1UG1A

Sh3 domain of hypothetical protein baa76854.1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1010 protein
publication title NMR structure of SH3 domain of Hypothetical protein BAA76854.1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ug1A00
3VS2A 1UTIA 1HD3A 2JW4A 4J9CA 4F14A 2A28A 2CSIA 4CC4B 2F2XA 1GBRA 1GBQA 1SEMA 1ZBJA 2SEMA 4J9BA 2PTKA 2DL8A 3QWYA 1PRMC 2W10A 4OMPA 3M0RA 1UDLA 1B3QA 2EYZA 4OMLA 1OPKA 1QCFA 2D8HA 2BZ8A 5GJVB 4CC3A 1CKBA 2L3SA 2W0ZA 3I9QA 4J9GA 2FG0A 3TSZA 2ROTA 1LCKA 1W6XA 2EBPA 4ESRA 1MV3A 2LP5A 3UF4A 4CC2A 1X2QA 2KT1A 2ESWA 1NG2A 1H92A 2H8HA 3CQTA 1UGVA 1WFWA 1WA7A 5GJWB 1GRIA 2RPNA 1SRLA 1RLQC 4IIOA 2QDLA 4QT7A 1MV0B 2DNUA 4X1VA 4E6RA 2XMFA 2DBMA 1NYGA 1Z9ZA 2LZ6B 2FRYA 1WX6A 2J7IA 3PVQA 1E7OA 1BB9A 2LJ0A 4AFQC 2GGRA 5I11A 2V1QA 1GL5A 1PNJA 1ZUUA 2JT4A 4LE9A 2ROLA 1YN8A 2CH4W 1E6GA 2CUBA 2DRMA 1PHTA 3M0TA 2A37A 1KJWA 4F17A 4RUGA 3QWXX 1UE9A 5ECAA 3SHWA 1QKWA 3JV3A 1GFCA 4DEXA 2DF6A 4GBQA 1YWPA 4DEYA 2K3BA 1XOVA 2LJ3A 1AWWA 1G2BA 1YWOA 4Z89A 1SHFA 2KRSA 2F2VA 2KR3A 1TUDA 2B86A 2GQIA 1X69A 1JQQA 2V1RA 3H0HA 2GTOA 2CDTA 2LNHB 2O9VA 2DE0X 2RQTA 1I0CA 2FRWA 2M0YA 3NMZC 1UG1A 4A63B 1QKXA 2YUQA 4J9EA 2EVRA 2JMAA 3TSWA 3EG2A 1RLPC 1AWOA 1YP5A 1ZX6A 3C0CA 1RUWA 2NUZA 2CT3A 1QWFA 4AFSC 1KIKA 2RMOA 1M3BA 3M0UA 1PKSA 1V1CA 2X3WD 1SRMA 3VS1A 1U3OA 1HSQA 1GCQA 5IXFA 4OMMA 4F16A 4HVUA 1M30A 2KYMA 3H41A 1K4US 2LX7A 2FPDA 1NLPC 4RTXA 1Y0MA 2J05A 1ABOA 3M0SA 4LNPA 1W70A 5HCKA 4D8DA 1AWJA 4JZ3A 2LCSA 4RTWA 2KT8A 2DX1A 2DL5A 1T3SA 2KXDA 3EG3A 1BU1A 1WXUA 3A98A 2DILA 3THKA 2C0OA 3M0QA 2JMCA 4J9DA 1T3LA 1X6GA 2A08A 1NEGA 1JO8A 1OOTA 1ARKA 1UJ0A 1K0XA 2JTEA 4JPBW 2J6FA 2AZVA 2YSQA 2BTTA 2FPEA 1JXOA 3NGPA 1QLYA 2KE9A 3UA7A 3NPFA 4JJCA 1K76A 2EGCA 3EHQA 3H0FA 2GBQA 3VS7A 2K9GA 1RI9A 2PNIA 2LQWA 1OV3A 2CT4A 2EYXA 2K7AA 1M8MA 1WDXA 4IIMA 1OEBA 4LUDA 4K11A 2RF0A 2DBKA 2EYWA 2JS2A 2M51A 2HSPA 2YT6A 4AG2C 2KNBB 5I22A 1VYTA 2HBWA 1ZLMA 1BK2A 1QWEA 3FJ5A 1NM7A 2J6OA 1VYVA 1AVZC 4OMQA 4AFUC 1ABQA 1SHGA 1VYUA 2I0NA 2CH4A 2K6DA 1AOJA 1HJDA 2YUPA 3GBQA 1WXTA 1TUCA 3LH5A 2J06A 2J6KA 4J9FA 2NWMA 4RTZA 2OI3A 2O9SA 2AKLA 1AZEA 2FEIA 3M0PA 2KEAA 4RTUA 1WIEA 5IH2A 1EFNA 2DMOA 2EKHA 3VRYA 4RTVA 2C0IA 3U23A 2D0NA 3UA6A 5IXBA 1ZSGA 1Z9QA 2ED1A 1KSWA 2LQNA 3H0IA 2LMJA 4EIKA 2HEQA 2EGEA 1JXMA 3I5SA 2RN8A 4OMNA 2AK5A 1WI7A 3SEMA 1UFFA 1AD5A 2DYBA 2YUOA 3RNJA 1AEYA 2RQRA 2DRKA 1YNZA 1PWTA 2EYYA 2ED0A 2MOXA 2ABLA 2DL4A 2RQUA 3EHRA 3ULRB 2DM1A 2CSQA 4RTYA 2O31A 2SRCA 2PZ1A 2KRMA 2K79A 2P4RA 4Z8AA 3I5RA 1MUZA 2A36A 2DA9A 2EPDA 2EW3A 3R6NA 1IO6A 4Z88A 2KROA 2KYBA 2BZXA 3NHNA 2X3XD 1OPLA 1M27C 1W1FA 3PE0A 4RTTA 1NYFA 2DL3A 4JJBA 5L23A 2KBTA 1WYXA 2AKKA 2DL7A 2RNAA 3REAB 3RBBB 2CREA 2ENMA 2RQWA 1ZUKA 1UHCA 2DJQA 1PRLC 1X6BA 2ECZA 2MIOA 1E6HA 5IHKA 1K9AA 1N5ZA 3KFVA 3VRZA 4J9IA 2AZSA 2DVJA 1UJYA 5EC7A 2K2MA 2L3QA 1GCPA 1JEGA 2HCKA 4ZNXA 2KRNA 2DLPA 4D8KA 1G83A 4HXJA 1U06A 1VA7A 2VWFA 1SSHA 2L2PA 1J3TA 1CKAA 3EGUA 2BZYA 3UATA 2JXBA 1A0NB 4LN2A 1H8KA 2G6FX 2GNCA 2EGAA 5FWCA 4Y92A 3VS4A 4JJDA 2YDLA 4ORZA 3REBB 2L3PA 3TVTA 4AFZC 4AG1C 2KXCA 1K0SA 3VS6A 1M3AA 1FYNA 4WCIA 2KGTA 2YUNA 5IHNA 1YCSB 4HVWA 1TG0A 2OAWA 5FW9A 3PVLA 1B07A 1BBZA 1UHFA 2MCNA 2LJ1A 1NLOC 3EG0A 2O2OA 2O88A 2RQVA 1NEBA 3I35A 4HVVA 1X2KA 4LUEA 4R0KA 1U5SA 2VVKA 1UECA 1CSKA 1T0HA 1Y57A 2FO0A 1S1NA 5FWBA 1ZUYA 1WXBA 1AZGB 3O5ZA 4J9HA 2D8JA 1JU5C 1UUEA 3IQLA 3VS3A 1T0JA 2L0AA 1I1JA 1WLPB 4JZ4A 2FPFA 3EG1A 4GLMA 1I07A 2EQIA 1X43A 1SPKA 2VKNA 1H3HA 2CUDA 3ZL7C 1GCQC 2IIMA 2E5KA 4M4ZA 1FMKA 2C0TA 3VS0A 2JS0A 2HDAA 1AWXA 2JM9A 1X27A 2GTJA 1PKTA 5IHIA 1KFZA 2JM8A 1M3CA 2OJ2A 1K1ZA 4FSSA 2F2WA 3VS5A 4KRTA 4OMOA 1GFDA 4CC7A 2D1XA 4HCKA
chains in the Genus database with same CATH superfamily
2QGGA 3VS2A 1YJNT 2COWA 2CYZB 4O6JA 2XKOC 3OYHA 4FYWB 2HKQB 4MZPA 4XTXA 4J9CA 7AT1B 1YI2A 1VQ6A 3PGGA 1KHCA 1OULA 3QPHA 1GBQA 4J9BA 2PTKA 1YJ9Q 1HXDA 2QQSA 2W10A 2YLBA 1H641 3M0RA 3OS1A 2X9HA 4OMLA 4C92B 1BI0A 4XAXB 3SWNC 5IN1A 1QCFA 4CC3A 2BZ8A 2VB6A 1CKBA 2L3SA 4KBMB 1LCKA 2XDDA 3PIPA 1QP3A 1I5LA 1MV3A 3UF4A 1PM3A 1X2QA 1F1BB 2RB6A 4J7FA 2ESWA 1NG2A 1QVGP 1VQ4A 4PJJA 2HL5C 3CQTA 1GRIA 5DLQE 1D09B 4EDUA 3MEVA 1SRLA 1RLQC 4IIOA 3OSVA 1WJSA 2M02A 4X1VA 3OS2A 4E6RA 4J6WA 5LJ3d 2DTHA 1VUBA 1VQ8T 3JCMV 2JTFA 3RKYA 3PVQA 1E7OA 1VQ5Q 1BB9A 2PQWA 4M75D 3JCMQ 1K9MU 3JCMX 3I56Q 1BKBA 4LE9A 2QASA 1M8VA 2IG0A 2CUBA 1E6GA 1TS9A 2DRMA 2EQUA 4M77D 1K73R 3DLMA 1Y96B 4MZMA 1UE9A 2F5TX 2H3EB 2EYQA 5ECAA 3SHWA 1YITA 3JV3A 3OYIA 1PCXA 5J3BA 4QVDA 3CC4T 1YJ9T 1XOVA 2LJ3A 2R58A 2A7YA 4M75G 5I2MA 1G2BA 2NUTA 1YWOA 2L8DA 2HL3A 3OYNA 1RAGB 1TUDA 2GQIA 4FM4B 1JQQA 3H0HA 4M77G 2DE0X 4NL3A 2RQTA 1XNIA 3CCRA 1QKXA 3OB9A 1ZBXA 3A8OB 3FJPA 5GAMg 4JRQA 2O4XA 1YP5A 1FMVA 1Y07A 1JB0E 2X4YA 2RM4A 1RUWA 1M3BA 4FT2A 1V1CA 4LDWA 2CP3A 3JB9D 4BE1A 1I8FA 3OYEA 2FZCB 2K2VA 1M30A 2FPDA 3JCMd 3BFMA 3OYMA 1RAIB 3M0SA 4D8DA 1AWJA 2OAUA 5LJ3e 4N0AC 1VIFA 2BKDN 4RTWA 3ZEHA 2KT8A 3G1JA 2DX1A 3JB9G 1W2BP 1YBYA 1M90U 2ZPEB 3M0QA 4N4GA 2JMCA 2A08A 3HPWA 4J5YA 3QXEB 1K9MR 3PMIA 2DXTA 3PTAA 3OYCA 3MP1A 3SWNA 1K0XA 2JTEA 3CBMA 5GMKj 3M55A 3AT1B 4BE0A 1YIJQ 3HHTB 4ANJA 2FB7A 3SB2A 3OYBA 3QYHB 4OB3B 5J39A 4JJCA 4E7SA 1VQNA 2DEQA 2K9GA 2PNIA 2L3RA 1VQOA 2QEXA 4J8OA 4EMGA 5GAMh 4DBQA 3GNFB 3OYLA 3EGXB 2EAYA 5KYWB 2EYWA 2M51A 3V8LA 5I22A 1VYTA 3WXMB 4R56A 2RK1A 1YI2Q 1KC8C 1BK2A 1VQ6Q 2E41A 3FJ5A 3R6OA 3TREA 1AVZC 4M75E 4AFUC 3CMAQ 1SHGA 1VYUA 3VU3C 3PMTA 1TUGB 3LWHA 1VQLT 2CH4A 2K6DA 4MZTA 1AOJA 4L6V5 2YUPA 3GBQA 2DD5A 4M77E 1WXTA 3LH5A 3JCMe 3L2ZA 4J9FA 5GAMf 1MMAA 2K3YA 2O9SA 2VUBA 4LDVA 2AKLA 5GAN4 4L59A 5GMKm 4RTUA 4C92F 3JB9H 1VQ4Q 3I55A 3RMQA 4XTZA 2DMOA 2EKHA 3VRYA 2RD1A 4RTVA 1D1BA 2CZ1B 4FT4A 1BYMA 2KDSA 3UA6A 5LJ3j 4XQ3A 3HRTA 2QQBA 3L2RA 2LQNA 3H0IA 4C5HA 4HCCA 4EIKA 1Q86C 3OW2A 4OMNA 3EGDB 1UFFA 4HA8A 1AD5A 4GY5A 1N9RA 1RAHB 3RKWA 1QVFS 2EYYA 2ED0A 3X24B 1VIEA 3ULRB 3X26B 4RTYA 3RESA 3V7CA 5GMKi 5GAOp 2CP7A 2SRCA 2DTOA 2PZ1A 2P4RA 4Z8AA 2DA9A 4N4IA 1YCYA 1YITQ 4Z88A 1AT1B 1TU0B 2BZXA 2E3HA 