;  4KH0 B;  4M75 E;  3MO8 A;  3OS5 A;  2QEX T;  1W1F A;  4DBR A;  3RR6 A;  3FRN A;  2PUO B;  5KYY B;  2DZC A;  2CYZ B;  2FB7 A;  1JQQ A;  5KE3 A;  4J9H A;  2EYX A;  4ZGE B;  3MEU A;  2K5L A;  1GL5 A;  4V2S A;  4RG8 A;  4EDU A;  1D1B A;  4C8Q C;  3HFN A;  1WDX A;  2FHD A;  4C5I A;  1WX6 A;  2P84 A;  2VWF A;  4CC3 A;  5CR2 A;  5ECA A;  4M75 A;  3H41 A;  1Y07 A;  3CCJ Q;  3JB9 G;  4Z88 A;  4M75 B;  2CP5 A;  3EFS A;  4E7Z A;  1BIA A;  3CCQ T;  1VQM T;  2K3X A;  3O8V A;  4B9W A;  1V76 A;  1VUB A;  2VVK A;  1H8K A;  1OX8 A;  1YBY A;  2L8D A;  4FU6 A;  4RTX A;  1WHH A;  1FMV A;  4YTL A;  4N0A A;  3JCM V;  3VRY A;  2EKH A;  1I1J A;  5IH2 A;  2E5K A;  1R0B G;  2KR3 A;  2QAS A;  1MMD A;  3M5A A;  3H0H A;  4ATO A;  3LWH A;  1IHV A;  1D3B B;  3G71 Q;  1GXI E;  2GNC A;  2EYZ A;  2CDT A;  3TEE A;  5HY6 A;  1T3L A;  1KHC A;  4AFS C;  4EIK A;  4EPC A;  2JJ9 A;  1RAA B;  2MWO A;  2X3W D;  3R6O A;  1PWT A;  2JS2 A;  2LMJ A;  3V8J A;  1ZUK A;  4HT8 A;  4KBM B;  2D1X A;  3CBM A;  4PFP A;  2K2M A;  5A0D A;  1QP3 A;  3CMA Q;  5I22 A;  2EBP A;  4QW2 A;  5CKE A;  4M78 G;  3HTR A;  1GCP A;  2EGE A;  3M0S A;  3OYI A;  3WVD B;  2EIF A;  2XU8 A;  2XMF A;  2K2V A;  3A5Z B;  3VKI A;  1Q86 R;  1W2B A;  2QGF B;  2E3H A;  1K0S A;  3PIP A;  2KEA A;  3H9N A;  4HA8 A;  2L0A A;  1YJW Q;  2R57 A;  3SWN A;  1E6G A;  1AWW A;  4KGV B;  5GJV B;  2ROT A;  4M77 E;  4QQD A;  2FRY A;  2EQI A;  3CBP A;  3M4G A;  1Q82 C;  4MDX A;  2QQB A;  3PVQ A;  3SWN B;  4E6R A;  2CRE A;  2MK5 A;  3VS0 A;  1WHJ A;  2GFA A;  2NYS A;  3QXE B;  2RPN A;  3FJP A;  2CZ6 B;  1KFZ A;  1WQ7 A;  3JB9 I;  2ZPF B;  1WPY A;  5FRO A;  3L2V A;  1YIJ A;  1CKB A;  2MWP A;  4GLK A;  3QZ5 B;  3TRE A;  2CUD A;  1N8R R;  4OB0 B;  2EQJ A;  3RDV A;  2OTJ Q;  1OEB A;  1M1K C;  1M90 U;  2J7I A;  2WSE E;  3NGP A;  4ORZ A;  9ATC B;  4B9X A;  3CCV T;  2KBT A;  2KT1 A;  3AT1 B;  4Z02 A;  5FWC A;  3JV3 A;  1JEG A;  4M77 B;  1NG2 A;  2RHY A;  1VQK Q;  2EJF A;  1AHJ B;  4WTO B;  2V26 A;  5LJ3 g;  3QYG B;  4C0D C;  1WXT A;  2KAF A;  2QQS A;  4OGC A;  3CCJ T;  1X6B A;  2JN0 A;  3OA6 A;  2XIC A;  1DJ7 B;  2GF7 A;  4PJO G;  1IHW A;  4HVW A;  1OYX A;  3O5Z A;  4KUI A;  2ZPB B;  2DM1 A;  1VQ6 T;  3PE0 A;  3RKX A;  5EG2 A;  2V8J A;  1V29 B;  1B34 