5GAMg

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 69
sequence length 75
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamg00
5LJ5d 4PJOA 4C8QF 1N9SA 2EWNA 3HFNA 3QHSA 4M7AG 1YCYA 2RA2A 2DJZA 2HNIA 4C8QB 5GAMh 4MMKA 2K57A 3EFRA 1TH7A 2VXFA 1H641 3L2ZA 4M7AE 4M7AC 4XU0A 2DTIA 5GMKm 2DTHA 3M4GA 3RKXA 4X9DA 5GAN8 3HSBA 4C92C 3JB9D 1HK9A 5LJ3d 4M7DG 3QO3A 2E41A 4M7DA 1I8FA 3V8KA 4Y91A 4M75C 4EMGA 3FB9A 4EMKB 4JUVA 4M78B 2EJFA 5GAMg 4M7DE 3JCMd 2E10A 5GMKi 1LOJA 5LJ5e 3SB2A 4V2SA 4M7AF 1HXDA 5GAOn 5GAMf 1D3BA 4M77C 5GANd 4QVCA 4RCBA 5GAMj 5GMKe 2EJGA 4J5YA 3QUIA 1KQ1A 3AHUA 4A54A 4C92B 4WF2A 4M75F 3SWNA 5LJ3e 3RIRA 2YLCA 2ZGWA 5GAN4 3JB9G 3L1AA 4M7DF 4OP0A 1Y96A 2CGHA 4M75B 3JCMV 1BIAA 4F7UG 4F7UA 3JCMe 4PJOC 4PJOE 3JCMW 2DXTA 3GIBA 4XTZA 2YLBA 4HT8A 1N9RA 2RB6A 4DQ2A 4F7UE 4M77F 1B34A 4NL3A 5GANe 4M77B 4J6XA 2VC8A 5LJ5h 3JCMQ 4RCCA 4C8QD 5CAIA 4EMKA 3RESA 2EAYA 5GAOl 3BFMA 4N0AA 1WQ7A 5GMKl 4M7DC 5GAN3 3PGGA 2VXEA 4PJOF 3RERA 5GAN5 4EMHA 5GAN7 5GAN6 4MMLA 5DY9A 4PJOB 2E64A 2E65A 1I4K1 5LJ3h 1WPYA 4PNOA 4M7AB 4M78D 5LJ5g 1LJOA 4XU2A 2DXUA 3JCMX 3JCMh 5I21A 4XTXA 3RUXA 2FYKA 4JRIA 2E1HA 5LJ5f 5GAMe 3V8LA 2DZ9A 4JLIA 3SWNC 4C8QG 5LJ5j 4M7DB 4C8QA 4XQ3A 1JBMA 5LJ3g 5GANh 2DTOA 3V7RA 4C92D 2DEQA 3JCMP 4HA8A 1WNLA 3JCMb 5GAOr 4M75D 3JCMg 3VU3C 5GMKj 1KQ2A 2RM4A 4JRKA 5GAMd 2Y90A 4M78G 5LJ3j 4X9CA 1D3BB 3HFOA 4M78A 1BIBA 3JB9J 4XTWA 3JB9H 4NOYA 1U1TA 4EMKC 5GAN2 1U1SA 5GANg 3JB9F 3V7CA 5GAOq 4M78E 4N0AC 3SWNB 2RD1A 2DVEA 4M77D 4F7UF 5GMKh 2QTXA 4XTUA 1Y96B 4A53A 4M7AA 4F7UB 4XU1A 5GANf 2FB7A 1WQWA 4C92G 5GANj 4C92A 1I5LA 5GAOm 3BDUA 4M75G 4PJOD 4M75A 2DKGA 4NL2A 1B34B 3FIFA 4C92E 4M7AD 4M78F 4J6YA 1I81A 4PJOG 1LNXA 4M75E 3RKWA 4XTYA 2DZCA 3V7SA 3V8JA 5GAOp 4C8QC 4C8QE 1M8VA 3JCMc 1JRIA 3INZA 4M77G 3BY7A 5LJ3f 4M77A 1M5Q1 4XTVA 4M7DD 4J6WA 3RKYA 4HT9A 2EJ9A 4QVDA 4XU3A 1MGQA 4M77E 4C92F 3JCMf 3JCMJ 2JN0A 3EFSA 2I2LA 4M78C 3QSUA 3FJPA 3JB9I 1X01A 2YHTA 3BW1A
chains in the Genus database with same CATH superfamily
1T3LA 3QHSA 4LDUA 2OTLA 1YCYA 2MWPA 5J3BA 1TH7A 2ZCFB 4LXCA 1WX6A 1GFCA 1RABB 3M55A 4MZPA 1R0CB 3JB9D 3NTKA 3OS1A 2KK4A 3C94A 3QKJA 3FB9A 5KE2A 3CXCA 3X28B 2HCKA 1GBRA 1VQMT 2EGCA 4KBMB 3SB2A 1TS9A 3UATA 4V2SA 4R56A 1BCMA 2CUBA 9ATCB 2K2VA 2RHXA 3CQTA 4BDZA 3MO8A 1VQ5T 5IHNA 1G3WA 1VQ4Q 4J7IA 3J80E 2SEMA 4JJBA 3ZFJA 3SEMA 1X6GA 4RTUA 1G3TA 2ED1A 4PNOA 5D7UA 3CCRQ 4N4IA 4RMOA 2BE7D 3LH0A 3EG2A 1YI2Q 1BKBA 1FMWA 4C8QA 3CC4Q 8ATCB 1AT1B 1VQ8T 1Q7YC 3EGDB 3JCMb 2NUTB 3RDVA 1D0XA 1K9AA 1NE8A 1MMGA 2AZSA 3E9GA 3A8LB 2JOYA 2JMAA 2CH4W 3NHNA 2JW4A 1FMKA 1V76A 2LX9A 3TCJA 4E7SA 1Q81R 2LQWA 2DD5A 2FPFA 1CKAA 1XQHA 3TEEA 4AFQC 3CCQQ 3OW2P 2GNCA 3A5ZB 4JS5A 5GAOp 5AYFA 2MOXA 1M1KU 1KQSP 1BI1A 2GFUA 1AWJA 1OULA 3EHRA 2BZ8A 3JCMJ 2L3RA 2O4XA 1O9SA 5LJ5d 1AHJB 3CCJQ 1M3CA 2O01E 3QG1A 1Y0MA 2BZYA 2DTHA 2JJ9A 1RUWA 5EG2A 4FYYB 3QXEB 3H41A 1WHMA 2PTKA 3JCMd 3OYBA 5LJ5e 1LOJA 2V8IA 2YUOA 3U23A 4M77C 1NYFA 1WHHA 1JU5C 5GMKe 2XIDA 1YJWA 2KYMA 4QVZA 4F7UA 4BI4A 4NS5A 3JCMe 3H0HA 2EYWA 2QDYB 1A0NB 1X6BA 1Y57A 1K9MR 1VQOT 2K2MA 5KYYA 5LJ5h 5CAIA 3CC7A 1VQLA 4ELYC 1WXTA 4PLIA 3JAME 4M78D 5LJ5g 4ZTJA 3MEVA 1RAAB 3G4SQ 2L2PA 3QYHB 2D0QB 3JCMh 4PJMA 1KIKA 1KFZA 3H8ZA 5LJ5j 4M7DB 3WXMB 2DIGA 2JM9A 1PRLC 1Q7YU 4BY6B 1AEYA 2MIOA 3JCMg 3VYGA 5CK9A 5GMKj 1Y7XA 2G6FX 3HFOA 2P4RA 3ZL7C 1FX7A 3OYKA 1TTHB 1VQ6Q 5GAOq 3FC3A 2RD1A 2QEXA 1G8XA 3UA6A 2A37A 2YRDA 3MEWA 1FYNA 3CCMT 1PSEA 2DVJA 4J6YA 2QK0A 1LNXA 1K0SA 1JRIA 1RADB 3KFVA 4M77A 3QZ5B 2EJ9A 2A7YA 4QVDA 1YJ9A 8AT1B 3QSUA 4NL3A 2CS7A 2CH4A 2OX7A 1MMNA 3J81E 2MK5A 2HNIA 4E7IA 2DJQA 3L2ZA 4CRIA 1NPPA 1VQNT 4J9DA 3M53A 2K6DA 1UE9A 3QO3A 2EGEA 1G83A 1K76A 4C0ZA 2VGNA 1WHJA 3O5ZA 3CMEA 2RHUA 1YITT 5IXBA 5GAOn 2EKOA 1FWZA 2RQWA 3QUIA 2K9GA 1Z9ZA 5KYUA 2QYZA 1UJ0A 1BCOA 1VQMA 2KNBB 3VS7A 1UUEA 4PJOE 2L3SA 2RQVA 2KYBA 2M9UA 4QKUA 4ORZA 3JCMQ 3EH2A 1D09B 2E6ZA 1WQ7A 2FG0A 1VQ5A 2M0OA 3CCEA 1VIEA 4R0KA 1LJOA 1VQ7T 4KUDK 3JCMX 3EG9A 5GJWB 3I35A 3PMTA 4RG8A 1W70A 3ASKA 2RJFA 2BKDN 2Y4YA 3D7SB 2QGGA 2WACA 3X25B 3VUBA 2B86A 2J7IA 2ZAEA 4JDSA 3C4SA 4M75D 1AZEA 1M1GA 2Y90A 4D8DA 3JB9J 1K73C 2HQEA 3JB9F 4N0AC 3SWNB 1VQ8A 3CEYA 1TUDA 3O8VA 3CC4A 5GANf 1MMDA 4QW2A 3M5AA 4FIBA 4Z8AA 3C12A 3CBPA 1WA7A 1AWXA 1M2OA 2XICA 2C0TA 1OX8A 4UC4A 1SEMA 4F16A 2DL5A 4GY5A 1VQ9T 2K5IA 1Q82R 3FJPA 3CCLQ 3VS4A 4M7AG 1W2BS 1WHLA 2EYYA 5C6SA 1QVFS 1QLYA 3VS3A 4M7AE 1AOJA 5GMKm 5FLXE 4C92C 5A2QE 1M4ZA 3GF5A 1JB0E 2K7AA 1M90R 4X1VA 2OTLT 1I07A 5KH6A 1ZA1B 2DL8A 1QVGP 4JRQA 7AT1B 3EG3A 3UWNA 2RHZA 2X3WD 1SSFA 4P5NA 5I2SA 4M7DF 1R0BG 5IXFA 5CKBA 3JCMW 1S72Q 4KRTA 5FW9A 2RH2A 4FW2A 1OV3A 4RTYA 2HD0A 1OYXA 2H8HA 2HQXA 4ME7A 4N0AA 1YP5A 2Z0WA 2DL4A 1U8RA 5IHIA 1MNDA 1AD5A 2DXCA 5GAN7 2WSFE 4C5GA 1VQOA 1WPYA 2XI9A 3CPWS 4Z02A 3NTIA 2ZPGB 1WHKA 3V8LA 4C8QG 3OYNA 2CREA 3OS0A 3LWIA 4L59A 2M16A 1PG5B 2M51A 3MP6A 4FT4A 1VQPT 4XAXB 2KRMA 1PSFA 1K73U 2EYQA 2PUOB 4ANJA 2QA4Q 1BU1A 3JRZA 4XU1A 3FJ5A 2EGAA 4KGZB 4MDWA 4C92A 4F17A 2L89A 3QWYA 2YXYA 1M1FA 2HKNA 2SRCA 4PJOD 3GLXA 1ZBJA 3OSVA 2FZKB 4ELZC 4OF1A 2RQUA 1MMAA 1OZ2A 2IIMA 3RKYA 1NJIC 1QP2A 4HCBA 2RQRA 3EFSA 2DM1A 1SF9A 4JJNK 3PTAA 1ZX6A 4F04B 3GNGA 1WYXA 4N4GA 3CCUT 5KYXB 3CMAQ 2LQ8A 4BE2A 2E41A 2MPXC 1VUBA 1H8KA 4DBRA 3CXCP 2K3XA 3GNFB 2RO0A 4C0GA 4QVCA 3HKSA 3VJPA 2B8AA 3AHUA 4Y92A 3GP8A 2ZGWA 2VWFA 4F7UG 3HPWA 4D6WA 1K8AU 1YITA 2CZ7B 3ZEHA 3CBMA 2YLBA 4F7UE 2J05A 3I5RA 1X43A 1B34A 2XDBA 2CZ0B 1YJWT 1NG2A 3BFMA 1YFNA 1NLPC 1ZLMA 3LW5E 2R57A 1QQJA 1ZHIA 4EMHA 2GQVA 5D6WA 2JNGA 2X4XA 2DL3A 4A63B 3VS0A 2DRKA 3X24B 1VQLT 1KJWA 3CC7T 5GAMe 2X35A 3S3MA 4FL6A 2HBPA 4XQ3A 2KXCA 4BE0A 1K4US 1KC8C 1VQ7A 3OYAA 3OYYA 2RNAA 2RM4A 4JRKA 3I55Q 2X9HA 1JO8A 4B6MA 4J9GA 1LVKA 3QJYA 4WCIA 3S3NA 2DPPB 2RJCA 2RI2A 3M0SA 1ZUUA 4AFZC 5DLOA 2ZPBB 1N8RR 2JXBA 1ZQ1A 1RAHB 1OI1A 4HVWA 2QEXT 1YHQQ 2P0QA 3OB9A 3JCMc 3NMZC 4M77G 4XTVA 2XG8D 4M77E 1NJIU 2E5QA 5FRNA 2MF2A 1N27A 1QVGS 2DD4A 2KVQG 3BW1A 3VV0A 2M02A 4XU0A 5A0GA 1VQ9A 2F5TX 3EFOB 1KK7A 1NM7A 2QQRA 4RTZA 2PVOB 3I56Q 1SRLA 2J6KA 4FSSA 3TU4K 2HL5C 4Z88A 2RF0A 4WF2A 4M75F 4OVAA 2C0OA 3QZ9B 2M1HA 2CGHA 2ZZDA 1NYGA 2XMFA 3CMET 2OAUA 1QVPA 1WIEA 3KXTA 4J83A 3RESA 1KHCA 4PFPA 4E7HA 4BB7A 4KGXB 1KD1C 4FU6A 3QJ6A 5GAN5 4MDXA 4MMLA 3TVTA 5KE3A 2F69A 4M7AB 2JUFA 4LD6A 5LJ5f 2EVRA 2LT1A 2FZGB 1JJ2S 2LNVA 5I22A 1CKBA 3CCET 2J6FA 1KC8U 3OS5A 2X3XD 1U5SA 1VQ4T 2YWWA 4IUUA 3CCVQ 1OQKA 1JQQA 5IH2A 5HK0A 4GLKA 1K9MC 3ME9A 2KT1A 3M0UA 2NLUA 4PFOA 3CCRT 1VQPA 2CSIA 3CC2A 1YI2T 3E9FA 2DZCA 2KDSA 5FU7B 3CC4T 1X2KA 1R77A 2QA4A 4M7DD 1EFNA 1UFFA 4E47A 2COZA 1MGQA 