5GAMg

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 8
structure length 69
sequence length 75
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamg00
2I2LA 4C92D 1D3BA 2EAYA 4QVCA 3RKYA 5CAIA 5GAN3 2E1HA 2E64A 4PNOA 4XQ3A 3JB9D 5GMKe 5GMKi 3V8JA 5LJ5j 5GAOr 5GMKm 4M7AB 3RUXA 2DKGA 1HK9A 1JRIA 1BIAA 4A53A 4M78F 3JCMb 4C92E 5GMKj 4C8QC 2DVEA 3JCMc 3JB9J 4N0AA 2DXTA 5I21A 5GAOq 5GMKl 3RKWA 1Y96A 5GAMd 4M77F 3FIFA 1B34A 3HFOA 2EJFA 2EWNA 2E10A 5GAN5 5GAMf 3JCMd 2DXUA 3L2ZA 4M75D 1WQWA 4EMGA 4M7DD 2JN0A 3RKXA 3JCMf 1I81A 1D3BB 3JB9H 3SWNC 4M7AF 1TH7A 2DTOA 3EFRA 4M75C 4XTYA 4J6YA 3QSUA 4PJOF 2VXEA 4C92B 4M7DC 1M8VA 4RCBA 4OP0A 1M5Q1 1U1TA 3RERA 4RCCA 5LJ5d 5LJ3g 3JCMW 4JRIA 4C92A 4NL2A 5LJ3h 2FB7A 4QVDA 3RESA 2VXFA 1KQ1A 4M75E 2RM4A 4C92G 5LJ5f 5GANd 2RA2A 3FB9A 4C8QD 2YHTA 4F7UA 3JB9G 4J5YA 3V7RA 2VC8A 4EMKC 5GANf 3JCMJ 4C8QA 1JBMA 1N9SA 4EMHA 4F7UG 5LJ3e 2FYKA 5GAN4 1Y96B 2CGHA 1LOJA 4C8QG 4Y91A 1B34B 4JUVA 3JCMQ 4DQ2A 2HNIA 4XTZA 4J6XA 4F7UE 1X01A 3BFMA 1I5LA 5GAN8 1KQ2A 4C92F 2ZGWA 3AHUA 1HXDA 4M78C 4C8QE 5LJ3j 1LNXA 2K57A 2RB6A 2E41A 1WPYA 3SWNA 5GAMg 4NL3A 1LJOA 4M75A 5GAMh 2DZ9A 4M77C 4M7DA 5GAOm 4NOYA 4M75G 4JLIA 5GAOp 4M7DG 5GAN2 4PJOD 2DTIA 3M4GA 4MMKA 4XU1A 3BW1A 3GIBA 4M7AC 4F7UB 3JB9I 5GAMe 1U1SA 4M7DE 4C8QB 4HT9A 4EMKA 5GAOl 4PJOC 3L1AA 4X9DA 5GAN7 2YLCA 3RIRA 4V2SA 5GAMj 5GANg 4M78D 4PJOE 5GANh 3BDUA 2YLBA 1I8FA 5LJ3d 3V8KA 4M78A 3BY7A 1N9RA 1I4K1 2RD1A 5GAN6 5LJ3f 3SWNB 2Y90A 4M78G 3QUIA 4M77D 4M75B 4XTWA 3SB2A 3QO3A 3V7CA 2E65A 3JB9F 4M7DB 5GANe 4F7UF 4M77A 4C8QF 4M78E 4C92C 3EFSA 4JRKA 4M77G 3VU3C 4M7AD 3JCMg 1H641 3INZA 1BIBA 1MGQA 4WF2A 3JCMh 2DTHA 1WNLA 4PJOB 1YCYA 2DJZA 5GANj 4M7AA 2QTXA 1WQ7A 3V7SA 3V8LA 4M77E 4EMKB 3JCMX 3HFNA 4M7AG 2DZCA 4J6WA 4PJOA 4XU2A 2EJ9A 4MMLA 4N0AC 4PJOG 3JCMe 5GAOn 5LJ5g 4XTXA 3JCMP 4XU0A 4A54A 5LJ5h 3HSBA 3JCMV 4HA8A 4M75F 4X9CA 4M7AE 2DEQA 4M7DF 4XU3A 4M78B 4HT8A 3QHSA 4XTVA 5DY9A 4XTUA 5GMKh 3FJPA 5LJ5e 3PGGA 2EJGA 4M77B
chains in the Genus database with same CATH superfamily
1IGQA 1QP3A 1WXBA 2COZA 2G3RA 4RUGA 3CC4T 2DIGA 4E7KA 1ZUKA 1BU1A 5GMKj 5I21A 2OX7A 2XICA 1GBRA 5GMKl 3RKWA 2LQKA 4JJNK 4AFQC 1EIFA 1Q7YC 3I56T 2ENMA 4EMGA 2DA9A 1I81A 3M4YA 3ZEHA 4YTLA 4OP0A 3RERA 1RACB 3CCSA 3HRUA 4RCCA 2Y4YA 2KQWA 4QQDA 5D6XA 5LJ5d 1G8XA 4D8DA 5LJ5f 1YWPA 3QXEB 1MMDA 5CO7A 1NYGA 1IREB 3JCMJ 2MWOA 1YWOA 1G3WA 2J6KA 1RAGB 2QG9B 3G4ST 2VVKA 2RQTA 4A63B 4NS5A 2O4XA 2HL3A 5M9OA 1K8AC 2E41A 3SWNA 3CCRQ 4ZN3A 1UGQB 4JPBW 4ZGEB 5GAN2 5ECAA 2V26A 2AK5A 1YFNA 4AG2C 3VS1A 2KY9A 1YP5A 2YLCA 3Q1JA 1M3BA 3EG3A 1G5VA 3CBOA 1YJ9T 4TVRA 4XTWA 6AT1B 1UGRB 4KH0B 4M75B 1VQ5Q 2A3LA 3QO3A 4ELYC 3J80E 1PD1A 5A0DA 1UJYA 4LXCA 3GP8A 3JCMh 4LDXA 1MMGA 1D0XA 3MEVA 5GJWB 3VUBA 1WQ7A 3VUZA 3C95A 2PU9B 3JCMe 2FG0A 3EH1A 3H8ZA 4HKEA 4X9CA 3OYCA 4M78B 2ZPIB 1D0YA 1JJ2P 2COWA 2DRKA 2FRWA 4M77B 4C92D 1WJSA 5CAIA 1KD1U 2HSEB 4M7AB 2X3XD 2PVOB 1JRIA 4M4ZA 4CC4B 5CK9A 2DXTA 2LCLA 4X34A 3M0RA 1RAAB 2JN0A 3SFMA 2O2OA 3SWNC 3PT9A 2CZ1B 1ARKA 3RNJA 3TCJA 5D6WA 4IIMA 2JVVA 1WDXA 4KH1B 4C8QG 1W2BA 3DKMA 1FYNA 1X01A 4F17A 5LJ3j 1S1NA 3LLRA 2E3HA 2VV5A 5DLQE 2MMPA 1Z9ZA 4D6WA 4Y28E 4EIKA 2DNUA 1M3AA 3NMZC 4J9CA 4CC2A 2YUNA 2RQWA 2CUBA 3L1AA 1QVGA 3M0SA 3E9GA 1QKXA 3CC7Q 5GAMj 3LW5E 2AKLA 2QEXA 5GANh 3S3OA 2NWMA 4RKUE 1YJNQ 3V8KA 1PC0A 3BY7A 3QPHA 2D8JA 5GANe 5KH6A 5HK0A 1VQ8T 1M8MA 2WSFE 4PFOA 1YIJA 1WFWA 2V1RA 4C5HA 2QTXA 2C0OA 2L0AA 2P84A 2K3XA 1QCOA 2MI6A 4A4EA 3HPWA 2HKQB 4PJMA 4MZPA 2E6NA 3EG2A 3E19A 2EQUA 3PGGA 4LDYA 2CP2A 2EAYA 4QVCA 4AFSC 2YWWA 1VQLA 5GMKi 3RUXA 2SRCA 1VOMA 2XMFA 3CC2Q 2DERA 1KD1C 2CUDA 3CCVQ 1KSWA 3CMET 5GAMd 5KYXA 2JJ9A 1TXQA 2DL7A 5GAMf 3QWYA 2RJDA 3QIIA 2EQIA 1MV3A 4C92A 1WA7A 2YUQA 1E7OA 1PKSA 4LDVA 4C8QD 2OTLA 3JB9G 3FJ5A 2PZ1A 5CVIA 2O4XB 4FL6A 3I56A 1YI2A 1K0SA 1G3SA 2RB6A 3L2VA 1R8OB 4ME7A 1YITQ 3NHNA 1TWBA 2DL3A 4RG8A 4BB7A 2VGNA 3L2QA 2QDLA 3MP1A 3PMTA 9ATCB 4AT1B 2RK1A 1TU0B 2KK4A 3N5BB 1I8FA 1QMCA 3MEUA 2QA4T 3P8HA 2A0FB 2BE9B 4PFPA 2EYYA 3EH2A 2ABLA 4F7UF 2M1HA 2MIOA 2CSIA 2EW3A 3TREA 2NUTA 2OTJA 2FHDA 1XOVA 5LJ5h 3HSBA 4C0GA 4HA8A 2F5TX 4M7DF 4HT8A 2O9VA 8AT1B 4PJLA 2DL8A 3OYFA 4LDWA 5LJ5e 2DXBA 3G71Q 3DB4A 1M1KR 3URGA 4FYVB 5I22A 2H3EB 3THKA 4A4HA 4RTVA 2KROA 3JV3A 5J39A 1BIAA 2QTVA 2JM8A 3R6NA 3JCMc 4OB2B 2VGMA 2JTFA 2PTKA 4ORZA 2AIRB 2EJFA 5KE3A 1ZSZB 1VUBA 2KXCA 1OEBA 4KGZB 2FL7A 1Q86R 3O5ZA 4IURA 2DF6A 4DA4A 2VWFA 4ZN1A 3CCST 2JNGA 3GNFB 5KYYB 3FC3A 2RA2A 3FB9A 3CCQA 4B6MA 3HP9A 4F14A 2FYKA 4MZMA 3CCUQ 4OF1A 5GAN8 2XDPA 1UG1A 2LQWA 2K57A 3HTRA 1PKTA 3M0QA 1QVFP 3GF5A 2E4HA 1M30A 2OAWA 1M1KU 3PIPA 4Z02A 3OMGA 2WACA 1VQ7A 1UGPB 3JB9I 3OYEA 4JJBA 1UECA 1SG5A 3M9QA 4HT9A 2KR3A 4JDSA 2GQIA 1BKBA 1Q82C 1O9SA 3VS0A 2DO3A 2YLBA 2RQVA 4ZGJB 1G3YA 5CKDA 3I55A 4FW2A 4MDWA 5HY6A 2VYTA 1NJIU 1U3OA 2RHXA 2F5KA 1BIBA 3LH0A 3CPWS 5GANj 2YUOA 2LCSA 3V7SA 1RAEB 4AFUC 1RLQC 4XU2A 1W6XA 3HKSA 2LVMA 4XU0A 4K11A 3TVTA 1QWEA 2DFUA 4QQ6A 3FJPA 2E1HA 3EFOB 3OW2S 1VQ8A 1UGVA 2XU8A 3CXCS 5FWBA 2LP5A 5EG2A 2R58A 1Y71A 3OYJA 1HSQA 1X6OA 4OMPA 1YJWA 2FPFA 2EQMA 3KFVA 2FZCB 1VIFA 2EWNA 3EGUA 1YHQA 2ECZA 2CS7A 4QVZA 4M7DD 1O75A 2PUOB 1D1BA 2YT6A 4C92B 1VQOQ 2FB7A 2L3PA 2VXFA 3I5SA 4M75E 4AFZC 5GANd 2WSCE 4A4GA 3CBPA 3SHWA 5GANf 2KRMA 3S3MA 1KC8R 1KQSA 1AHJB 1VQ6A 1B07A 4C5EA 3NTHA 3FLGA 1B34B 3CMEA 1M1GA 3HRSA 1RAFB 4J9FA 2DETA 3ASKA 2DPPB 3EGDA 1OU9A 1IGUA 2OAUA 2K2VA 3VS4A 3T9NA 3OYNA 3OQ5A 1IHVA 2A28A 2QQAA 3CCMQ 2DAQA 4MMKA 4XU1A 3CCJQ 1Q81U 1X69A 1U1SA 1FXXA 2DBMA 1X2KA 2JTEA 4JZ4A 3M57A 4E47A 3UF4A 2QEXT 1NG2A 3CPFA 1I4K1 2RD1A 1VQ4Q 2J6FA 4II1A 3RMQA 1X6GA 1VQKQ 4PK4A 4E6RA 1VQMQ 1JEGA 2DYIA 2NUTB 1WNLA 2A7YA 1BCMA 3F70A 1B7TA 1M2VA 1NJIC 2DJQA 3G6EA 1KJWA 4PL6A 3NTKA 1KC8U 1WX6A 2FZGB 3CBMA 1U8RA 1N8RC 4C0DC 1TOVA 3M0PA 1VYVA 2D8HA 2DXCA 2PUKB 1KQSP 3ULRB 2HAXA 3CCEQ 1UE9A 4DOWA 5IHIA 1NYFA 1K9MR 2E70A 1QCFA 1UGSB 2XI9A 2ROLA 1VQLT 5LJ5j 1Y7XA 2LJ0A 2K7AA 2DRMA 1HK9A 3DLLA 2FPEA 4AG1C 2QQRA 2CH4A 4BE1A 1T0HA 5CKHA 5CR2A 2IPOB 3VV0A 4OB1B 2L3QA 2LRQA 1X27A 1U06A 2DXUA 4OGEA 2KRSA 3RKXA 2MCNA 3E2UA 2RNAA 1LCKA 2EVRA 3L2RA 1WJQA 2ZPHB 4C92G 3EGXA 3G1JA 4F7UA 2OTLT 2LQNA 4PLIA 4QQGA 2GBQA 4ZGDB 4LD9K 1VIEA 3OYGA 3GLXA 3JCMQ 1IO6A 2ZPFB 4F7UE 3TSWA 2DD4A 2A08A 2K9GA 4KRTA 1MNEA 4LDUA 1I1JA 4QT7A 1YI2T 1G2BA 3EHRA 1X75C 2DZ9A 4M7DA 1IHWA 1K9MU 2CP7A 2FVUA 1FMKA 2DL5A 3NTIA 4M7DE 4C8QB 3CMAQ 3VS3A 3OYLA 1NEBA 1JJ2A 3RBBB 2DE0X 5D6YA 3M54A 3H0FA 1VQ9T 2CSQA 2OJ2A 1K76A 2RI2A 3QG1A 2GCXA 2KGTA 3MP6A 4N4HA 1RI0A 3V7CA 3EG9A 3OMCA 2JT4A 1OYXA 3CCVT 5LL6S 3EFSA 4JRKA 2DBKA 3EAEA 4BDZA 1VYUA 