3JB9D

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
b'SLCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSHIRFLIVPDMLRNAPMFKVGPGRSVPLPTRGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
molecule tags Rna binding protein/rna
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 13
structure length 96
sequence length 96
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9D00
3JCMg 4XTVA 4XU3A 4RCCA 4C8QC 4J6XA 5GMKe 5GAMg 5GAN4 5GAOl 1Y96B 4M7DE 3JCMW 3JCMJ 1WQWA 5GMKh 1BIBA 2DZ9A 3BY7A 3JCMc 1I4K1 5GANg 4XTUA 4M78C 4JRIA 4C92B 5GAN7 3QSUA 4M7AD 3BFMA 5GAMf 5LJ5g 2VXEA 1HK9A 1KQ2A 1LJOA 4C92D 1I5LA 4EMHA 4F7UA 1KQ1A 5LJ5e 5GAOp 4PJOA 2E10A 1HXDA 2E65A 1M8VA 5LJ5h 3GIBA 4C92E 4F7UB 4M7DD 4PJOB 4M77A 4M75D 1U1SA 4M78E 3RESA 4M78A 1I81A 5GANh 5GAOm 1D3BB 4OP0A 5GAN6 4M77B 2DTOA 4PJOG 3SWNA 1JRIA 4F7UG 3JCMf 5GMKi 2E1HA 4A54A 5GAMd 4M77C 4M7AC 4M7DF 4V2SA 4M78G 3EFRA 3JB9I 4JUVA 3SWNB 4HA8A 3L2ZA 2Y90A 1WPYA 4QVDA 5GAMj 3HFNA 1LOJA 2RM4A 2DXUA 3FB9A 4Y91A 3JCMb 5GANj 1B34A 1N9SA 4C8QE 5LJ5d 5GAOr 3JCMQ 2K57A 4X9CA 4M7DC 4X9DA 1U1TA 4M7AE 4N0AA 3JB9D 1B34B 1MGQA 2DKGA 4M75C 1H641 3JB9J 4XQ3A 4J6YA 3EFSA 4C8QD 2VC8A 2EJGA 3SB2A 4NOYA 3V7RA 4QVCA 1JBMA 3FJPA 2EJ9A 4J6WA 4C8QB 3JCMd 1LNXA 4XTXA 2E41A 2YLCA 4JLIA 3RUXA 5GAOn 3BW1A 4XU2A 4HT9A 3M4GA 1I8FA 2QTXA 2JN0A 3JCMh 3RKYA 3JCMP 4J5YA 4F7UE 4MMKA 3V8KA 4PJOE 1TH7A 2DTIA 4JRKA 4NL2A 4M78B 4C92C 5GAN2 5LJ3h 2CGHA 5GAN3 3HSBA 1N9RA 3QUIA 5GANf 2EAYA 4PNOA 3QO3A 4EMKB 5GAOq 4HT8A 3JB9H 4DQ2A 5LJ5f 3V8JA 3RIRA 4EMKC 3RERA 3AHUA 4WF2A 1M5Q1 5LJ3j 4C8QF 4EMKA 4NL3A 1YCYA 4M78D 4XU0A 2DJZA 2RD1A 2DVEA 4XTYA 2RB6A 2EWNA 4PJOC 4M77G 3HFOA 4RCBA 5LJ3d 5GMKj 5GMKl 5GAN8 3JCMV 2DZCA 2FB7A 2DTHA 3INZA 5GANe 5GMKm 5LJ3g 4XU1A 4PJOD 2YLBA 4M7AB 3V7CA 4C92A 2RA2A 5GAMe 3L1AA 2I2LA 4A53A 4M7AF 2ZGWA 4C92G 1WNLA 5GAN5 4M75E 3SWNC 2YHTA 4XTWA 3V7SA 5GAMh 5GANd 4M7AA 4M75F 4M7DG 2FYKA 1D3BA 4XTZA 4PJOF 4F7UF 3JCMe 4C8QA 4M75G 2EJFA 5LJ3e 2HNIA 3JB9F 1WQ7A 3V8LA 4M75A 4M77D 4M7AG 4M7DA 3JCMX 5LJ3f 3JB9G 3PGGA 3RKXA 3QHSA 4N0AC 4M75B 5CAIA 4MMLA 3RKWA 5DY9A 4EMGA 4M7DB 2DEQA 4M77E 4C92F 5I21A 4M77F 2VXFA 2E64A 5LJ5j 1BIAA 4M78F 2DXTA 3VU3C 1X01A 1Y96A 3BDUA 4C8QG 3FIFA
chains in the Genus database with same CATH superfamily
1D1AA 2HAXA 1TUGB 2E5QA 4L5GA 1HYOA 1R0BG 1YI2T 4A4HA 1VQOT 3CCRA 1MNEA 3OW2A 2BKDN 3I56Q 1E6GA 1X2QA 4JS4A 1N27A 2MI6A 2X3XD 2K4YA 2P4TA 3I5RA 2VWFA 2XMFA 2H8HA 5HY6A 4PJOG 2O2OA 4OMMA 4M77C 5GJWB 5DM7R 4Q5WA 2DA9A 1K8AC 2D0NA 1ZSZC 4DBFA 4A4KA 1U1TA 1QMCA 2FZGB 1SRMA 3NTIA 2A37A 3CBPA 2JJ9A 2AZVA 3H8ZA 2ENMA 3M9QA 1GBRA 2E41A 2F1LA 4FYXB 4FL6A 3A8OB 2FG0A 1KIKA 4LD6A 2CS7A 5J39A 1YP5A 3EGXA 4DQ2A 4LDXA 3RERA 3RIRA 4EMKC 1IHVA 4NL3A 3ULRB 5IH2A 2MIOA 1G5VA 1S1NA 2QG9B 2DM1A 4ESRA 5KH6A 2DZCA 3CEYA 5FU7C 1Y71A 3RDVA 4E7IA 2QTVA 3L1AA 1M4ZA 3M55A 2OI3A 1GCQA 3M59A 4QVZA 3OS1A 4B9WA 4Z02A 3MPUB 2RI5A 2BIVA 4RG8A 1PC0A 1QWFA 1Z9QA 2V1QA 4QKUA 1C0MA 1KQSP 2VXFA 4FYVB 4J9HA 5IAYA 2PVGB 2B86A 2DK3A 2PVOB 4C8QG 4RG2A 3FIFA 5EC7A 3CCST 2DJQA 3VS5A 2PVDB 3SEMA 4RTTA 2E5KA 1Q86R 5CVIA 1VUBA 3H0FA 1VQ9T 2H3EB 2LX9A 1D0XA 1XTDA 1AVZC 3VS1A 2E4HA 1M9SA 4C92E 2DD5A 3CD6A 2PNIA 1YNZA 2LCSA 2NUTB 3M0UA 2LQ8A 1U3OA 4E7JA 4M7AC 1WFWA 1WHHA 1AWWA 3PT9A 2VV5A 2HL3A 1SSHA 1ABOA 4ORZA 4Y91A 2KQWA 3HP9A 3SD4A 5LJ5d 5GAOr 3SHWA 1PWTA 3G71T 1D0ZA 4N0AA 4M75C 5A2QE 1Q7YC 1H641 2YRCA 5CKHA 1VQ8A 2D8HA 4KUDK 3VS3A 2Z0WA 1WA7A 2K5IA 3P8HA 4C8QB 1IO6A 3JCMd 4J7IA 2LJ0A 4C92C 1PRLC 3HSBA 3LGFA 5LJ3h 4AG1C 2F5TX 1SF9A 2L0AA 2PU9B 1M2VA 4QQDA 4RTVA 2J06A 3G7ZA 3WVDB 1RACB 1QW1A 2RD1A 2DVEA 4A4FA 2F2XA 2XU8A 3GNFB 4PJOD 1Q7YU 2RJFA 3V7CA 2EYYA 1Q86C 4XAXB 1BCMA 5GANd 2CT3A 4E7LA 1VQ4T 2RI3A 2DL8A 4CI0C 5HCKA 1CKAA 3RKXA 4IUPA 3KXTA 1AZGB 2Y4XA 1M1KC 4ZGDB 3CCVQ 1QVFP 1YHQA 1M1KR 3EG3A 1WQWA 3MP6A 3CXCA 3P8DA 2CZ1B 3ZFJA 2O01E 4M78C 5GANg 3L2VA 4Y28E 4JJDA 3PIOA 2QGGA 2V8JA 4JDSA 1SHFA 3VJPA 2EQKA 2AHJB 2RQTA 1VQ9A 2BZ8A 4C5HA 4AFUC 1QCOA 5GAMd 2NUTA 3JB9I 4D8DA 2DFUA 3H9NA 2LCLA 2Y90A 1ZUYA 2PZ1A 1VQ5Q 1NYGA 2YXYA 4JRQA 2P84A 2OTLT 2XG8D 1GRIA 3RBBB 4ANJA 1DJ7B 2YLCA 4HVUA 4HT9A 1S72Q 4PJOE 3ME9A 3L2RA 1QVGP 2MCNA 1K0SA 3QO3A 1QQJA 1UHCA 2ZAEA 4FW1A 4BE1A 3AHUA 2JZ2A 5FRNA 1M5Q1 1ZBXA 4EMKA 3OYBA 4M77G 3I55T 5GMKm 2DTHA 1VQPQ 6AT1B 5KE3A 4N4GA 4KULA 2AKKA 3CCMT 4QW2A 3NPFA 3CC2T 3TREA 1FMVA 4XTZA 3CC7Q 5FRMA 1P92A 2KVQG 4JJBA 5GAN3 1VQMA 1JEGA 4L6V5 5D7UA 3NMZC 1BI3A 3VU3C 2DL4A 3QKJA 4C0DB 3KUFA 5FW9A 5GAN4 5GAOl 3VYGA 8ATCB 1BIBA 4O6JA 4Z88A 1WHLA 1W70A 3PTAA 4JRIA 1SHGA 2VGMA 2M51A 1KQ2A 4N4HA 1VQLQ 1BI2A 4ZGJB 5FU6C 2J6FA 1K0XA 1BI0A 3S3MA 2CSQA 2CP7A 4K11A 4B6MA 3SWNA 1HJDA 1GXIE 3UWNA 3SFMA 1PHTA 4BUGA 4QVDA 1LOJA 1NYFA 2RHZA 5KYXA 1NJIC 4RUGA 3SB2A 4HCZA 1VIEA 2A7YA 2KXCA 4GBQA 3OS0A 5GAOn 1RLPC 1MNDA 1NLPC 2V1RA 2KY9A 3HPWA 2L89A 5LL6S 2FZKB 2XDPA 5KYWA 2E70A 2RJCA 3LGLA 4M78D 3OBWA 4XU0A 2KNBB 3URGA 1NZ9A 2RB6A 2VKNA 5L8RE 2LJ3A 1VOMA 3NTHA 1PKSA 4DBRA 1M90U 1SRLA 1UUEA 1H3ZA 1WJRA 4C92G 4M75E 2KMTA 2QEXQ 2FYKA 4F7UF 2G6FX 1ARKA 1JJ2S 3LLRA 2F2WA 2F5KA 1AD5A 4OMQA 3P8BB 2RPNA 4IKFA 1RAEB 4R56A 1GCPA 5LJ3f 3WVEB 1Q82C 2DF6A 1XJWB 3UF4A 2RJEA 2DRKA 1YITT 3OYEA 2DL3A 3FRNA 4C5EA 1NJIR 2K5LA 3A8LB 2QAZA 3C95A 4LD9K 2XD0A 4RCCA 1RI9A 5EG2A 4A4GA 1Y7XA 1YJNT 3JAME 2L2PA 5FWCA 1VQ6Q 3BY7A 3WXMB 2VUBA 1YFNA 3G6ET 3QIIA 3UPUA 4LDVA 1RAHB 3CXCP 1WXUA 3DLMA 3CC7T 1V76A 2LQNA 4PJOA 1HXDA 2E3IA 4PFPA 5D6XA 2A08A 2D8JA 1JJ2A 2DIQA 1TSFA 3QZ9B 4IIMA 5C6SA 3OQ5A 1VQMT 2ED0A 4PJLA 3CCUQ 2EYWA 3TQ7P 2CREA 2EYQA 3MEAA 2FPEA 5AYFA 1NJIU 3JCMb 1WHMA 1YJWA 2R58A 1B34A 2QQRA 1YIJA 3JB9D 2D9TA 1UGVA 1KHCA 4XQ3A 3I55A 4J9EA 3FLGA 2HSEB 4HKEA 2EFIA 3I35A 4TVRA 4XTXA 1IZ6A 3GLXA 5CKBA 2LZ6B 2KBTA 4BY6C 2DO3A 2CGHA 2FL7A 4J9IA 3X28B 2EQMA 2GQIA 2JW4A 4ZTJA 4ZNXA 1VQOQ 5ECAA 2MWOA 9ATCB 1NLOC 2DJZA 3UDCA 2QQBA 2QDYB 3VS7A 3VKIA 2BTTA 1KFZA 2VVKA 4XU1A 2YLBA 4C92A 1YI2Q 3CPFA 1TS9A 4BI8B 4LNPA 3HTRA 3VS0A 3SDZA 2HNIA 1Z9ZA 4RKUE 1OU8A 3ZEHA 1M3CA 1KG1A 4OMLA 3UA7A 4N0AC 3TSZA 1PSEA 5DY9A 1PCXA 4M77E 4M77F 1LPLA 2FEIA 3H6ZA 3CCLA 2KRMA 1Y96B 3JCMW 3OYAA 1QCFA 3PE0A 3BFMA 1KC8C 5I22A 4AFZC 1T0JA 4ELZC 1KQ1A 1AEYA 5DLOA 4KRTA 2NLUA 2RHXA 2DMOA 4M7DD 1V1CA 2YUNA 5GAOm 3OYJA 3MEVA 3OBYA 3CMEA 2A36A 1PM3A 3F70A 2HQHA 2O4XB 2KXDA 4V2SA 3SWNB 3CCQQ 2A0FB 5GANj 1M1FA 4C8QE 3JCMQ 2K7AA 4VUBA 1G2BA 3CCJA 1LVKA 1B34B 1MGQA 3DB3A 3EG9A 3META 4C5IA 3QXEB 3OYCA 2K3BA 3FJPA 1MUZA 3ZL7C 4F14A 3CCEA 4EIKA 3A5ZB 1M1GA 3CPWS 3CCSQ 1BYMA 1UFFA 2COWA 2GFUA 1RAGB 1U06A 5LJ3j 2ROTA 3OYMA 3G4SQ 3OA6A 2M16A 4FT4A 2JM8A 2RHUA 2M0YA 3C94A 2DILA 1YHQQ 