3G71Q 3I9QA 2RK1A 1NLOC 3JB9I 2DAQA 2YUNA 3FDRA 4E7LA 2EWNA 2DRMA 1MNEA 4C8QB 2E70A 1BYMA 4C0DB 4FW1A 3LLRA 5GAN8 2FO0A 2EQUA 1GBQA 2EQJA 3PIOA 3HSBA 2EJFA 1BK2A 4QT7A 3CCQT 2E10A 4Y28E 5GJVB 5KYWA 3CCUA 4IIMA 5HY6A 2CUDA 3S6WA 3PIPA 1BI3A 4J9FA 4E2FB 5FWCA 2ED0A 4A54A 3CMAA 3RBBB 5CIUA 2LJ3A 1Y96A 4KUIA 4RKUE 2A08A 1PWTA 1EZZB 2A28A 1VQKQ 1QWEA 1I0CA 1M3BA 3TSZA 4J6XA 2VC8A 3G7ZA 2VGMA 3RMQA 3RNJA 2HQHA 4PJOF 1KD1U 2KR3A 2O4XB 1IHVA 4D8KA 1FXXA 3UA7A 1IGQA 4HCKA 3OYFA 1VYUA 2FYKA 2LT4A 4DEXA 1FMVA 2FHDA 4R55A 2FRWA 4CC3A 2F2XA 3M4YA 2QXFA 2JTFA 3G6EA 4PJNA 4LDVA 2EQMA 2KT8A 2V26A 2QASA 5GMKh 4F14A 2ZPEB 4L6V5 3I5SA 1QKWA 2XDPA 1K9MU 1AWWA 4F7UB 5KCOA 2F5KA 3LGFA 1X69A 2GQIA 2EPDA 4C92G 3DLMA 1I5LA 2BTTA 2DERA 2R58A 1TXQA 3VUZA 3QIIA 2VV5A 5KYYB 2DKGA 4C92E 3I55A 4HVVA 2GBQA 3SFMA 1DJ7B 3TREA 1SHGA 2CZ6B 1D1CA 2DX1A 2COWA 4J9CA 1PKSA 1YCSB 2I2LA 2ZPFB 1PHTA 4M78C 5AT1B 3EGXB 3REAB 3HFNA 4FT2A 2DTIA 4O5VA 3M4GA 1UJYA 2AK5A 2OJ2A 2KAFA 1I8FA 4Y91A 3EG0A 4GBQA 4KH1B 4E7JA 2D9TA 4A4HA 4M7AF 3LX7A 4DBFA 5C0MA 3L2WA 1D3BA 3CCMQ 1ABQA 1IREB 2O88A 1NEGA 4LUEA 2NUZA 5GAN4 1RACB 2GFAA 2JT4A 2COYA 4BI8B 3HRTA 1Q82C 4M77B 3P8HA 2KRNA 1D0YA 1PRMC 2RHIA 3P8DA 3PMIA 1YIJQ 3ULRB 1VQNQ 4OGCA 2OTJQ 1PM3A 1M90C 1M3AA 2K5FA 4OMNA 3V7RA 4ZGJB 1M8MA 4LDWA 3VS2A 4DA4A 1YWPA 2XD0A 1SG5A 1UGVA 2FL7A 4AG1C 4M78A 5GAN2 2MWOA 1OZ3A 1ZUKA 3JV3A 5KYUB 2P4TA 3PT9A 4IURA 2DYIA 1GXIE 1VQ4A 2FPEA 2A36A 3CD6Q 1TWBA 2ABLA 3EG1A 1W2BA 1QMCA 5LJ3f 3OW2S 1QVFA 3CCRA 1RAEB 4JJDA 1KQSS 2PNIA 1YI2A 3OMGA 1NBEB 2EKHA 4J5YA 3HL8A 1W6XA 1VA7A 2GGRA 3Q1JA 3MJXA 4MMKA 3MCAB 4AFUC 1LCKA 5CR2A 1M30A 1WJSA 2HKQB 3MPUB 1B07A 1BB9A 3UT1A 4EMKB 4M75C 3DLLA 1X27A 4JUVA 4KULA 1OPLA 1YWOA 2FPDA 5IHKA 2EYXA 4M4ZA 1QW1A 3GOXA 2FRYA 4RCBA 4DBQA 1I1JA 2YLCA 3CCQA 1Q86C 2DXTA 3CCLT 2E5KA 3RR6A 3CPWA 4J7FA 2GF7A 1MUZA 1RL2A 2NUPA 5M9OA 5A0LA 3CCJA 1HD3A 1E6HA 1PCXA 2E1HA 4JLIA 3A8GB 1RI9A 2LP5A 3JCMP 3CCSQ 5CKDA 1W4SA 1S72T 3LH5A 1VYTA 4X9CA 2GCXA 1ZSZC 1V29B 3DB4A 2XKOC 4HCCA 4ZTFA 1YJNQ 3OYJA 4B9XA 3TSWA 3FLGA 3VRZA 4XK8E 3MHXA 3G1JA 1ZBXA 4M75A 2OI3A 4NL2A 4C5HA 1UGQB 2CDTA 2MI6A 4JJCA 5EC7A 4C8QE 2CP0A 2EQKA 1RAFB 4GLMA 4LE9A 1M5Q1 4ZGDB 2KY9A 4J6WA 2LCCA 3QBYA 4JLGA 3G4SA 3CC2T 2JN0A 1MHNA 2LZ6B 3LYIA 1QCOA 4RTTA 1K73R 5IT9E 2QA4T 1W1FA 2EIFA 3EFRA 1PKTA 3SDZA 1OU9A 1HK9A 2K5LA 5IAYA 2I0NA 1AWOA 2RQTA 3M57A 3GPLA 1VQ6A 5CKFA 1M9SA 1N8RC 1GFDA 4EIKA 2ESWA 2MMPA 4PFZA 1IXDA 3OA6A 2LMJA 2P0KA 4PLLA 4JZ4A 4Q5WA 4C92B 3JB9G 4C5EA 3RMSA 2HEQA 1Q86U 4PJOC 4XTZA 2F2WA 4DQ2A 2L5QA 4IUTA 1ZSZA 1QKXA 3ZBDA 3CMAT 2D6FA 1XTDA 5GMKl 4OMQA 3UF4A 2AT1B 3WVEB 2DF6A 2VYTA 4FYXB 2J6OA 2CKKA 5GAN6 4FCYA 1M2VB 2HZYA 2KSSA 4KT0E 2YRCA 1D0ZA 4OB3B 1E7OA 2LX7A 2EBPA 2PQWA 4WTOB 2MCNA 1K8AR 3HTRA 5GAMd 2HSEB 4DBHA 5CKEA 2OTJA 3NTHA 2QTXA 4TVRA 1C1AA 3ER0A 2BZXA 2IG0A 5L23A 3G6ET 2DA9A 4ZGEB 2ENMA 2DBKA 5LL6S 1YJWQ 3BDUA 1T3SA 1NEBA 3OSSC 1G2BA 1B34B 2V8KA 4M7AD 5CO7A 1U06A 2K3BA 5FWBA 1GCQC 2KE9A 3LGLA 4RTVA 2L8DA 2KBTA 1TUCA 4OMFB 5J39A 1UGPB 4OB2B 3I55T 4MZMA 2JM8A 4CI0C 3CD6A 5D6YA 3PNWC 3OYMA 2DK3A 1YNZA 4PJOA 2AKLA 4LNPA 1WZOA 5GAMh 2K57A 4M7AC 2VB6A 2V1QA 1XOVA 3UPUA 2X4WA 2JS0A 3QDRB 5GAMg 1OPKA 2C0IA 2O31A 1SHFA 3IQLA 3A8HB 1N8RU 4JZ3A 2AIRB 2RJDA 4HVUA 5GAMj 2EJGA 1WXUA 3OY9A 2K79A 3L1AA 3M9QA 2QEXQ 1NJIR 2JS2A 4ZN1A 2CT4A 5I11A 1UHFA 4C8QD 5FU6B 2V1RA 5GAOl 2CP3A 4YTLA 1VOMA 5HCKA 3RERA 3CCLA 3M0RA 3PVLA 4FYWB 1Q81C 1JJ2A 1SPKA 5CCAA 4HXJA 5DY9A 3I56T 2M0YA 5L8RE 1YJ9Q 1NPRA 1N6AA 2V8JA 4XTXA 2AKKA 2DE0X 1P92A 1GCQA 2BUDA 1IGUA 3EAEA 2H3JA 1ACMB 2Y4XA 3N5BB 4DOVA 4MZTA 5KCHA 3H0IA 2F2VA 4PL6A 1SRMA 4M78G 1UTIA 4IKFA 3VKIA 1G3YA 4CC2A 2KEAA 2ZPIB 4M78E 5KYNA 4N4HA 1R8OB 2LCSA 4A53A 4M7AA 1HYOA 5HKCA 4K11A 3L2RA 2J06A 1WQWA 1S72A 4X34A 2MYSA 2P84A 4CC4B 3CCSA 2YUQA 1J3TA 1UG1A 2YT6A 1VQMQ 1KHIA 1QCNA 5I2MA 2KRSA 4XTYA 5DM7R 3OYIA 1YJNA 4C92F 1KC8R 3JCMf 1VQ5Q 3HRSA 3CCVT 2A3LA 3CCEQ 2R5MA 4AT1B 2H3EB 2RI5A 3META 3M0QA 3OBYA 3L2UA 2QG9B 2E6NA 3RKXA 4II1A 2LC4A 3R6OA 3AT1B 4FYVB 4IUQA 3P8BB 4EMGA 2E12A 4QQGA 3OS2A 2EFIA 4LDYA 1M27C 3EGDA 1UDLA 2HL3A 2NUTA 3URGA 1YBYA 4OMLA 4CC7A 2MAMA 3CXCS 3G71T 1VQ8Q 4J9IA 1BIAA 1SKUB 1C0MA 1T0JA 3OYDA 3L2QA 1G5VA 4JPBW 2FVUA 3TQ7P 1TU0B 4M7DC 1GL5A 2RK2A 1Q81U 1M1KR 3M58A 4HCZA 4BY6C 3KUFA 2X51A 2DILA 2LCLA 2E3IA 1JBMA 2VVKA 3CCJT 4AFSC 2QQAA 1WNLA 2DIQA 5KYWB 4A4GA 1KQ2A 1S1NA 3CBOA 1VQKT 1IRXA 2AZVA 1BIBA 3JB9H 4NOYA 2HDAA 1WLPB 4ZNXA 4M77D 4DEYA 1Y96B 4QQDA 1OU8A 2YUPA 1KD1R 2HBWA 4A4KA 4J8OA 4M75G 2KI7A 4BUGA 3V7SA 4AG2C 1IO6A 4M75E 3RKWA 1B3QA 4JRPA 2RJEA 3C95A 1W2BP 4BE1A 1QVFP 3R6NA 4IUVA 2DBMA 3VS5A 1E6GA 2QGFB 2L0AA 1VQOQ 1TOVA 2QQBA 5HK3A 1UB4A 1Y07A 3G4ST 4BACA 4M7DA 4E6RA 2HSPA 4VUBA 2WSCE 5GMKi 2RN8A 1JXMA 2CP6A 2RHYA 1Q7YR 4O6JA 2PUKB 3M59A 3QDFA 3REBB 2DMOA 2K4YA 3OQ5A 3OBWA 1UGSB 3EGXA 1UEBA 4OP0A 4ZN3A 1VQ6T 2W0ZA 1YHQA 3GIBA 2CP7A 2BE9B 3SD4A 1ZSGA 1WJRA 3X20B 1B7TA 2QAZA 1RLQC 1WFWA 1Q95G 3CPWP 5GAN3 2X4YA 4BDYA 2RPNA 1I4K1 2JMCA 1PD0A 2YRVA 2XK0A 3RUXA 4JRIA 1WJQA 2IVWA 3SWNC 1SSHA 4OB1B 3I56A 4HKEA 4EDUA 2KXDA 5GAOr 2ZPHB 2D0NA 1D3BB 1D1BA 4EMKC 3VYHB 2LNHB 2DVEA 3A8OB 1NZ9A 4LD9K 3SHWA 2NWMA 1BI0A 3OW2A 1YIJT 1BI2A 1TUGB 5FROA 6AT1B 1KQSA 3F70A 2OTJT 2NYSA 5DLQE 3E1SA 1K1ZA 1YITQ 1RLPC 4PJLA 2X4JA 2E3HA 1D1AA 1IB8A 3INZA 3M56A 2PZ1A 1H92A 2CSQA 4PJOG 2DL7A 1UECA 3NGPA 3THKA 4C8QF 4C0FA 3L2VA 2XU8A 2GTJA 4OGEA 3GBQA 3V8KA 3CCVA 3CD6T 4Z89A 3C0CA 4M78B 2CZ1B 2YSQA 1VQ7Q 2D1XA 4BD3A 4LDXA 1KQ1A 3SWNA 2QI2A 1TG0A 3EG9B 3RIRA 2XHCA 1O75A 3HRUA 1X2QA 4HT8A 2RB6A 3PVQA 1QCFA 1UGRB 3BE3A 3A98A 3M0TA 1VYVA 3BDLA 4RCCA 4EMKA 5IN1A 3J7AF 3G71A 1LPLA 3FRNA 2VUBA 3PGGA 2CT3A 1F1BB 4IIOA 3NFCA 1Y71A 4C5IA 2DEUA 5I21A 3S3OA 2DZ9A 1K0XA 2JTMA 4E7ZA 2DNUA 3H6ZA 2FEIA 3PFSA 2DTOA 4C92D 4OB0B 4HA8A 3LWHA 2WSEE 1Q82U 2RMOA 4J9EA 1VQ9Q 2DFUA 4OMOA 1VIFA 1XNIA 2P0PA 2PU9B 3E2UA 2IPOB 4F7UF 4XTUA 3KBGA 5CKHA 1VQKA 2CYZB 2LQKA 2QDLA 4E7KA 3EH1A 2FZCB 2L3PA 2EW3A 1M90U 3X26B 1XJWB 4DOWA 1WGSA 1N5ZA 2OTLQ 2LDMA 3M54A 1I81A 2PVGB 2RI3A 4RUGA 2GTOA 4PKCC 2NUPB 1PNJA 1IHWA 2LJ0A 3BY7A 2ATCB 1HJDA 3CCST 5A0DA 3E19A 4XU3A 2JTEA 3HP9A 4ATOA 1I5OB 2EYZA 3DKMA 1K8AC 2DJZA 2DO3A 1YJNT 2DXBA 2LVMA 4X9DA 1RI0A 3QYGB 5LJ3d 1KSWA 2BIVA 3MEAA 3DB3A 3L42A 1WHGA 5CQYA 2D8HA 2AHJB 5GAMf 5GANd 2JZ2A 5LJ3e 3MKDA 1TSFA 3HHTB 1U3OA 4M75B 4KH0B 1N9RA 4EPCA 4M77F 4LN2A 2CP2A 1VQPQ 5GANe 1RAIB 3CC2Q 2EAYA 1WI7A 2VXEA 4IUPA 5LJ3h 2LJ1A 1MV0B 1JJ2P 2KROA 4OMPA 2DXUA 1IZ6A 2LTOA 1T0HA 2O9VA 2HMAA 1ABOA 5CQXA 3VRYA 2QTVA 5LJ3g 3NPFA 5GANh 3A1PA 5KYXA 3VS6A 1OEBA 3OYLA 