1UG1A

Sh3 domain of hypothetical protein baa76854.1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of SH3 domain of Hypothetical protein BAA76854.1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA1010 protein
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ug1A00
2A08A 4X1VA 2FO0A 3QWYA 1X43A 1Y0MA 1QWEA 2F2VA 1QKWA 1NLPC 2B86A 5IH2A 3THKA 4KRTA 2DBMA 4FSSA 3VS2A 3O5ZA 2RQTA 1VYTA 1BU1A 2LNHB 3TSZA 4Z8AA 4JJBA 2D8JA 1NLOC 1BK2A 5FW9A 4AFZC 2ECZA 1NG2A 1WYXA 1GCQC 3I5SA 2EW3A 4OMPA 2K9GA 1AWWA 3NMZC 2DF6A 1GCPA 2IIMA 1EFNA 1MUZA 1OV3A 2EYZA 1UDLA 1AZEA 2J6FA 1BBZA 2D0NA 4ESRA 2AZVA 2EYYA 4R0KA 4J9IA 2DX1A 2KT1A 2LQNA 1AWXA 2FRYA 2JW4A 4GBQA 4AFSC 4RTXA 4JZ4A 2CUBA 2DMOA 1M3AA 2M51A 4JZ3A 2G6FX 2JMAA 2JS2A 2VVKA 1GFCA 2KBTA 2RNAA 3SHWA 3VS3A 2KE9A 1OOTA 2KXCA 1ABOA 3QWXX 4F14A 3M0SA 2EYWA 2DJQA 3VS4A 1WIEA 3NPFA 4JPBW 2GQIA 2EVRA 2HSPA 1SPKA 2O31A 1AD5A 2J6KA 1YCSB 1OPLA 2KR3A 4DEXA 2RQWA 2O88A 1ZUKA 2D8HA 1M8MA 1B3QA 4F16A 4ORZA 2KT8A 2DILA 1W70A 1HJDA 2BZXA 2LX7A 1PWTA 1UTIA 1E6HA 3FJ5A 2EKHA 1U5SA 4K11A 4RUGA 2ROLA 1N5ZA 3GBQA 1AEYA 3M0QA 4RTZA 2YUOA 1RLQC 5ECAA 1PKTA 1WA7A 2JM8A 2KGTA 1PHTA 1GCQA 2AKLA 1WX6A 2YUQA 1G2BA 1RUWA 2CH4W 4Z88A 3EG2A 1JEGA 1M3BA 4AG1C 1PKSA 2FEIA 2OAWA 2H8HA 1E7OA 4D8KA 1K76A 4D8DA 1SRLA 2V1RA 2KYMA 1X69A 2ABLA 1WXTA 2JM9A 4J9HA 1NYGA 2A36A 3ZL7C 3NGPA 1NYFA 1S1NA 2EGCA 4J9CA 1YP5A 2OI3A 1JO8A 5GJVB 2K6DA 2RMOA 1U3OA 2LJ1A 2SRCA 2ROTA 1K9AA 1WXUA 2K7AA 2DL8A 3RBBB 1M30A 2RF0A 2AZSA 2PZ1A 4LUDA 3UA6A 1SRMA 2E5KA 1MV0B 3UA7A 1ZX6A 2CUDA 4IIMA 2EGAA 2KRNA 1Y57A 1SEMA 4LN2A 4RTYA 3M0PA 1WXBA 2KYBA 2EPDA 1WFWA 3TSWA 5IXFA 1K0SA 2O2OA 2DNUA 2DE0X 2NWMA 2DL5A 1MV3A 2GTJA 2ESWA 1H3HA 3H0IA 2LMJA 2JT4A 2PTKA 3U23A 2C0TA 2K3BA 1GRIA 2M0YA 4WCIA 1FMKA 4HCKA 4CC4B 1V1CA 1QWFA 1W1FA 3R6NA 1PRMC 2MOXA 1AOJA 2K2MA 4QT7A 1GBRA 4A63B 2NUZA 1IO6A 2JTEA 2JMCA 3VS6A 3A98A 2BZ8A 1QCFA 4J9GA 2A28A 1YN8A 2PNIA 2CT4A 2DRMA 3VS7A 1JXOA 1AWOA 1H92A 2DRKA 1W6XA 2J05A 3I5RA 4E6RA 1SHGA 2HEQA 2O9VA 2KRSA 3VS5A 2DYBA 3EG1A 3ULRB 4J9FA 4DEYA 2P4RA 1AZGB 2J06A 1TG0A 2XMFA 1Z9QA 2KEAA 3C0CA 1HSQA 3H0HA 2MIOA 2LQWA 1OEBA 2EBPA 2QDLA 2KROA 1BB9A 3SEMA 1RLPC 3I35A 2YUNA 1TUDA 5IHIA 1NEBA 2FPDA 1T0JA 3RNJA 3EG0A 2RQUA 1PRLC 2GGRA 2C0OA 2DA9A 1QLYA 4LUEA 1G83A 2OJ2A 5I22A 4CC3A 1T3SA 4Y92A 1PNJA 1UHFA 2HCKA 2X3WD 1FYNA 3VS1A 2DL4A 1ABQA 2AKKA 1I07A 3I9QA 4OMMA 1QKXA 1LCKA 4RTUA 1SHFA 1X6GA 1WI7A 1UJYA 2V1QA 1WDXA 1ZUUA 2HDAA 3M0RA 1A0NB 1AVZC 2RN8A 1B07A 2FPFA 2C0IA 2EQIA 3KFVA 1CSKA 2LZ6B 3EHRA 2FG0A 1RI9A 3VS0A 1U06A 2KXDA 4AFQC 4J9DA 2VWFA 2SEMA 1KFZA 2CDTA 2F2WA 1T0HA 2GBQA 2L3QA 2GTOA 1M27C 2FPEA 1UECA 1ZBJA 1KSWA 4HVUA 5IHKA 1YWOA 5I11A 1UG1A 2D1XA 2YSQA 2YUPA 1UUEA 2RPNA 1UFFA 2GNCA 2J6OA 1JQQA 1GBQA 2ED1A 3M0TA 1E6GA 2HBWA 2LJ3A 2EGEA 4EIKA 1X6BA 1GFDA 2JS0A 2LJ0A 1H8KA 2CT3A 3VRZA 1X2KA 5IXBA 2JXBA 3EGUA 4LE9A 4HVWA 1KJWA 4J9BA 3CQTA 5IHNA 2A37A 5HCKA 2CH4A 2DLPA 5FWBA 2EYXA 2YT6A 2L3PA 1K0XA 3H0FA 4OMNA 4F17A 4RTWA 1ARKA 1HD3A 1T3LA 2RQRA 4GLMA 2KRMA 1SSHA 4CC2A 2X3XD 3TVTA 1JU5C 2L0AA 4IIOA 1UE9A 2RQVA 3PVQA 1WLPB 1OPKA 1M3CA 2ED0A 2F2XA 1K1ZA 2AK5A 4OMQA 2BZYA 4HXJA 4LNPA 1VA7A 2K79A 1GL5A 2KNBB 4JJDA 5GJWB 2LCSA 2FRWA 3REAB 1XOVA 3NHNA 1NEGA 1UHCA 2VKNA 3UF4A 5EC7A 5FWCA 3JV3A 1YNZA 1ZUYA 2DL3A 1VYUA 1JXMA 1UJ0A 4J9EA 1Z9ZA 1TUCA 1NM7A 2DM1A 3H41A 3PE0A 3VRYA 4Z89A 2BTTA 2L2PA 4AG2C 4CC7A 2ENMA 1AWJA 3EG3A 4RTTA 4HVVA 2W10A 1CKAA 3EHQA 1X2QA 3REBB 1ZLMA 3M0UA 5L23A 2O9SA 1YWPA 2DBKA 1I1JA 3IQLA 2YDLA 4JJCA 2J7IA 2LP5A 3UATA 3LH5A 2CREA 4OMLA 2CSIA 4OMOA 2W0ZA 4M4ZA 1CKBA 1ZSGA 2DVJA 1J3TA 1UGVA 1I0CA 4ZNXA 2DL7A 2CSQA 2MCNA 1VYVA 1X27A 3PVLA 4AFUC 2L3SA 1K4US 1KIKA 4RTVA 2I0NA
chains in the Genus database with same CATH superfamily
5GMKm 4X1VA 3CMAQ 5GMKh 3ASKA 1EX4A 4PJLA 1TU0B 1Q95G 1NLPC 2CZ0B 2GF7A 3META 2H3EB 1YJNA 3JSCA 2DZ9A 2LQKA 3VS2A 1LOJA 3TSZA 4JJBA 2YRCA 1QVPA 2D8JA 4RG2A 1OI1A 4IUVA 2QTXA 2Y4XA 2QA4Q 3OS5A 2EW3A 1K8AU 3CCEA 2K9GA 4OB1B 4F7UE 3CC4A 2RM4A 1JRIA 1VQKT 5FRMA 3QSUA 4A4KA 5FLXE 4ESRA 2CZ7B 4J7IA 2EYYA 1K8AC 1C1AA 2DX1A 2HL5C 3SFMA 2PVGB 2LT4A 4RTXA 2IPOB 1JB0E 5GANd 1WHMA 1M3AA 2M51A 1KQSA 2QK0A 2RNAA 1PD0A 2HKNA 2QG9B 2KE9A 1OOTA 2KXCA 3CCMQ 2EYWA 3CXCP 2DJQA 1VIFA 4MMKA 4PFOA 3JB9G 4DOWA 3V8LA 3EAEA 3GF5A 2EVRA 2O31A 4QVDA 1YCSB 2X4WA 2RQWA 1ZA2B 1IREB 1S72A 1ZUKA 2D8HA 2EAYA 1QVGA 4JRKA 1M8MA 3CBOA 2E70A 2DILA 1HJDA 5KYYB 2LX7A 1W2BP 1G3YA 1M1KR 3RERA 1N5ZA 3M0QA 3SWNC 1W4SA 5KYUB 3MP6A 2FHDA 2JM8A 4Y91A 5DY9A 2AKLA 2VGNA 4Z88A 1M2VA 4AMCA 1JEGA 1V29B 4C8QB 4BI4A 3C95A 2OAWA 2H8HA 1K76A 4PJOF 2KYMA 1VQOT 1M1FA 1M2OA 1WXTA 1NYGA 4D6WA 5FU7C 1NYFA 2XK0A 3OYHA 3CCJA 3JAME 4M78A 2MAMA 4M77D 3I55T 1BIAA 3ZFJA 2BE7D 3M59A 2ROTA 3OS0A 1M30A 3EG9B 3VU3C 1D1CA 1MV0B 3UA7A 2HQXA 2EGAA 5J26A 1SEMA 3PIOA 2ATCB 3M0PA 5IXFA 1MMDA 3TSWA 3BFMA 2ZZDA 1U1SA 4E7SA 2DE0X 3P8BB 2DL5A 2ESWA 4F04B 4A4FA 3KUFA 1SKUB 2DERA 2JT4A 2LMJA 4A4GA 1FWZA 2M16A 4BI3A 1Q82C 1M1KU 1VQ9T 3NTHA 5KYYA 1QWFA 1R77A 1W1FA 1PRMC 2I2LA 2K2MA 4QT7A 3NTKA 1C0MA 4XTUA 2DRMA 4C92G 4ELZC 4MDXA 3E1SA 1VQLT 2DZCA 2DIGA 1KQSS 4FT4A 4M7AC 1VQMT 1M1GA 4DBRA 2HNIA 3ULRB 1W2BA 2E3IA 3BDUA 2K4YA 1YIJT 2JUFA 1Z9QA 2KEAA 2QTVA 3C0CA 2XKOC 3H0HA 1KC8C 3FEOA 1MNEA 3G4SA 2EBPA 5HKCA 2KROA 3SD4A 1VQNQ 1RLPC 2RI5A 3FLGA 3EGDB 4C92F 3PNWC 2VB6A 4IURA 4ZN3A 2FPDA 4FSXA 1KQ1A 3DB4A 4FW1A 2C0OA 4OB2B 3ZBDA 4HKEA 4OP0A 1PNJA 1YI2T 5GMKe 2DTIA 2RHXA 2WSCE 2HCKA 4JS4A 5J39A 3BY7A 4M78F 1FYNA 3OYMA 4OMMA 4RTUA 5A0LA 3FDRA 6AT1B 4OVAA 2DYIA 4C0ZA 1WI7A 1PD1A 3M55A 2CP3A 1BI3A 1UJYA 1D3BA 1IHVA 5DM7R 3UPUA 3JCMQ 1WHLA 2A0FB 1ZUUA 2QYZA 2EQIA 2FPFA 5KE3A 3EFOB 2LZ6B 3EHRA 1TOVA 2CZ1B 5LJ5e 4J6WA 1RADB 1KFZA 5GANe 3ME9A 4X9CA 3M4YA 1VQ8Q 1M27C 3P8DA 1ZBJA 4Y28E 3I56T 2KSSA 3OYFA 1YWOA 5I11A 4BDYA 2D1XA 2YSQA 2QQ9A 1UUEA 4MZMA 1UFFA 1YJWT 2GNCA 2E64A 1JQQA 3CC4T 2ZPIB 1E6GA 2KQWA 3L2QA 4EIKA 5LJ5j 2EFIA 1H8KA 1OQKA 2NLUA 2JXBA 2QEXA 4M7DG 1M8VA 4LE9A 2DJZA 4C0FA 3JCMX 2DAQA 3LGFA 1G8XA 1D1AA 5FWBA 2YT6A 