1UG1A

Sh3 domain of hypothetical protein baa76854.1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA1010 protein
publication title NMR structure of SH3 domain of Hypothetical protein BAA76854.1
rcsb
source organism Homo sapiens
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ug1A00
3VS0A 2DE0X 5ECAA 2DBMA 1K0XA 1KIKA 1YWOA 2AZSA 1QKWA 1X69A 4CC2A 3VRZA 1RI9A 2KRMA 3I35A 3H0IA 4J9FA 1CKBA 2RQUA 2EPDA 2YT6A 1KSWA 1YCSB 4J9BA 1T0JA 1NLPC 3VRYA 2DILA 2LZ6B 5IXBA 1UJYA 4HCKA 1KJWA 3GBQA 2GQIA 4J9HA 2LNHB 1MV3A 3THKA 2I0NA 2L3QA 1ABOA 2FRWA 4Z89A 1G2BA 2EGAA 2DLPA 4J9EA 3UA7A 1U5SA 2XMFA 4HXJA 1UGVA 4RTXA 4OMMA 2JMCA 4DEXA 4IIMA 4AFZC 1MV0B 2CSQA 3M0RA 3REBB 1QWEA 1Z9QA 2HDAA 4RUGA 1PRLC 1BBZA 1AD5A 1T3LA 5FWCA 4OMQA 1K76A 2GGRA 2K9GA 2VKNA 2VWFA 3I5RA 2DM1A 2O31A 1QKXA 2KT1A 1M3CA 3H0FA 1GCQA 1WXBA 2AK5A 5IHKA 1K0SA 1SRMA 2DRKA 3TVTA 4RTTA 2GNCA 1WDXA 1B07A 2JW4A 1X2KA 2YUPA 1I1JA 4AFQC 1WX6A 2YSQA 2FPDA 2ENMA 2A08A 2KRNA 2C0TA 4M4ZA 1NM7A 1OPKA 1SSHA 2C0OA 2M51A 2HCKA 3NHNA 2LCSA 2LX7A 2RN8A 1BK2A 4LN2A 1T3SA 1W1FA 2E5KA 2CT3A 2SRCA 4JJBA 4AG2C 3TSZA 2JS2A 2HSPA 1XOVA 1JQQA 2RQVA 3EG0A 5I22A 1X27A 1G83A 4Z8AA 2KT8A 1VYTA 2AKKA 4JZ4A 1YN8A 4AFSC 1X6GA 1NYFA 1YWPA 4Z88A 1PKTA 2LJ1A 2FO0A 2O2OA 1IO6A 1VYVA 1A0NB 1WXTA 2RQTA 1WI7A 1I07A 4J9DA 4JZ3A 2FG0A 1ZBJA 1ARKA 1OEBA 1UFFA 1PWTA 5IHNA 1JXOA 1N5ZA 2CUBA 3VS1A 3VS7A 1SPKA 2DNUA 1U06A 1RLPC 1GFDA 2GTOA 2JXBA 1GL5A 4FSSA 1UHFA 1K4US 2YUOA 3EG3A 2G6FX 3A98A 2FRYA 1OOTA 2LP5A 2O88A 2DL3A 5FW9A 4JJCA 4CC7A 1PRMC 4E6RA 3TSWA 2CREA 4LUDA 3ZL7C 2JT4A 2DL7A 5GJWB 1FYNA 1AZEA 4WCIA 2F2VA 2D0NA 2OAWA 1I0CA 2CT4A 5IH2A 1MUZA 3QWYA 2RPNA 4CC4B 1CKAA 2JTEA 4RTZA 4J9IA 2RQRA 1Y0MA 2A36A 1OPLA 2EGEA 3O5ZA 1H92A 1PKSA 2H8HA 3C0CA 3I9QA 1WLPB 2KYMA 5FWBA 4AG1C 2X3XD 1ZSGA 2CH4W 3VS4A 3I5SA 3EHRA 1SHGA 1JU5C 2YUQA 1WFWA 3EG1A 4JJDA 5EC7A 2EYZA 2BZYA 2RQWA 2KROA 1TG0A 2DMOA 1WA7A 2EW3A 2V1QA 3M0SA 4LNPA 3EGUA 2J6OA 2OI3A 1X43A 4QT7A 1YNZA 4DEYA 2X3WD 2AKLA 3M0PA 3H0HA 1X6BA 2AZVA 2ESWA 2JS0A 4Y92A 1E6HA 4GLMA 1ABQA 2EKHA 2KNBB 2EYYA 1PNJA 2RNAA 3ULRB 1AWJA 3UF4A 4R0KA 3UA6A 2DVJA 2A37A 2JM8A 1W70A 3M0TA 1UUEA 2EVRA 2RF0A 1NEBA 1E7OA 2DRMA 4HVVA 1K1ZA 2DYBA 1SEMA 1TUCA 2MOXA 1ZUYA 1UDLA 1X2QA 1ZX6A 1NLOC 2ROTA 2MIOA 3VS5A 1RUWA 4RTVA 1GBRA 1VA7A 2DA9A 2K7AA 1JEGA 2A28A 1WXUA 3VS6A 4J9GA 1PHTA 2V1RA 2K6DA 3REAB 2EQIA 4J9CA 4ESRA 4LE9A 2VVKA 2L3SA 2NWMA 2ABLA 1B3QA 4CC3A 1T0HA 2KGTA 3JV3A 3NMZC 2DJQA 2J06A 1BU1A 2FPFA 2OJ2A 4F16A 3VS2A 1HSQA 1AWOA 2W0ZA 1HD3A 1M27C 3PE0A 2B86A 2J6KA 2IIMA 4HVUA 4F14A 4HVWA 3SEMA 1KFZA 1U3OA 1GCPA 2J6FA 2LMJA 2EBPA 5IHIA 1QWFA 1J3TA 4F17A 2KBTA 2W10A 1ZLMA 2O9SA 1QLYA 4RTUA 4X1VA 2EYWA 1ZUUA 1UHCA 2SEMA 2ROLA 2M0YA 2DL8A 2D8HA 2FPEA 5HCKA 4ZNXA 1AOJA 1WIEA 2D1XA 4OMPA 2L0AA 1V1CA 1GBQA 2K2MA 1NG2A 1Y57A 4OMNA 2NUZA 2DL4A 2J7IA 1NEGA 2D8JA 1UTIA 4JPBW 2BZ8A 2EGCA 1BB9A 2EYXA 2QDLA 2BTTA 3EHQA 2YDLA 2PTKA 2GBQA 2LJ0A 1JXMA 2JM9A 2F2XA 1SRLA 4K11A 4KRTA 3RBBB 2KE9A 1H3HA 4GBQA 3KFVA 2C0IA 4D8DA 1EFNA 1TUDA 1AWXA 2BZXA 3SHWA 1WYXA 2JMAA 2J05A 1QCFA 2HEQA 1H8KA 3U23A 2KR3A 2LJ3A 2L3PA 2L2PA 2DL5A 1OV3A 1UE9A 2DF6A 2K79A 2P4RA 4IIOA 2MCNA 3R6NA 5I11A 3H41A 2CUDA 2PNIA 3LH5A 4D8KA 1M3BA 2FEIA 1VYUA 1AWWA 2KXCA 4OMOA 2HBWA 1UJ0A 2ED1A 3VS3A 2KXDA 3M0UA 2CSIA 1UG1A 4A63B 2O9VA 4LUEA 1JO8A 2KYBA 3M0QA 2KRSA 1S1NA 1CSKA 1M3AA 2CH4A 5GJVB 1FMKA 4RTYA 2CDTA 2LQWA 1AEYA 3PVLA 4OMLA 4ORZA 5L23A 2PZ1A 3QWXX 1M8MA 4EIKA 2ED0A 3CQTA 1W6XA 4AFUC 3FJ5A 5IXFA 4RTWA 2GTJA 2LQNA 2RMOA 1LCKA 1GFCA 3EG2A 1K9AA 3PVQA 1HJDA 2ECZA 1YP5A 3IQLA 3NPFA 1E6GA 1RLQC 1NYGA 2YUNA 3NGPA 2K3BA 1ZUKA 2F2WA 1GCQC 2DBKA 1M30A 1SHFA 3UATA 1AZGB 2KEAA 1GRIA 1Z9ZA 1AVZC 2DX1A 1UECA 3RNJA
chains in the Genus database with same CATH superfamily
4D6WA 3VS0A 1K0XA 3E9FA 1QQJA 4M7AC 1QKWA 3M59A 3I35A 3QG1A 4X9DA 2O4XA 4J9FA 2XDPA 3FB9A 1UB4A 1VQ7T 2E41A 3CC2Q 3CC7A 2D6FA 1M5Q1 3FLGA 2DILA 2LZ6B 1UJYA 2V8IA 5GANh 2GQIA 4J9HA 2EAYA 4C0DC 2F69A 2FZCB 1BI1A 3CCMQ 1ZSZA 3BDLA 3S3NA 1LJOA 2NUPB 1MHNA 2FRWA 4J9EA 2DLPA 4ELYC 4LDYA 1VIFA 4C8QC 2P0KA 1K9MR 4NL2A 4C92G 1JJ2S 3GP8A 3QUIA 4DEXA 4AFZC 3M0RA 4ZGJB 1M90U 5DY9A 5KH6A 2DO3A 2HDAA 2DEUA 3HTRA 1YBYA 3MEVA 5KCHA 2BUDA 3GIBA 5GMKe 1U8RA 1VQLA 2HL5C 1QCOA 1M1KU 2O31A 2V8JA 2KT1A 1M3CA 3CMAQ 1VIEA 3H0FA 3L2ZA 3GNFB 2XKOC 5GAMj 1VQ4T 1SRMA 2DRKA 2MI6A 3TVTA 3A8HB 1B07A 5GAN3 3QDRB 3UDCA 2L8DA 1YITQ 4EMKB 5LJ5d 3G4SA 1LVKA 1OZ2A 3RUXA 2ENMA 2XIDA 1OQKA 4J7FA 2C0TA 2YXYA 4VUBA 4M4ZA 2QEXT 1SSHA 4QVDA 3H8ZA 1TU0B 1KC8R 3NHNA 5GANj 2VXEA 3M4YA 4C5GA 4M77C 1BK2A 4PNOA 3L2WA 1QCNA 3P8BB 4KH1B 1Q82C 2CT3A 4ZTJA 1WNLA 4AG2C 2QEXA 3CCEQ 4C92B 2RQVA 1X27A 1G83A 2KT8A 1IZ6A 2CP3A 2LCLA 1N27A 1PKTA 4IUVA 3OYAA 2PUKB 2O2OA 1IO6A 3A8OB 1NJIR 1KK7A 2EWNA 3EG9B 2CP0A 4J9DA 4JZ3A 4KT0E 3JCMe 4M75G 5HK3A 5D7UA 3VYHB 5IHNA 2RI2A 2CUBA 3VS1A 4M78D 3VS7A 1Y96B 3GLXA 1W2BS 4OB3B 1D0YA 5KE2A 1Y07A 1K8AU 4HCBA 1QVFP 1OU9A 2JXBA 5EG2A 2JOYA 1M1FA 2FRYA 1N9RA 2P0PA 3MCAB 4PJOC 2OTJQ 4FYWB 3ZFJA 4CC7A 4E6RA 3QPHA 2DL7A 5KYWA 3OYDA 1AZEA 3FDRA 3CCLQ 2OTLQ 2D0NA 2RPNA 2X9HA 2RHYA 3LW5E 2XICA 3S3OA 2RK1A 2A36A 1WJSA 1OPLA 3PT9A 1H92A 3HFOA 2H8HA 2RI5A 4KBMB 3I9QA 1IHWA 5FWBA 2QQRA 1WGSA 3I5SA 3NTIA 4DBHA 2YUQA 1WFWA 3QZ5B 4JJDA 2BZYA 2KROA 5LJ5f 2FL7A 1TG0A 2VV5A 2EW3A 2V1QA 2LT4A 1Q81R 1NPRA 1Y7XA 2L3RA 3G7ZA 3MP8A 2ESWA 5GAN7 1R0BG 4M75B 2WSFE 3ULRB 2KSSA 3UA6A 2AHJB 2DVJA 2A37A 2MPXC 1NEBA 1SEMA 1JJ2A 3A1PA 3MKDA 1ZX6A 2RB6A 3QYGB 5KYUA 1VQ7Q 4PJOA 3OS1A 2EJFA 3OMCA 4XU0A 5D6WA 1JEGA 4XTWA 3M9QA 3VS6A 4CI0C 1VQLQ 1OYXA 3VV0A 3RMSA 5CKEA 5GAN2 4MDXA 8AT1B 2K4YA 4J6YA 2IVWA 1RL2A 1RAIB 1LPLA 3CCRT 3JV3A 3G71T 3CCST 3NMZC 1SG5A 2J06A 2KK4A 4Q5WA 5KYXA 2DFUA 2W0ZA 2QAZA 1JBMA 3PE0A 4DQ2A 2IIMA 4HVUA 4HVWA 3D7SB 1KFZA 3G4SQ 3FEOA 1GCPA 2J6FA 2LMJA 3VU3C 1J3TA 2EIFA 1KQ1A 2X51A 3OS5A 4RKUE 2E3HA 3CCSA 5KYYB 2DL8A 2DTOA 2D8HA 2P84A 1OI1A 5HCKA 4KUIA 1AOJA 1MMDA 2DIQA 1V1CA 3AHUA 1GBQA 1NG2A 3RDVA 1V76A 3HFNA 3CCUA 2A0FB 3LGLA 5LJ3d 2JTFA 2QEXQ 3VUBA 