3A1PA 3RR6A 2BZXA 1KFZA 4J6WA 1NZ9A 4MMLA 2OTJT 4XTXA 2DEQA 4IUUA 4XU3A 4XTVA 4BI3A 4CRIA 1S72T 2EJGA 1M1FA 2LX7A 1VQNQ 2RK2A 3UDCA 1PRLC 4X1VA 2AZVA 2CDTA 2P4RA 2C06A 5GAOq 2HZYA 5CQYA 1QWFA 5KYWB 1G3TA 2RO0A 1OX8A 1YCSB 1WQWA 1RAIB 2D0NA 4XTYA 1M8VA 2GQVA 4M7DC 2LNVA 2DILA 4JRIA 1W2BS 4XK8E 5FLXE 3RESA 4LN2A 1VQPQ 2O9SA 1TS9A 4OMMA 5FU6B 3GBQA 3CCQT 1OX9A 1JBMA 5D7UA 3CD6Q 3CCRA 1N27A 3EG0A 4RG2A 1IB8A 4QKUA 1KQ2A 3AHUA 2ZGWA 3PTAA 4OMQA 1TG0A 1WXTA 5J3BA 5KCHA 1QVGS 1JO8A 4B9WA 4C0FA 1K73R 1GXIE 3X20B 5IN1A 2DTIA 4BDYA 1VQ7T 4EMKA 5IXFA 1ZA2B 2LTOA 3G71T 1VQ5A 1P92A 3OY9A 4PJOE 2X3WD 1WZOA 4DEXA 2DEUA 2O88A 2DLPA 2P0KA 1PM3A 3I55T 1MNDA 2LX9A 4IUTA 1ABOA 1T0JA 1UDLA 1SHGA 3LYIA 4L59A 2GFUA 2HQEA 2DM1A 4PLLA 2NUZA 4LD6A 1QLYA 2K4YA 1WGSA 2NLUA 4M75F 1QKWA 2DMOA 3QHSA 1BI1A 2C0IA 2JMCA 1QVPA 2CKKA 3QYHB 2QI2A 1U5SA 2FO0A 4EDUA 1F1BB 1M90R 2EFIA 1K73U 2HD0A 2QGFB 4M78F 2QQ9A 5I11A 2DD5A 2CP0A 1YJWT 4M77F 3FIFA 3CC4Q 1YHQT 3OYAA 3D7SB 4ELZC 2DX1A 4M7AF 4MDXA 3VS5A 4HCZA 1OV3A 3H0HA 3QSUA 5CKBA 5FRMA 1U1TA 1MHNA 4ESRA 1ZSGA 1CKAA 1M4ZA 2GTJA 4PJNA 1HD3A 4EMKC 2F2WA 3J81E 2CGHA 4D8KA 1VQ6T 1OULA 1SKUB 3SD4A 5FRNA 1LNXA 4ANJA 1OQKA 1PRMC 1QCNA 2HQXA 3G4SQ 1SSFA 2AKKA 3CC7A 2FEIA 3M58A 3O8VA 7AT1B 1CKBA 3M4GA 1YJNA 2ATCB 3HL8A 1Y0MA 5KYUA 2E12A 4LE9A 3OA6A 3BE3A 2EQJA 4RMOA 1YBYA 3SWNB 2Y90A 3EG1A 1VA7A 1JXMA 2ROTA 2MWPA 4C0ZA 2YRDA 1YJ9Q 1ACMB 2RJFA 1IZ6A 3MKDA 3M56A 4DBQA 3A8OB 4E7SA 2LJ1A 2M0YA 3G6ET 1MV0B 1VQ9A 2YUPA 3X26B 1D3BA 4GLMA 3CCVA 1BI2A 4LNPA 3QDFA 3V8JA 1HJDA 4JLGA 1TTHB 3EHQA 4A4KA 1XNIA 2FRYA 5HKCA 1UFFA 2FZKB 1Y96A 3HFOA 3CCMT 1QVFA 2D6FA 4M75D 1T3SA 1S72A 1E6GA 3ZL7C 1IRXA 1A0NB 4ZNXA 4JS4A 3MHXA 2BE7D 2NUPA 1ABQA 1T3LA 5LJ3g 2F2XA 4NL2A 1KQ1A 4J83A 3OBWA 2P0PA 1JU5C 1YNZA 3KUFA 3H9NA 1N9SA 4EMHA 4F7UG 1ZBXA 1YITA 4JJDA 3A8GB 2PVGB 1TSFA 1I5LA 1ZHIA 2RPNA 2AHJB 3UWNA 2XIDA 3M53A 1WPYA 1KG1A 3CCLT 5GAMg 4FYYB 3NPFA 4NOYA 1AT1B 5EC7A 4M7DG 1AZEA 4RTXA 3JRZA 5HCKA 2ZPBB 1AOJA 1OZ3A 4IIOA 3LX7A 4Z8AA 3CCET 3RIRA 1C0MA 1ZX6A 2EYQA 5A0LA 5IXBA 4V2SA 2V8KA 2ED1A 1W70A 5IH2A 4E7ZA 2ZCFB 2MYSA 1NM7A 3REAB 3A5ZB 2DTHA 2DJZA 2H8HA 1RAHB 2V1QA 1KHIA 3G71A 4KT0E 1NBEB 4PJJA 2LC4A 4R55A 3H41A 1NLPC 5AT1B 4ZTFA 1M2OA 2LT1A 2M9UA 2RI5A 4OVAA 1QP2A 3VKIA 1OPLA 1Q86U 2K3YA 2VB6A 2KVQG 3KBGA 2QK0A 1I0CA 2CH4W 2DYBA 2AT1B 2HCKA 4FYXB 2K2MA 2J6OA 1UEBA 1XTDA 2MAMA 1WLPB 4OB0B 5FROA 4J7FA 5FU7C 3SDZA 2COYA 3WXMB 2K5IA 3MPUB 3EFRA 3CMEQ 4PJOF 2IVWA 3CCUA 1I5OB 1PWTA 1Q7YR 2R57A 2RM4A 3NGPA 2I0NA 3U23A 1JQQA 1AWOA 3CCRT 5KYXB 3M59A 4DQ2A 4WTOB 3H0IA 1BB9A 3S6WA 1PSFA 4CC3A 4DBHA 2QQSA 3UA7A 4QW2A 1SEMA 4M75A 5AYFA 2CT4A 3VRZA 2RHIA 4BI8B 1AWXA 2QYZA 3CEYA 1FWZA 1D09B 1K8AR 2KNBB 3GIBA 2X4JA 4O6JA 1V76A 2XDBA 1VQ5T 4Z89A 4EPCA 3CPWA 1V29B 2KSSA 2LMJA 2L89A 2LCCA 4M78A 1N9RA 4OGCA 2F1LA 3R6OA 1WHGA 1ZBJA 4BE2A 2JXBA 4M77A 1C6VX 2K5LA 2E6ZA 4M78E 2QA4Q 4HVWA 3JCMg 2HMAA 2XHCA 3C4SA 3RMSA 1ZA1B 1YCYA 3OYDA 4M7AA 2WSEE 4M77E 3PMIA 2EGEA 3HFNA 3OBYA 2Z0WA 1M1KC 3A8LB 4M7AE 3CXCA 1KHCA 3LGLA 4OMFB 3VRYA 2RI3A 2VKNA 5GJVB 2I2LA 2JTMA 3H6ZA 1H3ZA 3CD6T 1OPKA 2EYZA 4PNOA 1EFNA 2X51A 2SEMA 2RHZA 2VASA 5IT9E 1SHFA 5KE2A 3OYBA 1Q86C 3PIOA 3REBB 4J9GA 2JM9A 1GFDA 1VQOA 2LNHB 3L2ZA 1TH7A 4M75C 4FU6A 3CPWP 3VYHB 4O5VA 4KBMB 5L8RE 2KAFA 2X4XA 2L3RA 1WIEA 1X6BA 4BI4A 2QDYB 2KXDA 4R56A 4JZ3A 3CCSQ 4GLKA 2CZ7B 3MJXA 4J6XA 4XTZA 3CCMA 4C92F 4M78C 3OW2P 3CCJA 2JW4A 4CI0C 4RTUA 2MF2A 4OMLA 1LJOA 1JXOA 3CXCP 4M77C 1TUGB 1JJ2S 4JRQA 3VJPA 4JLIA 1AEYA 4Q5WA 3CC7T 4PJOD 4M7AC 3HRTA 2ED0A 1YJNT 2MPXC 3QBYA 2GTOA 2XD0A 1KK7A 3GOXA 5GANg 1VQMA 2LDMA 2ZPEB 2H3JA 1GL5A 1M3CA 5GAN6 2AZSA 3CCLA 2E5QA 1RUWA 2R5AA 2KT1A 3OYKA 4J9BA 3JCMX 2DZCA 3UT1A 3CCEA 3X25B 3M0TA 4E7LA 5C0MA 2JOYA 2QAZA 1UHFA 1Q81C 1SRLA 2F2VA 4XTUA 1RI9A 1OU8A 3CC2T 3ME9A 3RKYA 3QDRB 2BKDN 2GFAA 3A98A 2X9HA 2CZ0B 2DKGA 1TUCA 2JUFA 4N0AA 1J3TA 3VS6A 1MUZA 1NPPA 3J7AF 3WVDB 2YDLA 4KUDK 1R77A 1GCQA 1KD1R 1B3QA 1KC8C 3S3NA 3MEAA 2VXEA 4OMOA 1AD5A 4KUIA 2M16A 3L2UA 4J8OA 1UTIA 2O01E 1EZZB 1YN8A 2QXFA 4C0DB 1LOJA 1YITT 3A8MB 2K6DA 2HNIA 4MZTA 2D0QB 4HXJA 3CMAA 4NL3A 2K5FA 4FSSA 2JS0A 4L6V5 2V8IA 4FIBA 3GNGA 1WHHA 1XJWB 1UJ0A 1GBQA 5I2MA 2CREA 4GBQA 1PD0A 3BDUA 4IUPA 3EGDB 2MOXA 2B86A 2KYBA 1M9SA 1WYXA 2QASA 2X4WA 2E65A 2K3BA 1PHTA 2CP5A 3VS2A 1K1ZA 4C5GA 4C8QF 2QEXQ 2KI7A 2CZ6B 1LVKA 1ZLMA 4WF2A 5CCAA 2YXYA 4PFZA 3QJ6A 4PJOA 2EJ9A 4N0AC 5GAOn 3JCMP 5LJ5g 2GNCA 2IIMA 4A54A 1H3HA 5HK3A 1K9MC 1VQNA 1YIJQ 2XDDA 1UUEA 5DY9A 5CKFA 2YSQA 1GCQC 1ZSZA 2RH2A 1RLPC 2Y4XA 1NE8A 4OMNA 5GAN3 2J06A 3OYYA 4XQ3A 1D1AA 3L2WA 3BDLA 5IHNA 1RABB 5KYYA 1OI1A 1M2VB 5CKEA 2B8AA 3FEOA 2DVEA 2YRVA 4AMCA 1N5ZA 1VQLQ 4Z88A 1GFCA 1QW1A 2BIVA 1VQPA 3ER0A 5CIUA 2DTOA 3ZFJA 4J6YA 3CD6A 4RCBA 4DBFA 3CCUT 2X4YA 2X35A 2NYSA 4PKCC 5GAN4 1V1CA 2PVDB 1MMNA 1PNJA 4Y91A 4CC7A 2E5KA 3BFMA 2KDSA 3PE0A 2OTLQ 4XAXB 1C1AA 3MEWA 4ZTJA 4DOVA 5GAOm 1BK2A 4M75G 2W0ZA 3IQLA 5GAOp 3I56Q 3M5AA 1YI2Q 3EGXB 4F7UB 3C0CA 5FWCA 4PJOC 3KXTA 4X9DA 3OB9A 1WHJA 3PVLA 3P8DA 3TSZA 2HEQA 4RTZA 1EX4A 5LJ3d 3OYIA 1ZSZC 5LJ3f 4M78G 4BD3A 3JB9F 3HHTB 3SB2A 1W2BP 2A36A 4M7DB 1Q82R 2M51A 4HVVA 1VQ9Q 4M77G 3EFOA 2LQ8A 4E2FB 3QWXX 4J9EA 1M90U 3V8LA 4RTWA 1FX7A 2EYXA 3OS1A 4M7AG 3A8HB 2K79A 2KT8A 4BE0A 2RMOA 3MO8A 4FT2A 1SPKA 1QVGP 2OTJQ 3EG9B 2KEAA 3FDRA 2W10A 1MMAA 3G7ZA 1JB0E 4GY5A 2E64A 1ZQ1A 3DB3A 5GAOr 3CC4A 1S72Q 1QVFS 2O31A 4C92E 1W4SA 2QQBA 2D1XA 3C12A 2L8DA 1KIKA 2EPDA 3MP8A 1K0XA 1PSEA 2BUDA 2BZYA 4J7IA 1AZGB 1B34A 2HBPA 1VQOT 3ZBDA 4P5NA 3CC2A 2XK0A 3DLMA 2CT3A 1FMWA 1Q82U 5DM7R 2BTTA 3M55A 2JMAA 1H8KA 2VC8A 2L5QA 2P4TA 1RL2A 4LUDA 3G4SA 2DL4A 1K73C 1BI3A 2ZZDA 3PFSA 1XQHA 5A0GA 1HXDA 3CCQQ 1SRMA 1FMVA 4F16A 3CCJT 2DVJA 2KBTA 4RTYA 4FYWB 1AWWA 3OYHA 5L23A 4J9HA 3VS7A 1NPRA 4KULA 2J7IA 3E9FA 2CP6A 5GAOl 4JRPA 3M0UA 1WHLA 3QKJA 1VQ4T 4B9XA 1VQKT 4M78D 1VQ7Q 4E7IA 3GPLA 1YJ9A 1VQMT 2RQUA 1G83A 2E3IA 2HBWA 3OS5A 3QUIA 2F69A 4M77D 1BYMA 4IUQA 2V8JA 4C92C 4M7AD 1R0BG 1H641 4BY6C 3INZA 1MGQA 3OSSC 1BCOA 4PJOB 2HL5C 4EMKB 4IKFA 3TU4K 3I55Q 1R0CB 4DEYA 2RF0A 4E7JA 8ATCB 1NEGA 1ZUUA 3JCMV 2J05A 4IUVA 4BACA 2HQHA 1WHKA 1BBZA 3QYGB 2A37A 4R0KA 4E7HA 1M90C 2XG8D 3JSCA 4FT4A 3CQTA 4VUBA 5GMKh 1GCPA 4L5GA 3I9QA 1NJIR 1ZUYA 5KYNA 1N8RR 1QQJA 1K9AA 3JB9D 2L3SA 5J26A 3TQ7P 5GMKe 3PNWC 1CSKA 4UC4A 1UHCA 1I07A 3JCMb 1OZ2A 1N6AA 4C5IA 1SF9A 2EGAA 3LWHA 1VQ8Q 4A4FA 5GAN5 4J9DA 1AVZC 3JCMd 5FW9A 1M27C 3JCMf 1WXUA 3X28B 5IAYA 2ZAEA 2P0QA 2HSPA 2YRCA 1YJWQ 1M5Q1 3UPUA 4WCIA 1YHQQ 3META 1WJRA 5C6SA 1HYOA 1NLOC 3OYMA 2FPDA 2YHTA 2EQKA 4RTTA 4ATOA 4J5YA 4C8QA 2D9TA 2EGCA 