5GAMg

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
molecule keywords U5 snRNA
total genus 8
structure length 69
sequence length 75
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamg00
4M7AB 5GAN5 4C92D 5GAMj 4PJOC 4M75G 4PJOB 2EJ9A 2E64A 4MMLA 4XTVA 4M75C 4Y91A 1Y96A 3RESA 4M7DB 5GAMd 2DZ9A 1U1TA 4NL2A 3JB9D 3V7RA 2DJZA 2E41A 3QUIA 5DY9A 3JB9J 4M7DA 3JB9H 4HT9A 1N9SA 2I2LA 5GANj 5GANf 4A53A 1H641 4C92G 5LJ3g 5GAOr 5GMKj 4M77D 2DTIA 4EMHA 1HK9A 1Y96B 5GAN6 2HNIA 3SWNA 4EMKA 4J5YA 4M77E 5GANd 5I21A 4XTUA 3V7CA 4C92F 2EWNA 4NL3A 4PNOA 4M7AA 4J6WA 5LJ3d 2RM4A 3HFOA 3BW1A 4M77C 3FIFA 5LJ5f 4N0AC 4XU1A 4F7UB 3JCMb 4M78A 5GANg 4OP0A 2DTOA 3RKYA 5LJ3f 4M75A 3JCMg 4M7DG 4XU2A 4MMKA 1LJOA 4XTYA 5GAOm 4C8QF 1D3BB 4C92A 1WQ7A 2DKGA 1U1SA 3RKXA 3RIRA 1B34B 5GMKm 4J6YA 5GAN3 3JCMe 2K57A 1M8VA 4M7DF 2RA2A 3JCMd 4C8QG 1X01A 2YLCA 3EFSA 5LJ5h 4C8QB 4PJOF 4EMGA 5GAMe 5GAMh 4M7DC 1BIBA 3GIBA 4JLIA 3AHUA 1LOJA 1YCYA 5LJ5j 2VXEA 1I8FA 3HFNA 4M78B 2DZCA 4M7AD 1D3BA 4C92B 1I5LA 3JB9G 3V8LA 4M7AE 2JN0A 3QHSA 2DVEA 4RCCA 4M75F 3JCMV 3JCMc 3BDUA 1JBMA 3V8KA 4F7UA 5GAMf 5LJ3j 1N9RA 4M77A 1TH7A 4WF2A 5GMKe 2E10A 5GAMg 4M78D 3BY7A 2FB7A 2EAYA 2DEQA 4C8QD 1I81A 5GAOq 4JRIA 4RCBA 3SWNB 4EMKB 3JCMX 2YHTA 2ZGWA 5GANe 3M4GA 2E1HA 5GMKi 3BFMA 4M78F 2VXFA 4HT8A 4XQ3A 1MGQA 4XTWA 4XU0A 1M5Q1 4C8QC 3HSBA 2Y90A 5GMKl 4M7DE 4M78C 2EJGA 4JUVA 3QO3A 4M78G 5GAN4 3JCMh 3JCMP 1LNXA 5LJ5d 1BIAA 4M77F 4HA8A 2CGHA 3RERA 1JRIA 5CAIA 4QVCA 1KQ1A 4PJOA 3FJPA 5GMKh 4A54A 4XU3A 3PGGA 1I4K1 4M77G 4JRKA 3EFRA 4F7UG 5LJ5g 1WPYA 3SB2A 4M77B 5GAOn 4V2SA 3JCMf 3JCMQ 2VC8A 4M7AF 2QTXA 4F7UF 4XTZA 2E65A 3RUXA 2EJFA 4F7UE 4C8QE 3FB9A 5GAOp 1WNLA 4M7AG 2YLBA 4DQ2A 3INZA 3V7SA 1HXDA 5LJ3e 3JCMJ 4M75D 4J6XA 5GAN7 3L2ZA 5LJ5e 2RB6A 2DTHA 4M75E 4N0AA 4X9DA 4PJOD 4C8QA 1B34A 3V8JA 5GANh 4M78E 3JB9I 2DXUA 3SWNC 4EMKC 5GAN8 3QSUA 4M7DD 3JCMW 2FYKA 4X9CA 2DXTA 4NOYA 3RKWA 4XTXA 5LJ3h 4M75B 4PJOG 5GAN2 4QVDA 1WQWA 4M7AC 2RD1A 3L1AA 3VU3C 5GAOl 1KQ2A 4PJOE 4C92E 4C92C 3JB9F
chains in the Genus database with same CATH superfamily
1NG2A 1HSQA 2D9TA 1ZSZB 1P92A 1H8KA 3RESA 1UE9A 3CCLA 3FLGA 3MP1A 4PFPA 5DY9A 2X3WD 3LW5E 1WGSA 2PQWA 1K8AC 4GY5A 1GRIA 2EFIA 3H0FA 3KBGA 2EKOA 4X34A 3Q1JA 2CUDA 2ZPHB 3RIRA 5GMKm 4HXJA 1M3BA 1YJNA 1Y07A 3CMAQ 1M2OA 3DKMA 2HQHA 2IG0A 4ESRA 2KXDA 2FZCB 1KG1A 2EGAA 2XK0A 3FJ5A 4F7UA 2P4TA 3A8MB 1YIJT 2X9HA 3BY7A 3EGXB 2MOXA 3OYCA 1NLPC 2YHTA 4IIOA 1K1ZA 3CXCA 1D09B 5CKBA 4XU0A 2Y90A 4M78C 3OYDA 1G5VA 2H3EB 2Y4XA 1YJWQ 2K4YA 4EIKA 2VB6A 1LNXA 1ZA2B 2JT4A 2HKQB 4LE9A 3CCUQ 2DNUA 2DRMA 1EZZB 3NTIA 1I4K1 2LT1A 3CCMT 1KQSS 4XTZA 4E6RA 2J6OA 2EGEA 5LJ3e 3V7SA 1FMVA 1FWZA 3S3OA 5KE3A 3VYHB 5GANh 3CCRA 1ZUKA 2DXUA 4PFZA 4JJBA 2EQMA 4X9CA 2DVJA 3AT1B 1VQ7A 4C5HA 5EC7A 4M7AC 1TXQA 2P0QA 2DX1A 1IHWA 2KYBA 4RUGA 3HPWA 3DB3A 2OTJT 1UGQB 1T3LA 2VV5A 5I2SA 2K5LA 2BZ8A 3CMAT 2X51A 3C94A 3CPWP 5GANj 1GL5A 5LJ3g 2ABLA 3MP8A 1VQ5Q 1YJ9Q 2J05A 3PVLA 2GQIA 4LN2A 1RAEB 2M51A 5LJ3d 5D6XA 5LJ5f 1VQMA 3ME9A 1YIJA 2SEMA 1VQ9Q 6AT1B 4BI3A 2AKKA 1XOVA 4MZPA 1B7TA 1JJ2S 3EG9A 3EAEA 3CCQT 2OJ2A 2DJQA 1YI2T 1UTIA 2J6FA 1M90C 1OULA 2L3SA 2QQRA 3FDRA 3HFNA 2DE0X 1Q7YR 3CBPA 4RCCA 3LYIA 3MJXA 1UDLA 4M77A 2DYIA 2GFAA 3L2WA 1VQ6A 2QQ9A 4KBMB 3DB4A 3VS5A 2OTLA 1K9AA 1M1KC 1M8MA 3SWNB 4PJNA 1FXXA 1M30A 3LWIA 2L89A 1R8OB 4IURA 3TCJA 2E6NA 1OOTA 2MAMA 4OB2B 2DL8A 2AHJB 2K3BA 2KGTA 4M77F 4F16A 1RAAB 4DBHA 4C0DC 1K0XA 3JCMQ 3WVDB 1UGPB 2XIDA 2MI6A 3CC2Q 2AIRB 2OTJQ 1HXDA 1RABB 2K6DA 3OS2A 1IXDA 4J6XA 2MWPA 1UFFA 2P84A 4N0AA 3CCVQ 2E5QA 3EG0A 2LJ0A 3JAME 1ACMB 4NOYA 3VV0A 1QWFA 4XTXA 4M75B 4AFZC 3CCET 2CSQA 2LDMA 2RD1A 4Y92A 3CC2A 2F5KA 4E7JA 3CEYA 2H8HA 1VQ9T 4PJOC 2IVWA 2E64A 4MMLA 1VQPA 2F69A 3TU4K 1KC8R 4Z88A 4OB1B 2VGMA 4GLMA 1RACB 2R57A 2HZYA 5FROA 4EMHA 1GCPA 2GBQA 2K5IA 1MV0B 4J6WA 4AFUC 4N4HA 4M4ZA 2AKLA 2FPDA 4F7UB 2C0TA 4M78A 3RKYA 3OS0A 2LMJA 1VQ8A 3QWXX 2PNIA 1W2BS 2NUZA 5IXBA 3JCMe 1NYFA 2K57A 3PE0A 4IIMA 2YSQA 2YLCA 3PT9A 5GJWB 2QEXQ 2JS2A 5KYXA 2CZ0B 3VS0A 2HL5C 1VQKA 2KRSA 1X6OA 3OYHA 1I5LA 1ARKA 1VQ8T 1VQ6Q 4RTTA 1M4ZA 2BTTA 1YJ9A 1BK2A 4C8QD 2LNHB 2FPEA 1CSKA 2E1HA 2HCKA 3QWYA 3SD4A 1XNIA 3S3MA 4JUVA 4XK8E 3QZ9B 4NS5A 2LCLA 4LDXA 1KQ1A 1VQPT 3OBYA 3CCJA 4JRKA 1G3YA 1VQ7T 2BE7D 4J9FA 2OAWA 1FMWA 2VC8A 3G4ST 1QVFA 1VA7A 1M9SA 4F7UF 3M0QA 3CCRT 3RBBB 4C0ZA 3CCEA 1M1KU 1VQ4A 2YLBA 4C5IA 5CCAA 2B8AA 4KGVB 5LJ5e 3GNGA 5KYXB 2RHZA 1JB0E 4M78E 3CCJQ 4EMKC 1K8AU 3KXTA 4P5NA 4ZN3A 2KT1A 3PIOA 2F5TX 2EQKA 1Q86R 2RI5A 1XJWB 2A36A 3SFMA 5DLQE 2VKNA 2PZ1A 3UA6A 3LGLA 3JB9D 3CD6Q 1OZ3A 4BY6B 4AFSC 1W4SA 2DL5A 3NHNA 2DFUA 4FSXA 4QQDA 5GANf 5FWCA 1UGSB 5GAN6 1HK9A 1WFWA 5I21A 3META 2ZPEB 1Q82U 2OTLT 2KRNA 1VQ8Q 1VQ6T 2LC4A 2M9UA 3CC4Q 2DTOA 5L23A 4JDSA 3RKXA 2HAXA 5KYUA 2DL3A 2NUPA 1GCQA 3PFSA 2ED1A 3I56Q 4F14A 3I55Q 1JXMA 1LOJA 3M0UA 1ZA1B 2YRCA 4J9BA 2AZSA 3V8KA 2EYWA 3THKA 5LJ3j 1TH7A 1RLPC 2ZPFB 4FW1A 2ROTA 3CCRQ 3HHTB 4M78F 3QG1A 1S72T 2QTVA 4LDWA 1QQJA 2ZPGB 3OW2A 3EGXA 1WI7A 4DBFA 4QT7A 3E2UA 4RKUE 2DD5A 3UWNA 2K2VA 1YJNQ 1QWEA 2FVUA 4D8KA 1T0HA 4R55A 4A4GA 2O88A 3CXCP 4Z8AA 3EGDA 2VYTA 2KYMA 1K73R 2JM8A 1QVPA 4DA4A 1C1AA 4PFOA 3JB9I 3U23A 4JLGA 5CQYA 4J9CA 4B9XA 3OQ5A 3OYBA 2EYYA 2XDBA 4PLLA 4FYWB 4KRTA 5I11A 5CKEA 4M7AB 2QAZA 4PJOB 5GAMd 2BUDA 4OMMA 1QVGA 2CSIA 1KJWA 3WXMB 2J6KA 2F2WA 2KBTA 4GBQA 3I55T 2BKDN 2A37A 1M90U 2GFUA 1KQSP 2HNIA 1E7OA 3HRUA 1Q95G 1PG5B 4J5YA 4IKFA 5DLOA 1YITT 3VUBA 2DYBA 1IREB 5GANg 5CKFA 1SSFA 1D3BB 2J06A 2RK1A 5KYYB 3CPFA 3D7SB 2FHDA 1WHGA 3JCMd 1ABOA 4BY6C 2FZKB 4C8QB 2LQKA 5KYUB 1QW1A 1K0SA 1QVFP 4RTUA 3VRYA 1D1CA 3G1JA 3PIPA 3JB9G 1Q82C 2LZ6B 3L2QA 1NPPA 3OYAA 2F1LA 1JU5C 3VS3A 1UJYA 4M78D 2E3IA 2D0QB 3JCMX 1Z9ZA 5GANe 3G6EQ 2ROLA 2LQNA 1MGQA 3MO8A 1M5Q1 1YHQQ 1YIJQ 5LJ5d 1FYNA 2EQUA 3FRNA 3UF4A 4HA8A 4C0FA 4E7ZA 2QG9B 1AWWA 1KHCA 1VIFA 3ASKA 2LQ8A 4N4IA 3N5BB 1WXBA 5KCHA 1AWOA 4IUVA 4M7AG 1PSEA 1M1KR 2CP2A 4DOVA 1M3AA 4C8QA 3VJPA 4ZTJA 2HMAA 1RAIB 3QSUA 2DXTA 2R5AA 1BCOA 2KI7A 2MWOA 2RH2A 5GJVB 1KSWA 2AZVA 2K2MA 2HQXA 2CP3A 4PJOE 2R58A 4FW2A 2DXBA 2DRKA 3JB9F 4LDYA 1VQ5T 1UJ0A 3O8VA 1A0NB 3UPUA 3TREA 3G7ZA 2EYXA 2EYQA 4JZ4A 1IO6A 3PMIA 2I2LA 3X28B 2SRCA 4J9HA 2VGNA 5CKHA 4M77D 2X4JA 2DTIA 1QVGP 4OMFB 1DJ7B 1Y96B 2LP5A 3PTAA 1XTDA 4BI8B 4KGZB 4CC3A 2YUNA 4XTUA 3GPLA 4NL3A 3H41A 3CCQQ 1YFNA 3FIFA 2RJFA 1YI2Q 1FMKA 4XU2A 1U5SA 3J81E 2RO0A 4J6YA 3R6OA 1GXIE 4M7DF 3OW2P 5LJ5h 3EFSA 2RHYA 5IN1A 4KUDK 5GAMh 2LTOA 1B07A 3P8BB 2KNBB 1VQOA 1KD1R 1SKUB 5LJ5j 1RI0A 4M7AD 2HEQA 1VQ5A 1YNZA 1ZQ1A 4DOWA 4RTYA 5GAOq 4JPBW 2X4XA 5GMKi 2MMPA 3BFMA 5KH6A 4BDYA 