3FIFA

Crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
SDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized lipoprotein ygdR
publication title Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli k-12
total genus 4
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fifA00
4JRIA 4XTWA 4C92F 4F7UE 4M7AA 3QHSA 4C8QB 4J6WA 5LJ5g 5LJ3j 4F7UF 4M78A 4C8QE 5GAMe 4N0AC 4EMHA 5GMKj 1X01A 1BIBA 4C92A 4M77E 3VU3C 2YLBA 5GANd 4C8QF 4M75G 4XTYA 4JUVA 2EAYA 1KQ2A 4M78B 4XU1A 4NOYA 4F7UA 3JCMb 4PJOE 3BY7A 3INZA 4XU0A 2DKGA 2DZ9A 1TH7A 4C92B 3JCMW 2Y90A 2DTIA 2E10A 4RCBA 4JLIA 3JB9H 5GANh 1WQWA 4C8QA 1D3BB 4X9DA 1N9RA 3JCMd 4M7AC 2DTHA 2EJFA 2EWNA 2HNIA 5LJ3g 1HK9A 4M7DE 4M7AG 2RM4A 4MMKA 2EJGA 1LJOA 4HT9A 4M75D 2QTXA 4M78C 5I21A 5GAN8 4WF2A 5GMKl 2E1HA 4C92C 5LJ5d 4M77B 1LOJA 3JCMh 5GAOp 1YCYA 4QVDA 1N9SA 3FJPA 3QSUA 3HFOA 2DXTA 4PJOB 5GMKh 1Y96B 4XTVA 3V8LA 1LNXA 3HSBA 3SB2A 4Y91A 2DTOA 3GIBA 4M7AD 3M4GA 2RD1A 5GAMg 5LJ5h 5GAN7 1D3BA 4M77F 1U1TA 1I5LA 4C8QC 2VXFA 2VXEA 3JCMJ 4M7DB 1BIAA 1H641 2E65A 3L2ZA 2I2LA 3RUXA 3HFNA 3JCMV 4PJOF 4XTXA 4NL2A 3SWNB 4OP0A 3V8JA 3RIRA 4M75E 5LJ3d 4A54A 5GAMj 1WPYA 3JCMf 4M77A 3BFMA 5GAOr 4PJOC 2DJZA 4J6YA 3RERA 5GANe 4M7DF 2K57A 3FIFA 4M75F 4XU2A 3JB9G 1I81A 4EMKA 4PJOA 1Y96A 4A53A 4M78G 4M7DC 4EMGA 1JRIA 1B34B 2DXUA 3JB9I 5LJ5f 3BW1A 4X9CA 5LJ3h 4C92G 3QUIA 4J5YA 2DEQA 4M7AE 1KQ1A 4EMKB 5GAN3 4M7DA 1M8VA 4M75A 3RKWA 3JCMe 3RKYA 5GMKi 4F7UG 3L1AA 4PNOA 1U1SA 5GAN6 2FB7A 3JCMX 5GANf 5GAMd 3AHUA 3EFSA 3SWNA 4DQ2A 2YHTA 2E64A 5GMKe 1M5Q1 1JBMA 5GAN4 3JB9D 1I8FA 4M75B 4C8QG 4M77C 4JRKA 4M78D 1I4K1 5LJ5e 5CAIA 5GAN2 2CGHA 4M77G 3QO3A 4XU3A 5GAOq 4C92D 3FB9A 2FYKA 4HT8A 2E41A 4EMKC 3V7RA 5GAMh 1B34A 5LJ3f 4XTUA 2VC8A 4J6XA 1WQ7A 4PJOG 3JCMQ 4XQ3A 2RA2A 3EFRA 4QVCA 3JCMP 4M7AB 1HXDA 2JN0A 5GAOm 4M75C 2ZGWA 5GANg 1WNLA 3V8KA 4C8QD 4M7DG 2DZCA 3RESA 1MGQA 3JCMc 4N0AA 3SWNC 3V7CA 5LJ5j 4M77D 5DY9A 5GMKm 4NL3A 3PGGA 5LJ3e 3RKXA 4M7AF 2EJ9A 4PJOD 3V7SA 4M78E 2DVEA 5GANj 5GAMf 2YLCA 4RCCA 5GAOn 3JCMg 4C92E 4F7UB 4MMLA 5GAN5 3JB9J 3JB9F 4V2SA 4M78F 5GAOl 2RB6A 4XTZA 4HA8A 3BDUA 4M7DD
chains in the Genus database with same CATH superfamily
4F7UE 8AT1B 1GFDA 4GBQA 4PL6A 1VQ7T 4M78A 1SRMA 2BTTA 2OTJT 2XMFA 4DBQA 3CCQA 3H8ZA 2O9VA 1BCMA 2LCSA 1G5VA 3INZA 2I0NA 4XU0A 2YRVA 4LD9K 4IUPA 3H6ZA 1WQWA 1D3BB 2HNIA 1RLQC 4IUUA 3FRNA 4M75D 5D6YA 5GMKl 2CUDA 3CCVQ 2X3XD 4X1VA 2K9GA 2DTOA 2D0QB 3GP8A 1FWZA 4M77F 2VXEA 2LVMA 4QQDA 4PJOF 1O9SA 2EKOA 2LMJA 4HKEA 3SWNB 2QQRA 1YJNT 5LJ3d 4XK8E 1PHTA 3OS2A 3RERA 1B7TA 1UB4A 2KYMA 1K1ZA 2DXUA 4FU6A 2LT1A 2RQWA 3RKWA 5GMKi 4F7UG 2JVVA 1WZOA 2NWMA 2M1HA 1VQOA 4ESRA 3P8HA 4CC4B 2X35A 2AZSA 3REAB 4KBMB 4KUIA 7AT1B 3QJ6A 1RADB 1G3WA 2J06A 1VQMQ 1WIEA 3OYKA 1Y57A 1VQ9A 4JRPA 1WJRA 4IIOA 2QA4T 5IXFA 2WSEE 3L2UA 1NLOC 3V7SA 4V2SA 3E9FA 3PMTA 4XTZA 2HMAA 2EQUA 2A36A 2F5TX 3CCUQ 2LNVA 5FRNA 2HDAA 4NS5A 3GNFB 3OMGA 4BE0A 1ABQA 1WLPB 3X20B 2L2PA 4ZTFA 2DKGA 4C92B 2XI9A 2D1XA 3CPWP 2CP5A 5GANh 2XKOC 1N9RA 2CSIA 1JO8A 1RAGB 1R0CB 3G4ST 1WHMA 3EGUA 1Y07A 3PIOA 5KYYA 2GGRA 4IUVA 5GJWB 4PFPA 2NLUA 2W0ZA 3JCMh 1UGVA 2ABLA 2DX1A 1YCYA 3QWXX 2YWWA 1HYOA 1KIKA 1WFWA 1VQKQ 4J9BA 1FMVA 3G6EA 3PTAA 2EGCA 2CP2A 2QDYB 2DYIA 2DRKA 1NBEB 2QYZA 1H8KA 1RABB 2O4XA 5C0MA 1O75A 3BW1A 3DKMA 5IXBA 1KFZA 4DOVA 1M8VA 4M75A 3L1AA 4PNOA 5IH2A 3JCMX 3G71T 1JBMA 3JB9D 1I8FA 5GAN2 2L0AA 2XG8D 1IGUA 3RMQA 2FYKA 2C0OA 5LJ3f 2VC8A 4JJCA 4OMNA 1WJQA 1OPLA 3VRZA 3OW2P 2O88A 1C6VX 2LQWA 3C4SA 3CCMT 2KGTA 2XDPA 1YFNA 3EAEA 2DAQA 2GF7A 5CQXA 3GF5A 5D7UA 2OJ2A 4M78F 4FYYB 4C0DB 1V1CA 5KH6A 3CMAT 1VQ6T 5FWBA 2KBTA 4BY6C 2WSFE 3CD6T 5KYYB 2HSEB 2LNHB 4J83A 3CCJQ 5GANd 1MUZA 3LH5A 4BDYA 2C0IA 4NOYA 3OBWA 3VS4A 3JCMd 1VQOQ 2DTHA 1K8AU 1HK9A 2JOYA 4N4HA 3UATA 1MNEA 3HL8A 1K4US 2SRCA 3C94A 2FO0A 3HRSA 4BI3A 1YJ9Q 1H3HA 1RAEB 2RI3A 2O4XB 2K3YA 4M7AD 4R56A 2NYSA 1QP2A 2RJFA 3A1PA 1KC8C 1Q81C 1VQ4Q 2EBPA 3E9GA 3MKDA 4RTTA 3NFCA 3G7ZA 4A4KA 4BACA 2EQKA 1QQJA 4L5GA 4OP0A 1AHJB 3JSCA 1VQPT 4ANJA 1BBZA 3S3NA 4XU2A 3EHQA 2DNUA 1IHWA 2IIMA 5I11A 1OI1A 3RKYA 1XOVA 4ATOA 1HSQA 1ZLMA 2M02A 1SPKA 2DL7A 3CC2T 5KCOA 4HVUA 1LPLA 1N27A 1SHFA 3FB9A 4HT8A 2K2VA 1UGPB 4A4HA 2L3QA 1QCFA 2RA2A 1JJ2S 4KULA 4QVCA 1AEYA 5HCKA 2KT1A 2V8JA 2O9SA 3A8LB 4C8QD 5CKHA 3M0PA 3OS5A 2E3HA 1Q82U 1Q82R 4M78E 1VQ8A 1I1JA 5KYXA 1YJWT 3OYIA 1VQLT 4M7DD 1QLYA 1H3ZA 4C5EA 1IRXA 2WSCE 1PG5B 2JS0A 1X01A 2CYZB 4ME7A 1E6HA 1ZA1B 4XTYA 3GBQA 2EAYA 1UJYA 2E5QA 1Q7YR 3LGLA 4LXCA 4CC3A 2KAFA 1PC0A 1LCKA 2PUOB 2D8JA 2KR3A 1LJOA 1UUEA 1UJ0A 1QW1A 4J9IA 4BE1A 1VQ7Q 1BI2A 3FJPA 1K0XA 2FPEA 2OTJQ 4LDUA 1RAIB 4QW2A 2P4RA 1D09B 3OYMA 2J6FA 2CP3A 2X3WD 3JCMf 5KYWA 2EYXA 2F2VA 4J6YA 1N8RU 4M75F 1N8RR 2ZZDA 5LL6S 4A53A 4M78G 3OW2A 2FG0A 3VRYA 4EMKB 2JTEA 5GAN3 1M1KC 2QEXT 4Y28E 1XQHA 1OOTA 3WXMB 5GAN6 1X43A 5GMKe 4LUEA 3PVQA 2FEIA 1QVGS 1YJNQ 3QO3A 1BK2A 1X6GA 5KYXB 3CMAA 2NUZA 1PSEA 3EH2A 4MDWA 3OYAA 5IAYA 2DZCA 2LDMA 2QTVA 4HVWA 2EW3A 1W70A 5DY9A 1EFNA 4DBFA 2AK5A 2OAWA 5L23A 2DVEA 3AT1B 2R58A 2M16A 4OMQA 4FYWB 5A0GA 4XTWA 3A8OB 3PMIA 4J6WA 1Q86R 3MEUA 2V8KA 2BE9B 2KDSA 1HJDA 3CCVA 4A63B 1QWFA 3ASKA 3H0FA 5GMKj 3CXCS 1K9AA 3VU3C 1RI0A 3GNGA 2JMCA 1VA7A 1YWPA 2QA4Q 2EYWA 3MHXA 4F04B 2DM1A 3ME9A 5FU7C 2FZKB 1PD1A 4E7SA 4C8QA 3M0UA 4Z89A 2DXBA 1VQPA 2ZPHB 1KQSS 4FYXB 5HKCA 2GTOA 3VS0A 1WJSA 1M3BA 4R55A 2QGFB 4DOWA 4O6JA 5KYWB 3BE3A 1K9MC 4IUTA 1W2BA 2RJCA 3CCSA 2LJ3A 1LNXA 2CUBA 3GIBA 1UHCA 3CC2A 4FW1A 3JCMJ 1TSFA 1ZUUA 1H641 4PKCC 2ECZA 1JQQA 4D8KA 1NJIC 3G4SQ 4M75E 3OYHA 1VUBA 5FWCA 3OYFA 4PJOC 4FT4A 1K0SA 3FIFA 1I81A 2COYA 2JW4A 5AYFA 3OYJA 3OQ5A 4JS4A 1HD3A 4IURA 3HKSA 1M90R 3PFSA 4DQ2A 3UT1A 1EX4A 3OYCA 1YIJT 5LJ5e 3TCJA 4LD6A 2LJ0A 4XQ3A 2YSQA 2D8HA 2BZYA 1RAHB 1HXDA 3VKIA 4PFZA 1M3CA 3LX7A 2DXCA 4OF1A 2LX7A 1RACB 2VGNA 2VB6A 2ZPFB 3RKXA 4RUGA 3MP6A 2OTLT 1TWBA 1XJWB 1VIEA 2YLCA 4RCCA 3JB9F 1GCPA 1BCOA 2X4JA 4RMOA 2NUPA 4C8QB 1VYUA 2CS7A 1YP5A 2L3SA 2RJEA 3QYHB 3ZL7C 3LYIA 2YRCA 1KG1A 2P0QA 2JMAA 1NEBA 4M75G 1SG5A 4OGCA 4X34A 2HL3A 2LJ1A 3X25B 3C95A 3M54A 2JS2A 2DE0X 4E6RA 1GRIA 1TTHB 2JTMA 3CCLA 2YT6A 5CKBA 2EJGA 1PKSA 2QTXA 3DB3A 3CMAQ 1VQ6Q 2YUQA 2H8HA 4QVDA 3Q1JA 3MO8A 4KH0B 1A0NB 3EG9A 3SB2A 1U1TA 2P0PA 3RUXA 3JCMV 1AD5A 4PLIA 3V8JA 2WACA 5GAOr 3BFMA 4L59A 2MMPA 5KYUA 4AG2C 4ZN3A 3A8MB 3TREA 1WXBA 3NHNA 2HQEA 2YDLA 5IHNA 3H41A 4DEXA 1ZHIA 3CC7T 3EFSA 2DL8A 1AZEA 2DYBA 2GQIA 2KY9A 3EH1A 1MMDA 5CAIA 2RHIA 3OBYA 3SD4A 1VQPQ 4QKUA 1S72T 3JCMQ 1G83A 1FX7A 1M2VA 2NUPB 3E2UA 3CCJA 1SKUB 3CMET 2VUBA 2YUOA 3CCSQ 4JPBW 2DA9A 3CC2Q 1QVFS 3META 1NE8A 3FEOA 4HCBA 2X9HA 2EFIA 3EGXA 3CCET 