A;  1SKU B;  1TWB A;  4KH1 B;  5KYN A;  1TOV A;  1C1A A;  2DTI A;  1GRI A;  1B34 B;  1VQ4 T;  3E19 A;  2B8A A;  3NTK A;  2E10 A;  2C0O A;  1MHN A;  3I56 A;  2DD5 A;  1EIF A;  5I2S A;  1M27 C;  5IHI A;  1Q81 C;  2DYB A;  3EHQ A;  1HK9 A;  2AKK A;  1PM3 A;  2K7A A;  5KYW A;  5D6X A;  2HMA A;  5LJ3 e;  5C0M A;  1NJI U;  3QO3 A;  2RH2 A;  3SFM A;  1BI2 A;  2DAQ A;  5GAN h;  5CK9 A;  1T3S A;  1PC0 A;  3CCL A;  1XTD A;  3X24 B;  3JSC A;  4RTV A;  5IXB A;  4BI3 A;  1QCN A;  3SDZ A;  2HEQ A;  2H8H A;  4OB1 B;  1X6O A;  2FPD A;  1K4U S;  4XU1 A;  2VXF A;  1R0C B;  2MPX C;  3MP6 A;  3OYE A;  1OU9 A;  2OX7 A;  3OB9 A;  2LQW A;  1K0X A;  2CUB A;  4LUD A;  3I5S A;  2RQU A;  3OBY A;  1D09 B;  4A53 A;  1ZSZ C;  4PNO A;  3G6E A;  1S1N A;  4FIB A;  4F04 B;  3OSS C;  4C8Q A;  1YHQ A;  4C92 D;  4FYW B;  3RKY A;  4FM4 B;  1WGS A;  2SRC A;  4RCB A;  5GAO n;  4F7U E;  3OYC A;  1YIT Q;  2QQA A;  4AFZ C;  2HL5 C;  2LQK A;  1UGS B;  1TSF A;  2E12 A;  4OML A;  5GAN 5;  3EG1 A;  4RTW A;  2QI2 A;  2HQH A;  4BUG A;  2HAX A;  4QT7 A;  4C92 C;  3L2U A;  4A4E A;  2RN8 A;  4A4G A;  5LJ5 g;  2PNI A;  3CCM A;  1YI2 A;  1RAC B;  4LXC A;  2DE0 X;  3NMZ C;  1PCX A;  2OJ2 A;  1AZE A;  3T9N A;  4X9C A;  1WHL A;  1QMC A;  3OYN A;  3JB9 F;  2K79 A;  4Y28 E;  1YFN A;  4CC2 A;  4IUU A;  4RCC A;  5DLQ E;  4NL3 A;  1T0J A;  4BAC A;  2KK4 A;  3CCE T;  2AZV A;  2QA4 T;  4OMN A;  2JTE A;  4LUE A;  3JB9 J;  4QQG A;  2CZ1 B;  4EMH A;  2IIM A;  3EGX A;  3RBB B;  1VA7 A;  3P8H A;  3ULR B;  2XHC A;  1LJO A;  2LVM A;  2COY A;  4FYV B;  5HCK A;  1YJN Q;  3ZFJ A;  1B3Q A;  3EAE A;  1VQ9 A;  5IN1 A;  3TSZ A;  1K76 A;  2CH4 A;  5LJ5 e;  1D1C A;  4E7L A;  1AWO A;  4FT2 A;  2LJ1 A;  1TG0 A;  2RQT A;  2W10 A;  3RER A;  4F16 A;  3JB9 D;  1Q86 U;  2MCN A;  4QVC A;  1U8R A;  2YT6 A;  1ZUY A;  1HXD A;  1H3H A;  3DKM A;  3LYI A;  1PSE A;  3NTH A;  3JCM W;  4LDY A;  4M78 F;  2IVW A;  1KJW A;  2GQI A;  2RHI A;  2VB6 A;  2XDP A;  5EC7 A;  3UA6 A;  1KQS P;  4OMP A;  3R6N A;  1Q7Y C;  3GLX A;  3HHT B;  3EGD A;  1UEC A;  1WQW A;  1K73 R;  2DL3 A;  5CCA A;  1GBR A;  3MEV A;  1IRX A;  2C06 A;  3UF4 A;  3OS0 A;  1OPL A;  4HCB A;  4MMK A;  3EGD B;  3VS4 A;  4XTY A;  1NPR A;  2BIV A;  1FMK A;  2BTT A;  2CT3 A;  5HKC A;  2X4W