3JCMh

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
77
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Transcription
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 12
structure length 77
sequence length 88
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmh00
3JCMP 2E1HA 5GAN2 4WF2A 1I5LA 4NOYA 3BFMA 2FB7A 4N0AA 1LNXA 2VXFA 5LJ5d 2K57A 3RKWA 5GAOq 4HT8A 2CGHA 5GMKh 5GAMj 5GAMg 4C8QA 5GMKe 4M7DC 1MGQA 2E64A 3L1AA 4J6YA 1LJOA 3V8KA 4PJOE 4C92D 3JB9J 5GANe 1U1TA 4M78E 5I21A 4X9CA 4EMHA 4M7DA 1U1SA 3EFRA 3L2ZA 4J6WA 2DTHA 4M78C 1WQWA 4JRKA 3V7CA 3V8JA 3JCMX 5GAN5 3EFSA 4XTZA 2VC8A 4XTYA 4M77D 5GANf 4M78G 4M78F 2EJGA 2E41A 3JB9I 4M77A 3SWNA 3JCMe 2Y90A 1X01A 3BY7A 4DQ2A 2RA2A 2DEQA 3HFNA 5LJ5h 4M7AD 2EWNA 5GAOl 2ZGWA 4XU0A 3JCMg 4QVCA 4JLIA 4RCCA 4M75G 4M75F 2YLBA 4C92B 4M78A 4C8QB 3SB2A 1WPYA 2DJZA 3JB9D 5LJ3j 2RM4A 3RIRA 2DVEA 5GAOm 4EMKC 3JCMd 5LJ3h 3RERA 3QUIA 1BIBA 1TH7A 4XTUA 5GAMd 4PJOA 4M75A 4C8QC 4XQ3A 2YLCA 4RCBA 3JCMh 1Y96B 3M4GA 5GAN6 5DY9A 1HXDA 4F7UF 4F7UG 3RKYA 4M7DE 2EAYA 4XTXA 4EMKB 4F7UE 5LJ5j 3V8LA 3FJPA 4M7DF 4M7DG 4M7AA 4J5YA 2DZCA 3JCMV 5GAOp 4PJOG 3INZA 4PJOF 4EMKA 4XU2A 2RB6A 4C8QD 1N9RA 4OP0A 5GMKi 4M77G 4M77F 4M78D 3FIFA 5LJ3f 1JRIA 3SWNC 3AHUA 1D3BB 1LOJA 4J6XA 4C92E 1HK9A 2DZ9A 1KQ2A 5GMKj 5GAMh 1WQ7A 4M7AG 4M7AF 1M8VA 1KQ1A 4M75E 2E65A 3QHSA 3JCMf 1D3BA 4X9DA 4M75D 4A53A 4XTVA 2RD1A 4M7AC 1Y96A 5GMKm 1B34B 1H641 2DKGA 5CAIA 4HT9A 3RESA 3JB9G 5LJ5f 3JB9F 4M7AE 4M7AB 4EMGA 4XTWA 4A54A 3HSBA 3JCMW 1I81A 4M7DB 4PJOC 5GANh 5LJ5e 5GAN7 4PNOA 4MMKA 1BIAA 3RKXA 1I4K1 4M77B 2YHTA 4MMLA 4F7UA 5LJ3g 2EJ9A 4C92A 1JBMA 4PJOB 5GAN4 5GAMe 2DXUA 4M7DD 1N9SA 4XU1A 5GMKl 3JCMQ 3GIBA 2QTXA 4C92C 2FYKA 4Y91A 5GAN8 4V2SA 1B34A 4F7UB 5GAMf 3V7RA 4NL2A 4PJOD 4JRIA 3SWNB 2DTOA 4C8QG 4C8QF 5LJ3e 4C92F 4C92G 5GAOr 3JCMc 5LJ5g 1I8FA 2EJFA 3QO3A 4HA8A 3JCMb 3FB9A 4M77C 3PGGA 3BW1A 2VXEA 4QVDA 2HNIA 5GANj 3QSUA 2DTIA 5GANg 4M78B 4C8QE 2JN0A 4XU3A 4M75B 2DXTA 4JUVA 1YCYA 3JB9H 3BDUA 1M5Q1 5GAN3 5LJ3d 3JCMJ 1WNLA 4NL3A 5GAOn 4M77E 4N0AC 4M75C 2I2LA 3VU3C 3V7SA 5GANd 3RUXA 3HFOA 2E10A
chains in the Genus database with same CATH superfamily
1IO6A 2ZPIB 1KC8R 2VKNA 5LJ5d 2QK0A 5CKEA 5GAOq 3OYBA 1RAIB 4HT8A 4KH1B 1S1NA 4HXJA 4E7ZA 4F16A 5GANe 1JB0E 2C0TA 5KYXB 2O2OA 1IRXA 2VC8A 2XIDA 3C0CA 3P8DA 3QYHB 2LJ0A 4F17A 4TVRA 4BUGA 4ZNXA 1H3ZA 3JCMg 4QVCA 2DD4A 3M0SA 4JLIA 3OYDA 4M75G 4IIOA 4M78A 2HKNA 2DVEA 5AYFA 1E6HA 3QUIA 1BIBA 2YT6A 2CZ1B 4PJOA 3WXMB 2DXCA 1BKBA 1VQMT 3VS0A 4F7UG 3NHNA 3FJPA 1RI9A 1R77A 2DL7A 2LP5A 4ZGDB 5GAOp 1VQKT 4M4ZA 3X28B 4M77G 4RG8A 3CC4Q 1Q7YC 5FW9A 3VUBA 1KQ1A 4EDUA 3OYFA 1ZA1B 1AHJB 1U06A 2ZPFB 1G3YA 1D1CA 5HKCA 1BB9A 2K3XA 1GFCA 3OB9A 3E19A 1Y07A 1VQPA 4PNOA 2JNGA 3G6ET 2BTTA 2JS0A 1OI1A 2RNAA 1JBMA 4PJOB 3CD6Q 2LRQA 2J7IA 5KYWB 3H0FA 3IQLA 2DYIA 4HCCA 3CCJQ 4ELYC 4OMQA 2DILA 3CC4A 4C92G 3CCUA 1MV3A 5CKBA 1K73R 2PVDB 1VUBA 4M77C 2CT4A 2CZ7B 1JJ2A 3QSUA 2M51A 4C8QE 2D0QB 4JUVA 3OW2A 4FYYB 2K2VA 5GAOn 1VQ4T 4QQGA 2I2LA 2ZPEB 3V7SA 3VU3C 5GANd 1WI7A 2O4XA 2L2PA 1SHFA 2GTOA 3H0IA 2BE7D 3M0PA 1Q82C 2RF0A 4AT1B 1WHKA 2WSFE 2R57A 1UFFA 2WSCE 5A0LA 2CH4W 4OMFB 4AG2C 3CCEQ 2XK0A 1RUWA 2E6NA 2AHJB 1NEBA 5GAN5 2EYYA 1UUEA 4OB3B 1JQQA 2R58A 3CMEA 2EJGA 1UE9A 6AT1B 2Y90A 1MNDA 3A5ZB 1RLPC 2E12A 3CCSQ 1HJDA 4JZ3A 2ZGWA 3M0RA 4FSXA 3SEMA 3CCET 1O75A 3EG9B 5I2MA 1Q81U 1QVGA 2CS7A 2H3JA 1NYFA 3A8MB 1RAHB 2K79A 3S3NA 1G3TA 5GMKi 2XDPA 2D1XA 4J9DA 1X6OA 4J6XA 4OB2B 3HRUA 3CC7T 5GMKj 1H92A 1X69A 4C0GA 3QZ9B 3Q1JA 2K2MA 4HT9A 2V8JA 1GRIA 2L3PA 1WXUA 2CDTA 2DBMA 2A3LA 5IAYA 2LCSA 1EFNA 1G83A 2ED0A 3MJXA 5GAMe 3G6EQ 2QGGA 5GAN8 3HTRA 2BZ8A 3EG0A 3VJPA 1GCQA 2NYSA 2LVMA 1NZ9A 4HA8A 1VYVA 3VUZA 5C6SA 2HL5C 2KNBB 1B3QA 2L5QA 3OA6A 1VQ4Q 1W2BS 3URGA 2HBWA 4HKEA 3MKDA 1JO8A 2K3YA 3AHUA 5CKDA 3HPWA 1RI0A 3A8OB 1BCMA 4N0AA 1UHFA 2AIRB 3RMSA 1JU5C 2ZCFB 2MCNA 1OEBA 2RI2A 4C0DB 1YITA 4JRKA 3ULRB 3JAME 3EFSA 3VS1A 1AZGB 2J05A 1QW1A 2NUZA 3C95A 1X01A 3HFNA 5DM7R 2EWNA 2J06A 3PTAA 4RCCA 2GGRA 3OBYA 4BY6C 1KD1U 2LCCA 3LWIA 3GF5A 3EGDB 3CBOA 1YI2T 5GAMd 2XDDA 1Q82U 1VQ6Q 3M4GA 3X20B 1Q86R 1QVFA 1MMAA 4M7DG 1ZX6A 1YJWQ 4AFQC 3CC2A 2LMJA 4XU2A 2RB6A 1VQKA 1K76A 4LDUA 4CC2A 3A8HB 3TREA 3A8LB 3QJYA 1VQ9T 2E5KA 4HVVA 1VQ7A 1XNIA 4J7IA 4QW2A 2H8HA 5CCAA 1YI2Q 2JVVA 5CR2A 1X2QA 1LCKA 3KBGA 3NFCA 1VOMA 4XTWA 1QVFP 4MDXA 4L5GA 1LPLA 1PD0A 2KK4A 2M16A 3ZFJA 1OX8A 1IGUA 4JZ4A 5LJ3g 3OS1A 4RTUA 4AFSC 2QTXA 1QQJA 3LGLA 5GAMf 4C92F 2DO3A 4N4HA 3I9QA 1DJ7B 3X26B 3EG9A 3OW2S 5IHKA 4CI0C 1KD1R 3OW2P 3QDFA 3I56A 3QKJA 4N0AC 5L8RE 4E7LA 2CP2A 3M9QA 3C4SA 1JXMA 3E1SA 1UHCA 3NGPA 3GNGA 1ZBXA 3MP1A 3EFOA 2CGHA 3CCRQ 3X24B 2FZGB 1MGQA 3CCMQ 5AT1B 1E7OA 3KUFA 4EMHA 3CD6A 1QCFA 2DTHA 3LWHA 1QP2A 2EKHA 4M78F 2ATCB 2W0ZA 3M0UA 2PUOB 2CP0A 1I1JA 2LJ1A 2GQVA 1TS9A 1MMDA 2YRDA 1QWFA 3CCEA 1WHJA 4FCYA 4EMKC 2JXBA 3CCRT 1MNEA 4M75A 3UPUA 1M2OA 4JLGA 5CKFA 1OOTA 2LQNA 2EAYA 4XTXA 5LJ5j 1RACB 2J6OA 3CBMA 1FMWA 4PJOG 4LD9K 4MDWA 1U8RA 2CP5A 4Z89A 2X4JA 5GAMh 1YITQ 8AT1B 2I0NA 5FU6C 2RD1A 2A28A 4CC4B 1XJWB 4PLLA 3VYGA 3EGDA 4JJBA 4IIMA 2ED1A 3CBPA 4RTVA 1NJIU 4XAXB 4QT7A 5M9OA 5GMKl 2GQIA 2CKKA 4JJNK 4A4HA 4HCZA 2DTOA 4C8QG 2DBKA 2ZPBB 3OYKA 2DA9A 4GY5A 1Q81R 3PNWC 2OTJT 2Z0WA 3OMGA 2F2WA 1KK7A 5GANg 3CCMA 1QKWA 1M5Q1 5LJ3d 3UWNA 1WX6A 2KQWA 1M1KR 3UDCA 2KEAA 1VQ7T 3S3OA 2QEXA 1VQ8A 2ENMA 1PKSA 1MHNA 1JXOA 2PVOB 4L59A 5C0MA 2QASA 5GMKe 3VKIA 4M7DC 2JT4A 2OTJQ 4WTOB 1WFWA 3P8BB 2WSEE 1U1SA 1WA7A 2VVKA 4J6WA 2EQMA 2F5TX 4X34A 3OYJA 1OQKA 1VYTA 2COYA 5IXBA 4XK8E 1GBQA 1ABQA 2HDAA 1OPLA 5J39A 4IUPA 2QDYB 2YLBA 1VQMA 3L2QA 2M9UA 2O88A 2RM4A 2P0QA 2ZAEA 3RIRA 4C0FA 4LDWA 2LJ3A 3AT1B 2K5IA 5DY9A 4M7DF 2JOYA 4MZMA 2JUFA 4IUQA 1N9RA 2L3QA 2L8DA 1N27A 5LJ3f 1JRIA 1AWJA 3H8ZA 2P0KA 5DLOA 1VQMQ 3R6OA 4J7FA 3HRSA 3G71Q 2DF6A 3QYGB 2JS2A 4M7AE 2JM8A 4J9IA 3JCMW 2YWWA 3M58A 1PM3A 5LJ5e 1I4K1 3CEYA 3ER0A 3SHWA 4ZN1A 1FXXA 1D09B 2EGEA 2K7AA 5KE3A 3EFOB 1YIJA 1VQOA 3OS0A 2FZKB 2M0OA 4JRIA 3O5ZA 3QJ6A 5LJ5g 2EJFA 4FYXB 5CIUA 2F2XA 2ROLA 3G7ZA 1AZEA 1K9MR 2GBQA 5CK9A 1VQNT 2HQHA 1UGQB 2PNIA 4PJLA 1PRLC 1AT1B 2DLPA 4PJJA 4KRTA 2OX7A 2KDSA 1YBYA 3NTHA 2KT8A 3MHXA 3CCJA 3L2VA 3CCSA 4WCIA 4PFZA 1BBZA 2FVUA 1VQPQ 1YITT 4EPCA 3GLXA 2JTEA 1V76A 1BYMA 2F2VA 2NLUA 1KC8U 4ZGEB 4B6MA 4BDYA 4FT4A 2RQRA 3SWNA 2PVGB 5FRNA 1K9MU 4DQ2A 2DEQA 2K4YA 1N6AA 4C8QB 4HCBA 3ME9A 1U5SA 2DJZA 2YUQA 3G4ST 1M90R 3VRYA 3X25B 4KUDK 1G8XA 1UJ0A 2JMAA 1SPKA 4JJCA 2C0OA 2AZVA 1GL5A 2YSQA 2QEXQ 4OB0B 2LQWA 1HD3A 3VS7A 3OYMA 2VGMA 3JCMV 4PJOF 1IXDA 4LXCA 4OMNA 2OTLQ 4C5IA 2MOXA 4ANJA 1HK9A 1KQ2A 4LDYA 2QQ9A 