4J9FA

Crystal structure of the abl-sh3 domain complexed with the high affinity peptide p0
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 11
structure length 62
sequence length 62
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9fA00
1JXOA 2RPNA 2J06A 4JZ4A 2DF6A 5FWCA 2G6FX 1WXTA 2EKHA 2O9SA 2DRMA 3VS1A 2KT1A 4K11A 4ESRA 5I11A 1GCPA 2YDLA 1PHTA 2O9VA 1X2QA 3UF4A 3QWXX 2EBPA 1TUCA 4J9FA 1HSQA 2ROLA 1X27A 2EQIA 2JMCA 3NMZC 2BZ8A 4M4ZA 4LNPA 2CUDA 1WDXA 1FYNA 4AFZC 2X3WD 2DL7A 1IO6A 3GBQA 3EGUA 1BU1A 1JEGA 1QWFA 2KT8A 4CC3A 2DE0X 4RTZA 2OAWA 3I9QA 4HXJA 2MCNA 2VVKA 2DNUA 4OMOA 2HDAA 1NM7A 2NWMA 2DRKA 2DILA 4OMNA 1UHFA 1PKTA 4RTYA 5GJVB 3VS5A 2LZ6B 2FRYA 2KXCA 4RTVA 1K0SA 1NG2A 1PNJA 1YP5A 2RQUA 3H41A 4RTUA 2ENMA 1X6BA 1W70A 2SEMA 2D1XA 1UG1A 3REBB 1WX6A 2BZXA 2F2WA 2EVRA 4RTXA 3SEMA 1YNZA 3H0IA 2YUOA 2A28A 4RTWA 4D8KA 2KE9A 1UE9A 3EG1A 1G2BA 3VS2A 3VS7A 1MUZA 1SHGA 2HBWA 2EYWA 1GBRA 1RLQC 1QCFA 1K1ZA 3KFVA 4RTTA 1I0CA 1SRLA 1H8KA 4F14A 2HCKA 1NLOC 2AZSA 2JS2A 1UDLA 2AKLA 2YUQA 2RQWA 1WA7A 2K9GA 4AG1C 2ECZA 2QDLA 1WXUA 1MV0B 1E7OA 1I1JA 1M30A 1PRLC 4HCKA 2P4RA 2KNBB 1T0JA 2YT6A 5GJWB 4CC4B 3UA7A 1EFNA 4D8DA 1M27C 4AFUC 1TG0A 3U23A 1BK2A 2J6OA 3TSZA 2BTTA 3M0RA 3M0QA 2DM1A 1SPKA 2J05A 2DBMA 2W10A 2F2XA 4A63B 4Z8AA 1V1CA 2DL5A 4HVWA 3RNJA 5HCKA 2DX1A 3PVQA 1M3AA 1ARKA 2ED1A 1VA7A 2K2MA 5FWBA 1PRMC 2DL8A 1Y57A 1QKXA 3TSWA 3VS4A 2YUPA 4OMQA 2M0YA 1UTIA 3EHRA 2FO0A 4CC7A 4AFQC 1RI9A 2CSIA 2FPDA 2LQWA 2MOXA 1MV3A 4F17A 5ECAA 4F16A 2KYMA 1YWPA 3UATA 1GFCA 4EIKA 4J9DA 1QLYA 2ESWA 1KIKA 4Z89A 4ZNXA 2KGTA 1AEYA 1K76A 3THKA 1T3LA 2YUNA 3O5ZA 2GBQA 1SSHA 1HD3A 2V1QA 5IXFA 1AWJA 2DBKA 2X3XD 1Z9QA 2V1RA 4J9BA 4Y92A 2MIOA 1AVZC 1XOVA 2JM9A 2FEIA 2A36A 1PKSA 4J9GA 2CUBA 2M51A 1X2KA 4R0KA 2NUZA 2L0AA 5EC7A 2EYXA 1OPKA 3EG2A 5IHNA 1AWOA 1GRIA 4DEXA 1SHFA 2L3SA 2AK5A 1B07A 2LJ0A 1T0HA 1X43A 2CT3A 2KRSA 2LCSA 2LX7A 3SHWA 2LJ3A 4IIOA 4E6RA 2H8HA 2HSPA 3JV3A 3PE0A 4LUDA 3EHQA 2JM8A 1OOTA 1CKBA 1ZX6A 1UJ0A 2FRWA 1H92A 2AKKA 1I07A 1U5SA 1GCQA 2RQRA 3REAB 4DEYA 2DLPA 3ULRB 2EW3A 1UGVA 1UHCA 2JW4A 3UA6A 5IH2A 2EYYA 1NYGA 1J3TA 2DYBA 3NGPA 1M3BA 1SEMA 1T3SA 1ZBJA 1SRMA 1ZSGA 2K79A 2J6KA 2KROA 3A98A 3EG0A 3VRYA 2GNCA 2J6FA 2GTJA 4JPBW 1QKWA 1S1NA 1AWWA 1X69A 2OJ2A 2GGRA 1JU5C 4AFSC 2RN8A 2A37A 2KXDA 2CSQA 1CSKA 1G83A 1UJYA 4JJBA 2C0OA 4FSSA 2EPDA 1K4US 1E6HA 1GL5A 3M0UA 4OMMA 2GQIA 3ZL7C 4J9EA 3CQTA 3I5SA 2EGEA 2CDTA 2PTKA 2EGAA 2C0IA 1X6GA 3IQLA 1KJWA 1HJDA 2YSQA 1AZEA 2C0TA 2K7AA 1K9AA 4JJDA 1NYFA 4J9CA 1K0XA 3VRZA 4LUEA 2RF0A 1M8MA 2D8HA 1UFFA 1UUEA 2GTOA 1Y0MA 2BZYA 4HVVA 2FPFA 2K3BA 3EG3A 1RLPC 4LN2A 1PWTA 2DJQA 4ORZA 1WIEA 1WLPB 1WYXA 1YN8A 2E5KA 4OMLA 2AZVA 2LNHB 3H0HA 3FJ5A 2L3QA 1KSWA 2VWFA 4KRTA 1VYVA 2LQNA 3PVLA 1BBZA 2EGCA 2JMAA 3RBBB 2D0NA 1OPLA 1ZUKA 1QWEA 2JT4A 2PNIA 1OEBA 2ED0A 2OI3A 2O88A 1M3CA 1YCSB 5IHIA 5L23A 2A08A 3M0TA 4CC2A 2JS0A 2L3PA 4X1VA 2O2OA 2J7IA 3I35A 2RQTA 5IHKA 2B86A 1U3OA 2DA9A 1KFZA 2RQVA 3LH5A 2KYBA 3M0PA 1ABOA 1W6XA 2LJ1A 1W1FA 2CT4A 4Z88A 5I22A 1Z9ZA 2LMJA 4JJCA 1NEGA 1BB9A 1UECA 1WFWA 2IIMA 1WXBA 1JO8A 2DMOA 1AOJA 4IIMA 5FW9A 4J9HA 1VYUA 2FG0A 2JXBA 3C0CA 3I5RA 4J9IA 1B3QA 1GBQA 2KRMA 3NPFA 2FPEA 3NHNA 1GFDA 1OV3A 3VS6A 2DL4A 2ROTA 1VYTA 2K6DA 1U06A 2HEQA 1LCKA 2CH4W 2O31A 1CKAA 2ABLA 2RNAA 1ZLMA 1ZUYA 5IXBA 1ABQA 3VS3A 1JXMA 3TVTA 3VS0A 2D8JA 2VKNA 1RUWA 2LP5A 2DL3A 1AZGB 1TUDA 2CH4A 4WCIA 1WI7A 2KEAA 1GCQC 1JQQA 1NLPC 1NEBA 2PZ1A 3QWYA 2KBTA 2KR3A 2RMOA 4RUGA 3M0SA 1E6GA 1ZUUA 4QT7A 1YWOA 2SRCA 1N5ZA 2XMFA 2F2VA 4JZ3A 2EYZA 3H0FA 4OMPA 2L2PA 2KRNA 1AD5A 4GLMA 1AWXA 1H3HA 2CREA 2JTEA 2DVJA 4LE9A 2W0ZA 4HVUA 1A0NB 2I0NA 4GBQA 4AG2C 1FMKA 3R6NA
chains in the Genus database with same CATH superfamily
2RPNA 2J06A 2G6FX 4M7AE 3M58A 1BKBA 2KT1A 4QW2A 1PHTA 2O9VA 3M53A 2XHCA 3JCMP 1HSQA 1X27A 2P4TA 1KK7A 2ZGWA 4JS4A 2OTJQ 2RJEA 5CKFA 3PTAA 5L8RE 1VQMQ 3LGLA 4DA4A 4M7AG 2X3WD 2XDPA 3C12A 2Y4YA 3EFSA 4A54A 2IVWA 2PUOB 4CC3A 4PJOE 1Q81C 2OAWA 3X24B 2MCNA 2VVKA 2DNUA 1AHJB 5GMKe 1WJRA 2NWMA 4J6YA 3RMQA 3VU3C 2E3HA 1PKTA 3VS5A 4NS5A 4RTVA 3A1PA 1QVGA 2ENMA 2SEMA 3OYNA 2D1XA 3G71A 3REBB 2EVRA 3CCQA 5CK9A 2M0OA 3H0IA 4XU2A 2BE7D 3GLXA 4DBRA 2RHIA 2HNIA 4C5HA 2X51A 4D8KA 2OTLQ 3EG1A 1OYXA 3SB2A 1MUZA 5GANe 3HTRA 3BE3A 3X28B 1K1ZA 4FT4A 4PFZA 4RTTA 2XG8D 5GMKh 2AT1B 1RI0A 1H8KA 3MEUA 2AKLA 4WF2A 2YUQA 3CC4T 3RKWA 2HKNA 2QDLA 3CC7A 1N8RC 1EIFA 1WXUA 1E7OA 4HCKA 3T9NA 5CAIA 4OP0A 4C92C 2OTJT 1T0JA 1MGQA 3UDCA 5GANh 4CC4B 5HY6A 3OYKA 2V8KA 3U23A 5KYXB 5GMKm 3CMAQ 3S3NA 4M77F 1FXXA 3TSZA 3TU4K 1N27A 4A63B 1YJ9A 4Z8AA 1VQOQ 1V1CA 4EDUA 1WZOA 4LDYA 1WNLA 1M3AA 4Q5WA 4KT0E 3HSBA 2LQKA 2V8IA 1K73C 3M59A 1PRMC 2DL8A 4RCCA 3VS4A 3OYMA 2YUPA 4OMQA 1XTDA 4CC7A 4M7AC 2CSIA 1WHLA 2FPDA 2LQWA 3CXCP 1W2BP 1UGPB 2KYMA 2NUTA 3UATA 2OTLT 1VUBA 1GFCA 4JJNK 4J9DA 2DIGA 1BIBA 2VGMA 1DJ7B 3VJPA 2KGTA 1YITQ 3THKA 3MO8A 1VQ7T 5I21A 3BDUA 5IXFA 1AWJA 4C0GA 3CPWP 2Y4XA 2X3XD 3MHXA 4Y92A 3QJYA 3RKXA 2FEIA 4R56A 3J7AF 1M2OA 4C0FA 1D1AA 3V8LA 5EC7A 1OPKA 2P0KA 3A8MB 3OBWA 5CR2A 3CMEA 1GRIA 4N4IA 4C5EA 4ATOA 1OX8A 1PCXA 3LX7A 1B07A 2LJ0A 2LT4A 2LCLA 2FZKB 4M78A 1IREB 3SWNA 1FMWA 4X9DA 1VQOT 1Y71A 4A4KA 4DBQA 1QCOA 3VV0A 4E6RA 2HSPA 3JV3A 3V7RA 1M5Q1 3I55Q 2HQXA 2KQWA 3EHQA 5FU6B 3MKDA 2FRWA 1UJ0A 3QYHB 3OYIA 3QBYA 1I07A 4M75B 2YRCA 2NUPB 3ULRB 2DKGA 4BDYA 1C1AA 4BUGA 1UB4A 4JS5A 1I5LA 5IH2A 1NYGA 1J3TA 2DYBA 5GANd 2R5AA 2XD0A 1M3BA 2EQUA 1C0MA 1SRMA 3A98A 2J6KA 3ME9A 3NTHA 4OMFB 3VRYA 2RI3A 2GNCA 1I4K1 4IURA 1AWWA 1X69A 4N4GA 1TH7A 4O5VA 3AT1B 4M75G 3H8ZA 3PNWC 2RI5A 1Y7XA 1CSKA 3HFOA 2OX7A 1G83A 4FSSA 1K4US 2QG9B 4OB3B 3M0UA 2YRVA 2CP2A 3CCRQ 2GQIA 3ZL7C 4J9EA 5KYUA 3PFSA 3CQTA 1TS9A 2EGEA 2PTKA 5KYYA 2HZYA 2DK3A 2YSQA 2K7AA 1K9AA 1LVKA 1LNXA 2RF0A 3EFOB 1XNIA 5AYFA 4M7DB 3CC2Q 4BE1A 4Y28E 1UFFA 1JB0E 2FPFA 3JCMf 5LJ3g 1Q7YU 3JCMV 4LN2A 2IPOB 4PJJA 2A3LA 4RG8A 1PD0A 3GOXA 1ZSZA 1WYXA 3D7SB 3G1JA 5FRMA 2E5KA 1WHJA 1D0YA 3J80E 2AZVA 3MJXA 2DXUA 3FJ5A 2L3QA 3PVLA 4QQ6A 2EGCA 4XTZA 3RBBB 3JCMX 4M77E 