2RQVA

Solution structure of sh3ci domain of bem1p
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
108
structure length
108
Chain Sequence
b'GPLGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud emergence protein 1
publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 7
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqvA01
5I22A 5IXFA 2YSQA 1PWTA 3EG3A 2J05A 2RN8A 3VRYA 2HCKA 1PHTA 2J7IA 1UG1A 5IHKA 4CC3A 2ABLA 5IH2A 1WFWA 4AFSC 2FPDA 2DNUA 2EGCA 4K11A 2YDLA 3VS7A 4AG2C 2KEAA 3QWYA 2DL5A 2JMAA 4WCIA 1YP5A 2JS0A 1WI7A 2A37A 4LUDA 2K79A 3NPFA 1KSWA 2DILA 2RQRA 3PVLA 4JZ4A 2GTOA 2KXCA 2CDTA 2DMOA 3H0FA 2KBTA 4LE9A 2A28A 1RI9A 2B86A 1M3AA 4EIKA 1YCSB 1GBRA 2EYWA 3EGUA 2K7AA 4AFUC 2EGEA 1UUEA 3THKA 3A98A 2VVKA 2D1XA 2YUPA 1KFZA 4GLMA 2K3BA 2YUNA 3U23A 2DE0X 4DEYA 4OMNA 4OMPA 2O88A 2H8HA 2A36A 4IIOA 2KRSA 3QWXX 1QWFA 2DM1A 4GBQA 1E6GA 1NM7A 3FJ5A 4X1VA 1VA7A 2EQIA 2KT1A 1NEBA 2GBQA 2DYBA 4HCKA 4J9HA 1V1CA 1UHFA 2BZXA 2RMOA 1NYFA 2JMCA 1RUWA 3PE0A 3EHRA 3VS6A 2KE9A 1B3QA 2KRNA 2K9GA 2LX7A 1YNZA 2RQTA 1W6XA 1B07A 2DLPA 3JV3A 4RTTA 1X2KA 3EG1A 3REBB 1NYGA 2K6DA 4IIMA 4Z89A 1YWOA 4RTVA 1NLOC 1UTIA 2EBPA 3UATA 2E5KA 4J9CA 2W10A 2HBWA 2YUQA 2GGRA 3RNJA 2KROA 2F2WA 1K1ZA 1NG2A 4Z8AA 4AFQC 2JM9A 2SEMA 1TUCA 2BZ8A 2BZYA 2AZVA 3NGPA 3SHWA 4RUGA 1SRLA 2HEQA 2EKHA 3H0IA 1H8KA 1QKWA 1YWPA 5EC7A 2YUOA 3VS1A 2KT8A 1E6HA 1W1FA 2V1RA 2CT3A 1SHFA 3O5ZA 2CT4A 1QLYA 1WLPB 3M0SA 1UHCA 2LJ0A 1LCKA 1I0CA 1WX6A 2DL7A 2EVRA 4FSSA 2D8HA 3I9QA 2G6FX 4J9BA 3VS3A 1WDXA 4Z88A 2XMFA 2VWFA 1SPKA 2PZ1A 4RTZA 3UA6A 2EYXA 1JQQA 3TSWA 3R6NA 2AKKA 4OMLA 2DA9A 2FPFA 1VYUA 4ESRA 1BB9A 3M0QA 2W0ZA 2D0NA 5GJVB 4CC2A 1AWOA 2BTTA 4RTUA 1AD5A 1QWEA 2DL8A 4Y92A 3H41A 3H0HA 1K9AA 1OOTA 3EG2A 1ZUYA 3M0PA 4OMQA 2V1QA 2MIOA 4RTWA 4LNPA 2ED1A 2J6KA 1NEGA 1T0HA 1HD3A 1X69A 5FWCA 1UFFA 2AKLA 2EGAA 2EPDA 3ZL7C 4JPBW 2O9VA 4J9IA 2FG0A 1GFCA 1K4US 1OV3A 2J6OA 1WIEA 1BBZA 3TSZA 2LQWA 3VS5A 4M4ZA 2MCNA 2L2PA 1N5ZA 2L3SA 2RQWA 4RTYA 1NLPC 1UE9A 1X27A 2FPEA 2CH4W 2JXBA 3VS0A 4LUEA 3M0TA 1CKBA 4AG1C 5FW9A 4JJBA 3KFVA 1GCPA 3I35A 2HDAA 2KR3A 1W70A 2M51A 1QKXA 1AZEA 2LJ1A 1ZUKA 2JM8A 1WA7A 2L0AA 5IHIA 1KJWA 4OMMA 1I1JA 4AFZC 4CC4B 1GCQC 1ZSGA 1K76A 2LJ3A 2LQNA 4D8DA 1PNJA 2KXDA 1M27C 2A08A 3NMZC 2QDLA 3VS2A 4D8KA 4HXJA 2JS2A 2EW3A 1AWJA 2CUBA 3M0UA 5L23A 5IXBA 2OAWA 1T0JA 1MUZA 2FEIA 1VYTA 1HSQA 1PRMC 1H3HA 2JT4A 2RQUA 4OMOA 1KIKA 2DX1A 2SRCA 2DVJA 4HVVA 1JU5C 2F2VA 1U06A 1S1NA 1I07A 2J06A 2C0IA 2O2OA 3ULRB 2JTEA 4JZ3A 1OPKA 2ED0A 4QT7A 2JW4A 3C0CA 1UJ0A 2FO0A 2AK5A 2CH4A 1K0XA 2DJQA 1K0SA 4R0KA 2C0TA 1G83A 1GRIA 4F14A 2DRKA 1Y57A 2PTKA 2DBMA 1OPLA 2KRMA 1M30A 4J9FA 1WXUA 1M3BA 1X43A 1ZX6A 1OEBA 1UECA 1AZGB 2O9SA 2EYYA 1CKAA 3I5SA 3UF4A 1XOVA 1MV3A 1X6BA 1ABQA 2GTJA 2MOXA 2ROTA 2PNIA 2CSIA 1JEGA 2GNCA 1FMKA 1BK2A 1EFNA 3SEMA 2K2MA 3VRZA 1X6GA 1T3SA 1SEMA 1SRMA 1X2QA 1M3CA 1AWWA 4KRTA 1JO8A 3EG0A 1WYXA 2KYMA 4J9EA 5GJWB 2YT6A 1AOJA 3I5RA 2DL4A 3REAB 1QCFA 1RLQC 2DBKA 1UGVA 2GQIA 1ABOA 4HVUA 3VS4A 1RLPC 1BU1A 1YN8A 2RNAA 2F2XA 1AVZC 3M0RA 1JXOA 1Z9QA 1IO6A 2IIMA 5ECAA 3LH5A 2C0OA 1M8MA 1FYNA 2OI3A 3RBBB 3NHNA 2HSPA 1VYVA 4JJDA 5IHNA 2CREA 2KGTA 3GBQA 3EHQA 4LN2A 3TVTA 2DL3A 1ZBJA 1TUDA 1ARKA 1Y0MA 2CSQA 2X3WD 4E6RA 2I0NA 2DF6A 2RQVA 2CUDA 4CC7A 1PRLC 3UA7A 4A63B 3CQTA 1G2BA 2VKNA 2L3QA 1AWXA 1ZUUA 1A0NB 2RF0A 5FWBA 1HJDA 2AZSA 2D8JA 4HVWA 4J9DA 2X3XD 2RPNA 4JJCA 2ESWA 2NWMA 2DRMA 2LMJA 4RTXA 1H92A 2O31A 2ROLA 2J6FA 1MV0B 1TG0A 1UJYA 1SHGA 1ZLMA 2L3PA 2OJ2A 1U5SA 1SSHA 2FRYA 1GCQA 1E7OA 2ENMA 3PVQA 2LZ6B 4ORZA 2FRWA 1GL5A 1T3LA 1PKSA 5I11A 1U3OA 4J9GA 1GFDA 2ECZA 2M0YA 2NUZA 1J3TA 1AEYA 5HCKA 1JXMA 2LCSA 1UDLA 4F16A 2P4RA 1Z9ZA 1WXBA 4F17A 4ZNXA 1WXTA 1GBQA 3IQLA 2LP5A 2LNHB 2KNBB 1CSKA 2EYZA 1PKTA 4DEXA 2KYBA
chains in the Genus database with same CATH superfamily
1W2BA 3ME9A 2RN8A 1QVPA 2E12A 5GMKl 5IHKA 4N0AC 2ABLA 3MHXA 1WPYA 2FPDA 2DNUA 3AT1B 4K11A 3VS7A 2KEAA 2V26A 3J80E 2DXBA 2YWWA 2JS0A 1YITT 3BY7A 3OA6A 2K79A 4L6V5 1RAHB 3FDRA 4B6MA 2CDTA 2HQEA 2PVGB 4M77A 3CCMA 5CQXA 2ATCB 1N27A 1YCSB 4BE2A 3CBMA 2K7AA 2EGEA 1UUEA 1WZOA 2NLUA 2P0KA 3ZFJA 2JVVA 2K3BA 3LGLA 4J5YA 1WHLA 3G6ET 4OMPA 1NJIC 2YXYA 4A4HA 3OS0A 1BI1A 1B34B 1YI2Q 2A36A 3A8MB 1B34A 1KQ2A 3OYHA 2COYA 4X1VA 1VA7A 4C92D 4R56A 3EGDA 3VJPA 2QQBA 2RMOA 3EHRA 1OULA 3VS6A 3TEEA 2QEXQ 1W6XA 3M9QA 1B07A 4YTLA 2DLPA 1R77A 3N5BB 1PM3A 2QK0A 3CC4T 4FM4B 1VQMT 1PSEA 2RO0A 1VQ8A 2BE9B 1YWOA 1QMCA 3LW5E 3CCSA 3M53A 1M1FA 1WQ7A 2W10A 3RNJA 1SKUB 2LT4A 3V8KA 5J39A 1QVGP 2KROA 2HSEB 2RJDA 2E1HA 1NG2A 3JCMc 2LNVA 4OMFB 4AFQC 3G1JA 2JM9A 3SHWA 2BZ8A 2BZYA 4M7DE 1H8KA 2CP6A 4F7UE 2V1RA 5GMKm 3QBYA 3DLLA 4JS5A 3MCAB 1EZZB 1G8XA 1I0CA 1LCKA 1WX6A 3I9QA 2G6FX 3L2RA 4PK4A 4Z88A 3JRZA 1TTHB 1SPKA 5GAMg 1WHJA 1YITQ 4OB0B 3LWHA 2FZCB 3CC2A 1VQPT 4C8QF 1YJ9T 5GJVB 1VQLA 2BTTA 4RTUA 1AD5A 4XQ3A 3H0HA 1K9AA 5LJ3d 2QA4T 5L8RE 1JBMA 3EG2A 1ZUYA 3OYYA 1PG5B 4OMQA 2V1QA 5CKFA 2MIOA 4RTWA 4M7DB 2VV5A 1T0HA 2LT1A 4A54A 4M7DA 1QP2A 4F7UB 1LPLA 2HKQB 2BKDN 2EPDA 2EGAA 4F7UA 3P8DA 4J9IA 1K4US 2E41A 1BBZA 2NUPA 3TSZA 2MMPA 4M7AG 4N0AA 4BI8B 4M4ZA 5KH6A 2LTOA 2L2PA 1N9RA 1B7TA 2CP3A 4E7JA 1TU0B 2L3SA 4RTYA 3F70A 5A0GA 2QQRA 2XKOC 3CBPA 1K9MR 4JS4A 5A2QE 4NL2A 4M75C 3GLXA 4AG1C 2MI6A 3WXMB 4P5NA 3OYFA 3NFCA 3D7SB 2LQKA 2KR3A 3CCVT 2M51A 4FCYA 1N8RR 3CC4Q 2JM8A 5DM7R 1VQMQ 3JAME 2MPXC 1I5OB 4CC4B 1K76A 1ZQ1A 2DIQA 4A4GA 4QQDA 3OS5A 3H9NA 2AIRB 2E10A 2EWNA 4D8KA 3RESA 5KE3A 1FMWA 2OAUA 2CUBA 5IXBA 1T0JA 2BIVA 1XTDA 1H3HA 3CPWS 5FU7C 2RQUA 1KIKA 3QDRB 1ZHIA 2Y4XA 3JCMg 3CCMT 2A3LA 2HZYA 4JZ3A 5GAMf 2ED0A 4M77G 2K2VA 4JJNK 1FXXA 4RCBA 1JJ2P 1MMGA 2ZPEB 4A53A 1IHWA 2CS7A 1KQSP 2FO0A 1ZA2B 2AK5A 1YJ9Q 2QASA 2K5FA 1QVFP 1JRIA 2DJQA 5I2SA 1QVGS 4FYYB 4KH1B 1LJOA 1G83A 2QA4Q 2DXUA 1YI2A 5CR2A 3AHUA 1NZ9A 3A8HB 2PTKA 4Y91A 5GAMh 1TSFA 1WXUA 1K73U 2X4YA 1UGPB 2E3IA 1OEBA 1UECA 1BI2A 2EYYA 1SSFA 3QZ9B 1Y71A 5GANg 4BDZA 1K8AU 2QEXA 4EMKB 2PNIA 1FMKA 3BW1A 4EMKA 3SB2A 2DTOA 2ZPHB 3VRZA 1NJIU 2YRCA 1X2QA 1M3CA 2MYSA 1Q86C 2XK0A 