4J9FA

Crystal structure of the abl-sh3 domain complexed with the high affinity peptide p0
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
molecule tags Transferase/unknown function
source organism Homo sapiens
publication title Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
rcsb
total genus 11
structure length 62
sequence length 62
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9fA00
3NHNA 1AEYA 3PVLA 2DL4A 1WI7A 2L0AA 1I0CA 4LUDA 3H0FA 1M30A 1FYNA 3EG3A 1AZEA 2K79A 3NPFA 1PKTA 1M3BA 2FG0A 3TSWA 4DEYA 1T3SA 1WLPB 1WIEA 2J05A 1OPKA 5I22A 2KGTA 4OMNA 2X3XD 1AOJA 2KT8A 1NEBA 4M4ZA 2ESWA 2RF0A 4LE9A 1PRMC 4LUEA 2MCNA 3I35A 2DM1A 1RLPC 2KRNA 4X1VA 3UA7A 1WA7A 2LZ6B 1FMKA 3CQTA 2DL8A 2CH4A 5IXFA 4J9IA 1X43A 1HJDA 2LCSA 2AZVA 2OJ2A 2H8HA 1NEGA 2KBTA 1U3OA 2NUZA 3EG0A 2HEQA 2EW3A 2C0IA 2EPDA 1GFDA 1YP5A 4LN2A 4RUGA 1M3CA 4AG1C 1TG0A 2ENMA 1ZUKA 3EHQA 1TUDA 2LX7A 1ZUYA 4RTUA 3THKA 2DRMA 1WDXA 2CSIA 2K2MA 3H0HA 4HXJA 2JT4A 1ZUUA 1ZSGA 1AWXA 1SHGA 2FRWA 1X6BA 2O31A 3U23A 1KFZA 4CC7A 2HCKA 1B07A 2LJ0A 2VVKA 2FPFA 2YUNA 4J9DA 1AWOA 1H92A 2RPNA 1U5SA 1T0HA 2D0NA 3M0UA 3EGUA 4J9GA 2SEMA 5HCKA 3QWXX 1YCSB 2DF6A 3VRYA 3UA6A 2P4RA 2PZ1A 1GCQC 1JU5C 1MUZA 2YUPA 1RI9A 3M0TA 1SPKA 3NGPA 4J9BA 2J6KA 5IHNA 2O9VA 1J3TA 1RUWA 3UATA 4RTVA 5I11A 1UFFA 2J6OA 2J06A 4CC4B 3ULRB 2DMOA 2EYZA 2KYMA 3VS3A 2EKHA 4DEXA 2GTJA 4RTYA 3EG1A 2I0NA 4QT7A 1TUCA 2DBMA 4EIKA 3I5SA 2GTOA 2JM8A 2RQRA 4Z89A 1PKSA 1VYUA 1NYFA 4RTTA 2KXDA 4J9HA 1W70A 2DA9A 1SEMA 1Y0MA 4OMLA 1JXOA 2K7AA 4CC3A 1PWTA 1EFNA 3VRZA 2JMAA 2JMCA 5IHIA 3LH5A 1M3AA 2GBQA 5ECAA 4ESRA 1SSHA 2KYBA 2K6DA 1MV0B 2FRYA 5GJVB 5IH2A 4OMPA 3TSZA 2GQIA 2JS2A 2BZ8A 2LQNA 1E6GA 1WXBA 4K11A 3VS2A 1UTIA 1VA7A 1ZLMA 4F16A 2X3WD 4KRTA 2V1QA 2W10A 2CUBA 2AK5A 2SRCA 2EYYA 5EC7A 2BTTA 2BZXA 1M8MA 3H41A 3SHWA 4OMMA 2KNBB 2F2VA 2CDTA 3ZL7C 1S1NA 1T0JA 1ZBJA 2A37A 3TVTA 1OPLA 2NWMA 4RTXA 1UGVA 2K3BA 1AWWA 1VYVA 1U06A 4WCIA 4Z8AA 3VS7A 3QWYA 1UE9A 1G83A 2HBWA 2ROLA 2DBKA 2O88A 4AFUC 2V1RA 3REBB 2DLPA 2AKKA 2L2PA 2CUDA 2LQWA 3M0SA 4CC2A 2JS0A 2C0OA 2EGAA 1K0SA 1GCQA 2EQIA 2G6FX 2YUQA 4F17A 2F2WA 2YDLA 2RN8A 1N5ZA 2ROTA 3VS0A 2ECZA 2LNHB 1Z9QA 2VKNA 3UF4A 4HVWA 2YT6A 3JV3A 5GJWB 2B86A 3I5RA 1QKXA 1WXTA 1X69A 2A08A 1JEGA 1GRIA 1LCKA 3RBBB 2C0TA 1JXMA 1CKAA 4FSSA 1GFCA 1VYTA 1BU1A 1ARKA 2YSQA 1G2BA 2BZYA 3VS6A 3REAB 2MOXA 1BK2A 1AVZC 3FJ5A 2RQVA 3PE0A 2W0ZA 2ABLA 2L3PA 4AFQC 3EHRA 1QWEA 1QWFA 2JXBA 2OAWA 4GBQA 3VS5A 1X2KA 1NM7A 1OOTA 2RMOA 1HSQA 2GGRA 1AD5A 1CSKA 1I07A 2A28A 1ABOA 1SRMA 1UUEA 1ABQA 1K0XA 2LP5A 1X6GA 2D8HA 1OEBA 2EGCA 4AG2C 1UJ0A 1X27A 1QCFA 2E5KA 2JTEA 1Y57A 4R0KA 2XMFA 1YNZA 3C0CA 2DL5A 4A63B 4F14A 1PNJA 1PHTA 1UG1A 1KSWA 2ED1A 1XOVA 2F2XA 2KE9A 2O9SA 2D8JA 2DL7A 2DRKA 4HVVA 2LMJA 4LNPA 1MV3A 1WYXA 2FPDA 1GBRA 2DE0X 2J7IA 4D8DA 2EYWA 3EG2A 2EBPA 1Z9ZA 2FO0A 3KFVA 3VS1A 1GCPA 1SRLA 3I9QA 4GLMA 4Z88A 2AKLA 1B3QA 2L3QA 4OMQA 4AFZC 1AWJA 1CKBA 1K4US 4D8KA 2EVRA 2KT1A 2DVJA 2YUOA 2CSQA 4IIMA 2RQUA 1YN8A 2K9GA 3R6NA 2LJ1A 1ZX6A 3O5ZA 1GL5A 1K76A 2HDAA 1NG2A 3M0RA 2DYBA 4HCKA 2KXCA 1H8KA 4J9CA 2QDLA 2RNAA 2JW4A 1T3LA 1NLOC 1KIKA 2J6FA 2CT3A 2M0YA 2FEIA 1K1ZA 4JZ3A 1WXUA 1RLQC 2PNIA 3M0QA 1UJYA 3H0IA 2HSPA 1WFWA 1I1JA 3M0PA 4HVUA 1NLPC 2A36A 1W1FA 3VS4A 5FWCA 2LJ3A 5L23A 4ZNXA 2FPEA 2KRSA 2AZSA 1W6XA 2JM9A 1BBZA 1PRLC 1E6HA 2DILA 2PTKA 4JZ4A 2L3SA 1K9AA 1YWPA 1UHCA 2DX1A 4IIOA 2IIMA 1NYGA 1KJWA 2EYXA 2OI3A 4JJCA 4RTZA 1JO8A 1M27C 1GBQA 3IQLA 2KRMA 2CREA 2KEAA 1SHFA 2CH4W 2O2OA 3GBQA 3RNJA 5IXBA 5IHKA 5FWBA 2DNUA 3A98A 4RTWA 4J9EA 2KR3A 1OV3A 1UHFA 1A0NB 5FW9A 1X2QA 4JJBA 1WX6A 4AFSC 1QLYA 1UECA 4OMOA 4JJDA 1H3HA 2MIOA 1JQQA 2CT4A 3PVQA 2M51A 1QKWA 4J9FA 2KROA 3NMZC 1BB9A 3SEMA 2RQTA 1YWOA 1HD3A 1V1CA 1IO6A 4JPBW 2VWFA 2DJQA 2ED0A 2GNCA 1AZGB 1UDLA 1E7OA 2EGEA 4E6RA 2RQWA 2D1XA 2DL3A 4Y92A 4ORZA
chains in the Genus database with same CATH superfamily
3NHNA 3GOXA 4M78G 2DL4A 4E7JA 4JJNK 2HAXA 4LUDA 3H0FA 1PG5B 5KCOA 2K79A 3SD4A 3TCJA 2FG0A 4M7AD 1YJ9A 4DEYA 1N8RU 3SWNB 1KQSS 3M59A 2XIDA 4E2FB 1WLPB 1M2VB 4M7AA 5FU6C 1XJWB 1WIEA 1OU9A 5IAYA 4C92D 1YJ9Q 3CMAA 2X3XD 1MMAA 1NEBA 2VGMA 3NTIA 1PRMC 4LUEA 1RLPC 1M1FA 2LZ6B 1FMKA 3MP8A 3CCQA 1X43A 4XTZA 1HJDA 2O4XA 1MGQA 2AZVA 2OJ2A 1U3OA 2F69A 5D6WA 2NUZA 2HEQA 2EW3A 2C0IA 4OGCA 5CVIA 3P8BB 4C0DC 2E6ZA 4LN2A 1M3CA 2DIQA 4QQDA 1Q7YC 2DRMA 2KK4A 1C1AA 4BE1A 2K2MA 3L2RA 3CPWP 3G6EQ 2F1LA 3GNFB 3E1SA 2JT4A 3JCMf 2LNVA 1ZSGA 1AWXA 5LJ5h 1QVFP 4J8OA 1VQ4Q 1AWOA 2DTIA 1U5SA 2D0NA 4F7UA 1VQ7T 3VUBA 2VYTA 2BKDN 2SEMA 5J3BA 5GAOr 4A4GA 5CR2A 2DF6A 3UA6A 3CC2T 3CXCS 4M75E 1BI1A 3RERA 3M0TA 3CC4A 1AHJB 1JB0E 4XTWA 1J3TA 2H3JA 1LPLA 1O75A 4OGEA 1U8RA 1NPRA 3CCRA 1D1AA 2EYZA 3LGFA 4LDVA 4PJOF 3QPHA 1Y96A 3CBOA 2GTJA 1SF9A 1YJ9T 1DJ7B 2LCCA 2DBMA 4MZMA 4EIKA 3OS2A 1VQKQ 3FEOA 2O01E 2CP6A 4J9HA 4ATOA 2V26A 3M4GA 4C0FA 1Y0MA 5LJ3e 2E41A 3JB9D 1JXOA 2IG0A 2K7AA 4FYWB 3LH5A 4Z02A 1ZA2B 1VQ7Q 2GBQA 1IRXA 4PJOE 4M77D 3J80E 2RHYA 3M58A 3CC2Q 4JUVA 4YTLA 5GJVB 4LDXA 3LH0A 4OMPA 4KH0B 3TSZA 2ZPEB 2GQIA 2JS2A 2BZ8A 3JCMW 4M7AF 1M9SA 2LQNA 2XDBA 2YLBA 1E6GA 4IUUA 1OX8A 1ZA1B 1VA7A 4F16A 2X3WD 3CCEQ 2HKQB 1TTHB 4BE2A 2SRCA 1R0CB 3NTKA 5GAOq 3S3NA 2LQ8A 4M75A 2KNBB 2CDTA 2XKOC 3ZL7C 4A4KA 5GAMe 8AT1B 4FT4A 1OPLA 4L6V5 1Q82U 3PNWC 1QCNA 3VS7A 1N9RA 5J26A 2HBWA 1I5LA 4PLLA 3WVEB 2P0KA 1IGQA 2DLPA 4XTXA 3HSBA 1K73U 3VUZA 3PIPA 4M7DF 2RA2A 1W2BA 3L2UA 1LNXA 3OW2P 1VQPA 1GCQA 2G6FX 2RI3A 1D0YA 2RN8A 2R5MA 2ROTA 3H6ZA 2QI2A 3PGGA 4J6XA 5CCAA 1MMNA 2X4XA 3CCMT 1HXDA 1NBEB 2B86A 4Y28E 3M55A 3RBBB 1G2BA 4ZGJB 3JCMg 2G3RA 2PQWA 2MOXA 2RQVA 4F7UE 1FXXA 1Y7XA 1QWEA 2MAMA 2RJFA 4N0AC 4GBQA 1WNLA 2OAUA 3CCVT 3OB9A 1R0BG 4C8QF 1RADB 3PIOA 2GGRA 1AD5A 1G3SA 5GAN3 1I07A 3OYFA 4Q5WA 3DB4A 4HCZA 2K5LA 1X6GA 1WZOA 1OEBA 3G71Q 1UJ0A 1X27A 2JTEA 1Y57A 2K2VA 2XMFA 1VQLA 2E1HA 1YNZA 3G7ZA 3OYMA 2JOYA 1PNJA 1KSWA 4IURA 1XOVA 2EYQA 1M2OA 4PFZA 2AT1B 2LMJA 3JCMV 1GBRA 3MJXA 3X28B 5CK9A 2QEXQ 3EG2A 2L3RA 2C06A 2FO0A 3I9QA 1X75C 1QMCA 2CYZB 4NL2A 4AFZC 1WHHA 1K8AC 1IREB 1VQ7A 2YUOA 