1UG1A

Sh3 domain of hypothetical protein baa76854.1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
GSSGSSGASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1010 protein
publication title NMR structure of SH3 domain of Hypothetical protein BAA76854.1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ug1A00
2O9VA 2EVRA 2YUPA 2D1XA 4RUGA 1QKXA 4AG2C 1B3QA 1NYGA 2EYXA 2RQVA 1AWXA 2J6OA 2DYBA 2SRCA 1X6BA 4RTYA 1G83A 1OV3A 1YNZA 4LN2A 1ABOA 1NG2A 2DVJA 1I07A 5EC7A 1YN8A 4OMOA 2AZVA 4Y92A 1QLYA 2MIOA 1FMKA 1K0SA 3H0FA 1T0JA 1X2QA 5IHKA 1HSQA 1Y57A 2O88A 3VS6A 1ARKA 1WXBA 1WXUA 1LCKA 3M0UA 1UFFA 3M0SA 2J05A 4E6RA 1UHCA 1ZUUA 2DX1A 2LJ0A 1V1CA 2IIMA 2OJ2A 3EHRA 2RQWA 1JU5C 4RTTA 2W10A 1WX6A 1W6XA 4HVUA 1OEBA 1KJWA 2D8HA 2LMJA 1WDXA 1VYTA 4D8KA 4DEYA 4Z89A 1K76A 2JS2A 1RI9A 1NYFA 1CKAA 1GRIA 2RQUA 1RLQC 1TUCA 2A37A 2DRKA 2YDLA 2JMAA 1QCFA 2EKHA 3UATA 1E6GA 1U5SA 1YWPA 2AKKA 3A98A 4J9BA 1YP5A 4F14A 2PTKA 3I5SA 2KE9A 2ED0A 2CT4A 4R0KA 4A63B 1JO8A 3M0QA 2LP5A 2A08A 2CT3A 2X3WD 5HCKA 2MOXA 5FWBA 1QWEA 2K79A 3M0RA 4QT7A 2LCSA 3EG2A 1U06A 2OAWA 1T3LA 4RTVA 1JXMA 4J9GA 3O5ZA 2DILA 2CSIA 1SHGA 2RNAA 1ABQA 2L3PA 3NGPA 1ZSGA 2KRSA 1PRLC 2F2XA 1Z9ZA 1M3BA 1JQQA 2ABLA 3NHNA 4KRTA 2CDTA 2KNBB 1BBZA 1S1NA 1ZUKA 3M0PA 4OMMA 2D8JA 4AFUC 1HJDA 2KGTA 2RQRA 3LH5A 4EIKA 4LNPA 4RTXA 1X2KA 4IIOA 3VS4A 3SEMA 1AZEA 1AWJA 2CH4W 1N5ZA 2GQIA 1X27A 2EPDA 2RMOA 4J9FA 1X69A 1EFNA 4J9HA 2PNIA 2KRNA 4RTZA 1YCSB 4AG1C 4RTWA 2EBPA 1GFDA 3UA6A 2B86A 2AKLA 1X43A 2ROTA 3PE0A 2EGAA 4HVVA 2HSPA 1RUWA 1SRLA 1W70A 1QWFA 2AZSA 2VVKA 4CC3A 2J06A 2KROA 3JV3A 1SEMA 2O2OA 4RTUA 4F16A 2I0NA 2KR3A 3NMZC 1VYUA 1X6GA 2DM1A 1AEYA 2FEIA 1SPKA 1AWOA 1SSHA 3IQLA 1K0XA 3RNJA 2CUBA 2JXBA 4FSSA 2M51A 5FW9A 2MCNA 2KXCA 3VS7A 1ZUYA 4HXJA 1NEGA 1NM7A 2P4RA 1BU1A 2A36A 3EG1A 1GL5A 1AD5A 2DRMA 2JTEA 2EYYA 2L3QA 1I1JA 2DE0X 2RN8A 5ECAA 2BZXA 2DL7A 1G2BA 3FJ5A 2QDLA 4JJCA 2EGEA 3I35A 2LNHB 5IH2A 1WYXA 2K3BA 2BZYA 2ENMA 2DL3A 1OPLA 1GBQA 3TVTA 2LJ1A 2YUQA 1HD3A 2JW4A 3M0TA 1K1ZA 2RPNA 1YWOA 2DNUA 1PKTA 1BB9A 2DL4A 1U3OA 2EGCA 3SHWA 1KFZA 3RBBB 3THKA 1WLPB 4HVWA 2NWMA 4DEXA 1CKBA 2HEQA 3EG0A 2FPEA 2VKNA 4GBQA 2DF6A 3I5RA 4ORZA 2F2WA 2JS0A 3NPFA 1M3AA 3VS1A 1CSKA 1NEBA 2C0TA 3EHQA 2JT4A 1TUDA 3PVLA 3PVQA 5L23A 1GFCA 2DJQA 1UE9A 3H0HA 4AFSC 5I22A 2CH4A 2EYZA 2KEAA 2BTTA 2VWFA 1PNJA 2LQWA 2J6KA 2AK5A 1E7OA 3REAB 2GGRA 2FRYA 1M3CA 1UJYA 3EG3A 1WI7A 1GCQC 2OI3A 3H41A 1PRMC 2LJ3A 2BZ8A 4IIMA 1J3TA 3GBQA 1OPKA 2ESWA 2KYMA 1W1FA 2K9GA 2D0NA 2FO0A 4JJDA 1SHFA 2A28A 1UECA 1VYVA 2F2VA 1FYNA 1I0CA 1B07A 2KT8A 1PWTA 1QKWA 5I11A 1OOTA 1UGVA 2GTOA 2NUZA 2JMCA 4Z8AA 1KIKA 4J9DA 2RQTA 2EYWA 2HDAA 2L3SA 1BK2A 2DBMA 1M8MA 2YUNA 5IXFA 1Y0MA 2W0ZA 1WFWA 1UJ0A 4ZNXA 3TSZA 2M0YA 1SRMA 1VA7A 2G6FX 2JM8A 4J9CA 2GTJA 1UHFA 2YUOA 1GCPA 2L2PA 2KRMA 1JXOA 4LUEA 2KBTA 1RLPC 1UTIA 3VS2A 1IO6A 2KYBA 2DBKA 2EQIA 1PHTA 1NLOC 4K11A 2DA9A 4JJBA 1UDLA 2KXDA 1JEGA 2LX7A 3VS5A 1GCQA 2KT1A 1H3HA 3UA7A 1AWWA 2GNCA 4GLMA 3TSWA 2CREA 2V1QA 2E5KA 2H8HA 2ED1A 4X1VA 1GBRA 2FPDA 2EW3A 5IXBA 1M27C 1ZBJA 2XMFA 4JZ3A 4LUDA 4CC7A 2L0AA 2DL8A 2ECZA 3R6NA 3ZL7C 2RF0A 1A0NB 2DLPA 1K9AA 1MV3A 2FG0A 4AFZC 1UUEA 4HCKA 4Z88A 1K4US 1T3SA 1PKSA 2FRWA 3EGUA 3CQTA 5IHIA 3I9QA 4CC2A 3H0IA 4OMLA 4JPBW 2JM9A 4OMQA 5IHNA 2FPFA 2DMOA 2SEMA 1AVZC 1WXTA 2CSQA 2O9SA 2O31A 4LE9A 3VRZA 3ULRB 1H8KA 1H92A 1XOVA 1TG0A 1MUZA 3U23A 5GJWB 3VS3A 1NLPC 2HCKA 4WCIA 2HBWA 2YSQA 2C0IA 1WA7A 3VS0A 3REBB 2LZ6B 2PZ1A 4JZ4A 3QWXX 5FWCA 1WIEA 4OMNA 1Z9QA 4J9IA 3C0CA 2ROLA 2V1RA 1E6HA 5GJVB 2LQNA 2DL5A 1MV0B 4OMPA 2J6FA 3VRYA 2J7IA 3QWYA 1AZGB 4F17A 2K6DA 1T0HA 3UF4A 4AFQC 4CC4B 4ESRA 1AOJA 2CUDA 4M4ZA 2YT6A 3KFVA 1UG1A 2C0OA 2K7AA 1KSWA 4J9EA 1M30A 1ZX6A 4D8DA 1ZLMA 2K2MA 2X3XD 2GBQA
chains in the Genus database with same CATH superfamily
2ZPEB 3F70A 2D1XA 4LDWA 4RUGA 4XAXB 2JTFA 4OB3B 1YJNA 1NYGA 1IGQA 1UGRB 4XTZA 3NTIA 1PSFA 3OSVA 2SRCA 5GAMj 1G83A 2XU8A 4ZGEB 4C92F 1NG2A 2H3JA 1I07A 5EC7A 1YN8A 1UEBA 1QLYA 3CPFA 4EPCA 1FMKA 3V7SA 1X2QA 1HSQA 1Y57A 1M2VB 2O88A 2EWNA 3L2RA 1WXBA 2HSEB 1Q86R 3X26B 2DJZA 3CCQT 3VYHB 4XTWA 4RTTA 4FT4A 3RIRA 1WHLA 5GANe 4PK4A 3CCET 4D8KA 4Z89A 1I4K1 3CCSQ 3MEVA 4NS5A 3P8BB 1TUCA 4M77A 4WTOB 4DBQA 2AKKA 4C8QF 3RR6A 3DLMA 1XJWB 2RK1A 5HY6A 1K8AC 1DJ7B 3NTHA 5GANf 1JO8A 3M0QA 1I5OB 2F69A 4MMLA 4E7JA 1QWEA 3LH0A 3CCLT 3QZ9B 3EG2A 2OTLT 4CRIA 1SF9A 4N4HA 2M0OA 1SHGA 3P8HA 1PG5B 2PUKB 1M1KR 3CD6A 1ABQA 2K5FA 2FYKA 3V8LA 3AHUA 1PRLC 4C92G 5CQYA 1G3SA 4KRTA 3RDVA 3CC2A 1X01A 3EFRA 3G1JA 3EGXA 4LD6A 2VUBA 3SB2A 3OW2S 2BE7D 3QJ6A 1HJDA 4E7LA 2RQRA 4RTXA 4IIOA 2JN0A 2L8DA 1MMDA 2DK3A 1ZA2B 2GF7A 4M75G 1WGSA 2QQSA 4DBFA 3OY9A 1D1BA 3CCQA 4N4GA 2ZPBB 5CQXA 3OS1A 4M7AD 3G7ZA 4J9HA 2PNIA 5GAOn 2BIVA 1NPPA 2ZCFB 4PJOB 3CC7Q 2QG9B 3V8KA 2B86A 2AKLA 4XU3A 4KULA 2XICA 2EGAA 1Q7YU 1LNXA 5FLXE 1SRLA 3HRSA 1W70A 2COWA 4RCCA 1KC8C 1GXIE 3E19A 5GMKh 3OYHA 3RKXA 4KGVB 1VQMT 3N5BB 3PTAA 1WHJA 2K5LA 2KR3A 3SDZA 3M4GA 2Y4XA 3ASKA 1X6GA 3DLLA 2OTLA 5GANg 5CVIA 1WQWA 4FYYB 5KE2A 1K9MR 4C92E 5GAN5 1ZUYA 2CZ6B 5LJ5e 3CCSA 5CIUA 1NM7A 1NE8A 1BU1A 2NLUA 1BI0A 4M7AF 2DRMA 2L3QA 2RN8A 5ECAA 2E6NA 2JUFA 4ELZC 3I35A 4OGCA 3AT1B 1D0XA 2RJDA 2I2LA 3HFNA 1QCNA 1D1AA 2BE9B 4M75E 3TVTA 3QBYA 2RD1A 3M0TA 1K1ZA 2VC8A 3CCRT 1YCYA 1Q82U 1YWOA 3EG9A 3OYMA 4M77B 1VQLT 4J7IA 1SG5A 1U3OA 5AT1B 1VQ7T 2QTVA 1TWBA 3M53A 2X4YA 4HCZA 3THKA 1WLPB 2L5QA 1VQKT 1CKBA 3EG0A 5A0DA 1JB0E 1UGSB 1MMAA 4B9WA 2KQWA 1M3AA 1R0CB 3LWHA 1U1TA 3H8ZA 3OBYA 4JJNK 3PVLA 2XI9A 4ME7A 1UE9A 4LDYA 3H0HA 1VQMA 2LTOA 2LQWA 1N6AA 1VQ4Q 2FRYA 1VQOT 3EG3A 4QVZA 2YRVA 2OI3A 3H41A 1YJWT 2PVGB 1OPKA 4PKCC 3FLGA 1W1FA 1Y96B 4EMKA 2CGHA 3JCMh 5GAN2 2A28A 4FIBA 2EQJA 4XU1A 1M5Q1 2Y4YA 3EGXB 1G3WA 1LPLA 2KT8A 2IPOB 1PWTA 4M7AG 5FRNA 3G6EA 4RCBA 4A4EA 1VUBA 4Z8AA 3QXEB 2L3SA 1JJ2S 3GNFB 1EZZB 1M4ZA 1RAAB 1WHMA 4FYVB 1VQNT 5CKHA 1RL2A 3BW1A 2CP5A 4HT9A 3JCMW 1QVFS 2CS7A 2G6FX 4J9CA 2RHYA 1TU0B 2EJ9A 3CMEQ 4FCYA 2L2PA 3JB9J 3CCRA 2QA4Q 3EFSA 2KBTA 5LJ5g 3VS2A 2MPXC 2DBKA 1VQLA 1NLOC 1O75A 