3FIFA

Crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
SDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIERLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein ygdR
publication title Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
rcsb
source organism Escherichia coli k-12
molecule tags Structural genomics, unknown function
total genus 4
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fifA00
4C92F 4C92B 2ZGWA 2Y90A 5GAMh 5GAMe 4M7DE 5GAMf 5CAIA 5GAOn 4NL2A 3JCMe 5GMKh 4EMGA 1KQ1A 5GANj 3BY7A 5GAN7 4M75F 1LNXA 1D3BA 4M75B 4RCCA 4N0AA 3V7RA 2QTXA 5GANd 5GAOr 4XU1A 3HFNA 2DTHA 2VXFA 2DXUA 1WNLA 2RA2A 4PJOB 1WPYA 4M7AF 4M7AB 1B34A 1MGQA 2RD1A 1U1SA 2I2LA 2E10A 4JUVA 2E64A 4XU2A 4Y91A 5GAN5 4PNOA 3L1AA 4QVDA 5GAN8 2EAYA 5LJ5j 4J6WA 5GAN4 3JCMP 3GIBA 3RUXA 1WQ7A 2DEQA 2YLBA 4XQ3A 3JCMJ 4M7DF 4M78D 3V8KA 4M7DB 2EJ9A 3SWNC 2DTIA 1N9RA 5LJ5d 4M78A 4XU0A 4J5YA 4MMKA 4DQ2A 4EMKC 2E65A 3RIRA 4NL3A 4M77D 5GAN3 5I21A 3JCMc 4JRIA 4M77A 3JCMh 2E41A 4M78G 2DTOA 5GAOp 3JCMf 3SWNA 2VC8A 5LJ3d 2FYKA 1Y96A 4M77G 4EMKA 3V8LA 4OP0A 1I4K1 2EWNA 5GANg 3JB9H 4JRKA 5GMKj 2DXTA 5GAMd 1WQWA 4M78C 4A54A 4C8QC 3RKYA 4JLIA 4F7UA 3EFRA 4XU3A 4XTXA 4M78E 3QUIA 1JBMA 3JB9J 5GANe 2FB7A 2RB6A 4M77C 4RCBA 3V7CA 4XTYA 3QSUA 1D3BB 3RERA 4HT9A 1M5Q1 4PJOD 3RESA 4XTUA 4M77E 3V8JA 4C8QD 4C92C 2YHTA 1I5LA 5LJ5g 5GAN2 3FB9A 4C8QA 1LJOA 4WF2A 1B34B 5GMKl 5LJ3j 1U1TA 4MMLA 3BFMA 3VU3C 4C92D 1BIBA 2DVEA 4M75C 4C8QG 4XTZA 5LJ5e 2E1HA 4C92A 2RM4A 3JCMQ 3EFSA 3M4GA 4X9CA 5GAMj 1JRIA 5LJ3g 4M78F 1I8FA 4M78B 4F7UE 4J6XA 1LOJA 5GAOm 2EJGA 4PJOC 4C8QF 4A53A 3RKXA 1X01A 4M75D 4C92G 5GAOl 3FJPA 4NOYA 5GAN6 5GAMg 4M75A 4M77F 4M77B 4PJOE 3JCMd 3BW1A 2EJFA 4J6YA 5GANh 4QVCA 4M7DC 3JCMW 3SWNB 4C8QE 5GANf 2VXEA 2JN0A 1YCYA 3RKWA 3AHUA 4M7AD 1Y96B 2HNIA 4PJOA 4M75G 5DY9A 4EMKB 5GAOq 4M7AA 4F7UG 3BDUA 3QHSA 3V7SA 3PGGA 2DJZA 2CGHA 5GMKm 5GMKe 3JB9D 4C92E 4M7DD 3SB2A 4PJOG 2DZ9A 1N9SA 3JCMX 4M7AG 4F7UF 4F7UB 4M7DA 4XTWA 3FIFA 3JCMV 5LJ5h 3L2ZA 1TH7A 1HXDA 4EMHA 5GMKi 4HT8A 5LJ5f 2DZCA 4PJOF 4M7DG 4M75E 3JB9G 1M8VA 1H641 3HFOA 3JB9I 1HK9A 3HSBA 4C8QB 4M7AC 3QO3A 4XTVA 3JCMb 4X9DA 1I81A 2YLCA 3INZA 1BIAA 5LJ3h 3JB9F 4M7AE 5LJ3e 2K57A 5LJ3f 2DKGA 4HA8A 3JCMg 1KQ2A 4N0AC 4V2SA
chains in the Genus database with same CATH superfamily
2IPOB 1T0HA 1R8OB 2B86A 2RJDA 5GMKh 1ZHIA 3L42A 3H8ZA 2E6NA 2DD5A 2OTJQ 3N5BB 2YUNA 4HCCA 5GANd 2ZPEB 2FEIA 2EQIA 5GJWB 1KG1A 1OX8A 3CD6T 4NS5A 1MGQA 1K73C 4A63B 4HCZA 1E6GA 1OEBA 3GIBA 4BDZA 4M7DF 1W6XA 2QI2A 1D1CA 4C0DB 3OS0A 1X6OA 3CCJT 2FO0A 3UPUA 2DTOA 3JCMf 5J3BA 3OYHA 2DMOA 4EMKA 3ULRB 1WHGA 3LH5A 1ZUKA 2E12A 2OTLT 3ZFJA 1GCQC 5IT9E 4C8QD 4HCBA 3EGUA 1QVFS 5GAN2 4BE2A 4C8QG 1KQSA 3CCUT 4X9CA 2LT1A 3OYJA 1SSFA 4ELYC 3H0HA 4C8QF 1ABQA 1GL5A 1QWEA 5KE2A 1YCYA 3HL8A 4DOWA 2RI3A 2CGHA 3WVDB 4F7UB 3L2ZA 4VUBA 1Q86C 1XJWB 1H641 3URGA 1WZOA 4X9DA 3MCAB 3INZA 3MHXA 2NLUA 3NTHA 2IVWA 3SHWA 2CP5A 1VA7A 2QQ9A 4JRQA 2RQRA 3VV0A 2GFAA 3VUZA 3JSCA 2QEXA 3OSVA 3DLMA 1NJIU 1Z9ZA 3AT1B 1OV3A 2OTJT 1WXUA 3VS6A 2EW3A 1NPRA 5LL6S 5KCOA 3TSWA 2DF6A 1AHJB 2K3XA 4QVDA 1RAEB 2JM8A 2MPXC 5CVIA 3RUXA 2K5LA 4XQ3A 3M0TA 3G4ST 2BIVA 2QDLA 2CT3A 1N9RA 2ZPFB 3QWXX 4DQ2A 2RI5A 1UE9A 1Q82C 4C0GA 3JCMc 1E6HA 1OULA 3EGDA 4DBHA 1VQLA 4ORZA 3LGFA 4LD6A 1AOJA 1FWZA 4E6RA 2AK5A 2LMJA 2L2PA 1YJWQ 3OYLA 4HKEA 1GCPA 4KT0E 1EZZB 1VQNA 1ZX6A 5IN1A 3VU3C 4GLKA 1RI9A 3GNGA 4M78B 4C0FA 2DRMA 5IXBA 1KD1R 2YRVA 5GAMg 4M77F 1YI2A 3BW1A 4AG2C 4M7DC 3OYNA 1M9SA 4C8QE 2JN0A 3CCQT 5GAOq 3DB4A 1YNZA 4GLMA 3CPFA 3REAB 1SKUB 2KXCA 3EHQA 3ZEHA 1WHKA 1GFCA 3L2QA 3MP6A 3JB9I 4LN2A 1AVZC 2F1LA 1U3OA 1WGSA 4KGXB 4WTOB 1TXQA 1W2BP 5LJ3e 3EGXB 3CC2Q 2O01E 2K7AA 1ZA1B 1G3WA 3JCMe 2XKOC 1GRIA 2MYSA 3BY7A 3G6EQ 3A98A 4E47A 4QQGA 5I11A 4RG2A 4FYXB 1RACB 2DPPB 5IXFA 5KYWB 4RTYA 3OW2P 1M3AA 3JCMP 4BB7A 2R58A 3M55A 1MMDA 2LCLA 4LUEA 1GBRA 1FMKA 3RIRA 4XK8E 1QVFA 4II1A 4ZGJB 2M0YA 2C0IA 4IUQA 4F17A 3ER0A 1YITA 2CH4W 4ELZC 2I0NA 3MPUB 2LVMA 2EYQA 1I4K1 4LDUA 5GANg 3JB9H 4B6MA 2HKQB 4JLIA 1JBMA 4BE0A 1YJWT 1Q7YU 3CCMQ 2QG9B 2NUZA 3CCRT 1VQPA 4KH1B 2J7IA 2CSIA 2MOXA 1VQ8Q 1AD5A 1TUCA 2PVDB 3EG1A 2SRCA 5I22A 3CXCS 5GAN6 3L2RA 1YJ9Q 2X51A 4LNPA 1VQKQ 3RMSA 2CP0A 2DJZA 2C06A 2LRQA 1LVKA 2XDBA 1H8KA 2F2VA 4L59A 4L5GA 3CCLQ 3FJ5A 3HFOA 3HSBA 2YSQA 2QA4Q 1LPLA 3PVQA 1VQ6A 1CKBA 1KHIA 4OB1B 2O2OA 4C92F 2ZGWA 2Y90A 3PFSA 5GAMh 2RHUA 1K73U 2BZXA 5GANj 1V76A 1VQOT 1HD3A 4M75B 2MK5A 4FYVB 2JNGA 4LUDA 2RQTA 3H41A 3OS5A 1K8AC 2RD1A 3G1JA 3TSZA 1VQ7A 3L1AA 2CS7A 2O4XA 2D9TA 5A2QE 3JCMJ 1RUWA 2DRKA 5FWCA 4J5YA 4RTUA 3CPWP 1UG1A 2RK1A 1GCQA 2XD0A 3EAEA 1HJDA 2A37A 4FL6A 1SEMA 3OYKA 1MMGA 2AKKA 2CSQA 4ZNXA 1MV3A 4M78C 2JZ2A 2BKDN 1VYTA 5HKCA 3SDZA 1QP3A 3V7CA 1D3BB 1SG5A 2HQHA 4E7LA 1WLPB 3FB9A 1UJ0A 1B3QA 1LJOA 3R6NA 3H0FA 2DM1A 4J9FA 1KK7A 1VQ8T 2GNCA 1QCFA 3JCMQ 1H3HA 4PL6A 2QQBA 4BI4A 4PJJA 1N8RR 2HQXA 2D8HA 2MI6A 1JU5C 1YJ9T 5GANh 1ZQ1A 4CC4B 1KD1C 1M4ZA 4OB2B 1YWOA 4LDXA 4A4EA 1M2VA 1OPKA 2FHDA 5GMKe 1BI1A 3JCMX 1WHLA 1PC0A 2A36A 5GMKi 4ZTJA 1IGQA 1VQ9Q 3CCLT 1M8VA 4BD3A 3TU4K 5A0LA 2QA4T 4J9HA 2ZCFB 4AG1C 1BIAA 3X20B 2OX7A 5CKHA 1KC8U 3CMAA 4IUPA 2DK3A 4FW2A 3GNFB 2VGMA 1Y7XA 2VKNA 1JQQA 2LCCA 5CKDA 1YIJA 3EHRA 2E6ZA 1OZ2A 1KJWA 4JJCA 4M7AF 2W10A 3OYMA 4Y91A 1EX4A 2JJ9A 4A4HA 3M54A 2LQ8A 1UGPB 2P84A 2K3BA 3CCST 3CC7Q 5LJ5d 4R55A 1VIFA 4MZTA 3L2WA 1YHQA 1H92A 2RQUA 5I21A 1WJRA 1QVGP 4JDSA 3CCEA 3NFCA 3M4YA 1ZUUA 1K9MC 2VC8A 2DBMA 4J83A 1Q81R 3VJPA 4R0KA 1IHWA 1PCXA 3CD6Q 3UDCA 1AT1B 4J7FA 3CXCA 1X2KA 4JJNK 3QSUA 3QDRB 3QKJA 2XDPA 4C92C 3O5ZA 1KC8R 1BU1A 1YJNQ 2ED1A 1KSWA 5CKBA 1MHNA 2CP6A 3X24B 2K4YA 3G71T 1FXXA 1WI7A 4OB0B 1JRIA 1I8FA 5GAOm 4PJOC 2X4JA 1ZA2B 3F70A 1X01A 3HP9A 5KYUB 3EFOB 2OTLQ 3VYGA 4JLGA 2K6DA 3CCVT 3LX7A 2FRYA 3QZ9B 2YDLA 2ED0A 1UGRB 1IRXA 2DZ9A 3CMEA 1BI0A 2CYZB 2LQKA 4DOVA 1TWBA 2DETA 3CCUQ 3MKDA 2J6FA 4JPBW 5C0MA 1M1FA 4O6JA 2H3EB 1JB0E 4B9WA 3PMTA 2YLCA 4B9XA 1VYVA 2PUKB 2KBTA 2RJCA 4CC7A 4E7IA 1RAIB 1I0CA 5GAMf 2AIRB 5CAIA 3OY9A 1OZ3A 1M1KC 5GAN7 3L2UA 2CT4A 2QK0A 2DXUA 1JO8A 3CC4A 3H0IA 1U1SA 5GAN5 2XDDA 2E3HA 3UT1A 2GGRA 2QQSA 3HKSA 4M7DB 2DVJA 5KYNA 2EJ9A 3CC7T 4XU0A 3CBPA 2L8DA 2QQRA 4E7KA 4DBFA 3I56A 4ZTFA 2DBKA 2E3IA 2NUTA 1U06A 2LCSA 1GFDA 5LJ3d 1O75A 1RAFB 2HSEB 2K2MA 1QWFA 2DXCA 1G5VA 4X1VA 4ZN3A 2DL8A 3UA7A 2MAMA 4F7UA 3H9NA 3QJ6A 3ZL7C 4FYWB 4J7IA 2CZ0B 3A8HB 3G4SQ 4PLIA 3MP8A 6AT1B 5I2SA 2OAUA 4C0ZA 2GTOA 2WSEE 2F2WA 1YJNT 1W1FA 4XAXB 3OBYA 2K79A 2CKKA 2GTJA 2RM4A 5FROA 1RL2A 2GQIA 1WIEA 2EJGA 4RTWA 1VQ5T 2V1RA 1T0JA 5CKEA 5GANf 1K0SA 4KGZB 1N8RC 1YCSB 4J9EA 1PWTA 2ECZA 5A0GA 3JB9D 2CZ1B 