1OI1A 2XU8A 5LL6S 4PJOG 1K9MU 2DERA 2DEUA 3O5ZA 1K76A 3CC4T 1PM3A 4CI0C 4LDYA 2X35A 3OA6A 3HPWA 2ATCB 5GAMh 3CMAQ 2QDLA 2JW4A 4NL3A 2RJCA 2QQ9A 2CZ0B 2J6FA 2VB6A 2M0YA 3X20B 1K1ZA 2M16A 4JZ3A 1WXUA 3R6OA 5KYUA 4E47A 5GAN2 3H0IA 1D09B 4XU2A 1WFWA 5C0MA 2HQXA 2E12A 2KQWA 3OMCA 1YIJA 2A36A 2L89A 1W1FA 3M4YA 3RR6A 4GLKA 2FPEA 3JCMh 2AZSA 2KRSA 4HCBA 2GCXA 1BBZA 4C92C 3ER0A 2PTKA 1K9AA 1H3ZA 2HQEA 4C92E 1KG1A 3CBPA 1JO8A 1GBQA 4IUQA 3C4SA 1AT1B 2KEAA 2O2OA 2EAYA 4M75F 2QEXT 1UHFA 4J5YA 5FW9A 1TXQA 1VQNA 1NPPA 4JJBA 4F7UF 2MK5A 1QLYA 2M9UA 2FZKB 2EWNA 1KC8R 2M51A 1QKWA 4J9FA 4WF2A 1OQKA 3CD6A 1VQMA 3DLLA 3OYEA 2ED0A 1M5Q1 2GNCA 2IPOB 5GAMg 4ME7A 1W4SA 4ORZA 3C12A 4HKEA 3PVLA 3QYGB 1IGUA 1I0CA 1RAEB 3HRUA 5KYYB 3OW2S 2CP7A 3NPFA 2YHTA 2FB7A 3RUXA 4M7DC 3MEVA 2EJ9A 5GANf 3EFSA 2E3HA 3NTHA 3VYHB 1HYOA 5I22A 1D0ZA 2KY9A 4AMCA 3I35A 4DOWA 3UA7A 4WTOB 3UPUA 4JLIA 2M1HA 5KYYA 1M4ZA 4LD9K 5IXFA 4J9IA 2IVWA 1QP2A 1XNIA 1JJ2P 3L2WA 3M56A 2LCSA 5CAIA 2EJFA 1YBYA 4A54A 4M77G 1U1TA 1Y96B 2EPDA 4ZN3A 5FU7C 4XQ3A 1YP5A 2QA4Q 2DIGA 3PMIA 3CCQQ 4AG1C 2WSEE 3RKWA 4A4FA 1TG0A 1TOVA 3EHQA 1TUDA 2LX7A 1RAFB 4M77C 2DK3A 2DTHA 3UT1A 4C8QA 5GAN8 1N6AA 4KUDK 2V8JA 1PD0A 1BI3A 4KULA 1RI0A 4II1A 1S72A 4PJOB 4BD3A 4C8QC 1VQNT 2EQKA 2LJ0A 1BIAA 2YUNA 2RPNA 3M0UA 2X4YA 3EGUA 4L5GA 5HCKA 5GAMj 3URGA 1B34B 4C8QG 1RI9A 3M54A 4J7IA 1SPKA 5IHNA 1BIBA 2QGGA 4JRKA 4DBRA 3F70A 3NFCA 2QASA 4RTVA 2J06A 3I55T 4CC4B 1LVKA 1N27A 5J39A 3VS3A 2EKHA 4BY6B 5GAN6 4DEXA 2I0NA 2OTLA 1MNEA 2NUTB 3I5SA 2GTOA 1TUGB 2DXUA 2JM8A 4Z89A 1PKSA 1VYUA 4RTTA 5DM7R 3S3OA 2RHIA 2DA9A 2QTXA 3RESA 2XI9A 2L8DA 4QVZA 2L5QA 1PWTA 2JMCA 5ECAA 4ESRA 2FZGB 1SSHA 2K6DA 5KH6A 4C8QE 4LDWA 3FIFA 2GFAA 2XICA 4BY6C 4A4HA 2X4WA 1RAGB 5GAN4 1PSEA 3HP9A 2E10A 1WXBA 4MDXA 1UTIA 1QVPA 5A0DA 2DPPB 2MWPA 5D6YA 2A7YA 2CUBA 2X4JA 3I55Q 4PNOA 3OYCA 2AK5A 3CCSQ 1IZ6A 2MPXC 3FJPA 3H41A 2DKGA 3PT9A 4M78C 2RK2A 4ZN1A 2RI2A 1S1NA 2DYIA 1ZBJA 2BUDA 1ZHIA 1UGVA 2K3BA 4RKUE 4E7SA 1U06A 2HL5C 3OBYA 4M78D 1UE9A 1G83A 2JTFA 2ROLA 3QDRB 3AHUA 4AFUC 2V1RA 3BW1A 1EX4A 2RB6A 4MZTA 3M0SA 5LJ3g 4D6WA 1XQHA 4FIBA 3GNGA 2F2WA 2YDLA 5CKDA 1N5ZA 2X9HA 2ECZA 2LNHB 3MPUB 4R56A 1KHIA 4HVWA 1Q7YR 3JV3A 3I5RA 3P8DA 2XDDA 1WXTA 3QYHB 1JEGA 1GRIA 1KD1U 1TSFA 3CCST 3AT1B 2C0TA 1JXMA 1VYTA 1BU1A 1ARKA 2RHZA 2WSCE 2A0FB 3REAB 1BK2A 3LWIA 1RACB 3META 4EDUA 2W0ZA 2LVMA 4N0AA 1QWFA 2OAWA 1VQ9T 4M75C 3HRSA 3HHTB 1NM7A 1R8OB 1WQ7A 1CSKA 5LJ3j 2CZ1B 1ABOA 3SWNA 1NZ9A 3CD6Q 2X51A 2MI6A 1M1KC 1VQ4A 2D8HA 1YITA 1Q81C 2EGCA 4AG2C 3CEYA 1VIFA 1YJNA 2E5KA 3MEAA 4R0KA 3CCRT 4A53A 2K3YA 5KYUB 4UC4A 4LDUA 1QQJA 3CPWA 1ACMB 2RHUA 2ED1A 3QG1A 2QDYB 3QKJA 3G6EA 1M90U 3GF5A 2DRKA 5EG2A 2EJGA 4B6MA 1WYXA 4BE0A 1YJNT 2DO3A 2DE0X 2EQUA 4C92A 4X9CA 1QVFA 2EBPA 3CXCP 3N5BB 1QW1A 3VS1A 1KD1R 1SRLA 1BI0A 2ZAEA 3VKIA 1B3QA 1MMDA 2L3QA 1WHMA 2KDSA 1VQMT 3MEWA 1AWJA 2E6NA 1CKBA 2VXFA 4PJLA 5CKBA 3CCJA 3E19A 2K57A 1K4US 1IXDA 3X25B 4BB7A 2PUOB 1MMGA 2DVJA 2BIVA 2RD1A 4IUVA 4BI4A 2RHXA 4C92G 5LJ3d 4XTUA 4QQGA 4QW2A 1GL5A 4GY5A 2HDAA 4KGZB 3MCAB 3JB9H 5A2QE 5CKFA 3CCJQ 4M78F 3RMSA 1OZ2A 1N8RR 5IT9E 4C92F 2A3LA 3EFRA 3TU4K 4NS5A 1FMWA 1VQ8Q 2F5TX 3M9QA 2CKKA 4PLIA 4JS5A 1UEBA 5GMKm 1I1JA 2LT1A 2NUPB 2XK0A 2CZ7B 1YI2T 4FYYB 5FWCA 3QZ5B 2LJ3A 3HFOA 3JSCA 4ZNXA 2JZ2A 3UWNA 4OVAA 3KUFA 4L59A 2QG9B 1UGSB 2MWOA 3OYHA 3CD6T 4JZ4A 1OZ3A 3A8OB 1YWPA 5HKCA 1UHCA 3CCMA 2IIMA 1M1GA 4PL6A 1NYGA 1KJWA 3LW5E 3SDZA 2EYXA 2YXYA 1VQKT 1PC0A 2BE9B 3CBMA 1M27C 4OMFB 2DEQA 3CC7Q 3IQLA 2KRMA 3J7AF 4DQ2A 1YITT 2NUPA 4PK4A 5IHKA 5FWBA 4M75D 3A98A 1JRIA 2LRQA 4J9EA 5LJ5e 1VQ5T 4KGVB 2ZCFB 5A0LA 2CZ6B 3CCUQ 2DZ9A 3QUIA 1ZQ1A 3ASKA 1UECA 5GAMd 4VUBA 1G3WA 1JQQA 3OYGA 2K5IA 1W2BP 3CCLT 4AT1B 1YI2Q 2OTJA 2KROA 5I2MA 4C0DB 2RQTA 4BI3A 4KH1B 1VQLT 2VWFA 3EG9A 1K9MR 3H9NA 1WHKA 3EFOA 3MHXA 2D6FA 3OYDA 4Y92A 2HBPA 1AEYA 5DY9A 1WI7A 2L0AA 2R57A 5GAN7 4C8QB 2MMPA 3EH2A 1BYMA 1M30A 5GAN5 4M78E 3JB9G 2RO0A 1Q95G 3I56Q 1VQ5A 2Y90A 1T3SA 1LJOA 1KQ1A 3BDUA 3OYYA 3I56A 1VQ5Q 1VQ8T 2KGTA 3V7CA 3MP1A 1AOJA 4BDYA 2KT8A 2RM4A 4M4ZA 2ESWA 2HNIA 2QQSA 2RF0A 3VJPA 2CP5A 2MCNA 2DM1A 2KRNA 4PFOA 4X1VA 1VQ9A 1WA7A 2DL8A 2V8KA 2VASA 1YIJT 3LX7A 3A8GB 5A0GA 1VQLQ 2DZCA 5KCHA 3WXMB 2Z0WA 2KBTA 4FM4B 2D0QB 3C94A 2MF2A 1GFDA 2XDPA 4XK8E 4RUGA 3CCUA 2B8AA 4OP0A 1ZUYA 4Y91A 3I56T 3QO3A 2RH2A 1HK9A 5GMKj 3S6WA 3I55A 1NJIU 2JUFA 3A8MB 2XG8D 1NJIR 3O8VA 3G71T 1ZUUA 1EIFA 1VQ6A 1B7TA 2O31A 1KFZA 2PVDB 5GMKl 4J9DA 1RAHB 1WJSA 1WPYA 4TVRA 2QXFA 4J9GA 2RI5A 1G3YA 3VRYA 4M7DB 2P4RA 2PZ1A 1GCQC 2XHCA 1LOJA 3ZBDA 1KC8C 1MUZA 3QIIA 3NGPA 3TREA 4J9BA 2DJZA 2J6KA 1VQOT 3G4SA 1JBMA 1VIEA 4FW2A 5AT1B 1VQ4T 5I11A 1UFFA 5DLQE 2J6OA 2OTJQ 1KQSP 2LC4A 3L2QA 3X26B 1M90C 3RKYA 3ULRB 2MYSA 2KYMA 3JCMd 1SG5A 4RTYA 3EG1A 2EQJA 4KGXB 1TUCA 2KSSA 1S72T 3TQ7P 2RQRA 4C5IA 5GMKh 1I81A 1NYFA 3CC4Q 2LTOA 4JRPA 1Y71A 4DBQA 4R55A 1W70A 3V8JA 1SEMA 4OB3B 4OMLA 3CCET 3EGDA 4CC3A 4EMKA 1UB4A 2HSEB 2JMAA 4KUIA 2M0OA 1M3AA 1SKUB 5CIUA 2KYBA 3JCMX 5IH2A 3MEUA 2QAZA 2VGNA 3JB9I 1D0XA 1VQOQ 4CRIA 1C0MA 2NLUA 4K11A 3QJYA 1ZLMA 2BE7D 4KRTA 2W10A 3PMTA 3V7SA 3INZA 2V8IA 3JCMQ 4EMKB 4XU0A 5EC7A 2BTTA 1M8MA 5GAMf 3SHWA 4OF1A 2FHDA 1YJWA 4EMHA 1T0JA 4ZGDB 2A37A 4QQ6A 2NWMA 1AWWA 4Z8AA 5D7UA 2RJEA 3KBGA 2JNGA 2DXTA 2O88A 4HT9A 5LJ5j 3REBB 2EFIA 3A8HB 3FB9A 2AKKA 2L2PA 2GFUA 3JCMb 3GIBA 4CC2A 2EGAA 1K0SA 1BKBA 1KD1C 4M77B 4HCCA 1WGSA 2YUQA 2ZPFB 4QVCA 2HQHA 4C92B 4O5VA 1V76A 1UGPB 4A4EA 3UF4A 2OTJT 4QKUA 1OYXA 3LGLA 1QVGP 1KQ2A 1X69A 2PUKB 2A08A 1LCKA 1RAAB 1CKAA 5KE3A 2BZYA 4DBFA 3V8KA 4E7IA 5DLOA 3FJ5A 3A1PA 4NOYA 3PE0A 1JJ2A 1RAIB 4AFQC 3GP8A 2JXBA 3VS5A 1X2KA 1HSQA 1WJQA 1YHQA 4HT8A 1UUEA 1K0XA 1I5OB 4ELYC 3OYNA 4DBHA 3HFNA 1Q82C 4M7AB 1TH7A 3L2ZA 5GANj 2FL7A 5GAOl 1YHQQ 3C0CA 2DL5A 1YFNA 3SWNC 3CPFA 2E4HA 4A63B 4F14A 3OYAA 1PHTA 2OTLT 1K73C 3CCVQ 2O9SA 4F7UG 3EFOB 3CCSA 4HVVA 4IKFA 2DVEA 1B34A 1MV3A 4C0ZA 2VXEA 4OB1B 2FPDA 3DLMA 2J7IA 4D8DA 1TU0B 4J83A 5CO7A 5FROA 4E7LA 3CCLA 2O4XB 1Z9ZA 1YCYA 1Q82R 1GCPA 3FLGA 3M5AA 2AKLA 5CQYA 5LJ3h 4C5GA 4OMQA 