1VQ8T 3EG0A 1Q81R 1WGSA 1WYXA 4JLGA 3PMIA 4Q5WA 1WHKA 3V7SA 5KYWA 3PT9A 4O6JA 3I5RA 5CQYA 2DBKA 2IG0A 2GQIA 4LDWA 4M75E 4B9XA 1ABOA 2VUBA 3VS4A 3VUBA 1YN8A 2RNAA 2F2XA 3FEOA 1RI0A 3M0RA 5EG2A 1JXOA 3CCVQ 2IIMA 3LH5A 2C0OA 4HCBA 3RKWA 2PUKB 3QDFA 3VUZA 2HSPA 4QQ6A 3OS2A 3LYIA 2RI2A 2CREA 2D6FA 2L89A 2P0QA 1NPRA 8ATCB 3OW2S 1O9SA 4LN2A 3QXEB 3TVTA 1TXQA 3OQ5A 2I0NA 2RHXA 1KQ1A 4M78E 1YITA 4XTWA 3CCET 1VQLT 2P4TA 4QW2A 1PC0A 3JCMf 1ZUUA 2RF0A 3OMCA 4M75B 3PFSA 5D7UA 2RPNA 3CCMQ 4Y28E 2CYZB 4M75A 1H92A 5IN1A 2O31A 4M77D 3WVEB 4M7DG 3OSVA 3MEVA 1U5SA 2E64A 3CC7T 1DJ7B 4F7UG 3CCLQ 1BYMA 2LZ6B 3GF5A 3JCMh 1Q7YR 1C1AA 1V76A 4C92F 5FROA 4JUVA 3OYJA 5I11A 3ER0A 4J9GA 2KMTA 2ECZA 2M0YA 1R8OB 4IUVA 4M78B 2PU9B 1JXMA 3MO8A 1RAEB 3CPWA 2KVQG 2LCSA 3RMSA 5GANf 1UDLA 1RAIB 4M78A 1R0BG 1NE8A 1TUGB 4JRIA 1XJWB 2P4RA 5IT9E 4F17A 2XICA 2DPPB 1YIJT 2LP5A 1CSKA 1I4K1 2EYZA 4PLLA 4PJJA 5CO7A 4C0GA 4C5GA 2PUOB 1VQ8Q 4C0FA 2J7IA 1VQMA 4CC3A 4MZMA 1WFWA 2EGCA 4HKEA 2DL5A 1YP5A 1VQ5T 2A37A 2E6NA 4DBQA 3NPFA 1KSWA 9ATCB 5FRNA 2GTOA 2KDSA 4LDVA 2KXCA 3LLRA 3HP9A 2DMOA 3URGA 2A28A 2B8AA 2B86A 3PIPA 3PIOA 3HTRA 5HY6A 1F1BB 2Y4YA 1LNXA 5KCHA 4AFUC 1WJQA 3A98A 2VVKA 2YUPA 2HMAA 2JTMA 3PMTA 1G3YA 5GMKh 3U23A 5FU6B 4JRKA 2DERA 4OMNA 4GY5A 2K4YA 4BE1A 5J26A 3TREA 3QPHA 3CCEQ 3JCMb 2DM1A 4GBQA 1VQLQ 1YJ9A 2QQ9A 1NM7A 2EQIA 2GBQA 5GAOp 3GP8A 1WHMA 2DYBA 4HCKA 4PJOE 3QYHB 1IGQA 1NYFA 2JMCA 3L2UA 2QA4A 3CD6A 4XTUA 1IXDA 2K9GA 2LX7A 4FW1A 2JN0A 2VC8A 5FRMA 2HL5C 2DO3A 4UC4A 2RK1A 1FWZA 3CCJT 1X2KA 3EG1A 4NOYA 3G7ZA 3REBB 2QI2A 3CC7Q 1RACB 2MF2A 1VUBA 1NYGA 2F5TX 3OW2A 2EBPA 4TVRA 2M16A 5HK3A 1P92A 3GIBA 2HBWA 1N6AA 7AT1B 4BUGA 2AZVA 4EDUA 3GOXA 2HEQA 3OY9A 4PJOB 5CKEA 3CMET 4BI3A 1YIJQ 1U1TA 1KD1R 1QKWA 1YWPA 2RHYA 1W1FA 2LDMA 5HK0A 1VQKQ 3O5ZA 4ZN3A 2CT4A 2QG9B 4C8QE 3M59A 1TS9A 3CCVA 2HD0A 2EIFA 3X26B 2DL7A 1K9MU 5DLQE 1RADB 2EAYA 1D3BB 1WDXA 4HCCA 2XMFA 2E4HA 2VWFA 4RTZA 3UA6A 1VQ5Q 2V8IA 1VYUA 2COZA 3META 4LDXA 2W0ZA 1N8RU 4CC2A 4J7IA 4HCZA 3I55T 3M56A 3EG9B 2DEQA 5CVIA 5D6WA 5M9OA 2DJZA 5KYUB 3M0PA 5KYUA 2PVOB 4LD6A 1SG5A 1HK9A 3HFOA 3CCUT 1K73C 1HD3A 2RJFA 3JCMX 1X69A 2AKLA 3ZL7C 4A4FA 3E9GA 4M75G 4C8QB 1Y07A 2QGGA 2JZ2A 2O9VA 3C4SA 3H6ZA 4D6WA 2FG0A 1GFCA 4XTVA 1OV3A 4C8QA 1K8AC 4ZN1A 3L1AA 5FLXE 3VS5A 2MCNA 3CCLA 3JB9D 2RQWA 4JDSA 1UE9A 1X27A 2FPEA 3VS0A 5GAN5 1IGUA 4E7HA 5FW9A 1KC8R 2DD4A 1VIFA 3I35A 4XK8E 2HDAA 3CCJQ 2CZ7B 3VU3C 1IZ6A 4PJNA 3CCQQ 4M78G 1QKXA 3M5AA 2EQUA 1KJWA 4XTXA 3EH1A 4EPCA 5LL6S 3RKYA 1NPPA 2EKOA 3MP8A 1I1JA 1U1SA 1GCQC 1ZSGA 1V29B 4N4IA 3QUIA 4D8DA 1PNJA 4HT9A 1M27C 4PJOF 4PFPA 2A08A 4DA4A 2JS2A 2EW3A 3M57A 2DD5A 2OAWA 2O4XB 2CZ6B 1HSQA 1PRMC 3CMEQ 2O4XA 3I56T 4OMOA 1PSFA 2DX1A 4PFOA 2DVJA 1JU5C 2JUFA 2F2VA 2J06A 1UB4A 2C0IA 1I8FA 3ZEHA 1OPKA 1JB0E 3ASKA 1WHGA 1M90R 3QHSA 4DOVA 5DY9A 4E47A 1MGQA 2K5LA 4EMKC 3FLGA 4A4KA 3TCJA 1OQKA 1VQOT 3I55Q 1K0XA 1C6VX 1K0SA 3INZA 3X20B 4F14A 1RAGB 3CCEA 3JSCA 2KRMA 4J9FA 2EYQA 1M3BA 3CCUQ 5KCOA 3CD6T 2ZAEA 3CXCP 3NTKA 3MKDA 1OU8A 1PD0A 2E6ZA 2K2MA 4RMOA 1SEMA 1SRMA 3QZ5B 3GNFB 4KRTA 3CC7A 1JO8A 3G4ST 4FT2A 3BDLA 3EGXB 2KYMA 4J9EA 3L42A 5LJ3j 4J7FA 4X9CA 4RG8A 2LX9A 2M0OA 4RKUE 4QVDA 2RB6A 1YHQT 1BU1A 2R5AA 4AMCA 1M8MA 1YIJA 3DKMA 4WTOB 1HXDA 2P84A 1VQKA 1VYVA 2YRVA 5AT1B 3V7RA 3E2UA 1VQ4T 3RERA 3MPUB 2RJCA 1XNIA 2P0PA 5LJ5d 3KUFA 5LJ3e 5CAIA 6AT1B 2YLCA 1AHJB 3VYGA 2DF6A 5KYXB 2CUDA 3JCMP 3UA7A 4XAXB 3WVDB 4A63B 5GAMd 5KYXA 3I56Q 1VQ5A 2DEUA 2L3QA 3FC3A 1AWXA 3TU4K 1M1KR 2CP5A 3L2ZA 5FWBA 1QP3A 4LD9K 4IUTA 4M78C 2EQKA 1EX4A 4J9DA 3CPFA 5CCAA 2NYSA 4JJCA 2NWMA 3LGFA 4XTZA 4QQGA 2DRMA 4C92E 2QQSA 3OYAA 2ROLA 1W2BP 2EQMA 3O8VA 1IB8A 1UJYA 1IRXA 4OB1B 1S72T 1ZLMA 4R55A 4ME7A 2L3PA 4BB7A 1VQOQ 1GCQA 3A8OB 1VQ9A 1T3LA 4C8QG 2VGNA 2FYKA 2NUZA 3CCLT 1J3TA 1AEYA 1VQNT 3CD6Q 1ACMB 1W4SA 4F16A 5GAOn 1Z9ZA 4KUIA 1WXTA 2RA2A 4EMHA 5LJ5e 1GBQA 2LNHB 2KNBB 2QTVA 4LDUA 4DEXA 4C92B 3A8LB 2KYBA 3CCJA 2DETA 3A1PA 4BD3A 3CCQA 4C92A 1PWTA 3EG3A 1UEBA 2HCKA 1PHTA 1UG1A 2K3XA 3G4SQ 2H3EB 4MMKA 1AT1B 1HYOA 1ZBXA 1MMNA 2VXEA 4O5VA 5IH2A 5FU6C 2CZ1B 2YDLA 4AG2C 1K9MC 2HL3A 4M7AD 3M4GA 1WI7A 3NTHA 1YHQQ 2RQRA 1Q82R 3J81E 3PVLA 1N8RC 3H0FA 2KBTA 1RI9A 2O01E 3CMEA 2OX7A 3MEUA 4EIKA 3SWNB 4BE0A 2EYWA 3SWNA 3THKA 4E7IA 1VQ4Q 2VB6A 2YUNA 2XG8D 1BIAA 2BE7D 2DE0X 4DEYA 1KD1U 1M5Q1 3OSSC 1RAAB 1YCYA 3VV0A 2O88A 3HPWA 3VKIA 4IIOA 1G3SA 3QWXX 1E6GA 2KT1A 1PCXA 3I55A 1NEBA 1V1CA 1D1AA 1UHFA 2BZXA 2MK5A 2RH2A 1RUWA 4BI4A 3QG1A 4KULA 2RM4A 2DYIA 2KE9A 4PJOC 1YJNT 1YNZA 2RQTA 4C5IA 4IURA 5GAOq 4PKCC 3JV3A 3CCUA 2BUDA 1S72Q 3M55A 3VYHB 1ZSZB 2VGMA 2CP0A 2LCLA 2LC4A 2FZKB 1D1CA 4IIMA 1ZSZA 2F5KA 4Z89A 2Y90A 5GANd 1BKBA 1NLOC 1UTIA 4FIBA 1M8VA 3CBOA 2E5KA 3JB9F 2GGRA 2E5QA 2YHTA 2F1LA 3OYNA 2F2WA 1K1ZA 1VQNQ 2ZGWA 1GXIE 4C5EA 1TUCA 3NGPA 4KH0B 2EKHA 3H0IA 5EC7A 2YUOA 2KT8A 1E6HA 2CT3A 2QYZA 1QLYA 1RABB 2LJ0A 2DXCA 1Q81C 1BCMA 2QQAA 2EVRA 4QKUA 4FSSA 1VQKT 3PTAA 2XHCA 4FYWB 3QSUA 4C8QC 1JJ2S 3VS3A 2PZ1A 1KC8U 4FYVB 1JQQA 3R6NA 2DA9A 1KQSS 1YJWT 2FPFA 4ESRA 1BB9A 3S3MA 5GAN8 1QVFS 1AWOA 1BIBA 5D6YA 1I5LA 1QWEA 2DL8A 4BY6B 1QVGA 3V7CA 3H41A 5J3BA 3J7AF 5GAOr 1VQ6A 3I56A 5GANe 2J6KA 3JB9J 1NEGA 2JNGA 1UFFA 4JPBW 4ATOA 2K3YA 2KI7A 4C5HA 1VQ7T 3HFNA 4NS5A 2LQWA 3TQ7P 1VQOA 3RMQA 1VQ9T 5A0DA 3OYKA 4OVAA 2WSCE 1N5ZA 1M90U 1NLPC 2XI9A 5C0MA 2WSFE 3S3OA 2OTJA 5DLOA 4IUQA 4J6YA 3DB3A 1CKBA 1YJNQ 4JJBA 3KFVA 1GCPA 3CEYA 4LXCA 1G3TA 2OTLQ 3H8ZA 1W70A 2LJ1A 2D0QB 1WA7A 5IHIA 1Q7YC 1M4ZA 1FMVA 4E7LA 3X25B 2LJ3A 2LQNA 2KXDA 3P8HA 3CCQT 3OYBA 4IUPA 2IPOB 4M7DD 3EFSA 3EAEA 3PNWC 3NMZC 1MNEA 2QXFA 4C92G 4VUBA 2QGFB 3G4SA 3FJPA 3VS2A 2XD0A 3OYIA 4HXJA 2HAXA 1AWJA 3M0UA 1NJIR 4OF1A 1MUZA 2FEIA 5A0LA 3OYGA 3L2QA 2HNIA 3E1SA 4J83A 1Y96B 4ZTJA 1YHQA 1Y96A 4PJLA 1TH7A 1U06A 2E3HA 2DKGA 3JB9H 3ULRB 2JTEA 4PJOA 3C94A 1EIFA 3ZBDA 5IAYA 4DBFA 3OYCA 3HRUA 2JW4A 1TOVA 1VQ4A 2DXTA 2QDYB 2RI5A 1YJWQ 2MAMA 4IUUA 2K5IA 2C0TA 4M77E 1D3BA 3SD4A 2EQJA 2GCXA 4FU6A 3CCRT 1Y57A 2DBMA 1OPLA 1M30A 4KBMB 4ELYC 1FX7A 1X43A 1ZX6A 3EG9A 1G5VA 