3JCMh

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
77
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 12
structure length 77
sequence length 88
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmh00
3FJPA 1MGQA 1I5LA 4M77F 3RESA 3RKXA 4OP0A 4A53A 5CAIA 5GMKe 3VU3C 2ZGWA 1H641 4M77C 5GAN5 5GMKj 4F7UG 4M78A 4PJOF 3V7RA 4XU0A 1D3BB 4M7AG 2YLCA 2DKGA 5GAN4 5LJ5f 4M75D 4XU1A 3JB9G 5GAOn 4M75B 3JCMf 1U1TA 4XU2A 5LJ3j 3RUXA 3SWNC 3JCMP 4EMKA 4C92C 5LJ5e 4C92E 5GMKi 4M7DG 3JCMe 4HT8A 5GMKl 2HNIA 1BIAA 1I4K1 3BDUA 1WNLA 3SB2A 4F7UF 5LJ5d 1N9RA 5GANg 2DEQA 4PJOG 5LJ5h 3JCMd 4XTUA 2E64A 2E1HA 4JRIA 4F7UE 3JCMh 4M7AF 4M78B 4DQ2A 3V8JA 3V8LA 4MMKA 3JB9F 4NL2A 2EAYA 4M7AE 4M7AC 4C8QE 4C92G 5GAN7 4HA8A 2DJZA 2DVEA 4N0AA 4A54A 5GAN6 4M7DF 1I81A 2FB7A 2VXFA 4QVDA 4M77E 3JCMb 3SWNA 4M7DC 1JRIA 3JCMc 4C92A 4PNOA 3RKYA 5GANf 4M75G 4PJOC 2DZCA 3M4GA 4PJOE 4JRKA 1KQ1A 3RKWA 3BY7A 2JN0A 5GAOq 2YHTA 4XTVA 4C8QA 1YCYA 4J6WA 3JCMV 4JLIA 5LJ5j 2EJ9A 2RD1A 3BFMA 4Y91A 5GANd 5GAMg 5GANh 3SWNB 2VC8A 4J5YA 4M75F 4M77A 4M78D 3BW1A 3QUIA 4M75C 4XTWA 4M75E 4J6YA 3AHUA 3JB9H 2E41A 4PJOA 4V2SA 2I2LA 3HFNA 4XQ3A 5GAOl 3L2ZA 4EMKB 5GAOm 4NL3A 3V8KA 4C8QD 4M7DE 1X01A 4C8QB 4RCCA 5GAOr 4M78F 1M5Q1 2VXEA 4XTXA 5LJ3g 1BIBA 1I8FA 4J6XA 5GAMf 4M77D 2CGHA 1N9SA 4M77B 4HT9A 1Y96A 1HK9A 2DZ9A 3JB9J 4XU3A 4F7UA 5GANe 3JCMQ 3RERA 1HXDA 5GAMe 3HSBA 3JB9I 4M7AA 4EMGA 2DXUA 2Y90A 5GANj 3QO3A 4PJOB 3PGGA 2DXTA 4XTYA 4XTZA 1B34A 5GAMd 3EFSA 2YLBA 4M78G 5GAMh 4C92D 3FIFA 1WQWA 4JUVA 4C92B 3INZA 4QVCA 1WQ7A 3GIBA 3EFRA 4M7DA 2EJFA 3QHSA 1U1SA 5LJ3f 2DTHA 3FB9A 4X9DA 5GAN2 3JCMJ 2QTXA 1WPYA 4EMHA 5GAN3 1Y96B 5GAOp 5GAN8 4F7UB 2EWNA 4N0AC 4C8QG 5GMKh 5LJ3e 4M7AD 2RB6A 4M7AB 1M8VA 3QSUA 3V7CA 4C92F 3JB9D 4NOYA 3HFOA 5LJ3d 2RA2A 1B34B 4M78C 4M77G 5DY9A 4M78E 5LJ3h 2RM4A 1KQ2A 4M7DD 2K57A 4M7DB 1D3BA 5GMKm 1JBMA 1LOJA 3V7SA 3JCMW 5LJ5g 2DTOA 2EJGA 4RCBA 5I21A 3JCMX 2FYKA 3JCMg 2E65A 4M75A 4MMLA 4C8QF 4EMKC 2E10A 4PJOD 3RIRA 1TH7A 4WF2A 5GAMj 1LNXA 1LJOA 2DTIA 4C8QC 4X9CA 3L1AA
chains in the Genus database with same CATH superfamily
5GJVB 1JJ2S 2L0AA 1S1NA 1JJ2A 4M7AG 3A8OB 3EGXB 2R57A 4M75D 3GLXA 3JCMf 2AZVA 3CCSQ 4R56A 2D0NA 2D9TA 2QQSA 5IHNA 2KY9A 4J9HA 1Q7YC 1YHQT 1XQHA 5ECAA 2HCKA 1VQ6Q 4AT1B 3G4SA 3J80E 4E47A 4QVDA 3G7ZA 1OULA 1AVZC 3AT1B 2DBKA 4PNOA 1SRMA 3OYJA 4Y28E 4M75G 2YRDA 5HCKA 3VV0A 1YITA 1T0HA 1KQSP 2C06A 1AOJA 2VC8A 2HQHA 3OYLA 4O6JA 3TCJA 4JS4A 2JTFA 4EMKB 2DLPA 1RAEB 3TREA 4M78F 2R5AA 4BE0A 4M77B 4L5GA 2X4JA 4HVWA 3RERA 1RACB 2DETA 2VASA 3QG1A 1W6XA 1SPKA 1YJWQ 1VQMQ 4KBMB 1YJ9T 1Q7YR 2YWWA 2DERA 1UDLA 2DK3A 2OI3A 4E7KA 1OOTA 2M51A 5D6YA 2OTLQ 1M8VA 2CSIA 4BY6C 5DY9A 2KR3A 1NLPC 1VA7A 1D3BA 1ZBJA 3X28B 2C0IA 1VQOT 2CZ0B 2GGRA 4C8QF 4JJDA 1I5LA 1UFFA 1OU8A 3EH2A 5EC7A 5CVIA 4PJOF 2YLCA 1VQ7A 3A8LB 3I56T 1LVKA 1E6GA 3CCQQ 1R8OB 3JCMP 1SG5A 3MEAA 4JDSA 3CC7Q 1M8MA 4ZTJA 1RI0A 2O9VA 2P4RA 2LCSA 1OZ2A 1X6BA 3G71A 1RLQC 2EFIA 2QA4T 1TOVA 1TG0A 4ORZA 2HDAA 3ULRB 2FPDA 2QI2A 5KE3A 3ZBDA 4E7HA 2K3YA 2QEXQ 2JOYA 5HK0A 1I07A 1D09B 4Z89A 1XNIA 2JM9A 2QG9B 4FT2A 2JM8A 4ESRA 4ZGJB 4RUGA 2BIVA 3QJ6A 2L5QA 4ZGDB 1SF9A 4B6MA 4IURA 4PJMA 2PTKA 4HXJA 3C95A 2CUBA 3E1SA 4BI8B 5FRMA 2FZKB 3PMTA 1I8FA 1RAAB 4HT9A 1FWZA 1WZOA 3TQ7P 3G4ST 1XTDA 1C0MA 4LDVA 5A0GA 3NMZC 3CMEQ 1MMDA 3ME9A 1WQWA 2ZPEB 1OPLA 4EPCA 1YITT 3CCJQ 3EG9A 1VQLQ 2EWNA 1RAIB 2RB6A 1B34B 4M78C 3EHRA 1BCOA 3CEYA 1LOJA 2P0KA 2P0PA 4BI4A 3CC2A 2E10A 1D1CA 1VIFA 3SHWA 4AG1C 2COYA 1D0ZA 1YI2A 1U06A 1QVFP 4DA4A 1FMWA 2QGFB 4O5VA 2YRVA 1UJ0A 1M1GA 3OYHA 3VUZA 4BDYA 3URGA 5LJ5f 4XU1A 3QWXX 2NWMA 4PFZA 1T3LA 4II1A 1V29B 1PRLC 3H0HA 3I55A 4BE1A 4M7AF 1SSFA 1ZLMA 2KT1A 2VGMA 4DBHA 4A4KA 2COZA 1H3HA 5GAN7 4D8DA 1GFCA 2NUTB 3C0CA 1C6VX 1VQ9A 1VYUA 1RABB 3S3MA 5CO7A 4PJOC 4ZN1A 1G5VA 2E4HA 1QVFS 4RTZA 2LC4A 5D7UA 4JLIA 4OMMA 1CKAA 1PM3A 4AFUC 1QVFA 1KSWA 1K4US 4M75F 1VQ7T 4J9FA 4C0DB 1TWBA 3RDVA 2LQKA 1K73U 4BUGA 3JAME 1BU1A 2F1LA 1WHMA 3O5ZA 1BI1A 4LE9A 3QJYA 3UATA 1UGRB 3G71T 4XTXA 4J6XA 1N8RR 2EQMA 2MPXC 3CCLQ 2CSQA 3JCMQ 5GAMe 2DF6A 1H92A 1M30A 3EG3A 4ANJA 2KQWA 2D8HA 5LJ3f 2KBTA 5FLXE 4OMQA 4AFZC 2RHIA 1K73C 2HSEB 3QDRB 4OMLA 4M78E 3META 2A37A 2HD0A 3JCMg 2JS0A 1YJNQ 2FRYA 1SSHA 4DEXA 1G83A 1VQKA 3X26B 3QYHB 3RNJA 5FW9A 2WSEE 2L2PA 2O4XB 2NUPB 2K5FA 1VYTA 1EZZB 3OYMA 5GAN4 3JSCA 5DLQE 2LQ8A 2XMFA 3VS3A 2EGAA 5GMKl 2L89A 1WNLA 1Y7XA 4BY6B 1IHWA 4FYYB 5IAYA 4N4HA 4C8QE 3KXTA 4A54A 4QQ6A 3EG1A 4C92A 3HHTB 1XOVA 3OSSC 3CC2T 2D8JA 1ZUKA 2B86A 2HL3A 4PJOE 1K9MU 4LDYA 1RL2A 2CT4A 1YI2T 2XG8D 3PIOA 2VWFA 5LJ5j 1YIJQ 2GF7A 2RD1A 1K73R 3HRSA 1VQPQ 1QVPA 5FU7C 1RUWA 4M78D 1QCOA 1AT1B 1UG1A 2RJFA 3MP1A 1TUDA 1YWOA 2DNUA 2AHJB 4QW2A 3I55T 2MIOA 1FMKA 5HK3A 4PFOA 2DXBA 1VQ9T 4M78G 1M1FA 2VKNA 5CIUA 2P0QA 1OI1A 4ZN3A 2DO3A 1TTHB 5KCHA 2KSSA 1WHGA 3G6EQ 3CXCA 2CUDA 3JCMW 4FYXB 5IXFA 4RCBA 4PJOD 2PZ1A 1Q82U 3RIRA 1AWXA 1OYXA 5FWBA 3CPWS 1KJWA 2XDDA 4AFSC 4CRIA 1TS9A 2M16A 3OYAA 3CPWA 1P92A 1R77A 3L2WA 4F16A 4ZTFA 1YHQA 1UB4A 1KFZA 4CC2A 5GAOn 5LJ3j 4MDWA 4C0ZA 1OX9A 1KIKA 2DEQA 4PJOG 4M78B 4C5HA 5DM7R 3WVDB 3OSVA 2DVEA 2XU8A 1I5OB 5I2MA 3CCSA 1I0CA 1VQNQ 2M0YA 2RJDA 2R58A 3TU4K 2A28A 1Q82C 4JJCA 2YUPA 2KRSA 2ABLA 3CCVQ 1WX6A 1VQKT 2RO0A 1M3CA 1U3OA 1VQ6A 5KYYB 2OJ2A 1M2OA 2EJ9A 5GANd 2BE7D 2G6FX 2HBPA 3BW1A 1VIEA 2GQIA 3VYGA 3OYIA 4HVVA 1YNZA 2DM1A 4C8QB 2FVUA 2HQEA 2RI3A 4IUTA 2X3WD 3ZL7C 3NTKA 2DYIA 1Q81U 2JMCA 4PJOB 1NZ9A 5CR2A 4KH1B 2DIGA 4VUBA 1Q86U 1M4ZA 2ED1A 1BBZA 3LLRA 3OMCA 2M02A 1WXUA 2RJEA 2GBQA 5A0LA 3LGFA 4LUEA 2O9SA 4P5NA 1Q82R 1YJWA 2JNGA 1VQMA 5KYWB 5LJ5g 2L3RA 4WCIA 3A8GB 2DL7A 2OTLA 1QWEA 3M55A 3G1JA 3GP8A 1EIFA 3SD4A 1Q81C 2QDLA 5GAN5 3OYCA 3V7RA 2XD0A 2B8AA 4RTVA 1Q86C 2FEIA 4EMKA 1OV3A 1QCFA 5C0MA 2XIDA 2KYMA 3M58A 1I4K1 2E1HA 2CS7A 1JB0E 1YCSB 2EAYA 1VOMA 2ZPHB 1IO6A 4RTTA 2H8HA 3FRNA 2FB7A 3CCQA 3JCMb 3EGDB 3QZ9B 2JW4A 4KRTA 3CC7A 1ZBXA 2JXBA 4A4EA 3M4YA 5CKBA 2FZGB 4DBFA 1ABOA 1UEBA 4KT0E 2E12A 5C6SA 4A4GA 1BK2A 5GANh 2H3JA 3LX7A 4RTWA 2XICA 3CCUQ 4AMCA 1TUCA 1VQ4Q 1KHCA 4IIOA 3LGLA 2D1XA 1Q81R 5LJ3g 3EFOB 2JTMA 1NEGA 5GANe 4B9XA 3HSBA 2NYSA 3CCST 4QVZA 2DD5A 1Q86R 2ZZDA 4XK8E 3OA6A 3VJPA 1I1JA 2PVGB 2EW3A 5DLOA 2LVMA 4JUVA 3GIBA 3FLGA 1QP2A 1U1SA 2VGNA 3U23A 1PSEA 2L3SA 3LWHA 1WGSA 1VQ6T 2HSPA 4M7AB 1UTIA 4C92F 1E6HA 3E9FA 3OB9A 2QYZA 4N4IA 5CK9A 3CMEA 3CCRA 5M9OA 2BZ8A 4C0FA 1WDXA 2ZCFB 2DTOA 2KGTA 4MMLA 3CCMQ 3CCJA 1VQLA 1LNXA 2VB6A 4X9CA 3L2VA 3LW5E 5J39A 1WHLA 2KEAA 2CZ7B 2J7IA 2QQRA 3KUFA 1KQSS 2XK0A 1BI3A 4M75B 1AZGB 1U5SA 1RAHB 1KQSA 2MMPA 2G3RA 4OMOA 4C5GA 3D7SB 8ATCB 4JRPA 4XTUA 