2RQVA

Solution structure of sh3ci domain of bem1p
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
108
structure length
108
Chain Sequence
GPLGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bud emergence protein 1
publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqvA01
2DVJA 3M0SA 1TUCA 2D0NA 2EVRA 2GNCA 2SRCA 2GGRA 2ENMA 3VS2A 2DBKA 2KT8A 2ROTA 1MV0B 1PRLC 2MCNA 4LNPA 4RTXA 1GFDA 1KFZA 2M51A 2DBMA 4RTVA 2ECZA 1U3OA 1NG2A 2LX7A 3RNJA 1UJYA 1SPKA 3I9QA 2YDLA 2FRWA 3U23A 3FJ5A 2JM8A 4RTUA 1U06A 1WDXA 2KGTA 4IIOA 3ULRB 2XMFA 2DX1A 1N5ZA 1HSQA 3UA6A 2B86A 1K9AA 2L2PA 2KRMA 1PNJA 2L3SA 1NYFA 5EC7A 4E6RA 4M4ZA 2JW4A 2L0AA 2SEMA 4Z89A 5GJVB 3VS1A 3TSZA 2FPEA 2NWMA 4J9CA 1QWFA 2YUQA 2ROLA 2RQTA 4OMNA 1AWOA 2BZYA 1CKAA 1BK2A 1WLPB 2EGAA 1K1ZA 2BTTA 2KEAA 4ORZA 2K6DA 2X3XD 3SHWA 1I0CA 4JJBA 3VS4A 4AG2C 4CC3A 2C0IA 1QKWA 2KT1A 2RQRA 4CC2A 2HDAA 4RTYA 5ECAA 1NLOC 1BBZA 3REBB 5GJWB 2ED0A 2EYZA 1PKTA 4DEXA 2DRMA 2CDTA 2YT6A 4X1VA 4D8KA 2AK5A 2CH4W 2O9SA 1BB9A 4HCKA 1G2BA 2FPFA 1PHTA 1ZUKA 1HD3A 1MUZA 1SHGA 1ZUUA 4J9HA 3UATA 2JXBA 4A63B 4RTTA 4AG1C 1JXMA 2KBTA 4OMQA 1UECA 2FO0A 2VVKA 2OI3A 2DJQA 1ZLMA 1SRLA 1RLQC 2JT4A 2JS0A 1B3QA 3EG3A 1WXTA 2CT4A 1NEGA 1UJ0A 1X6BA 3VS6A 3NHNA 1IO6A 1OOTA 2AZVA 4D8DA 2GBQA 3NPFA 1JU5C 2RPNA 3SEMA 2A36A 2EGCA 1FYNA 1PWTA 2L3PA 2K2MA 2LJ3A 2EYXA 1SHFA 4J9EA 1QCFA 1T3SA 4F17A 2D8JA 2O88A 1OPKA 4JZ4A 1X69A 3EG1A 4RTWA 2DE0X 2IIMA 4DEYA 3KFVA 1H8KA 3H0HA 2FPDA 2ED1A 1W1FA 1YN8A 1E6GA 2LJ1A 2YUNA 4LN2A 1UGVA 2PZ1A 2LQNA 4FSSA 1G83A 4JJDA 4WCIA 4Z88A 1K0XA 4ZNXA 1NYGA 3RBBB 1UDLA 2P4RA 1UHCA 4JJCA 5FW9A 2JM9A 3QWYA 1A0NB 5L23A 1PRMC 2J7IA 2C0OA 2RQVA 1JO8A 3VRYA 2BZXA 1GFCA 2QDLA 1UUEA 2BZ8A 3H0IA 4CC4B 2LJ0A 2EKHA 2AZSA 2LZ6B 3EHQA 1KJWA 2JS2A 1RLPC 3PE0A 1M3BA 1ZUYA 2RNAA 3VS5A 2EBPA 2CSIA 3UA7A 1AEYA 5IHIA 1ZSGA 2F2XA 5IXFA 1VYUA 4RUGA 1VYTA 3LH5A 4OMLA 3NGPA 2YUOA 2GTJA 2EW3A 4GLMA 2GQIA 5FWBA 2KNBB 2O31A 1B07A 1GCPA 5I11A 2JMCA 4HVVA 3EHRA 2A08A 1UFFA 2RQWA 1NEBA 2MIOA 1I07A 1X2KA 2KXCA 1UG1A 2KR3A 1E7OA 3M0QA 2K79A 1GL5A 1M3AA 2ABLA 2CREA 2K9GA 4R0KA 3C0CA 1W6XA 2KXDA 3I35A 1UHFA 2J6KA 3PVQA 3O5ZA 1GRIA 4HXJA 1AWWA 1AZEA 4KRTA 2LP5A 4RTZA 3NMZC 3ZL7C 1JXOA 3IQLA 3A98A 1Z9ZA 1M27C 1W70A 1M30A 3QWXX 2C0TA 2EYWA 2W0ZA 3JV3A 5IH2A 1AWJA 1YNZA 1YWPA 2FEIA 1EFNA 1SRMA 4F16A 2J6FA 2F2WA 3PVLA 1ZX6A 1WFWA 1SSHA 2DL4A 4QT7A 3THKA 1WIEA 1AWXA 2RF0A 1OPLA 4OMPA 4LE9A 1T0HA 4LUEA 1WI7A 2KROA 3VS0A 4J9GA 1KIKA 1X2QA 3VS3A 2RQUA 2DILA 2DNUA 1WA7A 3I5SA 2VKNA 4J9DA 2DLPA 3GBQA 5IHNA 4LUDA 4AFUC 2J06A 2CSQA 1GBQA 1X27A 2MOXA 1U5SA 2DA9A 1AD5A 3EGUA 1YWOA 4K11A 2M0YA 1QKXA 2V1QA 3R6NA 2DL3A 4HVWA 2O2OA 2EQIA 4CC7A 1AOJA 2CT3A 2F2VA 1VYVA 2JMAA 1E6HA 1GBRA 3I5RA 1H92A 5I22A 2CUDA 2EGEA 1JQQA 2GTOA 1ZBJA 1YP5A 4Y92A 2FG0A 2K3BA 1QLYA 2D1XA 4Z8AA 3EG2A 2LCSA 2VWFA 2KYBA 2K7AA 2DL5A 3M0PA 1VA7A 3M0TA 2RN8A 2W10A 1LCKA 2CH4A 2HSPA 3TSWA 2HBWA 2DRKA 2I0NA 4AFZC 3M0RA 1PKSA 3CQTA 3VS7A 2KYMA 1BU1A 1WX6A 1KSWA 1T3LA 5HCKA 2LQWA 4OMMA 1T0JA 1Z9QA 2X3WD 2AKKA 2OJ2A 4ESRA 2J05A 1ABOA 2AKLA 1UTIA 1J3TA 2L3QA 2CUBA 1H3HA 1X43A 2PNIA 2HCKA 2NUZA 1JEGA 2EYYA 5IXBA 1K0SA 2LNHB 2KRSA 2E5KA 1AZGB 2OAWA 1RUWA 3VRZA 5IHKA 1TUDA 1Y0MA 1TG0A 4AFSC 4J9BA 4AFQC 2DMOA 2EPDA 1X6GA 2KE9A 3REAB 1SEMA 4JZ3A 1OV3A 2DL7A 3H41A 3TVTA 2RMOA 1Y57A 4OMOA 1M8MA 1AVZC 1NLPC 1K76A 1WXUA 4EIKA 2DF6A 1I1JA 1XOVA 1HJDA 3H0FA 2D8HA 2KRNA 4HVUA 1GCQA 4GBQA 1WYXA 1YCSB 1MV3A 4J9FA 1FMKA 4JPBW 4F14A 1OEBA 1CSKA 1CKBA 2DM1A 1RI9A 2PTKA 4IIMA 3UF4A 2ESWA 2YSQA 2DL8A 2J6OA 1ABQA 2YUPA 5FWCA 1GCQC 1QWEA 1M3CA 2G6FX 1K4US 1NM7A 2O9VA 2HEQA 2DYBA 1V1CA 1ARKA 2V1RA 3EG0A 1WXBA 2A28A 1UE9A 3M0UA 1S1NA 2JTEA 2H8HA 2LMJA 2A37A 2FRYA 4J9IA
chains in the Genus database with same CATH superfamily
2X4WA 2ZZDA 2DXCA 2GGRA 3CPFA 4A54A 3V8KA 2HQXA 1MNEA 1BYMA 4II1A 2M9UA 4RTXA 1KFZA 2M51A 2RHYA 1PG5B 2XI9A 1U3OA 2QYZA 1BKBA 2VGNA 1YJNQ 3I9QA 4J6WA 3P8HA 2CZ1B 4BE2A 2HL3A 2DXBA 5GAN3 1YJ9A 1VOMA 3RMSA 2DX1A 3UA6A 3L2QA 1IHWA 1Y96B 3HKSA 4F7UF 2L3SA 2DIQA 4M78F 5I2MA 3MP8A 3A8HB 4M4ZA 4Z89A 5GJVB 5KYWB 2FL7A 2FPEA 3M53A 2NWMA 1QWFA 5LJ5e 2JZ2A 7AT1B 1H641 1CKAA 3A5ZB 1WLPB 2EGAA 4M77B 4BI4A 1BIBA 2K6DA 2Z0WA 3VYHB 3SHWA 1I0CA 4CC3A 2KT1A 2GFAA 4ME7A 3LGLA 1MMAA 3REBB 3CPWP 2E41A 2ZPEB 2ED0A 2EYZA 5A0DA 2DRMA 3ZFJA 2RHIA 4FW2A 2CDTA 2YT6A 1Q95G 3QSUA 2JUFA 4HCKA 2FPFA 1PHTA 3CMEA 3CD6A 1HD3A 3GNGA 1KQ2A 4E7JA 1FXXA 1JXMA 2KBTA 4M7AB 4M7DF 1SRLA 1YITQ 4XU3A 1B3QA 2DEQA 4FU6A 4XQ3A 3MEVA 1NEGA 1OOTA 5AYFA 4XU0A 2GBQA 2Y4YA 3CC4T 4J83A 4EMGA 4PJJA 1PWTA 1RAAB 1KD1R 1VQLT 5CIUA 1PM3A 1VQPT 4C92F 3X25B 5DM7R 2CZ0B 4PLLA 3EFOA 1RAFB 5GAOn 4C8QB 5CO7A 2C06A 2E64A 2IIMA 3KFVA 3CCRT 4HT8A 1YN8A 1BIAA 1E6GA 2LJ1A 2YUNA 3QJ6A 2QA4A 2PZ1A 1R0BG 5GAOr 1Q86C 2JJ9A 1OI1A 1G83A 4JJDA 4WCIA 4ZNXA 2DJZA 3TREA 2DXTA 2OTLQ 4FT4A 3CMAQ 3QWYA 3J7AF 2HBPA 1A0NB 4PK4A 3I56A 2C0OA 3I55A 1JO8A 4HCCA 1GFCA 2QDLA 4CC4B 1KD1U 2EKHA 3CC7T 4XK8E 2PUKB 1ZUYA 2RNAA 5FRMA 1YI2Q 2CSIA 2LRQA 4OB0B 5LL6S 3OYLA 3L2VA 3OYIA 2XDBA 1S72T 2KI7A 4NS5A 1N8RR 4FYXB 2WACA 2CKKA 1KG1A 1WGSA 2I2LA 3L42A 5GMKh 5KYXB 2HKQB 4OMLA 2LX9A 4LDYA 2NUTA 4E7HA 2GQVA 2HSEB 2JMCA 3EHRA 2DZCA 2DD5A 3PTAA 1NEBA 4BI8B 1I07A 2KXCA 1QMCA 1I5LA 1E7OA 1M3AA 1FMVA 1YJWT 5GAN5 2F5TX 4R0KA 1M1FA 1W6XA 2KXDA 4C8QA 3GP8A 3TEEA 4E7LA 3PMTA 1RAHB 1AWWA 3HL8A 2XKOC 1AZEA 4RTZA 4E7ZA 4QVCA 3A98A 2LT1A 3PFSA 3M9QA 1N8RU 1Z9ZA 4MZMA 4C8QC 1W70A 1M30A 3QWXX 1KQSP 2EYWA 2W0ZA 4BDZA 2YLBA 1D09B 2HNIA 3CCSQ 2J6FA 2L5QA 1OZ2A 3GNFB 3S3MA 1ZX6A 1KQSS 5KE3A 1SSHA 2DL4A 3OYGA 1BI1A 2JVVA 2FVUA 1OPLA 4OMPA 3OA6A 4BDYA 4LUEA 1VQ6T 1H3ZA 1X2QA 5HK3A 3EG9B 3WVEB 4FSXA 2H3EB 5HY6A 4J9DA 1YITA 1W2BS 1OYXA 3MEAA 3EH2A 2B8AA 3TU4K 2OTJQ 4AFUC 5GAMf 5FU6C 4OB2B 5KYYB 4PKCC 2DA9A 1AD5A 2E6ZA 1G3TA 1QKXA 2V1QA 4OMFB 3PIOA 1G3SA 4HT9A 4HVWA 2EQIA 4DBFA 4LXCA 5A0LA 3FJPA 4YTLA 1VYVA 2JMAA 4F7UB 1H92A 5I22A 3CCMQ 2CUDA 2P84A 2ZGWA 3UT1A 2GTOA 1D1BA 1YP5A 1ZBJA 2D1XA 4Z8AA 4CRIA 3QDFA 2DVEA 5GANh 4FL6A 3EG2A 4JRKA 