1WHMA 2G6FX 5A2QE 2LJ3A 4BUGA 4JS5A 2EKOA 4C8QE 2EYWA 2OI3A 1VQ6Q 3CMAT 2M0OA 1E6HA 1KQSS 3RDVA 1N8RU 1D0ZA 3LGFA 2EBPA 4N4IA 3BW1A 1UB4A 1W1FA 5GAN7 3C94A 3NFCA 1TUDA 2KE9A 1BI0A 2PNIA 3OS2A 2KMTA 3I5RA 2BZ8A 2JS2A 3UA6A 2RJEA 2RN8A 2C0TA 3VU3C 1Q81R 4KGXB 2LZ6B 1OOTA 2DK3A 2R5MA 5KYUB 3MCAB 4FSXA 4PJOG 1VQNT 3JAME 5I2SA 5KYWA 3G6EQ 3QZ5B 4J9IA 4F04B 2ESWA 2RHUA 2DIQA 2ZPGB 4BY6B 2RQRA 2M02A 3LH5A 5GMKm 3X24B 4HCCA 1Q7YU 2XKOC 4A53A 5KCOA 4HVUA 4C8QC 4HCBA 3JB9J 3OW2A 3PVQA 3QJYA 1GRIA 3I35A 1H92A 4JJCA 2CP3A 3QZ9B 2E10A 2KRNA 3WVEB 3OS0A 1VQPT 2VUBA 1D3BB 3JB9H 2QGGA 3E1SA 1WI7A 3L42A 4FM4B 1X2QA 1RADB 1K4US 3JCMW 4OB3B 5LJ3h 4KGVB 4FW1A 4QVDA 1X43A 4HCKA 4N4GA 3V7RA 2MK5A 1SSHA 1K8AU 3TEEA 5DLOA 5LJ3e 1Y96B 4JUVA 2EKHA 2PQWA 3OSVA 3SEMA 1Q95G 2GGRA 1Y57A 2KYMA 3FRNA 1PCXA 1IXDA 2JZ2A 2RJCA 5GAMh 2NUPB 3LWIA 5IHKA 1YIJT 5GAMe 3CCLQ 4FCYA 1Z9QA 1D1CA 3AT1B 2LT4A 4LUEA 2QA4A 1AWJA 1Y07A 5FU7B 4DBRA 3VYGA 4Y92A 2CYZB 3UATA 3P8BB 1LPLA 2GF7A 2HKNA 2L2PA 2HDAA 5FU6C 2RHYA 2EIFA 2IG0A 1VQ4A 1PG5B 1DJ7B 1VQKA 5CQXA 1VYTA
chains in the Genus database with same CATH topology
1D3BA 1QP3A 5GAN3 3OYYA 2E1HA 4XQ3A 1BI2A 3CCVA 3OW2S 3L2WA 3BDLA 3V8JA 1VQ8A 2G3RA 4JLGA 2XU8A 3CXCS 3CC4T 1OI1A 2DIGA 5CKEA 5EG2A 2R58A 4E7KA 4A4KA 2B8AA 3FEOA 1XNIA 2DVEA 5GMKj 5HKCA 2YRVA 5I21A 1Y71A 2XICA 3OYJA 1X6OA 5GMKl 3RKWA 1YJWA 1Y96A 2EQMA 2LQKA 4JJNK 3HFOA 1EIFA 1VIFA 2EWNA 3CCMT 1YHQA 1Q7YC 3I56T 1QVFA 2D6FA 1QW1A 2BIVA 4M75D 2CS7A 4EMGA 3ER0A 4QVZA 1VQPA 1S72A 4M7DD 1I81A 1O75A 2PUOB 5CIUA 2DTOA 3M4YA 3ZEHA 3ZFJA 4J6YA 4JS4A 3CD6A 4C92B 4YTLA 4RCBA 3MHXA 4OP0A 3RERA 3CCSA 3HRUA 4RCCA 2Y4YA 2KQWA 4QQDA 5D6XA 4NL2A 5LJ3g 5LJ5d 2FB7A 3CCUT 2X4YA 2VXFA 1KQ1A 4M75E 2X35A 5LJ5f 4J83A 5GANd 3QXEB 3OBWA 2WSCE 5CO7A 2P0PA 4A4GA 1YJ9A 3CBPA 1IREB 5GANf 3KUFA 2MWOA 4PKCC 3JCMJ 4F7UG 1AHJB 1G3WA 1N9SA 4EMHA 5GAN4 1KQSA 1ZBXA 4C5EA 3NTHA 2PVDB 1YITA 3FLGA 4Y91A 1B34B 3A8GB 3CMEA 1M1GA 2PVGB 3G4ST 3BFMA 1I5LA 1ZHIA 2KDSA 3HRSA 4NS5A 2O4XA 5M9OA 1K8AC 3ASKA 2DPPB 4XAXB 2AHJB 3UWNA 2XIDA 2E41A 2OAUA 1WPYA 2K2VA 3M53A 3SWNA 3CCLT 1KG1A 3T9NA 5GAMg 3MEWA 4ZN3A 4ZTJA 4DOVA 1UGQB 3OYNA 3OQ5A 4NOYA 5GAOm 4M75G 2QQAA 5GAOp 4M7DG 4ZGEB 2DAQA 5GAN2 3M5AA 3JRZA 4MMKA 4XU1A 2ZPBB 4F7UB 1Q81U 1OZ3A 1U1SA 4PJOC 3KXTA 3LX7A 3CCET 4X9DA 1FXXA 3OB9A 2KY9A 3Q1JA 2YLCA 3RIRA 3P8DA 2EYQA 5A0LA 3M57A 4V2SA 1G5VA 4E47A 2V8KA 3CBOA 2QEXT 5LJ3d 1YJ9T 3CPFA 1I4K1 2RD1A 4TVRA 3OYIA 5LJ3f 4M78G 4XTWA 4BD3A 1UGRB 3HHTB 4M75B 3SB2A 2A3LA 3QO3A 2ZCFB 4ELYC 3JB9F 4M7DB 4II1A 3RMQA 3J80E 5A0DA 4M77G 3GP8A 2LQ8A 3JCMh 4LDXA 3A5ZB 2DTHA 3MEVA 3VUBA 1WNLA 2A7YA 1M90U 2DJZA 3F70A 1WQ7A 3VUZA 3V8LA 1FX7A 3OS1A 4M7AG 3A8HB 1KHIA 3C95A 2PU9B 4KT0E 3G6EA 3G71A 3JCMe 4PL6A 1KC8U 3NTKA 2LC4A 3CBMA 1U8RA 1N8RC 3H8ZA 4C0DC 4BE0A 4HKEA 4X9CA 4R55A 3OYCA 2DXCA 3MO8A 4M78B 4ZTFA 4FT2A 2ZPIB 2LT1A 2PUKB 3S3MA 2M9UA 2HAXA 2RI5A 4OVAA 1QP2A 3FDRA 4DOWA 4M77B 4C92D 1WJSA 5CAIA 3VKIA 1NJIC 3G7ZA 1Q86U 1KD1U 1JB0E 2E70A 2E64A 1ZQ1A 1UGSB 2K3YA 3DB3A 2XI9A 4GY5A 1VQLT 5LJ5j 5GAOr 2KVQG 1Y7XA 4M7AB 3CC4A 3KBGA 1QVFS 2PVOB 1HK9A 3DLLA 1JRIA 4C92E 2QQRA 4BE1A 1W4SA 2QQBA 3C12A 5CK9A 2DXTA 2L8DA 2LCLA 3MP8A 5CKHA 5CR2A 1PSEA 2BUDA 3VV0A 4J7IA 4OB1B 1UEBA 2LRQA 1B34A 1XTDA 4X34A 2HBPA 2MAMA 4OB0B 1VQOT 3ZBDA 2DXUA 4OGEA 5FROA 4J7FA 2JN0A 3RKXA 5FU7C 3SDZA 3SFMA 3WXMB 4P5NA 2K5IA 3SWNC 3PT9A 3CC2A 2XK0A 3EFRA 1VQKT 4PJOF 2IVWA 3L2RA 2CZ1B 3DLMA 1Q82U 3CCUA 1WJQA 2R57A 2ZPHB 2RM4A 4C92G 3TCJA 5D6WA 3M55A 5DM7R 2JVVA 4F7UA 2OTLT 2VC8A 4PLIA 2L5QA 4QQGA 2P4TA 4ZGDB 4LD9K 1RL2A 1VIEA 3CCRT 4C8QG 3OYGA 3M59A 3GLXA 3JCMQ 3DKMA 4DQ2A 3G4SA 1W2BA 2ZPFB 3S6WA 1PSFA 1X01A 1BI3A 2DD4A 2ZZDA 4F7UE 3PFSA 1K73C 1XQHA 5A0GA 1HXDA 4LDUA 2QQSA 5LJ3j 1YI2T 3LLRA 1X75C 3CCJT 4QW2A 2VV5A 5DLQE 2MMPA 4M75A 5AYFA 2DZ9A 4M7DA 4D6WA 2RHIA 4BI8B 4Y28E 3OYHA 1K9MU 3CEYA 1FWZA 1NPRA 2FVUA 4KULA 3GIBA 3E9FA 3NTIA 4M7DE 4C8QB 2X4JA 5GAOl 4O6JA 3L1AA 4JRPA 3OYLA 2XDBA 1JJ2A 1QVGA 3QKJA 3E9GA 1VQ4T 4B9XA 1VQ5T 4EPCA 3LW5E 5GAMj 4M78D 2QEXA 3CPWA 1V29B 5GANh 2KSSA 5D6YA 3M54A 2L89A 4RKUE 3GPLA 2LCCA 4E7IA 3S3OA 1VQMT 3V8KA 1VQ9T 4M78A 3BY7A 1N9RA 2RI2A 3QG1A 2GCXA 3OS5A 3R6OA 4OGCA 3QUIA 2F69A 3QPHA 4M77D 4BE2A 3MP6A 4N4HA 3V7CA 1RI0A 1BYMA 4IUQA 5GANe 2V8JA 4M77A 3OMCA 1OYXA 3CCVT 2K5LA 2E6ZA 4M78E 5LL6S 3EFSA 4JRKA 4C92C 5KH6A 4M7AD 3EAEA 1H641 3JCMg 4BY6C 3INZA 1MGQA 2WSFE 5HK0A 3OSSC 2XHCA 3C4SA 4BDZA 3RMSA 1YIJA 4PJOB 4C5HA 1YCYA 3OYDA 4M7AA 2QTXA 2WSEE 4EMKB 4M77E 4IKFA 3TU4K 3PMIA 2K3XA 3HFNA 4J6WA 1NZ9A 4MMLA 2OTJT 3OBYA 4XTXA 2MI6A 4E7JA 3A8LB 1M1KC 4A4EA 3HPWA 3JCMV 4M7AE 4IUVA 4BACA 2DEQA 1KHCA 3QYGB 4IUUA 4XU3A 3CXCA 2XG8D 4E7HA 3LGLA 3JSCA 4FT4A 4MZPA 4OMFB 4XTVA 4BI3A 2E6NA 2RI3A 4VUBA 4CRIA 5GMKh 1S72T 3E19A 2EQUA 3PGGA 4L5GA 4LDYA 2EJGA 2I2LA 2JTMA 3H6ZA 2EAYA 1M1FA 4QVCA 1H3ZA 3CD6T 4PNOA 3JB9D 2RK2A 1VQLA 5J26A 5GMKe 3UDCA 5GMKi 3PNWC 3RUXA 4UC4A 2RHZA 5IT9E 5KE2A 3OYBA 3JCMb 1OZ2A 1Q86C 1N6AA 1KD1C 3PIOA 2C06A 4C5IA 5GAOq 3LWHA 3CMET 5GAMd 5CQYA 4A4FA 1VQOA 5GAN5 1G3TA 5GAMf 2RO0A 3JCMd 3L2ZA 1WQWA 3JCMf 3X28B 5IAYA 2P0QA 1TH7A 4M75C 4FU6A 4XTYA 1M8VA 2GQVA 2RJDA 4M7DC 3VYHB 2LNVA 1M5Q1 3QIIA 4O5VA 4KBMB 5L8RE 3UPUA 2KAFA 2X4XA 2L3RA 4JRIA 3META 1WJRA 4C92A 1W2BS 4XK8E 5FLXE 3RESA 5C6SA 5FU6B 4BI4A 3OYMA 4LDVA 4C8QD 2QDYB 2YHTA 2EQKA 2OTLA 4ATOA 3JB9G 3CCQT 4J5YA 4R56A 4C8QA 1JBMA 2D9TA 3CCRA 1N27A 4RG2A 5A2QE 5CVIA 4GLKA 2O4XB 2CZ7B 4FL6A 4XTZA 4J6XA 4BUGA 3CCMA 4JS5A 1KQ2A 4C92F 2ZGWA 3I56A 3AHUA 2EKOA 4M78C 4C8QE 1YI2A 3PTAA 1G3SA 2RB6A 3L2VA 3CCJA 4CI0C 2MF2A 1R8OB 4ME7A 5J3BA 1LJOA 5KCHA 4RG8A 3CMAT 4M77C 2M0OA 1JJ2S 4BB7A 2VGNA 4JRQA 3VJPA 4B9WA 1QVGS 4JLIA 1KQSS 1N8RU 4C0FA 4Q5WA 3CC7T 3LGFA 3X20B 4PJOD 5IN1A 1GXIE 2DTIA 4BDYA 4N4IA 3BW1A 3MP1A 3L2QA 1VQ7T 3HRTA 1VQ8T 1UB4A 4M7AC 1YJNT 3PMTA 3QBYA 4EMKA 2LTOA 5GAN7 3G71T 1VQ5A 1P92A 2XD0A 3C94A 3NFCA 3GOXA 1BI0A 5GANg 3OY9A 1VQMA 4PJOE 3OS2A 2LDMA 2RK1A 2KK4A 2KMTA 2ZPEB 1I8FA 3MEUA 3N5BB 2QA4T 3P8HA 2H3JA 5GAN6 2P0KA 3CCLA 4F7UF 3I55T 2M1HA 2E5QA 2LX9A 2RJEA 4IUTA 3VU3C 2R5AA 3OYKA 3LYIA 4L59A 2GFUA 2HQEA 2DK3A 3TREA 3JCMX 2R5MA 4PLLA 2DZCA 3MCAB 3UT1A 4LD6A 3CCEA 2OTJA 2K4YA 4FSXA 1WGSA 2FHDA 2NLUA 4PJOG 3X25B 1XOVA 5LJ5h 3HSBA 4C0GA 4HA8A 4M75F 4E7LA 2F5TX 4M7DF 1VQNT 5C0MA 3JAME 2JOYA 4HT8A 3QHSA 1Q81C 5I2SA 1BI1A 4XTUA 1QVPA 2CKKA 4LDWA 5LJ5e 3OYFA 3QYHB 2QI2A 2DXBA 3QZ5B 3DB4A 3CC2T 3ME9A 3RKYA 4EDUA 2RHUA 2DIQA 2ZPGB 3URGA 4BY6B 3QDRB 1VQ6A 2BKDN 4A4HA 2GFAA 1M90C 5GMKm 2EFIA 1K73U 2HD0A 3X24B 4HCCA 2CZ0B 2DKGA 1Q7YU 2XKOC 5J39A 1BIAA 4A53A 4M78F 