4KT0E 3I5SA 3UPUA 3UF4A 1XOVA 3RKXA 1ABQA 1VQ7Q 2I2LA 3RR6A 4C0ZA 2ROTA 2GNCA 2D9TA 5GMKi 1M1KU 4PJMA 1X6GA 1T3SA 1S72A 1JJ2A 3M58A 2KK4A 3M54A 2ZZDA 1AWWA 3QYGB 1VQ9Q 4IKFA 3Q1JA 1KQSA 1UGSB 1QVFA 1AOJA 4Z02A 1QCFA 4M77B 4FW2A 1QW1A 1VQNA 1RLPC 4V2SA 1Z9QA 5ECAA 2KSSA 4L5GA 1M9SA 2OI3A 2QTXA 3E19A 3NHNA 3BDUA 5GAN2 5IHNA 5GAOl 1PD1A 2KGTA 1H641 3RDVA 1D0ZA 3EHQA 2X4WA 1KHCA 2NUTB 2DL3A 2YRDA 2RHZA 1TUDA 4M7AF 3DB4A 1Y0MA 3EGDB 2NUTA 2CSQA 2X3WD 5LJ3g 1O75A 2XU8A 4CC7A 1KD1C 1PRLC 3CPWP 3CQTA 1G2BA 2GFUA 4RG2A 4FT4A 2VKNA 5CKBA 3OYDA 2Z0WA 1A0NB 3HKSA 2V8KA 3A8GB 2AZSA 2D8JA 1X75C 1VQ6T 3OBWA 4CRIA 1OZ2A 3QKJA 1Q95G 2R5MA 2LMJA 4RTXA 1NBEB 5CK9A 1Q81U 1TG0A 1SHGA 3RUXA 2KQWA 1Q82U 4C92C 3HL8A 2OJ2A 3G71T 1MNDA 1SSHA 1D1BA 1I81A 2H3JA 2DK3A 3PVQA 1GL5A 1OX9A 2X9HA 1PKSA 2HBPA 1GFDA 1BCOA 2FL7A 3CCRQ 1QCNA 4E7SA 2OTJT 4FYXB 2WSEE 4XU3A 2RD1A 5LJ5g 2GF7A 1YJNA 4PLIA 2DZCA 4ANJA 3SWNC 2OTLA 4M77F 3QIIA 5I22A 5IXFA 2YSQA 2LCCA 2KY9A 2J05A 3VRYA 4J6XA 4M75D 1D0YA 3QO3A 2CKKA 4AFSC 3JCMJ 5GAN7 3GNGA 1M1GA 3QWYA 3R6OA 5CIUA 2JMAA 4BDYA 4WCIA 1KC8C 2EFIA 4LUDA 2M02A 2DILA 3EGXA 4C0DC 5GAN3 2RJEA 4JZ4A 2HQXA 4LE9A 1IHVA 1KHIA 1M3AA 1WJSA 5GAOm 2GFAA 5CKHA 1XQHA 3LX7A 1GBRA 5KYNA 3EGUA 3G6EQ 1Q7YU 3CMAT 2NUPB 2D1XA 3S6WA 3OW2P 1KFZA 5LJ3f 4M78D 4ZTFA 4GLMA 2DVEA 4L59A 2LVMA 5I21A 4PJOG 1ZSZC 4OGEA 3L2VA 2H8HA 2DIGA 2KRSA 1QWFA 1YJWA 3T9NA 3FJ5A 3EFOB 1Q86R 1D0XA 3EFOA 4J9HA 1VQ6Q 4NL3A 3PE0A 4MMLA 3X24B 3HSBA 2DFUA 3OBYA 5LJ3h 1M90C 2WACA 1B3QA 2KRNA 3EFRA 4OB3B 3SDZA 1UGQB 1KG1A 4RTTA 2XIDA 3G71Q 3M4YA 3MP6A 4FL6A 5LJ5j 5I2MA 1VQ7A 2DTHA 2K6DA 4FSXA 4RTVA 2XDPA 2M9UA 1BI3A 2YLBA 2CGHA 3UATA 3UDCA 2E70A 3FB9A 4J9CA 4PNOA 5GAMj 2AHJB 4OP0A 2YUQA 1MMDA 3MJXA 3PGGA 8AT1B 2EJ9A 2JJ9A 4HT8A 4Z8AA 2RHIA 2OTJQ 4OB2B 4KUDK 5LJ5f 2SEMA 1VOMA 4RUGA 4BY6C 3QJ6A 1SRLA 3OS1A 4LDYA 3VS1A 2VXFA 1SHFA 2X35A 2DTIA 1WLPB 3M0SA 1UHCA 5AYFA 3EH2A 1VQPQ 4M7DF 2D8HA 5C6SA 4J9BA 2MWOA 5GAMe 3OMGA 4F7UF 2EYXA 3MEAA 5LJ5h 3TSWA 1TWBA 4KGXB 2AKKA 2COWA 4ZGDB 4OMLA 3M0QA 2D0NA 2RK2A 3OYLA 4Y92A 1BI0A 2CP7A 1OU9A 2VYTA 1OOTA 4LNPA 2ED1A 3FIFA 3CMAQ 1QQJA 2HKNA 1YFNA 3MEWA 3OYMA 2EJGA 5FWCA 3CXCS 2KAFA 2K57A 2R57A 4OGCA 1RL2A 2ZPGB 2J6OA 5KYWB 4PJOD 3CCST 1WIEA 2X4XA 2CZ0B 2EJFA 4DBHA 3JCMd 1M1KC 3JCMQ 4ZGEB 2CH4W 2JXBA 1MHNA 2GQVA 4XTYA 4C0DB 4LUEA 3M0TA 2X4JA 3CCRA 4GLKA 1H3ZA 3MP1A 3DLMA 2A0FB 1M2OA 1LVKA 5KYYB 1AZEA 4M7AC 4N4GA 4HA8A 1ZUKA 2L0AA 5KYYA 4MZTA 4RCCA 3A5ZB 4OMMA 4AFZC 2OTLT 2V8JA 5HKCA 3V8JA 3LWIA 4EMGA 1OX8A 4PFZA 2LQ8A 4XU1A 3CC2T 3LH0A 4E7KA 2XDBA 2QDLA 2G3RA 1D09B 5L23A 4C8QD 1U8RA 1VYTA 1UGRB 2JT4A 3HRTA 2MWPA 2FZGB 2SRCA 4HVVA 4JRPA 4ELZC 3E9FA 1S1NA 1I07A 3JCMe 1X6OA 2O2OA 2FVUA 1WQWA 4ZGJB 5GANj 2L5QA 4E2FB 1W2BS 3G6EA 4QT7A 3C12A 3C0CA 5D6XA 2DZ9A 4J6WA 1UJ0A 4JRQA 2CH4A 1WHHA 1Q82C 5GAN4 2PVDB 4R0KA 2VASA 1LOJA 1OYXA 5FU7B 1GRIA 1WJRA 4A4EA 3C95A 2DRKA 2M1HA 3GPLA 4M77C 2JOYA 3FRNA 1AZGB 2O9SA 1CKAA 5GMKj 1MV3A 2ZPIB 2QAZA 2HQHA 1X6BA 2GTJA 2MOXA 3CC4A 2CSIA 1JEGA 2R58A 1BK2A 4BACA 1EFNA 3SEMA 3CCSQ 3BE3A 2FHDA 2FB7A 4MDWA 3V8LA 4DQ2A 5GANh 4DOWA 3G71A 4J8OA 3JCMV 4KGZB 5GJWB 2YT6A 2CP2A 4CI0C 2DL4A 3REAB 4XU0A 1RAFB 1RLQC 1UGVA 3NTIA 1X01A 3P8BB 2DAQA 4HVUA 4QVCA 3L2WA 1R0CB 5GMKe 4PL6A 1AVZC 2JTFA 4KGVB 4MDXA 1ZA1B 1IO6A 3BFMA 3JCMW 4M7AE 1FYNA 3CXCA 3RBBB 4DBRA 2RHUA 1SF9A 1YBYA 4JJDA 1OZ3A 4M75F 3HRSA 2L3RA 3GBQA 1K73R 2A7YA 1IREB 3CC2Q 2ZPFB 1WNLA 4XU2A 1ZBJA 1VQPA 1ARKA 1MMAA 3SFMA 3JB9G 1Y7XA 4E6RA 1M2VB 2RQVA 1YI2T 1K8AR 2F69A 1M2VA 5CKDA 2RI3A 3OB9A 2AT1B 3RIRA 1HJDA 2XDDA 1VIEA 4HVWA 2X3XD 2IVWA 4X9DA 3HHTB 3KXTA 2ESWA 4M78F 2QEXT 4M7AB 2C06A 2J6FA 1KK7A 3CMAA 1MV0B 4X34A 4M7AA 2PQWA 3KBGA 1OI1A 3JB9I 3QJYA 2ZPBB 4E7ZA 4WF2A 2FRYA 3OYEA 1C0MA 1QCOA 1E7OA 4F04B 2ENMA 1N9SA 4ORZA 2FRWA 5KE2A 3X28B 4JLIA 1U3OA 2LRQA 4MZPA 4QVZA 5GAN6 3S3NA 5HCKA 3UWNA 2E65A 4AT1B 2X51A 4M7DC 1WXBA 1G3WA 4II1A 4ZNXA 3IQLA 4N4HA 2L8DA 4B9WA 1PKTA 2ZCFB 1Q86U 3UT1A
chains in the Genus database with same CATH topology
5I22A 5IXFA 2YSQA 1PWTA 3EG3A 2J05A 2RN8A 3VRYA 2HCKA 1PHTA 2J7IA 1UG1A 5IHKA 4CC3A 2ABLA 5IH2A 1WFWA 4AFSC 2FPDA 2DNUA 2EGCA 4K11A 2YDLA 3VS7A 4AG2C 2KEAA 3QWYA 2DL5A 2JMAA 4WCIA 1YP5A 2JS0A 1WI7A 2A37A 4LUDA 2K79A 3NPFA 1KSWA 2DILA 2RQRA 3PVLA 4JZ4A 2GTOA 2KXCA 2CDTA 2DMOA 3H0FA 2KBTA 4LE9A 2A28A 1RI9A 2B86A 1M3AA 4EIKA 1YCSB 1GBRA 2EYWA 3EGUA 2K7AA 4AFUC 2EGEA 1UUEA 3THKA 3A98A 2VVKA 2D1XA 2YUPA 1KFZA 4GLMA 2K3BA 2YUNA 3U23A 2DE0X 4DEYA 4OMNA 4OMPA 2O88A 2H8HA 2A36A 4IIOA 2KRSA 3QWXX 1QWFA 2DM1A 4GBQA 1E6GA 1NM7A 3FJ5A 4X1VA 1VA7A 2EQIA 2KT1A 1NEBA 2GBQA 2DYBA 4HCKA 4J9HA 1V1CA 1UHFA 2BZXA 2RMOA 1NYFA 2JMCA 1RUWA 3PE0A 3EHRA 3VS6A 2KE9A 1B3QA 2KRNA 2K9GA 2LX7A 1YNZA 2RQTA 1W6XA 1B07A 2DLPA 3JV3A 4RTTA 1X2KA 3EG1A 3REBB 1NYGA 2K6DA 4IIMA 4Z89A 1YWOA 4RTVA 1NLOC 1UTIA 2EBPA 3UATA 2E5KA 4J9CA 2W10A 2HBWA 2YUQA 2GGRA 3RNJA 2KROA 2F2WA 1K1ZA 1NG2A 4Z8AA 4AFQC 2JM9A 2SEMA 1TUCA 2BZ8A 2BZYA 2AZVA 3NGPA 3SHWA 4RUGA 1SRLA 2HEQA 2EKHA 3H0IA 1H8KA 1QKWA 1YWPA 5EC7A 2YUOA 3VS1A 2KT8A 1E6HA 1W1FA 2V1RA 2CT3A 1SHFA 3O5ZA 2CT4A 1QLYA 1WLPB 3M0SA 1UHCA 2LJ0A 1LCKA 1I0CA 1WX6A 2DL7A 2EVRA 4FSSA 2D8HA 3I9QA 2G6FX 4J9BA 3VS3A 1WDXA 4Z88A 2XMFA 2VWFA 1SPKA 2PZ1A 4RTZA 3UA6A 2EYXA 1JQQA 3TSWA 3R6NA 2AKKA 4OMLA 2DA9A 2FPFA 1VYUA 4ESRA 1BB9A 3M0QA 2W0ZA 2D0NA 5GJVB 4CC2A 1AWOA 2BTTA 4RTUA 1AD5A 1QWEA 2DL8A 4Y92A 3H41A 3H0HA 1K9AA 1OOTA 3EG2A 1ZUYA 3M0PA 4OMQA 2V1QA 2MIOA 4RTWA 4LNPA 2ED1A 2J6KA 1NEGA 1T0HA 1HD3A 1X69A 5FWCA 1UFFA 2AKLA 2EGAA 2EPDA 3ZL7C 4JPBW 2O9VA 4J9IA 2FG0A 1GFCA 1K4US 1OV3A 2J6OA 1WIEA 1BBZA 3TSZA 2LQWA 3VS5A 4M4ZA 2MCNA 2L2PA 1N5ZA 2L3SA 2RQWA 4RTYA 1NLPC 1UE9A 1X27A 2FPEA 2CH4W 2JXBA 3VS0A 4LUEA 3M0TA 1CKBA 4AG1C 5FW9A 4JJBA 3KFVA 1GCPA 3I35A 2HDAA 2KR3A 1W70A 2M51A 1QKXA 1AZEA 2LJ1A 1ZUKA 2JM8A 1WA7A 2L0AA 5IHIA 1KJWA 4OMMA 1I1JA 4AFZC 4CC4B 1GCQC 1ZSGA 1K76A 2LJ3A 2LQNA 4D8DA 1PNJA 2KXDA 1M27C 2A08A 3NMZC 2QDLA 3VS2A 4D8KA 4HXJA 2JS2A 2EW3A 1AWJA 2CUBA 3M0UA 5L23A 5IXBA 2OAWA 1T0JA 1MUZA 2FEIA 