1KIKA 1NEGA 2V1RA 2QQAA 1CKBA 3OYNA 1V1CA 4HCZA 2CGHA 1VYTA 4HVWA 3P8HA 2A3LA 8AT1B 3CCVT 5GAOn 2GCXA 4M7AF 4J7FA 4RTWA 1QVGS 2NYSA 1NLOC 2ZPIB 3RUXA 2M1HA 1QKWA 5DM7R 3I9QA 3JRZA 2GTJA 2ATCB 3DLMA 4MZTA 1SRMA 3OB9A 1GFDA 2DEUA 5FRMA 1MMDA 2VVKA 2EPDA 1TU0B 4FSSA 3CC2T 4O5VA 3REBB 2KEAA 2LJ1A 2XKOC 1PM3A 5M9OA 4C92D 1K4US 1GBRA 3CCST 4ZGJB 4M75C 4E7LA 1T3SA 3A5ZB 2YUPA 1M2VA 4LNPA 4Q5WA 4OB3B 1MMNA 4NL2A 2RHUA 2X3XD 3NFCA 1Q7YU 2EGCA 4EMKA 4A4KA 5CIUA 1M1FA 3CBOA 1NEBA 1B3QA 1OPLA 2XDPA 3QKJA 4C92A 2QQBA 3M56A 4CC4B 5GAN3 2HBWA 1RL2A 1WIEA 3AHUA 1YCYA 2XD0A 1D3BA 1ABQA 5HKCA 5HY6A 4M7AE 2JN0A 2D0NA 2DVEA 4M75F 3BDUA 1JBMA 3NPFA 3URGA 4WF2A 4E47A 3C0CA 4JJCA 3E19A 3CCQA 2E70A 3M4GA 2YXYA 2DIQA 2FPFA 1VIEA 3PMTA 4WTOB 3I5SA 1CKAA 2PVOB 1X27A 3GOXA 2V8JA 2C06A 2VUBA 4F7UG 1FX7A 1YITA 4AFQC 2KAFA 5J39A 2DA9A 2QGFB 4KUIA 3OY9A 4CC7A 2E12A 4C8QE 3CMEA 5IHKA 4DQ2A 3INZA 2PVGB 2QA4T 2DTHA 1RAFB 2OTJA 1AZGB 1B34A 3M0RA 3EGDB 1SHGA 1K76A 1K9MU 3JCMW 1G2BA 3LX7A 5A0LA 2JTFA 4BDZA 3TQ7P 1KQ2A 4F17A 2G3RA 1RADB 2X4YA 3QJ6A 3OYEA 1VQLQ 4Z02A 1PD1A 2JMAA 1LVKA 4PJMA 4M7DB 4UC4A 3M0SA 2A08A 2BIVA 1VQNT 5GAOr 1WLPB 3OYJA 5GMKj 4KULA 1M2VB 3VYGA 1YJWA 1LPLA 4PNOA 4M77C 4E7SA 4OP0A 2C0OA 2QYZA 4XTYA 4J9DA 4AG2C 1U1SA 4RMOA 3A8OB 4OMNA 4X1VA 3M54A 2XDDA 4FCYA 5FRNA 2VWFA 2OTLQ 4BUGA 3C95A 4ME7A 3UA7A 1BIBA 2FRYA 3KUFA 1Q7YC 3RMQA 1X2KA 4HCBA 4BB7A 3H9NA 1PRMC 1SEMA 3O5ZA 4B9WA 3A1PA 2JZ2A 1U3OA 2DEQA 1UHFA 2DD4A 3OS1A 2PU9B 4FIBA 1W2BA 4RCBA 1TSFA 3J7AF 3A8HB 1SRLA 2LT4A 2WACA 1YJNT 3BDLA 1W6XA 1BU1A 1PWTA 4J9EA 3R6NA 4M78G 2H3JA 3EFOB 3OYMA 3EHQA 4A63B 3CCVA 2NUTB 4RG2A 4J9IA 3CCLT 3OYYA 1PKSA 1WHKA 1ZHIA 1VOMA 4QVDA 1BI0A 1V29B 1U06A 3CCUA 4ZTFA 7AT1B 1D0XA 1YITQ 1M27C 3M5AA 2DZ9A 4IUPA 2O9SA 2RQVA 4ZNXA 3RDVA 2QEXA 4A53A 1H641 4C92G 5EG2A 2VASA 2DPPB 1KK7A 2FG0A 3JSCA 4QW2A 2A7YA 2EWNA 1AD5A 1LCKA 2K5FA 2LVMA 4J83A 5LJ3f 3RMSA 2BZYA 5GAOm 1XQHA 4LXCA 4C5GA 1OEBA 1M8VA 2DIGA 1D1BA 2JTEA 2D8HA 2GQVA 1KD1U 3EG9B 5FU6B 3I56A 2X35A 1YJ9T 4M78B 4C92B 1YHQT 5D6YA 5IT9E 4FYYB 1I1JA 3JCMc 3CC7A 1N9RA 3S3NA 1JXOA 2KXCA 2QQSA 2YRDA 4A4FA 3CBMA 3MPUB 3M0PA 2LJ3A 3L42A 3HRSA 5GMKl 2L3QA 5GAN4 3G71T 4AMCA 2L5QA 2O4XB 3ZEHA 4A54A 4PLIA 4M77G 3LWHA 5LJ5g 1ZBXA 1OPKA 2MYSA 3GP8A 4V2SA 2RPNA 1WHMA 4MDXA 2I0NA 1QLYA 1TG0A 1NJIC 1Y0MA 4BD3A 1M1GA 2DF6A 3I5RA 5GAN7 4E7IA 2PVDB 2L8DA 4PJOD 4WCIA 3SWNC 2BE9B 4OGEA 1MNDA 1PC0A 2RJCA 3F70A 1WX6A 5KYYA 4JRQA 2JTMA 4JS4A 4OVAA 2A28A 2DLPA 1X6GA 1H92A 3L1AA 3VU3C 3HL8A 4C92C 1Y71A 4D8DA 1BB9A 2KT8A 1JO8A 1JQQA 3MEVA 3V7RA 1AVZC 2K3YA 3MCAB 1N27A 4M7DA 4DBRA 4PJLA 3S6WA 2JMCA 1WJRA 3A98A 2JNGA 3A8LB 3M4YA 1QCNA 3ZFJA 2DBKA 4M7AA 5AT1B 1C6VX 1WQ7A 3QPHA 1QCFA 1ZSZC 1OU8A 1MV3A 4Y28E 4PJOF 3CPWS 3ULRB 5GAMe 2NUTA 4M7DC 1BI1A 1ZUYA 3G71Q 4C0GA 2DZCA 1M3CA 4HKEA 3L2UA 4L6V5 1Z9QA 2L3RA 4ORZA 4RTZA 2CT3A 1QCOA 4C5EA 3VS7A 2QASA 4E2FB 1YI2A 4OB0B 4ELYC 1NZ9A 1HJDA 4GLKA 1VQLA 2QEXT 4BE2A 4HCKA 3JCMP 3JCMh 1K9MC 5FU6C 2OX7A 2WSFE 1E6HA 1NBEB 3PNWC 5KYWA 2XHCA 1VQMT 3H0IA 1RAGB 3X20B 5HK3A 1G3TA 1S1NA 3EFRA 1WPYA 2XI9A 2HKNA 3EHRA 2LRQA 3L2VA 5D7UA 3CMAA 2K7AA 1SHFA 1GFCA 1N6AA 2ED0A 2CZ6B 2Z0WA 3VS4A 2XG8D 2NWMA 4PJOG 1Q81R 1OX8A 3REAB 2O4XA 5HCKA 2C0IA 1VQ7Q 4A4EA 1I5OB 1Q81U 1WHHA 3ZL7C 3L2RA 2ESWA 4OF1A 2CKKA 3MP6A 2PUKB 3C12A 9ATCB 3LLRA 3CCMA 4M77E 5GANd 1TUDA 3CCSQ 2EW3A 4JJNK 3OSVA 4BE0A 1ZLMA 2RM4A 4HCCA 2KRMA 3KFVA 4N0AC 3JCMb 2CYZB 1SPKA 4M75A 2DERA 4JZ3A 1W1FA 2CP0A 3OMGA 1B34B 3CD6T 3WVEB 3FEOA 4LD9K 2G6FX 3X26B 2FL7A 1BYMA 4D6WA 2ENMA 3GBQA 2NUPB 2AT1B 1HYOA 1E6GA 4FYVB 3CD6A 4A4HA 2E5KA 2DXCA 4XAXB 4MDWA 2KY9A 2RQTA 4CRIA 3QHSA 3OS5A 1KC8C 3MKDA 1AWJA 2XU8A 2FB7A 1UG1A 3GNFB 4ZGEB 1K9MR 1WJSA 2JM9A 4JRIA 2LX9A 5KYWB 2FRWA 3QBYA 1PRLC 1PKTA 3SDZA 3X24B 1Q82R 4XQ3A 2X4WA 3HSBA 1UHCA 1ZSZA 2CREA 3QO3A 1YP5A 3QXEB 2K3XA 5AYFA 1N8RU 4PJOA 5KYNA 3CCEQ 2E6ZA 2P0KA 4XU3A 1YWOA 2ZAEA 3G4SA 3SB2A 3LH5A 2RI2A 3PVQA 3FB9A 3VRZA 5FWBA 2RB6A 4M75E 5GAN8 1K8AR 3QDFA 1EFNA 1UEBA 2XICA 3CMET 2QGGA 1YN8A 2HBPA 4BACA 2BZXA 3H0HA 2YUQA 1X69A 2DILA 5GAN5 2EJ9A 1KHIA 1AHJB 2LX7A 1JEGA 1Y96A 4K11A 1VQKT 1W2BP 2YT6A 8ATCB 3JB9H 1KD1C 1VQLT 2WSEE 1VQOQ 3CC7T 3NGPA 1C0MA 3VS6A 1YHQA 3BW1A 3HTRA 3ZBDA 1SG5A 4QQGA 4QQ6A 1KFZA 5L8RE 4N4GA 4QKUA 1AWXA 2B86A 3QYHB 1EIFA 2RHIA 3LH0A 2ZCFB 5LL6S 4C8QG 3E9GA 2CUBA 5A0DA 4BI4A 5J26A 4JLIA 4FL6A 5FU7C 3M9QA 2NLUA 3M0TA 1VQPQ 4BE1A 2COZA 3NTKA 2PTKA 1UUEA 5GAMg 4FT2A 1NJIU 2MK5A 1YWPA 4EMKB 2ZGWA 1D0YA 2VXFA 2GNCA 1QKXA 2F2XA 1W70A 2RJEA 3MEUA 1BI2A 1I07A 2O31A 3NTHA 1YBYA 3HRTA 3EG3A 2V8IA 4C0DB 2QK0A 1KC8U 2E4HA 3UT1A 3M57A 4LUDA 3G6ET 1VQKQ 3H6ZA 1NYGA 3EGUA 2O9VA 1X75C 5IAYA 1R0CB 2FYKA 4OMQA 2YRVA 3RKWA 5GAN2 3CC4A 3I35A 4LDVA 1N8RC 5GAOl 4CI0C 3CCLQ 3LGFA 4OMLA 1MMAA 3CC4T 1OX9A 3OYKA 4M75G 2EBPA 4XTVA 4EDUA 3NMZC 2CZ1B 1NJIR 3P8DA 1U1TA 4LUEA 1Y57A 5J3BA 3TSWA 2HDAA 4MZMA 1MUZA 2DAQA 1RI9A 2RQRA 3SWNA 2A0FB 3VKIA 2DL7A 4C92F 2GTOA 2JOYA 2DBMA 4LDUA 4ZGDB 2DO3A 2WSCE 2HSEB 1TOVA 2KDSA 2QI2A 4C8QF 2DKGA 4JJDA 4KH0B 1R0BG 1X01A 5D6WA 1BKBA 2V26A 4EMGA 1I0CA 1OU9A 2Y4YA 2AK5A 2RQWA 2GGRA 2KK4A 1WJQA 2KE9A 2RHXA 5I22A 4IUTA 1IHVA 1ZUUA 4PK4A 3SEMA 2OI3A 3JCMV 1YJWT 1MHNA 1JJ2A 5IXFA 2GF7A 3OMCA 1VQNA 1G3SA 3EFOA 2W0ZA 4AG1C 4C8QC 3BE3A 1PD0A 4M7DE 3OW2S 5CKDA 3MEAA 1OI1A 3OYLA 3M53A 3QJYA 5IHIA 3OA6A 2HQEA 1Q81C 4DEXA 1UECA 4F04B 3E9FA 4ZN1A 1WA7A 3MHXA 5GAOp 2F2VA 2EVRA 3JCMJ 3L2ZA 1TTHB 3OSSC 4X9DA 5ECAA 4M7DD 2JVVA 1N8RR 2PUOB 4EPCA 2KVQG 5KCOA 4J8OA 5CR2A 1NE8A 1ZBJA 4IUUA 1TS9A 4O6JA 5I2MA 2MPXC 4R0KA 5CO7A 4FYXB 1S72A 1KQSA 1PNJA 2DJZA 3JB9J 1N9SA 3EG1A 4KT0E 3FC3A 1UGRB 2ECZA 3GLXA 1Q86C 1VYVA 2CT4A 4FT4A 2IIMA 4XU1A 3QYGB 1LJOA 1OZ2A 3UATA 4HVVA 1X2QA 1MMGA 1O75A 1SSHA 3EH1A 2V8KA 4YTLA 1AOJA 2CH4W 2DMOA 2D1XA 5HK0A 1F1BB 2VXEA 2P4RA 3M59A 1AEYA 2MCNA 4R56A 2L3PA 5GMKe 3QIIA 2XMFA 2JUFA 3DLLA 1WXTA 1TWBA 1UB4A 5C0MA 1MNEA 1QVFS 1K73U 4RTVA 4E7KA 1GCQC 3M55A 4XTWA 3I55A 1QMCA 2EJGA 3CCSA 2QDYB 2JS0A 3TSZA 2JJ9A 1ZX6A 1UGVA 1U8RA 4J9GA 3FJPA 1WZOA 2RK2A 2P0PA 1N5ZA 1HD3A 1H3ZA 2HSPA 3RNJA 1RAHB 2EJFA 2FEIA 2FO0A 2M02A 3HKSA 1VQMQ 1IGQA 3QDRB 2E3HA 1VQ4T 1PHTA 2QA4A 2DETA 3A8GB 2ZZDA 1G3WA 5A2QE 4CC2A 4RTXA 1WQWA 1QP2A 4C92E 2KR3A 5GAMj 2COYA 2DK3A 1NM7A 4IUQA 1G8XA 3H8ZA 4Y91A 5IHNA 2K79A 3TVTA 2O2OA 4HVUA 2CDTA 3IQLA 4LD6A 5FW9A 2E41A 3QUIA 4PKCC 2J7IA 4HT9A 4ELZC 2EYZA 2EIFA 2HL3A 3J80E 3JV3A 3T9NA 1Y7XA 2MF2A 3MEWA 3VS2A 2CP5A 2COWA 1OQKA 3HFOA 1H3HA 2ZPBB 2RNAA 2W10A 3JCMg 4M7DG 4L59A 4MMKA 3ER0A 2V1QA 3UDCA 1PSFA 2EQJA 4VUBA 1TUGB 2RA2A 4AT1B 5CQXA 1VQNQ 3HP9A 3OYIA 