5KCOA 2JUFA 4HCBA 4C8QC 3JCMc 3JB9J 2QQ9A 4N0AA 3OW2A 2DD5A 4OB2B 2VGMA 3QJYA 1NPPA 2JTFA 1YJWT 4M77F 3FIFA 3J7AF 2EJFA 3QZ9B 2E10A 3WVEB 3WVDB 1YHQT 5KE3A 4KUDK 1VUBA 3OYAA 3OS0A 1VQPT 4ELZC 2FL7A 2VUBA 1D3BB 3JB9H 4M7AF 4MDXA 4HCZA 3E1SA 1KC8C 3S3NA 3L42A 3MEAA 5CKBA 3QSUA 2VXEA 4FM4B 4IURA 5FRMA 1U1TA 4DA4A 4KUIA 2M16A 3JCMW 4ZN1A 4OB3B 5LJ3h 2JNGA 3L2UA 3CCST 4QVDA 3GNFB 1MHNA 4J8OA 3FC3A 2RA2A 3FB9A 3CCQA 1M4ZA 4N4GA 2O01E 3V7RA 4EMKC 1K8AU 3TEEA 3HP9A 5DLOA 3J81E 5LJ3e 2FYKA 2QXFA 1Y96B 2CGHA 4C0DB 1LOJA 1VQ6T 4MZMA 1YITT 3SD4A 4JUVA 3A8MB 5FRNA 2HNIA 4OF1A 4MZTA 5GAN8 2XDPA 2PQWA 3OSVA 2D0QB 1LNXA 2K57A 3FRNA 2JZ2A 2RJCA 3CMAA 4NL3A 5GAMh 3GF5A 2HQXA 2K5FA 1SSFA 1M1KU 3CC7A 3PIPA 3LWIA 4Z02A 3M58A 3O8VA 2WACA 3OMGA 1YIJT 1UGPB 1VQ7A 3M4GA 4L6V5 1YJNA 3JB9I 5GAMe 3OYEA 2V8IA 4FIBA 3GNGA 3M9QA 4HT9A 3HL8A 2E12A 4JDSA 1BKBA 1Q82C 1O9SA 5I2MA 3OA6A 2LT4A 3BDUA 2QA4A 2DO3A 2YLBA 4IUPA 2EQJA 4RMOA 1Y07A 1YBYA 5FU7B 1M9SA 3SWNB 2Y90A 4ZGJB 2X4WA 1G3YA 2E65A 5CKDA 3I55A 3VYGA 2MWPA 4C0ZA 4MDWA 5HY6A 2CYZB 2VYTA 4C5GA 4C8QF 3P8BB 1NJIU 2CZ6B 2RHXA 2RJFA 2GF7A 2F5KA 1BIBA 1IZ6A 4WF2A 5CCAA 3LH0A 3M56A 3CPWS 5GANj 3V7SA 5FU6C 2RHYA 2EIFA 3QJ6A 4PJOA 3A8OB 4XU2A 2EJ9A 4N0AC 5GAOn 3HKSA 3JCMP 2IG0A 5LJ5g 2LVMA 4XU0A 4A54A 3G6ET 5HK3A 1VQ4A 1K9MC 1VQNA 1DJ7B 1VQKA 5CQXA 2XDDA 1VQ9A 5DY9A 5CKFA 4QQ6A 3FJPA 3X26B 2RH2A 2Y4XA 1NE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  4C92 D;  1D3B A;  2EAY A;  4QVC A;  3RKY A;  5CAI A;  5GAN 3;  2E1H A;  2E64 A;  4PNO A;  4XQ3 A;  3JB9 D;  5GMK e;  5GMK i;  3V8J A;  5LJ5 j;  5GAO r;  5GMK m;  4M7A B;  3RUX A;  2DKG A;  1HK9 A;  1JRI A;  1BIA A;  4A53 A;  4M78 F;  3JCM b;  4C92 E;  5GMK j;  4C8Q C;  2DVE A;  3JCM c;  3JB9 J;  4N0A A;  2DXT A;  5I21 A;  5GAO q;  5GMK l;  3RKW A;  1Y96 A;  5GAM d;  4M77 F;  3FIF A;  1B34 A;  3HFO A;  2EJF A;  2EWN A;  2E10 A;  5GAN 5;  5GAM f;  3JCM d;  2DXU A;  3L2Z A;  4M75 D;  1WQW A;  4EMG A;  4M7D D;  2JN0 A;  3RKX A;  3JCM f;  1I81 A;  1D3B B;  3JB9 H;  3SWN C;  4M7A F;  1TH7 A;  2DTO A;  3EFR A;  4M75 C;  4XTY A;  4J6Y A;  3QSU A;  4PJO F;  2VXE A;  4C92 B;  4M7D C;  1M8V A;  4RCB A;  4OP0 A;  1M5Q 1;  1U1T A;  3RER A;  4RCC A;  5LJ5 d;  5LJ3 g;  3JCM W;  4JRI A;  4C92 A;  4NL2 A;  5LJ3 h;  2FB7 A;  4QVD A;  3RES A;  2VXF A;  1KQ1 A;  4M75 E;  2RM4 A;  4C92 G;  5LJ5 f;  5GAN d;  2RA2 A;  3FB9 A;  4C8Q D;  2YHT A;  4F7U A;  3JB9 G;  4J5Y A;  3V7R A;  2VC8 A;  4EMK C;  5GAN f;  3JCM J;  4C8Q A;  1JBM A;  1N9S A;  4EMH A;  4F7U G;  5LJ3 e;  2FYK A;  5GAN 4;  1Y96 B;  2CGH A;  1LOJ A;  4C8Q G;  4Y91 A;  1B34 B;  4JUV A;  3JCM Q;  4DQ2 A;  2HNI A;  4XTZ A;  4J6X A;  4F7U E;  1X01 A;  3BFM A;  1I5L A;  5GAN 8;  1KQ2 A;  4C92 F;  2ZGW A;  3AHU A;  1HXD A;  4M78 C;  4C8Q E;  5LJ3 j;  1LNX A;  2K57 A;  2RB6 A;  2E41 A;  1WPY A;  3SWN A;  5GAM g;  4NL3 A;  1LJO A;  4M75 A;  5GAM h;  2DZ9 A;  4M77 C;  4M7D A;  5GAO m;  4NOY A;  4M75 G;  4JLI A;  5GAO p;  4M7D G;  5GAN 2;  4PJO D;  2DTI A;  3M4G A;  4MMK A;  4XU1 A;  3BW1 A;  3GIB A;  4M7A C;  4F7U B;  3JB9 I;  5GAM e;  1U1S A;  4M7D E;  4C8Q B;  4HT9 A;  4EMK A;  5GAO l;  4PJO C;  3L1A A;  4X9D A;  5GAN 7;  2YLC A;  3RIR A;  4V2S A;  5GAM j;  5GAN g;  4M78 D;  4PJO E;  5GAN h;  3BDU A;  2YLB A;  1I8F A;  5LJ3 d;  3V8K A;  4M78 A;  3BY7 A;  1N9R A;  1I4K 1;  2RD1 A;  5GAN 6;  5LJ3 f;  3SWN B;  2Y90 A;  4M78 G;  3QUI A;  4M77 D;  4M75 B;  4XTW A;  3SB2 A;  3QO3 A;  3V7C A;  2E65 A;  3JB9 F;  4M7D B;  5GAN e;  4F7U F;  4M77 A;  4C8Q F;  4M78 E;  4C92 C;  3EFS A;  4JRK A;  4M77 G;  3VU3 C;  4M7A D;  3JCM g;  1H64 1;  3INZ A;  1BIB A;  1MGQ A;  4WF2 A;  3JCM h;  2DTH A;  1WNL A;  4PJO B;  1YCY A;  2DJZ A;  5GAN j;  4M7A A;  2QTX A;  1WQ7 A;  3V7S A;  3V8L A;  4M77 E;  4EMK B;  3JCM X;  3HFN A;  4M7A G;  2DZC A;  4J6W A;  4PJO A;  4XU2 A;  2EJ9 A;  4MML A;  4N0A C;  4PJO G;  3JCM e;  5GAO n;  5LJ5 g;  4XTX A;  3JCM P;  4XU0 A;  4A54 A;  5LJ5 h;  3HSB A;  3JCM V;  4HA8 A;  4M75 F;  4X9C A;  4M7A E;  2DEQ A;  4M7D F;  4XU3 A;  4M78 B;  4HT8 A;  3QHS A;  4XTV A;  5DY9 A;  4XTU A;  5GMK h;  3FJP A;  5LJ5 e;  3PGG A;  2EJG A;  4M77 B; 
#chains in the Genus database with same CATH topology
 1IGQ A;  1QP3 A;  1WXB A;  2COZ A;  2G3R A;  4RUG A;  3CC4 T;  2DIG A;  4E7K A;  1ZUK A;  1BU1 A;  5GMK j;  5I21 A;  2OX7 A;  2XIC A;  1GBR A;  5GMK l;  3RKW A;  2LQK A;  4JJN K;  4AFQ C;  1EIF A;  1Q7Y C;  3I56 T;  2ENM A;  4EMG A;  2DA9 A;  1I81 A;  3M4Y A;  3ZEH A;  4YTL A;  4OP0 A;  3RER A;  1RAC B;  3CCS A;  3HRU A;  4RCC A;  2Y4Y A;  2KQW A;  4QQD A;  5D6X A;  5LJ5 d;  1G8X A;  4D8D A;  5LJ5 f;  1YWP A;  3QXE B;  1MMD A;  5CO7 A;  1NYG A;  1IRE B;  3JCM J;  2MWO A;  1YWO A;  1G3W A;  2J6K A;  1RAG B;  2QG9 B;  3G4S T;  2VVK A;  2RQT A;  4A63 B;  4NS5 A;  2O4X A;  2HL3 A;  5M9O A;  1K8A C;  2E41 A;  3SWN A;  3CCR Q;  4ZN3 A;  1UGQ B;  4JPB W;  4ZGE B;  5GAN 2;  5ECA A;  2V26 A;  2AK5 A;  1YFN A;  4AG2 C;  3VS1 A;  2KY9 A;  1YP5 A;  2YLC A;  3Q1J A;  1M3B A;  3EG3 A;  1G5V A;  3CBO A;  1YJ9 T;  4TVR A;  4XTW A;  6AT1 B;  1UGR B;  4KH0 B;  4M75 B;  1VQ5 Q;  2A3L A;  3QO3 A;  4ELY C;  3J80 E;  1PD1 A;  5A0D A;  1UJY A;  4LXC A;  3GP8 A;  3JCM h;  4LDX A;  1MMG A;  1D0X A;  3MEV A;  5GJW B;  3VUB A;  1WQ7 A;  3VUZ A;  3C95 A;  2PU9 B;  3JCM e;  2FG0 A;  3EH1 A;  3H8Z A;  4HKE A;  4X9C A;  3OYC A;  4M78 B;  2ZPI B;  1D0Y A;  1JJ2 P;  2COW A;  2DRK A;  2FRW A;  4M77 B;  4C92 D;  1WJS A;  5CAI A;  1KD1 U;  2HSE B;  4M7A B;  2X3X D;  2PVO B;  1JRI A;  4M4Z A;  4CC4 B;  5CK9 A;  2DXT A;  2LCL A;  4X34 A;  3M0R A;  1RAA B;  2JN0 A;  3SFM A;  2O2O A;  3SWN C;  3PT9 A;  2CZ1 B;  1ARK A;  3RNJ A;  3TCJ A;  5D6W A;  4IIM A;  2JVV A;  1WDX A;  4KH1 B;  4C8Q G;  1W2B A;  3DKM A;  1FYN A;  1X01 A;  4F17 A;  5LJ3 j;  1S1N A;  3LLR A;  2E3H A;  2VV5 A;  5DLQ E;  2MMP A;  1Z9Z A;  4D6W A;  4Y28 E;  4EIK A;  2DNU A;  1M3A A;  3NMZ C;  4J9C A;  4CC2 A;  2YUN A;  2RQW A;  2CUB A;  3L1A A;  1QVG A;  3M0S A;  3E9G A;  1QKX A;  3CC7 Q;  5GAM j;  3LW5 E;  2AKL A;  2QEX A;  5GAN h;  3S3O A;  2NWM A;  4RKU E;  1YJN Q;  3V8K A;  1PC0 A;  3BY7 A;  3QPH A;  2D8J A;  5GAN e;  5KH6 A;  5HK0 A;  1VQ8 T;  1M8M A;  2WSF E;  4PFO A;  1YIJ A;  1WFW A;  2V1R A;  4C5H A;  2QTX A;  2C0O A;  2L0A A;  2P84 A;  2K3X A;  1QCO A;  2MI6 A;  4A4E A;  3HPW A;  2HKQ B;  4PJM A;  4MZP A;  2E6N A;  3EG2 A;  3E19 A;  2EQU A;  3PGG A;  4LDY A;  2CP2 A;  2EAY A;  4QVC A;  4AFS C;  2YWW A;  1VQL A;  5GMK i;  3RUX A;  2SRC A;  1VOM A;  2XMF A;  3CC2 Q;  2DER A;  