3FIFA

Crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
SDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein ygdR
publication title Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli k-12
molecule tags Structural genomics, unknown function
total genus 4
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fifA00
2EWNA 1B34B 4M75F 4J6WA 3V8KA 1I5LA 2HNIA 3GIBA 1LNXA 5DY9A 4M7DE 4M7AA 4XU1A 4M7DC 2VXEA 4M78E 3SWNB 5GANe 2I2LA 5GANj 4V2SA 5GAN6 4X9DA 4M78C 5GMKe 5GAOn 4M7DB 3QO3A 2DXTA 4X9CA 5LJ3h 5CAIA 5LJ3g 5GAOq 3BFMA 1I81A 4JUVA 1KQ1A 5GAN3 2CGHA 5GAOm 1Y96A 4C92D 5GMKi 5GAOl 4M75G 4PJOF 4XU2A 3JB9F 4DQ2A 5GAN4 2DTIA 3BDUA 4J5YA 4C8QE 3JCMd 4C8QC 4F7UE 4M77E 4N0AC 5GMKm 4M7DD 4M7AB 2YLCA 4M77C 5GMKl 3RUXA 4M78D 3JB9H 5GANd 3QUIA 4JLIA 4M75A 2DTHA 4F7UB 4M77B 3HSBA 4XTUA 3HFNA 2E41A 4QVDA 3FIFA 4PJOD 4Y91A 3V7RA 2DVEA 4C92F 5GMKj 2Y90A 5GAMe 1Y96B 2E64A 4OP0A 2DKGA 1BIBA 5LJ5e 5LJ5j 3EFRA 2DZ9A 1M8VA 4M7DF 1MGQA 4A53A 3RESA 4C8QD 3HFOA 2JN0A 2RA2A 4EMKA 4M77D 2DJZA 4M78F 2E65A 4PJOA 3JCMf 4XU0A 5GAOr 4M7AE 2EAYA 1D3BA 4M75B 4RCCA 4M7AC 4NL3A 5GANf 3FJPA 5GAOp 4PNOA 4XTXA 1YCYA 4XQ3A 4XTZA 1WPYA 3QHSA 3V8LA 1TH7A 5LJ3e 5GAN5 5GAMd 3L2ZA 1WQWA 2RD1A 4EMGA 1JBMA 5GAN7 2DTOA 4C8QF 1WNLA 5LJ5d 1B34A 4M78G 4XTWA 4C92A 5GAN8 3JCMh 1H641 4F7UF 4M77F 4PJOG 2E10A 3JCMg 3JB9G 2DZCA 3SWNA 5GAMj 1KQ2A 3EFSA 3RKXA 2EJ9A 3M4GA 5GANh 4M7AD 3JCMJ 5GMKh 4M7DA 5GANg 3AHUA 4HA8A 3RERA 4M75E 4HT8A 2RB6A 4M78A 4M75C 3JCMV 2EJFA 1I4K1 2VXFA 3JB9J 1X01A 5I21A 4C8QG 1I8FA 1JRIA 2DEQA 5LJ3d 2FYKA 2YLBA 3L1AA 4MMKA 3JCMc 3JCMb 3BY7A 3V7CA 4C92G 2ZGWA 2FB7A 5GAMf 5GAN2 4C92B 4J6XA 4JRIA 3JCMP 1M5Q1 1HK9A 3VU3C 5LJ5f 3JB9D 3FB9A 5LJ3j 2DXUA 4M7AF 4RCBA 3BW1A 4XTYA 4N0AA 3RKWA 4C8QA 3JCMX 4M7DG 4PJOE 3V8JA 4EMKC 4F7UA 4M77A 4PJOC 1WQ7A 2YHTA 3JCMQ 4NOYA 2EJGA 2K57A 4M78B 4M75D 4MMLA 3RIRA 2VC8A 3V7SA 4A54A 4EMHA 4J6YA 4EMKB 4PJOB 4NL2A 2RM4A 3RKYA 3SB2A 1U1SA 3PGGA 1D3BB 4XTVA 5GAMh 1LOJA 3QSUA 5GAMg 5LJ5h 1BIAA 4HT9A 5LJ3f 1N9RA 1U1TA 1N9SA 2QTXA 5LJ5g 4JRKA 2E1HA 4M7AG 4XU3A 4C92E 1LJOA 4C92C 3INZA 4QVCA 3JCMW 4C8QB 1HXDA 4WF2A 4F7UG 4M77G 3JB9I 3SWNC 3JCMe
chains in the Genus database with same CATH superfamily
3KBGA 3CXCP 1PSFA 4X34A 1YJ9Q 1JJ2S 4QQGA 2DXTA 2OX7A 3QYHB 1KHIA 5LJ3g 3J81E 2HQEA 3G4SA 1U06A 1M2VB 2RQRA 4C92D 4RTUA 2PNIA 5GAOl 1K73R 3PMTA 4XU2A 2X3XD 2X9HA 1AD5A 3OSSC 1YITT 4BUGA 4KH0B 1RABB 2FZGB 1NJIC 1W4SA 1U5SA 1Q82R 4Y92A 3V7RA 5C0MA 1OPKA 1K9MU 4FCYA 1M8VA 4M7DF 2L3PA 2A28A 2K2VA 3M5AA 1I07A 2E65A 4XK8E 3M0PA 3CC7A 3PE0A 5FRNA 1KIKA 2LNHB 4J9BA 2IG0A 2PZ1A 2QQSA 2MWOA 3PT9A 5GAN5 3KFVA 3THKA 3TU4K 1VQOA 2L3SA 4F7UF 2I0NA 3JV3A 1FYNA 3EFSA 1MMGA 1UUEA 3LH0A 3CCQA 3VUBA 1OULA 4C0ZA 1VQ9A 3UF4A 1FMWA 2LZ6B 4LDWA 1X01A 2DK3A 1K0SA 2KRSA 3CQTA 5FRMA 3L1AA 2K5LA 1QVGA 2KBTA 3FC3A 3OB9A 1KD1C 4JJNK 5AT1B 1ACMB 2COZA 4ME7A 5J3BA 1WQ7A 4LUEA 1M3BA 4M75D 1IZ6A 2VC8A 2CP6A 2JXBA 1MUZA 1H3ZA 1OI1A 1OU8A 4J9GA 1UTIA 2A37A 2K3XA 1KQSS 2VWFA 2HL3A 2EQMA 3JRZA 2BE9B 1YHQT 2XMFA 2HDAA 4M77G 4PFZA 2EWNA 2XIDA 2YSQA 4C5EA 1IXDA 5DY9A 1LVKA 1YITQ 2CUDA 5KYUB 3VS0A 5GMKe 4L6V5 4M7DB 3ZL7C 3HPWA 4FW2A 1YWOA 3CCMT 1UFFA 4A4GA 2J6FA 2JT4A 1NBEB 3HKSA 4C8QC 1T0HA 4M7AB 4ANJA 2PVOB 3VJPA 1UJYA 2EKHA 4F7UB 2QA4Q 3G6EQ 2RK2A 1MV3A 4QVDA 3CCVT 1NPRA 4J9CA 2H3JA 2L2PA 1S1NA 2RA2A 3EGXA 2EQUA 2QDLA 2JTFA 1DJ7B 4DOVA 3CCST 4J83A 4Z02A 2C0OA 1MMNA 3QHSA 5GAMd 2DXBA 3T9NA 3EH2A 5KYWB 4A4EA 1X2QA 2EPDA 1YJ9A 3CD6A 2RQWA 3RKXA 3GPLA 3LGFA 5FU7C 1M90U 2RN8A 3J80E 3CCEA 2HSPA 2KNBB 3CBMA 2HQXA 2XKOC 4OVAA 2VXFA 2F2WA 2L5QA 2E3HA 2J6KA 2YRVA 3JCMc 4MMKA 1IRXA 4A4KA 3NTIA 2WSFE 3NGPA 1HYOA 5ECAA 2AKLA 1D0ZA 1YNZA 3VRYA 2GFUA 2L3QA 3FB9A 4JRQA 1S72A 1YHQQ 1T0JA 4M78B 5CKDA 1D1AA 3P8BB 4BDYA 4XTVA 2DO3A 2FRWA 4LD6A 5LJ5h 2EQIA 2DJQA 4JS4A 4BACA 3QXEB 1BCOA 2J05A 3I9QA 5FW9A 2KGTA 4C92C 2QXFA 3HRSA 3CCMQ 1YP5A 2CP2A 3IQLA 1XOVA 3NTKA 3NTHA 1BYMA 1AZGB 1GCQC 4PFOA 3JAME 5LJ3h 5A0GA 1SHGA 1X75C 1Q86C 2EYZA 2RJEA 3CCVQ 1C1AA 1ZSZA 1EIFA 2DXCA 4AT1B 2NUTB 3CMET 4ORZA 2LX7A 4AG1C 5IXFA 2DIQA 1KFZA 2M1HA 2B86A 1AHJB 3CCSQ 1MMDA 2LDMA 3SEMA 2DVEA 3RNJA 5GMKj 1VQKA 2F2VA 4HCKA 2D1XA 2LMJA 1QVFA 4KGVB 1QWFA 3EAEA 1ABQA 3PNWC 2ECZA 2O9VA 1OYXA 4FM4B 5J26A 3UWNA 3L42A 4HVWA 2KQWA 5GAN7 1XQHA 3GP8A 5KYUA 2ESWA 2DMOA 3CC4T 4M7DA 4M75C 1UGRB 4C0DC 2YT6A 4EPCA 1BI3A 1K73U 4JRPA 2KDSA 2YDLA 1WJSA 1B3QA 4IUQA 3HP9A 1YIJT 2QA4A 3G6EA 4F7UA 2QEXT 3SD4A 1Q82U 1UB4A 2OI3A 2RM4A 1U1SA 1D3BB 4CC2A 4BE1A 2DM1A 3QSUA 2EYXA 2O88A 3UDCA 2JNGA 1A0NB 4J7FA 4M7DE 2VXEA 1Z9QA 4PLIA 4V2SA 2HD0A 3OBWA 1VQ6Q 1D09B 1OQKA 3VV0A 1K9MR 2O4XB 4M4ZA 4ZGEB 2H3EB 3VYGA 2W10A 2CDTA 4IUTA 4D8DA 4OMOA 2ZPFB 1N8RC 4J7IA 2EYYA 2JM8A 4F7UE 5GMKm 4AMCA 2KROA 1VQPT 1Q81C 1ZSGA 4PL6A 2FZCB 1V1CA 3CCJT 1EX4A 2C06A 3NFCA 5M9OA 5LJ5e 2DZ9A 2A7YA 3TSWA 4C5IA 3UA6A 4BY6C 3CC4Q 2FRYA 2MYSA 4DBHA 4RG2A 1I0CA 5LJ3e 2DYIA 2J7IA 3OYGA 1WQWA 2DTOA 3VS3A 3QPHA 1KQ2A 3LX7A 1YIJQ 3JCMJ 1RADB 1AVZC 2QEXQ 3JCMV 2AKKA 3CCVA 3I5SA 2EQKA 1F1BB 3NPFA 4C92G 3CCUA 3C94A 3JCMP 2NUTA 1CSKA 1CKAA 2Y4YA 1IGUA 2KAFA 2HBWA 4EMKC 3NMZC 1YJNT 3P8HA 4MMLA 2HAXA 3RIRA 3QDRB 2RHYA 4A4HA 1QKWA 1K0XA 3TREA 4XU3A 2QAZA 1VIEA 2HZYA 4LDYA 1WHHA 4KBMB 3CMAT 3CCLT 1W2BS 3MP6A 5GANj 2YUNA 4C5HA 1RAFB 4J9IA 4X9CA 2LTOA 1VQPQ 2ZPBB 1OZ2A 3OS1A 3PTAA 2RK1A 2CGHA 2DAQA 1BB9A 1UEBA 2MPXC 3SHWA 3CCJQ 1UGPB 3JB9F 2F2XA 3CEYA 2R57A 3UPUA 2RHZA 3DLLA 2V8IA 1AOJA 4XTUA 2X4JA 4ELYC 1M1KC 2LJ1A 3EFRA 3URGA 4MDXA 2ATCB 2HKQB 1TUCA 2EAYA 1D3BA 2PVGB 2X35A 3WVDB 2LNVA 1KG1A 2ZPGB 1KK7A 1YCYA 2RNAA 4DBRA 1WI7A 3MP1A 4RG8A 4B9XA 1B7TA 3JCMg 1VQ6A 3ULRB 1GBQA 2EKOA 1G3WA 3GOXA 5GANg 3DKMA 4J9EA 4HA8A 2VASA 1OEBA 5KE3A 2EJFA 3A8HB 1ZA2B 1YJNQ 1X43A 2KT8A 1M30A 2JS0A 1I8FA 2J6OA 1QMCA 3E19A 3X26B 1D0YA 4ATOA 2D8HA 1JB0E 2K9GA 5LJ3j 1UHCA 1RL2A 2QQAA 4XTYA 3OSVA 5C6SA 3L2QA 4DOWA 4EMHA 4J6YA 4GBQA 5FU6C 1WHJA 1D1CA 4HKEA 2RQVA 2QK0A 1YJWA 3TQ7P 1U1TA 5CKFA 4RMOA 3ASKA 2GTJA 1X6BA 2O9SA 3EGUA 2D9TA 3M0TA 2HNIA 4OF1A 1E7OA 1UECA 4X9DA 5GAOn 4OGEA 2E3IA 4E7ZA 1QLYA 4FL6A 2X4XA 3QZ5B 1RAHB 2CREA 4M7DD 3OYCA 3QWXX 4JLIA 5CO7A 2JJ9A 4PJJA 2E41A 2K7AA 2RH2A 1ZUYA 2O2OA 4HCCA 3E9GA 2BZXA 2VB6A 1OV3A 2CP0A 2RHXA 3HFOA 1B07A 3HTRA 3OMCA 4JZ4A 2COWA 1Y57A 5KE2A 4BE0A 4CRIA 1Q95G 3V8LA 5D6WA 2C0IA 4OMPA 1H641 3PVQA 2GQVA 3I56Q 2V8KA 3FJ5A 3GBQA 3AHUA 2J06A 1YN8A 2JZ2A 2HBPA 4RTZA 3CPWS 1X27A 2FYKA 4KRTA 4HVVA 3PMIA 1HK9A 5LJ5f 3I55A 1K4US 4M7AF 2SEMA 1QVFP 3VS6A 2DRMA 4N4IA 1ZBXA 4LUDA 4NL2A 3UT1A 1IGQA 1ZQ1A 2DL8A 3ZBDA 4HT9A 5LJ3f 4FYVB 1VYTA 1MMAA 3E2UA 5A0LA 4C8QB 1FMKA 3A8LB 