5D6WA 5GAOl 2GFUA 4OMNA 4C5GA 4F17A 3CC2A 1VQPQ 4C8QF 3MP1A 1W2BS 2V26A 4CC2A 2X3XD 1JU5C 3PIPA 1QW1A 2JJ9A 4M77E 3PVQA 5KYUA 3I56A 3QDFA 1M3CA 3HRTA 1M90R 1Y71A 1B7TA 4JJDA 5GJWB 2QGGA 1VQKQ 1VQ7A 3CCLA 3CXCS 2QQBA 1N9RA 1XOVA 3NHNA 3L2UA 2LRQA 3UF4A 3I55A 1TWBA 2NUTA 1AHJB 3QIIA 1OX8A 4M75B 3QZ9B 8ATCB 3EG9A 3V7SA 2DL3A 2RA2A 3GIBA 3X25B 3CCUQ 3G71A 2V8KA 3CCQA 4PLIA 2MI6A 1RABB 4CC7A 3CCRA 1AWJA 3EG3A 3OYNA 4BY6B 4EDUA 4PJNA 5CCAA 1CKAA 1WJQA 3EHQA 3CC7A 3CCMT 3G1JA 2D9TA 3CC2T 2RD1A 2WSFE 2YLCA 3CCJQ 4PK4A 5GAMe 4A4HA 2J7IA 4OMLA 4FYXB 3QXEB 3CCRQ 4E7IA 2QEXT 1RACB 3V7CA 4M7AD 3G71Q 4ZNXA 2DL7A 5CQYA 4AFUC 2L3SA 4ATOA 4L59A 2O4XB 3HKSA 2YRVA 3A8LB 3INZA 3QKJA 4EMHA 1YITT 1PSFA 2FO0A 1K9MR 4LDXA 2VXFA 1VQMA 1X43A 1Y0MA 1QKWA 1UB4A 1ZSZA 5IH2A 4EPCA 1LNXA 5L8RE 3O5ZA 1V76A 1VYTA 1BU1A 4QVZA 2CP5A 4Z8AA 3CMAT 1KQ2A 5FU7B 1NLOC 3HP9A 4RMOA 5GANj 2P84A 2EYQA 2O01E 5FW9A 4C92A 3CEYA 2ECZA 1NG2A 3MJXA 4MZTA 1GCQC 4XQ3A 3M53A 4DA4A 1Q86U 3CCSQ 2DF6A 1GCPA 2DXBA 1MUZA 1OULA 2EYZA 3CBMA 5KYNA 2XI9A 4XU0A 4RKUE 2J6FA 4PKCC 1BBZA 5GMKi 1NPRA 4C8QG 2RJDA 4M75E 5LJ3d 4BE1A 3HL8A 4E7HA 4XU2A 1AWXA 3H8ZA 2FRYA 4AFSC 3L2VA 1VQ4A 4JZ4A 2A3LA 3KBGA 4ME7A 3CCSA 3G4SQ 1D3BB 1BIBA 2KDSA 4JZ3A 2RHZA 3H9NA 3BE3A 3CCVT 3OW2S 4C92D 3CXCA 1KG1A 1ZHIA 5D6XA 4F14A 2L89A 2YWWA 1KC8R 2Y4YA 3BW1A 4JPBW 3OS2A 3H6ZA 2EKOA 4JRIA 2J6KA 1OPLA 4DEXA 2D0QB 5GAMf 5A0DA 3M9QA 3RKYA 4F16A 2JOYA 2HAXA 1G3TA 1W70A 4M7DD 1LPLA 5J3BA 4E47A 3OY9A 2EKHA 3OYKA 1NPPA 1R0BG 2ROLA 5GANf 2PVDB 3GBQA 4RTZA 4KUDK 5ECAA 2EJ9A 1SSFA 1FXXA 1WA7A 3HSBA 2VXEA 1GCQA 1G2BA 2CH4W 2QAZA 4ANJA 3MHXA 2MPXC 4AG1C 1O75A 2FEIA 1XQHA 1S72T 2OAUA 2V1RA 3CPWA 1X69A 4J9HA 2A36A 3ZL7C 2NUPB 1S1NA 1N6AA 3G6ET 3JCMW 1P92A 1JJ2P 3PMTA 1XTDA 2K6DA 2OTLQ 1U3OA 5IAYA 5CKFA 1WXUA 2DL8A 3RBBB 3VJPA 5GAMj 2RF0A 2E65A 3QJYA 3EH2A 1IXDA 2FVUA 1VQ6A 5CKHA 2E10A 1BI2A 4FIBA 4IIMA 4NL3A 2HD0A 4LN2A 4RTYA 4XTWA 3CMEA 5D6YA 2E41A 4PJOA 1ZSZC 2NWMA 2GTJA 1UGRB 1Q81C 1RAEB 5GAOp 5LJ3g 4M77F 2LTOA 1NJIR 2C0TA 1VQKA 2M0YA 3V7RA 3E9GA 2NUZA 3M4GA 4WTOB 2BZ8A 1QCFA 3JCMh 1YN8A 2PNIA 2CT4A 1JXOA 1AWOA 4M7DF 2BIVA 2X9HA 2J05A 1JBMA 3I5RA 3FIFA 3ZEHA 5GAMd 3HFOA 3OW2A 1Q82R 4E7ZA 2CGHA 1SHGA 2HEQA 2O9VA 3MEUA 2KRSA 3VS5A 3FJPA 3QDRB 3RKWA 3JB9I 3C94A 2JZ2A 4DQ2A 2P4RA 1AZGB 2J06A 4HCCA 4KGVB 5CVIA 1HSQA 2CS7A 2MIOA 2QDLA 3G71T 3CBPA 5FU6B 3VYGA 1O9SA 2ZPGB 3A8HB 2E5QA 5IHIA 1OYXA 1IHWA 3Q1JA 3PMIA 3RNJA 1I81A 1TSFA 4QW2A 1VQ7T 2GGRA 4BUGA 1WPYA 1TTHB 1QLYA 3MEWA 2OJ2A 5I22A 1NJIU 4PJOC 2FZKB 4Y92A 5GAN5 4M7DB 2DL4A 3O8VA 1ABQA 4XTXA 1VUBA 4ZGJB 4GY5A 4ZGDB 2EIFA 3SWNA 1LCKA 4BB7A 1VQPA 5KH6A 1X6GA 2R5AA 3CPWS 2LX9A 1YJ9T 5GAN6 2OTLT 1M9SA 2YRDA 1YITQ 2HDAA 2K2VA 1YCYA 3VYHB 4DOVA 2RN8A 1B07A 4M7DE 2C0IA 2RB6A 1X75C 3S3NA 2OTJQ 1VQ5A 1RI9A 3OB9A 1U06A 4N4GA 3VS0A 1VQ6T 4MZPA 4M78C 5IT9E 4R56A 4BI8B 4AT1B 4P5NA 4DBFA 2E12A 5LJ3j 4RG8A 1PM3A 4HVUA 5IHKA 1VOMA 2YUPA 3HPWA 1EZZB 3OMCA 1YJ9A 3MO8A 5FROA 2DETA 4KT0E 4L5GA 2J6OA 4M75D 2M02A 1GBQA 2ED1A 3M0TA 2EGEA 2DIQA 2DPPB 1KQSP 5GANg 2NYSA 3LH0A 2LJ0A 2PU9B 3VRZA 5IXBA 1TH7A 4C0GA 4HVWA 3CCQQ 2MF2A 4J9BA 3CQTA 2K3XA 4ZTJA 3X28B 2DLPA 1X01A 5FU6C 4ZN1A 1YITA 3OYJA 3E9FA 3H0FA 1N8RC 4OB0B 5AYFA 4XU3A 1ARKA 3MEAA 1OZ2A 3TVTA 2RH2A 2L0AA 5GAN2 3MEVA 4J8OA 2KAFA 5I21A 3QZ5B 4QQGA 4QVCA 3OBYA 1OPKA 1IGUA 2RHUA 3WXMB 1K1ZA 3PT9A 1QMCA 3VV0A 2BZYA 3CC2Q 3A5ZB 4LNPA 3CCVA 4HCBA 1GL5A 2KNBB 4Q5WA 3N5BB 3GPLA 2LNVA 2JTFA 3REAB 3CCMA 1YHQQ 2VKNA 3C12A 3JV3A 2YHTA 2HMAA 4IUQA 1F1BB 1RAFB 4BDZA 1VYUA 3EFSA 3CCQT 2P4TA 2EJGA 2OX7A 1TUCA 2X35A 4UC4A 2HZYA 1NZ9A 4HT8A 4C8QE 1YHQA 1UGPB 1Q86R 1KHIA 1X2QA 3REBB 2CKKA 3M0UA 4C8QD 1D0YA 2L3RA 2DBKA 2DTOA 3IQLA 1EIFA 2YDLA 3GNGA 3F70A 1WHHA 2MYSA 2HQEA 2LP5A 1KD1C 3OSSC 5GAOr 4X34A 2W0ZA 3I56Q 4ELYC 4M4ZA 2XICA 2IG0A 4E7LA 1RAHB 1IRXA 3VUZA 1QCOA 2CSQA 2MCNA 1VQ4Q 5AT1B 8AT1B 1K4US 1KIKA 2I0NA 2A08A 2QA4T 2KMTA 5A0GA 2HQHA 1QWEA 4C92B 4QQDA 1S72Q 2RJCA 2B86A 1X6OA 1B34A 4KRTA 2DBMA 3RUXA 1YI2A 5CR2A 2RQTA 3M58A 2LT1A 1BK2A 4N4IA 2OTLA 4AFZC 2COYA 3CC7Q 3CC7T 1MNDA 1WYXA 1VQ8A 5GAOq 3CCJT 4F7UB 1RI0A 4C8QA 2YLBA 3NMZC 4HA8A 1H641 3OA6A 1EFNA 3EFOA 1Q7YU 1WGSA 1FMWA 3J80E 5KYXB 2D0NA 5KCOA 2JN0A 2AZVA 2DVEA 2LDMA 4PLLA 4R0KA 3I55Q 1ZSZB 4GLKA 2OTJA 3LX7A 4JRQA 2ZAEA 4GBQA 5CKEA 7AT1B 4BACA 3CCLT 2CUBA 4J83A 4XTYA 2F5KA 2JMAA 4KUIA 1Y07A 2JS2A 1ZQ1A 1GFCA 3SHWA 3JCMc 4BY6C 1KC8U 2VUBA 1VQ7Q 2K3YA 3QWXX 1ABOA 1AT1B 5GAOn 3GNFB 2DD5A 1VQ6Q 1MHNA 2XG8D 3VS4A 1YBYA 1WIEA 3FC3A 3NPFA 1RAAB 2GQIA 2HSPA 2CYZB 4N0AC 3X24B 2KR3A 1QVFA 3RESA 4M7AB 5A2QE 4F7UF 2QDYB 1ACMB 1KHCA 3JB9H 4J5YA 4ORZA 2KT8A 1PWTA 3FJ5A 1E6HA 4RUGA 4K11A 3LYIA 3OSVA 2LQ8A 1PHTA 2QXFA 5CKBA 1WX6A 1RUWA 1Q7YR 4B9WA 2Y90A 3OYIA 1RAIB 3GLXA 1E7OA 4D8KA 1Q82U 1SRLA 4A54A 2R58A 3V8KA 3L2WA 2NUTB 2JM9A 2EJFA 4JRPA 2ZGWA 2X51A 1JO8A 1VQLA 4FW2A 2D6FA 1NJIC 4FU6A 3LLRA 2BE9B 2RMOA 2B8AA 2SRCA 2DTHA 3DLLA 2PZ1A 4R55A 2QI2A 4IUPA 2CUDA 2DXCA 2KRNA 1WQWA 4IUTA 4OMFB 3GOXA 1C6VX 1WXBA 2KYBA 3A8GB 2V8JA 3CD6T 2O2OA 4FT2A 2DNUA 1N9SA 1I5LA 1D0ZA 3H0IA 1K73C 5GAN4 2PTKA 2MK5A 2K3BA 1GRIA 2RHIA 1N8RR 4WCIA 1FMKA 2X4JA 4HCKA 4V2SA 4X9DA 2BUDA 1V1CA 3QPHA 1PCXA 3UWNA 4LDUA 2DEUA 2F5TX 3BDLA 4PJMA 4A63B 3S3OA 1IO6A 3VS6A 3A98A 4J9GA 3CCVQ 4M7AG 1MMAA 3TREA 1H92A 1QVFP 4WF2A 4M75G 1W6XA 3TU4K 1D09B 4RCCA 1VQNA 3HRUA 2MWPA 2DYBA 2RI3A 4KH0B 4J9FA 4DEYA 2VV5A 2XMFA 2RJEA 5LJ3f 1BI1A 3SB2A 2CZ6B 1YIJA 1K73U 2LQWA 3G6EQ 1QVFS 1BB9A 1IGQA 2HKQB 5LJ5g 1Q7YC 2E6ZA 4M7AF 1LVKA 2VC8A 3I35A 4C8QC 2YUNA 1TUDA 3CCST 3CCET 2P0PA 4BD3A 5GAOm 1T0JA 3EG0A 2RQUA 3CPWP 3SDZA 5C6SA 5KE2A 2BKDN 2DA9A 3EGXB 4LUEA 1G83A 3DKMA 4CC3A 1T3SA 4C0DB 4LXCA 2QA4A 4M78G 1OX9A 1N8RU 2DD4A 4MDWA 1UHFA 1YJNT 4XTVA 3VS1A 2XDDA 3I9QA 4PJOG 3TEEA 3FB9A 5GAMg 1SHFA 3QYGB 5GANh 3MPUB 4MMLA 4M77C 1WDXA 3M0RA 1Q81U 2DXUA 1YFNA 3KFVA 4C5EA 3PTAA 2KXDA 2E3HA 1VQOQ 2VWFA 4J7FA 1PC0A 3OBWA 2CDTA 1GXIE 2F2WA 2ZPFB 2K5LA 4EMKC 2A7YA 2L3QA 3JCMJ 2COZA 1KSWA 3CCLQ 4KH1B 4RCBA 2YXYA 4NS5A 3M5AA 1WHJA 