2V1QA 3H9NA 4J8OA 5LJ5g 3RMSA 5CKFA 1X6OA 1CSKA 2DO3A 1YJ9A 1OV3A 3VS3A 4C8QF 1XNIA 2KROA 4M78B 2ROLA 1VQ4A 2XK0A 3OYEA 3WVEB 3D7SB 3SHWA 3EG9B 2E10A 3CCRT 4X9DA 1VQLQ 4RTUA 1D0XA 2MF2A 3X26B 2RM4A 1JB0E 2J6KA 1PCXA 4C92C 5ECAA 4TVRA 4AFSC 4OMLA 2DD4A 2DXTA 1LVKA 4JJDA 1UGQB 2QQAA 2YUNA 2D6FA 3J81E 9ATCB 3OYYA 3OMCA 4ZGDB 1C1AA 2CH4W 4E7ZA 1NPPA 3OSVA 4Z8AA 1TOVA 2MI6A 3JB9G 2RQUA 3UWNA 3L2VA 3VS2A 2RI5A 2QXFA 4ZN1A 1E7OA 2EQJA 3QUIA 4M7AE 2KE9A 3U23A 3DLLA 3HPWA 2KRMA 1M4ZA 2X4XA 4RTXA 2Y4YA 2F2WA 5GAOq 2FHDA 2E41A 3CCLQ 3J80E 1VQNT 2YXYA 1OULA 2GFAA 3E19A 4JZ3A 1W4SA 2EQMA 2COZA 2MCNA 3OYLA 3TSZA 1JJ2P 2HL5C 1TXQA 3A8GB 1PKTA 2PZ1A 3EGDA 2ZPIB 2PUKB 4BE2A 2L89A 1MMNA 1VQ7A 5LJ3j 2OI3A 4QVZA 4C8QE 1QKWA 2ZCFB 2OTJA 4QQ6A 4HCKA 2QK0A 4C0DC 4LNPA 1UGRB 2BZXA 2CZ0B 2HKNA 3M5AA 4C5HA 2E12A 4J7IA 1P92A 2ED1A 4M7DE 2D0NA 4M7AG 1K8AC 1WHKA 5I21A 1V76A 4XAXB 2L3PA 2LRQA 3EHRA 3M58A 3NMZC 2RF0A 2VVKA 1KD1U 1GXIE 1KD1R 3IQLA 5GMKh 2OAUA 3CC7A 3CEYA 2LX9A 1T0HA 1ZX6A 1TS9A 1BI0A 2E65A 2CP7A 1YJNA 4NL2A 2RO0A 4JZ4A 3CC4T 1S72A 5FU6B 4FT2A 3HRTA 3KUFA 1D1CA 1AWXA 3PE0A 2QI2A 4X9CA 2LTOA 4J5YA 1KQ1A 4BD3A 2X51A 1MV3A 4E2FB 1UEBA 1D1AA 4JJBA 2A0FB 4PK4A 1NEGA 4M75B 4C8QG 3CQTA 3N5BB 2CGHA 2K4YA 2KT8A 4OGEA 3L2RA 3M59A 3E1SA 3EGDB 2YRDA 1BU1A 2DRMA 3A98A 1QVGP 2GFUA 2CH4A 3JCMP 1VQ5T 2FRYA 1R77A 1G3SA 4M7DG 3CPWS 2DL5A 2ENMA 2QA4A 3VS5A 1QVPA 4M77D 3M0QA 1W2BP 3L42A 3THKA 1GCQC 1Q82C 4PJOD 2CT3A 3GOXA 2A08A 2EPDA 3ZEHA 3QDRB 3QYGB 4MMLA 2XICA 4HA8A 3BDUA 2K79A 4IUQA 4GY5A 1M30A 4RKUE 1TUGB 5GAMe 1R0BG 3NTIA 5I22A 2BE7D 1KC8R 1Q81R 1OZ3A 2DD5A 3BY7A 4BUGA 3CXCP 2HEQA 3JCMW 2OTLQ 2L3RA 1GFCA 2DTIA 4CC7A 2CZ1B 2E6ZA 3VV0A 2QQBA 2KK4A 1YITT 3G4SA 2RK2A 2RMOA 4RTYA 3NTKA 2RJDA 4M4ZA 3RNJA 2AHJB 2LZ6B 2MIOA 5DLOA 4BI4A 1KQSP 1IGQA 2KSSA 2CKKA 2DF6A 2KI7A 4J9CA 4J9FA 1YI2T 4N4IA 2JZ2A 5LJ5h 5D6XA 1Q7YU 3I55T 1KK7A 4OB1B 1IB8A 3GLXA 4A54A 5GAMj 2VGMA 3CBMA 1JXMA 1SEMA 3ZBDA 3EFOA 2F2XA 3CCUT 2RNAA 4RTVA 4EMGA 2GNCA 1JJ2A 1AWJA 1GBQA 5GJVB 2XD0A 4II1A 2FPDA 3G71A 3EG0A 5GANf 4MZPA 4VUBA 5GAN4 2YHTA 3CBPA 1QCOA 4UC4A 1C0MA 1NZ9A 4B9XA 4XU3A 4LDXA 4EMKC 1J3TA 4JJNK 2E6NA 4KGXB 3TSWA 4DEYA 1ZUYA 2FZGB 1AWWA 2LP5A 4RG8A 4J9EA 5A2QE 3QKJA 3CCMA 2G6FX 2VV5A 3KFVA 1K73U 1K73R 3CC7Q 1SSFA 4JRQA 1VQKT 1WI7A 2MYSA 4MDXA 3O5ZA 1AT1B 2JM9A 4M7AA 3OS0A 2BIVA 1VYVA 1VQ6A 1SRLA 3HP9A 2RPNA 1S72Q 4B9WA 2P0KA 3CD6A 4BDZA 2HBPA 2QQSA 1UHFA 4N0AC 3DB4A 4PJNA 1RL2A 2DBMA 1Y0MA 3CMEQ 4K11A 3CCQT 2DLPA 2XDDA 3M0SA 3M56A 3QBYA 3QXEB 2EJFA 3MP1A 1KSWA 1UE9A 3CCEQ 5FROA 2A3LA 2P84A 1Q86U 2E1HA 5LJ5d 3OY9A 4J9DA 2JUFA 3EFOB 4YTLA 3FJ5A 1SHGA 2LQNA 4KT0E 2RD1A 5GAMg 3OYGA 2L5QA 2GTJA 2K5LA 2H3EB 3L2ZA 2MWPA 4JDSA 4OMPA 5CCAA 1ZSGA 4WTOB 3VJPA 2K3XA 1YBYA 3I5SA 1QVGA 2ZPGB 1M3AA 1NLPC 4ORZA 5KCHA 1VQ5A 2DJQA 1NM7A 3LGFA 4KRTA 1UTIA 1F1BB 2CZ6B 4M7DA 2GBQA 3QPHA 2JNGA 1QKXA 2CDTA 2FB7A 2FRWA 3S6WA 4JLGA 2SEMA 1ZSZA 3WVDB 4M77C 3DLMA 3RR6A 1IREB 1JEGA 4C92D 2COWA 3V7RA 2KRNA 2EIFA 4FCYA 4J6XA 5D6WA 5FU7B 1PRLC 3P8BB 3NGPA 5J39A 1VQ9T 4M7AB 1ZUKA 2J7IA 2ZGWA 1IXDA 3V8KA 3CXCA 1M90U 1WXTA 2FPFA 1D1BA 2EVRA 2MAMA 1YJWA 5GAOn 1VQLA 5CKDA 4FSSA 1XTDA 2DMOA 3OYNA 1QVFP 1KQSA 3I9QA 1T3LA 4OB3B 2CZ7B 5CK9A 4WCIA 3SFMA 3BDLA 4E7LA 2V8IA 2ESWA 2XU8A 4JUVA 3VUBA 4XU1A 5HY6A 3I55A 2DZ9A 5CR2A 2IG0A 3G71Q 2Y90A 1NJIU 5CKEA 1NJIR 1GBRA 2EWNA 2PQWA 3OYDA 1WX6A 2F5KA 3OS1A 5GAOp 1N9SA 5KYNA 1QWEA 1YNZA 8ATCB 2ED0A 2KQWA 1IZ6A 2MK5A 3CCMQ 1PSFA 2VYTA 4M7DB 2DL3A 4CC2A 1W6XA 4RG2A 1Y71A 2K5IA 3CBOA 4PJLA 4HVVA 1ZSZB 3G6ET 3L2QA 3SDZA 2FVUA 1IHVA 3CD6Q 5C6SA 5LJ5f 3RDVA 3CPFA 3A8HB 4MZMA 2QEXA 3M57A 2EYZA 5IHKA 2E64A 2KEAA 1M5Q1 4L6V5 1BYMA 2BUDA 1TUDA 1SSHA 1PM3A 3NTHA 2RHZA 3HRUA 2EKHA 3CC4Q 5IN1A 5J26A 4C5IA 4LE9A 1WQ7A 3EFRA 2O2OA 2DVJA 2FZCB 4EIKA 4ZGJB 1WNLA 1ZQ1A 2LT4A 3V7CA 3SWNC 4D8DA 3PGGA 1T0JA 4C0GA 2V1RA 4M7AF 1EIFA 1RUWA 2LQKA 2L8DA 5IHIA 2ATCB 4ZNXA 2RB6A 4B6MA 4PJJA 3NPFA 1I07A 2DIQA 2LCLA 4EPCA 1MMGA 3A5ZB 2E3IA 1VQ5Q 2AKLA 1BIBA 2X4YA 4C92A 3O8VA 2EYYA 4JS5A 1TG0A 4DBHA 2RQRA 3UF4A 4AG1C 2JXBA 2QGGA 1RAFB 2JJ9A 1MHNA 4MZTA 2E70A 2RI2A 2A28A 3I56T 4HCZA 4FSXA 1OU8A 4A4EA 2AZVA 2RHYA 1PD0A 5DLQE 1H92A 2HD0A 4HT9A 2Y4XA 2F69A 4M78C 2BZ8A 4C0FA 1Y7XA 2KXCA 5HK3A 3URGA 2ZPBB 4J7FA 1I5LA 3P8DA 2PTKA 1BIAA 3QIIA 1N5ZA 1YJWQ 4HCCA 3UPUA 1YITQ 2DPPB 1X2KA 2DIGA 3HTRA 4M7DF 1I5OB 2B86A 1Q95G 3TVTA 4E7HA 5KYUB 1YI2Q 2EGEA 2BKDN 3T9NA 1Z9QA 3I55Q 1YIJA 3PT9A 3M0TA 4F16A 3H0HA 2K3BA 4JRKA 2E5KA 1QVFA 1JXOA 2E4HA 2XHCA 5GAMh 1OX9A 3TQ7P 1NG2A 1PNJA 4J9HA 2JN0A 4F14A 4CRIA 4KUDK 3ULRB 1M2VB 4Z88A 3JCMc 3OA6A 1QMCA 3RBBB 2MOXA 5LJ3e 3VYGA 2OTLA 2LCCA 1VQ8T 3C0CA 2PVDB 4IIMA 5AT1B 5HK0A 2HKQB 2MPXC 2ZPEB 4LUDA 2HAXA 3JAME 1WHJA 3C12A 2VWFA 2XIDA 3EGXB 4M77E 1D0ZA 1Z9ZA 1WGSA 2KXDA 2RHXA 1ARKA 2DK3A 3UDCA 3JCMb 2QEXQ 1YWOA 4PJOE 3KXTA 1I0CA 3REBB 4JLIA 3QWYA 2W10A 1KHIA 1ZBXA 3VS6A 4ELZC 2K2MA 5FRMA 1M27C 4C0ZA 3HFOA 1KD1C 4Q5WA 5M9OA 4N4GA 3CCQQ 4EDUA 3J7AF 1WHHA 4R0KA 1BB9A 4RTWA 1V29B 1RI9A 1UG1A 2OX7A 2DERA 3FDRA 2KVQG 1WHLA 5FW9A 3UA6A 1Y96A 1ZA2B 3LWHA 3EG2A 3S3OA 5IT9E 1WHGA 5FU6C 5GAMd 1W1FA 3PIPA 1AWOA 1GCQA 5CIUA 4M77G 1YHQT 3L2WA 2JTFA 2JT4A 2DILA 1B34A 4PJOG 4PFOA 3JRZA 1BI1A 4M75C 3CMEA 1MGQA 1M2OA 2K7AA 5GMKm 4BY6B 2EGAA 3I56A 2K5FA 3UA7A 3LW5E 2PNIA 3FLGA 1K8AR 1B07A 1CKAA 3EG3A 2M51A 3M9QA 3CCEA 4C92F 4D6WA 1D0YA 1T3SA 5KE2A 1VQ9Q 3LLRA 3CCVT 4DBRA 2J6OA 1KQ2A 4AFQC 1TUCA 4F7UA 2KRSA 1MV0B 4E47A 3R6OA 1OPKA 1PWTA 5J3BA 3CCRA 1U06A 4RCBA 3JB9H 1YIJQ 1UFFA 5LJ3g 2VASA 3MPUB 2DFUA 1M1FA 3M0RA 4MMKA 2CREA 4WF2A 1U5SA 2AIRB 4LDWA 3MJXA 3M4YA 2FL7A 1Y96B 2D9TA 3V8LA 2HSPA 3CCST 2CP0A 4LDYA 4ZGEB 2RHUA 1KC8U 1Q81U 5DM7R 2QASA 3LH0A 1PRMC 3I5RA 3HFNA 1Q7YC 1RLPC 1E6GA 4AT1B 4F17A 2Z0WA 4ZTJA 4RTZA 4J9GA 3MEAA 3ZFJA 5GANe 1VQMT 1U8RA 4GLMA 4EMKA 2PU9B 4PLLA 5CQYA 1UGSB 1UECA 1B34B 1X75C 1R8OB 2GQVA 3MCAB 1IO6A 4CI0C 2RQVA 3JCMe 3CPWA 1FMWA 3MEWA 1U3OA 1FYNA 5I2SA 2B8AA 2HBWA 2F1LA 4LDVA 1I4K1 4PJMA 1M9SA 1ZBJA 3G6EQ 4IKFA 1VQNA 3OW2S 2X4WA 2R57A 3OYBA 1N8RC 1WA7A 3RESA 4N0AA 4NL3A 6AT1B 2RK1A 1VOMA 4HXJA 1K73C 5GANj 5GAMf 1UDLA 3SEMA 2CSQA 5EG2A 4F7UB 4C92E 3JB9J 5GAN5 3LWIA 5GAOl 4AFUC 4JRIA 3QHSA 1YN8A 1WYXA 2V26A 1FXXA 4OMOA 4FM4B 3VS7A 3M53A 2O31A 4O5VA 5FLXE 1NPRA 2HCKA 2YUPA 1KHCA 1AVZC 5A0DA 2JM8A 2RH2A 1TH7A 2M0YA 4AFZC 2P4TA 3PVLA 4A4GA 2VKNA 1GL5A 2AT1B 3CCLT 2C06A 1EZZB 2DEUA 1QP3A 1Q86C 1LOJA 2DL4A 3QSUA 3QZ5B 1CKBA 4XTVA 3HSBA 4Y91A 5GAN7 4OMMA 4E7IA 3S3MA 1OQKA 5L8RE 1AZGB 3I56Q 2K6DA 4FL6A 4XTXA 1BI3A 1YHQA 3CC4A 4FIBA 2NUTA 1WPYA 2LQ8A 4M77A 4QQGA 5KE3A 2DJZA 3MEVA 