3JB9D

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
SLCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSHIRFLIVPDMLRNAPMFKVGPGRSVPLPTRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 13
structure length 96
sequence length 96
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9D00
4F7UG 4M75F 5GAOl 1B34B 2RA2A 3EFSA 2DZ9A 4M75G 4C8QG 5DY9A 5I21A 3JB9J 2HNIA 3JCMe 2YLBA 3BDUA 4M78C 3SB2A 4M7AD 3JCMg 5LJ3j 2YLCA 3L2ZA 3V8JA 4C8QD 4M78A 4M7AE 4QVCA 3INZA 5LJ5j 3JCMb 5GAMd 2DTOA 1HXDA 2ZGWA 4RCBA 1D3BB 4XQ3A 4C8QE 5GAN6 2E1HA 4XU2A 3V8LA 4C92F 5GANj 2EJGA 4X9DA 2QTXA 4XTWA 4C92G 1BIAA 3V7RA 3FIFA 2EWNA 2E10A 2YHTA 3JCMV 5LJ3e 4M7DC 1B34A 4NL2A 5GMKm 3QUIA 4EMKB 2VC8A 1MGQA 5CAIA 1KQ2A 4PJOC 1WNLA 4JUVA 1KQ1A 3V7CA 5GAMe 4C92D 3JCMf 4MMKA 3RERA 4M77G 5GMKj 1JBMA 5GAMg 2DEQA 5GANe 3JB9F 4HT8A 3FJPA 4RCCA 3JB9G 4C92E 1M8VA 1LJOA 1I8FA 4JLIA 4M7AB 3RUXA 4F7UB 1TH7A 5GAOr 4F7UF 2Y90A 4M77D 4XU0A 4M78F 1D3BA 4A54A 2EJ9A 4C8QB 5LJ3d 4M78G 3JCMW 4M75D 1YCYA 3JB9D 2DTHA 1Y96B 4EMKC 4M77E 5GMKe 4NL3A 4F7UE 3VU3C 4V2SA 4PNOA 5LJ5d 3RIRA 1N9RA 2FYKA 4M75E 2DXUA 3QO3A 4EMKA 3JCMh 4X9CA 4XTXA 5GANd 4HT9A 2K57A 5GAOp 4EMHA 5GAMf 3V7SA 1X01A 2RB6A 4XTYA 4M7AC 2I2LA 3HFOA 4M7DF 4NOYA 1H641 5GAOm 2RM4A 5LJ3g 4C92B 4PJOF 4C8QC 5GAN2 3V8KA 4M7DG 4M7AA 3M4GA 4F7UA 4PJOG 5LJ5e 3JCMQ 1I5LA 4C8QA 4WF2A 5LJ5g 4N0AC 3HFNA 4J6WA 4XTZA 4M7DD 1Y96A 2DXTA 5GANg 3SWNB 4M77B 4N0AA 5GAN8 4PJOD 2DKGA 1U1SA 3AHUA 4M75B 5GAN4 2RD1A 5GAMh 3BW1A 2DVEA 4C92C 1BIBA 4XTUA 1JRIA 3L1AA 4M7AG 2JN0A 5LJ3f 3QHSA 3RKWA 3GIBA 5GAN5 3JCMX 4C92A 2DTIA 3BFMA 3FB9A 4M78D 5GAOn 2CGHA 5LJ5f 1WQWA 1LNXA 1U1TA 3RESA 4M77C 3SWNC 3EFRA 3HSBA 5GANf 4M78E 5GMKh 4J5YA 1HK9A 4M75C 5GMKl 3SWNA 2FB7A 2EAYA 4M77A 4C8QF 5GAN3 2VXEA 4DQ2A 4Y91A 3JB9I 4M75A 4M7DB 2DZCA 2E41A 4PJOB 1LOJA 4XU3A 4XU1A 5LJ3h 4JRIA 4J6XA 5GAN7 4QVDA 1I4K1 4MMLA 3BY7A 4J6YA 3PGGA 2EJFA 4M7DE 3JCMJ 5GAMj 5LJ5h 4HA8A 1I81A 3JB9H 4PJOE 3JCMP 4EMGA 2E65A 5GANh 1N9SA 3RKXA 2DJZA 3QSUA 4M78B 2E64A 2VXFA 5GMKi 4XTVA 3JCMd 4A53A 1WPYA 4JRKA 4OP0A 3RKYA 4M77F 4M7DA 3JCMc 4M7AF 1WQ7A 4PJOA 5GAOq 1M5Q1
chains in the Genus database with same CATH superfamily
2MMPA 3M4YA 2OTLQ 1CSKA 4QW2A 5FU6C 2ATCB 2QQSA 3I9QA 2CT4A 2RPNA 3RMSA 1PRMC 4LUDA 3TVTA 3CBOA 5IHKA 1K73R 3CCVT 3DB4A 1TUDA 1VQKT 4XTWA 2LVMA 4M7DC 5CKDA 1KK7A 4JUVA 2ZPHB 1O75A 1UHCA 3MCAB 3CC4T 2X51A 5GAOr 4ZNXA 3QZ9B 4A54A 2DXCA 2YUOA 5GMKe 3OYFA 2A37A 1NZ9A 3QO3A 1YI2A 4RTYA 1PD1A 5GAMf 1Q7YU 4CC2A 1BCMA 1OV3A 3PMIA 1PG5B 1WZOA 2EGEA 2RHYA 1TXQA 3OBYA 4IIMA 2DILA 3QPHA 1NYGA 2C0IA 2K3YA 3HKSA 4OMMA 5CKBA 3JCMX 2F69A 2KRMA 3M5AA 1O9SA 3EG9A 1M2OA 2VV5A 1KD1C 1WHGA 2DM1A 2EQKA 4D6WA 3SWNA 2JTEA 2F2VA 4M77A 1FXXA 2RJDA 1JXOA 2DFUA 3GNGA 4JRIA 2VVKA 5FWCA 4DA4A 3G1JA 1VQMQ 1YJ9T 4AFZC 2QA4A 3A8HB 3I56A 2P4RA 4M78B 2VB6A 4MZPA 2BIVA 1XQHA 2A0FB 4C8QG 4HCCA 1VQ6Q 3OY9A 3MEVA 1WGSA 2DA9A 3CMEQ 1VYTA 3INZA 1YWOA 3CC2T 5IH2A 2E1HA 3V8LA 4A4GA 2O9VA 5GANj 5HK3A 3MEUA 3PFSA 5CQXA 1IREB 2K2VA 4E2FB 3HL8A 2XMFA 1MNDA 2PVDB 3M57A 5FRMA 3JCMf 2R58A 1EFNA 3KUFA 3G4SA 4LDVA 1H8KA 1I8FA 1PKSA 2Y90A 2KNBB 3Q1JA 4M75D 1WDXA 1QP3A 1I5OB 4QKUA 3CC7A 2WACA 2KI7A 2OJ2A 2D0QB 4J9FA 2FYKA 5LJ5d 4OMLA 3M0RA 4OMFB 2FO0A 4XTYA 5CKFA 1YJNT 3LH0A 1K1ZA 3HPWA 4M7DG 3LH5A 1NYFA 1WHJA 4FT4A 1K4US 4XTZA 4E7LA 2KR3A 2XU8A 3TREA 1YITT 5GAMh 1N27A 2E3HA 1GCPA 2E6ZA 2QGGA 4HCZA 4BUGA 1JU5C 4FT2A 2DTIA 4J9CA 2QDYB 2YRVA 1NEGA 2P0KA 2LCCA 3CCMT 4E6RA 3H8ZA 1HK9A 4RMOA 1VQOQ 5LL6S 4DQ2A 1UDLA 3G71T 2EGCA 1X2QA 1ZX6A 4FIBA 2LNVA 3M0TA 5IXFA 3EGXB 1M2VA 2FPFA 4E7SA 2RHXA 2L0AA 1Q81U 5KE2A 2CZ1B 4MZTA 3L2WA 1G3TA 1WPYA 3MHXA 3GOXA 4CC3A 4HKEA 2OAWA 5C0MA 1VQ9T 1YJWA 1WQ7A 1VQNA 1Q82U 2RA2A 2FG0A 4JS5A 3JSCA 1G8XA 3CCUA 3E9FA 2HBPA 1JB0E 2ZPEB 2KAFA 3SHWA 1E7OA 1WHHA 1VQLT 4KUDK 1Y07A 3CCET 2QQBA 3EGDA 4RCBA 1MV3A 2V1QA 3X20B 4C92G 1T0HA 1D1AA 2E10A 2EPDA 3S3NA 4XAXB 2LDMA 4EMKB 2DL8A 1P92A 2RQVA 3CCJQ 4ZGDB 2L89A 3SD4A 2LZ6B 1LCKA 2MI6A 3TEEA 3CCLT 3ME9A 2YDLA 4F7UB 4J9IA 2RI5A 2K9GA 3RR6A 4BB7A 1M4ZA 1VQ4T 1YIJT 3CXCS 1XTDA 3M55A 3JCMh 4HT9A 3M54A 2X4YA 3RMQA 4EMHA 1IO6A 1QVGP 4XK8E 4WF2A 3E19A 2LCLA 3A98A 4A4EA 1IZ6A 1QVFP 4BI8B 1U1SA 1WLPB 1H3ZA 4M75B 3NTKA 4FSSA 2RD1A 4N4GA 2QEXT 3OS1A 1ZSZC 5AT1B 3CD6A 5LJ5f 2D6FA 1KSWA 4C5HA 4M78E 2RK2A 3G6EA 4HVWA 7AT1B 1YHQT 2VKNA 4FYYB 5GJVB 3M0PA 4ZGEB 2DIQA 1I81A 1I07A 2XIDA 4EMGA 2DJZA 4PLLA 3CCVA 1WXUA 4J8OA 1SEMA 1VQKA 5CK9A 1QCNA 4M77F 8ATCB 3QJYA 1Z9ZA 3SFMA 5I21A 4M78C 2OTLT 2X3XD 4D8KA 4DOVA 3CC4A 1S72A 3M0SA 3JCMb 2O01E 4X9DA 1NM7A 2RMOA 4JDSA 5LJ3e 4LN2A 5GMKm 3EG1A 5FWBA 1Q81C 1KQ2A 1KQ1A 3VUBA 4PFPA 5A0LA 4ME7A 4QVZA 4RCCA 3JB9G 3HRTA 1G3YA 2K3XA 1UGSB 3UF4A 1TH7A 4XU0A 4KULA 2EJ9A 1TSFA 3CCRQ 2Y4YA 3F70A 3L2VA 1K0SA 4PNOA 3LGFA 5GANd 2K57A 3V7SA 1QVGA 2Y4XA 4M7DF 1BCOA 2RH2A 5LJ3g 4O6JA 1DJ7B 3CCST 4IKFA 2QK0A 2RQUA 1NBEB 2RNAA 1QVFA 1U5SA 2GBQA 1XNIA 5GAN4 1WI7A 3H0IA 2YXYA 2MOXA 2R5MA 2DVEA 4DBQA 1BYMA 2XG8D 1KIKA 1AD5A 1PRLC 2LTOA 2VWFA 4TVRA 2AKKA 1BBZA 2GQVA 1B3QA 2FB7A 2EAYA 3VS6A 2SEMA 3A8OB 1C0MA 4KRTA 3CEYA 3IQLA 3MKDA 4XU1A 4GLKA 3HHTB 1G3WA 2JTFA 5LJ5h 4HA8A 3SDZA 2BKDN 1SRMA 4PJOE 2H3EB 5FRNA 1YBYA 1EX4A 2AZVA 2O4XB 1VQMT 4PJLA 1WIEA 4IIOA 3OA6A 3NGPA 1GCQC 2R5AA 2DL5A 5CR2A 5GAOl 4JLGA 5DY9A 1JEGA 2VGMA 3CQTA 3QYGB 3VKIA 2VYTA 1PCXA 5J3BA 3THKA 4DBHA 1OOTA 1UE9A 4L6V5 1FMVA 2YUNA 4M78A 2GCXA 3ER0A 4C92F 3CMET 3PTAA 1OPKA 1UG1A 2CP7A 4PJOC 2XI9A 3META 3C94A 3UPUA 2EQMA 2MAMA 1I0CA 4YTLA 5HY6A 4GY5A 2AZSA 3JAME 4M78G 5KYUB 4EMKC 2KXDA 1SRLA 4M75E 1M90C 1JJ2A 3ZEHA 5CO7A 2F5KA 3HFOA 2HL5C 4JRQA 1H641 4AG2C 2MF2A 2JTMA 1W6XA 2OTJQ 3HFNA 1HSQA 4QQ6A 4LE9A 3G71A 4O5VA 2D1XA 5J39A 1KD1R 4L5GA 5ECAA 3CMAA 3EG2A 4LDYA 4IUTA 1V76A 2CREA 2D8HA 2KGTA 3QHSA 1LVKA 3OYGA 2A3LA 5GAOn 2EIFA 4QQGA 5KYXB 1M27C 4FU6A 3S6WA 5GANf 2R57A 5GMKh 4J5YA 4M75C 1VQ9A 2GFAA 1UFFA 5FROA 4LXCA 4J9DA 1J3TA 4ORZA 2QI2A 1Q86R 1T0JA 1WXTA 2E65A 3CCEA 2HD0A 1SPKA 3OQ5A 2VXFA 2ENMA 1UGQB 1KQSA 4M7AG 2PVGB 1GCQA 3EGXA 4QT7A 4BE0A 1FX7A 3CCLA 3M58A 3PIPA 1K9MU 4X34A 2ESWA 2YT6A 2YUQA 5A0DA 2VGNA 2QTXA 2L3SA 4OMQA 4BY6B 2YHTA 2GTJA 1C6VX 2QYZA 3QUIA 4CC4B 3OS0A 3EHRA 3DKMA 2RQWA 1PSFA 5GMKj 2DEQA 3JB9F 3VYHB 1NLPC 1YI2Q 3CCJT 1V29B 2RO0A 4J9BA 3M59A 4EIKA 1Y96B 4NL3A 3QBYA 4EMKA 4RKUE 1KC8U 1X01A 4MDWA 1MMAA 1KFZA 4FYVB 1PNJA 3VRYA 2MIOA 1WJSA 3MP8A 4PJOG 4F7UA 1NJIU 4DBRA 1ZUUA 4J7FA 3OYAA 4J6WA 3VS4A 1R0BG 1SHFA 2FPEA 3CCQA 2XDBA 2ROLA 2RI2A 3BDLA 1MV0B 2KT8A 2X3WD 2A36A 1M3BA 3MEWA 3OMCA 4HXJA 3X26B 1TTHB 3DLLA 2HKNA 5IHIA 1K73U 1ARKA 3VJPA 4A4FA 1UGVA 4JPBW 