2QDLA 2BTTA 5GAOl 3CPWP 4GY5A 2YDLA 3X26B 1YI2T 1D0XA 1RACB 1BYMA 1C0MA 2MAMA 4KRTA 4QQ6A 2WSCE 2HSEB 3Q1JA 3LWIA 4M7AD 2KE9A 4GBQA 4D8DA 1TUDA 2HZYA 2BKDN 3BFMA 5FU6B 1RAFB 1QP3A 2KR3A 2LJ3A 4C0ZA 3LLRA 2RHXA 5FU7C 5M9OA 2QXFA 3OYNA 4F7UE 1W2BA 2CUDA 3CD6T 1SKUB 3PIOA 4C8QD 1M3BA 2FEIA 1VYUA 1RI0A 1K73C 2KXDA 4M7DE 2HQEA 3M0QA 1G3YA 2KRSA 1S1NA 2HKNA 1M3AA 3VKIA 5GJVB 3CD6A 5A0GA 1NE8A 1Q82U 2DKGA 5L23A 2PZ1A 4OMFB 2K2VA 3JCMg 2ED0A 1W6XA 1N8RC 4M78C 1WJRA 2JVVA 2LQNA 4PJMA 4N0AC 4DA4A 4J7IA 1M1GA 2CGHA 3HHTB 1EX4A 1K9AA 4E7HA 3CMAT 4PLLA 1OZ3A 3NPFA 1E6GA 3I56A 1X75C 2EQJA 1NYGA 2M02A 1JB0E 1GCQC 2DBKA 3PFSA 1ACMB 5A0DA 4BE0A 3OQ5A 1OULA 4YTLA 1VQNA 5CR2A 2M16A 1GRIA 1MNEA 2PVDB 2DX1A 4C92D 4M77D 4L5GA 1VQKA 3HRSA 1X69A 2KRMA 5KCOA 3E19A 5GAOn 2DTHA 5LJ3f 2MYSA 5CKFA 1VQ8A 2EPDA 5IAYA 1YCSB 4J9BA 3VRYA 2E12A 4HCKA 1KJWA 1O75A 4AT1B 1TXQA 5CQXA 1KD1R 3OBYA 4JLGA 2Y4YA 4Z89A 5D6YA 1KG1A 1EZZB 3I55T 4FW1A 1HYOA 2BE7D 4N0AA 3ME9A 3C94A 4A4KA 5L8RE 2JMCA 4F7UG 2CSQA 2R5AA 4A4EA 1BCMA 3M53A 1QWEA 1Z9QA 4RUGA 3C12A 2ZPEB 1AD5A 1T3LA 4OMQA 1M2OA 4BACA 3PMTA 3I5RA 1QKXA 1GCQA 2LC4A 2K5FA 4M7DG 2AK5A 2E10A 3CMET 5FRMA 2RJEA 5IHKA 3CCSQ 1K0SA 2QQAA 4LDVA 3TREA 3OW2P 5GAMd 4RTTA 4A4GA 2JW4A 1X01A 3LH0A 1I1JA 2E4HA 3DKMA 1WX6A 1U1TA 1UGPB 3JB9G 1BKBA 2CP2A 2HBPA 2A08A 1S72T 2KRNA 4ATOA 3CMEA 3VUZA 1NM7A 1OPKA 3OSVA 4UC4A 2C0OA 3V8KA 3QHSA 2QK0A 4PJOF 5GANd 4C5IA 2RN8A 3CCJA 3JCMP 4LN2A 1T3SA 1W1FA 3MEWA 3L2QA 1M9SA 4N4HA 1SSFA 1RAGB 3C95A 1S72A 2O4XB 3TSZA 3VJPA 3TQ7P 2HSPA 1P92A 3QSUA 4MMLA 3EG0A 3SWNA 3WVDB 3OYEA 4F7UB 2CP6A 1Q86R 4Z8AA 1VUBA 3ER0A 2CZ0B 5AYFA 2MK5A 3EGXA 2PVGB 1YI2Q 1YN8A 1X6GA 1IRXA 1YWPA 4Z88A 2BE9B 5AT1B 1MMAA 3CC7T 2QG9B 2LQ8A 5GAN6 1SF9A 1PSFA 3M5AA 1VYVA 5CVIA 1VQOA 1WXTA 4M7DB 1R0CB 4E7ZA 5GMKm 4OGEA 2FG0A 4XU2A 1PM3A 1UFFA 2L89A 1QVGS 3CD6Q 1SPKA 1U06A 1RLPC 4ZGDB 4JUVA 2CZ7B 1PSEA 4M75E 1MMGA 1VQLT 4QKUA 4O6JA 1AT1B 4JRIA 4B9WA 3PGGA 4XTZA 3CCQA 2CREA 3ZL7C 3JCMb 2JT4A 2DK3A 5GJWB 1QVFS 3EAEA 4TVRA 3G6EA 4WCIA 2F2VA 4RCBA 2CT4A 2ZPFB 4J9IA 5HK0A 2RQRA 1Y0MA 1M90R 2GF7A 2ZZDA 3G4ST 1PKSA 5GAMf 4EMKC 4AG1C 4OP0A 3J80E 4J8OA 1D0ZA 2CH4W 1M1KR 1SHGA 1JU5C 3EG1A 2DTIA 5EC7A 2QASA 3HPWA 2JZ2A 3H6ZA 2D9TA 4LNPA 1YJ9A 4B6MA 4BI4A 2J6OA 1K73U 3ASKA 3WXMB 2ZAEA 2AKLA 4M7AA 4Y92A 4GLMA 3CBOA 2E1HA 2EKHA 2KNBB 2EYYA 4PFPA 4EMHA 2AIRB 4XTYA 2NUPA 4A53A 2XK0A 4R0KA 1VQ9A 5GANf 3OYCA 2JM8A 3MO8A 1W70A 1N8RU 4HVVA 4C92C 1PD1A 7AT1B 2GFAA 3M58A 2HQXA 5GMKh 1NLOC 1VQMT 3VS5A 5LJ5e 4C8QA 4RTVA 2DA9A 4QW2A 2NYSA 1WXUA 2ZCFB 4J9GA 2V1RA 2CKKA 4OGCA 4HT8A 2QQBA 3I55Q 5A2QE 1B3QA 2RD1A 1T0HA 2CS7A 1VQMA 2DJQA 4P5NA 1BI3A 4C5EA 4F16A 4EMKA 2KDSA 1AWOA 2DZCA 1HD3A 2B86A 1YJNA 1YJWT 1OU8A 1U3OA 3OS2A 2CYZB 3CC4A 1QWFA 3J7AF 4ANJA 2KBTA 4BB7A 1ZLMA 3CMEQ 1QLYA 3RESA 4KGVB 1ZUUA 2ROLA 4IUPA 4ZTFA 1K8AR 4ZNXA 1WIEA 3JCMJ 1Q7YC 2D1XA 3NTKA 1YJWA 3FIFA 3OB9A 4OB1B 4MMKA 4OMNA 4C92A 2NUZA 4M77A 1S72Q 1NEGA 2D8JA 2EGCA 1JJ2P 1BB9A 2EYXA 3KUFA 3M4GA 5GMKj 4M78F 3HP9A 2EQKA 5J26A 2LJ0A 3M56A 3OYBA 1JXMA 4Y91A 1MNDA 4QQDA 2F5KA 3JCMh 2YLCA 3JB9J 1I8FA 2K5LA 4Z02A 3EG9A 3OYJA 3KFVA 4FIBA 1VQOQ 3CPWS 4M75C 4EDUA 1WYXA 3PTAA 2E5QA 3CXCP 2J05A 2HEQA 4II1A 3M54A 4N4GA 3U23A 1Y96A 2VYTA 2L3PA 2LX9A 2L2PA 3OYMA 2DF6A 5I11A 1QVGA 2P4RA 2RJCA 2K5IA 3R6NA 3AT1B 2PNIA 3CC7Q 4BDYA 1C6VX 4OF1A 3CEYA 4A54A 2DXCA 5IT9E 2M0OA 4LDUA 2ED1A 3VS3A 2IPOB 4BDZA 1UG1A 5LJ5j 3PIPA 5KYXB 5I2MA 1M2VA 1QVFA 1JO8A 2KYBA 4IURA 2X4YA 3L42A 1KQSP 1VQ6A 4ORZA 1N6AA 1IGUA 1I4K1 1YFNA 4XTUA 4EIKA 4HCZA 3FC3A 3SFMA 3FJ5A 4RTWA 4FT4A 2RMOA 3OYFA 6AT1B 1LCKA 1NBEB 2A3LA 1D09B 2FVUA 4FSXA 8ATCB 2VGNA 3JCMX 5I21A 1RLQC 1BCOA 2CP5A 2NLUA 2RHZA 3EFRA 1YCYA 1I81A 1UEBA 1SHFA 5CKBA 5DM7R 4MZTA 2HD0A 3CCUT 2KEAA 4BD3A 2QGFB 3QIIA 3O8VA 1W2BP 3QJ6A 3SB2A 2DBMA 1HK9A 2RA2A 3FJPA 1TH7A 2AZSA 1HXDA 4CC2A 2K57A 1D3BA 3H0IA 3OBWA 3DLMA 3TCJA 1CKBA 1BI0A 2COZA 2RQUA 4PFZA 3CBPA 1KSWA 4M7DD 4BUGA 1T0JA 1NLPC 1W4SA 5IXBA 4LD6A 2WACA 4DBFA 2LNHB 4FYVB 3THKA 1WHMA 2L3QA 1ABOA 5FU6C 1G2BA 3UA7A 2XMFA 3EFOB 4HKEA 4DBRA 3JB9D 1VQMQ 4E7SA 1TOVA 2LTOA 4IIMA 2KAFA 3CCVA 1MV0B 4JRKA 3REBB 3QYHB 1YIJT 1K9MC 5LJ3e 5FWCA 1BI2A 1K76A 2GGRA 4J6WA 3QBYA 2VWFA 1YHQT 1XQHA 5KYNA 3CC4Q 4X9CA 3N5BB 5LJ5g 2LNVA 3P8HA 3P8DA 3JAME 1O9SA 2QA4A 1QP2A 4M7AF 1WDXA 1YIJA 4HA8A 3X28B 2Z0WA 3ZEHA 1YJWQ 4PJJA 2YUPA 2YSQA 1WQWA 2FPDA 1YHQA 2XU8A 3I56T 3RIRA 5GAN8 1C1AA 3OW2S 5GMKi 5CO7A 3HRUA 2M51A 5CAIA 4E7IA 1WHLA 4KGXB 2LX7A 4C8QF 1B34B 4AMCA 1VQNT 1IREB 1KC8C 1M8VA 1XNIA 2E5KA 3CPWA 1V29B 2A7YA 4R56A 3H9NA 3CC2A 2JS2A 1VQKT 2HMAA 2HKQB 5I22A 3R6OA 3CCMA 4MDWA 1VQ5T 3A5ZB 1WHGA 1VYTA 4JZ4A 4C5HA 4KH0B 3L2UA 1NYFA 1UGRB 1R77A 1VQ8T 1FMWA 2LJ1A 1TS9A 1FWZA 2F1LA 2LDMA 1A0NB 4FYXB 1KHCA 4IUUA 4RCCA 2KQWA 2RQTA 2M1HA 1D1AA 4EPCA 5CK9A 4BY6B 3EGDB 1ARKA 1VQ5A 1OEBA 4OB2B 1NJIC 3A8LB 1JXOA 1Q7YU 1G8XA 2DERA 1EIFA 4FM4B 4C0FA 1RAEB 4BE1A 2LVMA 3SD4A 2DNUA 3X20B 4L59A 4OB0B 2JN0A 4XQ3A 1GL5A 1UHFA 2HNIA 3KBGA 2FHDA 2E6ZA 1K4US 2YUOA 4C92F 4M77F 4NOYA 3EG3A 1G3WA 4IUTA 3C4SA 2G6FX 2LCCA 2RI3A 3A98A 4A4HA 2O88A 3UT1A 4M78A 4QVZA 4JJCA 5FW9A 3TSWA 4PJLA 3URGA 4ZN1A 3L2RA 3GF5A 1G5VA 1I0CA 4QVCA 1MUZA 4CC4B 2JTEA 2RHIA 1B7TA 2QGGA 2VASA 4OVAA 4V2SA 2EGEA 2GCXA 2CP7A 3O5ZA 2QQSA 1FMVA 5DLQE 1WLPB 2KYMA 4J5YA 5KE3A 1PC0A 2XHCA 4FYYB 2DZ9A 1VQPA 4KUDK 3CCEA 2RQWA 4JDSA 3MHXA 5J3BA 3RKXA 3M0SA 3X25B 4XAXB 5CKHA 2K3XA 3CCJT 2OI3A 3OS0A 4JS5A 2X3WD 3H0HA 2AZVA 2MWPA 3SWNB 2JS0A 4JS4A 3M57A 3CCUQ 1Q81C 3EGXB 4GLKA 2RNAA 3UF4A 4E7KA 2COYA 1UUEA 2ZPBB 5GAMe 4LDWA 4LD9K 2X4WA 4M75D 4PL6A 3MP6A 1KQ2A 2DYBA 4XU3A 4FCYA 2RH2A 3QO3A 4M7AG 2PU9B 2IG0A 1ZUYA 1UDLA 5I2SA 2MIOA 3UWNA 3MEAA 1VQOT 1RUWA 2K7AA 3V8JA 2A28A 2PUOB 3SDZA 3MPUB 4M7DC 3REAB 2EQIA 3JB9I 4LE9A 1VOMA 2ABLA 1ZSZB 2OTJA 3E9GA 5GANe 4WTOB 1BU1A 2DETA 2FPFA 2OJ2A 1YIJQ 2JNGA 3CCLA 2NUTA 1HSQA 2FZKB 1M27C 1WZOA 3SEMA 1YHQQ 3CCQT 4PJOE 3QJYA 2OX7A 2GFUA 3OW2A 4F17A 1H641 1QVPA 1WQ7A 2O9SA 2X4JA 4RTUA 4X1VA 1WHHA 2EYWA 3G6ET 5FLXE 1IHVA 1UHCA 