4M7DG 5CQXA 3FEOA 1VQ4T 4DOWA 4C8QB 5CIUA 1YCSB 1PSFA 4J83A 4RG2A 4CC2A 5C0MA 3OW2P 4LDVA 4VUBA 3FJPA 1VQKA 2DA9A 4C92F 2DXCA 3FDRA 4J7FA 2KYBA 2VXFA 5AT1B 4QVCA 5LJ5g 2CT4A 5I22A 2KI7A 1Z9ZA 2LMJA 4C8QG 3FB9A 1VQ6A 2Z0WA 2LDMA 3WXMB 2WSCE 5FW9A 5FU6C 1VYUA 4IUPA 3CCEA 4DBHA 3CD6T 2LX9A 3CXCS 4M75C 1W2BS 1GBQA 5A0LA 3X26B 3RIRA 3CC2T 3QPHA 1JBMA 2DL4A 2ROTA 3UT1A 4F7UA 3NFCA 4M7AF 1M1GA 1VYTA 2HEQA 4KBMB 4E7JA 3I56A 1LCKA 4QVDA 1Q86U 1MMNA 1TTHB 1YHQA 1ABQA 3CPWS 2KSSA 2LP5A 2DL3A 1KG1A 1AZGB 1VQPT 1OI1A 1NPRA 4XTXA 1WI7A 1JQQA 1NLPC 1NEBA 2PZ1A 3QWYA 3OSVA 5DY9A 2ZPFB 3RKYA 2QEXQ 3L2RA 2XMFA 2YLBA 4PJOF 3MCAB 2KRNA 2CS7A 3HHTB 2CZ0B 3ZFJA 2RO0A 2COYA 1EX4A 2W0ZA 3JCMW 4E2FB 9ATCB 3RDVA 1A0NB 1YJWT 5GAMe 1WJSA 3PIOA 4M7DC 4NL3A 2MMPA 5FLXE 3CCJQ 1R8OB 1M1KC 5HK0A 1JXOA 2DEQA 1O9SA 2L8DA 2LRQA 1MMDA 1WXTA 1HK9A 1M8VA 3FLGA 2DRMA 2E12A 4ESRA 5I11A 1VQ8Q 1GCPA 1X2QA 3TREA 3UF4A 3QWXX 1TUCA 3GNGA 3CBPA 3NTKA 3FC3A 5GAN4 3CCMQ 2XDDA 1HXDA 2BIVA 5GAMh 2MK5A 4C8QC 1WDXA 2LCCA 1D0XA 1IGUA 4XAXB 2DL7A 3OYDA 3EGUA 1BU1A 3CCLA 3EGXA 5GANf 5C6SA 3BFMA 4RTZA 2AHJB 2NUTB 2HQHA 2HDAA 4RTYA 1HYOA 4HKEA 4L6V5 2DZ9A 2LZ6B 2FRYA 1K0SA 1NG2A 1YP5A 2RB6A 1WX6A 4RTXA 2FZCB 5GAMj 2K3XA 3VS2A 2QQBA 3VS7A 2DEUA 1KHIA 3OSSC 3C94A 5J26A 3CCUT 1G3TA 2EYWA 3RMSA 3VUBA 1RLQC 2M16A 2RJFA 1N6AA 2HCKA 3S6WA 2JS2A 2E4HA 4BDZA 1WA7A 2PU9B 3DLMA 3DKMA 4PLIA 2RI2A 1K8AU 2ECZA 3L2WA 3JCMJ 1I1JA 1M30A 4M78B 4UC4A 3SWNB 4C92E 1ZQ1A 3CCMT 5GJWB 1UGSB 3UA7A 2XK0A 1M27C 4AFUC 2WACA 3V7CA 5HKCA 2HBPA 2NLUA 3H6ZA 3A8LB 3HP9A 1VQ5Q 3J81E 2K4YA 3OW2S 1VQNQ 5GMKl 2DM1A 1SPKA 2EJ9A 2DBMA 4HT9A 3M5AA 4M78G 5DLQE 3RNJA 1YFNA 3PVQA 1K9MU 1ARKA 5GAOp 2ED1A 2KMTA 3CC4A 3QO3A 1TXQA 4L59A 5FWBA 3ZEHA 1QKXA 2FO0A 2HMAA 4F17A 5ECAA 4F16A 5KE2A 1YWPA 3VUZA 2G3RA 1IZ6A 3FRNA 2JJ9A 2K2VA 4EIKA 5DLOA 2E6ZA 4Z89A 1YI2Q 1PSEA 2O4XA 1YCYA 4OGEA 1K76A 1VIEA 1T3LA 1G8XA 5KYUB 3URGA 1OX9A 5KYYB 2V1RA 4DQ2A 1ZHIA 1Q7YR 1AVZC 1XOVA 4AMCA 2A36A 1NE8A 5LJ3f 1IB8A 4FYXB 3SDZA 2FYKA 2LNVA 2HAXA 4J9GA 1X2KA 4XQ3A 2L0AA 2DTIA 1AWOA 1KHCA 3CPFA 4DEXA 1ZSZB 1VQLA 5CCAA 3G4SQ 2OTLA 4LDWA 1VQ5T 1VQNT 3INZA 1X43A 2JTMA 4XK8E 2DYIA 2CT3A 2KRSA 1VQ7A 3N5BB 1Y96A 4ZN3A 4IIOA 2D6FA 2YLCA 3OYJA 1JRIA 2KAFA 4LUDA 4PK4A 2D9TA 4FW1A 2Y90A 2AKKA 1U5SA 1GCQA 2RQRA 3REAB 5LJ5f 2DLPA 2EW3A 3L2ZA 3PIPA 4M7DF 3G71Q 1UGVA 3GF5A 3CCQQ 3MEWA 4M7AD 4NOYA 1SEMA 2K79A 2KROA 4M78C 4Z02A 2GCXA 3SWNC 1VQMT 4FU6A 2J6FA 1C6VX 4N0AC 3BDLA 1JU5C 3UPUA 2XU8A 1IXDA 2VGNA 2CSQA 4JJBA 1Q86R 1FWZA 2WSEE 1GL5A 3EGDA 3CC7Q 5DM7R 1X75C 4PJOD 4F7UB 4BD3A 1AT1B 3G4ST 5FU7B 5LL6S 2QQAA 1M9SA 2MWPA 4ZGJB 2RHUA 2E5QA 4J9CA 3HRSA 4B6MA 5GANg 2HKQB 2D8HA 1B34A 1TU0B 2GTOA 2BZYA 1BCOA 3HRTA 3EG3A 1N8RU 2RH2A 4ORZA 1QCNA 1WIEA 5D6XA 4F7UG 4LD9K 4O6JA 4OMLA 3M4YA 2P0PA 4FSXA 1KSWA 2VWFA 1N9RA 2LQNA 1BBZA 3OYCA 3P8DA 1VQ9Q 2IG0A 2HL5C 1OPLA 4BI3A 1QWEA 4JRQA 1BI1A 2PNIA 2GQVA 3QZ9B 2ED0A 2O88A 1M3CA 1YBYA 2QAZA 2FHDA 1N9SA 2L3PA 1QW1A 2J7IA 1BIAA 3CMAT 3OS2A 1U3OA 3LH5A 1ZSZC 3PMTA 1W6XA 3A8HB 1WHHA 3QDRB 3V8KA 2LJ1A 1ACMB 1NBEB 1NEGA 1YIJA 1BB9A 1JJ2S 2I2LA 1TUGB 1M1KR 2A0FB 2RHYA 2DMOA 4E7LA 1OU8A 4R55A 3E1SA 1NPPA 2M02A 2D0QB 2FG0A 3C0CA 1VQ4A 2ZPEB 4PFPA 3I5RA 4N4HA 3CMEQ 4M75E 2QQRA 3TQ7P 3OYHA 2CP6A 4FL6A 3NPFA 3EG9B 3NHNA 2JZ2A 3OYEA 1YITT 5GAN3 3A8GB 2CH4W 2O31A 4A4FA 2RHZA 2RNAA 1ZLMA 1D0ZA 2D8JA 2VKNA 5IT9E 1RUWA 1VQ9T 1Q7YC 2VV5A 4J7IA 5GMKi 2ZPGB 3JB9I 2KEAA 4JLIA 2KBTA 4M7AA 3M0SA 5CQYA 1RABB 3OMCA 4QT7A 3CD6A 1YWOA 1N5ZA 4JRIA 1K8AR 2X4WA 1JJ2A 1RAEB 1S72A 4FW2A 5KH6A 3CC2A 1AD5A 4GLMA 2X35A 3JB9F 2CREA 5FU7C 4XTVA 1SG5A 4PFOA 4EMGA 1KQSP 4GBQA 3RUXA 1VIFA 2E3IA 4M7DE 3I55T 1VQPA 4JZ4A 4PJOA 2PQWA 3QUIA 2O9SA 1K9MR 4K11A 3CMET 2YDLA 1ZBXA 4BY6B 5LJ3j 3OYAA 2EBPA 2DXBA 2ROLA 2EQIA 2JMCA 2VASA 4FYWB 3NMZC 4L5GA 3V8JA 2BZ8A 3DB3A 3HKSA 4LNPA 2CUDA 4C8QE 1FYNA 3L2UA 4AFZC 1F1BB 4ANJA 1M90U 1YJWA 1JEGA 2NYSA 4IUVA 2JNGA 4M78F 4BI8B 3I9QA 4HXJA 1BI2A 1NM7A 1Q86C 2DRKA 2DILA 4HT8A 3HPWA 4OMNA 2JTFA 1UHFA 5GJVB 3CCRT 3EH2A 2O4XB 2K3YA 2KXCA 4OGCA 2M9UA 3CCSQ 2RQUA 4RTUA 1X6BA 2O01E 1UG1A 3LWHA 2BZXA 4MMLA 3QJ6A 5LJ5j 4E7HA 4ZTJA 2MF2A 3SEMA 3JCMc 4IKFA 3L2VA 3OS1A 4MZTA 5J39A 1QVGP 1UE9A 1G2BA 2EQKA 1VQKQ 2CZ7B 1QCFA 3KFVA 5GAOn 3CCVA 1SRLA 4E7SA 2VYTA 2R5MA 4C0DB 4Y91A 1VQ6Q 3R6OA 2F5TX 2RQWA 3OS0A 4M7DD 2QK0A 1TSFA 1QQJA 3GP8A 4AG1C 4XU0A 2JVVA 3QHSA 3CCEQ 2P4RA 3JB9J 2MI6A 1X6OA 5GAN8 1Y96B 4HCZA 3RR6A 3C4SA 3MEAA 2YT6A 3QYGB 3META 4D8DA 1EFNA 2HSEB 3G6EQ 1KQ1A 4M77D 1BK2A 3CCUA 2BTTA 3M0RA 3M0QA 3I56Q 2W10A 2ZPIB 1YHQQ 1M2VA 2DL5A 1KQ2A 1V29B 2DX1A 2RK1A 3CXCA 1W2BA 4II1A 4QKUA 2E6NA 2QGFB 1MMGA 3OB9A 3CCST 3DLLA 1UTIA 3OYGA 2CYZB 2VC8A 3EHRA 1RI9A 4CRIA 3HRUA 1RACB 3CCMA 4HA8A 4V2SA 1WGSA 1VQKT 5IAYA 2ESWA 3CPWA 2EJFA 1MNDA 2QDYB 4BY6C 4EMKA 2YUNA 5GAOl 3EGDB 3O5ZA 2GBQA 1SSHA 2BUDA 1HD3A 2V1QA 2DBKA 4GY5A 1PG5B 2MIOA 1RADB 2JM9A 2CP0A 1BI0A 3LH0A 1Q95G 1PKSA 1B34B 2CUBA 1PD1A 2QI2A 2V8JA 4R0KA 2NUZA 2ZPHB 3G6ET 2F1LA 3JCMe 2QEXT 2R57A 4A53A 3PGGA 1K8AC 1OQKA 4PJMA 1MNEA 1IHWA 2YWWA 2AK5A 3E19A 2QQSA 1T0HA 2JN0A 4KGZB 3LLRA 1ZA1B 2CZ1B 2RK2A 2LJ3A 5GAMg 3CCLQ 1I81A 1WHGA 1YJNQ 4XTUA 3CCJT 3SFMA 2E70A 1SSFA 1OOTA 1CKBA 1H92A 1P92A 4XTWA 5KCOA 3SD4A 3M57A 3JCMh 4DEYA 4C0DC 1K9MC 1VQ8T 2V26A 2EJGA 4XU1A 1UHCA 3LGFA 1FX7A 3UA6A 1G3YA 5D7UA 1VQ5A 5KYWA 1VQNA 1T3SA 1ZBJA 1ZSGA 4M78E 2QA4Q 3EG0A 1X01A 4B9XA 3MEVA 1H3ZA 2P84A 2K5FA 2OJ2A 3JRZA 4AFSC 2RN8A 1KC8U 2A37A 1BYMA 4QQDA 1PC0A 2C0OA 2EPDA 4KGVB 1E6HA 2QQ9A 3VKIA 4OMMA 4BE2A 1KD1U 2CDTA 3M55A 4TVRA 2C0IA 1RAFB 3JB9D 1X6GA 4A4GA 2H3EB 4M77A 4BB7A 2QTVA 1KJWA 2VB6A 4BACA 4JJDA 2DZCA 1NYFA 1K0XA 2OTJA 3VRZA 2XIDA 4MZMA 4MMKA 1M8MA 1VQMA 1QVGS 3NTIA 4JUVA 2EYQA 4OVAA 1YJNT 2K3BA 4AT1B 2P0QA 5GAOm 5GAMd 4RKUE 2DFUA 1WLPB 4X34A 5IN1A 2CKKA 2DPPB 4KGXB 4M7AB 5CKBA 1YN8A 5A0GA 2XI9A 4M75F 4J6WA 3H0HA 1Q82U 3CC4Q 2X4JA 4CI0C 4PJNA 1U1TA 1BCMA 4KRTA 1VYVA 5GAN2 2JMAA 1WHMA 2COZA 3OW2A 5KE3A 1ZUKA 3L2QA 2JT4A 1OEBA 3G4SA 1EZZB 2OI3A 1NJIU 2K57A 2X9HA 