3FRNA 1N5ZA 1X2QA 2ATCB 3JB9G 1OPLA 1C1AA 3DB3A 1Q95G 1I81A 2EPDA 3JB9F 2DEUA 4RUGA 3OA6A 3CCQQ 2AZSA 1K8AU 3VS5A 1JXMA 2FPEA 4UC4A 4QW2A 3ME9A 2DL7A 1MNDA 4ZGDB 5M9OA 1LNXA 4PFZA 4N0AA 4O5VA 3REBB 2VXFA 4OMFB 4XU2A 2XICA 5GAN8 1TS9A 1D0XA 3X25B 4LD9K 4M78A 5D7UA 1D1BA 4NL3A 5GAN3 1UHFA 4JRIA 3NTKA 2VV5A 3NMZC 1VQLQ 4FSSA 3GF5A 2YWWA 3IQLA 3JAME 3M0SA 1UDLA 3EH2A 4A54A 2RHYA 4Y28E 1X75C 3FC3A 1Q81C 3Q1JA 3OMCA 1TTHB 3X26B 5ECAA 3RESA 3OMGA 3QYHB 5LJ5g 3EG9B 1BI3A 3S3NA 4ZGEB 3QPHA 1VYUA 3QZ5B 3EGXA 3PIPA 2P0PA 4OVAA 1QLYA 4F14A 2K3YA 3RBBB 1PNJA 2R57A 1WHHA 4M77B 5IHNA 3D7SB 4J6YA 3JCMW 4PFOA 1ZBXA 2P0QA 3R6OA 2PQWA 1MMNA 5KYWA 1XQHA 2RH2A 3CCRQ 2D0NA 2AT1B 3TVTA 3C4SA 1NJIR 2DZCA 2JW4A 1WX6A 2DX1A 3A5ZB 1VQ4A 4FIBA 4IIMA 1NBEB 1RLPC 2V26A 1WHJA 2CDTA 4ZN1A 2D0QB 2L3PA 3CBMA 4NL2A 4K11A 2QEXT 1BI2A 2QTXA 3M53A 4IUTA 2DTHA 3KXTA 3MJXA 4OB3B 1AWOA 1BBZA 4JS4A 2B8AA 5FU7C 4AFQC 3J80E 4A4KA 5LJ5j 1K9MU 1ZSZB 2DE0X 4PJMA 1E7OA 3JRZA 4M78D 3V8KA 3SWNC 2GQVA 2EYXA 4BUGA 4J9DA 4M78G 1W2BS 1VQLT 1VQOQ 3MP1A 1GXIE 1YFNA 3TCJA 5AYFA 3MEUA 3MO8A 4C8QC 3RKYA 2PVGB 1SSHA 2GF7A 2QGGA 1VOMA 5GANe 5L23A 3VKIA 1JJ2P 1VQNT 2VVKA 3OW2S 2X4YA 4ESRA 1VQPQ 1IXDA 2ABLA 1S72A 2QDYB 5GAMj 5LJ3g 4F7UE 1WYXA 4DEXA 3RKXA 4QVZA 1YBYA 3QDFA 4NOYA 3P8DA 4M75A 5CR2A 5AT1B 3RDVA 3J81E 2BUDA 1YI2T 3CC2A 4AFSC 3EG0A 2VXEA 4QQDA 5GJVB 2YRCA 4GBQA 3C95A 2LJ1A 3PGGA 2ESWA 4TVRA 3OS1A 1M90U 1TUGB 2P0KA 1R0BG 3G6EA 2X3XD 5LJ5h 4WCIA 2A7YA 2HL5C 1QCNA 4HVVA 1T3SA 4XTVA 1M1KU 1VQ6Q 2ZPHB 5FWBA 2K57A 4LE9A 4AFUC 4C92B 4JZ3A 5IHIA 2BE9B 3NTIA 4DEYA 4C5GA 1D3BA 1PHTA 2X3WD 2MWPA 5HCKA 2G3RA 1ABOA 3QXEB 1AZGB 4PJOB 4X34A 1BCOA 3CCMA 1WQ7A 4FCYA 2JT4A 3BE3A 1Q7YR 1TUDA 2KI7A 4EMKC 2K2VA 1PG5B 1T3LA 2VASA 4J8OA 1N6AA 4RTTA 2EVRA 1YITT 4CC2A 2K5IA 3KBGA 1OQKA 4JRKA 2E5QA 2DXTA 1OU8A 3L2VA 3HPWA 4FU6A 1PKTA 4M78E 3OYDA 5FRNA 2FB7A 4M77C 4PJOD 1VQKA 1HYOA 1EFNA 3CCSQ 5IHKA 3I55A 4OMOA 1M3BA 4WF2A 3RMQA 1B34B 3S3OA 5CO7A 3LYIA 2K9GA 1VQPT 1SF9A 2HBWA 2E1HA 3OYAA 4OGCA 2L3QA 3MEAA 3CPWS 5I2MA 2J06A 4M75D 3FJPA 5D6WA 1O9SA 3M0QA 2M9UA 7AT1B 2QASA 1WA7A 3QG1A 4M75G 4E7ZA 4F16A 3G7ZA 3VS1A 2RJEA 1I5OB 1K73R 4MZPA 1W70A 1NLPC 1QQJA 3G71Q 1H3ZA 1WFWA 2NUPB 4N4GA 5FLXE 1HK9A 3JCMb 5EG2A 1VQMA 1UFFA 1NJIC 1PSFA 1VQ6T 1WHMA 5LJ3h 4R56A 2KYMA 2A0FB 3CCVQ 1ZSZC 2X9HA 1Q86U 3CMAQ 4C5HA 2JS2A 1M1GA 1SRLA 5GAOn 5HY6A 5CIUA 1WJQA 1W2BA 1UECA 3HFNA 5DM7R 4IUVA 4M7AB 2LT4A 2KRNA 2I2LA 2V1QA 1VQ7T 2LJ3A 3OQ5A 2EFIA 1R0CB 4LXCA 3E1SA 5KYUA 1FMVA 3EFOA 3VYHB 1YHQQ 2GBQA 2HSPA 5HK3A 4E2FB 3OW2A 3VUBA 3M0UA 2ENMA 2EWNA 1KHCA 2AZVA 1I07A 1Q82U 4HVUA 2MF2A 2RMOA 1F1BB 3VS3A 2KSSA 3S3MA 3EFRA 4XU3A 2VB6A 3JB9J 2FZKB 4GY5A 1KQSP 2ZZDA 2RF0A 4XTUA 1SRMA 3EH1A 5KE3A 1M30A 2J6OA 1C0MA 2COYA 1G3YA 4MMLA 5J26A 2V8KA 2DVEA 2RHXA 4QKUA 1VQ9A 3M4GA 1JXOA 1IB8A 1NEGA 2H8HA 1PRMC 1QVGS 4RKUE 5GAOl 2HAXA 2JTEA 3M9QA 2MIOA 5HK0A 4PJOE 1KFZA 2XIDA 1CSKA 2EYYA 2HNIA 3O8VA 5DY9A 3X28B 4EPCA 1YWPA 2PZ1A 3V7SA 2QYZA 1TU0B 1VIEA 3M0PA 3QBYA 4JZ4A 4JJBA 4M7DA 4JJDA 3CMEQ 1MNEA 4MZMA 1QCOA 4EMHA 5LJ5f 5KYYB 3GLXA 4M75E 4BACA 4EDUA 3HHTB 1WDXA 1X6BA 1A0NB 1VQ5Q 2L3RA 3M59A 4QT7A 1KQ2A 1UGVA 2LDMA 4V2SA 5FW9A 3CMAT 2COZA 5DLOA 2QGFB 2DYIA 3V7RA 2GFUA 4PJNA 5GAOr 5KYXB 1YIJT 2MMPA 3CD6A 1X6GA 4JUVA 5C6SA 2A28A 2KY9A 1LCKA 4IIOA 1RI0A 3PNWC 4Y92A 2CH4A 2CREA 1PKSA 2QQAA 2SEMA 4E7JA 2RK2A 2Y4XA 2HDAA 3TREA 3CEYA 3CCJA 1YHQT 3UATA 3I56Q 5L8RE 2A3LA 1NG2A 4Z88A 3CCET 2E5KA 2YUOA 1D0YA 4OP0A 3HRSA 2JMAA 2E70A 4PFPA 2OTLA 4BDYA 3CPWA 2M02A 4C5EA 1MUZA 4Z02A 2FRWA 1X69A 3PTAA 2HBPA 2RJFA 4J9BA 2YHTA 5FRMA 3QIIA 2KEAA 3BFMA 2OJ2A 3CCUA 3KUFA 3OYBA 2VYTA 2AHJB 1RLQC 2BTTA 5FU7B 2FG0A 2IG0A 4FT2A 2CP2A 3JCMd 2DL3A 1DJ7B 1OOTA 3SWNB 1Y96B 2RHIA 9ATCB 3OYEA 1BB9A 2DO3A 1MV0B 4M7DD 3LWHA 1K9AA 1PD0A 2RI2A 3PT9A 4JS5A 3CMET 3VS7A 1TH7A 3J7AF 2PU9B 4OF1A 1G2BA 4P5NA 4M7DG 1QKXA 5FU6C 4C8QB 4M7AC 5LJ3f 3QWYA 4A4FA 3QJYA 2A08A 2VWFA 2VUBA 1X43A 1M3CA 1UUEA 4FSXA 3PIOA 2JOYA 4E7SA 2RPNA 2OTJA 4RMOA 2HEQA 3NGPA 1R77A 4XU1A 2H3JA 2FPDA 2CZ6B 3EG9A 1QVFP 1B07A 2D8JA 3CC4T 1V1CA 2E10A 1Z9QA 3LLRA 3WXMB 2BZ8A 3G4SA 2R5MA 2LQNA 2FVUA 4BY6C 2KE9A 5J39A 1U5SA 2CUDA 2EKOA 1AWWA 1SPKA 4M77A 2E41A 3I56T 2QEXQ 2EQUA 1TSFA 1I1JA 2X35A 5D6XA 1WQWA 3A8MB 2DL5A 1QVGA 3QUIA 2NUTB 2IIMA 2RB6A 4XTYA 1M5Q1 1WJSA 2YT6A 2FPFA 4HXJA 3S6WA 1I5LA 1XNIA 2HKNA 1RAAB 2CUBA 4L6V5 2PNIA 3JV3A 2ZAEA 5LJ5e 2DNUA 1OYXA 1G83A 3E19A 2NWMA 4KULA 2YXYA 4QQ6A 4Z8AA 1Y0MA 5CK9A 2EJFA 4FT4A 4BE1A 3CCQA 2PTKA 2DIQA 3T9NA 3VS4A 4A4GA 4EMKB 4CRIA 4F7UG 3DKMA 1AWJA 2L89A 3A8OB 1VQNQ 3OS2A 1ZSZA 1K8AR 1D0ZA 4F7UF 1ZSGA 3PVLA 4IKFA 1KC8C 1AEYA 1KD1U 2LQWA 3M0RA 2M1HA 2XMFA 1NM7A 1VQ4Q 2KK4A 1YI2Q 2LP5A 4E7HA 4OMPA 5GAMe 2Z0WA 4M7DE 5CQXA 1D1AA 4JRPA 2DFUA 2M0OA 4CC3A 1QKWA 2ZPBB 3RR6A 3OYGA 2DILA 1FX7A 3M57A 1NZ9A 2RA2A 4J9GA 2YUPA 1J3TA 2ROLA 4PK4A 2OI3A 2HD0A 3I5RA 2KAFA 1PRLC 4MMKA 4DBQA 3CBOA 4M77D 1XOVA 5CCAA 2L0AA 1OX9A 3SD4A 3GPLA 2KVQG 2KNBB 1NE8A 4HVWA 4M77G 2EQKA 2JMCA 3LH0A 4KH0B 4FYYB 2C0TA 5IAYA 1YJWA 4FW1A 2MCNA 2JTMA 2MWOA 1M27C 2QTVA 3SFMA 1K76A 3CCRA 2XG8D 3LWIA 3ZBDA 5CKFA 3DLLA 2RHZA 3C0CA 4KRTA 2FZCB 3VRZA 2RN8A 2XI9A 1YITQ 2V8IA 4C92A 2KYBA 1S72Q 4M78F 1NPPA 2JS0A 4IURA 1UGQB 1LOJA 3OBWA 3EGDB 4KUDK 2E4HA 3BDLA 3KFVA 3FLGA 4N4IA 3RKWA 4C0DC 4PJOA 2CZ7B 4Q5WA 2GCXA 3OSSC 2L3SA 1ZUYA 3UF4A 2F5KA 3SB2A 2FZGB 2J05A 4LDVA 1B7TA 1WXTA 2LZ6B 3GBQA 4J9CA 2CP7A 3EG3A 2KMTA 1JJ2S 4DA4A 2EGCA 3META 3QO3A 2M51A 1VQ4T 2LNVA 3JCMg 2FL7A 1RABB 2XHCA 1K9MR 4F04B 2ZPGB 1SHGA 4EMGA 1KQ1A 1VQOA 3LGLA 2HMAA 5EC7A 2EQMA 4C5IA 1UB4A 3VS0A 3UA6A 2J6KA 1WPYA 2EBPA 3RNJA 1B34A 1YN8A 1BKBA 3EG2A 4J6WA 2HCKA 2EKHA 4PKCC 2DTIA 1PD1A 4KUIA 2E65A 4MDXA 3A1PA 1IHVA 1S1NA 3CXCP 5GAOp 2KT8A 5DLQE 1G3SA 1W4SA 2EGEA 4RTVA 1YP5A 3LW5E 3OYYA 3PE0A 4OMNA 3THKA 4RTZA 3V8LA 1JEGA 1NYGA 2KXDA 4AFZC 1FMWA 1AWXA 3CQTA 4OMMA 2DA9A 1VQ7Q 3HRTA 4HT9A 3M5AA 2NUPA 2HL3A 2DJQA 4M77E 3V8JA 2F69A 4OMQA 3I55Q 4PLLA 5IH2A 5LJ3j 1K4US 2O88A 4C92D 1VQ8A 1BIBA 1M90R 1IREB 2LX9A 3FEOA 2KRSA 4LDWA 1S72T 1OI1A 2YUQA 1OU9A 4J9IA 4J6XA 2O31A 2KR3A 4C92G 1CKAA 4LDYA 1PM3A 4D6WA 3NHNA 1YJ9A 2JUFA 2WSFE 1PSEA 4FM4B 4QVCA 1M1KR 3CC2T 2R5AA 4M7AA 2W0ZA 1V29B 3E2UA 4PJOG 1N9SA 1AZEA 4XTWA 3G6ET 3JCMV 2LTOA 1HXDA 4HT8A 1Y07A 4D8DA 3CCLA 4PJOF 1N8RU 1XTDA 2ROTA 2QA4A 2HQEA 3NPFA 2NYSA 2RQVA 2JM9A 2KT1A 1VQMQ 4N0AC 1RAHB 1ZBJA 4RG8A 3C94A 2JXBA 4ME7A 1TG0A 3PMIA 3GP8A 4M75F 4MDWA 2RNAA 4IUUA 4RCCA 1FYNA 3UWNA 5D6YA 5KCHA 2EGAA 3C12A 3HTRA 3H6ZA 2E64A 4PNOA 3TQ7P 4HCKA 2CP3A 4OMLA 3CCSA 3CCMT 4CI0C 4YTLA 2QXFA 8AT1B 3P8HA 3JCMh 2AKLA 2DLPA 1QMCA 2FYKA 