1UG1A

Sh3 domain of hypothetical protein baa76854.1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1010 protein
publication title NMR structure of SH3 domain of Hypothetical protein BAA76854.1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ug1A00
3NHNA 4DEXA 2PTKA 2CDTA 4JZ4A 3SHWA 3VS6A 1Y0MA 2D0NA 2DL7A 2F2WA 4Z8AA 2GTOA 2EVRA 3PVLA 4JZ3A 4RTYA 2DMOA 2RQTA 3NMZC 1H3HA 4Z89A 2RQWA 4AFUC 2JS2A 3NGPA 2KBTA 1ARKA 2SRCA 2HSPA 2X3XD 2A37A 1W1FA 1I0CA 1T3SA 3CQTA 2LMJA 1UHCA 1GRIA 1BBZA 3ULRB 1QCFA 1JQQA 3SEMA 1CKBA 2VVKA 3I35A 5I11A 2CH4W 3FJ5A 3M0UA 5FWBA 3M0RA 1UHFA 4JPBW 2YUNA 5IHIA 1XOVA 2JTEA 2W10A 1OOTA 2LJ1A 2D1XA 2CH4A 2E5KA 4ORZA 4HXJA 2B86A 1WXUA 2KT1A 1SHFA 2CREA 2MOXA 1NYGA 1QLYA 2BZ8A 2MCNA 4CC3A 1EFNA 1GFDA 2KYMA 2GTJA 1Z9ZA 1ABQA 4JJBA 1K1ZA 1JXMA 4RTZA 1E6GA 4AFZC 2C0OA 3TSZA 3H0IA 1I07A 2RQRA 3UATA 4JJDA 3VRYA 1U06A 1AWWA 1J3TA 2EYYA 1ZUKA 1SRMA 2KXCA 2D8HA 2PZ1A 5IXBA 3A98A 2JW4A 1X43A 2FG0A 2EYWA 4J9DA 2EGAA 1X6BA 2EQIA 4LE9A 1PKSA 3QWYA 4DEYA 2NUZA 1GCPA 2VKNA 2L3PA 3VS7A 2DA9A 1OV3A 5EC7A 1H8KA 2EPDA 3VS1A 1M3AA 4IIOA 4RUGA 2AZSA 1AWJA 1WA7A 2DLPA 2EGEA 1WIEA 1U3OA 1B3QA 1PWTA 4F14A 1OPLA 1KFZA 1G2BA 1NLPC 1SEMA 2FPDA 1BB9A 3REBB 5HCKA 1AZEA 1UG1A 1LCKA 3LH5A 2JXBA 1W70A 2ED0A 3KFVA 2YUPA 4EIKA 1GBRA 1TUDA 1A0NB 1JO8A 1NLOC 2FRWA 1OPKA 4RTTA 5L23A 3ZL7C 2OAWA 1YWPA 2RN8A 1WYXA 1JXOA 2KYBA 4J9CA 1CSKA 3M0QA 3M0SA 2DRMA 4OMPA 1GFCA 2KRNA 1IO6A 2YDLA 2D8JA 2ABLA 1K76A 2EW3A 2K7AA 2YUQA 3NPFA 2V1RA 1N5ZA 2KRMA 1YN8A 2LQWA 1T0JA 2LNHB 4CC7A 1SPKA 1PKTA 1AWXA 2LX7A 4AFSC 2CSIA 2EGCA 2EYXA 2K6DA 2O2OA 2JS0A 2O31A 2L2PA 5FWCA 1I1JA 4ZNXA 1BU1A 2DM1A 1QWFA 2FO0A 1T3LA 3EHQA 4WCIA 2DL5A 1UFFA 2IIMA 1NM7A 2DNUA 1BK2A 1QWEA 2LZ6B 2DE0X 4X1VA 2KT8A 2GBQA 2HCKA 3IQLA 1AOJA 1V1CA 2K2MA 5IHKA 4F17A 1W6XA 4HCKA 2KROA 2O9VA 2BZYA 1RUWA 2JM9A 2ENMA 2FEIA 2HDAA 3VS0A 4QT7A 4LN2A 1TG0A 1AZGB 5ECAA 1ZUUA 3THKA 1U5SA 1SHGA 3I5SA 4J9EA 3R6NA 1E7OA 2QDLA 1PRLC 2DF6A 2A36A 2AKLA 4OMMA 3GBQA 2L0AA 2BZXA 1AD5A 1X6GA 3VS4A 2J7IA 1WI7A 2JMCA 1MV3A 1K0SA 2XMFA 2C0TA 1VYUA 1X2KA 5IHNA 1PHTA 3REAB 3H0FA 1X2QA 3PE0A 5GJVB 1KJWA 3O5ZA 1M30A 1RLQC 3UA7A 2ESWA 1UJ0A 4D8KA 1ZLMA 2JM8A 1YNZA 1Z9QA 2YT6A 1UGVA 2GQIA 2YSQA 4GLMA 2O9SA 2RNAA 1WFWA 1G83A 2DILA 2YUOA 1WX6A 2LQNA 1K0XA 3JV3A 2RMOA 4J9BA 1M8MA 4RTVA 4R0KA 1JU5C 5IH2A 1E6HA 2K9GA 1FYNA 3EG0A 4HVWA 4J9HA 3C0CA 4J9GA 2A28A 2KXDA 3I5RA 4LUEA 2L3SA 2DX1A 3UA6A 1TUCA 4KRTA 2J6FA 2ROLA 1UJYA 5IXFA 2P4RA 4J9FA 1NG2A 2DBMA 4GBQA 4RTXA 2VWFA 2CUBA 1AEYA 2J6OA 2J6KA 1VYTA 2AKKA 1WDXA 2LCSA 1VA7A 2DYBA 4RTUA 4CC2A 2K79A 3EHRA 2FPEA 3M0PA 2G6FX 2KGTA 4LNPA 2RPNA 2V1QA 1B07A 3U23A 2CSQA 4Y92A 1ZX6A 4D8DA 2F2XA 2HEQA 1VYVA 4F16A 1WXTA 3TSWA 1UUEA 2L3QA 1RI9A 2KNBB 2M51A 1UDLA 4M4ZA 4IIMA 4AFQC 3TVTA 4OMOA 2CUDA 1JEGA 2GNCA 4A63B 1X69A 2RF0A 2M0YA 2LJ0A 2KR3A 2EYZA 2BTTA 2OJ2A 2X3WD 2DRKA 1YP5A 4K11A 1UECA 5I22A 3EG1A 1KSWA 2J06A 1ABOA 1HJDA 1NYFA 2ROTA 3QWXX 3I9QA 3H41A 2KEAA 3UF4A 2EBPA 3VS5A 2SEMA 3RBBB 2W0ZA 4FSSA 2H8HA 1GL5A 2MIOA 1ZUYA 4E6RA 1MV0B 2NWMA 4Z88A 3RNJA 4AG1C 2A08A 3M0TA 5FW9A 2FRYA 2DVJA 2FPFA 1S1NA 2C0IA 2F2VA 2ECZA 2RQVA 4J9IA 4LUDA 2J05A 3H0HA 1HSQA 3VRZA 1UTIA 1FMKA 2AZVA 1NEGA 1QKXA 2DL8A 1PRMC 3VS3A 4CC4B 1GBQA 1K4US 4OMQA 2JMAA 1RLPC 3EG2A 1ZSGA 1PNJA 1HD3A 1ZBJA 1AWOA 1OEBA 2RQUA 1H92A 1WXBA 1UE9A 3VS2A 4JJCA 5GJWB 3EG3A 2O88A 4RTWA 1M3BA 1T0HA 1X27A 2DL3A 2JT4A 2OI3A 2LJ3A 2DL4A 1MUZA 4OMNA 4AG2C 2KRSA 1SRLA 2CT4A 2LP5A 1GCQA 1Y57A 2PNIA 1KIKA 2I0NA 1M3CA 1AVZC 2HBWA 2CT3A 1QKWA 2DJQA 4HVVA 2K3BA 4ESRA 1SSHA 2ED1A 3EGUA 1K9AA 1YCSB 2AK5A 2GGRA 1CKAA 2KE9A 1GCQC 1WLPB 2DBKA 1YWOA 1M27C 4HVUA 2EKHA 4OMLA 1NEBA 3PVQA
chains in the Genus database with same CATH superfamily
1VQOA 2CDTA 5GANd 1KQ2A 2L89A 1MMNA 2GTOA 2X4JA 3PMIA 3PVLA 2DMOA 5GMKl 4Z89A 2COZA 1KC8C 4C8QE 2SRCA 1VQOT 1IREB 2HSPA 2RJEA 4A54A 4ZN1A 1W1FA 1I0CA 2K57A 4C5GA 3EGDB 1BBZA 3PTAA 2FZGB 3I35A 1KHCA 3LWHA 3M0UA 5FWBA 2QEXT 5KYNA 3M0RA 2DXBA 2EFIA 3EFOA 8ATCB 2W10A 3QO3A 2D1XA 2DIGA 2ZCFB 4ORZA 5I2SA 1KD1U 1YJWA 1VQLQ 4HXJA 2DIQA 4WF2A 4F7UG 4XTXA 5J3BA 2DK3A 1QLYA 4D6WA 4C5EA 2VGNA 5KE2A 1EFNA 1GFDA 1OQKA 1QCNA 2HMAA 3L42A 2M1HA 4JJBA 3QUIA 1YJWT 4RTZA 1E6GA 2C0OA 3OYDA 2PVGB 3CPWA 1I07A 2RQRA 3L2UA 3E19A 1J3TA 1SRMA 5IAYA 4XTZA 4BE2A 2PZ1A 1XJWB 3A98A 3HKSA 1X01A 4J6WA 3CBOA 4MZPA 4M77D 4IUUA 2CZ1B 1W2BP 3M53A 1GXIE 2JOYA 1PKSA 4DEYA 3FLGA 1VQ5Q 4DA4A 2L3PA 2KI7A 1BIBA 2R5MA 3CXCA 4KH1B 4RUGA 2DTHA 1WA7A 2DLPA 5LJ5d 4ZGEB 1WIEA 2F5KA 4HCZA 1KC8U 1TUGB 2FHDA 1OZ2A 4RMOA 1TOVA 1KFZA 5GAMf 4JDSA 3JB9D 4XTYA 3REBB 5HCKA 3OSVA 2K5IA 3FRNA 4KUDK 2YLCA 5GANe 4E7IA 2E6ZA 3LH0A 1GBRA 3S3MA 2FVUA 1NLOC 3CC2Q 4RTTA 2CP7A 3I55Q 1I4K1 4DBHA 1YWPA 2RN8A 1WYXA 3H6ZA 5GAN3 3M0QA 2WSEE 4RKUE 3CMAA 2DRMA 4OMPA 4A4GA 3G4SA 2YUQA 1NJIC 3JCMd 3NPFA 3OYBA 2LQ8A 3KXTA 2NYSA 2V1RA 2RB6A 1YN8A 1KQSP 3CMAT 2LNHB 1SPKA 1Q81R 2Y90A 2LX7A 1AWXA 3G4ST 2CSIA 2EYXA 1WGSA 2K6DA 4OGCA 2E41A 5FWCA 1VQLA 2D0QB 3ZBDA 4KGZB 3DLLA 2FO0A 3MPUB 2QASA 1UFFA 1NM7A 2RHIA 4X1VA 2ZPIB 4PFPA 1QMCA 5DM7R 3VU3C 1VQLT 5IHKA 3LW5E 5CIUA 5GMKi 4QVDA 4HCKA 4M75F 2KROA 3WVDB 2QK0A 1R8OB 1BKBA 1M1KU 2JM9A 4BY6C 4XU3A 1W2BA 3TREA 2FEIA 2K4YA 2RJFA 3NTKA 1AZGB 3JRZA 3I5SA 2RH2A 1C1AA 4PNOA 4J9EA 1G8XA 2QGGA 3R6NA 1PRLC 3HHTB 4OMMA 1U1TA 2L0AA 1AD5A 3PIPA 2RM4A 1IGQA 3JAME 2JMCA 2LCCA 2I2LA 1VYUA 5IHNA 3REAB 1X2QA 3OYJA 1JB0E 1KHIA 5LJ5e 1VQ4Q 3OS2A 2QQBA 2P0KA 2JNGA 2PUOB 4M7AG 3FIFA 1YNZA 3ZFJA 2QA4Q 1UGVA 3OYFA 4GLMA 2HAXA 2O9SA 4FCYA 2YUOA 7AT1B 3JV3A 1UGRB 3GNGA 5GAMg 1D0YA 5FU7C 2KVQG 5GANh 1NJIU 1IB8A 1JU5C 1WHGA 1NJIR 3UT1A 4MDWA 3CPWS 4KRTA 2LDMA 2P4RA 4J9FA 2VWFA 1KQSA 4XTUA 1PCXA 3X26B 2DYBA 3HSBA 2FPEA 3M58A 3M0PA 3C12A 3RUXA 1HXDA 2KGTA 4LNPA 3INZA 1RAFB 3U23A 4MDXA 2LVMA 4PJNA 4Y92A 3CCSQ 4HA8A 2XHCA 2AHJB 1K73C 4M7DG 1SSFA 3CXCS 1RI9A 3WXMB 2KNBB 2E6NA 3QXEB 3MP6A 3LGLA 3N5BB 2YRCA 3SWNB 1JEGA 5A0LA 4E2FB 3H8ZA 2M0YA 4M7AE 1PSFA 1VQ8A 2XG8D 3BW1A 4X9CA 2EIFA 2KR3A 2P0PA 1D0XA 2L8DA 4M78G 2M9UA 