3FIFA

Crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
b'SDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein ygdR
publication title Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli k-12
molecule tags Structural genomics, unknown function
total genus 4
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fifA00
2DTOA 4C8QC 3FIFA 3RERA 2RD1A 4X9CA 4PJOF 3RESA 4F7UA 2Y90A 4NL3A 5GAMd 5GAOr 1KQ2A 1X01A 2ZGWA 2QTXA 1U1SA 4JLIA 4M78G 4MMKA 5GAN7 4OP0A 4M78C 5GAOn 2E10A 3SWNB 4M77A 4Y91A 5LJ3g 3EFSA 5GAOq 4F7UE 5LJ5j 2E41A 5GANg 2DZ9A 4C92B 5GAN3 4XTUA 4A54A 4C8QF 4J6WA 4M7AB 5LJ5h 3JCMc 4V2SA 4XTXA 4F7UF 2EAYA 4J5YA 1HXDA 3RKXA 4N0AC 3L1AA 5GAMf 4M7DB 2RM4A 1B34A 2VXEA 4NL2A 2DVEA 2RB6A 4M77F 2YLBA 3GIBA 1BIAA 4F7UG 4EMHA 5GAN6 4M7AA 3JB9D 5GMKj 5GAMj 5LJ5f 2EJFA 3QUIA 3QO3A 3JCMf 4JRKA 4C92E 4M77G 5GMKh 5GAMh 4XTWA 4M77C 1BIBA 5LJ3d 5LJ5e 4HT9A 2YLCA 5DY9A 4DQ2A 4M7AE 5GANd 2JN0A 3JCMe 5GAOp 4XU1A 2FYKA 1I8FA 4A53A 3JB9H 3VU3C 4M78B 3JCMb 4M7AD 4M7DE 1M8VA 3HSBA 3EFRA 3FB9A 1H641 3SWNA 3V7SA 4PJOB 2FB7A 4XU0A 3JCMh 4M7DD 2RA2A 1JBMA 1WNLA 2YHTA 4QVDA 5GAN8 3INZA 3L2ZA 1LOJA 1D3BB 4C92A 3V8KA 3BFMA 2DXTA 4RCBA 3JCMJ 1WQ7A 4M7AG 1KQ1A 5GMKi 5GAMe 5GMKe 4M75B 4M7AC 1Y96B 3FJPA 1LNXA 2DTIA 3RKWA 4HA8A 3JB9F 5LJ5g 3BY7A 4XU2A 3AHUA 4PJOA 1YCYA 1N9SA 2VC8A 2EJGA 3BW1A 4JRIA 4WF2A 1U1TA 4XTZA 4EMKB 3JCMP 3JCMg 2DXUA 4XTYA 4C8QB 2EJ9A 5I21A 3JCMV 4M78E 5LJ3j 2DZCA 4JUVA 2CGHA 4J6XA 2E1HA 4XTVA 3RKYA 5GANj 4QVCA 4EMGA 4M75A 3QSUA 1Y96A 3JB9G 2DJZA 4C92D 3JCMQ 4XQ3A 3JB9J 4HT8A 4PJOE 3RUXA 2I2LA 3SB2A 4C92F 5GAN4 3JCMW 5LJ3h 4EMKA 3PGGA 1I5LA 5GANh 4M7AF 4M77B 3SWNC 1I81A 4C8QA 3JCMX 4PJOD 1JRIA 2EWNA 3HFNA 4M75E 2DEQA 5GAMg 3JB9I 4M7DF 5GAN5 4RCCA 4C92G 4C92C 3V8LA 4M78A 1N9RA 4M75D 4X9DA 2K57A 4C8QE 1I4K1 2HNIA 5LJ3f 3QHSA 4M75F 3BDUA 2DTHA 4PJOG 3RIRA 5GAN2 5LJ5d 2DKGA 5GANf 4M7DA 4PJOC 3V7CA 3V7RA 4M7DG 4M7DC 1WPYA 1B34B 1TH7A 4C8QD 3JCMd 1D3BA 3HFOA 3V8JA 1MGQA 5LJ3e 5GAOm 4PNOA 4NOYA 5CAIA 1HK9A 4F7UB 2E65A 5GANe 5GMKm 1M5Q1 4XU3A 4M75G 5GAOl 4M77E 4M75C 4MMLA 4N0AA 2E64A 1LJOA 4M78D 5GMKl 3M4GA 1WQWA 4M78F 4J6YA 4EMKC 4M77D 4C8QG 2VXFA
chains in the Genus database with same CATH superfamily
4QW2A 3GP8A 4R56A 2HQXA 4NL3A 1N5ZA 3CMET 2LJ1A 4JRPA 4OP0A 1A0NB 4PFOA 2YXYA 1BKBA 2LNVA 2MYSA 4A4EA 3P8HA 1VQKQ 4C0GA 1QCOA 2DLPA 3FEOA 1BBZA 4ANJA 1WHMA 3VS1A 2NUTB 3DKMA 1WJRA 2EPDA 3OYEA 2P4TA 1TU0B 2E6ZA 2X51A 1ZHIA 3OB9A 3CCRA 3DLLA 1AHJB 2BUDA 3QDFA 1M1KR 2GCXA 3G6ET 2QASA 2Y4XA 3MKDA 4J7FA 2D6FA 3CC7A 2VB6A 1UHCA 5CK9A 1B7TA 3BFMA 3VS0A 1G5VA 2KY9A 2RJEA 3NGPA 3L2RA 2CUBA 1R8OB 5LJ5g 2CZ6B 3M0QA 3CXCS 2EYYA 1R0CB 3L42A 5LJ3j 4JUVA 2CGHA 5IT9E 3JB9G 1B07A 4PJOE 3RUXA 4C0DB 3LGLA 4M7AF 1NJIU 3TSZA 4AFUC 4KH1B 4M75E 1IHVA 3MP8A 3SEMA 3LGFA 2ED1A 2K79A 2XKOC 1R0BG 3G1JA 2QEXA 1KC8C 3M55A 5GANf 1RADB 4HVWA 1N8RU 3V8JA 3OS0A 1BB9A 1N27A 3EGXB 3CXCA 2QG9B 4XU3A 3CMAQ 5GMKl 3VV0A 2D1XA 1X6OA 3VYGA 3CCEA 4BE0A 4M77D 5KYYB 1MMGA 3U23A 2HAXA 2ZGWA 2A37A 2X3XD 1SRMA 5A0LA 4L59A 1YJ9A 4LDWA 1YNZA 3N5BB 4LE9A 2QGFB 3EFSA 5GAOq 1S1NA 3G4ST 1NEGA 1PD1A 2K3YA 1VQLT 1NM7A 2YRCA 3GNFB 1WHGA 1TUGB 5GAMf 1VQ7A 2COZA 3H8ZA 2QQRA 4E7LA 4KH0B 1WJQA 3CEYA 1M8MA 1X6BA 1D0ZA 4PKCC 3E2UA 4XTWA 1T0HA 2CP6A 5GANd 1M3AA 1PM3A 3QDRB 1BI2A 1UECA 5IN1A 3CCQA 1YJWA 3VS4A 2EQKA 1JXOA 3HTRA 5I22A 2RK2A 3KFVA 1FX7A 4HCZA 2ABLA 4JJBA 5FU6B 4BB7A 3JCMJ 3H41A 4J9BA 1NEBA 2J06A 4HA8A 4KGVB 2BZYA 2PVOB 1X43A 3ZEHA 3I5RA 2GTOA 3I35A 1NJIC 2DD5A 4L6V5 4XQ3A 2YUPA 1MMDA 3CCST 3JCMW 1AWOA 2E3HA 4QQDA 2X35A 1FXXA 3PGGA 5GANh 4Y92A 2MIOA 2JW4A 2O2OA 3CCRQ 1D09B 5J26A 1N8RC 4BD3A 3O5ZA 2XDBA 1KC8R 5GAOm 4J9IA 2E4HA 3IQLA 1M5Q1 3RMQA 1AWWA 1WHKA 5KYUB 2P84A 2EGAA 1BK2A 2KK4A 1G3YA 1UEBA 3UDCA 1TUCA 1CKAA 1UB4A 1HSQA 2M51A 3M56A 4M4ZA 1T0JA 5FRNA 4Y91A 1C0MA 1Q95G 1HD3A 5J39A 5KH6A 5I11A 6AT1B 4FM4B 1YJNA 1G2BA 4F7UF 3DLMA 1I1JA 2JS2A 2QXFA 2KYBA 3GNGA 3SHWA 1UUEA 2M0YA 2LQNA 3ZL7C 1VQOA 4OMPA 2WSFE 2QTVA 2ZPEB 5GAMj 2X9HA 1Y7XA 2JNGA 1VQ8T 3R6OA 2G3RA 4DQ2A 3SDZA 4X1VA 4M7AD 1DJ7B 4IKFA 1YJ9Q 2O31A 1PKTA 1VA7A 5KYWA 3OYIA 4BE1A 1WDXA 1TUDA 2AK5A 1QVFP 3G71T 1QCNA 1M3BA 4M7AG 1KSWA 3MJXA 1LNXA 4QVZA 2K2MA 2L3SA 2QGGA 2OTLT 2F2XA 2GF7A 3ULRB 3A5ZB 2KQWA 1MNDA 4D8KA 1UG1A 3I56T 3I56Q 1OI1A 3PIPA 5DLOA 3OYNA 4C92F 1NJIR 5IAYA 2CP2A 1YWOA 1NZ9A 3I55T 1XJWB 3JCMX 2ROTA 1EIFA 2LJ0A 2VWFA 1FMKA 1VQNA 4M7DF 2K7AA 3PMIA 4OMOA 1N9RA 2CT3A 1VQ6Q 4F17A 1I4K1 1K0XA 3CCQQ 1N8RR 3CCVA 2COYA 1CKBA 3V7RA 3ZFJA 4FW1A 1K8AU 3LX7A 5GMKm 2E65A 2X4YA 4P5NA 1IHWA 2ZCFB 1D1BA 1WHLA 2EQJA 2X3WD 1XOVA 2V1QA 4Z88A 2DAQA 2EQIA 3OYBA 2P0PA 3EFOA 3M0UA 3VJPA 1BCOA 1TG0A 5LJ5j 4PJNA 2QDYB 5CR2A 2KDSA 1YI2T 1GFCA 3J7AF 4C8QF 2X4JA 2J6KA 2OJ2A 4E7JA 3BE3A 3KBGA 3CC4A 4IUTA 3M0PA 1AWJA 4EMHA 1JEGA 4Z89A 4EPCA 2HSPA 3FLGA 2EJFA 1V76A 2YRVA 2ZPHB 2QA4Q 3EG2A 1OZ2A 2XMFA 2JN0A 3EH2A 1PHTA 5FLXE 3A8GB 3VU3C 1QCFA 1M8VA 2L3PA 3M58A 4II1A 3PFSA 4HCCA 2KROA 2EYWA 3M0TA 1D1AA 3MO8A 5GAN8 5HKCA 3L2UA 4CC2A 1RUWA 4RCBA 4CC4B 4PLIA 1S72A 3ZBDA 2DL8A 2HL3A 2KR3A 1QVGA 1M1FA 2CDTA 3OSSC 3VUBA 1MV3A 3G7ZA 1UDLA 2GFAA 2PVDB 3OYDA 2RK1A 4J6XA 4QVCA 1VQOQ 2DJZA 3OYJA 1JU5C 1MMNA 4LUEA 2L8DA 1I5OB 2V1RA 4BUGA 3NTKA 4XAXB 1K8AC 1RL2A 1JXMA 3CCJT 3CCUQ 2LQKA 1UFFA 4AT1B 3HPWA 1VYUA 2XHCA 2KT1A 5LJ3e 1MGQA 1YITT 1YITQ 4DBQA 2GQVA 3EFOB 2E64A 1M90U 1LJOA 1WQWA 2NUZA 1SHGA 1H3HA 4PJOF 1GXIE 2O01E 1XQHA 4GLMA 3CCLA 3H0FA 4F7UE 3CMEA 2CKKA 4HVVA 3PVQA 4E7ZA 3GOXA 4JZ3A 1WXBA 1RAIB 1YHQQ 1QKWA 1PRMC 1AVZC 3CCVQ 4DEYA 1Z9ZA 1E6HA 2Y4YA 3L2VA 2HQHA 1EX4A 2EKHA 4ZTJA 4FT2A 2PNIA 4E2FB 2DRMA 5LL6S 5HY6A 2LTOA 2DXCA 5EG2A 2EGEA 3UA7A 2JXBA 2CSIA 2QK0A 1VQ4T 2QYZA 4QQ6A 2XDPA 4J9GA 4M7DD 5C0MA 3INZA 3CCMA 3G6EA 3PVLA 1WQ7A 3Q1JA 1BI1A 2DTIA 2CP3A 3AHUA 2YUQA 4A63B 1IRXA 2DZCA 2NUTA 2M0OA 3CC4Q 2L3QA 1M4ZA 5GAN4 4CC3A 4EMKA 2E3IA 1K0SA 2HKQB 3L2WA 4RTYA 3LW5E 2DEUA 1M3CA 2HD0A 5LJ3f 2AKLA 2PTKA 2YWWA 2DKGA 2PUKB 4IIOA 4C8QD 2RH2A 1U3OA 3E1SA 3RNJA 5CKBA 4J8OA 4ZNXA 4BACA 1T3LA 4M78D 2FEIA 4EMKC 4KRTA 4C8QG 2ZPIB 1JQQA 1GBRA 4IURA 2Y90A 2VYTA 2D8HA 1BI3A 4M78G 5GAOn 4CRIA 1M9SA 5D6YA 1G3WA 2K3XA 1T3SA 2EYXA 4WCIA 2RHIA 2YT6A 4FSXA 4GBQA 5FWCA 4A54A 2EAYA 2IG0A 4ORZA 1VQLA 3HHTB 3EGXA 1RABB 2O4XB 2QQAA 1SRLA 4RKUE 2FZKB 4FW2A 3M0SA 4C0DC 4FSSA 4J9FA 3QO3A 3X24B 5KYYA 5LJ3d 2QQBA 2YLCA 2AIRB 2O9VA 2VGNA 1VQKT 4M78B 3E9GA 3CCLQ 1EZZB 1ZA1B 2W10A 1Q86U 3JCMh 2A3LA 1YIJA 4OVAA 1YN8A 2DXTA 5GAMe 4XTZA 3ASKA 3BW1A 4OMMA 4EMKB 5IH2A 1XTDA 2DL7A 1VUBA 2A08A 1W2BS 3LLRA 2FPEA 3EH1A 4ZGDB 3CD6Q 1ZA2B 4JLGA 5LJ3h 2MWPA 2RI2A 3FRNA 4JJCA 4PJOD 