3JB9D

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
SLCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSHIRFLIVPDMLRNAPMFKVGPGRSVPLPTRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 13
structure length 96
sequence length 96
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9D00
4A53A 3SWNA 1I5LA 5GAN3 4F7UG 1HXDA 4M75C 5GMKe 5GAN8 3BFMA 4PJOB 2EJGA 5LJ3g 4PJOG 2Y90A 4M78E 4M7AB 5GMKi 3JCMc 2RD1A 2DEQA 5GAMe 4M75E 4M7AG 4JRIA 3JB9I 1LOJA 1JBMA 5GMKj 3BDUA 3RERA 2DXUA 4M78B 5LJ5j 4V2SA 1WQWA 3SWNC 4M78G 1D3BA 2DVEA 2EJFA 2K57A 2DXTA 4QVDA 5GAOl 4M7DF 1Y96A 3BY7A 4M77D 4JUVA 5GAMh 4Y91A 5GAMg 4XU1A 4C8QA 4EMKA 5LJ5d 5GANg 3BW1A 4XTZA 5GANh 4C92D 3V8LA 1I4K1 3JCMd 5GAMf 1KQ2A 2E65A 1N9RA 4F7UF 2CGHA 3HFOA 5GANf 3SWNB 4PJOF 3V8KA 3RIRA 4NL3A 2YHTA 5GAOp 3JB9D 1HK9A 4M7AF 1N9SA 1I81A 1JRIA 3RESA 5CAIA 4C8QC 4EMKC 1B34B 3V7RA 5LJ3h 5LJ5e 2E64A 4M78F 4WF2A 2DTOA 4XTYA 4XU2A 2VC8A 4OP0A 3JCMe 4XQ3A 5LJ3f 4C8QE 4HA8A 1D3BB 3GIBA 3M4GA 5DY9A 4EMHA 4NL2A 3JCMV 4XTXA 3RKWA 4RCBA 5GAN5 4M75B 5GMKh 5GAOr 4C8QB 1MGQA 2DTHA 4M77A 4X9CA 5LJ5g 4M75G 3JB9H 1H641 3JCMg 4C8QG 3JCMh 1KQ1A 2VXEA 5GMKl 3JCMb 4EMGA 4C92A 2E41A 2HNIA 3EFRA 3FB9A 3QSUA 3VU3C 2DZCA 4JRKA 4XTWA 3JCMf 4A54A 4M7DA 5GANj 3JB9J 2I2LA 2ZGWA 4M7DD 1I8FA 4XTVA 4J5YA 4XTUA 3HFNA 4M77C 4F7UA 4M7DE 2QTXA 4PJOA 4C92C 5GAOm 4PJOD 4M77E 5GAN4 5I21A 4M7AA 4M7DC 3FJPA 2DTIA 3RUXA 2EJ9A 4M7AD 1YCYA 3JCMX 4HT8A 4C92E 4M75F 2JN0A 4XU3A 4C8QF 5GAOn 3L1AA 3PGGA 4J6XA 4M77B 2E1HA 3INZA 2YLCA 4M78A 4HT9A 3FIFA 1Y96B 1TH7A 4M77G 4M78D 5GAN7 4X9DA 4PJOC 4C92B 1LNXA 4EMKB 4MMKA 4F7UE 5LJ5h 4M7AC 3V7SA 4C92G 4XU0A 2RA2A 4PJOE 3JCMQ 5GANd 3SB2A 3V8JA 5LJ5f 1BIAA 1M5Q1 4M7AE 4M78C 5LJ3j 5GAN6 3JB9G 5GAN2 1U1SA 4J6WA 2EAYA 2DZ9A 1BIBA 3AHUA 4N0AA 3EFSA 4J6YA 1LJOA 3JCMJ 2DJZA 5LJ3d 1B34A 5GANe 5GAOq 3JB9F 4M77F 4MMLA 4DQ2A 5GMKm 4JLIA 5GAMj 2FB7A 3JCMP 4C92F 2E10A 2VXFA 1U1TA 2YLBA 3QO3A 1M8VA 4NOYA 4N0AC 2RB6A 4M75A 3RKYA 2EWNA 4M75D 4QVCA 1WQ7A 2RM4A 2DKGA 4C8QD 5LJ3e 1WNLA 2FYKA 5GAMd 3V7CA 3JCMW 4M7DB 4M7DG 3RKXA 4RCCA 4PNOA 3L2ZA 3HSBA 4F7UB 3QUIA 1WPYA 1X01A 3QHSA
chains in the Genus database with same CATH superfamily
4C0DC 1Z9QA 2X4XA 3TCJA 1RADB 1H8KA 1YHQQ 1NG2A 5HCKA 2O9VA 3OYFA 2LQ8A 4JRIA 1CKBA 3CMAQ 2XDDA 1K9MU 2GTJA 3RERA 2Y4XA 3VS6A 2QGFB 5GAMg 5GAMh 1M27C 2LZ6B 4C8QA 4XTZA 4FL6A 1TOVA 3CMAA 1VIEA 2VVKA 1X43A 2QA4Q 1IRXA 1BBZA 5D6XA 1F1BB 2O31A 4PJMA 1GCQA 2DVJA 3CC2T 2CUDA 2VGNA 3HTRA 2VUBA 4HCZA 5LJ3f 3OMCA 2XU8A 2CP6A 4F16A 1YITA 1YWOA 2BUDA 2E3HA 2H3JA 3EG0A 1M4ZA 1C6VX 2DZCA 4RUGA 3PVLA 4OB3B 2GQIA 3J7AF 2GTOA 3VS3A 4E6RA 1YJWT 4AFUC 2M9UA 3Q1JA 3LYIA 2L8DA 5KE2A 5KYWB 2DIGA 1MUZA 4M75F 3OYNA 4XU3A 2EQUA 3L1AA 5DM7R 3OS2A 2PUKB 3UWNA 3CCRQ 4QKUA 4Z02A 3VS7A 1N6AA 2F5TX 2CS7A 4BY6C 2VKNA 4D8DA 1Q7YR 1RAFB 3G71Q 1RAGB 3CPFA 1AWJA 1YBYA 1YWPA 4J6WA 3OYDA 4LDUA 1VQMT 3JCMJ 3HP9A 5GANe 4OB2B 4M77F 5GMKm 5FW9A 4OMLA 1AHJB 3G71A 2QASA 2FZGB 1NPPA 2MI6A 3CC7Q 3F70A 4QVCA 2LT1A 4C8QD 2FYKA 2DEUA 2LT4A 2DERA 4J9EA 4LN2A 4MZMA 1SRLA 3X25B 2X9HA 2DD5A 5FWCA 1JBMA 3CD6A 3G7ZA 4FYVB 2ZPHB 3LH5A 2O01E 3CMEQ 3EGUA 2A7YA 2C06A 2KROA 1VYTA 4JUVA 3RNJA 5L8RE 2RK2A 2X3WD 2D9TA 1QCFA 5A0GA 1HJDA 3FLGA 3X26B 3CMEA 3M0UA 3O8VA 5LJ3h 2KXCA 4LDYA 5LJ5e 1U5SA 3OYKA 2DBMA 2HMAA 4Z88A 3VUBA 2B86A 2HBPA 2WACA 1RAEB 4EMHA 4PFPA 2FEIA 3FJ5A 4JLGA 2RQRA 4C8QB 2K2MA 2RN8A 1VQLA 2NUTB 3G6EA 4RTXA 2E41A 3I5SA 1K1ZA 3OYYA 1E6HA 2MWOA 4XTUA 1ZSZC 2HQEA 4J9FA 2XIDA 5CQXA 3SHWA 1QP3A 5GAN4 4M7AA 4M7DC 1SG5A 1NJIR 5IXBA 4HT8A 1EIFA 1E7OA 2KGTA 1YJ9T 2RJCA 3UF4A 3FIFA 2SEMA 1WLPB 3ULRB 3V7SA 1KC8R 1EX4A 2D1XA 2JTMA 4D6WA 1M5Q1 2DX1A 4N4GA 1IHVA 4A4GA 2J05A 2KAFA 1VQ8Q 1KD1R 1Q86C 1V1CA 2EAYA 1QW1A 3M55A 3CCLT 2V8IA 2QQRA 2KBTA 1NJIU 2A08A 3GP8A 1UGSB 1RI0A 1VQOA 4NOYA 2QQBA 3URGA 2EWNA 4RTTA 3M56A 3DKMA 5I2MA 1HSQA 3UATA 4TVRA 5I2SA 1RL2A 2HZYA 4F7UB 2CSQA 1U3OA 1LCKA 3CMAT 1J3TA 1JB0E 5GMKj 3VS2A 3OBWA 1S72Q 4KGZB 2FPDA 3BY7A 2DO3A 4N4IA 2QA4T 3UPUA 2RI3A 2RO0A 1HK9A 1OV3A 2A37A 2HD0A 1VQ6Q 5FU6C 1I0CA 1BCMA 1FYNA 4O6JA 3M59A 3T9NA 1QCOA 2X4YA 1A0NB 1M90U 4NL2A 2EBPA 4AMCA 1R8OB 1MGQA 4M77A 5HKCA 1VQNA 3JCMb 1PSFA 1KSWA 1YI2Q 3A8HB 2NYSA 2P4RA 4LD6A 2MIOA 1ZX6A 2ZPFB 2EGCA 1MNDA 1Y07A 1QVPA 1OX8A 1WA7A 2VGMA 3FJPA 2L5QA 3C4SA 2XI9A 3PMTA 1K8AU 4E2FB 3CCRT 2BIVA 2JJ9A 2COYA 3NPFA 5KE3A 1PHTA 3G71T 3ZL7C 4MZTA 2LCCA 3C94A 3PTAA 2CT4A 4JJCA 2E5QA 3CC4A 3J80E 1M9SA 2COZA 1TTHB 2LJ0A 1TS9A 1NEBA 4Y92A 1M3AA 2OTLA 4OF1A 1SPKA 3CC7T 3C12A 3E19A 3EG1A 4IIMA 3CD6T 4M75D 3G4SQ 3A1PA 2K4YA 4DEXA 1AVZC 3LGFA 1VQ7A 1BK2A 2EJGA 2K2VA 3OYMA 2V8JA 2JVVA 1SSFA 3RBBB 1W2BS 2K3XA 2DXUA 3H41A 5GJWB 3CMET 1VIFA 3QYGB 2YRCA 4M77D 3SFMA 1AWXA 4L6V5 4AFZC 1RACB 3NGPA 3U23A 4FM4B 3FDRA 4P5NA 2RJEA 4PJOF 1RAIB 1I81A 5KYXA 1NLOC 3RESA 2O4XB 3A8LB 4M78F 3JCMe 3OW2P 4IURA 2WSFE 1UDLA 3OA6A 5KH6A 5IT9E 2ZPEB 2EYWA 4M75B 3CCMQ 5CK9A 1ACMB 1H641 2X51A 3PNWC 3EGDB 4C8QG 1PRMC 1BI1A 2EYXA 1B07A 2MAMA 1GBQA 1M2VA 1Y71A 4J5YA 4EDUA 5A0LA 1MV3A 2ABLA 4BI4A 9ATCB 2DFUA 2NLUA 2ZZDA 4XAXB 1BYMA 1IREB 4M77B 2DRMA 2FRYA 4KULA 2YUPA 2XHCA 3A5ZB 4XU0A 4BDZA 4BE0A 2DA9A 1N8RR 4A4KA 1FMKA 1VQ8T 4C5EA 4F04B 1VQKQ 1VQPQ 1X27A 2KQWA 3CCVQ 5GAOq 4ZGJB 1PG5B 4C5GA 2VXFA 1VQKA 1U1TA 1VQPA 5IHKA 1B7TA 2LQNA 2DJQA 4LD9K 2DLPA 5GAMd 2CP5A 3QZ5B 4MDWA 3EH2A 3CCVA 1Q81R 4PNOA 4DA4A 3L2ZA 2HCKA 3HHTB 1KJWA 2GQVA 4F7UG 4RTYA 1S72T 2FG0A 3MHXA 1WXUA 1JXOA 5EG2A 3ZBDA 1M1KC 4JPBW 2ROTA 1MV0B 2IIMA 3V8LA 1UEBA 3D7SB 1PNJA 3L42A 3TU4K 1BI0A 1VQ6T 4E7JA 1G3TA 5CVIA 2LCSA 2F1LA 1GXIE 2HKNA 2LX7A 2KXDA 4XTXA 3CCQQ 2O88A 1Q82U 1QWFA 3ME9A 4DOVA 1YI2T 4QQ6A 2QEXQ 1ARKA 3OYGA 1N27A 2JMCA 4ZGEB 1Y0MA 4HKEA 3QWYA 2QK0A 1BI2A 3OQ5A 3H0IA 1R0CB 4KH0B 3JRZA 2L3SA 2QEXA 5I21A 4BUGA 4C92E 1PRLC 3PGGA 5IH2A 2E5KA 2KI7A 2YLCA 1TH7A 2CZ6B 2XMFA 2XD0A 4KGVB 2A3LA 4F7UE 2MK5A 4ELZC 1M2VB 2DL3A 1D0XA 5LJ3j 3R6OA 3M4YA 3FRNA 3M0SA 2LQKA 4FW1A 4CC3A 3CCJA 3I56A 2DJZA 1WJSA 2K7AA 1WZOA 4RKUE 1I5OB 1TG0A 2PUOB 4C0FA 3G4ST 1WQ7A 3EG9A 4MDXA 1EZZB 4BE1A 2MCNA 1X2QA 4L59A 4LNPA 2DEQA 2KRSA 1D0YA 3JB9I 1K9MR 4IUTA 3EG3A 2NUPB 2DM1A 4XU1A 2GFAA 5FU7C 1N9RA 4HVUA 4OMNA 2K5IA 2YHTA 4M7AF 3OW2S 2ZAEA 2F69A 4EMKC 2VASA 4WF2A 4HA8A 2LRQA 2DBKA 4IIOA 1BB9A 2QI2A 4LE9A 3CCMT 1JXMA 1ZSZA 4X9CA 4M75G 4FSSA 1R0BG 2XG8D 3FB9A 3EFRA 7AT1B 4OMFB 4M7DA 1AWWA 3EHRA 2RJFA 1YITQ 5C6SA 1M1GA 1OULA 1K73C 4PJOD 2AKLA 1NZ9A 4J7IA 2JXBA 1KHCA 3WXMB 4LDWA 3TSWA 2YRVA 2ENMA 1QVFP 4M78D 4M77G 3OYLA 2K3YA 1UE9A 1OQKA 1WI7A 2L89A 3SB2A 1WHHA 1VQKT 4PKCC 5KYYB 1VQPT 2FZCB 4JZ4A 1OYXA 1ZHIA 1VOMA 3NTHA 2OAWA 