2EQUA 1M8VA 2DPPB 2G3RA 4D8DA 2EQKA 2ZPGB 2W10A 1B34B 2DKGA 1SHGA 4KGVB 4PFOA 1ZUUA 4E7KA 1KHCA 1LVKA 3R6NA 2B86A 5GJVB 1NBEB 1T0JA 1Q86C 4GBQA 2GFAA 3V7RA 4C5EA 5L23A 2QQAA 1X43A 2X35A 1K0XA 3JCMc 4DA4A 3RR6A 1VQOQ 2MIOA 1MMNA 1QP3A 4QVDA 1C1AA 3E2UA 3E9FA 3OSVA 1M2VB 2DXTA 2X4WA 2DIGA 3FJ5A 4QQ6A 2VWFA 2BZYA 3M55A 2E10A 2HSPA 3JCMP 5D6XA 2BKDN 1LNXA 2LT4A 5CVIA 2CH4A 3CC2T 1ZQ1A 2DE0X 2QQBA 1BCOA 1ACMB 1EIFA 1FMKA 4OVAA 2AZSA 3J7AF 3GNFB 2GTJA 1QVGS 3EGXB 4M78C 2MYSA 5IT9E 3FRNA 4XTYA 4CRIA 4NS5A 4DOWA 4E7HA 4Z88A 2LQ8A 2XHCA 4RTYA 3OYAA 1TXQA 4PKCC 4FYVB 3VV0A 2A36A 3I55Q 4PJNA 2LCLA 3SFMA 3LH5A 4BE2A 4KT0E 1NPPA 3DB4A 3UT1A 1TH7A 4B9XA 2KVQG 3JCMh 4JPBW 1Y96B 1X6GA 3CMAQ 1Q7YR 1CKBA 1Y57A 3L2RA 5HY6A 3CXCP 3QWYA 1C0MA 2RHUA 2FPFA 2J6FA 4AMCA 3I56Q 2F5KA 1KD1C 4JJDA 1GCQC 4A4FA 4IUVA 4HVUA 4M75E 3QHSA 1RLQC 1SSHA 4BACA 1VQLQ 2M02A 1C6VX 1KJWA 3RMQA 3J80E 5HCKA 2X51A 4UC4A 4A54A 1GCPA 1H8KA 4M7DB 2RO0A 3EAEA 3VS2A 1VQ5T 1ZA2B 3CD6T 1VQOT 2IIMA 1VIEA 4BB7A 2GCXA 3PGGA 1ZHIA 2KXDA 2O9SA 5IHIA 3OYCA 3G1JA 5IN1A 2XDBA 2QEXT 3OYHA 3OBWA 1WNLA 5KYNA 1M90U 2DMOA 1WDXA 1D1AA 2AKKA 2XKOC 4VUBA 3S6WA 3I55T 2IG0A 4II1A 4BE1A 1M3AA 1PWTA 1X27A 4PL6A 3RDVA 3E9GA 2P4RA 1ZSZB 2MK5A 3MP6A 3UATA 2DXBA 1Y71A 1NM7A 1WQWA 3JCMX 2IPOB 5FU7B 4M77D 4N4GA 2JW4A 2SRCA 4M77A 1W6XA 2JMCA 2EVRA 1PC0A 3EGUA 1T3LA 3G4SQ 2L3SA 4OGCA 5ECAA 3VYHB 5LL6S 2CSIA 1TWBA 1X2KA 1KQSS 5I2SA 3CMAT 2YLCA 4RCBA 2P0PA 3UA7A 4EMKB 1M90C 3D7SB 3I55A 2RQTA 4ATOA 1D1BA 1EZZB 1LOJA 1ZLMA 2DZ9A 1M27C 1QWEA 3M5AA 1WIEA 2NUPB 1M2VA 2KBTA 1Z9ZA 3H9NA 1QCOA 2QQRA 2AT1B 1YJ9A 3EG1A 5HK3A 1PKTA 5GAN7 1PD1A 2FO0A 3OYGA 1VQNQ 1E6GA 3O8VA 4FSSA 2QA4T 3VRZA 5CO7A 4GLMA 1YHQQ 2DK3A 1Q86U 1SF9A 5J26A 2HEQA 1KC8C 3CCJT 1RADB 4NL3A 1W70A 1W1FA 2DL8A 3CCLT 1K9MC 3RUXA 4A4KA 1RAEB 4NOYA 2K6DA 4P5NA 1W2BA 2D8HA 1J3TA 2RQUA 5GMKh 3G71T 4J6YA 4DBFA 2E4HA 2JZ2A 3OSSC 3T9NA 2G6FX 4BI4A 1VQKQ 3G4SA 2OJ2A 1G5VA 5GAOl 1CKAA 3L2UA 2DAQA 4LNPA 3GBQA 3J81E 4C92B 2LDMA 1SSFA 2QDLA 2OTLT 2HCKA 5GAOm 4C5HA 1OV3A 2KMTA 1G3WA 1N8RU 4JRQA 2L0AA 2P4TA 8ATCB 4M7DE 1K8AU 2JM9A 2X4XA 2V8KA 1K1ZA 3THKA 1I5OB 4LE9A 3VS6A 4C8QD 1WHHA 2HQEA 1FWZA 1VQ9Q 5EG2A 1ARKA 1QCNA 3JCMf 3JRZA 1KIKA 4HVWA 1KFZA 5KYYA 1M1KC 4A4GA 1YFNA 1SKUB 4EIKA 2F1LA 4EMGA 3KXTA 2RJFA 3U23A 3SD4A 4MMKA 2ABLA 5IHNA 4RKUE 3EG3A 3CMET 2QGFB 5KCHA 2WACA 1YP5A 4XU1A 4C92C 1NE8A 3SWNB 4RTZA 2DX1A 4PLIA 2HD0A 2YDLA 3QXEB 2LZ6B 3OQ5A 2J6KA 1BU1A 1K73C 3JB9H 4BY6B 2LX9A 2CUDA 2C0IA 3QG1A 2QAZA 2EYZA 1OZ2A 5GAN2 4WF2A 3PE0A 3MCAB 2LNVA 3M56A 4IKFA 3RKWA 3H41A 1VQPT 4F14A 1M1FA 3L1AA 1AWOA 3NMZC 4LUEA 4QVZA 1U1TA 3EGXA 2DRKA 4M7DA 4FYWB 4E7SA 4LUDA 2QA4A 3G71A 1TOVA 4LDVA 4D8KA 1OZ3A 3OYIA 4ZTJA 3UF4A 2O31A 3PIOA 4M7AD 2V1RA 2KYBA 4KH0B 2EW3A 4XU0A 2GFUA 1WXTA 1TU0B 5FU6B 4KGZB 3JB9D 3CXCS 4J9CA 1YN8A 4C0DC 2KT1A 1R0BG 3OY9A 4C8QC 3REBB 2FRWA 2O4XB 2CZ6B 1V1CA 3MPUB 2EGAA 4J5YA 2DZCA 1GBRA 2F69A 3ZEHA 3MEWA 4DOVA 2QA4Q 1ZUYA 1YJWA 1WQ7A 2ESWA 2BUDA 2E65A 1OYXA 4M75D 4XTVA 9ATCB 3RESA 5LJ5f 4N4IA 2E3HA 1YCSB 3NPFA 1IHVA 2EQIA 4AFZC 2ROTA 5GANh 3RKXA 4O6JA 4CC3A 4J9HA 1AWXA 4F7UA 1N8RC 2FYKA 4Y91A 2EGCA 1X75C 4NL2A 1KHIA 4C8QF 5LJ3e 4YTLA 2P84A 2VGNA 1S72T 1VQ7Q 1BK2A 2HSEB 4QQDA 3M4YA 2QXFA 2VXEA 3ZL7C 3HL8A 4XU3A 1S72A 3BDUA 1WJRA 1JJ2P 4KULA 1RABB 2L3RA 1I5LA 1NLOC 2EPDA 1NEGA 2KYMA 1KG1A 3M57A 1OU8A 2HAXA 5IXFA 4M78E 5I21A 1AOJA 3EFRA 1KQSA 2HMAA 4BI8B 5GANf 2E41A 4FW2A 1Z9QA 4OGEA 2RMOA 5LJ5h 3CCQQ 1MV0B 2LX7A 4J9GA 3SB2A 1YJNA 2E6ZA 1UECA 1MUZA 3H6ZA 1WHLA 2LQKA 2DL3A 2MMPA 4KUIA 1VYUA 4OMPA 4F7UF 1V29B 4F7UE 1W4SA 2RK2A 2V8IA 3I56T 2CP7A 2HZYA 1JJ2S 4OMLA 1AWWA 4M77F 2E70A 1PNJA 1OU9A 2RHZA 1D3BB 2NWMA 4C92E 2KAFA 3WVDB 1UGRB 5A2QE 3ZBDA 3TEEA 2RJCA 3I5SA 4X9DA 1M9SA 1M3BA 4IUTA 3CXCA 3UA6A 2D8JA 1SRMA 2BIVA 3EH1A 2Y4XA 3G6EA 1WYXA 1UB4A 2JTMA 2EJ9A 2LC4A 1QVGP 2PU9B 3VS4A 5CQXA 3CQTA 3CCQT 3TSZA 1QVPA 4AFUC 1VQLA 3M54A 2DFUA 5KYXA 4V2SA 1Q7YU 3CMEQ 1T0HA 2MWOA 4FM4B 2KR3A 2A0FB 5KYUB 3C12A 1XTDA 2K5FA 2KI7A 2HNIA 2DTIA 1UG1A 4CC7A 2MAMA 3OYLA 1JEGA 3JCMJ 1D0XA 1T3SA 2NUTA 1N5ZA 2A7YA 1K9AA 5A0DA 4ZTFA 2E1HA 2RJDA 4DBHA 3GOXA 2FB7A 3FDRA 3DB3A 1YHQT 2QG9B 2EYQA 4Z8AA 2A08A 3CC7Q 1PCXA 3CPWP 3L2WA 2E64A 2RPNA 5A0GA 3PMTA 3JB9J 5HK0A 4LDXA 1OPKA 4X9CA 3L2ZA 5CQYA 4IUUA 3GP8A 2XU8A 4BD3A 1SEMA 4GLKA 4JS5A 3A8GB 2VV5A 3CC2Q 2RA2A 3CCRA 4DBQA 2DIQA 3PFSA 5J3BA 2EYWA 3PT9A 5I11A 1VQ6A 2XD0A 3JV3A 2D0NA 2VUBA 2LT1A 1QVFS 3RERA 3PVLA 4XTUA 1WZOA 1RAFB 1WJQA 1K0SA 3QBYA 3V8LA 2DJQA 1EX4A 3P8HA 4M7AA 4EMKA 2Y4YA 2X3XD 4A4EA 4A63B 3WVEB 3CCLA 1VQ8Q 2D6FA 1H641 2KGTA 4E2FB 1PSFA 1M1GA 1K8AR 3RNJA 4M77B 4R56A 4MMLA 5GAN4 2FPDA 2A37A 1WLPB 2YRVA 1N9SA 5I22A 2V1QA 4F7UB 2RHYA 3LGFA 2CP3A 2M1HA 2OTLA 1VQLT 1I0CA 3TQ7P 4FT2A 3HHTB 1YWPA 2BZXA 4M78B 2JN0A 2RQVA 4M75B 3LH0A 5IH2A 4MZTA 2E3IA 1BI1A 2QQSA 1I8FA 1XOVA 1R8OB 3M53A 5KE2A 1HYOA 2RK1A 3CCLQ 7AT1B 1AVZC 2KE9A 1D0ZA 2EKOA 1YJ9T 4OB1B 1O9SA 4ELZC 1NYGA 3EHQA 4C92D 3A98A 1YHQA 2KRMA 2HQXA 4K11A 1UGVA 1ZSGA 3CPWS 4OMMA 1WXBA 3JCMe 1TSFA 1D0YA 1BI3A 4F04B 2CYZB 5LJ3j 2MPXC 5DLQE 2SEMA 1TUDA 1YI2A 1PG5B 2YRCA 1M4ZA 4KGXB 2GF7A 3PVQA 5KH6A 4JS4A 1SG5A 2QTVA 4E47A 1Y0MA 4FW1A 4OP0A 2CZ0B 1ZUKA 4M78D 4RG2A 1AEYA 2DVJA 3PMIA 4M7AF 1KSWA 2DEUA 1WJSA 2OAUA 1K8AC 2IVWA 1U3OA 1UGSB 2AKLA 4BI3A 4M7AC 2FRYA 2YUOA 2OI3A 2NUPA 1N8RR 3JB9F 1I81A 2CSQA 3VS3A 3OS5A 2OAWA 1FX7A 3CCQA 1RL2A 2M0YA 4LN2A 3DLLA 1B34A 2CP6A 1CSKA 2COZA 5GJWB 2XICA 1W2BP 2VASA 3VS5A 3QO3A 4BDZA 3JCMb 3QDRB 2RN8A 2JJ9A 3EHRA 2R5AA 3LYIA 4L6V5 2HKQB 2RHIA 1WGSA 2RI3A 5GAN3 4M75C 1IREB 4C5GA 2CUBA 3QIIA 4LD6A 4J9FA 4J8OA 3CCUQ 1WHMA 4ESRA 1M30A 2MI6A 2VXFA 3DKMA 1IGQA 3EG2A 1RAAB 1ABOA 1ZSZA 4C8QA 2GNCA 4X1VA 3FC3A 3S3MA 2H3EB 2X9HA 2EYXA 3TCJA 3MP8A 4ORZA 2VYTA 1B7TA 4XTZA 1UJYA 4JDSA 4M78G 3JB9I 3H0HA 2FEIA 4IURA 1M1KU 3F70A 2FPEA 3CCMT 1SRLA 2FZCB 5D6WA 2XG8D 2LNHB 1NG2A 1AD5A 2RJEA 5FWBA 5FWCA 4RTXA 1IHWA 2YXYA 4XQ3A 3MEAA 4J83A 4Y28E 2PZ1A 3META 3GPLA 2PUKB 1M8MA 4HCKA 2QI2A 3INZA 1UEBA 1NJIR 1TUGB 2DD5A 2EQJA 1IB8A 3MEVA 2BE9B 4E7JA 3MO8A 1TTHB 1RAGB 3HRTA 5GMKm 4Y92A 2RI5A 1P92A 4M7AB 3N5BB 3JSCA 3HSBA 2KY9A 1I07A 2R5MA 2CT3A 4C92A 3SDZA 1TUCA 1PRMC 2EIFA 4M7DD 3JCMQ 3CPWA 2D9TA 1YWOA 1B07A 4RUGA 1G2BA 3DLMA 1YIJQ 3FB9A 2KRSA 3LW5E 2ECZA 1YCYA 4RTWA 1Q82R 3HKSA 4ZN3A 3M0TA 1YJWT 2O9VA 2QYZA 4M77E 1X6BA 1OULA 2ZPHB 1XQHA 4R55A 3CMAA 3BFMA 1VQNA 1BI0A 2K57A 5GAMj 5GAMg 3NTIA 2YUPA 3MEUA 1LJOA 1QMCA 3NTKA 4J9BA 1YJ9Q 2DRMA 3OYEA 2NUTB 1GFDA 3V7CA 3I35A 2X3WD 2HBPA 1UTIA 1UGPB 1YJNT 3BY7A 4O5VA 1OX9A 4M75F 5D6YA 2DYBA 2KRNA 3JCMd 3QZ5B 2X4YA 