A;  4FCY A;  2QEX A;  1W6X A;  2K6D A;  1N8R U;  1EZZ B;  4BI8 B;  5FU6 C;  5GAN j;  2KDS A;  2DEU A;  1E7O A;  3M4Y A;  2M0O A;  2VC8 A;  3LGF A;  4ZTJ A;  2ED1 A;  2XK0 A;  2JS0 A;  4LNP A;  3CCQ Q;  1VIF A;  3G7Z A;  2RB6 A;  1UJ0 A;  3M0T A;  2LNV A;  1FXX A;  3JCM d;  2QXF A;  2NUT B;  2YDL A;  3FDR A;  3FJ5 A;  1WZO A;  5GAN 2;  3OQ5 A;  3CME A;  1VQM A;  3CCR A;  2RI3 A;  3E1S A;  4PFZ A;  5FU7 C;  4ZN3 A;  2AIR B;  4DBQ A;  5J39 A;  3CC2 T;  4RKU E;  2DF6 A;  3CC7 A;  1M4Z A;  2DTH A;  1B07 A;  2BZX A;  4CC4 B;  1ABO A;  1N9R A;  1PG5 B;  1UHF A;  4C0F A;  4C0G A;  4PJO F;  3H0F A;  2CP7 A;  2RJC A;  2JXB A;  5I11 A;  3CD6 A;  5GJW B;  4C92 G;  1KD1 C;  5GAN 3;  5DM7 R;  1QCF A;  2DJZ A;  3UWN A;  3G4S T;  1QVF A;  1M2V A;  1IGQ A;  5HK0 A;  2DJQ A;  1KHI A;  1ZQ1 A;  2YUN A;  3E9G A;  1KQS S;  1CKA A;  3OMC A;  4PJM A;  5CKF A;  5KYX A;  5LJ3 h;  4M7D E;  1M2V B;  2VGM A;  2RM4 A;  1YJN T;  2DD4 A;  2EWN A;  4GBQ A;  5KYX B;  2G6F X;  3TU4 K;  2DRK A;  4J5Y A;  1TUG B;  1TXQ A;  4HCK A;  1PKS A;  2NUP B;  3ME9 A;  3PGG A;  2PQW A;  1WYX A;  2ZCF B;  4EMK C;  5CAI A;  4M75 G;  4JS5 A;  2LX7 A;  4J7F A;  3UPU A;  5CKD A;  1ZSZ A;  2X4X A;  1ABQ A;  1RLQ C;  2D9T A;  3CPW S;  3QYH B;  1BK2 A;  3Q1J A;  1TH7 A;  2DVJ A;  4PJO D;  1SF9 A;  1ZSZ B;  3EFO A;  2CP2 A;  3I55 T;  1JJ2 S;  3NHN A;  3VS7 A;  2DEQ A;  1LCK A;  3KFV A;  1LVK A;  4KT0 E;  4M7D B;  4ME7 A;  3L1A A;  1K9M C;  4ZNX A;  3GBQ A;  1OZ3 A;  3HRS A;  3CCU T;  2OTL Q;  1HJD A;  3BW1 A;  5L23 A;  1VYV A;  4BY6 C;  3GOX A;  2DL5 A;  1KQ2 A;  1ARK A;  4PJO C;  3CCV Q;  1IZ6 A;  2KE9 A;  5A0G A;  5GAO m;  2K5F A;  3AHU A;  4XU0 A;  2M51 A;  4DBF A;  1MMA A;  1WHM A;  2GTO A;  4C5G A;  4LD6 A;  1I4K 1;  1D0Z A;  2KYB A;  4MZT A;  2M9U A;  2PZ1 A;  1AT1 B;  3A8O B;  4O6J A;  2SEM A;  2K3Y A;  2WSF E;  1RAD B;  1KG1 A;  1IO6 A;  1JB0 E;  4HVV A;  2DXC A;  2FO0 A;  1VQ7 T;  1ZSG A;  3F70 A;  2D0Q B;  3BE3 A;  1VQP Q;  3EFR A;  4ELY C;  2LJ3 A;  1WHG A;  4OF1 A;  1RLP C;  1PD0 A;  1UGV A;  1VQ6 Q;  3OMG A;  3CCJ A;  5C6S A;  1NYG A;  3I9Q A;  1Q82 R;  3EG3 A;  4J7I A;  4JJC A;  1VQ4 Q;  4XAX B;  1AWX A;  1JRI A;  3EG2 A;  4L6V 5;  2X9H A;  1Z9Q A;  1VQL T;  3C94 A;  4FSS A;  1YJ9 T;  4KUD K;  