2OJ2A 2MYSA 2EAYA 4XTWA 1VQMA 1HJDA 2IVWA 2WACA 3CCUQ 2FZCB 2H3JA 1YJ9A 3I9QA 3J80E 3H41A 5GAOl 3CC7Q 2LC4A 3AHUA 3TCJA 2W0ZA 1GL5A 1MNEA 4C0ZA 1MV0B 1OX8A 2BIVA 3RNJA 3G6EA 1V29B 4PJOB 1M4ZA 1PSEA 1YJ9T 5LJ5h 2FPFA 2OX7A 2PVOB 2JN0A 3QYHB 4LUDA 2O4XB 3H0HA 4N0AA 2CZ6B 4LXCA 3G6ET 1UTIA 1YCYA 2BE9B 1YI2Q 2AZVA 4F04B 1NEGA 4J5YA 2QA4A 2GFUA 2CP6A 3VS3A 2HD0A 4XK8E 1PM3A 4M7DE 3EG2A 1VQ4T 2YWWA 1HD3A 5CKBA 4E7JA 2RQUA 2EWNA 3P8DA 4ANJA 5GJWB 2O88A 2RHXA 4GLKA 2QA4T 1ZA2B 2XIDA 2LJ3A 2DL4A 4JUVA 4AG2C 1RI0A 1M1GA 1I5LA 4VUBA 3OYNA 1K73U 2OTLA 4M78E 3JCMV 1M3CA 2K3BA 1SSHA 4M7AA 3EGUA 1W2BS 1RAHB 1CKAA 1QW1A 2WSFE 2ZPBB 4O5VA 2ATCB 1YWOA 4XQ3A 2BE7D 4XAXB 1FWZA 3OBYA 4HVUA 4A4EA 4OMLA 2RJDA 4ATOA 4M77C 3CCSA 2DJZA 3META 3SHWA 3VS6A 2DAQA 1I5OB 1TSFA 2DL7A 2MAMA 2XDPA 5I21A 2EVRA 3F70A 3NMZC 1Y71A 3NGPA 3OS5A 1P92A 3M57A 5CKFA 4JLIA 3CCST 2A37A 3QKJA 2XD0A 2KY9A 1T3SA 2VV5A 2GFAA 2V8JA 1N8RC 1GRIA 1Q7YC 3ULRB 3VV0A 4FYYB 3FJ5A 3TU4K 1ZBXA 4JPBW 4PFOA 2YUNA 3FDRA 1Q82U 2CH4A 4Y28E 5AT1B 5LL6S 3CCUA 4AMCA 3X25B 2DKGA 4BE0A 2BKDN 3SWNA 3G7ZA 1TU0B 2MOXA 1BI2A 4CC3A 3JCMJ 1M2OA 2KYMA 3CCUT 1ABQA 1KQSS 5GAOr 8AT1B 2L3RA 3E9GA 4J7IA 4M78A 3OYKA 4X9DA 3VRYA 1MMAA 2EQUA 4BI3A 1ZUKA 4C8QB 1U8RA 1YI2A 1K9MU 5IXBA 4L6V5 5GAOq 3CCLQ 1X43A 2FG0A 3ER0A 2EYWA 4J9DA 1YHQA 2EQIA 2HQHA 3OA6A 5KYYA 4PJOA 1GCPA 2HKNA 4E7HA 2CZ0B 1YI2T 2VKNA 1WPYA 4KGVB 1M9SA 2DA9A 2O4XA 1YHQT 1I8FA 2PVDB 3VS1A 1M3AA 4IIOA 3RMSA 1VQNQ 2AZSA 1OZ3A 2M16A 3URGA 2EGEA 1G3TA 1B3QA 2DEQA 5CO7A 3RMQA 1PWTA 4M75G 4F14A 1VQPA 1OPLA 1B34A 1G2BA 1NLPC 4C92B 1SEMA 2FPDA 3P8HA 3OYEA 3CC4A 3OYCA 2ZZDA 3CCQQ 5D7UA 3LH5A 1N8RU 2RK1A 1QVPA 2ED0A 1Q95G 3KFVA 2ZPHB 1VQPT 4EIKA 1TUDA 2DXTA 3CC4T 2FRWA 1Q7YR 5L23A 1UGPB 2VXFA 3E1SA 3Q1JA 2MWOA 1JXOA 1GFCA 2KRNA 1IO6A 3CMAQ 1XNIA 3NTIA 3V7CA 4OVAA 1K76A 2EW3A 3G4SQ 2K7AA 3G71Q 3KUFA 4KBMB 5KCOA 4P5NA 1N27A 1LVKA 4TVRA 1T0JA 3CCRQ 5GAMd 5KH6A 4LD9K 1QVGP 2EGCA 3X24B 3QPHA 2JS0A 3HRSA 1BCOA 2YLBA 2EQKA 1YFNA 2JVVA 3RIRA 4QW2A 1BU1A 2DM1A 5GAN4 3OYLA 3EHQA 2B8AA 2DD5A 2IIMA 2DNUA 1BK2A 3LLRA 3JCMQ 4XTVA 4LD6A 4C92E 2KT8A 2DYIA 4M75E 4L5GA 2FYKA 4F7UB 1KD1R 1AOJA 2K2MA 4J7FA 4JRQA 1W6XA 2H3EB 3QBYA 4M77F 3JCMP 4FM4B 3X20B 5L8RE 3OSSC 1Q86U 1ZSZB 2XKOC 1MGQA 2M0OA 1BI1A 1SG5A 4QT7A 2K5LA 5ECAA 3UWNA 3V8JA 3CCLA 1E7OA 4L59A 3VUBA 3OY9A 4BACA 1QQJA 1X6GA 5GAN7 1WNLA 2J7IA 3CCLT 3OW2P 4PLLA 3JB9F 4O6JA 5GJVB 1M1KC 4C8QA 2KDSA 4J6XA 3TQ7P 1VQNA 2A7YA 1KJWA 3O5ZA 1QVFP 3OQ5A 2ESWA 4D8KA 1ZLMA 3CCJQ 2JM8A 5A0GA 2E64A 5A2QE 1XQHA 2YSQA 1RABB 2RNAA 2DILA 1VQNT 3CCQA 1K0XA 2RMOA 1KC8R 2EJ9A 1V76A 1MNDA 2K9GA 1FYNA 2VC8A 4F7UE 4HVWA 3VYHB 1IZ6A 4EPCA 1HK9A 3CCQT 1NE8A 1YIJQ 3RERA 5AYFA 3OB9A 3RESA 3SDZA 3HFNA 4LDWA 2J6FA 2DBMA 4GBQA 4C92A 4EMKA 4M75A 4RTXA 1AEYA 2J6OA 3VJPA 2EQMA 2VB6A 2AKKA 1QVGA 2F5TX 3BFMA 3G71A 2RA2A 2MK5A 1YJNA 4CC2A 2HSEB 2R58A 5GAMe 1R0BG 2V1QA 3CCRA 2CSQA 2EQJA 3AT1B 4E7LA 3TEEA 1VYVA 2E4HA 3G71T 3TSWA 5GANj 1UUEA 2KMTA 1EZZB 3CCRT 3CBMA 1UDLA 5FRNA 4IIMA 4MMKA 2C06A 1AT1B 2CUDA 2KQWA 3BDLA 3MJXA 2DZCA 2MF2A 1VQ8Q 5LJ3f 2EYZA 1OU9A 2BTTA 3CCEQ 2X3WD 1YP5A 4K11A 1D09B 4C8QD 5I22A 1Y07A 1KSWA 3QJYA 1ABOA 1VQMQ 1NYFA 3QYGB 2ROTA 3QWXX 3UF4A 1M1KR 2EBPA 3VS5A 5GMKm 3OW2A 2LT4A 1YJ9Q 2SEMA 2V8KA 4F7UA 2QDYB 4Z88A 4C0DB 2X4YA 5CQXA 3M0TA 2GQVA 3G6EQ 1W4SA 2QQ9A 1ZSZA 1WQWA 4J9IA 4BD3A 2J05A 5LJ3e 4HCBA 1WHMA 4BDZA 2FZKB 3CCJA 3OYAA 3PMTA 4JRPA 4N0AC 1BIAA 1K4US 3JCMX 2ZPEB 4OGEA 5HK0A 4M7AB 4HT9A 1WHJA 1UE9A 1TH7A 4JJCA 3VYGA 3CCJT 4RTWA 2RHUA 4OMNA 2A0FB 3CEYA 2MPXC 2CT4A 3M4GA 1YIJA 3JCMc 2ZPGB 1Y57A 4BI4A 2OTLQ 2QQAA 4FIBA 1QKWA 4OF1A 5LJ5j 2GGRA 3VKIA 2CKKA 2DBKA 1G5VA 1YIJT 2O01E 5GAMh 9ATCB 3QJ6A 1D1BA 1WJRA 1NEBA 4LDXA 1OULA 3NHNA 4DEXA 5KYXB 2KSSA 1Y0MA 4V2SA 2F2WA 3NFCA 3QG1A 4Z8AA 4ZGDB 4QVCA 1IHWA 4RTYA 4JZ3A 2D6FA 2RQTA 3CBPA 1H3HA 1OX9A 3P8BB 4AFUC 4WTOB 2CGHA 2JS2A 1TWBA 1ARKA 2P84A 2VGMA 2X3XD 2HL3A 4M7DB 1M90C 4FYVB 2RO0A 3CQTA 2LMJA 4CRIA 2BUDA 2E3IA 5KYUB 2COWA 1JQQA 1M2VB 3MEAA 1CKBA 3SEMA 2VVKA 2CH4W 1IRXA 3CCEA 3M56A 1XOVA 2JTEA 1MMDA 5LJ3g 1OOTA 4DOVA 4M78B 3OYHA 4GY5A 1VQ8T 1WXUA 3J7AF 4EDUA 3CCET 1SHFA 1NYGA 2BZ8A 4PFZA 1VQ7A 3L2QA 2GCXA 1VQMT 1Z9ZA 3SWNC 4N4HA 1K1ZA 3EGXB 1VQKQ 5KYYB 2JTMA 2RD1A 1PD0A 1QVGS 5CKDA 3GIBA 5LJ3h 3QZ9B 3UATA 4JJDA 1D1CA 1OU8A 4KGXB 1Q82C 2WSCE 1LJOA 2D8HA 2AIRB 1D3BA 3BDUA 4A53A 2JTFA 2LX9A 1X6BA 4KT0E 3I56Q 1IHVA 1YHQQ 4RG2A 2E3HA 3QWYA 2NUZA 1B34B 4RG8A 5FU6C 4LDUA 2DVEA 4QQ6A 1N9SA 1NZ9A 1OV3A 5EC7A 1H8KA 2X9HA 2XK0A 4QVZA 5HY6A 2RHZA 2QAZA 5GMKe 1U3OA 4M77G 1K9MC 3HPWA 1VQPQ 4ELZC 1M90U 1BB9A 3EAEA 3QZ5B 1SF9A 3GLXA 4NS5A 1K73R 1UG1A 5FRMA 1AZEA 3CC4Q 1LCKA 3OW2S 3PNWC 2OTLT 3C4SA 2HQEA 2YUPA 3PT9A 1IGUA 1A0NB 1JO8A 1QVFS 1OPKA 3MEVA 4A4KA 3ZL7C 2OAWA 3LWIA 2Z0WA 3M9QA 4B9WA 3JB9G 1PG5B 1UEBA 2KYBA 2MMPA 2YDLA 2D8JA 1K8AU 2DXCA 1QCOA 3CD6Q 4J83A 1VQ9Q 2CZ7B 5KYXA 1G3SA 2KRMA 4CC7A 3OS0A 3J81E 1PKTA 4J8OA 3L2WA 4AFSC 3ME9A 3OYIA 4ZTJA 2VYTA 2XU8A 2O2OA 1R0CB 2O31A 1VOMA 4ZNXA 4E7ZA 1YITQ 4M7DA 2X51A 1QWFA 4KULA 4WCIA 2DL5A 2HL5C 1QWEA 2LZ6B 2DE0X 4FYWB 1Q82R 5KYUA 1M2VA 1X75C 3LGFA 3OYYA 4IUPA 4M77E 4YTLA 1VQKA 1RAEB 4M7AF 1RAIB 4KH0B 2BZYA 3JSCA 1RUWA 5GAOp 1ACMB 5CR2A 1VQKT 2HDAA 2LRQA 4JRKA 3VS0A 1MHNA 3THKA 1ZUUA 1SHGA 2DXUA 4FT4A 2FB7A 3I56A 2QDLA 4M7AD 2MI6A 4BDYA 1QP3A 3EGXA 2AKLA 3RKXA 3EFSA 3GBQA 1K9MR 2CP2A 3A8OB 2HBPA 3VS4A 1WI7A 3S3NA 1MV3A 2XMFA 5J26A 4QKUA 4DBQA 1X2KA 3I56T 3PE0A 5GMKh 2FL7A 3FEOA 1Q86C 5DLQE 1M30A 3L2ZA 3UA7A 1UJ0A 4A4HA 2DEUA 3CCMA 1Z9QA 3RKWA 4C8QC 4JS4A 1VUBA 1UGQB 4EMKB 4M75B 4MZMA 4RTVA 4R0KA 4IUTA 5C0MA 1E6HA 4IUVA 3CCMT 3EG0A 2IPOB 3C0CA 1M1FA 2RJCA 4BI8B 5D6YA 1N8RR 2KXDA 2QTVA 3I5RA 4LUEA 1KK7A 2DX1A 3UA6A 1TUCA 4PJLA 2ROLA 3V8KA 1AHJB 1UJYA 4XU0A 4M7DD 1NG2A 2CUBA 3QSUA 1BI0A 1VYTA 1WJQA 1VA7A 2QYZA 3LX7A 2K79A 3MO8A 3EHRA 3CD6A 1VQ9A 3SFMA 2G6FX 1YJNQ 1FX7A 2VXEA 4FT2A 2VASA 1B07A 3CCVA 1FMWA 2YRDA 2QG9B 2JZ2A 4D8DA 4EMHA 3PGGA 2F2XA 4PJOF 4M78D 5EG2A 4PJJA 2HNIA 1WXTA 3CD6T 1VQ9T 