2E64A 2YXYA 4A4HA 3ER0A 3EG0A 3QWYA 1ZSZB 4DEYA 2DEUA 2XDBA 2CREA 1JU5C 3SWNA 1YJWT 1VQMT 2F5TX 2W10A 5J3BA 1OPKA 3PNWC 3A5ZB 3P8HA 1BCMA 1TSFA 2FPEA 2EQIA 2OTLT 4KGXB 2OTJQ 2FZCB 1MNDA 2V1RA 2A08A 5AT1B 4MZTA 3PMIA 2FO0A 3C94A 5GAOl 1B07A 1G2BA 3V8KA 4IKFA 5FWCA 2DX1A 4HCBA 4XAXB 5FU6C 3JB9I 2LT1A 1OQKA 3CCQT 2BKDN 1SHGA 2COWA 5GAMd 3CC7T 2X4XA 2YLBA 2X4WA 4FU6A 2LCCA 3EFRA 2LMJA 3E19A 2YDLA 1X27A 3CCLA 1G3SA 2DL4A 2K6DA 2DRMA 3VS7A 4IUVA 1GL5A 3V7CA 4Z88A 2O88A 2JVVA 5CCAA 1KQ2A 1X69A 4GBQA 1SRLA 3NPFA 3V7SA 3MKDA 3OMGA 1N8RU 2P84A 3FDRA 3QPHA 3M59A 3I9QA 1LJOA 4J83A 5D6XA 3FJPA 1MGQA 3FC3A 3CMAQ 3JV3A 3CCEQ 4AG2C 1D3BB 1D0YA 3GNFB 1TUGB 2ROLA 4IUPA 4LD6A 2YT6A 2CZ1B 1YJNA 4C92C 2RH2A 2L3QA 4C5EA 3VS1A 1M2VA 1KHIA 3DKMA 3SB2A 2LJ1A 4F7UE 3V8LA 1X2QA 1EX4A 1LPLA 3S3NA 4M4ZA 3CMET 3CCRT 2J6OA 4M7DC 1N8RC 2DRKA 1H8KA 5HKCA 5KYXA 3CCJT 2DZCA 1IRXA 1VQLT 1AWJA 2HKQB 2JN0A 2A36A 3RMQA 4RG8A 1BKBA 3OYKA 2MK5A 3ZFJA 2FPFA 2MWPA 2PVOB 3PT9A 1G3TA 3OBYA 4RCCA 5GAOr 1YIJA 1VQPA 2CGHA 1N9SA 1KK7A 1HK9A 2DZ9A 3J81E 4F7UA 2ED0A 2W0ZA 2Y90A 2MYSA 3M0SA 2DA9A 2KXCA 2VV5A 4RTXA 4FYVB 3LWIA 5GAMh 2FHDA 1S72Q 1WHJA 1GRIA 1QKWA 1Y71A 2JMAA 3HL8A 5D6WA 3KFVA 3X25B 3H41A 3CD6Q 1WJSA 3N5BB 2DVJA 3QSUA 3JB9D 1F1BB 1FX7A 4CC7A 2IIMA 1K8AU 1YWPA 1A0NB 1IXDA 4C0GA 1R0CB 3EG9B 2WSFE 2ECZA 1GFDA 1N27A 4HCZA 4F7UG 1K0SA 5I22A 4Z02A 3JB9G 2BZYA 1Y07A 2ZPFB 4C92E 4F17A 3JCMe 2MWOA 2F69A 2RHZA 4CC3A 3CCLT 1M3AA 4NL2A 2RQVA 2CP3A 2FG0A 2VXFA 1K8AC 5I11A 3VYHB 2D6FA 1IGUA 5GANf 1G3YA 1RADB 3FJ5A 3M4GA 1W2BP 5GAOq 1B7TA 3QDFA 4Y91A 4E7LA 1VQNA 2MOXA 4OB0B 2J6KA 1QW1A 4DBQA 2EQKA 3UF4A 1YJNT 3AHUA 3CCVA 4KULA 3IQLA 5GAOm 3H0FA 1YI2Q 1O75A 4RKUE 1M5Q1 2NLUA 1Y96A 2AKKA 2AIRB 4FT4A 2ENMA 1HXDA 5A2QE 1UGPB 3A98A 1QLYA 4C92D 1NJIU 3QZ5B 4M7DA 2EJFA 1W2BS 1PD0A 3L2RA 3M0PA 4JJNK 1MMAA 2YRCA 1WHKA 1E7OA 3OY9A 2K4YA 4IIMA 1K8AR 1X75C 2DFUA 1KC8R 4M7DD 4OMFB 4ZGEB 4CI0C 2E65A 4EMKC 3WXMB 4MZPA 2MCNA 5IHKA 3VS5A 4C92G 1Q95G 1PG5B 4PKCC 4A63B 3NTHA 1YIJT 1NEBA 1LCKA 1VQPT 4M77C 1WIEA 4BI3A 4E7IA 1UJYA 3LH0A 3ZEHA 2AZSA 2RPNA 4XU0A 2Y4XA 4MZMA 1NJIC 3GOXA 1C1AA 3RUXA 2O2OA 4KGVB 1ZX6A 2JZ2A 4M7DG 2RJCA 1M90U 1ZUYA 2K3XA 4E2FB 1HYOA 4LXCA 4GLMA 4JRIA 1GCQC 5KYUA 3ASKA 3V8JA 3EAEA 1W1FA 2LX7A 3E9GA 1VQ8A 2RNAA 1HD3A 2E5KA 2CP5A 3NTIA 3R6NA 4L59A 3JCMc 1QCNA 4FIBA 4J9CA 1KD1R 2RQWA 4ATOA 3DLMA 1Z9QA 2L8DA 1UUEA 2GTOA 2DIQA 5CKEA 3PTAA 2M1HA 2XKOC 4J6YA 1D1BA 2E41A 5KCOA 1J3TA 3HFNA 1M90C 4OB2B 4RG2A 2KROA 1RLPC 2LX9A 1IZ6A 2QQBA 2LZ6B 5CKFA 2OX7A 1MV3A 3NGPA 1NJIR 3I5SA 5GANj 1PRMC 1WJQA 2GQVA 2R5MA 4OVAA 1WI7A 1VQ4A 2Y4YA 2K5IA 5A0DA 2HL5C 3FIFA 1T0JA 2CP0A 3OS0A 2DTHA 3FB9A 3CQTA 3PFSA 2CP6A 5GAN3 3EH1A 1VQNT 2A0FB 2E5QA 2ZPIB 3M0QA 1JO8A 5L8RE 3EGXA 3CCVT 3JCMX 2EYZA 2PU9B 2JT4A 1UHCA 1B3QA 2DL3A 4OP0A 1GBRA 1UGSB 3VRYA 4R0KA 4B9WA 4HCKA 3MP6A 4PJLA 6AT1B 2LT4A 1U1TA 1M90R 3CCMA 1FYNA 1VYVA 2GNCA 3SWNC 2M0OA 2DBMA 5LJ5e 1VQ5Q 3VRZA 4HT8A 2RN8A 1NYFA 2X35A 3BDUA 4F7UF 2O01E 1PC0A 3JB9F 1OX8A 3CBOA 3CC4Q 2DJZA 1I81A 2XI9A 4KUDK 4LDUA 2KNBB 2BZXA 2GFAA 3RKWA 1JJ2P 1RAGB 2C0TA 2WSCE 2YHTA 2A7YA 2PQWA 1PHTA 4J6WA 3BFMA 2CYZB 4FM4B 3M9QA 3MO8A 4C5IA 4M77A 3X20B 2I0NA 3QIIA 2DMOA 2P4TA 2I2LA 3TVTA 1OZ3A 4NL3A 1ZSGA 2OTJA 1WA7A 2IG0A 4GY5A 2VYTA 5GAMf 4M77D 3TSWA 1YHQQ 1GCQA 1VQ8T 4J8OA 2X3XD 3OYYA 3EFSA 1CSKA 2EYYA 4E7JA 2KAFA 2QEXA 2EGEA 4ELZC 2LNHB 5GAOp 1K76A 3UPUA 5GMKh 1WFWA 5LJ3e 1ZSZA 2X51A 4JRQA 4FW1A 2F2WA 1U8RA 1WXBA 2RHYA 3GNGA 4M77G 3SFMA 2E3HA 2CH4W 4C0DC 1NYGA 3PVQA 2GTJA 2GCXA 2DYBA 4LDXA 4OB3B 1WXTA 3RR6A 5I21A 1GXIE 2RMOA 1TH7A 4WF2A 2ZPGB 3NFCA 4E7SA 1XJWB 2JUFA 3RKXA 3A8HB 5GMKe 1BYMA 2ZGWA 1Y57A 3H8ZA 1K0XA 1Y0MA 2AK5A 5FU7B 3CBMA 3CCUT 3HPWA 1HSQA 1W4SA 1VQ4T 1X2KA 2KT8A 2DXCA 3THKA 2PNIA 4QQDA 1O9SA 2CP2A 1IGQA 4HCCA 5GANg 1YJ9Q 2E6NA 1N9RA 1IB8A 1JXMA 3CMAA 3I35A 4X34A 1Z9ZA 2K79A 4DQ2A 3CCEA 2QXFA 3H0IA 3REAB 4M7DF 3M5AA 3MEUA 5EG2A 2QQ9A 4L6V5 3RKYA 1MV0B 2LP5A 4J7FA 3BE3A 1VQOQ 4JRKA 1KQ1A 2HKNA 3VS4A 3BDLA 4KUIA 3JCMV 2QK0A 3M54A 2CT3A 3M0RA 3HRUA 3CCMT 3I56Q 4DBRA 2DAQA 1CKBA 3MCAB 5CQYA 1JQQA 4F04B 3S3OA 5FRNA 1PWTA 2V8KA 1M27C 2YUQA 2FRWA 2QA4Q 3HKSA 3UA7A 3H9NA 2DXUA 2RQUA 1W70A 1B34A 1WLPB 1ZUUA 3DB4A 3UDCA 5IHIA 1WQ7A 2K2MA 2MI6A 2EGCA 4X9DA 1FMVA 2QTXA 2K2VA 2KI7A 3TSZA 1WJRA 4N0AC 2HBWA 2V8JA 4J9DA 2CP7A 3C12A 1YN8A 2RM4A 2HMAA 5GJWB 1S72A 4BD3A 5GAMj 2OTJT 3CD6A 4D8KA 4QT7A 4Y92A 2ATCB 2ESWA 1AWOA 2KYBA 1YFNA 1NPPA 1QKXA 3PVLA 5AYFA 3Q1JA 2LNVA 3G4SQ 2DL5A 4FL6A 2NUTA 1V1CA 3L2QA 4JJBA 4LDWA 2QEXT 2HNIA 1BIAA 1UGVA 3JCMd 1YITQ 2RHXA 4KGZB 2LJ3A 1WHHA 2BUDA 3A8MB 5GAN6 3X24B 4DOVA 2X9HA 4R55A 3PE0A 1M9SA 4FYWB 3UWNA 3P8BB 1PNJA 4X1VA 2F5KA 2M9UA 2LQNA 2YUOA 4OB1B 4XTVA 4K11A 4TVRA 4OMPA 3EG2A 3SWNB 2CDTA 3CCRQ 3OQ5A 4J7IA 3OS2A 3OS5A 2ROTA 2LCLA 2K5LA 3HP9A 2GFUA 3L2ZA 2EYWA 2F2VA 1QP3A 2EKHA 1IHVA 2EKOA 1AZEA 1TXQA 3CMAT 1BIBA 4HKEA 3CCET 1ABQA 3A1PA 3RMSA 2KRMA 1UHFA 4PK4A 3FEOA 2LRQA 3PGGA 3HRTA 1QVGP 2RQRA 3M0TA 3QKJA 4FCYA 7AT1B 1QWFA 2KK4A 1ACMB 5GAN8 1UECA 4NOYA 1ZHIA 2RI5A 2D0QB 2F2XA 3WVEB 2RI2A 3NHNA 2V8IA 4EDUA 1QMCA 2O4XA 3DLLA 2NUPA 1VQ7Q 4JLGA 2EQJA 2CKKA 8AT1B 2FYKA 4C8QC 3DB3A 4FSSA 2LJ0A 4M77F 3M57A 3L2UA 1PKSA 4Q5WA 2BTTA 3O8VA 3G71Q 3SEMA 2OAWA 2MAMA 1ZA2B 4AFQC 1KG1A 2KXDA 2DJQA 2DKGA 2RHUA 1MHNA 1T3SA 1QVGS 1WYXA 4FW2A 5HY6A 3TEEA 4RTUA 1QVGA 5GMKi 3OBWA 2IVWA 1NM7A 1KC8U 5L23A 3JCMh 2L3PA 1OEBA 4LNPA 4N0AA 2K7AA 1JRIA 3SDZA 1X6GA 3G6EA 2E6ZA 4NS5A 1M2VB 1S72T 1AWWA 4OGEA 4YTLA 2JTEA 1PSFA 3CD6T 9ATCB 4LUDA 4J9BA 1NPRA 3MEVA 5GAMg 4FSXA 2Z0WA 4OGCA 5IN1A 5KYXB 3OYDA 3OW2P 4V2SA 2KMTA 2FL7A 3MJXA 4M7DE 3KBGA 3RBBB 1AHJB 1KC8C 1YBYA 2VXEA 2HQXA 1MMGA 1AD5A 2QDYB 2EBPA 2WACA 4EMGA 3QO3A 2DD4A 2HEQA 1KD1U 5I2SA 2KVQG 2EVRA 4QVCA 4PLLA 1D1AA 3QHSA 2BE9B 1N5ZA 3CC2Q 2AKLA 3JCMJ 1X6OA 3CBPA 1SKUB 2CH4A 2KDSA 1WPYA 3UT1A 4F7UB 4BE2A 4LN2A 5CQXA 1X43A 4PL6A 3OYGA 3HFOA 2LTOA 2QAZA 5KYNA 2RA2A 2XHCA 4KH0B 3PIPA 2K57A 3UA6A 3VS0A 3OW2S 5LL6S 1JBMA 3LH5A 1UGQB 2EJGA 3VUBA 3OW2A 2QQAA 2EYQA 3JRZA 3LYIA 3VKIA 2YUNA 3I55Q 1H641 2QTVA 2VVKA 4EIKA 4J9IA 4DOWA 2HZYA 4M78A 1W2BA 1KD1C 1NG2A 4JZ4A 4BDZA 4XU2A 3QYGB 2KE9A 4ME7A 2KRNA 2HAXA 4D6WA 4A4FA 1VQ9Q 3GPLA 2C0OA 4LD9K 2H3EB 1GBQA 5LJ5d 3VS2A 1IREB 2V1QA 2JJ9A 4WTOB 4GLKA 3CXCP 2LQWA 4M7AC 2RK2A 3GBQA 4HA8A 3OS1A 5KYYA 1NLOC 4IUUA 5FU6B 1MNEA 1G8XA 1VQ5A 5IXBA 4JPBW 4ELYC 3CPWP 4F14A 2X4YA 1D0XA 2EIFA 4JZ3A 2EPDA 4J9GA 3S6WA 3CC4A 2XDPA 4C8QA 2YSQA 3OYNA 1M1KU 3J7AF 3OYFA 2RQTA 4J5YA 1H3ZA 1K9MC 4HVUA 4UC4A 4M75C 4XTWA 3JB9H 4PJOA 2A3LA 3H6ZA 5IH2A 3OYBA 1JXOA 3REBB 4C8QD 