1VYUA 3RR6A 1Q86U 3V8LA 5FLXE 2LCCA 4FU6A 2RQUA 2KQWA 1SF9A 2L0AA 1I81A 3OYFA 2DL4A 2CS7A 4FM4B 4HT8A 4E7HA 1VQ4Q 2JXBA 1AT1B 1VQ9A 2QXFA 3G6EA 3RERA 1JRIA 2YUOA 3M58A 4QVCA 3VUZA 5GMKh 2EKHA 5IH2A 4J7IA 1BI3A 4DEYA 2QTXA 2E65A 2EQIA 1T0JA 3EH2A 1QP3A 2CP7A 2YDLA 3EG2A 2RF0A 1K73C 4M75D 5CVIA 4B6MA 2KSSA 2RMOA 4TVRA 5C6SA 2R5MA 3G4SQ 4PJJA 2QDLA 3OYGA 1BBZA 3X25B 5CK9A 1O9SA 4KH1B 1IRXA 4OMOA 4L5GA 2YWWA 3CCJT 2JW4A 1RUWA 3CC7Q 1WHLA 1OYXA 2IPOB 2M0YA 1VUBA 3CMEQ 2KROA 1J3TA 1WXUA 3CQTA 1TUCA 2LQWA 3V7CA 4JS5A 3E1SA 4ANJA 1WDXA 4JRPA 2LCSA 5KE2A 1X6BA 3G71A 1V76A 1JJ2P 2D6FA 4OMPA 1IB8A 4PL6A 2K9GA 1VQOT 2CP6A 2DM1A 2OAUA 1IGUA 2M0OA 3GIBA 1WYXA 1D1AA 3OBWA 1ZSGA 1I8FA 1GBQA 4QVZA 2CZ7B 2MIOA 1RLQC 5GAMf 2O01E 1BCMA 2E10A 3I56T 2EAYA 4DBQA 5FU7B 4KGXB 3QZ5B 4ATOA 1AZEA 1IZ6A 3CXCS 3GF5A 2QA4Q 2L2PA 2RN8A 1BIAA 2HD0A 5CAIA 2FZGB 1PCXA 3PGGA 5A0GA 1NPRA 2LNVA 4M77B 1S72Q 2M16A 3JCMf 1YCSB 2KMTA 2RJDA 4II1A 4F7UE 1EX4A 1WNLA 1M90R 1WHJA 3VS1A 3CPWA 3TEEA 3V8JA 4OGCA 4Z89A 1X43A 5LJ3h 3CCUT 1D0ZA 4RG8A 1OV3A 2CH4A 3SHWA 1R77A 2D8JA 3CCMQ 1G83A 3C4SA 2RI3A
chains in the Genus database with same CATH topology
4M7AB 4M75G 4PJOB 2D9TA 4XTVA 4EDUA 1P92A 3RESA 2CZ1B 5GAMd 2BUDA 3P8DA 3M5AA 1QVGA 2DZ9A 1U1TA 4IUPA 3CCLA 3FLGA 5J3BA 3MP1A 5DY9A 4MZMA 3WXMB 3LW5E 1WGSA 2DAQA 3I55T 2QEXA 4A53A 1H641 2BKDN 2PQWA 4C92G 5EG2A 4GY5A 2GFUA 1K8AC 1M90U 2DPPB 2HNIA 3SWNA 3VKIA 3HRUA 4J5YA 4IKFA 3JSCA 4QW2A 2A7YA 2EFIA 4C92F 5DLOA 2EWNA 3VUBA 3CCUA 1YITT 2JOYA 2K5FA 1IREB 3KBGA 4LDUA 2EKOA 2LVMA 4X34A 4ZGDB 2DO3A 5GANg 2WSCE 4J83A 5LJ3f 3Q1JA 5CKFA 1SSFA 3RMSA 5GAOm 4C8QF 1D3BB 2KDSA 2QI2A 1XQHA 2RK1A 2DKGA 2ZPHB 3RIRA 4C5GA 5GMKm 3CPFA 1M8VA 2FHDA 2DIGA 1YJNA 3JCMd 1X01A 5D6WA 1Y07A 4BY6C 1BKBA 4C8QB 4EMGA 2LQKA 2GQVA 3DKMA 1QW1A 2IG0A 1KD1U 2Y4YA 5FU6B 2KK4A 3I56A 1WJQA 1KG1A 2X35A 1YJ9T 2RHXA 4M78B 4IUTA 4C92B 2XK0A 3PIPA 3JB9G 1Q82C 3L2QA 1YHQT 1NPPA 5D6YA 3OYAA 5IT9E 3JCMV 3JCMc 4F7UA 2P4TA 3CC7A 1N9RA 1MHNA 3A8MB 1YIJT 3S3NA 1YJWT 4M78D 3BY7A 1JJ2A 2D0QB 2QQSA 4A4FA 2GF7A 3OMCA 1VQNA 1G3SA 3OYCA 3JCMX 2YHTA 3CBMA 5GANe 3CXCA 3L42A 1MGQA 3MO8A 3HRSA 1M5Q1 4XU0A 5CKBA 4C8QC 2Y90A 5GMKl 4M7DE 4M78C 3OYDA 1G5VA 2Y4XA 2K4YA 5GAN4 1LNXA 2EQUA 5LJ5d 3OW2S 3FRNA 4HA8A 5CKDA 3G71T 3MEAA 4C0FA 1OI1A 2L5QA 2O4XB 3ZEHA 4A54A 3OYLA 3M53A 1I4K1 3NTIA 4M77G 1KHCA 4PLIA 5LJ5g 3LWHA 1VIFA 1ZBXA 2LT1A 3ASKA 3QJYA 2LQ8A 4N4IA 3GP8A 3OA6A 2HQEA 3CCMT 4MDXA 3N5BB 4V2SA 1Q81C 1KQSS 4XTZA 3E9FA 4ZN1A 1NJIC 5KCHA 3MHXA 4IUVA 5GAOp 1PSEA 4BD3A 4M7AG 1M1GA 3V7SA 5LJ3e 3JCMJ 1FWZA 4DOVA 3S3OA 5KE3A 3VYHB 3L2ZA 3OSSC 5GAN7 2PVDB 2L8DA 4X9DA 4E7IA 4PJOD 4C8QA 5GANh 3VJPA 3CCRA 2DXUA 4ZTJA 3SWNC 4M7DD 2EQMA 4OGEA 3QSUA 4X9CA 2DXTA 2R5AA 2RH2A 2JVVA 2MWOA 2RJCA 3F70A 4JRQA 1VQ7A 2JTMA 4JS4A 2PUOB 4OVAA 2HQXA 4C5HA 4EPCA 4M7AC 2KVQG 5KCOA 4J8OA 3L1AA 3VU3C 1NE8A 2P0QA 3HL8A 5CR2A 4PJOE 2R58A 4C92C 1Y71A 2DXBA 3JB9F 4IUUA 4LDYA 1VQ5T 4O6JA 3HPWA 5I2MA 3DB3A 3O8VA 2OTJT 1UGQB 5CO7A 2VV5A 3UPUA 1S72A 3TREA 1KQSA 3G7ZA 3MEVA 3V7RA 5I2SA 2K3YA 2DJZA 2EYQA 2K5LA 3MCAB 1N27A 3JB9J 3CMAT 3PMIA 4M7DA 1N9SA 2I2LA 3C94A 3X28B 3S6WA 5GANj 2VGNA 4KT0E 1UGRB 3FC3A 5LJ3g 5CKHA 1WJRA 4M77D 2X4JA 2DTIA 4OMFB 1DJ7B 1Y96B 2JNGA 3PTAA 1XTDA 3A8LB 3MP8A 3GLXA 4BI8B 3M4YA 1Q86C 3ZFJA 4XTUA 4FT4A 3GPLA 4NL3A 4M7AA 5LJ3d 5D6XA 3FIFA 5LJ5f 3ME9A 1YIJA 4XU1A 1VQMA 3QYGB 2RJFA 4XU2A 4BI3A 1LJOA 1OZ2A 1WQ7A 3J81E 3QPHA 2RO0A 4J6YA 1XOVA 4MZPA 3R6OA 1JJ2S 1GXIE 4M7DF 5LJ5h 3EFSA 2RHYA 4Y28E 1O75A 5IN1A 4PJOF 3CPWS 5GAMe 2V8KA 3EAEA 4YTLA 3CCQT 5GAMh 4KUDK 4M7DC 1BI1A 2LTOA 1YI2T 3P8BB 1M90C 1VQOA 2QQRA 3FDRA 5HK0A 5LJ5j 2VXEA 1RI0A 3M59A 3HFNA 4C0GA 2DZCA 4HKEA 3L2UA 4M7AD 1VQ5A 4L6V5 4R56A 1ZQ1A 3CBPA 4RCCA 2L3RA 3LYIA 4DOWA 4M77A 5GMKe 3QIIA 2GFAA 2JUFA 4C5EA 3L2WA 3DLLA 1VQ6A 2QQ9A 4KBMB 3DB4A 4OB0B 1YI2A 2OTLA 5GAOq 1M1KC 4ELYC 2X4XA 1NZ9A 3SWNB 1UB4A 5C0MA 4GLKA 1QVFS 1FXXA 3LWIA 2L89A 1K73U 1R8OB 2MMPA 3BFMA 5GMKi 4IURA 4E7KA 1VQLA 3TCJA 5KH6A 3M55A 2E6NA 4XTWA 3I55A 2QEXT 4BDYA 4BE2A 2MAMA 2QQAA 4OB2B 2EJGA 3CCSA 2QDYB 2AHJB 3OYNA 3JCMP 3JCMh 1K9MC 4HCZA 5FU6C 4M77F 2WSFE 2CGHA 3PNWC 2XHCA 1VQMT 3P8HA 1U8RA 3X20B 3FJPA 2A3LA 5HK3A 1G3TA 3EFRA 4C0DC 3CCVT 2RK2A 1WPYA 2XI9A 5GAOn 2P0PA 2GCXA 2LRQA 3WVDB 3JCMQ 4J7FA 3L2VA 4M7AF 1QVGS 1UGPB 2ZPIB 1H3ZA 3RUXA 2M1HA 2XIDA 5DM7R 2EJFA 2MI6A 3CMAA 3JRZA 3HKSA 1HXDA 3OS2A 4J6XA 2MWPA 1N6AA 3DLMA 3QDRB 4MZTA 3OB9A 4N0AA 2E5QA 1VQ4T 2CZ6B 3JAME 2QA4A 5FRMA 2XG8D 3A8GB 4NOYA 2ZZDA 3VV0A 1G3WA 4XTXA 5A2QE 4M75B 4PJOG 3CCET 1WQWA 3CC2T 4O5VA 2LDMA 2RD1A 3CC2A 2XKOC 2F5KA 2O4XA 4E7JA 1QP2A 4C92E 5M9OA 4A4EA 3CEYA 1VQ9T 1Q81U 4C92D 5GAMj 4PJOC 2DK3A 2IVWA 4IUQA 2E64A 4MMLA 3CCST 4ZGJB 4M75C 3H8ZA 3A5ZB 4Y91A 4E7LA 1VQPA 2F69A 3TU4K 4Q5WA 4OB3B 4NL2A 3L2RA 4LD6A 4OB1B 2E41A 3QUIA 4OF1A 4PKCC 2CKKA 2VGMA 2RHUA 2PUKB 3MP6A 4HT9A 3C12A 4ELZC 2EIFA 2R57A 3LLRA 3J80E 3NFCA 1Q7YU 5FROA 4EMHA 3CCMA 4EMKA 4M77E 5GANd 2K5IA 4A4KA 3T9NA 1Y7XA 5CIUA 1M1FA 4JJNK 2MF2A 3OSVA 3MEWA 3CBOA 4BE0A 4J6WA 2RM4A 3HFOA 4N4HA 2ZPBB 4HCCA 4N0AC 4F7UB 3JCMb 4M78A 4ZTFA 3RKYA 2CYZB 4M75A 3JCMg 3OS0A 4M7DG 1VQ8A 3ER0A 4L59A 2XDPA 3QKJA 4MMKA 3UDCA 2QQBA 1PSFA 2EQJA 3OMGA 4VUBA 4C92A 3M56A 1W2BS 1B34B 5GAN3 3JCMe 2K57A 3CD6T 3WVEB 2RA2A 3FEOA 4LD9K 2YLCA 3X26B 3PT9A 2FL7A 5CQXA 1BYMA 3HP9A 1RL2A 4D6WA 4LDXA 3OYIA 2CZ0B 3AHUA 3CD6A 1YCYA 4A4HA 1VQKA 1X6OA 2DXCA 1Q86U 2XD0A 1D3BA 4XAXB 4MDWA 5HY6A 5HKCA 2KY9A 4CRIA 3V8LA 3OYHA 2JN0A 3QHSA 2DVEA 5FLXE 1I5LA 1VQ8T 4M7AE 4M75F 2LCCA 3OS5A 1M4ZA 1JBMA 3BDUA 4FU6A 3URGA 1KC8C 4WF2A 1YJ9A 2XU8A 4E47A 2KQWA 2FB7A 3GNFB 4C8QD 4ZGEB 1I81A 1WJSA 4JRIA 3E19A 3OYFA 2LX9A 3CCQA 2E70A 3QBYA 3M4GA 2CS7A 2E1HA 4FM4B 3SDZA 3X24B 4HT8A 2DIQA 4XQ3A 3SD4A 1XNIA 3S3MA 1VIEA 2X4WA 3HSBA 4E7HA 4JUVA 3QO3A 4XK8E 3PMTA 3QXEB 2K3XA 5AYFA 1VQ9A 2PVOB 2QXFA 3QZ9B 2LCLA 1JRIA 3M58A 4NS5A 3G6EA 3GOXA 2V8JA 4QVCA 1KQ1A 1VQPT 1N8RU 2C06A 4PJOA 3VUZA 2VUBA 5GMKh 3OBYA 2E6ZA 2P0KA 4XU3A 3CCJA 4JRKA 1G3YA 4F7UG 1FX7A 3G4SA 3SB2A 1YITA 1VQ7T 2KAFA 5J39A 2VC8A 4J7IA 3G4ST 1BI3A 4KUIA 1QVFA 2QTXA 1M9SA 2RI2A 4F7UF 3RERA 2E65A 3OY9A 2E12A 1QP3A 3CCEA 4C0ZA 3CCRT 4C8QE 3FB9A 3CMEA 1VQ4A 1M1KU 2YLBA 4C5IA 1K73C 4DQ2A 3INZA 5CCAA 2B8AA 4M75D 2PVGB 5CVIA 2QA4T 5LJ5e 3GNGA 4ATOA 2RB6A 2DTHA 2RHZA 2KSSA 4M75E 2OTJA 1JB0E 1B34A 4M78E 4EMKC 4TVRA 5GAN8 1K9MU 3JCMW 5C6SA 2R5MA 1K8AU 3KXTA 3OYGA 4P5NA 1UEBA 3LX7A 5A0LA 2XICA 3CMET 2JTFA 4ZN3A 4BDZA 3PIOA 2F5TX 2EQKA 3X25B 2HBPA 5CK9A 4BACA 1KQ2A 1O9SA 2G3RA 2X4YA 3QJ6A 2RI5A 3OYEA 4Z02A 4L5GA 5GAN5 3SFMA 5DLQE 3CCJT 2EJ9A 