2SEMA 5D6XA 5LJ3g 3X24B 1BIBA 2F5TX 3JRZA 4R55A 2E65A 1WPYA 5GAOm 2LRQA 4PFOA 4ZN3A 4LDXA 5CCAA 3L2VA 4OMPA 2L0AA 4PJNA 4XU1A 2K2MA 3RKWA 2DL4A 3I56Q 4F7UA 4CRIA 2BZ8A 4M7AB 3EHQA 4XTVA 2PTKA 2GBQA 1YJ9T 4WF2A 4BE2A 1K9MU 2JM9A 4NS5A 4IKFA 2F2XA 1SRLA 4BI8B 1VQNQ 5GAOp 3RBBB 3TU4K 4M7DA 4M77G 4C0DB 1VQ7A 2C0IA 1VQ9T 1I5OB 3GNGA 3SHWA 1PD0A 1VQKQ 3OY9A 1H8KA 2OAUA 3OYGA 2AT1B 1VQ5Q 4C8QB 4PKCC 5LL6S 1G3SA 1OV3A 1KHIA 2K79A 3E1SA 3V8LA 4DBQA 1H3ZA 5GAOq 1N9SA 1VQ8Q 1IGQA 1AHJB 3OYKA 1D1CA 1X6OA 1K73R 3VYGA 2ZPHB 3CXCS 3LH5A 4D8KA 3DLLA 2QI2A 1DJ7B 3V7RA 2ZGWA 2RO0A 2KXCA 4OMOA 2HBWA 1UJ0A 2ZPIB 2DD5A 2O9VA 4XTXA 1WHJA 1KC8U 1N8RR 2FB7A 2R58A 4RTYA 1AEYA 4J83A 2EYQA 2VUBA 1M8MA 1VQ4A 3CQTA 2QTVA 2B8AA 1YJNT 3A8GB 1GFCA 3CC4T 3PVQA 1HJDA 2ECZA 3J81E 4FW2A 3IQLA 1KQSS 1QW1A 2DXTA 3JCMV 4PJOG 3JCMd 1VQPQ 2DJZA 1UGSB 3BY7A 4M77B 2YUNA 3NGPA 1M4ZA 2K3BA 2F2WA 1TWBA 5KYWB 1M30A 3UATA 3L1AA 2MWOA 1NJIU 1AZGB 2BIVA 1Z9ZA 4XK8E 1QVGP 1UECA 3RNJA 2DE0X 5ECAA 4RG8A 1KIKA 1ZHIA 2X35A 2JUFA 5LJ5h 1YWOA 4JRPA 3JCMW 4RG2A 3VRZA 1RI9A 3CCJQ 3LWHA 2RJFA 1XJWB 3JB9H 5HY6A 3GPLA 2YT6A 1OX9A 1FX7A 4PLIA 5J39A 3MEUA 2O01E 3GBQA 3TEEA 3OA6A 1MV3A 3V7SA 3F70A 4PK4A 2I0NA 3FRNA 4FT2A 2DAQA 2EGAA 1NZ9A 1U5SA 4DOVA 1KD1C 1ZQ1A 4HXJA 1UGVA 4RTXA 4OMMA 1RAHB 4N4IA 1FXXA 2DYIA 1M2VB 3S6WA 1PRLC 1BBZA 5GAMg 5KYUB 4PJOB 1NPPA 2K9GA 2VKNA 2Y4XA 2RM4A 2DM1A 2EFIA 2RK2A 2K3YA 3HSBA 2XD0A 1WXBA 1VQ6T 1Q81U 5GAN4 2KI7A 3JSCA 2GNCA 3MJXA 1LOJA 2R57A 4M78E 1X2KA 2EQUA 4AFQC 3NFCA 5GANg 3CCQQ 3DB4A 1TUGB 2YHTA 3HRTA 1QMCA 3ZBDA 3G6EQ 2EJGA 1U1SA 3LGFA 3JCMQ 3INZA 2HCKA 2LCSA 2R5MA 1UGQB 4KULA 3EFSA 2E64A 3JCMf 2SRCA 2MMPA 4JJBA 3RERA 1D3BB 3V7CA 4DOWA 3RMQA 1XOVA 2ATCB 1JQQA 3DB3A 1YJ9Q 4M75A 1IB8A 2FYKA 5CQYA 1MMNA 2AKKA 2HQHA 4AFSC 2YWWA 1Q86C 4Y28E 4ME7A 3CXCA 4LXCA 2LQKA 2FO0A 5GAN5 1VQ9Q 2M9UA 3G1JA 1WJQA 1WI7A 1I07A 2LT1A 1Y71A 1ZBJA 2CZ1B 1PWTA 3S3MA 9ATCB 4RMOA 1N5ZA 2HAXA 3META 3CCVT 3NTHA 3CCRA 3G71A 2DD4A 5CKDA 1GFDA 2GTOA 5GMKl 2CZ6B 1VQ4Q 2FZGB 3PNWC 4FSSA 2E3IA 1I5LA 4F7UF 4JLIA 1OOTA 2LP5A 4ELZC 4FL6A 2DL3A 1KQSA 1PRMC 4LUDA 4BI3A 4E7JA 2QA4T 2PQWA 5FROA 1FYNA 3CBMA 4MZMA 2OAWA 5IH2A 1TSFA 1TTHB 3QWYA 4M7DF 1CKAA 1YJNQ 1ZA1B 2V26A 4RTZA 2V8KA 3RR6A 1RAAB 2PVOB 2HL3A 3C0CA 4M78G 5GAOr 5KYYA 2X4XA 1WHKA 1M90C 2X3XD 1ZSGA 3VS4A 4ZGEB 3EHRA 4A4FA 3JB9F 2GQVA 2EYZA 1ZBXA 2DMOA 1WA7A 4E7LA 1M1KC 2DEQA 3EGUA 1X43A 4QT7A 3A8MB 4JRQA 1YNZA 4DEYA 1YI2A 2C06A 3M0PA 1X6BA 2YLBA 1E6HA 1ABQA 2YRCA 3BDUA 5IN1A 3PMIA 2XG8D 3CC2T 2DPPB 3JCMc 1PNJA 3QXEB 2E6NA 1AWJA 5C0MA 3EFOA 1D1BA 3CCMT 5FU7B 3M0TA 3T9NA 1Q82R 2EVRA 2RF0A 1E7OA 2DRMA 5FRNA 2QQ9A 2Y90A 1K1ZA 5LJ3h 2XDBA 1TUCA 2MOXA 3CPFA 1X2QA 2ROTA 1BIAA 2COWA 1GBRA 1VA7A 3RKYA 2DXUA 4MZPA 4M7AE 1JRIA 1PHTA 2K6DA 4J9CA 5A0LA 4ESRA 4KGZB 2VVKA 2L3SA 2NWMA 4BY6C 1OX8A 4CC3A 1G3TA 2KY9A 2KGTA 2VXFA 3QZ9B 5HKCA 2H3JA 4M78B 4EMGA 3VS2A 3OYYA 4JJNK 2I2LA 2J6KA 4F14A 1YITT 2KMTA 2EBPA 4C8QE 5IHIA 3CMAA 4HCCA 2W10A 2ZPGB 4C0GA 1VQ6Q 2MF2A 1Q7YR 1MGQA 1RADB 1B34A 2M0YA 2D0QB 4X34A 2FPEA 1R8OB 5C6SA 4E2FB 3OSSC 1YITA 1Y57A 1K8AC 1KD1U 2P4TA 2J7IA 5LJ3j 1UTIA 4JPBW 3OMGA 1GXIE 1VQPT 2H3EB 3CCET 1IXDA 2VB6A 4IUQA 1XTDA 3BW1A 3QKJA 4NL3A 1ZA2B 3LYIA 2DVEA 4J6XA 2XI9A 1PCXA 3KXTA 2KVQG 4K11A 3EH1A 2G3RA 1H3HA 3SWNC 5CIUA 1EFNA 1AWXA 3EGDA 2BZXA 3EH2A 2EKOA 2JMAA 3OYLA 1QCFA 4O5VA 2VC8A 4F04B 3MP1A 3WVEB 2YRVA 4C92E 2RJDA 4M77E 2DL5A 1UE9A 4IIOA 2MCNA 3OYHA 4E47A 2XDDA 3I55A 3H41A 3UPUA 3CCRQ 3G71Q 1Q95G 4PJOD 2EJ9A 4B9XA 1PG5B 1AWWA 2YRDA 2QYZA 4HT9A 3QDFA 3M0UA 3GOXA 2CSIA 2E70A 4A63B 2L5QA 2OTJT 2NUTB 1LNXA 4QQGA 4LUEA 2DIGA 1CSKA 2CH4A 2VGMA 1FMKA 3CCVQ 2CDTA 2LQWA 1ZSZC 3PVLA 4FU6A 4OMLA 3QWXX 3CCLT 2OTLT 2QTXA 4AFUC 5IXFA 2GTJA 3BE3A 2WSEE 3EG2A 2DXBA 3HL8A 1YP5A 1Q86U 2JJ9A 4M75F 2QA4Q 3E2UA 3M55A 4C8QG 2OTLA 2QDYB 1ZUKA 3HKSA 2JTMA 2RHUA 1RABB 4L6V5 1F1BB 2P0QA 3LX7A 5GAMh 5DLOA 1AVZC 2EQMA 3OYIA
chains in the Genus database with same CATH topology
3VS0A 2DE0X 5ECAA 2DBMA 1K0XA 1KIKA 1YWOA 2AZSA 1QKWA 1X69A 4CC2A 3VRZA 1RI9A 2KRMA 3I35A 3H0IA 4J9FA 1CKBA 2RQUA 2EPDA 2YT6A 1KSWA 1YCSB 4J9BA 1T0JA 1NLPC 3VRYA 2DILA 2LZ6B 5IXBA 1UJYA 4HCKA 1KJWA 3GBQA 2GQIA 4J9HA 2LNHB 1MV3A 3THKA 2I0NA 2L3QA 1ABOA 2FRWA 4Z89A 1G2BA 2EGAA 2DLPA 4J9EA 3UA7A 1U5SA 2XMFA 4HXJA 1UGVA 4RTXA 4OMMA 2JMCA 4DEXA 4IIMA 4AFZC 1MV0B 2CSQA 3M0RA 3REBB 1QWEA 1Z9QA 2HDAA 4RUGA 1PRLC 1BBZA 1AD5A 1T3LA 5FWCA 4OMQA 1K76A 2GGRA 2K9GA 2VKNA 2VWFA 3I5RA 2DM1A 2O31A 1QKXA 2KT1A 1M3CA 3H0FA 1GCQA 1WXBA 2AK5A 5IHKA 1K0SA 1SRMA 2DRKA 3TVTA 4RTTA 2GNCA 1WDXA 1B07A 2JW4A 1X2KA 2YUPA 1I1JA 4AFQC 1WX6A 2YSQA 2FPDA 2ENMA 2A08A 2KRNA 2C0TA 4M4ZA 1NM7A 1OPKA 1SSHA 2C0OA 2M51A 2HCKA 3NHNA 2LCSA 2LX7A 2RN8A 1BK2A 4LN2A 1T3SA 1W1FA 2E5KA 2CT3A 2SRCA 4JJBA 4AG2C 3TSZA 2JS2A 2HSPA 1XOVA 1JQQA 2RQVA 3EG0A 5I22A 1X27A 1G83A 4Z8AA 2KT8A 1VYTA 2AKKA 4JZ4A 1YN8A 4AFSC 1X6GA 1NYFA 1YWPA 4Z88A 1PKTA 2LJ1A 2FO0A 2O2OA 1IO6A 1VYVA 1A0NB 1WXTA 2RQTA 1WI7A 1I07A 4J9DA 4JZ3A 2FG0A 1ZBJA 1ARKA 1OEBA 1UFFA 1PWTA 5IHNA 1JXOA 1N5ZA 2CUBA 3VS1A 3VS7A 1SPKA 2DNUA 1U06A 1RLPC 1GFDA 2GTOA 2JXBA 1GL5A 4FSSA 1UHFA 1K4US 2YUOA 3EG3A 2G6FX 3A98A 2FRYA 1OOTA 2LP5A 2O88A 2DL3A 5FW9A 4JJCA 4CC7A 1PRMC 4E6RA 3TSWA 2CREA 4LUDA 3ZL7C 2JT4A 2DL7A 5GJWB 1FYNA 1AZEA 4WCIA 2F2VA 2D0NA 2OAWA 1I0CA 2CT4A 5IH2A 1MUZA 3QWYA 2RPNA 4CC4B 1CKAA 2JTEA 4RTZA 4J9IA 2RQRA 1Y0MA 2A36A 1OPLA 2EGEA 3O5ZA 1H92A 1PKSA 2H8HA 3C0CA 3I9QA 1WLPB 2KYMA 5FWBA 4AG1C 2X3XD 1ZSGA 2CH4W 3VS4A 3I5SA 3EHRA 1SHGA 1JU5C 2YUQA 1WFWA 3EG1A 4JJDA 5EC7A 2EYZA 2BZYA 2RQWA 2KROA 1TG0A 2DMOA 1WA7A 2EW3A 2V1QA 3M0SA 4LNPA 3EGUA 2J6OA 2OI3A 1X43A 4QT7A 1YNZA 4DEYA 2X3WD 2AKLA 3M0PA 3H0HA 1X6BA 2AZVA 2ESWA 2JS0A 4Y92A 1E6HA 4GLMA 1ABQA 2EKHA 2KNBB 2EYYA 1PNJA 2RNAA 3ULRB 1AWJA 3UF4A 4R0KA 3UA6A 2DVJA 2A37A 2JM8A 1W70A 3M0TA 1UUEA 2EVRA 2RF0A 1NEBA 1E7OA 2DRMA 4HVVA 1K1ZA 2DYBA 1SEMA 1TUCA 2MOXA 1ZUYA 1UDLA 1X2QA 1ZX6A 1NLOC 2ROTA 2MIOA 3VS5A 1RUWA 4RTVA 1GBRA 1VA7A 2DA9A 2K7AA 1JEGA 2A28A 1WXUA 3VS6A 4J9GA 