4PJOA 3ER0A 3R6NA 2ZAEA 4KH1B 3JB9I 1W2BS 3OB9A 4C92G 1M1KU 3X24B 1M1KR 2IPOB 1M1GA 3AHUA 1U1SA 3TU4K 2HQHA 2KYBA 2IVWA 4M78D 3CCRQ 2HZYA 3QJYA 2DBKA 1QCNA 3F70A 4E7JA 2CP6A 4XTUA 3JV3A 2RQTA 1VIFA 2M0OA 1MNDA 4Y92A 5GANg 3KBGA 4AMCA 3CCJT 4FYVB 4ELYC 1WDXA 1M90C 1N6AA 2G3RA 1TU0B 2EJ9A 4DA4A 4M7AC 3JCMg 4KGZB 1VQOT 1WXUA 2H3JA 3PNWC 1G8XA 1S1NA 3X28B 1OYXA 1K76A 1ACMB 1X6BA 1DJ7B 4F7UF 1G3YA 2QG9B 1OU9A 4EMHA 2O01E 2RN8A 3QDFA 2YLBA 2AKKA 1YJ9T 2A7YA 3VUZA 1VQ4T 1MMAA 4P5NA 1VQ8Q 1YITA 2ROTA 1OX8A 1VQMA 3MP8A 3HHTB 4C5GA 3H0IA 1NYGA 5GAN8 1VQNQ 2NUTB 4M77B 2XDBA 1X27A 1K9MU 1K9MR 4BB7A 4PJOB 3GPLA 4OMFB 1YI2A 1OEBA 1G2BA 3M4GA 3VS1A 1ABOA 1D3BA 4C8QC 2VXFA 5CVIA 2EQIA 2I2LA 1NYFA 3EG1A 2MWOA 3FC3A 1AOJA 3RIRA 2QDLA 2A37A 2R5MA 3CCUA 2R5AA 2K57A 3TEEA 3I35A 1YCSB 1B3QA 4M7DC 1JRIA 3QZ9B 2QQ9A 5LJ3h 5CO7A 2DEQA 2EYQA 1ZSZC 3M55A 4GLKA 3SWNA 1X69A 2PVOB 4OB0B 5EC7A 3QG1A 1OZ2A 2C0TA 2M9UA 4QT7A 2QAZA 4BI8B 4OVAA 2KNBB 5A0LA 1BKBA 4OB2B 2CT4A 2DETA 4Z02A 1VYTA 1G3TA 1SF9A 5GAOm 4FW2A 1M8MA 4A4FA 5I2MA 5LJ5j 2HQXA 3VYHB 4KGVB 4E7KA 2KMTA 3OSSC 1VQKA 2J05A 1KJWA 3G1JA 4LN2A 2LC4A 1X2QA 2PVGB 1JU5C 2GCXA 1RAAB 1FMKA 1YHQQ
chains in the Genus database with same CATH topology
4XTWA 4F7UE 2ZPEB 4IUQA 3A8OB 3PMIA 4J6WA 3MEUA 2V8KA 2HAXA 4PL6A 2KDSA 3JAME 3C12A 4GY5A 3CCVA 1VQ7T 4M78A 4RKUE 1S72T 2XIDA 5GAMe 3ASKA 5GMKj 3CXCS 3NTIA 4M77E 3VU3C 2OTJT 1RI0A 3GNGA 3CCQA 1WGSA 2RHXA 3H8ZA 2DK3A 3UDCA 3JCMb 4PJOE 1OZ3A 2DD5A 3BY7A 3INZA 3MHXA 4XU0A 4BUGA 3KXTA 2YRVA 3ME9A 3JCMW 5FU7C 2L3RA 2DTIA 2CZ1B 2E6ZA 3VV0A 4IUPA 4JLIA 2QQBA 2KK4A 1WQWA 3H6ZA 1D3BB 4C8QA 3G4SA 2RK2A 1YITT 2DXBA 2HNIA 1VQPA 2ZPHB 1KQSS 1KHIA 1ZBXA 3NTKA 4IUUA 2RJDA 5HKCA 4ELZC 3FRNA 4M75D 2AHJB 1WJSA 5D6YA 5DLOA 4R55A 5FRMA 4BI4A 5GMKl 4DOWA 4O6JA 4C0ZA 2KSSA 2CKKA 3HFOA 1K9MC 4IUTA 1KD1C 1W2BA 2RJCA 4Q5WA 3CCSA 1LNXA 5M9OA 4N4GA 4N4IA 1YI2T 3GIBA 2DTOA 2D0QB 4EDUA 3J7AF 2JZ2A 3GP8A 5LJ5h 1FWZA 4M77F 3CC2A 5D6XA 2VXEA 2LVMA 3JCMJ 4QQDA 1Q7YU 3I55T 4OB1B 1H641 1V29B 4PKCC 4PJOF 1O9SA 2EKOA 4HKEA 3SWNB 1NJIC 2QQRA 1YJNT 3FDRA 3GLXA 2KVQG 4M75E 1VUBA 4XK8E 5LJ3d 2VGMA 3CBMA 4A54A 5GAMj 3OYFA 3OYHA 3ZBDA 3OS2A 3RERA 4FT4A 3CCUT 3FIFA 1I81A 1UB4A 1Y96A 4EMGA 2DXUA 1JJ2A 5AYFA 3OYJA 3OQ5A 4FU6A 3LWHA 4JS4A 2LT1A 4IURA 3S3OA 2XD0A 3HKSA 3RKWA 3PFSA 4II1A 5IT9E 5GMKi 5FU6C 2JVVA 4F7UG 3G71A 5GANf 4MZPA 5GAMd 4VUBA 4DQ2A 5GAN4 2YHTA 3UT1A 2M1HA 3PIPA 3CBPA 1VQOA 3OYCA 1YIJT 3P8HA 4UC4A 5CIUA 1NZ9A 5LJ5e 2X35A 3TCJA 4KBMB 4KUIA 4M77G 4XU3A 4B9XA 4LDXA 1YHQT 4LD6A 3L2WA 3QJ6A 4EMKC 2JTFA 1G3WA 1B34A 4JJNK 2E6NA 4PJOG 3OYKA 4XQ3A 1VQ9A 4JRPA 1WJRA 3JRZA 1HXDA 1BI1A 3VKIA 4M75C 4RG8A 5A2QE 3CMEA 3QKJA 1MGQA 3LX7A 3CCMA 2DXCA 4OF1A 2VV5A 5GMKm 2QA4T 1K73U 2VGNA 2ZPFB 3RKXA 2WSEE 4BY6B 3L2UA 1SSFA 4JRQA 1VQKT 3MP6A 3I56A 2K5FA 3V7SA 4MDXA 2OTLT 1VIEA 2YLCA 4RCCA 3JB9F 3LW5E 4V2SA 3E9FA 3FLGA 3PMTA 4XTZA 3M9QA 2X4JA 4C92F 3CCEA 2EQUA 4RMOA 3OS0A 2BIVA 4C8QB 4M7AA 4D6WA 1VQ6A 3HP9A 5KE2A 2CS7A 2F5TX 4B9WA 2LNVA 2P0KA 3CD6A 2RJEA 3QYHB 4BDZA 5FRNA 3LLRA 2HBPA 2QQSA 3CCVT 4NS5A 4N0AC 3DB4A 3GNFB 1RL2A 3LYIA 3OMGA 4BE0A 1KG1A 2P0QA 4OGCA 4M75G 4X34A 3X20B 3CCQT 1KQ2A 2XDDA 4F7UA 3M56A 2DKGA 3X25B 4C92B 4E47A 3C95A 3R6OA 2XI9A 4ZTFA 3M54A 3QBYA 5J3BA 3CCRA 4RCBA 3JB9H 5GANh 2XKOC 1N9RA 3MP1A 2EJFA 3QXEB 5LJ3g 3G4ST 2JTMA 3CCLA 5CKBA 1Y07A 1M1FA 4MMKA 2EJGA 3PIOA 5FROA 2A3LA 2QTXA 3DB3A 4IUVA 1Q86U 4WF2A 2E1HA 5LJ5d 3OY9A 2NLUA 3JCMh 4LDWA 2JUFA 3OW2S 4YTLA 1YCYA 4QVDA 3Q1JA 3MO8A 3M4YA 2FL7A 1Y96B 2D9TA 3CC4A 3V8LA 3CCST 4LDYA 3SB2A 4ZGEB 2RHUA 1KC8U 4KT0E 1Q81U 2RD1A 5GAMg 3OYGA 2L5QA 5DM7R 1U1TA 2P0PA 3LH0A 2K5LA 3L2ZA 3RUXA 3HFNA 3JCMV 2MWPA 4JDSA 4PLIA 5CCAA 1Q7YC 3V8JA 2WACA 3VJPA 3G6EA 5GAOr 2K3XA 1YBYA 4ZTJA 3PTAA 3BFMA 1QVGA 3ZFJA 3MEAA 2ZPGB 2QDYB 4L59A 5GANe 1VQMT 5KCHA 1U8RA 1VQ5A 4EMKA 2PU9B 2MMPA 4ZN3A 3A8MB 4PLLA 5CQYA 1UGSB 2O4XA 1B34B 3TREA 1X75C 3LGFA 2HQEA 1O75A 3BW1A 1R8OB 3DKMA 4PJOC 2GQVA 3MCAB 2CZ6B 4DOVA 4CI0C 4M7DA 1M8VA 4M75A 3JCMe 3QPHA 3CPWA 2JNGA 1ZHIA 3L1AA 4PNOA 3JCMX 2FB7A 3MEWA 3S6WA 4JLGA 3G71T 3EFSA 3CC7T 1JBMA 5I2SA 2B8AA 3WVDB 1I8FA 3JB9D 2KY9A 4LDVA 4M77C 3DLMA 5GAN2 1I4K1 5CAIA 1IREB 2XG8D 3RMQA 2RHIA 3OBYA 3SD4A 4C92D 2FYKA 1M9SA 3V7RA 4IKFA 5LJ3f 1VQNA 2EIFA 2VC8A 4J6XA 5D6WA 5FU7B 2X4WA 3JCMQ 1FX7A 2R57A 3OYBA 3P8BB 5J39A 1VQ9T 4M7AB 1N8RC 1WJQA 3CCJA 2ZGWA 3V8KA 3RESA 3CMET 4N0AA 3CXCA 1M90U 2VUBA 3C4SA 2RK1A 2XDPA 4NL3A 3CCMT 3EAEA 2DAQA 2GF7A 1K73C 2MAMA 1YJWA 5CQXA 5GANj 5GAMf 1QVFS 5GAOn 1VQLA 5EG2A 4F7UB 3GF5A 4C92E 3META 1NE8A 3FEOA 5CKDA 5GAN5 3JB9J 3LWIA 4M78F 4HCBA 5GAOl 1XTDA 2EFIA 4C0DB 4JRIA 5KH6A 3OYNA 3CCET 3QHSA 1KQSA 4J8OA 3CMAT 1VQ6T 5LJ5g 4OB3B 3RMSA 4BY6C 1FXXA 2CZ7B 2WSFE 5CKFA 3CD6T 4FM4B 1X6OA 5CK9A 3SFMA 4J83A 2DO3A 3BDLA 1YJ9A 3M53A 5GANd 4E7LA 2V8IA 1XNIA 4O5VA 2XU8A 4C8QF 1NPRA 5FLXE 4JUVA 3VUBA 4M78B 4BDYA 1KHCA 4XU1A 4NOYA 1VQ4A 5A0DA 2XK0A 5HY6A 2DZ9A 2RH2A 1TH7A 2IG0A 3WVEB 5CR2A 3OYEA 3I55A 3OBWA 2Y90A 1NJIU 2E10A 5CKEA 3CCRT 2P4TA 4A4GA 4X9DA 3JCMd 2DTHA 2EWNA 2MF2A 2PQWA 1HK9A 3X26B 1K8AU 2JOYA 3OYDA 2RM4A 1JB0E 3CCLT 2C06A 4N4HA 2F5KA 3OS1A 3HL8A 3C94A 3HRSA 4C92C 1QP3A 1Q86C 1LOJA 5GAOp 4TVRA 3QSUA 1N9SA 4BI3A 2DD4A 2DXTA 3QZ5B 4XTVA 1UGQB 2RI3A 3HSBA 2O4XB 2K3YA 4Y91A 2KQWA 4R56A 4M7AD 2RJFA 1IZ6A 1QP2A 2QQAA 5GAN7 2D6FA 3J81E 4E7IA 1KC8C 5C0MA 3S3MA 1PSFA 2VYTA 3OYYA 1Q81C 3E9GA 3OMCA 4M7DB 3NFCA 3G7ZA 5L8RE 4A4KA 4ZGDB 2EQKA 4BACA 4FL6A 4XTXA 1BI3A 4RG2A 1YHQA 1Y71A 4L5GA 2K5IA 3CBOA 1NPPA 4FIBA 4OP0A 1AHJB 1WPYA 2LQ8A 3JSCA 4M77A 3OSVA 4QQGA 5KE3A 3G6ET 1VQPT 2DJZA 3MEVA 3L2QA 3S3NA 4XU2A 3SDZA 2FVUA 2MI6A 3JB9G 4PJOA 3ER0A 3UWNA 3JB9I 3L2VA 1W2BS 5C6SA 3OB9A 5LJ5f 2RI5A 2QXFA 4C92G 2EQJA 3QUIA 4ZN1A 1M1KU 4M7AE 3CPFA 3A8HB 3X24B 4MZMA 2QEXA 3M57A 1OI1A 3RKYA 1M1GA 1XOVA 4ATOA 3AHUA 1U1SA 3TU4K 3DLLA 2E64A 1M5Q1 3HPWA 1M4ZA 4L6V5 1BYMA 2X4XA 3CC2T 2BUDA 2Y4YA 2IVWA 4M78D 5KCOA 3QJYA 3NTHA 2RHZA 3HRUA 5GAOq 1N27A 3FB9A 4HT8A 2FHDA 3F70A 2E41A 2K2VA 5IN1A 4E7JA 1UGPB 4A4HA 5J26A 4C5IA 4XTUA 1WQ7A 3J80E 1VQNT 2RA2A 2GFAA 3EFRA 1JJ2S 4KULA 4QVCA 3E19A 1VIFA 2M0OA 1W4SA 2EQMA 2V8JA 4ZGJB 5GANg 1WNLA 3A8LB 1ZQ1A 3KBGA 4C8QD 5CKHA 4ELYC 3OYLA 3CCJT 2LT4A 3V7CA 3SWNC 3OS5A 3PGGA 1M90C 1Q82U 4C0GA 1N6AA 2G3RA 4M7AF 2EJ9A 3A8GB 4DA4A 4M78E 1EIFA 1VQ8A 1YJWT 2LQKA 2L8DA 4M7AC 3JCMg 3OYIA 1VQLT 1VQOT 2H3JA 2ZPIB 2RB6A 3PNWC 3X28B 1OYXA 4M7DD 2PUKB 4BE2A 2L89A 1H3ZA 2DIQA 2LCLA 4EPCA 4C5EA 3A5ZB 1DJ7B 2WSCE 4F7UF 5LJ3j 1VQ7A 1G3YA 4QVZA 4C8QE 4EMHA 1X01A 1BIBA 2O01E 2CYZB 2X4YA 2ZCFB 3O8VA 4ME7A 2YLBA 4C92A 4QQ6A 1YJ9T 