5CQXA 2BE9B 1V76A 3CMAT 3PNWC 3VJPA 1RL2A 2DYIA 3H8ZA 4JJBA 3H9NA 3J81E 4QVZA 4ZTJA 4L5GA 4N0AA 2P0QA 1WYXA 2DPPB 2DL7A 3REAB 4PJOC 5DM7R 1PRLC 2XHCA 3D7SB 4XU2A 3G6EA 1KC8R 4XK8E 1N5ZA 3KFVA 3VRZA 4A4GA 1UJYA 1G5VA 5A0DA 3CCUA 3JCMc 2KRNA 5C6SA 4OB0B 3X20B 3GIBA 4OGEA 1U06A 3OBWA 1V29B 5GAOm 3CCMT 1KD1U 1M1FA 4E7JA 3JRZA 3CC2A 3CCJQ 3OA6A 2PVOB 2GNCA 4ZTFA 5FWCA 3VS4A 2WSEE 2BE7D 5FU7C 3BE3A 5A2QE 2EIFA 1NPPA 2A3LA 1YJWT 1Q86R 3CC7A 3VS6A 1M3AA 3CCSA 1FYNA 4WCIA 3QJYA 2YUNA 3CMET 5GMKl 3LH0A 4ZN3A 4C5IA 5KYXA 3GP8A 2OAWA 1BBZA 1BCMA 4C0FA 1LOJA 4JDSA 2X35A 2O2OA 3DB4A 2O88A 2RQVA 1NEBA 3I35A 1X2KA 4LUEA 4R0KA 2DTIA 1G3TA 1T0HA 2HQXA 1ZUYA 4C8QB 1PSEA 4J9HA 1BI1A 2QEXQ 3QZ9B 2I2LA 4BI8B 3VV0A 1ZSZC 2QI2A 1X43A 3J80E 2VKNA 5GAOr 1QQJA 2E70A 1TWBA 2KK4A 2OTJA 3CCJT 2HDAA 2D9TA 4M78B 1C0MA 4ME7A 2JOYA 2RJEA 1PKTA 5IHIA 1M3CA 4IUTA 1TOVA 4XU3A 4HCKA 4J7IA 3EGDA 4JRKA 1Y71A 3CEYA 2M16A 1HD3A 2AHJB 4EMKB 2F1LA 1BIBA 2A28A 2V26A 3ER0A 2O01E 4F7UB 2WSFE 4M7DB 4NOYA 3QWYA 4II1A 3EG9B 1OZ3A 4OMPA 1UDLA 2EYZA 2KAFA 5LJ5e 4EMKC 2JJ9A 4PFPA 2D8HA 4RG2A 4IURA 1QCNA 2FG0A 2QQAA 1W6XA 2PUOB 5A0LA 5KYYB 3PT9A 2EBPA 4PJOA 1R0CB 3A8GB 2LP5A 4CC2A 2DZCA 1LVKA 2KT1A 5GAOl 4MDXA 3GLXA 2DAQA 1QMCA 2E4HA 2E64A 4X9DA 3CXCA 1UGVA 2K4YA 3QJ6A 5GJWB 2P84A 1IREB 4OGCA 3KXTA 1MMDA 4PK4A 5LJ3g 2QDLA 4OB2B 4QT7A 1MV0B 3QG1A 1JJ2A 2DNUA 2GF7A 2XMFA 2DBMA 2LZ6B 4NS5A 2DKGA 3CCEA 2MF2A 5AT1B 4C0DB 1M1KC 1GL5A 2YLCA 2JVVA 2JT4A 4N4HA 3F70A 1YN8A 2CH4W 3WVDB 2A37A 1KJWA 4F17A 4M7AB 5CIUA 4RUGA 2MK5A 5D6YA 3G71A 3X25B 1GFCA 3GPLA 5FRMA 4GBQA 1YWPA 2BUDA 2C06A 3INZA 2ZPBB 2LT4A 1PG5B 3ZBDA 1SHFA 3CCUQ 1QP2A 1PD0A 2V1RA 3CCVQ 3S3NA 1ZA1B 3CCLT 2O9VA 4AT1B 3OW2S 1WGSA 4KT0E 1K73C 3HKSA 3NMZC 4PJMA 5FU6C 2LRQA 2FVUA 2YUQA 1SKUB 4A4KA 3LGFA 1RAFB 3EG2A 2JZ2A 5LJ5j 3QUIA 3C4SA 1KIKA 2EQKA 2GQVA 3M0UA 1PKSA 1ZSZA 3CBOA 2LDMA 1PSFA 1OX8A 1VQMT 1SRMA 9ATCB 1WHKA 3CC7Q 3CCSQ 5GANh 5A0GA 3JB9I 3L2WA 2F5KA 1K8AU 2KYMA 3H41A 4Z02A 2LX7A 2E6ZA 4RTXA 4KUIA 3CCQQ 2J05A 1BIAA 4LNPA 4E7HA 5GAN8 2NUPB 2HSEB 2GFAA 2DL5A 3EG3A 1BU1A 1WXUA 2DILA 4EMHA 2DD4A 2C0OA 4J9DA 3LWIA 1T3LA 5GANf 2KMTA 4A4HA 1NEGA 2XK0A 1NPRA 3LGLA 1D1AA 1ARKA 2CP5A 1FMWA 3M58A 2K57A 4C92C 1M1KR 2DEUA 3CCVT 3VUZA 2AZVA 2BTTA 4C8QF 2OTJQ 4BDZA 1OQKA 2FPEA 1QVFP 1D3BB 2VGNA 2KE9A 4WTOB 1ZA2B 3EHQA 3H0FA 3G7ZA 2GBQA 5HK3A 3SD4A 2JNGA 4J6YA 3BY7A 4JLGA 3M54A 5KYUA 3OYJA 4E7ZA 2OTLT 5GAOq 1OEBA 4LUDA 1K9MC 3EH2A 4K11A 2RF0A 4M78F 2JS2A 3VUBA 4LDYA 4AMCA 1KQSA 2YT6A 2AT1B 2KNBB 3OYGA 1ZLMA 1I5OB 2HMAA 2E5QA 1Q81U 4RCBA 3CCQT 1B7TA 1ZHIA 2HKNA 3JAME 1LJOA 1TUCA 3MKDA 4F7UF 2NLUA 4M7DF 4IUUA 3A1PA 4RTZA 4E7KA 4LD6A 2LC4A 2K5LA 3RMSA 2KEAA 3PIOA 3AHUA 5IH2A 5HKCA 4GLKA 4PJOD 2DJZA 3DB3A 2D0NA 1LPLA 2ZGWA 2RJCA 2ED1A 1KSWA 4JLIA 2GFUA 1LNXA 1O75A 2EGEA 2AK5A 1WI7A 3RNJA 3CCEQ 1YNZA 4PFZA 3VYGA 1PWTA 4ZGDB 2MOXA 4PJOG 3M4GA 3EHRA 3META 2XICA 4LXCA 1VQ5T 5GAN5 3I56T 2KRMA 3A8HB 2LT1A 4UC4A 2COZA 1KK7A 1DJ7B 1M2OA 4IUVA 3QHSA 3NHNA 4Y28E 2QQRA 3CD6A 1WHHA 2RHUA 5FLXE 4ELYC 1NYFA 1M90C 4M7AF 1VQ7A 1R0BG 4Y91A 3G4SA 4LDUA 2ENMA 1UHCA 1RACB 5D6WA 3J7AF 3QZ5B 2VGMA 5J26A 2XIDA 4JRIA 1Q81R 2NUPA 2HQEA 1IGUA 1EIFA 2LTOA 3FB9A 2CP0A 2DVJA 3S3OA 5EC7A 3KUFA 2V8KA 2L3QA 1JEGA 4C92A 5GAN6 1G3SA 4D8KA 2QTVA 4X34A 4TVRA 3M56A 1CKAA 1BI2A 1J3TA 4VUBA 2YXYA 1VQPA 4QQDA 2JXBA 2QA4A 3GF5A 1SSFA 2P0KA 4DBHA 2G6FX 4DBFA 4DBRA 5HK0A 3T9NA 4JJDA 2YDLA 4ORZA 1B34B 3JSCA 1N6AA 5IT9E 1QCOA 4EPCA 2KGTA 5IHNA 1GXIE 1YCSB 2QGFB 4ZGJB 1UHFA 3OMGA 4JS4A 4BUGA 2LJ1A 1NLOC 1UGPB 2D0QB 3SFMA 4E7IA 1Y96A 2IPOB 1X01A 1CSKA 1Y57A 2RA2A 2K3XA 4PJOE 2DXBA 1S1NA 5FWBA 1YIJT 1AZGB 2MMPA 4HT8A 1I1JA 3BDUA 1M90R 3MEWA 4GLMA 2X51A 1SPKA 4M75B 2RH2A 1H3HA 1UGSB 1PD1A 1R8OB 1GCQC 4M4ZA 3VYHB 2JS0A 5M9OA 4IKFA 1AWXA 2DVEA 1YI2T 3OS0A 4M77B 3NTKA 4LD9K 1W4SA 1VQ6T 1U1TA 4V2SA 2F2WA 1UGQB 3L2QA 4KRTA 4OMOA 1VQKA 3C12A 1UTIA 1YFNA 1S72A 2JW4A 4F14A 2YRCA 3A8MB 4CC4B 2F2XA 1N8RU 1GBRA 1ZBJA 2DL8A 1PRMC 1WJQA 3CCRQ 2X4JA 4XTWA 1YJNA 1VQ4T 2QXFA 5GJVB 3OW2P 2W0ZA 2M9UA 3A8LB 4J9GA 2MPXC 4P5NA 5IAYA 5CKBA 4BI3A 3QO3A 3NTIA 4HKEA 2QAZA 1H92A 4JRPA 2RPNA 4FW1A 1M1GA 2QTXA 1ACMB 2Z0WA 1KQSS 5D7UA 1TSFA 4DQ2A 1Z9ZA 3CD6Q 1Q82U 2FRYA 1WX6A 2J7IA 1M2VB 2LJ0A 1YITT 1VQ7Q 2GGRA 5I11A 5LJ5d 3G4SQ 2D6FA 2CKKA 3P8DA 1PHTA 4BE2A 5CK9A 2K5IA 3EGXA 5GAMe 5KYWA 1VQ8A 3TCJA 6AT1B 2X4WA 2VXEA 1QKWA 1Q7YU 3CCRT 1MMGA 1AWWA 2F69A 4FSXA 3QDFA 1M9SA 1B34A 5CR2A 5GAN7 2KR3A 2JUFA 2LQKA 1VQNQ 2B86A 1X69A 1VQOQ 3OYYA 2GTOA 2LNHB 1XQHA 1I0CA 4PL6A 3CC4A 4OVAA 1YJ9A 1UG1A 4C92D 3UDCA 3OYDA 4A63B 3MJXA 4PNOA 2QA4Q 2XDPA 2JMAA 1FX7A 4RMOA 1KHIA 4C8QC 3TSWA 3L42A 1MMNA 2HBPA 2KQWA 3C0CA 4FW2A 2NUZA 2CT3A 4AFSC 2RMOA 2MWOA 4OF1A 2B8AA 2X3WD 3VS1A 5CAIA 1MGQA 1GCQA 2R5AA 4C92G 5FRNA 3CD6T 4OMMA 2FL7A 4M78C 4B9XA 3SDZA 1Q95G 1Y0MA 1ABOA 1SF9A 4XU1A 1W70A 3E2UA 3I55Q 4JZ3A 1MNDA 2EJ9A 2ZZDA 2LCSA 1HK9A 5EG2A 1KD1R 2HNIA 4HCBA 4PJNA 3A98A 3MP6A 2RI2A 4M7DC 2WACA 4C5EA 1JO8A 2L89A 2EJFA 2IVWA 1VQNT 5KE3A 1VQOT 4D6WA 1D0XA 2QEXT 2YSQA 4PLIA 5GAMj 1C1AA 1JXOA 1RABB 1U1SA 1QLYA 4A54A 3NPFA 4KH1B 3V7SA 4HT9A 4M75F 1OV3A 2CT4A 2EFIA 2EYXA 4FYYB 3HFOA 2M1HA 5GMKh 1OX9A 4IIMA 2DBKA 2HSPA 4AG2C 4M77F 1S72Q 1QWEA 3EFOB 1NM7A 4QKUA 2J6OA 1VYVA 5KE2A 2EQJA 2MAMA 1MNEA 2Y4XA 1TTHB 2NUTB 1ABQA 2XG8D 2LX9A 3RUXA 4XTVA 1YJNQ 1SG5A 4C0DC 3I55T 2I0NA 3G6EQ 1HJDA 3L2UA 2J06A 1NJIU 2J6KA 4M7AC 3OYKA 2HAXA 4BY6B 2FEIA 4R55A 5CKEA 1WIEA 3CXCP 1VQLA 4F04B 2C0IA 4DOWA 5IXBA 3CC2Q 4C5GA 3E1SA 2XI9A 4DOVA 1ZSGA 2V8IA 4BY6C 2RHIA 4JS5A 5KCHA 1JJ2P 2HEQA 3I5SA 3NTHA 3SEMA 4C92E 4MDWA 3URGA 3JB9F 3OYFA 2E3IA 2YUOA 1AEYA 2RQRA 1NBEB 1K73U 2RHZA 5LJ3h 3NFCA 3JCMg 1QVGA 2RQUA 4ZGEB 2BIVA 2ZPHB 4C8QA 3FLGA 2YHTA 3L2VA 5DY9A 3I5RA 2EPDA 2EW3A 3R6NA 1IO6A 1WHLA 2G3RA 2X3XD 3MPUB 2CZ0B 4RTTA 3PE0A 4M78A 2DL3A 4BI4A 5L23A 5LJ3f 3G6ET 3SWNB 5DLOA 3EAEA 2KBTA 3PFSA 3M59A 2JTMA 2H3JA 2RNAA 3RBBB 4CI0C 2RI3A 1XTDA 4LDXA 3CCUT 3CC4Q 3CMAA 4QVCA 4EMKA 4A53A 5IHKA 5CVIA 4F7UA 4M7DA 4J9IA 1U8RA 3CC2T 