3GNGA 1QP3A 2GFAA 2XU8A 2E4HA 1VQ7T 2M16A 5IHNA 1AWXA 2JW4A 1TS9A 4R56A 1VQMA 2GGRA 2KXCA 1VUBA 2FEIA 3VYHB 5IXBA 1VQNT 1LPLA 1Y96A 5FWBA 1TSFA 2A0FB 4OB3B 1FX7A 1M8MA 2QG9B 3CC2T 5D6XA 1G5VA 2O01E 3JB9H 3OYIA 4DBQA 3FIFA 2PUKB 2Y90A 4OP0A 3GNFB 2DKGA 3TCJA 2LJ0A 2MIOA 1WYXA 4M78F 1WXBA 1VQ8T 3A98A 4JJBA 2BE7D 2LT4A 2ZPIB 1VQ4T 4ZNXA 1PWTA 2MCNA 2YRDA 2F5KA 3M55A 1JBMA 1OX8A 1ZSZC 4XAXB 4C0GA 3JCMh 4LXCA 3OYFA 1VQ5A 2K79A 4JZ3A 2FPEA 5GANh 1WHGA 4ZTFA 3VS5A 4IKFA 2VUBA 4K11A 1KC8C 4N4HA 3U23A 3L2WA 2M0OA 1RLPC 2D8JA 4C92B 1M1FA 3L2VA 1WHKA 3A1PA 2XDDA 4WTOB 1H92A 3QJYA 2CT3A 2KYBA 1K8AR 2FHDA 5DLOA 1QVGS 1VQ7Q 1UGQB 3H0FA 2QI2A 3RKYA 1QQJA 4J9HA 3VS4A 2LQNA 2XICA 3HHTB 1Q7YR 1H8KA 1GFDA 1M2VA 2VV5A 4RTXA 1VQNQ 2OJ2A 4J9DA 1SG5A 4WF2A 1NLPC 3V8KA 1LNXA 2GBQA 4M7DC 2CS7A 3SWNB 1SF9A 1SPKA 3CC2Q 1YI2T 3EHQA 1IHWA 5KYYB 1VOMA 3I56A 2MAMA 4FIBA 1IHVA 1JO8A 2L3RA 4PJOF 2NUPB 2VYTA 2D0QB 5GAN4 1XJWB 2HSEB 2PVDB 4LDXA 3EH1A 1VA7A 2MF2A 2LT1A 1UGVA 1WXUA 4GLKA 3TVTA 4FSSA 2OTJT 3UATA 3G71T 2RJDA 2EYWA 1VQ4Q 1W70A 4UC4A 3MPUB 4QQDA 4M75B 1OX9A 2FL7A 4RCCA 4Z88A 5I2MA 1Z9ZA 3OYMA 4JLGA 5CVIA 3VS7A 1M2OA 2A3LA 3M59A 2DYBA 1UJ0A 1J3TA 4BI3A 2K4YA 1KHCA 2HKNA 1WNLA 5LJ5d 8AT1B 3OYLA 2K3BA 3KXTA 3RERA 2MI6A 1K76A 4E7IA 2SRCA 3H6ZA 2P0PA 1PG5B 3FEOA 1SRMA 5LJ3d 2KY9A 3QDFA 2KI7A 1PKTA 2P4TA 4PK4A 2QQ9A 2YHTA 1YITA 1V29B 1PRLC 4PJOB 4OGCA 2RQTA 1ZA1B 2EVRA 1GRIA 1TTHB 1M27C 1PD1A 4OB2B 2K2MA 1LJOA 1YWPA 3INZA 3CXCS 1JXMA 1NJIR 2FO0A 3JCMe 1B34B 3OYEA 2IPOB 1BU1A 3X25B 4M7AA 5GANe 3OYNA 5GAN6 3M56A 1X69A 2P0KA 1AWOA 3QYGB 2VKNA 1JJ2P 3BFMA 1NEGA 3QJ6A 3E9FA 4F14A 5GAOm 1FMVA 2OTJQ 3OYDA 3G1JA 3G71Q 3OQ5A 2JUFA 3M0RA 4KUDK 1T3SA 1XTDA 3LWIA 3VUZA 2KEAA 2EQJA 4BY6B 5HCKA 2DTHA 1UGSB 4C5GA 3CMEQ 2ED1A 2X3WD 2KT1A 5KYWA 2G6FX 4A53A 1GCQA 1U8RA 1M4ZA 5GJWB 1K73C 4M7AE 3L2UA 3LH5A 4R0KA 2LQ8A 4PNOA 4XTZA 1WPYA 3G4ST 1KD1R 3C95A 2QYZA 2EBPA 1Q82C 3OMGA 4M77F 3DB3A 3SWNA 1G3YA 1YHQA 3M0UA 4ZGJB 2CUBA 2HMAA 3RBBB 1NG2A 4M78A 2KRMA 2X4WA 1X6OA 1W2BA 1BK2A 3F70A 3BE3A 3LW5E 1TOVA 1QWEA 2E6ZA 2ZAEA 1WJRA 4J6XA 1JXOA 3CCMA 4M7DG 4N0AA 2YUOA 2BZYA 4LNPA 2XDPA 4NOYA 2K57A 3OBYA 5AYFA 4DEXA 3SB2A 1I5OB 3PGGA 2XK0A 4J9FA 1VQOT 4M7AG 3BDLA 1TG0A 2EGAA 1OOTA 4O5VA 3E1SA 1HXDA 4F7UG 5HY6A 3JB9D 4C0FA 1AEYA 2FG0A 2VGNA 1NE8A 3CCQT 2RI5A 4GY5A 3S3NA 1T3LA 4M78E 2I2LA 1VQ9T 1MNEA 3CCSA 2GTOA 2QASA 4AFZC 3MEVA 4ZN3A 5IH2A 3MP8A 4JUVA 4BE2A 5GMKi 1M3AA 4DQ2A 1QP2A 4BD3A 1ZX6A 2XD0A 4GLMA 3EG3A 2CKKA 3N5BB 2LC4A 3AT1B 4M77B 4DBFA 1GL5A 2JTMA 3M4YA 5CKEA 3H0HA 4RUGA 3A5ZB 1K8AU 4L5GA 2A08A 5KCOA 4PJOA 2AIRB 2E12A 4R55A 1RAAB 2D0NA 4FYYB 3QBYA 1Q7YU 1PC0A 2EIFA 4EDUA 2COYA 4EMGA 1B34A 4M78G 4MZMA 5HK3A 4AFUC 3MEUA 1PD0A 3J7AF 5DM7R 2C0TA 1GBRA 2RO0A 3QWYA 3JB9J 2FVUA 4QVZA 4OB1B 3JCMb 4X1VA 2R58A 2YRCA 7AT1B 1VQOQ 2QTVA 1Y71A 3OW2A 2DXUA 2VGMA 4PJOE 3BW1A 3UA7A 3EG1A 3NHNA 6AT1B 3OYBA 3CMEA 1Q86R 3OS2A 2LQKA 4FYWB 3X28B 1VQ9Q 3I5RA 2O4XA 4PLLA 5GAMg 2CP3A 2E1HA 2O31A 1YJ9T 2YUQA 3CD6T 1JJ2A 3DB4A 2MOXA 3A8MB 3REAB 1ABOA 3JB9I 3CCET 3VRZA 3GIBA 2X4YA 4BB7A 3EFOB 4DEYA 2PUOB 3KUFA 5EC7A 3MEAA 3CMAQ 1N6AA 1KQ1A 2JS2A 3CCLQ 1AT1B 1KJWA 3WXMB 2L8DA 1S72T 1ZUUA 1FXXA 4CC4B 1N27A 3PIOA 2VVKA 2DIGA 3OS5A 2YLCA 4CC3A 3C4SA 3RR6A 3OYAA 3CC4A 1Y0MA 3P8DA 2KR3A 1MV0B 2XG8D 2E70A 3R6NA 4B6MA 1EZZB 3R6OA 4ESRA 3EGDB 4Z8AA 2V1RA 4TVRA 2KYMA 1TUGB 1OU9A 2EGCA 1WHMA 4Q5WA 1WXTA 3ME9A 1YIJA 3JCMf 2JVVA 2OAWA 3M9QA 2E5KA 2QEXA 3C0CA 5GANf 3FJPA 1IREB 2PQWA 4XQ3A 2CZ1B 4HCZA 3M57A 1NJIU 2LP5A 4LN2A 4C8QF 1E6GA 3OYJA 3M4GA 4QKUA 4M7AD 4A4FA 1PCXA 3RMQA 2WSEE 2RB6A 4LE9A 4RTYA 5LL6S 3MO8A 1VQKT 1BI0A 3QG1A 2DEQA 5CR2A 4OMLA 3VU3C 3MCAB 1SRLA 3S6WA 5FROA 3CD6Q 4M77A 1KQSA 3CCEQ 5FLXE 1VQPA 4Y28E 5J39A 3MEWA 2EGEA 1R77A 1E6HA 4LDVA 4FT4A 1N8RR 2DE0X 4WCIA 3CCJA 2AHJB 2KVQG 3HSBA 4ZGDB 2M9UA 1VYVA 1Q81R 2JOYA 1XNIA 1S72Q 1BKBA 1KD1U 1PNJA 2XI9A 4OB0B 1WA7A 5EG2A 2BUDA 2DPPB 1UDLA 4II1A 4KGXB 2QA4T 3G6ET 1RAIB 4L59A 2MK5A 1EFNA 4M77E 1MHNA 2EW3A 1R8OB 5IT9E 5GMKl 4M78D 1TWBA 1VQLT 2PU9B 3H9NA 3HFNA 1P92A 1YFNA 3META 1WX6A 2K6DA 4C92F 2E64A 1ZSZB 2LJ3A 1K9MC 1ARKA 1ZBJA 3EHRA 4RKUE 1MGQA 2JN0A 3CCRT 5DLQE 4BI8B 2QDYB 3ER0A 3OYYA 3O8VA 2ENMA 5KCHA 1YJNA 2JM9A 3LGLA 5GAOp 3MJXA 3PVLA 2M02A 3Q1JA 4XTXA 2DBMA 2BTTA 1VQKQ 2RJFA 3ZEHA 2ZZDA 2X51A 3PFSA 3EFOA 4FT2A 1RLQC 1U3OA 2YWWA 1JQQA 4E7SA 2PTKA 3CMAA 1FWZA 2HCKA 2KRNA 5FU7B 3CCLA 3MKDA 3GLXA 1NZ9A 3L2RA 5I21A 1HSQA 2YLBA 3BY7A 1KC8U 4HXJA 4JRIA 1WIEA 5HKCA 2G3RA 2LCSA 1O75A 4D8KA 1YBYA 3EGDA 3FRNA 2WSCE 2K5FA 2R5MA 3FDRA 3OY9A 5CQXA 5GAMh 3VS1A 1G3TA 3O5ZA 9ATCB 1SSFA 3S3MA 3VS2A 4QVCA 4FYXB 4PJOD 4M75F 3C12A 4E6RA 3X24B 2B8AA 1W2BP 3QO3A 1M1KR 3CCUT 1UHFA 1VQLQ 4O6JA 3G7ZA 4IURA 4CI0C 4E7LA 2DD5A 1X2KA 2ABLA 2D6FA 2JTEA 3JCMd 4IUUA 5CQYA 2HQHA 5GANd 3CCRQ 4J8OA 2F1LA 1NLOC 1BBZA 1SKUB 4E7JA 1AWJA 2CZ6B 4RTWA 3RDVA 2AZVA 5KYXB 2V8JA 4A63B 5A0DA 2OTLT 4BDZA 1Q86U 2RHUA 1G3SA 3RESA 3PIPA 4XU0A 3ZFJA 1HD3A 4M7AC 2IIMA 2P84A 2K5IA 3H41A 1GXIE 2LQWA 1VYUA 1I1JA 3OYKA 2F69A 4AFSC 2QGGA 1TH7A 1M1GA 1QKXA 2BKDN 1VQ8Q 4XTWA 1SHFA 3JB9G 4KH1B 2V1QA 1M90C 3CXCA 4OMMA 1K9AA 4KUIA 1WGSA 4RTTA 1W1FA 2CP7A 1TU0B 4C0DB 2M0YA 2V26A 2ZGWA 2FB7A 5GAN2 4DA4A 1PSEA 3D7SB 2CP5A 4RCBA 4C8QA 1H3HA 2RPNA 2DNUA 8ATCB 1UG1A 4ELZC 3I35A 5CKBA 2ZPHB 4E7HA 2OAUA 4IUPA 3OYHA 1N9SA 2QTXA 5L8RE 3CCUQ 2BIVA 1VQ6T 2DLPA 3WVEB 2DX1A 4JPBW 2FZKB 2IVWA 3SWNC 4HCBA 4PJLA 2KXDA 4NS5A 4J6WA 1I5LA 2NUZA 4M78C 1Y7XA 5KH6A 2E5QA 5CAIA 2ED0A 5GAN3 2RI3A 5IHKA 2DETA 1IB8A 2KK4A 1RAEB 2DERA 1YI2Q 2L0AA 2RJCA 3BDUA 4J5YA 4C8QE 3OW2P 5CKHA 4N0AC 2OTLQ 2DFUA 3VKIA 3RUXA 2DL5A 4FU6A 1GFCA 4PFPA 1YJWT 2NYSA 1BCMA 3LLRA 5GAMe 1QCFA 4OMFB 2P0QA 4FW1A 3OS0A 4M77D 2DJZA 5L23A 4NL3A 3CPFA 4F04B 1N8RU 2WACA 1VIFA 1O9SA 3LYIA 3S3OA 3RMSA 2RD1A 1Q81U 4C92A 1D1BA 4MZPA 4FSXA 4CC7A 2DZCA 2HEQA 1QW1A 4KGZB 2CH4W 1VQLA 4HT8A 1VQ7A 5D7UA 1PRMC 1I4K1 1KSWA 1YCSB 2RI2A 1C6VX 1WZOA 5IHIA 1G83A 4C8QG 2MMPA 3CPWP 5A2QE 3OA6A 1RACB 2Y4XA 2AK5A 3QKJA 1IO6A 4OMNA 1VQNA 1M5Q1 3H8ZA 4LDUA 1QVFS 3CCRA 4JDSA 1NYFA 2MWPA 4PJOC 1WHLA 2EJGA 3HRTA 4EMKB 3CC2A 2CSQA 3QIIA 2QGFB 5KYXA 5KYYA 2YUPA 4ZTJA 2GNCA 4C92E 2DEUA 1WJQA 2CYZB 3TEEA 2LX9A 2NUPA 2KE9A 3DLMA 1ZHIA 5I22A 3M54A 4ZN1A 4P5NA 4AG2C 1VQ8A 1BI2A 3QZ9B 3CC7T 2CSIA 2CT4A 2CZ0B 4IIMA 2RHIA 2KSSA 5GAOq 1VQ4A 3REBB 1YJWQ 3GF5A 3I55T 1OPLA 3M53A 3A8OB 1QVPA 1R0BG 5IAYA 2KMTA 2NLUA 1HJDA 4D6WA 2Z0WA 1KQSP 1QCNA 3QUIA 4M75A 4Z89A 1K1ZA 1G2BA 1MNDA 4JJDA 2DD4A 2DRKA 2AT1B 3EG9B 5I2SA 1JEGA 1RAGB 1GCPA 1RUWA 2ZPEB 3EG0A 3HRUA 1TXQA 5GJVB 1BIBA 4HVUA 4QT7A 2LRQA 3SDZA 1SSHA 4YTLA 