4OF1A 5EC7A 2FL7A 4ME7A 1MMGA 3QWXX 3ASKA 5D7UA 5FRMA 5GAN6 1Y7XA 1R0CB 4PK4A 3OMCA 2OTJA 1YJNQ 1K4US 4MZPA 4E6RA 4J9EA 1BI2A 3FIFA 3SWNC 2K3BA 3QPHA 5KCOA 4M7AG 1D3BA 2HL3A 3FEOA 2KXCA 3I5RA 4A53A 1FYNA 4DEXA 4D6WA 3JB9G 1TG0A 3TSWA 4ZGJB 1VQ5A 1GXIE 4E7IA 5KYYB 4FIBA 2V26A 2KSSA 5FROA 1QLYA 3GIBA 1A0NB 3CCVQ 1WHGA 4RTTA 1YIJT 4PJOD 5GAOr 1Q95G 1H3HA 2MF2A 1S72Q 5GANj 4RMOA 2RQWA 1F1BB 1ZBJA 2XI9A 1VQ6T 2EFIA 2O01E 4JRPA 1FMVA 2PTKA 3EH2A 2B8AA 1VQ4A 4PJMA 3HFOA 1VQ9A 2K9GA 2ZZDA 2PQWA 3CCVT 3CCST 1G3SA 5KYWA 1IZ6A 3BDLA 3V8KA 2LTOA 4PJOE 1PSEA 2C06A 4DEYA 4KBMB 2DL4A 3V8JA 4QKUA 4Q5WA 2YUNA 3CPFA 3M0QA 4C0ZA 2K5LA 4PFPA 1YNZA 1K73U 2FHDA 4FL6A 1WPYA 5CKHA 2KROA 1VIFA 3LLRA 2XMFA 3LX7A 5LJ3h 3FLGA 3TU4K 2DL5A 2E5QA 4BE0A 3C94A 1UDLA 3RBBB 1HXDA 3RKYA 2COWA 5FLXE 1NPRA 2FG0A 4R0KA 4FU6A 4DBRA 2L89A 1Q81C 2EBPA 1NLPC 1VA7A 3OYYA 1PHTA 1VQ8T 2DNUA 2RH2A 3CC7A 5KYUA 2RHXA 3CCVA 1NJIC 1Y96A 5CAIA 3HP9A 3A1PA 3M59A 1M3CA 3TVTA 4OMOA 4PJOC 1VQ5Q 1BIAA 2YHTA 3CCUT 4B9WA 4Z02A 3PIPA 3REAB 2DXUA 4AG1C 3OS2A 2CREA 3KFVA 3CC4T 2DM1A 2VB6A 3L42A 1QKXA 2AK5A 2DERA 2JTFA 3BW1A 3BE3A 2DETA 1KQSP 1ZSZC 3OYNA 2MWPA 1HSQA 5FU7C
chains in the Genus database with same CATH topology
1XOVA 1VQ7T 1R8OB 3M53A 4A4KA 3S3OA 2QEXA 5KE2A 2ZPIB 4NOYA 1VQ8A 2RK1A 4P5NA 1W2BA 1MHNA 5LJ5d 2PVOB 5CKEA 5GAOq 3OYBA 4HT8A 4L59A 2EKOA 1YJ9T 5GMKh 5C0MA 5GMKe 4OB1B 1O9SA 3VKIA 4ELZC 3G71T 4M7DC 4J6YA 4C92D 5GANe 2JZ2A 1YHQA 3OSSC 1JB0E 3P8BB 2WSEE 1U1SA 4J6WA 2EQMA 2F5TX 3T9NA 2HQXA 4X34A 3OYJA 2VC8A 2XIDA 3P8DA 4XK8E 4BI4A 3CPWS 3G4SA 3JCMe 3QYHB 5J39A 4TVRA 4IUPA 4BUGA 1G5VA 5GAOl 3L2UA 1H3ZA 1BI3A 2QDYB 2DAQA 3JCMg 2DD4A 4QVCA 4JLIA 3OYDA 4M75G 2YLBA 3J81E 4C92B 2LDMA 1SSFA 4M78A 1VQMA 2OTLT 2CYZB 3L2QA 2M9UA 5LJ3j 2RM4A 2P0QA 5DLQE 3RIRA 2DVEA 4C0FA 5GAOm 4C5HA 1YI2A 5AYFA 3QUIA 1BIBA 2KMTA 1G3WA 1M4ZA 2CZ1B 4LDWA 1N8RU 4JRQA 2P4TA 3WXMB 4PJOA 2DXCA 2GF7A 2K5IA 1BKBA 5KH6A 1VQMT 4JS4A 5DY9A 4F7UG 4M7DE 4M7DF 2JOYA 4MZMA 1K8AU 3FJPA 2X4XA 2V8KA 2JUFA 4IUQA 4ZGDB 5GAOp 1VQKT 4E47A 4C8QD 1N9RA 4OP0A 2CZ0B 4M77G 2HQEA 2L8DA 1FWZA 1N27A 3X28B 4RG8A 4M78D 4RG2A 5LJ3f 1JRIA 1Q7YC 3VUBA 3PMIA 5EG2A 4M7AF 1WJSA 3H8ZA 1KQ1A 2OAUA 2IVWA 2P0KA 1UGSB 3JCMf 4BI3A 4EDUA 3JRZA 3R6OA 5DLOA 4J7FA 3OYFA 3HRSA 4M7AC 1M1KC 1AHJB 3QYGB 4A4GA 2ZPFB 1G3YA 5HKCA 3JB9F 4M7AE 4EMGA 2K3XA 3OB9A 3E19A 3KXTA 1Y07A 3M58A 3JCMW 1I81A 2RJFA 1VQPA 5LJ5e 3SD4A 4PNOA 2JNGA 4MMKA 3G6ET 1I4K1 1OI1A 3OS5A 4RKUE 1JBMA 3CEYA 3ER0A 3CMET 1FX7A 4PJOB 5KCHA 2WACA 3CCQA 1RL2A 2LRQA 1FXXA 4ZN1A 4XU1A 4C92C 5KE3A 4HCCA 3DLLA 1YIJA 1B34A 1NE8A 4ELYC 1VQOA 3OS0A 2M0OA 4JRIA 3SWNB 3CC4A 4C92G 2XICA 3CCUA 4PLIA 5CKBA 2PVDB 3QJ6A 5LJ5g 2EJFA 3QO3A 3JCMb 4BDZA 1VUBA 3QDRB 4M77C 5CIUA 2CZ7B 2HD0A 3G7ZA 3QXEB 1JJ2A 3QSUA 2R5AA 3OQ5A 3LYIA 4L6V5 4C8QE 2D0QB 2RHIA 4JUVA 1WGSA 2RI3A 5GAN3 3OW2A 5CK9A 1K73C 1VQNT 3JB9H 2K2VA 1UGQB 5GAOn 4BY6B 4M75C 2LX9A 1VQ4T 1IREB 4QQGA 2I2LA 4C5GA 2ZPEB 3V7SA 3VU3C 3QIIA 3QG1A 4LD6A 2KDSA 5GANd 4J8OA 2O4XA 1YBYA 3NTHA 1OZ2A 5GAN2 4WF2A 3MHXA 1Q82C 2MI6A 2VXFA 3MCAB 3DKMA 2LNVA 3CCJA 3M56A 4IKFA 3RKWA 3L2VA 1VQPT 2WSFE 3CCSA 2R57A 4C8QA 2WSCE 1M1FA 3L1AA 4OMFB 5A0LA 3FC3A 3S3MA 4QVZA 1U1TA 2FVUA 1YITT 2XK0A 4EPCA 3TCJA 3GLXA 3MP8A 2E6NA 4M7DA 2AHJB 2VYTA 1BYMA 5GAN5 2NLUA 1KC8U 4XTZA 4ZGEB 2QA4A 3G71A 4BDYA 4JDSA 4FT4A 4LDVA 2R58A 4M78G 4OB3B 2EJGA 3JB9I 3CMEA 3SWNA 1OZ3A 2PVGB 2Y90A 3OYIA 4ZTJA 1K9MU 4DQ2A 5FRNA 2DEQA 3PIOA 3A5ZB 4IURA 1M1KU 4M7AD 2K4YA 2E12A 2ZGWA 3F70A 4FSXA 4XU0A 2GFUA 3CCMT 5D6WA 1N6AA 2XG8D 4C8QB 3CCET 4HCBA 3ME9A 5FU6B 2DJZA 2RJEA 3G4ST 3JB9D 1O75A 3CXCS 5I2MA 3X25B 1Q81U 4KUDK 1QVGA 2CS7A 2H3JA 4C0DC 3OY9A 4C8QC 4XQ3A 2O4XB 2CZ6B 3MEAA 4J83A 4Y28E 4OB0B 3A8MB 3META 3GPLA 3S3NA 2PUKB 2VGMA 3OYMA 4J5YA 2DZCA 3JCMV 2F69A 2QI2A 3INZA 1UEBA 4PJOF 3ZEHA 1G3TA 2DD5A 5GMKi 3MEWA 2XDPA 4DOVA 1X6OA 4C5IA 4J6XA 1YJWA 1HK9A 2EQJA 3HRUA 3MEVA 4OB2B 1KQ2A 4LDYA 2QQ9A 5GMKj 1WQ7A 2EQUA 3CC7T 2DPPB 2BUDA 4E7JA 2E65A 3MO8A 2G3RA 1M8VA 4C0GA 2EQKA 1OYXA 2ZPGB 3QZ9B 3Q1JA 4M75D 4XTVA 3HRTA 5GMKm 1B34B 2DKGA 4HT9A 2RI5A 3RESA 5LJ5f 1P92A 4N4IA 2V8JA 4M7AB 3N5BB 3JSCA 3HSBA 2KY9A 2A3LA 4E7KA 5GANh 1KHCA 5IAYA 2R5MA 3RKXA 4O6JA 4F7UA 4C92A 3SDZA 5GAMe 2EIFA 1N8RC 4M7DD 3JCMQ 1Q86C 3CPWA 2FYKA 4Y91A 5GAN8 3VJPA 2D9TA 2GFAA 1X75C 4NL2A 1KHIA 3V7RA 4C5EA 4C8QF 2QQAA 5LJ3e 4YTLA 2X35A 2VGNA 3JCMc 4DA4A 1S72T 2LVMA 1NZ9A 4HA8A 3DLMA 4QQDA 3FB9A 3M4YA 2QXFA 3VUZA 1QP3A 5C6SA 2VXEA 4QVDA 3E9FA 3HL8A 3LW5E 3OSVA 2L5QA 4XU3A 2DXTA 1YCYA 3OA6A 3BDUA 3HKSA 4ZN3A 1S72A 2X4WA 2DIGA 1YJWT 1W2BS 4M77E 1WJRA 4QQ6A 3URGA 4HKEA 2ZPHB 1XQHA 3M55A 4KULA 2K3YA 2E10A 3AHUA 4R55A 2L3RA 3CMAA 3JCMP 5CKDA 3HPWA 1I5LA 1RI0A 3A8OB 3BFMA 5D6XA 2BKDN 1LNXA 4N0AA 1VQNA 2LT4A 5CVIA 3RMSA 1BI0A 2K57A 1KG1A 3M57A 2ZCFB 5GAMj 3CC2T 5GAMg 3NTIA 1ZQ1A 2HAXA 3MEUA 1LJOA 2QQBA 3NTKA 2RI2A 1EIFA 4M78E 5I21A 4OVAA 4C0DB 1YITA 3J7AF 3GNFB 3OYEA 1QVGS 3EFRA 4M78C 4JRKA 3V7CA 1KQSA 5IT9E 3JAME 3EFSA 3FRNA 2HBPA 4XTYA 4CRIA 4BI8B 5GANf 1UGPB 1QW1A 4NS5A 1YJNT 2E41A 3C95A 4DOWA 4E7HA 1X01A 4OGEA 3BY7A 2LQ8A 2XHCA 3HFNA 4O5VA 5LJ5h 3OYAA 4PKCC 5DM7R 2EWNA 3VV0A 3PTAA 4RCCA 4M75F 3SFMA 2LCLA 3OBYA 5D6YA 4BY6C 1KD1U 2LCCA 3LWIA 3SB2A 1YJNA 3GF5A 4BE2A 2E6ZA 4KT0E 1NPPA 3H6ZA 3JCMd 3QZ5B 2LQKA 2X4YA 3CBOA 3DB4A 4OF1A 1TH7A 3UT1A 4B9XA 5GAMd 2XDDA 1YI2T 2FL7A 4ME7A 2KVQG 2MMPA 1Q82U 3JCMh 1Y96B 3ASKA 3M4GA 4KUIA 3X20B 5GAN6 1Y7XA 5FRMA 1QVFA 4F7UF 1V29B 4F7UE 1W4SA 2RK2A 2V8IA 3I56T 5HY6A 3L2RA 4M7DG 1JJ2S 3CC2A 3OMCA 2RHUA 2OTJA 4XU2A 2RB6A 1VQKA 4MZPA 4M77F 2E70A 4LDUA 1BI2A 3FIFA 3SWNC 2F5KA 2RHZA 1D3BB 4C92E 3QPHA 5KCOA 2KAFA 1KD1C 3WVDB 1UGRB 4A4FA 4IUVA 5A2QE 4M7AG 4M75E 3A8HB 3QHSA 1D3BA 3FEOA 3TREA 3A8LB 3QJYA 3ZBDA 4BACA 1VQ9T 2RJCA 4X9DA 3TEEA 4A53A 1VQ7A 1XNIA 4J7IA 4QW2A 1M9SA 4D6WA 3RMQA 5CCAA 3J80E 3JB9G 2JVVA 4IUTA 4ZGJB 5CR2A 3CXCA 1VQ5A 3KBGA 2BIVA 3NFCA 4UC4A 4XTWA 4A54A 4MDXA 2Y4XA 4L5GA 2KK4A 4M7DB 2RO0A 2M16A 3EAEA 3G6EA 1GXIE 4E7IA 3ZFJA 1UB4A 4FIBA 2JTMA 5LJ3g 2EJ9A 3OS1A 2LC4A 2PU9B 2KSSA 5CQXA 5FROA 3CCQT 1VQLA 1QVPA 1VQ5T 3GIBA 3M54A 2QTXA 3CD6T 4V2SA 1Q7YU 3LGLA 5GAMf 1YIJT 4PJOD 2MWOA 1VQOT 4FM4B 5GAOr 4C92F 2DO3A 1VIEA 4N4HA 4BB7A 2GCXA 1DJ7B 3C12A 3PGGA 3X26B 1ZHIA 1XTDA 2K5FA 2MF2A 3OW2S 2HNIA 3OYCA 5GANj 5IN1A 2DTIA 4CI0C 4RMOA 2XDBA 2MAMA 2QEXT 3OYLA 2XI9A 1VQ6T 3OYHA 3OBWA 3I56A 3JCMJ 1WNLA 3QKJA 2EFIA 2O01E 4JRPA 4N0AC 5L8RE 2A7YA 4E7LA 1M90U 3M9QA 2B8AA 3C4SA 1VQ4A 5A0DA 4ZTFA 3HFOA 1VQ9A 3E1SA 2E1HA 2RJDA 3GOXA 2XKOC 4VUBA 2FB7A 3FDRA 3DB3A 3S6WA 3I55T 1YHQT 2IG0A 3GNGA 1ZBXA 2ZZDA 2PQWA 