3JCMW 4N4IA 4ZGJB 1YITA 2L3QA 2QEXA 3CCVT 5KYWB 2EYQA 2GNCA 4A63B 2RF0A 2COYA 4R55A 1F1BB 4PJOD 1YITT 3V7RA 1R77A 2NUPB 3OMCA 1M8VA 2OTJQ 2DRKA 3M5AA 4C0GA 2J06A 1VIEA 2L5QA 1JJ2P 2KEAA 1Q81C 2R5AA 5DY9A 1OYXA 1Q86R 2Y4XA 2MIOA 1ZUYA 4E6RA 2DPPB 2YHTA 3PIOA 4AG1C 2A08A 3ZEHA 5GAN8 5CK9A 2PU9B 1S1NA 3EFRA 2F2VA 1C6VX 2ECZA 2X4XA 3OS1A 4RCCA 3OYMA 2Y4YA 2XI9A 1HSQA 2E65A 2DO3A 1D1AA 2JJ9A 3VRZA 3A8GB 3GOXA 2QTXA 2X4WA 4XU2A 1QP2A 1ZSZC 5LJ3d 1QKXA 4MZTA 1WJSA 1JBMA 1PRMC 4CC4B 4J6YA 5GANf 4OMQA 2JMAA 1RLPC 1ZSGA 1AWOA 1OEBA 4B9XA 1WXBA 3M54A 3FB9A 4CI0C 3EG3A 1MMGA 3HRUA 3V7SA 1X27A 1T0HA 2DL3A 2OI3A 4PKCC 3JCMb 2LCLA 2HZYA 4FL6A 4DOWA 4NOYA 2CS7A 3V8LA 2LP5A 1GCQA 4BUGA 3GPLA 2I0NA 1Y96B 3H9NA 1KIKA 4HCCA 3A8LB 2DERA 1KG1A 2CT3A 2DJQA 3ASKA 4HVVA 4ELYC 4DBFA 5CAIA 4ESRA 2ED1A 3E2UA 1K9AA 1Y7XA 1YCSB 2AK5A 2GF7A 6AT1B 2KE9A 5CKEA 4PL6A 5HKCA 2CYZB 1H641 1WZOA 1C0MA 2YXYA 4PK4A 3GF5A 5GAN2 2ZGWA 2DETA 1YBYA 2PTKA 4JZ4A 1ZHIA 4C5IA 4PLIA 5GAN6 2D0NA 1BCMA 2DD4A 1G3YA 2RQWA 2KAFA 2V26A 2LT1A 1YJNT 1PD1A 3LYIA 2KBTA 3O8VA 3UPUA 1PC0A 3CPFA 1Q81U 4C8QF 1IXDA 1UHCA 3GNFB 3MP1A 1QCFA 2R57A 4BY6B 4DQ2A 5I11A 3NTHA 1JJ2A 2PUKB 2K5FA 4ZN3A 2OTJA 4FW1A 4LDVA 4EMGA 1UHFA 1WHHA 5IHIA 1TS9A 2LJ1A 2E5KA 5GAMj 4C5HA 1KQ1A 5KYWA 2B86A 4E7SA 3EGDA 2KT1A 1TTHB 2DZ9A 2E70A 3FC3A 2CREA 2OTJT 3MKDA 5HK3A 3BY7A 3X28B 4BB7A 2P0QA 2MCNA 1EX4A 1D3BB 5FLXE 3C94A 3FJPA 1VQ7Q 4A4FA 2GTJA 5LJ5f 2NUPA 1JXMA 3DB3A 4C0FA 1QVFA 4C92F 4AFZC 4KUIA 3TSZA 1EIFA 3A5ZB 2XDBA 2RI2A 3H0IA 1LNXA 1RL2A 1U06A 1AWWA 4FYXB 2EYYA 3PFSA 2KXCA 1I81A 2LQKA 2JW4A 2HQXA 4C92D 5FU7B 2EGAA 4M75D 1ZQ1A 4LE9A 4NL3A 1BYMA 2A3LA 2D9TA 1VQ5A 5GANg 4OB1B 3VS7A 2JUFA 1WHKA 4C0DC 2XDDA 2F69A 2EPDA 3D7SB 1O9SA 1VQ5T 1AWJA 2QQRA 3RDVA 3JCMf 2NUTB 4B6MA 2CP0A 5IT9E 4QQDA 5CCAA 5LJ3j 1WHLA 3CMEQ 2RK2A 2JXBA 1W70A 2EJFA 1H3ZA 4M7AC 1RADB 3CC2A 4DBRA 4JLGA 1G3WA 3I55A 3E9FA 4F7UF 2XICA 1Y96A 3VUZA 1XTDA 1VIFA 2DFUA 5D6WA 4E7KA 3EH1A 1VQ6Q 4J9CA 1CSKA 3HFOA 5I2MA 3M0SA 2QGFB 3CC2T 3JCMe 2LNVA 3I55T 2ABLA 3QDRB 2G3RA 2KK4A 1N6AA 4E47A 3C95A 1N5ZA 2LQWA 2M02A 2HKQB 1JRIA 2E10A 2F1LA 2L2PA 1LOJA 1I1JA 1T3LA 3MEWA 3UDCA 3DB4A 2RI5A 3JB9J 2OAUA 1K8AC 4M7DC 2GBQA 2HCKA 3IQLA 1ZA1B 1NPRA 1V1CA 2DTIA 5KCHA 4LDYA 3QDFA 4F17A 2RI3A 2IG0A 3GP8A 3MEUA 2O9VA 4R56A 1O75A 4OB0B 1WQ7A 5LJ5g 4UC4A 3G1JA 4OP0A 2QXFA 3OYGA 5M9OA 1VQ7T 5A0DA 2ENMA 1FMVA 4LN2A 1TG0A 3EG9B 1U5SA 5FU6B 4FU6A 4HKEA 4M78C 4PJOG 3SB2A 2DF6A 4FSXA 3S3OA 2A36A 2BZXA 2QI2A 5C6SA 4ZTFA 1K0SA 2C0TA 1VQ4A 2P4TA 1PHTA 3H0FA 4PJOC 5CQYA 1S72Q 1JJ2S 1RLQC 5CVIA 4AT1B 4MMLA 3EH2A 2E12A 3T9NA 2YT6A 3JCMg 1NPPA 2GQIA 5D6XA 3CCMQ 1WFWA 1G83A 2VUBA 3CMEA 1WX6A 2LQNA 1BI3A 4M77B 4J9BA 1M8MA 3JB9I 5IH2A 2CP5A 2ZPFB 4IURA 4J9HA 1M90R 1HYOA 4J9GA 4OMFB 2A28A 3CMET 1SKUB 3A1PA 2NUTA 1RACB 2L3SA 3QHSA 3JCMh 5IXFA 5CKHA 2EKOA 1VQ6A 2PQWA 2J6KA 2X35A 4Y91A 1RAAB 5GMKj 1WDXA 4X34A 2LCSA 4RTUA 4JRIA 1RAGB 3A8MB 4PJOE 1VQ6T 2RPNA 3M59A 1LPLA 1VQOQ 4OB3B 1ZX6A 3CCVQ 1K8AR 5J39A 2HEQA 2E5QA 4JS5A 3DLMA 5IN1A 4F16A 4QQGA 3L1AA 3EFOB 2EJGA 2AT1B 2M51A 4M4ZA 2QEXQ 4AFQC 2K2VA 3TVTA 4OMOA 2LTOA 4FW2A 4RCBA 4II1A 1DJ7B 4Z02A 3WVEB 2QQSA 1X69A 2LJ0A 4ME7A 3BE3A 5FROA 3MCAB 4XU1A 5DLOA 3MP8A 3L2RA 4Q5WA 1UECA 4OB2B 3EG1A 3QIIA 5GAOn 2K3YA 1N9RA 4IKFA 3RR6A 2ZAEA 5KE3A 1M5Q1 4IUQA 1YJWQ 3CC7A 3M4YA 3MHXA 4NL2A 3RBBB 4FSSA 2H8HA 3HTRA 4PJMA 1B7TA 2NWMA 2E1HA 3CC7T 5FW9A 4C8QG 1U1SA 2FRYA 2RHYA 3HP9A 2MWPA 1UB4A 2DVJA 2C0IA 3HL8A 2RQVA 2NLUA 1OI1A 1S72A 3EG9A 3A8HB 2V8IA 1KD1C 1FMKA 2CP3A 3HRTA 2DTOA 3RKYA 3CPWP 2DL8A 2K3XA 1GBQA 2YRVA 1PNJA 1ZBJA 3R6OA 1S72T 1H92A 5GAN5 3VS2A 4M7DF 1FXXA 1M3BA 2JT4A 5GAOm 1MUZA 1X6OA 3L2VA 2KRSA 1SRLA 1UGSB 4BE1A 1D0ZA 4C92G 3DKMA 2PNIA 1AVZC 2HBWA 3SD4A 1NBEB 4N4GA 3CXCP 4HT8A 4M77A 3JB9H 4M78F 1GCQC 1WLPB 1TXQA 1Q7YU 3KBGA 3OMGA 1M27C 4JJNK 2EKHA 3OBWA 3M55A 3S6WA 4C92C 4EMKC 4M75C 3PVQA
chains in the Genus database with same CATH topology
3NHNA 4DEXA 2PTKA 2CDTA 4JZ4A 3SHWA 3VS6A 1Y0MA 2D0NA 2DL7A 2F2WA 4Z8AA 2GTOA 2EVRA 3PVLA 4JZ3A 4RTYA 2DMOA 2RQTA 3NMZC 1H3HA 4Z89A 2RQWA 4AFUC 2JS2A 3NGPA 2KBTA 1ARKA 2SRCA 2HSPA 2X3XD 2A37A 1W1FA 1I0CA 1T3SA 3CQTA 2LMJA 1UHCA 1GRIA 1BBZA 3ULRB 1QCFA 1JQQA 3SEMA 1CKBA 2VVKA 3I35A 5I11A 2CH4W 3FJ5A 3M0UA 5FWBA 3M0RA 1UHFA 4JPBW 2YUNA 5IHIA 1XOVA 2JTEA 2W10A 1OOTA 2LJ1A 2D1XA 2CH4A 2E5KA 4ORZA 4HXJA 2B86A 1WXUA 2KT1A 1SHFA 2CREA 2MOXA 1NYGA 1QLYA 2BZ8A 2MCNA 4CC3A 1EFNA 1GFDA 2KYMA 2GTJA 1Z9ZA 1ABQA 4JJBA 1K1ZA 1JXMA 4RTZA 1E6GA 4AFZC 2C0OA 3TSZA 3H0IA 1I07A 2RQRA 3UATA 4JJDA 3VRYA 1U06A 1AWWA 1J3TA 2EYYA 1ZUKA 1SRMA 2KXCA 2D8HA 2PZ1A 5IXBA 3A98A 2JW4A 1X43A 2FG0A 2EYWA 4J9DA 2EGAA 1X6BA 2EQIA 4LE9A 1PKSA 3QWYA 4DEYA 2NUZA 1GCPA 2VKNA 2L3PA 3VS7A 2DA9A 1OV3A 5EC7A 1H8KA 2EPDA 3VS1A 1M3AA 4IIOA 4RUGA 2AZSA 1AWJA 1WA7A 2DLPA 2EGEA 1WIEA 1U3OA 1B3QA 1PWTA 4F14A 1OPLA 1KFZA 1G2BA 1NLPC 1SEMA 2FPDA 1BB9A 3REBB 5HCKA 1AZEA 1UG1A 1LCKA 3LH5A 2JXBA 1W70A 2ED0A 3KFVA 2YUPA 4EIKA 1GBRA 1TUDA 1A0NB 1JO8A 1NLOC 2FRWA 1OPKA 4RTTA 5L23A 3ZL7C 2OAWA 1YWPA 2RN8A 1WYXA 1JXOA 2KYBA 4J9CA 1CSKA 3M0QA 3M0SA 2DRMA 4OMPA 1GFCA 2KRNA 1IO6A 2YDLA 2D8JA 2ABLA 1K76A 2EW3A 2K7AA 2YUQA 3NPFA 2V1RA 1N5ZA 2KRMA 1YN8A 2LQWA 1T0JA 2LNHB 4CC7A 1SPKA 1PKTA 1AWXA 2LX7A 4AFSC 2CSIA 2EGCA 2EYXA 2K6DA 2O2OA 2JS0A 2O31A 2L2PA 5FWCA 1I1JA 4ZNXA 1BU1A 2DM1A 1QWFA 2FO0A 1T3LA 3EHQA 4WCIA 2DL5A 1UFFA 2IIMA 1NM7A 2DNUA 1BK2A 1QWEA 2LZ6B 2DE0X 4X1VA 2KT8A 2GBQA 2HCKA 3IQLA 1AOJA 1V1CA 2K2MA 5IHKA 4F17A 1W6XA 4HCKA 2KROA 2O9VA 2BZYA 1RUWA 2JM9A 2ENMA 2FEIA 2HDAA 3VS0A 4QT7A 4LN2A 1TG0A 1AZGB 5ECAA 1ZUUA 3THKA 1U5SA 1SHGA 3I5SA 4J9EA 3R6NA 1E7OA 2QDLA 1PRLC 2DF6A 2A36A 2AKLA 4OMMA 3GBQA 2L0AA 2BZXA 1AD5A 1X6GA 3VS4A 2J7IA 1WI7A 2JMCA 1MV3A 1K0SA 2XMFA 2C0TA 1VYUA 1X2KA 5IHNA 1PHTA 3REAB 3H0FA 1X2QA 3PE0A 5GJVB 1KJWA 3O5ZA 1M30A 1RLQC 3UA7A 2ESWA 1UJ0A 4D8KA 1ZLMA 2JM8A 1YNZA 1Z9QA 2YT6A 1UGVA 2GQIA 2YSQA 4GLMA 2O9SA 2RNAA 1WFWA 1G83A 2DILA 2YUOA 1WX6A 2LQNA 1K0XA 3JV3A 2RMOA 4J9BA 1M8MA 4RTVA 4R0KA 