3JCMh

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
77
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAAVKLNEIYIRGTFIKFIKLQDNIIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 77
sequence length 88
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmh00
5GAOn 5LJ5j 2CGHA 4XTZA 3RKYA 3JCMJ 2FB7A 5CAIA 4M7AC 4C8QA 2RA2A 1M5Q1 3RESA 4HT8A 4XU3A 2QTXA 4JRIA 4C92A 1WNLA 3JCMP 4XU1A 4PJOF 2HNIA 2DTOA 2VC8A 4QVCA 3QSUA 1X01A 5GAN6 4M77C 4J6XA 4N0AC 3INZA 4OP0A 4A53A 4PJOD 2DVEA 5GAMf 1U1TA 2EJFA 2RB6A 4M78E 4X9CA 5GMKe 3VU3C 4DQ2A 4XTWA 5DY9A 5GAN2 2DEQA 2DKGA 4J6YA 3RKWA 4N0AA 4M78B 4M77G 2DTHA 4M75E 1BIAA 1D3BA 2RM4A 4J5YA 4F7UA 5LJ5d 1H641 2E65A 3BFMA 5GMKh 4C92F 4M75B 3EFSA 3RIRA 2EJGA 2EJ9A 4C8QD 5LJ3e 3SWNC 4M7AA 1KQ2A 3SB2A 1Y96A 1WQWA 4M7DG 4EMGA 4C92D 4C8QE 5GAOl 1N9RA 2DZCA 4NL2A 1B34A 2DXUA 3JCMV 4C92E 3JCMW 4C8QB 4MMLA 1WQ7A 2E10A 4M78F 4NOYA 4C92B 4EMKC 5GMKj 3M4GA 2K57A 5LJ5f 3JCMe 4M78D 5GANe 1HK9A 4M75F 3V8JA 5GAOp 4PJOG 4EMKA 3FIFA 2JN0A 5LJ3g 4M7AF 4M75D 1BIBA 1N9SA 3BDUA 1LJOA 1HXDA 4M77A 4RCBA 5GAN8 3EFRA 4F7UE 3JB9D 3JCMh 3HSBA 4V2SA 5GANh 4M7DC 4C8QF 3JB9I 4M7AD 5GMKi 3FJPA 3BW1A 4JLIA 1D3BB 4XTVA 4F7UB 5GAOr 4EMHA 4M7AE 1MGQA 3BY7A 4XU0A 4M7DA 4Y91A 4JRKA 5GMKl 5GAN4 4XU2A 3JCMQ 2DXTA 3JCMg 1I81A 4M7AB 5GANg 1M8VA 1Y96B 3V8LA 1JRIA 4X9DA 5GAMe 2YLCA 3SWNA 3V8KA 4PJOC 5GANj 2DZ9A 5LJ3h 3HFNA 5GAN7 3RERA 5GAOm 1JBMA 4F7UF 3FB9A 1WPYA 4M77D 5GAMh 3GIBA 1KQ1A 4M78G 4PJOA 3JB9F 4JUVA 4RCCA 5GAOq 4M77E 3V7SA 4EMKB 1I4K1 2E1HA 2EAYA 4XQ3A 2VXEA 4M75G 2E41A 4C8QC 4M77B 3RKXA 4MMKA 1U1SA 5LJ3j 5GAMg 2YLBA 2E64A 4C92C 3V7RA 3JB9J 2Y90A 4M7DE 2DJZA 4XTYA 3JCMb 2EWNA 3JCMd 1LNXA 2ZGWA 3QO3A 5GAMj 5GANd 4C8QG 3QUIA 4M7DB 3HFOA 2FYKA 4XTXA 5I21A 5LJ5e 5LJ3f 4PNOA 4C92G 1B34B 2I2LA 4M78C 3V7CA 5GMKm 3SWNB 3QHSA 4M77F 4QVDA 3AHUA 5LJ5h 4PJOE 1LOJA 3PGGA 2YHTA 2VXFA 4M75C 4M78A 5GAN5 4XTUA 5GAN3 5LJ3d 4PJOB 3JCMX 3L2ZA 3L1AA 3JCMf 1I8FA 5GANf 4J6WA 3JCMc 4A54A 4M75A 4HT9A 3RUXA 4M7DF 1YCYA 4F7UG 4WF2A 5LJ5g 1TH7A 5GAMd 3JB9G 4HA8A 3JB9H 4M7DD 4NL3A 2RD1A 1I5LA 2DTIA 4M7AG
chains in the Genus database with same CATH superfamily
3NMZC 3CC2Q 4PJMA 1JXOA 4C0DB 1X27A 3S3MA 1TSFA 4LE9A 3CD6T 3OYIA 4BE1A 1R8OB 3I5RA 3CCLA 4E7IA 3CCRA 4N0AA 3META 5L23A 1Y7XA 2RJFA 1TG0A 1M27C 2M1HA 3M4YA 5KYWA 2O88A 1ZBXA 3OYLA 4C92D 1RAGB 4D8DA 3L2UA 3CCET 2BE7D 4NOYA 1VQKQ 3JAME 1M1GA 4J9BA 2PVDB 2X3XD 1BKBA 1KQSS 1F1BB 1IXDA 1A0NB 4DBFA 1M90R 3H41A 5KCOA 2JTMA 1SRMA 1OULA 2QGGA 1VQ6A 4J8OA 2A7YA 2AZSA 5KYYB 1PC0A 2F2VA 5J39A 2ZPIB 3THKA 2LJ1A 3SWNA 3VS4A 2DJQA 3GIBA 3CBMA 1PNJA 4FIBA 1PG5B 3ZBDA 2M9UA 5GAOq 3CEYA 3NHNA 3PMTA 3PTAA 2QQBA 3CD6A 2E1HA 1Q82R 1GL5A 4YTLA 2JS2A 2ATCB 5GAMg 3QYHB 1K73U 2Y90A 2RF0A 4DBRA 5GANd 1VYUA 3M56A 3MP1A 2CP7A 2WSCE 1B34B 5FWBA 1SPKA 3CCEA 2SEMA 4M75C 1IHWA 1YJWQ 3CMAQ 4XTUA 4ELYC 3JCMf 4M7DF 4DOWA 1YCYA 3M9QA 2J6KA 2QGFB 3VRYA 4WTOB 2MYSA 2O4XA 5GAOn 3LX7A 3CC7T 5D6WA 1WXUA 2V8JA 2EQMA 2VC8A 3RMSA 3M0UA 3CCVQ 2DKGA 2A36A 2M51A 1BIAA 1M2OA 2LCSA 2COZA 2EYZA 4OB3B 4AFUC 5I11A 4LD9K 4HKEA 4EMGA 1FMVA 1RUWA 3L42A 2BIVA 2WSEE 2X51A 1QKXA 2PUOB 3OSSC 3CC4Q 1RLPC 4XAXB 5LJ5f 5GANe 1HK9A 4BUGA 1Q7YR 4EMKA 2ESWA 2J7IA 3MCAB 5GAN8 4CI0C 4DEXA 2M0OA 3VS6A 1EX4A 1Q95G 2DYBA 3HSBA 1X75C 3G71Q 3QDRB 4E7ZA 1JXMA 1VYVA 2X35A 4QQDA 2YRCA 4L6V5 4WCIA 3JCMQ 5KYWB 6AT1B 2BKDN 1OU9A 5L8RE 3QWYA 2EGCA 4OMQA 5A0DA 4KUIA 3CCMQ 2EIFA 3CC7A 3RERA 5A2QE 2RHXA 2YSQA 1MHNA 1PSEA 4RCCA 3A8HB 3UA7A 4R0KA 1WYXA 1YI2T 1GCQC 1NZ9A 3QXEB 4B6MA 4FT4A 2KYBA 3CC4T 4N4HA 1VQMT 2ZGWA 2FYKA 3NFCA 4X1VA 3EG9A 1UB4A 4M78C 3V7CA 3SWNB 3QHSA 1WHMA 1BU1A 3C0CA 2A08A 3CXCP 1Q86R 1VQ5T 2JM9A 3MP8A 2LP5A 2QAZA 4XTZA 1B7TA 1M4ZA 1UGSB 2QDLA 1M5Q1 1SHFA 3EHRA 4XU1A 4HCKA 2HNIA 5CO7A 4C5EA 1TS9A 2FG0A 4J9DA 4R56A 2AK5A 5GAN2 1H8KA 1WJQA 3OW2A 2EYWA 2DD5A 3RIRA 1V76A 4L5GA 1YI2A 2O4XB 2LZ6B 5FU7B 1K8AC 4JZ3A 4AFZC 2L89A 4IKFA 4ANJA 3URGA 3KFVA 1VQMA 2C06A 1NM7A 3A8MB 2LT1A 2LQWA 2ZPHB 2O9SA 1Z9QA 3PNWC 3MEUA 4M7AF 3JB9D 2QG9B 4F7UE 3HRSA 2KSSA 2DXTA 5ECAA 1VQ5A 3CBOA 2VKNA 2X4YA 1E6HA 2G3RA 1H3HA 1IGQA 2LMJA 1PRLC 4EMKB 1ZQ1A 1WHJA 4KH0B 5KCHA 2XI9A 3JB9J 3X24B 4C0DC 4OMPA 2O01E 3G6ET 1GBRA 5I21A 1RABB 5CK9A 1AWJA 3CMEQ 2HBPA 4J7FA 2RJEA 4LUEA 1KQSA 4PJNA 2HKNA 2E3HA 1X6GA 3P8BB 4Y92A 4EDUA 1AZGB 1N6AA 3H8ZA 2ECZA 4J7IA 1RI9A 4OGCA 4HT8A 1AZEA 2VWFA 1WNLA 4BDZA 1RAEB 3QSUA 3EG9B 1YFNA 2J6OA 2QK0A 4FSSA 4J6XA 4CC2A 2JOYA 1U1TA 1VQ9Q 4BE0A 4PKCC 1VQ8Q 4E7JA 4ORZA 2DTHA 1YJ9Q 5KYXA 1AEYA 2VGMA 1ZLMA 2QXFA 3EFSA 4ZN1A 4K11A 1K8AU 1AWXA 4PFPA 3OYFA 3CMET 3FRNA 1Y96A 4C8QE 1SF9A 3JSCA 3G7ZA 3OYBA 2H8HA 2ZPEB 2DA9A 5AT1B 4FSXA 3G6EA 4C0FA 1UUEA 2KNBB 2DEUA 3A8OB 1VQ7Q 2YRDA 2JW4A 1KC8C 2QQRA 2OJ2A 2VVKA 5GMKi 3O8VA 4RG2A 3CPWS 3M53A 4XU2A 3VS2A 1I81A 3FJ5A 2EYYA 2LJ3A 1VQ8T 2YLCA 5J26A 2AZVA 3QJYA 1TUDA 2MK5A 4BI8B 4LD6A 2OTJQ 2KROA 3TCJA 4DBQA 3EFOA 1YIJQ 3UT1A 4C8QC 2CP0A 4HVVA 3I56T 2LDMA 2QDYB 1LNXA 3QO3A 3EG1A 1QVGS 3CMEA 3NGPA 2I2LA 2HQHA 3AHUA 2Y4XA 3QBYA 4OGEA 5LJ3d 2A0FB 5IHKA 5LL6S 1NYGA 1WHHA 1M3AA 5CIUA 1QWEA 1TXQA 5IN1A 2L8DA 4M7DD 2E3IA 4IUVA 4N4IA 2EBPA 3RR6A 2OTJT 2CZ1B 3UATA 1U5SA 3Q1JA 1K0XA 1YJNT 1T3LA 3AT1B 4N0AC 3D7SB 1T3SA 3CCSA 2K5IA 1AT1B 1GXIE 2FRYA 4F7UA 2HBWA 2MPXC 4Z89A 2KEAA 1KQ2A 2W0ZA 2GTOA 4Q5WA 3RBBB 3I56A 2G6FX 5CKEA 2LQ8A 4A4HA 3EGUA 4C0ZA 5GAOp 4HVUA 5LJ3g 1KC8U 3CCLQ 4RCBA 1I5OB 2OI3A 3CCRQ 2DFUA 4XTVA 3TSZA 4EPCA 1X2KA 5KYXB 2DMOA 2F5TX 5HK3A 3NPFA 4PLLA 2RK2A 2ZZDA 1Y96B 1WXBA 1RAHB 3V8KA 5IAYA 3GLXA 4FU6A 2RI5A 2OTJA 5CKHA 2KRSA 5GAMh 1QP3A 1YJNA 3JB9F 2O9VA 4M77E 5D6XA 1QP2A 2KQWA 3TREA 4FCYA 2ZAEA 1UE9A 2KXDA 1OPLA 1PWTA 4MDXA 1G3SA 3I55T 4FW1A 2RHYA 1BB9A 3M0QA 2KK4A 4ME7A 3REBB 4B9XA 1QW1A 1VQ6Q 1K4US 1BBZA 2R5AA 1RAAB 4C0GA 2NLUA 3OYKA 2R57A 2W10A 1IZ6A 2HD0A 5GAN5 1HD3A 2NUZA 4A54A 2FHDA 4F7UG 2AKLA 4RTXA 4BACA 2JT4A 3H0IA 1VQ4T 3CD6Q 2ZCFB 5AYFA 4C8QA 3PIOA 2DXCA 3FDRA 4PJOF 4E47A 2P0QA 3PFSA 1RAFB 5GAN6 4M77C 4OF1A 2CUDA 5GMKe 2KXCA 5DY9A 2P4TA 1YNZA 3CCEQ 4JJBA 2D0QB 2RJDA 3C12A 2XD0A 3E9GA 2F69A 1TTHB 3CCQT 5A0GA 1WHLA 3VS7A 4ZN3A 2DM1A 4PFOA 3JCMV 1Y07A 1HYOA 2V1QA 5KE2A 4GBQA 4EMKC 1YBYA 3I55A 4VUBA 3I9QA 2DLPA 1OEBA 2FPDA 1UG1A 2BTTA 1NPPA 1FMKA 1OX9A 2QTVA 1ZHIA 3QYGB 2JJ9A 4A4FA 2BE9B 4M7AD 3SD4A 4F7UB 1KIKA 1YHQA 3OS0A 4Y91A 2VASA 4JRKA 4RMOA 1M8VA 4QQ6A 1VQ4A 2KRNA 1JRIA 2J05A 2EPDA 2JMCA 1UEBA 1VYTA 5GANj 4IUTA 3NTHA 3EH1A 1K9MC 1JEGA 2CYZB 4JLGA 4OMLA 1RADB 1IREB 3OB9A 3RKXA 4MMKA 1VIEA 1PSFA 3OW2P 4M7DE 2DJZA 3VS0A 3JCMd 4C8QG 3QUIA 1NJIC 1VIFA 2MI6A 3CCQA 1YITT 3VS5A 2ED0A 5GMKm 3QG1A 