4DEX A;  2X35 A;  5DLO A;  2VKN A;  2OAW A;  3JCM f;  2D6F A;  2O4X A;  3CQT A;  2O2O A;  3QHS A;  5GAO p;  1M1K R;  5LJ5 h;  4JRK A;  3MPU B;  1WXU A;  2YXY A;  4OMO A;  2O4X B;  2VAS A;  1VQ5 T;  1BKB A;  3G71 A;  2CP3 A;  1QWE A;  1I5L A;  1RAE B;  1N27 A;  3MEW A;  2HQX A;  2DXT A;  2FL7 A;  2Y4Y A;  4M77 G;  3M58 A;  5GMK l;  2EQM A;  3GP8 A;  3PIO A;  3QWX X;  2KYM A;  1Y71 A;  1MNE A;  2LRQ A;  3JCM Q;  1PSF A;  4OMM A;  5J3B A;  3TCJ A;  1K73 U;  3CMA A;  2WAC A;  2E5Q A;  2FZG B;  4M7A F;  2K5I A;  5GAM f;  2ENM A;  5LJ3 j;  2FVU A;  5KYU A;  3X26 B;  1UEB A;  2E70 A;  3BY7 A;  1M9S A;  2DNU A;  2DX1 A;  3FIF A;  3H8Z A;  4ZN1 A;  4XQ3 A;  1S72 T;  1KSW A;  5KYU B;  2ATC B;  1YJW A;  5FRM A;  1MGQ A;  1OX9 A;  2LT4 A;  1PKT A;  1Q81 R;  4M78 E;  1XNI A;  5GMK i;  2OTL T;  1FX7 A;  1JXM A;  1O9S A;  2KRN A;  1PRM C;  2BZY A;  1UJY A;  1PHT A;  1C0M A;  1IB8 A;  3TVT A;  2YHT A;  1VYU A;  1X27 A;  2HBW A;  2CZ7 B;  3PT9 A;  1N5Z A;  3JCM P;  1FYN A;  1RAB B;  3FEO A;  3OYY A;  2RA2 A;  1D1A A;  1LOJ A;  4ANJ A;  3M57 A;  4WCI A;  2OTJ A;  2DL7 A;  3VYH B;  2IPO B;  3CCE Q;  2QA4 Q;  1K8A C;  2KY9 A;  1AOJ A;  2HQE A;  1AD5 A;  1MMG A;  1JBM A;  5HK3 A;  1X69 A;  4M7A D;  4M78 A;  2QGG A;  3DB3 A;  4HCZ A;  4R0K A;  2LJ0 A;  1G8X A;  3M9Q A;  3S3O A;  4IUV A;  2EJ9 A;  4M78 B;  4A54 A;  4JUV A;  2LQ8 A;  1VQK A;  2NWM A;  2GTJ A;  1VQP T;  4KRT A;  2EKO A;  2EYW A;  2HZY A;  1BU1 A;  5CQX A;  3TQ7 P;  5AYF A;  2A0F B;  2E41 A;  2EAY A;  2DBK A;  4M7A C;  5LL6 S;  4E7H A;  3OW2 P;  3EH2 A;  2DFU A;  5M9O A;  1PNJ A;  1RI9 A;  3OBW A;  1KC8 C;  4ESR A;  2NLU A;  1UTI A;  1R8O B;  2EVR A;  2E1H A;  3A1P A;  3TSW A;  2L5Q A;  4C92 F;  2EQK A;  4FL6 A;  2F5T X;  1OZ2 A;  1TU0 B;  3N5B B;  2D8H A;  1GFC A;  4IUT A;  3OYB A;  3ZBD A;  5KYW B;  3PFS A;  1M3B A;  2LCL A;  1WNL A;  1BYM A;  4C8Q E;  1TUD A;  3L2R A;  1G3Y A;  2BKD N;  1I07 A;  5D6W A;  2DL8 A;  3LH0 A;  2PTK A;  1M8V A;  4RUG A;  1E6H A;  4MDW A;  3PVL A;  4F7U G;  4M75 F;  3VJP A;  4AG1 C;  8AT1 B;  1BBZ A;  5LJ5 j;  3C95 A;  2AHJ B;  4PJO A;  5A2Q E;  4NL2 A;  2J6O A;  2HDA A;  4LDW A;  3A8L B;  5IAY A;  4BY6 B;  1W2B S;  2LTO A;  2LZ6 B;  2LT1 A;  3L42 A;  2NUZ A;  3CC4 Q;  3EG9 A;  