2KMTA 1NE8A 2GQVA 1WHLA 3CMAT 3ZEHA 5I2SA 3OS0A 1V29B 2CSQA 2P0QA 4IIMA 2RQUA 1YN8A 4BDZA 1ZX6A 2DXBA 1VUBA 3CMEA 2CP0A 3UDCA 4FU6A 1EZZB 2DYBA 2DAQA 4HCKA 3S3MA 3ZFJA 3T9NA 3HRTA 2KXCA 1H8KA 2RNAA 2OTLQ 1T3LA 1NLOC 1KIKA 4PJOA 4C0GA 1I8FA 4IUPA 1N9SA 3Q1JA 1Q81R 4PJJA 4F7UB 3VYGA 2PNIA 3M0QA 3OQ5A 1YJWQ 1M90R 4PJOD 3EG9B 2QEXA 2JTMA 2HSPA 1N8RC 4F04B 3RIRA 5FRNA 1G8XA 4HVUA 2CP2A 3EAEA 1NLPC 5KYNA 5FU7B 2E3IA 5CQXA 2Y4YA 3QHSA 1W6XA 2JM9A 3E2UA 1M1KU 3JCMP 4LD6A 1E6HA 1GXIE 4M7AC 2PU9B 2L3SA 4O6JA 4IIOA 2H3EB 2QQBA 1YHQT 3HTRA 5LJ5d 4JJCA 1K8AU 4JLGA 5KE2A 5GAOp 3TEEA 2QQRA 3A5ZB 2PVOB 3RNJA 4RTWA 1K9MC 2P84A 4FT2A 4RG8A 2HZYA 2KR3A 3D7SB 3JRZA 4E7HA 1YJWT 1WQWA 3QZ9B 4OB2B 4QVDA 1MNDA 4JJDA 1H3HA 4FW1A 2MIOA 1ZSZC 1F1BB 3P8HA 2HMAA 4X34A 3CCMQ 3NMZC 4N4IA 1BB9A 3SEMA 1UGRB 3PTAA 1HD3A 1IO6A 4JPBW 3EGXA 5KYWB 1AZGB 4E6RA 2D1XA 5CKHA 2EIFA 4M7DG 1KQSA 2EQMA 4J7FA 5L8RE 2FZCB 4MMKA 1RABB 1QCOA 1FYNA 3EG3A 1AZEA 2RK1A 3BDLA 1ZSZA 3OW2A 1PKTA 1M3BA 3TSWA 5AYFA 2HL3A 1X6OA 1BCOA 4EMGA 1WJRA 1KK7A 4PJMA 2J05A 1OPKA 1OU8A 1ZBXA 2VC8A 3EGXB 5KYWA 5GANe 4OMNA 2HKNA 4M7DA 4XU3A 5LJ5g 2YRDA 4LE9A 5KYXB 3L1AA 3CMEQ 4RCCA 1BCMA 5HK3A 3CCVA 3H8ZA 2E65A 6AT1B 4M7AG 3CQTA 3QDFA 4DOVA 2CH4A 3J81E 2RJDA 1M1KR 3CC7A 2F5KA 2P4TA 1IHWA 3MO8A 1OULA 2H8HA 1NEGA 1IB8A 4PJNA 3EG0A 4B9XA 2DD5A 3L42A 5HK0A 3FRNA 3CPWS 4ZTJA 2LT4A 1VQNQ 2ENMA 1VQ9Q 3CXCA 1ZUKA 3OMGA 4ELZC 3OYJA 4EMKC 4RTUA 3THKA 1TWBA 1WDXA 2CSIA 4M77A 3H0HA 1OX9A 4HXJA 2EKOA 3V7RA 4E7ZA 3ME9A 5LJ3f 1KC8U 3CCRQ 1SHGA 2DXCA 1X6BA 2FRWA 3U23A 3OYIA 3E9FA 3CCQT 4CC7A 2HCKA 1B07A 2LX9A 3JCMJ 2VVKA 1M2VA 9ATCB 1D3BB 2FPFA 1H92A 1T0HA 1H641 4J6WA 4FL6A 2DFUA 3QWXX 2QK0A 2FVUA 1YCSB 2YRVA 5FRMA 1JU5C 4X9DA 3GPLA 1BI2A 2YUPA 3OYLA 1QVGA 2O9VA 5M9OA 2XD0A 1RUWA 1VQMQ 1PSFA 3UATA 4PFPA 3G1JA 2AHJB 5I21A 2DMOA 1D3BA 3OYKA 4XTVA 3PFSA 4QT7A 3HKSA 2AIRB 3RKXA 1R77A 1Q86C 3OY9A 4JRIA 2NYSA 4M7AE 4EPCA 2KXDA 1UGQB 2D9TA 3CMET 2ZPIB 4M7DE 5GANd 4KT0E 1X01A 1EFNA 3VRZA 5IHIA 2E64A 3OS1A 2ZGWA 5GMKi 3BE3A 2CGHA 3QJ6A 1IHVA 4M75G 1MV0B 2VV5A 2FRYA 1G3TA 4M7DD 3LWHA 2DETA 5GANh 3VS2A 1D1CA 2V1QA 1WHGA 3JCMe 4FYVB 4ZGEB 2EYYA 2BZXA 2OX7A 4OMMA 2F2VA 1QVGS 4M77E 3TVTA 3RMQA 4DA4A 4P5NA 2COYA 3M53A 1I4K1 4RTXA 8ATCB 1VYVA 3QSUA 4WCIA 3DB3A 3G71A 4M78A 3QWYA 1YITQ 2DBKA 1K73R 1Y07A 3SB2A 3G4SQ 5D6XA 2CUDA 2LQWA 2CS7A 2YWWA 2JS0A 2C0OA 2QQAA 3GLXA 3OSVA 2EQIA 4F17A 4OB0B 4ANJA 3VS0A 4M75B 1TS9A 1FX7A 2GF7A 1Z9QA 2VUBA 4FSXA 2VKNA 3MP6A 2YT6A 4N4GA 4RCBA 5GJWB 1P92A 1Q7YU 3VU3C 5GAOm 4M78B 4JRQA 1QKXA 5C6SA 4FSSA 1GFCA 1SSFA 2YSQA 3VS6A 3DKMA 3JCMc 1AVZC 2QA4T 3QXEB 4C5EA 1FMVA 2E5QA 2ABLA 2LQKA 3FDRA 4HA8A 2L3PA 3EHRA 2YLCA 1VQPQ 2KI7A 1OOTA 2RMOA 5GANg 1VQOA 2JVVA 3G4ST 4BUGA 2A28A 5LJ5f 1SRMA 4LXCA 1YJNQ 1ABQA 2COZA 4RG2A 4BI8B 4MZPA 2LP5A 4V2SA 4PJOC 1QCFA 2Y4XA 2HD0A 1M8VA 4C5HA 4E7KA 2NUTA 3LYIA 1UG1A 2JJ9A 5GMKe 2F2XA 3LLRA 2KE9A 4PKCC 2D8JA 2DL7A 3KXTA 1YIJQ 4MMLA 1JJ2S 1XTDA 1WHJA 4LNPA 3M57A 2KVQG 2FYKA 2LDMA 3JAME 2EYWA 2R5AA 2ZPHB 3CCEA 3E9GA 4MDWA 3KFVA 4Z88A 4GLMA 1ZSZB 3JB9F 7AT1B 1PCXA 3QBYA 4C8QD 1W2BS 4XTYA 2QYZA 4D8KA 2EVRA 3V8LA 2KT1A 5GAOn 3WVDB 2I2LA 4J6YA 3OBWA 4KBMB 2QGFB 1NJIC 2YRCA 2K9GA 4N4HA 1KHCA 2WSFE 3R6NA 2LJ1A 5KYXA 5FU6B 3JB9J 2KAFA 3L2VA 1QP3A 3OS5A 1FWZA 1NG2A 2K4YA 3M0RA 4JDSA 3EGDB 2WACA 1VQKA 5HY6A 2R58A 2JN0A 4J9CA 1VOMA 4XAXB 2CT3A 1VQ6Q 2FEIA 1Q86R 1Q81U 4ZTFA 3A8LB 3C95A 2LCLA 4BACA 1RLQC 3SFMA 1UJYA 4JS4A 3M0PA 2DD4A 3CC7T 3BFMA 3CCJT 2M02A 1VQPT 3VS4A 5L23A 2DTOA 2QA4A 4FYXB 2CP3A 1MHNA 2E70A 1PRLC 1U1SA 2DILA 2K3XA 2K5FA 2DX1A 2ZPGB 1G5VA 3CCUT 1YI2A 3X24B 1S72Q 3HL8A 3BY7A 5IN1A 2OI3A 3OSSC 4RTZA 2COWA 1K8AR 3CCLQ 3RDVA 2CREA 1RL2A 1SHFA 2CH4W 2PVGB 3GBQA 5IXBA 4M77F 2DNUA 2ZPBB 3MKDA 1VQ6T 5FLXE 1OV3A 1A0NB 3G6ET 1X2QA 1VQ8A 4XU1A 1PD1A 3OYBA 1Q86U 1WX6A 4AFSC 4OMOA 3EH1A 3PVQA 2CT4A 1O9SA 4RMOA 3CC2A 1D1BA 1YWOA 3VV0A 1V1CA 4FCYA 2ZZDA 1C6VX 2DJQA 4B9WA 1UDLA 1E7OA 2EGEA 2RQWA 3FC3A 2DL3A 2P0PA 4IUTA 2QTVA 1QVFS 5CKEA
chains in the Genus database with same CATH topology
3NHNA 1AEYA 3PVLA 2DL4A 1WI7A 2L0AA 1I0CA 4LUDA 3H0FA 1M30A 1FYNA 3EG3A 1AZEA 2K79A 3NPFA 1PKTA 1M3BA 2FG0A 3TSWA 4DEYA 1T3SA 1WLPB 1WIEA 2J05A 1OPKA 5I22A 2KGTA 4OMNA 2X3XD 1AOJA 2KT8A 1NEBA 4M4ZA 2ESWA 2RF0A 4LE9A 1PRMC 4LUEA 2MCNA 3I35A 2DM1A 1RLPC 2KRNA 4X1VA 3UA7A 1WA7A 2LZ6B 1FMKA 3CQTA 2DL8A 2CH4A 5IXFA 4J9IA 1X43A 1HJDA 2LCSA 2AZVA 2OJ2A 2H8HA 1NEGA 2KBTA 1U3OA 2NUZA 3EG0A 2HEQA 2EW3A 2C0IA 2EPDA 1GFDA 1YP5A 4LN2A 4RUGA 1M3CA 4AG1C 1TG0A 2ENMA 1ZUKA 3EHQA 1TUDA 2LX7A 1ZUYA 4RTUA 3THKA 2DRMA 1WDXA 2CSIA 2K2MA 3H0HA 4HXJA 2JT4A 1ZUUA 1ZSGA 1AWXA 1SHGA 2FRWA 1X6BA 2O31A 3U23A 1KFZA 4CC7A 2HCKA 1B07A 2LJ0A 2VVKA 2FPFA 2YUNA 4J9DA 1AWOA 1H92A 2RPNA 1U5SA 1T0HA 2D0NA 3M0UA 3EGUA 4J9GA 2SEMA 5HCKA 3QWXX 1YCSB 2DF6A 3VRYA 3UA6A 2P4RA 2PZ1A 1GCQC 1JU5C 1MUZA 2YUPA 1RI9A 3M0TA 1SPKA 3NGPA 4J9BA 2J6KA 5IHNA 2O9VA 1J3TA 1RUWA 3UATA 4RTVA 5I11A 1UFFA 2J6OA 2J06A 4CC4B 3ULRB 2DMOA 2EYZA 2KYMA 3VS3A 2EKHA 4DEXA 2GTJA 4RTYA 3EG1A 2I0NA 4QT7A 1TUCA 2DBMA 4EIKA 3I5SA 2GTOA 2JM8A 2RQRA 4Z89A 1PKSA 1VYUA 1NYFA 4RTTA 2KXDA 4J9HA 1W70A 2DA9A 1SEMA 1Y0MA 4OMLA 1JXOA 2K7AA 4CC3A 1PWTA 1EFNA 3VRZA 2JMAA 2JMCA 5IHIA 3LH5A 1M3AA 2GBQA 5ECAA 4ESRA 1SSHA 2KYBA 2K6DA 1MV0B 2FRYA 5GJVB 5IH2A 4OMPA 3TSZA 2GQIA 2JS2A 2BZ8A 2LQNA 1E6GA 1WXBA 4K11A 3VS2A 1UTIA 1VA7A 1ZLMA 4F16A 2X3WD 4KRTA 2V1QA 2W10A 2CUBA 2AK5A 2SRCA 2EYYA 5EC7A 2BTTA 2BZXA 1M8MA 3H41A 3SHWA 4OMMA 2KNBB 2F2VA 2CDTA 3ZL7C 1S1NA 1T0JA 1ZBJA 2A37A 3TVTA 1OPLA 2NWMA 4RTXA 1UGVA 2K3BA 1AWWA 1VYVA 1U06A 4WCIA 4Z8AA 3VS7A 3QWYA 1UE9A 1G83A 2HBWA 2ROLA 2DBKA 2O88A 4AFUC 2V1RA 3REBB 2DLPA 2AKKA 2L2PA 2CUDA 2LQWA 3M0SA 4CC2A 2JS0A 2C0OA 2EGAA 1K0SA 1GCQA 2EQIA 2G6FX 2YUQA 4F17A 2F2WA 2YDLA 2RN8A 1N5ZA 2ROTA 3VS0A 2ECZA 2LNHB 1Z9QA 2VKNA 3UF4A 4HVWA 2YT6A 3JV3A 5GJWB 2B86A 3I5RA 1QKXA 1WXTA 1X69A 2A08A 1JEGA 1GRIA 1LCKA 3RBBB 2C0TA 1JXMA 1CKAA 4FSSA 1GFCA 1VYTA 1BU1A 1ARKA 2YSQA 1G2BA 2BZYA 3VS6A 3REAB 2MOXA 1BK2A 1AVZC 3FJ5A 