4K11A 2HBPA 1VQ7A 1M1FA 3CPWA 1UDLA 4BI3A 1O9SA 1GCQA 4KUDK 2IG0A 1VIEA 2V1QA 2VB6A 2E5KA 2E10A 1TS9A 1BCMA 2YRCA 2A3LA 1G3TA 4LXCA 5IXBA 5DLOA 1M27C 2GQVA 2GCXA 2L0AA 2FL7A 2P0PA 4Q5WA 4QQGA 3ZL7C 3LGFA 1MV3A 4AFZC 1MMGA 1UUEA 4HCKA 1MGQA 5GANh 1K4US 1IREB 3H9NA 5J39A 2DZCA 2X4JA 1YJWA 3EFOA 2LT1A 8AT1B 4OMLA 2KAFA 2XDDA 3OYEA 4CI0C 2V26A 2SEMA 5AYFA 5FU7B 2CSQA 4M7AE 2O31A 1NBEB 2QQRA 4BDZA 4QQ6A 2DEQA 1YITT 1H8KA 4Y91A 1OU8A 1XOVA 1S72T 4HT8A 1YHQQ 3CC4Q 1Q95G 2QEXT 2ZPIB 5HKCA 5GJWB 4C0GA 2YSQA 1WA7A 4JS5A 5D6XA 3CCUQ 3BY7A 2WSEE 3L2QA 3EG9B 1VQ4A 2PZ1A 1KQ2A 2FZGB 1WIEA 1Z9QA 1HXDA 4MZMA 9ATCB 3G4ST 2EQUA 2J6FA 4FL6A 4F7UA 3QYHB 4AFQC 4ESRA 2M1HA 2CYZB 3MHXA 4M4ZA 2YT6A 1UG1A 3BDUA 3KBGA 4C5GA 3J81E 4JRPA 5I2MA 4J9EA 1M30A 4M78C 1ZLMA 2X9HA 2X3XD 1ACMB 5GMKe 2O9VA 4V2SA 1R8OB 4FW2A 4EMKB 1B3QA 4N4IA 1RAGB 2GFAA 1AWXA 2J6OA 4GLKA 3CMEA 1X6BA 1Q81R 1OV3A 5C6SA 4AT1B 2QA4A 2LNVA 5KYNA 2DXTA 3CXCS 1V76A 2DO3A 4FU6A 3QUIA 3H0FA 1Q86U 3X20B 5KYYA 4PJMA 4OB1B 1YI2Q 2EAYA 2RB6A 1V29B 5GAN3 1WXUA 4E6RA 2EYQA 1ZUUA 2MAMA 2IIMA 2QDYB 4XU0A 1Q7YC 3EHRA 3M5AA 5I21A 5A2QE 2LX9A 1WX6A 1W6XA 1OEBA 2WACA 2D8HA 5LJ5h 1N9RA 1K76A 2JS2A 1NYFA 1CKAA 2XG8D 2A37A 1B34B 2MWPA 2YDLA 4PJNA 2JMAA 1QCFA 2EKHA 2XHCA 3UATA 1IHWA 4F14A 4PLLA 2PTKA 2V8JA 3I5SA 2KE9A 1QW1A 1PD0A 2G3RA 2ED0A 4JDSA 2MK5A 2ZPHB 1TSFA 4A63B 3RMQA 2CT3A 5HCKA 1PD1A 1M1KU 3CBMA 2LVMA 5FWBA 3M0RA 4OMFB 4QT7A 4J6WA 3O8VA 2KDSA 5GAMd 3CC4A 1T3LA 4HCBA 1H641 4J9GA 3O5ZA 3PGGA 3EFOB 4M7DC 3ME9A 5D7UA 3I55T 2F2XA 2ABLA 2RM4A 3NHNA 4A4FA 3CC2Q 2OTJT 1M9SA 4XTVA 4J8OA 3OMCA 1ZUKA 4LD9K 4C0FA 2QK0A 2D8JA 4E7KA 5L8RE 2X35A 1Q82C 2LQ8A 4M77F 5HK3A 1AZEA 2GQIA 3JCMf 2EPDA 3CCQQ 1M90U 2RMOA 4C8QD 1EFNA 1RAEB 3CCVT 3CCEQ 1KK7A 3RKWA 4J6XA 2JTMA 2QQ9A 4L5GA 1KQ1A 4BE1A 4JRKA 3HKSA 3OYGA 1RUWA 4F7UB 4E47A 2O4XA 1QWFA 3WVEB 4ZGJB 1YIJA 1QVGS 4IUUA 4CC3A 1C1AA 3RMSA 2LDMA 1W2BA 1KQSS 1UB4A 3UWNA 3DKMA 1YI2A 3RERA 3CCLQ 1K9MU 2NYSA 2OTLQ 5GMKm 1ZSZA 2LRQA 4HKEA 3IQLA 1K0XA 4UC4A 2CUBA 3TEEA 3NFCA 2MCNA 1RADB 3RESA 3I55A 4MZPA 3R6OA 2KVQG 3OMGA 4II1A 1YFNA 1NEGA 2QQAA 4M78D 3SWNA 5KYYB 3MP1A 3A8OB 4PFPA 4QVCA 2E3IA 1ZA1B 3PMIA 3EG1A 2H3EB 3QIIA 1GL5A 1I1JA 1G2BA 1OU9A 3FJ5A 2EGEA 3C4SA 2HQEA 5IH2A 4OGEA 2DL3A 4DA4A 1TH7A 2EJFA 1IZ6A 2LJ1A 2YUQA 1MHNA 2NUTA 2XK0A 2RPNA 2MMPA 1BB9A 2DL4A 4QW2A 3RBBB 1PC0A 4DEXA 3JCMg 2DF6A 2F2WA 2C0TA 3EHQA 2JT4A 1TUDA 2GFUA 1SSFA 4C92A 3OA6A 2DJQA 5I22A 1VQMQ 2CH4A 2VWFA 2YLCA 2DD5A 1QP2A 1R77A 3KXTA 1K73R 4M78F 1M3CA 1UJYA 2NUPA 1AHJB 3FC3A 2LJ3A 2BZ8A 4MDWA 3GBQA 1OULA 2E3HA 4J6YA 1SHFA 3VU3C 2DVEA 3EH1A 4M75A 1WPYA 5CKBA 3CCEA 1QKWA 4C8QG 3G6EQ 1M90R 5I11A 1I5LA 3P8DA 1UGVA 2XD0A 2E64A 2GTOA 4XTXA 2JMCA 1KIKA 2HD0A 4KT0E 4J9DA 2RQTA 3CPWP 2EYWA 2ZGWA 4M7DD 1M8MA 4C8QA 4DBHA 1Y0MA 4FW1A 4N0AC 1WFWA 1UJ0A 2FB7A 4HCCA 5IN1A 2F5KA 3TSZA 2COYA 4KBMB 1SRMA 4PFOA 4DOWA 2R5AA 2GTJA 3CCLA 2DERA 5GAMe 2CP0A 3D7SB 3CCRQ 2KRMA 1KD1R 4LUEA 1IO6A 1VQLQ 1QCOA 2HMAA 2KI7A 4E7HA 3I56T 4PJLA 2LCLA 1VQ7Q 1FXXA 2CKKA 1JEGA 3VKIA 1W4SA 3VS5A 1VQKQ 1PM3A 2GNCA 2M02A 3VJPA 5GAMf 2CREA 4XTYA 4NL2A 2ED1A 2YLBA 4ZN1A 2MWOA 2AHJB 3CCJT 4M78G 1QMCA 2EW3A 4PJJA 2XMFA 4LUDA 3A5ZB 2WSFE 4RG8A 1ZSZB 3X24B 5LJ5f 1K9AA 4PJOC 1YBYA 1VQOQ 1U8RA 3DB4A 3CC7T 2BKDN 1PKSA 2FRWA 3EGUA 1YJWQ 1Q86C 4M7DF 2CZ7B 3H0IA 4OMQA 3SWNB 2FPFA 1Y71A 3M56A 1AVZC 4C8QE 3VRZA 2E1HA 3HRTA 3ULRB 4FSXA 3JB9H 2XDBA 2K5IA 1TG0A 5KCOA 2R5MA 3L42A 2PUOB 4L59A 1VQNQ 2HCKA 3GIBA 1ZQ1A 2D0QB 3E2UA 3M55A 2NUTB 4X9DA 3VS0A 4E7ZA 2P84A 2X4XA 3VYGA 3QWXX 5FWCA 4J9IA 3L2VA 3C0CA 1E6HA 2M9UA 3A1PA 5LJ3j 2E65A 1M1KC 3OW2A 4OMPA 2DAQA 4OVAA 2J7IA 2DYIA 4QVDA 4C92B 2KMTA 1AOJA 3C94A 2DEUA 3NTKA 2C0OA 4ZTFA 1VQ9T 4D8DA 4M78E 2K2MA 1FMWA 4M77C 2VXEA 3V7RA 4BE0A 4M7AA 4MZTA 1QVFP 2YUPA 3T9NA 1Q81U 5GAMg 2JOYA 1QKXA 4M7DG 3ER0A 1VQ6T 2EYXA 3FJPA 2DYBA 3OYYA 4BI8B 4M75B 1MNEA 2K4YA 5CO7A 2YHTA 4LN2A 3FDRA 3MEAA 4E7SA 2Z0WA 4OMOA 2AZVA 4EDUA 2DETA 2LT4A 2MIOA 1T0JA 2ZPFB 1VQKA 4ZGDB 5FROA 5IHKA 1M90C 1YITQ 3ZFJA 4A54A 1ARKA 3GLXA 3M0UA 1LCKA 1S72Q 1UFFA 1IRXA 3M0SA 2J05A 2QEXQ 2LJ0A 4C0DB 1V1CA 4OP0A 1VQ5T 1KJWA 2LMJA 1VQOA 1WDXA 5A0GA 1VYTA 4MMKA 2F5TX 1RI9A 3H6ZA 1GRIA 5I2SA 1RLQC 1TUGB 1XQHA 3JCMX 3G71T 1VQPT 1E6GA 1Y7XA 2BUDA 1U5SA 1YWPA 4J9BA 3A98A 3G4SQ 4BD3A 1K9MC 4R0KA 3HHTB 5KE3A 2A08A 4A4KA 2X3WD 1R0BG 3OS0A 4E7IA 2OAWA 4RTVA 2MI6A 4VUBA 3CCMT 2CSIA 1VQNA 1XNIA 1QVPA 4M7DE 2RNAA 3CMAT 2L3PA 2JJ9A 2VYTA 3NGPA 4J5YA 2KRSA 1G3YA 1VQ6A 1NJIR 2F1LA 2K3YA 3CEYA 1JQQA 1N27A 2CDTA 1F1BB 2JVVA 1OX8A 3A8HB 3PMTA 1FWZA 4J7FA 1BBZA 1S1NA 3GF5A 4C0DC 2QTXA 5HK0A 4BUGA 4AFUC 4PJOD 3HTRA 1YJ9T 3C95A 1RACB 4BY6B 2VXFA 4EIKA 4LNPA 3MP6A 6AT1B 3VS4A 3SEMA 2DTHA 4QQDA 4XK8E 2RH2A 4KGZB 4HA8A 5KH6A 1N9SA 1D0YA 2LQKA 1G5VA 3C12A 1N5ZA 3BDLA 1X27A 1W2BP 1IHVA 2YXYA 4J9FA 1X69A 5FU7C 2KRNA 1VQ5A 4J83A 1EX4A 2P0KA 5IT9E 1M2OA 4RTZA 2L3RA 2RO0A 4RTWA 3VV0A 4AG1C 3UA6A 4JRIA 4FYWB 2DD4A 3PE0A 4HVVA 2HSPA 3CXCP 2HKQB 3PT9A 1YHQT 1YIJQ 3FRNA 1JJ2A 4C5HA 3TREA 1PSEA 2J06A 3KUFA 2V8KA 5CR2A 1N8RU 4M7AB 4F16A 2QASA 4ATOA 1QVFA 1YITA 3UPUA 1M1GA 5GAMh 5D6WA 1S72A 4F04B 1AEYA 2FEIA 3Q1JA 1RI0A 4IUPA 1C0MA 4JUVA 5CK9A 2QEXA 4PJOF 3RNJA 3BFMA 5CKDA 2JXBA 4FSSA 2V8IA 3CMAA 5FW9A 2KXCA 3I55Q 3OYIA 3VS7A 2CP6A 5GANj 4HXJA 3TCJA 3OYFA 2QYZA 4M77D 1WQ7A 3WVDB 2JTEA 4R56A 3G4SA 5CKFA 3JAME 3QHSA 2BZXA 3VUBA 2DL7A 4Z02A 4JJCA 4EMKC 1RABB 2DIQA 4D6WA 3PNWC 1WYXA 2K3BA 5FU6B 2ZPGB 2BZYA 2ENMA 1YJNT 2PVOB 1OPLA 2VGMA 1VQ8T 3V8JA 1HD3A 2JW4A 3MEUA 5KYXA 3QG1A 2RHZA 4OB0B 2HAXA 1PKTA 2IVWA 4XQ3A 5GAN4 3CCVQ 2EGCA 2EQMA 1KFZA 4HVWA 2NWMA 2VKNA 3M4YA 3I5RA 3LWIA 3JCMV 1G8XA 2JS0A 3NPFA 3VS1A 1NEBA 3HPWA 1TOVA 2QXFA 4B9XA 1K73U 2D6FA 4OF1A 3PVQA 5L23A 1GFCA 2HQXA 3RKYA 2VGNA 3S6WA 2EYZA 3ZEHA 2J6KA 3JCMP 1E7OA 3REAB 2K57A 2HZYA 4PJOG 1BKBA 1GCQC 4EMGA 4IIMA 1PRMC 4JRQA 1J3TA 2DPPB 2KYMA 2K9GA 3HSBA 1KC8R 2D0NA 2FO0A 4JJDA 2RHXA 2RI3A 4JLGA 1VYVA 2F2VA 1FYNA 1WHHA 2R57A 3URGA 1QVGP 4BI4A 3JCMQ 2HDAA 1BK2A 2DBMA 2YUNA 5IXFA 2P0QA 4KUIA 