1VYTA 1HSQA 1PRMC 1H3HA 2JT4A 2RQUA 4OMOA 1KIKA 2DX1A 2SRCA 2DVJA 4HVVA 1JU5C 2F2VA 1U06A 1S1NA 1I07A 2J06A 2C0IA 2O2OA 3ULRB 2JTEA 4JZ3A 1OPKA 2ED0A 4QT7A 2JW4A 3C0CA 1UJ0A 2FO0A 2AK5A 2CH4A 1K0XA 2DJQA 1K0SA 4R0KA 2C0TA 1G83A 1GRIA 4F14A 2DRKA 1Y57A 2PTKA 2DBMA 1OPLA 2KRMA 1M30A 4J9FA 1WXUA 1M3BA 1X43A 1ZX6A 1OEBA 1UECA 1AZGB 2O9SA 2EYYA 1CKAA 3I5SA 3UF4A 1XOVA 1MV3A 1X6BA 1ABQA 2GTJA 2MOXA 2ROTA 2PNIA 2CSIA 1JEGA 2GNCA 1FMKA 1BK2A 1EFNA 3SEMA 2K2MA 3VRZA 1X6GA 1T3SA 1SEMA 1SRMA 1X2QA 1M3CA 1AWWA 4KRTA 1JO8A 3EG0A 1WYXA 2KYMA 4J9EA 5GJWB 2YT6A 1AOJA 3I5RA 2DL4A 3REAB 1QCFA 1RLQC 2DBKA 1UGVA 2GQIA 1ABOA 4HVUA 3VS4A 1RLPC 1BU1A 1YN8A 2RNAA 2F2XA 1AVZC 3M0RA 1JXOA 1Z9QA 1IO6A 2IIMA 5ECAA 3LH5A 2C0OA 1M8MA 1FYNA 2OI3A 3RBBB 3NHNA 2HSPA 1VYVA 4JJDA 5IHNA 2CREA 2KGTA 3GBQA 3EHQA 4LN2A 3TVTA 2DL3A 1ZBJA 1TUDA 1ARKA 1Y0MA 2CSQA 2X3WD 4E6RA 2I0NA 2DF6A 2RQVA 2CUDA 4CC7A 1PRLC 3UA7A 4A63B 3CQTA 1G2BA 2VKNA 2L3QA 1AWXA 1ZUUA 1A0NB 2RF0A 5FWBA 1HJDA 2AZSA 2D8JA 4HVWA 4J9DA 2X3XD 2RPNA 4JJCA 2ESWA 2NWMA 2DRMA 2LMJA 4RTXA 1H92A 2O31A 2ROLA 2J6FA 1MV0B 1TG0A 1UJYA 1SHGA 1ZLMA 2L3PA 2OJ2A 1U5SA 1SSHA 2FRYA 1GCQA 1E7OA 2ENMA 3PVQA 2LZ6B 4ORZA 2FRWA 1GL5A 1T3LA 1PKSA 5I11A 1U3OA 4J9GA 1GFDA 2ECZA 2M0YA 2NUZA 1J3TA 1AEYA 5HCKA 1JXMA 2LCSA 1UDLA 4F16A 2P4RA 1Z9ZA 1WXBA 4F17A 4ZNXA 1WXTA 1GBQA 3IQLA 2LP5A 2LNHB 2KNBB 1CSKA 2EYZA 1PKTA 4DEXA 2KYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I22 A;  5IXF A;  2YSQ A;  1PWT A;  3EG3 A;  2J05 A;  2RN8 A;  3VRY A;  2HCK A;  1PHT A;  2J7I A;  1UG1 A;  5IHK A;  4CC3 A;  2ABL A;  5IH2 A;  1WFW A;  4AFS C;  2FPD A;  2DNU A;  2EGC A;  4K11 A;  2YDL A;  3VS7 A;  4AG2 C;  2KEA A;  3QWY A;  2DL5 A;  2JMA A;  4WCI A;  1YP5 A;  2JS0 A;  1WI7 A;  2A37 A;  4LUD A;  2K79 A;  3NPF A;  1KSW A;  2DIL A;  2RQR A;  3PVL A;  4JZ4 A;  2GTO A;  2KXC A;  2CDT A;  2DMO A;  3H0F A;  2KBT A;  4LE9 A;  2A28 A;  1RI9 A;  2B86 A;  1M3A A;  4EIK A;  1YCS B;  1GBR A;  2EYW A;  3EGU A;  2K7A A;  4AFU C;  2EGE A;  1UUE A;  3THK A;  3A98 A;  2VVK A;  2D1X A;  2YUP A;  1KFZ A;  4GLM A;  2K3B A;  2YUN A;  3U23 A;  2DE0 X;  4DEY A;  4OMN A;  4OMP A;  2O88 A;  2H8H A;  2A36 A;  4IIO A;  2KRS A;  3QWX X;  1QWF A;  2DM1 A;  4GBQ A;  1E6G A;  1NM7 A;  3FJ5 A;  4X1V A;  1VA7 A;  2EQI A;  2KT1 A;  1NEB A;  2GBQ A;  2DYB A;  4HCK A;  4J9H A;  1V1C A;  1UHF A;  2BZX A;  2RMO A;  1NYF A;  2JMC A;  1RUW A;  3PE0 A;  3EHR A;  3VS6 A;  2KE9 A;  1B3Q A;  2KRN A;  2K9G A;  2LX7 A;  1YNZ A;  2RQT A;  1W6X A;  1B07 A;  2DLP A;  3JV3 A;  4RTT A;  1X2K A;  3EG1 A;  3REB B;  1NYG A;  2K6D A;  4IIM A;  4Z89 A;  1YWO A;  4RTV A;  1NLO C;  1UTI A;  2EBP A;  3UAT A;  2E5K A;  4J9C A;  2W10 A;  2HBW A;  2YUQ A;  2GGR A;  3RNJ A;  2KRO A;  2F2W A;  1K1Z A;  1NG2 A;  4Z8A A;  4AFQ C;  2JM9 A;  2SEM A;  1TUC A;  2BZ8 A;  2BZY A;  2AZV A;  3NGP A;  3SHW A;  4RUG A;  1SRL A;  2HEQ A;  2EKH A;  3H0I A;  1H8K A;  1QKW A;  1YWP A;  5EC7 A;  2YUO A;  3VS1 A;  2KT8 A;  1E6H A;  1W1F A;  2V1R A;  2CT3 A;  1SHF A;  3O5Z A;  2CT4 A;  1QLY A;  1WLP B;  3M0S A;  1UHC A;  2LJ0 A;  1LCK A;  1I0C A;  1WX6 A;  2DL7 A;  2EVR A;  4FSS A;  2D8H A;  3I9Q A;  2G6F X;  4J9B A;  3VS3 A;  1WDX A;  4Z88 A;  2XMF A;  2VWF A;  1SPK A;  2PZ1 A;  4RTZ A;  3UA6 A;  2EYX A;  1JQQ A;  3TSW A;  3R6N A;  2AKK A;  4OML A;  2DA9 A;  2FPF A;  1VYU A;  4ESR A;  1BB9 A;  3M0Q A;  2W0Z A;  2D0N A;  5GJV B;  4CC2 A;  1AWO A;  2BTT A;  4RTU A;  1AD5 A;  1QWE A;  2DL8 A;  4Y92 A;  3H41 A;  3H0H A;  1K9A A;  1OOT A;  3EG2 A;  1ZUY A;  3M0P A;  4OMQ A;  2V1Q A;  2MIO A;  4RTW A;  4LNP A;  2ED1 A;  2J6K A;  1NEG A;  1T0H A;  1HD3 A;  1X69 A;  5FWC A;  1UFF A;  2AKL A;  2EGA A;  2EPD A;  3ZL7 C;  4JPB W;  2O9V A;  4J9I A;  2FG0 A;  1GFC A;  1K4U S;  1OV3 A;  2J6O A;  1WIE A;  1BBZ A;  3TSZ A;  2LQW A;  3VS5 A;  4M4Z A;  2MCN A;  2L2P A;  1N5Z A;  2L3S A;  2RQW A;  4RTY A;  1NLP C;  1UE9 A;  1X27 A;  2FPE A;  2CH4 W;  2JXB A;  3VS0 A;  4LUE A;  3M0T A;  1CKB A;  4AG1 C;  5FW9 A;  4JJB A;  3KFV A;  1GCP A;  3I35 A;  2HDA A;  2KR3 A;  1W70 A;  2M51 A;  1QKX A;  1AZE A;  2LJ1 A;  1ZUK A;  2JM8 A;  1WA7 A;  2L0A A;  5IHI A;  1KJW A;  4OMM A;  1I1J A;  4AFZ C;  4CC4 B;  1GCQ C;  1ZSG A;  1K76 A;  2LJ3 A;  2LQN A;  4D8D A;  1PNJ A;  2KXD A;  1M27 C;  2A08 A;  3NMZ C;  2QDL A;  3VS2 A;  4D8K A;  4HXJ A;  2JS2 A;  2EW3 A;  1AWJ A;  2CUB A;  3M0U A;  5L23 A;  5IXB A;  2OAW A;  1T0J A;  1MUZ A;  2FEI A;  1VYT A;  1HSQ A;  1PRM C;  1H3H A;  2JT4 A;  2RQU A;  4OMO A;  1KIK A;  2DX1 A;  2SRC A;  2DVJ A;  4HVV A;  1JU5 C;  2F2V A;  1U06 A;  1S1N A;  1I07 A;  2J06 A;  2C0I A;  2O2O A;  3ULR B;  2JTE A;  4JZ3 A;  1OPK A;  2ED0 A;  4QT7 A;  2JW4 A;  3C0C A;  1UJ0 A;  2FO0 A;  2AK5 A;  2CH4 A;  1K0X A;  2DJQ A;  1K0S A;  4R0K A;  2C0T A;  1G83 A;  1GRI A;  4F14 A;  2DRK A;  1Y57 A;  2PTK A;  2DBM A;  1OPL A;  2KRM A;  1M30 A;  4J9F A;  1WXU A;  1M3B A;  1X43 A;  1ZX6 A;  1OEB A;  1UEC A;  1AZG B;  2O9S A;  2EYY A;  1CKA A;  3I5S A;  3UF4 A;  1XOV A;  1MV3 A;  1X6B A;  1ABQ A;  2GTJ A;  2MOX A;  2ROT A;  2PNI A;  2CSI A;  1JEG A;  2GNC A;  1FMK A;  1BK2 A;  1EFN A;  3SEM A;  2K2M A;  3VRZ A;  1X6G A;  1T3S A;  1SEM A;  1SRM A;  1X2Q A;  1M3C A;  1AWW A;  4KRT A;  1JO8 A;  3EG0 A;  1WYX A;  2KYM A;  4J9E A;  5GJW B;  2YT6 A;  1AOJ A;  3I5R A;  2DL4 A;  3REA B;  1QCF A;  1RLQ C;  2DBK A;  1UGV A;  2GQI A;  1ABO A;  4HVU A;  3VS4 A;  1RLP C;  1BU1 A;  1YN8 A;  2RNA A;  2F2X A;  1AVZ C;  3M0R A;  1JXO A;  1Z9Q A;  1IO6 A;  2IIM A;  5ECA A;  3LH5 A;  2C0O A;  1M8M A;  1FYN A;  2OI3 A;  3RBB B;  3NHN A;  2HSP A;  1VYV A;  4JJD A;  5IHN A;  2CRE A;  2KGT A;  3GBQ A;  3EHQ A;  4LN2 A;  3TVT A;  2DL3 A;  1ZBJ A;  1TUD A;  1ARK A;  1Y0M A;  2CSQ A;  2X3W D;  4E6R A;  2I0N A;  2DF6 A;  2RQV A;  2CUD A;  4CC7 A;  1PRL C;  3UA7 A;  4A63 B;  3CQT A;  1G2B A;  2VKN A;  2L3Q A;  1AWX A;  1ZUU A;  1A0N B;  2RF0 A;  5FWB A;  1HJD A;  2AZS A;  2D8J A;  4HVW A;  4J9D A;  2X3X D;  2RPN A;  4JJC A;  2ESW A;  2NWM A;  2DRM A;  2LMJ A;  4RTX A;  1H92 A;  2O31 A;  2ROL A;  2J6F A;  1MV0 B;  1TG0 A;  1UJY A;  1SHG A;  1ZLM A;  2L3P A;  2OJ2 A;  1U5S A;  1SSH A;  2FRY A;  1GCQ A;  1E7O A;  2ENM A;  3PVQ A;  2LZ6 B;  4ORZ A;  2FRW A;  1GL5 A;  1T3L A;  1PKS A;  5I11 A;  1U3O A;  4J9G A;  1GFD A;  2ECZ A;  2M0Y A;  2NUZ A;  1J3T A;  1AEY A;  5HCK A;  1JXM A;  2LCS A;  1UDL A;  4F16 A;  2P4R A;  1Z9Z A;  1WXB A;  4F17 A;  4ZNX A;  1WXT A;  1GBQ A;  3IQL A;  2LP5 A;  2LNH B;  2KNB B;  1CSK A;  2EYZ A;  1PKT A;  4DEX A;  2KYB A; 