1PHTA 2V1RA 2K6DA 3REAB 2EQIA 4J9CA 4ESRA 4LE9A 2VVKA 2L3SA 2NWMA 2ABLA 1B3QA 4CC3A 1T0HA 2KGTA 3JV3A 3NMZC 2DJQA 2J06A 1BU1A 2FPFA 2OJ2A 4F16A 3VS2A 1HSQA 1AWOA 2W0ZA 1HD3A 1M27C 3PE0A 2B86A 2J6KA 2IIMA 4HVUA 4F14A 4HVWA 3SEMA 1KFZA 1U3OA 1GCPA 2J6FA 2LMJA 2EBPA 5IHIA 1QWFA 1J3TA 4F17A 2KBTA 2W10A 1ZLMA 2O9SA 1QLYA 4RTUA 4X1VA 2EYWA 1ZUUA 1UHCA 2SEMA 2ROLA 2M0YA 2DL8A 2D8HA 2FPEA 5HCKA 4ZNXA 1AOJA 1WIEA 2D1XA 4OMPA 2L0AA 1V1CA 1GBQA 2K2MA 1NG2A 1Y57A 4OMNA 2NUZA 2DL4A 2J7IA 1NEGA 2D8JA 1UTIA 4JPBW 2BZ8A 2EGCA 1BB9A 2EYXA 2QDLA 2BTTA 3EHQA 2YDLA 2PTKA 2GBQA 2LJ0A 1JXMA 2JM9A 2F2XA 1SRLA 4K11A 4KRTA 3RBBB 2KE9A 1H3HA 4GBQA 3KFVA 2C0IA 4D8DA 1EFNA 1TUDA 1AWXA 2BZXA 3SHWA 1WYXA 2JMAA 2J05A 1QCFA 2HEQA 1H8KA 3U23A 2KR3A 2LJ3A 2L3PA 2L2PA 2DL5A 1OV3A 1UE9A 2DF6A 2K79A 2P4RA 4IIOA 2MCNA 3R6NA 5I11A 3H41A 2CUDA 2PNIA 3LH5A 4D8KA 1M3BA 2FEIA 1VYUA 1AWWA 2KXCA 4OMOA 2HBWA 1UJ0A 2ED1A 3VS3A 2KXDA 3M0UA 2CSIA 1UG1A 4A63B 2O9VA 4LUEA 1JO8A 2KYBA 3M0QA 2KRSA 1S1NA 1CSKA 1M3AA 2CH4A 5GJVB 1FMKA 4RTYA 2CDTA 2LQWA 1AEYA 3PVLA 4OMLA 4ORZA 5L23A 2PZ1A 3QWXX 1M8MA 4EIKA 2ED0A 3CQTA 1W6XA 4AFUC 3FJ5A 5IXFA 4RTWA 2GTJA 2LQNA 2RMOA 1LCKA 1GFCA 3EG2A 1K9AA 3PVQA 1HJDA 2ECZA 1YP5A 3IQLA 3NPFA 1E6GA 1RLQC 1NYGA 2YUNA 3NGPA 2K3BA 1ZUKA 2F2WA 1GCQC 2DBKA 1M30A 1SHFA 3UATA 1AZGB 2KEAA 1GRIA 1Z9ZA 1AVZC 2DX1A 1UECA 3RNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS0 A;  2DE0 X;  5ECA A;  2DBM A;  1K0X A;  1KIK A;  1YWO A;  2AZS A;  1QKW A;  1X69 A;  4CC2 A;  3VRZ A;  1RI9 A;  2KRM A;  3I35 A;  3H0I A;  4J9F A;  1CKB A;  2RQU A;  2EPD A;  2YT6 A;  1KSW A;  1YCS B;  4J9B A;  1T0J A;  1NLP C;  3VRY A;  2DIL A;  2LZ6 B;  5IXB A;  1UJY A;  4HCK A;  1KJW A;  3GBQ A;  2GQI A;  4J9H A;  2LNH B;  1MV3 A;  3THK A;  2I0N A;  2L3Q A;  1ABO A;  2FRW A;  4Z89 A;  1G2B A;  2EGA A;  2DLP A;  4J9E A;  3UA7 A;  1U5S A;  2XMF A;  4HXJ A;  1UGV A;  4RTX A;  4OMM A;  2JMC A;  4DEX A;  4IIM A;  4AFZ C;  1MV0 B;  2CSQ A;  3M0R A;  3REB B;  1QWE A;  1Z9Q A;  2HDA A;  4RUG A;  1PRL C;  1BBZ A;  1AD5 A;  1T3L A;  5FWC A;  4OMQ A;  1K76 A;  2GGR A;  2K9G A;  2VKN A;  2VWF A;  3I5R A;  2DM1 A;  2O31 A;  1QKX A;  2KT1 A;  1M3C A;  3H0F A;  1GCQ A;  1WXB A;  2AK5 A;  5IHK A;  1K0S A;  1SRM A;  2DRK A;  3TVT A;  4RTT A;  2GNC A;  1WDX A;  1B07 A;  2JW4 A;  1X2K A;  2YUP A;  1I1J A;  4AFQ C;  1WX6 A;  2YSQ A;  2FPD A;  2ENM A;  2A08 A;  2KRN A;  2C0T A;  4M4Z A;  1NM7 A;  1OPK A;  1SSH A;  2C0O A;  2M51 A;  2HCK A;  3NHN A;  2LCS A;  2LX7 A;  2RN8 A;  1BK2 A;  4LN2 A;  1T3S A;  1W1F A;  2E5K A;  2CT3 A;  2SRC A;  4JJB A;  4AG2 C;  3TSZ A;  2JS2 A;  2HSP A;  1XOV A;  1JQQ A;  2RQV A;  3EG0 A;  5I22 A;  1X27 A;  1G83 A;  4Z8A A;  2KT8 A;  1VYT A;  2AKK A;  4JZ4 A;  1YN8 A;  4AFS C;  1X6G A;  1NYF A;  1YWP A;  4Z88 A;  1PKT A;  2LJ1 A;  2FO0 A;  2O2O A;  1IO6 A;  1VYV A;  1A0N B;  1WXT A;  2RQT A;  1WI7 A;  1I07 A;  4J9D A;  4JZ3 A;  2FG0 A;  1ZBJ A;  1ARK A;  1OEB A;  1UFF A;  1PWT A;  5IHN A;  1JXO A;  1N5Z A;  2CUB A;  3VS1 A;  3VS7 A;  1SPK A;  2DNU A;  1U06 A;  1RLP C;  1GFD A;  2GTO A;  2JXB A;  1GL5 A;  4FSS A;  1UHF A;  1K4U S;  2YUO A;  3EG3 A;  2G6F X;  3A98 A;  2FRY A;  1OOT A;  2LP5 A;  2O88 A;  2DL3 A;  5FW9 A;  4JJC A;  4CC7 A;  1PRM C;  4E6R A;  3TSW A;  2CRE A;  4LUD A;  3ZL7 C;  2JT4 A;  2DL7 A;  5GJW B;  1FYN A;  1AZE A;  4WCI A;  2F2V A;  2D0N A;  2OAW A;  1I0C A;  2CT4 A;  5IH2 A;  1MUZ A;  3QWY A;  2RPN A;  4CC4 B;  1CKA A;  2JTE A;  4RTZ A;  4J9I A;  2RQR A;  1Y0M A;  2A36 A;  1OPL A;  2EGE A;  3O5Z A;  1H92 A;  1PKS A;  2H8H A;  3C0C A;  3I9Q A;  1WLP B;  2KYM A;  5FWB A;  4AG1 C;  2X3X D;  1ZSG A;  2CH4 W;  3VS4 A;  3I5S A;  3EHR A;  1SHG A;  1JU5 C;  2YUQ A;  1WFW A;  3EG1 A;  4JJD A;  5EC7 A;  2EYZ A;  2BZY A;  2RQW A;  2KRO A;  1TG0 A;  2DMO A;  1WA7 A;  2EW3 A;  2V1Q A;  3M0S A;  4LNP A;  3EGU A;  2J6O A;  2OI3 A;  1X43 A;  4QT7 A;  1YNZ A;  4DEY A;  2X3W D;  2AKL A;  3M0P A;  3H0H A;  1X6B A;  2AZV A;  2ESW A;  2JS0 A;  4Y92 A;  1E6H A;  4GLM A;  1ABQ A;  2EKH A;  2KNB B;  2EYY A;  1PNJ A;  2RNA A;  3ULR B;  1AWJ A;  3UF4 A;  4R0K A;  3UA6 A;  2DVJ A;  2A37 A;  2JM8 A;  1W70 A;  3M0T A;  1UUE A;  2EVR A;  2RF0 A;  1NEB A;  1E7O A;  2DRM A;  4HVV A;  1K1Z A;  2DYB A;  1SEM A;  1TUC A;  2MOX A;  1ZUY A;  1UDL A;  1X2Q A;  1ZX6 A;  1NLO C;  2ROT A;  2MIO A;  3VS5 A;  1RUW A;  4RTV A;  1GBR A;  1VA7 A;  2DA9 A;  2K7A A;  1JEG A;  2A28 A;  1WXU A;  3VS6 A;  4J9G A;  1PHT A;  2V1R A;  2K6D A;  3REA B;  2EQI A;  4J9C A;  4ESR A;  4LE9 A;  2VVK A;  2L3S A;  2NWM A;  2ABL A;  1B3Q A;  4CC3 A;  1T0H A;  2KGT A;  3JV3 A;  3NMZ C;  2DJQ A;  2J06 A;  1BU1 A;  2FPF A;  2OJ2 A;  4F16 A;  3VS2 A;  1HSQ A;  1AWO A;  2W0Z A;  1HD3 A;  1M27 C;  3PE0 A;  2B86 A;  2J6K A;  2IIM A;  4HVU A;  4F14 A;  4HVW A;  3SEM A;  1KFZ A;  1U3O A;  1GCP A;  2J6F A;  2LMJ A;  2EBP A;  5IHI A;  1QWF A;  1J3T A;  4F17 A;  2KBT A;  2W10 A;  1ZLM A;  2O9S A;  1QLY A;  4RTU A;  4X1V A;  2EYW A;  1ZUU A;  1UHC A;  2SEM A;  2ROL A;  2M0Y A;  2DL8 A;  2D8H A;  2FPE A;  5HCK A;  4ZNX A;  1AOJ A;  1WIE A;  2D1X A;  4OMP A;  2L0A A;  1V1C A;  1GBQ A;  2K2M A;  1NG2 A;  1Y57 A;  4OMN A;  2NUZ A;  2DL4 A;  2J7I A;  1NEG A;  2D8J A;  1UTI A;  4JPB W;  2BZ8 A;  2EGC A;  1BB9 A;  2EYX A;  2QDL A;  2BTT A;  3EHQ A;  2YDL A;  2PTK A;  2GBQ A;  2LJ0 A;  1JXM A;  2JM9 A;  2F2X A;  1SRL A;  4K11 A;  4KRT A;  3RBB B;  2KE9 A;  1H3H A;  4GBQ A;  3KFV A;  2C0I A;  4D8D A;  1EFN A;  1TUD A;  1AWX A;  2BZX A;  3SHW A;  1WYX A;  2JMA A;  2J05 A;  1QCF A;  2HEQ A;  1H8K A;  3U23 A;  2KR3 A;  2LJ3 A;  2L3P A;  2L2P A;  2DL5 A;  1OV3 A;  1UE9 A;  2DF6 A;  2K79 A;  2P4R A;  4IIO A;  2MCN A;  3R6N A;  5I11 A;  3H41 A;  2CUD A;  2PNI A;  3LH5 A;  4D8K A;  1M3B A;  2FEI A;  1VYU A;  1AWW A;  2KXC A;  4OMO A;  2HBW A;  1UJ0 A;  2ED1 A;  3VS3 A;  2KXD A;  3M0U A;  2CSI A;  1UG1 A;  4A63 B;  2O9V A;  4LUE A;  1JO8 A;  2KYB A;  3M0Q A;  2KRS A;  1S1N A;  1CSK A;  1M3A A;  2CH4 A;  5GJV B;  1FMK A;  4RTY A;  2CDT A;  2LQW A;  1AEY A;  3PVL A;  4OML A;  4ORZ A;  5L23 A;  2PZ1 A;  3QWX X;  1M8M A;  4EIK A;  2ED0 A;  3CQT A;  1W6X A;  4AFU C;  3FJ5 A;  5IXF A;  4RTW A;  2GTJ A;  2LQN A;  2RMO A;  1LCK A;  1GFC A;  3EG2 A;  1K9A A;  3PVQ A;  1HJD A;  2ECZ A;  1YP5 A;  3IQL A;  3NPF A;  1E6G A;  1RLQ C;  1NYG A;  2YUN A;  3NGP A;  2K3B A;  1ZUK A;  2F2W A;  1GCQ C;  2DBK A;  1M30 A;  1SHF A;  3UAT A;  1AZG B;  2KEA A;  1GRI A;  1Z9Z A;  1AVZ C;  2DX1 A;  1UEC A;  3RNJ A; 