1KD1 C;  2CUD A;  3CCV Q;  1KSW A;  3CME T;  5GAM d;  5KYX A;  2JJ9 A;  1TXQ A;  2DL7 A;  5GAM f;  3QWY A;  2RJD A;  3QII A;  2EQI A;  1MV3 A;  4C92 A;  1WA7 A;  2YUQ A;  1E7O A;  1PKS A;  4LDV A;  4C8Q D;  2OTL A;  3JB9 G;  3FJ5 A;  2PZ1 A;  5CVI A;  2O4X B;  4FL6 A;  3I56 A;  1YI2 A;  1K0S A;  1G3S A;  2RB6 A;  3L2V A;  1R8O B;  4ME7 A;  1YIT Q;  3NHN A;  1TWB A;  2DL3 A;  4RG8 A;  4BB7 A;  2VGN A;  3L2Q A;  2QDL A;  3MP1 A;  3PMT A;  9ATC B;  4AT1 B;  2RK1 A;  1TU0 B;  2KK4 A;  3N5B B;  1I8F A;  1QMC A;  3MEU A;  2QA4 T;  3P8H A;  2A0F B;  2BE9 B;  4PFP A;  2EYY A;  3EH2 A;  2ABL A;  4F7U F;  2M1H A;  2MIO A;  2CSI A;  2EW3 A;  3TRE A;  2NUT A;  2OTJ A;  2FHD A;  1XOV A;  5LJ5 h;  3HSB A;  4C0G A;  4HA8 A;  2F5T X;  4M7D F;  4HT8 A;  2O9V A;  8AT1 B;  4PJL A;  2DL8 A;  3OYF A;  4LDW A;  5LJ5 e;  2DXB A;  3G71 Q;  3DB4 A;  1M1K R;  3URG A;  4FYV B;  5I22 A;  2H3E B;  3THK A;  4A4H A;  4RTV A;  2KRO A;  3JV3 A;  5J39 A;  1BIA A;  2QTV A;  2JM8 A;  3R6N A;  3JCM c;  4OB2 B;  2VGM A;  2JTF A;  2PTK A;  4ORZ A;  2AIR B;  2EJF A;  5KE3 A;  1ZSZ B;  1VUB A;  2KXC A;  1OEB A;  4KGZ B;  2FL7 A;  1Q86 R;  3O5Z A;  4IUR A;  2DF6 A;  4DA4 A;  2VWF A;  4ZN1 A;  3CCS T;  2JNG A;  3GNF B;  5KYY B;  3FC3 A;  2RA2 A;  3FB9 A;  3CCQ A;  4B6M A;  3HP9 A;  4F14 A;  2FYK A;  4MZM A;  3CCU Q;  4OF1 A;  5GAN 8;  2XDP A;  1UG1 A;  2LQW A;  2K57 A;  3HTR A;  1PKT A;  3M0Q A;  1QVF P;  3GF5 A;  2E4H A;  1M30 A;  2OAW A;  1M1K U;  3PIP A;  4Z02 A;  3OMG A;  2WAC A;  1VQ7 A;  1UGP B;  3JB9 I;  3OYE A;  4JJB A;  1UEC A;  1SG5 A;  3M9Q A;  4HT9 A;  2KR3 A;  4JDS A;  2GQI A;  1BKB A;  1Q82 C;  1O9S A;  3VS0 A;  2DO3 A;  2YLB A;  2RQV A;  4ZGJ B;  1G3Y A;  5CKD A;  3I55 A;  4FW2 A;  4MDW A;  5HY6 A;  2VYT A;  1NJI U;  1U3O A;  2RHX A;  2F5K A;  1BIB A;  3LH0 A;  3CPW S;  5GAN j;  2YUO A;  2LCS A;  3V7S A;  1RAE B;  4AFU C;  1RLQ C;  4XU2 A;  1W6X A;  3HKS A;  2LVM A;  4XU0 A;  4K11 A;  3TVT A;  1QWE A;  2DFU A;  4QQ6 A;  3FJP A;  2E1H A;  3EFO B;  3OW2 S;  1VQ8 A;  1UGV A;  2XU8 A;  3CXC S;  5FWB A;  2LP5 A;  5EG2 A;  2R58 A;  1Y71 A;  3OYJ A;  1HSQ A;  1X6O A;  4OMP A;  1YJW A;  2FPF A;  2EQM A;  3KFV A;  2FZC B;  1VIF A;  2EWN A;  3EGU A;  1YHQ A;  2ECZ A;  2CS7 A;  4QVZ A;  4M7D D;  1O75 A;  2PUO B;  1D1B A;  2YT6 A;  4C92 B;  1VQO Q;  2FB7 A;  2L3P A;  2VXF A;  3I5S A;  4M75 E;  4AFZ C;  5GAN d;  2WSC E;  4A4G A;  3CBP A;  3SHW A;  5GAN f;  2KRM A;  3S3M A;  1KC8 R;  1KQS A;  1AHJ B;  1VQ6 A;  1B07 A;  4C5E A;  3NTH A;  3FLG A;  1B34 B;  3CME A;  1M1G A;  3HRS A;  1RAF B;  4J9F A;  2DET A;  3ASK A;  2DPP B;  3EGD A;  1OU9 A;  1IGU A;  2OAU A;  2K2V A;  3VS4 A;  3T9N A;  3OYN A;  3OQ5 A;  1IHV A;  2A28 A;  2QQA A;  3CCM Q;  2DAQ A;  4MMK A;  4XU1 A;  3CCJ Q;  1Q81 U;  1X69 A;  1U1S A;  1FXX A;  2DBM A;  1X2K A;  2JTE A;  4JZ4 A;  3M57 A;  4E47 A;  3UF4 A;  2QEX T;  1NG2 A;  3CPF A;  1I4K 1;  2RD1 A;  1VQ4 Q;  2J6F A;  4II1 A;  3RMQ A;  1X6G A;  1VQK Q;  4PK4 A;  4E6R A;  1VQM Q;  1JEG A;  2DYI A;  2NUT B;  1WNL A;  2A7Y A;  1BCM A;  3F70 A;  1B7T A;  1M2V A;  1NJI C;  2DJQ A;  3G6E A;  1KJW A;  4PL6 A;  3NTK A;  1KC8 U;  1WX6 A;  2FZG B;  3CBM A;  1U8R A;  1N8R C;  4C0D C;  1TOV A;  3M0P A;  1VYV A;  2D8H A;  2DXC A;  2PUK B;  1KQS P;  3ULR B;  2HAX A;  3CCE Q;  1UE9 A;  4DOW A;  5IHI A;  1NYF A;  1K9M R;  2E70 A;  1QCF A;  1UGS B;  2XI9 A;  2ROL A;  1VQL T;  5LJ5 j;  1Y7X A;  2LJ0 A;  2K7A A;  2DRM A;  1HK9 A;  3DLL A;  2FPE A;  4AG1 C;  2QQR A;  2CH4 A;  4BE1 A;  1T0H A;  5CKH A;  5CR2 A;  2IPO B;  3VV0 A;  4OB1 B;  2L3Q A;  2LRQ A;  1X27 A;  1U06 A;  2DXU A;  4OGE A;  2KRS A;  3RKX A;  2MCN A;  3E2U A;  2RNA A;  1LCK A;  2EVR A;  3L2R A;  1WJQ A;  2ZPH B;  4C92 G;  3EGX A;  3G1J A;  4F7U A;  2OTL T;  2LQN A;  4PLI A;  4QQG A;  2GBQ A;  4ZGD B;  4LD9 K;  1VIE A;  3OYG A;  3GLX A;  3JCM Q;  1IO6 A;  2ZPF B;  4F7U E;  3TSW A;  2DD4 A;  2A08 A;  2K9G A;  4KRT A;  1MNE A;  4LDU A;  1I1J A;  4QT7 A;  1YI2 T;  1G2B A;  3EHR A;  1X75 C;  2DZ9 A;  4M7D A;  1IHW A;  1K9M U;  2CP7 A;  2FVU A;  1FMK A;  2DL5 A;  3NTI A;  4M7D E;  4C8Q B;  3CMA Q;  3VS3 A;  3OYL A;  1NEB A;  1JJ2 A;  3RBB B;  2DE0 X;  5D6Y A;  3M54 A;  3H0F A;  1VQ9 T;  2CSQ A;  2OJ2 A;  1K76 A;  2RI2 A;  3QG1 A;  2GCX A;  2KGT A;  3MP6 A;  4N4H A;  1RI0 A;  3V7C A;  3EG9 A;  3OMC A;  2JT4 A;  1OYX A;  3CCV T;  5LL6 S;  3EFS A;  4JRK A;  2DBK A;  3EAE A;  4BDZ A;  1VYU A;  3A1P A;  3RR6 A;  2BZX A;  1KFZ A;  4J6W A;  1NZ9 A;  4MML A;  2OTJ T;  4XTX A;  2DEQ A;  4IUU A;  4XU3 A;  4XTV A;  4BI3 A;  4CRI A;  1S72 T;  2EJG A;  1M1F A;  2LX7 A;  1VQN Q;  2RK2 A;  3UDC A;  1PRL C;  4X1V A;  2AZV A;  2CDT A;  2P4R A;  2C06 A;  5GAO q;  2HZY A;  5CQY A;  1QWF A;  5KYW B;  1G3T A;  2RO0 A;  1OX8 A;  1YCS B;  1WQW A;  1RAI B;  2D0N A;  4XTY A;  1M8V A;  2GQV A;  4M7D C;  2LNV A;  2DIL A;  4JRI A;  1W2B S;  4XK8 E;  5FLX E;  3RES A;  4LN2 A;  1VQP Q;  2O9S A;  1TS9 A;  4OMM A;  5FU6 B;  3GBQ A;  3CCQ T;  1OX9 A;  1JBM A;  5D7U A;  3CD6 Q;  3CCR A;  1N27 A;  3EG0 A;  4RG2 A;  1IB8 A;  4QKU A;  1KQ2 A;  3AHU A;  2ZGW A;  3PTA A;  4OMQ A;  1TG0 A;  1WXT A;  5J3B A;  5KCH A;  1QVG S;  1JO8 A;  4B9W A;  4C0F A;  1K73 R;  1GXI E;  3X20 B;  5IN1 A;  2DTI A;  4BDY A;  1VQ7 T;  4EMK A;  5IXF A;  1ZA2 B;  2LTO A;  3G71 T;  1VQ5 A;  1P92 A;  3OY9 A;  4PJO E;  2X3W D;  1WZO A;  4DEX A;  2DEU A;  2O88 A;  2DLP A;  2P0K A;  1PM3 A;  3I55 T;  1MND A;  2LX9 A;  4IUT A;  1ABO A;  1T0J A;  1UDL A;  1SHG A;  3LYI A;  4L59 A;  2GFU A;  2HQE A;  2DM1 A;  4PLL A;  2NUZ A;  4LD6 A;  1QLY A;  2K4Y A;  1WGS A;  2NLU A;  4M75 F;  1QKW A;  2DMO A;  3QHS A;  1BI1 A;  2C0I A;  2JMC A;  1QVP A;  2CKK A;  3QYH B;  2QI2 A;  1U5S A;  2FO0 A;  4EDU A;  1F1B B;  1M90 R;  2EFI A;  1K73 U;  2HD0 A;  2QGF B;  4M78 F;  2QQ9 A;  5I11 A;  2DD5 A;  2CP0 A;  1YJW T;  4M77 F;  3FIF A;  3CC4 Q;  1YHQ T;  3OYA A;  3D7S B;  4ELZ C;  2DX1 A;  4M7A F;  4MDX A;  3VS5 A;  4HCZ A;  1OV3 A;  3H0H A;  3QSU A;  5CKB A;  5FRM A;  1U1T A;  1MHN A;  4ESR A;  1ZSG A;  1CKA A;  1M4Z A;  2GTJ A;  4PJN A;  1HD3 A;  4EMK C;  2F2W A;  3J81 E;  2CGH A;  4D8K A;  1VQ6 T;  1OUL A;  1SKU B;  3SD4 A;  5FRN A;  1LNX A;  4ANJ A;  1OQK A;  1PRM C;  1QCN A;  2HQX A;  3G4S Q;  1SSF A;  2AKK A;  3CC7 A;  2FEI A;  3M58 A;  3O8V A;  7AT1 B;  1CKB A;  3M4G A;  1YJN A;  2ATC B;  3HL8 A;  1Y0M A;  5KYU A;  2E12 A;  4LE9 A;  3OA6 A;  3BE3 A;  2EQJ A;  4RMO A;  1YBY A;  3SWN B;  2Y90 A;  3EG1 A;  1VA7 A;  1JXM A;  2ROT A;  2MWP A;  4C0Z A;  2YRD A;  1YJ9 Q;  1ACM B;  