2QA4T 2DJZA 2E64A 5L23A 2A08A 4YTLA 2JS0A 2R58A 3BW1A 3I35A 2RQTA 4C92D 2B86A 1SKUB 4E7ZA 5IHKA 3QG1A 4PJOB 8AT1B 4ELZC 4HCCA 4M78D 5KCHA 3M0PA 1ABOA 5J3BA 5CKDA 3PT9A 2LC4A 1IHVA 2QASA 1UECA 3KBGA 6AT1B 1M90R 4XTYA 3V7SA 3JCMd 4IIMA 4KH0B 5I2MA 4PJOG 2MAMA 1I5OB 1B3QA 1QP2A 1R77A 3OQ5A 1VQLQ 2DETA 8ATCB 2E10A 2CP5A 2EAYA 2DD4A 1YI2T 3TCJA 3VS6A 3CMAA 1D09B 3MP8A 4A4EA 5A2QE 1Q81U 1VQ7Q 1G3SA 1OZ2A 2K6DA 1U06A 2YXYA 3ZBDA 3BY7A 1CKAA 2ABLA 5IXBA 2HQEA 1OU9A 1JXMA 3VS0A 1VQOA 1MHNA 1VOMA 1QP3A 4P5NA 2XDBA 1B7TA 4QQGA 1TUDA 4OF1A 2ZZDA 2CH4A 1SF9A 4WCIA 4JRKA 1PM3A 4C8QF 2MYSA 2QGGA 1ZA2B 2RHXA 3P8BB 2CGHA 2SRCA 4E47A 4JZ3A 2EYZA 5M9OA 3H0FA 2E41A 3RESA 2L2PA 4F7UE 5GMKj 1D3BA 2JTEA 4FT2A 1YITA 5KYNA 2K5LA 3MP1A 1UEBA 2DTHA 2L5QA 4OB0B 4HVUA 4EPCA 2EWNA 1YJ9Q 3A8OB 1VQ9A 2DF6A 2COWA 5FWCA 4NL2A 2EKHA 3VYGA 4EMHA 3QKJA 3VS1A 2LT1A 5GANj 2KK4A 1U1SA 5CKEA 4F04B 1VQLT 1QMCA 1G5VA 3MPUB 5I2SA 1QVPA 2LQ8A 3G71T 1BI3A 4J9FA 3OY9A 1M2VB 2M1HA 3JSCA 3CCQT 5A0DA 2JOYA 4MDXA 4M4ZA 3HL8A 3QSUA 1WPYA 2DTOA 4KULA 2HD0A 4X9CA 3G7ZA 1IO6A 3GBQA 3E9GA 1QVFP 1OULA 1K73U 3E9FA 1QWFA 2KT8A 2DERA 2FVUA 4PJOC 2DE0X 4J6XA 1TOVA 3I55A 2VUBA 4OMOA 1W4SA 2LVMA 1M4ZA 3CC7T 3O8VA 3RERA 1PNJA 4EMKB 3H41A 2RM4A 4C5IA 1W70A 2PVOB 4KUDK 2F2WA 2RJDA 1YNZA 2RJCA 4PLLA 4C92A 1NZ9A 2YUOA 2A28A 4RTWA 3EGXB 4IUQA 2KE9A 1SHGA 2HBWA 4N0AA 1GBRA 1MMAA 2LTOA 2X4YA 3EH1A 1I0CA 1LJOA 5LJ3e 1YJ9T 2DXTA 3M54A 4OB2B 4F14A 1NLOC 2CP3A 3L1AA 1WQ7A 2AZSA 1YIJQ 1UDLA 4FM4B 4JRPA 1RAGB 4DBFA 2FB7A 2EQJA 2K9GA 2PUKB 5GAMf 3CCRA 1MV0B 1PRLC 3FIFA 1VQ4Q 2KNBB 3OA6A 5EG2A 4OB1B 3HFNA 1D1BA 3QDFA 1TG0A 5LJ3h 2A7YA 2YHTA 2J6OA 1RAHB 2BE9B 4ZN1A 2J05A 3WVDB 3KUFA 4HCBA 2F2XA 3JCMb 5LJ5e 3KXTA 4HVWA 5HCKA 1Y07A 3CEYA 1VA7A 2E1HA 3LYIA 1KC8R 2K2MA 1M90C 5KYWB 3TSWA 1Y57A 2KDSA 3X25B 2M0YA 4LDUA 4JLGA 4AFQC 3ASKA 1IGQA 2MOXA 5GAN6 1MV3A 4PNOA 3CD6Q 3OYLA 2HL3A 4E7IA 1S72Q 1KD1R 4B9WA 1QLYA 1KIKA 3VYHB 5LJ5h 4ZNXA 1AEYA 4M75D 1I8FA 1V76A 2KY9A 2K5IA 1YIJT 1Z9QA 3M4GA 1RAAB 1WHKA 4J9BA 1XJWB 1FMVA 3LW5E 4M77B 4WTOB 4LXCA 2X4XA 3JB9H 1VQPQ 4J8OA 3JCMQ 3A5ZB 3CCSA 3OYBA 4ZGEB 5GAN7 3S3OA 1Q82R 2M51A 4J5YA 2DAQA 3F70A 4FYVB 2EIFA 3LWIA 2EYXA 3GNFB 3EG2A 5IHNA 7AT1B 2JUFA 4JDSA 1SHFA 2L3SA 5CVIA 2PVDB 3X20B 4EMKC 2XKOC 4MDWA 4M77G 3DB4A 1NJIR 3AHUA 2LCSA 3GIBA 2LX7A 3SHWA 1YJWQ 1UGRB 2H8HA 3EAEA 3PE0A 5KYXA 3S3MA 2JM8A 3OMGA 1ZX6A 3TEEA 3QZ5B 3WVEB 2ATCB 4ZGDB 2WSFE 2ZAEA 2VXEA 1S72T 5GAOr 2JW4A 3G6EA 2QEXA 2EYYA 3NGPA 1OZ3A 2DIQA 4PL6A 4PKCC 2CZ6B 5LJ3d 2GTJA 4JPBW 1QKWA 1S1NA 3OYFA 2GGRA 3E2UA 3CCVQ 1RL2A 1D1CA 5CO7A 2OAUA 3QXEB 1QVFS 2L89A 1WQWA 3CBMA 4PJLA 4ZTFA 2KXDA 1Q81R 4C8QD 1UJYA 5GAOq 3CCJA 2XICA 3CBOA 2DD5A 4RMOA 3Q1JA 1LPLA 4C0ZA 4DOVA 1R0BG 4BE0A 4FIBA 3I5SA 3P8HA 1WJQA 1VQ8A 2EGAA 4FYYB 3IQLA 5GAN5 1HJDA 1AZEA 2C0TA 3JAME 4LUEA 2L3RA 3CCUQ 4QVZA 1UUEA 1Y0MA 4HVVA 5LJ5d 2QYZA 2H3JA 1RLPC 1PWTA 2CP7A 2DJQA 3M9QA 4XU3A 4LDXA 2EFIA 2LNHB 4KUIA 4FCYA 1VQ6T 3PMIA 2E65A 3OBYA 2ZCFB 1M1FA 1N8RR 1D3BB 2F69A 4M77C 2D0NA 5FROA 3UWNA 1RAIB 3L42A 3CCET 1QVFA 5CKHA 4LD6A 5IHIA 2YRDA 3M0TA 4X1VA 2GFUA 2QTXA 2O2OA 4M75A 2PVGB 3CCVT 2BKDN 2NUPA 1M1KU 1GXIE 2RQVA 1KFZA 1YJNA 3I56T 2B8AA 3EG9A 1YHQT 1W1FA 4Z88A 3M56A 4JJCA 3C95A 1KQSS 4BI4A 4D6WA 1K73R 1WFWA 4IUTA 4F7UF 1R0CB 2IIMA 1WXBA 1H641 1KC8C 1JO8A 1AOJA 4J9HA 2MWOA 2JXBA 2RD1A 4J9IA 3JB9G 4GLKA 2QA4A 2AIRB 1O75A 4C5GA 5FRNA 2GF7A 1KD1C 1TWBA 2KRMA 2ZPBB 2FPEA 4KH1B 1GFDA 1OV3A 5D6WA 2FL7A 3OYYA 4RCBA 1LOJA 2QXFA 4ELYC 3EFRA 2KVQG 2C06A 2FZGB 1ZUYA 2DO3A 3VS3A 3TVTA 2MPXC 3EFOA 4ME7A 4C92B 4M7DA 1UGQB 1IRXA 2GFAA 1GCQC 2KR3A 2DVEA 2RMOA 1Q82C 4RUGA 3JCMg 1XQHA 1E6GA 1ZUUA 4E7KA 3MP6A 1U8RA 3ER0A 2F2VA 3OS5A 1KQSA 4OMPA 5HK3A 1AWXA 1H3HA 5D6YA 2F5KA 1YI2A 2EQMA 3QIIA 2DVJA 4LE9A 4C92G 3GPLA 1NJIC 4A4HA 4MZPA 2EKOA 4C8QA 4IUUA 1JJ2P 3CCLT 2I0NA 4AG2C 2RA2A 3H9NA 1FMKA 3R6NA 1G3WA
chains in the Genus database with same CATH topology
1JXOA 2RPNA 2J06A 4JZ4A 2DF6A 5FWCA 2G6FX 1WXTA 2EKHA 2O9SA 2DRMA 3VS1A 2KT1A 4K11A 4ESRA 5I11A 1GCPA 2YDLA 1PHTA 2O9VA 1X2QA 3UF4A 3QWXX 2EBPA 1TUCA 4J9FA 1HSQA 2ROLA 1X27A 2EQIA 2JMCA 3NMZC 2BZ8A 4M4ZA 4LNPA 2CUDA 1WDXA 1FYNA 4AFZC 2X3WD 2DL7A 1IO6A 3GBQA 3EGUA 1BU1A 1JEGA 1QWFA 2KT8A 4CC3A 2DE0X 4RTZA 2OAWA 3I9QA 4HXJA 2MCNA 2VVKA 2DNUA 4OMOA 2HDAA 1NM7A 2NWMA 2DRKA 2DILA 4OMNA 1UHFA 1PKTA 4RTYA 5GJVB 3VS5A 2LZ6B 2FRYA 2KXCA 4RTVA 1K0SA 1NG2A 1PNJA 1YP5A 2RQUA 3H41A 4RTUA 2ENMA 1X6BA 1W70A 2SEMA 2D1XA 1UG1A 3REBB 1WX6A 2BZXA 2F2WA 2EVRA 4RTXA 3SEMA 1YNZA 3H0IA 2YUOA 2A28A 4RTWA 4D8KA 2KE9A 1UE9A 3EG1A 1G2BA 3VS2A 3VS7A 1MUZA 1SHGA 2HBWA 2EYWA 1GBRA 1RLQC 1QCFA 1K1ZA 3KFVA 4RTTA 1I0CA 1SRLA 1H8KA 4F14A 2HCKA 1NLOC 2AZSA 2JS2A 1UDLA 2AKLA 2YUQA 2RQWA 1WA7A 2K9GA 4AG1C 2ECZA 2QDLA 1WXUA 1MV0B 1E7OA 1I1JA 1M30A 1PRLC 4HCKA 2P4RA 2KNBB 1T0JA 2YT6A 5GJWB 4CC4B 3UA7A 1EFNA 4D8DA 1M27C 4AFUC 1TG0A 3U23A 1BK2A 2J6OA 3TSZA 2BTTA 3M0RA 3M0QA 2DM1A 1SPKA 2J05A 2DBMA 2W10A 2F2XA 4A63B 4Z8AA 1V1CA 2DL5A 4HVWA 3RNJA 5HCKA 2DX1A 3PVQA 1M3AA 1ARKA 2ED1A 1VA7A 2K2MA 5FWBA 1PRMC 2DL8A 1Y57A 1QKXA 3TSWA 3VS4A 2YUPA 4OMQA 2M0YA 1UTIA 3EHRA 2FO0A 4CC7A 4AFQC 1RI9A 2CSIA 2FPDA 2LQWA 2MOXA 1MV3A 4F17A 5ECAA 4F16A 2KYMA 1YWPA 3UATA 1GFCA 4EIKA 4J9DA 1QLYA 2ESWA 1KIKA 4Z89A 4ZNXA 2KGTA 1AEYA 1K76A 3THKA 1T3LA 2YUNA 3O5ZA 2GBQA 1SSHA 1HD3A 2V1QA 5IXFA 1AWJA 2DBKA 2X3XD 1Z9QA 2V1RA 4J9BA 4Y92A 2MIOA 1AVZC 1XOVA 2JM9A 2FEIA 2A36A 1PKSA 4J9GA 2CUBA 2M51A 1X2KA 4R0KA 2NUZA 2L0AA 5EC7A 2EYXA 1OPKA 3EG2A 5IHNA 1AWOA 1GRIA 4DEXA 1SHFA 2L3SA 2AK5A 1B07A 2LJ0A 1T0HA 1X43A 2CT3A 2KRSA 2LCSA 2LX7A 3SHWA 2LJ3A 4IIOA 4E6RA 2H8HA 2HSPA 3JV3A 3PE0A 4LUDA 3EHQA 2JM8A 1OOTA 1CKBA 1ZX6A 1UJ0A 2FRWA 1H92A 2AKKA 1I07A 1U5SA 1GCQA 2RQRA 3REAB 4DEYA 2DLPA 3ULRB 2EW3A 1UGVA 1UHCA 2JW4A 3UA6A 5IH2A 2EYYA 1NYGA 1J3TA 2DYBA 3NGPA 1M3BA 1SEMA 1T3SA 1ZBJA 1SRMA 1ZSGA 2K79A 2J6KA 2KROA 3A98A 3EG0A 3VRYA 2GNCA 2J6FA 2GTJA 4JPBW 1QKWA 1S1NA 1AWWA 1X69A 2OJ2A 2GGRA 1JU5C 4AFSC 2RN8A 2A37A 2KXDA 2CSQA 1CSKA 1G83A 1UJYA 