#chains in the Genus database with same CATH topology
 4D6W A;  3VS0 A;  1K0X A;  3E9F A;  1QQJ A;  4M7A C;  1QKW A;  3M59 A;  3I35 A;  3QG1 A;  4X9D A;  2O4X A;  4J9F A;  2XDP A;  3FB9 A;  1UB4 A;  1VQ7 T;  2E41 A;  3CC2 Q;  3CC7 A;  2D6F A;  1M5Q 1;  3FLG A;  2DIL A;  2LZ6 B;  1UJY A;  2V8I A;  5GAN h;  2GQI A;  4J9H A;  2EAY A;  4C0D C;  2F69 A;  2FZC B;  1BI1 A;  3CCM Q;  1ZSZ A;  3BDL A;  3S3N A;  1LJO A;  2NUP B;  1MHN A;  2FRW A;  4J9E A;  2DLP A;  4ELY C;  4LDY A;  1VIF A;  4C8Q C;  2P0K A;  1K9M R;  4NL2 A;  4C92 G;  1JJ2 S;  3GP8 A;  3QUI A;  4DEX A;  4AFZ C;  3M0R A;  4ZGJ B;  1M90 U;  5DY9 A;  5KH6 A;  2DO3 A;  2HDA A;  2DEU A;  3HTR A;  1YBY A;  3MEV A;  5KCH A;  2BUD A;  3GIB A;  5GMK e;  1U8R A;  1VQL A;  2HL5 C;  1QCO A;  1M1K U;  2O31 A;  2V8J A;  2KT1 A;  1M3C A;  3CMA Q;  1VIE A;  3H0F A;  3L2Z A;  3GNF B;  2XKO C;  5GAM j;  1VQ4 T;  1SRM A;  2DRK A;  2MI6 A;  3TVT A;  3A8H B;  1B07 A;  5GAN 3;  3QDR B;  3UDC A;  2L8D A;  1YIT Q;  4EMK B;  5LJ5 d;  3G4S A;  1LVK A;  1OZ2 A;  3RUX A;  2ENM A;  2XID A;  1OQK A;  4J7F A;  2C0T A;  2YXY A;  4VUB A;  4M4Z A;  2QEX T;  1SSH A;  4QVD A;  3H8Z A;  1TU0 B;  1KC8 R;  3NHN A;  5GAN j;  2VXE A;  3M4Y A;  4C5G A;  4M77 C;  1BK2 A;  4PNO A;  3L2W A;  1QCN A;  3P8B B;  4KH1 B;  1Q82 C;  2CT3 A;  4ZTJ A;  1WNL A;  4AG2 C;  2QEX A;  3CCE Q;  4C92 B;  2RQV A;  1X27 A;  1G83 A;  2KT8 A;  1IZ6 A;  2CP3 A;  2LCL A;  1N27 A;  1PKT A;  4IUV A;  3OYA A;  2PUK B;  2O2O A;  1IO6 A;  3A8O B;  1NJI R;  1KK7 A;  2EWN A;  3EG9 B;  2CP0 A;  4J9D A;  4JZ3 A;  4KT0 E;  3JCM e;  4M75 G;  5HK3 A;  5D7U A;  3VYH B;  5IHN A;  2RI2 A;  2CUB A;  3VS1 A;  4M78 D;  3VS7 A;  1Y96 B;  3GLX A;  1W2B S;  4OB3 B;  1D0Y A;  5KE2 A;  1Y07 A;  1K8A U;  4HCB A;  1QVF P;  1OU9 A;  2JXB A;  5EG2 A;  2JOY A;  1M1F A;  2FRY A;  1N9R A;  2P0P A;  3MCA B;  4PJO C;  2OTJ Q;  4FYW B;  3ZFJ A;  4CC7 A;  4E6R A;  3QPH A;  2DL7 A;  5KYW A;  3OYD A;  1AZE A;  3FDR A;  3CCL Q;  2OTL Q;  2D0N A;  2RPN A;  2X9H A;  2RHY A;  3LW5 E;  2XIC A;  3S3O A;  2RK1 A;  2A36 A;  1WJS A;  1OPL A;  3PT9 A;  1H92 A;  3HFO A;  2H8H A;  2RI5 A;  4KBM B;  3I9Q A;  1IHW A;  5FWB A;  2QQR A;  1WGS A;  3I5S A;  3NTI A;  4DBH A;  2YUQ A;  1WFW A;  3QZ5 B;  4JJD A;  2BZY A;  2KRO A;  5LJ5 f;  2FL7 A;  1TG0 A;  2VV5 A;  2EW3 A;  2V1Q A;  2LT4 A;  1Q81 R;  1NPR A;  1Y7X A;  2L3R A;  3G7Z A;  3MP8 A;  2ESW A;  5GAN 7;  1R0B G;  4M75 B;  2WSF E;  3ULR B;  2KSS A;  3UA6 A;  2AHJ B;  2DVJ A;  2A37 A;  2MPX C;  1NEB A;  1SEM A;  1JJ2 A;  3A1P A;  3MKD A;  1ZX6 A;  2RB6 A;  3QYG B;  5KYU A;  1VQ7 Q;  4PJO A;  3OS1 A;  2EJF A;  3OMC A;  4XU0 A;  5D6W A;  1JEG A;  4XTW A;  3M9Q A;  3VS6 A;  4CI0 C;  1VQL Q;  1OYX A;  3VV0 A;  3RMS A;  5CKE A;  5GAN 2;  4MDX A;  8AT1 B;  2K4Y A;  4J6Y A;  2IVW A;  1RL2 A;  1RAI B;  1LPL A;  3CCR T;  3JV3 A;  3G71 T;  3CCS T;  3NMZ C;  1SG5 A;  2J06 A;  2KK4 A;  4Q5W A;  5KYX A;  2DFU A;  2W0Z A;  2QAZ A;  1JBM A;  3PE0 A;  4DQ2 A;  2IIM A;  4HVU A;  4HVW A;  3D7S B;  1KFZ A;  3G4S Q;  3FEO A;  1GCP A;  2J6F A;  2LMJ A;  3VU3 C;  1J3T A;  2EIF A;  1KQ1 A;  2X51 A;  3OS5 A;  4RKU E;  2E3H A;  3CCS A;  5KYY B;  2DL8 A;  2DTO A;  2D8H A;  2P84 A;  1OI1 A;  5HCK A;  4KUI A;  1AOJ A;  1MMD A;  2DIQ A;  1V1C A;  3AHU A;  1GBQ A;  1NG2 A;  3RDV A;  1V76 A;  3HFN A;  3CCU A;  2A0F B;  3LGL A;  5LJ3 d;  2JTF A;  2QEX Q;  3VUB A;  2QDL A;  2BTT A;  5GAO l;  3CPW P;  4GY5 A;  2YDL A;  3X26 B;  1YI2 T;  1D0X A;  1RAC B;  1BYM A;  1C0M A;  2MAM A;  4KRT A;  4QQ6 A;  2WSC E;  2HSE B;  3Q1J A;  3LWI A;  4M7A D;  2KE9 A;  4GBQ A;  4D8D A;  1TUD A;  2HZY A;  2BKD N;  3BFM A;  5FU6 B;  1RAF B;  1QP3 A;  2KR3 A;  2LJ3 A;  4C0Z A;  3LLR A;  2RHX A;  5FU7 C;  5M9O A;  2QXF A;  3OYN A;  4F7U E;  1W2B A;  2CUD A;  3CD6 T;  1SKU B;  3PIO A;  4C8Q D;  1M3B A;  2FEI A;  1VYU A;  1RI0 A;  1K73 C;  2KXD A;  4M7D E;  2HQE A;  3M0Q A;  1G3Y A;  2KRS A;  1S1N A;  2HKN A;  1M3A A;  3VKI A;  5GJV B;  3CD6 A;  5A0G A;  1NE8 A;  1Q82 U;  2DKG A;  5L23 A;  2PZ1 A;  4OMF B;  2K2V A;  3JCM g;  2ED0 A;  1W6X A;  1N8R C;  4M78 C;  1WJR A;  2JVV A;  2LQN A;  4PJM A;  4N0A C;  4DA4 A;  4J7I A;  1M1G A;  2CGH A;  3HHT B;  1EX4 A;  1K9A A;  4E7H A;  3CMA T;  4PLL A;  1OZ3 A;  3NPF A;  1E6G A;  3I56 A;  1X75 C;  2EQJ A;  1NYG A;  2M02 A;  1JB0 E;  1GCQ C;  2DBK A;  3PFS A;  1ACM B;  5A0D A;  4BE0 A;  3OQ5 A;  1OUL A;  4YTL A;  1VQN A;  5CR2 A;  2M16 A;  1GRI A;  1MNE A;  2PVD B;  2DX1 A;  4C92 D;  4M77 D;  4L5G A;  1VQK A;  3HRS A;  1X69 A;  2KRM A;  5KCO A;  3E19 A;  5GAO n;  2DTH A;  5LJ3 f;  2MYS A;  5CKF A;  1VQ8 A;  2EPD A;  5IAY A;  1YCS B;  4J9B A;  3VRY A;  2E12 A;  4HCK A;  1KJW A;  1O75 A;  4AT1 B;  1TXQ A;  5CQX A;  1KD1 R;  3OBY A;  4JLG A;  2Y4Y A;  4Z89 A;  5D6Y A;  1KG1 A;  1EZZ B;  3I55 T;  4FW1 A;  1HYO A;  2BE7 D;  4N0A A;  3ME9 A;  3C94 A;  4A4K A;  5L8R E;  2JMC A;  4F7U G;  2CSQ A;  2R5A A;  4A4E A;  1BCM A;  3M53 A;  1QWE A;  1Z9Q A;  4RUG A;  3C12 A;  2ZPE B;  1AD5 A;  1T3L A;  4OMQ A;  1M2O A;  4BAC A;  3PMT A;  3I5R A;  1QKX A;  1GCQ A;  2LC4 A;  2K5F A;  4M7D G;  2AK5 A;  2E10 A;  3CME T;  5FRM A;  2RJE A;  5IHK A;  3CCS Q;  1K0S A;  2QQA A;  4LDV A;  3TRE A;  3OW2 P;  5GAM d;  4RTT A;  4A4G A;  2JW4 A;  1X01 A;  3LH0 A;  1I1J A;  2E4H A;  3DKM A;  1WX6 A;  1U1T A;  1UGP B;  3JB9 G;  1BKB A;  2CP2 A;  2HBP A;  2A08 A;  1S72 T;  2KRN A;  4ATO A;  3CME A;  3VUZ A;  1NM7 A;  1OPK A;  3OSV A;  4UC4 A;  2C0O