1KHIA 1OYXA 1AHJB 1Y96A 1VQKT 4M7DB 4UC4A 1VUBA 3LGLA 3JB9D 1OZ3A 4BY6B 2BIVA 1W4SA 3JB9H 1VQNT 1KD1C 4FSXA 4QQDA 5GANf 5GAOr 1VQLT 3OYJA 5GMKj 1UGSB 4KULA 5GAN6 1HK9A 2WSEE 3VYGA 5I21A 1YJWA 3CC7T 3META 2ZPEB 3V7CA 4JS5A 3E1SA 1Q82U 2OTLT 1YHQA 4PNOA 4JRPA 3BW1A 5KE2A 1VQ6T 2LC4A 4M77C 2M9UA 4OP0A 2DTOA 3G71A 3ZBDA 4QQGA 4XTYA 4JDSA 2D6FA 1U1SA 4QQ6A 4RMOA 3RKXA 3A8OB 2HAXA 3M54A 4PL6A 2XDDA 5L8RE 4N4GA 1VQOT 3QYHB 1EIFA 2RHIA 3LH0A 2ZCFB 3PFSA 5LL6S 4C8QG 3E9GA 2OAUA 5FRNA 4BUGA 3C95A 5A0DA 4BI4A 4ME7A 2M0OA 5J26A 1BIBA 3GIBA 3KUFA 3OBWA 4JLIA 1Q7YC 4FL6A 1LOJA 5FU7C 3M9QA 3RMQA 1I8FA 2NLUA 4HCBA 4QVZA 4BB7A 2CZ7B 4BE1A 3NTKA 3V8KA 4B9WA 5GAMf 2O01E 5LJ3j 1TH7A 5GAMg 2E10A 2JZ2A 3I56T 2ZPFB 2EAYA 2DEQA 2DD4A 1W2BA 3OS1A 2PU9B 4FIBA 4FT2A 5FU7B 4RCBA 1NJIU 4EMKB 3J7AF 3A8HB 3QZ5B 2ZGWA 3HHTB 2LT4A 4M78F 2VXFA 2WACA 1YJNT 1IZ6A 3CXCS 3QG1A 3GF5A 1S72T 3BDLA 4LDWA 2RJEA 3MEUA 4M78G 1BI2A 2ZPGB 2H3JA 1BIAA 3OW2A 2HD0A 5CAIA 3OYMA 3NTHA 1YBYA 4RKUE 3HRTA 3PGGA 2DD5A 5A0GA 3UWNA 2V8IA 4C0DB 1NPRA 1KC8U 2LNVA 4M77B 2K2VA 2M16A 3JCMf 3CCVA 2FVUA 3UT1A 3M57A 2KMTA 2RJDA 4R55A 4II1A 4F7UE 1WNLA 4RG2A 4A4GA 3G6ET 3H6ZA 3CCLT 2VYTA 1QVPA 1X75C 5IAYA 3OYYA 3CPWA 3TEEA 3V8JA 4OGCA 3JB9I 4DA4A 4JLGA 2FYKA 3RKWA 2YRVA 5LJ3h 1ZHIA 5GAN2 3CCUT 3CC4A 5CQYA 4QVDA 4RG8A 3OQ5A 4LDVA 4B9XA 3OYBA 1N8RC 2XDBA 4PLLA 1BI0A 5GAOl 1V29B 4CI0C 3LGFA 3C4SA 3CC4T 5CKEA 2RI3A 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  5GAN 5;  4C92 D;  5GAM j;  4PJO C;  4M75 G;  4PJO B;  2EJ9 A;  2E64 A;  4MML A;  4XTV A;  4M75 C;  4Y91 A;  1Y96 A;  3RES A;  4M7D B;  5GAM d;  2DZ9 A;  1U1T A;  4NL2 A;  3JB9 D;  3V7R A;  2DJZ A;  2E41 A;  3QUI A;  5DY9 A;  3JB9 J;  4M7D A;  3JB9 H;  4HT9 A;  1N9S A;  2I2L A;  5GAN j;  5GAN f;  4A53 A;  1H64 1;  4C92 G;  5LJ3 g;  5GAO r;  5GMK j;  4M77 D;  2DTI A;  4EMH A;  1HK9 A;  1Y96 B;  5GAN 6;  2HNI A;  3SWN A;  4EMK A;  4J5Y A;  4M77 E;  5GAN d;  5I21 A;  4XTU A;  3V7C A;  4C92 F;  2EWN A;  4NL3 A;  4PNO A;  4M7A A;  4J6W A;  5LJ3 d;  2RM4 A;  3HFO A;  3BW1 A;  4M77 C;  3FIF A;  5LJ5 f;  4N0A C;  4XU1 A;  4F7U B;  3JCM b;  4M78 A;  5GAN g;  4OP0 A;  2DTO A;  3RKY A;  5LJ3 f;  4M75 A;  3JCM g;  4M7D G;  4XU2 A;  4MMK A;  1LJO A;  4XTY A;  5GAO m;  4C8Q F;  1D3B B;  4C92 A;  1WQ7 A;  2DKG A;  1U1S A;  3RKX A;  3RIR A;  1B34 B;  5GMK m;  4J6Y A;  5GAN 3;  3JCM e;  2K57 A;  1M8V A;  4M7D F;  2RA2 A;  3JCM d;  4C8Q G;  1X01 A;  2YLC A;  3EFS A;  5LJ5 h;  4C8Q B;  4PJO F;  4EMG A;  5GAM e;  5GAM h;  4M7D C;  1BIB A;  3GIB A;  4JLI A;  3AHU A;  1LOJ A;  1YCY A;  5LJ5 j;  2VXE A;  1I8F A;  3HFN A;  4M78 B;  2DZC A;  4M7A D;  1D3B A;  4C92 B;  1I5L A;  3JB9 G;  3V8L A;  4M7A E;  2JN0 A;  3QHS A;  2DVE A;  4RCC A;  4M75 F;  3JCM V;  3JCM c;  3BDU A;  1JBM A;  3V8K A;  4F7U A;  5GAM f;  5LJ3 j;  1N9R A;  4M77 A;  1TH7 A;  4WF2 A;  5GMK e;  2E10 A;  5GAM g;  4M78 D;  3BY7 A;  2FB7 A;  2EAY A;  2DEQ A;  4C8Q D;  1I81 A;  5GAO q;  4JRI A;  4RCB A;  3SWN B;  4EMK B;  3JCM X;  2YHT A;  2ZGW A;  5GAN e;  3M4G A;  2E1H A;  5GMK i;  3BFM A;  4M78 F;  2VXF A;  4HT8 A;  4XQ3 A;  1MGQ A;  4XTW A;  4XU0 A;  1M5Q 1;  4C8Q C;  3HSB A;  2Y90 A;  5GMK l;  4M7D E;  4M78 C;  2EJG A;  4JUV A;  3QO3 A;  4M78 G;  5GAN 4;  3JCM h;  3JCM P;  1LNX A;  5LJ5 d;  1BIA A;  4M77 F;  4HA8 A;  2CGH A;  3RER A;  1JRI A;  5CAI A;  4QVC A;  1KQ1 A;  4PJO A;  3FJP A;  5GMK h;  4A54 A;  4XU3 A;  3PGG A;  1I4K 1;  4M77 G;  4JRK A;  3EFR A;  4F7U G;  5LJ5 g;  1WPY A;  3SB2 A;  4M77 B;  5GAO n;  4V2S A;  3JCM f;  3JCM Q;  2VC8 A;  4M7A F;  2QTX A;  4F7U F;  4XTZ A;  2E65 A;  3RUX A;  2EJF A;  4F7U E;  4C8Q E;  3FB9 A;  5GAO p;  1WNL A;  4M7A G;  2YLB A;  4DQ2 A;  3INZ A;  3V7S A;  1HXD A;  5LJ3 e;  3JCM J;  4M75 D;  4J6X A;  5GAN 7;  3L2Z A;  5LJ5 e;  2RB6 A;  2DTH A;  4M75 E;  4N0A A;  4X9D A;  4PJO D;  4C8Q A;  1B34 A;  3V8J A;  5GAN h;  4M78 E;  3JB9 I;  2DXU A;  3SWN C;  4EMK C;  5GAN 8;  3QSU A;  4M7D D;  3JCM W;  2FYK A;  4X9C A;  2DXT A;  4NOY A;  3RKW A;  4XTX A;  5LJ3 h;  4M75 B;  4PJO G;  5GAN 2;  4QVD A;  1WQW A;  4M7A C;  2RD1 A;  3L1A A;  3VU3 C;  5GAO l;  1KQ2 A;  4PJO E;  4C92 E;  4C92 C;  3JB9 F; 
#chains in the Genus database with same CATH topology
 1NG2 A;  1HSQ A;  2D9T A;  1ZSZ B;  1P92 A;  1H8K A;  3RES A;  1UE9 A;  3CCL A;  3FLG A;  3MP1 A;  4PFP A;  5DY9 A;  2X3W D;  3LW5 E;  1WGS A;  2PQW A;  1K8A C;  4GY5 A;  1GRI A;  2EFI A;  3H0F A;  3KBG A;  2EKO A;  4X34 A;  3Q1J A;  2CUD A;  2ZPH B;  3RIR A;  5GMK m;  4HXJ A;  1M3B A;  1YJN A;  1Y07 A;  3CMA Q;  1M2O A;  3DKM A;  2HQH A;  2IG0 A;  4ESR A;  2KXD A;  2FZC B;  1KG1 A;  2EGA A;  2XK0 A;  3FJ5 A;  4F7U A;  2P4T A;  3A8M B;  1YIJ T;  2X9H A;  3BY7 A;  3EGX B;  2MOX A;  3OYC A;  1NLP C;  2YHT A;  4IIO A;  1K1Z A;  3CXC A;  1D09 B;  5CKB A;  4XU0 A;  2Y90 A;  4M78 C;  3OYD A;  1G5V A;  2H3E B;  2Y4X A;  1YJW Q;  2K4Y A;  4EIK A;  2VB6 A;  1LNX A;  1ZA2 B;  2JT4 A;  2HKQ B;  4LE9 A;  3CCU Q;  2DNU A;  2DRM A;  1EZZ B;  3NTI A;  1I4K 1;  2LT1 A;  3CCM T;  1KQS S;  4XTZ A;  4E6R A;  2J6O A;  2EGE A;  5LJ3 e;  3V7S A;  1FMV A;  1FWZ A;  3S3O A;  5KE3 A;  3VYH B;  5GAN h;  3CCR A;  1ZUK A;  2DXU A;  4PFZ A;  4JJB A;  2EQM A;  4X9C A;  2DVJ A;  3AT1 B;  1VQ7 A;  4C5H A;  5EC7 A;  4M7A C;  1TXQ A;  2P0Q A;  2DX1 A;  1IHW A;  2KYB A;  4RUG A;  3HPW A;  3DB3 A;  2OTJ T;  1UGQ B;  1T3L A;  2VV5 A;  5I2S A;  2K5L A;  2BZ8 A;  3CMA T;  2X51 A;  3C94 A;  3CPW P;  5GAN j;  1GL5 A;  5LJ3 g;  2ABL A;  3MP8 A;  1VQ5 Q;  1YJ9 Q;  2J05 A;  3PVL A;  2GQI A;  4LN2 A;  1RAE B;  2M51 A;  5LJ3 d;  5D6X A;  5LJ5 f;  1VQM A;  3ME9 A;  1YIJ A;  2SEM A;  1VQ9 Q;  6AT1 B;  4BI3 A;  2AKK A;  1XOV A;  4MZP A;  1B7T A;  1JJ2 S;  3EG9 A;  3EAE A;  3CCQ T;  2OJ2 A;  2DJQ A;  1YI2 T;  1UTI A;  2J6F A;  1M90 C;  1OUL A;  2L3S A;  2QQR A;  3FDR A;  3HFN A;  2DE0 X;  1Q7Y R;  3CBP A;  4RCC A;  3LYI A;  3MJX A;  1UDL A;  4M77 A;  2DYI A;  2GFA A;  3L2W A;  1VQ6 A;  2QQ9 A;  4KBM B;  3DB4 A;  3VS5 A;  2OTL A;  1K9A A;  1M1K C;  1M8M A;  3SWN B;  4PJN A;  1FXX A;  1M30 A;  3LWI A;  2L89 A;  1R8O B;  4IUR A;  3TCJ A;  2E6N A;  1OOT A;  2MAM A;  4OB2 B;  2DL8 A;  2AHJ B;  2K3B A;  2KGT A;  4M77 F;  4F16 A;  1RAA B;  4DBH A;  4C0D C;  1K0X A;  3JCM Q;  3WVD B;  1UGP B;  2XID A;  2MI6 A;  3CC2 Q;  2AIR B;  2OTJ Q;  1HXD A;  1RAB B;  2K6D A;  3OS2 A;  1IXD A;  4J6X A;  2MWP A;  1UFF A;  2P84 A;  4N0A A;  3CCV Q;  2E5Q A;  3EG0 A;  2LJ0 A;  3JAM E;  1ACM B;  4NOY A;  3VV0 A;  1QWF A;  4XTX A;  4M75 B;  4AFZ C;  3CCE T;  2CSQ A;  