2W0ZA 3CD6T 3JCMJ 1KD1U 1IB8A 3JCMc 3V7CA 2XKOC 1VA7A 4O6JA 1VQ8A 1UHFA 2YUOA 1MNDA 3OYNA 3CC2T 1N8RR 1JXOA 2KYBA 5C0MA 1PHTA 1D09B 3CXCA 5J3BA 2HQHA 2DA9A 2PVDB 2LX7A 2KT1A 1H3HA 5LJ5j 1AWWA 4GLMA 2CZ1B 4PNOA 1Q81C 2OTJA 1HK9A 3L2WA 3QDFA 4KH0B 1BYMA 1WJSA 1GBRA 4RKUE 3ZBDA 4JZ3A 4IUTA 4CC7A 4M77G 3FEOA 2ECZA 3R6NA 4M75F 1BIBA 2FZCB 2RF0A 2DLPA 1A0NB 2FG0A 4PJOE 1T3SA 4FM4B 3CQTA 4CC2A 4Y28E 2AIRB 4JPBW 2JM9A 4A4GA 1WXTA 3CCVA 4LE9A 2ATCB 5GAN8 1H92A 2R58A 1QP3A 1HYOA 3OW2P 2L89A 5EG2A 2WSCE 3VS3A 2RHUA 3L1AA 2HBWA 2C0IA 4JS4A 5KYXB 1KG1A 1FMVA 2VASA 5DM7R 3OB9A 5FRMA 1SKUB 2E70A 3MKDA 4JZ4A 3CCST 2A0FB 5D6YA 1Y96A 4QKUA 4EMHA 5KYUA 3PIOA 4PLIA 2V1RA 1RAHB 3I56Q 5GJVB 1WJQA 3S3NA 1AZGB 3LW5E 2K6DA 2B8AA 2CUDA 1D3BA 1BCOA 1BI3A 2MF2A 3M54A 1PCXA 1ZX6A 1X6OA 2LCCA 3CCJQ 4M77E 5LJ3h 2FVUA 2EVRA 3OQ5A 2RJCA 1IXDA 3LX7A 4AG2C 1WHKA 1WJRA 2RQVA 2E6ZA 2D9TA 4GY5A 4RTYA 4ANJA 1YNZA 2CP7A 3OYDA 1ABOA 2DVJA 1QVGA 1X75C 3L2ZA 4Y92A 3CPWS 3EH2A 2O4XB 1K0SA 2QI2A 1KQSA 2MYSA 2QAZA 2E4HA 3MP8A 1LJOA 2EIFA 1D1CA 1I81A 1P92A 3VS6A 4BACA 1JBMA 3MJXA 2RI2A 1UHCA 3HRUA 2DX1A 4MDXA 5CKEA 1NPRA 5GAOm 4KH1B 3L2UA 2OJ2A 2RJEA 2RQWA 5LJ3d 1JU5C 1IGUA 2W10A 3WXMB 1B7TA 4HVUA 1KHIA 2COZA 4AMCA 4DEYA 3EAEA 5LL6S 3G6ET 2DFUA 4M78A 2RQUA 2DRKA 2PU9B 3LGLA 2QGFB 5GMKl 2FHDA 1N8RC 2DIGA 1YP5A 3JCMb 2KK4A 4IKFA 3LYIA 3MO8A 2CT4A 4DQ2A 2JNGA 2LP5A 2OAUA 3QO3A 5GAOp 4ZTJA 2RHIA 2MOXA 3JSCA 3UT1A 2K79A 2LCSA 4DBRA 1VQ9Q 2RA2A 1TXQA 3RUXA 1U06A 2K3XA 3X25B 1JXMA 1NJIU 1FX7A 2DILA 3E9FA 4PL6A 3CBOA 5A0LA 5GAN6 1ZSGA 1VQ6Q 2ZAEA 2DZ9A 1Z9ZA 1M3BA 2EFIA 3OYCA 2KNBB 3M0PA 3OS5A 3VUZA 2O01E 4LDVA 2DXCA 4OMMA 4RG2A 3SD4A 3I56A 1ZSZC 2DTOA 2KGTA 3OYAA 3LH5A 1X2KA 5IAYA 1JJ2P 1C6VX 1BI1A 4P5NA 4R55A 1AWJA 2OX7A 2CH4W 3TU4K 3SWNC 1D0ZA 2NUPB 5GAOq 3CCJA 5GMKj 5KYUB 2DTIA 1VQ5Q 1OZ3A 4O5VA 3JB9D 1YCSB 2EBPA 1K73C 1GFDA 4OB2B 3CC7A 2RK2A 1X43A 2ROTA 3QPHA 3A8MB 1WNLA 4IUQA 1H3ZA 3G71Q 1VQPQ 4PFZA 3HL8A 4ZN3A 4C0ZA 1D3BB 4M7DA 2RJFA 3TQ7P 2AZSA 2VVKA 1EIFA 2KROA 3QZ5B 3JV3A 1Q7YR 2Y90A 3E9GA 3GP8A 2YRDA 1SEMA 2O2OA 2CZ0B 3GNGA 4RTUA 4C8QB 5KYWA 4X9CA 1VQ4T 4LDXA 2I0NA 3NMZC 1VYUA 4XU2A 1K8AU 5CAIA 4KGXB 4IURA 2DM1A 1OYXA 2QGGA 1SPKA 1AWOA 3CCMQ 1SSHA 4BB7A 1VOMA 2M51A 3JCMd 3CMAQ 4C92C 4F7UF 1B34A 2QQBA 2X4WA 2HL5C 3HP9A 4WF2A 5M9OA 3EGDA 3MPUB 2DXUA 2P4RA 3BE3A 2A36A 4NL3A 3FB9A 1KD1C 1AD5A 2AT1B 2EYYA 3A8LB 2DE0X 1YJ9Q 3OYBA 4L6V5 2X51A 3JB9F 2P4TA 2QDLA 2LNHB 2VV5A 4LDUA 4B6MA 4M75C 1GBQA 3CMET 1VQ9A 4TVRA 3QYGB 4M78B 2FZKB 5GAOl 3OYKA 2QA4T 1U1SA 2DNUA 1BIAA 1RAIB 4FYXB 3A8GB 3LLRA 4DOVA 2ZZDA 4C8QC 3SHWA 1OI1A 2EJGA 1AT1B 1Q82R 2HEQA 2FPEA 4GBQA 3M57A 4ORZA 2A7YA 1CSKA 4ELYC 4YTLA 4AFSC 2KEAA 2BTTA 2E41A 1PNJA 4FT2A 2AK5A 1KC8U 2GGRA 3X28B 5GANd 1WI7A 2CP3A 5GAOr 1WZOA 3FIFA 3JRZA 3META 4F7UG 4E2FB 2ESWA 3PFSA 5LJ3e 1TTHB 1UECA 1VIFA 5DY9A 1I0CA 1B07A 1JRIA 3UDCA 3M58A 2XDPA 1OOTA 2NUZA 3JB9G 3G71A 1BI2A 1XTDA 1VQPA 1NZ9A 3MEWA 2EKOA 5LJ3f 2KSSA 2HKNA 3CC4T 1M2VA 4BDYA 1W2BS 3OBWA 5J26A 4A4HA 3CBPA 4ZNXA 3CCUT 2M0YA 1YJNQ 2E5QA 2JM8A 4A53A 1VQ8Q 2JZ2A 1GCPA 4C5IA 1OQKA 3DB3A 3CCMA 1RLPC 1UTIA 3J80E 2EQIA 3M9QA 4NOYA 1RAFB 3M59A 1K8AR 4BY6C 4JJBA 2KXDA 4M7DB 1ZBXA 3UA7A 1UGQB 1Y07A 3TSWA 4BE2A 3JB9I 2H8HA 1QQJA 5KYWB 4IUVA 2LC4A 2OTJQ 3QDRB 2PQWA 4X1VA 2FPDA 3OYJA 1ZBJA 2M16A 1YJ9A 2DL8A 4RMOA 3INZA 4XTUA 4Z88A 5GAN7 3SFMA 1ZHIA 2K2VA 4F7UE 5IHIA 3I9QA 3S3OA 3OYLA 3EGDB 4N0AA 5DLQE 5IHNA 1YIJT 3QSUA 2DMOA 8ATCB 4M7AC 2YWWA 4C5EA 2O9SA 1WHGA 1LVKA 1YI2T 2RI5A 1OZ2A 2DXBA 7AT1B 1MUZA 1YHQA 2HL3A 3QJYA 5GMKi 3QKJA 3U23A 4C92D 1NLPC 2CP2A 4WCIA 3CD6Q 3MCAB 2HNIA 1LOJA 3OSSC 3REBB 3CCUA 5CCAA 2LZ6B 3HFOA 4JLIA 3J7AF 5LJ3g 5LJ5d 4OMNA 1I8FA 3S3MA 2C06A 2ROLA 1OX9A 3JCMe 2LQNA 4PJOA 2DL5A 1MV0B 3PIPA 3VRYA 2XIDA 5FU6C 3QWYA 1M8VA 4M75D 1UGPB 3OS2A 1MMNA 2E12A 1T0HA 3E1SA 3UF4A 4CC4B 4F17A 1NJIC 2EQKA 4X34A 5KCHA 3KFVA 2DKGA 2KY9A 2K7AA 1KSWA 1KHCA 3GOXA 3GPLA 1KQSP 2GBQA
chains in the Genus database with same CATH topology
2O9VA 2EVRA 2YUPA 2D1XA 4RUGA 1QKXA 4AG2C 1B3QA 1NYGA 2EYXA 2RQVA 1AWXA 2J6OA 2DYBA 2SRCA 1X6BA 4RTYA 1G83A 1OV3A 1YNZA 4LN2A 1ABOA 1NG2A 2DVJA 1I07A 5EC7A 1YN8A 4OMOA 2AZVA 4Y92A 1QLYA 2MIOA 1FMKA 1K0SA 3H0FA 1T0JA 1X2QA 5IHKA 1HSQA 1Y57A 2O88A 3VS6A 1ARKA 1WXBA 1WXUA 1LCKA 3M0UA 1UFFA 3M0SA 2J05A 4E6RA 1UHCA 1ZUUA 2DX1A 2LJ0A 1V1CA 2IIMA 2OJ2A 3EHRA 2RQWA 1JU5C 4RTTA 2W10A 1WX6A 1W6XA 4HVUA 1OEBA 1KJWA 2D8HA 2LMJA 1WDXA 1VYTA 4D8KA 4DEYA 4Z89A 1K76A 2JS2A 1RI9A 1NYFA 1CKAA 1GRIA 2RQUA 1RLQC 1TUCA 2A37A 2DRKA 2YDLA 2JMAA 1QCFA 2EKHA 3UATA 1E6GA 1U5SA 1YWPA 2AKKA 3A98A 4J9BA 1YP5A 4F14A 2PTKA 3I5SA 2KE9A 2ED0A 2CT4A 4R0KA 4A63B 1JO8A 3M0QA 2LP5A 2A08A 2CT3A 2X3WD 5HCKA 2MOXA 5FWBA 1QWEA 2K79A 3M0RA 4QT7A 2LCSA 3EG2A 1U06A 2OAWA 1T3LA 4RTVA 1JXMA 4J9GA 3O5ZA 2DILA 2CSIA 1SHGA 2RNAA 1ABQA 2L3PA 3NGPA 1ZSGA 2KRSA 1PRLC 2F2XA 1Z9ZA 1M3BA 1JQQA 2ABLA 3NHNA 4KRTA 2CDTA 2KNBB 1BBZA 1S1NA 1ZUKA 3M0PA 4OMMA 2D8JA 4AFUC 1HJDA 2KGTA 2RQRA 3LH5A 4EIKA 4LNPA 4RTXA 1X2KA 4IIOA 3VS4A 3SEMA 1AZEA 1AWJA 2CH4W 1N5ZA 2GQIA 1X27A 2EPDA 2RMOA 4J9FA 1X69A 1EFNA 4J9HA 2PNIA 2KRNA 4RTZA 1YCSB 4AG1C 4RTWA 2EBPA 1GFDA 3UA6A 2B86A 2AKLA 1X43A 2ROTA 3PE0A 2EGAA 4HVVA 2HSPA 1RUWA 1SRLA 1W70A 1QWFA 2AZSA 2VVKA 4CC3A 2J06A 2KROA 3JV3A 1SEMA 2O2OA 4RTUA 4F16A 2I0NA 2KR3A 3NMZC 1VYUA 1X6GA 2DM1A 1AEYA 2FEIA 1SPKA 1AWOA 1SSHA 3IQLA 1K0XA 3RNJA 2CUBA 2JXBA 4FSSA 2M51A 5FW9A 2MCNA 2KXCA 3VS7A 1ZUYA 4HXJA 1NEGA 1NM7A 2P4RA 1BU1A 2A36A 3EG1A 1GL5A 1AD5A 2DRMA 2JTEA 2EYYA 2L3QA 1I1JA 2DE0X 2RN8A 5ECAA 2BZXA 2DL7A 1G2BA 3FJ5A 2QDLA 4JJCA 2EGEA 3I35A 2LNHB 5IH2A 1WYXA 2K3BA 2BZYA 2ENMA 2DL3A 1OPLA 1GBQA 3TVTA 2LJ1A 2YUQA 1HD3A 2JW4A 3M0TA 1K1ZA 2RPNA 1YWOA 2DNUA 1PKTA 1BB9A 2DL4A 1U3OA 2EGCA 3SHWA 1KFZA 3RBBB 3THKA 1WLPB 4HVWA 2NWMA 4DEXA 1CKBA 2HEQA 3EG0A 2FPEA 2VKNA 4GBQA 2DF6A 3I5RA 4ORZA 2F2WA 2JS0A 3NPFA 1M3AA 3VS1A 1CSKA 1NEBA 2C0TA 3EHQA 2JT4A 1TUDA 3PVLA 3PVQA 5L23A 1GFCA 2DJQA 1UE9A 3H0HA 4AFSC 5I22A 2CH4A 2EYZA 2KEAA 2BTTA 2VWFA 1PNJA 2LQWA 