2E4HA 1D0ZA 2ENMA 3ZL7C 3CC7Q 3PGGA 3OYNA 3LWIA 1UDLA 2K7AA 3DB3A 1O9SA 1HJDA 2L3SA 2XDPA 2Z0WA 3GNFB 3CPWA 1QCOA 2RMOA 3RKYA 5EG2A 3L2WA 1RAIB 5CAIA 5FLXE 2YT6A 1CSKA 3OA6A 3JCMP 5CR2A 1JJ2A 1KD1R 2DE0X 2E6ZA 2P84A 3MEAA 4OP0A 3OYCA 2EVRA 4FT2A 1BI2A 5GAMf 2RB6A 3GOXA 3J7AF 2PZ1A 2DEQA 4PJJA 4B9WA 4J5YA 5LJ5d 1XJWB 3BFMA 3A1PA 4FYVB 4Y28E 4ZTFA 1W2BA 4A63B 2X4XA 1N9RA 4NL2A 4C5HA 1NBEB 5C0MA 3A8LB 2ZPBB 4C8QB 4J9GA 1QVGA 2JUFA 2I0NA 5CQYA 1H92A 1IB8A 4KBMB 3JCMe 4OB0B 4M75F 1JO8A 1M2VA 2PQWA 1YITA 3S3NA 4DOVA 3WXMB 3PT9A 4M77A 5IXFA 2LX9A 4HVWA 1CKBA 1KQSP 2BZ8A 2MIOA 1ZX6A 2IG0A 2X4WA 2FL7A 3BY7A 4IUPA 1BK2A 3UA6A 5GANg 3QZ5B 1V1CA 1YI2Q 1X43A 1ZSZC 4J9IA 2L0AA 1VQMQ 2M16A 1WPYA 2RJCA 2GCXA 1KQ1A 1PKTA 2KT1A 3GBQA 2JM8A 1SHGA 4D8KA 1WA7A 2KYMA 2D8JA 1UHFA 4JRQA 1ZA1B 1NJIU 3VUZA 1VQOT 3C94A 5LJ5e 1SSFA 3C95A 4N4GA 1VQ5Q 2RQVA 2WSFE 2DXBA 5GJWB 4AG2C 4J6WA 5IHIA 1IO6A 5IHNA 4O6JA 1M1KC 2K79A 5CCAA 2E41A 1KC8R 4LDUA 4CRIA 3M55A 4LDVA 4MZPA 1Q81R 4IURA 1VUBA 1WXTA 1X01A 3M57A 2K5FA 2XKOC 2RNAA 3OSVA 3RKWA 4M77G 1XOVA 2COYA 3QZ9B 1AWWA 1TUGB 3X20B 2JXBA 1WQWA 1D1BA 4II1A 1WX6A 4OVAA 3LLRA 4C92E 5M9OA 2DX1A 4M78F 3X28B 1VQOA 2VUBA 1K0SA 3UWNA 2LJ0A 4OMNA 2LCCA 4PK4A 4F16A 4KGXB 3BDUA 4ZGJB 2QEXT 4V2SA 1PM3A 1SEMA 2RO0A 4R55A 3QDFA 4E7LA 3OBYA 4M7DA 2EGEA 3I35A 3SEMA 2E5KA 2XK0A 4TVRA 3QIIA 2LNVA 4KT0E 3EH2A 4J9EA 2JVVA 2YWWA 2COWA 3HHTB 1FMWA 3G6EQ 1KSWA 1D1CA 4Z8AA 4ZGEB 1OX8A 1R77A 2EAYA 3CCUT 4M77B 2GTJA 2K6DA 3HRTA 4C5GA 4C92C 1N8RR 2L2PA 4XTYA 3JCMb 4PJLA 2CH4A 1G3TA 2NUPA 2CDTA 4Z88A 1QVFS 3OS2A 1Q82C 1NE8A 3DLMA 4ZTJA 3MPUB 1ACMB 1QWFA 1ZSZA 3T9NA 1Z9ZA 3FEOA 1O75A 1NEGA 1UECA 1M1KU 1BCOA 3E9FA 4WF2A 2J6FA 4DA4A 4E6RA 1I5LA 2QEXA 3OS5A 2VGNA 1MMGA 2CUBA 3VKIA 1GBQA 1WIEA 1M9SA 1X69A 4PJOD 2EJFA 4KGVB 1AD5A 4JZ4A 4FYWB 4J6YA 3L2VA 4PLIA 1ABOA 3CCJT 3FLGA 2V26A 3JV3A 1H641 1NYFA 2RQRA 2RHIA 2EJ9A 4MZMA 1IHVA 4LUDA 4M7DG 4FW2A 4L59A 3CCUA 1NLPC 2MWPA 2QQSA 4HCBA 2P0PA 3V8JA 2YDLA 4A4EA 2C0IA 2JN0A 4PL6A 2RK1A 3EG3A 4QVZA 3CCSQ 1N9SA 1LJOA 3EFRA 2ABLA 4FL6A 4ATOA 8AT1B 2AKKA 2WACA 2O31A 2JZ2A 2NYSA 4A4GA 2QASA 5GAN4 1XQHA 2D6FA 2D9TA 1RACB 2IPOB 4X9DA 1WDXA 2LC4A 4LN2A 1GRIA 2L3RA 1WI7A 1Q7YC 2KT8A 3OYAA 3OYYA 3I56Q 1K73R 5GAN7 3E2UA 3O5ZA 7AT1B 2DL7A 2QQ9A 3IQLA 2EYXA 1OU8A 2HMAA 1K9AA 5GJVB 4XQ3A 5LJ3j 4RTWA 1GFDA 4KUDK 2XU8A 3EG2A 3CCJA 2MOXA 5CKDA 1EFNA 4M7DB 2YUOA 4HCCA 1JJ2S 4GLMA 3CCST 1Q82U 1G5VA 3M59A 1MUZA 2CSQA 4CC4B 3HPWA 2JTEA 3L2QA 3HKSA 3LH5A 3EG0A 1VQLQ 3OYHA 3L2RA 1UGRB 1YJNQ 3RUXA 2JNGA 4NL3A 3HP9A 1OPKA 1W2BS 3LYIA 2CP3A 4C92A 9ATCB 2EQUA 4LXCA 3RMQA 1G83A 4LDXA 1AVZC 3GF5A 2DF6A 1Q86C 1IGUA 2NWMA 2PVOB 1DJ7B 2BZYA 2B86A 1ZSZB 4JJNK 2QI2A 4XK8E 2SRCA 3VS3A 2EYQA 5IH2A 2KAFA 1KJWA 3JCMW 2LX7A 1VQLT 4MMLA 2DRMA 1BYMA 4OMOA 2OAWA 1ARKA 5GMKj 1PD1A 2HKQB 2DIQA 3QWXX 3FIFA 4M75D 1HSQA 1OQKA 3JB9I 1XNIA 3H9NA 5GMKl 3WVDB 3S6WA 3MKDA 3J81E 1WZOA 3CPWP 2YXYA 2CREA 5FU6B 1QMCA 3J80E 5GAOm 1JJ2P 1JBMA 1TOVA 1G2BA 2V8KA 3FB9A 3RDVA 3I55Q 5FROA 1D0YA 4ZGDB 1I4K1 4FYYB 2VXEA 1NLOC 1PHTA 2PU9B 2E64A 2H3EB 1KG1A 5DLOA 1E7OA 1TWBA 1YHQQ 1KFZA 5LJ3f 4C92G 3ZFJA 1AWOA 4ELZC 1VQ4Q 1W2BP 3DB4A 2X4JA 3SHWA 4KULA 2LNHB 1NEBA 5IT9E 1S72T 1VQLA 1QVGP 4PJOE 5FRMA 2YHTA 1UJYA 3OQ5A 1P92A 1M1FA 4P5NA 2GGRA 4F17A 1LPLA 4HXJA 1TH7A 4HA8A 2BZXA 1D0XA 3VRZA 3JCMJ 3G1JA 2PVGB 3RESA 2J06A 3A98A 2HQXA 3M0SA 4RTZA 4JJDA 1H3ZA 1Q86U 2DVJA 1I0CA 2K9GA 2VYTA 3CCQQ 1T0HA 3G4ST 1PD0A 2K2VA 4E2FB 1YHQT 2A28A 1D3BA 3EFOB 3MEWA 3NTIA 4EIKA 1GFCA 4AFQC 3RNJA 2P0KA 2GQIA 1B34A 1PRMC 2E10A 4F14A 1QVFA 4C92B 3M4GA 3N5BB 3KXTA 4M78D 3FC3A 5KE3A 4J9CA 2FPEA 2MF2A 2QA4T 2QQAA 1KHCA 1BIBA 1S72A 1M3CA 5GANh 5HY6A 3FJPA 4HCZA 4O5VA 3MEVA 1MGQA 1QVPA 2HL5C 1MMAA 3TEEA 1M1KR 1PCXA 2LTOA 5DM7R 2GQVA 3CQTA 2EKOA 3H6ZA 1R0BG 5I22A 2DAQA 2HAXA 3WVEB 1WHKA 2KBTA 2OTLQ 1VOMA 3OY9A 1YITQ 1QQJA 3QKJA 3G4SA 3M0RA 2GFUA 2V8IA 4OB1B 4OB2B 5KYUA 1SKUB 1UFFA 2E6NA 1X6OA 1VQPT 2ZPGB 4BDYA 2CS7A 4JS5A 2A3LA 1CKAA 2QA4A 4LNPA 2VV5A 5GAMd 5KH6A 5D7UA 1M3BA 3HTRA 2R5MA 2CGHA 3M5AA 5LJ5j 2FB7A 2FZKB 3X26B 4XU3A 3TVTA 2DETA 2YRVA 2OTLT 4BB7A 2PUKB 4RKUE 2OAUA 1K8AR 3INZA 4JPBW 1GCPA 4X9CA 1I07A 4XTWA 2V1RA 1X2QA 1FYNA 2FZCB 1T0JA 1YN8A 4M75E 5C6SA 3CC2T 1OOTA 3LGLA 3R6NA 2QYZA 2EJGA 3SB2A 2YUQA 4BD3A 2RI2A 2DNUA 2HZYA 3P8DA 2DRKA 3U23A 5A0LA 2D1XA 1VQPA 4GY5A 4M7DC 2KR3A 1D3BB 2FVUA 5GAOr 4XU0A 1VQKT 1SSHA 3JCMg 2RH2A 2Y4YA 2F2WA 2H3JA 5GAMe 2XMFA 2DZ9A 1YP5A 5FW9A 2ROLA 1VQOQ 2OTLA 1V29B 2RQTA 4PJOA 2YUPA 3KBGA 1WJRA 2DL8A 1EZZB 1QKWA 2YLBA 1R0CB 3CC2A 4XTXA 1N27A 1NPRA 2XDBA 3PIPA 2F2XA 2VB6A 1PKSA 2EQIA 5D6YA 2KRMA 4QVDA 1K9MU 1WJSA 1UGVA 3CXCS 2VXFA 3E19A 8ATCB 5GANf 4LDWA 2D0NA 5LJ5g 1ABQA 2RQUA 3JB9G 1MNEA 4GLKA 3KUFA 4OMFB 2HSEB 2XG8D 1YJWT 1MV0B 3CMAT 1G3WA 2DILA 3OYGA 1W1FA 4DBHA 5KYUB 4QVCA 2DTOA 2F1LA 4JDSA 1VQKA 2E5QA 3PVLA 4M78E 4DQ2A 2CSIA 4KGZB 2K2MA 2RM4A 2RN8A 1D09B 2AIRB 2L5QA 1UGQB 3MP6A 4C8QD 3GPLA 5FU6C 2GBQA 3VJPA 1MMNA 1SRLA 1WLPB 3CCVT 3LW5E 2QEXQ 3MJXA 3DLLA 4QT7A 3MHXA 4PJOG 1ZSGA 1G3YA 3UF4A 3TSWA 1G8XA 3BW1A 4BI3A 3H0HA 2HSPA 4M7AE 4J9HA 3A8GB 1U8RA 4D6WA 5CKBA 3CCUQ 1VQNQ 3HFNA 3G71T 1YJWA 2DO3A 3CMAA 4LDYA 3HRUA 3F70A 2K3YA 2RHUA 2K5LA 4X34A 1C0MA 1UTIA 4RTVA 4PFZA 3CCMT 1X6BA 3V7RA 4JJCA 2EWNA 3C4SA 2LQNA 3OYEA 4KH1B 1OI1A 1YCSB 1OZ3A 4ZNXA 3JRZA 2CP6A 5I2SA 3ME9A 3CCVA 2ROTA 1M90C 3BE3A 4PJOB 1M2VB 4M7AC 4HT9A 4M75A 5CVIA 1QCNA 1VQNT 3REAB 3JB9H 4BI4A 1J3TA 1SG5A 2LRQA 2K3BA 3EGXA 3CC4A 2JTFA 2CZ6B 3CCJQ 2KGTA 1M30A 3M58A 3NTKA 2R58A 3ZEHA 3M0TA 1C6VX 1NG2A 2E12A 2D8HA 2X3WD 1K1ZA 2MWOA 3LH0A 2C0OA 2X9HA 3G71A 2E65A 3QJ6A 4C92F 4OMMA 1KD1C 3VV0A 1OV3A 1N5ZA 5GAOl 2AHJB 3E1SA 3CCMA 2DXUA 4RG8A 3CBPA 5IXBA 3VUBA 3SFMA 2EGAA 1KHIA 1XTDA 4BY6C 3EGDA 1W6XA 1Y71A 2HDAA 1EIFA 1HXDA 2RHZA 1ZUKA 3PVQA 3GP8A 1OYXA 1YWOA 2L3PA 4JLIA 4EMHA 1B07A 1VQNA 2GFAA 3V8LA 4MZTA 1FX7A 2K3XA 1LCKA 1W70A 5LJ3h 2CT4A 5I2MA 2MCNA 4F7UF 1VA7A 1I1JA 2DD4A 4M77D 4AMCA 1BI0A 2KI7A 4RTTA 1BI3A 4NS5A 1YWPA 2LT4A 4M75G 2EQKA 4QQGA 2FO0A 1GCQA 3LGFA 3M0PA 4IUQA 2JMAA 2FZGB 2OX7A 3R6OA 1K76A 2LVMA 1M90U 5FWCA 3GNGA 2DERA 1LOJA 3VYHB 4M78A 1QVFP 5GAN3 3ASKA 2DK3A 2FPFA 3JCMX 1D1AA 3L2ZA 4E7HA 1I8FA 2DL3A 3LWHA 2M0YA 4RTYA 2PTKA 2DBKA 2GNCA 2FEIA 4RUGA 2BUDA 4F04B 2DBMA 4JRIA 1U3OA 4E7KA 4FYXB 4AG1C 2CKKA 3HL8A 2DL4A 2DVEA 3VU3C 2CT3A 1S1NA 2M02A 4QW2A 3M54A 1E6GA 4J9FA 2HQEA 1QLYA 2GF7A 1KD1U 5GMKh 4M75B 1Q81C 3A5ZB 3OYMA 3OMGA 3SDZA 4M7AA 4C5IA 4IIOA 1VQ9T 1RI0A 3UPUA 2EQJA 5FRNA 3EGXB 2DL5A 3MO8A 1YJ9T 1M8MA 2F5KA 2HEQA 3TQ7P 2K57A 2NUPB 2KDSA 2ED1A 2NUTA 3CXCA 2L3QA 2RPNA 