1RAGB 3CCSA 1RI0A 1AT1B 1OOTA 1KJWA 1SSHA 2LT4A 4RCCA 2RQVA 3WVEB 4BDZA 1G83A 2LC4A 2OX7A 4M75D 4Y28E 1VQMA 1XNIA 4HT9A 4PJOG 1BU1A 1K4US 4R55A 4NOYA 2LCCA 4KBMB 2KGTA 1UTIA 1H3ZA 2DK3A 4M75G 3A8OB 2KE9A 2FPFA 4DEXA 4B9WA 1SG5A 4RTTA 3ER0A 2AT1B 2CZ7B 3CPWS 3H0IA 2DD4A 4XTUA 5FU6C 4CC7A 4XTXA 2J05A 1K76A 2BIVA 3CMAT 3RKXA 5AT1B 3X26B 2SRCA 4KGXB 1WI7A 4RTVA 3TQ7P 4D8DA 4KT0E 4D6WA 4LUDA 5KYUA 1W1FA 1PNJA 1SKUB 4M77G 3JAME 5LJ5e 1ZUUA 3M53A 1VQPA 2CP5A 3M0RA 2JTFA 3NHNA 1GCPA 1MUZA 2ED0A 1G3SA 2K9GA 4FYYB 2FB7A 2K6DA 4PLLA 4ZTFA 2B8AA 3C0CA 2DL5A 4LXCA 1PWTA 2QDLA 4C5EA 1PCXA 4PJJA 3BY7A 1UGSB 4VUBA 1NYGA 2EJGA 4WF2A 1M1GA 1QVFS 2DXUA 5CQXA 3EG3A 1Z9QA 2E1HA 3MP1A 5L23A 4CI0C 2DVJA 1FMVA 2GBQA 4RG8A 5HK0A 2RF0A 4M77B 1OULA 4Z02A 4MZTA 3FJ5A 1ZLMA 1W2BP 1X69A 3BDUA 3ME9A 1Y07A 1B34B 2K5FA 3TU4K 4PNOA 3TREA 2RQWA 1YIJQ 1WZOA 3OY9A 2BZXA 4AFSC 1QMCA 2MAMA 5GJWB 1O9SA 3HRTA 2YUOA 3CCRT 1NPPA 2YDLA 4A4HA 2NLUA 2DIGA 5GAMd 5GAOr 3LWHA 1KQ2A 2DF6A 1OZ3A 2C0IA 4OMQA 3SWNB 3MEVA 1PSEA 2LX7A 3TSWA 2J7IA 4C5HA 2KI7A 1D1CA 2LT1A 1QWFA 2AZSA 3CC7Q 4J5YA 1HXDA 4OMNA 3QZ5B 1YBYA 3NTHA 4DOWA 4RTUA 4X34A 4NL2A 4JDSA 2ESWA 1BIAA 4M7AA 1WA7A 5LJ5f 2CP0A 4IUVA 1QP2A 2BE9B 4DOVA 3CPWP 1BCMA 1WYXA 2F5TX 4IIMA 1TXQA 5GAMh 1QP3A 4PK4A 5DY9A 2RHYA 2W0ZA 3UA6A 2LZ6B 1VQ5A 2DO3A 3QYHB 1JJ2S 2A28A 4UC4A 2RA2A 2QEXT 2YHTA 2QEXQ 1E7OA 3R6NA 1UGQB 1BYMA 3V8KA 3GLXA 4M7AC 2FZGB 2M02A 2KMTA 2RI3A 2DE0X 2D8JA 2MWOA 3CCEQ 3CCET 2V8KA 2K3BA 1Y96A 2OI3A 3C12A 2WSEE 3SB2A 1E6GA 2HEQA 3MCAB 3NFCA 5CIUA 1LCKA 4K11A 1YJ9T 2EWNA 1K73U 4OB3B 3TEEA 3V8LA 1YFNA 2GQIA 1VQPQ 2XK0A 3JRZA 3RIRA 5FROA 2L2PA 3QHSA 3QG1A 5LJ5d 3SD4A 1CSKA 3V7CA 1MHNA 2J6OA 3HFOA 2KNBB 1VQ7Q 4NS5A 3DB3A 2HSEB 2OTJA 2BZ8A 3A8HB 1O75A 1ZBXA 2LCLA 2XD0A 4J9DA 4JLIA 2SEMA 2FPDA 4Z8AA 1VQ6T 2BKDN 2KBTA 5I2MA 3OA6A 3CC2A 3CCQT 1YJWQ 3VS6A 2ZPGB 1ABQA 5KCHA 1SEMA 2R5AA 3QYGB 1K9MU 2FO0A 1M30A 4M7AB 5LJ5h 4V2SA 3WVDB 2BTTA 2NWMA 4DBHA 4AFQC 5FWBA 4HCKA 2V26A 1B3QA 4PFPA 3EG9B 1KK7A 4OB1B 1W4SA 4RTZA 1GL5A 3QUIA 4J9HA 2RQTA 1RAAB 2K4YA 3JSCA 1C1AA 2ZZDA 1EFNA 2RI5A 1Q7YU 3UT1A 4B9XA 3QIIA 1W70A 4F04B 2QQ9A 1AWXA 9ATCB 3H0HA 2JVVA 2MF2A 5CO7A 4RUGA 1D3BB 4KUIA 4LD6A 4DBRA 4C0ZA 1Y96B 2V8IA 4C0FA 2B86A 4QKUA 2LNHB 1TWBA 5HCKA 2LJ3A 3JCMg 2H3EB 2QA4T 1NG2A 1JJ2P 3QZ9B 3MHXA 4XTVA 1NBEB 3RKYA 5CCAA 1K73C 3M4YA 3VS2A 2EVRA 1HYOA 4N4GA 3L2QA 1ZBJA 1IGQA 1U8RA 3JB9I 2RN8A 3VKIA 1OU9A 4RG2A 2FVUA 1KHCA 1FWZA 1KQSS 1VQ5Q 2HQEA 1VOMA 3OS2A 1VQ9A 1YJNT 5KYXB 1YJNQ 1G8XA 2LP5A 3UATA 3OW2S 4OB2B 3P8BB 5CAIA 1X2QA 3A98A 1VQOT 3LYIA 2Z0WA 1LPLA 2G6FX 2F5KA 3M4GA 1QQJA 2DVEA 1H8KA 5KE2A 2K2VA 2DMOA 4O5VA 1K9AA 1WHJA 1K9MC 2YRDA 1ZX6A 3CCUT 2A0FB 2EYZA 3A8MB 4LD9K 2CH4W 2JTMA 5KYNA 2WACA 2H3JA 1M1KU 3M57A 3M54A 4XK8E 1QKXA 2RM4A 1I07A 2RJCA 4F7UG 4GLKA 5KCOA 5GMKj 3OBWA 4OB0B 1Q7YC 1PD0A 4PL6A 2NUPA 2OTJQ 4O6JA 4PJLA 2DL3A 1P92A 4QQGA 2FYKA 1NYFA 3JB9H 1Y71A 2ATCB 1VQNQ 1YHQT 4XU0A 1U5SA 2JUFA 3CCVT 5CQYA 2F1LA 1FYNA 1W6XA 5FRMA 1NLOC 3JB9F 1OEBA 1PRLC 3OYYA 1OU8A 3H9NA 2DPPB 2EJ9A 2QI2A 2JOYA 4C92D 3JCMQ 2O4XA 4FCYA 4R0KA 2O88A 3CBMA 4C8QA 1I81A 4ELYC 1Y0MA 4AMCA 4C92G 2X4XA 1NPRA 3X28B 4M78A 1OPKA 2LVMA 3NTIA 4QT7A 1VYVA 4X9DA 2HNIA 3EHQA 3RBBB 4M7DG 4DBFA 3OQ5A 5CKHA 3A8LB 1WGSA 1QW1A 3CC4T 3OYLA 1Q81U 1NE8A 7AT1B 3OBYA 4AFZC 4RTWA 3HRSA 2VXFA 1KQSP 2DTOA 4C8QC 1MMAA 3M59A 1UJYA 3CBOA 2QAZA 3RESA 4J9EA 2L3RA 1ZUKA 3OW2P 1TS9A 4M78C 2O9SA 2JS0A 4Q5WA 3QKJA 2MCNA 3TCJA 1M1KC 4OGEA 1K9MR 5GANg 1K8AR 1M90C 4C92B 5GAN3 2VV5A 2E6NA 1FMWA 4J6WA 3S3OA 2CSQA 3MEWA 4HKEA 4B6MA 2CT4A 1S72Q 4ZN3A 4M7DB 2NUPB 2VXEA 3REBB 2MPXC 3OYMA 3LH5A 4BY6B 2P0KA 2DA9A 2WSCE 3EGUA 2KXDA 4J7IA 2PU9B 4MZMA 1M2OA 1Q7YR 2HZYA 4LDVA 4AG2C 2FZCB 2DNUA 1Y57A 4XU1A 5DLQE 2KYMA 1X27A 4A53A 3PMTA 5FW9A 2F69A 4BI8B 3HSBA 2CH4A 2R58A 3FB9A 3KXTA 2K5LA 3G4SA 4ESRA 2VGMA 1WNLA 1ZSGA 2EKOA 4J9CA 3S3NA 2ZAEA 4PJOA 4F14A 2CZ0B 3GPLA 5I21A 4C8QB 4JPBW 3UF4A 2PVGB 4M78E 3PTAA 1X6GA 4EMGA 4M75A 1OQKA 1AEYA 5GJVB 3CCLT 4LDYA 3M5AA 2RQUA 3P8DA 4OMFB 2EW3A 3D7SB 5GAN5 3CMEQ 2NYSA 3PNWC 4LDUA 4E7KA 4EIKA 2JM8A 4JJNK 2HBPA 2JJ9A 2PQWA 4PJOC 1Q81C 4JS5A 1SF9A 1WX6A 1JO8A 2MK5A 1KD1U 2OAUA 1HK9A 4FL6A 3GF5A 4LN2A 4M75C 3CD6T 1R77A 4FIBA 2DL4A 4RTXA 3C4SA 3RERA 4X9CA 4BI4A 2IVWA 2CYZB 2DBMA 2EQMA 5GAN7 2LCSA 3MEAA 4IUPA 4M77A 2JT4A 4KGZB 2KSSA 3C95A 1KHIA 3CCMT 2L5QA 3CCMQ 1M90R 3G6EQ 1W2BA 1GBQA 1B34A 4AG1C 3GIBA 5D7UA 3JB9D 2KRMA 2V8JA 4M77C 3RR6A 1YCSB 4ELZC 1V29B 3UPUA 3HKSA 3SWNA 2DXBA 2M9UA 4PJOB 2E5QA 2DBKA 3J81E 3WXMB 1AZEA 1KG1A 2PZ1A 1TOVA 1V1CA 2KAFA 1AD5A 4M75B 3I9QA 1IREB 3FJPA 2DILA 5M9OA 2C0TA 1LVKA 3QBYA 4JRQA 2A7YA 4XTYA 2ENMA 3JCMV 2F2VA 3OS1A 2HBWA 1Q86C 4A4KA 4E7IA 1VQ8A 1ABOA 1VIFA 5L8RE 3BDLA 2KRSA 3OYAA 3CPWA 4YTLA 3SWNC 2M16A 2EIFA 1IXDA 1TTHB 1ARKA 1KD1C 2RJDA 1J3TA 2K57A 2IIMA 3EG0A 2KXCA 3G71A 3G4SQ 2D0QB 2P0QA 4PJMA 1NLPC 1Q81R 1VQLQ 1I0CA 1ZUYA 3NMZC 4M77E 2OTLA 2DM1A 2DX1A 3I56A 2RD1A 2RO0A 2RNAA 1OPLA 4KUDK 5EC7A 1OX9A 2CS7A 2OAWA 3I55A 3OSVA 4FYXB 4BE2A 2LMJA 3MEUA 2DZ9A 3E19A 1VIEA 1VQ6A 5DM7R 1YIJT 8AT1B 1Q82U 1QVFA 3LH0A 2YSQA 3SFMA 4KULA 2VKNA 3VUZA 2XU8A 1D0XA 3VYHB 1OYXA 2EQUA 3VS5A 2COWA 1H92A 1BIBA 3VRYA 3CBPA 1PKSA 3CCSQ 3CC7T 2ROLA 4ZGEB 2VASA 1GFDA 1QLYA 1YI2A 3T9NA 1JBMA 1VQMT 1VQMQ 1LOJA 4F16A 3CXCP 4JZ4A 1KQ1A 2CUDA 5GMKe 2EGCA 1YCYA 2VC8A 2XICA 3EG9A 1UGPB 3QJYA 4FU6A 4C5IA 5GANj 5I2SA 1Q86R 1M27C 2QA4A 3OMCA 2I0NA 4ME7A 3QWXX 2RHXA 2KEAA 4E7SA 4ATOA 1WXUA 2GTJA 5IHNA 3QXEB 4E7HA 3A1PA 3EGDA 4ZGJB 3OYHA 3EG1A 1UGRB 3TVTA 8ATCB 1KD1R 3OS5A 2LX9A 4LDXA 1TH7A 1D3BA 4HXJA 3O8VA 2YUNA 5CKEA 1WHHA 4N0AA 4MZPA 1IZ6A 2KT8A 4IUUA 2HCKA 2VVKA 1ZSZA 3E9FA 1OX8A 1UGVA 1JJ2A 2QTXA 1VQPT 1QVPA 4J83A 1VQ8Q 3EAEA 2DETA 1Q82C 1PG5B 3JV3A 2LQ8A 2ZPFB 1WFWA 2XI9A 5HK3A 3QJ6A 3F70A 1UHFA 1MNEA 3CCJA 2CREA 3CCUA 1VQ7T 3S3MA 3HRUA 1RLPC 4N0AC 3CQTA 5KYXA 1TSFA 3L1AA 1YITA 1G3TA 2JM9A 1ZSZC 2YLBA 3G71Q 2PUOB 1AZGB 2FHDA 2OTLQ 2LRQA 3PIOA 4M7AE 1YJWT 2EFIA 3NPFA 1IO6A 2IPOB 2XG8D 1ZQ1A 5C6SA 3OYGA 2HL5C 3EFRA 2VUBA 3FC3A 3V7SA 3I55Q 2F2WA 1GRIA 4QVDA 3L2ZA 4GY5A 4E6RA 2X4WA 4ZN1A 1YHQA 5D6WA 1YP5A 3EHRA 5GMKi 2E12A 4N4HA 5A0DA 3S6WA 3OYKA 4OMLA 1SSFA 2C0OA 5D6XA 1PSFA 2BE7D 2D9TA 4JJDA 3QSUA 1HJDA 4RMOA 2LQWA 4HT8A 3THKA 3H6ZA 3EGDB 4OF1A 1I5LA 3KUFA 3QWYA 2GFUA 3HFNA 2DEQA 4OGCA 1VQ4A 5IHKA 3VS3A 5CKFA 4DA4A 2DYBA 5IXFA 1YI2Q 2GGRA 4EDUA 1ZSZB 2DFUA 2RMOA 2CZ1B 2EYQA 4IUQA 2RHUA 4M78F 4J6YA 1QVGS 3X20B 3UWNA 1RAEB 4FT4A 4F7UA 2FG0A 2XIDA 2AHJB 5ECAA 1U1SA 4MMKA 2DJQA 1VQ5T 2H8HA 3VRZA 3REAB 2MOXA 1GCQA 2JMAA 5LJ3g 4JS4A 4N4IA 4PFZA 5KYWB 2MMPA 