5CO7A 3JCMe 4ZTFA 4ZN1A 2EJFA 2MF2A 2IG0A 1KQSS 5KYYB 4UC4A 2GQVA 1OX8A 1SKUB 2JT4A 1BI1A 2NWMA 1ZSZB 4KH1B 3UA6A 2AT1B 4PLLA 3CD6T 1BIAA 1GFDA 2DXTA 2LX7A 1WHGA 1X01A 4C5GA 1YHQT 1UB4A 3BDUA 3MEUA 2XK0A 4OMPA 1VQ7T 2CZ0B 4JJNK 1UECA 2LC4A 3EGDB 5GAMf 3CCSA 1W4SA 3RMSA 4J9FA 4IUVA 3MCAB 1VQLA 4DA4A 2CP0A 1Q81C 4HCKA 4LUEA 1GBQA 3H41A 1C6VX 1M3BA 1WLPB 2JMAA 4BE0A 4R0KA 4KGXB 2QQSA 4F7UG 5J26A 3TU4K 2ECZA 3TCJA 3QDRB 1BU1A 4HA8A 1WPYA 1XNIA 1D09B 2DXCA 1QLYA 4DEYA 4E7SA 4X9CA 4M7DC 3A8MB 2LJ1A 1MMAA 3KBGA 1UE9A 3CMET 2ZPFB 3EHRA 3CCEQ 4PLIA 2EQJA 1I8FA 2QTXA 1NBEB 3QJYA 3QYGB 1OU9A 2P0QA 4AT1B 4J9CA 3QUIA 4JZ3A 3MO8A 3OYDA 1KD1U 3OYLA 4PKCC 1QVFS 2CP3A 2RQVA 2HCKA 2RJDA 4IIOA 2D1XA 4C8QF 4E7KA 1YCYA 4PFZA 1RL2A 4XTYA 4X34A 3VS6A 2YDLA 3GOXA 3ASKA 2K6DA 4OF1A 2KK4A 1M30A 1VYUA 4CC2A 1X75C 2ZGWA 2DETA 3OY9A 3EG1A 2DL7A 4RTYA 2WSFE 3TVTA 1RUWA 3QZ5B 4MMLA 5FWBA 1Q86U 3E9FA 2FRWA 1X2KA 3QG1A 3CD6Q 1KD1R 2OTLQ 3JCMg 4C8QC 4O5VA 4J6XA 3U23A 2LVMA 3S3NA 3QSUA 4C92B 1S72T 2IPOB 5D6YA 3NGPA 5LJ5g 5CIUA 2EIFA 3E19A 1I5LA 3PNWC 2YUQA 3S6WA 3CCQT 2FVUA 4PJNA 2E65A 2EQIA 3A98A 4WTOB 5DLQE 4F7UB 2KRSA 1D3BB 2OAWA 2HSPA 4RTXA 1X6OA 2EVRA 4JUVA 5M9OA 3R6OA 3CCMQ 1WI7A 2W10A 1G3TA 1PG5B 3OYHA 4LXCA 1RLQC 3L42A 1UHFA 2DE0X 2R5MA 2MYSA 4LE9A 4RTZA 2VC8A 2HL5C 4NOYA 4DOVA 2ZPEB 2DEUA 3KFVA 4XU2A 4CC3A 1I0CA 2X4XA 1I07A 1EZZB 2ZPBB 2DD4A 4PNOA 3REBB 2OTJT 5GAOq 4HT8A 2BZXA 4WF2A 4F04B 2LCCA 2GFAA 4PJOC 2KR3A 5LJ3d 3EHQA 1YJNA 3FDRA 5KYUA 2K3YA 1OV3A 2RA2A 5KE2A 4M7AF 1X43A 1VQ5A 1OX9A 2C0TA 1NEBA 3CCET 2LRQA 1EFNA 5HKCA 2DVJA 3PGGA 4M75B 3RKWA 3CCVA 4JJCA 3OW2S 2KYMA 2NYSA 3ER0A 1FWZA 4RTWA 1CKBA 1T0HA 2BE9B 2FO0A 5GAMg 1M8MA 1WGSA 2QASA 5I2MA 2RMOA 2VASA 5L23A 2HKNA 2KAFA 2PQWA 1VQKQ 4XTUA 4M7AD 2KRNA 4J8OA 5A0DA 3C12A 3NHNA 4JRPA 2QI2A 2EBPA 4EMHA 2L8DA 1NM7A 2MAMA 4FYYB 1D1CA 1OOTA 4XK8E 4MDWA 4X1VA 1U1SA 5GANh 2CP2A 1T3LA 2P4RA 3TSWA 4M77B 1JRIA 4BD3A 2WACA 1NEGA 2V8IA 2HBPA 2PUKB 3H0HA 1ABQA 1QKWA 2X3WD 2BZYA 3CC4A 3THKA 1U5SA 3M54A 4ELYC 3CMAA 1H8KA 2JNGA 3CCLQ 1QP2A 1FYNA 1ZSZA 4KH0B 3FC3A 1YJ9Q 2ATCB 1E7OA 4JLIA 1K8AR 3JCMh 3G1JA 1W2BA 4BDZA 2RF0A 5A0GA 2C06A 3HRUA 4F17A 1YITQ 1ZX6A 4EMKB 3M0TA 1VQLT 3MKDA 3N5BB 4CC7A 1VQ8T 3QYHB 3G4ST 1YBYA 1ZA1B 1YJNQ 2CSIA 2OTJA 3A1PA 1JJ2P 4GLKA 4LDYA 4AFSC 1N8RC 2I2LA 1VQ4Q 2SRCA 2LMJA 1VQMQ 1R0CB 5LJ3e 2K2MA 4OB0B 3GP8A 1U8RA 1KC8R 1YWOA 2CDTA 2JS2A 3OMGA 2DYBA 3VS2A 2RI2A 3CC4Q 4E47A 3GPLA 2JUFA 4IUTA 2M1HA 4FW2A 1VQPA 2M0OA 4HCCA 1IB8A 4YTLA 1VQ6T 1EX4A 1G8XA 1MHNA 4FSXA 2MK5A 2KGTA 5GMKh 5GJVB 5KYXB 1Q82U 1K4US 1J3TA 4CRIA 4C92D 2J05A 4OMOA 1K9MU 2LP5A 5LJ5h 3QWXX 5A0LA 1NG2A 1M27C 3JCMf 1K9MC 2HMAA 1UEBA 2JS0A 1H3HA 1M90R 4ZGEB 4ZN3A 3FB9A 1HSQA 2K3XA 1WYXA 2K57A 4OGEA 4QT7A 1SEMA 3EFSA 1GL5A 2EJGA 3V7RA 3X25B 1K73C 2ZCFB 1YJ9A 2DAQA 1Q95G 2H3JA 1LNXA 2JOYA 4E2FB 3EFOA 3CMAT 1M90C 3G6EQ 2O31A 3RMQA 3CQTA 2EGEA 3RKYA 3NTKA 2RH2A 1TH7A 4QQ6A 4NL2A 5GAN2 4ATOA 2YRDA 5GANf 2EGCA 2EAYA 3M53A 1B3QA 2KE9A 2MPXC 1O75A 2GF7A 5IN1A 3Q1JA 2ZPGB 3INZA 5KCOA 1X69A 2QA4T 2QQ9A 3IQLA 4AMCA 3CCLT 2A3LA 3EH1A 4FT2A 5GAMh 1D3BA 4PJOF 4DOWA 4M75G 1OZ3A 2CKKA 4D8KA 1WQ7A 2AKLA 3CCRQ 1T3SA 4KT0E 1TOVA 5IT9E 1R77A 1D0YA 1I1JA 4C92F 2GTJA 3VV0A 4JZ4A 4KBMB 2FPDA 4XTVA 4XU3A 1V29B 4M7DE 3CCUA 3H0IA 1MMNA 3JCMc 1VQOA 4BY6B 1YI2A 3OYNA 2XICA 1KSWA 1UDLA 1MMDA 2DNUA 2SEMA 5GAOp 4N4IA 2E10A 1VQ5T 2CH4A 1CSKA 1G3WA 2DRMA 2ROLA 2RQUA 1VYTA 3RESA 3HHTB 2JM9A 3OB9A 4M78A 3NFCA 2DTOA 1M8VA 2GTOA 2JTEA 1F1BB 5KYUB 2GNCA 4IUUA 2MWPA 5GAMj 2G3RA 1KK7A 1N9SA 3DB4A 2L3QA 2XDDA 1YIJT 4X9DA 4J7FA 2RQWA 3L2WA 2KSSA 3FEOA 3J7AF 4J6YA 3MEWA 2R5AA 2AZSA 2HEQA 3GF5A 1UGPB 2DX1A 2L3SA 1ZSGA 2KROA 4J5YA 4MMKA 2W0ZA 4J83A 1QVGS 1G83A 1VQ7Q 2R57A 2DBMA 3EGUA 3CC7A 1C1AA 3JB9H 2I0NA 2X4JA 3EGXB 3T9NA 2OTJQ 3C4SA 2CH4W 2CUDA 1X6GA 4RCBA 2LTOA 5CKEA 3JCMV 2FB7A 5GANe 2YWWA 2EYXA 4OB2B 1ZUKA 2JXBA 3CCQA 1VQNA 1WXBA 2PTKA 5FLXE 3JV3A 1WHJA 3D7SB 1AT1B 3J80E 5CAIA 2FZCB 3I9QA 2FPFA 5LJ5j 2O4XA 2HKQB 1OPKA 2V8KA 3CCUT 1W6XA 4AFQC 1EIFA 2E1HA 1FMWA 1TXQA 4C0DC 3OW2P 4FSSA 2HQEA 3M57A 2VXEA 2P0PA 4Z89A 1VA7A 3DLLA 4IUQA 1TWBA 3LYIA 2JVVA 3CMEQ 3VYHB 3GIBA 1N8RR 5FU7B 2DBKA 5FU6B 3R6NA 1VQ8Q 4OP0A 4L59A 2L3PA 3QBYA 1XQHA 5GMKi 4M7DF 1UGSB 3PMTA 1IREB 5CQYA 3L2ZA 2LNVA 2RN8A 2EGAA 1H92A 1ZHIA 3X26B 4M7AE 2B8AA 4GY5A 1TG0A 2CYZB 1MV3A 2LNHB 4J6WA 2NUPB 1FMKA 3QWYA 5KYYA 5CR2A 1YJ9T 2XHCA 2V26A 1JXOA 2BE7D 4HXJA 2L3RA 2YUOA 3LW5E 3PFSA 1N8RU 5LJ5f 2E12A 1M1KU 5IHKA 3OSSC 1OEBA 1WXTA 3CBMA 3AT1B 4WCIA 3CCRT 3VRYA 2DL5A 5GAN8 3I5SA 2YRVA 5IHIA 4M7AB 3EGDA 1FXXA 2K79A 3HL8A 3I55Q 3CPWP 4BDYA 3VS4A 4EDUA 1WNLA 2CP6A 3SWNC 2YHTA 4FM4B 3J81E 4PJJA 3VUBA 1NPPA 4C8QA 4BI3A 1JO8A 1ZLMA 1G3YA 1KD1C 3QHSA 2OX7A 4EMGA 1VQ7A 1UJ0A 1IXDA 2RK1A 3X20B 1OULA 3G71Q 2IIMA 3HRSA 1Y96A 2QEXT 4OB1B 1YJWT 5J3BA 2ED1A 5I2SA 2QEXA 3MP1A 3JCMJ 2GCXA 3OS2A 2ABLA 2QYZA 5GAN7 1Q81U 3EFOB 3MHXA 1X27A 4LDUA 1HK9A 1QVPA 1JQQA 2E6NA 1M2OA 2WSEE 1M2VB 1VIFA 2F69A 3A8HB 4PL6A 5C0MA 4A4EA 1UGRB 3QJ6A 2D6FA 1S72A 3EFRA 1Q81R 4D6WA 2OTLA 5CKDA 4B9XA 2LT1A 2CT4A 1RAFB 4DBQA 3EG9B 2FHDA 4OGCA 2P0KA 2LDMA 1AOJA 1VQ9Q 1I5OB 4PJMA 1YN8A 4HCBA 1OZ2A 1G3SA 3CCJT 2NUPA 4F7UE 1OPLA 4M78B 4FIBA 4RTUA 2MOXA 1OYXA 1IRXA 3M4YA 4JPBW 3M0RA 2C0IA 2JTFA 5IXBA 2YSQA 5IHNA 3CCJQ 4JS5A 2RO0A 1NE8A 5GAN5 1WJSA 3EG2A 1K1ZA 2COZA 3V8LA 3CBOA 2YT6A 4M77D 3BE3A 4CC4B 5I11A 2LT4A 2HQXA 1TUCA 2IVWA 2E64A 4OMFB 4M78F 4MZMA 3PVLA 5HK3A 2CZ6B 1ZUUA 1Y07A 3PMIA 4BB7A 1SSFA 1GFCA 4OB3B 1WIEA 1RI0A 4FCYA 3E2UA 2COYA 1I4K1 2ESWA 1PKTA 3M58A 2CZ7B 2KDSA 1K76A 2LQKA 4PJOB 4LUDA 1X6BA 4M75D 2C0OA 4MZTA 5FROA 4J9GA 5CQXA 1JB0E 3E9GA 3LWHA 2XDBA 2XI9A 1B7TA 5CK9A 4Y92A 1RADB 2XIDA 2BUDA 2RM4A 2K2VA 3REAB 2VB6A 4E6RA 4J9BA 2KI7A 5AT1B 3QDFA 2QA4A 2A28A 2AIRB 2X35A 2EKOA 3GNGA 2QXFA 4C8QD 1QVFA 1KHIA 4QVCA 4Z8AA 1QVGA 3UATA 2EJ9A 1PD1A 2DXBA 1Q82R 1ACMB 2MMPA 4II1A 3JCMP 4DBHA 3CC2A 3S3OA 2DTIA 4JRKA 1PD0A 3CCMA 2GGRA 4PFOA 3VUZA 4P5NA 3PVQA 1RAIB 1KJWA 1QCNA 2GBQA 4KUIA 4MDXA 2DIGA 1O9SA 5CCAA 2EWNA 1K73U 2ZZDA 1W2BP 1MMGA 4LN2A 1TUDA 5KCHA 2EYZA 3OMCA 1W1FA 4A53A 2QGFB 4BACA 3A8GB 3V7SA 4M7AA 2HZYA 2OAUA 4M75F 3DKMA 1BK2A 1Y57A 3RR6A 3JCMX 3G4SA 1AWXA 3JB9G 2KYBA 2J7IA 3FJ5A 1QKXA 2DYIA 2WSCE 2Y4YA 2FRYA 4MZPA 4C0FA 3VRZA 3L2UA 1K73R 2M02A 5I21A 4FU6A 5KYWB 2E6ZA 4QQGA 3RNJA 2HDAA 2PUOB 2ZPHB 4R55A 1UGQB 8AT1B 5IXFA 5GMKe 1RAAB 3EH2A 1YITA 3M5AA 2KEAA 2HD0A 2O9SA 2RK2A 1YWPA 2JTMA 1K8AU 4M4ZA 1VQ6A 4F7UA 3EG0A 1ZQ1A 2X4WA 3OSVA 1VQPT 3CMAQ 4EPCA 1BKBA 4M78E 1KQSA 3I56A 5GAN6 1JXMA 2E3HA 1NPRA 4A54A 2RHIA 4M78G 4E7ZA 3LH5A 1VQKA 2CP5A 1PSFA 