1OZ2A 2EFIA 3EAEA 1ZBJA 2AT1B 4C8QF 1WFWA 1K9MR 1Y0MA 2LCLA 2O2OA 3QPHA 4CC7A 1VQ7T 2K4YA 2CH4W 1NJIR 1FWZA 1KK7A 1BI1A 4M78G 1JU5C 3EGDB 3V7SA 1AOJA 4CC3A 2HCKA 1LVKA 1U1SA 1S72Q 5HK0A 5KYNA 3OBWA 4J83A 3ULRB 1RLQC 4BE2A 1WGSA 5HCKA 3HFOA 1TU0B 1Q7YU 1ZUUA 2EW3A 1YIJT 1VQ9A 1VQ8A 2CP5A 3VYGA 4IUUA 2A37A 2CZ7B 4UC4A 1YJ9A 1N8RC 4ESRA 4FM4B 3H0FA 1RL2A 2JS0A 2P4RA 2MMPA 3UDCA 3EHQA 4QKUA 2DTIA 4M7AG 3G4SQ 4MDWA 2RA2A 2E70A 3OYDA 2YUNA 2KVQG 2QTXA 1UJ0A 1ZA2B 4A53A 1VQ7A 4AFSC 2DIGA 5J3BA 1C1AA 1ZUYA 4M78B 1Q81U 2XICA 3TU4K 5KYYA 2KMTA 3SWNC 5LJ3e 2QA4Q 2HL3A 3OMCA 5CKFA 2DZCA 2LQKA 4AT1B 4A4KA 3DKMA 2EKHA 1BCMA 1WQ7A 2XDDA 3CPFA 3P8HA 3ER0A 3OYJA 1UHCA 3VS1A 1YIJA 1W4SA 2IIMA 2C0TA 3PMIA 5DLQE 4Z02A 1IRXA 2CZ0B 4DEYA 2XHCA 3JCMh 3I5SA 1B3QA 5EC7A 4IIMA 4JRPA 1Y57A 4M7AB 1MV3A 2MAMA 3CCLT 4PJOC 2B8AA 3CCRT 5CQXA 2KY9A 4JUVA 2NUTB 4M4ZA 5FU7C 1JB0E 1UGPB 3BDLA 3OW2S 2DYIA 1WHGA 1QCFA 2RI3A 2IVWA 1VQPQ 1FXXA 2KE9A 5GAMj 1K73C 1U06A 1JQQA 5HKCA 4PNOA 2FRWA 2PNIA 4M77F 2CP2A 3PE0A 5LJ5h 1N8RU 4KRTA 3X25B 4E7SA 3OS1A 1TUCA 3L1AA 4RTUA 2ZPFB 1MMDA 3JCMc 4JS4A 1VQ6T 1AHJB 2DPPB 2RQWA 4BY6B 2XIDA 3S3OA 2RD1A 1MNDA
chains in the Genus database with same CATH topology
2QEXA 4N4IA 2XG8D 1YJWT 3OS5A 2VGNA 1G3WA 3CMAT 2OTJT 3OYGA 2CZ1B 3Q1JA 3VKIA 4QVCA 2DTOA 4JDSA 1VQKA 1M9SA 1YJNT 4C0DB 3S3MA 3CD6T 4N0AC 4PJOD 3OYIA 2E5QA 4BE1A 2EJFA 1R8OB 3CCSA 4M78E 3CCLA 4DQ2A 4E7IA 4J6YA 2K5IA 3L2VA 4N0AA 3CCRA 4PLIA 3META 1GXIE 3CCJT 1Y7XA 2RM4A 3FLGA 2RJFA 4F7UA 1H641 2L5QA 1UGQB 3MP6A 2M1HA 2RHIA 2EJ9A 3M4YA 4MZMA 5FU6C 4C8QD 3GPLA 1ZBXA 1KQ2A 4M7DG 4L59A 4C92D 3OYLA 3CCUA 4Q5WA 3VJPA 3CCVT 3LW5E 3I56A 3L2UA 3CCET 4NOYA 5CKEA 2LQ8A 3DLLA 4A4HA 2MWPA 2QQSA 4HCBA 2P0PA 3JAME 1M1GA 3V8JA 4A4EA 3MHXA 4C0ZA 5GAOp 4PJOG 2JN0A 2PVDB 1BKBA 4PL6A 2RK1A 5LJ3g 1G3YA 4QVZA 1KC8U 1KQSS 1N9SA 1LJOA 4RCBA 3EFRA 5KCOA 2JTMA 4FL6A 4ATOA 3BW1A 4XTVA 4BI3A 4EPCA 4M7AE 2WACA 2F5TX 2JZ2A 4A4GA 5HK3A 3A8GB 1XQHA 4J8OA 2RK2A 2A7YA 2ZZDA 4PLLA 4D6WA 1U8RA 2D9TA 5J39A 1Y96B 2ZPIB 5CKBA 4X9DA 2LC4A 3SWNA 3V8KA 2L3RA 5IAYA 1Q7YC 3OYAA 3OYYA 3HFNA 5GAN7 3GLXA 4FU6A 3G71T 2DO3A 1YJWA 3CMAA 4LDYA 2RI5A 2OTJA 3HRUA 3F70A 2K3YA 5CKHA 2RHUA 2QQ9A 3GIBA 3CBMA 5GAMh 1QP3A 1YJNA 3JB9F 4FIBA 3ZBDA 5GAOq 2K5LA 2M9UA 4M77E 4X34A 3CEYA 3CD6A 3PMTA 5D6XA 2QQBA 1QP2A 2E1HA 3PTAA 2KQWA 3TREA 4XQ3A 4YTLA 3CCMT 5LJ3j 5GAMg 4MDXA 3QYHB 1K73U 3V7RA 3L2WA 2Y90A 4KUDK 2XU8A 3CCJA 2EWNA 3C4SA 5CKDA 1G3SA 5GANd 3I55T 4M7DB 2RHYA 4B9XA 2KK4A 3M56A 4ME7A 1QW1A 3OYEA 4HCCA 3MP1A 1JJ2S 2WSCE 1OI1A 3CCST 1Q82U 1B34B 1OZ3A 3JRZA 2R5AA 1G5VA 5I2SA 3M59A 3ME9A 4C0GA 3CCVA 2NLUA 3OYKA 2R57A 3HPWA 1M90C 3CCEA 3L2QA 1IZ6A 4M75C 2HD0A 3HKSA 5GAN5 4XTUA 3OYHA 4ELYC 3L2RA 4PJOB 3JCMf 4M7AC 1UGRB 4HT9A 4A54A 4M7DF 2FHDA 4M75A 3RUXA 4DOWA 1YCYA 3M9QA 5CVIA 4F7UG 2JNGA 4BACA 1VQ4T 1VQNT 3JB9H 4NL3A 2O4XA 2ZCFB 4BI4A 5GAOn 3LX7A 3HP9A 5AYFA 2LRQA 3CC7T 5D6WA 4C8QA 1W2BS 3PIOA 3LYIA 2DXCA 3CC4A 2JTFA 2CZ6B 4C92A 2V8JA 2EQUA 2EQMA 3FDRA 3M58A 4PJOF 2VC8A 2P0QA 4E47A 3NTKA 3PFSA 2R58A 3RMQA 3ZEHA 5GAN6 2E12A 4M77C 3RMSA 4OF1A 4LDXA 3GF5A 1Q86C 2MWOA 3LH0A 5GMKe 2PVOB 5DY9A 1DJ7B 2DKGA 2P4TA 3G71A 4JJNK 2QI2A 1BIAA 2D0QB 2RJDA 3C12A 2XD0A 3E9GA 2E65A 2F69A 3QJ6A 4C92F 4OB3B 4XK8E 4LD9K 4HKEA 3CCQT 1KD1C 3VV0A 5A0GA 4EMGA 4ZN3A 2EYQA 5GAOl 2KAFA 2AHJB 3E1SA 3L42A 3CCMA 2DXUA 1Y07A 2BIVA 2WSEE 4RG8A 3JCMV 3JCMW 4MMLA 1VQLT 3CBPA 2PUOB 3OSSC 3VUBA 5KE2A 1BYMA 3SFMA 1YBYA 4EMKC 3I55A 4XAXB 1KHIA 1XTDA 5GMKj 4VUBA 5LJ5f 4BY6C 5GANe 1HK9A 4BUGA 2DIQA 4EMKA 3FIFA 1Y71A 1NPPA 4M75D 1EIFA 3MCAB 5GAN8 1HXDA 4CI0C 1ZHIA 2M0OA 2RHZA 3QYGB 4A4FA 3GP8A 3HSBA 1OYXA 1X75C 3JB9I 4M7AD 3QDRB 4JLIA 1XNIA 3SD4A 4F7UB 4EMHA 1YHQA 2X35A 4QQDA 4L6V5 3OS0A 4Y91A 4JRKA 3WVDB 5GMKl 4RMOA 3JCMQ 3S6WA 1M8VA 2BKDN 4QQ6A 5L8RE 1VQ4A 1VQNA 2GFAA 3V8LA 4MZTA 1JRIA 1FX7A 3J81E 5A0DA 1UEBA 2K3XA 4KUIA 5FU6B 5GANj 2EIFA 4IUTA 5LJ3h 3CC7A 3RERA 5I2MA 3J80E 5GAOm 3NTHA 5A2QE 2RHXA 1JBMA 1MHNA 2V8KA 3FB9A 4F7UF 1PSEA 2DD4A 4M77D 1BI0A 1K9MC 4RCCA 5FROA 1BI3A 2CYZB 3A8HB 4NS5A 4JLGA 2LT4A 4ZGDB 1I4K1 1YI2T 1NZ9A 2VXEA 3QXEB 1IREB 2EQKA 4M75G 3OB9A 3RKXA 4FT4A 4MMKA 1VIEA 2PU9B 1PSFA 2E64A 4QQGA 3CC4T 1KG1A 4N4HA 2DJZA 4M7DE 1VQMT 5DLOA 3JCMd 2ZGWA 3LGFA 4C8QG 3QUIA 1NJIC 2FYKA 1VIFA 3NFCA 4IUQA 5LJ3f 1UB4A 2MI6A 3ZFJA 4C92G 3CCQA 3R6OA 4ELZC 1YITT 2LVMA 3DB4A 4M78C 1M90U 2X4JA 3V7CA 5GMKm 3SWNB 4KULA 3GNGA 3QHSA 3QG1A 5IT9E 1S72T 1VQLA 4PJOE 1LOJA 3VYHB 3PGGA 2YHTA 3OYNA 4M78A 3LWIA 5FRMA 3OQ5A 5GAN3 1P92A 1M1FA 2DK3A 3ASKA 4P5NA 3DB3A 3JCMX 1O9SA 3L2ZA 4E7HA 1I8FA 3LWHA 1TH7A 1VQ5T 4HA8A 3MP8A 2XDPA 3GNFB 3CPWA 4XTZA 2BUDA 5EG2A 3RKYA 5CAIA 2PVGB 1M4ZA 1UGSB 5FLXE 1M5Q1 3RESA 4JRIA 1JJ2A 3OA6A 3JCMP 5CR2A 4XU1A 2HQXA 2HNIA 5CO7A 4E7KA 4C5EA 2CKKA 2E6ZA 1H3ZA 3MEAA 3HL8A 1Q86U 2VYTA 4R56A 4OP0A 3OYCA 4FT2A 1BI2A 2DVEA 2RB6A 5GAMf 3GOXA 3VU3C 3G4ST 3J7AF 5GAN2 2DEQA 2K2VA 4QW2A 1WJQA 3M54A 3OW2A 1YHQT 4B9WA 1D3BA 4J5YA 5LJ5d 2HQEA 3BFMA 1KD1U 2GF7A 5GMKh 3MEWA 2DD5A 3NTIA 4M75B 4Y28E 3A5ZB 3RIRA 3OYMA 3OMGA 3SDZA 1Q81C 4M7AA 4C5IA 4ZTFA 2P0KA 4L5GA 1YI2A 1VQ9T 1W2BA 1RI0A 1N9RA 2O4XB 2X4XA 4NL2A 5FU7B 1B34A 3UPUA 4C5HA 1K8AC 5C0MA 2L89A 2EQJA 3A8LB 2ZPBB 4C8QB 4IKFA 5FRNA 1QVGA 2JUFA 3MO8A 5CQYA 2E10A 3URGA 1YJ9T 1VQMA 1QVFA 4C92B 2F5KA 2C06A 3M4GA 2K57A 3JCMJ 3N5BB 3A8MB 4KBMB 4M78D 4OB0B 5KE3A 3JCMe 2KDSA 4M75F 2LT1A 3KXTA 3FC3A 3CXCA 2MF2A 2PQWA 2ZPHB 2QA4T 3S3NA 1YITA 4DOVA 3PNWC 3WXMB 3MEUA 2QQAA 4M7AF 3PT9A 1KHCA 1BIBA 4M77A 1OZ2A 3JB9D 2LX9A 4F7UE 2EFIA 3EAEA 1S72A 5GANh 3HRSA 5HY6A 4C8QF 3FJPA 4HCZA 4O5VA 3MEVA 2LCLA 1MGQA 1QVPA 2FL7A 2IG0A 2KSSA 2X4WA 3BY7A 4IUPA 3QPHA 2DXTA 3TEEA 5GANg 3QZ5B 1VQ5A 2LTOA 5DM7R 2GQVA 1VQ7T 2K4YA 3CBOA 2EKOA 3H6ZA 1FWZA 2X4YA 1BI1A 2G3RA 2DAQA 2M16A 1WPYA 2RJCA 2GCXA 1KQ1A 4M78G 2HAXA 3WVEB 3V7SA 4EMKB 1ZQ1A 3OY9A 3QKJA 5KCHA 3G4SA 1U1SA 4JRQA 2XI9A 2GFUA 3JB9J 1NJIU 2V8IA 3X24B 4C0DC 3VUZA 5HK0A 1VQOT 3OBWA 2O01E 4J83A 4OB1B 4BE2A 4OB2B 1WGSA 3G6ET 3C94A 3HFOA 5I21A 5LJ5e 1Q7YU 1SSFA 5CK9A 3C95A 1YIJT 4N4GA 2E6NA 1VQ9A 1X6OA 1VQ8A 1VQPT 2HBPA 4J7FA 2RJEA 2WSFE 2ZPGB 3VYGA 4IUUA 4BDYA 2CS7A 2DXBA 4JS5A 2A3LA 2CZ7B 4UC4A 1YJ9A 1KQSA 1N8RC 4FM4B 4J6WA 1RL2A 2QA4A 3P8BB 2VV5A 5GAMd 4EDUA 4M7AG 2MMPA 4O6JA 3UDCA 5KH6A 1M1KC 1N6AA 3H8ZA 5CCAA 2E41A 2DTIA 4LDUA 4J7IA 2R5MA 2CGHA 3M5AA 4CRIA 5LJ5j 2FB7A 3M55A 4MDWA 4OGCA 2RA2A 2E70A 3OYDA 4LDVA 4MZPA 3X26B 4HT8A 2KVQG 4XU3A 2YRVA 2QTXA 4IURA 1WNLA 2OTLT 4BB7A 2PUKB 4BDZA 1VUBA 4RKUE 3QSUA 2OAUA 1X01A 3M57A 4J6XA 3INZA 2K5FA 2JOYA 2XKOC 4A53A 1U1TA 4X9CA 1VQ7A 4BE0A 4PKCC 