1B07A 1GFCA 1JXMA 2KSSA 4C5EA 5GAN3 3JB9I 4M75A 2DIGA 3QDRB 2BUDA 2QA4Q 1X6BA 1D1CA 2E70A 3I56Q 3NMZC 1X75C 4AG1C 2JT4A 2LQKA 5GJWB 3PT9A 1R8OB 5GANh 4VUBA 1AWXA 2RJCA 2HCKA 4PKCC 1W4SA 4M75G 2J05A 1OPLA 1ZQ1A 3BE3A 4KGXB 2YRCA 2O31A 4QVCA 2EYYA 2K79A 3OB9A 3LWIA 2K5FA 3G4SQ 3EHQA 1U3OA 1TUCA 2MK5A 1QVGS 3EH2A 1MMDA 3D7SB 2DD5A 3X28B 4M77G 2D9TA 3ASKA 1QKXA 3UDCA 3CC7Q 3CCSA 1X6GA 1M8VA 1XOVA 4KH1B 3SEMA 1AEYA 3OSVA 3KBGA 1QVFS 4M78F 3A8GB 2AKLA 3JCMW 2AT1B 3TCJA 1ZUYA 3I55T 1VA7A 3RIRA 2GGRA 2VUBA 3CCRT 3QKJA 5CQYA 5L8RE 4LDUA 2JM9A 1KG1A 2NUTB 1VQPT 1SF9A 4M4ZA 3I35A 1UTIA 2JNGA 1IRXA 3ULRB 3OYLA 4IUPA 2EBPA 2KXCA 3ZBDA 2JN0A 2AHJB 1QP2A 3CPWS 1BI2A 1I1JA 5GAN5 5CCAA 5KCOA 4Y28E 3RESA 2WSFE 5HKCA 1D1BA 4DEYA 2EYXA 2DO3A 4AFUC 2ZPFB 4RTZA 2O88A 2VXEA 3VS3A 4Q5WA 2HSEB 4F16A 2MWOA 3UATA 4C0FA 4PL6A 2F2XA 2RJEA 3OYMA 5HK0A 4JJCA 3JCMJ 4ATOA 3JB9H 1YJWQ 2XHCA 1VQNQ 2CP3A 1B7TA 4ELZC 1QQJA 2RQRA 4ZN3A 1GBRA 3CCUQ 3MJXA 3M56A 1JQQA 4M7AF 3REBB 5GAOq 2ROTA 1K73C 2EKOA 1Q7YC 1BB9A 1ZLMA 3LWHA 4PJNA 1AT1B 1VYVA 1VQ8T 4BI4A 1ZBXA 1WJQA 4B6MA 5C6SA 2X9HA 3I5SA 4C8QD 2O4XA 4A63B 4ANJA 1K8AU 3RNJA 2DTOA 1HXDA 4KBMB 4OB1B 1HJDA 1D3BB 2BZXA 3X24B 5I22A 1JJ2S 3OYBA 4NL2A 1HYOA 1VQ5A 1MGQA 2XICA 3CPFA 2EYWA 2RHUA 4KT0E 3FJPA 1F1BB 2F5TX 5I2SA 3TQ7P 2A28A 3NFCA 4BY6C 2NWMA 3E9GA 4LDWA 3KXTA 1SSFA 4PLIA 2DTHA 4C0DB 3FC3A 4FSXA 2DRKA 4PJMA 4XTXA 2DL3A 2PUOB 1AWOA 2AK5A 1VQ7T 1X69A 4LD6A 4PJOF 3A1PA 2H8HA 1ACMB 2WSEE 2MWPA 5KYUA 2YSQA 4M7DD 5GAN8 3AHUA 3CD6Q 4JZ4A 4BDZA 2V26A 2RHZA 4LNPA 2V8IA 1UJYA 3J7AF 4ESRA 2ABLA 3PIOA 3G6EQ 3P8BB 5IAYA 3HSBA 2GQIA 1FYNA 4OVAA 2ED0A 1KQSS 2RN8A 3I5RA 1SG5A 1RUWA 5KCHA 3UA6A 3ZL7C 1QCFA 1BI0A 3CCVQ 3LGLA 2LQ8A 2J06A 2OAUA 1I4K1 4DOWA 2DK3A 4J6YA 1VQKQ 4WCIA 1WXBA 5KYXA 2LJ0A 3MP1A 4AMCA 2KVQG 1K9AA 4J83A 2DNUA 2L2PA 2DERA 4OP0A 3CC4Q 2L8DA 1S72Q 4M75F 4EDUA 1V1CA 2YLBA 2BTTA 1MHNA 5LJ3j 4DEXA 5CKHA 2LT4A 1W2BA 4BE2A 2KDSA 4HCBA 5GAN6 1BK2A 1K0XA 3CPWP 5D6WA 3RDVA 2QTVA 1RAIB 4C92D 2EVRA 3HP9A 4MMKA 4RTVA 5GAMg 1M90R 4MZMA 2FZKB 1RL2A 4K11A 2HQHA 2BZ8A 4C8QB 1BKBA 1WYXA 1Z9QA 1YI2T 3OYCA 3OYJA 1GXIE 2DXUA 4C5IA 2K3BA 1MMGA 2V8JA 1K8AC 1CKBA 2LNHB 2EFIA 2COZA 2J6KA 4PK4A 4E7JA 2D0NA 4X1VA 4C5GA 2KYMA 4N4IA 4OB2B 1Y96A 1RACB 3PE0A 3WVDB 1Q82C 1IB8A 4FM4B 1FMKA 1K76A 4XTUA 1JRIA 3L1AA 1KJWA 3GIBA 1YCSB 2JZ2A 2CGHA 1Y0MA 1JJ2P 2QASA 1OX9A 1UJ0A 3EAEA 2K5LA 5HCKA 1N8RU 2X4XA 2K7AA 1MUZA 4M7DB 3TU4K 2C0TA 4HCKA 1IGUA 3P8HA 4J6XA 4CC7A 4QVDA 3BY7A 2NUPB 2LQWA 3EFOB 4MDXA 3RKXA 1QMCA 1YJ9A 2HEQA 3LLRA 4JRKA 1QVPA 2NYSA 2IVWA 4JJDA 3OW2A 1WHMA 2CZ0B 1UUEA 4BE1A 1B34B 2KMTA 3OYNA 2RI3A 1X27A 4KGVB 4WTOB 3BDUA 3M0UA 3JCMg 3L2RA 2F1LA 2JVVA 2M02A 1M1KU 1E6HA 1E6GA 4IURA 3VS5A 2LJ1A 2V8KA 1A0NB 3MPUB 3CPWA 3I55A 2E6NA 3CC2A 5DLOA 4P5NA 3H6ZA 3QJ6A 1OI1A 5CAIA 5KYNA 3G4ST 4RTTA 3OYYA 1KQSP 4HVVA 1VQPA 2J6FA 2ECZA 2JM8A 2I0NA 3CC7T 4DBFA 3JB9D 1BU1A 5J26A 3G7ZA 3PVQA 1VQ6T 4F7UE 1RI0A 2HKQB 3A8MB 1YP5A 2RF0A 4C92B 4CRIA 3CBPA 2PTKA 3PMTA 1YJNA 2ED1A 2X4JA 2DJQA 3CMAQ 2ZCFB 2PVOB 5FU7B 2KQWA 3HTRA 1XJWB 1YITA 2CH4W 2NUTA 2KRNA 3BFMA 1NLOC 2CZ7B 2P4TA 2CP5A 4ZTFA 2CZ6B 2DYBA 3M9QA 2D8JA 3CCMA 1ZUKA 4IUQA 1OU9A 1IHWA 3CCEQ 4J9EA 4E7ZA 1LOJA 3EGUA 1VQ8A 3PGGA 2HQEA 5KYWA 1M1FA 3M0QA 1TUGB 1G3SA 2LMJA 2CH4A 1WX6A 3QZ5B 1YJWT 1VQNT 4A4HA 2HMAA 4FL6A 3RERA 1D0ZA 2G6FX 3CCUT 4JJNK 2RHIA 5A2QE 3P8DA 2KEAA 4LDXA 1N8RC 1VQOT 2FPDA 2IPOB 2DBMA 3V8JA 1BI1A 5L23A 1VQLA 3MO8A 4C8QE 1KD1U 3NHNA 4ZTJA 4OGEA 1KHIA 2QQRA 2CKKA 4J7IA 1OX8A 1G83A 1WJRA 1SSHA 1VQ7A 1X6OA 2CYZB 3CBMA 1OYXA 1UGRB 2EQUA 1D3BA 2CP0A 5LJ3d 3A5ZB 2OI3A 1N9RA 4KGZB 1M1KC 3VUZA 4X9CA 2CDTA 5GAOp 1VQ4A 1YIJA 2ZZDA 2C0OA 1Q86U 3X25B 4Z02A 3CCQQ 2CS7A 2KT1A 2XKOC 4C8QC 3V8KA 2YUPA 3FJ5A 3H41A 1CKAA 3REAB 5LJ5g 3OMGA 4F04B 1PD0A 1PC0A 2XDPA 2QEXA 1OU8A 4E7KA 2CUDA 3UT1A 4FW2A 1UGPB 2GF7A 1LNXA 1OZ3A 1G2BA 2B86A 5I2MA 1FWZA 3G6ET 2FRYA 1OQKA 2A7YA 2Z0WA 2DZCA 4AFQC 4ELYC 4XU3A 2RJFA 2DF6A 2PUKB 1VYUA 1YHQA 2CSIA 3VYGA 3DLMA 1Q7YR 5CVIA 3JCMP 2L3QA 1W2BS 2SRCA 1N9SA 1AWWA 2E64A 4C0ZA 3GPLA 4A53A 3RKYA 1AHJB 1W1FA 5IXBA 2XD0A 2G3RA 1T3SA 3QYHB 4F7UG 2DEUA 3NPFA 3URGA 2DZ9A 4B9WA 2MCNA 3QDFA 1S72T 4M7AD 1JO8A 1M30A 1BI3A 2OTLA 2FEIA 2HL3A 4XQ3A 5KH6A 2JMAA 1NPPA 3CCSQ 2E4HA 2DMOA 1ZSZB 5KYYB 3VRZA 2KRSA 1M3CA 2QXFA 1M8MA 1M1GA 1Y7XA 2DE0X 2EQJA 4C92E 3AT1B 2K4YA 3QWYA 3T9NA 3GF5A 1RAAB 1PSEA 1M3AA 4J9HA 2K6DA 2OX7A 4KUIA 5D6YA 1RAFB 1QWEA 5M9OA 1ZSGA 4NS5A 1PWTA 2RB6A 2M9UA 2DVJA 5GAOm 2DBKA 4IUVA 3JCMQ 4LUEA 2C06A 4C8QA 1WA7A 3A8LB 3H9NA 3OYIA 4PJOD 3MEAA 1D09B 2V1RA 1YNZA 9ATCB 2JOYA 1WHKA 4C92C 2WSCE 3E2UA 5LJ3f 3RKWA 3S3OA 1K9MC 4OMPA 5I11A 3O8VA 3VS7A 3H0FA 3OBWA 3VV0A 5FU7C 5GMKl 3OW2S 1Q86C 3OYHA 2QAZA 2CP6A 3L42A 4N4HA 4RTXA 5GAN7 3TSZA 1NE8A 2JXBA 2M16A 6AT1B 3OS2A 1H3HA 2P84A 4JJBA 4FYXB 1HD3A 4OB3B 2CSQA 3EH1A 4E7IA 5KYWB 3L2QA 1RLQC 1VQMA 4M7DA 2P0QA 2W10A 4OB0B 1KC8C 3EFSA 4OMOA 2HNIA 2NUPA 3EFOA 1NJIC 2LJ3A 2QG9B 2NUZA 1GFDA 2LRQA 3GBQA 1VQ5Q 2ZGWA 2J7IA 4RUGA 1VQ6A 3OYDA 2EJGA 2GFUA 3V7RA 2HAXA 3JCMV 1B34A 2DD4A 3CMEA 5EG2A 1N6AA 3V7CA 5GANe 2F2WA 4FYWB 1K8AR 4JLIA 4M7AB 3RUXA 1TS9A 2EYZA 4BI3A 1QLYA 4M77D 4E7HA 1Q81R 2ZPBB 2E5QA 4V2SA 4AFSC 4JRPA 1W2BP 2MPXC 1D0YA 1Q82R 3GNFB 1UEBA 3VS0A 5KE3A 2RM4A 5GAN2 1PKTA 2AIRB 2KK4A 8AT1B 4PJJA 5GANg 3CMAT 1TU0B 2X4WA 4JS4A 1PHTA 1BIBA 1OZ2A 2NLUA 2K2MA 2L3RA 2IIMA 4C92A 3FDRA 3FRNA 2ZPGB 2ZPIB 3EFRA 2EGAA 2ZAEA 1OEBA 2FRWA 4R56A 2KE9A 3O5ZA 4IUUA 3WXMB 4PJOB 2DL4A 3OS5A 5LJ3h 4MMLA 1VQOA 2OTJT 5GAMj 2HBWA 2H3JA 3MP6A 4II1A 1TWBA 2EW3A 2E5KA 4OGCA 1AZEA 4F7UF 2KYBA 4D8DA 2FZCB 1GBQA 3R6NA 3J81E 1G5VA 1SHGA 2O9SA 2KY9A 5CKEA 2VASA 3GP8A 1YN8A 4HVUA 5A0GA 2M51A 2JJ9A 4BD3A 2GTOA 1NEBA 3L2UA 2E12A 1WNLA 4GBQA 3RBBB 5GAMe 3OW2P 3PVLA 2PNIA 4L59A 4Y92A 1R0CB 3GLXA 3H0HA 3CCJA 1VOMA 4PFOA 2LX9A 3TSWA 2JW4A 2O2OA 1U06A 3J80E 2COYA 2EQIA 1H92A 1NG2A 3EG9B 3CCQT 4N0AC 4LD9K 2DXTA 3SWNB 4M77B 4BDYA 2W0ZA 4OF1A 4Z8AA 2LP5A 2DETA 3BW1A 3EG3A 3FLGA 4RTWA 4RTUA 2M0YA 3FB9A 1U1TA 2BE7D 1QWFA 4C8QF 1QKWA 3OYKA 4Y91A 2DLPA 2QQAA 4A4KA 4F14A 1TG0A 1VIFA 1YJ9Q 1M90U 1YWPA 1T3LA 1N5ZA 2HZYA 2EJFA 2JMCA 2PZ1A 2YWWA 5FU6B 1N8RR 1ZBJA 4OMNA 2B8AA 3LYIA 1ABQA 3LX7A 3QWXX 1IXDA 1RABB 1M5Q1 2CT3A 3M53A 2CUBA 3JB9J 3JCMe 2J6OA 3CC2Q 3I55Q 3SB2A 2P0PA 2RK1A 3L2ZA 2QA4T 5CIUA 4M7AE 3I56T 1ZA2B 4XU2A 2JS0A 2CP2A 3QXEB 1VQPQ 4R0KA 2EWNA 4F17A 1AZGB 5FW9A 1RLPC 2VC8A 5IN1A 4C0GA 1JBMA 4RG8A 4HT8A 1M1KR 3EG0A 4B9XA 1LJOA 3N5BB 4ZN1A 1X2KA 2QDLA 3C4SA 4AT1B 2JUFA 1ZHIA 2FL7A 4CI0C 3VU3C 4BACA 3OSSC 1ZSZA 5KYYA 1YJNQ 3DB3A 1GL5A 1Y57A 3CCRA 4M7AC 4NOYA 