3LX7A 4C0GA 3O8VA 2DPPB 2QDLA 7AT1B 2DLPA 2VGNA 2QA4Q 3JB9J 2KT1A 1WJQA 2LQWA 1JBMA 2XKOC 2ZPIB 3OS5A 3CPWA 3LWIA 2QK0A 3BW1A 2EW3A 3M4GA 1VQ4A 1UTIA 3V8KA 2EKHA 1N9RA 1VQNQ 4E7HA 2RQRA 3HKSA 2OJ2A 1OI1A 4A63B 3V8JA 1KC8U 1ZA2B 3M56A 3CCVT 1N6AA 1IHWA 2NUZA 1IGQA 3QPHA 1YCSB 1Y0MA 5GMKl 1GCQC 1JU5C 2CUBA 2J6KA 5LJ3g 3OYFA 3MJXA 1VYVA 4RMOA 1VQNT 4M7DG 4PK4A 2KT8A 3TEEA 4AG2C 4M75A 1B07A 4M7DA 4BI4A 1K9AA 3M0QA 4HVWA 2O88A 1A0NB 2RNAA 4JLGA 3L2QA 1YIJQ 3G71A 1TU0B 3M0PA 1FX7A 1WDXA 2J6OA 1ZBJA 4BE2A 1BCOA 1UG1A 1VQKT 1YJWQ 2K9GA 2DZ9A 4KGZB 1R8OB 2VYTA 4OVAA 2O9VA 4GLMA 3I56T 1LJOA 5LJ5e 1OQKA 2L5QA 2K5FA 1PRMC 3OYKA 4M77A 2X9HA 2X51A 2X4YA 3CXCS 1I81A 1TTHB 3JSCA 1D1BA 1IGUA 3OYIA 2AK5A 3G6EA 4J9DA 2HBWA 1QP3A 3UT1A 1N5ZA 3HFNA 3O5ZA 1PNJA 2DXUA 1E6HA 4LDWA 1WX6A 2DKGA 1BBZA 4HVVA 5D6WA 4DEXA 3CC2Q 3OYGA 3BDLA 1RABB 1BB9A 3RUXA 1W2BS 1AHJB 2DERA 3C0CA 2JN0A 3PIPA 1AWJA 3OYYA 3X24B 1AWOA 4ME7A 4IURA 1SG5A 5CKFA 1K9MR 3CC4T 4KGVB 4NS5A 2EQUA 5KYNA 1AZEA 2EPDA 2M9UA 3M0SA 1WHKA 3LH0A 4C0ZA 3E1SA 3HFOA 5GMKj 2JMCA 1QWEA 4FYWB 5GAMe 1HD3A 2YUPA 3JRZA 2QQAA 1WZOA 4XTWA 3ZBDA 2RHYA 2F2VA 3JB9F 4OMNA 4F16A 4M7AG 1SPKA 1M3AA 3GBQA 1UJYA 3MP8A 1LCKA 2D0QB 4M7DB 2DEQA 5HK0A 1Q7YR 1MV0B 3EAEA 3HRTA 1XOVA
chains in the Genus database with same CATH topology
5GAMg 4RCCA 2HAXA 5EG2A 4A4GA 2QEXA 1WGSA 2XD0A 1Y7XA 3MP1A 2E5QA 3JCMJ 5I2MA 4L5GA 1YJNT 3JAME 2GCXA 3BY7A 3OS2A 2KAFA 2PQWA 3WXMB 2VUBA 4A4HA 1VQOT 4XTUA 5GAN7 3QIIA 3G6ET 3CCRA 3MHXA 1Q81U 4M7AD 3UPUA 4LDVA 4J8OA 5A0DA 3OW2A 4LDUA 1HK9A 1QVPA 3C12A 2BKDN 4JRPA 2QI2A 2E6NA 4EMHA 3DLMA 3CC7T 2L8DA 4PJOA 2MAMA 1HXDA 2WSEE 1VIFA 4JS4A 1N27A 4XK8E 5D6XA 4MDWA 2MI6A 2F69A 3A8HB 4PL6A 5C0MA 2K4YA 1JJ2A 1U1SA 2DIQA 5GANh 2P4TA 4A4EA 1UGRB 3QZ9B 5C6SA 3OQ5A 1VQMT 4M77B 5HY6A 4PJOG 1JRIA 3QJ6A 4BD3A 4M77C 2D6FA 2WACA 1S72A 2V8IA 3EFRA 5DM7R 2HBPA 4D6WA 2EYQA 4Q5WA 2OTLA 3MEAA 2PUKB 5CKDA 4B9XA 2LT1A 5AYFA 1NJIU 1K8AC 3JCMb 1YJWA 2R58A 1B34A 2QQRA 4A4KA 1YIJA 3CC4A 1U1TA 2FHDA 3M54A 4OGCA 4ELYC 3JB9D 2P0KA 2D9TA 1YJWT 3CMAA 3NTIA 2LDMA 1KHCA 4XQ3A 3CBPA 3I55A 2JNGA 1QP2A 3H8ZA 3FLGA 4HKEA 3FC3A 2EFIA 3M9QA 4TVRA 2E41A 1OZ2A 4XTXA 4JLIA 4HCBA 1IZ6A 1G3SA 3GLXA 3JCMh 5CKBA 4FL6A 3CCJT 4F7UE 4BDZA 1W2BA 4BY6C 2DO3A 3A8OB 4M78B 5A0GA 4LD6A 2CGHA 2CS7A 2FL7A 3HRUA 4FIBA 3X28B 2EQMA 5J39A 4ZTJA 4EMKB 1OYXA 1VQLT 4DQ2A 4LDXA 3RERA 3RIRA 4EMKC 3M4YA 2MWOA 4NL3A 2JTFA 3N5BB 2DJZA 3UDCA 2QQBA 1VQ8T 2QDYB 1G5VA 3VKIA 3QYHB 1Q7YC 3G4ST 1YBYA 5KH6A 4JS5A 2DZCA 3CEYA 5FU7C 1Y71A 2RO0A 4E7IA 4XU1A 2OTJA 2YLBA 4C92A 4GLKA 4LDYA 1N8RC 3CPFA 1NE8A 3L1AA 2I2LA 1M4ZA 3M55A 4BI8B 5GAN5 1WJSA 3M59A 4QVZA 3OS1A 4B9WA 4Z02A 2RI5A 3SDZA 5LJ3e 2HNIA 4OB0B 3CBOA 4RKUE 2BIVA 3V8LA 3ZEHA 4M77D 4RG8A 3GP8A 1U8RA 1KG1A 3OMGA 4N0AC 2RI2A 1PSEA 5DY9A 2LT4A 2HQXA 4M77E 4E47A 2IVWA 4M77F 2VXFA 2E64A 2JUFA 4IUTA 3GPLA 4OMFB 4M78F 2M1HA 2PVGB 4MZMA 5IAYA 5HK3A 1VQPA 2DK3A 2PVOB 2CZ6B 3H6ZA 4C8QG 3CCLA 1Y07A 4RG2A 3FIFA 2M0OA 4HCCA 3PMIA 4YTLA 4BB7A 1VQ6T 1SSFA 1Y96B 3CCST 1MHNA 4OB3B 4FSXA 3JCMW 3OYAA 1RI0A 5GMKh 2PVDB 1I4K1 5GAN2 1Q82U 3BFMA 2C06A 1KC8C 5CVIA 4CRIA 1VUBA 4C92D 4ELZC 3M58A 1VQ9T 1KQ1A 2CZ7B 2LX9A 2KDSA 1XTDA 5DLOA 1K9MU 5LJ5h 1M9SA 2NLUA 4C92E 2LQKA 4PJOB 2RHXA 4M7DD 2DD5A 4M75D 3CD6A 5GAOm 3OYJA 4MZTA 3MEVA 3OBYA 2LQ8A 5FROA 5A0LA 5CQXA 4E7JA 1JB0E 3CMEA 3E9GA 4M7AC 3LWHA 3F70A 2O4XB 3JCMf 3PT9A 1K9MC 4V2SA 2XDBA 2XI9A 2VV5A 3SWNB 5CK9A 1UEBA 1QVGA 2XIDA 2BUDA 4ZGEB 4ZN3A 2RM4A 3FB9A 4Y91A 2KQWA 2K2VA 1M1FA 5GANj 2K3XA 3HP9A 3SD4A 4C8QE 5LJ5d 4OGEA 2K57A 3JCMQ 5GAOr 1YI2T 4VUBA 3G71T 2QA4A 3CCJA 2X35A 4N0AA 1B34B 1MGQA 2EKOA 2QXFA 1H641 3DB3A 3GNGA 3META 4M75C 4C5IA 3QXEB 3EFSA 4C8QD 1QVFA 1KHIA 2EJGA 4QVCA 3V7RA 5CKHA 3X25B 1K73C 2ZCFB 1VQ8A 3OYCA 2DAQA 3FJPA 1YJ9A 2EJ9A 2K5IA 2H3JA 3P8HA 4C8QB 2DXBA 3JCMd 1LNXA 2JOYA 3CCEA 2MMPA 3CMAT 1M90C 4II1A 4J7IA 3JCMP 3RMQA 3RKYA 3NTKA 2RH2A 3CC2A 1TH7A 2DTIA 3A5ZB 4JRKA 4NL2A 4QQ6A 4C92C 3LGFA 5LJ3h 1M1GA 3CPWS 2F5TX 3CCMA 3HSBA 5GANf 1BYMA 2EAYA 3VUZA 4P5NA 2GFUA 3M53A 2PU9B 4QQDA 1O75A 3G7ZA 4KUIA 3WVDB 4MDXA 2DIGA 1O9SA 5LJ3j 3OYMA 5CCAA 2GF7A 1QW1A 3OA6A 2M16A 2RD1A 2DVEA 4A4FA 2EWNA 4FT4A 1K73U 2XU8A 2ZZDA 3GNFB 5IN1A 2RHUA 3Q1JA 2ZPGB 4PJOD 1Q7YU 3INZA 2RJFA 5KCOA 2QA4T 2QQ9A 3V7CA 3C94A 5KCHA 1Q86C 4XAXB 3OMCA 4A53A 4BACA 3CCLT 2A3LA 4FT2A 3A8GB 3V7SA 4M7AA 5GAMh 5GANd 2OAUA 4M75F 5CO7A 1D3BA 4PJOF 3DKMA 4DOWA 3JCMe 4ZTFA 4ZN1A 4M75G 1OZ3A 2EJFA 2IG0A 2MF2A 4E7LA 1VQ4T 2CKKA 1KQSS 1WQ7A 4UC4A 2GQVA 2RI3A 4CI0C 3JCMX 3G4SA 3JB9G 4KT0E 1BI1A 3RKXA 4IUPA 4C0FA 2WSCE 5IT9E 2Y4YA 4MZPA 3KXTA 3L2UA 4PLLA 2Y4XA 4C92F 3CD6T 5I21A 1M1KC 4FU6A 3VV0A 1BIAA 2E6ZA 2DXTA 4KBMB 4QQGA 4ZGDB 1VQLA 1X01A 4C5GA 2PUOB 2ZPHB 1YHQT 1UB4A 3BDUA 3MEUA 4R55A 1UGQB 2XK0A 4XTVA 4XU3A 5GMKe 1YHQA 1V29B 4M7DE 1YITA 1VQ7T 3CCUA 1WQWA 2CZ0B 3MP6A 3CXCA 4JJNK 3JCMc 3P8DA 1VQOA 3M5AA 2CZ1B 3ZFJA 2HD0A 2LC4A 2O01E 4M78C 4BY6B 5GANg 2XICA 3OYNA 3L2VA 2RK2A 4Y28E 5GAMf 2JTMA 3PIOA 3CCSA 1W4SA 3RMSA 1K8AU 2V8JA 4JDSA 1VQ6A 4IUVA 3MCAB 4F7UA 5GAOp 4DA4A 1Q81C 3VJPA 4N4IA 2E10A 1VQ5T 2EQKA 1ZQ1A 2X4WA 3OSVA 1G3WA 5A2QE 1VQPT 4EPCA 1BKBA 2AHJB 4M78E 3RESA 3HHTB 3OB9A 4M78A 4BE0A 1YI2A 1KQSA 3I56A 1VQ9A 5GAN6 4C5HA 3NFCA 1NPRA 2QQSA 2DTOA 4F7UG 5GAMd 1M8VA 5J26A 3TU4K 4A54A 3TCJA 3QDRB 2RHIA 4M78G 5J3BA 3JB9I 1VQKA 4HA8A 4IUUA 2LCLA 2MWPA 2Y90A 1WPYA 1XNIA 5GAMj 2G3RA 1PSFA 3LX7A 4C0GA 4JRQA 2DXCA 1N9SA 3DB4A 3O8VA 2DPPB 2XDDA 4X9CA 1YIJT 4M7DC 3A8MB 4X9DA 4J7FA 2VGNA 3L2WA 3KBGA 2KSSA 3JB9J 1WJQA 3FEOA 2OTLT 4J6YA 2XG8D 4KUDK 3MEWA 3J7AF 2R5AA 1JBMA 2ZPIB 2XKOC 3OS5A 1DJ7B 3CPWA 3LWIA 3GF5A 3CMET 2ZPFB 1UGPB 2YLCA 4PLIA 3BW1A 4HT9A 2EQJA 1I8FA 2QTXA 3M4GA 3QJYA 3QYGB 4J5YA 1VQ4A 4MMKA 3ME9A 3V8KA 4PJOE 2P0QA 4J83A 3L2RA 1QVGS 1N9RA 3QUIA 3MO8A 3OYDA 1KD1U 3OYLA 4PKCC 4E7HA 2R57A 1QVFS 3QO3A 3HKSA 1OI1A 4BE1A 3CC7A 3JB9H 2X4JA 2RJDA 3V8JA 3AHUA 2JZ2A 5FRNA 1M5Q1 1KC8U 4C8QF 1ZBXA 3M56A 4EMKA 4E7KA 1YCYA 3T9NA 1RL2A 1N6AA 3OYBA 3CCVT 4XTYA 3C4SA 3QPHA 4M77G 4X34A 4RCBA 3I55T 5GMKl 3GOXA 3ASKA 2LTOA 5CKEA 4OF1A 2FB7A 2DTHA 3JCMV 5GMKm 5GANe 5LJ3g 3OYFA 2KK4A 5KE3A 4OB2B 4RMOA 1VQNT 4N4GA 1X75C 4KULA 2ZGWA 3CCMT 4QW2A 3CCQA 4M7DG 3CC2T 3TREA 3OY9A 1VQNA 4XTZA 5FLXE 3TEEA 4M75A 4M7DA 5FRMA 4BI4A 2WSFE 1P92A 2KVQG 5GAN3 1VQMA 3J80E 5CAIA 3QZ5B 4MMLA 1Q86U 3E9FA 4JLGA 4L6V5 3L2QA 5LJ5j 3G71A 2O4XA 2V8KA 3CCUT 1BI3A 3VU3C 3QG1A 1EIFA 2E1HA 3QKJA 1FX7A 4C0DB 3KUFA 3JCMg 4C8QC 4O5VA 4J6XA 4C0DC 5GAN4 5GAOl 4BE2A 1VQKT 3VYGA 1BIBA 4O6JA 2DZ9A 2LVMA 4LD9K 1R8OB 2VYTA 3S3NA 3PTAA 4C92B 4JRIA 1S72T 3QSUA 4OVAA 5D6YA 4ATOA 