3OSVA 4E7JA 4XTWA 2DIGA 3RKWA 5J3BA 4M78B 4DA4A 4M77G 2DTHA 4M75E 5C6SA 3CC2T 1Q81U 1XOVA 3QZ9B 3LGLA 2VGMA 2QXFA 3EFSA 2EJGA 2XICA 4ZN1A 3TU4K 1K8AU 5LJ3e 2KMTA 3SWNC 3X20B 3OYFA 3CMET 3FRNA 3SB2A 1Y96A 1WQWA 3OMCA 4C8QE 5CKFA 4II1A 2DZCA 2LQKA 4OVAA 4A4KA 3DKMA 3LLRA 4C92E 3JSCA 4BD3A 5M9OA 1WQ7A 2RI2A 2XDDA 3G7ZA 4M78F 3X28B 5GAN4 3OYBA 1VQOA 2VUBA 3UWNA 2ZPEB 2D6FA 4FSXA 3CPFA 3G6EA 3P8DA 3P8HA 4C0FA 3ER0A 2LCCA 3OYJA 1YIJA 1W4SA 5A0LA 3PMIA 5DLQE 3A8OB 4Z02A 3BDUA 4ZGJB 1VQPA 2CZ0B 2QEXT 1KC8C 2XHCA 3JCMh 4GY5A 2QQRA 4M7DC 4V2SA 5GMKi 1D3BB 2FVUA 3O8VA 2RO0A 4R55A 4E7LA 5GAOr 3OBYA 4RG2A 4XU0A 3CPWS 1VQKT 4M7DA 4JRPA 3M53A 4XU2A 3JCMg 1I81A 4M7AB 2XK0A 2RH2A 2Y4YA 1VQ8T 2H3JA 2MAMA 2YLCA 2LNVA 3QIIA 4TVRA 5GAMe 3CCLT 5J26A 1VQ6A 4KT0E 4PJOC 2DZ9A 3QJYA 2B8AA 3CCRT 2JVVA 5CQXA 4BI8B 2KY9A 1V29B 3HHTB 2OTLA 4PJOA 4LD6A 4ZGEB 4JUVA 3TCJA 3KBGA 5FU7C 1JB0E 1UGPB 3BDLA 3OW2S 2EAYA 1WJRA 3UT1A 2RI3A 2IVWA 4C8QC 3CCUT 4M77B 1FXXA 3HRTA 4C5GA 3I56T 2YLBA 4C92C 2LDMA 2QDYB 4XTYA 3JCMb 3CC2A 1LNXA 3QO3A 5GAMj 1K73C 4XTXA 1N27A 1NPRA 5HKCA 4PNOA 1G3TA 1QVGS 2XDBA 3CMEA 3PIPA 2I2LA 1QVFS 5D6YA 4M77F 3OS2A 1Q82C 4QVDA 1NE8A 3AHUA 1K9MU 1WJSA 2Y4XA 5LJ5h 3DLMA 3CXCS 1N8RU 2VXFA 3QBYA 4ZTJA 3X25B 4OGEA 3T9NA 3FEOA 1O75A 5LJ3d 3OS1A 3E19A 3L1AA 2ZPFB 5LL6S 3JCMc 5GANf 4JS4A 1M1KU 3E9FA 1AHJB 4LDWA 1VQ6T 2DPPB 4WF2A 5CIUA 5LJ5g 4BY6B 5IN1A 3JB9G 2L8DA 2XIDA 3KUFA 4GLKA 3S3OA 2RD1A 4M7DD 1I5LA 4OMFB 4IUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO n;  5LJ5 j;  2CGH A;  4XTZ A;  3RKY A;  3JCM J;  2FB7 A;  5CAI A;  4M7A C;  4C8Q A;  2RA2 A;  1M5Q 1;  3RES A;  4HT8 A;  4XU3 A;  2QTX A;  4JRI A;  4C92 A;  1WNL A;  3JCM P;  4XU1 A;  4PJO F;  2HNI A;  2DTO A;  2VC8 A;  4QVC A;  3QSU A;  1X01 A;  5GAN 6;  4M77 C;  4J6X A;  4N0A C;  3INZ A;  4OP0 A;  4A53 A;  4PJO D;  2DVE A;  5GAM f;  1U1T A;  2EJF A;  2RB6 A;  4M78 E;  4X9C A;  5GMK e;  3VU3 C;  4DQ2 A;  4XTW A;  5DY9 A;  5GAN 2;  2DEQ A;  2DKG A;  4J6Y A;  3RKW A;  4N0A A;  4M78 B;  4M77 G;  2DTH A;  4M75 E;  1BIA A;  1D3B A;  2RM4 A;  4J5Y A;  4F7U A;  5LJ5 d;  1H64 1;  2E65 A;  3BFM A;  5GMK h;  4C92 F;  4M75 B;  3EFS A;  3RIR A;  2EJG A;  2EJ9 A;  4C8Q D;  5LJ3 e;  3SWN C;  4M7A A;  1KQ2 A;  3SB2 A;  1Y96 A;  1WQW A;  4M7D G;  4EMG A;  4C92 D;  4C8Q E;  5GAO l;  1N9R A;  2DZC A;  4NL2 A;  1B34 A;  2DXU A;  3JCM V;  4C92 E;  3JCM W;  4C8Q B;  4MML A;  1WQ7 A;  2E10 A;  4M78 F;  4NOY A;  4C92 B;  4EMK C;  5GMK j;  3M4G A;  2K57 A;  5LJ5 f;  3JCM e;  4M78 D;  5GAN e;  1HK9 A;  4M75 F;  3V8J A;  5GAO p;  4PJO G;  4EMK A;  3FIF A;  2JN0 A;  5LJ3 g;  4M7A F;  4M75 D;  1BIB A;  1N9S A;  3BDU A;  1LJO A;  1HXD A;  4M77 A;  4RCB A;  5GAN 8;  3EFR A;  4F7U E;  3JB9 D;  3JCM h;  3HSB A;  4V2S A;  5GAN h;  4M7D C;  4C8Q F;  3JB9 I;  4M7A D;  5GMK i;  3FJP A;  3BW1 A;  4JLI A;  1D3B B;  4XTV A;  4F7U B;  5GAO r;  4EMH A;  4M7A E;  1MGQ A;  3BY7 A;  4XU0 A;  4M7D A;  4Y91 A;  4JRK A;  5GMK l;  5GAN 4;  4XU2 A;  3JCM Q;  2DXT A;  3JCM g;  1I81 A;  4M7A B;  5GAN g;  1M8V A;  1Y96 B;  3V8L A;  1JRI A;  4X9D A;  5GAM e;  2YLC A;  3SWN A;  3V8K A;  4PJO C;  5GAN j;  2DZ9 A;  5LJ3 h;  3HFN A;  5GAN 7;  3RER A;  5GAO m;  1JBM A;  4F7U F;  3FB9 A;  1WPY A;  4M77 D;  5GAM h;  3GIB A;  1KQ1 A;  4M78 G;  4PJO A;  3JB9 F;  4JUV A;  4RCC A;  5GAO q;  4M77 E;  3V7S A;  4EMK B;  1I4K 1;  2E1H A;  2EAY A;  4XQ3 A;  2VXE A;  4M75 G;  2E41 A;  4C8Q C;  4M77 B;  3RKX A;  4MMK A;  1U1S A;  5LJ3 j;  5GAM g;  2YLB A;  2E64 A;  4C92 C;  3V7R A;  3JB9 J;  2Y90 A;  4M7D E;  2DJZ A;  4XTY A;  3JCM b;  2EWN A;  3JCM d;  1LNX A;  2ZGW A;  3QO3 A;  5GAM j;  5GAN d;  4C8Q G;  3QUI A;  4M7D B;  3HFO A;  2FYK A;  4XTX A;  5I21 A;  5LJ5 e;  5LJ3 f;  4PNO A;  4C92 G;  1B34 B;  2I2L A;  4M78 C;  3V7C A;  5GMK m;  3SWN B;  3QHS A;  4M77 F;  4QVD A;  3AHU A;  5LJ5 h;  4PJO E;  1LOJ A;  3PGG A;  2YHT A;  2VXF A;  4M75 C;  4M78 A;  5GAN 5;  4XTU A;  5GAN 3;  5LJ3 d;  4PJO B;  3JCM X;  3L2Z A;  3L1A A;  3JCM f;  1I8F A;  5GAN f;  4J6W A;  3JCM c;  4A54 A;  4M75 A;  4HT9 A;  3RUX A;  4M7D F;  1YCY A;  4F7U G;  4WF2 A;  5LJ5 g;  1TH7 A;  5GAM d;  3JB9 G;  4HA8 A;  3JB9 H;  4M7D D;  4NL3 A;  2RD1 A;  1I5L A;  2DTI A;  4M7A G; 
#chains in the Genus database with same CATH topology
 3NMZ C;  3CC2 Q;  4PJM A;  1JXO A;  4C0D B;  1X27 A;  3S3M A;  1TSF A;  4LE9 A;  3CD6 T;  3OYI A;  4BE1 A;  1R8O B;  3I5R A;  3CCL A;  4E7I A;  3CCR A;  4N0A A;  3MET A;  5L23 A;  1Y7X A;  2RJF A;  1TG0 A;  1M27 C;  2M1H A;  3M4Y A;  5KYW A;  2O88 A;  1ZBX A;  3OYL A;  4C92 D;  1RAG B;  4D8D A;  3L2U A;  3CCE T;  2BE7 D;  4NOY A;  1VQK Q;  3JAM E;  1M1G A;  4J9B A;  2PVD B;  2X3X D;  1BKB A;  1KQS S;  1F1B B;  1IXD A;  1A0N B;  4DBF A;  1M90 R;  3H41 A;  5KCO A;  2JTM A;  1SRM A;  1OUL A;  2QGG A;  1VQ6 A;  4J8O A;  2A7Y A;  2AZS A;  5KYY B;  1PC0 A;  2F2V A;  5J39 A;  2ZPI B;  3THK A;  2LJ1 A;  3SWN A;  3VS4 A;  2DJQ A;  3GIB A;  3CBM A;  1PNJ A;  4FIB A;  1PG5 B;  3ZBD A;  2M9U A;  5GAO q;  3CEY A;  3NHN A;  3PMT A;  3PTA A;  2QQB A;  3CD6 A;  2E1H A;  1Q82 R;  1GL5 A;  4YTL A;  2JS2 A;  2ATC B;  5GAM g;  3QYH B;  1K73 U;  2Y90 A;  2RF0 A;  4DBR A;  5GAN d;  1VYU A;  3M56 A;  3MP1 A;  2CP7 A;  2WSC E;  1B34 B;  5FWB A;  1SPK A;  3CCE A;  2SEM A;  4M75 C;  1IHW A;  1YJW Q;  3CMA Q;  4XTU A;  4ELY C;  3JCM f;  4M7D F;  4DOW A;  1YCY A;  3M9Q A;  2J6K A;  2QGF B;  3VRY A;  4WTO B;  2MYS A;  2O4X A;  5GAO n;  3LX7 A;  3CC7 T;  5D6W A;  1WXU A;  2V8J A;  2EQM A;  2VC8 A;  3RMS A;  3M0U A;  3CCV Q;  2DKG A;  2A36 A;  2M51 A;  1BIA A;  1M2O A;  2LCS A;  2COZ A;  2EYZ A;  4OB3 B;  4AFU C;  5I11 A;  4LD9 K;  4HKE A;  4EMG A;  1FMV A;  1RUW A;  3L42 A;  2BIV A;  2WSE E;  2X51 A;  1QKX A;  2PUO B;  3OSS C;  3CC4 Q;  1RLP C;  4XAX B;  5LJ5 f;  5GAN e;  1HK9 A;  4BUG A;  1Q7Y R;  4EMK A;  2ESW A;  2J7I A;  3MCA B;  5GAN 8;  4CI0 C;  4DEX A;  2M0O A;  3VS6 A;  1EX4 A;  1Q95 G;  2DYB A;  3HSB A;  1X75 C;  3G71 Q;  3QDR B;  4E7Z A;  1JXM A;  1VYV A;  2X35 A;  4QQD A;  2YRC A;  4L6V 5;  4WCI A;  3JCM Q;  5KYW B;  6AT1 B;  2BKD N;  1OU9 A;  5L8R E;  3QWY A;  2EGC A;  4OMQ A;  5A0D A;  4KUI A;  3CCM Q;  2EIF A;  3CC7 A;  3RER A;  5A2Q E;  2RHX A;  2YSQ A;  1MHN A;  1PSE A;  4RCC A;  3A8H B;  3UA7 A;  4R0K A;  1WYX A;  1YI2 T;  1GCQ C;  1NZ9 A;  3QXE B;  4B6M A;  4FT4 A;  2KYB A;  3CC4 T;  4N4H A;  1VQM T;  2ZGW A;  2FYK A;  3NFC A;  4X1V A;  3EG9 A;  1UB4 A;  4M78 C;  3V7C A;  3SWN B;  3QHS A;  1WHM A;  1BU1 A;  3C0C A;  2A08 A;  3CXC P;  1Q86 R;  1VQ5 T;  2JM9 A;  3MP8 