1Q86R 2CP5A 4PJJA 5LJ3j 3OYGA 3CCMA 1WDXA 1ZA2B 4XTWA 1EIFA 2O2OA 2O9SA 2QQSA 4J9HA 1U1TA 1U1SA 5GANg 1H3ZA 3V7CA 5J26A 3CCUQ 4A4EA 1M2VA 4B9WA 5GANj 3MP8A 5GAOm 2E4HA 3MEUA 3FIFA 1X6OA 1ZSZB 4M78F 1GCPA 2K3YA 2ROTA 3V8JA 2XDDA 2OAWA 2ROLA 2VKNA 1YIJA 4HT9A 1JXOA 1VQNA 4RTXA 3UDCA 2KMTA 1WXBA 1H3HA 5FU6C 3QPHA 2VASA 1RAGB 1X01A 1ARKA 1MV3A 2YHTA 3FEOA 4FSXA 3VS1A 1N9SA 2RA2A 4AMCA 4A4FA 2HAXA 2D8JA 2VXFA 1H641 1UHCA 2DYBA 4QQ6A 4M7DG 1QVGA 3OYHA 4M7DE 2KGTA 1HXDA 1JEGA 3G6EQ 1VQLQ 3CC7Q 2R5AA 1BBZA 3T9NA 1OOTA 3CPFA 3PE0A 2LRQA 4L5GA 3JCMV 1AVZC 2QQ9A 2W10A 2PVDB 4JS4A 3QWXX 4J9BA 1PD1A 5D6XA 3H9NA 1Z9QA 3H0FA 1X75C 4PK4A 3A8MB 2F1LA 4FM4B 3EGUA 3JSCA 1YHQT 1PC0A 1QP3A 1AZGB 4PJOB 2E64A 4OMMA 2E65A 1GRIA 4XU2A 3OMCA 1HSQA 2G3RA 4RG2A 5FRMA 4LUDA 1OX9A 2DLPA 2YDLA 2DEQA 5ECAA 3MP1A 1C6VX 3EFOA 3VU3C 2LQNA 2EQIA 2L3QA 1ZUYA 1G3SA 2JVVA 3M0PA 2KQWA 1YN8A 5FU7C 2FB7A 4ESRA 2DETA 4RTWA 1YJ9T 2A0FB 1CSKA 1M1KC 3EHQA 2ECZA 4C8QC 1M8VA 2C06A 1KG1A 4C0DC 3OYCA 3OYEA 5CVIA 1EX4A 1V1CA 4KGVB 4BI3A 3WVDB 3CMEQ 1QWFA
chains in the Genus database with same CATH topology
3PTAA 3QHSA 4LDUA 3Q1JA 2OTLA 1YCYA 2MWPA 3GNGA 4N4GA 5J3BA 4MMKA 3MCAB 1TH7A 2ZCFB 3CCUT 5CR2A 2QQBA 1WJSA 5HK3A 1UB4A 1Y07A 2LQ8A 3M55A 4MZPA 4BE2A 3JB9D 3G4ST 3NTKA 2E41A 3OS1A 4BACA 4M7DA 2KK4A 3UT1A 3C94A 4EMKB 4M75C 3QKJA 3FB9A 5KE2A 4JUVA 4VUBA 3X28B 1VUBA 4KULA 3CXCA 2WSCE 1VQMT 4KBMB 5GMKi 3SB2A 4V2SA 2RHYA 2K3XA 3GNFB 2RO0A 4R56A 4C0GA 1QW1A 3GOXA 4O6JA 2PUKB 3M59A 4RCBA 4QVCA 3HKSA 2K4YA 4J5YA 2K2VA 2B8AA 3VJPA 3AHUA 2RHXA 3OQ5A 3OBWA 1UGSB 2YLCA 2ZGWA 3GP8A 1UEBA 3CCQA 4OP0A 4ZN3A 3MO8A 4F7UG 4BDZA 1VQ5T 1Q86C 1VQ6T 3HPWA 4D6WA 1K8AU 1YHQA 1YITA 2CZ7B 2DXTA 1G3WA 3ZEHA 3CBMA 3CCLT 3GIBA 2YLBA 4F7UE 3SD4A 4J7IA 3J80E 4IUVA 1WJRA 1B34A 4J7FA 3X20B 3CPWA 2XDBA 3ZFJA 2GF7A 2CZ0B 1YJWT 1RL2A 3BFMA 5GAN3 3LW5E 5M9OA 2X4YA 2R57A 4BDYA 1ZHIA 4EMHA 1G3TA 2GQVA 5D6WA 5A0LA 3CCJA 5FRNA 1I4K1 2JNGA 4PNOA 2X4XA 4N4IA 4RMOA 2YRVA 3LH0A 2XK0A 3X24B 1VQLT 3CC7T 3RUXA 4JRIA 2E1HA 1WJQA 5GAMe 2IVWA 4JLIA 1BKBA 2X35A 4FL6A 3SWNC 3S3MA 2HBPA 4C8QA 4XQ3A 3A8GB 4BE0A 4OB1B 3I56A 1VQ8T 4HKEA 1Q7YC 1KC8C 3JCMP 4EDUA 5CKDA 1VQ7A 1W4SA 3JCMb 3OYAA 2ZPHB 3OYYA 5GAOr 1S72T 2RM4A 4JRKA 4X9CA 1D3BB 2GCXA 1V29B 3DB4A 3QJYA 2XKOC 4EMKC 1NE8A 3S3NA 4HCCA 4ZTFA 3VYHB 2DVEA 3E9GA 3A8LB 3A8OB 2DPPB 1NZ9A 2JOYA 2RI2A 2RJCA 4B9XA 3OYJA 5DLOA 3FLGA 4LD9K 4XK8E 1BI0A 3TCJA 2LX9A 2ZPBB 3MHXA 3OW2A 1YIJT 2DD5A 1ZBXA 1BI2A 1ZQ1A 4M75A 5FROA 1XQHA 4NL2A 4C5HA 1UGQB 1KQSA 3F70A 3TEEA 1OI1A 2OTJT 3A5ZB 4JS5A 5DLQE 2MI6A 2QEXT 5GAOp 5AYFA 3E1SA 3DLLA 1M1KU 4C8QE 2P0QA 3OB9A 2EQKA 2X4JA 3JCMc 1BI1A 3INZA 4M77G 2GFUA 4ZGDB 1M5Q1 4XTVA 2KY9A 4J6WA 2LCCA 2XG8D 3M56A 3QBYA 4JLGA 4M77E 3G4SA 1NJIU 3CC2T 2E5QA 3JCMJ 2JN0A 1N27A 2L3RA 2MF2A 1QVGS 2DD4A 1MHNA 2KVQG 2O4XA 4PJOG 1O9SA 3BW1A 5LJ5d 1AHJB 3LYIA 4C8QF 4C0FA 2O01E 5IT9E 3VV0A 2QA4T 2EIFA 3EFRA 3QG1A 3L2VA 4XU0A 3SDZA 5A0GA 1VQ9A 2DTHA 2F5TX 2XU8A 5EG2A 1HK9A 2K5LA 4OGEA 5IAYA 3QXEB 3M57A 3V8KA 3GPLA 3CCVA 3CD6T 2QQRA 4M78B 1VQ6A 5CKFA 3JCMd 3OYBA 2PVOB 1LOJA 2CZ1B 5LJ5e 2V8IA 1M9SA 1N8RC 2MMPA 3OA6A 4M77C 3TU4K 4BD3A 4LDXA 5GMKe 2XIDA 2P0KA 1KQ1A 4PLLA 4Q5WA 4C92B 4WF2A 4M75F 3SWNA 2QI2A 4OVAA 3RIRA 3JB9G 3QZ9B 4C5EA 2M1HA 2XHCA 3RMSA 2CGHA 2ZZDA 4QVZA 4F7UA 4BI4A 1O75A 3HRUA 4NS5A 3JCMe 3CMET 1Q86U 4PJOC 2OAUA 4XTZA 1QVPA 2QDYB 4HT8A 2RB6A 4DQ2A 2L5QA 4IUTA 1VQOT 1UGRB 3KXTA 4J83A 5LJ5h 3BDLA 4RCCA 3ZBDA 5CAIA 4EMKA 5IN1A 1KHCA 3RESA 4ELYC 3G71A 3CC7A 1XTDA 5GMKl 4E7HA 4BB7A 2D6FA 3FRNA 3WVEB 1KD1C 2VUBA 2VYTA 3PGGA 4FU6A 3QJ6A 5GAN5 2CKKA 4MDXA 4PLIA 3NFCA 5GAN6 4MMLA 3JAME 3QSUA 5KE3A 1Y71A 2F69A 4M7AB 2KSSA 4M78D 5LJ5g 2JUFA 4C5IA 4ZTJA 3MEVA 4KT0E 3QYHB 2D0QB 3JCMh 5I21A 4OB3B 4LD6A 3S3OA 5LJ5f 2LT1A 2DZ9A 1JJ2S 2JTMA 2LNVA 3H8ZA 5LJ5j 3WXMB 3CCET 4M7DB 2DIGA 3H6ZA 3PFSA 2DTOA 4C92D 2PQWA 4OB0B 4HA8A 3LWHA 1Q7YU 1KC8U 3OS5A 2WSEE 4BY6B 1Q82U 3VYGA 3JCMg 5CK9A 5GMKj 1VIFA 1Y7XA 1XNIA 5GAMd 1VQ4T 2P0PA 2PU9B 3HFOA 4IUUA 1FX7A 5CKEA 3OYKA 2OTJA 5GAOq 5HK0A 3FC3A 2RD1A 2QEXA 4GLKA 4F7UF 3NTHA 2QTXA 3ME9A 1K9MC 4XTUA 4TVRA 3ER0A 3KBGA 5CKHA 1VQKA 2CYZB 2IG0A 2LQKA 2NLUA 3G6ET 4ZGEB 4E7KA 3MEWA 5LL6S 3CCRT 3CCMT 3BDUA 1VQPA 1M90U 3OSSC 2V8KA 1B34B 3X26B 3CC2A 4DOWA 4M7AD 1YI2T 5CO7A 1WGSA 3E9FA 1PSEA 2LDMA 3M54A 1I81A 2PVGB 1LNXA 2RI3A 4J6YA 2DZCA 4PKCC 2KDSA 2XD0A 1JRIA 5FU7B 3CC4T 2QA4A 3BY7A 4M77A 3QZ5B 3LGLA 4M7DD 2L8DA 2EJ9A 2A7YA 5A0DA 4QVDA 4E47A 3CCST 4OMFB 1YJ9A 3E19A 1MGQA 4XU3A 5J39A 1UGPB 4OB2B 3I55T 2RK1A 4MZMA 3HP9A 4CI0C 3JB9I 2DAQA 4NL3A 3CD6A 5D6YA 3PNWC 2CS7A 3OYMA 4ATOA 2DK3A 3FDRA 4E7LA 4PJOA 2EWNA 3DKMA 1K8AC 3J81E 2DJZA 2DO3A 2HNIA 4C8QB 5GAMh 4E7IA 2K57A 1YJNT 2E70A 1BYMA 2DXBA 3L2ZA 4C0DB 4CRIA 3LLRA 4M7AC 1NPPA 2LVMA 1VQNT 5GAN8 1XOVA 1RI0A 2EQUA 2EQJA 3M53A 3QYGB 4X9DA 3PIOA 5LJ3d 3UPUA 2X4WA 3QO3A 3HSBA 4M7AA 2BIVA 3MEAA 3DB3A 3L42A 3QDRB 2EJFA 4C0ZA 5GAMg 2VGNA 3CCQT 2E10A 4Y28E 5CQYA 3CMEA 3CCUA 2AHJB 2RHUA 1YITT 5HY6A 3A8HB 1N8RU 5GAOn 5GAMf 2EKOA 3S6WA 3PIPA 2RJDA 5GANd 1BI3A 1FWZA 5GAMj 2EJGA 2JZ2A 3QUIA 4A54A 5LJ3e 3OY9A 3CMAA 5CIUA 3HHTB 3L1AA 1VQMA 3M9QA 1Y96A 4KUIA 4M75B 4RKUE 4PJOE 4ZN1A 1N9RA 4EPCA 4M77F 2M9UA 5GANe 3J7AF 4J6XA 2VC8A 3JCMQ 3G7ZA 2VGMA 4C8QD 5FU6B 2EAYA 2E6ZA 3RMQA 5GAOl 1WQ7A 1VQ5A 4YTLA 2VXEA 2M0OA 4PJOF 3CCEA 1KD1U 2O4XB 1Q81C 1JJ2A 3CCLA 3RERA 5CCAA 5DY9A 3I56T 4IUPA 5LJ3h 1VIEA 1FXXA 1LJOA 1VQ7T 4KUDK 5L8RE 3OYFA 1NPRA 1N6AA 2DXUA 3JCMX 2V8JA 1IZ6A 4XTXA 2LTOA 2FYKA 2LT4A 1P92A 5CQXA 3PMTA 4RG8A 2FHDA 4R55A 2BUDA 2RJFA 3ASKA 5LJ3g 5GANh 3EAEA 2H3JA 2BKDN 2Y4XA 2QXFA 2Y4YA 3M4YA 3N5BB 3OYLA 4DOVA 2WACA 2JTFA 3VUBA 4M75D 4JDSA 4MZTA 3X25B 3C4SA 5KCHA 3G6EA 1M1GA 4PL6A 2Y90A 4M78G 5LJ3j 3OYGA 3CCMA 4LDVA 3JB9J 4IKFA 4XTWA 3VKIA 1EIFA 1G3YA 2EQMA 2HQEA 2QQSA 1U1TA 1K73C 1U1SA 5GANg 3JB9F 3V7CA 1H3ZA 2ZPIB 4M78E 4N0AC 3SWNB 5GMKh 3CEYA 1VQ8A 2ZPEB 4L6V5 5J26A 4A4EA 4N4HA 1YJWA 1R8OB 2XDPA 3O8VA 4A53A 4B9WA 1K9MU 4F7UB 5KCOA 2F5KA 4QW2A 3LGFA 5HKCA 1WQWA 3M5AA 4C92G 5GANf 3L2RA 5GANj 3DLMA 4X34A 1I5LA 4FIBA 3MP8A 3CCSA 2R58A 5GAOm 3VUZA 3QIIA 2VV5A 3C12A 2DKGA 3MEUA 3FIFA 4C92E 3I55A 3CBPA 1X6OA 4M78F 1KHIA 3CC4A 2K3YA 5I2MA 2XICA 3SFMA 3V8JA 4XTYA 1DJ7B 2XDDA 5DM7R 4UC4A 3OYIA 1YJNA 3TREA 1YIJA 2CZ6B 4HT9A 4GY5A 1VQNA 1VQ9T 3UDCA 2K5IA 2KMTA 4C92F 3JCMf 5FU6C 3QPHA 2I2LA 2ZPFB 3HRSA 4M78C 3FJPA 1X01A 2YHTA 3CCVT 2A3LA 3FEOA 2R5MA 4FSXA 1N9SA 1W2BS 2RI5A 3HFNA 4M7AG 3META 2RA2A 5C6SA 3OBYA 3L2UA 4A4FA 1QVFS 4FT2A 2HAXA 2VXFA 1H641 4M7AE 2DTIA 5GMKm 2E6NA 4O5VA 3M4GA 3RKXA 4II1A 4QQ6A 