A;  3V8K A;  3QHS A;  2QK0 A;  4PJO F;  5GAN d;  4C5I A;  2RN8 A;  3CCJ A;  3JCM P;  4LN2 A;  1T3S A;  1W1F A;  3MEW A;  3L2Q A;  1M9S A;  4N4H A;  1SSF A;  1RAG B;  3C95 A;  1S72 A;  2O4X B;  3TSZ A;  3VJP A;  3TQ7 P;  2HSP A;  1P92 A;  3QSU A;  4MML A;  3EG0 A;  3SWN A;  3WVD B;  3OYE A;  4F7U B;  2CP6 A;  1Q86 R;  4Z8A A;  1VUB A;  3ER0 A;  2CZ0 B;  5AYF A;  2MK5 A;  3EGX A;  2PVG B;  1YI2 Q;  1YN8 A;  1X6G A;  1IRX A;  1YWP A;  4Z88 A;  2BE9 B;  5AT1 B;  1MMA A;  3CC7 T;  2QG9 B;  2LQ8 A;  5GAN 6;  1SF9 A;  1PSF A;  3M5A A;  1VYV A;  5CVI A;  1VQO A;  1WXT A;  4M7D B;  1R0C B;  4E7Z A;  5GMK m;  4OGE A;  2FG0 A;  4XU2 A;  1PM3 A;  1UFF A;  2L89 A;  1QVG S;  3CD6 Q;  1SPK A;  1U06 A;  1RLP C;  4ZGD B;  4JUV A;  2CZ7 B;  1PSE A;  4M75 E;  1MMG A;  1VQL T;  4QKU A;  4O6J A;  1AT1 B;  4JRI A;  4B9W A;  3PGG A;  4XTZ A;  3CCQ A;  2CRE A;  3ZL7 C;  3JCM b;  2JT4 A;  2DK3 A;  5GJW B;  1QVF S;  3EAE A;  4TVR A;  3G6E A;  4WCI A;  2F2V A;  4RCB A;  2CT4 A;  2ZPF B;  4J9I A;  5HK0 A;  2RQR A;  1Y0M A;  1M90 R;  2GF7 A;  2ZZD A;  3G4S T;  1PKS A;  5GAM f;  4EMK C;  4AG1 C;  4OP0 A;  3J80 E;  4J8O A;  1D0Z A;  2CH4 W;  1M1K R;  1SHG A;  1JU5 C;  3EG1 A;  2DTI A;  5EC7 A;  2QAS A;  3HPW A;  2JZ2 A;  3H6Z A;  2D9T A;  4LNP A;  1YJ9 A;  4B6M A;  4BI4 A;  2J6O A;  1K73 U;  3ASK A;  3WXM B;  2ZAE A;  2AKL A;  4M7A A;  4Y92 A;  4GLM A;  3CBO A;  2E1H A;  2EKH A;  2KNB B;  2EYY A;  4PFP A;  4EMH A;  2AIR B;  4XTY A;  2NUP A;  4A53 A;  2XK0 A;  4R0K A;  1VQ9 A;  5GAN f;  3OYC A;  2JM8 A;  3MO8 A;  1W70 A;  1N8R U;  4HVV A;  4C92 C;  1PD1 A;  7AT1 B;  2GFA A;  3M58 A;  2HQX A;  5GMK h;  1NLO C;  1VQM T;  3VS5 A;  5LJ5 e;  4C8Q A;  4RTV A;  2DA9 A;  4QW2 A;  2NYS A;  1WXU A;  2ZCF B;  4J9G A;  2V1R A;  2CKK A;  4OGC A;  4HT8 A;  2QQB A;  3I55 Q;  5A2Q E;  1B3Q A;  2RD1 A;  1T0H A;  2CS7 A;  1VQM A;  2DJQ A;  4P5N A;  1BI3 A;  4C5E A;  4F16 A;  4EMK A;  2KDS A;  1AWO A;  2DZC A;  1HD3 A;  2B86 A;  1YJN A;  1YJW T;  1OU8 A;  1U3O A;  3OS2 A;  2CYZ B;  3CC4 A;  1QWF A;  3J7A F;  4ANJ A;  2KBT A;  4BB7 A;  1ZLM A;  3CME Q;  1QLY A;  3RES A;  4KGV B;  1ZUU A;  2ROL A;  4IUP A;  4ZTF A;  1K8A R;  4ZNX A;  1WIE A;  3JCM J;  1Q7Y C;  2D1X A;  3NTK A;  1YJW A;  3FIF A;  3OB9 A;  4OB1 B;  4MMK A;  4OMN A;  4C92 A;  2NUZ A;  4M77 A;  1S72 Q;  1NEG A;  2D8J A;  2EGC A;  1JJ2 P;  1BB9 A;  2EYX A;  3KUF A;  3M4G A;  5GMK j;  4M78 F;  3HP9 A;  2EQK A;  5J26 A;  2LJ0 A;  3M56 A;  3OYB A;  1JXM A;  4Y91 A;  1MND A;  4QQD A;  2F5K A;  3JCM h;  2YLC A;  3JB9 J;  1I8F A;  2K5L A;  4Z02 A;  3EG9 A;  3OYJ A;  3KFV A;  4FIB A;  1VQO Q;  3CPW S;  4M75 C;  4EDU A;  1WYX A;  3PTA A;  2E5Q A;  3CXC P;  2J05 A;  2HEQ A;  4II1 A;  3M54 A;  4N4G A;  3U23 A;  1Y96 A;  2VYT A;  2L3P A;  2LX9 A;  2L2P A;  3OYM A;  2DF6 A;  5I11 A;  1QVG A;  2P4R A;  2RJC A;  2K5I A;  3R6N A;  3AT1 B;  2PNI A;  3CC7 Q;  4BDY A;  1C6V X;  4OF1 A;  3CEY A;  4A54 A;  2DXC A;  5IT9 E;  2M0O A;  4LDU A;  2ED1 A;  3VS3 A;  2IPO B;  4BDZ A;  1UG1 A;  5LJ5 j;  3PIP A;  5KYX B;  5I2M A;  1M2V A;  1QVF A;  1JO8 A;  2KYB A;  4IUR A;  2X4Y A;  3L42 A;  1KQS P;  1VQ6 A;  4ORZ A;  1N6A A;  1IGU A;  1I4K 1;  1YFN A;  4XTU A;  4EIK A;  4HCZ A;  3FC3 A;  3SFM A;  3FJ5 A;  4RTW A;  4FT4 A;  2RMO A;  3OYF A;  6AT1 B;  1LCK A;  1NBE B;  2A3L A;  1D09 B;  2FVU A;  4FSX A;  8ATC B;  2VGN A;  3JCM X;  5I21 A;  1RLQ C;  1BCO A;  2CP5 A;  2NLU A;  2RHZ A;  3EFR A;  1YCY A;  1I81 A;  1UEB A;  1SHF A;  5CKB A;  5DM7 R;  4MZT A;  2HD0 A;  3CCU T;  2KEA A;  4BD3 A;  2QGF B;  3QII A;  3O8V A;  1W2B P;  3QJ6 A;  3SB2 A;  2DBM A;  1HK9 A;  2RA2 A;  3FJP A;  1TH7 A;  2AZS A;  1HXD A;  4CC2 A;  2K57 A;  1D3B A;  3H0I A;  3OBW A;  3DLM A;  3TCJ A;  1CKB A;  1BI0 A;  2COZ A;  2RQU A;  4PFZ A;  3CBP A;  1KSW A;  4M7D D;  4BUG A;  1T0J A;  1NLP C;  1W4S A;  5IXB A;  4LD6 A;  2WAC A;  4DBF A;  2LNH B;  4FYV B;  3THK A;  1WHM A;  2L3Q A;  1ABO A;  5FU6 C;  1G2B A;  3UA7 A;  2XMF A;  3EFO B;  4HKE A;  4DBR A;  3JB9 D;  1VQM Q;  4E7S A;  1TOV A;  2LTO A;  4IIM A;  2KAF A;  3CCV A;  1MV0 B;  4JRK A;  3REB B;  3QYH B;  1YIJ T;  1K9M C;  5LJ3 e;  5FWC A;  1BI2 A;  1K76 A;  2GGR A;  4J6W A;  3QBY A;  2VWF A;  1YHQ T;  1XQH A;  5KYN A;  3CC4 Q;  4X9C A;  3N5B B;  5LJ5 g;  2LNV A;  3P8H A;  3P8D A;  3JAM E;  1O9S A;  2QA4 A;  1QP2 A;  4M7A F;  1WDX A;  1YIJ A;  4HA8 A;  3X28 B;  2Z0W A;  3ZEH A;  1YJW Q;  4PJJ A;  2YUP A;  2YSQ A;  1WQW A;  2FPD A;  1YHQ A;  2XU8 A;  3I56 T;  3RIR A;  5GAN 8;  1C1A A;  3OW2 S;  5GMK i;  5CO7 A;  3HRU A;  2M51 A;  5CAI A;  4E7I A;  1WHL A;  4KGX B;  2LX7 A;  4C8Q F;  1B34 B;  4AMC A;  1VQN T;  1IRE B;  1KC8 C;  1M8V A;  1XNI A;  2E5K A;  3CPW A;  1V29 B;  2A7Y A;  4R56 A;  3H9N A;  3CC2 A;  2JS2 A;  1VQK T;  2HMA A;  2HKQ B;  5I22 A;  3R6O A;  3CCM A;  4MDW A;  1VQ5 T;  3A5Z B;  1WHG A;  1VYT A;  4JZ4 A;  4C5H A;  4KH0 B;  3L2U A;  1NYF A;  1UGR B;  1R77 A;  1VQ8 T;  1FMW A;  2LJ1 A;  1TS9 A;  1FWZ A;  2F1L A;  2LDM A;  1A0N B;  4FYX B;  1KHC A;  4IUU A;  4RCC A;  2KQW A;  2RQT A;  2M1H A;  1D1A A;  4EPC A;  5CK9 A;  4BY6 B;  3EGD B;  1ARK A;  1VQ5 A;  1OEB A;  4OB2 B;  1NJI C;  3A8L B;  1JXO A;  1Q7Y U;  1G8X A;  2DER A;  1EIF A;  4FM4 B;  4C0F A;  1RAE B;  4BE1 A;  2LVM A;  3SD4 A;  2DNU A;  3X20 B;  4L59 A;  4OB0 B;  2JN0 A;  4XQ3 A;  1GL5 A;  1UHF A;  2HNI A;  3KBG A;  2FHD A;  2E6Z A;  1K4U S;  2YUO A;  4C92 F;  4M77 F;  4NOY A;  3EG3 A;  1G3W A;  4IUT A;  3C4S A;  2G6F X;  2LCC A;  2RI3 A;  3A98 A;  4A4H A;  2O88 A;  3UT1 A;  4M78 A;  4QVZ A;  4JJC A;  5FW9 A;  3TSW A;  4PJL A;  3URG A;  4ZN1 A;  3L2R A;  3GF5 A;  1G5V A;  1I0C A;  4QVC A;  1MUZ A;  4CC4 B;  2JTE A;  2RHI A;  1B7T A;  2QGG A;  2VAS A;  4OVA A;  4V2S A;  2EGE A;  2GCX A;  2CP7 A;  3O5Z A;  2QQS A;  1FMV A;  5DLQ E;  1WLP B;  2KYM A;  4J5Y A;  5KE3 A;  1PC0 A;  2XHC A;  4FYY B;  2DZ9 A;  1VQP A;  4KUD K;  3CCE A;  2RQW A;  4JDS A;  3MHX A;  5J3B A;  3RKX A;  3M0S A;  3X25 B;  4XAX B;  5CKH