2LDM A;  2RD1 A;  4Y92 A;  3CC2 A;  2F5K A;  4E7J A;  3CEY A;  2H8H A;  1VQ9 T;  4PJO C;  2IVW A;  2E64 A;  4MML A;  1VQP A;  2F69 A;  3TU4 K;  1KC8 R;  4Z88 A;  4OB1 B;  2VGM A;  4GLM A;  1RAC B;  2R57 A;  2HZY A;  5FRO A;  4EMH A;  1GCP A;  2GBQ A;  2K5I A;  1MV0 B;  4J6W A;  4AFU C;  4N4H A;  4M4Z A;  2AKL A;  2FPD A;  4F7U B;  2C0T A;  4M78 A;  3RKY A;  3OS0 A;  2LMJ A;  1VQ8 A;  3QWX X;  2PNI A;  1W2B S;  2NUZ A;  5IXB A;  3JCM e;  1NYF A;  2K57 A;  3PE0 A;  4IIM A;  2YSQ A;  2YLC A;  3PT9 A;  5GJW B;  2QEX Q;  2JS2 A;  5KYX A;  2CZ0 B;  3VS0 A;  2HL5 C;  1VQK A;  2KRS A;  1X6O A;  3OYH A;  1I5L A;  1ARK A;  1VQ8 T;  1VQ6 Q;  4RTT A;  1M4Z A;  2BTT A;  1YJ9 A;  1BK2 A;  4C8Q D;  2LNH B;  2FPE A;  1CSK A;  2E1H A;  2HCK A;  3QWY A;  3SD4 A;  1XNI A;  3S3M A;  4JUV A;  4XK8 E;  3QZ9 B;  4NS5 A;  2LCL A;  4LDX A;  1KQ1 A;  1VQP T;  3OBY A;  3CCJ A;  4JRK A;  1G3Y A;  1VQ7 T;  2BE7 D;  4J9F A;  2OAW A;  1FMW A;  2VC8 A;  3G4S T;  1QVF A;  1VA7 A;  1M9S A;  4F7U F;  3M0Q A;  3CCR T;  3RBB B;  4C0Z A;  3CCE A;  1M1K U;  1VQ4 A;  2YLB A;  4C5I A;  5CCA A;  2B8A A;  4KGV B;  5LJ5 e;  3GNG A;  5KYX B;  2RHZ A;  1JB0 E;  4M78 E;  3CCJ Q;  4EMK C;  1K8A U;  3KXT A;  4P5N A;  4ZN3 A;  2KT1 A;  3PIO A;  2F5T X;  2EQK A;  1Q86 R;  2RI5 A;  1XJW B;  2A36 A;  3SFM A;  5DLQ E;  2VKN A;  2PZ1 A;  3UA6 A;  3LGL A;  3JB9 D;  3CD6 Q;  1OZ3 A;  4BY6 B;  4AFS C;  1W4S A;  2DL5 A;  3NHN A;  2DFU A;  4FSX A;  4QQD A;  5GAN f;  5FWC A;  1UGS B;  5GAN 6;  1HK9 A;  1WFW A;  5I21 A;  3MET A;  2ZPE B;  1Q82 U;  2OTL T;  2KRN A;  1VQ8 Q;  1VQ6 T;  2LC4 A;  2M9U A;  3CC4 Q;  2DTO A;  5L23 A;  4JDS A;  3RKX A;  2HAX A;  5KYU A;  2DL3 A;  2NUP A;  1GCQ A;  3PFS A;  2ED1 A;  3I56 Q;  4F14 A;  3I55 Q;  1JXM A;  1LOJ A;  3M0U A;  1ZA1 B;  2YRC A;  4J9B A;  2AZS A;  3V8K A;  2EYW A;  3THK A;  5LJ3 j;  1TH7 A;  1RLP C;  2ZPF B;  4FW1 A;  2ROT A;  3CCR Q;  3HHT B;  4M78 F;  3QG1 A;  1S72 T;  2QTV A;  4LDW A;  1QQJ A;  2ZPG B;  3OW2 A;  3EGX A;  1WI7 A;  4DBF A;  4QT7 A;  3E2U A;  4RKU E;  2DD5 A;  3UWN A;  2K2V A;  1YJN Q;  1QWE A;  2FVU A;  4D8K A;  1T0H A;  4R55 A;  4A4G A;  2O88 A;  3CXC P;  4Z8A A;  3EGD A;  2VYT A;  2KYM A;  1K73 R;  2JM8 A;  1QVP A;  4DA4 A;  1C1A A;  4PFO A;  3JB9 I;  3U23 A;  4JLG A;  5CQY A;  4J9C A;  4B9X A;  3OQ5 A;  3OYB A;  2EYY A;  2XDB A;  4PLL A;  4FYW B;  4KRT A;  5I11 A;  5CKE A;  4M7A B;  2QAZ A;  4PJO B;  5GAM d;  2BUD A;  4OMM A;  1QVG A;  2CSI A;  1KJW A;  3WXM B;  2J6K A;  2F2W A;  2KBT A;  4GBQ A;  3I55 T;  2BKD N;  2A37 A;  1M90 U;  2GFU A;  1KQS P;  2HNI A;  1E7O A;  3HRU A;  1Q95 G;  1PG5 B;  4J5Y A;  4IKF A;  5DLO A;  1YIT T;  3VUB A;  2DYB A;  1IRE B;  5GAN g;  5CKF A;  1SSF A;  1D3B B;  2J06 A;  2RK1 A;  5KYY B;  3CPF A;  3D7S B;  2FHD A;  1WHG A;  3JCM d;  1ABO A;  4BY6 C;  2FZK B;  4C8Q B;  2LQK A;  5KYU B;  1QW1 A;  1K0S A;  1QVF P;  4RTU A;  3VRY A;  1D1C A;  3G1J A;  3PIP A;  3JB9 G;  1Q82 C;  2LZ6 B;  3L2Q A;  1NPP A;  3OYA A;  2F1L A;  1JU5 C;  3VS3 A;  1UJY A;  4M78 D;  2E3I A;  2D0Q B;  3JCM X;  1Z9Z A;  5GAN e;  3G6E Q;  2ROL A;  2LQN A;  1MGQ A;  3MO8 A;  1M5Q 1;  1YHQ Q;  1YIJ Q;  5LJ5 d;  1FYN A;  2EQU A;  3FRN A;  3UF4 A;  4HA8 A;  4C0F A;  4E7Z A;  2QG9 B;  1AWW A;  1KHC A;  1VIF A;  3ASK A;  2LQ8 A;  4N4I A;  3N5B B;  1WXB A;  5KCH A;  1AWO A;  4IUV A;  4M7A G;  1PSE A;  1M1K R;  2CP2 A;  4DOV A;  1M3A A;  4C8Q A;  3VJP A;  4ZTJ A;  2HMA A;  1RAI B;  3QSU A;  2DXT A;  2R5A A;  1BCO A;  2KI7 A;  2MWO A;  2RH2 A;  5GJV B;  1KSW A;  2AZV A;  2K2M A;  2HQX A;  2CP3 A;  4PJO E;  2R58 A;  4FW2 A;  2DXB A;  2DRK A;  3JB9 F;  4LDY A;  1VQ5 T;  1UJ0 A;  3O8V A;  1A0N B;  3UPU A;  3TRE A;  3G7Z A;  2EYX A;  2EYQ A;  4JZ4 A;  1IO6 A;  3PMI A;  2I2L A;  3X28 B;  2SRC A;  4J9H A;  2VGN A;  5CKH A;  4M77 D;  2X4J A;  2DTI A;  1QVG P;  4OMF B;  1DJ7 B;  1Y96 B;  2LP5 A;  3PTA A;  1XTD A;  4BI8 B;  4KGZ B;  4CC3 A;  2YUN A;  4XTU A;  3GPL A;  4NL3 A;  3H41 A;  3CCQ Q;  1YFN A;  3FIF A;  2RJF A;  1YI2 Q;  1FMK A;  4XU2 A;  1U5S A;  3J81 E;  2RO0 A;  4J6Y A;  3R6O A;  1GXI E;  4M7D F;  3OW2 P;  5LJ5 h;  3EFS A;  2RHY A;  5IN1 A;  4KUD K;  5GAM h;  2LTO A;  1B07 A;  3P8B B;  2KNB B;  1VQO A;  1KD1 R;  1SKU B;  5LJ5 j;  1RI0 A;  4M7A D;  2HEQ A;  1VQ5 A;  1YNZ A;  1ZQ1 A;  4DOW A;  4RTY A;  5GAO q;  4JPB W;  2X4X A;  5GMK i;  2MMP A;  3BFM A;  5KH6 A;  4BDY A;  1KIK A;  1NEG A;  2V1R A;  2QQA A;  1CKB A;  3OYN A;  1V1C A;  4HCZ A;  2CGH A;  1VYT A;  4HVW A;  3P8H A;  2A3L A;  8AT1 B;  3CCV T;  5GAO n;  2GCX A;  4M7A F;  4J7F A;  4RTW A;  1QVG S;  2NYS A;  1NLO C;  2ZPI B;  3RUX A;  2M1H A;  1QKW A;  5DM7 R;  3I9Q A;  3JRZ A;  2GTJ A;  2ATC B;  3DLM A;  4MZT A;  1SRM A;  3OB9 A;  1GFD A;  2DEU A;  5FRM A;  1MMD A;  2VVK A;  2EPD A;  1TU0 B;  4FSS A;  3CC2 T;  4O5V A;  3REB B;  2KEA A;  2LJ1 A;  2XKO C;  1PM3 A;  5M9O A;  4C92 D;  1K4U S;  1GBR A;  3CCS T;  4ZGJ B;  4M75 C;  4E7L A;  1T3S A;  3A5Z B;  2YUP A;  1M2V A;  4LNP A;  4Q5W A;  4OB3 B;  1MMN A;  4NL2 A;  2RHU A;  2X3X D;  3NFC A;  1Q7Y U;  2EGC A;  4EMK A;  4A4K A;  5CIU A;  1M1F A;  3CBO A;  1NEB A;  1B3Q A;  1OPL A;  2XDP A;  3QKJ A;  4C92 A;  2QQB A;  3M56 A;  4CC4 B;  5GAN 3;  2HBW A;  1RL2 A;  1WIE A;  3AHU A;  1YCY A;  2XD0 A;  1D3B A;  1ABQ A;  5HKC A;  5HY6 A;  4M7A E;  2JN0 A;  2D0N A;  2DVE A;  4M75 F;  3BDU A;  1JBM A;  3NPF A;  3URG A;  4WF2 A;  4E47 A;  3C0C A;  4JJC A;  3E19 A;  3CCQ A;  2E70 A;  3M4G A;  2YXY A;  2DIQ A;  2FPF A;  1VIE A;  3PMT A;  4WTO B;  3I5S A;  1CKA A;  2PVO B;  1X27 A;  3GOX A;  2V8J A;  2C06 A;  2VUB A;  4F7U G;  1FX7 A;  1YIT A;  4AFQ C;  2KAF A;  5J39 A;  2DA9 A;  2QGF B;  4KUI A;  3OY9 A;  4CC7 A;  2E12 A;  4C8Q E;  3CME A;  5IHK A;  4DQ2 A;  3INZ A;  2PVG B;  2QA4 T;  2DTH A;  1RAF B;  2OTJ A;  1AZG B;  1B34 A;  3M0R A;  3EGD B;  1SHG A;  1K76 A;  1K9M U;  3JCM W;  1G2B A;  3LX7 A;  5A0L A;  2JTF A;  4BDZ A;  3TQ7 P;  1KQ2 A;  4F17 A;  2G3R A;  1RAD B;  2X4Y A;  3QJ6 A;  3OYE A;  1VQL Q;  4Z02 A;  1PD1 A;  2JMA A;  1LVK A;  4PJM A;  4M7D B;  4UC4 A;  3M0S A;  2A08 A;  2BIV A;  1VQN T;  5GAO r;  1WLP B;  3OYJ A;  5GMK j;  4KUL A;  1M2V B;  3VYG A;  1YJW A;  1LPL A;  4PNO A;  4M77 C;  4E7S A;  4OP0 A;  2C0O A;  2QYZ A;  4XTY A;  4J9D A;  4AG2 C;  1U1S A;  4RMO A;  3A8O B;  4OMN A;  4X1V A;  3M54 A;  2XDD A;  4FCY A;  5FRN A;  2VWF A;  2OTL Q;  4BUG A;  3C95 A;  4ME7 A;  3UA7 A;  1BIB A;  2FRY A;  3KUF A;  1Q7Y C;  3RMQ A;  1X2K A;  4HCB A;  4BB7 A;  3H9N A;  1PRM C;  1SEM A;  3O5Z A;  4B9W A;  3A1P A;  