2J6KA 2AK5A 1E7OA 3REAB 2GGRA 2FRYA 1M3CA 1UJYA 3EG3A 1WI7A 1GCQC 2OI3A 3H41A 1PRMC 2LJ3A 2BZ8A 4IIMA 1J3TA 3GBQA 1OPKA 2ESWA 2KYMA 1W1FA 2K9GA 2D0NA 2FO0A 4JJDA 1SHFA 2A28A 1UECA 1VYVA 2F2VA 1FYNA 1I0CA 1B07A 2KT8A 1PWTA 1QKWA 5I11A 1OOTA 1UGVA 2GTOA 2NUZA 2JMCA 4Z8AA 1KIKA 4J9DA 2RQTA 2EYWA 2HDAA 2L3SA 1BK2A 2DBMA 1M8MA 2YUNA 5IXFA 1Y0MA 2W0ZA 1WFWA 1UJ0A 4ZNXA 3TSZA 2M0YA 1SRMA 1VA7A 2G6FX 2JM8A 4J9CA 2GTJA 1UHFA 2YUOA 1GCPA 2L2PA 2KRMA 1JXOA 4LUEA 2KBTA 1RLPC 1UTIA 3VS2A 1IO6A 2KYBA 2DBKA 2EQIA 1PHTA 1NLOC 4K11A 2DA9A 4JJBA 1UDLA 2KXDA 1JEGA 2LX7A 3VS5A 1GCQA 2KT1A 1H3HA 3UA7A 1AWWA 2GNCA 4GLMA 3TSWA 2CREA 2V1QA 2E5KA 2H8HA 2ED1A 4X1VA 1GBRA 2FPDA 2EW3A 5IXBA 1M27C 1ZBJA 2XMFA 4JZ3A 4LUDA 4CC7A 2L0AA 2DL8A 2ECZA 3R6NA 3ZL7C 2RF0A 1A0NB 2DLPA 1K9AA 1MV3A 2FG0A 4AFZC 1UUEA 4HCKA 4Z88A 1K4US 1T3SA 1PKSA 2FRWA 3EGUA 3CQTA 5IHIA 3I9QA 4CC2A 3H0IA 4OMLA 4JPBW 2JM9A 4OMQA 5IHNA 2FPFA 2DMOA 2SEMA 1AVZC 1WXTA 2CSQA 2O9SA 2O31A 4LE9A 3VRZA 3ULRB 1H8KA 1H92A 1XOVA 1TG0A 1MUZA 3U23A 5GJWB 3VS3A 1NLPC 2HCKA 4WCIA 2HBWA 2YSQA 2C0IA 1WA7A 3VS0A 3REBB 2LZ6B 2PZ1A 4JZ4A 3QWXX 5FWCA 1WIEA 4OMNA 1Z9QA 4J9IA 3C0CA 2ROLA 2V1RA 1E6HA 5GJVB 2LQNA 2DL5A 1MV0B 4OMPA 2J6FA 3VRYA 2J7IA 3QWYA 1AZGB 4F17A 2K6DA 1T0HA 3UF4A 4AFQC 4CC4B 4ESRA 1AOJA 2CUDA 4M4ZA 2YT6A 3KFVA 1UG1A 2C0OA 2K7AA 1KSWA 4J9EA 1M30A 1ZX6A 4D8DA 1ZLMA 2K2MA 2X3XD 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9V A;  2EVR A;  2YUP A;  2D1X A;  4RUG A;  1QKX A;  4AG2 C;  1B3Q A;  1NYG A;  2EYX A;  2RQV A;  1AWX A;  2J6O A;  2DYB A;  2SRC A;  1X6B A;  4RTY A;  1G83 A;  1OV3 A;  1YNZ A;  4LN2 A;  1ABO A;  1NG2 A;  2DVJ A;  1I07 A;  5EC7 A;  1YN8 A;  4OMO A;  2AZV A;  4Y92 A;  1QLY A;  2MIO A;  1FMK A;  1K0S A;  3H0F A;  1T0J A;  1X2Q A;  5IHK A;  1HSQ A;  1Y57 A;  2O88 A;  3VS6 A;  1ARK A;  1WXB A;  1WXU A;  1LCK A;  3M0U A;  1UFF A;  3M0S A;  2J05 A;  4E6R A;  1UHC A;  1ZUU A;  2DX1 A;  2LJ0 A;  1V1C A;  2IIM A;  2OJ2 A;  3EHR A;  2RQW A;  1JU5 C;  4RTT A;  2W10 A;  1WX6 A;  1W6X A;  4HVU A;  1OEB A;  1KJW A;  2D8H A;  2LMJ A;  1WDX A;  1VYT A;  4D8K A;  4DEY A;  4Z89 A;  1K76 A;  2JS2 A;  1RI9 A;  1NYF A;  1CKA A;  1GRI A;  2RQU A;  1RLQ C;  1TUC A;  2A37 A;  2DRK A;  2YDL A;  2JMA A;  1QCF A;  2EKH A;  3UAT A;  1E6G A;  1U5S A;  1YWP A;  2AKK A;  3A98 A;  4J9B A;  1YP5 A;  4F14 A;  2PTK A;  3I5S A;  2KE9 A;  2ED0 A;  2CT4 A;  4R0K A;  4A63 B;  1JO8 A;  3M0Q A;  2LP5 A;  2A08 A;  2CT3 A;  2X3W D;  5HCK A;  2MOX A;  5FWB A;  1QWE A;  2K79 A;  3M0R A;  4QT7 A;  2LCS A;  3EG2 A;  1U06 A;  2OAW A;  1T3L A;  4RTV A;  1JXM A;  4J9G A;  3O5Z A;  2DIL A;  2CSI A;  1SHG A;  2RNA A;  1ABQ A;  2L3P A;  3NGP A;  1ZSG A;  2KRS A;  1PRL C;  2F2X A;  1Z9Z A;  1M3B A;  1JQQ A;  2ABL A;  3NHN A;  4KRT A;  2CDT A;  2KNB B;  1BBZ A;  1S1N A;  1ZUK A;  3M0P A;  4OMM A;  2D8J A;  4AFU C;  1HJD A;  2KGT A;  2RQR A;  3LH5 A;  4EIK A;  4LNP A;  4RTX A;  1X2K A;  4IIO A;  3VS4 A;  3SEM A;  1AZE A;  1AWJ A;  2CH4 W;  1N5Z A;  2GQI A;  1X27 A;  2EPD A;  2RMO A;  4J9F A;  1X69 A;  1EFN A;  4J9H A;  2PNI A;  2KRN A;  4RTZ A;  1YCS B;  4AG1 C;  4RTW A;  2EBP A;  1GFD A;  3UA6 A;  2B86 A;  2AKL A;  1X43 A;  2ROT A;  3PE0 A;  2EGA A;  4HVV A;  2HSP A;  1RUW A;  1SRL A;  1W70 A;  1QWF A;  2AZS A;  2VVK A;  4CC3 A;  2J06 A;  2KRO A;  3JV3 A;  1SEM A;  2O2O A;  4RTU A;  4F16 A;  2I0N A;  2KR3 A;  3NMZ C;  1VYU A;  1X6G A;  2DM1 A;  1AEY A;  2FEI A;  1SPK A;  1AWO A;  1SSH A;  3IQL A;  1K0X A;  3RNJ A;  2CUB A;  2JXB A;  4FSS A;  2M51 A;  5FW9 A;  2MCN A;  2KXC A;  3VS7 A;  1ZUY A;  4HXJ A;  1NEG A;  1NM7 A;  2P4R A;  1BU1 A;  2A36 A;  3EG1 A;  1GL5 A;  1AD5 A;  2DRM A;  2JTE A;  2EYY A;  2L3Q A;  1I1J A;  2DE0 X;  2RN8 A;  5ECA A;  2BZX A;  2DL7 A;  1G2B A;  3FJ5 A;  2QDL A;  4JJC A;  2EGE A;  3I35 A;  2LNH B;  5IH2 A;  1WYX A;  2K3B A;  2BZY A;  2ENM A;  2DL3 A;  1OPL A;  1GBQ A;  3TVT A;  2LJ1 A;  2YUQ A;  1HD3 A;  2JW4 A;  3M0T A;  1K1Z A;  2RPN A;  1YWO A;  2DNU A;  1PKT A;  1BB9 A;  2DL4 A;  1U3O A;  2EGC A;  3SHW A;  1KFZ A;  3RBB B;  3THK A;  1WLP B;  4HVW A;  2NWM A;  4DEX A;  1CKB A;  2HEQ A;  3EG0 A;  2FPE A;  2VKN A;  4GBQ A;  2DF6 A;  3I5R A;  4ORZ A;  2F2W A;  2JS0 A;  3NPF A;  1M3A A;  3VS1 A;  1CSK A;  1NEB A;  2C0T A;  3EHQ A;  2JT4 A;  1TUD A;  3PVL A;  3PVQ A;  5L23 A;  1GFC A;  2DJQ A;  1UE9 A;  3H0H A;  4AFS C;  5I22 A;  2CH4 A;  2EYZ A;  2KEA A;  2BTT A;  2VWF A;  1PNJ A;  2LQW A;  2J6K A;  2AK5 A;  1E7O A;  3REA B;  2GGR A;  2FRY A;  1M3C A;  1UJY A;  3EG3 A;  1WI7 A;  1GCQ C;  2OI3 A;  3H41 A;  1PRM C;  2LJ3 A;  2BZ8 A;  4IIM A;  1J3T A;  3GBQ A;  1OPK A;  2ESW A;  2KYM A;  1W1F A;  2K9G A;  2D0N A;  2FO0 A;  4JJD A;  1SHF A;  2A28 A;  1UEC A;  1VYV A;  2F2V A;  1FYN A;  1I0C A;  1B07 A;  2KT8 A;  1PWT A;  1QKW A;  5I11 A;  1OOT A;  1UGV A;  2GTO A;  2NUZ A;  2JMC A;  4Z8A A;  1KIK A;  4J9D A;  2RQT A;  2EYW A;  2HDA A;  2L3S A;  1BK2 A;  2DBM A;  1M8M A;  2YUN A;  5IXF A;  1Y0M A;  2W0Z A;  1WFW A;  1UJ0 A;  4ZNX A;  3TSZ A;  2M0Y A;  1SRM A;  1VA7 A;  2G6F X;  2JM8 A;  4J9C A;  2GTJ A;  1UHF A;  2YUO A;  1GCP A;  2L2P A;  2KRM A;  1JXO A;  4LUE A;  2KBT A;  1RLP C;  1UTI A;  3VS2 A;  1IO6 A;  2KYB A;  2DBK A;  2EQI A;  1PHT A;  1NLO C;  4K11 A;  2DA9 A;  4JJB A;  1UDL A;  2KXD A;  1JEG A;  2LX7 A;  3VS5 A;  1GCQ A;  2KT1 A;  1H3H A;  3UA7 A;  1AWW A;  2GNC A;  4GLM A;  3TSW A;  2CRE A;  2V1Q A;  2E5K A;  2H8H A;  2ED1 A;  4X1V A;  1GBR A;  2FPD A;  2EW3 A;  5IXB A;  1M27 C;  1ZBJ A;  2XMF A;  4JZ3 A;  4LUD A;  4CC7 A;  2L0A A;  2DL8 A;  2ECZ A;  3R6N A;  3ZL7 C;  2RF0 A;  1A0N B;  2DLP A;  1K9A A;  1MV3 A;  2FG0 A;  4AFZ C;  1UUE A;  4HCK A;  4Z88 A;  1K4U S;  1T3S A;  1PKS A;  2FRW A;  3EGU A;  3CQT A;  5IHI A;  3I9Q A;  4CC2 A;  3H0I A;  4OML A;  4JPB W;  2JM9 A;  4OMQ A;  5IHN A;  2FPF A;  2DMO A;  2SEM A;  1AVZ C;  1WXT A;  2CSQ A;  2O9S A;  2O31 A;  4LE9 A;  3VRZ A;  3ULR B;  1H8K A;  1H92 A;  1XOV A;  1TG0 A;  1MUZ A;  3U23 A;  5GJW B;  3VS3 A;  1NLP C;  2HCK A;  4WCI A;  2HBW A;  2YSQ A;  2C0I A;  1WA7 A;  3VS0 A;  3REB B;  2LZ6 B;  2PZ1 A;  4JZ4 A;  3QWX X;  5FWC A;  1WIE A;  4OMN A;  1Z9Q A;  4J9I A;  3C0C A;  2ROL A;  2V1R A;  1E6H A;  5GJV B;  2LQN A;  2DL5 A;  1MV0 B;  4OMP A;  2J6F A;  3VRY A;  2J7I A;  3QWY A;  1AZG B;  4F17 A;  2K6D A;  1T0H A;  3UF4 A;  4AFQ C;  4CC4 B;  4ESR A;  1AOJ A;  2CUD A;  4M4Z A;  2YT6 A;  3KFV A;  1UG1 A;  2C0O A;  2K7A A;  1KSW A;  4J9E A;  1M30 A;  1ZX6 A;  4D8D A;  1ZLM A;  2K2M A;  2X3X D;  2GBQ A; 