2JZ2 A;  2A3L A;  3L2Z A;  4J9I A;  4RG2 A;  4C8Q B;  1G83 A;  3REA B;  2QTV A;  2EJG A;  4BB7 A;  3EG9 B;  1I8F A;  1X2Q A;  2DIQ A;  2JVV A;  4J9E A;  4FT4 A;  2KRS A;  3IQL A;  2D8J A;  4MZP A;  2RHU A;  3C0C A;  3KUF A;  5IHN A;  4C5E A;  2K3B A;  3RIR A;  1YIT A;  3X20 B;  1NBE B;  2ZPE B;  3OW2 S;  3BDL A;  5I21 A;  3RMS A;  1VQN Q;  2ZPH B;  1G3S A;  3V8L A;  1PRL C;  4M75 D;  3CC2 Q;  4X1V A;  1R77 A;  1BI1 A;  2EQU A;  1NPP A;  1Y7X A;  1Q82 U;  2QG9 B;  2XID A;  2E64 A;  1QLY A;  1Q7Y R;  3HP9 A;  5FLX E;  4PK4 A;  1NM7 A;  1U5S A;  1M3A A;  2VV5 A;  2YRD A;  2EFI A;  2V1R A;  3RMQ A;  4R56 A;  4XTU A;  1RAG B;  2DL4 A;  2KXC A;  4FSX A;  5IXF A;  4M75 C;  4GY5 A;  4DA4 A;  1M3C A;  4LE9 A;  5CIU A;  3G4S Q;  2FG0 A;  3REB B;  4A63 B;  1WI7 A;  1AWJ A;  1YCY A;  2IG0 A;  4EMG A;  1M1K U;  4D8D A;  3JB9 H;  2CKK A;  2E4H A;  2E65 A;  2E6Z A;  2JNG A;  3EGX B;  2YSQ A;  1ACM B;  3H6Z A;  1XOV A;  1YWP A;  1NLO C;  4D8K A;  3X25 B;  1O75 A;  3INZ A;  1VQO Q;  3MP1 A;  1SHG A;  1KQS A;  2MOX A;  2VXE A;  5KE2 A;  1ZUU A;  4J9C A;  1SEM A;  2RI2 A;  1XQH A;  3JCM J;  3M59 A;  2K9G A;  1XJW B;  1SSH A;  3A98 A;  3S6W A;  4N0A C;  4DQ2 A;  1P92 A;  2DIL A;  3I56 T;  2XI9 A;  1YJN A;  2XD0 A;  5GAN d;  3A8M B;  4JDS A;  1U06 A;  3MET A;  2P0Q A;  2RHZ A;  1TS9 A;  2EYQ A;  2ECZ A;  2LX9 A;  2J6K A;  3I55 Q;  4XU2 A;  4M7A G;  3V8K A;  1WIE A;  4PFO A;  2GCX A;  2DA9 A;  3MCA B;  2X3X D;  4XTV A;  2JTF A;  3HPW A;  4M77 F;  2I2L A;  3HSB A;  2R5M A;  1Z9Z A;  3CCU Q; 
#chains in the Genus database with same CATH homology
 1Q86 R;  1KC8 R;  1VQ4 Q;  3CCV Q;  1Q7Y R;  3CPW P;  3CCE Q;  3I56 Q;  1YJN Q;  3G6E Q;  1VQK Q;  1VQP Q;  1S72 Q;  3CME Q;  1VQM Q;  1VQO Q;  3CCQ Q;  1W2B P;  3CD6 Q;  3CCL Q;  1YJW Q;  1VQ5 Q;  3G71 Q;  3CCR Q;  3I55 Q;  1YIJ Q;  3CMA Q;  1Q81 R;  1N8R R;  3CC4 Q;  1KD1 R;  2QA4 Q;  1M90 R;  1JJ2 P;  1YHQ Q;  1VQ7 Q;  1VQ9 Q;  1NJI R;  1VQ6 Q;  2OTJ Q;  1VQN Q;  1YIT Q;  3CCS Q;  3OW2 P;  1VQL Q;  1QVG P;  3CXC P;  2OTL Q;  1KQS P;  1K8A R;  3G4S Q;  3CCJ Q;  3CC2 Q;  1YJ9 Q;  2QEX Q;  1K9M R;  3CCM Q;  1Q82 R;  3CC7 Q;  1M1K R;  1YI2 Q;  1VQ8 Q;  1QVF P;  3CCU Q;  1K73 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...