2RQVA

Solution structure of sh3ci domain of bem1p
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
108
structure length
108
Chain Sequence
GPLGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Bud emergence protein 1
total genus 7
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqvA01
1U06A 2QDLA 3RNJA 4RUGA 1UJ0A 1QKXA 3VS3A 1PHTA 1SRLA 1WXTA 2DL8A 3M0SA 4OMNA 2HCKA 1X43A 5I11A 2A37A 1AZGB 1UTIA 2G6FX 4F17A 3I9QA 4J9GA 2L3QA 1NLOC 2K3BA 1T3LA 3EG0A 1JXMA 2FPFA 2JW4A 1Y57A 2RNAA 3NGPA 2O31A 4RTWA 1X2KA 4IIOA 4OMQA 1ARKA 1UUEA 1YWPA 4Z89A 2EGAA 2KXDA 2L0AA 2O9VA 4J9FA 1XOVA 4RTYA 1M8MA 3UA7A 1PKTA 2GTJA 3A98A 2A08A 1KFZA 3SEMA 1LCKA 1GRIA 3JV3A 3H0IA 1M27C 2JM9A 2DL7A 2YUOA 1SHFA 2A28A 2PTKA 2DNUA 1A0NB 2RN8A 4RTXA 2EYYA 1YWOA 1HD3A 2NWMA 2C0IA 3PVQA 5IXBA 1UG1A 1WX6A 1WXBA 4WCIA 1GBRA 1ZSGA 1M30A 1UGVA 1YP5A 2RF0A 1K9AA 1MUZA 1SHGA 2GTOA 3CQTA 1GCQA 2LJ1A 1X27A 2OAWA 1AWJA 1NLPC 2IIMA 1JEGA 2JS2A 2BZ8A 3M0TA 5L23A 4J9BA 2KE9A 1GL5A 2DRMA 2LJ3A 5IHNA 1U5SA 1K0SA 1Y0MA 2A36A 1YN8A 2DLPA 3H0HA 4D8KA 1G83A 1N5ZA 2K9GA 2W10A 1UJYA 1H8KA 2LQNA 2DA9A 4IIMA 4QT7A 2DMOA 1E6HA 2MIOA 2BZYA 2JXBA 3PE0A 2AKKA 2H8HA 2W0ZA 1CSKA 3NMZC 2J7IA 2KGTA 1Z9ZA 1SPKA 2DBKA 1Z9QA 1PWTA 1MV0B 1W70A 3M0RA 1ABQA 2KT8A 2BZXA 1M3BA 4HVVA 2YSQA 1H3HA 2JMCA 4J9IA 4HVWA 4CC7A 2RQVA 2CSIA 2LMJA 2F2XA 2X3XD 1SSHA 1OPKA 2YUQA 1PKSA 1WXUA 1I1JA 2ABLA 3I5RA 2KNBB 4X1VA 3TSZA 2DJQA 3VS0A 2K6DA 3NHNA 4JZ4A 2CT3A 2DBMA 4R0KA 3VRYA 1M3CA 2MCNA 1NM7A 2FPEA 2KXCA 4RTZA 2KBTA 2J06A 2DL5A 4HCKA 4K11A 3VS1A 2LCSA 1T0HA 2FPDA 2JS0A 1TUCA 2KRMA 2M0YA 2C0TA 4AFUC 2JMAA 2PNIA 2KR3A 1S1NA 2K2MA 3GBQA 2EBPA 4D8DA 2K79A 2D8HA 1E6GA 4E6RA 2EQIA 2CUBA 2RMOA 1QLYA 2B86A 2I0NA 2DE0X 2YDLA 1KJWA 1K0XA 2EVRA 2O9SA 4J9HA 2J6FA 4LUDA 1I07A 3VS7A 3VS4A 5EC7A 2X3WD 1OOTA 1PRMC 1B3QA 1AZEA 1CKAA 1NEGA 1TUDA 2LNHB 1BBZA 4OMPA 4FSSA 1MV3A 1ZLMA 4OMOA 2DX1A 2RQTA 1X6BA 2EKHA 2GGRA 5IHIA 5I22A 1W1FA 2HDAA 2CREA 5HCKA 2GQIA 3UATA 1JXOA 2EYWA 3REBB 2OI3A 1X2QA 2CDTA 1YCSB 1CKBA 3M0QA 4RTUA 4LNPA 3O5ZA 1M3AA 3VS2A 1IO6A 1RI9A 3FJ5A 1UHFA 4CC4B 1T0JA 2YUNA 3VRZA 2V1RA 4HXJA 2ROTA 3THKA 1QWEA 1WDXA 2C0OA 4LN2A 2KYBA 1EFNA 2CH4A 2VVKA 1GCQC 3M0PA 1B07A 2FG0A 2AK5A 5IH2A 4AFSC 1GFCA 1VYTA 4F14A 3U23A 1AVZC 2EYZA 4ESRA 1HSQA 2JT4A 4EIKA 4JJCA 2FO0A 2KYMA 2EGEA 1YNZA 1SEMA 1J3TA 1ZBJA 2J6OA 1GBQA 1G2BA 2CT4A 1ZUYA 2LP5A 3REAB 3TSWA 3EG3A 3EG1A 1KSWA 3KFVA 4LE9A 1AWWA 1RLPC 2EYXA 3M0UA 1ZUUA 1ZUKA 2E5KA 1WIEA 2RPNA 1SRMA 2DRKA 5FWCA 3ULRB 1UFFA 2RQRA 5GJVB 5ECAA 2D1XA 1HJDA 4J9DA 1W6XA 1BK2A 3RBBB 4Y92A 4KRTA 1K4US 2BTTA 2D8JA 2HEQA 3EGUA 1WLPB 1JU5C 2EW3A 1UE9A 5FW9A 2YT6A 2KRSA 3I5SA 3VS5A 1WA7A 2ED0A 2XMFA 2ENMA 4GBQA 1WYXA 2DILA 4CC2A 3PVLA 3R6NA 1UDLA 2DVJA 4JJBA 1FYNA 2ESWA 1WFWA 3LH5A 1X69A 1BB9A 3EHQA 2L3SA 1UHCA 2EPDA 2FRYA 1K76A 2VWFA 4ORZA 1X6GA 2VKNA 3QWYA 3C0CA 2DL3A 1VYVA 4RTVA 1AWOA 1TG0A 5FWBA 1RUWA 3UA6A 2D0NA 1AD5A 4DEYA 2CSQA 2AZSA 1GCPA 2LZ6B 1K1ZA 2F2VA 2OJ2A 2DYBA 4OMLA 1VYUA 4Z88A 2AZVA 4ZNXA 2ECZA 2M51A 2L2PA 4RTTA 5IHKA 4J9CA 3UF4A 4F16A 1NYGA 4GLMA 3SHWA 1QKWA 1BU1A 1VA7A 3VS6A 2GNCA 2SRCA 1T3SA 3EHRA 3I35A 2EGCA 1UECA 2P4RA 1PRLC 1H92A 4JPBW 1V1CA 4CC3A 2O88A 1JO8A 4AFZC 3QWXX 2CUDA 2KRNA 1QWFA 1NG2A 4A63B 1OEBA 2HSPA 2NUZA 2J05A 4AFQC 2DF6A 1OPLA 4AG2C 2V1QA 4HVUA 3ZL7C 2DL4A 4M4ZA 2RQWA 2L3PA 2AKLA 1PNJA 2KROA 4OMMA 5IXFA 2FRWA 2FEIA 2JTEA 4JZ3A 2GBQA 2KT1A 2LX7A 1AOJA 1KIKA 2CH4W 2KEAA 4AG1C 1RLQC 3H0FA 1U3OA 1NEBA 1WI7A 2HBWA 4DEXA 3IQLA 4LUEA 2LQWA 3NPFA 4Z8AA 2LJ0A 1I0CA 2O2OA 1QCFA 2J6KA 1NYFA 1ZX6A 2DM1A 1OV3A 2SEMA 2YUPA 1E7OA 4J9EA 2F2WA 2JM8A 3H41A 2MOXA 2RQUA 1AEYA 2K7AA 2PZ1A 2ED1A 5GJWB 4JJDA 1AWXA 1FMKA 3TVTA 3EG2A 1ABOA 2ROLA 1GFDA 1JQQA
chains in the Genus database with same CATH superfamily
1U06A 3RNJA 1UJ0A 4PJJA 1QKXA 2EAYA 4HT9A 2DFUA 3VS3A 2RHIA 3M0SA 2FL7A 4OMNA 1AZGB 1QP3A 1UTIA 2G6FX 3VYGA 3I9QA 4YTLA 2L3QA 2VXFA 5LL6S 1U1TA 3EG0A 2FPFA 2RI2A 1Y57A 3M5AA 1K73U 2QA4A 2BKDN 1X2KA 4IIOA 5J3BA 5GAN3 2DTIA 5GMKm 4MDXA 3CBMA 3QSUA 3DLMA 4CI0C 3CCMA 1JJ2S 3CC2T 2K3YA 2EGAA 2LTOA 2O9VA 3UA7A 4RTYA 3TU4K 2RO0A 4M77D 1TTHB 2XKOC 3SEMA 4JLIA 5FU6C 3CBOA 1NBEB 1K73C 3BE3A 4PKCC 1S72Q 1A0NB 5I21A 1VQ6A 3E19A 1N27A 1YWOA 3S3OA 4C92F 1HD3A 2NWMA 4DQ2A 4WCIA 4BI8B 1GBRA 1KQ2A 3CQTA 3JCMP 2RF0A 1MUZA 2K5IA 4FYWB 2OAWA 3CCLA 2JS2A 2KE9A 2LJ3A 5CKBA 2A36A 1OU8A 4JJNK 3H0HA 3I56Q 4M77F 3CCET 3N5BB 1M2VB 4WTOB 5CR2A 2JXBA 3PE0A 2AKKA 2H8HA 2NYSA 4M75A 5GAN7 1Y7XA 5DLOA 2KQWA 2EKOA 1SPKA 2LRQA 1PWTA 3MEUA 1ABQA 5GANj 1H3HA 3SWNB 4ZGEB 2JMCA 3GP8A 1RAAB 4CC7A 1G3TA 2HL5C 1BKBA 1S72T 5KYUB 2LMJA 3HSBA 2JJ9A 1Y07A 3I56A 2ABLA 3LGLA 2CP6A 1N6AA 2R5MA 4V2SA 4M7DA 3OSSC 2EYQA 3VS0A 3NHNA 3G1JA 2CT3A 3A8OB 1LJOA 4BDYA 4E47A 3NTHA 3VRYA 3SWNC 1WJQA 3CCQA 4CRIA 1KHCA 2IPOB 4M78E 2VV5A 4KGXB 2LCSA 2JS0A 3LGFA 2KRMA 2FZKB 1KQSA 3GBQA 4EMKA 3E2UA 1E6GA 4E6RA 4PFZA 2CP3A 2CUBA 4R56A 2MAMA 1IHWA 2RMOA 2FZGB 2B86A 3X25B 2EWNA 2YDLA 4J7FA 3MPUB 1RABB 2O9SA 3CMET 1VQKA 2IG0A 4C0FA 2XK0A 4MZTA 1OOTA 5CKEA 4HCZA 2COWA 1BBZA 3ASKA 2DVEA 1VQ8Q 4FSSA 1SG5A 1YBYA 4E7JA 1MV3A 1VQNQ 3FDRA 2RK2A 1VQ5A 1WHLA 5KYXB 1XNIA 1K9MR 4XTWA 2D6FA 3G71Q 3OYYA 2EQMA 4PJLA 5IHIA 5I22A 4A4GA 2KAFA 3A8MB 3META 1JXOA 4HKEA 2LC4A 3REBB 1I81A 1X2QA 3G4ST 4IUUA 2RH2A 2R5AA 5I2SA 4DOWA 4M78C 2EQUA 3O8VA 1RI9A 3FJ5A 1UHFA 3NTIA 1YIJQ 4LD6A 2V1RA 2ROTA 5CCAA 1VQPA 2C0OA 2P0QA 1YJNT 2XD0A 4XU2A 4OF1A 1QQJA 4FL6A 2FHDA 3M0PA 3L2UA 4MMLA 2PQWA 3L42A 1NZ9A 3QPHA 4AFSC 4F14A 4N4IA 2JT4A 2E12A 4JJCA 4AMCA 4LXCA 4ZTJA 2MYSA 2FO0A 1TSFA 3GIBA 1YNZA 2KK4A 1J3TA 4OB3B 3OW2A 3L2ZA 2J6OA 1VQ7Q 2JZ2A 2VASA 4JUVA 2CT4A 5KCHA 3TSWA 3VKIA 3OS2A 3C95A 1KSWA 1Q86U 1AWWA 2E10A 4II1A 5GANh 2E5KA 1KD1C 2LCCA 1UGQB 4O6JA 2RPNA 4C8QA 2RQRA 1LVKA 1W6XA 3X26B 2QEXT 2ZGWA 3C12A 3RBBB 4Y92A 4ANJA 3QZ5B 1BCMA 1C1AA 2YXYA 2BTTA 2HEQA 3EGUA 3TQ7P 1JU5C 1M1FA 4OMFB 5FW9A 1YITT 4NS5A 5FRNA 3VS5A 2ENMA 1MNDA 2E70A 4GBQA 1X75C 3HTRA 2ZZDA 3M9QA 4PL6A 4XTZA 1YIJT 1VIFA 3J7AF 3PVLA 4E7HA 4C92G 1UDLA 