#chains in the Genus database with same CATH topology
 2ZPE B;  3F70 A;  2D1X A;  4LDW A;  4RUG A;  4XAX B;  2JTF A;  4OB3 B;  1YJN A;  1NYG A;  1IGQ A;  1UGR B;  4XTZ A;  3NTI A;  1PSF A;  3OSV A;  2SRC A;  5GAM j;  1G83 A;  2XU8 A;  4ZGE B;  4C92 F;  1NG2 A;  2H3J A;  1I07 A;  5EC7 A;  1YN8 A;  1UEB A;  1QLY A;  3CPF A;  4EPC A;  1FMK A;  3V7S A;  1X2Q A;  1HSQ A;  1Y57 A;  1M2V B;  2O88 A;  2EWN A;  3L2R A;  1WXB A;  2HSE B;  1Q86 R;  3X26 B;  2DJZ A;  3CCQ T;  3VYH B;  4XTW A;  4RTT A;  4FT4 A;  3RIR A;  1WHL A;  5GAN e;  4PK4 A;  3CCE T;  4D8K A;  4Z89 A;  1I4K 1;  3CCS Q;  3MEV A;  4NS5 A;  3P8B B;  1TUC A;  4M77 A;  4WTO B;  4DBQ A;  2AKK A;  4C8Q F;  3RR6 A;  3DLM A;  1XJW B;  2RK1 A;  5HY6 A;  1K8A C;  1DJ7 B;  3NTH A;  5GAN f;  1JO8 A;  3M0Q A;  1I5O B;  2F69 A;  4MML A;  4E7J A;  1QWE A;  3LH0 A;  3CCL T;  3QZ9 B;  3EG2 A;  2OTL T;  4CRI A;  1SF9 A;  4N4H A;  2M0O A;  1SHG A;  3P8H A;  1PG5 B;  2PUK B;  1M1K R;  3CD6 A;  1ABQ A;  2K5F A;  2FYK A;  3V8L A;  3AHU A;  1PRL C;  4C92 G;  5CQY A;  1G3S A;  4KRT A;  3RDV A;  3CC2 A;  1X01 A;  3EFR A;  3G1J A;  3EGX A;  4LD6 A;  2VUB A;  3SB2 A;  3OW2 S;  2BE7 D;  3QJ6 A;  1HJD A;  4E7L A;  2RQR A;  4RTX A;  4IIO A;  2JN0 A;  2L8D A;  1MMD A;  2DK3 A;  1ZA2 B;  2GF7 A;  4M75 G;  1WGS A;  2QQS A;  4DBF A;  3OY9 A;  1D1B A;  3CCQ A;  4N4G A;  2ZPB B;  5CQX A;  3OS1 A;  4M7A D;  3G7Z A;  4J9H A;  2PNI A;  5GAO n;  2BIV A;  1NPP A;  2ZCF B;  4PJO B;  3CC7 Q;  2QG9 B;  3V8K A;  2B86 A;  2AKL A;  4XU3 A;  4KUL A;  2XIC A;  2EGA A;  1Q7Y U;  1LNX A;  5FLX E;  1SRL A;  3HRS A;  1W70 A;  2COW A;  4RCC A;  1KC8 C;  1GXI E;  3E19 A;  5GMK h;  3OYH A;  3RKX A;  4KGV B;  1VQM T;  3N5B B;  3PTA A;  1WHJ A;  2K5L A;  2KR3 A;  3SDZ A;  3M4G A;  2Y4X A;  3ASK A;  1X6G A;  3DLL A;  2OTL A;  5GAN g;  5CVI A;  1WQW A;  4FYY B;  5KE2 A;  1K9M R;  4C92 E;  5GAN 5;  1ZUY A;  2CZ6 B;  5LJ5 e;  3CCS A;  5CIU A;  1NM7 A;  1NE8 A;  1BU1 A;  2NLU A;  1BI0 A;  4M7A F;  2DRM A;  2L3Q A;  2RN8 A;  5ECA A;  2E6N A;  2JUF A;  4ELZ C;  3I35 A;  4OGC A;  3AT1 B;  1D0X A;  2RJD A;  2I2L A;  3HFN A;  1QCN A;  1D1A A;  2BE9 B;  4M75 E;  3TVT A;  3QBY A;  2RD1 A;  3M0T A;  1K1Z A;  2VC8 A;  3CCR T;  1YCY A;  1Q82 U;  1YWO A;  3EG9 A;  3OYM A;  4M77 B;  1VQL T;  4J7I A;  1SG5 A;  1U3O A;  5AT1 B;  1VQ7 T;  2QTV A;  1TWB A;  3M53 A;  2X4Y A;  4HCZ A;  3THK A;  1WLP B;  2L5Q A;  1VQK T;  1CKB A;  3EG0 A;  5A0D A;  1JB0 E;  1UGS B;  1MMA A;  4B9W A;  2KQW A;  1M3A A;  1R0C B;  3LWH A;  1U1T A;  3H8Z A;  3OBY A;  4JJN K;  3PVL A;  2XI9 A;  4ME7 A;  1UE9 A;  4LDY A;  3H0H A;  1VQM A;  2LTO A;  2LQW A;  1N6A A;  1VQ4 Q;  2FRY A;  1VQO T;  3EG3 A;  4QVZ A;  2YRV A;  2OI3 A;  3H41 A;  1YJW T;  2PVG B;  1OPK A;  4PKC C;  3FLG A;  1W1F A;  1Y96 B;  4EMK A;  2CGH A;  3JCM h;  5GAN 2;  2A28 A;  4FIB A;  2EQJ A;  4XU1 A;  1M5Q 1;  2Y4Y A;  3EGX B;  1G3W A;  1LPL A;  2KT8 A;  2IPO B;  1PWT A;  4M7A G;  5FRN A;  3G6E A;  4RCB A;  4A4E A;  1VUB A;  4Z8A A;  3QXE B;  2L3S A;  1JJ2 S;  3GNF B;  1EZZ B;  1M4Z A;  1RAA B;  1WHM A;  4FYV B;  1VQN T;  5CKH A;  1RL2 A;  3BW1 A;  2CP5 A;  4HT9 A;  3JCM W;  1QVF S;  2CS7 A;  2G6F X;  4J9C A;  2RHY A;  1TU0 B;  2EJ9 A;  3CME Q;  4FCY A;  2L2P A;  3JB9 J;  3CCR A;  2QA4 Q;  3EFS A;  2KBT A;  5LJ5 g;  3VS2 A;  2MPX C;  2DBK A;  1VQL A;  1NLO C;  1O75 A;  4K11 A;  2HBP A;  1VQ7 A;  1M1F A;  3CPW A;  1UDL A;  4BI3 A;  1O9S A;  1GCQ A;  4KUD K;  2IG0 A;  1VIE A;  2V1Q A;  2VB6 A;  2E5K A;  2E10 A;  1TS9 A;  1BCM A;  2YRC A;  2A3L A;  1G3T A;  4LXC A;  5IXB A;  5DLO A;  1M27 C;  2GQV A;  2GCX A;  2L0A A;  2FL7 A;  2P0P A;  4Q5W A;  4QQG A;  3ZL7 C;  3LGF A;  1MV3 A;  4AFZ C;  1MMG A;  1UUE A;  4HCK A;  1MGQ A;  5GAN h;  1K4U S;  1IRE B;  3H9N A;  5J39 A;  2DZC A;  2X4J A;  1YJW A;  3EFO A;  2LT1 A;  8AT1 B;  4OML A;  2KAF A;  2XDD A;  3OYE A;  4CI0 C;  2V26 A;  2SEM A;  5AYF A;  5FU7 B;  2CSQ A;  4M7A E;  2O31 A;  1NBE B;  2QQR A;  4BDZ A;  4QQ6 A;  2DEQ A;  1YIT T;  1H8K A;  4Y91 A;  1OU8 A;  1XOV A;  1S72 T;  4HT8 A;  1YHQ Q;  3CC4 Q;  1Q95 G;  2QEX T;  2ZPI B;  5HKC A;  5GJW B;  4C0G A;  2YSQ A;  1WA7 A;  4JS5 A;  5D6X A;  3CCU Q;  3BY7 A;  2WSE E;  3L2Q A;  3EG9 B;  1VQ4 A;  2PZ1 A;  1KQ2 A;  2FZG B;  1WIE A;  1Z9Q A;  1HXD A;  4MZM A;  9ATC B;  3G4S T;  2EQU A;  2J6F A;  4FL6 A;  4F7U A;  3QYH B;  4AFQ C;  4ESR A;  2M1H A;  2CYZ B;  3MHX A;  4M4Z A;  2YT6 A;  1UG1 A;  3BDU A;  3KBG A;  4C5G A;  3J81 E;  4JRP A;  5I2M A;  4J9E A;  1M30 A;  4M78 C;  1ZLM A;  2X9H A;  2X3X D;  1ACM B;  5GMK e;  2O9V A;  4V2S A;  1R8O B;  4FW2 A;  4EMK B;  1B3Q A;  4N4I A;  1RAG B;  2GFA A;  1AWX A;  2J6O A;  4GLK A;  3CME A;  1X6B A;  1Q81 R;  1OV3 A;  5C6S A;  4AT1 B;  2QA4 A;  2LNV A;  5KYN A;  2DXT A;  3CXC S;  1V76 A;  2DO3 A;  4FU6 A;  3QUI A;  3H0F A;  1Q86 U;  3X20 B;  5KYY A;  4PJM A;  4OB1 B;  1YI2 Q;  2EAY A;  2RB6 A;  1V29 B;  5GAN 3;  1WXU A;  4E6R A;  2EYQ A;  1ZUU A;  2MAM A;  2IIM A;  2QDY B;  4XU0 A;  1Q7Y C;  3EHR A;  3M5A A;  5I21 A;  5A2Q E;  2LX9 A;  1WX6 A;  1W6X A;  1OEB A;  2WAC A;  2D8H A;  5LJ5 h;  1N9R A;  1K76 A;  2JS2 A;  1NYF A;  1CKA A;  2XG8 D;  2A37 A;  1B34 B;  2MWP A;  2YDL A;  4PJN A;  2JMA A;  1QCF A;  2EKH A;  2XHC A;  3UAT A;  1IHW A;  4F14 A;  4PLL A;  2PTK A;  2V8J A;  3I5S A;  2KE9 A;  1QW1 A;  1PD0 A;  2G3R A;  2ED0 A;  4JDS A;  2MK5 A;  2ZPH B;  1TSF A;  4A63 B;  3RMQ A;  2CT3 A;  5HCK A;  1PD1 A;  1M1K U;  3CBM A;  