2OTJA 4JS5A 2A7YA 4XTYA 2EAYA 4C0DC 1UGRB 3VUZA 1VQ4T 2CZ0B 2E5QA 3M5AA 3LGLA 2RI2A 1MHNA 4MZTA 2E70A 4C5HA 4P5NA 2KAFA 2E12A 4J7IA 1P92A 4HCZA 3I56T 4FSXA 1YITA 4A4EA 4M7DE 2PUOB 2RHYA 1G5VA 4M7AG 1VQMA 1K8AC 3MP8A 5DLQE 3HHTB 1LJOA 2HD0A 4C5GA 4HT9A 2Y4XA 5I21A 2F69A 4M78C 4XAXB 5GAN8 2LRQA 3M58A 1QW1A 4M77B 4C0FA 1Y7XA 4BE1A 2XDBA 1K9MU 1BI2A 1KD1U 1GXIE 3FJPA 4BB7A 5GMKh 4PJOB 3GPLA 4OMFB 5HK3A 2OAUA 1YI2A 3CC7A 4LDUA 4QW2A 3CEYA 2LX9A 3URGA 3M4GA 1D3BA 2ZPBB 4J7FA 4C8QC 3P8DA 3OYMA 2VXFA 5CVIA 1I5LA 1BIAA 3QIIA 1BI0A 2E65A 2I2LA 4HCCA 3UPUA 1YJNA 4NL2A 2DPPB 2MWOA 2RO0A 3RIRA 2DIGA 3FC3A 3CC4T 2R5MA 3JCMf 4LD9K 1S72A 5FU6B 3CCUA 4FT2A 4J6YA 2R5AA 1N8RU 4M7DF 2K57A 4M75F 3TEEA 2ZZDA 3HRTA 5LL6S 3KUFA 4A53A 4M78G 3OW2A 4M7DC 1JRIA 2QI2A 2QQ9A 3QZ9B 2LTOA 4X9CA 5LJ3h 4E7HA 4J5YA 2DEQA 5CO7A 1KQ1A 4EMKB 5GAN3 1M1KC 4BD3A 2QEXT 2EYQA 4Y28E 1XQHA 3M55A 1UEBA 3WXMB 5GAN6 2BKDN 4GLKA 3T9NA 3SWNA 5GMKe 2PVOB 1YIJA 3PT9A 4OB0B 4M75B 4C8QG 3QG1A 4JRKA 1OZ2A 1QVGS 3N5BB 2CGHA 2M9UA 3QO3A 2K4YA 4OGEA 1QVFA 3L2RA 3M59A 4BI8B 3CMAA 3E1SA 2XHCA 4OVAA 5GAMh 1PSEA 5A0LA 1BKBA 4OB2B 2GFUA 3JCMP 4Z02A 1VQ5T 1G3TA 2JN0A 4MDWA 4CRIA 5GAOm 1G3SA 3OYAA 4KUDK 4M7DG 5IAYA 3CPWS 2DZCA 2LDMA 5I2MA 4A4FA 3JCMc 5LJ5j 2QA4A 2HQXA 3VYHB 1QVPA 4M77D 5DY9A 3OA6A 4E7KA 2KMTA 3OSSC 5LJ3e 1VQKA 3L42A 3VYGA 1Q82C 2OTLA 4PJOD 2DVEA 2LCCA 2LC4A 3GOXA 1VQ8T 3ZEHA 2R58A 2PVGB 3QDRB 3QYGB 2M16A 2GCXA 4MMLA 2PVDB 2XICA 4HA8A 5HK0A 3BDUA 5A0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRI A;  4XTW A;  4C92 F;  4F7U E;  4M7A A;  3QHS A;  4C8Q B;  4J6W A;  5LJ5 g;  5LJ3 j;  4F7U F;  4M78 A;  4C8Q E;  5GAM e;  4N0A C;  4EMH A;  5GMK j;  1X01 A;  1BIB A;  4C92 A;  4M77 E;  3VU3 C;  2YLB A;  5GAN d;  4C8Q F;  4M75 G;  4XTY A;  4JUV A;  2EAY A;  1KQ2 A;  4M78 B;  4XU1 A;  4NOY A;  4F7U A;  3JCM b;  4PJO E;  3BY7 A;  3INZ A;  4XU0 A;  2DKG A;  2DZ9 A;  1TH7 A;  4C92 B;  3JCM W;  2Y90 A;  2DTI A;  2E10 A;  4RCB A;  4JLI A;  3JB9 H;  5GAN h;  1WQW A;  4C8Q A;  1D3B B;  4X9D A;  1N9R A;  3JCM d;  4M7A C;  2DTH A;  2EJF A;  2EWN A;  2HNI A;  5LJ3 g;  1HK9 A;  4M7D E;  4M7A G;  2RM4 A;  4MMK A;  2EJG A;  1LJO A;  4HT9 A;  4M75 D;  2QTX A;  4M78 C;  5I21 A;  5GAN 8;  4WF2 A;  5GMK l;  2E1H A;  4C92 C;  5LJ5 d;  4M77 B;  1LOJ A;  3JCM h;  5GAO p;  1YCY A;  4QVD A;  1N9S A;  3FJP A;  3QSU A;  3HFO A;  2DXT A;  4PJO B;  5GMK h;  1Y96 B;  4XTV A;  3V8L A;  1LNX A;  3HSB A;  3SB2 A;  4Y91 A;  2DTO A;  3GIB A;  4M7A D;  3M4G A;  2RD1 A;  5GAM g;  5LJ5 h;  5GAN 7;  1D3B A;  4M77 F;  1U1T A;  1I5L A;  4C8Q C;  2VXF A;  2VXE A;  3JCM J;  4M7D B;  1BIA A;  1H64 1;  2E65 A;  3L2Z A;  2I2L A;  3RUX A;  3HFN A;  3JCM V;  4PJO F;  4XTX A;  4NL2 A;  3SWN B;  4OP0 A;  3V8J A;  3RIR A;  4M75 E;  5LJ3 d;  4A54 A;  5GAM j;  1WPY A;  3JCM f;  4M77 A;  3BFM A;  5GAO r;  4PJO C;  2DJZ A;  4J6Y A;  3RER A;  5GAN e;  4M7D F;  2K57 A;  3FIF A;  4M75 F;  4XU2 A;  3JB9 G;  1I81 A;  4EMK A;  4PJO A;  1Y96 A;  4A53 A;  4M78 G;  4M7D C;  4EMG A;  1JRI A;  1B34 B;  2DXU A;  3JB9 I;  5LJ5 f;  3BW1 A;  4X9C A;  5LJ3 h;  4C92 G;  3QUI A;  4J5Y A;  2DEQ A;  4M7A E;  1KQ1 A;  4EMK B;  5GAN 3;  4M7D A;  1M8V A;  4M75 A;  3RKW A;  3JCM e;  3RKY A;  5GMK i;  4F7U G;  3L1A A;  4PNO A;  1U1S A;  5GAN 6;  2FB7 A;  3JCM X;  5GAN f;  5GAM d;  3AHU A;  3EFS A;  3SWN A;  4DQ2 A;  2YHT A;  2E64 A;  5GMK e;  1M5Q 1;  1JBM A;  5GAN 4;  3JB9 D;  1I8F A;  4M75 B;  4C8Q G;  4M77 C;  4JRK A;  4M78 D;  1I4K 1;  5LJ5 e;  5CAI A;  5GAN 2;  2CGH A;  4M77 G;  3QO3 A;  4XU3 A;  5GAO q;  4C92 D;  3FB9 A;  2FYK A;  4HT8 A;  2E41 A;  4EMK C;  3V7R A;  5GAM h;  1B34 A;  5LJ3 f;  4XTU A;  2VC8 A;  4J6X A;  1WQ7 A;  4PJO G;  3JCM Q;  4XQ3 A;  2RA2 A;  3EFR A;  4QVC A;  3JCM P;  4M7A B;  1HXD A;  2JN0 A;  5GAO m;  4M75 C;  2ZGW A;  5GAN g;  1WNL A;  3V8K A;  4C8Q D;  4M7D G;  2DZC A;  3RES A;  1MGQ A;  3JCM c;  4N0A A;  3SWN C;  3V7C A;  5LJ5 j;  4M77 D;  5DY9 A;  5GMK m;  4NL3 A;  3PGG A;  5LJ3 e;  3RKX A;  4M7A F;  2EJ9 A;  4PJO D;  3V7S A;  4M78 E;  2DVE A;  5GAN j;  5GAM f;  2YLC A;  4RCC A;  5GAO n;  3JCM g;  4C92 E;  4F7U B;  4MML A;  5GAN 5;  3JB9 J;  3JB9 F;  4V2S A;  4M78 F;  5GAO l;  2RB6 A;  4XTZ A;  4HA8 A;  3BDU A;  4M7D D; 
#chains in the Genus database with same CATH topology
 4F7U E;  8AT1 B;  1GFD A;  4GBQ A;  4PL6 A;  1VQ7 T;  4M78 A;  1SRM A;  2BTT A;  2OTJ T;  2XMF A;  4DBQ A;  3CCQ A;  3H8Z A;  2O9V A;  1BCM A;  2LCS A;  1G5V A;  3INZ A;  2I0N A;  4XU0 A;  2YRV A;  4LD9 K;  4IUP A;  3H6Z A;  1WQW A;  1D3B B;  2HNI A;  1RLQ C;  4IUU A;  3FRN A;  4M75 D;  5D6Y A;  5GMK l;  2CUD A;  3CCV Q;  2X3X D;  4X1V A;  2K9G A;  2DTO A;  2D0Q B;  3GP8 A;  1FWZ A;  4M77 F;  2VXE A;  2LVM A;  4QQD A;  4PJO F;  1O9S A;  2EKO A;  2LMJ A;  4HKE A;  3SWN B;  2QQR A;  1YJN T;  5LJ3 d;  4XK8 E;  1PHT A;  3OS2 A;  3RER A;  1B7T A;  1UB4 A;  2KYM A;  1K1Z A;  2DXU A;  4FU6 A;  2LT1 A;  2RQW A;  3RKW A;  5GMK i;  4F7U G;  2JVV A;  1WZO A;  2NWM A;  2M1H A;  1VQO A;  4ESR A;  3P8H A;  4CC4 B;  2X35 A;  2AZS A;  3REA B;  4KBM B;  4KUI A;  7AT1 B;  3QJ6 A;  1RAD B;  1G3W A;  2J06 A;  1VQM Q;  1WIE A;  3OYK A;  1Y57 A;  1VQ9 A;  4JRP A;  1WJR A;  4IIO A;  2QA4 T;  5IXF A;  2WSE E;  3L2U A;  1NLO C;  3V7S A;  4V2S A;  3E9F A;  3PMT A;  4XTZ A;  2HMA A;  2EQU A;  2A36 A;  2F5T X;  3CCU Q;  2LNV A;  5FRN A;  2HDA A;  4NS5 A;  3GNF B;  3OMG A;  4BE0 A;  1ABQ A;  1WLP B;  3X20 B;  2L2P A;  4ZTF A;  2DKG A;  4C92 B;  2XI9 A;  2D1X A;  3CPW P;  2CP5 A;  5GAN h;  2XKO C;  1N9R A;  2CSI A;  1JO8 A;  1RAG B;  1R0C B;  3G4S T;  1WHM A;  3EGU A;  1Y07 A;  3PIO A;  5KYY A;  2GGR A;  4IUV A;  5GJW B;  4PFP A;  2NLU A;  2W0Z A;  3JCM h;  1UGV A;  2ABL A;  2DX1 A;  1YCY A;  3QWX X;  2YWW A;  1HYO A;  1KIK A;  1WFW A;  1VQK Q;  4J9B A;  1FMV A;  3G6E A;  3PTA A;  2EGC A;  2CP2 A;  2QDY B;  2DYI A;  2DRK A;  1NBE B;  2QYZ A;  1H8K A;  1RAB B;  2O4X A;  5C0M A;  1O75 A;  3BW1 A;  3DKM A;  5IXB A;  1KFZ A;  4DOV A;  1M8V A;  4M75 A;  3L1A A;  4PNO A;  5IH2 A;  3JCM X;  3G71 T;  1JBM A;  3JB9 D;  1I8F A;  5GAN 2;  2L0A A;  2XG8 D;  1IGU A;  3RMQ A;  2FYK A;  2C0O A;  5LJ3 f;  2VC8 A;  4JJC A;  4OMN A;  1WJQ A;  1OPL A;  3VRZ A;  3OW2 P;  2O88 A;  1C6V X;  2LQW A;  3C4S A;  3CCM T;  2KGT A;  2XDP A;  1YFN A;  3EAE A;  2DAQ A;  2GF7 A;  5CQX A;  3GF5 A;  5D7U A;  2OJ2 A;  4M78 F;  4FYY B;  4C0D B;  1V1C A;  5KH6 A;  3CMA T;  1VQ6 T;  5FWB A;  2KBT A;  4BY6 C;  2WSF E;  3CD6 T;  5KYY B;  2HSE B;  2LNH B;  4J83 A;  3CCJ Q;  5GAN d;  1MUZ A;  3LH5 A;  4BDY A;  2C0I