4IUQA 2J06A 4JS5A 3CXCS 4CC4B 4N4GA 3MPUB 1ZSZC 3JB9J 4PJJA 4XU3A 2MF2A 3P8DA 1K9AA 4BB7A 2DXTA 2J6FA 3MP8A 4XTYA 4XTZA 3G6ET 2SEMA 4C92B 2DL8A 2V26A 5KYWA 1PCXA 3EGUA 1NBEB 5GAN2 4BACA 1Y96B 1M1KC 3C4SA 1VQKQ 4C8QG 1JEGA 1V76A 2DE0X 2ZPBB 1BB9A 2J05A 5LJ3d 1K1ZA 3MEWA 4E7ZA 2RF0A 2K3BA 3M53A 4M7DB 1YP5A 1HJDA 4J9EA 4RTYA 2DILA 3L42A 3CCUA 2SRCA 2DTIA 3MHXA 1NE8A 1MUZA 1UE9A 3RESA 4A53A 3I5RA 5CAIA 1GCPA 3VU3C 1QQJA 4QQGA 1G3WA 1N6AA 4OF1A 1K9MR 5GMKj 3VS6A 2CZ6B 3F70A 3R6OA 1DJ7B 4PLIA 1EFNA 1OU9A 2EQUA 5CKHA 1ZQ1A 1PKTA 2PUKB 2JS2A 4Z8AA 3HTRA 3EGDA 2QASA 3QXEB 4PFPA 2LDMA 4RMOA 5LJ5h 4MMKA 4OMNA 4M7AE 2PVDB 2K9GA 4MDXA 2O31A 4E6RA 1AEYA 2DPPB 4M77E 5J26A 1BI0A 2QGGA 1YJ9A 3T9NA 5KYUB 1M1KR 1SHFA 3BY7A 5IT9E 1VUBA 1YCYA 1M3BA 3QBYA 1MMNA 3CPFA 3EFOA 3EHQA 3QUIA 5CKDA 3GF5A 1PD1A 4QKUA 4M75E 2VUBA 5KH6A 3M0UA 1ZA1B 1VQOA 4XQ3A 1ARKA 1X01A 2E3IA 1RAFB 3E2UA 4ZNXA 2RK1A 2OAUA 3M56A 4M7AA 3I56A 1VQ5T 3OYEA 2NUZA 2PUOB 3INZA 2ZAEA 4EMHA 1BI2A 2E70A 1Q7YU 3CC4T 2EYXA 2QA4A 4M7AD 1VQ8Q 1SEMA 2IPOB 5KE2A 4PJNA 5LJ3h 1RI9A 2AT1B 5FROA 5GMKm 1R0BG 4M75A 1TU0B 3L1AA 1FXXA
chains in the Genus database with same CATH topology
1OYXA 3CPWS 2WSFE 2XDDA 4CRIA 1JJ2S 2M16A 3OYAA 3CPWA 1P92A 1NPPA 1N27A 4HCZA 5AYFA 4F7UG 3Q1JA 3L2WA 4ZTFA 1JJ2A 4M7AG 3A8OB 1YHQA 1UB4A 2LNVA 2R57A 4M75D 4Z02A 3JB9G 3GLXA 1Y07A 3JCMf 5GAOn 5LJ3j 4FL6A 4R56A 2ZPFB 4MDWA 4C0ZA 2D9TA 4C92E 2QQSA 3L2QA 3JCMe 2MWOA 4LDWA 2F69A 2QEXT 2RHZA 2HNIA 1BIAA 2KY9A 1Q7YC 2DEQA 4PJOG 3JCMd 3CCLT 1YHQT 4M78B 2RHXA 4C5HA 1XQHA 4NL2A 5DM7R 3WVDB 3OSVA 2DVEA 2XU8A 2BUDA 3A8MB 5GAN6 3G4SA 3X24B 3J80E 5I2MA 2VXFA 4DOVA 4E47A 3G7ZA 4QVDA 3CCSA 1K8AC 2RJDA 4R55A 2R58A 3TU4K 1M9SA 3UWNA 4PNOA 3VYHB 2D6FA 3P8BB 1Q82C 3OYJA 5GANf 1G3YA 4M75G 4Y28E 2F5KA 3M4GA 2M9UA 3VV0A 1YITA 1VQKT 5GAOq 4OB1B 2RO0A 4XTVA 1VQ6A 4TVRA 2EJ9A 5GANd 4Y91A 4E7LA 2C06A 3SWNB 1VQNA 2HBPA 2VC8A 4OB0B 3BW1A 1QW1A 3OQ5A 3OYLA 1VIEA 4O6JA 2EQKA 3VYGA 4J7IA 3OS2A 3TCJA 1YJNT 3AHUA 3OS5A 3OYIA 2LCLA 3CCVA 4KULA 4JS4A 2K5LA 2JTFA 3HP9A 2GFUA 3L2ZA 4EMKB 5GAOm 3TREA 1O75A 4RKUE 1QP3A 2FVUA 4C8QB 2EKOA 4M78F 1M5Q1 2NLUA 2HQEA 2R5AA 1BIBA 3CMAT 4HKEA 4BE0A 2RI3A 3CCET 4IUTA 4M77B 4L5GA 1Y96A 2X4JA 3RMSA 3NTKA 1Q81U 3RERA 4FT4A 5A2QE 1HXDA 3FEOA 4PJOB 2LRQA 3PGGA 1NZ9A 3HRTA 1UGPB 3QG1A 5CR2A 1NJIU 4C92D 3QKJA 3QZ5B 4VUBA 2DIGA 4KBMB 1YJ9T 1Q86U 4M7DA 2EJFA 1W2BS 1M4ZA 2DK3A 4E7KA 3L2RA 3LLRA 2KK4A 3OMCA 5D6YA 4JJNK 5GAN8 2RJEA 1M8VA 3OY9A 4NOYA 2K4YA 1ZHIA 2RI5A 2D0QB 3WVEB 5A0LA 1X75C 2RI2A 3LGFA 5DY9A 2V8IA 4BY6C 4EDUA 2O4XA 4P5NA 3DLLA 4M7DD 1YJWA 2JNGA 4OMFB 4ZGEB 1VQMA 1D3BA 4CI0C 4JLGA 3X28B 1VQOT 5LJ5g 2CZ0B 2CKKA 2EQJA 2L3RA 2FYKA 2E65A 4C8QF 4EMKC 3WXMB 4MZPA 4C8QC 3A8GB 3DB3A 2OTLA 4C92G 3M55A 4PKCC 1I5LA 3NTHA 3M57A 4M77F 3L2UA 1YIJT 4Q5WA 3O8VA 1VQPT 4M77C 3GP8A 1EIFA 3SD4A 1Q81C 2MAMA 4BI3A 5CVIA 5GAN5 3OYCA 4E7IA 3LH0A 3ZEHA 4PJOF 3V7RA 4XU0A 1KG1A 2YLCA 1VQ7A 2DKGA 2RHUA 2Y4XA 2B8AA 1MHNA 3A8LB 4MZMA 3I56T 1QVGS 1NJIC 3GOXA 3RUXA 1R8OB 5HY6A 3TEEA 3JCMP 4EMKA 1Q86C 2JZ2A 3MEAA 1QVGA 4JDSA 5GMKi 4M7DG 3OBWA 4ZTJA 2RJCA 2IVWA 2XIDA 5C0MA 1RI0A 2K3XA 3M58A 1I4K1 1M90U 1OZ2A 3G71A 1KC8U 4JRIA 2E1HA 2EFIA 2QA4T 2CS7A 3JCMh 3ASKA 3V8JA 1JB0E 3EAEA 2EAYA 2ZPHB 3E9GA 4N0AA 1VQ8A 3FRNA 5GANj 2FB7A 3CCQA 3NTIA 3JCMb 2QI2A 5KE3A 3QZ9B 1JRIA 4L59A 3SDZA 3JCMc 3ZBDA 2K3YA 3CC7A 4E7HA 3G6EA 2E6ZA 4NS5A 1ZBXA 1S72T 4FIBA 4OGEA 4YTLA 4A4EA 3M4YA 1PSFA 2JOYA 5CKBA 5HK0A 3CD6T 1XNIA 4FT2A 4ATOA 1UEBA 3DLMA 2L8DA 4KT0E 2E12A 5C6SA 4A4GA 2DIQA 1NPRA 3MEVA 5CKEA 5GAMg 4ZGJB 5GANh 2BIVA 3QJ6A 2L5QA 2M1HA 2H3JA 4FSXA 4ZGDB 3PTAA 3LX7A 2XKOC 4IURA 4OGCA 5IN1A 4J6YA 3OYDA 2XICA 2E41A 3C95A 5KCOA 4V2SA 2KMTA 3HFNA 1M90C 4OB2B 2FL7A 4RG2A 1KHCA 3E1SA 2LX9A 4M7DE 3KBGA 1IZ6A 1AHJB 3LGLA 1YBYA 4BI8B 1KC8C 5FRMA 2VXEA 2QQBA 5LJ3g 3PMTA 1I8FA 2HQXA 5CKFA 4HT9A 2JTMA 2QDYB 1FWZA 5GANe 4B9XA 3G4ST 3HSBA 2WACA 4EMGA 3CCST 4QVZA 2DD5A 1XTDA 1WJQA 2GQVA 2R5MA 2ZZDA 3QO3A 2DD4A 4LDVA 4OVAA 4XK8E 5A0GA 3OA6A 1KD1U 5I2SA 3VJPA 2Y4YA 1VQ4A 2PVGB 2KVQG 2K5IA 5A0DA 3FIFA 1WQWA 3ME9A 2LVMA 2ZPEB 4JUVA 4QVCA 5DLOA 4PLLA 3GIBA 3OS0A 3QHSA 3FLGA 1QP2A 1U1SA 2VGNA 4EPCA 2DTHA 1X6OA 3CBPA 3FB9A 3PFSA 1PSEA 2KDSA 3JCMJ 1WPYA 1YITT 5GAN3 3UT1A 3LWHA 1WGSA 4F7UB 2EWNA 4BE2A 1VQ6T 2RB6A 4M7AB 5CQXA 4C92F 4PL6A 3E9FA 3OB9A 3OYGA 3HFOA 2LTOA 1VQNT 2E5QA 2RA2A 1B34B 2XHCA 2ZPIB 4M78C 4N4IA 5CK9A 3CMEA 3PIPA 2K57A 3CEYA 4C0FA 5M9OA 3CCRA 3OW2S 5LL6S 1JBMA 1LOJA 2ZCFB 2P0KA 1UGQB 2DTOA 2EJGA 2P0PA 5L8RE 4BI4A 3JCMX 3CCVT 3CC2A 4MMLA 2E10A 2PU9B 3VUBA 3CCJA 2QQAA 3OW2A 2EYQA 3JRZA 1LNXA 3LYIA 1VIFA 3VKIA 1VQLA 4X9CA 3L2VA 3LW5E 5J39A 1YI2A 2CZ7B 4OP0A 1UGSB 4DA4A 1H641 4B9WA 4O5VA 4DOWA 2YRVA 2QQRA 3KUFA 4M78A 1M1GA 3OYHA 3VUZA 4BDYA 1W2BA 3MP6A 1KD1C 3URGA 5LJ5f 1KQSS 4XU1A 2LT4A 4BDZA 2XK0A 1BI3A 4M75B 1U1TA 4XU2A 3QYGB 3CCMA 3SWNC 2M0OA 4ME7A 1KQSA 2HAXA 5LJ5e 4II1A 4D6WA 1V29B 4A4FA 3GPLA 4HT8A 4LD9K 3I55A 2MMPA 2X35A 3BDUA 2G3RA 4F7UF 2O01E 4C5GA 5LJ5d 1IREB 4BE1A 4M7AF 4JRPA 4GLKA 2E64A 1SSFA 4XTUA 2VGMA 4A4HA 4A4KA 3JB9F 4M7AC 3ER0A 3CBOA 2RK2A 5GAN7 4HA8A 3OS1A 2DJZA 2XDBA 1I81A 4IUUA 5FU6B 3SWNA 1YJWT 1VQMT 1VQ5A 2F5TX 2XI9A 4KUDK 1VQ9A 5J3BA 4ELYC 3PNWC 3A5ZB 4LDUA 5CO7A 3P8HA 2X4YA 3S3MA 4PJOC 4ZN1A 1G5VA 2GFAA 3RKWA 2EIFA 2OTLT 2WSCE 2YHTA 2A7YA 3S6WA 1QVFS 3CC4A 2PQWA 2XDPA 2LC4A 4C8QA 4J6WA 3OYNA 1M1KU 3J7AF 4JLIA 4MZTA 3BFMA 2CYZB 4FM4B 3OYFA 3M9QA 1QVFA 3MO8A 4C5IA 4M77A 4J5YA 4M75F 3X20B 1K9MC 4C0DB 1VQ7T 1H3ZA 4UC4A 2LQKA 3PMIA 1K73U 4M75C 4BUGA 3QIIA 4XTWA 3JAME 3JB9H 4PJOA 2P4TA 2I2LA 1OZ3A 2A3LA 3C94A 3H6ZA 1BI1A 5GAOl 4NL3A 3OYBA 3QJYA 3V8KA 4C8QD 2OTJA 4IUQA 1UGRB 3G71T 4JS5A 3CXCS 4XTXA 4IKFA 4N4GA 2IG0A 4GY5A 4J6XA 2VYTA 5GAMf 4M77D 4HCBA 2EQMA 2XD0A 4XAXB 3JB9J 4XU3A 3JCMQ 1VQ8T 2MF2A 5GAMe 5FU6C 3JB9I 4J8OA 2LT1A 3CCQT 3P8DA 2BKDN 3OYYA 4BB7A 2DXTA 4XTYA 3MP8A 4XTZA 5GAMd 3EFSA 3CC7T 3G6ET 2X4XA 2YLBA 2X4WA 4FU6A 4C92B 2LCCA 3EFRA 4E7JA 2KQWA 2KAFA 2QEXA 5LJ3f 3E19A 5GAN2 4BACA 4ELZC 1Y96B 5GAOp 1M1KC 3C4SA 3UPUA 5GMKh 5LJ3e 4C8QG 1G3SA 3CCLA 4JRQA 2ZPBB 4IUVA 5FLXE 3V7CA 1U8RA 2RHIA 2RHYA 5LJ3d 3GNGA 3MEWA 4M77G 3SFMA 3QDRB 4C0DC 4M78E 2JVVA 5CCAA 1KQ2A 3M53A 3META 2GCXA 4LDXA 4M7DB 2HD0A 4OB3B 3V7SA 5I21A 3OMGA 1N8RU 3FDRA 3JCMg 3QPHA 1GXIE 3M59A 3L42A 3CCUA 1TH7A 4WF2A 2ZPGB 1LJOA 2DTIA 4J83A 5D6XA 3NFCA 1VQKA 3X26B 3FJPA 1MGQA 1NE8A 3MHXA 2JUFA 3RESA 3QYHB 3RKXA 3FC3A 3A8HB 4A53A 5CAIA 2WSEE 3VU3C 2ZGWA 5GMKe 1BYMA 4QQGA 1G3WA 1N6AA 3H8ZA 4OF1A 5GMKj 2CZ6B 2O4XB 3F70A 2K5FA 1DJ7B 3R6OA 4PLIA 1D3BB 3GNFB 5FU7B 3OYMA 3CBMA 