2RQVA 3PE0A 2W0ZA 2ABLA 2L3PA 4AFQC 3EHRA 1QWEA 1QWFA 2JXBA 2OAWA 4GBQA 3VS5A 1X2KA 1NM7A 1OOTA 2RMOA 1HSQA 2GGRA 1AD5A 1CSKA 1I07A 2A28A 1ABOA 1SRMA 1UUEA 1ABQA 1K0XA 2LP5A 1X6GA 2D8HA 1OEBA 2EGCA 4AG2C 1UJ0A 1X27A 1QCFA 2E5KA 2JTEA 1Y57A 4R0KA 2XMFA 1YNZA 3C0CA 2DL5A 4A63B 4F14A 1PNJA 1PHTA 1UG1A 1KSWA 2ED1A 1XOVA 2F2XA 2KE9A 2O9SA 2D8JA 2DL7A 2DRKA 4HVVA 2LMJA 4LNPA 1MV3A 1WYXA 2FPDA 1GBRA 2DE0X 2J7IA 4D8DA 2EYWA 3EG2A 2EBPA 1Z9ZA 2FO0A 3KFVA 3VS1A 1GCPA 1SRLA 3I9QA 4GLMA 4Z88A 2AKLA 1B3QA 2L3QA 4OMQA 4AFZC 1AWJA 1CKBA 1K4US 4D8KA 2EVRA 2KT1A 2DVJA 2YUOA 2CSQA 4IIMA 2RQUA 1YN8A 2K9GA 3R6NA 2LJ1A 1ZX6A 3O5ZA 1GL5A 1K76A 2HDAA 1NG2A 3M0RA 2DYBA 4HCKA 2KXCA 1H8KA 4J9CA 2QDLA 2RNAA 2JW4A 1T3LA 1NLOC 1KIKA 2J6FA 2CT3A 2M0YA 2FEIA 1K1ZA 4JZ3A 1WXUA 1RLQC 2PNIA 3M0QA 1UJYA 3H0IA 2HSPA 1WFWA 1I1JA 3M0PA 4HVUA 1NLPC 2A36A 1W1FA 3VS4A 5FWCA 2LJ3A 5L23A 4ZNXA 2FPEA 2KRSA 2AZSA 1W6XA 2JM9A 1BBZA 1PRLC 1E6HA 2DILA 2PTKA 4JZ4A 2L3SA 1K9AA 1YWPA 1UHCA 2DX1A 4IIOA 2IIMA 1NYGA 1KJWA 2EYXA 2OI3A 4JJCA 4RTZA 1JO8A 1M27C 1GBQA 3IQLA 2KRMA 2CREA 2KEAA 1SHFA 2CH4W 2O2OA 3GBQA 3RNJA 5IXBA 5IHKA 5FWBA 2DNUA 3A98A 4RTWA 4J9EA 2KR3A 1OV3A 1UHFA 1A0NB 5FW9A 1X2QA 4JJBA 1WX6A 4AFSC 1QLYA 1UECA 4OMOA 4JJDA 1H3HA 2MIOA 1JQQA 2CT4A 3PVQA 2M51A 1QKWA 4J9FA 2KROA 3NMZC 1BB9A 3SEMA 2RQTA 1YWOA 1HD3A 1V1CA 1IO6A 4JPBW 2VWFA 2DJQA 2ED0A 2GNCA 1AZGB 1UDLA 1E7OA 2EGEA 4E6RA 2RQWA 2D1XA 2DL3A 4Y92A 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHN A;  1AEY A;  3PVL A;  2DL4 A;  1WI7 A;  2L0A A;  1I0C A;  4LUD A;  3H0F A;  1M30 A;  1FYN A;  3EG3 A;  1AZE A;  2K79 A;  3NPF A;  1PKT A;  1M3B A;  2FG0 A;  3TSW A;  4DEY A;  1T3S A;  1WLP B;  1WIE A;  2J05 A;  1OPK A;  5I22 A;  2KGT A;  4OMN A;  2X3X D;  1AOJ A;  2KT8 A;  1NEB A;  4M4Z A;  2ESW A;  2RF0 A;  4LE9 A;  1PRM C;  4LUE A;  2MCN A;  3I35 A;  2DM1 A;  1RLP C;  2KRN A;  4X1V A;  3UA7 A;  1WA7 A;  2LZ6 B;  1FMK A;  3CQT A;  2DL8 A;  2CH4 A;  5IXF A;  4J9I A;  1X43 A;  1HJD A;  2LCS A;  2AZV A;  2OJ2 A;  2H8H A;  1NEG A;  2KBT A;  1U3O A;  2NUZ A;  3EG0 A;  2HEQ A;  2EW3 A;  2C0I A;  2EPD A;  1GFD A;  1YP5 A;  4LN2 A;  4RUG A;  1M3C A;  4AG1 C;  1TG0 A;  2ENM A;  1ZUK A;  3EHQ A;  1TUD A;  2LX7 A;  1ZUY A;  4RTU A;  3THK A;  2DRM A;  1WDX A;  2CSI A;  2K2M A;  3H0H A;  4HXJ A;  2JT4 A;  1ZUU A;  1ZSG A;  1AWX A;  1SHG A;  2FRW A;  1X6B A;  2O31 A;  3U23 A;  1KFZ A;  4CC7 A;  2HCK A;  1B07 A;  2LJ0 A;  2VVK A;  2FPF A;  2YUN A;  4J9D A;  1AWO A;  1H92 A;  2RPN A;  1U5S A;  1T0H A;  2D0N A;  3M0U A;  3EGU A;  4J9G A;  2SEM A;  5HCK A;  3QWX X;  1YCS B;  2DF6 A;  3VRY A;  3UA6 A;  2P4R A;  2PZ1 A;  1GCQ C;  1JU5 C;  1MUZ A;  2YUP A;  1RI9 A;  3M0T A;  1SPK A;  3NGP A;  4J9B A;  2J6K A;  5IHN A;  2O9V A;  1J3T A;  1RUW A;  3UAT A;  4RTV A;  5I11 A;  1UFF A;  2J6O A;  2J06 A;  4CC4 B;  3ULR B;  2DMO A;  2EYZ A;  2KYM A;  3VS3 A;  2EKH A;  4DEX A;  2GTJ A;  4RTY A;  3EG1 A;  2I0N A;  4QT7 A;  1TUC A;  2DBM A;  4EIK A;  3I5S A;  2GTO A;  2JM8 A;  2RQR A;  4Z89 A;  1PKS A;  1VYU A;  1NYF A;  4RTT A;  2KXD A;  4J9H A;  1W70 A;  2DA9 A;  1SEM A;  1Y0M A;  4OML A;  1JXO A;  2K7A A;  4CC3 A;  1PWT A;  1EFN A;  3VRZ A;  2JMA A;  2JMC A;  5IHI A;  3LH5 A;  1M3A A;  2GBQ A;  5ECA A;  4ESR A;  1SSH A;  2KYB A;  2K6D A;  1MV0 B;  2FRY A;  5GJV B;  5IH2 A;  4OMP A;  3TSZ A;  2GQI A;  2JS2 A;  2BZ8 A;  2LQN A;  1E6G A;  1WXB A;  4K11 A;  3VS2 A;  1UTI A;  1VA7 A;  1ZLM A;  4F16 A;  2X3W D;  4KRT A;  2V1Q A;  2W10 A;  2CUB A;  2AK5 A;  2SRC A;  2EYY A;  5EC7 A;  2BTT A;  2BZX A;  1M8M A;  3H41 A;  3SHW A;  4OMM A;  2KNB B;  2F2V A;  2CDT A;  3ZL7 C;  1S1N A;  1T0J A;  1ZBJ A;  2A37 A;  3TVT A;  1OPL A;  2NWM A;  4RTX A;  1UGV A;  2K3B A;  1AWW A;  1VYV A;  1U06 A;  4WCI A;  4Z8A A;  3VS7 A;  3QWY A;  1UE9 A;  1G83 A;  2HBW A;  2ROL A;  2DBK A;  2O88 A;  4AFU C;  2V1R A;  3REB B;  2DLP A;  2AKK A;  2L2P A;  2CUD A;  2LQW A;  3M0S A;  4CC2 A;  2JS0 A;  2C0O A;  2EGA A;  1K0S A;  1GCQ A;  2EQI A;  2G6F X;  2YUQ A;  4F17 A;  2F2W A;  2YDL A;  2RN8 A;  1N5Z A;  2ROT A;  3VS0 A;  2ECZ A;  2LNH B;  1Z9Q A;  2VKN A;  3UF4 A;  4HVW A;  2YT6 A;  3JV3 A;  5GJW B;  2B86 A;  3I5R A;  1QKX A;  1WXT A;  1X69 A;  2A08 A;  1JEG A;  1GRI A;  1LCK A;  3RBB B;  2C0T A;  1JXM A;  1CKA A;  4FSS A;  1GFC A;  1VYT A;  1BU1 A;  1ARK A;  2YSQ A;  1G2B A;  2BZY A;  3VS6 A;  3REA B;  2MOX A;  1BK2 A;  1AVZ C;  3FJ5 A;  2RQV A;  3PE0 A;  2W0Z A;  2ABL A;  2L3P A;  4AFQ C;  3EHR A;  1QWE A;  1QWF A;  2JXB A;  2OAW A;  4GBQ A;  3VS5 A;  1X2K A;  1NM7 A;  1OOT A;  2RMO A;  1HSQ A;  2GGR A;  1AD5 A;  1CSK A;  1I07 A;  2A28 A;  1ABO A;  1SRM A;  1UUE A;  1ABQ A;  1K0X A;  2LP5 A;  1X6G A;  2D8H A;  1OEB A;  2EGC A;  4AG2 C;  1UJ0 A;  1X27 A;  1QCF A;  2E5K A;  2JTE A;  1Y57 A;  4R0K A;  2XMF A;  1YNZ A;  3C0C A;  2DL5 A;  4A63 B;  4F14 A;  1PNJ A;  1PHT A;  1UG1 A;  1KSW A;  2ED1 A;  1XOV A;  2F2X A;  2KE9 A;  2O9S A;  2D8J A;  2DL7 A;  2DRK A;  4HVV A;  2LMJ A;  4LNP A;  1MV3 A;  1WYX A;  2FPD A;  1GBR A;  2DE0 X;  2J7I A;  4D8D A;  2EYW A;  3EG2 A;  2EBP A;  1Z9Z A;  2FO0 A;  3KFV A;  3VS1 A;  1GCP A;  1SRL A;  3I9Q A;  4GLM A;  4Z88 A;  2AKL A;  1B3Q A;  2L3Q A;  4OMQ A;  4AFZ C;  1AWJ A;  1CKB A;  1K4U S;  4D8K A;  2EVR A;  2KT1 A;  2DVJ A;  2YUO A;  2CSQ A;  4IIM A;  2RQU A;  1YN8 A;  2K9G A;  3R6N A;  2LJ1 A;  1ZX6 A;  3O5Z A;  1GL5 A;  1K76 A;  2HDA A;  1NG2 A;  3M0R A;  2DYB A;  4HCK A;  2KXC A;  1H8K A;  4J9C A;  2QDL A;  2RNA A;  2JW4 A;  1T3L A;  1NLO C;  1KIK A;  2J6F A;  2CT3 A;  2M0Y A;  2FEI A;  1K1Z A;  4JZ3 A;  1WXU A;  1RLQ C;  2PNI A;  3M0Q A;  1UJY A;  3H0I A;  2HSP A;  1WFW A;  1I1J A;  3M0P A;  4HVU A;  1NLP C;  2A36 A;  1W1F A;  3VS4 A;  5FWC A;  2LJ3 A;  5L23 A;  4ZNX A;  2FPE A;  2KRS A;  2AZS A;  1W6X A;  2JM9 A;  1BBZ A;  1PRL C;  1E6H A;  2DIL A;  2PTK A;  4JZ4 A;  2L3S A;  1K9A A;  1YWP A;  1UHC A;  2DX1 A;  4IIO A;  2IIM A;  1NYG A;  1KJW A;  2EYX A;  2OI3 A;  4JJC A;  4RTZ A;  1JO8 A;  1M27 C;  1GBQ A;  3IQL A;  2KRM A;  2CRE A;  2KEA A;  1SHF A;  2CH4 W;  2O2O A;  3GBQ A;  3RNJ A;  5IXB A;  5IHK A;  5FWB A;  2DNU A;  3A98 A;  4RTW A;  4J9E A;  2KR3 A;  1OV3 A;  1UHF A;  1A0N B;  5FW9 A;  1X2Q A;  4JJB A;  1WX6 A;  4AFS C;  1QLY A;  1UEC A;  4OMO A;  4JJD A;  1H3H A;  2MIO A;  1JQQ A;  2CT4 A;  3PVQ A;  2M51 A;  1QKW A;  4J9F A;  2KRO A;  3NMZ C;  1BB9 A;  3SEM A;  2RQT A;  1YWO A;  1HD3 A;  1V1C A;  1IO6 A;  4JPB W;  2VWF A;  2DJQ A;  2ED0 A;  2GNC A;  1AZG B;  1UDL A;  1E7O A;  2EGE A;  4E6R A;  2RQW A;  2D1X A;  2DL3 A;  4Y92 A;  4ORZ A; 