2HQEA 3I56T 2VGMA 3M57A 5LJ5g 2VXEA 2P0PA 1KQ2A 5CIUA 2EIFA 1LJOA 3DLLA 4IUQA 3E19A 1I5LA 3PNWC 3LYIA 5LJ5e 4N4HA 3S6WA 1BI2A 3CCQT 2FVUA 2JVVA 2E65A 2L5QA 4ZGJB 3VYHB 5FU6C 3GIBA 2K5FA 5DLQE 4F7UB 5FU7B 3OYKA 4M77A 5FU6B 1BI0A 2X4YA 3CXCS 3S3MA 1I81A 1D3BB 4OP0A 4L59A 3OYIA 3JSCA 3QBYA 1XQHA 1X6OA 3SWNA 5GMKi 4M7DF 1UGSB 3G6EA 3UWNA 1GXIE 3SFMA 3PMTA 4JUVA 1IREB 5CQYA 1QP3A 3L2ZA 3R6OA 4BUGA 5M9OA 3UT1A 2LNVA 4QVDA 3HFNA 1LOJA 2DXUA 1G3TA 3OYHA 3L42A 1ZHIA 3X26B 2R5MA 2RHZA 4LDWA 4M7AE 2B8AA 4GY5A 1NJIC 2DKGA 3HRTA 2VC8A 2CYZB 5D6WA 3SB2A 4NOYA 4HCZA 4DOVA 3OYGA 2ZPEB 3BDLA 4J6WA 1VIEA 2A7YA 5CR2A 3OS0A 3RUXA 5GAOn 1W2BS 1AHJB 1YJ9T 2XHCA 4XU2A 2JN0A 3PIPA 2X4XA 2L3RA 2KY9A 3OYYA 3X24B 2ZPBB 4ME7A 4IURA 2DD4A 3HPWA 2L89A 4PNOA 5CKFA 3LW5E 5LL6S 3CC4T 2OTJT 3PFSA 4NS5A 5GAOq 1N8RU 4HT8A 5LJ5f 2E12A 2XDPA 1M1KU 2E70A 2RJCA 4WF2A 2EQUA 3LGLA 2LCCA 3OSSC 4M78D 3OBWA 2M9UA 4XU0A 3CBMA 3URGA 3LH0A 2GFAA 3CCRT 1NZ9A 2RB6A 4PJOC 5L8RE 3E1SA 3HFOA 4C0ZA 5LJ3d 5GMKj 3S3OA 5GAN8 1YJNA 3FDRA 2YRVA 3NTHA 1M90U 4M7AB 2K3YA 1FXXA 3HL8A 2RA2A 5GAMe 1H3ZA 1WJRA 3JRZA 5KE2A 4C92G 4M7AF 4BDYA 4EDUA 1WNLA 2QQAA 4M75E 4FM4B 2YHTA 2KMTA 4XTWA 3SWNC 3ZBDA 3J81E 1VQ5A 2FYKA 3VUBA 4F7UF 1NPPA 2RHYA 4C8QA 3JB9F 1JJ2S 3CCET 2LRQA 2F5KA 3LLRA 3P8BB 4IKFA 4M7AG 4BI3A 4R56A 5LJ3f 3WVEB 1Q82C 1G3YA 5HKCA 1KD1C 3MP8A 3PGGA 3QHSA 2RJEA 4M75B 3RKWA 3CCVA 2D0QB 4EMGA 2DEQA 4M7DB 1YITT 1VQ7A 3OYEA 5HK0A 2RK1A 3X20B 3FRNA 3OW2S 4C5EA 3ER0A 2K5LA 1FWZA 3EAEA 3A8LB 3HRSA 1Y96A 2QEXT 4OB1B 3C95A 1XOVA 5I2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM g;  4XTV A;  4XU3 A;  4RCC A;  4C8Q C;  4J6X A;  5GMK e;  5GAM g;  5GAN 4;  5GAO l;  1Y96 B;  4M7D E;  3JCM W;  3JCM J;  1WQW A;  5GMK h;  1BIB A;  2DZ9 A;  3BY7 A;  3JCM c;  1I4K 1;  5GAN g;  4XTU A;  4M78 C;  4JRI A;  4C92 B;  5GAN 7;  3QSU A;  4M7A D;  3BFM A;  5GAM f;  5LJ5 g;  2VXE A;  1HK9 A;  1KQ2 A;  1LJO A;  4C92 D;  1I5L A;  4EMH A;  4F7U A;  1KQ1 A;  5LJ5 e;  5GAO p;  4PJO A;  2E10 A;  1HXD A;  2E65 A;  1M8V A;  5LJ5 h;  3GIB A;  4C92 E;  4F7U B;  4M7D D;  4PJO B;  4M77 A;  4M75 D;  1U1S A;  4M78 E;  3RES A;  4M78 A;  1I81 A;  5GAN h;  5GAO m;  1D3B B;  4OP0 A;  5GAN 6;  4M77 B;  2DTO A;  4PJO G;  3SWN A;  1JRI A;  4F7U G;  3JCM f;  5GMK i;  2E1H A;  4A54 A;  5GAM d;  4M77 C;  4M7A C;  4M7D F;  4V2S A;  4M78 G;  3EFR A;  3JB9 I;  4JUV A;  3SWN B;  4HA8 A;  3L2Z A;  2Y90 A;  1WPY A;  4QVD A;  5GAM j;  3HFN A;  1LOJ A;  2RM4 A;  2DXU A;  3FB9 A;  4Y91 A;  3JCM b;  5GAN j;  1B34 A;  1N9S A;  4C8Q E;  5LJ5 d;  5GAO r;  3JCM Q;  2K57 A;  4X9C A;  4M7D C;  4X9D A;  1U1T A;  4M7A E;  4N0A A;  3JB9 D;  1B34 B;  1MGQ A;  2DKG A;  4M75 C;  1H64 1;  3JB9 J;  4XQ3 A;  4J6Y A;  3EFS A;  4C8Q D;  2VC8 A;  2EJG A;  3SB2 A;  4NOY A;  3V7R A;  4QVC A;  1JBM A;  3FJP A;  2EJ9 A;  4J6W A;  4C8Q B;  3JCM d;  1LNX A;  4XTX A;  2E41 A;  2YLC A;  4JLI A;  3RUX A;  5GAO n;  3BW1 A;  4XU2 A;  4HT9 A;  3M4G A;  1I8F A;  2QTX A;  2JN0 A;  3JCM h;  3RKY A;  3JCM P;  4J5Y A;  4F7U E;  4MMK A;  3V8K A;  4PJO E;  1TH7 A;  2DTI A;  4JRK A;  4NL2 A;  4M78 B;  4C92 C;  5GAN 2;  5LJ3 h;  2CGH A;  5GAN 3;  3HSB A;  1N9R A;  3QUI A;  5GAN f;  2EAY A;  4PNO A;  3QO3 A;  4EMK B;  5GAO q;  4HT8 A;  3JB9 H;  4DQ2 A;  5LJ5 f;  3V8J A;  3RIR A;  4EMK C;  3RER A;  3AHU A;  4WF2 A;  1M5Q 1;  5LJ3 j;  4C8Q F;  4EMK A;  4NL3 A;  1YCY A;  4M78 D;  4XU0 A;  2DJZ A;  2RD1 A;  2DVE A;  4XTY A;  2RB6 A;  2EWN A;  4PJO C;  4M77 G;  3HFO A;  4RCB A;  5LJ3 d;  5GMK j;  5GMK l;  5GAN 8;  3JCM V;  2DZC A;  2FB7 A;  2DTH A;  3INZ A;  5GAN e;  5GMK m;  5LJ3 g;  4XU1 A;  4PJO D;  2YLB A;  4M7A B;  3V7C A;  4C92 A;  2RA2 A;  5GAM e;  3L1A A;  2I2L A;  4A53 A;  4M7A F;  2ZGW A;  4C92 G;  1WNL A;  5GAN 5;  4M75 E;  3SWN C;  2YHT A;  4XTW A;  3V7S A;  5GAM h;  5GAN d;  4M7A A;  4M75 F;  4M7D G;  2FYK A;  1D3B A;  4XTZ A;  4PJO F;  4F7U F;  3JCM e;  4C8Q A;  4M75 G;  2EJF A;  5LJ3 e;  2HNI A;  3JB9 F;  1WQ7 A;  3V8L A;  4M75 A;  4M77 D;  4M7A G;  4M7D A;  3JCM X;  5LJ3 f;  3JB9 G;  3PGG A;  3RKX A;  3QHS A;  4N0A C;  4M75 B;  5CAI A;  4MML A;  3RKW A;  5DY9 A;  4EMG A;  4M7D B;  2DEQ A;  4M77 E;  4C92 F;  5I21 A;  4M77 F;  2VXF A;  2E64 A;  5LJ5 j;  1BIA A;  4M78 F;  2DXT A;  3VU3 C;  1X01 A;  1Y96 A;  3BDU A;  4C8Q G;  3FIF A; 
#chains in the Genus database with same CATH topology
 1D1A A;  2HAX A;  1TUG B;  2E5Q A;  4L5G A;  1HYO A;  1R0B G;  1YI2 T;  4A4H A;  1VQO T;  3CCR A;  1MNE A;  3OW2 A;  2BKD N;  3I56 Q;  1E6G A;  1X2Q A;  4JS4 A;  1N27 A;  2MI6 A;  2X3X D;  2K4Y A;  2P4T A;  3I5R A;  2VWF A;  2XMF A;  2H8H A;  5HY6 A;  4PJO G;  2O2O A;  4OMM A;  4M77 C;  5GJW B;  5DM7 R;  4Q5W A;  2DA9 A;  1K8A C;  2D0N A;  1ZSZ C;  4DBF A;  4A4K A;  1U1T A;  1QMC A;  2FZG B;  1SRM A;  3NTI A;  2A37 A;  3CBP A;  2JJ9 A;  2AZV A;  3H8Z A;  2ENM A;  3M9Q A;  1GBR A;  2E41 A;  2F1L A;  4FYX B;  4FL6 A;  3A8O B;  2FG0 A;  1KIK A;  4LD6 A;  2CS7 A;  5J39 A;  1YP5 A;  3EGX A;  4DQ2 A;  4LDX A;  3RER A;  3RIR A;  4EMK C;  1IHV A;  4NL3 A;  3ULR B;  5IH2 A;  2MIO A;  1G5V A;  1S1N A;  2QG9 B;  2DM1 A;  4ESR A;  5KH6 A;  2DZC A;  3CEY A;  5FU7 C;  1Y71 A;  3RDV A;  4E7I A;  2QTV A;  3L1A A;  1M4Z A;  3M55 A;  2OI3 A;  1GCQ A;  3M59 A;  4QVZ A;  3OS1 A;  4B9W A;  4Z02 A;  3MPU B;  2RI5 A;  2BIV A;  4RG8 A;  1PC0 A;  1QWF A;  1Z9Q A;  2V1Q A;  4QKU A;  1C0M A;  1KQS P;  2VXF A;  4FYV B;  4J9H A;  5IAY A;  2PVG B;  2B86 A;  2DK3 A;  2PVO B;  4C8Q G;  4RG2 A;  3FIF A;  5EC7 A;  3CCS T;  2DJQ A;  3VS5 A;  2PVD B;  3SEM A;  4RTT A;  2E5K A;  1Q86 R;  5CVI A;  1VUB A;  3H0F A;  1VQ9 T;  2H3E B;  2LX9 A;  1D0X A;  1XTD A;  1AVZ C;  3VS1 A;  2E4H A;  1M9S A;  4C92 E;  2DD5 A;  3CD6 A;  2PNI A;  1YNZ A;  2LCS A;  2NUT B;  3M0U A;  2LQ8 A;  1U3O A;  4E7J A;  4M7A C;  1WFW A;  1WHH A;  1AWW A;  3PT9 A;  2VV5 A;  2HL3 A;  1SSH A;  1ABO A;  4ORZ A;  4Y91 A;  2KQW A;  3HP9 A;  3SD4 A;  5LJ5 d;  5GAO r;  3SHW A;  1PWT A;  3G71 T;  1D0Z A;  4N0A A;  4M75 C;  5A2Q E;  1Q7Y C;  1H64 1;  2YRC A;  5CKH A;  1VQ8 A;  2D8H A;  4KUD K;  3VS3 A;  2Z0W A;  1WA7 A;  2K5I A;  3P8H A;  4C8Q B;  1IO6 A;  3JCM d;  4J7I A;  2LJ0 A;  4C92 C;  1PRL C;  3HSB A;  3LGF A;  5LJ3 h;  4AG1 C;  2F5T X;  1SF9 A;  2L0A A;  2PU9 B;  1M2V A;  4QQD A;  4RTV A;  2J06 A;  3G7Z A;  3WVD B;  1RAC B;  1QW1 A;  2RD1 A;  2DVE A;  4A4F A;  2F2X A;  2XU8 A;  3GNF B;  4PJO D;  1Q7Y U;  2RJF A;  3V7C A;  2EYY A;  1Q86 C;  4XAX B;  1BCM A;  5GAN d;  2CT3 A;  4E7L A;  1VQ4 T;  2RI3 A;  2DL8 A;  4CI0 C;  5HCK A;  1CKA A;  3RKX A;  4IUP A;  3KXT A;  