5FLXE 4C92C 4M7DG 5A2QE 2KAFA 1I8FA 2LC4A 1M4ZA 3R6OA 3GF5A 1QVGA 4IUQA 1JB0E 3P8BB 4Y91A 4EMGA 3OYHA 1S72A 2E12A 4QQGA 3OS2A 2EFIA 4M7DE 4LDYA 2OTLT 4E7JA 5KH6A 2D9TA 4A4HA 4JRQA 4M7AF 1HXDA 3LX7A 5C0MA 3L2WA 3URGA 1D3BA 1YBYA 3UWNA 2R5AA 1IREB 2MAMA 3T9NA 2RHZA 4P5NA 1SSFA 3CPFA 3CXCS 2LRQA 5GAN4 5I2SA 3G71T 4M7DF 4L5GA 3JCMV 1BIAA 2GFAA 2QQ9A 5CKBA 2PVDB 4JS4A 3JCMW 4BI8B 5D6XA 3HRTA 3OYDA 3L2QA 1Q82C 1G5VA 2RH2A 2FVUA 4M77B 1X75C 3P8HA 2HD0A 1OYXA 2HQXA 3A8MB 4ME7A 4N0AA 4M7DC 4FM4B 2RK2A 3JSCA 1U8RA 2RHIA 3P8DA 2DXCA 1YHQT 1QP3A 5GAN7 2WSFE 1Q81U 4C5GA 4PJOB 2E64A 3M58A 2E65A 3PMIA 3KUFA 1WPYA 2XI9A 4HCZA 4Z02A 4BY6C 3CPWS 1VQOA 3NTIA 2ZPGB 1VQLA 4XU2A 3OMCA 4OGCA 1M90C 2G3RA 3V8LA 4RG2A 2LCLA 5FRMA 4C8QG 3OYNA 1JBMA 2K5FA 3V7RA 3CCJT 4ZGJB 2DEQA 3OS0A 3LWIA 2QQAA 4LDWA 1WNLA 4DA4A 2DIQA 3MP1A 3VU3C 2M16A 4L59A 2FL7A 3CBOA 4A4GA 1VQKT 1KQ2A 3MP6A 4FT4A 4M78A 1BIBA 1VQPT 4XAXB 3JB9H 1G3SA 4NOYA 1PSFA 2JVVA 5GAN2 1K73U 2EYQA 2MWOA 2PUOB 1OZ3A 2KQWA 4M77D 5FU7C 3CMAT 1Y96B 3JRZA 2P4TA 3PT9A 4QQDA 4XU1A 2FB7A 4IURA 4MDWA 1GXIE 4C92A 1VQ4A 2L89A 4A4KA 4J8OA 1M1FA 4M75G 4BUGA 4PJOD 1YJ9T 3GLXA 3OSVA 1M1KC 3V7SA 4M75E 3RKWA 4ELZC 4OF1A 4C8QC 1M8VA 2C06A 1KG1A 1OZ2A 1W2BA 4C0DC 4JRPA 5LJ3f 3OW2S 3OYCA 3OYEA 5CVIA 1QVFA 3RKYA 2RJEA 3CCRA 3C95A 1NJIC 1KQSS 4BE1A 1QP2A 1YI2A 4HCBA 3EFSA 3OMGA 4BI3A 3WVDB 4JJNK 3HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 d;  4PJO A;  4C8Q F;  1N9S A;  2EWN A;  3HFN A;  3QHS A;  4M7A G;  1YCY A;  2RA2 A;  2DJZ A;  2HNI A;  4C8Q B;  5GAM h;  4MMK A;  2K57 A;  3EFR A;  1TH7 A;  2VXF A;  1H64 1;  3L2Z A;  4M7A E;  4M7A C;  4XU0 A;  2DTI A;  5GMK m;  2DTH A;  3M4G A;  3RKX A;  4X9D A;  5GAN 8;  3HSB A;  4C92 C;  3JB9 D;  1HK9 A;  5LJ3 d;  4M7D G;  3QO3 A;  2E41 A;  4M7D A;  1I8F A;  3V8K A;  4Y91 A;  4M75 C;  4EMG A;  3FB9 A;  4EMK B;  4JUV A;  4M78 B;  2EJF A;  5GAM g;  4M7D E;  3JCM d;  2E10 A;  5GMK i;  1LOJ A;  5LJ5 e;  3SB2 A;  4V2S A;  4M7A F;  1HXD A;  5GAO n;  5GAM f;  1D3B A;  4M77 C;  5GAN d;  4QVC A;  4RCB A;  5GAM j;  5GMK e;  2EJG A;  4J5Y A;  3QUI A;  1KQ1 A;  3AHU A;  4A54 A;  4C92 B;  4WF2 A;  4M75 F;  3SWN A;  5LJ3 e;  3RIR A;  2YLC A;  2ZGW A;  5GAN 4;  3JB9 G;  3L1A A;  4M7D F;  4OP0 A;  1Y96 A;  2CGH A;  4M75 B;  3JCM V;  1BIA A;  4F7U G;  4F7U A;  3JCM e;  4PJO C;  4PJO E;  3JCM W;  2DXT A;  3GIB A;  4XTZ A;  2YLB A;  4HT8 A;  1N9R A;  2RB6 A;  4DQ2 A;  4F7U E;  4M77 F;  1B34 A;  4NL3 A;  5GAN e;  4M77 B;  4J6X A;  2VC8 A;  5LJ5 h;  3JCM Q;  4RCC A;  4C8Q D;  5CAI A;  4EMK A;  3RES A;  2EAY A;  5GAO l;  3BFM A;  4N0A A;  1WQ7 A;  5GMK l;  4M7D C;  5GAN 3;  3PGG A;  2VXE A;  4PJO F;  3RER A;  5GAN 5;  4EMH A;  5GAN 7;  5GAN 6;  4MML A;  5DY9 A;  4PJO B;  2E64 A;  2E65 A;  1I4K 1;  5LJ3 h;  1WPY A;  4PNO A;  4M7A B;  4M78 D;  5LJ5 g;  1LJO A;  4XU2 A;  2DXU A;  3JCM X;  3JCM h;  5I21 A;  4XTX A;  3RUX A;  2FYK A;  4JRI A;  2E1H A;  5LJ5 f;  5GAM e;  3V8L A;  2DZ9 A;  4JLI A;  3SWN C;  4C8Q G;  5LJ5 j;  4M7D B;  4C8Q A;  4XQ3 A;  1JBM A;  5LJ3 g;  5GAN h;  2DTO A;  3V7R A;  4C92 D;  2DEQ A;  3JCM P;  4HA8 A;  1WNL A;  3JCM b;  5GAO r;  4M75 D;  3JCM g;  3VU3 C;  5GMK j;  1KQ2 A;  2RM4 A;  4JRK A;  5GAM d;  2Y90 A;  4M78 G;  5LJ3 j;  4X9C A;  1D3B B;  3HFO A;  4M78 A;  1BIB A;  3JB9 J;  4XTW A;  3JB9 H;  4NOY A;  1U1T A;  4EMK C;  5GAN 2;  1U1S A;  5GAN g;  3JB9 F;  3V7C A;  5GAO q;  4M78 E;  4N0A C;  3SWN B;  2RD1 A;  2DVE A;  4M77 D;  4F7U F;  5GMK h;  2QTX A;  4XTU A;  1Y96 B;  4A53 A;  4M7A A;  4F7U B;  4XU1 A;  5GAN f;  2FB7 A;  1WQW A;  4C92 G;  5GAN j;  4C92 A;  1I5L A;  5GAO m;  3BDU A;  4M75 G;  4PJO D;  4M75 A;  2DKG A;  4NL2 A;  1B34 B;  3FIF A;  4C92 E;  4M7A D;  4M78 F;  4J6Y A;  1I81 A;  4PJO G;  1LNX A;  4M75 E;  3RKW A;  4XTY A;  2DZC A;  3V7S A;  3V8J A;  5GAO p;  4C8Q C;  4C8Q E;  1M8V A;  3JCM c;  1JRI A;  3INZ A;  4M77 G;  3BY7 A;  5LJ3 f;  4M77 A;  1M5Q 1;  4XTV A;  4M7D D;  4J6W A;  3RKY A;  4HT9 A;  2EJ9 A;  4QVD A;  4XU3 A;  1MGQ A;  4M77 E;  4C92 F;  3JCM f;  3JCM J;  2JN0 A;  3EFS A;  2I2L A;  4M78 C;  3QSU A;  3FJP A;  3JB9 I;  1X01 A;  2YHT A;  3BW1 A; 
#chains in the Genus database with same CATH topology
 1T3L A;  3QHS A;  4LDU A;  2OTL A;  1YCY A;  2MWP A;  5J3B A;  1TH7 A;  2ZCF B;  4LXC A;  1WX6 A;  1GFC A;  1RAB B;  3M55 A;  4MZP A;  1R0C B;  3JB9 D;  3NTK A;  3OS1 A;  2KK4 A;  3C94 A;  3QKJ A;  3FB9 A;  5KE2 A;  3CXC A;  3X28 B;  2HCK A;  1GBR A;  1VQM T;  2EGC A;  4KBM B;  3SB2 A;  1TS9 A;  3UAT A;  4V2S A;  4R56 A;  1BCM A;  2CUB A;  9ATC B;  2K2V A;  2RHX A;  3CQT A;  4BDZ A;  3MO8 A;  1VQ5 T;  5IHN A;  1G3W A;  1VQ4 Q;  4J7I A;  3J80 E;  2SEM A;  4JJB A;  3ZFJ A;  3SEM A;  1X6G A;  4RTU A;  1G3T A;  2ED1 A;  4PNO A;  5D7U A;  3CCR Q;  4N4I A;  4RMO A;  2BE7 D;  3LH0 A;  3EG2 A;  1YI2 Q;  1BKB A;  1FMW A;  4C8Q A;  3CC4 Q;  8ATC B;  1AT1 B;  1VQ8 T;  1Q7Y C;  3EGD B;  3JCM b;  2NUT B;  3RDV A;  1D0X A;  1K9A A;  1NE8 A;  1MMG A;  2AZS A;  3E9G A;  3A8L B;  2JOY A;  2JMA A;  2CH4 W;  3NHN A;  2JW4 A;  1FMK A;  1V76 A;  2LX9 A;  3TCJ A;  4E7S A;  1Q81 R;  2LQW A;  2DD5 A;  2FPF A;  1CKA A;  1XQH A;  3TEE A;  4AFQ C;  3CCQ Q;  3OW2 P;  2GNC A;  3A5Z B;  4JS5 A;  5GAO p;  5AYF A;  2MOX A;  1M1K U;  1KQS P;  1BI1 A;  2GFU A;  1AWJ A;  1OUL A;  3EHR A;  2BZ8 A;  3JCM J;  2L3R A;  2O4X A;  1O9S A;  5LJ5 d;  1AHJ B;  3CCJ Q;  1M3C A;  2O01 E;  3QG1 A;  1Y0M A;  2BZY A;  2DTH A;  2JJ9 A;  1RUW A;  5EG2 A;  4FYY B;  3QXE B;  3H41 A;  1WHM A;  2PTK A;  3JCM d;  3OYB A;  5LJ5 e;  1LOJ A;  2V8I A;  2YUO A;  3U23 A;  4M77 C;  1NYF A;  1WHH A;  1JU5 C;  5GMK e;  2XID A;  1YJW A;  2KYM A;  4QVZ A;  4F7U A;  4BI4 A;  4NS5 A;  3JCM e;  3H0H A;  2EYW A;  2QDY B;  1A0N B;  1X6B A;  1Y57 A;  1K9M R;  1VQO T;  2K2M A;  5KYY A;  5LJ5 h;  5CAI A;  3CC7 A;  1VQL A;  4ELY C;  1WXT A;  4PLI A;  3JAM E;  4M78 D;  5LJ5 g;  4ZTJ A;  3MEV A;  1RAA B;  3G4S Q;  2L2P A;  3QYH B;  2D0Q B;  3JCM h;  4PJM A;  1KIK A;  1KFZ A;  3H8Z A;  5LJ5 j;  4M7D B;  3WXM B;  2DIG A;  2JM9 A;  1PRL C;  1Q7Y U;  4BY6 B;  1AEY A;  2MIO A;  3JCM g;  3VYG A;  5CK9 A;  5GMK j;  1Y7X A;  2G6F X;  3HFO A;  2P4R A;  3ZL7 C;  1FX7 A;  3OYK A;  1TTH B;  1VQ6 Q;  5GAO q;  3FC3 A;  2RD1 A;  2QEX A;  1G8X A;  3UA6 A;  2A37 A;  2YRD A;  3MEW A;  1FYN A;  3CCM T;  1PSE A;  2DVJ A;  4J6Y A;  2QK0 A;  1LNX A;  1K0S A;  1JRI A;  1RAD B;  3KFV A;  4M77 A;  3QZ5 B;  2EJ9 A;  2A7Y A;  4QVD A;  1YJ9 A;  8AT1 B;  3QSU A;  4NL3 A;  2CS7 A;  2CH4 A;  2OX7 A;  1MMN A;  3J81 E;  2MK5 A;  