5CIUA 2DVJA 4Z02A 1FYNA 1FMWA 2OTJT 1BB9A 2QG9B 4ORZA 1X6GA 2VKNA 3QWYA 1U8RA 2DL3A 2CS7A 3SD4A 5FWBA 3ZBDA 5GMKh 2R57A 1IGUA 3UA6A 4QVZA 4FW2A 1AD5A 2LNVA 2JNGA 2O4XA 1K8AR 1Q82U 2OJ2A 1M2OA 2DO3A 2QQSA 2GCXA 2M51A 4C92A 5GAOr 4J9CA 3UF4A 4F16A 1NYGA 2RJEA 4GLMA 3R6OA 1HK9A 3SHWA 3CMAT 2GNCA 2CP7A 1UECA 1BI2A 1PRLC 2P4RA 1H92A 2YLCA 1SF9A 4DBHA 1V1CA 4CC3A 2O88A 3CXCA 4IUTA 1R8OB 2CUDA 4PJOA 2H3EB 1VQOQ 4C8QG 2X4WA 1WJSA 4AG2C 2LT1A 2NUPB 2RM4A 4MMKA 4PNOA 3JB9G 3ZL7C 3CXCP 3HKSA 4NOYA 4F04B 4J6WA 2L3PA 4M7AD 3URGA 4ZGJB 5J39A 5KYYB 2M9UA 2ATCB 1I5OB 1M8VA 2DIQA 2QEXQ 3RIRA 5GAMj 4PJOC 3SB2A 1D1BA 1TH7A 1TOVA 3CCRA 3OYEA 3EGXB 1KIKA 3LWIA 2XIDA 4AG1C 3RKWA 4KGVB 3GNGA 1U3OA 5J26A 1WI7A 4DEXA 1YI2Q 4LUEA 2LQWA 5KE2A 1I0CA 4M78D 3ME9A 3H9NA 1OV3A 2WSEE 1VQ9T 5KYXA 5GMKe 4M7DB 2MOXA 3NFCA 3QG1A 3GPLA 2PZ1A 1Y71A 1VIEA 2R58A 4OVAA 3OYNA 2CZ6B 2QAZA 3M58A 3OYAA 4PJOF 3EG2A 2F5TX 4A4EA 2QDLA 3UDCA 2K57A 4RUGA 1PHTA 1SRLA 1WXTA 2DL8A 4XU0A 3JRZA 4ME7A 4BE2A 2HCKA 2GF7A 2QGGA 2X4XA 2YRCA 2C06A 4F17A 1IZ6A 4J9GA 1H641 1NLOC 1T3LA 1JXMA 1MMGA 2JW4A 3OB9A 4J6YA 2ZPBB 2RNAA 3G7ZA 4C5EA 1B34B 1UGRB 1YWPA 4M7AB 3GOXA 4M7DE 4BI4A 3JCMQ 2L0AA 3CEYA 1XOVA 2RK1A 3SWNA 1PKTA 2A08A 3VUBA 1IHVA 2RB6A 1LCKA 2RHZA 5C6SA 1YI2T 1WJRA 1M27C 2RI3A 1QW1A 4AT1B 5GMKj 2YUOA 5HY6A 3GNFB 3S3MA 3MCAB 5FLXE 3KUFA 2DNUA 1PSEA 3KXTA 1N8RC 3CCLT 2C0IA 5LJ3h 1M30A 2MPXC 1WHJA 1SHGA 4D6WA 2QDYB 3PNWC 4QQGA 1QVFS 4FCYA 1NLPC 2IIMA 4HA8A 3M0TA 3NTKA 4C8QF 1GL5A 5IHNA 1U5SA 1YN8A 2QTXA 2NUPA 1G83A 1N5ZA 1Y96A 3J81E 2W10A 2K2VA 4QW2A 2LQNA 4IIMA 4M77E 3I55A 1BYMA 2DD4A 2BZYA 3CCJQ 2QQBA 3BDLA 5FU6B 3UPUA 1KK7A 2WSFE 4FYVB 4M78G 3NMZC 2VGMA 2DBKA 9ATCB 1M90R 1M9SA 1W70A 3M0RA 1VQ4Q 3EAEA 2CP0A 3SFMA 1RAFB 4PJMA 2E6ZA 4BD3A 3TEEA 4J7IA 1W2BS 4XQ3A 5GANf 1SSFA 4XTUA 2G3RA 2YUQA 2F5KA 1I1JA 5KYNA 2QQ9A 3OYFA 2V8IA 4A4KA 4EMHA 1VQ7A 2DBMA 2QQRA 4A54A 1M3CA 1QVFA 2E41A 2KXCA 5GAOp 2L3RA 2KBTA 2J06A 3OYLA 4EMKC 1VQ4A 4HCKA 3SDZA 4K11A 2M02A 3P8DA 1RI0A 3LH0A 3M53A 3HRTA 2KR3A 3MP1A 1MGQA 2L8DA 3CMEA 4C8QE 5FRMA 4R55A 3JB9I 3VJPA 3JCMe 4OP0A 5KYWA 1VQ4T 1K0XA 2MWPA 4J9HA 2J6FA 1OQKA 1TUGB 1ZSZB 3QXEB 4LUDA 4PLIA 1QVGP 3VS7A 5GANd 1BIBA 5EC7A 3G6EA 3CCVA 1NEGA 3D7SB 3CC2A 4OMPA 2P4TA 4QVCA 2H3JA 1B34A 4TVRA 4JRQA 1ZLMA 4OMOA 5DY9A 4KH1B 2DX1A 2RQTA 3JB9H 4N0AC 4OB0B 4M7DD 2JTMA 1WHKA 1X6OA 4O5VA 1Q81R 3L1AA 5GAN6 1YHQA 3E9FA 2HDAA 4C0GA 3H6ZA 2L89A 4JDSA 2ZAEA 3CMEQ 2KY9A 3CC7Q 4X34A 2XU8A 1C6VX 3M0QA 3VS2A 1BI0A 1VQ8T 3M4GA 4C0DC 5A0LA 1T0JA 1VQ8A 2HMAA 3THKA 3RERA 5AYFA 1VQ9A 4L5GA 1VQ5Q 4XAXB 2VVKA 5HK0A 2XDBA 2FG0A 4PJNA 2AK5A 1W4SA 2COZA 3OS1A 3CC7T 4ESRA 3L2WA 1HSQA 3PMTA 3I55T 1SEMA 2Y4YA 1ZBJA 4PFOA 3JCMJ 1MMDA 1M2VA 2AT1B 3KFVA 2P0KA 1YJNQ 4LE9A 2EYXA 3M0UA 4RKUE 1Q82R 1PCXA 1ZUKA 1ZUUA 1WIEA 4KULA 3LW5E 1VQ6T 1AT1B 2FB7A 1RAEB 5GJVB 5ECAA 4PJOG 2PVDB 1HJDA 1R77A 3M55A 1UGPB 2E5QA 5GAN8 4F7UG 1WHGA 3RMSA 1OYXA 1UE9A 3QJ6A 2YT6A 3A8GB 5KYUA 2NUTB 4BE1A 4CC2A 5HK3A 3JB9D 3R6NA 1C0MA 4JJBA 1X69A 2QA4T 2FRYA 1IRXA 4J83A 4E7ZA 1TG0A 1WGSA 5D6XA 3V8LA 2FVUA 1RUWA 4DEYA 3CC4A 3EH2A 3QDRB 3OYMA 3CC4T 5D6YA 1D0YA 1ZSZA 1R0CB 2AZVA 4ZNXA 1BCOA 1DJ7B 2ECZA 3CPWP 2ZCFB 1K9MU 1NJIC 2QI2A 5IHKA 1R0BG 5GANg 1D3BB 2DYIA 1QKWA 5CKFA 1VA7A 1KC8R 2SRCA 3EHRA 2EGCA 8ATCB 3CCQQ 2ZPFB 2DEQA 3E1SA 1JO8A 2GQVA 3OYCA 4AFZC 1VQOT 3QWXX 4M75E 4BDZA 1YHQT 2KRNA 1QWFA 4OB2B 3ZEHA 1OZ3A 2NUZA 2J05A 1U1SA 4AFQC 1YJ9T 2V1QA 1Y96B 4M78A 1KD1R 4M4ZA 1D1CA 1KQSP 1O75A 1G3WA 1I8FA 5IXFA 2RHUA 3FC3A 1VQMT 2B8AA 3FB9A 2JTEA 1VQKT 4C5GA 1VQKQ 2VUBA 4Q5WA 2KT1A 1YITQ 1YJWA 1YJ9A 2KEAA 1RLQC 5GAMg 3L2VA 3IQLA 3OYKA 3EFOB 3OQ5A 1VQOA 2J6KA 1NYFA 1Q82C 3QIIA 2QA4Q 5CAIA 3H41A 4ZN1A 2RHYA 1PSFA 4PLLA 2RQUA 3RDVA 3CCQT 1PD1A 5LJ5g 2M1HA 4JRIA 3KBGA 2YHTA 1AWXA 3TVTA 3X20B 1ABOA 5M9OA 4M7AC 2CP2A 5LJ5d 3CCRQ 2X4YA 4C5HA 1QVFP 4NL2A 1YJ9Q 5I11A 2A37A 5KE3A 1KC8C 3DKMA 1G3SA 2BUDA 2ZPEB 4C92B 2K3BA 1S72A 1VQ9Q 2V8KA 3GF5A 3QO3A 1D0ZA 2CP5A 1RAGB 4Z89A 3INZA 2HBPA 1VQNT 3QYHB 1K8AC 4J9FA 1M8MA 1D0XA 3A98A 1KFZA 3EG9A 1GRIA 3JV3A 2OTJA 2JM9A 2XICA 3MEVA 1QVPA 1EZZB 2D9TA 1H3ZA 1D1AA 3MJXA 3PMIA 2PU9B 4IUPA 2MF2A 4RTXA 3OS5A 5FROA 2EYYA 2OX7A 2PVOB 5IXBA 1WX6A 4IKFA 1WXBA 1YJWT 2A0FB 2DPPB 1KHIA 5C0MA 1UGVA 3G6EQ 1K9AA 2GTOA 1IREB 4HCBA 1GCQA 4IUVA 3WVDB 2RHXA 3TREA 1AWJA 3OYBA 1JEGA 2BZ8A 1OX8A 1RAHB 4EDUA 5L23A 2DXUA 4J9BA 1VUBA 2DRMA 5KH6A 1YCYA 1VQMA 1NPRA 3JCMV 3EG9B 3V8JA 4LDUA 5LJ3f 2K9GA 2E4HA 2WACA 3ER0A 4M75F 1UJYA 3JCMg 1H8KA 3G4SQ 4BB7A 2DMOA 1N9RA 2MIOA 1FMVA 1VQPT 2FYKA 3FIFA 5LJ5f 2DIGA 3CPFA 2W0ZA 3CD6A 1UEBA 2KGTA 1Z9QA 3CCSA 3OS0A 2JTFA 2KT8A 3TCJA 4HVVA 4RG8A 4M78B 4UC4A 6AT1B 2QYZA 5GAMe 3M56A 2RQVA 2F2XA 3CXCS 1PKSA 3H8ZA 1Q7YU 4WF2A 2DZCA 4X1VA 3G4SA 3TSZA 3EH1A 2DJQA 4KBMB 4F7UF 2LDMA 4R0KA 2MCNA 1NJIU 5FU7B 4RTZA 3VYHB 1M90C 4BACA 2NUTA 2DL5A 4E7IA 2ZPHB 2V8JA 4ZGDB 4XU1A 1T0HA 2QEXA 4N4GA 2XHCA 4M77A 2M0YA 2C0TA 1M5Q1 2FZCB 3EFSA 2JMAA 2PNIA 1S1NA 4Y28E 3OY9A 4FIBA 3CBPA 2LQ8A 3HP9A 2EBPA 2K79A 1YITA 1YJWQ 1HXDA 3V8KA 2EQIA 1ZA1B 2L5QA 1ZBXA 2DE0X 1KJWA 5LJ3d 5GAOn 3JB9F 2F1LA 2HD0A 4PJOE 5GAOm 4JRKA 3UWNA 2X3WD 1N8RR 4RCCA 1LOJA 1AZEA 1CKAA 2F69A 5DLQE 2AIRB 2OTLT 4KGZB 1X6BA 3T9NA 1X01A 1MMNA 2P0PA 3HRSA 3RKXA 4C0DB 1Q95G 3X28B 1MNEA 1WZOA 2BE9B 2M0OA 2GQIA 1QP2A 3UATA 2E3HA 2EYWA 2E64A 2VXEA 2CDTA 4RCBA 2KVQG 1IXDA 4RTUA 4LNPA 3O5ZA 3LLRA 4IUQA 4PJOB 1FX7A 1Q86C 2OAUA 2RJFA 3VRZA 4A4HA 2DETA 4HXJA 3Q1JA 1QWEA 3JCMf 1WDXA 1IB8A 1PM3A 4LN2A 1RADB 2LX9A 2RI5A 1WPYA 3JCMd 1OX9A 5KYWB 1M1KU 4FSXA 1Q81C 3RMQA 3QKJA 2E65A 1VQLQ 4FT2A 5FU7C 1GFCA 3U23A 1AVZC 1M1KC 2EYZA 1VQLT 4HCCA 5GANe 2KYMA 1I4K1 5CK9A 5KCOA 1Q81U 1OZ2A 1JRIA 2LP5A 1V76A 7AT1B 4MZMA 2LT4A 1RLPC 5GAN2 4J8OA 2AHJB 4DOVA 4Y91A 3PIPA 2DRKA 5FWCA 3QJYA 4J9DA 1BK2A 1NPPA 3WVEB 1K4US 3CMAQ 1PG5B 1WLPB 2EQJA 2O4XB 2EJFA 3BFMA 2EW3A 3JCMh 3I5SA 2ED0A 2VYTA 2XMFA 3QBYA 1G8XA 4FYXB 3M4YA 3WXMB 3OBYA 3CCJA 2V26A 2KDSA 3DB4A 4RG2A 4EPCA 4MDWA 2EQKA 3CCUA 3AT1B 1XJWB 3RESA 4BUGA 2QGFB 4N0AA 