2RJF A;  1IZ6 A;  3MKD A;  3M56 A;  4DBQ A;  3A8O B;  4E7S A;  2LJ1 A;  2M0Y A;  3G6E T;  1MV0 B;  1VQ9 A;  2YUP A;  3X26 B;  1D3B A;  4GLM A;  3CCV A;  1BI2 A;  4LNP A;  3QDF A;  3V8J A;  1HJD A;  4JLG A;  1TTH B;  3EHQ A;  4A4K A;  1XNI A;  2FRY A;  5HKC A;  1UFF A;  2FZK B;  1Y96 A;  3HFO A;  3CCM T;  1QVF A;  2D6F A;  4M75 D;  1T3S A;  1S72 A;  1E6G A;  3ZL7 C;  1IRX A;  1A0N B;  4ZNX A;  4JS4 A;  3MHX A;  2BE7 D;  2NUP A;  1ABQ A;  1T3L A;  5LJ3 g;  2F2X A;  4NL2 A;  1KQ1 A;  4J83 A;  3OBW A;  2P0P A;  1JU5 C;  1YNZ A;  3KUF A;  3H9N A;  1N9S A;  4EMH A;  4F7U G;  1ZBX A;  1YIT A;  4JJD A;  3A8G B;  2PVG B;  1TSF A;  1I5L A;  1ZHI A;  2RPN A;  2AHJ B;  3UWN A;  2XID A;  3M53 A;  1WPY A;  1KG1 A;  3CCL T;  5GAM g;  4FYY B;  3NPF A;  4NOY A;  1AT1 B;  5EC7 A;  4M7D G;  1AZE A;  4RTX A;  3JRZ A;  5HCK A;  2ZPB B;  1AOJ A;  1OZ3 A;  4IIO A;  3LX7 A;  4Z8A A;  3CCE T;  3RIR A;  1C0M A;  1ZX6 A;  2EYQ A;  5A0L A;  5IXB A;  4V2S A;  2V8K A;  2ED1 A;  1W70 A;  5IH2 A;  4E7Z A;  2ZCF B;  2MYS A;  1NM7 A;  3REA B;  3A5Z B;  2DTH A;  2DJZ A;  2H8H A;  1RAH B;  2V1Q A;  1KHI A;  3G71 A;  4KT0 E;  1NBE B;  4PJJ A;  2LC4 A;  4R55 A;  3H41 A;  1NLP C;  5AT1 B;  4ZTF A;  1M2O A;  2LT1 A;  2M9U A;  2RI5 A;  4OVA A;  1QP2 A;  3VKI A;  1OPL A;  1Q86 U;  2K3Y A;  2VB6 A;  2KVQ G;  3KBG A;  2QK0 A;  1I0C A;  2CH4 W;  2DYB A;  2AT1 B;  2HCK A;  4FYX B;  2K2M A;  2J6O A;  1UEB A;  1XTD A;  2MAM A;  1WLP B;  4OB0 B;  5FRO A;  4J7F A;  5FU7 C;  3SDZ A;  2COY A;  3WXM B;  2K5I A;  3MPU B;  3EFR A;  3CME Q;  4PJO F;  2IVW A;  3CCU A;  1I5O B;  1PWT A;  1Q7Y R;  2R57 A;  2RM4 A;  3NGP A;  2I0N A;  3U23 A;  1JQQ A;  1AWO A;  3CCR T;  5KYX B;  3M59 A;  4DQ2 A;  4WTO B;  3H0I A;  1BB9 A;  3S6W A;  1PSF A;  4CC3 A;  4DBH A;  2QQS A;  3UA7 A;  4QW2 A;  1SEM A;  4M75 A;  5AYF A;  2CT4 A;  3VRZ A;  2RHI A;  4BI8 B;  1AWX A;  2QYZ A;  3CEY A;  1FWZ A;  1D09 B;  1K8A R;  2KNB B;  3GIB A;  2X4J A;  4O6J A;  1V76 A;  2XDB A;  1VQ5 T;  4Z89 A;  4EPC A;  3CPW A;  1V29 B;  2KSS A;  2LMJ A;  2L89 A;  2LCC A;  4M78 A;  1N9R A;  4OGC A;  2F1L A;  3R6O A;  1WHG A;  1ZBJ A;  4BE2 A;  2JXB A;  4M77 A;  1C6V X;  2K5L A;  2E6Z A;  4M78 E;  2QA4 Q;  4HVW A;  3JCM g;  2HMA A;  2XHC A;  3C4S A;  3RMS A;  1ZA1 B;  1YCY A;  3OYD A;  4M7A A;  2WSE E;  4M77 E;  3PMI A;  2EGE A;  3HFN A;  3OBY A;  2Z0W A;  1M1K C;  3A8L B;  4M7A E;  3CXC A;  1KHC A;  3LGL A;  4OMF B;  3VRY A;  2RI3 A;  2VKN A;  5GJV B;  2I2L A;  2JTM A;  3H6Z A;  1H3Z A;  3CD6 T;  1OPK A;  2EYZ A;  4PNO A;  1EFN A;  2X51 A;  2SEM A;  2RHZ A;  2VAS A;  5IT9 E;  1SHF A;  5KE2 A;  3OYB A;  1Q86 C;  3PIO A;  3REB B;  4J9G A;  2JM9 A;  1GFD A;  1VQO A;  2LNH B;  3L2Z A;  1TH7 A;  4M75 C;  4FU6 A;  3CPW P;  3VYH B;  4O5V A;  4KBM B;  5L8R E;  2KAF A;  2X4X A;  2L3R A;  1WIE A;  1X6B A;  4BI4 A;  2QDY B;  2KXD A;  4R56 A;  4JZ3 A;  3CCS Q;  4GLK A;  2CZ7 B;  3MJX A;  4J6X A;  4XTZ A;  3CCM A;  4C92 F;  4M78 C;  3OW2 P;  3CCJ A;  2JW4 A;  4CI0 C;  4RTU A;  2MF2 A;  4OML A;  1LJO A;  1JXO A;  3CXC P;  4M77 C;  1TUG B;  1JJ2 S;  4JRQ A;  3VJP A;  4JLI A;  1AEY A;  4Q5W A;  3CC7 T;  4PJO D;  4M7A C;  3HRT A;  2ED0 A;  1YJN T;  2MPX C;  3QBY A;  2GTO A;  2XD0 A;  1KK7 A;  3GOX A;  5GAN g;  1VQM A;  2LDM A;  2ZPE B;  2H3J A;  1GL5 A;  1M3C A;  5GAN 6;  2AZS A;  3CCL A;  2E5Q A;  1RUW A;  2R5A A;  2KT1 A;  3OYK A;  4J9B A;  3JCM X;  2DZC A;  3UT1 A;  3CCE A;  3X25 B;  3M0T A;  4E7L A;  5C0M A;  2JOY A;  2QAZ A;  1UHF A;  1Q81 C;  1SRL A;  2F2V A;  4XTU A;  1RI9 A;  1OU8 A;  3CC2 T;  3ME9 A;  3RKY A;  3QDR B;  2BKD N;  2GFA A;  3A98 A;  2X9H A;  2CZ0 B;  2DKG A;  1TUC A;  2JUF A;  4N0A A;  1J3T A;  3VS6 A;  1MUZ A;  1NPP A;  3J7A F;  3WVD B;  2YDL A;  4KUD K;  1R77 A;  1GCQ A;  1KD1 R;  1B3Q A;  1KC8 C;  3S3N A;  3MEA A;  2VXE A;  4OMO A;  1AD5 A;  4KUI A;  2M16 A;  3L2U A;  4J8O A;  1UTI A;  2O01 E;  1EZZ B;  1YN8 A;  2QXF A;  4C0D B;  1LOJ A;  1YIT T;  3A8M B;  2K6D A;  2HNI A;  4MZT A;  2D0Q B;  4HXJ A;  3CMA A;  4NL3 A;  2K5F A;  4FSS A;  2JS0 A;  4L6V 5;  2V8I A;  4FIB A;  3GNG A;  1WHH A;  1XJW B;  1UJ0 A;  1GBQ A;  5I2M A;  2CRE A;  4GBQ A;  1PD0 A;  3BDU A;  4IUP A;  3EGD B;  2MOX A;  2B86 A;  2KYB A;  1M9S A;  1WYX A;  2QAS A;  2X4W A;  2E65 A;  2K3B A;  1PHT A;  2CP5 A;  3VS2 A;  1K1Z A;  4C5G A;  4C8Q F;  2QEX Q;  2KI7 A;  2CZ6 B;  1LVK A;  1ZLM A;  4WF2 A;  5CCA A;  2YXY A;  4PFZ A;  3QJ6 A;  4PJO A;  2EJ9 A;  4N0A C;  5GAO n;  3JCM P;  5LJ5 g;  2GNC A;  2IIM A;  4A54 A;  1H3H A;  5HK3 A;  1K9M C;  1VQN A;  1YIJ Q;  2XDD A;  1UUE A;  5DY9 A;  5CKF A;  2YSQ A;  1GCQ C;  1ZSZ A;  2RH2 A;  1RLP C;  2Y4X A;  1NE8 A;  4OMN A;  5GAN 3;  2J06 A;  3OYY A;  4XQ3 A;  1D1A A;  3L2W A;  3BDL A;  5IHN A;  1RAB B;  5KYY A;  1OI1 A;  1M2V B;  5CKE A;  2B8A A;  3FEO A;  2DVE A;  2YRV A;  4AMC A;  1N5Z A;  1VQL Q;  4Z88 A;  1GFC A;  1QW1 A;  2BIV A;  1VQP A;  3ER0 A;  5CIU A;  2DTO A;  3ZFJ A;  4J6Y A;  3CD6 A;  4RCB A;  4DBF A;  3CCU T;  2X4Y A;  2X35 A;  2NYS A;  4PKC C;  5GAN 4;  1V1C A;  2PVD B;  1MMN A;  1PNJ A;  4Y91 A;  4CC7 A;  2E5K A;  3BFM A;  2KDS A;  3PE0 A;  2OTL Q;  4XAX B;  1C1A A;  3MEW A;  4ZTJ A;  4DOV A;  5GAO m;  1BK2 A;  4M75 G;  2W0Z A;  3IQL A;  5GAO p;  3I56 Q;  3M5A A;  1YI2 Q;  3EGX B;  4F7U B;  3C0C A;  5FWC A;  4PJO C;  3KXT A;  4X9D A;  3OB9 A;  1WHJ A;  3PVL A;  3P8D A;  3TSZ A;  2HEQ A;  4RTZ A;  1EX4 A;  5LJ3 d;  3OYI A;  1ZSZ C;  5LJ3 f;  4M78 G;  4BD3 A;  3JB9 F;  3HHT B;  3SB2 A;  1W2B P;  2A36 A;  4M7D B;  1Q82 R;  2M51 A;  4HVV A;  1VQ9 Q;  4M77 G;  3EFO A;  2LQ8 A;  4E2F B;  3QWX X;  4J9E A;  1M90 U;  3V8L A;  4RTW A;  1FX7 A;  2EYX A;  3OS1 A;  4M7A G;  3A8H B;  2K79 A;  2KT8 A;  4BE0 A;  2RMO A;  3MO8 A;  4FT2 A;  1SPK A;  1QVG P;  2OTJ Q;  3EG9 B;  2KEA A;  3FDR A;  2W10 A;  1MMA A;  3G7Z A;  1JB0 E;  4GY5 A;  2E64 A;  1ZQ1 A;  3DB3 A;  5GAO r;  3CC4 A;  1S72 Q;  1QVF S;  2O31 A;  4C92 E;  1W4S A;  2QQB A;  2D1X A;  3C12 A;  2L8D A;  1KIK A;  2EPD A;  3MP8 A;  1K0X A;  1PSE A;  2BUD A;  2BZY A;  4J7I A;  1AZG B;  1B34 A;  2HBP A;  1VQO T;  3ZBD A;  4P5N A;  3CC2 A;  2XK0 A;  3DLM A;  2CT3 A;  1FMW A;  1Q82 U;  5DM7 R;  2BTT A;  3M55 A;  2JMA A;  1H8K A;  2VC8 A;  2L5Q A;  2P4T A;  1RL2 A;  4LUD A;  3G4S A;  2DL4 A;  1K73 C;  1BI3 A;  2ZZD A;  3PFS A;  1XQH A;  5A0G A;  1HXD A;  3CCQ Q;  1SRM A;  1FMV A;  4F16 A;  3CCJ T;  2DVJ A;  2KBT A;  4RTY A;  4FYW B;  1AWW A;  3OYH A;  5L23 A;  4J9H A;  3VS7 A;  1NPR A;  4KUL A;  2J7I A;  3E9F A;  2CP6 A;  5GAO l;  4JRP A;  3M0U