#chains in the Genus database with same CATH topology
 1W2B A;  3ME9 A;  2RN8 A;  1QVP A;  2E12 A;  5GMK l;  5IHK A;  4N0A C;  2ABL A;  3MHX A;  1WPY A;  2FPD A;  2DNU A;  3AT1 B;  4K11 A;  3VS7 A;  2KEA A;  2V26 A;  3J80 E;  2DXB A;  2YWW A;  2JS0 A;  1YIT T;  3BY7 A;  3OA6 A;  2K79 A;  4L6V 5;  1RAH B;  3FDR A;  4B6M A;  2CDT A;  2HQE A;  2PVG B;  4M77 A;  3CCM A;  5CQX A;  2ATC B;  1N27 A;  1YCS B;  4BE2 A;  3CBM A;  2K7A A;  2EGE A;  1UUE A;  1WZO A;  2NLU A;  2P0K A;  3ZFJ A;  2JVV A;  2K3B A;  3LGL A;  4J5Y A;  1WHL A;  3G6E T;  4OMP A;  1NJI C;  2YXY A;  4A4H A;  3OS0 A;  1BI1 A;  1B34 B;  1YI2 Q;  2A36 A;  3A8M B;  1B34 A;  1KQ2 A;  3OYH A;  2COY A;  4X1V A;  1VA7 A;  4C92 D;  4R56 A;  3EGD A;  3VJP A;  2QQB A;  2RMO A;  3EHR A;  1OUL A;  3VS6 A;  3TEE A;  2QEX Q;  1W6X A;  3M9Q A;  1B07 A;  4YTL A;  2DLP A;  1R77 A;  3N5B B;  1PM3 A;  2QK0 A;  3CC4 T;  4FM4 B;  1VQM T;  1PSE A;  2RO0 A;  1VQ8 A;  2BE9 B;  1YWO A;  1QMC A;  3LW5 E;  3CCS A;  3M53 A;  1M1F A;  1WQ7 A;  2W10 A;  3RNJ A;  1SKU B;  2LT4 A;  3V8K A;  5J39 A;  1QVG P;  2KRO A;  2HSE B;  2RJD A;  2E1H A;  1NG2 A;  3JCM c;  2LNV A;  4OMF B;  4AFQ C;  3G1J A;  2JM9 A;  3SHW A;  2BZ8 A;  2BZY A;  4M7D E;  1H8K A;  2CP6 A;  4F7U E;  2V1R A;  5GMK m;  3QBY A;  3DLL A;  4JS5 A;  3MCA B;  1EZZ B;  1G8X A;  1I0C A;  1LCK A;  1WX6 A;  3I9Q A;  2G6F X;  3L2R A;  4PK4 A;  4Z88 A;  3JRZ A;  1TTH B;  1SPK A;  5GAM g;  1WHJ A;  1YIT Q;  4OB0 B;  3LWH A;  2FZC B;  3CC2 A;  1VQP T;  4C8Q F;  1YJ9 T;  5GJV B;  1VQL A;  2BTT A;  4RTU A;  1AD5 A;  4XQ3 A;  3H0H A;  1K9A A;  5LJ3 d;  2QA4 T;  5L8R E;  1JBM A;  3EG2 A;  1ZUY A;  3OYY A;  1PG5 B;  4OMQ A;  2V1Q A;  5CKF A;  2MIO A;  4RTW A;  4M7D B;  2VV5 A;  1T0H A;  2LT1 A;  4A54 A;  4M7D A;  1QP2 A;  4F7U B;  1LPL A;  2HKQ B;  2BKD N;  2EPD A;  2EGA A;  4F7U A;  3P8D A;  4J9I A;  1K4U S;  2E41 A;  1BBZ A;  2NUP A;  3TSZ A;  2MMP A;  4M7A G;  4N0A A;  4BI8 B;  4M4Z A;  5KH6 A;  2LTO A;  2L2P A;  1N9R A;  1B7T A;  2CP3 A;  4E7J A;  1TU0 B;  2L3S A;  4RTY A;  3F70 A;  5A0G A;  2QQR A;  2XKO C;  3CBP A;  1K9M R;  4JS4 A;  5A2Q E;  4NL2 A;  4M75 C;  3GLX A;  4AG1 C;  2MI6 A;  3WXM B;  4P5N A;  3OYF A;  3NFC A;  3D7S B;  2LQK A;  2KR3 A;  3CCV T;  2M51 A;  4FCY A;  1N8R R;  3CC4 Q;  2JM8 A;  5DM7 R;  1VQM Q;  3JAM E;  2MPX C;  1I5O B;  4CC4 B;  1K76 A;  1ZQ1 A;  2DIQ A;  4A4G A;  4QQD A;  3OS5 A;  3H9N A;  2AIR B;  2E10 A;  2EWN A;  4D8K A;  3RES A;  5KE3 A;  1FMW A;  2OAU A;  2CUB A;  5IXB A;  1T0J A;  2BIV A;  1XTD A;  1H3H A;  3CPW S;  5FU7 C;  2RQU A;  1KIK A;  3QDR B;  1ZHI A;  2Y4X A;  3JCM g;  3CCM T;  2A3L A;  2HZY A;  4JZ3 A;  5GAM f;  2ED0 A;  4M77 G;  2K2V A;  4JJN K;  1FXX A;  4RCB A;  1JJ2 P;  1MMG A;  2ZPE B;  4A53 A;  1IHW A;  2CS7 A;  1KQS P;  2FO0 A;  1ZA2 B;  2AK5 A;  1YJ9 Q;  2QAS A;  2K5F A;  1QVF P;  1JRI A;  2DJQ A;  5I2S A;  1QVG S;  4FYY B;  4KH1 B;  1LJO A;  1G83 A;  2QA4 Q;  2DXU A;  1YI2 A;  5CR2 A;  3AHU A;  1NZ9 A;  3A8H B;  2PTK A;  4Y91 A;  5GAM h;  1TSF A;  1WXU A;  1K73 U;  2X4Y A;  1UGP B;  2E3I A;  1OEB A;  1UEC A;  1BI2 A;  2EYY A;  1SSF A;  3QZ9 B;  1Y71 A;  5GAN g;  4BDZ A;  1K8A U;  2QEX A;  4EMK B;  2PNI A;  1FMK A;  3BW1 A;  4EMK A;  3SB2 A;  2DTO A;  2ZPH B;  3VRZ A;  1NJI U;  2YRC A;  1X2Q A;  1M3C A;  2MYS A;  1Q86 C;  2XK0 A;  1VQ8 T;  3EG0 A;  1Q81 R;  1WGS A;  1WYX A;  4JLG A;  3PMI A;  4Q5W A;  1WHK A;  3V7S A;  5KYW A;  3PT9 A;  4O6J A;  3I5R A;  5CQY A;  2DBK A;  2IG0 A;  2GQI A;  4LDW A;  4M75 E;  4B9X A;  1ABO A;  2VUB A;  3VS4 A;  3VUB A;  1YN8 A;  2RNA A;  2F2X A;  3FEO A;  1RI0 A;  3M0R A;  5EG2 A;  1JXO A;  3CCV Q;  2IIM A;  3LH5 A;  2C0O A;  4HCB A;  3RKW A;  2PUK B;  3QDF A;  3VUZ A;  2HSP A;  4QQ6 A;  3OS2 A;  3LYI A;  2RI2 A;  2CRE A;  2D6F A;  2L89 A;  2P0Q A;  1NPR A;  8ATC B;  3OW2 S;  1O9S A;  4LN2 A;  3QXE B;  3TVT A;  1TXQ A;  3OQ5 A;  2I0N A;  2RHX A;  1KQ1 A;  4M78 E;  1YIT A;  4XTW A;  3CCE T;  1VQL T;  2P4T A;  4QW2 A;  1PC0 A;  3JCM f;  1ZUU A;  2RF0 A;  3OMC A;  4M75 B;  3PFS A;  5D7U A;  2RPN A;  3CCM Q;  4Y28 E;  2CYZ B;  4M75 A;  1H92 A;  5IN1 A;  2O31 A;  4M77 D;  3WVE B;  4M7D G;  3OSV A;  3MEV A;  1U5S A;  2E64 A;  3CC7 T;  1DJ7 B;  4F7U G;  3CCL Q;  1BYM A;  2LZ6 B;  3GF5 A;  3JCM h;  1Q7Y R;  1C1A A;  1V76 A;  4C92 F;  5FRO A;  4JUV A;  3OYJ A;  5I11 A;  3ER0 A;  4J9G A;  2KMT A;  2ECZ A;  2M0Y A;  1R8O B;  4IUV A;  4M78 B;  2PU9 B;  1JXM A;  3MO8 A;  1RAE B;  3CPW A;  2KVQ G;  2LCS A;  3RMS A;  5GAN f;  1UDL A;  1RAI B;  4M78 A;  1R0B G;  1NE8 A;  1TUG B;  4JRI A;  1XJW B;  2P4R A;  5IT9 E;  4F17 A;  2XIC A;  2DPP B;  1YIJ T;  2LP5 A;  1CSK A;  1I4K 1;  2EYZ A;  4PLL A;  4PJJ A;  5CO7 A;  4C0G A;  4C5G A;  2PUO B;  1VQ8 Q;  4C0F A;  2J7I A;  1VQM A;  4CC3 A;  4MZM A;  1WFW A;  2EGC A;  4HKE A;  2DL5 A;  1YP5 A;  1VQ5 T;  2A37 A;  2E6N A;  4DBQ A;  3NPF A;  1KSW A;  9ATC B;  5FRN A;  2GTO A;  2KDS A;  4LDV A;  2KXC A;  3LLR A;  3HP9 A;  2DMO A;  3URG A;  2A28 A;  2B8A A;  2B86 A;  3PIP A;  3PIO A;  3HTR A;  5HY6 A;  1F1B B;  2Y4Y A;  1LNX A;  5KCH A;  4AFU C;  1WJQ A;  3A98 A;  2VVK A;  2YUP A;  2HMA A;  2JTM A;  3PMT A;  1G3Y A;  5GMK h;  3U23 A;  5FU6 B;  4JRK A;  2DER A;  4OMN A;  4GY5 A;  2K4Y A;  4BE1 A;  5J26 A;  3TRE A;  3QPH A;  3CCE Q;  3JCM b;  2DM1 A;  4GBQ A;  1VQL Q;  1YJ9 A;  2QQ9 A;  1NM7 A;  2EQI A;  2GBQ A;  5GAO p;  3GP8 A;  1WHM A;  2DYB A;  4HCK A;  4PJO E;  3QYH B;  1IGQ A;  