#chains in the Genus database with same CATH topology
 3NHN A;  3GOX A;  4M78 G;  2DL4 A;  4E7J A;  4JJN K;  2HAX A;  4LUD A;  3H0F A;  1PG5 B;  5KCO A;  2K79 A;  3SD4 A;  3TCJ A;  2FG0 A;  4M7A D;  1YJ9 A;  4DEY A;  1N8R U;  3SWN B;  1KQS S;  3M59 A;  2XID A;  4E2F B;  1WLP B;  1M2V B;  4M7A A;  5FU6 C;  1XJW B;  1WIE A;  1OU9 A;  5IAY A;  4C92 D;  1YJ9 Q;  3CMA A;  2X3X D;  1MMA A;  1NEB A;  2VGM A;  3NTI A;  1PRM C;  4LUE A;  1RLP C;  1M1F A;  2LZ6 B;  1FMK A;  3MP8 A;  3CCQ A;  1X43 A;  4XTZ A;  1HJD A;  2O4X A;  1MGQ A;  2AZV A;  2OJ2 A;  1U3O A;  2F69 A;  5D6W A;  2NUZ A;  2HEQ A;  2EW3 A;  2C0I A;  4OGC A;  5CVI A;  3P8B B;  4C0D C;  2E6Z A;  4LN2 A;  1M3C A;  2DIQ A;  4QQD A;  1Q7Y C;  2DRM A;  2KK4 A;  1C1A A;  4BE1 A;  2K2M A;  3L2R A;  3CPW P;  3G6E Q;  2F1L A;  3GNF B;  3E1S A;  2JT4 A;  3JCM f;  2LNV A;  1ZSG A;  1AWX A;  5LJ5 h;  1QVF P;  4J8O A;  1VQ4 Q;  1AWO A;  2DTI A;  1U5S A;  2D0N A;  4F7U A;  1VQ7 T;  3VUB A;  2VYT A;  2BKD N;  2SEM A;  5J3B A;  5GAO r;  4A4G A;  5CR2 A;  2DF6 A;  3UA6 A;  3CC2 T;  3CXC S;  4M75 E;  1BI1 A;  3RER A;  3M0T A;  3CC4 A;  1AHJ B;  1JB0 E;  4XTW A;  1J3T A;  2H3J A;  1LPL A;  1O75 A;  4OGE A;  1U8R A;  1NPR A;  3CCR A;  1D1A A;  2EYZ A;  3LGF A;  4LDV A;  4PJO F;  3QPH A;  1Y96 A;  3CBO A;  2GTJ A;  1SF9 A;  1YJ9 T;  1DJ7 B;  2LCC A;  2DBM A;  4MZM A;  4EIK A;  3OS2 A;  1VQK Q;  3FEO A;  2O01 E;  2CP6 A;  4J9H A;  4ATO A;  2V26 A;  3M4G A;  4C0F A;  1Y0M A;  5LJ3 e;  2E41 A;  3JB9 D;  1JXO A;  2IG0 A;  2K7A A;  4FYW B;  3LH5 A;  4Z02 A;  1ZA2 B;  1VQ7 Q;  2GBQ A;  1IRX A;  4PJO E;  4M77 D;  3J80 E;  2RHY A;  3M58 A;  3CC2 Q;  4JUV A;  4YTL A;  5GJV B;  4LDX A;  3LH0 A;  4OMP A;  4KH0 B;  3TSZ A;  2ZPE B;  2GQI A;  2JS2 A;  2BZ8 A;  3JCM W;  4M7A F;  1M9S A;  2LQN A;  2XDB A;  2YLB A;  1E6G A;  4IUU A;  1OX8 A;  1ZA1 B;  1VA7 A;  4F16 A;  2X3W D;  3CCE Q;  2HKQ B;  1TTH B;  4BE2 A;  2SRC A;  1R0C B;  3NTK A;  5GAO q;  3S3N A;  2LQ8 A;  4M75 A;  2KNB B;  2CDT A;  2XKO C;  3ZL7 C;  4A4K A;  5GAM e;  8AT1 B;  4FT4 A;  1OPL A;  4L6V 5;  1Q82 U;  3PNW C;  1QCN A;  3VS7 A;  1N9R A;  5J26 A;  2HBW A;  1I5L A;  4PLL A;  3WVE B;  2P0K A;  1IGQ A;  2DLP A;  4XTX A;  3HSB A;  1K73 U;  3VUZ A;  3PIP A;  4M7D F;  2RA2 A;  1W2B A;  3L2U A;  1LNX A;  3OW2 P;  1VQP A;  1GCQ A;  2G6F X;  2RI3 A;  1D0Y A;  2RN8 A;  2R5M A;  2ROT A;  3H6Z A;  2QI2 A;  3PGG A;  4J6X A;  5CCA A;  1MMN A;  2X4X A;  3CCM T;  1HXD A;  1NBE B;  2B86 A;  4Y28 E;  3M55 A;  3RBB B;  1G2B A;  4ZGJ B;  3JCM g;  2G3R A;  2PQW A;  2MOX A;  2RQV A;  4F7U E;  1FXX A;  1Y7X A;  1QWE A;  2MAM A;  2RJF A;  4N0A C;  4GBQ A;  1WNL A;  2OAU A;  3CCV T;  3OB9 A;  1R0B G;  4C8Q F;  1RAD B;  3PIO A;  2GGR A;  1AD5 A;  1G3S A;  5GAN 3;  1I07 A;  3OYF A;  4Q5W A;  3DB4 A;  4HCZ A;  2K5L A;  1X6G A;  1WZO A;  1OEB A;  3G71 Q;  1UJ0 A;  1X27 A;  2JTE A;  1Y57 A;  2K2V A;  2XMF A;  1VQL A;  2E1H A;  1YNZ A;  3G7Z A;  3OYM A;  2JOY A;  1PNJ A;  1KSW A;  4IUR A;  1XOV A;  2EYQ A;  1M2O A;  4PFZ A;  2AT1 B;  2LMJ A;  3JCM V;  1GBR A;  3MJX A;  3X28 B;  5CK9 A;  2QEX Q;  3EG2 A;  2L3R A;  2C06 A;  2FO0 A;  3I9Q A;  1X75 C;  1QMC A;  2CYZ B;  4NL2 A;  4AFZ C;  1WHH A;  1K8A C;  1IRE B;  1VQ7 A;  2YUO A;  1OI1 A;  2XU8 A;  5LL6 S;  4PJO G;  1K9M U;  2DER A;  2DEU A;  3O5Z A;  1K76 A;  3CC4 T;  1PM3 A;  4CI0 C;  4LDY A;  2X35 A;  3OA6 A;  3HPW A;  2ATC B;  5GAM h;  3CMA Q;  2QDL A;  2JW4 A;  4NL3 A;  2RJC A;  2QQ9 A;  2CZ0 B;  2J6F A;  2VB6 A;  2M0Y A;  3X20 B;  1K1Z A;  2M16 A;  4JZ3 A;  1WXU A;  3R6O A;  5KYU A;  4E47 A;  5GAN 2;  3H0I A;  1D09 B;  4XU2 A;  1WFW A;  5C0M A;  2HQX A;  2E12 A;  2KQW A;  3OMC A;  1YIJ A;  2A36 A;  2L89 A;  1W1F A;  3M4Y A;  3RR6 A;  4GLK A;  2FPE A;  3JCM h;  2AZS A;  2KRS A;  4HCB A;  2GCX A;  1BBZ A;  4C92 C;  3ER0 A;  2PTK A;  1K9A A;  1H3Z A;  2HQE A;  4C92 E;  1KG1 A;  3CBP A;  1JO8 A;  1GBQ A;  4IUQ A;  3C4S A;  1AT1 B;  2KEA A;  2O2O A;  2EAY A;  4M75 F;  2QEX T;  1UHF A;  4J5Y A;  5FW9 A;  1TXQ A;  1VQN A;  1NPP A;  4JJB A;  4F7U F;  2MK5 A;  1QLY A;  2M9U A;  2FZK B;  2EWN A;  1KC8 R;  2M51 A;  1QKW A;  4J9F A;  4WF2 A;  1OQK A;  3CD6 A;  1VQM A;  3DLL A;  3OYE A;  2ED0 A;  1M5Q 1;  2GNC A;  2IPO B;  5GAM g;  4ME7 A;  1W4S A;  4ORZ A;  3C12 A;  4HKE A;  3PVL A;  3QYG B;  1IGU A;  1I0C A;  1RAE B;  3HRU A;  5KYY B;  3OW2 S;  2CP7 A;  3NPF A;  2YHT A;  2FB7 A;  3RUX A;  4M7D C;  3MEV A;  2EJ9 A;  5GAN f;  3EFS A;  2E3H A;  3NTH A;  3VYH B;  1HYO A;  5I22 A;  1D0Z A;  2KY9 A;  4AMC A;  3I35 A;  4DOW A;  3UA7 A;  4WTO B;  3UPU A;  4JLI A;  2M1H A;  5KYY A;  1M4Z A;  4LD9 K;  5IXF A;  4J9I A;  2IVW A;  1QP2 A;  1XNI A;  1JJ2 P;  3L2W A;  3M56 A;  2LCS A;  5CAI A;  2EJF A;  1YBY A;  4A54 A;  4M77 G;  1U1T A;  1Y96 B;  2EPD A;  4ZN3 A;  5FU7 C;  4XQ3 A;  1YP5 A;  2QA4 Q;  2DIG A;  3PMI A;  3CCQ Q;  4AG1 C;  2WSE E;  3RKW A;  4A4F A;  1TG0 A;  1TOV A;  3EHQ A;  1TUD A;  2LX7 A;  1RAF B;  4M77 C;  2DK3 A;  2DTH A;  3UT1 A;  4C8Q A;  5GAN 8;  1N6A A;  4KUD K;  2V8J A;  1PD0 A;  1BI3 A;  4KUL A;  1RI0 A;  4II1 A;  1S72 A;  4PJO B;  4BD3 A;  4C8Q C;  1VQN T;  2EQK A;  2LJ0 A;  1BIA A;  2YUN A;  2RPN A;  3M0U A;  2X4Y A;  3EGU A;  4L5G A;  5HCK A;  5GAM j;  3URG A;  1B34 B;  4C8Q G;  1RI9 A;  3M54 A;  4J7I A;  1SPK A;  5IHN A;  1BIB A;  2QGG A;  4JRK A;  4DBR A;  3F70 A;  3NFC A;  2QAS A;  4RTV A;  2J06 A;  3I55 T;  4CC4 B;  1LVK A;  1N27 