1VQMT 1C0MA 1KC8R 5CIUA 2F5TX 2H8HA 2R5AA 5FWCA 1Y07A 5GAMj 2DBKA 3G4SQ 2EJ9A 1M1KU 4M75E 2HL5C 4F16A 2M51A 4JS5A 4B9WA 1YI2A 1JRIA 5CCAA 2OTLA 2AZSA 4IIOA 1WFWA 1PM3A 2DL4A 5D6YA 3RKWA 4OMQA 4PKCC 5IN1A 3V8JA 3JCMQ 2DL3A 2GF7A 2NWMA 3V7SA 4A54A 1JU5C 4MDWA 3JSCA 1QVGP 1M3CA 1LOJA 3CC7Q 4VUBA 4AFQC 1BIAA 2OTJA 5FU6B 3G71A 2A36A 1WLPB 1VQ5T 2BZ8A 2QQBA 3JCMW 3LWHA 3I55Q 2W0ZA 1CKBA 2CH4A 2RQUA 3M0SA 1WDXA 5HK0A 4XU1A 3A8GB 4QQ6A 1PKSA 2DA9A 2XDBA 1K8AC 1M90R 1X6GA 1ZLMA 1I81A 1NEBA 3CCQQ 2LCLA 3CBOA 1RI0A 4M75G 4EIKA 4PJNA 5CK9A 1Q7YC 2FPFA 2DTIA 2QQRA 1SEMA 1UE9A 4IUVA 2JMAA 1RI9A 1N5ZA 4M77C 2FPDA 1G8XA 4JJCA 3HL8A 1VQMQ 2ZCFB 4MZTA 4Y91A 2EFIA 1ZUKA 2DILA 2XHCA 1Y96B 1AZEA 1LCKA 2L89A 4BI4A 5LJ5j 2EYQA 3M0QA 4KT0E 4C8QD 4PJMA 4EMKA 1D0XA 5GAOr 1PHTA 2LVMA 1W6XA 2GQIA 3I56T 3MHXA 1NPPA 2DF6A 3L2ZA 5GAN8 3CPWA 4PJOG 2E10A 4F17A 4KULA 4N4GA 4E7KA 4QW2A 4RTVA 5GMKh 5KYNA 4LD9K 3TSZA 1OZ3A 3X20B 2ROLA 3V7CA 5GAMf 1BI1A 5I11A 1R0CB 4E47A 2YXYA 1TUDA 4E2FB 1VQ5Q 3JCMX 2DVJA 2P4RA 1M9SA 3H0IA 3EGXB 3EG9A 3M58A 1V76A 3SFMA 3CBPA 2K3YA 2LCCA 3OW2S 2DL7A 3FLGA 2E6NA 1NM7A 2RF0A 2GCXA 2JMCA 2RMOA 1N9RA 1NYGA 5LJ5g 1AWWA 4JRKA 2ROTA 1QCOA 3EG2A 2CZ7B
chains in the Genus database with same CATH topology
1B34B 3KBGA 4M75F 3C12A 1PSFA 3OYEA 3CMAT 3X25B 4X34A 3CCLT 4M7AA 1W2BS 3MP6A 3X24B 2B8AA 5GANe 3OYNA 5GANj 5GAN6 3M56A 4C5HA 4QQGA 1JJ2S 3QO3A 2DXTA 4X9CA 2LTOA 3QYHB 2P0KA 1KHIA 2ZPBB 1OZ2A 3QYGB 5LJ3g 3OS1A 3PTAA 3BFMA 3QJ6A 3CCUT 2RK1A 3E9FA 2HQEA 4O6JA 3J81E 2CGHA 2DAQA 5GAOm 3G4SA 1UEBA 3G7ZA 3OYDA 4C92D 5GAOl 3PMTA 4XU2A 1UGPB 4IURA 3OQ5A 2JUFA 4CI0C 4E7LA 3OSSC 3CEYA 3JB9F 2DD5A 4KUDK 1YITT 4BUGA 1XTDA 2D6FA 3JCMd 3LWIA 2R57A 4IUUA 3VUZA 5CQYA 3UPUA 2EQJA 2RHZA 4BY6B 3DLLA 5GANd 2V8IA 1NJIC 2DTHA 4J8OA 1W4SA 1UGSB 4XTUA 4C5GA 2X4JA 4E7JA 2CZ6B 4ELYC 3V7RA 5C0MA 1M1KC 2V8JA 1K9MU 3EFRA 3URGA 5A0DA 2OTLT 4MDXA 1M8VA 4BDZA 4A53A 2RHUA 1G3SA 3RESA 1Q86U 2K2VA 3M5AA 3PIPA 4M7DF 1U8RA 2E65A 4XK8E 1M4ZA 1K73C 4XU0A 4M7AE 3CC7A 2EAYA 3ZFJA 3L2UA 1D3BA 5FRNA 4M7AC 2PVGB 2X35A 2IG0A 2K5IA 3WVDB 1GXIE 2LQ8A 2LNVA 1KG1A 2ZPGB 4PNOA 3OYKA 1YCYA 2F69A 2QQSA 1WPYA 2MWOA 4XTZA 3G4ST 3PT9A 1TH7A 1M1GA 5GAN5 2BKDN 3C95A 3TU4K 1Q82C 1VQOA 3MP1A 3OMGA 4RG8A 4XTWA 4F7UF 4M77F 3DB3A 4B9XA 3JCMg 3JB9G 1VQ6A 3SWNA 1G3YA 1M90C 3EFSA 2EKOA 3CXCA 1YHQA 1G3WA 4ZGJB 3LH0A 3GOXA 5GANg 3DKMA 4KUIA 1WGSA 4HA8A 4M78A 3CCQA 2X4WA 1X6OA 3VUBA 2EJFA 3A8HB 4C0ZA 5KE3A 1W2BA 1VQ9A 4LDWA 1X01A 2DK3A 5FRMA 4C0DB 3F70A 1I8FA 3LW5E 3L1AA 2E6ZA 2K5LA 3E19A 2ZGWA 1WJRA 2FB7A 3X26B 5GAN2 4DA4A 1PSEA 4J6XA 1QVGA 3FC3A 4ATOA 1JB0E 3OB9A 1KD1C 4JJNK 3CCMA 5LJ3j 4RCBA 1RL2A 2QQAA 4N0AA 4XTYA 4C8QA 4M7DG 3OSVA 5C6SA 5J3BA 2XDPA 4ME7A 1WQ7A 3L2QA 4NOYA 4DOWA 2K57A 3OBYA 4M75D 1IZ6A 4EMHA 2VC8A 4J6YA 5AYFA 3SB2A 1H3ZA 1OI1A 3PGGA 2XK0A 5FU6C 4ELZC 5CKBA 2ZPHB 2K3XA 1VQOT 4HKEA 4E7HA 2OAUA 4IUPA 3OYHA 1U1TA 1N9SA 2QTXA 5CKFA 5L8RE 4RMOA 3BDLA 1YJWA 1KQSS 4M7AG 2BIVA 1VQ6T 2EQMA 3ASKA 3WVEB 3JRZA 4O5VA 3E1SA 1YHQT 1HXDA 4F7UG 5HY6A 4M77G 2IVWA 3SWNC 4C0FA 3JB9D 2EWNA 2XIDA 4C5EA 2D9TA 1NE8A 2VGNA 2HNIA 4J6WA 4NS5A 5DY9A 2RI5A 4GY5A 3CCQT 3S3NA 4M78E 4OF1A 2I2LA 1VQ9T 5GMKe 4X9DA 4M78C 4L6V5 3CCSA 1Y7XA 5KH6A 2E5QA 4OGEA 5GAOn 4M7DB 5CAIA 3MEVA 4ZN3A 3HPWA 3MP8A 4JUVA 5GAN3 2RI3A 4BE2A 3CCMT 4A4GA 5GMKi 2KK4A 4FL6A 3HKSA 4DQ2A 1QP2A 2RJCA 3BDUA 4J5YA 2X4XA 4BD3A 5CKHA 4C8QE 2XD0A 3QZ5B 4C8QC 4N0AC 4M7DD 4M7AB 2PVOB 3VJPA 3VKIA 3OYCA 2CKKA 3N5BB 3RUXA 4JLIA 2LC4A 4FU6A 4M77B 2RK2A 5CO7A 4F7UB 2E41A 4QVDA 2JTMA 3CCVT 1YJWT 3M4YA 5CKEA 2RH2A 1NPRA 3LLRA 5GAMe 4HCCA 2H3JA 3E9GA 4OMFB 3A5ZB 1K8AU 2P0QA 4L5GA 5KCOA 2RHXA 3HFOA 3OS0A 2RA2A 4PJOA 4M77D 2DJZA 2E12A 2EQUA 3OMCA 4R55A 2JTFA 1DJ7B 4DOVA 3CCST 4J83A 4Z02A 4NL3A 3CPFA 3QBYA 1Q7YU 1N8RU 5KE2A 4BE0A 2WACA 4CRIA 1VIFA 2EIFA 1O9SA 3V8LA 3QHSA 4EDUA 3LYIA 3S3OA 5GAMd 3RMSA 2DXBA 2RD1A 5D6WA 3T9NA 4EMGA 1Q81U 4A4EA 1B34A 4M78G 4MZMA 4C92A 5HK3A 1H641 4MZPA 1YJ9A 4FSXA 2DZCA 2GQVA 3MEUA 3CD6A 2V8KA 3RKXA 3GPLA 3LGFA 5FU7C 1M90U 1QW1A 3J7AF 3J80E 3CCEA 3AHUA 1VQLA 4HT8A 1VQ7A 5DM7R 3CBMA 2HQXA 1I4K1 2JZ2A 2HBPA 2VXFA 2XKOC 2RO0A 4OVAA 3CPWS 3JB9J 2RI2A 2L5QA 2FVUA 4QVZA 4OB1B 4C8QG 2MMPA 3JCMb 5A2QE 2YRVA 2FYKA 4MMKA 3JCMc 4A4KA 3OA6A 2R58A 2Y4XA 3QKJA 3PMIA 1VQNA 3NTIA 2WSFE 1M5Q1 3H8ZA 4LDUA 1QVFS 1HK9A 5LJ5f 3CCRA 4JDSA 1Y71A 2GFUA 3FB9A 2DXUA 2VGMA 3I55A 3OW2A 3BW1A 4M7AF 4PJOE 4JRQA 2MWPA 1S72A 4PJOC 4N4IA 2EJGA 4M78B 3OYBA 3CMEA 1ZBXA 5CKDA 3HRTA 3OS2A 4EMKB 3CC2A 4NL2A 2LQKA 3P8BB 3UT1A 3X28B 4BDYA 3QIIA 4XTVA 2DO3A 1ZQ1A 4LD6A 3ZBDA 2O4XA 4PLLA 5GAMg 5LJ5h 4HT9A 5LJ3f 4ZTJA 4HCBA 2E1HA 4JS4A 4BACA 1YJ9T 4C92E 3QXEB 1WJQA 2CYZB 1JJ2A 3CD6T 3DB4A 3TEEA 4C92C 2LX9A 2QXFA 4C8QB 3HRSA 5A0LA 3A8MB 3A8LB 3DLMA 3JB9I 3GNGA 1QP3A 3CCET 2GFAA 1ZHIA 2XU8A 3GIBA 1VQ7T 2M16A 2X4YA 4BB7A 1XOVA 3M54A 4ZN1A 4P5NA 3NTKA 1VQ8A 1BI2A 3QZ9B 3NTHA 3CC7T 1BYMA 4R56A 2PUOB 3JAME 2CZ0B 1VQMA 5LJ3h 5A0GA 2RHIA 1X75C 3KUFA 1Q86C 1VUBA 2KSSA 3MEAA 4KBMB 3VYHB 5GAOq 1VQNT 2RJEA 1N6AA 1KQ1A 1VQ4A 3WXMB 1Y96A 3GF5A 2L8DA 3I55T 3M53A 3A8OB 1QVPA 5IAYA 1S72T 1EIFA 1FXXA 2DXCA 2KMTA 2NLUA 4OB3B 1FX7A 1N27A 3PIOA 3CMET 4D6WA 2DIGA 3OS5A 2YLCA 3CC2T 5D6XA 1G5VA 3C4SA 2O01E 3JB9H 3QUIA 2DIQA 4M75A 2M1HA 3P8DA 3OYAA 3CC4A 1AHJB 2XG8D 2DD4A 2E70A 3OYIA 2LDMA 3FIFA 5I2SA 3R6OA 2DVEA 5GMKj 2PUKB 2Y90A 2ZPEB 1VQKA 4TVRA 4OP0A 3HRUA 3GNFB 2DKGA 3TCJA 1BIBA 2LRQA 4Q5WA 1QVFA 3ME9A 1YIJA 4M78F 3SDZA 3JCMf 1VQ8T 2JVVA 3M9QA 4YTLA 3EAEA 2QEXA 1VQMT 3PNWC 5GANf 3FJPA 1IREB 2PQWA 5CIUA 2F5TX 1OYXA 2LT4A 2ZPIB 4FM4B 5J26A 4XQ3A 1VQ4T 2CZ1B 3UWNA 3L42A 2F5KA 4HCZA 3M57A 1NJIU 3M55A 1JBMA 2KQWA 2R5AA 4C8QF 5GAN7 4XAXB 4C0GA 3JCMh 1XQHA 3GP8A 1Y07A 3OYFA 3OYJA 5GAMj 1VQ5A 2EJ9A 3M4GA 5GANh 3CC4T 4A4FA 4M7AD 4M7DA 3RMQA 1M1KU 2WSEE 4M75E 2RB6A 4ZTFA 5LL6S 4M75C 1UGRB 4C0DC 4JS5A 4B9WA 3MO8A 4IKFA 4EPCA 2VUBA 1VQKT 1BI3A 1YI2A 1K73U 1BI0A 3QG1A 4JRPA 1JRIA 2DEQA 1KC8C 4N4HA 2KDSA 3L2WA 2M0OA 1WJSA 5CCAA 2OTLA 5CR2A 4IUQA 3L2VA 4C92B 3HP9A 1M1FA 3VU3C 3MCAB 3S6WA 2XDDA 1YIJT 5FROA 2QA4A 5D6YA 3G6EA 3RKWA 3QJYA 4PKCC 5IN1A 3V8JA 4M77A 4F7UA 2QEXT 3JCMQ 3SD4A 2FHDA 5DLOA 1KQSA 2GF7A 1Q82U 3V7SA 1QVGS 1UB4A 4A54A 1UGQB 2RM4A 2QI2A 4MDWA 3RKYA 3JSCA 1U1SA 5FLXE 1D3BB 4Y28E 2XICA 4BE1A 5J39A 1VQPA 3MEWA 1LOJA 3QSUA 4VUBA 3HHTB 4LDVA 3UDCA 2JNGA 1BIAA 4FT4A 5FU6B 2OTJA 1I5LA 3CCJA 2AHJB 2VV5A 3G71A 1VQ5T 2KVQG 2QQBA 3JCMW 3LWHA 4WF2A 3HSBA 4ZGDB 2M9UA 4J7FA 3V8KA 4M7DE 2JOYA 1LNXA 1XNIA 5HK0A 4XU1A 2CS7A 4M7DC 2VXEA 3SWNB 4PLIA 3A8GB 2HD0A 4QQ6A 1BKBA 3OBWA 1KD1U 4V2SA 1YI2T 2XI9A 2XDBA 