4JJBA 2C0OA 4FSSA 2EPDA 1K4US 1E6HA 1GL5A 3M0UA 4OMMA 2GQIA 3ZL7C 4J9EA 3CQTA 3I5SA 2EGEA 2CDTA 2PTKA 2EGAA 2C0IA 1X6GA 3IQLA 1KJWA 1HJDA 2YSQA 1AZEA 2C0TA 2K7AA 1K9AA 4JJDA 1NYFA 4J9CA 1K0XA 3VRZA 4LUEA 2RF0A 1M8MA 2D8HA 1UFFA 1UUEA 2GTOA 1Y0MA 2BZYA 4HVVA 2FPFA 2K3BA 3EG3A 1RLPC 4LN2A 1PWTA 2DJQA 4ORZA 1WIEA 1WLPB 1WYXA 1YN8A 2E5KA 4OMLA 2AZVA 2LNHB 3H0HA 3FJ5A 2L3QA 1KSWA 2VWFA 4KRTA 1VYVA 2LQNA 3PVLA 1BBZA 2EGCA 2JMAA 3RBBB 2D0NA 1OPLA 1ZUKA 1QWEA 2JT4A 2PNIA 1OEBA 2ED0A 2OI3A 2O88A 1M3CA 1YCSB 5IHIA 5L23A 2A08A 3M0TA 4CC2A 2JS0A 2L3PA 4X1VA 2O2OA 2J7IA 3I35A 2RQTA 5IHKA 2B86A 1U3OA 2DA9A 1KFZA 2RQVA 3LH5A 2KYBA 3M0PA 1ABOA 1W6XA 2LJ1A 1W1FA 2CT4A 4Z88A 5I22A 1Z9ZA 2LMJA 4JJCA 1NEGA 1BB9A 1UECA 1WFWA 2IIMA 1WXBA 1JO8A 2DMOA 1AOJA 4IIMA 5FW9A 4J9HA 1VYUA 2FG0A 2JXBA 3C0CA 3I5RA 4J9IA 1B3QA 1GBQA 2KRMA 3NPFA 2FPEA 3NHNA 1GFDA 1OV3A 3VS6A 2DL4A 2ROTA 1VYTA 2K6DA 1U06A 2HEQA 1LCKA 2CH4W 2O31A 1CKAA 2ABLA 2RNAA 1ZLMA 1ZUYA 5IXBA 1ABQA 3VS3A 1JXMA 3TVTA 3VS0A 2D8JA 2VKNA 1RUWA 2LP5A 2DL3A 1AZGB 1TUDA 2CH4A 4WCIA 1WI7A 2KEAA 1GCQC 1JQQA 1NLPC 1NEBA 2PZ1A 3QWYA 2KBTA 2KR3A 2RMOA 4RUGA 3M0SA 1E6GA 1ZUUA 4QT7A 1YWOA 2SRCA 1N5ZA 2XMFA 2F2VA 4JZ3A 2EYZA 3H0FA 4OMPA 2L2PA 2KRNA 1AD5A 4GLMA 1AWXA 1H3HA 2CREA 2JTEA 2DVJA 4LE9A 2W0ZA 4HVUA 1A0NB 2I0NA 4GBQA 4AG2C 1FMKA 3R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXO A;  2RPN A;  2J06 A;  4JZ4 A;  2DF6 A;  5FWC A;  2G6F X;  1WXT A;  2EKH A;  2O9S A;  2DRM A;  3VS1 A;  2KT1 A;  4K11 A;  4ESR A;  5I11 A;  1GCP A;  2YDL A;  1PHT A;  2O9V A;  1X2Q A;  3UF4 A;  3QWX X;  2EBP A;  1TUC A;  4J9F A;  1HSQ A;  2ROL A;  1X27 A;  2EQI A;  2JMC A;  3NMZ C;  2BZ8 A;  4M4Z A;  4LNP A;  2CUD A;  1WDX A;  1FYN A;  4AFZ C;  2X3W D;  2DL7 A;  1IO6 A;  3GBQ A;  3EGU A;  1BU1 A;  1JEG A;  1QWF A;  2KT8 A;  4CC3 A;  2DE0 X;  4RTZ A;  2OAW A;  3I9Q A;  4HXJ A;  2MCN A;  2VVK A;  2DNU A;  4OMO A;  2HDA A;  1NM7 A;  2NWM A;  2DRK A;  2DIL A;  4OMN A;  1UHF A;  1PKT A;  4RTY A;  5GJV B;  3VS5 A;  2LZ6 B;  2FRY A;  2KXC A;  4RTV A;  1K0S A;  1NG2 A;  1PNJ A;  1YP5 A;  2RQU A;  3H41 A;  4RTU A;  2ENM A;  1X6B A;  1W70 A;  2SEM A;  2D1X A;  1UG1 A;  3REB B;  1WX6 A;  2BZX A;  2F2W A;  2EVR A;  4RTX A;  3SEM A;  1YNZ A;  3H0I A;  2YUO A;  2A28 A;  4RTW A;  4D8K A;  2KE9 A;  1UE9 A;  3EG1 A;  1G2B A;  3VS2 A;  3VS7 A;  1MUZ A;  1SHG A;  2HBW A;  2EYW A;  1GBR A;  1RLQ C;  1QCF A;  1K1Z A;  3KFV A;  4RTT A;  1I0C A;  1SRL A;  1H8K A;  4F14 A;  2HCK A;  1NLO C;  2AZS A;  2JS2 A;  1UDL A;  2AKL A;  2YUQ A;  2RQW A;  1WA7 A;  2K9G A;  4AG1 C;  2ECZ A;  2QDL A;  1WXU A;  1MV0 B;  1E7O A;  1I1J A;  1M30 A;  1PRL C;  4HCK A;  2P4R A;  2KNB B;  1T0J A;  2YT6 A;  5GJW B;  4CC4 B;  3UA7 A;  1EFN A;  4D8D A;  1M27 C;  4AFU C;  1TG0 A;  3U23 A;  1BK2 A;  2J6O A;  3TSZ A;  2BTT A;  3M0R A;  3M0Q A;  2DM1 A;  1SPK A;  2J05 A;  2DBM A;  2W10 A;  2F2X A;  4A63 B;  4Z8A A;  1V1C A;  2DL5 A;  4HVW A;  3RNJ A;  5HCK A;  2DX1 A;  3PVQ A;  1M3A A;  1ARK A;  2ED1 A;  1VA7 A;  2K2M A;  5FWB A;  1PRM C;  2DL8 A;  1Y57 A;  1QKX A;  3TSW A;  3VS4 A;  2YUP A;  4OMQ A;  2M0Y A;  1UTI A;  3EHR A;  2FO0 A;  4CC7 A;  4AFQ C;  1RI9 A;  2CSI A;  2FPD A;  2LQW A;  2MOX A;  1MV3 A;  4F17 A;  5ECA A;  4F16 A;  2KYM A;  1YWP A;  3UAT A;  1GFC A;  4EIK A;  4J9D A;  1QLY A;  2ESW A;  1KIK A;  4Z89 A;  4ZNX A;  2KGT A;  1AEY A;  1K76 A;  3THK A;  1T3L A;  2YUN A;  3O5Z A;  2GBQ A;  1SSH A;  1HD3 A;  2V1Q A;  5IXF A;  1AWJ A;  2DBK A;  2X3X D;  1Z9Q A;  2V1R A;  4J9B A;  4Y92 A;  2MIO A;  1AVZ C;  1XOV A;  2JM9 A;  2FEI A;  2A36 A;  1PKS A;  4J9G A;  2CUB A;  2M51 A;  1X2K A;  4R0K A;  2NUZ A;  2L0A A;  5EC7 A;  2EYX A;  1OPK A;  3EG2 A;  5IHN A;  1AWO A;  1GRI A;  4DEX A;  1SHF A;  2L3S A;  2AK5 A;  1B07 A;  2LJ0 A;  1T0H A;  1X43 A;  2CT3 A;  2KRS A;  2LCS A;  2LX7 A;  3SHW A;  2LJ3 A;  4IIO A;  4E6R A;  2H8H A;  2HSP A;  3JV3 A;  3PE0 A;  4LUD A;  3EHQ A;  2JM8 A;  1OOT A;  1CKB A;  1ZX6 A;  1UJ0 A;  2FRW A;  1H92 A;  2AKK A;  1I07 A;  1U5S A;  1GCQ A;  2RQR A;  3REA B;  4DEY A;  2DLP A;  3ULR B;  2EW3 A;  1UGV A;  1UHC A;  2JW4 A;  3UA6 A;  5IH2 A;  2EYY A;  1NYG A;  1J3T A;  2DYB A;  3NGP A;  1M3B A;  1SEM A;  1T3S A;  1ZBJ A;  1SRM A;  1ZSG A;  2K79 A;  2J6K A;  2KRO A;  3A98 A;  3EG0 A;  3VRY A;  2GNC A;  2J6F A;  2GTJ A;  4JPB W;  1QKW A;  1S1N A;  1AWW A;  1X69 A;  2OJ2 A;  2GGR A;  1JU5 C;  4AFS C;  2RN8 A;  2A37 A;  2KXD A;  2CSQ A;  1CSK A;  1G83 A;  1UJY A;  4JJB A;  2C0O A;  4FSS A;  2EPD A;  1K4U S;  1E6H A;  1GL5 A;  3M0U A;  4OMM A;  2GQI A;  3ZL7 C;  4J9E A;  3CQT A;  3I5S A;  2EGE A;  2CDT A;  2PTK A;  2EGA A;  2C0I A;  1X6G A;  3IQL A;  1KJW A;  1HJD A;  2YSQ A;  1AZE A;  2C0T A;  2K7A A;  1K9A A;  4JJD A;  1NYF A;  4J9C A;  1K0X A;  3VRZ A;  4LUE A;  2RF0 A;  1M8M A;  2D8H A;  1UFF A;  1UUE A;  2GTO A;  1Y0M A;  2BZY A;  4HVV A;  2FPF A;  2K3B A;  3EG3 A;  1RLP C;  4LN2 A;  1PWT A;  2DJQ A;  4ORZ A;  1WIE A;  1WLP B;  1WYX A;  1YN8 A;  2E5K A;  4OML A;  2AZV A;  2LNH B;  3H0H A;  3FJ5 A;  2L3Q A;  1KSW A;  2VWF A;  4KRT A;  1VYV A;  2LQN A;  3PVL A;  1BBZ A;  2EGC A;  2JMA A;  3RBB B;  2D0N A;  1OPL A;  1ZUK A;  1QWE A;  2JT4 A;  2PNI A;  1OEB A;  2ED0 A;  2OI3 A;  2O88 A;  1M3C A;  1YCS B;  5IHI A;  5L23 A;  2A08 A;  3M0T A;  4CC2 A;  2JS0 A;  2L3P A;  4X1V A;  2O2O A;  2J7I A;  3I35 A;  2RQT A;  5IHK A;  2B86 A;  1U3O A;  2DA9 A;  1KFZ A;  2RQV A;  3LH5 A;  2KYB A;  3M0P A;  1ABO A;  1W6X A;  2LJ1 A;  1W1F A;  2CT4 A;  4Z88 A;  5I22 A;  1Z9Z A;  2LMJ A;  4JJC A;  1NEG A;  1BB9 A;  1UEC A;  1WFW A;  2IIM A;  1WXB A;  1JO8 A;  2DMO A;  1AOJ A;  4IIM A;  5FW9 A;  4J9H A;  1VYU A;  2FG0 A;  2JXB A;  3C0C A;  3I5R A;  4J9I A;  1B3Q A;  1GBQ A;  2KRM A;  3NPF A;  2FPE A;  3NHN A;  1GFD A;  1OV3 A;  3VS6 A;  2DL4 A;  2ROT A;  1VYT A;  2K6D A;  1U06 A;  2HEQ A;  1LCK A;  2CH4 W;  2O31 A;  1CKA A;  2ABL A;  2RNA A;  1ZLM A;  1ZUY A;  5IXB A;  1ABQ A;  3VS3 A;  1JXM A;  3TVT A;  3VS0 A;  2D8J A;  2VKN A;  1RUW A;  2LP5 A;  2DL3 A;  1AZG B;  1TUD A;  2CH4 A;  4WCI A;  1WI7 A;  2KEA A;  1GCQ C;  1JQQ A;  1NLP C;  1NEB A;  2PZ1 A;  3QWY A;  2KBT A;  2KR3 A;  2RMO A;  4RUG A;  3M0S A;  1E6G A;  1ZUU A;  4QT7 A;  1YWO A;  2SRC A;  1N5Z A;  2XMF A;  2F2V A;  4JZ3 A;  2EYZ A;  3H0F A;  4OMP A;  2L2P A;  2KRN A;  1AD5 A;  4GLM A;  1AWX A;  1H3H A;  2CRE A;  2JTE A;  2DVJ A;  4LE9 A;  2W0Z A;  4HVU A;  1A0N B;  2I0N A;  4GBQ A;  4AG2 C;  1FMK A;  3R6N A; 