1X6OA 5FROA 3EG9A 2RI5A 2RJDA 2K2MA 4FU6A 1OU8A 2DERA 2HCKA 4ZNXA 1X75C 2DLPA 2MI6A 3C94A 3HP9A 2QK0A 4HXJA 4E2FB 2VWFA 1NJIR 5KYYA 4BB7A 2LQ8A 3EGUA 3KBGA 4JJNK 1ZQ1A 3CC7T 3CCST 1H8KA 1C6VX 3X28B 1Q81C 3MP8A 3QBYA 2EGAA 5GAOn 3JCMh 2L3PA 3TVTA 3CCMA 5GANd 2HQHA 2KI7A 2CP2A 5CKFA 1K0SA 1UEBA 1I4K1 4C0ZA 4O5VA 2DO3A 3FRNA 1TG0A 5I2SA 5GMKe 2XD0A 3FEOA 2MCNA 3JCMf 3EG0A 2FZKB 1YJWA 3EFOA 1K8AR 4BACA 4M7AA 3CMEA 2QG9B 1U5SA 1W2BA 1UECA 8AT1B 2OTJT 2LCCA 3GOXA 3HL8A 3VS3A 2ZPGB 2L0AA 2QQ9A 4JZ4A 1IGQA 1KQSP 1WQWA 4X9CA 3TQ7P 3MCAB 2MYSA 2DETA 4WF2A 1FMKA 2C0TA 3VS0A 1WHGA 1OU9A 2COYA 2JM9A 1JRIA 2GTJA 5GAN3 3G71Q 3H6ZA 3CPWA 1GFDA 1G8XA 4CC7A 2L5QA 1R77A 3HRSA 3CCJA 1HYOA 1VQ9A 1D0YA 2CSIA 2YRVA 4J6XA 4OB1B 1NE8A 3JCMW 2CZ6B 4XTYA 2FHDA 1SEMA 1VQLQ 2SEMA 5GANe 3N5BB 3M9QA 3E9FA 1B3QA 1OPKA 2HD0A 3OBYA 4FYXB 3S3MA 3I9QA 3TSZA 2QYZA 2ROTA 3CXCS 4KGVB 1D0ZA 2VV5A 1BI3A 4ESRA 2E1HA 2FZGB 4E7LA 1WQ7A 2LNVA 2RHXA 3EFRA 1JJ2S 4J83A 2H8HA 3HTRA 1WFWA 1WA7A 3CCET 5CKHA 3E9GA 4C8QD 1UGRB 3CPWP 1NYGA 3MEUA 3M53A 5LJ5g 2DK3A 4BD3A 1D3BA 2V8JA 5KYXB 3G71T 1QVPA 3TEEA 4OP0A 4AFQC 2V1QA 2DFUA 3V8JA 1PNJA 1ZUUA 2ROLA 1KC8U 4M78D 4KH0B 3M0TA 2PVGB 2KY9A 4C8QG 4A4FA 3RR6A 3QWXX 3MEAA 5CQYA 1G3YA 4DEXA 3RERA 2DF6A 4DEYA 2K3BA 4PLLA 2E6NA 2ZPIB 4Z89A 2KRSA 3RKXA 2F2VA 4M7DD 4M78G 4KULA 4IUQA 1TH7A 2CDTA 2EJGA 2E10A 3LW5E 3FDRA 2FRWA 2M0YA 4J9EA 2EVRA 3O8VA 5GANj 2CGHA 3JCMb 2OX7A 1P92A 1QVGS 3FC3A 1Q86U 3L1AA 1XJWB 1RLPC 3CCLA 1AWOA 1ZX6A 3P8HA 4OMFB 4ELZC 4F7UG 1QWFA 1YHQA 4M7DG 3CCMQ 3EH1A 5GAMd 1N27A 3UT1A 4M75C 2X4XA 3C95A 1U3OA 5KYNA 1HSQA 1OZ2A 5IXFA 4F16A 4HVUA 4XTUA 1RADB 3OMCA 2PUKB 1K4US 3UPUA 1NLPC 4M77C 5LJ5h 3QSUA 1D1CA 3WVEB 3LX7A 1N8RC 5HCKA 1VQMA 3HSBA 1YJWQ 2CS7A 4PJOB 3BW1A 3CMEQ 2YWWA 1T3SA 2KXDA 3THKA 1Y7XA 5C0MA 4M7AD 1X6GA 2ATCB 1IRXA 1OOTA 5LJ5f 1UJ0A 4MMKA 3DLLA 2HZYA 4JPBW 4QQGA 2J6FA 2E65A 4KUDK 2VYTA 3M57A 1KD1C 2R57A 1WZOA 2MWPA 1KQ2A 3NGPA 2EQMA 3DKMA 3OQ5A 3UA7A 5GAN2 1K76A 2EGCA 2VXFA 4M7AG 1AHJB 3VS7A 2KVQG 1PC0A 2AIRB 2NYSA 1RI9A 3CCVA 2LQWA 1Q82C 3VKIA 2K7AA 4YTLA 1M8MA 1WDXA 1WJRA 4C8QE 5FU7B 1N9SA 1VQ9Q 2HBWA 2WSCE 2GCXA 4PFOA 4C0GA 4OMQA 3GNGA 2OTLA 1FWZA 1OYXA 3QYGB 4M78E 1Q7YC 4KGXB 2EKOA 2EWNA 2NWMA 2OI3A 4Q5WA 3RIRA 5CCAA 4XU0A 3OSSC 1AZEA 1M5Q1 3CCQA 2RHYA 3M0PA 1EZZB 1W2BS 1QW1A 2JN0A 1EFNA 4E47A 3U23A 1VQPQ 4F7UE 4M7DE 3A5ZB 1Z9QA 1ZSZB 1N8RR 2DXUA 5HY6A 3M5AA 2LMJA 1JXMA 2RN8A 3JCMJ 2DYBA 1JBMA 4PJLA 2DRKA 3V8KA 2A0FB 2ABLA 1KG1A 2DL4A 3CPWS 2DM1A 3BDLA 5L8RE 2CSQA 3ZFJA 2M0OA 2O31A 4CRIA 1VQ7T 1M4ZA 2K79A 3EFSA 1I81A 3G4ST 1MUZA 2A36A 4RCCA 1VQ9T 2DZ9A 3MHXA 1BCOA 4M75A 2KROA 2KYBA 5LL6S 1OPLA 1M27C 1W1FA 1VQ5A 2RJFA 4HCZA 4NL2A 4M77A 3I56A 4ATOA 4PKCC 3FIFA 2KSSA 2AKKA 1Q82R 4FIBA 4DA4A 2CREA 2YRDA 2RQWA 1ZUKA 1O9SA 3CBPA 2DJQA 2E12A 1IHVA 4KGZB 1X6BA 2FYKA 2ECZA 2MIOA 1E6HA 4M7AE 3JB9J 2P0PA 1K9AA 2ZPFB 2AZSA 5KYUB 4FCYA 1VQPT 3CCLQ 2QA4T 2XDBA 1IB8A 2XU8A 1GCPA 1YHQQ 4QW2A 2RK2A 1Q7YR 2ZAEA 1VQKQ 5KCOA 4FL6A 1G83A 1VA7A 3CPFA 3P8BB 1SSHA 2L2PA 4RG8A 2BZYA 3ASKA 2CZ7B 3UATA 1WNLA 2R5MA 4FYVB 1A0NB 4LN2A 4B6MA 2DIQA 5GANg 1NZ9A 3E19A 3M4YA 2ZCFB 3UWNA 1VQMQ 4Y92A 3REBB 3HRUA 3JCMP 4AFZC 1OI1A 1RAEB 4AG1C 2VC8A 2KXCA 1M1KU 5CO7A 1EX4A 1NJIC 1H3ZA 2K5FA 1M2VA 4HVWA 4PJOF 3QIIA 2LCLA 4QQ6A 5FW9A 3PVLA 1B07A 1MHNA 2DXCA 1IZ6A 3OY9A 2O4XB 3LLRA 2LVMA 2PU9B 4HVVA 1IHWA 3OS5A 5FU6B 3Q1JA 8ATCB 3RDVA 3TU4K 2VVKA 2FO0A 2CP6A 4BDYA 2VASA 1WHMA 3S6WA 3LYIA 1TXQA 1WXBA 1G3WA 1UB4A 3O5ZA 2D8JA 2RO0A 1JU5C 1WPYA 3QDRB 1UUEA 4ZN1A 3IQLA 1T0JA 3OYAA 1YHQT 4RKUE 1WLPB 2FPFA 2PVDB 3V7RA 4JUVA 3EG1A 1FXXA 1I07A 2EQIA 2P4TA 1RAAB 2QDYB 1VQKT 1VOMA 2CUDA 3HFNA 3MO8A 3ZL7C 1K8AC 2IIMA 2E5KA 2Y90A 4MMLA 1YIJA 3QKJA 1RI0A 2DIGA 1IXDA 5AYFA 5KH6A 1KQ1A 5D6XA 1S72T 1VQ8Q 1QVFA 3ME9A 1X27A 5CKDA 5I21A 2OTLQ 1KFZA 2JM8A 2OJ2A 2Y4YA 4IUPA 1K1ZA 4FSSA 3VS5A 4B9WA 2D1XA 1WHJA 4A4EA
chains in the Genus database with same CATH topology
3VS2A 1UTIA 1HD3A 2JW4A 4J9CA 4F14A 2A28A 2CSIA 4CC4B 2F2XA 1GBRA 1GBQA 1SEMA 1ZBJA 2SEMA 4J9BA 2PTKA 2DL8A 3QWYA 1PRMC 2W10A 4OMPA 3M0RA 1UDLA 1B3QA 2EYZA 4OMLA 1OPKA 1QCFA 2D8HA 2BZ8A 5GJVB 4CC3A 1CKBA 2L3SA 2W0ZA 3I9QA 4J9GA 2FG0A 3TSZA 2ROTA 1LCKA 1W6XA 2EBPA 4ESRA 1MV3A 2LP5A 3UF4A 4CC2A 1X2QA 2KT1A 2ESWA 1NG2A 1H92A 2H8HA 3CQTA 1UGVA 1WFWA 1WA7A 5GJWB 1GRIA 2RPNA 1SRLA 1RLQC 4IIOA 2QDLA 4QT7A 1MV0B 2DNUA 4X1VA 4E6RA 2XMFA 2DBMA 1NYGA 1Z9ZA 2LZ6B 2FRYA 1WX6A 2J7IA 3PVQA 1E7OA 1BB9A 2LJ0A 4AFQC 2GGRA 5I11A 2V1QA 1GL5A 1PNJA 1ZUUA 2JT4A 4LE9A 2ROLA 1YN8A 2CH4W 1E6GA 2CUBA 2DRMA 1PHTA 3M0TA 2A37A 1KJWA 4F17A 4RUGA 3QWXX 1UE9A 5ECAA 3SHWA 1QKWA 3JV3A 1GFCA 4DEXA 2DF6A 4GBQA 1YWPA 4DEYA 2K3BA 1XOVA 2LJ3A 1AWWA 1G2BA 1YWOA 4Z89A 1SHFA 2KRSA 2F2VA 2KR3A 1TUDA 2B86A 2GQIA 1X69A 1JQQA 2V1RA 3H0HA 2GTOA 2CDTA 2LNHB 2O9VA 2DE0X 2RQTA 1I0CA 2FRWA 2M0YA 3NMZC 1UG1A 4A63B 1QKXA 2YUQA 4J9EA 2EVRA 2JMAA 3TSWA 3EG2A 1RLPC 1AWOA 1YP5A 1ZX6A 3C0CA 1RUWA 2NUZA 2CT3A 1QWFA 4AFSC 1KIKA 2RMOA 1M3BA 3M0UA 1PKSA 1V1CA 2X3WD 1SRMA 3VS1A 1U3OA 1HSQA 1GCQA 5IXFA 4OMMA 4F16A 4HVUA 1M30A 2KYMA 3H41A 1K4US 2LX7A 2FPDA 1NLPC 4RTXA 1Y0MA 2J05A 1ABOA 3M0SA 4LNPA 1W70A 5HCKA 4D8DA 1AWJA 4JZ3A 2LCSA 4RTWA 2KT8A 2DX1A 2DL5A 1T3SA 2KXDA 3EG3A 1BU1A 1WXUA 3A98A 2DILA 3THKA 2C0OA 3M0QA 2JMCA 4J9DA 1T3LA 1X6GA 2A08A 1NEGA 1JO8A 1OOTA 1ARKA 1UJ0A 1K0XA 2JTEA 4JPBW 2J6FA 2AZVA 2YSQA 2BTTA 2FPEA 1JXOA 3NGPA 1QLYA 2KE9A 3UA7A 3NPFA 4JJCA 1K76A 2EGCA 3EHQA 3H0FA 2GBQA 3VS7A 2K9GA 1RI9A 2PNIA 2LQWA 1OV3A 2CT4A 2EYXA 2K7AA 1M8MA 1WDXA 4IIMA 1OEBA 4LUDA 4K11A 2RF0A 2DBKA 2EYWA 2JS2A 2M51A 2HSPA 2YT6A 4AG2C 2KNBB 5I22A 1VYTA 2HBWA 1ZLMA 1BK2A 1QWEA 3FJ5A 1NM7A 2J6OA 1VYVA 1AVZC 4OMQA 4AFUC 1ABQA 1SHGA 1VYUA 2I0NA 2CH4A 2K6DA 1AOJA 1HJDA 2YUPA 3GBQA 1WXTA 1TUCA 3LH5A 2J06A 2J6KA 4J9FA 2NWMA 4RTZA 2OI3A 2O9SA 2AKLA 1AZEA 2FEIA 3M0PA 2KEAA 4RTUA 1WIEA 5IH2A 1EFNA 2DMOA 2EKHA 3VRYA 4RTVA 2C0IA 3U23A 2D0NA 3UA6A 5IXBA 1ZSGA 1Z9QA 2ED1A 1KSWA 2LQNA 3H0IA 2LMJA 4EIKA 2HEQA 2EGEA 1JXMA 3I5SA 2RN8A 4OMNA 