5GAN4 2EQUA 5CKHA 3JSCA 1ZQ1A 4IUPA 3HPWA 3CCUT 1W4SA 4LD6A 5DLQE 2PUKB 2LQ8A 1VQ4T 2CZ1B 1YJNA 4C92C 2RH2A 2DXCA 4QQDA 4C5EA 1O9SA 5GMKl 4HCCA 2L89A 3QXEB 1KHIA 1WNLA 5GANg 3DKMA 2E6NA 3SB2A 2LDMA 1N9RA 4RMOA 1Y7XA 5LJ5h 3CMAA 4X34A 4F7UE 4BY6B 3CCEA 4DQ2A 3V8LA 4MMKA 2QXFA 5IAYA 2PVDB 4N4HA 4C8QE 3KXTA 4M7AE 3S3NA 4A54A 4MDXA 4M7DF 3M5AA 2DPPB 4QQ6A 3MEUA 3CMET 4M77E 3CCRT 4M7DC 5EG2A 2QQ9A 1N8RC 4C92A 3HHTB 4L6V5 1XOVA 3OSSC 5J26A 3RKYA 5HKCA 3CC2T 1BI0A 4J7FA 1YJ9A 3CCJT 2DZCA 3T9NA 4PJOE 1VQLT 1K9MU 4JRKA 1KQ1A 4LDYA 3BY7A 5IT9E 2JN0A 1VUBA 1RL2A 1YI2T 3BDLA 4KUIA 2XG8D 1YCYA 3PIOA 3JCMV 3M54A 3QBYA 5LJ5j 3RMQA 2GF7A 2RD1A 3CPFA 3HRSA 1QVPA 4RG8A 5FU7C 4M78D 1K73C 1BKBA 3OYKA 3QUIA 5CKDA 3GF5A 3HRUA 3ZFJA 4M75E 2VUBA 5KH6A 2RJFA 3CCMT 1VQOA 2DAQA 3MP1A 3MCAB 5CQYA 4XQ3A 3S3OA 2PVOB 2MWPA 5FRNA 3PT9A 1G3TA 1X01A 2AHJB 3OBYA 4QW2A 4RCCA 3I55T 5GAOr 2V8KA 1YIJA 1VQPA 2CGHA 1N9SA 2DZ9A 1HK9A 3J81E 4F7UA 2RK1A 3HKSA 2OAUA 3M56A 5HK3A 4M7AA 2DXUA 2Y90A 2DXBA 3I56A 1VQ5T 2VV5A 3OYEA 1B34A 3DB4A 1VQ9T 3LWIA 4M78G 5GAMh 2PUOB 3UDCA 1M1FA 3INZA 1WQ7A 2MI6A 2FHDA 2P0QA 5CIUA 1OI1A 4X9DA 4ZN3A 2QTXA 1Y71A 5D6WA 2K2VA 3HL8A 3X25B 4EMHA 1BI2A 2E70A 1Q7YU 3CC4T 1WJSA 1WJRA 4N0AC 2QA4A 4M7AD 2DO3A 3N5BB 3QSUA 3JB9D 2V8JA 5KE2A 1FX7A 3C12A 5KCHA 2KSSA 5LJ3h 2RM4A 3CXCA 5FROA 5GMKm 3JCMW 1K8AU 4RCBA 1S72A 4M75A 4C0GA 4PJOD 4BD3A 1Q82U 3RIRA 5GAMj 2OTJT 3CD6A 3L1AA 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJP A;  1MGQ A;  1I5L A;  4M77 F;  3RES A;  3RKX A;  4OP0 A;  4A53 A;  5CAI A;  5GMK e;  3VU3 C;  2ZGW A;  1H64 1;  4M77 C;  5GAN 5;  5GMK j;  4F7U G;  4M78 A;  4PJO F;  3V7R A;  4XU0 A;  1D3B B;  4M7A G;  2YLC A;  2DKG A;  5GAN 4;  5LJ5 f;  4M75 D;  4XU1 A;  3JB9 G;  5GAO n;  4M75 B;  3JCM f;  1U1T A;  4XU2 A;  5LJ3 j;  3RUX A;  3SWN C;  3JCM P;  4EMK A;  4C92 C;  5LJ5 e;  4C92 E;  5GMK i;  4M7D G;  3JCM e;  4HT8 A;  5GMK l;  2HNI A;  1BIA A;  1I4K 1;  3BDU A;  1WNL A;  3SB2 A;  4F7U F;  5LJ5 d;  1N9R A;  5GAN g;  2DEQ A;  4PJO G;  5LJ5 h;  3JCM d;  4XTU A;  2E64 A;  2E1H A;  4JRI A;  4F7U E;  3JCM h;  4M7A F;  4M78 B;  4DQ2 A;  3V8J A;  3V8L A;  4MMK A;  3JB9 F;  4NL2 A;  2EAY A;  4M7A E;  4M7A C;  4C8Q E;  4C92 G;  5GAN 7;  4HA8 A;  2DJZ A;  2DVE A;  4N0A A;  4A54 A;  5GAN 6;  4M7D F;  1I81 A;  2FB7 A;  2VXF A;  4QVD A;  4M77 E;  3JCM b;  3SWN A;  4M7D C;  1JRI A;  3JCM c;  4C92 A;  4PNO A;  3RKY A;  5GAN f;  4M75 G;  4PJO C;  2DZC A;  3M4G A;  4PJO E;  4JRK A;  1KQ1 A;  3RKW A;  3BY7 A;  2JN0 A;  5GAO q;  2YHT A;  4XTV A;  4C8Q A;  1YCY A;  4J6W A;  3JCM V;  4JLI A;  5LJ5 j;  2EJ9 A;  2RD1 A;  3BFM A;  4Y91 A;  5GAN d;  5GAM g;  5GAN h;  3SWN B;  2VC8 A;  4J5Y A;  4M75 F;  4M77 A;  4M78 D;  3BW1 A;  3QUI A;  4M75 C;  4XTW A;  4M75 E;  4J6Y A;  3AHU A;  3JB9 H;  2E41 A;  4PJO A;  4V2S A;  2I2L A;  3HFN A;  4XQ3 A;  5GAO l;  3L2Z A;  4EMK B;  5GAO m;  4NL3 A;  3V8K A;  4C8Q D;  4M7D E;  1X01 A;  4C8Q B;  4RCC A;  5GAO r;  4M78 F;  1M5Q 1;  2VXE A;  4XTX A;  5LJ3 g;  1BIB A;  1I8F A;  4J6X A;  5GAM f;  4M77 D;  2CGH A;  1N9S A;  4M77 B;  4HT9 A;  1Y96 A;  1HK9 A;  2DZ9 A;  3JB9 J;  4XU3 A;  4F7U A;  5GAN e;  3JCM Q;  3RER A;  1HXD A;  5GAM e;  3HSB A;  3JB9 I;  4M7A A;  4EMG A;  2DXU A;  2Y90 A;  5GAN j;  3QO3 A;  4PJO B;  3PGG A;  2DXT A;  4XTY A;  4XTZ A;  1B34 A;  5GAM d;  3EFS A;  2YLB A;  4M78 G;  5GAM h;  4C92 D;  3FIF A;  1WQW A;  4JUV A;  4C92 B;  3INZ A;  4QVC A;  1WQ7 A;  3GIB A;  3EFR A;  4M7D A;  2EJF A;  3QHS A;  1U1S A;  5LJ3 f;  2DTH A;  3FB9 A;  4X9D A;  5GAN 2;  3JCM J;  2QTX A;  1WPY A;  4EMH A;  5GAN 3;  1Y96 B;  5GAO p;  5GAN 8;  4F7U B;  2EWN A;  4N0A C;  4C8Q G;  5GMK h;  5LJ3 e;  4M7A D;  2RB6 A;  4M7A B;  1M8V A;  3QSU A;  3V7C A;  4C92 F;  3JB9 D;  4NOY A;  3HFO A;  5LJ3 d;  2RA2 A;  1B34 B;  4M78 C;  4M77 G;  5DY9 A;  4M78 E;  5LJ3 h;  2RM4 A;  1KQ2 A;  4M7D D;  2K57 A;  4M7D B;  1D3B A;  5GMK m;  1JBM A;  1LOJ A;  3V7S A;  3JCM W;  5LJ5 g;  2DTO A;  2EJG A;  4RCB A;  5I21 A;  3JCM X;  2FYK A;  3JCM g;  2E65 A;  4M75 A;  4MML A;  4C8Q F;  4EMK C;  2E10 A;  4PJO D;  3RIR A;  1TH7 A;  4WF2 A;  5GAM j;  1LNX A;  1LJO A;  2DTI A;  4C8Q C;  4X9C A;  3L1A A; 
#chains in the Genus database with same CATH topology
 5GJV B;  1JJ2 S;  2L0A A;  1S1N A;  1JJ2 A;  4M7A G;  3A8O B;  3EGX B;  2R57 A;  4M75 D;  3GLX A;  3JCM f;  2AZV A;  3CCS Q;  4R56 A;  2D0N A;  2D9T A;  2QQS A;  5IHN A;  2KY9 A;  4J9H A;  1Q7Y C;  1YHQ T;  1XQH A;  5ECA A;  2HCK A;  1VQ6 Q;  4AT1 B;  3G4S A;  3J80 E;  4E47 A;  4QVD A;  3G7Z A;  1OUL A;  1AVZ C;  3AT1 B;  2DBK A;  4PNO A;  1SRM A;  3OYJ A;  4Y28 E;  4M75 G;  2YRD A;  5HCK A;  3VV0 A;  1YIT A;  1T0H A;  1KQS P;  2C06 A;  1AOJ A;  2VC8 A;  2HQH A;  3OYL A;  4O6J A;  3TCJ A;  4JS4 A;  2JTF A;  4EMK B;  2DLP A;  1RAE B;  3TRE A;  4M78 F;  2R5A A;  4BE0 A;  4M77 B;  4L5G A;  2X4J A;  4HVW A;  3RER A;  1RAC B;  2DET A;  2VAS A;  3QG1 A;  1W6X A;  1SPK A;  1YJW Q;  1VQM Q;  4KBM B;  1YJ9 T;  1Q7Y R;  2YWW A;  2DER A;  1UDL A;  2DK3 A;  2OI3 A;  4E7K A;  1OOT A;  2M51 A;  5D6Y A;  2OTL Q;  1M8V A;  2CSI A;  4BY6 C;  5DY9 A;  2KR3 A;  1NLP C;  1VA7 A;  1D3B A;  1ZBJ A;  3X28 B;  2C0I A;  1VQO T;  2CZ0 B;  2GGR A;  4C8Q F;  4JJD A;  1I5L A;  1UFF A;  1OU8 A;  3EH2 A;  5EC7 A;  5CVI A;  4PJO F;  2YLC A;  1VQ7 A;  3A8L B;  3I56 T;  1LVK A;  1E6G A;  3CCQ Q;  1R8O B;  3JCM P;  1SG5 A;  3MEA A;  4JDS A;  3CC7 Q;  1M8M A;  4ZTJ A;  1RI0 A;  2O9V A;  2P4R A;  2LCS A;  1OZ2 A;  1X6B A;  3G71 A;  1RLQ C;  2EFI A;  2QA4 T;  1TOV A;  1TG0 A;  4ORZ A;  2HDA A;  3ULR B;  2FPD A;  2QI2 A;  5KE3 A;  3ZBD A;  4E7H A;  2K3Y A;  2QEX Q;  2JOY A;  5HK0 A;  1I07 A;  1D09 B;  4Z89 A;  1XNI A;  2JM9 A;  2QG9 B;  4FT2 A;  2JM8 A;  4ESR A;  4ZGJ B;  4RUG A;  2BIV A;  3QJ6 A;  2L5Q A;  4ZGD B;  1SF9 A;  4B6M A;  4IUR A;  4PJM A;  2PTK A;  4HXJ A;  3C95 A;  2CUB A;  3E1S A;  4BI8 B;  5FRM A;  2FZK B;  3PMT A;  1I8F A;  1RAA B;  4HT9 A;  1FWZ A;  1WZO A;  3TQ7 P;  3G4S T;  1XTD A;  1C0M A;  4LDV A;  5A0G A;  3NMZ C;  3CME Q;  1MMD A;  3ME9 A;  1WQW A;  2ZPE B;  1OPL A;  4EPC A;  1YIT T;  3CCJ Q;  3EG9 A;  1VQL Q;  2EWN A;  1RAI B;  2RB6 A;  1B34 B;  4M78 C;  3EHR A;  1BCO A;  3CEY A;  1LOJ A;  2P0K A;  2P0P A;  4BI4 A;  3CC2 A;  2E10 A;  1D1C A;  1VIF A;  3SHW A;  4AG1 C;  2COY A;  1D0Z A;  1YI2 A;  1U06 A;  1QVF P;  4DA4 A;  1FMW A;  2QGF B;  4O5V A;  2YRV A;  1UJ0 A;  1M1G A;  3OYH A;  3VUZ A;  4BDY A;  3URG A;  5LJ5 f;  4XU1 A;  3QWX X;  2NWM A;  4PFZ A;  1T3L A;  4II1 A;  1V29 B;  1PRL C;  3H0H