A;  4NOY A;  3OBW A;  3VS4 A;  3JCM d;  1VQO Q;  2DTH A;  1K8A U;  1HK9 A;  2JOY A;  4N4H A;  3UAT A;  1MNE A;  3HL8 A;  1K4U S;  2SRC A;  3C94 A;  2FO0 A;  3HRS A;  4BI3 A;  1YJ9 Q;  1H3H A;  1RAE B;  2RI3 A;  2O4X B;  2K3Y A;  4M7A D;  4R56 A;  2NYS A;  1QP2 A;  2RJF A;  3A1P A;  1KC8 C;  1Q81 C;  1VQ4 Q;  2EBP A;  3E9G A;  3MKD A;  4RTT A;  3NFC A;  3G7Z A;  4A4K A;  4BAC A;  2EQK A;  1QQJ A;  4L5G A;  4OP0 A;  1AHJ B;  3JSC A;  1VQP T;  4ANJ A;  1BBZ A;  3S3N A;  4XU2 A;  3EHQ A;  2DNU A;  1IHW A;  2IIM A;  5I11 A;  1OI1 A;  3RKY A;  1XOV A;  4ATO A;  1HSQ A;  1ZLM A;  2M02 A;  1SPK A;  2DL7 A;  3CC2 T;  5KCO A;  4HVU A;  1LPL A;  1N27 A;  1SHF A;  3FB9 A;  4HT8 A;  2K2V A;  1UGP B;  4A4H A;  2L3Q A;  1QCF A;  2RA2 A;  1JJ2 S;  4KUL A;  4QVC A;  1AEY A;  5HCK A;  2KT1 A;  2V8J A;  2O9S A;  3A8L B;  4C8Q D;  5CKH A;  3M0P A;  3OS5 A;  2E3H A;  1Q82 U;  1Q82 R;  4M78 E;  1VQ8 A;  1I1J A;  5KYX A;  1YJW T;  3OYI A;  1VQL T;  4M7D D;  1QLY A;  1H3Z A;  4C5E A;  1IRX A;  2WSC E;  1PG5 B;  2JS0 A;  1X01 A;  2CYZ B;  4ME7 A;  1E6H A;  1ZA1 B;  4XTY A;  3GBQ A;  2EAY A;  1UJY A;  2E5Q A;  1Q7Y R;  3LGL A;  4LXC A;  4CC3 A;  2KAF A;  1PC0 A;  1LCK A;  2PUO B;  2D8J A;  2KR3 A;  1LJO A;  1UUE A;  1UJ0 A;  1QW1 A;  4J9I A;  4BE1 A;  1VQ7 Q;  1BI2 A;  3FJP A;  1K0X A;  2FPE A;  2OTJ Q;  4LDU A;  1RAI B;  4QW2 A;  2P4R A;  1D09 B;  3OYM A;  2J6F A;  2CP3 A;  2X3W D;  3JCM f;  5KYW A;  2EYX A;  2F2V A;  4J6Y A;  1N8R U;  4M75 F;  1N8R R;  2ZZD A;  5LL6 S;  4A53 A;  4M78 G;  3OW2 A;  2FG0 A;  3VRY A;  4EMK B;  2JTE A;  5GAN 3;  1M1K C;  2QEX T;  4Y28 E;  1XQH A;  1OOT A;  3WXM B;  5GAN 6;  1X43 A;  5GMK e;  4LUE A;  3PVQ A;  2FEI A;  1QVG S;  1YJN Q;  3QO3 A;  1BK2 A;  1X6G A;  5KYX B;  3CMA A;  2NUZ A;  1PSE A;  3EH2 A;  4MDW A;  3OYA A;  5IAY A;  2DZC A;  2LDM A;  2QTV A;  4HVW A;  2EW3 A;  1W70 A;  5DY9 A;  1EFN A;  4DBF A;  2AK5 A;  2OAW A;  5L23 A;  2DVE A;  3AT1 B;  2R58 A;  2M16 A;  4OMQ A;  4FYW B;  5A0G A;  4XTW A;  3A8O B;  3PMI A;  4J6W A;  1Q86 R;  3MEU A;  2V8K A;  2BE9 B;  2KDS A;  1HJD A;  3CCV A;  4A63 B;  1QWF A;  3ASK A;  3H0F A;  5GMK j;  3CXC S;  1K9A A;  3VU3 C;  1RI0 A;  3GNG A;  2JMC A;  1VA7 A;  1YWP A;  2QA4 Q;  2EYW A;  3MHX A;  4F04 B;  2DM1 A;  3ME9 A;  5FU7 C;  2FZK B;  1PD1 A;  4E7S A;  4C8Q A;  3M0U A;  4Z89 A;  2DXB A;  1VQP A;  2ZPH B;  1KQS S;  4FYX B;  5HKC A;  2GTO A;  3VS0 A;  1WJS A;  1M3B A;  4R55 A;  2QGF B;  4DOW A;  4O6J A;  5KYW B;  3BE3 A;  1K9M C;  4IUT A;  1W2B A;  2RJC A;  3CCS A;  2LJ3 A;  1LNX A;  2CUB A;  3GIB A;  1UHC A;  3CC2 A;  4FW1 A;  3JCM J;  1TSF A;  1ZUU A;  1H64 1;  4PKC C;  2ECZ A;  1JQQ A;  4D8K A;  1NJI C;  3G4S Q;  4M75 E;  3OYH A;  1VUB A;  5FWC A;  3OYF A;  4PJO C;  4FT4 A;  1K0S A;  3FIF A;  1I81 A;  2COY A;  2JW4 A;  5AYF A;  3OYJ A;  3OQ5 A;  4JS4 A;  1HD3 A;  4IUR A;  3HKS A;  1M90 R;  3PFS A;  4DQ2 A;  3UT1 A;  1EX4 A;  3OYC A;  1YIJ T;  5LJ5 e;  3TCJ A;  4LD6 A;  2LJ0 A;  4XQ3 A;  2YSQ A;  2D8H A;  2BZY A;  1RAH B;  1HXD A;  3VKI A;  4PFZ A;  1M3C A;  3LX7 A;  2DXC A;  4OF1 A;  2LX7 A;  1RAC B;  2VGN A;  2VB6 A;  2ZPF B;  3RKX A;  4RUG A;  3MP6 A;  2OTL T;  1TWB A;  1XJW B;  1VIE A;  2YLC A;  4RCC A;  3JB9 F;  1GCP A;  1BCO A;  2X4J A;  4RMO A;  2NUP A;  4C8Q B;  1VYU A;  2CS7 A;  1YP5 A;  2L3S A;  2RJE A;  3QYH B;  3ZL7 C;  3LYI A;  2YRC A;  1KG1 A;  2P0Q A;  2JMA A;  1NEB A;  4M75 G;  1SG5 A;  4OGC A;  4X34 A;  2HL3 A;  2LJ1 A;  3X25 B;  3C95 A;  3M54 A;  2JS2 A;  2DE0 X;  4E6R A;  1GRI A;  1TTH B;  2JTM A;  3CCL A;  2YT6 A;  5CKB A;  2EJG A;  1PKS A;  2QTX A;  3DB3 A;  3CMA Q;  1VQ6 Q;  2YUQ A;  2H8H A;  4QVD A;  3Q1J A;  3MO8 A;  4KH0 B;  1A0N B;  3EG9 A;  3SB2 A;  1U1T A;  2P0P A;  3RUX A;  3JCM V;  1AD5 A;  4PLI A;  3V8J A;  2WAC A;  5GAO r;  3BFM A;  4L59 A;  2MMP A;  5KYU A;  4AG2 C;  4ZN3 A;  3A8M B;  3TRE A;  1WXB A;  3NHN A;  2HQE A;  2YDL A;  5IHN A;  3H41 A;  4DEX A;  1ZHI A;  3CC7 T;  3EFS A;  2DL8 A;  1AZE A;  2DYB A;  2GQI A;  2KY9 A;  3EH1 A;  1MMD A;  5CAI A;  2RHI A;  3OBY A;  3SD4 A;  1VQP Q;  4QKU A;  1S72 T;  3JCM Q;  1G83 A;  1FX7 A;  1M2V A;  2NUP B;  3E2U A;  3CCJ A;  1SKU B;  3CME T;  2VUB A;  2YUO A;  3CCS Q;  4JPB W;  2DA9 A;  3CC2 Q;  1QVF S;  3MET A;  1NE8 A;  3FEO A;  4HCB A;  2X9H A;  2EFI A;  3EGX A;  3CCE T;  2V1Q A;  3H9N A;  4J8O A;  5LJ5 g;  3RMS A;  5CKF A;  1X6O A;  1CSK A;  2DO3 A;  1YJ9 A;  1OV3 A;  3VS3 A;  4C8Q F;  1XNI A;  2KRO A;  4M78 B;  2ROL A;  1VQ4 A;  2XK0 A;  3OYE A;  3WVE B;  3D7S B;  3SHW A;  3EG9 B;  2E10 A;  3CCR T;  4X9D A;  1VQL Q;  4RTU A;  1D0X A;  2MF2 A;  3X26 B;  2RM4 A;  1JB0 E;  2J6K A;  1PCX A;  4C92 C;  5ECA A;  4TVR A;  4AFS C;  4OML A;  2DD4 A;  2DXT A;  1LVK A;  4JJD A;  1UGQ B;  2QQA A;  2YUN A;  2D6F A;  3J81 E;  9ATC B;  3OYY A;  3OMC A;  4ZGD B;  1C1A A;  2CH4 W;  4E7Z A;  1NPP A;  3OSV A;  4Z8A A;  1TOV A;  2MI6 A;  3JB9 G;  2RQU A;  3UWN A;  3L2V A;  3VS2 A;  2RI5 A;  2QXF A;  4ZN1 A;  1E7O A;  2EQJ A;  3QUI A;  4M7A E;  2KE9 A;  3U23 A;  3DLL A;  3HPW A;  2KRM A;  1M4Z A;  2X4X A;  4RTX A;  2Y4Y A;  2F2W A;  5GAO q;  2FHD A;  2E41 A;  3CCL Q;  3J80 E;  1VQN T;  2YXY A;  1OUL A;  2GFA A;  3E19 A;  4JZ3 A;  1W4S A;  2EQM A;  2COZ A;  2MCN A;  3OYL A;  3TSZ A;  1JJ2 P;  2HL5 C;  1TXQ A;  3A8G B;  1PKT A;  2PZ1 A;  3EGD A;  2ZPI B;  2PUK B;  4BE2 A;  2L89 A;  1MMN A;  1VQ7 A;  5LJ3 j;  2OI3 A;  4QVZ A;  4C8Q E;  1QKW A;  2ZCF B;  2OTJ A;  4QQ6 A;  4HCK A;  2QK0 A;  4C0D C;  4LNP A;  1UGR B;  2BZX A;  2CZ0 B;  2HKN A;  3M5A A;  4C5H A;  2E12 A;  4J7I A;  1P92 A;  2ED1 A;  4M7D E;  2D0N A;  4M7A G;  1K8A C;  1WHK A;  5I21 A;  1V76 A;  4XAX B;  2L3P A;  2LRQ A;  3EHR A;  3M58 A;  3NMZ C;  2RF0 A;  2VVK A;  1KD1 U;  1GXI E;  1KD1 R;  3IQL A;  5GMK h;  2OAU A;  3CC7 A;  3CEY A;  2LX9 A;  1T0H A;  1ZX6 A;  1TS9 A;  1BI0 A;  2E65 A;  2CP7 A;  1YJN A;  4NL2 A;  2RO0 A;  4JZ4 A;  3CC4 T;  1S72 A;  5FU6 B;  4FT2 A;  3HRT A;  3KUF A;  1D1C A;  1AWX A;  3PE0 A;  2QI2 A;  4X9C A;  2LTO A;  4J5Y A;  1KQ1 A;  4BD3 A;  2X51 A;  1MV3 A;  4E2F B;  1UEB A;  1D1A A;  4JJB A;  2A0F B;  4PK4 A;  1NEG A;  4M75 B;  4C8Q G;  3CQT A;  3N5B B;  2CGH A;  2K4Y A;  2KT8 A;  4OGE A;  3L2R A;  3M59 A;  3E1S A;  3EGD B;  2YRD A;  1BU1 A;  2DRM A;  3A98 A;  1QVG P;  2GFU A;  2CH4 A;  3JCM P;  1VQ5 T;  2FRY A;  1R77 A;  1G3S A;  4M7D G;  3CPW S;  2DL5 A;  2ENM A;  2QA4 A;  3VS5 A;  1QVP A;  4M77 D;  3M0Q A;  1W2B P;  3L42 A;  3THK A;  1GCQ C;  1Q82 C;  4PJO D;  2CT3 A;  3GOX A;  2A08 A;  2EPD A;  3ZEH A;  3QDR B;  3QYG B;  