3JB9D

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
SLCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSHIRFLIVPDMLRNAPMFKVGPGRSVPLPTRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 13
structure length 96
sequence length 96
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9D00
5GAMf 2VXFA 4M7DB 3HFNA 4C92E 4PJOF 5LJ3h 4RCBA 4C8QG 4F7UB 3JB9H 1TH7A 2YHTA 3RKWA 2ZGWA 5GAOr 5GANh 1BIAA 4C8QA 3RERA 2EAYA 1I81A 3QHSA 3QO3A 4M77F 4C92G 2E1HA 5LJ5j 1N9SA 4J6YA 4OP0A 3JB9G 3AHUA 3JCMJ 3HFOA 2YLCA 1H641 4EMGA 3JCMX 4M7AD 3L1AA 4XTVA 5GAMe 4M7AE 4C92A 3SWNA 4C8QB 4XU0A 4HA8A 5GMKl 4M75C 3V8JA 4NL2A 4PJOC 4EMHA 4Y91A 5LJ3g 5GMKi 3JCMQ 2K57A 5CAIA 4M7AG 3INZA 4M78F 1I5LA 3VU3C 4C92B 3SWNB 4NOYA 4QVDA 5GANg 2DVEA 5LJ5h 2DZ9A 2DTHA 3V8LA 3L2ZA 2E64A 4MMLA 2DZCA 4M77C 2RB6A 3JCMh 5GAMj 1B34A 4M7AA 5GMKm 3BDUA 2CGHA 4M75D 4M7DF 1LJOA 1X01A 1M8VA 2DEQA 4F7UF 4M75E 5LJ3d 4PJOD 4A53A 1BIBA 2DKGA 1U1TA 2E41A 4N0AC 5GAOm 2EJFA 5DY9A 4M7AB 3HSBA 3SB2A 2QTXA 1B34B 2RD1A 5GANd 1YCYA 1KQ1A 4RCCA 1WNLA 2EJ9A 2HNIA 5GAN3 4JUVA 4EMKC 1LNXA 2EWNA 1MGQA 4M78C 4M75G 4M77D 4J5YA 2Y90A 3JCMV 4X9DA 5GAMh 2DXTA 4J6XA 3FB9A 5GMKe 4PJOG 5LJ5g 4XTXA 5GAN7 2EJGA 1JBMA 4C8QF 5GAOp 3QSUA 4M75A 5LJ3f 3JCMg 5LJ5f 4M7DC 3JCMf 3RUXA 3BFMA 5GANf 3QUIA 3JB9D 4M77G 4XU2A 4C92F 4XTYA 3JB9F 4M75B 1WQ7A 3FJPA 4M78D 4MMKA 5GAN2 1KQ2A 5GAOn 3GIBA 5LJ5d 4M77A 4JRIA 4M78E 3M4GA 5GMKj 4HT8A 4PJOB 4PNOA 1Y96A 3RIRA 2DTOA 5LJ3e 3JCMd 4PJOE 4NL3A 2DJZA 4V2SA 5GAOq 4XTUA 1WPYA 4XQ3A 5GAMg 4XU1A 1D3BB 3BW1A 2I2LA 5GANe 4M7DD 3JCMP 1M5Q1 3V8KA 4C8QC 5GAN6 4N0AA 3JB9I 3JB9J 2RM4A 2E65A 4M78G 4HT9A 4M7DE 4M77B 4M7AF 4M77E 3V7RA 1Y96B 4F7UE 1I4K1 4XTZA 4EMKA 2JN0A 5GAN4 3FIFA 2FYKA 3EFRA 4M78A 1JRIA 1HXDA 2FB7A 4XU3A 3JCMW 4C92C 3SWNC 1LOJA 4PJOA 1N9RA 5LJ3j 1WQWA 3PGGA 3RESA 5GMKh 1U1SA 4M7DG 5GAN5 5GAMd 2YLBA 3V7SA 5GAN8 4A54A 4F7UG 2RA2A 4JLIA 5GANj 1D3BA 2VC8A 3EFSA 4C8QD 4EMKB 4M7DA 4M78B 2DXUA 4WF2A 4QVCA 3BY7A 3RKXA 4C8QE 4F7UA 1HK9A 3JCMc 4J6WA 3JCMb 4X9CA 5LJ5e 3RKYA 2VXEA 2DTIA 1I8FA 4JRKA 3V7CA 4XTWA 4DQ2A 4M7AC 4M75F 3JCMe 5I21A 4C92D 5GAOl 2E10A
chains in the Genus database with same CATH superfamily
3ASKA 4PJOF 4L6V5 1M2VA 4OB1B 3OYJA 3G4SQ 2ZGWA 3D7SB 2EVRA 2LNHB 4RTXA 2P0KA 5LJ5j 1VQOQ 5KYYB 1IB8A 1XQHA 2J6FA 3X20B 4E7ZA 4E7LA 1NJIR 2DJQA 2DL5A 3CD6T 3KFVA 4M75C 2GQVA 2MMPA 3MO8A 1ZBXA 3HHTB 4PJOC 2KY9A 5IXBA 1VQPT 3FEOA 2FZKB 5CKBA 1BI1A 3CC2T 3VUBA 2RB6A 1EX4A 1PSEA 2NUPB 5GMKm 4M7DF 2FPDA 1X01A 3C95A 4CC7A 1HD3A 2DKGA 3ULRB 4LD9K 2L0AA 2YSQA 4YTLA 4J8OA 1W2BP 2QASA 3BDLA 4PJLA 1HJDA 1BK2A 3PIOA 1VQ9T 2XK0A 1VQ7T 2XDBA 2CYZB 1QVGS 4M7DC 2AK5A 4CC4B 1Q81C 3ER0A 2V1QA 1X69A 2XKOC 1NLPC 5KYWA 2RHUA 3CC2Q 2OX7A 4IURA 1VQ5T 1WLPB 3ME9A 1MMAA 2LTOA 3BW1A 1LPLA 3EGXA 2RK2A 2EPDA 4E2FB 4ME7A 2KK4A 1NG2A 2YUOA 1VYVA 4OMPA 1UUEA 5CR2A 2L3PA 2D0QB 1AWJA 1MNEA 2E3HA 1VQ7Q 4A54A 1QKXA 2RA2A 2AIRB 4C5HA 3A1PA 1U06A 3QWYA 1QWFA 4A4GA 4C8QE 5C0MA 5IHKA 2X3WD 3M0PA 2ABLA 1ZX6A 2F2VA 3GP8A 4FSSA 4JJDA 5AYFA 1YBYA 3A8GB 4HXJA 4E7IA 2L5QA 2KR3A 2A0FB 2DIQA 1UE9A 2DEUA 2X51A 2CP7A 2LCCA 4Z89A 3VJPA 2L89A 1VIFA 1GBQA 2E1HA 4J6YA 2GQIA 3S3MA 2EQMA 3C4SA 5FLXE 2VUBA 3CBMA 3P8HA 2LP5A 1E6HA 2EQUA 1IXDA 1OX8A 1ZSZC 4EDUA 5GANg 1WJSA 4AG2C 1VQ6Q 2A36A 3IQLA 3LGFA 1VOMA 1RLQC 2E64A 4M7AA 4DBFA 3BDUA 1UHFA 2ED0A 4M75D 3TEEA 2ZPEB 2K79A 3E1SA 4A53A 3O5ZA 4PJOD 3E2UA 2EJFA 2H8HA 1RACB 5CO7A 4C5EA 4KRTA 2KROA 4OB2B 3G6EA 3FB9A 1YJNQ 4XTXA 4B9XA 5IAYA 3CMEA 1GBRA 3EG9B 1UB4A 4C92F 4DBRA 2VYTA 5A0DA 1RAIB 2FO0A 5FU7B 4M77A 1Q7YU 1C1AA 4LNPA 3I56A 2RK1A 4CRIA 1Q82U 1PWTA 3SFMA 2K5IA 2QK0A 3OBYA 4P5NA 4M7DD 4FIBA 1SHFA 3I5SA 4M77E 1R0CB 1ACMB 3V7RA 3CCVA 1S72Q 1JU5C 1K73C 5J26A 5FROA 4C92C 3L2UA 2JZ2A 1WQWA 1ZQ1A 2CSQA 4DEXA 3CCSA 3CCMA 1D3BA 3CCQA 1NM7A 1K9MC 4HCKA 2DTIA 2KNBB 3TU4K 5I21A 4C0DB 1QLYA 3OMGA 2QQSA 2D8HA 1ARKA 5LJ3h 2OI3A 1SEMA 2RQWA 4RTUA 3CCUA 2K5LA 1TH7A 1YITQ 1BIAA 4ESRA 2MOXA 4J9HA 1WGSA 1ZA1B 3QO3A 3H41A 1VQNA 4WCIA 1NPPA 3QYHB 4LUEA 1IHWA 4M4ZA 2P84A 3OYKA 2GNCA 1KC8C 1GXIE 1UGVA 2DVEA 1YJ9Q 4LDYA 2XU8A 1FYNA 3L2ZA 1B34A 1V1CA 2EQIA 3CPFA 2O31A 4F7UF 1PRMC 4JJBA 4ORZA 2YRVA 1OV3A 2F69A 3H0FA 4BE2A 2SRCA 3QIIA 2BKDN 1I07A 4K11A 4GY5A 1ZHIA 2F5KA 2LNVA 2MI6A 1BYMA 1KQSS 1G3WA 1M8MA 2V8KA 4OMOA 4J7FA 2QXFA 1LVKA 2AKKA 2KSSA 3JB9F 2J7IA 1WJQA 3NGPA 2GF7A 3GBQA 4PNOA 3EFOB 2AHJB 4J9FA 4KBMB 5GAOq 2IPOB 1BKBA 2LRQA 2QQRA 3EGDA 5GAMg 4AMCA 3CPWP 3JCMP 1TXQA 4OMFB 1T0JA 2BZXA 3P8DA 2JUFA 3ZBDA 1M3CA 5GAN4 3EFRA 1D0XA 2K5FA 3QJ6A 4PJOA 2DERA 4BE1A 1QCOA 3LX7A 1M90C 5GANj 3OYYA 2NYSA 4N4HA 2QA4T 1IHVA 2VASA 4X9CA 1OULA 2CUDA 3JCMe 4C92D 2LQ8A 5IN1A 2RMOA 4PFOA 3X25B 1X6OA 2DE0X 4VUBA 3L42A 2KGTA 2EGCA 4ZTFA 5GJVB 2M9UA 2YRDA 3H8ZA 4BI3A 1WJRA 2KAFA 4C5IA 1TG0A 3O8VA 5IHNA 2JJ9A 2A7YA 2BTTA 3RBBB 2M0OA 3NTHA 1PG5B 3N5BB 1I5LA 3HTRA 1Q86R 3SWNB 1VQMA 1VA7A 1NZ9A 2HDAA 3CC7A 1PNJA 3HL8A 1JJ2P 5J39A 1LJOA 4GBQA 2VV5A 1JXMA 4X1VA 2PVDB 1KQ1A 1NYGA 2IG0A 3QJYA 3DKMA 4HVUA 4JUVA 4PL6A 3VYGA 3WVEB 4CC2A 4J5YA 4FM4B 1TWBA 1VQKT 4AG1C 3QWXX 9ATCB 3T9NA 2OTJA 1H8KA 3L2WA 5FWCA 2ECZA 4LDUA 3CXCP 1KQ2A 3R6OA 2B86A 1FMVA 1Z9QA 1K1ZA 1WFWA 2GTJA 3I55A 3V8KA 2KEAA 2DL3A 3OW2P 2RM4A 4M7AF 2LX7A 4JJNK 3QDRB 1NJIC 3EG0A 3G6ET 5GMKh 1WHJA 2D0NA 2RF0A 2MWPA 3FDRA 2EYXA 4E7KA 1N8RU 1M1KR 2DXUA 1HK9A 3JCMc 1AVZC 2NWMA 3TVTA 4M7AC 3CCRT 3JB9D 1O9SA 4ELYC 3CCET 3M0UA 4L59A 2OAUA 3SD4A 2HKQB 2VGNA 2ZPIB 3MJXA 3OYDA 1PD1A 4M77F 1QP3A 2EQKA 3CCJA 1NE8A 2XDPA 3EH1A 3FRNA 3G6EQ 1V29B 3UT1A 3OYNA 1MMNA 2L3RA 2GGRA 3CMEQ 5GMKi 1TS9A 1C0MA 2V8JA 2QQBA 5GJWB 5KYXB 3E9FA 5GAMj 4M77C 1Q81U 2CZ1B 3S6WA 1ZLMA 2DL4A 3I56Q 1K4US 2E6ZA 4CI0C 3L2RA 3PIPA 1KK7A 2HCKA 3C94A 1B07A 3HP9A 3QKJA 1MGQA 4M75G 3CCVQ 2PUKB 2DFUA 4DEYA 4PJOG 1R8OB 3GOXA 2RHYA 3HKSA 3CCSQ 3CCMQ 1V76A 2V1RA 1SSHA 5I2SA 1AZGB 2CT3A 3CCQQ 4XTYA 2YWWA 1WQ7A 2COYA 1GCPA 4ZTJA 5KYUA 3VUZA 1ZUUA 2FZCB 2HL5C 2ZZDA 4RMOA 4LUDA 4DA4A 4JS5A 3QPHA 3CCUQ 1D3BB 2P0QA 2RJEA 2KDSA 3OYAA 5CKEA 5GAN6 3JB9J 2ESWA 1I0CA 1R77A 2C0TA 2D8JA 2KE9A 1K0SA 2EYWA 3JCMW 4M78A 1YJWT 5DLQE 1VQNQ 3VS3A 4M7DG 1QCFA 2YUQA 4XK8E 1VQ8T 2HMAA 3J81E 2RI3A 2X9HA 3M0RA 2KRSA 1D1AA 1OZ2A 5LJ5e 2QGGA 1M3AA 3G4ST 3VS1A 1YI2A 5GAN2 3VS2A 1M2OA 1M4ZA 4N4IA 4ZN3A 3JB9H 4J83A 2YHTA 2AKLA 2JM8A 2DM1A 3RERA 4NS5A 3OS2A 2V26A 2QEXA 1NLOC 4M7AD 2YLCA 5CK9A 3L1AA 2DK3A 1QW1A 5FW9A 5GMKl 3MHXA 3P8BB 4QKUA 1GL5A 3HPWA 3CBOA 5LJ3g 2CZ7B 2QQAA 2HL3A 4O6JA 1UGQB 4XAXB 3MEUA 2M1HA 3A98A 1N8RC 1Y7XA 3TQ7P 2EIFA 2O2OA 2O4XA 2HSEB 1WNLA 2EJ9A 2GFUA 4QQGA 3MKDA 4M77D 2Y90A 1KD1R 1WI7A 1AWWA 4OF1A 