A;  3I55 A;  4BE1 A;  4M7A F;  1SSF A;  1ZLM A;  2KT1 A;  2VGM A;  4DBH A;  4A4K A;  2COZ A;  1H3H A;  5GAN 7;  4D8D A;  1GFC A;  2NUT B;  3C0C A;  1C6V X;  1VQ9 A;  1VYU A;  1RAB B;  3S3M A;  5CO7 A;  4PJO C;  4ZN1 A;  1G5V A;  2E4H A;  1QVF S;  4RTZ A;  2LC4 A;  5D7U A;  4JLI A;  4OMM A;  1CKA A;  1PM3 A;  4AFU C;  1QVF A;  1KSW A;  1K4U S;  4M75 F;  1VQ7 T;  4J9F A;  4C0D B;  1TWB A;  3RDV A;  2LQK A;  1K73 U;  4BUG A;  3JAM E;  1BU1 A;  2F1L A;  1WHM A;  3O5Z A;  1BI1 A;  4LE9 A;  3QJY A;  3UAT A;  1UGR B;  3G71 T;  4XTX A;  4J6X A;  1N8R R;  2EQM A;  2MPX C;  3CCL Q;  2CSQ A;  3JCM Q;  5GAM e;  2DF6 A;  1H92 A;  1M30 A;  3EG3 A;  4ANJ A;  2KQW A;  2D8H A;  5LJ3 f;  2KBT A;  5FLX E;  4OMQ A;  4AFZ C;  2RHI A;  1K73 C;  2HSE B;  3QDR B;  4OML A;  4M78 E;  3MET A;  2A37 A;  2HD0 A;  3JCM g;  2JS0 A;  1YJN Q;  2FRY A;  1SSH A;  4DEX A;  1G83 A;  1VQK A;  3X26 B;  3QYH B;  3RNJ A;  5FW9 A;  2WSE E;  2L2P A;  2O4X B;  2NUP B;  2K5F A;  1VYT A;  1EZZ B;  3OYM A;  5GAN 4;  3JSC A;  5DLQ E;  2LQ8 A;  2XMF A;  3VS3 A;  2EGA A;  5GMK l;  2L89 A;  1WNL A;  1Y7X A;  4BY6 B;  1IHW A;  4FYY B;  5IAY A;  4N4H A;  4C8Q E;  3KXT A;  4A54 A;  4QQ6 A;  3EG1 A;  4C92 A;  3HHT B;  1XOV A;  3OSS C;  3CC2 T;  2D8J A;  1ZUK A;  2B86 A;  2HL3 A;  4PJO E;  1K9M U;  4LDY A;  1RL2 A;  2CT4 A;  1YI2 T;  2XG8 D;  3PIO A;  2VWF A;  5LJ5 j;  1YIJ Q;  2GF7 A;  2RD1 A;  1K73 R;  3HRS A;  1VQP Q;  1QVP A;  5FU7 C;  1RUW A;  4M78 D;  1QCO A;  1AT1 B;  1UG1 A;  2RJF A;  3MP1 A;  1TUD A;  1YWO A;  2DNU A;  2AHJ B;  4QW2 A;  3I55 T;  2MIO A;  1FMK A;  5HK3 A;  4PFO A;  2DXB A;  1VQ9 T;  4M78 G;  1M1F A;  2VKN A;  5CIU A;  2P0Q A;  1OI1 A;  4ZN3 A;  2DO3 A;  1TTH B;  5KCH A;  2KSS A;  1WHG A;  3G6E Q;  3CXC A;  2CUD A;  3JCM W;  4FYX B;  5IXF A;  4RCB A;  4PJO D;  2PZ1 A;  1Q82 U;  3RIR A;  1AWX A;  1OYX A;  5FWB A;  3CPW S;  1KJW A;  2XDD A;  4AFS C;  4CRI A;  1TS9 A;  2M16 A;  3OYA A;  3CPW A;  1P92 A;  1R77 A;  3L2W A;  4F16 A;  4ZTF A;  1YHQ A;  1UB4 A;  1KFZ A;  4CC2 A;  5GAO n;  5LJ3 j;  4MDW A;  4C0Z A;  1OX9 A;  1KIK A;  2DEQ A;  4PJO G;  4M78 B;  4C5H A;  5DM7 R;  3WVD B;  3OSV A;  2DVE A;  2XU8 A;  1I5O B;  5I2M A;  3CCS A;  1I0C A;  1VQN Q;  2M0Y A;  2RJD A;  2R58 A;  3TU4 K;  2A28 A;  1Q82 C;  4JJC A;  2YUP A;  2KRS A;  2ABL A;  3CCV Q;  1WX6 A;  1VQK T;  2RO0 A;  1M3C A;  1U3O A;  1VQ6 A;  5KYY B;  2OJ2 A;  1M2O A;  2EJ9 A;  5GAN d;  2BE7 D;  2G6F X;  2HBP A;  3BW1 A;  1VIE A;  2GQI A;  3VYG A;  3OYI A;  4HVV A;  1YNZ A;  2DM1 A;  4C8Q B;  2FVU A;  2HQE A;  2RI3 A;  4IUT A;  2X3W D;  3ZL7 C;  3NTK A;  2DYI A;  1Q81 U;  2JMC A;  4PJO B;  1NZ9 A;  5CR2 A;  4KH1 B;  2DIG A;  4VUB A;  1Q86 U;  1M4Z A;  2ED1 A;  1BBZ A;  3LLR A;  3OMC A;  2M02 A;  1WXU A;  2RJE A;  2GBQ A;  5A0L A;  3LGF A;  4LUE A;  2O9S A;  4P5N A;  1Q82 R;  1YJW A;  2JNG A;  1VQM A;  5KYW B;  5LJ5 g;  2L3R A;  4WCI A;  3A8G B;  2DL7 A;  2OTL A;  1QWE A;  3M55 A;  3G1J A;  3GP8 A;  1EIF A;  3SD4 A;  1Q81 C;  2QDL A;  5GAN 5;  3OYC A;  3V7R A;  2XD0 A;  2B8A A;  4RTV A;  1Q86 C;  2FEI A;  4EMK A;  1OV3 A;  1QCF A;  5C0M A;  2XID A;  2KYM A;  3M58 A;  1I4K 1;  2E1H A;  2CS7 A;  1JB0 E;  1YCS B;  2EAY A;  1VOM A;  2ZPH B;  1IO6 A;  4RTT A;  2H8H A;  3FRN A;  2FB7 A;  3CCQ A;  3JCM b;  3EGD B;  3QZ9 B;  2JW4 A;  4KRT A;  3CC7 A;  1ZBX A;  2JXB A;  4A4E A;  3M4Y A;  5CKB A;  2FZG B;  4DBF A;  1ABO A;  1UEB A;  4KT0 E;  2E12 A;  5C6S A;  4A4G A;  1BK2 A;  5GAN h;  2H3J A;  3LX7 A;  4RTW A;  2XIC A;  3CCU Q;  4AMC A;  1TUC A;  1VQ4 Q;  1KHC A;  4IIO A;  3LGL A;  2D1X A;  1Q81 R;  5LJ3 g;  3EFO B;  2JTM A;  1NEG A;  5GAN e;  4B9X A;  3HSB A;  2NYS A;  3CCS T;  4QVZ A;  2DD5 A;  1Q86 R;  2ZZD A;  4XK8 E;  3OA6 A;  3VJP A;  1I1J A;  2PVG B;  2EW3 A;  5DLO A;  2LVM A;  4JUV A;  3GIB A;  3FLG A;  1QP2 A;  1U1S A;  2VGN A;  3U23 A;  1PSE A;  2L3S A;  3LWH A;  1WGS A;  1VQ6 T;  2HSP A;  4M7A B;  1UTI A;  4C92 F;  1E6H A;  3E9F A;  3OB9 A;  2QYZ A;  4N4I A;  5CK9 A;  3CME A;  3CCR A;  5M9O A;  2BZ8 A;  4C0F A;  1WDX A;  2ZCF B;  2DTO A;  2KGT A;  4MML A;  3CCM Q;  3CCJ A;  1VQL A;  1LNX A;  2VB6 A;  4X9C A;  3L2V A;  3LW5 E;  5J39 A;  1WHL A;  2KEA A;  2CZ7 B;  2J7I A;  2QQR A;  3KUF A;  1KQS S;  2XK0 A;  1BI3 A;  4M75 B;  1AZG B;  1U5S A;  1RAH B;  1KQS A;  2MMP A;  2G3R A;  4OMO A;  4C5G A;  3D7S B;  8ATC B;  4JRP A;  4XTU A;  2E64 A;  2YXY A;  4A4H A;  3ER0 A;  3EG0 A;  3QWY A;  1ZSZ B;  4DEY A;  2DEU A;  2XDB A;  2CRE A;  1JU5 C;  3SWN A;  1YJW T;  1VQM T;  2F5T X;  2W10 A;  5J3B A;  1OPK A;  3PNW C;  3A5Z B;  3P8H A;  1BCM A;  1TSF A;  2FPE A;  2EQI A;  2OTL T;  4KGX B;  2OTJ Q;  2FZC B;  1MND A;  2V1R A;  2A08 A;  5AT1 B;  4MZT A;  3PMI A;  2FO0 A;  3C94 A;  5GAO l;  1B07 A;  1G2B A;  3V8K A;  4IKF A;  5FWC A;  2DX1 A;  4HCB A;  4XAX B;  5FU6 C;  3JB9 I;  2LT1 A;  1OQK A;  3CCQ T;  2BKD N;  1SHG A;  2COW A;  5GAM d;  3CC7 T;  2X4X A;  2YLB A;  2X4W A;  4FU6 A;  2LCC A;  3EFR A;  2LMJ A;  3E19 A;  2YDL A;  1X27 A;  3CCL A;  1G3S A;  2DL4 A;  2K6D A;  2DRM A;  3VS7 A;  4IUV A;  1GL5 A;  3V7C A;  4Z88 A;  2O88 A;  2JVV A;  5CCA A;  1KQ2 A;  1X69 A;  4GBQ A;  1SRL A;  3NPF A;  3V7S A;  3MKD A;  3OMG A;  1N8R U;  2P84 A;  3FDR A;  3QPH A;  3M59 A;  3I9Q A;  1LJO A;  4J83 A;  5D6X A;  3FJP A;  1MGQ A;  3FC3 A;  3CMA Q;  3JV3 A;  3CCE Q;  4AG2 C;  1D3B B;  1D0Y A;  3GNF B;  1TUG B;  2ROL A;  4IUP A;  4LD6 A;  2YT6 A;  2CZ1 B;  1YJN A;  4C92 C;  2RH2 A;  2L3Q A;  4C5E A;  3VS1 A;  1M2V A;  1KHI A;  3DKM A;  3SB2 A;  2LJ1 A;  4F7U E;  3V8L A;  1X2Q A;  1EX4 A;  1LPL A;  3S3N A;  4M4Z A;  3CME T;  3CCR T;  2J6O A;  4M7D C;  1N8R C;  2DRK A;  1H8K A;  5HKC A;  5KYX A;  3CCJ T;  2DZC A;  1IRX A;  1VQL T;  1AWJ A;  2HKQ B;  2JN0 A;  2A36 A;  3RMQ A;  4RG8 A;  1BKB A;  3OYK A;  2MK5 A;  3ZFJ A;  2FPF A;  2MWP A;  2PVO B;  3PT9 A;  1G3T A;  3OBY A;  4RCC A;  5GAO r;  1YIJ A;  1VQP A;  2CGH A;  1N9S A;  1KK7 A;  1HK9 A;  2DZ9 A;  3J81 E;  4F7U A;  2ED0 A;  2W0Z A;  2Y90 A;  2MYS A;  3M0S A;  2DA9 A;  2KXC A;  2VV5 A;  4RTX A;  4FYV B;  3LWI A;  5GAM h;  2FHD A;  1S72 Q;  1WHJ A;  1GRI A;  1QKW A;  1Y71 A;  2JMA A;  3HL8 A;  5D6W A;  3KFV A;  3X25 B;  3H41 A;  3CD6 Q;  1WJS A;  3N5B B;  2DVJ A;  3QSU A;  3JB9 D;  1F1B B;  1FX7 A;  4CC7 A;  2IIM A;  1K8A U;  1YWP A;  1A0N B;  1IXD A;  4C0G A;  1R0C B;  3EG9 B;  2WSF E;  2ECZ A;  1GFD A;  1N27 A;  4HCZ A;  4F7U G;  1K0S A;  5I22 A;  4Z02 A;  3JB9 G;  2BZY A;  1Y07 A;  2ZPF B;  4C92 E;  4F17 A;  3JCM e;  2MWO A;  2F69 A;  2RHZ A;  4CC3 A;  3CCL T;  