A;  5J39 A;  3VS3 A;  2EKH A;  4BY6 B;  5GAN 6;  4DEX A;  2I0N A;  2OTL A;  1MNE A;  2NUT B;  3I5S A;  2GTO A;  1TUG B;  2DXU A;  2JM8 A;  4Z89 A;  1PKS A;  1VYU A;  4RTT A;  5DM7 R;  3S3O A;  2RHI A;  2DA9 A;  2QTX A;  3RES A;  2XI9 A;  2L8D A;  4QVZ A;  2L5Q A;  1PWT A;  2JMC A;  5ECA A;  4ESR A;  2FZG B;  1SSH A;  2K6D A;  5KH6 A;  4C8Q E;  4LDW A;  3FIF A;  2GFA A;  2XIC A;  4BY6 C;  4A4H A;  2X4W A;  1RAG B;  5GAN 4;  1PSE A;  3HP9 A;  2E10 A;  1WXB A;  4MDX A;  1UTI A;  1QVP A;  5A0D A;  2DPP B;  2MWP A;  5D6Y A;  2A7Y A;  2CUB A;  2X4J A;  3I55 Q;  4PNO A;  3OYC A;  2AK5 A;  3CCS Q;  1IZ6 A;  2MPX C;  3FJP A;  3H41 A;  2DKG A;  3PT9 A;  4M78 C;  2RK2 A;  4ZN1 A;  2RI2 A;  1S1N A;  2DYI A;  1ZBJ A;  2BUD A;  1ZHI A;  1UGV A;  2K3B A;  4RKU E;  4E7S A;  1U06 A;  2HL5 C;  3OBY A;  4M78 D;  1UE9 A;  1G83 A;  2JTF A;  2ROL A;  3QDR B;  3AHU A;  4AFU C;  2V1R A;  3BW1 A;  1EX4 A;  2RB6 A;  4MZT A;  3M0S A;  5LJ3 g;  4D6W A;  1XQH A;  4FIB A;  3GNG A;  2F2W A;  2YDL A;  5CKD A;  1N5Z A;  2X9H A;  2ECZ A;  2LNH B;  3MPU B;  4R56 A;  1KHI A;  4HVW A;  1Q7Y R;  3JV3 A;  3I5R A;  3P8D A;  2XDD A;  1WXT A;  3QYH B;  1JEG A;  1GRI A;  1KD1 U;  1TSF A;  3CCS T;  3AT1 B;  2C0T A;  1JXM A;  1VYT A;  1BU1 A;  1ARK A;  2RHZ A;  2WSC E;  2A0F B;  3REA B;  1BK2 A;  3LWI A;  1RAC B;  3MET A;  4EDU A;  2W0Z A;  2LVM A;  4N0A A;  1QWF A;  2OAW A;  1VQ9 T;  4M75 C;  3HRS A;  3HHT B;  1NM7 A;  1R8O B;  1WQ7 A;  1CSK A;  5LJ3 j;  2CZ1 B;  1ABO A;  3SWN A;  1NZ9 A;  3CD6 Q;  2X51 A;  2MI6 A;  1M1K C;  1VQ4 A;  2D8H A;  1YIT A;  1Q81 C;  2EGC A;  4AG2 C;  3CEY A;  1VIF A;  1YJN A;  2E5K A;  3MEA A;  4R0K A;  3CCR T;  4A53 A;  2K3Y A;  5KYU B;  4UC4 A;  4LDU A;  1QQJ A;  3CPW A;  1ACM B;  2RHU A;  2ED1 A;  3QG1 A;  2QDY B;  3QKJ A;  3G6E A;  1M90 U;  3GF5 A;  2DRK A;  5EG2 A;  2EJG A;  4B6M A;  1WYX A;  4BE0 A;  1YJN T;  2DO3 A;  2DE0 X;  2EQU A;  4C92 A;  4X9C A;  1QVF A;  2EBP A;  3CXC P;  3N5B B;  1QW1 A;  3VS1 A;  1KD1 R;  1SRL A;  1BI0 A;  2ZAE A;  3VKI A;  1B3Q A;  1MMD A;  2L3Q A;  1WHM A;  2KDS A;  1VQM T;  3MEW A;  1AWJ A;  2E6N A;  1CKB A;  2VXF A;  4PJL A;  5CKB A;  3CCJ A;  3E19 A;  2K57 A;  1K4U S;  1IXD A;  3X25 B;  4BB7 A;  2PUO B;  1MMG A;  2DVJ A;  2BIV A;  2RD1 A;  4IUV A;  4BI4 A;  2RHX A;  4C92 G;  5LJ3 d;  4XTU A;  4QQG A;  4QW2 A;  1GL5 A;  4GY5 A;  2HDA A;  4KGZ B;  3MCA B;  3JB9 H;  5A2Q E;  5CKF A;  3CCJ Q;  4M78 F;  3RMS A;  1OZ2 A;  1N8R R;  5IT9 E;  4C92 F;  2A3L A;  3EFR A;  3TU4 K;  4NS5 A;  1FMW A;  1VQ8 Q;  2F5T X;  3M9Q A;  2CKK A;  4PLI A;  4JS5 A;  1UEB A;  5GMK m;  1I1J A;  2LT1 A;  2NUP B;  2XK0 A;  2CZ7 B;  1YI2 T;  4FYY B;  5FWC A;  3QZ5 B;  2LJ3 A;  3HFO A;  3JSC A;  4ZNX A;  2JZ2 A;  3UWN A;  4OVA A;  3KUF A;  4L59 A;  2QG9 B;  1UGS B;  2MWO A;  3OYH A;  3CD6 T;  4JZ4 A;  1OZ3 A;  3A8O B;  1YWP A;  5HKC A;  1UHC A;  3CCM A;  2IIM A;  1M1G A;  4PL6 A;  1NYG A;  1KJW A;  3LW5 E;  3SDZ A;  2EYX A;  2YXY A;  1VQK T;  1PC0 A;  2BE9 B;  3CBM A;  1M27 C;  4OMF B;  2DEQ A;  3CC7 Q;  3IQL A;  2KRM A;  3J7A F;  4DQ2 A;  1YIT T;  2NUP A;  4PK4 A;  5IHK A;  5FWB A;  4M75 D;  3A98 A;  1JRI A;  2LRQ A;  4J9E A;  5LJ5 e;  1VQ5 T;  4KGV B;  2ZCF B;  5A0L A;  2CZ6 B;  3CCU Q;  2DZ9 A;  3QUI A;  1ZQ1 A;  3ASK A;  1UEC A;  5GAM d;  4VUB A;  1G3W A;  1JQQ A;  3OYG A;  2K5I A;  1W2B P;  3CCL T;  4AT1 B;  1YI2 Q;  2OTJ A;  2KRO A;  5I2M A;  4C0D B;  2RQT A;  4BI3 A;  4KH1 B;  1VQL T;  2VWF A;  3EG9 A;  1K9M R;  3H9N A;  1WHK A;  3EFO A;  3MHX A;  2D6F A;  3OYD A;  4Y92 A;  2HBP A;  1AEY A;  5DY9 A;  1WI7 A;  2L0A A;  2R57 A;  5GAN 7;  4C8Q B;  2MMP A;  3EH2 A;  1BYM A;  1M30 A;  5GAN 5;  4M78 E;  3JB9 G;  2RO0 A;  1Q95 G;  3I56 Q;  1VQ5 A;  2Y90 A;  1T3S A;  1LJO A;  1KQ1 A;  3BDU A;  3OYY A;  3I56 A;  1VQ5 Q;  1VQ8 T;  2KGT A;  3V7C A;  3MP1 A;  1AOJ A;  4BDY A;  2KT8 A;  2RM4 A;  4M4Z A;  2ESW A;  2HNI A;  2QQS A;  2RF0 A;  3VJP A;  2CP5 A;  2MCN A;  2DM1 A;  2KRN A;  4PFO A;  4X1V A;  1VQ9 A;  1WA7 A;  2DL8 A;  2V8K A;  2VAS A;  1YIJ T;  3LX7 A;  3A8G B;  5A0G A;  1VQL Q;  2DZC A;  5KCH A;  3WXM B;  2Z0W A;  2KBT A;  4FM4 B;  2D0Q B;  3C94 A;  2MF2 A;  1GFD A;  2XDP A;  4XK8 E;  4RUG A;  3CCU A;  2B8A A;  4OP0 A;  1ZUY A;  4Y91 A;  3I56 T;  3QO3 A;  2RH2 A;  1HK9 A;  5GMK j;  3S6W A;  3I55 A;  1NJI U;  2JUF A;  3A8M B;  2XG8 D;  1NJI R;  3O8V A;  3G71 T;  1ZUU A;  1EIF A;  1VQ6 A;  1B7T A;  2O31 A;  1KFZ A;  2PVD B;  5GMK l;  4J9D A;  1RAH B;  1WJS A;  1WPY A;  4TVR A;  2QXF A;  4J9G A;  2RI5 A;  1G3Y A;  3VRY A;  4M7D B;  2P4R A;  2PZ1 A;  1GCQ C;  2XHC A;  1LOJ A;  3ZBD A;  1KC8 C;  1MUZ A;  3QII A;  3NGP A;  3TRE A;  4J9B A;  2DJZ A;  2J6K A;  1VQO T;  3G4S A;  1JBM A;  1VIE A;  4FW2 A;  5AT1 B;  1VQ4 T;  5I11 A;  1UFF A;  5DLQ E;  2J6O A;  2OTJ Q;  1KQS P;  2LC4 A;  3L2Q A;  3X26 B;  1M90 C;  3RKY A;  3ULR B;  2MYS A;  2KYM A;  3JCM d;  1SG5 A;  4RTY A;  3EG1 A;  2EQJ A;  4KGX B;  1TUC A;  2KSS A;  1S72 T;  3TQ7 P;  2RQR A;  4C5I A;  5GMK h;  1I81 A;  1NYF A;  3CC4 Q;  2LTO A;  4JRP A;  1Y71 A;  4DBQ A;  4R55 A;  1W70 A;  3V8J A;  1SEM A;  4OB3 B;  4OML A;  3CCE T;  3EGD A;  4CC3 A;  4EMK A;  1UB4 A;  2HSE B;  2JMA A;  4KUI A;  2M0O A;  1M3A A;  1SKU B;  5CIU A;  2KYB A;  3JCM X;  5IH2 A;  3MEU A;  2QAZ A;  2VGN A;  3JB9 I;  1D0X A;  1VQO Q;  4CRI A;  1C0M A;  2NLU A;  4K11 A;  3QJY A;  1ZLM A;  2BE7 D;  4KRT A;  2W10 A;  3PMT A;  3V7S A;  3INZ A;  2V8I A;  3JCM Q;  4EMK B;  4XU0 A;  5EC7 A;  2BTT A;  1M8M A;  5GAM f;  3SHW A;  4OF1 A;  2FHD A;  1YJW A;  4EMH A;  1T0J A;  4ZGD B;  2A37 A;  4QQ6 A;  2NWM A;  1AWW A;  4Z8A A;  5D7U A;  2RJE A;  3KBG A;  2JNG A;  2DXT A;  2O88 A;  4HT9 A;  5LJ5 j;  3REB B;  2EFI A;  3A8H B;  3FB9 A;  2AKK A;  2L2P A;  2GFU A;  3JCM b;  3GIB A;  4CC2 A;  2EGA A;  1K0S A;  1BKB A;  1KD1 C;  4M77 B;  4HCC A;  1WGS A;  2YUQ A;  2ZPF B;  4QVC A;  2HQH A;  4C92 B;  4O5V A;  1V76 A;  1UGP B;  4A4E A;  3UF4 A;  2OTJ T;  4QKU A;  1OYX A;  3LGL A;  1QVG P;  1KQ2 A;  