1AZG B;  2Y4X A;  1M1K C;  4ZGD B;  3CCV Q;  1QVF P;  1YHQ A;  1M1K R;  3EG3 A;  1WQW A;  3MP6 A;  3CXC A;  3P8D A;  2CZ1 B;  3ZFJ A;  2O01 E;  4M78 C;  5GAN g;  3L2V A;  4Y28 E;  4JJD A;  3PIO A;  2QGG A;  2V8J A;  4JDS A;  1SHF A;  3VJP A;  2EQK A;  2AHJ B;  2RQT A;  1VQ9 A;  2BZ8 A;  4C5H A;  4AFU C;  1QCO A;  5GAM d;  2NUT A;  3JB9 I;  4D8D A;  2DFU A;  3H9N A;  2LCL A;  2Y90 A;  1ZUY A;  2PZ1 A;  1VQ5 Q;  1NYG A;  2YXY A;  4JRQ A;  2P84 A;  2OTL T;  2XG8 D;  1GRI A;  3RBB B;  4ANJ A;  1DJ7 B;  2YLC A;  4HVU A;  4HT9 A;  1S72 Q;  4PJO E;  3ME9 A;  3L2R A;  1QVG P;  2MCN A;  1K0S A;  3QO3 A;  1QQJ A;  1UHC A;  2ZAE A;  4FW1 A;  4BE1 A;  3AHU A;  2JZ2 A;  5FRN A;  1M5Q 1;  1ZBX A;  4EMK A;  3OYB A;  4M77 G;  3I55 T;  5GMK m;  2DTH A;  1VQP Q;  6AT1 B;  5KE3 A;  4N4G A;  4KUL A;  2AKK A;  3CCM T;  4QW2 A;  3NPF A;  3CC2 T;  3TRE A;  1FMV A;  4XTZ A;  3CC7 Q;  5FRM A;  1P92 A;  2KVQ G;  4JJB A;  5GAN 3;  1VQM A;  1JEG A;  4L6V 5;  5D7U A;  3NMZ C;  1BI3 A;  3VU3 C;  2DL4 A;  3QKJ A;  4C0D B;  3KUF A;  5FW9 A;  5GAN 4;  5GAO l;  3VYG A;  8ATC B;  1BIB A;  4O6J A;  4Z88 A;  1WHL A;  1W70 A;  3PTA A;  4JRI A;  1SHG A;  2VGM A;  2M51 A;  1KQ2 A;  4N4H A;  1VQL Q;  1BI2 A;  4ZGJ B;  5FU6 C;  2J6F A;  1K0X A;  1BI0 A;  3S3M A;  2CSQ A;  2CP7 A;  4K11 A;  4B6M A;  3SWN A;  1HJD A;  1GXI E;  3UWN A;  3SFM A;  1PHT A;  4BUG A;  4QVD A;  1LOJ A;  1NYF A;  2RHZ A;  5KYX A;  1NJI C;  4RUG A;  3SB2 A;  4HCZ A;  1VIE A;  2A7Y A;  2KXC A;  4GBQ A;  3OS0 A;  5GAO n;  1RLP C;  1MND A;  1NLP C;  2V1R A;  2KY9 A;  3HPW A;  2L89 A;  5LL6 S;  2FZK B;  2XDP A;  5KYW A;  2E70 A;  2RJC A;  3LGL A;  4M78 D;  3OBW A;  4XU0 A;  2KNB B;  3URG A;  1NZ9 A;  2RB6 A;  2VKN A;  5L8R E;  2LJ3 A;  1VOM A;  3NTH A;  1PKS A;  4DBR A;  1M90 U;  1SRL A;  1UUE A;  1H3Z A;  1WJR A;  4C92 G;  4M75 E;  2KMT A;  2QEX Q;  2FYK A;  4F7U F;  2G6F X;  1ARK A;  1JJ2 S;  3LLR A;  2F2W A;  2F5K A;  1AD5 A;  4OMQ A;  3P8B B;  2RPN A;  4IKF A;  1RAE B;  4R56 A;  1GCP A;  5LJ3 f;  3WVE B;  1Q82 C;  2DF6 A;  1XJW B;  3UF4 A;  2RJE A;  2DRK A;  1YIT T;  3OYE A;  2DL3 A;  3FRN A;  4C5E A;  1NJI R;  2K5L A;  3A8L B;  2QAZ A;  3C95 A;  4LD9 K;  2XD0 A;  4RCC A;  1RI9 A;  5EG2 A;  4A4G A;  1Y7X A;  1YJN T;  3JAM E;  2L2P A;  5FWC A;  1VQ6 Q;  3BY7 A;  3WXM B;  2VUB A;  1YFN A;  3G6E T;  3QII A;  3UPU A;  4LDV A;  1RAH B;  3CXC P;  1WXU A;  3DLM A;  3CC7 T;  1V76 A;  2LQN A;  4PJO A;  1HXD A;  2E3I A;  4PFP A;  5D6X A;  2A08 A;  2D8J A;  1JJ2 A;  2DIQ A;  1TSF A;  3QZ9 B;  4IIM A;  5C6S A;  3OQ5 A;  1VQM T;  2ED0 A;  4PJL A;  3CCU Q;  2EYW A;  3TQ7 P;  2CRE A;  2EYQ A;  3MEA A;  2FPE A;  5AYF A;  1NJI U;  3JCM b;  1WHM A;  1YJW A;  2R58 A;  1B34 A;  2QQR A;  1YIJ A;  3JB9 D;  2D9T A;  1UGV A;  1KHC A;  4XQ3 A;  3I55 A;  4J9E A;  3FLG A;  2HSE B;  4HKE A;  2EFI A;  3I35 A;  4TVR A;  4XTX A;  1IZ6 A;  3GLX A;  5CKB A;  2LZ6 B;  2KBT A;  4BY6 C;  2DO3 A;  2CGH A;  2FL7 A;  4J9I A;  3X28 B;  2EQM A;  2GQI A;  2JW4 A;  4ZTJ A;  4ZNX A;  1VQO Q;  5ECA A;  2MWO A;  9ATC B;  1NLO C;  2DJZ A;  3UDC A;  2QQB A;  2QDY B;  3VS7 A;  3VKI A;  2BTT A;  1KFZ A;  2VVK A;  4XU1 A;  2YLB A;  4C92 A;  1YI2 Q;  3CPF A;  1TS9 A;  4BI8 B;  4LNP A;  3HTR A;  3VS0 A;  3SDZ A;  2HNI A;  1Z9Z A;  4RKU E;  1OU8 A;  3ZEH A;  1M3C A;  1KG1 A;  4OML A;  3UA7 A;  4N0A C;  3TSZ A;  1PSE A;  5DY9 A;  1PCX A;  4M77 E;  4M77 F;  1LPL A;  2FEI A;  3H6Z A;  3CCL A;  2KRM A;  1Y96 B;  3JCM W;  3OYA A;  1QCF A;  3PE0 A;  3BFM A;  1KC8 C;  5I22 A;  4AFZ C;  1T0J A;  4ELZ C;  1KQ1 A;  1AEY A;  5DLO A;  4KRT A;  2NLU A;  2RHX A;  2DMO A;  4M7D D;  1V1C A;  2YUN A;  5GAO m;  3OYJ A;  3MEV A;  3OBY A;  3CME A;  2A36 A;  1PM3 A;  3F70 A;  2HQH A;  2O4X B;  2KXD A;  4V2S A;  3SWN B;  3CCQ Q;  2A0F B;  5GAN j;  1M1F A;  4C8Q E;  3JCM Q;  2K7A A;  4VUB A;  1G2B A;  3CCJ A;  1LVK A;  1B34 B;  1MGQ A;  3DB3 A;  3EG9 A;  3MET A;  4C5I A;  3QXE B;  3OYC A;  2K3B A;  3FJP A;  1MUZ A;  3ZL7 C;  4F14 A;  3CCE A;  4EIK A;  3A5Z B;  1M1G A;  3CPW S;  3CCS Q;  1BYM A;  1UFF A;  2COW A;  2GFU A;  1RAG B;  1U06 A;  5LJ3 j;  2ROT A;  3OYM A;  3G4S Q;  3OA6 A;  2M16 A;  4FT4 A;  2JM8 A;  2RHU A;  2M0Y A;  3C94 A;  2DIL A;  1YHQ Q;  5CO7 A;  3JCM e;  4ZTF A;  4ZN1 A;  2EJF A;  2MF2 A;  2IG0 A;  1KQS S;  5KYY B;  4UC4 A;  2GQV A;  1OX8 A;  1SKU B;  2JT4 A;  1BI1 A;  2NWM A;  1ZSZ B;  4KH1 B;  3UA6 A;  2AT1 B;  4PLL A;  3CD6 T;  1BIA A;  1GFD A;  2DXT A;  2LX7 A;  1WHG A;  1X01 A;  4C5G A;  1YHQ T;  1UB4 A;  3BDU A;  3MEU A;  2XK0 A;  4OMP A;  1VQ7 T;  2CZ0 B;  4JJN K;  1UEC A;  2LC4 A;  3EGD B;  5GAM f;  3CCS A;  1W4S A;  3RMS A;  4J9F A;  4IUV A;  3MCA B;  1VQL A;  4DA4 A;  2CP0 A;  1Q81 C;  4HCK A;  4LUE A;  1GBQ A;  3H41 A;  1C6V X;  1M3B A;  1WLP B;  2JMA A;  4BE0 A;  4R0K A;  4KGX B;  2QQS A;  4F7U G;  5J26 A;  3TU4 K;  2ECZ A;  3TCJ A;  3QDR B;  1BU1 A;  4HA8 A;  1WPY A;  1XNI A;  1D09 B;  2DXC A;  1QLY A;  4DEY A;  4E7S A;  4X9C A;  4M7D C;  3A8M B;  2LJ1 A;  1MMA A;  3KBG A;  1UE9 A;  3CME T;  2ZPF B;  3EHR A;  3CCE Q;  4PLI A;  2EQJ A;  1I8F A;  2QTX A;  1NBE B;  3QJY A;  3QYG B;  1OU9 A;  2P0Q A;  4AT1 B;  4J9C A;  3QUI A;  4JZ3 A;  3MO8 A;  3OYD A;  1KD1 U;  3OYL A;  4PKC C;  1QVF S;  2CP3 A;  2RQV A;  2HCK A;  2RJD A;  4IIO A;  2D1X A;  4C8Q F;  4E7K A;  1YCY A;  4PFZ A;  1RL2 A;  4XTY A;  4X34 A;  3VS6 A;  2YDL A;  3GOX A;  3ASK A;  2K6D A;  4OF1 A;  2KK4 A;  1M30 A;  1VYU A;  4CC2 A;  1X75 C;  2ZGW A;  2DET A;  3OY9 A;  3EG1 A;  2DL7 A;  4RTY A;  2WSF E;  3TVT A;  1RUW A;  3QZ5 B;  4MML A;  5FWB A;  1Q86 U;  3E9F A;  2FRW A;  1X2K A;  3QG1 A;  3CD6 Q;  1KD1 R;  2OTL Q;  3JCM g;  4C8Q C;  4O5V A;  4J6X A;  3U23 A;  2LVM A;  3S3N A;  3QSU A;  4C92 B;  1S72 T;  2IPO B;  5D6Y A;  3NGP A;  5LJ5 g;  5CIU A;  2EIF A;  3E19 A;  1I5L A;  3PNW C;  2YUQ A;  3S6W A;  3CCQ T;  2FVU A;  4PJN A;  2E65 A;  2EQI A;  3A98 A;  4WTO B;  5DLQ E;  4F7U B;  2KRS A;  1D3B B;  2OAW A;  2HSP A;  4RTX A;  1X6O A;  2EVR A;  4JUV A;  5M9O A;  3R6O A;  3CCM Q;  1WI7 A;  2W10 A;  1G3T A;  1PG5 B;  3OYH A;  4LXC A;  1RLQ C;  3L42 A;  1UHF A;  2DE0 X;  2R5M A;  2MYS A;  4LE9 A;  4RTZ A;  2VC8 A;  2HL5 C;  4NOY A;  4DOV A;  2ZPE B;  2DEU A;  3KFV A;  4XU2 A;  4CC3 A;  1I0C A;  2X4X A;  1I07 A;  1EZZ B;  2ZPB B;  2DD4 A;  4PNO A;  3REB B;  2OTJ T;  5GAO q;  4HT8 A;  2BZX A;  4WF2 A;  4F04 B;  2LCC A;  2GFA A;  4PJO C;  2KR3 A;  5LJ3 d;  3EHQ A;  1YJN A;  3FDR A;  5KYU A;  2K3Y A;  1OV3 A;  2RA2 A;  5KE2 A;  4M7A F;  1X43 A;  1VQ5 A;  1OX9 A;  2C0T A;  1NEB A;  3CCE T;  2LRQ A;  