2LVM A;  5FWB A;  3M0R A;  4OMF B;  4QT7 A;  4J6W A;  3O8V A;  2KDS A;  5GAM d;  3CC4 A;  1T3L A;  4HCB A;  1H64 1;  4J9G A;  3O5Z A;  3PGG A;  3EFO B;  4M7D C;  3ME9 A;  5D7U A;  3I55 T;  2F2X A;  2ABL A;  2RM4 A;  3NHN A;  4A4F A;  3CC2 Q;  2OTJ T;  1M9S A;  4XTV A;  4J8O A;  3OMC A;  1ZUK A;  4LD9 K;  4C0F A;  2QK0 A;  2D8J A;  4E7K A;  5L8R E;  2X35 A;  1Q82 C;  2LQ8 A;  4M77 F;  5HK3 A;  1AZE A;  2GQI A;  3JCM f;  2EPD A;  3CCQ Q;  1M90 U;  2RMO A;  4C8Q D;  1EFN A;  1RAE B;  3CCV T;  3CCE Q;  1KK7 A;  3RKW A;  4J6X A;  2JTM A;  2QQ9 A;  4L5G A;  1KQ1 A;  4BE1 A;  4JRK A;  3HKS A;  3OYG A;  1RUW A;  4F7U B;  4E47 A;  2O4X A;  1QWF A;  3WVE B;  4ZGJ B;  1YIJ A;  1QVG S;  4IUU A;  4CC3 A;  1C1A A;  3RMS A;  2LDM A;  1W2B A;  1KQS S;  1UB4 A;  3UWN A;  3DKM A;  1YI2 A;  3RER A;  3CCL Q;  1K9M U;  2NYS A;  2OTL Q;  5GMK m;  1ZSZ A;  2LRQ A;  4HKE A;  3IQL A;  1K0X A;  4UC4 A;  2CUB A;  3TEE A;  3NFC A;  2MCN A;  1RAD B;  3RES A;  3I55 A;  4MZP A;  3R6O A;  2KVQ G;  3OMG A;  4II1 A;  1YFN A;  1NEG A;  2QQA A;  4M78 D;  3SWN A;  5KYY B;  3MP1 A;  3A8O B;  4PFP A;  4QVC A;  2E3I A;  1ZA1 B;  3PMI A;  3EG1 A;  2H3E B;  3QII A;  1GL5 A;  1I1J A;  1G2B A;  1OU9 A;  3FJ5 A;  2EGE A;  3C4S A;  2HQE A;  5IH2 A;  4OGE A;  2DL3 A;  4DA4 A;  1TH7 A;  2EJF A;  1IZ6 A;  2LJ1 A;  2YUQ A;  1MHN A;  2NUT A;  2XK0 A;  2RPN A;  2MMP A;  1BB9 A;  2DL4 A;  4QW2 A;  3RBB B;  1PC0 A;  4DEX A;  3JCM g;  2DF6 A;  2F2W A;  2C0T A;  3EHQ A;  2JT4 A;  1TUD A;  2GFU A;  1SSF A;  4C92 A;  3OA6 A;  2DJQ A;  5I22 A;  1VQM Q;  2CH4 A;  2VWF A;  2YLC A;  2DD5 A;  1QP2 A;  1R77 A;  3KXT A;  1K73 R;  4M78 F;  1M3C A;  1UJY A;  2NUP A;  1AHJ B;  3FC3 A;  2LJ3 A;  2BZ8 A;  4MDW A;  3GBQ A;  1OUL A;  2E3H A;  4J6Y A;  1SHF A;  3VU3 C;  2DVE A;  3EH1 A;  4M75 A;  1WPY A;  5CKB A;  3CCE A;  1QKW A;  4C8Q G;  3G6E Q;  1M90 R;  5I11 A;  1I5L A;  3P8D A;  1UGV A;  2XD0 A;  2E64 A;  2GTO A;  4XTX A;  2JMC A;  1KIK A;  2HD0 A;  4KT0 E;  4J9D A;  2RQT A;  3CPW P;  2EYW A;  2ZGW A;  4M7D D;  1M8M A;  4C8Q A;  4DBH A;  1Y0M A;  4FW1 A;  4N0A C;  1WFW A;  1UJ0 A;  2FB7 A;  4HCC A;  5IN1 A;  2F5K A;  3TSZ A;  2COY A;  4KBM B;  1SRM A;  4PFO A;  4DOW A;  2R5A A;  2GTJ A;  3CCL A;  2DER A;  5GAM e;  2CP0 A;  3D7S B;  3CCR Q;  2KRM A;  1KD1 R;  4LUE A;  1IO6 A;  1VQL Q;  1QCO A;  2HMA A;  2KI7 A;  4E7H A;  3I56 T;  4PJL A;  2LCL A;  1VQ7 Q;  1FXX A;  2CKK A;  1JEG A;  3VKI A;  1W4S A;  3VS5 A;  1VQK Q;  1PM3 A;  2GNC A;  2M02 A;  3VJP A;  5GAM f;  2CRE A;  4XTY A;  4NL2 A;  2ED1 A;  2YLB A;  4ZN1 A;  2MWO A;  2AHJ B;  3CCJ T;  4M78 G;  1QMC A;  2EW3 A;  4PJJ A;  2XMF A;  4LUD A;  3A5Z B;  2WSF E;  4RG8 A;  1ZSZ B;  3X24 B;  5LJ5 f;  1K9A A;  4PJO C;  1YBY A;  1VQO Q;  1U8R A;  3DB4 A;  3CC7 T;  2BKD N;  1PKS A;  2FRW A;  3EGU A;  1YJW Q;  1Q86 C;  4M7D F;  2CZ7 B;  3H0I A;  4OMQ A;  3SWN B;  2FPF A;  1Y71 A;  3M56 A;  1AVZ C;  4C8Q E;  3VRZ A;  2E1H A;  3HRT A;  3ULR B;  4FSX A;  3JB9 H;  2XDB A;  2K5I A;  1TG0 A;  5KCO A;  2R5M A;  3L42 A;  2PUO B;  4L59 A;  1VQN Q;  2HCK A;  3GIB A;  1ZQ1 A;  2D0Q B;  3E2U A;  3M55 A;  2NUT B;  4X9D A;  3VS0 A;  4E7Z A;  2P84 A;  2X4X A;  3VYG A;  3QWX X;  5FWC A;  4J9I A;  3L2V A;  3C0C A;  1E6H A;  2M9U A;  3A1P A;  5LJ3 j;  2E65 A;  1M1K C;  3OW2 A;  4OMP A;  2DAQ A;  4OVA A;  2J7I A;  2DYI A;  4QVD A;  4C92 B;  2KMT A;  1AOJ A;  3C94 A;  2DEU A;  3NTK A;  2C0O A;  4ZTF A;  1VQ9 T;  4D8D A;  4M78 E;  2K2M A;  1FMW A;  4M77 C;  2VXE A;  3V7R A;  4BE0 A;  4M7A A;  4MZT A;  1QVF P;  2YUP A;  3T9N A;  1Q81 U;  5GAM g;  2JOY A;  1QKX A;  4M7D G;  3ER0 A;  1VQ6 T;  2EYX A;  3FJP A;  2DYB A;  3OYY A;  4BI8 B;  4M75 B;  1MNE A;  2K4Y A;  5CO7 A;  2YHT A;  4LN2 A;  3FDR A;  3MEA A;  4E7S A;  2Z0W A;  4OMO A;  2AZV A;  4EDU A;  2DET A;  2LT4 A;  2MIO A;  1T0J A;  2ZPF B;  1VQK A;  4ZGD B;  5FRO A;  5IHK A;  1M90 C;  1YIT Q;  3ZFJ A;  4A54 A;  1ARK A;  3GLX A;  3M0U A;  1LCK A;  1S72 Q;  1UFF A;  1IRX A;  3M0S A;  2J05 A;  2QEX Q;  2LJ0 A;  4C0D B;  1V1C A;  4OP0 A;  1VQ5 T;  1KJW A;  2LMJ A;  1VQO A;  1WDX A;  5A0G A;  1VYT A;  4MMK A;  2F5T X;  1RI9 A;  3H6Z A;  1GRI A;  5I2S A;  1RLQ C;  1TUG B;  1XQH A;  3JCM X;  3G71 T;  1VQP T;  1E6G A;  1Y7X A;  2BUD A;  1U5S A;  1YWP A;  4J9B A;  3A98 A;  3G4S Q;  4BD3 A;  1K9M C;  4R0K A;  3HHT B;  5KE3 A;  2A08 A;  4A4K A;  2X3W D;  1R0B G;  3OS0 A;  4E7I A;  2OAW A;  4RTV A;  2MI6 A;  4VUB A;  3CCM T;  2CSI A;  1VQN A;  1XNI A;  1QVP A;  4M7D E;  2RNA A;  3CMA T;  2L3P A;  2JJ9 A;  2VYT A;  3NGP A;  4J5Y A;  2KRS A;  1G3Y A;  1VQ6 A;  1NJI R;  2F1L A;  2K3Y A;  3CEY A;  1JQQ A;  1N27 A;  2CDT A;  1F1B B;  2JVV A;  1OX8 A;  3A8H B;  3PMT A;  1FWZ A;  4J7F A;  1BBZ A;  1S1N A;  3GF5 A;  4C0D C;  2QTX A;  5HK0 A;  4BUG A;  4AFU C;  4PJO D;  3HTR A;  1YJ9 T;  3C95 A;  1RAC B;  4BY6 B;  2VXF A;  4EIK A;  4LNP A;  3MP6 A;  6AT1 B;  3VS4 A;  3SEM A;  2DTH A;  4QQD A;  4XK8 E;  2RH2 A;  4KGZ B;  4HA8 A;  5KH6 A;  1N9S A;  1D0Y A;  2LQK A;  1G5V A;  3C12 A;  1N5Z A;  3BDL A;  1X27 A;  1W2B P;  1IHV A;  2YXY A;  4J9F A;  1X69 A;  5FU7 C;  2KRN A;  1VQ5 A;  4J83 A;  1EX4 A;  2P0K A;  5IT9 E;  1M2O A;  4RTZ A;  2L3R A;  2RO0 A;  4RTW A;  3VV0 A;  4AG1 C;  3UA6 A;  4JRI A;  4FYW B;  2DD4 A;  3PE0 A;  4HVV A;  2HSP A;  3CXC P;  2HKQ B;  3PT9 A;  1YHQ T;  1YIJ Q;  3FRN A;  1JJ2 A;  4C5H A;  3TRE A;  1PSE A;  2J06 A;  3KUF A;  2V8K A;  5CR2 A;  1N8R U;  4M7A B;  4F16 A;  2QAS A;  4ATO A;  1QVF A;  1YIT A;  3UPU A;  1M1G A;  5GAM h;  5D6W A;  1S72 A;  4F04 B;  1AEY A;  2FEI A;  3Q1J A;  1RI0 A;  4IUP A;  1C0M A;  4JUV A;  5CK9 A;  2QEX A;  4PJO F;  3RNJ A;  3BFM A;  5CKD A;  2JXB A;  4FSS A;  2V8I A;  3CMA A;  5FW9 A;  2KXC A;  3I55 Q;  3OYI A;  3VS7 A;  2CP6 A;  5GAN j;  4HXJ A;  3TCJ A;  3OYF A;  2QYZ A;  4M77 D;  1WQ7 A;  3WVD B;  2JTE A;  4R56 A;  3G4S A;  5CKF A;  3JAM E;  3QHS A;  2BZX A;  3VUB A;  2DL7 A;  4Z02 A;  4JJC A;  4EMK C;  1RAB B;  2DIQ A;  4D6W A;  3PNW C;  1WYX