4KGXB 3M57A 2KYBA 4MZTA 3CCRA 3M0TA 3OS2A 2W10A 1YHQT 3ASKA 3OYCA 3BDLA 1G8XA 2DK3A 2XG8D 4C8QE 3JCMf 4Q5WA 4UC4A 2EWNA 1BU1A 1ZHIA 1U1SA 5KCOA 1LVKA 1TUGB 1T3LA 5HCKA 4MMLA 4IUVA 2QG9B 1T0JA 2X3WD 2PUOB 5L8RE 2L3RA 2CP7A 1YI2A 2NYSA 3QPHA 1J3TA 2L3QA 4C8QD 5GANj 2HCKA 2EYYA 2LNHB 1QW1A 1AZGB 4XTYA 2OAWA 1O9SA 5FROA 2DTIA 2KY9A 4MDWA 1TUDA 2ZAEA 1S72A 2DMOA 1MMNA 3REAB 3OMCA 2M0OA 5GAMd 2FB7A 4R55A 4J8OA 2HL5C 2RMOA 1Y57A 4C92B 4OMOA 4OB3B 3OYAA 1Y07A 2RHXA 2IVWA 3ZBDA 3OYYA 3G4ST 4J7FA 4EPCA 2DF6A 3EFRA 1XOVA 4P5NA 4BE0A 2D8HA 1NPRA 2QQRA 4A4GA 1YJWA 2NUPA 1OEBA 1TS9A 3DLLA 3UF4A 1ABQA 2FYKA 1Q7YC 1QWEA 4JS5A 1M2VA 2HEQA 4OVAA 2DYBA 3FC3A 3C95A 4QQ6A 4HA8A 1ARKA 2V1RA 2GF7A 2A28A 2DIGA 3E9GA 3OBYA 1EX4A 2H8HA 3JCMd 4RG2A 2DVJA 2GNCA 2D0NA 2R57A 2SRCA 2HAXA 4BY6B 2ENMA 3VS2A 3EGDA 3CCVQ 1GFDA 1JB0E 2DBMA 2OTJA 2MK5A 3CCUQ 8ATCB 2ECZA 3JCMQ 4PNOA 3FRNA 2EFIA 1SPKA 3V7RA 4LD6A 3L2UA 1XNIA 3FJ5A 4J6XA 1DJ7B 5DY9A 4RTUA 3QJYA 2KGTA 3CMET 5KYUA 2XMFA 1N5ZA 4E47A 1VQKA 2LTOA 2KMTA 4LDXA 2JW4A 2BE9B 2YRVA 4M78G 1TTHB 4PJOG 4JLIA 5LJ5h 2HMAA 2A0FB 4GY5A 1TXQA 1K1ZA 1X6OA 4L6V5 3M4GA 2RQRA 4C5HA 4M75B 1KD1C 1BBZA 2RA2A 3RKWA 3A8LB 2VYTA 3C94A 4AT1B 4EMKA 2CH4W 1G2BA 1VQ9Q 3PT9A 1ZA1B 2JOYA 1SHGA 3VU3C 1VQMQ 1YHQA 3META 2F1LA 4A63B 4RTTA 4OMQA 4EMKC 2OI3A 1HK9A 3FEOA 2JS0A 1X6BA 3I56T 1IO6A 1K8AU 2AZVA 3I55T 1OX8A 3UWNA 1JU5C 2RPNA 4FIBA 4JUVA 4BY6C 2EGCA 2RD1A 2XICA 2L3PA 1B34A 4N4IA 1V29B 1SHFA 4J9EA 2RK2A 3G7ZA 1T3SA 3BW1A 4F17A 1VQ5Q 1X69A 4GLKA 4RTWA 1F1BB 3M58A 2LQKA 4DEYA 2EKOA 2YHTA 5CKDA 2ED1A 4LN2A 2ZPIB 3JB9H 1HXDA 1OU8A 1XJWB 3JCMV 1YJNT 5FU7B 3X20B 4A4HA 3G4SA 4RCBA 1NYGA 1M1KC 3RBBB 1JRIA 3F70A 1WHKA 3QZ9B 5FW9A 1M90C 3OQ5A 1W2BA 5CQXA 8AT1B 2BZ8A 1Q7YR 5D7UA 2LZ6B 2WSEE 3WVDB 4QVDA 2LT4A 4ZGDB 2JS2A 3OYHA 1RLPC 2CP0A 4IUTA 5GMKi 5IHIA 1YIJQ 1ZSGA 4PJOF 4RUGA 4BACA 3QUIA 1BI3A 1VYTA 3OS0A 4B9XA 3LH5A 1IXDA 3L2RA 1I4K1 4GLMA 2GQIA 3HTRA 1GCPA 5I11A 4HVVA 1WNLA 4JJNK 5GAMe 2MIOA 3OSVA 4OF1A 5CKFA 4BUGA 1UG1A 3M0QA 2RHUA 1GL5A 2K5FA 3MO8A 1BCOA 1Q7YU 2O01E 3OB9A 1YITT 2CREA 3JCMW 3I35A 3EGXB 3NMZC 1M4ZA 3KUFA 5GAMg 3DB4A 1TU0B 2COYA 4PFOA 2LDMA 2K57A 3BE3A 5A2QE 1BI0A 3JV3A 2FEIA 2P0KA 1SRMA 4KGZB 4ZGJB 4IUQA 5KE2A 4IUUA 1M2OA 2F2WA 3PVLA 1VQOQ 2NLUA 2V8JA 1B7TA 5FU7C 3DB3A 1ACMB 1OX9A 3THKA 2H3JA 1M5Q1 2LCLA 3JCMe 1QP3A 4DA4A 1XTDA 1WI7A 2KROA 4X34A 4J9GA 4JRQA 3SB2A 2KAFA 3VUBA 4IKFA 1U8RA 1VQ7Q 1Y96A 3I5SA 2IPOB 2EJ9A 2EAYA 2OTLT 5KYWA 1R8OB 5IHNA 4M75E 4Y28E 5GAN7 4J7IA 1GBQA 2MOXA 4OGEA 1X01A 2ZPFB 3KBGA 4M77A 4K11A 3JCMg 2M0YA 4CC7A 2DAQA 1YI2T 3E19A 2CT3A 2F2VA 3HPWA 2R58A 1VQPQ 2V8IA 3I5RA 2QQSA 4M77C 2EJGA 2EGEA 3S3OA 3GF5A 4E7SA 2XDDA 5CR2A 2EQJA 3QO3A 1VQNQ 3TQ7P 5CKBA 1WHJA 2DL5A 1UGRB 5KYNA 4M7AA 3UDCA 4RKUE 1RL2A 1OULA 2FZCB 3RDVA 1LCKA 3QYHB 3JCMb 1EZZB 2HSPA 1M1KR 1G5VA 1RAEB 3TSWA 1YJNA 3G6EQ 2K5LA 3Q1JA 4AFZC 4M7AC 3CQTA 1MMDA 1M90R 1WHMA 2FHDA 4DBQA 5GAN6 1KSWA 3CC7Q 1RI0A 1Z9QA 2DTOA 1YFNA 4ZN1A 3CCQQ 2WSCE 4ESRA 1JJ2A 2J05A 1ABOA 5J26A 4XTXA 1C0MA 2A7YA 1UTIA 1PSEA 1H3HA 3X28B 5IXBA 4KUDK 4B6MA 1RUWA 5IHKA 1Y0MA 2DXUA 4XTVA 2GCXA 2KE9A 4EDUA 1SEMA 5DLQE 1OV3A 2YLCA 1M1KU 5CKHA 3G71Q 3RESA 1MGQA 1R0CB 1M90U 1K76A 1NLPC 4C0ZA 1WXUA 3HRSA 2E4HA 2OTJT 3MJXA 1W2BP 2CYZB 2EYQA 4FYVB 3LGFA 2QASA 4HVUA 3INZA 3J80E 4KH1B 4M77E 1WYXA 2K3XA 2X9HA 1MV3A 4F14A 1FMKA 2VUBA 4PJLA 1ZSZB 2DM1A 1VQ4Q 2PTKA 3L2WA 2YSQA 1WZOA 2DL8A 1NZ9A 2J6OA 3GLXA 3C4SA 2YUPA 3G1JA 3CCLQ 1VQKT 3CC2Q 2XD0A 2G6FX 5KYXA 3P8BB 4X9DA 4KT0E 3A8GB 1IGUA 4A4KA 4M77D 3EG0A 2X4YA 2PVDB 1D0XA 2RJDA 3M0UA 2FRYA 5LJ3f 4KULA 4M7AE 3M0SA 1TUCA 2EVRA 4PFPA 4M78B 2DBKA 2KT8A 2ROTA 4LDUA 1K8AC 3SWNB 1WPYA 1PRLC 1Y7XA 4J5YA 5GAOp 1SKUB 1IHVA 3X24B 2L8DA 2E3IA 4NL2A 3M59A 4RTVA 2BE7D 3CXCA 3P8DA 2YDLA 2FRWA 3U23A 2Y90A 4M7AD 1WDXA 2OTLA 4FYYB 4IIOA 3ULRB 2V26A 3VV0A 2GFUA 3CMAA 2VC8A 4QKUA 3LYIA 4C8QG 1HSQA 3CBOA 1K9AA 1KHIA 2L2PA 2KRMA 3V8LA 3OSSC 1PNJA 1K9MC 1NYFA 2MMPA 1D0ZA 2L0AA 3JSCA 1IZ6A 3VJPA 1SG5A 2D0QB 3VS1A 2AIRB 4Z02A 3QZ5B 2QEXQ 2F69A 2KSSA 4J9CA 1N9SA 2IG0A 1LNXA 2RQTA 4OMNA 3MKDA 2BZYA 1BK2A 2FZGB 3EG9A 2KEAA 2BTTA 1QCOA 4ORZA 4M7DB 4N4HA 4HCZA 3PIPA 2X3XD 2E70A 4JJBA 2COZA 1MNDA 4AG2C 4CC2A 5GAOm 4RTYA 5ECAA 1NLOC 3S6WA 5GJWB 1PKTA 5KYYA 3HSBA 3FLGA 5GAOq 4JDSA 4EMHA 3HRTA 1P92A 1RAIB 2D9TA 2O9SA 3VUZA 1BB9A 5FLXE 2X51A 3QDRB 3A1PA 6AT1B 1MUZA 5I2SA 2JXBA 3CCQA 4R56A 5HKCA 4F7UA 1UECA 4M77F 4C0GA 1Q82C 3EG3A 3V7CA 3S3NA 5LJ3d 3SWNA 4E7KA 5A0GA 3NHNA 5D6WA 4E2FB 2MAMA 3M5AA 3SEMA 2A36A 2YWWA 4N0AA 1VQ8Q 3SWNC 3JCMX 3JB9D 1XQHA 2K2MA 4O5VA 2EYXA 3CBPA 2D8JA 3CCSA 3ME9A 2L89A 4BI3A 4JZ4A 2RK1A 2JNGA 4N0AC 2E1HA 3V7SA 3CPWA 4A53A 4V2SA 1H8KA 1N27A 1YCYA 2QTVA 3H0HA 2FPDA 3GIBA 1KQ1A 1UGVA 3RIRA 4Z88A 1K0XA 2QTXA 3JB9I 4M7DA 3RKXA 1YJ9Q 2P4RA 1BCMA 1D3BB 1UHCA 4JJCA 3OYEA 3CCLA 5L23A 1PRMC 1JJ2P 2KK4A 2Y4XA 2A3LA 1QQJA 2RQVA 2BZXA 1WQ7A 4B9WA 1UUEA 4M7DC 3H0IA 4C8QF 2LJ0A 2ZCFB 3RERA 1KJWA 1JJ2S 2COWA 2XDPA 1M3BA 3VS5A 2DO3A 2DERA 2EBPA 4C92A 2QI2A 5D6XA 1GXIE 2F2XA 1QCNA 3CCMA 2EIFA 1N9RA 1VYUA 1UGSB 2K3YA 2EQKA 4C92C 1K8AR 3NGPA 4QVZA 5GAN8 4A4EA 3JCMc 5FWBA 3EFSA 1OU9A 2DD4A 2KNBB 3SD4A 1Y71A 2K5IA 5GAMh 2A08A 2RQWA 2E3HA 2WSFE 1VQ9T 1X2KA 2RJCA 4F7UE 1VQMT 3CMEQ 3CD6Q 4M78E 2ABLA 5KCHA 2VXFA 5C0MA 2ATCB 3QG1A 1UHFA 1MMGA 3O5ZA 1GRIA 3BFMA 4HXJA 1K9MR 4KRTA 2LP5A 4XTWA 5CQYA 5I21A 1JXOA 1NPPA 2KDSA 2G3RA 3VYGA 3GPLA 4KUIA 1SSFA 1M27C 1QVFA 3CBMA 1I8FA 1IRXA 2RM4A 4XAXB 1AWJA 1YNZA 1VQ5T 2HZYA 1EFNA 4F16A 5GAMj 4ELZC 4TVRA 1V76A 2HKNA 1WFWA 1IREB 1O75A 4AMCA 1WIEA 1AWXA 3JCMh 1G3WA 2RF0A 4LE9A 1T0HA 3CXCP 3MHXA 5EG2A 2QA4Q 3CCEQ 4M7DE 2DILA 1WA7A 2QGGA 2VKNA 2VXEA 3E2UA 3CXCS 3PGGA 2DLPA 4C5IA 1K9MU 1NJIR 3L1AA 3DLMA 3HRUA 2BIVA 5KH6A 1Q82R 2CSQA 1X27A 3I55Q 1WJSA 3EGUA 4IUPA 1K73R 4NOYA 1YWOA 4M7DD 1VQ8A 4C92E 2QGFB 2O2OA 1AOJA 4M75A 1GBRA 3RKYA 3OW2A 1UEBA 1AHJB 2RI2A 1TH7A 1Q81R 4Y92A 2QDYB 2FG0A 2E5QA 2K3BA 1PC0A 4M75C 3CCJQ 5HK0A 5FRNA 4C92D 2LCSA 2VWFA 2K7AA 3TCJA 3CCVA 1NJIU 3A8OB 2BUDA 