3LYIA 2G6FX 4B9WA 3LH5A 2EJGA 2LCLA 2CP2A 1K73U 1I5OB 1WA7A 2HZYA 3EGDB 3OY9A 2JOYA 4Y28E 2LC4A 2QYZA 2PVOB 1AWOA 4JZ4A 1WHKA 1YIJA 4LDVA 5FRMA 4M75B 2DRKA 3CC7T 4PJOB 1ABOA 2DJZA 1K9MU 1WPYA 2EYQA 3I5RA 4PKCC 2JS2A 2L8DA 1BI2A 2RI5A 3PVQA 4HT9A 2H3EB 1Y96B 1OYXA 1XTDA 2M02A 4PJNA 3VS4A 2FYKA 1JB0E 3GPLA 4JRQA 1QP2A 1O75A 4BD3A 2VC8A 3PMTA 4QVCA 4B6MA 1W4SA 1VQMQ 1I8FA 4LN2A 1KC8U 3CC7Q 4M7DB 2DA9A 1OQKA 1IREB 4QQDA 4C8QA 2R5AA 2KXDA 1QKWA 1UFFA 4C92G 4D6WA 5C6SA 2RI2A 3HFOA 4FYWB 2M0YA 4XTVA 1B3QA 5LL6S 3L2QA 1VQ6T 2GFAA 1FMWA 4AFSC 4ATOA 2OTJQ 2KT1A 3OS1A 3VV0A 1YHQA 1IZ6A 4ZGEB 1BU1A 1S1NA 4TVRA 3OYCA 2JW4A 4FT2A 3ZFJA 4RTWA 3I55Q 3LWIA 1UJYA 3QDFA 3THKA 5DLOA 1SPKA 1YJNT 1G5VA 1EZZB 3JCMV 3CCJT 2QG9B 2D1XA 2DXTA 1JBMA 3OB9A 4WTOB 2E12A 4Z02A 3JAME 2E4HA 3RMSA 5GANf 2RNAA 2ZCFB 3G7ZA 2O88A 4XU2A 1M90U 1JQQA 1P92A 5CIUA 2E3IA 3MP8A 1G3YA 1RUWA 4C0ZA 3M4GA 3EG2A 2DL7A 3JCMd 2OTLA 4A4KA 3A5ZB 4XTUA 3A8LB 2JTEA 1ZSZB 5D6WA 1S72T 4JS4A 2E65A 4FW2A 1UGSB 1VUBA 1I4K1 1Z9ZA 4EMKA 1YCSB 2FPFA 3CCJQ 1K8AR 2JM9A 5LJ3j 4A4HA 1U1SA 2KRNA 2M16A 3WVDB 4F7UG 2P4RA 1N6AA 1Q86C 1OZ3A 2DBMA 4GLMA 4KULA 4DOWA 4FU6A 3UATA 4RG8A 1YITT 1QVGP 4RCBA 1KIKA 2ENMA 3Q1JA 3VKIA 2HQXA 2D9TA 1X2KA 4C0FA 4RUGA 4MZMA 3CC4A 1M27C 2RQRA 3EAEA 3A8HB 3JB9G 3AHUA 1H641 3H6ZA 2X4WA 2DL8A 3LLRA 5I11A 2WSCE 2FEIA 2DYBA 2EYZA 2QTVA 4KGXB 1YJ9T 2JVVA 5KCOA 1YWPA 3A8MB 5A2QE 4M78F 3VU3C 4C92B 2C0OA 1W2BA 2DZ9A 1R0BG 3E19A 1VYUA 3OYIA 2CGHA 4BDYA 1TSFA 1T0HA 1QMCA 1D1BA 1WXTA 2BZYA 3SB2A 5DM7R 4RKUE 3PNWC 3H0IA 4OMNA 1VQLA 1X6BA 1LNXA 1UGPB 2DXCA 4M78C 4ZGJB 5KYUB 1M1KC 1FWZA 5GAN7 4HCCA 2DETA 1M1GA 1NJIU 1X43A 2FPEA 2DYIA 3G71A 4MDXA 2X4JA 1U5SA 3M56A 1ZSGA 3OYLA 1YI2Q 4FL6A 2X4XA 4NL3A 1M3BA 2RJDA 5GANe 2DO3A 3DB4A 2EGEA 3J7AF 2K3XA 4AFUC 2QEXQ 4XTZA 1QQJA 2LT1A 3CCLA 2NUZA 4A63B 5KCHA 3TCJA 2JS0A 2L2PA 3V7SA 4FYVB 2NUTB 2CZ0B 3NPFA 5IT9E 2X3XD 4C5GA 3BY7A 1IGUA 3S3OA 1TTHB 3CMAA 4JDSA 3C12A 5HK3A 3EG1A 4IIMA 1CSKA 3REAB 5GAMf 1CKBA 2PNIA 2RH2A 3LGLA 4F7UB 5KYYA 3OBWA 3UA6A 3M59A 3MEWA 1C6VX 4D8DA 2KBTA 2LCSA 3QYGB 4FYXB 1I81A 3QHSA 1SHGA 2LVMA 2MAMA 1MMGA 1M2VB 3BE3A 2XHCA 4ELZC 1VQOA 2HEQA 3GNFB 1GFCA 2NUPA 3EGUA 3VS0A 2K57A 2ZAEA 5CAIA 4M7AG 4AFQC 2CP3A 1YIJQ 4X34A 2KRMA 2NLUA 2I0NA 5CQYA 2X4YA 3L2VA 2LQKA 3PE0A 4M75E 4E47A 1KHCA 4JLGA 1QVFS 4CC3A 2RD1A 5GAN3 2HNIA 1LCKA 1K0XA 5CKHA 3E9GA 4C8QF 5IXFA 2RHIA 1H3HA 3VS5A 3CD6A 1DJ7B 3I9QA 2J06A 3QUIA 1KSWA 3OYGA 4M77G 4Z88A 4M78D 3QG1A 1VQPA 4QVZA 5GAOn 2J6KA 2P0PA 5LJ5d 5GMKj 4HT8A 4F17A 1E6GA 2RHXA 1PSFA 3FLGA 3M0SA 3CC2A 2Y4XA 2L3QA 5KYWB 3UWNA 2Y4YA 2COZA 4C8QC 1BB9A 4M7DE 4AFZC 1I1JA 5KYNA 1NPRA 1H3ZA 4XU3A 1T3LA 3EGXB 2DF6A 4IIOA 2ED1A 3EH2A 3QZ5B 1GRIA 3HRTA 4A4EA 1G3TA 4J9IA 1WIEA 1VQ9A 1A0NB 1VQ7A 2HKNA 2LDMA 4PK4A 2DVJA 2WSEE 2AZSA 1SKUB 4HVVA 1YHQQ 1KQSP 4RTZA 3OYHA 3VS7A 2K9GA 2J6OA 4IUQA 4JJCA 1VQ5A 2FVUA 2MIOA 1KD1C 1N9SA 4OP0A 2HAXA 1G8XA 5GAMe 2X35A 3CMET 4XU0A 4HA8A 2DAQA 2FL7A 1KFZA 4KUDK 3TSZA 5IH2A 1TU0B 2QGFB 1MV0B 4Z8AA 3INZA 4BDZA 2QAZA 3I56T 1K9AA 8ATCB 3JCMh 2BUDA 1GCQA 2R5MA 1D0YA 2ATCB 2YUPA 5FU6C 4KH1B 2PTKA 2OTLQ 3KXTA 3CCVT 4PLIA 1F1BB 2E5QA 4M7AB 4KUIA 1SF9A 1PD0A 1RADB 1D09B 3EG3A 2CH4W 4EMKC 3EG9A 2K6DA 2KYMA 3CCST 3CCMT 1YN8A 3M0TA 3CCQT 2B8AA 3JSCA 3CPWA 3RUXA 2QI2A 2E5KA 3LW5E 4KGVB 3HRSA 5D7UA 3AT1B 1PM3A 4IUUA 4IUVA 1MHNA 4EIKA 3CCUT 3GIBA 2YT6A 5CKFA 3G1JA 4JRIA 1FX7A 1PRLC 3RIRA 1XOVA 3JV3A 2PQWA 2XI9A 1AHJB 1VQNT 4M77B 3CC4Q 2XICA 1M1FA 3HRUA 1LOJA 2YUNA 2L3SA 3OYMA 2A28A 2FG0A 3MPUB 4JLIA 4C8QD 4WF2A 1WXUA 1X75C 4MZPA 3JCMb 2LQWA 4J6WA 4XTWA 1RI0A 3HFNA 4C92E 1W2BS 2P4TA 2C06A 3RKWA 1ZBJA 1OPLA 1WHGA 5CKDA 2LT4A 2O01E 1AEYA 1QVPA 1WZOA 3M0QA 2ZPFB 3JCMX 2QDLA 5HKCA 1VQLQ 2EFIA 5HY6A 4OVAA 1JJ2A 3CCLT 1HSQA 3QZ9B 3REBB 1UDLA 1PCXA 2KYBA 3M55A 3GLXA 1X6GA 4OB0B 3NFCA 4NOYA 2KVQG 1Q7YR 2DZCA 3RDVA 1Q82R 1KJWA 2CP0A 1TOVA 2SEMA 2VKNA 2DEQA 1BIBA 1U1TA 3HSBA 1KHIA 1B34B 5I22A 4RCCA 3FJ5A 1SRMA 3OQ5A 3ZEHA 3CXCA 4R56A 2DX1A 1VQ4A 1OX9A 4HCZA 3DLLA 1HYOA 3CCLQ 1VIEA 3NTKA 1M30A 2A08A 2CKKA 5LJ3f 2XDDA 2GTOA 3NHNA 3OW2A 2LZ6B 4BUGA 3CMAQ 1Q86U 2XMFA 5IHIA 4E7JA 4LXCA 4F14A 2RHZA 4PLLA 1EFNA 3J80E 1UTIA 1SG5A 2CUBA 3I35A 5HK0A 1RAGB 4EPCA 2K7AA 2R58A 4AT1B 1Y57A 4F7UE 1OOTA 2JN0A 1NEBA 2FB7A 2AT1B 1RAHB 2CZ6B 3PGGA 3OYFA 2YLBA 5ECAA 1VQMT 4OGEA 3SHWA 2LMJA 2EGAA 2VB6A 1QVFA 2VXEA 2KXCA 4OGCA 2GBQA 5GAOl 4L5GA 1Y71A 2MWOA 1UHCA 1UJ0A 1AOJA 5GAOr 4F16A 2D6FA 3X26B 2COWA 2EKHA 3MP6A 2EAYA 1BBZA 2LJ1A 2HBPA 4J9BA 3RNJA 2DLPA 3SWNA 1D0ZA 3OA6A 1WHHA 2OTJT 4DBHA 2F2XA 2F5TX 2KT8A 3EHRA 1M1KU 3CD6Q 5KE2A 2AZVA 3DB3A 3MP1A 5LJ5h 3UF4A 1WX6A 2QA4A 5M9OA 3OSVA 1VQPQ 2YXYA 3I55T 4HCBA 1U3OA 5GAOm 5DY9A 4PFZA 3VYHB 5GANd 1XNIA 1UECA 1MV3A 1FXXA 2DPPB 5A0GA 1VQ9Q 4LDXA 3EHQA 2KMTA 2PUOB 4R55A 3LH0A 2VVKA 1M9SA 4JRPA 5LJ3e 1OPKA 2M51A 3RMQA 1OU8A 4Q5WA 2I2LA 2PZ1A 4N0AA 2MK5A 1BI3A 2RQUA 4M78G 1VQ5Q 3PTAA 3LWHA 3QBYA 2EQJA 5FRNA 4JZ3A 1JRIA 5FWBA 3R6NA 2VGMA 4O5VA 5GAN8 1CKAA 3KUFA 1Y0MA 1JO8A 1VQKA 2DIGA 1IO6A 3RKYA 4RTTA 1WYXA 2K3YA 2JXBA 1GCQC 1NBEB 4RTYA 3SDZA 4KT0E 2Z0WA 3MEAA 1YP5A 3CBPA 1TUGB 2RQTA 3S3NA 4M7AE 2A37A 4J9DA 1OU9A 5KYXA 3V8JA 5FU7C 4NL2A 2JTMA 4BI4A 4Y91A 4EMHA 3JCMQ 1N27A 1PHTA 4QW2A 3A8OB 1NYFA 3CPWS 4MMLA 1T3SA 4OMMA 3CCRA 4KGZB 5KE3A 3MCAB 1YFNA 3NMZC 2QQ9A 2KQWA 4RTVA 3CCEA 2HQHA 4JPBW 2EWNA 4E7SA 1Q95G 2CSIA 1N8RR 2VWFA 4KH0B 5GAOp 3JCMg 3M9QA 4C0DC 2F1LA 2RPNA 1AWXA 3JCMf 1WXBA 2QDYB 2C0IA 4R0KA 1YI2T 2MYSA 3FJPA 1SRLA 2JNGA 4PFPA 5CVIA 2LJ0A 2DTOA 4IKFA 4V2SA 2RO0A 1QWEA 2QEXT 2G3RA 1TUDA 2K3BA 1PC0A 1JXOA 2FHDA 2ZPGB 2FRWA 2KI7A 1VQ4T 5EC7A 4MDWA 5GAN5 5GAMd 3X28B 1KD1U 1PKTA 2A3LA 5L23A 2YRCA 2ROLA 2GCXA 4HVWA 1JJ2S 1RLPC 4M78B 2O9SA 4II1A 4J7IA 3PT9A 1Q81R 1PKSA 4FT4A 1RAFB 1G2BA 4F04B 5J3BA 4C8QG 3U23A 2BZ8A 3M53A 1BCMA 2WACA 3M57A 4ZNXA 4ZN1A 3QXEB 1BCOA 1FMKA 4LE9A 2R57A 1VQ4Q 1X27A 4FW1A 4PJJA 2EKOA 3M4YA 3CXCS 2CDTA 1YJWA 3URGA 1YIJT 3ZL7C 1VQ8A 4QVDA 1X2QA 3OW2S 2CS7A 3PVLA 2MF2A 2CREA 2J05A 3G4SA 4J9CA 2E41A 2LX9A 1YCYA 4D8KA 2BE9B 1XJWB 2IIMA 3RR6A 1OI1A 4BY6C 4J6XA 5GMKe 2YDLA 4M75A 2O4XB 3META 1B7TA 1K76A 3SEMA 2EW3A 1YWOA 4HKEA 4BY6B 2DMOA 1Y96A 4LD6A 2XG8D 4PJOE 1UGRB 3X24B 3DLMA 2W0ZA 5L8RE 1AT1B 3FIFA 3M54A 4BACA 1MUZA 4GLKA 3SWNC 1QVGA 3RESA 2FRYA 4ZGDB 2RJCA 3TREA 3EFSA 3GNGA 4M7DA 3FC3A 1YHQT 1Q7YC 4E7HA 1Q82C 4JRKA 2QA4Q 4Y92A 3PMIA 2E10A 3OMCA 2BIVA 1UG1A 5I2MA 5GANh 1E7OA 1Y07A 3MEVA 1RL2A 2FZGB 3JCMJ 3H9NA 2K2MA 1K73R 4C8QB 2MPXC 2ZPHB 3OS5A 1K8AU 2DNUA 2CH4A 4C0GA 4N4GA 3OSSC 2CT4A 4IUTA 4OMQA 4QQ6A 2DTHA 2OTLT 1ZA2B 3TSWA 1K9MR 1W70A 2XD0A 