3MP1A 2EYQA 3CCVT 4II1A 3CCST 2CGHA 1G3SA 4BE1A 3X24B 1IZ6A 3BDLA 3L2WA 1MGQA 2E64A 4PL6A 3V8KA 2LTOA 4PJOE 5A0GA 1PSEA 3E9GA 3PMTA 3JB9J 2C06A 4KBMB 3KUFA 5HK0A 4LDXA 4X9CA 3MP6A 4EMHA 2DXBA 3L2ZA 3CD6A 3V8JA 1Y71A 2DTHA 1WQWA 5CQYA 3LWHA 3JCMX 1QP2A 4IUUA 3GP8A 4Q5WA 5FU7B 4M77D 2XU8A 4BD3A 4N4GA 3CPFA 4GLKA 4M78F 4JS5A 4M77A 3A8GB 2PUOB 2VV5A 2RA2A 4C0ZA 3CCRA 2K5LA 2DIQA 2GQVA 3PFSA 5J3BA 1K73U 2FHDA 3PT9A 4OGCA 3CCEA 4FL6A 1VQ6A 3VYHB 2XD0A 5LL6S 1WPYA 5CKHA 1VIFA 3LLRA 2VUBA 3LX7A 1KQSS 4EMKC 3CCRT 2LT1A 5LJ3h 3FLGA 1QVFS 3RERA 3TU4K 4XTUA 5I2SA 2E5QA 4M75A 4BE0A 3UPUA 1WJQA 3CMAT 2YLCA 4JLGA 4RCBA 3C94A 5CKFA 2P0PA 1HXDA 3RKYA 2EAYA 4XTXA 3QBYA 5FLXE 4EMKB 3V8LA 5LJ5j 1M90C 1NPRA 3CBMA 4FU6A 3P8HA 4M7AA 4PJOG 4EMKA 2L89A 1Q81C 2Y4YA 4LD9K 4MDWA 1U8RA 3I55A 4ATOA 3OYYA 1VQ8T 1LOJA 2DZ9A 2RH2A 3CC7A 2RHXA 4A4EA 2X4JA 3M5AA 5GAMh 3CCVA 3WVEB 3CCLA 5FU6C 1NJIC 2RD1A 1Y96A 2D6FA 1H641 5CAIA 3HP9A 2QQRA 1PSFA 1M1GA 4PLLA 3VYGA 3M59A 1YJ9A 1K9MC 5HK3A 4PJOC 5GAN7 3CBPA 1BIAA 4M77B 4R56A 2YHTA 4MMLA 3CCUT 1NJIU 4XAXB 4Z02A 4B9WA 3PIPA 5GAN4 2DXUA 5M9OA 2YRVA 1N9SA 5GMKl 3OS2A 3OYGA 2CKKA 4JJNK 4A4HA 2RHYA 4F7UB 1K8AC 4HCZA 3O8VA 3CC4T 3LGFA 2DTOA 2QA4T 2M1HA 4C8QG 3L42A 5CO7A 2ZPBB 3OYKA 2OTLA 4GY5A 1VQLT 2JTFA 2DK3A 3BW1A 3PNWC 2OTJT 4FT2A 3OMGA 3HHTB 5GANg 3CCMA 1Q86U 4M78B 2JN0A 5J26A 4M75B 3LH0A 1M5Q1 1KC8C 5LJ3d 3CCJT 4MZTA 3UWNA 4NL3A 2KQWA 1BI1A 2QQSA 3OYNA 2MWPA 5FU7C 3CCLT 3UDCA 3RUXA 1I8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM P;  2E1H A;  5GAN 2;  4WF2 A;  1I5L A;  4NOY A;  3BFM A;  2FB7 A;  4N0A A;  1LNX A;  2VXF A;  5LJ5 d;  2K57 A;  3RKW A;  5GAO q;  4HT8 A;  2CGH A;  5GMK h;  5GAM j;  5GAM g;  4C8Q A;  5GMK e;  4M7D C;  1MGQ A;  2E64 A;  3L1A A;  4J6Y A;  1LJO A;  3V8K A;  4PJO E;  4C92 D;  3JB9 J;  5GAN e;  1U1T A;  4M78 E;  5I21 A;  4X9C A;  4EMH A;  4M7D A;  1U1S A;  3EFR A;  3L2Z A;  4J6W A;  2DTH A;  4M78 C;  1WQW A;  4JRK A;  3V7C A;  3V8J A;  3JCM X;  5GAN 5;  3EFS A;  4XTZ A;  2VC8 A;  4XTY A;  4M77 D;  5GAN f;  4M78 G;  4M78 F;  2EJG A;  2E41 A;  3JB9 I;  4M77 A;  3SWN A;  3JCM e;  2Y90 A;  1X01 A;  3BY7 A;  4DQ2 A;  2RA2 A;  2DEQ A;  3HFN A;  5LJ5 h;  4M7A D;  2EWN A;  5GAO l;  2ZGW A;  4XU0 A;  3JCM g;  4QVC A;  4JLI A;  4RCC A;  4M75 G;  4M75 F;  2YLB A;  4C92 B;  4M78 A;  4C8Q B;  3SB2 A;  1WPY A;  2DJZ A;  3JB9 D;  5LJ3 j;  2RM4 A;  3RIR A;  2DVE A;  5GAO m;  4EMK C;  3JCM d;  5LJ3 h;  3RER A;  3QUI A;  1BIB A;  1TH7 A;  4XTU A;  5GAM d;  4PJO A;  4M75 A;  4C8Q C;  4XQ3 A;  2YLC A;  4RCB A;  3JCM h;  1Y96 B;  3M4G A;  5GAN 6;  5DY9 A;  1HXD A;  4F7U F;  4F7U G;  3RKY A;  4M7D E;  2EAY A;  4XTX A;  4EMK B;  4F7U E;  5LJ5 j;  3V8L A;  3FJP A;  4M7D F;  4M7D G;  4M7A A;  4J5Y A;  2DZC A;  3JCM V;  5GAO p;  4PJO G;  3INZ A;  4PJO F;  4EMK A;  4XU2 A;  2RB6 A;  4C8Q D;  1N9R A;  4OP0 A;  5GMK i;  4M77 G;  4M77 F;  4M78 D;  3FIF A;  5LJ3 f;  1JRI A;  3SWN C;  3AHU A;  1D3B B;  1LOJ A;  4J6X A;  4C92 E;  1HK9 A;  2DZ9 A;  1KQ2 A;  5GMK j;  5GAM h;  1WQ7 A;  4M7A G;  4M7A F;  1M8V A;  1KQ1 A;  4M75 E;  2E65 A;  3QHS A;  3JCM f;  1D3B A;  4X9D A;  4M75 D;  4A53 A;  4XTV A;  2RD1 A;  4M7A C;  1Y96 A;  5GMK m;  1B34 B;  1H64 1;  2DKG A;  5CAI A;  4HT9 A;  3RES A;  3JB9 G;  5LJ5 f;  3JB9 F;  4M7A E;  4M7A B;  4EMG A;  4XTW A;  4A54 A;  3HSB A;  3JCM W;  1I81 A;  4M7D B;  4PJO C;  5GAN h;  5LJ5 e;  5GAN 7;  4PNO A;  4MMK A;  1BIA A;  3RKX A;  1I4K 1;  4M77 B;  2YHT A;  4MML A;  4F7U A;  5LJ3 g;  2EJ9 A;  4C92 A;  1JBM A;  4PJO B;  5GAN 4;  5GAM e;  2DXU A;  4M7D D;  1N9S A;  4XU1 A;  5GMK l;  3JCM Q;  3GIB A;  2QTX A;  4C92 C;  2FYK A;  4Y91 A;  5GAN 8;  4V2S A;  1B34 A;  4F7U B;  5GAM f;  3V7R A;  4NL2 A;  4PJO D;  4JRI A;  3SWN B;  2DTO A;  4C8Q G;  4C8Q F;  5LJ3 e;  4C92 F;  4C92 G;  5GAO r;  3JCM c;  5LJ5 g;  1I8F A;  2EJF A;  3QO3 A;  4HA8 A;  3JCM b;  3FB9 A;  4M77 C;  3PGG A;  3BW1 A;  2VXE A;  4QVD A;  2HNI A;  5GAN j;  3QSU A;  2DTI A;  5GAN g;  4M78 B;  4C8Q E;  2JN0 A;  4XU3 A;  4M75 B;  2DXT A;  4JUV A;  1YCY A;  3JB9 H;  3BDU A;  1M5Q 1;  5GAN 3;  5LJ3 d;  3JCM J;  1WNL A;  4NL3 A;  5GAO n;  4M77 E;  4N0A C;  4M75 C;  2I2L A;  3VU3 C;  3V7S A;  5GAN d;  3RUX A;  3HFO A;  2E10 A; 
#chains in the Genus database with same CATH topology
 1IO6 A;  2ZPI B;  1KC8 R;  2VKN A;  5LJ5 d;  2QK0 A;  5CKE A;  5GAO q;  3OYB A;  1RAI B;  4HT8 A;  4KH1 B;  1S1N A;  4HXJ A;  4E7Z A;  4F16 A;  5GAN e;  1JB0 E;  2C0T A;  5KYX B;  2O2O A;  1IRX A;  2VC8 A;  2XID A;  3C0C A;  3P8D A;  3QYH B;  2LJ0 A;  4F17 A;  4TVR A;  4BUG A;  4ZNX A;  1H3Z A;  3JCM g;  4QVC A;  2DD4 A;  3M0S A;  4JLI A;  3OYD A;  4M75 G;  4IIO A;  4M78 A;  2HKN A;  2DVE A;  5AYF A;  1E6H A;  3QUI A;  1BIB A;  2YT6 A;  2CZ1 B;  4PJO A;  3WXM B;  2DXC A;  1BKB A;  1VQM T;  3VS0 A;  4F7U G;  3NHN A;  3FJP A;  1RI9 A;  1R77 A;  2DL7 A;  2LP5 A;  4ZGD B;  5GAO p;  1VQK T;  4M4Z A;  3X28 B;  4M77 G;  4RG8 A;  3CC4 Q;  1Q7Y C;  5FW9 A;  3VUB A;  1KQ1 A;  4EDU A;  3OYF A;  1ZA1 B;  1AHJ B;  1U06 A;  2ZPF B;  1G3Y A;  1D1C A;  5HKC A;  1BB9 A;  2K3X A;  1GFC A;  3OB9 A;  3E19 A;  1Y07 A;  1VQP A;  4PNO A;  2JNG A;  3G6E T;  2BTT A;  2JS0 A;  1OI1 A;  2RNA A;  1JBM A;  4PJO B;  3CD6 Q;  2LRQ A;  2J7I A;  5KYW B;  3H0F A;  3IQL A;  2DYI A;  4HCC A;  3CCJ Q;  4ELY C;  4OMQ A;  2DIL A;  3CC4 A;  4C92 G;  3CCU A;  1MV3 A;  5CKB A;  1K73 R;  2PVD B;  1VUB A;  4M77 C;  2CT4 A;  2CZ7 B;  1JJ2 A;  3QSU A;  2M51 A;  4C8Q E;  2D0Q B;  4JUV A;  3OW2 A;  4FYY B;  2K2V A;  5GAO n;  1VQ4 T;  4QQG A;  2I2L A;  2ZPE B;  3V7S A;  3VU3 C;  5GAN d;  1WI7 A;  2O4X A;  2L2P A;  1SHF A;  2GTO A;  3H0I A;  2BE7 D;  3M0P A;  1Q82 C;  2RF0 A;  4AT1 B;  1WHK A;  2WSF E;  2R57 A;  1UFF A;  2WSC E;  5A0L A;  2CH4 W;  4OMF B;  4AG2 C;  3CCE Q;  2XK0 A;  1RUW A;  2E6N A;  2AHJ B;  1NEB A;  5GAN 5;  2EYY A;  1UUE A;  4OB3 B;  1JQQ A;  2R58 A;  3CME A;  2EJG A;  1UE9 A;  6AT1 B;  2Y90 A;  1MND A;  3A5Z B;  1RLP C;  2E12 A;  3CCS Q;  1HJD A;  4JZ3 A;  2ZGW A;  3M0R A;  4FSX A;  3SEM A;  3CCE T;  1O75 A;  3EG9 B;  5I2M A;  1Q81 U;  1QVG A;  2CS7 A;  2H3J A;  1NYF A;  3A8M B;  1RAH B;  2K79 A;  3S3N A;  1G3T A;  5GMK i;  2XDP A;  2D1X A;  4J9D A;  1X6O A;  4J6X A;  4OB2 B;  3HRU A;  3CC7 T;  5GMK j;  1H92 A;  1X69 A;  4C0G A;  3QZ9 B;  3Q1J A;  2K2M A;  4HT9 A;  2V8J A;  1GRI A;  2L3P A;  1WXU A;  2CDT A;  2DBM A;  2A3L A;  5IAY A;  2LCS A;  1EFN A;  1G83 A;  2ED0 A;  3MJX A;  5GAM e;  3G6E Q;  2QGG A;  5GAN 8;  3HTR A;  2BZ8 A;  3EG0 A;  3VJP A;  1GCQ A;  2NYS A;  2LVM A;  