4JS5A 2JS0A 1RAHB 4OB1B 5J3BA 2AZVA 5GJVB 3CCVT 3NHNA 4BY6B 5DLOA 4JLIA 2J6KA 3JCMP 2AHJB 1M8VA 1Y57A 2BZYA 4Q5WA 3HRUA 5I11A 4C5IA 3DB4A 1ZUKA 1G3WA 1M3BA 3JB9F 2PU9B 1XTDA 1G83A 3CCEA 2J6FA 1X01A 4LXCA 4PJOB 1GL5A 4M4ZA 2RD1A 2CYZB 4M75E 1SHFA 5I22A 1K4US 2P4TA 4ZGDB 4M78B 2AZSA 4ORZA 3SWNC 2DVEA 2EQIA 3NMZC 2DETA 1M3CA 4YTLA 1Y96A 3EG9B 5DLQE 3R6NA 3MO8A 2EGAA 3H8ZA 2CGHA 8ATCB 3CD6Q 2KT1A 2R58A 2LQWA 1TUCA 3VJPA 1SSHA 2LCLA 1X75C 3E9FA 1YJNA 4GLKA 1XQHA 5HK3A 1VUBA 6AT1B 3QPHA 3CCQT 5CR2A 5DY9A 2C0OA 4RCBA 2QEXT 1G8XA 4OGCA 2H3EB 5LJ5g 1Q86U 1VA7A 1V76A 2M02A 4IUUA 1RI9A 3CXCP 3HFNA 3LH0A 1VQLQ 3G6EQ 4ELYC 1H92A 2EYZA 4HCCA 2AIRB 1O9SA 2RHYA 3VUZA 2CZ0B 2FO0A 2AKKA 5GAN7 2HQXA 2RHZA 3WVDB 2Z0WA 4MMKA 1PC0A 3RMSA 5A2QE 4L5GA 1WYXA 3V8JA 3OYAA 1CKAA 4N4HA 4IUVA 1ZUYA 2XKOC 1BIBA 3EFSA 4DQ2A 2LJ1A 4DBQA 3QJ6A 3P8BB 3QO3A 2LDMA 2XDPA 4E7KA 4JRQA 1MMNA 5LJ3e 2RM4A 2FPFA 2EKHA 1K0SA 3RKXA 1X6OA 5FROA 1X6BA 1VQOQ 1VYVA 4GBQA 5GAN8 2ZPIB 1XOVA 3OW2A 4E7SA 1C1AA 2RMOA 1U06A 2EGEA 1LVKA 1OX9A 2RK1A 1PCXA 1W70A 1Q7YC 2MOXA 3X24B 1N5ZA 1PSEA 1EFNA 4LDVA 4ATOA 1JJ2P 2EYQA 2AT1B 2KYMA 4LDXA 3HFOA 2JS2A 2QQ9A 5CKFA 3PMIA 5IN1A 2WSEE 3OYIA 2M0YA 4HCBA 3UA7A 2MF2A 2CZ7B 4BB7A 1OU8A 4KBMB 3TREA 1M90R 1NEGA 1W1FA 5J26A 5GAOr 1ZUUA 4F17A 3M5AA 4UC4A 1UGVA 2V1QA 1YIJA 2GFUA 4Z8AA 4R55A 2HNIA 4QQGA 3NTIA 2XK0A 3JCMf 3CCUQ 2QAZA 4II1A 1YITT 2K5LA 1E6GA 1VQNQ 3LWIA 2DILA 4C92C 1CSKA 2H8HA 1K0XA 2EW3A 2GGRA 4M7AD 1K8AR 3CCUA 4J6XA 4R56A 4WCIA 1WHKA 3VS0A 2HEQA 3SEMA 1HYOA 1FX7A 2F2XA 4FT4A 1KQSP 5KCOA 1LJOA 1WXBA 2DYIA 2EYYA 1VYUA 1OZ2A 3CQTA 4MMLA 4Z89A 3HKSA 3I35A 2EQJA 4JZ3A 4QT7A 1K9AA 2E10A 2KY9A 4LUDA 2JT4A 3CC4Q 3MKDA 2W0ZA 2KDSA 2L2PA 1TU0B 3VKIA 3HSBA 2OTLQ 3NTKA 4E7ZA 1HXDA 1KC8C 3OS5A 3HRTA 4PJOG 2Y90A 1Z9ZA 4OMQA 4M7AB 1VQ4Q 2YUQA 2LMJA 1W6XA 4AT1B 4BACA 4JJNK 1KD1C 4M78G 3BDLA 3S3OA 2QDYB 5GAOl 3CBOA 1VQ7Q 2V8KA 2KNBB 4Y91A 3L2UA 1X6GA 1VQ4A 1SHGA 4BI3A 2YXYA 1BU1A 3RIRA 3I55Q 4HVWA 3JB9D 2DL4A 3IQLA 4QVZA 3V7RA 1WGSA 3LX7A 4ANJA 4CC4B 2JTEA 2LVMA 1KFZA 3E9GA 4JJBA 3I55A 2FZKB 3EFOA 3JCMg 1WHJA 3JCMh 3X28B 1PM3A 3CXCS 2O2OA 3FC3A 2I2LA 2FRWA 1PWTA 4FU6A 1VQLT 4BE2A 3G6ET 2LNVA 2QTXA 3ER0A 2KE9A 3HL8A 2RI5A 5KYNA 4OMMA 3RUXA 2KVQG 1JEGA 1X69A 2IPOB 2JN0A 1PD1A 3G1JA 1IXDA 3AT1B 2EKOA 4PJOE 2JTFA 2Y4YA 1M1FA 4HVVA 3EGXA 3OS1A 3TQ7P 1W4SA 3AHUA 1B34A 1M1KU 2L0AA 2RH2A 2E12A 3VS1A 5GAMj 4QQDA 2MPXC 2YLBA 2K6DA 1SKUB 2D6FA 2RB6A 1UGRB 2CKKA 1WNLA 3JCMW 2FHDA 1VQOT 2L3PA 2KT8A 4M75C 2EQMA 1T0JA 4IUQA 2E6NA 4J9BA 2NUZA 4E7LA 1LOJA 4PFZA 4JJDA 3OB9A 2VYTA 1MHNA 1RUWA 1JJ2S 1YP5A 1QQJA 3GNGA 4M7DF 3QZ9B 2W10A 3DLLA 2OTJQ 5KCHA 4EMKA 1G3SA 4AG2C 3CC2A 2X4JA 2P0KA 1MNEA 3VRYA 2FVUA 4VUBA 1JRIA 4AG1C 2QGGA 2CP7A 2CDTA 2OTJA 1KG1A 1UGQB 4XU2A 1QVFA 4C8QE 4E7IA 1NE8A 4D8KA 4FYYB 1Q82R 1D1BA 3MP8A 5GMKh 1YJWA 3JB9H 4EMGA 3QKJA 3CCUT 1P92A 2DPPB 3VU3C 3LGLA 2IG0A 3TSZA 3JB9J 1I1JA 1OZ3A 1GBRA 1VQNT 1TWBA 1KIKA 3EG2A 1T0HA 1VQ5A 3JV3A 4IKFA 4QW2A 3UT1A 2CZ1B 1OI1A 4HT9A 3E2UA 1LNXA 2PNIA 3X20B 3QG1A 5GANd 2MMPA 1KQSS 2HDAA 5HY6A 1ZA2B 1Y7XA 2PVDB 2RI2A 2DXCA 5KYXB 2KMTA 1U1SA 3VYHB 3LLRA 2DZ9A 4ESRA 2JMAA 2RJDA 2PVOB 1GFDA 2EFIA 2BZXA 2R5MA 1MMDA 4R0KA 3S3MA 4C92F 3CC4T 4NS5A 3M0RA 2K9GA 5FLXE 2JM8A 4PLIA 2GBQA 3KXTA 3CCJQ 3I56Q 4J9HA 2CH4W 2YSQA 1NLPC 3EGXB 2OTLT 4RCCA 3UA6A 1UJ0A 3GLXA 3VS4A 2PQWA 3MP6A 2JZ2A 3P8HA 1SF9A 3GF5A 3SWNA 3GPLA 1VQ4T 2YWWA 1N8RC 3HPWA 3JCMc 4M7AG 3BE3A 1D0ZA 3BDUA 5KYWA 1UB4A 3DLMA 4WTOB 1VQ7T 3P8DA 2EJFA 2RPNA 2DXTA 3ZEHA 3GOXA 5LJ5d 1I4K1 3CXCA 1K73U 3I55T 5M9OA 5GANf 1BKBA 1WX6A 1NYGA 2DRKA 4A4EA 5GAOp 2MYSA 1S1NA 2LP5A 3L2RA 1FXXA 5FU7B 1Q81C 1WHMA 2P84A 1GFCA 3DB3A 3JCMV 3PIPA 4C0DB 4BI8B 5KYUA 1RAAB 2LNHB 5L23A 5EC7A 3QJYA 2V26A 3SD4A 4J9GA 3TEEA 1GCPA 2F2WA 3J81E 2D0QB 5GAOm 3PFSA 2CH4A 1VQ9A 2M0OA 2DL8A 3M57A 1AOJA 3LWHA 3QIIA 2LX9A 4EPCA 1G2BA 5D6WA 2BTTA 4PJLA 3JSCA 5CQYA 5LJ5f 4M7AE 1IB8A 1IGQA 5GAN6 3JB9G 1WXTA 5IHNA 2DIQA 2EIFA 3H0HA 1B3QA 1YN8A 1UFFA 1TUGB 1Q95G 2L3RA 3RMQA 1JJ2A 1OU9A 1UUEA 1YHQA 2JOYA 4F14A 5LL6S 2G3RA 4C0ZA 2NUTA 4GLMA 3REBB 2ATCB 3V7CA 1IO6A 1WPYA 2DNUA 2RHUA 5D6YA 4HCKA 1QKWA 2PZ1A 5GAMe 1T3LA 3WVEB 3CCEQ 2VV5A 1M2OA 5FWBA 2QA4A 3GNFB 4QVDA 2OTJT 1O75A 5GANg 3CCSQ 5GANh 2ED0A 4B6MA 3SWNB 1RABB 4FCYA 4DBFA 2NWMA 5CIUA 2COWA 1N9SA 3MEVA 1X2KA 4MZPA 3CCSA 4XTYA 3REAB 1QVGP 2YDLA 2QYZA 3M4GA 2L3QA 3RKWA 4JS4A 1IGUA 1VQ5T 2DTHA 1YJNQ 2DMOA 3H0FA 3I9QA 3M0TA 4XK8E 1Q86R 3UDCA 1K9MC 2E4HA 4C92A 3QSUA 2D8JA 3OSSC 8AT1B 1KQSA 2ZGWA 4M7DD 1I8FA 4XTVA 4A63B 1AT1B 4F7UA 2JM9A 1AWOA 3CCRA 3PVQA 1UGPB 1QP2A 2JNGA 2KSSA 1SRMA 4M77E 4IUPA 3M58A 1M8MA 3I5RA 5KYUB 3OYHA 3MJXA 3INZA 2IVWA 1JU5C 2GF7A 4PJOC 2P0PA 5LJ5h 1ZA1B 3OSVA 2RA2A 3M9QA 4ZTJA 3SDZA 4DBHA 3H6ZA 4M78C 3OYJA 1Q7YU 4OGEA 1MMAA 4KRTA 1ZQ1A 2D0NA 4FYXB 3CC7A 2BKDN 4X1VA 2QG9B 3S6WA 4O5VA 1OPKA 1ZSZB 1RLQC 1AZGB 1W2BP 1V29B 3CCJT 4N0AC 2KK4A 3I56T 2KRMA 3MP1A 3A8MB 4M7DB 3MEWA 2J06A 3A98A 3CPWP 2O9SA 1IHWA 2E3IA 3VV0A 4FYWB 4DBRA 5LJ3g 5GMKi 3QDRB 2HAXA 2CT3A 1WJQA 1WQWA 3A8GB 4RMOA 1QKXA 4J9CA 2HSEB 2CP0A 3VRZA 4C92D 5CO7A 2EPDA 3JCMd 3S3NA 2E65A 2QTVA 2I0NA 4JRPA 1QWEA 2OAUA 4RTZA 2C0IA 4C8QC 4DEYA 2E64A 4DOWA 4RG2A 4OP0A 3GIBA 2C0TA 3FEOA 2SRCA 5A0DA 4J83A 1ZSGA 1GCQC 1VQ9T 4CC7A 4KT0E 2DXBA 2QDLA 4XTWA 2QXFA 1IZ6A 2WSCE 2RNAA 3E1SA 4KH1B 1NM7A 1I07A 2OJ2A 2EVRA 1YIJQ 3JCMX 1VQ8A 2OI3A 1Y96B 1YNZA 5HK0A 4C92B 5FU6B 2ESWA 4ME7A 2PVGB 1KC8U 2YUNA 1XNIA 1YHQT 1OEBA 1BI3A 1QLYA 2ROLA 4RTWA 1KD1U 2BZ8A 2O4XA 1OPLA 3C0CA 1QVFS 5C0MA 5FRNA 2FB7A 4K11A 2LTOA 4HXJA 5CKEA 5IHIA 4ZTFA 4M75A 4J9IA 1FMWA 3L2QA 4C0GA 2DKGA 2JUFA 1UTIA 3EGDA 2GCXA 5CCAA 1S72A 2HSPA 4X34A 2RHIA 1G5VA 2RHXA 3THKA 3M0QA 1FWZA 2RF0A 5J39A 2DF6A 3CCET 2RQVA 1WDXA 2F5KA 3ASKA 2K57A 4ZNXA 1VQ6A 2CP2A 3CCST 1ZBXA 1NJIC 2X35A 3QYHB 2D8HA 4A4HA 4NL3A 2KEAA 1YCSB 2B8AA 1QVGS 1JQQA 1UHCA 1M30A 3RDVA 2CREA 4J8OA 1G3YA 1YI2A 2DTOA 2A0FB 2F2VA 3CEYA 1YJNT 2HBWA 2G6FX 4J7FA 2PTKA 2HQHA 2CP3A 3QBYA 1PKTA 4OMPA 1ZBJA 2QQSA 2EJ9A 1YCYA 2V1RA 1AZEA 2RQUA 5GAOn 4E7HA 2YUOA 2LC4A 1U8RA 3KUFA 1YFNA 1UJYA 4M7AC 2CUBA 4J9DA 1RLPC 2YT6A 1M90C 1BIAA 2DL5A 1D1CA 3EHQA 4RTUA 4BDYA 1M1KR 3G4SA 2HL3A 2XICA 1GRIA 2K5FA 3OMGA 4ZN3A 3N5BB 2HKQB 3OYEA 1TXQA 3CPWS 3HRSA 4KUDK 2VB6A 1QCNA 1K8AC 5D7UA 4M7DG 1WFWA 4Y28E 1D09B 4A53A 3ZFJA 3LW5E 4EIKA 5GAN3 2FL7A 1FMVA 2A28A 4M78E 1UHFA 4OVAA 5CKBA 3PT9A 3MEUA 3OBYA 5CKDA 2DL7A 1LPLA 3META 3QDFA 4V2SA 2DD4A 5IXFA 3NFCA 1D3BA 3TVTA 4B9XA 2KRNA 1KHIA 2E70A 4ZN1A 1T3SA 2K3BA 3OS0A 2DYBA 3CCMA 5CAIA 4CI0C 4PJNA 2VC8A 1ZLMA 4XQ3A 1C0MA 4FIBA 3OYBA 3CC2Q 2RQTA 