A;  2LP5 A;  2QAZ A;  4XTZ A;  1B7T A;  1M4Z A;  1UGS B;  2QDL A;  1M5Q 1;  1SHF A;  3EHR A;  4XU1 A;  4HCK A;  2HNI A;  5CO7 A;  4C5E A;  1TS9 A;  2FG0 A;  4J9D A;  4R56 A;  2AK5 A;  5GAN 2;  1H8K A;  1WJQ A;  3OW2 A;  2EYW A;  2DD5 A;  3RIR A;  1V76 A;  4L5G A;  1YI2 A;  2O4X B;  2LZ6 B;  5FU7 B;  1K8A C;  4JZ3 A;  4AFZ C;  2L89 A;  4IKF A;  4ANJ A;  3URG A;  3KFV A;  1VQM A;  2C06 A;  1NM7 A;  3A8M B;  2LT1 A;  2LQW A;  2ZPH B;  2O9S A;  1Z9Q A;  3PNW C;  3MEU A;  4M7A F;  3JB9 D;  2QG9 B;  4F7U E;  3HRS A;  2KSS A;  2DXT A;  5ECA A;  1VQ5 A;  3CBO A;  2VKN A;  2X4Y A;  1E6H A;  2G3R A;  1H3H A;  1IGQ A;  2LMJ A;  1PRL C;  4EMK B;  1ZQ1 A;  1WHJ A;  4KH0 B;  5KCH A;  2XI9 A;  3JB9 J;  3X24 B;  4C0D C;  4OMP A;  2O01 E;  3G6E T;  1GBR A;  5I21 A;  1RAB B;  5CK9 A;  1AWJ A;  3CME Q;  2HBP A;  4J7F A;  2RJE A;  4LUE A;  1KQS A;  4PJN A;  2HKN A;  2E3H A;  1X6G A;  3P8B B;  4Y92 A;  4EDU A;  1AZG B;  1N6A A;  3H8Z A;  2ECZ A;  4J7I A;  1RI9 A;  4OGC A;  4HT8 A;  1AZE A;  2VWF A;  1WNL A;  4BDZ A;  1RAE B;  3QSU A;  3EG9 B;  1YFN A;  2J6O A;  2QK0 A;  4FSS A;  4J6X A;  4CC2 A;  2JOY A;  1U1T A;  1VQ9 Q;  4BE0 A;  4PKC C;  1VQ8 Q;  4E7J A;  4ORZ A;  2DTH A;  1YJ9 Q;  5KYX A;  1AEY A;  2VGM A;  1ZLM A;  2QXF A;  3EFS A;  4ZN1 A;  4K11 A;  1K8A U;  1AWX A;  4PFP A;  3OYF A;  3CME T;  3FRN A;  1Y96 A;  4C8Q E;  1SF9 A;  3JSC A;  3G7Z A;  3OYB A;  2H8H A;  2ZPE B;  2DA9 A;  5AT1 B;  4FSX A;  3G6E A;  4C0F A;  1UUE A;  2KNB B;  2DEU A;  3A8O B;  1VQ7 Q;  2YRD A;  2JW4 A;  1KC8 C;  2QQR A;  2OJ2 A;  2VVK A;  5GMK i;  3O8V A;  4RG2 A;  3CPW S;  3M53 A;  4XU2 A;  3VS2 A;  1I81 A;  3FJ5 A;  2EYY A;  2LJ3 A;  1VQ8 T;  2YLC A;  5J26 A;  2AZV A;  3QJY A;  1TUD A;  2MK5 A;  4BI8 B;  4LD6 A;  2OTJ Q;  2KRO A;  3TCJ A;  4DBQ A;  3EFO A;  1YIJ Q;  3UT1 A;  4C8Q C;  2CP0 A;  4HVV A;  3I56 T;  2LDM A;  2QDY B;  1LNX A;  3QO3 A;  3EG1 A;  1QVG S;  3CME A;  3NGP A;  2I2L A;  2HQH A;  3AHU A;  2Y4X A;  3QBY A;  4OGE A;  5LJ3 d;  2A0F B;  5IHK A;  5LL6 S;  1NYG A;  1WHH A;  1M3A A;  5CIU A;  1QWE A;  1TXQ A;  5IN1 A;  2L8D A;  4M7D D;  2E3I A;  4IUV A;  4N4I A;  2EBP A;  3RR6 A;  2OTJ T;  2CZ1 B;  3UAT A;  1U5S A;  3Q1J A;  1K0X A;  1YJN T;  1T3L A;  3AT1 B;  4N0A C;  3D7S B;  1T3S A;  3CCS A;  2K5I A;  1AT1 B;  1GXI E;  2FRY A;  4F7U A;  2HBW A;  2MPX C;  4Z89 A;  2KEA A;  1KQ2 A;  2W0Z A;  2GTO A;  4Q5W A;  3RBB B;  3I56 A;  2G6F X;  5CKE A;  2LQ8 A;  4A4H A;  3EGU A;  4C0Z A;  5GAO p;  4HVU A;  5LJ3 g;  1KC8 U;  3CCL Q;  4RCB A;  1I5O B;  2OI3 A;  3CCR Q;  2DFU A;  4XTV A;  3TSZ A;  4EPC A;  1X2K A;  5KYX B;  2DMO A;  2F5T X;  5HK3 A;  3NPF A;  4PLL A;  2RK2 A;  2ZZD A;  1Y96 B;  1WXB A;  1RAH B;  3V8K A;  5IAY A;  3GLX A;  4FU6 A;  2RI5 A;  2OTJ A;  5CKH A;  2KRS A;  5GAM h;  1QP3 A;  1YJN A;  3JB9 F;  2O9V A;  4M77 E;  5D6X A;  1QP2 A;  2KQW A;  3TRE A;  4FCY A;  2ZAE A;  1UE9 A;  2KXD A;  1OPL A;  1PWT A;  4MDX A;  1G3S A;  3I55 T;  4FW1 A;  2RHY A;  1BB9 A;  3M0Q A;  2KK4 A;  4ME7 A;  3REB B;  4B9X A;  1QW1 A;  1VQ6 Q;  1K4U S;  1BBZ A;  2R5A A;  1RAA B;  4C0G A;  2NLU A;  3OYK A;  2R57 A;  2W10 A;  1IZ6 A;  2HD0 A;  5GAN 5;  1HD3 A;  2NUZ A;  4A54 A;  2FHD A;  4F7U G;  2AKL A;  4RTX A;  4BAC A;  2JT4 A;  3H0I A;  1VQ4 T;  3CD6 Q;  2ZCF B;  5AYF A;  4C8Q A;  3PIO A;  2DXC A;  3FDR A;  4PJO F;  4E47 A;  2P0Q A;  3PFS A;  1RAF B;  5GAN 6;  4M77 C;  4OF1 A;  2CUD A;  5GMK e;  2KXC A;  5DY9 A;  2P4T A;  1YNZ A;  3CCE Q;  4JJB A;  2D0Q B;  2RJD A;  3C12 A;  2XD0 A;  3E9G A;  2F69 A;  1TTH B;  3CCQ T;  5A0G A;  1WHL A;  3VS7 A;  4ZN3 A;  2DM1 A;  4PFO A;  3JCM V;  1Y07 A;  1HYO A;  2V1Q A;  5KE2 A;  4GBQ A;  4EMK C;  1YBY A;  3I55 A;  4VUB A;  3I9Q A;  2DLP A;  1OEB A;  2FPD A;  1UG1 A;  2BTT A;  1NPP A;  1FMK A;  1OX9 A;  2QTV A;  1ZHI A;  3QYG B;  2JJ9 A;  4A4F A;  2BE9 B;  4M7A D;  3SD4 A;  4F7U B;  1KIK A;  1YHQ A;  3OS0 A;  4Y91 A;  2VAS A;  4JRK A;  4RMO A;  1M8V A;  4QQ6 A;  1VQ4 A;  2KRN A;  1JRI A;  2J05 A;  2EPD A;  2JMC A;  1UEB A;  1VYT A;  5GAN j;  4IUT A;  3NTH A;  3EH1 A;  1K9M C;  1JEG A;  2CYZ B;  4JLG A;  4OML A;  1RAD B;  1IRE B;  3OB9 A;  3RKX A;  4MMK A;  1VIE A;  1PSF A;  3OW2 P;  4M7D E;  2DJZ A;  3VS0 A;  3JCM d;  4C8Q G;  3QUI A;  1NJI C;  1VIF A;  2MI6 A;  3CCQ A;  1YIT T;  3VS5 A;  2ED0 A;  5GMK m;  3QG1 A;  2E4H A;  1D0Z A;  2ENM A;  3ZL7 C;  3CC7 Q;  3PGG A;  3OYN A;  3LWI A;  1UDL A;  2K7A A;  3DB3 A;  1O9S A;  1HJD A;  2L3S A;  2XDP A;  2Z0W A;  3GNF B;  3CPW A;  1QCO A;  2RMO A;  3RKY A;  5EG2 A;  3L2W A;  1RAI B;  5CAI A;  5FLX E;  2YT6 A;  1CSK A;  3OA6 A;  3JCM P;  5CR2 A;  1JJ2 A;  1KD1 R;  2DE0 X;  2E6Z A;  2P84 A;  3MEA A;  4OP0 A;  3OYC A;  2EVR A;  4FT2 A;  1BI2 A;  5GAM f;  2RB6 A;  3GOX A;  3J7A F;  2PZ1 A;  2DEQ A;  4PJJ A;  4B9W A;  4J5Y A;  5LJ5 d;  1XJW B;  3BFM A;  3A1P A;  4FYV B;  4Y28 E;  4ZTF A;  1W2B A;  4A63 B;  2X4X A;  1N9R A;  4NL2 A;  4C5H A;  1NBE B;  5C0M A;  3A8L B;  2ZPB B;  4C8Q B;  4J9G A;  1QVG A;  2JUF A;  2I0N A;  5CQY A;  1H92 A;  1IB8 A;  4KBM B;  3JCM e;  4OB0 B;  4M75 F;  1JO8 A;  1M2V A;  2PQW A;  1YIT A;  3S3N A;  4DOV A;  3WXM B;  3PT9 A;  4M77 A;  5IXF A;  2LX9 A;  4HVW A;  1CKB A;  1KQS P;  2BZ8 A;  2MIO A;  1ZX6 A;  2IG0 A;  2X4W A;  2FL7 A;  3BY7 A;  4IUP A;  1BK2 A;  3UA6 A;  5GAN g;  3QZ5 B;  1V1C A;  1YI2 Q;  1X43 A;  1ZSZ C;  4J9I A;  2L0A A;  1VQM Q;  2M16 A;  1WPY A;  2RJC A;  2GCX A;  1KQ1 A;  1PKT A;  2KT1 A;  3GBQ A;  2JM8 A;  1SHG A;  4D8K A;  1WA7 A;  2KYM A;  2D8J A;  1UHF A;  4JRQ A;  1ZA1 B;  1NJI U;  3VUZ A;  1VQO T;  3C94 A;  5LJ5 e;  1SSF A;  3C95 A;  4N4G A;  1VQ5 Q;  2RQV A;  2WSF E;  2DXB A;  5GJW B;  4AG2 C;  4J6W A;  5IHI A;  1IO6 A;  5IHN A;  4O6J A;  1M1K C;  2K79 A;  5CCA A;  2E41 A;  1KC8 R;  4LDU A;  4CRI A;  3M55 A;  4LDV A;  4MZP A;  1Q81 R;  4IUR A;  1VUB A;  1WXT A;  1X01 A;  3M57 A;  2K5F A;  2XKO C;  2RNA A;  3OSV A;  3RKW A;  4M77 G;  1XOV A;  2COY A;  3QZ9 B;  1AWW A;  1TUG B;  3X20 B;  2JXB A;  1WQW A;  1D1B A;  4II1 A;  1WX6 A;  4OVA A;  3LLR A;  4C92 E;  5M9O A;  2DX1 A;  4M78 F;  3X28 B;  1VQO A;  2VUB A;  1K0S A;  3UWN A;  2LJ0 A;  4OMN A;  2LCC A;  4PK4 A;  4F16 A;  4KGX B;  3BDU A;  4ZGJ B;  2QEX T;  4V2S A;  1PM3 A;  1SEM A;  2RO0 A;  4R55 A;  3QDF A;  4E7L A;  3OBY A;  4M7D A;  2EGE A;  3I35 A;  3SEM A;  2E5K A;  2XK0 A;  4TVR A;  3QII A;  2LNV A;  4KT0 E;  3EH2 A;  4J9E A;  2JVV A;  2YWW A;  2COW A;  3HHT B;  1FMW A;  3G6E Q;  1KSW A;  1D1C A;  4Z8A A;  4ZGE B;  1OX8 A;  1R77 A;  2EAY A;  3CCU T;  4M77 B;  2GTJ A;  2K6D A;  