2RPNA 4PFPA 1RAGB 1XJWB 4E7KA 2HBWA 2LJ3A 1X6BA 2DK3A 4LD9K 2KK4A 5M9OA 2JS0A 1RL2A 1KD1U 1PSEA 3RDVA 3CD6A 5C0MA 4M7AA 1TUGB 4XK8E 1KJWA 1ZA1B 4HCZA 5IHNA 2AIRB 5HCKA 3GP8A 5CKDA 2L3PA 4ZGEB 3JCMP 1K0XA 2E4HA 2LCLA 4IUUA 1BCMA 4A53A 4C92C 4RTWA 1T3LA 2RQRA 4FYYB 1BCOA 3LWHA 4OB3B 2KRMA 4C5IA 1Q81R 3A1PA 3G4ST 2ZCFB 4IIOA 3T9NA 1QQJA 3HFNA 2FZCB 4M77A 1WLPB 4PJOB 3URGA 2KY9A 3RMSA 3OYLA 1KK7A 4OMQA 4HXJA 1TXQA 4LDYA 4L6V5 2LCSA 2FRWA 2XDPA 1M90U 4E7JA 3OMGA 4YTLA 5EC7A 3TCJA 4ZTFA 4M77B 3EGXA 1WHGA 4EMGA 3JCMe 1NM7A 3L1AA 3H41A 4LDVA 1YHQT 4Z89A 2L2PA 3OYBA 4AG2C 4DBHA 3CMET 2DKGA 3CMEQ 4RTTA 2W10A 4EMKB 1ZLMA 3D7SB 5CO7A 4NOYA 5L23A 2O9SA 1YWPA 3G7ZA 3A8OB 4QKUA 3QUIA 4TVRA 4JJCA 3LW5E 4VUBA 3UATA 3LH5A 2CREA 4O5VA 4XU1A 4FYWB 2EQKA 2CSIA 4OMOA 1K9MC 1UGSB 1CKBA 2FB7A 1ZSGA 1QCNA 2DVJA 2L5QA 1J3TA 5LJ5d 1UGVA 4M7DA 1VYVA 4FL6A 3DLMA 3S6WA 3SWNB 1K9MU 1FX7A 4RTVA 3M57A 2DFUA 3OS1A 1BI0A 2QEXQ 3QWYA 3OW2P 2X4XA 1Y7XA 2F2VA 2PUKB 3THKA 4FSSA 2LNHB 4M75A 4N4HA 4JJNK 2QQAA 4FYVB 4KGXB 1MMGA 1HYOA 2XIDA 4JS5A 1I4K1 3RIRA 3M56A 2QGFB 5HK3A 3OYAA 4KULA 3I5SA 4OF1A 4OMPA 5CK9A 1AWWA 2IVWA 2DXTA 3WVEB 2IIMA 1OV3A 3JCMg 2Z0WA 1UDLA 1WNLA 5LJ5f 1AZEA 2ZPEB 2KI7A 2FZGB 2NUPA 4J9IA 2KT1A 2LQNA 2PVOB 3CPFA 2JW4A 2F1LA 1VQ4T 4CRIA 2DMOA 2G6FX 2GFAA 3MP8A 2VVKA 2KBTA 3VS3A 1OU8A 1VQLQ 4PJOE 3M0SA 3J7AF 1M4ZA 2ZPHB 2C06A 4PFZA 2RK2A 3C4SA 5I2SA 1SPKA 1AD5A 3JCMf 2O88A 1NE8A 4B9XA 2M0OA 1IB8A 1B3QA 3P8HA 1BKBA 1Y96A 4EMKA 2CP6A 2BZXA 3JB9J 3LWIA 1VQ5Q 1UTIA 1M2VB 1SF9A 2PQWA 5GAMh 1U5SA 3M54A 2P0KA 1AEYA 2YUOA 1RLQC 3TQ7P 1K8AR 1PKTA 1FMVA 2KGTA 2YUQA 3EG2A 1QP3A 3EFRA 1M3BA 1PKSA 1M1KC 2H3JA 2CP7A 1WHKA 4O6JA 4D8DA 3S3MA 5HY6A 5KCHA 2ABLA 2EQMA 4KBMB 3CCRT 3NGPA 2EGCA 5GAN7 2RI2A 4J9CA 3HHTB 1XNIA 1YP5A 2OI3A 1H3ZA 3J81E 1WQ7A 5GJVB 2LJ1A 2E6NA 4M7DC 2RHYA 3L42A 1K9AA 2K7AA 4FCYA 2AZSA 1M90C 4LUDA 3UA6A 2GQVA 1SRMA 2E5KA 1ZX6A 4JLGA 1MGQA 1ZBXA 1Y57A 4DBQA 2EPDA 1WFWA 1K0SA 1D1BA 4BE2A 2K57A 5GAN3 1SG5A 1VQOA 1MV3A 1H3HA 5CAIA 4PJOD 3U23A 2X4YA 3UT1A 1UEBA 4A4EA 4M78B 4E2FB 4CC4B 3JCMd 4M78D 1WZOA 2R57A 3OQ5A 5FRNA 1YJWQ 3R6NA 1LJOA 2MOXA 1AOJA 4OGCA 2MMPA 1GBRA 2JTEA 2JMCA 3EGDA 1WJRA 3PFSA 3VKIA 2XU8A 3NFCA 2A28A 4II1A 3VS7A 3RMQA 5LJ3e 1R0CB 3ER0A 2DO3A 2DRKA 4E6RA 3DB3A 2FL7A 2V8IA 4JLIA 3QHSA 3EG1A 1VQ9A 1UGQB 1PG5B 1K73R 1TG0A 9ATCB 1I8FA 2GCXA 5DLOA 4M7AE 1OEBA 1TS9A 2K5IA 3JRZA 3OYDA 3SEMA 2RO0A 4F7UA 1HXDA 3X20B 3AT1B 2E1HA 2RJFA 1NEBA 1JJ2S 1PRLC 3AHUA 1M5Q1 2PUOB 2EQUA 5IN1A 2P0QA 5GMKl 1YJWA 5DLQE 2ZPBB 4QQ6A 1WJSA 2X3WD 3VUBA 2OTJT 1IZ6A 3QO3A 3WVDB 1VQPT 2AKKA 1I07A 2KVQG 4IKFA 1QKXA 2AT1B 2O4XA 1G3WA 1BYMA 3L2RA 3OYCA 3JB9D 3HTRA 2HL3A 1VQNT 5LL6S 3CCUA 4M75C 2V1QA 1NBEB 2G3RA 2DEQA 1A0NB 5CQXA 1AVZC 1VQ8T 1CSKA 2QQRA 2FG0A 4AFQC 2COWA 1OU9A 4J6XA 4J9DA 5GMKj 1G5VA 5LJ3h 4NL2A 2SEMA 3CD6Q 3RR6A 4LD6A 2VGMA 1T0HA 2HBPA 4JDSA 2EWNA 2GBQA 2VYTA 2GTOA 4LDWA 2FPEA 1UECA 1U8RA 4F7UG 3MCAB 3HRSA 3CCEQ 1UG1A 2M1HA 3QBYA 3CCUT 5D7UA 4PJJA 2WSEE 5KYWA 2LCCA 5EG2A 2CP0A 2XHCA 2WACA 3QG1A 3X26B 3LGLA 1YJNQ 1KD1R 1GFDA 2R5MA 2CP2A 3E19A 2RK1A 2CT3A 2LC4A 1X2KA 4J6YA 1QP2A 3EGUA 3CMAA 3V8JA 5CIUA 2A37A 4XAXB 3UDCA 2CH4A 2EYXA 4C5HA 1D0XA 2JTMA 1U1TA 3R6OA 1OZ3A 1HD3A 4M75F 3JCMb 1Y96B 4GLMA 1SSHA 5KYXA 1UE9A 2AHJB 5HK0A 2HSEB 2QASA 2K5FA 2RQVA 3QYHB 3CC4Q 4BE0A 4C0DC 2EQJA 2LVMA 2ED0A 2F2XA 4HT9A 2AK5A 3KXTA 4JUVA 1VA7A 2K79A 2MWOA 4M77G 4Z02A 1JJ2A 3EH1A 1VQMQ 1NEGA 1VQ5T 1UHCA 5FWCA 3FRNA 1G3SA 3JCMV 3G6EA 2M9UA 1MMNA 1YNZA 1ZUYA 1QVGP 1YIJQ 4PL6A 5KYWB 1VQ9Q 1VIEA 1JXMA 1UJ0A 2F69A 3MKDA 4J9EA 1Z9ZA 2DM1A 3NTIA 3PE0A 3VRYA 3JB9F 2BTTA 2FYKA 2JNGA 2ENMA 1QVGS 4B6MA 4N0AA 4HVVA 2XDBA 5I2MA 2VASA 2XD0A 1N27A 3OYGA 1I1JA 3QJ6A 4OGEA 1HK9A 4KGZB 1DJ7B 2JVVA 5LJ5h 4PNOA 4C92E 1YI2Q 1Q86C 1YJ9Q 3E2UA 3L2ZA 2QQSA 3PGGA 3A8MB 1I0CA 1B34B 5GAN8 1R8OB 1X27A 3PVLA 4CI0C 4FM4B 3OYEA 4M78E 3OYYA 1I5OB 2L8DA 3RKXA 4XTZA
chains in the Genus database with same CATH topology
2A08A 4X1VA 2FO0A 3QWYA 1X43A 1Y0MA 1QWEA 2F2VA 1QKWA 1NLPC 2B86A 5IH2A 3THKA 4KRTA 2DBMA 4FSSA 3VS2A 3O5ZA 2RQTA 1VYTA 1BU1A 2LNHB 3TSZA 4Z8AA 4JJBA 2D8JA 1NLOC 1BK2A 5FW9A 4AFZC 2ECZA 1NG2A 1WYXA 1GCQC 3I5SA 2EW3A 4OMPA 2K9GA 1AWWA 3NMZC 2DF6A 1GCPA 2IIMA 1EFNA 1MUZA 1OV3A 2EYZA 1UDLA 1AZEA 2J6FA 1BBZA 2D0NA 4ESRA 2AZVA 2EYYA 4R0KA 4J9IA 2DX1A 2KT1A 2LQNA 1AWXA 2FRYA 2JW4A 4GBQA 4AFSC 4RTXA 4JZ4A 2CUBA 2DMOA 1M3AA 2M51A 4JZ3A 2G6FX 2JMAA 2JS2A 2VVKA 1GFCA 2KBTA 2RNAA 3SHWA 3VS3A 2KE9A 1OOTA 2KXCA 1ABOA 3QWXX 4F14A 3M0SA 2EYWA 2DJQA 3VS4A 1WIEA 3NPFA 4JPBW 2GQIA 2EVRA 2HSPA 1SPKA 2O31A 1AD5A 2J6KA 1YCSB 1OPLA 2KR3A 4DEXA 2RQWA 2O88A 1ZUKA 2D8HA 1M8MA 1B3QA 4F16A 4ORZA 2KT8A 2DILA 1W70A 1HJDA 2BZXA 2LX7A 1PWTA 1UTIA 1E6HA 3FJ5A 2EKHA 1U5SA 4K11A 4RUGA 2ROLA 1N5ZA 3GBQA 1AEYA 3M0QA 4RTZA 2YUOA 1RLQC 5ECAA 1PKTA 1WA7A 2JM8A 2KGTA 1PHTA 1GCQA 2AKLA 1WX6A 2YUQA 1G2BA 1RUWA 2CH4W 4Z88A 3EG2A 1JEGA 1M3BA 4AG1C 1PKSA 2FEIA 2OAWA 2H8HA 1E7OA 4D8KA 1K76A 4D8DA 1SRLA 2V1RA 2KYMA 1X69A 2ABLA 1WXTA 2JM9A 4J9HA 1NYGA 2A36A 3ZL7C 3NGPA 1NYFA 1S1NA 2EGCA 4J9CA 1YP5A 2OI3A 1JO8A 5GJVB 2K6DA 2RMOA 1U3OA 2LJ1A 2SRCA 2ROTA 1K9AA 1WXUA 2K7AA 2DL8A 3RBBB 1M30A 2RF0A 2AZSA 2PZ1A 4LUDA 3UA6A 1SRMA 2E5KA 1MV0B 3UA7A 1ZX6A 2CUDA 4IIMA 2EGAA 2KRNA 1Y57A 1SEMA 4LN2A 4RTYA 3M0PA 1WXBA 2KYBA 2EPDA 1WFWA 3TSWA 5IXFA 1K0SA 2O2OA 2DNUA 2DE0X 2NWMA 2DL5A 1MV3A 2GTJA 2ESWA 1H3HA 3H0IA 2LMJA 2JT4A 2PTKA 3U23A 2C0TA 2K3BA 1GRIA 2M0YA 4WCIA 1FMKA 4HCKA 4CC4B 1V1CA 1QWFA 1W1FA 3R6NA 1PRMC 2MOXA 1AOJA 2K2MA 4QT7A 1GBRA 4A63B 2NUZA 1IO6A 2JTEA 2JMCA 3VS6A 3A98A 2BZ8A 1QCFA 4J9GA 2A28A 1YN8A 2PNIA 2CT4A 2DRMA 3VS7A 1JXOA 1AWOA 1H92A 2DRKA 1W6XA 2J05A 3I5RA 4E6RA 1SHGA 2HEQA 2O9VA 2KRSA 3VS5A 2DYBA 3EG1A 3ULRB 4J9FA 4DEYA 2P4RA 1AZGB 2J06A 1TG0A 2XMFA 1Z9QA 2KEAA 3C0CA 1HSQA 3H0HA 2MIOA 2LQWA 1OEBA 2EBPA 2QDLA 2KROA 1BB9A 3SEMA 1RLPC 3I35A 2YUNA 1TUDA 5IHIA 1NEBA 2FPDA 1T0JA 3RNJA 3EG0A 2RQUA 1PRLC 2GGRA 2C0OA 2DA9A 1QLYA 4LUEA 1G83A 2OJ2A 5I22A 4CC3A 1T3SA 4Y92A 1PNJA 1UHFA 2HCKA 