4MML A;  2XIC A;  4HA8 A;  3BDU A;  2K79 A;  4IUQ A;  4GY5 A;  1M30 A;  4RKU E;  1TUG B;  5GAM e;  1R0B G;  3NTI A;  5I22 A;  2BE7 D;  1KC8 R;  1Q81 R;  1OZ3 A;  2DD5 A;  3BY7 A;  4BUG A;  3CXC P;  2HEQ A;  3JCM W;  2OTL Q;  2L3R A;  1GFC A;  2DTI A;  4CC7 A;  2CZ1 B;  2E6Z A;  3VV0 A;  2QQB A;  2KK4 A;  1YIT T;  3G4S A;  2RK2 A;  2RMO A;  4RTY A;  3NTK A;  2RJD A;  4M4Z A;  3RNJ A;  2AHJ B;  2LZ6 B;  2MIO A;  5DLO A;  4BI4 A;  1KQS P;  1IGQ A;  2KSS A;  2CKK A;  2DF6 A;  2KI7 A;  4J9C A;  4J9F A;  1YI2 T;  4N4I A;  2JZ2 A;  5LJ5 h;  5D6X A;  1Q7Y U;  3I55 T;  1KK7 A;  4OB1 B;  1IB8 A;  3GLX A;  4A54 A;  5GAM j;  2VGM A;  3CBM A;  1JXM A;  1SEM A;  3ZBD A;  3EFO A;  2F2X A;  3CCU T;  2RNA A;  4RTV A;  4EMG A;  2GNC A;  1JJ2 A;  1AWJ A;  1GBQ A;  5GJV B;  2XD0 A;  4II1 A;  2FPD A;  3G71 A;  3EG0 A;  5GAN f;  4MZP A;  4VUB A;  5GAN 4;  2YHT A;  3CBP A;  1QCO A;  4UC4 A;  1C0M A;  1NZ9 A;  4B9X A;  4XU3 A;  4LDX A;  4EMK C;  1J3T A;  4JJN K;  2E6N A;  4KGX B;  3TSW A;  4DEY A;  1ZUY A;  2FZG B;  1AWW A;  2LP5 A;  4RG8 A;  4J9E A;  5A2Q E;  3QKJ A;  3CCM A;  2G6F X;  2VV5 A;  3KFV A;  1K73 U;  1K73 R;  3CC7 Q;  1SSF A;  4JRQ A;  1VQK T;  1WI7 A;  2MYS A;  4MDX A;  3O5Z A;  1AT1 B;  2JM9 A;  4M7A A;  3OS0 A;  2BIV A;  1VYV A;  1VQ6 A;  1SRL A;  3HP9 A;  2RPN A;  1S72 Q;  4B9W A;  2P0K A;  3CD6 A;  4BDZ A;  2HBP A;  2QQS A;  1UHF A;  4N0A C;  3DB4 A;  4PJN A;  1RL2 A;  2DBM A;  1Y0M A;  3CME Q;  4K11 A;  3CCQ T;  2DLP A;  2XDD A;  3M0S A;  3M56 A;  3QBY A;  3QXE B;  2EJF A;  3MP1 A;  1KSW A;  1UE9 A;  3CCE Q;  5FRO A;  2A3L A;  2P84 A;  1Q86 U;  2E1H A;  5LJ5 d;  3OY9 A;  4J9D A;  2JUF A;  3EFO B;  4YTL A;  3FJ5 A;  1SHG A;  2LQN A;  4KT0 E;  2RD1 A;  5GAM g;  3OYG A;  2L5Q A;  2GTJ A;  2K5L A;  2H3E B;  3L2Z A;  2MWP A;  4JDS A;  4OMP A;  5CCA A;  1ZSG A;  4WTO B;  3VJP A;  2K3X A;  1YBY A;  3I5S A;  1QVG A;  2ZPG B;  1M3A A;  1NLP C;  4ORZ A;  5KCH A;  1VQ5 A;  2DJQ A;  1NM7 A;  3LGF A;  4KRT A;  1UTI A;  1F1B B;  2CZ6 B;  4M7D A;  2GBQ A;  3QPH A;  2JNG A;  1QKX A;  2CDT A;  2FB7 A;  2FRW A;  3S6W A;  4JLG A;  2SEM A;  1ZSZ A;  3WVD B;  4M77 C;  3DLM A;  3RR6 A;  1IRE B;  1JEG A;  4C92 D;  2COW A;  3V7R A;  2KRN A;  2EIF A;  4FCY A;  4J6X A;  5D6W A;  5FU7 B;  1PRL C;  3P8B B;  3NGP A;  5J39 A;  1VQ9 T;  4M7A B;  1ZUK A;  2J7I A;  2ZGW A;  1IXD A;  3V8K A;  3CXC A;  1M90 U;  1WXT A;  2FPF A;  1D1B A;  2EVR A;  2MAM A;  1YJW A;  5GAO n;  1VQL A;  5CKD A;  4FSS A;  1XTD A;  2DMO A;  3OYN A;  1QVF P;  1KQS A;  3I9Q A;  1T3L A;  4OB3 B;  2CZ7 B;  5CK9 A;  4WCI A;  3SFM A;  3BDL A;  4E7L A;  2V8I A;  2ESW A;  2XU8 A;  4JUV A;  3VUB A;  4XU1 A;  5HY6 A;  3I55 A;  2DZ9 A;  5CR2 A;  2IG0 A;  3G71 Q;  2Y90 A;  1NJI U;  5CKE A;  1NJI R;  1GBR A;  2EWN A;  2PQW A;  3OYD A;  1WX6 A;  2F5K A;  3OS1 A;  5GAO p;  1N9S A;  5KYN A;  1QWE A;  1YNZ A;  8ATC B;  2ED0 A;  2KQW A;  1IZ6 A;  2MK5 A;  3CCM Q;  1PSF A;  2VYT A;  4M7D B;  2DL3 A;  4CC2 A;  1W6X A;  4RG2 A;  1Y71 A;  2K5I A;  3CBO A;  4PJL A;  4HVV A;  1ZSZ B;  3G6E T;  3L2Q A;  3SDZ A;  2FVU A;  1IHV A;  3CD6 Q;  5C6S A;  5LJ5 f;  3RDV A;  3CPF A;  3A8H B;  4MZM A;  2QEX A;  3M57 A;  2EYZ A;  5IHK A;  2E64 A;  2KEA A;  1M5Q 1;  4L6V 5;  1BYM A;  2BUD A;  1TUD A;  1SSH A;  1PM3 A;  3NTH A;  2RHZ A;  3HRU A;  2EKH A;  3CC4 Q;  5IN1 A;  5J26 A;  4C5I A;  4LE9 A;  1WQ7 A;  3EFR A;  2O2O A;  2DVJ A;  2FZC B;  4EIK A;  4ZGJ B;  1WNL A;  1ZQ1 A;  2LT4 A;  3V7C A;  3SWN C;  4D8D A;  3PGG A;  1T0J A;  4C0G A;  2V1R A;  4M7A F;  1EIF A;  1RUW A;  2LQK A;  2L8D A;  5IHI A;  2ATC B;  4ZNX A;  2RB6 A;  4B6M A;  4PJJ A;  3NPF A;  1I07 A;  2DIQ A;  2LCL A;  4EPC A;  1MMG A;  3A5Z B;  2E3I A;  1VQ5 Q;  2AKL A;  1BIB A;  2X4Y A;  4C92 A;  3O8V A;  2EYY A;  4JS5 A;  1TG0 A;  4DBH A;  2RQR A;  3UF4 A;  4AG1 C;  2JXB A;  2QGG A;  1RAF B;  2JJ9 A;  1MHN A;  4MZT A;  2E70 A;  2RI2 A;  2A28 A;  3I56 T;  4HCZ A;  4FSX A;  1OU8 A;  4A4E A;  2AZV A;  2RHY A;  1PD0 A;  5DLQ E;  1H92 A;  2HD0 A;  4HT9 A;  2Y4X A;  2F69 A;  4M78 C;  2BZ8 A;  4C0F A;  1Y7X A;  2KXC A;  5HK3 A;  3URG A;  2ZPB B;  4J7F A;  1I5L A;  3P8D A;  2PTK A;  1BIA A;  3QII A;  1N5Z A;  1YJW Q;  4HCC A;  3UPU A;  1YIT Q;  2DPP B;  1X2K A;  2DIG A;  3HTR A;  4M7D F;  1I5O B;  2B86 A;  1Q95 G;  3TVT A;  4E7H A;  5KYU B;  1YI2 Q;  2EGE A;  2BKD N;  3T9N A;  1Z9Q A;  3I55 Q;  1YIJ A;  3PT9 A;  3M0T A;  4F16 A;  3H0H A;  2K3B A;  4JRK A;  2E5K A;  1QVF A;  1JXO A;  2E4H A;  2XHC A;  5GAM h;  1OX9 A;  3TQ7 P;  1NG2 A;  1PNJ A;  4J9H A;  2JN0 A;  4F14 A;  4CRI A;  4KUD K;  3ULR B;  1M2V B;  4Z88 A;  3JCM c;  3OA6 A;  1QMC A;  3RBB B;  2MOX A;  5LJ3 e;  3VYG A;  2OTL A;  2LCC A;  1VQ8 T;  3C0C A;  2PVD B;  4IIM A;  5AT1 B;  5HK0 A;  2HKQ B;  2MPX C;  2ZPE B;  4LUD A;  2HAX A;  3JAM E;  1WHJ A;  3C12 A;  2VWF A;  2XID A;  3EGX B;  4M77 E;  1D0Z A;  1Z9Z A;  1WGS A;  2KXD A;  2RHX A;  1ARK A;  2DK3 A;  3UDC A;  3JCM b;  2QEX Q;  1YWO A;  4PJO E;  3KXT A;  1I0C A;  3REB B;  4JLI A;  3QWY A;  2W10 A;  1KHI A;  1ZBX A;  3VS6 A;  4ELZ C;  2K2M A;  5FRM A;  1M27 C;  4C0Z A;  3HFO A;  1KD1 C;  4Q5W A;  5M9O A;  4N4G A;  3CCQ Q;  4EDU A;  3J7A F;  1WHH A;  4R0K A;  1BB9 A;  4RTW A;  1V29 B;  1RI9 A;  1UG1 A;  2OX7 A;  2DER A;  3FDR A;  2KVQ G;  1WHL A;  5FW9 A;  3UA6 A;  1Y96 A;  1ZA2 B;  3LWH A;  3EG2 A;  3S3O A;  5IT9 E;  1WHG A;  5FU6 C;  5GAM d;  1W1F A;  3PIP A;  1AWO A;  1GCQ A;  5CIU A;  4M77 G;  1YHQ T;  3L2W A;  2JTF A;  2JT4 A;  2DIL A;  1B34 A;  4PJO G;  4PFO A;  3JRZ A;  1BI1 A;  4M75 C;  3CME A;  1MGQ A;  1M2O A;  2K7A A;  5GMK m;  4BY6 B;  2EGA A;  3I56 A;  2K5F A;  3UA7 A;  3LW5 E;  2PNI A;  3FLG A;  1K8A R;  1B07 A;  1CKA A;  3EG3 A;  2M51 A;  3M9Q A;  3CCE A;  4C92 F;  4D6W A;  1D0Y A;  1T3S A;  5KE2 A;  1VQ9 Q;  3LLR A;  3CCV T;  4DBR A;  2J6O A;  1KQ2 A;  4AFQ C;  1TUC A;  4F7U A;  2KRS A;  1MV0 B;  4E47 A;  3R6O A;  1OPK A;  1PWT A;  5J3B A;  3CCR A;  1U06 A;  4RCB A;  3JB9 H;  1YIJ Q;  1UFF A;  5LJ3 g;  2VAS A;  3MPU B;  2DFU A;  1M1F A;  3M0R A;  4MMK A;  2CRE A;  4WF2 A;  1U5S A;  2AIR B;  4LDW A;  3MJX A;  3M4Y A;  2FL7 A;  1Y96 B;  2D9T A;  3V8L A;  2HSP A;  3CCS T;  2CP0 A;  4LDY A;  4ZGE B;  2RHU A;  1KC8 U;  1Q81 U;  5DM7 R;  2QAS A;  3LH0 A;  1PRM C;  3I5R A;  3HFN A;  1Q7Y C;  1RLP C;  1E6G A;  4AT1 B;  4F17 A;  2Z0W A;  4ZTJ A;  4RTZ A;  4J9G A;  3MEA A;  3ZFJ A;  5GAN e;  1VQM T;  1U8R A;  4GLM A;  4EMK A;  2PU9 B;  4PLL A;  5CQY A;  1UGS B;  1UEC A;  1B34 B;  1X75 C;  1R8O B;  2GQV A;  3MCA B;  1IO6 A;  4CI0 C;  2RQV A;  3JCM