1X69 A;  2PUK B;  2A08 A;  1LCK A;  1RAA B;  1CKA A;  5KE3 A;  2BZY A;  4DBF A;  3V8K A;  4E7I A;  5DLO A;  3FJ5 A;  3A1P A;  4NOY A;  3PE0 A;  1JJ2 A;  1RAI B;  4AFQ C;  3GP8 A;  2JXB A;  3VS5 A;  1X2K A;  1HSQ A;  1WJQ A;  1YHQ A;  4HT8 A;  1UUE A;  1K0X A;  1I5O B;  4ELY C;  3OYN A;  4DBH A;  3HFN A;  1Q82 C;  4M7A B;  1TH7 A;  3L2Z A;  5GAN j;  2FL7 A;  5GAO l;  1YHQ Q;  3C0C A;  2DL5 A;  1YFN A;  3SWN C;  3CPF A;  2E4H A;  4A63 B;  4F14 A;  3OYA A;  1PHT A;  2OTL T;  1K73 C;  3CCV Q;  2O9S A;  4F7U G;  3EFO B;  3CCS A;  4HVV A;  4IKF A;  2DVE A;  1B34 A;  1MV3 A;  4C0Z A;  2VXE A;  4OB1 B;  2FPD A;  3DLM A;  2J7I A;  4D8D A;  1TU0 B;  4J83 A;  5CO7 A;  5FRO A;  4E7L A;  3CCL A;  2O4X B;  1Z9Z A;  1YCY A;  1Q82 R;  1GCP A;  3FLG A;  3M5A A;  2AKL A;  5CQY A;  5LJ3 h;  4C5G A;  4OMQ A;  2KMT A;  1NE8 A;  2GQV A;  1WHL A;  3CMA T;  3ZEH A;  5I2S A;  3OS0 A;  1V29 B;  2CSQ A;  2P0Q A;  4IIM A;  2RQU A;  1YN8 A;  4BDZ A;  1ZX6 A;  2DXB A;  1VUB A;  3CME A;  2CP0 A;  3UDC A;  4FU6 A;  1EZZ B;  2DYB A;  2DAQ A;  4HCK A;  3S3M A;  3ZFJ A;  3T9N A;  3HRT A;  2KXC A;  1H8K A;  2RNA A;  2OTL Q;  1T3L A;  1NLO C;  1KIK A;  4PJO A;  4C0G A;  1I8F A;  4IUP A;  1N9S A;  3Q1J A;  1Q81 R;  4PJJ A;  4F7U B;  3VYG A;  2PNI A;  3M0Q A;  3OQ5 A;  1YJW Q;  1M90 R;  4PJO D;  3EG9 B;  2QEX A;  2JTM A;  2HSP A;  1N8R C;  4F04 B;  3RIR A;  5FRN A;  1G8X A;  4HVU A;  2CP2 A;  3EAE A;  1NLP C;  5KYN A;  5FU7 B;  2E3I A;  5CQX A;  2Y4Y A;  3QHS A;  1W6X A;  2JM9 A;  3E2U A;  1M1K U;  3JCM P;  4LD6 A;  1E6H A;  1GXI E;  4M7A C;  2PU9 B;  2L3S A;  4O6J A;  4IIO A;  2H3E B;  2QQB A;  1YHQ T;  3HTR A;  5LJ5 d;  4JJC A;  1K8A U;  4JLG A;  5KE2 A;  5GAO p;  3TEE A;  2QQR A;  3A5Z B;  2PVO B;  3RNJ A;  4RTW A;  1K9M C;  2P84 A;  4FT2 A;  4RG8 A;  2HZY A;  2KR3 A;  3D7S B;  3JRZ A;  4E7H A;  1YJW T;  1WQW A;  3QZ9 B;  4OB2 B;  4QVD A;  1MND A;  4JJD A;  1H3H A;  4FW1 A;  2MIO A;  1ZSZ C;  1F1B B;  3P8H A;  2HMA A;  4X34 A;  3CCM Q;  3NMZ C;  4N4I A;  1BB9 A;  3SEM A;  1UGR B;  3PTA A;  1HD3 A;  1IO6 A;  4JPB W;  3EGX A;  5KYW B;  1AZG B;  4E6R A;  2D1X A;  5CKH A;  2EIF A;  4M7D G;  1KQS A;  2EQM A;  4J7F A;  5L8R E;  2FZC B;  4MMK A;  1RAB B;  1QCO A;  1FYN A;  3EG3 A;  1AZE A;  2RK1 A;  3BDL A;  1ZSZ A;  3OW2 A;  1PKT A;  1M3B A;  3TSW A;  5AYF A;  2HL3 A;  1X6O A;  1BCO A;  4EMG A;  1WJR A;  1KK7 A;  4PJM A;  2J05 A;  1OPK A;  1OU8 A;  1ZBX A;  2VC8 A;  3EGX B;  5KYW A;  5GAN e;  4OMN A;  2HKN A;  4M7D A;  4XU3 A;  5LJ5 g;  2YRD A;  4LE9 A;  5KYX B;  3L1A A;  3CME Q;  4RCC A;  1BCM A;  5HK3 A;  3CCV A;  3H8Z A;  2E65 A;  6AT1 B;  4M7A G;  3CQT A;  3QDF A;  4DOV A;  2CH4 A;  3J81 E;  2RJD A;  1M1K R;  3CC7 A;  2F5K A;  2P4T A;  1IHW A;  3MO8 A;  1OUL A;  2H8H A;  1NEG A;  1IB8 A;  4PJN A;  3EG0 A;  4B9X A;  2DD5 A;  3L42 A;  5HK0 A;  3FRN A;  3CPW S;  4ZTJ A;  2LT4 A;  1VQN Q;  2ENM A;  1VQ9 Q;  3CXC A;  1ZUK A;  3OMG A;  4ELZ C;  3OYJ A;  4EMK C;  4RTU A;  3THK A;  1TWB A;  1WDX A;  2CSI A;  4M77 A;  3H0H A;  1OX9 A;  4HXJ A;  2EKO A;  3V7R A;  4E7Z A;  3ME9 A;  5LJ3 f;  1KC8 U;  3CCR Q;  1SHG A;  2DXC A;  1X6B A;  2FRW A;  3U23 A;  3OYI A;  3E9F A;  3CCQ T;  4CC7 A;  2HCK A;  1B07 A;  2LX9 A;  3JCM J;  2VVK A;  1M2V A;  9ATC B;  1D3B B;  2FPF A;  1H92 A;  1T0H A;  1H64 1;  4J6W A;  4FL6 A;  2DFU A;  3QWX X;  2QK0 A;  2FVU A;  1YCS B;  2YRV A;  5FRM A;  1JU5 C;  4X9D A;  3GPL A;  1BI2 A;  2YUP A;  3OYL A;  1QVG A;  2O9V A;  5M9O A;  2XD0 A;  1RUW A;  1VQM Q;  1PSF A;  3UAT A;  4PFP A;  3G1J A;  2AHJ B;  5I21 A;  2DMO A;  1D3B A;  3OYK A;  4XTV A;  3PFS A;  4QT7 A;  3HKS A;  2AIR B;  3RKX A;  1R77 A;  1Q86 C;  3OY9 A;  4JRI A;  2NYS A;  4M7A E;  4EPC A;  2KXD A;  1UGQ B;  2D9T A;  3CME T;  2ZPI B;  4M7D E;  5GAN d;  4KT0 E;  1X01 A;  1EFN A;  3VRZ A;  5IHI A;  2E64 A;  3OS1 A;  2ZGW A;  5GMK i;  3BE3 A;  2CGH A;  3QJ6 A;  1IHV A;  4M75 G;  1MV0 B;  2VV5 A;  2FRY A;  1G3T A;  4M7D D;  3LWH A;  2DET A;  5GAN h;  3VS2 A;  1D1C A;  2V1Q A;  1WHG A;  3JCM e;  4FYV B;  4ZGE B;  2EYY A;  2BZX A;  2OX7 A;  4OMM A;  2F2V A;  1QVG S;  4M77 E;  3TVT A;  3RMQ A;  4DA4 A;  4P5N A;  2COY A;  3M53 A;  1I4K 1;  4RTX A;  8ATC B;  1VYV A;  3QSU A;  4WCI A;  3DB3 A;  3G71 A;  4M78 A;  3QWY A;  1YIT Q;  2DBK A;  1K73 R;  1Y07 A;  3SB2 A;  3G4S Q;  5D6X A;  2CUD A;  2LQW A;  2CS7 A;  2YWW A;  2JS0 A;  2C0O A;  2QQA A;  3GLX A;  3OSV A;  2EQI A;  4F17 A;  4OB0 B;  4ANJ A;  3VS0 A;  4M75 B;  1TS9 A;  1FX7 A;  2GF7 A;  1Z9Q A;  2VUB A;  4FSX A;  2VKN A;  3MP6 A;  2YT6 A;  4N4G A;  4RCB A;  5GJW B;  1P92 A;  1Q7Y U;  3VU3 C;  5GAO m;  4M78 B;  4JRQ A;  1QKX A;  5C6S A;  4FSS A;  1GFC A;  1SSF A;  2YSQ A;  3VS6 A;  3DKM A;  3JCM c;  1AVZ C;  2QA4 T;  3QXE B;  4C5E A;  1FMV A;  2E5Q A;  2ABL A;  2LQK A;  3FDR A;  4HA8 A;  2L3P A;  3EHR A;  2YLC A;  1VQP Q;  2KI7 A;  1OOT A;  2RMO A;  5GAN g;  1VQO A;  2JVV A;  3G4S T;  4BUG A;  2A28 A;  5LJ5 f;  1SRM A;  4LXC A;  1YJN Q;  1ABQ A;  2COZ A;  4RG2 A;  4BI8 B;  4MZP A;  2LP5 A;  4V2S A;  4PJO C;  1QCF A;  2Y4X A;  2HD0 A;  1M8V A;  4C5H A;  4E7K A;  2NUT A;  3LYI A;  1UG1 A;  2JJ9 A;  5GMK e;  2F2X A;  3LLR A;  2KE9 A;  4PKC C;  2D8J A;  2DL7 A;  3KXT A;  1YIJ Q;  4MML A;  1JJ2 S;  1XTD A;  1WHJ A;  4LNP A;  3M57 A;  2KVQ G;  2FYK A;  2LDM A;  3JAM E;  2EYW A;  2R5A A;  2ZPH B;  3CCE A;  3E9G A;  4MDW A;  3KFV A;  4Z88 A;  4GLM A;  1ZSZ B;  3JB9 F;  7AT1 B;  1PCX A;  3QBY A;  4C8Q D;  1W2B S;  4XTY A;  2QYZ A;  4D8K A;  2EVR A;  3V8L A;  2KT1 A;  5GAO n;  3WVD B;  2I2L A;  4J6Y A;  3OBW A;  4KBM B;  2QGF B;  1NJI C;  2YRC A;  2K9G A;  4N4H A;  1KHC A;  2WSF E;  3R6N A;  2LJ1 A;  5KYX A;  5FU6 B;  3JB9 J;  2KAF A;  3L2V A;  1QP3 A;  3OS5 A;  1FWZ A;  1NG2 A;  2K4Y A;  3M0R A;  4JDS A;  3EGD B;  2WAC A;  1VQK A;  5HY6 A;  2R58 A;  2JN0 A;  4J9C A;  1VOM A;  4XAX B;  2CT3 A;  1VQ6 Q;  2FEI A;  1Q86 R;  1Q81 U;  4ZTF A;  3A8L B;  3C95 A;  2LCL A;  4BAC A;  1RLQ C;  3SFM A;  1UJY A;  4JS4 A;  3M0P A;  2DD4 A;  3CC7 T;  3BFM A;  3CCJ T;  2M02 A;  1VQP T;  3VS4 A;  5L23 A;  2DTO A;  2QA4 A;  4FYX B;  2CP3 A;  1MHN A;  2E70 A;  1PRL C;  1U1S A;  2DIL A;  2K3X A;  2K5F A;  2DX1 A;  2ZPG B;  1G5V A;  3CCU T;  1YI2 A;  3X24 B;  1S72 Q;  3HL8 A;  3BY7 A;  5IN1 A;  2OI3 A;  3OSS C;  4RTZ A;  2COW A;  1K8A R;  3CCL Q;  3RDV A;  2CRE A;  1RL2 A;  1SHF A;  2CH4 W;  2PVG B;  3GBQ A;  5IXB A;  4M77 F;  2DNU A;  2ZPB B;  3MKD A;  1VQ6 T;  5FLX E;  1OV3 A;  1A0N B;  3G6E T;  1X2Q A;  1VQ8 A;  4XU1 A;  1PD1 A;  3OYB A;  1Q86 U;  1WX6 A;  4AFS C;  4OMO A;  3EH1 A;  3PVQ A;  2CT4 A;  1O9S A;  4RMO A;  3CC2 A;  1D1B A;  1YWO A;  3VV0 A;  1V1C A;  4FCY A;  2ZZD A;  1C6V X;  2DJQ A;  4B9W A;  1UDL A;  1E7O A;  2EGE A;  2RQW A;  3FC3 A;  2DL3 A;  2P0P A;  4IUT A;  2QTV A;  1QVF S;  5CKE A; 