2X3WD 1FYNA 3VS1A 2DL4A 1ABQA 2AKKA 1I07A 3I9QA 4OMMA 1QKXA 1LCKA 4RTUA 1SHFA 1X6GA 1WI7A 1UJYA 2V1QA 1WDXA 1ZUUA 2HDAA 3M0RA 1A0NB 1AVZC 2RN8A 1B07A 2FPFA 2C0IA 2EQIA 3KFVA 1CSKA 2LZ6B 3EHRA 2FG0A 1RI9A 3VS0A 1U06A 2KXDA 4AFQC 4J9DA 2VWFA 2SEMA 1KFZA 2CDTA 2F2WA 1T0HA 2GBQA 2L3QA 2GTOA 1M27C 2FPEA 1UECA 1ZBJA 1KSWA 4HVUA 5IHKA 1YWOA 5I11A 1UG1A 2D1XA 2YSQA 2YUPA 1UUEA 2RPNA 1UFFA 2GNCA 2J6OA 1JQQA 1GBQA 2ED1A 3M0TA 1E6GA 2HBWA 2LJ3A 2EGEA 4EIKA 1X6BA 1GFDA 2JS0A 2LJ0A 1H8KA 2CT3A 3VRZA 1X2KA 5IXBA 2JXBA 3EGUA 4LE9A 4HVWA 1KJWA 4J9BA 3CQTA 5IHNA 2A37A 5HCKA 2CH4A 2DLPA 5FWBA 2EYXA 2YT6A 2L3PA 1K0XA 3H0FA 4OMNA 4F17A 4RTWA 1ARKA 1HD3A 1T3LA 2RQRA 4GLMA 2KRMA 1SSHA 4CC2A 2X3XD 3TVTA 1JU5C 2L0AA 4IIOA 1UE9A 2RQVA 3PVQA 1WLPB 1OPKA 1M3CA 2ED0A 2F2XA 1K1ZA 2AK5A 4OMQA 2BZYA 4HXJA 4LNPA 1VA7A 2K79A 1GL5A 2KNBB 4JJDA 5GJWB 2LCSA 2FRWA 3REAB 1XOVA 3NHNA 1NEGA 1UHCA 2VKNA 3UF4A 5EC7A 5FWCA 3JV3A 1YNZA 1ZUYA 2DL3A 1VYUA 1JXMA 1UJ0A 4J9EA 1Z9ZA 1TUCA 1NM7A 2DM1A 3H41A 3PE0A 3VRYA 4Z89A 2BTTA 2L2PA 4AG2C 4CC7A 2ENMA 1AWJA 3EG3A 4RTTA 4HVVA 2W10A 1CKAA 3EHQA 1X2QA 3REBB 1ZLMA 3M0UA 5L23A 2O9SA 1YWPA 2DBKA 1I1JA 3IQLA 2YDLA 4JJCA 2J7IA 2LP5A 3UATA 3LH5A 2CREA 4OMLA 2CSIA 4OMOA 2W0ZA 4M4ZA 1CKBA 1ZSGA 2DVJA 1J3TA 1UGVA 1I0CA 4ZNXA 2DL7A 2CSQA 2MCNA 1VYVA 1X27A 3PVLA 4AFUC 2L3SA 1K4US 1KIKA 4RTVA 2I0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  4X1V A;  2FO0 A;  3QWY A;  1X43 A;  1Y0M A;  1QWE A;  2F2V A;  1QKW A;  1NLP C;  2B86 A;  5IH2 A;  3THK A;  4KRT A;  2DBM A;  4FSS A;  3VS2 A;  3O5Z A;  2RQT A;  1VYT A;  1BU1 A;  2LNH B;  3TSZ A;  4Z8A A;  4JJB A;  2D8J A;  1NLO C;  1BK2 A;  5FW9 A;  4AFZ C;  2ECZ A;  1NG2 A;  1WYX A;  1GCQ C;  3I5S A;  2EW3 A;  4OMP A;  2K9G A;  1AWW A;  3NMZ C;  2DF6 A;  1GCP A;  2IIM A;  1EFN A;  1MUZ A;  1OV3 A;  2EYZ A;  1UDL A;  1AZE A;  2J6F A;  1BBZ A;  2D0N A;  4ESR A;  2AZV A;  2EYY A;  4R0K A;  4J9I A;  2DX1 A;  2KT1 A;  2LQN A;  1AWX A;  2FRY A;  2JW4 A;  4GBQ A;  4AFS C;  4RTX A;  4JZ4 A;  2CUB A;  2DMO A;  1M3A A;  2M51 A;  4JZ3 A;  2G6F X;  2JMA A;  2JS2 A;  2VVK A;  1GFC A;  2KBT A;  2RNA A;  3SHW A;  3VS3 A;  2KE9 A;  1OOT A;  2KXC A;  1ABO A;  3QWX X;  4F14 A;  3M0S A;  2EYW A;  2DJQ A;  3VS4 A;  1WIE A;  3NPF A;  4JPB W;  2GQI A;  2EVR A;  2HSP A;  1SPK A;  2O31 A;  1AD5 A;  2J6K A;  1YCS B;  1OPL A;  2KR3 A;  4DEX A;  2RQW A;  2O88 A;  1ZUK A;  2D8H A;  1M8M A;  1B3Q A;  4F16 A;  4ORZ A;  2KT8 A;  2DIL A;  1W70 A;  1HJD A;  2BZX A;  2LX7 A;  1PWT A;  1UTI A;  1E6H A;  3FJ5 A;  2EKH A;  1U5S A;  4K11 A;  4RUG A;  2ROL A;  1N5Z A;  3GBQ A;  1AEY A;  3M0Q A;  4RTZ A;  2YUO A;  1RLQ C;  5ECA A;  1PKT A;  1WA7 A;  2JM8 A;  2KGT A;  1PHT A;  1GCQ A;  2AKL A;  1WX6 A;  2YUQ A;  1G2B A;  1RUW A;  2CH4 W;  4Z88 A;  3EG2 A;  1JEG A;  1M3B A;  4AG1 C;  1PKS A;  2FEI A;  2OAW A;  2H8H A;  1E7O A;  4D8K A;  1K76 A;  4D8D A;  1SRL A;  2V1R A;  2KYM A;  1X69 A;  2ABL A;  1WXT A;  2JM9 A;  4J9H A;  1NYG A;  2A36 A;  3ZL7 C;  3NGP A;  1NYF A;  1S1N A;  2EGC A;  4J9C A;  1YP5 A;  2OI3 A;  1JO8 A;  5GJV B;  2K6D A;  2RMO A;  1U3O A;  2LJ1 A;  2SRC A;  2ROT A;  1K9A A;  1WXU A;  2K7A A;  2DL8 A;  3RBB B;  1M30 A;  2RF0 A;  2AZS A;  2PZ1 A;  4LUD A;  3UA6 A;  1SRM A;  2E5K A;  1MV0 B;  3UA7 A;  1ZX6 A;  2CUD A;  4IIM A;  2EGA A;  2KRN A;  1Y57 A;  1SEM A;  4LN2 A;  4RTY A;  3M0P A;  1WXB A;  2KYB A;  2EPD A;  1WFW A;  3TSW A;  5IXF A;  1K0S A;  2O2O A;  2DNU A;  2DE0 X;  2NWM A;  2DL5 A;  1MV3 A;  2GTJ A;  2ESW A;  1H3H A;  3H0I A;  2LMJ A;  2JT4 A;  2PTK A;  3U23 A;  2C0T A;  2K3B A;  1GRI A;  2M0Y A;  4WCI A;  1FMK A;  4HCK A;  4CC4 B;  1V1C A;  1QWF A;  1W1F A;  3R6N A;  1PRM C;  2MOX A;  1AOJ A;  2K2M A;  4QT7 A;  1GBR A;  4A63 B;  2NUZ A;  1IO6 A;  2JTE A;  2JMC A;  3VS6 A;  3A98 A;  2BZ8 A;  1QCF A;  4J9G A;  2A28 A;  1YN8 A;  2PNI A;  2CT4 A;  2DRM A;  3VS7 A;  1JXO A;  1AWO A;  1H92 A;  2DRK A;  1W6X A;  2J05 A;  3I5R A;  4E6R A;  1SHG A;  2HEQ A;  2O9V A;  2KRS A;  3VS5 A;  2DYB A;  3EG1 A;  3ULR B;  4J9F A;  4DEY A;  2P4R A;  1AZG B;  2J06 A;  1TG0 A;  2XMF A;  1Z9Q A;  2KEA A;  3C0C A;  1HSQ A;  3H0H A;  2MIO A;  2LQW A;  1OEB A;  2EBP A;  2QDL A;  2KRO A;  1BB9 A;  3SEM A;  1RLP C;  3I35 A;  2YUN A;  1TUD A;  5IHI A;  1NEB A;  2FPD A;  1T0J A;  3RNJ A;  3EG0 A;  2RQU A;  1PRL C;  2GGR A;  2C0O A;  2DA9 A;  1QLY A;  4LUE A;  1G83 A;  2OJ2 A;  5I22 A;  4CC3 A;  1T3S A;  4Y92 A;  1PNJ A;  1UHF A;  2HCK A;  2X3W D;  1FYN A;  3VS1 A;  2DL4 A;  1ABQ A;  2AKK A;  1I07 A;  3I9Q A;  4OMM A;  1QKX A;  1LCK A;  4RTU A;  1SHF A;  1X6G A;  1WI7 A;  1UJY A;  2V1Q A;  1WDX A;  1ZUU A;  2HDA A;  3M0R A;  1A0N B;  1AVZ C;  2RN8 A;  1B07 A;  2FPF A;  2C0I A;  2EQI A;  3KFV A;  1CSK A;  2LZ6 B;  3EHR A;  2FG0 A;  1RI9 A;  3VS0 A;  1U06 A;  2KXD A;  4AFQ C;  4J9D A;  2VWF A;  2SEM A;  1KFZ A;  2CDT A;  2F2W A;  1T0H A;  2GBQ A;  2L3Q A;  2GTO A;  1M27 C;  2FPE A;  1UEC A;  1ZBJ A;  1KSW A;  4HVU A;  5IHK A;  1YWO A;  5I11 A;  1UG1 A;  2D1X A;  2YSQ A;  2YUP A;  1UUE A;  2RPN A;  1UFF A;  2GNC A;  2J6O A;  1JQQ A;  1GBQ A;  2ED1 A;  3M0T A;  1E6G A;  2HBW A;  2LJ3 A;  2EGE A;  4EIK A;  1X6B A;  1GFD A;  2JS0 A;  2LJ0 A;  1H8K A;  2CT3 A;  3VRZ A;  1X2K A;  5IXB A;  2JXB A;  3EGU A;  4LE9 A;  4HVW A;  1KJW A;  4J9B A;  3CQT A;  5IHN A;  2A37 A;  5HCK A;  2CH4 A;  2DLP A;  5FWB A;  2EYX A;  2YT6 A;  2L3P A;  1K0X A;  3H0F A;  4OMN A;  4F17 A;  4RTW A;  1ARK A;  1HD3 A;  1T3L A;  2RQR A;  4GLM A;  2KRM A;  1SSH A;  4CC2 A;  2X3X D;  3TVT A;  1JU5 C;  2L0A A;  4IIO A;  1UE9 A;  2RQV A;  3PVQ A;  1WLP B;  1OPK A;  1M3C A;  2ED0 A;  2F2X A;  1K1Z A;  2AK5 A;  4OMQ A;  2BZY A;  4HXJ A;  4LNP A;  1VA7 A;  2K79 A;  1GL5 A;  2KNB B;  4JJD A;  5GJW B;  2LCS A;  2FRW A;  3REA B;  1XOV A;  3NHN A;  1NEG A;  1UHC A;  2VKN A;  3UF4 A;  5EC7 A;  5FWC A;  3JV3 A;  1YNZ A;  1ZUY A;  2DL3 A;  1VYU A;  1JXM A;  1UJ0 A;  4J9E A;  1Z9Z A;  1TUC A;  1NM7 A;  2DM1 A;  3H41 A;  3PE0 A;  3VRY A;  4Z89 A;  2BTT A;  2L2P A;  4AG2 C;  4CC7 A;  2ENM A;  1AWJ A;  3EG3 A;  4RTT A;  4HVV A;  2W10 A;  1CKA A;  3EHQ A;  1X2Q A;  3REB B;  1ZLM A;  3M0U A;  5L23 A;  2O9S A;  1YWP A;  2DBK A;  1I1J A;  3IQL A;  2YDL A;  4JJC A;  2J7I A;  2LP5 A;  3UAT A;  3LH5 A;  2CRE A;  4OML A;  2CSI A;  4OMO A;  2W0Z A;  4M4Z A;  1CKB A;  1ZSG A;  2DVJ A;  1J3T A;  1UGV A;  1I0C A;  4ZNX A;  2DL7 A;  2CSQ A;  2MCN A;  1VYV A;  1X27 A;  3PVL A;  4AFU C;  2L3S A;  1K4U S;  1KIK A;  4RTV A;  2I0N A; 