1NYF A;  2JMC A;  3L2U A;  2QA4 A;  3CD6 A;  4XTU A;  1IXD A;  2K9G A;  2LX7 A;  4FW1 A;  2JN0 A;  2VC8 A;  5FRM A;  2HL5 C;  2DO3 A;  4UC4 A;  2RK1 A;  1FWZ A;  3CCJ T;  1X2K A;  3EG1 A;  4NOY A;  3G7Z A;  3REB B;  2QI2 A;  3CC7 Q;  1RAC B;  2MF2 A;  1VUB A;  1NYG A;  2F5T X;  3OW2 A;  2EBP A;  4TVR A;  2M16 A;  5HK3 A;  1P92 A;  3GIB A;  2HBW A;  1N6A A;  7AT1 B;  4BUG A;  2AZV A;  4EDU A;  3GOX A;  2HEQ A;  3OY9 A;  4PJO B;  5CKE A;  3CME T;  4BI3 A;  1YIJ Q;  1U1T A;  1KD1 R;  1QKW A;  1YWP A;  2RHY A;  1W1F A;  2LDM A;  5HK0 A;  1VQK Q;  3O5Z A;  4ZN3 A;  2CT4 A;  2QG9 B;  4C8Q E;  3M59 A;  1TS9 A;  3CCV A;  2HD0 A;  2EIF A;  3X26 B;  2DL7 A;  1K9M U;  5DLQ E;  1RAD B;  2EAY A;  1D3B B;  1WDX A;  4HCC A;  2XMF A;  2E4H A;  2VWF A;  4RTZ A;  3UA6 A;  1VQ5 Q;  2V8I A;  1VYU A;  2COZ A;  3MET A;  4LDX A;  2W0Z A;  1N8R U;  4CC2 A;  4J7I A;  4HCZ A;  3I55 T;  3M56 A;  3EG9 B;  2DEQ A;  5CVI A;  5D6W A;  5M9O A;  2DJZ A;  5KYU B;  3M0P A;  5KYU A;  2PVO B;  4LD6 A;  1SG5 A;  1HK9 A;  3HFO A;  3CCU T;  1K73 C;  1HD3 A;  2RJF A;  3JCM X;  1X69 A;  2AKL A;  3ZL7 C;  4A4F A;  3E9G A;  4M75 G;  4C8Q B;  1Y07 A;  2QGG A;  2JZ2 A;  2O9V A;  3C4S A;  3H6Z A;  4D6W A;  2FG0 A;  1GFC A;  4XTV A;  1OV3 A;  4C8Q A;  1K8A C;  4ZN1 A;  3L1A A;  5FLX E;  3VS5 A;  2MCN A;  3CCL A;  3JB9 D;  2RQW A;  4JDS A;  1UE9 A;  1X27 A;  2FPE A;  3VS0 A;  5GAN 5;  1IGU A;  4E7H A;  5FW9 A;  1KC8 R;  2DD4 A;  1VIF A;  3I35 A;  4XK8 E;  2HDA A;  3CCJ Q;  2CZ7 B;  3VU3 C;  1IZ6 A;  4PJN A;  3CCQ Q;  4M78 G;  1QKX A;  3M5A A;  2EQU A;  1KJW A;  4XTX A;  3EH1 A;  4EPC A;  5LL6 S;  3RKY A;  1NPP A;  2EKO A;  3MP8 A;  1I1J A;  1U1S A;  1GCQ C;  1ZSG A;  1V29 B;  4N4I A;  3QUI A;  4D8D A;  1PNJ A;  4HT9 A;  1M27 C;  4PJO F;  4PFP A;  2A08 A;  4DA4 A;  2JS2 A;  2EW3 A;  3M57 A;  2DD5 A;  2OAW A;  2O4X B;  2CZ6 B;  1HSQ A;  1PRM C;  3CME Q;  2O4X A;  3I56 T;  4OMO A;  1PSF A;  2DX1 A;  4PFO A;  2DVJ A;  1JU5 C;  2JUF A;  2F2V A;  2J06 A;  1UB4 A;  2C0I A;  1I8F A;  3ZEH A;  1OPK A;  1JB0 E;  3ASK A;  1WHG A;  1M90 R;  3QHS A;  4DOV A;  5DY9 A;  4E47 A;  1MGQ A;  2K5L A;  4EMK C;  3FLG A;  4A4K A;  3TCJ A;  1OQK A;  1VQO T;  3I55 Q;  1K0X A;  1C6V X;  1K0S A;  3INZ A;  3X20 B;  4F14 A;  1RAG B;  3CCE A;  3JSC A;  2KRM A;  4J9F A;  2EYQ A;  1M3B A;  3CCU Q;  5KCO A;  3CD6 T;  2ZAE A;  3CXC P;  3NTK A;  3MKD A;  1OU8 A;  1PD0 A;  2E6Z A;  2K2M A;  4RMO A;  1SEM A;  1SRM A;  3QZ5 B;  3GNF B;  4KRT A;  3CC7 A;  1JO8 A;  3G4S T;  4FT2 A;  3BDL A;  3EGX B;  2KYM A;  4J9E A;  3L42 A;  5LJ3 j;  4J7F A;  4X9C A;  4RG8 A;  2LX9 A;  2M0O A;  4RKU E;  4QVD A;  2RB6 A;  1YHQ T;  1BU1 A;  2R5A A;  4AMC A;  1M8M A;  1YIJ A;  3DKM A;  4WTO B;  1HXD A;  2P84 A;  1VQK A;  1VYV A;  2YRV A;  5AT1 B;  3V7R A;  3E2U A;  1VQ4 T;  3RER A;  3MPU B;  2RJC A;  1XNI A;  2P0P A;  5LJ5 d;  3KUF A;  5LJ3 e;  5CAI A;  6AT1 B;  2YLC A;  1AHJ B;  3VYG A;  2DF6 A;  5KYX B;  2CUD A;  3JCM P;  3UA7 A;  4XAX B;  3WVD B;  4A63 B;  5GAM d;  5KYX A;  3I56 Q;  1VQ5 A;  2DEU A;  2L3Q A;  3FC3 A;  1AWX A;  3TU4 K;  1M1K R;  2CP5 A;  3L2Z A;  5FWB A;  1QP3 A;  4LD9 K;  4IUT A;  4M78 C;  2EQK A;  1EX4 A;  4J9D A;  3CPF A;  5CCA A;  2NYS A;  4JJC A;  2NWM A;  3LGF A;  4XTZ A;  4QQG A;  2DRM A;  4C92 E;  2QQS A;  3OYA A;  2ROL A;  1W2B P;  2EQM A;  3O8V A;  1IB8 A;  1UJY A;  1IRX A;  4OB1 B;  1S72 T;  1ZLM A;  4R55 A;  4ME7 A;  2L3P A;  4BB7 A;  1VQO Q;  1GCQ A;  3A8O B;  1VQ9 A;  1T3L A;  4C8Q G;  2VGN A;  2FYK A;  2NUZ A;  3CCL T;  1J3T A;  1AEY A;  1VQN T;  3CD6 Q;  1ACM B;  1W4S A;  4F16 A;  5GAO n;  1Z9Z A;  4KUI A;  1WXT A;  2RA2 A;  4EMH A;  5LJ5 e;  1GBQ A;  2LNH B;  2KNB B;  2QTV A;  4LDU A;  4DEX A;  4C92 B;  3A8L B;  2KYB A;  3CCJ A;  2DET A;  3A1P A;  4BD3 A;  3CCQ A;  4C92 A;  1PWT A;  3EG3 A;  1UEB A;  2HCK A;  1PHT A;  1UG1 A;  2K3X A;  3G4S Q;  2H3E B;  4MMK A;  1AT1 B;  1HYO A;  1ZBX A;  1MMN A;  2VXE A;  4O5V A;  5IH2 A;  5FU6 C;  2CZ1 B;  2YDL A;  4AG2 C;  1K9M C;  2HL3 A;  4M7A D;  3M4G A;  1WI7 A;  3NTH A;  1YHQ Q;  2RQR A;  1Q82 R;  3J81 E;  3PVL A;  1N8R C;  3H0F A;  2KBT A;  1RI9 A;  2O01 E;  3CME A;  2OX7 A;  3MEU A;  4EIK A;  3SWN B;  4BE0 A;  2EYW A;  3SWN A;  3THK A;  4E7I A;  1VQ4 Q;  2VB6 A;  2YUN A;  2XG8 D;  1BIA A;  2BE7 D;  2DE0 X;  4DEY A;  1KD1 U;  1M5Q 1;  3OSS C;  1RAA B;  1YCY A;  3VV0 A;  2O88 A;  3HPW A;  3VKI A;  4IIO A;  1G3S A;  3QWX X;  1E6G A;  2KT1 A;  1PCX A;  3I55 A;  1NEB A;  1V1C A;  1D1A A;  1UHF A;  2BZX A;  2MK5 A;  2RH2 A;  1RUW A;  4BI4 A;  3QG1 A;  4KUL A;  2RM4 A;  2DYI A;  2KE9 A;  4PJO C;  1YJN T;  1YNZ A;  2RQT A;  4C5I A;  4IUR A;  5GAO q;  4PKC C;  3JV3 A;  3CCU A;  2BUD A;  1S72 Q;  3M55 A;  3VYH B;  1ZSZ B;  2VGM A;  2CP0 A;  2LCL A;  2LC4 A;  2FZK B;  1D1C A;  4IIM A;  1ZSZ A;  2F5K A;  4Z89 A;  2Y90 A;  5GAN d;  1BKB A;  1NLO C;  1UTI A;  4FIB A;  1M8V A;  3CBO A;  2E5K A;  3JB9 F;  2GGR A;  2E5Q A;  2YHT A;  2F1L A;  3OYN A;  2F2W A;  1K1Z A;  1VQN Q;  2ZGW A;  1GXI E;  4C5E A;  1TUC A;  3NGP A;  4KH0 B;  2EKH A;  3H0I A;  5EC7 A;  2YUO A;  2KT8 A;  1E6H A;  2CT3 A;  2QYZ A;  1QLY A;  1RAB B;  2LJ0 A;  2DXC A;  1Q81 C;  1BCM A;  2QQA A;  2EVR A;  4QKU A;  4FSS A;  1VQK T;  3PTA A;  2XHC A;  4FYW B;  3QSU A;  4C8Q C;  1JJ2 S;  3VS3 A;  2PZ1 A;  1KC8 U;  4FYV B;  1JQQ A;  3R6N A;  2DA9 A;  1KQS S;  1YJW T;  2FPF A;  4ESR A;  1BB9 A;  3S3M A;  5GAN 8;  1QVF S;  1AWO A;  1BIB A;  5D6Y A;  1I5L A;  1QWE A;  2DL8 A;  4BY6 B;  1QVG A;  3V7C A;  3H41 A;  5J3B A;  3J7A F;  5GAO r;  1VQ6 A;  3I56 A;  5GAN e;  2J6K A;  3JB9 J;  1NEG A;  2JNG A;  1UFF A;  4JPB W;  4ATO A;  2K3Y A;  2KI7 A;  4C5H A;  1VQ7 T;  3HFN A;  4NS5 A;  2LQW A;  3TQ7 P;  1VQO A;  3RMQ A;  1VQ9 T;  5A0D A;  3OYK A;  4OVA A;  2WSC E;  1N5Z A;  1M90 U;  1NLP C;  2XI9 A;  5C0M A;  2WSF E;  3S3O A;  2OTJ A;  5DLO A;  4IUQ A;  4J6Y A;  3DB3 A;  1CKB A;  1YJN Q;  4JJB A;  3KFV A;  1GCP A;  3CEY A;  4LXC A;  1G3T A;  2OTL Q;  3H8Z A;  1W70 A;  2LJ1 A;  