1UHCA 5IT9E 1K76A 1G3YA 1K73R 1M4ZA 1KD1U 2HAXA 4RTVA 4BE0A 2MWOA 1VQNA 2D0NA 2CSQA 4JLGA 4XU3A 4KT0E 1K1ZA 4KH0B 4OMLA 1BI1A 1VYUA 3UT1A 4FW1A 5LJ5e 3CD6T 3FJPA 4M7DG 2L2PA 3MKDA 1KQ1A 1WQ7A 1BU1A 4E2FB 5GAMd 1T3SA 3I35A 3CCEA 3EGDB 3HFOA 1YIJA 2JOYA 1W2BA 4N4HA 2E6NA 2DJZA 2HKQB 1NG2A 3OMCA 2HSPA 5HKCA 1FXXA 2DF6A 1Q7YC 4M75G 3OMGA 4C92D 2RQWA 4PJOD 4QQDA 1QVGS 3P8HA 1PNJA 4X9CA 2KROA 4OMMA 2YRDA 4XK8E 2YRVA 2CGHA 4FYYB 2MMPA 4JZ3A 3MEAA 3CPWS 3FEOA 3MHXA 2HL3A 2LX7A 5CKDA 2PUOB 3H0FA 3CC2Q 1NEBA 2HBWA 2DERA 1BI3A 4KUDK 3P8BB 4Z8AA 2HKNA 3RUXA 1KC8U 3CD6Q 4LD9K 1ZX6A 5GAMh 2Y90A 2SEMA 5GAN4 3I56T 2F2WA 3L2RA 1WQWA 3C4SA 1V29B 2HSEB 2K7AA 2A7YA 3CC7A 4BI3A 3DLLA 4JJDA 1SKUB 5A2QE 2QASA 4M7AF 2CZ1B 2WSCE 1RACB 3MP6A 3J80E 3OYIA 3MO8A 1X43A 4LDYA 4DBRA 1VQ6Q 2E1HA 4ATOA 2BE7D 3NGPA 5GAOl 2DXBA 2O31A 4RTWA 4XTXA 2DXCA 4OMQA 1ARKA 1UUEA 2MI6A 3AHUA 3CPWA 4GY5A 1RL2A 3RR6A 2KXDA 3CCLQ 2K5FA 3G6ET 2GTJA 1JJ2P 4FM4B 2XDDA 1N9SA 2RA2A 3H0IA 4JS5A 2DL7A 1SHFA 2A28A 4LDWA 3RKYA 3CCVT 1TS9A 2PTKA 3FLGA 2RN8A 4DBQA 3OA6A 3E9GA 2DTOA 1I5LA 1EX4A 3C94A 1BIAA 5CVIA 2E3IA 3OYDA 3PVQA 1UG1A 4M7AA 4M7AE 1ZSGA 1YP5A 2LJ1A 2DTHA 1X27A 4DA4A 5GAN5 3PGGA 3LWHA 1RAIB 4J5YA 1K0SA 1TWBA 1Y0MA 3HHTB 5A0GA 2DLPA 1FWZA 2EJ9A 4D8KA 2LCLA 3ZFJA 1NJIR 1WNLA 4X9DA 5LJ3j 2DA9A 4QT7A 1YI2A 1E6HA 1OULA 3EGXA 4L6V5 3HL8A 2HQHA 4C0ZA 2DK3A 1CSKA 2J7IA 1Z9ZA 3HRUA 4B6MA 1MV0B 4P5NA 3VV0A 2BZXA 2BIVA 4ZN3A 1M3BA 2YSQA 4E7KA 2EJGA 2X9HA 3CCST 2CZ7B 8AT1B 3LYIA 4J9IA 2XDPA 4HVWA 1VQMQ 1OU9A 2ZPIB 3V7CA 2CSIA 3JCMc 2YLBA 1ZQ1A 2KI7A 5A0DA 4FU6A 1TU0B 2X3XD 3CCEQ 4M7DC 1SSHA 2X51A 2PUKB 4EMGA 1OPKA 4LDXA 3A5ZB 1IGQA 1G5VA 1WXUA 1VOMA 3I55Q 3I5RA 3QZ9B 2KNBB 4M77B 3EGDA 4OGEA 2K6DA 4MZPA 5LJ5h 4JZ4A 5KYYA 2DEUA 3M54A 3BW1A 1NE8A 2D0QB 5LJ3e 3JCMX 1NM7A 1MMAA 4M7AG 3PIOA 1OI1A 2FPEA 4ZTFA 3DB3A 1HYOA 3CCSQ 3QYGB 4M7DF 4A4FA 3CCVQ 3VS1A 2YWWA 4M77C 3JCMb 2FPDA 3CCJT 1TUCA 2GFAA 1K9MC 2HQEA 1W2BP 1EIFA 2CKKA 4AFUC 1ZSZC 3V7RA 1LNXA 2OTLQ 2XI9A 3OW2P 2K2MA 2ZPGB 4D8DA 4B9WA 2D8HA 3A8HB 4C92C 1QLYA 2I0NA 5GAMf 3PTAA 1QVGA 2EVRA 4BY6B 2QQAA 2Y4XA 1I07A 4ELYC 3VS4A 1Q7YR 4XTYA 1PRMC 2EIFA 1VQ7T 1B3QA 2IVWA 1TUDA 2LNHB 4OGCA 1VQPQ 1PD0A 2GFUA 3CC4Q 1ZA2B 2EKHA 4J6XA 4M75D 2GGRA 1JB0E 1W1FA 1O9SA 5IAYA 2CREA 5HCKA 4C8QB 3EFOA 2VB6A 5D7UA 2OI3A 2RJCA 2HZYA 4RMOA 1YCSB 4PFPA 1CKBA 5IN1A 3EFRA 2DKGA 1JJ2A 4XTVA 5CQYA 1M3AA 1IO6A 4L59A 2O01E 4CC4B 4LDVA 4ELZC 2YUNA 3S6WA 3X24B 4C8QC 1P92A 2QXFA 3M57A 2KYBA 1EFNA 2CH4A 3JSCA 1GCQC 3V7SA 2M16A 2OTJQ 2K4YA 1B07A 1N8RU 2JN0A 1WHHA 1B7TA 1AHJB 5IH2A 1VYTA 4EIKA 2CYZB 2EGEA 2NLUA 2HNIA 1GBQA 1G2BA 2MK5A 3M59A 1UGSB 1ZUYA 3REAB 1GXIE 4OB1B 3EG3A 3EG1A 4QQ6A 4PK4A 1ACMB 2CZ0B 3MP8A 3HFNA 4DBFA 1SRMA 1D3BA 2VGNA 3ULRB 3QDFA 1UFFA 2D1XA 3F70A 4KRTA 3OYJA 2D8JA 4KUIA 2P84A 4M78F 2HQXA 2JVVA 4BY6C 1VQLA 5DM7R 4JS4A 2KRSA 4E7LA 5LJ3g 1WA7A 4M75C 4E7SA 3BY7A 1WYXA 1QMCA 2DILA 3OYGA 4FT4A 1M1KR 5LJ5j 3A8LB 3VU3C 1YJNA 2ESWA 1WFWA 3LH5A 3EHQA 2L3SA 2LVMA 2EPDA 2RD1A 4IURA 5CO7A 2VWFA 5GMKi 3C0CA 1VYVA 3QUIA 2K5LA 1AWOA 4M75B 5CKHA 1YFNA 1JBMA 2X35A 5L8RE 4A53A 2AZSA 1Q86R 1GCPA 1WHMA 3CMAA 1QCOA 2LZ6B 5CQXA 2F2VA 1D09B 1LPLA 2K3XA 1YHQQ 2DYBA 3G71T 4Z88A 2QK0A 3OW2S 2DD5A 4RTTA 2QTVA 5EG2A 1MHNA 3CCUQ 2JUFA 1TXQA 3VS6A 3CCUT 3OSVA 4JPBW 3L2QA 5AT1B 4F7UA 2LQKA 4F7UE 1M1GA 3A1PA 2RJDA 3MEWA 4VUBA 3VUZA 2KMTA 4A63B 1OEBA 3GLXA 2DAQA 1KG1A 1OPLA 2OTLA 4HVUA 1VQ5T 1PC0A 1XTDA 3CCRT 1XQHA 2X4JA 4M77G 3JAME 2DL4A 4HT8A 5D6WA 2AKLA 3JCMW 4QKUA 3PT9A 2FRWA 2FEIA 5I2MA 1F1BB 3BDUA 4C5IA 3QHSA 1K8AU 5GAOq 2GBQA 3OYHA 4C8QD 1AOJA 3HPWA 4F7UB 2CH4W 2PVGB 3OBWA 2COYA 2Z0WA 2I2LA 3LX7A 2VC8A 4GLKA 4B9XA 1M90U 3FRNA 1KQSS 1UB4A 3NPFA 2LJ0A 4C92E 4JRPA 2DZ9A 2O2OA 1QCFA 4NL3A 2DM1A 3CCMT 3PFSA 2KSSA 1E7OA 2YUPA 4J9EA 1QCNA 3CCMQ 2JM8A 2DXTA 2A3LA 2XG8D 1ZHIA 3JB9J 1AEYA 4EMKB 4QVDA 2EFIA 2ED1A 5GJWB 5GMKl 3S3NA 1FMKA 2ROLA 1GFDA 1JQQA 3G71A
chains in the Genus database with same CATH topology
1U06A 2QDLA 3RNJA 4RUGA 1UJ0A 1QKXA 3VS3A 1PHTA 1SRLA 1WXTA 2DL8A 3M0SA 4OMNA 2HCKA 1X43A 5I11A 2A37A 1AZGB 1UTIA 2G6FX 4F17A 3I9QA 4J9GA 2L3QA 1NLOC 2K3BA 1T3LA 3EG0A 1JXMA 2FPFA 2JW4A 1Y57A 2RNAA 3NGPA 2O31A 4RTWA 1X2KA 4IIOA 4OMQA 1ARKA 1UUEA 1YWPA 4Z89A 2EGAA 2KXDA 2L0AA 2O9VA 4J9FA 1XOVA 4RTYA 1M8MA 3UA7A 1PKTA 2GTJA 3A98A 2A08A 1KFZA 3SEMA 1LCKA 1GRIA 3JV3A 3H0IA 1M27C 2JM9A 2DL7A 2YUOA 1SHFA 2A28A 2PTKA 2DNUA 1A0NB 2RN8A 4RTXA 2EYYA 1YWOA 1HD3A 2NWMA 2C0IA 3PVQA 5IXBA 1UG1A 1WX6A 1WXBA 4WCIA 1GBRA 1ZSGA 1M30A 1UGVA 1YP5A 2RF0A 1K9AA 1MUZA 1SHGA 2GTOA 3CQTA 1GCQA 2LJ1A 1X27A 2OAWA 1AWJA 1NLPC 2IIMA 1JEGA 2JS2A 2BZ8A 3M0TA 5L23A 4J9BA 2KE9A 1GL5A 2DRMA 2LJ3A 5IHNA 1U5SA 1K0SA 1Y0MA 2A36A 1YN8A 2DLPA 3H0HA 4D8KA 1G83A 1N5ZA 2K9GA 2W10A 1UJYA 1H8KA 2LQNA 2DA9A 4IIMA 4QT7A 2DMOA 1E6HA 2MIOA 2BZYA 2JXBA 3PE0A 2AKKA 2H8HA 2W0ZA 1CSKA 3NMZC 2J7IA 2KGTA 1Z9ZA 1SPKA 2DBKA 1Z9QA 1PWTA 1MV0B 1W70A 3M0RA 1ABQA 2KT8A 2BZXA 1M3BA 4HVVA 2YSQA 1H3HA 2JMCA 4J9IA 4HVWA 4CC7A 2RQVA 2CSIA 2LMJA 2F2XA 2X3XD 1SSHA 1OPKA 2YUQA 1PKSA 1WXUA 1I1JA 2ABLA 3I5RA 2KNBB 4X1VA 3TSZA 2DJQA 3VS0A 2K6DA 3NHNA 4JZ4A 2CT3A 2DBMA 4R0KA 3VRYA 1M3CA 2MCNA 1NM7A 2FPEA 2KXCA 4RTZA 2KBTA 2J06A 2DL5A 4HCKA 4K11A 3VS1A 2LCSA 1T0HA 2FPDA 2JS0A 1TUCA 2KRMA 2M0YA 2C0TA 4AFUC 2JMAA 2PNIA 2KR3A 1S1NA 2K2MA 3GBQA 2EBPA 4D8DA 2K79A 2D8HA 1E6GA 4E6RA 2EQIA 2CUBA 2RMOA 1QLYA 2B86A 2I0NA 2DE0X 2YDLA 1KJWA 1K0XA 2EVRA 2O9SA 4J9HA 2J6FA 4LUDA 1I07A 3VS7A 3VS4A 5EC7A 2X3WD 1OOTA 1PRMC 1B3QA 1AZEA 1CKAA 1NEGA 1TUDA 2LNHB 1BBZA 4OMPA 4FSSA 1MV3A 1ZLMA 4OMOA 2DX1A 2RQTA 1X6BA 2EKHA 2GGRA 5IHIA 5I22A 1W1FA 2HDAA 2CREA 5HCKA 2GQIA 3UATA 1JXOA 2EYWA 3REBB 2OI3A 1X2QA 2CDTA 1YCSB 1CKBA 3M0QA 4RTUA 4LNPA 3O5ZA 1M3AA 3VS2A 1IO6A 1RI9A 3FJ5A 1UHFA 4CC4B 1T0JA 2YUNA 3VRZA 2V1RA 4HXJA 2ROTA 3THKA 1QWEA 1WDXA 2C0OA 4LN2A 2KYBA 1EFNA 2CH4A 2VVKA 1GCQC 3M0PA 1B07A 2FG0A 2AK5A 5IH2A 4AFSC 1GFCA 1VYTA 4F14A 3U23A 1AVZC 2EYZA 4ESRA 1HSQA 2JT4A 4EIKA 4JJCA 2FO0A 2KYMA 2EGEA 1YNZA 1SEMA 1J3TA 1ZBJA 