#chains in the Genus database with same CATH topology
 5GMK m;  4X1V A;  3CMA Q;  5GMK h;  3ASK A;  1EX4 A;  4PJL A;  1TU0 B;  1Q95 G;  1NLP C;  2CZ0 B;  2GF7 A;  3MET A;  2H3E B;  1YJN A;  3JSC A;  2DZ9 A;  2LQK A;  3VS2 A;  1LOJ A;  3TSZ A;  4JJB A;  2YRC A;  1QVP A;  2D8J A;  4RG2 A;  1OI1 A;  4IUV A;  2QTX A;  2Y4X A;  2QA4 Q;  3OS5 A;  2EW3 A;  1K8A U;  3CCE A;  2K9G A;  4OB1 B;  4F7U E;  3CC4 A;  2RM4 A;  1JRI A;  1VQK T;  5FRM A;  3QSU A;  4A4K A;  5FLX E;  4ESR A;  2CZ7 B;  4J7I A;  2EYY A;  1K8A C;  1C1A A;  2DX1 A;  2HL5 C;  3SFM A;  2PVG B;  2LT4 A;  4RTX A;  2IPO B;  1JB0 E;  5GAN d;  1WHM A;  1M3A A;  2M51 A;  1KQS A;  2QK0 A;  2RNA A;  1PD0 A;  2HKN A;  2QG9 B;  2KE9 A;  1OOT A;  2KXC A;  3CCM Q;  2EYW A;  3CXC P;  2DJQ A;  1VIF A;  4MMK A;  4PFO A;  3JB9 G;  4DOW A;  3V8L A;  3EAE A;  3GF5 A;  2EVR A;  2O31 A;  4QVD A;  1YCS B;  2X4W A;  2RQW A;  1ZA2 B;  1IRE B;  1S72 A;  1ZUK A;  2D8H A;  2EAY A;  1QVG A;  4JRK A;  1M8M A;  3CBO A;  2E70 A;  2DIL A;  1HJD A;  5KYY B;  2LX7 A;  1W2B P;  1G3Y A;  1M1K R;  3RER A;  1N5Z A;  3M0Q A;  3SWN C;  1W4S A;  5KYU B;  3MP6 A;  2FHD A;  2JM8 A;  4Y91 A;  5DY9 A;  2AKL A;  2VGN A;  4Z88 A;  1M2V A;  4AMC A;  1JEG A;  1V29 B;  4C8Q B;  4BI4 A;  3C95 A;  2OAW A;  2H8H A;  1K76 A;  4PJO F;  2KYM A;  1VQO T;  1M1F A;  1M2O A;  1WXT A;  1NYG A;  4D6W A;  5FU7 C;  1NYF A;  2XK0 A;  3OYH A;  3CCJ A;  3JAM E;  4M78 A;  2MAM A;  4M77 D;  3I55 T;  1BIA A;  3ZFJ A;  2BE7 D;  3M59 A;  2ROT A;  3OS0 A;  1M30 A;  3EG9 B;  3VU3 C;  1D1C A;  1MV0 B;  3UA7 A;  2HQX A;  2EGA A;  5J26 A;  1SEM A;  3PIO A;  2ATC B;  3M0P A;  5IXF A;  1MMD A;  3TSW A;  3BFM A;  2ZZD A;  1U1S A;  4E7S A;  2DE0 X;  3P8B B;  2DL5 A;  2ESW A;  4F04 B;  4A4F A;  3KUF A;  1SKU B;  2DER A;  2JT4 A;  2LMJ A;  4A4G A;  1FWZ A;  2M16 A;  4BI3 A;  1Q82 C;  1M1K U;  1VQ9 T;  3NTH A;  5KYY A;  1QWF A;  1R77 A;  1W1F A;  1PRM C;  2I2L A;  2K2M A;  4QT7 A;  3NTK A;  1C0M A;  4XTU A;  2DRM A;  4C92 G;  4ELZ C;  4MDX A;  3E1S A;  1VQL T;  2DZC A;  2DIG A;  1KQS S;  4FT4 A;  4M7A C;  1VQM T;  1M1G A;  4DBR A;  2HNI A;  3ULR B;  1W2B A;  2E3I A;  3BDU A;  2K4Y A;  1YIJ T;  2JUF A;  1Z9Q A;  2KEA A;  2QTV A;  3C0C A;  2XKO C;  3H0H A;  1KC8 C;  3FEO A;  1MNE A;  3G4S A;  2EBP A;  5HKC A;  2KRO A;  3SD4 A;  1VQN Q;  1RLP C;  2RI5 A;  3FLG A;  3EGD B;  4C92 F;  3PNW C;  2VB6 A;  4IUR A;  4ZN3 A;  2FPD A;  4FSX A;  1KQ1 A;  3DB4 A;  4FW1 A;  2C0O A;  4OB2 B;  3ZBD A;  4HKE A;  4OP0 A;  1PNJ A;  1YI2 T;  5GMK e;  2DTI A;  2RHX A;  2WSC E;  2HCK A;  4JS4 A;  5J39 A;  3BY7 A;  4M78 F;  1FYN A;  3OYM A;  4OMM A;  4RTU A;  5A0L A;  3FDR A;  6AT1 B;  4OVA A;  2DYI A;  4C0Z A;  1WI7 A;  1PD1 A;  3M55 A;  2CP3 A;  1BI3 A;  1UJY A;  1D3B A;  1IHV A;  5DM7 R;  3UPU A;  3JCM Q;  1WHL A;  2A0F B;  1ZUU A;  2QYZ A;  2EQI A;  2FPF A;  5KE3 A;  3EFO B;  2LZ6 B;  3EHR A;  1TOV A;  2CZ1 B;  5LJ5 e;  4J6W A;  1RAD B;  1KFZ A;  5GAN e;  3ME9 A;  4X9C A;  3M4Y A;  1VQ8 Q;  1M27 C;  3P8D A;  1ZBJ A;  4Y28 E;  3I56 T;  2KSS A;  3OYF A;  1YWO A;  5I11 A;  4BDY A;  2D1X A;  2YSQ A;  2QQ9 A;  1UUE A;  4MZM A;  1UFF A;  1YJW T;  2GNC A;  2E64 A;  1JQQ A;  3CC4 T;  2ZPI B;  1E6G A;  2KQW A;  3L2Q A;  4EIK A;  5LJ5 j;  2EFI A;  1H8K A;  1OQK A;  2NLU A;  2JXB A;  2QEX A;  4M7D G;  1M8V A;  4LE9 A;  2DJZ A;  4C0F A;  3JCM X;  2DAQ A;  3LGF A;  1G8X A;  1D1A A;  5FWB A;  2YT6 A;  5D6W A;  5GAO l;  2GFU A;  4OMN A;  4C5G A;  4F17 A;  3CC2 A;  1VQP Q;  4C8Q F;  3MP1 A;  1W2B S;  2V26 A;  4CC2 A;  2X3X D;  1JU5 C;  3PIP A;  1QW1 A;  2JJ9 A;  4M77 E;  3PVQ A;  5KYU A;  3I56 A;  3QDF A;  1M3C A;  3HRT A;  1M90 R;  1Y71 A;  1B7T A;  4JJD A;  5GJW B;  2QGG A;  1VQK Q;  1VQ7 A;  3CCL A;  3CXC S;  2QQB A;  1N9R A;  1XOV A;  3NHN A;  3L2U A;  2LRQ A;  3UF4 A;  3I55 A;  1TWB A;  2NUT A;  1AHJ B;  3QII A;  1OX8 A;  4M75 B;  3QZ9 B;  8ATC B;  3EG9 A;  3V7S A;  2DL3 A;  2RA2 A;  3GIB A;  3X25 B;  3CCU Q;  3G71 A;  2V8K A;  3CCQ A;  4PLI A;  2MI6 A;  1RAB B;  4CC7 A;  3CCR A;  1AWJ A;  3EG3 A;  3OYN A;  4BY6 B;  4EDU A;  4PJN A;  5CCA A;  1CKA A;  1WJQ A;  3EHQ A;  3CC7 A;  3CCM T;  3G1J A;  2D9T A;  3CC2 T;  2RD1 A;  2WSF E;  2YLC A;  3CCJ Q;  4PK4 A;  5GAM e;  4A4H A;  2J7I A;  4OML A;  4FYX B;  3QXE B;  3CCR Q;  4E7I A;  2QEX T;  1RAC B;  3V7C A;  4M7A D;  3G71 Q;  4ZNX A;  2DL7 A;  5CQY A;  4AFU C;  2L3S A;  4ATO A;  4L59 A;  2O4X B;  3HKS A;  2YRV A;  3A8L B;  3INZ A;  3QKJ A;  4EMH A;  1YIT T;  1PSF A;  2FO0 A;  1K9M R;  4LDX A;  2VXF A;  1VQM A;  1X43 A;  1Y0M A;  1QKW A;  1UB4 A;  1ZSZ A;  5IH2 A;  4EPC A;  1LNX A;  5L8R E;  3O5Z A;  1V76 A;  1VYT A;  1BU1 A;  4QVZ A;  2CP5 A;  4Z8A A;  3CMA T;  1KQ2 A;  5FU7 B;  1NLO C;  3HP9 A;  4RMO A;  5GAN j;  2P84 A;  2EYQ A;  2O01 E;  5FW9 A;  4C92 A;  3CEY A;  2ECZ A;  1NG2 A;  3MJX A;  4MZT A;  1GCQ C;  4XQ3 A;  3M53 A;  4DA4 A;  1Q86 U;  3CCS Q;  2DF6 A;  1GCP A;  2DXB A;  1MUZ A;  1OUL A;  2EYZ A;  3CBM A;  5KYN A;  2XI9 A;  4XU0 A;  4RKU E;  2J6F A;  4PKC C;  1BBZ A;  5GMK i;  1NPR A;  4C8Q G;  2RJD A;  4M75 E;  5LJ3 d;  4BE1 A;  3HL8 A;  4E7H A;  4XU2 A;  1AWX A;  3H8Z A;  2FRY A;  4AFS C;  3L2V A;  1VQ4 A;  4JZ4 A;  2A3L A;  3KBG A;  4ME7 A;  3CCS A;  3G4S Q;  1D3B B;  1BIB A;  2KDS A;  4JZ3 A;  2RHZ A;  3H9N A;  3BE3 A;  3CCV T;  3OW2 S;  4C92 D;  3CXC A;  1KG1 A;  1ZHI A;  5D6X A;  4F14 A;  2L89 A;  2YWW A;  1KC8 R;  2Y4Y A;  3BW1 A;  4JPB W;  3OS2 A;  3H6Z A;  2EKO A;  4JRI A;  2J6K A;  