2FPEA 3M0PA 3MPUB 1ABOA 3L2WA 2R57A 2VXEA 5GMKl 1ABQA 1D1AA 2DK3A 4A54A 2X3XD 3CBMA 4M77C 1YIJT 1YJWQ 1WIEA 1UECA 2BE7D 2K79A 1JO8A 2M1HA 2M16A 2VWFA 4RTVA 4PL6A 3VYGA 4C8QF 5GANj 4E47A 4M7DE 3O5ZA 4PLLA 2E1HA 4C5HA 2JW4A 3QXEB 2NUPA 4C92G 2LJ3A 1VQ5Q 3JCMQ 1N8RU 1H3HA 2MWPA 4B9WA 5ECAA 5GAN2 3JAME 1WJRA 2KYBA 1VQMQ 2ED1A 2KR3A 4FW2A 3M54A 3EFOB 3RKYA 4PJJA 4AFQC 1WHGA 4RG8A 2AK5A 4CRIA 1TSFA 1VQMA 1Q81U 5AYFA 4KUIA 3C95A 3PIOA 3KFVA 2E6ZA 3QUIA 1I5LA 5GMKe 3BFMA 1QVGA 2M51A 3OY9A 5FRMA 2ZPGB 4KGXB 2R5AA 2HL5C 5LJ5j 1AD5A 1NYFA 1NBEB 4GY5A 3BW1A 2BE9B 1KQ2A 5GAMf 1K73R 4F7UF 1PD0A 3V8KA 5KYYA 3CCQA 1QMCA 1SEMA 3OYCA 3QWXX 1B34B 4OMOA 2GNCA 3H9NA 1D3BB 1TUDA 3CBPA 5GAN5 4BD3A 1MMGA 2QQAA 1KQ1A 4CC2A 3GBQA 4JDSA 4AFSC 3EH1A 2DAQA 4JRKA 3KBGA 1AEYA 1WHLA 2XDBA 2A36A 2X4WA 1UG1A 3L2VA 4PJOA 2ZPBB 3RR6A 3VS5A 3M53A 4PFOA 4LUEA 2DTIA 1DJ7B 1W2BA 1HD3A 2CSIA 4M78A 3MCAB 2RQWA 1YJ9Q 3EAEA 4X9DA 1PKSA 2OX7A 4EMKB 3A8OB 2J6OA 3CPWA 4PK4A 4FT2A 5CKHA 3MEAA 1VQ9Q 1Q82C 4FSXA 4A4FA 2EQKA 2P0QA 1R77A 2ECZA 5IAYA 1YJ9A 3PE0A 4N0AA 4J6YA 5LJ3d 1BCOA 3CCLQ 4OB0B 2DE0X 1KK7A 1NPRA 1XJWB 2YRDA 1K76A 1OOTA 2ZCFB 5AT1B 3CCLA 1H3ZA 2J7IA 3QHSA
chains in the Genus database with same CATH topology
2GQVA 4C0DC 2X4XA 3TCJA 4F7UG 1HXDA 3VV0A 1KC8C 3OS5A 3HRTA 4PJOG 2Y90A 5LJ3g 4M7AB 5GMKi 3QDRB 3OYFA 2LQ8A 1S72T 2HAXA 4JRIA 1K9MU 2XDDA 1WJQA 4BACA 3RERA 2Y4XA 4JJNK 1KD1C 3MHXA 5EG2A 1WQWA 3A8GB 4M78G 3BDLA 4RMOA 3S3OA 3ZBDA 2QDYB 5GAOl 3CBOA 2V8KA 1M1KC 5GAMg 5GAMh 4Y91A 3L2UA 4C8QA 1VQ4A 4XTZA 4BI3A 4FL6A 1UEBA 5CO7A 3V8LA 4C92D 2E65A 3L42A 3JCMd 3CMAA 3TU4K 3S3NA 1VIEA 1BI0A 4JRPA 3RIRA 1VQ6T 5D6XA 2OAUA 3JB9D 4E7JA 1G3TA 4QVZA 5CVIA 3V7RA 4C8QC 1WGSA 3LX7A 2E64A 4DOWA 1GXIE 3CC2T 2VGNA 4RG2A 4OP0A 2VUBA 4HCZA 5LJ3f 3OMCA 2XU8A 2LVMA 3GIBA 3E9GA 4XTXA 3FEOA 1Q82U 3I55A 5A0DA 4J83A 3ME9A 4DOVA 1YITA 1YI2T 4QQ6A 3JCMg 2BUDA 3JCMh 2H3JA 3X28B 1VQ9T 4KT0E 2DXBA 3CXCS 3OYGA 1M4ZA 2DZCA 1N27A 4XTWA 2QXFA 4OB3B 4ZGEB 1IZ6A 2WSCE 2I2LA 4HKEA 3FC3A 3J7AF 1BI2A 3OQ5A 4FU6A 1YJWT 1VQLT 4BE2A 3E1SA 3JRZA 3G6ET 2LNVA 2M9UA 2QTXA 3ER0A 3Q1JA 3HL8A 2QEXA 3LYIA 2L8DA 5I21A 2RI5A 5KE2A 4BUGA 3RUXA 2KVQG 3JCMX 2DIGA 4C92E 4M75F 2JN0A 3OYNA 4XU3A 2EQUA 3L1AA 3PGGA 5DM7R 1VQ8A 2YLCA 3OS2A 1Y96B 1TH7A 2CZ6B 2PUKB 5HK0A 2XD0A 4C92B 5FU6B 3UWNA 2A3LA 4F7UE 4ME7A 2PVGB 1KC8U 4ELZC 2EKOA 4Z02A 4PJOE 1N6AA 2F5TX 2JTFA 2CS7A 2Y4YA 4BY6C 1M1FA 1XNIA 5LJ3j 3R6OA 1YHQT 1BI3A 3CPFA 3FRNA 3M4YA 1YBYA 3OS1A 1KD1U 2LQKA 4J6WA 1W4SA 3OYDA 3AHUA 4LDUA 1VQMT 3CCJA 3HP9A 3JCMJ 3I56A 2DJZA 1WJSA 1B34A 2O4XA 4OB2B 5GANe 1M1KU 4M77F 5GMKm 1QVFS 2RH2A 5C0MA 2E12A 1AHJB 5GAMj 5FRNA 2FB7A 4QQDA 3G71A 2LTOA 2YLBA 5CKEA 2D6FA 1NPPA 4ZTFA 2MI6A 4RKUE 2RB6A 4M75A 1UGRB 3F70A 2CKKA 3L2QA 2PUOB 4C0FA 2LT1A 1WQ7A 4C0GA 2DKGA 4C8QD 2JUFA 1WNLA 2FYKA 4QVCA 3JCMW 4MDXA 2FHDA 2GCXA 2LT4A 5CCAA 1S72A 4X34A 4BE1A 1VQOT 2RHIA 4MZMA 1G5VA 2RHXA 4M75C 2EQMA 3X25B 4L59A 2DD5A 1FWZA 5J39A 4IUQA 2E6NA 2DEQA 4E7LA 3CCET 3JB9I 1LOJA 1JBMA 3CD6A 3OB9A 3G7ZA 2VYTA 4IUTA 1MHNA 2ZPHB 2O01E 1JJ2S 2F5KA 3ASKA 2A7YA 3GNGA 2K57A 2C06A 1VQ6A 3CCST 4M7DF 4JUVA 1ZBXA 3QZ9B 5L8RE 3DLLA 5KCHA 4XU1A 4EMKA 2GFAA 2RK2A 2X35A 1NJIC 1G3SA 5FU7C 3QYHB 1N9RA 3NTKA 2D9TA 3CC2A 5A0GA 4A4HA 2X4JA 2K5IA 4NL3A 2YHTA 3FLGA 2P0KA 4M7AF 3X26B 2B8AA 2FVUA 4VUBA 1JRIA 3G4ST 3CMEA 3OW2S 1QVGS 2F69A 3O8VA 4EMKC 4J8OA 5LJ3h 5LJ5e 4LDYA 1G3YA 1YI2A 2OTJA 4WF2A 1KG1A 2DTOA 3OYKA 1UGQB 4XU2A 3VUBA 1QVFA 2HBPA 4C8QE 4HA8A 4E7IA 1NE8A 2LRQA 2WACA 4EMHA 3CEYA 2QI2A 4JLGA 3CCMT 1YJNT 3MP8A 5GMKh 4C8QB 1YJWA 4X9CA 1VQLA 3G6EA 4M75G 3JB9H 4J7FA 4EMGA 2E41A 2XG8D 3EFRA 3FB9A 3QKJA 3CCUT 1P92A 2DPPB 4OMFB 3LGLA 3VU3C 2IG0A 3OYYA 4M7DA 3JB9J 3QBYA 2MWOA 1OZ3A 2RJFA 4XTUA 1VQNT 2HQEA 5C6SA 2XIDA 1M1GA 5CQXA 1K73C 4PJOD 1QP3A 1NZ9A 5GAN4 4J7IA 1VQ5A 4M7AA 4M7DC 2QQSA 1KHCA 2EJ9A 3WXMB 1YCYA 4QW2A 2CZ1B 1EIFA 4LDWA 3UT1A 4HT8A 4IKFA 5GAOn 4E7HA 1YJ9T 2RJCA 1OI1A 2YRVA 4HT9A 2LC4A 3FIFA 4M78D 4M77G 3OYLA 1LNXA 3X20B 1U8RA 3KUFA 2K3YA 3QG1A 4M7AC 3V7SA 2JTMA 5GANd 1M90C 4D6WA 2L89A 3SB2A 2MMPA 1KQSS 1BIAA 1M5Q1 4PKCC 5HY6A 1VQKT 4N4GA 1VQPT 4A4GA 1Y7XA 2PVDB 2KAFA 2RI2A 1OYXA 1ZHIA 2DXCA 2KMTA 1Q86C 3NTHA 1U1SA 3VYHB 2EAYA 3LLRA 4JS5A 2DZ9A 4OB1B 1QW1A 3M55A 5J3BA 3CCVT 3CCLT 2V8IA 4BDYA 2RJDA 2PVOB 4BY6B 2EFIA 2QQRA 3G4SA 5DLOA 2R5MA 2XICA 1NJIU 4JLIA 2K5FA 3OMGA 3JCMP 3GP8A 1UGSB 2AHJB 4C92F 3CC4T 3S3MA 1M8VA 1RI0A 4ZN3A 4NS5A 3N5BB 3HRUA 4Q5WA 4C5IA 1VQOA 3OYEA 4NOYA 5FLXE 3DB4A 2QQBA 3CPWS 4PLIA 1G3WA 3HRSA 3URGA 3KXTA 2EWNA 4KUDK 3JB9F 2PU9B 1XTDA 1K8AC 3M56A 3DKMA 5I2MA 2OTLT 4M7DG 3CCEA 4RCCA 3GLXA 4TVRA 4Y28E 5I2SA 2PQWA 1RL2A 4F7UB 3MP6A 2JZ2A 1X01A 3P8HA 4A53A 3SWNA 3GF5A 3ZFJA 3LW5E 5GAN3 3GPLA 1VQ4T 2FL7A 4PJOB 1N8RC 4M78E 3CMAT 3HPWA 4OVAA 3JCMc 2RD1A 2CYZB 3PT9A 5CKBA 3MEUA 4M75E 4M7AG 3OBYA 2P4TA 1JB0E 5CKDA 5GMKj 3META 3OBWA 3BDUA 4ZGDB 4M78B 4V2SA 1UB4A 3DLMA 1VQ7T 3SWNC 2DD4A 3NFCA 1D3BA 2DVEA 3P8DA 2EJFA 2DXTA 4YTLA 1Y96A 3BY7A 3ZEHA 2DO3A 4N4IA 5DLQE 3GOXA 3MO8A 4B9XA 5LJ5d 1KHIA 2E70A 1I4K1 4ZN1A 3H8ZA 3CXCA 1K73U 2QA4T 2CGHA 3I55T 5M9OA 5GANf 1BKBA 2R58A 3UPUA 2RI3A 2RO0A 4A4EA 3VJPA 5GAOp 3OS0A 1HK9A 2HD0A 2LCLA 1X75C 3E9FA 3CCMA 5CAIA 4CI0C 1YJNA 5FU6C 3L2RA 1FXXA 4GLKA 5FU7B 1XQHA 1Q81C 5HK3A 4O6JA 2VC8A 1VUBA 3M59A 4XQ3A 3T9NA 3QPHA 4FIBA 3OYBA 3CCQT 2X4YA 5CR2A 5DY9A 1M90U 3DB3A 4NL2A 3JCMV 3PIPA 4RCBA 4C0DB 2QEXT 4BI8B 1R8OB 4OGCA 1MGQA 4M77A 5HKCA 5LJ5g 1VQNA 3JCMb 1Q86U 3L2WA 1PSFA 2R57A 2VXEA 5GMKl 4IUUA 2DK3A 3A8HB 3QJYA 4A54A 4LD6A 3CBMA 3SD4A 3HFNA 4M77C 2ZPFB 3TEEA 3LH0A 1YIJT 1Y07A 3J81E 2M1HA 2D0QB 5GAOm 1QVPA 2M16A 4ELYC 3PFSA 2VGMA 3FJPA 4PL6A 2L5QA 1VQ9A 3C4SA 4HCCA 2M0OA 2XI9A 3PMTA 3VYGA 1O9SA 1K8AU 2RHYA 4C8QF 4E47A 3VUZA 5GANj 4M7DE 4PLLA 2E1HA 2CZ0B 3M57A 4C5HA 3CCRT 3LWHA 2BIVA 5GAN7 2HQXA 2RHZA 3QIIA 2LX9A 1VQ7A 3WVDB 4EPCA 5KE3A 3QXEB 4MMKA 5D6WA 4C92G 3JSCA 3RMSA 3JCMQ 5A2QE 4L5GA 1N8RU 3V8JA 5CQYA 5LJ5f 3G71T 4MZTA 3OYAA 4M7AE 2LCCA 3C94A 4N4HA 5GAN6 3PTAA 3JB9G 2MWPA 4B9WA 4IUVA 2E5QA 5GAN2 3JAME 3CC4A 2XKOC 1BIBA 3J80E 1M9SA 1WJRA 3EFSA 2DIQA 2EIFA 4DQ2A 2L3RA 3RMQA 3M54A 2OTLA 4OF1A 3QJ6A 3P8BB 3QO3A 1JJ2A 2LDMA 3CC7T 3C12A 1YHQA 2JOYA 2XDPA 3E19A 3RKYA 4E7KA 4JRQA 5LL6S 2G3RA 4C0ZA 3CD6T 4RG8A 4M75D 5LJ3e 2RM4A 4CRIA 3V7CA 1VQMA 1Q81U 3RKXA 2K4YA 1X6OA 5AYFA 4KUIA 5FROA 3C95A 3PIOA 3QUIA 2E6ZA 1WPYA 3LGFA 1I5LA 2RHUA 5D6YA 2ZPIB 1XOVA 5GMKe 3BFMA 5GAN8 3OW2A 2EJGA 2K2VA 1QVGA 3OY9A 3OYMA 5FRMA 2V8JA 2JVVA 2ZPGB 5GAMe 1SSFA 3WVEB 2RK1A 2R5AA 1Q7YC 1W2BS 2K3XA 2DXUA 2VV5A 5LJ5j 3CMET 2QA4A 3GNFB 1VIFA 4GY5A 