#chains in the Genus database with same CATH topology
 2RPN A;  2J06 A;  2G6F X;  4M7A E;  3M58 A;  1BKB A;  2KT1 A;  4QW2 A;  1PHT A;  2O9V A;  3M53 A;  2XHC A;  3JCM P;  1HSQ A;  1X27 A;  2P4T A;  1KK7 A;  2ZGW A;  4JS4 A;  2OTJ Q;  2RJE A;  5CKF A;  3PTA A;  5L8R E;  1VQM Q;  3LGL A;  4DA4 A;  4M7A G;  2X3W D;  2XDP A;  3C12 A;  2Y4Y A;  3EFS A;  4A54 A;  2IVW A;  2PUO B;  4CC3 A;  4PJO E;  1Q81 C;  2OAW A;  3X24 B;  2MCN A;  2VVK A;  2DNU A;  1AHJ B;  5GMK e;  1WJR A;  2NWM A;  4J6Y A;  3RMQ A;  3VU3 C;  2E3H A;  1PKT A;  3VS5 A;  4NS5 A;  4RTV A;  3A1P A;  1QVG A;  2ENM A;  2SEM A;  3OYN A;  2D1X A;  3G71 A;  3REB B;  2EVR A;  3CCQ A;  5CK9 A;  2M0O A;  3H0I A;  4XU2 A;  2BE7 D;  3GLX A;  4DBR A;  2RHI A;  2HNI A;  4C5H A;  2X51 A;  4D8K A;  2OTL Q;  3EG1 A;  1OYX A;  3SB2 A;  1MUZ A;  5GAN e;  3HTR A;  3BE3 A;  3X28 B;  1K1Z A;  4FT4 A;  4PFZ A;  4RTT A;  2XG8 D;  5GMK h;  2AT1 B;  1RI0 A;  1H8K A;  3MEU A;  2AKL A;  4WF2 A;  2YUQ A;  3CC4 T;  3RKW A;  2HKN A;  2QDL A;  3CC7 A;  1N8R C;  1EIF A;  1WXU A;  1E7O A;  4HCK A;  3T9N A;  5CAI A;  4OP0 A;  4C92 C;  2OTJ T;  1T0J A;  1MGQ A;  3UDC A;  5GAN h;  4CC4 B;  5HY6 A;  3OYK A;  2V8K A;  3U23 A;  5KYX B;  5GMK m;  3CMA Q;  3S3N A;  4M77 F;  1FXX A;  3TSZ A;  3TU4 K;  1N27 A;  4A63 B;  1YJ9 A;  4Z8A A;  1VQO Q;  1V1C A;  4EDU A;  1WZO A;  4LDY A;  1WNL A;  1M3A A;  4Q5W A;  4KT0 E;  3HSB A;  2LQK A;  2V8I A;  1K73 C;  3M59 A;  1PRM C;  2DL8 A;  4RCC A;  3VS4 A;  3OYM A;  2YUP A;  4OMQ A;  1XTD A;  4CC7 A;  4M7A C;  2CSI A;  1WHL A;  2FPD A;  2LQW A;  3CXC P;  1W2B P;  1UGP B;  2KYM A;  2NUT A;  3UAT A;  2OTL T;  1VUB A;  1GFC A;  4JJN K;  4J9D A;  2DIG A;  1BIB A;  2VGM A;  1DJ7 B;  3VJP A;  2KGT A;  1YIT Q;  3THK A;  3MO8 A;  1VQ7 T;  5I21 A;  3BDU A;  5IXF A;  1AWJ A;  4C0G A;  3CPW P;  2Y4X A;  2X3X D;  3MHX A;  4Y92 A;  3QJY A;  3RKX A;  2FEI A;  4R56 A;  3J7A F;  1M2O A;  4C0F A;  1D1A A;  3V8L A;  5EC7 A;  1OPK A;  2P0K A;  3A8M B;  3OBW A;  5CR2 A;  3CME A;  1GRI A;  4N4I A;  4C5E A;  4ATO A;  1OX8 A;  1PCX A;  3LX7 A;  1B07 A;  2LJ0 A;  2LT4 A;  2LCL A;  2FZK B;  4M78 A;  1IRE B;  3SWN A;  1FMW A;  4X9D A;  1VQO T;  1Y71 A;  4A4K A;  4DBQ A;  1QCO A;  3VV0 A;  4E6R A;  2HSP A;  3JV3 A;  3V7R A;  1M5Q 1;  3I55 Q;  2HQX A;  2KQW A;  3EHQ A;  5FU6 B;  3MKD A;  2FRW A;  1UJ0 A;  3QYH B;  3OYI A;  3QBY A;  1I07 A;  4M75 B;  2YRC A;  2NUP B;  3ULR B;  2DKG A;  4BDY A;  1C1A A;  4BUG A;  1UB4 A;  4JS5 A;  1I5L A;  5IH2 A;  1NYG A;  1J3T A;  2DYB A;  5GAN d;  2R5A A;  2XD0 A;  1M3B A;  2EQU A;  1C0M A;  1SRM A;  3A98 A;  2J6K A;  3ME9 A;  3NTH A;  4OMF B;  3VRY A;  2RI3 A;  2GNC A;  1I4K 1;  4IUR A;  1AWW A;  1X69 A;  4N4G A;  1TH7 A;  4O5V A;  3AT1 B;  4M75 G;  3H8Z A;  3PNW C;  2RI5 A;  1Y7X A;  1CSK A;  3HFO A;  2OX7 A;  1G83 A;  4FSS A;  1K4U S;  2QG9 B;  4OB3 B;  3M0U A;  2YRV A;  2CP2 A;  3CCR Q;  2GQI A;  3ZL7 C;  4J9E A;  5KYU A;  3PFS A;  3CQT A;  1TS9 A;  2EGE A;  2PTK A;  5KYY A;  2HZY A;  2DK3 A;  2YSQ A;  2K7A A;  1K9A A;  1LVK A;  1LNX A;  2RF0 A;  3EFO B;  1XNI A;  5AYF A;  4M7D B;  3CC2 Q;  4BE1 A;  4Y28 E;  1UFF A;  1JB0 E;  2FPF A;  3JCM f;  5LJ3 g;  1Q7Y U;  3JCM V;  4LN2 A;  2IPO B;  4PJJ A;  2A3L A;  4RG8 A;  1PD0 A;  3GOX A;  1ZSZ A;  1WYX A;  3D7S B;  3G1J A;  5FRM A;  2E5K A;  1WHJ A;  1D0Y A;  3J80 E;  2AZV A;  3MJX A;  2DXU A;  3FJ5 A;  2L3Q A;  3PVL A;  4QQ6 A;  2EGC A;  4XTZ A;  3RBB B;  3JCM X;  4M77 E;  4M7D G;  5CQX A;  3FEO A;  1VQ4 T;  4DOW A;  4C8Q B;  5CIU A;  1YCS B;  1PSF A;  4J83 A;  4RG2 A;  4CC2 A;  5C0M A;  3OW2 P;  4LDV A;  4VUB A;  3FJP A;  1VQK A;  2DA9 A;  4C92 F;  2DXC A;  3FDR A;  4J7F A;  2KYB A;  2VXF A;  5AT1 B;  4QVC A;  5LJ5 g;  2CT4 A;  5I22 A;  2KI7 A;  1Z9Z A;  2LMJ A;  4C8Q G;  3FB9 A;  1VQ6 A;  2Z0W A;  2LDM A;  3WXM B;  2WSC E;  5FW9 A;  5FU6 C;  1VYU A;  4IUP A;  3CCE A;  4DBH A;  3CD6 T;  2LX9 A;  3CXC S;  4M75 C;  1W2B S;  1GBQ A;  5A0L A;  3X26 B;  3RIR A;  3CC2 T;  3QPH A;  1JBM A;  2DL4 A;  2ROT A;  3UT1 A;  4F7U A;  3NFC A;  4M7A F;  1M1G A;  1VYT A;  2HEQ A;  4KBM B;  4E7J A;  3I56 A;  1LCK A;  4QVD A;  1Q86 U;  1MMN A;  1TTH B;  1YHQ A;  1ABQ A;  3CPW S;  2KSS A;  2LP5 A;  2DL3 A;  1KG1 A;  1AZG B;  1VQP T;  1OI1 A;  1NPR A;  4XTX A;  1WI7 A;  1JQQ A;  1NLP C;  1NEB A;  2PZ1 A;  3QWY A;  3OSV A;  5DY9 A;  2ZPF B;  3RKY A;  2QEX Q;  3L2R A;  2XMF A;  2YLB A;  4PJO F;  3MCA B;  2KRN A;  2CS7 A;  3HHT B;  2CZ0 B;  3ZFJ A;  2RO0 A;  2COY A;  1EX4 A;  2W0Z A;  3JCM W;  4E2F B;  9ATC B;  3RDV A;  1A0N B;  1YJW T;  5GAM e;  1WJS A;  3PIO A;  4M7D C;  4NL3 A;  2MMP A;  5FLX E;  3CCJ Q;  1R8O B;  1M1K C;  5HK0 A;  1JXO A;  2DEQ A;  1O9S A;  2L8D A;  2LRQ A;  1MMD A;  1WXT A;  1HK9 A;  1M8V A;  3FLG A;  2DRM A;  2E12 A;  4ESR A;  5I11 A;  1VQ8 Q;  1GCP A;  1X2Q A;  3TRE A;  3UF4 A;  3QWX X;  1TUC A;  3GNG A;  3CBP A;  3NTK A;  3FC3 A;  5GAN 4;  3CCM Q;  2XDD A;  1HXD A;  2BIV A;  5GAM h;  2MK5 A;  4C8Q C;  1WDX A;  2LCC A;  1D0X A;  1IGU A;  4XAX B;  2DL7 A;  3OYD A;  3EGU A;  1BU1 A;  3CCL A;  3EGX A;  5GAN f;  5C6S A;  3BFM A;  4RTZ A;  2AHJ B;  2NUT B;  2HQH A;  2HDA A;  4RTY A;  1HYO A;  4HKE A;  4L6V 5;  2DZ9 A;  2LZ6 B;  2FRY A;  1K0S A;  1NG2 A;  1YP5 A;  2RB6 A;  1WX6 A;  4RTX A;  2FZC B;  5GAM j;  2K3X A;  3VS2 A;  2QQB A;  3VS7 A;  2DEU A;  1KHI A;  3OSS C;  3C94 A;  5J26 A;  3CCU T;  1G3T A;  2EYW A;  3RMS A;  3VUB A;  1RLQ C;  2M16 A;  2RJF A;  1N6A A;  2HCK A;  3S6W A;  2JS2 A;  2E4H