A;  2K3X A;  3CCJ T;  2OI3 A;  3OS0 A;  4JS5 A;  2X3W D;  3H0H A;  2AZV A;  2MWP A;  3SWN B;  2JS0 A;  4JS4 A;  3M57 A;  3CCU Q;  1Q81 C;  3EGX B;  4GLK A;  2RNA A;  3UF4 A;  4E7K A;  2COY A;  1UUE A;  2ZPB B;  5GAM e;  4LDW A;  4LD9 K;  2X4W A;  4M75 D;  4PL6 A;  3MP6 A;  1KQ2 A;  2DYB A;  4XU3 A;  4FCY A;  2RH2 A;  3QO3 A;  4M7A G;  2PU9 B;  2IG0 A;  1ZUY A;  1UDL A;  5I2S A;  2MIO A;  3UWN A;  3MEA A;  1VQO T;  1RUW A;  2K7A A;  3V8J A;  2A28 A;  2PUO B;  3SDZ A;  3MPU B;  4M7D C;  3REA B;  2EQI A;  3JB9 I;  4LE9 A;  1VOM A;  2ABL A;  1ZSZ B;  2OTJ A;  3E9G A;  5GAN e;  4WTO B;  1BU1 A;  2DET A;  2FPF A;  2OJ2 A;  1YIJ Q;  2JNG A;  3CCL A;  2NUT A;  1HSQ A;  2FZK B;  1M27 C;  1WZO A;  3SEM A;  1YHQ Q;  3CCQ T;  4PJO E;  3QJY A;  2OX7 A;  2GFU A;  3OW2 A;  4F17 A;  1H64 1;  1QVP A;  1WQ7 A;  2O9S A;  2X4J A;  4RTU A;  4X1V A;  1WHH A;  2EYW A;  3G6E T;  5FLX E;  1IHV A;  1UHC A;  2SEM A;  5D6X A;  5LJ3 g;  3X24 B;  1BIB A;  2F5T X;  3JRZ A;  4R55 A;  2E65 A;  1WPY A;  5GAO m;  2LRQ A;  4PFO A;  4ZN3 A;  4LDX A;  5CCA A;  3L2V A;  4OMP A;  2L0A A;  4PJN A;  4XU1 A;  2K2M A;  3RKW A;  2DL4 A;  3I56 Q;  4F7U A;  4CRI A;  2BZ8 A;  4M7A B;  3EHQ A;  4XTV A;  2PTK A;  2GBQ A;  1YJ9 T;  4WF2 A;  4BE2 A;  1K9M U;  2JM9 A;  4NS5 A;  4IKF A;  2F2X A;  1SRL A;  4BI8 B;  1VQN Q;  5GAO p;  3RBB B;  3TU4 K;  4M7D A;  4M77 G;  4C0D B;  1VQ7 A;  2C0I A;  1VQ9 T;  1I5O B;  3GNG A;  3SHW A;  1PD0 A;  1VQK Q;  3OY9 A;  1H8K A;  2OAU A;  3OYG A;  2AT1 B;  1VQ5 Q;  4C8Q B;  4PKC C;  5LL6 S;  1G3S A;  1OV3 A;  1KHI A;  2K79 A;  3E1S A;  3V8L A;  4DBQ A;  1H3Z A;  5GAO q;  1N9S A;  1VQ8 Q;  1IGQ A;  1AHJ B;  3OYK A;  1D1C A;  1X6O A;  1K73 R;  3VYG A;  2ZPH B;  3CXC S;  3LH5 A;  4D8K A;  3DLL A;  2QI2 A;  1DJ7 B;  3V7R A;  2ZGW A;  2RO0 A;  2KXC A;  4OMO A;  2HBW A;  1UJ0 A;  2ZPI B;  2DD5 A;  2O9V A;  4XTX A;  1WHJ A;  1KC8 U;  1N8R R;  2FB7 A;  2R58 A;  4RTY A;  1AEY A;  4J83 A;  2EYQ A;  2VUB A;  1M8M A;  1VQ4 A;  3CQT A;  2QTV A;  2B8A A;  1YJN T;  3A8G B;  1GFC A;  3CC4 T;  3PVQ A;  1HJD A;  2ECZ A;  3J81 E;  4FW2 A;  3IQL A;  1KQS S;  1QW1 A;  2DXT A;  3JCM V;  4PJO G;  3JCM d;  1VQP Q;  2DJZ A;  1UGS B;  3BY7 A;  4M77 B;  2YUN A;  3NGP A;  1M4Z A;  2K3B A;  2F2W A;  1TWB A;  5KYW B;  1M30 A;  3UAT A;  3L1A A;  2MWO A;  1NJI U;  1AZG B;  2BIV A;  1Z9Z A;  4XK8 E;  1QVG P;  1UEC A;  3RNJ A;  2DE0 X;  5ECA A;  4RG8 A;  1KIK A;  1ZHI A;  2X35 A;  2JUF A;  5LJ5 h;  1YWO A;  4JRP A;  3JCM W;  4RG2 A;  3VRZ A;  1RI9 A;  3CCJ Q;  3LWH A;  2RJF A;  1XJW B;  3JB9 H;  5HY6 A;  3GPL A;  2YT6 A;  1OX9 A;  1FX7 A;  4PLI A;  5J39 A;  3MEU A;  2O01 E;  3GBQ A;  3TEE A;  3OA6 A;  1MV3 A;  3V7S A;  3F70 A;  4PK4 A;  2I0N A;  3FRN A;  4FT2 A;  2DAQ A;  2EGA A;  1NZ9 A;  1U5S A;  4DOV A;  1KD1 C;  1ZQ1 A;  4HXJ A;  1UGV A;  4RTX A;  4OMM A;  1RAH B;  4N4I A;  1FXX A;  2DYI A;  1M2V B;  3S6W A;  1PRL C;  1BBZ A;  5GAM g;  5KYU B;  4PJO B;  1NPP A;  2K9G A;  2VKN A;  2Y4X A;  2RM4 A;  2DM1 A;  2EFI A;  2RK2 A;  2K3Y A;  3HSB A;  2XD0 A;  1WXB A;  1VQ6 T;  1Q81 U;  5GAN 4;  2KI7 A;  3JSC A;  2GNC A;  3MJX A;  1LOJ A;  2R57 A;  4M78 E;  1X2K A;  2EQU A;  4AFQ C;  3NFC A;  5GAN g;  3CCQ Q;  3DB4 A;  1TUG B;  2YHT A;  3HRT A;  1QMC A;  3ZBD A;  3G6E Q;  2EJG A;  1U1S A;  3LGF A;  3JCM Q;  3INZ A;  2HCK A;  2LCS A;  2R5M A;  1UGQ B;  4KUL A;  3EFS A;  2E64 A;  3JCM f;  2SRC A;  2MMP A;  4JJB A;  3RER A;  1D3B B;  3V7C A;  4DOW A;  3RMQ A;  1XOV A;  2ATC B;  1JQQ A;  3DB3 A;  1YJ9 Q;  4M75 A;  1IB8 A;  2FYK A;  5CQY A;  1MMN A;  2AKK A;  2HQH A;  4AFS C;  2YWW A;  1Q86 C;  4Y28 E;  4ME7 A;  3CXC A;  4LXC A;  2LQK A;  2FO0 A;  5GAN 5;  1VQ9 Q;  2M9U A;  3G1J A;  1WJQ A;  1WI7 A;  1I07 A;  2LT1 A;  1Y71 A;  1ZBJ A;  2CZ1 B;  1PWT A;  3S3M A;  9ATC B;  4RMO A;  1N5Z A;  2HAX A;  3MET A;  3CCV T;  3NTH A;  3CCR A;  3G71 A;  2DD4 A;  5CKD A;  1GFD A;  2GTO A;  5GMK l;  2CZ6 B;  1VQ4 Q;  2FZG B;  3PNW C;  4FSS A;  2E3I A;  1I5L A;  4F7U F;  4JLI A;  1OOT A;  2LP5 A;  4ELZ C;  4FL6 A;  2DL3 A;  1KQS A;  1PRM C;  4LUD A;  4BI3 A;  4E7J A;  2QA4 T;  2PQW A;  5FRO A;  1FYN A;  3CBM A;  4MZM A;  2OAW A;  5IH2 A;  1TSF A;  1TTH B;  3QWY A;  4M7D F;  1CKA A;  1YJN Q;  1ZA1 B;  2V26 A;  4RTZ A;  2V8K A;  3RR6 A;  1RAA B;  2PVO B;  2HL3 A;  3C0C A;  4M78 G;  5GAO r;  5KYY A;  2X4X A;  1WHK A;  1M90 C;  2X3X D;  1ZSG A;  3VS4 A;  4ZGE B;  3EHR A;  4A4F A;  3JB9 F;  2GQV A;  2EYZ A;  1ZBX A;  2DMO A;  1WA7 A;  4E7L A;  1M1K C;  2DEQ A;  3EGU A;  1X43 A;  4QT7 A;  3A8M B;  4JRQ A;  1YNZ A;  4DEY A;  1YI2 A;  2C06 A;  3M0P A;  1X6B A;  2YLB A;  1E6H A;  1ABQ A;  2YRC A;  3BDU A;  5IN1 A;  3PMI A;  2XG8 D;  3CC2 T;  2DPP B;  3JCM c;  1PNJ A;  3QXE B;  2E6N A;  1AWJ A;  5C0M A;  3EFO A;  1D1B A;  3CCM T;  5FU7 B;  3M0T A;  3T9N A;  1Q82 R;  2EVR A;  2RF0 A;  1E7O A;  2DRM A;  5FRN A;  2QQ9 A;  2Y90 A;  1K1Z A;  5LJ3 h;  2XDB A;  1TUC A;  2MOX A;  3CPF A;  1X2Q A;  2ROT A;  1BIA A;  2COW A;  1GBR A;  1VA7 A;  3RKY A;  2DXU A;  4MZP A;  4M7A E;  1JRI A;  1PHT A;  2K6D A;  4J9C A;  5A0L A;  4ESR A;  4KGZ B;  2VVK A;  2L3S A;  2NWM A;  4BY6 C;  1OX8 A;  4CC3 A;  1G3T A;  2KY9 A;  2KGT A;  2VXF A;  3QZ9 B;  5HKC A;  2H3J A;  4M78 B;  4EMG A;  3VS2 A;  3OYY A;  4JJN K;  2I2L A;  2J6K A;  4F14 A;  1YIT T;  2KMT A;  2EBP A;  4C8Q E;  5IHI A;  3CMA A;  4HCC A;  2W10 A;  2ZPG B;  4C0G A;  1VQ6 Q;  2MF2 A;  1Q7Y R;  1MGQ A;  1RAD B;  1B34 A;  2M0Y A;  2D0Q B;  4X34 A;  2FPE A;  1R8O B;  5C6S A;  4E2F B;  3OSS C;  1YIT A;  1Y57 A;  1K8A C;  1KD1 U;  2P4T A;  2J7I A;  5LJ3 j;  1UTI A;  4JPB W;  3OMG A;  1GXI E;  1VQP T;  2H3E B;  3CCE T;  1IXD A;  2VB6 A;  4IUQ A;  1XTD A;  3BW1 A;  3QKJ A;  4NL3 A;  1ZA2 B;  3LYI A;  2DVE A;  4J6X A;  2XI9 A;  1PCX A;  3KXT A;  2KVQ G;  4K11 A;  3EH1 A;  2G3R A;  1H3H A;  3SWN C;  5CIU A;  1EFN A;  1AWX A;  3EGD A;  2BZX A;  3EH2 A;  2EKO A;  2JMA A;  3OYL A;  1QCF A;  4O5V A;  2VC8 A;  4F04 B;  3MP1 A;  3WVE B;  2YRV A;  4C92 E;  2RJD A;  4M77 E;  2DL5 A;  1UE9 A;  4IIO A;  2MCN A;  3OYH A;  4E47 A;  2XDD A;  3I55 A;  3H41 A;  3UPU A;  3CCR Q;  3G71 Q;  1Q95 G;  4PJO D;  2EJ9 A;  4B9X A;  1PG5 B;  1AWW A;  2YRD A;  2QYZ A;  4HT9 A;  3QDF A;  3M0U A;  3GOX A;  2CSI A;  2E70 A;  4A63 B;  2L5Q A;  2OTJ T;  2NUT B;  1LNX A;  4QQG A;  4LUE A;  2DIG A;  1CSK A;  2CH4 A;  2VGM A;  1FMK A;  3CCV Q;  2CDT A;  2LQW A;  1ZSZ C;  3PVL A;  4FU6 A;  4OML A;  3QWX X;  3CCL T;  2OTL T;  2QTX A;  4AFU C;  5IXF A;  2GTJ A;  3BE3 A;  2WSE E;  3EG2 A;  2DXB A;  3HL8 A;  1YP5 A;  1Q86 U;  2JJ9 A;  4M75 F;  2QA4 Q;  3E2U A;  3M55 A;  4C8Q G;  2OTL A;  2QDY B;  1ZUK A;  3HKS A;  2JTM A;  2RHU A;  1RAB B;  4L6V 5;  1F1B B;  2P0Q A;  3LX7 A;  5GAM h;  5DLO A;  1AVZ C;  2EQM A;  3OYI A; 