1M3A A;  4NL2 A;  2RQV A;  2CP3 A;  2FG0 A;  2VXF A;  1K8A C;  5I11 A;  3VYH B;  2D6F A;  1IGU A;  5GAN f;  1G3Y A;  1RAD B;  3FJ5 A;  3M4G A;  1W2B P;  5GAO q;  1B7T A;  3QDF A;  4Y91 A;  4E7L A;  1VQN A;  2MOX A;  4OB0 B;  2J6K A;  1QW1 A;  4DBQ A;  2EQK A;  3UF4 A;  1YJN T;  3AHU A;  3CCV A;  4KUL A;  3IQL A;  5GAO m;  3H0F A;  1YI2 Q;  1O75 A;  4RKU E;  1M5Q 1;  2NLU A;  1Y96 A;  2AKK A;  2AIR B;  4FT4 A;  2ENM A;  1HXD A;  5A2Q E;  1UGP B;  3A98 A;  1QLY A;  4C92 D;  1NJI U;  3QZ5 B;  4M7D A;  2EJF A;  1W2B S;  1PD0 A;  3L2R A;  3M0P A;  4JJN K;  1MMA A;  2YRC A;  1WHK A;  1E7O A;  3OY9 A;  2K4Y A;  4IIM A;  1K8A R;  1X75 C;  2DFU A;  1KC8 R;  4M7D D;  4OMF B;  4ZGE B;  4CI0 C;  2E65 A;  4EMK C;  3WXM B;  4MZP A;  2MCN A;  5IHK A;  3VS5 A;  4C92 G;  1Q95 G;  1PG5 B;  4PKC C;  4A63 B;  3NTH A;  1YIJ T;  1NEB A;  1LCK A;  1VQP T;  4M77 C;  1WIE A;  4BI3 A;  4E7I A;  1UJY A;  3LH0 A;  3ZEH A;  2AZS A;  2RPN A;  4XU0 A;  2Y4X A;  4MZM A;  1NJI C;  3GOX A;  1C1A A;  3RUX A;  2O2O A;  4KGV B;  1ZX6 A;  2JZ2 A;  4M7D G;  2RJC A;  1M90 U;  1ZUY A;  2K3X A;  4E2F B;  1HYO A;  4LXC A;  4GLM A;  4JRI A;  1GCQ C;  5KYU A;  3ASK A;  3V8J A;  3EAE A;  1W1F A;  2LX7 A;  3E9G A;  1VQ8 A;  2RNA A;  1HD3 A;  2E5K A;  2CP5 A;  3NTI A;  3R6N A;  4L59 A;  3JCM c;  1QCN A;  4FIB A;  4J9C A;  1KD1 R;  2RQW A;  4ATO A;  3DLM A;  1Z9Q A;  2L8D A;  1UUE A;  2GTO A;  2DIQ A;  5CKE A;  3PTA A;  2M1H A;  2XKO C;  4J6Y A;  1D1B A;  2E41 A;  5KCO A;  1J3T A;  3HFN A;  1M90 C;  4OB2 B;  4RG2 A;  2KRO A;  1RLP C;  2LX9 A;  1IZ6 A;  2QQB A;  2LZ6 B;  5CKF A;  2OX7 A;  1MV3 A;  3NGP A;  1NJI R;  3I5S A;  5GAN j;  1PRM C;  1WJQ A;  2GQV A;  2R5M A;  4OVA A;  1WI7 A;  1VQ4 A;  2Y4Y A;  2K5I A;  5A0D A;  2HL5 C;  3FIF A;  1T0J A;  2CP0 A;  3OS0 A;  2DTH A;  3FB9 A;  3CQT A;  3PFS A;  2CP6 A;  5GAN 3;  3EH1 A;  1VQN T;  2A0F B;  2E5Q A;  2ZPI B;  3M0Q A;  1JO8 A;  5L8R E;  3EGX A;  3CCV T;  3JCM X;  2EYZ A;  2PU9 B;  2JT4 A;  1UHC A;  1B3Q A;  2DL3 A;  4OP0 A;  1GBR A;  1UGS B;  3VRY A;  4R0K A;  4B9W A;  4HCK A;  3MP6 A;  4PJL A;  6AT1 B;  2LT4 A;  1U1T A;  1M90 R;  3CCM A;  1FYN A;  1VYV A;  2GNC A;  3SWN C;  2M0O A;  2DBM A;  5LJ5 e;  1VQ5 Q;  3VRZ A;  4HT8 A;  2RN8 A;  1NYF A;  2X35 A;  3BDU A;  4F7U F;  2O01 E;  1PC0 A;  3JB9 F;  1OX8 A;  3CBO A;  3CC4 Q;  2DJZ A;  1I81 A;  2XI9 A;  4KUD K;  4LDU A;  2KNB B;  2BZX A;  2GFA A;  3RKW A;  1JJ2 P;  1RAG B;  2C0T A;  2WSC E;  2YHT A;  2A7Y A;  2PQW A;  1PHT A;  4J6W A;  3BFM A;  2CYZ B;  4FM4 B;  3M9Q A;  3MO8 A;  4C5I A;  4M77 A;  3X20 B;  2I0N A;  3QII A;  2DMO A;  2P4T A;  2I2L A;  3TVT A;  1OZ3 A;  4NL3 A;  1ZSG A;  2OTJ A;  1WA7 A;  2IG0 A;  4GY5 A;  2VYT A;  5GAM f;  4M77 D;  3TSW A;  1YHQ Q;  1GCQ A;  1VQ8 T;  4J8O A;  2X3X D;  3OYY A;  3EFS A;  1CSK A;  2EYY A;  4E7J A;  2KAF A;  2QEX A;  2EGE A;  4ELZ C;  2LNH B;  5GAO p;  1K76 A;  3UPU A;  5GMK h;  1WFW A;  5LJ3 e;  1ZSZ A;  2X51 A;  4JRQ A;  4FW1 A;  2F2W A;  1U8R A;  1WXB A;  2RHY A;  3GNG A;  4M77 G;  3SFM A;  2E3H A;  2CH4 W;  4C0D C;  1NYG A;  3PVQ A;  2GTJ A;  2GCX A;  2DYB A;  4LDX A;  4OB3 B;  1WXT A;  3RR6 A;  5I21 A;  1GXI E;  2RMO A;  1TH7 A;  4WF2 A;  2ZPG B;  3NFC A;  4E7S A;  1XJW B;  2JUF A;  3RKX A;  3A8H B;  5GMK e;  1BYM A;  2ZGW A;  1Y57 A;  3H8Z A;  1K0X A;  1Y0M A;  2AK5 A;  5FU7 B;  3CBM A;  3CCU T;  3HPW A;  1HSQ A;  1W4S A;  1VQ4 T;  1X2K A;  2KT8 A;  2DXC A;  3THK A;  2PNI A;  4QQD A;  1O9S A;  2CP2 A;  1IGQ A;  4HCC A;  5GAN g;  1YJ9 Q;  2E6N A;  1N9R A;  1IB8 A;  1JXM A;  3CMA A;  3I35 A;  4X34 A;  1Z9Z A;  2K79 A;  4DQ2 A;  3CCE A;  2QXF A;  3H0I A;  3REA B;  4M7D F;  3M5A A;  3MEU A;  5EG2 A;  2QQ9 A;  4L6V 5;  3RKY A;  1MV0 B;  2LP5 A;  4J7F A;  3BE3 A;  1VQO Q;  4JRK A;  1KQ1 A;  2HKN A;  3VS4 A;  3BDL A;  4KUI A;  3JCM V;  2QK0 A;  3M54 A;  2CT3 A;  3M0R A;  3HRU A;  3CCM T;  3I56 Q;  4DBR A;  2DAQ A;  1CKB A;  3MCA B;  5CQY A;  1JQQ A;  4F04 B;  3S3O A;  5FRN A;  1PWT A;  2V8K A;  1M27 C;  2YUQ A;  2FRW A;  2QA4 Q;  3HKS A;  3UA7 A;  3H9N A;  2DXU A;  2RQU A;  1W70 A;  1B34 A;  1WLP B;  1ZUU A;  3DB4 A;  3UDC A;  5IHI A;  1WQ7 A;  2K2M A;  2MI6 A;  2EGC A;  4X9D A;  1FMV A;  2QTX A;  2K2V A;  2KI7 A;  3TSZ A;  1WJR A;  4N0A C;  2HBW A;  2V8J A;  4J9D A;  2CP7 A;  3C12 A;  1YN8 A;  2RM4 A;  2HMA A;  5GJW B;  1S72 A;  4BD3 A;  5GAM j;  2OTJ T;  3CD6 A;  4D8K A;  4QT7 A;  4Y92 A;  2ATC B;  2ESW A;  1AWO A;  2KYB A;  1YFN A;  1NPP A;  1QKX A;  3PVL A;  5AYF A;  3Q1J A;  2LNV A;  3G4S Q;  2DL5 A;  4FL6 A;  2NUT A;  1V1C A;  3L2Q A;  4JJB A;  4LDW A;  2QEX T;  2HNI A;  1BIA A;  1UGV A;  3JCM d;  1YIT Q;  2RHX A;  4KGZ B;  2LJ3 A;  1WHH A;  2BUD A;  3A8M B;  5GAN 6;  3X24 B;  4DOV A;  2X9H A;  4R55 A;  3PE0 A;  1M9S A;  4FYW B;  3UWN A;  3P8B B;  1PNJ A;  4X1V A;  2F5K A;  2M9U A;  2LQN A;  2YUO A;  4OB1 B;  4XTV A;  4K11 A;  4TVR A;  4OMP A;  3EG2 A;  3SWN B;  2CDT A;  3CCR Q;  3OQ5 A;  4J7I A;  3OS2 A;  3OS5 A;  2ROT A;  2LCL A;  2K5L A;  3HP9 A;  2GFU A;  3L2Z A;  2EYW A;  2F2V A;  1QP3 A;  2EKH A;  1IHV A;  2EKO A;  1AZE A;  1TXQ A;  3CMA T;  1BIB A;  4HKE A;  3CCE T;  1ABQ A;  3A1P A;  3RMS A;  2KRM A;  1UHF A;  4PK4 A;  3FEO A;  2LRQ A;  3PGG A;  3HRT A;  1QVG P;  2RQR A;  3M0T A;  3QKJ A;  4FCY A;  7AT1 B;  1QWF A;  2KK4 A;  1ACM B;  5GAN 8;  1UEC A;  4NOY A;  1ZHI A;  2RI5 A;  2D0Q B;  2F2X A;  3WVE B;  2RI2 A;  3NHN A;  2V8I A;  4EDU A;  1QMC A;  2O4X A;  3DLL A;  2NUP A;  1VQ7 Q;  4JLG A;  2EQJ A;  2CKK A;  8AT1 B;  2FYK A;  4C8Q C;  3DB3 A;  4FSS A;  2LJ0 A;  4M77 F;  3M57 A;  3L2U A;  1PKS A;  4Q5W A;  2BTT A;  3O8V A;  3G71 Q;  3SEM A;  2OAW A;  2MAM A;  1ZA2 B;  4AFQ C;  1KG1 A;  2KXD A;  2DJQ A;  2DKG A;  2RHU A;  1MHN A;  1T3S A;  1QVG S;  1WYX A;  4FW2 A;  5HY6 A;  3TEE A;  4RTU A;  1QVG A;  5GMK i;  3OBW A;  2IVW A;  1NM7 A;  1KC8 U;  5L23 A;  3JCM h;  2L3P A;  1OEB A;  4LNP A;  4N0A A;  2K7A A;  1JRI A;  3SDZ A;  1X6G A;  3G6E A;  2E6Z A;  4NS5 A;  1M2V B;  1S72 T;  1AWW A;  4OGE A;  4YTL A;  2JTE A;  1PSF A;  3CD6 T;  9ATC B;  4LUD A;  4J9B A;  1NPR A;  3MEV A;  5GAM g;  4FSX A;  2Z0W A;  4OGC A;  5IN1 A;  5KYX B;  3OYD A;  3OW2 P;  4V2S A;  2KMT A;  2FL7 A;  3MJX A;  4M7D E;  3KBG A;  3RBB B;  1AHJ B;  1KC8 C;  1YBY A;  2VXE A;  2HQX A;  1MMG A;  1AD5 A;  2QDY B;  2EBP A;  2WAC A;  4EMG A;  3QO3 A;  2DD4 A;  2HEQ A;  1KD1 U;  5I2S A;  2KVQ G;  2EVR A;  4QVC A;  4PLL A;  1D1A A;  3QHS A;  2BE9 B;  1N5Z A;  3CC2 Q;  2AKL A;  3JCM J;  1X6O A;  3CBP A;  1SKU B;  2CH4 A;  2KDS A;  1WPY A;  3UT1 