2J6OA 1GBQA 1G2BA 2CT4A 1ZUYA 2LP5A 3REAB 3TSWA 3EG3A 3EG1A 1KSWA 3KFVA 4LE9A 1AWWA 1RLPC 2EYXA 3M0UA 1ZUUA 1ZUKA 2E5KA 1WIEA 2RPNA 1SRMA 2DRKA 5FWCA 3ULRB 1UFFA 2RQRA 5GJVB 5ECAA 2D1XA 1HJDA 4J9DA 1W6XA 1BK2A 3RBBB 4Y92A 4KRTA 1K4US 2BTTA 2D8JA 2HEQA 3EGUA 1WLPB 1JU5C 2EW3A 1UE9A 5FW9A 2YT6A 2KRSA 3I5SA 3VS5A 1WA7A 2ED0A 2XMFA 2ENMA 4GBQA 1WYXA 2DILA 4CC2A 3PVLA 3R6NA 1UDLA 2DVJA 4JJBA 1FYNA 2ESWA 1WFWA 3LH5A 1X69A 1BB9A 3EHQA 2L3SA 1UHCA 2EPDA 2FRYA 1K76A 2VWFA 4ORZA 1X6GA 2VKNA 3QWYA 3C0CA 2DL3A 1VYVA 4RTVA 1AWOA 1TG0A 5FWBA 1RUWA 3UA6A 2D0NA 1AD5A 4DEYA 2CSQA 2AZSA 1GCPA 2LZ6B 1K1ZA 2F2VA 2OJ2A 2DYBA 4OMLA 1VYUA 4Z88A 2AZVA 4ZNXA 2ECZA 2M51A 2L2PA 4RTTA 5IHKA 4J9CA 3UF4A 4F16A 1NYGA 4GLMA 3SHWA 1QKWA 1BU1A 1VA7A 3VS6A 2GNCA 2SRCA 1T3SA 3EHRA 3I35A 2EGCA 1UECA 2P4RA 1PRLC 1H92A 4JPBW 1V1CA 4CC3A 2O88A 1JO8A 4AFZC 3QWXX 2CUDA 2KRNA 1QWFA 1NG2A 4A63B 1OEBA 2HSPA 2NUZA 2J05A 4AFQC 2DF6A 1OPLA 4AG2C 2V1QA 4HVUA 3ZL7C 2DL4A 4M4ZA 2RQWA 2L3PA 2AKLA 1PNJA 2KROA 4OMMA 5IXFA 2FRWA 2FEIA 2JTEA 4JZ3A 2GBQA 2KT1A 2LX7A 1AOJA 1KIKA 2CH4W 2KEAA 4AG1C 1RLQC 3H0FA 1U3OA 1NEBA 1WI7A 2HBWA 4DEXA 3IQLA 4LUEA 2LQWA 3NPFA 4Z8AA 2LJ0A 1I0CA 2O2OA 1QCFA 2J6KA 1NYFA 1ZX6A 2DM1A 1OV3A 2SEMA 2YUPA 1E7OA 4J9EA 2F2WA 2JM8A 3H41A 2MOXA 2RQUA 1AEYA 2K7AA 2PZ1A 2ED1A 5GJWB 4JJDA 1AWXA 1FMKA 3TVTA 3EG2A 1ABOA 2ROLA 1GFDA 1JQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U06 A;  2QDL A;  3RNJ A;  4RUG A;  1UJ0 A;  1QKX A;  3VS3 A;  1PHT A;  1SRL A;  1WXT A;  2DL8 A;  3M0S A;  4OMN A;  2HCK A;  1X43 A;  5I11 A;  2A37 A;  1AZG B;  1UTI A;  2G6F X;  4F17 A;  3I9Q A;  4J9G A;  2L3Q A;  1NLO C;  2K3B A;  1T3L A;  3EG0 A;  1JXM A;  2FPF A;  2JW4 A;  1Y57 A;  2RNA A;  3NGP A;  2O31 A;  4RTW A;  1X2K A;  4IIO A;  4OMQ A;  1ARK A;  1UUE A;  1YWP A;  4Z89 A;  2EGA A;  2KXD A;  2L0A A;  2O9V A;  4J9F A;  1XOV A;  4RTY A;  1M8M A;  3UA7 A;  1PKT A;  2GTJ A;  3A98 A;  2A08 A;  1KFZ A;  3SEM A;  1LCK A;  1GRI A;  3JV3 A;  3H0I A;  1M27 C;  2JM9 A;  2DL7 A;  2YUO A;  1SHF A;  2A28 A;  2PTK A;  2DNU A;  1A0N B;  2RN8 A;  4RTX A;  2EYY A;  1YWO A;  1HD3 A;  2NWM A;  2C0I A;  3PVQ A;  5IXB A;  1UG1 A;  1WX6 A;  1WXB A;  4WCI A;  1GBR A;  1ZSG A;  1M30 A;  1UGV A;  1YP5 A;  2RF0 A;  1K9A A;  1MUZ A;  1SHG A;  2GTO A;  3CQT A;  1GCQ A;  2LJ1 A;  1X27 A;  2OAW A;  1AWJ A;  1NLP C;  2IIM A;  1JEG A;  2JS2 A;  2BZ8 A;  3M0T A;  5L23 A;  4J9B A;  2KE9 A;  1GL5 A;  2DRM A;  2LJ3 A;  5IHN A;  1U5S A;  1K0S A;  1Y0M A;  2A36 A;  1YN8 A;  2DLP A;  3H0H A;  4D8K A;  1G83 A;  1N5Z A;  2K9G A;  2W10 A;  1UJY A;  1H8K A;  2LQN A;  2DA9 A;  4IIM A;  4QT7 A;  2DMO A;  1E6H A;  2MIO A;  2BZY A;  2JXB A;  3PE0 A;  2AKK A;  2H8H A;  2W0Z A;  1CSK A;  3NMZ C;  2J7I A;  2KGT A;  1Z9Z A;  1SPK A;  2DBK A;  1Z9Q A;  1PWT A;  1MV0 B;  1W70 A;  3M0R A;  1ABQ A;  2KT8 A;  2BZX A;  1M3B A;  4HVV A;  2YSQ A;  1H3H A;  2JMC A;  4J9I A;  4HVW A;  4CC7 A;  2RQV A;  2CSI A;  2LMJ A;  2F2X A;  2X3X D;  1SSH A;  1OPK A;  2YUQ A;  1PKS A;  1WXU A;  1I1J A;  2ABL A;  3I5R A;  2KNB B;  4X1V A;  3TSZ A;  2DJQ A;  3VS0 A;  2K6D A;  3NHN A;  4JZ4 A;  2CT3 A;  2DBM A;  4R0K A;  3VRY A;  1M3C A;  2MCN A;  1NM7 A;  2FPE A;  2KXC A;  4RTZ A;  2KBT A;  2J06 A;  2DL5 A;  4HCK A;  4K11 A;  3VS1 A;  2LCS A;  1T0H A;  2FPD A;  2JS0 A;  1TUC A;  2KRM A;  2M0Y A;  2C0T A;  4AFU C;  2JMA A;  2PNI A;  2KR3 A;  1S1N A;  2K2M A;  3GBQ A;  2EBP A;  4D8D A;  2K79 A;  2D8H A;  1E6G A;  4E6R A;  2EQI A;  2CUB A;  2RMO A;  1QLY A;  2B86 A;  2I0N A;  2DE0 X;  2YDL A;  1KJW A;  1K0X A;  2EVR A;  2O9S A;  4J9H A;  2J6F A;  4LUD A;  1I07 A;  3VS7 A;  3VS4 A;  5EC7 A;  2X3W D;  1OOT A;  1PRM C;  1B3Q A;  1AZE A;  1CKA A;  1NEG A;  1TUD A;  2LNH B;  1BBZ A;  4OMP A;  4FSS A;  1MV3 A;  1ZLM A;  4OMO A;  2DX1 A;  2RQT A;  1X6B A;  2EKH A;  2GGR A;  5IHI A;  5I22 A;  1W1F A;  2HDA A;  2CRE A;  5HCK A;  2GQI A;  3UAT A;  1JXO A;  2EYW A;  3REB B;  2OI3 A;  1X2Q A;  2CDT A;  1YCS B;  1CKB A;  3M0Q A;  4RTU A;  4LNP A;  3O5Z A;  1M3A A;  3VS2 A;  1IO6 A;  1RI9 A;  3FJ5 A;  1UHF A;  4CC4 B;  1T0J A;  2YUN A;  3VRZ A;  2V1R A;  4HXJ A;  2ROT A;  3THK A;  1QWE A;  1WDX A;  2C0O A;  4LN2 A;  2KYB A;  1EFN A;  2CH4 A;  2VVK A;  1GCQ C;  3M0P A;  1B07 A;  2FG0 A;  2AK5 A;  5IH2 A;  4AFS C;  1GFC A;  1VYT A;  4F14 A;  3U23 A;  1AVZ C;  2EYZ A;  4ESR A;  1HSQ A;  2JT4 A;  4EIK A;  4JJC A;  2FO0 A;  2KYM A;  2EGE A;  1YNZ A;  1SEM A;  1J3T A;  1ZBJ A;  2J6O A;  1GBQ A;  1G2B A;  2CT4 A;  1ZUY A;  2LP5 A;  3REA B;  3TSW A;  3EG3 A;  3EG1 A;  1KSW A;  3KFV A;  4LE9 A;  1AWW A;  1RLP C;  2EYX A;  3M0U A;  1ZUU A;  1ZUK A;  2E5K A;  1WIE A;  2RPN A;  1SRM A;  2DRK A;  5FWC A;  3ULR B;  1UFF A;  2RQR A;  5GJV B;  5ECA A;  2D1X A;  1HJD A;  4J9D A;  1W6X A;  1BK2 A;  3RBB B;  4Y92 A;  4KRT A;  1K4U S;  2BTT A;  2D8J A;  2HEQ A;  3EGU A;  1WLP B;  1JU5 C;  2EW3 A;  1UE9 A;  5FW9 A;  2YT6 A;  2KRS A;  3I5S A;  3VS5 A;  1WA7 A;  2ED0 A;  2XMF A;  2ENM A;  4GBQ A;  1WYX A;  2DIL A;  4CC2 A;  3PVL A;  3R6N A;  1UDL A;  2DVJ A;  4JJB A;  1FYN A;  2ESW A;  1WFW A;  3LH5 A;  1X69 A;  1BB9 A;  3EHQ A;  2L3S A;  1UHC A;  2EPD A;  2FRY A;  1K76 A;  2VWF A;  4ORZ A;  1X6G A;  2VKN A;  3QWY A;  3C0C A;  2DL3 A;  1VYV A;  4RTV A;  1AWO A;  1TG0 A;  5FWB A;  1RUW A;  3UA6 A;  2D0N A;  1AD5 A;  4DEY A;  2CSQ A;  2AZS A;  1GCP A;  2LZ6 B;  1K1Z A;  2F2V A;  2OJ2 A;  2DYB A;  4OML A;  1VYU A;  4Z88 A;  2AZV A;  4ZNX A;  2ECZ A;  2M51 A;  2L2P A;  4RTT A;  5IHK A;  4J9C A;  3UF4 A;  4F16 A;  1NYG A;  4GLM A;  3SHW A;  1QKW A;  1BU1 A;  1VA7 A;  3VS6 A;  2GNC A;  2SRC A;  1T3S A;  3EHR A;  3I35 A;  2EGC A;  1UEC A;  2P4R A;  1PRL C;  1H92 A;  4JPB W;  1V1C A;  4CC3 A;  2O88 A;  1JO8 A;  4AFZ C;  3QWX X;  2CUD A;  2KRN A;  1QWF A;  1NG2 A;  4A63 B;  1OEB A;  2HSP A;  2NUZ A;  2J05 A;  4AFQ C;  2DF6 A;  1OPL A;  4AG2 C;  2V1Q A;  4HVU A;  3ZL7 C;  2DL4 A;  4M4Z A;  2RQW A;  2L3P A;  2AKL A;  1PNJ A;  2KRO A;  4OMM A;  5IXF A;  2FRW A;  2FEI A;  2JTE A;  4JZ3 A;  2GBQ A;  2KT1 A;  2LX7 A;  1AOJ A;  1KIK A;  2CH4 W;  2KEA A;  4AG1 C;  1RLQ C;  3H0F A;  1U3O A;  1NEB A;  1WI7 A;  2HBW A;  4DEX A;  3IQL A;  4LUE A;  2LQW A;  3NPF A;  4Z8A A;  2LJ0 A;  1I0C A;  2O2O A;  1QCF A;  2J6K A;  1NYF A;  1ZX6 A;  2DM1 A;  1OV3 A;  2SEM A;  2YUP A;  1E7O A;  4J9E A;  2F2W A;  2JM8 A;  3H41 A;  2MOX A;  2RQU A;  1AEY A;  2K7A A;  2PZ1 A;  2ED1 A;  5GJW B;  4JJD A;  1AWX A;  1FMK A;  3TVT A;  3EG2 A;  1ABO A;  2ROL A;  1GFD A;  1JQQ A; 