4DOVA 1UEBA 4LDWA 2DBKA 1YNZA 4N0AC 1MNDA 5D6XA 2IVWA 2EBPA 2QTXA 4A4FA 5EG2A 8AT1B 3JRZA 3NTIA 4FYYB 1WDXA 4MZTA 2CP6A 1GFDA 1EIFA 5LJ5g 1W1FA 1NEGA 5D6YA 3QSUA 2DRMA 2CP5A 3OYEA 5LJ5f 1U8RA 4QT7A 3UPUA 3BFMA 4BE0A 1VQKQ 2JTFA 1VQ6A 2DD4A 1ZSZA 1KC8R 4MMKA 2O9VA 3OYBA 2K4YA 1N5ZA 3CC4T 1OEBA 4XU1A 1M5Q1 1SSFA 3CEYA 5FU6B 2MCNA 3M5AA 2LQNA 2PVGB 1YJNA 2LJ3A 1QVFP 2V8IA 2F2WA 3M58A 1TUCA 4E6RA 4EMKB 3UA7A 2HBWA 3RKXA 2RJFA 3VS6A 1RABB 2HSPA 2JT4A 4OB3B 3V7CA 3VRYA 1AZEA 5HCKA 5CQXA 2VXFA 3WXMB 2DILA 4J9GA 3CCRQ 4FCYA 1RAAB 3PFSA 1VQLT 2E6NA 2W10A 3CCEQ 2XIDA 1ABQA 1S72A 2HQEA 4EMGA 5AT1B 1G3SA 2BE7D 4C92A 7AT1B 3G71T 1W6XA 2JMAA 1M90R 1D1CA 1VYTA 1IRXA 1RI9A 4OMLA 3V8LA 4BB7A 1QCNA 2RN8A 3VRZA 1M8VA 4RG2A 4IUPA 1YITA 5LJ3d 4FSXA 2H3JA 3GF5A 3OS0A 2WSFE 1JEGA 2EYYA 3CQTA 1KG1A 2DXBA 4X9DA 5GAMh 4ANJA 3G71Q 2JMCA 1WHLA 1WHMA 3CMAT 2ROTA 1YJ9A 1MMDA 2HD0A 1IGQA 4M78E 1RAEB 4XQ3A 4UC4A 1ZUYA 2E70A 2OJ2A 3UDCA 3H0HA 5CCAA 1K8AC 3JB9I 1AD5A 2RQVA 2K2VA 3F70A 1J3TA 1VQOT 2NUTA 5KH6A 1HXDA 1KQSA 1BI0A 1N9RA 3EFOA 4DBQA 4J9EA 6AT1B 1ZUKA 2OAWA 2ZPBB 1YJWQ 1H92A 3KBGA 4F7UA 1VQ8Q 5A0LA 2PU9B 4BI8B 4DQ2A 4PJMA 4M75F 1G83A 2DD5A 3C0CA
chains in the Genus database with same CATH topology
1O9SA 5GAMf 3SDZA 3ASKA 2RH2A 3LGLA 4PJOF 4L6V5 4ELYC 4F7UB 3CCET 4OB1B 3OYJA 4L59A 4KT0E 2ZGWA 3OBWA 2OAUA 3M59A 3MEWA 3MEAA 2ZPIB 2VGNA 3QYGB 3SD4A 3OYDA 2P0KA 1I81A 3QHSA 4M77F 5LJ5j 2LVMA 2MAMA 3CBPA 1QP3A 3S3NA 2EQKA 3CCJA 1NE8A 1XQHA 2XHCA 2XDPA 3X20B 4ELZC 4E7LA 1VQOA 4M7AE 3FRNA 1V29B 3UT1A 3CD6T 4M75C 2GQVA 2MMPA 3OYNA 3MO8A 3GNFB 2L3RA 3V8JA 5FU7C 1ZBXA 4NL2A 2JTMA 3HHTB 4PJOC 2KY9A 4Y91A 4BI4A 4EMHA 5GMKi 3JCMQ 2K57A 1N27A 5CAIA 3FEOA 1VQPT 4M7AG 5CKBA 2V8JA 4QW2A 1BI1A 2QQBA 3CC2T 3A8OB 3CPWS 3VUBA 3E9FA 4MMLA 5GAMj 4X34A 4M77C 2NLUA 2RB6A 1Q81U 1PSEA 2CZ1B 5GMKm 5CQYA 3S6WA 2X4YA 3L2VA 4M7DF 2LQKA 1X01A 3CCRA 3C95A 5KE3A 2E6ZA 4M75E 4E47A 1KHCA 3MCAB 4CI0C 2DKGA 2KQWA 2QQ9A 4JLGA 1QVFS 3CCEA 4LD9K 2RD1A 3L2RA 3PIPA 3C94A 4YTLA 5GAN3 2HNIA 3HP9A 3QKJA 4J8OA 2EWNA 1MGQA 3BDLA 4M75G 2PUKB 5CKHA 3PIOA 1VQ9T 3E9GA 4PJOG 2XK0A 1VQ7T 1R8OB 4C8QF 5GAOp 2XDBA 2RHIA 3GOXA 3JCMg 3M9QA 2RHYA 3HKSA 4C0DC 2CYZB 1QVGS 3JCMf 3CD6A 4M7DC 1DJ7B 5I2SA 1Q81C 3ER0A 3QUIA 2QDYB 3OYGA 4M77G 1YI2T 2XKOC 4XTYA 2RHUA 4M78D 1WQ7A 3FJPA 2JNGA 3QG1A 1VQPA 4QVZA 5GAOn 4ZTJA 2P0PA 4IURA 5LJ5d 5CVIA 3VUZA 5GMKj 4HT8A 2RHXA 1VQ5T 1PSFA 3FLGA 2DTOA 2ZZDA 4RMOA 3CC2A 4IKFA 4V2SA 3ME9A 2Y4XA 2RO0A 4DA4A 2QEXT 2LTOA 2G3RA 4JS5A 3QPHA 2RJEA 1D3BB 2P0QA 2KDSA 3BW1A 3UWNA 2Y4YA 2RK2A 5CKEA 4C8QC 5GAN6 3JB9J 4ME7A 2KK4A 4M7DE 1NPRA 2FHDA 1H3ZA 2ZPGB 4XU3A 3JCMW 4M78A 1YJWT 5DLQE 5CR2A 2D0QB 1VQ4T 4M7DG 4XK8E 4MDWA 5GAN5 5GAMd 3X28B 1KD1U 1VQ8T 2A3LA 4A54A 2RA2A 3J81E 2RI3A 3QZ5B 3HRTA 2GCXA 1G3TA 4A4EA 4C5HA 1JJ2S 1OZ2A 1VQ9A 1VQ7A 4M78B 4II1A 4J7IA 3PT9A 4A4GA 4C8QE 5C0MA 2LDMA 5LJ5e 3GP8A 3G4ST 4FT4A 5AYFA 2WSEE 1YBYA 3A8GB 4E7IA 1YI2A 2L5QA 5GAN2 3OYHA 5J3BA 1M4ZA 4C8QG 4N4IA 4ZN3A 3JB9H 2DIQA 3M53A 2YHTA 4J83A 2LCCA 4IUQA 1VQ5A 3VJPA 3M57A 2L89A 2FVUA 2WACA 4NS5A 3OS2A 3RERA 2QEXA 4ZN1A 3QXEB 1VIFA 2E1HA 1KD1C 1N9SA 4J6YA 4OP0A 2HAXA 3S3MA 2YLCA 5CK9A 4M7AD 2EQMA 3L1AA 2DK3A 5GAMe 2R57A 2X35A 3CMET 1QW1A 3C4SA 5FLXE 4XU0A 2EKOA 3M4YA 2VUBA 3CBMA 4HA8A 5GMKl 2DAQA 3CXCS 2FL7A 1YJWA 3P8HA 3MHXA 4KUDK 3P8BB 3URGA 2EQUA 3HPWA 3CBOA 5LJ3g 1YIJT 2CZ7B 1VQ8A 3INZA 4BDZA 2QQAA 4EDUA 4QVDA 5GANg 1WJSA 3I56T 3LGFA 4O6JA 1UGQB 3OW2S 2CS7A 2E64A 3JCMh 4M7AA 4XAXB 2MF2A 2BUDA 3BDUA 3MEUA 2R5MA 4M75D 3TEEA 5FU6C 3G4SA 3KXTA 2M1HA 2ZPEB 3E1SA 4A53A 4PJOD 2E41A 1Y7XA 2LX9A 4PLIA 2EJFA 3CCVT 1N8RC 2E5QA 4M7AB 4KUIA 2EIFA 1YCYA 2O4XA 5CO7A 4C5EA 1WNLA 2EJ9A 2GFUA 4EMKC 4QQGA 1OI1A 4M77D 2Y90A 4BY6C 3CCMT 3CCST 4OB2B 3LYIA 4OF1A 3G6EA 4B9WA 4J6XA 3FB9A 5GMKe 4XTXA 4B9XA 2EJGA 2LCLA 2O4XB 4M75A 5IAYA 1K73U 3CCQT 3META 3OY9A 2JOYA 3CMEA 2B8AA 3JSCA 4Y28E 2LC4A 3CPWA 3RUXA 2QI2A 1UB4A 3LW5E 2PVOB 3HRSA 4C92F 4IUUA 2VYTA 5A0DA 4IUVA 4LDVA 1MHNA 4M75B 1YIJA 5FRMA 3CCUT 3GIBA 5CKFA 4HKEA 4M77A 4JRIA 5FU7B 4BY6B 1Q7YU 3CC7T 4PJOB 1FX7A 1Y96A 3I56A 2RK1A 3RIRA 4LD6A 2XG8D 4CRIA 4PJOE 1XOVA 2DJZA 2PQWA 1Q82U 1K9MU 1WPYA 3SFMA 2K5IA 1UGRB 2XI9A 3OBYA 2EYQA 4P5NA 4PKCC 3X24B 1AHJB 4M7DD 3DLMA 2L8DA 3OYAA 1BI2A 2RI5A 1VQNT 4HT9A 5L8RE 4FIBA 4M77B 1BYMA 2XICA 4M77E 3V7RA 1Y96B 1OYXA 1XTDA 1M1FA 3CCVA 1K73C 3FIFA 2FYKA 3M54A 5J26A 4BACA 3HRUA 4GLKA 5FROA 3SWNC 4C92C 3L2UA 1LOJA 2JZ2A 1QVGA 1JB0E 1WQWA 1ZQ1A 3RESA 3GPLA 4JRQA 3OYMA 4ZGDB 1QP2A 3CCSA 3CCMA 1O75A 2RJCA 4JLIA 1D3BA 3TREA 2VC8A 4BD3A 3EFSA 3PMTA 3GNGA 4C8QD 4M7DA 4QVCA 4WF2A 3FC3A 1YHQT 1Q7YC 1X75C 4MZPA 4E7HA 3JCMb 3CCQA 4J6WA 1W4SA 1Q82C 1K9MC 2DTIA 1I8FA 4JRKA 4XTWA 3TU4K 5I21A 4C0DB 3OMGA 3PMIA 2QQSA 2E10A 1KC8U 4M7DB 1RI0A 3HFNA 3OMCA 5LJ3h 4C92E 1W2BS 2BIVA 2P4TA 5I2MA 3CCUA 2C06A 2K5LA 1TH7A 3RKWA 5GANh 1IREB 4QQDA 1BIAA 4C8QA 2R5AA 1Y07A 5CKDA 3QSUA 2LT4A 2O01E 1WGSA 1QVPA 3MEVA 3QO3A 4C92G 4D6WA 1RL2A 5C6SA 2RI2A 2ZPFB 3JCMJ 3HFOA 3JCMX 1VQNA 5HKCA 2EFIA 4XTVA 5HY6A 4OVAA 1JJ2A 3CCLT 1NPPA 4C8QB 3QZ9B 5LL6S 3OS5A 2ZPHB 1K8AU 3L2QA 4C0GA 4N4GA 3QYHB 2GFAA 1VQ6T 3OSSC 3M55A 3GLXA 3OYKA 1KC8C 4ATOA 4OB0B 4IUTA 3NFCA 1GXIE 4NOYA 2DVEA 2KVQG 4QQ6A 3OS1A 3VV0A 4LDYA 2DTHA 2XU8A 2OTLT 1YHQA 1IZ6A 3L2ZA 2DZCA 1B34A 4ZGEB 3CPFA 4TVRA 3OYCA 2XD0A 4DOVA 2DEQA 4F7UF 1UEBA 4LDWA 4FT2A 3ZFJA 1BIBA 1U1TA 2YRVA 4N0AC 3LWIA 3HSBA 5D6XA 1KHIA 2IVWA 1B34B 2F69A 2QTXA 5EG2A 4A4FA 5DLOA 4BE2A 1YJNT 4RCCA 1G5VA 3OQ5A 3JRZA 3NTIA 3ZEHA 3CXCA 4MZTA 4R56A 3JCMV 3QIIA 3CCJT 1VQ4A 1EIFA 2BKDN 4HCZA 3DLLA 2DXTA 1VIEA 5LJ5g 3NTKA 1JBMA 5D6YA 1ZHIA 2CKKA 3OB9A 2E12A 4GY5A 2F5KA 2LNVA 2MI6A 5LJ3f 4Z02A 5LJ5f 3JAME 2XDDA 3OYEA 1U8RA 3RMSA 1KQSS 1G3WA 3UPUA 3BFMA 5GANf 3OW2A 2V8KA 4J7FA 4BE0A 2ZCFB 3G7ZA 2JTFA 1VQ6A 4XU2A 1M90U 1P92A 2DD4A 2KSSA 2QXFA 4BUGA 3JB9F 4MMKA 5CIUA 1Q86U 1WJQA 3MP8A 1G3YA 2GF7A 4C0ZA 3OYBA 3M4GA 2K4YA 4PNOA 2AHJB 3JCMd 4KBMB 4E7JA 2OTLA 4A4KA 3CC4T 2RHZA 4PLLA 5GAOq 3A5ZB 4XTUA 3A8LB 5GAMg 2QQRA 1BKBA 2LRQA 4XU1A 5D6WA 3J80E 4JS4A 1S72T 3JCMP 1SSFA 1M5Q1 3CEYA 2E65A 4EPCA 5HK0A 2R58A 4OMFB 1UGSB 1VUBA 4F7UE 3P8DA 2JUFA 3ZBDA 1I4K1 5FU6B 4EMKA 2JN0A 5GAN4 3EFRA 3M5AA 2FB7A 2PVGB 1YJNA 2K5FA 3QJ6A 5LJ3j 2CZ6B 3PGGA 4A4HA 4PJOA 4BE1A 1U1SA 2V8IA 2M16A 3WVDB 3M58A 2YLBA 3OYFA 3LX7A 4F7UG 1M90C 5GANj 3OYYA 1N6AA 1VQMT 4OGEA 1Q86C 4EMKB 1OZ3A 4N4HA 2QA4T 3RKXA 2RJFA 1QVFA 4X9CA 4KULA 4DOWA 2VXEA 4FU6A 4OB3B 3V7CA 4OGCA 3JCMe 4C92D 4RG8A 2LQ8A 1YITT 5GAOl 4L5GA 5CQXA 2VXFA 5IN1A 3WXMB 4RCBA 1Y71A 2MWOA 3X25B 1X6OA 3Q1JA 3VKIA 2HQXA 4VUBA 3L42A 2D9TA 