5J3BA 3MP6A 1Q82R 1QWEA 2DIQA 2FL7A 1PC0A 4HCBA 4E47A 3J80E 4BDYA 2RB6A 5A0GA 5GAN6 2ECZA 2HKNA 2R57A 3HP9A 1MV0B 2JMCA 2QQSA 3OYFA 1JB0E 5GMKh 5IHIA 1GCQC 1KQSA 5GAOp 3JCMe 3LWIA 2FRWA 2HMAA 2L0AA 3META 1KIKA 1U06A 3X25B 4C5GA 3OW2A 2DERA 4LNPA 4BI3A 2KRNA 2L89A 2MI6A 4C92A 2ZPBB 2P4RA 1RAHB 2DYIA 1WLPB 3RKWA 3CCJQ 4XU2A 2M1HA 3QPHA 4FYWB 4JRIA 4M7DA 1U1TA 3FDRA 3JCMP 1UE9A 2OTJT 2RJFA 2E5KA 3MPUB 1KFZA 2RPNA 1VYTA 1C6VX 4FYVB 3JB9J 1M2VA 2I2LA 4MDXA 5IXBA 1VQNT 3OMGA 1JRIA 1VQKA 1RI9A 1N6AA 3CC2T 3CC2Q 1AOJA 4L5GA 4C92C 4HVUA 1IB8A 4M75F 3M9QA 3GBQA 4M7DC 1WPYA 1F1BB 2XDDA 1X75C 4F7UB 4BY6C 4A4FA 4TVRA 2A36A 1K73R 3DB4A 3JCMb 3FIFA 3CD6A 2C06A 2AZVA 1X01A 3URGA 1UJ0A 1X2KA 2E10A 1BI0A 4MDWA 2E41A 2RQRA 1QVGP 2HDAA 5CVIA 3JCMc 1VQ4Q 5FU7C 1RAFB 1IGUA 2K5IA 1K1ZA 3HL8A 4M77F 3PE0A 1OV3A 4WTOB 2LDMA 1SHFA 3PT9A 2DRKA 3JCMf 3RMSA 4JRKA 4C92E 2KVQG 5KE3A 2EBPA 2D0NA 1I8FA 3CPFA 2R5MA 4M7DE 1H641 1S72T 2AKKA 1VQ9T 1VQ9Q 1D0YA 3RDVA 3CMAA 1SPKA 1M2VB 3OYCA 3VS7A 1N9SA 2GNCA 3I5SA 1ACMB 1RLQC 1RACB 1WXTA 5CKDA 4A4GA 5A2QE 2J6FA 1WJSA 2CP7A 2JTEA 5GAMg 2FRYA 1WIEA 5FU7B 3C94A 4C8QE 2E70A 2DTHA 5GAN2 1YWPA 3AT1B 5AYFA 3JCMd 2RHZA 5GANe 1KC8U 5GAOl 4MMLA 2JZ2A
chains in the Genus database with same CATH topology
4QW2A 2XD0A 3GP8A 2RD1A 2RO0A 4PJOF 4R56A 4KUDK 2HQXA 1GXIE 4NL3A 2O01E 1XQHA 3CMET 2CS7A 3I55A 4JRPA 4JLIA 3OSVA 3CCLA 4OP0A 1VQ6T 2BKDN 3OA6A 5I2MA 1BKBA 3CC2A 3CCQT 2LNVA 4F7UE 3CMEA 4BE2A 3MEUA 2DZ9A 2ZPGB 4A4EA 5KCHA 3P8HA 3E19A 1VIEA 1VQ6A 2CKKA 2R5AA 3QYGB 5DM7R 1K9MU 1YIJT 4M7AB 4C0GA 5LJ5h 3GOXA 4V2SA 3WVDB 1Q82U 1QVFA 3LH0A 3FEOA 3SFMA 4KULA 3VUZA 4OB1B 3DKMA 1W4SA 2Y4YA 3L2VA 2XU8A 1WJRA 3OYEA 4ZTJA 2P4TA 2E6ZA 3QUIA 3VYHB 1OYXA 2EQUA 1ZHIA 3OB9A 3CCRA 3DLLA 4FT2A 1BIBA 2K4YA 5HY6A 5LL6S 3JSCA 1AHJB 2LTOA 2ZZDA 2BUDA 2DXCA 5EG2A 2RI5A 1Q7YU 3CBPA 3UT1A 3CC7T 4B9XA 1VQ4T 2GCXA 4ZGEB 3G6ET 3QIIA 4QQ6A 2QQ9A 2XDPA 2Y4XA 1YI2A 2QA4T 4J7FA 4M7DD 2D6FA 3T9NA 1JBMA 1VQMT 5C0MA 2JVVA 2MF2A 5CO7A 3INZA 5CK9A 1LOJA 1D3BB 3CC7A 3G6EA 4KUIA 4LD6A 3CCMA 3BFMA 1G5VA 2KY9A 2RJEA 1WQ7A 1KQ1A 3Q1JA 5GMKe 4C0ZA 3L2RA 1Y96B 2V8IA 1BI1A 4C0FA 2DTIA 1R8OB 5LJ5g 3AHUA 2CZ6B 1YCYA 2VC8A 3CXCS 2XICA 3L42A 3JCMg 5LJ3j 1UGPB 2DZCA 3QJYA 4JUVA 2CGHA 4FU6A 3QZ9B 3MHXA 2M0OA 4XTVA 3RKYA 4C5IA 5IT9E 5GANj 5CCAA 3JB9G 1M4ZA 1K73C 4PJOE 3RUXA 4C0DB 5I2SA 3M4YA 5GAN4 2QA4A 3LGLA 3OMCA 4EMKA 4ME7A 4M7AF 4N4GA 1NJIU 2RHXA 3L2QA 1U8RA 4M75E 4ATOA 3MP8A 3JB9I 3L2WA 3VKIA 3LGFA 4RG2A 2FVUA 1KHCA 2XKOC 3QXEB 1FWZA 4E7HA 3LW5E 4ZGJB 3OYHA 1KQSS 2HQEA 2HD0A 5LJ3f 1UGRB 3OS2A 2QEXA 1KC8C 3OS5A 1VQ9A 1YJNT 2LX9A 3M55A 2DKGA 5GANf 2PUKB 3OW2S 4LDXA 4OB2B 1N8RU 1TH7A 4C8QD 2RH2A 1D3BA 3V8JA 3P8BB 3OS0A 1N27A 3E1SA 5CAIA 5CKBA 3CXCA 3O8VA 4J8OA 1VQOT 4XU3A 3LYIA 5CKEA 4N0AA 4BACA 4MZPA 4M78D 2F5KA 5GMKl 3VV0A 3M4GA 1X6OA 3VYGA 4EMKC 1IZ6A 3CCEA 4BE0A 4M77D 4IUUA 2DVEA 2ZPIB 4C8QG 5KE2A 2K2VA 3E9FA 4IURA 2Y90A 2VYTA 1JJ2A 4O5VA 2HAXA 2ZGWA 2QTXA 1VQPT 5A0LA 1BI3A 1QVPA 4L59A 4M78G 1YJ9A 5GAOn 4LDWA 4J83A 1K9MC 4CRIA 1M9SA 3N5BB 3EAEA 1G3WA 2K3XA 5D6YA 3CCUT 3EFSA 5GAOq 3A8MB 1Q82C 2LQ8A 2ZPFB 4LD9K 2XI9A 2RHIA 5HK3A 3G4ST 3QJ6A 4FSXA 3F70A 2JTMA 4A54A 2K3YA 3CCJA 2WACA 3CCUA 1VQLT 1VQ7T 3S3MA 2H3JA 1M1KU 2EAYA 3M57A 3HRUA 3M54A 2IG0A 3GNFB 4XK8E 4N0AC 3L1AA 5GAMf 1YITA 2RM4A 1VQLA 2RJCA 3HHTB 1VQ7A 3H8ZA 1G3TA 2QQRA 2YLBA 4E7LA 4F7UG 4GLKA 5KCOA 5GMKj 1WJQA 3CEYA 3OBWA 4OB0B 2O4XB 2QQAA 4RKUE 4C0DC 2PUOB 1Q7YC 3QO3A 4PKCC 2FHDA 2LRQA 4PL6A 3X24B 4XTWA 4O6JA 5LJ3d 2QQBA 3PIOA 4M7AE 2YLCA 1YJWT 2EFIA 5GANd 3QDRB 1P92A 2VGNA 4QQGA 2FYKA 1BI2A 1VQKT 3JB9H 2XG8D 5IN1A 1ZQ1A 4M78B 5C6SA 3OYGA 3CCQA 1Y71A 3E9GA 3EFRA 1YJWA 2VUBA 3FC3A 2EQKA 1YHQT 3V7SA 2RK2A 1Q86U 4XU0A 1FX7A 3JCMh 4HCZA 2A3LA 2JUFA 4QVDA 1YIJA 3L2ZA 4GY5A 4OVAA 2X4WA 4ZN1A 5CQYA 3CCVT 5FU6B 2DXTA 4BB7A 1YHQA 3JCMJ 5D6WA 5GAMe 5GMKi 2E12A 5FRMA 4N4HA 5A0DA 3S6WA 3OYKA 4HA8A 3JB9F 1SSFA 4XTZA 3ASKA 3BW1A 2PVOB 3OYYA 4EMKB 5D6XA 2DPPB 1PSFA 1XTDA 2D9TA 2EJ9A 3ZEHA 2QI2A 1VUBA 1W2BS 3QSUA 1NJIC 3LLRA 4RMOA 2JOYA 2DD5A 4ZGDB 4C92D 4L6V5 3JCMQ 4XQ3A 4HT8A 2O4XA 3CCST 3H6ZA 4JLGA 3JCMW 5LJ3h 2MWPA 2RI2A 3FRNA 4OF1A 2X35A 1FXXA 3PGGA 4QQDA 5GANh 3KUFA 1I5LA 3CBMA 4C8QA 1I81A 4PJOD 2GFUA 4ELYC 3CCSA 3HFNA 1RI0A 2DEQA 4OGCA 1VQ4A 2LT4A 4RCCA 4C92G 2X4XA 3WVEB 5J26A 4BDZA 1NPRA 3X28B 4M78A 1N8RC 2LVMA 2LC4A 3NTIA 5CKFA 4M75D 4X9DA 4BD3A 4Y28E 4DA4A 2HNIA 1VQMA 1XNIA 4HT9A 4PJOG 2XDBA 4M7DG 5GAOm 4EDUA 3OQ5A 4R55A 5CKHA 3A8LB 4NOYA 2LCCA 4KBMB 1WGSA 2CZ1B 1M5Q1 1QW1A 2DK3A 4M75G 3CC4T 1H3ZA 3RMQA 2EYQA 3OYLA 1Q81U 4IUQA 3A8OB 1NE8A 2RHUA 3OBYA 4M78F 2KK4A 4J6YA 1QVGS 3HRSA 2VXFA 1G3YA 2DTOA 3X20B 4C8QC 3UWNA 1UEBA 3M59A 3CBOA 3UDCA 4FT4A 3RESA 4F7UA 2XIDA 1UB4A 2L3RA 2AHJB 1U1SA 3M56A 4MMKA 4B9WA 1VQ5T 4M78C 4Q5WA 5FRNA 4Y91A 5LJ3g 3ER0A 3QKJA 3TCJA 4JS4A 4N4IA 1M1KC 4OGEA 2CZ7B 2MMPA 5GANg 5J3BA 3CPWS 1M90C 2DD4A 5J39A 4C92B 3MP6A 5KH6A 5GAN3 2DIQA 4XTUA 4FM4B 2VV5A 5FU6C 2E6NA 2FL7A 4J6WA 1YJNA 3S3OA 4XTXA 3MEWA 4HKEA 4F7UF 3DLMA 3A8HB 4HCBA 2BIVA 2QXFA 3CMAT 3RKXA 3X26B 3GNGA 4ZN3A 4E47A 3J80E 4M7DB 4BDYA 2VXEA 1VQOA 2RB6A 5A0GA 2WSFE 3OYMA 4KT0E 5GAN6 2R57A 2ZPEB 4D6WA 5GAMj 4BY6B 2P0KA 3HP9A 2WSCE 1Y7XA 2JNGA 4J7IA 2PU9B 4MZMA 2QQSA 3OYFA 1VQ8T 1JB0E 4M77G 5GMKh 3JAME 3R6OA 5LJ5e 2G3RA 4DQ2A 3M53A 4LDVA 1VQPA 1KQSA 3SDZA 5GAOp 3JCMe 3LWIA 4XU1A 5DLQE 3META 4A53A 3PMTA 2F69A 2JTFA 4BI8B 4M7AD 3X25B 2R58A 4C5GA 3FB9A 3OW2A 3HSBA 1DJ7B 4IKFA 3KXTA 1G3SA 2K5LA 3G4SA 2FB7A 2L89A 4BI3A 2VGMA 4PLLA 2MI6A 1WNLA 3OYIA 4BE1A 4ZTFA 2B8AA 4C92A 2ZPBB 3G71T 2EKOA 4M7AG 4C5EA 3S3NA 1LNXA 4QVZA 3RKWA 4PJOA 3BY7A 4XU2A 2CZ0B 1UGSB 2M1HA 3QPHA 4VUBA 4JRIA 2EJGA 4WF2A 3GPLA 2OTLT 1U1TA 3FDRA 3JCMP 1M1GA 1QVFS 2DXUA 5I21A 5CQXA 4C8QB 2RJFA 2OTJT 2GF7A 2PVGB 4M78E 3A5ZB 3PTAA 2KQWA 3MP1A 2E1HA 3I56T 4EMGA 4M75A 1OI1A 4CI0C 3JB9J 3PIPA 5DLOA 3OYNA 2I2LA 4C92F 4MDXA 1VQNT 4RG8A 5IAYA 5HK0A 1NZ9A 4LDYA 3I55T 3CCLT 4M77B 3OMGA 3M5AA 3P8DA 3JCMX 1JRIA 4Z02A 1EIFA 1VQKA 4MZTA 1N6AA 3CC2T 4OMFB 1VQNA 4M7DF 5GAN5 4L5GA 3PNWC 4LDUA 4C92C 3PMIA 4E7KA 1N9RA 4JJNK 1I4K1 2HBPA 3BDUA 4M75F 2PQWA 3CCVA 3M9QA 4PJOC 3ME9A 1Y07A 3V7RA 4JS5A 1Q81C 4M7DC 1KD1U 1WPYA 1B34B 3ZFJA 2K5FA 2XDDA 1X75C 3TU4K 4PNOA 3TREA 1K8AU 2OAUA 1HK9A 3LX7A 2E65A 3GF5A 4FL6A 4F7UB 5GMKm 3OY9A 4M75C 3CD6T 2X4YA 4P5NA 4BY6C 2ZCFB 4FIBA 4A4FA 4TVRA 2MAMA 3DB4A 2EQJA 3JCMb 4M7DA 3C4SA 1O9SA 3FIFA 3HRTA 4X9CA 3RERA 1XOVA 3CCRT 1NPPA 3CD6A 4A4HA 2NLUA 2DIGA 2DAQA 4BI4A 5GAMd 3LWHA 5GAOr 2IVWA 3OYBA 2C06A 1X01A 1OZ3A 2CYZB 2EQMA 2P0PA 1KQ2A 5GAN7 3URGA 3MEAA 2E10A 4IUPA 3SWNB 