1EFN A;  5HKC A;  2DVJ A;  3PGG A;  4M75 B;  3RKW A;  3CCV A;  4JJC A;  3OW2 S;  2KYM A;  2NYS A;  3ER0 A;  1FWZ A;  4RTW A;  1CKB A;  1T0H A;  2BE9 B;  2FO0 A;  5GAM g;  1M8M A;  1WGS A;  2QAS A;  5I2M A;  2RMO A;  2VAS A;  5L23 A;  2HKN A;  2KAF A;  2PQW A;  1VQK Q;  4XTU A;  4M7A D;  2KRN A;  4J8O A;  5A0D A;  3C12 A;  3NHN A;  4JRP A;  2QI2 A;  2EBP A;  4EMH A;  2L8D A;  1NM7 A;  2MAM A;  4FYY B;  1D1C A;  1OOT A;  4XK8 E;  4MDW A;  4X1V A;  1U1S A;  5GAN h;  2CP2 A;  1T3L A;  2P4R A;  3TSW A;  4M77 B;  1JRI A;  4BD3 A;  2WAC A;  1NEG A;  2V8I A;  2HBP A;  2PUK B;  3H0H A;  1ABQ A;  1QKW A;  2X3W D;  2BZY A;  3CC4 A;  3THK A;  1U5S A;  3M54 A;  4ELY C;  3CMA A;  1H8K A;  2JNG A;  3CCL Q;  1QP2 A;  1FYN A;  1ZSZ A;  4KH0 B;  3FC3 A;  1YJ9 Q;  2ATC B;  1E7O A;  4JLI A;  1K8A R;  3JCM h;  3G1J A;  1W2B A;  4BDZ A;  2RF0 A;  5A0G A;  2C06 A;  3HRU A;  4F17 A;  1YIT Q;  1ZX6 A;  4EMK B;  3M0T A;  1VQL T;  3MKD A;  3N5B B;  4CC7 A;  1VQ8 T;  3QYH B;  3G4S T;  1YBY A;  1ZA1 B;  1YJN Q;  2CSI A;  2OTJ A;  3A1P A;  1JJ2 P;  4GLK A;  4LDY A;  4AFS C;  1N8R C;  2I2L A;  1VQ4 Q;  2SRC A;  2LMJ A;  1VQM Q;  1R0C B;  5LJ3 e;  2K2M A;  4OB0 B;  3GP8 A;  1U8R A;  1KC8 R;  1YWO A;  2CDT A;  2JS2 A;  3OMG A;  2DYB A;  3VS2 A;  2RI2 A;  3CC4 Q;  4E47 A;  3GPL A;  2JUF A;  4IUT A;  2M1H A;  4FW2 A;  1VQP A;  2M0O A;  4HCC A;  1IB8 A;  4YTL A;  1VQ6 T;  1EX4 A;  1G8X A;  1MHN A;  4FSX A;  2MK5 A;  2KGT A;  5GMK h;  5GJV B;  5KYX B;  1Q82 U;  1K4U S;  1J3T A;  4CRI A;  4C92 D;  2J05 A;  4OMO A;  1K9M U;  2LP5 A;  5LJ5 h;  3QWX X;  5A0L A;  1NG2 A;  1M27 C;  3JCM f;  1K9M C;  2HMA A;  1UEB A;  2JS0 A;  1H3H A;  1M90 R;  4ZGE B;  4ZN3 A;  3FB9 A;  1HSQ A;  2K3X A;  1WYX A;  2K57 A;  4OGE A;  4QT7 A;  1SEM A;  3EFS A;  1GL5 A;  2EJG A;  3V7R A;  3X25 B;  1K73 C;  2ZCF B;  1YJ9 A;  2DAQ A;  1Q95 G;  2H3J A;  1LNX A;  2JOY A;  4E2F B;  3EFO A;  3CMA T;  1M90 C;  3G6E Q;  2O31 A;  3RMQ A;  3CQT A;  2EGE A;  3RKY A;  3NTK A;  2RH2 A;  1TH7 A;  4QQ6 A;  4NL2 A;  5GAN 2;  4ATO A;  2YRD A;  5GAN f;  2EGC A;  2EAY A;  3M53 A;  1B3Q A;  2KE9 A;  2MPX C;  1O75 A;  2GF7 A;  5IN1 A;  3Q1J A;  2ZPG B;  3INZ A;  5KCO A;  1X69 A;  2QA4 T;  2QQ9 A;  3IQL A;  4AMC A;  3CCL T;  2A3L A;  3EH1 A;  4FT2 A;  5GAM h;  1D3B A;  4PJO F;  4DOW A;  4M75 G;  1OZ3 A;  2CKK A;  4D8K A;  1WQ7 A;  2AKL A;  3CCR Q;  1T3S A;  4KT0 E;  1TOV A;  5IT9 E;  1R77 A;  1D0Y A;  1I1J A;  4C92 F;  2GTJ A;  3VV0 A;  4JZ4 A;  4KBM B;  2FPD A;  4XTV A;  4XU3 A;  1V29 B;  4M7D E;  3CCU A;  3H0I A;  1MMN A;  3JCM c;  1VQO A;  4BY6 B;  1YI2 A;  3OYN A;  2XIC A;  1KSW A;  1UDL A;  1MMD A;  2DNU A;  2SEM A;  5GAO p;  4N4I A;  2E10 A;  1VQ5 T;  2CH4 A;  1CSK A;  1G3W A;  2DRM A;  2ROL A;  2RQU A;  1VYT A;  3RES A;  3HHT B;  2JM9 A;  3OB9 A;  4M78 A;  3NFC A;  2DTO A;  1M8V A;  2GTO A;  2JTE A;  1F1B B;  5KYU B;  2GNC A;  4IUU A;  2MWP A;  5GAM j;  2G3R A;  1KK7 A;  1N9S A;  3DB4 A;  2L3Q A;  2XDD A;  1YIJ T;  4X9D A;  4J7F A;  2RQW A;  3L2W A;  2KSS A;  3FEO A;  3J7A F;  4J6Y A;  3MEW A;  2R5A A;  2AZS A;  2HEQ A;  3GF5 A;  1UGP B;  2DX1 A;  2L3S A;  1ZSG A;  2KRO A;  4J5Y A;  4MMK A;  2W0Z A;  4J83 A;  1QVG S;  1G83 A;  1VQ7 Q;  2R57 A;  2DBM A;  3EGU A;  3CC7 A;  1C1A A;  3JB9 H;  2I0N A;  2X4J A;  3EGX B;  3T9N A;  2OTJ Q;  3C4S A;  2CH4 W;  2CUD A;  1X6G A;  4RCB A;  2LTO A;  5CKE A;  3JCM V;  2FB7 A;  5GAN e;  2YWW A;  2EYX A;  4OB2 B;  1ZUK A;  2JXB A;  3CCQ A;  1VQN A;  1WXB A;  2PTK A;  5FLX E;  3JV3 A;  1WHJ A;  3D7S B;  1AT1 B;  3J80 E;  5CAI A;  2FZC B;  3I9Q A;  2FPF A;  5LJ5 j;  2O4X A;  2HKQ B;  1OPK A;  2V8K A;  3CCU T;  1W6X A;  4AFQ C;  1EIF A;  2E1H A;  1FMW A;  1TXQ A;  4C0D C;  3OW2 P;  4FSS A;  2HQE A;  3M57 A;  2VXE A;  2P0P A;  4Z89 A;  1VA7 A;  3DLL A;  4IUQ A;  1TWB A;  3LYI A;  2JVV A;  3CME Q;  3VYH B;  3GIB A;  1N8R R;  5FU7 B;  2DBK A;  5FU6 B;  3R6N A;  1VQ8 Q;  4OP0 A;  4L59 A;  2L3P A;  3QBY A;  1XQH A;  5GMK i;  4M7D F;  1UGS B;  3PMT A;  1IRE B;  5CQY A;  3L2Z A;  2LNV A;  2RN8 A;  2EGA A;  1H92 A;  1ZHI A;  3X26 B;  4M7A E;  2B8A A;  4GY5 A;  1TG0 A;  2CYZ B;  1MV3 A;  2LNH B;  4J6W A;  2NUP B;  1FMK A;  3QWY A;  5KYY A;  5CR2 A;  1YJ9 T;  2XHC A;  2V26 A;  1JXO A;  2BE7 D;  4HXJ A;  2L3R A;  2YUO A;  3LW5 E;  3PFS A;  1N8R U;  5LJ5 f;  2E12 A;  1M1K U;  5IHK A;  3OSS C;  1OEB A;  1WXT A;  3CBM A;  3AT1 B;  4WCI A;  3CCR T;  3VRY A;  2DL5 A;  5GAN 8;  3I5S A;  2YRV A;  5IHI A;  4M7A B;  3EGD A;  1FXX A;  2K79 A;  3HL8 A;  3I55 Q;  3CPW P;  4BDY A;  3VS4 A;  4EDU A;  1WNL A;  2CP6 A;  3SWN C;  2YHT A;  4FM4 B;  3J81 E;  4PJJ A;  3VUB A;  1NPP A;  4C8Q A;  4BI3 A;  1JO8 A;  1ZLM A;  1G3Y A;  1KD1 C;  3QHS A;  2OX7 A;  4EMG A;  1VQ7 A;  1UJ0 A;  1IXD A;  2RK1 A;  3X20 B;  1OUL A;  3G71 Q;  2IIM A;  3HRS A;  1Y96 A;  2QEX T;  4OB1 B;  1YJW T;  5J3B A;  2ED1 A;  5I2S A;  2QEX A;  3MP1 A;  3JCM J;  2GCX A;  3OS2 A;  2ABL A;  2QYZ A;  5GAN 7;  1Q81 U;  3EFO B;  3MHX A;  1X27 A;  4LDU A;  1HK9 A;  1QVP A;  1JQQ A;  2E6N A;  1M2O A;  2WSE E;  1M2V B;  1VIF A;  2F69 A;  3A8H B;  4PL6 A;  5C0M A;  4A4E A;  1UGR B;  3QJ6 A;  2D6F A;  1S72 A;  3EFR A;  1Q81 R;  4D6W A;  2OTL A;  5CKD A;  4B9X A;  2LT1 A;  2CT4 A;  1RAF B;  4DBQ A;  3EG9 B;  2FHD A;  4OGC A;  2P0K A;  2LDM A;  1AOJ A;  1VQ9 Q;  1I5O B;  4PJM A;  1YN8 A;  4HCB A;  1OZ2 A;  1G3S A;  3CCJ T;  2NUP A;  4F7U E;  1OPL A;  4M78 B;  4FIB A;  4RTU A;  2MOX A;  1OYX A;  1IRX A;  3M4Y A;  4JPB W;  3M0R A;  2C0I A;  2JTF A;  5IXB A;  2YSQ A;  5IHN A;  3CCJ Q;  4JS5 A;  2RO0 A;  1NE8 A;  5GAN 5;  1WJS A;  3EG2 A;  1K1Z A;  2COZ A;  3V8L A;  3CBO A;  2YT6 A;  4M77 D;  3BE3 A;  4CC4 B;  5I11 A;  2LT4 A;  2HQX A;  1TUC A;  2IVW A;  2E64 A;  4OMF B;  4M78 F;  4MZM A;  3PVL A;  5HK3 A;  2CZ6 B;  1ZUU A;  1Y07 A;  3PMI A;  4BB7 A;  1SSF A;  1GFC A;  4OB3 B;  1WIE A;  1RI0 A;  4FCY A;  3E2U A;  2COY A;  1I4K 1;  2ESW A;  1PKT A;  3M58 A;  2CZ7 B;  2KDS A;  1K76 A;  2LQK A;  4PJO B;  4LUD A;  1X6B A;  4M75 D;  2C0O A;  4MZT A;  5FRO A;  4J9G A;  5CQX A;  1JB0 E;  3E9G A;  3LWH A;  2XDB A;  2XI9 A;  1B7T A;  5CK9 A;  4Y92 A;  1RAD B;  2XID A;  2BUD A;  2RM4 A;  2K2V A;  3REA B;  2VB6 A;  4E6R A;  4J9B A;  2KI7 A;  5AT1 B;  3QDF A;  2QA4 A;  2A28 A;  2AIR B;  2X35 A;  2EKO A;  3GNG A;  2QXF A;  4C8Q D;  1QVF A;  1KHI A;  4QVC A;  4Z8A A;  1QVG A;  3UAT A;  2EJ9 A;  1PD1 A;  2DXB A;  1Q82 R;  1ACM B;  2MMP A;  4II1 A;  3JCM P;  4DBH A;  3CC2 A;  3S3O A;  2DTI A;  4JRK A;  1PD0 A;  3CCM A;  2GGR A;  4PFO A;  3VUZ A;  4P5N A;  3PVQ A;  1RAI