3X24B 3QYGB 1PSEA 4QVDA 2OTJT 4LDVA 4ATOA 4M77D 1O75A 3SFMA 4L6V5 5GANg 5GANh 2EYQA 3BW1A 1KQ2A 4FM4B 5GAMf 4F7UF 3FDRA 4P5NA 4LDXA 3HFOA 2RJEA 4PJOF 3SWNB 3V8KA 2QQ9A 3CCQA 5CIUA 1N9SA 1I81A 5CKFA 3PMIA 5IN1A 2WSEE 3MEVA 3RESA 3OYIA 3OYCA 1B34B 2O4XB 4HCBA 3A8LB 4MZPA 2MF2A 4M78F 3JCMe 3CCSA 2CZ7B 4XTYA 4IURA 4BB7A 1D3BB 4KBMB 3TREA 3M4GA 2WSFE 3OA6A 5KH6A 4JS4A 3RKWA 5IT9E 2ZPEB 3CBPA 5GAN5 4BD3A 4M75B 5J26A 5GAOr 1VQ5T 2DTHA 3M5AA 4UC4A 5CK9A 4XK8E 1H641 3PNWC 3UDCA 2QQAA 1KQ1A 4C8QG 1YIJA 1K9MC 2GFUA 4C92A 2HNIA 1BI1A 4JDSA 4QQGA 4R55A 3QSUA 3NTIA 3OSSC 2XK0A 4JRKA 2DAQA 3JCMf 3KBGA 2MAMA 1KQSA 4II1A 2ZGWA 4M7DD 1I8FA 1Y71A 4J5YA 4XTVA 4EDUA 5A0LA 2X4WA 1YITT 2XDBA 4F7UA 3L2VA 2K5LA 3LWIA 4PJOA 2ZPBB 3CCRA 3M53A 4C92C 1UGPB 1QP2A 2JNGA 4BI4A 2KSSA 4M77E 4IUPA 2NLUA 2DTIA 1DJ7B 4M7AD 1W2BA 2ZZDA 4XAXB 3CCUA 3M58A 1IREB 1BYMA 3OYHA 4J6XA 3MCAB 4M77B 4M78A 4R56A 3INZA 2IVWA 2GF7A 4PJOC 2P0PA 3EAEA 4X9DA 4KULA 4EMKB 3A8OB 2XHCA 5LJ5h 3CPWA 3A5ZB 3OSVA 4FT2A 3MEAA 2RA2A 3M9QA 4XU0A 5CKHA 4BDZA 4BE0A 4A4KA 4ZTJA 1Q82C 3SDZA 4FSXA 1VQ8T 4C5EA 3H6ZA 4M78C 4A4FA 1FX7A 3OYJA 1Q7YU 4OGEA 2EQKA 4FT4A 1ZQ1A 2P0QA 5IAYA 5KCOA 1YJ9A 4N0AA 3CC7A 4J6YA 1LJOA 2KQWA 5LJ3d 1OZ2A 2BKDN 5GAOq 4MMLA 4ZGJB 4OB0B 3HKSA 4C5GA 3S6WA 4O5VA 2EQJA 1NPRA 2E10A 2VXFA 1U1TA 1VQKA 2KY9A 1VQPA 1V29B 3CCJT 4N0AC 2KK4A 3I56T 4LD9K 3MP1A 3A8MB 4M7DB 5GAMd 2ZCFB 3QZ5B 4MDWA 3MEWA 3CCVA 3CCLA 2KDSA 3VKIA 4PNOA 4DA4A 3L2ZA 3HSBA 1H3ZA 3HHTB 3QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A53 A;  3SWN A;  1I5L A;  5GAN 3;  4F7U G;  1HXD A;  4M75 C;  5GMK e;  5GAN 8;  3BFM A;  4PJO B;  2EJG A;  5LJ3 g;  4PJO G;  2Y90 A;  4M78 E;  4M7A B;  5GMK i;  3JCM c;  2RD1 A;  2DEQ A;  5GAM e;  4M75 E;  4M7A G;  4JRI A;  3JB9 I;  1LOJ A;  1JBM A;  5GMK j;  3BDU A;  3RER A;  2DXU A;  4M78 B;  5LJ5 j;  4V2S A;  1WQW A;  3SWN C;  4M78 G;  1D3B A;  2DVE A;  2EJF A;  2K57 A;  2DXT A;  4QVD A;  5GAO l;  4M7D F;  1Y96 A;  3BY7 A;  4M77 D;  4JUV A;  5GAM h;  4Y91 A;  5GAM g;  4XU1 A;  4C8Q A;  4EMK A;  5LJ5 d;  5GAN g;  3BW1 A;  4XTZ A;  5GAN h;  4C92 D;  3V8L A;  1I4K 1;  3JCM d;  5GAM f;  1KQ2 A;  2E65 A;  1N9R A;  4F7U F;  2CGH A;  3HFO A;  5GAN f;  3SWN B;  4PJO F;  3V8K A;  3RIR A;  4NL3 A;  2YHT A;  5GAO p;  3JB9 D;  1HK9 A;  4M7A F;  1N9S A;  1I81 A;  1JRI A;  3RES A;  5CAI A;  4C8Q C;  4EMK C;  1B34 B;  3V7R A;  5LJ3 h;  5LJ5 e;  2E64 A;  4M78 F;  4WF2 A;  2DTO A;  4XTY A;  4XU2 A;  2VC8 A;  4OP0 A;  3JCM e;  4XQ3 A;  5LJ3 f;  4C8Q E;  4HA8 A;  1D3B B;  3GIB A;  3M4G A;  5DY9 A;  4EMH A;  4NL2 A;  3JCM V;  4XTX A;  3RKW A;  4RCB A;  5GAN 5;  4M75 B;  5GMK h;  5GAO r;  4C8Q B;  1MGQ A;  2DTH A;  4M77 A;  4X9C A;  5LJ5 g;  4M75 G;  3JB9 H;  1H64 1;  3JCM g;  4C8Q G;  3JCM h;  1KQ1 A;  2VXE A;  5GMK l;  3JCM b;  4EMG A;  4C92 A;  2E41 A;  2HNI A;  3EFR A;  3FB9 A;  3QSU A;  3VU3 C;  2DZC A;  4JRK A;  4XTW A;  3JCM f;  4A54 A;  4M7D A;  5GAN j;  3JB9 J;  2I2L A;  2ZGW A;  4M7D D;  1I8F A;  4XTV A;  4J5Y A;  4XTU A;  3HFN A;  4M77 C;  4F7U A;  4M7D E;  2QTX A;  4PJO A;  4C92 C;  5GAO m;  4PJO D;  4M77 E;  5GAN 4;  5I21 A;  4M7A A;  4M7D C;  3FJP A;  2DTI A;  3RUX A;  2EJ9 A;  4M7A D;  1YCY A;  3JCM X;  4HT8 A;  4C92 E;  4M75 F;  2JN0 A;  4XU3 A;  4C8Q F;  5GAO n;  3L1A A;  3PGG A;  4J6X A;  4M77 B;  2E1H A;  3INZ A;  2YLC A;  4M78 A;  4HT9 A;  3FIF A;  1Y96 B;  1TH7 A;  4M77 G;  4M78 D;  5GAN 7;  4X9D A;  4PJO C;  4C92 B;  1LNX A;  4EMK B;  4MMK A;  4F7U E;  5LJ5 h;  4M7A C;  3V7S A;  4C92 G;  4XU0 A;  2RA2 A;  4PJO E;  3JCM Q;  5GAN d;  3SB2 A;  3V8J A;  5LJ5 f;  1BIA A;  1M5Q 1;  4M7A E;  4M78 C;  5LJ3 j;  5GAN 6;  3JB9 G;  5GAN 2;  1U1S A;  4J6W A;  2EAY A;  2DZ9 A;  1BIB A;  3AHU A;  4N0A A;  3EFS A;  4J6Y A;  1LJO A;  3JCM J;  2DJZ A;  5LJ3 d;  1B34 A;  5GAN e;  5GAO q;  3JB9 F;  4M77 F;  4MML A;  4DQ2 A;  5GMK m;  4JLI A;  5GAM j;  2FB7 A;  3JCM P;  4C92 F;  2E10 A;  2VXF A;  1U1T A;  2YLB A;  3QO3 A;  1M8V A;  4NOY A;  4N0A C;  2RB6 A;  4M75 A;  3RKY A;  2EWN A;  4M75 D;  4QVC A;  1WQ7 A;  2RM4 A;  2DKG A;  4C8Q D;  5LJ3 e;  1WNL A;  2FYK A;  5GAM d;  3V7C A;  3JCM W;  4M7D B;  4M7D G;  3RKX A;  4RCC A;  4PNO A;  3L2Z A;  3HSB A;  4F7U B;  3QUI A;  1WPY A;  1X01 A;  3QHS A; 
#chains in the Genus database with same CATH topology
 4C0D C;  1Z9Q A;  2X4X A;  3TCJ A;  1RAD B;  1H8K A;  1YHQ Q;  1NG2 A;  5HCK A;  2O9V A;  3OYF A;  2LQ8 A;  4JRI A;  1CKB A;  3CMA Q;  2XDD A;  1K9M U;  2GTJ A;  3RER A;  2Y4X A;  3VS6 A;  2QGF B;  5GAM g;  5GAM h;  1M27 C;  2LZ6 B;  4C8Q A;  4XTZ A;  4FL6 A;  1TOV A;  3CMA A;  1VIE A;  2VVK A;  1X43 A;  2QA4 Q;  1IRX A;  1BBZ A;  5D6X A;  1F1B B;  2O31 A;  4PJM A;  1GCQ A;  2DVJ A;  3CC2 T;  2CUD A;  2VGN A;  3HTR A;  2VUB A;  4HCZ A;  5LJ3 f;  3OMC A;  2XU8 A;  2CP6 A;  4F16 A;  1YIT A;  1YWO A;  2BUD A;  2E3H A;  2H3J A;  3EG0 A;  1M4Z A;  1C6V X;  2DZC A;  4RUG A;  3PVL A;  4OB3 B;  2GQI A;  3J7A F;  2GTO A;  3VS3 A;  4E6R A;  1YJW T;  4AFU C;  2M9U A;  3Q1J A;  3LYI A;  2L8D A;  5KE2 A;  5KYW B;  2DIG A;  1MUZ A;  4M75 F;  3OYN A;  4XU3 A;  2EQU A;  3L1A A;  5DM7 R;  3OS2 A;  2PUK B;  3UWN A;  3CCR Q;  4QKU A;  4Z02 A;  3VS7 A;  1N6A A;  2F5T X;  2CS7 A;  4BY6 C;  2VKN A;  4D8D A;  1Q7Y R;  1RAF B;  3G71 Q;  1RAG B;  3CPF A;  1AWJ A;  1YBY A;  1YWP A;  4J6W A;  3OYD A;  4LDU A;  1VQM T;  3JCM J;  3HP9 A;  5GAN e;  4OB2 B;  4M77 F;  5GMK m;  5FW9 A;  4OML A;  1AHJ B;  3G71 A;  2QAS A;  2FZG B;  1NPP A;  2MI6 A;  3CC7 Q;  3F70 A;  4QVC A;  2LT1 A;  4C8Q D;  2FYK A;  2DEU A;  2LT4 A;  2DER A;  4J9E A;  4LN2 A;  4MZM A;  1SRL A;  3X25 B;  2X9H A;  2DD5 A;  5FWC A;  1JBM A;  3CD6 A;  3G7Z A;  4FYV B;  2ZPH B;  3LH5 A;  2O01 E;  3CME Q;  3EGU A;  2A7Y A;  2C06 A;  2KRO A;  1VYT A;  4JUV A;  3RNJ A;  5L8R E;  2RK2 A;  2X3W D;  2D9T A;  1QCF A;  5A0G A;  1HJD A;  3FLG A;  3X26 B;  3CME A;  3M0U A;  3O8V A;  5LJ3 h;  2KXC A;  4LDY A;  5LJ5 e;  1U5S A;  3OYK A;  2DBM A;  2HMA A;  4Z88 A;  3VUB A;  2B86 A;  2HBP A;  2WAC A;  1RAE B;  4EMH A;  4PFP A;  2FEI A;  3FJ5 A;  4JLG A;  2RQR A;  4C8Q B;  2K2M A;  2RN8 A;  1VQL A;  2NUT B;  3G6E A;  4RTX A;  2E41 A;  3I5S A;  1K1Z A;  3OYY A;  1E6H A;  2MWO A;  4XTU A;  1ZSZ C;  2HQE A;  4J9F A;  2XID A;  5CQX A;  3SHW A;  1QP3 A;  5GAN 4;  4M7A A;  4M7D C;  1SG5 A;  1NJI R;  5IXB A;  4HT8 A;  1EIF A;  1E7O A;  2KGT A;  1YJ9 T;  2RJC A;  3UF4 A;  3FIF A;  2SEM A;  1WLP B;  3ULR B;  3V7S A;  1KC8 R;  1EX4 A;  2D1X A;  2JTM A;  4D6W A;  1M5Q 1;  2DX1 A;  4N4G A;  1IHV A;  4A4G A;  2J05 A;  2KAF A;  1VQ8 Q;  