A;  4F7U B;  4BE2 A;  4LN2 A;  5CQX A;  1X43 A;  4PL6 A;  3OYG A;  3HFO A;  2LTO A;  2QAZ A;  5KYN A;  2RA2 A;  2XHC A;  4KH0 B;  3PIP A;  2K57 A;  3UA6 A;  3VS0 A;  3OW2 S;  5LL6 S;  1JBM A;  3LH5 A;  1UGQ B;  2EJG A;  3VUB A;  3OW2 A;  2QQA A;  2EYQ A;  3JRZ A;  3LYI A;  3VKI A;  2YUN A;  3I55 Q;  1H64 1;  2QTV A;  2VVK A;  4EIK A;  4J9I A;  4DOW A;  2HZY A;  4M78 A;  1W2B A;  1KD1 C;  1NG2 A;  4JZ4 A;  4BDZ A;  4XU2 A;  3QYG B;  2KE9 A;  4ME7 A;  2KRN A;  2HAX A;  4D6W A;  4A4F A;  1VQ9 Q;  3GPL A;  2C0O A;  4LD9 K;  2H3E B;  1GBQ A;  5LJ5 d;  3VS2 A;  1IRE B;  2V1Q A;  2JJ9 A;  4WTO B;  4GLK A;  3CXC P;  2LQW A;  4M7A C;  2RK2 A;  3GBQ A;  4HA8 A;  3OS1 A;  5KYY A;  1NLO C;  4IUU A;  5FU6 B;  1MNE A;  1G8X A;  1VQ5 A;  5IXB A;  4JPB W;  4ELY C;  3CPW P;  4F14 A;  2X4Y A;  1D0X A;  2EIF A;  4JZ3 A;  2EPD A;  4J9G A;  3S6W A;  3CC4 A;  2XDP A;  4C8Q A;  2YSQ A;  3OYN A;  1M1K U;  3J7A F;  3OYF A;  2RQT A;  4J5Y A;  1H3Z A;  1K9M C;  4HVU A;  4UC4 A;  4M75 C;  4XTW A;  3JB9 H;  4PJO A;  2A3L A;  3H6Z A;  5IH2 A;  3OYB A;  1JXO A;  3REB B;  4C8Q D;  4IUQ A;  2J06 A;  4JS5 A;  3CXC S;  4CC4 B;  4N4G A;  3MPU B;  1ZSZ C;  3JB9 J;  4PJJ A;  4XU3 A;  2MF2 A;  3P8D A;  1K9A A;  4BB7 A;  2DXT A;  2J6F A;  3MP8 A;  4XTY A;  4XTZ A;  3G6E T;  2SEM A;  4C92 B;  2DL8 A;  2V26 A;  5KYW A;  1PCX A;  3EGU A;  1NBE B;  5GAN 2;  4BAC A;  1Y96 B;  1M1K C;  3C4S A;  1VQK Q;  4C8Q G;  1JEG A;  1V76 A;  2DE0 X;  2ZPB B;  1BB9 A;  2J05 A;  5LJ3 d;  1K1Z A;  3MEW A;  4E7Z A;  2RF0 A;  2K3B A;  3M53 A;  4M7D B;  1YP5 A;  1HJD A;  4J9E A;  4RTY A;  2DIL A;  3L42 A;  3CCU A;  2SRC A;  2DTI A;  3MHX A;  1NE8 A;  1MUZ A;  1UE9 A;  3RES A;  4A53 A;  3I5R A;  5CAI A;  1GCP A;  3VU3 C;  1QQJ A;  4QQG A;  1G3W A;  1N6A A;  4OF1 A;  1K9M R;  5GMK j;  3VS6 A;  2CZ6 B;  3F70 A;  3R6O A;  1DJ7 B;  4PLI A;  1EFN A;  1OU9 A;  2EQU A;  5CKH A;  1ZQ1 A;  1PKT A;  2PUK B;  2JS2 A;  4Z8A A;  3HTR A;  3EGD A;  2QAS A;  3QXE B;  4PFP A;  2LDM A;  4RMO A;  5LJ5 h;  4MMK A;  4OMN A;  4M7A E;  2PVD B;  2K9G A;  4MDX A;  2O31 A;  4E6R A;  1AEY A;  2DPP B;  4M77 E;  5J26 A;  1BI0 A;  2QGG A;  1YJ9 A;  3T9N A;  5KYU B;  1M1K R;  1SHF A;  3BY7 A;  5IT9 E;  1VUB A;  1YCY A;  1M3B A;  3QBY A;  1MMN A;  3CPF A;  3EFO A;  3EHQ A;  3QUI A;  5CKD A;  3GF5 A;  1PD1 A;  4QKU A;  4M75 E;  2VUB A;  5KH6 A;  3M0U A;  1ZA1 B;  1VQO A;  4XQ3 A;  1ARK A;  1X01 A;  2E3I A;  1RAF B;  3E2U A;  4ZNX A;  2RK1 A;  2OAU A;  3M56 A;  4M7A A;  3I56 A;  1VQ5 T;  3OYE A;  2NUZ A;  2PUO B;  3INZ A;  2ZAE A;  4EMH A;  1BI2 A;  2E70 A;  1Q7Y U;  3CC4 T;  2EYX A;  2QA4 A;  4M7A D;  1VQ8 Q;  1SEM A;  2IPO B;  5KE2 A;  4PJN A;  5LJ3 h;  1RI9 A;  2AT1 B;  5FRO A;  5GMK m;  1R0B G;  4M75 A;  1TU0 B;  3L1A A;  1FXX A; 
#chains in the Genus database with same CATH homology
 1OYX A;  3CPW S;  2WSF E;  2XDD A;  4CRI A;  1JJ2 S;  2M16 A;  3OYA A;  3CPW A;  1P92 A;  1NPP A;  1N27 A;  4HCZ A;  5AYF A;  4F7U G;  3Q1J A;  3L2W A;  4ZTF A;  1JJ2 A;  4M7A G;  3A8O B;  1YHQ A;  1UB4 A;  2LNV A;  2R57 A;  4M75 D;  4Z02 A;  3JB9 G;  3GLX A;  1Y07 A;  3JCM f;  5GAO n;  5LJ3 j;  4FL6 A;  4R56 A;  2ZPF B;  4MDW A;  4C0Z A;  2D9T A;  4C92 E;  2QQS A;  3L2Q A;  3JCM e;  2MWO A;  4LDW A;  2F69 A;  2QEX T;  2RHZ A;  2HNI A;  1BIA A;  2KY9 A;  1Q7Y C;  2DEQ A;  4PJO G;  3JCM d;  3CCL T;  1YHQ T;  4M78 B;  2RHX A;  4C5H A;  1XQH A;  4NL2 A;  5DM7 R;  3WVD B;  3OSV A;  2DVE A;  2XU8 A;  2BUD A;  3A8M B;  5GAN 6;  3G4S A;  3X24 B;  3J80 E;  5I2M A;  2VXF A;  4DOV A;  4E47 A;  3G7Z A;  4QVD A;  3CCS A;  1K8A C;  2RJD A;  4R55 A;  2R58 A;  3TU4 K;  1M9S A;  3UWN A;  4PNO A;  3VYH B;  2D6F A;  3P8B B;  1Q82 C;  3OYJ A;  5GAN f;  1G3Y A;  4M75 G;  4Y28 E;  2F5K A;  3M4G A;  2M9U A;  3VV0 A;  1YIT A;  1VQK T;  5GAO q;  4OB1 B;  2RO0 A;  4XTV A;  1VQ6 A;  4TVR A;  2EJ9 A;  5GAN d;  4Y91 A;  4E7L A;  2C06 A;  3SWN B;  1VQN A;  2HBP A;  2VC8 A;  4OB0 B;  3BW1 A;  1QW1 A;  3OQ5 A;  3OYL A;  1VIE A;  4O6J A;  2EQK A;  3VYG A;  4J7I A;  3OS2 A;  3TCJ A;  1YJN T;  3AHU A;  3OS5 A;  3OYI A;  2LCL A;  3CCV A;  4KUL A;  4JS4 A;  2K5L A;  2JTF A;  3HP9 A;  2GFU A;  3L2Z A;  4EMK B;  5GAO m;  3TRE A;  1O75 A;  4RKU E;  1QP3 A;  2FVU A;  4C8Q B;  2EKO A;  4M78 F;  1M5Q 1;  2NLU A;  2HQE A;  2R5A A;  1BIB A;  3CMA T;  4HKE A;  4BE0 A;  2RI3 A;  3CCE T;  4IUT A;  4M77 B;  4L5G A;  1Y96 A;  2X4J A;  3RMS A;  3NTK A;  1Q81 U;  3RER A;  4FT4 A;  5A2Q E;  1HXD A;  3FEO A;  4PJO B;  2LRQ A;  3PGG A;  1NZ9 A;  3HRT A;  1UGP B;  3QG1 A;  5CR2 A;  1NJI U;  4C92 D;  3QKJ A;  3QZ5 B;  4VUB A;  2DIG A;  4KBM B;  1YJ9 T;  1Q86 U;  4M7D A;  2EJF A;  1W2B S;  1M4Z A;  2DK3 A;  4E7K A;  3L2R A;  3LLR A;  2KK4 A;  3OMC A;  5D6Y A;  4JJN K;  5GAN 8;  2RJE A;  1M8V A;  3OY9 A;  4NOY A;  2K4Y A;  1ZHI A;  2RI5 A;  2D0Q B;  3WVE B;  5A0L A;  1X75 C;  2RI2 A;  3LGF A;  5DY9 A;  2V8I A;  4BY6 C;  4EDU A;  2O4X A;  4P5N A;  3DLL A;  4M7D D;  1YJW A;  2JNG A;  4OMF B;  4ZGE B;  1VQM A;  1D3B A;  4CI0 C;  4JLG A;  3X28 B;  1VQO T;  5LJ5 g;  2CZ0 B;  2CKK A;  2EQJ A;  2L3R A;  2FYK A;  2E65 A;  4C8Q F;  4EMK C;  3WXM B;  4MZP A;  4C8Q C;  3A8G B;  3DB3 A;  2OTL A;  4C92 G;  3M55 A;  4PKC C;  1I5L A;  3NTH A;  3M57 A;  4M77 F;  3L2U A;  1YIJ T;  4Q5W A;  3O8V A;  1VQP T;  4M77 C;  3GP8 A;  1EIF A;  3SD4 A;  1Q81 C;  2MAM A;  4BI3 A;  5CVI A;  5GAN 5;  3OYC A;  4E7I A;  3LH0 A;  3ZEH A;  4PJO F;  3V7R A;  4XU0 A;  1KG1 A;  2YLC A;  1VQ7 A;  2DKG A;  2RHU A;  2Y4X A;  2B8A A;  1MHN A;  3A8L B;  4MZM A;  3I56 T;  1QVG S;  1NJI C;  3GOX A;  3RUX A;  1R8O B;  5HY6 A;  3TEE A;  3JCM P;  4EMK A;  1Q86 C;  2JZ2 A;  3MEA A;  1QVG A;  4JDS A;  5GMK i;  4M7D G;  3OBW A;  4ZTJ A;  2RJC A;  2IVW A;  2XID A;  5C0M A;  1RI0 A;  2K3X A;  3M58 A;  1I4K 1;  1M90 U;  1OZ2 A;  3G71 A;  1KC8 U;  4JRI A;  2E1H A;  2EFI A;  2QA4 T;  2CS7 A;  3JCM h;  3ASK A;  3V8J A;  1JB0 E;  3EAE A;  2EAY A;  2ZPH B;  3E9G A;  4N0A A;  1VQ8 A;  3FRN A;  5GAN j;  2FB7 A;  3CCQ A;  3NTI A;  3JCM b;  2QI2 A;  5KE3 A;  3QZ9 B;  1JRI A;  4L59 A;  3SDZ A;  3JCM c;  3ZBD A;  2K3Y A;  3CC7 A;  4E7H A;  3G6E A;  2E6Z A;  4NS5 A;  1ZBX A;  1S72 T;  4FIB A;  4OGE A;  4YTL A;  4A4E A;  3M4Y A;  1PSF A;  2JOY A;  5CKB A;  5HK0 A;  3CD6 T;  1XNI A;  4FT2 A;  4ATO A;  1UEB A;  3DLM A;  2L8D A;  4KT0 E;  2E12 A;  5C6S A;  4A4G A;  2DIQ A;  1NPR A;  3MEV A;  5CKE A;  5GAM g;  4ZGJ B;  5GAN h;  2BIV A;  3QJ6 A;  2L5Q A;  2M1H A;  2H3J A;  4FSX A;  4ZGD B;  3PTA A;  3LX7 A;  2XKO C;  4IUR A;  4OGC A;  5IN1 A;  4J6Y