1ZA2B 4DBRA 1FWZA 1Q82U 3CCUA 2AHJB 4OB1B 1FMWA 5GAN2 3EFOB 1K73U 3M0RA 1PKSA 2KVQG 2MWOA 4LDWA 3NFCA 3OYFA 4OMMA 1JBMA 5GAOl 2OJ2A 4PL6A 3PMIA 3EAEA 1LPLA 2P0PA 1I81A 1Q81U 5LJ3e 1X43A 2PNIA 1JEGA 2NUZA 1ZBXA 3LLRA 2KRSA 3H9NA 1UB4A 2CP6A 3VRZA 1VQOT 2K2VA 1WHHA 1X6GA 2RJEA 4VUBA 4JZ3A 3N5BB 1C1AA 1TSFA 1X75C 3TVTA 4F04B 5LJ5g 1WHGA 3H8ZA 3CPWS 1AVZC 2E65A 1VQ7T 3LX7A 2E12A 3OBWA 4KH0B 3WXMB 2MPXC 2PU9B 1G3YA 3PNWC 4EIKA 5LJ3g 2CP3A 5GANf 2JN0A 4KBMB 4QQDA 1HJDA 2XK0A 3H0FA 1VQ9A 2MF2A 4J6YA 2KRNA 1VQMA 2NUTB 1GCQA 2RI3A 4GBQA 3HFNA 2QAZA 3HHTB 4J9FA 1M9SA 4JPBW 4KGVB 4FW1A 1CSKA 1RI9A 4IIMA 4M75G 5J39A 3CMAT 1GCQC 2RHZA 1M3CA 1RADB 1QVGA 1NM7A 3CC4Q 1WQWA 3NTKA 2F5KA 2M1HA 3JCMJ 1WXBA 1RAGB 2MWPA 2V8KA 1UE9A 3JAME 1S1NA 1VQLQ 1VIFA 4DBHA 2D6FA 3M56A 2CS7A 1VQ5A 4J9IA 3CCEA 1VQNT 4M75D 4OP0A 1VUBA 2EQUA 1MV0B 2MCNA 4LNPA 3CCRQ 3T9NA 1M1GA 3EGXA 1NG2A 3G6ET 2LX7A 3RNJA 4BB7A 1KC8R 4LD9K 2E10A 1UJYA 1OZ3A 1PD1A 2JM8A 1U06A 2AT1B 2MYSA 1LJOA 4QW2A 5IT9E 4JLGA 1QP2A 4ZTFA 3CCQT 2B86A 5FU6B 1LOJA 1D1CA 1WJQA 1QVFP 3QXEB 5EC7A 4E6RA 2SEMA 3OYKA 3TSZA 1IGQA 3KXTA 2YUQA 2ROLA 3CCJA 2DEUA 1QVFS 1AWOA 3OYDA 1YIJA 4ZTJA 4C0FA 5GANd 2OX7A 4L59A 2KQWA 5IAYA 1S72Q 2LQ8A 3VS4A 4QQGA 3FDRA 3OS5A 2C0IA 1QKWA 3G71T 4PJNA 2HDAA 5CCAA 3CCST 1KC8U 1NBEB 4DEXA 3QKJA 4X1VA 4D8KA 9ATCB 3OS1A 2AK5A 2JTFA 4L5GA 1ZUKA 4BD3A 1ZUUA 4J9HA 3UATA 2RI5A 3D7SB 1RABB 2M16A 4AG1C 3R6OA 1YJWQ 2FO0A 1VQ4T 2VVKA 3ER0A 2DJQA 1ZLMA 2QXFA 3OYNA 1RLQC 5GMKj 2JT4A 1N6AA 1WXTA 2CT4A 3CCLT 3CC2T 1UJ0A 3VS6A 4DOVA 4M77G 4D8DA 3OW2P 2YRCA 4M75F 3NPFA 5DLOA 1WJRA 5CKEA 1EIFA 4ZGEB 4IURA 3AT1B 1FYNA 3OW2S 2LJ3A 3DKMA 1QCFA 1KHCA 3EH1A 3HP9A 5IN1A 2O88A 4JRIA 3CCMT 1VQOA 3OYBA 1OPKA 2JTMA 3RR6A 3EG1A 5LJ5f 2DE0X 4RMOA 3QIIA 3JCMP 4M7AG 2DZ9A 1W1FA 1VQ6Q 4MMKA 2ZPBB 4OGCA 5GMKm 3OY9A 1VQ7A 3OYJA 2LQNA 4FSSA 4C5EA 4PJOB 2RO0A 1I5OB 5J3BA 2QQAA 1VIEA 2YXYA 1MHNA 1UDLA 2QQ9A 2LNVA 2X4XA 2JM9A 4WF2A 2J7IA 2XU8A 1VQKQ 3VRYA 3GOXA 3CC4A 5GAN4 3LWHA 3UPUA 3MEUA 3MPUB 4X9CA 2VGMA 2AZSA 3EHQA 2QEXT 1VQLA 3PE0A 1PD0A 3H6ZA 1VQPA 3UA7A 1AEYA 2CZ6B 4E7IA 2NUPB 4DQ2A 2LVMA 5IXFA 4JRPA 3M4YA 1Q86R 1TOVA 5GMKe 1M2VB 2P4TA 2YUOA 3QBYA 4FYWB 2GTJA 2EW3A 1VQNA 2O31A 1B07A 3V8JA 1ZSZA 1UFFA 2KR3A 3HFOA 2K79A 3J81E 1YHQQ 3JB9J 3G6EA 4LDVA 3EGDB 3ZEHA 2K9GA 2O4XB 1ZSZC 3C0CA 3A8MB 3PVQA 2J6KA 4D6WA 2LC4A 3CC7A 1QVGP 3JB9G 1AT1B 3ZL7C 1NJIC 5LJ5d 3IQLA 3MCAB 2PQWA 4M78A 5D6YA 4DOWA 4CI0C 1VQ8T 4FM4B 1QVGS 4PJOA 1Q86U 5KYUB 2C0TA 3OMGA 1K73C 5IH2A 1YWPA 2OAUA 3FIFA 2CZ7B 5CAIA 2QK0A 4M78C 3BY7A 2X4JA 1TWBA 4FT2A 2XIDA 2HD0A 4PJOC 4QT7A 2VB6A 4PFZA 5CK9A 3G71A 2MI6A 3LWIA 3VS0A 1KIKA 1Q81C 2BKDN 2QQBA 2VASA 3E9FA 3VS3A 4XU1A 2RQUA 2DNUA 2X35A 3X26B 3CCVT 4M7AF 3BDUA 3CEYA 3QYGB 3G4SQ 1YJ9T 2R5MA 2YRDA 3MP6A 3GBQA 3CCUT 3M55A 2CP2A 4LUDA 2RB6A 1HYOA 2J06A 2FZKB 3LH0A 2HQHA 1U5SA 4PJMA 2R5AA 1VQ4A 4RCCA 3O8VA 1UGPB 4EMKB 4C0DB 2ZPHB 2P0QA 1RACB 3R6NA 2DL3A 2DPPB 3CC2A 1YBYA 2EJFA 1SF9A 2CGHA 1E6HA 3LW5E 5CVIA 2VV5A 1M8VA 2DYIA 5C6SA 1JQQA 2O4XA 3RUXA 3NTHA 1QLYA 4XTZA 1ZQ1A 3M54A 4WTOB 5M9OA 1VQ6A 4FCYA 5GANe 2DETA 4HKEA 3MEWA 1D1AA 1B34B 3M0PA 4PLIA 2DKGA 1VA7A 1W4SA 2RN8A 3CD6T 2CH4A 4MZPA 2HBWA 4Y91A 2DRKA 2I0NA 3VS7A 2KYMA 3QHSA 2DTHA 1WX6A 3E1SA 4F7UG 2LQWA 3RMQA 2ZPGB 5GANg 2AKKA 3C12A 1C6VX 4ATOA 4PJOE 3NTIA 3OYMA 2PVGB 3SDZA 3JB9F 5LJ3h 2AKLA 2CP5A 2CUBA 2QEXA 2HQEA 4A4FA 1K0SA 4JS4A 2E5KA 3SFMA 2EQMA 3MP1A 4N4GA 1FX7A 1TG0A 4AFSC 4J9BA 4M78D 4AFQC 2EPDA 4XTUA 1D0YA 2XHCA 4PJOD 4RG8A 5AT1B 2DL7A 1PCXA 3H41A 1BI2A 2QA4T 1D3BA 3CCET 1WHLA 1M8MA 3VKIA 4BE1A 4NL3A 3FB9A 2PVOB 1I1JA 1OQKA 4C0DC 2E6NA 5LJ5j 2RH2A 1QVPA 2RJFA 4M7DG 4ELYC 1UGQB 1PSFA 5LJ3j 4ANJA 1YCSB 3JRZA 1CKBA 1KC8C 4HCBA 4ZN3A 2ESWA 2DFUA 2M02A 5FWCA 3I56Q 1K4US 5GMKl 2O9VA 1IB8A 4C5GA 3URGA 1V1CA 3L2ZA 4C92G 4O6JA 1NE8A 2LCCA 1KK7A 4MDXA 1R77A 2JTEA 2K4YA 2LMJA 1U1TA 3CCJT 1N8RC 1KQSA 4XU2A 2A37A 1YIJT 3AHUA
chains in the Genus database with same CATH topology
2DVJA 3M0SA 1TUCA 2D0NA 2EVRA 2GNCA 2SRCA 2GGRA 2ENMA 3VS2A 2DBKA 2KT8A 2ROTA 1MV0B 1PRLC 2MCNA 4LNPA 4RTXA 1GFDA 1KFZA 2M51A 2DBMA 4RTVA 2ECZA 1U3OA 1NG2A 2LX7A 3RNJA 1UJYA 1SPKA 3I9QA 2YDLA 2FRWA 3U23A 3FJ5A 2JM8A 4RTUA 1U06A 1WDXA 2KGTA 4IIOA 3ULRB 2XMFA 2DX1A 1N5ZA 1HSQA 3UA6A 2B86A 1K9AA 2L2PA 2KRMA 1PNJA 2L3SA 1NYFA 5EC7A 4E6RA 4M4ZA 2JW4A 2L0AA 2SEMA 4Z89A 5GJVB 3VS1A 3TSZA 2FPEA 2NWMA 4J9CA 1QWFA 2YUQA 2ROLA 2RQTA 4OMNA 1AWOA 2BZYA 1CKAA 1BK2A 1WLPB 2EGAA 1K1ZA 2BTTA 2KEAA 4ORZA 2K6DA 2X3XD 3SHWA 1I0CA 4JJBA 3VS4A 4AG2C 4CC3A 2C0IA 1QKWA 2KT1A 2RQRA 4CC2A 2HDAA 4RTYA 5ECAA 1NLOC 1BBZA 3REBB 5GJWB 2ED0A 2EYZA 1PKTA 4DEXA 2DRMA 2CDTA 2YT6A 4X1VA 4D8KA 2AK5A 2CH4W 2O9SA 1BB9A 4HCKA 1G2BA 2FPFA 1PHTA 1ZUKA 1HD3A 1MUZA 1SHGA 1ZUUA 4J9HA 3UATA 2JXBA 4A63B 4RTTA 4AG1C 1JXMA 2KBTA 4OMQA 1UECA 2FO0A 2VVKA 2OI3A 2DJQA 1ZLMA 1SRLA 1RLQC 2JT4A 2JS0A 1B3QA 3EG3A 1WXTA 2CT4A 1NEGA 1UJ0A 1X6BA 3VS6A 3NHNA 1IO6A 1OOTA 2AZVA 4D8DA 2GBQA 3NPFA 1JU5C 2RPNA 3SEMA 2A36A 2EGCA 1FYNA 1PWTA 2L3PA 2K2MA 2LJ3A 2EYXA 1SHFA 4J9EA 1QCFA 1T3SA 4F17A 2D8JA 2O88A 1OPKA 4JZ4A 1X69A 3EG1A 4RTWA 2DE0X 2IIMA 4DEYA 3KFVA 1H8KA 3H0HA 2FPDA 2ED1A 1W1FA 1YN8A 1E6GA 2LJ1A 2YUNA 4LN2A 1UGVA 2PZ1A 2LQNA 4FSSA 1G83A 4JJDA 4WCIA 4Z88A 1K0XA 4ZNXA 1NYGA 3RBBB 1UDLA 2P4RA 1UHCA 4JJCA 5FW9A 2JM9A 3QWYA 1A0NB 5L23A 1PRMC 2J7IA 2C0OA 2RQVA 1JO8A 3VRYA 2BZXA 1GFCA 2QDLA 1UUEA 2BZ8A 3H0IA 4CC4B 2LJ0A 2EKHA 2AZSA 2LZ6B 3EHQA 1KJWA 2JS2A 1RLPC 3PE0A 1M3BA 1ZUYA 2RNAA 3VS5A 2EBPA 2CSIA 3UA7A 1AEYA 5IHIA 1ZSGA 2F2XA 5IXFA 1VYUA 4RUGA 1VYTA 3LH5A 4OMLA 3NGPA 2YUOA 2GTJA 2EW3A 4GLMA 2GQIA 5FWBA 2KNBB 2O31A 1B07A 1GCPA 5I11A 2JMCA 4HVVA 3EHRA 2A08A 1UFFA 2RQWA 1NEBA 2MIOA 1I07A 1X2KA 2KXCA 1UG1A 2KR3A 1E7OA 3M0QA 2K79A 1GL5A 1M3AA 2ABLA 2CREA 2K9GA 4R0KA 3C0CA 1W6XA 2KXDA 3I35A 1UHFA 2J6KA 3PVQA 3O5ZA 1GRIA 4HXJA 1AWWA 1AZEA 4KRTA 2LP5A 4RTZA 3NMZC 3ZL7C 1JXOA 3IQLA 3A98A 1Z9ZA 1M27C 1W70A 1M30A 3QWXX 2C0TA 2EYWA 2W0ZA 3JV3A 5IH2A 1AWJA 1YNZA 1YWPA 2FEIA 1EFNA 1SRMA 4F16A 2J6FA 