5GAOr 2D6FA 3PFSA 4C0FA 1VQLT 3X26B 4MZMA 3MP6A 3CC4A 2E6NA 2EAYA 3EAEA 4ZTFA 2XIDA 3A8HB 1S72A 3JB9G 3AHUA 2M9UA 2HBPA 2HQEA 3H8ZA 1H641 4BI3A 1WJRA 2KAFA 4C5IA 4EMGA 3H6ZA 1G3SA 4C92A 3SWNA 2X4WA 3O8VA 3OA6A 3G71T 3LLRA 2OTJT 2A7YA 2F5TX 2WSCE 1YJ9T 2JVVA 2M0OA 3NTHA 3A8MB 5KCOA 1M1KU 3N5BB 5A2QE 5KE2A 4M78F 1I5LA 3VU3C 4C92B 3SWNB 1VQMA 3DB3A 1W2BA 3MP1A 2DZ9A 5LJ5h 2QA4A 3E19A 1NZ9A 3V8LA 4BB7A 5M9OA 3OSVA 3CC7A 3HL8A 3I55T 3OYIA 2CGHA 4BDYA 4HCBA 5J39A 1LJOA 1M8VA 4RG2A 2VV5A 4IUPA 1YITA 5LJ3d 2PVDB 4FSXA 5GAOm 5DY9A 2H3JA 3GF5A 3SB2A 2WSFE 3OS0A 3VYHB 5GANd 5DM7R 1KQ1A 3PNWC 4RKUE 2IG0A 3QJYA 3DKMA 1VQLA 1XNIA 4JUVA 1LNXA 4PL6A 3VYGA 3WVEB 1UGPB 2DXCA 4M78C 1KG1A 4J5YA 2DXBA 4ZGJB 4X9DA 5GAMh 1M1KC 4FM4B 1FWZA 5GAN7 4HCCA 1VQKT 1M1GA 1NJIU 1FXXA 2DPPB 3CMAT 3G71A 3T9NA 5A0GA 2OTJA 3L2WA 4MDXA 2X4JA 4LDXA 1YJ9A 2KMTA 4LDUA 2PUOB 2HD0A 3M56A 4R55A 1KQ2A 3LH0A 3R6OA 1M9SA 4M78E 4JRPA 3OYLA 5LJ3e 4FL6A 2X4XA 4NL3A 3RMQA 4XQ3A 4UC4A 4Q5WA 2RJDA 2E70A 1K8AC 2I2LA 3UDCA 5GANe 5CCAA 3I55A 3V8KA 2DO3A 3JB9I 4N0AA 3DB4A 1BI3A 2RM4A 4M78G 3J7AF 4M7AF 2K2VA 2K3XA 3F70A 3LWHA 3PTAA 1VQOT 3QBYA 2EQJA 4XTZA 5KH6A 2LT1A 3QDRB 4JJNK 1NJIC 5FRNA 1JRIA 1HXDA 3CCLA 1KQSA 1BI0A 5KCHA 1N9RA 3G6ET 2VGMA 3TCJA 5GMKh 4O5VA 3V7SA 2MWPA 5GAN8 3FDRA 4E7KA 1N8RU 3KUFA 2ZPBB 2CZ0B 5IT9E 4C5GA 2DXUA 2DIGA 1VQKA 3BY7A 3KBGA 4F7UA 3S3OA 1HK9A 3JCMc 5A0LA 3CMAA 4JDSA 2PU9B 3C12A 3RKYA 4BI8B 5HK3A 4DQ2A 4M7AC 4M75F 3CCRT 2K3YA 2DD5A 3JB9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM f;  2VXF A;  4M7D B;  3HFN A;  4C92 E;  4PJO F;  5LJ3 h;  4RCB A;  4C8Q G;  4F7U B;  3JB9 H;  1TH7 A;  2YHT A;  3RKW A;  2ZGW A;  5GAO r;  5GAN h;  1BIA A;  4C8Q A;  3RER A;  2EAY A;  1I81 A;  3QHS A;  3QO3 A;  4M77 F;  4C92 G;  2E1H A;  5LJ5 j;  1N9S A;  4J6Y A;  4OP0 A;  3JB9 G;  3AHU A;  3JCM J;  3HFO A;  2YLC A;  1H64 1;  4EMG A;  3JCM X;  4M7A D;  3L1A A;  4XTV A;  5GAM e;  4M7A E;  4C92 A;  3SWN A;  4C8Q B;  4XU0 A;  4HA8 A;  5GMK l;  4M75 C;  3V8J A;  4NL2 A;  4PJO C;  4EMH A;  4Y91 A;  5LJ3 g;  5GMK i;  3JCM Q;  2K57 A;  5CAI A;  4M7A G;  3INZ A;  4M78 F;  1I5L A;  3VU3 C;  4C92 B;  3SWN B;  4NOY A;  4QVD A;  5GAN g;  2DVE A;  5LJ5 h;  2DZ9 A;  2DTH A;  3V8L A;  3L2Z A;  2E64 A;  4MML A;  2DZC A;  4M77 C;  2RB6 A;  3JCM h;  5GAM j;  1B34 A;  4M7A A;  5GMK m;  3BDU A;  2CGH A;  4M75 D;  4M7D F;  1LJO A;  1X01 A;  1M8V A;  2DEQ A;  4F7U F;  4M75 E;  5LJ3 d;  4PJO D;  4A53 A;  1BIB A;  2DKG A;  1U1T A;  2E41 A;  4N0A C;  5GAO m;  2EJF A;  5DY9 A;  4M7A B;  3HSB A;  3SB2 A;  2QTX A;  1B34 B;  2RD1 A;  5GAN d;  1YCY A;  1KQ1 A;  4RCC A;  1WNL A;  2EJ9 A;  2HNI A;  5GAN 3;  4JUV A;  4EMK C;  1LNX A;  2EWN A;  1MGQ A;  4M78 C;  4M75 G;  4M77 D;  4J5Y A;  2Y90 A;  3JCM V;  4X9D A;  5GAM h;  2DXT A;  4J6X A;  3FB9 A;  5GMK e;  4PJO G;  5LJ5 g;  4XTX A;  5GAN 7;  2EJG A;  1JBM A;  4C8Q F;  5GAO p;  3QSU A;  4M75 A;  5LJ3 f;  3JCM g;  5LJ5 f;  4M7D C;  3JCM f;  3RUX A;  3BFM A;  5GAN f;  3QUI A;  3JB9 D;  4M77 G;  4XU2 A;  4C92 F;  4XTY A;  3JB9 F;  4M75 B;  1WQ7 A;  3FJP A;  4M78 D;  4MMK A;  5GAN 2;  1KQ2 A;  5GAO n;  3GIB A;  5LJ5 d;  4M77 A;  4JRI A;  4M78 E;  3M4G A;  5GMK j;  4HT8 A;  4PJO B;  4PNO A;  1Y96 A;  3RIR A;  2DTO A;  5LJ3 e;  3JCM d;  4PJO E;  4NL3 A;  2DJZ A;  4V2S A;  5GAO q;  4XTU A;  1WPY A;  4XQ3 A;  5GAM g;  4XU1 A;  1D3B B;  3BW1 A;  2I2L A;  5GAN e;  4M7D D;  3JCM P;  1M5Q 1;  3V8K A;  4C8Q C;  5GAN 6;  4N0A A;  3JB9 I;  3JB9 J;  2RM4 A;  2E65 A;  4M78 G;  4HT9 A;  4M7D E;  4M77 B;  4M7A F;  4M77 E;  3V7R A;  1Y96 B;  4F7U E;  1I4K 1;  4XTZ A;  4EMK A;  2JN0 A;  5GAN 4;  3FIF A;  2FYK A;  3EFR A;  4M78 A;  1JRI A;  1HXD A;  2FB7 A;  4XU3 A;  3JCM W;  4C92 C;  3SWN C;  1LOJ A;  4PJO A;  1N9R A;  5LJ3 j;  1WQW A;  3PGG A;  3RES A;  5GMK h;  1U1S A;  4M7D G;  5GAN 5;  5GAM d;  2YLB A;  3V7S A;  5GAN 8;  4A54 A;  4F7U G;  2RA2 A;  4JLI A;  5GAN j;  1D3B A;  2VC8 A;  3EFS A;  4C8Q D;  4EMK B;  4M7D A;  4M78 B;  2DXU A;  4WF2 A;  4QVC A;  3BY7 A;  3RKX A;  4C8Q E;  4F7U A;  1HK9 A;  3JCM c;  4J6W A;  3JCM b;  4X9C A;  5LJ5 e;  3RKY A;  2VXE A;  2DTI A;  1I8F A;  4JRK A;  3V7C A;  4XTW A;  4DQ2 A;  4M7A C;  4M75 F;  3JCM e;  5I21 A;  4C92 D;  5GAO l;  2E10 A; 
#chains in the Genus database with same CATH topology
 3ASK A;  4PJO F;  4L6V 5;  1M2V A;  4OB1 B;  3OYJ A;  3G4S Q;  2ZGW A;  3D7S B;  2EVR A;  2LNH B;  4RTX A;  2P0K A;  5LJ5 j;  1VQO Q;  5KYY B;  1IB8 A;  1XQH A;  2J6F A;  3X20 B;  4E7Z A;  4E7L A;  1NJI R;  2DJQ A;  2DL5 A;  3CD6 T;  3KFV A;  4M75 C;  2GQV A;  2MMP A;  3MO8 A;  1ZBX A;  3HHT B;  4PJO C;  2KY9 A;  5IXB A;  1VQP T;  3FEO A;  2FZK B;  5CKB A;  1BI1 A;  3CC2 T;  3VUB A;  2RB6 A;  1EX4 A;  1PSE A;  2NUP B;  5GMK m;  4M7D F;  2FPD A;  1X01 A;  3C95 A;  4CC7 A;  1HD3 A;  2DKG A;  3ULR B;  4LD9 K;  2L0A A;  2YSQ A;  4YTL A;  4J8O A;  1W2B P;  2QAS A;  3BDL A;  4PJL A;  1HJD A;  1BK2 A;  3PIO A;  1VQ9 T;  2XK0 A;  1VQ7 T;  2XDB A;  2CYZ B;  1QVG S;  4M7D C;  2AK5 A;  4CC4 B;  1Q81 C;  3ER0 A;  2V1Q A;  1X69 A;  2XKO C;  1NLP C;  5KYW A;  2RHU A;  3CC2 Q;  2OX7 A;  4IUR A;  1VQ5 T;  1WLP B;  3ME9 A;  1MMA A;  2LTO A;  3BW1 A;  1LPL A;  3EGX A;  2RK2 A;  2EPD A;  4E2F B;  4ME7 A;  2KK4 A;  1NG2 A;  2YUO A;  1VYV A;  4OMP A;  1UUE A;  5CR2 A;  2L3P A;  2D0Q B;  1AWJ A;  1MNE A;  2E3H A;  1VQ7 Q;  4A54 A;  1QKX A;  2RA2 A;  2AIR B;  4C5H A;  3A1P A;  1U06 A;  3QWY A;  1QWF A;  4A4G A;  4C8Q E;  5C0M A;  5IHK A;  2X3W D;  3M0P A;  2ABL A;  1ZX6 A;  2F2V A;  3GP8 A;  4FSS A;  4JJD A;  5AYF A;  1YBY A;  3A8G B;  4HXJ A;  4E7I A;  2L5Q A;  2KR3 A;  2A0F B;  2DIQ A;  1UE9 A;  2DEU A;  2X51 A;  2CP7 A;  2LCC A;  4Z89 A;  3VJP A;  2L89 A;  1VIF A;  1GBQ A;  2E1H A;  4J6Y A;  2GQI A;  3S3M A;  2EQM A;  3C4S A;  5FLX E;  2VUB A;  3CBM A;  3P8H A;  2LP5 A;  1E6H A;  2EQU A;  1IXD A;  1OX8 A;  1ZSZ C;  4EDU A;  5GAN g;  1WJS A;  4AG2 C;  1VQ6 Q;  2A36 A;  3IQL A;  3LGF A;  1VOM A;  1RLQ C;  2E64 A;  4M7A A;  4DBF A;  3BDU A;  1UHF A;  2ED0 A;  4M75 D;  3TEE A;  2ZPE B;  2K79 A;  3E1S A;  4A53 A;  3O5Z A;  4PJO D;  3E2U A;  2EJF A;  2H8H A;  1RAC B;  5CO7 A;  4C5E A;  4KRT A;  2KRO A;  4OB2 B;  3G6E A;  3FB9 A;  1YJN Q;  4XTX A;  4B9X A;  5IAY A;  3CME A;  1GBR A;  3EG9 B;  1UB4 A;  4C92 F;  4DBR A;  2VYT A;  5A0D A;  1RAI B;  2FO0 A;  5FU7 B;  4M77 A;  1Q7Y U;  1C1A A;  4LNP A;  3I56 A;  2RK1 A;  4CRI A;  1Q82 U;  1PWT A;  3SFM A;  2K5I A;  2QK0 A;  3OBY A;  4P5N A;  4M7D D;  4FIB A;  1SHF A;  3I5S A;  4M77 E;  1R0C B;  1ACM B;  3V7R A;  3CCV A;  