1KD1 R;  1Q86 C;  1V1C A;  2EAY A;  1QW1 A;  3M55 A;  3CCL T;  2V8I A;  2QQR A;  2KBT A;  1NJI U;  2A08 A;  3GP8 A;  1UGS B;  1RI0 A;  1VQO A;  4NOY A;  2QQB A;  3URG A;  2EWN A;  4RTT A;  3M56 A;  3DKM A;  5I2M A;  1HSQ A;  3UAT A;  4TVR A;  5I2S A;  1RL2 A;  2HZY A;  4F7U B;  2CSQ A;  1U3O A;  1LCK A;  3CMA T;  1J3T A;  1JB0 E;  5GMK j;  3VS2 A;  3OBW A;  1S72 Q;  4KGZ B;  2FPD A;  3BY7 A;  2DO3 A;  4N4I A;  2QA4 T;  3UPU A;  2RI3 A;  2RO0 A;  1HK9 A;  1OV3 A;  2A37 A;  2HD0 A;  1VQ6 Q;  5FU6 C;  1I0C A;  1BCM A;  1FYN A;  4O6J A;  3M59 A;  3T9N A;  1QCO A;  2X4Y A;  1A0N B;  1M90 U;  4NL2 A;  2EBP A;  4AMC A;  1R8O B;  1MGQ A;  4M77 A;  5HKC A;  1VQN A;  3JCM b;  1PSF A;  1KSW A;  1YI2 Q;  3A8H B;  2NYS A;  2P4R A;  4LD6 A;  2MIO A;  1ZX6 A;  2ZPF B;  2EGC A;  1MND A;  1Y07 A;  1QVP A;  1OX8 A;  1WA7 A;  2VGM A;  3FJP A;  2L5Q A;  3C4S A;  2XI9 A;  3PMT A;  1K8A U;  4E2F B;  3CCR T;  2BIV A;  2JJ9 A;  2COY A;  3NPF A;  5KE3 A;  1PHT A;  3G71 T;  3ZL7 C;  4MZT A;  2LCC A;  3C94 A;  3PTA A;  2CT4 A;  4JJC A;  2E5Q A;  3CC4 A;  3J80 E;  1M9S A;  2COZ A;  1TTH B;  2LJ0 A;  1TS9 A;  1NEB A;  4Y92 A;  1M3A A;  2OTL A;  4OF1 A;  1SPK A;  3CC7 T;  3C12 A;  3E19 A;  3EG1 A;  4IIM A;  3CD6 T;  4M75 D;  3G4S Q;  3A1P A;  2K4Y A;  4DEX A;  1AVZ C;  3LGF A;  1VQ7 A;  1BK2 A;  2EJG A;  2K2V A;  3OYM A;  2V8J A;  2JVV A;  1SSF A;  3RBB B;  1W2B S;  2K3X A;  2DXU A;  3H41 A;  5GJW B;  3CME T;  1VIF A;  3QYG B;  2YRC A;  4M77 D;  3SFM A;  1AWX A;  4L6V 5;  4AFZ C;  1RAC B;  3NGP A;  3U23 A;  4FM4 B;  3FDR A;  4P5N A;  2RJE A;  4PJO F;  1RAI B;  1I81 A;  5KYX A;  1NLO C;  3RES A;  2O4X B;  3A8L B;  4M78 F;  3JCM e;  3OW2 P;  4IUR A;  2WSF E;  1UDL A;  3OA6 A;  5KH6 A;  5IT9 E;  2ZPE B;  2EYW A;  4M75 B;  3CCM Q;  5CK9 A;  1ACM B;  1H64 1;  2X51 A;  3PNW C;  3EGD B;  4C8Q G;  1PRM C;  1BI1 A;  2EYX A;  1B07 A;  2MAM A;  1GBQ A;  1M2V A;  1Y71 A;  4J5Y A;  4EDU A;  5A0L A;  1MV3 A;  2ABL A;  4BI4 A;  9ATC B;  2DFU A;  2NLU A;  2ZZD A;  4XAX B;  1BYM A;  1IRE B;  4M77 B;  2DRM A;  2FRY A;  4KUL A;  2YUP A;  2XHC A;  3A5Z B;  4XU0 A;  4BDZ A;  4BE0 A;  2DA9 A;  1N8R R;  4A4K A;  1FMK A;  1VQ8 T;  4C5E A;  4F04 B;  1VQK Q;  1VQP Q;  1X27 A;  2KQW A;  3CCV Q;  5GAO q;  4ZGJ B;  1PG5 B;  4C5G A;  2VXF A;  1VQK A;  1U1T A;  1VQP A;  5IHK A;  1B7T A;  2LQN A;  2DJQ A;  4LD9 K;  2DLP A;  5GAM d;  2CP5 A;  3QZ5 B;  4MDW A;  3EH2 A;  3CCV A;  1Q81 R;  4PNO A;  4DA4 A;  3L2Z A;  2HCK A;  3HHT B;  1KJW A;  2GQV A;  4F7U G;  4RTY A;  1S72 T;  2FG0 A;  3MHX A;  1WXU A;  1JXO A;  5EG2 A;  3ZBD A;  1M1K C;  4JPB W;  2ROT A;  1MV0 B;  2IIM A;  3V8L A;  1UEB A;  3D7S B;  1PNJ A;  3L42 A;  3TU4 K;  1BI0 A;  1VQ6 T;  4E7J A;  1G3T A;  5CVI A;  2LCS A;  2F1L A;  1GXI E;  2HKN A;  2LX7 A;  2KXD A;  4XTX A;  3CCQ Q;  2O88 A;  1Q82 U;  1QWF A;  3ME9 A;  4DOV A;  1YI2 T;  4QQ6 A;  2QEX Q;  1ARK A;  3OYG A;  1N27 A;  2JMC A;  4ZGE B;  1Y0M A;  4HKE A;  3QWY A;  2QK0 A;  1BI2 A;  3OQ5 A;  3H0I A;  1R0C B;  4KH0 B;  3JRZ A;  2L3S A;  2QEX A;  5I21 A;  4BUG A;  4C92 E;  1PRL C;  3PGG A;  5IH2 A;  2E5K A;  2KI7 A;  2YLC A;  1TH7 A;  2CZ6 B;  2XMF A;  2XD0 A;  4KGV B;  2A3L A;  4F7U E;  2MK5 A;  4ELZ C;  1M2V B;  2DL3 A;  1D0X A;  5LJ3 j;  3R6O A;  3M4Y A;  3FRN A;  3M0S A;  2LQK A;  4FW1 A;  4CC3 A;  3CCJ A;  3I56 A;  2DJZ A;  1WJS A;  2K7A A;  1WZO A;  4RKU E;  1I5O B;  1TG0 A;  2PUO B;  4C0F A;  3G4S T;  1WQ7 A;  3EG9 A;  4MDX A;  1EZZ B;  4BE1 A;  2MCN A;  1X2Q A;  4L59 A;  4LNP A;  2DEQ A;  2KRS A;  1D0Y A;  3JB9 I;  1K9M R;  4IUT A;  3EG3 A;  2NUP B;  2DM1 A;  4XU1 A;  2GFA A;  5FU7 C;  1N9R A;  4HVU A;  4OMN A;  2K5I A;  2YHT A;  4M7A F;  3OW2 S;  2ZAE A;  2F69 A;  4EMK C;  2VAS A;  4WF2 A;  4HA8 A;  2LRQ A;  2DBK A;  4IIO A;  1BB9 A;  2QI2 A;  4LE9 A;  3CCM T;  1JXM A;  1ZSZ A;  4X9C A;  4M75 G;  4FSS A;  1R0B G;  2XG8 D;  3FB9 A;  3EFR A;  7AT1 B;  4OMF B;  4M7D A;  1AWW A;  3EHR A;  2RJF A;  1YIT Q;  5C6S A;  1M1G A;  1OUL A;  1K73 C;  4PJO D;  2AKL A;  1NZ9 A;  4J7I A;  2JXB A;  1KHC A;  3WXM B;  4LDW A;  3TSW A;  2YRV A;  2ENM A;  1QVF P;  4M78 D;  4M77 G;  3OYL A;  2K3Y A;  1UE9 A;  1OQK A;  1WI7 A;  2L89 A;  3SB2 A;  1WHH A;  1VQK T;  4PKC C;  5KYY B;  1VQP T;  2FZC B;  4JZ4 A;  1OYX A;  1ZHI A;  1VOM A;  3NTH A;  2OAW A;  4JS5 A;  2JS0 A;  1RAH B;  4OB1 B;  5J3B A;  2AZV A;  5GJV B;  3CCV T;  3NHN A;  4BY6 B;  5DLO A;  4JLI A;  2J6K A;  3JCM P;  2AHJ B;  1M8V A;  1Y57 A;  2BZY A;  4Q5W A;  3HRU A;  5I11 A;  4C5I A;  3DB4 A;  1ZUK A;  1G3W A;  1M3B A;  3JB9 F;  2PU9 B;  1XTD A;  1G83 A;  3CCE A;  2J6F A;  1X01 A;  4LXC A;  4PJO B;  1GL5 A;  4M4Z A;  2RD1 A;  2CYZ B;  4M75 E;  1SHF A;  5I22 A;  1K4U S;  2P4T A;  4ZGD B;  4M78 B;  2AZS A;  4ORZ A;  3SWN C;  2DVE A;  2EQI A;  3NMZ C;  2DET A;  1M3C A;  4YTL A;  1Y96 A;  3EG9 B;  5DLQ E;  3R6N A;  3MO8 A;  2EGA A;  3H8Z A;  2CGH A;  8ATC B;  3CD6 Q;  2KT1 A;  2R58 A;  2LQW A;  1TUC A;  3VJP A;  1SSH A;  2LCL A;  1X75 C;  3E9F A;  1YJN A;  4GLK A;  1XQH A;  5HK3 A;  1VUB A;  6AT1 B;  3QPH A;  3CCQ T;  5CR2 A;  5DY9 A;  2C0O A;  4RCB A;  2QEX T;  1G8X A;  4OGC A;  2H3E B;  5LJ5 g;  1Q86 U;  1VA7 A;  1V76 A;  2M02 A;  4IUU A;  1RI9 A;  3CXC P;  3HFN A;  3LH0 A;  1VQL Q;  3G6E Q;  4ELY C;  1H92 A;  2EYZ A;  4HCC A;  2AIR B;  1O9S A;  2RHY A;  3VUZ A;  2CZ0 B;  2FO0 A;  2AKK A;  5GAN 7;  2HQX A;  2RHZ A;  3WVD B;  2Z0W A;  4MMK A;  1PC0 A;  3RMS A;  5A2Q E;  4L5G A;  1WYX A;  3V8J A;  3OYA A;  1CKA A;  4N4H A;  4IUV A;  1ZUY A;  2XKO C;  1BIB A;  3EFS A;  4DQ2 A;  2LJ1 A;  4DBQ A;  3QJ6 A;  3P8B B;  3QO3 A;  2LDM A;  2XDP A;  4E7K A;  4JRQ A;  1MMN A;  5LJ3 e;  2RM4 A;  2FPF A;  2EKH A;  1K0S A;  3RKX A;  1X6O A;  5FRO A;  1X6B A;  1VQO Q;  1VYV A;  4GBQ A;  5GAN 8;  2ZPI B;  1XOV A;  3OW2 A;  4E7S A;  1C1A A;  2RMO A;  1U06 A;  2EGE A;  1LVK A;  1OX9 A;  2RK1 A;  1PCX A;  1W70 A;  1Q7Y C;  2MOX A;  3X24 B;  1N5Z A;  1PSE A;  1EFN A;  4LDV A;  4ATO A;  1JJ2 P;  2EYQ A;  2AT1 B;  2KYM A;  4LDX A;  3HFO A;  2JS2 A;  2QQ9 A;  5CKF A;  3PMI A;  5IN1 A;  2WSE E;  3OYI A;  2M0Y A;  4HCB A;  3UA7 A;  2MF2 A;  2CZ7 B;  4BB7 A;  1OU8 A;  4KBM B;  3TRE A;  1M90 R;  1NEG A;  1W1F A;  5J26 A;  5GAO r;  1ZUU A;  4F17 A;  3M5A A;  4UC4 A;  1UGV A;  2V1Q A;  1YIJ A;  2GFU A;  4Z8A A;  4R55 A;  2HNI A;  4QQG A;  3NTI A;  2XK0 A;  3JCM f;  3CCU Q;  2QAZ A;  4II1 A;  1YIT T;  2K5L A;  1E6G A;  1VQN Q;  3LWI A;  2DIL A;  4C92 C;  1CSK A;  2H8H A;  1K0X A;  2EW3 A;  2GGR A;  4M7A D;  1K8A R;  3CCU A;  4J6X A;  4R56 A;  4WCI A;  1WHK