2F2WA 3PVLA 1ZX6A 1WFWA 1SSHA 2DL4A 4QT7A 3THKA 1WIEA 1AWXA 2RF0A 1OPLA 4OMPA 4LE9A 1T0HA 4LUEA 1WI7A 2KROA 3VS0A 4J9GA 1KIKA 1X2QA 3VS3A 2RQUA 2DILA 2DNUA 1WA7A 3I5SA 2VKNA 4J9DA 2DLPA 3GBQA 5IHNA 4LUDA 4AFUC 2J06A 2CSQA 1GBQA 1X27A 2MOXA 1U5SA 2DA9A 1AD5A 3EGUA 1YWOA 4K11A 2M0YA 1QKXA 2V1QA 3R6NA 2DL3A 4HVWA 2O2OA 2EQIA 4CC7A 1AOJA 2CT3A 2F2VA 1VYVA 2JMAA 1E6HA 1GBRA 3I5RA 1H92A 5I22A 2CUDA 2EGEA 1JQQA 2GTOA 1ZBJA 1YP5A 4Y92A 2FG0A 2K3BA 1QLYA 2D1XA 4Z8AA 3EG2A 2LCSA 2VWFA 2KYBA 2K7AA 2DL5A 3M0PA 1VA7A 3M0TA 2RN8A 2W10A 1LCKA 2CH4A 2HSPA 3TSWA 2HBWA 2DRKA 2I0NA 4AFZC 3M0RA 1PKSA 3CQTA 3VS7A 2KYMA 1BU1A 1WX6A 1KSWA 1T3LA 5HCKA 2LQWA 4OMMA 1T0JA 1Z9QA 2X3WD 2AKKA 2OJ2A 4ESRA 2J05A 1ABOA 2AKLA 1UTIA 1J3TA 2L3QA 2CUBA 1H3HA 1X43A 2PNIA 2HCKA 2NUZA 1JEGA 2EYYA 5IXBA 1K0SA 2LNHB 2KRSA 2E5KA 1AZGB 2OAWA 1RUWA 3VRZA 5IHKA 1TUDA 1Y0MA 1TG0A 4AFSC 4J9BA 4AFQC 2DMOA 2EPDA 1X6GA 2KE9A 3REAB 1SEMA 4JZ3A 1OV3A 2DL7A 3H41A 3TVTA 2RMOA 1Y57A 4OMOA 1M8MA 1AVZC 1NLPC 1K76A 1WXUA 4EIKA 2DF6A 1I1JA 1XOVA 1HJDA 3H0FA 2D8HA 2KRNA 4HVUA 1GCQA 4GBQA 1WYXA 1YCSB 1MV3A 4J9FA 1FMKA 4JPBW 4F14A 1OEBA 1CSKA 1CKBA 2DM1A 1RI9A 2PTKA 4IIMA 3UF4A 2ESWA 2YSQA 2DL8A 2J6OA 1ABQA 2YUPA 5FWCA 1GCQC 1QWEA 1M3CA 2G6FX 1K4US 1NM7A 2O9VA 2HEQA 2DYBA 1V1CA 1ARKA 2V1RA 3EG0A 1WXBA 2A28A 1UE9A 3M0UA 1S1NA 2JTEA 2H8HA 2LMJA 2A37A 2FRYA 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  3M0S A;  1TUC A;  2D0N A;  2EVR A;  2GNC A;  2SRC A;  2GGR A;  2ENM A;  3VS2 A;  2DBK A;  2KT8 A;  2ROT A;  1MV0 B;  1PRL C;  2MCN A;  4LNP A;  4RTX A;  1GFD A;  1KFZ A;  2M51 A;  2DBM A;  4RTV A;  2ECZ A;  1U3O A;  1NG2 A;  2LX7 A;  3RNJ A;  1UJY A;  1SPK A;  3I9Q A;  2YDL A;  2FRW A;  3U23 A;  3FJ5 A;  2JM8 A;  4RTU A;  1U06 A;  1WDX A;  2KGT A;  4IIO A;  3ULR B;  2XMF A;  2DX1 A;  1N5Z A;  1HSQ A;  3UA6 A;  2B86 A;  1K9A A;  2L2P A;  2KRM A;  1PNJ A;  2L3S A;  1NYF A;  5EC7 A;  4E6R A;  4M4Z A;  2JW4 A;  2L0A A;  2SEM A;  4Z89 A;  5GJV B;  3VS1 A;  3TSZ A;  2FPE A;  2NWM A;  4J9C A;  1QWF A;  2YUQ A;  2ROL A;  2RQT A;  4OMN A;  1AWO A;  2BZY A;  1CKA A;  1BK2 A;  1WLP B;  2EGA A;  1K1Z A;  2BTT A;  2KEA A;  4ORZ A;  2K6D A;  2X3X D;  3SHW A;  1I0C A;  4JJB A;  3VS4 A;  4AG2 C;  4CC3 A;  2C0I A;  1QKW A;  2KT1 A;  2RQR A;  4CC2 A;  2HDA A;  4RTY A;  5ECA A;  1NLO C;  1BBZ A;  3REB B;  5GJW B;  2ED0 A;  2EYZ A;  1PKT A;  4DEX A;  2DRM A;  2CDT A;  2YT6 A;  4X1V A;  4D8K A;  2AK5 A;  2CH4 W;  2O9S A;  1BB9 A;  4HCK A;  1G2B A;  2FPF A;  1PHT A;  1ZUK A;  1HD3 A;  1MUZ A;  1SHG A;  1ZUU A;  4J9H A;  3UAT A;  2JXB A;  4A63 B;  4RTT A;  4AG1 C;  1JXM A;  2KBT A;  4OMQ A;  1UEC A;  2FO0 A;  2VVK A;  2OI3 A;  2DJQ A;  1ZLM A;  1SRL A;  1RLQ C;  2JT4 A;  2JS0 A;  1B3Q A;  3EG3 A;  1WXT A;  2CT4 A;  1NEG A;  1UJ0 A;  1X6B A;  3VS6 A;  3NHN A;  1IO6 A;  1OOT A;  2AZV A;  4D8D A;  2GBQ A;  3NPF A;  1JU5 C;  2RPN A;  3SEM A;  2A36 A;  2EGC A;  1FYN A;  1PWT A;  2L3P A;  2K2M A;  2LJ3 A;  2EYX A;  1SHF A;  4J9E A;  1QCF A;  1T3S A;  4F17 A;  2D8J A;  2O88 A;  1OPK A;  4JZ4 A;  1X69 A;  3EG1 A;  4RTW A;  2DE0 X;  2IIM A;  4DEY A;  3KFV A;  1H8K A;  3H0H A;  2FPD A;  2ED1 A;  1W1F A;  1YN8 A;  1E6G A;  2LJ1 A;  2YUN A;  4LN2 A;  1UGV A;  2PZ1 A;  2LQN A;  4FSS A;  1G83 A;  4JJD A;  4WCI A;  4Z88 A;  1K0X A;  4ZNX A;  1NYG A;  3RBB B;  1UDL A;  2P4R A;  1UHC A;  4JJC A;  5FW9 A;  2JM9 A;  3QWY A;  1A0N B;  5L23 A;  1PRM C;  2J7I A;  2C0O A;  2RQV A;  1JO8 A;  3VRY A;  2BZX A;  1GFC A;  2QDL A;  1UUE A;  2BZ8 A;  3H0I A;  4CC4 B;  2LJ0 A;  2EKH A;  2AZS A;  2LZ6 B;  3EHQ A;  1KJW A;  2JS2 A;  1RLP C;  3PE0 A;  1M3B A;  1ZUY A;  2RNA A;  3VS5 A;  2EBP A;  2CSI A;  3UA7 A;  1AEY A;  5IHI A;  1ZSG A;  2F2X A;  5IXF A;  1VYU A;  4RUG A;  1VYT A;  3LH5 A;  4OML A;  3NGP A;  2YUO A;  2GTJ A;  2EW3 A;  4GLM A;  2GQI A;  5FWB A;  2KNB B;  2O31 A;  1B07 A;  1GCP A;  5I11 A;  2JMC A;  4HVV A;  3EHR A;  2A08 A;  1UFF A;  2RQW A;  1NEB A;  2MIO A;  1I07 A;  1X2K A;  2KXC A;  1UG1 A;  2KR3 A;  1E7O A;  3M0Q A;  2K79 A;  1GL5 A;  1M3A A;  2ABL A;  2CRE A;  2K9G A;  4R0K A;  3C0C A;  1W6X A;  2KXD A;  3I35 A;  1UHF A;  2J6K A;  3PVQ A;  3O5Z A;  1GRI A;  4HXJ A;  1AWW A;  1AZE A;  4KRT A;  2LP5 A;  4RTZ A;  3NMZ C;  3ZL7 C;  1JXO A;  3IQL A;  3A98 A;  1Z9Z A;  1M27 C;  1W70 A;  1M30 A;  3QWX X;  2C0T A;  2EYW A;  2W0Z A;  3JV3 A;  5IH2 A;  1AWJ A;  1YNZ A;  1YWP A;  2FEI A;  1EFN A;  1SRM A;  4F16 A;  2J6F A;  2F2W A;  3PVL A;  1ZX6 A;  1WFW A;  1SSH A;  2DL4 A;  4QT7 A;  3THK A;  1WIE A;  1AWX A;  2RF0 A;  1OPL A;  4OMP A;  4LE9 A;  1T0H A;  4LUE A;  1WI7 A;  2KRO A;  3VS0 A;  4J9G A;  1KIK A;  1X2Q A;  3VS3 A;  2RQU A;  2DIL A;  2DNU A;  1WA7 A;  3I5S A;  2VKN A;  4J9D A;  2DLP A;  3GBQ A;  5IHN A;  4LUD A;  4AFU C;  2J06 A;  2CSQ A;  1GBQ A;  1X27 A;  2MOX A;  1U5S A;  2DA9 A;  1AD5 A;  3EGU A;  1YWO A;  4K11 A;  2M0Y A;  1QKX A;  2V1Q A;  3R6N A;  2DL3 A;  4HVW A;  2O2O A;  2EQI A;  4CC7 A;  1AOJ A;  2CT3 A;  2F2V A;  1VYV A;  2JMA A;  1E6H A;  1GBR A;  3I5R A;  1H92 A;  5I22 A;  2CUD A;  2EGE A;  1JQQ A;  2GTO A;  1ZBJ A;  1YP5 A;  4Y92 A;  2FG0 A;  2K3B A;  1QLY A;  2D1X A;  4Z8A A;  3EG2 A;  2LCS A;  2VWF A;  2KYB A;  2K7A A;  2DL5 A;  3M0P A;  1VA7 A;  3M0T A;  2RN8 A;  2W10 A;  1LCK A;  2CH4 A;  2HSP A;  3TSW A;  2HBW A;  2DRK A;  2I0N A;  4AFZ C;  3M0R A;  1PKS A;  3CQT A;  3VS7 A;  2KYM A;  1BU1 A;  1WX6 A;  1KSW A;  1T3L A;  5HCK A;  2LQW A;  4OMM A;  1T0J A;  1Z9Q A;  2X3W D;  2AKK A;  2OJ2 A;  4ESR A;  2J05 A;  1ABO A;  2AKL A;  1UTI A;  1J3T A;  2L3Q A;  2CUB A;  1H3H A;  1X43 A;  2PNI A;  2HCK A;  2NUZ A;  1JEG A;  2EYY A;  5IXB A;  1K0S A;  2LNH B;  2KRS A;  2E5K A;  1AZG B;  2OAW A;  1RUW A;  3VRZ A;  5IHK A;  1TUD A;  1Y0M A;  1TG0 A;  4AFS C;  4J9B A;  4AFQ C;  2DMO A;  2EPD A;  1X6G A;  2KE9 A;  3REA B;  1SEM A;  4JZ3 A;  1OV3 A;  2DL7 A;  3H41 A;  3TVT A;  2RMO A;  1Y57 A;  4OMO A;  1M8M A;  1AVZ C;  1NLP C;  1K76 A;  1WXU A;  4EIK A;  2DF6 A;  1I1J A;  1XOV A;  1HJD A;  3H0F A;  2D8H A;  2KRN A;  4HVU A;  1GCQ A;  4GBQ A;  1WYX A;  1YCS B;  1MV3 A;  4J9F A;  1FMK A;  4JPB W;  4F14 A;  1OEB A;  1CSK A;  1CKB A;  2DM1 A;  1RI9 A;  2PTK A;  4IIM A;  3UF4 A;  2ESW A;  2YSQ A;  2DL8 A;  2J6O A;  1ABQ A;  2YUP A;  5FWC A;  1GCQ C;  1QWE A;  1M3C A;  2G6F X;  1K4U S;  1NM7 A;  2O9V A;  2HEQ A;  2DYB A;  1V1C A;  1ARK A;  2V1R A;  3EG0 A;  1WXB A;  2A28 A;  1UE9 A;  3M0U A;  1S1N A;  2JTE A;  2H8H A;  2LMJ A;  2A37 A;  2FRY A;  4J9I A; 