A;  4BDZ A;  1WA7 A;  2PU9 B;  3DLM A;  3DKM A;  4PLI A;  2RI2 A;  1K8A U;  2ECZ A;  3L2W A;  3JCM J;  1I1J A;  1M30 A;  4M78 B;  4UC4 A;  3SWN B;  4C92 E;  1ZQ1 A;  3CCM T;  5GJW B;  1UGS B;  3UA7 A;  2XK0 A;  1M27 C;  4AFU C;  2WAC A;  3V7C A;  5HKC A;  2HBP A;  2NLU A;  3H6Z A;  3A8L B;  3HP9 A;  1VQ5 Q;  3J81 E;  2K4Y A;  3OW2 S;  1VQN Q;  5GMK l;  2DM1 A;  1SPK A;  2EJ9 A;  2DBM A;  4HT9 A;  3M5A A;  4M78 G;  5DLQ E;  3RNJ A;  1YFN A;  3PVQ A;  1K9M U;  1ARK A;  5GAO p;  2ED1 A;  2KMT A;  3CC4 A;  3QO3 A;  1TXQ A;  4L59 A;  5FWB A;  3ZEH A;  1QKX A;  2FO0 A;  2HMA A;  4F17 A;  5ECA A;  4F16 A;  5KE2 A;  1YWP A;  3VUZ A;  2G3R A;  1IZ6 A;  3FRN A;  2JJ9 A;  2K2V A;  4EIK A;  5DLO A;  2E6Z A;  4Z89 A;  1YI2 Q;  1PSE A;  2O4X A;  1YCY A;  4OGE A;  1K76 A;  1VIE A;  1T3L A;  1G8X A;  5KYU B;  3URG A;  1OX9 A;  5KYY B;  2V1R A;  4DQ2 A;  1ZHI A;  1Q7Y R;  1AVZ C;  1XOV A;  4AMC A;  2A36 A;  1NE8 A;  5LJ3 f;  1IB8 A;  4FYX B;  3SDZ A;  2FYK A;  2LNV A;  2HAX A;  4J9G A;  1X2K A;  4XQ3 A;  2L0A A;  2DTI A;  1AWO A;  1KHC A;  3CPF A;  4DEX A;  1ZSZ B;  1VQL A;  5CCA A;  3G4S Q;  2OTL A;  4LDW A;  1VQ5 T;  1VQN T;  3INZ A;  1X43 A;  2JTM A;  4XK8 E;  2DYI A;  2CT3 A;  2KRS A;  1VQ7 A;  3N5B B;  1Y96 A;  4ZN3 A;  4IIO A;  2D6F A;  2YLC A;  3OYJ A;  1JRI A;  2KAF A;  4LUD A;  4PK4 A;  2D9T A;  4FW1 A;  2Y90 A;  2AKK A;  1U5S A;  1GCQ A;  2RQR A;  3REA B;  5LJ5 f;  2DLP A;  2EW3 A;  3L2Z A;  3PIP A;  4M7D F;  3G71 Q;  1UGV A;  3GF5 A;  3CCQ Q;  3MEW A;  4M7A D;  4NOY A;  1SEM A;  2K79 A;  2KRO A;  4M78 C;  4Z02 A;  2GCX A;  3SWN C;  1VQM T;  4FU6 A;  2J6F A;  1C6V X;  4N0A C;  3BDL A;  1JU5 C;  3UPU A;  2XU8 A;  1IXD A;  2VGN A;  2CSQ A;  4JJB A;  1Q86 R;  1FWZ A;  2WSE E;  1GL5 A;  3EGD A;  3CC7 Q;  5DM7 R;  1X75 C;  4PJO D;  4F7U B;  4BD3 A;  1AT1 B;  3G4S T;  5FU7 B;  5LL6 S;  2QQA A;  1M9S A;  2MWP A;  4ZGJ B;  2RHU A;  2E5Q A;  4J9C A;  3HRS A;  4B6M A;  5GAN g;  2HKQ B;  2D8H A;  1B34 A;  1TU0 B;  2GTO A;  2BZY A;  1BCO A;  3HRT A;  3EG3 A;  1N8R U;  2RH2 A;  4ORZ A;  1QCN A;  1WIE A;  5D6X A;  4F7U G;  4LD9 K;  4O6J A;  4OML A;  3M4Y A;  2P0P A;  4FSX A;  1KSW A;  2VWF A;  1N9R A;  2LQN A;  1BBZ A;  3OYC A;  3P8D A;  1VQ9 Q;  2IG0 A;  2HL5 C;  1OPL A;  4BI3 A;  1QWE A;  4JRQ A;  1BI1 A;  2PNI A;  2GQV A;  3QZ9 B;  2ED0 A;  2O88 A;  1M3C A;  1YBY A;  2QAZ A;  2FHD A;  1N9S A;  2L3P A;  1QW1 A;  2J7I A;  1BIA A;  3CMA T;  3OS2 A;  1U3O A;  3LH5 A;  1ZSZ C;  3PMT A;  1W6X A;  3A8H B;  1WHH A;  3QDR B;  3V8K A;  2LJ1 A;  1ACM B;  1NBE B;  1NEG A;  1YIJ A;  1BB9 A;  1JJ2 S;  2I2L A;  1TUG B;  1M1K R;  2A0F B;  2RHY A;  2DMO A;  4E7L A;  1OU8 A;  4R55 A;  3E1S A;  1NPP A;  2M02 A;  2D0Q B;  2FG0 A;  3C0C A;  1VQ4 A;  2ZPE B;  4PFP A;  3I5R A;  4N4H A;  3CME Q;  4M75 E;  2QQR A;  3TQ7 P;  3OYH A;  2CP6 A;  4FL6 A;  3NPF A;  3EG9 B;  3NHN A;  2JZ2 A;  3OYE A;  1YIT T;  5GAN 3;  3A8G B;  2CH4 W;  2O31 A;  4A4F A;  2RHZ A;  2RNA A;  1ZLM A;  1D0Z A;  2D8J A;  2VKN A;  5IT9 E;  1RUW A;  1VQ9 T;  1Q7Y C;  2VV5 A;  4J7I A;  5GMK i;  2ZPG B;  3JB9 I;  2KEA A;  4JLI A;  2KBT A;  4M7A A;  3M0S A;  5CQY A;  1RAB B;  3OMC A;  4QT7 A;  3CD6 A;  1YWO A;  1N5Z A;  4JRI A;  1K8A R;  2X4W A;  1JJ2 A;  1RAE B;  1S72 A;  4FW2 A;  5KH6 A;  3CC2 A;  1AD5 A;  4GLM A;  2X35 A;  3JB9 F;  2CRE A;  5FU7 C;  4XTV A;  1SG5 A;  4PFO A;  4EMG A;  1KQS P;  4GBQ A;  3RUX A;  1VIF A;  2E3I A;  4M7D E;  3I55 T;  1VQP A;  4JZ4 A;  4PJO A;  2PQW A;  3QUI A;  2O9S A;  1K9M R;  4K11 A;  3CME T;  2YDL A;  1ZBX A;  4BY6 B;  5LJ3 j;  3OYA A;  2EBP A;  2DXB A;  2ROL A;  2EQI A;  2JMC A;  2VAS A;  4FYW B;  3NMZ C;  4L5G A;  3V8J A;  2BZ8 A;  3DB3 A;  3HKS A;  4LNP A;  2CUD A;  4C8Q E;  1FYN A;  3L2U A;  4AFZ C;  1F1B B;  4ANJ A;  1M90 U;  1YJW A;  1JEG A;  2NYS A;  4IUV A;  2JNG A;  4M78 F;  4BI8 B;  3I9Q A;  4HXJ A;  1BI2 A;  1NM7 A;  1Q86 C;  2DRK A;  2DIL A;  4HT8 A;  3HPW A;  4OMN A;  2JTF A;  1UHF A;  5GJV B;  3CCR T;  3EH2 A;  2O4X B;  2K3Y A;  2KXC A;  4OGC A;  2M9U A;  3CCS Q;  2RQU A;  4RTU A;  1X6B A;  2O01 E;  1UG1 A;  3LWH A;  2BZX A;  4MML A;  3QJ6 A;  5LJ5 j;  4E7H A;  4ZTJ A;  2MF2 A;  3SEM A;  3JCM c;  4IKF A;  3L2V A;  3OS1 A;  4MZT A;  5J39 A;  1QVG P;  1UE9 A;  1G2B A;  2EQK A;  1VQK Q;  2CZ7 B;  1QCF A;  3KFV A;  5GAO n;  3CCV A;  1SRL A;  4E7S A;  2VYT A;  2R5M A;  4C0D B;  4Y91 A;  1VQ6 Q;  3R6O A;  2F5T X;  2RQW A;  3OS0 A;  4M7D D;  2QK0 A;  1TSF A;  1QQJ A;  3GP8 A;  4AG1 C;  4XU0 A;  2JVV A;  3QHS A;  3CCE Q;  2P4R A;  3JB9 J;  2MI6 A;  1X6O A;  5GAN 8;  1Y96 B;  4HCZ A;  3RR6 A;  3C4S A;  3MEA A;  2YT6 A;  3QYG B;  3MET A;  4D8D A;  1EFN A;  2HSE B;  3G6E Q;  1KQ1 A;  4M77 D;  1BK2 A;  3CCU A;  2BTT A;  3M0R A;  3M0Q A;  3I56 Q;  2W10 A;  2ZPI B;  1YHQ Q;  1M2V A;  2DL5 A;  1KQ2 A;  1V29 B;  2DX1 A;  2RK1 A;  3CXC A;  1W2B A;  4II1 A;  4QKU A;  2E6N A;  2QGF B;  1MMG A;  3OB9 A;  3CCS T;  3DLL A;  1UTI A;  3OYG A;  2CYZ B;  2VC8 A;  3EHR A;  1RI9 A;  4CRI A;  3HRU A;  1RAC B;  3CCM A;  4HA8 A;  4V2S A;  1WGS A;  1VQK T;  5IAY A;  2ESW A;  3CPW A;  2EJF A;  1MND A;  2QDY B;  4BY6 C;  4EMK A;  2YUN A;  5GAO l;  3EGD B;  3O5Z A;  2GBQ A;  1SSH A;  2BUD A;  1HD3 A;  2V1Q A;  2DBK A;  4GY5 A;  1PG5 B;  2MIO A;  1RAD B;  2JM9 A;  2CP0 A;  1BI0 A;  3LH0 A;  1Q95 G;  1PKS A;  1B34 B;  2CUB A;  1PD1 A;  2QI2 A;  2V8J A;  4R0K A;  2NUZ A;  2ZPH B;  3G6E T;  2F1L A;  3JCM e;  2QEX T;  2R57 A;  4A53 A;  3PGG A;  1K8A C;  1OQK A;  4PJM A;  1MNE A;  1IHW A;  2YWW A;  2AK5 A;  3E19 A;  2QQS A;  1T0H A;  2JN0 A;  4KGZ B;  3LLR A;  1ZA1 B;  2CZ1 B;  2RK2 A;  2LJ3 A;  5GAM g;  3CCL Q;  1I81 A;  1WHG A;  1YJN Q;  4XTU A;  3CCJ T;  3SFM A;  2E70 A;  1SSF A;  1OOT A;  1CKB A;  1H92 A;  1P92 A;  4XTW A;  5KCO A;  3SD4 A;  3M57 A;  3JCM h;  4DEY A;  4C0D C;  1K9M C;  1VQ8 T;  2V26 A;  2EJG A;  4XU1 A;  1UHC A;  3LGF A;  1FX7 A;  3UA6 A;  1G3Y A;  5D7U A;  1VQ5 A;  5KYW A;  1VQN A;  1T3S A;  1ZBJ A;  1ZSG A;  4M78 E;  