3HRT A;  4C5G A;  4C92 C;  1N8R R;  2L2P A;  4XTY A;  3JCM b;  4PJL A;  2CH4 A;  1G3T A;  2NUP A;  2CDT A;  4Z88 A;  1QVF S;  3OS2 A;  1Q82 C;  1NE8 A;  3DLM A;  4ZTJ A;  3MPU B;  1ACM B;  1QWF A;  1ZSZ A;  3T9N A;  1Z9Z A;  3FEO A;  1O75 A;  1NEG A;  1UEC A;  1M1K U;  1BCO A;  3E9F A;  4WF2 A;  2J6F A;  4DA4 A;  4E6R A;  1I5L A;  2QEX A;  3OS5 A;  2VGN A;  1MMG A;  2CUB A;  3VKI A;  1GBQ A;  1WIE A;  1M9S A;  1X69 A;  4PJO D;  2EJF A;  4KGV B;  1AD5 A;  4JZ4 A;  4FYW B;  4J6Y A;  3L2V A;  4PLI A;  1ABO A;  3CCJ T;  3FLG A;  2V26 A;  3JV3 A;  1H64 1;  1NYF A;  2RQR A;  2RHI A;  2EJ9 A;  4MZM A;  1IHV A;  4LUD A;  4M7D G;  4FW2 A;  4L59 A;  3CCU A;  1NLP C;  2MWP A;  2QQS A;  4HCB A;  2P0P A;  3V8J A;  2YDL A;  4A4E A;  2C0I A;  2JN0 A;  4PL6 A;  2RK1 A;  3EG3 A;  4QVZ A;  3CCS Q;  1N9S A;  1LJO A;  3EFR A;  2ABL A;  4FL6 A;  4ATO A;  8AT1 B;  2AKK A;  2WAC A;  2O31 A;  2JZ2 A;  2NYS A;  4A4G A;  2QAS A;  5GAN 4;  1XQH A;  2D6F A;  2D9T A;  1RAC B;  2IPO B;  4X9D A;  1WDX A;  2LC4 A;  4LN2 A;  1GRI A;  2L3R A;  1WI7 A;  1Q7Y C;  2KT8 A;  3OYA A;  3OYY A;  3I56 Q;  1K73 R;  5GAN 7;  3E2U A;  3O5Z A;  7AT1 B;  2DL7 A;  2QQ9 A;  3IQL A;  2EYX A;  1OU8 A;  2HMA A;  1K9A A;  5GJV B;  4XQ3 A;  5LJ3 j;  4RTW A;  1GFD A;  4KUD K;  2XU8 A;  3EG2 A;  3CCJ A;  2MOX A;  5CKD A;  1EFN A;  4M7D B;  2YUO A;  4HCC A;  1JJ2 S;  4GLM A;  3CCS T;  1Q82 U;  1G5V A;  3M59 A;  1MUZ A;  2CSQ A;  4CC4 B;  3HPW A;  2JTE A;  3L2Q A;  3HKS A;  3LH5 A;  3EG0 A;  1VQL Q;  3OYH A;  3L2R A;  1UGR B;  1YJN Q;  3RUX A;  2JNG A;  4NL3 A;  3HP9 A;  1OPK A;  1W2B S;  3LYI A;  2CP3 A;  4C92 A;  9ATC B;  2EQU A;  4LXC A;  3RMQ A;  1G83 A;  4LDX A;  1AVZ C;  3GF5 A;  2DF6 A;  1Q86 C;  1IGU A;  2NWM A;  2PVO B;  1DJ7 B;  2BZY A;  2B86 A;  1ZSZ B;  4JJN K;  2QI2 A;  4XK8 E;  2SRC A;  3VS3 A;  2EYQ A;  5IH2 A;  2KAF A;  1KJW A;  3JCM W;  2LX7 A;  1VQL T;  4MML A;  2DRM A;  1BYM A;  4OMO A;  2OAW A;  1ARK A;  5GMK j;  1PD1 A;  2HKQ B;  2DIQ A;  3QWX X;  3FIF A;  4M75 D;  1HSQ A;  1OQK A;  3JB9 I;  1XNI A;  3H9N A;  5GMK l;  3WVD B;  3S6W A;  3MKD A;  3J81 E;  1WZO A;  3CPW P;  2YXY A;  2CRE A;  5FU6 B;  1QMC A;  3J80 E;  5GAO m;  1JJ2 P;  1JBM A;  1TOV A;  1G2B A;  2V8K A;  3FB9 A;  3RDV A;  3I55 Q;  5FRO A;  1D0Y A;  4ZGD B;  1I4K 1;  4FYY B;  2VXE A;  1NLO C;  1PHT A;  2PU9 B;  2E64 A;  2H3E B;  1KG1 A;  5DLO A;  1E7O A;  1TWB A;  1YHQ Q;  1KFZ A;  5LJ3 f;  4C92 G;  3ZFJ A;  1AWO A;  4ELZ C;  1VQ4 Q;  1W2B P;  3DB4 A;  2X4J A;  3SHW A;  4KUL A;  2LNH B;  1NEB A;  5IT9 E;  1S72 T;  1VQL A;  1QVG P;  4PJO E;  5FRM A;  2YHT A;  1UJY A;  3OQ5 A;  1P92 A;  1M1F A;  4P5N A;  2GGR A;  4F17 A;  1LPL A;  4HXJ A;  1TH7 A;  4HA8 A;  2BZX A;  1D0X A;  3VRZ A;  3JCM J;  3G1J A;  2PVG B;  3RES A;  2J06 A;  3A98 A;  2HQX A;  3M0S A;  4RTZ A;  4JJD A;  1H3Z A;  1Q86 U;  2DVJ A;  1I0C A;  2K9G A;  2VYT A;  3CCQ Q;  1T0H A;  3G4S T;  1PD0 A;  2K2V A;  4E2F B;  1YHQ T;  2A28 A;  1D3B A;  3EFO B;  3MEW A;  3NTI A;  4EIK A;  1GFC A;  4AFQ C;  3RNJ A;  2P0K A;  2GQI A;  1B34 A;  1PRM C;  2E10 A;  4F14 A;  1QVF A;  4C92 B;  3M4G A;  3N5B B;  3KXT A;  4M78 D;  3FC3 A;  5KE3 A;  4J9C A;  2FPE A;  2MF2 A;  2QA4 T;  2QQA A;  1KHC A;  1BIB A;  1S72 A;  1M3C A;  5GAN h;  5HY6 A;  3FJP A;  4HCZ A;  4O5V A;  3MEV A;  1MGQ A;  1QVP A;  2HL5 C;  1MMA A;  3TEE A;  1M1K R;  1PCX A;  2LTO A;  5DM7 R;  2GQV A;  3CQT A;  2EKO A;  3H6Z A;  1R0B G;  5I22 A;  2DAQ A;  2HAX A;  3WVE B;  1WHK A;  2KBT A;  2OTL Q;  1VOM A;  3OY9 A;  1YIT Q;  1QQJ A;  3QKJ A;  3G4S A;  3M0R A;  2GFU A;  2V8I A;  4OB1 B;  4OB2 B;  5KYU A;  1SKU B;  1UFF A;  2E6N A;  1X6O A;  1VQP T;  2ZPG B;  4BDY A;  2CS7 A;  4JS5 A;  2A3L A;  1CKA A;  2QA4 A;  4LNP A;  2VV5 A;  5GAM d;  5KH6 A;  5D7U A;  1M3B A;  3HTR A;  2R5M A;  2CGH A;  3M5A A;  5LJ5 j;  2FB7 A;  2FZK B;  3X26 B;  4XU3 A;  3TVT A;  2DET A;  2YRV A;  2OTL T;  4BB7 A;  2PUK B;  4RKU E;  2OAU A;  1K8A R;  3INZ A;  4JPB W;  1GCP A;  4X9C A;  1I07 A;  4XTW A;  2V1R A;  1X2Q A;  1FYN A;  2FZC B;  1T0J A;  1YN8 A;  4M75 E;  5C6S A;  3CC2 T;  1OOT A;  3LGL A;  3R6N A;  2QYZ A;  2EJG A;  3SB2 A;  2YUQ A;  4BD3 A;  2RI2 A;  2DNU A;  2HZY A;  3P8D A;  2DRK A;  3U23 A;  5A0L A;  2D1X A;  1VQP A;  4GY5 A;  4M7D C;  2KR3 A;  1D3B B;  2FVU A;  5GAO r;  4XU0 A;  1VQK T;  1SSH A;  3JCM g;  2RH2 A;  2Y4Y A;  2F2W A;  2H3J A;  5GAM e;  2XMF A;  2DZ9 A;  1YP5 A;  5FW9 A;  2ROL A;  1VQO Q;  2OTL A;  1V29 B;  2RQT A;  4PJO A;  2YUP A;  3KBG A;  1WJR A;  2DL8 A;  1EZZ B;  1QKW A;  2YLB A;  1R0C B;  3CC2 A;  4XTX A;  1N27 A;  1NPR A;  2XDB A;  3PIP A;  2F2X A;  2VB6 A;  1PKS A;  2EQI A;  5D6Y A;  2KRM A;  4QVD A;  1K9M U;  1WJS A;  1UGV A;  3CXC S;  2VXF A;  3E19 A;  8ATC B;  5GAN f;  4LDW A;  2D0N A;  5LJ5 g;  1ABQ A;  2RQU A;  3JB9 G;  1MNE A;  4GLK A;  3KUF A;  4OMF B;  2HSE B;  2XG8 D;  1YJW T;  1MV0 B;  3CMA T;  1G3W A;  2DIL A;  3OYG A;  1W1F A;  4DBH A;  5KYU B;  4QVC A;  2DTO A;  2F1L A;  4JDS A;  1VQK A;  2E5Q A;  3PVL A;  4M78 E;  4DQ2 A;  2CSI A;  4KGZ B;  2K2M A;  2RM4 A;  2RN8 A;  1D09 B;  2AIR B;  2L5Q A;  1UGQ B;  3MP6 A;  4C8Q D;  3GPL A;  5FU6 C;  2GBQ A;  3VJP A;  1MMN A;  1SRL A;  1WLP B;  3CCV T;  3LW5 E;  2QEX Q;  3MJX A;  3DLL A;  4QT7 A;  3MHX A;  4PJO G;  1ZSG A;  1G3Y A;  3UF4 A;  3TSW A;  1G8X A;  3BW1 A;  4BI3 A;  3H0H A;  2HSP A;  4M7A E;  4J9H A;  3A8G B;  1U8R A;  4D6W A;  5CKB A;  3CCU Q;  1VQN Q;  3HFN A;  3G71 T;  1YJW A;  2DO3 A;  3CMA A;  4LDY A;  3HRU A;  3F70 A;  2K3Y A;  2RHU A;  2K5L A;  4X34 A;  1C0M A;  1UTI A;  4RTV A;  4PFZ A;  3CCM T;  1X6B A;  3V7R A;  4JJC A;  2EWN A;  3C4S A;  2LQN A;  3OYE A;  4KH1 B;  1OI1 A;  1YCS B;  1OZ3 A;  4ZNX A;  3JRZ A;  2CP6 A;  5I2S A;  3ME9 A;  3CCV A;  2ROT A;  1M90 C;  3BE3 A;  4PJO B;  1M2V B;  4M7A C;  4HT9 A;  4M75 A;  5CVI A;  1QCN A;  1VQN T;  3REA B;  3JB9 H;  4BI4 A;  1J3T A;  1SG5 A;  2LRQ A;  2K3B A;  3EGX A;  3CC4 A;  2JTF A;  2CZ6 B;  3CCJ Q;  2KGT A;  1M30 A;  3M58 A;  3NTK A;  2R58 A;  3ZEH A;  3M0T A;  1C6V X;  1NG2 A;  2E12 A;  2D8H A;  2X3W D;  1K1Z A;  2MWO A;  3LH0 A;  2C0O A;  2X9H A;  3G71 A;  2E65 A;  3QJ6 A;  4C92 F;  4OMM A;  1KD1 C;  3VV0 A;  1OV3 A;  1N5Z A;  5GAO l;  2AHJ B;  3E1S A;  3CCM A;  2DXU A;  4RG8 A;  3CBP A;  5IXB A;  3VUB A;  3SFM A;  2EGA A;  1KHI A;  1XTD A;  4BY6 C;  3EGD A;  1W6X A;  1Y71 A;  2HDA A;  1EIF A;  1HXD A;  2RHZ A;  1ZUK A;  3PVQ A;  3GP8 A;  1OYX A;  1YWO A;  2L3P A;  4JLI A;  4EMH A;  1B07 A;  1VQN A;  2GFA A;  3V8L A;  4MZT A;  1FX7 A;  2K3X A;  1LCK A;  