2HNI A;  4E7I A;  2DJQ A;  3L2Z A;  4CRI A;  1NPP A;  1VQN T;  4J9D A;  3M53 A;  2K6D A;  1UE9 A;  3QO3 A;  2EGE A;  1G83 A;  1K76 A;  4C0Z A;  2VGN A;  1WHJ A;  3O5Z A;  3CME A;  2RHU A;  1YIT T;  5IXB A;  5GAO n;  2EKO A;  1FWZ A;  2RQW A;  3QUI A;  2K9G A;  1Z9Z A;  5KYU A;  2QYZ A;  1UJ0 A;  1BCO A;  1VQM A;  2KNB B;  3VS7 A;  1UUE A;  4PJO E;  2L3S A;  2RQV A;  2KYB A;  2M9U A;  4QKU A;  4ORZ A;  3JCM Q;  3EH2 A;  1D09 B;  2E6Z A;  1WQ7 A;  2FG0 A;  1VQ5 A;  2M0O A;  3CCE A;  1VIE A;  4R0K A;  1LJO A;  1VQ7 T;  4KUD K;  3JCM X;  3EG9 A;  5GJW B;  3I35 A;  3PMT A;  4RG8 A;  1W70 A;  3ASK A;  2RJF A;  2BKD N;  2Y4Y A;  3D7S B;  2QGG A;  2WAC A;  3X25 B;  3VUB A;  2B86 A;  2J7I A;  2ZAE A;  4JDS A;  3C4S A;  4M75 D;  1AZE A;  1M1G A;  2Y90 A;  4D8D A;  3JB9 J;  1K73 C;  2HQE A;  3JB9 F;  4N0A C;  3SWN B;  1VQ8 A;  3CEY A;  1TUD A;  3O8V A;  3CC4 A;  5GAN f;  1MMD A;  4QW2 A;  3M5A A;  4FIB A;  4Z8A A;  3C12 A;  3CBP A;  1WA7 A;  1AWX A;  1M2O A;  2XIC A;  2C0T A;  1OX8 A;  4UC4 A;  1SEM A;  4F16 A;  2DL5 A;  4GY5 A;  1VQ9 T;  2K5I A;  1Q82 R;  3FJP A;  3CCL Q;  3VS4 A;  4M7A G;  1W2B S;  1WHL A;  2EYY A;  5C6S A;  1QVF S;  1QLY A;  3VS3 A;  4M7A E;  1AOJ A;  5GMK m;  5FLX E;  4C92 C;  5A2Q E;  1M4Z A;  3GF5 A;  1JB0 E;  2K7A A;  1M90 R;  4X1V A;  2OTL T;  1I07 A;  5KH6 A;  1ZA1 B;  2DL8 A;  1QVG P;  4JRQ A;  7AT1 B;  3EG3 A;  3UWN A;  2RHZ A;  2X3W D;  1SSF A;  4P5N A;  5I2S A;  4M7D F;  1R0B G;  5IXF A;  5CKB A;  3JCM W;  1S72 Q;  4KRT A;  5FW9 A;  2RH2 A;  4FW2 A;  1OV3 A;  4RTY A;  2HD0 A;  1OYX A;  2H8H A;  2HQX A;  4ME7 A;  4N0A A;  1YP5 A;  2Z0W A;  2DL4 A;  1U8R A;  5IHI A;  1MND A;  1AD5 A;  2DXC A;  5GAN 7;  2WSF E;  4C5G A;  1VQO A;  1WPY A;  2XI9 A;  3CPW S;  4Z02 A;  3NTI A;  2ZPG B;  1WHK A;  3V8L A;  4C8Q G;  3OYN A;  2CRE A;  3OS0 A;  3LWI A;  4L59 A;  2M16 A;  1PG5 B;  2M51 A;  3MP6 A;  4FT4 A;  1VQP T;  4XAX B;  2KRM A;  1PSF A;  1K73 U;  2EYQ A;  2PUO B;  4ANJ A;  2QA4 Q;  1BU1 A;  3JRZ A;  4XU1 A;  3FJ5 A;  2EGA A;  4KGZ B;  4MDW A;  4C92 A;  4F17 A;  2L89 A;  3QWY A;  2YXY A;  1M1F A;  2HKN A;  2SRC A;  4PJO D;  3GLX A;  1ZBJ A;  3OSV A;  2FZK B;  4ELZ C;  4OF1 A;  2RQU A;  1MMA A;  1OZ2 A;  2IIM A;  3RKY A;  1NJI C;  1QP2 A;  4HCB A;  2RQR A;  3EFS A;  2DM1 A;  1SF9 A;  4JJN K;  3PTA A;  1ZX6 A;  4F04 B;  3GNG A;  1WYX A;  4N4G A;  3CCU T;  5KYX B;  3CMA Q;  2LQ8 A;  4BE2 A;  2E41 A;  2MPX C;  1VUB A;  1H8K A;  4DBR A;  3CXC P;  2K3X A;  3GNF B;  2RO0 A;  4C0G A;  4QVC A;  3HKS A;  3VJP A;  2B8A A;  3AHU A;  4Y92 A;  3GP8 A;  2ZGW A;  2VWF A;  4F7U G;  3HPW A;  4D6W A;  1K8A U;  1YIT A;  2CZ7 B;  3ZEH A;  3CBM A;  2YLB A;  4F7U E;  2J05 A;  3I5R A;  1X43 A;  1B34 A;  2XDB A;  2CZ0 B;  1YJW T;  1NG2 A;  3BFM A;  1YFN A;  1NLP C;  1ZLM A;  3LW5 E;  2R57 A;  1QQJ A;  1ZHI A;  4EMH A;  2GQV A;  5D6W A;  2JNG A;  2X4X A;  2DL3 A;  4A63 B;  3VS0 A;  2DRK A;  3X24 B;  1VQL T;  1KJW A;  3CC7 T;  5GAM e;  2X35 A;  3S3M A;  4FL6 A;  2HBP A;  4XQ3 A;  2KXC A;  4BE0 A;  1K4U S;  1KC8 C;  1VQ7 A;  3OYA A;  3OYY A;  2RNA A;  2RM4 A;  4JRK A;  3I55 Q;  2X9H A;  1JO8 A;  4B6M A;  4J9G A;  1LVK A;  3QJY A;  4WCI A;  3S3N A;  2DPP B;  2RJC A;  2RI2 A;  3M0S A;  1ZUU A;  4AFZ C;  5DLO A;  2ZPB B;  1N8R R;  2JXB A;  1ZQ1 A;  1RAH B;  1OI1 A;  4HVW A;  2QEX T;  1YHQ Q;  2P0Q A;  3OB9 A;  3JCM c;  3NMZ C;  4M77 G;  4XTV A;  2XG8 D;  4M77 E;  1NJI U;  2E5Q A;  5FRN A;  2MF2 A;  1N27 A;  1QVG S;  2DD4 A;  2KVQ G;  3BW1 A;  3VV0 A;  2M02 A;  4XU0 A;  5A0G A;  1VQ9 A;  2F5T X;  3EFO B;  1KK7 A;  1NM7 A;  2QQR A;  4RTZ A;  2PVO B;  3I56 Q;  1SRL A;  2J6K A;  4FSS A;  3TU4 K;  2HL5 C;  4Z88 A;  2RF0 A;  4WF2 A;  4M75 F;  4OVA A;  2C0O A;  3QZ9 B;  2M1H A;  2CGH A;  2ZZD A;  1NYG A;  2XMF A;  3CME T;  2OAU A;  1QVP A;  1WIE A;  3KXT A;  4J83 A;  3RES A;  1KHC A;  4PFP A;  4E7H A;  4BB7 A;  4KGX B;  1KD1 C;  4FU6 A;  3QJ6 A;  5GAN 5;  4MDX A;  4MML A;  3TVT A;  5KE3 A;  2F69 A;  4M7A B;  2JUF A;  4LD6 A;  5LJ5 f;  2EVR A;  2LT1 A;  2FZG B;  1JJ2 S;  2LNV A;  5I22 A;  1CKB A;  3CCE T;  2J6F A;  1KC8 U;  3OS5 A;  2X3X D;  1U5S A;  1VQ4 T;  2YWW A;  4IUU A;  3CCV Q;  1OQK A;  1JQQ A;  5IH2 A;  5HK0 A;  4GLK A;  1K9M C;  3ME9 A;  2KT1 A;  3M0U A;  2NLU A;  4PFO A;  3CCR T;  1VQP A;  2CSI A;  3CC2 A;  1YI2 T;  3E9F A;  2DZC A;  2KDS A;  5FU7 B;  3CC4 T;  1X2K A;  1R77 A;  2QA4 A;  4M7D D;  1EFN A;  1UFF A;  4E47 A;  2COZ A;  1MGQ A;  3G71 Q;  3I9Q A;  2RK1 A;  1NLO C;  3JB9 I;  2DAQ A;  2YUN A;  3FDR A;  4E7L A;  2EWN A;  2DRM A;  1MNE A;  4C8Q B;  2E70 A;  1BYM A;  4C0D B;  4FW1 A;  3LLR A;  5GAN 8;  2FO0 A;  2EQU A;  1GBQ A;  2EQJ A;  3PIO A;  3HSB A;  2EJF A;  1BK2 A;  4QT7 A;  3CCQ T;  2E10 A;  4Y28 E;  5GJV B;  5KYW A;  3CCU A;  4IIM A;  5HY6 A;  2CUD A;  3S6W A;  3PIP A;  1BI3 A;  4J9F A;  4E2F B;  5FWC A;  2ED0 A;  4A54 A;  3CMA A;  3RBB B;  5CIU A;  2LJ3 A;  1Y96 A;  4KUI A;  4RKU E;  2A08 A;  1PWT A;  1EZZ B;  2A28 A;  1VQK Q;  1QWE A;  1I0C A;  1M3B A;  3TSZ A;  4J6X A;  2VC8 A;  3G7Z A;  2VGM A;  3RMQ A;  3RNJ A;  2HQH A;  4PJO F;  1KD1 U;  2KR3 A;  2O4X B;  1IHV A;  4D8K A;  1FXX A;  3UA7 A;  1IGQ A;  4HCK A;  3OYF A;  1VYU A;  2FYK A;  2LT4 A;  4DEX A;  1FMV A;  2FHD A;  4R55 A;  2FRW A;  4CC3 A;  2F2X A;  3M4Y A;  2QXF A;  2JTF A;  3G6E A;  4PJN A;  4LDV A;  2EQM A;  2KT8 A;  2V26 A;  2QAS A;  5GMK h;  4F14 A;  2ZPE B;  4L6V 5;  3I5S A;  1QKW A;  2XDP A;  1K9M U;  1AWW A;  4F7U B;  5KCO A;  2F5K A;  3LGF A;  1X69 A;  2GQI A;  2EPD A;  4C92 G;  3DLM A;  1I5L A;  2BTT A;  2DER A;  2R58 A;  1TXQ A;  3VUZ A;  3QII A;  2VV5 A;  5KYY B;  2DKG A;  4C92 E;  3I55 A;  4HVV A;  2GBQ A;  3SFM A;  1DJ7 B;  3TRE A;  1SHG A;  2CZ6 B;  1D1C A;  2DX1 A;  2COW A;  4J9C A;  1PKS A;  1YCS B;  2I2L A;  2ZPF B;  1PHT A;  4M78 C;  5AT1 B;  3EGX B;  3REA B;  3HFN A;  4FT2 A;  2DTI A;  4O5V A;  3M4G A;  1UJY A;  2AK5 A;  2OJ2 A;  2KAF A;  1I8F A;  4Y91 A;  3EG0 A;  4GBQ A;  4KH1 B;  4E7J A;  2D9T A;  4A4H A;  4M7A F;  3LX7 A;  4DBF A;  5C0M A;  3L2W A;  1D3B A;  3CCM Q;  1ABQ A;  1IRE B;  2O88 A;  1NEG A;  4LUE A;  2NUZ A;  5GAN 4;  1RAC B;  2GFA A;  2JT4 A;  2COY A;  4BI8 B;  3HRT A;  1Q82 C;  4M77 B;  3P8H A;  2KRN A;  1D0Y A;  1PRM C;  2RHI A;  3P8D A;  3PMI A;  1YIJ Q;  3ULR B;  1VQN Q;  4OGC A;  2OTJ Q;  1PM3 A;  1M90 C;  1M3A A;  2K5F A;  4OMN A;  3V7R A;  4ZGJ B;  1M8M A;  4LDW A;  3VS2 A;  4DA4 A;  1YWP A;  2XD0 A;  1SG5 A;  1UGV A;  2FL7 A;  4AG1 C;  4M78 A;  5GAN 2;  2MWO A;  1OZ3 A;  1ZUK A;  3JV3 A;  5KYU B;  2P4T