#chains in the Genus database with same CATH topology
 1U06 A;  3RNJ A;  1UJ0 A;  4PJJ A;  1QKX A;  2EAY A;  4HT9 A;  2DFU A;  3VS3 A;  2RHI A;  3M0S A;  2FL7 A;  4OMN A;  1AZG B;  1QP3 A;  1UTI A;  2G6F X;  3VYG A;  3I9Q A;  4YTL A;  2L3Q A;  2VXF A;  5LL6 S;  1U1T A;  3EG0 A;  2FPF A;  2RI2 A;  1Y57 A;  3M5A A;  1K73 U;  2QA4 A;  2BKD N;  1X2K A;  4IIO A;  5J3B A;  5GAN 3;  2DTI A;  5GMK m;  4MDX A;  3CBM A;  3QSU A;  3DLM A;  4CI0 C;  3CCM A;  1JJ2 S;  3CC2 T;  2K3Y A;  2EGA A;  2LTO A;  2O9V A;  3UA7 A;  4RTY A;  3TU4 K;  2RO0 A;  4M77 D;  1TTH B;  2XKO C;  3SEM A;  4JLI A;  5FU6 C;  3CBO A;  1NBE B;  1K73 C;  3BE3 A;  4PKC C;  1S72 Q;  1A0N B;  5I21 A;  1VQ6 A;  3E19 A;  1N27 A;  1YWO A;  3S3O A;  4C92 F;  1HD3 A;  2NWM A;  4DQ2 A;  4WCI A;  4BI8 B;  1GBR A;  1KQ2 A;  3CQT A;  3JCM P;  2RF0 A;  1MUZ A;  2K5I A;  4FYW B;  2OAW A;  3CCL A;  2JS2 A;  2KE9 A;  2LJ3 A;  5CKB A;  2A36 A;  1OU8 A;  4JJN K;  3H0H A;  3I56 Q;  4M77 F;  3CCE T;  3N5B B;  1M2V B;  4WTO B;  5CR2 A;  2JXB A;  3PE0 A;  2AKK A;  2H8H A;  2NYS A;  4M75 A;  5GAN 7;  1Y7X A;  5DLO A;  2KQW A;  2EKO A;  1SPK A;  2LRQ A;  1PWT A;  3MEU A;  1ABQ A;  5GAN j;  1H3H A;  3SWN B;  4ZGE B;  2JMC A;  3GP8 A;  1RAA B;  4CC7 A;  1G3T A;  2HL5 C;  1BKB A;  1S72 T;  5KYU B;  2LMJ A;  3HSB A;  2JJ9 A;  1Y07 A;  3I56 A;  2ABL A;  3LGL A;  2CP6 A;  1N6A A;  2R5M A;  4V2S A;  4M7D A;  3OSS C;  2EYQ A;  3VS0 A;  3NHN A;  3G1J A;  2CT3 A;  3A8O B;  1LJO A;  4BDY A;  4E47 A;  3NTH A;  3VRY A;  3SWN C;  1WJQ A;  3CCQ A;  4CRI A;  1KHC A;  2IPO B;  4M78 E;  2VV5 A;  4KGX B;  2LCS A;  2JS0 A;  3LGF A;  2KRM A;  2FZK B;  1KQS A;  3GBQ A;  4EMK A;  3E2U A;  1E6G A;  4E6R A;  4PFZ A;  2CP3 A;  2CUB A;  4R56 A;  2MAM A;  1IHW A;  2RMO A;  2FZG B;  2B86 A;  3X25 B;  2EWN A;  2YDL A;  4J7F A;  3MPU B;  1RAB B;  2O9S A;  3CME T;  1VQK A;  2IG0 A;  4C0F A;  2XK0 A;  4MZT A;  1OOT A;  5CKE A;  4HCZ A;  2COW A;  1BBZ A;  3ASK A;  2DVE A;  1VQ8 Q;  4FSS A;  1SG5 A;  1YBY A;  4E7J A;  1MV3 A;  1VQN Q;  3FDR A;  2RK2 A;  1VQ5 A;  1WHL A;  5KYX B;  1XNI A;  1K9M R;  4XTW A;  2D6F A;  3G71 Q;  3OYY A;  2EQM A;  4PJL A;  5IHI A;  5I22 A;  4A4G A;  2KAF A;  3A8M B;  3MET A;  1JXO A;  4HKE A;  2LC4 A;  3REB B;  1I81 A;  1X2Q A;  3G4S T;  4IUU A;  2RH2 A;  2R5A A;  5I2S A;  4DOW A;  4M78 C;  2EQU A;  3O8V A;  1RI9 A;  3FJ5 A;  1UHF A;  3NTI A;  1YIJ Q;  4LD6 A;  2V1R A;  2ROT A;  5CCA A;  1VQP A;  2C0O A;  2P0Q A;  1YJN T;  2XD0 A;  4XU2 A;  4OF1 A;  1QQJ A;  4FL6 A;  2FHD A;  3M0P A;  3L2U A;  4MML A;  2PQW A;  3L42 A;  1NZ9 A;  3QPH A;  4AFS C;  4F14 A;  4N4I A;  2JT4 A;  2E12 A;  4JJC A;  4AMC A;  4LXC A;  4ZTJ A;  2MYS A;  2FO0 A;  1TSF A;  3GIB A;  1YNZ A;  2KK4 A;  1J3T A;  4OB3 B;  3OW2 A;  3L2Z A;  2J6O A;  1VQ7 Q;  2JZ2 A;  2VAS A;  4JUV A;  2CT4 A;  5KCH A;  3TSW A;  3VKI A;  3OS2 A;  3C95 A;  1KSW A;  1Q86 U;  1AWW A;  2E10 A;  4II1 A;  5GAN h;  2E5K A;  1KD1 C;  2LCC A;  1UGQ B;  4O6J A;  2RPN A;  4C8Q A;  2RQR A;  1LVK A;  1W6X A;  3X26 B;  2QEX T;  2ZGW A;  3C12 A;  3RBB B;  4Y92 A;  4ANJ A;  3QZ5 B;  1BCM A;  1C1A A;  2YXY A;  2BTT A;  2HEQ A;  3EGU A;  3TQ7 P;  1JU5 C;  1M1F A;  4OMF B;  5FW9 A;  1YIT T;  4NS5 A;  5FRN A;  3VS5 A;  2ENM A;  1MND A;  2E70 A;  4GBQ A;  1X75 C;  3HTR A;  2ZZD A;  3M9Q A;  4PL6 A;  4XTZ A;  1YIJ T;  1VIF A;  3J7A F;  3PVL A;  4E7H A;  4C92 G;  1UDL A;  5CIU A;  2DVJ A;  4Z02 A;  1FYN A;  1FMW A;  2OTJ T;  1BB9 A;  2QG9 B;  4ORZ A;  1X6G A;  2VKN A;  3QWY A;  1U8R A;  2DL3 A;  2CS7 A;  3SD4 A;  5FWB A;  3ZBD A;  5GMK h;  2R57 A;  1IGU A;  3UA6 A;  4QVZ A;  4FW2 A;  1AD5 A;  2LNV A;  2JNG A;  2O4X A;  1K8A R;  1Q82 U;  2OJ2 A;  1M2O A;  2DO3 A;  2QQS A;  2GCX A;  2M51 A;  4C92 A;  5GAO r;  4J9C A;  3UF4 A;  4F16 A;  1NYG A;  2RJE A;  4GLM A;  3R6O A;  1HK9 A;  3SHW A;  3CMA T;  2GNC A;  2CP7 A;  1UEC A;  1BI2 A;  1PRL C;  2P4R A;  1H92 A;  2YLC A;  1SF9 A;  4DBH A;  1V1C A;  4CC3 A;  2O88 A;  3CXC A;  4IUT A;  1R8O B;  2CUD A;  4PJO A;  2H3E B;  1VQO Q;  4C8Q G;  2X4W A;  1WJS A;  4AG2 C;  2LT1 A;  2NUP B;  2RM4 A;  4MMK A;  4PNO A;  3JB9 G;  3ZL7 C;  3CXC P;  3HKS A;  4NOY A;  4F04 B;  4J6W A;  2L3P A;  4M7A D;  3URG A;  4ZGJ B;  5J39 A;  5KYY B;  2M9U A;  2ATC B;  1I5O B;  1M8V A;  2DIQ A;  2QEX Q;  3RIR A;  5GAM j;  4PJO C;  3SB2 A;  1D1B A;  1TH7 A;  1TOV A;  3CCR A;  3OYE A;  3EGX B;  1KIK A;  3LWI A;  2XID A;  4AG1 C;  3RKW A;  4KGV B;  3GNG A;  1U3O A;  5J26 A;  1WI7 A;  4DEX A;  1YI2 Q;  4LUE A;  2LQW A;  5KE2 A;  1I0C A;  4M78 D;  3ME9 A;  3H9N A;  1OV3 A;  2WSE E;  1VQ9 T;  5KYX A;  5GMK e;  4M7D B;  2MOX A;  3NFC A;  3QG1 A;  3GPL A;  2PZ1 A;  1Y71 A;  1VIE A;  2R58 A;  4OVA A;  3OYN A;  2CZ6 B;  2QAZ A;  3M58 A;  3OYA A;  4PJO F;  3EG2 A;  2F5T X;  4A4E A;  2QDL A;  3UDC A;  2K57 A;  4RUG A;  1PHT A;  1SRL A;  1WXT A;  2DL8 A;  4XU0 A;  3JRZ A;  4ME7 A;  4BE2 A;  2HCK A;  2GF7 A;  2QGG A;  2X4X A;  2YRC A;  2C06 A;  4F17 A;  1IZ6 A;  4J9G A;  1H64 1;  1NLO C;  1T3L A;  1JXM A;  1MMG A;  2JW4 A;  3OB9 A;  4J6Y A;  2ZPB B;  2RNA A;  3G7Z A;  4C5E A;  1B34 B;  1UGR B;  1YWP A;  4M7A B;  3GOX A;  4M7D E;  4BI4 A;  3JCM Q;  2L0A A;  3CEY A;  1XOV A;  2RK1 A;  3SWN A;  1PKT A;  2A08 A;  3VUB A;  1IHV A;  2RB6 A;  1LCK A;  2RHZ A;  5C6S A;  1YI2 T;  1WJR A;  1M27 C;  2RI3 A;  1QW1 A;  4AT1 B;  5GMK j;  2YUO A;  5HY6 A;  3GNF B;  3S3M A;  3MCA B;  5FLX E;  3KUF A;  2DNU A;  1PSE A;  3KXT A;  1N8R C;  3CCL T;  