1S72 Q;  1JU5 C;  1K73 C;  5J26 A;  5FRO A;  4C92 C;  3L2U A;  2JZ2 A;  1WQW A;  1ZQ1 A;  2CSQ A;  4DEX A;  3CCS A;  3CCM A;  1D3B A;  3CCQ A;  1NM7 A;  1K9M C;  4HCK A;  2DTI A;  2KNB B;  3TU4 K;  5I21 A;  4C0D B;  1QLY A;  3OMG A;  2QQS A;  2D8H A;  1ARK A;  5LJ3 h;  2OI3 A;  1SEM A;  2RQW A;  4RTU A;  3CCU A;  2K5L A;  1TH7 A;  1YIT Q;  1BIA A;  4ESR A;  2MOX A;  4J9H A;  1WGS A;  1ZA1 B;  3QO3 A;  3H41 A;  1VQN A;  4WCI A;  1NPP A;  3QYH B;  4LUE A;  1IHW A;  4M4Z A;  2P84 A;  3OYK A;  2GNC A;  1KC8 C;  1GXI E;  1UGV A;  2DVE A;  1YJ9 Q;  4LDY A;  2XU8 A;  1FYN A;  3L2Z A;  1B34 A;  1V1C A;  2EQI A;  3CPF A;  2O31 A;  4F7U F;  1PRM C;  4JJB A;  4ORZ A;  2YRV A;  1OV3 A;  2F69 A;  3H0F A;  4BE2 A;  2SRC A;  3QII A;  2BKD N;  1I07 A;  4K11 A;  4GY5 A;  1ZHI A;  2F5K A;  2LNV A;  2MI6 A;  1BYM A;  1KQS S;  1G3W A;  1M8M A;  2V8K A;  4OMO A;  4J7F A;  2QXF A;  1LVK A;  2AKK A;  2KSS A;  3JB9 F;  2J7I A;  1WJQ A;  3NGP A;  2GF7 A;  3GBQ A;  4PNO A;  3EFO B;  2AHJ B;  4J9F A;  4KBM B;  5GAO q;  2IPO B;  1BKB A;  2LRQ A;  2QQR A;  3EGD A;  5GAM g;  4AMC A;  3CPW P;  3JCM P;  1TXQ A;  4OMF B;  1T0J A;  2BZX A;  3P8D A;  2JUF A;  3ZBD A;  1M3C A;  5GAN 4;  3EFR A;  1D0X A;  2K5F A;  3QJ6 A;  4PJO A;  2DER A;  4BE1 A;  1QCO A;  3LX7 A;  1M90 C;  5GAN j;  3OYY A;  2NYS A;  4N4H A;  2QA4 T;  1IHV A;  2VAS A;  4X9C A;  1OUL A;  2CUD A;  3JCM e;  4C92 D;  2LQ8 A;  5IN1 A;  2RMO A;  4PFO A;  3X25 B;  1X6O A;  2DE0 X;  4VUB A;  3L42 A;  2KGT A;  2EGC A;  4ZTF A;  5GJV B;  2M9U A;  2YRD A;  3H8Z A;  4BI3 A;  1WJR A;  2KAF A;  4C5I A;  1TG0 A;  3O8V A;  5IHN A;  2JJ9 A;  2A7Y A;  2BTT A;  3RBB B;  2M0O A;  3NTH A;  1PG5 B;  3N5B B;  1I5L A;  3HTR A;  1Q86 R;  3SWN B;  1VQM A;  1VA7 A;  1NZ9 A;  2HDA A;  3CC7 A;  1PNJ A;  3HL8 A;  1JJ2 P;  5J39 A;  1LJO A;  4GBQ A;  2VV5 A;  1JXM A;  4X1V A;  2PVD B;  1KQ1 A;  1NYG A;  2IG0 A;  3QJY A;  3DKM A;  4HVU A;  4JUV A;  4PL6 A;  3VYG A;  3WVE B;  4CC2 A;  4J5Y A;  4FM4 B;  1TWB A;  1VQK T;  4AG1 C;  3QWX X;  9ATC B;  3T9N A;  2OTJ A;  1H8K A;  3L2W A;  5FWC A;  2ECZ A;  4LDU A;  3CXC P;  1KQ2 A;  3R6O A;  2B86 A;  1FMV A;  1Z9Q A;  1K1Z A;  1WFW A;  2GTJ A;  3I55 A;  3V8K A;  2KEA A;  2DL3 A;  3OW2 P;  2RM4 A;  4M7A F;  2LX7 A;  4JJN K;  3QDR B;  1NJI C;  3EG0 A;  3G6E T;  5GMK h;  1WHJ A;  2D0N A;  2RF0 A;  2MWP A;  3FDR A;  2EYX A;  4E7K A;  1N8R U;  1M1K R;  2DXU A;  1HK9 A;  3JCM c;  1AVZ C;  2NWM A;  3TVT A;  4M7A C;  3CCR T;  3JB9 D;  1O9S A;  4ELY C;  3CCE T;  3M0U A;  4L59 A;  2OAU A;  3SD4 A;  2HKQ B;  2VGN A;  2ZPI B;  3MJX A;  3OYD A;  1PD1 A;  4M77 F;  1QP3 A;  2EQK A;  3CCJ A;  1NE8 A;  2XDP A;  3EH1 A;  3FRN A;  3G6E Q;  1V29 B;  3UT1 A;  3OYN A;  1MMN A;  2L3R A;  2GGR A;  3CME Q;  5GMK i;  1TS9 A;  1C0M A;  2V8J A;  2QQB A;  5GJW B;  5KYX B;  3E9F A;  5GAM j;  4M77 C;  1Q81 U;  2CZ1 B;  3S6W A;  1ZLM A;  2DL4 A;  3I56 Q;  1K4U S;  2E6Z A;  4CI0 C;  3L2R A;  3PIP A;  1KK7 A;  2HCK A;  3C94 A;  1B07 A;  3HP9 A;  3QKJ A;  1MGQ A;  4M75 G;  3CCV Q;  2PUK B;  2DFU A;  4DEY A;  4PJO G;  1R8O B;  3GOX A;  2RHY A;  3HKS A;  3CCS Q;  3CCM Q;  1V76 A;  2V1R A;  1SSH A;  5I2S A;  1AZG B;  2CT3 A;  3CCQ Q;  4XTY A;  2YWW A;  1WQ7 A;  2COY A;  1GCP A;  4ZTJ A;  5KYU A;  3VUZ A;  1ZUU A;  2FZC B;  2HL5 C;  2ZZD A;  4RMO A;  4LUD A;  4DA4 A;  4JS5 A;  3QPH A;  3CCU Q;  1D3B B;  2P0Q A;  2RJE A;  2KDS A;  3OYA A;  5CKE A;  5GAN 6;  3JB9 J;  2ESW A;  1I0C A;  1R77 A;  2C0T A;  2D8J A;  2KE9 A;  1K0S A;  2EYW A;  3JCM W;  4M78 A;  1YJW T;  5DLQ E;  1VQN Q;  3VS3 A;  4M7D G;  1QCF A;  2YUQ A;  4XK8 E;  1VQ8 T;  2HMA A;  3J81 E;  2RI3 A;  2X9H A;  3M0R A;  2KRS A;  1D1A A;  1OZ2 A;  5LJ5 e;  2QGG A;  1M3A A;  3G4S T;  3VS1 A;  1YI2 A;  5GAN 2;  3VS2 A;  1M2O A;  1M4Z A;  4N4I A;  4ZN3 A;  3JB9 H;  4J83 A;  2YHT A;  2AKL A;  2JM8 A;  2DM1 A;  3RER A;  4NS5 A;  3OS2 A;  2V26 A;  2QEX A;  1NLO C;  4M7A D;  2YLC A;  5CK9 A;  3L1A A;  2DK3 A;  1QW1 A;  5FW9 A;  5GMK l;  3MHX A;  3P8B B;  4QKU A;  1GL5 A;  3HPW A;  3CBO A;  5LJ3 g;  2CZ7 B;  2QQA A;  2HL3 A;  4O6J A;  1UGQ B;  4XAX B;  3MEU A;  2M1H A;  3A98 A;  1N8R C;  1Y7X A;  3TQ7 P;  2EIF A;  2O2O A;  2O4X A;  2HSE B;  1WNL A;  2EJ9 A;  2GFU A;  4QQG A;  3MKD A;  4M77 D;  2Y90 A;  1KD1 R;  1WI7 A;  1AWW A;  4OF1 A;  3LYI A;  2G6F X;  4B9W A;  3LH5 A;  2EJG A;  2LCL A;  2CP2 A;  1K73 U;  1I5O B;  1WA7 A;  2HZY A;  3EGD B;  3OY9 A;  2JOY A;  4Y28 E;  2LC4 A;  2QYZ A;  2PVO B;  1AWO A;  4JZ4 A;  1WHK A;  1YIJ A;  4LDV A;  5FRM A;  4M75 B;  2DRK A;  3CC7 T;  4PJO B;  1ABO A;  2DJZ A;  1K9M U;  1WPY A;  2EYQ A;  3I5R A;  4PKC C;  2JS2 A;  2L8D A;  1BI2 A;  2RI5 A;  3PVQ A;  4HT9 A;  2H3E B;  1Y96 B;  1OYX A;  1XTD A;  2M02 A;  4PJN A;  3VS4 A;  2FYK A;  1JB0 E;  3GPL A;  4JRQ A;  1QP2 A;  1O75 A;  4BD3 A;  2VC8 A;  3PMT A;  4QVC A;  4B6M A;  1W4S A;  1VQM Q;  1I8F A;  4LN2 A;  1KC8 U;  3CC7 Q;  4M7D B;  2DA9 A;  1OQK A;  1IRE B;  4QQD A;  4C8Q A;  2R5A A;  2KXD A;  1QKW A;  1UFF A;  4C92 G;  4D6W A;  5C6S A;  2RI2 A;  3HFO A;  4FYW B;  2M0Y A;  4XTV A;  1B3Q A;  5LL6 S;  3L2Q A;  1VQ6 T;  2GFA A;  1FMW A;  4AFS C;  4ATO A;  2OTJ Q;  2KT1 A;  3OS1 A;  3VV0 A;  1YHQ A;  1IZ6 A;  4ZGE B;  1BU1 A;  1S1N A;  4TVR A;  3OYC A;  2JW4 A;  4FT2 A;  3ZFJ A;  4RTW A;  3I55 Q;  3LWI A;  1UJY A;  3QDF A;  3THK A;  5DLO A;  1SPK A;  1YJN T;  1G5V A;  1EZZ B;  3JCM V;  3CCJ T;  2QG9 B;  2D1X A;  2DXT A;  1JBM A;  3OB9 A;  4WTO B;  2E12 A;  4Z02 A;  3JAM E;  2E4H A;  3RMS A;  5GAN f;  2RNA A;  2ZCF B;  3G7Z A;  2O88 A;  4XU2 A;  1M90 U;  1JQQ A;  1P92 A;  5CIU A;  2E3I A;  3MP8 A;  1G3Y A;  1RUW A;  4C0Z A;  3M4G A;  3EG2 A;  2DL7 A;  3JCM d;  2OTL A;  4A4K A;  3A5Z B;  4XTU A;  3A8L B;  2JTE A;  1ZSZ B;  5D6W A;  1S72 T;  4JS4 A;  2E65 A;  4FW2 A;  1UGS B;  1VUB A;  1I4K 1;  1Z9Z A;  4EMK A;  1YCS B;  2FPF A;  3CCJ Q;  1K8A R;  2JM9 A;  5LJ3 j;  4A4H A;  1U1S A;  2KRN A;  2M16 A;  3WVD B;  4F7U G;  2P4R A;  1N6A A;  1Q86 C;  1OZ3 A;  2DBM A;  4GLM A;  4KUL A;  4DOW A;  4FU6 A;  3UAT A;  4RG8 A;  1YIT T;  1QVG P;  4RCB A;  1KIK A;  2ENM A;  3Q1J A;  3VKI A;  2HQX A;  2D9T A;  1X2K A;  4C0F A;  4RUG A;  4MZM A;  3CC4 A;  1M27 C;  2RQR A;  3EAE A;  3A8H B;  3JB9 G;  3AHU A;  1H64 1;  3H6Z A;  2X4W A;  2DL8 A;  3LLR A;  5I11 A;  2WSC E;  2FEI A;  2DYB A;  2EYZ A;  2QTV A;  4KGX B;  1YJ9 T;  2JVV A;  5KCO A;  1YWP A;  3A8M B;  5A2Q E;  4M78 F;  3VU3 C;  4C92 B;  2C0O A;  1W2B A;  2DZ9 A;  1R0B G;  3E19 A;  1VYU A;  3OYI A;  2CGH A;  4BDY A;  1TSF A;  1T0H A;  1QMC A;  1D1B A;  