#chains in the Genus database with same CATH topology
 2X4W A;  2ZZD A;  2DXC A;  2GGR A;  3CPF A;  4A54 A;  3V8K A;  2HQX A;  1MNE A;  1BYM A;  4II1 A;  2M9U A;  4RTX A;  1KFZ A;  2M51 A;  2RHY A;  1PG5 B;  2XI9 A;  1U3O A;  2QYZ A;  1BKB A;  2VGN A;  1YJN Q;  3I9Q A;  4J6W A;  3P8H A;  2CZ1 B;  4BE2 A;  2HL3 A;  2DXB A;  5GAN 3;  1YJ9 A;  1VOM A;  3RMS A;  2DX1 A;  3UA6 A;  3L2Q A;  1IHW A;  1Y96 B;  3HKS A;  4F7U F;  2L3S A;  2DIQ A;  4M78 F;  5I2M A;  3MP8 A;  3A8H B;  4M4Z A;  4Z89 A;  5GJV B;  5KYW B;  2FL7 A;  2FPE A;  3M53 A;  2NWM A;  1QWF A;  5LJ5 e;  2JZ2 A;  7AT1 B;  1H64 1;  1CKA A;  3A5Z B;  1WLP B;  2EGA A;  4M77 B;  4BI4 A;  1BIB A;  2K6D A;  2Z0W A;  3VYH B;  3SHW A;  1I0C A;  4CC3 A;  2KT1 A;  2GFA A;  4ME7 A;  3LGL A;  1MMA A;  3REB B;  3CPW P;  2E41 A;  2ZPE B;  2ED0 A;  2EYZ A;  5A0D A;  2DRM A;  3ZFJ A;  2RHI A;  4FW2 A;  2CDT A;  2YT6 A;  1Q95 G;  3QSU A;  2JUF A;  4HCK A;  2FPF A;  1PHT A;  3CME A;  3CD6 A;  1HD3 A;  3GNG A;  1KQ2 A;  4E7J A;  1FXX A;  1JXM A;  2KBT A;  4M7A B;  4M7D F;  1SRL A;  1YIT Q;  4XU3 A;  1B3Q A;  2DEQ A;  4FU6 A;  4XQ3 A;  3MEV A;  1NEG A;  1OOT A;  5AYF A;  4XU0 A;  2GBQ A;  2Y4Y A;  3CC4 T;  4J83 A;  4EMG A;  4PJJ A;  1PWT A;  1RAA B;  1KD1 R;  1VQL T;  5CIU A;  1PM3 A;  1VQP T;  4C92 F;  3X25 B;  5DM7 R;  2CZ0 B;  4PLL A;  3EFO A;  1RAF B;  5GAO n;  4C8Q B;  5CO7 A;  2C06 A;  2E64 A;  2IIM A;  3KFV A;  3CCR T;  4HT8 A;  1YN8 A;  1BIA A;  1E6G A;  2LJ1 A;  2YUN A;  3QJ6 A;  2QA4 A;  2PZ1 A;  1R0B G;  5GAO r;  1Q86 C;  2JJ9 A;  1OI1 A;  1G83 A;  4JJD A;  4WCI A;  4ZNX A;  2DJZ A;  3TRE A;  2DXT A;  2OTL Q;  4FT4 A;  3CMA Q;  3QWY A;  3J7A F;  2HBP A;  1A0N B;  4PK4 A;  3I56 A;  2C0O A;  3I55 A;  1JO8 A;  4HCC A;  1GFC A;  2QDL A;  4CC4 B;  1KD1 U;  2EKH A;  3CC7 T;  4XK8 E;  2PUK B;  1ZUY A;  2RNA A;  5FRM A;  1YI2 Q;  2CSI A;  2LRQ A;  4OB0 B;  5LL6 S;  3OYL A;  3L2V A;  3OYI A;  2XDB A;  1S72 T;  2KI7 A;  4NS5 A;  1N8R R;  4FYX B;  2WAC A;  2CKK A;  1KG1 A;  1WGS A;  2I2L A;  3L42 A;  5GMK h;  5KYX B;  2HKQ B;  4OML A;  2LX9 A;  4LDY A;  2NUT A;  4E7H A;  2GQV A;  2HSE B;  2JMC A;  3EHR A;  2DZC A;  2DD5 A;  3PTA A;  1NEB A;  4BI8 B;  1I07 A;  2KXC A;  1QMC A;  1I5L A;  1E7O A;  1M3A A;  1FMV A;  1YJW T;  5GAN 5;  2F5T X;  4R0K A;  1M1F A;  1W6X A;  2KXD A;  4C8Q A;  3GP8 A;  3TEE A;  4E7L A;  3PMT A;  1RAH B;  1AWW A;  3HL8 A;  2XKO C;  1AZE A;  4RTZ A;  4E7Z A;  4QVC A;  3A98 A;  2LT1 A;  3PFS A;  3M9Q A;  1N8R U;  1Z9Z A;  4MZM A;  4C8Q C;  1W70 A;  1M30 A;  3QWX X;  1KQS P;  2EYW A;  2W0Z A;  4BDZ A;  2YLB A;  1D09 B;  2HNI A;  3CCS Q;  2J6F A;  2L5Q A;  1OZ2 A;  3GNF B;  3S3M A;  1ZX6 A;  1KQS S;  5KE3 A;  1SSH A;  2DL4 A;  3OYG A;  1BI1 A;  2JVV A;  2FVU A;  1OPL A;  4OMP A;  3OA6 A;  4BDY A;  4LUE A;  1VQ6 T;  1H3Z A;  1X2Q A;  5HK3 A;  3EG9 B;  3WVE B;  4FSX A;  2H3E B;  5HY6 A;  4J9D A;  1YIT A;  1W2B S;  1OYX A;  3MEA A;  3EH2 A;  2B8A A;  3TU4 K;  2OTJ Q;  4AFU C;  5GAM f;  5FU6 C;  4OB2 B;  5KYY B;  4PKC C;  2DA9 A;  1AD5 A;  2E6Z A;  1G3T A;  1QKX A;  2V1Q A;  4OMF B;  3PIO A;  1G3S A;  4HT9 A;  4HVW A;  2EQI A;  4DBF A;  4LXC A;  5A0L A;  3FJP A;  4YTL A;  1VYV A;  2JMA A;  4F7U B;  1H92 A;  5I22 A;  3CCM Q;  2CUD A;  2P84 A;  2ZGW A;  3UT1 A;  2GTO A;  1D1B A;  1YP5 A;  1ZBJ A;  2D1X A;  4Z8A A;  4CRI A;  3QDF A;  2DVE A;  5GAN h;  4FL6 A;  3EG2 A;  4JRK A;  4KGX B;  3M57 A;  2KYB A;  4MZT A;  3CCR A;  3M0T A;  3OS2 A;  2W10 A;  1YHQ T;  3ASK A;  3OYC A;  3BDL A;  1G8X A;  2DK3 A;  2XG8 D;  4C8Q E;  3JCM f;  4Q5W A;  4UC4 A;  2EWN A;  1BU1 A;  1ZHI A;  1U1S A;  5KCO A;  1LVK A;  1TUG B;  1T3L A;  5HCK A;  4MML A;  4IUV A;  2QG9 B;  1T0J A;  2X3W D;  2PUO B;  5L8R E;  2L3R A;  2CP7 A;  1YI2 A;  2NYS A;  3QPH A;  1J3T A;  2L3Q A;  4C8Q D;  5GAN j;  2HCK A;  2EYY A;  2LNH B;  1QW1 A;  1AZG B;  4XTY A;  2OAW A;  1O9S A;  5FRO A;  2DTI A;  2KY9 A;  4MDW A;  1TUD A;  2ZAE A;  1S72 A;  2DMO A;  1MMN A;  3REA B;  3OMC A;  2M0O A;  5GAM d;  2FB7 A;  4R55 A;  4J8O A;  2HL5 C;  2RMO A;  1Y57 A;  4C92 B;  4OMO A;  4OB3 B;  3OYA A;  1Y07 A;  2RHX A;  2IVW A;  3ZBD A;  3OYY A;  3G4S T;  4J7F A;  4EPC A;  2DF6 A;  3EFR A;  1XOV A;  4P5N A;  4BE0 A;  2D8H A;  1NPR A;  2QQR A;  4A4G A;  1YJW A;  2NUP A;  1OEB A;  1TS9 A;  3DLL A;  3UF4 A;  1ABQ A;  2FYK A;  1Q7Y C;  1QWE A;  4JS5 A;  1M2V A;  2HEQ A;  4OVA A;  2DYB A;  3FC3 A;  3C95 A;  4QQ6 A;  4HA8 A;  1ARK A;  2V1R A;  2GF7 A;  2A28 A;  2DIG A;  3E9G A;  3OBY A;  1EX4 A;  2H8H A;  3JCM d;  4RG2 A;  2DVJ A;  2GNC A;  2D0N A;  2R57 A;  2SRC A;  2HAX A;  4BY6 B;  2ENM A;  3VS2 A;  3EGD A;  3CCV Q;  1GFD A;  1JB0 E;  2DBM A;  2OTJ A;  2MK5 A;  3CCU Q;  8ATC B;  2ECZ A;  3JCM Q;  4PNO A;  3FRN A;  2EFI A;  1SPK A;  3V7R A;  4LD6 A;  3L2U A;  1XNI A;  3FJ5 A;  4J6X A;  1DJ7 B;  5DY9 A;  4RTU A;  3QJY A;  2KGT A;  3CME T;  5KYU A;  2XMF A;  1N5Z A;  4E47 A;  1VQK A;  2LTO A;  2KMT A;  4LDX A;  2JW4 A;  2BE9 B;  2YRV A;  4M78 G;  1TTH B;  4PJO G;  4JLI A;  5LJ5 h;  2HMA A;  2A0F B;  4GY5 A;  1TXQ A;  1K1Z A;  1X6O A;  4L6V 5;  3M4G A;  2RQR A;  4C5H A;  4M75 B;  1KD1 C;  1BBZ A;  2RA2 A;  3RKW A;  3A8L B;  2VYT A;  3C94 A;  4AT1 B;  4EMK A;  2CH4 W;  1G2B A;  1VQ9 Q;  3PT9 A;  1ZA1 B;  2JOY A;  1SHG A;  3VU3 C;  1VQM Q;  1YHQ A;  3MET A;  2F1L A;  4A63 B;  4RTT A;  4OMQ A;  4EMK C;  2OI3 A;  1HK9 A;  3FEO A;  2JS0 A;  1X6B A;  3I56 T;  1IO6 A;  1K8A U;  2AZV A;  3I55 T;  1OX8 A;  3UWN A;  