3VJPA 4M77A 3MEVA 1BI0A 5LJ5j 1PSEA 2E41A 2QDYB 4MDWA 2KSSA 5CR2A 2KDSA 4C5HA 1YI2T 3C95A 1KHIA 2LT1A 3J7AF 4C8QF 2X4JA 3CCMT 2L5QA 5CVIA 3JCMc 4E7JA 5FU7C 4J5YA 1HXDA 1W2BA 3QZ5B 2K5IA 1YBYA 3KBGA 3NTHA 3HL8A 1B34A 4X34A 4DOWA 4NL2A 3CC4A 4IUTA 4JDSA 4M77F 3GIBA 1BIAA 4M7AA 4EMHA 3JB9D 4EPCA 3FLGA 5LJ5f 2EJFA 4DOVA 4IUVA 1QP2A 2V8JA 2LDMA 3PT9A 2F5TX 3JCMf 3RMSA 4JRKA 4C92E 2YRVA 2KVQG 2ZPHB 5GAMh 1QP3A 4M77C 5DY9A 2RHYA 1OZ2A 5KE3A 2JN0A 1VQ5A 4ELZC 2DO3A 1V29B 5FLXE 1I8FA 3A8GB 3CPFA 2R5MA 3UPUA 3VU3C 4M7DE 3HKSA 1M8VA 3QYHB 3M58A 4II1A 3PFSA 1H641 1JJ2S 4HCCA 3SWNA 2DXBA 1S72T 2M9UA 4UC4A 4PJOB 2E5QA 3J81E 2RA2A 3WXMB 2QEXT 3MO8A 2YHTA 5HKCA 5GAN8 1VQ9T 3L2UA 1KG1A 1UGQB 1BYMA 3V8KA 4RCBA 2KAFA 4PLIA 1S72A 3ZBDA 3CMAA 3GLXA 4M7AC 4M75B 1IREB 1QVGA 3FJPA 5M9OA 1M1FA 3OYCA 2KMTA 1N9SA 3QBYA 3OSSC 2RI3A 3VUBA 4JRQA 2A7YA 3G7ZA 4XTYA 2GFAA 3JCMV 2PVDB 3OYDA 2RK1A 3OS1A 2MWOA 4J6XA 3CCET 1Q86C 2V8KA 4QVCA 1Y96A 4A4KA 2DJZA 4E7IA 3C12A 1VQ8A 3OYJA 5CKDA 2WSEE 1VIFA 3SB2A 3MCAB 3NFCA 5CIUA 5L8RE 3BDLA 4A4GA 5A2QE 3OYAA 3CPWA 4YTLA 1WJSA 3SWNC 1YJ9T 2EWNA 2M16A 2L8DA 1K73U 2EIFA 5GAMg 4OB3B 4BUGA 3TEEA 3NTKA 3V8LA 1KD1C 4XAXB 2RJDA 5FU7B 1K8AC 2XK0A 2K57A 3C94A 3JRZA 2E70A 1RL2A 3RIRA 3QHSA 5FROA 4C8QE 2DTHA 3QG1A 3CCJT 5GAN2 5LJ5d 3SD4A 3V7CA 2LQKA 5AYFA 3G71A 1MHNA 3HPWA 2XHCA 3JCMd 2D0QB 2P0QA 3HFOA 1MGQA 5LJ3e 1YITT 2RHZA 5GANe 1KC8U 4NS5A 5GAOl 3DB3A 4M77E 2OTLA 4MMLA 2GQVA 2E64A 1M90U 1LJOA 2OTJA 2JZ2A 1WQWA 1O75A 1ZBXA 3I56A 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  4C8Q C;  3FIF A;  3RER A;  2RD1 A;  4X9C A;  4PJO F;  3RES A;  4F7U A;  2Y90 A;  4NL3 A;  5GAM d;  5GAO r;  1KQ2 A;  1X01 A;  2ZGW A;  2QTX A;  1U1S A;  4JLI A;  4M78 G;  4MMK A;  5GAN 7;  4OP0 A;  4M78 C;  5GAO n;  2E10 A;  3SWN B;  4M77 A;  4Y91 A;  5LJ3 g;  3EFS A;  5GAO q;  4F7U E;  5LJ5 j;  2E41 A;  5GAN g;  2DZ9 A;  4C92 B;  5GAN 3;  4XTU A;  4A54 A;  4C8Q F;  4J6W A;  4M7A B;  5LJ5 h;  3JCM c;  4V2S A;  4XTX A;  4F7U F;  2EAY A;  4J5Y A;  1HXD A;  3RKX A;  4N0A C;  3L1A A;  5GAM f;  4M7D B;  2RM4 A;  1B34 A;  2VXE A;  4NL2 A;  2DVE A;  2RB6 A;  4M77 F;  2YLB A;  3GIB A;  1BIA A;  4F7U G;  4EMH A;  5GAN 6;  4M7A A;  3JB9 D;  5GMK j;  5GAM j;  5LJ5 f;  2EJF A;  3QUI A;  3QO3 A;  3JCM f;  4JRK A;  4C92 E;  4M77 G;  5GMK h;  5GAM h;  4XTW A;  4M77 C;  1BIB A;  5LJ3 d;  5LJ5 e;  4HT9 A;  2YLC A;  5DY9 A;  4DQ2 A;  4M7A E;  5GAN d;  2JN0 A;  3JCM e;  5GAO p;  4XU1 A;  2FYK A;  1I8F A;  4A53 A;  3JB9 H;  3VU3 C;  4M78 B;  3JCM b;  4M7A D;  4M7D E;  1M8V A;  3HSB A;  3EFR A;  3FB9 A;  1H64 1;  3SWN A;  3V7S A;  4PJO B;  2FB7 A;  4XU0 A;  3JCM h;  4M7D D;  2RA2 A;  1JBM A;  1WNL A;  2YHT A;  4QVD A;  5GAN 8;  3INZ A;  3L2Z A;  1LOJ A;  1D3B B;  4C92 A;  3V8K A;  3BFM A;  2DXT A;  4RCB A;  3JCM J;  1WQ7 A;  4M7A G;  1KQ1 A;  5GMK i;  5GAM e;  5GMK e;  4M75 B;  4M7A C;  1Y96 B;  3FJP A;  1LNX A;  2DTI A;  3RKW A;  4HA8 A;  3JB9 F;  5LJ5 g;  3BY7 A;  4XU2 A;  3AHU A;  4PJO A;  1YCY A;  1N9S A;  2VC8 A;  2EJG A;  3BW1 A;  4JRI A;  4WF2 A;  1U1T A;  4XTZ A;  4EMK B;  3JCM P;  3JCM g;  2DXU A;  4XTY A;  4C8Q B;  2EJ9 A;  5I21 A;  3JCM V;  4M78 E;  5LJ3 j;  2DZC A;  4JUV A;  2CGH A;  4J6X A;  2E1H A;  4XTV A;  3RKY A;  5GAN j;  4QVC A;  4EMG A;  4M75 A;  3QSU A;  1Y96 A;  3JB9 G;  2DJZ A;  4C92 D;  3JCM Q;  4XQ3 A;  3JB9 J;  4HT8 A;  4PJO E;  3RUX A;  2I2L A;  3SB2 A;  4C92 F;  5GAN 4;  3JCM W;  5LJ3 h;  4EMK A;  3PGG A;  1I5L A;  5GAN h;  4M7A F;  4M77 B;  3SWN C;  1I81 A;  4C8Q A;  3JCM X;  4PJO D;  1JRI A;  2EWN A;  3HFN A;  4M75 E;  2DEQ A;  5GAM g;  3JB9 I;  4M7D F;  5GAN 5;  4RCC A;  4C92 G;  4C92 C;  3V8L A;  4M78 A;  1N9R A;  4M75 D;  4X9D A;  2K57 A;  4C8Q E;  1I4K 1;  2HNI A;  5LJ3 f;  3QHS A;  4M75 F;  3BDU A;  2DTH A;  4PJO G;  3RIR A;  5GAN 2;  5LJ5 d;  2DKG A;  5GAN f;  4M7D A;  4PJO C;  3V7C A;  3V7R A;  4M7D G;  4M7D C;  1WPY A;  1B34 B;  1TH7 A;  4C8Q D;  3JCM d;  1D3B A;  3HFO A;  3V8J A;  1MGQ A;  5LJ3 e;  5GAO m;  4PNO A;  4NOY A;  5CAI A;  1HK9 A;  4F7U B;  2E65 A;  5GAN e;  5GMK m;  1M5Q 1;  4XU3 A;  4M75 G;  5GAO l;  4M77 E;  4M75 C;  4MML A;  4N0A A;  2E64 A;  1LJO A;  4M78 D;  5GMK l;  3M4G A;  1WQW A;  4M78 F;  4J6Y A;  4EMK C;  4M77 D;  4C8Q G;  2VXF A; 
#chains in the Genus database with same CATH topology
 4QW2 A;  3GP8 A;  4R56 A;  2HQX A;  4NL3 A;  1N5Z A;  3CME T;  2LJ1 A;  4JRP A;  4OP0 A;  1A0N B;  4PFO A;  2YXY A;  1BKB A;  2LNV A;  2MYS A;  4A4E A;  3P8H A;  1VQK Q;  4C0G A;  1QCO A;  2DLP A;  3FEO A;  1BBZ A;  4ANJ A;  1WHM A;  3VS1 A;  2NUT B;  3DKM A;  1WJR A;  2EPD A;  3OYE A;  2P4T A;  1TU0 B;  2E6Z A;  2X51 A;  1ZHI A;  3OB9 A;  3CCR A;  3DLL A;  1AHJ B;  2BUD A;  3QDF A;  1M1K R;  2GCX A;  3G6E T;  2QAS A;  2Y4X A;  3MKD A;  4J7F A;  2D6F A;  3CC7 A;  2VB6 A;  1UHC A;  5CK9 A;  1B7T A;  3BFM A;  3VS0 A;  1G5V A;  2KY9 A;  2RJE A;  3NGP A;  3L2R A;  2CUB A;  1R8O B;  5LJ5 g;  2CZ6 B;  3M0Q A;  3CXC S;  2EYY A;  1R0C B;  3L42 A;  5LJ3 j;  4JUV A;  2CGH A;  5IT9 E;  3JB9 G;  1B07 A;  4PJO E;  3RUX A;  4C0D B;  3LGL A;  4M7A F;  1NJI U;  3TSZ A;  4AFU C;  4KH1 B;  4M75 E;  1IHV A;  3MP8 A;  3SEM A;  3LGF A;  2ED1 A;  2K79 A;  2XKO C;  1R0B G;  3G1J A;  2QEX A;  1KC8 C;  3M55 A;  5GAN f;  1RAD B;  4HVW A;  1N8R U;  3V8J A;  3OS0 A;  1BB9 A;  1N27 A;  3EGX B;  3CXC A;  2QG9 B;  4XU3 A;  3CMA Q;  5GMK l;  3VV0 A;  2D1X A;  1X6O A;  3VYG A;  3CCE A;  4BE0 A;  4M77 D;  5KYY B;  1MMG A;  3U23 A;  2HAX A;  2ZGW A;  2A37 A;  2X3X D;  1SRM A;  5A0L A;  4L59 A;  1YJ9 A;  4LDW A;  1YNZ A;  3N5B B;  4LE9 A;  2QGF B;  3EFS A;  5GAO q;  1S1N A;  3G4S T;  1NEG A;  1PD1 A;  2K3Y A;  1VQL T;  1NM7 A;  2YRC A;  3GNF B;  1WHG A;  1TUG B;  5GAM f;  1VQ7 A;  2COZ A;  3H8Z A;  2QQR A;  4E7L A;  4KH0 B;  1WJQ A;  3CEY A;  1M8M A;  1X6B A;  1D0Z A;  4PKC C;  3E2U A;  4XTW A;  1T0H A;  2CP6 A;  5GAN d;  1M3A A;  1PM3 A;  3QDR B;  1BI2 A;  1UEC A;  5IN1 A;  3CCQ A;  1YJW A;  3VS4 A;  2EQK A;  1JXO A;  3HTR A;  5I22 A;  2RK2 A;  3KFV A;  1FX7 A;  4HCZ A;  2ABL A;  4JJB A;  5FU6 B;  4BB7 A;  3JCM J;  3H41 A;  4J9B A;  1NEB A;  2J06 A;  4HA8 A;  4KGV B;  2BZY A;  2PVO B;  1X43 A;  3ZEH A;  3I5R A;  2GTO A;  3I35 A;  1NJI C;  2DD5 A;  4L6V 5;  4XQ3 A;  2YUP A;  1MMD A;  3CCS T;  3JCM W;  1AWO A;  2E3H A;  4QQD A;  2X35 A;  1FXX A;  3PGG A;  5GAN h;  4Y92 A;  2MIO A;  2JW4 A;  2O2O A;  3CCR Q;  1D09 B;  5J26 A;  1N8R C;  4BD3 A;  3O5Z A;  2XDB A;  1KC8 R;  5GAO m;  4J9I A;  2E4H A;  3IQL A;  1M5Q 1;  3RMQ A;  1AWW A;  1WHK A;  5KYU B;  2P84 A;  