1W70 A;  5LJ3 h;  2CT4 A;  5I2M A;  2MCN A;  4F7U F;  1VA7 A;  1I1J A;  2DD4 A;  4M77 D;  4AMC A;  1BI0 A;  2KI7 A;  4RTT A;  1BI3 A;  4NS5 A;  1YWP A;  2LT4 A;  4M75 G;  2EQK A;  4QQG A;  2FO0 A;  1GCQ A;  3LGF A;  3M0P A;  4IUQ A;  2JMA A;  2FZG B;  2OX7 A;  3R6O A;  1K76 A;  2LVM A;  1M90 U;  5FWC A;  3GNG A;  2DER A;  1LOJ A;  3VYH B;  4M78 A;  1QVF P;  5GAN 3;  3ASK A;  2DK3 A;  2FPF A;  3JCM X;  1D1A A;  3L2Z A;  4E7H A;  1I8F A;  2DL3 A;  3LWH A;  2M0Y A;  4RTY A;  2PTK A;  2DBK A;  2GNC A;  2FEI A;  4RUG A;  2BUD A;  4F04 B;  2DBM A;  4JRI A;  1U3O A;  4E7K A;  4FYX B;  4AG1 C;  2CKK A;  3HL8 A;  2DL4 A;  2DVE A;  3VU3 C;  2CT3 A;  1S1N A;  2M02 A;  4QW2 A;  3M54 A;  1E6G A;  4J9F A;  2HQE A;  1QLY A;  2GF7 A;  1KD1 U;  5GMK h;  4M75 B;  1Q81 C;  3A5Z B;  3OYM A;  3OMG A;  3SDZ A;  4M7A A;  4C5I A;  4IIO A;  1VQ9 T;  1RI0 A;  3UPU A;  2EQJ A;  5FRN A;  3EGX B;  2DL5 A;  3MO8 A;  1YJ9 T;  1M8M A;  2F5K A;  2HEQ A;  3TQ7 P;  2K57 A;  2NUP B;  2KDS A;  2ED1 A;  2NUT A;  3CXC A;  2L3Q A;  2RPN A;  1OZ2 A;  2EFI A;  3EAE A;  1ZBJ A;  2AT1 B;  4C8Q F;  1WFW A;  1K9M R;  1Y0M A;  2LCL A;  2O2O A;  3QPH A;  4CC7 A;  1VQ7 T;  2K4Y A;  2CH4 W;  1NJI R;  1FWZ A;  1KK7 A;  1BI1 A;  4M78 G;  1JU5 C;  3EGD B;  3V7S A;  1AOJ A;  4CC3 A;  2HCK A;  1LVK A;  1U1S A;  1S72 Q;  5HK0 A;  5KYN A;  3OBW A;  4J83 A;  3ULR B;  1RLQ C;  4BE2 A;  1WGS A;  5HCK A;  3HFO A;  1TU0 B;  1Q7Y U;  1ZUU A;  2EW3 A;  1YIJ T;  1VQ9 A;  1VQ8 A;  2CP5 A;  3VYG A;  4IUU A;  2A37 A;  2CZ7 B;  4UC4 A;  1YJ9 A;  1N8R C;  4ESR A;  4FM4 B;  3H0F A;  1RL2 A;  2JS0 A;  2P4R A;  2MMP A;  3UDC A;  3EHQ A;  4QKU A;  2DTI A;  4M7A G;  3G4S Q;  4MDW A;  2RA2 A;  2E70 A;  3OYD A;  2YUN A;  2KVQ G;  2QTX A;  1UJ0 A;  1ZA2 B;  4A53 A;  1VQ7 A;  4AFS C;  2DIG A;  5J3B A;  1C1A A;  1ZUY A;  4M78 B;  1Q81 U;  2XIC A;  3TU4 K;  5KYY A;  2KMT A;  3SWN C;  5LJ3 e;  2QA4 Q;  2HL3 A;  3OMC A;  5CKF A;  2DZC A;  2LQK A;  4AT1 B;  4A4K A;  3DKM A;  2EKH A;  1BCM A;  1WQ7 A;  2XDD A;  3CPF A;  3P8H A;  3ER0 A;  3OYJ A;  1UHC A;  3VS1 A;  1YIJ A;  1W4S A;  2IIM A;  2C0T A;  3PMI A;  5DLQ E;  4Z02 A;  1IRX A;  2CZ0 B;  4DEY A;  2XHC A;  3JCM h;  3I5S A;  1B3Q A;  5EC7 A;  4IIM A;  4JRP A;  1Y57 A;  4M7A B;  1MV3 A;  2MAM A;  3CCL T;  4PJO C;  2B8A A;  3CCR T;  5CQX A;  2KY9 A;  4JUV A;  2NUT B;  4M4Z A;  5FU7 C;  1JB0 E;  1UGP B;  3BDL A;  3OW2 S;  2DYI A;  1WHG A;  1QCF A;  2RI3 A;  2IVW A;  1VQP Q;  1FXX A;  2KE9 A;  5GAM j;  1K73 C;  1U06 A;  1JQQ A;  5HKC A;  4PNO A;  2FRW A;  2PNI A;  4M77 F;  2CP2 A;  3PE0 A;  5LJ5 h;  1N8R U;  4KRT A;  3X25 B;  4E7S A;  3OS1 A;  1TUC A;  3L1A A;  4RTU A;  2ZPF B;  1MMD A;  3JCM c;  4JS4 A;  1VQ6 T;  1AHJ B;  2DPP B;  2RQW A;  4BY6 B;  2XID A;  3S3O A;  2RD1 A;  1MND A; 
#chains in the Genus database with same CATH homology
 2QEX A;  4N4I A;  2XG8 D;  1YJW T;  3OS5 A;  2VGN A;  1G3W A;  3CMA T;  2OTJ T;  3OYG A;  2CZ1 B;  3Q1J A;  3VKI A;  4QVC A;  2DTO A;  4JDS A;  1VQK A;  1M9S A;  1YJN T;  4C0D B;  3S3M A;  3CD6 T;  4N0A C;  4PJO D;  3OYI A;  2E5Q A;  4BE1 A;  2EJF A;  1R8O B;  3CCS A;  4M78 E;  3CCL A;  4DQ2 A;  4E7I A;  4J6Y A;  2K5I A;  3L2V A;  4N0A A;  3CCR A;  4PLI A;  3MET A;  1GXI E;  3CCJ T;  1Y7X A;  2RM4 A;  3FLG A;  2RJF A;  4F7U A;  1H64 1;  2L5Q A;  1UGQ B;  3MP6 A;  2M1H A;  2RHI A;  2EJ9 A;  3M4Y A;  4MZM A;  5FU6 C;  4C8Q D;  3GPL A;  1ZBX A;  1KQ2 A;  4M7D G;  4L59 A;  4C92 D;  3OYL A;  3CCU A;  4Q5W A;  3VJP A;  3CCV T;  3LW5 E;  3I56 A;  3L2U A;  3CCE T;  4NOY A;  5CKE A;  2LQ8 A;  3DLL A;  4A4H A;  2MWP A;  2QQS A;  4HCB A;  2P0P A;  3JAM E;  1M1G A;  3V8J A;  4A4E A;  3MHX A;  4C0Z A;  5GAO p;  4PJO G;  2JN0 A;  2PVD B;  1BKB A;  4PL6 A;  2RK1 A;  5LJ3 g;  1G3Y A;  4QVZ A;  1KC8 U;  1KQS S;  1N9S A;  1LJO A;  4RCB A;  3EFR A;  5KCO A;  2JTM A;  4FL6 A;  4ATO A;  3BW1 A;  4XTV A;  4BI3 A;  4EPC A;  4M7A E;  2WAC A;  2F5T X;  2JZ2 A;  4A4G A;  5HK3 A;  3A8G B;  1XQH A;  4J8O A;  2RK2 A;  2A7Y A;  2ZZD A;  4PLL A;  4D6W A;  1U8R A;  2D9T A;  5J39 A;  1Y96 B;  2ZPI B;  5CKB A;  4X9D A;  2LC4 A;  3SWN A;  3V8K A;  2L3R A;  5IAY A;  1Q7Y C;  3OYA A;  3OYY A;  3HFN A;  5GAN 7;  3GLX A;  4FU6 A;  3G71 T;  2DO3 A;  1YJW A;  3CMA A;  4LDY A;  2RI5 A;  2OTJ A;  3HRU A;  3F70 A;  2K3Y A;  5CKH A;  2RHU A;  2QQ9 A;  3GIB A;  3CBM A;  5GAM h;  1QP3 A;  1YJN A;  3JB9 F;  4FIB A;  3ZBD A;  5GAO q;  2K5L A;  2M9U A;  4M77 E;  4X34 A;  3CEY A;  3CD6 A;  3PMT A;  5D6X A;  2QQB A;  1QP2 A;  2E1H A;  3PTA A;  2KQW A;  3TRE A;  4XQ3 A;  4YTL A;  3CCM T;  5LJ3 j;  5GAM g;  4MDX A;  3QYH B;  1K73 U;  3V7R A;  3L2W A;  2Y90 A;  4KUD K;  2XU8 A;  3CCJ A;  2EWN A;  3C4S A;  5CKD A;  1G3S A;  5GAN d;  3I55 T;  4M7D B;  2RHY A;  4B9X A;  2KK4 A;  3M56 A;  4ME7 A;  1QW1 A;  3OYE A;  4HCC A;  3MP1 A;  1JJ2 S;  2WSC E;  1OI1 A;  3CCS T;  1Q82 U;  1B34 B;  1OZ3 A;  3JRZ A;  2R5A A;  1G5V A;  5I2S A;  3M59 A;  3ME9 A;  4C0G A;  3CCV A;  2NLU A;  3OYK A;  2R57 A;  3HPW A;  1M90 C;  3CCE A;  3L2Q A;  1IZ6 A;  4M75 C;  2HD0 A;  3HKS A;  5GAN 5;  4XTU A;  3OYH A;  4ELY C;  3L2R A;  4PJO B;  3JCM f;  4M7A C;  1UGR B;  4HT9 A;  4A54 A;  4M7D F;  2FHD A;  4M75 A;  3RUX A;  4DOW A;  1YCY A;  3M9Q A;  5CVI A;  4F7U G;  2JNG A;  4BAC A;  1VQ4 T;  1VQN T;  3JB9 H;  4NL3 A;  2O4X A;  2ZCF B;  4BI4 A;  5GAO n;  3LX7 A;  3HP9 A;  5AYF A;  2LRQ A;  3CC7 T;  5D6W A;  4C8Q A;  1W2B S;  3PIO A;  3LYI A;  2DXC A;  3CC4 A;  2JTF A;  2CZ6 B;  4C92 A;  2V8J A;  2EQU A;  2EQM A;  3FDR A;  3M58 A;  4PJO F;  2VC8 A;  2P0Q A;  4E47 A;  3NTK A;  3PFS A;  2R58 A;  3RMQ A;  3ZEH A;  5GAN 6;  2E12 A;  4M77 C;  3RMS A;  4OF1 A;  4LDX A;  3GF5 A;  1Q86 C;  2MWO A;  3LH0 A;  5GMK e;  2PVO B;  5DY9 A;  1DJ7 B;  2DKG A;  2P4T A;  3G71 A;  4JJN K;  2QI2 A;  1BIA A;  2D0Q B;  2RJD A;  3C12 A;  2XD0 A;  3E9G A;  2E65 A;  2F69 A;  3QJ6 A;  4C92 F;  4OB3 B;  4XK8 E;  4LD9 K;  4HKE A;  3CCQ T;  1KD1 C;  3VV0 A;  5A0G A;  4EMG A;  4ZN3 A;  2EYQ A;  5GAO l;  2KAF A;  2AHJ B;  3E1S A;  3L42 A;  3CCM A;  2DXU A;  1Y07 A;  2BIV A;  2WSE E;  4RG8 A;  3JCM V;  3JCM W;  4MML A;  1VQL T;  3CBP A;  2PUO B;  3OSS C;  3VUB A;  5KE2 A;  1BYM A;  3SFM A;  1YBY A;  4EMK C;  3I55 A;  4XAX B;  1KHI A;  1XTD A;  5GMK j;  4VUB A;  5LJ5 f;  4BY6 C;  5GAN e;  1HK9 A;  4BUG A;  2DIQ A;  4EMK A;  3FIF A;  1Y71 A;  1NPP A;  4M75 D;  1EIF A;  3MCA B;  5GAN 8;  1HXD A;  4CI0 C;  1ZHI A;  2M0O A;  2RHZ A;  3QYG B;  4A4F A;  3GP8 A;  3HSB A;  1OYX A;  1X75 C;  3JB9 I;  4M7A D;  3QDR B;  4JLI A;  1XNI A;  3SD4 A;  4F7U