A;  2K3B A;  5FU6 B;  2ZPG B;  2BZY A;  2ENM A;  1YJN T;  2PVO B;  1OPL A;  2VGM A;  1VQ8 T;  3V8J A;  1HD3 A;  2JW4 A;  3MEU A;  5KYX A;  3QG1 A;  2RHZ A;  4OB0 B;  2HAX A;  1PKT A;  2IVW A;  4XQ3 A;  5GAN 4;  3CCV Q;  2EGC A;  2EQM A;  1KFZ A;  4HVW A;  2NWM A;  2VKN A;  3M4Y A;  3I5R A;  3LWI A;  3JCM V;  1G8X A;  2JS0 A;  3NPF A;  3VS1 A;  1NEB A;  3HPW A;  1TOV A;  2QXF A;  4B9X A;  1K73 U;  2D6F A;  4OF1 A;  3PVQ A;  5L23 A;  1GFC A;  2HQX A;  3RKY A;  2VGN A;  3S6W A;  2EYZ A;  3ZEH A;  2J6K A;  3JCM P;  1E7O A;  3REA B;  2K57 A;  2HZY A;  4PJO G;  1BKB A;  1GCQ C;  4EMG A;  4IIM A;  1PRM C;  4JRQ A;  1J3T A;  2DPP B;  2KYM A;  2K9G A;  3HSB A;  1KC8 R;  2D0N A;  2FO0 A;  4JJD A;  2RHX A;  2RI3 A;  4JLG A;  1VYV A;  2F2V A;  1FYN A;  1WHH A;  2R57 A;  3URG A;  1QVG P;  4BI4 A;  3JCM Q;  2HDA A;  1BK2 A;  2DBM A;  2YUN A;  5IXF A;  2P0Q A;  4KUI A;  2W0Z A;  3CD6 T;  3JCM J;  1KD1 U;  1IB8 A;  3JCM c;  3V7C A;  2XKO C;  1VA7 A;  4O6J A;  1VQ8 A;  1UHF A;  2YUO A;  1MND A;  3OYN A;  3CC2 T;  1N8R R;  1JXO A;  2KYB A;  5C0M A;  1PHT A;  1D09 B;  3CXC A;  5J3B A;  2HQH A;  2DA9 A;  2PVD B;  2LX7 A;  2KT1 A;  1H3H A;  5LJ5 j;  1AWW A;  4GLM A;  2CZ1 B;  4PNO A;  1Q81 C;  2OTJ A;  1HK9 A;  3L2W A;  3QDF A;  4KH0 B;  1BYM A;  1WJS A;  1GBR A;  4RKU E;  3ZBD A;  4JZ3 A;  4IUT A;  4CC7 A;  4M77 G;  3FEO A;  2ECZ A;  3R6N A;  4M75 F;  1BIB A;  2FZC B;  2RF0 A;  2DLP A;  1A0N B;  2FG0 A;  4PJO E;  1T3S A;  4FM4 B;  3CQT A;  4CC2 A;  4Y28 E;  2AIR B;  4JPB W;  2JM9 A;  4A4G A;  1WXT A;  3CCV A;  4LE9 A;  2ATC B;  5GAN 8;  1H92 A;  2R58 A;  1QP3 A;  1HYO A;  3OW2 P;  2L89 A;  5EG2 A;  2WSC E;  3VS3 A;  2RHU A;  3L1A A;  2HBW A;  2C0I A;  4JS4 A;  5KYX B;  1KG1 A;  1FMV A;  2VAS A;  5DM7 R;  3OB9 A;  5FRM A;  1SKU B;  2E70 A;  3MKD A;  4JZ4 A;  3CCS T;  2A0F B;  5D6Y A;  1Y96 A;  4QKU A;  4EMH A;  5KYU A;  3PIO A;  4PLI A;  2V1R A;  1RAH B;  3I56 Q;  5GJV B;  1WJQ A;  3S3N A;  1AZG B;  3LW5 E;  2K6D A;  2B8A A;  2CUD A;  1D3B A;  1BCO A;  1BI3 A;  2MF2 A;  3M54 A;  1PCX A;  1ZX6 A;  1X6O A;  2LCC A;  3CCJ Q;  4M77 E;  5LJ3 h;  2FVU A;  2EVR A;  3OQ5 A;  2RJC A;  1IXD A;  3LX7 A;  4AG2 C;  1WHK A;  1WJR A;  2RQV A;  2E6Z A;  2D9T A;  4GY5 A;  4RTY A;  4ANJ A;  1YNZ A;  2CP7 A;  3OYD A;  1ABO A;  2DVJ A;  1QVG A;  1X75 C;  3L2Z A;  4Y92 A;  3CPW S;  3EH2 A;  2O4X B;  1K0S A;  2QI2 A;  1KQS A;  2MYS A;  2QAZ A;  2E4H A;  3MP8 A;  1LJO A;  2EIF A;  1D1C A;  1I81 A;  1P92 A;  3VS6 A;  4BAC A;  1JBM A;  3MJX A;  2RI2 A;  1UHC A;  3HRU A;  2DX1 A;  4MDX A;  5CKE A;  1NPR A;  5GAO m;  4KH1 B;  3L2U A;  2OJ2 A;  2RJE A;  2RQW A;  5LJ3 d;  1JU5 C;  1IGU A;  2W10 A;  3WXM B;  1B7T A;  4HVU A;  1KHI A;  2COZ A;  4AMC A;  4DEY A;  3EAE A;  5LL6 S;  3G6E T;  2DFU A;  4M78 A;  2RQU A;  2DRK A;  2PU9 B;  3LGL A;  2QGF B;  5GMK l;  2FHD A;  1N8R C;  2DIG A;  1YP5 A;  3JCM b;  2KK4 A;  4IKF A;  3LYI A;  3MO8 A;  2CT4 A;  4DQ2 A;  2JNG A;  2LP5 A;  2OAU A;  3QO3 A;  5GAO p;  4ZTJ A;  2RHI A;  2MOX A;  3JSC A;  3UT1 A;  2K79 A;  2LCS A;  4DBR A;  1VQ9 Q;  2RA2 A;  1TXQ A;  3RUX A;  1U06 A;  2K3X A;  3X25 B;  1JXM A;  1NJI U;  1FX7 A;  2DIL A;  3E9F A;  4PL6 A;  3CBO A;  5A0L A;  5GAN 6;  1ZSG A;  1VQ6 Q;  2ZAE A;  2DZ9 A;  1Z9Z A;  1M3B A;  2EFI A;  3OYC A;  2KNB B;  3M0P A;  3OS5 A;  3VUZ A;  2O01 E;  4LDV A;  2DXC A;  4OMM A;  4RG2 A;  3SD4 A;  3I56 A;  1ZSZ C;  2DTO A;  2KGT A;  3OYA A;  3LH5 A;  1X2K A;  5IAY A;  1JJ2 P;  1C6V X;  1BI1 A;  4P5N A;  4R55 A;  1AWJ A;  2OX7 A;  2CH4 W;  3TU4 K;  3SWN C;  1D0Z A;  2NUP B;  5GAO q;  3CCJ A;  5GMK j;  5KYU B;  2DTI A;  1VQ5 Q;  1OZ3 A;  4O5V A;  3JB9 D;  1YCS B;  2EBP A;  1K73 C;  1GFD A;  4OB2 B;  3CC7 A;  2RK2 A;  1X43 A;  2ROT A;  3QPH A;  3A8M B;  1WNL A;  4IUQ A;  1H3Z A;  3G71 Q;  1VQP Q;  4PFZ A;  3HL8 A;  4ZN3 A;  4C0Z A;  1D3B B;  4M7D A;  2RJF A;  3TQ7 P;  2AZS A;  2VVK A;  1EIF A;  2KRO A;  3QZ5 B;  3JV3 A;  1Q7Y R;  2Y90 A;  3E9G A;  3GP8 A;  2YRD A;  1SEM A;  2O2O A;  2CZ0 B;  3GNG A;  4RTU A;  4C8Q B;  5KYW A;  4X9C A;  1VQ4 T;  4LDX A;  2I0N A;  3NMZ C;  1VYU A;  4XU2 A;  1K8A U;  5CAI A;  4KGX B;  4IUR A;  2DM1 A;  1OYX A;  2QGG A;  1SPK A;  1AWO A;  3CCM Q;  1SSH A;  4BB7 A;  1VOM A;  2M51 A;  3JCM d;  3CMA Q;  4C92 C;  4F7U F;  1B34 A;  2QQB A;  2X4W A;  2HL5 C;  3HP9 A;  4WF2 A;  5M9O A;  3EGD A;  3MPU B;  2DXU A;  2P4R A;  3BE3 A;  2A36 A;  4NL3 A;  3FB9 A;  1KD1 C;  1AD5 A;  2AT1 B;  2EYY A;  3A8L B;  2DE0 X;  1YJ9 Q;  3OYB A;  4L6V 5;  2X51 A;  3JB9 F;  2P4T A;  2QDL A;  2LNH B;  2VV5 A;  4LDU A;  4B6M A;  4M75 C;  1GBQ A;  3CME T;  1VQ9 A;  4TVR A;  3QYG B;  4M78 B;  2FZK B;  5GAO l;  3OYK A;  2QA4 T;  1U1S A;  2DNU A;  1BIA A;  1RAI B;  4FYX B;  3A8G B;  3LLR A;  4DOV A;  2ZZD A;  4C8Q C;  3SHW A;  1OI1 A;  2EJG A;  1AT1 B;  1Q82 R;  2HEQ A;  2FPE A;  4GBQ A;  3M57 A;  4ORZ A;  2A7Y A;  1CSK A;  4ELY C;  4YTL A;  4AFS C;  2KEA A;  2BTT A;  2E41 A;  1PNJ A;  4FT2 A;  2AK5 A;  1KC8 U;  2GGR A;  3X28 B;  5GAN d;  1WI7 A;  2CP3 A;  5GAO r;  1WZO A;  3FIF A;  3JRZ A;  3MET A;  4F7U G;  4E2F B;  2ESW A;  3PFS A;  5LJ3 e;  1TTH B;  1UEC A;  1VIF A;  5DY9 A;  1I0C A;  1B07 A;  1JRI A;  3UDC A;  3M58 A;  2XDP A;  1OOT A;  2NUZ A;  3JB9 G;  3G71 A;  1BI2 A;  1XTD A;  1VQP A;  1NZ9 A;  3MEW A;  2EKO A;  5LJ3 f;  2KSS A;  2HKN A;  3CC4 T;  1M2V A;  4BDY A;  1W2B S;  3OBW A;  5J26 A;  4A4H A;  3CBP A;  4ZNX A;  3CCU T;  2M0Y A;  1YJN Q;  2E5Q A;  2JM8 A;  4A53 A;  1VQ8 Q;  2JZ2 A;  1GCP A;  4C5I A;  1OQK A;  3DB3 A;  3CCM A;  1RLP C;  1UTI A;  3J80 E;  2EQI A;  3M9Q A;  4NOY A;  1RAF B;  3M59 A;  1K8A R;  4BY6 C;  4JJB A;  2KXD A;  4M7D B;  1ZBX A;  3UA7 A;  1UGQ B;  1Y07 A;  3TSW A;  4BE2 A;  3JB9 I;  2H8H A;  1QQJ A;  5KYW B;  4IUV A;  2LC4 A;  2OTJ Q;  3QDR B;  2PQW A;  4X1V A;  2FPD A;  3OYJ A;  1ZBJ A;  2M16 A;  1YJ9 A;  2DL8 A;  4RMO A;  3INZ A;  4XTU A;  4Z88 A;  5GAN 7;  3SFM A;  1ZHI A;  2K2V A;  4F7U E;  5IHI A;  3I9Q A;  3S3O A;  3OYL A;  3EGD B;  4N0A A;  5DLQ E;  5IHN A;  1YIJ T;  3QSU A;  2DMO A;  8ATC B;  4M7A C;  2YWW A;  4C5E A;  2O9S A;  1WHG A;  1LVK A;  1YI2 T;  2RI5 A;  1OZ2 A;  2DXB A;  7AT1 B;  1MUZ A;  1YHQ A;  2HL3 A;  3QJY A;  5GMK i;  3QKJ A;  3U23 A;  4C92 D;  1NLP C;  2CP2 A;  4WCI A;  3CD6 Q;  3MCA B;  2HNI A;  1LOJ A;  3OSS C;  3REB B;  3CCU A;  5CCA A;  2LZ6 B;  3HFO A;  4JLI A;  3J7A F;  5LJ3 g;  5LJ5 d;  4OMN A;  1I8F A;  3S3M A;  2C06 A;  2ROL A;  1OX9 A;  3JCM e;  2LQN A;  4PJO A;  2DL5 A;  1MV0 B;  3PIP A;  3VRY A;  2XID A;  5FU6 C;  3QWY A;  1M8V A;  4M75 D;  1UGP B;  3OS2 A;  1MMN A;  2E12 A;  1T0H A;  3E1S A;  3UF4 A;  4CC4 B;  4F17 A;  1NJI C;  2EQK A;  4X34 A;  5KCH A;  3KFV A;  2DKG A;  2KY9 A;  2K7A A;  1KSW A;  1KHC A;  3GOX A;  3GPL A;  1KQS P;  2GBQ A; 