2JZ2 A;  1U3O A;  2DEQ A;  1UHF A;  2DD4 A;  3OS1 A;  2PU9 B;  4FIB A;  1W2B A;  4RCB A;  1TSF A;  3J7A F;  3A8H B;  1SRL A;  2LT4 A;  2WAC A;  1YJN T;  3BDL A;  1W6X A;  1BU1 A;  1PWT A;  4J9E A;  3R6N A;  4M78 G;  2H3J A;  3EFO B;  3OYM A;  3EHQ A;  4A63 B;  3CCV A;  2NUT B;  4RG2 A;  4J9I A;  3CCL T;  3OYY A;  1PKS A;  1WHK A;  1ZHI A;  1VOM A;  4QVD A;  1BI0 A;  1V29 B;  1U06 A;  3CCU A;  4ZTF A;  7AT1 B;  1D0X A;  1YIT Q;  1M27 C;  3M5A A;  2DZ9 A;  4IUP A;  2O9S A;  2RQV A;  4ZNX A;  3RDV A;  2QEX A;  4A53 A;  1H64 1;  4C92 G;  5EG2 A;  2VAS A;  2DPP B;  1KK7 A;  2FG0 A;  3JSC A;  4QW2 A;  2A7Y A;  2EWN A;  1AD5 A;  1LCK A;  2K5F A;  2LVM A;  4J83 A;  5LJ3 f;  3RMS A;  2BZY A;  5GAO m;  1XQH A;  4LXC A;  4C5G A;  1OEB A;  1M8V A;  2DIG A;  1D1B A;  2JTE A;  2D8H A;  2GQV A;  1KD1 U;  3EG9 B;  5FU6 B;  3I56 A;  2X35 A;  1YJ9 T;  4M78 B;  4C92 B;  1YHQ T;  5D6Y A;  5IT9 E;  4FYY B;  1I1J A;  3JCM c;  3CC7 A;  1N9R A;  3S3N A;  1JXO A;  2KXC A;  2QQS A;  2YRD A;  4A4F A;  3CBM A;  3MPU B;  3M0P A;  2LJ3 A;  3L42 A;  3HRS A;  5GMK l;  2L3Q A;  5GAN 4;  3G71 T;  4AMC A;  2L5Q A;  2O4X B;  3ZEH A;  4A54 A;  4PLI A;  4M77 G;  3LWH A;  5LJ5 g;  1ZBX A;  1OPK A;  2MYS A;  3GP8 A;  4V2S A;  2RPN A;  1WHM A;  4MDX A;  2I0N A;  1QLY A;  1TG0 A;  1NJI C;  1Y0M A;  4BD3 A;  1M1G A;  2DF6 A;  3I5R A;  5GAN 7;  4E7I A;  2PVD B;  2L8D A;  4PJO D;  4WCI A;  3SWN C;  2BE9 B;  4OGE A;  1MND A;  1PC0 A;  2RJC A;  3F70 A;  1WX6 A;  5KYY A;  4JRQ A;  2JTM A;  4JS4 A;  4OVA A;  2A28 A;  2DLP A;  1X6G A;  1H92 A;  3L1A A;  3VU3 C;  3HL8 A;  4C92 C;  1Y71 A;  4D8D A;  1BB9 A;  2KT8 A;  1JO8 A;  1JQQ A;  3MEV A;  3V7R A;  1AVZ C;  2K3Y A;  3MCA B;  1N27 A;  4M7D A;  4DBR A;  4PJL A;  3S6W A;  2JMC A;  1WJR A;  3A98 A;  2JNG A;  3A8L B;  3M4Y A;  1QCN A;  3ZFJ A;  2DBK A;  4M7A A;  5AT1 B;  1C6V X;  1WQ7 A;  3QPH A;  1QCF A;  1ZSZ C;  1OU8 A;  1MV3 A;  4Y28 E;  4PJO F;  3CPW S;  3ULR B;  5GAM e;  2NUT A;  4M7D C;  1BI1 A;  1ZUY A;  3G71 Q;  4C0G A;  2DZC A;  1M3C A;  4HKE A;  3L2U A;  4L6V 5;  1Z9Q A;  2L3R A;  4ORZ A;  4RTZ A;  2CT3 A;  1QCO A;  4C5E A;  3VS7 A;  2QAS A;  4E2F B;  1YI2 A;  4OB0 B;  4ELY C;  1NZ9 A;  1HJD A;  4GLK A;  1VQL A;  2QEX T;  4BE2 A;  4HCK A;  3JCM P;  3JCM h;  1K9M C;  5FU6 C;  2OX7 A;  2WSF E;  1E6H A;  1NBE B;  3PNW C;  5KYW A;  2XHC A;  1VQM T;  3H0I A;  1RAG B;  3X20 B;  5HK3 A;  1G3T A;  1S1N A;  3EFR A;  1WPY A;  2XI9 A;  2HKN A;  3EHR A;  2LRQ A;  3L2V A;  5D7U A;  3CMA A;  2K7A A;  1SHF A;  1GFC A;  1N6A A;  2ED0 A;  2CZ6 B;  2Z0W A;  3VS4 A;  2XG8 D;  2NWM A;  4PJO G;  1Q81 R;  1OX8 A;  3REA B;  2O4X A;  5HCK A;  2C0I A;  1VQ7 Q;  4A4E A;  1I5O B;  1Q81 U;  1WHH A;  3ZL7 C;  3L2R A;  2ESW A;  4OF1 A;  2CKK A;  3MP6 A;  2PUK B;  3C12 A;  9ATC B;  3LLR A;  3CCM A;  4M77 E;  5GAN d;  1TUD A;  3CCS Q;  2EW3 A;  4JJN K;  3OSV A;  4BE0 A;  1ZLM A;  2RM4 A;  4HCC A;  2KRM A;  3KFV A;  4N0A C;  3JCM b;  2CYZ B;  1SPK A;  4M75 A;  2DER A;  4JZ3 A;  1W1F A;  2CP0 A;  3OMG A;  1B34 B;  3CD6 T;  3WVE B;  3FEO A;  4LD9 K;  2G6F X;  3X26 B;  2FL7 A;  1BYM A;  4D6W A;  2ENM A;  3GBQ A;  2NUP B;  2AT1 B;  1HYO A;  1E6G A;  4FYV B;  3CD6 A;  4A4H A;  2E5K A;  2DXC A;  4XAX B;  4MDW A;  2KY9 A;  2RQT A;  4CRI A;  3QHS A;  3OS5 A;  1KC8 C;  3MKD A;  1AWJ A;  2XU8 A;  2FB7 A;  1UG1 A;  3GNF B;  4ZGE B;  1K9M R;  1WJS A;  2JM9 A;  4JRI A;  2LX9 A;  5KYW B;  2FRW A;  3QBY A;  1PRL C;  1PKT A;  3SDZ A;  3X24 B;  1Q82 R;  4XQ3 A;  2X4W A;  3HSB A;  1UHC A;  1ZSZ A;  2CRE A;  3QO3 A;  1YP5 A;  3QXE B;  2K3X A;  5AYF A;  1N8R U;  4PJO A;  5KYN A;  3CCE Q;  2E6Z A;  2P0K A;  4XU3 A;  1YWO A;  2ZAE A;  3G4S A;  3SB2 A;  3LH5 A;  2RI2 A;  3PVQ A;  3FB9 A;  3VRZ A;  5FWB A;  2RB6 A;  4M75 E;  5GAN 8;  1K8A R;  3QDF A;  1EFN A;  1UEB A;  2XIC A;  3CME T;  2QGG A;  1YN8 A;  2HBP A;  4BAC A;  2BZX A;  3H0H A;  2YUQ A;  1X69 A;  2DIL A;  5GAN 5;  2EJ9 A;  1KHI A;  1AHJ B;  2LX7 A;  1JEG A;  1Y96 A;  4K11 A;  1VQK T;  1W2B P;  2YT6 A;  8ATC B;  3JB9 H;  1KD1 C;  1VQL T;  2WSE E;  1VQO Q;  3CC7 T;  3NGP A;  1C0M A;  3VS6 A;  1YHQ A;  3BW1 A;  3HTR A;  3ZBD A;  1SG5 A;  4QQG A;  4QQ6 A;  1KFZ A;  5L8R E;  4N4G A;  4QKU A;  1AWX A;  2B86 A;  3QYH B;  1EIF A;  2RHI A;  3LH0 A;  2ZCF B;  5LL6 S;  4C8Q G;  3E9G A;  2CUB A;  5A0D A;  4BI4 A;  5J26 A;  4JLI A;  4FL6 A;  5FU7 C;  3M9Q A;  2NLU A;  3M0T A;  1VQP Q;  4BE1 A;  2COZ A;  3NTK A;  2PTK A;  1UUE A;  5GAM g;  4FT2 A;  1NJI U;  2MK5 A;  1YWP A;  4EMK B;  2ZGW A;  1D0Y A;  2VXF A;  2GNC A;  1QKX A;  2F2X A;  1W70 A;  2RJE A;  3MEU A;  1BI2 A;  1I07 A;  2O31 A;  3NTH A;  1YBY A;  3HRT A;  3EG3 A;  2V8I A;  4C0D B;  2QK0 A;  1KC8 U;  2E4H A;  3UT1 A;  3M57 A;  4LUD A;  3G6E T;  1VQK Q;  3H6Z A;  1NYG A;  3EGU A;  2O9V A;  1X75 C;  5IAY A;  1R0C B;  2FYK A;  4OMQ A;  2YRV A;  3RKW A;  5GAN 2;  3CC4 A;  3I35 A;  4LDV A;  1N8R C;  5GAO l;  4CI0 C;  3CCL Q;  3LGF A;  4OML A;  1MMA A;  3CC4 T;  1OX9 A;  3OYK A;  4M75 G;  2EBP A;  4XTV A;  4EDU A;  3NMZ C;  2CZ1 B;  1NJI R;  3P8D A;  1U1T A;  4LUE A;  1Y57 A;  5J3B A;  3TSW A;  2HDA A;  4MZM A;  1MUZ A;  2DAQ A;  1RI9 A;  2RQR A;  3SWN A;  2A0F B;  3VKI A;  2DL7 A;  4C92 F;  2GTO A;  2JOY A;  2DBM A;  4LDU A;  4ZGD B;  2DO3 A;  2WSC E;  2HSE B;  1TOV A;  2KDS A;  2QI2 A;  4C8Q F;  2DKG A;  4JJD A;  4KH0 B;  1R0B G;  1X01 A;  5D6W A;  1BKB A;  2V26 A;  4EMG A;  1I0C A;  1OU9 A;  2Y4Y A;  2AK5 A;  2RQW A;  2GGR A;  2KK4 A;  1WJQ A;  2KE9 A;  2RHX A;  5I22 A;  4IUT A;  1IHV A;  1ZUU A;  4PK4 A;  3SEM A;  2OI3 A;  3JCM V;  1YJW T;  1MHN A;  1JJ2 A;  5IXF A;  2GF7 A;  3OMC A;  1VQN A;  1G3S A;  3EFO A;  2W0Z A;  4AG1 C;  4C8Q C;  3BE3 A;  1PD0 A;  4M7D E;  3OW2 S;  5CKD A;  3MEA A;  1OI1 A;  3OYL A;  3M53 A;  3QJY A;  5IHI A;  3OA6 A;  2HQE A;  1Q81 C;  4DEX A;  1UEC A;  4F04 B;  3E9F A;  4ZN1 A;  1WA7 A;  3MHX A;  5GAO p;  2F2V A;  2EVR A;  3JCM J;  3L2Z A;  1TTH B;  3OSS C;  4X9D A;  5ECA A;  4M7D D;  2JVV A;  1N8R R;  2PUO B;  4EPC A;  2KVQ G;  5KCO A;  4J8O A;  5CR2 A;  1NE8 A;  1ZBJ A;  4IUU A;  1TS9 A;  4O6J A;  5I2M A;  2MPX C;  4R0K A;  5CO7 A;  4FYX B;  1S72 A;  1KQS A;  1PNJ A;  2DJZ A;  3JB9 J;  1N9S A;  3EG1 A;  4KT0 E;  3FC3 A;  1UGR B;  2ECZ A;  3GLX A;  1Q86 C;  1VYV A;  2CT4 A;  4FT4 A;  2IIM A;  4XU1 A;  3QYG B;  1LJO A;  1OZ2 A;  3UAT A;  4HVV A;  1X2Q A;  1MMG A;  1O75 A;  1SSH A;  3EH1 A;  2V8K A;  4YTL A;  1AOJ A;  2CH4 W;  2DMO A;  2D1X A;  5HK0 A;  1F1B B;  2VXE A;  2P4R A;  3M59 A;  1AEY A;  2MCN A;  4R56 A;  2L3P A;  