A;  3VS0 A;  2HEQ A;  3SEM A;  1HYO A;  1FX7 A;  2F2X A;  4FT4 A;  1KQS P;  5KCO A;  1LJO A;  1WXB A;  2DYI A;  2EYY A;  1VYU A;  1OZ2 A;  3CQT A;  4MML A;  4Z89 A;  3HKS A;  3I35 A;  2EQJ A;  4JZ3 A;  4QT7 A;  1K9A A;  2E10 A;  2KY9 A;  4LUD A;  2JT4 A;  3CC4 Q;  3MKD A;  2W0Z A;  2KDS A;  2L2P A;  1TU0 B;  3VKI A;  3HSB A;  2OTL Q;  3NTK A;  4E7Z A;  1HXD A;  1KC8 C;  3OS5 A;  3HRT A;  4PJO G;  2Y90 A;  1Z9Z A;  4OMQ A;  4M7A B;  1VQ4 Q;  2YUQ A;  2LMJ A;  1W6X A;  4AT1 B;  4BAC A;  4JJN K;  1KD1 C;  4M78 G;  3BDL A;  3S3O A;  2QDY B;  5GAO l;  3CBO A;  1VQ7 Q;  2V8K A;  2KNB B;  4Y91 A;  3L2U A;  1X6G A;  1VQ4 A;  1SHG A;  4BI3 A;  2YXY A;  1BU1 A;  3RIR A;  3I55 Q;  4HVW A;  3JB9 D;  2DL4 A;  3IQL A;  4QVZ A;  3V7R A;  1WGS A;  3LX7 A;  4ANJ A;  4CC4 B;  2JTE A;  2LVM A;  1KFZ A;  3E9G A;  4JJB A;  3I55 A;  2FZK B;  3EFO A;  3JCM g;  1WHJ A;  3JCM h;  3X28 B;  1PM3 A;  3CXC S;  2O2O A;  3FC3 A;  2I2L A;  2FRW A;  1PWT A;  4FU6 A;  1VQL T;  4BE2 A;  3G6E T;  2LNV A;  2QTX A;  3ER0 A;  2KE9 A;  3HL8 A;  2RI5 A;  5KYN A;  4OMM A;  3RUX A;  2KVQ G;  1JEG A;  1X69 A;  2IPO B;  2JN0 A;  1PD1 A;  3G1J A;  1IXD A;  3AT1 B;  2EKO A;  4PJO E;  2JTF A;  2Y4Y A;  1M1F A;  4HVV A;  3EGX A;  3OS1 A;  3TQ7 P;  1W4S A;  3AHU A;  1B34 A;  1M1K U;  2L0A A;  2RH2 A;  2E12 A;  3VS1 A;  5GAM j;  4QQD A;  2MPX C;  2YLB A;  2K6D A;  1SKU B;  2D6F A;  2RB6 A;  1UGR B;  2CKK A;  1WNL A;  3JCM W;  2FHD A;  1VQO T;  2L3P A;  2KT8 A;  4M75 C;  2EQM A;  1T0J A;  4IUQ A;  2E6N A;  4J9B A;  2NUZ A;  4E7L A;  1LOJ A;  4PFZ A;  4JJD A;  3OB9 A;  2VYT A;  1MHN A;  1RUW A;  1JJ2 S;  1YP5 A;  1QQJ A;  3GNG A;  4M7D F;  3QZ9 B;  2W10 A;  3DLL A;  2OTJ Q;  5KCH A;  4EMK A;  1G3S A;  4AG2 C;  3CC2 A;  2X4J A;  2P0K A;  1MNE A;  3VRY A;  2FVU A;  4VUB A;  1JRI A;  4AG1 C;  2QGG A;  2CP7 A;  2CDT A;  2OTJ A;  1KG1 A;  1UGQ B;  4XU2 A;  1QVF A;  4C8Q E;  4E7I A;  1NE8 A;  4D8K A;  4FYY B;  1Q82 R;  1D1B A;  3MP8 A;  5GMK h;  1YJW A;  3JB9 H;  4EMG A;  3QKJ A;  3CCU T;  1P92 A;  2DPP B;  3VU3 C;  3LGL A;  2IG0 A;  3TSZ A;  3JB9 J;  1I1J A;  1OZ3 A;  1GBR A;  1VQN T;  1TWB A;  1KIK A;  3EG2 A;  1T0H A;  1VQ5 A;  3JV3 A;  4IKF A;  4QW2 A;  3UT1 A;  2CZ1 B;  1OI1 A;  4HT9 A;  3E2U A;  1LNX A;  2PNI A;  3X20 B;  3QG1 A;  5GAN d;  2MMP A;  1KQS S;  2HDA A;  5HY6 A;  1ZA2 B;  1Y7X A;  2PVD B;  2RI2 A;  2DXC A;  5KYX B;  2KMT A;  1U1S A;  3VYH B;  3LLR A;  2DZ9 A;  4ESR A;  2JMA A;  2RJD A;  2PVO B;  1GFD A;  2EFI A;  2BZX A;  2R5M A;  1MMD A;  4R0K A;  3S3M A;  4C92 F;  3CC4 T;  4NS5 A;  3M0R A;  2K9G A;  5FLX E;  2JM8 A;  4PLI A;  2GBQ A;  3KXT A;  3CCJ Q;  3I56 Q;  4J9H A;  2CH4 W;  2YSQ A;  1NLP C;  3EGX B;  2OTL T;  4RCC A;  3UA6 A;  1UJ0 A;  3GLX A;  3VS4 A;  2PQW A;  3MP6 A;  2JZ2 A;  3P8H A;  1SF9 A;  3GF5 A;  3SWN A;  3GPL A;  1VQ4 T;  2YWW A;  1N8R C;  3HPW A;  3JCM c;  4M7A G;  3BE3 A;  1D0Z A;  3BDU A;  5KYW A;  1UB4 A;  3DLM A;  4WTO B;  1VQ7 T;  3P8D A;  2EJF A;  2RPN A;  2DXT A;  3ZEH A;  3GOX A;  5LJ5 d;  1I4K 1;  3CXC A;  1K73 U;  3I55 T;  5M9O A;  5GAN f;  1BKB A;  1WX6 A;  1NYG A;  2DRK A;  4A4E A;  5GAO p;  2MYS A;  1S1N A;  2LP5 A;  3L2R A;  1FXX A;  5FU7 B;  1Q81 C;  1WHM A;  2P84 A;  1GFC A;  3DB3 A;  3JCM V;  3PIP A;  4C0D B;  4BI8 B;  5KYU A;  1RAA B;  2LNH B;  5L23 A;  5EC7 A;  3QJY A;  2V26 A;  3SD4 A;  4J9G A;  3TEE A;  1GCP A;  2F2W A;  3J81 E;  2D0Q B;  5GAO m;  3PFS A;  2CH4 A;  1VQ9 A;  2M0O A;  2DL8 A;  3M57 A;  1AOJ A;  3LWH A;  3QII A;  2LX9 A;  4EPC A;  1G2B A;  5D6W A;  2BTT A;  4PJL A;  3JSC A;  5CQY A;  5LJ5 f;  4M7A E;  1IB8 A;  1IGQ A;  5GAN 6;  3JB9 G;  1WXT A;  5IHN A;  2DIQ A;  2EIF A;  3H0H A;  1B3Q A;  1YN8 A;  1UFF A;  1TUG B;  1Q95 G;  2L3R A;  3RMQ A;  1JJ2 A;  1OU9 A;  1UUE A;  1YHQ A;  2JOY A;  4F14 A;  5LL6 S;  2G3R A;  4C0Z A;  2NUT A;  4GLM A;  3REB B;  2ATC B;  3V7C A;  1IO6 A;  1WPY A;  2DNU A;  2RHU A;  5D6Y A;  4HCK A;  1QKW A;  2PZ1 A;  5GAM e;  1T3L A;  3WVE B;  3CCE Q;  2VV5 A;  1M2O A;  5FWB A;  2QA4 A;  3GNF B;  4QVD A;  2OTJ T;  1O75 A;  5GAN g;  3CCS Q;  5GAN h;  2ED0 A;  4B6M A;  3SWN B;  1RAB B;  4FCY A;  4DBF A;  2NWM A;  5CIU A;  2COW A;  1N9S A;  3MEV A;  1X2K A;  4MZP A;  3CCS A;  4XTY A;  3REA B;  1QVG P;  2YDL A;  2QYZ A;  3M4G A;  2L3Q A;  3RKW A;  4JS4 A;  1IGU A;  1VQ5 T;  2DTH A;  1YJN Q;  2DMO A;  3H0F A;  3I9Q A;  3M0T A;  4XK8 E;  1Q86 R;  3UDC A;  1K9M C;  2E4H A;  4C92 A;  3QSU A;  2D8J A;  3OSS C;  8AT1 B;  1KQS A;  2ZGW A;  4M7D D;  1I8F A;  4XTV A;  4A63 B;  1AT1 B;  4F7U A;  2JM9 A;  1AWO A;  3CCR A;  3PVQ A;  1UGP B;  1QP2 A;  2JNG A;  2KSS A;  1SRM A;  4M77 E;  4IUP A;  3M58 A;  1M8M A;  3I5R A;  5KYU B;  3OYH A;  3MJX A;  3INZ A;  2IVW A;  1JU5 C;  2GF7 A;  4PJO C;  2P0P A;  5LJ5 h;  1ZA1 B;  3OSV A;  2RA2 A;  3M9Q A;  4ZTJ A;  3SDZ A;  4DBH A;  3H6Z A;  4M78 C;  3OYJ A;  1Q7Y U;  4OGE A;  1MMA A;  4KRT A;  1ZQ1 A;  2D0N A;  4FYX B;  3CC7 A;  2BKD N;  4X1V A;  2QG9 B;  3S6W A;  4O5V A;  1OPK A;  1ZSZ B;  1RLQ C;  1AZG B;  1W2B P;  1V29 B;  3CCJ T;  4N0A C;  2KK4 A;  3I56 T;  2KRM A;  3MP1 A;  3A8M B;  4M7D B;  3MEW A;  2J06 A;  3A98 A;  3CPW P;  2O9S A;  1IHW A;  2E3I A;  3VV0 A;  4FYW B;  4DBR A;  5LJ3 g;  5GMK i;  3QDR B;  2HAX A;  2CT3 A;  1WJQ A;  1WQW A;  3A8G B;  4RMO A;  1QKX A;  4J9C A;  2HSE B;  2CP0 A;  3VRZ A;  4C92 D;  5CO7 A;  2EPD A;  3JCM d;  3S3N A;  2E65 A;  2QTV A;  2I0N A;  4JRP A;  1QWE A;  2OAU A;  4RTZ A;  2C0I A;  4C8Q C;  4DEY A;  2E64 A;  4DOW A;  4RG2 A;  4OP0 A;  3GIB A;  2C0T A;  3FEO A;  2SRC A;  5A0D A;  4J83 A;  1ZSG A;  1GCQ C;  1VQ9 T;  4CC7 A;  4KT0 E;  2DXB A;  2QDL A;  4XTW A;  2QXF A;  1IZ6 A;  2WSC E;  2RNA A;  3E1S A;  4KH1 B;  1NM7 A;  1I07 A;  2OJ2 A;  2EVR A;  1YIJ Q;  3JCM X;  1VQ8 A;  2OI3 A;  1Y96 B;  1YNZ A;  5HK0 A;  4C92 B;  5FU6 B;  2ESW A;  4ME7 A;  2PVG B;  1KC8 U;  2YUN A;  1XNI A;  1YHQ T;  1OEB A;  1BI3 A;  1QLY A;  2ROL A;  4RTW A;  1KD1 U;  2BZ8 A;  2O4X A;  1OPL A;  3C0C A;  1QVF S;  5C0M A;  5FRN A;  2FB7 A;  4K11 A;  2LTO A;  4HXJ A;  5CKE A;  5IHI A;  4ZTF A;  4M75 A;  4J9I A;  1FMW A;  3L2Q A;  4C0G A;  2DKG A;  2JUF A;  1UTI A;  3EGD A;  2GCX A;  5CCA A;  1S72 A;  2HSP A;  4X34 A;  2RHI A;  1G5V A;  2RHX A;  3THK A;  3M0Q A;  1FWZ A;  2RF0 A;  5J39 A;  2DF6 A;  3CCE T;  2RQV A;  1WDX A;  2F5K A;  3ASK A;  2K57 A;  4ZNX A;  1VQ6 A;  2CP2 A;  3CCS T;  1ZBX A;  1NJI C;  2X35 A;  3QYH B;  2D8H A;  4A4H A;  4NL3 A;  2KEA A;  1YCS B;  2B8A A;  1QVG S;  1JQQ A;  1UHC A;  1M30 A;  3RDV A;  2CRE A;  4J8O A;  1G3Y A;  1YI2 A;  2DTO