2QA4 Q;  3EG0 A;  1X01 A;  4B9X A;  3MEV A;  1H3Z A;  2P84 A;  2K5F A;  2OJ2 A;  3JRZ A;  4AFS C;  2RN8 A;  1KC8 U;  2A37 A;  1BYM A;  4QQD A;  1PC0 A;  2C0O A;  2EPD A;  4KGV B;  1E6H A;  2QQ9 A;  3VKI A;  4OMM A;  4BE2 A;  1KD1 U;  2CDT A;  3M55 A;  4TVR A;  2C0I A;  1RAF B;  3JB9 D;  1X6G A;  4A4G A;  2H3E B;  4M77 A;  4BB7 A;  2QTV A;  1KJW A;  2VB6 A;  4BAC A;  4JJD A;  2DZC A;  1NYF A;  1K0X A;  2OTJ A;  3VRZ A;  2XID A;  4MZM A;  4MMK A;  1M8M A;  1VQM A;  1QVG S;  3NTI A;  4JUV A;  2EYQ A;  4OVA A;  1YJN T;  2K3B A;  4AT1 B;  2P0Q A;  5GAO m;  5GAM d;  4RKU E;  2DFU A;  1WLP B;  4X34 A;  5IN1 A;  2CKK A;  2DPP B;  4KGX B;  4M7A B;  5CKB A;  1YN8 A;  5A0G A;  2XI9 A;  4M75 F;  4J6W A;  3H0H A;  1Q82 U;  3CC4 Q;  2X4J A;  4CI0 C;  4PJN A;  1U1T A;  1BCM A;  4KRT A;  1VYV A;  5GAN 2;  2JMA A;  1WHM A;  2COZ A;  3OW2 A;  5KE3 A;  1ZUK A;  3L2Q A;  2JT4 A;  1OEB A;  3G4S A;  1EZZ B;  2OI3 A;  1NJI U;  2K57 A;  2X9H A;  2QA4 T;  2DJZ A;  2E64 A;  5L23 A;  2A08 A;  4YTL A;  2JS0 A;  2R58 A;  3BW1 A;  3I35 A;  2RQT A;  4C92 D;  2B86 A;  1SKU B;  4E7Z A;  5IHK A;  3QG1 A;  4PJO B;  8AT1 B;  4ELZ C;  4HCC A;  4M78 D;  5KCH A;  3M0P A;  1ABO A;  5J3B A;  5CKD A;  3PT9 A;  2LC4 A;  1IHV A;  2QAS A;  1UEC A;  3KBG A;  6AT1 B;  1M90 R;  4XTY A;  3V7S A;  3JCM d;  4IIM A;  4KH0 B;  5I2M A;  4PJO G;  2MAM A;  1I5O B;  1B3Q A;  1QP2 A;  1R77 A;  3OQ5 A;  1VQL Q;  2DET A;  8ATC B;  2E10 A;  2CP5 A;  2EAY A;  2DD4 A;  1YI2 T;  3TCJ A;  3VS6 A;  3CMA A;  1D09 B;  3MP8 A;  4A4E A;  5A2Q E;  1Q81 U;  1VQ7 Q;  1G3S A;  1OZ2 A;  2K6D A;  1U06 A;  2YXY A;  3ZBD A;  3BY7 A;  1CKA A;  2ABL A;  5IXB A;  2HQE A;  1OU9 A;  1JXM A;  3VS0 A;  1VQO A;  1MHN A;  1VOM A;  1QP3 A;  4P5N A;  2XDB A;  1B7T A;  4QQG A;  1TUD A;  4OF1 A;  2ZZD A;  2CH4 A;  1SF9 A;  4WCI A;  4JRK A;  1PM3 A;  4C8Q F;  2MYS A;  2QGG A;  1ZA2 B;  2RHX A;  3P8B B;  2CGH A;  2SRC A;  4E47 A;  4JZ3 A;  2EYZ A;  5M9O A;  3H0F A;  2E41 A;  3RES A;  2L2P A;  4F7U E;  5GMK j;  1D3B A;  2JTE A;  4FT2 A;  1YIT A;  5KYN A;  2K5L A;  3MP1 A;  1UEB A;  2DTH A;  2L5Q A;  4OB0 B;  4HVU A;  4EPC A;  2EWN A;  1YJ9 Q;  3A8O B;  1VQ9 A;  2DF6 A;  2COW A;  5FWC A;  4NL2 A;  2EKH A;  3VYG A;  4EMH A;  3QKJ A;  3VS1 A;  2LT1 A;  5GAN j;  2KK4 A;  1U1S A;  5CKE A;  4F04 B;  1VQL T;  1QMC A;  1G5V A;  3MPU B;  5I2S A;  1QVP A;  2LQ8 A;  3G71 T;  1BI3 A;  4J9F A;  3OY9 A;  1M2V B;  2M1H A;  3JSC A;  3CCQ T;  5A0D A;  2JOY A;  4MDX A;  4M4Z A;  3HL8 A;  3QSU A;  1WPY A;  2DTO A;  4KUL A;  2HD0 A;  4X9C A;  3G7Z A;  1IO6 A;  3GBQ A;  3E9G A;  1QVF P;  1OUL A;  1K73 U;  3E9F A;  1QWF A;  2KT8 A;  2DER A;  2FVU A;  4PJO C;  2DE0 X;  4J6X A;  1TOV A;  3I55 A;  2VUB A;  4OMO A;  1W4S A;  2LVM A;  1M4Z A;  3CC7 T;  3O8V A;  3RER A;  1PNJ A;  4EMK B;  3H41 A;  2RM4 A;  4C5I A;  1W70 A;  2PVO B;  4KUD K;  2F2W A;  2RJD A;  1YNZ A;  2RJC A;  4PLL A;  4C92 A;  1NZ9 A;  2YUO A;  2A28 A;  4RTW A;  3EGX B;  4IUQ A;  2KE9 A;  1SHG A;  2HBW A;  4N0A A;  1GBR A;  1MMA A;  2LTO A;  2X4Y A;  3EH1 A;  1I0C A;  1LJO A;  5LJ3 e;  1YJ9 T;  2DXT A;  3M54 A;  4OB2 B;  4F14 A;  1NLO C;  2CP3 A;  3L1A A;  1WQ7 A;  2AZS A;  1YIJ Q;  1UDL A;  4FM4 B;  4JRP A;  1RAG B;  4DBF A;  2FB7 A;  2EQJ A;  2K9G A;  2PUK B;  5GAM f;  3CCR A;  1MV0 B;  1PRL C;  3FIF A;  1VQ4 Q;  2KNB B;  3OA6 A;  5EG2 A;  4OB1 B;  3HFN A;  1D1B A;  3QDF A;  1TG0 A;  5LJ3 h;  2A7Y A;  2YHT A;  2J6O A;  1RAH B;  2BE9 B;  4ZN1 A;  2J05 A;  3WVD B;  3KUF A;  4HCB A;  2F2X A;  3JCM b;  5LJ5 e;  3KXT A;  4HVW A;  5HCK A;  1Y07 A;  3CEY A;  1VA7 A;  2E1H A;  3LYI A;  1KC8 R;  2K2M A;  1M90 C;  5KYW B;  3TSW A;  1Y57 A;  2KDS A;  3X25 B;  2M0Y A;  4LDU A;  4JLG A;  4AFQ C;  3ASK A;  1IGQ A;  2MOX A;  5GAN 6;  1MV3 A;  4PNO A;  3CD6 Q;  3OYL A;  2HL3 A;  4E7I A;  1S72 Q;  1KD1 R;  4B9W A;  1QLY A;  1KIK A;  3VYH B;  5LJ5 h;  4ZNX A;  1AEY A;  4M75 D;  1I8F A;  1V76 A;  2KY9 A;  2K5I A;  1YIJ T;  1Z9Q A;  3M4G A;  1RAA B;  1WHK A;  4J9B A;  1XJW B;  1FMV A;  3LW5 E;  4M77 B;  4WTO B;  4LXC A;  2X4X A;  3JB9 H;  1VQP Q;  4J8O A;  3JCM Q;  3A5Z B;  3CCS A;  3OYB A;  4ZGE B;  5GAN 7;  3S3O A;  1Q82 R;  2M51 A;  4J5Y A;  2DAQ A;  3F70 A;  4FYV B;  2EIF A;  3LWI A;  2EYX A;  3GNF B;  3EG2 A;  5IHN A;  7AT1 B;  2JUF A;  4JDS A;  1SHF A;  2L3S A;  5CVI A;  2PVD B;  3X20 B;  4EMK C;  2XKO C;  4MDW A;  4M77 G;  3DB4 A;  1NJI R;  3AHU A;  2LCS A;  3GIB A;  2LX7 A;  3SHW A;  1YJW Q;  1UGR B;  2H8H A;  3EAE A;  3PE0 A;  5KYX A;  3S3M A;  2JM8 A;  3OMG A;  1ZX6 A;  3TEE A;  3QZ5 B;  3WVE B;  2ATC B;  4ZGD B;  2WSF E;  2ZAE A;  2VXE A;  1S72 T;  5GAO r;  2JW4 A;  3G6E A;  2QEX A;  2EYY A;  3NGP A;  1OZ3 A;  2DIQ A;  4PL6 A;  4PKC C;  2CZ6 B;  5LJ3 d;  2GTJ A;  4JPB W;  1QKW A;  1S1N A;  3OYF A;  2GGR A;  3E2U A;  3CCV Q;  1RL2 A;  1D1C A;  5CO7 A;  2OAU A;  3QXE B;  1QVF S;  2L89 A;  1WQW A;  3CBM A;  4PJL A;  4ZTF A;  2KXD A;  1Q81 R;  4C8Q D;  1UJY A;  5GAO q;  3CCJ A;  2XIC A;  3CBO A;  2DD5 A;  4RMO A;  3Q1J A;  1LPL A;  4C0Z A;  4DOV A;  1R0B G;  4BE0 A;  4FIB A;  3I5S A;  3P8H A;  1WJQ A;  1VQ8 A;  2EGA A;  4FYY B;  3IQL A;  5GAN 5;  1HJD A;  1AZE A;  2C0T A;  3JAM E;  4LUE A;  2L3R A;  3CCU Q;  4QVZ A;  1UUE A;  1Y0M A;  4HVV A;  5LJ5 d;  2QYZ A;  2H3J A;  1RLP C;  1PWT A;  2CP7 A;  2DJQ A;  3M9Q A;  4XU3 A;  4LDX A;  2EFI A;  2LNH B;  4KUI A;  4FCY A;  1VQ6 T;  3PMI A;  2E65 A;  3OBY A;  2ZCF B;  1M1F A;  1N8R R;  1D3B B;  2F69 A;  4M77 C;  2D0N A;  5FRO A;  3UWN A;  1RAI B;  3L42 A;  3CCE T;  1QVF A;  5CKH A;  4LD6 A;  5IHI A;  2YRD A;  3M0T A;  4X1V A;  2GFU A;  2QTX A;  2O2O A;  4M75 A;  2PVG B;  3CCV T;  2BKD N;  2NUP A;  1M1K U;  1GXI E;  2RQV A;  1KFZ A;  1YJN A;  3I56 T;  2B8A A;  3EG9 A;  1YHQ T;  1W1F A;  4Z88 A;  3M56 A;  4JJC A;  3C95 A;  1KQS S;  4BI4 A;  4D6W A;  1K73 R;  1WFW A;  4IUT A;  4F7U F;  1R0C B;  2IIM A;  1WXB A;  1H64 1;  1KC8 C;  1JO8 A;  1AOJ A;  4J9H A;  2MWO A;  2JXB A;  2RD1 A;  4J9I A;  3JB9 G;  4GLK A;  2QA4 A;  2AIR B;  1O75 A;  4C5G A;  5FRN A;  2GF7 A;  1KD1 C;  1TWB A;  2KRM A;  2ZPB B;  2FPE A;  4KH1 B;  1GFD A;  1OV3 A;  5D6W A;  2FL7 A;  3OYY A;  4RCB A;  1LOJ A;  2QXF A;  4ELY C;  3EFR A;  2KVQ G;  2C06 A;  2FZG B;  1ZUY A;  2DO3 A;  3VS3 A;  3TVT A;  2MPX C;  3EFO A;  4ME7 A;  4C92 B;  4M7D A;  1UGQ B;  1IRX A;  2GFA A;  1GCQ C;  2KR3 A;  2DVE A;  2RMO A;  1Q82 C;  4RUG A;  3JCM g;  1XQH A;  1E6G A;  1ZUU A;  4E7K A;  3MP6 A;  1U8R A;  3ER0 A;  2F2V A;  3OS5 A;  1KQS A;  4OMP A;  5HK3 A;  1AWX A;  1H3H A;  5D6Y A;  2F5K A;  1YI2 A;  2EQM A;  3QII A;  2DVJ A;  4LE9 A;  4C92 G;  3GPL A;  1NJI C;  4A4H A;  4MZP A;  2EKO A;  4C8Q A;  4IUU A;  1JJ2 P;  3CCL T;  2I0N A;  4AG2 C;  2RA2 A;  3H9N A;  1FMK A;  3R6N A;  1G3W A; 