1MNEA 2DX1A 2YRDA 1U8RA 1RI9A 2E3IA 5EC7A 1I5LA 3VS1A 2KBTA 1TOVA 4QQDA 1YITQ 1M9SA 1X43A 4N0AA 2DKGA 2EYQA 2MYSA 1RAHB 1UHFA 3JV3A 2DRMA 2M0OA 3KFVA 3CXCP 3CCMQ 1M2VB 1EIFA 3G71Q 2LC4A 1AOJA 4FW1A 1VQ8Q 3ZFJA 4UC4A 2DYIA 2LCSA 1WFWA 2PU9B 4C0DC 2GNCA 1D0XA 1AVZC 5FLXE 2FVUA 3C95A 2BE9B 3UA7A 3C0CA 1MMNA 1RAGB 3FEOA 4PFZA 3S3MA 4JZ3A 1VQ9Q 1EZZB 5AYFA 3EGDB 5GMKi 5D6XA 2HQXA 2JS2A 3UWNA 1C1AA 1QW1A 3U23A 2LT1A 2DL7A 3JCMc 2DAQA 2IG0A 2EKHA 1SKUB 5DM7R 3QG1A 4RG2A 1VQLQ 2PQWA 4Z89A 2YLCA 2K5IA 2LX7A 2RQTA 5LJ5j 5GAMd 2XK0A 1VQ7Q 2A08A 2QQ9A 4FCYA 4KH0B 1BIAA 3JRZA 1VQ5T 3FIFA 2DPPB 1QCOA 2COWA 5IT9E 3CCLQ 5D7UA 3NTHA 3PNWC 2KROA 3WVEB 2XDDA 4GLMA 1UB4A 1IGQA 2FZGB 1Y71A 1FMWA 1W70A 1YIJQ 1VQ4Q 1YCYA 2BZYA 1Q95G 1RAEB 4M77E 4EPCA 2DXBA 2X35A 1VUBA 2I2LA 1R77A 1WHLA 1KHCA 4M7AA 3M4GA 5LJ5e 1VIEA 1K9MR 4ZGJB 1OULA 2QEXQ 1S1NA 1LPLA 3R6OA 3NTIA 1GRIA 1RADB 2FHDA 3QIIA 2HDAA 2OTJA 3CXCA 3HRUA 5DLQE 2L5QA 5IHNA 1AWJA 4M78D 1PM3A 1WQWA 1YFNA 4J9GA 3SWNC 1IHVA 3E1SA 4M77C 2QGFB 1UECA 1ABOA 3VS2A 1YHQQ 3C12A 2E41A 1NPRA 4R55A 3LW5E 4M7DE 2L3PA 1KC8R 2M1HA 2HSPA 3OYEA 4Z88A 3CD6T 3QSUA 1ZA1B 3HRSA 2LQNA 1NJIR 4XTVA 3JCMd 4E47A 4PJOA
chains in the Genus database with same CATH topology
2MMPA 4M75F 1KC8C 3M4YA 5GAOl 3EFSA 4JLGA 4QW2A 5DY9A 5FU6C 2VGMA 4EDUA 2HNIA 3QYGB 2YLBA 3VKIA 1MHNA 2QQSA 2VYTA 5J3BA 1NJIC 3RMSA 5LJ3j 5CKHA 4L6V5 4M78A 2LRQA 2LT4A 3CBOA 2GCXA 1W2BA 2ZGWA 4BE2A 2KDSA 3ER0A 3CCVT 1M8VA 4HCBA 5GAN6 3OYDA 1VQ6A 4C92F 3DB4A 2EJGA 3CMET 1VQKT 2GFUA 4XTWA 2LVMA 3V7RA 3PTAA 2HAXA 5D6WA 3JCMV 4M7DC 1B34A 2DD4A 3CMEA 4PJOC 2XI9A 3META 5EG2A 5CKDA 4JUVA 1N6AA 3V7CA 4C92D 3C94A 2ZPHB 3HP9A 2EQMA 4MMKA 3UPUA 2MAMA 5GAMg 5GANe 4MZMA 1O75A 4YTLA 5HY6A 4GY5A 1RL2A 3MCAB 4JLIA 3CC4T 4M7AB 3RUXA 4BI3A 3JAME 5GAOr 4M77D 3QZ9B 4A54A 4C8QB 4E7HA 1BKBA 2DXCA 4M78G 2ZPBB 1YI2T 2E5QA 4EMKC 5GMKe 3OYFA 3OYCA 4V2SA 3OYJA 4JRPA 4M75E 1NZ9A 2DXUA 3QO3A 1YI2A 4C5IA 1M90C 1GXIE 1JJ2A 2V8JA 5GAMf 1Q7YU 1K8AC 3ZEHA 3GNFB 2EFIA 5CO7A 2F5KA 3HFOA 1UEBA 5KE3A 4JRQA 1H641 2RM4A 5GAN2 3PMIA 4E7JA 2KK4A 4C5GA 2RHYA 2MF2A 2JTMA 3HFNA 4N4IA 4OB2B 4QQ6A 3OBYA 3G71A 1Y96A 5GANg 4O5VA 5J39A 3WVDB 3QPHA 3CMAT 2X4WA 1Q82C 3CC2A 4L5GA 2K3YA 4FM4B 3CMAA 3HKSA 4JS4A 4LDYA 4IUTA 1BIBA 4XTUA 1JRIA 1OZ2A 3L1AA 2NLUA 5CKBA 3QHSA 3GIBA 2L3RA 3JCMX 2F69A 2JZ2A 3FDRA 3M5AA 4C92A 2A3LA 5GAOn 2EIFA 3FRNA 1O9SA 2CGHA 3OYGA 2ZPGB 2VV5A 4QQGA 4FU6A 2ZPIB 1KD1C 3EFRA 3S6WA 5GANf 2R57A 2EQKA 5GMKh 4J5YA 4D6WA 4M75C 4R56A 3EAEA 2K5LA 3SWNA 4M77A 1N8RU 2X4XA 1VQ9A 1FXXA 2GFAA 2RJDA 5FROA 4M7DB 4IUUA 3WXMB 3TU4K 4PJOB 3OS5A 5LJ3h 3GNGA 4JRIA 3P8HA 4J6XA 4QVDA 4MMLA 3BY7A 1VQOA 2OTJT 4DA4A 5GAMj 2QI2A 2H3JA 1YJ9T 4MDXA 2QA4A 2E65A 3CCEA 3A8HB 2HD0A 3MP6A 4II1A 3RKXA 3I56A 3OQ5A 1YJ9A 4M78B 2VXFA 3LLRA 4MZPA 2BIVA 4OGCA 4JRKA 1QVPA 1XQHA 1UGQB 1KQSA 2IVWA 4F7UF 3OW2A 2CZ0B 4M7AG 2PVGB 3J81E 4BE1A 1B34B 1G5VA 2KMTA 3OYNA 2RI3A 4C8QG 4BE0A 1FX7A 4HCCA 3OY9A 3MEVA 3BDUA 3CCLA 2KY9A 3M58A 5CKEA 3JCMg 3PIPA 5CR2A 3L2RA 1K9MU 3GP8A 4X34A 2JVVA 1WGSA 1M1KU 3INZA 3CC2T 5A0DA 2VGNA 4IURA 2V8KA 2E1HA 3V8LA 4A4GA 5A0GA 3CPWA 5HK3A 3I55A 2E6NA 5GANj 5DLOA 2QTXA 4P5NA 3MEUA 4BD3A 3H6ZA 3PFSA 3QJ6A 4BY6B 5CQXA 1IREB 2YHTA 2K2VA 3QUIA 1OI1A 3HL8A 5CAIA 2PVDB 3L2UA 2E12A 1WNLA 3OS0A 3M57A 3DKMA 5GAMe 5FRMA 3G4ST 3JCMf 3OYYA 1PSFA 2R58A 5GMKj 2DEQA 3JB9F 3VYHB 1VQPA 3KUFA 3G4SA 4LDVA 1I8FA 3CCJT 1V29B 2RO0A 2Y90A 4L59A 3GLXA 3CC7T 3Q1JA 3M59A 4M75D 5J26A 3CCJA 3JB9D 1QP3A 1Y96B 3G7ZA 1VQ6T 4NL3A 3CC7A 4F7UE 3QBYA 2WACA 2LX9A 5LJ5d 2D0QB 2FYKA 4EMKA 1RI0A 4RKUE 1KC8U 1X01A 3J80E 3A8MB 4OMFB 4XTYA 4MDWA 5CKFA 1YJNT 3LH0A 3HPWA 4M7DG 4C92B 4CRIA 3CBPA 4F7UA 1WJSA 3MP8A 3PMTA 4PJOG 1YJNA 1NJIU 2X4JA 4FT4A 4J7FA 3OYAA 4N0AC 4J6WA 3CCQT 4LD9K 4XTZA 2ZCFB 4E7LA 2DXTA 2PVOB 2XU8A 3SWNB 4M77B 3TREA 3CCQA 4BDYA 4OF1A 2XDBA 5FU7B 2RI2A 1YITT 2KQWA 3BDLA 3BW1A 5GAMh 1N27A 4HCZA 2E6ZA 3MEWA 3X26B 3OMCA 4BUGA 1YITA 4FT2A 3FLGA 3DLLA 2DTIA 3BFMA 3FB9A 1K73U 2QDYB 2CZ7B 2YRVA 1U1TA 2P4TA 2P0KA 2LCCA 3CCMT 3VJPA 3H8ZA 4A4FA 4ZTFA 1HK9A 2CZ6B 3M9QA 4RMOA 4C8QF 5LL6S 3CCMA 5GAN3 4C5EA 2KSSA 4DQ2A 3OYKA 3G71T 4Y91A 3JB9I 4IUQA 4M75A 2DIGA 3QDRB 2BUDA 2QQAA 4FIBA 2LNVA 4A4KA 1VIFA 2E70A 1LOJA 1VQ8A 1M90U 1X75C 3PGGA 2HQEA 2EJFA 2LQKA 3PT9A 1M1FA 1R8OB 2RHXA 5GANh 4VUBA 5FU6B 1Q81U 1G3SA 5KE2A 2RJCA 2CZ1B 4MZTA 3L2WA 3QZ5B 4PKCC 1YJWT 2B8AA 1G3TA 1WPYA 3MHXA 4A4HA 3GOXA 1VQNT 3LYIA 4HKEA 3LX7A 5C0MA 1VQ9T 4FL6A 1W4SA 1WQ7A 1YJWA 3RERA 1VQNA 1M5Q1 1Q82U 3M53A 3CCUT 2RA2A 4JS5A 4M75G 4JJNK 2RHIA 3JSCA 3JB9J 5A2QE 3P8DA 3CCUA 3E9FA 3JCMe 4LDXA 1ZQ1A 1N8RC 3SB2A 2HBPA 1VQOT 2P0PA 1JB0E 2RK1A 2ZPEB 2KAFA 1VQLT 3L2ZA 3V8JA 1Y07A 4KUDK 2QA4T 3CCET 2QQBA 5CIUA 4QVCA 4M7AE 3I56T 4RCBA 1BI1A 1VQLA 3MO8A 4C8QE 1KD1U 3OB9A 4XU2A 3LWIA 2K5FA 3X20B 4C92G 3QXEB 4HT9A 4ZTJA 2EWNA 2E10A 3S3NA 4OGEA 1KHIA 4XAXB 2LDMA 2VC8A 5IN1A 2QQRA 4EMKB 2CKKA 1QVGS 4C0GA 4J7IA 2DD5A 1WJRA 3X28B 4M77G 1VQ7A 1JBMA 1P92A 1X6OA 4ZGDB 2CYZB 2D9TA 2L89A 3ASKA 3CBMA 4RG8A 3SD4A 3UDCA 3CCSA 4B9XA 4HT8A 2MI6A 1OYXA 1LJOA 1XOVA 3ME9A 3TEEA 1UGRB 3N5BB 4ZN1A 3CCLT 3OSVA 2EQUA 4F7UB 3KBGA 1QVFS 2RI5A 3C4SA 1D3BA 3A8GB 2JUFA 1ZHIA 4M78F 5LJ3d 3JCMW 2FL7A 3A5ZB 4CI0C 3TCJA 3VU3C 4BB7A 1M4ZA 3I55T 3OSSC 4BACA 3RIRA 1N9RA 3CXCS 1VQ4T 1YIJT 2VUBA 1XTDA 3DB3A 3CCRT 1M1KC 3M55A 4X9CA 3JCMh 3VUZA 3M54A 2X4YA 3QKJA 3RMQA 4EMHA 5GAOp 1VQ4A 2ZZDA 5CQYA 1YIJA 5L8RE 1Q86U 4LDUA 3X25B 3CCRA 4Z02A 4M7AC 4NOYA 2CS7A 1KG1A 2XKOC 4C8QC 3V8KA 1U8RA 1VQPT 1I5LA 4QQDA 4XK8E 4WF2A 5LJ5g 3OMGA 3E19A 2LCLA 1M9SA 4A4EA 1IZ6A 2JNGA 4N0AA 2DKGA 1U1SA 4BI8B 2EYQA 1H3ZA 3OYLA 4M75B 3NTKA 2RD1A 4N4GA 2QEXT 4IUPA 3OS1A 2M0OA 2XDPA 3ZBDA 2JN0A 2AHJB 1QP2A 2QEXA 4E7KA 3CPWS 1BI2A 3UT1A 5GAN5 3CD6A 5CCAA 1UGPB 2GF7A 1LNXA 5KCOA 5LJ5f 4Y28E 1OZ3A 3RESA 1EIFA 2D6FA 2LC4A 4C5HA 2WSFE 5HKCA 4M78E 3ZFJA 5I2MA 2DO3A 1FWZA 2RK2A 4UC4A 3G6ET 2ZPFB 2VXEA 2PU9B 4Q5WA 2A7YA 3G6EA 4C0DC 2DZCA 4ELYC 1YHQT 2MWOA 4XU3A 4C0FA 2RJFA 5FLXE 4PL6A 2PUKB 4ZGEB 2FVUA 2RJEA 1YHQA 3C95A 3OYMA 3VYGA 5HK0A 3JCMJ 4ATOA 2DIQA 3DLMA 1I81A 2XIDA 5CVIA 3JB9H 3JCMP 4EMGA 2XHCA 1W2BS 3FEOA 1N9SA 2DJZA 3S3MA 4PLLA 3CCVA 4ELZC 2E64A 4J8OA 5AYFA 4C0ZA 3GPLA 4ZN3A 5GMKi 5D6XA 1VQKA 5CK9A 4A53A 2HQXA 3RKYA 1AHJB 3M56A 1QW1A 4M77F 2G3RA 3UWNA 2LT1A 3QJYA 3JCMc 2XD0A 3QYHB 5GAOq 1K73C 4M7AF 2EKOA 4F7UG 1Q7YC 2DAQA 3URGA 2IG0A 2DZ9A 3SFMA 3LWHA 5I21A 3QG1A 4RG2A 5DM7R 4B9WA 2PQWA 1S72T 1VQ8T 4M78C 4M7AD 4BI4A 2OTLT 1ZBXA 3CC4A 1WJQA 4DOVA 1BI3A 5C6SA 1S72A 2YLCA 4C8QD 2K5IA 2O4XA 2OTLA 5LJ5j 3JCMb 5GAMd 2DTOA 1HXDA 2XK0A 4KBMB 4OB1B 1K8AU 1D3BB 4XQ3A 2O01E 3X24B 5KH6A 2QQ9A 4X9DA 1BIAA 1NPPA 3JRZA 1VQ5T 3FIFA 4JDSA 2DPPB 5LJ3e 1JJ2S 5GMKm 4NL2A 3OYBA 1Q81C 1VQ5A 1MGQA 1KQ2A 2XICA 3CPFA 1KQ1A 5IT9E 2RHUA 2QXFA 3NTHA 3VUBA 5A0LA 3PNWC 4ME7A 4KT0E 4QVZA 1M1GA 1Y7XA 3WVEB 2XDDA 3FJPA 4RCCA 3JB9G 1UB4A 2EQJA 3HRTA 4C92E 1G3YA 2F5TX 2K3XA 1UGSB 5I2SA 1TH7A 2K4YA 1Y71A 4XU0A 3NFCA 4KULA 4BY6C 2EJ9A 3E9GA 3T9NA 3GF5A 4LDWA 3KXTA 1PSEA 2Y4YA 1YCYA 1SSFA 3F70A 2DTHA 4PLIA 4M77E 4KUIA 3L2VA 5D6YA 4C0DB 4PNOA 3FC3A 3LGFA 4FSXA 4EPCA 2DXBA 5M9OA 4XTXA 5GANd 2K57A 2X35A 4NS5A 2PUOB 3V7SA 1VUBA 2RB6A 2I2LA 1QVGA 2Y4XA 4M7DF 2M9UA 5GAOm 2RH2A 5LJ3g 4LD6A 4O6JA 4PJOF 1VQ7T 1DJ7B 1KHCA 4M7AA 4IUVA 3M4GA 5LJ5e 3JCMQ 3CCST 1VIEA 2C06A 4C8QA 4IKFA 4ZGJB 2WSEE 2MWPA 3A8LB 3OYIA 4M7DD 1QVFA 1XNIA 4PJOD 5GAN8 3MEAA 3AHUA 3R6OA 3NTIA 5GAN4 4BDZA 2RHZA 2FHDA 3QIIA 2V8IA 2JOYA 2R5MA 2DVEA 3J7AF 4C92C 3CXCA 2OTJA 2XG8D 1BYMA 2WSCE 3HRUA 5DLQE 2L5QA 5LJ3f 3RKWA 3PIOA 3S3OA 1K9MC 3O8VA 2LTOA 4TVRA 4M78D 3P8BB 1WQWA 3OBWA 4M77C 3E1SA 3SWNC 5IAYA 3HSBA 3VV0A 4OVAA 5FU7C 5GMKl 2GQVA 1KQSS 2FB7A 2EAYA 3OW2S 1Q86C 5KCHA 3A8OB 3OYHA 3L42A 3C12A 2E41A 3CEYA 1NPRA 4N4HA 1BI0A 4GLKA 4XU1A 5GAN7 3HHTB 1NE8A 3LGLA 2LQ8A 2M16A 2OAUA 1I4K1 4DOWA 4R55A 2DK3A 4J6YA 3LW5E 1G3WA 2JTFA 3OS2A 4M7DE 5LJ5h 4HA8A 3SDZA 2BKDN 4PJOE 2M1HA 3OYEA 3CD6T 3QSUA 3HRSA 3MP1A 5FRNA 1YBYA 2O4XB 4OB3B 2KVQG 1VQMT 4E7IA 4J83A 4XTVA 3JCMd 3L2QA 3OA6A 4OP0A 1VQMA 4M7DA 2P0QA 2R5AA 2L8DA 4E47A 4OB0B 4PJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U G;  4M75 F;  5GAO l;  1B34 B;  2RA2 A;  3EFS A;  2DZ9 A;  4M75 G;  4C8Q G;  5DY9 A;  5I21 A;  3JB9 J;  2HNI A;  3JCM e;  2YLB A;  3BDU A;  4M78 C;  3SB2 A;  4M7A D;  3JCM g;  5LJ3 j;  2YLC A;  3L2Z A;  3V8J A;  4C8Q D;  4M78 A;  4M7A E;  4QVC A;  3INZ A;  5LJ5 j;  3JCM b;  5GAM d;  2DTO A;  1HXD A;  2ZGW A;  4RCB A;  1D3B B;  4XQ3 A;  4C8Q E;  5GAN 6;  2E1H A;  4XU2 A;  3V8L A;  4C92 F;  5GAN j;  2EJG A;  4X9D A;  2QTX A;  4XTW A;  4C92 G;  1BIA A;  3V7R A;  3FIF A;  2EWN A;  2E10 A;  2YHT A;  3JCM V;  5LJ3 e;  4M7D C;  1B34 A;  4NL2 A;  5GMK m;  3QUI A;  4EMK B;  2VC8 A;  1MGQ A;  5CAI A;  1KQ2 A;  4PJO C;  1WNL A;  4JUV A;  1KQ1 A;  3V7C A;  5GAM e;  4C92 D;  3JCM f;  4MMK A;  3RER A;  4M77 G;  5GMK j;  1JBM A;  5GAM g;  2DEQ A;  5GAN e;  3JB9 F;  4HT8 A;  3FJP A;  4RCC A;  3JB9 G;  4C92 E;  1M8V A;  1LJO A;  1I8F A;  4JLI A;  4M7A B;  3RUX A;  4F7U B;  1TH7 A;  5GAO r;  4F7U F;  2Y90 A;  4M77 D;  4XU0 A;  4M78 F;  1D3B A;  4A54 A;  2EJ9 A;  4C8Q B;  5LJ3 d;  4M78 G;  3JCM W;  4M75 D;  1YCY A;  3JB9 D;  2DTH A;  1Y96 B;  4EMK C;  4M77 E;  5GMK e;  4NL3 A;  4F7U E;  3VU3 C;  4V2S A;  4PNO A;  5LJ5 d;  3RIR A;  1N9R A;  2FYK A;  4M75 E;  2DXU A;  3QO3 A;  4EMK A;  3JCM h;  4X9C A;  4XTX A;  5GAN d;  4HT9 A;  2K57 A;  5GAO p;  4EMH A;  5GAM f;  3V7S A;  1X01 A;  2RB6 A;  4XTY A;  4M7A C;  2I2L A;  3HFO A;  4M7D F;  4NOY A;  1H64 1;  5GAO m;  2RM4 A;  5LJ3 g;  4C92 B;  4PJO F;  4C8Q C;  5GAN 2;  3V8K A;  4M7D G;  4M7A A;  3M4G A;  4F7U A;  4PJO G;  5LJ5 e;  3JCM Q;  1I5L A;  4C8Q A;  4WF2 A;  5LJ5 g;  4N0A C;  3HFN A;  4J6W A;  4XTZ A;  4M7D D;  1Y96 A;  2DXT A;  5GAN g;  3SWN B;  4M77 B;  4N0A A;  5GAN 8;  4PJO D;  2DKG A;  1U1S A;  3AHU A;  4M75 B;  5GAN 4;  2RD1 A;  5GAM h;  3BW1 A;  2DVE A;  4C92 C;  1BIB A;  4XTU A;  1JRI A;  3L1A A;  4M7A G;  2JN0 A;  5LJ3 f;  3QHS A;  3RKW A;  3GIB A;  5GAN 5;  3JCM X;  4C92 A;  2DTI A;  3BFM A;  3FB9 A;  4M78 D;  5GAO n;  2CGH A;  5LJ5 f;  1WQW A;  1LNX A;  1U1T A;  3RES A;  4M77 C;  3SWN C;  3EFR A;  3HSB A;  5GAN f;  4M78 E;  5GMK h;  4J5Y A;  1HK9 A;  4M75 C;  5GMK l;  3SWN A;  2FB7 A;  2EAY A;  4M77 A;  4C8Q F;  5GAN 3;  2VXE A;  4DQ2 A;  4Y91 A;  3JB9 I;  4M75 A;  4M7D B;  2DZC A;  2E41 A;  4PJO B;  1LOJ A;  4XU3 A;  4XU1 A;  5LJ3 h;  4JRI A;  4J6X A;  5GAN 7;  4QVD A;  1I4K 1;  4MML A;  3BY7 A;  4J6Y A;  3PGG A;  2EJF A;  4M7D E;  3JCM J;  5GAM j;  5LJ5 h;  4HA8 A;  1I81 A;  3JB9 H;  4PJO E;  3JCM P;  4EMG A;  2E65 A;  5GAN h;  1N9S A;  3RKX A;  2DJZ A;  3QSU A;  4M78 B;  2E64 A;  2VXF A;  5GMK i;  4XTV A;  3JCM d;  4A53 A;  1WPY A;  4JRK A;  4OP0 A;  3RKY A;  4M77 F;  4M7D A;  3JCM c;  4M7A F;  1WQ7 A;  4PJO A;  5GAO q;  1M5Q 1; 
#chains in the Genus database with same CATH topology
 2MMP A;  3M4Y A;  2OTL Q;  1CSK A;  4QW2 A;  5FU6 C;  2ATC B;  2QQS A;  3I9Q A;  2CT4 A;  2RPN A;  3RMS A;  1PRM C;  4LUD A;  3TVT A;  3CBO A;  5IHK A;  1K73 R;  3CCV T;  3DB4 A;  1TUD A;  1VQK T;  4XTW A;  2LVM A;  4M7D C;  5CKD A;  1KK7 A;  4JUV A;  2ZPH B;  1O75 A;  1UHC A;  3MCA B;  3CC4 T;  2X51 A;  5GAO r;  4ZNX A;  3QZ9 B;  4A54 A;  2DXC A;  2YUO A;  5GMK e;  3OYF A;  2A37 A;  1NZ9 A;  3QO3 A;  1YI2 A;  4RTY A;  1PD1 A;  5GAM f;  1Q7Y U;  4CC2 A;  1BCM A;  1OV3 A;  3PMI A;  1PG5 B;  1WZO A;  2EGE A;  2RHY A;  1TXQ A;  3OBY A;  4IIM A;  2DIL A;  3QPH A;  1NYG A;  2C0I A;  2K3Y A;  3HKS A;  4OMM A;  5CKB A;  3JCM X;  2F69 A;  2KRM A;  3M5A A;  1O9S A;  3EG9 A;  1M2O A;  2VV5 A;  1KD1 C;  1WHG A;  2DM1 A;  2EQK A;  4D6W A;  3SWN A;  2JTE A;  2F2V A;  4M77 A;  1FXX A;  2RJD A;  1JXO A;  2DFU A;  3GNG A;  4JRI A;  2VVK A;  5FWC A;  4DA4 A;  3G1J A;  1VQM Q;  1YJ9 T;  4AFZ C;  2QA4 A;  3A8H B;  3I56 A;  2P4R A;  4M78 B;  2VB6 A;  4MZP A;  2BIV A;  1XQH A;  2A0F B;  4C8Q G;  4HCC A;  1VQ6 Q;  3OY9 A;  3MEV A;  1WGS A;  2DA9 A;  3CME Q;  1VYT A;  3INZ A;  1YWO A;  3CC2 T;  5IH2 A;  2E1H A;  3V8L A;  4A4G A;  2O9V A;  5GAN j;  5HK3 A;  3MEU A;  3PFS A;  5CQX A;  1IRE B;  2K2V A;  4E2F B;  3HL8 A;  2XMF A;  1MND A;  2PVD B;  3M57 A;  5FRM A;  3JCM f;  2R58 A;  1EFN A;  3KUF A;  3G4S A;  4LDV A;  1H8K A;  1I8F A;  1PKS A;  2Y90 A;  2KNB B;  3Q1J A;  4M75 D;  1WDX A;  1QP3 A;  1I5O B;  4QKU A;  3CC7 A;  2WAC A;  2KI7 A;  2OJ2 A;  2D0Q B;  4J9F A;  2FYK A;  5LJ5 d;  4OML A;  3M0R A;  4OMF B;  2FO0 A;  4XTY A;  5CKF A;  1YJN T;  3LH0 A;  1K1Z A;  3HPW A;  4M7D G;  3LH5 A;  1NYF A;  1WHJ A;  4FT4 A;  1K4U S;  4XTZ A;  4E7L A;  2KR3 A;  2XU8 A;  3TRE A;  1YIT T;  5GAM h;  1N27 A;  2E3H A;  1GCP A;  2E6Z A;  2QGG A;  4HCZ A;  4BUG A;  1JU5 C;  4FT2 A;  2DTI A;  4J9C A;  2QDY B;  2YRV A;  1NEG A;  2P0K A;  2LCC A;  3CCM T;  4E6R A;  3H8Z A;  1HK9 A;  4RMO A;  1VQO Q;  5LL6 S;  4DQ2 A;  1UDL A;  3G71 T;  2EGC A;  1X2Q A;  1ZX6 A;  4FIB A;  2LNV A;  3M0T A;  5IXF A;  3EGX B;  1M2V A;  2FPF A;  4E7S A;  2RHX A;  2L0A A;  1Q81 U;  5KE2 A;  2CZ1 B;  4MZT A;  3L2W A;  1G3T A;  1WPY A;  3MHX A;  3GOX A;  4CC3 A;  4HKE A;  2OAW A;  5C0M A;  1VQ9 T;  1YJW A;  