A;  1WHL A;  3QKJ A;  1VQ4 T;  4B9X A;  1VQK T;  4M78 D;  1VQ7 Q;  4E7I A;  3GPL A;  1YJ9 A;  1VQM T;  2RQU A;  1G83 A;  2E3I A;  2HBW A;  3OS5 A;  3QUI A;  2F69 A;  4M77 D;  1BYM A;  4IUQ A;  2V8J A;  4C92 C;  4M7A D;  1R0B G;  1H64 1;  4BY6 C;  3INZ A;  1MGQ A;  3OSS C;  1BCO A;  4PJO B;  2HL5 C;  4EMK B;  4IKF A;  3TU4 K;  3I55 Q;  1R0C B;  4DEY A;  2RF0 A;  4E7J A;  8ATC B;  1NEG A;  1ZUU A;  3JCM V;  2J05 A;  4IUV A;  4BAC A;  2HQH A;  1WHK A;  1BBZ A;  3QYG B;  2A37 A;  4R0K A;  4E7H A;  1M90 C;  2XG8 D;  3JSC A;  4FT4 A;  3CQT A;  4VUB A;  5GMK h;  1GCP A;  4L5G A;  3I9Q A;  1NJI R;  1ZUY A;  5KYN A;  1N8R R;  1QQJ A;  1K9A A;  3JB9 D;  2L3S A;  5J26 A;  3TQ7 P;  5GMK e;  3PNW C;  1CSK A;  4UC4 A;  1UHC A;  1I07 A;  3JCM b;  1OZ2 A;  1N6A A;  4C5I A;  1SF9 A;  2EGA A;  3LWH A;  1VQ8 Q;  4A4F A;  5GAN 5;  4J9D A;  1AVZ C;  3JCM d;  5FW9 A;  1M27 C;  3JCM f;  1WXU A;  3X28 B;  5IAY A;  2ZAE A;  2P0Q A;  2HSP A;  2YRC A;  1YJW Q;  1M5Q 1;  3UPU A;  4WCI A;  1YHQ Q;  3MET A;  1WJR A;  5C6S A;  1HYO A;  1NLO C;  3OYM A;  2FPD A;  2YHT A;  2EQK A;  4RTT A;  4ATO A;  4J5Y A;  4C8Q A;  2D9T A;  2EGC A;  1WHM A;  2G6F X;  5A2Q E;  2LJ3 A;  4BUG A;  4JS5 A;  2EKO A;  4C8Q E;  2EYW A;  2OI3 A;  1VQ6 Q;  3CMA T;  2M0O A;  1E6H A;  1KQS S;  3RDV A;  1N8R U;  1D0Z A;  3LGF A;  2EBP A;  4N4I A;  3BW1 A;  1UB4 A;  1W1F A;  5GAN 7;  3C94 A;  3NFC A;  1TUD A;  2KE9 A;  1BI0 A;  2PNI A;  3OS2 A;  2KMT A;  3I5R A;  2BZ8 A;  2JS2 A;  3UA6 A;  2RJE A;  2RN8 A;  2C0T A;  3VU3 C;  1Q81 R;  4KGX B;  2LZ6 B;  1OOT A;  2DK3 A;  2R5M A;  5KYU B;  3MCA B;  4FSX A;  4PJO G;  1VQN T;  3JAM E;  5I2S A;  5KYW A;  3G6E Q;  3QZ5 B;  4J9I A;  4F04 B;  2ESW A;  2RHU A;  2DIQ A;  2ZPG B;  4BY6 B;  2RQR A;  2M02 A;  3LH5 A;  5GMK m;  3X24 B;  4HCC A;  1Q7Y U;  2XKO C;  4A53 A;  5KCO A;  4HVU A;  4C8Q C;  4HCB A;  3JB9 J;  3OW2 A;  3PVQ A;  3QJY A;  1GRI A;  3I35 A;  1H92 A;  4JJC A;  2CP3 A;  3QZ9 B;  2E10 A;  2KRN A;  3WVE B;  3OS0 A;  1VQP T;  2VUB A;  1D3B B;  3JB9 H;  2QGG A;  3E1S A;  1WI7 A;  3L42 A;  4FM4 B;  1X2Q A;  1RAD B;  1K4U S;  3JCM W;  4OB3 B;  5LJ3 h;  4KGV B;  4FW1 A;  4QVD A;  1X43 A;  4HCK A;  4N4G A;  3V7R A;  2MK5 A;  1SSH A;  1K8A U;  3TEE A;  5DLO A;  5LJ3 e;  1Y96 B;  4JUV A;  2EKH A;  2PQW A;  3OSV A;  3SEM A;  1Q95 G;  2GGR A;  1Y57 A;  2KYM A;  3FRN A;  1PCX A;  1IXD A;  2JZ2 A;  2RJC A;  5GAM h;  2NUP B;  3LWI A;  5IHK A;  1YIJ T;  5GAM e;  3CCL Q;  4FCY A;  1Z9Q A;  1D1C A;  3AT1 B;  2LT4 A;  4LUE A;  2QA4 A;  1AWJ A;  1Y07 A;  5FU7 B;  4DBR A;  3VYG A;  4Y92 A;  2CYZ B;  3UAT A;  3P8B B;  1LPL A;  2GF7 A;  2HKN A;  2L2P A;  2HDA A;  5FU6 C;  2RHY A;  2EIF A;  2IG0 A;  1VQ4 A;  1PG5 B;  1DJ7 B;  1VQK A;  5CQX A;  1VYT A; 
#chains in the Genus database with same CATH homology
 1D3B A;  1QP3 A;  5GAN 3;  3OYY A;  2E1H A;  4XQ3 A;  1BI2 A;  3CCV A;  3OW2 S;  3L2W A;  3BDL A;  3V8J A;  1VQ8 A;  2G3R A;  4JLG A;  2XU8 A;  3CXC S;  3CC4 T;  1OI1 A;  2DIG A;  5CKE A;  5EG2 A;  2R58 A;  4E7K A;  4A4K A;  2B8A A;  3FEO A;  1XNI A;  2DVE A;  5GMK j;  5HKC A;  2YRV A;  5I21 A;  1Y71 A;  2XIC A;  3OYJ A;  1X6O A;  5GMK l;  3RKW A;  1YJW A;  1Y96 A;  2EQM A;  2LQK A;  4JJN K;  3HFO A;  1EIF A;  1VIF A;  2EWN A;  3CCM T;  1YHQ A;  1Q7Y C;  3I56 T;  1QVF A;  2D6F A;  1QW1 A;  2BIV A;  4M75 D;  2CS7 A;  4EMG A;  3ER0 A;  4QVZ A;  1VQP A;  1S72 A;  4M7D D;  1I81 A;  1O75 A;  2PUO B;  5CIU A;  2DTO A;  3M4Y A;  3ZEH A;  3ZFJ A;  4J6Y A;  4JS4 A;  3CD6 A;  4C92 B;  4YTL A;  4RCB A;  3MHX A;  4OP0 A;  3RER A;  3CCS A;  3HRU A;  4RCC A;  2Y4Y A;  2KQW A;  4QQD A;  5D6X A;  4NL2 A;  5LJ3 g;  5LJ5 d;  2FB7 A;  3CCU T;  2X4Y A;  2VXF A;  1KQ1 A;  4M75 E;  2X35 A;  5LJ5 f;  4J83 A;  5GAN d;  3QXE B;  3OBW A;  2WSC E;  5CO7 A;  2P0P A;  4A4G A;  1YJ9 A;  3CBP A;  1IRE B;  5GAN f;  3KUF A;  2MWO A;  4PKC C;  3JCM J;  4F7U G;  1AHJ B;  1G3W A;  1N9S A;  4EMH A;  5GAN 4;  1KQS A;  1ZBX A;  4C5E A;  3NTH A;  2PVD B;  1YIT A;  3FLG A;  4Y91 A;  1B34 B;  3A8G B;  3CME A;  1M1G A;  2PVG B;  3G4S T;  3BFM A;  1I5L A;  1ZHI A;  2KDS A;  3HRS A;  4NS5 A;  2O4X A;  5M9O A;  1K8A C;  3ASK A;  2DPP B;  4XAX B;  2AHJ B;  3UWN A;  2XID A;  2E41 A;  2OAU A;  1WPY A;  2K2V A;  3M53 A;  3SWN A;  3CCL T;  1KG1 A;  3T9N A;  5GAM g;  3MEW A;  4ZN3 A;  4ZTJ A;  4DOV A;  1UGQ B;  3OYN A;  3OQ5 A;  4NOY A;  5GAO m;  4M75 G;  2QQA A;  5GAO p;  4M7D G;  4ZGE B;  2DAQ A;  5GAN 2;  3M5A A;  3JRZ A;  4MMK A;  4XU1 A;  2ZPB B;  4F7U B;  1Q81 U;  1OZ3 A;  1U1S A;  4PJO C;  3KXT A;  3LX7 A;  3CCE T;  4X9D A;  1FXX A;  3OB9 A;  2KY9 A;  3Q1J A;  2YLC A;  3RIR A;  3P8D A;  2EYQ A;  5A0L A;  3M57 A;  4V2S A;  1G5V A;  4E47 A;  2V8K A;  3CBO A;  2QEX T;  5LJ3 d;  1YJ9 T;  3CPF A;  1I4K 1;  2RD1 A;  4TVR A;  3OYI A;  5LJ3 f;  4M78 G;  4XTW A;  4BD3 A;  1UGR B;  3HHT B;  4M75 B;  3SB2 A;  2A3L A;  3QO3 A;  2ZCF B;  4ELY C;  3JB9 F;  4M7D B;  4II1 A;  3RMQ A;  3J80 E;  5A0D A;  4M77 G;  3GP8 A;  2LQ8 A;  3JCM h;  4LDX A;  3A5Z B;  2DTH A;  3MEV A;  3VUB A;  1WNL A;  2A7Y A;  1M90 U;  2DJZ A;  3F70 A;  1WQ7 A;  3VUZ A;  3V8L A;  1FX7 A;  3OS1 A;  4M7A G;  3A8H B;  1KHI A;  3C95 A;  2PU9 B;  4KT0 E;  3G6E A;  3G71 A;  3JCM e;  4PL6 A;  1KC8 U;  3NTK A;  2LC4 A;  3CBM A;  1U8R A;  1N8R C;  3H8Z A;  4C0D C;  4BE0 A;  4HKE A;  4X9C A;  4R55 A;  3OYC A;  2DXC A;  3MO8 A;  4M78 B;  4ZTF A;  4FT2 A;  2ZPI B;  2LT1 A;  2PUK B;  3S3M A;  2M9U A;  2HAX A;  2RI5 A;  4OVA A;  1QP2 A;  3FDR A;  4DOW A;  4M77 B;  4C92 D;  1WJS A;  5CAI A;  3VKI A;  1NJI C;  3G7Z A;  1Q86 U;  1KD1 U;  1JB0 E;  2E70 A;  2E64 A;  1ZQ1 A;  1UGS B;  2K3Y A;  3DB3 A;  2XI9 A;  4GY5 A;  1VQL T;  5LJ5 j;  5GAO r;  2KVQ G;  1Y7X A;  4M7A B;  3CC4 A;  3KBG A;  1QVF S;  2PVO B;  1HK9 A;  3DLL A;  1JRI A;  4C92 E;  2QQR A;  4BE1 A;  1W4S A;  2QQB A;  3C12 A;  5CK9 A;  2DXT A;  2L8D A;  2LCL A;  3MP8 A;  5CKH A;  5CR2 A;  1PSE A;  2BUD A;  3VV0 A;  4J7I A;  4OB1 B;  1UEB A;  2LRQ A;  1B34 A;  1XTD A;  4X34 A;  2HBP A;  2MAM A;  4OB0 B;  1VQO T;  3ZBD A;  2DXU A;  4OGE A;  5FRO A;  4J7F A;  2JN0 A;  3RKX A;  5FU7 C;  3SDZ A;  3SFM A;  3WXM B;  4P5N A;  2K5I A;  3SWN C;  3PT9 A;  3CC2 A;  2XK0 A;  3EFR A;  1VQK T;  4PJO F;  2IVW A;  3L2R A;  2CZ1 B;  3DLM A;  1Q82 U;  3CCU A;  1WJQ A;  2R57 A;  2ZPH B;  2RM4 A;  4C92 G;  3TCJ A;  5D6W A;  3M55 A;  5DM7 R;  2JVV A;  4F7U A;  2OTL T;  2VC8 A;  4PLI A;  2L5Q A;  4QQG A;  2P4T A;  4ZGD B;  4LD9 K;  1RL2 A;  1VIE A;  3CCR T;  4C8Q G;  3OYG A;  3M59 A;  3GLX A;  3JCM Q;  