A;  2A0F B;  2F2V A;  3CEY A;  1YJN T;  2HBW A;  2G6F X;  4J7F A;  2PTK A;  2HQH A;  2CP3 A;  3QBY A;  1PKT A;  4OMP A;  1ZBJ A;  2QQS A;  2EJ9 A;  1YCY A;  2V1R A;  1AZE A;  2RQU A;  5GAO n;  4E7H A;  2YUO A;  2LC4 A;  1U8R A;  3KUF A;  1YFN A;  1UJY A;  4M7A C;  2CUB A;  4J9D A;  1RLP C;  2YT6 A;  1M90 C;  1BIA A;  2DL5 A;  1D1C A;  3EHQ A;  4RTU A;  4BDY A;  1M1K R;  3G4S A;  2HL3 A;  2XIC A;  1GRI A;  2K5F A;  3OMG A;  4ZN3 A;  3N5B B;  2HKQ B;  3OYE A;  1TXQ A;  3CPW S;  3HRS A;  4KUD K;  2VB6 A;  1QCN A;  1K8A C;  5D7U A;  4M7D G;  1WFW A;  4Y28 E;  1D09 B;  4A53 A;  3ZFJ A;  3LW5 E;  4EIK A;  5GAN 3;  2FL7 A;  1FMV A;  2A28 A;  4M78 E;  1UHF A;  4OVA A;  5CKB A;  3PT9 A;  3MEU A;  3OBY A;  5CKD A;  2DL7 A;  1LPL A;  3MET A;  3QDF A;  4V2S A;  2DD4 A;  5IXF A;  3NFC A;  1D3B A;  3TVT A;  4B9X A;  2KRN A;  1KHI A;  2E70 A;  4ZN1 A;  1T3S A;  2K3B A;  3OS0 A;  2DYB A;  3CCM A;  5CAI A;  4CI0 C;  4PJN A;  2VC8 A;  1ZLM A;  4XQ3 A;  1C0M A;  4FIB A;  3OYB A;  3CC2 Q;  2RQT A;  2FPE A;  3M0P A;  3MPU B;  1ABO A;  3L2W A;  2R57 A;  2VXE A;  5GMK l;  1ABQ A;  1D1A A;  2DK3 A;  4A54 A;  2X3X D;  3CBM A;  4M77 C;  1YIJ T;  1YJW Q;  1WIE A;  1UEC A;  2BE7 D;  2K79 A;  1JO8 A;  2M1H A;  2M16 A;  2VWF A;  4RTV A;  4PL6 A;  3VYG A;  4C8Q F;  5GAN j;  4E47 A;  4M7D E;  3O5Z A;  4PLL A;  2E1H A;  4C5H A;  2JW4 A;  3QXE B;  2NUP A;  4C92 G;  2LJ3 A;  1VQ5 Q;  3JCM Q;  1N8R U;  1H3H A;  2MWP A;  4B9W A;  5ECA A;  5GAN 2;  3JAM E;  1WJR A;  2KYB A;  1VQM Q;  2ED1 A;  2KR3 A;  4FW2 A;  3M54 A;  3EFO B;  3RKY A;  4PJJ A;  4AFQ C;  1WHG A;  4RG8 A;  2AK5 A;  4CRI A;  1TSF A;  1VQM A;  1Q81 U;  5AYF A;  4KUI A;  3C95 A;  3PIO A;  3KFV A;  2E6Z A;  3QUI A;  1I5L A;  5GMK e;  3BFM A;  1QVG A;  2M51 A;  3OY9 A;  5FRM A;  2ZPG B;  4KGX B;  2R5A A;  2HL5 C;  5LJ5 j;  1AD5 A;  1NYF A;  1NBE B;  4GY5 A;  3BW1 A;  2BE9 B;  1KQ2 A;  5GAM f;  1K73 R;  4F7U F;  1PD0 A;  3V8K A;  5KYY A;  3CCQ A;  1QMC A;  1SEM A;  3OYC A;  3QWX X;  1B34 B;  4OMO A;  2GNC A;  3H9N A;  1D3B B;  1TUD A;  3CBP A;  5GAN 5;  4BD3 A;  1MMG A;  2QQA A;  1KQ1 A;  4CC2 A;  3GBQ A;  4JDS A;  4AFS C;  3EH1 A;  2DAQ A;  4JRK A;  3KBG A;  1AEY A;  1WHL A;  2XDB A;  2A36 A;  2X4W A;  1UG1 A;  3L2V A;  4PJO A;  2ZPB B;  3RR6 A;  3VS5 A;  3M53 A;  4PFO A;  4LUE A;  2DTI A;  1DJ7 B;  1W2B A;  1HD3 A;  2CSI A;  4M78 A;  3MCA B;  2RQW A;  1YJ9 Q;  3EAE A;  4X9D A;  1PKS A;  2OX7 A;  4EMK B;  3A8O B;  2J6O A;  3CPW A;  4PK4 A;  4FT2 A;  5CKH A;  3MEA A;  1VQ9 Q;  1Q82 C;  4FSX A;  4A4F A;  2EQK A;  2P0Q A;  1R77 A;  2ECZ A;  5IAY A;  1YJ9 A;  3PE0 A;  4N0A A;  4J6Y A;  5LJ3 d;  1BCO A;  3CCL Q;  4OB0 B;  2DE0 X;  1KK7 A;  1NPR A;  1XJW B;  2YRD A;  1K76 A;  1OOT A;  2ZCF B;  5AT1 B;  3CCL A;  1H3Z A;  2J7I A;  3QHS A; 
#chains in the Genus database with same CATH homology
 2GQV A;  4C0D C;  2X4X A;  3TCJ A;  4F7U G;  1HXD A;  3VV0 A;  1KC8 C;  3OS5 A;  3HRT A;  4PJO G;  2Y90 A;  5LJ3 g;  4M7A B;  5GMK i;  3QDR B;  3OYF A;  2LQ8 A;  1S72 T;  2HAX A;  4JRI A;  1K9M U;  2XDD A;  1WJQ A;  4BAC A;  3RER A;  2Y4X A;  4JJN K;  1KD1 C;  3MHX A;  5EG2 A;  1WQW A;  3A8G B;  4M78 G;  3BDL A;  4RMO A;  3S3O A;  3ZBD A;  2QDY B;  5GAO l;  3CBO A;  2V8K A;  1M1K C;  5GAM g;  5GAM h;  4Y91 A;  3L2U A;  4C8Q A;  1VQ4 A;  4XTZ A;  4BI3 A;  4FL6 A;  1UEB A;  5CO7 A;  3V8L A;  4C92 D;  2E65 A;  3L42 A;  3JCM d;  3CMA A;  3TU4 K;  3S3N A;  1VIE A;  1BI0 A;  4JRP A;  3RIR A;  1VQ6 T;  5D6X A;  2OAU A;  3JB9 D;  4E7J A;  1G3T A;  4QVZ A;  5CVI A;  3V7R A;  4C8Q C;  1WGS A;  3LX7 A;  2E64 A;  4DOW A;  1GXI E;  3CC2 T;  2VGN A;  4RG2 A;  4OP0 A;  2VUB A;  4HCZ A;  5LJ3 f;  3OMC A;  2XU8 A;  2LVM A;  3GIB A;  3E9G A;  4XTX A;  3FEO A;  1Q82 U;  3I55 A;  5A0D A;  4J83 A;  3ME9 A;  4DOV A;  1YIT A;  1YI2 T;  4QQ6 A;  3JCM g;  2BUD A;  3JCM h;  2H3J A;  3X28 B;  1VQ9 T;  4KT0 E;  2DXB A;  3CXC S;  3OYG A;  1M4Z A;  2DZC A;  1N27 A;  4XTW A;  2QXF A;  4OB3 B;  4ZGE B;  1IZ6 A;  2WSC E;  2I2L A;  4HKE A;  3FC3 A;  3J7A F;  1BI2 A;  3OQ5 A;  4FU6 A;  1YJW T;  1VQL T;  4BE2 A;  3E1S A;  3JRZ A;  3G6E T;  2LNV A;  2M9U A;  2QTX A;  3ER0 A;  3Q1J A;  3HL8 A;  2QEX A;  3LYI A;  2L8D A;  5I21 A;  2RI5 A;  5KE2 A;  4BUG A;  3RUX A;  2KVQ G;  3JCM X;  2DIG A;  4C92 E;  4M75 F;  2JN0 A;  3OYN A;  4XU3 A;  2EQU A;  3L1A A;  3PGG A;  5DM7 R;  1VQ8 A;  2YLC A;  3OS2 A;  1Y96 B;  1TH7 A;  2CZ6 B;  2PUK B;  5HK0 A;  2XD0 A;  4C92 B;  5FU6 B;  3UWN A;  2A3L A;  4F7U E;  4ME7 A;  2PVG B;  1KC8 U;  4ELZ C;  2EKO A;  4Z02 A;  4PJO E;  1N6A A;  2F5T X;  2JTF A;  2CS7 A;  2Y4Y A;  4BY6 C;  1M1F A;  1XNI A;  5LJ3 j;  3R6O A;  1YHQ T;  1BI3 A;  3CPF A;  3FRN A;  3M4Y A;  1YBY A;  3OS1 A;  1KD1 U;  2LQK A;  4J6W A;  1W4S A;  3OYD A;  3AHU A;  4LDU A;  1VQM T;  3CCJ A;  3HP9 A;  3JCM J;  3I56 A;  2DJZ A;  1WJS A;  1B34 A;  2O4X A;  4OB2 B;  5GAN e;  1M1K U;  4M77 F;  5GMK m;  1QVF S;  2RH2 A;  5C0M A;  2E12 A;  1AHJ B;  5GAM j;  5FRN A;  2FB7 A;  4QQD A;  3G71 A;  2LTO A;  2YLB A;  5CKE A;  2D6F A;  1NPP A;  4ZTF A;  2MI6 A;  4RKU E;  2RB6 A;  4M75 A;  1UGR B;  3F70 A;  2CKK A;  3L2Q A;  2PUO B;  4C0F A;  2LT1 A;  1WQ7 A;  4C0G A;  2DKG A;  4C8Q D;  2JUF A;  1WNL A;  2FYK A;  4QVC A;  3JCM W;  4MDX A;  2FHD A;  2GCX A;  2LT4 A;  5CCA A;  1S72 A;  4X34 A;  4BE1 A;  1VQO T;  2RHI A;  4MZM A;  1G5V A;  2RHX A;  4M75 C;  2EQM A;  3X25 B;  4L59 A;  2DD5 A;  1FWZ A;  5J39 A;  4IUQ A;  2E6N A;  2DEQ A;  4E7L A;  3CCE T;  3JB9 I;  1LOJ A;  1JBM A;  3CD6 A;  3OB9 A;  3G7Z A;  2VYT A;  4IUT A;  1MHN A;  2ZPH B;  2O01 E;  1JJ2 S;  2F5K A;  3ASK A;  2A7Y A;  3GNG A;  2K57 A;  2C06 A;  1VQ6 A;  3CCS T;  4M7D F;  4JUV A;  1ZBX A;  3QZ9 B;  5L8R E;  3DLL A;  5KCH A;  4XU1 A;  4EMK A;  2GFA A;  2RK2 A;  2X35 A;  1NJI C;  1G3S A;  5FU7 C;  3QYH B;  1N9R A;  3NTK A;  2D9T A;  3CC2 A;  5A0G A;  4A4H A;  2X4J A;  2K5I A;  4NL3 A;  2YHT A;  3FLG A;  2P0K A;  4M7A F;  3X26 B;  2B8A A;  2FVU A;  4VUB A;  1JRI A;  3G4S T;  3CME A;  3OW2 S;  1QVG S;  2F69 A;  3O8V A;  4EMK C;  4J8O A;  5LJ3 h;  5LJ5 e;  4LDY A;  1G3Y A;  1YI2 A;  2OTJ A;  4WF2 A;  1KG1 A;  2DTO A;  3OYK A;  1UGQ B;  4XU2 A;  3VUB A;  1QVF A;  2HBP A;  4C8Q E;  4HA8 A;  4E7I A;  1NE8 A;  2LRQ A;  2WAC A;  4EMH A;  3CEY A;  2QI2 A;  4JLG A;  3CCM T;  1YJN T;  3MP8 A;  5GMK h;  4C8Q B;  1YJW A;  4X9C A;  1VQL A;  3G6E A;  4M75 G;  3JB9 H;  4J7F A;  4EMG A;  2E41 A;  2XG8 D;  3EFR A;  3FB9 A;  3QKJ A;  3CCU T;  1P92 A;  2DPP B;  4OMF B;  3LGL A;  3VU3 C;  2IG0 A;  3OYY A;  4M7D A;  3JB9 J;  3QBY A;  