1NZ9 A;  4HA8 A;  1VYV A;  3VUZ A;  5C6S A;  2HL5 C;  2KNB B;  1B3Q A;  2L5Q A;  3OA6 A;  1VQ4 Q;  1W2B S;  3URG A;  2HBW A;  4HKE A;  3MKD A;  1JO8 A;  2K3Y A;  3AHU A;  5CKD A;  3HPW A;  1RI0 A;  3A8O B;  1BCM A;  4N0A A;  1UHF A;  2AIR B;  3RMS A;  1JU5 C;  2ZCF B;  2MCN A;  1OEB A;  2RI2 A;  4C0D B;  1YIT A;  4JRK A;  3ULR B;  3JAM E;  3EFS A;  3VS1 A;  1AZG B;  2J05 A;  1QW1 A;  2NUZ A;  3C95 A;  1X01 A;  3HFN A;  5DM7 R;  2EWN A;  2J06 A;  3PTA A;  4RCC A;  2GGR A;  3OBY A;  4BY6 C;  1KD1 U;  2LCC A;  3LWI A;  3GF5 A;  3EGD B;  3CBO A;  1YI2 T;  5GAM d;  2XDD A;  1Q82 U;  1VQ6 Q;  3M4G A;  3X20 B;  1Q86 R;  1QVF A;  1MMA A;  4M7D G;  1ZX6 A;  1YJW Q;  4AFQ C;  3CC2 A;  2LMJ A;  4XU2 A;  2RB6 A;  1VQK A;  1K76 A;  4LDU A;  4CC2 A;  3A8H B;  3TRE A;  3A8L B;  3QJY A;  1VQ9 T;  2E5K A;  4HVV A;  1VQ7 A;  1XNI A;  4J7I A;  4QW2 A;  2H8H A;  5CCA A;  1YI2 Q;  2JVV A;  5CR2 A;  1X2Q A;  1LCK A;  3KBG A;  3NFC A;  1VOM A;  4XTW A;  1QVF P;  4MDX A;  4L5G A;  1LPL A;  1PD0 A;  2KK4 A;  2M16 A;  3ZFJ A;  1OX8 A;  1IGU A;  4JZ4 A;  5LJ3 g;  3OS1 A;  4RTU A;  4AFS C;  2QTX A;  1QQJ A;  3LGL A;  5GAM f;  4C92 F;  2DO3 A;  4N4H A;  3I9Q A;  1DJ7 B;  3X26 B;  3EG9 A;  3OW2 S;  5IHK A;  4CI0 C;  1KD1 R;  3OW2 P;  3QDF A;  3I56 A;  3QKJ A;  4N0A C;  5L8R E;  4E7L A;  2CP2 A;  3M9Q A;  3C4S A;  1JXM A;  3E1S A;  1UHC A;  3NGP A;  3GNG A;  1ZBX A;  3MP1 A;  3EFO A;  2CGH A;  3CCR Q;  3X24 B;  2FZG B;  1MGQ A;  3CCM Q;  5AT1 B;  1E7O A;  3KUF A;  4EMH A;  3CD6 A;  1QCF A;  2DTH A;  3LWH A;  1QP2 A;  2EKH A;  4M78 F;  2ATC B;  2W0Z A;  3M0U A;  2PUO B;  2CP0 A;  1I1J A;  2LJ1 A;  2GQV A;  1TS9 A;  1MMD A;  2YRD A;  1QWF A;  3CCE A;  1WHJ A;  4FCY A;  4EMK C;  2JXB A;  3CCR T;  1MNE A;  4M75 A;  3UPU A;  1M2O A;  4JLG A;  5CKF A;  1OOT A;  2LQN A;  2EAY A;  4XTX A;  5LJ5 j;  1RAC B;  2J6O A;  3CBM A;  1FMW A;  4PJO G;  4LD9 K;  4MDW A;  1U8R A;  2CP5 A;  4Z89 A;  2X4J A;  5GAM h;  1YIT Q;  8AT1 B;  2I0N A;  5FU6 C;  2RD1 A;  2A28 A;  4CC4 B;  1XJW B;  4PLL A;  3VYG A;  3EGD A;  4JJB A;  4IIM A;  2ED1 A;  3CBP A;  4RTV A;  1NJI U;  4XAX B;  4QT7 A;  5M9O A;  5GMK l;  2GQI A;  2CKK A;  4JJN K;  4A4H A;  4HCZ A;  2DTO A;  4C8Q G;  2DBK A;  2ZPB B;  3OYK A;  2DA9 A;  4GY5 A;  1Q81 R;  3PNW C;  2OTJ T;  2Z0W A;  3OMG A;  2F2W A;  1KK7 A;  5GAN g;  3CCM A;  1QKW A;  1M5Q 1;  5LJ3 d;  3UWN A;  1WX6 A;  2KQW A;  1M1K R;  3UDC A;  2KEA A;  1VQ7 T;  3S3O A;  2QEX A;  1VQ8 A;  2ENM A;  1PKS A;  1MHN A;  1JXO A;  2PVO B;  4L59 A;  5C0M A;  2QAS A;  5GMK e;  3VKI A;  4M7D C;  2JT4 A;  2OTJ Q;  4WTO B;  1WFW A;  3P8B B;  2WSE E;  1U1S A;  1WA7 A;  2VVK A;  4J6W A;  2EQM A;  2F5T X;  4X34 A;  3OYJ A;  1OQK A;  1VYT A;  2COY A;  5IXB A;  4XK8 E;  1GBQ A;  1ABQ A;  2HDA A;  1OPL A;  5J39 A;  4IUP A;  2QDY B;  2YLB A;  1VQM A;  3L2Q A;  2M9U A;  2O88 A;  2RM4 A;  2P0Q A;  2ZAE A;  3RIR A;  4C0F A;  4LDW A;  2LJ3 A;  3AT1 B;  2K5I A;  5DY9 A;  4M7D F;  2JOY A;  4MZM A;  2JUF A;  4IUQ A;  1N9R A;  2L3Q A;  2L8D A;  1N27 A;  5LJ3 f;  1JRI A;  1AWJ A;  3H8Z A;  2P0K A;  5DLO A;  1VQM Q;  3R6O A;  4J7F A;  3HRS A;  3G71 Q;  2DF6 A;  3QYG B;  2JS2 A;  4M7A E;  2JM8 A;  4J9I A;  3JCM W;  2YWW A;  3M58 A;  1PM3 A;  5LJ5 e;  1I4K 1;  3CEY A;  3ER0 A;  3SHW A;  4ZN1 A;  1FXX A;  1D09 B;  2EGE A;  2K7A A;  5KE3 A;  3EFO B;  1YIJ A;  1VQO A;  3OS0 A;  2FZK B;  2M0O A;  4JRI A;  3O5Z A;  3QJ6 A;  5LJ5 g;  2EJF A;  4FYX B;  5CIU A;  2F2X A;  2ROL A;  3G7Z A;  1AZE A;  1K9M R;  2GBQ A;  5CK9 A;  1VQN T;  2HQH A;  1UGQ B;  2PNI A;  4PJL A;  1PRL C;  1AT1 B;  2DLP A;  4PJJ A;  4KRT A;  2OX7 A;  2KDS A;  1YBY A;  3NTH A;  2KT8 A;  3MHX A;  3CCJ A;  3L2V A;  3CCS A;  4WCI A;  4PFZ A;  1BBZ A;  2FVU A;  1VQP Q;  1YIT T;  4EPC A;  3GLX A;  2JTE A;  1V76 A;  1BYM A;  2F2V A;  2NLU A;  1KC8 U;  4ZGE B;  4B6M A;  4BDY A;  4FT4 A;  2RQR A;  3SWN A;  2PVG B;  5FRN A;  1K9M U;  4DQ2 A;  2DEQ A;  2K4Y A;  1N6A A;  4C8Q B;  4HCB A;  3ME9 A;  1U5S A;  2DJZ A;  2YUQ A;  3G4S T;  1M90 R;  3VRY A;  3X25 B;  4KUD K;  1G8X A;  1UJ0 A;  2JMA A;  1SPK A;  4JJC A;  2C0O A;  2AZV A;  1GL5 A;  2YSQ A;  2QEX Q;  4OB0 B;  2LQW A;  1HD3 A;  3VS7 A;  3OYM A;  2VGM A;  3JCM V;  4PJO F;  1IXD A;  4LXC A;  4OMN A;  2OTL Q;  4C5I A;  2MOX A;  4ANJ A;  1HK9 A;  1KQ2 A;  4LDY A;  2QQ9 A;  2EQU A;  1M8V A;  2DPP B;  2G3R A;  4D8D A;  2EQK A;  2ZPG B;  2W10 A;  1B34 B;  2DKG A;  1SHG A;  4KGV B;  4PFO A;  1ZUU A;  4E7K A;  1KHC A;  1LVK A;  3R6N A;  2B86 A;  5GJV B;  1NBE B;  1T0J A;  1Q86 C;  4GBQ A;  2GFA A;  3V7R A;  4C5E A;  5L23 A;  2QQA A;  1X43 A;  2X35 A;  1K0X A;  3JCM c;  4DA4 A;  3RR6 A;  1VQO Q;  2MIO A;  1MMN A;  1QP3 A;  4QVD A;  1C1A A;  3E2U A;  3E9F A;  3OSV A;  1M2V B;  2DXT A;  2X4W A;  2DIG A;  3FJ5 A;  4QQ6 A;  2VWF A;  2BZY A;  3M55 A;  2E10 A;  2HSP A;  3JCM P;  5D6X A;  2BKD N;  1LNX A;  2LT4 A;  5CVI A;  2CH4 A;  3CC2 T;  1ZQ1 A;  2DE0 X;  2QQB A;  1BCO A;  1ACM B;  1EIF A;  1FMK A;  4OVA A;  2AZS A;  3J7A F;  3GNF B;  2GTJ A;  1QVG S;  3EGX B;  4M78 C;  2MYS A;  5IT9 E;  3FRN A;  4XTY A;  4CRI A;  4NS5 A;  4DOW A;  4E7H A;  4Z88 A;  2LQ8 A;  2XHC A;  4RTY A;  3OYA A;  1TXQ A;  4PKC C;  4FYV B;  3VV0 A;  2A36 A;  3I55 Q;  4PJN A;  2LCL A;  3SFM A;  3LH5 A;  4BE2 A;  4KT0 E;  1NPP A;  3DB4 A;  3UT1 A;  1TH7 A;  4B9X A;  2KVQ G;  3JCM h;  4JPB W;  1Y96 B;  1X6G A;  3CMA Q;  1Q7Y R;  1CKB A;  1Y57 A;  3L2R A;  5HY6 A;  3CXC P;  3QWY A;  1C0M A;  2RHU A;  2FPF A;  2J6F A;  4AMC A;  3I56 Q;  2F5K A;  1KD1 C;  4JJD A;  1GCQ C;  4A4F A;  4IUV A;  4HVU A;  4M75 E;  3QHS A;  1RLQ C;  1SSH A;  4BAC A;  1VQL Q;  2M02 A;  1C6V X;  1KJW A;  3RMQ A;  3J80 E;  5HCK A;  2X51 A;  4UC4 A;  4A54 A;  1GCP A;  1H8K A;  4M7D B;  2RO0 A;  3EAE A;  3VS2 A;  1VQ5 T;  1ZA2 B;  3CD6 T;  1VQO T;  2IIM A;  1VIE A;  4BB7 A;  2GCX A;  3PGG A;  1ZHI A;  2KXD A;  2O9S A;  5IHI A;  3OYC A;  3G1J A;  5IN1 A;  2XDB A;  2QEX T;  3OYH A;  3OBW A;  1WNL A;  5KYN A;  1M90 U;  2DMO A;  1WDX A;  1D1A A;  2AKK A;  2XKO C;  4VUB A;  3S6W A;  3I55 T;  2IG0 A;  4II1 A;  4BE1 A;  1M3A A;  1PWT A;  1X27 A;  4PL6 A;  3RDV A;  3E9G A;  2P4R A;  1ZSZ B;  2MK5 A;  3MP6 A;  3UAT A;  2DXB A;  1Y71 A;  1NM7 A;  1WQW A;  3JCM X;  2IPO B;  5FU7 B;  4M77 D;  4N4G A;  2JW4 A;  2SRC A;  4M77 A;  1W6X A;  2JMC A;  2EVR A;  1PC0 A;  3EGU A;  1T3L A;  3G4S Q;  2L3S A;  4OGC A;  5ECA A;  3VYH B;  5LL6 S;  2CSI A;  1TWB A;  1X2K A;  1KQS S;  5I2S A;  3CMA T;  2YLC A;  4RCB A;  2P0P A;  3UA7 A;  4EMK B;  1M90 C;  3D7S B;  3I55 A;  2RQT A;  4ATO