1JU5 C;  2RPN A;  4FIB A;  4JUV A;  4BY6 C;  2EGC A;  2RD1 A;  2XIC A;  2L3P A;  1B34 A;  4N4I A;  1V29 B;  1SHF A;  4J9E A;  2RK2 A;  3G7Z A;  1T3S A;  3BW1 A;  4F17 A;  1VQ5 Q;  1X69 A;  4GLK A;  4RTW A;  1F1B B;  3M58 A;  2LQK A;  4DEY A;  2EKO A;  2YHT A;  5CKD A;  2ED1 A;  4LN2 A;  2ZPI B;  3JB9 H;  1HXD A;  1OU8 A;  1XJW B;  3JCM V;  1YJN T;  5FU7 B;  3X20 B;  4A4H A;  3G4S A;  4RCB A;  1NYG A;  1M1K C;  3RBB B;  1JRI A;  3F70 A;  1WHK A;  3QZ9 B;  5FW9 A;  1M90 C;  3OQ5 A;  1W2B A;  5CQX A;  8AT1 B;  2BZ8 A;  1Q7Y R;  5D7U A;  2LZ6 B;  2WSE E;  3WVD B;  4QVD A;  2LT4 A;  4ZGD B;  2JS2 A;  3OYH A;  1RLP C;  2CP0 A;  4IUT A;  5GMK i;  5IHI A;  1YIJ Q;  1ZSG A;  4PJO F;  4RUG A;  4BAC A;  3QUI A;  1BI3 A;  1VYT A;  3OS0 A;  4B9X A;  3LH5 A;  1IXD A;  3L2R A;  1I4K 1;  4GLM A;  2GQI A;  3HTR A;  1GCP A;  5I11 A;  4HVV A;  1WNL A;  4JJN K;  5GAM e;  2MIO A;  3OSV A;  4OF1 A;  5CKF A;  4BUG A;  1UG1 A;  3M0Q A;  2RHU A;  1GL5 A;  2K5F A;  3MO8 A;  1BCO A;  1Q7Y U;  2O01 E;  3OB9 A;  1YIT T;  2CRE A;  3JCM W;  3I35 A;  3EGX B;  3NMZ C;  1M4Z A;  3KUF A;  5GAM g;  3DB4 A;  1TU0 B;  2COY A;  4PFO A;  2LDM A;  2K57 A;  3BE3 A;  5A2Q E;  1BI0 A;  3JV3 A;  2FEI A;  2P0K A;  1SRM A;  4KGZ B;  4ZGJ B;  4IUQ A;  5KE2 A;  4IUU A;  1M2O A;  2F2W A;  3PVL A;  1VQO Q;  2NLU A;  2V8J A;  1B7T A;  5FU7 C;  3DB3 A;  1ACM B;  1OX9 A;  3THK A;  2H3J A;  1M5Q 1;  2LCL A;  3JCM e;  1QP3 A;  4DA4 A;  1XTD A;  1WI7 A;  2KRO A;  4X34 A;  4J9G A;  4JRQ A;  3SB2 A;  2KAF A;  3VUB A;  4IKF A;  1U8R A;  1VQ7 Q;  1Y96 A;  3I5S A;  2IPO B;  2EJ9 A;  2EAY A;  2OTL T;  5KYW A;  1R8O B;  5IHN A;  4M75 E;  4Y28 E;  5GAN 7;  4J7I A;  1GBQ A;  2MOX A;  4OGE A;  1X01 A;  2ZPF B;  3KBG A;  4M77 A;  4K11 A;  3JCM g;  2M0Y A;  4CC7 A;  2DAQ A;  1YI2 T;  3E19 A;  2CT3 A;  2F2V A;  3HPW A;  2R58 A;  1VQP Q;  2V8I A;  3I5R A;  2QQS A;  4M77 C;  2EJG A;  2EGE A;  3S3O A;  3GF5 A;  4E7S A;  2XDD A;  5CR2 A;  2EQJ A;  3QO3 A;  1VQN Q;  3TQ7 P;  5CKB A;  1WHJ A;  2DL5 A;  1UGR B;  5KYN A;  4M7A A;  3UDC A;  4RKU E;  1RL2 A;  1OUL A;  2FZC B;  3RDV A;  1LCK A;  3QYH B;  3JCM b;  1EZZ B;  2HSP A;  1M1K R;  1G5V A;  1RAE B;  3TSW A;  1YJN A;  3G6E Q;  2K5L A;  3Q1J A;  4AFZ C;  4M7A C;  3CQT A;  1MMD A;  1M90 R;  1WHM A;  2FHD A;  4DBQ A;  5GAN 6;  1KSW A;  3CC7 Q;  1RI0 A;  1Z9Q A;  2DTO A;  1YFN A;  4ZN1 A;  3CCQ Q;  2WSC E;  4ESR A;  1JJ2 A;  2J05 A;  1ABO A;  5J26 A;  4XTX A;  1C0M A;  2A7Y A;  1UTI A;  1PSE A;  1H3H A;  3X28 B;  5IXB A;  4KUD K;  4B6M A;  1RUW A;  5IHK A;  1Y0M A;  2DXU A;  4XTV A;  2GCX A;  2KE9 A;  4EDU A;  1SEM A;  5DLQ E;  1OV3 A;  2YLC A;  1M1K U;  5CKH A;  3G71 Q;  3RES A;  1MGQ A;  1R0C B;  1M90 U;  1K76 A;  1NLP C;  4C0Z A;  1WXU A;  3HRS A;  2E4H A;  2OTJ T;  3MJX A;  1W2B P;  2CYZ B;  2EYQ A;  4FYV B;  3LGF A;  2QAS A;  4HVU A;  3INZ A;  3J80 E;  4KH1 B;  4M77 E;  1WYX A;  2K3X A;  2X9H A;  1MV3 A;  4F14 A;  1FMK A;  2VUB A;  4PJL A;  1ZSZ B;  2DM1 A;  1VQ4 Q;  2PTK A;  3L2W A;  2YSQ A;  1WZO A;  2DL8 A;  1NZ9 A;  2J6O A;  3GLX A;  3C4S A;  2YUP A;  3G1J A;  3CCL Q;  1VQK T;  3CC2 Q;  2XD0 A;  2G6F X;  5KYX A;  3P8B B;  4X9D A;  4KT0 E;  3A8G B;  1IGU A;  4A4K A;  4M77 D;  3EG0 A;  2X4Y A;  2PVD B;  1D0X A;  2RJD A;  3M0U A;  2FRY A;  5LJ3 f;  4KUL A;  4M7A E;  3M0S A;  1TUC A;  2EVR A;  4PFP A;  4M78 B;  2DBK A;  2KT8 A;  2ROT A;  4LDU A;  1K8A C;  3SWN B;  1WPY A;  1PRL C;  1Y7X A;  4J5Y A;  5GAO p;  1SKU B;  1IHV A;  3X24 B;  2L8D A;  2E3I A;  4NL2 A;  3M59 A;  4RTV A;  2BE7 D;  3CXC A;  3P8D A;  2YDL A;  2FRW A;  3U23 A;  2Y90 A;  4M7A D;  1WDX A;  2OTL A;  4FYY B;  4IIO A;  3ULR B;  2V26 A;  3VV0 A;  2GFU A;  3CMA A;  2VC8 A;  4QKU A;  3LYI A;  4C8Q G;  1HSQ A;  3CBO A;  1K9A A;  1KHI A;  2L2P A;  2KRM A;  3V8L A;  3OSS C;  1PNJ A;  1K9M C;  1NYF A;  2MMP A;  1D0Z A;  2L0A A;  3JSC A;  1IZ6 A;  3VJP A;  1SG5 A;  2D0Q B;  3VS1 A;  2AIR B;  4Z02 A;  3QZ5 B;  2QEX Q;  2F69 A;  2KSS A;  4J9C A;  1N9S A;  2IG0 A;  1LNX A;  2RQT A;  4OMN A;  3MKD A;  2BZY A;  1BK2 A;  2FZG B;  3EG9 A;  2KEA A;  2BTT A;  1QCO A;  4ORZ A;  4M7D B;  4N4H A;  4HCZ A;  3PIP A;  2X3X D;  2E70 A;  4JJB A;  2COZ A;  1MND A;  4AG2 C;  4CC2 A;  5GAO m;  4RTY A;  5ECA A;  1NLO C;  3S6W A;  5GJW B;  1PKT A;  5KYY A;  3HSB A;  3FLG A;  5GAO q;  4JDS A;  4EMH A;  3HRT A;  1P92 A;  1RAI B;  2D9T A;  2O9S A;  3VUZ A;  1BB9 A;  5FLX E;  2X51 A;  3QDR B;  3A1P A;  6AT1 B;  1MUZ A;  5I2S A;  2JXB A;  3CCQ A;  4R56 A;  5HKC A;  4F7U A;  1UEC A;  4M77 F;  4C0G A;  1Q82 C;  3EG3 A;  3V7C A;  3S3N A;  5LJ3 d;  3SWN A;  4E7K A;  5A0G A;  3NHN A;  5D6W A;  4E2F B;  2MAM A;  3M5A A;  3SEM A;  2A36 A;  2YWW A;  4N0A A;  1VQ8 Q;  3SWN C;  3JCM X;  3JB9 D;  1XQH A;  2K2M A;  4O5V A;  2EYX A;  3CBP A;  2D8J A;  3CCS A;  3ME9 A;  2L89 A;  4BI3 A;  4JZ4 A;  2RK1 A;  2JNG A;  4N0A C;  2E1H A;  3V7S A;  3CPW A;  4A53 A;  4V2S A;  1H8K A;  1N27 A;  1YCY A;  2QTV A;  3H0H A;  2FPD A;  3GIB A;  1KQ1 A;  1UGV A;  3RIR A;  4Z88 A;  1K0X A;  2QTX A;  3JB9 I;  4M7D A;  3RKX A;  1YJ9 Q;  2P4R A;  1BCM A;  1D3B B;  1UHC A;  4JJC A;  3OYE A;  3CCL A;  5L23 A;  1PRM C;  1JJ2 P;  2KK4 A;  2Y4X A;  2A3L A;  1QQJ A;  2RQV A;  2BZX A;  1WQ7 A;  4B9W A;  1UUE A;  4M7D C;  3H0I A;  4C8Q F;  2LJ0 A;  2ZCF B;  3RER A;  1KJW A;  1JJ2 S;  2COW A;  2XDP A;  1M3B A;  3VS5 A;  2DO3 A;  2DER A;  2EBP A;  4C92 A;  2QI2 A;  5D6X A;  1GXI E;  2F2X A;  1QCN A;  3CCM A;  2EIF A;  1N9R A;  1VYU A;  1UGS B;  2K3Y A;  2EQK A;  4C92 C;  1K8A R;  3NGP A;  4QVZ A;  5GAN 8;  4A4E A;  3JCM c;  5FWB A;  3EFS A;  1OU9 A;  2DD4 A;  2KNB B;  3SD4 A;  1Y71 A;  2K5I A;  5GAM h;  2A08 A;  2RQW A;  2E3H A;  2WSF E;  1VQ9 T;  1X2K A;  2RJC A;  4F7U E;  1VQM T;  3CME Q;  3CD6 Q;  4M78 E;  2ABL A;  5KCH A;  2VXF A;  5C0M A;  2ATC B;  3QG1 A;  1UHF A;  1MMG A;  3O5Z A;  1GRI A;  3BFM A;  4HXJ A;  1K9M R;  4KRT A;  2LP5 A;  4XTW A;  5CQY A;  5I21 A;  1JXO A;  1NPP A;  2KDS A;  2G3R A;  3VYG