3VV0A 1K8AC 4OB0B 2O4XB 4ZGEB 3I56A 1I81A 5EG2A 2MAMA 2BUDA 3VYGA 2DPPB 4IUTA 4FIBA 2LCLA 3CBOA 4II1A 1RI0A 2QA4T 4M75G 2L3RA 2ZPFB 4PJOF 5CK9A 3G6ET 2VYTA 1Q7YC 2D0QB 5GAN4 2PVDB 2DTIA 2QQRA 4IUVA 4L59A 4J7IA 1N8RC 4LDXA 4F7UE 4M77E 5GMKm 1MHNA 4M77C 1R8OB 5IT9E 5GMKl 4M78D 2MF2A 1VQPT 2LT1A 4GLKA 1Q81C 3HL8A 4PL6A 1VQLT 2PU9B 3HFNA 1P92A 2ZCFB 2OTJT 4MZTA 3META 4Y91A 2EFIA 3CCJT 4C92F 3G71T 2C06A 2RJDA 2XHCA 1Y96B 2E64A 1K9MC 2L89A 3NFCA 4BI4A 5M9OA 5LJ5e 5LJ5j 4RKUE 2DZ9A 2A7YA 2EYQA 4UC4A 1MGQA 4KT0E 4C8QD 2JN0A 4QQDA 4C5IA 4EMKA 3CCRT 5DLQE 4BI8B 5GAOr 2QDYB 3ER0A 4M75B 2FL7A 3O8VA 3OYYA 4RCCA 5I2MA 3OYMA 5KCHA 4BY6C 1YJNA 2LVMA 4JLGA 5CVIA 3LGLA 5GAOp 2A3LA 4XTXA 3Q1JA 3I56T 3M59A 3MHXA 1NPPA 4RG2A 5LJ3e 3OYGA 4BI3A 3L2ZA 1WQWA 2K4YA 1KHCA 2DTOA 5GAN8 1WNLA 5LJ5d 2RJFA 3ZEHA 2ZZDA 3PFSA 3CPWA 4PJOG 2E10A 3OYLA 4KULA 4N4GA 3QPHA 4FT2A 1KQ2A 4E7KA 3LX7A 4QW2A 3JCMJ 5GMKh 3KXTA 3RERA 2MI6A 3CMAA 1FWZA 4E7IA 5FU7B 3CCLA 3JCMV 3CCVA 3H6ZA 2P0PA 3GLXA 1NZ9A 2EQKA 3FEOA 3L2RA 4LD9K 1OZ3A 5I21A 5LJ3d 3X20B 2YLBA 3BY7A 1KC8U 3V7CA 2KY9A 4C92G 5GAMf 3CCUA 1BI1A 3C94A 3JCMP 4JRIA 4E47A 2Y4YA 5HKCA 2G3RA 2KAFA 2P4TA 1O75A 3JCMX 2QQ9A 4EMKC 2YHTA 1YITA 1YJNT 1V29B 1M9SA 3P8HA 4MMLA 2HAXA 3RIRA 4PJOB 3QDRB 1YBYA 2RHYA 3M58A 3FRNA 4OGCA 3SFMA 2WSCE 2K5FA 2R5MA 3CBPA 2K3YA 2LCCA 3FDRA 4A4HA 5CQXA 3OY9A 5GAMh 3FLGA 3OW2S 2E6NA 1G3TA 2GCXA 4OB2B 1N9RA 1SSFA 5LJ5g 4JRKA 3TREA 3S3MA 4XU3A 1LJOA 4QVCA 3INZA 1VIEA 3CXCS 4LDYA 4PJOD 2CZ7B 3JCMe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  1B34 B;  4M75 F;  4J6W A;  3V8K A;  1I5L A;  2HNI A;  3GIB A;  1LNX A;  5DY9 A;  4M7D E;  4M7A A;  4XU1 A;  4M7D C;  2VXE A;  4M78 E;  3SWN B;  5GAN e;  2I2L A;  5GAN j;  4V2S A;  5GAN 6;  4X9D A;  4M78 C;  5GMK e;  5GAO n;  4M7D B;  3QO3 A;  2DXT A;  4X9C A;  5LJ3 h;  5CAI A;  5LJ3 g;  5GAO q;  3BFM A;  1I81 A;  4JUV A;  1KQ1 A;  5GAN 3;  2CGH A;  5GAO m;  1Y96 A;  4C92 D;  5GMK i;  5GAO l;  4M75 G;  4PJO F;  4XU2 A;  3JB9 F;  4DQ2 A;  5GAN 4;  2DTI A;  3BDU A;  4J5Y A;  4C8Q E;  3JCM d;  4C8Q C;  4F7U E;  4M77 E;  4N0A C;  5GMK m;  4M7D D;  4M7A B;  2YLC A;  4M77 C;  5GMK l;  3RUX A;  4M78 D;  3JB9 H;  5GAN d;  3QUI A;  4JLI A;  4M75 A;  2DTH A;  4F7U B;  4M77 B;  3HSB A;  4XTU A;  3HFN A;  2E41 A;  4QVD A;  3FIF A;  4PJO D;  4Y91 A;  3V7R A;  2DVE A;  4C92 F;  5GMK j;  2Y90 A;  5GAM e;  1Y96 B;  2E64 A;  4OP0 A;  2DKG A;  1BIB A;  5LJ5 e;  5LJ5 j;  3EFR A;  2DZ9 A;  1M8V A;  4M7D F;  1MGQ A;  4A53 A;  3RES A;  4C8Q D;  3HFO A;  2JN0 A;  2RA2 A;  4EMK A;  4M77 D;  2DJZ A;  4M78 F;  2E65 A;  4PJO A;  3JCM f;  4XU0 A;  5GAO r;  4M7A E;  2EAY A;  1D3B A;  4M75 B;  4RCC A;  4M7A C;  4NL3 A;  5GAN f;  3FJP A;  5GAO p;  4PNO A;  4XTX A;  1YCY A;  4XQ3 A;  4XTZ A;  1WPY A;  3QHS A;  3V8L A;  1TH7 A;  5LJ3 e;  5GAN 5;  5GAM d;  3L2Z A;  1WQW A;  2RD1 A;  4EMG A;  1JBM A;  5GAN 7;  2DTO A;  4C8Q F;  1WNL A;  5LJ5 d;  1B34 A;  4M78 G;  4XTW A;  4C92 A;  5GAN 8;  3JCM h;  1H64 1;  4F7U F;  4M77 F;  4PJO G;  2E10 A;  3JCM g;  3JB9 G;  2DZC A;  3SWN A;  5GAM j;  1KQ2 A;  3EFS A;  3RKX A;  2EJ9 A;  3M4G A;  5GAN h;  4M7A D;  3JCM J;  5GMK h;  4M7D A;  5GAN g;  3AHU A;  4HA8 A;  3RER A;  4M75 E;  4HT8 A;  2RB6 A;  4M78 A;  4M75 C;  3JCM V;  2EJF A;  1I4K 1;  2VXF A;  3JB9 J;  1X01 A;  5I21 A;  4C8Q G;  1I8F A;  1JRI A;  2DEQ A;  5LJ3 d;  2FYK A;  2YLB A;  3L1A A;  4MMK A;  3JCM c;  3JCM b;  3BY7 A;  3V7C A;  4C92 G;  2ZGW A;  2FB7 A;  5GAM f;  5GAN 2;  4C92 B;  4J6X A;  4JRI A;  3JCM P;  1M5Q 1;  1HK9 A;  3VU3 C;  5LJ5 f;  3JB9 D;  3FB9 A;  5LJ3 j;  2DXU A;  4M7A F;  4RCB A;  3BW1 A;  4XTY A;  4N0A A;  3RKW A;  4C8Q A;  3JCM X;  4M7D G;  4PJO E;  3V8J A;  4EMK C;  4F7U A;  4M77 A;  4PJO C;  1WQ7 A;  2YHT A;  3JCM Q;  4NOY A;  2EJG A;  2K57 A;  4M78 B;  4M75 D;  4MML A;  3RIR A;  2VC8 A;  3V7S A;  4A54 A;  4EMH A;  4J6Y A;  4EMK B;  4PJO B;  4NL2 A;  2RM4 A;  3RKY A;  3SB2 A;  1U1S A;  3PGG A;  1D3B B;  4XTV A;  5GAM h;  1LOJ A;  3QSU A;  5GAM g;  5LJ5 h;  1BIA A;  4HT9 A;  5LJ3 f;  1N9R A;  1U1T A;  1N9S A;  2QTX A;  5LJ5 g;  4JRK A;  2E1H A;  4M7A G;  4XU3 A;  4C92 E;  1LJO A;  4C92 C;  3INZ A;  4QVC A;  3JCM W;  4C8Q B;  1HXD A;  4WF2 A;  4F7U G;  4M77 G;  3JB9 I;  3SWN C;  3JCM e; 
#chains in the Genus database with same CATH topology
 3KBG A;  3CXC P;  1PSF A;  4X34 A;  1YJ9 Q;  1JJ2 S;  4QQG A;  2DXT A;  2OX7 A;  3QYH B;  1KHI A;  5LJ3 g;  3J81 E;  2HQE A;  3G4S A;  1U06 A;  1M2V B;  2RQR A;  4C92 D;  4RTU A;  2PNI A;  5GAO l;  1K73 R;  3PMT A;  4XU2 A;  2X3X D;  2X9H A;  1AD5 A;  3OSS C;  1YIT T;  4BUG A;  4KH0 B;  1RAB B;  2FZG B;  1NJI C;  1W4S A;  1U5S A;  1Q82 R;  4Y92 A;  3V7R A;  5C0M A;  1OPK A;  1K9M U;  4FCY A;  1M8V A;  4M7D F;  2L3P A;  2A28 A;  2K2V A;  3M5A A;  1I07 A;  2E65 A;  4XK8 E;  3M0P A;  3CC7 A;  3PE0 A;  5FRN A;  1KIK A;  2LNH B;  4J9B A;  2IG0 A;  2PZ1 A;  2QQS A;  2MWO A;  3PT9 A;  5GAN 5;  3KFV A;  3THK A;  3TU4 K;  1VQO A;  2L3S A;  4F7U F;  2I0N A;  3JV3 A;  1FYN A;  3EFS A;  1MMG A;  1UUE A;  3LH0 A;  3CCQ A;  3VUB A;  1OUL A;  4C0Z A;  1VQ9 A;  3UF4 A;  1FMW A;  2LZ6 B;  4LDW A;  1X01 A;  2DK3 A;  1K0S A;  2KRS A;  3CQT A;  5FRM A;  3L1A A;  2K5L A;  1QVG A;  2KBT A;  3FC3 A;  3OB9 A;  1KD1 C;  4JJN K;  5AT1 B;  1ACM B;  2COZ A;  4ME7 A;  5J3B A;  1WQ7 A;  4LUE A;  1M3B A;  4M75 D;  1IZ6 A;  2VC8 A;  2CP6 A;  2JXB A;  1MUZ A;  1H3Z A;  1OI1 A;  1OU8 A;  4J9G A;  1UTI A;  2A37 A;  2K3X A;  1KQS S;  2VWF A;  2HL3 A;  2EQM A;  3JRZ A;  2BE9 B;  1YHQ T;  2XMF A;  2HDA A;  4M77 G;  4PFZ A;  2EWN A;  2XID A;  2YSQ A;  4C5E A;  1IXD A;  5DY9 A;  1LVK A;  1YIT Q;  2CUD A;  5KYU B;  3VS0 A;  5GMK e;  4L6V 5;  4M7D B;  3ZL7 C;  3HPW A;  4FW2 A;  1YWO A;  3CCM T;  1UFF A;  4A4G A;  2J6F A;  2JT4 A;  1NBE B;  3HKS A;  4C8Q C;  1T0H A;  4M7A B;  4ANJ A;  2PVO B;  3VJP A;  1UJY A;  2EKH A;  4F7U B;  2QA4 Q;  3G6E Q;  2RK2 A;  1MV3 A;  4QVD A;  3CCV T;  1NPR A;  4J9C A;  2H3J A;  2L2P A;  1S1N A;  2RA2 A;  3EGX A;  2EQU A;  2QDL A;  2JTF A;  1DJ7 B;  4DOV A;  3CCS T;  4J83 A;  4Z02 A;  2C0O A;  1MMN A;  3QHS A;  5GAM d;  2DXB A;  3T9N A;  3EH2 A;  5KYW B;  4A4E A;  1X2Q A;  2EPD A;  1YJ9 A;  3CD6 A;  2RQW A;  3RKX A;  3GPL A;  3LGF A;  5FU7 C;  1M90 U;  2RN8 A;  3J80 E;  3CCE A;  2HSP A;  2KNB B;  3CBM A;  2HQX A;  2XKO C;  4OVA A;  2VXF A;  2F2W A;  2L5Q A;  2E3H A;  2J6K A;  2YRV A;  3JCM c;  4MMK A;  1IRX A;  4A4K A;  3NTI A;  2WSF E;  3NGP A;  1HYO A;  5ECA A;  2AKL A;  1D0Z A;  1YNZ A;  3VRY A;  2GFU A;  2L3Q A;  3FB9 A;  4JRQ A;  1S72 A;  