2D0Q B;  1WA7 A;  5IHI A;  1Q7Y C;  1M4Z A;  1FMV A;  4E7L A;  3X25 B;  2LJ3 A;  2LQN A;  2KXD A;  3P8H A;  3CCQ T;  3OYB A;  4IUP A;  2IPO B;  4M7D D;  3EFS A;  3EAE A;  3PNW C;  3NMZ C;  1MNE A;  2QXF A;  4C92 G;  4VUB A;  2QGF B;  3G4S A;  3FJP A;  3VS2 A;  2XD0 A;  3OYI A;  4HXJ A;  2HAX A;  1AWJ A;  3M0U A;  1NJI R;  4OF1 A;  1MUZ A;  2FEI A;  5A0L A;  3OYG A;  3L2Q A;  2HNI A;  3E1S A;  4J83 A;  1Y96 B;  4ZTJ A;  1YHQ A;  1Y96 A;  4PJL A;  1TH7 A;  1U06 A;  2E3H A;  2DKG A;  3JB9 H;  3ULR B;  2JTE A;  4PJO A;  3C94 A;  1EIF A;  3ZBD A;  5IAY A;  4DBF A;  3OYC A;  3HRU A;  2JW4 A;  1TOV A;  1VQ4 A;  2DXT A;  2QDY B;  2RI5 A;  1YJW Q;  2MAM A;  4IUU A;  2K5I A;  2C0T A;  4M77 E;  1D3B A;  3SD4 A;  2EQJ A;  2GCX A;  4FU6 A;  3CCR T;  1Y57 A;  2DBM A;  1OPL A;  1M30 A;  4KBM B;  4ELY C;  1FX7 A;  1X43 A;  1ZX6 A;  3EG9 A;  1G5V A;  4KT0 E;  3I5S A;  3UPU A;  3UF4 A;  1XOV A;  3RKX A;  1ABQ A;  1VQ7 Q;  2I2L A;  3RR6 A;  4C0Z A;  2ROT A;  2GNC A;  2D9T A;  5GMK i;  1M1K U;  4PJM A;  1X6G A;  1T3S A;  1S72 A;  1JJ2 A;  3M58 A;  2KK4 A;  3M54 A;  2ZZD A;  1AWW A;  3QYG B;  1VQ9 Q;  4IKF A;  3Q1J A;  1KQS A;  1UGS B;  1QVF A;  1AOJ A;  4Z02 A;  1QCF A;  4M77 B;  4FW2 A;  1QW1 A;  1VQN A;  1RLP C;  4V2S A;  1Z9Q A;  5ECA A;  2KSS A;  4L5G A;  1M9S A;  2OI3 A;  2QTX A;  3E19 A;  3NHN A;  3BDU A;  5GAN 2;  5IHN A;  5GAO l;  1PD1 A;  2KGT A;  1H64 1;  3RDV A;  1D0Z A;  3EHQ A;  2X4W A;  1KHC A;  2NUT B;  2DL3 A;  2YRD A;  2RHZ A;  1TUD A;  4M7A F;  3DB4 A;  1Y0M A;  3EGD B;  2NUT A;  2CSQ A;  2X3W D;  5LJ3 g;  1O75 A;  2XU8 A;  4CC7 A;  1KD1 C;  1PRL C;  3CPW P;  3CQT A;  1G2B A;  2GFU A;  4RG2 A;  4FT4 A;  2VKN A;  5CKB A;  3OYD A;  2Z0W A;  1A0N B;  3HKS A;  2V8K A;  3A8G B;  2AZS A;  2D8J A;  1X75 C;  1VQ6 T;  3OBW A;  4CRI A;  1OZ2 A;  3QKJ A;  1Q95 G;  2R5M A;  2LMJ A;  4RTX A;  1NBE B;  5CK9 A;  1Q81 U;  1TG0 A;  1SHG A;  3RUX A;  2KQW A;  1Q82 U;  4C92 C;  3HL8 A;  2OJ2 A;  3G71 T;  1MND A;  1SSH A;  1D1B A;  1I81 A;  2H3J A;  2DK3 A;  3PVQ A;  1GL5 A;  1OX9 A;  2X9H A;  1PKS A;  2HBP A;  1GFD A;  1BCO A;  2FL7 A;  3CCR Q;  1QCN A;  4E7S A;  2OTJ T;  4FYX B;  2WSE E;  4XU3 A;  2RD1 A;  5LJ5 g;  2GF7 A;  1YJN A;  4PLI A;  2DZC A;  4ANJ A;  3SWN C;  2OTL A;  4M77 F;  3QII A;  5I22 A;  5IXF A;  2YSQ A;  2LCC A;  2KY9 A;  2J05 A;  3VRY A;  4J6X A;  4M75 D;  1D0Y A;  3QO3 A;  2CKK A;  4AFS C;  3JCM J;  5GAN 7;  3GNG A;  1M1G A;  3QWY A;  3R6O A;  5CIU A;  2JMA A;  4BDY A;  4WCI A;  1KC8 C;  2EFI A;  4LUD A;  2M02 A;  2DIL A;  3EGX A;  4C0D C;  5GAN 3;  2RJE A;  4JZ4 A;  2HQX A;  4LE9 A;  1IHV A;  1KHI A;  1M3A A;  1WJS A;  5GAO m;  2GFA A;  5CKH A;  1XQH A;  3LX7 A;  1GBR A;  5KYN A;  3EGU A;  3G6E Q;  1Q7Y U;  3CMA T;  2NUP B;  2D1X A;  3S6W A;  3OW2 P;  1KFZ A;  5LJ3 f;  4M78 D;  4ZTF A;  4GLM A;  2DVE A;  4L59 A;  2LVM A;  5I21 A;  4PJO G;  1ZSZ C;  4OGE A;  3L2V A;  2H8H A;  2DIG A;  2KRS A;  1QWF A;  1YJW A;  3T9N A;  3FJ5 A;  3EFO B;  1Q86 R;  1D0X A;  3EFO A;  4J9H A;  1VQ6 Q;  4NL3 A;  3PE0 A;  4MML A;  3X24 B;  3HSB A;  2DFU A;  3OBY A;  5LJ3 h;  1M90 C;  2WAC A;  1B3Q A;  2KRN A;  3EFR A;  4OB3 B;  3SDZ A;  1UGQ B;  1KG1 A;  4RTT A;  2XID A;  3G71 Q;  3M4Y A;  3MP6 A;  4FL6 A;  5LJ5 j;  5I2M A;  1VQ7 A;  2DTH A;  2K6D A;  4FSX A;  4RTV A;  2XDP A;  2M9U A;  1BI3 A;  2YLB A;  2CGH A;  3UAT A;  3UDC A;  2E70 A;  3FB9 A;  4J9C A;  4PNO A;  5GAM j;  2AHJ B;  4OP0 A;  2YUQ A;  1MMD A;  3MJX A;  3PGG A;  8AT1 B;  2EJ9 A;  2JJ9 A;  4HT8 A;  4Z8A A;  2RHI A;  2OTJ Q;  4OB2 B;  4KUD K;  5LJ5 f;  2SEM A;  1VOM A;  4RUG A;  4BY6 C;  3QJ6 A;  1SRL A;  3OS1 A;  4LDY A;  3VS1 A;  2VXF A;  1SHF A;  2X35 A;  2DTI A;  1WLP B;  3M0S A;  1UHC A;  5AYF A;  3EH2 A;  1VQP Q;  4M7D F;  2D8H A;  5C6S A;  4J9B A;  2MWO A;  5GAM e;  3OMG A;  4F7U F;  2EYX A;  3MEA A;  5LJ5 h;  3TSW A;  1TWB A;  4KGX B;  2AKK A;  2COW A;  4ZGD B;  4OML A;  3M0Q A;  2D0N A;  2RK2 A;  3OYL A;  4Y92 A;  1BI0 A;  2CP7 A;  1OU9 A;  2VYT A;  1OOT A;  4LNP A;  2ED1 A;  3FIF A;  3CMA Q;  1QQJ A;  2HKN A;  1YFN A;  3MEW A;  3OYM A;  2EJG A;  5FWC A;  3CXC S;  2KAF A;  2K57 A;  2R57 A;  4OGC A;  1RL2 A;  2ZPG B;  2J6O A;  5KYW B;  4PJO D;  3CCS T;  1WIE A;  2X4X A;  2CZ0 B;  2EJF A;  4DBH A;  3JCM d;  1M1K C;  3JCM Q;  4ZGE B;  2CH4 W;  2JXB A;  1MHN A;  2GQV A;  4XTY A;  4C0D B;  4LUE A;  3M0T A;  2X4J A;  3CCR A;  4GLK A;  1H3Z A;  3MP1 A;  3DLM A;  2A0F B;  1M2O A;  1LVK A;  5KYY B;  1AZE A;  4M7A C;  4N4G A;  4HA8 A;  1ZUK A;  2L0A A;  5KYY A;  4MZT A;  4RCC A;  3A5Z B;  4OMM A;  4AFZ C;  2OTL T;  2V8J A;  5HKC A;  3V8J A;  3LWI A;  4EMG A;  1OX8 A;  4PFZ A;  2LQ8 A;  4XU1 A;  3CC2 T;  3LH0 A;  4E7K A;  2XDB A;  2QDL A;  2G3R A;  1D09 B;  5L23 A;  4C8Q D;  1U8R A;  1VYT A;  1UGR B;  2JT4 A;  3HRT A;  2MWP A;  2FZG B;  2SRC A;  4HVV A;  4JRP A;  4ELZ C;  3E9F A;  1S1N A;  1I07 A;  3JCM e;  1X6O A;  2O2O A;  2FVU A;  1WQW A;  4ZGJ B;  5GAN j;  2L5Q A;  4E2F B;  1W2B S;  3G6E A;  4QT7 A;  3C12 A;  3C0C A;  5D6X A;  2DZ9 A;  4J6W A;  1UJ0 A;  4JRQ A;  2CH4 A;  1WHH A;  1Q82 C;  5GAN 4;  2PVD B;  4R0K A;  2VAS A;  1LOJ A;  1OYX A;  5FU7 B;  1GRI A;  1WJR A;  4A4E A;  3C95 A;  2DRK A;  2M1H A;  3GPL A;  4M77 C;  2JOY A;  3FRN A;  1AZG B;  2O9S A;  1CKA A;  5GMK j;  1MV3 A;  2ZPI B;  2QAZ A;  2HQH A;  1X6B A;  2GTJ A;  2MOX A;  3CC4 A;  2CSI A;  1JEG A;  2R58 A;  1BK2 A;  4BAC A;  1EFN A;  3SEM A;  3CCS Q;  3BE3 A;  2FHD A;  2FB7 A;  4MDW A;  3V8L A;  4DQ2 A;  5GAN h;  4DOW A;  3G71 A;  4J8O A;  3JCM V;  4KGZ B;  5GJW B;  2YT6 A;  2CP2 A;  4CI0 C;  2DL4 A;  3REA B;  4XU0 A;  1RAF B;  1RLQ C;  1UGV A;  3NTI A;  1X01 A;  3P8B B;  2DAQ A;  4HVU A;  4QVC A;  3L2W A;  1R0C B;  5GMK e;  4PL6 A;  1AVZ C;  2JTF A;  4KGV B;  4MDX A;  1ZA1 B;  1IO6 A;  3BFM A;  3JCM W;  4M7A E;  1FYN A;  3CXC A;  3RBB B;  4DBR A;  2RHU A;  1SF9 A;  1YBY A;  4JJD A;  1OZ3 A;  4M75 F;  3HRS A;  2L3R A;  3GBQ A;  1K73 R;  2A7Y A;  1IRE B;  3CC2 Q;  2ZPF B;  1WNL A;  4XU2 A;  1ZBJ A;  1VQP A;  1ARK A;  1MMA A;  3SFM A;  3JB9 G;  1Y7X A;  4E6R A;  1M2V B;  2RQV A;  1YI2 T;  1K8A R;  2F69 A;  1M2V A;  5CKD A;  2RI3 A;  3OB9 A;  2AT1 B;  3RIR A;  1HJD A;  2XDD A;  1VIE A;  4HVW A;  2X3X D;  2IVW A;  4X9D A;  3HHT B;  3KXT A;  2ESW A;  4M78 F;  2QEX T;  4M7A B;  2C06 A;  2J6F A;  1KK7 A;  3CMA A;  1MV0 B;  4X34 A;  4M7A A;  2PQW A;  3KBG A;  1OI1 A;  3JB9 I;  3QJY A;  2ZPB B;  4E7Z A;  4WF2 A;  2FRY A;  3OYE A;  1C0M A;  1QCO A;  1E7O A;  4F04 B;  2ENM A;  1N9S A;  4ORZ A;  2FRW A;  5KE2 A;  3X28 B;  4JLI A;  1U3O A;  2LRQ A;  4MZP A;  4QVZ A;  5GAN 6;  3S3N A;  5HCK A;  3UWN A;  2E65 A;  4AT1 B;  2X51 A;  4M7D C;  1WXB A;  1G3W A;  4II1 A;  4ZNX A;  3IQL A;  4N4H A;  2L8D A;  4B9W A;  1PKT A;  2ZCF B;  1Q86 U;  3UT1 A; 