2AK5A 1WI7A 3SEMA 1UFFA 1AD5A 2DYBA 2YUOA 3RNJA 1AEYA 2RQRA 2DRKA 1YNZA 1PWTA 2EYYA 2ED0A 2MOXA 2ABLA 2DL4A 2RQUA 3EHRA 3ULRB 2DM1A 2CSQA 4RTYA 2O31A 2SRCA 2PZ1A 2KRMA 2K79A 2P4RA 4Z8AA 3I5RA 1MUZA 2A36A 2DA9A 2EPDA 2EW3A 3R6NA 1IO6A 4Z88A 2KROA 2KYBA 2BZXA 3NHNA 2X3XD 1OPLA 1M27C 1W1FA 3PE0A 4RTTA 1NYFA 2DL3A 4JJBA 5L23A 2KBTA 1WYXA 2AKKA 2DL7A 2RNAA 3REAB 3RBBB 2CREA 2ENMA 2RQWA 1ZUKA 1UHCA 2DJQA 1PRLC 1X6BA 2ECZA 2MIOA 1E6HA 5IHKA 1K9AA 1N5ZA 3KFVA 3VRZA 4J9IA 2AZSA 2DVJA 1UJYA 5EC7A 2K2MA 2L3QA 1GCPA 1JEGA 2HCKA 4ZNXA 2KRNA 2DLPA 4D8KA 1G83A 4HXJA 1U06A 1VA7A 2VWFA 1SSHA 2L2PA 1J3TA 1CKAA 3EGUA 2BZYA 3UATA 2JXBA 1A0NB 4LN2A 1H8KA 2G6FX 2GNCA 2EGAA 5FWCA 4Y92A 3VS4A 4JJDA 2YDLA 4ORZA 3REBB 2L3PA 3TVTA 4AFZC 4AG1C 2KXCA 1K0SA 3VS6A 1M3AA 1FYNA 4WCIA 2KGTA 2YUNA 5IHNA 1YCSB 4HVWA 1TG0A 2OAWA 5FW9A 3PVLA 1B07A 1BBZA 1UHFA 2MCNA 2LJ1A 1NLOC 3EG0A 2O2OA 2O88A 2RQVA 1NEBA 3I35A 4HVVA 1X2KA 4LUEA 4R0KA 1U5SA 2VVKA 1UECA 1CSKA 1T0HA 1Y57A 2FO0A 1S1NA 5FWBA 1ZUYA 1WXBA 1AZGB 3O5ZA 4J9HA 2D8JA 1JU5C 1UUEA 3IQLA 3VS3A 1T0JA 2L0AA 1I1JA 1WLPB 4JZ4A 2FPFA 3EG1A 4GLMA 1I07A 2EQIA 1X43A 1SPKA 2VKNA 1H3HA 2CUDA 3ZL7C 1GCQC 2IIMA 2E5KA 4M4ZA 1FMKA 2C0TA 3VS0A 2JS0A 2HDAA 1AWXA 2JM9A 1X27A 2GTJA 1PKTA 5IHIA 1KFZA 2JM8A 1M3CA 2OJ2A 1K1ZA 4FSSA 2F2WA 3VS5A 4KRTA 4OMOA 1GFDA 4CC7A 2D1XA 4HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS2 A;  1UTI A;  1HD3 A;  2JW4 A;  4J9C A;  4F14 A;  2A28 A;  2CSI A;  4CC4 B;  2F2X A;  1GBR A;  1GBQ A;  1SEM A;  1ZBJ A;  2SEM A;  4J9B A;  2PTK A;  2DL8 A;  3QWY A;  1PRM C;  2W10 A;  4OMP A;  3M0R A;  1UDL A;  1B3Q A;  2EYZ A;  4OML A;  1OPK A;  1QCF A;  2D8H A;  2BZ8 A;  5GJV B;  4CC3 A;  1CKB A;  2L3S A;  2W0Z A;  3I9Q A;  4J9G A;  2FG0 A;  3TSZ A;  2ROT A;  1LCK A;  1W6X A;  2EBP A;  4ESR A;  1MV3 A;  2LP5 A;  3UF4 A;  4CC2 A;  1X2Q A;  2KT1 A;  2ESW A;  1NG2 A;  1H92 A;  2H8H A;  3CQT A;  1UGV A;  1WFW A;  1WA7 A;  5GJW B;  1GRI A;  2RPN A;  1SRL A;  1RLQ C;  4IIO A;  2QDL A;  4QT7 A;  1MV0 B;  2DNU A;  4X1V A;  4E6R A;  2XMF A;  2DBM A;  1NYG A;  1Z9Z A;  2LZ6 B;  2FRY A;  1WX6 A;  2J7I A;  3PVQ A;  1E7O A;  1BB9 A;  2LJ0 A;  4AFQ C;  2GGR A;  5I11 A;  2V1Q A;  1GL5 A;  1PNJ A;  1ZUU A;  2JT4 A;  4LE9 A;  2ROL A;  1YN8 A;  2CH4 W;  1E6G A;  2CUB A;  2DRM A;  1PHT A;  3M0T A;  2A37 A;  1KJW A;  4F17 A;  4RUG A;  3QWX X;  1UE9 A;  5ECA A;  3SHW A;  1QKW A;  3JV3 A;  1GFC A;  4DEX A;  2DF6 A;  4GBQ A;  1YWP A;  4DEY A;  2K3B A;  1XOV A;  2LJ3 A;  1AWW A;  1G2B A;  1YWO A;  4Z89 A;  1SHF A;  2KRS A;  2F2V A;  2KR3 A;  1TUD A;  2B86 A;  2GQI A;  1X69 A;  1JQQ A;  2V1R A;  3H0H A;  2GTO A;  2CDT A;  2LNH B;  2O9V A;  2DE0 X;  2RQT A;  1I0C A;  2FRW A;  2M0Y A;  3NMZ C;  1UG1 A;  4A63 B;  1QKX A;  2YUQ A;  4J9E A;  2EVR A;  2JMA A;  3TSW A;  3EG2 A;  1RLP C;  1AWO A;  1YP5 A;  1ZX6 A;  3C0C A;  1RUW A;  2NUZ A;  2CT3 A;  1QWF A;  4AFS C;  1KIK A;  2RMO A;  1M3B A;  3M0U A;  1PKS A;  1V1C A;  2X3W D;  1SRM A;  3VS1 A;  1U3O A;  1HSQ A;  1GCQ A;  5IXF A;  4OMM A;  4F16 A;  4HVU A;  1M30 A;  2KYM A;  3H41 A;  1K4U S;  2LX7 A;  2FPD A;  1NLP C;  4RTX A;  1Y0M A;  2J05 A;  1ABO A;  3M0S A;  4LNP A;  1W70 A;  5HCK A;  4D8D A;  1AWJ A;  4JZ3 A;  2LCS A;  4RTW A;  2KT8 A;  2DX1 A;  2DL5 A;  1T3S A;  2KXD A;  3EG3 A;  1BU1 A;  1WXU A;  3A98 A;  2DIL A;  3THK A;  2C0O A;  3M0Q A;  2JMC A;  4J9D A;  1T3L A;  1X6G A;  2A08 A;  1NEG A;  1JO8 A;  1OOT A;  1ARK A;  1UJ0 A;  1K0X A;  2JTE A;  4JPB W;  2J6F A;  2AZV A;  2YSQ A;  2BTT A;  2FPE A;  1JXO A;  3NGP A;  1QLY A;  2KE9 A;  3UA7 A;  3NPF A;  4JJC A;  1K76 A;  2EGC A;  3EHQ A;  3H0F A;  2GBQ A;  3VS7 A;  2K9G A;  1RI9 A;  2PNI A;  2LQW A;  1OV3 A;  2CT4 A;  2EYX A;  2K7A A;  1M8M A;  1WDX A;  4IIM A;  1OEB A;  4LUD A;  4K11 A;  2RF0 A;  2DBK A;  2EYW A;  2JS2 A;  2M51 A;  2HSP A;  2YT6 A;  4AG2 C;  2KNB B;  5I22 A;  1VYT A;  2HBW A;  1ZLM A;  1BK2 A;  1QWE A;  3FJ5 A;  1NM7 A;  2J6O A;  1VYV A;  1AVZ C;  4OMQ A;  4AFU C;  1ABQ A;  1SHG A;  1VYU A;  2I0N A;  2CH4 A;  2K6D A;  1AOJ A;  1HJD A;  2YUP A;  3GBQ A;  1WXT A;  1TUC A;  3LH5 A;  2J06 A;  2J6K A;  4J9F A;  2NWM A;  4RTZ A;  2OI3 A;  2O9S A;  2AKL A;  1AZE A;  2FEI A;  3M0P A;  2KEA A;  4RTU A;  1WIE A;  5IH2 A;  1EFN A;  2DMO A;  2EKH A;  3VRY A;  4RTV A;  2C0I A;  3U23 A;  2D0N A;  3UA6 A;  5IXB A;  1ZSG A;  1Z9Q A;  2ED1 A;  1KSW A;  2LQN A;  3H0I A;  2LMJ A;  4EIK A;  2HEQ A;  2EGE A;  1JXM A;  3I5S A;  2RN8 A;  4OMN A;  2AK5 A;  1WI7 A;  3SEM A;  1UFF A;  1AD5 A;  2DYB A;  2YUO A;  3RNJ A;  1AEY A;  2RQR A;  2DRK A;  1YNZ A;  1PWT A;  2EYY A;  2ED0 A;  2MOX A;  2ABL A;  2DL4 A;  2RQU A;  3EHR A;  3ULR B;  2DM1 A;  2CSQ A;  4RTY A;  2O31 A;  2SRC A;  2PZ1 A;  2KRM A;  2K79 A;  2P4R A;  4Z8A A;  3I5R A;  1MUZ A;  2A36 A;  2DA9 A;  2EPD A;  2EW3 A;  3R6N A;  1IO6 A;  4Z88 A;  2KRO A;  2KYB A;  2BZX A;  3NHN A;  2X3X D;  1OPL A;  1M27 C;  1W1F A;  3PE0 A;  4RTT A;  1NYF A;  2DL3 A;  4JJB A;  5L23 A;  2KBT A;  1WYX A;  2AKK A;  2DL7 A;  2RNA A;  3REA B;  3RBB B;  2CRE A;  2ENM A;  2RQW A;  1ZUK A;  1UHC A;  2DJQ A;  1PRL C;  1X6B A;  2ECZ A;  2MIO A;  1E6H A;  5IHK A;  1K9A A;  1N5Z A;  3KFV A;  3VRZ A;  4J9I A;  2AZS A;  2DVJ A;  1UJY A;  5EC7 A;  2K2M A;  2L3Q A;  1GCP A;  1JEG A;  2HCK A;  4ZNX A;  2KRN A;  2DLP A;  4D8K A;  1G83 A;  4HXJ A;  1U06 A;  1VA7 A;  2VWF A;  1SSH A;  2L2P A;  1J3T A;  1CKA A;  3EGU A;  2BZY A;  3UAT A;  2JXB A;  1A0N B;  4LN2 A;  1H8K A;  2G6F X;  2GNC A;  2EGA A;  5FWC A;  4Y92 A;  3VS4 A;  4JJD A;  2YDL A;  4ORZ A;  3REB B;  2L3P A;  3TVT A;  4AFZ C;  4AG1 C;  2KXC A;  1K0S A;  3VS6 A;  1M3A A;  1FYN A;  4WCI A;  2KGT A;  2YUN A;  5IHN A;  1YCS B;  4HVW A;  1TG0 A;  2OAW A;  5FW9 A;  3PVL A;  1B07 A;  1BBZ A;  1UHF A;  2MCN A;  2LJ1 A;  1NLO C;  3EG0 A;  2O2O A;  2O88 A;  2RQV A;  1NEB A;  3I35 A;  4HVV A;  1X2K A;  4LUE A;  4R0K A;  1U5S A;  2VVK A;  1UEC A;  1CSK A;  1T0H A;  1Y57 A;  2FO0 A;  1S1N A;  5FWB A;  1ZUY A;  1WXB A;  1AZG B;  3O5Z A;  4J9H A;  2D8J A;  1JU5 C;  1UUE A;  3IQL A;  3VS3 A;  1T0J A;  2L0A A;  1I1J A;  1WLP B;  4JZ4 A;  2FPF A;  3EG1 A;  4GLM A;  1I07 A;  2EQI A;  1X43 A;  1SPK A;  2VKN A;  1H3H A;  2CUD A;  3ZL7 C;  1GCQ C;  2IIM A;  2E5K A;  4M4Z A;  1FMK A;  2C0T A;  3VS0 A;  2JS0 A;  2HDA A;  1AWX A;  2JM9 A;  1X27 A;  2GTJ A;  1PKT A;  5IHI A;  1KFZ A;  2JM8 A;  1M3C A;  2OJ2 A;  1K1Z A;  4FSS A;  2F2W A;  3VS5 A;  4KRT A;  4OMO A;  1GFD A;  4CC7 A;  2D1X A;  4HCK A; 