1OPL A;  4DEX A;  2D0Q B;  5GAM f;  5A0D A;  3M9Q A;  3RKY A;  4F16 A;  2JOY A;  2HAX A;  1G3T A;  1W70 A;  4M7D D;  1LPL A;  5J3B A;  4E47 A;  3OY9 A;  2EKH A;  3OYK A;  1NPP A;  1R0B G;  2ROL A;  5GAN f;  2PVD B;  3GBQ A;  4RTZ A;  4KUD K;  5ECA A;  2EJ9 A;  1SSF A;  1FXX A;  1WA7 A;  3HSB A;  2VXE A;  1GCQ A;  1G2B A;  2CH4 W;  2QAZ A;  4ANJ A;  3MHX A;  2MPX C;  4AG1 C;  1O75 A;  2FEI A;  1XQH A;  1S72 T;  2OAU A;  2V1R A;  3CPW A;  1X69 A;  4J9H A;  2A36 A;  3ZL7 C;  2NUP B;  1S1N A;  1N6A A;  3G6E T;  3JCM W;  1P92 A;  1JJ2 P;  3PMT A;  1XTD A;  2K6D A;  2OTL Q;  1U3O A;  5IAY A;  5CKF A;  1WXU A;  2DL8 A;  3RBB B;  3VJP A;  5GAM j;  2RF0 A;  2E65 A;  3QJY A;  3EH2 A;  1IXD A;  2FVU A;  1VQ6 A;  5CKH A;  2E10 A;  1BI2 A;  4FIB A;  4IIM A;  4NL3 A;  2HD0 A;  4LN2 A;  4RTY A;  4XTW A;  3CME A;  5D6Y A;  2E41 A;  4PJO A;  1ZSZ C;  2NWM A;  2GTJ A;  1UGR B;  1Q81 C;  1RAE B;  5GAO p;  5LJ3 g;  4M77 F;  2LTO A;  1NJI R;  2C0T A;  1VQK A;  2M0Y A;  3V7R A;  3E9G A;  2NUZ A;  3M4G A;  4WTO B;  2BZ8 A;  1QCF A;  3JCM h;  1YN8 A;  2PNI A;  2CT4 A;  1JXO A;  1AWO A;  4M7D F;  2BIV A;  2X9H A;  2J05 A;  1JBM A;  3I5R A;  3FIF A;  3ZEH A;  5GAM d;  3HFO A;  3OW2 A;  1Q82 R;  4E7Z A;  2CGH A;  1SHG A;  2HEQ A;  2O9V A;  3MEU A;  2KRS A;  3VS5 A;  3FJP A;  3QDR B;  3RKW A;  3JB9 I;  3C94 A;  2JZ2 A;  4DQ2 A;  2P4R A;  1AZG B;  2J06 A;  4HCC A;  4KGV B;  5CVI A;  1HSQ A;  2CS7 A;  2MIO A;  2QDL A;  3G71 T;  3CBP A;  5FU6 B;  3VYG A;  1O9S A;  2ZPG B;  3A8H B;  2E5Q A;  5IHI A;  1OYX A;  1IHW A;  3Q1J A;  3PMI A;  3RNJ A;  1I81 A;  1TSF A;  4QW2 A;  1VQ7 T;  2GGR A;  4BUG A;  1WPY A;  1TTH B;  1QLY A;  3MEW A;  2OJ2 A;  5I22 A;  1NJI U;  4PJO C;  2FZK B;  4Y92 A;  5GAN 5;  4M7D B;  2DL4 A;  3O8V A;  1ABQ A;  4XTX A;  1VUB A;  4ZGJ B;  4GY5 A;  4ZGD B;  2EIF A;  3SWN A;  1LCK A;  4BB7 A;  1VQP A;  5KH6 A;  1X6G A;  2R5A A;  3CPW S;  2LX9 A;  1YJ9 T;  5GAN 6;  2OTL T;  1M9S A;  2YRD A;  1YIT Q;  2HDA A;  2K2V A;  1YCY A;  3VYH B;  4DOV A;  2RN8 A;  1B07 A;  4M7D E;  2C0I A;  2RB6 A;  1X75 C;  3S3N A;  2OTJ Q;  1VQ5 A;  1RI9 A;  3OB9 A;  1U06 A;  4N4G A;  3VS0 A;  1VQ6 T;  4MZP A;  4M78 C;  5IT9 E;  4R56 A;  4BI8 B;  4AT1 B;  4P5N A;  4DBF A;  2E12 A;  5LJ3 j;  4RG8 A;  1PM3 A;  4HVU A;  5IHK A;  1VOM A;  2YUP A;  3HPW A;  1EZZ B;  3OMC A;  1YJ9 A;  3MO8 A;  5FRO A;  2DET A;  4KT0 E;  4L5G A;  2J6O A;  4M75 D;  2M02 A;  1GBQ A;  2ED1 A;  3M0T A;  2EGE A;  2DIQ A;  2DPP B;  1KQS P;  5GAN g;  2NYS A;  3LH0 A;  2LJ0 A;  2PU9 B;  3VRZ A;  5IXB A;  1TH7 A;  4C0G A;  4HVW A;  3CCQ Q;  2MF2 A;  4J9B A;  3CQT A;  2K3X A;  4ZTJ A;  3X28 B;  2DLP A;  1X01 A;  5FU6 C;  4ZN1 A;  1YIT A;  3OYJ A;  3E9F A;  3H0F A;  1N8R C;  4OB0 B;  5AYF A;  4XU3 A;  1ARK A;  3MEA A;  1OZ2 A;  3TVT A;  2RH2 A;  2L0A A;  5GAN 2;  3MEV A;  4J8O A;  2KAF A;  5I21 A;  3QZ5 B;  4QQG A;  4QVC A;  3OBY A;  1OPK A;  1IGU A;  2RHU A;  3WXM B;  1K1Z A;  3PT9 A;  1QMC A;  3VV0 A;  2BZY A;  3CC2 Q;  3A5Z B;  4LNP A;  3CCV A;  4HCB A;  1GL5 A;  2KNB B;  4Q5W A;  3N5B B;  3GPL A;  2LNV A;  2JTF A;  3REA B;  3CCM A;  1YHQ Q;  2VKN A;  3C12 A;  3JV3 A;  2YHT A;  2HMA A;  4IUQ A;  1F1B B;  1RAF B;  4BDZ A;  1VYU A;  3EFS A;  3CCQ T;  2P4T A;  2EJG A;  2OX7 A;  1TUC A;  2X35 A;  4UC4 A;  2HZY A;  1NZ9 A;  4HT8 A;  4C8Q E;  1YHQ A;  1UGP B;  1Q86 R;  1KHI A;  1X2Q A;  3REB B;  2CKK A;  3M0U A;  4C8Q D;  1D0Y A;  2L3R A;  2DBK A;  2DTO A;  3IQL A;  1EIF A;  2YDL A;  3GNG A;  3F70 A;  1WHH A;  2MYS A;  2HQE A;  2LP5 A;  1KD1 C;  3OSS C;  5GAO r;  4X34 A;  2W0Z A;  3I56 Q;  4ELY C;  4M4Z A;  2XIC A;  2IG0 A;  4E7L A;  1RAH B;  1IRX A;  3VUZ A;  1QCO A;  2CSQ A;  2MCN A;  1VQ4 Q;  5AT1 B;  8AT1 B;  1K4U S;  1KIK A;  2I0N A;  2A08 A;  2QA4 T;  2KMT A;  5A0G A;  2HQH A;  1QWE A;  4C92 B;  4QQD A;  1S72 Q;  2RJC A;  2B86 A;  1X6O A;  1B34 A;  4KRT A;  2DBM A;  3RUX A;  1YI2 A;  5CR2 A;  2RQT A;  3M58 A;  2LT1 A;  1BK2 A;  4N4I A;  2OTL A;  4AFZ C;  2COY A;  3CC7 Q;  3CC7 T;  1MND A;  1WYX A;  1VQ8 A;  5GAO q;  3CCJ T;  4F7U B;  1RI0 A;  4C8Q A;  2YLB A;  3NMZ C;  4HA8 A;  1H64 1;  3OA6 A;  1EFN A;  3EFO A;  1Q7Y U;  1WGS A;  1FMW A;  3J80 E;  5KYX B;  2D0N A;  5KCO A;  2JN0 A;  2AZV A;  2DVE A;  2LDM A;  4PLL A;  4R0K A;  3I55 Q;  1ZSZ B;  4GLK A;  2OTJ A;  3LX7 A;  4JRQ A;  2ZAE A;  4GBQ A;  5CKE A;  7AT1 B;  4BAC A;  3CCL T;  2CUB A;  4J83 A;  4XTY A;  2F5K A;  2JMA A;  4KUI A;  1Y07 A;  2JS2 A;  1ZQ1 A;  1GFC A;  3SHW A;  3JCM c;  4BY6 C;  1KC8 U;  2VUB A;  1VQ7 Q;  2K3Y A;  3QWX X;  1ABO A;  1AT1 B;  5GAO n;  3GNF B;  2DD5 A;  1VQ6 Q;  1MHN A;  2XG8 D;  3VS4 A;  1YBY A;  1WIE A;  3FC3 A;  3NPF A;  1RAA B;  2GQI A;  2HSP A;  2CYZ B;  4N0A C;  3X24 B;  2KR3 A;  1QVF A;  3RES A;  4M7A B;  5A2Q E;  4F7U F;  2QDY B;  1ACM B;  1KHC A;  3JB9 H;  4J5Y A;  4ORZ A;  2KT8 A;  1PWT A;  3FJ5 A;  1E6H A;  4RUG A;  4K11 A;  3LYI A;  3OSV A;  2LQ8 A;  1PHT A;  2QXF A;  5CKB A;  1WX6 A;  1RUW A;  1Q7Y R;  4B9W A;  2Y90 A;  3OYI A;  1RAI B;  3GLX A;  1E7O A;  4D8K A;  1Q82 U;  1SRL A;  4A54 A;  2R58 A;  3V8K A;  3L2W A;  2NUT B;  2JM9 A;  2EJF A;  4JRP A;  2ZGW A;  2X51 A;  1JO8 A;  1VQL A;  4FW2 A;  2D6F A;  1NJI C;  4FU6 A;  3LLR A;  2BE9 B;  2RMO A;  2B8A A;  2SRC A;  2DTH A;  3DLL A;  2PZ1 A;  4R55 A;  2QI2 A;  4IUP A;  2CUD A;  2DXC A;  2KRN A;  1WQW A;  4IUT A;  4OMF B;  3GOX A;  1C6V X;  1WXB A;  2KYB A;  3A8G B;  2V8J A;  3CD6 T;  2O2O A;  4FT2 A;  2DNU A;  1N9S A;  1I5L A;  1D0Z A;  3H0I A;  1K73 C;  5GAN 4;  2PTK A;  2MK5 A;  2K3B A;  1GRI A;  2RHI A;  1N8R R;  4WCI A;  1FMK A;  2X4J A;  4HCK A;  4V2S A;  4X9D A;  2BUD A;  1V1C A;  3QPH A;  1PCX A;  3UWN A;  4LDU A;  2DEU A;  2F5T X;  3BDL A;  4PJM A;  4A63 B;  3S3O A;  1IO6 A;  3VS6 A;  3A98 A;  4J9G A;  3CCV Q;  4M7A G;  1MMA A;  3TRE A;  1H92 A;  1QVF P;  4WF2 A;  4M75 G;  1W6X A;  3TU4 K;  1D09 B;  4RCC A;  1VQN A;  3HRU A;  2MWP A;  2DYB A;  2RI3 A;  4KH0 B;  4J9F A;  4DEY A;  2VV5 A;  2XMF A;  