1YHQ Q;  1T0J A;  4M78 B;  5CKD A;  1D1A A;  3P8B B;  4BDY A;  4XTV A;  2DO3 A;  2FRW A;  4LD6 A;  5LJ5 h;  2EQI A;  2DJQ A;  4JS4 A;  4BAC A;  3QXE B;  1BCO A;  2J05 A;  3I9Q A;  5FW9 A;  2KGT A;  4C92 C;  2QXF A;  3HRS A;  3CCM Q;  1YP5 A;  2CP2 A;  3IQL A;  1XOV A;  3NTK A;  3NTH A;  1BYM A;  1AZG B;  1GCQ C;  4PFO A;  3JAM E;  5LJ3 h;  5A0G A;  1SHG A;  1X75 C;  1Q86 C;  2EYZ A;  2RJE A;  3CCV Q;  1C1A A;  1ZSZ A;  1EIF A;  2DXC A;  4AT1 B;  2NUT B;  3CME T;  4ORZ A;  2LX7 A;  4AG1 C;  5IXF A;  2DIQ A;  1KFZ A;  2M1H A;  2B86 A;  1AHJ B;  3CCS Q;  1MMD A;  2LDM A;  3SEM A;  2DVE A;  3RNJ A;  5GMK j;  1VQK A;  2F2V A;  4HCK A;  2D1X A;  2LMJ A;  1QVF A;  4KGV B;  1QWF A;  3EAE A;  1ABQ A;  3PNW C;  2ECZ A;  2O9V A;  1OYX A;  4FM4 B;  5J26 A;  3UWN A;  3L42 A;  4HVW A;  2KQW A;  5GAN 7;  1XQH A;  3GP8 A;  5KYU A;  2ESW A;  2DMO A;  3CC4 T;  4M7D A;  4M75 C;  1UGR B;  4C0D C;  2YT6 A;  4EPC A;  1BI3 A;  1K73 U;  4JRP A;  2KDS A;  2YDL A;  1WJS A;  1B3Q A;  4IUQ A;  3HP9 A;  1YIJ T;  2QA4 A;  3G6E A;  4F7U A;  2QEX T;  3SD4 A;  1Q82 U;  1UB4 A;  2OI3 A;  2RM4 A;  1U1S A;  1D3B B;  4CC2 A;  4BE1 A;  2DM1 A;  3QSU A;  2EYX A;  2O88 A;  3UDC A;  2JNG A;  1A0N B;  4J7F A;  4M7D E;  2VXE A;  1Z9Q A;  4PLI A;  4V2S A;  2HD0 A;  3OBW A;  1VQ6 Q;  1D09 B;  1OQK A;  3VV0 A;  1K9M R;  2O4X B;  4M4Z A;  4ZGE B;  2H3E B;  3VYG A;  2W10 A;  2CDT A;  4IUT A;  4D8D A;  4OMO A;  2ZPF B;  1N8R C;  4J7I A;  2EYY A;  2JM8 A;  4F7U E;  5GMK m;  4AMC A;  2KRO A;  1VQP T;  1Q81 C;  1ZSG A;  4PL6 A;  2FZC B;  1V1C A;  3CCJ T;  1EX4 A;  2C06 A;  3NFC A;  5M9O A;  5LJ5 e;  2DZ9 A;  2A7Y A;  3TSW A;  4C5I A;  3UA6 A;  4BY6 C;  3CC4 Q;  2FRY A;  2MYS A;  4DBH A;  4RG2 A;  1I0C A;  5LJ3 e;  2DYI A;  2J7I A;  3OYG A;  1WQW A;  2DTO A;  3VS3 A;  3QPH A;  1KQ2 A;  3LX7 A;  1YIJ Q;  3JCM J;  1RAD B;  1AVZ C;  2QEX Q;  3JCM V;  2AKK A;  3CCV A;  3I5S A;  2EQK A;  1F1B B;  3NPF A;  4C92 G;  3CCU A;  3C94 A;  3JCM P;  2NUT A;  1CSK A;  1CKA A;  2Y4Y A;  1IGU A;  2KAF A;  2HBW A;  4EMK C;  3NMZ C;  1YJN T;  3P8H A;  4MML A;  2HAX A;  3RIR A;  3QDR B;  2RHY A;  4A4H A;  1QKW A;  1K0X A;  3TRE A;  4XU3 A;  2QAZ A;  1VIE A;  2HZY A;  4LDY A;  1WHH A;  4KBM B;  3CMA T;  3CCL T;  1W2B S;  3MP6 A;  5GAN j;  2YUN A;  4C5H A;  1RAF B;  4J9I A;  4X9C A;  2LTO A;  1VQP Q;  2ZPB B;  1OZ2 A;  3OS1 A;  3PTA A;  2RK1 A;  2CGH A;  2DAQ A;  1BB9 A;  1UEB A;  2MPX C;  3SHW A;  3CCJ Q;  1UGP B;  3JB9 F;  2F2X A;  3CEY A;  2R57 A;  3UPU A;  2RHZ A;  3DLL A;  2V8I A;  1AOJ A;  4XTU A;  2X4J A;  4ELY C;  1M1K C;  2LJ1 A;  3EFR A;  3URG A;  4MDX A;  2ATC B;  2HKQ B;  1TUC A;  2EAY A;  1D3B A;  2PVG B;  2X35 A;  3WVD B;  2LNV A;  1KG1 A;  2ZPG B;  1KK7 A;  1YCY A;  2RNA A;  4DBR A;  1WI7 A;  3MP1 A;  4RG8 A;  4B9X A;  1B7T A;  3JCM g;  1VQ6 A;  3ULR B;  1GBQ A;  2EKO A;  1G3W A;  3GOX A;  5GAN g;  3DKM A;  4J9E A;  4HA8 A;  2VAS A;  1OEB A;  5KE3 A;  2EJF A;  3A8H B;  1ZA2 B;  1YJN Q;  1X43 A;  2KT8 A;  1M30 A;  2JS0 A;  1I8F A;  2J6O A;  1QMC A;  3E19 A;  3X26 B;  1D0Y A;  4ATO A;  2D8H A;  1JB0 E;  2K9G A;  5LJ3 j;  1UHC A;  1RL2 A;  2QQA A;  4XTY A;  3OSV A;  5C6S A;  3L2Q A;  4DOW A;  4EMH A;  4J6Y A;  4GBQ A;  5FU6 C;  1WHJ A;  1D1C A;  4HKE A;  2RQV A;  2QK0 A;  1YJW A;  3TQ7 P;  1U1T A;  5CKF A;  4RMO A;  3ASK A;  2GTJ A;  1X6B A;  2O9S A;  3EGU A;  2D9T A;  3M0T A;  2HNI A;  4OF1 A;  1E7O A;  1UEC A;  4X9D A;  5GAO n;  4OGE A;  2E3I A;  4E7Z A;  1QLY A;  4FL6 A;  2X4X A;  3QZ5 B;  1RAH B;  2CRE A;  4M7D D;  3OYC A;  3QWX X;  4JLI A;  5CO7 A;  2JJ9 A;  4PJJ A;  2E41 A;  2K7A A;  2RH2 A;  1ZUY A;  2O2O A;  4HCC A;  3E9G A;  2BZX A;  2VB6 A;  1OV3 A;  2CP0 A;  2RHX A;  3HFO A;  1B07 A;  3HTR A;  3OMC A;  4JZ4 A;  2COW A;  1Y57 A;  5KE2 A;  4BE0 A;  4CRI A;  1Q95 G;  3V8L A;  5D6W A;  2C0I A;  4OMP A;  1H64 1;  3PVQ A;  2GQV A;  3I56 Q;  2V8K A;  3FJ5 A;  3GBQ A;  3AHU A;  2J06 A;  1YN8 A;  2JZ2 A;  2HBP A;  4RTZ A;  3CPW S;  1X27 A;  2FYK A;  4KRT A;  4HVV A;  3PMI A;  1HK9 A;  5LJ5 f;  3I55 A;  1K4U S;  4M7A F;  2SEM A;  1QVF P;  3VS6 A;  2DRM A;  4N4I A;  1ZBX A;  4LUD A;  4NL2 A;  3UT1 A;  1IGQ A;  1ZQ1 A;  2DL8 A;  3ZBD A;  4HT9 A;  5LJ3 f;  4FYV B;  1VYT A;  1MMA A;  3E2U A;  5A0L A;  4C8Q B;  1FMK A;  3A8L B;  3GNG A;  1QP3 A;  2GFA A;  2XU8 A;  2E4H A;  1VQ7 T;  2M16 A;  5IHN A;  1AWX A;  2JW4 A;  1TS9 A;  4R56 A;  1VQM A;  2GGR A;  2KXC A;  1VUB A;  2FEI A;  3VYH B;  5IXB A;  1VQN T;  1LPL A;  1Y96 A;  5FWB A;  1TSF A;  2A0F B;  4OB3 B;  1FX7 A;  1M8M A;  2QG9 B;  3CC2 T;  5D6X A;  1G5V A;  2O01 E;  3JB9 H;  3OYI A;  4DBQ A;  3FIF A;  2PUK B;  2Y90 A;  4OP0 A;  3GNF B;  2DKG A;  3TCJ A;  2LJ0 A;  2MIO A;  1WYX A;  4M78 F;  1WXB A;  1VQ8 T;  3A98 A;  4JJB A;  2BE7 D;  2LT4 A;  2ZPI B;  1VQ4 T;  4ZNX A;  1PWT A;  2MCN A;  2YRD A;  2F5K A;  3M55 A;  1JBM A;  1OX8 A;  1ZSZ C;  4XAX B;  4C0G A;  3JCM h;  4LXC A;  3OYF A;  1VQ5 A;  2K79 A;  4JZ3 A;  2FPE A;  5GAN h;  1WHG A;  4ZTF A;  3VS5 A;  4IKF A;  2VUB A;  4K11 A;  1KC8 C;  4N4H A;  3U23 A;  3L2W A;  2M0O A;  1RLP C;  2D8J A;  4C92 B;  1M1F A;  3L2V A;  1WHK A;  3A1P A;  2XDD A;  4WTO B;  1H92 A;  3QJY A;  2CT3 A;  2KYB A;  1K8A R;  2FHD A;  5DLO A;  1QVG S;  1VQ7 Q;  1UGQ B;  3H0F A;  2QI2 A;  3RKY A;  1QQJ A;  4J9H A;  3VS4 A;  2LQN A;  2XIC A;  3HHT B;  1Q7Y R;  1H8K A;  1GFD A;  1M2V A;  2VV5 A;  4RTX A;  1VQN Q;  2OJ2 A;  4J9D A;  1SG5 A;  4WF2 A;  1NLP C;  3V8K A;  1LNX A;  2GBQ A;  4M7D C;  2CS7 A;  3SWN B;  1SF9 A;  1SPK A;  3CC2 Q;  1YI2 T;  3EHQ A;  1IHW A;  5KYY B;  1VOM A;  3I56 A;  2MAM A;  4FIB A;  1IHV A;  1JO8 A;  2L3R A;  4PJO F;  2NUP B;  2VYT A;  2D0Q B;  5GAN 4;  1XJW B;  2HSE B;  2PVD B;  4LDX A;  3EH1 A;  1VA7 A;  2MF2 A;  2LT1 A;  1UGV A;  1WXU A;  4GLK A;  3TVT A;  4FSS A;  2OTJ T;  3UAT A;  3G71 T;  2RJD A;  2EYW A;  1VQ4 Q;  1W70 A;  4UC4 A;  3MPU B;  4QQD A;  4M75 B;  1OX9 A;  2FL7 A;  4RCC A;  4Z88 A;  5I2M A;  1Z9Z A;  3OYM A;  4JLG A;  5CVI A;  3VS7 A;  1M2O A;  2A3L A;  3M59 A;  2DYB A;  1UJ0 A;  1J3T A;  4BI3 A;  2K4Y A;  1KHC A;  2HKN A;  1WNL A;  5LJ5 d;  8AT1 B;  3OYL A;  2K3B A;  3KXT A;  3RER A;  2MI6 A;  1K76 A;  4E7I A;  2SRC A;  3H6Z A;  2P0P A;  1PG5 B;  3FEO A;  1SRM A;  5LJ3 d;  2KY9 A;  3QDF A;  2KI7 A;  1PKT A;  2P4T A;  4PK4 A;  2QQ9 A;  2YHT A;  1YIT A;  1V29 B;  1PRL C;  4PJO B;  4OGC A;  2RQT A;  1ZA1 B;  2EVR A;  1GRI A;  1TTH B;  1M27 C;  1PD1 A;  4OB2 B;  2K2M A;  1LJO A;  1YWP A;  3INZ A;  3CXC S;  1JXM A;  1NJI R;  2FO0 A;  3JCM e;  1B34 B;  3OYE A;  2IPO B;  1BU1 A;  