1JU5C 5IH2A 1E6HA 2K9GA 1FYNA 3EG0A 4HVWA 4J9HA 3C0CA 4J9GA 2A28A 2KXDA 3I5RA 4LUEA 2L3SA 2DX1A 3UA6A 1TUCA 4KRTA 2J6FA 2ROLA 1UJYA 5IXFA 2P4RA 4J9FA 1NG2A 2DBMA 4GBQA 4RTXA 2VWFA 2CUBA 1AEYA 2J6OA 2J6KA 1VYTA 2AKKA 1WDXA 2LCSA 1VA7A 2DYBA 4RTUA 4CC2A 2K79A 3EHRA 2FPEA 3M0PA 2G6FX 2KGTA 4LNPA 2RPNA 2V1QA 1B07A 3U23A 2CSQA 4Y92A 1ZX6A 4D8DA 2F2XA 2HEQA 1VYVA 4F16A 1WXTA 3TSWA 1UUEA 2L3QA 1RI9A 2KNBB 2M51A 1UDLA 4M4ZA 4IIMA 4AFQC 3TVTA 4OMOA 2CUDA 1JEGA 2GNCA 4A63B 1X69A 2RF0A 2M0YA 2LJ0A 2KR3A 2EYZA 2BTTA 2OJ2A 2X3WD 2DRKA 1YP5A 4K11A 1UECA 5I22A 3EG1A 1KSWA 2J06A 1ABOA 1HJDA 1NYFA 2ROTA 3QWXX 3I9QA 3H41A 2KEAA 3UF4A 2EBPA 3VS5A 2SEMA 3RBBB 2W0ZA 4FSSA 2H8HA 1GL5A 2MIOA 1ZUYA 4E6RA 1MV0B 2NWMA 4Z88A 3RNJA 4AG1C 2A08A 3M0TA 5FW9A 2FRYA 2DVJA 2FPFA 1S1NA 2C0IA 2F2VA 2ECZA 2RQVA 4J9IA 4LUDA 2J05A 3H0HA 1HSQA 3VRZA 1UTIA 1FMKA 2AZVA 1NEGA 1QKXA 2DL8A 1PRMC 3VS3A 4CC4B 1GBQA 1K4US 4OMQA 2JMAA 1RLPC 3EG2A 1ZSGA 1PNJA 1HD3A 1ZBJA 1AWOA 1OEBA 2RQUA 1H92A 1WXBA 1UE9A 3VS2A 4JJCA 5GJWB 3EG3A 2O88A 4RTWA 1M3BA 1T0HA 1X27A 2DL3A 2JT4A 2OI3A 2LJ3A 2DL4A 1MUZA 4OMNA 4AG2C 2KRSA 1SRLA 2CT4A 2LP5A 1GCQA 1Y57A 2PNIA 1KIKA 2I0NA 1M3CA 1AVZC 2HBWA 2CT3A 1QKWA 2DJQA 4HVVA 2K3BA 4ESRA 1SSHA 2ED1A 3EGUA 1K9AA 1YCSB 2AK5A 2GGRA 1CKAA 2KE9A 1GCQC 1WLPB 2DBKA 1YWOA 1M27C 4HVUA 2EKHA 4OMLA 1NEBA 3PVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHN A;  4DEX A;  2PTK A;  2CDT A;  4JZ4 A;  3SHW A;  3VS6 A;  1Y0M A;  2D0N A;  2DL7 A;  2F2W A;  4Z8A A;  2GTO A;  2EVR A;  3PVL A;  4JZ3 A;  4RTY A;  2DMO A;  2RQT A;  3NMZ C;  1H3H A;  4Z89 A;  2RQW A;  4AFU C;  2JS2 A;  3NGP A;  2KBT A;  1ARK A;  2SRC A;  2HSP A;  2X3X D;  2A37 A;  1W1F A;  1I0C A;  1T3S A;  3CQT A;  2LMJ A;  1UHC A;  1GRI A;  1BBZ A;  3ULR B;  1QCF A;  1JQQ A;  3SEM A;  1CKB A;  2VVK A;  3I35 A;  5I11 A;  2CH4 W;  3FJ5 A;  3M0U A;  5FWB A;  3M0R A;  1UHF A;  4JPB W;  2YUN A;  5IHI A;  1XOV A;  2JTE A;  2W10 A;  1OOT A;  2LJ1 A;  2D1X A;  2CH4 A;  2E5K A;  4ORZ A;  4HXJ A;  2B86 A;  1WXU A;  2KT1 A;  1SHF A;  2CRE A;  2MOX A;  1NYG A;  1QLY A;  2BZ8 A;  2MCN A;  4CC3 A;  1EFN A;  1GFD A;  2KYM A;  2GTJ A;  1Z9Z A;  1ABQ A;  4JJB A;  1K1Z A;  1JXM A;  4RTZ A;  1E6G A;  4AFZ C;  2C0O A;  3TSZ A;  3H0I A;  1I07 A;  2RQR A;  3UAT A;  4JJD A;  3VRY A;  1U06 A;  1AWW A;  1J3T A;  2EYY A;  1ZUK A;  1SRM A;  2KXC A;  2D8H A;  2PZ1 A;  5IXB A;  3A98 A;  2JW4 A;  1X43 A;  2FG0 A;  2EYW A;  4J9D A;  2EGA A;  1X6B A;  2EQI A;  4LE9 A;  1PKS A;  3QWY A;  4DEY A;  2NUZ A;  1GCP A;  2VKN A;  2L3P A;  3VS7 A;  2DA9 A;  1OV3 A;  5EC7 A;  1H8K A;  2EPD A;  3VS1 A;  1M3A A;  4IIO A;  4RUG A;  2AZS A;  1AWJ A;  1WA7 A;  2DLP A;  2EGE A;  1WIE A;  1U3O A;  1B3Q A;  1PWT A;  4F14 A;  1OPL A;  1KFZ A;  1G2B A;  1NLP C;  1SEM A;  2FPD A;  1BB9 A;  3REB B;  5HCK A;  1AZE A;  1UG1 A;  1LCK A;  3LH5 A;  2JXB A;  1W70 A;  2ED0 A;  3KFV A;  2YUP A;  4EIK A;  1GBR A;  1TUD A;  1A0N B;  1JO8 A;  1NLO C;  2FRW A;  1OPK A;  4RTT A;  5L23 A;  3ZL7 C;  2OAW A;  1YWP A;  2RN8 A;  1WYX A;  1JXO A;  2KYB A;  4J9C A;  1CSK A;  3M0Q A;  3M0S A;  2DRM A;  4OMP A;  1GFC A;  2KRN A;  1IO6 A;  2YDL A;  2D8J A;  2ABL A;  1K76 A;  2EW3 A;  2K7A A;  2YUQ A;  3NPF A;  2V1R A;  1N5Z A;  2KRM A;  1YN8 A;  2LQW A;  1T0J A;  2LNH B;  4CC7 A;  1SPK A;  1PKT A;  1AWX A;  2LX7 A;  4AFS C;  2CSI A;  2EGC A;  2EYX A;  2K6D A;  2O2O A;  2JS0 A;  2O31 A;  2L2P A;  5FWC A;  1I1J A;  4ZNX A;  1BU1 A;  2DM1 A;  1QWF A;  2FO0 A;  1T3L A;  3EHQ A;  4WCI A;  2DL5 A;  1UFF A;  2IIM A;  1NM7 A;  2DNU A;  1BK2 A;  1QWE A;  2LZ6 B;  2DE0 X;  4X1V A;  2KT8 A;  2GBQ A;  2HCK A;  3IQL A;  1AOJ A;  1V1C A;  2K2M A;  5IHK A;  4F17 A;  1W6X A;  4HCK A;  2KRO A;  2O9V A;  2BZY A;  1RUW A;  2JM9 A;  2ENM A;  2FEI A;  2HDA A;  3VS0 A;  4QT7 A;  4LN2 A;  1TG0 A;  1AZG B;  5ECA A;  1ZUU A;  3THK A;  1U5S A;  1SHG A;  3I5S A;  4J9E A;  3R6N A;  1E7O A;  2QDL A;  1PRL C;  2DF6 A;  2A36 A;  2AKL A;  4OMM A;  3GBQ A;  2L0A A;  2BZX A;  1AD5 A;  1X6G A;  3VS4 A;  2J7I A;  1WI7 A;  2JMC A;  1MV3 A;  1K0S A;  2XMF A;  2C0T A;  1VYU A;  1X2K A;  5IHN A;  1PHT A;  3REA B;  3H0F A;  1X2Q A;  3PE0 A;  5GJV B;  1KJW A;  3O5Z A;  1M30 A;  1RLQ C;  3UA7 A;  2ESW A;  1UJ0 A;  4D8K A;  1ZLM A;  2JM8 A;  1YNZ A;  1Z9Q A;  2YT6 A;  1UGV A;  2GQI A;  2YSQ A;  4GLM A;  2O9S A;  2RNA A;  1WFW A;  1G83 A;  2DIL A;  2YUO A;  1WX6 A;  2LQN A;  1K0X A;  3JV3 A;  2RMO A;  4J9B A;  1M8M A;  4RTV A;  4R0K A;  1JU5 C;  5IH2 A;  1E6H A;  2K9G A;  1FYN A;  3EG0 A;  4HVW A;  4J9H A;  3C0C A;  4J9G A;  2A28 A;  2KXD A;  3I5R A;  4LUE A;  2L3S A;  2DX1 A;  3UA6 A;  1TUC A;  4KRT A;  2J6F A;  2ROL A;  1UJY A;  5IXF A;  2P4R A;  4J9F A;  1NG2 A;  2DBM A;  4GBQ A;  4RTX A;  2VWF A;  2CUB A;  1AEY A;  2J6O A;  2J6K A;  1VYT A;  2AKK A;  1WDX A;  2LCS A;  1VA7 A;  2DYB A;  4RTU A;  4CC2 A;  2K79 A;  3EHR A;  2FPE A;  3M0P A;  2G6F X;  2KGT A;  4LNP A;  2RPN A;  2V1Q A;  1B07 A;  3U23 A;  2CSQ A;  4Y92 A;  1ZX6 A;  4D8D A;  2F2X A;  2HEQ A;  1VYV A;  4F16 A;  1WXT A;  3TSW A;  1UUE A;  2L3Q A;  1RI9 A;  2KNB B;  2M51 A;  1UDL A;  4M4Z A;  4IIM A;  4AFQ C;  3TVT A;  4OMO A;  2CUD A;  1JEG A;  2GNC A;  4A63 B;  1X69 A;  2RF0 A;  2M0Y A;  2LJ0 A;  2KR3 A;  2EYZ A;  2BTT A;  2OJ2 A;  2X3W D;  2DRK A;  1YP5 A;  4K11 A;  1UEC A;  5I22 A;  3EG1 A;  1KSW A;  2J06 A;  1ABO A;  1HJD A;  1NYF A;  2ROT A;  3QWX X;  3I9Q A;  3H41 A;  2KEA A;  3UF4 A;  2EBP A;  3VS5 A;  2SEM A;  3RBB B;  2W0Z A;  4FSS A;  2H8H A;  1GL5 A;  2MIO A;  1ZUY A;  4E6R A;  1MV0 B;  2NWM A;  4Z88 A;  3RNJ A;  4AG1 C;  2A08 A;  3M0T A;  5FW9 A;  2FRY A;  2DVJ A;  2FPF A;  1S1N A;  2C0I A;  2F2V A;  2ECZ A;  2RQV A;  4J9I A;  4LUD A;  2J05 A;  3H0H A;  1HSQ A;  3VRZ A;  1UTI A;  1FMK A;  2AZV A;  1NEG A;  1QKX A;  2DL8 A;  1PRM C;  3VS3 A;  4CC4 B;  1GBQ A;  1K4U S;  4OMQ A;  2JMA A;  1RLP C;  3EG2 A;  1ZSG A;  1PNJ A;  1HD3 A;  1ZBJ A;  1AWO A;  1OEB A;  2RQU A;  1H92 A;  1WXB A;  1UE9 A;  3VS2 A;  4JJC A;  5GJW B;  3EG3 A;  2O88 A;  4RTW A;  1M3B A;  1T0H A;  1X27 A;  2DL3 A;  2JT4 A;  2OI3 A;  2LJ3 A;  2DL4 A;  1MUZ A;  4OMN A;  4AG2 C;  2KRS A;  1SRL A;  2CT4 A;  2LP5 A;  1GCQ A;  1Y57 A;  2PNI A;  1KIK A;  2I0N A;  1M3C A;  1AVZ C;  2HBW A;  2CT3 A;  1QKW A;  2DJQ A;  4HVV A;  2K3B A;  4ESR A;  1SSH A;  2ED1 A;  3EGU A;  1K9A A;  1YCS B;  2AK5 A;  2GGR A;  1CKA A;  2KE9 A;  1GCQ C;  1WLP B;  2DBK A;  1YWO A;  1M27 C;  4HVU A;  2EKH A;  4OML A;  1NEB A;  3PVQ A; 