2MWO A;  1OZ3 A;  2RJF A;  4XTU A;  1VQN T;  2HQE A;  5C6S A;  2XID A;  1M1G A;  5CQX A;  1K73 C;  4PJO D;  1QP3 A;  1NZ9 A;  5GAN 4;  4J7I A;  1VQ5 A;  4M7A A;  4M7D C;  2QQS A;  1KHC A;  2EJ9 A;  3WXM B;  1YCY A;  4QW2 A;  2CZ1 B;  1EIF A;  4LDW A;  3UT1 A;  4HT8 A;  4IKF A;  5GAO n;  4E7H A;  1YJ9 T;  2RJC A;  1OI1 A;  2YRV A;  4HT9 A;  2LC4 A;  3FIF A;  4M78 D;  4M77 G;  3OYL A;  1LNX A;  3X20 B;  1U8R A;  3KUF A;  2K3Y A;  3QG1 A;  4M7A C;  3V7S A;  2JTM A;  5GAN d;  1M90 C;  4D6W A;  2L89 A;  3SB2 A;  2MMP A;  1KQS S;  1BIA A;  1M5Q 1;  4PKC C;  5HY6 A;  1VQK T;  4N4G A;  1VQP T;  4A4G A;  1Y7X A;  2PVD B;  2KAF A;  2RI2 A;  1OYX A;  1ZHI A;  2DXC A;  2KMT A;  1Q86 C;  3NTH A;  1U1S A;  3VYH B;  2EAY A;  3LLR A;  4JS5 A;  2DZ9 A;  4OB1 B;  1QW1 A;  3M55 A;  5J3B A;  3CCV T;  3CCL T;  2V8I A;  4BDY A;  2RJD A;  2PVO B;  4BY6 B;  2EFI A;  2QQR A;  3G4S A;  5DLO A;  2R5M A;  2XIC A;  1NJI U;  4JLI A;  2K5F A;  3OMG A;  3JCM P;  3GP8 A;  1UGS B;  2AHJ B;  4C92 F;  3CC4 T;  3S3M A;  1M8V A;  1RI0 A;  4ZN3 A;  4NS5 A;  3N5B B;  3HRU A;  4Q5W A;  4C5I A;  1VQO A;  3OYE A;  4NOY A;  5FLX E;  3DB4 A;  2QQB A;  3CPW S;  4PLI A;  1G3W A;  3HRS A;  3URG A;  3KXT A;  2EWN A;  4KUD K;  3JB9 F;  2PU9 B;  1XTD A;  1K8A C;  3M56 A;  3DKM A;  5I2M A;  2OTL T;  4M7D G;  3CCE A;  4RCC A;  3GLX A;  4TVR A;  4Y28 E;  5I2S A;  2PQW A;  1RL2 A;  4F7U B;  3MP6 A;  2JZ2 A;  1X01 A;  3P8H A;  4A53 A;  3SWN A;  3GF5 A;  3ZFJ A;  3LW5 E;  5GAN 3;  3GPL A;  1VQ4 T;  2FL7 A;  4PJO B;  1N8R C;  4M78 E;  3CMA T;  3HPW A;  4OVA A;  3JCM c;  2RD1 A;  2CYZ B;  3PT9 A;  5CKB A;  3MEU A;  4M75 E;  4M7A G;  3OBY A;  2P4T A;  1JB0 E;  5CKD A;  5GMK j;  3MET A;  3OBW A;  3BDU A;  4ZGD B;  4M78 B;  4V2S A;  1UB4 A;  3DLM A;  1VQ7 T;  3SWN C;  2DD4 A;  3NFC A;  1D3B A;  2DVE A;  3P8D A;  2EJF A;  2DXT A;  4YTL A;  1Y96 A;  3BY7 A;  3ZEH A;  2DO3 A;  4N4I A;  5DLQ E;  3GOX A;  3MO8 A;  4B9X A;  5LJ5 d;  1KHI A;  2E70 A;  1I4K 1;  4ZN1 A;  3H8Z A;  3CXC A;  1K73 U;  2QA4 T;  2CGH A;  3I55 T;  5M9O A;  5GAN f;  1BKB A;  2R58 A;  3UPU A;  2RI3 A;  2RO0 A;  4A4E A;  3VJP A;  5GAO p;  3OS0 A;  1HK9 A;  2HD0 A;  2LCL A;  1X75 C;  3E9F A;  3CCM A;  5CAI A;  4CI0 C;  1YJN A;  5FU6 C;  3L2R A;  1FXX A;  4GLK A;  5FU7 B;  1XQH A;  1Q81 C;  5HK3 A;  4O6J A;  2VC8 A;  1VUB A;  3M59 A;  4XQ3 A;  3T9N A;  3QPH A;  4FIB A;  3OYB A;  3CCQ T;  2X4Y A;  5CR2 A;  5DY9 A;  1M90 U;  3DB3 A;  4NL2 A;  3JCM V;  3PIP A;  4RCB A;  4C0D B;  2QEX T;  4BI8 B;  1R8O B;  4OGC A;  1MGQ A;  4M77 A;  5HKC A;  5LJ5 g;  1VQN A;  3JCM b;  1Q86 U;  3L2W A;  1PSF A;  2R57 A;  2VXE A;  5GMK l;  4IUU A;  2DK3 A;  3A8H B;  3QJY A;  4A54 A;  4LD6 A;  3CBM A;  3SD4 A;  3HFN A;  4M77 C;  2ZPF B;  3TEE A;  3LH0 A;  1YIJ T;  1Y07 A;  3J81 E;  2M1H A;  2D0Q B;  5GAO m;  1QVP A;  2M16 A;  4ELY C;  3PFS A;  2VGM A;  3FJP A;  4PL6 A;  2L5Q A;  1VQ9 A;  3C4S A;  4HCC A;  2M0O A;  2XI9 A;  3PMT A;  3VYG A;  1O9S A;  1K8A U;  2RHY A;  4C8Q F;  4E47 A;  3VUZ A;  5GAN j;  4M7D E;  4PLL A;  2E1H A;  2CZ0 B;  3M57 A;  4C5H A;  3CCR T;  3LWH A;  2BIV A;  5GAN 7;  2HQX A;  2RHZ A;  3QII A;  2LX9 A;  1VQ7 A;  3WVD B;  4EPC A;  5KE3 A;  3QXE B;  4MMK A;  5D6W A;  4C92 G;  3JSC A;  3RMS A;  3JCM Q;  5A2Q E;  4L5G A;  1N8R U;  3V8J A;  5CQY A;  5LJ5 f;  3G71 T;  4MZT A;  3OYA A;  4M7A E;  2LCC A;  3C94 A;  4N4H A;  5GAN 6;  3PTA A;  3JB9 G;  2MWP A;  4B9W A;  4IUV A;  2E5Q A;  5GAN 2;  3JAM E;  3CC4 A;  2XKO C;  1BIB A;  3J80 E;  1M9S A;  1WJR A;  3EFS A;  2DIQ A;  2EIF A;  4DQ2 A;  2L3R A;  3RMQ A;  3M54 A;  2OTL A;  4OF1 A;  3QJ6 A;  3P8B B;  3QO3 A;  1JJ2 A;  2LDM A;  3CC7 T;  3C12 A;  1YHQ A;  2JOY A;  2XDP A;  3E19 A;  3RKY A;  4E7K A;  4JRQ A;  5LL6 S;  2G3R A;  4C0Z A;  3CD6 T;  4RG8 A;  4M75 D;  5LJ3 e;  2RM4 A;  4CRI A;  3V7C A;  1VQM A;  1Q81 U;  3RKX A;  2K4Y A;  1X6O A;  5AYF A;  4KUI A;  5FRO A;  3C95 A;  3PIO A;  3QUI A;  2E6Z A;  1WPY A;  3LGF A;  1I5L A;  2RHU A;  5D6Y A;  2ZPI B;  1XOV A;  5GMK e;  3BFM A;  5GAN 8;  3OW2 A;  2EJG A;  2K2V A;  1QVG A;  3OY9 A;  3OYM A;  5FRM A;  2V8J A;  2JVV A;  2ZPG B;  5GAM e;  1SSF A;  3WVE B;  2RK1 A;  2R5A A;  1Q7Y C;  1W2B S;  2K3X A;  2DXU A;  2VV5 A;  5LJ5 j;  3CME T;  2QA4 A;  3GNF B;  1VIF A;  4GY5 A;  3X24 B;  3QYG B;  1PSE A;  4QVD A;  2OTJ T;  4LDV A;  4ATO A;  4M77 D;  1O75 A;  3SFM A;  4L6V 5;  5GAN g;  5GAN h;  2EYQ A;  3BW1 A;  1KQ2 A;  4FM4 B;  5GAM f;  4F7U F;  3FDR A;  4P5N A;  4LDX A;  3HFO A;  2RJE A;  4PJO F;  3SWN B;  3V8K A;  2QQ9 A;  3CCQ A;  5CIU A;  1N9S A;  1I81 A;  5CKF A;  3PMI A;  5IN1 A;  2WSE E;  3MEV A;  3RES A;  3OYI A;  3OYC A;  1B34 B;  2O4X B;  4HCB A;  3A8L B;  4MZP A;  2MF2 A;  4M78 F;  3JCM e;  3CCS A;  2CZ7 B;  4XTY A;  4IUR A;  4BB7 A;  1D3B B;  4KBM B;  3TRE A;  3M4G A;  2WSF E;  3OA6 A;  5KH6 A;  4JS4 A;  3RKW A;  5IT9 E;  2ZPE B;  3CBP A;  5GAN 5;  4BD3 A;  4M75 B;  5J26 A;  5GAO r;  1VQ5 T;  2DTH A;  3M5A A;  4UC4 A;  5CK9 A;  4XK8 E;  1H64 1;  3PNW C;  3UDC A;  2QQA A;  1KQ1 A;  4C8Q G;  1YIJ A;  1K9M C;  2GFU A;  4C92 A;  2HNI A;  1BI1 A;  4JDS A;  4QQG A;  4R55 A;  3QSU A;  3NTI A;  3OSS C;  2XK0 A;  4JRK A;  2DAQ A;  3JCM f;  3KBG A;  2MAM A;  1KQS A;  4II1 A;  2ZGW A;  4M7D D;  1I8F A;  1Y71 A;  4J5Y A;  4XTV A;  4EDU A;  5A0L A;  2X4W A;  1YIT T;  2XDB A;  4F7U A;  3L2V A;  2K5L A;  3LWI A;  4PJO A;  2ZPB B;  3CCR A;  3M53 A;  4C92 C;  1UGP B;  1QP2 A;  2JNG A;  4BI4 A;  2KSS A;  4M77 E;  4IUP A;  2NLU A;  2DTI A;  1DJ7 B;  4M7A D;  1W2B A;  2ZZD A;  4XAX B;  3CCU A;  3M58 A;  1IRE B;  1BYM A;  3OYH A;  4J6X A;  3MCA B;  4M77 B;  4M78 A;  4R56 A;  3INZ A;  2IVW A;  2GF7 A;  4PJO C;  2P0P A;  3EAE A;  4X9D A;  4KUL A;  4EMK B;  3A8O B;  2XHC A;  5LJ5 h;  3CPW A;  3A5Z B;  3OSV A;  4FT2 A;  3MEA A;  2RA2 A;  3M9Q A;  4XU0 A;  5CKH A;  4BDZ A;  4BE0 A;  4A4K A;  4ZTJ A;  1Q82 C;  3SDZ A;  4FSX A;  1VQ8 T;  4C5E A;  3H6Z A;  4M78 C;  4A4F A;  1FX7 A;  3OYJ A;  1Q7Y U;  4OGE A;  2EQK A;  4FT4 A;  1ZQ1 A;  2P0Q A;  5IAY A;  5KCO A;  1YJ9 A;  4N0A A;  3CC7 A;  4J6Y A;  1LJO A;  2KQW A;  5LJ3 d;  1OZ2 A;  2BKD N;  5GAO q;  4MML A;  4ZGJ B;  4OB0 B;  3HKS A;  4C5G A;  3S6W A;  4O5V A;  2EQJ A;  1NPR A;  2E10 A;  2VXF A;  1U1T A;  1VQK A;  2KY9 A;  1VQP A;  1V29 B;  3CCJ T;  4N0A C;  2KK4 A;  3I56 T;  4LD9 K;  3MP1 A;  3A8M B;  4M7D B;  5GAM d;  2ZCF B;  3QZ5 B;  4MDW A;  3MEW A;  3CCV A;  3CCL A;  2KDS A;  3VKI A;  4PNO A;  4DA4 A;  3L2Z A;  3HSB A;  1H3Z A;  3HHT B;  3QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...