2EGA A;  1BK2 A;  2KK4 A;  1G3Y A;  1UEB A;  3UDC A;  1TUC A;  1CKA A;  1UB4 A;  1HSQ A;  2M51 A;  3M56 A;  4M4Z A;  1T0J A;  5FRN A;  4Y91 A;  1C0M A;  1Q95 G;  1HD3 A;  5J39 A;  5KH6 A;  5I11 A;  6AT1 B;  4FM4 B;  1YJN A;  1G2B A;  4F7U F;  3DLM A;  1I1J A;  2JS2 A;  2QXF A;  2KYB A;  3GNG A;  3SHW A;  1UUE A;  2M0Y A;  2LQN A;  3ZL7 C;  1VQO A;  4OMP A;  2WSF E;  2QTV A;  2ZPE B;  5GAM j;  2X9H A;  1Y7X A;  2JNG A;  1VQ8 T;  3R6O A;  2G3R A;  4DQ2 A;  3SDZ A;  4X1V A;  4M7A D;  1DJ7 B;  4IKF A;  1YJ9 Q;  2O31 A;  1PKT A;  1VA7 A;  5KYW A;  3OYI A;  4BE1 A;  1WDX A;  1TUD A;  2AK5 A;  1QVF P;  3G71 T;  1QCN A;  1M3B A;  4M7A G;  1KSW A;  3MJX A;  1LNX A;  4QVZ A;  2K2M A;  2L3S A;  2QGG A;  2OTL T;  2F2X A;  2GF7 A;  3ULR B;  3A5Z B;  2KQW A;  1MND A;  4D8K A;  1UG1 A;  3I56 T;  3I56 Q;  1OI1 A;  3PIP A;  5DLO A;  3OYN A;  4C92 F;  1NJI R;  5IAY A;  2CP2 A;  1YWO A;  1NZ9 A;  3I55 T;  1XJW B;  3JCM X;  2ROT A;  1EIF A;  2LJ0 A;  2VWF A;  1FMK A;  1VQN A;  4M7D F;  2K7A A;  3PMI A;  4OMO A;  1N9R A;  2CT3 A;  1VQ6 Q;  4F17 A;  1I4K 1;  1K0X A;  3CCQ Q;  1N8R R;  3CCV A;  2COY A;  1CKB A;  3V7R A;  3ZFJ A;  4FW1 A;  1K8A U;  3LX7 A;  5GMK m;  2E65 A;  2X4Y A;  4P5N A;  1IHW A;  2ZCF B;  1D1B A;  1WHL A;  2EQJ A;  2X3W D;  1XOV A;  2V1Q A;  4Z88 A;  2DAQ A;  2EQI A;  3OYB A;  2P0P A;  3EFO A;  3M0U A;  3VJP A;  1BCO A;  1TG0 A;  5LJ5 j;  4PJN A;  2QDY B;  5CR2 A;  2KDS A;  1YI2 T;  1GFC A;  3J7A F;  4C8Q F;  2X4J A;  2J6K A;  2OJ2 A;  4E7J A;  3BE3 A;  3KBG A;  3CC4 A;  4IUT A;  3M0P A;  1AWJ A;  4EMH A;  1JEG A;  4Z89 A;  4EPC A;  2HSP A;  3FLG A;  2EJF A;  1V76 A;  2YRV A;  2ZPH B;  2QA4 Q;  3EG2 A;  1OZ2 A;  2XMF A;  2JN0 A;  3EH2 A;  1PHT A;  5FLX E;  3A8G B;  3VU3 C;  1QCF A;  1M8V A;  2L3P A;  3M58 A;  4II1 A;  3PFS A;  4HCC A;  2KRO A;  2EYW A;  3M0T A;  1D1A A;  3MO8 A;  5GAN 8;  5HKC A;  3L2U A;  4CC2 A;  1RUW A;  4RCB A;  4CC4 B;  4PLI A;  1S72 A;  3ZBD A;  2DL8 A;  2HL3 A;  2KR3 A;  1QVG A;  1M1F A;  2CDT A;  3OSS C;  3VUB A;  1MV3 A;  3G7Z A;  1UDL A;  2GFA A;  2PVD B;  3OYD A;  2RK1 A;  4J6X A;  4QVC A;  1VQO Q;  2DJZ A;  3OYJ A;  1JU5 C;  1MMN A;  4LUE A;  2L8D A;  1I5O B;  2V1R A;  4BUG A;  3NTK A;  4XAX B;  1K8A C;  1RL2 A;  1JXM A;  3CCJ T;  3CCU Q;  2LQK A;  1UFF A;  4AT1 B;  3HPW A;  1VYU A;  2XHC A;  2KT1 A;  5LJ3 e;  1MGQ A;  1YIT T;  1YIT Q;  4DBQ A;  2GQV A;  3EFO B;  2E64 A;  1M90 U;  1LJO A;  1WQW A;  2NUZ A;  1SHG A;  1H3H A;  4PJO F;  1GXI E;  2O01 E;  1XQH A;  4GLM A;  3CCL A;  3H0F A;  4F7U E;  3CME A;  2CKK A;  4HVV A;  3PVQ A;  4E7Z A;  3GOX A;  4JZ3 A;  1WXB A;  1RAI B;  1YHQ Q;  1QKW A;  1PRM C;  1AVZ C;  3CCV Q;  4DEY A;  1Z9Z A;  1E6H A;  2Y4Y A;  3L2V A;  2HQH A;  1EX4 A;  2EKH A;  4ZTJ A;  4FT2 A;  2PNI A;  4E2F B;  2DRM A;  5LL6 S;  5HY6 A;  2LTO A;  2DXC A;  5EG2 A;  2EGE A;  3UA7 A;  2JXB A;  2CSI A;  2QK0 A;  1VQ4 T;  2QYZ A;  4QQ6 A;  2XDP A;  4J9G A;  4M7D D;  5C0M A;  3INZ A;  3CCM A;  3G6E A;  3PVL A;  1WQ7 A;  3Q1J A;  1BI1 A;  2DTI A;  2CP3 A;  3AHU A;  2YUQ A;  4A63 B;  1IRX A;  2DZC A;  2NUT A;  2M0O A;  3CC4 Q;  2L3Q A;  1M4Z A;  5GAN 4;  4CC3 A;  4EMK A;  2E3I A;  1K0S A;  2HKQ B;  3L2W A;  4RTY A;  3LW5 E;  2DEU A;  1M3C A;  2HD0 A;  5LJ3 f;  2AKL A;  2PTK A;  2YWW A;  2DKG A;  2PUK B;  4IIO A;  4C8Q D;  2RH2 A;  1U3O A;  3E1S A;  3RNJ A;  5CKB A;  4J8O A;  4ZNX A;  4BAC A;  1T3L A;  4M78 D;  2FEI A;  4EMK C;  4KRT A;  4C8Q G;  2ZPI B;  1JQQ A;  1GBR A;  4IUR A;  2Y90 A;  2VYT A;  2D8H A;  1BI3 A;  4M78 G;  5GAO n;  4CRI A;  1M9S A;  5D6Y A;  1G3W A;  2K3X A;  1T3S A;  2EYX A;  4WCI A;  2RHI A;  2YT6 A;  4FSX A;  4GBQ A;  5FWC A;  4A54 A;  2EAY A;  2IG0 A;  4ORZ A;  1VQL A;  3HHT B;  3EGX A;  1RAB B;  2O4X B;  2QQA A;  1SRL A;  4RKU E;  2FZK B;  4FW2 A;  3M0S A;  4C0D C;  4FSS A;  4J9F A;  3QO3 A;  3X24 B;  5KYY A;  5LJ3 d;  2QQB A;  2YLC A;  2AIR B;  2O9V A;  2VGN A;  1VQK T;  4M78 B;  3E9G A;  3CCL Q;  1EZZ B;  1ZA1 B;  2W10 A;  1Q86 U;  3JCM h;  2A3L A;  1YIJ A;  4OVA A;  1YN8 A;  2DXT A;  5GAM e;  4XTZ A;  3ASK A;  3BW1 A;  4OMM A;  4EMK B;  5IH2 A;  1XTD A;  2DL7 A;  1VUB A;  2A08 A;  1W2B S;  3LLR A;  2FPE A;  3EH1 A;  4ZGD B;  3CD6 Q;  1ZA2 B;  4JLG A;  5LJ3 h;  2MWP A;  2RI2 A;  3FRN A;  4JJC A;  4PJO D;  1RAG B;  3CCS A;  1RI0 A;  1AT1 B;  1OOT A;  1KJW A;  1SSH A;  2LT4 A;  4RCC A;  2RQV A;  3WVE B;  4BDZ A;  1G83 A;  2LC4 A;  2OX7 A;  4M75 D;  4Y28 E;  1VQM A;  1XNI A;  4HT9 A;  4PJO G;  1BU1 A;  1K4U S;  4R55 A;  4NOY A;  2LCC A;  4KBM B;  2KGT A;  1UTI A;  1H3Z A;  2DK3 A;  4M75 G;  3A8O B;  2KE9 A;  2FPF A;  4DEX A;  4B9W A;  1SG5 A;  4RTT A;  3ER0 A;  2AT1 B;  2CZ7 B;  3CPW S;  3H0I A;  2DD4 A;  4XTU A;  5FU6 C;  4CC7 A;  4XTX A;  2J05 A;  1K76 A;  2BIV A;  3CMA T;  3RKX A;  5AT1 B;  3X26 B;  2SRC A;  4KGX B;  1WI7 A;  4RTV A;  3TQ7 P;  4D8D A;  4KT0 E;  4D6W A;  4LUD A;  5KYU A;  1W1F A;  1PNJ A;  1SKU B;  4M77 G;  3JAM E;  5LJ5 e;  1ZUU A;  3M53 A;  1VQP A;  2CP5 A;  3M0R A;  2JTF A;  3NHN A;  1GCP A;  1MUZ A;  2ED0 A;  1G3S A;  2K9G A;  4FYY B;  2FB7 A;  2K6D A;  4PLL A;  4ZTF A;  2B8A A;  3C0C A;  2DL5 A;  4LXC A;  1PWT A;  2QDL A;  4C5E A;  1PCX A;  4PJJ A;  3BY7 A;  1UGS B;  4VUB A;  1NYG A;  2EJG A;  4WF2 A;  1M1G A;  1QVF S;  2DXU A;  5CQX A;  3EG3 A;  1Z9Q A;  2E1H A;  3MP1 A;  5L23 A;  4CI0 C;  2DVJ A;  1FMV A;  2GBQ A;  4RG8 A;  5HK0 A;  2RF0 A;  4M77 B;  1OUL A;  4Z02 A;  4MZT A;  3FJ5 A;  1ZLM A;  1W2B P;  1X69 A;  3BDU A;  3ME9 A;  1Y07 A;  1B34 B;  2K5F A;  3TU4 K;  4PNO A;  3TRE A;  2RQW A;  1YIJ Q;  1WZO A;  3OY9 A;  2BZX A;  4AFS C;  1QMC A;  2MAM A;  5GJW B;  1O9S A;  3HRT A;  2YUO A;  3CCR T;  1NPP A;  2YDL A;  4A4H A;  2NLU A;  2DIG A;  5GAM d;  5GAO r;  3LWH A;  1KQ2 A;  2DF6 A;  1OZ3 A;  2C0I A;  4OMQ A;  3SWN B;  3MEV A;  1PSE A;  2LX7 A;  3TSW A;  2J7I A;  4C5H A;  2KI7 A;  1D1C A;  2LT1 A;  1QWF A;  2AZS A;  3CC7 Q;  4J5Y A;  1HXD A;  4OMN A;  3QZ5 B;  1YBY A;  3NTH A;  4DOW A;  4RTU A;  4X34 A;  4NL2 A;  4JDS A;  2ESW A;  1BIA A;  4M7A A;  1WA7 A;  5LJ5 f;  2CP0 A;  4IUV A;  1QP2 A;  2BE9 B;  4DOV A;  3CPW P;  1BCM A;  1WYX A;  2F5T X;  4IIM A;  1TXQ A;  5GAM h;  1QP3 A;  4PK4 A;  5DY9 A;  2RHY A;  2W0Z A;  3UA6 A;  2LZ6 B;  1VQ5 A;  2DO3 A;  3QYH B;  1JJ2 S;  2A28 A;  4UC4 A;  2RA2 A;  2QEX T;  2YHT A;  2QEX Q;  1E7O A;  3R6N A;  1UGQ B;  1BYM A;  3V8K A;  3GLX A;  4M7A C;  2FZG B;  2M02 A;  2KMT A;  2RI3 A;  2DE0 X;  2D8J A;  2MWO A;  3CCE Q;  3CCE T;  2V8K A;  2K3B A;  1Y96 A;  2OI3 A;  3C12 A;  2WSE E;  3SB2 A;  1E6G A;  2HEQ A;  3MCA B;  3NFC A;  5CIU A;  1LCK A;  4K11 A;  1YJ9 T;  2EWN A;  1K73 U;  4OB3 B;  3TEE A;  3V8L A;  1YFN A;  2GQI A;  1VQP Q;  2XK0 A;  3JRZ A;  3RIR A;  5FRO A;  2L2P A;  3QHS A;  3QG1 A;  5LJ5 d;  3SD4 A;  1CSK A;  3V7C A;  1MHN A;  2J6O A;  3HFO A;  2KNB B;  1VQ7 Q;  4NS5 A;  3DB3 A;  2HSE B;  2OTJ A;  2BZ8 A;  3A8H B;  1O75 A;  1ZBX A;  2LCL A;  2XD0 A;  4J9D A;  4JLI A;  2SEM A;  2FPD A;  4Z8A A;  1VQ6 T;  2BKD N;  2KBT A;  5I2M A;  3OA6 A;  3CC2 A;  3CCQ T;  1YJW Q;  3VS6 A;  2ZPG B;  1ABQ A;  5KCH A;  1SEM A;  2R5A A;  3QYG B;  1K9M U;  2FO0 A;  1M30 A;  4M7A B;  5LJ5 h;  4V2S A;  3WVD B;  2BTT A;  2NWM A;  4DBH A;  4AFQ C;  5FWB A;  4HCK A;  2V26 A;  1B3Q A;  4PFP A;  3EG9 B;  1KK7 A;  4OB1 B;  1W4S A;  4RTZ A;  1GL5 A;  3QUI A;  4J9H A;  2RQT A;  1RAA B;  2K4Y A;  3JSC A;  1C1A A;  2ZZD A;  1EFN A;  2RI5 A;  1Q7Y U;  3UT1 A;  4B9X A;  3QII A;  1W70 A;  4F04 B;  2QQ9 A;  1AWX A;  9ATC B;  3H0H A;  2JVV A;  2MF2 A;  5CO7 A;  4RUG A;  1D3B B;  4KUI A;  4LD6 A;  4DBR A;  4C0Z A;  1Y96 B;  2V8I A;  4C0F A;  2B86 A;  4QKU A;  2LNH B;  1TWB A;  5HCK A;  2LJ3 A;  3JCM g;  2H3E B;  2QA4 T;  1NG2 A;  1JJ2 P;  3QZ9 B;  3MHX A;  4XTV A;  1NBE B;  3RKY A;  5CCA A;  1K73 C;  3M4Y A;  3VS2 A;  2EVR A;  1HYO A;  4N4G A;  3L2Q A;  1ZBJ A;  1IGQ A;  1U8R A;  3JB9 I;  2RN8 A;  3VKI A;  1OU9 A;  4RG2 A;  2FVU A;  1KHC A;  1FWZ A;  1KQS S;  1VQ5 Q;  2HQE A;  1VOM A;  3OS2 A;  1VQ9 A;  1YJN T;  5KYX B;  1YJN Q;  1G8X A;  2LP5 A;  3UAT A;  3OW2 S;  4OB2 B;  3P8B B;  5CAI A;  1X2Q A;  3A98 A;  1VQO T;  3LYI A;  2Z0W A;  1LPL A;  2G6F X;  2F5K A;  3M4G A;  1QQJ A;  2DVE A;  1H8K A;  5KE2 A;  2K2V A;  2DMO A;  4O5V A;  1K9A A;  1WHJ A;  1K9M C;  2YRD A;  1ZX6 A;  3CCU T;  2A0F B;  2EYZ A;  3A8M B;  4LD9 K;  2CH4 W;  2JTM A;  5KYN A;  2WAC A;  2H3J A;  1M1K U;  3M57 A;  3M54 A;  4XK8 E;  1QKX A;  2RM4 A;  1I07 A;  2RJC A;  4F7U G;  4GLK A;  5KCO A;  5GMK j;  3OBW A;  4OB0 B;  1Q7Y C;  1PD0 A;  4PL6 A;  2NUP A;  2OTJ Q;  4O6J A;  4PJL A;  2DL3 A;  1P92 A;  4QQG A;  2FYK A;  1NYF A;  3JB9 H;  1Y71 A;  2ATC B;  1VQN Q;  1YHQ T;  4XU0 A;  1U5S A;  2JUF A;  3CCV T;  5CQY A;  2F1L A;  1FYN A;  1W6X A;  5FRM A;  1NLO C;  3JB9 F;  1OEB A;  1PRL C;  3OYY A;  1OU8 A;  3H9N A;  2DPP B;  2EJ9 A;  2QI2 A;  2JOY A;  4C92 D;  3JCM Q;  2O4X A;  4FCY A;  4R0K A;  2O88 A;  3CBM A;  4C8Q A;  1I81 A;  4ELY C;  1Y0M A;  4AMC A;  4C92 G;  2X4X A;  1NPR A;  3X28 B;  4M78 A;  1OPK A;  2LVM A;  3NTI A;  4QT7 A;  1VYV A;  4X9D A;  2HNI A;  3EHQ A;  3RBB B;  4M7D G;  4DBF A;  3OQ5 A;  5CKH A;  3A8L B;  1WGS A;  1QW1 A;  3CC4 T;  3OYL A;  1Q81 U;  1NE8 A;  7AT1 B;  3OBY A;  4AFZ C;  4RTW A;  3HRS A;  2VXF A;  1KQS P;  2DTO A;  4C8Q C;  1MMA A;  3M59 A;  1UJY A;  3CBO A;  2QAZ A;  3RES A;  4J9E A;  2L3R A;  1ZUK A;  3OW2 P;  1TS9 A;  4M78 C;  2O9S A;  2JS0 A;  4Q5W A;  3QKJ A;  2MCN A;  3TCJ A;  1M1K C;  4OGE A;  1K9M R;  5GAN g;  1K8A R;  1M90 C;  4C92 B;  5GAN 3;  2VV5 A;  2E6N A;  1FMW A;  4J6W A;  3S3O A;  2CSQ A;  3MEW A;  4HKE A;  4B6M A;  2CT4 A;  1S72 Q;  4ZN3 A;  4M7D B;  2NUP B;  2VXE A;  3REB B;  2MPX C;  3OYM A;  3LH5 A;  4BY6 B;  2P0K A;  2DA9 A;  2WSC E;  3EGU A;  2KXD A;  4J7I A;  2PU9 B;  4MZM A;  1M2O A;  1Q7Y R;  2HZY A;  4LDV A;  4AG2 C;  2FZC B;  2DNU A;  1Y57 A;  4XU1 A;  5DLQ E;  2KYM A;  1X27 A;  4A53 A;  3PMT A;  5FW9 A;  2F69 A;  4BI8 B;  3HSB A;  2CH4 A;  2R58 A;  3FB9 A;  3KXT A;  2K5L A;  3G4S A;  4ESR A;  2VGM A;  1WNL A;  1ZSG A;  2EKO A;  4J9C A;  3S3N A;  2ZAE A;  4PJO A;  4F14 A;  2CZ0 B;  3GPL A;  5I21 A;  4C8Q B;  4JPB W;  3UF4 A;  2PVG B;  4M78 E;  3PTA A;  1X6G A;  4EMG A;  4M75 A;  1OQK A;  1AEY A;  5GJV B;  3CCL T;  4LDY A;  3M5A A;  2RQU A;  3P8D A;  4OMF B;  2EW3 A;  3D7S B;  5GAN 5;  3CME Q;  2NYS A;  3PNW C;  4LDU A;  4E7K A;  4EIK A;  2JM8 A;  4JJN K;  2HBP A;  2JJ9 A;  2PQW A;  4PJO C;  1Q81 C;  4JS5 A;  1SF9 A;  1WX6 A;  1JO8 A;  2MK5 A;  1KD1 U;  2OAU A;  1HK9 A;  4FL6 A;  3GF5 A;  4LN2 A;  4M75 C;  3CD6 T;  1R77 A;  4FIB A;  2DL4 A;  4RTX A;  3C4S A;  3RER A;  4X9C A;  4BI4 A;  2IVW A;  2CYZ B;  2DBM A;  2EQM A;  5GAN 7;  2LCS A;  3MEA A;  4IUP A;  4M77 A;  2JT4 A;  4KGZ B;  2KSS A;  3C95 A;  1KHI A;  3CCM T;  2L5Q A;  3CCM Q;  1M90 R;  3G6E Q;  1W2B A;  1GBQ A;  1B34 A;  4AG1 C;  3GIB A;  5D7U A;  3JB9 D;  2KRM A;  2V8J A;  4M77 C;  3RR6 A;  1YCS B;  4ELZ C;  1V29 B;  3UPU A;  3HKS A;  3SWN A;  2DXB A;  2M9U A;  4PJO B;  2E5Q A;  2DBK A;  3J81 E;  3WXM B;  1AZE A;  1KG1 A;  2PZ1 A;  1TOV A;  1V1C A;  2KAF A;  1AD5 A;  4M75 B;  3I9Q A;  1IRE B;  3FJP A;  2DIL A;  5M9O A;  2C0T A;  1LVK A;  3QBY A;  4JRQ A;  2A7Y A;  4XTY A;  2ENM A;  3JCM V;  2F2V A;  3OS1 A;  2HBW A;  1Q86 C;  4A4K A;  4E7I A;  1VQ8 A;  1ABO A;  1VIF A;  5L8R E;  3BDL A;  2KRS A;  3OYA A;  3CPW A;  4YTL A;  3SWN C;  2M16 A;  2EIF A;  1IXD A;  1TTH B;  1ARK A;  1KD1 C;  2RJD A;  1J3T A;  2K57 A;  2IIM A;  3EG0 A;  2KXC A;  3G71 A;  3G4S Q;  2D0Q B;  2P0Q A;  4PJM A;  1NLP C;  1Q81 R;  1VQL Q;  1I0C A;  1ZUY A;  3NMZ C;  4M77 E;  2OTL A;  2DM1 A;  2DX1 A;  3I56 A;  2RD1 A;  2RO0 A;  2RNA A;  1OPL A;  4KUD K;  5EC7 A;  1OX9 A;  2CS7 A;  2OAW A;  3I55 A;  3OSV A;  4FYX B;  4BE2 A;  2LMJ A;  3MEU A;  2DZ9 A;  3E19 A;  1VIE A;  1VQ6 A;  5DM7 R;  1YIJ T;  8AT1 B;  1Q82 U;  1QVF A;  3LH0 A;  2YSQ A;  3SFM A;  4KUL A;  2VKN A;  3VUZ A;  2XU8 A;  1D0X A;  3VYH B;  1OYX A;  2EQU A;  3VS5 A;  2COW A;  1H92 A;  1BIB A;  3VRY A;  3CBP A;  1PKS A;  3CCS Q;  3CC7 T;  2ROL A;  4ZGE B;  2VAS A;  1GFD A;  1QLY A;  1YI2 A;  3T9N A;  1JBM A;  1VQM T;  1VQM Q;  1LOJ A;  4F16 A;  3CXC P;  4JZ4 A;  1KQ1 A;  2CUD A;  5GMK e;  2EGC A;  1YCY A;  2VC8 A;  2XIC A;  3EG9 A;  1UGP B;  3QJY A;  4FU6 A;  4C5I A;  5GAN j;  5I2S A;  1Q86 R;  1M27 C;  2QA4 A;  3OMC A;  2I0N A;  4ME7 A;  3QWX X;  2RHX A;  2KEA A;  4E7S A;  4ATO A;  1WXU A;  2GTJ A;  5IHN A;  3QXE B;  4E7H A;  3A1P A;  3EGD A;  4ZGJ B;  3OYH A;  3EG1 A;  1UGR B;  3TVT A;  8ATC B;  1KD1 R;  3OS5 A;  2LX9 A;  4LDX A;  1TH7 A;  1D3B A;  4HXJ A;  3O8V A;  2YUN A;  5CKE A;  1WHH A;  4N0A A;  4MZP A;  1IZ6 A;  2KT8 A;  4IUU A;  2HCK A;  2VVK A;  1ZSZ A;  3E9F A;  1OX8 A;  1UGV A;  1JJ2 A;  2QTX A;  1VQP T;  1QVP A;  4J83 A;  1VQ8 Q;  3EAE A;  2DET A;  1Q82 C;  1PG5 B;  3JV3 A;  2LQ8 A;  2ZPF B;  1WFW A;  2XI9 A;  5HK3 A;  3QJ6 A;  3F70 A;  1UHF A;  1MNE A;  3CCJ A;  2CRE A;  3CCU A;  1VQ7 T;  3S3M A;  3HRU A;  1RLP C;  4N0A C;  3CQT A;  5KYX A;  1TSF A;  3L1A A;  1YIT A;  1G3T A;  2JM9 A;  1ZSZ C;  2YLB A;  3G71 Q;  2PUO B;  1AZG