A;  3GPL A;  4KUI A;  1SSF A;  1M27 C;  1QVF A;  3CBM A;  1I8F A;  1IRX A;  2RM4 A;  4XAX B;  1AWJ A;  1YNZ A;  1VQ5 T;  2HZY A;  1EFN A;  4F16 A;  5GAM j;  4ELZ C;  4TVR A;  1V76 A;  2HKN A;  1WFW A;  1IRE B;  1O75 A;  4AMC A;  1WIE A;  1AWX A;  3JCM h;  1G3W A;  2RF0 A;  4LE9 A;  1T0H A;  3CXC P;  3MHX A;  5EG2 A;  2QA4 Q;  3CCE Q;  4M7D E;  2DIL A;  1WA7 A;  2QGG A;  2VKN A;  2VXE A;  3E2U A;  3CXC S;  3PGG A;  2DLP A;  4C5I A;  1K9M U;  1NJI R;  3L1A A;  3DLM A;  3HRU A;  2BIV A;  5KH6 A;  1Q82 R;  2CSQ A;  1X27 A;  3I55 Q;  1WJS A;  3EGU A;  4IUP A;  1K73 R;  4NOY A;  1YWO A;  4M7D D;  1VQ8 A;  4C92 E;  2QGF B;  2O2O A;  1AOJ A;  4M75 A;  1GBR A;  3RKY A;  3OW2 A;  1UEB A;  1AHJ B;  2RI2 A;  1TH7 A;  1Q81 R;  4Y92 A;  2QDY B;  2FG0 A;  2E5Q A;  2K3B A;  1PC0 A;  4M75 C;  3CCJ Q;  5HK0 A;  5FRN A;  4C92 D;  2LCS A;  2VWF A;  2K7A A;  3TCJ A;  3CCV A;  1NJI U;  3A8O B;  2BUD A;  1ZA2 B;  4DBR A;  1FWZ A;  1Q82 U;  3CCU A;  2AHJ B;  4OB1 B;  1FMW A;  5GAN 2;  3EFO B;  1K73 U;  3M0R A;  1PKS A;  2KVQ G;  2MWO A;  4LDW A;  3NFC A;  3OYF A;  4OMM A;  1JBM A;  5GAO l;  2OJ2 A;  4PL6 A;  3PMI A;  3EAE A;  1LPL A;  2P0P A;  1I81 A;  1Q81 U;  5LJ3 e;  1X43 A;  2PNI A;  1JEG A;  2NUZ A;  1ZBX A;  3LLR A;  2KRS A;  3H9N A;  1UB4 A;  2CP6 A;  3VRZ A;  1VQO T;  2K2V A;  1WHH A;  1X6G A;  2RJE A;  4VUB A;  4JZ3 A;  3N5B B;  1C1A A;  1TSF A;  1X75 C;  3TVT A;  4F04 B;  5LJ5 g;  1WHG A;  3H8Z A;  3CPW S;  1AVZ C;  2E65 A;  1VQ7 T;  3LX7 A;  2E12 A;  3OBW A;  4KH0 B;  3WXM B;  2MPX C;  2PU9 B;  1G3Y A;  3PNW C;  4EIK A;  5LJ3 g;  2CP3 A;  5GAN f;  2JN0 A;  4KBM B;  4QQD A;  1HJD A;  2XK0 A;  3H0F A;  1VQ9 A;  2MF2 A;  4J6Y A;  2KRN A;  1VQM A;  2NUT B;  1GCQ A;  2RI3 A;  4GBQ A;  3HFN A;  2QAZ A;  3HHT B;  4J9F A;  1M9S A;  4JPB W;  4KGV B;  4FW1 A;  1CSK A;  1RI9 A;  4IIM A;  4M75 G;  5J39 A;  3CMA T;  1GCQ C;  2RHZ A;  1M3C A;  1RAD B;  1QVG A;  1NM7 A;  3CC4 Q;  1WQW A;  3NTK A;  2F5K A;  2M1H A;  3JCM J;  1WXB A;  1RAG B;  2MWP A;  2V8K A;  1UE9 A;  3JAM E;  1S1N A;  1VQL Q;  1VIF A;  4DBH A;  2D6F A;  3M56 A;  2CS7 A;  1VQ5 A;  4J9I A;  3CCE A;  1VQN T;  4M75 D;  4OP0 A;  1VUB A;  2EQU A;  1MV0 B;  2MCN A;  4LNP A;  3CCR Q;  3T9N A;  1M1G A;  3EGX A;  1NG2 A;  3G6E T;  2LX7 A;  3RNJ A;  4BB7 A;  1KC8 R;  4LD9 K;  2E10 A;  1UJY A;  1OZ3 A;  1PD1 A;  2JM8 A;  1U06 A;  2AT1 B;  2MYS A;  1LJO A;  4QW2 A;  5IT9 E;  4JLG A;  1QP2 A;  4ZTF A;  3CCQ T;  2B86 A;  5FU6 B;  1LOJ A;  1D1C A;  1WJQ A;  1QVF P;  3QXE B;  5EC7 A;  4E6R A;  2SEM A;  3OYK A;  3TSZ A;  1IGQ A;  3KXT A;  2YUQ A;  2ROL A;  3CCJ A;  2DEU A;  1QVF S;  1AWO A;  3OYD A;  1YIJ A;  4ZTJ A;  4C0F A;  5GAN d;  2OX7 A;  4L59 A;  2KQW A;  5IAY A;  1S72 Q;  2LQ8 A;  3VS4 A;  4QQG A;  3FDR A;  3OS5 A;  2C0I A;  1QKW A;  3G71 T;  4PJN A;  2HDA A;  5CCA A;  3CCS T;  1KC8 U;  1NBE B;  4DEX A;  3QKJ A;  4X1V A;  4D8K A;  9ATC B;  3OS1 A;  2AK5 A;  2JTF A;  4L5G A;  1ZUK A;  4BD3 A;  1ZUU A;  4J9H A;  3UAT A;  2RI5 A;  3D7S B;  1RAB B;  2M16 A;  4AG1 C;  3R6O A;  1YJW Q;  2FO0 A;  1VQ4 T;  2VVK A;  3ER0 A;  2DJQ A;  1ZLM A;  2QXF A;  3OYN A;  1RLQ C;  5GMK j;  2JT4 A;  1N6A A;  1WXT A;  2CT4 A;  3CCL T;  3CC2 T;  1UJ0 A;  3VS6 A;  4DOV A;  4M77 G;  4D8D A;  3OW2 P;  2YRC A;  4M75 F;  3NPF A;  5DLO A;  1WJR A;  5CKE A;  1EIF A;  4ZGE B;  4IUR A;  3AT1 B;  1FYN A;  3OW2 S;  2LJ3 A;  3DKM A;  1QCF A;  1KHC A;  3EH1 A;  3HP9 A;  5IN1 A;  2O88 A;  4JRI A;  3CCM T;  1VQO A;  3OYB A;  1OPK A;  2JTM A;  3RR6 A;  3EG1 A;  5LJ5 f;  2DE0 X;  4RMO A;  3QII A;  3JCM P;  4M7A G;  2DZ9 A;  1W1F A;  1VQ6 Q;  4MMK A;  2ZPB B;  4OGC A;  5GMK m;  3OY9 A;  1VQ7 A;  3OYJ A;  2LQN A;  4FSS A;  4C5E A;  4PJO B;  2RO0 A;  1I5O B;  5J3B A;  2QQA A;  1VIE A;  2YXY A;  1MHN A;  1UDL A;  2QQ9 A;  2LNV A;  2X4X A;  2JM9 A;  4WF2 A;  2J7I A;  2XU8 A;  1VQK Q;  3VRY A;  3GOX A;  3CC4 A;  5GAN 4;  3LWH A;  3UPU A;  3MEU A;  3MPU B;  4X9C A;  2VGM A;  2AZS A;  3EHQ A;  2QEX T;  1VQL A;  3PE0 A;  1PD0 A;  3H6Z A;  1VQP A;  3UA7 A;  1AEY A;  2CZ6 B;  4E7I A;  2NUP B;  4DQ2 A;  2LVM A;  5IXF A;  4JRP A;  3M4Y A;  1Q86 R;  1TOV A;  5GMK e;  1M2V B;  2P4T A;  2YUO A;  3QBY A;  4FYW B;  2GTJ A;  2EW3 A;  1VQN A;  2O31 A;  1B07 A;  3V8J A;  1ZSZ A;  1UFF A;  2KR3 A;  3HFO A;  2K79 A;  3J81 E;  1YHQ Q;  3JB9 J;  3G6E A;  4LDV A;  3EGD B;  3ZEH A;  2K9G A;  2O4X B;  1ZSZ C;  3C0C A;  3A8M B;  3PVQ A;  2J6K A;  4D6W A;  2LC4 A;  3CC7 A;  1QVG P;  3JB9 G;  1AT1 B;  3ZL7 C;  1NJI C;  5LJ5 d;  3IQL A;  3MCA B;  2PQW A;  4M78 A;  5D6Y A;  4DOW A;  4CI0 C;  1VQ8 T;  4FM4 B;  1QVG S;  4PJO A;  1Q86 U;  5KYU B;  2C0T A;  3OMG A;  1K73 C;  5IH2 A;  1YWP A;  2OAU A;  3FIF A;  2CZ7 B;  5CAI A;  2QK0 A;  4M78 C;  3BY7 A;  2X4J A;  1TWB A;  4FT2 A;  2XID A;  2HD0 A;  4PJO C;  4QT7 A;  2VB6 A;  4PFZ A;  5CK9 A;  3G71 A;  2MI6 A;  3LWI A;  3VS0 A;  1KIK A;  1Q81 C;  2BKD N;  2QQB A;  2VAS A;  3E9F A;  3VS3 A;  4XU1 A;  2RQU A;  2DNU A;  2X35 A;  3X26 B;  3CCV T;  4M7A F;  3BDU A;  3CEY A;  3QYG B;  3G4S Q;  1YJ9 T;  2R5M A;  2YRD A;  3MP6 A;  3GBQ A;  3CCU T;  3M55 A;  2CP2 A;  4LUD A;  2RB6 A;  1HYO A;  2J06 A;  2FZK B;  3LH0 A;  2HQH A;  1U5S A;  4PJM A;  2R5A A;  1VQ4 A;  4RCC A;  3O8V A;  1UGP B;  4EMK B;  4C0D B;  2ZPH B;  2P0Q A;  1RAC B;  3R6N A;  2DL3 A;  2DPP B;  3CC2 A;  1YBY A;  2EJF A;  1SF9 A;  2CGH A;  1E6H A;  3LW5 E;  5CVI A;  2VV5 A;  1M8V A;  2DYI A;  5C6S A;  1JQQ A;  2O4X A;  3RUX A;  3NTH A;  1QLY A;  4XTZ A;  1ZQ1 A;  3M54 A;  4WTO B;  5M9O A;  1VQ6 A;  4FCY A;  5GAN e;  2DET A;  4HKE A;  3MEW A;  1D1A A;  1B34 B;  3M0P A;  4PLI A;  2DKG A;  1VA7 A;  1W4S A;  2RN8 A;  3CD6 T;  2CH4 A;  4MZP A;  2HBW A;  4Y91 A;  2DRK A;  2I0N A;  3VS7 A;  2KYM A;  3QHS A;  2DTH A;  1WX6 A;  3E1S A;  4F7U G;  2LQW A;  3RMQ A;  2ZPG B;  5GAN g;  2AKK A;  3C12 A;  1C6V X;  4ATO A;  4PJO E;  3NTI A;  3OYM A;  2PVG B;  3SDZ A;  3JB9 F;  5LJ3 h;  2AKL A;  2CP5 A;  2CUB A;  2QEX A;  2HQE A;  