A;  1D1B A;  1EZZ B;  1LOJ A;  1ZLM A;  2DZ9 A;  1M27 C;  1QWE A;  3M5A A;  1WIE A;  2NUP B;  1M2V A;  2KBT A;  1Z9Z A;  3H9N A;  1QCO A;  2QQR A;  2AT1 B;  1YJ9 A;  3EG1 A;  5HK3 A;  1PKT A;  5GAN 7;  1PD1 A;  2FO0 A;  3OYG A;  1VQN Q;  1E6G A;  3O8V A;  4FSS A;  2QA4 T;  3VRZ A;  5CO7 A;  4GLM A;  1YHQ Q;  2DK3 A;  1Q86 U;  1SF9 A;  5J26 A;  2HEQ A;  1KC8 C;  3CCJ T;  1RAD B;  4NL3 A;  1W70 A;  1W1F A;  2DL8 A;  3CCL T;  1K9M C;  3RUX A;  4A4K A;  1RAE B;  4NOY A;  2K6D A;  4P5N A;  1W2B A;  2D8H A;  1J3T A;  2RQU A;  5GMK h;  3G71 T;  4J6Y A;  4DBF A;  2E4H A;  2JZ2 A;  3OSS C;  3T9N A;  2G6F X;  4BI4 A;  1VQK Q;  3G4S A;  2OJ2 A;  1G5V A;  5GAO l;  1CKA A;  3L2U A;  2DAQ A;  4LNP A;  3GBQ A;  3J81 E;  4C92 B;  2LDM A;  1SSF A;  2QDL A;  2OTL T;  2HCK A;  5GAO m;  4C5H A;  1OV3 A;  2KMT A;  1G3W A;  1N8R U;  4JRQ A;  2L0A A;  2P4T A;  8ATC B;  4M7D E;  1K8A U;  2JM9 A;  2X4X A;  2V8K A;  1K1Z A;  3THK A;  1I5O B;  4LE9 A;  3VS6 A;  4C8Q D;  1WHH A;  2HQE A;  1FWZ A;  1VQ9 Q;  5EG2 A;  1ARK A;  1QCN A;  3JCM f;  3JRZ A;  1KIK A;  4HVW A;  1KFZ A;  5KYY A;  1M1K C;  4A4G A;  1YFN A;  1SKU B;  4EIK A;  2F1L A;  4EMG A;  3KXT A;  2RJF A;  3U23 A;  3SD4 A;  4MMK A;  2ABL A;  5IHN A;  4RKU E;  3EG3 A;  3CME T;  2QGF B;  5KCH A;  2WAC A;  1YP5 A;  4XU1 A;  4C92 C;  1NE8 A;  3SWN B;  4RTZ A;  2DX1 A;  4PLI A;  2HD0 A;  2YDL A;  3QXE B;  2LZ6 B;  3OQ5 A;  2J6K A;  1BU1 A;  1K73 C;  3JB9 H;  4BY6 B;  2LX9 A;  2CUD A;  2C0I A;  3QG1 A;  2QAZ A;  2EYZ A;  1OZ2 A;  5GAN 2;  4WF2 A;  3PE0 A;  3MCA B;  2LNV A;  3M56 A;  4IKF A;  3RKW A;  3H41 A;  1VQP T;  4F14 A;  1M1F A;  3L1A A;  1AWO A;  3NMZ C;  4LUE A;  4QVZ A;  1U1T A;  3EGX A;  2DRK A;  4M7D A;  4FYW B;  4E7S A;  4LUD A;  2QA4 A;  3G71 A;  1TOV A;  4LDV A;  4D8K A;  1OZ3 A;  3OYI A;  4ZTJ A;  3UF4 A;  2O31 A;  3PIO A;  4M7A D;  2V1R A;  2KYB A;  4KH0 B;  2EW3 A;  4XU0 A;  2GFU A;  1WXT A;  1TU0 B;  5FU6 B;  4KGZ B;  3JB9 D;  3CXC S;  4J9C A;  1YN8 A;  4C0D C;  2KT1 A;  1R0B G;  3OY9 A;  4C8Q C;  3REB B;  2FRW A;  2O4X B;  2CZ6 B;  1V1C A;  3MPU B;  2EGA A;  4J5Y A;  2DZC A;  1GBR A;  2F69 A;  3ZEH A;  3MEW A;  4DOV A;  2QA4 Q;  1ZUY A;  1YJW A;  1WQ7 A;  2ESW A;  2BUD A;  2E65 A;  1OYX A;  4M75 D;  4XTV A;  9ATC B;  3RES A;  5LJ5 f;  4N4I A;  2E3H A;  1YCS B;  3NPF A;  1IHV A;  2EQI A;  4AFZ C;  2ROT A;  5GAN h;  3RKX A;  4O6J A;  4CC3 A;  4J9H A;  1AWX A;  4F7U A;  1N8R C;  2FYK A;  4Y91 A;  2EGC A;  1X75 C;  4NL2 A;  1KHI A;  4C8Q F;  5LJ3 e;  4YTL A;  2P84 A;  2VGN A;  1S72 T;  1VQ7 Q;  1BK2 A;  2HSE B;  4QQD A;  3M4Y A;  2QXF A;  2VXE A;  3ZL7 C;  3HL8 A;  4XU3 A;  1S72 A;  3BDU A;  1WJR A;  1JJ2 P;  4KUL A;  1RAB B;  2L3R A;  1I5L A;  1NLO C;  2EPD A;  1NEG A;  2KYM A;  1KG1 A;  3M57 A;  1OU8 A;  2HAX A;  5IXF A;  4M78 E;  5I21 A;  1AOJ A;  3EFR A;  1KQS A;  2HMA A;  4BI8 B;  5GAN f;  2E41 A;  4FW2 A;  1Z9Q A;  4OGE A;  2RMO A;  5LJ5 h;  3CCQ Q;  1MV0 B;  2LX7 A;  4J9G A;  3SB2 A;  1YJN A;  2E6Z A;  1UEC A;  1MUZ A;  3H6Z A;  1WHL A;  2LQK A;  2DL3 A;  2MMP A;  4KUI A;  1VYU A;  4OMP A;  4F7U F;  1V29 B;  4F7U E;  1W4S A;  2RK2 A;  2V8I A;  3I56 T;  2CP7 A;  2HZY A;  1JJ2 S;  4OML A;  1AWW A;  4M77 F;  2E70 A;  1PNJ A;  1OU9 A;  2RHZ A;  1D3B B;  2NWM A;  4C92 E;  2KAF A;  3WVD B;  1UGR B;  5A2Q E;  3ZBD A;  3TEE A;  2RJC A;  3I5S A;  4X9D A;  1M9S A;  1M3B A;  4IUT A;  3CXC A;  3UA6 A;  2D8J A;  1SRM A;  2BIV A;  3EH1 A;  2Y4X A;  3G6E A;  1WYX A;  1UB4 A;  2JTM A;  2EJ9 A;  2LC4 A;  1QVG P;  2PU9 B;  3VS4 A;  5CQX A;  3CQT A;  3CCQ T;  3TSZ A;  1QVP A;  4AFU C;  1VQL A;  3M54 A;  2DFU A;  5KYX A;  4V2S A;  1Q7Y U;  3CME Q;  1T0H A;  2MWO A;  4FM4 B;  2KR3 A;  2A0F B;  5KYU B;  3C12 A;  1XTD A;  2K5F A;  2KI7 A;  2HNI A;  2DTI A;  1UG1 A;  4CC7 A;  2MAM A;  3OYL A;  1JEG A;  3JCM J;  1D0X A;  1T3S A;  2NUT A;  1N5Z A;  2A7Y A;  1K9A A;  5A0D A;  4ZTF A;  2E1H A;  2RJD A;  4DBH A;  3GOX A;  2FB7 A;  3FDR A;  3DB3 A;  1YHQ T;  2QG9 B;  2EYQ A;  4Z8A A;  2A08 A;  3CC7 Q;  1PCX A;  3CPW P;  3L2W A;  2E64 A;  2RPN A;  5A0G A;  3PMT A;  3JB9 J;  5HK0 A;  4LDX A;  1OPK A;  4X9C A;  3L2Z A;  5CQY A;  4IUU A;  3GP8 A;  2XU8 A;  4BD3 A;  1SEM A;  4GLK A;  4JS5 A;  3A8G B;  2VV5 A;  3CC2 Q;  2RA2 A;  3CCR A;  4DBQ A;  2DIQ A;  3PFS A;  5J3B A;  2EYW A;  3PT9 A;  5I11 A;  1VQ6 A;  2XD0 A;  3JV3 A;  2D0N A;  2VUB A;  2LT1 A;  1QVF S;  3RER A;  3PVL A;  4XTU A;  1WZO A;  1RAF B;  1WJQ A;  1K0S A;  3QBY A;  3V8L A;  2DJQ A;  1EX4 A;  3P8H A;  4M7A A;  4EMK A;  2Y4Y A;  2X3X D;  4A4E A;  4A63 B;  3WVE B;  3CCL A;  1VQ8 Q;  2D6F A;  1H64 1;  2KGT A;  4E2F B;  1PSF A;  1M1G A;  1K8A R;  3RNJ A;  4M77 B;  4R56 A;  4MML A;  5GAN 4;  2FPD A;  2A37 A;  1WLP B;  2YRV A;  1N9S A;  5I22 A;  2V1Q A;  4F7U B;  2RHY A;  3LGF A;  2CP3 A;  2M1H A;  2OTL A;  1VQL T;  1I0C A;  3TQ7 P;  4FT2 A;  3HHT B;  1YWP A;  2BZX A;  4M78 B;  2JN0 A;  2RQV A;  4M75 B;  3LH0 A;  5IH2 A;  4MZT A;  2E3I A;  1BI1 A;  2QQS A;  1I8F A;  1XOV A;  1R8O B;  3M53 A;  5KE2 A;  1HYO A;  2RK1 A;  3CCL Q;  7AT1 B;  1AVZ C;  2KE9 A;  1D0Z A;  2EKO A;  1YJ9 T;  4OB1 B;  1O9S A;  4ELZ C;  1NYG A;  3EHQ A;  4C92 D;  3A98 A;  1YHQ A;  2KRM A;  2HQX A;  4K11 A;  1UGV A;  1ZSG A;  3CPW S;  4OMM A;  1WXB A;  3JCM e;  1TSF A;  1D0Y A;  1BI3 A;  4F04 B;  2CYZ B;  5LJ3 j;  2MPX C;  5DLQ E;  2SEM A;  1TUD A;  1YI2 A;  1PG5 B;  2YRC A;  1M4Z A;  4KGX B;  2GF7 A;  3PVQ A;  5KH6 A;  4JS4 A;  1SG5 A;  2QTV A;  4E47 A;  1Y0M A;  4FW1 A;  4OP0 A;  2CZ0 B;  1ZUK A;  4M78 D;  4RG2 A;  1AEY A;  2DVJ A;  3PMI A;  4M7A F;  1KSW A;  2DEU A;  1WJS A;  2OAU A;  1K8A C;  2IVW A;  1U3O A;  1UGS B;  2AKL A;  4BI3 A;  4M7A C;  2FRY A;  2YUO A;  2OI3 A;  2NUP A;  1N8R R;  3JB9 F;  1I81 A;  2CSQ A;  3VS3 A;  3OS5 A;  2OAW A;  1FX7 A;  3CCQ A;  1RL2 A;  2M0Y A;  4LN2 A;  3DLL A;  1B34 A;  2CP6 A;  1CSK A;  2COZ A;  5GJW B;  2XIC A;  1W2B P;  2VAS A;  3VS5 A;  3QO3 A;  4BDZ A;  3JCM b;  3QDR B;  2RN8 A;  2JJ9 A;  3EHR A;  2R5A A;  3LYI A;  4L6V 5;  2HKQ B;  2RHI A;  1WGS A;  2RI3 A;  5GAN 3;  4M75 C;  1IRE B;  4C5G A;  2CUB A;  3QII A;  4LD6 A;  4J9F A;  4J8O A;  3CCU Q;  1WHM A;  4ESR A;  1M30 A;  2MI6 A;  2VXF A;  3DKM A;  1IGQ A;  3EG2 A;  1RAA B;  1ABO A;  1ZSZ A;  4C8Q A;  2GNC A;  4X1V A;  3FC3 A;  3S3M A;  2H3E B;  2X9H A;  2EYX A;  3TCJ A;  3MP8 A;  4ORZ A;  2VYT A;  1B7T A;  4XTZ A;  1UJY A;  4JDS A;  4M78 G;  3JB9 I;  3H0H A;  2FEI A;  4IUR A;  1M1K U;  3F70 A;  2FPE A;  3CCM T;  1SRL A;  2FZC B;  5D6W A;  2XG8 D;  2LNH B;  1NG2 A;  1AD5 A;  2RJE A;  