A;  3PT9 A;  4IUR A;  2DYI A;  1GXI E;  1VQ4 A;  2FPE A;  2A36 A;  3CD6 Q;  1TWB A;  2ABL A;  3EG1 A;  1W2B A;  1QMC A;  5LJ3 f;  3OW2 S;  1QVF A;  3CCR A;  1RAE B;  4JJD A;  1KQS S;  2PNI A;  1YI2 A;  3OMG A;  1NBE B;  2EKH A;  4J5Y A;  3HL8 A;  1W6X A;  1VA7 A;  2GGR A;  3Q1J A;  3MJX A;  4MMK A;  3MCA B;  4AFU C;  1LCK A;  5CR2 A;  1M30 A;  1WJS A;  2HKQ B;  3MPU B;  1B07 A;  1BB9 A;  3UT1 A;  4EMK B;  4M75 C;  3DLL A;  1X27 A;  4JUV A;  4KUL A;  1OPL A;  1YWO A;  2FPD A;  5IHK A;  2EYX A;  4M4Z A;  1QW1 A;  3GOX A;  2FRY A;  4RCB A;  4DBQ A;  1I1J A;  2YLC A;  3CCQ A;  1Q86 C;  2DXT A;  3CCL T;  2E5K A;  3RR6 A;  3CPW A;  4J7F A;  2GF7 A;  1MUZ A;  1RL2 A;  2NUP A;  5M9O A;  5A0L A;  3CCJ A;  1HD3 A;  1E6H A;  1PCX A;  2E1H A;  4JLI A;  3A8G B;  1RI9 A;  2LP5 A;  3JCM P;  3CCS Q;  5CKD A;  1W4S A;  1S72 T;  3LH5 A;  1VYT A;  4X9C A;  2GCX A;  1ZSZ C;  1V29 B;  3DB4 A;  2XKO C;  4HCC A;  4ZTF A;  1YJN Q;  3OYJ A;  4B9X A;  3TSW A;  3FLG A;  3VRZ A;  4XK8 E;  3MHX A;  3G1J A;  1ZBX A;  4M75 A;  2OI3 A;  4NL2 A;  4C5H A;  1UGQ B;  2CDT A;  2MI6 A;  4JJC A;  5EC7 A;  4C8Q E;  2CP0 A;  2EQK A;  1RAF B;  4GLM A;  4LE9 A;  1M5Q 1;  4ZGD B;  2KY9 A;  4J6W A;  2LCC A;  3QBY A;  4JLG A;  3G4S A;  3CC2 T;  2JN0 A;  1MHN A;  2LZ6 B;  3LYI A;  1QCO A;  4RTT A;  1K73 R;  5IT9 E;  2QA4 T;  1W1F A;  2EIF A;  3EFR A;  1PKT A;  3SDZ A;  1OU9 A;  1HK9 A;  2K5L A;  5IAY A;  2I0N A;  1AWO A;  2RQT A;  3M57 A;  3GPL A;  1VQ6 A;  5CKF A;  1M9S A;  1N8R C;  1GFD A;  4EIK A;  2ESW A;  2MMP A;  4PFZ A;  1IXD A;  3OA6 A;  2LMJ A;  2P0K A;  4PLL A;  4JZ4 A;  4Q5W A;  4C92 B;  3JB9 G;  4C5E A;  3RMS A;  2HEQ A;  1Q86 U;  4PJO C;  4XTZ A;  2F2W A;  4DQ2 A;  2L5Q A;  4IUT A;  1ZSZ A;  1QKX A;  3ZBD A;  3CMA T;  2D6F A;  1XTD A;  5GMK l;  4OMQ A;  3UF4 A;  2AT1 B;  3WVE B;  2DF6 A;  2VYT A;  4FYX B;  2J6O A;  2CKK A;  5GAN 6;  4FCY A;  1M2V B;  2HZY A;  2KSS A;  4KT0 E;  2YRC A;  1D0Z A;  4OB3 B;  1E7O A;  2LX7 A;  2EBP A;  2PQW A;  4WTO B;  2MCN A;  1K8A R;  3HTR A;  5GAM d;  2HSE B;  4DBH A;  5CKE A;  2OTJ A;  3NTH A;  2QTX A;  4TVR A;  1C1A A;  3ER0 A;  2BZX A;  2IG0 A;  5L23 A;  3G6E T;  2DA9 A;  4ZGE B;  2ENM A;  2DBK A;  5LL6 S;  1YJW Q;  3BDU A;  1T3S A;  1NEB A;  3OSS C;  1G2B A;  1B34 B;  2V8K A;  4M7A D;  5CO7 A;  1U06 A;  2K3B A;  5FWB A;  1GCQ C;  2KE9 A;  3LGL A;  4RTV A;  2L8D A;  2KBT A;  1TUC A;  4OMF B;  5J39 A;  1UGP B;  4OB2 B;  3I55 T;  4MZM A;  2JM8 A;  4CI0 C;  3CD6 A;  5D6Y A;  3PNW C;  3OYM A;  2DK3 A;  1YNZ A;  4PJO A;  2AKL A;  4LNP A;  1WZO A;  5GAM h;  2K57 A;  4M7A C;  2VB6 A;  2V1Q A;  1XOV A;  3UPU A;  2X4W A;  2JS0 A;  3QDR B;  5GAM g;  1OPK A;  2C0I A;  2O31 A;  1SHF A;  3IQL A;  3A8H B;  1N8R U;  4JZ3 A;  2AIR B;  2RJD A;  4HVU A;  5GAM j;  2EJG A;  1WXU A;  3OY9 A;  2K79 A;  3L1A A;  3M9Q A;  2QEX Q;  1NJI R;  2JS2 A;  4ZN1 A;  2CT4 A;  5I11 A;  1UHF A;  4C8Q D;  5FU6 B;  2V1R A;  5GAO l;  2CP3 A;  4YTL A;  1VOM A;  5HCK A;  3RER A;  3CCL A;  3M0R A;  3PVL A;  4FYW B;  1Q81 C;  1JJ2 A;  1SPK A;  5CCA A;  4HXJ A;  5DY9 A;  3I56 T;  2M0Y A;  5L8R E;  1YJ9 Q;  1NPR A;  1N6A A;  2V8J A;  4XTX A;  2AKK A;  2DE0 X;  1P92 A;  1GCQ A;  2BUD A;  1IGU A;  3EAE A;  2H3J A;  1ACM B;  2Y4X A;  3N5B B;  4DOV A;  4MZT A;  5KCH A;  3H0I A;  2F2V A;  4PL6 A;  1SRM A;  4M78 G;  1UTI A;  4IKF A;  3VKI A;  1G3Y A;  4CC2 A;  2KEA A;  2ZPI B;  4M78 E;  5KYN A;  4N4H A;  1R8O B;  2LCS A;  4A53 A;  4M7A A;  1HYO A;  5HKC A;  4K11 A;  3L2R A;  2J06 A;  1WQW A;  1S72 A;  4X34 A;  2MYS A;  2P84 A;  4CC4 B;  3CCS A;  2YUQ A;  1J3T A;  1UG1 A;  2YT6 A;  1VQM Q;  1KHI A;  1QCN A;  5I2M A;  2KRS A;  4XTY A;  5DM7 R;  3OYI A;  1YJN A;  4C92 F;  1KC8 R;  3JCM f;  1VQ5 Q;  3HRS A;  3CCV T;  2A3L A;  3CCE Q;  2R5M A;  4AT1 B;  2H3E B;  2RI5 A;  3MET A;  3M0Q A;  3OBY A;  3L2U A;  2QG9 B;  2E6N A;  3RKX A;  4II1 A;  2LC4 A;  3R6O A;  3AT1 B;  4FYV B;  4IUQ A;  3P8B B;  4EMG A;  2E12 A;  4QQG A;  3OS2 A;  2EFI A;  4LDY A;  1M27 C;  3EGD A;  1UDL A;  2HL3 A;  2NUT A;  3URG A;  1YBY A;  4OML A;  4CC7 A;  2MAM A;  3CXC S;  3G71 T;  1VQ8 Q;  4J9I A;  1BIA A;  1SKU B;  1C0M A;  1T0J A;  3OYD A;  3L2Q A;  1G5V A;  4JPB W;  2FVU A;  3TQ7 P;  1TU0 B;  4M7D C;  1GL5 A;  2RK2 A;  1Q81 U;  1M1K R;  3M58 A;  4HCZ A;  4BY6 C;  3KUF A;  2X51 A;  2DIL A;  2LCL A;  2E3I A;  1JBM A;  2VVK A;  3CCJ T;  4AFS C;  2QQA A;  1WNL A;  2DIQ A;  5KYW B;  4A4G A;  1KQ2 A;  1S1N A;  3CBO A;  1VQK T;  1IRX A;  2AZV A;  1BIB A;  3JB9 H;  4NOY A;  2HDA A;  1WLP B;  4ZNX A;  4M77 D;  4DEY A;  1Y96 B;  4QQD A;  1OU8 A;  2YUP A;  1KD1 R;  2HBW A;  4A4K A;  4J8O A;  4M75 G;  2KI7 A;  4BUG A;  3V7S A;  4AG2 C;  1IO6 A;  4M75 E;  3RKW A;  1B3Q A;  4JRP A;  2RJE A;  3C95 A;  1W2B P;  4BE1 A;  1QVF P;  3R6N A;  4IUV A;  2DBM A;  3VS5 A;  1E6G A;  2QGF B;  2L0A A;  1VQO Q;  1TOV A;  2QQB A;  5HK3 A;  1UB4 A;  1Y07 A;  3G4S T;  4BAC A;  4M7D A;  4E6R A;  2HSP A;  4VUB A;  2WSC E;  5GMK i;  2RN8 A;  1JXM A;  2CP6 A;  2RHY A;  1Q7Y R;  4O6J A;  2PUK B;  3M59 A;  3QDF A;  3REB B;  2DMO A;  2K4Y A;  3OQ5 A;  3OBW A;  1UGS B;  3EGX A;  1UEB A;  4OP0 A;  4ZN3 A;  1VQ6 T;  2W0Z A;  1YHQ A;  3GIB A;  2CP7 A;  2BE9 B;  3SD4 A;  1ZSG A;  1WJR A;  3X20 B;  1B7T A;  2QAZ A;  1RLQ C;  1WFW A;  1Q95 G;  3CPW P;  5GAN 3;  2X4Y A;  4BDY A;  2RPN A;  1I4K 1;  2JMC A;  1PD0 A;  2YRV A;  2XK0 A;  3RUX A;  4JRI A;  1WJQ A;  2IVW A;  3SWN C;  1SSH A;  4OB1 B;  3I56 A;  4HKE A;  4EDU A;  2KXD A;  5GAO r;  2ZPH B;  2D0N A;  1D3B B;  1D1B A;  4EMK C;  3VYH B;  2LNH B;  2DVE A;  3A8O B;  1NZ9 A;  4LD9 K;  3SHW A;  2NWM A;  1BI0 A;  3OW2 A;  1YIJ T;  1BI2 A;  1TUG B;  5FRO A;  6AT1 B;  1KQS A;  3F70 A;  2OTJ T;  2NYS A;  5DLQ E;  3E1S A;  1K1Z A;  1YIT Q;  1RLP C;  4PJL A;  2X4J A;  2E3H A;  1D1A A;  1IB8 A;  3INZ A;  3M56 A;  2PZ1 A;  1H92 A;  2CSQ A;  4PJO G;  2DL7 A;  1UEC A;  3NGP A;  3THK A;  4C8Q F;  4C0F A;  3L2V A;  2XU8 A;  2GTJ A;  4OGE A;  3GBQ A;  3V8K A;  3CCV A;  3CD6 T;  4Z89 A;  3C0C A;  4M78 B;  2CZ1 B;  2YSQ A;  1VQ7 Q;  2D1X A;  4BD3 A;  4LDX A;  1KQ1 A;  3SWN A;  2QI2 A;  1TG0 A;  3EG9 B;  3RIR A;  2XHC A;  1O75 A;  3HRU A;  1X2Q A;  4HT8 A;  2RB6 A;  3PVQ A;  1QCF A;  1UGR B;  3BE3 A;  3A98 A;  3M0T A;  1VYV A;  3BDL A;  4RCC A;  4EMK A;  5IN1 A;  3J7A F;  3G71 A;  1LPL A;  3FRN A;  2VUB A;  3PGG A;  2CT3 A;  1F1B B;  4IIO A;  3NFC A;  1Y71 A;  4C5I A;  2DEU A;  5I21 A;  3S3O A;  2DZ9 A;  1K0X A;  2JTM A;  4E7Z A;  2DNU A;  3H6Z A;  2FEI A;  3PFS A;  2DTO A;  4C92 D;  4OB0 B;  