3DKM A;  4DQ2 A;  3G4S A;  1W2B A;  2ZPF B;  3S6W A;  1PSF A;  1X01 A;  1BI3 A;  2DD4 A;  2ZZD A;  4F7U E;  3PFS A;  1K73 C;  1XQH A;  5A0G A;  1HXD A;  4LDU A;  2QQS A;  5LJ3 j;  1YI2 T;  3LLR A;  1X75 C;  3CCJ T;  4QW2 A;  2VV5 A;  5DLQ E;  2MMP A;  4M75 A;  5AYF A;  2DZ9 A;  4M7D A;  4D6W A;  2RHI A;  4BI8 B;  4Y28 E;  3OYH A;  1K9M U;  3CEY A;  1FWZ A;  1NPR A;  2FVU A;  4KUL A;  3GIB A;  3E9F A;  3NTI A;  4M7D E;  4C8Q B;  2X4J A;  5GAO l;  4O6J A;  3L1A A;  4JRP A;  3OYL A;  2XDB A;  1JJ2 A;  1QVG A;  3QKJ A;  3E9G A;  1VQ4 T;  4B9X A;  1VQ5 T;  4EPC A;  3LW5 E;  5GAM j;  4M78 D;  2QEX A;  3CPW A;  1V29 B;  5GAN h;  2KSS A;  5D6Y A;  3M54 A;  2L89 A;  4RKU E;  3GPL A;  2LCC A;  4E7I A;  3S3O A;  1VQM T;  3V8K A;  1VQ9 T;  4M78 A;  3BY7 A;  1N9R A;  2RI2 A;  3QG1 A;  2GCX A;  3OS5 A;  3R6O A;  4OGC A;  3QUI A;  2F69 A;  3QPH A;  4M77 D;  4BE2 A;  3MP6 A;  4N4H A;  3V7C A;  1RI0 A;  1BYM A;  4IUQ A;  5GAN e;  2V8J A;  4M77 A;  3OMC A;  1OYX A;  3CCV T;  2K5L A;  2E6Z A;  4M78 E;  5LL6 S;  3EFS A;  4JRK A;  4C92 C;  5KH6 A;  4M7A D;  3EAE A;  1H64 1;  3JCM g;  4BY6 C;  3INZ A;  1MGQ A;  2WSF E;  5HK0 A;  3OSS C;  2XHC A;  3C4S A;  4BDZ A;  3RMS A;  1YIJ A;  4PJO B;  4C5H A;  1YCY A;  3OYD A;  4M7A A;  2QTX A;  2WSE E;  4EMK B;  4M77 E;  4IKF A;  3TU4 K;  3PMI A;  2K3X A;  3HFN A;  4J6W A;  1NZ9 A;  4MML A;  2OTJ T;  3OBY A;  4XTX A;  2MI6 A;  4E7J A;  3A8L B;  1M1K C;  4A4E A;  3HPW A;  3JCM V;  4M7A E;  4IUV A;  4BAC A;  2DEQ A;  1KHC A;  3QYG B;  4IUU A;  4XU3 A;  3CXC A;  2XG8 D;  4E7H A;  3LGL A;  3JSC A;  4FT4 A;  4MZP A;  4OMF B;  4XTV A;  4BI3 A;  2E6N A;  2RI3 A;  4VUB A;  4CRI A;  5GMK h;  1S72 T;  3E19 A;  2EQU A;  3PGG A;  4L5G A;  4LDY A;  2EJG A;  2I2L A;  2JTM A;  3H6Z A;  2EAY A;  1M1F A;  4QVC A;  1H3Z A;  3CD6 T;  4PNO A;  3JB9 D;  2RK2 A;  1VQL A;  5J26 A;  5GMK e;  3UDC A;  5GMK i;  3PNW C;  3RUX A;  4UC4 A;  2RHZ A;  5IT9 E;  5KE2 A;  3OYB A;  3JCM b;  1OZ2 A;  1Q86 C;  1N6A A;  1KD1 C;  3PIO A;  2C06 A;  4C5I A;  5GAO q;  3LWH A;  3CME T;  5GAM d;  5CQY A;  4A4F A;  1VQO A;  5GAN 5;  1G3T A;  5GAM f;  2RO0 A;  3JCM d;  3L2Z A;  1WQW A;  3JCM f;  3X28 B;  5IAY A;  2P0Q A;  1TH7 A;  4M75 C;  4FU6 A;  4XTY A;  1M8V A;  2GQV A;  2RJD A;  4M7D C;  3VYH B;  2LNV A;  1M5Q 1;  3QII A;  4O5V A;  4KBM B;  5L8R E;  3UPU A;  2KAF A;  2X4X A;  2L3R A;  4JRI A;  3MET A;  1WJR A;  4C92 A;  1W2B S;  4XK8 E;  5FLX E;  3RES A;  5C6S A;  5FU6 B;  4BI4 A;  3OYM A;  4LDV A;  4C8Q D;  2QDY B;  2YHT A;  2EQK A;  2OTL A;  4ATO A;  3JB9 G;  3CCQ T;  4J5Y A;  4R56 A;  4C8Q A;  1JBM A;  2D9T A;  3CCR A;  1N27 A;  4RG2 A;  5A2Q E;  5CVI A;  4GLK A;  2O4X B;  2CZ7 B;  4FL6 A;  4XTZ A;  4J6X A;  4BUG A;  3CCM A;  4JS5 A;  1KQ2 A;  4C92 F;  2ZGW A;  3I56 A;  3AHU A;  2EKO A;  4M78 C;  4C8Q E;  1YI2 A;  3PTA A;  1G3S A;  2RB6 A;  3L2V A;  3CCJ A;  4CI0 C;  2MF2 A;  1R8O B;  4ME7 A;  5J3B A;  1LJO A;  5KCH A;  4RG8 A;  3CMA T;  4M77 C;  2M0O A;  1JJ2 S;  4BB7 A;  2VGN A;  4JRQ A;  3VJP A;  4B9W A;  1QVG S;  4JLI A;  1KQS S;  1N8R U;  4C0F A;  4Q5W A;  3CC7 T;  3LGF A;  3X20 B;  4PJO D;  5IN1 A;  1GXI E;  2DTI A;  4BDY A;  4N4I A;  3BW1 A;  3MP1 A;  3L2Q A;  1VQ7 T;  3HRT A;  1VQ8 T;  1UB4 A;  4M7A C;  1YJN T;  3PMT A;  3QBY A;  4EMK A;  2LTO A;  5GAN 7;  3G71 T;  1VQ5 A;  1P92 A;  2XD0 A;  3C94 A;  3NFC A;  3GOX A;  1BI0 A;  5GAN g;  3OY9 A;  1VQM A;  4PJO E;  3OS2 A;  2LDM A;  2RK1 A;  2KK4 A;  2KMT A;  2ZPE B;  1I8F A;  3MEU A;  3N5B B;  2QA4 T;  3P8H A;  2H3J A;  5GAN 6;  2P0K A;  3CCL A;  4F7U F;  3I55 T;  2M1H A;  2E5Q A;  2LX9 A;  2RJE A;  4IUT A;  3VU3 C;  2R5A A;  3OYK A;  3LYI A;  4L59 A;  2GFU A;  2HQE A;  2DK3 A;  3TRE A;  3JCM X;  2R5M A;  4PLL A;  2DZC A;  3MCA B;  3UT1 A;  4LD6 A;  3CCE A;  2OTJ A;  2K4Y A;  4FSX A;  1WGS A;  2FHD A;  2NLU A;  4PJO G;  3X25 B;  1XOV A;  5LJ5 h;  3HSB A;  4C0G A;  4HA8 A;  4M75 F;  4E7L A;  2F5T X;  4M7D F;  1VQN T;  5C0M A;  3JAM E;  2JOY A;  4HT8 A;  3QHS A;  1Q81 C;  5I2S A;  1BI1 A;  4XTU A;  1QVP A;  2CKK A;  4LDW A;  5LJ5 e;  3OYF A;  3QYH B;  2QI2 A;  2DXB A;  3QZ5 B;  3DB4 A;  3CC2 T;  3ME9 A;  3RKY A;  4EDU A;  2RHU A;  2DIQ A;  2ZPG B;  3URG A;  4BY6 B;  3QDR B;  1VQ6 A;  2BKD N;  4A4H A;  2GFA A;  1M90 C;  5GMK m;  2EFI A;  1K73 U;  2HD0 A;  3X24 B;  4HCC A;  2CZ0 B;  2DKG A;  1Q7Y U;  2XKO C;  5J39 A;  1BIA A;  4A53 A;  4M78 F;  5KCO A;  2JUF A;  4HCB A;  4C8Q C;  3JCM c;  3JB9 J;  2QQ9 A;  4N0A A;  3OW2 A;  2DD5 A;  4OB2 B;  2VGM A;  3QJY A;  1NPP A;  2JTF A;  1YJW T;  4M77 F;  3FIF A;  3J7A F;  2EJF A;  3QZ9 B;  2E10 A;  3WVE B;  3WVD B;  1YHQ T;  5KE3 A;  4KUD K;  1VUB A;  3OYA A;  3OS0 A;  1VQP T;  4ELZ C;  2FL7 A;  2VUB A;  1D3B B;  3JB9 H;  4M7A F;  4MDX A;  4HCZ A;  3E1S A;  1KC8 C;  3S3N A;  3L42 A;  3MEA A;  5CKB A;  3QSU A;  2VXE A;  4FM4 B;  4IUR A;  5FRM A;  1U1T A;  4DA4 A;  4KUI A;  2M16 A;  3JCM W;  4ZN1 A;  4OB3 B;  5LJ3 h;  2JNG A;  3L2U A;  3CCS T;  4QVD A;  3GNF B;  1MHN A;  4J8O A;  3FC3 A;  2RA2 A;  3FB9 A;  3CCQ A;  1M4Z A;  4N4G A;  2O01 E;  3V7R A;  4EMK C;  1K8A U;  3TEE A;  3HP9 A;  5DLO A;  3J81 E;  5LJ3 e;  2FYK A;  2QXF A;  1Y96 B;  2CGH A;  4C0D B;  1LOJ A;  1VQ6 T;  4MZM A;  1YIT T;  3SD4 A;  4JUV A;  3A8M B;  5FRN A;  2HNI A;  4OF1 A;  4MZT A;  5GAN 8;  2XDP A;  2PQW A;  3OSV A;  2D0Q B;  1LNX A;  2K57 A;  3FRN A;  2JZ2 A;  2RJC A;  3CMA A;  4NL3 A;  5GAM h;  3GF5 A;  2HQX A;  2K5F A;  1SSF A;  1M1K U;  3CC7 A;  3PIP A;  3LWI A;  4Z02 A;  3M58 A;  3O8V A;  2WAC A;  3OMG A;  1YIJ T;  1UGP B;  1VQ7 A;  3M4G A;  4L6V 5;  1YJN A;  3JB9 I;  5GAM e;  3OYE A;  2V8I A;  4FIB A;  3GNG A;  3M9Q A;  4HT9 A;  3HL8 A;  2E12 A;  4JDS A;  1BKB A;  1Q82 C;  1O9S A;  5I2M A;  3OA6 A;  2LT4 A;  3BDU A;  2QA4 A;  2DO3 A;  2YLB A;  4IUP A;  2EQJ A;  4RMO A;  1Y07 A;  1YBY A;  5FU7 B;  1M9S A;  3SWN B;  2Y90 A;  4ZGJ B;  2X4W A;  1G3Y A;  2E65 A;  5CKD A;  3I55 A;  3VYG A;  2MWP A;  4C0Z A;  4MDW A;  5HY6 A;  2CYZ B;  2VYT A;  4C5G A;  4C8Q F;  3P8B B;  1NJI U;  2CZ6 B;  2RHX A;  2RJF A;  2GF7 A;  2F5K A;  1BIB A;  1IZ6 A;  4WF2 A;  5CCA A;  3LH0 A;  3M56 A;  3CPW S;  5GAN j;  3V7S A;  5FU6 C;  2RHY A;  2EIF A;  3QJ6 A;  4PJO A;  3A8O B;  4XU2 A;  2EJ9 A;  4N0A C;  5GAO n;  3HKS A;  3JCM P;  2IG0 A;  5LJ5 g;  2LVM A;  4XU0 A;  4A54 A;  3G6E T;  5HK3 A;  1VQ4 A;  1K9M C;  1VQN A;  1DJ7 B;  1VQK A;  5CQX A;  2XDD A;  1VQ9 A;  5DY9 A;  5CKF A;  4QQ6 A;  3FJP A;  3X26 B;  2RH2 A;  2Y4X A;  1NE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...