1Y71A 4OGEA 1YIJQ 1BCMA 3MEVA 5FU6B 1BK2A 2ZPIB 1D09B 1ARKA 4XTXA 3I5SA 1QW1A 2DYBA 4RCBA 2DERA 3RERA 5KYYA 2BZYA 1VQKT 2RQWA 2JVVA 2OAWA 3I55T 1Q81U 5GMKl 2YRDA 1UEBA 4ATOA 3G71A 2O4XB 4XTZA 3OYIA 3CCEQ 3EFSA 1P92A 3FDRA 1X27A 3OYCA 4A53A 1JJ2A 3I35A 1UGSB 4KGVB 3CCVA 3A8GB 5KYXA 2L5QA 4BY6B 4M7AD 2KRMA 3U23A 3E9GA 3BDUA 1G8XA 5GMKm 1Q86R 4C92E 1ZLMA 1K0XA 3VS2A 4RTXA 4M7AG 1UTIA 2D6FA 3FIFA 1KQSS 2K5FA 1RADB 1K1ZA 3SEMA 2DIGA 2XU8A 1VQMT 2LJ0A 1U8RA 1G3TA 2EQJA 2P4TA 2QAZA 5CQYA 3OYFA 2XK0A 1UJYA 4BI8B 1QP2A 1BYMA 2WACA 2F2XA 2O9SA 3WVEB 1WNLA 4BI3A 4EIKA 1HSQA 2DD4A 2KDSA 3M56A 2EAYA 1M2VB 5GAN4 1Q82R 4AT1B 2DEQA 3CC7A 2YLBA 2V8JA 1IO6A 2DL4A 2EIFA 4Z89A 1TOVA 2KGTA 2PVOB 2LC4A 5A0DA 2RO0A 3CCJQ 1GBQA 1RAGB 2X4XA 3SWNA 3ASKA 1Y96A 1QVPA 2EYWA 1KIKA 2WSCE 2F5TX 5KH6A 2PUOB 5GMKj 2DAQA 5GAMd 2Y4YA 1VUBA 3GOXA 2C0OA 4M4ZA 3CC4Q 1Y57A 2G6FX 4N4HA 2VGNA 4ANJA 3TEEA 2D1XA 3MEWA 1YJNA 2KQWA 4AMCA 4C8QA 2M16A 3E9FA 1U1TA 3VRYA 4D8KA 1EIFA 3P8BB 2P4RA 4M75C 1WXBA 1Q7YC 4KBMB 1M2OA 2LNHB 1VQ9T 1ACMB 1IZ6A 4DBRA 2O9VA 1VQ5A 1MMAA 3HRUA 1M90C 8ATCB 2X4WA 2COWA 3AHUA 2JTFA 2DXBA 2HZYA 3QHSA 1M8MA 1C6VX 2EYZA 3OB9A 3QYGB 2BE7D 2KROA 3A8LB 1NLOC 3I9QA 3M58A 4PJLA 1NYFA 1SHFA 2LX7A 1N27A 1UHCA 4M7AE 1IGUA 2DKGA 4HA8A 1NEBA
chains in the Genus database with same CATH topology
4C92B 3CMAA 4E7HA 4IUPA 5GAMe 2DK3A 4M7DE 5CQXA 1R8OB 4JRPA 2M0OA 3NTIA 3GNFB 2RJDA 2VGMA 4C5GA 1ZHIA 5GMKh 3L42A 3H8ZA 1Y7XA 2E6NA 2ZPBB 2DD5A 1D3BA 2LCCA 3N5BB 5CKDA 3OYGA 1YIJA 1FX7A 4HCCA 3M57A 5GANd 2MWPA 2ZPEB 1NZ9A 2G3RA 2E6ZA 1OZ2A 2RA2A 3QXEB 3CD6T 4NS5A 4PJOB 4M7AF 1KG1A 1MGQA 1K73C 3OYMA 4X34A 4Y91A 2HD0A 4HCZA 4A4HA 3M54A 3GIBA 2LQ8A 3CCMA 1UGPB 1WQ7A 4BDZA 4M7DF 2KAFA 3CCST 2QI2A 4C0DB 3OS0A 5LJ5d 1X6OA 1VIFA 4R55A 4MZTA 3L2WA 4MMKA 4EMKC 3CBOA 2K2VA 4M77D 1YHQA 4J8OA 5I21A 1N6AA 1WJRA 1XOVA 5CCAA 3CCJT 3UPUA 2DTOA 3SD4A 5J3BA 4JDSA 3JCMf 3NFCA 3M4YA 3OYHA 3GPLA 3CCEA 1YITT 1K9MC 2VC8A 4J83A 2K5IA 2KVQG 3VJPA 1NE8A 4M77G 4EMKA 2EQKA 3KBGA 3LH0A 4JRKA 2E5QA 2DXTA 3L2VA 2E12A 3UDCA 2OTLT 3HPWA 5IAYA 3ZFJA 4FU6A 4J7FA 4M78E 3CXCA 3OYDA 1YJWA 5FRNA 2FB7A 4M77C 2JTMA 4JJNK 3QDRB 3QSUA 4PJOD 3QKJA 2MWOA 1VQKA 5IT9E 2XDPA 4C92C 4C8QD 3SFMA 4HCBA 1QVFS 5GAN2 3I55A 4WF2A 5CKBA 1MHNA 3RMQA 1B34B 3CCRA 2XG8D 3LWIA 3ZBDA 5CKFA 3DLLA 3S3OA 2RHZA 5CO7A 3LYIA 4BE2A 1VQPT 3X24B 2K4YA 4C8QG 3G71T 2XI9A 2E1HA 2V8IA 4OGCA 1FXXA 4C92A 3OYAA 1KQSA 3CCUT 4X9CA 4OB0B 1JRIA 3MEAA 2LT1A 1I8FA 1NPPA 4IURA 1UGQB 4M78F 1LOJA 1SSFA 3OBWA 5I2MA 4C8QF 2X4JA 3F70A 4ELYC 5GAOm 3CPWS 1X01A 3HP9A 4M75D 3FJPA 5D6WA 1O9SA 3VYGA 4JLGA 4KUDK 3CCVT 2M9UA 5KE2A 3BDLA 3LX7A 1YCYA 3FLGA 3HL8A 2RI3A 3QG1A 4N4IA 3RKWA 4C0DC 4M75G 4DOWA 4PJOA 2CZ7B 4Q5WA 3G7ZA 2GCXA 3OSSC 3QZ9B 2F5KA 2CGHA 2RJEA 1UGRB 3WVDB 3SB2A 2DZ9A 3CMEA 1BI0A 4LDVA 2CYZB 4MZPA 4F7UB 2LQKA 3L2ZA 4DOVA 1H3ZA 4VUBA 1Q86C 2KMTA 1JJ2S 4DA4A 4N4GA 5FLXE 3META 5C0MA 1H641 1HK9A 1M1FA 4O6JA 3QO3A 3URGA 3JCMb 5EG2A 1JB0E 4X9DA 4B9WA 3PMTA 1VQMA 1NJIC 1PSFA 3MCAB 2YLCA 3INZA 5LJ3h 4R56A 1VQ4T 4B9XA 1VQ6T 3MHXA 2NLUA 2PUKB 2LNVA 2IVWA 2RJCA 3NTHA 3JCMg 4E7IA 2FL7A 2XHCA 1Q86U 2QQ9A 4C5HA 4JRQA 5GAMf 5CAIA 2ZPGB 1M1GA 5GAOn 5HY6A 2GFAA 5CIUA 3VUZA 3VV0A 3OY9A 4EMGA 1KQ1A 1OZ3A 3JSCA 3DLMA 3OSVA 1WJQA 2QEXA 1VQOA 5GAN7 3LGLA 1NJIU 1M1KC 3L2UA 2EQMA 4C5IA 1W2BA 2OTJT 1UB4A 1NPRA 3HFNA 5LL6S 5KCOA 5DM7R 4IUVA 2DXUA 1WPYA 3CC4A 4M7AB 2LT4A 1B34A 1AHJB 2K3XA 1U1SA 2I2LA 5GAN5 2XDDA 3UT1A 4QVDA 1BKBA 4J6WA 5CVIA 1VQ7T 2QQSA 3RUXA 2K5LA 3HKSA 4XQ3A 4M7DB 4PKCC 3G4ST 2BIVA 2EJ9A 3OQ5A 3CC7T 2DTIA 1N9RA 2EFIA 3E1SA 2ZPFB 3CBPA 4XU0A 4KUIA 2L8DA 2QQRA 2RI5A 4DQ2A 2E65A 4E7KA 1Q82C 4C0GA 4MDXA 3JCMc 3VYHB 3I56A 4ZTFA 5GAOp 1VQLA 5HK3A 5DLQE 3OW2A 1G3SA 1W4SA 5LJ3d 3VUBA 1O75A 3LW5E 3OYYA 3LGFA 3V8LA 4LD6A 2EWNA 2DXCA 1KHCA 1G5VA 1Q82U 1FWZA 4ZN3A 2MF2A 2MAMA 2KSSA 3S3MA 4F7UA 3EFRA 3QJ6A 4XU3A 3JB9J 4J7IA 2CZ0B 4GY5A 3HRTA 3A8HB 4HT9A 3OYLA 3M5AA 2ZZDA 4HKEA 4PLIA 3MP8A 4XTUA 4KT0E 4M77E 3V8JA 5I2SA 2OAUA 4C0ZA 2WSEE 5KE3A 1VQNA 1YJNT 2F69A 4XAXB 4PLLA 1G3YA 3OBYA 5LJ3j 4MMLA 5IN1A 5J26A 3VU3C 2V8KA 4C92D 1VQ8A 1BIBA 2DVEA 2RHXA 2CKKA 4GLKA 1IREB 2LX9A 3FEOA 4LDWA 1VQ9A 2RM4A 1S72T 1OI1A 3GNGA 3M4GA 5FROA 1RL2A 4M78B 4J6XA 4C0FA 2EJGA 1QVGS 1VQ5T 4RKUE 4C92G 5GAOl 2HAXA 4LDYA 2YRVA 3M9QA 4D6WA 5HK0A 5GAMg 4M77F 1YJ9A 5CKEA 1YI2A 4PJOE 2XIDA 3BW1A 2JUFA 2WSFE 1PSEA 4FM4B 4QVCA 3OYNA 1M9SA 4C8QE 5GANf 4M7DC 2JN0A 3CCQT 3CC2T 2R5AA 2HNIA 1N8RC 3O8VA 5DY9A 3X28B 5GAOq 4M7AA 3DB4A 4EPCA 3V7SA 5A0GA 1V29B 1VIEA 3QBYA 3JB9D 4PJOG 1N9SA 2CZ1B 4M7DA 3FRNA 4MZMA 4XTWA 3CPFA 3G6ET 3JCMV 2LTOA 1HXDA 4EMHA 4HT8A 5LJ5f 1Y07A 3ZEHA 3CCLA 4PJOF 1N8RU 3GLXA 4M75E 3L2QA 4BACA 3JB9G 1XTDA 4EDUA 3HHTB 3MP6A 2QA4A 3JB9I 2HQEA 3DB3A 1WGSA 2L3RA 1I81A 3JB9F 3M59A 5LJ3e 1KQ2A 4N0AC 2LDMA 4V2SA 3OA6A 3CMAT 2O01E 4RG8A 5DLOA 5GAMd 3C94A 1K8AU 1G3WA 4ME7A 4UC4A 3JCMe 4QW2A 3ME9A 4ZGDB 2XKOC 3PMIA 5M9OA 3BY7A 3GP8A 4M75F 1LNXA 4MDWA 4IUUA 4N0AA 4RCCA 3V7RA 2GFUA 5GAOr 4O5VA 3UWNA 1YIJT 5D6YA 4E47A 2MMPA 5KCHA 3CD6A 2VXFA 3C12A 4QQGA 4RG2A 4OMFB 2DPPB 4JUVA 3H6ZA 5C6SA 2E64A 4XU2A 2KY9A 2XICA 4PNOA 5GAN8 3JCMP 1RI0A 4BB7A 2R58A 3CCSA 3X25B 3M55A 3PNWC 3CCMT 2LCLA 4LD9K 2QQAA 4M78A 4E7JA 2RK2A 4CI0C 3RIRA 2Y4XA 4XK8E 4YTLA 4NL3A 3TREA 2QXFA 5GAN3 3CEYA 3CCJA 1QVFA 4JRIA 4II1A 3P8HA 4ZGJB 1YHQT 3JCMh 3NTKA 4IUQA 5L8RE 2A3LA 2VV5A 3ER0A 1YITA 3CCET 2FYKA 4ELZC 1Y71A 3GF5A 2LVMA 3JAME 2EYQA 4OP0A 3HRSA 1I4K1 4LDUA 4OGEA 2E70A 5GANg 3JB9H 3MEVA 5FU6B 2ZPIB 2OTLA 4A54A 2RHYA 4BDYA 3CPWA 4Y28E 1X75C 3FC3A 1Q81C 4C5EA 3Q1JA 4JLIA 4XTXA 1JBMA 4Z02A 3OMCA 4BE0A 1YJWT 1QW1A 4RCBA 1Q7YU 3PTAA 3RERA 3X26B 2HBPA 3RESA 1VQKT 2RJFA 3OMGA 2YHTA 3QYHB 5LJ5g 5FRMA 2JVVA 3I55T 1Q81U 5GMKl 1BI3A 1UEBA 3CCRT 3QIIA 4ZGEB 3S3NA 1VQPA 4ATOA 3BFMA 3QPHA 3G71A 2O4XB 4XTZA 3QZ5B 3PIPA 3CCUA 3KUFA 3OYBA 3OYIA 3EFSA 2PVDB 2P0PA 1P92A 3FDRA 4OVAA 2VYTA 2AHJB 2K3YA 4A53A 3OYCA 5FU7B 1JJ2A 2R57A 1UGSB 3CXCS 5GAN6 2IG0A 4FT2A 4M77B 3JCMd 3CCVA 3L2RA 4J6YA 3A8GB 1DJ7B 2L5QA 3SWNB 4BY6B 3JCMW 4M7AD 1Y96B 1ZBXA 2RHIA 3E9GA 3OYEA 3OYJA 3RMSA 3BDUA 2P0QA 2DJZA 3R6OA 2PQWA 2DO3A 1XQHA 5GMKm 4M7DD 4C92E 3LWHA 2RH2A 2C06A 2LRQA 4M7AG 2RI2A 2D6FA 3PT9A 4JS5A 3CMET 3FIFA 1KQSS 1TH7A 2XDBA 3J7AF 2PU9B 3C4SA 4OF1A 2DZCA 2K5FA 4L59A 4L5GA 4P5NA 4M7DG 5FU6C 3HFOA 2DIGA 3HSBA 4C8QB 4M7AC 3A5ZB 1VQ4A 1VQ6A 2XU8A 1VQMT 4FIBA 1KHIA 4OB1B 5LJ3f 1U8RA 1G3TA 4A4FA 2P4TA 2EQJA 4C92F 2ZGWA 3QJYA 2Y90A 3PFSA 5CQYA 4ZN1A 5GAMh 2VUBA 3OYFA 2RHUA 2D0QB 2XK0A 1K73U 3CBMA 4NL2A 4FSXA 3PIOA 2JOYA 5GANj 2QEXT 2OTJA 1VQOT 4M75B 1BI2A 4BI8B 1QP2A 4RMOA 1BYMA 