#chains in the Genus database with same CATH homology
 3VS0 A;  2DE0 X;  5ECA A;  2DBM A;  1K0X A;  1KIK A;  1YWO A;  2AZS A;  1QKW A;  1X69 A;  4CC2 A;  3VRZ A;  1RI9 A;  2KRM A;  3I35 A;  3H0I A;  4J9F A;  1CKB A;  2RQU A;  2EPD A;  2YT6 A;  1KSW A;  1YCS B;  4J9B A;  1T0J A;  1NLP C;  3VRY A;  2DIL A;  2LZ6 B;  5IXB A;  1UJY A;  4HCK A;  1KJW A;  3GBQ A;  2GQI A;  4J9H A;  2LNH B;  1MV3 A;  3THK A;  2I0N A;  2L3Q A;  1ABO A;  2FRW A;  4Z89 A;  1G2B A;  2EGA A;  2DLP A;  4J9E A;  3UA7 A;  1U5S A;  2XMF A;  4HXJ A;  1UGV A;  4RTX A;  4OMM A;  2JMC A;  4DEX A;  4IIM A;  4AFZ C;  1MV0 B;  2CSQ A;  3M0R A;  3REB B;  1QWE A;  1Z9Q A;  2HDA A;  4RUG A;  1PRL C;  1BBZ A;  1AD5 A;  1T3L A;  5FWC A;  4OMQ A;  1K76 A;  2GGR A;  2K9G A;  2VKN A;  2VWF A;  3I5R A;  2DM1 A;  2O31 A;  1QKX A;  2KT1 A;  1M3C A;  3H0F A;  1GCQ A;  1WXB A;  2AK5 A;  5IHK A;  1K0S A;  1SRM A;  2DRK A;  3TVT A;  4RTT A;  2GNC A;  1WDX A;  1B07 A;  2JW4 A;  1X2K A;  2YUP A;  1I1J A;  4AFQ C;  1WX6 A;  2YSQ A;  2FPD A;  2ENM A;  2A08 A;  2KRN A;  2C0T A;  4M4Z A;  1NM7 A;  1OPK A;  1SSH A;  2C0O A;  2M51 A;  2HCK A;  3NHN A;  2LCS A;  2LX7 A;  2RN8 A;  1BK2 A;  4LN2 A;  1T3S A;  1W1F A;  2E5K A;  2CT3 A;  2SRC A;  4JJB A;  4AG2 C;  3TSZ A;  2JS2 A;  2HSP A;  1XOV A;  1JQQ A;  2RQV A;  3EG0 A;  5I22 A;  1X27 A;  1G83 A;  4Z8A A;  2KT8 A;  1VYT A;  2AKK A;  4JZ4 A;  1YN8 A;  4AFS C;  1X6G A;  1NYF A;  1YWP A;  4Z88 A;  1PKT A;  2LJ1 A;  2FO0 A;  2O2O A;  1IO6 A;  1VYV A;  1A0N B;  1WXT A;  2RQT A;  1WI7 A;  1I07 A;  4J9D A;  4JZ3 A;  2FG0 A;  1ZBJ A;  1ARK A;  1OEB A;  1UFF A;  1PWT A;  5IHN A;  1JXO A;  1N5Z A;  2CUB A;  3VS1 A;  3VS7 A;  1SPK A;  2DNU A;  1U06 A;  1RLP C;  1GFD A;  2GTO A;  2JXB A;  1GL5 A;  4FSS A;  1UHF A;  1K4U S;  2YUO A;  3EG3 A;  2G6F X;  3A98 A;  2FRY A;  1OOT A;  2LP5 A;  2O88 A;  2DL3 A;  5FW9 A;  4JJC A;  4CC7 A;  1PRM C;  4E6R A;  3TSW A;  2CRE A;  4LUD A;  3ZL7 C;  2JT4 A;  2DL7 A;  5GJW B;  1FYN A;  1AZE A;  4WCI A;  2F2V A;  2D0N A;  2OAW A;  1I0C A;  2CT4 A;  5IH2 A;  1MUZ A;  3QWY A;  2RPN A;  4CC4 B;  1CKA A;  2JTE A;  4RTZ A;  4J9I A;  2RQR A;  1Y0M A;  2A36 A;  1OPL A;  2EGE A;  3O5Z A;  1H92 A;  1PKS A;  2H8H A;  3C0C A;  3I9Q A;  1WLP B;  2KYM A;  5FWB A;  4AG1 C;  2X3X D;  1ZSG A;  2CH4 W;  3VS4 A;  3I5S A;  3EHR A;  1SHG A;  1JU5 C;  2YUQ A;  1WFW A;  3EG1 A;  4JJD A;  5EC7 A;  2EYZ A;  2BZY A;  2RQW A;  2KRO A;  1TG0 A;  2DMO A;  1WA7 A;  2EW3 A;  2V1Q A;  3M0S A;  4LNP A;  3EGU A;  2J6O A;  2OI3 A;  1X43 A;  4QT7 A;  1YNZ A;  4DEY A;  2X3W D;  2AKL A;  3M0P A;  3H0H A;  1X6B A;  2AZV A;  2ESW A;  2JS0 A;  4Y92 A;  1E6H A;  4GLM A;  1ABQ A;  2EKH A;  2KNB B;  2EYY A;  1PNJ A;  2RNA A;  3ULR B;  1AWJ A;  3UF4 A;  4R0K A;  3UA6 A;  2DVJ A;  2A37 A;  2JM8 A;  1W70 A;  3M0T A;  1UUE A;  2EVR A;  2RF0 A;  1NEB A;  1E7O A;  2DRM A;  4HVV A;  1K1Z A;  2DYB A;  1SEM A;  1TUC A;  2MOX A;  1ZUY A;  1UDL A;  1X2Q A;  1ZX6 A;  1NLO C;  2ROT A;  2MIO A;  3VS5 A;  1RUW A;  4RTV A;  1GBR A;  1VA7 A;  2DA9 A;  2K7A A;  1JEG A;  2A28 A;  1WXU A;  3VS6 A;  4J9G A;  1PHT A;  2V1R A;  2K6D A;  3REA B;  2EQI A;  4J9C A;  4ESR A;  4LE9 A;  2VVK A;  2L3S A;  2NWM A;  2ABL A;  1B3Q A;  4CC3 A;  1T0H A;  2KGT A;  3JV3 A;  3NMZ C;  2DJQ A;  2J06 A;  1BU1 A;  2FPF A;  2OJ2 A;  4F16 A;  3VS2 A;  1HSQ A;  1AWO A;  2W0Z A;  1HD3 A;  1M27 C;  3PE0 A;  2B86 A;  2J6K A;  2IIM A;  4HVU A;  4F14 A;  4HVW A;  3SEM A;  1KFZ A;  1U3O A;  1GCP A;  2J6F A;  2LMJ A;  2EBP A;  5IHI A;  1QWF A;  1J3T A;  4F17 A;  2KBT A;  2W10 A;  1ZLM A;  2O9S A;  1QLY A;  4RTU A;  4X1V A;  2EYW A;  1ZUU A;  1UHC A;  2SEM A;  2ROL A;  2M0Y A;  2DL8 A;  2D8H A;  2FPE A;  5HCK A;  4ZNX A;  1AOJ A;  1WIE A;  2D1X A;  4OMP A;  2L0A A;  1V1C A;  1GBQ A;  2K2M A;  1NG2 A;  1Y57 A;  4OMN A;  2NUZ A;  2DL4 A;  2J7I A;  1NEG A;  2D8J A;  1UTI A;  4JPB W;  2BZ8 A;  2EGC A;  1BB9 A;  2EYX A;  2QDL A;  2BTT A;  3EHQ A;  2YDL A;  2PTK A;  2GBQ A;  2LJ0 A;  1JXM A;  2JM9 A;  2F2X A;  1SRL A;  4K11 A;  4KRT A;  3RBB B;  2KE9 A;  1H3H A;  4GBQ A;  3KFV A;  2C0I A;  4D8D A;  1EFN A;  1TUD A;  1AWX A;  2BZX A;  3SHW A;  1WYX A;  2JMA A;  2J05 A;  1QCF A;  2HEQ A;  1H8K A;  3U23 A;  2KR3 A;  2LJ3 A;  2L3P A;  2L2P A;  2DL5 A;  1OV3 A;  1UE9 A;  2DF6 A;  2K79 A;  2P4R A;  4IIO A;  2MCN A;  3R6N A;  5I11 A;  3H41 A;  2CUD A;  2PNI A;  3LH5 A;  4D8K A;  1M3B A;  2FEI A;  1VYU A;  1AWW A;  2KXC A;  4OMO A;  2HBW A;  1UJ0 A;  2ED1 A;  3VS3 A;  2KXD A;  3M0U A;  2CSI A;  1UG1 A;  4A63 B;  2O9V A;  4LUE A;  1JO8 A;  2KYB A;  3M0Q A;  2KRS A;  1S1N A;  1CSK A;  1M3A A;  2CH4 A;  5GJV B;  1FMK A;  4RTY A;  2CDT A;  2LQW A;  1AEY A;  3PVL A;  4OML A;  4ORZ A;  5L23 A;  2PZ1 A;  3QWX X;  1M8M A;  4EIK A;  2ED0 A;  3CQT A;  1W6X A;  4AFU C;  3FJ5 A;  5IXF A;  4RTW A;  2GTJ A;  2LQN A;  2RMO A;  1LCK A;  1GFC A;  3EG2 A;  1K9A A;  3PVQ A;  1HJD A;  2ECZ A;  1YP5 A;  3IQL A;  3NPF A;  1E6G A;  1RLQ C;  1NYG A;  2YUN A;  3NGP A;  2K3B A;  1ZUK A;  2F2W A;  1GCQ C;  2DBK A;  1M30 A;  1SHF A;  3UAT A;  1AZG B;  2KEA A;  1GRI A;  1Z9Z A;  1AVZ C;  2DX1 A;  1UEC A;  3RNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...