#chains in the Genus database with same CATH topology
 2QGG A;  3VS2 A;  1YJN T;  2COW A;  2CYZ B;  4O6J A;  2XKO C;  3OYH A;  4FYW B;  2HKQ B;  4MZP A;  4XTX A;  4J9C A;  7AT1 B;  1YI2 A;  1VQ6 A;  3PGG A;  1KHC A;  1OUL A;  3QPH A;  1GBQ A;  4J9B A;  2PTK A;  1YJ9 Q;  1HXD A;  2QQS A;  2W10 A;  2YLB A;  1H64 1;  3M0R A;  3OS1 A;  2X9H A;  4OML A;  4C92 B;  1BI0 A;  4XAX B;  3SWN C;  5IN1 A;  1QCF A;  4CC3 A;  2BZ8 A;  2VB6 A;  1CKB A;  2L3S A;  4KBM B;  1LCK A;  2XDD A;  3PIP A;  1QP3 A;  1I5L A;  1MV3 A;  3UF4 A;  1PM3 A;  1X2Q A;  1F1B B;  2RB6 A;  4J7F A;  2ESW A;  1NG2 A;  1QVG P;  1VQ4 A;  4PJJ A;  2HL5 C;  3CQT A;  1GRI A;  5DLQ E;  1D09 B;  4EDU A;  3MEV A;  1SRL A;  1RLQ C;  4IIO A;  3OSV A;  1WJS A;  2M02 A;  4X1V A;  3OS2 A;  4E6R A;  4J6W A;  5LJ3 d;  2DTH A;  1VUB A;  1VQ8 T;  3JCM V;  2JTF A;  3RKY A;  3PVQ A;  1E7O A;  1VQ5 Q;  1BB9 A;  2PQW A;  4M75 D;  3JCM Q;  1K9M U;  3JCM X;  3I56 Q;  1BKB A;  4LE9 A;  2QAS A;  1M8V A;  2IG0 A;  2CUB A;  1E6G A;  1TS9 A;  2DRM A;  2EQU A;  4M77 D;  1K73 R;  3DLM A;  1Y96 B;  4MZM A;  1UE9 A;  2F5T X;  2H3E B;  2EYQ A;  5ECA A;  3SHW A;  1YIT A;  3JV3 A;  3OYI A;  1PCX A;  5J3B A;  4QVD A;  3CC4 T;  1YJ9 T;  1XOV A;  2LJ3 A;  2R58 A;  2A7Y A;  4M75 G;  5I2M A;  1G2B A;  2NUT A;  1YWO A;  2L8D A;  2HL3 A;  3OYN A;  1RAG B;  1TUD A;  2GQI A;  4FM4 B;  1JQQ A;  3H0H A;  4M77 G;  2DE0 X;  4NL3 A;  2RQT A;  1XNI A;  3CCR A;  1QKX A;  3OB9 A;  1ZBX A;  3A8O B;  3FJP A;  5GAM g;  4JRQ A;  2O4X A;  1YP5 A;  1FMV A;  1Y07 A;  1JB0 E;  2X4Y A;  2RM4 A;  1RUW A;  1M3B A;  4FT2 A;  1V1C A;  4LDW A;  2CP3 A;  3JB9 D;  4BE1 A;  1I8F A;  3OYE A;  2FZC B;  2K2V A;  1M30 A;  2FPD A;  3JCM d;  3BFM A;  3OYM A;  1RAI B;  3M0S A;  4D8D A;  1AWJ A;  2OAU A;  5LJ3 e;  4N0A C;  1VIF A;  2BKD N;  4RTW A;  3ZEH A;  2KT8 A;  3G1J A;  2DX1 A;  3JB9 G;  1W2B P;  1YBY A;  1M90 U;  2ZPE B;  3M0Q A;  4N4G A;  2JMC A;  2A08 A;  3HPW A;  4J5Y A;  3QXE B;  1K9M R;  3PMI A;  2DXT A;  3PTA A;  3OYC A;  3MP1 A;  3SWN A;  1K0X A;  2JTE A;  3CBM A;  5GMK j;  3M55 A;  3AT1 B;  4BE0 A;  1YIJ Q;  3HHT B;  4ANJ A;  2FB7 A;  3SB2 A;  3OYB A;  3QYH B;  4OB3 B;  5J39 A;  4JJC A;  4E7S A;  1VQN A;  2DEQ A;  2K9G A;  2PNI A;  2L3R A;  1VQO A;  2QEX A;  4J8O A;  4EMG A;  5GAM h;  4DBQ A;  3GNF B;  3OYL A;  3EGX B;  2EAY A;  5KYW B;  2EYW A;  2M51 A;  3V8L A;  5I22 A;  1VYT A;  3WXM B;  4R56 A;  2RK1 A;  1YI2 Q;  1KC8 C;  1BK2 A;  1VQ6 Q;  2E41 A;  3FJ5 A;  3R6O A;  3TRE A;  1AVZ C;  4M75 E;  4AFU C;  3CMA Q;  1SHG A;  1VYU A;  3VU3 C;  3PMT A;  1TUG B;  3LWH A;  1VQL T;  2CH4 A;  2K6D A;  4MZT A;  1AOJ A;  4L6V 5;  2YUP A;  3GBQ A;  2DD5 A;  4M77 E;  1WXT A;  3LH5 A;  3JCM e;  3L2Z A;  4J9F A;  5GAM f;  1MMA A;  2K3Y A;  2O9S A;  2VUB A;  4LDV A;  2AKL A;  5GAN 4;  4L59 A;  5GMK m;  4RTU A;  4C92 F;  3JB9 H;  1VQ4 Q;  3I55 A;  3RMQ A;  4XTZ A;  2DMO A;  2EKH A;  3VRY A;  2RD1 A;  4RTV A;  1D1B A;  2CZ1 B;  4FT4 A;  1BYM A;  2KDS A;  3UA6 A;  5LJ3 j;  4XQ3 A;  3HRT A;  2QQB A;  3L2R A;  2LQN A;  3H0I A;  4C5H A;  4HCC A;  4EIK A;  1Q86 C;  3OW2 A;  4OMN A;  3EGD B;  1UFF A;  4HA8 A;  1AD5 A;  4GY5 A;  1N9R A;  1RAH B;  3RKW A;  1QVF S;  2EYY A;  2ED0 A;  3X24 B;  1VIE A;  3ULR B;  3X26 B;  4RTY A;  3RES A;  3V7C A;  5GMK i;  5GAO p;  2CP7 A;  2SRC A;  2DTO A;  2PZ1 A;  2P4R A;  4Z8A A;  2DA9 A;  4N4I A;  1YCY A;  1YIT Q;  4Z88 A;  1AT1 B;  1TU0 B;  2BZX A;  2E3H A;  5CQX A;  2BE9 B;  1V76 A;  3CMA T;  3PNW C;  3VJP A;  1RL2 A;  2DYI A;  3H8Z A;  4JJB A;  3H9N A;  3J81 E;  4QVZ A;  4ZTJ A;  4L5G A;  4N0A A;  2P0Q A;  1WYX A;  2DPP B;  2DL7 A;  3REA B;  4PJO C;  5DM7 R;  1PRL C;  2XHC A;  3D7S B;  4XU2 A;  3G6E A;  1KC8 R;  4XK8 E;  1N5Z A;  3KFV A;  3VRZ A;  4A4G A;  1UJY A;  1G5V A;  5A0D A;  3CCU A;  3JCM c;  2KRN A;  5C6S A;  4OB0 B;  3X20 B;  3GIB A;  4OGE A;  1U06 A;  3OBW A;  1V29 B;  5GAO m;  3CCM T;  1KD1 U;  1M1F A;  4E7J A;  3JRZ A;  3CC2 A;  3CCJ Q;  3OA6 A;  2PVO B;  2GNC A;  4ZTF A;  5FWC A;  3VS4 A;  2WSE E;  2BE7 D;  5FU7 C;  3BE3 A;  5A2Q E;  2EIF A;  1NPP A;  2A3L A;  1YJW T;  1Q86 R;  3CC7 A;  3VS6 A;  1M3A A;  3CCS A;  1FYN A;  4WCI A;  3QJY A;  2YUN A;  3CME T;  5GMK l;  3LH0 A;  4ZN3 A;  4C5I A;  5KYX A;  3GP8 A;  2OAW A;  1BBZ A;  1BCM A;  4C0F A;  1LOJ A;  4JDS A;  2X35 A;  2O2O A;  3DB4 A;  2O88 A;  2RQV A;  1NEB A;  3I35 A;  1X2K A;  4LUE A;  4R0K A;  2DTI A;  1G3T A;  1T0H A;  2HQX A;  1ZUY A;  4C8Q B;  1PSE A;  4J9H A;  1BI1 A;  2QEX Q;  3QZ9 B;  2I2L A;  4BI8 B;  3VV0 A;  1ZSZ C;  2QI2 A;  1X43 A;  3J80 E;  2VKN A;  5GAO r;  1QQJ A;  2E70 A;  1TWB A;  2KK4 A;  2OTJ A;  3CCJ T;  2HDA A;  2D9T A;  4M78 B;  1C0M A;  4ME7 A;  2JOY A;  2RJE A;  1PKT A;  5IHI A;  1M3C A;  4IUT A;  1TOV A;  4XU3 A;  4HCK A;  4J7I A;  3EGD A;  4JRK A;  1Y71 A;  3CEY A;  2M16 A;  1HD3 A;  2AHJ B;  4EMK B;  2F1L A;  1BIB A;  2A28 A;  2V26 A;  3ER0 A;  2O01 E;  4F7U B;  2WSF E;  4M7D B;  4NOY A;  3QWY A;  4II1 A;  3EG9 B;  1OZ3 A;  4OMP A;  1UDL A;  2EYZ A;  2KAF A;  5LJ5 e;  4EMK C;  2JJ9 A;  4PFP A;  2D8H A;  4RG2 A;  4IUR A;  1QCN A;  2FG0 A;  2QQA A;  1W6X A;  2PUO B;  5A0L A;  5KYY B;  3PT9 A;  2EBP A;  4PJO A;  1R0C B;  3A8G B;  2LP5 A;  4CC2 A;  2DZC A;  1LVK A;  2KT1 A;  5GAO l;  4MDX A;  3GLX A;  2DAQ A;  1QMC A;  2E4H A;  2E64 A;  4X9D A;  3CXC A;  1UGV A;  2K4Y A;  3QJ6 A;  5GJW B;  2P84 A;  1IRE B;  4OGC A;  3KXT A;  1MMD A;  4PK4 A;  5LJ3 g;  2QDL A;  4OB2 B;  4QT7 A;  1MV0 B;  3QG1 A;  