2JNGA 2QTXA 3M53A 2WACA 4IUTA 4XU1A 2DTHA 3KXTA 2H3JA 4OB3B 3WVEB 1WNLA 2CZ6B 4BI3A 2DD4A 2KDSA 3OS5A 1K8AC 4JS4A 3CC4T 2B8AA 2RD1A 5FU7C 2E10A 3M56A 3J80E 3LLRA 4A4KA 3L1AA 3WXMB 2CS7A 2EAYA 2O4XA 5LJ5j 5GAN4 2D9TA 1VQ7A 5A2QE 1K9MU 2DEQA 3G4SA 2YLBA 3CC7A 2R5MA 3JCMJ 2V8JA 3JRZA 4M78D 3V8KA 2FVUA 3SWNC 2EIFA 4BY6C 5J39A 2GQVA 4J5YA 2PVOB 2LC4A 5A0DA 2EKOA 2RK1A 4BUGA 2XD0A 2RO0A 3EAEA 4M77A 2E41A 4M78G 4FL6A 3I56T 1W2BS 2X4XA 3SWNA 1VQLT 2EQUA 3OYKA 3ASKA 1Y96A 1QVPA 3MP1A 1GXIE 2WSCE 2F5TX 2X35A 5KH6A 2PUOB 5D6XA 3TCJA 5AYFA 5GMKj 2DAQA 1WQWA 2JZ2A 2BKDN 2Y4YA 3MEUA 3A8MB 1VUBA 3MO8A 4M78C 3GOXA 4C8QC 4PJOC 3RKYA 1QVGA 5HKCA 2PVGB 2GF7A 3QUIA 5GANe 3SDZA 1QP3A 2RB6A 4N4HA 3V7CA 4XTYA 3VKIA 1D3BB 1M5Q1 1WJSA 2VGNA 3S6WA 3TEEA 3MEWA 1YJNA 4E7LA 1I5LA 1XNIA 2KQWA 3FB9A 4C8QA 1LJOA 1VQNT 2M16A 3E9FA 3OW2S 1U1TA 2X4YA 4L6V5 1EIFA 3P8BB 4M75C 5LJ5e 1S72A 1Q7YC 1VQ8T 2QDYB 4KBMB 1OYXA 3JCMQ 5GAMj 1VQ9T 5LJ3g 3E19A 1IZ6A 4KULA 4F7UE 4PL6A 2QQBA 1VQ5A 4QQ6A 3HRUA 4BI4A 3RKXA 4QVZA 1M90C 2X4WA 1YBYA 2HQXA 4NOYA 3P8DA 4M75A 5CR2A 2MI6A 5CK9A 3J81E 2BUDA 2EJFA 4FT4A 1ZQ1A 5GANh 3CCQA 4BE1A 1YI2T 1YJ9T 3CC2A 2DIQA 2VXEA 4QQDA 2JTFA 1KD1C 3AHUA 3T9NA 1M4ZA 4EMKB 4A4GA 2DXBA 4CRIA 4OB2B 4F7UG 3QHSA 3C95A 3DKMA 4LDXA 3PGGA 4A4EA 3OS1A 2L89A 4TVRA 1M90U 2P0KA 3A8OB 5GMKe 2FHDA 3OB9A 3QYGB 3OS2A 1BI1A 3JCMX 3A8LB 4F7UF 3G6EA 4IKFA 5LJ5h 5GMKi 3M58A 1KC8C 4ZTJA 2A7YA 1KD1U 2M1HA 3CCLT 1M8VA 4BD3A 3TU4K 1N27A 5A0LA 2QA4T 4XTVA 1M1KU 2ZCFB 2ZPHB 2KK4A 1BIAA 4M7AE 3X20B 2K57A 2DKGA 4HA8A 5CKHA 1KC8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 F;  4C92 B;  2ZGW A;  2Y90 A;  5GAM h;  5GAM e;  4M7D E;  5GAM f;  5CAI A;  5GAO n;  4NL2 A;  3JCM e;  5GMK h;  4EMG A;  1KQ1 A;  5GAN j;  3BY7 A;  5GAN 7;  4M75 F;  1LNX A;  1D3B A;  4M75 B;  4RCC A;  4N0A A;  3V7R A;  2QTX A;  5GAN d;  5GAO r;  4XU1 A;  3HFN A;  2DTH A;  2VXF A;  2DXU A;  1WNL A;  2RA2 A;  4PJO B;  1WPY A;  4M7A F;  4M7A B;  1B34 A;  1MGQ A;  2RD1 A;  1U1S A;  2I2L A;  2E10 A;  4JUV A;  2E64 A;  4XU2 A;  4Y91 A;  5GAN 5;  4PNO A;  3L1A A;  4QVD A;  5GAN 8;  2EAY A;  5LJ5 j;  4J6W A;  5GAN 4;  3JCM P;  3GIB A;  3RUX A;  1WQ7 A;  2DEQ A;  2YLB A;  4XQ3 A;  3JCM J;  4M7D F;  4M78 D;  3V8K A;  4M7D B;  2EJ9 A;  3SWN C;  2DTI A;  1N9R A;  5LJ5 d;  4M78 A;  4XU0 A;  4J5Y A;  4MMK A;  4DQ2 A;  4EMK C;  2E65 A;  3RIR A;  4NL3 A;  4M77 D;  5GAN 3;  5I21 A;  3JCM c;  4JRI A;  4M77 A;  3JCM h;  2E41 A;  4M78 G;  2DTO A;  5GAO p;  3JCM f;  3SWN A;  2VC8 A;  5LJ3 d;  2FYK A;  1Y96 A;  4M77 G;  4EMK A;  3V8L A;  4OP0 A;  1I4K 1;  2EWN A;  5GAN g;  3JB9 H;  4JRK A;  5GMK j;  2DXT A;  5GAM d;  1WQW A;  4M78 C;  4A54 A;  4C8Q C;  3RKY A;  4JLI A;  4F7U A;  3EFR A;  4XU3 A;  4XTX A;  4M78 E;  3QUI A;  1JBM A;  3JB9 J;  5GAN e;  2FB7 A;  2RB6 A;  4M77 C;  4RCB A;  3V7C A;  4XTY A;  3QSU A;  1D3B B;  3RER A;  4HT9 A;  1M5Q 1;  4PJO D;  3RES A;  4XTU A;  4M77 E;  3V8J A;  4C8Q D;  4C92 C;  2YHT A;  1I5L A;  5LJ5 g;  5GAN 2;  3FB9 A;  4C8Q A;  1LJO A;  4WF2 A;  1B34 B;  5GMK l;  5LJ3 j;  1U1T A;  4MML A;  3BFM A;  3VU3 C;  4C92 D;  1BIB A;  2DVE A;  4M75 C;  4C8Q G;  4XTZ A;  5LJ5 e;  2E1H A;  4C92 A;  2RM4 A;  3JCM Q;  3EFS A;  3M4G A;  4X9C A;  5GAM j;  1JRI A;  5LJ3 g;  4M78 F;  1I8F A;  4M78 B;  4F7U E;  4J6X A;  1LOJ A;  5GAO m;  2EJG A;  4PJO C;  4C8Q F;  4A53 A;  3RKX A;  1X01 A;  4M75 D;  4C92 G;  5GAO l;  3FJP A;  4NOY A;  5GAN 6;  5GAM g;  4M75 A;  4M77 F;  4M77 B;  4PJO E;  3JCM d;  3BW1 A;  2EJF A;  4J6Y A;  5GAN h;  4QVC A;  4M7D C;  3JCM W;  3SWN B;  4C8Q E;  5GAN f;  2VXE A;  2JN0 A;  1YCY A;  3RKW A;  3AHU A;  4M7A D;  1Y96 B;  2HNI A;  4PJO A;  4M75 G;  5DY9 A;  4EMK B;  5GAO q;  4M7A A;  4F7U G;  3BDU A;  3QHS A;  3V7S A;  3PGG A;  2DJZ A;  2CGH A;  5GMK m;  5GMK e;  3JB9 D;  4C92 E;  4M7D D;  3SB2 A;  4PJO G;  2DZ9 A;  1N9S A;  3JCM X;  4M7A G;  4F7U F;  4F7U B;  4M7D A;  4XTW A;  3FIF A;  3JCM V;  5LJ5 h;  3L2Z A;  1TH7 A;  1HXD A;  4EMH A;  5GMK i;  4HT8 A;  5LJ5 f;  2DZC A;  4PJO F;  4M7D G;  4M75 E;  3JB9 G;  1M8V A;  1H64 1;  3HFO A;  3JB9 I;  1HK9 A;  3HSB A;  4C8Q B;  4M7A C;  3QO3 A;  4XTV A;  3JCM b;  4X9D A;  1I81 A;  2YLC A;  3INZ A;  1BIA A;  5LJ3 h;  3JB9 F;  4M7A E;  5LJ3 e;  2K57 A;  5LJ3 f;  2DKG A;  4HA8 A;  3JCM g;  1KQ2 A;  4N0A C;  4V2S A; 
#chains in the Genus database with same CATH topology
 2IPO B;  1T0H A;  1R8O B;  2B86 A;  2RJD A;  5GMK h;  1ZHI A;  3L42 A;  3H8Z A;  2E6N A;  2DD5 A;  2OTJ Q;  3N5B B;  2YUN A;  4HCC A;  5GAN d;  2ZPE B;  2FEI A;  2EQI A;  5GJW B;  1KG1 A;  1OX8 A;  3CD6 T;  4NS5 A;  1MGQ A;  1K73 C;  4A63 B;  4HCZ A;  1E6G A;  1OEB A;  3GIB A;  4BDZ A;  4M7D F;  1W6X A;  2QI2 A;  1D1C A;  4C0D B;  3OS0 A;  1X6O A;  3CCJ T;  2FO0 A;  3UPU A;  2DTO A;  3JCM f;  5J3B A;  3OYH A;  2DMO A;  4EMK A;  3ULR B;  1WHG A;  3LH5 A;  1ZUK A;  2E12 A;  2OTL T;  3ZFJ A;  1GCQ C;  5IT9 E;  4C8Q D;  4HCB A;  3EGU A;  1QVF S;  5GAN 2;  4BE2 A;  4C8Q G;  1KQS A;  3CCU T;  4X9C A;  2LT1 A;  3OYJ A;  1SSF A;  4ELY C;  3H0H A;  4C8Q F;  1ABQ A;  1GL5 A;  1QWE A;  5KE2 A;  1YCY A;  3HL8 A;  4DOW A;  2RI3 A;  2CGH A;  3WVD B;  4F7U B;  3L2Z A;  4VUB A;  1Q86 C;  1XJW B;  1H64 1;  3URG A;  1WZO A;  4X9D A;  3MCA B;  3INZ A;  3MHX A;  2NLU A;  3NTH A;  2IVW A;  3SHW A;  2CP5 A;  1VA7 A;  2QQ9 A;  4JRQ A;  2RQR A;  3VV0 A;  2GFA A;  3VUZ A;  3JSC A;  2QEX A;  3OSV A;  3DLM A;  1NJI U;  1Z9Z A;  3AT1 B;  1OV3 A;  2OTJ T;  1WXU A;  3VS6 A;  2EW3 A;  1NPR A;  5LL6 S;  5KCO A;  3TSW A;  2DF6 A;  1AHJ B;  2K3X A;  4QVD A;  1RAE B;  2JM8 A;  2MPX C;  5CVI A;  3RUX A;  2K5L A;  4XQ3 A;  3M0T A;  3G4S T;  2BIV A;  2QDL A;  2CT3 A;  1N9R A;  2ZPF B;  3QWX X;  4DQ2 A;  2RI5 A;  1UE9 A;  1Q82 C;  4C0G A;  3JCM c;  1E6H A;  1OUL A;  3EGD A;  4DBH A;  1VQL A;  4ORZ A;  3LGF A;  4LD6 A;  1AOJ A;  1FWZ A;  4E6R A;  2AK5 A;  2LMJ A;  2L2P A;  1YJW Q;  3OYL A;  4HKE A;  1GCP A;  4KT0 E;  1EZZ B;  1VQN A;  1ZX6 A;  5IN1 A;  3VU3 C;  4GLK A;  1RI9 A;  3GNG A;  4M78 B;  4C0F A;  2DRM A;  5IXB A;  1KD1 R;  2YRV A;  5GAM g;  4M77 F;  1YI2 A;  3BW1 A;  4AG2 C;  4M7D C;  3OYN A;  1M9S A;  4C8Q E;  2JN0 A;  3CCQ T;  5GAO q;  3DB4 A;  1YNZ A;  4GLM A;  3CPF A;  3REA B;  1SKU B;  2KXC A;  3EHQ A;  3ZEH A;  1WHK A;  1GFC A;  3L2Q A;  3MP6 A;  3JB9 I;  4LN2 A;  1AVZ C;  2F1L A;  1U3O A;  1WGS A;  4KGX B;  4WTO B;  1TXQ A;  1W2B P;  5LJ3 e;  3EGX B;  3CC2 Q;  2O01 E;  2K7A A;  1ZA1 B;  1G3W A;  3JCM e;  2XKO C;  1GRI A;  2MYS A;  3BY7 A;  3G6E Q;  3A98 A;  4E47 A;  4QQG A;  5I11 A;  4RG2 A;  4FYX B;  1RAC