#chains in the Genus database with same CATH homology
 3NHN A;  1AEY A;  3PVL A;  2DL4 A;  1WI7 A;  2L0A A;  1I0C A;  4LUD A;  3H0F A;  1M30 A;  1FYN A;  3EG3 A;  1AZE A;  2K79 A;  3NPF A;  1PKT A;  1M3B A;  2FG0 A;  3TSW A;  4DEY A;  1T3S A;  1WLP B;  1WIE A;  2J05 A;  1OPK A;  5I22 A;  2KGT A;  4OMN A;  2X3X D;  1AOJ A;  2KT8 A;  1NEB A;  4M4Z A;  2ESW A;  2RF0 A;  4LE9 A;  1PRM C;  4LUE A;  2MCN A;  3I35 A;  2DM1 A;  1RLP C;  2KRN A;  4X1V A;  3UA7 A;  1WA7 A;  2LZ6 B;  1FMK A;  3CQT A;  2DL8 A;  2CH4 A;  5IXF A;  4J9I A;  1X43 A;  1HJD A;  2LCS A;  2AZV A;  2OJ2 A;  2H8H A;  1NEG A;  2KBT A;  1U3O A;  2NUZ A;  3EG0 A;  2HEQ A;  2EW3 A;  2C0I A;  2EPD A;  1GFD A;  1YP5 A;  4LN2 A;  4RUG A;  1M3C A;  4AG1 C;  1TG0 A;  2ENM A;  1ZUK A;  3EHQ A;  1TUD A;  2LX7 A;  1ZUY A;  4RTU A;  3THK A;  2DRM A;  1WDX A;  2CSI A;  2K2M A;  3H0H A;  4HXJ A;  2JT4 A;  1ZUU A;  1ZSG A;  1AWX A;  1SHG A;  2FRW A;  1X6B A;  2O31 A;  3U23 A;  1KFZ A;  4CC7 A;  2HCK A;  1B07 A;  2LJ0 A;  2VVK A;  2FPF A;  2YUN A;  4J9D A;  1AWO A;  1H92 A;  2RPN A;  1U5S A;  1T0H A;  2D0N A;  3M0U A;  3EGU A;  4J9G A;  2SEM A;  5HCK A;  3QWX X;  1YCS B;  2DF6 A;  3VRY A;  3UA6 A;  2P4R A;  2PZ1 A;  1GCQ C;  1JU5 C;  1MUZ A;  2YUP A;  1RI9 A;  3M0T A;  1SPK A;  3NGP A;  4J9B A;  2J6K A;  5IHN A;  2O9V A;  1J3T A;  1RUW A;  3UAT A;  4RTV A;  5I11 A;  1UFF A;  2J6O A;  2J06 A;  4CC4 B;  3ULR B;  2DMO A;  2EYZ A;  2KYM A;  3VS3 A;  2EKH A;  4DEX A;  2GTJ A;  4RTY A;  3EG1 A;  2I0N A;  4QT7 A;  1TUC A;  2DBM A;  4EIK A;  3I5S A;  2GTO A;  2JM8 A;  2RQR A;  4Z89 A;  1PKS A;  1VYU A;  1NYF A;  4RTT A;  2KXD A;  4J9H A;  1W70 A;  2DA9 A;  1SEM A;  1Y0M A;  4OML A;  1JXO A;  2K7A A;  4CC3 A;  1PWT A;  1EFN A;  3VRZ A;  2JMA A;  2JMC A;  5IHI A;  3LH5 A;  1M3A A;  2GBQ A;  5ECA A;  4ESR A;  1SSH A;  2KYB A;  2K6D A;  1MV0 B;  2FRY A;  5GJV B;  5IH2 A;  4OMP A;  3TSZ A;  2GQI A;  2JS2 A;  2BZ8 A;  2LQN A;  1E6G A;  1WXB A;  4K11 A;  3VS2 A;  1UTI A;  1VA7 A;  1ZLM A;  4F16 A;  2X3W D;  4KRT A;  2V1Q A;  2W10 A;  2CUB A;  2AK5 A;  2SRC A;  2EYY A;  5EC7 A;  2BTT A;  2BZX A;  1M8M A;  3H41 A;  3SHW A;  4OMM A;  2KNB B;  2F2V A;  2CDT A;  3ZL7 C;  1S1N A;  1T0J A;  1ZBJ A;  2A37 A;  3TVT A;  1OPL A;  2NWM A;  4RTX A;  1UGV A;  2K3B A;  1AWW A;  1VYV A;  1U06 A;  4WCI A;  4Z8A A;  3VS7 A;  3QWY A;  1UE9 A;  1G83 A;  2HBW A;  2ROL A;  2DBK A;  2O88 A;  4AFU C;  2V1R A;  3REB B;  2DLP A;  2AKK A;  2L2P A;  2CUD A;  2LQW A;  3M0S A;  4CC2 A;  2JS0 A;  2C0O A;  2EGA A;  1K0S A;  1GCQ A;  2EQI A;  2G6F X;  2YUQ A;  4F17 A;  2F2W A;  2YDL A;  2RN8 A;  1N5Z A;  2ROT A;  3VS0 A;  2ECZ A;  2LNH B;  1Z9Q A;  2VKN A;  3UF4 A;  4HVW A;  2YT6 A;  3JV3 A;  5GJW B;  2B86 A;  3I5R A;  1QKX A;  1WXT A;  1X69 A;  2A08 A;  1JEG A;  1GRI A;  1LCK A;  3RBB B;  2C0T A;  1JXM A;  1CKA A;  4FSS A;  1GFC A;  1VYT A;  1BU1 A;  1ARK A;  2YSQ A;  1G2B A;  2BZY A;  3VS6 A;  3REA B;  2MOX A;  1BK2 A;  1AVZ C;  3FJ5 A;  2RQV A;  3PE0 A;  2W0Z A;  2ABL A;  2L3P A;  4AFQ C;  3EHR A;  1QWE A;  1QWF A;  2JXB A;  2OAW A;  4GBQ A;  3VS5 A;  1X2K A;  1NM7 A;  1OOT A;  2RMO A;  1HSQ A;  2GGR A;  1AD5 A;  1CSK A;  1I07 A;  2A28 A;  1ABO A;  1SRM A;  1UUE A;  1ABQ A;  1K0X A;  2LP5 A;  1X6G A;  2D8H A;  1OEB A;  2EGC A;  4AG2 C;  1UJ0 A;  1X27 A;  1QCF A;  2E5K A;  2JTE A;  1Y57 A;  4R0K A;  2XMF A;  1YNZ A;  3C0C A;  2DL5 A;  4A63 B;  4F14 A;  1PNJ A;  1PHT A;  1UG1 A;  1KSW A;  2ED1 A;  1XOV A;  2F2X A;  2KE9 A;  2O9S A;  2D8J A;  2DL7 A;  2DRK A;  4HVV A;  2LMJ A;  4LNP A;  1MV3 A;  1WYX A;  2FPD A;  1GBR A;  2DE0 X;  2J7I A;  4D8D A;  2EYW A;  3EG2 A;  2EBP A;  1Z9Z A;  2FO0 A;  3KFV A;  3VS1 A;  1GCP A;  1SRL A;  3I9Q A;  4GLM A;  4Z88 A;  2AKL A;  1B3Q A;  2L3Q A;  4OMQ A;  4AFZ C;  1AWJ A;  1CKB A;  1K4U S;  4D8K A;  2EVR A;  2KT1 A;  2DVJ A;  2YUO A;  2CSQ A;  4IIM A;  2RQU A;  1YN8 A;  2K9G A;  3R6N A;  2LJ1 A;  1ZX6 A;  3O5Z A;  1GL5 A;  1K76 A;  2HDA A;  1NG2 A;  3M0R A;  2DYB A;  4HCK A;  2KXC A;  1H8K A;  4J9C A;  2QDL A;  2RNA A;  2JW4 A;  1T3L A;  1NLO C;  1KIK A;  2J6F A;  2CT3 A;  2M0Y A;  2FEI A;  1K1Z A;  4JZ3 A;  1WXU A;  1RLQ C;  2PNI A;  3M0Q A;  1UJY A;  3H0I A;  2HSP A;  1WFW A;  1I1J A;  3M0P A;  4HVU A;  1NLP C;  2A36 A;  1W1F A;  3VS4 A;  5FWC A;  2LJ3 A;  5L23 A;  4ZNX A;  2FPE A;  2KRS A;  2AZS A;  1W6X A;  2JM9 A;  1BBZ A;  1PRL C;  1E6H A;  2DIL A;  2PTK A;  4JZ4 A;  2L3S A;  1K9A A;  1YWP A;  1UHC A;  2DX1 A;  4IIO A;  2IIM A;  1NYG A;  1KJW A;  2EYX A;  2OI3 A;  4JJC A;  4RTZ A;  1JO8 A;  1M27 C;  1GBQ A;  3IQL A;  2KRM A;  2CRE A;  2KEA A;  1SHF A;  2CH4 W;  2O2O A;  3GBQ A;  3RNJ A;  5IXB A;  5IHK A;  5FWB A;  2DNU A;  3A98 A;  4RTW A;  4J9E A;  2KR3 A;  1OV3 A;  1UHF A;  1A0N B;  5FW9 A;  1X2Q A;  4JJB A;  1WX6 A;  4AFS C;  1QLY A;  1UEC A;  4OMO A;  4JJD A;  1H3H A;  2MIO A;  1JQQ A;  2CT4 A;  3PVQ A;  2M51 A;  1QKW A;  4J9F A;  2KRO A;  3NMZ C;  1BB9 A;  3SEM A;  2RQT A;  1YWO A;  1HD3 A;  1V1C A;  1IO6 A;  4JPB W;  2VWF A;  2DJQ A;  2ED0 A;  2GNC A;  1AZG B;  1UDL A;  1E7O A;  2EGE A;  4E6R A;  2RQW A;  2D1X A;  2DL3 A;  4Y92 A;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...