4HA8 A;  3LWH A;  2WSE E;  1Q82 U;  2RMO A;  4J9E A;  1VQ9 Q;  2DFU A;  4OMO A;  1VIF A;  1XNI A;  2P0P A;  2PU9 B;  3E2U A;  2IPO B;  4F7U F;  4XTU A;  3KBG A;  5CKH A;  1VQK A;  2CYZ B;  2LQK A;  2QDL A;  4E7K A;  3EH1 A;  2FZC B;  2L3P A;  2EW3 A;  1M90 U;  3X26 B;  1XJW B;  4DOW A;  1WGS A;  1N5Z A;  2OTL Q;  2LDM A;  3M54 A;  1I81 A;  2PVG B;  2RI3 A;  4RUG A;  2GTO A;  4PKC C;  2NUP B;  1PNJ A;  1IHW A;  2LJ0 A;  3BY7 A;  2ATC B;  1HJD A;  3CCS T;  5A0D A;  3E19 A;  4XU3 A;  2JTE A;  3HP9 A;  4ATO A;  1I5O B;  2EYZ A;  3DKM A;  1K8A C;  2DJZ A;  2DO3 A;  1YJN T;  2DXB A;  2LVM A;  4X9D A;  1RI0 A;  3QYG B;  5LJ3 d;  1KSW A;  2BIV A;  3MEA A;  3DB3 A;  3L42 A;  1WHG A;  5CQY A;  2D8H A;  2AHJ B;  5GAM f;  5GAN d;  2JZ2 A;  5LJ3 e;  3MKD A;  1TSF A;  3HHT B;  1U3O A;  4M75 B;  4KH0 B;  1N9R A;  4EPC A;  4M77 F;  4LN2 A;  2CP2 A;  1VQP Q;  5GAN e;  1RAI B;  3CC2 Q;  2EAY A;  1WI7 A;  2VXE A;  4IUP A;  5LJ3 h;  2LJ1 A;  1MV0 B;  1JJ2 P;  2KRO A;  4OMP A;  2DXU A;  1IZ6 A;  2LTO A;  1T0H A;  2O9V A;  2HMA A;  1ABO A;  5CQX A;  3VRY A;  2QTV A;  5LJ3 g;  3NPF A;  5GAN h;  3A1P A;  5KYX A;  3VS6 A;  1OEB A;  3OYL A;  1Q86 R;  2CP5 A;  4PJJ A;  5LJ3 j;  3OYG A;  3CCM A;  1WDX A;  1ZA2 B;  4XTW A;  1EIF A;  2O2O A;  2O9S A;  2QQS A;  4J9H A;  1U1T A;  1U1S A;  5GAN g;  1H3Z A;  3V7C A;  5J26 A;  3CCU Q;  4A4E A;  1M2V A;  4B9W A;  5GAN j;  3MP8 A;  5GAO m;  2E4H A;  3MEU A;  3FIF A;  1X6O A;  1ZSZ B;  4M78 F;  1GCP A;  2K3Y A;  2ROT A;  3V8J A;  2XDD A;  2OAW A;  2ROL A;  2VKN A;  1YIJ A;  4HT9 A;  1JXO A;  1VQN A;  4RTX A;  3UDC A;  2KMT A;  1WXB A;  1H3H A;  5FU6 C;  3QPH A;  2VAS A;  1RAG B;  1X01 A;  1ARK A;  1MV3 A;  2YHT A;  3FEO A;  4FSX A;  3VS1 A;  1N9S A;  2RA2 A;  4AMC A;  4A4F A;  2HAX A;  2D8J A;  2VXF A;  1H64 1;  1UHC A;  2DYB A;  4QQ6 A;  4M7D G;  1QVG A;  3OYH A;  4M7D E;  2KGT A;  1HXD A;  1JEG A;  3G6E Q;  1VQL Q;  3CC7 Q;  2R5A A;  1BBZ A;  3T9N A;  1OOT A;  3CPF A;  3PE0 A;  2LRQ A;  4L5G A;  3JCM V;  1AVZ C;  2QQ9 A;  2W10 A;  2PVD B;  4JS4 A;  3QWX X;  4J9B A;  1PD1 A;  5D6X A;  3H9N A;  1Z9Q A;  3H0F A;  1X75 C;  4PK4 A;  3A8M B;  2F1L A;  4FM4 B;  3EGU A;  3JSC A;  1YHQ T;  1PC0 A;  1QP3 A;  1AZG B;  4PJO B;  2E64 A;  4OMM A;  2E65 A;  1GRI A;  4XU2 A;  3OMC A;  1HSQ A;  2G3R A;  4RG2 A;  5FRM A;  4LUD A;  1OX9 A;  2DLP A;  2YDL A;  2DEQ A;  5ECA A;  3MP1 A;  1C6V X;  3EFO A;  3VU3 C;  2LQN A;  2EQI A;  2L3Q A;  1ZUY A;  1G3S A;  2JVV A;  3M0P A;  2KQW A;  1YN8 A;  5FU7 C;  2FB7 A;  4ESR A;  2DET A;  4RTW A;  1YJ9 T;  2A0F B;  1CSK A;  1M1K C;  3EHQ A;  2ECZ A;  4C8Q C;  1M8V A;  2C06 A;  1KG1 A;  4C0D C;  3OYC A;  3OYE A;  5CVI A;  1EX4 A;  1V1C A;  4KGV B;  4BI3 A;  3WVD B;  3CME Q;  1QWF A; 
#chains in the Genus database with same CATH homology
 3PTA A;  3QHS A;  4LDU A;  3Q1J A;  2OTL A;  1YCY A;  2MWP A;  3GNG A;  4N4G A;  5J3B A;  4MMK A;  3MCA B;  1TH7 A;  2ZCF B;  3CCU T;  5CR2 A;  2QQB A;  1WJS A;  5HK3 A;  1UB4 A;  1Y07 A;  2LQ8 A;  3M55 A;  4MZP A;  4BE2 A;  3JB9 D;  3G4S T;  3NTK A;  2E41 A;  3OS1 A;  4BAC A;  4M7D A;  2KK4 A;  3UT1 A;  3C94 A;  4EMK B;  4M75 C;  3QKJ A;  3FB9 A;  5KE2 A;  4JUV A;  4VUB A;  3X28 B;  1VUB A;  4KUL A;  3CXC A;  2WSC E;  1VQM T;  4KBM B;  5GMK i;  3SB2 A;  4V2S A;  2RHY A;  2K3X A;  3GNF B;  2RO0 A;  4R56 A;  4C0G A;  1QW1 A;  3GOX A;  4O6J A;  2PUK B;  3M59 A;  4RCB A;  4QVC A;  3HKS A;  2K4Y A;  4J5Y A;  2K2V A;  2B8A A;  3VJP A;  3AHU A;  2RHX A;  3OQ5 A;  3OBW A;  1UGS B;  2YLC A;  2ZGW A;  3GP8 A;  1UEB A;  3CCQ A;  4OP0 A;  4ZN3 A;  3MO8 A;  4F7U G;  4BDZ A;  1VQ5 T;  1Q86 C;  1VQ6 T;  3HPW A;  4D6W A;  1K8A U;  1YHQ A;  1YIT A;  2CZ7 B;  2DXT A;  1G3W A;  3ZEH A;  3CBM A;  3CCL T;  3GIB A;  2YLB A;  4F7U E;  3SD4 A;  4J7I A;  3J80 E;  4IUV A;  1WJR A;  1B34 A;  4J7F A;  3X20 B;  3CPW A;  2XDB A;  3ZFJ A;  2GF7 A;  2CZ0 B;  1YJW T;  1RL2 A;  3BFM A;  5GAN 3;  3LW5 E;  5M9O A;  2X4Y A;  2R57 A;  4BDY A;  1ZHI A;  4EMH A;  1G3T A;  2GQV A;  5D6W A;  5A0L A;  3CCJ A;  5FRN A;  1I4K 1;  2JNG A;  4PNO A;  2X4X A;  4N4I A;  4RMO A;  2YRV A;  3LH0 A;  2XK0 A;  3X24 B;  1VQL T;  3CC7 T;  3RUX A;  4JRI A;  2E1H A;  1WJQ A;  5GAM e;  2IVW A;  4JLI A;  1BKB A;  2X35 A;  4FL6 A;  3SWN C;  3S3M A;  2HBP A;  4C8Q A;  4XQ3 A;  3A8G B;  4BE0 A;  4OB1 B;  3I56 A;  1VQ8 T;  4HKE A;  1Q7Y C;  1KC8 C;  3JCM P;  4EDU A;  5CKD A;  1VQ7 A;  1W4S A;  3JCM b;  3OYA A;  2ZPH B;  3OYY A;  5GAO r;  1S72 T;  2RM4 A;  4JRK A;  4X9C A;  1D3B B;  2GCX A;  1V29 B;  3DB4 A;  3QJY A;  2XKO C;  4EMK C;  1NE8 A;  3S3N A;  4HCC A;  4ZTF A;  3VYH B;  2DVE A;  3E9G A;  3A8L B;  3A8O B;  2DPP B;  1NZ9 A;  2JOY A;  2RI2 A;  2RJC A;  4B9X A;  3OYJ A;  5DLO A;  3FLG A;  4LD9 K;  4XK8 E;  1BI0 A;  3TCJ A;  2LX9 A;  2ZPB B;  3MHX A;  3OW2 A;  1YIJ T;  2DD5 A;  1ZBX A;  1BI2 A;  1ZQ1 A;  4M75 A;  5FRO A;  1XQH A;  4NL2 A;  4C5H A;  1UGQ B;  1KQS A;  3F70 A;  3TEE A;  1OI1 A;  2OTJ T;  3A5Z B;  4JS5 A;  5DLQ E;  2MI6 A;  2QEX T;  5GAO p;  5AYF A;  3E1S A;  3DLL A;  1M1K U;  4C8Q E;  2P0Q A;  3OB9 A;  2EQK A;  2X4J A;  3JCM c;  1BI1 A;  3INZ A;  4M77 G;  2GFU A;  4ZGD B;  1M5Q 1;  4XTV A;  2KY9 A;  4J6W A;  2LCC A;  2XG8 D;  3M56 A;  3QBY A;  4JLG A;  4M77 E;  3G4S A;  1NJI U;  3CC2 T;  2E5Q A;  3JCM J;  2JN0 A;  1N27 A;  2L3R A;  2MF2 A;  1QVG S;  2DD4 A;  1MHN A;  2KVQ G;  2O4X A;  4PJO G;  1O9S A;  3BW1 A;  5LJ5 d;  1AHJ B;  3LYI A;  4C8Q F;  4C0F A;  2O01 E;  5IT9 E;  3VV0 A;  2QA4 T;  2EIF A;  3EFR A;  3QG1 A;  3L2V A;  4XU0 A;  3SDZ A;  5A0G A;  1VQ9 A;  2DTH A;  2F5T X;  2XU8 A;  5EG2 A;  1HK9 A;  2K5L A;  4OGE A;  5IAY A;  3QXE B;  3M57 A;  3V8K A;  3GPL A;  3CCV A;  3CD6 T;  2QQR A;  4M78 B;  1VQ6 A;  5CKF A;  3JCM d;  3OYB A;  2PVO B;  1LOJ A;  2CZ1 B;  5LJ5 e;  2V8I A;  1M9S A;  1N8R C;  2MMP A;  3OA6 A;  4M77 C;  3TU4 K;  4BD3 A;  4LDX A;  5GMK e;  2XID A;  2P0K A;  1KQ1 A;  4PLL A;  4Q5W A;  4C92 B;  4WF2 A;  4M75 F;  3SWN A;  2QI2 A;  4OVA A;  3RIR A;  3JB9 G;  3QZ9 B;  4C5E A;  2M1H A;  2XHC A;  3RMS A;  2CGH A;  2ZZD A;  4QVZ A;  4F7U A;  4BI4 A;  1O75 A;  3HRU A;  4NS5 A;  3JCM e;  3CME T;  1Q86 U;  4PJO C;  2OAU A;  4XTZ A;  1QVP A;  2QDY B;  4HT8 A;  2RB6 A;  4DQ2 A;  2L5Q A;  4IUT A;  1VQO T;  1UGR B;  3KXT A;  4J83 A;  5LJ5 h;  3BDL A;  4RCC A;  3ZBD A;  5CAI A;  4EMK A;  5IN1 A;  1KHC A;  3RES A;  4ELY C;  3G71 A;  3CC7 A;  1XTD A;  5GMK l;  4E7H A;  4BB7 A;  2D6F A;  3FRN A;  3WVE B;  1KD1 C;  2VUB A;  2VYT A;  3PGG A;  4FU6 A;  3QJ6 A;  5GAN 5;  2CKK A;  