B;  2DPP B;  5IXF A;  5KYW B;  4RTY A;  3OW2 P;  1M3A A;  3JCM P;  4BB7 A;  2R58 A;  3M55 A;  1MMD A;  2LCL A;  4LUE A;  1GBR A;  1FMK A;  3RIR A;  4XK8 E;  1QVF A;  4II1 A;  4ZGJ B;  2M0Y A;  2C0I A;  4IUQ A;  4F17 A;  3ER0 A;  1YIT A;  2CH4 W;  4ELZ C;  2I0N A;  3MPU B;  2LVM A;  2EYQ A;  1I4K 1;  4LDU A;  5GAN g;  3JB9 H;  4B6M A;  2HKQ B;  4JLI A;  1JBM A;  4BE0 A;  1YJW T;  1Q7Y U;  3CCM Q;  2QG9 B;  2NUZ A;  3CCR T;  1VQP A;  4KH1 B;  2J7I A;  2CSI A;  2MOX A;  1VQ8 Q;  1AD5 A;  1TUC A;  2PVD B;  3EG1 A;  2SRC A;  5I22 A;  3CXC S;  5GAN 6;  3L2R A;  1YJ9 Q;  2X51 A;  4LNP A;  1VQK Q;  3RMS A;  2CP0 A;  2DJZ A;  2C06 A;  2LRQ A;  1LVK A;  2XDB A;  1H8K A;  2F2V A;  4L59 A;  4L5G A;  3CCL Q;  3FJ5 A;  3HFO A;  3HSB A;  2YSQ A;  2QA4 Q;  1LPL A;  3PVQ A;  1VQ6 A;  1CKB A;  1KHI A;  4OB1 B;  2O2O A;  4C92 F;  2ZGW A;  2Y90 A;  3PFS A;  5GAM h;  2RHU A;  1K73 U;  2BZX A;  5GAN j;  1V76 A;  1VQO T;  1HD3 A;  4M75 B;  2MK5 A;  4FYV B;  2JNG A;  4LUD A;  2RQT A;  3H41 A;  3OS5 A;  1K8A C;  2RD1 A;  3G1J A;  3TSZ A;  1VQ7 A;  3L1A A;  2CS7 A;  2O4X A;  2D9T A;  5A2Q E;  3JCM J;  1RUW A;  2DRK A;  5FWC A;  4J5Y A;  4RTU A;  3CPW P;  1UG1 A;  2RK1 A;  1GCQ A;  2XD0 A;  3EAE A;  1HJD A;  2A37 A;  4FL6 A;  1SEM A;  3OYK A;  1MMG A;  2AKK A;  2CSQ A;  4ZNX A;  1MV3 A;  4M78 C;  2JZ2 A;  2BKD N;  1VYT A;  5HKC A;  3SDZ A;  1QP3 A;  3V7C A;  1D3B B;  1SG5 A;  2HQH A;  4E7L A;  1WLP B;  3FB9 A;  1UJ0 A;  1B3Q A;  1LJO A;  3R6N A;  3H0F A;  2DM1 A;  4J9F A;  1KK7 A;  1VQ8 T;  2GNC A;  1QCF A;  3JCM Q;  1H3H A;  4PL6 A;  2QQB A;  4BI4 A;  4PJJ A;  1N8R R;  2HQX A;  2D8H A;  2MI6 A;  1JU5 C;  1YJ9 T;  5GAN h;  1ZQ1 A;  4CC4 B;  1KD1 C;  1M4Z A;  4OB2 B;  1YWO A;  4LDX A;  4A4E A;  1M2V A;  1OPK A;  2FHD A;  5GMK e;  1BI1 A;  3JCM X;  1WHL A;  1PC0 A;  2A36 A;  5GMK i;  4ZTJ A;  1IGQ A;  1VQ9 Q;  3CCL T;  1M8V A;  4BD3 A;  3TU4 K;  5A0L A;  2QA4 T;  4J9H A;  2ZCF B;  4AG1 C;  1BIA A;  3X20 B;  2OX7 A;  5CKH A;  1KC8 U;  3CMA A;  4IUP A;  2DK3 A;  4FW2 A;  3GNF B;  2VGM A;  1Y7X A;  2VKN A;  1JQQ A;  2LCC A;  5CKD A;  1YIJ A;  3EHR A;  2E6Z A;  1OZ2 A;  1KJW A;  4JJC A;  4M7A F;  2W10 A;  3OYM A;  4Y91 A;  1EX4 A;  2JJ9 A;  4A4H A;  3M54 A;  2LQ8 A;  1UGP B;  2P84 A;  2K3B A;  3CCS T;  3CC7 Q;  5LJ5 d;  4R55 A;  1VIF A;  4MZT A;  3L2W A;  1YHQ A;  1H92 A;  2RQU A;  5I21 A;  1WJR A;  1QVG P;  4JDS A;  3CCE A;  3NFC A;  3M4Y A;  1ZUU A;  1K9M C;  2VC8 A;  2DBM A;  4J83 A;  1Q81 R;  3VJP A;  4R0K A;  1IHW A;  1PCX A;  3CD6 Q;  3UDC A;  1AT1 B;  4J7F A;  3CXC A;  1X2K A;  4JJN K;  3QSU A;  3QDR B;  3QKJ A;  2XDP A;  4C92 C;  3O5Z A;  1KC8 R;  1BU1 A;  1YJN Q;  2ED1 A;  1KSW A;  5CKB A;  1MHN A;  2CP6 A;  3X24 B;  2K4Y A;  3G71 T;  1FXX A;  1WI7 A;  4OB0 B;  1JRI A;  1I8F A;  5GAO m;  4PJO C;  2X4J A;  1ZA2 B;  3F70 A;  1X01 A;  3HP9 A;  5KYU B;  3EFO B;  2OTL Q;  3VYG A;  4JLG A;  2K6D A;  3CCV T;  3LX7 A;  2FRY A;  3QZ9 B;  2YDL A;  2ED0 A;  1UGR B;  1IRX A;  2DZ9 A;  3CME A;  1BI0 A;  2CYZ B;  2LQK A;  4DOV A;  1TWB A;  2DET A;  3CCU Q;  3MKD A;  2J6F A;  4JPB W;  5C0M A;  1M1F A;  4O6J A;  2H3E B;  1JB0 E;  4B9W A;  3PMT A;  2YLC A;  4B9X A;  1VYV A;  2PUK B;  2KBT A;  2RJC A;  4CC7 A;  4E7I A;  1RAI B;  1I0C A;  5GAM f;  2AIR B;  5CAI A;  3OY9 A;  1OZ3 A;  1M1K C;  5GAN 7;  3L2U A;  2CT4 A;  2QK0 A;  2DXU A;  1JO8 A;  3CC4 A;  3H0I A;  1U1S A;  5GAN 5;  2XDD A;  2E3H A;  3UT1 A;  2GGR A;  2QQS A;  3HKS A;  4M7D B;  2DVJ A;  5KYN A;  2EJ9 A;  3CC7 T;  4XU0 A;  3CBP A;  2L8D A;  2QQR A;  4E7K A;  4DBF A;  3I56 A;  4ZTF A;  2DBK A;  2E3I A;  2NUT A;  1U06 A;  2LCS A;  1GFD A;  5LJ3 d;  1O75 A;  1RAF B;  2HSE B;  2K2M A;  1QWF A;  2DXC A;  1G5V A;  4X1V A;  4ZN3 A;  2DL8 A;  3UA7 A;  2MAM A;  4F7U A;  3H9N A;  3QJ6 A;  3ZL7 C;  4FYW B;  4J7I A;  2CZ0 B;  3A8H B;  3G4S Q;  4PLI A;  3MP8 A;  6AT1 B;  5I2S A;  2OAU A;  4C0Z A;  2GTO A;  2WSE E;  2F2W A;  1YJN T;  1W1F A;  4XAX B;  3OBY A;  2K79 A;  2CKK A;  2GTJ A;  2RM4 A;  5FRO A;  1RL2 A;  2GQI A;  1WIE A;  2EJG A;  4RTW A;  1VQ5 T;  2V1R A;  1T0J A;  5CKE A;  5GAN f;  1K0S A;  4KGZ B;  1N8R C;  1YCS B;  4J9E A;  1PWT A;  2ECZ A;  5A0G A;  3JB9 D;  2CZ1 B;  3FRN A;  1N5Z A;  1X2Q A;  2ATC B;  3JB9 G;  1OPL A;  1C1A A;  3DB3 A;  1Q95 G;  1I81 A;  2EPD A;  3JB9 F;  2DEU A;  4RUG A;  3OA6 A;  3CCQ Q;  2AZS A;  1K8A U;  3VS5 A;  1JXM A;  2FPE A;  4UC4 A;  4QW2 A;  3ME9 A;  2DL7 A;  1MND A;  4ZGD B;  5M9O A;  1LNX A;  4PFZ A;  4N0A A;  4O5V A;  3REB B;  2VXF A;  4OMF B;  4XU2 A;  2XIC A;  5GAN 8;  1TS9 A;  1D0X A;  3X25 B;  4LD9 K;  4M78 A;  5D7U A;  1D1B A;  4NL3 A;  5GAN 3;  1UHF A;  4JRI A;  3NTK A;  2VV5 A;  3NMZ C;  1VQL Q;  4FSS A;  3GF5 A;  2YWW A;  3IQL A;  3JAM E;  3M0S A;  1UDL A;  3EH2 A;  4A54 A;  2RHY A;  4Y28 E;  1X75 C;  3FC3 A;  1Q81 C;  3Q1J A;  3OMC A;  1TTH B;  3X26 B;  5ECA A;  3RES A;  3OMG A;  3QYH B;  5LJ5 g;  3EG9 B;  1BI3 A;  3S3N A;  4ZGE B;  3QPH A;  1VYU A;  3QZ5 B;  3EGX A;  3PIP A;  2P0P A;  4OVA A;  1QLY A;  4F14 A;  2K3Y A;  3RBB B;  1PNJ A;  2R57 A;  1WHH A;  4M77 B;  5IHN A;  3D7S B;  4J6Y A;  3JCM W;  4PFO A;  1ZBX A;  2P0Q A;  3R6O A;  2PQW A;  1MMN A;  5KYW A;  1XQH A;  2RH2 A;  3CCR Q;  2D0N A;  2AT1 B;  3TVT A;  3C4S A;  1NJI R;  2DZC A;  2JW4 A;  1WX6 A;  2DX1 A;  3A5Z B;  1VQ4 A;  4FIB A;  4IIM A;  1NBE B;  1RLP C;  2V26 A;  1WHJ A;  2CDT A;  4ZN1 A;  2D0Q B;  2L3P A;  3CBM A;  4NL2 A;  4K11 A;  2QEX T;  1BI2 A;  2QTX A;  3M53 A;  4IUT A;  2DTH A;  3KXT A;  3MJX A;  4OB3 B;  1AWO A;  1BBZ A;  4JS4 A;  2B8A A;  5FU7 C;  4AFQ C;  3J80 E;  4A4K A;  5LJ5 j;  1K9M U;  1ZSZ B;  2DE0 X;  4PJM A;  1E7O A;  3JRZ A;  4M78 D;  3V8K A;  3SWN C;  2GQV A;  2EYX A;  4BUG A;  4J9D A;  4M78 G;  1W2B S;  1VQL T;  1VQO Q;  3MP1 A;  1GXI E;  1YFN A;  3TCJ A;  5AYF A;  3MEU A;  3MO8 A;  4C8Q C;  3RKY A;  2PVG B;  1SSH A;  2GF7 A;  2QGG A;  1VOM A;  5GAN e;  5L23 A;  3VKI A;  1JJ2 P;  1VQN T;  2VVK A;  3OW2 S;  2X4Y A;  4ESR A;  1VQP Q;  1IXD A;  2ABL A;  1S72 A;  2QDY B;  5GAM j;  5LJ3 g;  4F7U E;  1WYX A;  4DEX A;  3RKX A;  4QVZ A;  1YBY A;  3QDF A;  4NOY A;  3P8D A;  4M75 A;  5CR2 A;  5AT1 B;  3RDV A;  3J81 E;  2BUD A;  1YI2 T;  3CC2 A;  4AFS C;  3EG0 A;  2VXE A;  4QQD A;  5GJV B;  2YRC A;  4GBQ A;  3C95 A;  2LJ1 A;  3PGG A;  2ESW A;  4TVR A;  3OS1 A;  1M90 U;  1TUG B;  2P0K A;  1R0B G;  3G6E A;  2X3X D;  5LJ5 h;  4WCI A;  2A7Y A;  2HL5 C;  1QCN A;  4HVV A;  1T3S A;  4XTV A;  1M1K U;  1VQ6 Q;  2ZPH B;  5FWB A;  2K57 A;  4LE9 A;  4AFU C;  4C92 B;  4JZ3 A;  5IHI A;  2BE9 B;  3NTI A;  4DEY