2C0I A;  5LJ3 h;  1M30 A;  2MPX C;  1WHJ A;  1SHG A;  4D6W A;  2QDY B;  3PNW C;  4QQG A;  1QVF S;  4FCY A;  1NLP C;  2IIM A;  4HA8 A;  3M0T A;  3NTK A;  4C8Q F;  1GL5 A;  5IHN A;  1U5S A;  1YN8 A;  2QTX A;  2NUP A;  1G83 A;  1N5Z A;  1Y96 A;  3J81 E;  2W10 A;  2K2V A;  4QW2 A;  2LQN A;  4IIM A;  4M77 E;  3I55 A;  1BYM A;  2DD4 A;  2BZY A;  3CCJ Q;  2QQB A;  3BDL A;  5FU6 B;  3UPU A;  1KK7 A;  2WSF E;  4FYV B;  4M78 G;  3NMZ C;  2VGM A;  2DBK A;  9ATC B;  1M90 R;  1M9S A;  1W70 A;  3M0R A;  1VQ4 Q;  3EAE A;  2CP0 A;  3SFM A;  1RAF B;  4PJM A;  2E6Z A;  4BD3 A;  3TEE A;  4J7I A;  1W2B S;  4XQ3 A;  5GAN f;  1SSF A;  4XTU A;  2G3R A;  2YUQ A;  2F5K A;  1I1J A;  5KYN A;  2QQ9 A;  3OYF A;  2V8I A;  4A4K A;  4EMH A;  1VQ7 A;  2DBM A;  2QQR A;  4A54 A;  1M3C A;  1QVF A;  2E41 A;  2KXC A;  5GAO p;  2L3R A;  2KBT A;  2J06 A;  3OYL A;  4EMK C;  1VQ4 A;  4HCK A;  3SDZ A;  4K11 A;  2M02 A;  3P8D A;  1RI0 A;  3LH0 A;  3M53 A;  3HRT A;  2KR3 A;  3MP1 A;  1MGQ A;  2L8D A;  3CME A;  4C8Q E;  5FRM A;  4R55 A;  3JB9 I;  3VJP A;  3JCM e;  4OP0 A;  5KYW A;  1VQ4 T;  1K0X A;  2MWP A;  4J9H A;  2J6F A;  1OQK A;  1TUG B;  1ZSZ B;  3QXE B;  4LUD A;  4PLI A;  1QVG P;  3VS7 A;  5GAN d;  1BIB A;  5EC7 A;  3G6E A;  3CCV A;  1NEG A;  3D7S B;  3CC2 A;  4OMP A;  2P4T A;  4QVC A;  2H3J A;  1B34 A;  4TVR A;  4JRQ A;  1ZLM A;  4OMO A;  5DY9 A;  4KH1 B;  2DX1 A;  2RQT A;  3JB9 H;  4N0A C;  4OB0 B;  4M7D D;  2JTM A;  1WHK A;  1X6O A;  4O5V A;  1Q81 R;  3L1A A;  5GAN 6;  1YHQ A;  3E9F A;  2HDA A;  4C0G A;  3H6Z A;  2L89 A;  4JDS A;  2ZAE A;  3CME Q;  2KY9 A;  3CC7 Q;  4X34 A;  2XU8 A;  1C6V X;  3M0Q A;  3VS2 A;  1BI0 A;  1VQ8 T;  3M4G A;  4C0D C;  5A0L A;  1T0J A;  1VQ8 A;  2HMA A;  3THK A;  3RER A;  5AYF A;  1VQ9 A;  4L5G A;  1VQ5 Q;  4XAX B;  2VVK A;  5HK0 A;  2XDB A;  2FG0 A;  4PJN A;  2AK5 A;  1W4S A;  2COZ A;  3OS1 A;  3CC7 T;  4ESR A;  3L2W A;  1HSQ A;  3PMT A;  3I55 T;  1SEM A;  2Y4Y A;  1ZBJ A;  4PFO A;  3JCM J;  1MMD A;  1M2V A;  2AT1 B;  3KFV A;  2P0K A;  1YJN Q;  4LE9 A;  2EYX A;  3M0U A;  4RKU E;  1Q82 R;  1PCX A;  1ZUK A;  1ZUU A;  1WIE A;  4KUL A;  3LW5 E;  1VQ6 T;  1AT1 B;  2FB7 A;  1RAE B;  5GJV B;  5ECA A;  4PJO G;  2PVD B;  1HJD A;  1R77 A;  3M55 A;  1UGP B;  2E5Q A;  5GAN 8;  4F7U G;  1WHG A;  3RMS A;  1OYX A;  1UE9 A;  3QJ6 A;  2YT6 A;  3A8G B;  5KYU A;  2NUT B;  4BE1 A;  4CC2 A;  5HK3 A;  3JB9 D;  3R6N A;  1C0M A;  4JJB A;  1X69 A;  2QA4 T;  2FRY A;  1IRX A;  4J83 A;  4E7Z A;  1TG0 A;  1WGS A;  5D6X A;  3V8L A;  2FVU A;  1RUW A;  4DEY A;  3CC4 A;  3EH2 A;  3QDR B;  3OYM A;  3CC4 T;  5D6Y A;  1D0Y A;  1ZSZ A;  1R0C B;  2AZV A;  4ZNX A;  1BCO A;  1DJ7 B;  2ECZ A;  3CPW P;  2ZCF B;  1K9M U;  1NJI C;  2QI2 A;  5IHK A;  1R0B G;  5GAN g;  1D3B B;  2DYI A;  1QKW A;  5CKF A;  1VA7 A;  1KC8 R;  2SRC A;  3EHR A;  2EGC A;  8ATC B;  3CCQ Q;  2ZPF B;  2DEQ A;  3E1S A;  1JO8 A;  2GQV A;  3OYC A;  4AFZ C;  1VQO T;  3QWX X;  4M75 E;  4BDZ A;  1YHQ T;  2KRN A;  1QWF A;  4OB2 B;  3ZEH A;  1OZ3 A;  2NUZ A;  2J05 A;  1U1S A;  4AFQ C;  1YJ9 T;  2V1Q A;  1Y96 B;  4M78 A;  1KD1 R;  4M4Z A;  1D1C A;  1KQS P;  1O75 A;  1G3W A;  1I8F A;  5IXF A;  2RHU A;  3FC3 A;  1VQM T;  2B8A A;  3FB9 A;  2JTE A;  1VQK T;  4C5G A;  1VQK Q;  2VUB A;  4Q5W A;  2KT1 A;  1YIT Q;  1YJW A;  1YJ9 A;  2KEA A;  1RLQ C;  5GAM g;  3L2V A;  3IQL A;  3OYK A;  3EFO B;  3OQ5 A;  1VQO A;  2J6K A;  1NYF A;  1Q82 C;  3QII A;  2QA4 Q;  5CAI A;  3H41 A;  4ZN1 A;  2RHY A;  1PSF A;  4PLL A;  2RQU A;  3RDV A;  3CCQ T;  1PD1 A;  5LJ5 g;  2M1H A;  4JRI A;  3KBG A;  2YHT A;  1AWX A;  3TVT A;  3X20 B;  1ABO A;  5M9O A;  4M7A C;  2CP2 A;  5LJ5 d;  3CCR Q;  2X4Y A;  4C5H A;  1QVF P;  4NL2 A;  1YJ9 Q;  5I11 A;  2A37 A;  5KE3 A;  1KC8 C;  3DKM A;  1G3S A;  2BUD A;  2ZPE B;  4C92 B;  2K3B A;  1S72 A;  1VQ9 Q;  2V8K A;  3GF5 A;  3QO3 A;  1D0Z A;  2CP5 A;  1RAG B;  4Z89 A;  3INZ A;  2HBP A;  1VQN T;  3QYH B;  1K8A C;  4J9F A;  1M8M A;  1D0X A;  3A98 A;  1KFZ A;  3EG9 A;  1GRI A;  3JV3 A;  2OTJ A;  2JM9 A;  2XIC A;  3MEV A;  1QVP A;  1EZZ B;  2D9T A;  1H3Z A;  1D1A A;  3MJX A;  3PMI A;  2PU9 B;  4IUP A;  2MF2 A;  4RTX A;  3OS5 A;  5FRO A;  2EYY A;  2OX7 A;  2PVO B;  5IXB A;  1WX6 A;  4IKF A;  1WXB A;  1YJW T;  2A0F B;  2DPP B;  1KHI A;  5C0M A;  1UGV A;  3G6E Q;  1K9A A;  2GTO A;  1IRE B;  4HCB A;  1GCQ A;  4IUV A;  3WVD B;  2RHX A;  3TRE A;  1AWJ A;  3OYB A;  1JEG A;  2BZ8 A;  1OX8 A;  1RAH B;  4EDU A;  5L23 A;  2DXU A;  4J9B A;  1VUB A;  2DRM A;  5KH6 A;  1YCY A;  1VQM A;  1NPR A;  3JCM V;  3EG9 B;  3V8J A;  4LDU A;  5LJ3 f;  2K9G A;  2E4H A;  2WAC A;  3ER0 A;  4M75 F;  1UJY A;  3JCM g;  1H8K A;  3G4S Q;  4BB7 A;  2DMO A;  1N9R A;  2MIO A;  1FMV A;  1VQP T;  2FYK A;  3FIF A;  5LJ5 f;  2DIG A;  3CPF A;  2W0Z A;  3CD6 A;  1UEB A;  2KGT A;  1Z9Q A;  3CCS A;  3OS0 A;  2JTF A;  2KT8 A;  3TCJ A;  4HVV A;  4RG8 A;  4M78 B;  4UC4 A;  6AT1 B;  2QYZ A;  5GAM e;  3M56 A;  2RQV A;  2F2X A;  3CXC S;  1PKS A;  3H8Z A;  1Q7Y U;  4WF2 A;  2DZC A;  4X1V A;  3G4S A;  3TSZ A;  3EH1 A;  2DJQ A;  4KBM B;  4F7U F;  2LDM A;  4R0K A;  2MCN A;  1NJI U;  5FU7 B;  4RTZ A;  3VYH B;  1M90 C;  4BAC A;  2NUT A;  2DL5 A;  4E7I A;  2ZPH B;  2V8J A;  4ZGD B;  4XU1 A;  1T0H A;  2QEX A;  4N4G A;  2XHC A;  4M77 A;  2M0Y A;  2C0T A;  1M5Q 1;  2FZC B;  3EFS A;  2JMA A;  2PNI A;  1S1N A;  4Y28 E;  3OY9 A;  4FIB A;  3CBP A;  2LQ8 A;  3HP9 A;  2EBP A;  2K79 A;  1YIT A;  1YJW Q;  1HXD A;  3V8K A;  2EQI A;  1ZA1 B;  2L5Q A;  1ZBX A;  2DE0 X;  1KJW A;  5LJ3 d;  5GAO n;  3JB9 F;  2F1L A;  2HD0 A;  4PJO E;  5GAO m;  4JRK A;  3UWN A;  2X3W D;  1N8R R;  4RCC A;  1LOJ A;  1AZE A;  1CKA A;  2F69 A;  5DLQ E;  2AIR B;  2OTL T;  4KGZ B;  1X6B A;  3T9N A;  1X01 A;  1MMN A;  2P0P A;  3HRS A;  3RKX A;  4C0D B;  1Q95 G;  3X28 B;  1MNE A;  1WZO A;  2BE9 B;  2M0O A;  2GQI A;  1QP2 A;  3UAT A;  2E3H A;  2EYW A;  2E64 A;  2VXE A;  2CDT A;  4RCB A;  2KVQ G;  1IXD A;  4RTU A;  4LNP A;  3O5Z A;  3LLR A;  4IUQ A;  4PJO B;  1FX7 A;  1Q86 