5FWB A;  5FWC A;  4RTX A;  1IHW A;  2YXY A;  4XQ3 A;  3MEA A;  4J83 A;  4Y28 E;  2PZ1 A;  3MET A;  3GPL A;  2PUK B;  1M8M A;  4HCK A;  2QI2 A;  3INZ A;  1UEB A;  1NJI R;  1TUG B;  2DD5 A;  2EQJ A;  1IB8 A;  3MEV A;  2BE9 B;  4E7J A;  3MO8 A;  1TTH B;  1RAG B;  3HRT A;  5GMK m;  4Y92 A;  2RI5 A;  1P92 A;  4M7A B;  3N5B B;  3JSC A;  3HSB A;  2KY9 A;  1I07 A;  2R5M A;  2CT3 A;  4C92 A;  3SDZ A;  1TUC A;  1PRM C;  2EIF A;  4M7D D;  3JCM Q;  3CPW A;  2D9T A;  1YWO A;  1B07 A;  4RUG A;  1G2B A;  3DLM A;  1YIJ Q;  3FB9 A;  2KRS A;  3LW5 E;  2ECZ A;  1YCY A;  4RTW A;  1Q82 R;  3HKS A;  4ZN3 A;  3M0T A;  1YJW T;  2O9V A;  2QYZ A;  4M77 E;  1X6B A;  1OUL A;  2ZPH B;  1XQH A;  4R55 A;  3CMA A;  3BFM A;  1VQN A;  1BI0 A;  2K57 A;  5GAM j;  5GAM g;  3NTI A;  2YUP A;  3MEU A;  1LJO A;  1QMC A;  3NTK A;  4J9B A;  1YJ9 Q;  2DRM A;  3OYE A;  2NUT B;  1GFD A;  3V7C A;  3I35 A;  2X3W D;  2HBP A;  1UTI A;  1UGP B;  1YJN T;  3BY7 A;  4O5V A;  1OX9 A;  4M75 F;  5D6Y A;  2DYB A;  2KRN A;  3JCM d;  3QZ5 B;  2X4Y A;  4OF1 A;  5EC7 A;  2FL7 A;  4ME7 A;  1MMG A;  3QWX X;  3ASK A;  5D7U A;  5FRM A;  5GAN 6;  1Y7X A;  1R0C B;  4PK4 A;  3OMC A;  2OTJ A;  1YJN Q;  1K4U S;  4MZP A;  4E6R A;  4J9E A;  1BI2 A;  3FIF A;  3SWN C;  2K3B A;  3QPH A;  5KCO A;  4M7A G;  1D3B A;  2HL3 A;  3FEO A;  2KXC A;  3I5R A;  4A53 A;  1FYN A;  4DEX A;  4D6W A;  3JB9 G;  1TG0 A;  3TSW A;  4ZGJ B;  1VQ5 A;  1GXI E;  4E7I A;  5KYY B;  4FIB A;  2V26 A;  2KSS A;  5FRO A;  1QLY A;  3GIB A;  1A0N B;  3CCV Q;  1WHG A;  4RTT A;  1YIJ T;  4PJO D;  5GAO r;  1Q95 G;  1H3H A;  2MF2 A;  1S72 Q;  5GAN j;  4RMO A;  2RQW A;  1F1B B;  1ZBJ A;  2XI9 A;  1VQ6 T;  2EFI A;  2O01 E;  4JRP A;  1FMV A;  2PTK A;  3EH2 A;  2B8A A;  1VQ4 A;  4PJM A;  3HFO A;  1VQ9 A;  2K9G A;  2ZZD A;  2PQW A;  3CCV T;  3CCS T;  1G3S A;  5KYW A;  1IZ6 A;  3BDL A;  3V8K A;  2LTO A;  4PJO E;  1PSE A;  2C06 A;  4DEY A;  4KBM B;  2DL4 A;  3V8J A;  4QKU A;  4Q5W A;  2YUN A;  3CPF A;  3M0Q A;  4C0Z A;  2K5L A;  4PFP A;  1YNZ A;  1K73 U;  2FHD A;  4FL6 A;  1WPY A;  5CKH A;  2KRO A;  1VIF A;  3LLR A;  2XMF A;  3LX7 A;  5LJ3 h;  3FLG A;  3TU4 K;  2DL5 A;  2E5Q A;  4BE0 A;  3C94 A;  1UDL A;  3RBB B;  1HXD A;  3RKY A;  2COW A;  5FLX E;  1NPR A;  2FG0 A;  4R0K A;  4FU6 A;  4DBR A;  2L89 A;  1Q81 C;  2EBP A;  1NLP C;  1VA7 A;  3OYY A;  1PHT A;  1VQ8 T;  2DNU A;  2RH2 A;  3CC7 A;  5KYU A;  2RHX A;  3CCV A;  1NJI C;  1Y96 A;  5CAI A;  3HP9 A;  3A1P A;  3M59 A;  1M3C A;  3TVT A;  4OMO A;  4PJO C;  1VQ5 Q;  1BIA A;  2YHT A;  3CCU T;  4B9W A;  4Z02 A;  3PIP A;  3REA B;  2DXU A;  4AG1 C;  3OS2 A;  2CRE A;  3KFV A;  3CC4 T;  2DM1 A;  2VB6 A;  3L42 A;  1QKX A;  2AK5 A;  2DER A;  2JTF A;  3BW1 A;  3BE3 A;  2DET A;  1KQS P;  1ZSZ C;  3OYN A;  2MWP A;  1HSQ A;  5FU7 C; 
#chains in the Genus database with same CATH homology
 1XOV A;  1VQ7 T;  1R8O B;  3M53 A;  4A4K A;  3S3O A;  2QEX A;  5KE2 A;  2ZPI B;  4NOY A;  1VQ8 A;  2RK1 A;  4P5N A;  1W2B A;  1MHN A;  5LJ5 d;  2PVO B;  5CKE A;  5GAO q;  3OYB A;  4HT8 A;  4L59 A;  2EKO A;  1YJ9 T;  5GMK h;  5C0M A;  5GMK e;  4OB1 B;  1O9S A;  3VKI A;  4ELZ C;  3G71 T;  4M7D C;  4J6Y A;  4C92 D;  5GAN e;  2JZ2 A;  1YHQ A;  3OSS C;  1JB0 E;  3P8B B;  2WSE E;  1U1S A;  4J6W A;  2EQM A;  2F5T X;  3T9N A;  2HQX A;  4X34 A;  3OYJ A;  2VC8 A;  2XID A;  3P8D A;  4XK8 E;  4BI4 A;  3CPW S;  3G4S A;  3JCM e;  3QYH B;  5J39 A;  4TVR A;  4IUP A;  4BUG A;  1G5V A;  5GAO l;  3L2U A;  1H3Z A;  1BI3 A;  2QDY B;  2DAQ A;  3JCM g;  2DD4 A;  4QVC A;  4JLI A;  3OYD A;  4M75 G;  2YLB A;  3J81 E;  4C92 B;  2LDM A;  1SSF A;  4M78 A;  1VQM A;  2OTL T;  2CYZ B;  3L2Q A;  2M9U A;  5LJ3 j;  2RM4 A;  2P0Q A;  5DLQ E;  3RIR A;  2DVE A;  4C0F A;  5GAO m;  4C5H A;  1YI2 A;  5AYF A;  3QUI A;  1BIB A;  2KMT A;  1G3W A;  1M4Z A;  2CZ1 B;  4LDW A;  1N8R U;  4JRQ A;  2P4T A;  3WXM B;  4PJO A;  2DXC A;  2GF7 A;  2K5I A;  1BKB A;  5KH6 A;  1VQM T;  4JS4 A;  5DY9 A;  4F7U G;  4M7D E;  4M7D F;  2JOY A;  4MZM A;  1K8A U;  3FJP A;  2X4X A;  2V8K A;  2JUF A;  4IUQ A;  4ZGD B;  5GAO p;  1VQK T;  4E47 A;  4C8Q D;  1N9R A;  4OP0 A;  2CZ0 B;  4M77 G;  2HQE A;  2L8D A;  1FWZ A;  1N27 A;  3X28 B;  4RG8 A;  4M78 D;  4RG2 A;  5LJ3 f;  1JRI A;  1Q7Y C;  3VUB A;  3PMI A;  5EG2 A;  4M7A F;  1WJS A;  3H8Z A;  1KQ1 A;  2OAU A;  2IVW A;  2P0K A;  1UGS B;  3JCM f;  4BI3 A;  4EDU A;  3JRZ A;  3R6O A;  5DLO A;  4J7F A;  3OYF A;  3HRS A;  4M7A C;  1M1K C;  1AHJ B;  3QYG B;  4A4G A;  2ZPF B;  1G3Y A;  5HKC A;  3JB9 F;  4M7A E;  4EMG A;  2K3X A;  3OB9 A;  3E19 A;  3KXT A;  1Y07 A;  3M58 A;  3JCM W;  1I81 A;  2RJF A;  1VQP A;  5LJ5 e;  3SD4 A;  4PNO A;  2JNG A;  4MMK A;  3G6E T;  1I4K 1;  1OI1 A;  3OS5 A;  4RKU E;  1JBM A;  3CEY A;  3ER0 A;  3CME T;  1FX7 A;  4PJO B;  5KCH A;  2WAC A;  3CCQ A;  1RL2 A;  2LRQ A;  1FXX A;  4ZN1 A;  4XU1 A;  4C92 C;  5KE3 A;  4HCC A;  3DLL A;  1YIJ A;  1B34 A;  1NE8 A;  4ELY C;  1VQO A;  3OS0 A;  2M0O A;  4JRI A;  3SWN B;  3CC4 A;  4C92 G;  2XIC A;  3CCU A;  4PLI A;  5CKB A;  2PVD B;  3QJ6 A;  5LJ5 g;  2EJF A;  3QO3 A;  3JCM b;  4BDZ A;  1VUB A;  3QDR B;  4M77 C;  5CIU A;  2CZ7 B;  2HD0 A;  3G7Z A;  3QXE B;  1JJ2 A;  3QSU A;  2R5A A;  3OQ5 A;  3LYI A;  4L6V 5;  4C8Q E;  2D0Q B;  2RHI A;  4JUV A;  1WGS A;  2RI3 A;  5GAN 3;  3OW2 A;  5CK9 A;  1K73 C;  1VQN T;  3JB9 H;  2K2V A;  1UGQ B;  5GAO n;  4BY6 B;  4M75 C;  2LX9 A;  1VQ4 T;  1IRE B;  4QQG A;  2I2L A;  4C5G A;  2ZPE B;  3V7S A;  3VU3 C;  3QII A;  3QG1 A;  4LD6 A;  2KDS A;  5GAN d;  4J8O A;  2O4X A;  1YBY A;  3NTH A;  1OZ2 A;  5GAN 2;  4WF2 A;  3MHX A;  1Q82 C;  2MI6 A;  2VXF A;  3MCA B;  3DKM A;  2LNV A;  3CCJ A;  3M56 A;  4IKF A;  3RKW A;  3L2V A;  1VQP T;  2WSF E;  3CCS A;  2R57 A;  4C8Q A;  2WSC E;  1M1F A;  3L1A A;  4OMF B;  5A0L A;  3FC3 A;  3S3M A;  4QVZ A;  1U1T A;  2FVU A;  1YIT T;  2XK0 A;  4EPC A;  3TCJ A;  3GLX A;  3MP8 A;  2E6N A;  4M7D A;  2AHJ B;  2VYT A;  1BYM A;  5GAN 5;  2NLU A;  1KC8 U;  4XTZ A;  4ZGE B;  2QA4 A;  3G71 A;  4BDY A;  4JDS A;  4FT4 A;  4LDV A;  2R58 A;  4M78 G;  4OB3 B;  2EJG A;  3JB9 I;  3CME A;  3SWN A;  1OZ3 A;  2PVG B;  2Y90 A;  3OYI A;  4ZTJ A;  1K9M U;  4DQ2 A;  5FRN A;  2DEQ A;  3PIO A;  3A5Z B;  4IUR A;  1M1K U;  4M7A D;  2K4Y A;  2E12 A;  2ZGW A;  3F70 A;  4FSX A;  4XU0 A;  2GFU A;  3CCM T;  5D6W A;  1N6A A;  2XG8 D;  4C8Q B;  3CCE T;  4HCB A;  3ME9 A;  5FU6 B;  2DJZ A;  2RJE A;  3G4S T;  3JB9 D;  1O75 A;  3CXC S;  5I2M A;  3X25 B;  1Q81 U;  4KUD K;  1QVG A;  2CS7 A;  2H3J A;  4C0D C;  3OY9 A;  4C8Q C;  4XQ3 A;  2O4X B;  2CZ6 B;  3MEA A;  