1JJ2 A;  2DNU A;  2GF7 A;  2XMF A;  2DBM A;  2LZ6 B;  4NS5 A;  2DKG A;  3CCE A;  2MF2 A;  5AT1 B;  4C0D B;  1M1K C;  1GL5 A;  2YLC A;  2JVV A;  2JT4 A;  4N4H A;  3F70 A;  1YN8 A;  2CH4 W;  3WVD B;  2A37 A;  1KJW A;  4F17 A;  4M7A B;  5CIU A;  4RUG A;  2MK5 A;  5D6Y A;  3G71 A;  3X25 B;  1GFC A;  3GPL A;  5FRM A;  4GBQ A;  1YWP A;  2BUD A;  2C06 A;  3INZ A;  2ZPB B;  2LT4 A;  1PG5 B;  3ZBD A;  1SHF A;  3CCU Q;  1QP2 A;  1PD0 A;  2V1R A;  3CCV Q;  3S3N A;  1ZA1 B;  3CCL T;  2O9V A;  4AT1 B;  3OW2 S;  1WGS A;  4KT0 E;  1K73 C;  3HKS A;  3NMZ C;  4PJM A;  5FU6 C;  2LRQ A;  2FVU A;  2YUQ A;  1SKU B;  4A4K A;  3LGF A;  1RAF B;  3EG2 A;  2JZ2 A;  5LJ5 j;  3QUI A;  3C4S A;  1KIK A;  2EQK A;  2GQV A;  3M0U A;  1PKS A;  1ZSZ A;  3CBO A;  2LDM A;  1PSF A;  1OX8 A;  1VQM T;  1SRM A;  9ATC B;  1WHK A;  3CC7 Q;  3CCS Q;  5GAN h;  5A0G A;  3JB9 I;  3L2W A;  2F5K A;  1K8A U;  2KYM A;  3H41 A;  4Z02 A;  2LX7 A;  2E6Z A;  4RTX A;  4KUI A;  3CCQ Q;  2J05 A;  1BIA A;  4LNP A;  4E7H A;  5GAN 8;  2NUP B;  2HSE B;  2GFA A;  2DL5 A;  3EG3 A;  1BU1 A;  1WXU A;  2DIL A;  4EMH A;  2DD4 A;  2C0O A;  4J9D A;  3LWI A;  1T3L A;  5GAN f;  2KMT A;  4A4H A;  1NEG A;  2XK0 A;  1NPR A;  3LGL A;  1D1A A;  1ARK A;  2CP5 A;  1FMW A;  3M58 A;  2K57 A;  4C92 C;  1M1K R;  2DEU A;  3CCV T;  3VUZ A;  2AZV A;  2BTT A;  4C8Q F;  2OTJ Q;  4BDZ A;  1OQK A;  2FPE A;  1QVF P;  1D3B B;  2VGN A;  2KE9 A;  4WTO B;  1ZA2 B;  3EHQ A;  3H0F A;  3G7Z A;  2GBQ A;  5HK3 A;  3SD4 A;  2JNG A;  4J6Y A;  3BY7 A;  4JLG A;  3M54 A;  5KYU A;  3OYJ A;  4E7Z A;  2OTL T;  5GAO q;  1OEB A;  4LUD A;  1K9M C;  3EH2 A;  4K11 A;  2RF0 A;  4M78 F;  2JS2 A;  3VUB A;  4LDY A;  4AMC A;  1KQS A;  2YT6 A;  2AT1 B;  2KNB B;  3OYG A;  1ZLM A;  1I5O B;  2HMA A;  2E5Q A;  1Q81 U;  4RCB A;  3CCQ T;  1B7T A;  1ZHI A;  2HKN A;  3JAM E;  1LJO A;  1TUC A;  3MKD A;  4F7U F;  2NLU A;  4M7D F;  4IUU A;  3A1P A;  4RTZ A;  4E7K A;  4LD6 A;  2LC4 A;  2K5L A;  3RMS A;  2KEA A;  3PIO A;  3AHU A;  5IH2 A;  5HKC A;  4GLK A;  4PJO D;  2DJZ A;  3DB3 A;  2D0N A;  1LPL A;  2ZGW A;  2RJC A;  2ED1 A;  1KSW A;  4JLI A;  2GFU A;  1LNX A;  1O75 A;  2EGE A;  2AK5 A;  1WI7 A;  3RNJ A;  3CCE Q;  1YNZ A;  4PFZ A;  3VYG A;  1PWT A;  4ZGD B;  2MOX A;  4PJO G;  3M4G A;  3EHR A;  3MET A;  2XIC A;  4LXC A;  1VQ5 T;  5GAN 5;  3I56 T;  2KRM A;  3A8H B;  2LT1 A;  4UC4 A;  2COZ A;  1KK7 A;  1DJ7 B;  1M2O A;  4IUV A;  3QHS A;  3NHN A;  4Y28 E;  2QQR A;  3CD6 A;  1WHH A;  2RHU A;  5FLX E;  4ELY C;  1NYF A;  1M90 C;  4M7A F;  1VQ7 A;  1R0B G;  4Y91 A;  3G4S A;  4LDU A;  2ENM A;  1UHC A;  1RAC B;  5D6W A;  3J7A F;  3QZ5 B;  2VGM A;  5J26 A;  2XID A;  4JRI A;  1Q81 R;  2NUP A;  2HQE A;  1IGU A;  1EIF A;  2LTO A;  3FB9 A;  2CP0 A;  2DVJ A;  3S3O A;  5EC7 A;  3KUF A;  2V8K A;  2L3Q A;  1JEG A;  4C92 A;  5GAN 6;  1G3S A;  4D8K A;  2QTV A;  4X34 A;  4TVR A;  3M56 A;  1CKA A;  1BI2 A;  1J3T A;  4VUB A;  2YXY A;  1VQP A;  4QQD A;  2JXB A;  2QA4 A;  3GF5 A;  1SSF A;  2P0K A;  4DBH A;  2G6F X;  4DBF A;  4DBR A;  5HK0 A;  3T9N A;  4JJD A;  2YDL A;  4ORZ A;  1B34 B;  3JSC A;  1N6A A;  5IT9 E;  1QCO A;  4EPC A;  2KGT A;  5IHN A;  1GXI E;  1YCS B;  2QGF B;  4ZGJ B;  1UHF A;  3OMG A;  4JS4 A;  4BUG A;  2LJ1 A;  1NLO C;  1UGP B;  2D0Q B;  3SFM A;  4E7I A;  1Y96 A;  2IPO B;  1X01 A;  1CSK A;  1Y57 A;  2RA2 A;  2K3X A;  4PJO E;  2DXB A;  1S1N A;  5FWB A;  1YIJ T;  1AZG B;  2MMP A;  4HT8 A;  1I1J A;  3BDU A;  1M90 R;  3MEW A;  4GLM A;  2X51 A;  1SPK A;  4M75 B;  2RH2 A;  1H3H A;  1UGS B;  1PD1 A;  1R8O B;  1GCQ C;  4M4Z A;  3VYH B;  2JS0 A;  5M9O A;  4IKF A;  1AWX A;  2DVE A;  1YI2 T;  3OS0 A;  4M77 B;  3NTK A;  4LD9 K;  1W4S A;  1VQ6 T;  1U1T A;  4V2S A;  2F2W A;  1UGQ B;  3L2Q A;  4KRT A;  4OMO A;  1VQK A;  3C12 A;  1UTI A;  1YFN A;  1S72 A;  2JW4 A;  4F14 A;  2YRC A;  3A8M B;  4CC4 B;  2F2X A;  1N8R U;  1GBR A;  1ZBJ A;  2DL8 A;  1PRM C;  1WJQ A;  3CCR Q;  2X4J A;  4XTW A;  1YJN A;  1VQ4 T;  2QXF A;  5GJV B;  3OW2 P;  2W0Z A;  2M9U A;  3A8L B;  4J9G A;  2MPX C;  4P5N A;  5IAY A;  5CKB A;  4BI3 A;  3QO3 A;  3NTI A;  4HKE A;  2QAZ A;  1H92 A;  4JRP A;  2RPN A;  4FW1 A;  1M1G A;  2QTX A;  1ACM B;  2Z0W A;  1KQS S;  5D7U A;  1TSF A;  4DQ2 A;  1Z9Z A;  3CD6 Q;  1Q82 U;  2FRY A;  1WX6 A;  2J7I A;  1M2V B;  2LJ0 A;  1YIT T;  1VQ7 Q;  2GGR A;  5I11 A;  5LJ5 d;  3G4S Q;  2D6F A;  2CKK A;  3P8D A;  1PHT A;  4BE2 A;  5CK9 A;  2K5I A;  3EGX A;  5GAM e;  5KYW A;  1VQ8 A;  3TCJ A;  6AT1 B;  2X4W A;  2VXE A;  1QKW A;  1Q7Y U;  3CCR T;  1MMG A;  1AWW A;  2F69 A;  4FSX A;  3QDF A;  1M9S A;  1B34 A;  5CR2 A;  5GAN 7;  2KR3 A;  2JUF A;  2LQK A;  1VQN Q;  2B86 A;  1X69 A;  1VQO Q;  3OYY A;  2GTO A;  2LNH B;  1XQH A;  1I0C A;  4PL6 A;  3CC4 A;  4OVA A;  1YJ9 A;  1UG1 A;  4C92 D;  3UDC A;  3OYD A;  4A63 B;  3MJX A;  4PNO A;  2QA4 Q;  2XDP A;  2JMA A;  1FX7 A;  4RMO A;  1KHI A;  4C8Q C;  3TSW A;  3L42 A;  1MMN A;  2HBP A;  2KQW A;  3C0C A;  4FW2 A;  2NUZ A;  2CT3 A;  4AFS C;  2RMO A;  2MWO A;  4OF1 A;  2B8A A;  2X3W D;  3VS1 A;  5CAI A;  1MGQ A;  1GCQ A;  2R5A A;  4C92 G;  5FRN A;  3CD6 T;  4OMM A;  2FL7 A;  4M78 C;  4B9X A;  3SDZ A;  1Q95 G;  1Y0M A;  1ABO A;  1SF9 A;  4XU1 A;  1W70 A;  3E2U A;  3I55 Q;  4JZ3 A;  1MND A;  2EJ9 A;  2ZZD A;  2LCS A;  1HK9 A;  5EG2 A;  1KD1 R;  2HNI A;  4HCB A;  4PJN A;  3A98 A;  3MP6 A;  2RI2 A;  4M7D C;  2WAC A;  4C5E A;  1JO8 A;  2L89 A;  2EJF A;  2IVW A;  1VQN T;  5KE3 A;  1VQO T;  4D6W A;  1D0X A;  2QEX T;  2YSQ A;  4PLI A;  5GAM j;  1C1A A;  1JXO A;  1RAB B;  1U1S A;  1QLY A;  4A54 A;  3NPF A;  4KH1 B;  3V7S A;  4HT9 A;  4M75 F;  1OV3 A;  2CT4 A;  2EFI A;  2EYX A;  4FYY B;  3HFO A;  2M1H A;  5GMK h;  1OX9 A;  4IIM A;  2DBK A;  2HSP A;  4AG2 C;  4M77 F;  1S72 Q;  1QWE A;  3EFO B;  1NM7 A;  4QKU A;  2J6O A;  1VYV A;  5KE2 A;  2EQJ A;  2MAM A;  1MNE A;  2Y4X A;  1TTH B;  2NUT B;  1ABQ A;  2XG8 D;  2LX9 A;  3RUX A;  4XTV A;  1YJN Q;  1SG5 A;  4C0D C;  3I55 T;  2I0N A;  3G6E Q;  1HJD A;  3L2U A;  2J06 