B;  1KJW A;  1QCN A;  2GBQ A;  4KUI A;  4MDX A;  2DIG A;  1O9S A;  5CCA A;  2EWN A;  1K73 U;  2ZZD A;  1W2B P;  1MMG A;  4LN2 A;  1TUD A;  5KCH A;  2EYZ A;  3OMC A;  1W1F A;  4A53 A;  2QGF B;  4BAC A;  3A8G B;  3V7S A;  4M7A A;  2HZY A;  2OAU A;  4M75 F;  3DKM A;  1BK2 A;  1Y57 A;  3RR6 A;  3JCM X;  3G4S A;  1AWX A;  3JB9 G;  2KYB A;  2J7I A;  3FJ5 A;  1QKX A;  2DYI A;  2WSC E;  2Y4Y A;  2FRY A;  4MZP A;  4C0F A;  3VRZ A;  3L2U A;  1K73 R;  2M02 A;  5I21 A;  4FU6 A;  5KYW B;  2E6Z A;  4QQG A;  3RNJ A;  2HDA A;  2PUO B;  2ZPH B;  4R55 A;  1UGQ B;  8AT1 B;  5IXF A;  5GMK e;  1RAA B;  3EH2 A;  1YIT A;  3M5A A;  2KEA A;  2HD0 A;  2O9S A;  2RK2 A;  1YWP A;  2JTM A;  1K8A U;  4M4Z A;  1VQ6 A;  4F7U A;  3EG0 A;  1ZQ1 A;  2X4W A;  3OSV A;  1VQP T;  3CMA Q;  4EPC A;  1BKB A;  4M78 E;  1KQS A;  3I56 A;  5GAN 6;  1JXM A;  2E3H A;  1NPR A;  4A54 A;  2RHI A;  4M78 G;  4E7Z A;  3LH5 A;  1VQK A;  2CP5 A;  1PSF A;  3LX7 A;  4C0G A;  3O8V A;  2DPP B;  2QDL A;  7AT1 B;  2DLP A;  2VGN A;  2QA4 Q;  3JB9 J;  2KT1 A;  1WJQ A;  2LQW A;  1JBM A;  2XKO C;  2ZPI B;  3OS5 A;  3CPW A;  3LWI A;  2QK0 A;  3BW1 A;  2EW3 A;  3M4G A;  1VQ4 A;  1UTI A;  3V8K A;  2EKH A;  1N9R A;  1VQN Q;  4E7H A;  2RQR A;  3HKS A;  2OJ2 A;  1OI1 A;  4A63 B;  3V8J A;  1KC8 U;  1ZA2 B;  3M56 A;  3CCV T;  1N6A A;  1IHW A;  2NUZ A;  1IGQ A;  3QPH A;  1YCS B;  1Y0M A;  5GMK l;  1GCQ C;  1JU5 C;  2CUB A;  2J6K A;  5LJ3 g;  3OYF A;  3MJX A;  1VYV A;  4RMO A;  1VQN T;  4M7D G;  4PK4 A;  2KT8 A;  3TEE A;  4AG2 C;  4M75 A;  1B07 A;  4M7D A;  4BI4 A;  1K9A A;  3M0Q A;  4HVW A;  2O88 A;  1A0N B;  2RNA A;  4JLG A;  3L2Q A;  1YIJ Q;  3G71 A;  1TU0 B;  3M0P A;  1FX7 A;  1WDX A;  2J6O A;  1ZBJ A;  4BE2 A;  1BCO A;  1UG1 A;  1VQK T;  1YJW Q;  2K9G A;  2DZ9 A;  4KGZ B;  1R8O B;  2VYT A;  4OVA A;  2O9V A;  4GLM A;  3I56 T;  1LJO A;  5LJ5 e;  1OQK A;  2L5Q A;  2K5F A;  1PRM C;  3OYK A;  4M77 A;  2X9H A;  2X51 A;  2X4Y A;  3CXC S;  1I81 A;  1TTH B;  3JSC A;  1D1B A;  1IGU A;  3OYI A;  2AK5 A;  3G6E A;  4J9D A;  2HBW A;  1QP3 A;  3UT1 A;  1N5Z A;  3HFN A;  3O5Z A;  1PNJ A;  2DXU A;  1E6H A;  4LDW A;  1WX6 A;  2DKG A;  1BBZ A;  4HVV A;  5D6W A;  4DEX A;  3CC2 Q;  3OYG A;  3BDL A;  1RAB B;  1BB9 A;  3RUX A;  1W2B S;  1AHJ B;  2DER A;  3C0C A;  2JN0 A;  3PIP A;  1AWJ A;  3OYY A;  3X24 B;  1AWO A;  4ME7 A;  4IUR A;  1SG5 A;  5CKF A;  1K9M R;  3CC4 T;  4KGV B;  4NS5 A;  2EQU A;  5KYN A;  1AZE A;  2EPD A;  2M9U A;  3M0S A;  1WHK A;  3LH0 A;  4C0Z A;  3E1S A;  3HFO A;  5GMK j;  2JMC A;  1QWE A;  4FYW B;  5GAM e;  1HD3 A;  2YUP A;  3JRZ A;  2QQA A;  1WZO A;  4XTW A;  3ZBD A;  2RHY A;  2F2V A;  3JB9 F;  4OMN A;  4F16 A;  4M7A G;  1SPK A;  1M3A A;  3GBQ A;  1UJY A;  3MP8 A;  1LCK A;  2D0Q B;  4M7D B;  2DEQ A;  5HK0 A;  1Q7Y R;  1MV0 B;  3EAE A;  3HRT A;  1XOV A; 
#chains in the Genus database with same CATH homology
 5GAM g;  4RCC A;  2HAX A;  5EG2 A;  4A4G A;  2QEX A;  1WGS A;  2XD0 A;  1Y7X A;  3MP1 A;  2E5Q A;  3JCM J;  5I2M A;  4L5G A;  1YJN T;  3JAM E;  2GCX A;  3BY7 A;  3OS2 A;  2KAF A;  2PQW A;  3WXM B;  2VUB A;  4A4H A;  1VQO T;  4XTU A;  5GAN 7;  3QII A;  3G6E T;  3CCR A;  3MHX A;  1Q81 U;  4M7A D;  3UPU A;  4LDV A;  4J8O A;  5A0D A;  3OW2 A;  4LDU A;  1HK9 A;  1QVP A;  3C12 A;  2BKD N;  4JRP A;  2QI2 A;  2E6N A;  4EMH A;  3DLM A;  3CC7 T;  2L8D A;  4PJO A;  2MAM A;  1HXD A;  2WSE E;  1VIF A;  4JS4 A;  1N27 A;  4XK8 E;  5D6X A;  4MDW A;  2MI6 A;  2F69 A;  3A8H B;  4PL6 A;  5C0M A;  2K4Y A;  1JJ2 A;  1U1S A;  2DIQ A;  5GAN h;  2P4T A;  4A4E A;  1UGR B;  3QZ9 B;  5C6S A;  3OQ5 A;  1VQM T;  4M77 B;  5HY6 A;  4PJO G;  1JRI A;  3QJ6 A;  4BD3 A;  4M77 C;  2D6F A;  2WAC A;  1S72 A;  2V8I A;  3EFR A;  5DM7 R;  2HBP A;  4D6W A;  2EYQ A;  4Q5W A;  2OTL A;  3MEA A;  2PUK B;  5CKD A;  4B9X A;  2LT1 A;  5AYF A;  1NJI U;  1K8A C;  3JCM b;  1YJW A;  2R58 A;  1B34 A;  2QQR A;  4A4K A;  1YIJ A;  3CC4 A;  1U1T A;  2FHD A;  3M54 A;  4OGC A;  4ELY C;  3JB9 D;  2P0K A;  2D9T A;  1YJW T;  3CMA A;  3NTI A;  2LDM A;  1KHC A;  4XQ3 A;  3CBP A;  3I55 A;  2JNG A;  1QP2 A;  3H8Z A;  3FLG A;  4HKE A;  3FC3 A;  2EFI A;  3M9Q A;  4TVR A;  2E41 A;  1OZ2 A;  4XTX A;  4JLI A;  4HCB A;  1IZ6 A;  1G3S A;  3GLX A;  3JCM h;  5CKB A;  4FL6 A;  3CCJ T;  4F7U E;  4BDZ A;  1W2B A;  4BY6 C;  2DO3 A;  3A8O B;  4M78 B;  5A0G A;  4LD6 A;  2CGH A;  2CS7 A;  2FL7 A;  3HRU A;  4FIB A;  3X28 B;  2EQM A;  5J39 A;  4ZTJ A;  4EMK B;  1OYX A;  1VQL T;  4DQ2 A;  4LDX A;  3RER A;  3RIR A;  4EMK C;  3M4Y A;  2MWO A;  4NL3 A;  2JTF A;  3N5B B;  2DJZ A;  3UDC A;  2QQB A;  1VQ8 T;  2QDY B;  1G5V A;  3VKI A;  3QYH B;  1Q7Y C;  3G4S T;  1YBY A;  5KH6 A;  4JS5 A;  2DZC A;  3CEY A;  5FU7 C;  1Y71 A;  2RO0 A;  4E7I A;  4XU1 A;  2OTJ A;  2YLB A;  4C92 A;  4GLK A;  4LDY A;  1N8R C;  3CPF A;  1NE8 A;  3L1A A;  2I2L A;  1M4Z A;  3M55 A;  4BI8 B;  5GAN 5;  1WJS A;  3M59 A;  4QVZ A;  3OS1 A;  4B9W A;  4Z02 A;  2RI5 A;  3SDZ A;  5LJ3 e;  2HNI A;  4OB0 B;  3CBO A;  4RKU E;  2BIV A;  3V8L A;  3ZEH A;  4M77 D;  4RG8 A;  3GP8 A;  1U8R A;  1KG1 A;  3OMG A;  4N0A C;  2RI2 A;  1PSE A;  5DY9 A;  2LT4 A;  2HQX A;  4M77 E;  4E47 A;  2IVW A;  4M77 F;  2VXF A;  2E64 A;  2JUF A;  4IUT A;  3GPL A;  4OMF B;  4M78 F;  2M1H A;  2PVG B;  4MZM A;  5IAY A;  5HK3 A;  1VQP A;  2DK3 A;  2PVO B;  2CZ6 B;  3H6Z A;  4C8Q G;  3CCL A;  1Y07 A;  4RG2 A;  3FIF A;  2M0O A;  4HCC A;  3PMI A;  4YTL A;  4BB7 A;  1VQ6 T;  1SSF A;  1Y96 B;  3CCS T;  1MHN A;  4OB3 B;  4FSX A;  3JCM W;  3OYA A;  1RI0 A;  5GMK h;  2PVD B;  1I4K 1;  5GAN 2;  1Q82 U;  3BFM A;  2C06 A;  1KC8 C;  5CVI A;  4CRI A;  1VUB A;  4C92 D;  4ELZ C;  3M58 A;  1VQ9 T;  1KQ1 A;  2CZ7 B;  2LX9 A;  2KDS A;  1XTD A;  5DLO A;  1K9M U;  5LJ5 h;  1M9S A;  2NLU A;  4C92 E;  2LQK A;  4PJO B;  2RHX A;  4M7D D;  2DD5 A;  4M75 D;  3CD6 A;  5GAO m;  3OYJ A;  4MZT A;  3MEV A;  3OBY A;  2LQ8 A;  5FRO A;  5A0L A;  5CQX A;  4E7J A;  1JB0 E;  3CME A;  3E9G A;  4M7A C;  3LWH A;  3F70 A;  2O4X B;  3JCM f;  3PT9 A;  1K9M C;  4V2S A;  2XDB A;  2XI9 A;  2VV5 A;  3SWN B;  5CK9 A;  1UEB A;  1QVG A;  2XID A;  2BUD A;  4ZGE B;  4ZN3 A;  2RM4 A;  3FB9 A;  4Y91 A;  2KQW A;  2K2V A;  1M1F A;  5GAN j;  2K3X A;  3HP9 A;  3SD4 A;  4C8Q E;  5LJ5 d;  4OGE A;  2K57 A;  3JCM Q;  5GAO r;  1YI2 T;  4VUB A;  3G71 T;  2QA4 A;  3CCJ A;  2X35 A;  4N0A A;  1B34 B;  1MGQ A;  2EKO A;  2QXF A;  1H64 1;  3DB3 A;  3GNG A;  3MET A;  4M75 C;  4C5I A;  3QXE B;  3EFS A;  4C8Q D;  1QVF A;  1KHI A;  2EJG A;  4QVC A;  3V7R A;  5CKH A;  3X25 B;  1K73 C;  2ZCF B;  1VQ8 A;  3OYC A;  2DAQ A;  3FJP A;  1YJ9 