B;  4EMH A;  1YHQ A;  2X35 A;  4QQD A;  4L6V 5;  3OS0 A;  4Y91 A;  4JRK A;  3WVD B;  5GMK l;  4RMO A;  3JCM Q;  3S6W A;  1M8V A;  2BKD N;  4QQ6 A;  5L8R E;  1VQ4 A;  1VQN A;  2GFA A;  3V8L A;  4MZT A;  1JRI A;  1FX7 A;  3J81 E;  5A0D A;  1UEB A;  2K3X A;  4KUI A;  5FU6 B;  5GAN j;  2EIF A;  4IUT A;  5LJ3 h;  3CC7 A;  3RER A;  5I2M A;  3J80 E;  5GAO m;  3NTH A;  5A2Q E;  2RHX A;  1JBM A;  1MHN A;  2V8K A;  3FB9 A;  4F7U F;  1PSE A;  2DD4 A;  4M77 D;  1BI0 A;  1K9M C;  4RCC A;  5FRO A;  1BI3 A;  2CYZ B;  3A8H B;  4NS5 A;  4JLG A;  2LT4 A;  4ZGD B;  1I4K 1;  1YI2 T;  1NZ9 A;  2VXE A;  3QXE B;  1IRE B;  2EQK A;  4M75 G;  3OB9 A;  3RKX A;  4FT4 A;  4MMK A;  1VIE A;  2PU9 B;  1PSF A;  2E64 A;  4QQG A;  3CC4 T;  1KG1 A;  4N4H A;  2DJZ A;  4M7D E;  1VQM T;  5DLO A;  3JCM d;  2ZGW A;  3LGF A;  4C8Q G;  3QUI A;  1NJI C;  2FYK A;  1VIF A;  3NFC A;  4IUQ A;  5LJ3 f;  1UB4 A;  2MI6 A;  3ZFJ A;  4C92 G;  3CCQ A;  3R6O A;  4ELZ C;  1YIT T;  2LVM A;  3DB4 A;  4M78 C;  1M90 U;  2X4J A;  3V7C A;  5GMK m;  3SWN B;  4KUL A;  3GNG A;  3QHS A;  3QG1 A;  5IT9 E;  1S72 T;  1VQL A;  4PJO E;  1LOJ A;  3VYH B;  3PGG A;  2YHT A;  3OYN A;  4M78 A;  3LWI A;  5FRM A;  3OQ5 A;  5GAN 3;  1P92 A;  1M1F A;  2DK3 A;  3ASK A;  4P5N A;  3DB3 A;  3JCM X;  1O9S A;  3L2Z A;  4E7H A;  1I8F A;  3LWH A;  1TH7 A;  1VQ5 T;  4HA8 A;  3MP8 A;  2XDP A;  3GNF B;  3CPW A;  4XTZ A;  2BUD A;  5EG2 A;  3RKY A;  5CAI A;  2PVG B;  1M4Z A;  1UGS B;  5FLX E;  1M5Q 1;  3RES A;  4JRI A;  1JJ2 A;  3OA6 A;  3JCM P;  5CR2 A;  4XU1 A;  2HQX A;  2HNI A;  5CO7 A;  4E7K A;  4C5E A;  2CKK A;  2E6Z A;  1H3Z A;  3MEA A;  3HL8 A;  1Q86 U;  2VYT A;  4R56 A;  4OP0 A;  3OYC A;  4FT2 A;  1BI2 A;  2DVE A;  2RB6 A;  5GAM f;  3GOX A;  3VU3 C;  3G4S T;  3J7A F;  5GAN 2;  2DEQ A;  2K2V A;  4QW2 A;  1WJQ A;  3M54 A;  3OW2 A;  1YHQ T;  4B9W A;  1D3B A;  4J5Y A;  5LJ5 d;  2HQE A;  3BFM A;  1KD1 U;  2GF7 A;  5GMK h;  3MEW A;  2DD5 A;  3NTI A;  4M75 B;  4Y28 E;  3A5Z B;  3RIR A;  3OYM A;  3OMG A;  3SDZ A;  1Q81 C;  4M7A A;  4C5I A;  4ZTF A;  2P0K A;  4L5G A;  1YI2 A;  1VQ9 T;  1W2B A;  1RI0 A;  1N9R A;  2O4X B;  2X4X A;  4NL2 A;  5FU7 B;  1B34 A;  3UPU A;  4C5H A;  1K8A C;  5C0M A;  2L89 A;  2EQJ A;  3A8L B;  2ZPB B;  4C8Q B;  4IKF A;  5FRN A;  1QVG A;  2JUF A;  3MO8 A;  5CQY A;  2E10 A;  3URG A;  1YJ9 T;  1VQM A;  1QVF A;  4C92 B;  2F5K A;  2C06 A;  3M4G A;  2K57 A;  3JCM J;  3N5B B;  3A8M B;  4KBM B;  4M78 D;  4OB0 B;  5KE3 A;  3JCM e;  2KDS A;  4M75 F;  2LT1 A;  3KXT A;  3FC3 A;  3CXC A;  2MF2 A;  2PQW A;  2ZPH B;  2QA4 T;  3S3N A;  1YIT A;  4DOV A;  3PNW C;  3WXM B;  3MEU A;  2QQA A;  4M7A F;  3PT9 A;  1KHC A;  1BIB A;  4M77 A;  1OZ2 A;  3JB9 D;  2LX9 A;  4F7U E;  2EFI A;  3EAE A;  1S72 A;  5GAN h;  3HRS A;  5HY6 A;  4C8Q F;  3FJP A;  4HCZ A;  4O5V A;  3MEV A;  2LCL A;  1MGQ A;  1QVP A;  2FL7 A;  2IG0 A;  2KSS A;  2X4W A;  3BY7 A;  4IUP A;  3QPH A;  2DXT A;  3TEE A;  5GAN g;  3QZ5 B;  1VQ5 A;  2LTO A;  5DM7 R;  2GQV A;  1VQ7 T;  2K4Y A;  3CBO A;  2EKO A;  3H6Z A;  1FWZ A;  2X4Y A;  1BI1 A;  2G3R A;  2DAQ A;  2M16 A;  1WPY A;  2RJC A;  2GCX A;  1KQ1 A;  4M78 G;  2HAX A;  3WVE B;  3V7S A;  4EMK B;  1ZQ1 A;  3OY9 A;  3QKJ A;  5KCH A;  3G4S A;  1U1S A;  4JRQ A;  2XI9 A;  2GFU A;  3JB9 J;  1NJI U;  2V8I A;  3X24 B;  4C0D C;  3VUZ A;  5HK0 A;  1VQO T;  3OBW A;  2O01 E;  4J83 A;  4OB1 B;  4BE2 A;  4OB2 B;  1WGS A;  3G6E T;  3C94 A;  3HFO A;  5I21 A;  5LJ5 e;  1Q7Y U;  1SSF A;  5CK9 A;  3C95 A;  1YIJ T;  4N4G A;  2E6N A;  1VQ9 A;  1X6O A;  1VQ8 A;  1VQP T;  2HBP A;  4J7F A;  2RJE A;  2WSF E;  2ZPG B;  3VYG A;  4IUU A;  4BDY A;  2CS7 A;  2DXB A;  4JS5 A;  2A3L A;  2CZ7 B;  4UC4 A;  1YJ9 A;  1KQS A;  1N8R C;  4FM4 B;  4J6W A;  1RL2 A;  2QA4 A;  3P8B B;  2VV5 A;  5GAM d;  4EDU A;  4M7A G;  2MMP A;  4O6J A;  3UDC A;  5KH6 A;  1M1K C;  1N6A A;  3H8Z A;  5CCA A;  2E41 A;  2DTI A;  4LDU A;  4J7I A;  2R5M A;  2CGH A;  3M5A A;  4CRI A;  5LJ5 j;  2FB7 A;  3M55 A;  4MDW A;  4OGC A;  2RA2 A;  2E70 A;  3OYD A;  4LDV A;  4MZP A;  3X26 B;  4HT8 A;  2KVQ G;  4XU3 A;  2YRV A;  2QTX A;  4IUR A;  1WNL A;  2OTL T;  4BB7 A;  2PUK B;  4BDZ A;  1VUB A;  4RKU E;  3QSU A;  2OAU A;  1X01 A;  3M57 A;  4J6X A;  3INZ A;  2K5F A;  2JOY A;  2XKO C;  4A53 A;  1U1T A;  4X9C A;  1VQ7 A;  4BE0 A;  4PKC C;  3OSV A;  4E7J A;  4XTW A;  2DIG A;  3RKW A;  5J3B A;  4M78 B;  4DA4 A;  4M77 G;  2DTH A;  4M75 E;  5C6S A;  3CC2 T;  1Q81 U;  1XOV A;  3QZ9 B;  3LGL A;  2VGM A;  2QXF A;  3EFS A;  2EJG A;  2XIC A;  4ZN1 A;  3TU4 K;  1K8A U;  5LJ3 e;  2KMT A;  3SWN C;  3X20 B;  3OYF A;  3CME T;  3FRN A;  3SB2 A;  1Y96 A;  1WQW A;  3OMC A;  4C8Q E;  5CKF A;  4II1 A;  2DZC A;  2LQK A;  4OVA A;  4A4K A;  3DKM A;  3LLR A;  4C92 E;  3JSC A;  4BD3 A;  5M9O A;  1WQ7 A;  2RI2 A;  2XDD A;  3G7Z A;  4M78 F;  3X28 B;  5GAN 4;  3OYB A;  1VQO A;  2VUB A;  3UWN A;  2ZPE B;  2D6F A;  4FSX A;  3CPF A;  3G6E A;  3P8D A;  3P8H A;  4C0F A;  3ER0 A;  2LCC A;  3OYJ A;  1YIJ A;  1W4S A;  5A0L A;  3PMI A;  5DLQ E;  3A8O B;  4Z02 A;  3BDU A;  4ZGJ B;  1VQP A;  2CZ0 B;  2QEX T;  1KC8 C;  2XHC A;  3JCM h;  4GY5 A;  2QQR A;  4M7D C;  4V2S A;  5GMK i;  1D3B B;  2FVU A;  3O8V A;  2RO0 A;  4R55 A;  4E7L A;  5GAO r;  3OBY A;  4RG2 A;  4XU0 A;  3CPW S;  1VQK T;  4M7D A;  4JRP A;  3M53 A;  4XU2 A;  3JCM g;  1I81 A;  4M7A B;  2XK0 A;  2RH2 A;  2Y4Y A;  1VQ8 T;  2H3J A;  2MAM A;  2YLC A;  2LNV A;  3QII A;  4TVR A;  5GAM e;  3CCL T;  5J26 A;  1VQ6 A;  4KT0 E;  4PJO C;  2DZ9 A;  3QJY A;  2B8A A;  3CCR T;  2JVV A;  5CQX A;  4BI8 B;  2KY9 A;  1V29 B;  3HHT B;  2OTL A;  4PJO A;  4LD6 A;  4ZGE B;  4JUV A;  3TCJ A;  3KBG A;  5FU7 C;  1JB0 E;  1UGP B;  3BDL A;  3OW2 S;  2EAY A;  1WJR A;  3UT1 A;  2RI3 A;  2IVW A;  4C8Q C;  3CCU T;  4M77 B;  1FXX A;  3HRT A;  4C5G A;  3I56 T;  2YLB A;  4C92 C;  2LDM A;  2QDY B;  4XTY A;  3JCM b;  3CC2 A;  1LNX A;  3QO3 A;  5GAM j;  1K73 C;  4XTX A;  1N27 A;  1NPR A;  5HKC A;  4PNO A;  1G3T A;  1QVG S;  2XDB A;  3CME A;  3PIP A;  2I2L A;  1QVF S;  5D6Y A;  4M77 F;  3OS2 A;  1Q82 C;  4QVD A;  1NE8 A;  3AHU A;  1K9M U;  1WJS A;  2Y4X A;  5LJ5 h;  3DLM A;  3CXC S;  1N8R U;  2VXF A;  3QBY A;  4ZTJ A;  3X25 B;  4OGE A;  3T9N A;  3FEO A;  1O75 A;  5LJ3 d;  3OS1 A;  3E19 A;  3L1A A;  2ZPF B;  5LL6 S;  3JCM c;  5GAN f;  4JS4 A;  1M1K U;  3E9F A;  1AHJ B;  4LDW A;  1VQ6 T;  2DPP B;  4WF2 A;  5CIU A;  5LJ5 g;  4BY6 B;  5IN1 A;  3JB9 G;  2L8D A;  2XID A;  3KUF A;  4GLK A;  3S3O A;  2RD1 A;  4M7D D;  1I5L A;  4OMF B;  4IUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...