C;  2OAU A;  2RJF A;  3VRZ A;  4A4H A;  2DET A;  4HXJ A;  3Q1J A;  1QWE A;  3JCM f;  1WDX A;  1IB8 A;  1PM3 A;  4LN2 A;  1RAD B;  2LX9 A;  2RI5 A;  1WPY A;  3JCM d;  1OX9 A;  5KYW B;  1M1K U;  4FSX A;  1Q81 C;  3RMQ A;  3QKJ A;  2E65 A;  1VQL Q;  4FT2 A;  5FU7 C;  1GFC A;  3U23 A;  1AVZ C;  1M1K C;  2EYZ A;  1VQL T;  4HCC A;  5GAN e;  2KYM A;  1I4K 1;  5CK9 A;  5KCO A;  1Q81 U;  1OZ2 A;  1JRI A;  2LP5 A;  1V76 A;  7AT1 B;  4MZM A;  2LT4 A;  1RLP C;  5GAN 2;  4J8O A;  2AHJ B;  4DOV A;  4Y91 A;  3PIP A;  2DRK A;  5FWC A;  3QJY A;  4J9D A;  1BK2 A;  1NPP A;  3WVE B;  1K4U S;  3CMA Q;  1PG5 B;  1WLP B;  2EQJ A;  2O4X B;  2EJF A;  3BFM A;  2EW3 A;  3JCM h;  3I5S A;  2ED0 A;  2VYT A;  2XMF A;  3QBY A;  1G8X A;  4FYX B;  3M4Y A;  3WXM B;  3OBY A;  3CCJ A;  2V26 A;  2KDS A;  3DB4 A;  4RG2 A;  4EPC A;  4MDW A;  2EQK A;  3CCU A;  3AT1 B;  1XJW B;  3RES A;  4BUG A;  2QGF B;  4N0A A;  1UHC A;  5IT9 E;  1K76 A;  1G3Y A;  1K73 R;  1M4Z A;  1KD1 U;  2HAX A;  4RTV A;  4BE0 A;  2MWO A;  1VQN A;  2D0N A;  2CSQ A;  4JLG A;  4XU3 A;  4KT0 E;  1K1Z A;  4KH0 B;  4OML A;  1BI1 A;  1VYU A;  3UT1 A;  4FW1 A;  5LJ5 e;  3CD6 T;  3FJP A;  4M7D G;  2L2P A;  3MKD A;  1KQ1 A;  1WQ7 A;  1BU1 A;  4E2F B;  5GAM d;  1T3S A;  3I35 A;  3CCE A;  3EGD B;  3HFO A;  1YIJ A;  2JOY A;  1W2B A;  4N4H A;  2E6N A;  2DJZ A;  2HKQ B;  1NG2 A;  3OMC A;  2HSP A;  5HKC A;  1FXX A;  2DF6 A;  1Q7Y C;  4M75 G;  3OMG A;  4C92 D;  2RQW A;  4PJO D;  4QQD A;  1QVG S;  3P8H A;  1PNJ A;  4X9C A;  2KRO A;  4OMM A;  2YRD A;  4XK8 E;  2YRV A;  2CGH A;  4FYY B;  2MMP A;  4JZ3 A;  3MEA A;  3CPW S;  3FEO A;  3MHX A;  2HL3 A;  2LX7 A;  5CKD A;  2PUO B;  3H0F A;  3CC2 Q;  1NEB A;  2HBW A;  2DER A;  1BI3 A;  4KUD K;  3P8B B;  4Z8A A;  2HKN A;  3RUX A;  1KC8 U;  3CD6 Q;  4LD9 K;  1ZX6 A;  5GAM h;  2Y90 A;  2SEM A;  5GAN 4;  3I56 T;  2F2W A;  3L2R A;  1WQW A;  3C4S A;  1V29 B;  2HSE B;  2K7A A;  2A7Y A;  3CC7 A;  4BI3 A;  3DLL A;  4JJD A;  1SKU B;  5A2Q E;  2QAS A;  4M7A F;  2CZ1 B;  2WSC E;  1RAC B;  3MP6 A;  3J80 E;  3OYI A;  3MO8 A;  1X43 A;  4LDY A;  4DBR A;  1VQ6 Q;  2E1H A;  4ATO A;  2BE7 D;  3NGP A;  5GAO l;  2DXB A;  2O31 A;  4RTW A;  4XTX A;  2DXC A;  4OMQ A;  1ARK A;  1UUE A;  2MI6 A;  3AHU A;  3CPW A;  4GY5 A;  1RL2 A;  3RR6 A;  2KXD A;  3CCL Q;  2K5F A;  3G6E T;  2GTJ A;  1JJ2 P;  4FM4 B;  2XDD A;  1N9S A;  2RA2 A;  3H0I A;  4JS5 A;  2DL7 A;  1SHF A;  2A28 A;  4LDW A;  3RKY A;  3CCV T;  1TS9 A;  2PTK A;  3FLG A;  2RN8 A;  4DBQ A;  3OA6 A;  3E9G A;  2DTO A;  1I5L A;  1EX4 A;  3C94 A;  1BIA A;  5CVI A;  2E3I A;  3OYD A;  3PVQ A;  1UG1 A;  4M7A A;  4M7A E;  1ZSG A;  1YP5 A;  2LJ1 A;  2DTH A;  1X27 A;  4DA4 A;  5GAN 5;  3PGG A;  3LWH A;  1RAI B;  4J5Y A;  1K0S A;  1TWB A;  1Y0M A;  3HHT B;  5A0G A;  2DLP A;  1FWZ A;  2EJ9 A;  4D8K A;  2LCL A;  3ZFJ A;  1NJI R;  1WNL A;  4X9D A;  5LJ3 j;  2DA9 A;  4QT7 A;  1YI2 A;  1E6H A;  1OUL A;  3EGX A;  4L6V 5;  3HL8 A;  2HQH A;  4C0Z A;  2DK3 A;  1CSK A;  2J7I A;  1Z9Z A;  3HRU A;  4B6M A;  1MV0 B;  4P5N A;  3VV0 A;  2BZX A;  2BIV A;  4ZN3 A;  1M3B A;  2YSQ A;  4E7K A;  2EJG A;  2X9H A;  3CCS T;  2CZ7 B;  8AT1 B;  3LYI A;  4J9I A;  2XDP A;  4HVW A;  1VQM Q;  1OU9 A;  2ZPI B;  3V7C A;  2CSI A;  3JCM c;  2YLB A;  1ZQ1 A;  2KI7 A;  5A0D A;  4FU6 A;  1TU0 B;  2X3X D;  3CCE Q;  4M7D C;  1SSH A;  2X51 A;  2PUK B;  4EMG A;  1OPK A;  4LDX A;  3A5Z B;  1IGQ A;  1G5V A;  1WXU A;  1VOM A;  3I55 Q;  3I5R A;  3QZ9 B;  2KNB B;  4M77 B;  3EGD A;  4OGE A;  2K6D A;  4MZP A;  5LJ5 h;  4JZ4 A;  5KYY A;  2DEU A;  3M54 A;  3BW1 A;  1NE8 A;  2D0Q B;  5LJ3 e;  3JCM X;  1NM7 A;  1MMA A;  4M7A G;  3PIO A;  1OI1 A;  2FPE A;  4ZTF A;  3DB3 A;  1HYO A;  3CCS Q;  3QYG B;  4M7D F;  4A4F A;  3CCV Q;  3VS1 A;  2YWW A;  4M77 C;  3JCM b;  2FPD A;  3CCJ T;  1TUC A;  2GFA A;  1K9M C;  2HQE A;  1W2B P;  1EIF A;  2CKK A;  4AFU C;  1ZSZ C;  3V7R A;  1LNX A;  2OTL Q;  2XI9 A;  3OW2 P;  2K2M A;  2ZPG B;  4D8D A;  4B9W A;  2D8H A;  3A8H B;  4C92 C;  1QLY A;  2I0N A;  5GAM f;  3PTA A;  1QVG A;  2EVR A;  4BY6 B;  2QQA A;  2Y4X A;  1I07 A;  4ELY C;  3VS4 A;  1Q7Y R;  4XTY A;  1PRM C;  2EIF A;  1VQ7 T;  1B3Q A;  2IVW A;  1TUD A;  2LNH B;  4OGC A;  1VQP Q;  1PD0 A;  2GFU A;  3CC4 Q;  1ZA2 B;  2EKH A;  4J6X A;  4M75 D;  2GGR A;  1JB0 E;  1W1F A;  1O9S A;  5IAY A;  2CRE A;  5HCK A;  4C8Q B;  3EFO A;  2VB6 A;  5D7U A;  2OI3 A;  2RJC A;  2HZY A;  4RMO A;  1YCS B;  4PFP A;  1CKB A;  5IN1 A;  3EFR A;  2DKG A;  1JJ2 A;  4XTV A;  5CQY A;  1M3A A;  1IO6 A;  4L59 A;  2O01 E;  4CC4 B;  4LDV A;  4ELZ C;  2YUN A;  3S6W A;  3X24 B;  4C8Q C;  1P92 A;  2QXF A;  3M57 A;  2KYB A;  1EFN A;  2CH4 A;  3JSC A;  1GCQ C;  3V7S A;  2M16 A;  2OTJ Q;  2K4Y A;  1B07 A;  1N8R U;  2JN0 A;  1WHH A;  1B7T A;  1AHJ B;  5IH2 A;  1VYT A;  4EIK A;  2CYZ B;  2EGE A;  2NLU A;  2HNI A;  1GBQ A;  1G2B A;  2MK5 A;  3M59 A;  1UGS B;  1ZUY A;  3REA B;  1GXI E;  4OB1 B;  3EG3 A;  3EG1 A;  4QQ6 A;  4PK4 A;  1ACM B;  2CZ0 B;  3MP8 A;  3HFN A;  4DBF A;  1SRM A;  1D3B A;  2VGN A;  3ULR B;  3QDF A;  1UFF A;  2D1X A;  3F70 A;  4KRT A;  3OYJ A;  2D8J A;  4KUI A;  2P84 A;  4M78 F;  2HQX A;  2JVV A;  4BY6 C;  1VQL A;  5DM7 R;  4JS4 A;  2KRS A;  4E7L A;  5LJ3 g;  1WA7 A;  4M75 C;  4E7S A;  3BY7 A;  1WYX A;  1QMC A;  2DIL A;  3OYG A;  4FT4 A;  1M1K R;  5LJ5 j;  3A8L B;  3VU3 C;  1YJN A;  2ESW A;  1WFW A;  3LH5 A;  3EHQ A;  2L3S A;  2LVM A;  2EPD A;  2RD1 A;  4IUR A;  5CO7 A;  2VWF A;  5GMK i;  3C0C A;  1VYV A;  3QUI A;  2K5L A;  1AWO A;  4M75 B;  5CKH A;  1YFN A;  1JBM A;  2X35 A;  5L8R E;  4A53 A;  2AZS A;  1Q86 R;  1GCP A;  1WHM A;  3CMA A;  1QCO A;  2LZ6 B;  5CQX A;  2F2V A;  1D09 B;  1LPL A;  2K3X A;  1YHQ Q;  2DYB A;  3G71 T;  4Z88 A;  2QK0 A;  3OW2 S;  2DD5 A;  4RTT A;  2QTV A;  5EG2 A;  1MHN A;  3CCU Q;  2JUF A;  1TXQ A;  3VS6 A;  3CCU T;  3OSV A;  4JPB W;  3L2Q A;  5AT1 B;  4F7U A;  2LQK A;  4F7U E;  1M1G A;  3A1P A;  2RJD A;  3MEW A;  4VUB A;  3VUZ A;  2KMT A;  4A63 B;  1OEB A;  3GLX A;  2DAQ A;  1KG1 A;  1OPL A;  2OTL A;  4HVU A;  1VQ5 T;  1PC0 A;  1XTD A;  3CCR T;  1XQH A;  2X4J A;  4M77 G;  3JAM E;  2DL4 A;  4HT8 A;  5D6W A;  2AKL A;  3JCM W;  4QKU A;  3PT9 A;  2FRW A;  2FEI A;  5I2M A;  1F1B B;  3BDU A;  4C5I A;  3QHS A;  1K8A U;  5GAO q;  2GBQ A;  3OYH A;  4C8Q D;  1AOJ A;  3HPW A;  4F7U B;  2CH4 W;  2PVG B;  3OBW A;  2COY A;  2Z0W A;  2I2L A;  3LX7 A;  2VC8 A;  4GLK A;  4B9X A;  1M90 U;  3FRN A;  1KQS S;  1UB4 A;  3NPF A;  2LJ0 A;  4C92 E;  4JRP A;  2DZ9 A;  2O2O A;  1QCF A;  4NL3 A;  2DM1 A;  3CCM T;  3PFS A;  2KSS A;  1E7O A;  2YUP A;  4J9E A;  1QCN A;  3CCM Q;  2JM8 A;  2DXT A;  2A3L A;  2XG8 D;  1ZHI A;  3JB9 J;  1AEY A;  4EMK B;  4QVD A;  2EFI A;  2ED1 A;  5GJW B;  5GMK l;  3S3N A;  1FMK A;  2ROL A;  1GFD A;  1JQQ A;  3G71 A; 