5GMK e;  3QII A;  2XMF A;  2JUF A;  3DLL A;  1WXT A;  1TWB A;  1UB4 A;  5C0M A;  1MNE A;  1QVF S;  1K73 U;  4RTV A;  4E7K A;  1GCQ C;  3M55 A;  4XTW A;  3I55 A;  1QMC A;  2EJG A;  3CCS A;  2QDY B;  2JS0 A;  3TSZ A;  2JJ9 A;  1ZX6 A;  1UGV A;  1U8R A;  4J9G A;  3FJP A;  1WZO A;  2RK2 A;  2P0P A;  1N5Z A;  1HD3 A;  1H3Z A;  2HSP A;  3RNJ A;  1RAH B;  2EJF A;  2FEI A;  2FO0 A;  2M02 A;  3HKS A;  1VQM Q;  1IGQ A;  3QDR B;  2E3H A;  1VQ4 T;  1PHT A;  2QA4 A;  2DET A;  3A8G B;  2ZZD A;  1G3W A;  5A2Q E;  4CC2 A;  4RTX A;  1WQW A;  1QP2 A;  4C92 E;  2KR3 A;  5GAM j;  2COY A;  2DK3 A;  1NM7 A;  4IUQ A;  1G8X A;  3H8Z A;  4Y91 A;  5IHN A;  2K79 A;  3TVT A;  2O2O A;  4HVU A;  2CDT A;  3IQL A;  4LD6 A;  5FW9 A;  2E41 A;  3QUI A;  4PKC C;  2J7I A;  4HT9 A;  4ELZ C;  2EYZ A;  2EIF A;  2HL3 A;  3J80 E;  3JV3 A;  3T9N A;  1Y7X A;  2MF2 A;  3MEW A;  3VS2 A;  2CP5 A;  2COW A;  1OQK A;  3HFO A;  1H3H A;  2ZPB B;  2RNA A;  2W10 A;  3JCM g;  4M7D G;  4L59 A;  4MMK A;  3ER0 A;  2V1Q A;  3UDC A;  1PSF A;  2EQJ A;  4VUB A;  1TUG B;  2RA2 A;  4AT1 B;  5CQX A;  1VQN Q;  3HP9 A;  3OYI A;  1VYU A;  3RR6 A;  1Q86 U;  3V8L A;  5FLX E;  2LCC A;  4FU6 A;  2RQU A;  2KQW A;  1SF9 A;  2L0A A;  1I81 A;  3OYF A;  2DL4 A;  2CS7 A;  4FM4 B;  4HT8 A;  4E7H A;  1VQ4 Q;  2JXB A;  1AT1 B;  1VQ9 A;  2QXF A;  3G6E A;  3RER A;  1JRI A;  2YUO A;  3M58 A;  4QVC A;  3VUZ A;  5GMK h;  2EKH A;  5IH2 A;  4J7I A;  1BI3 A;  4DEY A;  2QTX A;  2E65 A;  2EQI A;  1T0J A;  3EH2 A;  1QP3 A;  2CP7 A;  2YDL A;  3EG2 A;  2RF0 A;  1K73 C;  4M75 D;  5CVI A;  4B6M A;  2KSS A;  2RMO A;  4TVR A;  5C6S A;  2R5M A;  3G4S Q;  4PJJ A;  2QDL A;  3OYG A;  1BBZ A;  3X25 B;  5CK9 A;  1O9S A;  4KH1 B;  1IRX A;  4OMO A;  4L5G A;  2YWW A;  3CCJ T;  2JW4 A;  1RUW A;  3CC7 Q;  1WHL A;  1OYX A;  2IPO B;  2M0Y A;  1VUB A;  3CME Q;  2KRO A;  1J3T A;  1WXU A;  3CQT A;  1TUC A;  2LQW A;  3V7C A;  4JS5 A;  3E1S A;  4ANJ A;  1WDX A;  4JRP A;  2LCS A;  5KE2 A;  1X6B A;  3G71 A;  1V76 A;  1JJ2 P;  2D6F A;  4OMP A;  1IB8 A;  4PL6 A;  2K9G A;  1VQO T;  2CP6 A;  2DM1 A;  2OAU A;  1IGU A;  2M0O A;  3GIB A;  1WYX A;  1D1A A;  3OBW A;  1ZSG A;  1I8F A;  1GBQ A;  4QVZ A;  2CZ7 B;  2MIO A;  1RLQ C;  5GAM f;  2O01 E;  1BCM A;  2E10 A;  3I56 T;  2EAY A;  4DBQ A;  5FU7 B;  4KGX B;  3QZ5 B;  4ATO A;  1AZE A;  1IZ6 A;  3CXC S;  3GF5 A;  2QA4 Q;  2L2P A;  2RN8 A;  1BIA A;  2HD0 A;  5CAI A;  2FZG B;  1PCX A;  3PGG A;  5A0G A;  1NPR A;  2LNV A;  4M77 B;  1S72 Q;  2M16 A;  3JCM f;  1YCS B;  2KMT A;  2RJD A;  4II1 A;  4F7U E;  1EX4 A;  1WNL A;  1M90 R;  1WHJ A;  3VS1 A;  3CPW A;  3TEE A;  3V8J A;  4OGC A;  4Z89 A;  1X43 A;  5LJ3 h;  3CCU T;  1D0Z A;  4RG8 A;  1OV3 A;  2CH4 A;  3SHW A;  1R77 A;  2D8J A;  3CCM Q;  1G83 A;  3C4S A;  2RI3 A; 
#chains in the Genus database with same CATH homology
 4M7A B;  4M75 G;  4PJO B;  2D9T A;  4XTV A;  4EDU A;  1P92 A;  3RES A;  2CZ1 B;  5GAM d;  2BUD A;  3P8D A;  3M5A A;  1QVG A;  2DZ9 A;  1U1T A;  4IUP A;  3CCL A;  3FLG A;  5J3B A;  3MP1 A;  5DY9 A;  4MZM A;  3WXM B;  3LW5 E;  1WGS A;  2DAQ A;  3I55 T;  2QEX A;  4A53 A;  1H64 1;  2BKD N;  2PQW A;  4C92 G;  5EG2 A;  4GY5 A;  2GFU A;  1K8A C;  1M90 U;  2DPP B;  2HNI A;  3SWN A;  3VKI A;  3HRU A;  4J5Y A;  4IKF A;  3JSC A;  4QW2 A;  2A7Y A;  2EFI A;  4C92 F;  5DLO A;  2EWN A;  3VUB A;  3CCU A;  1YIT T;  2JOY A;  2K5F A;  1IRE B;  3KBG A;  4LDU A;  2EKO A;  2LVM A;  4X34 A;  4ZGD B;  2DO3 A;  5GAN g;  2WSC E;  4J83 A;  5LJ3 f;  3Q1J A;  5CKF A;  1SSF A;  3RMS A;  5GAO m;  4C8Q F;  1D3B B;  2KDS A;  2QI2 A;  1XQH A;  2RK1 A;  2DKG A;  2ZPH B;  3RIR A;  4C5G A;  5GMK m;  3CPF A;  1M8V A;  2FHD A;  2DIG A;  1YJN A;  3JCM d;  1X01 A;  5D6W A;  1Y07 A;  4BY6 C;  1BKB A;  4C8Q B;  4EMG A;  2LQK A;  2GQV A;  3DKM A;  1QW1 A;  2IG0 A;  1KD1 U;  2Y4Y A;  5FU6 B;  2KK4 A;  3I56 A;  1WJQ A;  1KG1 A;  2X35 A;  1YJ9 T;  2RHX A;  4M78 B;  4IUT A;  4C92 B;  2XK0 A;  3PIP A;  3JB9 G;  1Q82 C;  3L2Q A;  1YHQ T;  1NPP A;  5D6Y A;  3OYA A;  5IT9 E;  3JCM V;  3JCM c;  4F7U A;  2P4T A;  3CC7 A;  1N9R A;  1MHN A;  3A8M B;  1YIJ T;  3S3N A;  1YJW T;  4M78 D;  3BY7 A;  1JJ2 A;  2D0Q B;  2QQS A;  4A4F A;  2GF7 A;  3OMC A;  1VQN A;  1G3S A;  3OYC A;  3JCM X;  2YHT A;  3CBM A;  5GAN e;  3CXC A;  3L42 A;  1MGQ A;  3MO8 A;  3HRS A;  1M5Q 1;  4XU0 A;  5CKB A;  4C8Q C;  2Y90 A;  5GMK l;  4M7D E;  4M78 C;  3OYD A;  1G5V A;  2Y4X A;  2K4Y A;  5GAN 4;  1LNX A;  2EQU A;  5LJ5 d;  3OW2 S;  3FRN A;  4HA8 A;  5CKD A;  3G71 T;  3MEA A;  4C0F A;  1OI1 A;  2L5Q A;  2O4X B;  3ZEH A;  4A54 A;  3OYL A;  3M53 A;  1I4K 1;  3NTI A;  4M77 G;  1KHC A;  4PLI A;  5LJ5 g;  3LWH A;  1VIF A;  1ZBX A;  2LT1 A;  3ASK A;  3QJY A;  2LQ8 A;  4N4I A;  3GP8 A;  3OA6 A;  2HQE A;  3CCM T;  4MDX A;  3N5B B;  4V2S A;  1Q81 C;  1KQS S;  4XTZ A;  3E9F A;  4ZN1 A;  1NJI C;  5KCH A;  3MHX A;  4IUV A;  5GAO p;  1PSE A;  4BD3 A;  4M7A G;  1M1G A;  3V7S A;  5LJ3 e;  3JCM J;  1FWZ A;  4DOV A;  3S3O A;  5KE3 A;  3VYH B;  3L2Z A;  3OSS C;  5GAN 7;  2PVD B;  2L8D A;  4X9D A;  4E7I A;  4PJO D;  4C8Q A;  5GAN h;  3VJP A;  3CCR A;  2DXU A;  4ZTJ A;  3SWN C;  4M7D D;  2EQM A;  4OGE A;  3QSU A;  4X9C A;  2DXT A;  2R5A A;  2RH2 A;  2JVV A;  2MWO A;  2RJC A;  3F70 A;  4JRQ A;  1VQ7 A;  2JTM A;  4JS4 A;  2PUO B;  4OVA A;  2HQX A;  4C5H A;  4EPC A;  4M7A C;  2KVQ G;  5KCO A;  4J8O A;  3L1A A;  3VU3 C;  1NE8 A;  2P0Q A;  3HL8 A;  5CR2 A;  4PJO E;  2R58 A;  4C92 C;  1Y71 A;  2DXB A;  3JB9 F;  4IUU A;  4LDY A;  1VQ5 T;  4O6J A;  3HPW A;  5I2M A;  3DB3 A;  3O8V A;  2OTJ T;  1UGQ B;  5CO7 A;  2VV5 A;  3UPU A;  1S72 A;  3TRE A;  1KQS A;  3G7Z A;  3MEV A;  3V7R A;  5I2S A;  2K3Y A;  2DJZ A;  2EYQ A;  2K5L A;  3MCA B;  1N27 A;  3JB9 J;  3CMA T;  3PMI A;  4M7D A;  1N9S A;  2I2L A;  3C94 A;  3X28 B;  3S6W A;  5GAN j;  2VGN A;  4KT0 E;  1UGR B;  3FC3 A;  5LJ3 g;  5CKH A;  1WJR A;  4M77 D;  2X4J A;  2DTI A;  4OMF B;  1DJ7 B;  1Y96 B;  2JNG A;  3PTA A;  1XTD A;  3A8L B;  3MP8 A;  3GLX A;  4BI8 B;  3M4Y A;  1Q86 C;  3ZFJ A;  4XTU A;  4FT4 A;  3GPL A;  4NL3 A;  4M7A A;  5LJ3 d;  5D6X A;  3FIF A;  5LJ5 f;  3ME9 A;  1YIJ A;  4XU1 A;  1VQM A;  3QYG B;  2RJF A;  4XU2 A;  4BI3 A;  1LJO A;  1OZ2 A;  1WQ7 A;  3J81 E;  3QPH A;  2RO0 A;  4J6Y A;  1XOV A;  4MZP A;  3R6O A;  1JJ2 S;  1GXI E;  4M7D F;  5LJ5 h;  3EFS A;  2RHY A;  4Y28 E;  1O75 A;  5IN1 A;  4PJO F;  3CPW S;  5GAM e;  2V8K A;  3EAE A;  4YTL A;  3CCQ T;  5GAM h;  4KUD K;  4M7D C;  1BI1 A;  2LTO A;  1YI2 T;  3P8B B;  1M90 C;  1VQO A;  2QQR A;  3FDR A;  5HK0 A;  5LJ5 j;  2VXE A;  