3X25 B;  4M7A A;  5GAN e;  3OYN A;  5GAN 6;  3M56 A;  1X69 A;  2P0K A;  1AWO A;  3QYG B;  2VKN A;  1JJ2 P;  3BFM A;  1NEG A;  3QJ6 A;  3E9F A;  4F14 A;  5GAO m;  1FMV A;  2OTJ Q;  3OYD A;  3G1J A;  3G71 Q;  3OQ5 A;  2JUF A;  3M0R A;  4KUD K;  1T3S A;  1XTD A;  3LWI A;  3VUZ A;  2KEA A;  2EQJ A;  4BY6 B;  5HCK A;  2DTH A;  1UGS B;  4C5G A;  3CME Q;  2ED1 A;  2X3W D;  2KT1 A;  5KYW A;  2G6F X;  4A53 A;  1GCQ A;  1U8R A;  1M4Z A;  5GJW B;  1K73 C;  4M7A E;  3L2U A;  3LH5 A;  4R0K A;  2LQ8 A;  4PNO A;  4XTZ A;  1WPY A;  3G4S T;  1KD1 R;  3C95 A;  2QYZ A;  2EBP A;  1Q82 C;  3OMG A;  4M77 F;  3DB3 A;  3SWN A;  1G3Y A;  1YHQ A;  3M0U A;  4ZGJ B;  2CUB A;  2HMA A;  3RBB B;  1NG2 A;  4M78 A;  2KRM A;  2X4W A;  1X6O A;  1W2B A;  1BK2 A;  3F70 A;  3BE3 A;  3LW5 E;  1TOV A;  1QWE A;  2E6Z A;  2ZAE A;  1WJR A;  4J6X A;  1JXO A;  3CCM A;  4M7D G;  4N0A A;  2YUO A;  2BZY A;  4LNP A;  2XDP A;  4NOY A;  2K57 A;  3OBY A;  5AYF A;  4DEX A;  3SB2 A;  1I5O B;  3PGG A;  2XK0 A;  4J9F A;  1VQO T;  4M7A G;  3BDL A;  1TG0 A;  2EGA A;  1OOT A;  4O5V A;  3E1S A;  1HXD A;  4F7U G;  5HY6 A;  3JB9 D;  4C0F A;  1AEY A;  2FG0 A;  2VGN A;  1NE8 A;  3CCQ T;  2RI5 A;  4GY5 A;  3S3N A;  1T3L A;  4M78 E;  2I2L A;  1VQ9 T;  1MNE A;  3CCS A;  2GTO A;  2QAS A;  4AFZ C;  3MEV A;  4ZN3 A;  5IH2 A;  3MP8 A;  4JUV A;  4BE2 A;  5GMK i;  1M3A A;  4DQ2 A;  1QP2 A;  4BD3 A;  1ZX6 A;  2XD0 A;  4GLM A;  3EG3 A;  2CKK A;  3N5B B;  2LC4 A;  3AT1 B;  4M77 B;  4DBF A;  1GL5 A;  2JTM A;  3M4Y A;  5CKE A;  3H0H A;  4RUG A;  3A5Z B;  1K8A U;  4L5G A;  2A08 A;  5KCO A;  4PJO A;  2AIR B;  2E12 A;  4R55 A;  1RAA B;  2D0N A;  4FYY B;  3QBY A;  1Q7Y U;  1PC0 A;  2EIF A;  4EDU A;  2COY A;  4EMG A;  1B34 A;  4M78 G;  4MZM A;  5HK3 A;  4AFU C;  3MEU A;  1PD0 A;  3J7A F;  5DM7 R;  2C0T A;  1GBR A;  2RO0 A;  3QWY A;  3JB9 J;  2FVU A;  4QVZ A;  4OB1 B;  3JCM b;  4X1V A;  2R58 A;  2YRC A;  7AT1 B;  1VQO Q;  2QTV A;  1Y71 A;  3OW2 A;  2DXU A;  2VGM A;  4PJO E;  3BW1 A;  3UA7 A;  3EG1 A;  3NHN A;  6AT1 B;  3OYB A;  3CME A;  1Q86 R;  3OS2 A;  2LQK A;  4FYW B;  3X28 B;  1VQ9 Q;  3I5R A;  2O4X A;  4PLL A;  5GAM g;  2CP3 A;  2E1H A;  2O31 A;  1YJ9 T;  2YUQ A;  3CD6 T;  1JJ2 A;  3DB4 A;  2MOX A;  3A8M B;  3REA B;  1ABO A;  3JB9 I;  3CCE T;  3VRZ A;  3GIB A;  2X4Y A;  4BB7 A;  3EFO B;  4DEY A;  2PUO B;  3KUF A;  5EC7 A;  3MEA A;  3CMA Q;  1N6A A;  1KQ1 A;  2JS2 A;  3CCL Q;  1AT1 B;  1KJW A;  3WXM B;  2L8D A;  1S72 T;  1ZUU A;  1FXX A;  4CC4 B;  1N27 A;  3PIO A;  2VVK A;  2DIG A;  3OS5 A;  2YLC A;  4CC3 A;  3C4S A;  3RR6 A;  3OYA A;  3CC4 A;  1Y0M A;  3P8D A;  2KR3 A;  1MV0 B;  2XG8 D;  2E70 A;  3R6N A;  4B6M A;  1EZZ B;  3R6O A;  4ESR A;  3EGD B;  4Z8A A;  2V1R A;  4TVR A;  2KYM A;  1TUG B;  1OU9 A;  2EGC A;  1WHM A;  4Q5W A;  1WXT A;  3ME9 A;  1YIJ A;  3JCM f;  2JVV A;  2OAW A;  3M9Q A;  2E5K A;  2QEX A;  3C0C A;  5GAN f;  3FJP A;  1IRE B;  2PQW A;  4XQ3 A;  2CZ1 B;  4HCZ A;  3M57 A;  1NJI U;  2LP5 A;  4LN2 A;  4C8Q F;  1E6G A;  3OYJ A;  3M4G A;  4QKU A;  4M7A D;  4A4F A;  1PCX A;  3RMQ A;  2WSE E;  2RB6 A;  4LE9 A;  4RTY A;  5LL6 S;  3MO8 A;  1VQK T;  1BI0 A;  3QG1 A;  2DEQ A;  5CR2 A;  4OML A;  3VU3 C;  3MCA B;  1SRL A;  3S6W A;  5FRO A;  3CD6 Q;  4M77 A;  1KQS A;  3CCE Q;  5FLX E;  1VQP A;  4Y28 E;  5J39 A;  3MEW A;  2EGE A;  1R77 A;  1E6H A;  4LDV A;  4FT4 A;  1N8R R;  2DE0 X;  4WCI A;  3CCJ A;  2AHJ B;  2KVQ G;  3HSB A;  4ZGD B;  2M9U A;  1VYV A;  1Q81 R;  2JOY A;  1XNI A;  1S72 Q;  1BKB A;  1KD1 U;  1PNJ A;  2XI9 A;  4OB0 B;  1WA7 A;  5EG2 A;  2BUD A;  2DPP B;  1UDL A;  4II1 A;  4KGX B;  2QA4 T;  3G6E T;  1RAI B;  4L59 A;  2MK5 A;  1EFN A;  4M77 E;  1MHN A;  2EW3 A;  1R8O B;  5IT9 E;  5GMK l;  4M78 D;  1TWB A;  1VQL T;  2PU9 B;  3H9N A;  3HFN A;  1P92 A;  1YFN A;  3MET A;  1WX6 A;  2K6D A;  4C92 F;  2E64 A;  1ZSZ B;  2LJ3 A;  1K9M C;  1ARK A;  1ZBJ A;  3EHR A;  4RKU E;  1MGQ A;  2JN0 A;  3CCR T;  5DLQ E;  4BI8 B;  2QDY B;  3ER0 A;  3OYY A;  3O8V A;  2ENM A;  5KCH A;  1YJN A;  2JM9 A;  3LGL A;  5GAO p;  3MJX A;  3PVL A;  2M02 A;  3Q1J A;  4XTX A;  2DBM A;  2BTT A;  1VQK Q;  2RJF A;  3ZEH A;  2ZZD A;  2X51 A;  3PFS A;  3EFO A;  4FT2 A;  1RLQ C;  1U3O A;  2YWW A;  1JQQ A;  4E7S A;  2PTK A;  3CMA A;  1FWZ A;  2HCK A;  2KRN A;  5FU7 B;  3CCL A;  3MKD A;  3GLX A;  1NZ9 A;  3L2R A;  5I21 A;  1HSQ A;  2YLB A;  3BY7 A;  1KC8 U;  4HXJ A;  4JRI A;  1WIE A;  5HKC A;  2G3R A;  2LCS A;  1O75 A;  4D8K A;  1YBY A;  3EGD A;  3FRN A;  2WSC E;  2K5F A;  2R5M A;  3FDR A;  3OY9 A;  5CQX A;  5GAM h;  3VS1 A;  1G3T A;  3O5Z A;  9ATC B;  1SSF A;  3S3M A;  3VS2 A;  4QVC A;  4FYX B;  4PJO D;  4M75 F;  3C12 A;  4E6R A;  3X24 B;  2B8A A;  1W2B P;  3QO3 A;  1M1K R;  3CCU T;  1UHF A;  1VQL Q;  4O6J A;  3G7Z A;  4IUR A;  4CI0 C;  4E7L A;  2DD5 A;  1X2K A;  2ABL A;  2D6F A;  2JTE A;  3JCM d;  4IUU A;  5CQY A;  2HQH A;  5GAN d;  3CCR Q;  4J8O A;  2F1L A;  1NLO C;  1BBZ A;  1SKU B;  4E7J A;  1AWJ A;  2CZ6 B;  4RTW A;  3RDV A;  2AZV A;  5KYX B;  2V8J A;  4A63 B;  5A0D A;  2OTL T;  4BDZ A;  1Q86 U;  2RHU A;  1G3S A;  3RES A;  3PIP A;  4XU0 A;  3ZFJ A;  1HD3 A;  4M7A C;  2IIM A;  2P84 A;  2K5I A;  3H41 A;  1GXI E;  2LQW A;  1VYU A;  1I1J A;  3OYK A;  2F69 A;  4AFS C;  2QGG A;  1TH7 A;  1M1G A;  1QKX A;  2BKD N;  1VQ8 Q;  4XTW A;  1SHF A;  3JB9 G;  4KH1 B;  2V1Q A;  1M90 C;  3CXC A;  4OMM A;  1K9A A;  4KUI A;  1WGS A;  4RTT A;  1W1F A;  2CP7 A;  1TU0 B;  4C0D B;  2M0Y A;  2V26 A;  2ZGW A;  2FB7 A;  5GAN 2;  4DA4 A;  1PSE A;  3D7S B;  2CP5 A;  4RCB A;  4C8Q A;  1H3H A;  2RPN A;  2DNU A;  8ATC B;  1UG1 A;  4ELZ C;  3I35 A;  5CKB A;  2ZPH B;  4E7H A;  2OAU A;  4IUP A;  3OYH A;  1N9S A;  2QTX A;  5L8R E;  3CCU Q;  2BIV A;  1VQ6 T;  2DLP A;  3WVE B;  2DX1 A;  4JPB W;  2FZK B;  2IVW A;  3SWN C;  4HCB A;  4PJL A;  2KXD A;  4NS5 A;  4J6W A;  1I5L A;  2NUZ A;  4M78 C;  1Y7X A;  5KH6 A;  2E5Q A;  5CAI A;  2ED0 A;  5GAN 3;  2RI3 A;  5IHK A;  2DET A;  1IB8 A;  2KK4 A;  1RAE B;  2DER A;  1YI2 Q;  2L0A A;  2RJC A;  3BDU A;  4J5Y A;  4C8Q E;  3OW2 P;  5CKH A;  4N0A C;  2OTL Q;  2DFU A;  3VKI A;  3RUX A;  2DL5 A;  4FU6 A;  1GFC A;  4PFP A;  1YJW T;  2NYS A;  1BCM A;  3LLR A;  5GAM e;  1QCF A;  4OMF B;  2P0Q A;  4FW1 A;  3OS0 A;  4M77 D;  2DJZ A;  5L23 A;  4NL3 A;  3CPF A;  4F04 B;  1N8R U;  2WAC A;  1VIF A;  1O9S A;  3LYI A;  3S3O A;  3RMS A;  2RD1 A;  1Q81 U;  4C92 A;  1D1B A;  4MZP A;  4FSX A;  4CC7 A;  2DZC A;  2HEQ A;  1QW1 A;  4KGZ B;  2CH4 W;  1VQL A;  4HT8 A;  1VQ7 A;  5D7U A;  1PRM C;  1I4K 1;  1KSW A;  1YCS B;  2RI2 A;  1C6V X;  1WZO A;  