e;  3CPW A;  1FMW A;  3MEW A;  1U3O A;  1FYN A;  5I2S A;  2B8A A;  2HBW A;  2F1L A;  4LDV A;  1I4K 1;  4PJM A;  1M9S A;  1ZBJ A;  3G6E Q;  4IKF A;  1VQN A;  3OW2 S;  2X4W A;  2R57 A;  3OYB A;  1N8R C;  1WA7 A;  3RES A;  4N0A A;  4NL3 A;  6AT1 B;  2RK1 A;  1VOM A;  4HXJ A;  1K73 C;  5GAN j;  5GAM f;  1UDL A;  3SEM A;  2CSQ A;  5EG2 A;  4F7U B;  4C92 E;  3JB9 J;  5GAN 5;  3LWI A;  5GAO l;  4AFU C;  4JRI A;  3QHS A;  1YN8 A;  1WYX A;  2V26 A;  1FXX A;  4OMO A;  4FM4 B;  3VS7 A;  3M53 A;  2O31 A;  4O5V A;  5FLX E;  1NPR A;  2HCK A;  2YUP A;  1KHC A;  1AVZ C;  5A0D A;  2JM8 A;  2RH2 A;  1TH7 A;  2M0Y A;  4AFZ C;  2P4T A;  3PVL A;  4A4G A;  2VKN A;  1GL5 A;  2AT1 B;  3CCL T;  2C06 A;  1EZZ B;  2DEU A;  1QP3 A;  1Q86 C;  1LOJ A;  2DL4 A;  3QSU A;  3QZ5 B;  1CKB A;  4XTV A;  3HSB A;  4Y91 A;  5GAN 7;  4OMM A;  4E7I A;  3S3M A;  1OQK A;  5L8R E;  1AZG B;  3I56 Q;  2K6D A;  4FL6 A;  4XTX A;  1BI3 A;  1YHQ A;  3CC4 A;  4FIB A;  2NUT A;  1WPY A;  2LQ8 A;  4M77 A;  4QQG A;  5KE3 A;  2DJZ A;  3MEV A;  4PJO A;  3ER0 A;  3R6N A;  2ZAE A;  4KH1 B;  3JB9 I;  1W2B S;  3OB9 A;  4C92 G;  1M1K U;  3X24 B;  1M1K R;  2IPO B;  1M1G A;  3AHU A;  1U1S A;  3TU4 K;  2HQH A;  2KYB A;  2IVW A;  4M78 D;  3CCR Q;  2HZY A;  3QJY A;  2DBK A;  1QCN A;  3F70 A;  4E7J A;  2CP6 A;  4XTU A;  3JV3 A;  2RQT A;  1VIF A;  2M0O A;  1MND A;  4Y92 A;  5GAN g;  3KBG A;  4AMC A;  3CCJ T;  4FYV B;  4ELY C;  1WDX A;  1M90 C;  1N6A A;  2G3R A;  1TU0 B;  2EJ9 A;  4DA4 A;  4M7A C;  3JCM g;  4KGZ B;  1VQO T;  1WXU A;  2H3J A;  3PNW C;  1G8X A;  1S1N A;  3X28 B;  1OYX A;  1K76 A;  1ACM B;  1X6B A;  1DJ7 B;  4F7U F;  1G3Y A;  2QG9 B;  1OU9 A;  4EMH A;  2O01 E;  2RN8 A;  3QDF A;  2YLB A;  2AKK A;  1YJ9 T;  2A7Y A;  3VUZ A;  1VQ4 T;  1MMA A;  4P5N A;  1VQ8 Q;  1YIT A;  2ROT A;  1OX8 A;  1VQM A;  3MP8 A;  3HHT B;  4C5G A;  3H0I A;  1NYG A;  5GAN 8;  1VQN Q;  2NUT B;  4M77 B;  2XDB A;  1X27 A;  1K9M U;  1K9M R;  4BB7 A;  4PJO B;  3GPL A;  4OMF B;  1YI2 A;  1OEB A;  1G2B A;  3M4G A;  3VS1 A;  1ABO A;  1D3B A;  4C8Q C;  2VXF A;  5CVI A;  2EQI A;  2I2L A;  1NYF A;  3EG1 A;  2MWO A;  3FC3 A;  1AOJ A;  3RIR A;  2QDL A;  2A37 A;  2R5M A;  3CCU A;  2R5A A;  2K57 A;  3TEE A;  3I35 A;  1YCS B;  1B3Q A;  4M7D C;  1JRI A;  3QZ9 B;  2QQ9 A;  5LJ3 h;  5CO7 A;  2DEQ A;  2EYQ A;  1ZSZ C;  3M55 A;  4GLK A;  3SWN A;  1X69 A;  2PVO B;  4OB0 B;  5EC7 A;  3QG1 A;  1OZ2 A;  2C0T A;  2M9U A;  4QT7 A;  2QAZ A;  4BI8 B;  4OVA A;  2KNB B;  5A0L A;  1BKB A;  4OB2 B;  2CT4 A;  2DET A;  4Z02 A;  1VYT A;  1G3T A;  1SF9 A;  5GAO m;  4FW2 A;  1M8M A;  4A4F A;  5I2M A;  5LJ5 j;  2HQX A;  3VYH B;  4KGV B;  4E7K A;  2KMT A;  3OSS C;  1VQK A;  2J05 A;  1KJW A;  3G1J A;  4LN2 A;  2LC4 A;  1X2Q A;  2PVG B;  1JU5 C;  2GCX A;  1RAA B;  1FMK A;  1YHQ Q; 
#chains in the Genus database with same CATH homology
 4XTW A;  4F7U E;  2ZPE B;  4IUQ A;  3A8O B;  3PMI A;  4J6W A;  3MEU A;  2V8K A;  2HAX A;  4PL6 A;  2KDS A;  3JAM E;  3C12 A;  4GY5 A;  3CCV A;  1VQ7 T;  4M78 A;  4RKU E;  1S72 T;  2XID A;  5GAM e;  3ASK A;  5GMK j;  3CXC S;  3NTI A;  4M77 E;  3VU3 C;  2OTJ T;  1RI0 A;  3GNG A;  3CCQ A;  1WGS A;  2RHX A;  3H8Z A;  2DK3 A;  3UDC A;  3JCM b;  4PJO E;  1OZ3 A;  2DD5 A;  3BY7 A;  3INZ A;  3MHX A;  4XU0 A;  4BUG A;  3KXT A;  2YRV A;  3ME9 A;  3JCM W;  5FU7 C;  2L3R A;  2DTI A;  2CZ1 B;  2E6Z A;  3VV0 A;  4IUP A;  4JLI A;  2QQB A;  2KK4 A;  1WQW A;  3H6Z A;  1D3B B;  4C8Q A;  3G4S A;  2RK2 A;  1YIT T;  2DXB A;  2HNI A;  1VQP A;  2ZPH B;  1KQS S;  1KHI A;  1ZBX A;  3NTK A;  4IUU A;  2RJD A;  5HKC A;  4ELZ C;  3FRN A;  4M75 D;  2AHJ B;  1WJS A;  5D6Y A;  5DLO A;  4R55 A;  5FRM A;  4BI4 A;  5GMK l;  4DOW A;  4O6J A;  4C0Z A;  2KSS A;  2CKK A;  3HFO A;  1K9M C;  4IUT A;  1KD1 C;  1W2B A;  2RJC A;  4Q5W A;  3CCS A;  1LNX A;  5M9O A;  4N4G A;  4N4I A;  1YI2 T;  3GIB A;  2DTO A;  2D0Q B;  4EDU A;  3J7A F;  2JZ2 A;  3GP8 A;  5LJ5 h;  1FWZ A;  4M77 F;  3CC2 A;  5D6X A;  2VXE A;  2LVM A;  3JCM J;  4QQD A;  1Q7Y U;  3I55 T;  4OB1 B;  1H64 1;  1V29 B;  4PKC C;  4PJO F;  1O9S A;  2EKO A;  4HKE A;  3SWN B;  1NJI C;  2QQR A;  1YJN T;  3FDR A;  3GLX A;  2KVQ G;  4M75 E;  1VUB A;  4XK8 E;  5LJ3 d;  2VGM A;  3CBM A;  4A54 A;  5GAM j;  3OYF A;  3OYH A;  3ZBD A;  3OS2 A;  3RER A;  4FT4 A;  3CCU T;  3FIF A;  1I81 A;  1UB4 A;  1Y96 A;  4EMG A;  2DXU A;  1JJ2 A;  5AYF A;  3OYJ A;  3OQ5 A;  4FU6 A;  3LWH A;  4JS4 A;  2LT1 A;  4IUR A;  3S3O A;  2XD0 A;  3HKS A;  3RKW A;  3PFS A;  4II1 A;  5IT9 E;  5GMK i;  5FU6 C;  2JVV A;  4F7U G;  3G71 A;  5GAN f;  4MZP A;  5GAM d;  4VUB A;  4DQ2 A;  5GAN 4;  2YHT A;  3UT1 A;  2M1H A;  3PIP A;  3CBP A;  1VQO A;  3OYC A;  1YIJ T;  3P8H A;  4UC4 A;  5CIU A;  1NZ9 A;  5LJ5 e;  2X35 A;  3TCJ A;  4KBM B;  4KUI A;  4M77 G;  4XU3 A;  4B9X A;  4LDX A;  1YHQ T;  4LD6 A;  3L2W A;  3QJ6 A;  4EMK C;  2JTF A;  1G3W A;  1B34 A;  4JJN K;  2E6N A;  4PJO G;  3OYK A;  4XQ3 A;  1VQ9 A;  4JRP A;  1WJR A;  3JRZ A;  1HXD A;  1BI1 A;  3VKI A;  4M75 C;  4RG8 A;  5A2Q E;  3CME A;  3QKJ A;  1MGQ A;  3LX7 A;  3CCM A;  2DXC A;  4OF1 A;  2VV5 A;  5GMK m;  2QA4 T;  1K73 U;  2VGN A;  2ZPF B;  3RKX A;  2WSE E;  4BY6 B;  3L2U A;  1SSF A;  4JRQ A;  1VQK T;  3MP6 A;  3I56 A;  2K5F A;  3V7S A;  4MDX A;  2OTL T;  1VIE A;  2YLC A;  4RCC A;  3JB9 F;  3LW5 E;  4V2S A;  3E9F A;  3FLG A;  3PMT A;  4XTZ A;  3M9Q A;  2X4J A;  4C92 F;  3CCE A;  2EQU A;  4RMO A;  3OS0 A;  2BIV A;  4C8Q B;  4M7A A;  4D6W A;  1VQ6 A;  3HP9 A;  5KE2 A;  2CS7 A;  2F5T X;  4B9W A;  2LNV A;  2P0K A;  3CD6 A;  2RJE A;  3QYH B;  4BDZ A;  5FRN A;  3LLR A;  2HBP A;  2QQS A;  3CCV T;  4NS5 A;  4N0A C;  3DB4 A;  3GNF B;  1RL2 A;  3LYI A;  3OMG A;  4BE0 A;  1KG1 A;  2P0Q A;  4OGC A;  4M75 G;  4X34 A;  3X20 B;  3CCQ T;  1KQ2 A;  2XDD A;  4F7U A;  3M56 A;  2DKG A;  3X25 B;  4C92 B;  4E47 A;  3C95 A;  3R6O A;  2XI9 A;  4ZTF A;  3M54 A;  3QBY A;  5J3B A;  3CCR A;  4RCB A;  3JB9 H;  5GAN h;  2XKO C;  1N9R A;  3MP1 A;  2EJF A;  3QXE B;  5LJ3 g;  3G4S T;  2JTM A;  3CCL A;  5CKB A;  1Y07 A;  1M1F A;  4MMK A;  2EJG A;  3PIO A;  5FRO A;  2A3L A;  2QTX A;  3DB3 A;  4IUV A;  1Q86 U;  4WF2 A;  2E1H A;  5LJ5 d;  3OY9 A;  2NLU A;  3JCM h;  4LDW A;  2JUF A;  3OW2 S;  4YTL A;  1YCY A;  4QVD A;  3Q1J A;  3MO8 A;  3M4Y A;  2FL7 A;  1Y96 B;  2D9T A;  3CC4 A;  3V8L A;  3CCS T;  4LDY A;  3SB2 A;  4ZGE B;  2RHU A;  1KC8 U;  4KT0 E;  1Q81 U;  2RD1 A;  5GAM g;  3OYG A;  2L5Q A;  5DM7 R;  1U1T A;  2P0P A;  3LH0 A;  2K5L A;  3L2Z A;  3RUX A;  3HFN A;  3JCM V;  2MWP A;  4JDS A;  4PLI A;  5CCA A;  1Q7Y C;  3V8J A;  