A;  3OYD A;  2XIC A;  2E41 A;  3C95 A;  5KCO A;  4V2S A;  2KMT A;  3HFN A;  1M90 C;  4OB2 B;  2FL7 A;  4RG2 A;  1KHC A;  3E1S A;  2LX9 A;  4M7D E;  3KBG A;  1IZ6 A;  1AHJ B;  3LGL A;  1YBY A;  4BI8 B;  1KC8 C;  5FRM A;  2VXE A;  2QQB A;  5LJ3 g;  3PMT A;  1I8F A;  2HQX A;  5CKF A;  4HT9 A;  2JTM A;  2QDY B;  1FWZ A;  5GAN e;  4B9X A;  3G4S T;  3HSB A;  2WAC A;  4EMG A;  3CCS T;  4QVZ A;  2DD5 A;  1XTD A;  1WJQ A;  2GQV A;  2R5M A;  2ZZD A;  3QO3 A;  2DD4 A;  4LDV A;  4OVA A;  4XK8 E;  5A0G A;  3OA6 A;  1KD1 U;  5I2S A;  3VJP A;  2Y4Y A;  1VQ4 A;  2PVG B;  2KVQ G;  2K5I A;  5A0D A;  3FIF A;  1WQW A;  3ME9 A;  2LVM A;  2ZPE B;  4JUV A;  4QVC A;  5DLO A;  4PLL A;  3GIB A;  3OS0 A;  3QHS A;  3FLG A;  1QP2 A;  1U1S A;  2VGN A;  4EPC A;  2DTH A;  1X6O A;  3CBP A;  3FB9 A;  3PFS A;  1PSE A;  2KDS A;  3JCM J;  1WPY A;  1YIT T;  5GAN 3;  3UT1 A;  3LWH A;  1WGS A;  4F7U B;  2EWN A;  4BE2 A;  1VQ6 T;  2RB6 A;  4M7A B;  5CQX A;  4C92 F;  4PL6 A;  3E9F A;  3OB9 A;  3OYG A;  3HFO A;  2LTO A;  1VQN T;  2E5Q A;  2RA2 A;  1B34 B;  2XHC A;  2ZPI B;  4M78 C;  4N4I A;  5CK9 A;  3CME A;  3PIP A;  2K57 A;  3CEY A;  4C0F A;  5M9O A;  3CCR A;  3OW2 S;  5LL6 S;  1JBM A;  1LOJ A;  2ZCF B;  2P0K A;  1UGQ B;  2DTO A;  2EJG A;  2P0P A;  5L8R E;  4BI4 A;  3JCM X;  3CCV T;  3CC2 A;  4MML A;  2E10 A;  2PU9 B;  3VUB A;  3CCJ A;  2QQA A;  3OW2 A;  2EYQ A;  3JRZ A;  1LNX A;  3LYI A;  1VIF A;  3VKI A;  1VQL A;  4X9C A;  3L2V A;  3LW5 E;  5J39 A;  1YI2 A;  2CZ7 B;  4OP0 A;  1UGS B;  4DA4 A;  1H64 1;  4B9W A;  4O5V A;  4DOW A;  2YRV A;  2QQR A;  3KUF A;  4M78 A;  1M1G A;  3OYH A;  3VUZ A;  4BDY A;  1W2B A;  3MP6 A;  1KD1 C;  3URG A;  5LJ5 f;  1KQS S;  4XU1 A;  2LT4 A;  4BDZ A;  2XK0 A;  1BI3 A;  4M75 B;  1U1T A;  4XU2 A;  3QYG B;  3CCM A;  3SWN C;  2M0O A;  4ME7 A;  1KQS A;  2HAX A;  5LJ5 e;  4II1 A;  4D6W A;  1V29 B;  4A4F A;  3GPL A;  4HT8 A;  4LD9 K;  3I55 A;  2MMP A;  2X35 A;  3BDU A;  2G3R A;  4F7U F;  2O01 E;  4C5G A;  5LJ5 d;  1IRE B;  4BE1 A;  4M7A F;  4JRP A;  4GLK A;  2E64 A;  1SSF A;  4XTU A;  2VGM A;  4A4H A;  4A4K A;  3JB9 F;  4M7A C;  3ER0 A;  3CBO A;  2RK2 A;  5GAN 7;  4HA8 A;  3OS1 A;  2DJZ A;  2XDB A;  1I81 A;  4IUU A;  5FU6 B;  3SWN A;  1YJW T;  1VQM T;  1VQ5 A;  2F5T X;  2XI9 A;  4KUD K;  1VQ9 A;  5J3B A;  4ELY C;  3PNW C;  3A5Z B;  4LDU A;  5CO7 A;  3P8H A;  2X4Y A;  3S3M A;  4PJO C;  4ZN1 A;  1G5V A;  2GFA A;  3RKW A;  2EIF A;  2OTL T;  2WSC E;  2YHT A;  2A7Y A;  3S6W A;  1QVF S;  3CC4 A;  2PQW A;  2XDP A;  2LC4 A;  4C8Q A;  4J6W A;  3OYN A;  1M1K U;  3J7A F;  4JLI A;  4MZT A;  3BFM A;  2CYZ B;  4FM4 B;  3OYF A;  3M9Q A;  1QVF A;  3MO8 A;  4C5I A;  4M77 A;  4J5Y A;  4M75 F;  3X20 B;  1K9M C;  4C0D B;  1VQ7 T;  1H3Z A;  4UC4 A;  2LQK A;  3PMI A;  1K73 U;  4M75 C;  4BUG A;  3QII A;  4XTW A;  3JAM E;  3JB9 H;  4PJO A;  2P4T A;  2I2L A;  1OZ3 A;  2A3L A;  3C94 A;  3H6Z A;  1BI1 A;  5GAO l;  4NL3 A;  3OYB A;  3QJY A;  3V8K A;  4C8Q D;  2OTJ A;  4IUQ A;  1UGR B;  3G71 T;  4JS5 A;  3CXC S;  4XTX A;  4IKF A;  4N4G A;  2IG0 A;  4GY5 A;  4J6X A;  2VYT A;  5GAM f;  4M77 D;  4HCB A;  2EQM A;  2XD0 A;  4XAX B;  3JB9 J;  4XU3 A;  3JCM Q;  1VQ8 T;  2MF2 A;  5GAM e;  5FU6 C;  3JB9 I;  4J8O A;  2LT1 A;  3CCQ T;  3P8D A;  2BKD N;  3OYY A;  4BB7 A;  2DXT A;  4XTY A;  3MP8 A;  4XTZ A;  5GAM d;  3EFS A;  3CC7 T;  3G6E T;  2X4X A;  2YLB A;  2X4W A;  4FU6 A;  4C92 B;  2LCC A;  3EFR A;  4E7J A;  2KQW A;  2KAF A;  2QEX A;  5LJ3 f;  3E19 A;  5GAN 2;  4BAC A;  4ELZ C;  1Y96 B;  5GAO p;  1M1K C;  3C4S A;  3UPU A;  5GMK h;  5LJ3 e;  4C8Q G;  1G3S A;  3CCL A;  4JRQ A;  2ZPB B;  4IUV A;  5FLX E;  3V7C A;  1U8R A;  2RHI A;  2RHY A;  5LJ3 d;  3GNG A;  3MEW A;  4M77 G;  3SFM A;  3QDR B;  4C0D C;  4M78 E;  2JVV A;  5CCA A;  1KQ2 A;  3M53 A;  3MET A;  2GCX A;  4LDX A;  4M7D B;  2HD0 A;  4OB3 B;  3V7S A;  5I21 A;  3OMG A;  1N8R U;  3FDR A;  3JCM g;  3QPH A;  1GXI E;  3M59 A;  3L42 A;  3CCU A;  1TH7 A;  4WF2 A;  2ZPG B;  1LJO A;  2DTI A;  4J83 A;  5D6X A;  3NFC A;  1VQK A;  3X26 B;  3FJP A;  1MGQ A;  1NE8 A;  3MHX A;  2JUF A;  3RES A;  3QYH B;  3RKX A;  3FC3 A;  3A8H B;  4A53 A;  5CAI A;  2WSE E;  3VU3 C;  2ZGW A;  5GMK e;  1BYM A;  4QQG A;  1G3W A;  1N6A A;  3H8Z A;  4OF1 A;  5GMK j;  2CZ6 B;  2O4X B;  3F70 A;  2K5F A;  1DJ7 B;  3R6O A;  4PLI A;  1D3B B;  3GNF B;  5FU7 B;  3OYM A;  3CBM A;  5GAN 4;  2EQU A;  5CKH A;  3JSC A;  1ZQ1 A;  4IUP A;  3HPW A;  3CCU T;  1W4S A;  4LD6 A;  5DLQ E;  2PUK B;  2LQ8 A;  1VQ4 T;  2CZ1 B;  1YJN A;  4C92 C;  2RH2 A;  2DXC A;  4QQD A;  4C5E A;  1O9S A;  5GMK l;  4HCC A;  2L89 A;  3QXE B;  1KHI A;  1WNL A;  5GAN g;  3DKM A;  2E6N A;  3SB2 A;  2LDM A;  1N9R A;  4RMO A;  1Y7X A;  5LJ5 h;  3CMA A;  4X34 A;  4F7U E;  4BY6 B;  3CCE A;  4DQ2 A;  3V8L A;  4MMK A;  2QXF A;  5IAY A;  2PVD B;  4N4H A;  4C8Q E;  3KXT A;  4M7A E;  3S3N A;  4A54 A;  4MDX A;  4M7D F;  3M5A A;  2DPP B;  4QQ6 A;  3MEU A;  3CME T;  4M77 E;  3CCR T;  4M7D C;  5EG2 A;  2QQ9 A;  1N8R C;  4C92 A;  3HHT B;  4L6V 5;  1XOV A;  3OSS C;  5J26 A;  3RKY A;  5HKC A;  3CC2 T;  1BI0 A;  4J7F A;  1YJ9 A;  3CCJ T;  2DZC A;  3T9N A;  4PJO E;  1VQL T;  1K9M U;  4JRK A;  1KQ1 A;  4LDY A;  3BY7 A;  5IT9 E;  2JN0 A;  1VUB A;  1RL2 A;  1YI2 T;  3BDL A;  4KUI A;  2XG8 D;  1YCY A;  3PIO A;  3JCM V;  3M54 A;  3QBY A;  5LJ5 j;  3RMQ A;  2GF7 A;  2RD1 A;  3CPF A;  3HRS A;  1QVP A;  4RG8 A;  5FU7 C;  4M78 D;  1K73 C;  1BKB A;  3OYK A;  3QUI A;  5CKD A;  3GF5 A;  3HRU A;  3ZFJ A;  4M75 E;  2VUB A;  5KH6 A;  2RJF A;  3CCM T;  1VQO A;  2DAQ A;  3MP1 A;  3MCA B;  5CQY A;  4XQ3 A;  3S3O A;  2PVO B;  2MWP A;  5FRN A;  3PT9 A;  1G3T A;  1X01 A;  2AHJ B;  3OBY A;  4QW2 A;  4RCC A;  3I55 T;  5GAO r;  2V8K A;  1YIJ A;  1VQP A;  2CGH A;  1N9S A;  2DZ9 A;  1HK9 A;  3J81 E;  4F7U A;  2RK1 A;  3HKS A;  2OAU A;  3M56 A;  5HK3 A;  4M7A A;  2DXU A;  2Y90 A;  2DXB A;  3I56 A;  1VQ5 T;  2VV5 A;  3OYE A;  1B34 A;  3DB4 A;  1VQ9 T;  3LWI A;  4M78 G;  5GAM h;  2PUO B;  3UDC A;  1M1F A;  3INZ A;  1WQ7 A;  2MI6 A;  2FHD A;  2P0Q A;  5CIU A;  1OI1 A;  4X9D A;  4ZN3 A;  2QTX A;  1Y71 A;  5D6W A;  2K2V A;  3HL8 A;  3X25 B;  4EMH A;  1BI2 A;  2E70 A;  1Q7Y U;  3CC4 T;  1WJS A;  1WJR A;  4N0A C;  2QA4 A;  4M7A D;  2DO3 A;  3N5B B;  3QSU A;  3JB9 D;  2V8J A;  5KE2 A;  1FX7 A;  3C12 A;  5KCH A;  2KSS A;  5LJ3 h;  2RM4 A;  3CXC A;  5FRO A;  5GMK m;  3JCM W;  1K8A U;  4RCB A;  1S72 A;  4M75 A;  4C0G A;  4PJO D;  4BD3 A;  1Q82 U;  3RIR A;  5GAM j;  2OTJ T;  3CD6 A;  3L1A A;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...