4J83 A;  4Y28 E;  4OB0 B;  3A8M B;  3MET A;  3GPL A;  3S3N A;  2PUK B;  2VGM A;  3OYM A;  4J5Y A;  2DZC A;  3JCM V;  2F69 A;  2QI2 A;  3INZ A;  1UEB A;  4PJO F;  3ZEH A;  1G3T A;  2DD5 A;  5GMK i;  3MEW A;  2XDP A;  4DOV A;  1X6O A;  4C5I A;  4J6X A;  1YJW A;  1HK9 A;  2EQJ A;  3HRU A;  3MEV A;  4OB2 B;  1KQ2 A;  4LDY A;  2QQ9 A;  5GMK j;  1WQ7 A;  2EQU A;  3CC7 T;  2DPP B;  2BUD A;  4E7J A;  2E65 A;  3MO8 A;  2G3R A;  1M8V A;  4C0G A;  2EQK A;  1OYX A;  2ZPG B;  3QZ9 B;  3Q1J A;  4M75 D;  4XTV A;  3HRT A;  5GMK m;  1B34 B;  2DKG A;  4HT9 A;  2RI5 A;  3RES A;  5LJ5 f;  1P92 A;  4N4I A;  2V8J A;  4M7A B;  3N5B B;  3JSC A;  3HSB A;  2KY9 A;  2A3L A;  4E7K A;  5GAN h;  1KHC A;  5IAY A;  2R5M A;  3RKX A;  4O6J A;  4F7U A;  4C92 A;  3SDZ A;  5GAM e;  2EIF A;  1N8R C;  4M7D D;  3JCM Q;  1Q86 C;  3CPW A;  2FYK A;  4Y91 A;  5GAN 8;  3VJP A;  2D9T A;  2GFA A;  1X75 C;  4NL2 A;  1KHI A;  3V7R A;  4C5E A;  4C8Q F;  2QQA A;  5LJ3 e;  4YTL A;  2X35 A;  2VGN A;  3JCM c;  4DA4 A;  1S72 T;  2LVM A;  1NZ9 A;  4HA8 A;  3DLM A;  4QQD A;  3FB9 A;  3M4Y A;  2QXF A;  3VUZ A;  1QP3 A;  5C6S A;  2VXE A;  4QVD A;  3E9F A;  3HL8 A;  3LW5 E;  3OSV A;  2L5Q A;  4XU3 A;  2DXT A;  1YCY A;  3OA6 A;  3BDU A;  3HKS A;  4ZN3 A;  1S72 A;  2X4W A;  2DIG A;  1YJW T;  1W2B S;  4M77 E;  1WJR A;  4QQ6 A;  3URG A;  4HKE A;  2ZPH B;  1XQH A;  3M55 A;  4KUL A;  2K3Y A;  2E10 A;  3AHU A;  4R55 A;  2L3R A;  3CMA A;  3JCM P;  5CKD A;  3HPW A;  1I5L A;  1RI0 A;  3A8O B;  3BFM A;  5D6X A;  2BKD N;  1LNX A;  4N0A A;  1VQN A;  2LT4 A;  5CVI A;  3RMS A;  1BI0 A;  2K57 A;  1KG1 A;  3M57 A;  2ZCF B;  5GAM j;  3CC2 T;  5GAM g;  3NTI A;  1ZQ1 A;  2HAX A;  3MEU A;  1LJO A;  2QQB A;  3NTK A;  2RI2 A;  1EIF A;  4M78 E;  5I21 A;  4OVA A;  4C0D B;  1YIT A;  3J7A F;  3GNF B;  3OYE A;  1QVG S;  3EFR A;  4M78 C;  4JRK A;  3V7C A;  1KQS A;  5IT9 E;  3JAM E;  3EFS A;  3FRN A;  2HBP A;  4XTY A;  4CRI A;  4BI8 B;  5GAN f;  1UGP B;  1QW1 A;  4NS5 A;  1YJN T;  2E41 A;  3C95 A;  4DOW A;  4E7H A;  1X01 A;  4OGE A;  3BY7 A;  2LQ8 A;  2XHC A;  3HFN A;  4O5V A;  5LJ5 h;  3OYA A;  4PKC C;  5DM7 R;  2EWN A;  3VV0 A;  3PTA A;  4RCC A;  4M75 F;  3SFM A;  2LCL A;  3OBY A;  5D6Y A;  4BY6 C;  1KD1 U;  2LCC A;  3LWI A;  3SB2 A;  1YJN A;  3GF5 A;  4BE2 A;  2E6Z A;  4KT0 E;  1NPP A;  3H6Z A;  3JCM d;  3QZ5 B;  2LQK A;  2X4Y A;  3CBO A;  3DB4 A;  4OF1 A;  1TH7 A;  3UT1 A;  4B9X A;  5GAM d;  2XDD A;  1YI2 T;  2FL7 A;  4ME7 A;  2KVQ G;  2MMP A;  1Q82 U;  3JCM h;  1Y96 B;  3ASK A;  3M4G A;  4KUI A;  3X20 B;  5GAN 6;  1Y7X A;  5FRM A;  1QVF A;  4F7U F;  1V29 B;  4F7U E;  1W4S A;  2RK2 A;  2V8I A;  3I56 T;  5HY6 A;  3L2R A;  4M7D G;  1JJ2 S;  3CC2 A;  3OMC A;  2RHU A;  2OTJ A;  4XU2 A;  2RB6 A;  1VQK A;  4MZP A;  4M77 F;  2E70 A;  4LDU A;  1BI2 A;  3FIF A;  3SWN C;  2F5K A;  2RHZ A;  1D3B B;  4C92 E;  3QPH A;  5KCO A;  2KAF A;  1KD1 C;  3WVD B;  1UGR B;  4A4F A;  4IUV A;  5A2Q E;  4M7A G;  4M75 E;  3A8H B;  3QHS A;  1D3B A;  3FEO A;  3TRE A;  3A8L B;  3QJY A;  3ZBD A;  4BAC A;  1VQ9 T;  2RJC A;  4X9D A;  3TEE A;  4A53 A;  1VQ7 A;  1XNI A;  4J7I A;  4QW2 A;  1M9S A;  4D6W A;  3RMQ A;  5CCA A;  3J80 E;  3JB9 G;  2JVV A;  4IUT A;  4ZGJ B;  5CR2 A;  3CXC A;  1VQ5 A;  3KBG A;  2BIV A;  3NFC A;  4UC4 A;  4XTW A;  4A54 A;  4MDX A;  2Y4X A;  4L5G A;  2KK4 A;  4M7D B;  2RO0 A;  2M16 A;  3EAE A;  3G6E A;  1GXI E;  4E7I A;  3ZFJ A;  1UB4 A;  4FIB A;  2JTM A;  5LJ3 g;  2EJ9 A;  3OS1 A;  2LC4 A;  2PU9 B;  2KSS A;  5CQX A;  5FRO A;  3CCQ T;  1VQL A;  1QVP A;  1VQ5 T;  3GIB A;  3M54 A;  2QTX A;  3CD6 T;  4V2S A;  1Q7Y U;  3LGL A;  5GAM f;  1YIJ T;  4PJO D;  2MWO A;  1VQO T;  4FM4 B;  5GAO r;  4C92 F;  2DO3 A;  1VIE A;  4N4H A;  4BB7 A;  2GCX A;  1DJ7 B;  3C12 A;  3PGG A;  3X26 B;  1ZHI A;  1XTD A;  2K5F A;  2MF2 A;  3OW2 S;  2HNI A;  3OYC A;  5GAN j;  5IN1 A;  2DTI A;  4CI0 C;  4RMO A;  2XDB A;  2MAM A;  2QEX T;  3OYL A;  2XI9 A;  1VQ6 T;  3OYH A;  3OBW A;  3I56 A;  3JCM J;  1WNL A;  3QKJ A;  2EFI A;  2O01 E;  4JRP A;  4N0A C;  5L8R E;  2A7Y A;  4E7L A;  1M90 U;  3M9Q A;  2B8A A;  3C4S A;  1VQ4 A;  5A0D A;  4ZTF A;  3HFO A;  1VQ9 A;  3E1S A;  2E1H A;  2RJD A;  3GOX A;  2XKO C;  4VUB A;  2FB7 A;  3FDR A;  3DB3 A;  3S6W A;  3I55 T;  1YHQ T;  2IG0 A;  3GNG A;  1ZBX A;  2ZZD A;  2PQW A;  3MP1 A;  2EYQ A;  3CCV T;  4II1 A;  3CCS T;  2CGH A;  1G3S A;  4BE1 A;  3X24 B;  1IZ6 A;  3BDL A;  3L2W A;  1MGQ A;  2E64 A;  4PL6 A;  3V8K A;  2LTO A;  4PJO E;  5A0G A;  1PSE A;  3E9G A;  3PMT A;  3JB9 J;  2C06 A;  4KBM B;  3KUF A;  5HK0 A;  4LDX A;  4X9C A;  3MP6 A;  4EMH A;  2DXB A;  3L2Z A;  3CD6 A;  3V8J A;  1Y71 A;  2DTH A;  1WQW A;  5CQY A;  3LWH A;  3JCM X;  1QP2 A;  4IUU A;  3GP8 A;  4Q5W A;  5FU7 B;  4M77 D;  2XU8 A;  4BD3 A;  4N4G A;  3CPF A;  4GLK A;  4M78 F;  4JS5 A;  4M77 A;  3A8G B;  2PUO B;  2VV5 A;  2RA2 A;  4C0Z A;  3CCR A;  2K5L A;  2DIQ A;  2GQV A;  3PFS A;  5J3B A;  1K73 U;  2FHD A;  3PT9 A;  4OGC A;  3CCE A;  4FL6 A;  1VQ6 A;  3VYH B;  2XD0 A;  5LL6 S;  1WPY A;  5CKH A;  1VIF A;  3LLR A;  2VUB A;  3LX7 A;  1KQS S;  4EMK C;  3CCR T;  2LT1 A;  5LJ3 h;  3FLG A;  1QVF S;  3RER A;  3TU4 K;  4XTU A;  5I2S A;  2E5Q A;  4M75 A;  4BE0 A;  3UPU A;  1WJQ A;  3CMA T;  2YLC A;  4JLG A;  4RCB A;  3C94 A;  5CKF A;  2P0P A;  1HXD A;  3RKY A;  2EAY A;  4XTX A;  3QBY A;  5FLX E;  4EMK B;  3V8L A;  5LJ5 j;  1M90 C;  1NPR A;  3CBM A;  4FU6 A;  3P8H A;  4M7A A;  4PJO G;  4EMK A;  2L89 A;  1Q81 C;  2Y4Y A;  4LD9 K;  4MDW A;  1U8R A;  3I55 A;  4ATO A;  3OYY A;  1VQ8 T;  1LOJ A;  2DZ9 A;  2RH2 A;  3CC7 A;  2RHX A;  4A4E A;  2X4J A;  3M5A A;  5GAM h;  3CCV A;  3WVE B;  3CCL A;  5FU6 C;  1NJI C;  2RD1 A;  1Y96 A;  2D6F A;  1H64 1;  5CAI A;  3HP9 A;  2QQR A;  1PSF A;  1M1G A;  4PLL A;  3VYG A;  3M59 A;  1YJ9 A;  1K9M C;  5HK3 A;  4PJO C;  5GAN 7;  3CBP A;  1BIA A;  4M77 B;  4R56 A;  2YHT A;  4MML A;  3CCU T;  1NJI U;  4XAX B;  4Z02 A;  4B9W A;  3PIP A;  5GAN 4;  2DXU A;  5M9O A;  2YRV A;  1N9S A;  5GMK l;  3OS2 A;  3OYG A;  2CKK A;  4JJN K;  4A4H A;  2RHY A;  4F7U B;  1K8A C;  4HCZ A;  3O8V A;  3CC4 T;  3LGF A;  2DTO A;  2QA4 T;  2M1H A;  4C8Q G;  3L42 A;  5CO7 A;  2ZPB B;  3OYK A;  2OTL A;  4GY5 A;  1VQL T;  2JTF A;  2DK3 A;  3BW1 A;  3PNW C;  2OTJ T;  4FT2 A;  3OMG A;  3HHT B;  5GAN g;  3CCM A;  1Q86 U;  4M78 B;  2JN0 A;  5J26 A;  4M75 B;  3LH0 A;  1M5Q 1;  1KC8 C;  5LJ3 d;  3CCJ T;  4MZT A;  3UWN A;  4NL3 A;  2KQW A;  1BI1 A;  2QQS A;  3OYN A;  2MWP A;  5FU7 C;  3CCL T;  3UDC A;  3RUX A;  1I8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...