B;  2FHD A;  2OTL Q;  2LRQ A;  3PIO A;  4M7A E;  1YJW T;  2EFI A;  3NPF A;  1IO6 A;  2IPO B;  2XG8 D;  1ZQ1 A;  5C6S A;  3OYG A;  2HL5 C;  3EFR A;  2VUB A;  3FC3 A;  3V7S A;  3I55 Q;  2F2W A;  1GRI A;  4QVD A;  3L2Z A;  4GY5 A;  4E6R A;  2X4W A;  4ZN1 A;  1YHQ A;  5D6W A;  1YP5 A;  3EHR A;  5GMK i;  2E12 A;  4N4H A;  5A0D A;  3S6W A;  3OYK A;  4OML A;  1SSF A;  2C0O A;  5D6X A;  1PSF A;  2BE7 D;  2D9T A;  4JJD A;  3QSU A;  1HJD A;  4RMO A;  2LQW A;  4HT8 A;  3THK A;  3H6Z A;  3EGD B;  4OF1 A;  1I5L A;  3KUF A;  3QWY A;  2GFU A;  3HFN A;  2DEQ A;  4OGC A;  1VQ4 A;  5IHK A;  3VS3 A;  5CKF A;  4DA4 A;  2DYB A;  5IXF A;  1YI2 Q;  2GGR A;  4EDU A;  1ZSZ B;  2DFU A;  2RMO A;  2CZ1 B;  2EYQ A;  4IUQ A;  2RHU A;  4M78 F;  4J6Y A;  1QVG S;  3X20 B;  3UWN A;  1RAE B;  4FT4 A;  4F7U A;  2FG0 A;  2XID A;  2AHJ B;  5ECA A;  1U1S A;  4MMK A;  2DJQ A;  1VQ5 T;  2H8H A;  3VRZ A;  3REA B;  2MOX A;  1GCQ A;  2JMA A;  5LJ3 g;  4JS4 A;  4N4I A;  4PFZ A;  5KYW B;  2MMP A;  5J3B A;  3MP6 A;  1Q82 R;  1QWE A;  2DIQ A;  2FL7 A;  1PC0 A;  4HCB A;  4E47 A;  3J80 E;  4BDY A;  2RB6 A;  5A0G A;  5GAN 6;  2ECZ A;  2HKN A;  2R57 A;  3HP9 A;  1MV0 B;  2JMC A;  2QQS A;  3OYF A;  1JB0 E;  5GMK h;  5IHI A;  1GCQ C;  1KQS A;  5GAO p;  3JCM e;  3LWI A;  2FRW A;  2HMA A;  2L0A A;  3MET A;  1KIK A;  1U06 A;  3X25 B;  4C5G A;  3OW2 A;  2DER A;  4LNP A;  4BI3 A;  2KRN A;  2L89 A;  2MI6 A;  4C92 A;  2ZPB B;  2P4R A;  1RAH B;  2DYI A;  1WLP B;  3RKW A;  3CCJ Q;  4XU2 A;  2M1H A;  3QPH A;  4FYW B;  4JRI A;  4M7D A;  1U1T A;  3FDR A;  3JCM P;  1UE9 A;  2OTJ T;  2RJF A;  2E5K A;  3MPU B;  1KFZ A;  2RPN A;  1VYT A;  1C6V X;  4FYV B;  3JB9 J;  1M2V A;  2I2L A;  4MDX A;  5IXB A;  1VQN T;  3OMG A;  1JRI A;  1VQK A;  1RI9 A;  1N6A A;  3CC2 T;  3CC2 Q;  1AOJ A;  4L5G A;  4C92 C;  4HVU A;  1IB8 A;  4M75 F;  3M9Q A;  3GBQ A;  4M7D C;  1WPY A;  1F1B B;  2XDD A;  1X75 C;  4F7U B;  4BY6 C;  4A4F A;  4TVR A;  2A36 A;  1K73 R;  3DB4 A;  3JCM b;  3FIF A;  3CD6 A;  2C06 A;  2AZV A;  1X01 A;  3URG A;  1UJ0 A;  1X2K A;  2E10 A;  1BI0 A;  4MDW A;  2E41 A;  2RQR A;  1QVG P;  2HDA A;  5CVI A;  3JCM c;  1VQ4 Q;  5FU7 C;  1RAF B;  1IGU A;  2K5I A;  1K1Z A;  3HL8 A;  4M77 F;  3PE0 A;  1OV3 A;  4WTO B;  2LDM A;  1SHF A;  3PT9 A;  2DRK A;  3JCM f;  3RMS A;  4JRK A;  4C92 E;  2KVQ G;  5KE3 A;  2EBP A;  2D0N A;  1I8F A;  3CPF A;  2R5M A;  4M7D E;  1H64 1;  1S72 T;  2AKK A;  1VQ9 T;  1VQ9 Q;  1D0Y A;  3RDV A;  3CMA A;  1SPK A;  1M2V B;  3OYC A;  3VS7 A;  1N9S A;  2GNC A;  3I5S A;  1ACM B;  1RLQ C;  1RAC B;  1WXT A;  5CKD A;  4A4G A;  5A2Q E;  2J6F A;  1WJS A;  2CP7 A;  2JTE A;  5GAM g;  2FRY A;  1WIE A;  5FU7 B;  3C94 A;  4C8Q E;  2E70 A;  2DTH A;  5GAN 2;  1YWP A;  3AT1 B;  5AYF A;  3JCM d;  2RHZ A;  5GAN e;  1KC8 U;  5GAO l;  4MML A;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 4QW2 A;  2XD0 A;  3GP8 A;  2RD1 A;  2RO0 A;  4PJO F;  4R56 A;  4KUD K;  2HQX A;  1GXI E;  4NL3 A;  2O01 E;  1XQH A;  3CME T;  2CS7 A;  3I55 A;  4JRP A;  4JLI A;  3OSV A;  3CCL A;  4OP0 A;  1VQ6 T;  2BKD N;  3OA6 A;  5I2M A;  1BKB A;  3CC2 A;  3CCQ T;  2LNV A;  4F7U E;  3CME A;  4BE2 A;  3MEU A;  2DZ9 A;  2ZPG B;  4A4E A;  5KCH A;  3P8H A;  3E19 A;  1VIE A;  1VQ6 A;  2CKK A;  2R5A A;  3QYG B;  5DM7 R;  1K9M U;  1YIJ T;  4M7A B;  4C0G A;  5LJ5 h;  3GOX A;  4V2S A;  3WVD B;  1Q82 U;  1QVF A;  3LH0 A;  3FEO A;  3SFM A;  4KUL A;  3VUZ A;  4OB1 B;  3DKM A;  1W4S A;  2Y4Y A;  3L2V A;  2XU8 A;  1WJR A;  3OYE A;  4ZTJ A;  2P4T A;  2E6Z A;  3QUI A;  3VYH B;  1OYX A;  2EQU A;  1ZHI A;  3OB9 A;  3CCR A;  3DLL A;  4FT2 A;  1BIB A;  2K4Y A;  5HY6 A;  5LL6 S;  3JSC A;  1AHJ B;  2LTO A;  2ZZD A;  2BUD A;  2DXC A;  5EG2 A;  2RI5 A;  1Q7Y U;  3CBP A;  3UT1 A;  3CC7 T;  4B9X A;  1VQ4 T;  2GCX A;  4ZGE B;  3G6E T;  3QII A;  4QQ6 A;  2QQ9 A;  2XDP A;  2Y4X A;  1YI2 A;  2QA4 T;  4J7F A;  4M7D D;  2D6F A;  3T9N A;  1JBM A;  1VQM T;  5C0M A;  2JVV A;  2MF2 A;  5CO7 A;  3INZ A;  5CK9 A;  1LOJ A;  1D3B B;  3CC7 A;  3G6E A;  4KUI A;  4LD6 A;  3CCM A;  3BFM A;  1G5V A;  2KY9 A;  2RJE A;  1WQ7 A;  1KQ1 A;  3Q1J A;  5GMK e;  4C0Z A;  3L2R A;  1Y96 B;  2V8I A;  1BI1 A;  4C0F A;  2DTI A;  1R8O B;  5LJ5 g;  3AHU A;  2CZ6 B;  1YCY A;  2VC8 A;  3CXC S;  2XIC A;  3L42 A;  3JCM g;  5LJ3 j;  1UGP B;  2DZC A;  3QJY A;  4JUV A;  2CGH A;  4FU6 A;  3QZ9 B;  3MHX A;  2M0O A;  4XTV A;  3RKY A;  4C5I A;  5IT9 E;  5GAN j;  5CCA A;  3JB9 G;  1M4Z A;  1K73 C;  4PJO E;  3RUX A;  4C0D B;  5I2S A;  3M4Y A;  5GAN 4;  2QA4 A;  3LGL A;  3OMC A;  4EMK A;  4ME7 A;  4M7A F;  4N4G A;  1NJI U;  2RHX A;  3L2Q A;  1U8R A;  4M75 E;  4ATO A;  3MP8 A;  3JB9 I;  3L2W A;  3VKI A;  3LGF A;  4RG2 A;  2FVU A;  1KHC A;  2XKO C;  3QXE B;  1FWZ A;  4E7H A;  3LW5 E;  4ZGJ B;  3OYH A;  1KQS S;  2HQE A;  2HD0 A;  5LJ3 f;  1UGR B;  3OS2 A;  2QEX A;  1KC8 C;  3OS5 A;  1VQ9 A;  1YJN T;  2LX9 A;  3M55 A;  2DKG A;  5GAN f;  2PUK B;  3OW2 S;  4LDX A;  4OB2 B;  1N8R U;  1TH7 A;  4C8Q D;  2RH2 A;  1D3B A;  3V8J A;  3P8B B;  3OS0 A;  1N27 A;  3E1S A;  5CAI A;  5CKB A;  3CXC A;  3O8V A;  4J8O A;  1VQO T;  4XU3 A;  3LYI A;  5CKE A;  4N0A A;  4BAC A;  4MZP A;  4M78 D;  2F5K A;  5GMK l;  3VV0 A;  3M4G A;  1X6O A;  3VYG A;  4EMK C;  1IZ6 A;  3CCE A;  4BE0 A;  4M77 D;  4IUU A;  2DVE A;  2ZPI B;  4C8Q G;  5KE2 A;  2K2V A;  3E9F A;  4IUR A;  2Y90 A;  2VYT A;  1JJ2 A;  4O5V A;  2HAX A;  2ZGW A;  2QTX A;  1VQP T;  5A0L A;  1BI3 A;  1QVP A;  4L59 A;  4M78 G;  1YJ9 A;  5GAO n;  4LDW A;  4J83 A;  1K9M C;  4CRI A;  1M9S A;  3N5B B;  3EAE A;  1G3W A;  2K3X A;  5D6Y A;  3CCU T;  3EFS A;  5GAO q;  3A8M B;  1Q82 C;  2LQ8 A;  2ZPF B;  4LD9 K;  2XI9 A;  2RHI A;  5HK3 A;  3G4S T;  3QJ6 A;  4FSX A;  3F70 A;  2JTM A;  4A54 A;  2K3Y A;  3CCJ A;  2WAC A;  3CCU A;  1VQL T;  1VQ7 T;  3S3M A;  2H3J A;  1M1K U;  2EAY A;  3M57 A;  3HRU A;  3M54 A;  2IG0 A;  3GNF B;  4XK8 E;  4N0A C;  3L1A A;  5GAM f;  1YIT A;  2RM4 A;  1VQL A;  2RJC A;  3HHT B;  1VQ7 A;  3H8Z A;  1G3T A;  2QQR A;  2YLB A;  4E7L A;  4F7U G;  4GLK A;  5KCO A;  5GMK j;  1WJQ A;  3CEY A;  3OBW A;  4OB0 B;  2O4X B;  2QQA A;  4RKU E;  4C0D C;  2PUO B;  1Q7Y C;  3QO3 A;  4PKC C;  2FHD A;  2LRQ A;  4PL6 A;  3X24 B;  4XTW A;  4O6J A;  5LJ3 d;  2QQB A;  3PIO A;  4M7A E;  2YLC A;  1YJW T;  2EFI A;  5GAN d;  3QDR B;  1P92 A;  2VGN A;  4QQG A;  2FYK A;  1BI2 A;  1VQK T;  3JB9 H;  2XG8 D;  5IN1 A;  1ZQ1 A;  4M78 B;  5C6S A;  3OYG A;  3CCQ A;  1Y71 A;  3E9G A;  3EFR A;  1YJW A;  2VUB A;  3FC3 A;  2EQK A;  1YHQ T;  3V7S A;  2RK2 A;  1Q86 U;  4XU0 A;  1FX7 A;  3JCM h;  