2RJE A;  5LJ3 f;  1BI1 A;  3SB2 A;  2CZ6 B;  1YIJ A;  1K73 U;  2LQW A;  3G6E Q;  1QVF S;  1BB9 A;  1IGQ A;  2HKQ B;  5LJ5 g;  1Q7Y C;  2E6Z A;  4M7A F;  1LVK A;  2VC8 A;  3I35 A;  4C8Q C;  2YUN A;  1TUD A;  3CCS T;  3CCE T;  2P0P A;  4BD3 A;  5GAO m;  1T0J A;  3EG0 A;  2RQU A;  3CPW P;  3SDZ A;  5C6S A;  5KE2 A;  2BKD N;  2DA9 A;  3EGX B;  4LUE A;  1G83 A;  3DKM A;  4CC3 A;  1T3S A;  4C0D B;  4LXC A;  2QA4 A;  4M78 G;  1OX9 A;  1N8R U;  2DD4 A;  4MDW A;  1UHF A;  1YJN T;  4XTV A;  3VS1 A;  2XDD A;  3I9Q A;  4PJO G;  3TEE A;  3FB9 A;  5GAM g;  1SHF A;  3QYG B;  5GAN h;  3MPU B;  4MML A;  4M77 C;  1WDX A;  3M0R A;  1Q81 U;  2DXU A;  1YFN A;  3KFV A;  4C5E A;  3PTA A;  2KXD A;  2E3H A;  1VQO Q;  2VWF A;  4J7F A;  1PC0 A;  3OBW A;  2CDT A;  1GXI E;  2F2W A;  2ZPF B;  2K5L A;  4EMK C;  2A7Y A;  2L3Q A;  3JCM J;  2COZ A;  1KSW A;  3CCL Q;  4KH1 B;  4RCB A;  2YXY A;  4NS5 A;  3M5A A;  1WHJ A;  2RPN A;  4PFP A;  1RAG B;  1XJW B;  4E7K A;  2HBW A;  2LJ3 A;  1X6B A;  2DK3 A;  4LD9 K;  2KK4 A;  5M9O A;  2JS0 A;  1RL2 A;  1KD1 U;  1PSE A;  3RDV A;  3CD6 A;  5C0M A;  4M7A A;  1TUG B;  4XK8 E;  1KJW A;  1ZA1 B;  4HCZ A;  5IHN A;  2AIR B;  5HCK A;  3GP8 A;  5CKD A;  2L3P A;  4ZGE B;  3JCM P;  1K0X A;  2E4H A;  2LCL A;  4IUU A;  1BCM A;  4A53 A;  4C92 C;  4RTW A;  1T3L A;  2RQR A;  4FYY B;  1BCO A;  3LWH A;  4OB3 B;  2KRM A;  4C5I A;  1Q81 R;  3A1P A;  3G4S T;  2ZCF B;  4IIO A;  3T9N A;  1QQJ A;  3HFN A;  2FZC B;  4M77 A;  1WLP B;  4PJO B;  3URG A;  2KY9 A;  3RMS A;  3OYL A;  1KK7 A;  4OMQ A;  4HXJ A;  1TXQ A;  4LDY A;  4L6V 5;  2LCS A;  2FRW A;  2XDP A;  1M90 U;  4E7J A;  3OMG A;  4YTL A;  5EC7 A;  3TCJ A;  4ZTF A;  4M77 B;  3EGX A;  1WHG A;  4EMG A;  3JCM e;  1NM7 A;  3L1A A;  3H41 A;  4LDV A;  1YHQ T;  4Z89 A;  2L2P A;  3OYB A;  4AG2 C;  4DBH A;  3CME T;  2DKG A;  3CME Q;  4RTT A;  2W10 A;  4EMK B;  1ZLM A;  3D7S B;  5CO7 A;  4NOY A;  5L23 A;  2O9S A;  1YWP A;  3G7Z A;  3A8O B;  4QKU A;  3QUI A;  4TVR A;  4JJC A;  3LW5 E;  4VUB A;  3UAT A;  3LH5 A;  2CRE A;  4O5V A;  4XU1 A;  4FYW B;  2EQK A;  2CSI A;  4OMO A;  1K9M C;  1UGS B;  1CKB A;  2FB7 A;  1ZSG A;  1QCN A;  2DVJ A;  2L5Q A;  1J3T A;  5LJ5 d;  1UGV A;  4M7D A;  1VYV A;  4FL6 A;  3DLM A;  3S6W A;  3SWN B;  1K9M U;  1FX7 A;  4RTV A;  3M57 A;  2DFU A;  3OS1 A;  1BI0 A;  2QEX Q;  3QWY A;  3OW2 P;  2X4X A;  1Y7X A;  2F2V A;  2PUK B;  3THK A;  4FSS A;  2LNH B;  4M75 A;  4N4H A;  4JJN K;  2QQA A;  4FYV B;  4KGX B;  1MMG A;  1HYO A;  2XID A;  4JS5 A;  1I4K 1;  3RIR A;  3M56 A;  2QGF B;  5HK3 A;  3OYA A;  4KUL A;  3I5S A;  4OF1 A;  4OMP A;  5CK9 A;  1AWW A;  2IVW A;  2DXT A;  3WVE B;  2IIM A;  1OV3 A;  3JCM g;  2Z0W A;  1UDL A;  1WNL A;  5LJ5 f;  1AZE A;  2ZPE B;  2KI7 A;  2FZG B;  2NUP A;  4J9I A;  2KT1 A;  2LQN A;  2PVO B;  3CPF A;  2JW4 A;  2F1L A;  1VQ4 T;  4CRI A;  2DMO A;  2G6F X;  2GFA A;  3MP8 A;  2VVK A;  2KBT A;  3VS3 A;  1OU8 A;  1VQL Q;  4PJO E;  3M0S A;  3J7A F;  1M4Z A;  2ZPH B;  2C06 A;  4PFZ A;  2RK2 A;  3C4S A;  5I2S A;  1SPK A;  1AD5 A;  3JCM f;  2O88 A;  1NE8 A;  4B9X A;  2M0O A;  1IB8 A;  1B3Q A;  3P8H A;  1BKB A;  1Y96 A;  4EMK A;  2CP6 A;  2BZX A;  3JB9 J;  3LWI A;  1VQ5 Q;  1UTI A;  1M2V B;  1SF9 A;  2PQW A;  5GAM h;  1U5S A;  3M54 A;  2P0K A;  1AEY A;  2YUO A;  1RLQ C;  3TQ7 P;  1K8A R;  1PKT A;  1FMV A;  2KGT A;  2YUQ A;  3EG2 A;  1QP3 A;  3EFR A;  1M3B A;  1PKS A;  1M1K C;  2H3J A;  2CP7 A;  1WHK A;  4O6J A;  4D8D A;  3S3M A;  5HY6 A;  5KCH A;  2ABL A;  2EQM A;  4KBM B;  3CCR T;  3NGP A;  2EGC A;  5GAN 7;  2RI2 A;  4J9C A;  3HHT B;  1XNI A;  1YP5 A;  2OI3 A;  1H3Z A;  3J81 E;  1WQ7 A;  5GJV B;  2LJ1 A;  2E6N A;  4M7D C;  2RHY A;  3L42 A;  1K9A A;  2K7A A;  4FCY A;  2AZS A;  1M90 C;  4LUD A;  3UA6 A;  2GQV A;  1SRM A;  2E5K A;  1ZX6 A;  4JLG A;  1MGQ A;  1ZBX A;  1Y57 A;  4DBQ A;  2EPD A;  1WFW A;  1K0S A;  1D1B A;  4BE2 A;  2K57 A;  5GAN 3;  1SG5 A;  1VQO A;  1MV3 A;  1H3H A;  5CAI A;  4PJO D;  3U23 A;  2X4Y A;  3UT1 A;  1UEB A;  4A4E A;  4M78 B;  4E2F B;  4CC4 B;  3JCM d;  4M78 D;  1WZO A;  2R57 A;  3OQ5 A;  5FRN A;  1YJW Q;  3R6N A;  1LJO A;  2MOX A;  1AOJ A;  4OGC A;  2MMP A;  1GBR A;  2JTE A;  2JMC A;  3EGD A;  1WJR A;  3PFS A;  3VKI A;  2XU8 A;  3NFC A;  2A28 A;  4II1 A;  3VS7 A;  3RMQ A;  5LJ3 e;  1R0C B;  3ER0 A;  2DO3 A;  2DRK A;  4E6R A;  3DB3 A;  2FL7 A;  2V8I A;  4JLI A;  3QHS A;  3EG1 A;  1VQ9 A;  1UGQ B;  1PG5 B;  1K73 R;  1TG0 A;  9ATC B;  1I8F A;  2GCX A;  5DLO A;  4M7A E;  1OEB A;  1TS9 A;  2K5I A;  3JRZ A;  3OYD A;  3SEM A;  2RO0 A;  4F7U A;  1HXD A;  3X20 B;  3AT1 B;  2E1H A;  2RJF A;  1NEB A;  1JJ2 S;  1PRL C;  3AHU A;  1M5Q 1;  2PUO B;  2EQU A;  5IN1 A;  2P0Q A;  5GMK l;  1YJW A;  5DLQ E;  2ZPB B;  4QQ6 A;  1WJS A;  2X3W D;  3VUB A;  2OTJ T;  1IZ6 A;  3QO3 A;  3WVD B;  1VQP T;  2AKK A;  1I07 A;  2KVQ G;  4IKF A;  1QKX A;  2AT1 B;  2O4X A;  1G3W A;  1BYM A;  3L2R A;  3OYC A;  3JB9 D;  3HTR A;  2HL3 A;  1VQN T;  5LL6 S;  3CCU A;  4M75 C;  2V1Q A;  1NBE B;  2G3R A;  2DEQ A;  1A0N B;  5CQX A;  1AVZ C;  1VQ8 T;  1CSK A;  2QQR A;  2FG0 A;  4AFQ C;  2COW A;  1OU9 A;  4J6X A;  4J9D A;  5GMK j;  1G5V A;  5LJ3 h;  4NL2 A;  2SEM A;  3CD6 Q;  3RR6 A;  4LD6 A;  2VGM A;  1T0H A;  2HBP A;  4JDS A;  2EWN A;  2GBQ A;  2VYT A;  2GTO A;  4LDW A;  2FPE A;  1UEC A;  1U8R A;  4F7U G;  3MCA B;  3HRS A;  3CCE Q;  1UG1 A;  2M1H A;  3QBY A;  3CCU T;  5D7U A;  4PJJ A;  2WSE E;  5KYW A;  2LCC A;  5EG2 A;  2CP0 A;  2XHC A;  2WAC A;  3QG1 A;  3X26 B;  3LGL A;  1YJN Q;  1KD1 R;  1GFD A;  2R5M A;  2CP2 A;  3E19 A;  2RK1 A;  2CT3 A;  2LC4 A;  1X2K A;  4J6Y A;  1QP2 A;  3EGU A;  3CMA A;  3V8J A;  5CIU A;  2A37 A;  4XAX B;  3UDC A;  2CH4 A;  2EYX A;  4C5H A;  1D0X A;  2JTM A;  1U1T A;  3R6O A;  1OZ3 A;  1HD3 A;  4M75 F;  3JCM b;  1Y96 B;  4GLM A;  1SSH A;  5KYX A;  1UE9 A;  2AHJ B;  5HK0 A;  2HSE B;  2QAS A;  2K5F A;  2RQV A;  3QYH B;  3CC4 Q;  4BE0 A;  4C0D C;  2EQJ A;  2LVM A;  2ED0 A;  2F2X A;  4HT9 A;  2AK5 A;  3KXT A;  4JUV A;  1VA7 A;  2K79 A;  2MWO A;  4M77 G;  4Z02 A;  1JJ2 A;  3EH1 A;  1VQM Q;  1NEG A;  1VQ5 T;  1UHC A;  5FWC A;  3FRN A;  1G3S A;  3JCM V;  3G6E A;  2M9U A;  1MMN A;  1YNZ A;  1ZUY A;  1QVG P;  1YIJ Q;  4PL6 A;  5KYW B;  1VQ9 Q;  1VIE A;  1JXM A;  1UJ0 A;  2F69 A;  3MKD A;  4J9E A;  1Z9Z A;  2DM1 A;  3NTI A;  3PE0 A;  3VRY A;  3JB9 F;  2BTT A;  2FYK A;  2JNG A;  2ENM A;  1QVG S;  4B6M A;  4N0A A;  4HVV A;  2XDB A;  5I2M A;  2VAS A;  2XD0 A;  1N27 A;  3OYG A;  1I1J A;  3QJ6 A;  4OGE A;  1HK9 A;  4KGZ B;  1DJ7 B;  2JVV A;  5LJ5 h;  4PNO A;  4C92 E;  1YI2 Q;  1Q86 C;  1YJ9 Q;  3E2U A;  3L2Z A;  2QQS A;  3PGG A;  3A8M B;  1I0C A;  1B34 B;  5GAN 8;  1R8O B;  1X27 A;  3PVL A;  4CI0 C;  4FM4 B;  3OYE A;  4M78 E;  3OYY A;  1I5O B;  2L8D A;  3RKX A;  4XTZ A; 