5IHI A;  1G83 A;  4C8Q G;  2MMP A;  3CPW P;  5A2Q E;  3OA6 A;  1RAC B;  2Y4X A;  2AK5 A;  3QKJ A;  1IO6 A;  4OMN A;  1VQN A;  1M5Q 1;  3H8Z A;  4LDU A;  1QVF S;  3CCR A;  4JDS A;  1NYF A;  2MWP A;  4PJO C;  1WHL A;  2EJG A;  3HRT A;  4EMK B;  3CC2 A;  2CSQ A;  3QII A;  2QGF B;  5KYX A;  5KYY A;  2YUP A;  4ZTJ A;  2GNC A;  4C92 E;  2DEU A;  1WJQ A;  2CYZ B;  3TEE A;  2LX9 A;  2NUP A;  2KE9 A;  3DLM A;  1ZHI A;  5I22 A;  3M54 A;  4ZN1 A;  4P5N A;  4AG2 C;  1VQ8 A;  1BI2 A;  3QZ9 B;  3CC7 T;  2CSI A;  2CT4 A;  2CZ0 B;  4IIM A;  2RHI A;  2KSS A;  5GAO q;  1VQ4 A;  3REB B;  1YJW Q;  3GF5 A;  3I55 T;  1OPL A;  3M53 A;  3A8O B;  1QVP A;  1R0B G;  5IAY A;  2KMT A;  2NLU A;  1HJD A;  4D6W A;  2Z0W A;  1KQS P;  1QCN A;  3QUI A;  4M75 A;  4Z89 A;  1K1Z A;  1G2B A;  1MND A;  4JJD A;  2DD4 A;  2DRK A;  2AT1 B;  3EG9 B;  5I2S A;  1JEG A;  1RAG B;  1GCP A;  1RUW A;  2ZPE B;  3EG0 A;  3HRU A;  1TXQ A;  5GJV B;  1BIB A;  4HVU A;  4QT7 A;  2LRQ A;  3SDZ A;  1SSH A;  4YTL A;  1VQM T;  1C0M A;  1KC8 R;  5CIU A;  2F5T X;  2H8H A;  2R5A A;  5FWC A;  1Y07 A;  5GAM j;  2DBK A;  3G4S Q;  2EJ9 A;  1M1K U;  4M75 E;  2HL5 C;  4F16 A;  2M51 A;  4JS5 A;  4B9W A;  1YI2 A;  1JRI A;  5CCA A;  2OTL A;  2AZS A;  4IIO A;  1WFW A;  1PM3 A;  2DL4 A;  5D6Y A;  3RKW A;  4OMQ A;  4PKC C;  5IN1 A;  3V8J A;  3JCM Q;  2DL3 A;  2GF7 A;  2NWM A;  3V7S A;  4A54 A;  1JU5 C;  4MDW A;  3JSC A;  1QVG P;  1M3C A;  1LOJ A;  3CC7 Q;  4VUB A;  4AFQ C;  1BIA A;  2OTJ A;  5FU6 B;  3G71 A;  2A36 A;  1WLP B;  1VQ5 T;  2BZ8 A;  2QQB A;  3JCM W;  3LWH A;  3I55 Q;  2W0Z A;  1CKB A;  2CH4 A;  2RQU A;  3M0S A;  1WDX A;  5HK0 A;  4XU1 A;  3A8G B;  4QQ6 A;  1PKS A;  2DA9 A;  2XDB A;  1K8A C;  1M90 R;  1X6G A;  1ZLM A;  1I81 A;  1NEB A;  3CCQ Q;  2LCL A;  3CBO A;  1RI0 A;  4M75 G;  4EIK A;  4PJN A;  5CK9 A;  1Q7Y C;  2FPF A;  2DTI A;  2QQR A;  1SEM A;  1UE9 A;  4IUV A;  2JMA A;  1RI9 A;  1N5Z A;  4M77 C;  2FPD A;  1G8X A;  4JJC A;  3HL8 A;  1VQM Q;  2ZCF B;  4MZT A;  4Y91 A;  2EFI A;  1ZUK A;  2DIL A;  2XHC A;  1Y96 B;  1AZE A;  1LCK A;  2L89 A;  4BI4 A;  5LJ5 j;  2EYQ A;  3M0Q A;  4KT0 E;  4C8Q D;  4PJM A;  4EMK A;  1D0X A;  5GAO r;  1PHT A;  2LVM A;  1W6X A;  2GQI A;  3I56 T;  3MHX A;  1NPP A;  2DF6 A;  3L2Z A;  5GAN 8;  3CPW A;  4PJO G;  2E10 A;  4F17 A;  4KUL A;  4N4G A;  4E7K A;  4QW2 A;  4RTV A;  5GMK h;  5KYN A;  4LD9 K;  3TSZ A;  1OZ3 A;  3X20 B;  2ROL A;  3V7C A;  5GAM f;  1BI1 A;  5I11 A;  1R0C B;  4E47 A;  2YXY A;  1TUD A;  4E2F B;  1VQ5 Q;  3JCM X;  2DVJ A;  2P4R A;  1M9S A;  3H0I A;  3EGX B;  3EG9 A;  3M58 A;  1V76 A;  3SFM A;  3CBP A;  2K3Y A;  2LCC A;  3OW2 S;  2DL7 A;  3FLG A;  2E6N A;  1NM7 A;  2RF0 A;  2GCX A;  2JMC A;  2RMO A;  1N9R A;  1NYG A;  5LJ5 g;  1AWW A;  4JRK A;  2ROT A;  1QCO A;  3EG2 A;  2CZ7 B; 
#chains in the Genus database with same CATH homology
 1B34 B;  3KBG A;  4M75 F;  3C12 A;  1PSF A;  3OYE A;  3CMA T;  3X25 B;  4X34 A;  3CCL T;  4M7A A;  1W2B S;  3MP6 A;  3X24 B;  2B8A A;  5GAN e;  3OYN A;  5GAN j;  5GAN 6;  3M56 A;  4C5H A;  4QQG A;  1JJ2 S;  3QO3 A;  2DXT A;  4X9C A;  2LTO A;  3QYH B;  2P0K A;  1KHI A;  2ZPB B;  1OZ2 A;  3QYG B;  5LJ3 g;  3OS1 A;  3PTA A;  3BFM A;  3QJ6 A;  3CCU T;  2RK1 A;  3E9F A;  2HQE A;  4O6J A;  3J81 E;  2CGH A;  2DAQ A;  5GAO m;  3G4S A;  1UEB A;  3G7Z A;  3OYD A;  4C92 D;  5GAO l;  3PMT A;  4XU2 A;  1UGP B;  4IUR A;  3OQ5 A;  2JUF A;  4CI0 C;  4E7L A;  3OSS C;  3CEY A;  3JB9 F;  2DD5 A;  4KUD K;  1YIT T;  4BUG A;  1XTD A;  2D6F A;  3JCM d;  3LWI A;  2R57 A;  4IUU A;  3VUZ A;  5CQY A;  3UPU A;  2EQJ A;  2RHZ A;  4BY6 B;  3DLL A;  5GAN d;  2V8I A;  1NJI C;  2DTH A;  4J8O A;  1W4S A;  1UGS B;  4XTU A;  4C5G A;  2X4J A;  4E7J A;  2CZ6 B;  4ELY C;  3V7R A;  5C0M A;  1M1K C;  2V8J A;  1K9M U;  3EFR A;  3URG A;  5A0D A;  2OTL T;  4MDX A;  1M8V A;  4BDZ A;  4A53 A;  2RHU A;  1G3S A;  3RES A;  1Q86 U;  2K2V A;  3M5A A;  3PIP A;  4M7D F;  1U8R A;  2E65 A;  4XK8 E;  1M4Z A;  1K73 C;  4XU0 A;  4M7A E;  3CC7 A;  2EAY A;  3ZFJ A;  3L2U A;  1D3B A;  5FRN A;  4M7A C;  2PVG B;  2X35 A;  2IG0 A;  2K5I A;  3WVD B;  1GXI E;  2LQ8 A;  2LNV A;  1KG1 A;  2ZPG B;  4PNO A;  3OYK A;  1YCY A;  2F69 A;  2QQS A;  1WPY A;  2MWO A;  4XTZ A;  3G4S T;  3PT9 A;  1TH7 A;  1M1G A;  5GAN 5;  2BKD N;  3C95 A;  3TU4 K;  1Q82 C;  1VQO A;  3MP1 A;  3OMG A;  4RG8 A;  4XTW A;  4F7U F;  4M77 F;  3DB3 A;  4B9X A;  3JCM g;  3JB9 G;  1VQ6 A;  3SWN A;  1G3Y A;  1M90 C;  3EFS A;  2EKO A;  3CXC A;  1YHQ A;  1G3W A;  4ZGJ B;  3LH0 A;  3GOX A;  5GAN g;  3DKM A;  4KUI A;  1WGS A;  4HA8 A;  4M78 A;  3CCQ A;  2X4W A;  1X6O A;  3VUB A;  2EJF A;  3A8H B;  4C0Z A;  5KE3 A;  1W2B A;  1VQ9 A;  4LDW A;  1X01 A;  2DK3 A;  5FRM A;  4C0D B;  3F70 A;  1I8F A;  3LW5 E;  3L1A A;  2E6Z A;  2K5L A;  3E19 A;  2ZGW A;  1WJR A;  2FB7 A;  3X26 B;  5GAN 2;  4DA4 A;  1PSE A;  4J6X A;  1QVG A;  3FC3 A;  4ATO A;  1JB0 E;  3OB9 A;  1KD1 C;  4JJN K;  3CCM A;  5LJ3 j;  4RCB A;  1RL2 A;  2QQA A;  4N0A A;  4XTY A;  4C8Q A;  4M7D G;  3OSV A;  5C6S A;  5J3B A;  2XDP A;  4ME7 A;  1WQ7 A;  3L2Q A;  4NOY A;  4DOW A;  2K57 A;  3OBY A;  4M75 D;  1IZ6 A;  4EMH A;  2VC8 A;  4J6Y A;  5AYF A;  3SB2 A;  1H3Z A;  1OI1 A;  3PGG A;  2XK0 A;  5FU6 C;  4ELZ C;  5CKB A;  2ZPH B;  2K3X A;  1VQO T;  4HKE A;  4E7H A;  2OAU A;  4IUP A;  3OYH A;  1U1T A;  1N9S A;  2QTX A;  5CKF A;  5L8R E;  4RMO A;  3BDL A;  1YJW A;  1KQS S;  4M7A G;  2BIV A;  1VQ6 T;  2EQM A;  3ASK A;  3WVE B;  3JRZ A;  4O5V A;  3E1S A;  1YHQ T;  1HXD A;  4F7U G;  5HY6 A;  4M77 G;  2IVW A;  3SWN C;  4C0F A;  3JB9 D;  2EWN A;  2XID A;  4C5E A;  2D9T A;  1NE8 A;  2VGN A;  2HNI A;  4J6W A;  4NS5 A;  5DY9 A;  2RI5 A;  4GY5 A;  3CCQ T;  3S3N A;  4M78 E;  4OF1 A;  2I2L A;  1VQ9 T;  5GMK e;  4X9D A;  4M78 C;  4L6V 5;  3CCS A;  1Y7X A;  5KH6 A;  2E5Q A;  4OGE A;  5GAO n;  4M7D B;  5CAI A;  3MEV A;  4ZN3 A;  3HPW A;  3MP8 A;  4JUV A;  5GAN 3;  2RI3 A;  4BE2 A;  3CCM T;  4A4G A;  5GMK i;  2KK4 A;  4FL6 A;  3HKS A;  4DQ2 A;  1QP2 A;  2RJC A;  3BDU A;  4J5Y A;  2X4X A;  4BD3 A;  5CKH A;  4C8Q E;  2XD0 A;  3QZ5 B;  4C8Q C;  4N0A C;  4M7D D;  4M7A B;  2PVO B;  3VJP A;  3VKI A;  3OYC A;  2CKK A;  3N5B B;  3RUX A;  4JLI A;  2LC4 A;  4FU6 A;  4M77 B;  2RK2 A;  5CO7 A;  4F7U B;  2E41 A;  4QVD A;  2JTM A;  3CCV T;  1YJW T;  3M4Y A;  5CKE A;  2RH2 A;  1NPR A;  3LLR A;  5GAM e;  4HCC A;  2H3J A;  3E9G A;  4OMF B;  3A5Z B;  1K8A U;  2P0Q A;  4L5G A;  5KCO A;  2RHX A;  3HFO A;  3OS0 A;  2RA2 A;  4PJO A;  4M77 D;  2DJZ A;  2E12 A;  2EQU A;  3OMC A;  4R55 A;  2JTF A;  1DJ7 B;  4DOV A;  