#chains in the Genus database with same CATH topology
 1VQO A;  2CDT A;  5GAN d;  1KQ2 A;  2L89 A;  1MMN A;  2GTO A;  2X4J A;  3PMI A;  3PVL A;  2DMO A;  5GMK l;  4Z89 A;  2COZ A;  1KC8 C;  4C8Q E;  2SRC A;  1VQO T;  1IRE B;  2HSP A;  2RJE A;  4A54 A;  4ZN1 A;  1W1F A;  1I0C A;  2K57 A;  4C5G A;  3EGD B;  1BBZ A;  3PTA A;  2FZG B;  3I35 A;  1KHC A;  3LWH A;  3M0U A;  5FWB A;  2QEX T;  5KYN A;  3M0R A;  2DXB A;  2EFI A;  3EFO A;  8ATC B;  2W10 A;  3QO3 A;  2D1X A;  2DIG A;  2ZCF B;  4ORZ A;  5I2S A;  1KD1 U;  1YJW A;  1VQL Q;  4HXJ A;  2DIQ A;  4WF2 A;  4F7U G;  4XTX A;  5J3B A;  2DK3 A;  1QLY A;  4D6W A;  4C5E A;  2VGN A;  5KE2 A;  1EFN A;  1GFD A;  1OQK A;  1QCN A;  2HMA A;  3L42 A;  2M1H A;  4JJB A;  3QUI A;  1YJW T;  4RTZ A;  1E6G A;  2C0O A;  3OYD A;  2PVG B;  3CPW A;  1I07 A;  2RQR A;  3L2U A;  3E19 A;  1J3T A;  1SRM A;  5IAY A;  4XTZ A;  4BE2 A;  2PZ1 A;  1XJW B;  3A98 A;  3HKS A;  1X01 A;  4J6W A;  3CBO A;  4MZP A;  4M77 D;  4IUU A;  2CZ1 B;  1W2B P;  3M53 A;  1GXI E;  2JOY A;  1PKS A;  4DEY A;  3FLG A;  1VQ5 Q;  4DA4 A;  2L3P A;  2KI7 A;  1BIB A;  2R5M A;  3CXC A;  4KH1 B;  4RUG A;  2DTH A;  1WA7 A;  2DLP A;  5LJ5 d;  4ZGE B;  1WIE A;  2F5K A;  4HCZ A;  1KC8 U;  1TUG B;  2FHD A;  1OZ2 A;  4RMO A;  1TOV A;  1KFZ A;  5GAM f;  4JDS A;  3JB9 D;  4XTY A;  3REB B;  5HCK A;  3OSV A;  2K5I A;  3FRN A;  4KUD K;  2YLC A;  5GAN e;  4E7I A;  2E6Z A;  3LH0 A;  1GBR A;  3S3M A;  2FVU A;  1NLO C;  3CC2 Q;  4RTT A;  2CP7 A;  3I55 Q;  1I4K 1;  4DBH A;  1YWP A;  2RN8 A;  1WYX A;  3H6Z A;  5GAN 3;  3M0Q A;  2WSE E;  4RKU E;  3CMA A;  2DRM A;  4OMP A;  4A4G A;  3G4S A;  2YUQ A;  1NJI C;  3JCM d;  3NPF A;  3OYB A;  2LQ8 A;  3KXT A;  2NYS A;  2V1R A;  2RB6 A;  1YN8 A;  1KQS P;  3CMA T;  2LNH B;  1SPK A;  1Q81 R;  2Y90 A;  2LX7 A;  1AWX A;  3G4S T;  2CSI A;  2EYX A;  1WGS A;  2K6D A;  4OGC A;  2E41 A;  5FWC A;  1VQL A;  2D0Q B;  3ZBD A;  4KGZ B;  3DLL A;  2FO0 A;  3MPU B;  2QAS A;  1UFF A;  1NM7 A;  2RHI A;  4X1V A;  2ZPI B;  4PFP A;  1QMC A;  5DM7 R;  3VU3 C;  1VQL T;  5IHK A;  3LW5 E;  5CIU A;  5GMK i;  4QVD A;  4HCK A;  4M75 F;  2KRO A;  3WVD B;  2QK0 A;  1R8O B;  1BKB A;  1M1K U;  2JM9 A;  4BY6 C;  4XU3 A;  1W2B A;  3TRE A;  2FEI A;  2K4Y A;  2RJF A;  3NTK A;  1AZG B;  3JRZ A;  3I5S A;  2RH2 A;  1C1A A;  4PNO A;  4J9E A;  1G8X A;  2QGG A;  3R6N A;  1PRL C;  3HHT B;  4OMM A;  1U1T A;  2L0A A;  1AD5 A;  3PIP A;  2RM4 A;  1IGQ A;  3JAM E;  2JMC A;  2LCC A;  2I2L A;  1VYU A;  5IHN A;  3REA B;  1X2Q A;  3OYJ A;  1JB0 E;  1KHI A;  5LJ5 e;  1VQ4 Q;  3OS2 A;  2QQB A;  2P0K A;  2JNG A;  2PUO B;  4M7A G;  3FIF A;  1YNZ A;  3ZFJ A;  2QA4 Q;  1UGV A;  3OYF A;  4GLM A;  2HAX A;  2O9S A;  4FCY A;  2YUO A;  7AT1 B;  3JV3 A;  1UGR B;  3GNG A;  5GAM g;  1D0Y A;  5FU7 C;  2KVQ G;  5GAN h;  1NJI U;  1IB8 A;  1JU5 C;  1WHG A;  1NJI R;  3UT1 A;  4MDW A;  3CPW S;  4KRT A;  2LDM A;  2P4R A;  4J9F A;  2VWF A;  1KQS A;  4XTU A;  1PCX A;  3X26 B;  2DYB A;  3HSB A;  2FPE A;  3M58 A;  3M0P A;  3C12 A;  3RUX A;  1HXD A;  2KGT A;  4LNP A;  3INZ A;  1RAF B;  3U23 A;  4MDX A;  2LVM A;  4PJN A;  4Y92 A;  3CCS Q;  4HA8 A;  2XHC A;  2AHJ B;  1K73 C;  4M7D G;  1SSF A;  3CXC S;  1RI9 A;  3WXM B;  2KNB B;  2E6N A;  3QXE B;  3MP6 A;  3LGL A;  3N5B B;  2YRC A;  3SWN B;  1JEG A;  5A0L A;  4E2F B;  3H8Z A;  2M0Y A;  4M7A E;  1PSF A;  1VQ8 A;  2XG8 D;  3BW1 A;  4X9C A;  2EIF A;  2KR3 A;  2P0P A;  1D0X A;  2L8D A;  4M78 G;  2M9U A;  2OJ2 A;  2MYS A;  2EAY A;  4XTW A;  1VQM A;  1HJD A;  2IVW A;  2WAC A;  3CCU Q;  2FZC B;  2H3J A;  1YJ9 A;  3I9Q A;  3J80 E;  3H41 A;  5GAO l;  3CC7 Q;  2LC4 A;  3AHU A;  3TCJ A;  2W0Z A;  1GL5 A;  1MNE A;  4C0Z A;  1MV0 B;  1OX8 A;  2BIV A;  3RNJ A;  3G6E A;  1V29 B;  4PJO B;  1M4Z A;  1PSE A;  1YJ9 T;  5LJ5 h;  2FPF A;  2OX7 A;  2PVO B;  2JN0 A;  3QYH B;  4LUD A;  2O4X B;  3H0H A;  4N0A A;  2CZ6 B;  4LXC A;  3G6E T;  1UTI A;  1YCY A;  2BE9 B;  1YI2 Q;  2AZV A;  4F04 B;  1NEG A;  4J5Y A;  2QA4 A;  2GFU A;  2CP6 A;  3VS3 A;  2HD0 A;  4XK8 E;  1PM3 A;  4M7D E;  3EG2 A;  1VQ4 T;  2YWW A;  1HD3 A;  5CKB A;  4E7J A;  2RQU A;  2EWN A;  3P8D A;  4ANJ A;  5GJW B;  2O88 A;  2RHX A;  4GLK A;  2QA4 T;  1ZA2 B;  2XID A;  2LJ3 A;  2DL4 A;  4JUV A;  4AG2 C;  1RI0 A;  1M1G A;  1I5L A;  4VUB A;  3OYN A;  1K73 U;  2OTL A;  4M78 E;  3JCM V;  1M3C A;  2K3B A;  1SSH A;  4M7A A;  3EGU A;  1W2B S;  1RAH B;  1CKA A;  1QW1 A;  2WSF E;  2ZPB B;  4O5V A;  2ATC B;  1YWO A;  4XQ3 A;  2BE7 D;  4XAX B;  1FWZ A;  3OBY A;  4HVU A;  4A4E A;  4OML A;  2RJD A;  4ATO A;  4M77 C;  3CCS A;  2DJZ A;  3MET A;  3SHW A;  3VS6 A;  2DAQ A;  1I5O B;  1TSF A;  2DL7 A;  2MAM A;  2XDP A;  5I21 A;  2EVR A;  3F70 A;  3NMZ C;  1Y71 A;  3NGP A;  3OS5 A;  1P92 A;  3M57 A;  5CKF A;  4JLI A;  3CCS T;  2A37 A;  3QKJ A;  2XD0 A;  2KY9 A;  1T3S A;  2VV5 A;  2GFA A;  2V8J A;  1N8R C;  1GRI A;  1Q7Y C;  3ULR B;  3VV0 A;  4FYY B;  3FJ5 A;  3TU4 K;  1ZBX A;  4JPB W;  4PFO A;  2YUN A;  3FDR A;  1Q82 U;  2CH4 A;  4Y28 E;  5AT1 B;  5LL6 S;  3CCU A;  4AMC A;  3X25 B;  2DKG A;  4BE0 A;  2BKD N;  3SWN A;  3G7Z A;  1TU0 B;  2MOX A;  1BI2 A;  4CC3 A;  3JCM J;  1M2O A;  2KYM A;  3CCU T;  1ABQ A;  1KQS S;  5GAO r;  8AT1 B;  2L3R A;  3E9G A;  4J7I A;  4M78 A;  3OYK A;  4X9D A;  3VRY A;  1MMA A;  2EQU A;  4BI3 A;  1ZUK A;  4C8Q B;  1U8R A;  1YI2 A;  1K9M U;  5IXB A;  4L6V 5;  5GAO q;  3CCL Q;  1X43 A;  2FG0 A;  3ER0 A;  2EYW A;  4J9D A;  1YHQ A;  2EQI A;  2HQH A;  3OA6 A;  5KYY A;  4PJO A;  1GCP A;  