2WAC A;  3VJP A;  3G6E A;  5GAO r;  2K3X A;  1YBY A;  4ZTJ A;  3PTA A;  3BFM A;  1QVG A;  3ZFJ A;  3MEA A;  2ZPG B;  2QDY B;  4L59 A;  5GAN e;  1VQM T;  5KCH A;  1U8R A;  1VQ5 A;  4EMK A;  2PU9 B;  2MMP A;  4ZN3 A;  3A8M B;  4PLL A;  5CQY A;  1UGS B;  2O4X A;  1B34 B;  3TRE A;  1X75 C;  3LGF A;  2HQE A;  1O75 A;  3BW1 A;  1R8O B;  3DKM A;  4PJO C;  2GQV A;  3MCA B;  2CZ6 B;  4DOV A;  4CI0 C;  4M7D A;  1M8V A;  4M75 A;  3JCM e;  3QPH A;  3CPW A;  2JNG A;  1ZHI A;  3L1A A;  4PNO A;  3JCM X;  2FB7 A;  3MEW A;  3S6W A;  4JLG A;  3G71 T;  3EFS A;  3CC7 T;  1JBM A;  5I2S A;  2B8A A;  3WVD B;  1I8F A;  3JB9 D;  2KY9 A;  4LDV A;  4M77 C;  3DLM A;  5GAN 2;  1I4K 1;  5CAI A;  1IRE B;  2XG8 D;  3RMQ A;  2RHI A;  3OBY A;  3SD4 A;  4C92 D;  2FYK A;  1M9S A;  3V7R A;  4IKF A;  5LJ3 f;  1VQN A;  2EIF A;  2VC8 A;  4J6X A;  5D6W A;  5FU7 B;  2X4W A;  3JCM Q;  1FX7 A;  2R57 A;  3OYB A;  3P8B B;  5J39 A;  1VQ9 T;  4M7A B;  1N8R C;  1WJQ A;  3CCJ A;  2ZGW A;  3V8K A;  3RES A;  3CME T;  4N0A A;  3CXC A;  1M90 U;  2VUB A;  3C4S A;  2RK1 A;  2XDP A;  4NL3 A;  3CCM T;  3EAE A;  2DAQ A;  2GF7 A;  1K73 C;  2MAM A;  1YJW A;  5CQX A;  5GAN j;  5GAM f;  1QVF S;  5GAO n;  1VQL A;  5EG2 A;  4F7U B;  3GF5 A;  4C92 E;  3MET A;  1NE8 A;  3FEO A;  5CKD A;  5GAN 5;  3JB9 J;  3LWI A;  4M78 F;  4HCB A;  5GAO l;  1XTD A;  2EFI A;  4C0D B;  4JRI A;  5KH6 A;  3OYN A;  3CCE T;  3QHS A;  1KQS A;  4J8O A;  3CMA T;  1VQ6 T;  5LJ5 g;  4OB3 B;  3RMS A;  4BY6 C;  1FXX A;  2CZ7 B;  2WSF E;  5CKF A;  3CD6 T;  4FM4 B;  1X6O A;  5CK9 A;  3SFM A;  4J83 A;  2DO3 A;  3BDL A;  1YJ9 A;  3M53 A;  5GAN d;  4E7L A;  2V8I A;  1XNI A;  4O5V A;  2XU8 A;  4C8Q F;  1NPR A;  5FLX E;  4JUV A;  3VUB A;  4M78 B;  4BDY A;  1KHC A;  4XU1 A;  4NOY A;  1VQ4 A;  5A0D A;  2XK0 A;  5HY6 A;  2DZ9 A;  2RH2 A;  1TH7 A;  2IG0 A;  3WVE B;  5CR2 A;  3OYE A;  3I55 A;  3OBW A;  2Y90 A;  1NJI U;  2E10 A;  5CKE A;  3CCR T;  2P4T A;  4A4G A;  4X9D A;  3JCM d;  2DTH A;  2EWN A;  2MF2 A;  2PQW A;  1HK9 A;  3X26 B;  1K8A U;  2JOY A;  3OYD A;  2RM4 A;  1JB0 E;  3CCL T;  2C06 A;  4N4H A;  2F5K A;  3OS1 A;  3HL8 A;  3C94 A;  3HRS A;  4C92 C;  1QP3 A;  1Q86 C;  1LOJ A;  5GAO p;  4TVR A;  3QSU A;  1N9S A;  4BI3 A;  2DD4 A;  2DXT A;  3QZ5 B;  4XTV A;  1UGQ B;  2RI3 A;  3HSB A;  2O4X B;  2K3Y A;  4Y91 A;  2KQW A;  4R56 A;  4M7A D;  2RJF A;  1IZ6 A;  1QP2 A;  2QQA A;  5GAN 7;  2D6F A;  3J81 E;  4E7I A;  1KC8 C;  5C0M A;  3S3M A;  1PSF A;  2VYT A;  3OYY A;  1Q81 C;  3E9G A;  3OMC A;  4M7D B;  3NFC A;  3G7Z A;  5L8R E;  4A4K A;  4ZGD B;  2EQK A;  4BAC A;  4FL6 A;  4XTX A;  1BI3 A;  4RG2 A;  1YHQ A;  1Y71 A;  4L5G A;  2K5I A;  3CBO A;  1NPP A;  4FIB A;  4OP0 A;  1AHJ B;  1WPY A;  2LQ8 A;  3JSC A;  4M77 A;  3OSV A;  4QQG A;  5KE3 A;  3G6E T;  1VQP T;  2DJZ A;  3MEV A;  3L2Q A;  3S3N A;  4XU2 A;  3SDZ A;  2FVU A;  2MI6 A;  3JB9 G;  4PJO A;  3ER0 A;  3UWN A;  3JB9 I;  3L2V A;  1W2B S;  5C6S A;  3OB9 A;  5LJ5 f;  2RI5 A;  2QXF A;  4C92 G;  2EQJ A;  3QUI A;  4ZN1 A;  1M1K U;  4M7A E;  3CPF A;  3A8H B;  3X24 B;  4MZM A;  2QEX A;  3M57 A;  1OI1 A;  3RKY A;  1M1G A;  1XOV A;  4ATO A;  3AHU A;  1U1S A;  3TU4 K;  3DLL A;  2E64 A;  1M5Q 1;  3HPW A;  1M4Z A;  4L6V 5;  1BYM A;  2X4X A;  3CC2 T;  2BUD A;  2Y4Y A;  2IVW A;  4M78 D;  5KCO A;  3QJY A;  3NTH A;  2RHZ A;  3HRU A;  5GAO q;  1N27 A;  3FB9 A;  4HT8 A;  2FHD A;  3F70 A;  2E41 A;  2K2V A;  5IN1 A;  4E7J A;  1UGP B;  4A4H A;  5J26 A;  4C5I A;  4XTU A;  1WQ7 A;  3J80 E;  1VQN T;  2RA2 A;  2GFA A;  3EFR A;  1JJ2 S;  4KUL A;  4QVC A;  3E19 A;  1VIF A;  2M0O A;  1W4S A;  2EQM A;  2V8J A;  4ZGJ B;  5GAN g;  1WNL A;  3A8L B;  1ZQ1 A;  3KBG A;  4C8Q D;  5CKH A;  4ELY C;  3OYL A;  3CCJ T;  2LT4 A;  3V7C A;  3SWN C;  3OS5 A;  3PGG A;  1M90 C;  1Q82 U;  4C0G A;  1N6A A;  2G3R A;  4M7A F;  2EJ9 A;  3A8G B;  4DA4 A;  4M78 E;  1EIF A;  1VQ8 A;  1YJW T;  2LQK A;  2L8D A;  4M7A C;  3JCM g;  3OYI A;  1VQL T;  1VQO T;  2H3J A;  2ZPI B;  2RB6 A;  3PNW C;  3X28 B;  1OYX A;  4M7D D;  2PUK B;  4BE2 A;  2L89 A;  1H3Z A;  2DIQ A;  2LCL A;  4EPC A;  4C5E A;  3A5Z B;  1DJ7 B;  2WSC E;  4F7U F;  5LJ3 j;  1VQ7 A;  1G3Y A;  4QVZ A;  4C8Q E;  4EMH A;  1X01 A;  1BIB A;  2O01 E;  2CYZ B;  2X4Y A;  2ZCF B;  3O8V A;  4ME7 A;  2YLB A;  4C92 A;  4QQ6 A;  1YJ9 T;  2OTJ A;  4JS5 A;  2A7Y A;  4XTY A;  2EAY A;  4C0D C;  1UGR B;  3VUZ A;  1VQ4 T;  2CZ0 B;  2E5Q A;  3M5A A;  3LGL A;  2RI2 A;  1MHN A;  4MZT A;  2E70 A;  4C5H A;  4P5N A;  2KAF A;  2E12 A;  4J7I A;  1P92 A;  4HCZ A;  3I56 T;  4FSX A;  1YIT A;  4A4E A;  4M7D E;  2PUO B;  2RHY A;  1G5V A;  4M7A G;  1VQM A;  1K8A C;  3MP8 A;  5DLQ E;  3HHT B;  1LJO A;  2HD0 A;  4C5G A;  4HT9 A;  2Y4X A;  5I21 A;  2F69 A;  4M78 C;  4XAX B;  5GAN 8;  2LRQ A;  3M58 A;  1QW1 A;  4M77 B;  4C0F A;  1Y7X A;  4BE1 A;  2XDB A;  1K9M U;  1BI2 A;  1KD1 U;  1GXI E;  3FJP A;  4BB7 A;  5GMK h;  4PJO B;  3GPL A;  4OMF B;  5HK3 A;  2OAU A;  1YI2 A;  3CC7 A;  4LDU A;  4QW2 A;  3CEY A;  2LX9 A;  3URG A;  3M4G A;  1D3B A;  2ZPB B;  4J7F A;  4C8Q C;  3P8D A;  3OYM A;  2VXF A;  5CVI A;  1I5L A;  1BIA A;  3QII A;  1BI0 A;  2E65 A;  2I2L A;  4HCC A;  3UPU A;  1YJN A;  4NL2 A;  2DPP B;  2MWO A;  2RO0 A;  3RIR A;  2DIG A;  3FC3 A;  3CC4 T;  2R5M A;  3JCM f;  4LD9 K;  1S72 A;  5FU6 B;  3CCU A;  4FT2 A;  4J6Y A;  2R5A A;  1N8R U;  4M7D F;  2K57 A;  4M75 F;  3TEE A;  2ZZD A;  3HRT A;  5LL6 S;  3KUF A;  4A53 A;  4M78 G;  3OW2 A;  4M7D C;  1JRI A;  2QI2 A;  2QQ9 A;  3QZ9 B;  2LTO A;  4X9C A;  5LJ3 h;  4E7H A;  4J5Y A;  2DEQ A;  5CO7 A;  1KQ1 A;  4EMK B;  5GAN 3;  1M1K C;  4BD3 A;  2QEX T;  2EYQ A;  4Y28 E;  1XQH A;  3M55 A;  1UEB A;  3WXM B;  5GAN 6;  2BKD N;  4GLK A;  3T9N A;  3SWN A;  5GMK e;  2PVO B;  1YIJ A;  3PT9 A;  4OB0 B;  4M75 B;  4C8Q G;  3QG1 A;  4JRK A;  1OZ2 A;  1QVG S;  3N5B B;  2CGH A;  2M9U A;  3QO3 A;  2K4Y A;  4OGE A;  1QVF A;  3L2R A;  3M59 A;  4BI8 B;  3CMA A;  3E1S A;  2XHC A;  4OVA A;  5GAM h;  1PSE A;  5A0L A;  1BKB A;  4OB2 B;  2GFU A;  3JCM P;  4Z02 A;  1VQ5 T;  1G3T A;  2JN0 A;  4MDW A;  4CRI A;  5GAO m;  1G3S A;  3OYA A;  4KUD K;  4M7D G;  5IAY A;  3CPW S;  2DZC A;  2LDM A;  5I2M A;  4A4F A;  3JCM c;  5LJ5 j;  2QA4 A;  2HQX A;  3VYH B;  1QVP A;  4M77 D;  5DY9 A;  3OA6 A;  4E7K A;  2KMT A;  3OSS C;  5LJ3 e;  1VQK A;  3L42 A;  3VYG A;  1Q82 C;  2OTL A;  4PJO D;  2DVE A;  2LCC A;  2LC4 A;  3GOX A;  1VQ8 T;  3ZEH A;  2R58 A;  2PVG B;  3QDR B;  3QYG B;  2M16 A;  2GCX A;  4MML A;  2PVD B;  2XIC A;  4HA8 A;  5HK0 A;  3BDU A;  5A0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...