#chains in the Genus database with same CATH homology
 2O9V A;  2EVR A;  2YUP A;  2D1X A;  4RUG A;  1QKX A;  4AG2 C;  1B3Q A;  1NYG A;  2EYX A;  2RQV A;  1AWX A;  2J6O A;  2DYB A;  2SRC A;  1X6B A;  4RTY A;  1G83 A;  1OV3 A;  1YNZ A;  4LN2 A;  1ABO A;  1NG2 A;  2DVJ A;  1I07 A;  5EC7 A;  1YN8 A;  4OMO A;  2AZV A;  4Y92 A;  1QLY A;  2MIO A;  1FMK A;  1K0S A;  3H0F A;  1T0J A;  1X2Q A;  5IHK A;  1HSQ A;  1Y57 A;  2O88 A;  3VS6 A;  1ARK A;  1WXB A;  1WXU A;  1LCK A;  3M0U A;  1UFF A;  3M0S A;  2J05 A;  4E6R A;  1UHC A;  1ZUU A;  2DX1 A;  2LJ0 A;  1V1C A;  2IIM A;  2OJ2 A;  3EHR A;  2RQW A;  1JU5 C;  4RTT A;  2W10 A;  1WX6 A;  1W6X A;  4HVU A;  1OEB A;  1KJW A;  2D8H A;  2LMJ A;  1WDX A;  1VYT A;  4D8K A;  4DEY A;  4Z89 A;  1K76 A;  2JS2 A;  1RI9 A;  1NYF A;  1CKA A;  1GRI A;  2RQU A;  1RLQ C;  1TUC A;  2A37 A;  2DRK A;  2YDL A;  2JMA A;  1QCF A;  2EKH A;  3UAT A;  1E6G A;  1U5S A;  1YWP A;  2AKK A;  3A98 A;  4J9B A;  1YP5 A;  4F14 A;  2PTK A;  3I5S A;  2KE9 A;  2ED0 A;  2CT4 A;  4R0K A;  4A63 B;  1JO8 A;  3M0Q A;  2LP5 A;  2A08 A;  2CT3 A;  2X3W D;  5HCK A;  2MOX A;  5FWB A;  1QWE A;  2K79 A;  3M0R A;  4QT7 A;  2LCS A;  3EG2 A;  1U06 A;  2OAW A;  1T3L A;  4RTV A;  1JXM A;  4J9G A;  3O5Z A;  2DIL A;  2CSI A;  1SHG A;  2RNA A;  1ABQ A;  2L3P A;  3NGP A;  1ZSG A;  2KRS A;  1PRL C;  2F2X A;  1Z9Z A;  1M3B A;  1JQQ A;  2ABL A;  3NHN A;  4KRT A;  2CDT A;  2KNB B;  1BBZ A;  1S1N A;  1ZUK A;  3M0P A;  4OMM A;  2D8J A;  4AFU C;  1HJD A;  2KGT A;  2RQR A;  3LH5 A;  4EIK A;  4LNP A;  4RTX A;  1X2K A;  4IIO A;  3VS4 A;  3SEM A;  1AZE A;  1AWJ A;  2CH4 W;  1N5Z A;  2GQI A;  1X27 A;  2EPD A;  2RMO A;  4J9F A;  1X69 A;  1EFN A;  4J9H A;  2PNI A;  2KRN A;  4RTZ A;  1YCS B;  4AG1 C;  4RTW A;  2EBP A;  1GFD A;  3UA6 A;  2B86 A;  2AKL A;  1X43 A;  2ROT A;  3PE0 A;  2EGA A;  4HVV A;  2HSP A;  1RUW A;  1SRL A;  1W70 A;  1QWF A;  2AZS A;  2VVK A;  4CC3 A;  2J06 A;  2KRO A;  3JV3 A;  1SEM A;  2O2O A;  4RTU A;  4F16 A;  2I0N A;  2KR3 A;  3NMZ C;  1VYU A;  1X6G A;  2DM1 A;  1AEY A;  2FEI A;  1SPK A;  1AWO A;  1SSH A;  3IQL A;  1K0X A;  3RNJ A;  2CUB A;  2JXB A;  4FSS A;  2M51 A;  5FW9 A;  2MCN A;  2KXC A;  3VS7 A;  1ZUY A;  4HXJ A;  1NEG A;  1NM7 A;  2P4R A;  1BU1 A;  2A36 A;  3EG1 A;  1GL5 A;  1AD5 A;  2DRM A;  2JTE A;  2EYY A;  2L3Q A;  1I1J A;  2DE0 X;  2RN8 A;  5ECA A;  2BZX A;  2DL7 A;  1G2B A;  3FJ5 A;  2QDL A;  4JJC A;  2EGE A;  3I35 A;  2LNH B;  5IH2 A;  1WYX A;  2K3B A;  2BZY A;  2ENM A;  2DL3 A;  1OPL A;  1GBQ A;  3TVT A;  2LJ1 A;  2YUQ A;  1HD3 A;  2JW4 A;  3M0T A;  1K1Z A;  2RPN A;  1YWO A;  2DNU A;  1PKT A;  1BB9 A;  2DL4 A;  1U3O A;  2EGC A;  3SHW A;  1KFZ A;  3RBB B;  3THK A;  1WLP B;  4HVW A;  2NWM A;  4DEX A;  1CKB A;  2HEQ A;  3EG0 A;  2FPE A;  2VKN A;  4GBQ A;  2DF6 A;  3I5R A;  4ORZ A;  2F2W A;  2JS0 A;  3NPF A;  1M3A A;  3VS1 A;  1CSK A;  1NEB A;  2C0T A;  3EHQ A;  2JT4 A;  1TUD A;  3PVL A;  3PVQ A;  5L23 A;  1GFC A;  2DJQ A;  1UE9 A;  3H0H A;  4AFS C;  5I22 A;  2CH4 A;  2EYZ A;  2KEA A;  2BTT A;  2VWF A;  1PNJ A;  2LQW A;  2J6K A;  2AK5 A;  1E7O A;  3REA B;  2GGR A;  2FRY A;  1M3C A;  1UJY A;  3EG3 A;  1WI7 A;  1GCQ C;  2OI3 A;  3H41 A;  1PRM C;  2LJ3 A;  2BZ8 A;  4IIM A;  1J3T A;  3GBQ A;  1OPK A;  2ESW A;  2KYM A;  1W1F A;  2K9G A;  2D0N A;  2FO0 A;  4JJD A;  1SHF A;  2A28 A;  1UEC A;  1VYV A;  2F2V A;  1FYN A;  1I0C A;  1B07 A;  2KT8 A;  1PWT A;  1QKW A;  5I11 A;  1OOT A;  1UGV A;  2GTO A;  2NUZ A;  2JMC A;  4Z8A A;  1KIK A;  4J9D A;  2RQT A;  2EYW A;  2HDA A;  2L3S A;  1BK2 A;  2DBM A;  1M8M A;  2YUN A;  5IXF A;  1Y0M A;  2W0Z A;  1WFW A;  1UJ0 A;  4ZNX A;  3TSZ A;  2M0Y A;  1SRM A;  1VA7 A;  2G6F X;  2JM8 A;  4J9C A;  2GTJ A;  1UHF A;  2YUO A;  1GCP A;  2L2P A;  2KRM A;  1JXO A;  4LUE A;  2KBT A;  1RLP C;  1UTI A;  3VS2 A;  1IO6 A;  2KYB A;  2DBK A;  2EQI A;  1PHT A;  1NLO C;  4K11 A;  2DA9 A;  4JJB A;  1UDL A;  2KXD A;  1JEG A;  2LX7 A;  3VS5 A;  1GCQ A;  2KT1 A;  1H3H A;  3UA7 A;  1AWW A;  2GNC A;  4GLM A;  3TSW A;  2CRE A;  2V1Q A;  2E5K A;  2H8H A;  2ED1 A;  4X1V A;  1GBR A;  2FPD A;  2EW3 A;  5IXB A;  1M27 C;  1ZBJ A;  2XMF A;  4JZ3 A;  4LUD A;  4CC7 A;  2L0A A;  2DL8 A;  2ECZ A;  3R6N A;  3ZL7 C;  2RF0 A;  1A0N B;  2DLP A;  1K9A A;  1MV3 A;  2FG0 A;  4AFZ C;  1UUE A;  4HCK A;  4Z88 A;  1K4U S;  1T3S A;  1PKS A;  2FRW A;  3EGU A;  3CQT A;  5IHI A;  3I9Q A;  4CC2 A;  3H0I A;  4OML A;  4JPB W;  2JM9 A;  4OMQ A;  5IHN A;  2FPF A;  2DMO A;  2SEM A;  1AVZ C;  1WXT A;  2CSQ A;  2O9S A;  2O31 A;  4LE9 A;  3VRZ A;  3ULR B;  1H8K A;  1H92 A;  1XOV A;  1TG0 A;  1MUZ A;  3U23 A;  5GJW B;  3VS3 A;  1NLP C;  2HCK A;  4WCI A;  2HBW A;  2YSQ A;  2C0I A;  1WA7 A;  3VS0 A;  3REB B;  2LZ6 B;  2PZ1 A;  4JZ4 A;  3QWX X;  5FWC A;  1WIE A;  4OMN A;  1Z9Q A;  4J9I A;  3C0C A;  2ROL A;  2V1R A;  1E6H A;  5GJV B;  2LQN A;  2DL5 A;  1MV0 B;  4OMP A;  2J6F A;  3VRY A;  2J7I A;  3QWY A;  1AZG B;  4F17 A;  2K6D A;  1T0H A;  3UF4 A;  4AFQ C;  4CC4 B;  4ESR A;  1AOJ A;  2CUD A;  4M4Z A;  2YT6 A;  3KFV A;  1UG1 A;  2C0O A;  2K7A A;  1KSW A;  4J9E A;  1M30 A;  1ZX6 A;  4D8D A;  1ZLM A;  2K2M A;  2X3X D;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...