1WXT A;  2BZY A;  3SB2 A;  5DM7 R;  4RKU E;  3PNW C;  3H0I A;  4OMN A;  1VQL A;  1X6B A;  1LNX A;  1UGP B;  2DXC A;  4M78 C;  4ZGJ B;  5KYU B;  1M1K C;  1FWZ A;  5GAN 7;  4HCC A;  2DET A;  1M1G A;  1NJI U;  1X43 A;  2FPE A;  2DYI A;  3G71 A;  4MDX A;  2X4J A;  1U5S A;  3M56 A;  1ZSG A;  3OYL A;  1YI2 Q;  4FL6 A;  2X4X A;  4NL3 A;  1M3B A;  2RJD A;  5GAN e;  2DO3 A;  3DB4 A;  2EGE A;  3J7A F;  2K3X A;  4AFU C;  2QEX Q;  4XTZ A;  1QQJ A;  2LT1 A;  3CCL A;  2NUZ A;  4A63 B;  5KCH A;  3TCJ A;  2JS0 A;  2L2P A;  3V7S A;  4FYV B;  2NUT B;  2CZ0 B;  3NPF A;  5IT9 E;  2X3X D;  4C5G A;  3BY7 A;  1IGU A;  3S3O A;  1TTH B;  3CMA A;  4JDS A;  3C12 A;  5HK3 A;  3EG1 A;  4IIM A;  1CSK A;  3REA B;  5GAM f;  1CKB A;  2PNI A;  2RH2 A;  3LGL A;  4F7U B;  5KYY A;  3OBW A;  3UA6 A;  3M59 A;  3MEW A;  1C6V X;  4D8D A;  2KBT A;  2LCS A;  3QYG B;  4FYX B;  1I81 A;  3QHS A;  1SHG A;  2LVM A;  2MAM A;  1MMG A;  1M2V B;  3BE3 A;  2XHC A;  4ELZ C;  1VQO A;  2HEQ A;  3GNF B;  1GFC A;  2NUP A;  3EGU A;  3VS0 A;  2K57 A;  2ZAE A;  5CAI A;  4M7A G;  4AFQ C;  2CP3 A;  1YIJ Q;  4X34 A;  2KRM A;  2NLU A;  2I0N A;  5CQY A;  2X4Y A;  3L2V A;  2LQK A;  3PE0 A;  4M75 E;  4E47 A;  1KHC A;  4JLG A;  1QVF S;  4CC3 A;  2RD1 A;  5GAN 3;  2HNI A;  1LCK A;  1K0X A;  5CKH A;  3E9G A;  4C8Q F;  5IXF A;  2RHI A;  1H3H A;  3VS5 A;  3CD6 A;  1DJ7 B;  3I9Q A;  2J06 A;  3QUI A;  1KSW A;  3OYG A;  4M77 G;  4Z88 A;  4M78 D;  3QG1 A;  1VQP A;  4QVZ A;  5GAO n;  2J6K A;  2P0P A;  5LJ5 d;  5GMK j;  4HT8 A;  4F17 A;  1E6G A;  2RHX A;  1PSF A;  3FLG A;  3M0S A;  3CC2 A;  2Y4X A;  2L3Q A;  5KYW B;  3UWN A;  2Y4Y A;  2COZ A;  4C8Q C;  1BB9 A;  4M7D E;  4AFZ C;  1I1J A;  5KYN A;  1NPR A;  1H3Z A;  4XU3 A;  1T3L A;  3EGX B;  2DF6 A;  4IIO A;  2ED1 A;  3EH2 A;  3QZ5 B;  1GRI A;  3HRT A;  4A4E A;  1G3T A;  4J9I A;  1WIE A;  1VQ9 A;  1A0N B;  1VQ7 A;  2HKN A;  2LDM A;  4PK4 A;  2DVJ A;  2WSE E;  2AZS A;  1SKU B;  4HVV A;  1YHQ Q;  1KQS P;  4RTZ A;  3OYH A;  3VS7 A;  2K9G A;  2J6O A;  4IUQ A;  4JJC A;  1VQ5 A;  2FVU A;  2MIO A;  1KD1 C;  1N9S A;  4OP0 A;  2HAX A;  1G8X A;  5GAM e;  2X35 A;  3CME T;  4XU0 A;  4HA8 A;  2DAQ A;  2FL7 A;  1KFZ A;  4KUD K;  3TSZ A;  5IH2 A;  1TU0 B;  2QGF B;  1MV0 B;  4Z8A A;  3INZ A;  4BDZ A;  2QAZ A;  3I56 T;  1K9A A;  8ATC B;  3JCM h;  2BUD A;  1GCQ A;  2R5M A;  1D0Y A;  2ATC B;  2YUP A;  5FU6 C;  4KH1 B;  2PTK A;  2OTL Q;  3KXT A;  3CCV T;  4PLI A;  1F1B B;  2E5Q A;  4M7A B;  4KUI A;  1SF9 A;  1PD0 A;  1RAD B;  1D09 B;  3EG3 A;  2CH4 W;  4EMK C;  3EG9 A;  2K6D A;  2KYM A;  3CCS T;  3CCM T;  1YN8 A;  3M0T A;  3CCQ T;  2B8A A;  3JSC A;  3CPW A;  3RUX A;  2QI2 A;  2E5K A;  3LW5 E;  4KGV B;  3HRS A;  5D7U A;  3AT1 B;  1PM3 A;  4IUU A;  4IUV A;  1MHN A;  4EIK A;  3CCU T;  3GIB A;  2YT6 A;  5CKF A;  3G1J A;  4JRI A;  1FX7 A;  1PRL C;  3RIR A;  1XOV A;  3JV3 A;  2PQW A;  2XI9 A;  1AHJ B;  1VQN T;  4M77 B;  3CC4 Q;  2XIC A;  1M1F A;  3HRU A;  1LOJ A;  2YUN A;  2L3S A;  3OYM A;  2A28 A;  2FG0 A;  3MPU B;  4JLI A;  4C8Q D;  4WF2 A;  1WXU A;  1X75 C;  4MZP A;  3JCM b;  2LQW A;  4J6W A;  4XTW A;  1RI0 A;  3HFN A;  4C92 E;  1W2B S;  2P4T A;  2C06 A;  3RKW A;  1ZBJ A;  1OPL A;  1WHG A;  5CKD A;  2LT4 A;  2O01 E;  1AEY A;  1QVP A;  1WZO A;  3M0Q A;  2ZPF B;  3JCM X;  2QDL A;  5HKC A;  1VQL Q;  2EFI A;  5HY6 A;  4OVA A;  1JJ2 A;  3CCL T;  1HSQ A;  3QZ9 B;  3REB B;  1UDL A;  1PCX A;  2KYB A;  3M55 A;  3GLX A;  1X6G A;  4OB0 B;  3NFC A;  4NOY A;  2KVQ G;  1Q7Y R;  2DZC A;  3RDV A;  1Q82 R;  1KJW A;  2CP0 A;  1TOV A;  2SEM A;  2VKN A;  2DEQ A;  1BIB A;  1U1T A;  3HSB A;  1KHI A;  1B34 B;  5I22 A;  4RCC A;  3FJ5 A;  1SRM A;  3OQ5 A;  3ZEH A;  3CXC A;  4R56 A;  2DX1 A;  1VQ4 A;  1OX9 A;  4HCZ A;  3DLL A;  1HYO A;  3CCL Q;  1VIE A;  3NTK A;  1M30 A;  2A08 A;  2CKK A;  5LJ3 f;  2XDD A;  2GTO A;  3NHN A;  3OW2 A;  2LZ6 B;  4BUG A;  3CMA Q;  1Q86 U;  2XMF A;  5IHI A;  4E7J A;  4LXC A;  4F14 A;  2RHZ A;  4PLL A;  1EFN A;  3J80 E;  1UTI A;  1SG5 A;  2CUB A;  3I35 A;  5HK0 A;  1RAG B;  4EPC A;  2K7A A;  2R58 A;  4AT1 B;  1Y57 A;  4F7U E;  1OOT A;  2JN0 A;  1NEB A;  2FB7 A;  2AT1 B;  1RAH B;  2CZ6 B;  3PGG A;  3OYF A;  2YLB A;  5ECA A;  1VQM T;  4OGE A;  3SHW A;  2LMJ A;  2EGA A;  2VB6 A;  1QVF A;  2VXE A;  2KXC A;  4OGC A;  2GBQ A;  5GAO l;  4L5G A;  1Y71 A;  2MWO A;  1UHC A;  1UJ0 A;  1AOJ A;  5GAO r;  4F16 A;  2D6F A;  3X26 B;  2COW A;  2EKH A;  3MP6 A;  2EAY A;  1BBZ A;  2LJ1 A;  2HBP A;  4J9B A;  3RNJ A;  2DLP A;  3SWN A;  1D0Z A;  3OA6 A;  1WHH A;  2OTJ T;  4DBH A;  2F2X A;  2F5T X;  2KT8 A;  3EHR A;  1M1K U;  3CD6 Q;  5KE2 A;  2AZV A;  3DB3 A;  3MP1 A;  5LJ5 h;  3UF4 A;  1WX6 A;  2QA4 A;  5M9O A;  3OSV A;  1VQP Q;  2YXY A;  3I55 T;  4HCB A;  1U3O A;  5GAO m;  5DY9 A;  4PFZ A;  3VYH B;  5GAN d;  1XNI A;  1UEC A;  1MV3 A;  1FXX A;  2DPP B;  5A0G A;  1VQ9 Q;  4LDX A;  3EHQ A;  2KMT A;  2PUO B;  4R55 A;  3LH0 A;  2VVK A;  1M9S A;  4JRP A;  5LJ3 e;  1OPK A;  2M51 A;  3RMQ A;  1OU8 A;  4Q5W A;  2I2L A;  2PZ1 A;  4N0A A;  2MK5 A;  1BI3 A;  2RQU A;  4M78 G;  1VQ5 Q;  3PTA A;  3LWH A;  3QBY A;  2EQJ A;  5FRN A;  4JZ3 A;  1JRI A;  5FWB A;  3R6N A;  2VGM A;  4O5V A;  5GAN 8;  1CKA A;  3KUF A;  1Y0M A;  1JO8 A;  1VQK A;  2DIG A;  1IO6 A;  3RKY A;  4RTT A;  1WYX A;  2K3Y A;  2JXB A;  1GCQ C;  1NBE B;  4RTY A;  3SDZ A;  4KT0 E;  2Z0W A;  3MEA A;  1YP5 A;  3CBP A;  1TUG B;  2RQT A;  3S3N A;  4M7A E;  2A37 A;  4J9D A;  1OU9 A;  5KYX A;  3V8J A;  5FU7 C;  4NL2 A;  2JTM A;  4BI4 A;  4Y91 A;  4EMH A;  3JCM Q;  1N27 A;  1PHT A;  4QW2 A;  3A8O B;  1NYF A;  3CPW S;  4MML A;  1T3S A;  4OMM A;  3CCR A;  4KGZ B;  5KE3 A;  3MCA B;  1YFN A;  3NMZ C;  2QQ9 A;  2KQW A;  4RTV A;  3CCE A;  2HQH A;  4JPB W;  2EWN A;  4E7S A;  1Q95 G;  2CSI A;  1N8R R;  2VWF A;  4KH0 B;  5GAO p;  3JCM g;  3M9Q A;  4C0D C;  2F1L A;  2RPN A;  1AWX A;  3JCM f;  1WXB A;  2QDY B;  2C0I A;  4R0K A;  1YI2 T;  2MYS A;  3FJP A;  1SRL A;  2JNG A;  4PFP A;  5CVI A;  2LJ0 A;  2DTO A;  4IKF A;  4V2S A;  2RO0 A;  1QWE A;  2QEX T;  2G3R A;  1TUD A;  2K3B A;  1PC0 A;  1JXO A;  2FHD A;  2ZPG B;  2FRW A;  2KI7 A;  1VQ4 T;  5EC7 A;  4MDW A;  5GAN 5;  5GAM d;  3X28 B;  1KD1 U;  1PKT A;  2A3L A;  5L23 A;  2YRC A;  2ROL A;  2GCX A;  4HVW A;  1JJ2 S;  1RLP C;  4M78 B;  2O9S A;  4II1 A;  4J7I A;  3PT9 A;  1Q81 R;  1PKS A;  4FT4 A;  1RAF B;  1G2B A;  4F04 B;  5J3B A;  4C8Q G;  3U23 A;  2BZ8 A;  3M53 A;  1BCM A;  2WAC A;  3M57 A;  4ZNX A;  4ZN1 A;  3QXE B;  1BCO A;  1FMK A;  4LE9 A;  2R57 A;  1VQ4 Q;  1X27 A;  4FW1 A;  4PJJ A;  2EKO A;  3M4Y A;  3CXC