1WQ7 A;  1VQN A;  1Q82 U;  2RA2 A;  2FG0 A;  4JS5 A;  3JSC A;  1G8X A;  3CCU A;  3E9F A;  2HBP A;  1JB0 E;  2ZPE B;  2KAF A;  3SHW A;  1E7O A;  1WHH A;  1VQL T;  4KUD K;  1Y07 A;  3CCE T;  2QQB A;  3EGD A;  4RCB A;  1MV3 A;  2V1Q A;  3X20 B;  4C92 G;  1T0H A;  1D1A A;  2E10 A;  2EPD A;  3S3N A;  4XAX B;  2LDM A;  4EMK B;  2DL8 A;  1P92 A;  2RQV A;  3CCJ Q;  4ZGD B;  2L89 A;  3SD4 A;  2LZ6 B;  1LCK A;  2MI6 A;  3TEE A;  3CCL T;  3ME9 A;  2YDL A;  4F7U B;  4J9I A;  2RI5 A;  2K9G A;  3RR6 A;  4BB7 A;  1M4Z A;  1VQ4 T;  1YIJ T;  3CXC S;  1XTD A;  3M55 A;  3JCM h;  4HT9 A;  3M54 A;  2X4Y A;  3RMQ A;  4EMH A;  1IO6 A;  1QVG P;  4XK8 E;  4WF2 A;  3E19 A;  2LCL A;  3A98 A;  4A4E A;  1IZ6 A;  1QVF P;  4BI8 B;  1U1S A;  1WLP B;  1H3Z A;  4M75 B;  3NTK A;  4FSS A;  2RD1 A;  4N4G A;  2QEX T;  3OS1 A;  1ZSZ C;  5AT1 B;  3CD6 A;  5LJ5 f;  2D6F A;  1KSW A;  4C5H A;  4M78 E;  2RK2 A;  3G6E A;  4HVW A;  7AT1 B;  1YHQ T;  2VKN A;  4FYY B;  5GJV B;  3M0P A;  4ZGE B;  2DIQ A;  1I81 A;  1I07 A;  2XID A;  4EMG A;  2DJZ A;  4PLL A;  3CCV A;  1WXU A;  4J8O A;  1SEM A;  1VQK A;  5CK9 A;  1QCN A;  4M77 F;  8ATC B;  3QJY A;  1Z9Z A;  3SFM A;  5I21 A;  4M78 C;  2OTL T;  2X3X D;  4D8K A;  4DOV A;  3CC4 A;  1S72 A;  3M0S A;  3JCM b;  2O01 E;  4X9D A;  1NM7 A;  2RMO A;  4JDS A;  5LJ3 e;  4LN2 A;  5GMK m;  3EG1 A;  5FWB A;  1Q81 C;  1KQ2 A;  1KQ1 A;  3VUB A;  4PFP A;  5A0L A;  4ME7 A;  4QVZ A;  4RCC A;  3JB9 G;  3HRT A;  1G3Y A;  2K3X A;  1UGS B;  3UF4 A;  1TH7 A;  4XU0 A;  4KUL A;  2EJ9 A;  1TSF A;  3CCR Q;  2Y4Y A;  3F70 A;  3L2V A;  1K0S A;  4PNO A;  3LGF A;  5GAN d;  2K57 A;  3V7S A;  1QVG A;  2Y4X A;  4M7D F;  1BCO A;  2RH2 A;  5LJ3 g;  4O6J A;  1DJ7 B;  3CCS T;  4IKF A;  2QK0 A;  2RQU A;  1NBE B;  2RNA A;  1QVF A;  1U5S A;  2GBQ A;  1XNI A;  5GAN 4;  1WI7 A;  3H0I A;  2YXY A;  2MOX A;  2R5M A;  2DVE A;  4DBQ A;  1BYM A;  2XG8 D;  1KIK A;  1AD5 A;  1PRL C;  2LTO A;  2VWF A;  4TVR A;  2AKK A;  1BBZ A;  2GQV A;  1B3Q A;  2FB7 A;  2EAY A;  3VS6 A;  2SEM A;  3A8O B;  1C0M A;  4KRT A;  3CEY A;  3IQL A;  3MKD A;  4XU1 A;  4GLK A;  3HHT B;  1G3W A;  2JTF A;  5LJ5 h;  4HA8 A;  3SDZ A;  2BKD N;  1SRM A;  4PJO E;  2H3E B;  5FRN A;  1YBY A;  1EX4 A;  2AZV A;  2O4X B;  1VQM T;  4PJL A;  1WIE A;  4IIO A;  3OA6 A;  3NGP A;  1GCQ C;  2R5A A;  2DL5 A;  5CR2 A;  5GAO l;  4JLG A;  5DY9 A;  1JEG A;  2VGM A;  3CQT A;  3QYG B;  3VKI A;  2VYT A;  1PCX A;  5J3B A;  3THK A;  4DBH A;  1OOT A;  1UE9 A;  4L6V 5;  1FMV A;  2YUN A;  4M78 A;  2GCX A;  3ER0 A;  4C92 F;  3CME T;  3PTA A;  1OPK A;  1UG1 A;  2CP7 A;  4PJO C;  2XI9 A;  3MET A;  3C94 A;  3UPU A;  2EQM A;  2MAM A;  1I0C A;  4YTL A;  5HY6 A;  4GY5 A;  2AZS A;  3JAM E;  4M78 G;  5KYU B;  4EMK C;  2KXD A;  1SRL A;  4M75 E;  1M90 C;  1JJ2 A;  3ZEH A;  5CO7 A;  2F5K A;  3HFO A;  2HL5 C;  4JRQ A;  1H64 1;  4AG2 C;  2MF2 A;  2JTM A;  1W6X A;  2OTJ Q;  3HFN A;  1HSQ A;  4QQ6 A;  4LE9 A;  3G71 A;  4O5V A;  2D1X A;  5J39 A;  1KD1 R;  4L5G A;  5ECA A;  3CMA A;  3EG2 A;  4LDY A;  4IUT A;  1V76 A;  2CRE A;  2D8H A;  2KGT A;  3QHS A;  1LVK A;  3OYG A;  2A3L A;  5GAO n;  2EIF A;  4QQG A;  5KYX B;  1M27 C;  4FU6 A;  3S6W A;  5GAN f;  2R57 A;  5GMK h;  4J5Y A;  4M75 C;  1VQ9 A;  2GFA A;  1UFF A;  5FRO A;  4LXC A;  4J9D A;  1J3T A;  4ORZ A;  2QI2 A;  1Q86 R;  1T0J A;  1WXT A;  2E65 A;  3CCE A;  2HD0 A;  1SPK A;  3OQ5 A;  2VXF A;  2ENM A;  1UGQ B;  1KQS A;  4M7A G;  2PVG B;  1GCQ A;  3EGX A;  4QT7 A;  4BE0 A;  1FX7 A;  3CCL A;  3M58 A;  3PIP A;  1K9M U;  4X34 A;  2ESW A;  2YT6 A;  2YUQ A;  5A0D A;  2VGN A;  2QTX A;  2L3S A;  4OMQ A;  4BY6 B;  2YHT A;  2GTJ A;  1C6V X;  2QYZ A;  3QUI A;  4CC4 B;  3OS0 A;  3EHR A;  3DKM A;  2RQW A;  1PSF A;  5GMK j;  2DEQ A;  3JB9 F;  3VYH B;  1NLP C;  1YI2 Q;  3CCJ T;  1V29 B;  2RO0 A;  4J9B A;  3M59 A;  4EIK A;  1Y96 B;  4NL3 A;  3QBY A;  4EMK A;  4RKU E;  1KC8 U;  1X01 A;  4MDW A;  1MMA A;  1KFZ A;  4FYV B;  1PNJ A;  3VRY A;  2MIO A;  1WJS A;  3MP8 A;  4PJO G;  4F7U A;  1NJI U;  4DBR A;  1ZUU A;  4J7F A;  3OYA A;  4J6W A;  3VS4 A;  1R0B G;  1SHF A;  2FPE A;  3CCQ A;  2XDB A;  2ROL A;  2RI2 A;  3BDL A;  1MV0 B;  2KT8 A;  2X3W D;  2A36 A;  1M3B A;  3MEW A;  3OMC A;  4HXJ A;  3X26 B;  1TTH B;  3DLL A;  2HKN A;  5IHI A;  1K73 U;  1ARK A;  3VJP A;  4A4F A;  1UGV A;  4JPB W;  1B07 A;  1GFC A;  1JXM A;  2KSS A;  4C5E A;  5GAN 3;  3JB9 I;  4M75 A;  2DIG A;  3QDR B;  2BUD A;  2QA4 Q;  1X6B A;  1D1C A;  2E70 A;  3I56 Q;  3NMZ C;  1X75 C;  4AG1 C;  2JT4 A;  2LQK A;  5GJW B;  3PT9 A;  1R8O B;  5GAN h;  4VUB A;  1AWX A;  2RJC A;  2HCK A;  4PKC C;  1W4S A;  4M75 G;  2J05 A;  1OPL A;  1ZQ1 A;  3BE3 A;  4KGX B;  2YRC A;  2O31 A;  4QVC A;  2EYY A;  2K79 A;  3OB9 A;  3LWI A;  2K5F A;  3G4S Q;  3EHQ A;  1U3O A;  1TUC A;  2MK5 A;  1QVG S;  3EH2 A;  1MMD A;  3D7S B;  2DD5 A;  3X28 B;  4M77 G;  2D9T A;  3ASK A;  1QKX A;  3UDC A;  3CC7 Q;  3CCS A;  1X6G A;  1M8V A;  1XOV A;  4KH1 B;  3SEM A;  1AEY A;  3OSV A;  3KBG A;  1QVF S;  4M78 F;  3A8G B;  2AKL A;  3JCM W;  2AT1 B;  3TCJ A;  1ZUY A;  3I55 T;  1VA7 A;  3RIR A;  2GGR A;  2VUB A;  3CCR T;  3QKJ A;  5CQY A;  5L8R E;  4LDU A;  2JM9 A;  1KG1 A;  2NUT B;  1VQP T;  1SF9 A;  4M4Z A;  3I35 A;  1UTI A;  2JNG A;  1IRX A;  3ULR B;  3OYL A;  4IUP A;  2EBP A;  2KXC A;  3ZBD A;  2JN0 A;  2AHJ B;  1QP2 A;  3CPW S;  1BI2 A;  1I1J A;  5GAN 5;  5CCA A;  5KCO A;  4Y28 E;  3RES A;  2WSF E;  5HKC A;  1D1B A;  4DEY A;  2EYX A;  2DO3 A;  4AFU C;  2ZPF B;  4RTZ A;  2O88 A;  2VXE A;  3VS3 A;  4Q5W A;  2HSE B;  4F16 A;  2MWO A;  3UAT A;  4C0F A;  4PL6 A;  2F2X A;  2RJE A;  3OYM A;  5HK0 A;  4JJC A;  3JCM J;  4ATO A;  3JB9 H;  1YJW Q;  2XHC A;  1VQN Q;  2CP3 A;  1B7T A;  4ELZ C;  1QQJ A;  2RQR A;  4ZN3 A;  1GBR A;  3CCU Q;  3MJX A;  3M56 A;  1JQQ A;  4M7A F;  3REB B;  5GAO q;  2ROT A;  1K73 C;  2EKO A;  1Q7Y C;  1BB9 A;  1ZLM A;  3LWH A;  4PJN A;  1AT1 B;  1VYV A;  1VQ8 T;  4BI4 A;  1ZBX A;  1WJQ A;  4B6M A;  5C6S A;  2X9H A;  3I5S A;  4C8Q D;  2O4X A;  4A63 B;  4ANJ A;  1K8A U;  3RNJ A;  2DTO A;  1HXD A;  4KBM B;  4OB1 B;  1HJD A;  1D3B B;  2BZX A;  3X24 B;  5I22 A;  1JJ2 S;  3OYB A;  4NL2 A;  1HYO A;  1VQ5 A;  1MGQ A;  2XIC A;  3CPF A;  2EYW A;  2RHU A;  4KT0 E;  3FJP A;  1F1B B;  2F5T X;  5I2S A;  3TQ7 P;  2A28 A;  3NFC A;  4BY6 C;  2NWM A;  3E9G A;  4LDW A;  3KXT A;  1SSF A;  4PLI A;  2DTH A;  4C0D B;  3FC3 A;  4FSX A;  2DRK A;  4PJM A;  4XTX A;  2DL3 A;  2PUO B;  1AWO A;  2AK5 A;  1VQ7 T;  1X69 A;  4LD6 A;  4PJO F;  3A1P A;  2H8H A;  1ACM B;  2WSE E;  2MWP A;  5KYU A;  2YSQ A;  4M7D D;  5GAN 8;  