2HKN A;  4E7H A;  2CZ0 B;  1YI2 T;  2VKN A;  1WPY A;  4KGV B;  1M9S A;  2DA9 A;  2O4X A;  1YHQ T;  1I8F A;  2PVD B;  3VS1 A;  1M3A A;  4IIO A;  3RMS A;  1VQN Q;  2AZS A;  1OZ3 A;  2M16 A;  3URG A;  2EGE A;  1G3T A;  1B3Q A;  2DEQ A;  5CO7 A;  3RMQ A;  1PWT A;  4M75 G;  4F14 A;  1VQP A;  1OPL A;  1B34 A;  1G2B A;  1NLP C;  4C92 B;  1SEM A;  2FPD A;  3P8H A;  3OYE A;  3CC4 A;  3OYC A;  2ZZD A;  3CCQ Q;  5D7U A;  3LH5 A;  1N8R U;  2RK1 A;  1QVP A;  2ED0 A;  1Q95 G;  3KFV A;  2ZPH B;  1VQP T;  4EIK A;  1TUD A;  2DXT A;  3CC4 T;  2FRW A;  1Q7Y R;  5L23 A;  1UGP B;  2VXF A;  3E1S A;  3Q1J A;  2MWO A;  1JXO A;  1GFC A;  2KRN A;  1IO6 A;  3CMA Q;  1XNI A;  3NTI A;  3V7C A;  4OVA A;  1K76 A;  2EW3 A;  3G4S Q;  2K7A A;  3G71 Q;  3KUF A;  4KBM B;  5KCO A;  4P5N A;  1N27 A;  1LVK A;  4TVR A;  1T0J A;  3CCR Q;  5GAM d;  5KH6 A;  4LD9 K;  1QVG P;  2EGC A;  3X24 B;  3QPH A;  2JS0 A;  3HRS A;  1BCO A;  2YLB A;  2EQK A;  1YFN A;  2JVV A;  3RIR A;  4QW2 A;  1BU1 A;  2DM1 A;  5GAN 4;  3OYL A;  3EHQ A;  2B8A A;  2DD5 A;  2IIM A;  2DNU A;  1BK2 A;  3LLR A;  3JCM Q;  4XTV A;  4LD6 A;  4C92 E;  2KT8 A;  2DYI A;  4M75 E;  4L5G A;  2FYK A;  4F7U B;  1KD1 R;  1AOJ A;  2K2M A;  4J7F A;  4JRQ A;  1W6X A;  2H3E B;  3QBY A;  4M77 F;  3JCM P;  4FM4 B;  3X20 B;  5L8R E;  3OSS C;  1Q86 U;  1ZSZ B;  2XKO C;  1MGQ A;  2M0O A;  1BI1 A;  1SG5 A;  4QT7 A;  2K5L A;  5ECA A;  3UWN A;  3V8J A;  3CCL A;  1E7O A;  4L59 A;  3VUB A;  3OY9 A;  4BAC A;  1QQJ A;  1X6G A;  5GAN 7;  1WNL A;  2J7I A;  3CCL T;  3OW2 P;  4PLL A;  3JB9 F;  4O6J A;  5GJV B;  1M1K C;  4C8Q A;  2KDS A;  4J6X A;  3TQ7 P;  1VQN A;  2A7Y A;  1KJW A;  3O5Z A;  1QVF P;  3OQ5 A;  2ESW A;  4D8K A;  1ZLM A;  3CCJ Q;  2JM8 A;  5A0G A;  2E64 A;  5A2Q E;  1XQH A;  2YSQ A;  1RAB B;  2RNA A;  2DIL A;  1VQN T;  3CCQ A;  1K0X A;  2RMO A;  1KC8 R;  2EJ9 A;  1V76 A;  1MND A;  2K9G A;  1FYN A;  2VC8 A;  4F7U E;  4HVW A;  3VYH B;  1IZ6 A;  4EPC A;  1HK9 A;  3CCQ T;  1NE8 A;  1YIJ Q;  3RER A;  5AYF A;  3OB9 A;  3RES A;  3SDZ A;  3HFN A;  4LDW A;  2J6F A;  2DBM A;  4GBQ A;  4C92 A;  4EMK A;  4M75 A;  4RTX A;  1AEY A;  2J6O A;  3VJP A;  2EQM A;  2VB6 A;  2AKK A;  1QVG A;  2F5T X;  3BFM A;  3G71 A;  2RA2 A;  2MK5 A;  1YJN A;  4CC2 A;  2HSE B;  2R58 A;  5GAM e;  1R0B G;  2V1Q A;  3CCR A;  2CSQ A;  2EQJ A;  3AT1 B;  4E7L A;  3TEE A;  1VYV A;  2E4H A;  3G71 T;  3TSW A;  5GAN j;  1UUE A;  2KMT A;  1EZZ B;  3CCR T;  3CBM A;  1UDL A;  5FRN A;  4IIM A;  4MMK A;  2C06 A;  1AT1 B;  2CUD A;  2KQW A;  3BDL A;  3MJX A;  2DZC A;  2MF2 A;  1VQ8 Q;  5LJ3 f;  2EYZ A;  1OU9 A;  2BTT A;  3CCE Q;  2X3W D;  1YP5 A;  4K11 A;  1D09 B;  4C8Q D;  5I22 A;  1Y07 A;  1KSW A;  3QJY A;  1ABO A;  1VQM Q;  1NYF A;  3QYG B;  2ROT A;  3QWX X;  3UF4 A;  1M1K R;  2EBP A;  3VS5 A;  5GMK m;  3OW2 A;  2LT4 A;  1YJ9 Q;  2SEM A;  2V8K A;  4F7U A;  2QDY B;  4Z88 A;  4C0D B;  2X4Y A;  5CQX A;  3M0T A;  2GQV A;  3G6E Q;  1W4S A;  2QQ9 A;  1ZSZ A;  1WQW A;  4J9I A;  4BD3 A;  2J05 A;  5LJ3 e;  4HCB A;  1WHM A;  4BDZ A;  2FZK B;  3CCJ A;  3OYA A;  3PMT A;  4JRP A;  4N0A C;  1BIA A;  1K4U S;  3JCM X;  2ZPE B;  4OGE A;  5HK0 A;  4M7A B;  4HT9 A;  1WHJ A;  1UE9 A;  1TH7 A;  4JJC A;  3VYG A;  3CCJ T;  4RTW A;  2RHU A;  4OMN A;  2A0F B;  3CEY A;  2MPX C;  2CT4 A;  3M4G A;  1YIJ A;  3JCM c;  2ZPG B;  1Y57 A;  4BI4 A;  2OTL Q;  2QQA A;  4FIB A;  1QKW A;  4OF1 A;  5LJ5 j;  2GGR A;  3VKI A;  2CKK A;  2DBK A;  1G5V A;  1YIJ T;  2O01 E;  5GAM h;  9ATC B;  3QJ6 A;  1D1B A;  1WJR A;  1NEB A;  4LDX A;  1OUL A;  3NHN A;  4DEX A;  5KYX B;  2KSS A;  1Y0M A;  4V2S A;  2F2W A;  3NFC A;  3QG1 A;  4Z8A A;  4ZGD B;  4QVC A;  1IHW A;  4RTY A;  4JZ3 A;  2D6F A;  2RQT A;  3CBP A;  1H3H A;  1OX9 A;  3P8B B;  4AFU C;  4WTO B;  2CGH A;  2JS2 A;  1TWB A;  1ARK A;  2P84 A;  2VGM A;  2X3X D;  2HL3 A;  4M7D B;  1M90 C;  4FYV B;  2RO0 A;  3CQT A;  2LMJ A;  4CRI A;  2BUD A;  2E3I A;  5KYU B;  2COW A;  1JQQ A;  1M2V B;  3MEA A;  1CKB A;  3SEM A;  2VVK A;  2CH4 W;  1IRX A;  3CCE A;  3M56 A;  1XOV A;  2JTE A;  1MMD A;  5LJ3 g;  1OOT A;  4DOV A;  4M78 B;  3OYH A;  4GY5 A;  1VQ8 T;  1WXU A;  3J7A F;  4EDU A;  3CCE T;  1SHF A;  1NYG A;  2BZ8 A;  4PFZ A;  1VQ7 A;  3L2Q A;  2GCX A;  1VQM T;  1Z9Z A;  3SWN C;  4N4H A;  1K1Z A;  3EGX B;  1VQK Q;  5KYY B;  2JTM A;  2RD1 A;  1PD0 A;  1QVG S;  5CKD A;  3GIB A;  5LJ3 h;  3QZ9 B;  3UAT A;  4JJD A;  1D1C A;  1OU8 A;  4KGX B;  1Q82 C;  2WSC E;  1LJO A;  2D8H A;  2AIR B;  1D3B A;  3BDU A;  4A53 A;  2JTF A;  2LX9 A;  1X6B A;  4KT0 E;  3I56 Q;  1IHV A;  1YHQ Q;  4RG2 A;  2E3H A;  3QWY A;  2NUZ A;  1B34 B;  4RG8 A;  5FU6 C;  4LDU A;  2DVE A;  4QQ6 A;  1N9S A;  1NZ9 A;  1OV3 A;  5EC7 A;  1H8K A;  2X9H A;  2XK0 A;  4QVZ A;  5HY6 A;  2RHZ A;  2QAZ A;  5GMK e;  1U3O A;  4M77 G;  1K9M C;  3HPW A;  1VQP Q;  4ELZ C;  1M90 U;  1BB9 A;  3EAE A;  3QZ5 B;  1SF9 A;  3GLX A;  4NS5 A;  1K73 R;  1UG1 A;  5FRM A;  1AZE A;  3CC4 Q;  1LCK A;  3OW2 S;  3PNW C;  2OTL T;  3C4S A;  2HQE A;  2YUP A;  3PT9 A;  1IGU A;  1A0N B;  1JO8 A;  1QVF S;  1OPK A;  3MEV A;  4A4K A;  3ZL7 C;  2OAW A;  3LWI A;  2Z0W A;  3M9Q A;  4B9W A;  3JB9 G;  1PG5 B;  1UEB A;  2KYB A;  2MMP A;  2YDL A;  2D8J A;  1K8A U;  2DXC A;  1QCO A;  3CD6 Q;  4J83 A;  1VQ9 Q;  2CZ7 B;  5KYX A;  1G3S A;  2KRM A;  4CC7 A;  3OS0 A;  3J81 E;  1PKT A;  4J8O A;  3L2W A;  4AFS C;  3ME9 A;  3OYI A;  4ZTJ A;  2VYT A;  2XU8 A;  2O2O A;  1R0C B;  2O31 A;  1VOM A;  4ZNX A;  4E7Z A;  1YIT Q;  4M7D A;  2X51 A;  1QWF A;  4KUL A;  4WCI A;  2DL5 A;  2HL5 C;  1QWE A;  2LZ6 B;  2DE0 X;  4FYW B;  1Q82 R;  5KYU A;  1M2V A;  1X75 C;  3LGF A;  3OYY A;  4IUP A;  4M77 E;  4YTL A;  1VQK A;  1RAE B;  4M7A F;  1RAI B;  4KH0 B;  2BZY A;  3JSC A;  1RUW A;  5GAO p;  1ACM B;  5CR2 A;  1VQK T;  2HDA A;  2LRQ A;  4JRK A;  3VS0 A;  1MHN A;  3THK A;  1ZUU A;  1SHG A;  2DXU A;  4FT4 A;  2FB7 A;  3I56 A;  2QDL A;  4M7A D;  2MI6 A;  4BDY A;  1QP3 A;  3EGX A;  2AKL A;  3RKX A;  3EFS A;  3GBQ A;  1K9M R;  2CP2 A;  3A8O