S;  2CDT A;  1YJW A;  3URG A;  1YIJ T;  3ZL7 C;  1VQ8 A;  4QVD A;  1X2Q A;  3OW2 S;  2CS7 A;  3PVL A;  2MF2 A;  2CRE A;  2J05 A;  3G4S A;  4J9C A;  2E41 A;  2LX9 A;  1YCY A;  4D8K A;  2BE9 B;  1XJW B;  2IIM A;  3RR6 A;  1OI1 A;  4BY6 C;  4J6X A;  5GMK e;  2YDL A;  4M75 A;  2O4X B;  3MET A;  1B7T A;  1K76 A;  3SEM A;  2EW3 A;  1YWO A;  4HKE A;  4BY6 B;  2DMO A;  1Y96 A;  4LD6 A;  2XG8 D;  4PJO E;  1UGR B;  3X24 B;  3DLM A;  2W0Z A;  5L8R E;  1AT1 B;  3FIF A;  3M54 A;  4BAC A;  1MUZ A;  4GLK A;  3SWN C;  1QVG A;  3RES A;  2FRY A;  4ZGD B;  2RJC A;  3TRE A;  3EFS A;  3GNG A;  4M7D A;  3FC3 A;  1YHQ T;  1Q7Y C;  4E7H A;  1Q82 C;  4JRK A;  2QA4 Q;  4Y92 A;  3PMI A;  2E10 A;  3OMC A;  2BIV A;  1UG1 A;  5I2M A;  5GAN h;  1E7O A;  1Y07 A;  3MEV A;  1RL2 A;  2FZG B;  3JCM J;  3H9N A;  2K2M A;  1K73 R;  4C8Q B;  2MPX C;  2ZPH B;  3OS5 A;  1K8A U;  2DNU A;  2CH4 A;  4C0G A;  4N4G A;  3OSS C;  2CT4 A;  4IUT A;  4OMQ A;  4QQ6 A;  2DTH A;  2OTL T;  1ZA2 B;  3TSW A;  1K9M R;  1W70 A;  2XD0 A;  4DOV A;  1UEB A;  4LDW A;  2DBK A;  1YNZ A;  4N0A C;  1MND A;  5D6X A;  2IVW A;  2EBP A;  2QTX A;  4A4F A;  5EG2 A;  8AT1 B;  3JRZ A;  3NTI A;  4FYY B;  1WDX A;  4MZT A;  2CP6 A;  1GFD A;  1EIF A;  5LJ5 g;  1W1F A;  1NEG A;  5D6Y A;  3QSU A;  2DRM A;  2CP5 A;  3OYE A;  5LJ5 f;  1U8R A;  4QT7 A;  3UPU A;  3BFM A;  4BE0 A;  1VQK Q;  2JTF A;  1VQ6 A;  2DD4 A;  1ZSZ A;  1KC8 R;  4MMK A;  2O9V A;  3OYB A;  2K4Y A;  1N5Z A;  3CC4 T;  1OEB A;  4XU1 A;  1M5Q 1;  1SSF A;  3CEY A;  5FU6 B;  2MCN A;  3M5A A;  2LQN A;  2PVG B;  1YJN A;  2LJ3 A;  1QVF P;  2V8I A;  2F2W A;  3M58 A;  1TUC A;  4E6R A;  4EMK B;  3UA7 A;  2HBW A;  3RKX A;  2RJF A;  3VS6 A;  1RAB B;  2HSP A;  2JT4 A;  4OB3 B;  3V7C A;  3VRY A;  1AZE A;  5HCK A;  5CQX A;  2VXF A;  3WXM B;  2DIL A;  4J9G A;  3CCR Q;  4FCY A;  1RAA B;  3PFS A;  1VQL T;  2E6N A;  2W10 A;  3CCE Q;  2XID A;  1ABQ A;  1S72 A;  2HQE A;  4EMG A;  5AT1 B;  1G3S A;  2BE7 D;  4C92 A;  7AT1 B;  3G71 T;  1W6X A;  2JMA A;  1M90 R;  1D1C A;  1VYT A;  1IRX A;  1RI9 A;  4OML A;  3V8L A;  4BB7 A;  1QCN A;  2RN8 A;  3VRZ A;  1M8V A;  4RG2 A;  4IUP A;  1YIT A;  5LJ3 d;  4FSX A;  2H3J A;  3GF5 A;  3OS0 A;  2WSF E;  1JEG A;  2EYY A;  3CQT A;  1KG1 A;  2DXB A;  4X9D A;  5GAM h;  4ANJ A;  3G71 Q;  2JMC A;  1WHL A;  1WHM A;  3CMA T;  2ROT A;  1YJ9 A;  1MMD A;  2HD0 A;  1IGQ A;  4M78 E;  1RAE B;  4XQ3 A;  4UC4 A;  1ZUY A;  2E70 A;  2OJ2 A;  3UDC A;  3H0H A;  5CCA A;  1K8A C;  3JB9 I;  1AD5 A;  2RQV A;  2K2V A;  3F70 A;  1J3T A;  1VQO T;  2NUT A;  5KH6 A;  1HXD A;  1KQS A;  1BI0 A;  1N9R A;  3EFO A;  4DBQ A;  4J9E A;  6AT1 B;  1ZUK A;  2OAW A;  2ZPB B;  1YJW Q;  1H92 A;  3KBG A;  4F7U A;  1VQ8 Q;  5A0L A;  2PU9 B;  4BI8 B;  4DQ2 A;  4PJM A;  4M75 F;  1G83 A;  2DD5 A;  3C0C A; 
#chains in the Genus database with same CATH homology
 1O9S A;  5GAM f;  3SDZ A;  3ASK A;  2RH2 A;  3LGL A;  4PJO F;  4L6V 5;  4ELY C;  4F7U B;  3CCE T;  4OB1 B;  3OYJ A;  4L59 A;  4KT0 E;  2ZGW A;  3OBW A;  2OAU A;  3M59 A;  3MEW A;  3MEA A;  2ZPI B;  2VGN A;  3QYG B;  3SD4 A;  3OYD A;  2P0K A;  1I81 A;  3QHS A;  4M77 F;  5LJ5 j;  2LVM A;  2MAM A;  3CBP A;  1QP3 A;  3S3N A;  2EQK A;  3CCJ A;  1NE8 A;  1XQH A;  2XHC A;  2XDP A;  3X20 B;  4ELZ C;  4E7L A;  1VQO A;  4M7A E;  3FRN A;  1V29 B;  3UT1 A;  3CD6 T;  4M75 C;  2GQV A;  2MMP A;  3OYN A;  3MO8 A;  3GNF B;  2L3R A;  3V8J A;  5FU7 C;  1ZBX A;  4NL2 A;  2JTM A;  3HHT B;  4PJO C;  2KY9 A;  4Y91 A;  4BI4 A;  4EMH A;  5GMK i;  3JCM Q;  2K57 A;  1N27 A;  5CAI A;  3FEO A;  1VQP T;  4M7A G;  5CKB A;  2V8J A;  4QW2 A;  1BI1 A;  2QQB A;  3CC2 T;  3A8O B;  3CPW S;  3VUB A;  3E9F A;  4MML A;  5GAM j;  4X34 A;  4M77 C;  2NLU A;  2RB6 A;  1Q81 U;  1PSE A;  2CZ1 B;  5GMK m;  5CQY A;  3S6W A;  2X4Y A;  3L2V A;  4M7D F;  2LQK A;  1X01 A;  3CCR A;  3C95 A;  5KE3 A;  2E6Z A;  4M75 E;  4E47 A;  1KHC A;  3MCA B;  4CI0 C;  2DKG A;  2KQW A;  2QQ9 A;  4JLG A;  1QVF S;  3CCE A;  4LD9 K;  2RD1 A;  3L2R A;  3PIP A;  3C94 A;  4YTL A;  5GAN 3;  2HNI A;  3HP9 A;  3QKJ A;  4J8O A;  2EWN A;  1MGQ A;  3BDL A;  4M75 G;  2PUK B;  5CKH A;  3PIO A;  1VQ9 T;  3E9G A;  4PJO G;  2XK0 A;  1VQ7 T;  1R8O B;  4C8Q F;  5GAO p;  2XDB A;  2RHI A;  3GOX A;  3JCM g;  3M9Q A;  2RHY A;  3HKS A;  4C0D C;  2CYZ B;  1QVG S;  3JCM f;  3CD6 A;  4M7D C;  1DJ7 B;  5I2S A;  1Q81 C;  3ER0 A;  3QUI A;  2QDY B;  3OYG A;  4M77 G;  1YI2 T;  2XKO C;  4XTY A;  2RHU A;  4M78 D;  1WQ7 A;  3FJP A;  2JNG A;  3QG1 A;  1VQP A;  4QVZ A;  5GAO n;  4ZTJ A;  2P0P A;  4IUR A;  5LJ5 d;  5CVI A;  3VUZ A;  5GMK j;  4HT8 A;  2RHX A;  1VQ5 T;  1PSF A;  3FLG A;  2DTO A;  2ZZD A;  4RMO A;  3CC2 A;  4IKF A;  4V2S A;  3ME9 A;  2Y4X A;  2RO0 A;  4DA4 A;  2QEX T;  2LTO A;  2G3R A;  4JS5 A;  3QPH A;  2RJE A;  1D3B B;  2P0Q A;  2KDS A;  3BW1 A;  3UWN A;  2Y4Y A;  2RK2 A;  5CKE A;  4C8Q C;  5GAN 6;  3JB9 J;  4ME7 A;  2KK4 A;  4M7D E;  1NPR A;  2FHD A;  1H3Z A;  2ZPG B;  4XU3 A;  3JCM W;  4M78 A;  1YJW T;  5DLQ E;  5CR2 A;  2D0Q B;  1VQ4 T;  4M7D G;  4XK8 E;  4MDW A;  5GAN 5;  5GAM d;  3X28 B;  1KD1 U;  1VQ8 T;  2A3L A;  4A54 A;  2RA2 A;  3J81 E;  2RI3 A;  3QZ5 B;  3HRT A;  2GCX A;  1G3T A;  4A4E A;  4C5H A;  1JJ2 S;  1OZ2 A;  1VQ9 A;  1VQ7 A;  4M78 B;  4II1 A;  4J7I A;  3PT9 A;  4A4G A;  4C8Q E;  5C0M A;  2LDM A;  5LJ5 e;  3GP8 A;  3G4S T;  4FT4 A;  5AYF A;  2WSE E;  1YBY A;  3A8G B;  4E7I A;  1YI2 A;  2L5Q A;  5GAN 2;  3OYH A;  5J3B A;  1M4Z A;  4C8Q G;  4N4I A;  4ZN3 A;  3JB9 H;  2DIQ A;  3M53 A;  2YHT A;  4J83 A;  2LCC A;  4IUQ A;  1VQ5 A;  3VJP A;  3M57 A;  2L89 A;  2FVU A;  2WAC A;  4NS5 A;  3OS2 A;  3RER A;  2QEX A;  4ZN1 A;  3QXE B;  1VIF A;  2E1H A;  1KD1 C;  1N9S A;  4J6Y A;  4OP0 A;  2HAX A;  3S3M A;  2YLC A;  5CK9 A;  4M7A D;  2EQM A;  3L1A A;  2DK3 A;  5GAM e;  2R57 A;  2X35 A;  3CME T;  1QW1 A;  3C4S A;  5FLX E;  4XU0 A;  2EKO A;  3M4Y A;  2VUB A;  3CBM A;  4HA8 A;  5GMK l;  2DAQ A;  3CXC S;  2FL7 A;  1YJW A;  3P8H A;  3MHX A;  4KUD K;  3P8B B;  3URG A;  2EQU A;  3HPW A;  3CBO A;  5LJ3 g;  1YIJ T;  2CZ7 B;  1VQ8 A;  3INZ A;  4BDZ A;  2QQA A;  4EDU A;  4QVD A;  5GAN g;  1WJS A;  3I56 T;  3LGF A;  4O6J A;  1UGQ B;  3OW2 S;  2CS7 A;  2E64 A;  3JCM h;  4M7A A;  4XAX B;  2MF2 A;  2BUD A;  3BDU A;  3MEU A;  2R5M A;  4M75 D;  3TEE A;  5FU6 C;  3G4S A;  3KXT A;  2M1H A;  2ZPE B;  3E1S A;  4A53 A;  4PJO D;  2E41 A;  1Y7X A;  2LX9 A;  4PLI A;  2EJF A;  3CCV T;  1N8R C;  2E5Q A;  4M7A B;  4KUI A;  2EIF A;  1YCY A;  2O4X A;  5CO7 A;  4C5E A;  1WNL A;  2EJ9 A;  2GFU A;  4EMK C;  4QQG A;  1OI1 A;  4M77 D;  