A;  1NJI U;  2J6K A;  4M7A C;  3OYK A;  2HAX A;  4BY6 B;  2FEI A;  4R55 A;  5CKE A;  1WIE A;  3CXC P;  1VQL A;  4F04 B;  2C0I A;  4DOW A;  5IXB A;  3CC2 Q;  4C5G A;  3E1S A;  2XI9 A;  4DOV A;  1ZSG A;  2V8I A;  4BY6 C;  2RHI A;  4JS5 A;  5KCH A;  1JJ2 P;  2HEQ A;  3I5S A;  3NTH A;  3SEM A;  4C92 E;  4MDW A;  3URG A;  3JB9 F;  3OYF A;  2E3I A;  2YUO A;  1AEY A;  2RQR A;  1NBE B;  1K73 U;  2RHZ A;  5LJ3 h;  3NFC A;  3JCM g;  1QVG A;  2RQU A;  4ZGE B;  2BIV A;  2ZPH B;  4C8Q A;  3FLG A;  2YHT A;  3L2V A;  5DY9 A;  3I5R A;  2EPD A;  2EW3 A;  3R6N A;  1IO6 A;  1WHL A;  2G3R A;  2X3X D;  3MPU B;  2CZ0 B;  4RTT A;  3PE0 A;  4M78 A;  2DL3 A;  4BI4 A;  5L23 A;  5LJ3 f;  3G6E T;  3SWN B;  5DLO A;  3EAE A;  2KBT A;  3PFS A;  3M59 A;  2JTM A;  2H3J A;  2RNA A;  3RBB B;  4CI0 C;  2RI3 A;  1XTD A;  4LDX A;  3CCU T;  3CC4 Q;  3CMA A;  4QVC A;  4EMK A;  4A53 A;  5IHK A;  5CVI A;  4F7U A;  4M7D A;  4J9I A;  1U8R A;  3CC2 T;  1X6O A;  5FRO A;  3EG9 A;  2RI5 A;  2RJD A;  2K2M A;  4FU6 A;  1OU8 A;  2DER A;  2HCK A;  4ZNX A;  1X75 C;  2DLP A;  2MI6 A;  3C94 A;  3HP9 A;  2QK0 A;  4HXJ A;  4E2F B;  2VWF A;  1NJI R;  5KYY A;  4BB7 A;  2LQ8 A;  3EGU A;  3KBG A;  4JJN K;  1ZQ1 A;  3CC7 T;  3CCS T;  1H8K A;  1C6V X;  3X28 B;  1Q81 C;  3MP8 A;  3QBY A;  2EGA A;  5GAO n;  3JCM h;  2L3P A;  3TVT A;  3CCM A;  5GAN d;  2HQH A;  2KI7 A;  2CP2 A;  5CKF A;  1K0S A;  1UEB A;  1I4K 1;  4C0Z A;  4O5V A;  2DO3 A;  3FRN A;  1TG0 A;  5I2S A;  5GMK e;  2XD0 A;  3FEO A;  2MCN A;  3JCM f;  3EG0 A;  2FZK B;  1YJW A;  3EFO A;  1K8A R;  4BAC A;  4M7A A;  3CME A;  2QG9 B;  1U5S A;  1W2B A;  1UEC A;  8AT1 B;  2OTJ T;  2LCC A;  3GOX A;  3HL8 A;  3VS3 A;  2ZPG B;  2L0A A;  2QQ9 A;  4JZ4 A;  1IGQ A;  1KQS P;  1WQW A;  4X9C A;  3TQ7 P;  3MCA B;  2MYS A;  2DET A;  4WF2 A;  1FMK A;  2C0T A;  3VS0 A;  1WHG A;  1OU9 A;  2COY A;  2JM9 A;  1JRI A;  2GTJ A;  5GAN 3;  3G71 Q;  3H6Z A;  3CPW A;  1GFD A;  1G8X A;  4CC7 A;  2L5Q A;  1R77 A;  3HRS A;  3CCJ A;  1HYO A;  1VQ9 A;  1D0Y A;  2CSI A;  2YRV A;  4J6X A;  4OB1 B;  1NE8 A;  3JCM W;  2CZ6 B;  4XTY A;  2FHD A;  1SEM A;  1VQL Q;  2SEM A;  5GAN e;  3N5B B;  3M9Q A;  3E9F A;  1B3Q A;  1OPK A;  2HD0 A;  3OBY A;  4FYX B;  3S3M A;  3I9Q A;  3TSZ A;  2QYZ A;  2ROT A;  3CXC S;  4KGV B;  1D0Z A;  2VV5 A;  1BI3 A;  4ESR A;  2E1H A;  2FZG B;  4E7L A;  1WQ7 A;  2LNV A;  2RHX A;  3EFR A;  1JJ2 S;  4J83 A;  2H8H A;  3HTR A;  1WFW A;  1WA7 A;  3CCE T;  5CKH A;  3E9G A;  4C8Q D;  1UGR B;  3CPW P;  1NYG A;  3MEU A;  3M53 A;  5LJ5 g;  2DK3 A;  4BD3 A;  1D3B A;  2V8J A;  5KYX B;  3G71 T;  1QVP A;  3TEE A;  4OP0 A;  4AFQ C;  2V1Q A;  2DFU A;  3V8J A;  1PNJ A;  1ZUU A;  2ROL A;  1KC8 U;  4M78 D;  4KH0 B;  3M0T A;  2PVG B;  2KY9 A;  4C8Q G;  4A4F A;  3RR6 A;  3QWX X;  3MEA A;  5CQY A;  1G3Y A;  4DEX A;  3RER A;  2DF6 A;  4DEY A;  2K3B A;  4PLL A;  2E6N A;  2ZPI B;  4Z89 A;  2KRS A;  3RKX A;  2F2V A;  4M7D D;  4M78 G;  4KUL A;  4IUQ A;  1TH7 A;  2CDT A;  2EJG A;  2E10 A;  3LW5 E;  3FDR A;  2FRW A;  2M0Y A;  4J9E A;  2EVR A;  3O8V A;  5GAN j;  2CGH A;  3JCM b;  2OX7 A;  1P92 A;  1QVG S;  3FC3 A;  1Q86 U;  3L1A A;  1XJW B;  1RLP C;  3CCL A;  1AWO A;  1ZX6 A;  3P8H A;  4OMF B;  4ELZ C;  4F7U G;  1QWF A;  1YHQ A;  4M7D G;  3CCM Q;  3EH1 A;  5GAM d;  1N27 A;  3UT1 A;  4M75 C;  2X4X A;  3C95 A;  1U3O A;  5KYN A;  1HSQ A;  1OZ2 A;  5IXF A;  4F16 A;  4HVU A;  4XTU A;  1RAD B;  3OMC A;  2PUK B;  1K4U S;  3UPU A;  1NLP C;  4M77 C;  5LJ5 h;  3QSU A;  1D1C A;  3WVE B;  3LX7 A;  1N8R C;  5HCK A;  1VQM A;  3HSB A;  1YJW Q;  2CS7 A;  4PJO B;  3BW1 A;  3CME Q;  2YWW A;  1T3S A;  2KXD A;  3THK A;  1Y7X A;  5C0M A;  4M7A D;  1X6G A;  2ATC B;  1IRX A;  1OOT A;  5LJ5 f;  1UJ0 A;  4MMK A;  3DLL A;  2HZY A;  4JPB W;  4QQG A;  2J6F A;  2E65 A;  4KUD K;  2VYT A;  3M57 A;  1KD1 C;  2R57 A;  1WZO A;  2MWP A;  1KQ2 A;  3NGP A;  2EQM A;  3DKM A;  3OQ5 A;  3UA7 A;  5GAN 2;  1K76 A;  2EGC A;  2VXF A;  4M7A G;  1AHJ B;  3VS7 A;  2KVQ G;  1PC0 A;  2AIR B;  2NYS A;  1RI9 A;  3CCV A;  2LQW A;  1Q82 C;  3VKI A;  2K7A A;  4YTL A;  1M8M A;  1WDX A;  1WJR A;  4C8Q E;  5FU7 B;  1N9S A;  1VQ9 Q;  2HBW A;  2WSC E;  2GCX A;  4PFO A;  4C0G A;  4OMQ A;  3GNG A;  2OTL A;  1FWZ A;  1OYX A;  3QYG B;  4M78 E;  1Q7Y C;  4KGX B;  2EKO A;  2EWN A;  2NWM A;  2OI3 A;  4Q5W A;  3RIR A;  5CCA A;  4XU0 A;  3OSS C;  1AZE A;  1M5Q 1;  3CCQ A;  2RHY A;  3M0P A;  1EZZ B;  1W2B S;  1QW1 A;  2JN0 A;  1EFN A;  4E47 A;  3U23 A;  1VQP Q;  4F7U E;  4M7D E;  3A5Z B;  1Z9Q A;  1ZSZ B;  1N8R R;  2DXU A;  5HY6 A;  3M5A A;  2LMJ A;  1JXM A;  2RN8 A;  3JCM J;  2DYB A;  1JBM A;  4PJL A;  2DRK A;  3V8K A;  2A0F B;  2ABL A;  1KG1 A;  2DL4 A;  3CPW S;  2DM1 A;  3BDL A;  5L8R E;  2CSQ A;  3ZFJ A;  2M0O A;  2O31 A;  4CRI A;  1VQ7 T;  1M4Z A;  2K79 A;  3EFS A;  1I81 A;  3G4S T;  1MUZ A;  2A36 A;  4RCC A;  1VQ9 T;  2DZ9 A;  3MHX A;  1BCO A;  4M75 A;  2KRO A;  2KYB A;  5LL6 S;  1OPL A;  1M27 C;  1W1F A;  1VQ5 A;  2RJF A;  4HCZ A;  4NL2 A;  4M77 A;  3I56 A;  4ATO A;  4PKC C;  3FIF A;  2KSS A;  2AKK A;  1Q82 R;  4FIB A;  4DA4 A;  2CRE A;  2YRD A;  2RQW A;  1ZUK A;  1O9S A;  3CBP A;  2DJQ A;  2E12 A;  1IHV A;  4KGZ B;  1X6B A;  2FYK A;  2ECZ A;  2MIO A;  1E6H A;  4M7A E;  3JB9 J;  2P0P A;  1K9A A;  2ZPF B;  2AZS A;  5KYU B;  4FCY A;  1VQP T;  3CCL Q;  2QA4 T;  2XDB A;  1IB8 A;  2XU8 A;  1GCP A;  1YHQ Q;  4QW2 A;  2RK2 A;  1Q7Y R;  2ZAE A;  1VQK Q;  5KCO A;  4FL6 A;  1G83 A;  1VA7 A;  3CPF A;  3P8B B;  1SSH A;  2L2P A;  4RG8 A;  2BZY A;  3ASK A;  2CZ7 B;  3UAT A;  1WNL A;  2R5M A;  4FYV B;  1A0N B;  4LN2 A;  4B6M A;  2DIQ A;  5GAN g;  1NZ9 A;  3E19 A;  3M4Y A;  2ZCF B;  3UWN A;  1VQM Q;  4Y92 A;  3REB B;  3HRU A;  3JCM P;  4AFZ C;  1OI1 A;  1RAE B;  4AG1 C;  2VC8 A;  2KXC A;  1M1K U;  5CO7 A;  1EX4 A;  1NJI C;  1H3Z A;  2K5F A;  1M2V A;  4HVW A;  4PJO F;  3QII A;  2LCL A;  4QQ6 A;  5FW9 A;  3PVL A;  1B07 A;  1MHN A;  2DXC A;  1IZ6 A;  3OY9 A;  2O4X B;  3LLR A;  2LVM A;  2PU9 B;  4HVV A;  1IHW A;  3OS5 A;  5FU6 B;  3Q1J A;  8ATC B;  3RDV A;  3TU4 K;  2VVK A;  2FO0 A;  2CP6 A;  4BDY A;  2VAS A;  1WHM A;  3S6W A;  3LYI A;  1TXQ A;  1WXB A;  1G3W A;  1UB4 A;  3O5Z A;  2D8J A;  2RO0 A;  1JU5 C;  1WPY A;  3QDR B;  1UUE A;  4ZN1 A;  3IQL A;  1T0J A;  3OYA A;  1YHQ T;  4RKU E;  1WLP B;  2FPF A;  2PVD B;  3V7R A;  4JUV A;  3EG1 A;  1FXX A;  1I07 A;  2EQI A;  2P4T A;  1RAA B;  2QDY B;  1VQK T;  1VOM A;  2CUD A;  3HFN A;  3MO8 A;  3ZL7 C;  1K8A C;  2IIM A;  2E5K A;  2Y90 A;  4MML A;  1YIJ A;  3QKJ A;  1RI0 A;  2DIG A;  1IXD A;  5AYF A;  5KH6 A;  1KQ1 A;  5D6X A;  1S72 T;  1VQ8 Q;  1QVF A;  3ME9 A;  1X27 A;  5CKD A;  5I21 A;  2OTL Q;  1KFZ A;  2JM8 A;  2OJ2 A;  2Y4Y A;  4IUP A;  1K1Z A;  4FSS A;  3VS5 A;  4B9W A;  2D1X A;  1WHJ A;  4A4E A; 