3AHU A;  3CD6 Q;  4JZ4 A;  4BDZ A;  2V26 A;  2RHZ A;  4LNP A;  2V8I A;  1UJY A;  3J7A F;  4ESR A;  2ABL A;  3PIO A;  3G6E Q;  3P8B B;  5IAY A;  3HSB A;  2GQI A;  1FYN A;  4OVA A;  2ED0 A;  1KQS S;  2RN8 A;  3I5R A;  1SG5 A;  1RUW A;  5KCH A;  3UA6 A;  3ZL7 C;  1QCF A;  1BI0 A;  3CCV Q;  3LGL A;  2LQ8 A;  2J06 A;  2OAU A;  1I4K 1;  4DOW A;  2DK3 A;  4J6Y A;  1VQK Q;  4WCI A;  1WXB A;  5KYX A;  2LJ0 A;  3MP1 A;  4AMC A;  2KVQ G;  1K9A A;  4J83 A;  2DNU A;  2L2P A;  2DER A;  4OP0 A;  3CC4 Q;  2L8D A;  1S72 Q;  4M75 F;  4EDU A;  1V1C A;  2YLB A;  2BTT A;  1MHN A;  5LJ3 j;  4DEX A;  5CKH A;  2LT4 A;  1W2B A;  4BE2 A;  2KDS A;  4HCB A;  5GAN 6;  1BK2 A;  1K0X A;  3CPW P;  5D6W A;  3RDV A;  2QTV A;  1RAI B;  4C92 D;  2EVR A;  3HP9 A;  4MMK A;  4RTV A;  5GAM g;  1M90 R;  4MZM A;  2FZK B;  1RL2 A;  4K11 A;  2HQH A;  2BZ8 A;  4C8Q B;  1BKB A;  1WYX A;  1Z9Q A;  1YI2 T;  3OYC A;  3OYJ A;  1GXI E;  2DXU A;  4C5I A;  2K3B A;  1MMG A;  2V8J A;  1K8A C;  1CKB A;  2LNH B;  2EFI A;  2COZ A;  2J6K A;  4PK4 A;  4E7J A;  2D0N A;  4X1V A;  4C5G A;  2KYM A;  4N4I A;  4OB2 B;  1Y96 A;  1RAC B;  3PE0 A;  3WVD B;  1Q82 C;  1IB8 A;  4FM4 B;  1FMK A;  1K76 A;  4XTU A;  1JRI A;  3L1A A;  1KJW A;  3GIB A;  1YCS B;  2JZ2 A;  2CGH A;  1Y0M A;  1JJ2 P;  2QAS A;  1OX9 A;  1UJ0 A;  3EAE A;  2K5L A;  5HCK A;  1N8R U;  2X4X A;  2K7A A;  1MUZ A;  4M7D B;  3TU4 K;  2C0T A;  4HCK A;  1IGU A;  3P8H A;  4J6X A;  4CC7 A;  4QVD A;  3BY7 A;  2NUP B;  2LQW A;  3EFO B;  4MDX A;  3RKX A;  1QMC A;  1YJ9 A;  2HEQ A;  3LLR A;  4JRK A;  1QVP A;  2NYS A;  2IVW A;  4JJD A;  3OW2 A;  1WHM A;  2CZ0 B;  1UUE A;  4BE1 A;  1B34 B;  2KMT A;  3OYN A;  2RI3 A;  1X27 A;  4KGV B;  4WTO B;  3BDU A;  3M0U A;  3JCM g;  3L2R A;  2F1L A;  2JVV A;  2M02 A;  1M1K U;  1E6H A;  1E6G A;  4IUR A;  3VS5 A;  2LJ1 A;  2V8K A;  1A0N B;  3MPU B;  3CPW A;  3I55 A;  2E6N A;  3CC2 A;  5DLO A;  4P5N A;  3H6Z A;  3QJ6 A;  1OI1 A;  5CAI A;  5KYN A;  3G4S T;  4RTT A;  3OYY A;  1KQS P;  4HVV A;  1VQP A;  2J6F A;  2ECZ A;  2JM8 A;  2I0N A;  3CC7 T;  4DBF A;  3JB9 D;  1BU1 A;  5J26 A;  3G7Z A;  3PVQ A;  1VQ6 T;  4F7U E;  1RI0 A;  2HKQ B;  3A8M B;  1YP5 A;  2RF0 A;  4C92 B;  4CRI A;  3CBP A;  2PTK A;  3PMT A;  1YJN A;  2ED1 A;  2X4J A;  2DJQ A;  3CMA Q;  2ZCF B;  2PVO B;  5FU7 B;  2KQW A;  3HTR A;  1XJW B;  1YIT A;  2CH4 W;  2NUT A;  2KRN A;  3BFM A;  1NLO C;  2CZ7 B;  2P4T A;  2CP5 A;  4ZTF A;  2CZ6 B;  2DYB A;  3M9Q A;  2D8J A;  3CCM A;  1ZUK A;  4IUQ A;  1OU9 A;  1IHW A;  3CCE Q;  4J9E A;  4E7Z A;  1LOJ A;  3EGU A;  1VQ8 A;  3PGG A;  2HQE A;  5KYW A;  1M1F A;  3M0Q A;  1TUG B;  1G3S A;  2LMJ A;  2CH4 A;  1WX6 A;  3QZ5 B;  1YJW T;  1VQN T;  4A4H A;  2HMA A;  4FL6 A;  3RER A;  1D0Z A;  2G6F X;  3CCU T;  4JJN K;  2RHI A;  5A2Q E;  3P8D A;  2KEA A;  4LDX A;  1N8R C;  1VQO T;  2FPD A;  2IPO B;  2DBM A;  3V8J A;  1BI1 A;  5L23 A;  1VQL A;  3MO8 A;  4C8Q E;  1KD1 U;  3NHN A;  4ZTJ A;  4OGE A;  1KHI A;  2QQR A;  2CKK A;  4J7I A;  1OX8 A;  1G83 A;  1WJR A;  1SSH A;  1VQ7 A;  1X6O A;  2CYZ B;  3CBM A;  1OYX A;  1UGR B;  2EQU A;  1D3B A;  2CP0 A;  5LJ3 d;  3A5Z B;  2OI3 A;  1N9R A;  4KGZ B;  1M1K C;  3VUZ A;  4X9C A;  2CDT A;  5GAO p;  1VQ4 A;  1YIJ A;  2ZZD A;  2C0O A;  1Q86 U;  3X25 B;  4Z02 A;  3CCQ Q;  2CS7 A;  2KT1 A;  2XKO C;  4C8Q C;  3V8K A;  2YUP A;  3FJ5 A;  3H41 A;  1CKA A;  3REA B;  5LJ5 g;  3OMG A;  4F04 B;  1PD0 A;  1PC0 A;  2XDP A;  2QEX A;  1OU8 A;  4E7K A;  2CUD A;  3UT1 A;  4FW2 A;  1UGP B;  2GF7 A;  1LNX A;  1OZ3 A;  1G2B A;  2B86 A;  5I2M A;  1FWZ A;  3G6E T;  2FRY A;  1OQK A;  2A7Y A;  2Z0W A;  2DZC A;  4AFQ C;  4ELY C;  4XU3 A;  2RJF A;  2DF6 A;  2PUK B;  1VYU A;  1YHQ A;  2CSI A;  3VYG A;  3DLM A;  1Q7Y R;  5CVI A;  3JCM P;  2L3Q A;  1W2B S;  2SRC A;  1N9S A;  1AWW A;  2E64 A;  4C0Z A;  3GPL A;  4A53 A;  3RKY A;  1AHJ B;  1W1F A;  5IXB A;  2XD0 A;  2G3R A;  1T3S A;  3QYH B;  4F7U G;  2DEU A;  3NPF A;  3URG A;  2DZ9 A;  4B9W A;  2MCN A;  3QDF A;  1S72 T;  4M7A D;  1JO8 A;  1M30 A;  1BI3 A;  2OTL A;  2FEI A;  2HL3 A;  4XQ3 A;  5KH6 A;  2JMA A;  1NPP A;  3CCS Q;  2E4H A;  2DMO A;  1ZSZ B;  5KYY B;  3VRZ A;  2KRS A;  1M3C A;  2QXF A;  1M8M A;  1M1G A;  1Y7X A;  2DE0 X;  2EQJ A;  4C92 E;  3AT1 B;  2K4Y A;  3QWY A;  3T9N A;  3GF5 A;  1RAA B;  1PSE A;  1M3A A;  4J9H A;  2K6D A;  2OX7 A;  4KUI A;  5D6Y A;  1RAF B;  1QWE A;  5M9O A;  1ZSG A;  4NS5 A;  1PWT A;  2RB6 A;  2M9U A;  2DVJ A;  5GAO m;  2DBK A;  4IUV A;  3JCM Q;  4LUE A;  2C06 A;  4C8Q A;  1WA7 A;  3A8L B;  3H9N A;  3OYI A;  4PJO D;  3MEA A;  1D09 B;  2V1R A;  1YNZ A;  9ATC B;  2JOY A;  1WHK A;  4C92 C;  2WSC E;  3E2U A;  5LJ3 f;  3RKW A;  3S3O A;  1K9M C;  4OMP A;  5I11 A;  3O8V A;  3VS7 A;  3H0F A;  3OBW A;  3VV0 A;  5FU7 C;  5GMK l;  3OW2 S;  1Q86 C;  3OYH A;  2QAZ A;  2CP6 A;  3L42 A;  4N4H A;  4RTX A;  5GAN 7;  3TSZ A;  1NE8 A;  2JXB A;  2M16 A;  6AT1 B;  3OS2 A;  1H3H A;  2P84 A;  4JJB A;  4FYX B;  1HD3 A;  4OB3 B;  2CSQ A;  3EH1 A;  4E7I A;  5KYW B;  3L2Q A;  1RLQ C;  1VQM A;  4M7D A;  2P0Q A;  2W10 A;  4OB0 B;  1KC8 C;  3EFS A;  4OMO A;  2HNI A;  2NUP A;  3EFO A;  1NJI C;  2LJ3 A;  2QG9 B;  2NUZ A;  1GFD A;  2LRQ A;  3GBQ A;  1VQ5 Q;  2ZGW A;  2J7I A;  4RUG A;  1VQ6 A;  3OYD A;  2EJG A;  2GFU A;  3V7R A;  2HAX A;  3JCM V;  1B34 A;  2DD4 A;  3CME A;  5EG2 A;  1N6A A;  3V7C A;  5GAN e;  2F2W A;  4FYW B;  1K8A R;  4JLI A;  4M7A B;  3RUX A;  1TS9 A;  2EYZ A;  4BI3 A;  1QLY A;  4M77 D;  4E7H A;  1Q81 R;  2ZPB B;  2E5Q A;  4V2S A;  4AFS C;  4JRP A;  1W2B P;  2MPX C;  1D0Y A;  1Q82 R;  3GNF B;  1UEB A;  3VS0 A;  5KE3 A;  2RM4 A;  5GAN 2;  1PKT A;  2AIR B;  2KK4 A;  8AT1 B;  4PJJ A;  5GAN g;  3CMA T;  1TU0 B;  2X4W A;  4JS4 A;  1PHT A;  1BIB A;  1OZ2 A;  2NLU A;  2K2M A;  2L3R A;  2IIM A;  4C92 A;  3FDR A;  3FRN A;  2ZPG B;  2ZPI B;  3EFR A;  2EGA A;  2ZAE A;  1OEB A;  2FRW A;  4R56 A;  2KE9 A;  3O5Z A;  4IUU A;  3WXM B;  4PJO B;  2DL4 A;  3OS5 A;  5LJ3 h;  4MML A;  1VQO A;  2OTJ T;  5GAM j;  2HBW A;  2H3J A;  3MP6 A;  4II1 A;  1TWB A;  2EW3 A;  2E5K A;  4OGC A;  1AZE A;  4F7U F;  2KYB A;  4D8D A;  2FZC B;  1GBQ A;  3R6N A;  3J81 E;  1G5V A;  1SHG A;  2O9S A;  2KY9 A;  5CKE A;  2VAS A;  3GP8 A;  1YN8 A;  4HVU A;  5A0G A;  2M51 A;  2JJ9 A;  4BD3 A;  2GTO A;  1NEB A;  3L2U A;  2E12 A;  1WNL A;  4GBQ A;  3RBB B;  5GAM e;  3OW2 P;  3PVL A;  2PNI A;  4L59 A;  4Y92 A;  1R0C B;  3GLX A;  3H0H A;  3CCJ A;  1VOM A;  4PFO A;  2LX9 A;  3TSW A;  2JW4 A;  2O2O A;  1U06 A;  3J80 E;  2COY A;  2EQI A;  1H92 A;  1NG2 A;  3EG9 B;  3CCQ T;  4N0A C;  4LD9 K;  2DXT