4HCZ A;  2A3L A;  2JUF A;  4QVD A;  1YIJ A;  3L2Z A;  4GY5 A;  4OVA A;  2X4W A;  4ZN1 A;  5CQY A;  3CCV T;  5FU6 B;  2DXT A;  4BB7 A;  1YHQ A;  3JCM J;  5D6W A;  5GAM e;  5GMK i;  2E12 A;  5FRM A;  4N4H A;  5A0D A;  3S6W A;  3OYK A;  4HA8 A;  3JB9 F;  1SSF A;  4XTZ A;  3ASK A;  3BW1 A;  2PVO B;  3OYY A;  4EMK B;  5D6X A;  2DPP B;  1PSF A;  1XTD A;  2D9T A;  2EJ9 A;  3ZEH A;  2QI2 A;  1VUB A;  1W2B S;  3QSU A;  1NJI C;  3LLR A;  4RMO A;  2JOY A;  2DD5 A;  4ZGD B;  4C92 D;  4L6V 5;  3JCM Q;  4XQ3 A;  4HT8 A;  2O4X A;  3CCS T;  3H6Z A;  4JLG A;  3JCM W;  5LJ3 h;  2MWP A;  2RI2 A;  3FRN A;  4OF1 A;  2X35 A;  1FXX A;  3PGG A;  4QQD A;  5GAN h;  3KUF A;  1I5L A;  3CBM A;  4C8Q A;  1I81 A;  4PJO D;  2GFU A;  4ELY C;  3CCS A;  3HFN A;  1RI0 A;  2DEQ A;  4OGC A;  1VQ4 A;  2LT4 A;  4RCC A;  4C92 G;  2X4X A;  3WVE B;  5J26 A;  4BDZ A;  1NPR A;  3X28 B;  4M78 A;  1N8R C;  2LVM A;  2LC4 A;  3NTI A;  5CKF A;  4M75 D;  4X9D A;  4BD3 A;  4Y28 E;  4DA4 A;  2HNI A;  1VQM A;  1XNI A;  4HT9 A;  4PJO G;  2XDB A;  4M7D G;  5GAO m;  4EDU A;  3OQ5 A;  4R55 A;  5CKH A;  3A8L B;  4NOY A;  2LCC A;  4KBM B;  1WGS A;  2CZ1 B;  1M5Q 1;  1QW1 A;  2DK3 A;  4M75 G;  3CC4 T;  1H3Z A;  3RMQ A;  2EYQ A;  3OYL A;  1Q81 U;  4IUQ A;  3A8O B;  1NE8 A;  2RHU A;  3OBY A;  4M78 F;  2KK4 A;  4J6Y A;  1QVG S;  3HRS A;  2VXF A;  1G3Y A;  2DTO A;  3X20 B;  4C8Q C;  3UWN A;  1UEB A;  3M59 A;  3CBO A;  3UDC A;  4FT4 A;  3RES A;  4F7U A;  2XID A;  1UB4 A;  2L3R A;  2AHJ B;  1U1S A;  3M56 A;  4MMK A;  4B9W A;  1VQ5 T;  4M78 C;  4Q5W A;  5FRN A;  4Y91 A;  5LJ3 g;  3ER0 A;  3QKJ A;  3TCJ A;  4JS4 A;  4N4I A;  1M1K C;  4OGE A;  2CZ7 B;  2MMP A;  5GAN g;  5J3B A;  3CPW S;  1M90 C;  2DD4 A;  5J39 A;  4C92 B;  3MP6 A;  5KH6 A;  5GAN 3;  2DIQ A;  4XTU A;  4FM4 B;  2VV5 A;  5FU6 C;  2E6N A;  2FL7 A;  4J6W A;  1YJN A;  3S3O A;  4XTX A;  3MEW A;  4HKE A;  4F7U F;  3DLM A;  3A8H B;  4HCB A;  2BIV A;  2QXF A;  3CMA T;  3RKX A;  3X26 B;  3GNG A;  4ZN3 A;  4E47 A;  3J80 E;  4M7D B;  4BDY A;  2VXE A;  1VQO A;  2RB6 A;  5A0G A;  2WSF E;  3OYM A;  4KT0 E;  5GAN 6;  2R57 A;  2ZPE B;  4D6W A;  5GAM j;  4BY6 B;  2P0K A;  3HP9 A;  2WSC E;  1Y7X A;  2JNG A;  4J7I A;  2PU9 B;  4MZM A;  2QQS A;  3OYF A;  1VQ8 T;  1JB0 E;  4M77 G;  5GMK h;  3JAM E;  3R6O A;  5LJ5 e;  2G3R A;  4DQ2 A;  3M53 A;  4LDV A;  1VQP A;  1KQS A;  3SDZ A;  5GAO p;  3JCM e;  3LWI A;  4XU1 A;  5DLQ E;  3MET A;  4A53 A;  3PMT A;  2F69 A;  2JTF A;  4BI8 B;  4M7A D;  3X25 B;  2R58 A;  4C5G A;  3FB9 A;  3OW2 A;  3HSB A;  1DJ7 B;  4IKF A;  3KXT A;  1G3S A;  2K5L A;  3G4S A;  2FB7 A;  2L89 A;  4BI3 A;  2VGM A;  4PLL A;  2MI6 A;  1WNL A;  3OYI A;  4BE1 A;  4ZTF A;  2B8A A;  4C92 A;  2ZPB B;  3G71 T;  2EKO A;  4M7A G;  4C5E A;  3S3N A;  1LNX A;  4QVZ A;  3RKW A;  4PJO A;  3BY7 A;  4XU2 A;  2CZ0 B;  1UGS B;  2M1H A;  3QPH A;  4VUB A;  4JRI A;  2EJG A;  4WF2 A;  3GPL A;  2OTL T;  1U1T A;  3FDR A;  3JCM P;  1M1G A;  1QVF S;  2DXU A;  5I21 A;  5CQX A;  4C8Q B;  2RJF A;  2OTJ T;  2GF7 A;  2PVG B;  4M78 E;  3A5Z B;  3PTA A;  2KQW A;  3MP1 A;  2E1H A;  3I56 T;  4EMG A;  4M75 A;  1OI1 A;  4CI0 C;  3JB9 J;  3PIP A;  5DLO A;  3OYN A;  2I2L A;  4C92 F;  4MDX A;  1VQN T;  4RG8 A;  5IAY A;  5HK0 A;  1NZ9 A;  4LDY A;  3I55 T;  3CCL T;  4M77 B;  3OMG A;  3M5A A;  3P8D A;  3JCM X;  1JRI A;  4Z02 A;  1EIF A;  1VQK A;  4MZT A;  1N6A A;  3CC2 T;  4OMF B;  1VQN A;  4M7D F;  5GAN 5;  4L5G A;  3PNW C;  4LDU A;  4C92 C;  3PMI A;  4E7K A;  1N9R A;  4JJN K;  1I4K 1;  2HBP A;  3BDU A;  4M75 F;  2PQW A;  3CCV A;  3M9Q A;  4PJO C;  3ME9 A;  1Y07 A;  3V7R A;  4JS5 A;  1Q81 C;  4M7D C;  1KD1 U;  1WPY A;  1B34 B;  3ZFJ A;  2K5F A;  2XDD A;  1X75 C;  3TU4 K;  4PNO A;  3TRE A;  1K8A U;  2OAU A;  1HK9 A;  3LX7 A;  2E65 A;  3GF5 A;  4FL6 A;  4F7U B;  5GMK m;  3OY9 A;  4M75 C;  3CD6 T;  2X4Y A;  4P5N A;  4BY6 C;  2ZCF B;  4FIB A;  4A4F A;  4TVR A;  2MAM A;  3DB4 A;  2EQJ A;  3JCM b;  4M7D A;  3C4S A;  1O9S A;  3FIF A;  3HRT A;  4X9C A;  3RER A;  1XOV A;  3CCR T;  1NPP A;  3CD6 A;  4A4H A;  2NLU A;  2DIG A;  2DAQ A;  4BI4 A;  5GAM d;  3LWH A;  5GAO r;  2IVW A;  3OYB A;  2C06 A;  1X01 A;  1OZ3 A;  2CYZ B;  2EQM A;  2P0P A;  1KQ2 A;  5GAN 7;  3URG A;  3MEA A;  2E10 A;  4IUP A;  3SWN B;  3VJP A;  4M77 A;  3MEV A;  1BI0 A;  5LJ5 j;  1PSE A;  2E41 A;  2QDY B;  4MDW A;  2KSS A;  5CR2 A;  2KDS A;  4C5H A;  1YI2 T;  3C95 A;  1KHI A;  2LT1 A;  3J7A F;  4C8Q F;  2X4J A;  3CCM T;  2L5Q A;  5CVI A;  3JCM c;  4E7J A;  5FU7 C;  4J5Y A;  1HXD A;  1W2B A;  3QZ5 B;  2K5I A;  1YBY A;  3KBG A;  3NTH A;  3HL8 A;  1B34 A;  4X34 A;  4DOW A;  4NL2 A;  3CC4 A;  4IUT A;  4JDS A;  4M77 F;  3GIB A;  1BIA A;  4M7A A;  4EMH A;  3JB9 D;  4EPC A;  3FLG A;  5LJ5 f;  2EJF A;  4DOV A;  4IUV A;  1QP2 A;  2V8J A;  2LDM A;  3PT9 A;  2F5T X;  3JCM f;  3RMS A;  4JRK A;  4C92 E;  2YRV A;  2KVQ G;  2ZPH B;  5GAM h;  1QP3 A;  4M77 C;  5DY9 A;  2RHY A;  1OZ2 A;  5KE3 A;  2JN0 A;  1VQ5 A;  4ELZ C;  2DO3 A;  1V29 B;  5FLX E;  1I8F A;  3A8G B;  3CPF A;  2R5M A;  3UPU A;  3VU3 C;  4M7D E;  3HKS A;  1M8V A;  3QYH B;  3M58 A;  4II1 A;  3PFS A;  1H64 1;  1JJ2 S;  4HCC A;  3SWN A;  2DXB A;  1S72 T;  2M9U A;  4UC4 A;  4PJO B;  2E5Q A;  3J81 E;  2RA2 A;  3WXM B;  2QEX T;  3MO8 A;  2YHT A;  5HKC A;  5GAN 8;  1VQ9 T;  3L2U A;  1KG1 A;  1UGQ B;  1BYM A;  3V8K A;  4RCB A;  2KAF A;  4PLI A;  1S72 A;  3ZBD A;  3CMA A;  3GLX A;  4M7A C;  4M75 B;  1IRE B;  1QVG A;  3FJP A;  5M9O A;  1M1F A;  3OYC A;  2KMT A;  1N9S A;  3QBY A;  3OSS C;  2RI3 A;  3VUB A;  4JRQ A;  2A7Y A;  3G7Z A;  4XTY A;  2GFA A;  3JCM V;  2PVD B;  3OYD A;  2RK1 A;  3OS1 A;  2MWO A;  4J6X A;  3CCE T;  1Q86 C;  2V8K A;  4QVC A;  1Y96 A;  4A4K A;  2DJZ A;  4E7I A;  3C12 A;  1VQ8 A;  3OYJ A;  5CKD A;  2WSE E;  1VIF A;  3SB2 A;  3MCA B;  3NFC A;  5CIU A;  5L8R E;  3BDL A;  4A4G A;  5A2Q E;  3OYA A;  3CPW A;  4YTL A;  1WJS A;  3SWN C;  1YJ9 T;  2EWN A;  2M16 A;  2L8D A;  1K73 U;  2EIF A;  5GAM g;  4OB3 B;  4BUG A;  3TEE A;  3NTK A;  3V8L A;  1KD1 C;  4XAX B;  2RJD A;  5FU7 B;  1K8A C;  2XK0 A;  2K57 A;  3C94 A;  3JRZ A;  2E70 A;  1RL2 A;  3RIR A;  3QHS A;  5FRO A;  4C8Q E;  2DTH A;  3QG1 A;  3CCJ T;  5GAN 2;  5LJ5 d;  3SD4 A;  3V7C A;  2LQK A;  5AYF A;  3G71 A;  1MHN A;  3HPW A;  2XHC A;  3JCM d;  2D0Q B;  2P0Q A;  3HFO A;  1MGQ A;  5LJ3 e;  1YIT T;  2RHZ A;  5GAN e;  1KC8 U;  4NS5 A;  5GAO l;  3DB3 A;  4M77 E;  2OTL A;  4MML A;  2GQV A;  2E64 A;  1M90 U;  1LJO A;  2OTJ A;  2JZ2 A;  1WQW A;  1O75 A;  1ZBX A;  3I56 A;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...