A;  4C5G A;  1D3B A;  1PHT A;  2X3W D;  2MWP A;  5HCK A;  2G3R A;  1ABO A;  3QXE B;  1AZG B;  4PJO B;  4X34 A;  1BCO A;  3CCM A;  1WQ7 A;  4FCY A;  2JT4 A;  3BE3 A;  1Q7Y R;  1TUD A;  2KI7 A;  4EMK C;  2K2V A;  1PG5 B;  1T3L A;  2VAS A;  4J8O A;  1N6A A;  4RTT A;  2EVR A;  1YIT T;  4CC2 A;  2K5I A;  3KBG A;  1OQK A;  4JRK A;  2E5Q A;  2DXT A;  1OU8 A;  3L2V A;  3HPW A;  4FU6 A;  1PKT A;  4M78 E;  3OYD A;  5FRN A;  2FB7 A;  4M77 C;  4PJO D;  1VQK A;  1HYO A;  1EFN A;  3CCS Q;  5IHK A;  3I55 A;  4OMO A;  1M3B A;  4WF2 A;  3RMQ A;  1B34 B;  3S3O A;  5CO7 A;  3LYI A;  2K9G A;  1VQP T;  1SF9 A;  2HBW A;  2E1H A;  3OYA A;  4OGC A;  2L3Q A;  3MEA A;  3CPW S;  5I2M A;  2J06 A;  4M75 D;  3FJP A;  5D6W A;  1O9S A;  3M0Q A;  2M9U A;  7AT1 B;  2QAS A;  1WA7 A;  3QG1 A;  4M75 G;  4E7Z A;  4F16 A;  3G7Z A;  3VS1 A;  2RJE A;  1I5O B;  1K73 R;  4MZP A;  1W70 A;  1NLP C;  1QQJ A;  3G71 Q;  1H3Z A;  1WFW A;  2NUP B;  4N4G A;  5FLX E;  1HK9 A;  3JCM b;  5EG2 A;  1VQM A;  1UFF A;  1NJI C;  1PSF A;  1VQ6 T;  1WHM A;  5LJ3 h;  4R56 A;  2KYM A;  2A0F B;  3CCV Q;  1ZSZ C;  2X9H A;  1Q86 U;  3CMA Q;  4C5H A;  2JS2 A;  1M1G A;  1SRL A;  5GAO n;  5HY6 A;  5CIU A;  1WJQ A;  1W2B A;  1UEC A;  3HFN A;  5DM7 R;  4IUV A;  4M7A B;  2LT4 A;  2KRN A;  2I2L A;  2V1Q A;  1VQ7 T;  2LJ3 A;  3OQ5 A;  2EFI A;  1R0C B;  4LXC A;  3E1S A;  5KYU A;  1FMV A;  3EFO A;  3VYH B;  1YHQ Q;  2GBQ A;  2HSP A;  5HK3 A;  4E2F B;  3OW2 A;  3VUB A;  3M0U A;  2ENM A;  2EWN A;  1KHC A;  2AZV A;  1I07 A;  1Q82 U;  4HVU A;  2MF2 A;  2RMO A;  1F1B B;  3VS3 A;  2KSS A;  3S3M A;  3EFR A;  4XU3 A;  2VB6 A;  3JB9 J;  2FZK B;  4GY5 A;  1KQS P;  2ZZD A;  2RF0 A;  4XTU A;  1SRM A;  3EH1 A;  5KE3 A;  1M30 A;  2J6O A;  1C0M A;  2COY A;  1G3Y A;  4MML A;  5J26 A;  2V8K A;  2DVE A;  2RHX A;  4QKU A;  1VQ9 A;  3M4G A;  1JXO A;  1IB8 A;  1NEG A;  2H8H A;  1PRM C;  1QVG S;  4RKU E;  5GAO l;  2HAX A;  2JTE A;  3M9Q A;  2MIO A;  5HK0 A;  4PJO E;  1KFZ A;  2XID A;  1CSK A;  2EYY A;  2HNI A;  3O8V A;  5DY9 A;  3X28 B;  4EPC A;  1YWP A;  2PZ1 A;  3V7S A;  2QYZ A;  1TU0 B;  1VIE A;  3M0P A;  3QBY A;  4JZ4 A;  4JJB A;  4M7D A;  4JJD A;  3CME Q;  1MNE A;  4MZM A;  1QCO A;  4EMH A;  5LJ5 f;  5KYY B;  3GLX A;  4M75 E;  4BAC A;  4EDU A;  3HHT B;  1WDX A;  1X6B A;  1A0N B;  1VQ5 Q;  2L3R A;  3M59 A;  4QT7 A;  1KQ2 A;  1UGV A;  2LDM A;  4V2S A;  5FW9 A;  3CMA T;  2COZ A;  5DLO A;  2QGF B;  2DYI A;  3V7R A;  2GFU A;  4PJN A;  5GAO r;  5KYX B;  1YIJ T;  2MMP A;  3CD6 A;  1X6G A;  4JUV A;  5C6S A;  2A28 A;  2KY9 A;  1LCK A;  4IIO A;  1RI0 A;  3PNW C;  4Y92 A;  2CH4 A;  2CRE A;  1PKS A;  2QQA A;  2SEM A;  4E7J A;  2RK2 A;  2Y4X A;  2HDA A;  3TRE A;  3CEY A;  3CCJ A;  1YHQ T;  3UAT A;  3I56 Q;  5L8R E;  2A3L A;  1NG2 A;  4Z88 A;  3CCE T;  2E5K A;  2YUO A;  1D0Y A;  4OP0 A;  3HRS A;  2JMA A;  2E70 A;  4PFP A;  2OTL A;  4BDY A;  3CPW A;  2M02 A;  4C5E A;  1MUZ A;  4Z02 A;  2FRW A;  1X69 A;  3PTA A;  2HBP A;  2RJF A;  4J9B A;  2YHT A;  5FRM A;  3QII A;  2KEA A;  3BFM A;  2OJ2 A;  3CCU A;  3KUF A;  3OYB A;  2VYT A;  2AHJ B;  1RLQ C;  2BTT A;  5FU7 B;  2FG0 A;  2IG0 A;  4FT2 A;  2CP2 A;  3JCM d;  2DL3 A;  1DJ7 B;  1OOT A;  3SWN B;  1Y96 B;  2RHI A;  9ATC B;  3OYE A;  1BB9 A;  2DO3 A;  1MV0 B;  4M7D D;  3LWH A;  1K9A A;  1PD0 A;  2RI2 A;  3PT9 A;  4JS5 A;  3CME T;  3VS7 A;  1TH7 A;  3J7A F;  2PU9 B;  4OF1 A;  1G2B A;  4P5N A;  4M7D G;  1QKX A;  5FU6 C;  4C8Q B;  4M7A C;  5LJ3 f;  3QWY A;  4A4F A;  3QJY A;  2A08 A;  2VWF A;  2VUB A;  1X43 A;  1M3C A;  1UUE A;  4FSX A;  3PIO A;  2JOY A;  4E7S A;  2RPN A;  2OTJ A;  4RMO A;  2HEQ A;  3NGP A;  1R77 A;  4XU1 A;  2H3J A;  2FPD A;  2CZ6 B;  3EG9 A;  1QVF P;  1B07 A;  2D8J A;  3CC4 T;  1V1C A;  2E10 A;  1Z9Q A;  3LLR A;  3WXM B;  2BZ8 A;  3G4S A;  2R5M A;  2LQN A;  2FVU A;  4BY6 C;  2KE9 A;  5J39 A;  1U5S A;  2CUD A;  2EKO A;  1AWW A;  1SPK A;  4M77 A;  2E41 A;  3I56 T;  2QEX Q;  2EQU A;  1TSF A;  1I1J A;  2X35 A;  5D6X A;  1WQW A;  3A8M B;  2DL5 A;  1QVG A;  3QUI A;  2NUT B;  2IIM A;  2RB6 A;  4XTY A;  1M5Q 1;  1WJS A;  2YT6 A;  2FPF A;  4HXJ A;  3S6W A;  1I5L A;  1XNI A;  2HKN A;  1RAA B;  2CUB A;  4L6V 5;  2PNI A;  3JV3 A;  2ZAE A;  5LJ5 e;  2DNU A;  1OYX A;  1G83 A;  3E19 A;  2NWM A;  4KUL A;  2YXY A;  4QQ6 A;  4Z8A A;  1Y0M A;  5CK9 A;  2EJF A;  4FT4 A;  4BE1 A;  3CCQ A;  2PTK A;  2DIQ A;  3T9N A;  3VS4 A;  4A4G A;  4EMK B;  4CRI A;  4F7U G;  3DKM A;  1AWJ A;  2L89 A;  3A8O B;  1VQN Q;  3OS2 A;  1ZSZ A;  1K8A R;  1D0Z A;  4F7U F;  1ZSG A;  3PVL A;  4IKF A;  1KC8 C;  1AEY A;  1KD1 U;  2LQW A;  3M0R A;  2M1H A;  2XMF A;  1NM7 A;  1VQ4 Q;  2KK4 A;  1YI2 Q;  2LP5 A;  4E7H A;  4OMP A;  5GAM e;  2Z0W A;  4M7D E;  5CQX A;  1D1A A;  4JRP A;  2DFU A;  2M0O A;  4CC3 A;  1QKW A;  2ZPB B;  3RR6 A;  3OYG A;  2DIL A;  1FX7 A;  3M57 A;  1NZ9 A;  2RA2 A;  4J9G A;  2YUP A;  1J3T A;  2ROL A;  4PK4 A;  2OI3 A;  2HD0 A;  3I5R A;  2KAF A;  1PRL C;  4MMK A;  4DBQ A;  3CBO A;  4M77 D;  1XOV A;  5CCA A;  2L0A A;  1OX9 A;  3SD4 A;  3GPL A;  2KVQ G;  2KNB B;  1NE8 A;  4HVW A;  4M77 G;  2EQK A;  2JMC A;  3LH0 A;  4KH0 B;  4FYY B;  2C0T A;  5IAY A;  1YJW A;  4FW1 A;  2MCN A;  2JTM A;  2MWO A;  1M27 C;  2QTV A;  3SFM A;  1K76 A;  3CCR A;  2XG8 D;  3LWI A;  3ZBD A;  5CKF A;  3DLL A;  2RHZ A;  3C0C A;  4KRT A;  2FZC B;  3VRZ A;  2RN8 A;  2XI9 A;  1YIT Q;  2V8I A;  4C92 A;  2KYB A;  1S72 Q;  4M78 F;  1NPP A;  2JS0 A;  4IUR A;  1UGQ B;  1LOJ A;  3OBW A;  3EGD B;  4KUD K;  2E4H A;  3BDL A;  3KFV A;  3FLG A;  4N4I A;  3RKW A;  4C0D C;  4PJO A;  2CZ7 B;  4Q5W A;  2GCX A;  3OSS C;  2L3S A;  1ZUY A;  3UF4 A;  2F5K A;  3SB2 A;  2FZG B;  2J05 A;  4LDV A;  1B7T A;  1WXT A;  2LZ6 B;  3GBQ A;  4J9C A;  2CP7 A;  3EG3 A;  2KMT A;  1JJ2 S;  4DA4 A;  2EGC A;  3MET A;  3QO3 A;  2M51 A;  1VQ4 T;  2LNV A;  3JCM g;  2FL7 A;  1RAB B;  2XHC A;  1K9M R;  4F04 B;  2ZPG B;  1SHG A;  4EMG A;  1KQ1 A;  1VQO A;  3LGL A;  2HMA A;  5EC7 A;  2EQM A;  4C5I A;  1UB4 A;  3VS0 A;  3UA6 A;  2J6K A;  1WPY A;  2EBP A;  3RNJ A;  1B34 A;  1YN8 A;  1BKB A;  3EG2 A;  4J6W A;  2HCK A;  2EKH A;  4PKC C;  2DTI A;  1PD1 A;  4KUI A;  2E65 A;  4MDX A;  3A1P A;  1IHV A;  1S1N A;  3CXC P;  5GAO p;  2KT8 A;  5DLQ E;  1G3S A;  1W4S A;  2EGE A;  4RTV A;  1YP5 A;  3LW5 E;  3OYY A;  3PE0 A;  4OMN A;  3THK A;  4RTZ A;  3V8L A;  1JEG A;  1NYG A;  2KXD A;  4AFZ C;  1FMW A;  1AWX A;  3CQT A;  4OMM A;  2DA9 A;  1VQ7 Q;  3HRT A;  4HT9 A;  3M5A A;  2NUP A;  2HL3 A;  2DJQ A;  4M77 E;  3V8J A;  2F69 A;  4OMQ A;  3I55 Q;  4PLL A;  5IH2 A;  5LJ3 j;  1K4U S;  2O88 A;  4C92 D;  1VQ8 A;  