A;  3SWN B;  4M77 B;  4BDY A;  2W0Z A;  4OF1 A;  4Z8A A;  2LP5 A;  2DET A;  3BW1 A;  3EG3 A;  3FLG A;  4RTW A;  4RTU A;  2M0Y A;  3FB9 A;  1U1T A;  2BE7 D;  1QWF A;  4C8Q F;  1QKW A;  3OYK A;  4Y91 A;  2DLP A;  2QQA A;  4A4K A;  4F14 A;  1TG0 A;  1VIF A;  1YJ9 Q;  1M90 U;  1YWP A;  1T3L A;  1N5Z A;  2HZY A;  2EJF A;  2JMC A;  2PZ1 A;  2YWW A;  5FU6 B;  1N8R R;  1ZBJ A;  4OMN A;  2B8A A;  3LYI A;  1ABQ A;  3LX7 A;  3QWX X;  1IXD A;  1RAB B;  1M5Q 1;  2CT3 A;  3M53 A;  2CUB A;  3JB9 J;  3JCM e;  2J6O A;  3CC2 Q;  3I55 Q;  3SB2 A;  2P0P A;  2RK1 A;  3L2Z A;  2QA4 T;  5CIU A;  4M7A E;  3I56 T;  1ZA2 B;  4XU2 A;  2JS0 A;  2CP2 A;  3QXE B;  1VQP Q;  4R0K A;  2EWN A;  4F17 A;  1AZG B;  5FW9 A;  1RLP C;  2VC8 A;  5IN1 A;  4C0G A;  1JBM A;  4RG8 A;  4HT8 A;  1M1K R;  3EG0 A;  4B9X A;  1LJO A;  3N5B B;  4ZN1 A;  1X2K A;  2QDL A;  3C4S A;  4AT1 B;  2JUF A;  1ZHI A;  2FL7 A;  4CI0 C;  3VU3 C;  4BAC A;  3OSS C;  1ZSZ A;  5KYY A;  1YJN Q;  3DB3 A;  1GL5 A;  1Y57 A;  3CCR A;  4M7A C;  4NOY A;  1MNE A;  2DX1 A;  2YRD A;  1U8R A;  1RI9 A;  2E3I A;  5EC7 A;  1I5L A;  3VS1 A;  2KBT A;  1TOV A;  4QQD A;  1YIT Q;  1M9S A;  1X43 A;  4N0A A;  2DKG A;  2EYQ A;  2MYS A;  1RAH B;  1UHF A;  3JV3 A;  2DRM A;  2M0O A;  3KFV A;  3CXC P;  3CCM Q;  1M2V B;  1EIF A;  3G71 Q;  2LC4 A;  1AOJ A;  4FW1 A;  1VQ8 Q;  3ZFJ A;  4UC4 A;  2DYI A;  2LCS A;  1WFW A;  2PU9 B;  4C0D C;  2GNC A;  1D0X A;  1AVZ C;  5FLX E;  2FVU A;  3C95 A;  2BE9 B;  3UA7 A;  3C0C A;  1MMN A;  1RAG B;  3FEO A;  4PFZ A;  3S3M A;  4JZ3 A;  1VQ9 Q;  1EZZ B;  5AYF A;  3EGD B;  5GMK i;  5D6X A;  2HQX A;  2JS2 A;  3UWN A;  1C1A A;  1QW1 A;  3U23 A;  2LT1 A;  2DL7 A;  3JCM c;  2DAQ A;  2IG0 A;  2EKH A;  1SKU B;  5DM7 R;  3QG1 A;  4RG2 A;  1VQL Q;  2PQW A;  4Z89 A;  2YLC A;  2K5I A;  2LX7 A;  2RQT A;  5LJ5 j;  5GAM d;  2XK0 A;  1VQ7 Q;  2A08 A;  2QQ9 A;  4FCY A;  4KH0 B;  1BIA A;  3JRZ A;  1VQ5 T;  3FIF A;  2DPP B;  1QCO A;  2COW A;  5IT9 E;  3CCL Q;  5D7U A;  3NTH A;  3PNW C;  2KRO A;  3WVE B;  2XDD A;  4GLM A;  1UB4 A;  1IGQ A;  2FZG B;  1Y71 A;  1FMW A;  1W70 A;  1YIJ Q;  1VQ4 Q;  1YCY A;  2BZY A;  1Q95 G;  1RAE B;  4M77 E;  4EPC A;  2DXB A;  2X35 A;  1VUB A;  2I2L A;  1R77 A;  1WHL A;  1KHC A;  4M7A A;  3M4G A;  5LJ5 e;  1VIE A;  1K9M R;  4ZGJ B;  1OUL A;  2QEX Q;  1S1N A;  1LPL A;  3R6O A;  3NTI A;  1GRI A;  1RAD B;  2FHD A;  3QII A;  2HDA A;  2OTJ A;  3CXC A;  3HRU A;  5DLQ E;  2L5Q A;  5IHN A;  1AWJ A;  4M78 D;  1PM3 A;  1WQW A;  1YFN A;  4J9G A;  3SWN C;  1IHV A;  3E1S A;  4M77 C;  2QGF B;  1UEC A;  1ABO A;  3VS2 A;  1YHQ Q;  3C12 A;  2E41 A;  1NPR A;  4R55 A;  3LW5 E;  4M7D E;  2L3P A;  1KC8 R;  2M1H A;  2HSP A;  3OYE A;  4Z88 A;  3CD6 T;  3QSU A;  1ZA1 B;  3HRS A;  2LQN A;  1NJI R;  4XTV A;  3JCM d;  4E47 A;  4PJO A; 
#chains in the Genus database with same CATH homology
 2MMP A;  4M75 F;  1KC8 C;  3M4Y A;  5GAO l;  3EFS A;  4JLG A;  4QW2 A;  5DY9 A;  5FU6 C;  2VGM A;  4EDU A;  2HNI A;  3QYG B;  2YLB A;  3VKI A;  1MHN A;  2QQS A;  2VYT A;  5J3B A;  1NJI C;  3RMS A;  5LJ3 j;  5CKH A;  4L6V 5;  4M78 A;  2LRQ A;  2LT4 A;  3CBO A;  2GCX A;  1W2B A;  2ZGW A;  4BE2 A;  2KDS A;  3ER0 A;  3CCV T;  1M8V A;  4HCB A;  5GAN 6;  3OYD A;  1VQ6 A;  4C92 F;  3DB4 A;  2EJG A;  3CME T;  1VQK T;  2GFU A;  4XTW A;  2LVM A;  3V7R A;  3PTA A;  2HAX A;  5D6W A;  3JCM V;  4M7D C;  1B34 A;  2DD4 A;  3CME A;  4PJO C;  2XI9 A;  3MET A;  5EG2 A;  5CKD A;  4JUV A;  1N6A A;  3V7C A;  4C92 D;  3C94 A;  2ZPH B;  3HP9 A;  2EQM A;  4MMK A;  3UPU A;  2MAM A;  5GAM g;  5GAN e;  4MZM A;  1O75 A;  4YTL A;  5HY6 A;  4GY5 A;  1RL2 A;  3MCA B;  4JLI A;  3CC4 T;  4M7A B;  3RUX A;  4BI3 A;  3JAM E;  5GAO r;  4M77 D;  3QZ9 B;  4A54 A;  4C8Q B;  4E7H A;  1BKB A;  2DXC A;  4M78 G;  2ZPB B;  1YI2 T;  2E5Q A;  4EMK C;  5GMK e;  3OYF A;  3OYC A;  4V2S A;  3OYJ A;  4JRP A;  4M75 E;  1NZ9 A;  2DXU A;  3QO3 A;  1YI2 A;  4C5I A;  1M90 C;  1GXI E;  1JJ2 A;  2V8J A;  5GAM f;  1Q7Y U;  1K8A C;  3ZEH A;  3GNF B;  2EFI A;  5CO7 A;  2F5K A;  3HFO A;  1UEB A;  5KE3 A;  4JRQ A;  1H64 1;  2RM4 A;  5GAN 2;  3PMI A;  4E7J A;  2KK4 A;  4C5G A;  2RHY A;  2MF2 A;  2JTM A;  3HFN A;  4N4I A;  4OB2 B;  4QQ6 A;  3OBY A;  3G71 A;  1Y96 A;  5GAN g;  4O5V A;  5J39 A;  3WVD B;  3QPH A;  3CMA T;  2X4W A;  1Q82 C;  3CC2 A;  4L5G A;  2K3Y A;  4FM4 B;  3CMA A;  3HKS A;  4JS4 A;  4LDY A;  4IUT A;  1BIB A;  4XTU A;  1JRI A;  1OZ2 A;  3L1A A;  2NLU A;  5CKB A;  3QHS A;  3GIB A;  2L3R A;  3JCM X;  2F69 A;  2JZ2 A;  3FDR A;  3M5A A;  4C92 A;  2A3L A;  5GAO n;  2EIF A;  3FRN A;  1O9S A;  2CGH A;  3OYG A;  2ZPG B;  2VV5 A;  4QQG A;  4FU6 A;  2ZPI B;  1KD1 C;  3EFR A;  3S6W A;  5GAN f;  2R57 A;  2EQK A;  5GMK h;  4J5Y A;  4D6W A;  4M75 C;  4R56 A;  3EAE A;  2K5L A;  3SWN A;  4M77 A;  1N8R U;  2X4X A;  1VQ9 A;  1FXX A;  2GFA A;  2RJD A;  5FRO A;  4M7D B;  4IUU A;  3WXM B;  3TU4 K;  4PJO B;  3OS5 A;  5LJ3 h;  3GNG A;  4JRI A;  3P8H A;  4J6X A;  4QVD A;  4MML A;  3BY7 A;  1VQO A;  2OTJ T;  4DA4 A;  5GAM j;  2QI2 A;  2H3J A;  1YJ9 T;  4MDX A;  2QA4 A;  2E65 A;  3CCE A;  3A8H B;  2HD0 A;  3MP6 A;  4II1 A;  3RKX A;  3I56 A;  3OQ5 A;  1YJ9 A;  4M78 B;  2VXF A;  3LLR A;  4MZP A;  2BIV A;  4OGC A;  4JRK A;  1QVP A;  1XQH A;  1UGQ B;  1KQS A;  2IVW A;  4F7U F;  3OW2 A;  2CZ0 B;  4M7A G;  2PVG B;  3J81 E;  4BE1 A;  1B34 B;  1G5V A;  2KMT A;  3OYN A;  2RI3 A;  4C8Q G;  4BE0 A;  1FX7 A;  4HCC A;  3OY9 A;  3MEV A;  3BDU A;  3CCL A;  2KY9 A;  3M58 A;  5CKE A;  3JCM g;  3PIP A;  5CR2 A;  3L2R A;  1K9M U;  3GP8 A;  4X34 A;  2JVV A;  1WGS A;  1M1K U;  3INZ A;  3CC2 T;  5A0D A;  2VGN A;  4IUR A;  2V8K A;  2E1H A;  3V8L A;  4A4G A;  5A0G A;  3CPW A;  5HK3 A;  3I55 A;  2E6N A;  5GAN j;  5DLO A;  2QTX A;  4P5N A;  3MEU A;  4BD3 A;  3H6Z A;  3PFS A;  3QJ6 A;  4BY6 B;  5CQX A;  1IRE B;  2YHT A;  2K2V A;  3QUI A;  1OI1 A;  3HL8 A;  5CAI A;  2PVD B;  3L2U A;  2E12 A;  1WNL A;  3OS0 A;  3M57 A;  3DKM A;  5GAM e;  5FRM A;  3G4S T;  3JCM f;  3OYY A;  1PSF A;  2R58 A;  5GMK j;  2DEQ A;  3JB9 F;  3VYH B;  1VQP A;  3KUF A;  3G4S A;  4LDV A;  1I8F A;  3CCJ T;  1V29 B;  2RO0 A;  2Y90 A;  4L59 A;  3GLX A;  3CC7 T;  3Q1J A;  3M59 A;  4M75 D;  5J26 A;  3CCJ A;  3JB9 D;  1QP3 A;  1Y96 B;  3G7Z A;  1VQ6 T;  4NL3 A;  3CC7 A;  4F7U E;  3QBY A;  2WAC A;  2LX9 A;  5LJ5 d;  2D0Q B;  2FYK A;  4EMK A;  1RI0 A;  4RKU E;  1KC8 U;  1X01 A;  3J80 E;  3A8M B;  4OMF B;  4XTY A;  4MDW A;  5CKF A;  1YJN T;  3LH0 A;  3HPW A;  4M7D G;  4C92 B;  4CRI A;  3CBP A;  4F7U A;  1WJS A;  3MP8 A;  3PMT A;  4PJO G;  1YJN A;  1NJI U;  