#chains in the Genus database with same CATH homology
 1JXO A;  2RPN A;  2J06 A;  4JZ4 A;  2DF6 A;  5FWC A;  2G6F X;  1WXT A;  2EKH A;  2O9S A;  2DRM A;  3VS1 A;  2KT1 A;  4K11 A;  4ESR A;  5I11 A;  1GCP A;  2YDL A;  1PHT A;  2O9V A;  1X2Q A;  3UF4 A;  3QWX X;  2EBP A;  1TUC A;  4J9F A;  1HSQ A;  2ROL A;  1X27 A;  2EQI A;  2JMC A;  3NMZ C;  2BZ8 A;  4M4Z A;  4LNP A;  2CUD A;  1WDX A;  1FYN A;  4AFZ C;  2X3W D;  2DL7 A;  1IO6 A;  3GBQ A;  3EGU A;  1BU1 A;  1JEG A;  1QWF A;  2KT8 A;  4CC3 A;  2DE0 X;  4RTZ A;  2OAW A;  3I9Q A;  4HXJ A;  2MCN A;  2VVK A;  2DNU A;  4OMO A;  2HDA A;  1NM7 A;  2NWM A;  2DRK A;  2DIL A;  4OMN A;  1UHF A;  1PKT A;  4RTY A;  5GJV B;  3VS5 A;  2LZ6 B;  2FRY A;  2KXC A;  4RTV A;  1K0S A;  1NG2 A;  1PNJ A;  1YP5 A;  2RQU A;  3H41 A;  4RTU A;  2ENM A;  1X6B A;  1W70 A;  2SEM A;  2D1X A;  1UG1 A;  3REB B;  1WX6 A;  2BZX A;  2F2W A;  2EVR A;  4RTX A;  3SEM A;  1YNZ A;  3H0I A;  2YUO A;  2A28 A;  4RTW A;  4D8K A;  2KE9 A;  1UE9 A;  3EG1 A;  1G2B A;  3VS2 A;  3VS7 A;  1MUZ A;  1SHG A;  2HBW A;  2EYW A;  1GBR A;  1RLQ C;  1QCF A;  1K1Z A;  3KFV A;  4RTT A;  1I0C A;  1SRL A;  1H8K A;  4F14 A;  2HCK A;  1NLO C;  2AZS A;  2JS2 A;  1UDL A;  2AKL A;  2YUQ A;  2RQW A;  1WA7 A;  2K9G A;  4AG1 C;  2ECZ A;  2QDL A;  1WXU A;  1MV0 B;  1E7O A;  1I1J A;  1M30 A;  1PRL C;  4HCK A;  2P4R A;  2KNB B;  1T0J A;  2YT6 A;  5GJW B;  4CC4 B;  3UA7 A;  1EFN A;  4D8D A;  1M27 C;  4AFU C;  1TG0 A;  3U23 A;  1BK2 A;  2J6O A;  3TSZ A;  2BTT A;  3M0R A;  3M0Q A;  2DM1 A;  1SPK A;  2J05 A;  2DBM A;  2W10 A;  2F2X A;  4A63 B;  4Z8A A;  1V1C A;  2DL5 A;  4HVW A;  3RNJ A;  5HCK A;  2DX1 A;  3PVQ A;  1M3A A;  1ARK A;  2ED1 A;  1VA7 A;  2K2M A;  5FWB A;  1PRM C;  2DL8 A;  1Y57 A;  1QKX A;  3TSW A;  3VS4 A;  2YUP A;  4OMQ A;  2M0Y A;  1UTI A;  3EHR A;  2FO0 A;  4CC7 A;  4AFQ C;  1RI9 A;  2CSI A;  2FPD A;  2LQW A;  2MOX A;  1MV3 A;  4F17 A;  5ECA A;  4F16 A;  2KYM A;  1YWP A;  3UAT A;  1GFC A;  4EIK A;  4J9D A;  1QLY A;  2ESW A;  1KIK A;  4Z89 A;  4ZNX A;  2KGT A;  1AEY A;  1K76 A;  3THK A;  1T3L A;  2YUN A;  3O5Z A;  2GBQ A;  1SSH A;  1HD3 A;  2V1Q A;  5IXF A;  1AWJ A;  2DBK A;  2X3X D;  1Z9Q A;  2V1R A;  4J9B A;  4Y92 A;  2MIO A;  1AVZ C;  1XOV A;  2JM9 A;  2FEI A;  2A36 A;  1PKS A;  4J9G A;  2CUB A;  2M51 A;  1X2K A;  4R0K A;  2NUZ A;  2L0A A;  5EC7 A;  2EYX A;  1OPK A;  3EG2 A;  5IHN A;  1AWO A;  1GRI A;  4DEX A;  1SHF A;  2L3S A;  2AK5 A;  1B07 A;  2LJ0 A;  1T0H A;  1X43 A;  2CT3 A;  2KRS A;  2LCS A;  2LX7 A;  3SHW A;  2LJ3 A;  4IIO A;  4E6R A;  2H8H A;  2HSP A;  3JV3 A;  3PE0 A;  4LUD A;  3EHQ A;  2JM8 A;  1OOT A;  1CKB A;  1ZX6 A;  1UJ0 A;  2FRW A;  1H92 A;  2AKK A;  1I07 A;  1U5S A;  1GCQ A;  2RQR A;  3REA B;  4DEY A;  2DLP A;  3ULR B;  2EW3 A;  1UGV A;  1UHC A;  2JW4 A;  3UA6 A;  5IH2 A;  2EYY A;  1NYG A;  1J3T A;  2DYB A;  3NGP A;  1M3B A;  1SEM A;  1T3S A;  1ZBJ A;  1SRM A;  1ZSG A;  2K79 A;  2J6K A;  2KRO A;  3A98 A;  3EG0 A;  3VRY A;  2GNC A;  2J6F A;  2GTJ A;  4JPB W;  1QKW A;  1S1N A;  1AWW A;  1X69 A;  2OJ2 A;  2GGR A;  1JU5 C;  4AFS C;  2RN8 A;  2A37 A;  2KXD A;  2CSQ A;  1CSK A;  1G83 A;  1UJY A;  4JJB A;  2C0O A;  4FSS A;  2EPD A;  1K4U S;  1E6H A;  1GL5 A;  3M0U A;  4OMM A;  2GQI A;  3ZL7 C;  4J9E A;  3CQT A;  3I5S A;  2EGE A;  2CDT A;  2PTK A;  2EGA A;  2C0I A;  1X6G A;  3IQL A;  1KJW A;  1HJD A;  2YSQ A;  1AZE A;  2C0T A;  2K7A A;  1K9A A;  4JJD A;  1NYF A;  4J9C A;  1K0X A;  3VRZ A;  4LUE A;  2RF0 A;  1M8M A;  2D8H A;  1UFF A;  1UUE A;  2GTO A;  1Y0M A;  2BZY A;  4HVV A;  2FPF A;  2K3B A;  3EG3 A;  1RLP C;  4LN2 A;  1PWT A;  2DJQ A;  4ORZ A;  1WIE A;  1WLP B;  1WYX A;  1YN8 A;  2E5K A;  4OML A;  2AZV A;  2LNH B;  3H0H A;  3FJ5 A;  2L3Q A;  1KSW A;  2VWF A;  4KRT A;  1VYV A;  2LQN A;  3PVL A;  1BBZ A;  2EGC A;  2JMA A;  3RBB B;  2D0N A;  1OPL A;  1ZUK A;  1QWE A;  2JT4 A;  2PNI A;  1OEB A;  2ED0 A;  2OI3 A;  2O88 A;  1M3C A;  1YCS B;  5IHI A;  5L23 A;  2A08 A;  3M0T A;  4CC2 A;  2JS0 A;  2L3P A;  4X1V A;  2O2O A;  2J7I A;  3I35 A;  2RQT A;  5IHK A;  2B86 A;  1U3O A;  2DA9 A;  1KFZ A;  2RQV A;  3LH5 A;  2KYB A;  3M0P A;  1ABO A;  1W6X A;  2LJ1 A;  1W1F A;  2CT4 A;  4Z88 A;  5I22 A;  1Z9Z A;  2LMJ A;  4JJC A;  1NEG A;  1BB9 A;  1UEC A;  1WFW A;  2IIM A;  1WXB A;  1JO8 A;  2DMO A;  1AOJ A;  4IIM A;  5FW9 A;  4J9H A;  1VYU A;  2FG0 A;  2JXB A;  3C0C A;  3I5R A;  4J9I A;  1B3Q A;  1GBQ A;  2KRM A;  3NPF A;  2FPE A;  3NHN A;  1GFD A;  1OV3 A;  3VS6 A;  2DL4 A;  2ROT A;  1VYT A;  2K6D A;  1U06 A;  2HEQ A;  1LCK A;  2CH4 W;  2O31 A;  1CKA A;  2ABL A;  2RNA A;  1ZLM A;  1ZUY A;  5IXB A;  1ABQ A;  3VS3 A;  1JXM A;  3TVT A;  3VS0 A;  2D8J A;  2VKN A;  1RUW A;  2LP5 A;  2DL3 A;  1AZG B;  1TUD A;  2CH4 A;  4WCI A;  1WI7 A;  2KEA A;  1GCQ C;  1JQQ A;  1NLP C;  1NEB A;  2PZ1 A;  3QWY A;  2KBT A;  2KR3 A;  2RMO A;  4RUG A;  3M0S A;  1E6G A;  1ZUU A;  4QT7 A;  1YWO A;  2SRC A;  1N5Z A;  2XMF A;  2F2V A;  4JZ3 A;  2EYZ A;  3H0F A;  4OMP A;  2L2P A;  2KRN A;  1AD5 A;  4GLM A;  1AWX A;  1H3H A;  2CRE A;  2JTE A;  2DVJ A;  4LE9 A;  2W0Z A;  4HVU A;  1A0N B;  2I0N A;  4GBQ A;  4AG2 C;  1FMK A;  3R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...