1BIB A;  1M90 R;  1IRE B;  2LX9 A;  3FEO A;  2KRS A;  4LDW A;  1S72 T;  1OI1 A;  2YUQ A;  1OU9 A;  4J9I A;  4J6X A;  2O31 A;  2KR3 A;  4C92 G;  1CKA A;  4LDY A;  1PM3 A;  4D6W A;  3NHN A;  1YJ9 A;  2JUF A;  2WSF E;  1PSE A;  4FM4 B;  4QVC A;  1M1K R;  3CC2 T;  2R5A A;  4M7A A;  2W0Z A;  1V29 B;  3E2U A;  4PJO G;  1N9S A;  1AZE A;  4XTW A;  3G6E T;  3JCM V;  2LTO A;  1HXD A;  4HT8 A;  1Y07 A;  4D8D A;  3CCL A;  4PJO F;  1N8R U;  1XTD A;  2ROT A;  2QA4 A;  2HQE A;  3NPF A;  2NYS A;  2RQV A;  2JM9 A;  2KT1 A;  1VQM Q;  4N0A C;  1RAH B;  1ZBJ A;  4RG8 A;  3C94 A;  2JXB A;  4ME7 A;  1TG0 A;  3PMI A;  3GP8 A;  4M75 F;  4MDW A;  2RNA A;  4IUU A;  4RCC A;  1FYN A;  3UWN A;  5D6Y A;  5KCH A;  2EGA A;  3C12 A;  3HTR A;  3H6Z A;  2E64 A;  4PNO A;  3TQ7 P;  4HCK A;  2CP3 A;  4OML A;  3CCS A;  3CCM T;  4CI0 C;  4YTL A;  2QXF A;  8AT1 B;  3P8H A;  3JCM h;  2AKL A;  2DLP A;  1QMC A;  2FYK A;  1Y71 A;  4OGE A;  1YIJ Q;  1BCM A;  3MEV A;  5FU6 B;  1BK2 A;  2ZPI B;  1D09 B;  1ARK A;  4XTX A;  3I5S A;  1QW1 A;  2DYB A;  4RCB A;  2DER A;  3RER A;  5KYY A;  2BZY A;  1VQK T;  2RQW A;  2JVV A;  2OAW A;  3I55 T;  1Q81 U;  5GMK l;  2YRD A;  1UEB A;  4ATO A;  3G71 A;  2O4X B;  4XTZ A;  3OYI A;  3CCE Q;  3EFS A;  1P92 A;  3FDR A;  1X27 A;  3OYC A;  4A53 A;  1JJ2 A;  3I35 A;  1UGS B;  4KGV B;  3CCV A;  3A8G B;  5KYX A;  2L5Q A;  4BY6 B;  4M7A D;  2KRM A;  3U23 A;  3E9G A;  3BDU A;  1G8X A;  5GMK m;  1Q86 R;  4C92 E;  1ZLM A;  1K0X A;  3VS2 A;  4RTX A;  4M7A G;  1UTI A;  2D6F A;  3FIF A;  1KQS S;  2K5F A;  1RAD B;  1K1Z A;  3SEM A;  2DIG A;  2XU8 A;  1VQM T;  2LJ0 A;  1U8R A;  1G3T A;  2EQJ A;  2P4T A;  2QAZ A;  5CQY A;  3OYF A;  2XK0 A;  1UJY A;  4BI8 B;  1QP2 A;  1BYM A;  2WAC A;  2F2X A;  2O9S A;  3WVE B;  1WNL A;  4BI3 A;  4EIK A;  1HSQ A;  2DD4 A;  2KDS A;  3M56 A;  2EAY A;  1M2V B;  5GAN 4;  1Q82 R;  4AT1 B;  2DEQ A;  3CC7 A;  2YLB A;  2V8J A;  1IO6 A;  2DL4 A;  2EIF A;  4Z89 A;  1TOV A;  2KGT A;  2PVO B;  2LC4 A;  5A0D A;  2RO0 A;  3CCJ Q;  1GBQ A;  1RAG B;  2X4X A;  3SWN A;  3ASK A;  1Y96 A;  1QVP A;  2EYW A;  1KIK A;  2WSC E;  2F5T X;  5KH6 A;  2PUO B;  5GMK j;  2DAQ A;  5GAM d;  2Y4Y A;  1VUB A;  3GOX A;  2C0O A;  4M4Z A;  3CC4 Q;  1Y57 A;  2G6F X;  4N4H A;  2VGN A;  4ANJ A;  3TEE A;  2D1X A;  3MEW A;  1YJN A;  2KQW A;  4AMC A;  4C8Q A;  2M16 A;  3E9F A;  1U1T A;  3VRY A;  4D8K A;  1EIF A;  3P8B B;  2P4R A;  4M75 C;  1WXB A;  1Q7Y C;  4KBM B;  1M2O A;  2LNH B;  1VQ9 T;  1ACM B;  1IZ6 A;  4DBR A;  2O9V A;  1VQ5 A;  1MMA A;  3HRU A;  1M90 C;  8ATC B;  2X4W A;  2COW A;  3AHU A;  2JTF A;  2DXB A;  2HZY A;  3QHS A;  1M8M A;  1C6V X;  2EYZ A;  3OB9 A;  3QYG B;  2BE7 D;  2KRO A;  3A8L B;  1NLO C;  3I9Q A;  3M58 A;  4PJL A;  1NYF A;  1SHF A;  2LX7 A;  1N27 A;  1UHC A;  4M7A E;  1IGU A;  2DKG A;  4HA8 A;  1NEB A; 
#chains in the Genus database with same CATH homology
 4C92 B;  3CMA A;  4E7H A;  4IUP A;  5GAM e;  2DK3 A;  4M7D E;  5CQX A;  1R8O B;  4JRP A;  2M0O A;  3NTI A;  3GNF B;  2RJD A;  2VGM A;  4C5G A;  1ZHI A;  5GMK h;  3L42 A;  3H8Z A;  1Y7X A;  2E6N A;  2ZPB B;  2DD5 A;  1D3B A;  2LCC A;  3N5B B;  5CKD A;  3OYG A;  1YIJ A;  1FX7 A;  4HCC A;  3M57 A;  5GAN d;  2MWP A;  2ZPE B;  1NZ9 A;  2G3R A;  2E6Z A;  1OZ2 A;  2RA2 A;  3QXE B;  3CD6 T;  4NS5 A;  4PJO B;  4M7A F;  1KG1 A;  1MGQ A;  1K73 C;  3OYM A;  4X34 A;  4Y91 A;  2HD0 A;  4HCZ A;  4A4H A;  3M54 A;  3GIB A;  2LQ8 A;  3CCM A;  1UGP B;  1WQ7 A;  4BDZ A;  4M7D F;  2KAF A;  3CCS T;  2QI2 A;  4C0D B;  3OS0 A;  5LJ5 d;  1X6O A;  1VIF A;  4R55 A;  4MZT A;  3L2W A;  4MMK A;  4EMK C;  3CBO A;  2K2V A;  4M77 D;  1YHQ A;  4J8O A;  5I21 A;  1N6A A;  1WJR A;  1XOV A;  5CCA A;  3CCJ T;  3UPU A;  2DTO A;  3SD4 A;  5J3B A;  4JDS A;  3JCM f;  3NFC A;  3M4Y A;  3OYH A;  3GPL A;  3CCE A;  1YIT T;  1K9M C;  2VC8 A;  4J83 A;  2K5I A;  2KVQ G;  3VJP A;  1NE8 A;  4M77 G;  4EMK A;  2EQK A;  3KBG A;  3LH0 A;  4JRK A;  2E5Q A;  2DXT A;  3L2V A;  2E12 A;  3UDC A;  2OTL T;  3HPW A;  5IAY A;  3ZFJ A;  4FU6 A;  4J7F A;  4M78 E;  3CXC A;  3OYD A;  1YJW A;  5FRN A;  2FB7 A;  4M77 C;  2JTM A;  4JJN K;  3QDR B;  3QSU A;  4PJO D;  3QKJ A;  2MWO A;  1VQK A;  5IT9 E;  2XDP A;  4C92 C;  4C8Q D;  3SFM A;  4HCB A;  1QVF S;  5GAN 2;  3I55 A;  4WF2 A;  5CKB A;  1MHN A;  3RMQ A;  1B34 B;  3CCR A;  2XG8 D;  3LWI A;  3ZBD A;  5CKF A;  3DLL A;  3S3O A;  2RHZ A;  5CO7 A;  3LYI A;  4BE2 A;  1VQP T;  3X24 B;  2K4Y A;  4C8Q G;  3G71 T;  2XI9 A;  2E1H A;  2V8I A;  4OGC A;  1FXX A;  4C92 A;  3OYA A;  1KQS A;  3CCU T;  4X9C A;  4OB0 B;  1JRI A;  3MEA A;  2LT1 A;  1I8F A;  1NPP A;  4IUR A;  1UGQ B;  4M78 F;  1LOJ A;  1SSF A;  3OBW A;  5I2M A;  4C8Q F;  2X4J A;  3F70 A;  4ELY C;  5GAO m;  3CPW S;  1X01 A;  3HP9 A;  4M75 D;  3FJP A;  5D6W A;  1O9S A;  3VYG A;  4JLG A;  4KUD K;  3CCV T;  2M9U A;  5KE2 A;  3BDL A;  3LX7 A;  1YCY A;  3FLG A;  3HL8 A;  2RI3 A;  3QG1 A;  4N4I A;  3RKW A;  4C0D C;  4M75 G;  4DOW A;  4PJO A;  2CZ7 B;  4Q5W A;  3G7Z A;  2GCX A;  3OSS C;  3QZ9 B;  2F5K A;  2CGH A;  2RJE A;  1UGR B;  3WVD B;  3SB2 A;  2DZ9 A;  3CME A;  1BI0 A;  4LDV A;  2CYZ B;  4MZP A;  4F7U B;  2LQK A;  3L2Z A;  4DOV A;  1H3Z A;  4VUB A;  1Q86 C;  2KMT A;  1JJ2 S;  4DA4 A;  4N4G A;  5FLX E;  3MET A;  5C0M A;  1H64 1;  1HK9 A;  1M1F A;  4O6J A;  3QO3 A;  3URG A;  3JCM b;  5EG2 A;  1JB0 E;  4X9D A;  4B9W A;  3PMT A;  1VQM A;  1NJI C;  1PSF A;  3MCA B;  2YLC A;  3INZ A;  5LJ3 h;  4R56 A;  1VQ4 T;  4B9X A;  1VQ6 T;  3MHX A;  2NLU A;  2PUK B;  2LNV A;  2IVW A;  2RJC A;  3NTH A;  3JCM g;  4E7I A;  2FL7 A;  2XHC A;  1Q86 U;  2QQ9 A;  4C5H A;  4JRQ A;  5GAM f;  5CAI A;  2ZPG B;  1M1G A;  5GAO n;  5HY6 A;  2GFA A;  5CIU A;  3VUZ A;  3VV0 A;  3OY9 A;  4EMG A;  1KQ1 A;  1OZ3 A;  3JSC A;  3DLM A;  3OSV A;  1WJQ A;  2QEX A;  1VQO A;  5GAN 7;  3LGL A;  1NJI U;  1M1K C;  3L2U A;  2EQM A;  4C5I A;  1W2B A;  2OTJ T;  1UB4 A;  1NPR A;  3HFN A;  5LL6 S;  5KCO A;  5DM7 R;  4IUV A;  2DXU A;  1WPY A;  3CC4 A;  4M7A B;  2LT4 A;  1B34 A;  1AHJ B;  2K3X A;  1U1S A;  2I2L A;  5GAN 5;  2XDD A;  3UT1 A;  4QVD A;  1BKB A;  4J6W A;  5CVI A;  1VQ7 T;  2QQS A;  3RUX A;  2K5L A;  3HKS A;  4XQ3 A;  4M7D B;  4PKC C;  3G4S T;  2BIV A;  2EJ9 A;  3OQ5 A;  3CC7 T;  2DTI A;  1N9R A;  2EFI A;  3E1S A;  2ZPF B;  3CBP A;  4XU0 A;  4KUI A;  2L8D A;  2QQR A;  2RI5 A;  4DQ2 A;  2E65 A;  4E7K A;  1Q82 C;  4C0G A;  4MDX A;  3JCM c;  3VYH B;  3I56 A;  4ZTF A;  5GAO p;  1VQL A;  5HK3 A;  5DLQ E;  3OW2 A;  1G3S A;  1W4S A;  5LJ3 d;  3VUB A;  1O75 A;  3LW5 E;  3OYY A;  3LGF A;  3V8L A;  4LD6 A;  2EWN A;  2DXC A;  1KHC