2X4J A;  4FT4 A;  4J7F A;  3OYA A;  4N0A C;  4J6W A;  3CCQ T;  4LD9 K;  4XTZ A;  2ZCF B;  4E7L A;  2DXT A;  2PVO B;  2XU8 A;  3SWN B;  4M77 B;  3TRE A;  3CCQ A;  4BDY A;  4OF1 A;  2XDB A;  5FU7 B;  2RI2 A;  1YIT T;  2KQW A;  3BDL A;  3BW1 A;  5GAM h;  1N27 A;  4HCZ A;  2E6Z A;  3MEW A;  3X26 B;  3OMC A;  4BUG A;  1YIT A;  4FT2 A;  3FLG A;  3DLL A;  2DTI A;  3BFM A;  3FB9 A;  1K73 U;  2QDY B;  2CZ7 B;  2YRV A;  1U1T A;  2P4T A;  2P0K A;  2LCC A;  3CCM T;  3VJP A;  3H8Z A;  4A4F A;  4ZTF A;  1HK9 A;  2CZ6 B;  3M9Q A;  4RMO A;  4C8Q F;  5LL6 S;  3CCM A;  5GAN 3;  4C5E A;  2KSS A;  4DQ2 A;  3OYK A;  3G71 T;  4Y91 A;  3JB9 I;  4IUQ A;  4M75 A;  2DIG A;  3QDR B;  2BUD A;  2QQA A;  4FIB A;  2LNV A;  4A4K A;  1VIF A;  2E70 A;  1LOJ A;  1VQ8 A;  1M90 U;  1X75 C;  3PGG A;  2HQE A;  2EJF A;  2LQK A;  3PT9 A;  1M1F A;  1R8O B;  2RHX A;  5GAN h;  4VUB A;  5FU6 B;  1Q81 U;  1G3S A;  5KE2 A;  2RJC A;  2CZ1 B;  4MZT A;  3L2W A;  3QZ5 B;  4PKC C;  1YJW T;  2B8A A;  1G3T A;  1WPY A;  3MHX A;  4A4H A;  3GOX A;  1VQN T;  3LYI A;  4HKE A;  3LX7 A;  5C0M A;  1VQ9 T;  4FL6 A;  1W4S A;  1WQ7 A;  1YJW A;  3RER A;  1VQN A;  1M5Q 1;  1Q82 U;  3M53 A;  3CCU T;  2RA2 A;  4JS5 A;  4M75 G;  4JJN K;  2RHI A;  3JSC A;  3JB9 J;  5A2Q E;  3P8D A;  3CCU A;  3E9F A;  3JCM e;  4LDX A;  1ZQ1 A;  1N8R C;  3SB2 A;  2HBP A;  1VQO T;  2P0P A;  1JB0 E;  2RK1 A;  2ZPE B;  2KAF A;  1VQL T;  3L2Z A;  3V8J A;  1Y07 A;  4KUD K;  2QA4 T;  3CCE T;  2QQB A;  5CIU A;  4QVC A;  4M7A E;  3I56 T;  4RCB A;  1BI1 A;  1VQL A;  3MO8 A;  4C8Q E;  1KD1 U;  3OB9 A;  4XU2 A;  3LWI A;  2K5F A;  3X20 B;  4C92 G;  3QXE B;  4HT9 A;  4ZTJ A;  2EWN A;  2E10 A;  3S3N A;  4OGE A;  1KHI A;  4XAX B;  2LDM A;  2VC8 A;  5IN1 A;  2QQR A;  4EMK B;  2CKK A;  1QVG S;  4C0G A;  4J7I A;  2DD5 A;  1WJR A;  3X28 B;  4M77 G;  1VQ7 A;  1JBM A;  1P92 A;  1X6O A;  4ZGD B;  2CYZ B;  2D9T A;  2L89 A;  3ASK A;  3CBM A;  4RG8 A;  3SD4 A;  3UDC A;  3CCS A;  4B9X A;  4HT8 A;  2MI6 A;  1OYX A;  1LJO A;  1XOV A;  3ME9 A;  3TEE A;  1UGR B;  3N5B B;  4ZN1 A;  3CCL T;  3OSV A;  2EQU A;  4F7U B;  3KBG A;  1QVF S;  2RI5 A;  3C4S A;  1D3B A;  3A8G B;  2JUF A;  1ZHI A;  4M78 F;  5LJ3 d;  3JCM W;  2FL7 A;  3A5Z B;  4CI0 C;  3TCJ A;  3VU3 C;  4BB7 A;  1M4Z A;  3I55 T;  3OSS C;  4BAC A;  3RIR A;  1N9R A;  3CXC S;  1VQ4 T;  1YIJ T;  2VUB A;  1XTD A;  3DB3 A;  3CCR T;  1M1K C;  3M55 A;  4X9C A;  3JCM h;  3VUZ A;  3M54 A;  2X4Y A;  3QKJ A;  3RMQ A;  4EMH A;  5GAO p;  1VQ4 A;  2ZZD A;  5CQY A;  1YIJ A;  5L8R E;  1Q86 U;  4LDU A;  3X25 B;  3CCR A;  4Z02 A;  4M7A C;  4NOY A;  2CS7 A;  1KG1 A;  2XKO C;  4C8Q C;  3V8K A;  1U8R A;  1VQP T;  1I5L A;  4QQD A;  4XK8 E;  4WF2 A;  5LJ5 g;  3OMG A;  3E19 A;  2LCL A;  1M9S A;  4A4E A;  1IZ6 A;  2JNG A;  4N0A A;  2DKG A;  1U1S A;  4BI8 B;  2EYQ A;  1H3Z A;  3OYL A;  4M75 B;  3NTK A;  2RD1 A;  4N4G A;  2QEX T;  4IUP A;  3OS1 A;  2M0O A;  2XDP A;  3ZBD A;  2JN0 A;  2AHJ B;  1QP2 A;  2QEX A;  4E7K A;  3CPW S;  1BI2 A;  3UT1 A;  5GAN 5;  3CD6 A;  5CCA A;  1UGP B;  2GF7 A;  1LNX A;  5KCO A;  5LJ5 f;  4Y28 E;  1OZ3 A;  3RES A;  1EIF A;  2D6F A;  2LC4 A;  4C5H A;  2WSF E;  5HKC A;  4M78 E;  3ZFJ A;  5I2M A;  2DO3 A;  1FWZ A;  2RK2 A;  4UC4 A;  3G6E T;  2ZPF B;  2VXE A;  2PU9 B;  4Q5W A;  2A7Y A;  3G6E A;  4C0D C;  2DZC A;  4ELY C;  1YHQ T;  2MWO A;  4XU3 A;  4C0F A;  2RJF A;  5FLX E;  4PL6 A;  2PUK B;  4ZGE B;  2FVU A;  2RJE A;  1YHQ A;  3C95 A;  3OYM A;  3VYG A;  5HK0 A;  3JCM J;  4ATO A;  2DIQ A;  3DLM A;  1I81 A;  2XID A;  5CVI A;  3JB9 H;  3JCM P;  4EMG A;  2XHC A;  1W2B S;  3FEO A;  1N9S A;  2DJZ A;  3S3M A;  4PLL A;  3CCV A;  4ELZ C;  2E64 A;  4J8O A;  5AYF A;  4C0Z A;  3GPL A;  4ZN3 A;  5GMK i;  5D6X A;  1VQK A;  5CK9 A;  4A53 A;  2HQX A;  3RKY A;  1AHJ B;  3M56 A;  1QW1 A;  4M77 F;  2G3R A;  3UWN A;  2LT1 A;  3QJY A;  3JCM c;  2XD0 A;  3QYH B;  5GAO q;  1K73 C;  4M7A F;  2EKO A;  4F7U G;  1Q7Y C;  2DAQ A;  3URG A;  2IG0 A;  2DZ9 A;  3SFM A;  3LWH A;  5I21 A;  3QG1 A;  4RG2 A;  5DM7 R;  4B9W A;  2PQW A;  1S72 T;  1VQ8 T;  4M78 C;  4M7A D;  4BI4 A;  2OTL T;  1ZBX A;  3CC4 A;  1WJQ A;  4DOV A;  1BI3 A;  5C6S A;  1S72 A;  2YLC A;  4C8Q D;  2K5I A;  2O4X A;  2OTL A;  5LJ5 j;  3JCM b;  5GAM d;  2DTO A;  1HXD A;  2XK0 A;  4KBM B;  4OB1 B;  1K8A U;  1D3B B;  4XQ3 A;  2O01 E;  3X24 B;  5KH6 A;  2QQ9 A;  4X9D A;  1BIA A;  1NPP A;  3JRZ A;  1VQ5 T;  3FIF A;  4JDS A;  2DPP B;  5LJ3 e;  1JJ2 S;  5GMK m;  4NL2 A;  3OYB A;  1Q81 C;  1VQ5 A;  1MGQ A;  1KQ2 A;  2XIC A;  3CPF A;  1KQ1 A;  5IT9 E;  2RHU A;  2QXF A;  3NTH A;  3VUB A;  5A0L A;  3PNW C;  4ME7 A;  4KT0 E;  4QVZ A;  1M1G A;  1Y7X A;  3WVE B;  2XDD A;  3FJP A;  4RCC A;  3JB9 G;  1UB4 A;  2EQJ A;  3HRT A;  4C92 E;  1G3Y A;  2F5T X;  2K3X A;  1UGS B;  5I2S A;  1TH7 A;  2K4Y A;  1Y71 A;  4XU0 A;  3NFC A;  4KUL A;  4BY6 C;  2EJ9 A;  3E9G A;  3T9N A;  3GF5 A;  4LDW A;  3KXT A;  1PSE A;  2Y4Y A;  1YCY A;  1SSF A;  3F70 A;  2DTH A;  4PLI A;  4M77 E;  4KUI A;  3L2V A;  5D6Y A;  4C0D B;  4PNO A;  3FC3 A;  3LGF A;  4FSX A;  4EPC A;  2DXB A;  5M9O A;  4XTX A;  5GAN d;  2K57 A;  2X35 A;  4NS5 A;  2PUO B;  3V7S A;  1VUB A;  2RB6 A;  2I2L A;  1QVG A;  2Y4X A;  4M7D F;  2M9U A;  5GAO m;  2RH2 A;  5LJ3 g;  4LD6 A;  4O6J A;  4PJO F;  1VQ7 T;  1DJ7 B;  1KHC A;  4M7A A;  4IUV A;  3M4G A;  5LJ5 e;  3JCM Q;  3CCS T;  1VIE A;  2C06 A;  4C8Q A;  4IKF A;  4ZGJ B;  2WSE E;  2MWP A;  3A8L B;  3OYI A;  4M7D D;  1QVF A;  1XNI A;  4PJO D;  5GAN 8;  3MEA A;  3AHU A;  3R6O A;  3NTI A;  5GAN 4;  4BDZ A;  2RHZ A;  2FHD A;  3QII A;  2V8I A;  2JOY A;  2R5M A;  2DVE A;  3J7A F;  4C92 C;  3CXC A;  2OTJ A;  2XG8 D;  1BYM A;  2WSC E;  3HRU A;  5DLQ E;  2L5Q A;  5LJ3 f;  3RKW A;  3PIO A;  3S3O A;  1K9M C;  3O8V A;  2LTO A;  4TVR A;  4M78 D;  3P8B B;  1WQW A;  3OBW A;  4M77 C;  3E1S A;  3SWN C;  5IAY A;  3HSB A;  3VV0 A;  4OVA A;  5FU7 C;  5GMK l;  2GQV A;  1KQS S;  2FB7 A;  2EAY A;  3OW2 S;  1Q86 C;  5KCH A;  3A8O B;  3OYH A;  3L42 A;  3C12 A;  2E41 A;  3CEY A;  1NPR A;  4N4H A;  1BI0 A;  4GLK A;  4XU1 A;  5GAN 7;  3HHT B;  1NE8 A;  3LGL A;  2LQ8 A;  2M16 A;  2OAU A;  1I4K 1;  4DOW A;  4R55 A;  2DK3 A;  4J6Y A;  3LW5 E;  1G3W A;  2JTF A;  3OS2 A;  4M7D E;  5LJ5 h;  4HA8 A;  3SDZ A;  2BKD N;  4PJO E;  2M1H A;  3OYE A;  3CD6 T;  3QSU A;  3HRS A;  3MP1 A;  5FRN A;  1YBY A;  2O4X B;  4OB3 B;  2KVQ G;  1VQM T;  4E7I A;  4J83 A;  4XTV A;  3JCM d;  3L2Q A;  3OA6 A;  4OP0 A;  1VQM A;  4M7D A;  2P0Q A;  2R5A A;  2L8D A;  4E47 A;  4OB0 B;  4PJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...