B;  2HBP A;  3VS4 A;  1WI7 A;  3S3N A;  1MV3 A;  2XMF A;  5J26 A;  4QKU A;  4DBQ A;  1X2K A;  3I56 T;  3PE0 A;  5GMK h;  2FL7 A;  3FEO A;  1Q86 C;  5DLQ E;  1M30 A;  3L2Z A;  3UA7 A;  1UJ0 A;  4A4H A;  2DEU A;  3CCM A;  1Z9Q A;  3RKW A;  4C8Q C;  4JS4 A;  1VUB A;  1UGQ B;  4EMK B;  4M75 B;  4MZM A;  4RTV A;  4R0K A;  4IUT A;  5C0M A;  1E6H A;  4IUV A;  3CCM T;  3EG0 A;  2IPO B;  3C0C A;  1M1F A;  2RJC A;  4BI8 B;  5D6Y A;  1N8R R;  2KXD A;  2QTV A;  3I5R A;  4LUE A;  1KK7 A;  2DX1 A;  3UA6 A;  1TUC A;  4PJL A;  2ROL A;  3V8K A;  1AHJ B;  1UJY A;  4XU0 A;  4M7D D;  1NG2 A;  2CUB A;  3QSU A;  1BI0 A;  1VYT A;  1WJQ A;  1VA7 A;  2QYZ A;  3LX7 A;  2K79 A;  3MO8 A;  3EHR A;  3CD6 A;  1VQ9 A;  3SFM A;  2G6F X;  1YJN Q;  1FX7 A;  2VXE A;  4FT2 A;  2VAS A;  1B07 A;  3CCV A;  1FMW A;  2YRD A;  2QG9 B;  2JZ2 A;  4D8D A;  4EMH A;  3PGG A;  2F2X A;  4PJO F;  4M78 D;  5EG2 A;  4PJJ A;  2HNI A;  1WXT A;  3CD6 T;  1VQ9 T;  3JCM W;  4N4I A;  4ZGJ B;  1YIT A;  2L3Q A;  2QEX A;  3CCV T;  5KYW B;  2EYQ A;  2GNC A;  4A63 B;  2RF0 A;  2COY A;  4R55 A;  1F1B B;  4PJO D;  1YIT T;  3V7R A;  1R77 A;  2NUP B;  3OMC A;  1M8V A;  2OTJ Q;  2DRK A;  3M5A A;  4C0G A;  2J06 A;  1VIE A;  2L5Q A;  1JJ2 P;  2KEA A;  1Q81 C;  2R5A A;  5DY9 A;  1OYX A;  1Q86 R;  2Y4X A;  2MIO A;  1ZUY A;  4E6R A;  2DPP B;  2YHT A;  3PIO A;  4AG1 C;  2A08 A;  3ZEH A;  5GAN 8;  5CK9 A;  2PU9 B;  1S1N A;  3EFR A;  2F2V A;  1C6V X;  2ECZ A;  2X4X A;  3OS1 A;  4RCC A;  3OYM A;  2Y4Y A;  2XI9 A;  1HSQ A;  2E65 A;  2DO3 A;  1D1A A;  2JJ9 A;  3VRZ A;  3A8G B;  3GOX A;  2QTX A;  2X4W A;  4XU2 A;  1QP2 A;  1ZSZ C;  5LJ3 d;  1QKX A;  4MZT A;  1WJS A;  1JBM A;  1PRM C;  4CC4 B;  4J6Y A;  5GAN f;  4OMQ A;  2JMA A;  1RLP C;  1ZSG A;  1AWO A;  1OEB A;  4B9X A;  1WXB A;  3M54 A;  3FB9 A;  4CI0 C;  3EG3 A;  1MMG A;  3HRU A;  3V7S A;  1X27 A;  1T0H A;  2DL3 A;  2OI3 A;  4PKC C;  3JCM b;  2LCL A;  2HZY A;  4FL6 A;  4DOW A;  4NOY A;  2CS7 A;  3V8L A;  2LP5 A;  1GCQ A;  4BUG A;  3GPL A;  2I0N A;  1Y96 B;  3H9N A;  1KIK A;  4HCC A;  3A8L B;  2DER A;  1KG1 A;  2CT3 A;  2DJQ A;  3ASK A;  4HVV A;  4ELY C;  4DBF A;  5CAI A;  4ESR A;  2ED1 A;  3E2U A;  1K9A A;  1Y7X A;  1YCS B;  2AK5 A;  2GF7 A;  6AT1 B;  2KE9 A;  5CKE A;  4PL6 A;  5HKC A;  2CYZ B;  1H64 1;  1WZO A;  1C0M A;  2YXY A;  4PK4 A;  3GF5 A;  5GAN 2;  2ZGW A;  2DET A;  1YBY A;  2PTK A;  4JZ4 A;  1ZHI A;  4C5I A;  4PLI A;  5GAN 6;  2D0N A;  1BCM A;  2DD4 A;  1G3Y A;  2RQW A;  2KAF A;  2V26 A;  2LT1 A;  1YJN T;  1PD1 A;  3LYI A;  2KBT A;  3O8V A;  3UPU A;  1PC0 A;  3CPF A;  1Q81 U;  4C8Q F;  1IXD A;  1UHC A;  3GNF B;  3MP1 A;  1QCF A;  2R57 A;  4BY6 B;  4DQ2 A;  5I11 A;  3NTH A;  1JJ2 A;  2PUK B;  2K5F A;  4ZN3 A;  2OTJ A;  4FW1 A;  4LDV A;  4EMG A;  1UHF A;  1WHH A;  5IHI A;  1TS9 A;  2LJ1 A;  2E5K A;  5GAM j;  4C5H A;  1KQ1 A;  5KYW A;  2B86 A;  4E7S A;  3EGD A;  2KT1 A;  1TTH B;  2DZ9 A;  2E70 A;  3FC3 A;  2CRE A;  2OTJ T;  3MKD A;  5HK3 A;  3BY7 A;  3X28 B;  4BB7 A;  2P0Q A;  2MCN A;  1EX4 A;  1D3B B;  5FLX E;  3C94 A;  3FJP A;  1VQ7 Q;  4A4F A;  2GTJ A;  5LJ5 f;  2NUP A;  1JXM A;  3DB3 A;  4C0F A;  1QVF A;  4C92 F;  4AFZ C;  4KUI A;  3TSZ A;  1EIF A;  3A5Z B;  2XDB A;  2RI2 A;  3H0I A;  1LNX A;  1RL2 A;  1U06 A;  1AWW A;  4FYX B;  2EYY A;  3PFS A;  2KXC A;  1I81 A;  2LQK A;  2JW4 A;  2HQX A;  4C92 D;  5FU7 B;  2EGA A;  4M75 D;  1ZQ1 A;  4LE9 A;  4NL3 A;  1BYM A;  2A3L A;  2D9T A;  1VQ5 A;  5GAN g;  4OB1 B;  3VS7 A;  2JUF A;  1WHK A;  4C0D C;  2XDD A;  2F69 A;  2EPD A;  3D7S B;  1O9S A;  1VQ5 T;  1AWJ A;  2QQR A;  3RDV A;  3JCM f;  2NUT B;  4B6M A;  2CP0 A;  5IT9 E;  4QQD A;  5CCA A;  5LJ3 j;  1WHL A;  3CME Q;  2RK2 A;  2JXB A;  1W70 A;  2EJF A;  1H3Z A;  4M7A C;  1RAD B;  3CC2 A;  4DBR A;  4JLG A;  1G3W A;  3I55 A;  3E9F A;  4F7U F;  2XIC A;  1Y96 A;  3VUZ A;  1XTD A;  1VIF A;  2DFU A;  5D6W A;  4E7K A;  3EH1 A;  1VQ6 Q;  4J9C A;  1CSK A;  3HFO A;  5I2M A;  3M0S A;  2QGF B;  3CC2 T;  3JCM e;  2LNV A;  3I55 T;  2ABL A;  3QDR B;  2G3R A;  2KK4 A;  1N6A A;  4E47 A;  3C95 A;  1N5Z A;  2LQW A;  2M02 A;  2HKQ B;  1JRI A;  2E10 A;  2F1L A;  2L2P A;  1LOJ A;  1I1J A;  1T3L A;  3MEW A;  3UDC A;  3DB4 A;  2RI5 A;  3JB9 J;  2OAU A;  1K8A C;  4M7D C;  2GBQ A;  2HCK A;  3IQL A;  1ZA1 B;  1NPR A;  1V1C A;  2DTI A;  5KCH A;  4LDY A;  3QDF A;  4F17 A;  2RI3 A;  2IG0 A;  3GP8 A;  3MEU A;  2O9V A;  4R56 A;  1O75 A;  4OB0 B;  1WQ7 A;  5LJ5 g;  4UC4 A;  3G1J A;  4OP0 A;  2QXF A;  3OYG A;  5M9O A;  1VQ7 T;  5A0D A;  2ENM A;  1FMV A;  4LN2 A;  1TG0 A;  3EG9 B;  1U5S A;  5FU6 B;  4FU6 A;  4HKE A;  4M78 C;  4PJO G;  3SB2 A;  2DF6 A;  4FSX A;  3S3O A;  2A36 A;  2BZX A;  2QI2 A;  5C6S A;  4ZTF A;  1K0S A;  2C0T A;  1VQ4 A;  2P4T A;  1PHT A;  3H0F A;  4PJO C;  5CQY A;  1S72 Q;  1JJ2 S;  1RLQ C;  5CVI A;  4AT1 B;  4MML A;  3EH2 A;  2E12 A;  3T9N A;  2YT6 A;  3JCM g;  1NPP A;  2GQI A;  5D6X A;  3CCM Q;  1WFW A;  1G83 A;  2VUB A;  3CME A;  1WX6 A;  2LQN A;  1BI3 A;  4M77 B;  4J9B A;  1M8M A;  3JB9 I;  5IH2 A;  2CP5 A;  2ZPF B;  4IUR A;  4J9H A;  1M90 R;  1HYO A;  4J9G A;  4OMF B;  2A28 A;  3CME T;  1SKU B;  3A1P A;  2NUT A;  1RAC B;  2L3S A;  3QHS A;  3JCM h;  5IXF A;  5CKH A;  2EKO A;  1VQ6 A;  2PQW A;  2J6K A;  2X35 A;  4Y91 A;  1RAA B;  5GMK j;  1WDX A;  4X34 A;  2LCS A;  4RTU A;  4JRI A;  1RAG B;  3A8M B;  4PJO E;  1VQ6 T;  2RPN A;  3M59 A;  1LPL A;  1VQO Q;  4OB3 B;  1ZX6 A;  3CCV Q;  1K8A R;  5J39 A;  2HEQ A;  2E5Q A;  4JS5 A;  3DLM A;  5IN1 A;  4F16 A;  4QQG A;  3L1A A;  3EFO B;  2EJG A;  2AT1 B;  2M51 A;  4M4Z A;  2QEX Q;  4AFQ C;  2K2V A;  3TVT A;  4OMO A;  2LTO A;  4FW2 A;  4RCB A;  4II1 A;  1DJ7 B;  4Z02 A;  3WVE B;  2QQS A;  1X69 A;  2LJ0 A;  4ME7 A;  3BE3 A;  5FRO A;  3MCA B;  4XU1 A;  5DLO A;  3MP8 A;  3L2R A;  4Q5W A;  1UEC A;  4OB2 B;  3EG1 A;  3QII A;  5GAO n;  2K3Y A;  1N9R A;  4IKF A;  3RR6 A;  2ZAE A;  5KE3 A;  1M5Q 1;  4IUQ A;  1YJW Q;  3CC7 A;  3M4Y A;  3MHX A;  4NL2 A;  3RBB B;  4FSS A;  2H8H A;  3HTR A;  4PJM A;  1B7T A;  2NWM A;  2E1H A;  3CC7 T;  5FW9 A;  4C8Q G;  1U1S A;  2FRY A;  2RHY A;  3HP9 A;  2MWP A;  1UB4 A;  2DVJ A;  2C0I A;  3HL8 A;  2RQV A;  2NLU A;  1OI1 A;  1S72 A;  3EG9 A;  3A8H B;  2V8I A;  1KD1 C;  1FMK A;  2CP3 A;  3HRT A;  2DTO A;  3RKY A;  3CPW P;  2DL8 A;  2K3X A;  1GBQ A;  2YRV A;  1PNJ A;  1ZBJ A;  3R6O A;  1S72 T;  1H92 A;  5GAN 5;  3VS2 A;  4M7D F;  1FXX A;  1M3B A;  2JT4 A;  5GAO m;  1MUZ A;  1X6O A;  3L2V A;  2KRS A;  1SRL A;  1UGS B;  4BE1 A;  1D0Z A;  4C92 G;  3DKM A;  2PNI A;  1AVZ C;  2HBW A;  3SD4 A;  1NBE B;  4N4G A;  3CXC P;  4HT8 A;  4M77 A;  3JB9 H;  4M78 F;  1GCQ C;  1WLP B;  1TXQ A;  1Q7Y U;  3KBG A;  3OMG A;  1M27 C;  4JJN K;  2EKH A;  3OBW A;  3M55 A;  3S6W A;  4C92 C;  4EMK C;  4M75 C;  3PVQ A; 