#chains in the Genus database with same CATH homology
 5I22 A;  5IXF A;  2YSQ A;  1PWT A;  3EG3 A;  2J05 A;  2RN8 A;  3VRY A;  2HCK A;  1PHT A;  2J7I A;  1UG1 A;  5IHK A;  4CC3 A;  2ABL A;  5IH2 A;  1WFW A;  4AFS C;  2FPD A;  2DNU A;  2EGC A;  4K11 A;  2YDL A;  3VS7 A;  4AG2 C;  2KEA A;  3QWY A;  2DL5 A;  2JMA A;  4WCI A;  1YP5 A;  2JS0 A;  1WI7 A;  2A37 A;  4LUD A;  2K79 A;  3NPF A;  1KSW A;  2DIL A;  2RQR A;  3PVL A;  4JZ4 A;  2GTO A;  2KXC A;  2CDT A;  2DMO A;  3H0F A;  2KBT A;  4LE9 A;  2A28 A;  1RI9 A;  2B86 A;  1M3A A;  4EIK A;  1YCS B;  1GBR A;  2EYW A;  3EGU A;  2K7A A;  4AFU C;  2EGE A;  1UUE A;  3THK A;  3A98 A;  2VVK A;  2D1X A;  2YUP A;  1KFZ A;  4GLM A;  2K3B A;  2YUN A;  3U23 A;  2DE0 X;  4DEY A;  4OMN A;  4OMP A;  2O88 A;  2H8H A;  2A36 A;  4IIO A;  2KRS A;  3QWX X;  1QWF A;  2DM1 A;  4GBQ A;  1E6G A;  1NM7 A;  3FJ5 A;  4X1V A;  1VA7 A;  2EQI A;  2KT1 A;  1NEB A;  2GBQ A;  2DYB A;  4HCK A;  4J9H A;  1V1C A;  1UHF A;  2BZX A;  2RMO A;  1NYF A;  2JMC A;  1RUW A;  3PE0 A;  3EHR A;  3VS6 A;  2KE9 A;  1B3Q A;  2KRN A;  2K9G A;  2LX7 A;  1YNZ A;  2RQT A;  1W6X A;  1B07 A;  2DLP A;  3JV3 A;  4RTT A;  1X2K A;  3EG1 A;  3REB B;  1NYG A;  2K6D A;  4IIM A;  4Z89 A;  1YWO A;  4RTV A;  1NLO C;  1UTI A;  2EBP A;  3UAT A;  2E5K A;  4J9C A;  2W10 A;  2HBW A;  2YUQ A;  2GGR A;  3RNJ A;  2KRO A;  2F2W A;  1K1Z A;  1NG2 A;  4Z8A A;  4AFQ C;  2JM9 A;  2SEM A;  1TUC A;  2BZ8 A;  2BZY A;  2AZV A;  3NGP A;  3SHW A;  4RUG A;  1SRL A;  2HEQ A;  2EKH A;  3H0I A;  1H8K A;  1QKW A;  1YWP A;  5EC7 A;  2YUO A;  3VS1 A;  2KT8 A;  1E6H A;  1W1F A;  2V1R A;  2CT3 A;  1SHF A;  3O5Z A;  2CT4 A;  1QLY A;  1WLP B;  3M0S A;  1UHC A;  2LJ0 A;  1LCK A;  1I0C A;  1WX6 A;  2DL7 A;  2EVR A;  4FSS A;  2D8H A;  3I9Q A;  2G6F X;  4J9B A;  3VS3 A;  1WDX A;  4Z88 A;  2XMF A;  2VWF A;  1SPK A;  2PZ1 A;  4RTZ A;  3UA6 A;  2EYX A;  1JQQ A;  3TSW A;  3R6N A;  2AKK A;  4OML A;  2DA9 A;  2FPF A;  1VYU A;  4ESR A;  1BB9 A;  3M0Q A;  2W0Z A;  2D0N A;  5GJV B;  4CC2 A;  1AWO A;  2BTT A;  4RTU A;  1AD5 A;  1QWE A;  2DL8 A;  4Y92 A;  3H41 A;  3H0H A;  1K9A A;  1OOT A;  3EG2 A;  1ZUY A;  3M0P A;  4OMQ A;  2V1Q A;  2MIO A;  4RTW A;  4LNP A;  2ED1 A;  2J6K A;  1NEG A;  1T0H A;  1HD3 A;  1X69 A;  5FWC A;  1UFF A;  2AKL A;  2EGA A;  2EPD A;  3ZL7 C;  4JPB W;  2O9V A;  4J9I A;  2FG0 A;  1GFC A;  1K4U S;  1OV3 A;  2J6O A;  1WIE A;  1BBZ A;  3TSZ A;  2LQW A;  3VS5 A;  4M4Z A;  2MCN A;  2L2P A;  1N5Z A;  2L3S A;  2RQW A;  4RTY A;  1NLP C;  1UE9 A;  1X27 A;  2FPE A;  2CH4 W;  2JXB A;  3VS0 A;  4LUE A;  3M0T A;  1CKB A;  4AG1 C;  5FW9 A;  4JJB A;  3KFV A;  1GCP A;  3I35 A;  2HDA A;  2KR3 A;  1W70 A;  2M51 A;  1QKX A;  1AZE A;  2LJ1 A;  1ZUK A;  2JM8 A;  1WA7 A;  2L0A A;  5IHI A;  1KJW A;  4OMM A;  1I1J A;  4AFZ C;  4CC4 B;  1GCQ C;  1ZSG A;  1K76 A;  2LJ3 A;  2LQN A;  4D8D A;  1PNJ A;  2KXD A;  1M27 C;  2A08 A;  3NMZ C;  2QDL A;  3VS2 A;  4D8K A;  4HXJ A;  2JS2 A;  2EW3 A;  1AWJ A;  2CUB A;  3M0U A;  5L23 A;  5IXB A;  2OAW A;  1T0J A;  1MUZ A;  2FEI A;  1VYT A;  1HSQ A;  1PRM C;  1H3H A;  2JT4 A;  2RQU A;  4OMO A;  1KIK A;  2DX1 A;  2SRC A;  2DVJ A;  4HVV A;  1JU5 C;  2F2V A;  1U06 A;  1S1N A;  1I07 A;  2J06 A;  2C0I A;  2O2O A;  3ULR B;  2JTE A;  4JZ3 A;  1OPK A;  2ED0 A;  4QT7 A;  2JW4 A;  3C0C A;  1UJ0 A;  2FO0 A;  2AK5 A;  2CH4 A;  1K0X A;  2DJQ A;  1K0S A;  4R0K A;  2C0T A;  1G83 A;  1GRI A;  4F14 A;  2DRK A;  1Y57 A;  2PTK A;  2DBM A;  1OPL A;  2KRM A;  1M30 A;  4J9F A;  1WXU A;  1M3B A;  1X43 A;  1ZX6 A;  1OEB A;  1UEC A;  1AZG B;  2O9S A;  2EYY A;  1CKA A;  3I5S A;  3UF4 A;  1XOV A;  1MV3 A;  1X6B A;  1ABQ A;  2GTJ A;  2MOX A;  2ROT A;  2PNI A;  2CSI A;  1JEG A;  2GNC A;  1FMK A;  1BK2 A;  1EFN A;  3SEM A;  2K2M A;  3VRZ A;  1X6G A;  1T3S A;  1SEM A;  1SRM A;  1X2Q A;  1M3C A;  1AWW A;  4KRT A;  1JO8 A;  3EG0 A;  1WYX A;  2KYM A;  4J9E A;  5GJW B;  2YT6 A;  1AOJ A;  3I5R A;  2DL4 A;  3REA B;  1QCF A;  1RLQ C;  2DBK A;  1UGV A;  2GQI A;  1ABO A;  4HVU A;  3VS4 A;  1RLP C;  1BU1 A;  1YN8 A;  2RNA A;  2F2X A;  1AVZ C;  3M0R A;  1JXO A;  1Z9Q A;  1IO6 A;  2IIM A;  5ECA A;  3LH5 A;  2C0O A;  1M8M A;  1FYN A;  2OI3 A;  3RBB B;  3NHN A;  2HSP A;  1VYV A;  4JJD A;  5IHN A;  2CRE A;  2KGT A;  3GBQ A;  3EHQ A;  4LN2 A;  3TVT A;  2DL3 A;  1ZBJ A;  1TUD A;  1ARK A;  1Y0M A;  2CSQ A;  2X3W D;  4E6R A;  2I0N A;  2DF6 A;  2RQV A;  2CUD A;  4CC7 A;  1PRL C;  3UA7 A;  4A63 B;  3CQT A;  1G2B A;  2VKN A;  2L3Q A;  1AWX A;  1ZUU A;  1A0N B;  2RF0 A;  5FWB A;  1HJD A;  2AZS A;  2D8J A;  4HVW A;  4J9D A;  2X3X D;  2RPN A;  4JJC A;  2ESW A;  2NWM A;  2DRM A;  2LMJ A;  4RTX A;  1H92 A;  2O31 A;  2ROL A;  2J6F A;  1MV0 B;  1TG0 A;  1UJY A;  1SHG A;  1ZLM A;  2L3P A;  2OJ2 A;  1U5S A;  1SSH A;  2FRY A;  1GCQ A;  1E7O A;  2ENM A;  3PVQ A;  2LZ6 B;  4ORZ A;  2FRW A;  1GL5 A;  1T3L A;  1PKS A;  5I11 A;  1U3O A;  4J9G A;  1GFD A;  2ECZ A;  2M0Y A;  2NUZ A;  1J3T A;  1AEY A;  5HCK A;  1JXM A;  2LCS A;  1UDL A;  4F16 A;  2P4R A;  1Z9Z A;  1WXB A;  4F17 A;  4ZNX A;  1WXT A;  1GBQ A;  3IQL A;  2LP5 A;  2LNH B;  2KNB B;  1CSK A;  2EYZ A;  1PKT A;  4DEX A;  2KYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...