4MDX A;  4PLI A;  3NFC A;  5GAN 6;  4MML A;  3JAM E;  3QSU A;  5KE3 A;  1Y71 A;  2F69 A;  4M7A B;  2KSS A;  4M78 D;  5LJ5 g;  2JUF A;  4C5I A;  4ZTJ A;  3MEV A;  4KT0 E;  3QYH B;  2D0Q B;  3JCM h;  5I21 A;  4OB3 B;  4LD6 A;  3S3O A;  5LJ5 f;  2LT1 A;  2DZ9 A;  1JJ2 S;  2JTM A;  2LNV A;  3H8Z A;  5LJ5 j;  3WXM B;  3CCE T;  4M7D B;  2DIG A;  3H6Z A;  3PFS A;  2DTO A;  4C92 D;  2PQW A;  4OB0 B;  4HA8 A;  3LWH A;  1Q7Y U;  1KC8 U;  3OS5 A;  2WSE E;  4BY6 B;  1Q82 U;  3VYG A;  3JCM g;  5CK9 A;  5GMK j;  1VIF A;  1Y7X A;  1XNI A;  5GAM d;  1VQ4 T;  2P0P A;  2PU9 B;  3HFO A;  4IUU A;  1FX7 A;  5CKE A;  3OYK A;  2OTJ A;  5GAO q;  5HK0 A;  3FC3 A;  2RD1 A;  2QEX A;  4GLK A;  4F7U F;  3NTH A;  2QTX A;  3ME9 A;  1K9M C;  4XTU A;  4TVR A;  3ER0 A;  3KBG A;  5CKH A;  1VQK A;  2CYZ B;  2IG0 A;  2LQK A;  2NLU A;  3G6E T;  4ZGE B;  4E7K A;  3MEW A;  5LL6 S;  3CCR T;  3CCM T;  3BDU A;  1VQP A;  1M90 U;  3OSS C;  2V8K A;  1B34 B;  3X26 B;  3CC2 A;  4DOW A;  4M7A D;  1YI2 T;  5CO7 A;  1WGS A;  3E9F A;  1PSE A;  2LDM A;  3M54 A;  1I81 A;  2PVG B;  1LNX A;  2RI3 A;  4J6Y A;  2DZC A;  4PKC C;  2KDS A;  2XD0 A;  1JRI A;  5FU7 B;  3CC4 T;  2QA4 A;  3BY7 A;  4M77 A;  3QZ5 B;  3LGL A;  4M7D D;  2L8D A;  2EJ9 A;  2A7Y A;  5A0D A;  4QVD A;  4E47 A;  3CCS T;  4OMF B;  1YJ9 A;  3E19 A;  1MGQ A;  4XU3 A;  5J39 A;  1UGP B;  4OB2 B;  3I55 T;  2RK1 A;  4MZM A;  3HP9 A;  4CI0 C;  3JB9 I;  2DAQ A;  4NL3 A;  3CD6 A;  5D6Y A;  3PNW C;  2CS7 A;  3OYM A;  4ATO A;  2DK3 A;  3FDR A;  4E7L A;  4PJO A;  2EWN A;  3DKM A;  1K8A C;  3J81 E;  2DJZ A;  2DO3 A;  2HNI A;  4C8Q B;  5GAM h;  4E7I A;  2K57 A;  1YJN T;  2E70 A;  1BYM A;  2DXB A;  3L2Z A;  4C0D B;  4CRI A;  3LLR A;  4M7A C;  1NPP A;  2LVM A;  1VQN T;  5GAN 8;  1XOV A;  1RI0 A;  2EQU A;  2EQJ A;  3M53 A;  3QYG B;  4X9D A;  3PIO A;  5LJ3 d;  3UPU A;  2X4W A;  3QO3 A;  3HSB A;  4M7A A;  2BIV A;  3MEA A;  3DB3 A;  3L42 A;  3QDR B;  2EJF A;  4C0Z A;  5GAM g;  2VGN A;  3CCQ T;  2E10 A;  4Y28 E;  5CQY A;  3CME A;  3CCU A;  2AHJ B;  2RHU A;  1YIT T;  5HY6 A;  3A8H B;  1N8R U;  5GAO n;  5GAM f;  2EKO A;  3S6W A;  3PIP A;  2RJD A;  5GAN d;  1BI3 A;  1FWZ A;  5GAM j;  2EJG A;  2JZ2 A;  3QUI A;  4A54 A;  5LJ3 e;  3OY9 A;  3CMA A;  5CIU A;  3HHT B;  3L1A A;  1VQM A;  3M9Q A;  1Y96 A;  4KUI A;  4M75 B;  4RKU E;  4PJO E;  4ZN1 A;  1N9R A;  4EPC A;  4M77 F;  2M9U A;  5GAN e;  3J7A F;  4J6X A;  2VC8 A;  3JCM Q;  3G7Z A;  2VGM A;  4C8Q D;  5FU6 B;  2EAY A;  2E6Z A;  3RMQ A;  5GAO l;  1WQ7 A;  1VQ5 A;  4YTL A;  2VXE A;  2M0O A;  4PJO F;  3CCE A;  1KD1 U;  2O4X B;  1Q81 C;  1JJ2 A;  3CCL A;  3RER A;  5CCA A;  5DY9 A;  3I56 T;  4IUP A;  5LJ3 h;  1VIE A;  1FXX A;  1LJO A;  1VQ7 T;  4KUD K;  5L8R E;  3OYF A;  1NPR A;  1N6A A;  2DXU A;  3JCM X;  2V8J A;  1IZ6 A;  4XTX A;  2LTO A;  2FYK A;  2LT4 A;  1P92 A;  5CQX A;  3PMT A;  4RG8 A;  2FHD A;  4R55 A;  2BUD A;  2RJF A;  3ASK A;  5LJ3 g;  5GAN h;  3EAE A;  2H3J A;  2BKD N;  2Y4X A;  2QXF A;  2Y4Y A;  3M4Y A;  3N5B B;  3OYL A;  4DOV A;  2WAC A;  2JTF A;  3VUB A;  4M75 D;  4JDS A;  4MZT A;  3X25 B;  3C4S A;  5KCH A;  3G6E A;  1M1G A;  4PL6 A;  2Y90 A;  4M78 G;  5LJ3 j;  3OYG A;  3CCM A;  4LDV A;  3JB9 J;  4IKF A;  4XTW A;  3VKI A;  1EIF A;  1G3Y A;  2EQM A;  2HQE A;  2QQS A;  1U1T A;  1K73 C;  1U1S A;  5GAN g;  3JB9 F;  3V7C A;  1H3Z A;  2ZPI B;  4M78 E;  4N0A C;  3SWN B;  5GMK h;  3CEY A;  1VQ8 A;  2ZPE B;  4L6V 5;  5J26 A;  4A4E A;  4N4H A;  1YJW A;  1R8O B;  2XDP A;  3O8V A;  4A53 A;  4B9W A;  1K9M U;  4F7U B;  5KCO A;  2F5K A;  4QW2 A;  3LGF A;  5HKC A;  1WQW A;  3M5A A;  4C92 G;  5GAN f;  3L2R A;  5GAN j;  3DLM A;  4X34 A;  1I5L A;  4FIB A;  3MP8 A;  3CCS A;  2R58 A;  5GAO m;  3VUZ A;  3QII A;  2VV5 A;  3C12 A;  2DKG A;  3MEU A;  3FIF A;  4C92 E;  3I55 A;  3CBP A;  1X6O A;  4M78 F;  1KHI A;  3CC4 A;  2K3Y A;  5I2M A;  2XIC A;  3SFM A;  3V8J A;  4XTY A;  1DJ7 B;  2XDD A;  5DM7 R;  4UC4 A;  3OYI A;  1YJN A;  3TRE A;  1YIJ A;  2CZ6 B;  4HT9 A;  4GY5 A;  1VQN A;  1VQ9 T;  3UDC A;  2K5I A;  2KMT A;  4C92 F;  3JCM f;  5FU6 C;  3QPH A;  2I2L A;  2ZPF B;  3HRS A;  4M78 C;  3FJP A;  1X01 A;  2YHT A;  3CCV T;  2A3L A;  3FEO A;  2R5M A;  4FSX A;  1N9S A;  1W2B S;  2RI5 A;  3HFN A;  4M7A G;  3MET A;  2RA2 A;  5C6S A;  3OBY A;  3L2U A;  4A4F A;  1QVF S;  4FT2 A;  2HAX A;  2VXF A;  1H64 1;  4M7A E;  2DTI A;  5GMK m;  2E6N A;  4O5V A;  3M4G A;  3RKX A;  4II1 A;  4QQ6 A;  5FLX E;  4C92 C;  4M7D G;  5A2Q E;  2KAF A;  1I8F A;  2LC4 A;  1M4Z A;  3R6O A;  3GF5 A;  1QVG A;  4IUQ A;  1JB0 E;  3P8B B;  4Y91 A;  4EMG A;  3OYH A;  1S72 A;  2E12 A;  4QQG A;  3OS2 A;  2EFI A;  4M7D E;  4LDY A;  2OTL T;  4E7J A;  5KH6 A;  2D9T A;  4A4H A;  4JRQ A;  4M7A F;  1HXD A;  3LX7 A;  5C0M A;  3L2W A;  3URG A;  1D3B A;  1YBY A;  3UWN A;  2R5A A;  1IRE B;  2MAM A;  3T9N A;  2RHZ A;  4P5N A;  1SSF A;  3CPF A;  3CXC S;  2LRQ A;  5GAN 4;  5I2S A;  3G71 T;  4M7D F;  4L5G A;  3JCM V;  1BIA A;  2GFA A;  2QQ9 A;  5CKB A;  2PVD B;  4JS4 A;  3JCM W;  4BI8 B;  5D6X A;  3HRT A;  3OYD A;  3L2Q A;  1Q82 C;  1G5V A;  2RH2 A;  2FVU A;  4M77 B;  1X75 C;  3P8H A;  2HD0 A;  1OYX A;  2HQX A;  3A8M B;  4ME7 A;  4N0A A;  4M7D C;  4FM4 B;  2RK2 A;  3JSC A;  1U8R A;  2RHI A;  3P8D A;  2DXC A;  1YHQ T;  1QP3 A;  5GAN 7;  2WSF E;  1Q81 U;  4C5G A;  4PJO B;  2E64 A;  3M58 A;  2E65 A;  3PMI A;  3KUF A;  1WPY A;  2XI9 A;  4HCZ A;  4Z02 A;  4BY6 C;  3CPW S;  1VQO A;  3NTI A;  2ZPG B;  1VQL A;  4XU2 A;  3OMC A;  4OGC A;  1M90 C;  2G3R A;  3V8L A;  4RG2 A;  2LCL A;  5FRM A;  4C8Q G;  3OYN A;  1JBM A;  2K5F A;  3V7R A;  3CCJ T;  4ZGJ B;  2DEQ A;  3OS0 A;  3LWI A;  2QQA A;  4LDW A;  1WNL A;  4DA4 A;  2DIQ A;  3MP1 A;  3VU3 C;  2M16 A;  4L59 A;  2FL7 A;  3CBO A;  4A4G A;  1VQK T;  1KQ2 A;  3MP6 A;  4FT4 A;  4M78 A;  1BIB A;  1VQP T;  4XAX B;  3JB9 H;  1G3S A;  4NOY A;  1PSF A;  2JVV A;  5GAN 2;  1K73 U;  2EYQ A;  2MWO A;  2PUO B;  1OZ3 A;  2KQW A;  4M77 D;  5FU7 C;  3CMA T;  1Y96 B;  3JRZ A;  2P4T A;  3PT9 A;  4QQD A;  4XU1 A;  2FB7 A;  4IUR A;  4MDW A;  1GXI E;  4C92 A;  1VQ4 A;  2L89 A;  4A4K A;  4J8O A;  1M1F A;  4M75 G;  4BUG A;  4PJO D;  1YJ9 T;  3GLX A;  3OSV A;  1M1K C;  3V7S A;  4M75 E;  3RKW A;  4ELZ C;  4OF1 A;  4C8Q C;  1M8V A;  2C06 A;  1KG1 A;  1OZ2 A;  1W2B A;  4C0D C;  4JRP A;  5LJ3 f;  3OW2 S;  3OYC A;  3OYE A;  5CVI A;  1QVF A;  3RKY A;  2RJE A;  3CCR A;  3C95 A;  1NJI C;  1KQS S;  4BE1 A;  1QP2 A;  1YI2 A;  4HCB A;  3EFS A;  3OMG A;  4BI3 A;  3WVD B;  4JJN K;  3HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...