4A4F A;  1K0S A;  4JS4 A;  2E5K A;  3SFM A;  2EQM A;  3MP1 A;  4N4G A;  1FX7 A;  1TG0 A;  4AFS C;  4J9B A;  4M78 D;  4AFQ C;  2EPD A;  4XTU A;  1D0Y A;  2XHC A;  4PJO D;  4RG8 A;  5AT1 B;  2DL7 A;  1PCX A;  3H41 A;  1BI2 A;  2QA4 T;  1D3B A;  3CCE T;  1WHL A;  1M8M A;  3VKI A;  4BE1 A;  4NL3 A;  3FB9 A;  2PVO B;  1I1J A;  1OQK A;  4C0D C;  2E6N A;  5LJ5 j;  2RH2 A;  1QVP A;  2RJF A;  4M7D G;  4ELY C;  1UGQ B;  1PSF A;  5LJ3 j;  4ANJ A;  1YCS B;  3JRZ A;  1CKB A;  1KC8 C;  4HCB A;  4ZN3 A;  2ESW A;  2DFU A;  2M02 A;  5FWC A;  3I56 Q;  1K4U S;  5GMK l;  2O9V A;  1IB8 A;  4C5G A;  3URG A;  1V1C A;  3L2Z A;  4C92 G;  4O6J A;  1NE8 A;  2LCC A;  1KK7 A;  4MDX A;  1R77 A;  2JTE A;  2K4Y A;  2LMJ A;  1U1T A;  3CCJ T;  1N8R C;  1KQS A;  4XU2 A;  2A37 A;  1YIJ T;  3AHU A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  3M0S A;  1TUC A;  2D0N A;  2EVR A;  2GNC A;  2SRC A;  2GGR A;  2ENM A;  3VS2 A;  2DBK A;  2KT8 A;  2ROT A;  1MV0 B;  1PRL C;  2MCN A;  4LNP A;  4RTX A;  1GFD A;  1KFZ A;  2M51 A;  2DBM A;  4RTV A;  2ECZ A;  1U3O A;  1NG2 A;  2LX7 A;  3RNJ A;  1UJY A;  1SPK A;  3I9Q A;  2YDL A;  2FRW A;  3U23 A;  3FJ5 A;  2JM8 A;  4RTU A;  1U06 A;  1WDX A;  2KGT A;  4IIO A;  3ULR B;  2XMF A;  2DX1 A;  1N5Z A;  1HSQ A;  3UA6 A;  2B86 A;  1K9A A;  2L2P A;  2KRM A;  1PNJ A;  2L3S A;  1NYF A;  5EC7 A;  4E6R A;  4M4Z A;  2JW4 A;  2L0A A;  2SEM A;  4Z89 A;  5GJV B;  3VS1 A;  3TSZ A;  2FPE A;  2NWM A;  4J9C A;  1QWF A;  2YUQ A;  2ROL A;  2RQT A;  4OMN A;  1AWO A;  2BZY A;  1CKA A;  1BK2 A;  1WLP B;  2EGA A;  1K1Z A;  2BTT A;  2KEA A;  4ORZ A;  2K6D A;  2X3X D;  3SHW A;  1I0C A;  4JJB A;  3VS4 A;  4AG2 C;  4CC3 A;  2C0I A;  1QKW A;  2KT1 A;  2RQR A;  4CC2 A;  2HDA A;  4RTY A;  5ECA A;  1NLO C;  1BBZ A;  3REB B;  5GJW B;  2ED0 A;  2EYZ A;  1PKT A;  4DEX A;  2DRM A;  2CDT A;  2YT6 A;  4X1V A;  4D8K A;  2AK5 A;  2CH4 W;  2O9S A;  1BB9 A;  4HCK A;  1G2B A;  2FPF A;  1PHT A;  1ZUK A;  1HD3 A;  1MUZ A;  1SHG A;  1ZUU A;  4J9H A;  3UAT A;  2JXB A;  4A63 B;  4RTT A;  4AG1 C;  1JXM A;  2KBT A;  4OMQ A;  1UEC A;  2FO0 A;  2VVK A;  2OI3 A;  2DJQ A;  1ZLM A;  1SRL A;  1RLQ C;  2JT4 A;  2JS0 A;  1B3Q A;  3EG3 A;  1WXT A;  2CT4 A;  1NEG A;  1UJ0 A;  1X6B A;  3VS6 A;  3NHN A;  1IO6 A;  1OOT A;  2AZV A;  4D8D A;  2GBQ A;  3NPF A;  1JU5 C;  2RPN A;  3SEM A;  2A36 A;  2EGC A;  1FYN A;  1PWT A;  2L3P A;  2K2M A;  2LJ3 A;  2EYX A;  1SHF A;  4J9E A;  1QCF A;  1T3S A;  4F17 A;  2D8J A;  2O88 A;  1OPK A;  4JZ4 A;  1X69 A;  3EG1 A;  4RTW A;  2DE0 X;  2IIM A;  4DEY A;  3KFV A;  1H8K A;  3H0H A;  2FPD A;  2ED1 A;  1W1F A;  1YN8 A;  1E6G A;  2LJ1 A;  2YUN A;  4LN2 A;  1UGV A;  2PZ1 A;  2LQN A;  4FSS A;  1G83 A;  4JJD A;  4WCI A;  4Z88 A;  1K0X A;  4ZNX A;  1NYG A;  3RBB B;  1UDL A;  2P4R A;  1UHC A;  4JJC A;  5FW9 A;  2JM9 A;  3QWY A;  1A0N B;  5L23 A;  1PRM C;  2J7I A;  2C0O A;  2RQV A;  1JO8 A;  3VRY A;  2BZX A;  1GFC A;  2QDL A;  1UUE A;  2BZ8 A;  3H0I A;  4CC4 B;  2LJ0 A;  2EKH A;  2AZS A;  2LZ6 B;  3EHQ A;  1KJW A;  2JS2 A;  1RLP C;  3PE0 A;  1M3B A;  1ZUY A;  2RNA A;  3VS5 A;  2EBP A;  2CSI A;  3UA7 A;  1AEY A;  5IHI A;  1ZSG A;  2F2X A;  5IXF A;  1VYU A;  4RUG A;  1VYT A;  3LH5 A;  4OML A;  3NGP A;  2YUO A;  2GTJ A;  2EW3 A;  4GLM A;  2GQI A;  5FWB A;  2KNB B;  2O31 A;  1B07 A;  1GCP A;  5I11 A;  2JMC A;  4HVV A;  3EHR A;  2A08 A;  1UFF A;  2RQW A;  1NEB A;  2MIO A;  1I07 A;  1X2K A;  2KXC A;  1UG1 A;  2KR3 A;  1E7O A;  3M0Q A;  2K79 A;  1GL5 A;  1M3A A;  2ABL A;  2CRE A;  2K9G A;  4R0K A;  3C0C A;  1W6X A;  2KXD A;  3I35 A;  1UHF A;  2J6K A;  3PVQ A;  3O5Z A;  1GRI A;  4HXJ A;  1AWW A;  1AZE A;  4KRT A;  2LP5 A;  4RTZ A;  3NMZ C;  3ZL7 C;  1JXO A;  3IQL A;  3A98 A;  1Z9Z A;  1M27 C;  1W70 A;  1M30 A;  3QWX X;  2C0T A;  2EYW A;  2W0Z A;  3JV3 A;  5IH2 A;  1AWJ A;  1YNZ A;  1YWP A;  2FEI A;  1EFN A;  1SRM A;  4F16 A;  2J6F A;  2F2W A;  3PVL A;  1ZX6 A;  1WFW A;  1SSH A;  2DL4 A;  4QT7 A;  3THK A;  1WIE A;  1AWX A;  2RF0 A;  1OPL A;  4OMP A;  4LE9 A;  1T0H A;  4LUE A;  1WI7 A;  2KRO A;  3VS0 A;  4J9G A;  1KIK A;  1X2Q A;  3VS3 A;  2RQU A;  2DIL A;  2DNU A;  1WA7 A;  3I5S A;  2VKN A;  4J9D A;  2DLP A;  3GBQ A;  5IHN A;  4LUD A;  4AFU C;  2J06 A;  2CSQ A;  1GBQ A;  1X27 A;  2MOX A;  1U5S A;  2DA9 A;  1AD5 A;  3EGU A;  1YWO A;  4K11 A;  2M0Y A;  1QKX A;  2V1Q A;  3R6N A;  2DL3 A;  4HVW A;  2O2O A;  2EQI A;  4CC7 A;  1AOJ A;  2CT3 A;  2F2V A;  1VYV A;  2JMA A;  1E6H A;  1GBR A;  3I5R A;  1H92 A;  5I22 A;  2CUD A;  2EGE A;  1JQQ A;  2GTO A;  1ZBJ A;  1YP5 A;  4Y92 A;  2FG0 A;  2K3B A;  1QLY A;  2D1X A;  4Z8A A;  3EG2 A;  2LCS A;  2VWF A;  2KYB A;  2K7A A;  2DL5 A;  3M0P A;  1VA7 A;  3M0T A;  2RN8 A;  2W10 A;  1LCK A;  2CH4 A;  2HSP A;  3TSW A;  2HBW A;  2DRK A;  2I0N A;  4AFZ C;  3M0R A;  1PKS A;  3CQT A;  3VS7 A;  2KYM A;  1BU1 A;  1WX6 A;  1KSW A;  1T3L A;  5HCK A;  2LQW A;  4OMM A;  1T0J A;  1Z9Q A;  2X3W D;  2AKK A;  2OJ2 A;  4ESR A;  2J05 A;  1ABO A;  2AKL A;  1UTI A;  1J3T A;  2L3Q A;  2CUB A;  1H3H A;  1X43 A;  2PNI A;  2HCK A;  2NUZ A;  1JEG A;  2EYY A;  5IXB A;  1K0S A;  2LNH B;  2KRS A;  2E5K A;  1AZG B;  2OAW A;  1RUW A;  3VRZ A;  5IHK A;  1TUD A;  1Y0M A;  1TG0 A;  4AFS C;  4J9B A;  4AFQ C;  2DMO A;  2EPD A;  1X6G A;  2KE9 A;  3REA B;  1SEM A;  4JZ3 A;  1OV3 A;  2DL7 A;  3H41 A;  3TVT A;  2RMO A;  1Y57 A;  4OMO A;  1M8M A;  1AVZ C;  1NLP C;  1K76 A;  1WXU A;  4EIK A;  2DF6 A;  1I1J A;  1XOV A;  1HJD A;  3H0F A;  2D8H A;  2KRN A;  4HVU A;  1GCQ A;  4GBQ A;  1WYX A;  1YCS B;  1MV3 A;  4J9F A;  1FMK A;  4JPB W;  4F14 A;  1OEB A;  1CSK A;  1CKB A;  2DM1 A;  1RI9 A;  2PTK A;  4IIM A;  3UF4 A;  2ESW A;  2YSQ A;  2DL8 A;  2J6O A;  1ABQ A;  2YUP A;  5FWC A;  1GCQ C;  1QWE A;  1M3C A;  2G6F X;  1K4U S;  1NM7 A;  2O9V A;  2HEQ A;  2DYB A;  1V1C A;  1ARK A;  2V1R A;  3EG0 A;  1WXB A;  2A28 A;  1UE9 A;  3M0U A;  1S1N A;  2JTE A;  2H8H A;  2LMJ A;  2A37 A;  2FRY A;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...