A;  1G5V A;  1Q82 U;  1FWZ A;  4ZN3 A;  2MF2 A;  2MAM A;  2KSS A;  3S3M A;  4F7U A;  3EFR A;  3QJ6 A;  4XU3 A;  3JB9 J;  4J7I A;  2CZ0 B;  4GY5 A;  3HRT A;  3A8H B;  4HT9 A;  3OYL A;  3M5A A;  2ZZD A;  4HKE A;  4PLI A;  3MP8 A;  4XTU A;  4KT0 E;  4M77 E;  3V8J A;  5I2S A;  2OAU A;  4C0Z A;  2WSE E;  5KE3 A;  1VQN A;  1YJN T;  2F69 A;  4XAX B;  4PLL A;  1G3Y A;  3OBY A;  5LJ3 j;  4MML A;  5IN1 A;  5J26 A;  3VU3 C;  2V8K A;  4C92 D;  1VQ8 A;  1BIB A;  2DVE A;  2RHX A;  2CKK A;  4GLK A;  1IRE B;  2LX9 A;  3FEO A;  4LDW A;  1VQ9 A;  2RM4 A;  1S72 T;  1OI1 A;  3GNG A;  3M4G A;  5FRO A;  1RL2 A;  4M78 B;  4J6X A;  4C0F A;  2EJG A;  1QVG S;  1VQ5 T;  4RKU E;  4C92 G;  5GAO l;  2HAX A;  4LDY A;  2YRV A;  3M9Q A;  4D6W A;  5HK0 A;  5GAM g;  4M77 F;  1YJ9 A;  5CKE A;  1YI2 A;  4PJO E;  2XID A;  3BW1 A;  2JUF A;  2WSF E;  1PSE A;  4FM4 B;  4QVC A;  3OYN A;  1M9S A;  4C8Q E;  5GAN f;  4M7D C;  2JN0 A;  3CCQ T;  3CC2 T;  2R5A A;  2HNI A;  1N8R C;  3O8V A;  5DY9 A;  3X28 B;  5GAO q;  4M7A A;  3DB4 A;  4EPC A;  3V7S A;  5A0G A;  1V29 B;  1VIE A;  3QBY A;  3JB9 D;  4PJO G;  1N9S A;  2CZ1 B;  4M7D A;  3FRN A;  4MZM A;  4XTW A;  3CPF A;  3G6E T;  3JCM V;  2LTO A;  1HXD A;  4EMH A;  4HT8 A;  5LJ5 f;  1Y07 A;  3ZEH A;  3CCL A;  4PJO F;  1N8R U;  3GLX A;  4M75 E;  3L2Q A;  4BAC A;  3JB9 G;  1XTD A;  4EDU A;  3HHT B;  3MP6 A;  2QA4 A;  3JB9 I;  2HQE A;  3DB3 A;  1WGS A;  2L3R A;  1I81 A;  3JB9 F;  3M59 A;  5LJ3 e;  1KQ2 A;  4N0A C;  2LDM A;  4V2S A;  3OA6 A;  3CMA T;  2O01 E;  4RG8 A;  5DLO A;  5GAM d;  3C94 A;  1K8A U;  1G3W A;  4ME7 A;  4UC4 A;  3JCM e;  4QW2 A;  3ME9 A;  4ZGD B;  2XKO C;  3PMI A;  5M9O A;  3BY7 A;  3GP8 A;  4M75 F;  1LNX A;  4MDW A;  4IUU A;  4N0A A;  4RCC A;  3V7R A;  2GFU A;  5GAO r;  4O5V A;  3UWN A;  1YIJ T;  5D6Y A;  4E47 A;  2MMP A;  5KCH A;  3CD6 A;  2VXF A;  3C12 A;  4QQG A;  4RG2 A;  4OMF B;  2DPP B;  4JUV A;  3H6Z A;  5C6S A;  2E64 A;  4XU2 A;  2KY9 A;  2XIC A;  4PNO A;  5GAN 8;  3JCM P;  1RI0 A;  4BB7 A;  2R58 A;  3CCS A;  3X25 B;  3M55 A;  3PNW C;  3CCM T;  2LCL A;  4LD9 K;  2QQA A;  4M78 A;  4E7J A;  2RK2 A;  4CI0 C;  3RIR A;  2Y4X A;  4XK8 E;  4YTL A;  4NL3 A;  3TRE A;  2QXF A;  5GAN 3;  3CEY A;  3CCJ A;  1QVF A;  4JRI A;  4II1 A;  3P8H A;  4ZGJ B;  1YHQ T;  3JCM h;  3NTK A;  4IUQ A;  5L8R E;  2A3L A;  2VV5 A;  3ER0 A;  1YIT A;  3CCE T;  2FYK A;  4ELZ C;  1Y71 A;  3GF5 A;  2LVM A;  3JAM E;  2EYQ A;  4OP0 A;  3HRS A;  1I4K 1;  4LDU A;  4OGE A;  2E70 A;  5GAN g;  3JB9 H;  3MEV A;  5FU6 B;  2ZPI B;  2OTL A;  4A54 A;  2RHY A;  4BDY A;  3CPW A;  4Y28 E;  1X75 C;  3FC3 A;  1Q81 C;  4C5E A;  3Q1J A;  4JLI A;  4XTX A;  1JBM A;  4Z02 A;  3OMC A;  4BE0 A;  1YJW T;  1QW1 A;  4RCB A;  1Q7Y U;  3PTA A;  3RER A;  3X26 B;  2HBP A;  3RES A;  1VQK T;  2RJF A;  3OMG A;  2YHT A;  3QYH B;  5LJ5 g;  5FRM A;  2JVV A;  3I55 T;  1Q81 U;  5GMK l;  1BI3 A;  1UEB A;  3CCR T;  3QII A;  4ZGE B;  3S3N A;  1VQP A;  4ATO A;  3BFM A;  3QPH A;  3G71 A;  2O4X B;  4XTZ A;  3QZ5 B;  3PIP A;  3CCU A;  3KUF A;  3OYB A;  3OYI A;  3EFS A;  2PVD B;  2P0P A;  1P92 A;  3FDR A;  4OVA A;  2VYT A;  2AHJ B;  2K3Y A;  4A53 A;  3OYC A;  5FU7 B;  1JJ2 A;  2R57 A;  1UGS B;  3CXC S;  5GAN 6;  2IG0 A;  4FT2 A;  4M77 B;  3JCM d;  3CCV A;  3L2R A;  4J6Y A;  3A8G B;  1DJ7 B;  2L5Q A;  3SWN B;  4BY6 B;  3JCM W;  4M7A D;  1Y96 B;  1ZBX A;  2RHI A;  3E9G A;  3OYE A;  3OYJ A;  3RMS A;  3BDU A;  2P0Q A;  2DJZ A;  3R6O A;  2PQW A;  2DO3 A;  1XQH A;  5GMK m;  4M7D D;  4C92 E;  3LWH A;  2RH2 A;  2C06 A;  2LRQ A;  4M7A G;  2RI2 A;  2D6F A;  3PT9 A;  4JS5 A;  3CME T;  3FIF A;  1KQS S;  1TH7 A;  2XDB A;  3J7A F;  2PU9 B;  3C4S A;  4OF1 A;  2DZC A;  2K5F A;  4L59 A;  4L5G A;  4P5N A;  4M7D G;  5FU6 C;  3HFO A;  2DIG A;  3HSB A;  4C8Q B;  4M7A C;  3A5Z B;  1VQ4 A;  1VQ6 A;  2XU8 A;  1VQM T;  4FIB A;  1KHI A;  4OB1 B;  5LJ3 f;  1U8R A;  1G3T A;  4A4F A;  2P4T A;  2EQJ A;  4C92 F;  2ZGW A;  3QJY A;  2Y90 A;  3PFS A;  5CQY A;  4ZN1 A;  5GAM h;  2VUB A;  3OYF A;  2RHU A;  2D0Q B;  2XK0 A;  1K73 U;  3CBM A;  4NL2 A;  4FSX A;  3PIO A;  2JOY A;  5GAN j;  2QEX T;  2OTJ A;  1VQO T;  4M75 B;  1BI2 A;  4BI8 B;  1QP2 A;  4RMO A;  1BYM A;  2JNG A;  2QTX A;  3M53 A;  2WAC A;  4IUT A;  4XU1 A;  2DTH A;  3KXT A;  2H3J A;  4OB3 B;  3WVE B;  1WNL A;  2CZ6 B;  4BI3 A;  2DD4 A;  2KDS A;  3OS5 A;  1K8A C;  4JS4 A;  3CC4 T;  2B8A A;  2RD1 A;  5FU7 C;  2E10 A;  3M56 A;  3J80 E;  3LLR A;  4A4K A;  3L1A A;  3WXM B;  2CS7 A;  2EAY A;  2O4X A;  5LJ5 j;  5GAN 4;  2D9T A;  1VQ7 A;  5A2Q E;  1K9M U;  2DEQ A;  3G4S A;  2YLB A;  3CC7 A;  2R5M A;  3JCM J;  2V8J A;  3JRZ A;  4M78 D;  3V8K A;  2FVU A;  3SWN C;  2EIF A;  4BY6 C;  5J39 A;  2GQV A;  4J5Y A;  2PVO B;  2LC4 A;  5A0D A;  2EKO A;  2RK1 A;  4BUG A;  2XD0 A;  2RO0 A;  3EAE A;  4M77 A;  2E41 A;  4M78 G;  4FL6 A;  3I56 T;  1W2B S;  2X4X A;  3SWN A;  1VQL T;  2EQU A;  3OYK A;  3ASK A;  1Y96 A;  1QVP A;  3MP1 A;  1GXI E;  2WSC E;  2F5T X;  2X35 A;  5KH6 A;  2PUO B;  5D6X A;  3TCJ A;  5AYF A;  5GMK j;  2DAQ A;  1WQW A;  2JZ2 A;  2BKD N;  2Y4Y A;  3MEU A;  3A8M B;  1VUB A;  3MO8 A;  4M78 C;  3GOX A;  4C8Q C;  4PJO C;  3RKY A;  1QVG A;  5HKC A;  2PVG B;  2GF7 A;  3QUI A;  5GAN e;  3SDZ A;  1QP3 A;  2RB6 A;  4N4H A;  3V7C A;  4XTY A;  3VKI A;  1D3B B;  1M5Q 1;  1WJS A;  2VGN A;  3S6W A;  3TEE A;  3MEW A;  1YJN A;  4E7L A;  1I5L A;  1XNI A;  2KQW A;  3FB9 A;  4C8Q A;  1LJO A;  1VQN T;  2M16 A;  3E9F A;  3OW2 S;  1U1T A;  2X4Y A;  4L6V 5;  1EIF A;  3P8B B;  4M75 C;  5LJ5 e;  1S72 A;  1Q7Y C;  1VQ8 T;  2QDY B;  4KBM B;  1OYX A;  3JCM Q;  5GAM j;  1VQ9 T;  5LJ3 g;  3E19 A;  1IZ6 A;  4KUL A;  4F7U E;  4PL6 A;  2QQB A;  1VQ5 A;  4QQ6 A;  3HRU A;  4BI4 A;  3RKX A;  4QVZ A;  1M90 C;  2X4W A;  1YBY A;  2HQX A;  4NOY A;  3P8D A;  4M75 A;  5CR2 A;  2MI6 A;  5CK9 A;  3J81 E;  2BUD A;  2EJF A;  4FT4 A;  1ZQ1 A;  5GAN h;  3CCQ A;  4BE1 A;  1YI2 T;  1YJ9 T;  3CC2 A;  2DIQ A;  2VXE A;  4QQD A;  2JTF A;  1KD1 C;  3AHU A;  3T9N A;  1M4Z A;  4EMK B;  4A4G A;  2DXB A;  4CRI A;  4OB2 B;  4F7U G;  3QHS A;  3C95 A;  3DKM A;  4LDX A;  3PGG A;  4A4E A;  3OS1 A;  2L89 A;  4TVR A;  1M90 U;  2P0K A;  3A8O B;  5GMK e;  2FHD A;  3OB9 A;  3QYG B;  3OS2 A;  1BI1 A;  3JCM X;  3A8L B;  4F7U F;  3G6E A;  4IKF A;  5LJ5 h;  5GMK i;  3M58 A;  1KC8 C;  4ZTJ A;  2A7Y A;  1KD1 U;  2M1H A;  3CCL T;  1M8V A;  4BD3 A;  3TU4 K;  1N27 A;  5A0L A;  2QA4 T;  4XTV A;  1M1K U;  2ZCF B;  2ZPH B;  2KK4 A;  1BIA A;  4M7A E;  3X20 B;  2K57 A;  2DKG A;  4HA8 A;  5CKH A;  1KC8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...