#chains in the Genus database with same CATH homology
 3NHN A;  4DEX A;  2PTK A;  2CDT A;  4JZ4 A;  3SHW A;  3VS6 A;  1Y0M A;  2D0N A;  2DL7 A;  2F2W A;  4Z8A A;  2GTO A;  2EVR A;  3PVL A;  4JZ3 A;  4RTY A;  2DMO A;  2RQT A;  3NMZ C;  1H3H A;  4Z89 A;  2RQW A;  4AFU C;  2JS2 A;  3NGP A;  2KBT A;  1ARK A;  2SRC A;  2HSP A;  2X3X D;  2A37 A;  1W1F A;  1I0C A;  1T3S A;  3CQT A;  2LMJ A;  1UHC A;  1GRI A;  1BBZ A;  3ULR B;  1QCF A;  1JQQ A;  3SEM A;  1CKB A;  2VVK A;  3I35 A;  5I11 A;  2CH4 W;  3FJ5 A;  3M0U A;  5FWB A;  3M0R A;  1UHF A;  4JPB W;  2YUN A;  5IHI A;  1XOV A;  2JTE A;  2W10 A;  1OOT A;  2LJ1 A;  2D1X A;  2CH4 A;  2E5K A;  4ORZ A;  4HXJ A;  2B86 A;  1WXU A;  2KT1 A;  1SHF A;  2CRE A;  2MOX A;  1NYG A;  1QLY A;  2BZ8 A;  2MCN A;  4CC3 A;  1EFN A;  1GFD A;  2KYM A;  2GTJ A;  1Z9Z A;  1ABQ A;  4JJB A;  1K1Z A;  1JXM A;  4RTZ A;  1E6G A;  4AFZ C;  2C0O A;  3TSZ A;  3H0I A;  1I07 A;  2RQR A;  3UAT A;  4JJD A;  3VRY A;  1U06 A;  1AWW A;  1J3T A;  2EYY A;  1ZUK A;  1SRM A;  2KXC A;  2D8H A;  2PZ1 A;  5IXB A;  3A98 A;  2JW4 A;  1X43 A;  2FG0 A;  2EYW A;  4J9D A;  2EGA A;  1X6B A;  2EQI A;  4LE9 A;  1PKS A;  3QWY A;  4DEY A;  2NUZ A;  1GCP A;  2VKN A;  2L3P A;  3VS7 A;  2DA9 A;  1OV3 A;  5EC7 A;  1H8K A;  2EPD A;  3VS1 A;  1M3A A;  4IIO A;  4RUG A;  2AZS A;  1AWJ A;  1WA7 A;  2DLP A;  2EGE A;  1WIE A;  1U3O A;  1B3Q A;  1PWT A;  4F14 A;  1OPL A;  1KFZ A;  1G2B A;  1NLP C;  1SEM A;  2FPD A;  1BB9 A;  3REB B;  5HCK A;  1AZE A;  1UG1 A;  1LCK A;  3LH5 A;  2JXB A;  1W70 A;  2ED0 A;  3KFV A;  2YUP A;  4EIK A;  1GBR A;  1TUD A;  1A0N B;  1JO8 A;  1NLO C;  2FRW A;  1OPK A;  4RTT A;  5L23 A;  3ZL7 C;  2OAW A;  1YWP A;  2RN8 A;  1WYX A;  1JXO A;  2KYB A;  4J9C A;  1CSK A;  3M0Q A;  3M0S A;  2DRM A;  4OMP A;  1GFC A;  2KRN A;  1IO6 A;  2YDL A;  2D8J A;  2ABL A;  1K76 A;  2EW3 A;  2K7A A;  2YUQ A;  3NPF A;  2V1R A;  1N5Z A;  2KRM A;  1YN8 A;  2LQW A;  1T0J A;  2LNH B;  4CC7 A;  1SPK A;  1PKT A;  1AWX A;  2LX7 A;  4AFS C;  2CSI A;  2EGC A;  2EYX A;  2K6D A;  2O2O A;  2JS0 A;  2O31 A;  2L2P A;  5FWC A;  1I1J A;  4ZNX A;  1BU1 A;  2DM1 A;  1QWF A;  2FO0 A;  1T3L A;  3EHQ A;  4WCI A;  2DL5 A;  1UFF A;  2IIM A;  1NM7 A;  2DNU A;  1BK2 A;  1QWE A;  2LZ6 B;  2DE0 X;  4X1V A;  2KT8 A;  2GBQ A;  2HCK A;  3IQL A;  1AOJ A;  1V1C A;  2K2M A;  5IHK A;  4F17 A;  1W6X A;  4HCK A;  2KRO A;  2O9V A;  2BZY A;  1RUW A;  2JM9 A;  2ENM A;  2FEI A;  2HDA A;  3VS0 A;  4QT7 A;  4LN2 A;  1TG0 A;  1AZG B;  5ECA A;  1ZUU A;  3THK A;  1U5S A;  1SHG A;  3I5S A;  4J9E A;  3R6N A;  1E7O A;  2QDL A;  1PRL C;  2DF6 A;  2A36 A;  2AKL A;  4OMM A;  3GBQ A;  2L0A A;  2BZX A;  1AD5 A;  1X6G A;  3VS4 A;  2J7I A;  1WI7 A;  2JMC A;  1MV3 A;  1K0S A;  2XMF A;  2C0T A;  1VYU A;  1X2K A;  5IHN A;  1PHT A;  3REA B;  3H0F A;  1X2Q A;  3PE0 A;  5GJV B;  1KJW A;  3O5Z A;  1M30 A;  1RLQ C;  3UA7 A;  2ESW A;  1UJ0 A;  4D8K A;  1ZLM A;  2JM8 A;  1YNZ A;  1Z9Q A;  2YT6 A;  1UGV A;  2GQI A;  2YSQ A;  4GLM A;  2O9S A;  2RNA A;  1WFW A;  1G83 A;  2DIL A;  2YUO A;  1WX6 A;  2LQN A;  1K0X A;  3JV3 A;  2RMO A;  4J9B A;  1M8M A;  4RTV A;  4R0K A;  1JU5 C;  5IH2 A;  1E6H A;  2K9G A;  1FYN A;  3EG0 A;  4HVW A;  4J9H A;  3C0C A;  4J9G A;  2A28 A;  2KXD A;  3I5R A;  4LUE A;  2L3S A;  2DX1 A;  3UA6 A;  1TUC A;  4KRT A;  2J6F A;  2ROL A;  1UJY A;  5IXF A;  2P4R A;  4J9F A;  1NG2 A;  2DBM A;  4GBQ A;  4RTX A;  2VWF A;  2CUB A;  1AEY A;  2J6O A;  2J6K A;  1VYT A;  2AKK A;  1WDX A;  2LCS A;  1VA7 A;  2DYB A;  4RTU A;  4CC2 A;  2K79 A;  3EHR A;  2FPE A;  3M0P A;  2G6F X;  2KGT A;  4LNP A;  2RPN A;  2V1Q A;  1B07 A;  3U23 A;  2CSQ A;  4Y92 A;  1ZX6 A;  4D8D A;  2F2X A;  2HEQ A;  1VYV A;  4F16 A;  1WXT A;  3TSW A;  1UUE A;  2L3Q A;  1RI9 A;  2KNB B;  2M51 A;  1UDL A;  4M4Z A;  4IIM A;  4AFQ C;  3TVT A;  4OMO A;  2CUD A;  1JEG A;  2GNC A;  4A63 B;  1X69 A;  2RF0 A;  2M0Y A;  2LJ0 A;  2KR3 A;  2EYZ A;  2BTT A;  2OJ2 A;  2X3W D;  2DRK A;  1YP5 A;  4K11 A;  1UEC A;  5I22 A;  3EG1 A;  1KSW A;  2J06 A;  1ABO A;  1HJD A;  1NYF A;  2ROT A;  3QWX X;  3I9Q A;  3H41 A;  2KEA A;  3UF4 A;  2EBP A;  3VS5 A;  2SEM A;  3RBB B;  2W0Z A;  4FSS A;  2H8H A;  1GL5 A;  2MIO A;  1ZUY A;  4E6R A;  1MV0 B;  2NWM A;  4Z88 A;  3RNJ A;  4AG1 C;  2A08 A;  3M0T A;  5FW9 A;  2FRY A;  2DVJ A;  2FPF A;  1S1N A;  2C0I A;  2F2V A;  2ECZ A;  2RQV A;  4J9I A;  4LUD A;  2J05 A;  3H0H A;  1HSQ A;  3VRZ A;  1UTI A;  1FMK A;  2AZV A;  1NEG A;  1QKX A;  2DL8 A;  1PRM C;  3VS3 A;  4CC4 B;  1GBQ A;  1K4U S;  4OMQ A;  2JMA A;  1RLP C;  3EG2 A;  1ZSG A;  1PNJ A;  1HD3 A;  1ZBJ A;  1AWO A;  1OEB A;  2RQU A;  1H92 A;  1WXB A;  1UE9 A;  3VS2 A;  4JJC A;  5GJW B;  3EG3 A;  2O88 A;  4RTW A;  1M3B A;  1T0H A;  1X27 A;  2DL3 A;  2JT4 A;  2OI3 A;  2LJ3 A;  2DL4 A;  1MUZ A;  4OMN A;  4AG2 C;  2KRS A;  1SRL A;  2CT4 A;  2LP5 A;  1GCQ A;  1Y57 A;  2PNI A;  1KIK A;  2I0N A;  1M3C A;  1AVZ C;  2HBW A;  2CT3 A;  1QKW A;  2DJQ A;  4HVV A;  2K3B A;  4ESR A;  1SSH A;  2ED1 A;  3EGU A;  1K9A A;  1YCS B;  2AK5 A;  2GGR A;  1CKA A;  2KE9 A;  1GCQ C;  1WLP B;  2DBK A;  1YWO A;  1M27 C;  4HVU A;  2EKH A;  4OML A;  1NEB A;  3PVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...