1RI0 A;  3M59 A;  3HFN A;  4C0G A;  2DZC A;  4HKE A;  3L2U A;  4M7A D;  1VQ5 A;  4L6V 5;  4R56 A;  1ZQ1 A;  3CBP A;  4RCC A;  2L3R A;  3LYI A;  4DOW A;  4M77 A;  5GMK e;  3QII A;  2GFA A;  2JUF A;  4C5E A;  3L2W A;  3DLL A;  1VQ6 A;  2QQ9 A;  4KBM B;  3DB4 A;  4OB0 B;  1YI2 A;  2OTL A;  5GAO q;  1M1K C;  4ELY C;  2X4X A;  1NZ9 A;  3SWN B;  1UB4 A;  5C0M A;  4GLK A;  1QVF S;  1FXX A;  3LWI A;  2L89 A;  1K73 U;  1R8O B;  2MMP A;  3BFM A;  5GMK i;  4IUR A;  4E7K A;  1VQL A;  3TCJ A;  5KH6 A;  3M55 A;  2E6N A;  4XTW A;  3I55 A;  2QEX T;  4BDY A;  4BE2 A;  2MAM A;  2QQA A;  4OB2 B;  2EJG A;  3CCS A;  2QDY B;  2AHJ B;  3OYN A;  3JCM P;  3JCM h;  1K9M C;  4HCZ A;  5FU6 C;  4M77 F;  2WSF E;  2CGH A;  3PNW C;  2XHC A;  1VQM T;  3P8H A;  1U8R A;  3X20 B;  3FJP A;  2A3L A;  5HK3 A;  1G3T A;  3EFR A;  4C0D C;  3CCV T;  2RK2 A;  1WPY A;  2XI9 A;  5GAO n;  2P0P A;  2GCX A;  2LRQ A;  3WVD B;  3JCM Q;  4J7F A;  3L2V A;  4M7A F;  1QVG S;  1UGP B;  2ZPI B;  1H3Z A;  3RUX A;  2M1H A;  2XID A;  5DM7 R;  2EJF A;  2MI6 A;  3CMA A;  3JRZ A;  3HKS A;  1HXD A;  3OS2 A;  4J6X A;  2MWP A;  1N6A A;  3DLM A;  3QDR B;  4MZT A;  3OB9 A;  4N0A A;  2E5Q A;  1VQ4 T;  2CZ6 B;  3JAM E;  2QA4 A;  5FRM A;  2XG8 D;  3A8G B;  4NOY A;  2ZZD A;  3VV0 A;  1G3W A;  4XTX A;  5A2Q E;  4M75 B;  4PJO G;  3CCE T;  1WQW A;  3CC2 T;  4O5V A;  2LDM A;  2RD1 A;  3CC2 A;  2XKO C;  2F5K A;  2O4X A;  4E7J A;  1QP2 A;  4C92 E;  5M9O A;  4A4E A;  3CEY A;  1VQ9 T;  1Q81 U;  4C92 D;  5GAM j;  4PJO C;  2DK3 A;  2IVW A;  4IUQ A;  2E64 A;  4MML A;  3CCS T;  4ZGJ B;  4M75 C;  3H8Z A;  3A5Z B;  4Y91 A;  4E7L A;  1VQP A;  2F69 A;  3TU4 K;  4Q5W A;  4OB3 B;  4NL2 A;  3L2R A;  4LD6 A;  4OB1 B;  2E41 A;  3QUI A;  4OF1 A;  4PKC C;  2CKK A;  2VGM A;  2RHU A;  2PUK B;  3MP6 A;  4HT9 A;  3C12 A;  4ELZ C;  2EIF A;  2R57 A;  3LLR A;  3J80 E;  3NFC A;  1Q7Y U;  5FRO A;  4EMH A;  3CCM A;  4EMK A;  4M77 E;  5GAN d;  2K5I A;  4A4K A;  3T9N A;  1Y7X A;  5CIU A;  1M1F A;  4JJN K;  2MF2 A;  3OSV A;  3MEW A;  3CBO A;  4BE0 A;  4J6W A;  2RM4 A;  3HFO A;  4N4H A;  2ZPB B;  4HCC A;  4N0A C;  4F7U B;  3JCM b;  4M78 A;  4ZTF A;  3RKY A;  2CYZ B;  4M75 A;  3JCM g;  3OS0 A;  4M7D G;  1VQ8 A;  3ER0 A;  4L59 A;  2XDP A;  3QKJ A;  4MMK A;  3UDC A;  2QQB A;  1PSF A;  2EQJ A;  3OMG A;  4VUB A;  4C92 A;  3M56 A;  1W2B S;  1B34 B;  5GAN 3;  3JCM e;  2K57 A;  3CD6 T;  3WVE B;  2RA2 A;  3FEO A;  4LD9 K;  2YLC A;  3X26 B;  3PT9 A;  2FL7 A;  5CQX A;  1BYM A;  3HP9 A;  1RL2 A;  4D6W A;  4LDX A;  3OYI A;  2CZ0 B;  3AHU A;  3CD6 A;  1YCY A;  4A4H A;  1VQK A;  1X6O A;  2DXC A;  1Q86 U;  2XD0 A;  1D3B A;  4XAX B;  4MDW A;  5HY6 A;  5HKC A;  2KY9 A;  4CRI A;  3V8L A;  3OYH A;  2JN0 A;  3QHS A;  2DVE A;  5FLX E;  1I5L A;  1VQ8 T;  4M7A E;  4M75 F;  2LCC A;  3OS5 A;  1M4Z A;  1JBM A;  3BDU A;  4FU6 A;  3URG A;  1KC8 C;  4WF2 A;  1YJ9 A;  2XU8 A;  4E47 A;  2KQW A;  2FB7 A;  3GNF B;  4C8Q D;  4ZGE B;  1I81 A;  1WJS A;  4JRI A;  3E19 A;  3OYF A;  2LX9 A;  3CCQ A;  2E70 A;  3QBY A;  3M4G A;  2CS7 A;  2E1H A;  4FM4 B;  3SDZ A;  3X24 B;  4HT8 A;  2DIQ A;  4XQ3 A;  3SD4 A;  1XNI A;  3S3M A;  1VIE A;  2X4W A;  3HSB A;  4E7H A;  4JUV A;  3QO3 A;  4XK8 E;  3PMT A;  3QXE B;  2K3X A;  5AYF A;  1VQ9 A;  2PVO B;  2QXF A;  3QZ9 B;  2LCL A;  1JRI A;  3M58 A;  4NS5 A;  3G6E A;  3GOX A;  2V8J A;  4QVC A;  1KQ1 A;  1VQP T;  1N8R U;  2C06 A;  4PJO A;  3VUZ A;  2VUB A;  5GMK h;  3OBY A;  2E6Z A;  2P0K A;  4XU3 A;  3CCJ A;  4JRK A;  1G3Y A;  4F7U G;  1FX7 A;  3G4S A;  3SB2 A;  1YIT A;  1VQ7 T;  2KAF A;  5J39 A;  2VC8 A;  4J7I A;  3G4S T;  1BI3 A;  4KUI A;  1QVF A;  2QTX A;  1M9S A;  2RI2 A;  4F7U F;  3RER A;  2E65 A;  3OY9 A;  2E12 A;  1QP3 A;  3CCE A;  4C0Z A;  3CCR T;  4C8Q E;  3FB9 A;  3CME A;  1VQ4 A;  1M1K U;  2YLB A;  4C5I A;  1K73 C;  4DQ2 A;  3INZ A;  5CCA A;  2B8A A;  4M75 D;  2PVG B;  5CVI A;  2QA4 T;  5LJ5 e;  3GNG A;  4ATO A;  2RB6 A;  2DTH A;  2RHZ A;  2KSS A;  4M75 E;  2OTJ A;  1JB0 E;  1B34 A;  4M78 E;  4EMK C;  4TVR A;  5GAN 8;  1K9M U;  3JCM W;  5C6S A;  2R5M A;  1K8A U;  3KXT A;  3OYG A;  4P5N A;  1UEB A;  3LX7 A;  5A0L A;  2XIC A;  3CME T;  2JTF A;  4ZN3 A;  4BDZ A;  3PIO A;  2F5T X;  2EQK A;  3X25 B;  2HBP A;  5CK9 A;  4BAC A;  1KQ2 A;  1O9S A;  2G3R A;  2X4Y A;  3QJ6 A;  2RI5 A;  3OYE A;  4Z02 A;  4L5G A;  5GAN 5;  3SFM A;  5DLQ E;  3CCJ T;  2EJ9 A;  1KHI A;  1OYX A;  1AHJ B;  1Y96 A;  1VQK T;  4M7D B;  4UC4 A;  1VUB A;  3LGL A;  3JB9 D;  1OZ3 A;  4BY6 B;  2BIV A;  1W4S A;  3JB9 H;  1VQN T;  1KD1 C;  4FSX A;  4QQD A;  5GAN f;  5GAO r;  1VQL T;  3OYJ A;  5GMK j;  1UGS B;  4KUL A;  5GAN 6;  1HK9 A;  2WSE E;  3VYG A;  5I21 A;  1YJW A;  3CC7 T;  3MET A;  2ZPE B;  3V7C A;  4JS5 A;  3E1S A;  1Q82 U;  2OTL T;  1YHQ A;  4PNO A;  4JRP A;  3BW1 A;  5KE2 A;  1VQ6 T;  2LC4 A;  4M77 C;  2M9U A;  4OP0 A;  2DTO A;  3G71 A;  3ZBD A;  4QQG A;  4XTY A;  4JDS A;  2D6F A;  1U1S A;  4QQ6 A;  4RMO A;  3RKX A;  3A8O B;  2HAX A;  3M54 A;  4PL6 A;  2XDD A;  5L8R E;  4N4G A;  1VQO T;  3QYH B;  1EIF A;  2RHI A;  3LH0 A;  2ZCF B;  3PFS A;  5LL6 S;  4C8Q G;  3E9G A;  2OAU A;  5FRN A;  4BUG A;  3C95 A;  5A0D A;  4BI4 A;  4ME7 A;  2M0O A;  5J26 A;  1BIB A;  3GIB A;  3KUF A;  3OBW A;  4JLI A;  1Q7Y C;  4FL6 A;  1LOJ A;  5FU7 C;  3M9Q A;  3RMQ A;  1I8F A;  2NLU A;  4HCB A;  4QVZ A;  4BB7 A;  2CZ7 B;  4BE1 A;  3NTK A;  3V8K A;  4B9W A;  5GAM f;  2O01 E;  5LJ3 j;  1TH7 A;  5GAM g;  2E10 A;  2JZ2 A;  3I56 T;  2ZPF B;  2EAY A;  2DEQ A;  2DD4 A;  1W2B A;  3OS1 A;  2PU9 B;  4FIB A;  4FT2 A;  5FU7 B;  4RCB A;  1NJI U;  4EMK B;  3J7A F;  3A8H B;  3QZ5 B;  2ZGW A;  3HHT B;  2LT4 A;  4M78 F;  2VXF A;  2WAC A;  1YJN T;  1IZ6 A;  3CXC S;  3QG1 A;  3GF5 A;  1S72 T;  3BDL A;  4LDW A;  2RJE A;  3MEU A;  4M78 G;  1BI2 A;  2ZPG B;  2H3J A;  1BIA A;  3OW2 A;  2HD0 A;  5CAI A;  3OYM A;  3NTH A;  1YBY A;  4RKU E;  3HRT A;  3PGG A;  2DD5 A;  5A0G A;  3UWN A;  2V8I A;  4C0D B;  1NPR A;  1KC8 U;  2LNV A;  4M77 B;  2K2V A;  2M16 A;  3JCM f;  3CCV A;  2FVU A;  3UT1 A;  3M57 A;  2KMT A;  2RJD A;  4R55 A;  4II1 A;  4F7U E;  1WNL A;  4RG2 A;  4A4G A;  3G6E T;  3H6Z A;  3CCL T;  2VYT A;  1QVP A;  1X75 C;  5IAY A;  3OYY A;  3CPW A;  3TEE A;  3V8J A;  4OGC A;  3JB9 I;  4DA4 A;  4JLG A;  2FYK A;  3RKW A;  2YRV A;  5LJ3 h;  1ZHI A;  5GAN 2;  3CCU T;  3CC4 A;  5CQY A;  4QVD A;  4RG8 A;  3OQ5 A;  4LDV A;  4B9X A;  3OYB A;  1N8R C;  2XDB A;  4PLL A;  1BI0 A;  5GAO l;  1V29 B;  4CI0 C;  3LGF A;  3C4S A;  3CC4 T;  5CKE A;  2RI3 A;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...