2Y90 A;  4BY6 C;  3CCM T;  3CCS T;  4OB2 B;  3LYI A;  4OF1 A;  3G6E A;  4B9W A;  4J6X A;  3FB9 A;  5GMK e;  4XTX A;  4B9X A;  2EJG A;  2LCL A;  2O4X B;  4M75 A;  5IAY A;  1K73 U;  3CCQ T;  3MET A;  3OY9 A;  2JOY A;  3CME A;  2B8A A;  3JSC A;  4Y28 E;  2LC4 A;  3CPW A;  3RUX A;  2QI2 A;  1UB4 A;  3LW5 E;  2PVO B;  3HRS A;  4C92 F;  4IUU A;  2VYT A;  5A0D A;  4IUV A;  4LDV A;  1MHN A;  4M75 B;  1YIJ A;  5FRM A;  3CCU T;  3GIB A;  5CKF A;  4HKE A;  4M77 A;  4JRI A;  5FU7 B;  4BY6 B;  1Q7Y U;  3CC7 T;  4PJO B;  1FX7 A;  1Y96 A;  3I56 A;  2RK1 A;  3RIR A;  4LD6 A;  2XG8 D;  4CRI A;  4PJO E;  1XOV A;  2DJZ A;  2PQW A;  1Q82 U;  1K9M U;  1WPY A;  3SFM A;  2K5I A;  1UGR B;  2XI9 A;  3OBY A;  2EYQ A;  4P5N A;  4PKC C;  3X24 B;  1AHJ B;  4M7D D;  3DLM A;  2L8D A;  3OYA A;  1BI2 A;  2RI5 A;  1VQN T;  4HT9 A;  5L8R E;  4FIB A;  4M77 B;  1BYM A;  2XIC A;  4M77 E;  3V7R A;  1Y96 B;  1OYX A;  1XTD A;  1M1F A;  3CCV A;  1K73 C;  3FIF A;  2FYK A;  3M54 A;  5J26 A;  4BAC A;  3HRU A;  4GLK A;  5FRO A;  3SWN C;  4C92 C;  3L2U A;  1LOJ A;  2JZ2 A;  1QVG A;  1JB0 E;  1WQW A;  1ZQ1 A;  3RES A;  3GPL A;  4JRQ A;  3OYM A;  4ZGD B;  1QP2 A;  3CCS A;  3CCM A;  1O75 A;  2RJC A;  4JLI A;  1D3B A;  3TRE A;  2VC8 A;  4BD3 A;  3EFS A;  3PMT A;  3GNG A;  4C8Q D;  4M7D A;  4QVC A;  4WF2 A;  3FC3 A;  1YHQ T;  1Q7Y C;  1X75 C;  4MZP A;  4E7H A;  3JCM b;  3CCQ A;  4J6W A;  1W4S A;  1Q82 C;  1K9M C;  2DTI A;  1I8F A;  4JRK A;  4XTW A;  3TU4 K;  5I21 A;  4C0D B;  3OMG A;  3PMI A;  2QQS A;  2E10 A;  1KC8 U;  4M7D B;  1RI0 A;  3HFN A;  3OMC A;  5LJ3 h;  4C92 E;  1W2B S;  2BIV A;  2P4T A;  5I2M A;  3CCU A;  2C06 A;  2K5L A;  1TH7 A;  3RKW A;  5GAN h;  1IRE B;  4QQD A;  1BIA A;  4C8Q A;  2R5A A;  1Y07 A;  5CKD A;  3QSU A;  2LT4 A;  2O01 E;  1WGS A;  1QVP A;  3MEV A;  3QO3 A;  4C92 G;  4D6W A;  1RL2 A;  5C6S A;  2RI2 A;  2ZPF B;  3JCM J;  3HFO A;  3JCM X;  1VQN A;  5HKC A;  2EFI A;  4XTV A;  5HY6 A;  4OVA A;  1JJ2 A;  3CCL T;  1NPP A;  4C8Q B;  3QZ9 B;  5LL6 S;  3OS5 A;  2ZPH B;  1K8A U;  3L2Q A;  4C0G A;  4N4G A;  3QYH B;  2GFA A;  1VQ6 T;  3OSS C;  3M55 A;  3GLX A;  3OYK A;  1KC8 C;  4ATO A;  4OB0 B;  4IUT A;  3NFC A;  1GXI E;  4NOY A;  2DVE A;  2KVQ G;  4QQ6 A;  3OS1 A;  3VV0 A;  4LDY A;  2DTH A;  2XU8 A;  2OTL T;  1YHQ A;  1IZ6 A;  3L2Z A;  2DZC A;  1B34 A;  4ZGE B;  3CPF A;  4TVR A;  3OYC A;  2XD0 A;  4DOV A;  2DEQ A;  4F7U F;  1UEB A;  4LDW A;  4FT2 A;  3ZFJ A;  1BIB A;  1U1T A;  2YRV A;  4N0A C;  3LWI A;  3HSB A;  5D6X A;  1KHI A;  2IVW A;  1B34 B;  2F69 A;  2QTX A;  5EG2 A;  4A4F A;  5DLO A;  4BE2 A;  1YJN T;  4RCC A;  1G5V A;  3OQ5 A;  3JRZ A;  3NTI A;  3ZEH A;  3CXC A;  4MZT A;  4R56 A;  3JCM V;  3QII A;  3CCJ T;  1VQ4 A;  1EIF A;  2BKD N;  4HCZ A;  3DLL A;  2DXT A;  1VIE A;  5LJ5 g;  3NTK A;  1JBM A;  5D6Y A;  1ZHI A;  2CKK A;  3OB9 A;  2E12 A;  4GY5 A;  2F5K A;  2LNV A;  2MI6 A;  5LJ3 f;  4Z02 A;  5LJ5 f;  3JAM E;  2XDD A;  3OYE A;  1U8R A;  3RMS A;  1KQS S;  1G3W A;  3UPU A;  3BFM A;  5GAN f;  3OW2 A;  2V8K A;  4J7F A;  4BE0 A;  2ZCF B;  3G7Z A;  2JTF A;  1VQ6 A;  4XU2 A;  1M90 U;  1P92 A;  2DD4 A;  2KSS A;  2QXF A;  4BUG A;  3JB9 F;  4MMK A;  5CIU A;  1Q86 U;  1WJQ A;  3MP8 A;  1G3Y A;  2GF7 A;  4C0Z A;  3OYB A;  3M4G A;  2K4Y A;  4PNO A;  2AHJ B;  3JCM d;  4KBM B;  4E7J A;  2OTL A;  4A4K A;  3CC4 T;  2RHZ A;  4PLL A;  5GAO q;  3A5Z B;  4XTU A;  3A8L B;  5GAM g;  2QQR A;  1BKB A;  2LRQ A;  4XU1 A;  5D6W A;  3J80 E;  4JS4 A;  1S72 T;  3JCM P;  1SSF A;  1M5Q 1;  3CEY A;  2E65 A;  4EPC A;  5HK0 A;  2R58 A;  4OMF B;  1UGS B;  1VUB A;  4F7U E;  3P8D A;  2JUF A;  3ZBD A;  1I4K 1;  5FU6 B;  4EMK A;  2JN0 A;  5GAN 4;  3EFR A;  3M5A A;  2FB7 A;  2PVG B;  1YJN A;  2K5F A;  3QJ6 A;  5LJ3 j;  2CZ6 B;  3PGG A;  4A4H A;  4PJO A;  4BE1 A;  1U1S A;  2V8I A;  2M16 A;  3WVD B;  3M58 A;  2YLB A;  3OYF A;  3LX7 A;  4F7U G;  1M90 C;  5GAN j;  3OYY A;  1N6A A;  1VQM T;  4OGE A;  1Q86 C;  4EMK B;  1OZ3 A;  4N4H A;  2QA4 T;  3RKX A;  2RJF A;  1QVF A;  4X9C A;  4KUL A;  4DOW A;  2VXE A;  4FU6 A;  4OB3 B;  3V7C A;  4OGC A;  3JCM e;  4C92 D;  4RG8 A;  2LQ8 A;  1YIT T;  5GAO l;  4L5G A;  5CQX A;  2VXF A;  5IN1 A;  3WXM B;  4RCB A;  1Y71 A;  2MWO A;  3X25 B;  1X6O A;  3Q1J A;  3VKI A;  2HQX A;  4VUB A;  3L42 A;  2D9T A;  5GAO r;  2D6F A;  3PFS A;  4C0F A;  1VQL T;  3X26 B;  4MZM A;  3MP6 A;  3CC4 A;  2E6N A;  2EAY A;  3EAE A;  4ZTF A;  2XID A;  3A8H B;  1S72 A;  3JB9 G;  3AHU A;  2M9U A;  2HBP A;  2HQE A;  3H8Z A;  1H64 1;  4BI3 A;  1WJR A;  2KAF A;  4C5I A;  4EMG A;  3H6Z A;  1G3S A;  4C92 A;  3SWN A;  2X4W A;  3O8V A;  3OA6 A;  3G71 T;  3LLR A;  2OTJ T;  2A7Y A;  2F5T X;  2WSC E;  1YJ9 T;  2JVV A;  2M0O A;  3NTH A;  3A8M B;  5KCO A;  1M1K U;  3N5B B;  5A2Q E;  5KE2 A;  4M78 F;  1I5L A;  3VU3 C;  4C92 B;  3SWN B;  1VQM A;  3DB3 A;  1W2B A;  3MP1 A;  2DZ9 A;  5LJ5 h;  2QA4 A;  3E19 A;  1NZ9 A;  3V8L A;  4BB7 A;  5M9O A;  3OSV A;  3CC7 A;  3HL8 A;  3I55 T;  3OYI A;  2CGH A;  4BDY A;  4HCB A;  5J39 A;  1LJO A;  1M8V A;  4RG2 A;  2VV5 A;  4IUP A;  1YIT A;  5LJ3 d;  2PVD B;  4FSX A;  5GAO m;  5DY9 A;  2H3J A;  3GF5 A;  3SB2 A;  2WSF E;  3OS0 A;  3VYH B;  5GAN d;  5DM7 R;  1KQ1 A;  3PNW C;  4RKU E;  2IG0 A;  3QJY A;  3DKM A;  1VQL A;  1XNI A;  4JUV A;  1LNX A;  4PL6 A;  3VYG A;  3WVE B;  1UGP B;  2DXC A;  4M78 C;  1KG1 A;  4J5Y A;  2DXB A;  4ZGJ B;  4X9D A;  5GAM h;  1M1K C;  4FM4 B;  1FWZ A;  5GAN 7;  4HCC A;  1VQK T;  1M1G A;  1NJI U;  1FXX A;  2DPP B;  3CMA T;  3G71 A;  3T9N A;  5A0G A;  2OTJ A;  3L2W A;  4MDX A;  2X4J A;  4LDX A;  1YJ9 A;  2KMT A;  4LDU A;  2PUO B;  2HD0 A;  3M56 A;  4R55 A;  1KQ2 A;  3LH0 A;  3R6O A;  1M9S A;  4M78 E;  4JRP A;  3OYL A;  5LJ3 e;  4FL6 A;  2X4X A;  4NL3 A;  3RMQ A;  4XQ3 A;  4UC4 A;  4Q5W A;  2RJD A;  2E70 A;  1K8A C;  2I2L A;  3UDC A;  5GAN e;  5CCA A;  3I55 A;  3V8K A;  2DO3 A;  3JB9 I;  4N0A A;  3DB4 A;  1BI3 A;  2RM4 A;  4M78 G;  3J7A F;  4M7A F;  2K2V A;  2K3X A;  3F70 A;  3LWH A;  3PTA A;  1VQO T;  3QBY A;  2EQJ A;  4XTZ A;  5KH6 A;  2LT1 A;  3QDR B;  4JJN K;  1NJI C;  5FRN A;  1JRI A;  1HXD A;  3CCL A;  1KQS A;  1BI0 A;  5KCH A;  1N9R A;  3G6E T;  2VGM A;  3TCJ A;  5GMK h;  4O5V A;  3V7S A;  2MWP A;  5GAN 8;  3FDR A;  4E7K A;  1N8R U;  3KUF A;  2ZPB B;  2CZ0 B;  5IT9 E;  4C5G A;  2DXU A;  2DIG A;  1VQK A;  3BY7 A;  3KBG A;  4F7U A;  3S3O A;  1HK9 A;  3JCM c;  5A0L A;  3CMA A;  4JDS A;  2PU9 B;  3C12 A;  3RKY A;  4BI8 B;  5HK3 A;  4DQ2 A;  4M7A C;  4M75 F;  3CCR T;  2K3Y A;  2DD5 A;  3JB9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...