#chains in the Genus database with same CATH homology
 3VS2 A;  1UTI A;  1HD3 A;  2JW4 A;  4J9C A;  4F14 A;  2A28 A;  2CSI A;  4CC4 B;  2F2X A;  1GBR A;  1GBQ A;  1SEM A;  1ZBJ A;  2SEM A;  4J9B A;  2PTK A;  2DL8 A;  3QWY A;  1PRM C;  2W10 A;  4OMP A;  3M0R A;  1UDL A;  1B3Q A;  2EYZ A;  4OML A;  1OPK A;  1QCF A;  2D8H A;  2BZ8 A;  5GJV B;  4CC3 A;  1CKB A;  2L3S A;  2W0Z A;  3I9Q A;  4J9G A;  2FG0 A;  3TSZ A;  2ROT A;  1LCK A;  1W6X A;  2EBP A;  4ESR A;  1MV3 A;  2LP5 A;  3UF4 A;  4CC2 A;  1X2Q A;  2KT1 A;  2ESW A;  1NG2 A;  1H92 A;  2H8H A;  3CQT A;  1UGV A;  1WFW A;  1WA7 A;  5GJW B;  1GRI A;  2RPN A;  1SRL A;  1RLQ C;  4IIO A;  2QDL A;  4QT7 A;  1MV0 B;  2DNU A;  4X1V A;  4E6R A;  2XMF A;  2DBM A;  1NYG A;  1Z9Z A;  2LZ6 B;  2FRY A;  1WX6 A;  2J7I A;  3PVQ A;  1E7O A;  1BB9 A;  2LJ0 A;  4AFQ C;  2GGR A;  5I11 A;  2V1Q A;  1GL5 A;  1PNJ A;  1ZUU A;  2JT4 A;  4LE9 A;  2ROL A;  1YN8 A;  2CH4 W;  1E6G A;  2CUB A;  2DRM A;  1PHT A;  3M0T A;  2A37 A;  1KJW A;  4F17 A;  4RUG A;  3QWX X;  1UE9 A;  5ECA A;  3SHW A;  1QKW A;  3JV3 A;  1GFC A;  4DEX A;  2DF6 A;  4GBQ A;  1YWP A;  4DEY A;  2K3B A;  1XOV A;  2LJ3 A;  1AWW A;  1G2B A;  1YWO A;  4Z89 A;  1SHF A;  2KRS A;  2F2V A;  2KR3 A;  1TUD A;  2B86 A;  2GQI A;  1X69 A;  1JQQ A;  2V1R A;  3H0H A;  2GTO A;  2CDT A;  2LNH B;  2O9V A;  2DE0 X;  2RQT A;  1I0C A;  2FRW A;  2M0Y A;  3NMZ C;  1UG1 A;  4A63 B;  1QKX A;  2YUQ A;  4J9E A;  2EVR A;  2JMA A;  3TSW A;  3EG2 A;  1RLP C;  1AWO A;  1YP5 A;  1ZX6 A;  3C0C A;  1RUW A;  2NUZ A;  2CT3 A;  1QWF A;  4AFS C;  1KIK A;  2RMO A;  1M3B A;  3M0U A;  1PKS A;  1V1C A;  2X3W D;  1SRM A;  3VS1 A;  1U3O A;  1HSQ A;  1GCQ A;  5IXF A;  4OMM A;  4F16 A;  4HVU A;  1M30 A;  2KYM A;  3H41 A;  1K4U S;  2LX7 A;  2FPD A;  1NLP C;  4RTX A;  1Y0M A;  2J05 A;  1ABO A;  3M0S A;  4LNP A;  1W70 A;  5HCK A;  4D8D A;  1AWJ A;  4JZ3 A;  2LCS A;  4RTW A;  2KT8 A;  2DX1 A;  2DL5 A;  1T3S A;  2KXD A;  3EG3 A;  1BU1 A;  1WXU A;  3A98 A;  2DIL A;  3THK A;  2C0O A;  3M0Q A;  2JMC A;  4J9D A;  1T3L A;  1X6G A;  2A08 A;  1NEG A;  1JO8 A;  1OOT A;  1ARK A;  1UJ0 A;  1K0X A;  2JTE A;  4JPB W;  2J6F A;  2AZV A;  2YSQ A;  2BTT A;  2FPE A;  1JXO A;  3NGP A;  1QLY A;  2KE9 A;  3UA7 A;  3NPF A;  4JJC A;  1K76 A;  2EGC A;  3EHQ A;  3H0F A;  2GBQ A;  3VS7 A;  2K9G A;  1RI9 A;  2PNI A;  2LQW A;  1OV3 A;  2CT4 A;  2EYX A;  2K7A A;  1M8M A;  1WDX A;  4IIM A;  1OEB A;  4LUD A;  4K11 A;  2RF0 A;  2DBK A;  2EYW A;  2JS2 A;  2M51 A;  2HSP A;  2YT6 A;  4AG2 C;  2KNB B;  5I22 A;  1VYT A;  2HBW A;  1ZLM A;  1BK2 A;  1QWE A;  3FJ5 A;  1NM7 A;  2J6O A;  1VYV A;  1AVZ C;  4OMQ A;  4AFU C;  1ABQ A;  1SHG A;  1VYU A;  2I0N A;  2CH4 A;  2K6D A;  1AOJ A;  1HJD A;  2YUP A;  3GBQ A;  1WXT A;  1TUC A;  3LH5 A;  2J06 A;  2J6K A;  4J9F A;  2NWM A;  4RTZ A;  2OI3 A;  2O9S A;  2AKL A;  1AZE A;  2FEI A;  3M0P A;  2KEA A;  4RTU A;  1WIE A;  5IH2 A;  1EFN A;  2DMO A;  2EKH A;  3VRY A;  4RTV A;  2C0I A;  3U23 A;  2D0N A;  3UA6 A;  5IXB A;  1ZSG A;  1Z9Q A;  2ED1 A;  1KSW A;  2LQN A;  3H0I A;  2LMJ A;  4EIK A;  2HEQ A;  2EGE A;  1JXM A;  3I5S A;  2RN8 A;  4OMN A;  2AK5 A;  1WI7 A;  3SEM A;  1UFF A;  1AD5 A;  2DYB A;  2YUO A;  3RNJ A;  1AEY A;  2RQR A;  2DRK A;  1YNZ A;  1PWT A;  2EYY A;  2ED0 A;  2MOX A;  2ABL A;  2DL4 A;  2RQU A;  3EHR A;  3ULR B;  2DM1 A;  2CSQ A;  4RTY A;  2O31 A;  2SRC A;  2PZ1 A;  2KRM A;  2K79 A;  2P4R A;  4Z8A A;  3I5R A;  1MUZ A;  2A36 A;  2DA9 A;  2EPD A;  2EW3 A;  3R6N A;  1IO6 A;  4Z88 A;  2KRO A;  2KYB A;  2BZX A;  3NHN A;  2X3X D;  1OPL A;  1M27 C;  1W1F A;  3PE0 A;  4RTT A;  1NYF A;  2DL3 A;  4JJB A;  5L23 A;  2KBT A;  1WYX A;  2AKK A;  2DL7 A;  2RNA A;  3REA B;  3RBB B;  2CRE A;  2ENM A;  2RQW A;  1ZUK A;  1UHC A;  2DJQ A;  1PRL C;  1X6B A;  2ECZ A;  2MIO A;  1E6H A;  5IHK A;  1K9A A;  1N5Z A;  3KFV A;  3VRZ A;  4J9I A;  2AZS A;  2DVJ A;  1UJY A;  5EC7 A;  2K2M A;  2L3Q A;  1GCP A;  1JEG A;  2HCK A;  4ZNX A;  2KRN A;  2DLP A;  4D8K A;  1G83 A;  4HXJ A;  1U06 A;  1VA7 A;  2VWF A;  1SSH A;  2L2P A;  1J3T A;  1CKA A;  3EGU A;  2BZY A;  3UAT A;  2JXB A;  1A0N B;  4LN2 A;  1H8K A;  2G6F X;  2GNC A;  2EGA A;  5FWC A;  4Y92 A;  3VS4 A;  4JJD A;  2YDL A;  4ORZ A;  3REB B;  2L3P A;  3TVT A;  4AFZ C;  4AG1 C;  2KXC A;  1K0S A;  3VS6 A;  1M3A A;  1FYN A;  4WCI A;  2KGT A;  2YUN A;  5IHN A;  1YCS B;  4HVW A;  1TG0 A;  2OAW A;  5FW9 A;  3PVL A;  1B07 A;  1BBZ A;  1UHF A;  2MCN A;  2LJ1 A;  1NLO C;  3EG0 A;  2O2O A;  2O88 A;  2RQV A;  1NEB A;  3I35 A;  4HVV A;  1X2K A;  4LUE A;  4R0K A;  1U5S A;  2VVK A;  1UEC A;  1CSK A;  1T0H A;  1Y57 A;  2FO0 A;  1S1N A;  5FWB A;  1ZUY A;  1WXB A;  1AZG B;  3O5Z A;  4J9H A;  2D8J A;  1JU5 C;  1UUE A;  3IQL A;  3VS3 A;  1T0J A;  2L0A A;  1I1J A;  1WLP B;  4JZ4 A;  2FPF A;  3EG1 A;  4GLM A;  1I07 A;  2EQI A;  1X43 A;  1SPK A;  2VKN A;  1H3H A;  2CUD A;  3ZL7 C;  1GCQ C;  2IIM A;  2E5K A;  4M4Z A;  1FMK A;  2C0T A;  3VS0 A;  2JS0 A;  2HDA A;  1AWX A;  2JM9 A;  1X27 A;  2GTJ A;  1PKT A;  5IHI A;  1KFZ A;  2JM8 A;  1M3C A;  2OJ2 A;  1K1Z A;  4FSS A;  2F2W A;  3VS5 A;  4KRT A;  4OMO A;  1GFD A;  4CC7 A;  2D1X A;  4HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...