#chains in the Genus database with same CATH homology
 1U06 A;  2QDL A;  3RNJ A;  4RUG A;  1UJ0 A;  1QKX A;  3VS3 A;  1PHT A;  1SRL A;  1WXT A;  2DL8 A;  3M0S A;  4OMN A;  2HCK A;  1X43 A;  5I11 A;  2A37 A;  1AZG B;  1UTI A;  2G6F X;  4F17 A;  3I9Q A;  4J9G A;  2L3Q A;  1NLO C;  2K3B A;  1T3L A;  3EG0 A;  1JXM A;  2FPF A;  2JW4 A;  1Y57 A;  2RNA A;  3NGP A;  2O31 A;  4RTW A;  1X2K A;  4IIO A;  4OMQ A;  1ARK A;  1UUE A;  1YWP A;  4Z89 A;  2EGA A;  2KXD A;  2L0A A;  2O9V A;  4J9F A;  1XOV A;  4RTY A;  1M8M A;  3UA7 A;  1PKT A;  2GTJ A;  3A98 A;  2A08 A;  1KFZ A;  3SEM A;  1LCK A;  1GRI A;  3JV3 A;  3H0I A;  1M27 C;  2JM9 A;  2DL7 A;  2YUO A;  1SHF A;  2A28 A;  2PTK A;  2DNU A;  1A0N B;  2RN8 A;  4RTX A;  2EYY A;  1YWO A;  1HD3 A;  2NWM A;  2C0I A;  3PVQ A;  5IXB A;  1UG1 A;  1WX6 A;  1WXB A;  4WCI A;  1GBR A;  1ZSG A;  1M30 A;  1UGV A;  1YP5 A;  2RF0 A;  1K9A A;  1MUZ A;  1SHG A;  2GTO A;  3CQT A;  1GCQ A;  2LJ1 A;  1X27 A;  2OAW A;  1AWJ A;  1NLP C;  2IIM A;  1JEG A;  2JS2 A;  2BZ8 A;  3M0T A;  5L23 A;  4J9B A;  2KE9 A;  1GL5 A;  2DRM A;  2LJ3 A;  5IHN A;  1U5S A;  1K0S A;  1Y0M A;  2A36 A;  1YN8 A;  2DLP A;  3H0H A;  4D8K A;  1G83 A;  1N5Z A;  2K9G A;  2W10 A;  1UJY A;  1H8K A;  2LQN A;  2DA9 A;  4IIM A;  4QT7 A;  2DMO A;  1E6H A;  2MIO A;  2BZY A;  2JXB A;  3PE0 A;  2AKK A;  2H8H A;  2W0Z A;  1CSK A;  3NMZ C;  2J7I A;  2KGT A;  1Z9Z A;  1SPK A;  2DBK A;  1Z9Q A;  1PWT A;  1MV0 B;  1W70 A;  3M0R A;  1ABQ A;  2KT8 A;  2BZX A;  1M3B A;  4HVV A;  2YSQ A;  1H3H A;  2JMC A;  4J9I A;  4HVW A;  4CC7 A;  2RQV A;  2CSI A;  2LMJ A;  2F2X A;  2X3X D;  1SSH A;  1OPK A;  2YUQ A;  1PKS A;  1WXU A;  1I1J A;  2ABL A;  3I5R A;  2KNB B;  4X1V A;  3TSZ A;  2DJQ A;  3VS0 A;  2K6D A;  3NHN A;  4JZ4 A;  2CT3 A;  2DBM A;  4R0K A;  3VRY A;  1M3C A;  2MCN A;  1NM7 A;  2FPE A;  2KXC A;  4RTZ A;  2KBT A;  2J06 A;  2DL5 A;  4HCK A;  4K11 A;  3VS1 A;  2LCS A;  1T0H A;  2FPD A;  2JS0 A;  1TUC A;  2KRM A;  2M0Y A;  2C0T A;  4AFU C;  2JMA A;  2PNI A;  2KR3 A;  1S1N A;  2K2M A;  3GBQ A;  2EBP A;  4D8D A;  2K79 A;  2D8H A;  1E6G A;  4E6R A;  2EQI A;  2CUB A;  2RMO A;  1QLY A;  2B86 A;  2I0N A;  2DE0 X;  2YDL A;  1KJW A;  1K0X A;  2EVR A;  2O9S A;  4J9H A;  2J6F A;  4LUD A;  1I07 A;  3VS7 A;  3VS4 A;  5EC7 A;  2X3W D;  1OOT A;  1PRM C;  1B3Q A;  1AZE A;  1CKA A;  1NEG A;  1TUD A;  2LNH B;  1BBZ A;  4OMP A;  4FSS A;  1MV3 A;  1ZLM A;  4OMO A;  2DX1 A;  2RQT A;  1X6B A;  2EKH A;  2GGR A;  5IHI A;  5I22 A;  1W1F A;  2HDA A;  2CRE A;  5HCK A;  2GQI A;  3UAT A;  1JXO A;  2EYW A;  3REB B;  2OI3 A;  1X2Q A;  2CDT A;  1YCS B;  1CKB A;  3M0Q A;  4RTU A;  4LNP A;  3O5Z A;  1M3A A;  3VS2 A;  1IO6 A;  1RI9 A;  3FJ5 A;  1UHF A;  4CC4 B;  1T0J A;  2YUN A;  3VRZ A;  2V1R A;  4HXJ A;  2ROT A;  3THK A;  1QWE A;  1WDX A;  2C0O A;  4LN2 A;  2KYB A;  1EFN A;  2CH4 A;  2VVK A;  1GCQ C;  3M0P A;  1B07 A;  2FG0 A;  2AK5 A;  5IH2 A;  4AFS C;  1GFC A;  1VYT A;  4F14 A;  3U23 A;  1AVZ C;  2EYZ A;  4ESR A;  1HSQ A;  2JT4 A;  4EIK A;  4JJC A;  2FO0 A;  2KYM A;  2EGE A;  1YNZ A;  1SEM A;  1J3T A;  1ZBJ A;  2J6O A;  1GBQ A;  1G2B A;  2CT4 A;  1ZUY A;  2LP5 A;  3REA B;  3TSW A;  3EG3 A;  3EG1 A;  1KSW A;  3KFV A;  4LE9 A;  1AWW A;  1RLP C;  2EYX A;  3M0U A;  1ZUU A;  1ZUK A;  2E5K A;  1WIE A;  2RPN A;  1SRM A;  2DRK A;  5FWC A;  3ULR B;  1UFF A;  2RQR A;  5GJV B;  5ECA A;  2D1X A;  1HJD A;  4J9D A;  1W6X A;  1BK2 A;  3RBB B;  4Y92 A;  4KRT A;  1K4U S;  2BTT A;  2D8J A;  2HEQ A;  3EGU A;  1WLP B;  1JU5 C;  2EW3 A;  1UE9 A;  5FW9 A;  2YT6 A;  2KRS A;  3I5S A;  3VS5 A;  1WA7 A;  2ED0 A;  2XMF A;  2ENM A;  4GBQ A;  1WYX A;  2DIL A;  4CC2 A;  3PVL A;  3R6N A;  1UDL A;  2DVJ A;  4JJB A;  1FYN A;  2ESW A;  1WFW A;  3LH5 A;  1X69 A;  1BB9 A;  3EHQ A;  2L3S A;  1UHC A;  2EPD A;  2FRY A;  1K76 A;  2VWF A;  4ORZ A;  1X6G A;  2VKN A;  3QWY A;  3C0C A;  2DL3 A;  1VYV A;  4RTV A;  1AWO A;  1TG0 A;  5FWB A;  1RUW A;  3UA6 A;  2D0N A;  1AD5 A;  4DEY A;  2CSQ A;  2AZS A;  1GCP A;  2LZ6 B;  1K1Z A;  2F2V A;  2OJ2 A;  2DYB A;  4OML A;  1VYU A;  4Z88 A;  2AZV A;  4ZNX A;  2ECZ A;  2M51 A;  2L2P A;  4RTT A;  5IHK A;  4J9C A;  3UF4 A;  4F16 A;  1NYG A;  4GLM A;  3SHW A;  1QKW A;  1BU1 A;  1VA7 A;  3VS6 A;  2GNC A;  2SRC A;  1T3S A;  3EHR A;  3I35 A;  2EGC A;  1UEC A;  2P4R A;  1PRL C;  1H92 A;  4JPB W;  1V1C A;  4CC3 A;  2O88 A;  1JO8 A;  4AFZ C;  3QWX X;  2CUD A;  2KRN A;  1QWF A;  1NG2 A;  4A63 B;  1OEB A;  2HSP A;  2NUZ A;  2J05 A;  4AFQ C;  2DF6 A;  1OPL A;  4AG2 C;  2V1Q A;  4HVU A;  3ZL7 C;  2DL4 A;  4M4Z A;  2RQW A;  2L3P A;  2AKL A;  1PNJ A;  2KRO A;  4OMM A;  5IXF A;  2FRW A;  2FEI A;  2JTE A;  4JZ3 A;  2GBQ A;  2KT1 A;  2LX7 A;  1AOJ A;  1KIK A;  2CH4 W;  2KEA A;  4AG1 C;  1RLQ C;  3H0F A;  1U3O A;  1NEB A;  1WI7 A;  2HBW A;  4DEX A;  3IQL A;  4LUE A;  2LQW A;  3NPF A;  4Z8A A;  2LJ0 A;  1I0C A;  2O2O A;  1QCF A;  2J6K A;  1NYF A;  1ZX6 A;  2DM1 A;  1OV3 A;  2SEM A;  2YUP A;  1E7O A;  4J9E A;  2F2W A;  2JM8 A;  3H41 A;  2MOX A;  2RQU A;  1AEY A;  2K7A A;  2PZ1 A;  2ED1 A;  5GJW B;  4JJD A;  1AWX A;  1FMK A;  3TVT A;  3EG2 A;  1ABO A;  2ROL A;  1GFD A;  1JQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...