A;  2EJ9 A;  2K5I A;  2H3J A;  3P8H A;  4C8Q B;  2DXB A;  3JCM d;  1LNX A;  2JOY A;  3CCE A;  2MMP A;  3CMA T;  1M90 C;  4II1 A;  4J7I A;  3JCM P;  3RMQ A;  3RKY A;  3NTK A;  2RH2 A;  3CC2 A;  1TH7 A;  2DTI A;  3A5Z B;  4JRK A;  4NL2 A;  4QQ6 A;  4C92 C;  3LGF A;  5LJ3 h;  1M1G A;  3CPW S;  2F5T X;  3CCM A;  3HSB A;  5GAN f;  1BYM A;  2EAY A;  3VUZ A;  4P5N A;  2GFU A;  3M53 A;  2PU9 B;  4QQD A;  1O75 A;  3G7Z A;  4KUI A;  3WVD B;  4MDX A;  2DIG A;  1O9S A;  5LJ3 j;  3OYM A;  5CCA A;  2GF7 A;  1QW1 A;  3OA6 A;  2M16 A;  2RD1 A;  2DVE A;  4A4F A;  2EWN A;  4FT4 A;  1K73 U;  2XU8 A;  2ZZD A;  3GNF B;  5IN1 A;  2RHU A;  3Q1J A;  2ZPG B;  4PJO D;  1Q7Y U;  3INZ A;  2RJF A;  5KCO A;  2QA4 T;  2QQ9 A;  3V7C A;  3C94 A;  5KCH A;  1Q86 C;  4XAX B;  3OMC A;  4A53 A;  4BAC A;  3CCL T;  2A3L A;  4FT2 A;  3A8G B;  3V7S A;  4M7A A;  5GAM h;  5GAN d;  2OAU A;  4M75 F;  5CO7 A;  1D3B A;  4PJO F;  3DKM A;  4DOW A;  3JCM e;  4ZTF A;  4ZN1 A;  4M75 G;  1OZ3 A;  2EJF A;  2IG0 A;  2MF2 A;  4E7L A;  1VQ4 T;  2CKK A;  1KQS S;  1WQ7 A;  4UC4 A;  2GQV A;  2RI3 A;  4CI0 C;  3JCM X;  3G4S A;  3JB9 G;  4KT0 E;  1BI1 A;  3RKX A;  4IUP A;  4C0F A;  2WSC E;  5IT9 E;  2Y4Y A;  4MZP A;  3KXT A;  3L2U A;  4PLL A;  2Y4X A;  4C92 F;  3CD6 T;  5I21 A;  1M1K C;  4FU6 A;  3VV0 A;  1BIA A;  2E6Z A;  2DXT A;  4KBM B;  4QQG A;  4ZGD B;  1VQL A;  1X01 A;  4C5G A;  2PUO B;  2ZPH B;  1YHQ T;  1UB4 A;  3BDU A;  3MEU A;  4R55 A;  1UGQ B;  2XK0 A;  4XTV A;  4XU3 A;  5GMK e;  1YHQ A;  1V29 B;  4M7D E;  1YIT A;  1VQ7 T;  3CCU A;  1WQW A;  2CZ0 B;  3MP6 A;  3CXC A;  4JJN K;  3JCM c;  3P8D A;  1VQO A;  3M5A A;  2CZ1 B;  3ZFJ A;  2HD0 A;  2LC4 A;  2O01 E;  4M78 C;  4BY6 B;  5GAN g;  2XIC A;  3OYN A;  3L2V A;  2RK2 A;  4Y28 E;  5GAM f;  2JTM A;  3PIO A;  3CCS A;  1W4S A;  3RMS A;  1K8A U;  2V8J A;  4JDS A;  1VQ6 A;  4IUV A;  3MCA B;  4F7U A;  5GAO p;  4DA4 A;  1Q81 C;  3VJP A;  4N4I A;  2E10 A;  1VQ5 T;  2EQK A;  1ZQ1 A;  2X4W A;  3OSV A;  1G3W A;  5A2Q E;  1VQP T;  4EPC A;  1BKB A;  2AHJ B;  4M78 E;  3RES A;  3HHT B;  3OB9 A;  4M78 A;  4BE0 A;  1YI2 A;  1KQS A;  3I56 A;  1VQ9 A;  5GAN 6;  4C5H A;  3NFC A;  1NPR A;  2QQS A;  2DTO A;  4F7U G;  5GAM d;  1M8V A;  5J26 A;  3TU4 K;  4A54 A;  3TCJ A;  3QDR B;  2RHI A;  4M78 G;  5J3B A;  3JB9 I;  1VQK A;  4HA8 A;  4IUU A;  2LCL A;  2MWP A;  2Y90 A;  1WPY A;  1XNI A;  5GAM j;  2G3R A;  1PSF A;  3LX7 A;  4C0G A;  4JRQ A;  2DXC A;  1N9S A;  3DB4 A;  3O8V A;  2DPP B;  2XDD A;  4X9C A;  1YIJ T;  4M7D C;  3A8M B;  4X9D A;  4J7F A;  2VGN A;  3L2W A;  3KBG A;  2KSS A;  3JB9 J;  1WJQ A;  3FEO A;  2OTL T;  4J6Y A;  2XG8 D;  4KUD K;  3MEW A;  3J7A F;  2R5A A;  1JBM A;  2ZPI B;  2XKO C;  3OS5 A;  1DJ7 B;  3CPW A;  3LWI A;  3GF5 A;  3CME T;  2ZPF B;  1UGP B;  2YLC A;  4PLI A;  3BW1 A;  4HT9 A;  2EQJ A;  1I8F A;  2QTX A;  3M4G A;  3QJY A;  3QYG B;  4J5Y A;  1VQ4 A;  4MMK A;  3ME9 A;  3V8K A;  4PJO E;  2P0Q A;  4J83 A;  3L2R A;  1QVG S;  1N9R A;  3QUI A;  3MO8 A;  3OYD A;  1KD1 U;  3OYL A;  4PKC C;  4E7H A;  2R57 A;  1QVF S;  3QO3 A;  3HKS A;  1OI1 A;  4BE1 A;  3CC7 A;  3JB9 H;  2X4J A;  2RJD A;  3V8J A;  3AHU A;  2JZ2 A;  5FRN A;  1M5Q 1;  1KC8 U;  4C8Q F;  1ZBX A;  3M56 A;  4EMK A;  4E7K A;  1YCY A;  3T9N A;  1RL2 A;  1N6A A;  3OYB A;  3CCV T;  4XTY A;  3C4S A;  3QPH A;  4M77 G;  4X34 A;  4RCB A;  3I55 T;  5GMK l;  3GOX A;  3ASK A;  2LTO A;  5CKE A;  4OF1 A;  2FB7 A;  2DTH A;  3JCM V;  5GMK m;  5GAN e;  5LJ3 g;  3OYF A;  2KK4 A;  5KE3 A;  4OB2 B;  4RMO A;  1VQN T;  4N4G A;  1X75 C;  4KUL A;  2ZGW A;  3CCM T;  4QW2 A;  3CCQ A;  4M7D G;  3CC2 T;  3TRE A;  3OY9 A;  1VQN A;  4XTZ A;  5FLX E;  3TEE A;  4M75 A;  4M7D A;  5FRM A;  4BI4 A;  2WSF E;  1P92 A;  2KVQ G;  5GAN 3;  1VQM A;  3J80 E;  5CAI A;  3QZ5 B;  4MML A;  1Q86 U;  3E9F A;  4JLG A;  4L6V 5;  3L2Q A;  5LJ5 j;  3G71 A;  2O4X A;  2V8K A;  3CCU T;  1BI3 A;  3VU3 C;  3QG1 A;  1EIF A;  2E1H A;  3QKJ A;  1FX7 A;  4C0D B;  3KUF A;  3JCM g;  4C8Q C;  4O5V A;  4J6X A;  4C0D C;  5GAN 4;  5GAO l;  4BE2 A;  1VQK T;  3VYG A;  1BIB A;  4O6J A;  2DZ9 A;  2LVM A;  4LD9 K;  1R8O B;  2VYT A;  3S3N A;  3PTA A;  4C92 B;  4JRI A;  1S72 T;  3QSU A;  4OVA A;  5D6Y A;  4ATO A;  2HQE A;  3I56 T;  2VGM A;  3M57 A;  5LJ5 g;  2VXE A;  2P0P A;  1KQ2 A;  5CIU A;  2EIF A;  1LJO A;  3DLL A;  4IUQ A;  3E19 A;  1I5L A;  3PNW C;  3LYI A;  5LJ5 e;  4N4H A;  3S6W A;  1BI2 A;  3CCQ T;  2FVU A;  2JVV A;  2E65 A;  2L5Q A;  4ZGJ B;  3VYH B;  5FU6 C;  3GIB A;  2K5F A;  5DLQ E;  4F7U B;  5FU7 B;  3OYK A;  4M77 A;  5FU6 B;  1BI0 A;  2X4Y A;  3CXC S;  3S3M A;  1I81 A;  1D3B B;  4OP0 A;  4L59 A;  3OYI A;  3JSC A;  3QBY A;  1XQH A;  1X6O A;  3SWN A;  5GMK i;  4M7D F;  1UGS B;  3G6E A;  3UWN A;  1GXI E;  3SFM A;  3PMT A;  4JUV A;  1IRE B;  5CQY A;  1QP3 A;  3L2Z A;  3R6O A;  4BUG A;  5M9O A;  3UT1 A;  2LNV A;  4QVD A;  3HFN A;  1LOJ A;  2DXU A;  1G3T A;  3OYH A;  3L42 A;  1ZHI A;  3X26 B;  2R5M A;  2RHZ A;  4LDW A;  4M7A E;  2B8A A;  4GY5 A;  1NJI C;  2DKG A;  3HRT A;  2VC8 A;  2CYZ B;  5D6W A;  3SB2 A;  4NOY A;  4HCZ A;  4DOV A;  3OYG A;  2ZPE B;  3BDL A;  4J6W A;  1VIE A;  2A7Y A;  5CR2 A;  3OS0 A;  3RUX A;  5GAO n;  1W2B S;  1AHJ B;  1YJ9 T;  2XHC A;  4XU2 A;  2JN0 A;  3PIP A;  2X4X A;  2L3R A;  2KY9 A;  3OYY A;  3X24 B;  2ZPB B;  4ME7 A;  4IUR A;  2DD4 A;  3HPW A;  2L89 A;  4PNO A;  5CKF A;  3LW5 E;  5LL6 S;  3CC4 T;  2OTJ T;  3PFS A;  4NS5 A;  5GAO q;  1N8R U;  4HT8 A;  5LJ5 f;  2E12 A;  2XDP A;  1M1K U;  2E70 A;  2RJC A;  4WF2 A;  2EQU A;  3LGL A;  2LCC A;  3OSS C;  4M78 D;  3OBW A;  2M9U A;  4XU0 A;  3CBM A;  3URG A;  3LH0 A;  2GFA A;  3CCR T;  1NZ9 A;  2RB6 A;  4PJO C;  5L8R E;  3E1S A;  3HFO A;  4C0Z A;  5LJ3 d;  5GMK j;  3S3O A;  5GAN 8;  1YJN A;  3FDR A;  2YRV A;  3NTH A;  1M90 U;  4M7A B;  2K3Y A;  1FXX A;  3HL8 A;  2RA2 A;  5GAM e;  1H3Z A;  1WJR A;  3JRZ A;  5KE2 A;  4C92 G;  4M7A F;  4BDY A;  4EDU A;  1WNL A;  2QQA A;  4M75 E;  4FM4 B;  2YHT A;  2KMT A;  4XTW A;  3SWN C;  3ZBD A;  3J81 E;  1VQ5 A;  2FYK A;  3VUB A;  4F7U F;  1NPP A;  2RHY A;  4C8Q A;  3JB9 F;  1JJ2 S;  3CCE T;  2LRQ A;  2F5K A;  3LLR A;  3P8B B;  4IKF A;  4M7A G;  4BI3 A;  4R56 A;  5LJ3 f;  3WVE B;  1Q82 C;  1G3Y A;  5HKC A;  1KD1 C;  3MP8 A;  3PGG A;  3QHS A;  2RJE A;  4M75 B;  3RKW A;  3CCV A;  2D0Q B;  4EMG A;  2DEQ A;  4M7D B;  1YIT T;  1VQ7 A;  3OYE A;  5HK0 A;  2RK1 A;  3X20 B;  3FRN A;  3OW2 S;  4C5E A;  3ER0 A;  2K5L A;  1FWZ A;  3EAE A;  3A8L B;  3HRS A;  1Y96 A;  2QEX T;  4OB1 B;  3C95 A;  1XOV A;  5I2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...