#chains in the Genus database with same CATH homology
 2A08 A;  4X1V A;  2FO0 A;  3QWY A;  1X43 A;  1Y0M A;  1QWE A;  2F2V A;  1QKW A;  1NLP C;  2B86 A;  5IH2 A;  3THK A;  4KRT A;  2DBM A;  4FSS A;  3VS2 A;  3O5Z A;  2RQT A;  1VYT A;  1BU1 A;  2LNH B;  3TSZ A;  4Z8A A;  4JJB A;  2D8J A;  1NLO C;  1BK2 A;  5FW9 A;  4AFZ C;  2ECZ A;  1NG2 A;  1WYX A;  1GCQ C;  3I5S A;  2EW3 A;  4OMP A;  2K9G A;  1AWW A;  3NMZ C;  2DF6 A;  1GCP A;  2IIM A;  1EFN A;  1MUZ A;  1OV3 A;  2EYZ A;  1UDL A;  1AZE A;  2J6F A;  1BBZ A;  2D0N A;  4ESR A;  2AZV A;  2EYY A;  4R0K A;  4J9I A;  2DX1 A;  2KT1 A;  2LQN A;  1AWX A;  2FRY A;  2JW4 A;  4GBQ A;  4AFS C;  4RTX A;  4JZ4 A;  2CUB A;  2DMO A;  1M3A A;  2M51 A;  4JZ3 A;  2G6F X;  2JMA A;  2JS2 A;  2VVK A;  1GFC A;  2KBT A;  2RNA A;  3SHW A;  3VS3 A;  2KE9 A;  1OOT A;  2KXC A;  1ABO A;  3QWX X;  4F14 A;  3M0S A;  2EYW A;  2DJQ A;  3VS4 A;  1WIE A;  3NPF A;  4JPB W;  2GQI A;  2EVR A;  2HSP A;  1SPK A;  2O31 A;  1AD5 A;  2J6K A;  1YCS B;  1OPL A;  2KR3 A;  4DEX A;  2RQW A;  2O88 A;  1ZUK A;  2D8H A;  1M8M A;  1B3Q A;  4F16 A;  4ORZ A;  2KT8 A;  2DIL A;  1W70 A;  1HJD A;  2BZX A;  2LX7 A;  1PWT A;  1UTI A;  1E6H A;  3FJ5 A;  2EKH A;  1U5S A;  4K11 A;  4RUG A;  2ROL A;  1N5Z A;  3GBQ A;  1AEY A;  3M0Q A;  4RTZ A;  2YUO A;  1RLQ C;  5ECA A;  1PKT A;  1WA7 A;  2JM8 A;  2KGT A;  1PHT A;  1GCQ A;  2AKL A;  1WX6 A;  2YUQ A;  1G2B A;  1RUW A;  2CH4 W;  4Z88 A;  3EG2 A;  1JEG A;  1M3B A;  4AG1 C;  1PKS A;  2FEI A;  2OAW A;  2H8H A;  1E7O A;  4D8K A;  1K76 A;  4D8D A;  1SRL A;  2V1R A;  2KYM A;  1X69 A;  2ABL A;  1WXT A;  2JM9 A;  4J9H A;  1NYG A;  2A36 A;  3ZL7 C;  3NGP A;  1NYF A;  1S1N A;  2EGC A;  4J9C A;  1YP5 A;  2OI3 A;  1JO8 A;  5GJV B;  2K6D A;  2RMO A;  1U3O A;  2LJ1 A;  2SRC A;  2ROT A;  1K9A A;  1WXU A;  2K7A A;  2DL8 A;  3RBB B;  1M30 A;  2RF0 A;  2AZS A;  2PZ1 A;  4LUD A;  3UA6 A;  1SRM A;  2E5K A;  1MV0 B;  3UA7 A;  1ZX6 A;  2CUD A;  4IIM A;  2EGA A;  2KRN A;  1Y57 A;  1SEM A;  4LN2 A;  4RTY A;  3M0P A;  1WXB A;  2KYB A;  2EPD A;  1WFW A;  3TSW A;  5IXF A;  1K0S A;  2O2O A;  2DNU A;  2DE0 X;  2NWM A;  2DL5 A;  1MV3 A;  2GTJ A;  2ESW A;  1H3H A;  3H0I A;  2LMJ A;  2JT4 A;  2PTK A;  3U23 A;  2C0T A;  2K3B A;  1GRI A;  2M0Y A;  4WCI A;  1FMK A;  4HCK A;  4CC4 B;  1V1C A;  1QWF A;  1W1F A;  3R6N A;  1PRM C;  2MOX A;  1AOJ A;  2K2M A;  4QT7 A;  1GBR A;  4A63 B;  2NUZ A;  1IO6 A;  2JTE A;  2JMC A;  3VS6 A;  3A98 A;  2BZ8 A;  1QCF A;  4J9G A;  2A28 A;  1YN8 A;  2PNI A;  2CT4 A;  2DRM A;  3VS7 A;  1JXO A;  1AWO A;  1H92 A;  2DRK A;  1W6X A;  2J05 A;  3I5R A;  4E6R A;  1SHG A;  2HEQ A;  2O9V A;  2KRS A;  3VS5 A;  2DYB A;  3EG1 A;  3ULR B;  4J9F A;  4DEY A;  2P4R A;  1AZG B;  2J06 A;  1TG0 A;  2XMF A;  1Z9Q A;  2KEA A;  3C0C A;  1HSQ A;  3H0H A;  2MIO A;  2LQW A;  1OEB A;  2EBP A;  2QDL A;  2KRO A;  1BB9 A;  3SEM A;  1RLP C;  3I35 A;  2YUN A;  1TUD A;  5IHI A;  1NEB A;  2FPD A;  1T0J A;  3RNJ A;  3EG0 A;  2RQU A;  1PRL C;  2GGR A;  2C0O A;  2DA9 A;  1QLY A;  4LUE A;  1G83 A;  2OJ2 A;  5I22 A;  4CC3 A;  1T3S A;  4Y92 A;  1PNJ A;  1UHF A;  2HCK A;  2X3W D;  1FYN A;  3VS1 A;  2DL4 A;  1ABQ A;  2AKK A;  1I07 A;  3I9Q A;  4OMM A;  1QKX A;  1LCK A;  4RTU A;  1SHF A;  1X6G A;  1WI7 A;  1UJY A;  2V1Q A;  1WDX A;  1ZUU A;  2HDA A;  3M0R A;  1A0N B;  1AVZ C;  2RN8 A;  1B07 A;  2FPF A;  2C0I A;  2EQI A;  3KFV A;  1CSK A;  2LZ6 B;  3EHR A;  2FG0 A;  1RI9 A;  3VS0 A;  1U06 A;  2KXD A;  4AFQ C;  4J9D A;  2VWF A;  2SEM A;  1KFZ A;  2CDT A;  2F2W A;  1T0H A;  2GBQ A;  2L3Q A;  2GTO A;  1M27 C;  2FPE A;  1UEC A;  1ZBJ A;  1KSW A;  4HVU A;  5IHK A;  1YWO A;  5I11 A;  1UG1 A;  2D1X A;  2YSQ A;  2YUP A;  1UUE A;  2RPN A;  1UFF A;  2GNC A;  2J6O A;  1JQQ A;  1GBQ A;  2ED1 A;  3M0T A;  1E6G A;  2HBW A;  2LJ3 A;  2EGE A;  4EIK A;  1X6B A;  1GFD A;  2JS0 A;  2LJ0 A;  1H8K A;  2CT3 A;  3VRZ A;  1X2K A;  5IXB A;  2JXB A;  3EGU A;  4LE9 A;  4HVW A;  1KJW A;  4J9B A;  3CQT A;  5IHN A;  2A37 A;  5HCK A;  2CH4 A;  2DLP A;  5FWB A;  2EYX A;  2YT6 A;  2L3P A;  1K0X A;  3H0F A;  4OMN A;  4F17 A;  4RTW A;  1ARK A;  1HD3 A;  1T3L A;  2RQR A;  4GLM A;  2KRM A;  1SSH A;  4CC2 A;  2X3X D;  3TVT A;  1JU5 C;  2L0A A;  4IIO A;  1UE9 A;  2RQV A;  3PVQ A;  1WLP B;  1OPK A;  1M3C A;  2ED0 A;  2F2X A;  1K1Z A;  2AK5 A;  4OMQ A;  2BZY A;  4HXJ A;  4LNP A;  1VA7 A;  2K79 A;  1GL5 A;  2KNB B;  4JJD A;  5GJW B;  2LCS A;  2FRW A;  3REA B;  1XOV A;  3NHN A;  1NEG A;  1UHC A;  2VKN A;  3UF4 A;  5EC7 A;  5FWC A;  3JV3 A;  1YNZ A;  1ZUY A;  2DL3 A;  1VYU A;  1JXM A;  1UJ0 A;  4J9E A;  1Z9Z A;  1TUC A;  1NM7 A;  2DM1 A;  3H41 A;  3PE0 A;  3VRY A;  4Z89 A;  2BTT A;  2L2P A;  4AG2 C;  4CC7 A;  2ENM A;  1AWJ A;  3EG3 A;  4RTT A;  4HVV A;  2W10 A;  1CKA A;  3EHQ A;  1X2Q A;  3REB B;  1ZLM A;  3M0U A;  5L23 A;  2O9S A;  1YWP A;  2DBK A;  1I1J A;  3IQL A;  2YDL A;  4JJC A;  2J7I A;  2LP5 A;  3UAT A;  3LH5 A;  2CRE A;  4OML A;  2CSI A;  4OMO A;  2W0Z A;  4M4Z A;  1CKB A;  1ZSG A;  2DVJ A;  1J3T A;  1UGV A;  1I0C A;  4ZNX A;  2DL7 A;  2CSQ A;  2MCN A;  1VYV A;  1X27 A;  3PVL A;  4AFU C;  2L3S A;  1K4U S;  1KIK A;  4RTV A;  2I0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...