3CCS T;  4J83 A;  4Z02 A;  4NL3 A;  3CPF A;  3QBY A;  1Q7Y U;  1N8R U;  5KE2 A;  4BE0 A;  2WAC A;  4CRI A;  1VIF A;  2EIF A;  1O9S A;  3V8L A;  3QHS A;  4EDU A;  3LYI A;  3S3O A;  5GAM d;  3RMS A;  2DXB A;  2RD1 A;  5D6W A;  3T9N A;  4EMG A;  1Q81 U;  4A4E A;  1B34 A;  4M78 G;  4MZM A;  4C92 A;  5HK3 A;  1H64 1;  4MZP A;  1YJ9 A;  4FSX A;  2DZC A;  2GQV A;  3MEU A;  3CD6 A;  2V8K A;  3RKX A;  3GPL A;  3LGF A;  5FU7 C;  1M90 U;  1QW1 A;  3J7A F;  3J80 E;  3CCE A;  3AHU A;  1VQL A;  4HT8 A;  1VQ7 A;  5DM7 R;  3CBM A;  2HQX A;  1I4K 1;  2JZ2 A;  2HBP A;  2VXF A;  2XKO C;  2RO0 A;  4OVA A;  3CPW S;  3JB9 J;  2RI2 A;  2L5Q A;  2FVU A;  4QVZ A;  4OB1 B;  4C8Q G;  2MMP A;  3JCM b;  5A2Q E;  2YRV A;  2FYK A;  4MMK A;  3JCM c;  4A4K A;  3OA6 A;  2R58 A;  2Y4X A;  3QKJ A;  3PMI A;  1VQN A;  3NTI A;  2WSF E;  1M5Q 1;  3H8Z A;  4LDU A;  1QVF S;  1HK9 A;  5LJ5 f;  3CCR A;  4JDS A;  1Y71 A;  2GFU A;  3FB9 A;  2DXU A;  2VGM A;  3I55 A;  3OW2 A;  3BW1 A;  4M7A F;  4PJO E;  4JRQ A;  2MWP A;  1S72 A;  4PJO C;  4N4I A;  2EJG A;  4M78 B;  3OYB A;  3CME A;  1ZBX A;  5CKD A;  3HRT A;  3OS2 A;  4EMK B;  3CC2 A;  4NL2 A;  2LQK A;  3P8B B;  3UT1 A;  3X28 B;  4BDY A;  3QII A;  4XTV A;  2DO3 A;  1ZQ1 A;  4LD6 A;  3ZBD A;  2O4X A;  4PLL A;  5GAM g;  5LJ5 h;  4HT9 A;  5LJ3 f;  4ZTJ A;  4HCB A;  2E1H A;  4JS4 A;  4BAC A;  1YJ9 T;  4C92 E;  3QXE B;  1WJQ A;  2CYZ B;  1JJ2 A;  3CD6 T;  3DB4 A;  3TEE A;  4C92 C;  2LX9 A;  2QXF A;  4C8Q B;  3HRS A;  5A0L A;  3A8M B;  3A8L B;  3DLM A;  3JB9 I;  3GNG A;  1QP3 A;  3CCE T;  2GFA A;  1ZHI A;  2XU8 A;  3GIB A;  1VQ7 T;  2M16 A;  2X4Y A;  4BB7 A;  1XOV A;  3M54 A;  4ZN1 A;  4P5N A;  3NTK A;  1VQ8 A;  1BI2 A;  3QZ9 B;  3NTH A;  3CC7 T;  1BYM A;  4R56 A;  2PUO B;  3JAM E;  2CZ0 B;  1VQM A;  5LJ3 h;  5A0G A;  2RHI A;  1X75 C;  3KUF A;  1Q86 C;  1VUB A;  2KSS A;  3MEA A;  4KBM B;  3VYH B;  5GAO q;  1VQN T;  2RJE A;  1N6A A;  1KQ1 A;  1VQ4 A;  3WXM B;  1Y96 A;  3GF5 A;  2L8D A;  3I55 T;  3M53 A;  3A8O B;  1QVP A;  5IAY A;  1S72 T;  1EIF A;  1FXX A;  2DXC A;  2KMT A;  2NLU A;  4OB3 B;  1FX7 A;  1N27 A;  3PIO A;  3CME T;  4D6W A;  2DIG A;  3OS5 A;  2YLC A;  3CC2 T;  5D6X A;  1G5V A;  3C4S A;  2O01 E;  3JB9 H;  3QUI A;  2DIQ A;  4M75 A;  2M1H A;  3P8D A;  3OYA A;  3CC4 A;  1AHJ B;  2XG8 D;  2DD4 A;  2E70 A;  3OYI A;  2LDM A;  3FIF A;  5I2S A;  3R6O A;  2DVE A;  5GMK j;  2PUK B;  2Y90 A;  2ZPE B;  1VQK A;  4TVR A;  4OP0 A;  3HRU A;  3GNF B;  2DKG A;  3TCJ A;  1BIB A;  2LRQ A;  4Q5W A;  1QVF A;  3ME9 A;  1YIJ A;  4M78 F;  3SDZ A;  3JCM f;  1VQ8 T;  2JVV A;  3M9Q A;  4YTL A;  3EAE A;  2QEX A;  1VQM T;  3PNW C;  5GAN f;  3FJP A;  1IRE B;  2PQW A;  5CIU A;  2F5T X;  1OYX A;  2LT4 A;  2ZPI B;  4FM4 B;  5J26 A;  4XQ3 A;  1VQ4 T;  2CZ1 B;  3UWN A;  3L42 A;  2F5K A;  4HCZ A;  3M57 A;  1NJI U;  3M55 A;  1JBM A;  2KQW A;  2R5A A;  4C8Q F;  5GAN 7;  4XAX B;  4C0G A;  3JCM h;  1XQH A;  3GP8 A;  1Y07 A;  3OYF A;  3OYJ A;  5GAM j;  1VQ5 A;  2EJ9 A;  3M4G A;  5GAN h;  3CC4 T;  4A4F A;  4M7A D;  4M7D A;  3RMQ A;  1M1K U;  2WSE E;  4M75 E;  2RB6 A;  4ZTF A;  5LL6 S;  4M75 C;  1UGR B;  4C0D C;  4JS5 A;  4B9W A;  3MO8 A;  4IKF A;  4EPC A;  2VUB A;  1VQK T;  1BI3 A;  1YI2 A;  1K73 U;  1BI0 A;  3QG1 A;  4JRP A;  1JRI A;  2DEQ A;  1KC8 C;  4N4H A;  2KDS A;  3L2W A;  2M0O A;  1WJS A;  5CCA A;  2OTL A;  5CR2 A;  4IUQ A;  3L2V A;  4C92 B;  3HP9 A;  1M1F A;  3VU3 C;  3MCA B;  3S6W A;  2XDD A;  1YIJ T;  5FRO A;  2QA4 A;  5D6Y A;  3G6E A;  3RKW A;  3QJY A;  4PKC C;  5IN1 A;  3V8J A;  4M77 A;  4F7U A;  2QEX T;  3JCM Q;  3SD4 A;  2FHD A;  5DLO A;  1KQS A;  2GF7 A;  1Q82 U;  3V7S A;  1QVG S;  1UB4 A;  4A54 A;  1UGQ B;  2RM4 A;  2QI2 A;  4MDW A;  3RKY A;  3JSC A;  1U1S A;  5FLX E;  1D3B B;  4Y28 E;  2XIC A;  4BE1 A;  5J39 A;  1VQP A;  3MEW A;  1LOJ A;  3QSU A;  4VUB A;  3HHT B;  4LDV A;  3UDC A;  2JNG A;  1BIA A;  4FT4 A;  5FU6 B;  2OTJ A;  1I5L A;  3CCJ A;  2AHJ B;  2VV5 A;  3G71 A;  1VQ5 T;  2KVQ G;  2QQB A;  3JCM W;  3LWH A;  4WF2 A;  3HSB A;  4ZGD B;  2M9U A;  4J7F A;  3V8K A;  4M7D E;  2JOY A;  1LNX A;  1XNI A;  5HK0 A;  4XU1 A;  2CS7 A;  4M7D C;  2VXE A;  3SWN B;  4PLI A;  3A8G B;  2HD0 A;  4QQ6 A;  1BKB A;  3OBW A;  1KD1 U;  4V2S A;  1YI2 T;  2XI9 A;  2XDB A;  3VV0 A;  1K8A C;  4OB0 B;  2O4X B;  4ZGE B;  3I56 A;  1I81 A;  5EG2 A;  2MAM A;  2BUD A;  3VYG A;  2DPP B;  4IUT A;  4FIB A;  2LCL A;  3CBO A;  4II1 A;  1RI0 A;  2QA4 T;  4M75 G;  2L3R A;  2ZPF B;  4PJO F;  5CK9 A;  3G6E T;  2VYT A;  1Q7Y C;  2D0Q B;  5GAN 4;  2PVD B;  2DTI A;  2QQR A;  4IUV A;  4L59 A;  4J7I A;  1N8R C;  4LDX A;  4F7U E;  4M77 E;  5GMK m;  1MHN A;  4M77 C;  1R8O B;  5IT9 E;  5GMK l;  4M78 D;  2MF2 A;  1VQP T;  2LT1 A;  4GLK A;  1Q81 C;  3HL8 A;  4PL6 A;  1VQL T;  2PU9 B;  3HFN A;  1P92 A;  2ZCF B;  2OTJ T;  4MZT A;  3MET A;  4Y91 A;  2EFI A;  3CCJ T;  4C92 F;  3G71 T;  2C06 A;  2RJD A;  2XHC A;  1Y96 B;  2E64 A;  1K9M C;  2L89 A;  3NFC A;  4BI4 A;  5M9O A;  5LJ5 e;  5LJ5 j;  4RKU E;  2DZ9 A;  2A7Y A;  2EYQ A;  4UC4 A;  1MGQ A;  4KT0 E;  4C8Q D;  2JN0 A;  4QQD A;  4C5I A;  4EMK A;  3CCR T;  5DLQ E;  4BI8 B;  5GAO r;  2QDY B;  3ER0 A;  4M75 B;  2FL7 A;  3O8V A;  3OYY A;  4RCC A;  5I2M A;  3OYM A;  5KCH A;  4BY6 C;  1YJN A;  2LVM A;  4JLG A;  5CVI A;  3LGL A;  5GAO p;  2A3L A;  4XTX A;  3Q1J A;  3I56 T;  3M59 A;  3MHX A;  1NPP A;  4RG2 A;  5LJ3 e;  3OYG A;  4BI3 A;  3L2Z A;  1WQW A;  2K4Y A;  1KHC A;  2DTO A;  5GAN 8;  1WNL A;  5LJ5 d;  2RJF A;  3ZEH A;  2ZZD A;  3PFS A;  3CPW A;  4PJO G;  2E10 A;  3OYL A;  4KUL A;  4N4G A;  3QPH A;  4FT2 A;  1KQ2 A;  4E7K A;  3LX7 A;  4QW2 A;  3JCM J;  5GMK h;  3KXT A;  3RER A;  2MI6 A;  3CMA A;  1FWZ A;  4E7I A;  5FU7 B;  3CCL A;  3JCM V;  3CCV A;  3H6Z A;  2P0P A;  3GLX A;  1NZ9 A;  2EQK A;  3FEO A;  3L2R A;  4LD9 K;  1OZ3 A;  5I21 A;  5LJ3 d;  3X20 B;  2YLB A;  3BY7 A;  1KC8 U;  3V7C A;  2KY9 A;  4C92 G;  5GAM f;  3CCU A;  1BI1 A;  3C94 A;  3JCM P;  4JRI A;  4E47 A;  2Y4Y A;  5HKC A;  2G3R A;  2KAF A;  2P4T A;  1O75 A;  3JCM X;  2QQ9 A;  4EMK C;  2YHT A;  1YIT A;  1YJN T;  1V29 B;  1M9S A;  3P8H A;  4MML A;  2HAX A;  3RIR A;  4PJO B;  3QDR B;  1YBY A;  2RHY A;  3M58 A;  3FRN A;  4OGC A;  3SFM A;  2WSC E;  2K5F A;  2R5M A;  3CBP A;  2K3Y A;  2LCC A;  3FDR A;  4A4H A;  5CQX A;  3OY9 A;  5GAM h;  3FLG A;  3OW2 S;  2E6N A;  1G3T A;  2GCX A;  4OB2 B;  1N9R A;  1SSF A;  5LJ5 g;  4JRK A;  3TRE A;  3S3M A;  4XU3 A;  1LJO A;  4QVC A;  3INZ A;  1VIE A;  3CXC S;  4LDY A;  4PJO D;  2CZ7 B;  3JCM e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...